2VD0A

Complex structure of prostaglandin d2 synthase at 2.2a.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GLUTATHIONE-REQUIRING PROSTAGLANDIN D SYNTHASE
publication title Novel Prostaglandin D Synthase Inhibitors Generated by Fragment-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vd0A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vd0A01
2N5BA 2RM5A 4EVMA 4PURA 2GGTA 1K0CA 1YY7A 3UARA 3PH9A 4JR6A 2JACA 3GMFA 2HI7A 2HRNA 4NWYA 3DYRA 4BVYA 1MDKA 2C80A 1Z6MA 1SK1A 3DMLA 4L5OA 2RUEA 2K18A 2DBCA 2TIRA 11GSA 4LLRA 5ECHB 1SD9A 1Y6EA 4F9ZA 1BYEA 3CTGA 1OYJA 1K3LA 1U6TA 2VL2C 3EURA 1XWAA 2B1KA 3E0UA 4L0UA 2L57A 2YCDA 2HZEA 1WWJA 2GQKA 6GSUA 2PN8A 4MF7A 2OBKA 3GKXA 3CSHA 1DBYA 2V6OA 1T3BA 1YEPA 2XPDA 4WBRD 1B9XC 1W89A 2MBSA 3TJKA 5B8AA 1TJDA 3HVVA 3W8SA 3L0HA 2WGRA 2DMMA 2VD1A 1ZYEA 5KEJA 1SYXA 2KLXA 4J57E 4HOJA 3IXRA 1R5PA 4L8EA 4I8BA 2HLSA 3QAWA 4N11A 2X8GA 4IP6A 4HJ2A 5J5NA 2V6KA 2WS2A 5ID2A 2R5GA 4MF6A 1GWCA 2H01A 6GSWA 2O7KA 1WIKA 5H5QA 2X99A 3DWVA 1YDKA 3KMOA 3TUEA 1T8EB 2BMXA 3C71A 1Z9HA 5C00A 3JCML 4DSRA 5D9VA 1G7EA 3GX0A 5IMDA 2DJ2A 4EL1A 3LJRA 3GNJA 2R4VA 2C0GA 1FVKA 2M72A 1XWBA 5DQYA 2XBQA 2GTUA 3U6VA 2R3XA 4IN0A 2GSTA 2NPBA 3QFAC 4BPYA 4RQRA 3I69A 1QUWA 3IDVA 5ECKB 4WR4A 1JZWA 5F8BA 2YANA 2IMFA 1GL8A 4JZQA 1HNBA 1NHOA 4TN8A 5IMZA 4NV5A 3TKSA 1GSEA 4PTSA 1GSUA 3HKRA 2MMZA 1G0TA 3R3EA 1M2AA 4HS1A 3TJGA 4NAXA 2F8FA 1B48A 4CHSA 5HR0A 3RPPA 2JZTA 2CVKA 5B6MA 3IE3A 4PUAA 2H76A 3ZFBA 4IQ1A 3KP9A 2H70A 1GTUA 1FAAA 2DJ0A 4OO4A 2WFCA 1XVQA 1GSDA 2DMLA 2QSIA 4ML6A 4RUVA 4TR3A 18GSA 2B5XA 4EO3A 2HT9A 3RDWA 2LRCA 1ERWA 4FYBA 1BAYA 2H0HA 1SU9A 5DDLA 5L71A 2PUKC 3GURA 5EL8A 4JR4A 1QGVA 2IN3A 2H74A 2ZNMA 2AUVA 3IC8A 3TJBA 2V2GA 1VF4A 2HNLA 3QOUA 2H0GA 3ZVJD 3ZZXA 3P8WA 1ZL9A 5H5RA 1DSBA 3L78A 1AQXA 2MMNA 5JWOB 4KF9A 1BQ7A 4XS1A 4MZBA 2E2MA 4OFTA 5ECQB 3IK7A 3GL5A 1TU8A 2P5RA 1Z7PA 1PL1A 1XWKA 1F37A 2L59A 3DVWA 1QXHA 4WF4A 1EV4A 1U3IA 1F2EA 1M2BA 3V1WA 2O89A 3FR6A 3VI5A 2L4QA 2LQOA 2OKAA 3P2AA 2WJUA 3RHCA 2VCTA 2E2GA 4LMWA 3J7Yk 2KUCA 1V2AA 1UC7A 4KSOA 4ACSA 5HQPA 5IOWA 4GCIA 3LEFA 4TOPA 3HXSA 3GA4A 2FY6A 5G31A 3F6FA 5ENUA 4K7IA 2O8VB 3GTUB 3UAPA 5G5EA 2FHEA 2LRTA 5A5KA 2IFQB 1Y25A 3L9VA 3KP8A 3QD9A 3TCOA 1G6YA 5EY6A 4RI6A 1HYUA 4OMVA 4X43A 1M99A 5B6NA 2CZ3A 2KP1A 2A2SA 1TRSA 3F9UA 3HD5A 2F3MA 3H1NA 2PMTA 3GH9A 1AC1A 3MWHA 4F82A 3MDKA 2FGXA 1H4OA 2ZCTA 2GQLA 5F05A 2CZ2A 2DJKA 4TR4A 3BJ5A 3GSTA 1X5DA 1Z5YE 1OE7A 3EWLA 8GSSA 5LNKe 1JFUA 3GX8A 2NBSA 5DAKB 1TP9A 1GTBA 4FO5A 4RQXA 4PNGA 3APOA 3MSZA 5DCGA 1SL1B 2FWFA 1EV9A 4MA9A 1T7PB 2JSZA 2YV9A 3MAKA 3ZVJA 5CNWA 1ERTA 3H8QA 3H4KA 2R37A 4MCUA 4ULXA 3FKFA 3HA9A 2DC5A 2OBIA 1BEDA 3RHBA 4HZ2A 4XRDA 3P7XA 1PA3A 3TRPA 1PGTA 3FW2A 3LGCA 4X0XA 2FWEA 2DLXA 3Q18A 2A4VA 4OWYA 2HRKB 3UL3A 2YWIA 2N5AA 4K8MA 5E59A 1SKWB 2P0GA 3EMPA 3LYKA 3D22A 4MK3A 2Z9SA 2GS3A 3IRAA 5JCWA 3G7JA 2LQQA 3FR9A 1QQ2A 1GSSA 3PR8A 4GSTA 4YQUA 2MBTA 3A2XA 4GQCA 5IM9A 4JRRA 5IOXA 5DALB 4I2UA 3CTFA 1LJRA 4FIWA 1YF1A 1MTCA 2V41A 6GSYA 2H1AA 3O3TA 3DXBA 3Q6OA 4N0ZA 4O5RA 2D2ZA 5IIZA 4K0GA 5ECIB 3M9KA 3EC3A 1SJIA 3GTUA 5KN0A 3DRNA 1M2DA 3ED3A 4IW9A 2VO4A 4TR0A 3WYWA 1PL2A 4E8HA 3ERGA 1ERVA 1EWXA 3P90A 1EOHA 3ME7A 2VIMA 1SYRA 1TOFA 1M9BA 1HQOA 3HJOA 1K3YA 2OA7A 1OC3A 3ME8A 1A0RP 1SD8A 3WGDA 1GSFA 1A2LA 3TKSC 1R5AA 2VD0A 2B5EA 3TJFA 2AV4A 5CRDA 3ZREA 3A2WA 4P3YB 3C8EA 4HUAA 4BWSA 1Q4JA 2YNXA 4GRFA 3PPUA 4IS0A 3I43A 2FLSA 3HDCA 4KDYA 3EMXA 4MZCA 3J7Yb 3TB2A 4O32A 1ZCPA 4ISDA 4YQMA 4WF5A 4CW9A 3S9FA 4LMVA 1THOA 5DAKA 3CMIA 2H1BA 1B4QA 1MDIA 4IBPA 2QKEA 1K0AA 2PVQA 3APSA 4AGSA 3TRQA 1T4ZA 2LKUA 3C1RA 5G30A 5F06A 4HQSA 4AJ7A 4ECJA 4KE3A 2OE3A 3FZ4A 6GSXA 2YPMA 3KGKA 2VL9A 4MPGA 2L5OA 1K0MA 4ZIJA 2FWGA 2AHEA 2IPAA 4XHMA 4FYCA 2WDUA 5IQYA 3E3EA 2H1DA 3DGQA 1PKZA 2FD3A 4YAPA 2B7JA 3WT2A 3I9V2 3D21A 1RW1A 3ERWA 4KCEA 3FYGA 1KNGA 1KBNA 4GQFA 2IMKA 2HRKA 5LD0A 2FNOA 4GTUA 1USBA 1A23A 4TXOB 1O85A 4HEA2 2C3NA 3HZ4A 2YJHA 1SJZA 5HR2A 1SK0A 1AQVA 5HFGA 5ABRA 4PUFC 3W6GA 16GSA 1H75A 3VK9A 2GSSA 3IHQA 5DALA 1M7TA 2IMIA 1DE1A 4MPFA 1ZMAA 4MABA 1Z3EA 5GSSA 4O7HA 1JZDA 4NMUA 2B7KA 1TU7A 3UBKA 5CAXA 1V98A 1K0OA 4EDYA 4TKYA 4J56E 5ECOB 3IK9A 2IL3A 4MJAA 2I1UA 2BTOT 3LYPA 1I9DA 4G2EA 2O87A 3LSZA 1YQ1A 2CAQA 1EP8A 3DIEA 4ZB9A 4K0NA 3IOSA 2MZCA 5CRWA 1J0FA 4IQAA 2VCVA 1BG5A 2C3QA 1N2AA 3O76A 3VURA 3TDGA 1VRSD 3GYKA 1O8XA 4MF5A 4KCAA 2PU9C 3VLNA 1EP7A 3O6TA 4IJ3A 1PKWA 3ERFA 4DEJA 3D4TA 4N30A 3MNGA 1LU4A 1XOAA 5CREA 2GZPA 2F8AA 2N5FA 3Q19A 1PD21 5KN3A 5JWQB 1XW9A 4L0WA 3LWAA 4H86A 1BX9A 1TXXA 1T4YA 4IVFA 1K3OA 4ML1A 4Q5RA 2HXKA 3TGZA 2NTOA 2VM1A 4EUYA 5J3RA 5ECMB 1M9AA 5DVBA 1V58A 3IPZA 2GDRA 3ISOA 4OD7A 2FCHA 1K0DA 1PQNA 5AGYA 4POMA 5E4WA 5IMFA 1TK5B 2AAWA 4NXIA 4GWRA 4J2FA 2H6XA 2JSYA 3UBLA 4ZBAA 2EIOA 2RUFA 2YP6A 4TR1B 2P5QA 4GLTA 3FZ9A 2M80A 3UMAA 1F6MC 1FB0A 1GUKA 5FT3A 3F8UA 2WULA 1YEXA 2RM6A 4TRXA 3VWVA 4TXOA 1JHBA 3ZYWA 2J23A 1JZOA 5CRHA 4K9ZA 4XCSA 1R26A 2AJQB 3CXGA 5JCUA 3GH6A 1YZXA 9GSSA 4KUNA 2VCQA 4EKZA 5AN1A 3FZAA 4POKA 2HRAA 3E9JB 3FRCA 3F6DA 2DSAA 2KP2A 1HNCA 4ZL8A 3QR6A 4RI7A 2I81A 1F3BA 1PX7A 2YJ7A 2LV3A 3QDNA 4LA1A 3SBCA 2ON5A 5JWRB 3EVIA 4XIHA 4FYUA 3D5JA 1A8YA 3F3RA 3TKSE 1OC9B 1LBKA 1ST9A 4TXVA 2F9SA 2DJJA 2GT5A 1XFLA 5EPFA 4ZL9A 1AUCA 4V2LA 1V57A 2IMEA 1TTZA 3HY2A 3KH7A 4Z7XA 2RLIA 4JBBA 1FW1A 2K8SA 2WRTA 5DBQA 2YZHA 3DEXA 5F0GA 3TRXA 1S3AA 3HYPA 2WZ9A 4K1FA 1V40A 4YQVA 1GH2A 2YV7A 2H66A 1XPVA 3KJYA 1CQGA 1PMTA 2G0FA 4ZBBA 3RAZA 4Q5QA 3BCIA 1HD2A 3BCKA 4V2NA 2VCXA 3FEUA 1ABAA 4AJ8A 1UA5A 2V32A 4MH2A 2MMAA 3GRXA 4Q5FA 1MDJA 4QQ7A 10GSA 3KIJA 4FQUA 1VF1A 5J4UA 4MLYA 3HCZA 2C0EA 1T1VA 4G9HA 1GRXA 4I2TA 4F03A 3H79A 3QMXA 2LJKA 4OCFA 1U3AA 4YAVA 1MEKA 2HYXA 2H30A 1GLQA 2TRCP 2JL4A 1VF3A 4IELA 5ECSA 4K7OA 1PSQA 3QPMA 4I6XA 1FB6A 4TR1A 3QCPA 4OCEA 2NVLA 1XWCA 2VCZA 1KTEA 3H93A 4ZBDA 4JE1A 4KSMA 4ILFA 3HVXA 2LNSA 3VFIA 2FUG2 2XPEA 5A4VA 4F0CA 3AY8A 3QAGA 1EZKA 5B8BA 3KM6A 4G10A 1NSWA 5D9XA 4GSSA 3GL3A 4EDZA 5CYYA 1PRXA 4TW5A 4BVXB 2ES7A 2JZSA 3L9SA 3CSJA 1RK4A 1E2YA 2GQMA 3IAS2 4N0VA 3KD0A 5FWGA 1RQMA 5DCHA 2VAFA 3LG6A 5AISA 2H71A 4TVEA 4XTSA 3M8NA 3WD6A 3LXTA 2KHPA 2LS5A 3L4NA 1WRYA 4V1Ap 3M3MA 1OC9A 4ZL7A 4KH7A 1X9SB 5AIVA 5G1LA 1A24A 4I97A 1YJ6A 4BWQA 3ZLPA 1K0BA 2C0DA 2CV4A 3UJ1A 3QFBC 1U88A 4OFMA 1MD3A 2L6CA 4V1Ag 1OKTA 2MYGA 2DJ3A 3VPTA 3GIXA 3IR4A 2GZZA 2RIIA 3WT1A 5IO0A 4E8EA 2L6DA 3I6AA 4LL4B 2OJLA 5IPHA 1TK0B 4MZWA 2AB6A 1WJKA 1M0UA 1EOGA 3HJPA 3CRTA 5IMVA 3UVHA 1BJXA 1QFNA 3F4SA 4V2MA 3QAVA 4HJMA 2JZRA 3VI7A 1GLPA 3F4TA 2CVDA 4MJCA 1IYIA 1A2MA 3TKQA 5G1KA 1SENA 3EE2A 4OFNA 2VLVA 3K8NA 4EC0A 1A8LA 3G7IA 2HSNB 2H72A 2I3YA 4D73B 3GFKA 4XS6A 4QL9A 5INYA 2KOKA 5FHIA 2J9HA 2H8LA 1PN9A 1O73A 4XRAA 5IPGA 5A4WA 3A2VA 2GSRA 1XWGA 4G19A 4AF2A 3VPQA 3FK8A 1EGOA 2FWHA 5CO3A 5J9CA 2C3TA 4PXOA 2HSHA 2HZFA 3GHAA 1WPIA 1GUMA 1URMA 3TKPA 4BL7B 3R2QA 2PVOC 1EGRA 1EEMA 3CSIA 5B7CA 3TJJA 2VLUA 4BVXA 2OE1A 5KN1A 2CX3A 7GSSA 5IMCA 3UOMA 2PGTA 5J9BA 1TKDB 4ECBA 1Z7RA 3ZIJA 1AW9A 4MDCA 4PQIA 2IIYA 1EEJA 2B5YA 1X5EA 3PINA 3U5RE 2PERA 2K6VA 5ECPB 4KW6A 4K7NA 2CAIA 3CRUA 1OKDA 3ZTLA 3G7YA 4MP4A 5IO2A 4DSQA 2LRNA 1AAZA 4PGTA 4I5QA 5G5FA 3TOUA 5HR1A 2NDOA 1OAZA 3N9JA 5ECRB 4ZB6A 3HVSA 5KN2A 2GVPA 19GSA 4YH2A 1ACVA 2XHFA 3F0IA 4POBA 4DVCA 3M1GA 2CX4A 2XBIA 1X9WB 1JZRA 3KH9A 2M46A 1G7OA 1JLWA 4HU9A 6GSTA 5ECLB 2PWJA 5DJLA 3TKRA 1YKCA 1WP0A 2B3SA 4POLA 3LORA 2LTKA 1OVNA 4NHZA 1GULA 4ECIA 4USSA 3SWLA 4JEDA 3N5OA 1B9YC 6GSSA 4N10A 5D8IA 2VCWA 4K2DA 4HDEA 1ZGNA 5DQSA 3VWXA 2OACA 1A2JA 3M0FA 5BMUA 1NM3A 1C72A 5DJMA 1J9BA 2FA4A 1GNEA 2YWOA 5LCZA 1TK8B 4MMMA 4F0BA 3US3A 1GNWA 4KGIA 2CA8A 1ZZYA 2DIYA 4OO5A 1GTAA 5D9TA 4ID0A 1WE0A 4IKHA 5HFKA 4D73A 2REMA 4GXZA 1R7HA 5A4UA 1UVZA 4PQ1A 1SL0B 1WMJA 5CP1A 4EXJA 4JU5A 1GSYA 1CQHA 2YOIA 1XW6A 1JLVA 1T00A 4AJ6A 1X0RA 4IP1A 2CT6A 4WETA 1QK8A 3ZMLA 1U87A 2WCIA 2IJYA 1XZOA 1O7UA 1OE8A 1WOUA 2HFDA 5G2ZA 1AXDA 4BL7A 4XS4B 1V9WA 4HI7A 5ELAA 5EVOA 2I9HA 4MJEA 2LSTA 2GLRA 5COHA 1K0NA 1VF2A 2LJRA 3GUSA 1ERUA 1X5CA 3G9BA 1W4VA 1XXUA 3D6IA 3UVTA 5IMAA 3GV1A 5GAPD 2IMDA 3L9UA 4KB3A 4ZXGA 4F2IA 2H19A 2V1MA 5H5SA 4IJIA 3D4MA 1R4WA 1SK2A 2OADA 2VL2A 4NV2A 3TOTA 3EU3A 3KEBA 1QMVA 1TI1A 2B6MA 5CRGA 2VL3A 3GN3A 4GSNA 1KEBA 3KZQA 4DSSB 3NZNA 5D9WA 3ZMKA 5AIXA 2K9FA 2A2RA 2HSMB 2FA8A 5D96A 3DVXA 1Q98A 1Z6NA 5GZZB 1XIYA 4GF0A 2H6YA 2HE3A 4BA7A 2EIQA 3OR5A 3BBYA 5GAND 1IYHA 3KTBA 1YF0A 1HNAA 2H0IA 3D0ZA 1J08A 2CQ9A 3IAM2 1TRWA 2L4CA 3A3TA 3ZIVA 5JCGA 3C7MA 1GUHA 1TDIA 2QGVA 1ON4A 2LNTA 4HZ4A 4MH3A 4K6XA 4MJBA 2LUSA 3EINA 4NPBA 22GSA 3GKMA 3LQ7A 2WB9A 3F3QA 3KXOA 1FO5A 2QC7A 2GT6A 3KTLA 1B8XA 4QL7A 1DUGA 3VWWA 4Q5NA 1FVJA 2YWMA 3F63A 3FZ5A 2E7PA 1AQWA 2YWNA 2K8VA 3C1SA 4KNDA 2HRFA 12GSA 2PBJA 6GSVA 2H75A 2G2QA 3WGEA 2DIZA 1XVWA 3KCMA 2BJXA 1O8WA 1O6JA 1E6BA 5D93A 2ALBA 3HJMA 3IA1A 3IV4A 2X64A 3DD3A 3PGTA 2TRXA 2DJ1A 4KDUA 3FY7A 3GKKA 4PX1A 5J41A 4LL1B 3VWUA 2H73A 1FHEA 3M9JA 17GSA 5ELGA 4HU7A 2XC2A 1NHYA 2VLTA 4PQHA 4XS4A 1AIUA 4WXTA 3ZFLA 2EC4A 1SL2B 20GSA 4KDXA 3KMNA 5F07A 3LFLA 2UZ8A 4ZB8A 1ZOFA 1A0FA 1F3AA 1F9MA 1PX6A 1XOBA 5D73A 4BVYB 1YKAA 3GKNA 1FG4A 3WGXA 1ML6A 4G0LA 1GSQA 2YZUA 2I4AA 1ILOA 2GZYA 5HR3A 1G6WA 2F51A 1XW5A 4O92A 2OE0A 4DSSA 1GP1A 2P31A 1VGLA 3A5WA 3EYTA 3FR3A 2B1LA 2HSMA 1X9MB 2HZEB 4KX4A 4CDOA 2GSQA 3EU4A 1TRVA 2X8HA 3ZRDA 1ZYQB 1XBSA 2C1YA 1S3DA 1MD4A 2H1GA 1GTIA 1XCCA 3C73A 2C0FA 4WKWA 2ON7A 5HFIA 1FOVA 3NOFA 2JU5A 4EF0A 2HQTA 2IWTA 1SJ6A 3ZL5A 1O81A 2L5LA 2YN1A 4HQZA 3BOAA 3APQA 14GSA 4FH8A 3CBUA 5C04A 2AYTA 2LJAA 1UN2A 1S3CA 5ID2B 3DKSA 13GSA 3GSSA 2C8UA 4ECCA 1N8JA 2X8CA 2VUPA 2JADA 2E0QA 2CVBA 4PNFA 3UIWA 2C4JA 1DE2A 5GSTA 1B4PA 1SKRB 4KA0A 2MMOA 4WBJA 3BD2A 3RBTA 4L5LA 2IFQA 4KAEA 2R2JA 3HHVA 4G0KA 2R6KA 4IGJA 2VOCA 3LXZA 2LEGA 1OC8A 3NIVA 4EE0A 3ZITA 3IC4A 3W8JA 3RPNA 4WEYA 2PPTA 3Q74A 4IHUA 3IBHA 1THXA 4G0IA 2ZUPA 2VM2A 1SKSB 3UEMA 3HZ8A 1TI3A 1TRUA 3CYNA 3FHKA 2EIRA 5ECNB 2H6ZA 2HSYA 3F4RA 4NHWA 4WR5A 1NW2A 4X1UA 1TW9A 2O85A 1I5GA 4ZILA
