3LG6A

Crystal structure of putative glutathione transferase from coccidioides immitis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
229
structure length
229
Chain Sequence
TPNFELYGYFRSSCSGRLRIAFHLKSIPYTRHPVNLLKGEQHSDTYKSLNPTNTVPLLVVSNINNTVSPSSASFSIGQSLAALEYLEEALPTNARPLLPPISNPVARAHVRTICNIIACDVQPVTNLKIQKKVKALDGDPTVWSRDLATQGFGAVEKLLELSAGRFCVGDEITLADVCLVPAVWAAERVGMDLARFPITKRVFEEMLKEEAVQKAHWQKQEDTPEDLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative glutathione transferase
publication title Structures of a putative zeta-class glutathione S-transferase from the pathogenic fungus Coccidioides immitis.
pubmed doi rcsb
source organism Coccidioides immitis
molecule tags Transferase
total genus 78
structure length 229
sequence length 229
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2010-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3lg6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3lg6A01
3FZ5A 2IFQA 2OE0A 3GHAA 4P3YB 14GSA 4F0CA 3M1GA 4MF5A 5ECPB 1GSDA 4JR6A 3TKQA 4K7OA 4O5RA 1N8JA 2FWEA 1B4PA 4EC0A 2VIMA 1U87A 3U6VA 2VLVA 2YPMA 3LORA 2VCWA 1OC9B 1VGLA 4LL4B 1T1VA 3ZMLA 5A4WA 2VL2A 4MABA 1I5GA 2H74A 3VFIA 1GTBA 2WRTA 4TW5A 2F8AA 3EWLA 1XW5A 1IYIA 3IOSA 1UVZA 3ZREA 1B9XC 4GQCA 3KGKA 2IMKA 1XW6A 3C7MA 2AUVA 1RQMA 1K0NA 4HJ2A 3A2WA 5IPHA 4L0UA 2DJKA 3EMXA 3A5WA 1NM3A 1F2EA 1H4OA 4K7NA 2BTOT 2HI7A 1EP8A 4ML6A 2NVLA 2REMA 1WOUA 4IELA 19GSA 1WJKA 2C80A 2VL3A 4OCFA 4E8EA 1TRVA 2V6KA 1JZOA 1PD21 5ID2B 2MBTA 3KH7A 5CRHA 4DSSB 2V41A 5DJLA 1YDKA 1GSQA 3D4TA 1XWKA 4WETA 5IMCA 3LFLA 3D0ZA 3P2AA 4F0BA 3GL3A 3GH6A 2GSQA 3EYTA 5HFGA 1Z5YE 1SU9A 2H72A 3SWLA 5IOXA 4PXOA 4KUNA 2DC5A 3GTUB 2H0IA 3HHVA 3G7JA 2D2ZA 1F9MA 1MDJA 3W8JA 4XS4B 2KP2A 1SKWB 6GSUA 3P8WA 4JE1A 2R6KA 8GSSA 4TXOA 2LNTA 3L4NA 6GSYA 3ZMKA 4I8BA 1SYXA 4MH2A 2H6ZA 4FH8A 4QL9A 4N0ZA 4K0NA 2LRTA 3GKXA 2O7KA 1MDIA 2JACA 3ERFA 1K3YA 1UN2A 3TCOA 1GSEA 2KOKA 4PQHA 1A8YA 5F0GA 5KN1A 2PVQA 4LA1A 5F06A 1MTCA 3LYPA 5D8IA 1K0MA 1R7HA 1FO5A 4BVYA 4ZB6A 3PPUA 2YNXA 5GSSA 1Z6NA 1GP1A 4XIHA 3CMIA 3QAVA 4J2FA 4K1FA 5G2ZA 4GTUA 4HJMA 3GUSA 3KMNA 1NSWA 1GULA 1A2MA 2F9SA 1X5DA 4XS1A 4MMMA 1PGTA 4KGIA 5IIZA 3IHQA 1GTIA 3E3EA 1YEPA 3VWXA 3HA9A 4KH7A 5D73A 5E4WA 4YQUA 1TP9A 2YZHA 1EGOA 2CVDA 4IHUA 4HI7A 1O85A 3QOUA 4TOPA 5HFKA 3D21A 3LJRA 2HRAA 1J9BA 3DYRA 4GQFA 2LQQA 3RBTA 1AQWA 3VPTA 2B1KA 2YWOA 3HVVA 5INYA 1M0UA 5KN2A 3SBCA 2VL2C 2P5QA 2XHFA 4TXVA 4F82A 3G9BA 2ON7A 1X5EA 4BL7A 3QFAC 5HR0A 2CZ2A 4RQXA 2A2SA 3GL5A 2PWJA 4BVXA 4BPYA 1K3OA 3HCZA 1U88A 5AISA 2AYTA 3TRXA 4PTSA 3ERWA 4ML1A 3WGEA 2GGTA 3TJJA 1FB6A 2C3NA 2H1DA 2VOCA 4X0XA 4EF0A 5ECIB 3QFBC 2PVOC 1YJ6A 2K18A 4AJ8A 1BG5A 1G7EA 5J41A 2H75A 2J23A 5A4UA 1V40A 2M46A 2FWHA 3FR6A 2X99A 1THXA 3UOMA 1TK0B 4CHSA 3G7YA 4XS6A 1TOFA 1H75A 3ZYWA 1PA3A 3FYGA 5B6MA 2C0EA 5IM9A 2K8VA 1GLQA 1TXXA 4OMVA 2A4VA 3KZQA 5G31A 1A2LA 1B48A 3P7XA 4JU5A 3ZITA 1GSYA 3WGDA 3DRNA 2C3TA 3Q74A 3ZTLA 4X43A 5A4VA 5JWRB 4BVYB 4POBA 2MMZA 5D96A 3R2QA 5ENUA 3DD3A 3FHKA 3KEBA 1YEXA 2ZUPA 3F6DA 1EEJA 4V2NA 5CREA 2AHEA 2FHEA 3O6TA 5IPGA 3M8NA 3GKKA 3S9FA 2G0FA 3W6GA 1ML6A 3ISOA 2VLUA 2CV4A 5DJMA 1AXDA 4KDYA 4FO5A 4AJ6A 4JRRA 1URMA 2H73A 2HLSA 2LJRA 3IC8A 1M9BA 2B5YA 3F4RA 1R5AA 4WEYA 3GNJA 4MZWA 1RK4A 2FWGA 1Y25A 2RM6A 2HQTA 2JU5A 2YV7A 1OE7A 5IO2A 1XVWA 4GXZA 3KIJA 1AQXA 4WR4A 1M2DA 5D9XA 3F63A 3O3TA 5IOWA 4JZQA 1VF1A 3FKFA 2FUG2 3DKSA 3BJ5A 3WT2A 1GTAA 1K0AA 1OC9A 4OWYA 4BVXB 4F9ZA 5LCZA 1G0TA 4WBJA 4RUVA 5ECQB 2GSSA 2DIYA 1DBYA 2NPBA 2JSZA 4MF7A 3TKSA 2L5LA 4AJ7A 4F03A 1C72A 1EWXA 3CSHA 4POKA 3TKPA 3GX0A 4DEJA 2YV9A 1XWAA 4TN8A 5G5FA 5J9CA 1HYUA 4KCAA 3L9SA 4X1UA 4K9ZA 3P90A 1FVKA 2FLSA 2YN1A 2WULA 2WJUA 1ST9A 5DCHA 1ZCPA 4Q5FA 5GAND 3E9JB 1PX6A 2VAFA 2EIQA 4DSSA 1X5CA 1A0RP 2GZPA 3MDKA 4G10A 3UVTA 3US3A 2KHPA 3GV1A 2R4VA 2YCDA 4HOJA 2PGTA 2DBCA 1XXUA 5GSTA 3H79A 2VCXA 3D6IA 2HXKA 2HZEB 4MZBA 2R2JA 1GWCA 1XWCA 5CRDA 2I81A 4XS4A 1SJ6A 4ZXGA 2F8FA 1ZZYA 2QC7A 2OACA 2OE1A 5L71A 4OD7A 4G2EA 2ZCTA 3HVSA 4G0LA 5IMDA 3PINA 4D73B 2PU9C 3WGXA 1Z6MA 1BEDA 2LNSA 2PERA 1BYEA 4O92A 2CAIA 3ZZXA 1KNGA 4J56E 3BCKA 2PPTA 3QD9A 2R3XA 1GNWA 5G1LA 3I69A 1PMTA 3OR5A 1IYHA 1SL1B 2HE3A 2DJ3A 1Q4JA 3E0UA 3KP8A 2H66A 5IMZA 2OKAA 2JSYA 4GLTA 2B7JA 2L4QA 4CW9A 2L6CA 1X9MB 1JLWA 1S3CA 2NTOA 2TRXA 1S3DA 3A3TA 1F6MC 4KE3A 3FEUA 4XHMA 1KBNA 2N5AA 5D9WA 2WDUA 2FGXA 2X8HA 1GUMA 2B5EA 2RUEA 4IJ3A 2UZ8A 2GVPA 2RM5A 1LBKA 4ECCA 2WZ9A 1GL8A 1PN9A 3ZRDA 4G19A 4N30A 1VF2A 16GSA 2V6OA 1TK8B 4MK3A 3ZLPA 2YWMA 11GSA 4NV5A 3IR4A 2I4AA 1MDKA 1TI3A 4L5OA 3CRTA 5DALB 3GSSA 1DSBA 4ZBAA 5EVOA 2X64A 2VCQA 2E0QA 1SD9A 4EVMA 1O6JA 3FR9A 3KTLA 1QGVA 1AC1A 2FWFA 3L78A 2LRNA 1GTUA 2GT5A 2ON5A 3UAPA 1JFUA 2EIRA 1NHYA 3UJ1A 4MPFA 4ECJA 3TKSC 2VD1A 1SK2A 4YQMA 5B8BA 3D5JA 3Q19A 2GT6A 1SK1A 1VRSD 1JZDA 4OFMA 1V58A 5G5EA 5ELGA 3HJOA 1FVJA 1WP0A 2H0GA 3C1RA 3EMPA 2K8SA 1GSFA 3ZL5A 1GSSA 4OCEA 1GRXA 5LNKe 1VF3A 4GCIA 1V57A 4WXTA 1ZYEA 4GWRA 2CT6A 3IK9A 3VWVA 2RUFA 5E59A 5AIXA 4ZBBA 3M0FA 1PSQA 2CX4A 2H01A 5GAPD 4ZBDA 1SL0B 2WGRA 3AY8A 2QSIA 3LEFA 4K6XA 4RI7A 4ZB8A 3HKRA 3EURA 4USSA 3KM6A 3HZ4A 1AQVA 1W89A 4L8EA 2I1UA 2TRCP 1K0BA 3LYKA 2H71A 4Z7XA 2GTUA 1OC3A 3NZNA 1U3AA 2JL4A 2HSHA 4XRAA 4MF6A 4H86A 2L59A 2PMTA 4JEDA 3QAGA 1R5PA 2DMMA 3TKSE 4MJCA 1WIKA 4ZL8A 1WMJA 2OJLA 1GSUA 4NHZA 4YAPA 3VWUA 3VK9A 3GKMA 5JCUA 3NOFA 