2VD0A

Complex structure of prostaglandin d2 synthase at 2.2a.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE-REQUIRING PROSTAGLANDIN D SYNTHASE
publication title Novel Prostaglandin D Synthase Inhibitors Generated by Fragment-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vd0A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vd0A01
5EVOA 2M72A 3VWVA 4MJBA 2AB6A 1QUWA 13GSA 1OYJA 2FWGA 1Y25A 4XRAA 3PR8A 2WULA 2R5GA 5D9TA 1HNAA 5ECLB 1EZKA 4RUVA 5DDLA 1MD4A 3G7YA 2MMZA 2O7KA 1XWGA 6GSVA 1FHEA 2N5FA 4ZB6A 1Z9HA 2EC4A 2JZTA 3TRQA 3CXGA 4OFMA 4MP4A 1ZGNA 4KH7A 2PVQA 5IMCA 2K18A 1ZOFA 3DMLA 1AC1A 4YQVA 5ECRB 5KN1A 2DMMA 3QAWA 2IJYA 5F0GA 1SYXA 1XIYA 1XW9A 4IQAA 4IBPA 5IMDA 4EVMA 2VCVA 4FIWA 3GYKA 4K0GA 4WKWA 3FZ5A 1SJZA 3LG6A 3M8NA 1B9XC 5IO0A 2GGTA 2KLXA 3TRXA 3GMFA 3WT1A 2YN1A 3DD3A 11GSA 4HQZA 5EPFA 2E7PA 2H01A 3IR4A 4PGTA 1ST9A 5DVBA 3L0HA 1LJRA 4Q5RA 4PNGA 3QAGA 4NHZA 1FB6A 3PGTA 1WWJA 3HXSA 2IFQB 4EKZA 3SWLA 2DLXA 2AAWA 2L5OA 3M9JA 4QL9A 1ERTA 3QFBC 2HE3A 2L6DA 4TR1A 4GWRA 5IQYA 4L0UA 1O7UA 1EEMA 4TOPA 1SD8A 5KN0A 2QSIA 4ZBAA 3VURA 4IN0A 2H66A 5EL8A 4WETA 3F9UA 4TRXA 4HDEA 2IMKA 2B7JA 2WZ9A 4I8BA 5ECOB 1K0BA 4OMVA 3TKSC 3FKFA 2HRNA 8GSSA 4J2FA 5H5SA 4F82A 5ENUA 4BVXA 1PKZA 3E3EA 2HNLA 3Q18A 4PTSA 3G7IA 3D0ZA 2HSHA 3WGEA 2LNTA 3QR6A 1TDIA 2A2RA 3APOA 4BWQA 1V9WA 4K2DA 3Q19A 1UN2A 5AIXA 1MTCA 1TP9A 3LXZA 2FWEA 6GSUA 4MA9A 3HVXA 1VF2A 4GSTA 4BWSA 1M9BA 3KJYA 4HI7A 1ML6A 5G2ZA 5A5KA 2CAIA 1YY7A 1AIUA 2LKUA 1V2AA 1T7PB 3CSJA 3KGKA 1WMJA 3L78A 3UEMA 2J9HA 4ZL7A 2LEGA 6GSYA 1RW1A 4Q5QA 1NHYA 5FWGA 4PQIA 4KE3A 5ID2B 1QMVA 1BAYA 1DE1A 1M2DA 1OKTA 4I5QA 18GSA 4FYCA 1T3BA 2MYGA 2GZZA 3PINA 1R5PA 4ZB8A 3FW2A 4OWYA 2I81A 2IWTA 1W4VA 2VCQA 2XBIA 1A0FA 2IMIA 1AQXA 5L71A 5C04A 5F8BA 1TRUA 1SYRA 2X8CA 3H8QA 3VPTA 2L5LA 2WGRA 3DKSA 7GSSA 4P3YB 5A4UA 2LRCA 3F6FA 2B7KA 5HR2A 1OC8A 3EVIA 5HFKA 4IJ3A 1XWAA 2JADA 5ECQB 2C3QA 1YKCA 5IMVA 4EXJA 2L6CA 2VLTA 3GURA 4F9ZA 2LNSA 4HU7A 1JLWA 3TGZA 3Q74A 5B8AA 4POMA 3ZYWA 4MPGA 5JCGA 2PERA 5EY6A 3JCML 3IAS2 5D9XA 3TB2A 1IYIA 2D2ZA 1AUCA 5LD0A 1BG5A 2CQ9A 4GLTA 6GSSA 3TOTA 4ULXA 1SU9A 1G7OA 2I9HA 2AHEA 2RLIA 2JSYA 5ECPB 4TW5A 3R3EA 3FR9A 3P2AA 5G5FA 1WP0A 3HJOA 1S3CA 2HSNB 2IMEA 3QMXA 2PUKC 5HFGA 4MMMA 1TRVA 4KDXA 4GQFA 2J23A 2X99A 3FY7A 1U3AA 2LV3A 1K0DA 4BL7A 3GIXA 1DUGA 1XW6A 1XPVA 2Z9SA 1FOVA 3QD9A 3HJMA 1ZL9A 5CP1A 4AF2A 2VD0A 4AJ8A 1GSUA 3GNJA 1URMA 1TRWA 2WDUA 1SK0A 3L9VA 2FA8A 3H79A 4L0WA 3QOUA 5KN2A 1WE0A 5J41A 4WBRD 1XWCA 4ZBBA 2LTKA 6GSXA 2LQQA 4K9ZA 4ECBA 2C0GA 2ZUPA 2EIRA 4MF7A 3HHVA 5HQPA 1U3IA 1R26A 3WD6A 3HA9A 3MDKA 2ES7A 2V6OA 1A8LA 4DSSB 1BQ7A 1F9MA 4OO5A 1O6JA 1SL0B 3GTUA 3O3TA 1GNWA 5JWOB 1FVJA 3LEFA 2V41A 4Q5FA 1TK8B 4KSOA 3CRUA 2PPTA 2C4JA 3UIWA 4GRFA 1XOBA 1A2LA 2WRTA 1TK5B 2C3NA 1A0RP 2IMDA 2NDOA 1AQWA 1ERWA 4QQ7A 1FW1A 5E4WA 1GSDA 2VIMA 1NM3A 3TOUA 5IMFA 3KMNA 3HYPA 1DBYA 2H0IA 1Z3EA 2R3XA 2XBQA 3IRAA 4LMVA 4IVFA 3D6IA 1EGRA 1I9DA 3CMIA 3GX0A 2E2GA 4YQMA 3UJ1A 5J3RA 2O8VB 4XS4A 3F4SA 2OE3A 3M9KA 3CYNA 4GSSA 2RIIA 5ECHB 1ZYEA 1TRSA 2OACA 5GZZB 3ZREA 2F8FA 3W8JA 4NMUA 1C72A 3FHKA 1GTIA 2RUEA 5IMAA 2HXKA 1MDKA 4ZIJA 4OCFA 3D5JA 4FYBA 2OE0A 4WBJA 4FH8A 3UOMA 3G7JA 1O73A 2LJAA 5IOWA 3RBTA 1OC9A 1F2EA 2N5BA 4XCSA 3IDVA 1OE8A 1J08A 1PL1A 1TI1A 2CX3A 1MEKA 4WXTA 2RUFA 3E0UA 1R4WA 1A24A 4PX1A 1GTBA 3VI5A 1MDJA 2HFDA 3EU3A 2FNOA 2QKEA 2ZNMA 5INYA 2EIQA 2REMA 1NW2A 2H6ZA 2NVLA 2XPDA 1FG4A 2V1MA 2JZSA 3KTLA 3IE3A 4E8EA 1TOFA 3EC3A 3F8UA 3C7MA 5CNWA 1M99A 2I3YA 2IMFA 3I9V2 3US3A 1K0AA 5ABRA 4MH2A 4EDZA 5B6NA 3KD0A 3I43A 1ZZYA 1Z6NA 3F3RA 4ECCA 1FO5A 2YANA 3CTGA 3WYWA 3KIJA 3TJJA 1N8JA 1QK8A 3L4NA 1TI3A 1GUMA 1XVWA 1U87A 4GF0A 3KH9A 4CW9A 2H1DA 2C1YA 4OO4A 4ECJA 2K6VA 4YAPA 1PL2A 2LJKA 4ISDA 3HVVA 1GLQA 2FHEA 2E0QA 5D9WA 3R2QA 2P5QA 2VCTA 3A2VA 4DEJA 4MZCA 3UMAA 2VL2A 4OCEA 1KBNA 1TW9A 4IELA 4XHMA 4BPYA 4PQHA 4PXOA 3HCZA 4G0LA 3UBKA 1XOAA 1U6TA 3TRPA 3GH6A 6GSWA 4AJ6A 4V2NA 1VGLA 4KAEA 12GSA 2NBSA 2GSRA 3KEBA 3DVXA 2KUCA 3F0IA 4TXOB 1CQHA 5LNKe 5D9VA 4RQRA 4HOJA 2HT9A 2PWJA 1IYHA 2ON7A 5ECKB 1G7EA 2VD1A 5C00A 4O7HA 1K0CA 2AUVA 2O87A 4JR4A 4CDOA 4MJCA 1JZOA 2EIOA 3N9JA 2A2SA 1XZOA 4NHWA 4L8EA 5IO2A 2DJKA 2OE1A 4OD7A 2IIYA 5A4WA 3HY2A 2K9FA 3DXBA 1SKWB 4LL4B 3W6GA 1BEDA 4PNFA 2BTOT 4CHSA 1M2BA 1PN9A 3NOFA 1HNBA 3CRTA 4JE1A 4I97A 20GSA 1XWKA 3FEUA 2HLSA 2VOCA 2HZEA 3TDGA 5DALA 3EMPA 5CYYA 4RI6A 4HUAA 4PUFC 1XCCA 3BOAA 4HQSA 3O76A 3CTFA 2YV7A 2QC7A 4ZL9A 3F6DA 5G31A 5F07A 3F3QA 2FLSA 2MBSA 1T8EB 1TK0B 3ZL5A 3ME7A 4POKA 2GS3A 3QDNA 2H8LA 4OFNA 4KDUA 4V2LA 22GSA 3IK9A 2VO4A 1K0MA 5J9CA 1TU8A 1EGOA 4EC0A 3GH9A 2PVOC 3GKKA 4J57E 1EV9A 3LYKA 1YQ1A 1M7TA 1G6YA 2ALBA 1J0FA 4NPBA 2WS2A 4PURA 1UA5A 2PMTA 3IA1A 1OVNA 2YZHA 3DVWA 4ML6A 1B4PA 1OKDA 1SK1A 2P5RA 1F6MC 4HEA2 1GTUA 2G2QA 2AJQB 3VPQA 1Z5YE 1GSYA 1R5AA 4G10A 3VI7A 2HRAA 2DJJA 2BMXA 2FCHA 3UVHA 3IC8A 4TXOA 5DAKB 3GL3A 2P31A 3LSZA 2HSMB 2FD3A 4KGIA 4I6XA 5ECMB 4TVEA 2YV9A 1RK4A 1X9WB 4ZL8A 3RDWA 2IFQA 3FYGA 1ON4A 5FHIA 3IAM2 3A3TA 2LS5A 1CQGA 1TJDA 4FO5A 3F4TA 2HI7A 4JBBA 3HZ8A 4JR6A 1LBKA 3WT2A 4L5OA 2L4QA 3C73A 2I1UA 5ELAA 2CAQA 3P7XA 1HNCA 1JFUA 3UL3A 2X64A 3P90A 4EF0A 1EV4A 2RM5A 2F51A 1T4ZA 1QFNA 2GLRA 5JWRB 3LXTA 5ECIB 2JL4A 2C8UA 2MMOA 2ON5A 3DIEA 5GAND 3TCOA 4BVYB 1THXA 3TKSE 1LU4A 3LORA 1TKDB 2JSZA 4LMWA 1Z6MA 1PX7A 1GLPA 3TKSA 1BX9A 1V57A 2VM1A 1H4OA 2MZCA 5AGYA 2GSTA 3KP8A 3P8WA 1PQNA 2VCXA 2VL3A 5B8BA 4HJ2A 4TN8A 1XVQA 5KN3A 2R4VA 1EEJA 3EWLA 1GWCA 3G9BA 3ME8A 2MBTA 3NZNA 1E6BA 1V98A 1HYUA 1ZYQB 4NWYA 4N30A 5F05A 1WPIA 3ZTLA 3CSHA 5IPGA 5ID2A 1VRSD 3D4MA 2L4CA 1X9MB 3F4RA 2GSSA 2LJRA 1XFLA 4GXZA 2G0FA 1ILOA 3FR3A 1DSBA 1X5EA 1ERUA 5CRGA 4GQCA 4E8HA 2M46A 1PSQA 5J9BA 3ZIJA 2YNXA 1PKWA 4LA1A 3ZZXA 1ABAA 2CVKA 4G9HA 4K7OA 1HQOA 2FGXA 2H0GA 3ZVJA 2VCWA 3ERGA 3HJPA 5ECSA 1PA3A 5CREA 4GCIA 4EL1A 3L9SA 4K6XA 2H71A 1GSQA 3H1NA 3WGXA 1SD9A 5DQYA 1SL2B 1K3OA 3LYPA 1EP7A 3N5OA 2DIYA 1GL8A 3D21A 4HZ2A 1R7HA 4KF9A 3FZ4A 2E2MA 4LL1B 3GFKA 1YEPA 3PPUA 1TU7A 2H74A 1FVKA 1X5CA 3LWAA 4MDCA 2YWIA 5JWQB 4V2MA 2RM6A 3S9FA 5D73A 1K0NA 3TKQA 5CO3A 5F06A 3A2WA 5IIZA 4IJIA 2V6KA 2GZPA 2I4AA 1QQ2A 2AYTA 2K8VA 2IPAA 2OKAA 1EWXA 2F3MA 4MJEA 2C80A 1YEXA 4TR0A 2YWMA 1SL1B 1EP8A 2C0EA 4DVCA 1SKRB 1KNGA 2H70A 4X43A 2X8GA 1O85A 4IS0A 3DRNA 1PD21 5D8IA 2DJ3A 2OBKA 2KP1A 2HYXA 4RQXA 2LRTA 2QGVA 2TIRA 3GL5A 2HQTA 5ELGA 4TR1B 1PGTA 3E9JB 4X1UA 2A4VA 5JCUA 4ILFA 3ZLPA 2GZYA 3TKRA 3BJ5A 3GKXA 4MK3A 1RQMA 3IV4A 4X0XA 5G1KA 3TJKA 1WIKA 3KMOA 1AW9A 1W89A 1GUKA 1GSSA 3KCMA 3MSZA 4KSMA 4XIHA 1ZMAA 3FZAA 1WOUA 2YP6A 4V1Ag 3IBHA 2R6KA 5B6MA 6GSTA 2WB9A 1UVZA 5IPHA 1JZDA 4WF5A 3CBUA 4WEYA 4EDYA 3LFLA 4N0ZA 4BVXB 2NTOA 4I2UA 2GDRA 2KHPA 2H0HA 1AQVA 1AAZA 1M2AA 4F2IA 1F3AA 3DYRA 3KTBA 2HRFA 2DSAA 3ERWA 2FA4A 2X8HA 1M0UA 1SKSB 3IK7A 4H86A 2DJ2A 2GT5A 5G1LA 1Y6EA 4FQUA 1PMTA 1QXHA 1U88A 3IC4A 1O8XA 4DSSA 2IL3A 1B8XA 1KTEA 4POLA 2MMNA 1AXDA 2H30A 5HR1A 2VLUA 2LUSA 1X0RA 3BBYA 2GT6A 2DBCA 3AY8A 4V1Ap 4KDYA 1JLVA 4ML1A 2YPMA 2NPBA 3TJGA 1I5GA 3TKPA 3BCIA 4TR4A 3M1GA 4HS1A 1XW5A 3FZ9A 3I6AA 2C3TA 4J56E 1NHOA 1Z7PA 3HVSA 2V2GA 3IHQA 1MDIA 2XPEA 3K8NA 3PH9A 3C71A 1VF1A 5HFIA 4OFTA 4ZB9A 2TRCP 1GUHA 5H5QA 3F63A 1YF1A 1S3AA 2FUG2 2XHFA 2DC5A 1OC3A 1MD3A 2CT6A 3GSTA 2B5XA 1F3BA 3MNGA 1TTZA 3FK8A 1UC7A 3ZIVA 3L9UA 4MPFA 4RI7A 3EMXA 3RHCA 1Q4JA 2L59A 4WR5A 4XTSA 3A5WA 3KM6A 1G6WA 2H6XA 5IOXA 3FRCA 4DSQA 3H93A 1V58A 2BJXA 2R2JA 1WRYA 3TUEA 2FWFA 5IM9A 2JACA 5GSTA 4PQ1A 2C0DA 1Z7RA 3KH7A 4G2EA 3IOSA 2VUPA 1H75A 3GKNA 1VF3A 4ECIA 4IGJA 2H75A 2P0GA 1DE2A 3UVTA 1BYEA 4D73B 2AV4A 17GSA 3VLNA 1VF4A 4TXVA 3RPPA 2IN3A 2JU5A 2YWNA 3FR6A 3OR5A 4MH3A 1GNEA 1EOHA 16GSA 2F9SA 1GULA 2PN8A 4KW6A 4O5RA 5DCGA 3A2XA 1HD2A 3BCKA 2HSYA 2XC2A 1WJKA 4I2TA 2LQOA 4MZWA 1G0TA 2VAFA 1K0OA 1GRXA 2FY6A 4K7IA 4PUAA 2KOKA 2CVBA 3ZMLA 3ERFA 1SJIA 4TR3A 10GSA 4EO3A 4EUYA 2KP2A 4K7NA 4BL7B 2PBJA 4F0CA 1O81A 4LLRA 3GA4A 4HZ4A 4Q5NA 5E59A 3DGQA 4IW9A 2L57A 5FT3A 1OE7A 2UZ8A 1GP1A 3RPNA 3Q6OA 4G0IA 2CZ2A 1GSFA 1YZXA 4L5LA 4KX4A 3ZRDA 3GHAA 2WFCA 4G19A 5J5NA 5CRDA 2YWOA 1A2MA 2H6YA 1N2AA 2VM2A 4ZBDA 4JEDA 1A2JA 1B9YC 4F0BA 5G30A 3TJBA 3QAVA 1O8WA 4MF5A 5G5EA 3VWXA 3H4KA 2H1BA 2LRNA 3BD2A 4YQUA 2H73A 5J4UA 4AJ7A 4MZBA 1SK2A 2B5YA 4YH2A 2VLVA 3U5RE 4KUNA 3GTUB 2LSTA 2MMAA 4IP6A 5ECNB 3J7Yb 2B1LA 3UAPA 5A4VA 3C8EA 2TRXA 2DJ0A 3RHBA 4KCAA 4KNDA 2GVPA 2H1GA 5DQSA 3NIVA 2GQLA 1ZCPA 3J7Yk 3ZVJD 4XS1A 4IQ1A 5AISA 3KP9A 4NXIA 1SJ6A 1QGVA 4FYUA 3GN3A 3C1RA 3GRXA 19GSA 1USBA 1J9BA 3KXOA 2CA8A 4YAVA 3GKMA 4K0NA 1XWBA 5GAPD 3EE2A 5AN1A 1SENA 3HD5A 4KB3A 3O6TA 4N10A 4K8MA 4G0KA 2N5AA 2GSQA 4ZXGA 2VCZA 5CAXA 2YZUA 4D73A 3D22A 2HRKB 4XS4B 2PU9C 1K3YA 1F37A 2YJ7A 1A23A 3HKRA 9GSSA 3QFAC 2GQMA 3GUSA 3VK9A 3EYTA 4XS6A 3W8SA 4IKHA 3CSIA 5D96A 5D93A 4NV2A 2PGTA 1GH2A 5B7CA 2VL9A 3D4TA 4KA0A 4HU9A 2B6MA 1B4QA 1OC9B 4MLYA 1THOA 14GSA 4DSRA 4WF4A 4O92A 4N0VA 2GQKA 1K3LA 5AIVA 3V1WA 3GX8A 2DJ1A 3M3MA 3RAZA 1XXUA 1Q98A 3QPMA 4NV5A 4ID0A 2YOIA 2JZRA 1T4YA 1FAAA 4XRDA 1X9SB 4GSNA 4POBA 3C1SA 1EOGA 3EURA 3EU4A 2B5EA 4AGSA 3HDCA 2V32A 2HZFA 3LJRA 3IPZA 3WGDA 2H72A 4JRRA 3HZ4A 5DJLA 1YKAA 2B1KA 2VL2C 1GSEA 3ISOA 5H5RA 2YCDA 3M0FA 3ZMKA 3MWHA 4O32A 1OAZA 5HR3A 2CZ3A 3GV1A 2YJHA 2GTUA 4QL7A 2O89A 2R37A 1T1VA 1YF0A 1B48A 3MAKA 5DAKA 2HSMA 4Z7XA 2K8SA 5IMZA 1XBSA 4HJMA 2F8AA 3APQA 3APSA 4IHUA 5HR0A 2C0FA 4TKYA 3VWUA 2OA7A 3UARA 5DJMA 1KEBA 3LGCA 2OJLA 4N11A 3TJFA 2DMLA 1JZRA 1JZWA 2H76A 2B3SA 1TXXA 3ZFLA 3QCPA 3KZQA 5DCHA 3LQ7A 2OBIA 4MJAA 1V40A 3VFIA 1FB0A 4JZQA 4EE0A 3GSSA 5BMUA 4F03A 5DBQA 4MCUA 3IXRA 3ZITA 3DWVA 4MABA 1PRXA 2HRKA 1A8YA 3ZFBA 2OADA 2H19A 1JHBA 1NSWA 2H1AA 1S3DA 1E2YA 4GTUA 4USSA 4IP1A 2M80A 4BA7A 4BVYA 1T00A 5GSSA 1YDKA 5CRWA 4K1FA 3SBCA 4NAXA 2DIZA 3VWWA 4JU5A 1YJ6A 2FWHA 5CRHA 2CV4A 4WR4A 4KCEA 4ZILA 1ACVA 1ERVA 1PX6A 2ZCTA 1GTAA 1X5DA 2CVDA 1BJXA 3U6VA 3ED3A 3EINA 3UBLA 3DEXA 1M9AA 3I69A 2O85A 4ACSA 5COHA 2HZEB 2WJUA 2WCIA 5DALB 4MF6A 5JCWA 5KEJA 2CX4A 5LCZA
