2VD0A

Complex structure of prostaglandin d2 synthase at 2.2a.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE-REQUIRING PROSTAGLANDIN D SYNTHASE
publication title Novel Prostaglandin D Synthase Inhibitors Generated by Fragment-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vd0A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vd0A01
1S3AA 3HYPA 5F05A 3IA1A 5CRGA 6GSSA 3HCZA 5B7CA 1A8LA 1TK5B 17GSA 2H70A 1RW1A 5CRWA 5ECPB 1AQWA 3MWHA 4JRRA 2LNSA 3IRAA 2MMZA 4GLTA 4JZQA 5DAKB 1W4VA 4XIHA 3VURA 1X5DA 2REMA 4PX1A 2GT5A 4WR4A 4K6XA 1BJXA 1VF2A 1J9BA 2NBSA 4MJEA 3TOTA 1EOGA 5D9XA 1A0RP 4GRFA 4IVFA 2IIYA 5A5KA 18GSA 5G1LA 2C0DA 1V57A 2IWTA 2TIRA 2OE3A 3H8QA 4PGTA 4XTSA 3RPNA 2XBQA 3ZREA 1VF1A 3D4MA 2BJXA 5GZZB 1SJIA 1FAAA 4KX4A 5CRDA 2C3TA 3Q6OA 3EYTA 4WKWA 3U6VA 2HT9A 1G7OA 2DJKA 2VCVA 2I1UA 5F0GA 5KN0A 2X8GA 5ECLB 2RIIA 1G6WA 5D93A 4ZBAA 4CHSA 3L9VA 3QAVA 3VWVA 4K0GA 2K8SA 1FB0A 2YZHA 2PMTA 1I5GA 5ECSA 3GA4A 4KSMA 4I2TA 3VI5A 2H66A 1SD8A 3FRCA 1MDJA 1WP0A 3US3A 2H71A 4K2DA 3UL3A 1TRSA 3KEBA 4EXJA 1PD21 4TN8A 4FIWA 3ZVJD 4TR4A 1GWCA 4G0KA 2O87A 3C71A 2OE1A 5IM9A 4XS4A 1GUMA 4G19A 4TXOB 5HFIA 5KN1A 2PGTA 5DJLA 1K0NA 5BMUA 1XWCA 2HLSA 1W89A 2DSAA 2VM2A 3HXSA 3DXBA 1WMJA 3D5JA 5IMDA 3D4TA 1F37A 1HNCA 8GSSA 1M2DA 3H79A 3TDGA 7GSSA 2HI7A 2OACA 3MSZA 3GTUA 5ECHB 2YWMA 4OCEA 2H19A 4V1Ag 4ECCA 5C04A 1R26A 5D8IA 2R6KA 3FZAA 2B5XA 2WULA 1TU8A 1Z7RA 2A2RA 3BCIA 1QK8A 3DRNA 2DBCA 2MBSA 1FB6A 3UIWA 2YWOA 3APOA 2FUG2 2VLUA 3I6AA 2A4VA 1MDKA 4FYBA 4IN0A 2DMMA 3IBHA 1XWBA 1OC9A 1V2AA 3IK9A 3D22A 1T4YA 1IYIA 4EF0A 3ZFBA 1Z6NA 1FVKA 3KH9A 2G0FA 4PUAA 3TCOA 5IMVA 4Q5RA 1CQGA 2RM5A 3F4RA 3Q19A 4F82A 1EGRA 1AIUA 1TTZA 4D73A 5IPGA 3TJFA 3ZL5A 2YV9A 2JADA 3KM6A 2R37A 3W8JA 2L5LA 4V2LA 3D21A 4YAVA 2R2JA 2HE3A 3MDKA 4HEA2 2V32A 2PPTA 2XHFA 3VPTA 2GZZA 4MPGA 2PUKC 5CP1A 3TUEA 3ME8A 4DVCA 3H4KA 2HXKA 2M46A 4Z7XA 1Q98A 3AY8A 4ZL9A 5F8BA 3TRPA 3J7Yb 1FVJA 1TU7A 2VCQA 2H75A 2AUVA 5HR3A 1WWJA 3GURA 2H73A 3TRXA 4YQUA 1HNBA 3WD6A 4DSQA 4KDUA 5ECQB 3EU4A 4V1Ap 2CVDA 4IP1A 1ZYEA 2MBTA 9GSSA 2JZRA 1A24A 1HD2A 4ULXA 4I8BA 1BYEA 4MF7A 3GKXA 4BWSA 3ZVJA 2YN1A 3BOAA 1SD9A 1IYHA 2KP2A 1EP7A 4Q5FA 3GH6A 1X9SB 2NPBA 4LA1A 1WJKA 2K6VA 1H75A 2ES7A 3GN3A 2CA8A 2ZNMA 3G7JA 3FR3A 2DLXA 2JZSA 4MJBA 2VL9A 3M8NA 2KUCA 1XWAA 2XBIA 4XCSA 1R4WA 1U87A 1O8XA 2LEGA 3KH7A 1PMTA 5D73A 1F9MA 3ZMKA 5DJMA 2CAIA 1O6JA 1MEKA 2F51A 2MMAA 1B4QA 2B7JA 3M0FA 3K8NA 1GSDA 5IPHA 3ED3A 2JSYA 1M7TA 4XRAA 3FZ4A 1YEXA 1DUGA 2DJJA 1AAZA 3ZIVA 1CQHA 6GSTA 3GFKA 4MF5A 4HI7A 2VL2C 4HZ4A 3TKPA 4G0LA 1AQXA 4EO3A 3C1SA 5JWQB 2HRKA 2B1LA 2C8UA 3KXOA 2YWNA 5IMCA 5B6NA 4E8EA 4KW6A 3HJPA 4JEDA 4POBA 3DWVA 1OC8A 4YAPA 2HSMA 2VCXA 3BCKA 3HD5A 1SU9A 2A2SA 3EC3A 2H1AA 4NWYA 11GSA 2PVOC 3F63A 4XS6A 1XW5A 1M9BA 4BPYA 1ST9A 2FNOA 3EE2A 3M3MA 1SK1A 1SKWB 5INYA 1S3CA 1G7EA 3JCML 3C73A 2VM1A 1NHYA 3LXZA 1KBNA 1B9XC 1VRSD 4DSRA 5JCGA 1UA5A 2DIZA 1PGTA 1ZCPA 2YJ7A 1EEJA 4BL7B 2LRNA 6GSUA 2GQKA 1TJDA 2B5EA 4EC0A 5H5QA 3PR8A 2CZ2A 2C0FA 4P3YB 1H4OA 19GSA 3GSTA 5CAXA 2FCHA 6GSWA 3RAZA 3GKNA 1GSQA 3LYPA 1ZGNA 2R4VA 3FR6A 1G6YA 5CRHA 4QQ7A 4BVXA 3QDNA 3LG6A 3UBLA 2FWGA 5J41A 1M99A 3LEFA 5IQYA 2ALBA 2H76A 2WZ9A 1O8WA 4BWQA 1A23A 1AQVA 2K18A 3E0UA 1MDIA 4K7OA 4MZWA 5IOWA 1TP9A 1OE8A 5DQYA 2P5RA 3ZZXA 4J56E 3P2AA 1A2LA 1UC7A 2H01A 2X8CA 2IFQA 5COHA 1K0MA 1U3IA 3F6DA 1PKWA 3GL5A 1WOUA 1ERTA 2GSQA 2C80A 4O7HA 1F3BA 3CTFA 4ZIJA 5LNKe 2VCZA 4MABA 2LQQA 5A4UA 4JR6A 3BD2A 4EL1A 3NOFA 1KTEA 2GQMA 1K0BA 5B6MA 3DMLA 4IQAA 2JZTA 4FYUA 2F9SA 4USSA 1B9YC 3WGEA 3GKKA 1GSFA 3GKMA 5FHIA 3KTLA 3NZNA 5HR1A 2O8VB 4K9ZA 3P90A 1WRYA 2H6XA 4V2MA 1VGLA 1K3LA 2FA4A 2X64A 4ZXGA 4G0IA 1BQ7A 5ECRB 2K9FA 3C1RA 3DD3A 2LUSA 1OKDA 1DE2A 3PINA 4MH3A 1J0FA 1GSEA 4ZB9A 2DJ0A 5G30A 4WBRD 2XPDA 1X9MB 1OC3A 4EVMA 4KB3A 4IW9A 3UJ1A 2I3YA 6GSXA 4ZBBA 1FHEA 2FWEA 2OADA 3PH9A 4KGIA 4F9ZA 2L57A 1PA3A 4YH2A 5ID2A 3UARA 4GF0A 2CQ9A 4MLYA 1YQ1A 3L9UA 2YPMA 1QFNA 4DSSA 3GX8A 2B7KA 3G7YA 4TR0A 2M72A 1Y25A 2HSYA 3BBYA 5IO2A 2VIMA 4L0WA 3FK8A 2K8VA 4F2IA 4HZ2A 1WIKA 2H0GA 1PX6A 5CO3A 1X5EA 3LXTA 5G2ZA 1F2EA 2JACA 4WF4A 1AW9A 5D96A 4EDYA 1ZZYA 2YZUA 4HJMA 1NHOA 2H74A 2JSZA 3FYGA 2YNXA 4TW5A 3LGCA 4TR1A 4K8MA 2CVKA 1ZOFA 1GTIA 4XS4B 3DKSA 1RQMA 3LSZA 3Q74A 2CZ3A 3F8UA 2PN8A 3ZFLA 3V1WA 4KNDA 2H0IA 2LTKA 4F03A 1HQOA 2O7KA 1FO5A 3FZ5A 2L4QA 1THOA 2LSTA 5FT3A 1V98A 3F6FA 3A2XA 1PN9A 2BTOT 2F8FA 1UN2A 2N5FA 4XS1A 3DVXA 3UVTA 4IS0A 5J4UA 1JLVA 2TRCP 1TW9A 4L5OA 5CREA 3GTUB 2GTUA 4POLA 1M9AA 10GSA 2QC7A 2LRCA 2B5YA 2WJUA 3KTBA 5DVBA 1EOHA 1PL2A 1XXUA 3DEXA 1Z6MA 3WT2A 4RI7A 3C8EA 1GNEA 1DSBA 4NV2A 3F3QA 3KGKA 4CW9A 1LBKA 1OC9B 3GV1A 4JU5A 1K3OA 6GSYA 3GHAA 2C4JA 1MTCA 1SJZA 3KP9A 1SYRA 2OBKA 4MZCA 4LL4B 2L5OA 1GTUA 4D73B 2DJ1A 1YDKA 1M2BA 2YCDA 4EKZA 3ERFA 2DIYA 3L4NA 1XFLA 2YWIA 4I2UA 3G9BA 5HQPA 3HHVA 1A0FA 2HZFA 4WR5A 2PBJA 4XHMA 2WCIA 1ON4A 3FKFA 3GIXA 2EC4A 3I9V2 4X0XA 1RK4A 3L9SA 5D9VA 4IKHA 1GNWA 3A2WA 4KSOA 2C0EA 4Q5NA 2I9HA 3IC8A 3M1GA 2PWJA 2ZUPA 2VCWA 4MF6A 4MK3A 5E4WA 4OFTA 2HZEB 5KN2A 1YZXA 3IXRA 4JBBA 4O32A 1F3AA 5LCZA 2NTOA 1BG5A 3CRTA 1FG4A 5JCWA 3VLNA 4TOPA 1ERUA 4OFMA 1DE1A 5DQSA 1FOVA 1SJ6A 2R5GA 1NW2A 4IELA 3ZLPA 1T4ZA 1G0TA 5IMAA 3Q18A 2HFDA 1XVWA 3CXGA 4CDOA 5HFGA 3UVHA 4ECBA 4NHZA 4WXTA 1ERVA 1U3AA 1Y6EA 4TRXA 3A3TA 2LRTA 3MNGA 5IIZA 2QKEA 3TJGA 3HJMA 3MAKA 4ML1A 4N10A 4ILFA 3HJOA 5IO0A 2V2GA 3KZQA 4O92A 4IGJA 1EV9A 3F0IA 3H93A 2X8HA 1K0DA 2FLSA 5GSSA 2NDOA 2LQOA 2X99A 4HU7A 2C3NA 3HZ4A 3WGXA 4PNFA 2GSRA 3HDCA 1TK8B 4OCFA 5IMZA 1K0CA 1M2AA 2IJYA 1HNAA 2GS3A 1SKRB 3EVIA 4F0CA 3HKRA 1OVNA 1QQ2A 3R2QA 4YQMA 5FWGA 3KMOA 3GSSA 4L0UA 2HRKB 3UBKA 5IOXA 1GLPA 3A5WA 4XRDA 3E9JB 4OWYA 2HSMB 4BVYA 5CYYA 3VK9A 3EMPA 5EVOA 2D2ZA 4PQIA 1EZKA 4PTSA 3IC4A 1BAYA 4KH7A 2PU9C 3GL3A 4IJ3A 3E3EA 5DALA 5L71A 2FD3A 4IBPA 2C0GA 1X0RA 4ZL8A 4K7IA 1O85A 3TRQA 1AUCA 4FYCA 1K0AA 3U5RE 2KP1A 2LS5A 5LD0A 5GAPD 4WEYA 3CRUA 4KCEA 1PSQA 4LMVA 1PL1A 3TKSE 5HFKA 3EWLA 2V6OA 3PPUA 1Z9HA 3KMNA 14GSA 2ON5A 2IMKA 3N9JA 3SWLA 3C7MA 5KN3A 2JL4A 2YANA 1Z7PA 2AHEA 4HJ2A 1XIYA 3KD0A 4AGSA 4N0ZA 1TOFA 1TDIA 2XPEA 3IR4A 1ILOA 5ELGA 4NHWA 3NIVA 3TGZA 2IMIA 1XPVA 1SL0B 4IQ1A 1MD4A 3P7XA 4BVXB 5ECOB 3GH9A 3HVVA 2MZCA 4FO5A 3A2VA 1XWGA 1XW6A 1C72A 4BA7A 5KEJA 1R5AA 1ACVA 3EURA 3HVSA 5ENUA 2IMFA 2PVQA 1E2YA 3HVXA 4X1UA 3FY7A 3RHBA 5HR2A 2P5QA 13GSA 4MH2A 4EE0A 1T8EB 1OKTA 4KE3A 3LFLA 4AJ7A 4NMUA 1THXA 2YP6A 2IFQB 1XBSA 1SL2B 1XOAA 2IMDA 2WDUA 4OO4A 5EY6A 3TKSC 4MDCA 5JWOB 4MZBA 4AF2A 1S3DA 1T00A 5A4WA 3ERWA 2LJAA 5G1KA 1SK2A 2MYGA 1SL1B 1O81A 5JWRB 2KOKA 4Q5QA 3TJBA 4WF5A 2RLIA 1FW1A 3F4TA 3RBTA 2E2MA 3UAPA 1R7HA 1VF3A 5DDLA 1O7UA 4AJ6A 2HSNB 3PGTA 1JHBA 1Z5YE 1R5PA 3ME7A 3LORA 2VLTA 5IMFA 2R3XA 1OE7A 5J9CA 2JU5A 1ML6A 16GSA 1USBA 1Z3EA 4I5QA 2IPAA 4N30A 2KHPA 1EV4A 2H1BA 4ML6A 3D0ZA 4V2NA 2CT6A 3CTGA 3HZ8A 2N5BA 5A4VA 4GSTA 3LJRA 4KDXA 2VD0A 1VF4A 4TVEA 5ABRA 5ID2B 3F3RA 2EIQA 3OR5A 4J57E 2C1YA 4DSSB 1J08A 4AJ8A 2L59A 1XVQA 1TI3A 2OA7A 3GRXA 3ZRDA 5B8BA 3QAWA 4HDEA 5ECNB 2MMOA 2LNTA 4RQRA 4TKYA 2HRNA 2VL3A 4N11A 1EEMA 4LMWA 5ECIB 5E59A 1JZRA 2AJQB 1PQNA 4HUAA 2P0GA 3S9FA 1YY7A 4ZB8A 3RDWA 2KLXA 2AAWA 2IL3A 2ON7A 2BMXA 3VWXA 2AV4A 3D6IA 4TR1B 3GUSA 2RUFA 2GSSA 2HRFA 1GULA 5DAKA 3CYNA 1SENA 5D9TA 1M0UA 2DJ2A 1ABAA 1ERWA 1GTBA 3G7IA 4DEJA 1BEDA 2AB6A 5ECKB 2O89A 4X43A 5AN1A 3TKQA 1SYXA 1QGVA 1QMVA 5F07A 4GXZA 4TXVA 3TJJA 3CSJA 3IE3A 3O3TA 2L6DA 2YOIA 4POKA 3TKRA 2V41A 3FW2A 3VFIA 1A2MA 1HYUA 2QGVA 1I9DA 2B1KA 1E6BA 2NVLA 2L6CA 2VL2A 3UMAA 1AXDA 1Q4JA 5DBQA 1U6TA 3QR6A 4POMA 5GAND 4LLRA 1T1VA 4O5RA 5H5SA 5JCUA 4ZBDA 1BX9A 4ZB6A 12GSA 3GX0A 1DBYA 4GQCA 2CVBA 3VWWA 4GSNA 2OE0A 2EIRA 3IHQA 2TRXA 3QCPA 1OYJA 1K0OA 3EMXA 1B48A 4MP4A 1XOBA 3APSA 1JLWA 4MCUA 2UZ8A 3HA9A 3O6TA 4HS1A 3LQ7A 2CAQA 2DJ3A 2FHEA 1N2AA 1XW9A 3DVWA 3GYKA 1URMA 1PRXA 4TXOA 1EP8A 1GL8A 4GQFA 5ECMB 2CX3A 4RI6A 2VO4A 3DYRA 3FEUA 3UEMA 4ECJA 2GT6A 5DCHA 1NM3A 2CX4A 2FGXA 1T7PB 4HQSA 3SBCA 3VI7A 3R3EA 4RQXA 5J9BA 4LL1B 5EL8A 1WPIA 4IP6A 4QL7A 3ZMLA 2VAFA 1UVZA 1GSSA 4GWRA 4PQ1A 4HQZA 2GSTA 1EGOA 1ZMAA 2H0HA 2GQLA 3H1NA 3I43A 1GP1A 2RUEA 2IMEA 1XWKA 2FWFA 5GSTA 2WB9A 1OAZA 1YEPA 1SK0A 4K1FA 3QAGA 1NSWA 4K7NA 3IV4A 4KCAA 1A8YA 5CNWA 3TKSA 3KCMA 3WT1A 1V40A 4OD7A 2OBIA 3TOUA 3ZTLA 1GSYA 3LYKA 1X9WB 4L8EA 3FZ9A 3DIEA 4PUFC 2DMLA 1F6MC 4N0VA 2YJHA 1ZL9A 4IHUA 3ZIJA 2OKAA 5J3RA 4G2EA 4NV5A 2I4AA 3QMXA 4PNGA 2AYTA 1PKZA 1LU4A 4PQHA 4HU9A 4WBJA 2XC2A 2DC5A 5G5FA 1AC1A 2P31A 2HZEA 3WGDA 3TB2A 2HSHA 4I6XA 1JZDA 5H5RA 2HYXA 3ERGA 3VPQA 5F06A 4RUVA 4H86A 4MMMA 3QPMA 1V58A 4G9HA 4QL9A 1TK0B 1TKDB 2F8AA 4OO5A 1LJRA 1YKCA 5G31A 1GUHA 3I69A 4BVYB 2PERA 3WYWA 2HRAA 2E2GA 4EUYA 1QUWA 1MD3A 2EIOA 2WGRA 1JFUA 1YJ6A 2GZPA 3W6GA 2H1DA 1TXXA 3L0HA 4MPFA 3UOMA 5DALB 4PXOA 4F0BA 2J9HA 1YKAA 2FA8A 3O76A 22GSA 1GLQA 5DCGA 2IN3A 3APQA 3M9KA 4GCIA 1QXHA 2LV3A 3J7Yk 1KEBA 1A2JA 1JZWA 1ZYQB 2GLRA 3ISOA 4FQUA 2E7PA 4NXIA 3F9UA 2VUPA 2F3MA 2I81A 1T3BA 3IAM2 4WETA 2C3QA 3M9JA 2GVPA 4ID0A 4KA0A 3RPPA 4GSSA 2GDRA 4KUNA 4KAEA 2O85A 4KF9A 3IDVA 2H8LA 6GSVA 3ZYWA 1KNGA 2RM6A 5G5EA 4KDYA 4ACSA 2HQTA 3EINA 2OJLA 1B8XA 3CBUA 4K0NA 3CMIA 2B6MA 4GTUA 1B4PA 2MMNA 3GMFA 5HR0A 4MA9A 3QOUA 1YF1A 1SKSB 4PURA 2GZYA 1K3YA 4HOJA 3KP8A 4TR3A 2YV7A 2WFCA 4ECIA 2VD1A 4G10A 3CSIA 3IK7A 2LJRA 2WRTA 3IAS2 3IOSA 2J23A 2LJKA 4OFNA 3FHKA 2N5AA 4NPBA 3KIJA 4L5LA 3ZITA 1PX7A 3L78A 4NAXA 1O73A 2GGTA 5EPFA 1GH2A 3VWUA 4MJAA 2ZCTA 2LKUA 5ELAA 2L4CA 1V9WA 4YQVA 20GSA 5AISA 2B3SA 3EU3A 3TJKA 4BL7A 3QD9A 1TRVA 4IJIA 1TI1A 2M80A 2Z9SA 2CV4A 2VLVA 4ZL7A 1EWXA 4OMVA 1XZOA 4JR4A 1XCCA 3P8WA 3QFBC 5B8AA 3W8SA 2H72A 1WE0A 1N8JA 5AIXA 3DGQA 2VCTA 5C00A 2QSIA 1TRWA 4ISDA 2E0QA 1YF0A 4J2FA 2H6YA 2V6KA 1TRUA 3LWAA 2H1GA 5J5NA 2FWHA 4FH8A 1GUKA 4MJCA 4E8HA 1JZOA 1X5CA 4ZILA 2H6ZA 2VOCA 1GRXA 5AGYA 3N5OA 4JE1A 3RHCA 3FR9A 1GSUA 3GNJA 4EDZA 3KJYA 2HNLA 4I97A 2FY6A 5D9WA 2V1MA 1GTAA 3CSHA 2G2QA 3F4SA 3QFAC 3IPZA 2H30A 1U88A 3BJ5A 2WS2A 3HY2A 5AIVA
