3LG6A

Crystal structure of putative glutathione transferase from coccidioides immitis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
229
structure length
229
Chain Sequence
b'TPNFELYGYFRSSCSGRLRIAFHLKSIPYTRHPVNLLKGEQHSDTYKSLNPTNTVPLLVVSNINNTVSPSSASFSIGQSLAALEYLEEALPTNARPLLPPISNPVARAHVRTICNIIACDVQPVTNLKIQKKVKALDGDPTVWSRDLATQGFGAVEKLLELSAGRFCVGDEITLADVCLVPAVWAAERVGMDLARFPITKRVFEEMLKEEAVQKAHWQKQEDTPEDLRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative glutathione transferase
molecule tags Transferase
source organism Coccidioides immitis
publication title Structures of a putative zeta-class glutathione S-transferase from the pathogenic fungus Coccidioides immitis.
pubmed doi rcsb
total genus 78
structure length 229
sequence length 229
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2010-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3lg6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3lg6A01
2VD1A 1R26A 1GNEA 2PBJA 20GSA 1FVKA 4FO5A 1LJRA 2B6MA 1TU7A 3IOSA 3G7IA 2P31A 1FO5A 3G9BA 4I8BA 3HA9A 2MMAA 1YJ6A 2WZ9A 2YN1A 3QD9A 5HFGA 4MP4A 1EOGA 4TKYA 2WS2A 4XRDA 1AIUA 3E3EA 4I97A 1K3LA 3TCOA 4BL7B 1PSQA 5ID2A 1MTCA 4G9HA 4BVYA 2LEGA 1N2AA 3TOUA 1W4VA 1ZYQB 1GTUA 4D73A 2HLSA 4WF4A 1MD3A 2YZUA 3GIXA 3KP8A 3OR5A 3I9V2 1I9DA 3ERFA 1ACVA 4ZBBA 2CAQA 3FKFA 4IGJA 3WYWA 4L5OA 1J08A 1FB6A 3LYKA 5IPGA 4DEJA 2ZCTA 2CZ2A 3HJOA 1Z6MA 4IKHA 3IC8A 3APOA 1OAZA 1ILOA 4LLRA 2B1LA 3LSZA 1PRXA 3GL5A 2GGTA 3ZREA 1NSWA 2H71A 5AISA 3CBUA 1M2AA 1Z9HA 4ZB8A 4DSQA 1MEKA 3VFIA 3U5RE 1R4WA 5IMDA 2OADA 3GNJA 3LGCA 2KOKA 1ZGNA 2X8GA 1RW1A 2LRNA 1BYEA 5CP1A 6GSYA 2H6ZA 3H93A 1ERUA 4POBA 3LEFA 1GL8A 1BEDA 2BMXA 1GTIA 3UJ1A 4HOJA 1S3CA 4GSSA 1AUCA 1XW9A 2LJRA 1OC9A 2FLSA 1OC3A 13GSA 1A0RP 2HRKB 4CDOA 2GVPA 3P8WA 1SYRA 2CX3A 3VWXA 2F51A 2DMLA 1FW1A 3VWVA 1QGVA 3IK7A 3D6IA 3DYRA 3IRAA 3M9KA 3IAM2 3HVXA 2IFQA 3FRCA 1A2JA 2FNOA 2DC5A 1EP7A 2LUSA 1X9MB 1GLPA 2YOIA 4D73B 1NM3A 2VCXA 2B5YA 4TW5A 4HZ2A 1K0BA 1SJZA 2GZYA 4HU9A 2NTOA 1YZXA 4HJ2A 5KN3A 2FCHA 3TJBA 2JSYA 1ZZYA 3FW2A 4RQRA 2OBKA 2CVBA 3KD0A 4KCEA 3SWLA 3KTLA 3W6GA 3MAKA 2HRAA 6GSVA 4K2DA 1WOUA 3R2QA 2C1YA 6GSWA 3UVHA 4KH7A 4OFNA 5ECPB 2H6XA 4MLYA 4H86A 2ZNMA 3TDGA 3DVXA 1WPIA 1NHYA 2H75A 3APQA 3UVTA 5CRHA 2L57A 3A2XA 4NV5A 4OD7A 2DSAA 1ZYEA 4BA7A 5F06A 4ZB6A 2CVDA 2PERA 3HD5A 3TRPA 3VI7A 2YJHA 1GSDA 5JWOB 4WBRD 4ZILA 1F6MC 2X99A 1U6TA 5D93A 5ABRA 4KB3A 1GWCA 5LD0A 4IJ3A 1TKDB 2FY6A 2H1DA 1XWCA 1V98A 2IMKA 1GNWA 4POKA 2IMEA 4V2NA 3IC4A 3KJYA 1AAZA 4N11A 5ECOB 3TOTA 3TRQA 4XIHA 1E6BA 3UBKA 4N0ZA 4LL1B 2LTKA 1XFLA 3DWVA 4MZCA 3PGTA 3M3MA 4GSNA 2GT5A 2TRXA 2CQ9A 3KEBA 1SL1B 4BL7A 4HU7A 3NZNA 3F6DA 3ZLPA 3RBTA 4LMWA 4GSTA 2NPBA 4EKZA 4I2TA 2PWJA 4AJ8A 4K6XA 3EE2A 1TTZA 1GP1A 1USBA 1AW9A 5DALB 5B6NA 4RI6A 3PINA 4KGIA 2YJ7A 4FYBA 2O7KA 4FH8A 3R3EA 3L9UA 2IMIA 3RAZA 1PN9A 2DLXA 5JWQB 3D21A 1YEPA 1QK8A 2WJUA 3WT2A 3C1RA 2FD3A 1O73A 2P0GA 3VPQA 5E4WA 5G2ZA 4OCFA 4TR3A 3A5WA 3QOUA 2L6CA 4EVMA 4BVXA 4MF6A 4MPFA 4HEA2 1XWKA 1XBSA 3KM6A 2GZPA 4BWQA 4TOPA 5DBQA 5HR3A 4MF7A 1V40A 1RQMA 2L5OA 4IP6A 1SKWB 1JFUA 2PMTA 2HSNB 4PUFC 4JEDA 3APSA 1WP0A 2VM2A 5EVOA 3C71A 2YNXA 1FB0A 10GSA 4IP1A 1XXUA 4XS4B 3FYGA 5CRGA 2QSIA 5H5QA 3QAWA 4KA0A 5D8IA 5J9BA 4TXOA 5HR1A 14GSA 2DMMA 3GL3A 2HZEA 3ME7A 1M0UA 3P90A 1XWBA 1SL2B 2GQKA 6GSUA 2X8HA 4OFMA 1ABAA 2YWIA 1PA3A 5AGYA 1R5AA 2V1MA 2H0HA 4L0UA 1T7PB 1X5CA 2F8AA 3C1SA 4HDEA 4WXTA 2HSMB 5HFKA 4POMA 2B3SA 1TU8A 4MF5A 2YV9A 5F8BA 4F82A 2JZTA 2HYXA 5C00A 2O87A 5L71A 1IYIA 3RHBA 3DEXA 2O89A 2F3MA 5D96A 4YQMA 3GHAA 3ED3A 1VF3A 1K0NA 5J5NA 1SYXA 3GRXA 4IHUA 3Q6OA 4O32A 2AAWA 3FHKA 4PGTA 4K7IA 2H74A 5DQYA 3UEMA 4KAEA 4YAVA 4ML6A 3G7YA 1TP9A 2VOCA 16GSA 2LNTA 2IL3A 2LS5A 4FIWA 4WKWA 3ZRDA 3LORA 4PNFA 3Q19A 3IA1A 4WR5A 3F4RA 4TR1A 1FVJA 2JACA 3QDNA 4ISDA 3RHCA 1TRUA 3ZMKA 1O7UA 4P3YB 2VCZA 2A4VA 3L9VA 2TIRA 2FGXA 5HFIA 2AUVA 1BG5A 3RDWA 4I5QA 3QR6A 4FYUA 3IDVA 5H5SA 3VI5A 4G0IA 17GSA 3FZAA 8GSSA 2AYTA 1U3AA 4TR0A 4QL7A 4DSRA 3WGEA 4DSSB 3TKSC 1PL2A 4Q5NA 4MH3A 5EY6A 1S3DA 3BJ5A 3WD6A 3V1WA 4Q5RA 5ECSA 1C72A 1OC9B 4E8HA 1YF0A 2HSMA 1J9BA 2L4QA 5IOXA 3QFAC 1U3IA 3PPUA 4MMMA 1XWAA 3FZ9A 2WRTA 2YV7A 4MA9A 5B8AA 1AC1A 1LBKA 2V6KA 4N0VA 2YANA 1M2DA 2YCDA 2XPDA 1GTAA 1OKTA 5J9CA 1Z7PA 5DAKB 1GSSA 2H19A 2PN8A 4MDCA 3D22A 4G19A 3MWHA 5B8BA 5CO3A 4MPGA 4BVXB 2H66A 1QFNA 1PKZA 1EV9A 3ZZXA 2E2GA 1GH2A 4JR4A 2DBCA 3HCZA 2YZHA 1Z3EA 3TKRA 5ECMB 2VUPA 2VCTA 3CXGA 1A24A 4F0CA 2YPMA 3P7XA 1M99A 2B5EA 3HDCA 4XS6A 4ILFA 1PL1A 3HZ4A 4XCSA 5A5KA 3A2VA 3FY7A 4K0GA 2RLIA 2H72A 3F4SA 3LG6A 3GSTA 4X43A 3O3TA 3GSSA 3MDKA 5GAND 4ACSA 1IYHA 2HQTA 1BAYA 3DMLA 2V6OA 3TB2A 6GSXA 5DJLA 1AQXA 2RUFA 22GSA 1MDJA 2C3NA 3TJGA 4G0KA 2R6KA 5DQSA 3LXTA 1SENA 3ERGA 1M9AA 3QMXA 1J0FA 5IIZA 3N5OA 3W8JA 1XWGA 1JZDA 3FR6A 2MBTA 3M0FA 4WETA 4GF0A 3CRUA 3HVVA 3DRNA 2H01A 2CZ3A 3GUSA 2K18A 2P5RA 3VURA 2J23A 4NAXA 1WRYA 3UIWA 5GSTA 4YH2A 2OJLA 2HSHA 4HQZA 4QL9A 2VAFA 2FUG2 3O76A 5JCGA 3IBHA 2MMOA 2B1KA 3GA4A 1AQWA 5J41A 3I43A 2I4AA 5AN1A 5CAXA 1Z7RA 2RIIA 1SD8A 3BD2A 5IO2A 3IV4A 4CW9A 3L4NA 2FWFA 2M72A 1ST9A 3QAVA 3UBLA 1UVZA 5IO0A 4CHSA 3KXOA 4AJ7A 3DXBA 3CSIA 3GN3A 2QC7A 5J3RA 2KP1A 1SK2A 4TR4A 9GSSA 2L5LA 4F03A 1SK0A 2VIMA 3TJFA 4ZL9A 2J9HA 11GSA 2MYGA 2M80A 1ZOFA 4GRFA 1GSQA 3IPZA 3S9FA 2TRCP 4USSA 2R5GA 1G6WA 2GLRA 2KP2A 2RM6A 1OKDA 2LRTA 3EWLA 1OE7A 3E0UA 4XS4A 2CAIA 1W89A 1GUMA 4RUVA 3M8NA 2CV4A 1A0FA 5LCZA 4XTSA 2K9FA 4K7NA 3DGQA 3FZ4A 3PH9A 1QQ2A 2R4VA 1K0AA 1PMTA 2FWEA 1DE1A 2LJKA 2HFDA 1T4YA 3TKSE 2HZEB 2GQLA 2V32A 1V9WA 3HY2A 1A8YA 3IE3A 4Q5FA 1HNBA 3GTUA 3F4TA 1K0MA 3EMXA 3GX8A 1SL0B 1ERTA 2DIYA 1T00A 4ZL8A 2VLVA 4Z7XA 2NBSA 2GSTA 4IQAA 1MD4A 2DJ3A 3EURA 5ECLB 4ECJA 1V57A 5FWGA 4AGSA 6GSSA 4MK3A 2I9HA 4NHWA 5CNWA 4HUAA 3VWUA 4PNGA 3F3RA 2HSYA 1HYUA 3EVIA 3EYTA 4KNDA 1PQNA 2XHFA 5A4UA 4OCEA 4KF9A 3F0IA 5H5RA 3TKPA 1VRSD 2PPTA 3GFKA 4OFTA 1NHOA 2GZZA 1TJDA 2OACA 2H1BA 1TRSA 1O85A 3M1GA 4KUNA 5JCUA 4BPYA 2N5BA 4RQXA 1K0CA 1EEJA 3EINA 3F9UA 3TJJA 4MZWA 2BJXA 1HNAA 2K8VA 3WT1A 1SKRB 2QGVA 3EC3A 4K9ZA 2ON7A 3TKSA 1KTEA 1LU4A 4GQCA 4GTUA 3CTFA 3H79A 4KDYA 1EOHA 3HYPA 1ZL9A 1B48A 3JCML 2IPAA 3D5JA 3SBCA 3TRXA 5AIXA 12GSA 4IJIA 4N30A 2GQMA 4PUAA 5ECRB 5HR2A 4MJAA 1U88A 1EEMA 2C0EA 3UAPA 2C0DA 4EDYA 3L0HA 1KBNA 5FT3A 3BCIA 5AIVA 5IQYA 5ELAA 2OBIA 4K1FA 2DJJA 3WGDA 3ZITA 1MDIA 3A2WA 2Z9SA 1UA5A 1B8XA 2C4JA 3C8EA 1T3BA 3QCPA 2E0QA 3ISOA 3C7MA 4KW6A 3UMAA 5DAKA 2HT9A 3D4TA 3VWWA 1TDIA 5F07A 1Z5YE 4MJCA 1QXHA 2LQOA 3CSJA 3LFLA 4LL4B 3F8UA 2H30A 4MJBA 5KEJA 1CQHA 1H75A 2H0GA 2KLXA 1X9WB 1JZRA 1WIKA 4JE1A 4O92A 2NDOA 4PXOA 2REMA 4JBBA 2R2JA 3IXRA 4MJEA 3CTGA 3LXZA 4OMVA 1O6JA 2IMFA 4NXIA 2ON5A 1H4OA 1GSUA 3BCKA 1BJXA 4JU5A 3FR9A 4GQFA 2B5XA 3K8NA 2AJQB 2LJAA 2IN3A 2H70A 4KX4A 4FQUA 1JHBA 2BTOT 2WCIA 3KP9A 1YQ1A 1KEBA 4L5LA 5BMUA 4TVEA 2IMDA 2G0FA 4J56E 1ERWA 1GUHA 5EL8A 1TI1A 1Q4JA 1YDKA 1S3AA 4MZBA 2OA7A 4LA1A 2DJ0A 1Y6EA 2X64A 1DUGA 2LV3A 4XRAA 18GSA 2DJKA 1CQGA 5ECKB 3RPPA 2DIZA 2RUEA 4E8EA 5G1LA 1PX7A 3QAGA 1SJIA 3IR4A 1JLWA 3QPMA 2O8VB 3VPTA 1UC7A 1SK1A 2I1UA 1B4PA 5D9WA 4I6XA 3N9JA 1X9SB 1I5GA 3TKQA 3M9JA 2P5QA 2VL2C 2VL2A 1YEXA 1AXDA 3GV1A 4ZB9A 3EU4A 2JL4A 4ULXA 3GH6A 5F05A 1TI3A 2GS3A 1EGRA 4KDXA 2PU9C 3KMNA 3GKMA 4YAPA 1YF1A 2XPEA 2K6VA 3GYKA 5EPFA 2OE3A 1OE8A 4G2EA 5DCGA 4J57E 2JADA 2MMZA 3HXSA 3KTBA 4DVCA 1EP8A 1DBYA 1M9BA 2IFQB 5ID2B 1PD21 4ID0A 3HVSA 5JWRB 1BQ7A 2LSTA 2WGRA 2G2QA 1BX9A 1MDKA 2C80A 4KSMA 4WBJA 1K3OA 1WE0A 1PGTA 2K8SA 4F9ZA 5GZZB 4GCIA 2OE0A 2EIQA 4J2FA 2LQQA 2LRCA 2CX4A 3HHVA 4HZ4A 4TRXA 1XZOA 3KGKA 3I6AA 1XW5A 5KN1A 2FWHA 1B9YC 4XS1A 1ERVA 5A4WA 1URMA 2VM1A 2IIYA 4KSOA 2F9SA 1QUWA 1ON4A 2E2MA 1TK8B 1GTBA 3LJRA 4PURA 2VLUA 1X0RA 3CRTA 1HD2A 2HRNA 2MMNA 3CMIA 1OVNA 4Q5QA 3ZMLA 5IMVA 1PKWA 1PX6A 5LNKe 3CSHA 1ZMAA 1K0DA 4MH2A 2GDRA 2IJYA 2C3QA 2QKEA 2D2ZA 3ME8A 3DVWA 1SKSB 4DSSA 2OE1A 1R5PA 2B7JA 2GSQA 5CYYA 1SU9A 2A2SA 4PQHA 4PX1A 1G7OA 4ZXGA 1XVQA 3CYNA 2O85A 3EU3A 3G7JA 2KUCA 2A2RA 3HKRA 1JZWA 1THOA 2CT6A 2LKUA 4NV2A 3KMOA 3DIEA 2VD0A 1TXXA 1VF2A 4K8MA 3FEUA 3BBYA 4ECCA 2YWNA 2F8FA 4TN8A 4TXVA 1YKAA 4OO5A 2VCQA 2MZCA 2GSSA 2OKAA 5DCHA 4N10A 3RPNA 5ECIB 2L59A 2XBQA 3DKSA 5G5EA 4EDZA 2DJ1A 4BVYB 3HZ8A 4F0BA 2XC2A 4K7OA 2RM5A 2N5FA 5HR0A 4HQSA 1XIYA 4NPBA 3KZQA 3FZ5A 2YWOA 1Y25A 3NIVA 1HNCA 2PGTA 3ZL5A 5IMFA 4RI7A 4FYCA 4JRRA 1M7TA 4I2UA 5A4VA 2EIOA 2YP6A 5COHA 2R37A 5G1KA 2VL9A 1DSBA 2WB9A 4KE3A 5CREA 1DE2A 2L4CA 1GSFA 1VGLA 4IELA 4OWYA 3TGZA 5IMAA 3DD3A 4IS0A 4MCUA 5ECQB 5FHIA 5IOWA 3Q74A 4HS1A 2C0GA 1T1VA 2FHEA 4X0XA 4O5RA 4EF0A 3J7Yk 1UN2A 3MSZA 1OC8A 4ECBA 3FR3A 2HXKA 3GKKA 5GAPD 5CRWA 3AY8A 4EO3A 4AJ6A 2H6YA 3GX0A 3VLNA 2AHEA 1JLVA 2PVOC 4K0NA 4ML1A 1A2LA 4EL1A 2IWTA 3ZVJD 3J7Yb 2EIRA 1YKCA 3WGXA 3GMFA 4ZBDA 5IM9A 1O8XA 2XBIA 1QMVA 1RK4A 6GSTA 2CA8A 3D4MA 3EMPA 5E59A 1WJKA 3ZIJA 2CVKA 3BOAA 1FOVA 4HI7A 4KDUA 1GSEA 2WFCA 1TOFA 4PQIA 3US3A 5J4UA 4IN0A 1VF1A 5C04A 3UARA 3GTUB 1TK0B 1SJ6A 1WWJA 2H8LA 4GLTA 1M2BA 4WEYA 1YY7A 1A8LA 1G0TA 2JZRA 1U87A 4WF5A 4GWRA 1WMJA 5KN2A 1F9MA 3QFBC 4PTSA 1ZCPA 3LQ7A 5DJMA 5ENUA 3H1NA 1TK5B 4L0WA 1EWXA 2E7PA 1K3YA 4ECIA 5CRDA 4TR1B 3LWAA 1F37A 4MABA 4EUYA 2YWMA 3F3QA 2HNLA 1TW9A 3TJKA 5G31A 2VCVA 3F6FA 4BWSA 1V2AA 1XOBA 3U6VA 1GUKA 4QQ7A 4G10A 2C0FA 2ZUPA 5B7CA 1A2MA 2JU5A 2DJ2A 3IK9A 5D9VA 2GT6A 3A3TA 3L9SA 5D73A 5F0GA 2H73A 1SD9A 1XCCA 4X1UA 1OYJA 1T8EB 4V1Ap 2WDUA 4IW9A 1EZKA 4JZQA 2I3YA 2VL3A 3ERWA 4EC0A 1ML6A 1AQVA 2HI7A 4YQVA 4EE0A 1XW6A 1GRXA 4ZBAA 1T4ZA 1KNGA 4JR6A 1R7HA 1F2EA 2L6DA 1B9XC 4KCAA 5D9XA 4G0LA 2N5AA 1A23A 4YQUA 5G5FA 4V2LA 4XHMA 4TXOB 2H0IA 2FWGA 4GXZA 2V41A 2HE3A 1Q98A 2ES7A 3FK8A 5DVBA 5JCWA 1NW2A 2AV4A 2HZFA 2FA4A 4L8EA 2EC4A 1THXA 3H8QA 3HJPA 2C8UA 1E2YA 3GKXA 3Q18A 2LNSA 2VO4A 3KCMA 3ZTLA 4POLA 3GKNA 2H76A 3UOMA 3ZYWA 3PR8A 3C73A 1GLQA 2V2GA 1EV4A 3MNGA 3HJMA 2B7KA 2WULA 19GSA 1G7EA 4IVFA 3W8SA 3KH9A 1GSYA 5B6MA 3F63A 1XPVA 3ZFLA 1O8WA 3P2AA 5ELGA 4LMVA 1FG4A 1X5DA 4O7HA 5G30A 5DDLA 4NMUA 5IPHA 2ALBA 3IHQA 1TRWA 2NVLA 5INYA 2HRFA 1O81A 1F3AA 4EXJA 4WR4A 3KIJA 2AB6A 1Z6NA 4ZIJA 5D9TA 3TUEA 2HRKA 2PUKC 2VLTA 2H1GA 1GULA 3GH9A 4OO4A 3ZIVA 2MBSA 1JZOA 2X8CA 4V1Ag 3VK9A 1X5EA 1TRVA 4HJMA 1B4QA 3ZVJA 5KN0A 2R3XA 1HQOA 3KH7A 3GURA 2I81A 1FHEA 4NHZA 4F2IA 2KHPA 2M46A 3NOFA 2PVQA 3E9JB 1K0OA 4IBPA 2JZSA 5DALA 2GTUA 1EGOA 4V2MA 4ZL7A 3H4KA 2FA8A 1F3BA 3UL3A 3O6TA 1V58A 7GSSA 5GSSA 1XVWA 1XOAA 3IAS2 2GSRA 3I69A 5IMCA 2UZ8A 2JSZA 2VCWA 3ZFBA 1G6YA 5IMZA 3L78A 3D0ZA 3LYPA 5HQPA 1VF4A 4NWYA 1N8JA 4IQ1A 4PQ1A 2H1AA 1FAAA 2C3TA 5ECHB 4AF2A 5ECNB