chains in the Genus database with same CATH superfamily
5EVOA 2M72A 3VWVA 4MJBA 2AB6A 1QUWA 13GSA 1OYJA 2FWGA 1Y25A 4XRAA 3PR8A 2WULA 2R5GA 5D9TA 1HNAA 5ECLB 1EZKA 4RUVA 5DDLA 4Z2TA 1MD4A 3G7YA 2WW0A 2MMZA 2O7KA 1XWGA 6GSVA 1FHEA 2N5FA 4ZB6A 1Z9HA 2EC4A 2JZTA 3TRQA 3CXGA 4OFMA 4MP4A 1ZGNA 4KH7A 2PVQA 5IMCA 2K18A 1ZOFA 3DMLA 1AC1A 4YQVA 5ECRB 5KN1A 2DMMA 3QAWA 2VKZG 2IJYA 5F0GA 1SYXA 1XIYA 1XW9A 4IQAA 4IBPA 5IMDA 4EVMA 2VCVA 4FIWA 3GYKA 4K0GA 4WKWA 3FZ5A 1SJZA 3LG6A 1BF5A 3M8NA 5KOWA 1B9XC 5IO0A 2GGTA 2KLXA 3TRXA 3GMFA 3WT1A 2YN1A 3DD3A 11GSA 4HQZA 5EPFA 2E7PA 2H01A 3IR4A 3IHGA 4PGTA 1ST9A 5DVBA 3L0HA 1LJRA 4Q5RA 4PNGA 3QAGA 4NHZA 1FB6A 3PGTA 1WWJA 3HXSA 2IFQB 4EKZA 3SWLA 2DLXA 2AAWA 2L5OA 3M9JA 4QL9A 4AKGA 1ERTA 3QFBC 2HE3A 2L6DA 4TR1A 4GWRA 5IQYA 2WVZA 4L0UA 1O7UA 1EEMA 4TOPA 1SD8A 5KN0A 2QSIA 4ZBAA 3VURA 4IN0A 2H66A 5EL8A 4WETA 3F9UA 4TRXA 4HDEA 2IMKA 2B7JA 2WZ9A 4I8BA 5ECOB 1K0BA 4OMVA 3TKSC 3FKFA 2HRNA 2QA2A 8GSSA 4J2FA 5H5SA 4F82A 5ENUA 4BVXA 1PKZA 3E3EA 2HNLA 3Q18A 4PTSA 3G7IA 3D0ZA 2HSHA 3WGEA 2LNTA 3QR6A 1TDIA 2A2RA 3APOA 4BWQA 1V9WA 4K2DA 3Q19A 1UN2A 5AIXA 1MTCA 1TP9A 3LXZA 3LW9A 2FWEA 6GSUA 4MA9A 3HVXA 4K2XA 1VF2A 4GSTA 4BWSA 1M9BA 3KJYA 4HI7A 1ML6A 5G2ZA 5A5KA 2CAIA 1YY7A 1AIUA 2LKUA 1V2AA 1T7PB 3CSJA 1YVLA 3KGKA 1WMJA 3L78A 3UEMA 2J9HA 4ZL7A 2LEGA 6GSYA 1RW1A 4Q5QA 1NHYA 5FWGA 4CY6A 4PQIA 4KE3A 5ID2B 1QMVA 1BAYA 1DE1A 1M2DA 1OKTA 4I5QA 18GSA 4FYCA 4GDFA 1T3BA 2MYGA 2GZZA 3PINA 1R5PA 4ZB8A 3FW2A 4OWYA 2I81A 2IWTA 1W4VA 2VCQA 2XBIA 1A0FA 2IMIA 1AQXA 5L71A 5C04A 5F8BA 1TRUA 1SYRA 2X8CA 3H8QA 3VPTA 4AI6A 2L5LA 2WGRA 3DKSA 7GSSA 4P3YB 4AKIA 5A4UA 2LRCA 3F6FA 2R0GA 2B7KA 5HR2A 1OC8A 3EVIA 5HFKA 4IJ3A 1XWAA 2JADA 4EIPA 5ECQB 2C3QA 1YKCA 5IMVA 4EXJA 2L6CA 2VLTA 3GURA 4F9ZA 2LNSA 4HU7A 1JLWA 3TGZA 1I1IP 3Q74A 5B8AA 4POMA 3ZYWA 4MPGA 5JCGA 2PERA 5EY6A 3JCML 3IAS2 5D9XA 3TB2A 1IYIA 2D2ZA 1AUCA 2DKIA 5LD0A 2A2PA 1BG5A 2CQ9A 4GLTA 6GSSA 3TOTA 4ULXA 1SU9A 2WVXA 1G7OA 2I9HA 2AHEA 2RLIA 1N25A 2JSYA 5ECPB 4TW5A 3R3EA 3FR9A 3P2AA 5G5FA 1WP0A 3HJOA 1S3CA 2HSNB 2IMEA 3QMXA 2DKHA 2PUKC 5HFGA 4MMMA 1TRVA 4KDXA 4GQFA 2J23A 2X99A 3FY7A 1U3AA 4AKHA 2LV3A 1K0DA 2OT3A 4BL7A 3GIXA 1DUGA 1XW6A 1XPVA 2Z9SA 1FOVA 3QD9A 3HJMA 1ZL9A 5CP1A 4AF2A 2VD0A 4AJ8A 1GSUA 3GNJA 1URMA 1TRWA 2WDUA 1SK0A 3L9VA 2FA8A 3H79A 4L0WA 3QOUA 1SVLA 5KN2A 1WE0A 5J41A 4WBRD 1XWCA 4ZBBA 2LTKA 6GSXA 2LQQA 4K9ZA 4ECBA 2C0GA 2ZUPA 2EIRA 4MF7A 3HHVA 5HQPA 1U3IA 1R26A 3WD6A 3HA9A 3MDKA 2ES7A 2V6OA 1A8LA 4DSSB 1BQ7A 1F9MA 4OO5A 1O6JA 1SL0B 3FMWA 3GTUA 3O3TA 1GNWA 5JWOB 1FVJA 3LEFA 2V41A 4Q5FA 1TK8B 4KSOA 5BRTA 2R0CA 3CRUA 2PPTA 2C4JA 3UIWA 4GRFA 1XOBA 1A2LA 2WRTA 1TK5B 2C3NA 1A0RP 4A5PA 2IMDA 2NDOA 1AQWA 1ERWA 4QQ7A 1FW1A 5E4WA 1GSDA 1BG1A 2VIMA 1NM3A 3TOUA 1Y1UA 5IMFA 3KMNA 3HYPA 1DBYA 2H0IA 1Z3EA 2R3XA 2XBQA 3IRAA 4LMVA 4IVFA 3D6IA 1EGRA 1I9DA 3CMIA 3GX0A 2E2GA 4YQMA 3UJ1A 5J3RA 2O8VB 4XS4A 3F4SA 2OE3A 3CHXC 3M9KA 3CYNA 4GSSA 2RIIA 5ECHB 1ZYEA 4Z2RA 1TRSA 2OACA 5GZZB 3ZREA 2F8FA 3W8JA 4NMUA 1C72A 3FHKA 1GTIA 2RUEA 5IMAA 2HXKA 1MDKA 4ZIJA 4OCFA 3D5JA 4FYBA 2OE0A 4WBJA 4FH8A 3UOMA 3G7JA 1O73A 2LJAA 5IOWA 3RBTA 1OC9A 1F2EA 2N5BA 4XCSA 3IDVA 1OE8A 1J08A 1PL1A 1TI1A 2CX3A 1MEKA 4WXTA 2RUFA 3E0UA 1R4WA 1A24A 4PX1A 1GTBA 3VI5A 1MDJA 2HFDA 4ICYA 3HMJG 3EU3A 2FNOA 2QKEA 2ZNMA 5INYA 2EIQA 2REMA 1NW2A 2H6ZA 2NVLA 2XPDA 1FG4A 2V1MA 2JZSA 3KTLA 3IE3A 1TXUA 4E8EA 1TOFA 3EC3A 3F8UA 3C7MA 5CNWA 1M99A 2I3YA 2IMFA 3I9V2 3US3A 1K0AA 5ABRA 4MH2A 4EDZA 5B6NA 3KD0A 3I43A 1ZZYA 3MIXA 1Z6NA 3F3RA 4CY8A 4ECCA 1FO5A 2YANA 3CTGA 3WYWA 3KIJA 3TJJA 1N8JA 1QK8A 1TI3A 3L4NA 1GUMA 1XVWA 1U87A 4GF0A 3KH9A 4CW9A 2H1DA 2C1YA 4OO4A 4ECJA 2K6VA 4YAPA 1PL2A 2LJKA 4ISDA 3HVVA 1GLQA 2FHEA 2E0QA 5D9WA 3R2QA 2P5QA 2VCTA 3A2VA 4DEJA 4MZCA 3UMAA 2VL2A 4OCEA 1KBNA 1TW9A 2H1LA 1XG8A 4IELA 4XHMA 4BPYA 4PQHA 4PXOA 1M3IA 3HCZA 2EFCA 4G0LA 3UBKA 1XOAA 1U6TA 3TRPA 3GH6A 6GSWA 4AJ6A 5A1NB 4V2NA 1VGLA 4KAEA 12GSA 3RGBC 2NBSA 2GSRA 3KEBA 3DVXA 2KUCA 3F0IA 5A34B 4TXOB 1CQHA 5LNKe 5D9VA 4RQRA 4HOJA 2HT9A 2PWJA 1IYHA 2ON7A 5ECKB 1G7EA 2VD1A 5C00A 4FXYP 4O7HA 1K0CA 2AUVA 2O87A 4JR4A 4CDOA 4MJCA 1JZOA 2EIOA 3N9JA 2A2SA 1XZOA 4NHWA 4L8EA 5IO2A 2DJKA 2OE1A 4OD7A 2IIYA 5A4WA 3HY2A 2K9FA 3DXBA 1SKWB 4LL4B 3W6GA 1BEDA 4PNFA 2BTOT 4CHSA 1M2BA 1PN9A 3NOFA 1HNBA 3CRTA 4JE1A 4I97A 20GSA 3A5IA 1XWKA 3FEUA 2HLSA 2VOCA 2HZEA 3TDGA 5DALA 3EMPA 1ZYPA 5CYYA 4RI6A 4HUAA 4PUFC 1XCCA 3BOAA 4HQSA 3O76A 3CTFA 2YV7A 2QC7A 4ZL9A 3F6DA 5G31A 1PFOA 5F07A 3F3QA 2FLSA 2MBSA 1T8EB 1TK0B 3ZL5A 3ME7A 4POKA 2GS3A 3QDNA 4N3ZA 2H8LA 4OFNA 4KDUA 4V2LA 22GSA 3IK9A 2VO4A 1K0MA 5J9CA 1TU8A 1EGOA 3MYDA 4EC0A 3CQFA 3GH9A 2PVOC 3GKKA 4J57E 1EV9A 3LYKA 1YQ1A 1M7TA 2O36A 1G6YA 2ALBA 1J0FA 4NPBA 2WS2A 2WZSA 4PURA 1UA5A 2PMTA 3IA1A 1OVNA 2YZHA 3DVWA 4ML6A 1B4PA 1OKDA 1SK1A 2P5RA 1F6MC 4HEA2 1GTUA 2G2QA 2AJQB 5A1NA 3VPQA 1Z5YE 1GSYA 1R5AA 4G10A 3VI7A 2HRAA 2DJJA 2BMXA 2FCHA 3UVHA 3IC8A 4TXOA 5DAKB 3GL3A 2P31A 3LSZA 2HSMB 2FD3A 4KGIA 4I6XA 5ECMB 4TVEA 2YV9A 1RK4A 1X9WB 4ZL8A 3RDWA 2IFQA 3FYGA 1ON4A 5FHIA 3IAM2 3A3TA 2LS5A 1CQGA 1TJDA 4FO5A 3F4TA 4O5QA 2HI7A 4JBBA 3HZ8A 4JR6A 1LBKA 3WT2A 4L5OA 2L4QA 3C73A 2I1UA 5ELAA 5BMUB 2CAQA 3P7XA 1HNCA 1JFUA 3UL3A 2X64A 3P90A 4EF0A 1EV4A 2RM5A 2F51A 1T4ZA 1QFNA 2GLRA 1S3RA 3LXTA 5JWRB 5ECIB 2JL4A 2C8UA 2MMOA 2ON5A 3DIEA 5GAND 3TCOA 4BVYB 1THXA 3TKSE 1LU4A 3LORA 1TKDB 2JSZA 4LMWA 4O5UA 1Z6MA 1PX7A 1GLPA 3TKSA 1BX9A 1V57A 2VM1A 1H4OA 2MZCA 5AGYA 2GSTA 3KP8A 3P8WA 1PQNA 2VCXA 2VL3A 5B8BA 4HJ2A 4TN8A 1XVQA 5KN3A 2R4VA 1EEJA 3EWLA 1GWCA 3G9BA 2UV8G 3ME8A 2MBTA 3NZNA 1E6BA 1V98A 1HYUA 1ZYQB 4NWYA 4N30A 5F05A 1WPIA 3ZTLA 3CSHA 5IPGA 5ID2A 1VRSD 3D4MA 2L4CA 1X9MB 3F4RA 2GSSA 2LJRA 1XFLA 4GXZA 2G0FA 1ILOA 3FR3A 1DSBA 1X5EA 1ERUA 5CRGA 2WW1A 4GQCA 4E8HA 2M46A 1PSQA 3HVNA 5J9BA 3ZIJA 2YNXA 1PKWA 4LA1A 3ZZXA 1ABAA 2CVKA 4G9HA 4K7OA 1HQOA 5J47A 2FGXA 2H0GA 3ZVJA 2VCWA 3ERGA 3HJPA 5ECSA 1PA3A 5CREA 4GCIA 4EL1A 3L9SA 4K6XA 2H71A 1GSQA 3H1NA 3WGXA 1SD9A 5DQYA 1SL2B 1K3OA 3LYPA 1EP7A 3N5OA 2DIYA 1GL8A 3D21A 4HZ2A 1R7HA 4KF9A 3FZ4A 2E2MA 4LL1B 3GFKA 1YEPA 3PPUA 1TU7A 2H74A 1FVKA 1X5CA 3LWAA 4MDCA 2YWIA 5JWQB 4V2MA 4Z2UA 2RM6A 3S9FA 5D73A 1K0NA 3TKQA 5CO3A 5F06A 3A2WA 5IIZA 4W66A 4IJIA 2V6KA 2GZPA 2I4AA 3RFRC 1FOHA 1QQ2A 2AYTA 2K8VA 2IPAA 2OKAA 1EWXA 2F3MA 4MJEA 2C80A 1YEXA 4TR0A 2YWMA 1SL1B 1EP8A 2C0EA 4DVCA 1SKRB 1KNGA 2H70A 4X43A 2X8GA 1O85A 4IS0A 2HSNA 3DRNA 1PD21 5D8IA 2DJ3A 2OBKA 2KP1A 2HYXA 5KOXA 4RQXA 2LRTA 2QGVA 1SVMA 2TIRA 3GL5A 2HQTA 5ELGA 2EFDA 4TR1B 1PGTA 3E9JB 4X1UA 2A4VA 5JCUA 4ILFA 3ZLPA 2GZYA 3TKRA 2O5VA 3BJ5A 3GKXA 3EPTA 4MK3A 1RQMA 3IV4A 4X0XA 5G1KA 3TJKA 1WIKA 3KMOA 1AW9A 4X4JA 1W89A 1GUKA 4QMKA 1GSSA 3KCMA 3MSZA 4KSMA 4XIHA 1ZMAA 2EFEA 3FZAA 1WOUA 2YP6A 4V1Ag 3IBHA 2R6KA 5B6MA 6GSTA 2WB9A 1UVZA 5IPHA 1JZDA 4E68A 4WF5A 3CBUA 4WEYA 3CWGA 4EDYA 1PN0A 3LFLA 4N0ZA 4BVXB 2NTOA 4I2UA 2GDRA 2KHPA 2H0HA 1AQVA 1AAZA 1M2AA 4F2IA 5J40A 1F3AA 3DYRA 3KTBA 2HRFA 2DSAA 3ERWA 2FA4A 2X4AA 2X8HA 1M0UA 1SKSB 3IK7A 4H86A 2DJ2A 2GT5A 5G1LA 1Y6EA 4FQUA 1PMTA 1QXHA 1U88A 3IC4A 1O8XA 4DSSA 2IL3A 1B8XA 1KTEA 4POLA 2MMNA 1AXDA 2H30A 4G01A 5HR1A 2VLUA 2LUSA 1X0RA 3BBYA 2GT6A 2DBCA 3AY8A 4V1Ap 4KDYA 1JLVA 4ML1A 2YPMA 2NPBA 3TJGA 1I5GA 3TKPA 3BCIA 4TR4A 3M1GA 4HS1A 1XW5A 4K5RA 3FZ9A 3I6AA 2C3TA 4J56E 1NHOA 1Z7PA 2A4HA 3HVSA 2V2GA 3IHQA 1MDIA 2XPEA 3K8NA 3PH9A 3C71A 1VF1A 2WW2A 5HFIA 4OFTA 4ZB9A 2TRCP 1GUHA 5H5QA 3F63A 1YF1A 1S3AA 2FUG2 2XHFA 2DC5A 2EFHA 1OC3A 1MD3A 2CT6A 3GSTA 2B5XA 1F3BA 3MNGA 1TTZA 3FK8A 1UC7A 3ZIVA 3L9UA 2WVYA 4MPFA 4RI7A 3EMXA 3RHCA 1Q4JA 2L59A 4WR5A 4XTSA 3A5WA 3KM6A 1G6WA 3TU3B 2H6XA 5IOXA 3FRCA 4DSQA 3H93A 1V58A 2BJXA 2R2JA 1WRYA 3TUEA 2FWFA 5IM9A 2JACA 5J4VA 5GSTA 4PQ1A 2C0DA 1Z7RA 3KH7A 4G2EA 3IOSA 2VUPA 1H75A 3GKNA 1VF3A 4ECIA 4IGJA 2H75A 2P0GA 1DE2A 3UVTA 1BYEA 5J4YA 4D73B 2AV4A 17GSA 3VLNA 1VF4A 4TXVA 3RPPA 2IN3A 2JU5A 2YWNA 3FR6A 3OR5A 4MH3A 1GNEA 1EOHA 16GSA 2F9SA 1GULA 2PN8A 4KW6A 4O5RA 5DCGA 2WVXB 3A2XA 1HD2A 3BCKA 2HSYA 2XC2A 1WJKA 4I2TA 2LQOA 4MZWA 1G0TA 2VAFA 1K0OA 1GRXA 2FY6A 2X49A 4K7IA 4PUAA 2KOKA 2CVBA 3ZMLA 3ERFA 1SJIA 4TR3A 10GSA 4EO3A 4EUYA 2KP2A 4K7NA 4BL7B 2PBJA 2QA1A 4F0CA 1O81A 4LLRA 4PHZC 3GA4A 4HZ4A 4Q5NA 5E59A 3DGQA 4IW9A 2L57A 5FT3A 1M3JA 1OE7A 2UZ8A 1GP1A 3RPNA 3Q6OA 2R0PA 4G0IA 4YKGA 2CZ2A 1GSFA 1YZXA 4L5LA 4KX4A 3ZRDA 3GHAA 2WFCA 4G19A 5J5NA 5CRDA 4EIQA 4AKXB 2YWOA 1A2MA 2H6YA 1N2AA 2VM2A 4ZBDA 4JEDA 1A2JA 1B9YC 4F0BA 5G30A 3TJBA 3QAVA 1O8WA 1S4BP 4MF5A 5G5EA 3VWXA 3H4KA 2H1BA 2LRNA 3BD2A 4YQUA 2H73A 5J4UA 4AJ7A 4MZBA 1SK2A 2B5YA 4YH2A 2VLVA 3U5RE 4KUNA 3GTUB 2LSTA 2MMAA 4IP6A 5ECNB 4K5SA 3J7Yb 2B1LA 5A34A 3UAPA 5A4VA 3C8EA 2TRXA 2DJ0A 3RHBA 4KCAA 4KNDA 2GVPA 2H1GA 5DQSA 3NIVA 2GQLA 1ZCPA 3J7Yk 3ZVJD 4XS1A 4IQ1A 5AISA 3KP9A 4NXIA 1SJ6A 1QGVA 4FYUA 3GN3A 3C1RA 3GRXA 19GSA 1USBA 5A5HB 1J9BA 3KXOA 2CA8A 4YAVA 3GKMA 4K0NA 1XWBA 5GAPD 4ZB7A 3EE2A 5AN1A 1SENA 3HD5A 4KB3A 3O6TA 4N10A 4K8MA 4G0KA 2N5AA 2GSQA 4ZXGA 2VCZA 5CAXA 2YZUA 4D73A 3D22A 2HRKB 4XS4B 2PU9C 1K3YA 1F37A 2YJ7A 1A23A 3HKRA 9GSSA 3QFAC 2GQMA 3GUSA 3VK9A 3EYTA 4XS6A 3W8SA 4IKHA 3CSIA 5D96A 5D93A 4NV2A 4PI0C 1ZYNA 2PGTA 1GH2A 5B7CA 2VL9A 3D4TA 1YEWC 4YKFA 4KA0A 4HU9A 2B6MA 1B4QA 1OC9B 4MLYA 1THOA 14GSA 4DSRA 4WF4A 4O92A 4N0VA 2GQKA 1K3LA 5AIVA 3V1WA 3GX8A 2DJ1A 3M3MA 3RAZA 1XXUA 1Q98A 3QPMA 4NV5A 4ID0A 2YOIA 2JZRA 1T4YA 1FAAA 4XRDA 4BIKA 1X9SB 4GSNA 4POBA 3C1SA 1EOGA 3EURA 3EU4A 2B5EA 4PI2C 4AGSA 3HDCA 2V32A 2HZFA 3LJRA 3IPZA 3WGDA 2H72A 4JRRA 3HZ4A 5DJLA 1YKAA 2B1KA 2VL2C 1GSEA 3ISOA 5H5RA 2YCDA 3M0FA 3ZMKA 3MWHA 4O32A 1OAZA 5HR3A 2CZ3A 3GV1A 2YJHA 2GTUA 4QL7A 2O89A 2R37A 1T1VA 1YF0A 1B48A 3MAKA 5DAKA 2HSMA 4Z7XA 2K8SA 5IMZA 1XBSA 4HJMA 2F8AA 3APQA 3APSA 4IHUA 5HR0A 2C0FA 4TKYA 3VWUA 2OA7A 3UARA 5DJMA 5A5HA 1KEBA 3LGCA 2OJLA 4N11A 3TJFA 2DMLA 1JZRA 1JZWA 2H76A 2B3SA 1TXXA 3ZFLA 3QCPA 3KZQA 5DCHA 3LQ7A 2OBIA 4MJAA 1V40A 3VFIA 1FB0A 4JZQA 2O3EA 4EE0A 3GSSA 5BMUA 4F03A 5DBQA 4MCUA 3IXRA 3ZITA 3DWVA 4MABA 1PRXA 2HRKA 1A8YA 3ZFBA 2OADA 2H19A 1JHBA 1NSWA 2H1AA 1S3DA 1E2YA 4GTUA 4USSA 4IP1A 2M80A 4BA7A 4BVYA 1T00A 5GSSA 1YDKA 4HSCX 5CRWA 4K1FA 3SBCA 4NAXA 2DIZA 3VWWA 4JU5A 1YJ6A 2FWHA 5CRHA 2CV4A 4WR4A 4KCEA 4ZILA 4MNNA 1ACVA 1ERVA 1PX6A 2ZCTA 1GTAA 1X5DA 2CVDA 1BJXA 3U6VA 3ED3A 3EINA 3UBLA 3DEXA 1SVOA 1M9AA 3I69A 2O85A 2WW3A 4ACSA 5COHA 2HZEB 2WJUA 2WCIA 5DALB 4MF6A 5JCWA 5KEJA 2CX4A 5LCZA