chains in the Genus database with same CATH superfamily
1S3AA 3HYPA 5F05A 3IA1A 4QMKA 5CRGA 6GSSA 3HCZA 5B7CA 1A8LA 1TK5B 17GSA 2H70A 1RW1A 5CRWA 5ECPB 1AQWA 3MWHA 4JRRA 4AI6A 2LNSA 5A1NA 3FMWA 3IRAA 2MMZA 4GLTA 4JZQA 5DAKB 1W4VA 4XIHA 3VURA 1X5DA 2REMA 1SVLA 4PX1A 2GT5A 4PHZC 4WR4A 4K6XA 1BJXA 1VF2A 1J9BA 2NBSA 4MJEA 3TOTA 1EOGA 5D9XA 1A0RP 4GRFA 4IVFA 2IIYA 5A5KA 18GSA 5G1LA 2C0DA 1V57A 2IWTA 4K2XA 2TIRA 3HMJG 2OE3A 3H8QA 4PGTA 4XTSA 3RPNA 2XBQA 3ZREA 1VF1A 3D4MA 2BJXA 5GZZB 1SJIA 1FAAA 4KX4A 5CRDA 2C3TA 3Q6OA 3EYTA 3CHXC 4WKWA 3U6VA 2HT9A 1G7OA 2DJKA 2VCVA 2I1UA 2WVYA 5F0GA 5KN0A 2X8GA 5ECLB 2RIIA 1G6WA 5D93A 4ZBAA 4CHSA 3L9VA 3QAVA 3VWVA 4K0GA 2K8SA 1FB0A 2YZHA 2PMTA 1I5GA 5ECSA 3GA4A 4KSMA 4I2TA 3VI5A 2H66A 1SD8A 3FRCA 1MDJA 1WP0A 3US3A 2H71A 4K2DA 3UL3A 1TRSA 3KEBA 4EXJA 1PD21 4TN8A 4FIWA 3ZVJD 4TR4A 1GWCA 4G0KA 2O87A 3C71A 1M3JA 2OE1A 2EFCA 5IM9A 4XS4A 1GUMA 4N3ZA 4G19A 4TXOB 5HFIA 5KN1A 2PGTA 5DJLA 1K0NA 5BMUA 1XWCA 2HLSA 2H1LA 1W89A 2DSAA 2VM2A 3HXSA 3DXBA 1WMJA 3D5JA 5IMDA 3D4TA 1F37A 1HNCA 8GSSA 1M2DA 3H79A 3TDGA 7GSSA 2HI7A 2OACA 3MSZA 1PN0A 3GTUA 5ECHB 2YWMA 4OCEA 2H19A 4V1Ag 4ECCA 5C04A 1R26A 5D8IA 2R6KA 3FZAA 1BF5A 2B5XA 2WULA 1TU8A 1Z7RA 2A2RA 3BCIA 1QK8A 3DRNA 2DBCA 2MBSA 1FB6A 3UIWA 2YWOA 4HSCX 3APOA 2FUG2 2VLUA 3I6AA 2A4VA 1MDKA 4FYBA 4IN0A 2DMMA 3IBHA 1XWBA 1OC9A 1V2AA 3IK9A 3D22A 1T4YA 1IYIA 4EF0A 3ZFBA 1Z6NA 1FVKA 3KH9A 3LW9A 2G0FA 1PFOA 4PUAA 1I1IP 3TCOA 5IMVA 4Q5RA 1CQGA 2RM5A 3F4RA 3Q19A 4F82A 1EGRA 1AIUA 1TTZA 4D73A 5IPGA 3TJFA 3ZL5A 2YV9A 1M3IA 2JADA 3KM6A 2R37A 3W8JA 2L5LA 4V2LA 3D21A 4YAVA 2R2JA 2HE3A 3MDKA 4HEA2 2V32A 2PPTA 2XHFA 3VPTA 2GZZA 2WZSA 4MPGA 2PUKC 5CP1A 3TUEA 3ME8A 2WVXA 4DVCA 2EFEA 3H4KA 1S4BP 2HXKA 2M46A 4Z7XA 1Q98A 3AY8A 4ZL9A 5F8BA 3TRPA 3J7Yb 1FVJA 1TU7A 2VCQA 2H75A 2AUVA 5HR3A 1WWJA 3GURA 2H73A 3TRXA 4YQUA 1HNBA 3WD6A 4DSQA 4KDUA 5ECQB 3EU4A 4V1Ap 4EIPA 2CVDA 4IP1A 1ZYEA 2MBTA 9GSSA 2JZRA 1A24A 4O5UA 1HD2A 4ULXA 4I8BA 1BYEA 4MF7A 3GKXA 4BWSA 3ZVJA 2YN1A 3BOAA 1SD9A 1IYHA 2KP2A 1EP7A 4Q5FA 3GH6A 1X9SB 2NPBA 4LA1A 1WJKA 2K6VA 1H75A 2ES7A 3GN3A 2CA8A 2ZNMA 3G7JA 3FR3A 2DLXA 2JZSA 4MJBA 2VL9A 3M8NA 2KUCA 1XWAA 2XBIA 4XCSA 1R4WA 1U87A 1O8XA 2LEGA 1YEWC 3KH7A 1PMTA 5D73A 1F9MA 3ZMKA 5DJMA 2CAIA 4AKIA 1O6JA 1MEKA 2F51A 2MMAA 1B4QA 2B7JA 3M0FA 3K8NA 1GSDA 5IPHA 3ED3A 2JSYA 1M7TA 4XRAA 3FZ4A 4PI0C 1DUGA 1YEXA 2DJJA 1AAZA 3ZIVA 1CQHA 6GSTA 3GFKA 4MF5A 4HI7A 2VL2C 4HZ4A 3TKPA 4G0LA 1AQXA 4EO3A 1XG8A 3C1SA 5JWQB 2HRKA 2B1LA 4YKFA 2C8UA 3KXOA 2YWNA 5IMCA 5B6NA 4E8EA 1BG1A 4KW6A 3HJPA 4JEDA 1ZYPA 4POBA 3DWVA 1OC8A 4YAPA 2HSMA 2VCXA 3BCKA 3HD5A 5A5HA 1SU9A 2A2SA 3EC3A 2QA1A 2H1AA 4NWYA 11GSA 2PVOC 3F63A 4XS6A 1XW5A 1M9BA 4BPYA 1ST9A 2FNOA 3EE2A 3M3MA 1SK1A 1SKWB 5INYA 1S3CA 1G7EA 3JCML 3C73A 2VM1A 3MYDA 1NHYA 3LXZA 1KBNA 2X49A 1B9XC 1VRSD 4DSRA 5JCGA 1UA5A 2DIZA 1PGTA 1ZCPA 2YJ7A 1EEJA 2WW2A 4BL7B 2LRNA 6GSUA 2GQKA 1TJDA 2B5EA 4EC0A 5H5QA 3PR8A 2CZ2A 2C0FA 4P3YB 1H4OA 19GSA 3GSTA 5CAXA 2FCHA 6GSWA 3RAZA 3GKNA 1GSQA 3LYPA 1ZGNA 2R4VA 3FR6A 1G6YA 5CRHA 4QQ7A 4BVXA 3QDNA 4CY6A 3LG6A 3UBLA 2FWGA 5J41A 1M99A 3LEFA 5IQYA 2ALBA 3RGBC 2H76A 2WZ9A 1O8WA 4BWQA 1A23A 1AQVA 2K18A 3E0UA 1MDIA 4K7OA 4MZWA 5IOWA 1TP9A 1OE8A 5DQYA 2P5RA 3ZZXA 4J56E 3P2AA 1A2LA 4MNNA 1SVOA 1UC7A 2H01A 3CQFA 2X8CA 2IFQA 5COHA 1K0MA 1U3IA 3F6DA 1PKWA 3GL5A 3TU3B 1WOUA 1ERTA 2GSQA 2C80A 4O7HA 1F3BA 3CTFA 4ZIJA 5LNKe 2VCZA 4MABA 2LQQA 5A4UA 5A1NB 4JR6A 3BD2A 4EL1A 3NOFA 1KTEA 2GQMA 1K0BA 5B6MA 3DMLA 4IQAA 2JZTA 4FYUA 2F9SA 4USSA 1B9YC 3WGEA 3GKKA 1GSFA 3GKMA 2HSNA 3CWGA 5FHIA 3KTLA 3NZNA 4CY8A 5HR1A 2O8VB 4K9ZA 3P90A 1WRYA 2H6XA 4V2MA 1VGLA 1K3LA 2FA4A 2X64A 4ZXGA 4G0IA 1BQ7A 5ECRB 2K9FA 3C1RA 3DD3A 2LUSA 1OKDA 1DE2A 3PINA 4MH3A 1J0FA 1GSEA 4ZB9A 2DJ0A 5G30A 4WBRD 2XPDA 1X9MB 1OC3A 4EVMA 4KB3A 4IW9A 3UJ1A 2I3YA 6GSXA 4ZBBA 1FHEA 2FWEA 2OADA 2EFHA 3PH9A 4KGIA 4F9ZA 4PI2C 2L57A 1PA3A 4YH2A 5ID2A 3UARA 4GF0A 2CQ9A 4MLYA 1YQ1A 3L9UA 2YPMA 1QFNA 4DSSA 3GX8A 2B7KA 3G7YA 4TR0A 2M72A 1Y25A 2A4HA 2HSYA 3BBYA 5IO2A 2VIMA 4L0WA 3FK8A 2K8VA 4F2IA 4HZ2A 1WIKA 2H0GA 1PX6A 5CO3A 1X5EA 3LXTA 5G2ZA 1F2EA 2JACA 4WF4A 1AW9A 5D96A 4EDYA 1ZZYA 2YZUA 4HJMA 1NHOA 2H74A 2JSZA 3FYGA 2YNXA 4TW5A 3LGCA 4TR1A 4K8MA 5J47A 2CVKA 1ZOFA 1GTIA 4XS4B 3DKSA 1RQMA 3LSZA 3Q74A 2CZ3A 3F8UA 2PN8A 1FOHA 3ZFLA 3V1WA 4KNDA 5BMUB 2H0IA 2LTKA 4F03A 1HQOA 2O7KA 4E68A 3FZ5A 1FO5A 2L4QA 1THOA 2LSTA 5FT3A 1V98A 3F6FA 3A2XA 1PN9A 2BTOT 2F8FA 1UN2A 2N5FA 4XS1A 3DVXA 3UVTA 4IS0A 5J4UA 1JLVA 2TRCP 4BIKA 1TW9A 4L5OA 5CREA 3GTUB 2GTUA 4POLA 1Y1UA 1M9AA 10GSA 2QC7A 2LRCA 2B5YA 2WJUA 3KTBA 5DVBA 1EOHA 1PL2A 1XXUA 3DEXA 1Z6MA 3WT2A 4Z2TA 4RI7A 3C8EA 1GNEA 1DSBA 4NV2A 3F3QA 3KGKA 4CW9A 1LBKA 1OC9B 3GV1A 4JU5A 1K3OA 6GSYA 3GHAA 2C4JA 1MTCA 1SJZA 3KP9A 1YVLA 1SYRA 2OBKA 4MZCA 4LL4B 2L5OA 1GTUA 4D73B 2DJ1A 1YDKA 1M2BA 2YCDA 4EKZA 3ERFA 2DIYA 3L4NA 1XFLA 2YWIA 4I2UA 3G9BA 5HQPA 3HHVA 1A0FA 2HZFA 4WR5A 2PBJA 4XHMA 2WCIA 1ON4A 3FKFA 3GIXA 2EC4A 3I9V2 2WVXB 1RK4A 4X0XA 3L9SA 5D9VA 4IKHA 1GNWA 3A2WA 4KSOA 2C0EA 3A5IA 4Q5NA 2I9HA 3IC8A 3M1GA 2PWJA 2ZUPA 2VCWA 2OT3A 4MF6A 4MK3A 5E4WA 4OFTA 2HZEB 5KN2A 1YZXA 3IXRA 4JBBA 4O32A 1F3AA 5LCZA 2NTOA 1BG5A 3CRTA 1FG4A 5JCWA 3VLNA 4TOPA 1ERUA 4OFMA 1DE1A 5DQSA 1FOVA 1SJ6A 2R5GA 1NW2A 4IELA 3ZLPA 1T4ZA 4A5PA 1G0TA 5IMAA 3Q18A 2HFDA 1XVWA 3CXGA 4CDOA 5HFGA 3UVHA 4ECBA 4NHZA 5BRTA 4WXTA 1ERVA 1U3AA 1Y6EA 4TRXA 4X4JA 3A3TA 2LRTA 3MNGA 5IIZA 4ZB7A 2QKEA 3TJGA 3HJMA 3MAKA 2WW3A 4ML1A 4N10A 4ILFA 3HJOA 5IO0A 2V2GA 3KZQA 4O92A 4IGJA 5A34A 1EV9A 3F0IA 3H93A 2X8HA 1K0DA 2FLSA 5GSSA 2NDOA 2LQOA 2X99A 4HU7A 2C3NA 3HZ4A 3WGXA 4PNFA 2GSRA 3HDCA 1TK8B 4OCFA 5IMZA 1K0CA 1M2AA 2IJYA 1HNAA 2GS3A 1SKRB 3EVIA 4F0CA 3HKRA 1OVNA 1QQ2A 3R2QA 4YQMA 5FWGA 3KMOA 3GSSA 4L0UA 1N25A 2HRKB 3UBKA 5IOXA 1GLPA 3A5WA 4XRDA 3E9JB 4OWYA 2HSMB 4BVYA 5CYYA 5A5HB 3VK9A 3EMPA 5EVOA 2D2ZA 4PQIA 1EZKA 4PTSA 3IC4A 1BAYA 4KH7A 2PU9C 3GL3A 4IJ3A 3E3EA 5DALA 5L71A 2FD3A 4IBPA 2C0GA 1X0RA 4ZL8A 4K7IA 1O85A 2QA2A 3TRQA 1AUCA 4K5RA 4FYCA 1K0AA 3U5RE 2KP1A 2LS5A 5LD0A 5GAPD 4WEYA 3CRUA 4KCEA 1PSQA 4LMVA 1PL1A 5J4YA 3TKSE 5HFKA 3EWLA 2V6OA 3PPUA 1Z9HA 3KMNA 14GSA 2ON5A 2IMKA 3N9JA 3SWLA 3C7MA 5KN3A 2JL4A 2YANA 1Z7PA 2AHEA 4HJ2A 1XIYA 3KD0A 4AGSA 4N0ZA 2WW0A 1TOFA 1TDIA 2XPEA 3IR4A 1ILOA 5ELGA 4NHWA 3NIVA 3TGZA 2IMIA 1XPVA 1SL0B 4IQ1A 1MD4A 3P7XA 4BVXB 5ECOB 3GH9A 3HVVA 2MZCA 4FO5A 3A2VA 1XWGA 1XW6A 1C72A 4BA7A 5KEJA 1R5AA 1ACVA 3EURA 3HVSA 2R0CA 5ENUA 2IMFA 2PVQA 1E2YA 3HVXA 4X1UA 3FY7A 3RHBA 5HR2A 2P5QA 13GSA 4MH2A 4EE0A 1T8EB 1OKTA 4KE3A 2O3EA 3LFLA 4AJ7A 4NMUA 1THXA 2YP6A 1SVMA 2IFQB 1XBSA 1SL2B 1XOAA 2IMDA 2WDUA 4OO4A 5EY6A 3TKSC 4MDCA 5JWOB 4MZBA 4AF2A 1S3DA 1T00A 5A4WA 3ERWA 2LJAA 5G1KA 1SK2A 2MYGA 1SL1B 1O81A 5JWRB 2KOKA 4Q5QA 3TJBA 4WF5A 2RLIA 2R0PA 1FW1A 3F4TA 3RBTA 2E2MA 3UAPA 1R7HA 1VF3A 5DDLA 1O7UA 4AJ6A 2HSNB 3PGTA 1JHBA 1Z5YE 1R5PA 3ME7A 3IHGA 5J4VA 3LORA 2VLTA 5IMFA 2R3XA 1OE7A 5J9CA 2JU5A 1ML6A 2UV8G 16GSA 1USBA 1Z3EA 4I5QA 2IPAA 4N30A 2KHPA 1EV4A 2H1BA 4ML6A 3D0ZA 4V2NA 2CT6A 3CTGA 3HZ8A 2N5BA 5A4VA 4GSTA 4EIQA 3LJRA 4KDXA 2VD0A 1VF4A 4TVEA 5ABRA 5ID2B 3F3RA 2EIQA 3OR5A 4J57E 2C1YA 4DSSB 1J08A 4AJ8A 2L59A 1XVQA 1TI3A 2OA7A 3GRXA 3ZRDA 5B8BA 3QAWA 4HDEA 5ECNB 2MMOA 2LNTA 4RQRA 4TKYA 2HRNA 2VL3A 4N11A 1EEMA 4LMWA 5ECIB 2DKHA 1JZRA 5E59A 2AJQB 1PQNA 4HUAA 2P0GA 3S9FA 2EFDA 1YY7A 4ZB8A 3RDWA 2KLXA 2AAWA 4K5SA 2IL3A 2ON7A 2BMXA 3VWXA 2AV4A 3D6IA 4TR1B 3GUSA 2RUFA 2GSSA 2HRFA 1GULA 1S3RA 5DAKA 3RFRC 3CYNA 1SENA 2WVZA 1M0UA 5D9TA 2DJ2A 1ABAA 1ERWA 1GTBA 3G7IA 4Z2RA 4DEJA 1BEDA 2AB6A 5ECKB 2O89A 4X43A 5AN1A 3TKQA 1SYXA 1QGVA 1QMVA 5F07A 4GXZA 4TXVA 4O5QA 3TJJA 3CSJA 3IE3A 3O3TA 2L6DA 2YOIA 4POKA 3TKRA 2V41A 3FW2A 3VFIA 1A2MA 1HYUA 2QGVA 1I9DA 2B1KA 1E6BA 2O5VA 2NVLA 2L6CA 2VL2A 3UMAA 1AXDA 1Q4JA 5DBQA 1U6TA 3QR6A 4POMA 5GAND 4LLRA 1T1VA 4O5RA 5H5SA 5JCUA 4ZBDA 4YKGA 1BX9A 4ZB6A 12GSA 3GX0A 1DBYA 4GQCA 2CVBA 3VWWA 4GSNA 2OE0A 2EIRA 3IHQA 2TRXA 3QCPA 1OYJA 4ICYA 1K0OA 3EMXA 1B48A 4MP4A 1XOBA 3APSA 1JLWA 4MCUA 1TXUA 2UZ8A 3HA9A 3O6TA 4HS1A 3LQ7A 2CAQA 2DJ3A 2FHEA 1N2AA 1XW9A 3DVWA 3GYKA 1URMA 1PRXA 4TXOA 1EP8A 1GL8A 4G01A 4GQFA 5ECMB 2CX3A 4RI6A 2VO4A 3DYRA 3FEUA 3UEMA 4ECJA 4Z2UA 2GT6A 5DCHA 1NM3A 2CX4A 2FGXA 1T7PB 4HQSA 3SBCA 3VI7A 3R3EA 4RQXA 5J9BA 4LL1B 5EL8A 1WPIA 4IP6A 4QL7A 3ZMLA 2VAFA 1UVZA 1GSSA 4GWRA 4PQ1A 4HQZA 2GSTA 1EGOA 1ZMAA 2H0HA 2WW1A 2GQLA 3H1NA 3I43A 1GP1A 2RUEA 2IMEA 1XWKA 2FWFA 5GSTA 2WB9A 1OAZA 4GDFA 1YEPA 1SK0A 4K1FA 3QAGA 1NSWA 4K7NA 3IV4A 4KCAA 1A8YA 5CNWA 3TKSA 3KCMA 3WT1A 1V40A 4OD7A 2OBIA 3TOUA 3ZTLA 1GSYA 3LYKA 1X9WB 4L8EA 3FZ9A 3DIEA 4PUFC 2DMLA 1F6MC 4N0VA 2YJHA 1ZL9A 4IHUA 5J40A 3ZIJA 2OKAA 5J3RA 5A34B 4G2EA 4NV5A 2I4AA 3QMXA 4PNGA 2AYTA 1PKZA 1LU4A 4PQHA 4HU9A 4WBJA 2XC2A 2DC5A 5G5FA 1AC1A 2P31A 2HZEA 3WGDA 3TB2A 2HSHA 4I6XA 1JZDA 5H5RA 2HYXA 3ERGA 3VPQA 5F06A 4RUVA 4H86A 4MMMA 3QPMA 1V58A 3HVNA 4G9HA 4QL9A 1TK0B 1TKDB 2F8AA 4OO5A 1LJRA 1YKCA 5G31A 1GUHA 3I69A 4BVYB 2PERA 3WYWA 2HRAA 2E2GA 4EUYA 1QUWA 1MD3A 2EIOA 2WGRA 4AKXB 1JFUA 1YJ6A 2GZPA 2R0GA 3W6GA 2H1DA 1TXXA 3L0HA 4MPFA 2DKIA 3UOMA 5DALB 4PXOA 4F0BA 2J9HA 1YKAA 2FA8A 3O76A 22GSA 1GLQA 5DCGA 2IN3A 3APQA 3M9KA 4GCIA 1QXHA 2LV3A 3J7Yk 1KEBA 1A2JA 2VKZG 1JZWA 1ZYQB 2GLRA 3ISOA 4FQUA 2E7PA 4NXIA 3F9UA 2VUPA 2F3MA 1ZYNA 2I81A 1T3BA 3IAM2 4WETA 2C3QA 2X4AA 3M9JA 2GVPA 4ID0A 4KA0A 3RPPA 4GSSA 2GDRA 4KUNA 4KAEA 2O85A 4KF9A 3IDVA 2H8LA 6GSVA 3ZYWA 2RM6A 1KNGA 4FXYP 5G5EA 4KDYA 4ACSA 2HQTA 3EINA 2OJLA 1B8XA 4W66A 3CBUA 4K0NA 3CMIA 2B6MA 3EPTA 4GTUA 1B4PA 2MMNA 4AKHA 3GMFA 5HR0A 4MA9A 3QOUA 1YF1A 1SKSB 4PURA 2GZYA 1K3YA 4HOJA 5KOWA 3KP8A 4TR3A 4AKGA 2YV7A 2WFCA 4ECIA 2VD1A 5KOXA 4G10A 3CSIA 3IK7A 2LJRA 2O36A 2WRTA 3IAS2 3IOSA 2J23A 2LJKA 4OFNA 3FHKA 2N5AA 4NPBA 3KIJA 3MIXA 4L5LA 3ZITA 1PX7A 3L78A 4NAXA 1O73A 2GGTA 5EPFA 1GH2A 3VWUA 4MJAA 2ZCTA 2LKUA 5ELAA 2L4CA 1V9WA 4YQVA 20GSA 5AISA 2B3SA 3EU3A 3TJKA 4BL7A 3QD9A 1TRVA 4IJIA 1TI1A 2M80A 2Z9SA 2CV4A 2VLVA 4ZL7A 1EWXA 4OMVA 1XZOA 4JR4A 1XCCA 3P8WA 3QFBC 5B8AA 3W8SA 2H72A 1WE0A 1N8JA 5AIXA 3DGQA 2VCTA 5C00A 2QSIA 1TRWA 4ISDA 2E0QA 1YF0A 4J2FA 2H6YA 2V6KA 1TRUA 3LWAA 2H1GA 5J5NA 2FWHA 1GUKA 4FH8A 4MJCA 4E8HA 1JZOA 1X5CA 4ZILA 2H6ZA 2VOCA 1GRXA 5AGYA 3N5OA 4JE1A 3RHCA 3FR9A 1GSUA 3GNJA 4EDZA 3KJYA 2HNLA 2A2PA 4I97A 2FY6A 5D9WA 2V1MA 1GTAA 3CSHA 2G2QA 3F4SA 3QFAC 3IPZA 2H30A 1U88A 3BJ5A 2WS2A 3HY2A 5AIVA