3Q6OA 1BAYA 3M9KA 3ZVJA 4XCSA 4RI6A 2DLXA 3TGZA 1USBA 1WRYA 3DMLA 4TRXA 4MJEA 2PBJA 3IC4A 2AV4A 1TI1A 2EC4A 3WYWA 3CYNA 4FYUA 4N11A 2NDOA 1O81A 4PNGA 1G6YA 1ZOFA 1NW2A 2K9FA 3RHBA 3J7Yb 5ECOB 1ACVA 3C1SA 5EPFA 4K8MA 3ZIJA 5KN0A 3IA1A 2HZFA 2DJJA 1TW9A 3F3RA 1FOVA 4BA7A 2P0GA 2CVBA 2V32A 5EY6A 1TRSA 1O8WA 5CNWA 5G1KA 2K6VA 2HRKB 5J3RA 2HRFA 5BMUA 1A0FA 4YAVA 3EC3A 1SD8A 2PN8A 1EOHA 3HD5A 2DSAA 1JZRA 3ZFBA 5F07A 1F3AA 3QCPA 1JHBA 1FG4A 1PKWA 3U5RE 4JR4A 4QL7A 1ZGNA 3MNGA 2KLXA 3DVXA 4HEA2 3H4KA 2OBKA 1AIUA 3UIWA 2FCHA 4NXIA 2E2GA 1K3LA 2FA4A 2F3MA 1G6WA 5COHA 3H1NA 1SK0A 2MMNA 4WR5A 4GSTA 4F2IA 1LJRA 3IPZA 2XBQA 1OKTA 2LEGA 3HYPA 4TR1A 2B3SA 2XPEA 2H6XA 4ULXA 2QKEA 1EP7A 2BMXA 2HZEA 2V1MA 3GX8A 3BOAA 1XWBA 5H5RA 4MP4A 4RQRA 4EO3A 3FW2A 2HFDA 4K2DA 1M2AA 3EU4A 2L6DA 1EV4A 3EU3A 1ABAA 4MZCA 1X9WB 1XBSA 1V9WA 4KCEA 3HDCA 3HZ8A 1TU7A 2E7PA 1KEBA 3GYKA 2JZTA 1SKRB 2B5XA 4I2TA 4D73A 1JLVA 3TOUA 9GSSA 1XPVA 2CQ9A 5C00A 3EINA 3TJGA 1U3IA 17GSA 5ECKB 1PKZA 3DGQA 3GH9A 3CRUA 2ES7A 4ZB9A 3CSIA 3FK8A 1EV9A 12GSA 1YKCA 4MLYA 3QMXA 2YANA 5AGYA 3LXTA 4ECBA 4OFNA 1ZL9A 4WF4A 2IMFA 3TB2A 3VI7A 4XRDA 4J57E 3WD6A 2LQOA 2CVKA 4IN0A 3UMAA 2GS3A 2O8VB 2DJ1A 1GNEA 4Q5QA 5IO0A 3IXRA 3ERGA 3F0IA 2BJXA 1XWGA 5J5NA 5G30A 3ED3A 3G7IA 2E2MA 1SJIA 4OFTA 4BWSA 2F51A 2MYGA 6GSSA 3Q18A 2OA7A 4O7HA 3FRCA 5DALA 5CYYA 4MPGA 3C8EA 2LV3A 2GSTA 2DIZA 1PQNA 4FYBA 4IS0A 4FIWA 1J0FA 3O76A 1HNBA 4G0IA 4PURA 1SKSB 2GQLA 5GZZB 4EDYA 3TJBA 4GSSA 5J4UA 4K0GA 1FAAA 3K8NA 1AAZA 4EL1A 1PL2A 3ME8A 1X0RA 2P5RA 2C4JA 1LU4A 3GFKA 2FY6A 2A2RA 1AW9A 2VD0A 3IDVA 2IL3A 2RIIA 4TR3A 4EDZA 4TR1B 4OO5A 1TK5B 3FZAA 1V98A 4ID0A 1OYJA 4HZ4A 2YWIA 3KXOA 1EEMA 1A2JA 1Z9HA 3KD0A 5ELAA 3RAZA 1TKDB 4KNDA 3F8UA 4I6XA 4G0KA 1YZXA 4ECIA 1B4QA 3WT1A 1NHOA 3APOA 2L4CA 1FB0A 1E2YA 5B8AA 2WCIA 1CQHA 3VURA 3LGCA 2JADA 3UBLA 4ISDA 5CRGA 5ECHB 2VO4A 3RDWA 3VI5A 1WPIA 1XZOA 1T00A 1EOGA 5IMAA 4TR4A 4DVCA 5ECLB 5DAKA 2NBSA 2VUPA 2LRCA 6GSVA 5AN1A 5CAXA 5ECSA 2PUKC 3CTFA 2FNOA 4IW9A 1M2BA 4EXJA 4TR0A 2FD3A 2L5OA 1XIYA 4WF5A 2O85A 2M80A 1DE1A 1OE8A 2FA8A 2H30A 1SENA 4Q5NA 3QDNA 2IN3A 5ECNB 5DDLA 1Z7PA 2LJKA 1PL1A 5CO3A 1HD2A 1XOBA 4IJIA 2YOIA 2HSNB 4HUAA 2HRNA 1GH2A 3FZ4A 3IV4A 3GURA 2LJAA 1ZMAA 5H5QA 5C04A 2RLIA 4MJBA 4I97A 13GSA 1I9DA 2V2GA 4LLRA 4O32A 2HNLA 5EL8A 4KW6A 5DVBA 2HSMB 4IP1A 1YF0A 3UARA 1M7TA 3D4MA 2IIYA 2CX3A 1ERVA 3IBHA 3M3MA 3VLNA 3N5OA 1OC8A 2IMEA 3V1WA 3LG6A 3KH9A 3LSZA 4MA9A 4IBPA 4V1Ag 1GUKA 3GRXA 6GSWA 5HR2A 4ZILA 3C73A 4KA0A 1Z7RA 2IMDA 4IP6A 4KB3A 1T4ZA 4HS1A 5HFIA 3LWAA 2H1BA 4WBRD 2MMAA 5IMFA 1ILOA 1HNCA 1F3BA 2P31A 5F8BA 5FT3A 1KTEA 1XW9A 2HRKA 2YZUA 4TVEA 2GQMA 2M72A 5H5SA 5FHIA 5ECMB 4N0VA 1M99A 2H19A 5DBQA 4FQUA 1PRXA 5D9TA 1K0OA 4NAXA 3VPQA 1MD4A 3BBYA 2EIOA 4KDXA 4TKYA 2C8UA 4E8HA 2R37A 3FR3A 3R3EA 1YF1A 4HDEA 1TRWA 2H0HA 4DSQA 4KDUA 2C0GA 3CXGA 5HR3A 2VLTA 1GUHA 2VL9A 3CSJA 3TRQA 4IKHA 4AF2A 4LMWA 5ECRB 4ZL7A 4EKZA 2O89A 5A5KA 4ZIJA 5DAKB 3GSTA 5D9VA 4GF0A 1PX7A 1ERWA 5IMVA 1A8LA 3HVXA 3HJPA 3FY7A 3KCMA 1UC7A 2XPDA 1Z3EA 4KSMA 2IFQB 2AAWA 4IGJA 3TUEA 2DJ0A 2TIRA 4NWYA 5LD0A 3KMOA 3H8QA 4CDOA 1E6BA 3QAWA 1S3AA 4EE0A 2QGVA 1QFNA 4PUAA 3IRAA 2GDRA 1SJZA 3APSA 3H93A 2HT9A 2ZNMA 5HQPA 4IQAA 3F4TA 4OO4A 2MBSA 3D22A 3TOTA 1XVQA 1O73A 1FW1A 1R26A 2H76A 3IAS2 3W8SA 6GSTA 1K0CA 3KP9A 5JCGA 3HJMA 1O8XA 1OVNA 2WB9A 2C0DA 2LSTA 3TKRA 3TJKA 4HQSA 2VCZA 3FZ9A 4DSRA 1T4YA 3RPNA 4LL1B 2N5BA 1T7PB 2XC2A 1YQ1A 3GMFA 18GSA 3PR8A 2GZZA 4HZ2A 3A2XA 2JZSA 3DIEA 2O87A 4ACSA 2LUSA 5J9BA 1DE2A 5B6NA 5DQSA 4N10A 5D93A 1QK8A 3RPPA 2YJHA 3N9JA 3UBKA 7GSSA 4WKWA 5JCWA 1TRUA 1AUCA 4NPBA 1VF4A 4MDCA 2YJ7A 2CA8A 5JWQB 2GQKA 2VCTA 4XTSA 2G2QA 1YKAA 1J08A 3GKNA 4PUFC 2LKUA 4KX4A 2J9HA 4G9HA 2N5FA 3I43A 4AGSA 1K0DA 2X8CA 1B8XA 4YQVA 3TJFA 4IVFA 3TRPA 2GSRA 2DMLA 2OBIA 4L5LA 1BQ7A 5KN3A 3TDGA 4NMUA 4QQ7A 2H8LA 1UA5A 3MAKA 4TXOB 4KF9A 4PNFA 1FHEA 1F37A 2HSYA 3L9UA 2YWNA 4PGTA 2IMIA 2B1LA 4HU7A 4NHWA 3LXZA 1TJDA 2YP6A 2C0FA 3QPMA 3UVHA 6GSXA 2ALBA 2MZCA 2H70A 2MMOA 4MCUA 3L9VA 3UL3A 5CP1A 3DXBA 4KAEA 2IPAA 3IAM2 4GRFA 4IQ1A 1T8EB 1U6TA 1WE0A 3EE2A 1HQOA 3KTBA 3RHCA 1EGRA 3IK7A 4I2UA 4Q5RA 1TDIA 2C3QA 3IE3A 3GA4A 1JZWA 4L0WA 1ZYQB 5KEJA 3KJYA 3L0HA 5IQYA 2XBIA 2H6YA 2B6MA 1TTZA 3F3QA 1Y6EA 1BX9A 2IJYA 2VCVA 4POMA 2GLRA 4PQ1A 3QR6A 1MD3A 4ILFA 1XCCA 2OADA 3CBUA 22GSA 5FWGA 3MWHA 2AJQB 1N2AA 3CTGA 2R5GA 4V1Ap 1GLPA 2WS2A 3PGTA 4V2LA 4ZL9A 2KUCA 4EUYA 1SYRA 4HU9A 1X9SB 3BCIA 1R4WA 1Q98A 2H1GA 5B7CA 2X8GA 2JZRA 4POLA 3LQ7A 1T3BA 1XOAA 1YY7A 2DJ2A 5JWOB 3EVIA 1OKDA 1W4VA 2B7KA 3C71A 20GSA 2CAQA 3F6FA 4BL7B 1A24A 1M9AA 5DQYA 3VWWA 2H1AA 3ME7A 4V2MA 1HNAA 2Z9SA 2L57A 2HSMA 2AB6A 2VM2A 1ON4A 1G7OA 3I9V2 1OAZA 3DVWA 1A23A 3PH9A 4JBBA 5HR1A 1ERTA 4I5QA 1RW1A 2GZYA 3ZVJD 1DUGA 4HQZA 4NV2A 3MSZA 2HYXA 1B9YC 2KP1A 4FYCA 4PX1A 4LMVA 1TU8A 4MJAA 1QXHA 5DCGA 5F05A 1V2AA 1O7UA 3A2VA 2VM1A 4KSOA 1WWJA 3DEXA 3I6AA 1BJXA 5ID2A 5CRWA 2IWTA 4K7IA 3UEMA 3NIVA 3JCML 1QMVA 10GSA 4GSNA 3J7Yk 4MH3A 2LTKA 3GIXA 3HY2A 5ABRA 3HXSA 1SL2B 4BWQA 3F9UA 1CQGA 3GN3A 3GTUA 3BD2A 3APQA 1QUWA 2I9HA 2WFCA 1XFLA 2CZ3A 2I3YA 4PQIA 4YH2A 2OE3A 2C1YA 1QQ2A 1MEKA 3ZFLA 1EZKA 3ZIVA 3DWVA 3F4SA 3M9JA 5AIVA 1ERUA 2LS5A 1THOA
chains in the Genus database with same CATH superfamily