chains in the Genus database with same CATH topology
5EVOA 2M72A 3VWVA 4MJBA 2AB6A 1QUWA 13GSA 1OYJA 2FWGA 1Y25A 4XRAA 3PR8A 2WULA 2R5GA 5D9TA 1HNAA 5ECLB 1EZKA 4RUVA 5DDLA 4Z2TA 1MD4A 3G7YA 2MMZA 2O7KA 1XWGA 6GSVA 1FHEA 2N5FA 4ZB6A 1Z9HA 2EC4A 2JZTA 3TRQA 3CXGA 4OFMA 4MP4A 1ZGNA 4KH7A 2PVQA 5IMCA 2K18A 1ZOFA 3DMLA 1AC1A 4YQVA 5ECRB 5KN1A 2DMMA 3QAWA 2VKZG 2IJYA 5F0GA 1SYXA 1XIYA 1XW9A 4IQAA 4IBPA 5IMDA 4EVMA 2VCVA 4FIWA 3GYKA 4K0GA 4WKWA 3FZ5A 1SJZA 3LG6A 1BF5A 3M8NA 5KOWA 1B9XC 5IO0A 2GGTA 2KLXA 3TRXA 3GMFA 3WT1A 2YN1A 3DD3A 11GSA 4HQZA 5EPFA 2E7PA 2H01A 3IR4A 3IHGA 4PGTA 1ST9A 5DVBA 3L0HA 1LJRA 4Q5RA 4PNGA 3QAGA 4NHZA 1FB6A 3PGTA 1WWJA 3HXSA 2IFQB 4EKZA 3SWLA 2DLXA 2AAWA 2L5OA 3M9JA 4QL9A 4AKGA 1ERTA 3QFBC 2HE3A 2L6DA 4TR1A 4GWRA 5IQYA 4L0UA 1O7UA 1EEMA 4TOPA 1SD8A 5KN0A 2QSIA 4ZBAA 3VURA 4IN0A 2H66A 5EL8A 4WETA 3F9UA 4TRXA 4HDEA 2IMKA 2B7JA 2WZ9A 4I8BA 5ECOB 1K0BA 4OMVA 3TKSC 3FKFA 2HRNA 2QA2A 8GSSA 4J2FA 5H5SA 4F82A 5ENUA 4BVXA 1PKZA 3E3EA 2HNLA 3Q18A 4PTSA 3G7IA 3D0ZA 2HSHA 3WGEA 2LNTA 3QR6A 1TDIA 2A2RA 3APOA 4BWQA 1V9WA 4K2DA 3Q19A 1UN2A 5AIXA 1MTCA 1TP9A 3LXZA 3LW9A 2FWEA 6GSUA 4MA9A 3HVXA 4K2XA 1VF2A 4GSTA 4BWSA 1M9BA 3KJYA 4HI7A 1ML6A 5G2ZA 5A5KA 2CAIA 1YY7A 1AIUA 2LKUA 1V2AA 1T7PB 3CSJA 1YVLA 3KGKA 1WMJA 3L78A 3UEMA 2J9HA 4ZL7A 2LEGA 6GSYA 1RW1A 4Q5QA 1NHYA 5FWGA 4CY6A 4PQIA 4KE3A 5ID2B 1QMVA 1BAYA 1DE1A 1M2DA 1OKTA 4I5QA 18GSA 4FYCA 4GDFA 1T3BA 2MYGA 2GZZA 3PINA 1R5PA 4ZB8A 3FW2A 4OWYA 2I81A 2IWTA 1W4VA 2VCQA 2XBIA 1A0FA 2IMIA 1AQXA 5L71A 5C04A 5F8BA 1TRUA 1SYRA 2X8CA 3H8QA 3VPTA 4AI6A 2L5LA 2WGRA 3DKSA 7GSSA 4P3YB 4AKIA 5A4UA 2LRCA 3F6FA 2R0GA 2B7KA 5HR2A 1OC8A 3EVIA 5HFKA 4IJ3A 1XWAA 2JADA 4EIPA 5ECQB 2C3QA 1YKCA 5IMVA 4EXJA 2L6CA 2VLTA 3GURA 4F9ZA 2LNSA 4HU7A 1JLWA 3TGZA 3Q74A 5B8AA 4POMA 3ZYWA 4MPGA 5JCGA 2PERA 5EY6A 3JCML 3IAS2 5D9XA 3TB2A 1IYIA 2D2ZA 1AUCA 2DKIA 5LD0A 2A2PA 1BG5A 2CQ9A 4GLTA 6GSSA 3TOTA 4ULXA 1SU9A 1G7OA 2I9HA 2AHEA 2RLIA 1N25A 2JSYA 5ECPB 4TW5A 3R3EA 3FR9A 3P2AA 5G5FA 1WP0A 3HJOA 1S3CA 2HSNB 2IMEA 3QMXA 2DKHA 2PUKC 5HFGA 4MMMA 1TRVA 4KDXA 4GQFA 2J23A 2X99A 3FY7A 1U3AA 4AKHA 2LV3A 1K0DA 2OT3A 4BL7A 3GIXA 1DUGA 1XW6A 1XPVA 2Z9SA 1FOVA 3QD9A 3HJMA 1ZL9A 5CP1A 4AF2A 2VD0A 4AJ8A 1GSUA 3GNJA 1URMA 1TRWA 2WDUA 1SK0A 3L9VA 2FA8A 3H79A 4L0WA 3QOUA 1SVLA 5KN2A 1WE0A 5J41A 4WBRD 1XWCA 4ZBBA 2LTKA 6GSXA 2LQQA 4K9ZA 4ECBA 2C0GA 2ZUPA 2EIRA 4MF7A 3HHVA 5HQPA 1U3IA 1R26A 3WD6A 3HA9A 3MDKA 2ES7A 2V6OA 1A8LA 4DSSB 1BQ7A 1F9MA 4OO5A 1O6JA 1SL0B 3FMWA 3GTUA 3O3TA 1GNWA 5JWOB 1FVJA 3LEFA 2V41A 4Q5FA 1TK8B 4KSOA 5BRTA 2R0CA 3CRUA 2PPTA 2C4JA 3UIWA 4GRFA 1XOBA 1A2LA 2WRTA 1TK5B 2C3NA 1A0RP 4A5PA 2IMDA 2NDOA 1AQWA 1ERWA 4QQ7A 1FW1A 5E4WA 1GSDA 1BG1A 2VIMA 1NM3A 3TOUA 1Y1UA 5IMFA 3KMNA 3HYPA 1DBYA 2H0IA 1Z3EA 2R3XA 2XBQA 3IRAA 4LMVA 4IVFA 3D6IA 1EGRA 1I9DA 3CMIA 3GX0A 2E2GA 4YQMA 3UJ1A 5J3RA 2O8VB 4XS4A 3F4SA 2OE3A 3M9KA 3CYNA 4GSSA 2RIIA 5ECHB 1ZYEA 4Z2RA 1TRSA 2OACA 5GZZB 3ZREA 2F8FA 3W8JA 4NMUA 1C72A 3FHKA 1GTIA 2RUEA 5IMAA 2HXKA 1MDKA 4ZIJA 4OCFA 3D5JA 4FYBA 2OE0A 4WBJA 4FH8A 3UOMA 3G7JA 1O73A 2LJAA 5IOWA 3RBTA 1OC9A 1F2EA 2N5BA 4XCSA 3IDVA 1OE8A 1J08A 1PL1A 1TI1A 2CX3A 1MEKA 4WXTA 2RUFA 3E0UA 1R4WA 1A24A 4PX1A 1GTBA 3VI5A 1MDJA 2HFDA 4ICYA 3HMJG 3EU3A 2FNOA 2QKEA 2ZNMA 5INYA 2EIQA 2REMA 1NW2A 2H6ZA 2NVLA 2XPDA 1FG4A 2V1MA 2JZSA 3KTLA 3IE3A 1TXUA 4E8EA 1TOFA 3EC3A 3F8UA 3C7MA 5CNWA 1M99A 2I3YA 2IMFA 3I9V2 3US3A 1K0AA 5ABRA 4MH2A 4EDZA 5B6NA 3KD0A 3I43A 1ZZYA 3MIXA 1Z6NA 3F3RA 4CY8A 4ECCA 1FO5A 2YANA 3CTGA 3WYWA 3KIJA 3TJJA 1N8JA 1QK8A 3L4NA 1TI3A 1GUMA 1XVWA 1U87A 4GF0A 3KH9A 4CW9A 2H1DA 2C1YA 4OO4A 4ECJA 2K6VA 4YAPA 1PL2A 2LJKA 4ISDA 3HVVA 1GLQA 2FHEA 2E0QA 5D9WA 3R2QA 2P5QA 2VCTA 3A2VA 4DEJA 4MZCA 3UMAA 2VL2A 4OCEA 1KBNA 1TW9A 2H1LA 4IELA 4XHMA 4BPYA 4PQHA 4PXOA 3HCZA 2EFCA 4G0LA 3UBKA 1XOAA 1U6TA 3TRPA 3GH6A 6GSWA 4AJ6A 5A1NB 4V2NA 1VGLA 4KAEA 12GSA 2NBSA 2GSRA 3KEBA 3DVXA 2KUCA 3F0IA 5A34B 4TXOB 1CQHA 5LNKe 5D9VA 4RQRA 4HOJA 2HT9A 2PWJA 1IYHA 2ON7A 5ECKB 1G7EA 2VD1A 5C00A 4O7HA 1K0CA 2AUVA 2O87A 4JR4A 4CDOA 4MJCA 1JZOA 2EIOA 3N9JA 2A2SA 1XZOA 4NHWA 4L8EA 5IO2A 2DJKA 2OE1A 4OD7A 2IIYA 5A4WA 3HY2A 2K9FA 3DXBA 1SKWB 4LL4B 3W6GA 1BEDA 4PNFA 2BTOT 4CHSA 1M2BA 1PN9A 3NOFA 1HNBA 3CRTA 4JE1A 4I97A 20GSA 3A5IA 1XWKA 3FEUA 2HLSA 2VOCA 2HZEA 3TDGA 5DALA 3EMPA 1ZYPA 5CYYA 4RI6A 4HUAA 4PUFC 1XCCA 3BOAA 4HQSA 3O76A 3CTFA 2YV7A 2QC7A 4ZL9A 3F6DA 5G31A 5F07A 3F3QA 2FLSA 2MBSA 1T8EB 1TK0B 3ZL5A 3ME7A 4POKA 2GS3A 3QDNA 4N3ZA 2H8LA 4OFNA 4KDUA 4V2LA 22GSA 3IK9A 2VO4A 1K0MA 5J9CA 1TU8A 1EGOA 3MYDA 4EC0A 3GH9A 2PVOC 3GKKA 4J57E 1EV9A 3LYKA 1YQ1A 1M7TA 1G6YA 2ALBA 1J0FA 4NPBA 2WS2A 4PURA 1UA5A 2PMTA 3IA1A 1OVNA 2YZHA 3DVWA 4ML6A 1B4PA 1OKDA 1SK1A 2P5RA 1F6MC 4HEA2 1GTUA 2G2QA 2AJQB 5A1NA 3VPQA 1Z5YE 1GSYA 1R5AA 4G10A 3VI7A 2HRAA 2DJJA 2BMXA 2FCHA 3UVHA 3IC8A 4TXOA 5DAKB 3GL3A 2P31A 3LSZA 2HSMB 2FD3A 4KGIA 4I6XA 5ECMB 4TVEA 2YV9A 1RK4A 1X9WB 4ZL8A 3RDWA 2IFQA 3FYGA 1ON4A 5FHIA 3IAM2 3A3TA 2LS5A 1CQGA 1TJDA 4FO5A 3F4TA 4O5QA 2HI7A 4JBBA 3HZ8A 4JR6A 1LBKA 3WT2A 4L5OA 2L4QA 3C73A 2I1UA 5ELAA 5BMUB 2CAQA 3P7XA 1HNCA 1JFUA 3UL3A 2X64A 3P90A 4EF0A 1EV4A 2RM5A 2F51A 1T4ZA 1QFNA 2GLRA 5JWRB 3LXTA 5ECIB 2JL4A 2C8UA 2MMOA 2ON5A 3DIEA 5GAND 3TCOA 4BVYB 1THXA 3TKSE 1LU4A 3LORA 1TKDB 2JSZA 4LMWA 4O5UA 1Z6MA 1PX7A 1GLPA 3TKSA 1BX9A 1V57A 2VM1A 1H4OA 2MZCA 5AGYA 2GSTA 3KP8A 3P8WA 1PQNA 2VCXA 2VL3A 5B8BA 4HJ2A 4TN8A 1XVQA 5KN3A 2R4VA 1EEJA 3EWLA 1GWCA 3G9BA 2UV8G 3ME8A 2MBTA 3NZNA 1E6BA 1V98A 1HYUA 1ZYQB 4NWYA 4N30A 5F05A 1WPIA 3ZTLA 3CSHA 5IPGA 5ID2A 1VRSD 3D4MA 2L4CA 1X9MB 3F4RA 2GSSA 2LJRA 1XFLA 4GXZA 2G0FA 1ILOA 3FR3A 1DSBA 1X5EA 1ERUA 5CRGA 4GQCA 4E8HA 2M46A 1PSQA 5J9BA 3ZIJA 2YNXA 1PKWA 4LA1A 3ZZXA 1ABAA 2CVKA 4G9HA 4K7OA 1HQOA 5J47A 2FGXA 2H0GA 3ZVJA 2VCWA 3ERGA 3HJPA 5ECSA 1PA3A 5CREA 4GCIA 4EL1A 3L9SA 4K6XA 2H71A 1GSQA 3H1NA 3WGXA 1SD9A 5DQYA 1SL2B 1K3OA 3LYPA 1EP7A 3N5OA 2DIYA 1GL8A 3D21A 4HZ2A 1R7HA 4KF9A 3FZ4A 2E2MA 4LL1B 3GFKA 1YEPA 3PPUA 1TU7A 2H74A 1FVKA 1X5CA 3LWAA 4MDCA 2YWIA 5JWQB 4V2MA 4Z2UA 2RM6A 3S9FA 5D73A 1K0NA 3TKQA 5CO3A 5F06A 3A2WA 5IIZA 4W66A 4IJIA 2V6KA 2GZPA 2I4AA 1FOHA 1QQ2A 2AYTA 2K8VA 2IPAA 2OKAA 1EWXA 2F3MA 4MJEA 2C80A 1YEXA 4TR0A 2YWMA 1SL1B 1EP8A 2C0EA 4DVCA 1SKRB 1KNGA 2H70A 4X43A 2X8GA 1O85A 4IS0A 2HSNA 3DRNA 1PD21 5D8IA 2DJ3A 2OBKA 2KP1A 2HYXA 5KOXA 4RQXA 2LRTA 2QGVA 1SVMA 2TIRA 3GL5A 2HQTA 5ELGA 2EFDA 4TR1B 1PGTA 3E9JB 4X1UA 2A4VA 5JCUA 4ILFA 3ZLPA 2GZYA 3TKRA 2O5VA 3BJ5A 3GKXA 3EPTA 4MK3A 1RQMA 3IV4A 4X0XA 5G1KA 3TJKA 1WIKA 3KMOA 1AW9A 4X4JA 1W89A 1GUKA 4QMKA 1GSSA 3KCMA 3MSZA 4KSMA 4XIHA 1ZMAA 2EFEA 3FZAA 1WOUA 2YP6A 4V1Ag 3IBHA 2R6KA 5B6MA 6GSTA 2WB9A 1UVZA 5IPHA 1JZDA 4E68A 4WF5A 3CBUA 4WEYA 3CWGA 4EDYA 1PN0A 3LFLA 4N0ZA 4BVXB 2NTOA 4I2UA 2GDRA 2KHPA 2H0HA 1AQVA 1AAZA 1M2AA 4F2IA 5J40A 1F3AA 3DYRA 3KTBA 2HRFA 2DSAA 3ERWA 2FA4A 2X4AA 2X8HA 1M0UA 1SKSB 3IK7A 4H86A 2DJ2A 2GT5A 5G1LA 1Y6EA 4FQUA 1PMTA 1QXHA 1U88A 3IC4A 1O8XA 4DSSA 2IL3A 1B8XA 1KTEA 4POLA 2MMNA 1AXDA 2H30A 4G01A 5HR1A 2VLUA 2LUSA 1X0RA 3BBYA 2GT6A 2DBCA 3AY8A 4V1Ap 4KDYA 1JLVA 4ML1A 2YPMA 2NPBA 3TJGA 1I5GA 3TKPA 3BCIA 4TR4A 3M1GA 4HS1A 1XW5A 4K5RA 3FZ9A 3I6AA 2C3TA 4J56E 1NHOA 1Z7PA 2A4HA 3HVSA 2V2GA 3IHQA 1MDIA 2XPEA 3K8NA 3PH9A 3C71A 1VF1A 5HFIA 4OFTA 4ZB9A 2TRCP 1GUHA 5H5QA 3F63A 1YF1A 1S3AA 2FUG2 2XHFA 2DC5A 2EFHA 1OC3A 1MD3A 2CT6A 3GSTA 2B5XA 1F3BA 3MNGA 1TTZA 3FK8A 1UC7A 3ZIVA 3L9UA 4MPFA 4RI7A 3EMXA 3RHCA 1Q4JA 2L59A 4WR5A 4XTSA 3A5WA 3KM6A 1G6WA 3TU3B 2H6XA 5IOXA 3FRCA 4DSQA 3H93A 1V58A 2BJXA 2R2JA 1WRYA 3TUEA 2FWFA 5IM9A 2JACA 5J4VA 5GSTA 4PQ1A 2C0DA 1Z7RA 3KH7A 4G2EA 3IOSA 2VUPA 1H75A 3GKNA 1VF3A 4ECIA 4IGJA 2H75A 2P0GA 1DE2A 3UVTA 1BYEA 5J4YA 4D73B 2AV4A 17GSA 3VLNA 1VF4A 4TXVA 3RPPA 2IN3A 2JU5A 2YWNA 3FR6A 3OR5A 4MH3A 1GNEA 1EOHA 16GSA 2F9SA 1GULA 2PN8A 4KW6A 4O5RA 5DCGA 3A2XA 1HD2A 3BCKA 2HSYA 2XC2A 1WJKA 4I2TA 2LQOA 4MZWA 1G0TA 2VAFA 1K0OA 1GRXA 2FY6A 2X49A 4K7IA 4PUAA 2KOKA 2CVBA 3ZMLA 3ERFA 1SJIA 4TR3A 10GSA 4EO3A 4EUYA 2KP2A 4K7NA 4BL7B 2PBJA 2QA1A 4F0CA 1O81A 4LLRA 3GA4A 4HZ4A 4Q5NA 5E59A 3DGQA 4IW9A 