chains in the Genus database with same CATH superfamily
2N5BA 2RM5A 4EVMA 4PURA 2GGTA 1K0CA 1YY7A 3UARA 3PH9A 4JR6A 2JACA 3GMFA 2HI7A 2HRNA 4NWYA 3DYRA 4BVYA 1MDKA 2C80A 1Z6MA 1SK1A 3DMLA 4L5OA 2RUEA 2K18A 2DBCA 2TIRA 11GSA 4LLRA 3CHXC 5ECHB 1SD9A 1Y6EA 4F9ZA 1BYEA 2WVZA 3CTGA 4EIPA 1OYJA 1K3LA 1U6TA 2VL2C 3EURA 1XWAA 2B1KA 3E0UA 4L0UA 2L57A 2YCDA 2HZEA 1WWJA 2GQKA 6GSUA 2PN8A 4MF7A 2OBKA 3GKXA 3CSHA 1DBYA 2V6OA 1T3BA 1YEPA 2XPDA 4WBRD 1B9XC 1W89A 2MBSA 3TJKA 5B8AA 1TJDA 3HVVA 3W8SA 3L0HA 2WGRA 2WW3A 2DMMA 2VD1A 1ZYEA 5KEJA 1SYXA 2KLXA 4J57E 4HOJA 3IXRA 1R5PA 4L8EA 1PN0A 4I8BA 2HLSA 3QAWA 4N11A 2X8GA 4IP6A 4HJ2A 5J5NA 2V6KA 2WS2A 5ID2A 2R5GA 4MF6A 1GWCA 2H01A 6GSWA 2O7KA 1WIKA 5H5QA 2X99A 3DWVA 1YDKA 3KMOA 3TUEA 1T8EB 2BMXA 3C71A 1Z9HA 5C00A 3JCML 4DSRA 5D9VA 1G7EA 3GX0A 5IMDA 2DJ2A 4EL1A 3LJRA 3GNJA 2R4VA 2C0GA 1FVKA 2M72A 1XWBA 5DQYA 2XBQA 2GTUA 3U6VA 2R3XA 4IN0A 2GSTA 2NPBA 3QFAC 4BPYA 4RQRA 3I69A 1QUWA 3IDVA 5ECKB 4WR4A 1JZWA 5F8BA 2YANA 2IMFA 1GL8A 4JZQA 1HNBA 1NHOA 4TN8A 5IMZA 4NV5A 3TKSA 1GSEA 4PTSA 1GSUA 3HKRA 4BIKA 2MMZA 2X49A 1G0TA 3R3EA 1M2AA 4HS1A 3TJGA 4NAXA 2F8FA 1B48A 4CHSA 5HR0A 3RPPA 2JZTA 2CVKA 5B6MA 3IE3A 4PUAA 2H76A 3ZFBA 4IQ1A 2WVXB 3KP9A 2H70A 1GTUA 1FAAA 2DJ0A 4OO4A 2WFCA 1XVQA 1GSDA 2DMLA 2QSIA 4ML6A 4RUVA 4TR3A 18GSA 2B5XA 4EO3A 2HT9A 3RDWA 2LRCA 1ERWA 4FYBA 1BAYA 3A5IA 2H0HA 1SU9A 5DDLA 5L71A 4PHZC 3GURA 2PUKC 5EL8A 4JR4A 1QGVA 2IN3A 2H74A 2ZNMA 2AUVA 3IC8A 3TJBA 2V2GA 1VF4A 2HNLA 3QOUA 2H0GA 3ZVJD 3ZZXA 3P8WA 1ZL9A 5H5RA 1DSBA 3L78A 1AQXA 2MMNA 5JWOB 4KF9A 1BQ7A 4XS1A 4MZBA 5BRTA 2E2MA 4OFTA 5ECQB 3IK7A 3GL5A 1TU8A 2P5RA 1Z7PA 1PL1A 1M3IA 1XWKA 1F37A 2L59A 3DVWA 1QXHA 4WF4A 1EV4A 1U3IA 1F2EA 1M2BA 3V1WA 2O89A 3FR6A 3VI5A 2L4QA 2LQOA 2OKAA 3P2AA 2WJUA 3RHCA 2VCTA 2E2GA 4LMWA 4PI0C 3J7Yk 2KUCA 4CY8A 1V2AA 1UC7A 4KSOA 4ACSA 5HQPA 5IOWA 4GCIA 3LEFA 4TOPA 3HXSA 3GA4A 2FY6A 5G31A 3F6FA 5ENUA 4K7IA 2O8VB 3GTUB 3UAPA 5G5EA 2FHEA 2LRTA 5A5KA 2IFQB 1Y25A 3L9VA 3KP8A 3QD9A 3TCOA 1G6YA 5EY6A 4RI6A 1HYUA 4OMVA 4X43A 1M99A 5B6NA 2CZ3A 2KP1A 2A2SA 1TRSA 3F9UA 3HD5A 2F3MA 3H1NA 2PMTA 3GH9A 1AC1A 3MWHA 4F82A 3MDKA 2FGXA 1H4OA 2ZCTA 2GQLA 5F05A 2CZ2A 2DJKA 4TR4A 3BJ5A 2QA2A 3GSTA 1X5DA 2WVXA 1Z5YE 1OE7A 3EWLA 8GSSA 5LNKe 1JFUA 3GX8A 2NBSA 5DAKB 1TP9A 1GTBA 4FO5A 4RQXA 4PNGA 3APOA 3MSZA 5DCGA 1SL1B 2FWFA 1EV9A 4MA9A 2EFHA 2QA1A 1T7PB 2JSZA 2YV9A 3MAKA 3ZVJA 5CNWA 1ERTA 3H8QA 3H4KA 2R37A 4MCUA 4ULXA 3FKFA 5J47A 3HA9A 2DC5A 2OBIA 1BEDA 3RHBA 4HZ2A 4XRDA 3P7XA 5J4YA 4QMKA 1PA3A 3TRPA 1PGTA 3FW2A 3LGCA 4X0XA 2FWEA 2DLXA 3Q18A 2A4VA 3TU3B 4OWYA 2HRKB 3UL3A 2YWIA 2N5AA 4K8MA 5E59A 1SKWB 2P0GA 3EMPA 3LYKA 3D22A 4MK3A 2Z9SA 2GS3A 3IRAA 4MNNA 5JCWA 3G7JA 2LQQA 3FR9A 1QQ2A 1GSSA 3PR8A 4GSTA 4YQUA 2MBTA 3A2XA 4GQCA 5IM9A 4JRRA 5IOXA 5DALB 4I2UA 2DKHA 3CTFA 1LJRA 4HSCX 4FIWA 1YF1A 1MTCA 3RFRC 6GSYA 2H1AA 3O3TA 2V41A 3DXBA 3Q6OA 4N0ZA 4O5RA 2R0PA 2R0CA 2D2ZA 5IIZA 2UV8G 4K0GA 5ECIB 3M9KA 3EC3A 1SJIA 3GTUA 5KN0A 3DRNA 1M2DA 3ED3A 4IW9A 2VO4A 4TR0A 3WYWA 1PL2A 4E8HA 3ERGA 1ERVA 1S3RA 1EWXA 3P90A 1EOHA 3ME7A 2VIMA 1SYRA 1TOFA 1M9BA 1HQOA 3HJOA 1K3YA 2OA7A 1OC3A 3ME8A 1A0RP 1SD8A 3WGDA 1GSFA 1A2LA 3TKSC 1R5AA 2VD0A 2B5EA 3TJFA 2AV4A 5CRDA 3ZREA 3A2WA 4P3YB 2WW0A 4AKGA 3C8EA 4HUAA 4BWSA 1Q4JA 2YNXA 4GRFA 3PPUA 4IS0A 1N25A 3I43A 1BF5A 2FLSA 3HDCA 4KDYA 3EMXA 4MZCA 3J7Yb 3TB2A 4O32A 1ZCPA 4ISDA 4YQMA 4WF5A 4CW9A 3S9FA 4LMVA 1THOA 5DAKA 3CMIA 2H1BA 1B4QA 1MDIA 4IBPA 2QKEA 1K0AA 2PVQA 3APSA 4AGSA 3TRQA 1T4ZA 2LKUA 3C1RA 5G30A 5F06A 4HQSA 4AJ7A 4ECJA 4KE3A 2OE3A 3FZ4A 6GSXA 2YPMA 3KGKA 2VL9A 4MPGA 2L5OA 4O5UA 1K0MA 4ZIJA 2FWGA 2AHEA 2IPAA 4XHMA 4FYCA 2WDUA 5IQYA 3E3EA 2H1DA 3DGQA 1PKZA 2FD3A 4YAPA 3MIXA 2B7JA 3WT2A 1ZYNA 3I9V2 3D21A 1RW1A 3ERWA 4KCEA 3FYGA 1KNGA 1KBNA 4GQFA 2IMKA 2HRKA 5LD0A 2FNOA 3EPTA 4GTUA 1USBA 1A23A 4TXOB 1O85A 4HEA2 2C3NA 3HZ4A 2YJHA 1SJZA 5HR2A 1SK0A 1AQVA 4AKHA 5HFGA 5ABRA 4PUFC 3W6GA 16GSA 1H75A 3VK9A 2GSSA 3IHQA 5DALA 1M7TA 2IMIA 1DE1A 4GDFA 4MPFA 1ZMAA 4MABA 1Z3EA 5GSSA 4O7HA 1JZDA 4NMUA 2B7KA 1TU7A 3UBKA 5CAXA 1V98A 1K0OA 4EDYA 4TKYA 4J56E 5ECOB 2DKIA 3IK9A 2IL3A 4MJAA 2I1UA 2BTOT 3LYPA 1I9DA 4G2EA 2O87A 3LSZA 1YQ1A 2CAQA 1EP8A 3DIEA 4ZB9A 4K0NA 3IOSA 2EFDA 2MZCA 5CRWA 4ICYA 4O5QA 2R0GA 1J0FA 4IQAA 2VCVA 1BG5A 2C3QA 4K2XA 1N2AA 3O76A 3VURA 3TDGA 1VRSD 3GYKA 4Z2RA 1O8XA 4MF5A 4KCAA 2PU9C 3VLNA 1EP7A 3O6TA 4IJ3A 1PKWA 3ERFA 4DEJA 3D4TA 4N30A 3MNGA 1LU4A 3LW9A 1XOAA 5CREA 2GZPA 2F8AA 2N5FA 4EIQA 3Q19A 1PD21 5KN3A 5JWQB 1XW9A 2EFEA 4L0WA 3LWAA 4H86A 1BX9A 1TXXA 1T4YA 4IVFA 1K3OA 4ML1A 4Q5RA 2HXKA 3TGZA 2NTOA 2VM1A 4EUYA 5J3RA 5ECMB 1M9AA 5DVBA 2EFCA 1V58A 3IPZA 2GDRA 3ISOA 4OD7A 2FCHA 1K0DA 1PQNA 5AGYA 4A5PA 4POMA 5E4WA 5IMFA 1TK5B 2AAWA 4NXIA 4GWRA 4J2FA 2H6XA 2JSYA 3UBLA 4ZBAA 2EIOA 2RUFA 2YP6A 3CQFA 4TR1B 2P5QA 4GLTA 3FZ9A 2O5VA 2M80A 3UMAA 1F6MC 1FB0A 1GUKA 5FT3A 3F8UA 2WULA 1YEXA 2RM6A 4TRXA 3VWVA 4TXOA 1JHBA 3ZYWA 2J23A 1JZOA 5CRHA 4K9ZA 4XCSA 1R26A 2AJQB 3CXGA 5JCUA 3GH6A 1ZYPA 3CWGA 1YZXA 9GSSA 4KUNA 2VCQA 4EKZA 5AN1A 3FZAA 4POKA 2HRAA 3E9JB 3FRCA 3F6DA 2DSAA 2H1LA 2KP2A 1HNCA 1XG8A 4ZL8A 3QR6A 4RI7A 2I81A 1F3BA 1PX7A 1SVOA 2YJ7A 2LV3A 3QDNA 4LA1A 3SBCA 5KOWA 4K5SA 2ON5A 5JWRB 3EVIA 4XIHA 4FYUA 3D5JA 1A8YA 3F3RA 3TKSE 1OC9B 1BG1A 1LBKA 1ST9A 4TXVA 2F9SA 2DJJA 2GT5A 1XFLA 5EPFA 4ZL9A 1AUCA 4V2LA 1V57A 2IMEA 1TTZA 3HY2A 3KH7A 4Z7XA 2RLIA 4JBBA 1FW1A 2WZSA 2WRTA 2K8SA 5DBQA 2YZHA 3DEXA 5F0GA 3TRXA 1S3AA 3HYPA 2WZ9A 4K1FA 1V40A 4YQVA 1GH2A 2YV7A 2H66A 1XPVA 3KJYA 1CQGA 1PMTA 2G0FA 4ZBBA 3RAZA 4Q5QA 3BCIA 1HD2A 3BCKA 4V2NA 2VKZG 2VCXA 3FEUA 1S4BP 1ABAA 4AJ8A 1UA5A 2V32A 4MH2A 2MMAA 3GRXA 4Q5FA 1MDJA 4QQ7A 10GSA 3KIJA 4FQUA 1VF1A 5J4UA 4MLYA 3HCZA 2C0EA 1T1VA 4X4JA 4G9HA 1GRXA 4I2TA 4F03A 3H79A 3QMXA 2LJKA 4OCFA 1U3AA 4YAVA 1MEKA 2HYXA 2H30A 5J40A 4G01A 1GLQA 2TRCP 2JL4A 1VF3A 1PFOA 4IELA 5ECSA 4K7OA 1PSQA 3QPMA 4I6XA 1FB6A 4TR1A 2O3EA 3QCPA 4OCEA 2NVLA 2OT3A 1XWCA 2VCZA 1KTEA 3H93A 4ZBDA 4JE1A 4KSMA 4ILFA 3HVXA 2LNSA 3VFIA 2FUG2 2XPEA 5A4VA 4F0CA 3AY8A 3QAGA 1EZKA 5B8BA 3KM6A 4G10A 1NSWA 5D9XA 1FOHA 4GSSA 3GL3A 4EDZA 5CYYA 1PRXA 4TW5A 4BVXB 2ES7A 2JZSA 3L9SA 3CSJA 1RK4A 1E2YA 2GQMA 3IAS2 4N0VA 3KD0A 5FWGA 1RQMA 5DCHA 2VAFA 3LG6A 5AISA 2H71A 4TVEA 4XTSA 3M8NA 3WD6A 3LXTA 2KHPA 2LS5A 3L4NA 1WRYA 4V1Ap 3M3MA 1OC9A 4ZL7A 4KH7A 1X9SB 5AIVA 5A34B 5G1LA 1A24A 4I97A 1YJ6A 4BWQA 3ZLPA 1K0BA 2C0DA 2CV4A 3UJ1A 3QFBC 1U88A 4OFMA 1MD3A 2L6CA 4V1Ag 1OKTA 2MYGA 2DJ3A 3VPTA 3GIXA 4YKFA 3IR4A 2GZZA 2RIIA 3WT1A 5IO0A 4E8EA 2L6DA 3I6AA 4LL4B 2OJLA 5IPHA 1TK0B 4MZWA 2AB6A 1WJKA 1M0UA 1EOGA 3HJPA 3MYDA 3CRTA 3RGBC 5IMVA 3UVHA 1BJXA 1QFNA 3F4SA 4V2MA 3QAVA 2WW2A 4HJMA 5BMUB 2JZRA 3VI7A 1GLPA 3F4TA 2CVDA 4K5RA 4MJCA 1IYIA 1A2MA 3TKQA 5G1KA 1SENA 3EE2A 4OFNA 2VLVA 3K8NA 4EC0A 1A8LA 3G7IA 2HSNB 2H72A 2I3YA 4D73B 3GFKA 4XS6A 4QL9A 5INYA 2KOKA 5FHIA 2J9HA 2H8LA 1PN9A 1O73A 4XRAA 5IPGA 5A4WA 3A2VA 2GSRA 1XWGA 4G19A 4AF2A 3VPQA 3FK8A 1EGOA 1M3JA 1SVLA 2FWHA 5CO3A 5J9CA 2C3TA 4PXOA 2HSHA 2HZFA 3GHAA 1WPIA 1GUMA 1URMA 3TKPA 4BL7B 4W66A 3R2QA 2PVOC 1EGRA 1EEMA 3CSIA 5B7CA 3TJJA 2VLUA 4BVXA 2OE1A 5KN1A 2CX3A 7GSSA 4YKGA 5IMCA 3UOMA 2PGTA 5J9BA 1TKDB 4ECBA 3FMWA 1Z7RA 3ZIJA 1AW9A 4MDCA 4PQIA 2IIYA 1EEJA 2B5YA 2O36A 1X5EA 3PINA 3U5RE 2PERA 2K6VA 5ECPB 4KW6A 4K7NA 2CAIA 3CRUA 1OKDA 3ZTLA 3G7YA 4MP4A 5IO2A 4DSQA 2LRNA 1AAZA 4PGTA 4I5QA 5G5FA 5A34A 3TOUA 5HR1A 2NDOA 1OAZA 1YVLA 3N9JA 4CY6A 5ECRB 4ZB6A 3HVSA 5KN2A 2GVPA 19GSA 4YH2A 1ACVA 2XHFA 3F0IA 4POBA 4DVCA 5A5HB 3M1GA 2CX4A 2XBIA 4Z2TA 1X9WB 1JZRA 3KH9A 2M46A 1G7OA 1JLWA 4HU9A 6GSTA 5ECLB 2PWJA 5DJLA 3TKRA 1YKCA 1WP0A 2B3SA 4POLA 3LORA 2LTKA 1OVNA 4NHZA 1GULA 4ECIA 4USSA 3SWLA 4JEDA 3N5OA 1B9YC 6GSSA 4N10A 5D8IA 2VCWA 4K2DA 4HDEA 4AI6A 1ZGNA 5DQSA 3VWXA 2OACA 1A2JA 3M0FA 5BMUA 1NM3A 1C72A 5DJMA 1J9BA 2FA4A 1GNEA 2YWOA 5LCZA 1TK8B 4MMMA 4F0BA 3US3A 1GNWA 4KGIA 2CA8A 1ZZYA 2DIYA 4OO5A 1GTAA 5D9TA 4ID0A 1WE0A 4IKHA 2HSNA 5HFKA 4D73A 2REMA 4GXZA 1R7HA 5A4UA 1UVZA 4PQ1A 1SL0B 1WMJA 5CP1A 4EXJA 4JU5A 1GSYA 1CQHA 2YOIA 1XW6A 1JLVA 1T00A 4AJ6A 1I1IP 1X0RA 4IP1A 2CT6A 4Z2UA 4WETA 1QK8A 3ZMLA 1U87A 2WCIA 2IJYA 1XZOA 1O7UA 1OE8A 1WOUA 2HFDA 5G2ZA 1AXDA 4BL7A 4XS4B 1V9WA 4HI7A 5ELAA 5EVOA 2I9HA 4MJEA 2LSTA 2GLRA 5COHA 1K0NA 1VF2A 2LJRA 3GUSA 1ERUA 2A4HA 1X5CA 3G9BA 1W4VA 1XXUA 3D6IA 3UVTA 5IMAA 3GV1A 5GAPD 2IMDA 3L9UA 4KB3A 1TXUA 4ZXGA 4F2IA 5KOXA 2H19A 2V1MA 5H5SA 4IJIA 5A1NB 3D4MA 1R4WA 1SK2A 2OADA 2VL2A 4ZB7A 4NV2A 3TOTA 3EU3A 3KEBA 1QMVA 1TI1A 2B6MA 5CRGA 2VL3A 3GN3A 4GSNA 1KEBA 3KZQA 4DSSB 3NZNA 5D9WA 3ZMKA 5AIXA 2K9FA 2A2RA 2HSMB 2FA8A 5D96A 3DVXA 1Q98A 1Z6NA 5GZZB 1XIYA 4GF0A 2H6YA 2HE3A 4BA7A 2EIQA 3OR5A 3BBYA 5GAND 5A5HA 1IYHA 3KTBA 1YF0A 1HNAA 2H0IA 3D0ZA 1J08A 2CQ9A 3IAM2 1TRWA 2L4CA 3A3TA 3ZIVA 5JCGA 4AKIA 3C7MA 1GUHA 1TDIA 3HVNA 2QGVA 1ON4A 2LNTA 4HZ4A 4MH3A 4K6XA 4MJBA 2LUSA 3EINA 4NPBA 22GSA 4N3ZA 3GKMA 3LQ7A 2WB9A 3F3QA 3HMJG 3KXOA 1FO5A 2WVYA 2QC7A 2GT6A 3KTLA 1B8XA 4QL7A 1DUGA 4E68A 3VWWA 4Q5NA 1FVJA 2YWMA 3F63A 3FZ5A 2E7PA 1AQWA 2YWNA 2K8VA 3C1SA 4KNDA 2HRFA 12GSA 2PBJA 6GSVA 2H75A 2G2QA 3WGEA 2DIZA 1XVWA 3KCMA 2BJXA 1O8WA 1O6JA 1E6BA 5D93A 2ALBA 3HJMA 3IA1A 3IV4A 2X64A 3DD3A 3PGTA 2TRXA 2DJ1A 4KDUA 3FY7A 3GKKA 4PX1A 5J41A 4LL1B 3VWUA 2H73A 1FHEA 3M9JA 17GSA 5ELGA 4HU7A 2XC2A 1NHYA 2VLTA 4PQHA 4XS4A 1AIUA 4WXTA 3ZFLA 2EC4A 1SL2B 20GSA 2A2PA 4KDXA 3KMNA 5F07A 3LFLA 2UZ8A 4ZB8A 1ZOFA 3IHGA 1A0FA 1F3AA 1F9MA 1PX6A 1XOBA 5D73A 4BVYB 1YKAA 3GKNA 5A1NA 1FG4A 3WGXA 1ML6A 4G0LA 2WW1A 1GSQA 2YZUA 2I4AA 1ILOA 2GZYA 5HR3A 1G6WA 2F51A 1XW5A 4O92A 2OE0A 4DSSA 1GP1A 1Y1UA 2P31A 1VGLA 3A5WA 3EYTA 3FR3A 2B1LA 2HSMA 1X9MB 2HZEB 4KX4A 4CDOA 2GSQA 3EU4A 1TRVA 1YEWC 2X8HA 3ZRDA 1ZYQB 1XBSA 2C1YA 1S3DA 1MD4A 2H1GA 1GTIA 1XCCA 3C73A 2C0FA 4WKWA 2ON7A 5HFIA 1FOVA 3NOFA 2JU5A 4EF0A 2HQTA 2IWTA 1SJ6A 3ZL5A 1O81A 2L5LA 2YN1A 4HQZA 3BOAA 3APQA 14GSA 4FH8A 3CBUA 5C04A 2AYTA 2LJAA 1UN2A 1S3CA 4FXYP 5ID2B 3DKSA 13GSA 3GSSA 2C8UA 4ECCA 1N8JA 2X8CA 2VUPA 2JADA 2E0QA 2CVBA 4PNFA 3UIWA 2C4JA 1DE2A 5GSTA 1B4PA 1SKRB 4KA0A 2MMOA 4WBJA 3BD2A 3RBTA 4L5LA 2IFQA 4KAEA 2R2JA 3HHVA 4G0KA 2R6KA 4IGJA 2VOCA 3LXZA 2LEGA 4AKXB 1OC8A 3NIVA 4EE0A 3ZITA 3IC4A 3W8JA 3RPNA 4WEYA 2X4AA 2PPTA 3Q74A 4IHUA 3IBHA 1THXA 4G0IA 4PI2C 2ZUPA 2VM2A 1SKSB 3UEMA 3HZ8A 1TI3A 1TRUA 3CYNA 1SVMA 3FHKA 2EIRA 5ECNB 2H6ZA 2HSYA 3F4RA 4NHWA 4WR5A 1NW2A 4X1UA 1TW9A 5J4VA 2O85A 1I5GA 4ZILA