3FZ5A 2IFQA 2OE0A 3GHAA 4P3YB 14GSA 4F0CA 3M1GA 4MF5A 5ECPB 1GSDA 4JR6A 3TKQA 4K7OA 4O5RA 1N8JA 2FWEA 2WW3A 1B4PA 4EC0A 2VIMA 1U87A 3U6VA 5A5HA 2VLVA 2YPMA 3LORA 2VCWA 1OC9B 1VGLA 4LL4B 1T1VA 3ZMLA 5A4WA 2VL2A 4MABA 1I5GA 2H74A 3VFIA 3LW9A 1GTBA 2WRTA 4TW5A 2F8AA 3EWLA 1XW5A 1IYIA 3IOSA 4HSCX 1UVZA 3ZREA 1B9XC 4GQCA 3KGKA 2IMKA 1YEWC 1XW6A 3C7MA 2AUVA 1RQMA 1K0NA 4HJ2A 3A2WA 5IPHA 4L0UA 2DJKA 2WVXA 3EMXA 3A5WA 1NM3A 1F2EA 1H4OA 4K7NA 2BTOT 2HI7A 1EP8A 4ML6A 2NVLA 2REMA 1WOUA 4IELA 19GSA 1WJKA 2C80A 2VL3A 4OCFA 4E8EA 1TRVA 2V6KA 1JZOA 1PD21 5ID2B 2MBTA 3KH7A 5CRHA 4DSSB 2V41A 5DJLA 1YDKA 1GSQA 3D4TA 1XWKA 4WETA 5IMCA 3LFLA 3HVNA 3D0ZA 3P2AA 4F0BA 3GL3A 3GH6A 2GSQA 3EYTA 5HFGA 1Z5YE 1SU9A 2H72A 3SWLA 5IOXA 4PXOA 4KUNA 2DC5A 3GTUB 2H0IA 3HHVA 3G7JA 2D2ZA 1F9MA 1MDJA 3W8JA 4XS4B 2KP2A 1SKWB 6GSUA 3P8WA 5KOWA 4JE1A 2R6KA 8GSSA 4TXOA 2LNTA 3L4NA 6GSYA 3ZMKA 4I8BA 4E68A 1SYXA 4MH2A 2H6ZA 4FH8A 4QL9A 4N0ZA 4K0NA 2LRTA 3GKXA 2O7KA 1MDIA 2JACA 3ERFA 1K3YA 1UN2A 3TCOA 1GSEA 2KOKA 2R0CA 4PQHA 1A8YA 5F0GA 3RGBC 5KN1A 2PVQA 4LA1A 5F06A 1MTCA 3LYPA 5D8IA 1K0MA 1R7HA 1FO5A 4BVYA 4ZB6A 3PPUA 2YNXA 5GSSA 4AI6A 1Z6NA 1GP1A 4XIHA 3CMIA 3QAVA 4J2FA 4K1FA 5G2ZA 4GTUA 4HJMA 3GUSA 3KMNA 1NSWA 1GULA 2R0GA 1A2MA 2F9SA 1X5DA 4XS1A 4MMMA 1PGTA 4KGIA 5IIZA 3IHQA 1GTIA 3E3EA 1YEPA 3VWXA 3HA9A 4KH7A 5D73A 5E4WA 4YQUA 1TP9A 2YZHA 1EGOA 2CVDA 4IHUA 4HI7A 1O85A 3QOUA 4TOPA 5HFKA 3FMWA 3D21A 3LJRA 2HRAA 1J9BA 3DYRA 4GQFA 2LQQA 3RBTA 1AQWA 3VPTA 2B1KA 2YWOA 3HVVA 5INYA 1M0UA 5KN2A 3SBCA 2VL2C 2P5QA 2XHFA 4TXVA 4F82A 3G9BA 2ON7A 1X5EA 4BL7A 3QFAC 5HR0A 2CZ2A 4RQXA 2A2SA 3GL5A 2PWJA 4BVXA 4BPYA 1K3OA 3HCZA 1U88A 5AISA 2AYTA 3TRXA 4PTSA 3ERWA 4ML1A 3WGEA 2GGTA 3TJJA 1FB6A 2C3NA 2H1DA 2VOCA 4X0XA 4EF0A 5ECIB 3QFBC 2PVOC 1YJ6A 2K18A 4AJ8A 1BG5A 1G7EA 5J41A 2H75A 2J23A 5A4UA 1V40A 2M46A 2FWHA 3FR6A 2X99A 1THXA 3UOMA 1TK0B 4CHSA 3G7YA 4XS6A 1TOFA 1H75A 3ZYWA 1PA3A 3FYGA 1FOHA 5B6MA 2C0EA 5IM9A 2K8VA 1GLQA 1TXXA 4OMVA 2A4VA 3KZQA 5G31A 1A2LA 1B48A 3P7XA 4JU5A 3ZITA 1GSYA 3WGDA 3DRNA 2C3TA 3Q74A 3ZTLA 4X43A 5A4VA 5JWRB 4BVYB 4POBA 2MMZA 5D96A 3R2QA 5ENUA 3DD3A 3FHKA 3KEBA 1YEXA 2ZUPA 3F6DA 1EEJA 4V2NA 5CREA 2AHEA 2FHEA 3O6TA 2WW0A 5IPGA 3M8NA 3GKKA 3S9FA 2G0FA 3W6GA 1ML6A 3ISOA 2VLUA 2CV4A 5DJMA 1AXDA 4KDYA 4FO5A 4AJ6A 4JRRA 1URMA 2H73A 2HLSA 2LJRA 3IC8A 1M9BA 2B5YA 3F4RA 1R5AA 4WEYA 3GNJA 4MZWA 2OT3A 1RK4A 2RM6A 2QA1A 2FWGA 2HQTA 1Y25A 2JU5A 2YV7A 1OE7A 5IO2A 1XVWA 4GXZA 3KIJA 1AQXA 4WR4A 1M2DA 5D9XA 3F63A 3O3TA 5IOWA 4JZQA 1VF1A 3FKFA 2FUG2 3DKSA 3BJ5A 3WT2A 1GTAA 1K0AA 1OC9A 4OWYA 4BVXB 4F9ZA 5LCZA 1G0TA 4WBJA 3A5IA 4RUVA 5ECQB 2GSSA 2DIYA 1DBYA 5J47A 2NPBA 2JSZA 4MF7A 3TKSA 2L5LA 4AJ7A 4F03A 1C72A 1EWXA 3CSHA 1TXUA 4POKA 3TKPA 3GX0A 2EFDA 4DEJA 2YV9A 1XWAA 4TN8A 5G5FA 5J9CA 1HYUA 4KCAA 3L9SA 4X1UA 4K9ZA 3P90A 1FVKA 2FLSA 2YN1A 2WULA 2WJUA 1ST9A 5DCHA 1ZCPA 4Q5FA 5GAND 3E9JB 1PX6A 2VAFA 2EIQA 4DSSA 1X5CA 1A0RP 2GZPA 3MDKA 4G10A 3UVTA 3US3A 2KHPA 3GV1A 2R4VA 2YCDA 4HOJA 2PGTA 2DBCA 1XXUA 5GSTA 3H79A 3MYDA 2VCXA 3D6IA 2HXKA 2HZEB 4X4JA 4MZBA 2R2JA 1GWCA 1XWCA 5CRDA 2I81A 4XS4A 1SJ6A 4ZXGA 2F8FA 1ZZYA 4Z2TA 2QC7A 2OACA 2OE1A 5L71A 4OD7A 4G2EA 2ZCTA 3HVSA 4G0LA 5IMDA 4AKHA 3PINA 4D73B 1SVLA 2PU9C 3WGXA 1Z6MA 1BEDA 2LNSA 2PERA 1BYEA 4O92A 2CAIA 3ZZXA 1KNGA 4J56E 3BCKA 2PPTA 3QD9A 2R3XA 1GNWA 5G1LA 3I69A 4MNNA 1PMTA 3OR5A 1IYHA 1SL1B 2HE3A 2DJ3A 1Q4JA 3E0UA 3KP8A 2H66A 4Z2RA 5IMZA 2OKAA 2JSYA 4GLTA 2B7JA 5J4YA 2L4QA 4CW9A 2L6CA 1X9MB 1JLWA 1S3CA 2NTOA 2TRXA 1S3DA 3A3TA 1F6MC 4KE3A 3FEUA 4EIQA 4XHMA 1KBNA 2N5AA 5D9WA 2WDUA 2FGXA 2X8HA 4ICYA 1GUMA 2B5EA 2RUEA 2UZ8A 2GVPA 4IJ3A 2RM5A 1LBKA 4ECCA 2WZ9A 1GL8A 1PN9A 3ZRDA 4G19A 4N30A 1VF2A 16GSA 2V6OA 1TK8B 4MK3A 3ZLPA 2YWMA 11GSA 4NV5A 3IR4A 2I4AA 1MDKA 1TI3A 4L5OA 3CRTA 4QMKA 5DALB 3GSSA 1DSBA 4ZBAA 5EVOA 2X64A 2VCQA 2E0QA 1SD9A 4EVMA 1O6JA 3FR9A 3KTLA 1QGVA 1AC1A 2FWFA 3L78A 2LRNA 2R0PA 1GTUA 2GT5A 2ON5A 3UAPA 1JFUA 2DKHA 2EIRA 1NHYA 3UJ1A 3IHGA 4MPFA 4ECJA 3TKSC 2VD1A 1SK2A 4YQMA 5B8BA 3D5JA 3Q19A 2GT6A 1SK1A 1VRSD 1JZDA 4OFMA 1V58A 5G5EA 5ELGA 3HJOA 1FVJA 1WP0A 2H0GA 3C1RA 3EMPA 2K8SA 1GSFA 3ZL5A 1GSSA 4OCEA 1GRXA 5LNKe 1VF3A 4GCIA 1V57A 4WXTA 1ZYEA 4GWRA 2CT6A 3IK9A 3VWVA 2RUFA 4N3ZA 5E59A 5AIXA 4ZBBA 3CQFA 3M0FA 1PSQA 2CX4A 2H01A 5GAPD 4ZBDA 1SL0B 1XG8A 2WGRA 3AY8A 3RFRC 2QSIA 3LEFA 4K2XA 4K6XA 4RI7A 4ZB8A 3HKRA 3EURA 4USSA 3KM6A 3HZ4A 1AQVA 1W89A 4L8EA 2I1UA 2TRCP 1K0BA 3LYKA 2H71A 4Z7XA 2GTUA 1OC3A 2H1LA 3NZNA 1U3AA 2JL4A 2HSHA 4XRAA 4MF6A 4H86A 2L59A 2PMTA 4JEDA 3QAGA 1R5PA 2WVYA 2DMMA 1S3RA 3TKSE 4MJCA 1WIKA 4ZL8A 1WMJA 2OJLA 1GSUA 1SVMA 4NHZA 1N25A 2DKIA 4YAPA 3VWUA 3VK9A 3GKMA 5JCUA 3NOFA 5KOXA 3Q6OA 1BAYA 3M9KA 2UV8G 3ZVJA 4XCSA 4RI6A 2DLXA 3TGZA 1USBA 1WRYA 3DMLA 4TRXA 4MJEA 2PBJA 3IC4A 2AV4A 1TI1A 2EC4A 3WYWA 3CYNA 4FYUA 4Z2UA 4N11A 2NDOA 1O81A 4PNGA 1G6YA 1ZOFA 1NW2A 2K9FA 3RHBA 3J7Yb 5ECOB 1ACVA 3C1SA 5EPFA 4K8MA 3ZIJA 5KN0A 3IA1A 2HZFA 2DJJA 1TW9A 3F3RA 1FOVA 4BA7A 2O5VA 2P0GA 2CVBA 2V32A 5EY6A 1TRSA 1O8WA 2EFCA 5CNWA 5G1KA 2K6VA 2HRKB 5J3RA 2HRFA 5BMUA 1A0FA 2EFEA 4YAVA 3EC3A 1SD8A 2PN8A 1EOHA 3HD5A 2DSAA 1JZRA 3ZFBA 5F07A 1F3AA 3QCPA 4K5SA 1JHBA 1FG4A 1PKWA 3U5RE 4JR4A 4QL7A 1ZGNA 3MNGA 2KLXA 3DVXA 4HEA2 3H4KA 2OBKA 1ZYNA 1SVOA 1AIUA 3UIWA 2FCHA 4NXIA 4EIPA 2E2GA 1K3LA 2FA4A 2F3MA 1G6WA 5COHA 3H1NA 1SK0A 1PN0A 2MMNA 4WR5A 4GSTA 4F2IA 1LJRA 3IPZA 2XBQA 1OKTA 2LEGA 3HYPA 4TR1A 2B3SA 2XPEA 2H6XA 4ULXA 2QKEA 1EP7A 