chains in the Genus database with same CATH superfamily
2VD1A 1R26A 1GNEA 2PBJA 20GSA 1FVKA 4FO5A 1LJRA 2B6MA 1TU7A 3IOSA 3G7IA 2P31A 1FO5A 3G9BA 2WW2A 4I8BA 3HA9A 2MMAA 1YJ6A 2WZ9A 2YN1A 3QD9A 5HFGA 4MP4A 1EOGA 4TKYA 2WS2A 4XRDA 1AIUA 3E3EA 4I97A 1K3LA 3TCOA 4BL7B 1PSQA 5ID2A 1MTCA 4G9HA 3RFRC 4BVYA 2LEGA 1N2AA 3TOUA 1W4VA 1ZYQB 1GTUA 4D73A 2HLSA 4WF4A 1MD3A 2WW1A 2YZUA 3GIXA 3KP8A 3OR5A 3I9V2 1I9DA 3ERFA 1ACVA 4ZBBA 2CAQA 3FKFA 4IGJA 3WYWA 4L5OA 1J08A 1FB6A 4K5SA 3LYKA 5IPGA 4DEJA 2ZCTA 2CZ2A 3HJOA 1Z6MA 4IKHA 3IC8A 3APOA 1OAZA 1ILOA 4LLRA 2B1LA 3LSZA 1PRXA 3GL5A 2GGTA 3ZREA 1NSWA 3TU3B 2H71A 5AISA 2X4AA 3CBUA 1M2AA 1Z9HA 4ZB8A 4EIPA 4DSQA 1MEKA 3VFIA 4AKGA 3U5RE 1R4WA 5IMDA 2OADA 3GNJA 3LGCA 2KOKA 1ZGNA 2X8GA 1RW1A 2LRNA 1BYEA 5CP1A 6GSYA 2H6ZA 3H93A 1ERUA 4A5PA 4POBA 3LEFA 1GL8A 1BEDA 2BMXA 1GTIA 3UJ1A 4HOJA 1S3CA 4GSSA 1AUCA 1XW9A 2LJRA 1OC9A 2X49A 2FLSA 1OC3A 13GSA 1A0RP 2HRKB 4CDOA 3RGBC 2GVPA 3P8WA 1SYRA 2CX3A 3VWXA 2F51A 2DMLA 4FXYP 1FW1A 3VWVA 1QGVA 3IK7A 3D6IA 3DYRA 3IRAA 3M9KA 3IAM2 3HVXA 2IFQA 3FRCA 1A2JA 2FNOA 2DC5A 1EP7A 2LUSA 1X9MB 1GLPA 2YOIA 4K2XA 4D73B 1NM3A 2VCXA 2B5YA 4TW5A 4HZ2A 1K0BA 1SJZA 2GZYA 4HU9A 2NTOA 1YZXA 4HJ2A 5KN3A 2FCHA 3TJBA 2JSYA 1ZZYA 3FW2A 4RQRA 2OBKA 2CVBA 3KD0A 4KCEA 3SWLA 3KTLA 3W6GA 3MAKA 2HRAA 6GSVA 4K2DA 1WOUA 3R2QA 2C1YA 6GSWA 3UVHA 4KH7A 4OFNA 5ECPB 2H6XA 4MLYA 4H86A 2ZNMA 3TDGA 4W66A 3DVXA 1WPIA 1NHYA 2H75A 3APQA 3UVTA 5CRHA 2L57A 3A2XA 4NV5A 4OD7A 2DSAA 2WVZA 1ZYEA 4BA7A 5F06A 4ZB6A 2CVDA 2PERA 1BF5A 3HD5A 3TRPA 3VI7A 4AKHA 2YJHA 1GSDA 5JWOB 4WBRD 4ZILA 1F6MC 2X99A 5J4YA 1U6TA 5D93A 5ABRA 4KB3A 1GWCA 5LD0A 4IJ3A 1TKDB 2FY6A 2H1DA 1XWCA 1V98A 2IMKA 1GNWA 3CHXC 4POKA 2IMEA 4V2NA 3IC4A 3KJYA 1AAZA 4N11A 5ECOB 3TOTA 3TRQA 4XIHA 2HSNA 1E6BA 3UBKA 4N0ZA 4LL1B 2R0PA 2LTKA 1XFLA 4MZCA 3DWVA 3PGTA 3M3MA 1N25A 4GSNA 2GT5A 2TRXA 2CQ9A 3KEBA 1SL1B 4BL7A 4HU7A 3LW9A 3NZNA 3F6DA 3ZLPA 3RBTA 4LMWA 4GSTA 2NPBA 4EKZA 4I2TA 2PWJA 4AJ8A 4K6XA 3EE2A 1TTZA 1GP1A 1USBA 1AW9A 5DALB 5B6NA 4RI6A 3PINA 4KGIA 2YJ7A 4FYBA 2O7KA 5J4VA 4FH8A 3R3EA 3L9UA 2IMIA 3RAZA 2WW3A 1I1IP 1PN9A 2DLXA 5JWQB 3D21A 1YEPA 1QK8A 2WJUA 3WT2A 3C1RA 2FD3A 1O73A 2P0GA 3VPQA 5E4WA 5G2ZA 5A5HA 4OCFA 4TR3A 3A5WA 3QOUA 2L6CA 2DKIA 4EVMA 4BVXA 4MF6A 4MPFA 4HEA2 1XWKA 1XBSA 3KM6A 2GZPA 4BWQA 4TOPA 5DBQA 5HR3A 4MF7A 1V40A 1RQMA 2L5OA 4IP6A 1SVLA 1SKWB 1JFUA 2PMTA 2HSNB 4PUFC 4JEDA 3APSA 1WP0A 2VM2A 5EVOA 3C71A 2YNXA 1FB0A 10GSA 4IP1A 1XXUA 4XS4B 3FYGA 5CRGA 2QSIA 5H5QA 3QAWA 4KA0A 5D8IA 5J9BA 4TXOA 5HR1A 14GSA 2DMMA 3GL3A 2HZEA 3ME7A 1M0UA 4PHZC 3P90A 1XWBA 1SL2B 2GQKA 6GSUA 2X8HA 2O36A 4OFMA 1ABAA 2YWIA 1PA3A 5AGYA 1R5AA 2V1MA 2H0HA 4L0UA 1T7PB 1X5CA 2F8AA 3C1SA 4HDEA 4WXTA 2HSMB 5HFKA 4POMA 2B3SA 1TU8A 4MF5A 2YV9A 2EFCA 5F8BA 4F82A 2JZTA 2HYXA 5C00A 2O87A 5L71A 1IYIA 3RHBA 3DEXA 2O89A 2EFEA 2F3MA 1Y1UA 5D96A 4YQMA 3GHAA 3ED3A 1VF3A 1K0NA 5J5NA 1SYXA 3GRXA 4IHUA 3Q6OA 4O32A 2AAWA 3FHKA 4PGTA 4K7IA 2H74A 5DQYA 3UEMA 4KAEA 4YAVA 4ML6A 3G7YA 1TP9A 2VOCA 16GSA 4K5RA 3FMWA 2LNTA 2IL3A 2LS5A 4FIWA 4WKWA 3ZRDA 3LORA 4PNFA 5A34B 3Q19A 3IA1A 4WR5A 3F4RA 4TR1A 1FVJA 2JACA 3QDNA 4ISDA 3RHCA 1TRUA 3ZMKA 1O7UA 4P3YB 2VCZA 2A4VA 3L9VA 2TIRA 2FGXA 5HFIA 2AUVA 1BG5A 3RDWA 4I5QA 1TXUA 3QR6A 4FYUA 3IDVA 5H5SA 3VI5A 4G0IA 17GSA 3FZAA 8GSSA 2AYTA 1U3AA 4TR0A 4QL7A 4DSRA 3WGEA 4DSSB 3TKSC 1PL2A 4Q5NA 5A1NA 4MH3A 1ZYPA 5EY6A 1S3DA 3BJ5A 3WD6A 3V1WA 4Q5RA 5ECSA 1C72A 1OC9B 4E8HA 1YF0A 2HSMA 1J9BA 2L4QA 5IOXA 1M3JA 3QFAC 1U3IA 3PPUA 4MMMA 1XWAA 3FZ9A 2WRTA 2YV7A 4MA9A 5B8AA 1AC1A 1LBKA 2V6KA 4N0VA 2YANA 1M2DA 2YCDA 2XPDA 1GTAA 1OKTA 5J9CA 1Z7PA 5DAKB 1GSSA 2H19A 1YVLA 2PN8A 4MDCA 3D22A 3IHGA 4EIQA 4G19A 3MWHA 2WVXB 5B8BA 5CO3A 4MPGA 4BVXB 2H66A 1QFNA 1PKZA 1EV9A 3ZZXA 2E2GA 1GH2A 4JR4A 2DBCA 3HCZA 2YZHA 1Z3EA 3TKRA 5ECMB 2VUPA 2VCTA 3CXGA 1A24A 4F0CA 2WW0A 2YPMA 3P7XA 1M99A 2B5EA 3HDCA 5A5HB 4XS6A 4ILFA 1PL1A 3HZ4A 4XCSA 5A5KA 3A2VA 3FY7A 4K0GA 2RLIA 2H72A 3F4SA 3LG6A 3GSTA 4X43A 3O3TA 2O3EA 3GSSA 3MDKA 5GAND 4ACSA 1IYHA 2HQTA 1BAYA 3DMLA 2V6OA 3TB2A 6GSXA 5DJLA 1AQXA 2RUFA 22GSA 1MDJA 2C3NA 3TJGA 4G0KA 2R6KA 5DQSA 4HSCX 3LXTA 1SENA 3ERGA 1M9AA 3QMXA 1J0FA 5IIZA 3N5OA 3W8JA 1XWGA 1JZDA 3FR6A 2MBTA 3M0FA 4WETA 4GF0A 3CRUA 3HVVA 3DRNA 2H01A 2CZ3A 3GUSA 2K18A 2P5RA 3VURA 2J23A 4NAXA 1WRYA 3UIWA 4Z2UA 5GSTA 4YH2A 2OJLA 2HSHA 4HQZA 4QL9A 2VAFA 2FUG2 3O76A 5JCGA 3IBHA 2MMOA 2B1KA 3GA4A 1AQWA 5J41A 3I43A 4AKIA 2I4AA 2A4HA 5AN1A 5CAXA 1Z7RA 2QA1A 2RIIA 1SD8A 3BD2A 5IO2A 3IV4A 4CW9A 3L4NA 2FWFA 2M72A 1SVMA 1ST9A 3QAVA 2QA2A 3UBLA 1UVZA 5IO0A 4CHSA 3KXOA 4AJ7A 3DXBA 3CSIA 4O5QA 3GN3A 2QC7A 5J3RA 2KP1A 1SK2A 4TR4A 9GSSA 2L5LA 4F03A 1SK0A 2VIMA 3TJFA 4ZL9A 2J9HA 11GSA 2MYGA 2M80A 1ZOFA 4GRFA 1GSQA 3IPZA 3S9FA 2TRCP 4USSA 2R5GA 1G6WA 2GLRA 2KP2A 2RM6A 1OKDA 2LRTA 3EWLA 1OE7A 3E0UA 4XS4A 2CAIA 1W89A 1GUMA 4RUVA 3M8NA 2CV4A 4ICYA 1A0FA 5LCZA 4XTSA 2K9FA 4K7NA 3DGQA 3FZ4A 3PH9A 1QQ2A 5A1NB 2R4VA 1K0AA 1PMTA 2FWEA 1DE1A 2LJKA 2HFDA 1T4YA 3TKSE 2HZEB 2GQLA 2V32A 1V9WA 3HY2A 1A8YA 3IE3A 4Q5FA 1HNBA 4O5UA 3GTUA 3F4TA 1K0MA 3EMXA 3GX8A 1SL0B 1ERTA 2DIYA 1T00A 4ZL8A 2VLVA 4Z7XA 2NBSA 2GSTA 4IQAA 1MD4A 2DJ3A 3EURA 5ECLB 4ECJA 1V57A 5FWGA 4AGSA 6GSSA 2O5VA 4MK3A 2I9HA 4PI2C 4NHWA 5CNWA 4HUAA 3VWUA 4PNGA 3F3RA 3MYDA 2HSYA 1HYUA 3EVIA 3EYTA 4KNDA 1PQNA 2XHFA 5A4UA 4OCEA 4KF9A 3F0IA 5H5RA 3TKPA 1VRSD 2PPTA 3GFKA 4OFTA 1NHOA 2GZZA 1TJDA 2OACA 2H1BA 1TRSA 1O85A 3M1GA 4KUNA 5JCUA 4BPYA 2N5BA 4RQXA 1K0CA 1EEJA 3EINA 3F9UA 3TJJA 4MZWA 2BJXA 1HNAA 2K8VA 3WT1A 1SKRB 2QGVA 3EC3A 4K9ZA 2ON7A 3TKSA 1KTEA 1LU4A 4ZB7A 4GQCA 4GTUA 4GDFA 3CTFA 3H79A 4KDYA 3MIXA 1EOHA 3HYPA 2EFHA 1ZL9A 1B48A 3JCML 2IPAA 3D5JA 3SBCA 3TRXA 5AIXA 12GSA 4IJIA 4N30A 2GQMA 4PUAA 5ECRB 5HR2A 4MJAA 1U88A 1EEMA 2C0EA 3UAPA 2C0DA 4EDYA 3L0HA 1KBNA 5FT3A 3BCIA 5AIVA 5IQYA 5ELAA 2OBIA 4K1FA 2DJJA 2EFDA 3WGDA 3ZITA 1MDIA 3A2WA 2Z9SA 1UA5A 1B8XA 2C4JA 3C8EA 1T3BA 3QCPA 2E0QA 3ISOA 3C7MA 4KW6A 3CQFA 3UMAA 5DAKA 2HT9A 3D4TA 3VWWA 1TDIA 5F07A 1Z5YE 4MJCA 1QXHA 2LQOA 3CSJA 3LFLA 4LL4B 3F8UA 2H30A 4MJBA 5KEJA 1CQHA 5KOXA 1H75A 2H0GA 2KLXA 1X9WB 1JZRA 1WIKA 4JE1A 4O92A 2NDOA 4PXOA 2REMA 2UV8G 4JBBA 2R2JA 3IXRA 4MJEA 3CTGA 3LXZA 4OMVA 1O6JA 2IMFA 4NXIA 2ON5A 1H4OA 1GSUA 3BCKA 1BJXA 4JU5A 3FR9A 4GQFA 2B5XA 3K8NA 2AJQB 2LJAA 2IN3A 2H70A 4KX4A 4FQUA 1JHBA 2BTOT 2WCIA 3KP9A 1YQ1A 1KEBA 4L5LA 5BMUA 4TVEA 2IMDA 2G0FA 4J56E 1ERWA 1GUHA 5EL8A 1TI1A 1Q4JA 1YDKA 1S3AA 4MZBA 2OA7A 1PFOA 4LA1A 2DJ0A 1Y6EA 2X64A 1DUGA 2LV3A 4XRAA 18GSA 2DJKA 1CQGA 5ECKB 3RPPA 2DIZA 2RUEA 4E8EA 5G1LA 5BRTA 1PX7A 3QAGA 1SJIA 3IR4A 1JLWA 1FOHA 3QPMA 2O8VB 3VPTA 1UC7A 1SK1A 2I1UA 1B4PA 5D9WA 4I6XA 3EPTA 3N9JA 1X9SB 1I5GA 3TKQA 3M9JA 2P5QA 2VL2C 2VL2A 1YEXA 4Z2RA 1AXDA 3GV1A 4ZB9A 3EU4A 2JL4A 4ULXA 3GH6A 5F05A 1TI3A 2GS3A 1S4BP 1EGRA 2WVYA 4KDXA 2PU9C 3KMNA 3GKMA 4YAPA 1YF1A 2XPEA 2K6VA 3GYKA 5EPFA 2OE3A 1OE8A 4G2EA 5DCGA 4J57E 2JADA 1PN0A 2MMZA 3HXSA 3KTBA 4DVCA 1EP8A 1DBYA 1M9BA 2IFQB 5ID2B 1PD21 4ID0A 3HVSA 5JWRB 1BQ7A 2LSTA 2WGRA 2G2QA 1BX9A 1MDKA 2C80A 4KSMA 4WBJA 1K3OA 1WE0A 1PGTA 2K8SA 4F9ZA 5GZZB 4GCIA 2OE0A 2EIQA 4J2FA 2LQQA 2LRCA 2H1LA 2CX4A 1S3RA 3HHVA 4HZ4A 2OT3A 4TRXA 1XZOA 3KGKA 3I6AA 1XW5A 5KN1A 2FWHA 1B9YC 4XS1A 1ERVA 5A4WA 1URMA 2VM1A 2IIYA 5J40A 4KSOA 2F9SA 4MNNA 1QUWA 1ON4A 2E2MA 3HVNA 1TK8B 1GTBA 3LJRA 4PURA 2VLUA 1X0RA 3CRTA 1YEWC 1HD2A 1XG8A 2HRNA 2MMNA 3CMIA 1OVNA 4Q5QA 3ZMLA 5IMVA 1PKWA 1PX6A 5LNKe 3CSHA 1ZMAA 1K0DA 4MH2A 2GDRA 2IJYA 2C3QA 2QKEA 2D2ZA 3ME8A 3DVWA 1SKSB 4DSSA 2OE1A 1R5PA 2B7JA 2GSQA 2WZSA 5CYYA 1SU9A 2R0CA 2A2SA 4PQHA 4PX1A 1G7OA 4ZXGA 1XVQA 3CYNA 2O85A 3EU3A 3G7JA 2KUCA 2A2RA 3HKRA 1JZWA 1THOA 2CT6A 2LKUA 4NV2A 3KMOA 3DIEA 2VD0A 1TXXA 1VF2A 4K8MA 3FEUA 3BBYA 4ECCA 2YWNA 2F8FA 4TN8A 4TXVA 1YKAA 4OO5A 4E68A 2VCQA 2MZCA 2GSSA 2OKAA 5DCHA 4N10A 3RPNA 5ECIB 2L59A 2XBQA 3DKSA 5G5EA 2DKHA 4EDZA 2DJ1A 4BVYB 3HZ8A 4F0BA 2XC2A 4K7OA 2RM5A 2N5FA 5HR0A 4HQSA 4X4JA 1XIYA 4NPBA 3KZQA 3FZ5A 2YWOA 1Y25A 3NIVA 1HNCA 2PGTA 3ZL5A 5IMFA 4RI7A 4FYCA 4JRRA 1M7TA 4I2UA 5A4VA 2EIOA 2YP6A 5COHA 2R37A 5G1KA 2VL9A 1DSBA 2WB9A 4KE3A 5CREA 4YKGA 1DE2A 2L4CA 1GSFA 1VGLA 4IELA 2VKZG 3TGZA 4OWYA 5IMAA 3DD3A 4IS0A 4MCUA 4Z2TA 5ECQB 5FHIA 5IOWA 3Q74A 4HS1A 2C0GA 1BG1A 2FHEA 1T1VA 4X0XA 1ZYNA 4O5RA 4EF0A 3J7Yk 1UN2A 3MSZA 1OC8A 4ECBA 3FR3A 2HXKA 3GKKA 5GAPD 5CRWA 3AY8A 4EO3A 4AJ6A 2H6YA 3GX0A 3VLNA 2AHEA 1JLVA 2PVOC 4K0NA 4ML1A 1A2LA 4EL1A 2R0GA 2IWTA 3ZVJD 3J7Yb 2EIRA 1YKCA 3WGXA 2A2PA 3GMFA 4ZBDA 5IM9A 1O8XA 2XBIA 1QMVA 1RK4A 6GSTA 2CA8A 3D4MA 3EMPA 5E59A 1WJKA 3ZIJA 