chains in the Genus database with same CATH topology
2N5BA 2RM5A 4EVMA 4PURA 2GGTA 1K0CA 1YY7A 3UARA 3PH9A 4JR6A 2JACA 3GMFA 2HI7A 2HRNA 4NWYA 3DYRA 4BVYA 1MDKA 2C80A 1Z6MA 1SK1A 3DMLA 4L5OA 2RUEA 2K18A 2DBCA 2TIRA 11GSA 4LLRA 5ECHB 1SD9A 1Y6EA 4F9ZA 1BYEA 3CTGA 4EIPA 1OYJA 1K3LA 1U6TA 2VL2C 3EURA 1XWAA 2B1KA 3E0UA 4L0UA 2L57A 2YCDA 2HZEA 1WWJA 2GQKA 6GSUA 2PN8A 4MF7A 2OBKA 3GKXA 3CSHA 1DBYA 2V6OA 1T3BA 1YEPA 2XPDA 4WBRD 1B9XC 1W89A 2MBSA 3TJKA 5B8AA 1TJDA 3HVVA 3W8SA 3L0HA 2WGRA 2DMMA 2VD1A 1ZYEA 5KEJA 1SYXA 2KLXA 4J57E 4HOJA 3IXRA 1R5PA 4L8EA 1PN0A 4I8BA 2HLSA 3QAWA 4N11A 2X8GA 4IP6A 4HJ2A 5J5NA 2V6KA 2WS2A 5ID2A 2R5GA 4MF6A 1GWCA 2H01A 6GSWA 2O7KA 1WIKA 5H5QA 2X99A 3DWVA 1YDKA 3KMOA 3TUEA 1T8EB 2BMXA 3C71A 1Z9HA 5C00A 3JCML 4DSRA 5D9VA 1G7EA 3GX0A 5IMDA 2DJ2A 4EL1A 3LJRA 3GNJA 2R4VA 2C0GA 1FVKA 2M72A 1XWBA 5DQYA 2XBQA 2GTUA 3U6VA 2R3XA 4IN0A 2GSTA 2NPBA 3QFAC 4BPYA 4RQRA 3I69A 1QUWA 3IDVA 5ECKB 4WR4A 1JZWA 5F8BA 2YANA 2IMFA 1GL8A 4JZQA 1HNBA 1NHOA 4TN8A 5IMZA 4NV5A 3TKSA 1GSEA 4PTSA 1GSUA 3HKRA 2MMZA 2X49A 1G0TA 3R3EA 1M2AA 4HS1A 3TJGA 4NAXA 2F8FA 1B48A 4CHSA 5HR0A 3RPPA 2JZTA 2CVKA 5B6MA 3IE3A 4PUAA 2H76A 3ZFBA 4IQ1A 3KP9A 2H70A 1GTUA 1FAAA 2DJ0A 4OO4A 2WFCA 1XVQA 1GSDA 2DMLA 2QSIA 4ML6A 4RUVA 4TR3A 18GSA 2B5XA 4EO3A 2HT9A 3RDWA 2LRCA 1ERWA 4FYBA 1BAYA 3A5IA 2H0HA 1SU9A 5DDLA 5L71A 2PUKC 3GURA 5EL8A 4JR4A 1QGVA 2IN3A 2H74A 2ZNMA 2AUVA 3IC8A 3TJBA 2V2GA 1VF4A 2HNLA 3QOUA 2H0GA 3ZVJD 3ZZXA 3P8WA 1ZL9A 5H5RA 1DSBA 3L78A 1AQXA 2MMNA 5JWOB 4KF9A 1BQ7A 4XS1A 4MZBA 5BRTA 2E2MA 4OFTA 5ECQB 3IK7A 3GL5A 1TU8A 2P5RA 1Z7PA 1PL1A 1XWKA 1F37A 2L59A 3DVWA 1QXHA 4WF4A 1EV4A 1U3IA 1F2EA 1M2BA 3V1WA 2O89A 3FR6A 3VI5A 2L4QA 2LQOA 2OKAA 3P2AA 2WJUA 3RHCA 2VCTA 2E2GA 4LMWA 3J7Yk 2KUCA 4CY8A 1V2AA 1UC7A 4KSOA 4ACSA 5HQPA 5IOWA 4GCIA 3LEFA 4TOPA 3HXSA 3GA4A 2FY6A 5G31A 3F6FA 5ENUA 4K7IA 2O8VB 3GTUB 3UAPA 5G5EA 2FHEA 2LRTA 5A5KA 2IFQB 1Y25A 3L9VA 3KP8A 3QD9A 3TCOA 1G6YA 5EY6A 4RI6A 1HYUA 4OMVA 4X43A 1M99A 5B6NA 2CZ3A 2KP1A 2A2SA 1TRSA 3F9UA 3HD5A 2F3MA 3H1NA 2PMTA 3GH9A 1AC1A 3MWHA 4F82A 3MDKA 2FGXA 1H4OA 2ZCTA 2GQLA 5F05A 2CZ2A 2DJKA 4TR4A 3BJ5A 2QA2A 3GSTA 1X5DA 1Z5YE 1OE7A 3EWLA 8GSSA 5LNKe 1JFUA 3GX8A 2NBSA 5DAKB 1TP9A 1GTBA 4FO5A 4RQXA 4PNGA 3APOA 3MSZA 5DCGA 1SL1B 2FWFA 1EV9A 4MA9A 2EFHA 2QA1A 1T7PB 2JSZA 2YV9A 3MAKA 3ZVJA 5CNWA 1ERTA 3H8QA 3H4KA 2R37A 4MCUA 4ULXA 3FKFA 5J47A 3HA9A 2DC5A 2OBIA 1BEDA 3RHBA 4HZ2A 4XRDA 3P7XA 5J4YA 4QMKA 1PA3A 3TRPA 1PGTA 3FW2A 3LGCA 4X0XA 2FWEA 2DLXA 3Q18A 2A4VA 3TU3B 4OWYA 2HRKB 3UL3A 2YWIA 2N5AA 4K8MA 5E59A 1SKWB 2P0GA 3EMPA 3LYKA 3D22A 4MK3A 2Z9SA 2GS3A 3IRAA 4MNNA 5JCWA 3G7JA 2LQQA 3FR9A 1QQ2A 1GSSA 3PR8A 4GSTA 4YQUA 2MBTA 3A2XA 4GQCA 5IM9A 4JRRA 5IOXA 5DALB 4I2UA 2DKHA 3CTFA 1LJRA 4FIWA 1YF1A 1MTCA 2V41A 6GSYA 2H1AA 3O3TA 3DXBA 3Q6OA 4N0ZA 4O5RA 2R0PA 2R0CA 2D2ZA 5IIZA 2UV8G 4K0GA 5ECIB 3M9KA 3EC3A 1SJIA 3GTUA 5KN0A 3DRNA 1M2DA 3ED3A 4IW9A 2VO4A 4TR0A 3WYWA 1PL2A 4E8HA 3ERGA 1ERVA 1EWXA 3P90A 1EOHA 3ME7A 2VIMA 1SYRA 1TOFA 1M9BA 1HQOA 3HJOA 1K3YA 2OA7A 1OC3A 3ME8A 1A0RP 1SD8A 3WGDA 1GSFA 1A2LA 3TKSC 1R5AA 2VD0A 2B5EA 3TJFA 2AV4A 5CRDA 3ZREA 3A2WA 4P3YB 4AKGA 3C8EA 4HUAA 4BWSA 1Q4JA 2YNXA 4GRFA 3PPUA 4IS0A 1N25A 3I43A 1BF5A 2FLSA 3HDCA 4KDYA 3EMXA 4MZCA 3J7Yb 3TB2A 4O32A 1ZCPA 4ISDA 4YQMA 4WF5A 4CW9A 3S9FA 4LMVA 1THOA 5DAKA 3CMIA 2H1BA 1B4QA 1MDIA 4IBPA 2QKEA 1K0AA 2PVQA 3APSA 4AGSA 3TRQA 1T4ZA 2LKUA 3C1RA 5G30A 5F06A 4HQSA 4AJ7A 4ECJA 4KE3A 2OE3A 3FZ4A 6GSXA 2YPMA 3KGKA 2VL9A 4MPGA 2L5OA 4O5UA 1K0MA 4ZIJA 2FWGA 2AHEA 2IPAA 4XHMA 4FYCA 2WDUA 5IQYA 3E3EA 2H1DA 3DGQA 1PKZA 2FD3A 4YAPA 3MIXA 2B7JA 3WT2A 1ZYNA 3I9V2 3D21A 1RW1A 3ERWA 4KCEA 3FYGA 1KNGA 1KBNA 4GQFA 2IMKA 2HRKA 5LD0A 2FNOA 3EPTA 4GTUA 1USBA 1A23A 4TXOB 1O85A 4HEA2 2C3NA 3HZ4A 2YJHA 1SJZA 5HR2A 1SK0A 1AQVA 4AKHA 5HFGA 5ABRA 4PUFC 3W6GA 16GSA 1H75A 3VK9A 2GSSA 3IHQA 5DALA 1M7TA 2IMIA 1DE1A 4GDFA 4MPFA 1ZMAA 4MABA 1Z3EA 5GSSA 4O7HA 1JZDA 4NMUA 2B7KA 1TU7A 3UBKA 5CAXA 1V98A 1K0OA 4EDYA 4TKYA 4J56E 5ECOB 2DKIA 3IK9A 2IL3A 4MJAA 2I1UA 2BTOT 3LYPA 1I9DA 4G2EA 2O87A 3LSZA 1YQ1A 2CAQA 1EP8A 3DIEA 4ZB9A 4K0NA 3IOSA 2EFDA 2MZCA 5CRWA 4ICYA 4O5QA 2R0GA 1J0FA 4IQAA 2VCVA 1BG5A 2C3QA 4K2XA 1N2AA 3O76A 3VURA 3TDGA 1VRSD 3GYKA 4Z2RA 1O8XA 4MF5A 4KCAA 2PU9C 3VLNA 1EP7A 3O6TA 4IJ3A 1PKWA 3ERFA 4DEJA 3D4TA 4N30A 3MNGA 1LU4A 3LW9A 1XOAA 5CREA 2GZPA 2F8AA 2N5FA 4EIQA 3Q19A 1PD21 5KN3A 5JWQB 1XW9A 2EFEA 4L0WA 3LWAA 4H86A 1BX9A 1TXXA 1T4YA 4IVFA 1K3OA 4ML1A 4Q5RA 2HXKA 3TGZA 2NTOA 2VM1A 4EUYA 5J3RA 5ECMB 1M9AA 5DVBA 2EFCA 1V58A 3IPZA 2GDRA 3ISOA 4OD7A 2FCHA 1K0DA 1PQNA 5AGYA 4A5PA 4POMA 5E4WA 5IMFA 1TK5B 2AAWA 4NXIA 4GWRA 4J2FA 2H6XA 2JSYA 3UBLA 4ZBAA 2EIOA 2RUFA 2YP6A 4TR1B 2P5QA 4GLTA 3FZ9A 2O5VA 2M80A 3UMAA 1F6MC 1FB0A 1GUKA 5FT3A 3F8UA 2WULA 1YEXA 2RM6A 4TRXA 3VWVA 4TXOA 1JHBA 3ZYWA 2J23A 1JZOA 5CRHA 4K9ZA 4XCSA 1R26A 2AJQB 3CXGA 5JCUA 3GH6A 1ZYPA 3CWGA 1YZXA 9GSSA 4KUNA 2VCQA 4EKZA 5AN1A 3FZAA 4POKA 2HRAA 3E9JB 3FRCA 3F6DA 2DSAA 2H1LA 2KP2A 1HNCA 4ZL8A 3QR6A 4RI7A 2I81A 1F3BA 1PX7A 1SVOA 2YJ7A 2LV3A 3QDNA 4LA1A 3SBCA 5KOWA 4K5SA 2ON5A 5JWRB 3EVIA 4XIHA 4FYUA 3D5JA 1A8YA 3F3RA 3TKSE 1OC9B 1BG1A 1LBKA 1ST9A 4TXVA 2F9SA 2DJJA 2GT5A 1XFLA 5EPFA 4ZL9A 1AUCA 4V2LA 1V57A 2IMEA 1TTZA 3HY2A 3KH7A 4Z7XA 2RLIA 4JBBA 1FW1A 2K8SA 2WRTA 5DBQA 2YZHA 3DEXA 5F0GA 3TRXA 1S3AA 3HYPA 2WZ9A 4K1FA 1V40A 4YQVA 1GH2A 2YV7A 2H66A 1XPVA 3KJYA 1CQGA 1PMTA 2G0FA 4ZBBA 3RAZA 4Q5QA 3BCIA 1HD2A 3BCKA 4V2NA 2VKZG 2VCXA 3FEUA 1ABAA 4AJ8A 1UA5A 2V32A 4MH2A 2MMAA 3GRXA 4Q5FA 1MDJA 4QQ7A 10GSA 3KIJA 4FQUA 1VF1A 5J4UA 4MLYA 3HCZA 2C0EA 1T1VA 4X4JA 4G9HA 1GRXA 4I2TA 4F03A 3H79A 3QMXA 2LJKA 4OCFA 1U3AA 4YAVA 1MEKA 2HYXA 2H30A 5J40A 4G01A 1GLQA 2TRCP 2JL4A 1VF3A 4IELA 5ECSA 4K7OA 1PSQA 3QPMA 4I6XA 1FB6A 4TR1A 3QCPA 4OCEA 2NVLA 2OT3A 1XWCA 2VCZA 1KTEA 3H93A 4ZBDA 4JE1A 4KSMA 4ILFA 3HVXA 2LNSA 3VFIA 2FUG2 2XPEA 5A4VA 4F0CA 3AY8A 3QAGA 1EZKA 5B8BA 3KM6A 4G10A 1NSWA 5D9XA 1FOHA 4GSSA 3GL3A 4EDZA 5CYYA 1PRXA 4TW5A 4BVXB 2ES7A 2JZSA 3L9SA 3CSJA 1RK4A 1E2YA 2GQMA 3IAS2 4N0VA 3KD0A 5FWGA 1RQMA 5DCHA 2VAFA 3LG6A 5AISA 2H71A 4TVEA 4XTSA 3M8NA 3WD6A 3LXTA 2KHPA 2LS5A 3L4NA 1WRYA 4V1Ap 3M3MA 1OC9A 4ZL7A 4KH7A 1X9SB 5AIVA 5A34B 5G1LA 1A24A 4I97A 1YJ6A 4BWQA 3ZLPA 1K0BA 2C0DA 2CV4A 3UJ1A 3QFBC 1U88A 4OFMA 1MD3A 2L6CA 4V1Ag 1OKTA 2MYGA 2DJ3A 3VPTA 3GIXA 4YKFA 3IR4A 2GZZA 2RIIA 3WT1A 5IO0A 4E8EA 2L6DA 3I6AA 4LL4B 2OJLA 5IPHA 1TK0B 4MZWA 2AB6A 1WJKA 1M0UA 1EOGA 3HJPA 3MYDA 3CRTA 5IMVA 3UVHA 1BJXA 1QFNA 3F4SA 4V2MA 3QAVA 4HJMA 5BMUB 2JZRA 3VI7A 1GLPA 3F4TA 2CVDA 4K5RA 4MJCA 1IYIA 1A2MA 3TKQA 5G1KA 1SENA 3EE2A 4OFNA 2VLVA 3K8NA 4EC0A 1A8LA 3G7IA 2HSNB 2H72A 2I3YA 4D73B 3GFKA 4XS6A 4QL9A 5INYA 2KOKA 5FHIA 2J9HA 2H8LA 1PN9A 1O73A 4XRAA 5IPGA 5A4WA 3A2VA 2GSRA 1XWGA 4G19A 4AF2A 3VPQA 3FK8A 1EGOA 1SVLA 2FWHA 5CO3A 5J9CA 2C3TA 4PXOA 2HSHA 2HZFA 3GHAA 1WPIA 1GUMA 1URMA 3TKPA 4BL7B 4W66A 3R2QA 2PVOC 1EGRA 1EEMA 3CSIA 5B7CA 3TJJA 2VLUA 4BVXA 2OE1A 5KN1A 2CX3A 7GSSA 4YKGA 5IMCA 3UOMA 2PGTA 5J9BA 1TKDB 4ECBA 3FMWA 1Z7RA 3ZIJA 1AW9A 4MDCA 4PQIA 2IIYA 1EEJA 2B5YA 1X5EA 3PINA 3U5RE 2PERA 2K6VA 5ECPB 4KW6A 4K7NA 2CAIA 3CRUA 1OKDA 3ZTLA 3G7YA 4MP4A 5IO2A 4DSQA 2LRNA 1AAZA 4PGTA 4I5QA 5G5FA 5A34A 3TOUA 5HR1A 2NDOA 1OAZA 1YVLA 3N9JA 4CY6A 5ECRB 4ZB6A 3HVSA 5KN2A 2GVPA 19GSA 4YH2A 1ACVA 2XHFA 3F0IA 4POBA 4DVCA 5A5HB 3M1GA 2CX4A 2XBIA 4Z2TA 1X9WB 1JZRA 3KH9A 2M46A 1G7OA 1JLWA 4HU9A 6GSTA 5ECLB 2PWJA 5DJLA 3TKRA 1YKCA 1WP0A 2B3SA 4POLA 3LORA 2LTKA 1OVNA 4NHZA 1GULA 4ECIA 4USSA 3SWLA 4JEDA 3N5OA 1B9YC 6GSSA 4N10A 5D8IA 2VCWA 4K2DA 4HDEA 4AI6A 1ZGNA 5DQSA 3VWXA 2OACA 1A2JA 3M0FA 5BMUA 1NM3A 1C72A 5DJMA 1J9BA 2FA4A 1GNEA 2YWOA 5LCZA 1TK8B 4MMMA 4F0BA 3US3A 1GNWA 4KGIA 2CA8A 1ZZYA 2DIYA 4OO5A 1GTAA 5D9TA 4ID0A 1WE0A 4IKHA 2HSNA 5HFKA 4D73A 2REMA 4GXZA 1R7HA 5A4UA 1UVZA 4PQ1A 1SL0B 1WMJA 5CP1A 4EXJA 4JU5A 1GSYA 1CQHA 2YOIA 1XW6A 1JLVA 1T00A 4AJ6A 1X0RA 4IP1A 2CT6A 4Z2UA 4WETA 1QK8A 3ZMLA 1U87A 2WCIA 2IJYA 1XZOA 1O7UA 1OE8A 1WOUA 2HFDA 5G2ZA 1AXDA 4BL7A 4XS4B 1V9WA 4HI7A 5ELAA 5EVOA 2I9HA 4MJEA 2LSTA 2GLRA 5COHA 1K0NA 