2BMXA 2HZEA 2V1MA 3GX8A 3BOAA 1XWBA 5H5RA 4MP4A 4RQRA 4EO3A 3FW2A 1I1IP 2HFDA 4K2DA 1M2AA 3EU4A 2L6DA 1EV4A 3EU3A 1ABAA 1ZYPA 4MZCA 1X9WB 1XBSA 1V9WA 4KCEA 3HDCA 3HZ8A 1TU7A 2E7PA 1KEBA 3GYKA 2JZTA 1SKRB 2B5XA 4I2TA 4D73A 1JLVA 3TOUA 9GSSA 1XPVA 2CQ9A 5C00A 3EINA 3TJGA 1U3IA 17GSA 5ECKB 1PKZA 3DGQA 3GH9A 3CRUA 2ES7A 4W66A 4ZB9A 3CSIA 3FK8A 1EV9A 12GSA 1M3IA 1YKCA 4MLYA 3QMXA 2YANA 5AGYA 3LXTA 4ECBA 4OFNA 1ZL9A 4WF4A 2IMFA 3TB2A 3VI7A 4XRDA 4J57E 3WD6A 2LQOA 2CVKA 4IN0A 3UMAA 2GS3A 2O8VB 2DJ1A 1GNEA 4Q5QA 5IO0A 3IXRA 5BMUB 3ERGA 3F0IA 2BJXA 1XWGA 4AKGA 4PHZC 5J5NA 5G30A 3ED3A 3G7IA 2E2MA 1SJIA 4OFTA 4BWSA 2F51A 2MYGA 6GSSA 3Q18A 2OA7A 4O7HA 1M3JA 3FRCA 5DALA 5CYYA 5A34B 4MPGA 3C8EA 2LV3A 2GSTA 2DIZA 1PQNA 4FYBA 4IS0A 4FIWA 1J0FA 3O76A 1HNBA 4G0IA 4PURA 1PFOA 1SKSB 2GQLA 5GZZB 4EDYA 3TJBA 4GSSA 5J4UA 4K0GA 1FAAA 3K8NA 1AAZA 4EL1A 1PL2A 3ME8A 1X0RA 2P5RA 2C4JA 1LU4A 3GFKA 2FY6A 2A2RA 1AW9A 2VD0A 3IDVA 2IL3A 2RIIA 4TR3A 4EDZA 4TR1B 4OO5A 1TK5B 3FZAA 1V98A 4ID0A 1OYJA 4HZ4A 2YWIA 3KXOA 1EEMA 1A2JA 1Z9HA 3KD0A 5ELAA 3RAZA 1TKDB 4KNDA 3F8UA 4I6XA 4G0KA 4O5UA 1YZXA 4ECIA 1B4QA 3WT1A 1NHOA 3APOA 2L4CA 1FB0A 1E2YA 5B8AA 2WCIA 1CQHA 3VURA 3LGCA 2JADA 3UBLA 4ISDA 5CRGA 5ECHB 2VO4A 3RDWA 3VI5A 1WPIA 2O3EA 1T00A 1XZOA 5A1NA 1EOGA 5IMAA 3EPTA 4TR4A 4DVCA 5ECLB 5DAKA 1Y1UA 2NBSA 2O36A 2VUPA 2LRCA 6GSVA 5AN1A 5CAXA 5ECSA 2PUKC 3CTFA 2FNOA 4IW9A 1M2BA 4EXJA 4CY8A 4TR0A 2FD3A 2L5OA 1XIYA 4WF5A 2O85A 2M80A 1DE1A 1OE8A 2FA8A 2H30A 1SENA 4Q5NA 3QDNA 2IN3A 5ECNB 5DDLA 1Z7PA 2LJKA 1PL1A 5CO3A 1HD2A 3TU3B 1XOBA 4IJIA 2YOIA 2HSNB 4HUAA 2HRNA 1GH2A 3FZ4A 3IV4A 3GURA 2LJAA 4ZB7A 1ZMAA 5H5QA 5C04A 2RLIA 4MJBA 4I97A 13GSA 1I9DA 2V2GA 4LLRA 4O32A 2HNLA 5EL8A 4KW6A 5DVBA 2HSMB 4IP1A 1YF0A 3UARA 4PI2C 1M7TA 3D4MA 2IIYA 2CX3A 1ERVA 3IBHA 3M3MA 3VLNA 3N5OA 1OC8A 2IMEA 3V1WA 2A4HA 3LG6A 3KH9A 3LSZA 4MA9A 4IBPA 4V1Ag 1GUKA 3GRXA 6GSWA 5HR2A 4ZILA 3C73A 4KA0A 1Z7RA 2IMDA 4IP6A 4KB3A 1T4ZA 4HS1A 5HFIA 3LWAA 2H1BA 4WBRD 2MMAA 5IMFA 1ILOA 1HNCA 1F3BA 2P31A 5F8BA 5FT3A 1KTEA 1XW9A 2HRKA 2YZUA 4TVEA 2GQMA 2M72A 5H5SA 5FHIA 5ECMB 4N0VA 5BRTA 1M99A 2H19A 5DBQA 4FQUA 1PRXA 5D9TA 1K0OA 4NAXA 3VPQA 3HMJG 1MD4A 3BBYA 2EIOA 4KDXA 4TKYA 2C8UA 4E8HA 2R37A 3FR3A 3R3EA 1YF1A 4BIKA 4HDEA 1TRWA 2H0HA 4DSQA 4KDUA 2C0GA 3CXGA 5HR3A 2VLTA 1GUHA 2VL9A 3CSJA 3TRQA 4IKHA 4AF2A 4GDFA 4LMWA 5ECRB 5A1NB 4ZL7A 4EKZA 2O89A 5A5KA 4ZIJA 5DAKB 3GSTA 5D9VA 4GF0A 4CY6A 1PX7A 1ERWA 5IMVA 1A8LA 3HVXA 3HJPA 3FY7A 4YKFA 3KCMA 1UC7A 2XPDA 1Z3EA 4KSMA 2IFQB 2AAWA 4IGJA 3TUEA 4O5QA 2DJ0A 2TIRA 4NWYA 5LD0A 3KMOA 3H8QA 4CDOA 1E6BA 3QAWA 1S3AA 4EE0A 2QGVA 1QFNA 4PUAA 3IRAA 2GDRA 1SJZA 3APSA 3H93A 2HT9A 1YVLA 2ZNMA 5HQPA 3CWGA 4IQAA 3F4TA 4OO4A 2MBSA 4A5PA 3D22A 5A5HB 3TOTA 1XVQA 1O73A 4AKIA 1FW1A 1S4BP 1R26A 2H76A 3IAS2 3W8SA 6GSTA 1K0CA 3KP9A 5JCGA 3HJMA 1O8XA 1OVNA 2WW2A 2WB9A 2C0DA 2LSTA 3TKRA 3TJKA 4FXYP 4HQSA 2VCZA 4G01A 3FZ9A 4DSRA 1T4YA 3RPNA 4LL1B 2N5BA 1T7PB 2XC2A 1YQ1A 3GMFA 18GSA 3PR8A 2GZZA 4HZ2A 3A2XA 2WVXB 2JZSA 3DIEA 2O87A 4ACSA 2LUSA 1BG1A 2WW1A 5J4VA 5J9BA 1DE2A 5B6NA 5DQSA 4N10A 5D93A 1QK8A 3RPPA 2YJHA 2EFHA 3N9JA 3UBKA 7GSSA 4WKWA 5JCWA 1TRUA 1AUCA 4NPBA 1VF4A 4MDCA 2YJ7A 2CA8A 5JWQB 2GQKA 2VCTA 4XTSA 2G2QA 1YKAA 1J08A 3GKNA 4PUFC 2LKUA 4KX4A 2J9HA 5A34A 4G9HA 2N5FA 3I43A 4AGSA 1K0DA 2X8CA 1B8XA 4YQVA 3TJFA 4IVFA 3TRPA 2GSRA 2DMLA 2OBIA 4L5LA 1BQ7A 5KN3A 3TDGA 4NMUA 2X4AA 4QQ7A 2H8LA 1UA5A 3MAKA 4TXOB 4KF9A 4PNFA 1FHEA 1F37A 2HSYA 3L9UA 2YWNA 4PGTA 2IMIA 2B1LA 4HU7A 4NHWA 3LXZA 1TJDA 2YP6A 2C0FA 3QPMA 3UVHA 6GSXA 2ALBA 2MZCA 2H70A 2MMOA 4MCUA 3L9VA 3UL3A 5CP1A 3DXBA 4KAEA 2IPAA 3IAM2 4GRFA 4IQ1A 1T8EB 1U6TA 1WE0A 3EE2A 1HQOA 3KTBA 3RHCA 1EGRA 3IK7A 4I2UA 4Q5RA 1TDIA 2C3QA 3IE3A 3GA4A 1JZWA 4K5RA 4L0WA 1ZYQB 5KEJA 3KJYA 3L0HA 5IQYA 2XBIA 2H6YA 2B6MA 1TTZA 3F3QA 1Y6EA 1BX9A 2IJYA 2VCVA 4PI0C 4POMA 2GLRA 4PQ1A 2QA2A 2A2PA 3QR6A 1MD3A 4ILFA 1XCCA 2OADA 3CBUA 22GSA 5FWGA 3MWHA 2AJQB 1N2AA 3CTGA 2R5GA 4V1Ap 1GLPA 2WS2A 3PGTA 4V2LA 4ZL9A 2KUCA 4EUYA 1SYRA 4HU9A 1X9SB 3BCIA 1R4WA 1Q98A 2H1GA 5B7CA 2X8GA 2JZRA 4POLA 2HSNA 3LQ7A 1T3BA 1XOAA 1YY7A 2DJ2A 5JWOB 3EVIA 1OKDA 1W4VA 2B7KA 3C71A 20GSA 2CAQA 3F6FA 4BL7B 1A24A 1M9AA 5DQYA 3VWWA 2H1AA 3ME7A 4V2MA 1HNAA 2Z9SA 2L57A 2HSMA 2AB6A 5J40A 2VM2A 1ON4A 1G7OA 3I9V2 1OAZA 3DVWA 3CHXC 1A23A 3PH9A 4JBBA 2WVZA 2VKZG 5HR1A 1ERTA 4I5QA 1RW1A 2GZYA 3ZVJD 1DUGA 2WZSA 4HQZA 4NV2A 3MSZA 2HYXA 1B9YC 2KP1A 4FYCA 4PX1A 4LMVA 1TU8A 4MJAA 1QXHA 5DCGA 5F05A 1V2AA 1O7UA 3A2VA 2VM1A 4KSOA 1WWJA 3DEXA 3I6AA 1BJXA 5ID2A 5CRWA 2IWTA 4K7IA 3UEMA 3NIVA 3MIXA 3JCML 4AKXB 1QMVA 10GSA 4GSNA 3J7Yk 4MH3A 2LTKA 3GIXA 3HY2A 5ABRA 3HXSA 1SL2B 4BWQA 3F9UA 2X49A 1CQGA 3GN3A 3GTUA 3BD2A 3APQA 1QUWA 1BF5A 2I9HA 2WFCA 1XFLA 2CZ3A 2I3YA 4PQIA 4YH2A 2OE3A 4YKGA 2C1YA 1QQ2A 1MEKA 3ZFLA 1EZKA 3ZIVA 3DWVA 3F4SA 3M9JA 5AIVA 1ERUA 2LS5A 1THOA
chains in the Genus database with same CATH topology