2CVKA 3BOAA 1FOVA 4HI7A 4KDUA 1GSEA 2WFCA 1TOFA 4PQIA 3US3A 5J4UA 4IN0A 5A34A 1VF1A 5C04A 3UARA 3GTUB 1TK0B 1SJ6A 1WWJA 2H8LA 4GLTA 1M2BA 4WEYA 1YY7A 1A8LA 1G0TA 2JZRA 1U87A 4WF5A 4GWRA 1WMJA 5KN2A 4QMKA 1F9MA 3A5IA 3QFBC 4PTSA 1ZCPA 3LQ7A 5DJMA 5ENUA 3H1NA 1TK5B 4L0WA 1EWXA 2E7PA 4YKFA 1K3YA 4ECIA 5CRDA 4TR1B 3LWAA 1F37A 4MABA 4EUYA 2YWMA 3F3QA 2HNLA 1TW9A 3TJKA 5G31A 2VCVA 3F6FA 4BWSA 1V2AA 1XOBA 3U6VA 4CY6A 1GUKA 4QQ7A 4G10A 2C0FA 5KOWA 2ZUPA 3CWGA 5B7CA 1A2MA 4N3ZA 2JU5A 2DJ2A 3IK9A 5D9VA 2GT6A 3A3TA 3L9SA 5D73A 5F0GA 2H73A 1SD9A 1XCCA 4X1UA 1OYJA 1T8EB 4G01A 2WDUA 4IW9A 4V1Ap 1EZKA 4JZQA 2I3YA 2VL3A 3ERWA 4EC0A 1ML6A 1AQVA 2HI7A 4YQVA 4AI6A 4EE0A 1XW6A 1GRXA 4ZBAA 1T4ZA 1KNGA 4JR6A 1R7HA 1F2EA 2L6DA 1B9XC 5BMUB 4KCAA 5D9XA 3HMJG 4G0LA 4PI0C 2N5AA 1A23A 4YQUA 5G5FA 4V2LA 2WVXA 4XHMA 4TXOB 2H0IA 2FWGA 4GXZA 2V41A 2HE3A 1Q98A 2ES7A 3FK8A 5DVBA 5JCWA 1NW2A 2AV4A 2HZFA 2FA4A 4L8EA 2EC4A 1THXA 3H8QA 3HJPA 2C8UA 1E2YA 3GKXA 3Q18A 2LNSA 2VO4A 1M3IA 3KCMA 3ZTLA 4POLA 3GKNA 2H76A 3UOMA 3ZYWA 3PR8A 3C73A 1GLQA 2V2GA 1EV4A 3MNGA 3HJMA 2B7KA 2WULA 19GSA 1G7EA 4IVFA 3W8SA 3KH9A 1GSYA 5B6MA 3F63A 1XPVA 3ZFLA 1O8WA 3P2AA 5ELGA 4LMVA 1FG4A 1X5DA 4O7HA 5G30A 5DDLA 4NMUA 5IPHA 2ALBA 3IHQA 1TRWA 2NVLA 5INYA 2HRFA 1O81A 1F3AA 4EXJA 4WR4A 3KIJA 2AB6A 1Z6NA 4ZIJA 5D9TA 3TUEA 2HRKA 2PUKC 2VLTA 2H1GA 1GULA 3GH9A 4AKXB 4OO4A 3ZIVA 2MBSA 1JZOA 2X8CA 4V1Ag 3VK9A 1X5EA 1TRVA 4HJMA 1B4QA 3ZVJA 5KN0A 2R3XA 1SVOA 1HQOA 3KH7A 3GURA 2I81A 1FHEA 4NHZA 4F2IA 2KHPA 2M46A 3NOFA 2PVQA 5J47A 3E9JB 1K0OA 4BIKA 4IBPA 2JZSA 5DALA 2GTUA 1EGOA 4V2MA 4ZL7A 3H4KA 2FA8A 1F3BA 3UL3A 3O6TA 1V58A 7GSSA 5GSSA 1XVWA 1XOAA 3IAS2 2GSRA 3I69A 5IMCA 2UZ8A 2JSZA 2VCWA 3ZFBA 1G6YA 5IMZA 3L78A 3D0ZA 4CY8A 3LYPA 5HQPA 1VF4A 4NWYA 1N8JA 4IQ1A 4PQ1A 2H1AA 1FAAA 2C3TA 5ECHB 4AF2A 5ECNB
chains in the Genus database with same CATH topology
2VD1A 1R26A 1GNEA 2PBJA 20GSA 1FVKA 4FO5A 1LJRA 2B6MA 1TU7A 3IOSA 3G7IA 2P31A 1FO5A 3G9BA 4I8BA 3HA9A 2MMAA 1YJ6A 2WZ9A 2YN1A 3QD9A 5HFGA 4MP4A 1EOGA 4TKYA 2WS2A 4XRDA 1AIUA 3E3EA 4I97A 1K3LA 3TCOA 4BL7B 1PSQA 5ID2A 1MTCA 4G9HA 4BVYA 2LEGA 1N2AA 3TOUA 1W4VA 1ZYQB 1GTUA 4D73A 2HLSA 4WF4A 1MD3A 2YZUA 3GIXA 3KP8A 3OR5A 3I9V2 1I9DA 3ERFA 1ACVA 4ZBBA 2CAQA 3FKFA 4IGJA 3WYWA 4L5OA 1J08A 1FB6A 4K5SA 3LYKA 5IPGA 4DEJA 2ZCTA 2CZ2A 3HJOA 1Z6MA 4IKHA 3IC8A 3APOA 1OAZA 1ILOA 4LLRA 2B1LA 3LSZA 1PRXA 3GL5A 2GGTA 3ZREA 1NSWA 3TU3B 2H71A 5AISA 2X4AA 3CBUA 1M2AA 1Z9HA 4ZB8A 4EIPA 4DSQA 1MEKA 3VFIA 4AKGA 3U5RE 1R4WA 5IMDA 2OADA 3GNJA 3LGCA 2KOKA 1ZGNA 2X8GA 1RW1A 2LRNA 1BYEA 5CP1A 6GSYA 2H6ZA 3H93A 1ERUA 4A5PA 4POBA 3LEFA 1GL8A 1BEDA 2BMXA 1GTIA 3UJ1A 4HOJA 1S3CA 4GSSA 1AUCA 1XW9A 2LJRA 1OC9A 2X49A 2FLSA 1OC3A 13GSA 1A0RP 2HRKB 4CDOA 2GVPA 3P8WA 1SYRA 2CX3A 3VWXA 2F51A 2DMLA 1FW1A 3VWVA 1QGVA 3IK7A 3D6IA 3DYRA 3IRAA 3M9KA 3IAM2 3HVXA 2IFQA 3FRCA 1A2JA 2FNOA 2DC5A 1EP7A 2LUSA 1X9MB 1GLPA 2YOIA 4K2XA 4D73B 1NM3A 2VCXA 2B5YA 4TW5A 4HZ2A 1K0BA 1SJZA 2GZYA 4HU9A 2NTOA 1YZXA 4HJ2A 5KN3A 2FCHA 3TJBA 2JSYA 1ZZYA 3FW2A 4RQRA 2OBKA 2CVBA 3KD0A 4KCEA 3SWLA 3KTLA 3W6GA 3MAKA 2HRAA 6GSVA 4K2DA 1WOUA 3R2QA 2C1YA 6GSWA 3UVHA 4KH7A 4OFNA 5ECPB 2H6XA 4MLYA 4H86A 2ZNMA 3TDGA 4W66A 3DVXA 1WPIA 1NHYA 2H75A 3APQA 3UVTA 5CRHA 2L57A 3A2XA 4NV5A 4OD7A 2DSAA 1ZYEA 4BA7A 5F06A 4ZB6A 2CVDA 2PERA 1BF5A 3HD5A 3TRPA 3VI7A 4AKHA 2YJHA 1GSDA 5JWOB 4WBRD 4ZILA 1F6MC 2X99A 5J4YA 1U6TA 5D93A 5ABRA 4KB3A 1GWCA 5LD0A 4IJ3A 1TKDB 2FY6A 2H1DA 1XWCA 1V98A 2IMKA 1GNWA 4POKA 2IMEA 4V2NA 3IC4A 3KJYA 1AAZA 4N11A 5ECOB 3TOTA 3TRQA 4XIHA 2HSNA 1E6BA 3UBKA 4N0ZA 4LL1B 2R0PA 2LTKA 1XFLA 4MZCA 3DWVA 3PGTA 3M3MA 1N25A 4GSNA 2GT5A 2TRXA 2CQ9A 3KEBA 1SL1B 4BL7A 4HU7A 3LW9A 3NZNA 3F6DA 3ZLPA 3RBTA 4LMWA 4GSTA 2NPBA 4EKZA 4I2TA 2PWJA 4AJ8A 4K6XA 3EE2A 1TTZA 1GP1A 1USBA 1AW9A 5DALB 5B6NA 4RI6A 3PINA 4KGIA 2YJ7A 4FYBA 2O7KA 5J4VA 4FH8A 3R3EA 3L9UA 2IMIA 3RAZA 1PN9A 2DLXA 5JWQB 3D21A 1YEPA 1QK8A 2WJUA 3WT2A 3C1RA 2FD3A 1O73A 2P0GA 3VPQA 5E4WA 5G2ZA 5A5HA 4OCFA 4TR3A 3A5WA 3QOUA 2L6CA 2DKIA 4EVMA 4BVXA 4MF6A 4MPFA 4HEA2 1XWKA 1XBSA 3KM6A 2GZPA 4BWQA 4TOPA 5DBQA 5HR3A 4MF7A 1V40A 1RQMA 2L5OA 4IP6A 1SVLA 1SKWB 1JFUA 2PMTA 2HSNB 4PUFC 4JEDA 3APSA 1WP0A 2VM2A 5EVOA 3C71A 2YNXA 1FB0A 10GSA 4IP1A 1XXUA 4XS4B 3FYGA 5CRGA 2QSIA 5H5QA 3QAWA 4KA0A 5D8IA 5J9BA 4TXOA 5HR1A 14GSA 2DMMA 3GL3A 2HZEA 3ME7A 1M0UA 3P90A 1XWBA 1SL2B 2GQKA 6GSUA 2X8HA 4OFMA 1ABAA 2YWIA 1PA3A 5AGYA 1R5AA 2V1MA 2H0HA 4L0UA 1T7PB 1X5CA 2F8AA 3C1SA 4HDEA 4WXTA 2HSMB 5HFKA 4POMA 2B3SA 1TU8A 4MF5A 2YV9A 2EFCA 5F8BA 4F82A 2JZTA 2HYXA 5C00A 2O87A 5L71A 1IYIA 3RHBA 3DEXA 2O89A 2EFEA 2F3MA 1Y1UA 5D96A 4YQMA 3GHAA 3ED3A 1VF3A 1K0NA 5J5NA 1SYXA 3GRXA 4IHUA 3Q6OA 4O32A 2AAWA 3FHKA 4PGTA 4K7IA 2H74A 5DQYA 3UEMA 4KAEA 4YAVA 4ML6A 3G7YA 1TP9A 2VOCA 16GSA 4K5RA 3FMWA 2LNTA 2IL3A 2LS5A 4FIWA 4WKWA 3ZRDA 3LORA 4PNFA 5A34B 3Q19A 3IA1A 4WR5A 3F4RA 4TR1A 1FVJA 2JACA 3QDNA 4ISDA 3RHCA 1TRUA 3ZMKA 1O7UA 4P3YB 2VCZA 2A4VA 3L9VA 2TIRA 2FGXA 5HFIA 2AUVA 1BG5A 3RDWA 4I5QA 1TXUA 3QR6A 4FYUA 3IDVA 5H5SA 3VI5A 4G0IA 17GSA 3FZAA 8GSSA 2AYTA 1U3AA 4TR0A 4QL7A 4DSRA 3WGEA 4DSSB 3TKSC 1PL2A 4Q5NA 5A1NA 4MH3A 1ZYPA 5EY6A 1S3DA 3BJ5A 3WD6A 3V1WA 4Q5RA 5ECSA 1C72A 1OC9B 4E8HA 1YF0A 2HSMA 1J9BA 2L4QA 5IOXA 3QFAC 1U3IA 3PPUA 4MMMA 1XWAA 3FZ9A 2WRTA 2YV7A 4MA9A 5B8AA 1AC1A 1LBKA 2V6KA 4N0VA 2YANA 1M2DA 2YCDA 2XPDA 1GTAA 1OKTA 5J9CA 1Z7PA 5DAKB 1GSSA 2H19A 1YVLA 2PN8A 4MDCA 3D22A 3IHGA 4EIQA 4G19A 3MWHA 5B8BA 5CO3A 4MPGA 4BVXB 2H66A 1QFNA 1PKZA 1EV9A 3ZZXA 2E2GA 1GH2A 4JR4A 2DBCA 3HCZA 2YZHA 1Z3EA 3TKRA 5ECMB 2VUPA 2VCTA 3CXGA 1A24A 4F0CA 2YPMA 3P7XA 1M99A 2B5EA 3HDCA 5A5HB 4XS6A 4ILFA 1PL1A 3HZ4A 4XCSA 5A5KA 3A2VA 3FY7A 4K0GA 2RLIA 2H72A 3F4SA 3LG6A 3GSTA 4X43A 3O3TA 3GSSA 3MDKA 5GAND 4ACSA 1IYHA 2HQTA 1BAYA 3DMLA 2V6OA 3TB2A 6GSXA 5DJLA 1AQXA 2RUFA 22GSA 1MDJA 2C3NA 3TJGA 4G0KA 2R6KA 5DQSA 3LXTA 1SENA 3ERGA 1M9AA 3QMXA 1J0FA 5IIZA 3N5OA 3W8JA 1XWGA 1JZDA 3FR6A 2MBTA 3M0FA 4WETA 4GF0A 3CRUA 3HVVA 3DRNA 2H01A 2CZ3A 3GUSA 2K18A 2P5RA 3VURA 2J23A 4NAXA 1WRYA 3UIWA 4Z2UA 5GSTA 4YH2A 2OJLA 2HSHA 4HQZA 4QL9A 2VAFA 2FUG2 3O76A 5JCGA 3IBHA 2MMOA 2B1KA 3GA4A 1AQWA 5J41A 3I43A 4AKIA 2I4AA 2A4HA 5AN1A 5CAXA 1Z7RA 2QA1A 2RIIA 1SD8A 3BD2A 5IO2A 3IV4A 4CW9A 3L4NA 2FWFA 2M72A 1SVMA 1ST9A 3QAVA 2QA2A 3UBLA 1UVZA 5IO0A 4CHSA 3KXOA 4AJ7A 3DXBA 3CSIA 4O5QA 3GN3A 2QC7A 5J3RA 2KP1A 1SK2A 4TR4A 9GSSA 2L5LA 4F03A 1SK0A 2VIMA 3TJFA 4ZL9A 2J9HA 11GSA 2MYGA 2M80A 1ZOFA 4GRFA 1GSQA 3IPZA 3S9FA 2TRCP 4USSA 2R5GA 1G6WA 2GLRA 2KP2A 2RM6A 1OKDA 2LRTA 3EWLA 1OE7A 3E0UA 4XS4A 2CAIA 1W89A 1GUMA 4RUVA 3M8NA 2CV4A 4ICYA 1A0FA 5LCZA 4XTSA 2K9FA 4K7NA 3DGQA 3FZ4A 3PH9A 1QQ2A 5A1NB 2R4VA 1K0AA 1PMTA 2FWEA 1DE1A 2LJKA 2HFDA 1T4YA 3TKSE 2HZEB 2GQLA 2V32A 1V9WA 3HY2A 1A8YA 3IE3A 4Q5FA 1HNBA 4O5UA 3GTUA 3F4TA 1K0MA 3EMXA 3GX8A 1SL0B 1ERTA 2DIYA 1T00A 4ZL8A 2VLVA 4Z7XA 2NBSA 2GSTA 4IQAA 1MD4A 2DJ3A 3EURA 5ECLB 4ECJA 1V57A 5FWGA 4AGSA 6GSSA 2O5VA 4MK3A 2I9HA 4NHWA 5CNWA 4HUAA 3VWUA 4PNGA 3F3RA 3MYDA 2HSYA 1HYUA 3EVIA 3EYTA 4KNDA 1PQNA 2XHFA 5A4UA 4OCEA 4KF9A 3F0IA 5H5RA 3TKPA 1VRSD 2PPTA 3GFKA 4OFTA 1NHOA 2GZZA 1TJDA 2OACA 2H1BA 1TRSA 1O85A 3M1GA 4KUNA 5JCUA 4BPYA 2N5BA 4RQXA 1K0CA 1EEJA 3EINA 3F9UA 3TJJA 4MZWA 2BJXA 1HNAA 2K8VA 3WT1A 1SKRB 2QGVA 3EC3A 4K9ZA 2ON7A 3TKSA 1KTEA 1LU4A 4ZB7A 4GQCA 4GTUA 4GDFA 3CTFA 3H79A 4KDYA 3MIXA 1EOHA 3HYPA 2EFHA 1ZL9A 1B48A 3JCML 2IPAA 3D5JA 3SBCA 3TRXA 5AIXA 12GSA 4IJIA 4N30A 2GQMA 4PUAA 5ECRB 5HR2A 4MJAA 1U88A 1EEMA 2C0EA 3UAPA 2C0DA 4EDYA 3L0HA 1KBNA 5FT3A 3BCIA 5AIVA 5IQYA 5ELAA 2OBIA 4K1FA 2DJJA 2EFDA 3WGDA 3ZITA 1MDIA 3A2WA 2Z9SA 1UA5A 1B8XA 2C4JA 3C8EA 1T3BA 3QCPA 2E0QA 3ISOA 3C7MA 4KW6A 3UMAA 5DAKA 2HT9A 3D4TA 3VWWA 1TDIA 5F07A 1Z5YE 4MJCA 1QXHA 2LQOA 3CSJA 3LFLA 4LL4B 3F8UA 2H30A 4MJBA 5KEJA 1CQHA 5KOXA 1H75A 2H0GA 2KLXA 1X9WB 1JZRA 1WIKA 4JE1A 4O92A 2NDOA 4PXOA 2REMA 2UV8G 4JBBA 2R2JA 3IXRA 4MJEA 3CTGA 3LXZA 4OMVA 1O6JA 2IMFA 4NXIA 2ON5A 1H4OA 1GSUA 3BCKA 1BJXA 4JU5A 3FR9A 4GQFA 2B5XA 3K8NA 2AJQB 2LJAA 2IN3A 2H70A 4KX4A 4FQUA 1JHBA 2BTOT 2WCIA 3KP9A 1YQ1A 1KEBA 4L5LA 5BMUA 4TVEA 2IMDA 2G0FA 4J56E 1ERWA 1GUHA 5EL8A 1TI1A 1Q4JA 1YDKA 1S3AA 4MZBA 2OA7A 4LA1A 2DJ0A 1Y6EA 2X64A 1DUGA 2LV3A 4XRAA 18GSA 2DJKA 1CQGA 5ECKB 3RPPA 2DIZA 2RUEA 4E8EA 5G1LA 5BRTA 1PX7A 3QAGA 1SJIA 3IR4A 1JLWA 1FOHA 3QPMA 2O8VB 3VPTA 1UC7A 1SK1A 2I1UA 1B4PA 5D9WA 4I6XA 3EPTA 3N9JA 1X9SB 1I5GA 3TKQA 3M9JA 2P5QA 2VL2C 2VL2A 1YEXA 4Z2RA 1AXDA 3GV1A 4ZB9A 3EU4A 2JL4A 4ULXA 3GH6A 5F05A 1TI3A 2GS3A 1EGRA 4KDXA 2PU9C 3KMNA 3GKMA 4YAPA 1YF1A 2XPEA 2K6VA 3GYKA 5EPFA 2OE3A 1OE8A 4G2EA 5DCGA 4J57E 2JADA 1PN0A 2MMZA 3HXSA 3KTBA 4DVCA 1EP8A 1DBYA 1M9BA 2IFQB 5ID2B 1PD21 4ID0A 3HVSA 5JWRB 1BQ7A 2LSTA 2WGRA 2G2QA 1BX9A 1MDKA 2C80A 4KSMA 4WBJA 1K3OA 1WE0A 1PGTA 2K8SA 4F9ZA 5GZZB 4GCIA 2OE0A 2EIQA 4J2FA 2LQQA 2LRCA 2H1LA 2CX4A 3HHVA 4HZ4A 2OT3A 4TRXA 1XZOA 3KGKA 3I6AA 1XW5A 5KN1A 2FWHA 1B9YC 4XS1A 1ERVA 5A4WA 1URMA 2VM1A 2IIYA 5J40A 4KSOA 2F9SA 4MNNA 1QUWA 1ON4A 2E2MA 1TK8B 1GTBA 3LJRA 4PURA 2VLUA 1X0RA 3CRTA 1HD2A 2HRNA 2MMNA 3CMIA 1OVNA 4Q5QA 3ZMLA 5IMVA 1PKWA 1PX6A 5LNKe 3CSHA 1ZMAA 1K0DA 4MH2A 2GDRA 2IJYA 2C3QA 2QKEA 2D2ZA 3ME8A 3DVWA 1SKSB 4DSSA 2OE1A 1R5PA 2B7JA 2GSQA 5CYYA 1SU9A 2R0CA 2A2SA 4PQHA 4PX1A 1G7OA 4ZXGA 1XVQA 3CYNA 2O85A 3EU3A 3G7JA 2KUCA 2A2RA 3HKRA 1JZWA 1THOA 2CT6A 2LKUA 4NV2A 3KMOA 3DIEA 2VD0A 1TXXA 1VF2A 4K8MA 3FEUA 3BBYA 4ECCA 2YWNA 2F8FA 4TN8A 4TXVA 1YKAA 4OO5A 4E68A 2VCQA 2MZCA 2GSSA 2OKAA 5DCHA 4N10A 3RPNA 5ECIB 2L59A 2XBQA 3DKSA 5G5EA 2DKHA 4EDZA 2DJ1A 4BVYB 3HZ8A 4F0BA 