chains in the Genus database with same CATH topology
1S3AA 3HYPA 5F05A 3IA1A 4QMKA 5CRGA 6GSSA 3HCZA 5B7CA 1A8LA 1TK5B 17GSA 2H70A 1RW1A 5CRWA 5ECPB 1AQWA 3MWHA 4JRRA 4AI6A 2LNSA 5A1NA 3FMWA 3IRAA 2MMZA 4GLTA 4JZQA 5DAKB 1W4VA 4XIHA 3VURA 1X5DA 2REMA 1SVLA 4PX1A 2GT5A 4WR4A 4K6XA 1BJXA 1VF2A 1J9BA 2NBSA 4MJEA 3TOTA 1EOGA 5D9XA 1A0RP 4GRFA 4IVFA 2IIYA 5A5KA 18GSA 5G1LA 2C0DA 1V57A 2IWTA 4K2XA 2TIRA 3HMJG 2OE3A 3H8QA 4PGTA 4XTSA 3RPNA 2XBQA 3ZREA 1VF1A 3D4MA 2BJXA 5GZZB 1SJIA 1FAAA 4KX4A 5CRDA 2C3TA 3Q6OA 3EYTA 4WKWA 3U6VA 2HT9A 1G7OA 2DJKA 2VCVA 2I1UA 5F0GA 5KN0A 2X8GA 5ECLB 2RIIA 1G6WA 5D93A 4ZBAA 4CHSA 3L9VA 3QAVA 3VWVA 4K0GA 2K8SA 1FB0A 2YZHA 2PMTA 1I5GA 5ECSA 3GA4A 4KSMA 4I2TA 3VI5A 2H66A 1SD8A 3FRCA 1MDJA 1WP0A 3US3A 2H71A 4K2DA 3UL3A 1TRSA 3KEBA 4EXJA 1PD21 4TN8A 4FIWA 3ZVJD 4TR4A 1GWCA 4G0KA 2O87A 3C71A 2OE1A 2EFCA 5IM9A 4XS4A 1GUMA 4N3ZA 4G19A 4TXOB 5HFIA 5KN1A 2PGTA 5DJLA 1K0NA 5BMUA 1XWCA 2HLSA 2H1LA 1W89A 2DSAA 2VM2A 3HXSA 3DXBA 1WMJA 3D5JA 5IMDA 3D4TA 1F37A 1HNCA 8GSSA 1M2DA 3H79A 3TDGA 7GSSA 2HI7A 2OACA 3MSZA 1PN0A 3GTUA 5ECHB 2YWMA 4OCEA 2H19A 4V1Ag 4ECCA 5C04A 1R26A 5D8IA 2R6KA 3FZAA 1BF5A 2B5XA 2WULA 1TU8A 1Z7RA 2A2RA 3BCIA 1QK8A 3DRNA 2DBCA 2MBSA 1FB6A 3UIWA 2YWOA 3APOA 2FUG2 2VLUA 3I6AA 2A4VA 1MDKA 4FYBA 4IN0A 2DMMA 3IBHA 1XWBA 1OC9A 1V2AA 3IK9A 3D22A 1T4YA 1IYIA 4EF0A 3ZFBA 1Z6NA 1FVKA 3KH9A 3LW9A 2G0FA 4PUAA 3TCOA 5IMVA 4Q5RA 1CQGA 2RM5A 3F4RA 3Q19A 4F82A 1EGRA 1AIUA 1TTZA 4D73A 5IPGA 3TJFA 3ZL5A 2YV9A 2JADA 3KM6A 2R37A 3W8JA 2L5LA 4V2LA 3D21A 4YAVA 2R2JA 2HE3A 3MDKA 4HEA2 2V32A 2PPTA 2XHFA 3VPTA 2GZZA 4MPGA 2PUKC 5CP1A 3TUEA 3ME8A 4DVCA 2EFEA 3H4KA 2HXKA 2M46A 4Z7XA 1Q98A 3AY8A 4ZL9A 5F8BA 3TRPA 3J7Yb 1FVJA 1TU7A 2VCQA 2H75A 2AUVA 5HR3A 1WWJA 3GURA 2H73A 3TRXA 4YQUA 1HNBA 3WD6A 4DSQA 4KDUA 5ECQB 3EU4A 4V1Ap 4EIPA 2CVDA 4IP1A 1ZYEA 2MBTA 9GSSA 2JZRA 1A24A 4O5UA 1HD2A 4ULXA 4I8BA 1BYEA 4MF7A 3GKXA 4BWSA 3ZVJA 2YN1A 3BOAA 1SD9A 1IYHA 2KP2A 1EP7A 4Q5FA 3GH6A 1X9SB 2NPBA 4LA1A 1WJKA 2K6VA 1H75A 2ES7A 3GN3A 2CA8A 2ZNMA 3G7JA 3FR3A 2DLXA 2JZSA 4MJBA 2VL9A 3M8NA 2KUCA 1XWAA 2XBIA 4XCSA 1R4WA 1U87A 1O8XA 2LEGA 3KH7A 1PMTA 5D73A 1F9MA 3ZMKA 5DJMA 2CAIA 4AKIA 1O6JA 1MEKA 2F51A 2MMAA 1B4QA 2B7JA 3M0FA 3K8NA 1GSDA 5IPHA 3ED3A 2JSYA 1M7TA 4XRAA 3FZ4A 1YEXA 1DUGA 2DJJA 1AAZA 3ZIVA 1CQHA 6GSTA 3GFKA 4MF5A 4HI7A 2VL2C 4HZ4A 3TKPA 4G0LA 1AQXA 4EO3A 3C1SA 5JWQB 2HRKA 2B1LA 4YKFA 2C8UA 3KXOA 2YWNA 5IMCA 5B6NA 4E8EA 1BG1A 4KW6A 3HJPA 4JEDA 1ZYPA 4POBA 3DWVA 1OC8A 4YAPA 2HSMA 2VCXA 3BCKA 3HD5A 5A5HA 1SU9A 2A2SA 3EC3A 2QA1A 2H1AA 4NWYA 11GSA 2PVOC 3F63A 4XS6A 1XW5A 1M9BA 4BPYA 1ST9A 2FNOA 3EE2A 3M3MA 1SK1A 1SKWB 5INYA 1S3CA 1G7EA 3JCML 3C73A 2VM1A 3MYDA 1NHYA 3LXZA 1KBNA 2X49A 1B9XC 1VRSD 4DSRA 5JCGA 1UA5A 2DIZA 1PGTA 1ZCPA 2YJ7A 1EEJA 4BL7B 2LRNA 6GSUA 2GQKA 1TJDA 2B5EA 4EC0A 5H5QA 3PR8A 2CZ2A 2C0FA 4P3YB 1H4OA 19GSA 3GSTA 5CAXA 2FCHA 6GSWA 3RAZA 3GKNA 1GSQA 3LYPA 1ZGNA 2R4VA 3FR6A 1G6YA 5CRHA 4QQ7A 4BVXA 3QDNA 4CY6A 3LG6A 3UBLA 2FWGA 5J41A 1M99A 3LEFA 5IQYA 2ALBA 2H76A 2WZ9A 1O8WA 4BWQA 1A23A 1AQVA 2K18A 3E0UA 1MDIA 4K7OA 4MZWA 5IOWA 1TP9A 1OE8A 5DQYA 2P5RA 3ZZXA 4J56E 3P2AA 1A2LA 4MNNA 1SVOA 1UC7A 2H01A 2X8CA 2IFQA 5COHA 1K0MA 1U3IA 3F6DA 1PKWA 3GL5A 3TU3B 1WOUA 1ERTA 2GSQA 2C80A 4O7HA 1F3BA 3CTFA 4ZIJA 5LNKe 2VCZA 4MABA 2LQQA 5A4UA 5A1NB 4JR6A 3BD2A 4EL1A 3NOFA 1KTEA 2GQMA 1K0BA 5B6MA 3DMLA 4IQAA 2JZTA 4FYUA 2F9SA 4USSA 1B9YC 3WGEA 3GKKA 1GSFA 3GKMA 2HSNA 3CWGA 5FHIA 3KTLA 3NZNA 4CY8A 5HR1A 2O8VB 4K9ZA 3P90A 1WRYA 2H6XA 4V2MA 1VGLA 1K3LA 2FA4A 2X64A 4ZXGA 4G0IA 1BQ7A 5ECRB 2K9FA 3C1RA 3DD3A 2LUSA 1OKDA 1DE2A 3PINA 4MH3A 1J0FA 1GSEA 4ZB9A 2DJ0A 5G30A 4WBRD 2XPDA 1X9MB 1OC3A 4EVMA 4KB3A 4IW9A 3UJ1A 2I3YA 6GSXA 4ZBBA 1FHEA 2FWEA 2OADA 2EFHA 3PH9A 4KGIA 4F9ZA 2L57A 1PA3A 4YH2A 5ID2A 3UARA 4GF0A 2CQ9A 4MLYA 1YQ1A 3L9UA 2YPMA 1QFNA 4DSSA 3GX8A 2B7KA 3G7YA 4TR0A 2M72A 1Y25A 2A4HA 2HSYA 3BBYA 5IO2A 2VIMA 4L0WA 3FK8A 2K8VA 4F2IA 4HZ2A 1WIKA 2H0GA 1PX6A 5CO3A 1X5EA 3LXTA 5G2ZA 1F2EA 2JACA 4WF4A 1AW9A 5D96A 4EDYA 1ZZYA 2YZUA 4HJMA 1NHOA 2H74A 2JSZA 3FYGA 2YNXA 4TW5A 3LGCA 4TR1A 4K8MA 5J47A 2CVKA 1ZOFA 1GTIA 4XS4B 3DKSA 1RQMA 3LSZA 3Q74A 2CZ3A 3F8UA 2PN8A 1FOHA 3ZFLA 3V1WA 4KNDA 5BMUB 2H0IA 2LTKA 4F03A 1HQOA 2O7KA 4E68A 3FZ5A 1FO5A 2L4QA 1THOA 2LSTA 5FT3A 1V98A 3F6FA 3A2XA 1PN9A 2BTOT 2F8FA 1UN2A 2N5FA 4XS1A 3DVXA 3UVTA 4IS0A 5J4UA 1JLVA 2TRCP 1TW9A 4L5OA 5CREA 3GTUB 2GTUA 4POLA 1Y1UA 1M9AA 10GSA 2QC7A 2LRCA 2B5YA 2WJUA 3KTBA 5DVBA 1EOHA 1PL2A 1XXUA 3DEXA 1Z6MA 3WT2A 4Z2TA 4RI7A 3C8EA 1GNEA 1DSBA 4NV2A 3F3QA 3KGKA 4CW9A 1LBKA 1OC9B 3GV1A 4JU5A 1K3OA 6GSYA 3GHAA 2C4JA 1MTCA 1SJZA 3KP9A 1YVLA 1SYRA 2OBKA 4MZCA 4LL4B 2L5OA 1GTUA 4D73B 2DJ1A 1YDKA 1M2BA 2YCDA 4EKZA 3ERFA 2DIYA 3L4NA 1XFLA 2YWIA 4I2UA 3G9BA 5HQPA 3HHVA 1A0FA 2HZFA 4WR5A 2PBJA 4XHMA 2WCIA 1ON4A 3FKFA 3GIXA 2EC4A 3I9V2 4X0XA 1RK4A 3L9SA 5D9VA 4IKHA 1GNWA 3A2WA 4KSOA 2C0EA 3A5IA 4Q5NA 2I9HA 3IC8A 3M1GA 2PWJA 2ZUPA 2VCWA 2OT3A 4MF6A 4MK3A 5E4WA 4OFTA 2HZEB 5KN2A 1YZXA 3IXRA 4JBBA 4O32A 1F3AA 5LCZA 2NTOA 1BG5A 3CRTA 1FG4A 5JCWA 3VLNA 4TOPA 1ERUA 4OFMA 1DE1A 5DQSA 1FOVA 1SJ6A 2R5GA 1NW2A 4IELA 3ZLPA 1T4ZA 4A5PA 1G0TA 5IMAA 3Q18A 2HFDA 1XVWA 3CXGA 4CDOA 5HFGA 3UVHA 4ECBA 4NHZA 5BRTA 4WXTA 1ERVA 1U3AA 1Y6EA 4TRXA 4X4JA 3A3TA 2LRTA 3MNGA 5IIZA 4ZB7A 2QKEA 3TJGA 3HJMA 3MAKA 4ML1A 4N10A 4ILFA 3HJOA 5IO0A 2V2GA 3KZQA 4O92A 4IGJA 5A34A 1EV9A 3F0IA 3H93A 2X8HA 1K0DA 2FLSA 5GSSA 2NDOA 2LQOA 2X99A 4HU7A 2C3NA 3HZ4A 3WGXA 4PNFA 2GSRA 3HDCA 1TK8B 4OCFA 5IMZA 1K0CA 1M2AA 2IJYA 1HNAA 2GS3A 1SKRB 3EVIA 4F0CA 3HKRA 1OVNA 1QQ2A 3R2QA 4YQMA 5FWGA 3KMOA 3GSSA 4L0UA 1N25A 2HRKB 3UBKA 5IOXA 1GLPA 3A5WA 4XRDA 3E9JB 4OWYA 2HSMB 4BVYA 5CYYA 5A5HB 3VK9A 3EMPA 5EVOA 2D2ZA 4PQIA 1EZKA 4PTSA 3IC4A 1BAYA 4KH7A 2PU9C 3GL3A 4IJ3A 3E3EA 5DALA 5L71A 2FD3A 4IBPA 2C0GA 1X0RA 4ZL8A 4K7IA 1O85A 2QA2A 3TRQA 1AUCA 4K5RA 4FYCA 1K0AA 3U5RE 2KP1A 2LS5A 5LD0A 5GAPD 4WEYA 3CRUA 4KCEA 1PSQA 4LMVA 1PL1A 5J4YA 3TKSE 5HFKA 3EWLA 2V6OA 3PPUA 1Z9HA 3KMNA 14GSA 2ON5A 2IMKA 3N9JA 3SWLA 3C7MA 5KN3A 2JL4A 2YANA 1Z7PA 2AHEA 4HJ2A 1XIYA 3KD0A 4AGSA 4N0ZA 1TOFA 1TDIA 2XPEA 3IR4A 1ILOA 5ELGA 4NHWA 3NIVA 3TGZA 2IMIA 1XPVA 1SL0B 4IQ1A 1MD4A 3P7XA 4BVXB 5ECOB 3GH9A 3HVVA 2MZCA 4FO5A 3A2VA 1XWGA 1XW6A 1C72A 4BA7A 5KEJA 1R5AA 1ACVA 3EURA 3HVSA 2R0CA 5ENUA 2IMFA 2PVQA 1E2YA 3HVXA 4X1UA 3FY7A 3RHBA 5HR2A 2P5QA 13GSA 4MH2A 4EE0A 1T8EB 1OKTA 4KE3A 3LFLA 4AJ7A 4NMUA 1THXA 2YP6A 1SVMA 2IFQB 1XBSA 1SL2B 1XOAA 2IMDA 2WDUA 4OO4A 5EY6A 3TKSC 4MDCA 5JWOB 4MZBA 4AF2A 1S3DA 1T00A 5A4WA 3ERWA 2LJAA 5G1KA 1SK2A 2MYGA 1SL1B 1O81A 5JWRB 2KOKA 4Q5QA 3TJBA 4WF5A 2RLIA 2R0PA 1FW1A 3F4TA 3RBTA 2E2MA 3UAPA 1R7HA 1VF3A 5DDLA 1O7UA 4AJ6A 2HSNB 3PGTA 1JHBA 1Z5YE 1R5PA 3ME7A 3IHGA 5J4VA 3LORA 2VLTA 5IMFA 2R3XA 1OE7A 5J9CA 2JU5A 1ML6A 2UV8G 16GSA 1USBA 1Z3EA 4I5QA 2IPAA 4N30A 2KHPA 1EV4A 2H1BA 4ML6A 3D0ZA 4V2NA 2CT6A 3CTGA 3HZ8A 2N5BA 5A4VA 4GSTA 4EIQA 3LJRA 4KDXA 2VD0A 1VF4A 4TVEA 5ABRA 5ID2B 3F3RA 2EIQA 3OR5A 4J57E 2C1YA 4DSSB 1J08A 4AJ8A 2L59A 1XVQA 1TI3A 2OA7A 3GRXA 3ZRDA 5B8BA 3QAWA 4HDEA 5ECNB 2MMOA 2LNTA 4RQRA 4TKYA 2HRNA 2VL3A 4N11A 1EEMA 4LMWA 5ECIB 2DKHA 1JZRA 5E59A 2AJQB 1PQNA 4HUAA 2P0GA 3S9FA 2EFDA 1YY7A 4ZB8A 3RDWA 2KLXA 2AAWA 4K5SA 2IL3A 2ON7A 2BMXA 3VWXA 2AV4A 3D6IA 4TR1B 3GUSA 2RUFA 2GSSA 2HRFA 1GULA 5DAKA 3CYNA 1SENA 5D9TA 1M0UA 2DJ2A 1ABAA 1ERWA 1GTBA 3G7IA 4Z2RA 4DEJA 1BEDA 2AB6A 5ECKB 2O89A 4X43A 5AN1A 3TKQA 1SYXA 1QGVA 1QMVA 5F07A 4GXZA 4TXVA 4O5QA 3TJJA 3CSJA 3IE3A 3O3TA 2L6DA 2YOIA 4POKA 3TKRA 2V41A 3FW2A 3VFIA 1A2MA 1HYUA 2QGVA 1I9DA 2B1KA 1E6BA 2O5VA 2NVLA 2L6CA 2VL2A 3UMAA 1AXDA 1Q4JA 5DBQA 1U6TA 3QR6A 4POMA 5GAND 4LLRA 1T1VA 4O5RA 5H5SA 5JCUA 4ZBDA 4YKGA 1BX9A 4ZB6A 12GSA 3GX0A 1DBYA 4GQCA 2CVBA 3VWWA 4GSNA 2OE0A 2EIRA 3IHQA 2TRXA 3QCPA 1OYJA 4ICYA 1K0OA 3EMXA 1B48A 4MP4A 1XOBA 3APSA 1JLWA 4MCUA 1TXUA 2UZ8A 3HA9A 3O6TA 4HS1A 3LQ7A 2CAQA 2DJ3A 2FHEA 1N2AA 1XW9A 3DVWA 3GYKA 1URMA 1PRXA 4TXOA 1EP8A 1GL8A 4G01A 4GQFA 5ECMB 2CX3A 4RI6A 2VO4A 3DYRA 3FEUA 3UEMA 4ECJA 4Z2UA 2GT6A 5DCHA 1NM3A 2CX4A 2FGXA 1T7PB 4HQSA 3SBCA 3VI7A 3R3EA 4RQXA 5J9BA 4LL1B 5EL8A 1WPIA 4IP6A 4QL7A 3ZMLA 2VAFA 1UVZA 1GSSA 4GWRA 4PQ1A 4HQZA 2GSTA 1EGOA 1ZMAA 2H0HA 2GQLA 3H1NA 3I43A 1GP1A 2RUEA 2IMEA 1XWKA 2FWFA 5GSTA 2WB9A 1OAZA 4GDFA 1YEPA 1SK0A 4K1FA 3QAGA 1NSWA 4K7NA 3IV4A 4KCAA 1A8YA 5CNWA 3TKSA 3KCMA 3WT1A 1V40A 4OD7A 2OBIA 3TOUA 3ZTLA 1GSYA 3LYKA 1X9WB 4L8EA 3FZ9A 3DIEA 4PUFC 2DMLA 1F6MC 4N0VA 2YJHA 1ZL9A 4IHUA 5J40A 3ZIJA 2OKAA 5J3RA 5A34B 4G2EA 4NV5A 2I4AA 3QMXA 4PNGA 2AYTA 1PKZA 1LU4A 4PQHA 4HU9A 4WBJA 2XC2A 2DC5A 5G5FA 1AC1A 2P31A 2HZEA 3WGDA 3TB2A 2HSHA 4I6XA 1JZDA 5H5RA 2HYXA 3ERGA 3VPQA 5F06A 4RUVA 4H86A 4MMMA 3QPMA 1V58A 4G9HA 4QL9A 1TK0B 1TKDB 2F8AA 4OO5A 1LJRA 1YKCA 5G31A 1GUHA 3I69A 4BVYB 2PERA 3WYWA 2HRAA 2E2GA 4EUYA 1QUWA 1MD3A 2EIOA 2WGRA 4AKXB 1JFUA 1YJ6A 2GZPA 2R0GA 3W6GA 2H1DA 1TXXA 3L0HA 4MPFA 2DKIA 3UOMA 5DALB 4PXOA 4F0BA 2J9HA 1YKAA 2FA8A 3O76A 22GSA 1GLQA 5DCGA 2IN3A 3APQA 3M9KA 4GCIA 1QXHA 2LV3A 3J7Yk 1KEBA 1A2JA 2VKZG 1JZWA 1ZYQB 2GLRA 3ISOA 4FQUA 2E7PA 4NXIA 3F9UA 2VUPA 2F3MA 1ZYNA 2I81A 1T3BA 3IAM2 4WETA 2C3QA 2X4AA 3M9JA 2GVPA 4ID0A 4KA0A 3RPPA 4GSSA 2GDRA 4KUNA 4KAEA 2O85A 4KF9A 3IDVA 2H8LA 6GSVA 3ZYWA 1KNGA 2RM6A 5G5EA 4KDYA 4ACSA 2HQTA 3EINA 2OJLA 1B8XA 4W66A 3CBUA 4K0NA 3CMIA 2B6MA 3EPTA 4GTUA 1B4PA 2MMNA 4AKHA 3GMFA 5HR0A 4MA9A 3QOUA 1YF1A 1SKSB 4PURA 2GZYA 1K3YA 4HOJA 5KOWA 3KP8A 4TR3A 4AKGA 2YV7A 2WFCA 4ECIA 2VD1A 5KOXA 4G10A 3CSIA 3IK7A 2LJRA 2WRTA 3IAS2 3IOSA 2J23A 2LJKA 4OFNA 3FHKA 2N5AA 4NPBA 3KIJA 3MIXA 4L5LA 3ZITA 1PX7A 3L78A 4NAXA 1O73A 2GGTA 5EPFA 1GH2A 3VWUA 4MJAA 2ZCTA 2LKUA 5ELAA 2L4CA 1V9WA 4YQVA 20GSA 5AISA 2B3SA 3EU3A 3TJKA 4BL7A 3QD9A 1TRVA 4IJIA 1TI1A 2M80A 2Z9SA 2CV4A 2VLVA 4ZL7A 1EWXA 4OMVA 1XZOA 4JR4A 1XCCA 3P8WA 3QFBC 5B8AA 3W8SA 2H72A 1WE0A 1N8JA 5AIXA 3DGQA 2VCTA 5C00A 2QSIA 1TRWA 4ISDA 2E0QA 1YF0A 4J2FA 2H6YA 2V6KA 1TRUA 3LWAA 2H1GA 5J5NA 2FWHA 1GUKA 4FH8A 4MJCA 4E8HA 1JZOA 1X5CA 4ZILA 2H6ZA 2VOCA 1GRXA 5AGYA 3N5OA 4JE1A 3RHCA 3FR9A 1GSUA 3GNJA 4EDZA 3KJYA 2HNLA 2A2PA 4I97A 2FY6A 5D9WA 2V1MA 1GTAA 3CSHA 2G2QA 3F4SA 3QFAC 3IPZA 2H30A 1U88A 3BJ5A 2WS2A 3HY2A 5AIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3A A;  3HYP A;  5F05 A;  3IA1 A;  5CRG A;  6GSS A;  3HCZ A;  5B7C A;  1A8L A;  1TK5 B;  17GS A;  2H70 A;  1RW1 A;  5CRW A;  5ECP B;  1AQW A;  3MWH A;  4JRR A;  2LNS A;  3IRA A;  2MMZ A;  4GLT A;  4JZQ A;  5DAK B;  1W4V A;  4XIH A;  3VUR A;  1X5D A;  2REM A;  4PX1 A;  2GT5 A;  4WR4 A;  4K6X A;  1BJX A;  1VF2 A;  1J9B A;  2NBS A;  4MJE A;  3TOT A;  1EOG A;  5D9X A;  1A0R P;  4GRF A;  4IVF A;  2IIY A;  5A5K A;  18GS A;  5G1L A;  2C0D A;  1V57 A;  2IWT A;  2TIR A;  2OE3 A;  3H8Q A;  4PGT A;  4XTS A;  3RPN A;  2XBQ A;  3ZRE A;  1VF1 A;  3D4M A;  2BJX A;  5GZZ B;  1SJI A;  1FAA A;  4KX4 A;  5CRD A;  2C3T A;  3Q6O A;  3EYT A;  4WKW A;  3U6V A;  2HT9 A;  1G7O A;  2DJK A;  2VCV A;  2I1U A;  5F0G A;  5KN0 A;  2X8G A;  5ECL B;  2RII A;  1G6W A;  5D93 A;  4ZBA A;  4CHS A;  3L9V A;  3QAV A;  3VWV A;  4K0G A;  2K8S A;  1FB0 A;  2YZH A;  2PMT A;  1I5G A;  5ECS A;  3GA4 A;  4KSM A;  4I2T A;  3VI5 A;  2H66 A;  1SD8 A;  3FRC A;  1MDJ A;  1WP0 A;  3US3 A;  2H71 A;  4K2D A;  3UL3 A;  1TRS A;  3KEB A;  4EXJ A;  1PD2 1;  4TN8 A;  4FIW A;  3ZVJ D;  4TR4 A;  1GWC A;  4G0K A;  2O87 A;  3C71 A;  2OE1 A;  5IM9 A;  4XS4 A;  1GUM A;  4G19 A;  4TXO B;  5HFI A;  5KN1 A;  2PGT A;  5DJL A;  1K0N A;  5BMU A;  1XWC A;  2HLS A;  1W89 A;  2DSA A;  2VM2 A;  3HXS A;  3DXB A;  1WMJ A;  3D5J A;  5IMD A;  3D4T A;  1F37 A;  1HNC A;  8GSS A;  1M2D A;  3H79 A;  3TDG A;  7GSS A;  2HI7 A;  2OAC A;  3MSZ A;  3GTU A;  5ECH B;  2YWM A;  4OCE A;  2H19 A;  4V1A g;  4ECC A;  5C04 A;  1R26 A;  5D8I A;  2R6K A;  3FZA A;  2B5X A;  2WUL A;  1TU8 A;  1Z7R A;  2A2R A;  3BCI A;  1QK8 A;  3DRN A;  2DBC A;  2MBS A;  1FB6 A;  3UIW A;  2YWO A;  3APO A;  2FUG 2;  2VLU A;  3I6A A;  2A4V A;  1MDK A;  4FYB A;  4IN0 A;  2DMM A;  3IBH A;  1XWB A;  1OC9 A;  1V2A A;  3IK9 A;  3D22 A;  1T4Y A;  1IYI A;  4EF0 A;  3ZFB A;  1Z6N A;  1FVK A;  3KH9 A;  2G0F A;  4PUA A;  3TCO A;  5IMV A;  4Q5R A;  1CQG A;  2RM5 A;  3F4R A;  3Q19 A;  4F82 A;  1EGR A;  1AIU A;  1TTZ A;  4D73 A;  5IPG A;  3TJF A;  3ZL5 A;  2YV9 A;  2JAD A;  3KM6 A;  2R37 A;  3W8J A;  2L5L A;  4V2L A;  3D21 A;  4YAV A;  2R2J A;  2HE3 A;  3MDK A;  4HEA 2;  2V32 A;  2PPT A;  2XHF A;  3VPT A;  2GZZ A;  4MPG A;  2PUK C;  5CP1 A;  3TUE A;  3ME8 A;  4DVC A;  3H4K A;  2HXK A;  2M46 A;  4Z7X A;  1Q98 A;  3AY8 A;  4ZL9 A;  5F8B A;  3TRP A;  3J7Y b;  1FVJ A;  1TU7 A;  2VCQ A;  2H75 A;  2AUV A;  5HR3 A;  1WWJ A;  3GUR A;  2H73 A;  3TRX A;  4YQU A;  1HNB A;  3WD6 A;  4DSQ A;  4KDU A;  5ECQ B;  3EU4 A;  4V1A p;  2CVD A;  4IP1 A;  1ZYE A;  2MBT A;  9GSS A;  2JZR A;  1A24 A;  1HD2 A;  4ULX A;  4I8B A;  1BYE A;  4MF7 A;  3GKX A;  4BWS A;  3ZVJ A;  2YN1 A;  3BOA A;  1SD9 A;  1IYH A;  2KP2 A;  1EP7 A;  4Q5F A;  3GH6 A;  1X9S B;  2NPB A;  4LA1 A;  1WJK A;  2K6V A;  1H75 A;  2ES7 A;  3GN3 A;  2CA8 A;  2ZNM A;  3G7J A;  3FR3 A;  2DLX A;  2JZS A;  4MJB A;  2VL9 A;  3M8N A;  2KUC A;  1XWA A;  2XBI A;  4XCS A;  1R4W A;  1U87 A;  1O8X A;  2LEG A;  3KH7 A;  1PMT A;  5D73 A;  1F9M A;  3ZMK A;  5DJM A;  2CAI A;  1O6J A;  1MEK A;  2F51 A;  2MMA A;  1B4Q A;  2B7J A;  3M0F A;  3K8N A;  1GSD A;  5IPH A;  3ED3 A;  2JSY A;  1M7T A;  4XRA A;  3FZ4 A;  1YEX A;  1DUG A;  2DJJ A;  1AAZ A;  3ZIV A;  1CQH A;  6GST A;  3GFK A;  4MF5 A;  4HI7 A;  2VL2 C;  4HZ4 A;  3TKP A;  4G0L A;  1AQX A;  4EO3 A;  3C1S A;  5JWQ B;  2HRK A;  2B1L A;  2C8U A;  3KXO A;  2YWN A;  5IMC A;  5B6N A;  4E8E A;  4KW6 A;  3HJP A;  4JED A;  4POB A;  3DWV A;  1OC8 A;  4YAP A;  2HSM A;  2VCX A;  3BCK A;  3HD5 A;  1SU9 A;  2A2S A;  3EC3 A;  2H1A A;  4NWY A;  11GS A;  2PVO C;  3F63 A;  4XS6 A;  1XW5 A;  1M9B A;  4BPY A;  1ST9 A;  2FNO A;  3EE2 A;  3M3M A;  1SK1 A;  1SKW B;  5INY A;  1S3C A;  1G7E A;  3JCM L;  3C73 A;  2VM1 A;  1NHY A;  3LXZ A;  1KBN A;  1B9X C;  1VRS D;  4DSR A;  5JCG A;  1UA5 A;  2DIZ A;  1PGT A;  1ZCP A;  2YJ7 A;  1EEJ A;  4BL7 B;  2LRN A;  6GSU A;  2GQK A;  1TJD A;  2B5E A;  4EC0 A;  5H5Q A;  3PR8 A;  2CZ2 A;  2C0F A;  4P3Y B;  1H4O A;  19GS A;  3GST A;  5CAX A;  2FCH A;  6GSW A;  3RAZ A;  3GKN A;  1GSQ A;  3LYP A;  1ZGN A;  2R4V A;  3FR6 A;  1G6Y A;  5CRH A;  4QQ7 A;  4BVX A;  3QDN A;  3LG6 A;  3UBL A;  2FWG A;  5J41 A;  1M99 A;  3LEF A;  5IQY A;  2ALB A;  2H76 A;  2WZ9 A;  1O8W A;  4BWQ A;  1A23 A;  1AQV A;  2K18 A;  3E0U A;  1MDI A;  4K7O A;  4MZW A;  5IOW A;  1TP9 A;  1OE8 A;  5DQY A;  2P5R A;  3ZZX A;  4J56 E;  3P2A A;  1A2L A;  1UC7 A;  2H01 A;  2X8C A;  2IFQ A;  5COH A;  1K0M A;  1U3I A;  3F6D A;  1PKW A;  3GL5 A;  1WOU A;  1ERT A;  2GSQ A;  2C80 A;  4O7H A;  1F3B A;  3CTF A;  4ZIJ A;  5LNK e;  2VCZ A;  4MAB A;  2LQQ A;  5A4U A;  4JR6 A;  3BD2 A;  4EL1 A;  3NOF A;  1KTE A;  2GQM A;  1K0B A;  5B6M A;  3DML A;  4IQA A;  2JZT A;  4FYU A;  2F9S A;  4USS A;  1B9Y C;  3WGE A;  3GKK A;  1GSF A;  3GKM A;  5FHI A;  3KTL A;  3NZN A;  5HR1 A;  2O8V B;  4K9Z A;  3P90 A;  1WRY A;  2H6X A;  4V2M A;  1VGL A;  1K3L A;  2FA4 A;  2X64 A;  4ZXG A;  4G0I A;  1BQ7 A;  5ECR B;  2K9F A;  3C1R A;  3DD3 A;  2LUS A;  1OKD A;  1DE2 A;  3PIN A;  4MH3 A;  1J0F A;  1GSE A;  4ZB9 A;  2DJ0 A;  5G30 A;  4WBR D;  2XPD A;  1X9M B;  1OC3 A;  4EVM A;  4KB3 A;  4IW9 A;  3UJ1 A;  2I3Y A;  6GSX A;  4ZBB A;  1FHE A;  2FWE A;  2OAD A;  3PH9 A;  4KGI A;  4F9Z A;  2L57 A;  1PA3 A;  4YH2 A;  5ID2 A;  3UAR A;  4GF0 A;  2CQ9 A;  4MLY A;  1YQ1 A;  3L9U A;  2YPM A;  1QFN A;  4DSS A;  3GX8 A;  2B7K A;  3G7Y A;  4TR0 A;  2M72 A;  1Y25 A;  2HSY A;  3BBY A;  5IO2 A;  2VIM A;  4L0W A;  3FK8 A;  2K8V A;  4F2I A;  4HZ2 A;  1WIK A;  2H0G A;  1PX6 A;  5CO3 A;  1X5E A;  3LXT A;  5G2Z A;  1F2E A;  2JAC A;  4WF4 A;  1AW9 A;  5D96 A;  4EDY A;  1ZZY A;  2YZU A;  4HJM A;  1NHO A;  2H74 A;  2JSZ A;  3FYG A;  2YNX A;  4TW5 A;  3LGC A;  4TR1 A;  4K8M A;  2CVK A;  1ZOF A;  1GTI A;  4XS4 B;  3DKS A;  1RQM A;  3LSZ A;  3Q74 A;  2CZ3 A;  3F8U A;  2PN8 A;  3ZFL A;  3V1W A;  4KND A;  2H0I A;  2LTK A;  4F03 A;  1HQO A;  2O7K A;  1FO5 A;  3FZ5 A;  2L4Q A;  1THO A;  2LST A;  5FT3 A;  1V98 A;  3F6F A;  3A2X A;  1PN9 A;  2BTO T;  2F8F A;  1UN2 A;  2N5F A;  4XS1 A;  3DVX A;  3UVT A;  4IS0 A;  5J4U A;  1JLV A;  2TRC P;  1TW9 A;  4L5O A;  5CRE A;  3GTU B;  2GTU A;  4POL A;  1M9A A;  10GS A;  2QC7 A;  2LRC A;  2B5Y A;  2WJU A;  3KTB A;  5DVB A;  1EOH A;  1PL2 A;  1XXU A;  3DEX A;  1Z6M A;  3WT2 A;  4RI7 A;  3C8E A;  1GNE A;  1DSB A;  4NV2 A;  3F3Q A;  3KGK A;  4CW9 A;  1LBK A;  1OC9 B;  3GV1 A;  4JU5 A;  1K3O A;  6GSY A;  3GHA A;  2C4J A;  1MTC A;  1SJZ A;  3KP9 A;  1SYR A;  2OBK A;  4MZC A;  4LL4 B;  2L5O A;  1GTU A;  4D73 B;  2DJ1 A;  1YDK A;  1M2B A;  2YCD A;  4EKZ A;  3ERF A;  2DIY A;  3L4N A;  1XFL A;  2YWI A;  4I2U A;  3G9B A;  5HQP A;  3HHV A;  1A0F A;  2HZF A;  4WR5 A;  2PBJ A;  4XHM A;  2WCI A;  1ON4 A;  3FKF A;  3GIX A;  2EC4 A;  3I9V 2;  4X0X A;  1RK4 A;  3L9S A;  5D9V A;  4IKH A;  1GNW A;  3A2W A;  4KSO A;  2C0E A;  4Q5N A;  2I9H A;  3IC8 A;  3M1G A;  2PWJ A;  2ZUP A;  2VCW A;  4MF6 A;  4MK3 A;  5E4W A;  4OFT A;  2HZE B;  5KN2 A;  1YZX A;  3IXR A;  4JBB A;  4O32 A;  1F3A A;  5LCZ A;  2NTO A;  1BG5 A;  3CRT A;  1FG4 A;  5JCW A;  3VLN A;  4TOP A;  1ERU A;  4OFM A;  1DE1 A;  5DQS A;  1FOV A;  1SJ6 A;  2R5G A;  1NW2 A;  4IEL A;  3ZLP A;  1T4Z A;  1G0T A;  5IMA A;  3Q18 A;  2HFD A;  1XVW A;  3CXG A;  4CDO A;  5HFG A;  