2L57A 5FT3A 1OE7A 2UZ8A 1GP1A 3RPNA 3Q6OA 2R0PA 4G0IA 4YKGA 2CZ2A 1GSFA 1YZXA 4L5LA 4KX4A 3ZRDA 3GHAA 2WFCA 4G19A 5J5NA 5CRDA 4EIQA 4AKXB 2YWOA 1A2MA 2H6YA 1N2AA 2VM2A 4ZBDA 4JEDA 1A2JA 1B9YC 4F0BA 5G30A 3TJBA 3QAVA 1O8WA 4MF5A 5G5EA 3VWXA 3H4KA 2H1BA 2LRNA 3BD2A 4YQUA 2H73A 5J4UA 4AJ7A 4MZBA 1SK2A 2B5YA 4YH2A 2VLVA 3U5RE 4KUNA 3GTUB 2LSTA 2MMAA 4IP6A 5ECNB 4K5SA 3J7Yb 2B1LA 5A34A 3UAPA 5A4VA 3C8EA 2TRXA 2DJ0A 3RHBA 4KCAA 4KNDA 2GVPA 2H1GA 5DQSA 3NIVA 2GQLA 1ZCPA 3J7Yk 3ZVJD 4XS1A 4IQ1A 5AISA 3KP9A 4NXIA 1SJ6A 1QGVA 4FYUA 3GN3A 3C1RA 3GRXA 19GSA 1USBA 5A5HB 1J9BA 3KXOA 2CA8A 4YAVA 3GKMA 4K0NA 1XWBA 5GAPD 4ZB7A 3EE2A 5AN1A 1SENA 3HD5A 4KB3A 3O6TA 4N10A 4K8MA 4G0KA 2N5AA 2GSQA 4ZXGA 2VCZA 5CAXA 2YZUA 4D73A 3D22A 2HRKB 4XS4B 2PU9C 1K3YA 1F37A 2YJ7A 1A23A 3HKRA 9GSSA 3QFAC 2GQMA 3GUSA 3VK9A 3EYTA 4XS6A 3W8SA 4IKHA 3CSIA 5D96A 5D93A 4NV2A 1ZYNA 2PGTA 1GH2A 5B7CA 2VL9A 3D4TA 4YKFA 4KA0A 4HU9A 2B6MA 1B4QA 1OC9B 4MLYA 1THOA 14GSA 4DSRA 4WF4A 4O92A 4N0VA 2GQKA 1K3LA 5AIVA 3V1WA 3GX8A 2DJ1A 3M3MA 3RAZA 1XXUA 1Q98A 3QPMA 4NV5A 4ID0A 2YOIA 2JZRA 1T4YA 1FAAA 4XRDA 1X9SB 4GSNA 4POBA 3C1SA 1EOGA 3EURA 3EU4A 2B5EA 4AGSA 3HDCA 2V32A 2HZFA 3LJRA 3IPZA 3WGDA 2H72A 4JRRA 3HZ4A 5DJLA 1YKAA 2B1KA 2VL2C 1GSEA 3ISOA 5H5RA 2YCDA 3M0FA 3ZMKA 3MWHA 4O32A 1OAZA 5HR3A 2CZ3A 3GV1A 2YJHA 2GTUA 4QL7A 2O89A 2R37A 1T1VA 1YF0A 1B48A 3MAKA 5DAKA 2HSMA 4Z7XA 2K8SA 5IMZA 1XBSA 4HJMA 2F8AA 3APQA 3APSA 4IHUA 5HR0A 2C0FA 4TKYA 3VWUA 2OA7A 3UARA 5DJMA 5A5HA 1KEBA 3LGCA 2OJLA 4N11A 3TJFA 2DMLA 1JZRA 1JZWA 2H76A 2B3SA 1TXXA 3ZFLA 3QCPA 3KZQA 5DCHA 3LQ7A 2OBIA 4MJAA 1V40A 3VFIA 1FB0A 4JZQA 4EE0A 3GSSA 5BMUA 4F03A 5DBQA 4MCUA 3IXRA 3ZITA 3DWVA 4MABA 1PRXA 2HRKA 1A8YA 3ZFBA 2OADA 2H19A 1JHBA 1NSWA 2H1AA 1S3DA 1E2YA 4GTUA 4USSA 4IP1A 2M80A 4BA7A 4BVYA 1T00A 5GSSA 1YDKA 5CRWA 4K1FA 3SBCA 4NAXA 2DIZA 3VWWA 4JU5A 1YJ6A 2FWHA 5CRHA 2CV4A 4WR4A 4KCEA 4ZILA 4MNNA 1ACVA 1ERVA 1PX6A 2ZCTA 1GTAA 1X5DA 2CVDA 1BJXA 3U6VA 3ED3A 3EINA 3UBLA 3DEXA 1SVOA 1M9AA 3I69A 2O85A 4ACSA 5COHA 2HZEB 2WJUA 2WCIA 5DALB 4MF6A 5JCWA 5KEJA 2CX4A 5LCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVO A;  2M72 A;  3VWV A;  4MJB A;  2AB6 A;  1QUW A;  13GS A;  1OYJ A;  2FWG A;  1Y25 A;  4XRA A;  3PR8 A;  2WUL A;  2R5G A;  5D9T A;  1HNA A;  5ECL B;  1EZK A;  4RUV A;  5DDL A;  1MD4 A;  3G7Y A;  2MMZ A;  2O7K A;  1XWG A;  6GSV A;  1FHE A;  2N5F A;  4ZB6 A;  1Z9H A;  2EC4 A;  2JZT A;  3TRQ A;  3CXG A;  4OFM A;  4MP4 A;  1ZGN A;  4KH7 A;  2PVQ A;  5IMC A;  2K18 A;  1ZOF A;  3DML A;  1AC1 A;  4YQV A;  5ECR B;  5KN1 A;  2DMM A;  3QAW A;  2IJY A;  5F0G A;  1SYX A;  1XIY A;  1XW9 A;  4IQA A;  4IBP A;  5IMD A;  4EVM A;  2VCV A;  4FIW A;  3GYK A;  4K0G A;  4WKW A;  3FZ5 A;  1SJZ A;  3LG6 A;  3M8N A;  1B9X C;  5IO0 A;  2GGT A;  2KLX A;  3TRX A;  3GMF A;  3WT1 A;  2YN1 A;  3DD3 A;  11GS A;  4HQZ A;  5EPF A;  2E7P A;  2H01 A;  3IR4 A;  4PGT A;  1ST9 A;  5DVB A;  3L0H A;  1LJR A;  4Q5R A;  4PNG A;  3QAG A;  4NHZ A;  1FB6 A;  3PGT A;  1WWJ A;  3HXS A;  2IFQ B;  4EKZ A;  3SWL A;  2DLX A;  2AAW A;  2L5O A;  3M9J A;  4QL9 A;  1ERT A;  3QFB C;  2HE3 A;  2L6D A;  4TR1 A;  4GWR A;  5IQY A;  4L0U A;  1O7U A;  1EEM A;  4TOP A;  1SD8 A;  5KN0 A;  2QSI A;  4ZBA A;  3VUR A;  4IN0 A;  2H66 A;  5EL8 A;  4WET A;  3F9U A;  4TRX A;  4HDE A;  2IMK A;  2B7J A;  2WZ9 A;  4I8B A;  5ECO B;  1K0B A;  4OMV A;  3TKS C;  3FKF A;  2HRN A;  8GSS A;  4J2F A;  5H5S A;  4F82 A;  5ENU A;  4BVX A;  1PKZ A;  3E3E A;  2HNL A;  3Q18 A;  4PTS A;  3G7I A;  3D0Z A;  2HSH A;  3WGE A;  2LNT A;  3QR6 A;  1TDI A;  2A2R A;  3APO A;  4BWQ A;  1V9W A;  4K2D A;  3Q19 A;  1UN2 A;  5AIX A;  1MTC A;  1TP9 A;  3LXZ A;  2FWE A;  6GSU A;  4MA9 A;  3HVX A;  1VF2 A;  4GST A;  4BWS A;  1M9B A;  3KJY A;  4HI7 A;  1ML6 A;  5G2Z A;  5A5K A;  2CAI A;  1YY7 A;  1AIU A;  2LKU A;  1V2A A;  1T7P B;  3CSJ A;  3KGK A;  1WMJ A;  3L78 A;  3UEM A;  2J9H A;  4ZL7 A;  2LEG A;  6GSY A;  1RW1 A;  4Q5Q A;  1NHY A;  5FWG A;  4PQI A;  4KE3 A;  5ID2 B;  1QMV A;  1BAY A;  1DE1 A;  1M2D A;  1OKT A;  4I5Q A;  18GS A;  4FYC A;  1T3B A;  2MYG A;  2GZZ A;  3PIN A;  1R5P A;  4ZB8 A;  3FW2 A;  4OWY A;  2I81 A;  2IWT A;  1W4V A;  2VCQ A;  2XBI A;  1A0F A;  2IMI A;  1AQX A;  5L71 A;  5C04 A;  5F8B A;  1TRU A;  1SYR A;  2X8C A;  3H8Q A;  3VPT A;  2L5L A;  2WGR A;  3DKS A;  7GSS A;  4P3Y B;  5A4U A;  2LRC A;  3F6F A;  2B7K A;  5HR2 A;  1OC8 A;  3EVI A;  5HFK A;  4IJ3 A;  1XWA A;  2JAD A;  5ECQ B;  2C3Q A;  1YKC A;  5IMV A;  4EXJ A;  2L6C A;  2VLT A;  3GUR A;  4F9Z A;  2LNS A;  4HU7 A;  1JLW A;  3TGZ A;  3Q74 A;  5B8A A;  4POM A;  3ZYW A;  4MPG A;  5JCG A;  2PER A;  5EY6 A;  3JCM L;  3IAS 2;  5D9X A;  3TB2 A;  1IYI A;  2D2Z A;  1AUC A;  5LD0 A;  1BG5 A;  2CQ9 A;  4GLT A;  6GSS A;  3TOT A;  4ULX A;  1SU9 A;  1G7O A;  2I9H A;  2AHE A;  2RLI A;  2JSY A;  5ECP B;  4TW5 A;  3R3E A;  3FR9 A;  3P2A A;  5G5F A;  1WP0 A;  3HJO A;  1S3C A;  2HSN B;  2IME A;  3QMX A;  2PUK C;  5HFG A;  4MMM A;  1TRV A;  4KDX A;  4GQF A;  2J23 A;  2X99 A;  3FY7 A;  1U3A A;  2LV3 A;  1K0D A;  4BL7 A;  3GIX A;  1DUG A;  1XW6 A;  1XPV A;  2Z9S A;  1FOV A;  3QD9 A;  3HJM A;  1ZL9 A;  5CP1 A;  4AF2 A;  2VD0 A;  4AJ8 A;  1GSU A;  3GNJ A;  1URM A;  1TRW A;  2WDU A;  1SK0 A;  3L9V A;  2FA8 A;  3H79 A;  4L0W A;  3QOU A;  5KN2 A;  1WE0 A;  5J41 A;  4WBR D;  1XWC A;  4ZBB A;  2LTK A;  6GSX A;  2LQQ A;  4K9Z A;  4ECB A;  2C0G A;  2ZUP A;  2EIR A;  4MF7 A;  3HHV A;  5HQP A;  1U3I A;  1R26 A;  3WD6 A;  3HA9 A;  3MDK A;  2ES7 A;  2V6O A;  1A8L A;  4DSS B;  1BQ7 A;  1F9M A;  4OO5 A;  1O6J A;  1SL0 B;  3GTU A;  3O3T A;  1GNW A;  5JWO B;  1FVJ A;  3LEF A;  2V41 A;  4Q5F A;  1TK8 B;  4KSO A;  3CRU A;  2PPT A;  2C4J A;  3UIW A;  4GRF A;  1XOB A;  1A2L A;  2WRT A;  1TK5 B;  2C3N A;  1A0R P;  2IMD A;  2NDO A;  1AQW A;  1ERW A;  4QQ7 A;  1FW1 A;  5E4W A;  1GSD A;  2VIM A;  1NM3 A;  3TOU A;  5IMF A;  3KMN A;  3HYP A;  1DBY A;  2H0I A;  1Z3E A;  2R3X A;  2XBQ A;  3IRA A;  4LMV A;  4IVF A;  3D6I A;  1EGR A;  1I9D A;  3CMI A;  3GX0 A;  2E2G A;  4YQM A;  3UJ1 A;  5J3R A;  2O8V B;  4XS4 A;  3F4S A;  2OE3 A;  3M9K A;  3CYN A;  4GSS A;  2RII A;  5ECH B;  1ZYE A;  1TRS A;  2OAC A;  5GZZ B;  3ZRE A;  2F8F A;  3W8J A;  4NMU A;  1C72 A;  3FHK A;  1GTI A;  2RUE A;  5IMA A;  2HXK A;  1MDK A;  4ZIJ A;  4OCF A;  3D5J A;  4FYB A;  2OE0 A;  4WBJ A;  4FH8 A;  3UOM A;  3G7J A;  1O73 A;  2LJA A;  5IOW A;  3RBT A;  1OC9 A;  1F2E A;  2N5B A;  4XCS A;  3IDV A;  1OE8 A;  1J08 A;  1PL1 A;  1TI1 A;  2CX3 A;  1MEK A;  4WXT A;  2RUF A;  3E0U A;  1R4W A;  1A24 A;  4PX1 A;  1GTB A;  3VI5 A;  1MDJ A;  2HFD A;  3EU3 A;  2FNO A;  2QKE A;  2ZNM A;  5INY A;  2EIQ A;  2REM A;  1NW2 A;  2H6Z A;  2NVL A;  2XPD A;  1FG4 A;  2V1M A;  2JZS A;  3KTL A;  3IE3 A;  4E8E A;  1TOF A;  3EC3 A;  3F8U A;  3C7M A;  5CNW A;  1M99 A;  2I3Y A;  2IMF A;  3I9V 2;  3US3 A;  1K0A A;  5ABR A;  4MH2 A;  4EDZ A;  5B6N A;  3KD0 A;  3I43 A;  1ZZY A;  1Z6N A;  3F3R A;  4ECC A;  1FO5 A;  2YAN A;  3CTG A;  3WYW A;  3KIJ A;  3TJJ A;  1N8J A;  1QK8 A;  3L4N A;  1TI3 A;  1GUM A;  1XVW A;  1U87 A;  4GF0 A;  3KH9 A;  4CW9 A;  2H1D A;  2C1Y A;  4OO4 A;  4ECJ A;  2K6V A;  4YAP A;  1PL2 A;  2LJK A;  4ISD A;  3HVV A;  1GLQ A;  2FHE A;  2E0Q A;  5D9W A;  3R2Q A;  2P5Q A;  2VCT A;  3A2V A;  4DEJ A;  4MZC A;  3UMA A;  2VL2 A;  4OCE A;  1KBN A;  1TW9 A;  4IEL A;  4XHM A;  4BPY A;  4PQH A;  4PXO A;  3HCZ A;  4G0L A;  3UBK A;  1XOA A;  1U6T A;  3TRP A;  3GH6 A;  6GSW A;  4AJ6 A;  4V2N A;  1VGL A;  4KAE A;  12GS A;  2NBS A;  2GSR A;  3KEB A;  3DVX A;  2KUC A;  3F0I A;  4TXO B;  1CQH A;  5LNK e;  5D9V A;  4RQR A;  4HOJ A;  2HT9 A;  2PWJ A;  1IYH A;  2ON7 A;  5ECK B;  1G7E A;  2VD1 A;  5C00 A;  4O7H A;  1K0C A;  2AUV A;  2O87 A;  4JR4 A;  4CDO A;  4MJC A;  1JZO A;  2EIO A;  3N9J A;  2A2S A;  1XZO A;  4NHW A;  4L8E A;  5IO2 A;  2DJK A;  2OE1 A;  4OD7 A;  2IIY A;  5A4W A;  3HY2 A;  2K9F A;  3DXB A;  1SKW B;  4LL4 B;  3W6G A;  1BED A;  4PNF A;  2BTO T;  4CHS A;  1M2B A;  1PN9 A;  3NOF A;  1HNB A;  3CRT A;  4JE1 A;  4I97 A;  20GS A;  1XWK A;  3FEU A;  2HLS A;  2VOC A;  2HZE A;  3TDG A;  5DAL A;  3EMP A;  5CYY A;  4RI6 A;  4HUA A;  4PUF C;  1XCC A;  3BOA A;  4HQS A;  3O76 A;  3CTF A;  2YV7 A;  2QC7 A;  4ZL9 A;  3F6D A;  5G31 A;  5F07 A;  3F3Q A;  2FLS A;  2MBS A;  1T8E B;  1TK0 B;  3ZL5 A;  3ME7 A;  4POK A;  2GS3 A;  3QDN A;  2H8L A;  4OFN A;  4KDU A;  4V2L A;  22GS A;  3IK9 A;  2VO4 A;  1K0M A;  5J9C A;  1TU8 A;  1EGO A;  4EC0 A;  3GH9 A;  2PVO C;  3GKK A;  4J57 E;  1EV9 A;  3LYK A;  1YQ1 A;  1M7T A;  1G6Y A;  2ALB A;  1J0F A;  4NPB A;  2WS2 A;  4PUR A;  1UA5 A;  2PMT A;  3IA1 A;  1OVN A;  2YZH A;  3DVW A;  4ML6 A;  1B4P A;  1OKD A;  1SK1 A;  2P5R A;  1F6M C;  4HEA 2;  1GTU A;  2G2Q A;  2AJQ B;  3VPQ A;  1Z5Y E;  1GSY A;  1R5A A;  4G10 A;  3VI7 A;  2HRA A;  2DJJ A;  2BMX A;  2FCH A;  3UVH A;  3IC8 A;  4TXO A;  5DAK B;  3GL3 A;  2P31 A;  3LSZ A;  2HSM B;  2FD3 A;  4KGI A;  4I6X A;  5ECM B;  4TVE A;  2YV9 A;  1RK4 A;  1X9W B;  4ZL8 A;  3RDW A;  2IFQ A;  3FYG A;  1ON4 A;  5FHI A;  3IAM 2;  3A3T A;  2LS5 A;  1CQG A;  1TJD A;  4FO5 A;  3F4T A;  2HI7 A;  4JBB A;  3HZ8 A;  4JR6 A;  1LBK A;  3WT2 A;  4L5O A;  2L4Q A;  3C73 A;  2I1U A;  5ELA A;  2CAQ A;  3P7X A;  1HNC A;  1JFU A;  3UL3 A;  2X64 A;  3P90 A;  4EF0 A;  1EV4 A;  2RM5 A;  2F51 A;  1T4Z A;  1QFN A;  2GLR A;  5JWR B;  3LXT A;  5ECI B;  2JL4 A;  2C8U A;  2MMO A;  2ON5 A;  