2XC2A 4K7OA 2RM5A 2N5FA 5HR0A 4HQSA 4X4JA 1XIYA 4NPBA 3KZQA 3FZ5A 2YWOA 1Y25A 3NIVA 1HNCA 2PGTA 3ZL5A 5IMFA 4RI7A 4FYCA 4JRRA 1M7TA 4I2UA 5A4VA 2EIOA 2YP6A 5COHA 2R37A 5G1KA 2VL9A 1DSBA 2WB9A 4KE3A 5CREA 4YKGA 1DE2A 2L4CA 1GSFA 1VGLA 4IELA 2VKZG 3TGZA 4OWYA 5IMAA 3DD3A 4IS0A 4MCUA 4Z2TA 5ECQB 5FHIA 5IOWA 3Q74A 4HS1A 2C0GA 1BG1A 2FHEA 1T1VA 4X0XA 1ZYNA 4O5RA 4EF0A 3J7Yk 1UN2A 3MSZA 1OC8A 4ECBA 3FR3A 2HXKA 3GKKA 5GAPD 5CRWA 3AY8A 4EO3A 4AJ6A 2H6YA 3GX0A 3VLNA 2AHEA 1JLVA 2PVOC 4K0NA 4ML1A 1A2LA 4EL1A 2R0GA 2IWTA 3ZVJD 3J7Yb 2EIRA 1YKCA 3WGXA 2A2PA 3GMFA 4ZBDA 5IM9A 1O8XA 2XBIA 1QMVA 1RK4A 6GSTA 2CA8A 3D4MA 3EMPA 5E59A 1WJKA 3ZIJA 2CVKA 3BOAA 1FOVA 4HI7A 4KDUA 1GSEA 2WFCA 1TOFA 4PQIA 3US3A 5J4UA 4IN0A 5A34A 1VF1A 5C04A 3UARA 3GTUB 1TK0B 1SJ6A 1WWJA 2H8LA 4GLTA 1M2BA 4WEYA 1YY7A 1A8LA 1G0TA 2JZRA 1U87A 4WF5A 4GWRA 1WMJA 5KN2A 4QMKA 1F9MA 3A5IA 3QFBC 4PTSA 1ZCPA 3LQ7A 5DJMA 5ENUA 3H1NA 1TK5B 4L0WA 1EWXA 2E7PA 4YKFA 1K3YA 4ECIA 5CRDA 4TR1B 3LWAA 1F37A 4MABA 4EUYA 2YWMA 3F3QA 2HNLA 1TW9A 3TJKA 5G31A 2VCVA 3F6FA 4BWSA 1V2AA 1XOBA 3U6VA 4CY6A 1GUKA 4QQ7A 4G10A 2C0FA 5KOWA 2ZUPA 3CWGA 5B7CA 1A2MA 4N3ZA 2JU5A 2DJ2A 3IK9A 5D9VA 2GT6A 3A3TA 3L9SA 5D73A 5F0GA 2H73A 1SD9A 1XCCA 4X1UA 1OYJA 1T8EB 4G01A 2WDUA 4IW9A 4V1Ap 1EZKA 4JZQA 2I3YA 2VL3A 3ERWA 4EC0A 1ML6A 1AQVA 2HI7A 4YQVA 4AI6A 4EE0A 1XW6A 1GRXA 4ZBAA 1T4ZA 1KNGA 4JR6A 1R7HA 1F2EA 2L6DA 1B9XC 5BMUB 4KCAA 5D9XA 3HMJG 4G0LA 2N5AA 1A23A 4YQUA 5G5FA 4V2LA 4XHMA 4TXOB 2H0IA 2FWGA 4GXZA 2V41A 2HE3A 1Q98A 2ES7A 3FK8A 5DVBA 5JCWA 1NW2A 2AV4A 2HZFA 2FA4A 4L8EA 2EC4A 1THXA 3H8QA 3HJPA 2C8UA 1E2YA 3GKXA 3Q18A 2LNSA 2VO4A 3KCMA 3ZTLA 4POLA 3GKNA 2H76A 3UOMA 3ZYWA 3PR8A 3C73A 1GLQA 2V2GA 1EV4A 3MNGA 3HJMA 2B7KA 2WULA 19GSA 1G7EA 4IVFA 3W8SA 3KH9A 1GSYA 5B6MA 3F63A 1XPVA 3ZFLA 1O8WA 3P2AA 5ELGA 4LMVA 1FG4A 1X5DA 4O7HA 5G30A 5DDLA 4NMUA 5IPHA 2ALBA 3IHQA 1TRWA 2NVLA 5INYA 2HRFA 1O81A 1F3AA 4EXJA 4WR4A 3KIJA 2AB6A 1Z6NA 4ZIJA 5D9TA 3TUEA 2HRKA 2PUKC 2VLTA 2H1GA 1GULA 3GH9A 4AKXB 4OO4A 3ZIVA 2MBSA 1JZOA 2X8CA 4V1Ag 3VK9A 1X5EA 1TRVA 4HJMA 1B4QA 3ZVJA 5KN0A 2R3XA 1SVOA 1HQOA 3KH7A 3GURA 2I81A 1FHEA 4NHZA 4F2IA 2KHPA 2M46A 3NOFA 2PVQA 5J47A 3E9JB 1K0OA 4IBPA 2JZSA 5DALA 2GTUA 1EGOA 4V2MA 4ZL7A 3H4KA 2FA8A 1F3BA 3UL3A 3O6TA 1V58A 7GSSA 5GSSA 1XVWA 1XOAA 3IAS2 2GSRA 3I69A 5IMCA 2UZ8A 2JSZA 2VCWA 3ZFBA 1G6YA 5IMZA 3L78A 3D0ZA 4CY8A 3LYPA 5HQPA 1VF4A 4NWYA 1N8JA 4IQ1A 4PQ1A 2H1AA 1FAAA 2C3TA 5ECHB 4AF2A 5ECNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VD1 A;  1R26 A;  1GNE A;  2PBJ A;  20GS A;  1FVK A;  4FO5 A;  1LJR A;  2B6M A;  1TU7 A;  3IOS A;  3G7I A;  2P31 A;  1FO5 A;  3G9B A;  4I8B A;  3HA9 A;  2MMA A;  1YJ6 A;  2WZ9 A;  2YN1 A;  3QD9 A;  5HFG A;  4MP4 A;  1EOG A;  4TKY A;  2WS2 A;  4XRD A;  1AIU A;  3E3E A;  4I97 A;  1K3L A;  3TCO A;  4BL7 B;  1PSQ A;  5ID2 A;  1MTC A;  4G9H A;  4BVY A;  2LEG A;  1N2A A;  3TOU A;  1W4V A;  1ZYQ B;  1GTU A;  4D73 A;  2HLS A;  4WF4 A;  1MD3 A;  2YZU A;  3GIX A;  3KP8 A;  3OR5 A;  3I9V 2;  1I9D A;  3ERF A;  1ACV A;  4ZBB A;  2CAQ A;  3FKF A;  4IGJ A;  3WYW A;  4L5O A;  1J08 A;  1FB6 A;  3LYK A;  5IPG A;  4DEJ A;  2ZCT A;  2CZ2 A;  3HJO A;  1Z6M A;  4IKH A;  3IC8 A;  3APO A;  1OAZ A;  1ILO A;  4LLR A;  2B1L A;  3LSZ A;  1PRX A;  3GL5 A;  2GGT A;  3ZRE A;  1NSW A;  2H71 A;  5AIS A;  3CBU A;  1M2A A;  1Z9H A;  4ZB8 A;  4DSQ A;  1MEK A;  3VFI A;  3U5R E;  1R4W A;  5IMD A;  2OAD A;  3GNJ A;  3LGC A;  2KOK A;  1ZGN A;  2X8G A;  1RW1 A;  2LRN A;  1BYE A;  5CP1 A;  6GSY A;  2H6Z A;  3H93 A;  1ERU A;  4POB A;  3LEF A;  1GL8 A;  1BED A;  2BMX A;  1GTI A;  3UJ1 A;  4HOJ A;  1S3C A;  4GSS A;  1AUC A;  1XW9 A;  2LJR A;  1OC9 A;  2FLS A;  1OC3 A;  13GS A;  1A0R P;  2HRK B;  4CDO A;  2GVP A;  3P8W A;  1SYR A;  2CX3 A;  3VWX A;  2F51 A;  2DML A;  1FW1 A;  3VWV A;  1QGV A;  3IK7 A;  3D6I A;  3DYR A;  3IRA A;  3M9K A;  3IAM 2;  3HVX A;  2IFQ A;  3FRC A;  1A2J A;  2FNO A;  2DC5 A;  1EP7 A;  2LUS A;  1X9M B;  1GLP A;  2YOI A;  4D73 B;  1NM3 A;  2VCX A;  2B5Y A;  4TW5 A;  4HZ2 A;  1K0B A;  1SJZ A;  2GZY A;  4HU9 A;  2NTO A;  1YZX A;  4HJ2 A;  5KN3 A;  2FCH A;  3TJB A;  2JSY A;  1ZZY A;  3FW2 A;  4RQR A;  2OBK A;  2CVB A;  3KD0 A;  4KCE A;  3SWL A;  3KTL A;  3W6G A;  3MAK A;  2HRA A;  6GSV A;  4K2D A;  1WOU A;  3R2Q A;  2C1Y A;  6GSW A;  3UVH A;  4KH7 A;  4OFN A;  5ECP B;  2H6X A;  4MLY A;  4H86 A;  2ZNM A;  3TDG A;  3DVX A;  1WPI A;  1NHY A;  2H75 A;  3APQ A;  3UVT A;  5CRH A;  2L57 A;  3A2X A;  4NV5 A;  4OD7 A;  2DSA A;  1ZYE A;  4BA7 A;  5F06 A;  4ZB6 A;  2CVD A;  2PER A;  3HD5 A;  3TRP A;  3VI7 A;  2YJH A;  1GSD A;  5JWO B;  4WBR D;  4ZIL A;  1F6M C;  2X99 A;  1U6T A;  5D93 A;  5ABR A;  4KB3 A;  1GWC A;  5LD0 A;  4IJ3 A;  1TKD B;  2FY6 A;  2H1D A;  1XWC A;  1V98 A;  2IMK A;  1GNW A;  4POK A;  2IME A;  4V2N A;  3IC4 A;  3KJY A;  1AAZ A;  4N11 A;  5ECO B;  3TOT A;  3TRQ A;  4XIH A;  1E6B A;  3UBK A;  4N0Z A;  4LL1 B;  2LTK A;  1XFL A;  3DWV A;  4MZC A;  3PGT A;  3M3M A;  4GSN A;  2GT5 A;  2TRX A;  2CQ9 A;  3KEB A;  1SL1 B;  4BL7 A;  4HU7 A;  3NZN A;  3F6D A;  3ZLP A;  3RBT A;  4LMW A;  4GST A;  2NPB A;  4EKZ A;  4I2T A;  2PWJ A;  4AJ8 A;  4K6X A;  3EE2 A;  1TTZ A;  1GP1 A;  1USB A;  1AW9 A;  5DAL B;  5B6N A;  4RI6 A;  3PIN A;  4KGI A;  2YJ7 A;  4FYB A;  2O7K A;  4FH8 A;  3R3E A;  3L9U A;  2IMI A;  3RAZ A;  1PN9 A;  2DLX A;  5JWQ B;  3D21 A;  1YEP A;  1QK8 A;  2WJU A;  3WT2 A;  3C1R A;  2FD3 A;  1O73 A;  2P0G A;  3VPQ A;  5E4W A;  5G2Z A;  4OCF A;  4TR3 A;  3A5W A;  3QOU A;  2L6C A;  4EVM A;  4BVX A;  4MF6 A;  4MPF A;  4HEA 2;  1XWK A;  1XBS A;  3KM6 A;  2GZP A;  4BWQ A;  4TOP A;  5DBQ A;  5HR3 A;  4MF7 A;  1V40 A;  1RQM A;  2L5O A;  4IP6 A;  1SKW B;  1JFU A;  2PMT A;  2HSN B;  4PUF C;  4JED A;  3APS A;  1WP0 A;  2VM2 A;  5EVO A;  3C71 A;  2YNX A;  1FB0 A;  10GS A;  4IP1 A;  1XXU A;  4XS4 B;  3FYG A;  5CRG A;  2QSI A;  5H5Q A;  3QAW A;  4KA0 A;  5D8I A;  5J9B A;  4TXO A;  5HR1 A;  14GS A;  2DMM A;  3GL3 A;  2HZE A;  3ME7 A;  1M0U A;  3P90 A;  1XWB A;  1SL2 B;  2GQK A;  6GSU A;  2X8H A;  4OFM A;  1ABA A;  2YWI A;  1PA3 A;  5AGY A;  1R5A A;  2V1M A;  2H0H A;  4L0U A;  1T7P B;  1X5C A;  2F8A A;  3C1S A;  4HDE A;  4WXT A;  2HSM B;  5HFK A;  4POM A;  2B3S A;  1TU8 A;  4MF5 A;  2YV9 A;  5F8B A;  4F82 A;  2JZT A;  2HYX A;  5C00 A;  2O87 A;  5L71 A;  1IYI A;  3RHB A;  3DEX A;  2O89 A;  2F3M A;  5D96 A;  4YQM A;  3GHA A;  3ED3 A;  1VF3 A;  1K0N A;  5J5N A;  1SYX A;  3GRX A;  4IHU A;  3Q6O A;  4O32 A;  2AAW A;  3FHK A;  4PGT A;  4K7I A;  2H74 A;  5DQY A;  3UEM A;  4KAE A;  4YAV A;  4ML6 A;  3G7Y A;  1TP9 A;  2VOC A;  16GS A;  2LNT A;  2IL3 A;  2LS5 A;  4FIW A;  4WKW A;  3ZRD A;  3LOR A;  4PNF A;  3Q19 A;  3IA1 A;  4WR5 A;  3F4R A;  4TR1 A;  1FVJ A;  2JAC A;  3QDN A;  4ISD A;  3RHC A;  1TRU A;  3ZMK A;  1O7U A;  4P3Y B;  2VCZ A;  2A4V A;  3L9V A;  2TIR A;  2FGX A;  5HFI A;  2AUV A;  1BG5 A;  3RDW A;  4I5Q A;  3QR6 A;  4FYU A;  3IDV A;  5H5S A;  3VI5 A;  4G0I A;  17GS A;  3FZA A;  8GSS A;  2AYT A;  1U3A A;  4TR0 A;  4QL7 A;  4DSR A;  3WGE A;  4DSS B;  3TKS C;  1PL2 A;  4Q5N A;  4MH3 A;  5EY6 A;  1S3D A;  3BJ5 A;  3WD6 A;  3V1W A;  4Q5R A;  5ECS A;  1C72 A;  1OC9 B;  4E8H A;  1YF0 A;  2HSM A;  1J9B A;  2L4Q A;  5IOX A;  3QFA C;  1U3I A;  3PPU A;  4MMM A;  1XWA A;  3FZ9 A;  2WRT A;  2YV7 A;  4MA9 A;  5B8A A;  1AC1 A;  1LBK A;  2V6K A;  4N0V A;  2YAN A;  1M2D A;  2YCD A;  2XPD A;  1GTA A;  1OKT A;  5J9C A;  1Z7P A;  5DAK B;  1GSS A;  2H19 A;  2PN8 A;  4MDC A;  3D22 A;  4G19 A;  3MWH A;  5B8B A;  5CO3 A;  4MPG A;  4BVX B;  2H66 A;  1QFN A;  1PKZ A;  1EV9 A;  3ZZX A;  2E2G A;  1GH2 A;  4JR4 A;  2DBC A;  3HCZ A;  2YZH A;  1Z3E A;  3TKR A;  5ECM B;  2VUP A;  2VCT A;  3CXG A;  1A24 A;  4F0C A;  2YPM A;  3P7X A;  1M99 A;  2B5E A;  3HDC A;  4XS6 A;  4ILF A;  1PL1 A;  3HZ4 A;  4XCS A;  5A5K A;  3A2V A;  3FY7 A;  4K0G A;  2RLI A;  2H72 A;  3F4S A;  3LG6 A;  3GST A;  4X43 A;  3O3T A;  3GSS A;  3MDK A;  5GAN D;  4ACS A;  1IYH A;  2HQT A;  1BAY A;  3DML A;  2V6O A;  3TB2 A;  6GSX A;  5DJL A;  1AQX A;  2RUF A;  22GS A;  1MDJ A;  2C3N A;  3TJG A;  4G0K A;  2R6K A;  5DQS A;  3LXT A;  1SEN A;  3ERG A;  1M9A A;  3QMX A;  1J0F A;  5IIZ A;  3N5O A;  3W8J A;  1XWG A;  1JZD A;  3FR6 A;  2MBT A;  3M0F A;  4WET A;  4GF0 A;  3CRU A;  3HVV A;  3DRN A;  2H01 A;  2CZ3 A;  3GUS A;  2K18 A;  2P5R A;  3VUR A;  2J23 A;  4NAX A;  1WRY A;  3UIW A;  5GST A;  4YH2 A;  2OJL A;  2HSH A;  4HQZ A;  4QL9 A;  2VAF A;  2FUG 2;  3O76 A;  5JCG A;  3IBH A;  2MMO A;  2B1K A;  3GA4 A;  1AQW A;  5J41 A;  3I43 A;  2I4A A;  5AN1 A;  5CAX A;  1Z7R A;  2RII A;  1SD8 A;  3BD2 A;  5IO2 A;  3IV4 A;  4CW9 A;  3L4N A;  2FWF A;  2M72 A;  1ST9 A;  3QAV A;  3UBL A;  1UVZ A;  5IO0 A;  4CHS A;  3KXO A;  4AJ7 A;  3DXB A;  3CSI A;  3GN3 A;  2QC7 A;  5J3R A;  2KP1 A;  1SK2 A;  4TR4 A;  9GSS A;  2L5L A;  4F03 A;  1SK0 A;  2VIM A;  3TJF A;  4ZL9 A;  2J9H A;  11GS A;  2MYG A;  2M80 A;  1ZOF A;  4GRF A;  1GSQ A;  3IPZ A;  3S9F A;  2TRC P;  4USS A;  2R5G A;  1G6W A;  2GLR A;  2KP2 A;  2RM6 A;  1OKD A;  2LRT A;  3EWL A;  1OE7 A;  3E0U A;  4XS4 A;  2CAI A;  1W89 A;  1GUM A;  4RUV A;  3M8N A;  2CV4 A;  1A0F A;  5LCZ A;  4XTS A;  2K9F A;  4K7N A;  3DGQ A;  3FZ4 A;  3PH9 A;  1QQ2 A;  2R4V A;  1K0A A;  1PMT A;  2FWE A;  1DE1 A;  2LJK A;  2HFD A;  1T4Y A;  3TKS E;  2HZE B;  2GQL A;  2V32 A;  1V9W A;  3HY2 A;  1A8Y A;  3IE3 A;  4Q5F A;  1HNB A;  3GTU A;  3F4T A;  1K0M A;  3EMX A;  3GX8 A;  1SL0 B;  1ERT A;  2DIY A;  1T00 