1VF2A 2LJRA 3GUSA 1ERUA 2A4HA 1X5CA 3G9BA 1W4VA 1XXUA 3D6IA 3UVTA 5IMAA 3GV1A 5GAPD 2IMDA 3L9UA 4KB3A 1TXUA 4ZXGA 4F2IA 5KOXA 2H19A 2V1MA 5H5SA 4IJIA 5A1NB 3D4MA 1R4WA 1SK2A 2OADA 2VL2A 4ZB7A 4NV2A 3TOTA 3EU3A 3KEBA 1QMVA 1TI1A 2B6MA 5CRGA 2VL3A 3GN3A 4GSNA 1KEBA 3KZQA 4DSSB 3NZNA 5D9WA 3ZMKA 5AIXA 2K9FA 2A2RA 2HSMB 2FA8A 5D96A 3DVXA 1Q98A 1Z6NA 5GZZB 1XIYA 4GF0A 2H6YA 2HE3A 4BA7A 2EIQA 3OR5A 3BBYA 5GAND 5A5HA 1IYHA 3KTBA 1YF0A 1HNAA 2H0IA 3D0ZA 1J08A 2CQ9A 3IAM2 1TRWA 2L4CA 3A3TA 3ZIVA 5JCGA 4AKIA 3C7MA 1GUHA 1TDIA 2QGVA 1ON4A 2LNTA 4HZ4A 4MH3A 4K6XA 4MJBA 2LUSA 3EINA 4NPBA 22GSA 4N3ZA 3GKMA 3LQ7A 2WB9A 3F3QA 3HMJG 3KXOA 1FO5A 2QC7A 2GT6A 3KTLA 1B8XA 4QL7A 1DUGA 4E68A 3VWWA 4Q5NA 1FVJA 2YWMA 3F63A 3FZ5A 2E7PA 1AQWA 2YWNA 2K8VA 3C1SA 4KNDA 2HRFA 12GSA 2PBJA 6GSVA 2H75A 2G2QA 3WGEA 2DIZA 1XVWA 3KCMA 2BJXA 1O8WA 1O6JA 1E6BA 5D93A 2ALBA 3HJMA 3IA1A 3IV4A 2X64A 3DD3A 3PGTA 2TRXA 2DJ1A 4KDUA 3FY7A 3GKKA 4PX1A 5J41A 4LL1B 3VWUA 2H73A 1FHEA 3M9JA 17GSA 5ELGA 4HU7A 2XC2A 1NHYA 2VLTA 4PQHA 4XS4A 1AIUA 4WXTA 3ZFLA 2EC4A 1SL2B 20GSA 2A2PA 4KDXA 3KMNA 5F07A 3LFLA 2UZ8A 4ZB8A 1ZOFA 3IHGA 1A0FA 1F3AA 1F9MA 1PX6A 1XOBA 5D73A 4BVYB 1YKAA 3GKNA 5A1NA 1FG4A 3WGXA 1ML6A 4G0LA 1GSQA 2YZUA 2I4AA 1ILOA 2GZYA 5HR3A 1G6WA 2F51A 1XW5A 4O92A 2OE0A 4DSSA 1GP1A 1Y1UA 2P31A 1VGLA 3A5WA 3EYTA 3FR3A 2B1LA 2HSMA 1X9MB 2HZEB 4KX4A 4CDOA 2GSQA 3EU4A 1TRVA 2X8HA 3ZRDA 1ZYQB 1XBSA 2C1YA 1S3DA 1MD4A 2H1GA 1GTIA 1XCCA 3C73A 2C0FA 4WKWA 2ON7A 5HFIA 1FOVA 3NOFA 2JU5A 4EF0A 2HQTA 2IWTA 1SJ6A 3ZL5A 1O81A 2L5LA 2YN1A 4HQZA 3BOAA 3APQA 14GSA 4FH8A 3CBUA 5C04A 2AYTA 2LJAA 1UN2A 1S3CA 5ID2B 3DKSA 13GSA 3GSSA 2C8UA 4ECCA 1N8JA 2X8CA 2VUPA 2JADA 2E0QA 2CVBA 4PNFA 3UIWA 2C4JA 1DE2A 5GSTA 1B4PA 1SKRB 4KA0A 2MMOA 4WBJA 3BD2A 3RBTA 4L5LA 2IFQA 4KAEA 2R2JA 3HHVA 4G0KA 2R6KA 4IGJA 2VOCA 3LXZA 2LEGA 4AKXB 1OC8A 3NIVA 4EE0A 3ZITA 3IC4A 3W8JA 3RPNA 4WEYA 2X4AA 2PPTA 3Q74A 4IHUA 3IBHA 1THXA 4G0IA 2ZUPA 2VM2A 1SKSB 3UEMA 3HZ8A 1TI3A 1TRUA 3CYNA 1SVMA 3FHKA 2EIRA 5ECNB 2H6ZA 2HSYA 3F4RA 4NHWA 4WR5A 1NW2A 4X1UA 1TW9A 5J4VA 2O85A 1I5GA 4ZILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N5B A;  2RM5 A;  4EVM A;  4PUR A;  2GGT A;  1K0C A;  1YY7 A;  3UAR A;  3PH9 A;  4JR6 A;  2JAC A;  3GMF A;  2HI7 A;  2HRN A;  4NWY A;  3DYR A;  4BVY A;  1MDK A;  2C80 A;  1Z6M A;  1SK1 A;  3DML A;  4L5O A;  2RUE A;  2K18 A;  2DBC A;  2TIR A;  11GS A;  4LLR A;  5ECH B;  1SD9 A;  1Y6E A;  4F9Z A;  1BYE A;  3CTG A;  1OYJ A;  1K3L A;  1U6T A;  2VL2 C;  3EUR A;  1XWA A;  2B1K A;  3E0U A;  4L0U A;  2L57 A;  2YCD A;  2HZE A;  1WWJ A;  2GQK A;  6GSU A;  2PN8 A;  4MF7 A;  2OBK A;  3GKX A;  3CSH A;  1DBY A;  2V6O A;  1T3B A;  1YEP A;  2XPD A;  4WBR D;  1B9X C;  1W89 A;  2MBS A;  3TJK A;  5B8A A;  1TJD A;  3HVV A;  3W8S A;  3L0H A;  2WGR A;  2DMM A;  2VD1 A;  1ZYE A;  5KEJ A;  1SYX A;  2KLX A;  4J57 E;  4HOJ A;  3IXR A;  1R5P A;  4L8E A;  4I8B A;  2HLS A;  3QAW A;  4N11 A;  2X8G A;  4IP6 A;  4HJ2 A;  5J5N A;  2V6K A;  2WS2 A;  5ID2 A;  2R5G A;  4MF6 A;  1GWC A;  2H01 A;  6GSW A;  2O7K A;  1WIK A;  5H5Q A;  2X99 A;  3DWV A;  1YDK A;  3KMO A;  3TUE A;  1T8E B;  2BMX A;  3C71 A;  1Z9H A;  5C00 A;  3JCM L;  4DSR A;  5D9V A;  1G7E A;  3GX0 A;  5IMD A;  2DJ2 A;  4EL1 A;  3LJR A;  3GNJ A;  2R4V A;  2C0G A;  1FVK A;  2M72 A;  1XWB A;  5DQY A;  2XBQ A;  2GTU A;  3U6V A;  2R3X A;  4IN0 A;  2GST A;  2NPB A;  3QFA C;  4BPY A;  4RQR A;  3I69 A;  1QUW A;  3IDV A;  5ECK B;  4WR4 A;  1JZW A;  5F8B A;  2YAN A;  2IMF A;  1GL8 A;  4JZQ A;  1HNB A;  1NHO A;  4TN8 A;  5IMZ A;  4NV5 A;  3TKS A;  1GSE A;  4PTS A;  1GSU A;  3HKR A;  2MMZ A;  1G0T A;  3R3E A;  1M2A A;  4HS1 A;  3TJG A;  4NAX A;  2F8F A;  1B48 A;  4CHS A;  5HR0 A;  3RPP A;  2JZT A;  2CVK A;  5B6M A;  3IE3 A;  4PUA A;  2H76 A;  3ZFB A;  4IQ1 A;  3KP9 A;  2H70 A;  1GTU A;  1FAA A;  2DJ0 A;  4OO4 A;  2WFC A;  1XVQ A;  1GSD A;  2DML A;  2QSI A;  4ML6 A;  4RUV A;  4TR3 A;  18GS A;  2B5X A;  4EO3 A;  2HT9 A;  3RDW A;  2LRC A;  1ERW A;  4FYB A;  1BAY A;  2H0H A;  1SU9 A;  5DDL A;  5L71 A;  2PUK C;  3GUR A;  5EL8 A;  4JR4 A;  1QGV A;  2IN3 A;  2H74 A;  2ZNM A;  2AUV A;  3IC8 A;  3TJB A;  2V2G A;  1VF4 A;  2HNL A;  3QOU A;  2H0G A;  3ZVJ D;  3ZZX A;  3P8W A;  1ZL9 A;  5H5R A;  1DSB A;  3L78 A;  1AQX A;  2MMN A;  5JWO B;  4KF9 A;  1BQ7 A;  4XS1 A;  4MZB A;  2E2M A;  4OFT A;  5ECQ B;  3IK7 A;  3GL5 A;  1TU8 A;  2P5R A;  1Z7P A;  1PL1 A;  1XWK A;  1F37 A;  2L59 A;  3DVW A;  1QXH A;  4WF4 A;  1EV4 A;  1U3I A;  1F2E A;  1M2B A;  3V1W A;  2O89 A;  3FR6 A;  3VI5 A;  2L4Q A;  2LQO A;  2OKA A;  3P2A A;  2WJU A;  3RHC A;  2VCT A;  2E2G A;  4LMW A;  3J7Y k;  2KUC A;  1V2A A;  1UC7 A;  4KSO A;  4ACS A;  5HQP A;  5IOW A;  4GCI A;  3LEF A;  4TOP A;  3HXS A;  3GA4 A;  2FY6 A;  5G31 A;  3F6F A;  5ENU A;  4K7I A;  2O8V B;  3GTU B;  3UAP A;  5G5E A;  2FHE A;  2LRT A;  5A5K A;  2IFQ B;  1Y25 A;  3L9V A;  3KP8 A;  3QD9 A;  3TCO A;  1G6Y A;  5EY6 A;  4RI6 A;  1HYU A;  4OMV A;  4X43 A;  1M99 A;  5B6N A;  2CZ3 A;  2KP1 A;  2A2S A;  1TRS A;  3F9U A;  3HD5 A;  2F3M A;  3H1N A;  2PMT A;  3GH9 A;  1AC1 A;  3MWH A;  4F82 A;  3MDK A;  2FGX A;  1H4O A;  2ZCT A;  2GQL A;  5F05 A;  2CZ2 A;  2DJK A;  4TR4 A;  3BJ5 A;  3GST A;  1X5D A;  1Z5Y E;  1OE7 A;  3EWL A;  8GSS A;  5LNK e;  1JFU A;  3GX8 A;  2NBS A;  5DAK B;  1TP9 A;  1GTB A;  4FO5 A;  4RQX A;  4PNG A;  3APO A;  3MSZ A;  5DCG A;  1SL1 B;  2FWF A;  1EV9 A;  4MA9 A;  1T7P B;  2JSZ A;  2YV9 A;  3MAK A;  3ZVJ A;  5CNW A;  1ERT A;  3H8Q A;  3H4K A;  2R37 A;  4MCU A;  4ULX A;  3FKF A;  3HA9 A;  2DC5 A;  2OBI A;  1BED A;  3RHB A;  4HZ2 A;  4XRD A;  3P7X A;  1PA3 A;  3TRP A;  1PGT A;  3FW2 A;  3LGC A;  4X0X A;  2FWE A;  2DLX A;  3Q18 A;  2A4V A;  4OWY A;  2HRK B;  3UL3 A;  2YWI A;  2N5A A;  4K8M A;  5E59 A;  1SKW B;  2P0G A;  3EMP A;  3LYK A;  3D22 A;  4MK3 A;  2Z9S A;  2GS3 A;  3IRA A;  5JCW A;  3G7J A;  2LQQ A;  3FR9 A;  1QQ2 A;  1GSS A;  3PR8 A;  4GST A;  4YQU A;  2MBT A;  3A2X A;  4GQC A;  5IM9 A;  4JRR A;  5IOX A;  5DAL B;  4I2U A;  3CTF A;  1LJR A;  4FIW A;  1YF1 A;  1MTC A;  2V41 A;  6GSY A;  2H1A A;  3O3T A;  3DXB A;  3Q6O A;  4N0Z A;  4O5R A;  2D2Z A;  5IIZ A;  4K0G A;  5ECI B;  3M9K A;  3EC3 A;  1SJI A;  3GTU A;  5KN0 A;  3DRN A;  1M2D A;  3ED3 A;  4IW9 A;  2VO4 A;  4TR0 A;  3WYW A;  1PL2 A;  4E8H A;  3ERG A;  1ERV A;  1EWX A;  3P90 A;  1EOH A;  3ME7 A;  2VIM A;  1SYR A;  1TOF A;  1M9B A;  1HQO A;  3HJO A;  1K3Y A;  2OA7 A;  1OC3 A;  3ME8 A;  1A0R P;  1SD8 A;  3WGD A;  1GSF A;  1A2L A;  3TKS C;  1R5A A;  2VD0 A;  2B5E A;  3TJF A;  2AV4 A;  5CRD A;  3ZRE A;  3A2W A;  4P3Y B;  3C8E A;  4HUA A;  4BWS A;  1Q4J A;  2YNX A;  4GRF A;  3PPU A;  4IS0 A;  3I43 A;  2FLS A;  3HDC A;  4KDY A;  3EMX A;  4MZC A;  3J7Y b;  3TB2 A;  4O32 A;  1ZCP A;  4ISD A;  4YQM A;  4WF5 A;  4CW9 A;  3S9F A;  4LMV A;  1THO A;  5DAK A;  3CMI A;  2H1B A;  1B4Q A;  1MDI A;  4IBP A;  2QKE A;  1K0A A;  2PVQ A;  3APS A;  4AGS A;  3TRQ A;  1T4Z A;  2LKU A;  3C1R A;  5G30 A;  5F06 A;  4HQS A;  4AJ7 A;  4ECJ A;  4KE3 A;  2OE3 A;  3FZ4 A;  6GSX A;  2YPM A;  3KGK A;  2VL9 A;  4MPG A;  2L5O A;  1K0M A;  4ZIJ A;  2FWG A;  2AHE A;  2IPA A;  4XHM A;  4FYC A;  2WDU A;  5IQY A;  3E3E A;  2H1D A;  3DGQ A;  1PKZ A;  2FD3 A;  4YAP A;  2B7J A;  3WT2 A;  3I9V 2;  3D21 A;  1RW1 A;  3ERW A;  4KCE A;  3FYG A;  1KNG A;  1KBN A;  4GQF A;  2IMK A;  2HRK A;  5LD0 A;  2FNO A;  4GTU A;  1USB A;  1A23 A;  4TXO B;  1O85 A;  4HEA 2;  2C3N A;  3HZ4 A;  2YJH A;  1SJZ A;  5HR2 A;  1SK0 A;  1AQV A;  5HFG A;  5ABR A;  4PUF C;  3W6G A;  16GS A;  1H75 A;  3VK9 A;  2GSS A;  3IHQ A;  5DAL A;  1M7T A;  2IMI A;  1DE1 A;  4MPF A;  1ZMA A;  4MAB A;  1Z3E A;  5GSS A;  4O7H A;  1JZD A;  4NMU A;  2B7K A;  1TU7 A;  3UBK A;  5CAX A;  1V98 A;  1K0O A;  4EDY A;  4TKY A;  4J56 E;  5ECO B;  3IK9 A;  2IL3 A;  4MJA A;  2I1U A;  2BTO T;  3LYP A;  1I9D A;  4G2E A;  2O87 A;  3LSZ A;  1YQ1 A;  2CAQ A;  1EP8 A;  3DIE A;  4ZB9 A;  4K0N A;  3IOS A;  2MZC A;  5CRW A;  1J0F A;  4IQA A;  2VCV A;  1BG5 A;  2C3Q A;  1N2A A;  3O76 A;  3VUR A;  3TDG A;  1VRS D;  3GYK A;  1O8X A;  4MF5 A;  4KCA A;  2PU9 C;  3VLN A;  1EP7 A;  3O6T A;  4IJ3 A;  1PKW A;  3ERF A;  4DEJ A;  3D4T A;  4N30 A;  3MNG A;  1LU4 A;  1XOA A;  5CRE A;  2GZP A;  2F8A A;  2N5F A;  3Q19 A;  1PD2 1;  5KN3 A;  5JWQ B;  1XW9 A;  4L0W A;  3LWA A;  4H86 A;  1BX9 A;  1TXX A;  1T4Y A;  4IVF A;  1K3O A;  4ML1 A;  4Q5R A;  2HXK A;  3TGZ A;  2NTO A;  2VM1 A;  4EUY A;  5J3R A;  5ECM B;  1M9A A;  5DVB A;  1V58 A;  3IPZ A;  2GDR A;  3ISO A;  4OD7 A;  2FCH A;  1K0D A;  1PQN A;  5AGY A;  4POM A;  5E4W A;  5IMF A;  1TK5 B;  2AAW A;  4NXI A;  4GWR A;  4J2F A;  2H6X A;  2JSY A;  3UBL A;  4ZBA A;  2EIO A;  2RUF A;  2YP6 A;  4TR1 B;  2P5Q A;  4GLT A;  3FZ9 A;  2M80 A;  3UMA A;  1F6M C;  1FB0 A;  1GUK A;  5FT3 A;  3F8U A;  2WUL A;  1YEX A;  2RM6 A;  4TRX A;  3VWV A;  4TXO A;  1JHB A;  3ZYW A;  2J23 A;  1JZO A;  5CRH A;  4K9Z A;  4XCS A;  1R26 A;  2AJQ B;  3CXG A;  5JCU A;  3GH6 A;  1YZX A;  9GSS A;  4KUN A;  2VCQ A;  4EKZ A;  5AN1 A;  3FZA A;  4POK A;  2HRA A;  3E9J B;  3FRC A;  3F6D A;  2DSA A;  2KP2 A;  1HNC A;  4ZL8 A;  3QR6 A;  4RI7 A;  2I81 A;  1F3B A;  1PX7 A;  2YJ7 A;  2LV3 A;  3QDN A;  4LA1 A;  3SBC A;  2ON5 A;  5JWR B;  3EVI A;  4XIH A;  4FYU A;  3D5J A;  1A8Y A;  3F3R A;  3TKS E;  1OC9 B;  1LBK A;  1ST9 A;  4TXV A;  2F9S A;  2DJJ A;  2GT5 A;  1XFL A;  5EPF A;  4ZL9 A;  1AUC A;  4V2L