3FZ5A 2IFQA 2OE0A 3GHAA 4P3YB 14GSA 4F0CA 3M1GA 4MF5A 5ECPB 1GSDA 4JR6A 3TKQA 4K7OA 4O5RA 1N8JA 2FWEA 1B4PA 4EC0A 2VIMA 1U87A 3U6VA 5A5HA 2VLVA 2YPMA 3LORA 2VCWA 1OC9B 1VGLA 4LL4B 1T1VA 3ZMLA 5A4WA 2VL2A 4MABA 1I5GA 2H74A 3VFIA 3LW9A 1GTBA 2WRTA 4TW5A 2F8AA 3EWLA 1XW5A 1IYIA 3IOSA 1UVZA 3ZREA 1B9XC 4GQCA 3KGKA 2IMKA 1XW6A 3C7MA 2AUVA 1RQMA 1K0NA 4HJ2A 3A2WA 5IPHA 4L0UA 2DJKA 3EMXA 3A5WA 1NM3A 1F2EA 1H4OA 4K7NA 2BTOT 2HI7A 1EP8A 4ML6A 2NVLA 2REMA 1WOUA 4IELA 19GSA 1WJKA 2C80A 2VL3A 4OCFA 4E8EA 1TRVA 2V6KA 1JZOA 1PD21 5ID2B 2MBTA 3KH7A 5CRHA 4DSSB 2V41A 5DJLA 1YDKA 1GSQA 3D4TA 1XWKA 4WETA 5IMCA 3LFLA 3D0ZA 3P2AA 4F0BA 3GL3A 3GH6A 2GSQA 3EYTA 5HFGA 1Z5YE 1SU9A 2H72A 3SWLA 5IOXA 4PXOA 4KUNA 2DC5A 3GTUB 2H0IA 3HHVA 3G7JA 2D2ZA 1F9MA 1MDJA 3W8JA 4XS4B 2KP2A 1SKWB 6GSUA 3P8WA 5KOWA 4JE1A 2R6KA 8GSSA 4TXOA 2LNTA 3L4NA 6GSYA 3ZMKA 4I8BA 4E68A 1SYXA 4MH2A 2H6ZA 4FH8A 4QL9A 4N0ZA 4K0NA 2LRTA 3GKXA 2O7KA 1MDIA 2JACA 3ERFA 1K3YA 1UN2A 3TCOA 1GSEA 2KOKA 2R0CA 4PQHA 1A8YA 5F0GA 5KN1A 2PVQA 4LA1A 5F06A 1MTCA 3LYPA 5D8IA 1K0MA 1R7HA 1FO5A 4BVYA 4ZB6A 3PPUA 2YNXA 5GSSA 4AI6A 1Z6NA 1GP1A 4XIHA 3CMIA 3QAVA 4J2FA 4K1FA 5G2ZA 4GTUA 4HJMA 3GUSA 3KMNA 1NSWA 1GULA 2R0GA 1A2MA 2F9SA 1X5DA 4XS1A 4MMMA 1PGTA 4KGIA 5IIZA 3IHQA 1GTIA 3E3EA 1YEPA 3VWXA 3HA9A 4KH7A 5D73A 5E4WA 4YQUA 1TP9A 2YZHA 1EGOA 2CVDA 4IHUA 4HI7A 1O85A 3QOUA 4TOPA 5HFKA 3FMWA 3D21A 3LJRA 2HRAA 1J9BA 3DYRA 4GQFA 2LQQA 3RBTA 1AQWA 3VPTA 2B1KA 2YWOA 3HVVA 5INYA 1M0UA 5KN2A 3SBCA 2VL2C 2P5QA 2XHFA 4TXVA 4F82A 3G9BA 2ON7A 1X5EA 4BL7A 3QFAC 5HR0A 2CZ2A 4RQXA 2A2SA 3GL5A 2PWJA 4BVXA 4BPYA 1K3OA 3HCZA 1U88A 5AISA 2AYTA 3TRXA 4PTSA 3ERWA 4ML1A 3WGEA 2GGTA 3TJJA 1FB6A 2C3NA 2H1DA 2VOCA 4X0XA 4EF0A 5ECIB 3QFBC 2PVOC 1YJ6A 2K18A 4AJ8A 1BG5A 1G7EA 5J41A 2H75A 2J23A 5A4UA 1V40A 2M46A 2FWHA 3FR6A 2X99A 1THXA 3UOMA 1TK0B 4CHSA 3G7YA 4XS6A 1TOFA 1H75A 3ZYWA 1PA3A 3FYGA 1FOHA 5B6MA 2C0EA 5IM9A 2K8VA 1GLQA 1TXXA 4OMVA 2A4VA 3KZQA 5G31A 1A2LA 1B48A 3P7XA 4JU5A 3ZITA 1GSYA 3WGDA 3DRNA 2C3TA 3Q74A 3ZTLA 4X43A 5A4VA 5JWRB 4BVYB 4POBA 2MMZA 5D96A 3R2QA 5ENUA 3DD3A 3FHKA 3KEBA 1YEXA 2ZUPA 3F6DA 1EEJA 4V2NA 5CREA 2AHEA 2FHEA 3O6TA 5IPGA 3M8NA 3GKKA 3S9FA 2G0FA 3W6GA 1ML6A 3ISOA 2VLUA 2CV4A 5DJMA 1AXDA 4KDYA 4FO5A 4AJ6A 4JRRA 1URMA 2H73A 2HLSA 2LJRA 3IC8A 1M9BA 2B5YA 3F4RA 1R5AA 4WEYA 3GNJA 4MZWA 2OT3A 1RK4A 2RM6A 2QA1A 2FWGA 2HQTA 1Y25A 2JU5A 2YV7A 1OE7A 5IO2A 1XVWA 4GXZA 3KIJA 1AQXA 4WR4A 1M2DA 5D9XA 3F63A 3O3TA 5IOWA 4JZQA 1VF1A 3FKFA 2FUG2 3DKSA 3BJ5A 3WT2A 1GTAA 1K0AA 1OC9A 4OWYA 4BVXB 4F9ZA 5LCZA 1G0TA 4WBJA 3A5IA 4RUVA 5ECQB 2GSSA 2DIYA 1DBYA 5J47A 2NPBA 2JSZA 4MF7A 3TKSA 2L5LA 4AJ7A 4F03A 1C72A 1EWXA 3CSHA 1TXUA 4POKA 3TKPA 3GX0A 2EFDA 4DEJA 2YV9A 1XWAA 4TN8A 5G5FA 5J9CA 1HYUA 4KCAA 3L9SA 4X1UA 4K9ZA 3P90A 1FVKA 2FLSA 2YN1A 2WULA 2WJUA 1ST9A 5DCHA 1ZCPA 4Q5FA 5GAND 3E9JB 1PX6A 2VAFA 2EIQA 4DSSA 1X5CA 1A0RP 2GZPA 3MDKA 4G10A 3UVTA 3US3A 2KHPA 3GV1A 2R4VA 2YCDA 4HOJA 2PGTA 2DBCA 1XXUA 5GSTA 3H79A 3MYDA 2VCXA 3D6IA 2HXKA 2HZEB 4X4JA 4MZBA 2R2JA 1GWCA 1XWCA 5CRDA 2I81A 4XS4A 1SJ6A 4ZXGA 2F8FA 1ZZYA 4Z2TA 2QC7A 2OACA 2OE1A 5L71A 4OD7A 4G2EA 2ZCTA 3HVSA 4G0LA 5IMDA 4AKHA 3PINA 4D73B 1SVLA 2PU9C 3WGXA 1Z6MA 1BEDA 2LNSA 2PERA 1BYEA 4O92A 2CAIA 3ZZXA 1KNGA 4J56E 3BCKA 2PPTA 3QD9A 2R3XA 1GNWA 5G1LA 3I69A 4MNNA 1PMTA 3OR5A 1IYHA 1SL1B 2HE3A 2DJ3A 1Q4JA 3E0UA 3KP8A 2H66A 4Z2RA 5IMZA 2OKAA 2JSYA 4GLTA 2B7JA 5J4YA 2L4QA 4CW9A 2L6CA 1X9MB 1JLWA 1S3CA 2NTOA 2TRXA 1S3DA 3A3TA 1F6MC 4KE3A 3FEUA 4EIQA 4XHMA 1KBNA 2N5AA 5D9WA 2WDUA 2FGXA 2X8HA 4ICYA 1GUMA 2B5EA 2RUEA 2UZ8A 2GVPA 4IJ3A 2RM5A 1LBKA 4ECCA 2WZ9A 1GL8A 1PN9A 3ZRDA 4G19A 4N30A 1VF2A 16GSA 2V6OA 1TK8B 4MK3A 3ZLPA 2YWMA 11GSA 4NV5A 3IR4A 2I4AA 1MDKA 1TI3A 4L5OA 3CRTA 4QMKA 5DALB 3GSSA 1DSBA 4ZBAA 5EVOA 2X64A 2VCQA 2E0QA 1SD9A 4EVMA 1O6JA 3FR9A 3KTLA 1QGVA 1AC1A 2FWFA 3L78A 2LRNA 2R0PA 1GTUA 2GT5A 2ON5A 3UAPA 1JFUA 2DKHA 2EIRA 1NHYA 3UJ1A 3IHGA 4MPFA 4ECJA 3TKSC 2VD1A 1SK2A 4YQMA 5B8BA 3D5JA 3Q19A 2GT6A 1SK1A 1VRSD 1JZDA 4OFMA 1V58A 5G5EA 5ELGA 3HJOA 1FVJA 1WP0A 2H0GA 3C1RA 3EMPA 2K8SA 1GSFA 3ZL5A 1GSSA 4OCEA 1GRXA 5LNKe 1VF3A 4GCIA 1V57A 4WXTA 1ZYEA 4GWRA 2CT6A 3IK9A 3VWVA 2RUFA 4N3ZA 5E59A 5AIXA 4ZBBA 3M0FA 1PSQA 2CX4A 2H01A 5GAPD 4ZBDA 1SL0B 2WGRA 3AY8A 2QSIA 3LEFA 4K2XA 4K6XA 4RI7A 4ZB8A 3HKRA 3EURA 4USSA 3KM6A 3HZ4A 1AQVA 1W89A 4L8EA 2I1UA 2TRCP 1K0BA 3LYKA 2H71A 4Z7XA 2GTUA 1OC3A 2H1LA 3NZNA 1U3AA 2JL4A 2HSHA 4XRAA 4MF6A 4H86A 2L59A 2PMTA 4JEDA 3QAGA 1R5PA 2DMMA 3TKSE 4MJCA 1WIKA 4ZL8A 1WMJA 2OJLA 1GSUA 1SVMA 4NHZA 1N25A 2DKIA 4YAPA 3VWUA 3VK9A 3GKMA 5JCUA 3NOFA 5KOXA 3Q6OA 1BAYA 3M9KA 2UV8G 3ZVJA 4XCSA 4RI6A 2DLXA 3TGZA 1USBA 1WRYA 3DMLA 4TRXA 4MJEA 2PBJA 3IC4A 2AV4A 1TI1A 2EC4A 3WYWA 3CYNA 4FYUA 4Z2UA 4N11A 2NDOA 1O81A 4PNGA 1G6YA 1ZOFA 1NW2A 2K9FA 3RHBA 3J7Yb 5ECOB 1ACVA 3C1SA 5EPFA 4K8MA 3ZIJA 5KN0A 3IA1A 2HZFA 2DJJA 1TW9A 3F3RA 1FOVA 4BA7A 2O5VA 2P0GA 2CVBA 2V32A 5EY6A 1TRSA 1O8WA 2EFCA 5CNWA 5G1KA 2K6VA 2HRKB 5J3RA 2HRFA 5BMUA 1A0FA 2EFEA 4YAVA 3EC3A 1SD8A 2PN8A 1EOHA 3HD5A 2DSAA 1JZRA 3ZFBA 5F07A 1F3AA 3QCPA 4K5SA 1JHBA 1FG4A 1PKWA 3U5RE 4JR4A 4QL7A 1ZGNA 3MNGA 2KLXA 3DVXA 4HEA2 3H4KA 2OBKA 1ZYNA 1SVOA 1AIUA 3UIWA 2FCHA 4NXIA 4EIPA 2E2GA 1K3LA 2FA4A 2F3MA 1G6WA 5COHA 3H1NA 1SK0A 1PN0A 2MMNA 4WR5A 4GSTA 4F2IA 1LJRA 3IPZA 2XBQA 1OKTA 2LEGA 3HYPA 4TR1A 2B3SA 2XPEA 2H6XA 4ULXA 2QKEA 1EP7A 2BMXA 2HZEA 2V1MA 3GX8A 3BOAA 1XWBA 5H5RA 4MP4A 4RQRA 4EO3A 3FW2A 2HFDA 4K2DA 1M2AA 3EU4A 2L6DA 1EV4A 3EU3A 1ABAA 1ZYPA 4MZCA 1X9WB 1XBSA 1V9WA 4KCEA 3HDCA 3HZ8A 1TU7A 2E7PA 1KEBA 3GYKA 2JZTA 1SKRB 2B5XA 4I2TA 4D73A 1JLVA 3TOUA 9GSSA 1XPVA 2CQ9A 5C00A 3EINA 3TJGA 1U3IA 17GSA 5ECKB 1PKZA 3DGQA 3GH9A 3CRUA 2ES7A 4W66A 4ZB9A 3CSIA 3FK8A 1EV9A 12GSA 1YKCA 4MLYA 3QMXA 2YANA 5AGYA 3LXTA 4ECBA 