3DIE A;  5GAN D;  3TCO A;  4BVY B;  1THX A;  3TKS E;  1LU4 A;  3LOR A;  1TKD B;  2JSZ A;  4LMW A;  1Z6M A;  1PX7 A;  1GLP A;  3TKS A;  1BX9 A;  1V57 A;  2VM1 A;  1H4O A;  2MZC A;  5AGY A;  2GST A;  3KP8 A;  3P8W A;  1PQN A;  2VCX A;  2VL3 A;  5B8B A;  4HJ2 A;  4TN8 A;  1XVQ A;  5KN3 A;  2R4V A;  1EEJ A;  3EWL A;  1GWC A;  3G9B A;  3ME8 A;  2MBT A;  3NZN A;  1E6B A;  1V98 A;  1HYU A;  1ZYQ B;  4NWY A;  4N30 A;  5F05 A;  1WPI A;  3ZTL A;  3CSH A;  5IPG A;  5ID2 A;  1VRS D;  3D4M A;  2L4C A;  1X9M B;  3F4R A;  2GSS A;  2LJR A;  1XFL A;  4GXZ A;  2G0F A;  1ILO A;  3FR3 A;  1DSB A;  1X5E A;  1ERU A;  5CRG A;  4GQC A;  4E8H A;  2M46 A;  1PSQ A;  5J9B A;  3ZIJ A;  2YNX A;  1PKW A;  4LA1 A;  3ZZX A;  1ABA A;  2CVK A;  4G9H A;  4K7O A;  1HQO A;  2FGX A;  2H0G A;  3ZVJ A;  2VCW A;  3ERG A;  3HJP A;  5ECS A;  1PA3 A;  5CRE A;  4GCI A;  4EL1 A;  3L9S A;  4K6X A;  2H71 A;  1GSQ A;  3H1N A;  3WGX A;  1SD9 A;  5DQY A;  1SL2 B;  1K3O A;  3LYP A;  1EP7 A;  3N5O A;  2DIY A;  1GL8 A;  3D21 A;  4HZ2 A;  1R7H A;  4KF9 A;  3FZ4 A;  2E2M A;  4LL1 B;  3GFK A;  1YEP A;  3PPU A;  1TU7 A;  2H74 A;  1FVK A;  1X5C A;  3LWA A;  4MDC A;  2YWI A;  5JWQ B;  4V2M A;  2RM6 A;  3S9F A;  5D73 A;  1K0N A;  3TKQ A;  5CO3 A;  5F06 A;  3A2W A;  5IIZ A;  4IJI A;  2V6K A;  2GZP A;  2I4A A;  1QQ2 A;  2AYT A;  2K8V A;  2IPA A;  2OKA A;  1EWX A;  2F3M A;  4MJE A;  2C80 A;  1YEX A;  4TR0 A;  2YWM A;  1SL1 B;  1EP8 A;  2C0E A;  4DVC A;  1SKR B;  1KNG A;  2H70 A;  4X43 A;  2X8G A;  1O85 A;  4IS0 A;  3DRN A;  1PD2 1;  5D8I A;  2DJ3 A;  2OBK A;  2KP1 A;  2HYX A;  4RQX A;  2LRT A;  2QGV A;  2TIR A;  3GL5 A;  2HQT A;  5ELG A;  4TR1 B;  1PGT A;  3E9J B;  4X1U A;  2A4V A;  5JCU A;  4ILF A;  3ZLP A;  2GZY A;  3TKR A;  3BJ5 A;  3GKX A;  4MK3 A;  1RQM A;  3IV4 A;  4X0X A;  5G1K A;  3TJK A;  1WIK A;  3KMO A;  1AW9 A;  1W89 A;  1GUK A;  1GSS A;  3KCM A;  3MSZ A;  4KSM A;  4XIH A;  1ZMA A;  3FZA A;  1WOU A;  2YP6 A;  4V1A g;  3IBH A;  2R6K A;  5B6M A;  6GST A;  2WB9 A;  1UVZ A;  5IPH A;  1JZD A;  4WF5 A;  3CBU A;  4WEY A;  4EDY A;  3LFL A;  4N0Z A;  4BVX B;  2NTO A;  4I2U A;  2GDR A;  2KHP A;  2H0H A;  1AQV A;  1AAZ A;  1M2A A;  4F2I A;  1F3A A;  3DYR A;  3KTB A;  2HRF A;  2DSA A;  3ERW A;  2FA4 A;  2X8H A;  1M0U A;  1SKS B;  3IK7 A;  4H86 A;  2DJ2 A;  2GT5 A;  5G1L A;  1Y6E A;  4FQU A;  1PMT A;  1QXH A;  1U88 A;  3IC4 A;  1O8X A;  4DSS A;  2IL3 A;  1B8X A;  1KTE A;  4POL A;  2MMN A;  1AXD A;  2H30 A;  5HR1 A;  2VLU A;  2LUS A;  1X0R A;  3BBY A;  2GT6 A;  2DBC A;  3AY8 A;  4V1A p;  4KDY A;  1JLV A;  4ML1 A;  2YPM A;  2NPB A;  3TJG A;  1I5G A;  3TKP A;  3BCI A;  4TR4 A;  3M1G A;  4HS1 A;  1XW5 A;  3FZ9 A;  3I6A A;  2C3T A;  4J56 E;  1NHO A;  1Z7P A;  3HVS A;  2V2G A;  3IHQ A;  1MDI A;  2XPE A;  3K8N A;  3PH9 A;  3C71 A;  1VF1 A;  5HFI A;  4OFT A;  4ZB9 A;  2TRC P;  1GUH A;  5H5Q A;  3F63 A;  1YF1 A;  1S3A A;  2FUG 2;  2XHF A;  2DC5 A;  1OC3 A;  1MD3 A;  2CT6 A;  3GST A;  2B5X A;  1F3B A;  3MNG A;  1TTZ A;  3FK8 A;  1UC7 A;  3ZIV A;  3L9U A;  4MPF A;  4RI7 A;  3EMX A;  3RHC A;  1Q4J A;  2L59 A;  4WR5 A;  4XTS A;  3A5W A;  3KM6 A;  1G6W A;  2H6X A;  5IOX A;  3FRC A;  4DSQ A;  3H93 A;  1V58 A;  2BJX A;  2R2J A;  1WRY A;  3TUE A;  2FWF A;  5IM9 A;  2JAC A;  5GST A;  4PQ1 A;  2C0D A;  1Z7R A;  3KH7 A;  4G2E A;  3IOS A;  2VUP A;  1H75 A;  3GKN A;  1VF3 A;  4ECI A;  4IGJ A;  2H75 A;  2P0G A;  1DE2 A;  3UVT A;  1BYE A;  4D73 B;  2AV4 A;  17GS A;  3VLN A;  1VF4 A;  4TXV A;  3RPP A;  2IN3 A;  2JU5 A;  2YWN A;  3FR6 A;  3OR5 A;  4MH3 A;  1GNE A;  1EOH A;  16GS A;  2F9S A;  1GUL A;  2PN8 A;  4KW6 A;  4O5R A;  5DCG A;  3A2X A;  1HD2 A;  3BCK A;  2HSY A;  2XC2 A;  1WJK A;  4I2T A;  2LQO A;  4MZW A;  1G0T A;  2VAF A;  1K0O A;  1GRX A;  2FY6 A;  4K7I A;  4PUA A;  2KOK A;  2CVB A;  3ZML A;  3ERF A;  1SJI A;  4TR3 A;  10GS A;  4EO3 A;  4EUY A;  2KP2 A;  4K7N A;  4BL7 B;  2PBJ A;  4F0C A;  1O81 A;  4LLR A;  3GA4 A;  4HZ4 A;  4Q5N A;  5E59 A;  3DGQ A;  4IW9 A;  2L57 A;  5FT3 A;  1OE7 A;  2UZ8 A;  1GP1 A;  3RPN A;  3Q6O A;  4G0I A;  2CZ2 A;  1GSF A;  1YZX A;  4L5L A;  4KX4 A;  3ZRD A;  3GHA A;  2WFC A;  4G19 A;  5J5N A;  5CRD A;  2YWO A;  1A2M A;  2H6Y A;  1N2A A;  2VM2 A;  4ZBD A;  4JED A;  1A2J A;  1B9Y C;  4F0B A;  5G30 A;  3TJB A;  3QAV A;  1O8W A;  4MF5 A;  5G5E A;  3VWX A;  3H4K A;  2H1B A;  2LRN A;  3BD2 A;  4YQU A;  2H73 A;  5J4U A;  4AJ7 A;  4MZB A;  1SK2 A;  2B5Y A;  4YH2 A;  2VLV A;  3U5R E;  4KUN A;  3GTU B;  2LST A;  2MMA A;  4IP6 A;  5ECN B;  3J7Y b;  2B1L A;  3UAP A;  5A4V A;  3C8E A;  2TRX A;  2DJ0 A;  3RHB A;  4KCA A;  4KND A;  2GVP A;  2H1G A;  5DQS A;  3NIV A;  2GQL A;  1ZCP A;  3J7Y k;  3ZVJ D;  4XS1 A;  4IQ1 A;  5AIS A;  3KP9 A;  4NXI A;  1SJ6 A;  1QGV A;  4FYU A;  3GN3 A;  3C1R A;  3GRX A;  19GS A;  1USB A;  1J9B A;  3KXO A;  2CA8 A;  4YAV A;  3GKM A;  4K0N A;  1XWB A;  5GAP D;  3EE2 A;  5AN1 A;  1SEN A;  3HD5 A;  4KB3 A;  3O6T A;  4N10 A;  4K8M A;  4G0K A;  2N5A A;  2GSQ A;  4ZXG A;  2VCZ A;  5CAX A;  2YZU A;  4D73 A;  3D22 A;  2HRK B;  4XS4 B;  2PU9 C;  1K3Y A;  1F37 A;  2YJ7 A;  1A23 A;  3HKR A;  9GSS A;  3QFA C;  2GQM A;  3GUS A;  3VK9 A;  3EYT A;  4XS6 A;  3W8S A;  4IKH A;  3CSI A;  5D96 A;  5D93 A;  4NV2 A;  2PGT A;  1GH2 A;  5B7C A;  2VL9 A;  3D4T A;  4KA0 A;  4HU9 A;  2B6M A;  1B4Q A;  1OC9 B;  4MLY A;  1THO A;  14GS A;  4DSR A;  4WF4 A;  4O92 A;  4N0V A;  2GQK A;  1K3L A;  5AIV A;  3V1W A;  3GX8 A;  2DJ1 A;  3M3M A;  3RAZ A;  1XXU A;  1Q98 A;  3QPM A;  4NV5 A;  4ID0 A;  2YOI A;  2JZR A;  1T4Y A;  1FAA A;  4XRD A;  1X9S B;  4GSN A;  4POB A;  3C1S A;  1EOG A;  3EUR A;  3EU4 A;  2B5E A;  4AGS A;  3HDC A;  2V32 A;  2HZF A;  3LJR A;  3IPZ A;  3WGD A;  2H72 A;  4JRR A;  3HZ4 A;  5DJL A;  1YKA A;  2B1K A;  2VL2 C;  1GSE A;  3ISO A;  5H5R A;  2YCD A;  3M0F A;  3ZMK A;  3MWH A;  4O32 A;  1OAZ A;  5HR3 A;  2CZ3 A;  3GV1 A;  2YJH A;  2GTU A;  4QL7 A;  2O89 A;  2R37 A;  1T1V A;  1YF0 A;  1B48 A;  3MAK A;  5DAK A;  2HSM A;  4Z7X A;  2K8S A;  5IMZ A;  1XBS A;  4HJM A;  2F8A A;  3APQ A;  3APS A;  4IHU A;  5HR0 A;  2C0F A;  4TKY A;  3VWU A;  2OA7 A;  3UAR A;  5DJM A;  1KEB A;  3LGC A;  2OJL A;  4N11 A;  3TJF A;  2DML A;  1JZR A;  1JZW A;  2H76 A;  2B3S A;  1TXX A;  3ZFL A;  3QCP A;  3KZQ A;  5DCH A;  3LQ7 A;  2OBI A;  4MJA A;  1V40 A;  3VFI A;  1FB0 A;  4JZQ A;  4EE0 A;  3GSS A;  5BMU A;  4F03 A;  5DBQ A;  4MCU A;  3IXR A;  3ZIT A;  3DWV A;  4MAB A;  1PRX A;  2HRK A;  1A8Y A;  3ZFB A;  2OAD A;  2H19 A;  1JHB A;  1NSW A;  2H1A A;  1S3D A;  1E2Y A;  4GTU A;  4USS A;  4IP1 A;  2M80 A;  4BA7 A;  4BVY A;  1T00 A;  5GSS A;  1YDK A;  5CRW A;  4K1F A;  3SBC A;  4NAX A;  2DIZ A;  3VWW A;  4JU5 A;  1YJ6 A;  2FWH A;  5CRH A;  2CV4 A;  4WR4 A;  4KCE A;  4ZIL A;  1ACV A;  1ERV A;  1PX6 A;  2ZCT A;  1GTA A;  1X5D A;  2CVD A;  1BJX A;  3U6V A;  3ED3 A;  3EIN A;  3UBL A;  3DEX A;  1M9A A;  3I69 A;  2O85 A;  4ACS A;  5COH A;  2HZE B;  2WJU A;  2WCI A;  5DAL B;  4MF6 A;  5JCW A;  5KEJ A;  2CX4 A;  5LCZ A; 
#chains in the Genus database with same CATH topology
 5EVO A;  2M72 A;  3VWV A;  4MJB A;  2AB6 A;  1QUW A;  13GS A;  1OYJ A;  2FWG A;  1Y25 A;  4XRA A;  3PR8 A;  2WUL A;  2R5G A;  5D9T A;  1HNA A;  5ECL B;  1EZK A;  4RUV A;  5DDL A;  4Z2T A;  1MD4 A;  3G7Y A;  2WW0 A;  2MMZ A;  2O7K A;  1XWG A;  6GSV A;  1FHE A;  2N5F A;  4ZB6 A;  1Z9H A;  2EC4 A;  2JZT A;  3TRQ A;  3CXG A;  4OFM A;  4MP4 A;  1ZGN A;  4KH7 A;  2PVQ A;  5IMC A;  2K18 A;  1ZOF A;  3DML A;  1AC1 A;  4YQV A;  5ECR B;  5KN1 A;  2DMM A;  3QAW A;  2VKZ G;  2IJY A;  5F0G A;  1SYX A;  1XIY A;  1XW9 A;  4IQA A;  4IBP A;  5IMD A;  4EVM A;  2VCV A;  4FIW A;  3GYK A;  4K0G A;  4WKW A;  3FZ5 A;  1SJZ A;  3LG6 A;  1BF5 A;  3M8N A;  5KOW A;  1B9X C;  5IO0 A;  2GGT A;  2KLX A;  3TRX A;  3GMF A;  3WT1 A;  2YN1 A;  3DD3 A;  11GS A;  4HQZ A;  5EPF A;  2E7P A;  2H01 A;  3IR4 A;  3IHG A;  4PGT A;  1ST9 A;  5DVB A;  3L0H A;  1LJR A;  4Q5R A;  4PNG A;  3QAG A;  4NHZ A;  1FB6 A;  3PGT A;  1WWJ A;  3HXS A;  2IFQ B;  4EKZ A;  3SWL A;  2DLX A;  2AAW A;  2L5O A;  3M9J A;  4QL9 A;  4AKG A;  1ERT A;  3QFB C;  2HE3 A;  2L6D A;  4TR1 A;  4GWR A;  5IQY A;  2WVZ A;  4L0U A;  1O7U A;  1EEM A;  4TOP A;  1SD8 A;  5KN0 A;  2QSI A;  4ZBA A;  3VUR A;  4IN0 A;  2H66 A;  5EL8 A;  4WET A;  3F9U A;  4TRX A;  4HDE A;  2IMK A;  2B7J A;  2WZ9 A;  4I8B A;  5ECO B;  1K0B A;  4OMV A;  3TKS C;  3FKF A;  2HRN A;  2QA2 A;  8GSS A;  4J2F A;  5H5S A;  4F82 A;  5ENU A;  4BVX A;  1PKZ A;  3E3E A;  2HNL A;  3Q18 A;  4PTS A;  3G7I A;  3D0Z A;  2HSH A;  3WGE A;  2LNT A;  3QR6 A;  1TDI A;  2A2R A;  3APO A;  4BWQ A;  1V9W A;  4K2D A;  3Q19 A;  1UN2 A;  5AIX A;  1MTC A;  1TP9 A;  3LXZ A;  3LW9 A;  2FWE A;  6GSU A;  4MA9 A;  3HVX A;  4K2X A;  1VF2 A;  4GST A;  4BWS A;  1M9B A;  3KJY A;  4HI7 A;  1ML6 A;  5G2Z A;  5A5K A;  2CAI A;  1YY7 A;  1AIU A;  2LKU A;  1V2A A;  1T7P B;  3CSJ A;  1YVL A;  3KGK A;  1WMJ A;  3L78 A;  3UEM A;  2J9H A;  4ZL7 A;  2LEG A;  6GSY A;  1RW1 A;  4Q5Q A;  1NHY A;  5FWG A;  4CY6 A;  4PQI A;  4KE3 A;  5ID2 B;  1QMV A;  1BAY A;  1DE1 A;  1M2D A;  1OKT A;  4I5Q A;  18GS A;  4FYC A;  4GDF A;  1T3B A;  2MYG A;  2GZZ A;  3PIN A;  1R5P A;  4ZB8 A;  3FW2 A;  4OWY A;  2I81 A;  2IWT A;  1W4V A;  2VCQ A;  2XBI A;  1A0F A;  2IMI A;  1AQX A;  5L71 A;  5C04 A;  5F8B A;  1TRU A;  1SYR A;  2X8C A;  3H8Q A;  3VPT A;  4AI6 A;  2L5L A;  2WGR A;  3DKS A;  7GSS A;  4P3Y B;  4AKI