A;  1V57 A;  2IME A;  1TTZ A;  3HY2 A;  3KH7 A;  4Z7X A;  2RLI A;  4JBB A;  1FW1 A;  2K8S A;  2WRT A;  5DBQ A;  2YZH A;  3DEX A;  5F0G A;  3TRX A;  1S3A A;  3HYP A;  2WZ9 A;  4K1F A;  1V40 A;  4YQV A;  1GH2 A;  2YV7 A;  2H66 A;  1XPV A;  3KJY A;  1CQG A;  1PMT A;  2G0F A;  4ZBB A;  3RAZ A;  4Q5Q A;  3BCI A;  1HD2 A;  3BCK A;  4V2N A;  2VCX A;  3FEU A;  1ABA A;  4AJ8 A;  1UA5 A;  2V32 A;  4MH2 A;  2MMA A;  3GRX A;  4Q5F A;  1MDJ A;  4QQ7 A;  10GS A;  3KIJ A;  4FQU A;  1VF1 A;  5J4U A;  4MLY A;  3HCZ A;  2C0E A;  1T1V A;  4G9H A;  1GRX A;  4I2T A;  4F03 A;  3H79 A;  3QMX A;  2LJK A;  4OCF A;  1U3A A;  4YAV A;  1MEK A;  2HYX A;  2H30 A;  1GLQ A;  2TRC P;  2JL4 A;  1VF3 A;  4IEL A;  5ECS A;  4K7O A;  1PSQ A;  3QPM A;  4I6X A;  1FB6 A;  4TR1 A;  3QCP A;  4OCE A;  2NVL A;  1XWC A;  2VCZ A;  1KTE A;  3H93 A;  4ZBD A;  4JE1 A;  4KSM A;  4ILF A;  3HVX A;  2LNS A;  3VFI A;  2FUG 2;  2XPE A;  5A4V A;  4F0C A;  3AY8 A;  3QAG A;  1EZK A;  5B8B A;  3KM6 A;  4G10 A;  1NSW A;  5D9X A;  4GSS A;  3GL3 A;  4EDZ A;  5CYY A;  1PRX A;  4TW5 A;  4BVX B;  2ES7 A;  2JZS A;  3L9S A;  3CSJ A;  1RK4 A;  1E2Y A;  2GQM A;  3IAS 2;  4N0V A;  3KD0 A;  5FWG A;  1RQM A;  5DCH A;  2VAF A;  3LG6 A;  5AIS A;  2H71 A;  4TVE A;  4XTS A;  3M8N A;  3WD6 A;  3LXT A;  2KHP A;  2LS5 A;  3L4N A;  1WRY A;  4V1A p;  3M3M A;  1OC9 A;  4ZL7 A;  4KH7 A;  1X9S B;  5AIV A;  5G1L A;  1A24 A;  4I97 A;  1YJ6 A;  4BWQ A;  3ZLP A;  1K0B A;  2C0D A;  2CV4 A;  3UJ1 A;  3QFB C;  1U88 A;  4OFM A;  1MD3 A;  2L6C A;  4V1A g;  1OKT A;  2MYG A;  2DJ3 A;  3VPT A;  3GIX A;  3IR4 A;  2GZZ A;  2RII A;  3WT1 A;  5IO0 A;  4E8E A;  2L6D A;  3I6A A;  4LL4 B;  2OJL A;  5IPH A;  1TK0 B;  4MZW A;  2AB6 A;  1WJK A;  1M0U A;  1EOG A;  3HJP A;  3CRT A;  5IMV A;  3UVH A;  1BJX A;  1QFN A;  3F4S A;  4V2M A;  3QAV A;  4HJM A;  2JZR A;  3VI7 A;  1GLP A;  3F4T A;  2CVD A;  4MJC A;  1IYI A;  1A2M A;  3TKQ A;  5G1K A;  1SEN A;  3EE2 A;  4OFN A;  2VLV A;  3K8N A;  4EC0 A;  1A8L A;  3G7I A;  2HSN B;  2H72 A;  2I3Y A;  4D73 B;  3GFK A;  4XS6 A;  4QL9 A;  5INY A;  2KOK A;  5FHI A;  2J9H A;  2H8L A;  1PN9 A;  1O73 A;  4XRA A;  5IPG A;  5A4W A;  3A2V A;  2GSR A;  1XWG A;  4G19 A;  4AF2 A;  3VPQ A;  3FK8 A;  1EGO A;  2FWH A;  5CO3 A;  5J9C A;  2C3T A;  4PXO A;  2HSH A;  2HZF A;  3GHA A;  1WPI A;  1GUM A;  1URM A;  3TKP A;  4BL7 B;  3R2Q A;  2PVO C;  1EGR A;  1EEM A;  3CSI A;  5B7C A;  3TJJ A;  2VLU A;  4BVX A;  2OE1 A;  5KN1 A;  2CX3 A;  7GSS A;  5IMC A;  3UOM A;  2PGT A;  5J9B A;  1TKD B;  4ECB A;  1Z7R A;  3ZIJ A;  1AW9 A;  4MDC A;  4PQI A;  2IIY A;  1EEJ A;  2B5Y A;  1X5E A;  3PIN A;  3U5R E;  2PER A;  2K6V A;  5ECP B;  4KW6 A;  4K7N A;  2CAI A;  3CRU A;  1OKD A;  3ZTL A;  3G7Y A;  4MP4 A;  5IO2 A;  4DSQ A;  2LRN A;  1AAZ A;  4PGT A;  4I5Q A;  5G5F A;  3TOU A;  5HR1 A;  2NDO A;  1OAZ A;  3N9J A;  5ECR B;  4ZB6 A;  3HVS A;  5KN2 A;  2GVP A;  19GS A;  4YH2 A;  1ACV A;  2XHF A;  3F0I A;  4POB A;  4DVC A;  3M1G A;  2CX4 A;  2XBI A;  1X9W B;  1JZR A;  3KH9 A;  2M46 A;  1G7O A;  1JLW A;  4HU9 A;  6GST A;  5ECL B;  2PWJ A;  5DJL A;  3TKR A;  1YKC A;  1WP0 A;  2B3S A;  4POL A;  3LOR A;  2LTK A;  1OVN A;  4NHZ A;  1GUL A;  4ECI A;  4USS A;  3SWL A;  4JED A;  3N5O A;  1B9Y C;  6GSS A;  4N10 A;  5D8I A;  2VCW A;  4K2D A;  4HDE A;  1ZGN A;  5DQS A;  3VWX A;  2OAC A;  1A2J A;  3M0F A;  5BMU A;  1NM3 A;  1C72 A;  5DJM A;  1J9B A;  2FA4 A;  1GNE A;  2YWO A;  5LCZ A;  1TK8 B;  4MMM A;  4F0B A;  3US3 A;  1GNW A;  4KGI A;  2CA8 A;  1ZZY A;  2DIY A;  4OO5 A;  1GTA A;  5D9T A;  4ID0 A;  1WE0 A;  4IKH A;  5HFK A;  4D73 A;  2REM A;  4GXZ A;  1R7H A;  5A4U A;  1UVZ A;  4PQ1 A;  1SL0 B;  1WMJ A;  5CP1 A;  4EXJ A;  4JU5 A;  1GSY A;  1CQH A;  2YOI A;  1XW6 A;  1JLV A;  1T00 A;  4AJ6 A;  1X0R A;  4IP1 A;  2CT6 A;  4WET A;  1QK8 A;  3ZML A;  1U87 A;  2WCI A;  2IJY A;  1XZO A;  1O7U A;  1OE8 A;  1WOU A;  2HFD A;  5G2Z A;  1AXD A;  4BL7 A;  4XS4 B;  1V9W A;  4HI7 A;  5ELA A;  5EVO A;  2I9H A;  4MJE A;  2LST A;  2GLR A;  5COH A;  1K0N A;  1VF2 A;  2LJR A;  3GUS A;  1ERU A;  1X5C A;  3G9B A;  1W4V A;  1XXU A;  3D6I A;  3UVT A;  5IMA A;  3GV1 A;  5GAP D;  2IMD A;  3L9U A;  4KB3 A;  4ZXG A;  4F2I A;  2H19 A;  2V1M A;  5H5S A;  4IJI A;  3D4M A;  1R4W A;  1SK2 A;  2OAD A;  2VL2 A;  4NV2 A;  3TOT A;  3EU3 A;  3KEB A;  1QMV A;  1TI1 A;  2B6M A;  5CRG A;  2VL3 A;  3GN3 A;  4GSN A;  1KEB A;  3KZQ A;  4DSS B;  3NZN A;  5D9W A;  3ZMK A;  5AIX A;  2K9F A;  2A2R A;  2HSM B;  2FA8 A;  5D96 A;  3DVX A;  1Q98 A;  1Z6N A;  5GZZ B;  1XIY A;  4GF0 A;  2H6Y A;  2HE3 A;  4BA7 A;  2EIQ A;  3OR5 A;  3BBY A;  5GAN D;  1IYH A;  3KTB A;  1YF0 A;  1HNA A;  2H0I A;  3D0Z A;  1J08 A;  2CQ9 A;  3IAM 2;  1TRW A;  2L4C A;  3A3T A;  3ZIV A;  5JCG A;  3C7M A;  1GUH A;  1TDI A;  2QGV A;  1ON4 A;  2LNT A;  4HZ4 A;  4MH3 A;  4K6X A;  4MJB A;  2LUS A;  3EIN A;  4NPB A;  22GS A;  3GKM A;  3LQ7 A;  2WB9 A;  3F3Q A;  3KXO A;  1FO5 A;  2QC7 A;  2GT6 A;  3KTL A;  1B8X A;  4QL7 A;  1DUG A;  3VWW A;  4Q5N A;  1FVJ A;  2YWM A;  3F63 A;  3FZ5 A;  2E7P A;  1AQW A;  2YWN A;  2K8V A;  3C1S A;  4KND A;  2HRF A;  12GS A;  2PBJ A;  6GSV A;  2H75 A;  2G2Q A;  3WGE A;  2DIZ A;  1XVW A;  3KCM A;  2BJX A;  1O8W A;  1O6J A;  1E6B A;  5D93 A;  2ALB A;  3HJM A;  3IA1 A;  3IV4 A;  2X64 A;  3DD3 A;  3PGT A;  2TRX A;  2DJ1 A;  4KDU A;  3FY7 A;  3GKK A;  4PX1 A;  5J41 A;  4LL1 B;  3VWU A;  2H73 A;  1FHE A;  3M9J A;  17GS A;  5ELG A;  4HU7 A;  2XC2 A;  1NHY A;  2VLT A;  4PQH A;  4XS4 A;  1AIU A;  4WXT A;  3ZFL A;  2EC4 A;  1SL2 B;  20GS A;  4KDX A;  3KMN A;  5F07 A;  3LFL A;  2UZ8 A;  4ZB8 A;  1ZOF A;  1A0F A;  1F3A A;  1F9M A;  1PX6 A;  1XOB A;  5D73 A;  4BVY B;  1YKA A;  3GKN A;  1FG4 A;  3WGX A;  1ML6 A;  4G0L A;  1GSQ A;  2YZU A;  2I4A A;  1ILO A;  2GZY A;  5HR3 A;  1G6W A;  2F51 A;  1XW5 A;  4O92 A;  2OE0 A;  4DSS A;  1GP1 A;  2P31 A;  1VGL A;  3A5W A;  3EYT A;  3FR3 A;  2B1L A;  2HSM A;  1X9M B;  2HZE B;  4KX4 A;  4CDO A;  2GSQ A;  3EU4 A;  1TRV A;  2X8H A;  3ZRD A;  1ZYQ B;  1XBS A;  2C1Y A;  1S3D A;  1MD4 A;  2H1G A;  1GTI A;  1XCC A;  3C73 A;  2C0F A;  4WKW A;  2ON7 A;  5HFI A;  1FOV A;  3NOF A;  2JU5 A;  4EF0 A;  2HQT A;  2IWT A;  1SJ6 A;  3ZL5 A;  1O81 A;  2L5L A;  2YN1 A;  4HQZ A;  3BOA A;  3APQ A;  14GS A;  4FH8 A;  3CBU A;  5C04 A;  2AYT A;  2LJA A;  1UN2 A;  1S3C A;  5ID2 B;  3DKS A;  13GS A;  3GSS A;  2C8U A;  4ECC A;  1N8J A;  2X8C A;  2VUP A;  2JAD A;  2E0Q A;  2CVB A;  4PNF A;  3UIW A;  2C4J A;  1DE2 A;  5GST A;  1B4P A;  1SKR B;  4KA0 A;  2MMO A;  4WBJ A;  3BD2 A;  3RBT A;  4L5L A;  2IFQ A;  4KAE A;  2R2J A;  3HHV A;  4G0K A;  2R6K A;  4IGJ A;  2VOC A;  3LXZ A;  2LEG A;  1OC8 A;  3NIV A;  4EE0 A;  3ZIT A;  3IC4 A;  3W8J A;  3RPN A;  4WEY A;  2PPT A;  3Q74 A;  4IHU A;  3IBH A;  1THX A;  4G0I A;  2ZUP A;  2VM2 A;  1SKS B;  3UEM A;  3HZ8 A;  1TI3 A;  1TRU A;  3CYN A;  3FHK A;  2EIR A;  5ECN B;  2H6Z A;  2HSY A;  3F4R A;  4NHW A;  4WR5 A;  1NW2 A;  4X1U A;  1TW9 A;  2O85 A;  1I5G A;  4ZIL A; 
#chains in the Genus database with same CATH topology
 2N5B A;  2RM5 A;  4EVM A;  4PUR A;  2GGT A;  1K0C A;  1YY7 A;  3UAR A;  3PH9 A;  4JR6 A;  2JAC A;  3GMF A;  2HI7 A;  2HRN A;  4NWY A;  3DYR A;  4BVY A;  1MDK A;  2C80 A;  1Z6M A;  1SK1 A;  3DML A;  4L5O A;  2RUE A;  2K18 A;  2DBC A;  2TIR A;  11GS A;  4LLR A;  3CHX C;  5ECH B;  1SD9 A;  1Y6E A;  4F9Z A;  1BYE A;  2WVZ A;  3CTG A;  4EIP A;  1OYJ A;  1K3L A;  1U6T A;  2VL2 C;  3EUR A;  1XWA A;  2B1K A;  3E0U A;  4L0U A;  2L57 A;  2YCD A;  2HZE A;  1WWJ A;  2GQK A;  6GSU A;  2PN8 A;  4MF7 A;  2OBK A;  3GKX A;  3CSH A;  1DBY A;  2V6O A;  1T3B A;  1YEP A;  2XPD A;  4WBR D;  1B9X C;  1W89 A;  2MBS A;  3TJK A;  5B8A A;  1TJD A;  3HVV A;  3W8S A;  3L0H A;  2WGR A;  2WW3 A;  2DMM A;  2VD1 A;  1ZYE A;  5KEJ A;  1SYX A;  2KLX A;  4J57 E;  4HOJ A;  3IXR A;  1R5P A;  4L8E A;  1PN0 A;  4I8B A;  2HLS A;  3QAW A;  4N11 A;  2X8G A;  4IP6 A;  4HJ2 A;  5J5N A;  2V6K A;  2WS2 A;  5ID2 A;  2R5G A;  4MF6 A;  1GWC A;  2H01 A;  6GSW A;  2O7K A;  1WIK A;  5H5Q A;  2X99 A;  3DWV A;  1YDK A;  3KMO A;  3TUE A;  1T8E B;  2BMX A;  3C71 A;  1Z9H A;  5C00 A;  3JCM L;  4DSR A;  5D9V A;  1G7E A;  3GX0 A;  5IMD A;  2DJ2 A;  4EL1 A;  3LJR A;  3GNJ A;  2R4V A;  2C0G A;  1FVK A;  2M72 A;  1XWB A;  5DQY A;  2XBQ A;  2GTU A;  3U6V A;  2R3X A;  4IN0 A;  2GST A;  2NPB A;  3QFA C;  4BPY A;  4RQR A;  3I69 A;  1QUW A;  3IDV A;  5ECK B;  4WR4 A;  1JZW A;  5F8B A;  2YAN A;  2IMF A;  1GL8 A;  4JZQ A;  1HNB A;  1NHO A;  4TN8 A;  5IMZ A;  4NV5 A;  3TKS A;  1GSE A;  4PTS A;  1GSU A;  3HKR A;  4BIK A;  2MMZ A;  2X49 A;  1G0T A;  3R3E A;  1M2A A;  4HS1 A;  3TJG A;  4NAX A;  2F8F A;  1B48 A;  4CHS A;  5HR0 A;  3RPP A;  2JZT A;  2CVK A;  5B6M A;  3IE3 A;  4PUA A;  2H76 A;  3ZFB A;  4IQ1 A;  2WVX B;  3KP9 A;  2H70 A;  1GTU A;  1FAA A;  2DJ0 A;  4OO4 A;  2WFC A;  1XVQ A;  1GSD A;  2DML A;  2QSI A;  4ML6 A;  4RUV A;  4TR3 A;  18GS A;  2B5X A;  4EO3 A;  2HT9 A;  3RDW A;  2LRC A;  1ERW A;  4FYB A;  1BAY A;  3A5I A;  2H0H A;  1SU9 A;  5DDL A;  5L71 A;  4PHZ C;  3GUR A;  2PUK C;  5EL8 A;  4JR4 A;  1QGV A;  2IN3 A;  2H74 A;  2ZNM A;  2AUV A;  3IC8 A;  3TJB A;  2V2G A;  1VF4 A;  2HNL A;  3QOU A;  2H0G A;  3ZVJ D;  3ZZX A;  3P8W A;  1ZL9 A;  5H5R A;  1DSB A;  3L78 A;  1AQX A;  2MMN A;  5JWO B;  4KF9 A;  1BQ7 A;  4XS1 A;  4MZB A;  5BRT A;  2E2M A;  4OFT A;  5ECQ B;  3IK7 A;  3GL5 A;  1TU8 A;  