3UVH A;  4ECB A;  4NHZ A;  4WXT A;  1ERV A;  1U3A A;  1Y6E A;  4TRX A;  3A3T A;  2LRT A;  3MNG A;  5IIZ A;  2QKE A;  3TJG A;  3HJM A;  3MAK A;  4ML1 A;  4N10 A;  4ILF A;  3HJO A;  5IO0 A;  2V2G A;  3KZQ A;  4O92 A;  4IGJ A;  1EV9 A;  3F0I A;  3H93 A;  2X8H A;  1K0D A;  2FLS A;  5GSS A;  2NDO A;  2LQO A;  2X99 A;  4HU7 A;  2C3N A;  3HZ4 A;  3WGX A;  4PNF A;  2GSR A;  3HDC A;  1TK8 B;  4OCF A;  5IMZ A;  1K0C A;  1M2A A;  2IJY A;  1HNA A;  2GS3 A;  1SKR B;  3EVI A;  4F0C A;  3HKR A;  1OVN A;  1QQ2 A;  3R2Q A;  4YQM A;  5FWG A;  3KMO A;  3GSS A;  4L0U A;  2HRK B;  3UBK A;  5IOX A;  1GLP A;  3A5W A;  4XRD A;  3E9J B;  4OWY A;  2HSM B;  4BVY A;  5CYY A;  3VK9 A;  3EMP A;  5EVO A;  2D2Z A;  4PQI A;  1EZK A;  4PTS A;  3IC4 A;  1BAY A;  4KH7 A;  2PU9 C;  3GL3 A;  4IJ3 A;  3E3E A;  5DAL A;  5L71 A;  2FD3 A;  4IBP A;  2C0G A;  1X0R A;  4ZL8 A;  4K7I A;  1O85 A;  3TRQ A;  1AUC A;  4FYC A;  1K0A A;  3U5R E;  2KP1 A;  2LS5 A;  5LD0 A;  5GAP D;  4WEY A;  3CRU A;  4KCE A;  1PSQ A;  4LMV A;  1PL1 A;  3TKS E;  5HFK A;  3EWL A;  2V6O A;  3PPU A;  1Z9H A;  3KMN A;  14GS A;  2ON5 A;  2IMK A;  3N9J A;  3SWL A;  3C7M A;  5KN3 A;  2JL4 A;  2YAN A;  1Z7P A;  2AHE A;  4HJ2 A;  1XIY A;  3KD0 A;  4AGS A;  4N0Z A;  1TOF A;  1TDI A;  2XPE A;  3IR4 A;  1ILO A;  5ELG A;  4NHW A;  3NIV A;  3TGZ A;  2IMI A;  1XPV A;  1SL0 B;  4IQ1 A;  1MD4 A;  3P7X A;  4BVX B;  5ECO B;  3GH9 A;  3HVV A;  2MZC A;  4FO5 A;  3A2V A;  1XWG A;  1XW6 A;  1C72 A;  4BA7 A;  5KEJ A;  1R5A A;  1ACV A;  3EUR A;  3HVS A;  5ENU A;  2IMF A;  2PVQ A;  1E2Y A;  3HVX A;  4X1U A;  3FY7 A;  3RHB A;  5HR2 A;  2P5Q A;  13GS A;  4MH2 A;  4EE0 A;  1T8E B;  1OKT A;  4KE3 A;  3LFL A;  4AJ7 A;  4NMU A;  1THX A;  2YP6 A;  2IFQ B;  1XBS A;  1SL2 B;  1XOA A;  2IMD A;  2WDU A;  4OO4 A;  5EY6 A;  3TKS C;  4MDC A;  5JWO B;  4MZB A;  4AF2 A;  1S3D A;  1T00 A;  5A4W A;  3ERW A;  2LJA A;  5G1K A;  1SK2 A;  2MYG A;  1SL1 B;  1O81 A;  5JWR B;  2KOK A;  4Q5Q A;  3TJB A;  4WF5 A;  2RLI A;  1FW1 A;  3F4T A;  3RBT A;  2E2M A;  3UAP A;  1R7H A;  1VF3 A;  5DDL A;  1O7U A;  4AJ6 A;  2HSN B;  3PGT A;  1JHB A;  1Z5Y E;  1R5P A;  3ME7 A;  3LOR A;  2VLT A;  5IMF A;  2R3X A;  1OE7 A;  5J9C A;  2JU5 A;  1ML6 A;  16GS A;  1USB A;  1Z3E A;  4I5Q A;  2IPA A;  4N30 A;  2KHP A;  1EV4 A;  2H1B A;  4ML6 A;  3D0Z A;  4V2N A;  2CT6 A;  3CTG A;  3HZ8 A;  2N5B A;  5A4V A;  4GST A;  3LJR A;  4KDX A;  2VD0 A;  1VF4 A;  4TVE A;  5ABR A;  5ID2 B;  3F3R A;  2EIQ A;  3OR5 A;  4J57 E;  2C1Y A;  4DSS B;  1J08 A;  4AJ8 A;  2L59 A;  1XVQ A;  1TI3 A;  2OA7 A;  3GRX A;  3ZRD A;  5B8B A;  3QAW A;  4HDE A;  5ECN B;  2MMO A;  2LNT A;  4RQR A;  4TKY A;  2HRN A;  2VL3 A;  4N11 A;  1EEM A;  4LMW A;  5ECI B;  5E59 A;  1JZR A;  2AJQ B;  1PQN A;  4HUA A;  2P0G A;  3S9F A;  1YY7 A;  4ZB8 A;  3RDW A;  2KLX A;  2AAW A;  2IL3 A;  2ON7 A;  2BMX A;  3VWX A;  2AV4 A;  3D6I A;  4TR1 B;  3GUS A;  2RUF A;  2GSS A;  2HRF A;  1GUL A;  5DAK A;  3CYN A;  1SEN A;  5D9T A;  1M0U A;  2DJ2 A;  1ABA A;  1ERW A;  1GTB A;  3G7I A;  4DEJ A;  1BED A;  2AB6 A;  5ECK B;  2O89 A;  4X43 A;  5AN1 A;  3TKQ A;  1SYX A;  1QGV A;  1QMV A;  5F07 A;  4GXZ A;  4TXV A;  3TJJ A;  3CSJ A;  3IE3 A;  3O3T A;  2L6D A;  2YOI A;  4POK A;  3TKR A;  2V41 A;  3FW2 A;  3VFI A;  1A2M A;  1HYU A;  2QGV A;  1I9D A;  2B1K A;  1E6B A;  2NVL A;  2L6C A;  2VL2 A;  3UMA A;  1AXD A;  1Q4J A;  5DBQ A;  1U6T A;  3QR6 A;  4POM A;  5GAN D;  4LLR A;  1T1V A;  4O5R A;  5H5S A;  5JCU A;  4ZBD A;  1BX9 A;  4ZB6 A;  12GS A;  3GX0 A;  1DBY A;  4GQC A;  2CVB A;  3VWW A;  4GSN A;  2OE0 A;  2EIR A;  3IHQ A;  2TRX A;  3QCP A;  1OYJ A;  1K0O A;  3EMX A;  1B48 A;  4MP4 A;  1XOB A;  3APS A;  1JLW A;  4MCU A;  2UZ8 A;  3HA9 A;  3O6T A;  4HS1 A;  3LQ7 A;  2CAQ A;  2DJ3 A;  2FHE A;  1N2A A;  1XW9 A;  3DVW A;  3GYK A;  1URM A;  1PRX A;  4TXO A;  1EP8 A;  1GL8 A;  4GQF A;  5ECM B;  2CX3 A;  4RI6 A;  2VO4 A;  3DYR A;  3FEU A;  3UEM A;  4ECJ A;  2GT6 A;  5DCH A;  1NM3 A;  2CX4 A;  2FGX A;  1T7P B;  4HQS A;  3SBC A;  3VI7 A;  3R3E A;  4RQX A;  5J9B A;  4LL1 B;  5EL8 A;  1WPI A;  4IP6 A;  4QL7 A;  3ZML A;  2VAF A;  1UVZ A;  1GSS A;  4GWR A;  4PQ1 A;  4HQZ A;  2GST A;  1EGO A;  1ZMA A;  2H0H A;  2GQL A;  3H1N A;  3I43 A;  1GP1 A;  2RUE A;  2IME A;  1XWK A;  2FWF A;  5GST A;  2WB9 A;  1OAZ A;  1YEP A;  1SK0 A;  4K1F A;  3QAG A;  1NSW A;  4K7N A;  3IV4 A;  4KCA A;  1A8Y A;  5CNW A;  3TKS A;  3KCM A;  3WT1 A;  1V40 A;  4OD7 A;  2OBI A;  3TOU A;  3ZTL A;  1GSY A;  3LYK A;  1X9W B;  4L8E A;  3FZ9 A;  3DIE A;  4PUF C;  2DML A;  1F6M C;  4N0V A;  2YJH A;  1ZL9 A;  4IHU A;  3ZIJ A;  2OKA A;  5J3R A;  4G2E A;  4NV5 A;  2I4A A;  3QMX A;  4PNG A;  2AYT A;  1PKZ A;  1LU4 A;  4PQH A;  4HU9 A;  4WBJ A;  2XC2 A;  2DC5 A;  5G5F A;  1AC1 A;  2P31 A;  2HZE A;  3WGD A;  3TB2 A;  2HSH A;  4I6X A;  1JZD A;  5H5R A;  2HYX A;  3ERG A;  3VPQ A;  5F06 A;  4RUV A;  4H86 A;  4MMM A;  3QPM A;  1V58 A;  4G9H A;  4QL9 A;  1TK0 B;  1TKD B;  2F8A A;  4OO5 A;  1LJR A;  1YKC A;  5G31 A;  1GUH A;  3I69 A;  4BVY B;  2PER A;  3WYW A;  2HRA A;  2E2G A;  4EUY A;  1QUW A;  1MD3 A;  2EIO A;  2WGR A;  1JFU A;  1YJ6 A;  2GZP A;  3W6G A;  2H1D A;  1TXX A;  3L0H A;  4MPF A;  3UOM A;  5DAL B;  4PXO A;  4F0B A;  2J9H A;  1YKA A;  2FA8 A;  3O76 A;  22GS A;  1GLQ A;  5DCG A;  2IN3 A;  3APQ A;  3M9K A;  4GCI A;  1QXH A;  2LV3 A;  3J7Y k;  1KEB A;  1A2J A;  1JZW A;  1ZYQ B;  2GLR A;  3ISO A;  4FQU A;  2E7P A;  4NXI A;  3F9U A;  2VUP A;  2F3M A;  2I81 A;  1T3B A;  3IAM 2;  4WET A;  2C3Q A;  3M9J A;  2GVP A;  4ID0 A;  4KA0 A;  3RPP A;  4GSS A;  2GDR A;  4KUN A;  4KAE A;  2O85 A;  4KF9 A;  3IDV A;  2H8L A;  6GSV A;  3ZYW A;  1KNG A;  2RM6 A;  5G5E A;  4KDY A;  4ACS A;  2HQT A;  3EIN A;  2OJL A;  1B8X A;  3CBU A;  4K0N A;  3CMI A;  2B6M A;  4GTU A;  1B4P A;  2MMN A;  3GMF A;  5HR0 A;  4MA9 A;  3QOU A;  1YF1 A;  1SKS B;  4PUR A;  2GZY A;  1K3Y A;  4HOJ A;  3KP8 A;  4TR3 A;  2YV7 A;  2WFC A;  4ECI A;  2VD1 A;  4G10 A;  3CSI A;  3IK7 A;  2LJR A;  2WRT A;  3IAS 2;  3IOS A;  2J23 A;  2LJK A;  4OFN A;  3FHK A;  2N5A A;  4NPB A;  3KIJ A;  4L5L A;  3ZIT A;  1PX7 A;  3L78 A;  4NAX A;  1O73 A;  2GGT A;  5EPF A;  1GH2 A;  3VWU A;  4MJA A;  2ZCT A;  2LKU A;  5ELA A;  2L4C A;  1V9W A;  4YQV A;  20GS A;  5AIS A;  2B3S A;  3EU3 A;  3TJK A;  4BL7 A;  3QD9 A;  1TRV A;  4IJI A;  1TI1 A;  2M80 A;  2Z9S A;  2CV4 A;  2VLV A;  4ZL7 A;  1EWX A;  4OMV A;  1XZO A;  4JR4 A;  1XCC A;  3P8W A;  3QFB C;  5B8A A;  3W8S A;  2H72 A;  1WE0 A;  1N8J A;  5AIX A;  3DGQ A;  2VCT A;  5C00 A;  2QSI A;  1TRW A;  4ISD A;  2E0Q A;  1YF0 A;  4J2F A;  2H6Y A;  2V6K A;  1TRU A;  3LWA A;  2H1G A;  5J5N A;  2FWH A;  4FH8 A;  1GUK A;  4MJC A;  4E8H A;  1JZO A;  1X5C A;  4ZIL A;  2H6Z A;  2VOC A;  1GRX A;  5AGY A;  3N5O A;  4JE1 A;  3RHC A;  3FR9 A;  1GSU A;  3GNJ A;  4EDZ A;  3KJY A;  2HNL A;  4I97 A;  2FY6 A;  5D9W A;  2V1M A;  1GTA A;  3CSH A;  2G2Q A;  3F4S A;  3QFA C;  3IPZ A;  2H30 A;  1U88 A;  3BJ5 A;  2WS2 A;  3HY2 A;  5AIV A; 
#chains in the Genus database with same CATH topology
 1S3A A;  3HYP A;  5F05 A;  3IA1 A;  4QMK A;  5CRG A;  6GSS A;  3HCZ A;  5B7C A;  1A8L A;  1TK5 B;  17GS A;  2H70 A;  1RW1 A;  5CRW A;  5ECP B;  1AQW A;  3MWH A;  4JRR A;  4AI6 A;  2LNS A;  5A1N A;  3FMW A;  3IRA A;  2MMZ A;  4GLT A;  4JZQ A;  5DAK B;  1W4V A;  4XIH A;  3VUR A;  1X5D A;  2REM A;  1SVL A;  4PX1 A;  2GT5 A;  4PHZ C;  4WR4 A;  4K6X A;  1BJX A;  1VF2 A;  1J9B A;  2NBS A;  4MJE A;  3TOT A;  1EOG A;  5D9X A;  1A0R P;  4GRF A;  4IVF A;  2IIY A;  5A5K A;  18GS A;  5G1L A;  2C0D A;  1V57 A;  2IWT A;  4K2X A;  2TIR A;  3HMJ G;  2OE3 A;  3H8Q A;  4PGT A;  4XTS A;  3RPN A;  2XBQ A;  3ZRE A;  1VF1 A;  3D4M A;  2BJX A;  5GZZ B;  1SJI A;  1FAA A;  4KX4 A;  5CRD A;  2C3T A;  3Q6O A;  3EYT A;  3CHX C;  4WKW A;  3U6V A;  2HT9 A;  1G7O A;  2DJK A;  2VCV A;  2I1U A;  2WVY A;  5F0G A;  5KN0 A;  2X8G A;  5ECL B;  2RII A;  1G6W A;  5D93 A;  4ZBA A;  4CHS A;  3L9V A;  3QAV A;  3VWV A;  4K0G A;  2K8S A;  1FB0 A;  2YZH A;  2PMT A;  1I5G A;  5ECS A;  3GA4 A;  4KSM A;  4I2T A;  3VI5 A;  2H66 A;  1SD8 A;  3FRC A;  1MDJ A;  1WP0 A;  3US3 A;  2H71 A;  4K2D A;  3UL3 A;  1TRS A;  3KEB A;  4EXJ A;  1PD2 1;  4TN8 A;  4FIW A;  3ZVJ D;  4TR4 A;  1GWC A;  4G0K A;  2O87 A;  3C71 A;  1M3J A;  2OE1 A;  2EFC A;  5IM9 A;  4XS4 A;  1GUM A;  4N3Z A;  4G19 A;  4TXO B;  5HFI A;  5KN1 A;  2PGT A;  5DJL A;  1K0N A;  5BMU A;  1XWC A;  2HLS A;  2H1L A;  1W89 A;  2DSA A;  2VM2 A;  3HXS A;  3DXB A;  1WMJ A;  3D5J A;  5IMD A;  3D4T A;  1F37 A;  1HNC A;  8GSS A;  1M2D A;  3H79 A;  3TDG A;  7GSS A;  2HI7 A;  2OAC A;  3MSZ A;  1PN0 A;  3GTU A;  5ECH B;  2YWM A;  4OCE A;  2H19 A;  4V1A g;  4ECC A;  5C04 A;  1R26 A;  5D8I A;  2R6K A;  3FZA A;  1BF5 A;  2B5X A;  2WUL A;  1TU8 A;  1Z7R A;  2A2R A;  3BCI A;  1QK8 A;  3DRN A;  2DBC A;  2MBS A;  1FB6 A;  3UIW A;  2YWO A;  4HSC X;  3APO A;  2FUG 2;  2VLU A;  3I6A A;  2A4V A;  1MDK A;  4FYB A;  4IN0 A;  2DMM A;  3IBH A;  1XWB A;  1OC9 A;  1V2A A;  3IK9 A;  3D22 A;  1T4Y A;  1IYI A;  4EF0 A;  3ZFB A;  1Z6N A;  1FVK A;  3KH9 A;  3LW9 A;  2G0F A;  1PFO A;  4PUA A;  1I1I P;  3TCO A;  5IMV A;  4Q5R A;  1CQG A;  2RM5 A;  3F4R A;  3Q19 A;  4F82 A;  1EGR A;  1AIU A;  1TTZ A;  4D73 A;  5IPG A;  3TJF A;  3ZL5 A;  2YV9 A;  1M3I A;  2JAD A;  3KM6 A;  2R37 A;  3W8J A;  2L5L A;  4V2L A;  3D21 A;  4YAV A;  2R2J A;  2HE3 A;  3MDK A;  4HEA 2;  2V32 