A;  5A4U A;  2LRC A;  3F6F A;  2R0G A;  2B7K A;  5HR2 A;  1OC8 A;  3EVI A;  5HFK A;  4IJ3 A;  1XWA A;  2JAD A;  4EIP A;  5ECQ B;  2C3Q A;  1YKC A;  5IMV A;  4EXJ A;  2L6C A;  2VLT A;  3GUR A;  4F9Z A;  2LNS A;  4HU7 A;  1JLW A;  3TGZ A;  1I1I P;  3Q74 A;  5B8A A;  4POM A;  3ZYW A;  4MPG A;  5JCG A;  2PER A;  5EY6 A;  3JCM L;  3IAS 2;  5D9X A;  3TB2 A;  1IYI A;  2D2Z A;  1AUC A;  2DKI A;  5LD0 A;  2A2P A;  1BG5 A;  2CQ9 A;  4GLT A;  6GSS A;  3TOT A;  4ULX A;  1SU9 A;  2WVX A;  1G7O A;  2I9H A;  2AHE A;  2RLI A;  1N25 A;  2JSY A;  5ECP B;  4TW5 A;  3R3E A;  3FR9 A;  3P2A A;  5G5F A;  1WP0 A;  3HJO A;  1S3C A;  2HSN B;  2IME A;  3QMX A;  2DKH A;  2PUK C;  5HFG A;  4MMM A;  1TRV A;  4KDX A;  4GQF A;  2J23 A;  2X99 A;  3FY7 A;  1U3A A;  4AKH A;  2LV3 A;  1K0D A;  2OT3 A;  4BL7 A;  3GIX A;  1DUG A;  1XW6 A;  1XPV A;  2Z9S A;  1FOV A;  3QD9 A;  3HJM A;  1ZL9 A;  5CP1 A;  4AF2 A;  2VD0 A;  4AJ8 A;  1GSU A;  3GNJ A;  1URM A;  1TRW A;  2WDU A;  1SK0 A;  3L9V A;  2FA8 A;  3H79 A;  4L0W A;  3QOU A;  1SVL A;  5KN2 A;  1WE0 A;  5J41 A;  4WBR D;  1XWC A;  4ZBB A;  2LTK A;  6GSX A;  2LQQ A;  4K9Z A;  4ECB A;  2C0G A;  2ZUP A;  2EIR A;  4MF7 A;  3HHV A;  5HQP A;  1U3I A;  1R26 A;  3WD6 A;  3HA9 A;  3MDK A;  2ES7 A;  2V6O A;  1A8L A;  4DSS B;  1BQ7 A;  1F9M A;  4OO5 A;  1O6J A;  1SL0 B;  3FMW A;  3GTU A;  3O3T A;  1GNW A;  5JWO B;  1FVJ A;  3LEF A;  2V41 A;  4Q5F A;  1TK8 B;  4KSO A;  5BRT A;  2R0C A;  3CRU A;  2PPT A;  2C4J A;  3UIW A;  4GRF A;  1XOB A;  1A2L A;  2WRT A;  1TK5 B;  2C3N A;  1A0R P;  4A5P A;  2IMD A;  2NDO A;  1AQW A;  1ERW A;  4QQ7 A;  1FW1 A;  5E4W A;  1GSD A;  1BG1 A;  2VIM A;  1NM3 A;  3TOU A;  1Y1U A;  5IMF A;  3KMN A;  3HYP A;  1DBY A;  2H0I A;  1Z3E A;  2R3X A;  2XBQ A;  3IRA A;  4LMV A;  4IVF A;  3D6I A;  1EGR A;  1I9D A;  3CMI A;  3GX0 A;  2E2G A;  4YQM A;  3UJ1 A;  5J3R A;  2O8V B;  4XS4 A;  3F4S A;  2OE3 A;  3CHX C;  3M9K A;  3CYN A;  4GSS A;  2RII A;  5ECH B;  1ZYE A;  4Z2R A;  1TRS A;  2OAC A;  5GZZ B;  3ZRE A;  2F8F A;  3W8J A;  4NMU A;  1C72 A;  3FHK A;  1GTI A;  2RUE A;  5IMA A;  2HXK A;  1MDK A;  4ZIJ A;  4OCF A;  3D5J A;  4FYB A;  2OE0 A;  4WBJ A;  4FH8 A;  3UOM A;  3G7J A;  1O73 A;  2LJA A;  5IOW A;  3RBT A;  1OC9 A;  1F2E A;  2N5B A;  4XCS A;  3IDV A;  1OE8 A;  1J08 A;  1PL1 A;  1TI1 A;  2CX3 A;  1MEK A;  4WXT A;  2RUF A;  3E0U A;  1R4W A;  1A24 A;  4PX1 A;  1GTB A;  3VI5 A;  1MDJ A;  2HFD A;  4ICY A;  3HMJ G;  3EU3 A;  2FNO A;  2QKE A;  2ZNM A;  5INY A;  2EIQ A;  2REM A;  1NW2 A;  2H6Z A;  2NVL A;  2XPD A;  1FG4 A;  2V1M A;  2JZS A;  3KTL A;  3IE3 A;  1TXU A;  4E8E A;  1TOF A;  3EC3 A;  3F8U A;  3C7M A;  5CNW A;  1M99 A;  2I3Y A;  2IMF A;  3I9V 2;  3US3 A;  1K0A A;  5ABR A;  4MH2 A;  4EDZ A;  5B6N A;  3KD0 A;  3I43 A;  1ZZY A;  3MIX A;  1Z6N A;  3F3R A;  4CY8 A;  4ECC A;  1FO5 A;  2YAN A;  3CTG A;  3WYW A;  3KIJ A;  3TJJ A;  1N8J A;  1QK8 A;  1TI3 A;  3L4N A;  1GUM A;  1XVW A;  1U87 A;  4GF0 A;  3KH9 A;  4CW9 A;  2H1D A;  2C1Y A;  4OO4 A;  4ECJ A;  2K6V A;  4YAP A;  1PL2 A;  2LJK A;  4ISD A;  3HVV A;  1GLQ A;  2FHE A;  2E0Q A;  5D9W A;  3R2Q A;  2P5Q A;  2VCT A;  3A2V A;  4DEJ A;  4MZC A;  3UMA A;  2VL2 A;  4OCE A;  1KBN A;  1TW9 A;  2H1L A;  1XG8 A;  4IEL A;  4XHM A;  4BPY A;  4PQH A;  4PXO A;  1M3I A;  3HCZ A;  2EFC A;  4G0L A;  3UBK A;  1XOA A;  1U6T A;  3TRP A;  3GH6 A;  6GSW A;  4AJ6 A;  5A1N B;  4V2N A;  1VGL A;  4KAE A;  12GS A;  3RGB C;  2NBS A;  2GSR A;  3KEB A;  3DVX A;  2KUC A;  3F0I A;  5A34 B;  4TXO B;  1CQH A;  5LNK e;  5D9V A;  4RQR A;  4HOJ A;  2HT9 A;  2PWJ A;  1IYH A;  2ON7 A;  5ECK B;  1G7E A;  2VD1 A;  5C00 A;  4FXY P;  4O7H A;  1K0C A;  2AUV A;  2O87 A;  4JR4 A;  4CDO A;  4MJC A;  1JZO A;  2EIO A;  3N9J A;  2A2S A;  1XZO A;  4NHW A;  4L8E A;  5IO2 A;  2DJK A;  2OE1 A;  4OD7 A;  2IIY A;  5A4W A;  3HY2 A;  2K9F A;  3DXB A;  1SKW B;  4LL4 B;  3W6G A;  1BED A;  4PNF A;  2BTO T;  4CHS A;  1M2B A;  1PN9 A;  3NOF A;  1HNB A;  3CRT A;  4JE1 A;  4I97 A;  20GS A;  3A5I A;  1XWK A;  3FEU A;  2HLS A;  2VOC A;  2HZE A;  3TDG A;  5DAL A;  3EMP A;  1ZYP A;  5CYY A;  4RI6 A;  4HUA A;  4PUF C;  1XCC A;  3BOA A;  4HQS A;  3O76 A;  3CTF A;  2YV7 A;  2QC7 A;  4ZL9 A;  3F6D A;  5G31 A;  1PFO A;  5F07 A;  3F3Q A;  2FLS A;  2MBS A;  1T8E B;  1TK0 B;  3ZL5 A;  3ME7 A;  4POK A;  2GS3 A;  3QDN A;  4N3Z A;  2H8L A;  4OFN A;  4KDU A;  4V2L A;  22GS A;  3IK9 A;  2VO4 A;  1K0M A;  5J9C A;  1TU8 A;  1EGO A;  3MYD A;  4EC0 A;  3CQF A;  3GH9 A;  2PVO C;  3GKK A;  4J57 E;  1EV9 A;  3LYK A;  1YQ1 A;  1M7T A;  2O36 A;  1G6Y A;  2ALB A;  1J0F A;  4NPB A;  2WS2 A;  2WZS A;  4PUR A;  1UA5 A;  2PMT A;  3IA1 A;  1OVN A;  2YZH A;  3DVW A;  4ML6 A;  1B4P A;  1OKD A;  1SK1 A;  2P5R A;  1F6M C;  4HEA 2;  1GTU A;  2G2Q A;  2AJQ B;  5A1N A;  3VPQ A;  1Z5Y E;  1GSY A;  1R5A A;  4G10 A;  3VI7 A;  2HRA A;  2DJJ A;  2BMX A;  2FCH A;  3UVH A;  3IC8 A;  4TXO A;  5DAK B;  3GL3 A;  2P31 A;  3LSZ A;  2HSM B;  2FD3 A;  4KGI A;  4I6X A;  5ECM B;  4TVE A;  2YV9 A;  1RK4 A;  1X9W B;  4ZL8 A;  3RDW A;  2IFQ A;  3FYG A;  1ON4 A;  5FHI A;  3IAM 2;  3A3T A;  2LS5 A;  1CQG A;  1TJD A;  4FO5 A;  3F4T A;  4O5Q A;  2HI7 A;  4JBB A;  3HZ8 A;  4JR6 A;  1LBK A;  3WT2 A;  4L5O A;  2L4Q A;  3C73 A;  2I1U A;  5ELA A;  5BMU B;  2CAQ A;  3P7X A;  1HNC A;  1JFU A;  3UL3 A;  2X64 A;  3P90 A;  4EF0 A;  1EV4 A;  2RM5 A;  2F51 A;  1T4Z A;  1QFN A;  2GLR A;  1S3R A;  3LXT A;  5JWR B;  5ECI B;  2JL4 A;  2C8U A;  2MMO A;  2ON5 A;  3DIE A;  5GAN D;  3TCO A;  4BVY B;  1THX A;  3TKS E;  1LU4 A;  3LOR A;  1TKD B;  2JSZ A;  4LMW A;  4O5U A;  1Z6M A;  1PX7 A;  1GLP A;  3TKS A;  1BX9 A;  1V57 A;  2VM1 A;  1H4O A;  2MZC A;  5AGY A;  2GST A;  3KP8 A;  3P8W A;  1PQN A;  2VCX A;  2VL3 A;  5B8B A;  4HJ2 A;  4TN8 A;  1XVQ A;  5KN3 A;  2R4V A;  1EEJ A;  3EWL A;  1GWC A;  3G9B A;  2UV8 G;  3ME8 A;  2MBT A;  3NZN A;  1E6B A;  1V98 A;  1HYU A;  1ZYQ B;  4NWY A;  4N30 A;  5F05 A;  1WPI A;  3ZTL A;  3CSH A;  5IPG A;  5ID2 A;  1VRS D;  3D4M A;  2L4C A;  1X9M B;  3F4R A;  2GSS A;  2LJR A;  1XFL A;  4GXZ A;  2G0F A;  1ILO A;  3FR3 A;  1DSB A;  1X5E A;  1ERU A;  5CRG A;  2WW1 A;  4GQC A;  4E8H A;  2M46 A;  1PSQ A;  3HVN A;  5J9B A;  3ZIJ A;  2YNX A;  1PKW A;  4LA1 A;  3ZZX A;  1ABA A;  2CVK A;  4G9H A;  4K7O A;  1HQO A;  5J47 A;  2FGX A;  2H0G A;  3ZVJ A;  2VCW A;  3ERG A;  3HJP A;  5ECS A;  1PA3 A;  5CRE A;  4GCI A;  4EL1 A;  3L9S A;  4K6X A;  2H71 A;  1GSQ A;  3H1N A;  3WGX A;  1SD9 A;  5DQY A;  1SL2 B;  1K3O A;  3LYP A;  1EP7 A;  3N5O A;  2DIY A;  1GL8 A;  3D21 A;  4HZ2 A;  1R7H A;  4KF9 A;  3FZ4 A;  2E2M A;  4LL1 B;  3GFK A;  1YEP A;  3PPU A;  1TU7 A;  2H74 A;  1FVK A;  1X5C A;  3LWA A;  4MDC A;  2YWI A;  5JWQ B;  4V2M A;  4Z2U A;  2RM6 A;  3S9F A;  5D73 A;  1K0N A;  3TKQ A;  5CO3 A;  5F06 A;  3A2W A;  5IIZ A;  4W66 A;  4IJI A;  2V6K A;  2GZP A;  2I4A A;  3RFR C;  1FOH A;  1QQ2 A;  2AYT A;  2K8V A;  2IPA A;  2OKA A;  1EWX A;  2F3M A;  4MJE A;  2C80 A;  1YEX A;  4TR0 A;  2YWM A;  1SL1 B;  1EP8 A;  2C0E A;  4DVC A;  1SKR B;  1KNG A;  2H70 A;  4X43 A;  2X8G A;  1O85 A;  4IS0 A;  2HSN A;  3DRN A;  1PD2 1;  5D8I A;  2DJ3 A;  2OBK A;  2KP1 A;  2HYX A;  5KOX A;  4RQX A;  2LRT A;  2QGV A;  1SVM A;  2TIR A;  3GL5 A;  2HQT A;  5ELG A;  2EFD A;  4TR1 B;  1PGT A;  3E9J B;  4X1U A;  2A4V A;  5JCU A;  4ILF A;  3ZLP A;  2GZY A;  3TKR A;  2O5V A;  3BJ5 A;  3GKX A;  3EPT A;  4MK3 A;  1RQM A;  3IV4 A;  4X0X A;  5G1K A;  3TJK A;  1WIK A;  3KMO A;  1AW9 A;  4X4J A;  1W89 A;  1GUK A;  4QMK A;  1GSS A;  3KCM A;  3MSZ A;  4KSM A;  4XIH A;  1ZMA A;  2EFE A;  3FZA A;  1WOU A;  2YP6 A;  4V1A g;  3IBH A;  2R6K A;  5B6M A;  6GST A;  2WB9 A;  1UVZ A;  5IPH A;  1JZD A;  4E68 A;  4WF5 A;  3CBU A;  4WEY A;  3CWG A;  4EDY A;  1PN0 A;  3LFL A;  4N0Z A;  4BVX B;  2NTO A;  4I2U A;  2GDR A;  2KHP A;  2H0H A;  1AQV A;  1AAZ A;  1M2A A;  4F2I A;  5J40 A;  1F3A A;  3DYR A;  3KTB A;  2HRF A;  2DSA A;  3ERW A;  2FA4 A;  2X4A A;  2X8H A;  1M0U A;  1SKS B;  3IK7 A;  4H86 A;  2DJ2 A;  2GT5 A;  5G1L A;  1Y6E A;  4FQU A;  1PMT A;  1QXH A;  1U88 A;  3IC4 A;  1O8X A;  4DSS A;  2IL3 A;  1B8X A;  1KTE A;  4POL A;  2MMN A;  1AXD A;  2H30 A;  4G01 A;  5HR1 A;  2VLU A;  2LUS A;  1X0R A;  3BBY A;  2GT6 A;  2DBC A;  3AY8 A;  4V1A p;  4KDY A;  1JLV A;  4ML1 A;  2YPM A;  2NPB A;  3TJG A;  1I5G A;  3TKP A;  3BCI A;  4TR4 A;  3M1G A;  4HS1 A;  1XW5 A;  4K5R A;  3FZ9 A;  3I6A A;  2C3T A;  4J56 E;  1NHO A;  1Z7P A;  2A4H A;  3HVS A;  2V2G A;  3IHQ A;  1MDI A;  2XPE A;  3K8N A;  3PH9 A;  3C71 A;  1VF1 A;  2WW2 A;  5HFI A;  4OFT A;  4ZB9 A;  2TRC P;  1GUH A;  5H5Q A;  3F63 A;  1YF1 A;  1S3A A;  2FUG 2;  2XHF A;  2DC5 A;  2EFH A;  1OC3 A;  1MD3 A;  2CT6 A;  3GST A;  2B5X A;  1F3B A;  3MNG A;  1TTZ A;  3FK8 A;  1UC7 A;  3ZIV A;  3L9U A;  2WVY A;  4MPF A;  4RI7 A;  3EMX A;  3RHC A;  1Q4J A;  2L59 A;  4WR5 A;  4XTS A;  3A5W A;  3KM6 A;  1G6W A;  3TU3 B;  2H6X A;  5IOX A;  3FRC A;  4DSQ A;  3H93 A;  1V58 A;  2BJX A;  2R2J A;  1WRY A;  3TUE A;  2FWF A;  5IM9 A;  2JAC A;  5J4V A;  5GST A;  4PQ1 A;  2C0D A;  1Z7R A;  3KH7 A;  4G2E A;  3IOS A;  2VUP A;  1H75 A;  3GKN A;  1VF3 A;  4ECI A;  4IGJ A;  2H75 A;  2P0G A;  1DE2 A;  3UVT A;  1BYE A;  5J4Y A;  4D73 B;  2AV4 A;  17GS A;  3VLN A;  1VF4 A;  4TXV A;  3RPP A;  2IN3 A;  2JU5 A;  2YWN A;  3FR6 A;  3OR5 A;  4MH3 A;  1GNE A;  1EOH A;  16GS A;  2F9S A;  1GUL A;  2PN8 A;  4KW6 A;  4O5R