2P5R A;  1Z7P A;  1PL1 A;  1M3I A;  1XWK A;  1F37 A;  2L59 A;  3DVW A;  1QXH A;  4WF4 A;  1EV4 A;  1U3I A;  1F2E A;  1M2B A;  3V1W A;  2O89 A;  3FR6 A;  3VI5 A;  2L4Q A;  2LQO A;  2OKA A;  3P2A A;  2WJU A;  3RHC A;  2VCT A;  2E2G A;  4LMW A;  4PI0 C;  3J7Y k;  2KUC A;  4CY8 A;  1V2A A;  1UC7 A;  4KSO A;  4ACS A;  5HQP A;  5IOW A;  4GCI A;  3LEF A;  4TOP A;  3HXS A;  3GA4 A;  2FY6 A;  5G31 A;  3F6F A;  5ENU A;  4K7I A;  2O8V B;  3GTU B;  3UAP A;  5G5E A;  2FHE A;  2LRT A;  5A5K A;  2IFQ B;  1Y25 A;  3L9V A;  3KP8 A;  3QD9 A;  3TCO A;  1G6Y A;  5EY6 A;  4RI6 A;  1HYU A;  4OMV A;  4X43 A;  1M99 A;  5B6N A;  2CZ3 A;  2KP1 A;  2A2S A;  1TRS A;  3F9U A;  3HD5 A;  2F3M A;  3H1N A;  2PMT A;  3GH9 A;  1AC1 A;  3MWH A;  4F82 A;  3MDK A;  2FGX A;  1H4O A;  2ZCT A;  2GQL A;  5F05 A;  2CZ2 A;  2DJK A;  4TR4 A;  3BJ5 A;  2QA2 A;  3GST A;  1X5D A;  2WVX A;  1Z5Y E;  1OE7 A;  3EWL A;  8GSS A;  5LNK e;  1JFU A;  3GX8 A;  2NBS A;  5DAK B;  1TP9 A;  1GTB A;  4FO5 A;  4RQX A;  4PNG A;  3APO A;  3MSZ A;  5DCG A;  1SL1 B;  2FWF A;  1EV9 A;  4MA9 A;  2EFH A;  2QA1 A;  1T7P B;  2JSZ A;  2YV9 A;  3MAK A;  3ZVJ A;  5CNW A;  1ERT A;  3H8Q A;  3H4K A;  2R37 A;  4MCU A;  4ULX A;  3FKF A;  5J47 A;  3HA9 A;  2DC5 A;  2OBI A;  1BED A;  3RHB A;  4HZ2 A;  4XRD A;  3P7X A;  5J4Y A;  4QMK A;  1PA3 A;  3TRP A;  1PGT A;  3FW2 A;  3LGC A;  4X0X A;  2FWE A;  2DLX A;  3Q18 A;  2A4V A;  3TU3 B;  4OWY A;  2HRK B;  3UL3 A;  2YWI A;  2N5A A;  4K8M A;  5E59 A;  1SKW B;  2P0G A;  3EMP A;  3LYK A;  3D22 A;  4MK3 A;  2Z9S A;  2GS3 A;  3IRA A;  4MNN A;  5JCW A;  3G7J A;  2LQQ A;  3FR9 A;  1QQ2 A;  1GSS A;  3PR8 A;  4GST A;  4YQU A;  2MBT A;  3A2X A;  4GQC A;  5IM9 A;  4JRR A;  5IOX A;  5DAL B;  4I2U A;  2DKH A;  3CTF A;  1LJR A;  4HSC X;  4FIW A;  1YF1 A;  1MTC A;  3RFR C;  6GSY A;  2H1A A;  3O3T A;  2V41 A;  3DXB A;  3Q6O A;  4N0Z A;  4O5R A;  2R0P A;  2R0C A;  2D2Z A;  5IIZ A;  2UV8 G;  4K0G A;  5ECI B;  3M9K A;  3EC3 A;  1SJI A;  3GTU A;  5KN0 A;  3DRN A;  1M2D A;  3ED3 A;  4IW9 A;  2VO4 A;  4TR0 A;  3WYW A;  1PL2 A;  4E8H A;  3ERG A;  1ERV A;  1S3R A;  1EWX A;  3P90 A;  1EOH A;  3ME7 A;  2VIM A;  1SYR A;  1TOF A;  1M9B A;  1HQO A;  3HJO A;  1K3Y A;  2OA7 A;  1OC3 A;  3ME8 A;  1A0R P;  1SD8 A;  3WGD A;  1GSF A;  1A2L A;  3TKS C;  1R5A A;  2VD0 A;  2B5E A;  3TJF A;  2AV4 A;  5CRD A;  3ZRE A;  3A2W A;  4P3Y B;  2WW0 A;  4AKG A;  3C8E A;  4HUA A;  4BWS A;  1Q4J A;  2YNX A;  4GRF A;  3PPU A;  4IS0 A;  1N25 A;  3I43 A;  1BF5 A;  2FLS A;  3HDC A;  4KDY A;  3EMX A;  4MZC A;  3J7Y b;  3TB2 A;  4O32 A;  1ZCP A;  4ISD A;  4YQM A;  4WF5 A;  4CW9 A;  3S9F A;  4LMV A;  1THO A;  5DAK A;  3CMI A;  2H1B A;  1B4Q A;  1MDI A;  4IBP A;  2QKE A;  1K0A A;  2PVQ A;  3APS A;  4AGS A;  3TRQ A;  1T4Z A;  2LKU A;  3C1R A;  5G30 A;  5F06 A;  4HQS A;  4AJ7 A;  4ECJ A;  4KE3 A;  2OE3 A;  3FZ4 A;  6GSX A;  2YPM A;  3KGK A;  2VL9 A;  4MPG A;  2L5O A;  4O5U A;  1K0M A;  4ZIJ A;  2FWG A;  2AHE A;  2IPA A;  4XHM A;  4FYC A;  2WDU A;  5IQY A;  3E3E A;  2H1D A;  3DGQ A;  1PKZ A;  2FD3 A;  4YAP A;  3MIX A;  2B7J A;  3WT2 A;  1ZYN A;  3I9V 2;  3D21 A;  1RW1 A;  3ERW A;  4KCE A;  3FYG A;  1KNG A;  1KBN A;  4GQF A;  2IMK A;  2HRK A;  5LD0 A;  2FNO A;  3EPT A;  4GTU A;  1USB A;  1A23 A;  4TXO B;  1O85 A;  4HEA 2;  2C3N A;  3HZ4 A;  2YJH A;  1SJZ A;  5HR2 A;  1SK0 A;  1AQV A;  4AKH A;  5HFG A;  5ABR A;  4PUF C;  3W6G A;  16GS A;  1H75 A;  3VK9 A;  2GSS A;  3IHQ A;  5DAL A;  1M7T A;  2IMI A;  1DE1 A;  4GDF A;  4MPF A;  1ZMA A;  4MAB A;  1Z3E A;  5GSS A;  4O7H A;  1JZD A;  4NMU A;  2B7K A;  1TU7 A;  3UBK A;  5CAX A;  1V98 A;  1K0O A;  4EDY A;  4TKY A;  4J56 E;  5ECO B;  2DKI A;  3IK9 A;  2IL3 A;  4MJA A;  2I1U A;  2BTO T;  3LYP A;  1I9D A;  4G2E A;  2O87 A;  3LSZ A;  1YQ1 A;  2CAQ A;  1EP8 A;  3DIE A;  4ZB9 A;  4K0N A;  3IOS A;  2EFD A;  2MZC A;  5CRW A;  4ICY A;  4O5Q A;  2R0G A;  1J0F A;  4IQA A;  2VCV A;  1BG5 A;  2C3Q A;  4K2X A;  1N2A A;  3O76 A;  3VUR A;  3TDG A;  1VRS D;  3GYK A;  4Z2R A;  1O8X A;  4MF5 A;  4KCA A;  2PU9 C;  3VLN A;  1EP7 A;  3O6T A;  4IJ3 A;  1PKW A;  3ERF A;  4DEJ A;  3D4T A;  4N30 A;  3MNG A;  1LU4 A;  3LW9 A;  1XOA A;  5CRE A;  2GZP A;  2F8A A;  2N5F A;  4EIQ A;  3Q19 A;  1PD2 1;  5KN3 A;  5JWQ B;  1XW9 A;  2EFE A;  4L0W A;  3LWA A;  4H86 A;  1BX9 A;  1TXX A;  1T4Y A;  4IVF A;  1K3O A;  4ML1 A;  4Q5R A;  2HXK A;  3TGZ A;  2NTO A;  2VM1 A;  4EUY A;  5J3R A;  5ECM B;  1M9A A;  5DVB A;  2EFC A;  1V58 A;  3IPZ A;  2GDR A;  3ISO A;  4OD7 A;  2FCH A;  1K0D A;  1PQN A;  5AGY A;  4A5P A;  4POM A;  5E4W A;  5IMF A;  1TK5 B;  2AAW A;  4NXI A;  4GWR A;  4J2F A;  2H6X A;  2JSY A;  3UBL A;  4ZBA A;  2EIO A;  2RUF A;  2YP6 A;  3CQF A;  4TR1 B;  2P5Q A;  4GLT A;  3FZ9 A;  2O5V A;  2M80 A;  3UMA A;  1F6M C;  1FB0 A;  1GUK A;  5FT3 A;  3F8U A;  2WUL A;  1YEX A;  2RM6 A;  4TRX A;  3VWV A;  4TXO A;  1JHB A;  3ZYW A;  2J23 A;  1JZO A;  5CRH A;  4K9Z A;  4XCS A;  1R26 A;  2AJQ B;  3CXG A;  5JCU A;  3GH6 A;  1ZYP A;  3CWG A;  1YZX A;  9GSS A;  4KUN A;  2VCQ A;  4EKZ A;  5AN1 A;  3FZA A;  4POK A;  2HRA A;  3E9J B;  3FRC A;  3F6D A;  2DSA A;  2H1L A;  2KP2 A;  1HNC A;  1XG8 A;  4ZL8 A;  3QR6 A;  4RI7 A;  2I81 A;  1F3B A;  1PX7 A;  1SVO A;  2YJ7 A;  2LV3 A;  3QDN A;  4LA1 A;  3SBC A;  5KOW A;  4K5S A;  2ON5 A;  5JWR B;  3EVI A;  4XIH A;  4FYU A;  3D5J A;  1A8Y A;  3F3R A;  3TKS E;  1OC9 B;  1BG1 A;  1LBK A;  1ST9 A;  4TXV A;  2F9S A;  2DJJ A;  2GT5 A;  1XFL A;  5EPF A;  4ZL9 A;  1AUC A;  4V2L A;  1V57 A;  2IME A;  1TTZ A;  3HY2 A;  3KH7 A;  4Z7X A;  2RLI A;  4JBB A;  1FW1 A;  2WZS A;  2WRT A;  2K8S A;  5DBQ A;  2YZH A;  3DEX A;  5F0G A;  3TRX A;  1S3A A;  3HYP A;  2WZ9 A;  4K1F A;  1V40 A;  4YQV A;  1GH2 A;  2YV7 A;  2H66 A;  1XPV A;  3KJY A;  1CQG A;  1PMT A;  2G0F A;  4ZBB A;  3RAZ A;  4Q5Q A;  3BCI A;  1HD2 A;  3BCK A;  4V2N A;  2VKZ G;  2VCX A;  3FEU A;  1S4B P;  1ABA A;  4AJ8 A;  1UA5 A;  2V32 A;  4MH2 A;  2MMA A;  3GRX A;  4Q5F A;  1MDJ A;  4QQ7 A;  10GS A;  3KIJ A;  4FQU A;  1VF1 A;  5J4U A;  4MLY A;  3HCZ A;  2C0E A;  1T1V A;  4X4J A;  4G9H A;  1GRX A;  4I2T A;  4F03 A;  3H79 A;  3QMX A;  2LJK A;  4OCF A;  1U3A A;  4YAV A;  1MEK A;  2HYX A;  2H30 A;  5J40 A;  4G01 A;  1GLQ A;  2TRC P;  2JL4 A;  1VF3 A;  1PFO A;  4IEL A;  5ECS A;  4K7O A;  1PSQ A;  3QPM A;  4I6X A;  1FB6 A;  4TR1 A;  2O3E A;  3QCP A;  4OCE A;  2NVL A;  2OT3 A;  1XWC A;  2VCZ A;  1KTE A;  3H93 A;  4ZBD A;  4JE1 A;  4KSM A;  4ILF A;  3HVX A;  2LNS A;  3VFI A;  2FUG 2;  2XPE A;  5A4V A;  4F0C A;  3AY8 A;  3QAG A;  1EZK A;  5B8B A;  3KM6 A;  4G10 A;  1NSW A;  5D9X A;  1FOH A;  4GSS A;  3GL3 A;  4EDZ A;  5CYY A;  1PRX A;  4TW5 A;  4BVX B;  2ES7 A;  2JZS A;  3L9S A;  3CSJ A;  1RK4 A;  1E2Y A;  2GQM A;  3IAS 2;  4N0V A;  3KD0 A;  5FWG A;  1RQM A;  5DCH A;  2VAF A;  3LG6 A;  5AIS A;  2H71 A;  4TVE A;  4XTS A;  3M8N A;  3WD6 A;  3LXT A;  2KHP A;  2LS5 A;  3L4N A;  1WRY A;  4V1A p;  3M3M A;  1OC9 A;  4ZL7 A;  4KH7 A;  1X9S B;  5AIV A;  5A34 B;  5G1L A;  1A24 A;  4I97 A;  1YJ6 A;  4BWQ A;  3ZLP A;  1K0B A;  2C0D A;  2CV4 A;  3UJ1 A;  3QFB C;  1U88 A;  4OFM A;  1MD3 A;  2L6C A;  4V1A g;  1OKT A;  2MYG A;  2DJ3 A;  3VPT A;  3GIX A;  4YKF A;  3IR4 A;  2GZZ A;  2RII A;  3WT1 A;  5IO0 A;  4E8E A;  2L6D A;  3I6A A;  4LL4 B;  2OJL A;  5IPH A;  1TK0 B;  4MZW A;  2AB6 A;  1WJK A;  1M0U A;  1EOG A;  3HJP A;  3MYD A;  3CRT A;  3RGB C;  5IMV A;  3UVH A;  1BJX A;  1QFN A;  3F4S A;  4V2M A;  3QAV A;  2WW2 A;  4HJM A;  5BMU B;  2JZR A;  3VI7 A;  1GLP A;  3F4T A;  2CVD A;  4K5R A;  4MJC A;  1IYI A;  1A2M A;  3TKQ A;  5G1K A;  1SEN A;  3EE2 A;  4OFN A;  2VLV A;  3K8N A;  4EC0 A;  1A8L A;  3G7I A;  2HSN B;  2H72 A;  2I3Y A;  4D73 B;  3GFK A;  4XS6 A;  4QL9 A;  5INY A;  2KOK A;  5FHI A;  2J9H A;  2H8L A;  1PN9 A;  1O73 A;  4XRA A;  5IPG A;  5A4W A;  3A2V A;  2GSR A;  1XWG A;  4G19 A;  4AF2 A;  3VPQ A;  3FK8 A;  1EGO A;  1M3J A;  1SVL A;  2FWH A;  5CO3 A;  5J9C A;  2C3T A;  4PXO A;  2HSH A;  2HZF A;  3GHA A;  1WPI A;  1GUM A;  1URM A;  3TKP A;  4BL7 B;  4W66 A;  3R2Q A;  2PVO C;  1EGR A;  1EEM A;  3CSI A;  5B7C A;  3TJJ A;  2VLU A;  4BVX A;  2OE1 A;  5KN1 A;  2CX3 A;  7GSS A;  4YKG A;  5IMC A;  3UOM A;  2PGT A;  5J9B A;  1TKD B;  4ECB A;  3FMW A;  1Z7R A;  3ZIJ A;  1AW9 A;  4MDC A;  4PQI A;  2IIY A;  1EEJ A;  2B5Y A;  2O36 A;  1X5E A;  3PIN A;  3U5R E;  2PER A;  2K6V A;  5ECP B;  4KW6 A;  4K7N A;  2CAI A;  3CRU A;  1OKD A;  3ZTL A;  3G7Y A;  4MP4 A;  5IO2 A;  4DSQ A;  2LRN A;  1AAZ A;  4PGT A;  4I5Q A;  5G5F A;  5A34 A;  3TOU A;  5HR1 A;  2NDO A;  1OAZ A;  1YVL A;  3N9J A;  4CY6 A;  5ECR B;  4ZB6 A;  3HVS A;  5KN2 A;  2GVP A;  19GS A;  4YH2 A;  1ACV A;  2XHF A;  3F0I A;  4POB A;  4DVC A;  5A5H B;  3M1G A;  2CX4 A;  2XBI A;  4Z2T A;  1X9W B;  1JZR A;  3KH9 A;  2M46 A;  1G7O A;  1JLW A;  4HU9 A;  6GST A;  5ECL B;  2PWJ A;  5DJL A;  3TKR A;  1YKC A;  1WP0 A;  2B3S A;  4POL A;  3LOR A;  2LTK A;  1OVN A;  4NHZ A;  1GUL A;  4ECI A;  4USS A;  3SWL A;  4JED A;  3N5O A;  1B9Y C;  6GSS A;  4N10 A;  5D8I A;  2VCW A;  4K2D A;  4HDE A;  4AI6 A;  1ZGN A;  5DQS A;  3VWX A;  2OAC A;  1A2J A;  3M0F A;  5BMU A;  1NM3 A;  1C72 A;  5DJM A;  1J9B A;  2FA4 A;  1GNE A;  2YWO A;  5LCZ A;  1TK8 B;  4MMM A;  4F0B A;  3US3 A;  1GNW A;  4KGI A;  2CA8 A;  1ZZY A;  2DIY A;  4OO5 A;  1GTA A;  5D9T A;  4ID0 A;  1WE0 A;  4IKH A;  2HSN A;  5HFK A;  4D73 A;  2REM A;  4GXZ A;  1R7H