A;  4ZL8 A;  2VLV A;  4Z7X A;  2NBS A;  2GST A;  4IQA A;  1MD4 A;  2DJ3 A;  3EUR A;  5ECL B;  4ECJ A;  1V57 A;  5FWG A;  4AGS A;  6GSS A;  4MK3 A;  2I9H A;  4NHW A;  5CNW A;  4HUA A;  3VWU A;  4PNG A;  3F3R A;  2HSY A;  1HYU A;  3EVI A;  3EYT A;  4KND A;  1PQN A;  2XHF A;  5A4U A;  4OCE A;  4KF9 A;  3F0I A;  5H5R A;  3TKP A;  1VRS D;  2PPT A;  3GFK A;  4OFT A;  1NHO A;  2GZZ A;  1TJD A;  2OAC A;  2H1B A;  1TRS A;  1O85 A;  3M1G A;  4KUN A;  5JCU A;  4BPY A;  2N5B A;  4RQX A;  1K0C A;  1EEJ A;  3EIN A;  3F9U A;  3TJJ A;  4MZW A;  2BJX A;  1HNA A;  2K8V A;  3WT1 A;  1SKR B;  2QGV A;  3EC3 A;  4K9Z A;  2ON7 A;  3TKS A;  1KTE A;  1LU4 A;  4GQC A;  4GTU A;  3CTF A;  3H79 A;  4KDY A;  1EOH A;  3HYP A;  1ZL9 A;  1B48 A;  3JCM L;  2IPA A;  3D5J A;  3SBC A;  3TRX A;  5AIX A;  12GS A;  4IJI A;  4N30 A;  2GQM A;  4PUA A;  5ECR B;  5HR2 A;  4MJA A;  1U88 A;  1EEM A;  2C0E A;  3UAP A;  2C0D A;  4EDY A;  3L0H A;  1KBN A;  5FT3 A;  3BCI A;  5AIV A;  5IQY A;  5ELA A;  2OBI A;  4K1F A;  2DJJ A;  3WGD A;  3ZIT A;  1MDI A;  3A2W A;  2Z9S A;  1UA5 A;  1B8X A;  2C4J A;  3C8E A;  1T3B A;  3QCP A;  2E0Q A;  3ISO A;  3C7M A;  4KW6 A;  3UMA A;  5DAK A;  2HT9 A;  3D4T A;  3VWW A;  1TDI A;  5F07 A;  1Z5Y E;  4MJC A;  1QXH A;  2LQO A;  3CSJ A;  3LFL A;  4LL4 B;  3F8U A;  2H30 A;  4MJB A;  5KEJ A;  1CQH A;  1H75 A;  2H0G A;  2KLX A;  1X9W B;  1JZR A;  1WIK A;  4JE1 A;  4O92 A;  2NDO A;  4PXO A;  2REM A;  4JBB A;  2R2J A;  3IXR A;  4MJE A;  3CTG A;  3LXZ A;  4OMV A;  1O6J A;  2IMF A;  4NXI A;  2ON5 A;  1H4O A;  1GSU A;  3BCK A;  1BJX A;  4JU5 A;  3FR9 A;  4GQF A;  2B5X A;  3K8N A;  2AJQ B;  2LJA A;  2IN3 A;  2H70 A;  4KX4 A;  4FQU A;  1JHB A;  2BTO T;  2WCI A;  3KP9 A;  1YQ1 A;  1KEB A;  4L5L A;  5BMU A;  4TVE A;  2IMD A;  2G0F A;  4J56 E;  1ERW A;  1GUH A;  5EL8 A;  1TI1 A;  1Q4J A;  1YDK A;  1S3A A;  4MZB A;  2OA7 A;  4LA1 A;  2DJ0 A;  1Y6E A;  2X64 A;  1DUG A;  2LV3 A;  4XRA A;  18GS A;  2DJK A;  1CQG A;  5ECK B;  3RPP A;  2DIZ A;  2RUE A;  4E8E A;  5G1L A;  1PX7 A;  3QAG A;  1SJI A;  3IR4 A;  1JLW A;  3QPM A;  2O8V B;  3VPT A;  1UC7 A;  1SK1 A;  2I1U A;  1B4P A;  5D9W A;  4I6X A;  3N9J A;  1X9S B;  1I5G A;  3TKQ A;  3M9J A;  2P5Q A;  2VL2 C;  2VL2 A;  1YEX A;  1AXD A;  3GV1 A;  4ZB9 A;  3EU4 A;  2JL4 A;  4ULX A;  3GH6 A;  5F05 A;  1TI3 A;  2GS3 A;  1EGR A;  4KDX A;  2PU9 C;  3KMN A;  3GKM A;  4YAP A;  1YF1 A;  2XPE A;  2K6V A;  3GYK A;  5EPF A;  2OE3 A;  1OE8 A;  4G2E A;  5DCG A;  4J57 E;  2JAD A;  2MMZ A;  3HXS A;  3KTB A;  4DVC A;  1EP8 A;  1DBY A;  1M9B A;  2IFQ B;  5ID2 B;  1PD2 1;  4ID0 A;  3HVS A;  5JWR B;  1BQ7 A;  2LST A;  2WGR A;  2G2Q A;  1BX9 A;  1MDK A;  2C80 A;  4KSM A;  4WBJ A;  1K3O A;  1WE0 A;  1PGT A;  2K8S A;  4F9Z A;  5GZZ B;  4GCI A;  2OE0 A;  2EIQ A;  4J2F A;  2LQQ A;  2LRC A;  2CX4 A;  3HHV A;  4HZ4 A;  4TRX A;  1XZO A;  3KGK A;  3I6A A;  1XW5 A;  5KN1 A;  2FWH A;  1B9Y C;  4XS1 A;  1ERV A;  5A4W A;  1URM A;  2VM1 A;  2IIY A;  4KSO A;  2F9S A;  1QUW A;  1ON4 A;  2E2M A;  1TK8 B;  1GTB A;  3LJR A;  4PUR A;  2VLU A;  1X0R A;  3CRT A;  1HD2 A;  2HRN A;  2MMN A;  3CMI A;  1OVN A;  4Q5Q A;  3ZML A;  5IMV A;  1PKW A;  1PX6 A;  5LNK e;  3CSH A;  1ZMA A;  1K0D A;  4MH2 A;  2GDR A;  2IJY A;  2C3Q A;  2QKE A;  2D2Z A;  3ME8 A;  3DVW A;  1SKS B;  4DSS A;  2OE1 A;  1R5P A;  2B7J A;  2GSQ A;  5CYY A;  1SU9 A;  2A2S A;  4PQH A;  4PX1 A;  1G7O A;  4ZXG A;  1XVQ A;  3CYN A;  2O85 A;  3EU3 A;  3G7J A;  2KUC A;  2A2R A;  3HKR A;  1JZW A;  1THO A;  2CT6 A;  2LKU A;  4NV2 A;  3KMO A;  3DIE A;  2VD0 A;  1TXX A;  1VF2 A;  4K8M A;  3FEU A;  3BBY A;  4ECC A;  2YWN A;  2F8F A;  4TN8 A;  4TXV A;  1YKA A;  4OO5 A;  2VCQ A;  2MZC A;  2GSS A;  2OKA A;  5DCH A;  4N10 A;  3RPN A;  5ECI B;  2L59 A;  2XBQ A;  3DKS A;  5G5E A;  4EDZ A;  2DJ1 A;  4BVY B;  3HZ8 A;  4F0B A;  2XC2 A;  4K7O A;  2RM5 A;  2N5F A;  5HR0 A;  4HQS A;  1XIY A;  4NPB A;  3KZQ A;  3FZ5 A;  2YWO A;  1Y25 A;  3NIV A;  1HNC A;  2PGT A;  3ZL5 A;  5IMF A;  4RI7 A;  4FYC A;  4JRR A;  1M7T A;  4I2U A;  5A4V A;  2EIO A;  2YP6 A;  5COH A;  2R37 A;  5G1K A;  2VL9 A;  1DSB A;  2WB9 A;  4KE3 A;  5CRE A;  1DE2 A;  2L4C A;  1GSF A;  1VGL A;  4IEL A;  4OWY A;  3TGZ A;  5IMA A;  3DD3 A;  4IS0 A;  4MCU A;  5ECQ B;  5FHI A;  5IOW A;  3Q74 A;  4HS1 A;  2C0G A;  1T1V A;  2FHE A;  4X0X A;  4O5R A;  4EF0 A;  3J7Y k;  1UN2 A;  3MSZ A;  1OC8 A;  4ECB A;  3FR3 A;  2HXK A;  3GKK A;  5GAP D;  5CRW A;  3AY8 A;  4EO3 A;  4AJ6 A;  2H6Y A;  3GX0 A;  3VLN A;  2AHE A;  1JLV A;  2PVO C;  4K0N A;  4ML1 A;  1A2L A;  4EL1 A;  2IWT A;  3ZVJ D;  3J7Y b;  2EIR A;  1YKC A;  3WGX A;  3GMF A;  4ZBD A;  5IM9 A;  1O8X A;  2XBI A;  1QMV A;  1RK4 A;  6GST A;  2CA8 A;  3D4M A;  3EMP A;  5E59 A;  1WJK A;  3ZIJ A;  2CVK A;  3BOA A;  1FOV A;  4HI7 A;  4KDU A;  1GSE A;  2WFC A;  1TOF A;  4PQI A;  3US3 A;  5J4U A;  4IN0 A;  1VF1 A;  5C04 A;  3UAR A;  3GTU B;  1TK0 B;  1SJ6 A;  1WWJ A;  2H8L A;  4GLT A;  1M2B A;  4WEY A;  1YY7 A;  1A8L A;  1G0T A;  2JZR A;  1U87 A;  4WF5 A;  4GWR A;  1WMJ A;  5KN2 A;  1F9M A;  3QFB C;  4PTS A;  1ZCP A;  3LQ7 A;  5DJM A;  5ENU A;  3H1N A;  1TK5 B;  4L0W A;  1EWX A;  2E7P A;  1K3Y A;  4ECI A;  5CRD A;  4TR1 B;  3LWA A;  1F37 A;  4MAB A;  4EUY A;  2YWM A;  3F3Q A;  2HNL A;  1TW9 A;  3TJK A;  5G31 A;  2VCV A;  3F6F A;  4BWS A;  1V2A A;  1XOB A;  3U6V A;  1GUK A;  4QQ7 A;  4G10 A;  2C0F A;  2ZUP A;  5B7C A;  1A2M A;  2JU5 A;  2DJ2 A;  3IK9 A;  5D9V A;  2GT6 A;  3A3T A;  3L9S A;  5D73 A;  5F0G A;  2H73 A;  1SD9 A;  1XCC A;  4X1U A;  1OYJ A;  1T8E B;  4V1A p;  2WDU A;  4IW9 A;  1EZK A;  4JZQ A;  2I3Y A;  2VL3 A;  3ERW A;  4EC0 A;  1ML6 A;  1AQV A;  2HI7 A;  4YQV A;  4EE0 A;  1XW6 A;  1GRX A;  4ZBA A;  1T4Z A;  1KNG A;  4JR6 A;  1R7H A;  1F2E A;  2L6D A;  1B9X C;  4KCA A;  5D9X A;  4G0L A;  2N5A A;  1A23 A;  4YQU A;  5G5F A;  4V2L A;  4XHM A;  4TXO B;  2H0I A;  2FWG A;  4GXZ A;  2V41 A;  2HE3 A;  1Q98 A;  2ES7 A;  3FK8 A;  5DVB A;  5JCW A;  1NW2 A;  2AV4 A;  2HZF A;  2FA4 A;  4L8E A;  2EC4 A;  1THX A;  3H8Q A;  3HJP A;  2C8U A;  1E2Y A;  3GKX A;  3Q18 A;  2LNS A;  2VO4 A;  3KCM A;  3ZTL A;  4POL A;  3GKN A;  2H76 A;  3UOM A;  3ZYW A;  3PR8 A;  3C73 A;  1GLQ A;  2V2G A;  1EV4 A;  3MNG A;  3HJM A;  2B7K A;  2WUL A;  19GS A;  1G7E A;  4IVF A;  3W8S A;  3KH9 A;  1GSY A;  5B6M A;  3F63 A;  1XPV A;  3ZFL A;  1O8W A;  3P2A A;  5ELG A;  4LMV A;  1FG4 A;  1X5D A;  4O7H A;  5G30 A;  5DDL A;  4NMU A;  5IPH A;  2ALB A;  3IHQ A;  1TRW A;  2NVL A;  5INY A;  2HRF A;  1O81 A;  1F3A A;  4EXJ A;  4WR4 A;  3KIJ A;  2AB6 A;  1Z6N A;  4ZIJ A;  5D9T A;  3TUE A;  2HRK A;  2PUK C;  2VLT A;  2H1G A;  1GUL A;  3GH9 A;  4OO4 A;  3ZIV A;  2MBS A;  1JZO A;  2X8C A;  4V1A g;  3VK9 A;  1X5E A;  1TRV A;  4HJM A;  1B4Q A;  3ZVJ A;  5KN0 A;  2R3X A;  1HQO A;  3KH7 A;  3GUR A;  2I81 A;  1FHE A;  4NHZ A;  4F2I A;  2KHP A;  2M46 A;  3NOF A;  2PVQ A;  3E9J B;  1K0O A;  4IBP A;  2JZS A;  5DAL A;  2GTU A;  1EGO A;  4V2M A;  4ZL7 A;  3H4K A;  2FA8 A;  1F3B A;  3UL3 A;  3O6T A;  1V58 A;  7GSS A;  5GSS A;  1XVW A;  1XOA A;  3IAS 2;  2GSR A;  3I69 A;  5IMC A;  2UZ8 A;  2JSZ A;  2VCW A;  3ZFB A;  1G6Y A;  5IMZ A;  3L78 A;  3D0Z A;  3LYP A;  5HQP A;  1VF4 A;  4NWY A;  1N8J A;  4IQ1 A;  4PQ1 A;  2H1A A;  1FAA A;  2C3T A;  5ECH B;  4AF2 A;  5ECN B; 
#chains in the Genus database with same CATH topology
 2VD1 A;  1R26 A;  1GNE A;  2PBJ A;  20GS A;  1FVK A;  4FO5 A;  1LJR A;  2B6M A;  1TU7 A;  3IOS A;  3G7I A;  2P31 A;  1FO5 A;  3G9B A;  2WW2 A;  4I8B A;  3HA9 A;  2MMA A;  1YJ6 A;  2WZ9 A;  2YN1 A;  3QD9 A;  5HFG A;  4MP4 A;  1EOG A;  4TKY A;  2WS2 A;  4XRD A;  1AIU A;  3E3E A;  4I97 A;  1K3L A;  3TCO A;  4BL7 B;  1PSQ A;  5ID2 A;  1MTC A;  4G9H A;  3RFR C;  4BVY A;  2LEG A;  1N2A A;  3TOU A;  1W4V A;  1ZYQ B;  1GTU A;  4D73 A;  2HLS A;  4WF4 A;  1MD3 A;  2WW1 A;  2YZU A;  3GIX A;  3KP8 A;  3OR5 A;  3I9V 2;  1I9D A;  3ERF A;  1ACV A;  4ZBB A;  2CAQ A;  3FKF A;  4IGJ A;  3WYW A;  4L5O A;  1J08 A;  1FB6 A;  4K5S A;  3LYK A;  5IPG A;  4DEJ A;  2ZCT A;  2CZ2 A;  3HJO A;  1Z6M A;  4IKH A;  3IC8 A;  3APO A;  1OAZ A;  1ILO A;  4LLR A;  2B1L A;  3LSZ A;  1PRX A;  3GL5 A;  2GGT A;  3ZRE A;  1NSW A;  3TU3 B;  2H71 A;  5AIS A;  2X4A A;  3CBU A;  1M2A A;  1Z9H A;  4ZB8 A;  4EIP A;  4DSQ A;  1MEK A;  3VFI A;  4AKG A;  3U5R E;  1R4W A;  5IMD A;  2OAD A;  3GNJ A;  3LGC A;  2KOK A;  1ZGN A;  2X8G A;  1RW1 A;  2LRN A;  1BYE A;  5CP1 A;  6GSY A;  2H6Z A;  3H93 A;  1ERU A;  4A5P A;  4POB A;  3LEF A;  1GL8 A;  1BED A;  2BMX A;  1GTI A;  3UJ1 A;  4HOJ A;  1S3C A;  4GSS A;  1AUC A;  1XW9 A;  2LJR A;  1OC9 A;  2X49 A;  2FLS A;  1OC3 A;  13GS A;  1A0R P;  2HRK B;  4CDO A;  3RGB C;  2GVP A;  3P8W A;  1SYR A;  2CX3 A;  3VWX A;  2F51 A;  2DML A;  4FXY P;  1FW1 A;  3VWV A;  1QGV A;  3IK7 A;  3D6I A;  3DYR A;  3IRA A;  3M9K A;  3IAM 2;  3HVX A;  2IFQ A;  3FRC A;  1A2J A;  2FNO A;  2DC5 A;  1EP7 A;  2LUS A;  1X9M B;  1GLP A;  2YOI A;  4K2X A;  4D73 B;  1NM3 A;  2VCX A;  2B5Y A;  4TW5 A;  4HZ2 A;  1K0B A;  1SJZ A;  2GZY A;  4HU9 A;  2NTO A;  1YZX A;  4HJ2 A;  5KN3 A;  2FCH A;  3TJB A;  2JSY A;  1ZZY A;  3FW2 A;  4RQR A;  2OBK A;  2CVB A;  3KD0 A;  4KCE A;  3SWL A;  3KTL A;  3W6G A;  3MAK A;  2HRA A;  6GSV A;  4K2D A;  1WOU A;  3R2Q A;  2C1Y A;  6GSW A;  3UVH A;  4KH7 A;  4OFN A;  5ECP B;  2H6X A;  4MLY A;  4H86 A;  2ZNM A;  3TDG A;  4W66 A;  3DVX A;  1WPI A;  1NHY A;  2H75 A;  3APQ A;  3UVT A;  5CRH A;  2L57 A;  3A2X A;  4NV5 A;  4OD7 A;  2DSA A;  