4OFNA 1ZL9A 4WF4A 2IMFA 3TB2A 3VI7A 4XRDA 4J57E 3WD6A 2LQOA 2CVKA 4IN0A 3UMAA 2GS3A 2O8VB 2DJ1A 1GNEA 4Q5QA 5IO0A 3IXRA 5BMUB 3ERGA 3F0IA 2BJXA 1XWGA 4AKGA 5J5NA 5G30A 3ED3A 3G7IA 2E2MA 1SJIA 4OFTA 4BWSA 2F51A 2MYGA 6GSSA 3Q18A 2OA7A 4O7HA 3FRCA 5DALA 5CYYA 5A34B 4MPGA 3C8EA 2LV3A 2GSTA 2DIZA 1PQNA 4FYBA 4IS0A 4FIWA 1J0FA 3O76A 1HNBA 4G0IA 4PURA 1SKSB 2GQLA 5GZZB 4EDYA 3TJBA 4GSSA 5J4UA 4K0GA 1FAAA 3K8NA 1AAZA 4EL1A 1PL2A 3ME8A 1X0RA 2P5RA 2C4JA 1LU4A 3GFKA 2FY6A 2A2RA 1AW9A 2VD0A 3IDVA 2IL3A 2RIIA 4TR3A 4EDZA 4TR1B 4OO5A 1TK5B 3FZAA 1V98A 4ID0A 1OYJA 4HZ4A 2YWIA 3KXOA 1EEMA 1A2JA 1Z9HA 3KD0A 5ELAA 3RAZA 1TKDB 4KNDA 3F8UA 4I6XA 4G0KA 4O5UA 1YZXA 4ECIA 1B4QA 3WT1A 1NHOA 3APOA 2L4CA 1FB0A 1E2YA 5B8AA 2WCIA 1CQHA 3VURA 3LGCA 2JADA 3UBLA 4ISDA 5CRGA 5ECHB 2VO4A 3RDWA 3VI5A 1WPIA 1XZOA 1T00A 5A1NA 1EOGA 5IMAA 3EPTA 4TR4A 4DVCA 5ECLB 5DAKA 1Y1UA 2NBSA 2VUPA 2LRCA 6GSVA 5AN1A 5CAXA 5ECSA 2PUKC 3CTFA 2FNOA 4IW9A 1M2BA 4EXJA 4CY8A 4TR0A 2FD3A 2L5OA 1XIYA 4WF5A 2O85A 2M80A 1DE1A 1OE8A 2FA8A 2H30A 1SENA 4Q5NA 3QDNA 2IN3A 5ECNB 5DDLA 1Z7PA 2LJKA 1PL1A 5CO3A 1HD2A 3TU3B 1XOBA 4IJIA 2YOIA 2HSNB 4HUAA 2HRNA 1GH2A 3FZ4A 3IV4A 3GURA 2LJAA 4ZB7A 1ZMAA 5H5QA 5C04A 2RLIA 4MJBA 4I97A 13GSA 1I9DA 2V2GA 4LLRA 4O32A 2HNLA 5EL8A 4KW6A 5DVBA 2HSMB 4IP1A 1YF0A 3UARA 1M7TA 3D4MA 2IIYA 2CX3A 1ERVA 3IBHA 3M3MA 3VLNA 3N5OA 1OC8A 2IMEA 3V1WA 2A4HA 3LG6A 3KH9A 3LSZA 4MA9A 4IBPA 4V1Ag 1GUKA 3GRXA 6GSWA 5HR2A 4ZILA 3C73A 4KA0A 1Z7RA 2IMDA 4IP6A 4KB3A 1T4ZA 4HS1A 5HFIA 3LWAA 2H1BA 4WBRD 2MMAA 5IMFA 1ILOA 1HNCA 1F3BA 2P31A 5F8BA 5FT3A 1KTEA 1XW9A 2HRKA 2YZUA 4TVEA 2GQMA 2M72A 5H5SA 5FHIA 5ECMB 4N0VA 5BRTA 1M99A 2H19A 5DBQA 4FQUA 1PRXA 5D9TA 1K0OA 4NAXA 3VPQA 3HMJG 1MD4A 3BBYA 2EIOA 4KDXA 4TKYA 2C8UA 4E8HA 2R37A 3FR3A 3R3EA 1YF1A 4HDEA 1TRWA 2H0HA 4DSQA 4KDUA 2C0GA 3CXGA 5HR3A 2VLTA 1GUHA 2VL9A 3CSJA 3TRQA 4IKHA 4AF2A 4GDFA 4LMWA 5ECRB 5A1NB 4ZL7A 4EKZA 2O89A 5A5KA 4ZIJA 5DAKB 3GSTA 5D9VA 4GF0A 4CY6A 1PX7A 1ERWA 5IMVA 1A8LA 3HVXA 3HJPA 3FY7A 4YKFA 3KCMA 1UC7A 2XPDA 1Z3EA 4KSMA 2IFQB 2AAWA 4IGJA 3TUEA 4O5QA 2DJ0A 2TIRA 4NWYA 5LD0A 3KMOA 3H8QA 4CDOA 1E6BA 3QAWA 1S3AA 4EE0A 2QGVA 1QFNA 4PUAA 3IRAA 2GDRA 1SJZA 3APSA 3H93A 2HT9A 1YVLA 2ZNMA 5HQPA 3CWGA 4IQAA 3F4TA 4OO4A 2MBSA 4A5PA 3D22A 5A5HB 3TOTA 1XVQA 1O73A 4AKIA 1FW1A 1R26A 2H76A 3IAS2 3W8SA 6GSTA 1K0CA 3KP9A 5JCGA 3HJMA 1O8XA 1OVNA 2WB9A 2C0DA 2LSTA 3TKRA 3TJKA 4HQSA 2VCZA 4G01A 3FZ9A 4DSRA 1T4YA 3RPNA 4LL1B 2N5BA 1T7PB 2XC2A 1YQ1A 3GMFA 18GSA 3PR8A 2GZZA 4HZ2A 3A2XA 2JZSA 3DIEA 2O87A 4ACSA 2LUSA 1BG1A 5J4VA 5J9BA 1DE2A 5B6NA 5DQSA 4N10A 5D93A 1QK8A 3RPPA 2YJHA 2EFHA 3N9JA 3UBKA 7GSSA 4WKWA 5JCWA 1TRUA 1AUCA 4NPBA 1VF4A 4MDCA 2YJ7A 2CA8A 5JWQB 2GQKA 2VCTA 4XTSA 2G2QA 1YKAA 1J08A 3GKNA 4PUFC 2LKUA 4KX4A 2J9HA 5A34A 4G9HA 2N5FA 3I43A 4AGSA 1K0DA 2X8CA 1B8XA 4YQVA 3TJFA 4IVFA 3TRPA 2GSRA 2DMLA 2OBIA 4L5LA 1BQ7A 5KN3A 3TDGA 4NMUA 2X4AA 4QQ7A 2H8LA 1UA5A 3MAKA 4TXOB 4KF9A 4PNFA 1FHEA 1F37A 2HSYA 3L9UA 2YWNA 4PGTA 2IMIA 2B1LA 4HU7A 4NHWA 3LXZA 1TJDA 2YP6A 2C0FA 3QPMA 3UVHA 6GSXA 2ALBA 2MZCA 2H70A 2MMOA 4MCUA 3L9VA 3UL3A 5CP1A 3DXBA 4KAEA 2IPAA 3IAM2 4GRFA 4IQ1A 1T8EB 1U6TA 1WE0A 3EE2A 1HQOA 3KTBA 3RHCA 1EGRA 3IK7A 4I2UA 4Q5RA 1TDIA 2C3QA 3IE3A 3GA4A 1JZWA 4K5RA 4L0WA 1ZYQB 5KEJA 3KJYA 3L0HA 5IQYA 2XBIA 2H6YA 2B6MA 1TTZA 3F3QA 1Y6EA 1BX9A 2IJYA 2VCVA 4POMA 2GLRA 4PQ1A 2QA2A 2A2PA 3QR6A 1MD3A 4ILFA 1XCCA 2OADA 3CBUA 22GSA 5FWGA 3MWHA 2AJQB 1N2AA 3CTGA 2R5GA 4V1Ap 1GLPA 2WS2A 3PGTA 4V2LA 4ZL9A 2KUCA 4EUYA 1SYRA 4HU9A 1X9SB 3BCIA 1R4WA 1Q98A 2H1GA 5B7CA 2X8GA 2JZRA 4POLA 2HSNA 3LQ7A 1T3BA 1XOAA 1YY7A 2DJ2A 5JWOB 3EVIA 1OKDA 1W4VA 2B7KA 3C71A 20GSA 2CAQA 3F6FA 4BL7B 1A24A 1M9AA 5DQYA 3VWWA 2H1AA 3ME7A 4V2MA 1HNAA 2Z9SA 2L57A 2HSMA 2AB6A 5J40A 2VM2A 1ON4A 1G7OA 3I9V2 1OAZA 3DVWA 1A23A 3PH9A 4JBBA 2VKZG 5HR1A 1ERTA 4I5QA 1RW1A 2GZYA 3ZVJD 1DUGA 4HQZA 4NV2A 3MSZA 2HYXA 1B9YC 2KP1A 4FYCA 4PX1A 4LMVA 1TU8A 4MJAA 1QXHA 5DCGA 5F05A 1V2AA 1O7UA 3A2VA 2VM1A 4KSOA 1WWJA 3DEXA 3I6AA 1BJXA 5ID2A 5CRWA 2IWTA 4K7IA 3UEMA 3NIVA 3MIXA 3JCML 4AKXB 1QMVA 10GSA 4GSNA 3J7Yk 4MH3A 2LTKA 3GIXA 3HY2A 5ABRA 3HXSA 1SL2B 4BWQA 3F9UA 2X49A 1CQGA 3GN3A 3GTUA 3BD2A 3APQA 1QUWA 1BF5A 2I9HA 2WFCA 1XFLA 2CZ3A 2I3YA 4PQIA 4YH2A 2OE3A 4YKGA 2C1YA 1QQ2A 1MEKA 3ZFLA 1EZKA 3ZIVA 3DWVA 3F4SA 3M9JA 5AIVA 1ERUA 2LS5A 1THOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZ5 A;  2IFQ A;  2OE0 A;  3GHA A;  4P3Y B;  14GS A;  4F0C A;  3M1G A;  4MF5 A;  5ECP B;  1GSD A;  4JR6 A;  3TKQ A;  4K7O A;  4O5R A;  1N8J A;  2FWE A;  1B4P A;  4EC0 A;  2VIM A;  1U87 A;  3U6V A;  2VLV A;  2YPM A;  3LOR A;  2VCW A;  1OC9 B;  1VGL A;  4LL4 B;  1T1V A;  3ZML A;  5A4W A;  2VL2 A;  4MAB A;  1I5G A;  2H74 A;  3VFI A;  1GTB A;  2WRT A;  4TW5 A;  2F8A A;  3EWL A;  1XW5 A;  1IYI A;  3IOS A;  1UVZ A;  3ZRE A;  1B9X C;  4GQC A;  3KGK A;  2IMK A;  1XW6 A;  3C7M A;  2AUV A;  1RQM A;  1K0N A;  4HJ2 A;  3A2W A;  5IPH A;  4L0U A;  2DJK A;  3EMX A;  3A5W A;  1NM3 A;  1F2E A;  1H4O A;  4K7N A;  2BTO T;  2HI7 A;  1EP8 A;  4ML6 A;  2NVL A;  2REM A;  1WOU A;  4IEL A;  19GS A;  1WJK A;  2C80 A;  2VL3 A;  4OCF A;  4E8E A;  1TRV A;  2V6K A;  1JZO A;  1PD2 1;  5ID2 B;  2MBT A;  3KH7 A;  5CRH A;  4DSS B;  2V41 A;  5DJL A;  1YDK A;  1GSQ A;  3D4T A;  1XWK A;  4WET A;  5IMC A;  3LFL A;  3D0Z A;  3P2A A;  4F0B A;  