A;  5A4U A;  1UVZ A;  4PQ1 A;  1SL0 B;  1WMJ A;  5CP1 A;  4EXJ A;  4JU5 A;  1GSY A;  1CQH A;  2YOI A;  1XW6 A;  1JLV A;  1T00 A;  4AJ6 A;  1I1I P;  1X0R A;  4IP1 A;  2CT6 A;  4Z2U A;  4WET A;  1QK8 A;  3ZML A;  1U87 A;  2WCI A;  2IJY A;  1XZO A;  1O7U A;  1OE8 A;  1WOU A;  2HFD A;  5G2Z A;  1AXD A;  4BL7 A;  4XS4 B;  1V9W A;  4HI7 A;  5ELA A;  5EVO A;  2I9H A;  4MJE A;  2LST A;  2GLR A;  5COH A;  1K0N A;  1VF2 A;  2LJR A;  3GUS A;  1ERU A;  2A4H A;  1X5C A;  3G9B A;  1W4V A;  1XXU A;  3D6I A;  3UVT A;  5IMA A;  3GV1 A;  5GAP D;  2IMD A;  3L9U A;  4KB3 A;  1TXU A;  4ZXG A;  4F2I A;  5KOX A;  2H19 A;  2V1M A;  5H5S A;  4IJI A;  5A1N B;  3D4M A;  1R4W A;  1SK2 A;  2OAD A;  2VL2 A;  4ZB7 A;  4NV2 A;  3TOT A;  3EU3 A;  3KEB A;  1QMV A;  1TI1 A;  2B6M A;  5CRG A;  2VL3 A;  3GN3 A;  4GSN A;  1KEB A;  3KZQ A;  4DSS B;  3NZN A;  5D9W A;  3ZMK A;  5AIX A;  2K9F A;  2A2R A;  2HSM B;  2FA8 A;  5D96 A;  3DVX A;  1Q98 A;  1Z6N A;  5GZZ B;  1XIY A;  4GF0 A;  2H6Y A;  2HE3 A;  4BA7 A;  2EIQ A;  3OR5 A;  3BBY A;  5GAN D;  5A5H A;  1IYH A;  3KTB A;  1YF0 A;  1HNA A;  2H0I A;  3D0Z A;  1J08 A;  2CQ9 A;  3IAM 2;  1TRW A;  2L4C A;  3A3T A;  3ZIV A;  5JCG A;  4AKI A;  3C7M A;  1GUH A;  1TDI A;  3HVN A;  2QGV A;  1ON4 A;  2LNT A;  4HZ4 A;  4MH3 A;  4K6X A;  4MJB A;  2LUS A;  3EIN A;  4NPB A;  22GS A;  4N3Z A;  3GKM A;  3LQ7 A;  2WB9 A;  3F3Q A;  3HMJ G;  3KXO A;  1FO5 A;  2WVY A;  2QC7 A;  2GT6 A;  3KTL A;  1B8X A;  4QL7 A;  1DUG A;  4E68 A;  3VWW A;  4Q5N A;  1FVJ A;  2YWM A;  3F63 A;  3FZ5 A;  2E7P A;  1AQW A;  2YWN A;  2K8V A;  3C1S A;  4KND A;  2HRF A;  12GS A;  2PBJ A;  6GSV A;  2H75 A;  2G2Q A;  3WGE A;  2DIZ A;  1XVW A;  3KCM A;  2BJX A;  1O8W A;  1O6J A;  1E6B A;  5D93 A;  2ALB A;  3HJM A;  3IA1 A;  3IV4 A;  2X64 A;  3DD3 A;  3PGT A;  2TRX A;  2DJ1 A;  4KDU A;  3FY7 A;  3GKK A;  4PX1 A;  5J41 A;  4LL1 B;  3VWU A;  2H73 A;  1FHE A;  3M9J A;  17GS A;  5ELG A;  4HU7 A;  2XC2 A;  1NHY A;  2VLT A;  4PQH A;  4XS4 A;  1AIU A;  4WXT A;  3ZFL A;  2EC4 A;  1SL2 B;  20GS A;  2A2P A;  4KDX A;  3KMN A;  5F07 A;  3LFL A;  2UZ8 A;  4ZB8 A;  1ZOF A;  3IHG A;  1A0F A;  1F3A A;  1F9M A;  1PX6 A;  1XOB A;  5D73 A;  4BVY B;  1YKA A;  3GKN A;  5A1N A;  1FG4 A;  3WGX A;  1ML6 A;  4G0L A;  2WW1 A;  1GSQ A;  2YZU A;  2I4A A;  1ILO A;  2GZY A;  5HR3 A;  1G6W A;  2F51 A;  1XW5 A;  4O92 A;  2OE0 A;  4DSS A;  1GP1 A;  1Y1U A;  2P31 A;  1VGL A;  3A5W A;  3EYT A;  3FR3 A;  2B1L A;  2HSM A;  1X9M B;  2HZE B;  4KX4 A;  4CDO A;  2GSQ A;  3EU4 A;  1TRV A;  1YEW C;  2X8H A;  3ZRD A;  1ZYQ B;  1XBS A;  2C1Y A;  1S3D A;  1MD4 A;  2H1G A;  1GTI A;  1XCC A;  3C73 A;  2C0F A;  4WKW A;  2ON7 A;  5HFI A;  1FOV A;  3NOF A;  2JU5 A;  4EF0 A;  2HQT A;  2IWT A;  1SJ6 A;  3ZL5 A;  1O81 A;  2L5L A;  2YN1 A;  4HQZ A;  3BOA A;  3APQ A;  14GS A;  4FH8 A;  3CBU A;  5C04 A;  2AYT A;  2LJA A;  1UN2 A;  1S3C A;  4FXY P;  5ID2 B;  3DKS A;  13GS A;  3GSS A;  2C8U A;  4ECC A;  1N8J A;  2X8C A;  2VUP A;  2JAD A;  2E0Q A;  2CVB A;  4PNF A;  3UIW A;  2C4J A;  1DE2 A;  5GST A;  1B4P A;  1SKR B;  4KA0 A;  2MMO A;  4WBJ A;  3BD2 A;  3RBT A;  4L5L A;  2IFQ A;  4KAE A;  2R2J A;  3HHV A;  4G0K A;  2R6K A;  4IGJ A;  2VOC A;  3LXZ A;  2LEG A;  4AKX B;  1OC8 A;  3NIV A;  4EE0 A;  3ZIT A;  3IC4 A;  3W8J A;  3RPN A;  4WEY A;  2X4A A;  2PPT A;  3Q74 A;  4IHU A;  3IBH A;  1THX A;  4G0I A;  4PI2 C;  2ZUP A;  2VM2 A;  1SKS B;  3UEM A;  3HZ8 A;  1TI3 A;  1TRU A;  3CYN A;  1SVM A;  3FHK A;  2EIR A;  5ECN B;  2H6Z A;  2HSY A;  3F4R A;  4NHW A;  4WR5 A;  1NW2 A;  4X1U A;  1TW9 A;  5J4V A;  2O85 A;  1I5G A;  4ZIL A; 
#chains in the Genus database with same CATH homology
 2N5B A;  2RM5 A;  4EVM A;  4PUR A;  2GGT A;  1K0C A;  1YY7 A;  3UAR A;  3PH9 A;  4JR6 A;  2JAC A;  3GMF A;  2HI7 A;  2HRN A;  4NWY A;  3DYR A;  4BVY A;  1MDK A;  2C80 A;  1Z6M A;  1SK1 A;  3DML A;  4L5O A;  2RUE A;  2K18 A;  2DBC A;  2TIR A;  11GS A;  4LLR A;  5ECH B;  1SD9 A;  1Y6E A;  4F9Z A;  1BYE A;  3CTG A;  4EIP A;  1OYJ A;  1K3L A;  1U6T A;  2VL2 C;  3EUR A;  1XWA A;  2B1K A;  3E0U A;  4L0U A;  2L57 A;  2YCD A;  2HZE A;  1WWJ A;  2GQK A;  6GSU A;  2PN8 A;  4MF7 A;  2OBK A;  3GKX A;  3CSH A;  1DBY A;  2V6O A;  1T3B A;  1YEP A;  2XPD A;  4WBR D;  1B9X C;  1W89 A;  2MBS A;  3TJK A;  5B8A A;  1TJD A;  3HVV A;  3W8S A;  3L0H A;  2WGR A;  2DMM A;  2VD1 A;  1ZYE A;  5KEJ A;  1SYX A;  2KLX A;  4J57 E;  4HOJ A;  3IXR A;  1R5P A;  4L8E A;  1PN0 A;  4I8B A;  2HLS A;  3QAW A;  4N11 A;  2X8G A;  4IP6 A;  4HJ2 A;  5J5N A;  2V6K A;  2WS2 A;  5ID2 A;  2R5G A;  4MF6 A;  1GWC A;  2H01 A;  6GSW A;  2O7K A;  1WIK A;  5H5Q A;  2X99 A;  3DWV A;  1YDK A;  3KMO A;  3TUE A;  1T8E B;  2BMX A;  3C71 A;  1Z9H A;  5C00 A;  3JCM L;  4DSR A;  5D9V A;  1G7E A;  3GX0 A;  5IMD A;  2DJ2 A;  4EL1 A;  3LJR A;  3GNJ A;  2R4V A;  2C0G A;  1FVK A;  2M72 A;  1XWB A;  5DQY A;  2XBQ A;  2GTU A;  3U6V A;  2R3X A;  4IN0 A;  2GST A;  2NPB A;  3QFA C;  4BPY A;  4RQR A;  3I69 A;  1QUW A;  3IDV A;  5ECK B;  4WR4 A;  1JZW A;  5F8B A;  2YAN A;  2IMF A;  1GL8 A;  4JZQ A;  1HNB A;  1NHO A;  4TN8 A;  5IMZ A;  4NV5 A;  3TKS A;  1GSE A;  4PTS A;  1GSU A;  3HKR A;  2MMZ A;  2X49 A;  1G0T A;  3R3E A;  1M2A A;  4HS1 A;  3TJG A;  4NAX A;  2F8F A;  1B48 A;  4CHS A;  5HR0 A;  3RPP A;  2JZT A;  2CVK A;  5B6M A;  3IE3 A;  4PUA A;  2H76 A;  3ZFB A;  4IQ1 A;  3KP9 A;  2H70 A;  1GTU A;  1FAA A;  2DJ0 A;  4OO4 A;  2WFC A;  1XVQ A;  1GSD A;  2DML A;  2QSI A;  4ML6 A;  4RUV A;  4TR3 A;  18GS A;  2B5X A;  4EO3 A;  2HT9 A;  3RDW A;  2LRC A;  1ERW A;  4FYB A;  1BAY A;  3A5I A;  2H0H A;  1SU9 A;  5DDL A;  5L71 A;  2PUK C;  3GUR A;  5EL8 A;  4JR4 A;  1QGV A;  2IN3 A;  2H74 A;  2ZNM A;  2AUV A;  3IC8 A;  3TJB A;  2V2G A;  1VF4 A;  2HNL A;  3QOU A;  2H0G A;  3ZVJ D;  3ZZX A;  3P8W A;  1ZL9 A;  5H5R A;  1DSB A;  3L78 A;  1AQX A;  2MMN A;  5JWO B;  4KF9 A;  1BQ7 A;  4XS1 A;  4MZB A;  5BRT A;  2E2M A;  4OFT A;  5ECQ B;  3IK7 A;  3GL5 A;  1TU8 A;  2P5R A;  1Z7P A;  1PL1 A;  1XWK A;  1F37 A;  2L59 A;  3DVW A;  1QXH A;  4WF4 A;  1EV4 A;  1U3I A;  1F2E A;  1M2B A;  3V1W A;  2O89 A;  3FR6 A;  3VI5 A;  2L4Q A;  2LQO A;  2OKA A;  3P2A A;  2WJU A;  3RHC A;  2VCT A;  2E2G A;  4LMW A;  3J7Y k;  2KUC A;  4CY8 A;  1V2A A;  1UC7 A;  4KSO A;  4ACS A;  5HQP A;  5IOW A;  4GCI A;  3LEF A;  4TOP A;  3HXS A;  3GA4 A;  2FY6 A;  5G31 A;  3F6F A;  5ENU A;  4K7I A;  2O8V B;  3GTU B;  3UAP A;  5G5E A;  2FHE A;  2LRT A;  5A5K A;  2IFQ B;  1Y25 A;  3L9V A;  3KP8 A;  3QD9 A;  3TCO A;  1G6Y A;  5EY6 A;  4RI6 A;  1HYU A;  4OMV A;  4X43 A;  1M99 A;  5B6N A;  2CZ3 A;  2KP1 A;  2A2S A;  1TRS A;  3F9U A;  3HD5 A;  2F3M A;  3H1N A;  2PMT A;  3GH9 A;  1AC1 A;  3MWH A;  4F82 A;  3MDK A;  2FGX A;  1H4O A;  2ZCT A;  2GQL A;  5F05 A;  2CZ2 A;  2DJK A;  4TR4 A;  3BJ5 A;  2QA2 A;  3GST A;  1X5D A;  1Z5Y E;  1OE7 A;  3EWL A;  8GSS A;  5LNK e;  1JFU A;  3GX8 A;  2NBS A;  5DAK B;  1TP9 A;  1GTB A;  4FO5 A;  4RQX A;  4PNG A;  3APO A;  3MSZ A;  5DCG A;  1SL1 B;  2FWF A;  1EV9 A;  4MA9 A;  2EFH A;  2QA1 A;  1T7P B;  2JSZ A;  2YV9 A;  3MAK A;  3ZVJ A;  5CNW A;  1ERT A;  3H8Q A;  3H4K A;  2R37 A;  4MCU A;  4ULX A;  3FKF A;  5J47 A;  3HA9 A;  2DC5 A;  2OBI A;  1BED A;  3RHB A;  4HZ2 A;  4XRD A;  3P7X A;  5J4Y A;  4QMK A;  1PA3 A;  3TRP A;  1PGT A;  3FW2 A;  3LGC A;  4X0X A;  2FWE A;  2DLX A;  3Q18 A;  2A4V A;  3TU3 B;  4OWY A;  2HRK B;  3UL3 A;  2YWI A;  2N5A A;  4K8M A;  5E59 A;  1SKW B;  2P0G A;  3EMP A;  3LYK A;  3D22 A;  4MK3 A;  2Z9S A;  2GS3 A;  3IRA A;  4MNN A;  5JCW A;  3G7J A;  2LQQ A;  3FR9 A;  1QQ2 A;  1GSS A;  3PR8 A;  4GST A;  4YQU A;  2MBT A;  3A2X A;  4GQC A;  5IM9 A;  4JRR A;  5IOX A;  5DAL B;  4I2U A;  2DKH A;  3CTF A;  1LJR A;  4FIW A;  1YF1 A;  1MTC A;  2V41 A;  6GSY A;  2H1A A;  3O3T A;  3DXB A;  3Q6O A;  4N0Z A;  4O5R A;  2R0P A;  2R0C A;  2D2Z A;  5IIZ A;  2UV8 G;  4K0G A;  5ECI B;  3M9K A;  3EC3 A;  1SJI A;  3GTU A;  5KN0 A;  3DRN A;  1M2D A;  3ED3 A;  4IW9 A;  2VO4 A;  4TR0 A;  3WYW A;  1PL2 A;  4E8H A;  3ERG A;  1ERV A;  1EWX A;  3P90 A;  1EOH A;  3ME7 A;  2VIM A;  1SYR A;  1TOF A;  1M9B A;  1HQO A;  3HJO A;  1K3Y A;  2OA7 A;  1OC3 A;  3ME8 A;  1A0R P;  1SD8 A;  3WGD A;  1GSF A;  1A2L A;  3TKS C;  1R5A A;  2VD0 A;  2B5E A;  3TJF A;  2AV4 A;  5CRD A;  3ZRE A;  3A2W A;  4P3Y B;  4AKG A;  3C8E A;  4HUA A;  4BWS A;  1Q4J A;  2YNX A;  4GRF A;  3PPU A;  4IS0 A;  1N25 A;  3I43 A;  1BF5 A;  2FLS A;  3HDC A;  4KDY A;  3EMX A;  4MZC A;  3J7Y b;  3TB2 A;  4O32 A;  1ZCP A;  4ISD A;  4YQM A;  4WF5 A;  4CW9 A;  3S9F A;  4LMV A;  1THO A;  5DAK A;  3CMI A;  2H1B A;  1B4Q A;  1MDI A;  4IBP A;  2QKE A;  1K0A A;  2PVQ A;  3APS A;  4AGS A;  3TRQ A;  1T4Z A;  2LKU A;  3C1R A;  5G30 A;  5F06 A;  4HQS A;  4AJ7 A;  4ECJ A;  4KE3 A;  2OE3 A;  3FZ4 A;  6GSX A;  2YPM A;  3KGK A;  2VL9 A;  4MPG A;  2L5O A;  4O5U A;  1K0M A;  4ZIJ A;  2FWG A;  2AHE A;  2IPA A;  4XHM A;  4FYC A;  2WDU A;  5IQY A;  3E3E A;  2H1D A;  3DGQ A;  1PKZ A;  2FD3 A;  4YAP A;  3MIX A;  2B7J A;  3WT2 A;  1ZYN A;  3I9V 2;  3D21 A;  1RW1 A;  3ERW A;  4KCE A;  3FYG A;  1KNG A;  1KBN A;  4GQF A;  2IMK A;  2HRK A;  5LD0 A;  2FNO A;  3EPT A;  4GTU A;  1USB A;  1A23 A;  4TXO B;  1O85 A;  4HEA 2;  2C3N A;  3HZ4 A;  2YJH A;  1SJZ A;  5HR2 A;  1SK0 A;  1AQV A;  4AKH A;  5HFG A;  5ABR A;  4PUF C;  3W6G A;  16GS A;  1H75 A;  3VK9 A;  2GSS A;  3IHQ A;  5DAL A;  1M7T A;  2IMI A;  1DE1 A;  4GDF A;  