2WVZ A;  1ZYE A;  4BA7 A;  5F06 A;  4ZB6 A;  2CVD A;  2PER A;  1BF5 A;  3HD5 A;  3TRP A;  3VI7 A;  4AKH A;  2YJH A;  1GSD A;  5JWO B;  4WBR D;  4ZIL A;  1F6M C;  2X99 A;  5J4Y A;  1U6T A;  5D93 A;  5ABR A;  4KB3 A;  1GWC A;  5LD0 A;  4IJ3 A;  1TKD B;  2FY6 A;  2H1D A;  1XWC A;  1V98 A;  2IMK A;  1GNW A;  3CHX C;  4POK A;  2IME A;  4V2N A;  3IC4 A;  3KJY A;  1AAZ A;  4N11 A;  5ECO B;  3TOT A;  3TRQ A;  4XIH A;  2HSN A;  1E6B A;  3UBK A;  4N0Z A;  4LL1 B;  2R0P A;  2LTK A;  1XFL A;  4MZC A;  3DWV A;  3PGT A;  3M3M A;  1N25 A;  4GSN A;  2GT5 A;  2TRX A;  2CQ9 A;  3KEB A;  1SL1 B;  4BL7 A;  4HU7 A;  3LW9 A;  3NZN A;  3F6D A;  3ZLP A;  3RBT A;  4LMW A;  4GST A;  2NPB A;  4EKZ A;  4I2T A;  2PWJ A;  4AJ8 A;  4K6X A;  3EE2 A;  1TTZ A;  1GP1 A;  1USB A;  1AW9 A;  5DAL B;  5B6N A;  4RI6 A;  3PIN A;  4KGI A;  2YJ7 A;  4FYB A;  2O7K A;  5J4V A;  4FH8 A;  3R3E A;  3L9U A;  2IMI A;  3RAZ A;  2WW3 A;  1I1I P;  1PN9 A;  2DLX A;  5JWQ B;  3D21 A;  1YEP A;  1QK8 A;  2WJU A;  3WT2 A;  3C1R A;  2FD3 A;  1O73 A;  2P0G A;  3VPQ A;  5E4W A;  5G2Z A;  5A5H A;  4OCF A;  4TR3 A;  3A5W A;  3QOU A;  2L6C A;  2DKI A;  4EVM A;  4BVX A;  4MF6 A;  4MPF A;  4HEA 2;  1XWK A;  1XBS A;  3KM6 A;  2GZP A;  4BWQ A;  4TOP A;  5DBQ A;  5HR3 A;  4MF7 A;  1V40 A;  1RQM A;  2L5O A;  4IP6 A;  1SVL A;  1SKW B;  1JFU A;  2PMT A;  2HSN B;  4PUF C;  4JED A;  3APS A;  1WP0 A;  2VM2 A;  5EVO A;  3C71 A;  2YNX A;  1FB0 A;  10GS A;  4IP1 A;  1XXU A;  4XS4 B;  3FYG A;  5CRG A;  2QSI A;  5H5Q A;  3QAW A;  4KA0 A;  5D8I A;  5J9B A;  4TXO A;  5HR1 A;  14GS A;  2DMM A;  3GL3 A;  2HZE A;  3ME7 A;  1M0U A;  4PHZ C;  3P90 A;  1XWB A;  1SL2 B;  2GQK A;  6GSU A;  2X8H A;  2O36 A;  4OFM A;  1ABA A;  2YWI A;  1PA3 A;  5AGY A;  1R5A A;  2V1M A;  2H0H A;  4L0U A;  1T7P B;  1X5C A;  2F8A A;  3C1S A;  4HDE A;  4WXT A;  2HSM B;  5HFK A;  4POM A;  2B3S A;  1TU8 A;  4MF5 A;  2YV9 A;  2EFC A;  5F8B A;  4F82 A;  2JZT A;  2HYX A;  5C00 A;  2O87 A;  5L71 A;  1IYI A;  3RHB A;  3DEX A;  2O89 A;  2EFE A;  2F3M A;  1Y1U A;  5D96 A;  4YQM A;  3GHA A;  3ED3 A;  1VF3 A;  1K0N A;  5J5N A;  1SYX A;  3GRX A;  4IHU A;  3Q6O A;  4O32 A;  2AAW A;  3FHK A;  4PGT A;  4K7I A;  2H74 A;  5DQY A;  3UEM A;  4KAE A;  4YAV A;  4ML6 A;  3G7Y A;  1TP9 A;  2VOC A;  16GS A;  4K5R A;  3FMW A;  2LNT A;  2IL3 A;  2LS5 A;  4FIW A;  4WKW A;  3ZRD A;  3LOR A;  4PNF A;  5A34 B;  3Q19 A;  3IA1 A;  4WR5 A;  3F4R A;  4TR1 A;  1FVJ A;  2JAC A;  3QDN A;  4ISD A;  3RHC A;  1TRU A;  3ZMK A;  1O7U A;  4P3Y B;  2VCZ A;  2A4V A;  3L9V A;  2TIR A;  2FGX A;  5HFI A;  2AUV A;  1BG5 A;  3RDW A;  4I5Q A;  1TXU A;  3QR6 A;  4FYU A;  3IDV A;  5H5S A;  3VI5 A;  4G0I A;  17GS A;  3FZA A;  8GSS A;  2AYT A;  1U3A A;  4TR0 A;  4QL7 A;  4DSR A;  3WGE A;  4DSS B;  3TKS C;  1PL2 A;  4Q5N A;  5A1N A;  4MH3 A;  1ZYP A;  5EY6 A;  1S3D A;  3BJ5 A;  3WD6 A;  3V1W A;  4Q5R A;  5ECS A;  1C72 A;  1OC9 B;  4E8H A;  1YF0 A;  2HSM A;  1J9B A;  2L4Q A;  5IOX A;  1M3J A;  3QFA C;  1U3I A;  3PPU A;  4MMM A;  1XWA A;  3FZ9 A;  2WRT A;  2YV7 A;  4MA9 A;  5B8A A;  1AC1 A;  1LBK A;  2V6K A;  4N0V A;  2YAN A;  1M2D A;  2YCD A;  2XPD A;  1GTA A;  1OKT A;  5J9C A;  1Z7P A;  5DAK B;  1GSS A;  2H19 A;  1YVL A;  2PN8 A;  4MDC A;  3D22 A;  3IHG A;  4EIQ A;  4G19 A;  3MWH A;  2WVX B;  5B8B A;  5CO3 A;  4MPG A;  4BVX B;  2H66 A;  1QFN A;  1PKZ A;  1EV9 A;  3ZZX A;  2E2G A;  1GH2 A;  4JR4 A;  2DBC A;  3HCZ A;  2YZH A;  1Z3E A;  3TKR A;  5ECM B;  2VUP A;  2VCT A;  3CXG A;  1A24 A;  4F0C A;  2WW0 A;  2YPM A;  3P7X A;  1M99 A;  2B5E A;  3HDC A;  5A5H B;  4XS6 A;  4ILF A;  1PL1 A;  3HZ4 A;  4XCS A;  5A5K A;  3A2V A;  3FY7 A;  4K0G A;  2RLI A;  2H72 A;  3F4S A;  3LG6 A;  3GST A;  4X43 A;  3O3T A;  2O3E A;  3GSS A;  3MDK A;  5GAN D;  4ACS A;  1IYH A;  2HQT A;  1BAY A;  3DML A;  2V6O A;  3TB2 A;  6GSX A;  5DJL A;  1AQX A;  2RUF A;  22GS A;  1MDJ A;  2C3N A;  3TJG A;  4G0K A;  2R6K A;  5DQS A;  4HSC X;  3LXT A;  1SEN A;  3ERG A;  1M9A A;  3QMX A;  1J0F A;  5IIZ A;  3N5O A;  3W8J A;  1XWG A;  1JZD A;  3FR6 A;  2MBT A;  3M0F A;  4WET A;  4GF0 A;  3CRU A;  3HVV A;  3DRN A;  2H01 A;  2CZ3 A;  3GUS A;  2K18 A;  2P5R A;  3VUR A;  2J23 A;  4NAX A;  1WRY A;  3UIW A;  4Z2U A;  5GST A;  4YH2 A;  2OJL A;  2HSH A;  4HQZ A;  4QL9 A;  2VAF A;  2FUG 2;  3O76 A;  5JCG A;  3IBH A;  2MMO A;  2B1K A;  3GA4 A;  1AQW A;  5J41 A;  3I43 A;  4AKI A;  2I4A A;  2A4H A;  5AN1 A;  5CAX A;  1Z7R A;  2QA1 A;  2RII A;  1SD8 A;  3BD2 A;  5IO2 A;  3IV4 A;  4CW9 A;  3L4N A;  2FWF A;  2M72 A;  1SVM A;  1ST9 A;  3QAV A;  2QA2 A;  3UBL A;  1UVZ A;  5IO0 A;  4CHS A;  3KXO A;  4AJ7 A;  3DXB A;  3CSI A;  4O5Q A;  3GN3 A;  2QC7 A;  5J3R A;  2KP1 A;  1SK2 A;  4TR4 A;  9GSS A;  2L5L A;  4F03 A;  1SK0 A;  2VIM A;  3TJF A;  4ZL9 A;  2J9H A;  11GS A;  2MYG A;  2M80 A;  1ZOF A;  4GRF A;  1GSQ A;  3IPZ A;  3S9F A;  2TRC P;  4USS A;  2R5G A;  1G6W A;  2GLR A;  2KP2 A;  2RM6 A;  1OKD A;  2LRT A;  3EWL A;  1OE7 A;  3E0U A;  4XS4 A;  2CAI A;  1W89 A;  1GUM A;  4RUV A;  3M8N A;  2CV4 A;  4ICY A;  1A0F A;  5LCZ A;  4XTS A;  2K9F A;  4K7N A;  3DGQ A;  3FZ4 A;  3PH9 A;  1QQ2 A;  5A1N B;  2R4V A;  1K0A A;  1PMT A;  2FWE A;  1DE1 A;  2LJK A;  2HFD A;  1T4Y A;  3TKS E;  2HZE B;  2GQL A;  2V32 A;  1V9W A;  3HY2 A;  1A8Y A;  3IE3 A;  4Q5F A;  1HNB A;  4O5U A;  3GTU A;  3F4T A;  1K0M A;  3EMX A;  3GX8 A;  1SL0 B;  1ERT A;  2DIY A;  1T00 A;  4ZL8 A;  2VLV A;  4Z7X A;  2NBS A;  2GST A;  4IQA A;  1MD4 A;  2DJ3 A;  3EUR A;  5ECL B;  4ECJ A;  1V57 A;  5FWG A;  4AGS A;  6GSS A;  2O5V A;  4MK3 A;  2I9H A;  4PI2 C;  4NHW A;  5CNW A;  4HUA A;  3VWU A;  4PNG A;  3F3R A;  3MYD A;  2HSY A;  1HYU A;  3EVI A;  3EYT A;  4KND A;  1PQN A;  2XHF A;  5A4U A;  4OCE A;  4KF9 A;  3F0I A;  5H5R A;  3TKP A;  1VRS D;  2PPT A;  3GFK A;  4OFT A;  1NHO A;  2GZZ A;  1TJD A;  2OAC A;  2H1B A;  1TRS A;  1O85 A;  3M1G A;  4KUN A;  5JCU A;  4BPY A;  2N5B A;  4RQX A;  1K0C A;  1EEJ A;  3EIN A;  3F9U A;  3TJJ A;  4MZW A;  2BJX A;  1HNA A;  2K8V A;  3WT1 A;  1SKR B;  2QGV A;  3EC3 A;  4K9Z A;  2ON7 A;  3TKS A;  1KTE A;  1LU4 A;  4ZB7 A;  4GQC A;  4GTU A;  4GDF A;  3CTF A;  3H79 A;  4KDY A;  3MIX A;  1EOH A;  3HYP A;  2EFH A;  1ZL9 A;  1B48 A;  3JCM L;  2IPA A;  3D5J A;  3SBC A;  3TRX A;  5AIX A;  12GS A;  4IJI A;  4N30 A;  2GQM A;  4PUA A;  5ECR B;  5HR2 A;  4MJA A;  1U88 A;  1EEM A;  2C0E A;  3UAP A;  2C0D A;  4EDY A;  3L0H A;  1KBN A;  5FT3 A;  3BCI A;  5AIV A;  5IQY A;  5ELA A;  2OBI A;  4K1F A;  2DJJ A;  2EFD A;  3WGD A;  3ZIT A;  1MDI A;  3A2W A;  2Z9S A;  1UA5 A;  1B8X A;  2C4J A;  3C8E A;  1T3B A;  3QCP A;  2E0Q A;  3ISO A;  3C7M A;  4KW6 A;  3CQF A;  3UMA A;  5DAK A;  2HT9 A;  3D4T A;  3VWW A;  1TDI A;  5F07 A;  1Z5Y E;  4MJC A;  1QXH A;  2LQO A;  3CSJ A;  3LFL A;  4LL4 B;  3F8U A;  2H30 A;  4MJB A;  5KEJ A;  1CQH A;  5KOX A;  1H75 A;  2H0G A;  2KLX A;  1X9W B;  1JZR A;  1WIK A;  4JE1 A;  4O92 A;  2NDO A;  4PXO A;  2REM A;  2UV8 G;  4JBB A;  2R2J A;  3IXR A;  4MJE A;  3CTG A;  3LXZ A;  4OMV A;  1O6J A;  2IMF A;  4NXI A;  2ON5 A;  1H4O A;  1GSU A;  3BCK A;  1BJX A;  4JU5 A;  3FR9 A;  4GQF A;  2B5X A;  3K8N A;  2AJQ B;  2LJA A;  2IN3 A;  2H70 A;  4KX4 A;  4FQU A;  1JHB A;  2BTO T;  2WCI A;  3KP9 A;  1YQ1 A;  1KEB A;  4L5L A;  5BMU A;  4TVE A;  2IMD A;  2G0F A;  4J56 E;  1ERW A;  1GUH A;  5EL8 A;  1TI1 A;  1Q4J A;  1YDK A;  1S3A A;  4MZB A;  2OA7 A;  1PFO A;  4LA1 A;  2DJ0 A;  1Y6E A;  2X64 A;  1DUG A;  2LV3 A;  4XRA A;  18GS A;  2DJK A;  1CQG A;  5ECK B;  3RPP A;  2DIZ A;  2RUE A;  4E8E A;  5G1L A;  5BRT A;  1PX7 A;  3QAG A;  1SJI A;  3IR4 A;  1JLW A;  1FOH A;  3QPM A;  2O8V B;  3VPT A;  1UC7 A;  1SK1 A;  2I1U A;  1B4P A;  5D9W A;  4I6X A;  3EPT A;  3N9J A;  1X9S B;  1I5G A;  3TKQ A;  3M9J A;  2P5Q A;  2VL2 C;  2VL2 A;  1YEX A;  4Z2R A;  1AXD A;  3GV1 A;  4ZB9 A;  3EU4 A;  2JL4 A;  4ULX A;  3GH6 A;  5F05 A;  1TI3 A;  2GS3 A;  1S4B P;  1EGR A;  2WVY A;  4KDX A;  2PU9 C;  3KMN A;  3GKM A;  4YAP A;  1YF1 A;  2XPE A;  2K6V A;  3GYK A;  5EPF A;  2OE3 A;  1OE8 A;  4G2E A;  5DCG A;  4J57 E;  2JAD A;  1PN0 A;  2MMZ A;  3HXS A;  3KTB A;  4DVC A;  1EP8 A;  1DBY A;  1M9B A;  2IFQ B;  5ID2 B;  1PD2 1;  4ID0 A;  3HVS A;  5JWR B;  1BQ7 A;  2LST A;  2WGR A;  2G2Q A;  1BX9 A;  1MDK A;  2C80 A;  4KSM A;  4WBJ A;  1K3O A;  1WE0 A;  1PGT A;  2K8S A;  4F9Z A;  5GZZ B;  4GCI A;  2OE0 A;  2EIQ A;  4J2F A;  2LQQ A;  2LRC A;  2H1L A;  2CX4 A;  1S3R A;  3HHV A;  4HZ4 A;  2OT3 A;  4TRX A;  1XZO A;  3KGK A;  3I6A A;  1XW5 A;  5KN1 A;  2FWH A;  1B9Y C;  4XS1 A;  1ERV A;  5A4W A;  1URM A;  2VM1 A;  2IIY A;  5J40 A;  4KSO A;  2F9S A;  4MNN A;  1QUW A;  1ON4 A;  2E2M A;  3HVN A;  1TK8 B;  1GTB A;  3LJR A;  4PUR A;  2VLU A;  1X0R A;  3CRT A;  1YEW C;  1HD2 A;  1XG8 A;  2HRN A;  2MMN A;  3CMI A;  1OVN A;  4Q5Q A;  3ZML A;  5IMV A;  1PKW A;  1PX6 A;  5LNK e;  3CSH A;  1ZMA A;  1K0D A;  4MH2 A;  2GDR A;  2IJY A;  2C3Q A;  2QKE A;  2D2Z A;  3ME8 A;  3DVW A;  1SKS B;  4DSS A;  2OE1 A;  1R5P A;  2B7J A;  2GSQ A;  2WZS A;  5CYY A;  1SU9 A;  2R0C A;  2A2S A;  4PQH A;  4PX1 A;  1G7O A;  4ZXG A;  1XVQ A;  3CYN A;  2O85 A;  3EU3 A;  3G7J A;  2KUC A;  2A2R A;  3HKR A;  1JZW A;  1THO A;  2CT6 A;  2LKU A;  4NV2 A;  3KMO A;  3DIE A;  2VD0 A;  1TXX A;  1VF2 A;  4K8M A;  3FEU A;  3BBY A;  4ECC A;  2YWN A;  2F8F A;  4TN8 A;  4TXV A;  1YKA A;  4OO5 A;  4E68 A;  2VCQ A;  2MZC A;  2GSS A;  2OKA A;  5DCH A;  4N10 A;  3RPN A;  5ECI B;  2L59 A;  2XBQ A;  3DKS A;  5G5E A;  2DKH A;  4EDZ A;  2DJ1 A;  4BVY B;  3HZ8 A;  4F0B A;  2XC2 A;  4K7O A;  2RM5 A;  2N5F A;  5HR0 A;  4HQS A;  4X4J A;  1XIY A;  4NPB A;  3KZQ A;  3FZ5 A;  2YWO A;  1Y25 A;  3NIV A;  1HNC A;  2PGT A;  3ZL5 A;  5IMF A;  4RI7 A;  4FYC A;  4JRR A;  1M7T A;  4I2U A;  5A4V A;  2EIO A;  2YP6 A;  5COH A;  2R37 A;  5G1K A;  2VL9 A;  1DSB A;  2WB9 A;  4KE3 A;  5CRE A;  4YKG A;  1DE2 A;  2L4C A;  1GSF A;  1VGL A;  4IEL A;  2VKZ G;  3TGZ A;  4OWY A;  5IMA A;  3DD3 A;  4IS0 A;  4MCU A;  4Z2T A;  5ECQ B;  5FHI A;  5IOW A;  3Q74 A;  4HS1 A;  2C0G A;  1BG1 A;  2FHE A;  1T1V A;  4X0X A;  1ZYN A;  4O5R A;  4EF0 A;  3J7Y k;  1UN2 A;  3MSZ A;  1OC8 A;  4ECB A;  3FR3 A;  2HXK A;  3GKK A;  5GAP D;  5CRW A;  3AY8 A;  4EO3 A;  4AJ6 A;  2H6Y A;  3GX0 A;  3VLN A;  2AHE A;  1JLV A;  2PVO C;  4K0N A;  4ML1 A;  1A2L A;  4EL1 A;  2R0G A;  2IWT A;  3ZVJ D;  3J7Y b;  2EIR A;  1YKC A;  3WGX A;  2A2P A;  3GMF A;  4ZBD A;  5IM9 A;  1O8X A;  2XBI A;  1QMV A;  1RK4 A;  6GST A;  2CA8 A;  3D4M A;  3EMP A;  5E59 A;  1WJK A;  3ZIJ A;  2CVK A;  3BOA A;  1FOV A;  4HI7 A;  4KDU A;  1GSE A;  2WFC A;  1TOF A;  4PQI A;  3US3 A;  5J4U A;  4IN0 A;  5A34 A;  1VF1 A;  5C04 A;  3UAR A;  3GTU B;  1TK0 B;  1SJ6 A;  1WWJ A;  2H8L A;  4GLT A;  1M2B A;  4WEY A;  1YY7 A;  1A8L A;  1G0T A;  2JZR A;  1U87 A;  4WF5 A;  4GWR A;  1WMJ A;  5KN2 A;  4QMK A;  1F9M A;  3A5I A;  3QFB C;  4PTS A;  1ZCP A;  3LQ7 A;  5DJM A;  5ENU A;  3H1N A;  1TK5 B;  4L0W A;  1EWX A;  2E7P A;  4YKF A;  1K3Y A;  4ECI A;  5CRD A;  4TR1 B;  3LWA A;  1F37 A;  4MAB A;  4EUY A;  2YWM A;  3F3Q A;  2HNL A;  1TW9 A;  3TJK A;  5G31 A;  2VCV A;  3F6F A;  4BWS A;  1V2A A;  1XOB A;  3U6V A;  4CY6 A;  1GUK A;  4QQ7 A;  4G10 A;  2C0F A;  5KOW A;  2ZUP A;  3CWG A;  5B7C A;  1A2M A;  4N3Z A;  2JU5 A;  2DJ2 A;  3IK9 A;  5D9V A;  2GT6 A;  3A3T A;  3L9S A;  5D73 A;  5F0G A;  2H73 A;  1SD9 A;  1XCC A;  4X1U A;  1OYJ A;  1T8E B;  4G01 A;  2WDU A;  4IW9 A;  4V1A p;  1EZK A;  4JZQ A;  2I3Y A;  2VL3 A;  3ERW A;  4EC0 A;  1ML6 A;  1AQV A;  2HI7 A;  4YQV A;  4AI6 A;  4EE0 A;  1XW6 A;  1GRX A;  4ZBA A;  1T4Z A;  1KNG A;  4JR6 A;  1R7H A;  1F2E A;  2L6D A;  1B9X C;  5BMU B;  4KCA A;  5D9X A;  3HMJ G;  4G0L A;  4PI0 C;  2N5A A;  1A23 A;  4YQU A;  5G5F A;  4V2L A;  2WVX A;  4XHM A;  4TXO B;  2H0I A;  2FWG A;  4GXZ A;  2V41 A;  2HE3 A;  1Q98 A;  2ES7 A;  3FK8 A;  5DVB A;  5JCW A;  1NW2 A;  2AV4 A;  2HZF A;  2FA4 A;  4L8E A;  2EC4 A;  1THX A;  3H8Q A;  3HJP A;  2C8U A;  1E2Y A;  3GKX A;  3Q18 A;  2LNS A;  2VO4 A;  1M3I A;  3KCM A;  3ZTL A;  4POL A;  3GKN A;  2H76 A;  3UOM A;  3ZYW A;  3PR8 A;  3C73 A;  1GLQ A;  2V2G A;  1EV4 A;  3MNG A;  3HJM A;  2B7K A;  2WUL A;  19GS A;  1G7E A;  4IVF A;  3W8S A;  3KH9 A;  1GSY A;  5B6M A;  3F63 A;  1XPV A;  3ZFL A;  1O8W A;  3P2A A;  5ELG A;  4LMV A;  1FG4 A;  1X5D A;  4O7H A;  5G30 A;  5DDL A;  4NMU A;  5IPH A;  2ALB A;  3IHQ A;  1TRW A;  2NVL A;  5INY A;  2HRF A;  1O81 A;  1F3A A;  4EXJ A;  4WR4 A;  3KIJ A;  2AB6 A;  1Z6N A;  4ZIJ A;  5D9T A;  3TUE A;  2HRK A;  2PUK C;  2VLT A;  2H1G A;  1GUL A;  3GH9 A;  4AKX B;  4OO4 A;  3ZIV A;  2MBS A;  1JZO A;  2X8C A;  4V1A g;  3VK9 A;  1X5E A;  1TRV A;  4HJM A;  1B4Q A;  3ZVJ A;  5KN0 A;  2R3X A;  1SVO A;  1HQO A;  3KH7 A;  3GUR A;  2I81 A;  1FHE A;  4NHZ A;  4F2I A;  2KHP A;  2M46 A;  3NOF A;  2PVQ A;  5J47 A;  3E9J B;  1K0O A;  4BIK A;  4IBP A;  2JZS A;  5DAL A;  2GTU A;  1EGO A;  4V2M A;  4ZL7 A;  3H4K A;  2FA8 A;  1F3B A;  3UL3 A;  3O6T A;  1V58 A;  7GSS A;  5GSS A;  1XVW A;  1XOA A;  3IAS 2;  2GSR A;  3I69 A;  5IMC A;  2UZ8 A;  2JSZ A;  2VCW A;  3ZFB A;  1G6Y A;  5IMZ A;  3L78 A;  3D0Z A;  4CY8 A;  3LYP A;  5HQP A;  1VF4 A;  4NWY A;  1N8J A;  4IQ1 A;  4PQ1 A;  2H1A A;  1FAA A;  2C3T A;  5ECH B;  4AF2 A;  5ECN B; 
#chains in the Genus database with same CATH homology
 2VD1 A;  1R26 A;  1GNE A;  2PBJ A;  20GS A;  1FVK A;  4FO5 A;  1LJR A;  2B6M A;  1TU7 A;  3IOS A;  3G7I A;  2P31 A;  1FO5 A;  3G9B A;  4I8B A;  3HA9 A;  2MMA A;  1YJ6 A;  2WZ9 A;  2YN1 A;  3QD9 A;  5HFG A;  4MP4 A;  1EOG A;  4TKY A;  2WS2 A;  4XRD A;  1AIU A;  3E3E A;  4I97 A;  1K3L A;  3TCO A;  4BL7 B;  1PSQ A;  5ID2 A;  1MTC A;  4G9H A;  4BVY A;  2LEG A;  1N2A A;  3TOU A;  1W4V A;  1ZYQ B;  1GTU A;  4D73 A;  2HLS A;  4WF4 A;  1MD3 A;  2YZU A;  3GIX A;  3KP8 A;  3OR5 A;  3I9V 2;  1I9D A;  3ERF A;  1ACV A;  4ZBB A;  2CAQ A;  3FKF A;  4IGJ A;  3WYW A;  4L5O A;  1J08 A;  1FB6 A;  4K5S A;  3LYK A;  5IPG A;  4DEJ A;  2ZCT A;  2CZ2 A;  3HJO A;  1Z6M A;  4IKH A;  3IC8 A;  3APO A;  1OAZ A;  1ILO A;  4LLR A;  2B1L A;  3LSZ A;  1PRX A;  3GL5 A;  2GGT A;  3ZRE A;  1NSW A;  3TU3 B;  2H71 A;  5AIS A;  2X4A A;  3CBU A;  1M2A A;  1Z9H A;  4ZB8 A;  4EIP A;  4DSQ A;  1MEK A;  3VFI A;  4AKG A;  3U5R E;  1R4W A;  5IMD A;  2OAD A;  3GNJ A;  3LGC A;  2KOK A;  1ZGN A;  2X8G A;  1RW1 A;  2LRN A;  1BYE A;  5CP1 A;  6GSY A;  2H6Z A;  3H93 A;  1ERU A;  4A5P A;  4POB A;  3LEF A;  1GL8 A;  1BED A;  2BMX A;  1GTI A;  3UJ1 A;  4HOJ A;  1S3C A;  4GSS A;  1AUC A;  1XW9 A;  2LJR A;  1OC9 A;  2X49 A;  2FLS A;  1OC3 A;  13GS A;  1A0R P;  2HRK B;  4CDO A;  2GVP A;  3P8W A;  1SYR A;  2CX3 A;  3VWX A;  2F51 A;  2DML A;  1FW1 A;  3VWV A;  1QGV A;  3IK7 A;  3D6I A;  3DYR A;  3IRA A;  3M9K A;  3IAM 2;  3HVX A;  2IFQ A;  3FRC A;  1A2J A;  2FNO A;  2DC5 A;  1EP7 A;  2LUS A;  1X9M B;  1GLP A;  2YOI A;  4K2X A;  4D73 B;  1NM3 A;  2VCX A;  2B5Y A;  4TW5 A;  4HZ2 A;  1K0B A;  1SJZ A;  2GZY A;  4HU9 A;  2NTO A;  1YZX A;  4HJ2 A;  5KN3 A;  2FCH A;  3TJB A;  2JSY A;  1ZZY A;  3FW2 A;  4RQR A;  2OBK A;  2CVB A;  3KD0 A;  4KCE A;  3SWL A;  3KTL A;  3W6G A;  3MAK A;  2HRA A;  6GSV A;  4K2D A;  1WOU A;  3R2Q A;  2C1Y A;  6GSW A;  3UVH A;  4KH7 A;  4OFN A;  5ECP B;  2H6X A;  4MLY A;  4H86 A;  2ZNM A;  3TDG A;  4W66 A;  3DVX A;  1WPI A;  1NHY A;  2H75 A;  3APQ A;  3UVT A;  5CRH A;  2L57 A;  3A2X A;  4NV5 A;  4OD7 A;  2DSA A;  1ZYE A;  4BA7 A;  5F06 A;  4ZB6 A;  2CVD A;  2PER A;  1BF5 A;  3HD5 A;  3TRP A;  3VI7 A;  4AKH A;  2YJH A;  1GSD A;  5JWO B;  4WBR D;  4ZIL A;  1F6M C;  2X99 A;  5J4Y A;  1U6T A;  5D93 A;  5ABR A;  4KB3 A;  1GWC A;  5LD0 A;  4IJ3 A;  1TKD B;  2FY6 A;  2H1D A;  1XWC A;  1V98 A;  2IMK A;  1GNW A;  4POK A;  2IME A;  4V2N A;  3IC4 A;  3KJY A;  1AAZ A;  4N11 A;  5ECO B;  3TOT A;  3TRQ A;  4XIH A;  2HSN A;  1E6B A;  3UBK A;  4N0Z A;  4LL1 B;  2R0P A;  2LTK A;  1XFL A;  4MZC A;  3DWV A;  3PGT A;  3M3M A;  1N25 A;  4GSN A;  2GT5 A;  2TRX A;  2CQ9 A;  3KEB A;  1SL1 B;  4BL7 A;  4HU7 A;  3LW9 A;  3NZN A;  3F6D A;  3ZLP A;  3RBT A;  4LMW A;  4GST A;  2NPB A;  4EKZ A;  4I2T A;  2PWJ A;  4AJ8 A;  4K6X A;  3EE2 A;  1TTZ A;  1GP1 A;  1USB A;  1AW9 A;  5DAL B;  5B6N A;  4RI6 A;  3PIN A;  4KGI A;  2YJ7 A;  4FYB A;  2O7K A;  5J4V A;  4FH8 A;  3R3E A;  3L9U A;  2IMI A;  3RAZ A;  1PN9 A;  2DLX A;  5JWQ B;  3D21 A;  1YEP A;  1QK8 A;  2WJU A;  3WT2 A;  3C1R A;  2FD3 A;  1O73 A;  2P0G A;  3VPQ A;  5E4W A;  5G2Z A;  5A5H A;  4OCF A;  4TR3 A;  3A5W A;  3QOU A;  2L6C A;  2DKI A;  4EVM A;  4BVX A;  4MF6 A;  4MPF A;  4HEA 2;  1XWK A;  1XBS A;  3KM6 A;  2GZP A;  4BWQ A;  4TOP A;  5DBQ A;  5HR3 A;  4MF7 A;  1V40 A;  1RQM A;  2L5O A;  4IP6 A;  1SVL A;  1SKW B;  1JFU A;  2PMT A;  2HSN B;  4PUF C;  4JED A;  3APS A;  1WP0 A;  2VM2 A;  5EVO A;  3C71 A;  2YNX A;  1FB0 A;  10GS A;  4IP1 A;  1XXU A;  4XS4 B;  3FYG A;  5CRG A;  2QSI A;  5H5Q A;  3QAW A;  4KA0 A;  5D8I A;  5J9B A;  4TXO A;  5HR1 A;  14GS A;  2DMM A;  3GL3 A;  2HZE A;  3ME7 A;  1M0U A;  3P90 A;  1XWB A;  1SL2 B;  2GQK A;  6GSU A;  2X8H A;  4OFM A;  1ABA A;  2YWI A;  1PA3 A;  5AGY A;  1R5A A;  2V1M A;  2H0H A;  4L0U A;  1T7P B;  1X5C A;  2F8A A;  3C1S A;  4HDE A;  4WXT A;  2HSM B;  5HFK A;  4POM A;  2B3S A;  1TU8 A;  4MF5 A;  2YV9 A;  2EFC A;  5F8B A;  4F82 A;  2JZT A;  2HYX A;  5C00 A;  2O87 A;  5L71 A;  1IYI A;  3RHB A;  3DEX A;  2O89 A;  2EFE A;  2F3M A;  1Y1U A;  5D96 A;  4YQM A;  3GHA A;  3ED3 A;  1VF3 A;  1K0N A;  5J5N A;  1SYX A;  3GRX A;  4IHU A;  3Q6O A;  4O32 A;  2AAW A;  3FHK A;  4PGT A;  4K7I A;  2H74 A;  5DQY A;  3UEM A;  4KAE A;  4YAV A;  4ML6 A;  3G7Y A;  1TP9 A;  2VOC A;  16GS A;  4K5R A;  3FMW A;  2LNT A;  2IL3 A;  2LS5 A;  4FIW A;  4WKW A;  3ZRD A;  3LOR A;  4PNF A;  5A34 B;  3Q19 A;  3IA1 A;  4WR5 A;  3F4R A;  4TR1 A;  1FVJ A;  2JAC A;  3QDN A;  4ISD A;  3RHC A;  1TRU A;  3ZMK A;  1O7U A;  4P3Y B;  2VCZ A;  2A4V A;  3L9V A;  2TIR A;  2FGX A;  5HFI A;  2AUV A;  1BG5 A;  3RDW A;  4I5Q A;  1TXU A;  3QR6 A;  4FYU A;  3IDV A;  5H5S A;  3VI5 A;  4G0I A;  17GS A;  3FZA A;  8GSS A;  2AYT A;  1U3A A;  4TR0 A;  4QL7 A;  4DSR A;  3WGE A;  4DSS B;  3TKS C;  1PL2 A;  4Q5N A;  5A1N A;  4MH3 A;  1ZYP A;  5EY6 A;  1S3D A;  3BJ5 A;  3WD6 A;  3V1W A;  4Q5R A;  5ECS A;  1C72 A;  1OC9 B;  4E8H A;  1YF0 A;  2HSM A;  1J9B A;  2L4Q A;  5IOX A;  3QFA C;  1U3I A;  3PPU A;  4MMM A;  1XWA A;  3FZ9 A;  2WRT A;  2YV7 A;  4MA9 A;  5B8A A;  1AC1 A;  1LBK A;  2V6K A;  4N0V A;  2YAN A;  1M2D A;  2YCD A;  2XPD A;  1GTA A;  1OKT A;  5J9C A;  1Z7P A;  5DAK B;  1GSS A;  2H19 A;  1YVL A;  2PN8 A;  4MDC A;  3D22 A;  3IHG A;  4EIQ A;  4G19 A;  3MWH A;  5B8B A;  5CO3 A;  4MPG A;  4BVX B;  2H66 A;  1QFN A;  1PKZ A;  1EV9 A;  3ZZX A;  2E2G A;  1GH2 A;  4JR4 A;  2DBC A;  3HCZ A;  2YZH A;  1Z3E A;  3TKR A;  5ECM B;  2VUP A;  2VCT A;  3CXG A;  1A24 A;  4F0C A;  2YPM A;  3P7X A;  1M99 A;  2B5E A;  3HDC A;  5A5H B;  4XS6 A;  4ILF A;  1PL1 A;  3HZ4 A;  4XCS A;  5A5K A;  3A2V A;  3FY7 A;  4K0G A;  