A;  2PPT A;  2XHF A;  3VPT A;  2GZZ A;  2WZS A;  4MPG A;  2PUK C;  5CP1 A;  3TUE A;  3ME8 A;  2WVX A;  4DVC A;  2EFE A;  3H4K A;  1S4B P;  2HXK A;  2M46 A;  4Z7X A;  1Q98 A;  3AY8 A;  4ZL9 A;  5F8B A;  3TRP A;  3J7Y b;  1FVJ A;  1TU7 A;  2VCQ A;  2H75 A;  2AUV A;  5HR3 A;  1WWJ A;  3GUR A;  2H73 A;  3TRX A;  4YQU A;  1HNB A;  3WD6 A;  4DSQ A;  4KDU A;  5ECQ B;  3EU4 A;  4V1A p;  4EIP A;  2CVD A;  4IP1 A;  1ZYE A;  2MBT A;  9GSS A;  2JZR A;  1A24 A;  4O5U A;  1HD2 A;  4ULX A;  4I8B A;  1BYE A;  4MF7 A;  3GKX A;  4BWS A;  3ZVJ A;  2YN1 A;  3BOA A;  1SD9 A;  1IYH A;  2KP2 A;  1EP7 A;  4Q5F A;  3GH6 A;  1X9S B;  2NPB A;  4LA1 A;  1WJK A;  2K6V A;  1H75 A;  2ES7 A;  3GN3 A;  2CA8 A;  2ZNM A;  3G7J A;  3FR3 A;  2DLX A;  2JZS A;  4MJB A;  2VL9 A;  3M8N A;  2KUC A;  1XWA A;  2XBI A;  4XCS A;  1R4W A;  1U87 A;  1O8X A;  2LEG A;  1YEW C;  3KH7 A;  1PMT A;  5D73 A;  1F9M A;  3ZMK A;  5DJM A;  2CAI A;  4AKI A;  1O6J A;  1MEK A;  2F51 A;  2MMA A;  1B4Q A;  2B7J A;  3M0F A;  3K8N A;  1GSD A;  5IPH A;  3ED3 A;  2JSY A;  1M7T A;  4XRA A;  3FZ4 A;  4PI0 C;  1DUG A;  1YEX A;  2DJJ A;  1AAZ A;  3ZIV A;  1CQH A;  6GST A;  3GFK A;  4MF5 A;  4HI7 A;  2VL2 C;  4HZ4 A;  3TKP A;  4G0L A;  1AQX A;  4EO3 A;  1XG8 A;  3C1S A;  5JWQ B;  2HRK A;  2B1L A;  4YKF A;  2C8U A;  3KXO A;  2YWN A;  5IMC A;  5B6N A;  4E8E A;  1BG1 A;  4KW6 A;  3HJP A;  4JED A;  1ZYP A;  4POB A;  3DWV A;  1OC8 A;  4YAP A;  2HSM A;  2VCX A;  3BCK A;  3HD5 A;  5A5H A;  1SU9 A;  2A2S A;  3EC3 A;  2QA1 A;  2H1A A;  4NWY A;  11GS A;  2PVO C;  3F63 A;  4XS6 A;  1XW5 A;  1M9B A;  4BPY A;  1ST9 A;  2FNO A;  3EE2 A;  3M3M A;  1SK1 A;  1SKW B;  5INY A;  1S3C A;  1G7E A;  3JCM L;  3C73 A;  2VM1 A;  3MYD A;  1NHY A;  3LXZ A;  1KBN A;  2X49 A;  1B9X C;  1VRS D;  4DSR A;  5JCG A;  1UA5 A;  2DIZ A;  1PGT A;  1ZCP A;  2YJ7 A;  1EEJ A;  2WW2 A;  4BL7 B;  2LRN A;  6GSU A;  2GQK A;  1TJD A;  2B5E A;  4EC0 A;  5H5Q A;  3PR8 A;  2CZ2 A;  2C0F A;  4P3Y B;  1H4O A;  19GS A;  3GST A;  5CAX A;  2FCH A;  6GSW A;  3RAZ A;  3GKN A;  1GSQ A;  3LYP A;  1ZGN A;  2R4V A;  3FR6 A;  1G6Y A;  5CRH A;  4QQ7 A;  4BVX A;  3QDN A;  4CY6 A;  3LG6 A;  3UBL A;  2FWG A;  5J41 A;  1M99 A;  3LEF A;  5IQY A;  2ALB A;  3RGB C;  2H76 A;  2WZ9 A;  1O8W A;  4BWQ A;  1A23 A;  1AQV A;  2K18 A;  3E0U A;  1MDI A;  4K7O A;  4MZW A;  5IOW A;  1TP9 A;  1OE8 A;  5DQY A;  2P5R A;  3ZZX A;  4J56 E;  3P2A A;  1A2L A;  4MNN A;  1SVO A;  1UC7 A;  2H01 A;  3CQF A;  2X8C A;  2IFQ A;  5COH A;  1K0M A;  1U3I A;  3F6D A;  1PKW A;  3GL5 A;  3TU3 B;  1WOU A;  1ERT A;  2GSQ A;  2C80 A;  4O7H A;  1F3B A;  3CTF A;  4ZIJ A;  5LNK e;  2VCZ A;  4MAB A;  2LQQ A;  5A4U A;  5A1N B;  4JR6 A;  3BD2 A;  4EL1 A;  3NOF A;  1KTE A;  2GQM A;  1K0B A;  5B6M A;  3DML A;  4IQA A;  2JZT A;  4FYU A;  2F9S A;  4USS A;  1B9Y C;  3WGE A;  3GKK A;  1GSF A;  3GKM A;  2HSN A;  3CWG A;  5FHI A;  3KTL A;  3NZN A;  4CY8 A;  5HR1 A;  2O8V B;  4K9Z A;  3P90 A;  1WRY A;  2H6X A;  4V2M A;  1VGL A;  1K3L A;  2FA4 A;  2X64 A;  4ZXG A;  4G0I A;  1BQ7 A;  5ECR B;  2K9F A;  3C1R A;  3DD3 A;  2LUS A;  1OKD A;  1DE2 A;  3PIN A;  4MH3 A;  1J0F A;  1GSE A;  4ZB9 A;  2DJ0 A;  5G30 A;  4WBR D;  2XPD A;  1X9M B;  1OC3 A;  4EVM A;  4KB3 A;  4IW9 A;  3UJ1 A;  2I3Y A;  6GSX A;  4ZBB A;  1FHE A;  2FWE A;  2OAD A;  2EFH A;  3PH9 A;  4KGI A;  4F9Z A;  4PI2 C;  2L57 A;  1PA3 A;  4YH2 A;  5ID2 A;  3UAR A;  4GF0 A;  2CQ9 A;  4MLY A;  1YQ1 A;  3L9U A;  2YPM A;  1QFN A;  4DSS A;  3GX8 A;  2B7K A;  3G7Y A;  4TR0 A;  2M72 A;  1Y25 A;  2A4H A;  2HSY A;  3BBY A;  5IO2 A;  2VIM A;  4L0W A;  3FK8 A;  2K8V A;  4F2I A;  4HZ2 A;  1WIK A;  2H0G A;  1PX6 A;  5CO3 A;  1X5E A;  3LXT A;  5G2Z A;  1F2E A;  2JAC A;  4WF4 A;  1AW9 A;  5D96 A;  4EDY A;  1ZZY A;  2YZU A;  4HJM A;  1NHO A;  2H74 A;  2JSZ A;  3FYG A;  2YNX A;  4TW5 A;  3LGC A;  4TR1 A;  4K8M A;  5J47 A;  2CVK A;  1ZOF A;  1GTI A;  4XS4 B;  3DKS A;  1RQM A;  3LSZ A;  3Q74 A;  2CZ3 A;  3F8U A;  2PN8 A;  1FOH A;  3ZFL A;  3V1W A;  4KND A;  5BMU B;  2H0I A;  2LTK A;  4F03 A;  1HQO A;  2O7K A;  4E68 A;  3FZ5 A;  1FO5 A;  2L4Q A;  1THO A;  2LST A;  5FT3 A;  1V98 A;  3F6F A;  3A2X A;  1PN9 A;  2BTO T;  2F8F A;  1UN2 A;  2N5F A;  4XS1 A;  3DVX A;  3UVT A;  4IS0 A;  5J4U A;  1JLV A;  2TRC P;  4BIK A;  1TW9 A;  4L5O A;  5CRE A;  3GTU B;  2GTU A;  4POL A;  1Y1U A;  1M9A A;  10GS A;  2QC7 A;  2LRC A;  2B5Y A;  2WJU A;  3KTB A;  5DVB A;  1EOH A;  1PL2 A;  1XXU A;  3DEX A;  1Z6M A;  3WT2 A;  4Z2T A;  4RI7 A;  3C8E A;  1GNE A;  1DSB A;  4NV2 A;  3F3Q A;  3KGK A;  4CW9 A;  1LBK A;  1OC9 B;  3GV1 A;  4JU5 A;  1K3O A;  6GSY A;  3GHA A;  2C4J A;  1MTC A;  1SJZ A;  3KP9 A;  1YVL A;  1SYR A;  2OBK A;  4MZC A;  4LL4 B;  2L5O A;  1GTU A;  4D73 B;  2DJ1 A;  1YDK A;  1M2B A;  2YCD A;  4EKZ A;  3ERF A;  2DIY A;  3L4N A;  1XFL A;  2YWI A;  4I2U A;  3G9B A;  5HQP A;  3HHV A;  1A0F A;  2HZF A;  4WR5 A;  2PBJ A;  4XHM A;  2WCI A;  1ON4 A;  3FKF A;  3GIX A;  2EC4 A;  3I9V 2;  2WVX B;  1RK4 A;  4X0X A;  3L9S A;  5D9V A;  4IKH A;  1GNW A;  3A2W A;  4KSO A;  2C0E A;  3A5I A;  4Q5N A;  2I9H A;  3IC8 A;  3M1G A;  2PWJ A;  2ZUP A;  2VCW A;  2OT3 A;  4MF6 A;  4MK3 A;  5E4W A;  4OFT A;  2HZE B;  5KN2 A;  1YZX A;  3IXR A;  4JBB A;  4O32 A;  1F3A A;  5LCZ A;  2NTO A;  1BG5 A;  3CRT A;  1FG4 A;  5JCW A;  3VLN A;  4TOP A;  1ERU A;  4OFM A;  1DE1 A;  5DQS A;  1FOV A;  1SJ6 A;  2R5G A;  1NW2 A;  4IEL A;  3ZLP A;  1T4Z A;  4A5P A;  1G0T A;  5IMA A;  3Q18 A;  2HFD A;  1XVW A;  3CXG A;  4CDO A;  5HFG A;  3UVH A;  4ECB A;  4NHZ A;  5BRT A;  4WXT A;  1ERV A;  1U3A A;  1Y6E A;  4TRX A;  4X4J A;  3A3T A;  2LRT A;  3MNG A;  5IIZ A;  4ZB7 A;  2QKE A;  3TJG A;  3HJM A;  3MAK A;  2WW3 A;  4ML1 A;  4N10 A;  4ILF A;  3HJO A;  5IO0 A;  2V2G A;  3KZQ A;  4O92 A;  4IGJ A;  5A34 A;  1EV9 A;  3F0I A;  3H93 A;  2X8H A;  1K0D A;  2FLS A;  5GSS A;  2NDO A;  2LQO A;  2X99 A;  4HU7 A;  2C3N A;  3HZ4 A;  3WGX A;  4PNF A;  2GSR A;  3HDC A;  1TK8 B;  4OCF A;  5IMZ A;  1K0C A;  1M2A A;  2IJY A;  1HNA A;  2GS3 A;  1SKR B;  3EVI A;  4F0C A;  3HKR A;  1OVN A;  1QQ2 A;  3R2Q A;  4YQM A;  5FWG A;  3KMO A;  3GSS A;  4L0U A;  1N25 A;  2HRK B;  3UBK A;  5IOX A;  1GLP A;  3A5W A;  4XRD A;  3E9J B;  4OWY A;  2HSM B;  4BVY A;  5CYY A;  5A5H B;  3VK9 A;  3EMP A;  5EVO A;  2D2Z A;  4PQI A;  1EZK A;  4PTS A;  3IC4 A;  1BAY A;  4KH7 A;  2PU9 C;  3GL3 A;  4IJ3 A;  3E3E A;  5DAL A;  5L71 A;  2FD3 A;  4IBP A;  2C0G A;  1X0R A;  4ZL8 A;  4K7I A;  1O85 A;  2QA2 A;  3TRQ A;  1AUC A;  4K5R A;  4FYC A;  1K0A A;  3U5R E;  2KP1 A;  2LS5 A;  5LD0 A;  5GAP D;  4WEY A;  3CRU A;  4KCE A;  1PSQ A;  4LMV A;  1PL1 A;  5J4Y A;  3TKS E;  5HFK A;  3EWL A;  2V6O A;  3PPU A;  1Z9H A;  3KMN A;  14GS A;  2ON5 A;  2IMK A;  3N9J A;  3SWL A;  3C7M A;  5KN3 A;  2JL4 A;  2YAN A;  1Z7P A;  2AHE A;  4HJ2 A;  1XIY A;  3KD0 A;  4AGS A;  4N0Z A;  2WW0 A;  1TOF A;  1TDI A;  2XPE A;  3IR4 A;  1ILO A;  5ELG A;  4NHW A;  3NIV A;  3TGZ A;  2IMI A;  1XPV A;  1SL0 B;  4IQ1 A;  1MD4 A;  3P7X A;  4BVX B;  5ECO B;  3GH9 A;  3HVV A;  2MZC A;  4FO5 A;  3A2V A;  1XWG A;  1XW6 A;  1C72 A;  4BA7 A;  5KEJ A;  1R5A A;  1ACV A;  3EUR A;  3HVS A;  2R0C A;  5ENU A;  2IMF A;  2PVQ A;  1E2Y A;  3HVX A;  4X1U A;  3FY7 A;  3RHB A;  5HR2 A;  2P5Q A;  13GS A;  4MH2 A;  4EE0 A;  1T8E B;  1OKT A;  4KE3 A;  2O3E A;  3LFL A;  4AJ7 A;  4NMU A;  1THX A;  2YP6 A;  1SVM A;  2IFQ B;  1XBS A;  1SL2 B;  1XOA A;  2IMD A;  2WDU A;  4OO4 A;  5EY6 A;  3TKS C;  4MDC A;  5JWO B;  4MZB A;  4AF2 A;  1S3D A;  1T00 A;  5A4W A;  3ERW A;  2LJA A;  5G1K A;  1SK2 A;  2MYG A;  1SL1 B;  1O81 A;  5JWR B;  2KOK A;  4Q5Q A;  3TJB A;  4WF5 A;  2RLI A;  2R0P A;  1FW1 A;  3F4T A;  3RBT A;  2E2M A;  3UAP A;  1R7H A;  1VF3 A;  5DDL A;  1O7U A;  4AJ6 A;  2HSN B;  3PGT A;  1JHB A;  1Z5Y E;  1R5P A;  3ME7 A;  3IHG A;  5J4V A;  3LOR A;  2VLT A;  5IMF A;  2R3X A;  1OE7 A;  5J9C A;  2JU5 A;  1ML6 A;  2UV8 G;  16GS A;  1USB A;  1Z3E A;  4I5Q A;  2IPA A;  4N30 A;  2KHP A;  1EV4 A;  2H1B A;  4ML6 A;  3D0Z A;  4V2N A;  2CT6 A;  3CTG A;  3HZ8 A;  2N5B A;  5A4V A;  4GST A;  4EIQ A;  3LJR A;  4KDX A;  2VD0 A;  1VF4 A;  4TVE A;  5ABR A;  5ID2 B;  3F3R A;  2EIQ A;  3OR5 A;  4J57 E;  2C1Y A;  4DSS B;  1J08 A;  4AJ8 A;  2L59 A;  1XVQ A;  1TI3 A;  2OA7 A;  3GRX A;  3ZRD A;  5B8B A;  3QAW A;  4HDE A;  5ECN B;  2MMO A;  2LNT A;  4RQR A;  4TKY A;  2HRN A;  2VL3 A;  4N11 A;  1EEM A;  4LMW A;  5ECI B;  2DKH A;  1JZR A;  5E59 A;  2AJQ B;  1PQN A;  4HUA A;  2P0G A;  3S9F A;  2EFD A;  1YY7 A;  4ZB8 A;  3RDW A;  2KLX A;  2AAW A;  4K5S A;  2IL3 A;  2ON7 A;  2BMX A;  3VWX A;  2AV4 A;  3D6I A;  4TR1 B;  3GUS A;  2RUF A;  2GSS A;  2HRF A;  1GUL A;  1S3R A;  5DAK A;  3RFR C;  3CYN A;  1SEN A;  2WVZ A;  1M0U A;  5D9T A;  2DJ2 A;  1ABA A;  1ERW A;  1GTB A;  3G7I A;  4Z2R A;  4DEJ A;  1BED A;  2AB6 A;  5ECK B;  2O89 A;  4X43 A;  5AN1 A;  3TKQ A;  1SYX A;  1QGV A;  1QMV A;  5F07 A;  4GXZ A;  4TXV A;  4O5Q A;  3TJJ A;  3CSJ A;  3IE3 A;  3O3T A;  2L6D A;  2YOI A;  4POK A;  3TKR A;  2V41 A;  3FW2 A;  3VFI A;  1A2M A;  1HYU A;  2QGV A;  1I9D A;  2B1K A;  1E6B A;  2O5V A;  2NVL A;  2L6C A;  2VL2 A;  3UMA A;  1AXD A;  1Q4J A;  5DBQ A;  1U6T A;  3QR6 A;  4POM A;  5GAN D;  4LLR A;  1T1V A;  4O5R A;  5H5S A;  5JCU A;  4ZBD A;  4YKG A;  1BX9 A;  4ZB6 A;  12GS A;  3GX0 A;  1DBY A;  4GQC A;  2CVB A;  3VWW A;  4GSN A;  2OE0 A;  2EIR A;  3IHQ A;  2TRX A;  3QCP