4MPF A;  1ZMA A;  4MAB A;  1Z3E A;  5GSS A;  4O7H A;  1JZD A;  4NMU A;  2B7K A;  1TU7 A;  3UBK A;  5CAX A;  1V98 A;  1K0O A;  4EDY A;  4TKY A;  4J56 E;  5ECO B;  2DKI A;  3IK9 A;  2IL3 A;  4MJA A;  2I1U A;  2BTO T;  3LYP A;  1I9D A;  4G2E A;  2O87 A;  3LSZ A;  1YQ1 A;  2CAQ A;  1EP8 A;  3DIE A;  4ZB9 A;  4K0N A;  3IOS A;  2EFD A;  2MZC A;  5CRW A;  4ICY A;  4O5Q A;  2R0G A;  1J0F A;  4IQA A;  2VCV A;  1BG5 A;  2C3Q A;  4K2X A;  1N2A A;  3O76 A;  3VUR A;  3TDG A;  1VRS D;  3GYK A;  4Z2R A;  1O8X A;  4MF5 A;  4KCA A;  2PU9 C;  3VLN A;  1EP7 A;  3O6T A;  4IJ3 A;  1PKW A;  3ERF A;  4DEJ A;  3D4T A;  4N30 A;  3MNG A;  1LU4 A;  3LW9 A;  1XOA A;  5CRE A;  2GZP A;  2F8A A;  2N5F A;  4EIQ A;  3Q19 A;  1PD2 1;  5KN3 A;  5JWQ B;  1XW9 A;  2EFE A;  4L0W A;  3LWA A;  4H86 A;  1BX9 A;  1TXX A;  1T4Y A;  4IVF A;  1K3O A;  4ML1 A;  4Q5R A;  2HXK A;  3TGZ A;  2NTO A;  2VM1 A;  4EUY A;  5J3R A;  5ECM B;  1M9A A;  5DVB A;  2EFC A;  1V58 A;  3IPZ A;  2GDR A;  3ISO A;  4OD7 A;  2FCH A;  1K0D A;  1PQN A;  5AGY A;  4A5P A;  4POM A;  5E4W A;  5IMF A;  1TK5 B;  2AAW A;  4NXI A;  4GWR A;  4J2F A;  2H6X A;  2JSY A;  3UBL A;  4ZBA A;  2EIO A;  2RUF A;  2YP6 A;  4TR1 B;  2P5Q A;  4GLT A;  3FZ9 A;  2O5V A;  2M80 A;  3UMA A;  1F6M C;  1FB0 A;  1GUK A;  5FT3 A;  3F8U A;  2WUL A;  1YEX A;  2RM6 A;  4TRX A;  3VWV A;  4TXO A;  1JHB A;  3ZYW A;  2J23 A;  1JZO A;  5CRH A;  4K9Z A;  4XCS A;  1R26 A;  2AJQ B;  3CXG A;  5JCU A;  3GH6 A;  1ZYP A;  3CWG A;  1YZX A;  9GSS A;  4KUN A;  2VCQ A;  4EKZ A;  5AN1 A;  3FZA A;  4POK A;  2HRA A;  3E9J B;  3FRC A;  3F6D A;  2DSA A;  2H1L A;  2KP2 A;  1HNC A;  4ZL8 A;  3QR6 A;  4RI7 A;  2I81 A;  1F3B A;  1PX7 A;  1SVO A;  2YJ7 A;  2LV3 A;  3QDN A;  4LA1 A;  3SBC A;  5KOW A;  4K5S A;  2ON5 A;  5JWR B;  3EVI A;  4XIH A;  4FYU A;  3D5J A;  1A8Y A;  3F3R A;  3TKS E;  1OC9 B;  1BG1 A;  1LBK A;  1ST9 A;  4TXV A;  2F9S A;  2DJJ A;  2GT5 A;  1XFL A;  5EPF A;  4ZL9 A;  1AUC A;  4V2L A;  1V57 A;  2IME A;  1TTZ A;  3HY2 A;  3KH7 A;  4Z7X A;  2RLI A;  4JBB A;  1FW1 A;  2K8S A;  2WRT A;  5DBQ A;  2YZH A;  3DEX A;  5F0G A;  3TRX A;  1S3A A;  3HYP A;  2WZ9 A;  4K1F A;  1V40 A;  4YQV A;  1GH2 A;  2YV7 A;  2H66 A;  1XPV A;  3KJY A;  1CQG A;  1PMT A;  2G0F A;  4ZBB A;  3RAZ A;  4Q5Q A;  3BCI A;  1HD2 A;  3BCK A;  4V2N A;  2VKZ G;  2VCX A;  3FEU A;  1ABA A;  4AJ8 A;  1UA5 A;  2V32 A;  4MH2 A;  2MMA A;  3GRX A;  4Q5F A;  1MDJ A;  4QQ7 A;  10GS A;  3KIJ A;  4FQU A;  1VF1 A;  5J4U A;  4MLY A;  3HCZ A;  2C0E A;  1T1V A;  4X4J A;  4G9H A;  1GRX A;  4I2T A;  4F03 A;  3H79 A;  3QMX A;  2LJK A;  4OCF A;  1U3A A;  4YAV A;  1MEK A;  2HYX A;  2H30 A;  5J40 A;  4G01 A;  1GLQ A;  2TRC P;  2JL4 A;  1VF3 A;  4IEL A;  5ECS A;  4K7O A;  1PSQ A;  3QPM A;  4I6X A;  1FB6 A;  4TR1 A;  3QCP A;  4OCE A;  2NVL A;  2OT3 A;  1XWC A;  2VCZ A;  1KTE A;  3H93 A;  4ZBD A;  4JE1 A;  4KSM A;  4ILF A;  3HVX A;  2LNS A;  3VFI A;  2FUG 2;  2XPE A;  5A4V A;  4F0C A;  3AY8 A;  3QAG A;  1EZK A;  5B8B A;  3KM6 A;  4G10 A;  1NSW A;  5D9X A;  1FOH A;  4GSS A;  3GL3 A;  4EDZ A;  5CYY A;  1PRX A;  4TW5 A;  4BVX B;  2ES7 A;  2JZS A;  3L9S A;  3CSJ A;  1RK4 A;  1E2Y A;  2GQM A;  3IAS 2;  4N0V A;  3KD0 A;  5FWG A;  1RQM A;  5DCH A;  2VAF A;  3LG6 A;  5AIS A;  2H71 A;  4TVE A;  4XTS A;  3M8N A;  3WD6 A;  3LXT A;  2KHP A;  2LS5 A;  3L4N A;  1WRY A;  4V1A p;  3M3M A;  1OC9 A;  4ZL7 A;  4KH7 A;  1X9S B;  5AIV A;  5A34 B;  5G1L A;  1A24 A;  4I97 A;  1YJ6 A;  4BWQ A;  3ZLP A;  1K0B A;  2C0D A;  2CV4 A;  3UJ1 A;  3QFB C;  1U88 A;  4OFM A;  1MD3 A;  2L6C A;  4V1A g;  1OKT A;  2MYG A;  2DJ3 A;  3VPT A;  3GIX A;  4YKF A;  3IR4 A;  2GZZ A;  2RII A;  3WT1 A;  5IO0 A;  4E8E A;  2L6D A;  3I6A A;  4LL4 B;  2OJL A;  5IPH A;  1TK0 B;  4MZW A;  2AB6 A;  1WJK A;  1M0U A;  1EOG A;  3HJP A;  3MYD A;  3CRT A;  5IMV A;  3UVH A;  1BJX A;  1QFN A;  3F4S A;  4V2M A;  3QAV A;  4HJM A;  5BMU B;  2JZR A;  3VI7 A;  1GLP A;  3F4T A;  2CVD A;  4K5R A;  4MJC A;  1IYI A;  1A2M A;  3TKQ A;  5G1K A;  1SEN A;  3EE2 A;  4OFN A;  2VLV A;  3K8N A;  4EC0 A;  1A8L A;  3G7I A;  2HSN B;  2H72 A;  2I3Y A;  4D73 B;  3GFK A;  4XS6 A;  4QL9 A;  5INY A;  2KOK A;  5FHI A;  2J9H A;  2H8L A;  1PN9 A;  1O73 A;  4XRA A;  5IPG A;  5A4W A;  3A2V A;  2GSR A;  1XWG A;  4G19 A;  4AF2 A;  3VPQ A;  3FK8 A;  1EGO A;  1SVL A;  2FWH A;  5CO3 A;  5J9C A;  2C3T A;  4PXO A;  2HSH A;  2HZF A;  3GHA A;  1WPI A;  1GUM A;  1URM A;  3TKP A;  4BL7 B;  4W66 A;  3R2Q A;  2PVO C;  1EGR A;  1EEM A;  3CSI A;  5B7C A;  3TJJ A;  2VLU A;  4BVX A;  2OE1 A;  5KN1 A;  2CX3 A;  7GSS A;  4YKG A;  5IMC A;  3UOM A;  2PGT A;  5J9B A;  1TKD B;  4ECB A;  3FMW A;  1Z7R A;  3ZIJ A;  1AW9 A;  4MDC A;  4PQI A;  2IIY A;  1EEJ A;  2B5Y A;  1X5E A;  3PIN A;  3U5R E;  2PER A;  2K6V A;  5ECP B;  4KW6 A;  4K7N A;  2CAI A;  3CRU A;  1OKD A;  3ZTL A;  3G7Y A;  4MP4 A;  5IO2 A;  4DSQ A;  2LRN A;  1AAZ A;  4PGT A;  4I5Q A;  5G5F A;  5A34 A;  3TOU A;  5HR1 A;  2NDO A;  1OAZ A;  1YVL A;  3N9J A;  4CY6 A;  5ECR B;  4ZB6 A;  3HVS A;  5KN2 A;  2GVP A;  19GS A;  4YH2 A;  1ACV A;  2XHF A;  3F0I A;  4POB A;  4DVC A;  5A5H B;  3M1G A;  2CX4 A;  2XBI A;  4Z2T A;  1X9W B;  1JZR A;  3KH9 A;  2M46 A;  1G7O A;  1JLW A;  4HU9 A;  6GST A;  5ECL B;  2PWJ A;  5DJL A;  3TKR A;  1YKC A;  1WP0 A;  2B3S A;  4POL A;  3LOR A;  2LTK A;  1OVN A;  4NHZ A;  1GUL A;  4ECI A;  4USS A;  3SWL A;  4JED A;  3N5O A;  1B9Y C;  6GSS A;  4N10 A;  5D8I A;  2VCW A;  4K2D A;  4HDE A;  4AI6 A;  1ZGN A;  5DQS A;  3VWX A;  2OAC A;  1A2J A;  3M0F A;  5BMU A;  1NM3 A;  1C72 A;  5DJM A;  1J9B A;  2FA4 A;  1GNE A;  2YWO A;  5LCZ A;  1TK8 B;  4MMM A;  4F0B A;  3US3 A;  1GNW A;  4KGI A;  2CA8 A;  1ZZY A;  2DIY A;  4OO5 A;  1GTA A;  5D9T A;  4ID0 A;  1WE0 A;  4IKH A;  2HSN A;  5HFK A;  4D73 A;  2REM A;  4GXZ A;  1R7H A;  5A4U A;  1UVZ A;  4PQ1 A;  1SL0 B;  1WMJ A;  5CP1 A;  4EXJ A;  4JU5 A;  1GSY A;  1CQH A;  2YOI A;  1XW6 A;  1JLV A;  1T00 A;  4AJ6 A;  1X0R A;  4IP1 A;  2CT6 A;  4Z2U A;  4WET A;  1QK8 A;  3ZML A;  1U87 A;  2WCI A;  2IJY A;  1XZO A;  1O7U A;  1OE8 A;  1WOU A;  2HFD A;  5G2Z A;  1AXD A;  4BL7 A;  4XS4 B;  1V9W A;  4HI7 A;  5ELA A;  5EVO A;  2I9H A;  4MJE A;  2LST A;  2GLR A;  5COH A;  1K0N A;  1VF2 A;  2LJR A;  3GUS A;  1ERU A;  2A4H A;  1X5C A;  3G9B A;  1W4V A;  1XXU A;  3D6I A;  3UVT A;  5IMA A;  3GV1 A;  5GAP D;  2IMD A;  3L9U A;  4KB3 A;  1TXU A;  4ZXG A;  4F2I A;  5KOX A;  2H19 A;  2V1M A;  5H5S A;  4IJI A;  5A1N B;  3D4M A;  1R4W A;  1SK2 A;  2OAD A;  2VL2 A;  4ZB7 A;  4NV2 A;  3TOT A;  3EU3 A;  3KEB A;  1QMV A;  1TI1 A;  2B6M A;  5CRG A;  2VL3 A;  3GN3 A;  4GSN A;  1KEB A;  3KZQ A;  4DSS B;  3NZN A;  5D9W A;  3ZMK A;  5AIX A;  2K9F A;  2A2R A;  2HSM B;  2FA8 A;  5D96 A;  3DVX A;  1Q98 A;  1Z6N A;  5GZZ B;  1XIY A;  4GF0 A;  2H6Y A;  2HE3 A;  4BA7 A;  2EIQ A;  3OR5 A;  3BBY A;  5GAN D;  5A5H A;  1IYH A;  3KTB A;  1YF0 A;  1HNA A;  2H0I A;  3D0Z A;  1J08 A;  2CQ9 A;  3IAM 2;  1TRW A;  2L4C A;  3A3T A;  3ZIV A;  5JCG A;  4AKI A;  3C7M A;  1GUH A;  1TDI A;  2QGV A;  1ON4 A;  2LNT A;  4HZ4 A;  4MH3 A;  4K6X A;  4MJB A;  2LUS A;  3EIN A;  4NPB A;  22GS A;  4N3Z A;  3GKM A;  3LQ7 A;  2WB9 A;  3F3Q A;  3HMJ G;  3KXO A;  1FO5 A;  2QC7 A;  2GT6 A;  3KTL A;  1B8X A;  4QL7 A;  1DUG A;  4E68 A;  3VWW A;  4Q5N A;  1FVJ A;  2YWM A;  3F63 A;  3FZ5 A;  2E7P A;  1AQW A;  2YWN A;  2K8V A;  3C1S A;  4KND A;  2HRF A;  12GS A;  2PBJ A;  6GSV A;  2H75 A;  2G2Q A;  3WGE A;  2DIZ A;  1XVW A;  3KCM A;  2BJX A;  1O8W A;  1O6J A;  1E6B A;  5D93 A;  2ALB A;  3HJM A;  3IA1 A;  3IV4 A;  2X64 A;  3DD3 A;  3PGT A;  2TRX A;  2DJ1 A;  4KDU A;  3FY7 A;  3GKK A;  4PX1 A;  5J41 A;  4LL1 B;  3VWU A;  2H73 A;  1FHE A;  3M9J A;  17GS A;  5ELG A;  4HU7 A;  2XC2 A;  1NHY A;  2VLT A;  4PQH A;  4XS4 A;  1AIU A;  4WXT A;  3ZFL A;  2EC4 A;  1SL2 B;  20GS A;  2A2P A;  4KDX A;  3KMN A;  5F07 A;  3LFL A;  2UZ8 A;  4ZB8 A;  1ZOF A;  3IHG A;  1A0F A;  1F3A A;  1F9M A;  1PX6 A;  1XOB A;  5D73 A;  4BVY B;  1YKA A;  3GKN A;  5A1N A;  1FG4 A;  3WGX A;  1ML6 A;  4G0L A;  1GSQ A;  2YZU A;  2I4A A;  1ILO A;  2GZY A;  5HR3 A;  1G6W A;  2F51 A;  1XW5 A;  4O92 A;  2OE0 A;  4DSS A;  1GP1 A;  1Y1U A;  2P31 A;  1VGL A;  3A5W A;  3EYT A;  3FR3 A;  2B1L A;  2HSM A;  1X9M B;  2HZE B;  4KX4 A;  4CDO A;  2GSQ A;  3EU4 A;  1TRV A;  2X8H A;  3ZRD A;  1ZYQ B;  1XBS A;  2C1Y A;  1S3D A;  1MD4 A;  2H1G A;  1GTI A;  1XCC A;  3C73 A;  2C0F A;  4WKW A;  2ON7 A;  5HFI A;  1FOV A;  3NOF A;  2JU5 A;  4EF0 A;  2HQT A;  2IWT A;  1SJ6 A;  3ZL5 A;  1O81 A;  2L5L A;  2YN1 A;  4HQZ A;  3BOA A;  3APQ A;  14GS A;  4FH8 A;  3CBU A;  5C04 A;  2AYT A;  2LJA A;  1UN2 A;  1S3C A;  5ID2 B;  3DKS A;  13GS A;  3GSS A;  2C8U A;  4ECC A;  1N8J A;  2X8C A;  2VUP A;  2JAD A;  2E0Q A;  2CVB A;  4PNF A;  3UIW A;  2C4J A;  1DE2 A;  5GST A;  1B4P A;  1SKR B;  4KA0 A;  2MMO A;  4WBJ A;  3BD2 A;  3RBT A;  4L5L A;  2IFQ A;  4KAE A;  2R2J A;  3HHV A;  4G0K A;  2R6K A;  4IGJ A;  2VOC A;  3LXZ A;  2LEG A;  4AKX B;  1OC8 A;  3NIV A;  4EE0 A;  3ZIT A;  3IC4 A;  3W8J A;  3RPN A;  4WEY A;  2X4A A;  2PPT A;  3Q74 A;  4IHU A;  3IBH A;  1THX A;  4G0I A;  2ZUP A;  2VM2 A;  1SKS B;  3UEM A;  3HZ8 A;  1TI3 A;  1TRU A;  3CYN A;  1SVM A;  3FHK A;  2EIR A;  5ECN B;  2H6Z A;  2HSY A;  3F4R A;  4NHW A;  4WR5 A;  1NW2 A;  4X1U A;  1TW9 A;  5J4V A;  2O85 A;  1I5G A;  4ZIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...