A;  5DCG A;  2WVX B;  3A2X A;  1HD2 A;  3BCK A;  2HSY A;  2XC2 A;  1WJK A;  4I2T A;  2LQO A;  4MZW A;  1G0T A;  2VAF A;  1K0O A;  1GRX A;  2FY6 A;  2X49 A;  4K7I A;  4PUA A;  2KOK A;  2CVB A;  3ZML A;  3ERF A;  1SJI A;  4TR3 A;  10GS A;  4EO3 A;  4EUY A;  2KP2 A;  4K7N A;  4BL7 B;  2PBJ A;  2QA1 A;  4F0C A;  1O81 A;  4LLR A;  4PHZ C;  3GA4 A;  4HZ4 A;  4Q5N A;  5E59 A;  3DGQ A;  4IW9 A;  2L57 A;  5FT3 A;  1M3J A;  1OE7 A;  2UZ8 A;  1GP1 A;  3RPN A;  3Q6O A;  2R0P A;  4G0I A;  4YKG A;  2CZ2 A;  1GSF A;  1YZX A;  4L5L A;  4KX4 A;  3ZRD A;  3GHA A;  2WFC A;  4G19 A;  5J5N A;  5CRD A;  4EIQ A;  4AKX B;  2YWO A;  1A2M A;  2H6Y A;  1N2A A;  2VM2 A;  4ZBD A;  4JED A;  1A2J A;  1B9Y C;  4F0B A;  5G30 A;  3TJB A;  3QAV A;  1O8W A;  1S4B P;  4MF5 A;  5G5E A;  3VWX A;  3H4K A;  2H1B A;  2LRN A;  3BD2 A;  4YQU A;  2H73 A;  5J4U A;  4AJ7 A;  4MZB A;  1SK2 A;  2B5Y A;  4YH2 A;  2VLV A;  3U5R E;  4KUN A;  3GTU B;  2LST A;  2MMA A;  4IP6 A;  5ECN B;  4K5S A;  3J7Y b;  2B1L A;  5A34 A;  3UAP A;  5A4V A;  3C8E A;  2TRX A;  2DJ0 A;  3RHB A;  4KCA A;  4KND A;  2GVP A;  2H1G A;  5DQS A;  3NIV A;  2GQL A;  1ZCP A;  3J7Y k;  3ZVJ D;  4XS1 A;  4IQ1 A;  5AIS A;  3KP9 A;  4NXI A;  1SJ6 A;  1QGV A;  4FYU A;  3GN3 A;  3C1R A;  3GRX A;  19GS A;  1USB A;  5A5H B;  1J9B A;  3KXO A;  2CA8 A;  4YAV A;  3GKM A;  4K0N A;  1XWB A;  5GAP D;  4ZB7 A;  3EE2 A;  5AN1 A;  1SEN A;  3HD5 A;  4KB3 A;  3O6T A;  4N10 A;  4K8M A;  4G0K A;  2N5A A;  2GSQ A;  4ZXG A;  2VCZ A;  5CAX A;  2YZU A;  4D73 A;  3D22 A;  2HRK B;  4XS4 B;  2PU9 C;  1K3Y A;  1F37 A;  2YJ7 A;  1A23 A;  3HKR A;  9GSS A;  3QFA C;  2GQM A;  3GUS A;  3VK9 A;  3EYT A;  4XS6 A;  3W8S A;  4IKH A;  3CSI A;  5D96 A;  5D93 A;  4NV2 A;  4PI0 C;  1ZYN A;  2PGT A;  1GH2 A;  5B7C A;  2VL9 A;  3D4T A;  1YEW C;  4YKF A;  4KA0 A;  4HU9 A;  2B6M A;  1B4Q A;  1OC9 B;  4MLY A;  1THO A;  14GS A;  4DSR A;  4WF4 A;  4O92 A;  4N0V A;  2GQK A;  1K3L A;  5AIV A;  3V1W A;  3GX8 A;  2DJ1 A;  3M3M A;  3RAZ A;  1XXU A;  1Q98 A;  3QPM A;  4NV5 A;  4ID0 A;  2YOI A;  2JZR A;  1T4Y A;  1FAA A;  4XRD A;  4BIK A;  1X9S B;  4GSN A;  4POB A;  3C1S A;  1EOG A;  3EUR A;  3EU4 A;  2B5E A;  4PI2 C;  4AGS A;  3HDC A;  2V32 A;  2HZF A;  3LJR A;  3IPZ A;  3WGD A;  2H72 A;  4JRR A;  3HZ4 A;  5DJL A;  1YKA A;  2B1K A;  2VL2 C;  1GSE A;  3ISO A;  5H5R A;  2YCD A;  3M0F A;  3ZMK A;  3MWH A;  4O32 A;  1OAZ A;  5HR3 A;  2CZ3 A;  3GV1 A;  2YJH A;  2GTU A;  4QL7 A;  2O89 A;  2R37 A;  1T1V A;  1YF0 A;  1B48 A;  3MAK A;  5DAK A;  2HSM A;  4Z7X A;  2K8S A;  5IMZ A;  1XBS A;  4HJM A;  2F8A A;  3APQ A;  3APS A;  4IHU A;  5HR0 A;  2C0F A;  4TKY A;  3VWU A;  2OA7 A;  3UAR A;  5DJM A;  5A5H A;  1KEB A;  3LGC A;  2OJL A;  4N11 A;  3TJF A;  2DML A;  1JZR A;  1JZW A;  2H76 A;  2B3S A;  1TXX A;  3ZFL A;  3QCP A;  3KZQ A;  5DCH A;  3LQ7 A;  2OBI A;  4MJA A;  1V40 A;  3VFI A;  1FB0 A;  4JZQ A;  2O3E A;  4EE0 A;  3GSS A;  5BMU A;  4F03 A;  5DBQ A;  4MCU A;  3IXR A;  3ZIT A;  3DWV A;  4MAB A;  1PRX A;  2HRK A;  1A8Y A;  3ZFB A;  2OAD A;  2H19 A;  1JHB A;  1NSW A;  2H1A A;  1S3D A;  1E2Y A;  4GTU A;  4USS A;  4IP1 A;  2M80 A;  4BA7 A;  4BVY A;  1T00 A;  5GSS A;  1YDK A;  4HSC X;  5CRW A;  4K1F A;  3SBC A;  4NAX A;  2DIZ A;  3VWW A;  4JU5 A;  1YJ6 A;  2FWH A;  5CRH A;  2CV4 A;  4WR4 A;  4KCE A;  4ZIL A;  4MNN A;  1ACV A;  1ERV A;  1PX6 A;  2ZCT A;  1GTA A;  1X5D A;  2CVD A;  1BJX A;  3U6V A;  3ED3 A;  3EIN A;  3UBL A;  3DEX A;  1SVO A;  1M9A A;  3I69 A;  2O85 A;  2WW3 A;  4ACS A;  5COH A;  2HZE B;  2WJU A;  2WCI A;  5DAL B;  4MF6 A;  5JCW A;  5KEJ A;  2CX4 A;  5LCZ A; 
#chains in the Genus database with same CATH homology
 5EVO A;  2M72 A;  3VWV A;  4MJB A;  2AB6 A;  1QUW A;  13GS A;  1OYJ A;  2FWG A;  1Y25 A;  4XRA A;  3PR8 A;  2WUL A;  2R5G A;  5D9T A;  1HNA A;  5ECL B;  1EZK A;  4RUV A;  5DDL A;  4Z2T A;  1MD4 A;  3G7Y A;  2MMZ A;  2O7K A;  1XWG A;  6GSV A;  1FHE A;  2N5F A;  4ZB6 A;  1Z9H A;  2EC4 A;  2JZT A;  3TRQ A;  3CXG A;  4OFM A;  4MP4 A;  1ZGN A;  4KH7 A;  2PVQ A;  5IMC A;  2K18 A;  1ZOF A;  3DML A;  1AC1 A;  4YQV A;  5ECR B;  5KN1 A;  2DMM A;  3QAW A;  2VKZ G;  2IJY A;  5F0G A;  1SYX A;  1XIY A;  1XW9 A;  4IQA A;  4IBP A;  5IMD A;  4EVM A;  2VCV A;  4FIW A;  3GYK A;  4K0G A;  4WKW A;  3FZ5 A;  1SJZ A;  3LG6 A;  1BF5 A;  3M8N A;  5KOW A;  1B9X C;  5IO0 A;  2GGT A;  2KLX A;  3TRX A;  3GMF A;  3WT1 A;  2YN1 A;  3DD3 A;  11GS A;  4HQZ A;  5EPF A;  2E7P A;  2H01 A;  3IR4 A;  3IHG A;  4PGT A;  1ST9 A;  5DVB A;  3L0H A;  1LJR A;  4Q5R A;  4PNG A;  3QAG A;  4NHZ A;  1FB6 A;  3PGT A;  1WWJ A;  3HXS A;  2IFQ B;  4EKZ A;  3SWL A;  2DLX A;  2AAW A;  2L5O A;  3M9J A;  4QL9 A;  4AKG A;  1ERT A;  3QFB C;  2HE3 A;  2L6D A;  4TR1 A;  4GWR A;  5IQY A;  4L0U A;  1O7U A;  1EEM A;  4TOP A;  1SD8 A;  5KN0 A;  2QSI A;  4ZBA A;  3VUR A;  4IN0 A;  2H66 A;  5EL8 A;  4WET A;  3F9U A;  4TRX A;  4HDE A;  2IMK A;  2B7J A;  2WZ9 A;  4I8B A;  5ECO B;  1K0B A;  4OMV A;  3TKS C;  3FKF A;  2HRN A;  2QA2 A;  8GSS A;  4J2F A;  5H5S A;  4F82 A;  5ENU A;  4BVX A;  1PKZ A;  3E3E A;  2HNL A;  3Q18 A;  4PTS A;  3G7I A;  3D0Z A;  2HSH A;  3WGE A;  2LNT A;  3QR6 A;  1TDI A;  2A2R A;  3APO A;  4BWQ A;  1V9W A;  4K2D A;  3Q19 A;  1UN2 A;  5AIX A;  1MTC A;  1TP9 A;  3LXZ A;  3LW9 A;  2FWE A;  6GSU A;  4MA9 A;  3HVX A;  4K2X A;  1VF2 A;  4GST A;  4BWS A;  1M9B A;  3KJY A;  4HI7 A;  1ML6 A;  5G2Z A;  5A5K A;  2CAI A;  1YY7 A;  1AIU A;  2LKU A;  1V2A A;  1T7P B;  3CSJ A;  1YVL A;  3KGK A;  1WMJ A;  3L78 A;  3UEM A;  2J9H A;  4ZL7 A;  2LEG A;  6GSY A;  1RW1 A;  4Q5Q A;  1NHY A;  5FWG A;  4CY6 A;  4PQI A;  4KE3 A;  5ID2 B;  1QMV A;  1BAY A;  1DE1 A;  1M2D A;  1OKT A;  4I5Q A;  18GS A;  4FYC A;  4GDF A;  1T3B A;  2MYG A;  2GZZ A;  3PIN A;  1R5P A;  4ZB8 A;  3FW2 A;  4OWY A;  2I81 A;  2IWT A;  1W4V A;  2VCQ A;  2XBI A;  1A0F A;  2IMI A;  1AQX A;  5L71 A;  5C04 A;  5F8B A;  1TRU A;  1SYR A;  2X8C A;  3H8Q A;  3VPT A;  4AI6 A;  2L5L A;  2WGR A;  3DKS A;  7GSS A;  4P3Y B;  4AKI A;  5A4U A;  2LRC A;  3F6F A;  2R0G A;  2B7K A;  5HR2 A;  1OC8 A;  3EVI A;  5HFK A;  4IJ3 A;  1XWA A;  2JAD A;  4EIP A;  5ECQ B;  2C3Q A;  1YKC A;  5IMV A;  4EXJ A;  2L6C A;  2VLT A;  3GUR A;  4F9Z A;  2LNS A;  4HU7 A;  1JLW A;  3TGZ A;  3Q74 A;  5B8A A;  4POM A;  3ZYW A;  4MPG A;  5JCG A;  2PER A;  5EY6 A;  3JCM L;  3IAS 2;  5D9X A;  3TB2 A;  1IYI A;  2D2Z A;  1AUC A;  2DKI A;  5LD0 A;  2A2P A;  1BG5 A;  2CQ9 A;  4GLT A;  6GSS A;  3TOT A;  4ULX A;  1SU9 A;  1G7O A;  2I9H A;  2AHE A;  2RLI A;  1N25 A;  2JSY A;  5ECP B;  4TW5 A;  3R3E A;  3FR9 A;  3P2A A;  5G5F A;  1WP0 A;  3HJO A;  1S3C A;  2HSN B;  2IME A;  3QMX A;  2DKH A;  2PUK C;  5HFG A;  4MMM A;  1TRV A;  4KDX A;  4GQF A;  2J23 A;  2X99 A;  3FY7 A;  1U3A A;  4AKH A;  2LV3 A;  1K0D A;  2OT3 A;  4BL7 A;  3GIX A;  1DUG A;  1XW6 A;  1XPV A;  2Z9S A;  1FOV A;  3QD9 A;  3HJM A;  1ZL9 A;  5CP1 A;  4AF2 A;  2VD0 A;  4AJ8 A;  1GSU A;  3GNJ A;  1URM A;  1TRW A;  2WDU A;  1SK0 A;  3L9V A;  2FA8 A;  3H79 A;  4L0W A;  3QOU A;  1SVL A;  5KN2 A;  1WE0 A;  5J41 A;  4WBR D;  1XWC A;  4ZBB A;  2LTK A;  6GSX A;  2LQQ A;  4K9Z A;  4ECB A;  2C0G A;  2ZUP A;  2EIR A;  4MF7 A;  3HHV A;  5HQP A;  1U3I A;  1R26 A;  3WD6 A;  3HA9 A;  3MDK A;  2ES7 A;  2V6O A;  1A8L A;  4DSS B;  1BQ7 A;  1F9M A;  4OO5 A;  1O6J A;  1SL0 B;  3FMW A;  3GTU A;  3O3T A;  1GNW A;  5JWO B;  1FVJ A;  3LEF A;  2V41 A;  4Q5F A;  1TK8 B;  4KSO A;  5BRT A;  2R0C A;  3CRU A;  2PPT A;  2C4J A;  3UIW A;  4GRF A;  1XOB A;  1A2L A;  2WRT A;  1TK5 B;  2C3N A;  1A0R P;  4A5P A;  2IMD A;  2NDO A;  1AQW A;  1ERW A;  4QQ7 A;  1FW1 A;  5E4W A;  1GSD A;  1BG1 A;  2VIM A;  1NM3 A;  3TOU A;  1Y1U A;  5IMF A;  3KMN A;  3HYP A;  1DBY A;  2H0I A;  1Z3E A;  2R3X A;  2XBQ A;  3IRA A;  4LMV A;  4IVF A;  3D6I A;  1EGR A;  1I9D A;  3CMI A;  3GX0 A;  2E2G A;  4YQM A;  3UJ1 A;  5J3R A;  2O8V B;  4XS4 A;  3F4S A;  2OE3 A;  3M9K A;  3CYN A;  4GSS A;  2RII A;  5ECH B;  1ZYE A;  4Z2R A;  1TRS A;  2OAC A;  5GZZ B;  3ZRE A;  2F8F A;  3W8J A;  4NMU A;  1C72 A;  3FHK A;  1GTI A;  2RUE A;  5IMA A;  2HXK A;  1MDK A;  4ZIJ A;  4OCF A;  3D5J A;  4FYB A;  2OE0 A;  4WBJ A;  4FH8 A;  3UOM A;  3G7J A;  1O73 A;  2LJA A;  5IOW A;  3RBT A;  1OC9 A;  1F2E A;  2N5B A;  4XCS A;  3IDV A;  1OE8 A;  1J08 A;  1PL1 A;  1TI1 A;  2CX3 A;  1MEK A;  4WXT A;  2RUF A;  3E0U A;  1R4W A;  1A24 A;  4PX1 A;  1GTB A;  3VI5 A;  1MDJ A;  2HFD A;  4ICY A;  3HMJ G;  3EU3 A;  2FNO A;  2QKE A;  2ZNM A;  5INY A;  2EIQ A;  2REM A;  1NW2 A;  2H6Z A;  2NVL A;  2XPD A;  1FG4 A;  2V1M A;  2JZS A;  3KTL A;  3IE3 A;  1TXU A;  4E8E A;  1TOF A;  3EC3 A;  3F8U A;  3C7M A;  5CNW A;  1M99 A;  2I3Y A;  2IMF A;  3I9V 2;  3US3 A;  1K0A A;  5ABR A;  4MH2 A;  4EDZ A;  5B6N A;  3KD0 A;  3I43 A;  1ZZY A;  3MIX A;  1Z6N A;  3F3R A;  4CY8 A;  4ECC A;  1FO5 A;  2YAN A;  3CTG A;  3WYW A;  3KIJ A;  3TJJ A;  1N8J A;  1QK8 A;  3L4N A;  1TI3 A;  1GUM A;  1XVW A;  1U87 A;  4GF0 A;  3KH9 A;  4CW9 A;  2H1D A;  2C1Y A;  4OO4 A;  4ECJ A;  2K6V A;  4YAP A;  1PL2 A;  2LJK A;  4ISD A;  3HVV A;  1GLQ A;  2FHE A;  2E0Q A;  5D9W A;  3R2Q A;  2P5Q A;  2VCT A;  3A2V A;  4DEJ A;  4MZC A;  3UMA A;  2VL2 A;  4OCE A;  1KBN A;  1TW9 A;  2H1L A;  4IEL A;  4XHM A;  4BPY A;  4PQH A;  4PXO A;  3HCZ A;  2EFC A;  4G0L A;  3UBK A;  1XOA A;  1U6T A;  3TRP A;  3GH6 A;  6GSW A;  4AJ6 A;  5A1N B;  4V2N A;  1VGL A;  4KAE A;  12GS A;  2NBS A;  