2RLI A;  2H72 A;  3F4S A;  3LG6 A;  3GST A;  4X43 A;  3O3T A;  3GSS A;  3MDK A;  5GAN D;  4ACS A;  1IYH A;  2HQT A;  1BAY A;  3DML A;  2V6O A;  3TB2 A;  6GSX A;  5DJL A;  1AQX A;  2RUF A;  22GS A;  1MDJ A;  2C3N A;  3TJG A;  4G0K A;  2R6K A;  5DQS A;  3LXT A;  1SEN A;  3ERG A;  1M9A A;  3QMX A;  1J0F A;  5IIZ A;  3N5O A;  3W8J A;  1XWG A;  1JZD A;  3FR6 A;  2MBT A;  3M0F A;  4WET A;  4GF0 A;  3CRU A;  3HVV A;  3DRN A;  2H01 A;  2CZ3 A;  3GUS A;  2K18 A;  2P5R A;  3VUR A;  2J23 A;  4NAX A;  1WRY A;  3UIW A;  4Z2U A;  5GST A;  4YH2 A;  2OJL A;  2HSH A;  4HQZ A;  4QL9 A;  2VAF A;  2FUG 2;  3O76 A;  5JCG A;  3IBH A;  2MMO A;  2B1K A;  3GA4 A;  1AQW A;  5J41 A;  3I43 A;  4AKI A;  2I4A A;  2A4H A;  5AN1 A;  5CAX A;  1Z7R A;  2QA1 A;  2RII A;  1SD8 A;  3BD2 A;  5IO2 A;  3IV4 A;  4CW9 A;  3L4N A;  2FWF A;  2M72 A;  1SVM A;  1ST9 A;  3QAV A;  2QA2 A;  3UBL A;  1UVZ A;  5IO0 A;  4CHS A;  3KXO A;  4AJ7 A;  3DXB A;  3CSI A;  4O5Q A;  3GN3 A;  2QC7 A;  5J3R A;  2KP1 A;  1SK2 A;  4TR4 A;  9GSS A;  2L5L A;  4F03 A;  1SK0 A;  2VIM A;  3TJF A;  4ZL9 A;  2J9H A;  11GS A;  2MYG A;  2M80 A;  1ZOF A;  4GRF A;  1GSQ A;  3IPZ A;  3S9F A;  2TRC P;  4USS A;  2R5G A;  1G6W A;  2GLR A;  2KP2 A;  2RM6 A;  1OKD A;  2LRT A;  3EWL A;  1OE7 A;  3E0U A;  4XS4 A;  2CAI A;  1W89 A;  1GUM A;  4RUV A;  3M8N A;  2CV4 A;  4ICY A;  1A0F A;  5LCZ A;  4XTS A;  2K9F A;  4K7N A;  3DGQ A;  3FZ4 A;  3PH9 A;  1QQ2 A;  5A1N B;  2R4V A;  1K0A A;  1PMT A;  2FWE A;  1DE1 A;  2LJK A;  2HFD A;  1T4Y A;  3TKS E;  2HZE B;  2GQL A;  2V32 A;  1V9W A;  3HY2 A;  1A8Y A;  3IE3 A;  4Q5F A;  1HNB A;  4O5U A;  3GTU A;  3F4T A;  1K0M A;  3EMX A;  3GX8 A;  1SL0 B;  1ERT A;  2DIY A;  1T00 A;  4ZL8 A;  2VLV A;  4Z7X A;  2NBS A;  2GST A;  4IQA A;  1MD4 A;  2DJ3 A;  3EUR A;  5ECL B;  4ECJ A;  1V57 A;  5FWG A;  4AGS A;  6GSS A;  2O5V A;  4MK3 A;  2I9H A;  4NHW A;  5CNW A;  4HUA A;  3VWU A;  4PNG A;  3F3R A;  3MYD A;  2HSY A;  1HYU A;  3EVI A;  3EYT A;  4KND A;  1PQN A;  2XHF A;  5A4U A;  4OCE A;  4KF9 A;  3F0I A;  5H5R A;  3TKP A;  1VRS D;  2PPT A;  3GFK A;  4OFT A;  1NHO A;  2GZZ A;  1TJD A;  2OAC A;  2H1B A;  1TRS A;  1O85 A;  3M1G A;  4KUN A;  5JCU A;  4BPY A;  2N5B A;  4RQX A;  1K0C A;  1EEJ A;  3EIN A;  3F9U A;  3TJJ A;  4MZW A;  2BJX A;  1HNA A;  2K8V A;  3WT1 A;  1SKR B;  2QGV A;  3EC3 A;  4K9Z A;  2ON7 A;  3TKS A;  1KTE A;  1LU4 A;  4ZB7 A;  4GQC A;  4GTU A;  4GDF A;  3CTF A;  3H79 A;  4KDY A;  3MIX A;  1EOH A;  3HYP A;  2EFH A;  1ZL9 A;  1B48 A;  3JCM L;  2IPA A;  3D5J A;  3SBC A;  3TRX A;  5AIX A;  12GS A;  4IJI A;  4N30 A;  2GQM A;  4PUA A;  5ECR B;  5HR2 A;  4MJA A;  1U88 A;  1EEM A;  2C0E A;  3UAP A;  2C0D A;  4EDY A;  3L0H A;  1KBN A;  5FT3 A;  3BCI A;  5AIV A;  5IQY A;  5ELA A;  2OBI A;  4K1F A;  2DJJ A;  2EFD A;  3WGD A;  3ZIT A;  1MDI A;  3A2W A;  2Z9S A;  1UA5 A;  1B8X A;  2C4J A;  3C8E A;  1T3B A;  3QCP A;  2E0Q A;  3ISO A;  3C7M A;  4KW6 A;  3UMA A;  5DAK A;  2HT9 A;  3D4T A;  3VWW A;  1TDI A;  5F07 A;  1Z5Y E;  4MJC A;  1QXH A;  2LQO A;  3CSJ A;  3LFL A;  4LL4 B;  3F8U A;  2H30 A;  4MJB A;  5KEJ A;  1CQH A;  5KOX A;  1H75 A;  2H0G A;  2KLX A;  1X9W B;  1JZR A;  1WIK A;  4JE1 A;  4O92 A;  2NDO A;  4PXO A;  2REM A;  2UV8 G;  4JBB A;  2R2J A;  3IXR A;  4MJE A;  3CTG A;  3LXZ A;  4OMV A;  1O6J A;  2IMF A;  4NXI A;  2ON5 A;  1H4O A;  1GSU A;  3BCK A;  1BJX A;  4JU5 A;  3FR9 A;  4GQF A;  2B5X A;  3K8N A;  2AJQ B;  2LJA A;  2IN3 A;  2H70 A;  4KX4 A;  4FQU A;  1JHB A;  2BTO T;  2WCI A;  3KP9 A;  1YQ1 A;  1KEB A;  4L5L A;  5BMU A;  4TVE A;  2IMD A;  2G0F A;  4J56 E;  1ERW A;  1GUH A;  5EL8 A;  1TI1 A;  1Q4J A;  1YDK A;  1S3A A;  4MZB A;  2OA7 A;  4LA1 A;  2DJ0 A;  1Y6E A;  2X64 A;  1DUG A;  2LV3 A;  4XRA A;  18GS A;  2DJK A;  1CQG A;  5ECK B;  3RPP A;  2DIZ A;  2RUE A;  4E8E A;  5G1L A;  5BRT A;  1PX7 A;  3QAG A;  1SJI A;  3IR4 A;  1JLW A;  1FOH A;  3QPM A;  2O8V B;  3VPT A;  1UC7 A;  1SK1 A;  2I1U A;  1B4P A;  5D9W A;  4I6X A;  3EPT A;  3N9J A;  1X9S B;  1I5G A;  3TKQ A;  3M9J A;  2P5Q A;  2VL2 C;  2VL2 A;  1YEX A;  4Z2R A;  1AXD A;  3GV1 A;  4ZB9 A;  3EU4 A;  2JL4 A;  4ULX A;  3GH6 A;  5F05 A;  1TI3 A;  2GS3 A;  1EGR A;  4KDX A;  2PU9 C;  3KMN A;  3GKM A;  4YAP A;  1YF1 A;  2XPE A;  2K6V A;  3GYK A;  5EPF A;  2OE3 A;  1OE8 A;  4G2E A;  5DCG A;  4J57 E;  2JAD A;  1PN0 A;  2MMZ A;  3HXS A;  3KTB A;  4DVC A;  1EP8 A;  1DBY A;  1M9B A;  2IFQ B;  5ID2 B;  1PD2 1;  4ID0 A;  3HVS A;  5JWR B;  1BQ7 A;  2LST A;  2WGR A;  2G2Q A;  1BX9 A;  1MDK A;  2C80 A;  4KSM A;  4WBJ A;  1K3O A;  1WE0 A;  1PGT A;  2K8S A;  4F9Z A;  5GZZ B;  4GCI A;  2OE0 A;  2EIQ A;  4J2F A;  2LQQ A;  2LRC A;  2H1L A;  2CX4 A;  3HHV A;  4HZ4 A;  2OT3 A;  4TRX A;  1XZO A;  3KGK A;  3I6A A;  1XW5 A;  5KN1 A;  2FWH A;  1B9Y C;  4XS1 A;  1ERV A;  5A4W A;  1URM A;  2VM1 A;  2IIY A;  5J40 A;  4KSO A;  2F9S A;  4MNN A;  1QUW A;  1ON4 A;  2E2M A;  1TK8 B;  1GTB A;  3LJR A;  4PUR A;  2VLU A;  1X0R A;  3CRT A;  1HD2 A;  2HRN A;  2MMN A;  3CMI A;  1OVN A;  4Q5Q A;  3ZML A;  5IMV A;  1PKW A;  1PX6 A;  5LNK e;  3CSH A;  1ZMA A;  1K0D A;  4MH2 A;  2GDR A;  2IJY A;  2C3Q A;  2QKE A;  2D2Z A;  3ME8 A;  3DVW A;  1SKS B;  4DSS A;  2OE1 A;  1R5P A;  2B7J A;  2GSQ A;  5CYY A;  1SU9 A;  2R0C A;  2A2S A;  4PQH A;  4PX1 A;  1G7O A;  4ZXG A;  1XVQ A;  3CYN A;  2O85 A;  3EU3 A;  3G7J A;  2KUC A;  2A2R A;  3HKR A;  1JZW A;  1THO A;  2CT6 A;  2LKU A;  4NV2 A;  3KMO A;  3DIE A;  2VD0 A;  1TXX A;  1VF2 A;  4K8M A;  3FEU A;  3BBY A;  4ECC A;  2YWN A;  2F8F A;  4TN8 A;  4TXV A;  1YKA A;  4OO5 A;  4E68 A;  2VCQ A;  2MZC A;  2GSS A;  2OKA A;  5DCH A;  4N10 A;  3RPN A;  5ECI B;  2L59 A;  2XBQ A;  3DKS A;  5G5E A;  2DKH A;  4EDZ A;  2DJ1 A;  4BVY B;  3HZ8 A;  4F0B A;  2XC2 A;  4K7O A;  2RM5 A;  2N5F A;  5HR0 A;  4HQS A;  4X4J A;  1XIY A;  4NPB A;  3KZQ A;  3FZ5 A;  2YWO A;  1Y25 A;  3NIV A;  1HNC A;  2PGT A;  3ZL5 A;  5IMF A;  4RI7 A;  4FYC A;  4JRR A;  1M7T A;  4I2U A;  5A4V A;  2EIO A;  2YP6 A;  5COH A;  2R37 A;  5G1K A;  2VL9 A;  1DSB A;  2WB9 A;  4KE3 A;  5CRE A;  4YKG A;  1DE2 A;  2L4C A;  1GSF A;  1VGL A;  4IEL A;  2VKZ G;  3TGZ A;  4OWY A;  5IMA A;  3DD3 A;  4IS0 A;  4MCU A;  4Z2T A;  5ECQ B;  5FHI A;  5IOW A;  3Q74 A;  4HS1 A;  2C0G A;  1BG1 A;  2FHE A;  1T1V A;  4X0X A;  1ZYN A;  4O5R A;  4EF0 A;  3J7Y k;  1UN2 A;  3MSZ A;  1OC8 A;  4ECB A;  3FR3 A;  2HXK A;  3GKK A;  5GAP D;  5CRW A;  3AY8 A;  4EO3 A;  4AJ6 A;  2H6Y A;  3GX0 A;  3VLN A;  2AHE A;  1JLV A;  2PVO C;  4K0N A;  4ML1 A;  1A2L A;  4EL1 A;  2R0G A;  2IWT A;  3ZVJ D;  3J7Y b;  2EIR A;  1YKC A;  3WGX A;  2A2P A;  3GMF A;  4ZBD A;  5IM9 A;  1O8X A;  2XBI A;  1QMV A;  1RK4 A;  6GST A;  2CA8 A;  3D4M A;  3EMP A;  5E59 A;  1WJK A;  3ZIJ A;  2CVK A;  3BOA A;  1FOV A;  4HI7 A;  4KDU A;  1GSE A;  2WFC A;  1TOF A;  4PQI A;  3US3 A;  5J4U A;  4IN0 A;  5A34 A;  1VF1 A;  5C04 A;  3UAR A;  3GTU B;  1TK0 B;  1SJ6 A;  1WWJ A;  2H8L A;  4GLT A;  1M2B A;  4WEY A;  1YY7 A;  1A8L A;  1G0T A;  2JZR A;  1U87 A;  4WF5 A;  4GWR A;  1WMJ A;  5KN2 A;  4QMK A;  1F9M A;  3A5I A;  3QFB C;  4PTS A;  1ZCP A;  3LQ7 A;  5DJM A;  5ENU A;  3H1N A;  1TK5 B;  4L0W A;  1EWX A;  2E7P A;  4YKF A;  1K3Y A;  4ECI A;  5CRD A;  4TR1 B;  3LWA A;  1F37 A;  4MAB A;  4EUY A;  2YWM A;  3F3Q A;  2HNL A;  1TW9 A;  3TJK A;  5G31 A;  2VCV A;  3F6F A;  4BWS A;  1V2A A;  1XOB A;  3U6V A;  4CY6 A;  1GUK A;  4QQ7 A;  4G10 A;  2C0F A;  5KOW A;  2ZUP A;  3CWG A;  5B7C A;  1A2M A;  4N3Z A;  2JU5 A;  2DJ2 A;  3IK9 A;  5D9V A;  2GT6 A;  3A3T A;  3L9S A;  5D73 A;  5F0G A;  2H73 A;  1SD9 A;  1XCC A;  4X1U A;  1OYJ A;  1T8E B;  4G01 A;  2WDU A;  4IW9 A;  4V1A p;  1EZK A;  4JZQ A;  2I3Y A;  2VL3 A;  3ERW A;  4EC0 A;  1ML6 A;  1AQV A;  2HI7 A;  4YQV A;  4AI6 A;  4EE0 A;  1XW6 A;  1GRX A;  4ZBA A;  1T4Z A;  1KNG A;  4JR6 A;  1R7H A;  1F2E A;  2L6D A;  1B9X C;  5BMU B;  4KCA A;  5D9X A;  3HMJ G;  4G0L A;  2N5A A;  1A23 A;  4YQU A;  5G5F A;  4V2L A;  4XHM A;  4TXO B;  2H0I A;  2FWG A;  4GXZ A;  2V41 A;  2HE3 A;  1Q98 A;  2ES7 A;  3FK8 A;  5DVB A;  5JCW A;  1NW2 A;  2AV4 A;  2HZF A;  2FA4 A;  4L8E A;  2EC4 A;  1THX A;  3H8Q A;  3HJP A;  2C8U A;  1E2Y A;  3GKX A;  3Q18 A;  2LNS A;  2VO4 A;  3KCM A;  3ZTL A;  4POL A;  3GKN A;  2H76 A;  3UOM A;  3ZYW A;  3PR8 A;  3C73 A;  1GLQ A;  2V2G A;  1EV4 A;  3MNG A;  3HJM A;  2B7K A;  2WUL A;  19GS A;  1G7E A;  4IVF A;  3W8S A;  3KH9 A;  1GSY A;  5B6M A;  3F63 A;  1XPV A;  3ZFL A;  1O8W A;  3P2A A;  5ELG A;  4LMV A;  1FG4 A;  1X5D A;  4O7H A;  5G30 A;  5DDL A;  4NMU A;  5IPH A;  2ALB A;  3IHQ A;  1TRW A;  2NVL A;  5INY A;  2HRF A;  1O81 A;  1F3A A;  4EXJ A;  4WR4 A;  3KIJ A;  2AB6 A;  1Z6N A;  4ZIJ A;  5D9T A;  3TUE A;  2HRK A;  2PUK C;  2VLT A;  2H1G A;  1GUL A;  3GH9 A;  4AKX B;  4OO4 A;  3ZIV A;  2MBS A;  1JZO A;  2X8C A;  4V1A g;  3VK9 A;  1X5E A;  1TRV A;  4HJM A;  1B4Q A;  3ZVJ A;  5KN0 A;  2R3X A;  1SVO A;  1HQO A;  3KH7 A;  3GUR A;  2I81 A;  1FHE A;  4NHZ A;  4F2I A;  2KHP A;  2M46 A;  3NOF A;  2PVQ A;  5J47 A;  3E9J B;  1K0O A;  4IBP A;  2JZS A;  5DAL A;  2GTU A;  1EGO A;  4V2M A;  4ZL7 A;  3H4K A;  2FA8 A;  1F3B A;  3UL3 A;  3O6T A;  1V58 A;  7GSS A;  5GSS A;  1XVW A;  1XOA A;  3IAS 2;  2GSR A;  3I69 A;  5IMC A;  2UZ8 A;  2JSZ A;  2VCW A;  3ZFB A;  1G6Y A;  5IMZ A;  3L78 A;  3D0Z A;  4CY8 A;  3LYP A;  5HQP A;  1VF4 A;  4NWY A;  1N8J A;  4IQ1 A;  4PQ1 A;  2H1A A;  1FAA A;  2C3T A;  5ECH B;  4AF2 A;  5ECN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...