A;  1OYJ A;  4ICY A;  1K0O A;  3EMX A;  1B48 A;  4MP4 A;  1XOB A;  3APS A;  1JLW A;  4MCU A;  1TXU A;  2UZ8 A;  3HA9 A;  3O6T A;  4HS1 A;  3LQ7 A;  2CAQ A;  2DJ3 A;  2FHE A;  1N2A A;  1XW9 A;  3DVW A;  3GYK A;  1URM A;  1PRX A;  4TXO A;  1EP8 A;  1GL8 A;  4G01 A;  4GQF A;  5ECM B;  2CX3 A;  4RI6 A;  2VO4 A;  3DYR A;  3FEU A;  3UEM A;  4ECJ A;  4Z2U A;  2GT6 A;  5DCH A;  1NM3 A;  2CX4 A;  2FGX A;  1T7P B;  4HQS A;  3SBC A;  3VI7 A;  3R3E A;  4RQX A;  5J9B A;  4LL1 B;  5EL8 A;  1WPI A;  4IP6 A;  4QL7 A;  3ZML A;  2VAF A;  1UVZ A;  1GSS A;  4GWR A;  4PQ1 A;  4HQZ A;  2GST A;  1EGO A;  1ZMA A;  2H0H A;  2WW1 A;  2GQL A;  3H1N A;  3I43 A;  1GP1 A;  2RUE A;  2IME A;  1XWK A;  2FWF A;  5GST A;  2WB9 A;  1OAZ A;  4GDF A;  1YEP A;  1SK0 A;  4K1F A;  3QAG A;  1NSW A;  4K7N A;  3IV4 A;  4KCA A;  1A8Y A;  5CNW A;  3TKS A;  3KCM A;  3WT1 A;  1V40 A;  4OD7 A;  2OBI A;  3TOU A;  3ZTL A;  1GSY A;  3LYK A;  1X9W B;  4L8E A;  3FZ9 A;  3DIE A;  4PUF C;  2DML A;  1F6M C;  4N0V A;  2YJH A;  1ZL9 A;  4IHU A;  5J40 A;  3ZIJ A;  2OKA A;  5J3R A;  5A34 B;  4G2E A;  4NV5 A;  2I4A A;  3QMX A;  4PNG A;  2AYT A;  1PKZ A;  1LU4 A;  4PQH A;  4HU9 A;  4WBJ A;  2XC2 A;  2DC5 A;  5G5F A;  1AC1 A;  2P31 A;  2HZE A;  3WGD A;  3TB2 A;  2HSH A;  4I6X A;  1JZD A;  5H5R A;  2HYX A;  3ERG A;  3VPQ A;  5F06 A;  4RUV A;  4H86 A;  4MMM A;  3QPM A;  1V58 A;  3HVN A;  4G9H A;  4QL9 A;  1TK0 B;  1TKD B;  2F8A A;  4OO5 A;  1LJR A;  1YKC A;  5G31 A;  1GUH A;  3I69 A;  4BVY B;  2PER A;  3WYW A;  2HRA A;  2E2G A;  4EUY A;  1QUW A;  1MD3 A;  2EIO A;  2WGR A;  4AKX B;  1JFU A;  1YJ6 A;  2GZP A;  2R0G A;  3W6G A;  2H1D A;  1TXX A;  3L0H A;  4MPF A;  2DKI A;  3UOM A;  5DAL B;  4PXO A;  4F0B A;  2J9H A;  1YKA A;  2FA8 A;  3O76 A;  22GS A;  1GLQ A;  5DCG A;  2IN3 A;  3APQ A;  3M9K A;  4GCI A;  1QXH A;  2LV3 A;  3J7Y k;  1KEB A;  1A2J A;  2VKZ G;  1JZW A;  1ZYQ B;  2GLR A;  3ISO A;  4FQU A;  2E7P A;  4NXI A;  3F9U A;  2VUP A;  2F3M A;  1ZYN A;  2I81 A;  1T3B A;  3IAM 2;  4WET A;  2C3Q A;  2X4A A;  3M9J A;  2GVP A;  4ID0 A;  4KA0 A;  3RPP A;  4GSS A;  2GDR A;  4KUN A;  4KAE A;  2O85 A;  4KF9 A;  3IDV A;  2H8L A;  6GSV A;  3ZYW A;  2RM6 A;  1KNG A;  4FXY P;  5G5E A;  4KDY A;  4ACS A;  2HQT A;  3EIN A;  2OJL A;  1B8X A;  4W66 A;  3CBU A;  4K0N A;  3CMI A;  2B6M A;  3EPT A;  4GTU A;  1B4P A;  2MMN A;  4AKH A;  3GMF A;  5HR0 A;  4MA9 A;  3QOU A;  1YF1 A;  1SKS B;  4PUR A;  2GZY A;  1K3Y A;  4HOJ A;  5KOW A;  3KP8 A;  4TR3 A;  4AKG A;  2YV7 A;  2WFC A;  4ECI A;  2VD1 A;  5KOX A;  4G10 A;  3CSI A;  3IK7 A;  2LJR A;  2O36 A;  2WRT A;  3IAS 2;  3IOS A;  2J23 A;  2LJK A;  4OFN A;  3FHK A;  2N5A A;  4NPB A;  3KIJ A;  3MIX A;  4L5L A;  3ZIT A;  1PX7 A;  3L78 A;  4NAX A;  1O73 A;  2GGT A;  5EPF A;  1GH2 A;  3VWU A;  4MJA A;  2ZCT A;  2LKU A;  5ELA A;  2L4C A;  1V9W A;  4YQV A;  20GS A;  5AIS A;  2B3S A;  3EU3 A;  3TJK A;  4BL7 A;  3QD9 A;  1TRV A;  4IJI A;  1TI1 A;  2M80 A;  2Z9S A;  2CV4 A;  2VLV A;  4ZL7 A;  1EWX A;  4OMV A;  1XZO A;  4JR4 A;  1XCC A;  3P8W A;  3QFB C;  5B8A A;  3W8S A;  2H72 A;  1WE0 A;  1N8J A;  5AIX A;  3DGQ A;  2VCT A;  5C00 A;  2QSI A;  1TRW A;  4ISD A;  2E0Q A;  1YF0 A;  4J2F A;  2H6Y A;  2V6K A;  1TRU A;  3LWA A;  2H1G A;  5J5N A;  2FWH A;  1GUK A;  4FH8 A;  4MJC A;  4E8H A;  1JZO A;  1X5C A;  4ZIL A;  2H6Z A;  2VOC A;  1GRX A;  5AGY A;  3N5O A;  4JE1 A;  3RHC A;  3FR9 A;  1GSU A;  3GNJ A;  4EDZ A;  3KJY A;  2HNL A;  2A2P A;  4I97 A;  2FY6 A;  5D9W A;  2V1M A;  1GTA A;  3CSH A;  2G2Q A;  3F4S A;  3QFA C;  3IPZ A;  2H30 A;  1U88 A;  3BJ5 A;  2WS2 A;  3HY2 A;  5AIV A; 
#chains in the Genus database with same CATH homology
 1S3A A;  3HYP A;  5F05 A;  3IA1 A;  4QMK A;  5CRG A;  6GSS A;  3HCZ A;  5B7C A;  1A8L A;  1TK5 B;  17GS A;  2H70 A;  1RW1 A;  5CRW A;  5ECP B;  1AQW A;  3MWH A;  4JRR A;  4AI6 A;  2LNS A;  5A1N A;  3FMW A;  3IRA A;  2MMZ A;  4GLT A;  4JZQ A;  5DAK B;  1W4V A;  4XIH A;  3VUR A;  1X5D A;  2REM A;  1SVL A;  4PX1 A;  2GT5 A;  4WR4 A;  4K6X A;  1BJX A;  1VF2 A;  1J9B A;  2NBS A;  4MJE A;  3TOT A;  1EOG A;  5D9X A;  1A0R P;  4GRF A;  4IVF A;  2IIY A;  5A5K A;  18GS A;  5G1L A;  2C0D A;  1V57 A;  2IWT A;  4K2X A;  2TIR A;  3HMJ G;  2OE3 A;  3H8Q A;  4PGT A;  4XTS A;  3RPN A;  2XBQ A;  3ZRE A;  1VF1 A;  3D4M A;  2BJX A;  5GZZ B;  1SJI A;  1FAA A;  4KX4 A;  5CRD A;  2C3T A;  3Q6O A;  3EYT A;  4WKW A;  3U6V A;  2HT9 A;  1G7O A;  2DJK A;  2VCV A;  2I1U A;  5F0G A;  5KN0 A;  2X8G A;  5ECL B;  2RII A;  1G6W A;  5D93 A;  4ZBA A;  4CHS A;  3L9V A;  3QAV A;  3VWV A;  4K0G A;  2K8S A;  1FB0 A;  2YZH A;  2PMT A;  1I5G A;  5ECS A;  3GA4 A;  4KSM A;  4I2T A;  3VI5 A;  2H66 A;  1SD8 A;  3FRC A;  1MDJ A;  1WP0 A;  3US3 A;  2H71 A;  4K2D A;  3UL3 A;  1TRS A;  3KEB A;  4EXJ A;  1PD2 1;  4TN8 A;  4FIW A;  3ZVJ D;  4TR4 A;  1GWC A;  4G0K A;  2O87 A;  3C71 A;  2OE1 A;  2EFC A;  5IM9 A;  4XS4 A;  1GUM A;  4N3Z A;  4G19 A;  4TXO B;  5HFI A;  5KN1 A;  2PGT A;  5DJL A;  1K0N A;  5BMU A;  1XWC A;  2HLS A;  2H1L A;  1W89 A;  2DSA A;  2VM2 A;  3HXS A;  3DXB A;  1WMJ A;  3D5J A;  5IMD A;  3D4T A;  1F37 A;  1HNC A;  8GSS A;  1M2D A;  3H79 A;  3TDG A;  7GSS A;  2HI7 A;  2OAC A;  3MSZ A;  1PN0 A;  3GTU A;  5ECH B;  2YWM A;  4OCE A;  2H19 A;  4V1A g;  4ECC A;  5C04 A;  1R26 A;  5D8I A;  2R6K A;  3FZA A;  1BF5 A;  2B5X A;  2WUL A;  1TU8 A;  1Z7R A;  2A2R A;  3BCI A;  1QK8 A;  3DRN A;  2DBC A;  2MBS A;  1FB6 A;  3UIW A;  2YWO A;  3APO A;  2FUG 2;  2VLU A;  3I6A A;  2A4V A;  1MDK A;  4FYB A;  4IN0 A;  2DMM A;  3IBH A;  1XWB A;  1OC9 A;  1V2A A;  3IK9 A;  3D22 A;  1T4Y A;  1IYI A;  4EF0 A;  3ZFB A;  1Z6N A;  1FVK A;  3KH9 A;  3LW9 A;  2G0F A;  4PUA A;  3TCO A;  5IMV A;  4Q5R A;  1CQG A;  2RM5 A;  3F4R A;  3Q19 A;  4F82 A;  1EGR A;  1AIU A;  1TTZ A;  4D73 A;  5IPG A;  3TJF A;  3ZL5 A;  2YV9 A;  2JAD A;  3KM6 A;  2R37 A;  3W8J A;  2L5L A;  4V2L A;  3D21 A;  4YAV A;  2R2J A;  2HE3 A;  3MDK A;  4HEA 2;  2V32 A;  2PPT A;  2XHF A;  3VPT A;  2GZZ A;  4MPG A;  2PUK C;  5CP1 A;  3TUE A;  3ME8 A;  4DVC A;  2EFE A;  3H4K A;  2HXK A;  2M46 A;  4Z7X A;  1Q98 A;  3AY8 A;  4ZL9 A;  5F8B A;  3TRP A;  3J7Y b;  1FVJ A;  1TU7 A;  2VCQ A;  2H75 A;  2AUV A;  5HR3 A;  1WWJ A;  3GUR A;  2H73 A;  3TRX A;  4YQU A;  1HNB A;  3WD6 A;  4DSQ A;  4KDU A;  5ECQ B;  3EU4 A;  4V1A p;  4EIP A;  2CVD A;  4IP1 A;  1ZYE A;  2MBT A;  9GSS A;  2JZR A;  1A24 A;  4O5U A;  1HD2 A;  4ULX A;  4I8B A;  1BYE A;  4MF7 A;  3GKX A;  4BWS A;  3ZVJ A;  2YN1 A;  3BOA A;  1SD9 A;  1IYH A;  2KP2 A;  1EP7 A;  4Q5F A;  3GH6 A;  1X9S B;  2NPB A;  4LA1 A;  1WJK A;  2K6V A;  1H75 A;  2ES7 A;  3GN3 A;  2CA8 A;  2ZNM A;  3G7J A;  3FR3 A;  2DLX A;  2JZS A;  4MJB A;  2VL9 A;  3M8N A;  2KUC A;  1XWA A;  2XBI A;  4XCS A;  1R4W A;  1U87 A;  1O8X A;  2LEG A;  3KH7 A;  1PMT A;  5D73 A;  1F9M A;  3ZMK A;  5DJM A;  2CAI A;  4AKI A;  1O6J A;  1MEK A;  2F51 A;  2MMA A;  1B4Q A;  2B7J A;  3M0F A;  3K8N A;  1GSD A;  5IPH A;  3ED3 A;  2JSY A;  1M7T A;  4XRA A;  3FZ4 A;  1YEX A;  1DUG A;  2DJJ A;  1AAZ A;  3ZIV A;  1CQH A;  6GST A;  3GFK A;  4MF5 A;  4HI7 A;  2VL2 C;  4HZ4 A;  3TKP A;  4G0L A;  1AQX A;  4EO3 A;  3C1S A;  5JWQ B;  2HRK A;  2B1L A;  4YKF A;  2C8U A;  3KXO A;  2YWN A;  5IMC A;  5B6N A;  4E8E A;  1BG1 A;  4KW6 A;  3HJP A;  4JED A;  1ZYP A;  4POB A;  3DWV A;  1OC8 A;  4YAP A;  2HSM A;  2VCX A;  3BCK A;  3HD5 A;  5A5H A;  1SU9 A;  2A2S A;  3EC3 A;  2QA1 A;  2H1A A;  4NWY A;  11GS A;  2PVO C;  3F63 A;  4XS6 A;  1XW5 A;  1M9B A;  4BPY A;  1ST9 A;  2FNO A;  3EE2 A;  3M3M A;  1SK1 A;  1SKW B;  5INY A;  1S3C A;  1G7E A;  3JCM L;  3C73 A;  2VM1 A;  3MYD A;  1NHY A;  3LXZ A;  1KBN A;  2X49 A;  1B9X C;  1VRS D;  4DSR A;  5JCG A;  1UA5 A;  2DIZ A;  1PGT A;  1ZCP A;  2YJ7 A;  1EEJ A;  4BL7 B;  2LRN A;  6GSU A;  2GQK A;  1TJD A;  2B5E A;  4EC0 A;  5H5Q A;  3PR8 A;  2CZ2 A;  2C0F A;  4P3Y B;  1H4O A;  19GS A;  3GST A;  5CAX A;  2FCH A;  6GSW A;  3RAZ A;  3GKN A;  1GSQ A;  3LYP A;  1ZGN A;  2R4V A;  3FR6 A;  1G6Y A;  5CRH A;  4QQ7 A;  4BVX A;  3QDN A;  4CY6 A;  3LG6 A;  3UBL A;  2FWG A;  5J41 A;  1M99 A;  3LEF A;  5IQY A;  2ALB A;  2H76 A;  2WZ9 A;  1O8W A;  4BWQ A;  1A23 A;  1AQV A;  2K18 A;  3E0U A;  1MDI A;  4K7O A;  4MZW A;  5IOW A;  1TP9 A;  1OE8 A;  5DQY A;  2P5R A;  3ZZX A;  4J56 E;  3P2A A;  1A2L A;  4MNN A;  1SVO A;  1UC7 A;  2H01 A;  2X8C A;  2IFQ A;  5COH A;  1K0M A;  1U3I A;  3F6D A;  1PKW A;  3GL5 A;  3TU3 B;  1WOU A;  1ERT A;  2GSQ A;  2C80 A;  4O7H A;  1F3B A;  3CTF A;  4ZIJ A;  5LNK e;  2VCZ A;  4MAB A;  2LQQ A;  5A4U A;  5A1N B;  4JR6 A;  3BD2 A;  4EL1 A;  3NOF A;  1KTE A;  2GQM A;  1K0B A;  5B6M A;  3DML A;  4IQA A;  2JZT A;  4FYU A;  2F9S A;  4USS A;  1B9Y C;  3WGE A;  3GKK A;  1GSF A;  3GKM A;  2HSN A;  3CWG A;  5FHI A;  3KTL A;  3NZN A;  4CY8 A;  5HR1 A;  2O8V B;  4K9Z A;  3P90 A;  1WRY A;  2H6X A;  4V2M A;  1VGL A;  1K3L A;  2FA4 A;  2X64 A;  4ZXG A;  4G0I A;  1BQ7 A;  5ECR B;  2K9F A;  3C1R A;  3DD3 A;  2LUS A;  1OKD A;  1DE2 A;  3PIN A;  4MH3 A;  1J0F A;  1GSE A;  4ZB9 A;  2DJ0 A;  5G30 A;  4WBR D;  2XPD A;  1X9M B;  1OC3 A;  4EVM A;  4KB3 A;  4IW9 A;  3UJ1 A;  2I3Y A;  6GSX A;  4ZBB A;  1FHE A;  2FWE A;  2OAD A;  2EFH A;  3PH9 A;  4KGI A;  4F9Z A;  2L57 A;  1PA3 A;  4YH2 A;  5ID2 A;  3UAR A;  4GF0 A;  2CQ9 A;  4MLY A;  1YQ1 A;  3L9U A;  2YPM A;  1QFN A;  4DSS A;  3GX8 A;  2B7K A;  3G7Y A;  4TR0 A;  2M72 A;  1Y25 A;  2A4H A;  