3GL3 A;  3GH6 A;  2GSQ A;  3EYT A;  5HFG A;  1Z5Y E;  1SU9 A;  2H72 A;  3SWL A;  5IOX A;  4PXO A;  4KUN A;  2DC5 A;  3GTU B;  2H0I A;  3HHV A;  3G7J A;  2D2Z A;  1F9M A;  1MDJ A;  3W8J A;  4XS4 B;  2KP2 A;  1SKW B;  6GSU A;  3P8W A;  4JE1 A;  2R6K A;  8GSS A;  4TXO A;  2LNT A;  3L4N A;  6GSY A;  3ZMK A;  4I8B A;  1SYX A;  4MH2 A;  2H6Z A;  4FH8 A;  4QL9 A;  4N0Z A;  4K0N A;  2LRT A;  3GKX A;  2O7K A;  1MDI A;  2JAC A;  3ERF A;  1K3Y A;  1UN2 A;  3TCO A;  1GSE A;  2KOK A;  4PQH A;  1A8Y A;  5F0G A;  5KN1 A;  2PVQ A;  4LA1 A;  5F06 A;  1MTC A;  3LYP A;  5D8I A;  1K0M A;  1R7H A;  1FO5 A;  4BVY A;  4ZB6 A;  3PPU A;  2YNX A;  5GSS A;  1Z6N A;  1GP1 A;  4XIH A;  3CMI A;  3QAV A;  4J2F A;  4K1F A;  5G2Z A;  4GTU A;  4HJM A;  3GUS A;  3KMN A;  1NSW A;  1GUL A;  1A2M A;  2F9S A;  1X5D A;  4XS1 A;  4MMM A;  1PGT A;  4KGI A;  5IIZ A;  3IHQ A;  1GTI A;  3E3E A;  1YEP A;  3VWX A;  3HA9 A;  4KH7 A;  5D73 A;  5E4W A;  4YQU A;  1TP9 A;  2YZH A;  1EGO A;  2CVD A;  4IHU A;  4HI7 A;  1O85 A;  3QOU A;  4TOP A;  5HFK A;  3D21 A;  3LJR A;  2HRA A;  1J9B A;  3DYR A;  4GQF A;  2LQQ A;  3RBT A;  1AQW A;  3VPT A;  2B1K A;  2YWO A;  3HVV A;  5INY A;  1M0U A;  5KN2 A;  3SBC A;  2VL2 C;  2P5Q A;  2XHF A;  4TXV A;  4F82 A;  3G9B A;  2ON7 A;  1X5E A;  4BL7 A;  3QFA C;  5HR0 A;  2CZ2 A;  4RQX A;  2A2S A;  3GL5 A;  2PWJ A;  4BVX A;  4BPY A;  1K3O A;  3HCZ A;  1U88 A;  5AIS A;  2AYT A;  3TRX A;  4PTS A;  3ERW A;  4ML1 A;  3WGE A;  2GGT A;  3TJJ A;  1FB6 A;  2C3N A;  2H1D A;  2VOC A;  4X0X A;  4EF0 A;  5ECI B;  3QFB C;  2PVO C;  1YJ6 A;  2K18 A;  4AJ8 A;  1BG5 A;  1G7E A;  5J41 A;  2H75 A;  2J23 A;  5A4U A;  1V40 A;  2M46 A;  2FWH A;  3FR6 A;  2X99 A;  1THX A;  3UOM A;  1TK0 B;  4CHS A;  3G7Y A;  4XS6 A;  1TOF A;  1H75 A;  3ZYW A;  1PA3 A;  3FYG A;  5B6M A;  2C0E A;  5IM9 A;  2K8V A;  1GLQ A;  1TXX A;  4OMV A;  2A4V A;  3KZQ A;  5G31 A;  1A2L A;  1B48 A;  3P7X A;  4JU5 A;  3ZIT A;  1GSY A;  3WGD A;  3DRN A;  2C3T A;  3Q74 A;  3ZTL A;  4X43 A;  5A4V A;  5JWR B;  4BVY B;  4POB A;  2MMZ A;  5D96 A;  3R2Q A;  5ENU A;  3DD3 A;  3FHK A;  3KEB A;  1YEX A;  2ZUP A;  3F6D A;  1EEJ A;  4V2N A;  5CRE A;  2AHE A;  2FHE A;  3O6T A;  5IPG A;  3M8N A;  3GKK A;  3S9F A;  2G0F A;  3W6G A;  1ML6 A;  3ISO A;  2VLU A;  2CV4 A;  5DJM A;  1AXD A;  4KDY A;  4FO5 A;  4AJ6 A;  4JRR A;  1URM A;  2H73 A;  2HLS A;  2LJR A;  3IC8 A;  1M9B A;  2B5Y A;  3F4R A;  1R5A A;  4WEY A;  3GNJ A;  4MZW A;  1RK4 A;  2FWG A;  1Y25 A;  2RM6 A;  2HQT A;  2JU5 A;  2YV7 A;  1OE7 A;  5IO2 A;  1XVW A;  4GXZ A;  3KIJ A;  1AQX A;  4WR4 A;  1M2D A;  5D9X A;  3F63 A;  3O3T A;  5IOW A;  4JZQ A;  1VF1 A;  3FKF A;  2FUG 2;  3DKS A;  3BJ5 A;  3WT2 A;  1GTA A;  1K0A A;  1OC9 A;  4OWY A;  4BVX B;  4F9Z A;  5LCZ A;  1G0T A;  4WBJ A;  4RUV A;  5ECQ B;  2GSS A;  2DIY A;  1DBY A;  2NPB A;  2JSZ A;  4MF7 A;  3TKS A;  2L5L A;  4AJ7 A;  4F03 A;  1C72 A;  1EWX A;  3CSH A;  4POK A;  3TKP A;  3GX0 A;  4DEJ A;  2YV9 A;  1XWA A;  4TN8 A;  5G5F A;  5J9C A;  1HYU A;  4KCA A;  3L9S A;  4X1U A;  4K9Z A;  3P90 A;  1FVK A;  2FLS A;  2YN1 A;  2WUL A;  2WJU A;  1ST9 A;  5DCH A;  1ZCP A;  4Q5F A;  5GAN D;  3E9J B;  1PX6 A;  2VAF A;  2EIQ A;  4DSS A;  1X5C A;  1A0R P;  2GZP A;  3MDK A;  4G10 A;  3UVT A;  3US3 A;  2KHP A;  3GV1 A;  2R4V A;  2YCD A;  4HOJ A;  2PGT A;  2DBC A;  1XXU A;  5GST A;  3H79 A;  2VCX A;  3D6I A;  2HXK A;  2HZE B;  4MZB A;  2R2J A;  1GWC A;  1XWC A;  5CRD A;  2I81 A;  4XS4 A;  1SJ6 A;  4ZXG A;  2F8F A;  1ZZY A;  2QC7 A;  2OAC A;  2OE1 A;  5L71 A;  4OD7 A;  4G2E A;  2ZCT A;  3HVS A;  4G0L A;  5IMD A;  3PIN A;  4D73 B;  2PU9 C;  3WGX A;  1Z6M A;  1BED A;  2LNS A;  2PER A;  1BYE A;  4O92 A;  2CAI A;  3ZZX A;  1KNG A;  4J56 E;  3BCK A;  2PPT A;  3QD9 A;  2R3X A;  1GNW A;  5G1L A;  3I69 A;  1PMT A;  3OR5 A;  1IYH A;  1SL1 B;  2HE3 A;  2DJ3 A;  1Q4J A;  3E0U A;  3KP8 A;  2H66 A;  5IMZ A;  2OKA A;  2JSY A;  4GLT A;  2B7J A;  2L4Q A;  4CW9 A;  2L6C A;  1X9M B;  1JLW A;  1S3C A;  2NTO A;  2TRX A;  1S3D A;  3A3T A;  1F6M C;  4KE3 A;  3FEU A;  4XHM A;  1KBN A;  2N5A A;  5D9W A;  2WDU A;  2FGX A;  2X8H A;  1GUM A;  2B5E A;  2RUE A;  4IJ3 A;  2UZ8 A;  2GVP A;  2RM5 A;  1LBK A;  4ECC A;  2WZ9 A;  1GL8 A;  1PN9 A;  3ZRD A;  4G19 A;  4N30 A;  1VF2 A;  16GS A;  2V6O A;  1TK8 B;  4MK3 A;  3ZLP A;  2YWM A;  11GS A;  4NV5 A;  3IR4 A;  2I4A A;  1MDK A;  1TI3 A;  4L5O A;  3CRT A;  5DAL B;  3GSS A;  1DSB A;  4ZBA A;  5EVO A;  2X64 A;  2VCQ A;  2E0Q A;  1SD9 A;  4EVM A;  1O6J A;  3FR9 A;  3KTL A;  1QGV A;  1AC1 A;  2FWF A;  3L78 A;  2LRN A;  1GTU A;  2GT5 A;  2ON5 A;  3UAP A;  1JFU A;  2EIR A;  1NHY A;  3UJ1 A;  4MPF A;  4ECJ A;  3TKS C;  2VD1 A;  1SK2 A;  4YQM A;  5B8B A;  3D5J A;  3Q19 A;  2GT6 A;  1SK1 A;  1VRS D;  1JZD A;  4OFM A;  1V58 A;  5G5E A;  5ELG A;  3HJO A;  1FVJ A;  1WP0 A;  2H0G A;  3C1R A;  3EMP A;  2K8S A;  1GSF A;  3ZL5 A;  1GSS A;  4OCE A;  1GRX A;  5LNK e;  1VF3 A;  4GCI A;  1V57 A;  4WXT A;  1ZYE A;  4GWR A;  2CT6 A;  3IK9 A;  3VWV A;  2RUF A;  5E59 A;  5AIX A;  4ZBB A;  3M0F A;  1PSQ A;  2CX4 A;  2H01 A;  5GAP D;  4ZBD A;  1SL0 B;  2WGR A;  3AY8 A;  2QSI A;  3LEF A;  4K6X A;  4RI7 A;  4ZB8 A;  3HKR A;  3EUR A;  4USS A;  3KM6 A;  3HZ4 A;  1AQV A;  1W89 A;  4L8E A;  2I1U A;  2TRC P;  1K0B A;  3LYK A;  2H71 A;  4Z7X A;  2GTU A;  1OC3 