2GSR A;  3KEB A;  3DVX A;  2KUC A;  3F0I A;  5A34 B;  4TXO B;  1CQH A;  5LNK e;  5D9V A;  4RQR A;  4HOJ A;  2HT9 A;  2PWJ A;  1IYH A;  2ON7 A;  5ECK B;  1G7E A;  2VD1 A;  5C00 A;  4O7H A;  1K0C A;  2AUV A;  2O87 A;  4JR4 A;  4CDO A;  4MJC A;  1JZO A;  2EIO A;  3N9J A;  2A2S A;  1XZO A;  4NHW A;  4L8E A;  5IO2 A;  2DJK A;  2OE1 A;  4OD7 A;  2IIY A;  5A4W A;  3HY2 A;  2K9F A;  3DXB A;  1SKW B;  4LL4 B;  3W6G A;  1BED A;  4PNF A;  2BTO T;  4CHS A;  1M2B A;  1PN9 A;  3NOF A;  1HNB A;  3CRT A;  4JE1 A;  4I97 A;  20GS A;  3A5I A;  1XWK A;  3FEU A;  2HLS A;  2VOC A;  2HZE A;  3TDG A;  5DAL A;  3EMP A;  1ZYP A;  5CYY A;  4RI6 A;  4HUA A;  4PUF C;  1XCC A;  3BOA A;  4HQS A;  3O76 A;  3CTF A;  2YV7 A;  2QC7 A;  4ZL9 A;  3F6D A;  5G31 A;  5F07 A;  3F3Q A;  2FLS A;  2MBS A;  1T8E B;  1TK0 B;  3ZL5 A;  3ME7 A;  4POK A;  2GS3 A;  3QDN A;  4N3Z A;  2H8L A;  4OFN A;  4KDU A;  4V2L A;  22GS A;  3IK9 A;  2VO4 A;  1K0M A;  5J9C A;  1TU8 A;  1EGO A;  3MYD A;  4EC0 A;  3GH9 A;  2PVO C;  3GKK A;  4J57 E;  1EV9 A;  3LYK A;  1YQ1 A;  1M7T A;  1G6Y A;  2ALB A;  1J0F A;  4NPB A;  2WS2 A;  4PUR A;  1UA5 A;  2PMT A;  3IA1 A;  1OVN A;  2YZH A;  3DVW A;  4ML6 A;  1B4P A;  1OKD A;  1SK1 A;  2P5R A;  1F6M C;  4HEA 2;  1GTU A;  2G2Q A;  2AJQ B;  5A1N A;  3VPQ A;  1Z5Y E;  1GSY A;  1R5A A;  4G10 A;  3VI7 A;  2HRA A;  2DJJ A;  2BMX A;  2FCH A;  3UVH A;  3IC8 A;  4TXO A;  5DAK B;  3GL3 A;  2P31 A;  3LSZ A;  2HSM B;  2FD3 A;  4KGI A;  4I6X A;  5ECM B;  4TVE A;  2YV9 A;  1RK4 A;  1X9W B;  4ZL8 A;  3RDW A;  2IFQ A;  3FYG A;  1ON4 A;  5FHI A;  3IAM 2;  3A3T A;  2LS5 A;  1CQG A;  1TJD A;  4FO5 A;  3F4T A;  4O5Q A;  2HI7 A;  4JBB A;  3HZ8 A;  4JR6 A;  1LBK A;  3WT2 A;  4L5O A;  2L4Q A;  3C73 A;  2I1U A;  5ELA A;  5BMU B;  2CAQ A;  3P7X A;  1HNC A;  1JFU A;  3UL3 A;  2X64 A;  3P90 A;  4EF0 A;  1EV4 A;  2RM5 A;  2F51 A;  1T4Z A;  1QFN A;  2GLR A;  5JWR B;  3LXT A;  5ECI B;  2JL4 A;  2C8U A;  2MMO A;  2ON5 A;  3DIE A;  5GAN D;  3TCO A;  4BVY B;  1THX A;  3TKS E;  1LU4 A;  3LOR A;  1TKD B;  2JSZ A;  4LMW A;  4O5U A;  1Z6M A;  1PX7 A;  1GLP A;  3TKS A;  1BX9 A;  1V57 A;  2VM1 A;  1H4O A;  2MZC A;  5AGY A;  2GST A;  3KP8 A;  3P8W A;  1PQN A;  2VCX A;  2VL3 A;  5B8B A;  4HJ2 A;  4TN8 A;  1XVQ A;  5KN3 A;  2R4V A;  1EEJ A;  3EWL A;  1GWC A;  3G9B A;  2UV8 G;  3ME8 A;  2MBT A;  3NZN A;  1E6B A;  1V98 A;  1HYU A;  1ZYQ B;  4NWY A;  4N30 A;  5F05 A;  1WPI A;  3ZTL A;  3CSH A;  5IPG A;  5ID2 A;  1VRS D;  3D4M A;  2L4C A;  1X9M B;  3F4R A;  2GSS A;  2LJR A;  1XFL A;  4GXZ A;  2G0F A;  1ILO A;  3FR3 A;  1DSB A;  1X5E A;  1ERU A;  5CRG A;  4GQC A;  4E8H A;  2M46 A;  1PSQ A;  5J9B A;  3ZIJ A;  2YNX A;  1PKW A;  4LA1 A;  3ZZX A;  1ABA A;  2CVK A;  4G9H A;  4K7O A;  1HQO A;  5J47 A;  2FGX A;  2H0G A;  3ZVJ A;  2VCW A;  3ERG A;  3HJP A;  5ECS A;  1PA3 A;  5CRE A;  4GCI A;  4EL1 A;  3L9S A;  4K6X A;  2H71 A;  1GSQ A;  3H1N A;  3WGX A;  1SD9 A;  5DQY A;  1SL2 B;  1K3O A;  3LYP A;  1EP7 A;  3N5O A;  2DIY A;  1GL8 A;  3D21 A;  4HZ2 A;  1R7H A;  4KF9 A;  3FZ4 A;  2E2M A;  4LL1 B;  3GFK A;  1YEP A;  3PPU A;  1TU7 A;  2H74 A;  1FVK A;  1X5C A;  3LWA A;  4MDC A;  2YWI A;  5JWQ B;  4V2M A;  4Z2U A;  2RM6 A;  3S9F A;  5D73 A;  1K0N A;  3TKQ A;  5CO3 A;  5F06 A;  3A2W A;  5IIZ A;  4W66 A;  4IJI A;  2V6K A;  2GZP A;  2I4A A;  1FOH A;  1QQ2 A;  2AYT A;  2K8V A;  2IPA A;  2OKA A;  1EWX A;  2F3M A;  4MJE A;  2C80 A;  1YEX A;  4TR0 A;  2YWM A;  1SL1 B;  1EP8 A;  2C0E A;  4DVC A;  1SKR B;  1KNG A;  2H70 A;  4X43 A;  2X8G A;  1O85 A;  4IS0 A;  2HSN A;  3DRN A;  1PD2 1;  5D8I A;  2DJ3 A;  2OBK A;  2KP1 A;  2HYX A;  5KOX A;  4RQX A;  2LRT A;  2QGV A;  1SVM A;  2TIR A;  3GL5 A;  2HQT A;  5ELG A;  2EFD A;  4TR1 B;  1PGT A;  3E9J B;  4X1U A;  2A4V A;  5JCU A;  4ILF A;  3ZLP A;  2GZY A;  3TKR A;  2O5V A;  3BJ5 A;  3GKX A;  3EPT A;  4MK3 A;  1RQM A;  3IV4 A;  4X0X A;  5G1K A;  3TJK A;  1WIK A;  3KMO A;  1AW9 A;  4X4J A;  1W89 A;  1GUK A;  4QMK A;  1GSS A;  3KCM A;  3MSZ A;  4KSM A;  4XIH A;  1ZMA A;  2EFE A;  3FZA A;  1WOU A;  2YP6 A;  4V1A g;  3IBH A;  2R6K A;  5B6M A;  6GST A;  2WB9 A;  1UVZ A;  5IPH A;  1JZD A;  4E68 A;  4WF5 A;  3CBU A;  4WEY A;  3CWG A;  4EDY A;  1PN0 A;  3LFL A;  4N0Z A;  4BVX B;  2NTO A;  4I2U A;  2GDR A;  2KHP A;  2H0H A;  1AQV A;  1AAZ A;  1M2A A;  4F2I A;  5J40 A;  1F3A A;  3DYR A;  3KTB A;  2HRF A;  2DSA A;  3ERW A;  2FA4 A;  2X4A A;  2X8H A;  1M0U A;  1SKS B;  3IK7 A;  4H86 A;  2DJ2 A;  2GT5 A;  5G1L A;  1Y6E A;  4FQU A;  1PMT A;  1QXH A;  1U88 A;  3IC4 A;  1O8X A;  4DSS A;  2IL3 A;  1B8X A;  1KTE A;  4POL A;  2MMN A;  1AXD A;  2H30 A;  4G01 A;  5HR1 A;  2VLU A;  2LUS A;  1X0R A;  3BBY A;  2GT6 A;  2DBC A;  3AY8 A;  4V1A p;  4KDY A;  1JLV A;  4ML1 A;  2YPM A;  2NPB A;  3TJG A;  1I5G A;  3TKP A;  3BCI A;  4TR4 A;  3M1G A;  4HS1 A;  1XW5 A;  4K5R A;  3FZ9 A;  3I6A A;  2C3T A;  4J56 E;  1NHO A;  1Z7P A;  2A4H A;  3HVS A;  2V2G A;  3IHQ A;  1MDI A;  2XPE A;  3K8N A;  3PH9 A;  3C71 A;  1VF1 A;  5HFI A;  4OFT A;  4ZB9 A;  2TRC P;  1GUH A;  5H5Q A;  3F63 A;  1YF1 A;  1S3A A;  2FUG 2;  2XHF A;  2DC5 A;  2EFH A;  1OC3 A;  1MD3 A;  2CT6 A;  3GST A;  2B5X A;  1F3B A;  3MNG A;  1TTZ A;  3FK8 A;  1UC7 A;  3ZIV A;  3L9U A;  4MPF A;  4RI7 A;  3EMX A;  3RHC A;  1Q4J A;  2L59 A;  4WR5 A;  4XTS A;  3A5W A;  3KM6 A;  1G6W A;  3TU3 B;  2H6X A;  5IOX A;  3FRC A;  4DSQ A;  3H93 A;  1V58 A;  2BJX A;  2R2J A;  1WRY A;  3TUE A;  2FWF A;  5IM9 A;  2JAC A;  5J4V A;  5GST A;  4PQ1 A;  2C0D A;  1Z7R A;  3KH7 A;  4G2E A;  3IOS A;  2VUP A;  1H75 A;  3GKN A;  1VF3 A;  4ECI A;  4IGJ A;  2H75 A;  2P0G A;  1DE2 A;  3UVT A;  1BYE A;  5J4Y A;  4D73 B;  2AV4 A;  17GS A;  3VLN A;  1VF4 A;  4TXV A;  3RPP A;  2IN3 A;  2JU5 A;  2YWN A;  3FR6 A;  3OR5 A;  4MH3 A;  1GNE A;  1EOH A;  16GS A;  2F9S A;  1GUL A;  2PN8 A;  4KW6 A;  4O5R A;  5DCG A;  3A2X A;  1HD2 A;  3BCK A;  2HSY A;  2XC2 A;  1WJK A;  4I2T A;  2LQO A;  4MZW A;  1G0T A;  2VAF A;  1K0O A;  1GRX A;  2FY6 A;  2X49 A;  4K7I A;  4PUA A;  2KOK A;  2CVB A;  3ZML A;  3ERF A;  1SJI A;  4TR3 A;  10GS A;  4EO3 A;  4EUY A;  2KP2 A;  4K7N A;  4BL7 B;  2PBJ A;  2QA1 A;  4F0C A;  1O81 A;  4LLR A;  3GA4 A;  4HZ4 A;  4Q5N A;  5E59 A;  3DGQ A;  4IW9 A;  2L57 A;  5FT3 A;  1OE7 A;  2UZ8 A;  1GP1 A;  3RPN A;  3Q6O A;  2R0P A;  4G0I A;  4YKG A;  2CZ2 A;  1GSF A;  1YZX A;  4L5L A;  4KX4 A;  3ZRD A;  3GHA A;  2WFC A;  4G19 A;  5J5N A;  5CRD A;  4EIQ A;  4AKX B;  2YWO A;  1A2M A;  2H6Y A;  1N2A A;  2VM2 A;  4ZBD A;  4JED A;  1A2J A;  1B9Y C;  4F0B A;  5G30 A;  3TJB A;  3QAV A;  1O8W A;  4MF5 A;  5G5E A;  3VWX A;  3H4K A;  2H1B A;  2LRN A;  3BD2 A;  4YQU A;  2H73 A;  5J4U A;  4AJ7 A;  4MZB A;  1SK2 A;  2B5Y A;  4YH2 A;  2VLV A;  3U5R E;  4KUN A;  3GTU B;  2LST A;  2MMA A;  4IP6 A;  5ECN B;  4K5S A;  3J7Y b;  2B1L A;  5A34 A;  3UAP A;  5A4V A;  3C8E A;  2TRX A;  2DJ0 A;  3RHB A;  4KCA A;  4KND A;  2GVP A;  2H1G A;  5DQS A;  3NIV A;  2GQL A;  1ZCP A;  3J7Y k;  3ZVJ D;  4XS1 A;  4IQ1 A;  5AIS A;  3KP9 A;  4NXI A;  1SJ6 A;  1QGV A;  4FYU A;  3GN3 A;  3C1R A;  3GRX A;  19GS A;  1USB A;  5A5H B;  1J9B A;  3KXO A;  2CA8 A;  4YAV A;  3GKM A;  4K0N A;  1XWB A;  5GAP D;  4ZB7 A;  3EE2 A;  5AN1 A;  1SEN A;  3HD5 A;  4KB3 A;  3O6T A;  4N10 A;  4K8M A;  4G0K A;  2N5A A;  2GSQ A;  4ZXG A;  2VCZ A;  5CAX A;  2YZU A;  4D73 A;  3D22 A;  2HRK B;  4XS4 B;  2PU9 C;  1K3Y A;  1F37 A;  2YJ7 A;  1A23 A;  3HKR A;  9GSS A;  3QFA C;  2GQM A;  3GUS A;  3VK9 A;  3EYT A;  4XS6 A;  3W8S A;  4IKH A;  3CSI A;  5D96 A;  5D93 A;  4NV2 A;  1ZYN A;  2PGT A;  1GH2 A;  5B7C A;  2VL9 A;  3D4T A;  4YKF A;  4KA0 A;  4HU9 A;  2B6M A;  1B4Q A;  1OC9 B;  4MLY A;  1THO A;  14GS A;  4DSR A;  4WF4 A;  4O92 A;  4N0V A;  2GQK A;  1K3L A;  5AIV A;  3V1W A;  3GX8 A;  2DJ1 A;  3M3M A;  3RAZ A;  1XXU A;  1Q98 A;  3QPM A;  4NV5 A;  4ID0 A;  2YOI A;  2JZR A;  1T4Y A;  1FAA A;  4XRD A;  1X9S B;  4GSN A;  4POB A;  3C1S A;  1EOG A;  3EUR A;  3EU4 A;  2B5E A;  4AGS A;  3HDC A;  2V32 A;  2HZF A;  3LJR A;  3IPZ A;  3WGD A;  2H72 A;  4JRR A;  3HZ4 A;  5DJL A;  1YKA A;  2B1K A;  2VL2 C;  1GSE A;  3ISO A;  5H5R A;  2YCD A;  3M0F A;  3ZMK A;  3MWH A;  4O32 A;  1OAZ A;  5HR3 A;  2CZ3 A;  3GV1 A;  2YJH A;  2GTU A;  4QL7 A;  2O89 A;  2R37 A;  1T1V A;  1YF0 A;  1B48 A;  3MAK A;  5DAK A;  2HSM A;  4Z7X A;  2K8S A;  5IMZ A;  1XBS A;  4HJM A;  2F8A A;  3APQ A;  3APS A;  4IHU A;  5HR0 A;  2C0F A;  4TKY A;  3VWU A;  2OA7 A;  3UAR A;  5DJM A;  5A5H A;  1KEB A;  3LGC A;  2OJL A;  4N11 A;  3TJF A;  2DML A;  1JZR A;  1JZW A;  2H76 A;  2B3S A;  1TXX A;  3ZFL A;  3QCP A;  3KZQ A;  5DCH A;  3LQ7 A;  2OBI A;  4MJA A;  1V40 A;  3VFI A;  1FB0 A;  4JZQ A;  4EE0 A;  3GSS A;  5BMU A;  4F03 A;  5DBQ A;  4MCU A;  3IXR A;  3ZIT A;  3DWV A;  4MAB A;  1PRX A;  2HRK A;  1A8Y A;  3ZFB A;  2OAD A;  2H19 A;  1JHB A;  1NSW A;  2H1A A;  1S3D A;  1E2Y A;  4GTU A;  4USS A;  4IP1 A;  2M80 A;  4BA7 A;  4BVY A;  1T00 A;  5GSS A;  1YDK A;  5CRW A;  4K1F A;  3SBC A;  4NAX A;  2DIZ A;  3VWW A;  4JU5 A;  1YJ6 A;  2FWH A;  5CRH A;  2CV4 A;  4WR4 A;  4KCE A;  4ZIL A;  4MNN A;  1ACV A;  1ERV A;  1PX6 A;  2ZCT A;  1GTA A;  1X5D A;  2CVD A;  1BJX A;  3U6V A;  3ED3 A;  3EIN A;  3UBL A;  3DEX A;  1SVO A;  1M9A A;  3I69 A;  2O85 A;  4ACS A;  5COH A;  2HZE B;  2WJU A;  2WCI A;  5DAL B;  4MF6 A;  5JCW A;  5KEJ A;  2CX4 A;  5LCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...