2HSY A;  3BBY A;  5IO2 A;  2VIM A;  4L0W A;  3FK8 A;  2K8V A;  4F2I A;  4HZ2 A;  1WIK A;  2H0G A;  1PX6 A;  5CO3 A;  1X5E A;  3LXT A;  5G2Z A;  1F2E A;  2JAC A;  4WF4 A;  1AW9 A;  5D96 A;  4EDY A;  1ZZY A;  2YZU A;  4HJM A;  1NHO A;  2H74 A;  2JSZ A;  3FYG A;  2YNX A;  4TW5 A;  3LGC A;  4TR1 A;  4K8M A;  5J47 A;  2CVK A;  1ZOF A;  1GTI A;  4XS4 B;  3DKS A;  1RQM A;  3LSZ A;  3Q74 A;  2CZ3 A;  3F8U A;  2PN8 A;  1FOH A;  3ZFL A;  3V1W A;  4KND A;  5BMU B;  2H0I A;  2LTK A;  4F03 A;  1HQO A;  2O7K A;  4E68 A;  3FZ5 A;  1FO5 A;  2L4Q A;  1THO A;  2LST A;  5FT3 A;  1V98 A;  3F6F A;  3A2X A;  1PN9 A;  2BTO T;  2F8F A;  1UN2 A;  2N5F A;  4XS1 A;  3DVX A;  3UVT A;  4IS0 A;  5J4U A;  1JLV A;  2TRC P;  1TW9 A;  4L5O A;  5CRE A;  3GTU B;  2GTU A;  4POL A;  1Y1U A;  1M9A A;  10GS A;  2QC7 A;  2LRC A;  2B5Y A;  2WJU A;  3KTB A;  5DVB A;  1EOH A;  1PL2 A;  1XXU A;  3DEX A;  1Z6M A;  3WT2 A;  4Z2T A;  4RI7 A;  3C8E A;  1GNE A;  1DSB A;  4NV2 A;  3F3Q A;  3KGK A;  4CW9 A;  1LBK A;  1OC9 B;  3GV1 A;  4JU5 A;  1K3O A;  6GSY A;  3GHA A;  2C4J A;  1MTC A;  1SJZ A;  3KP9 A;  1YVL A;  1SYR A;  2OBK A;  4MZC A;  4LL4 B;  2L5O A;  1GTU A;  4D73 B;  2DJ1 A;  1YDK A;  1M2B A;  2YCD A;  4EKZ A;  3ERF A;  2DIY A;  3L4N A;  1XFL A;  2YWI A;  4I2U A;  3G9B A;  5HQP A;  3HHV A;  1A0F A;  2HZF A;  4WR5 A;  2PBJ A;  4XHM A;  2WCI A;  1ON4 A;  3FKF A;  3GIX A;  2EC4 A;  3I9V 2;  4X0X A;  1RK4 A;  3L9S A;  5D9V A;  4IKH A;  1GNW A;  3A2W A;  4KSO A;  2C0E A;  3A5I A;  4Q5N A;  2I9H A;  3IC8 A;  3M1G A;  2PWJ A;  2ZUP A;  2VCW A;  2OT3 A;  4MF6 A;  4MK3 A;  5E4W A;  4OFT A;  2HZE B;  5KN2 A;  1YZX A;  3IXR A;  4JBB A;  4O32 A;  1F3A A;  5LCZ A;  2NTO A;  1BG5 A;  3CRT A;  1FG4 A;  5JCW A;  3VLN A;  4TOP A;  1ERU A;  4OFM A;  1DE1 A;  5DQS A;  1FOV A;  1SJ6 A;  2R5G A;  1NW2 A;  4IEL A;  3ZLP A;  1T4Z A;  4A5P A;  1G0T A;  5IMA A;  3Q18 A;  2HFD A;  1XVW A;  3CXG A;  4CDO A;  5HFG A;  3UVH A;  4ECB A;  4NHZ A;  5BRT A;  4WXT A;  1ERV A;  1U3A A;  1Y6E A;  4TRX A;  4X4J A;  3A3T A;  2LRT A;  3MNG A;  5IIZ A;  4ZB7 A;  2QKE A;  3TJG A;  3HJM A;  3MAK A;  4ML1 A;  4N10 A;  4ILF A;  3HJO A;  5IO0 A;  2V2G A;  3KZQ A;  4O92 A;  4IGJ A;  5A34 A;  1EV9 A;  3F0I A;  3H93 A;  2X8H A;  1K0D A;  2FLS A;  5GSS A;  2NDO A;  2LQO A;  2X99 A;  4HU7 A;  2C3N A;  3HZ4 A;  3WGX A;  4PNF A;  2GSR A;  3HDC A;  1TK8 B;  4OCF A;  5IMZ A;  1K0C A;  1M2A A;  2IJY A;  1HNA A;  2GS3 A;  1SKR B;  3EVI A;  4F0C A;  3HKR A;  1OVN A;  1QQ2 A;  3R2Q A;  4YQM A;  5FWG A;  3KMO A;  3GSS A;  4L0U A;  1N25 A;  2HRK B;  3UBK A;  5IOX A;  1GLP A;  3A5W A;  4XRD A;  3E9J B;  4OWY A;  2HSM B;  4BVY A;  5CYY A;  5A5H B;  3VK9 A;  3EMP A;  5EVO A;  2D2Z A;  4PQI A;  1EZK A;  4PTS A;  3IC4 A;  1BAY A;  4KH7 A;  2PU9 C;  3GL3 A;  4IJ3 A;  3E3E A;  5DAL A;  5L71 A;  2FD3 A;  4IBP A;  2C0G A;  1X0R A;  4ZL8 A;  4K7I A;  1O85 A;  2QA2 A;  3TRQ A;  1AUC A;  4K5R A;  4FYC A;  1K0A A;  3U5R E;  2KP1 A;  2LS5 A;  5LD0 A;  5GAP D;  4WEY A;  3CRU A;  4KCE A;  1PSQ A;  4LMV A;  1PL1 A;  5J4Y A;  3TKS E;  5HFK A;  3EWL A;  2V6O A;  3PPU A;  1Z9H A;  3KMN A;  14GS A;  2ON5 A;  2IMK A;  3N9J A;  3SWL A;  3C7M A;  5KN3 A;  2JL4 A;  2YAN A;  1Z7P A;  2AHE A;  4HJ2 A;  1XIY A;  3KD0 A;  4AGS A;  4N0Z A;  1TOF A;  1TDI A;  2XPE A;  3IR4 A;  1ILO A;  5ELG A;  4NHW A;  3NIV A;  3TGZ A;  2IMI A;  1XPV A;  1SL0 B;  4IQ1 A;  1MD4 A;  3P7X A;  4BVX B;  5ECO B;  3GH9 A;  3HVV A;  2MZC A;  4FO5 A;  3A2V A;  1XWG A;  1XW6 A;  1C72 A;  4BA7 A;  5KEJ A;  1R5A A;  1ACV A;  3EUR A;  3HVS A;  2R0C A;  5ENU A;  2IMF A;  2PVQ A;  1E2Y A;  3HVX A;  4X1U A;  3FY7 A;  3RHB A;  5HR2 A;  2P5Q A;  13GS A;  4MH2 A;  4EE0 A;  1T8E B;  1OKT A;  4KE3 A;  3LFL A;  4AJ7 A;  4NMU A;  1THX A;  2YP6 A;  1SVM A;  2IFQ B;  1XBS A;  1SL2 B;  1XOA A;  2IMD A;  2WDU A;  4OO4 A;  5EY6 A;  3TKS C;  4MDC A;  5JWO B;  4MZB A;  4AF2 A;  1S3D A;  1T00 A;  5A4W A;  3ERW A;  2LJA A;  5G1K A;  1SK2 A;  2MYG A;  1SL1 B;  1O81 A;  5JWR B;  2KOK A;  4Q5Q A;  3TJB A;  4WF5 A;  2RLI A;  2R0P A;  1FW1 A;  3F4T A;  3RBT A;  2E2M A;  3UAP A;  1R7H A;  1VF3 A;  5DDL A;  1O7U A;  4AJ6 A;  2HSN B;  3PGT A;  1JHB A;  1Z5Y E;  1R5P A;  3ME7 A;  3IHG A;  5J4V A;  3LOR A;  2VLT A;  5IMF A;  2R3X A;  1OE7 A;  5J9C A;  2JU5 A;  1ML6 A;  2UV8 G;  16GS A;  1USB A;  1Z3E A;  4I5Q A;  2IPA A;  4N30 A;  2KHP A;  1EV4 A;  2H1B A;  4ML6 A;  3D0Z A;  4V2N A;  2CT6 A;  3CTG A;  3HZ8 A;  2N5B A;  5A4V A;  4GST A;  4EIQ A;  3LJR A;  4KDX A;  2VD0 A;  1VF4 A;  4TVE A;  5ABR A;  5ID2 B;  3F3R A;  2EIQ A;  3OR5 A;  4J57 E;  2C1Y A;  4DSS B;  1J08 A;  4AJ8 A;  2L59 A;  1XVQ A;  1TI3 A;  2OA7 A;  3GRX A;  3ZRD A;  5B8B A;  3QAW A;  4HDE A;  5ECN B;  2MMO A;  2LNT A;  4RQR A;  4TKY A;  2HRN A;  2VL3 A;  4N11 A;  1EEM A;  4LMW A;  5ECI B;  2DKH A;  1JZR A;  5E59 A;  2AJQ B;  1PQN A;  4HUA A;  2P0G A;  3S9F A;  2EFD A;  1YY7 A;  4ZB8 A;  3RDW A;  2KLX A;  2AAW A;  4K5S A;  2IL3 A;  2ON7 A;  2BMX A;  3VWX A;  2AV4 A;  3D6I A;  4TR1 B;  3GUS A;  2RUF A;  2GSS A;  2HRF A;  1GUL A;  5DAK A;  3CYN A;  1SEN A;  5D9T A;  1M0U A;  2DJ2 A;  1ABA A;  1ERW A;  1GTB A;  3G7I A;  4Z2R A;  4DEJ A;  1BED A;  2AB6 A;  5ECK B;  2O89 A;  4X43 A;  5AN1 A;  3TKQ A;  1SYX A;  1QGV A;  1QMV A;  5F07 A;  4GXZ A;  4TXV A;  4O5Q A;  3TJJ A;  3CSJ A;  3IE3 A;  3O3T A;  2L6D A;  2YOI A;  4POK A;  3TKR A;  2V41 A;  3FW2 A;  3VFI A;  1A2M A;  1HYU A;  2QGV A;  1I9D A;  2B1K A;  1E6B A;  2O5V A;  2NVL A;  2L6C A;  2VL2 A;  3UMA A;  1AXD A;  1Q4J A;  5DBQ A;  1U6T A;  3QR6 A;  4POM A;  5GAN D;  4LLR A;  1T1V A;  4O5R A;  5H5S A;  5JCU A;  4ZBD A;  4YKG A;  1BX9 A;  4ZB6 A;  12GS A;  3GX0 A;  1DBY A;  4GQC A;  2CVB A;  3VWW A;  4GSN A;  2OE0 A;  2EIR A;  3IHQ A;  2TRX A;  3QCP A;  1OYJ A;  4ICY A;  1K0O A;  3EMX A;  1B48 A;  4MP4 A;  1XOB A;  3APS A;  1JLW A;  4MCU A;  1TXU A;  2UZ8 A;  3HA9 A;  3O6T A;  4HS1 A;  3LQ7 A;  2CAQ A;  2DJ3 A;  2FHE A;  1N2A A;  1XW9 A;  3DVW A;  3GYK A;  1URM A;  1PRX A;  4TXO A;  1EP8 A;  1GL8 A;  4G01 A;  4GQF A;  5ECM B;  2CX3 A;  4RI6 A;  2VO4 A;  3DYR A;  3FEU A;  3UEM A;  4ECJ A;  4Z2U A;  2GT6 A;  5DCH A;  1NM3 A;  2CX4 A;  2FGX A;  1T7P B;  4HQS A;  3SBC A;  3VI7 A;  3R3E A;  4RQX A;  5J9B A;  4LL1 B;  5EL8 A;  1WPI A;  4IP6 A;  4QL7 A;  3ZML A;  2VAF A;  1UVZ A;  1GSS A;  4GWR A;  4PQ1 A;  4HQZ A;  2GST A;  1EGO A;  1ZMA A;  2H0H A;  2GQL A;  3H1N A;  3I43 A;  1GP1 A;  2RUE A;  2IME A;  1XWK A;  2FWF A;  5GST A;  2WB9 A;  1OAZ A;  4GDF A;  1YEP A;  1SK0 A;  4K1F A;  3QAG A;  1NSW A;  4K7N A;  3IV4 A;  4KCA A;  1A8Y A;  5CNW A;  3TKS A;  3KCM A;  3WT1 A;  1V40 A;  4OD7 A;  2OBI A;  3TOU A;  3ZTL A;  1GSY A;  3LYK A;  1X9W B;  4L8E A;  3FZ9 A;  3DIE A;  4PUF C;  2DML A;  1F6M C;  4N0V A;  2YJH A;  1ZL9 A;  4IHU A;  5J40 A;  3ZIJ A;  2OKA A;  5J3R A;  5A34 B;  4G2E A;  4NV5 A;  2I4A A;  3QMX A;  4PNG A;  2AYT A;  1PKZ A;  1LU4 A;  4PQH A;  4HU9 A;  4WBJ A;  2XC2 A;  2DC5 A;  5G5F A;  1AC1 A;  2P31 A;  2HZE A;  3WGD A;  3TB2 A;  2HSH A;  4I6X A;  1JZD A;  5H5R A;  2HYX A;  3ERG A;  3VPQ A;  5F06 A;  4RUV A;  4H86 A;  4MMM A;  3QPM A;  1V58 A;  4G9H A;  4QL9 A;  1TK0 B;  1TKD B;  2F8A A;  4OO5 A;  1LJR A;  1YKC A;  5G31 A;  1GUH A;  3I69 A;  4BVY B;  2PER A;  3WYW A;  2HRA A;  2E2G A;  4EUY A;  1QUW A;  1MD3 A;  2EIO A;  2WGR A;  4AKX B;  1JFU A;  1YJ6 A;  2GZP A;  2R0G A;  3W6G A;  2H1D A;  1TXX A;  3L0H A;  4MPF A;  2DKI A;  3UOM A;  5DAL B;  4PXO A;  4F0B A;  2J9H A;  1YKA A;  2FA8 A;  3O76 A;  22GS A;  1GLQ A;  5DCG A;  2IN3 A;  3APQ A;  3M9K A;  4GCI A;  1QXH A;  2LV3 A;  3J7Y k;  1KEB A;  1A2J A;  2VKZ G;  1JZW A;  1ZYQ B;  2GLR A;  3ISO A;  4FQU A;  2E7P A;  4NXI A;  3F9U A;  2VUP A;  2F3M A;  1ZYN A;  2I81 A;  1T3B A;  3IAM 2;  4WET A;  2C3Q A;  2X4A A;  3M9J A;  2GVP A;  4ID0 A;  4KA0 A;  3RPP A;  4GSS A;  2GDR A;  4KUN A;  4KAE A;  2O85 A;  4KF9 A;  3IDV A;  2H8L A;  6GSV A;  3ZYW A;  1KNG A;  2RM6 A;  5G5E A;  4KDY A;  4ACS A;  2HQT A;  3EIN A;  2OJL A;  1B8X A;  4W66 A;  3CBU A;  4K0N A;  3CMI A;  2B6M A;  3EPT A;  4GTU A;  1B4P A;  2MMN A;  4AKH A;  3GMF A;  5HR0 A;  4MA9 A;  3QOU A;  1YF1 A;  1SKS B;  4PUR A;  2GZY A;  1K3Y A;  4HOJ A;  5KOW A;  3KP8 A;  4TR3 A;  4AKG A;  2YV7 A;  2WFC A;  4ECI A;  2VD1 A;  5KOX A;  4G10 A;  3CSI A;  3IK7 A;  2LJR A;  2WRT A;  3IAS 2;  3IOS A;  2J23 A;  2LJK A;  4OFN A;  3FHK A;  2N5A A;  4NPB A;  3KIJ A;  3MIX A;  4L5L A;  3ZIT A;  1PX7 A;  3L78 A;  4NAX A;  1O73 A;  2GGT A;  5EPF A;  1GH2 A;  3VWU A;  4MJA A;  2ZCT A;  2LKU A;  5ELA A;  2L4C A;  1V9W A;  4YQV A;  20GS A;  5AIS A;  2B3S A;  3EU3 A;  3TJK A;  4BL7 A;  3QD9 A;  1TRV A;  4IJI A;  1TI1 A;  2M80 A;  2Z9S A;  2CV4 A;  2VLV A;  4ZL7 A;  1EWX A;  4OMV A;  1XZO A;  4JR4 A;  1XCC A;  3P8W A;  3QFB C;  5B8A A;  3W8S A;  2H72 A;  1WE0 A;  1N8J A;  5AIX A;  3DGQ A;  2VCT A;  5C00 A;  2QSI A;  1TRW A;  4ISD A;  2E0Q A;  1YF0 A;  4J2F A;  2H6Y A;  2V6K A;  1TRU A;  3LWA A;  2H1G A;  5J5N A;  2FWH A;  1GUK A;  4FH8 A;  4MJC A;  4E8H A;  1JZO A;  1X5C A;  4ZIL A;  2H6Z A;  2VOC A;  1GRX A;  5AGY A;  3N5O A;  4JE1 A;  3RHC A;  3FR9 A;  1GSU A;  3GNJ A;  4EDZ A;  3KJY A;  2HNL A;  2A2P A;  4I97 A;  2FY6 A;  5D9W A;  2V1M A;  1GTA A;  3CSH A;  2G2Q A;  3F4S A;  3QFA C;  3IPZ A;  2H30 A;  1U88 A;  3BJ5 A;  2WS2 A;  3HY2 A;  5AIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...