A;  3NZN A;  1U3A A;  2JL4 A;  2HSH A;  4XRA A;  4MF6 A;  4H86 A;  2L59 A;  2PMT A;  4JED A;  3QAG A;  1R5P A;  2DMM A;  3TKS E;  4MJC A;  1WIK A;  4ZL8 A;  1WMJ A;  2OJL A;  1GSU A;  4NHZ A;  4YAP A;  3VWU A;  3VK9 A;  3GKM A;  5JCU A;  3NOF A;  3Q6O A;  1BAY A;  3M9K A;  3ZVJ A;  4XCS A;  4RI6 A;  2DLX A;  3TGZ A;  1USB A;  1WRY A;  3DML A;  4TRX A;  4MJE A;  2PBJ A;  3IC4 A;  2AV4 A;  1TI1 A;  2EC4 A;  3WYW A;  3CYN A;  4FYU A;  4N11 A;  2NDO A;  1O81 A;  4PNG A;  1G6Y A;  1ZOF A;  1NW2 A;  2K9F A;  3RHB A;  3J7Y b;  5ECO B;  1ACV A;  3C1S A;  5EPF A;  4K8M A;  3ZIJ A;  5KN0 A;  3IA1 A;  2HZF A;  2DJJ A;  1TW9 A;  3F3R A;  1FOV A;  4BA7 A;  2P0G A;  2CVB A;  2V32 A;  5EY6 A;  1TRS A;  1O8W A;  5CNW A;  5G1K A;  2K6V A;  2HRK B;  5J3R A;  2HRF A;  5BMU A;  1A0F A;  4YAV A;  3EC3 A;  1SD8 A;  2PN8 A;  1EOH A;  3HD5 A;  2DSA A;  1JZR A;  3ZFB A;  5F07 A;  1F3A A;  3QCP A;  1JHB A;  1FG4 A;  1PKW A;  3U5R E;  4JR4 A;  4QL7 A;  1ZGN A;  3MNG A;  2KLX A;  3DVX A;  4HEA 2;  3H4K A;  2OBK A;  1AIU A;  3UIW A;  2FCH A;  4NXI A;  2E2G A;  1K3L A;  2FA4 A;  2F3M A;  1G6W A;  5COH A;  3H1N A;  1SK0 A;  2MMN A;  4WR5 A;  4GST A;  4F2I A;  1LJR A;  3IPZ A;  2XBQ A;  1OKT A;  2LEG A;  3HYP A;  4TR1 A;  2B3S A;  2XPE A;  2H6X A;  4ULX A;  2QKE A;  1EP7 A;  2BMX A;  2HZE A;  2V1M A;  3GX8 A;  3BOA A;  1XWB A;  5H5R A;  4MP4 A;  4RQR A;  4EO3 A;  3FW2 A;  2HFD A;  4K2D A;  1M2A A;  3EU4 A;  2L6D A;  1EV4 A;  3EU3 A;  1ABA A;  4MZC A;  1X9W B;  1XBS A;  1V9W A;  4KCE A;  3HDC A;  3HZ8 A;  1TU7 A;  2E7P A;  1KEB A;  3GYK A;  2JZT A;  1SKR B;  2B5X A;  4I2T A;  4D73 A;  1JLV A;  3TOU A;  9GSS A;  1XPV A;  2CQ9 A;  5C00 A;  3EIN A;  3TJG A;  1U3I A;  17GS A;  5ECK B;  1PKZ A;  3DGQ A;  3GH9 A;  3CRU A;  2ES7 A;  4ZB9 A;  3CSI A;  3FK8 A;  1EV9 A;  12GS A;  1YKC A;  4MLY A;  3QMX A;  2YAN A;  5AGY A;  3LXT A;  4ECB A;  4OFN A;  1ZL9 A;  4WF4 A;  2IMF A;  3TB2 A;  3VI7 A;  4XRD A;  4J57 E;  3WD6 A;  2LQO A;  2CVK A;  4IN0 A;  3UMA A;  2GS3 A;  2O8V B;  2DJ1 A;  1GNE A;  4Q5Q A;  5IO0 A;  3IXR A;  3ERG A;  3F0I A;  2BJX A;  1XWG A;  5J5N A;  5G30 A;  3ED3 A;  3G7I A;  2E2M A;  1SJI A;  4OFT A;  4BWS A;  2F51 A;  2MYG A;  6GSS A;  3Q18 A;  2OA7 A;  4O7H A;  3FRC A;  5DAL A;  5CYY A;  4MPG A;  3C8E A;  2LV3 A;  2GST A;  2DIZ A;  1PQN A;  4FYB A;  4IS0 A;  4FIW A;  1J0F A;  3O76 A;  1HNB A;  4G0I A;  4PUR A;  1SKS B;  2GQL A;  5GZZ B;  4EDY A;  3TJB A;  4GSS A;  5J4U A;  4K0G A;  1FAA A;  3K8N A;  1AAZ A;  4EL1 A;  1PL2 A;  3ME8 A;  1X0R A;  2P5R A;  2C4J A;  1LU4 A;  3GFK A;  2FY6 A;  2A2R A;  1AW9 A;  2VD0 A;  3IDV A;  2IL3 A;  2RII A;  4TR3 A;  4EDZ A;  4TR1 B;  4OO5 A;  1TK5 B;  3FZA A;  1V98 A;  4ID0 A;  1OYJ A;  4HZ4 A;  2YWI A;  3KXO A;  1EEM A;  1A2J A;  1Z9H A;  3KD0 A;  5ELA A;  3RAZ A;  1TKD B;  4KND A;  3F8U A;  4I6X A;  4G0K A;  1YZX A;  4ECI A;  1B4Q A;  3WT1 A;  1NHO A;  3APO A;  2L4C A;  1FB0 A;  1E2Y A;  5B8A A;  2WCI A;  1CQH A;  3VUR A;  3LGC A;  2JAD A;  3UBL A;  4ISD A;  5CRG A;  5ECH B;  2VO4 A;  3RDW A;  3VI5 A;  1WPI A;  1XZO A;  1T00 A;  1EOG A;  5IMA A;  4TR4 A;  4DVC A;  5ECL B;  5DAK A;  2NBS A;  2VUP A;  2LRC A;  6GSV A;  5AN1 A;  5CAX A;  5ECS A;  2PUK C;  3CTF A;  2FNO A;  4IW9 A;  1M2B A;  4EXJ A;  4TR0 A;  2FD3 A;  2L5O A;  1XIY A;  4WF5 A;  2O85 A;  2M80 A;  1DE1 A;  1OE8 A;  2FA8 A;  2H30 A;  1SEN A;  4Q5N A;  3QDN A;  2IN3 A;  5ECN B;  5DDL A;  1Z7P A;  2LJK A;  1PL1 A;  5CO3 A;  1HD2 A;  1XOB A;  4IJI A;  2YOI A;  2HSN B;  4HUA A;  2HRN A;  1GH2 A;  3FZ4 A;  3IV4 A;  3GUR A;  2LJA A;  1ZMA A;  5H5Q A;  5C04 A;  2RLI A;  4MJB A;  4I97 A;  13GS A;  1I9D A;  2V2G A;  4LLR A;  4O32 A;  2HNL A;  5EL8 A;  4KW6 A;  5DVB A;  2HSM B;  4IP1 A;  1YF0 A;  3UAR A;  1M7T A;  3D4M A;  2IIY A;  2CX3 A;  1ERV A;  3IBH A;  3M3M A;  3VLN A;  3N5O A;  1OC8 A;  2IME A;  3V1W A;  3LG6 A;  3KH9 A;  3LSZ A;  4MA9 A;  4IBP A;  4V1A g;  1GUK A;  3GRX A;  6GSW A;  5HR2 A;  4ZIL A;  3C73 A;  4KA0 A;  1Z7R A;  2IMD A;  4IP6 A;  4KB3 A;  1T4Z A;  4HS1 A;  5HFI A;  3LWA A;  2H1B A;  4WBR D;  2MMA A;  5IMF A;  1ILO A;  1HNC A;  1F3B A;  2P31 A;  5F8B A;  5FT3 A;  1KTE A;  1XW9 A;  2HRK A;  2YZU A;  4TVE A;  2GQM A;  2M72 A;  5H5S A;  5FHI A;  5ECM B;  4N0V A;  1M99 A;  2H19 A;  5DBQ A;  4FQU A;  1PRX A;  5D9T A;  1K0O A;  4NAX A;  3VPQ A;  1MD4 A;  3BBY A;  2EIO A;  4KDX A;  4TKY A;  2C8U A;  4E8H A;  2R37 A;  3FR3 A;  3R3E A;  1YF1 A;  4HDE A;  1TRW A;  2H0H A;  4DSQ A;  4KDU A;  2C0G A;  3CXG A;  5HR3 A;  2VLT A;  1GUH A;  2VL9 A;  3CSJ A;  3TRQ A;  4IKH A;  4AF2 A;  4LMW A;  5ECR B;  4ZL7 A;  4EKZ A;  2O89 A;  5A5K A;  4ZIJ A;  5DAK B;  3GST A;  5D9V A;  4GF0 A;  1PX7 A;  1ERW A;  5IMV A;  1A8L A;  3HVX A;  3HJP A;  3FY7 A;  3KCM A;  1UC7 A;  2XPD A;  1Z3E A;  4KSM A;  2IFQ B;  2AAW A;  4IGJ A;  3TUE A;  2DJ0 A;  2TIR A;  4NWY A;  5LD0 A;  3KMO A;  3H8Q A;  4CDO A;  1E6B A;  3QAW A;  1S3A A;  4EE0 A;  2QGV A;  1QFN A;  4PUA A;  3IRA A;  2GDR A;  1SJZ A;  3APS A;  3H93 A;  2HT9 A;  2ZNM A;  5HQP A;  4IQA A;  3F4T A;  4OO4 A;  2MBS A;  3D22 A;  3TOT A;  1XVQ A;  1O73 A;  1FW1 A;  1R26 A;  2H76 A;  3IAS 2;  3W8S A;  6GST A;  1K0C A;  3KP9 A;  5JCG A;  3HJM A;  1O8X A;  1OVN A;  2WB9 A;  2C0D A;  2LST A;  3TKR A;  3TJK A;  4HQS A;  2VCZ A;  3FZ9 A;  4DSR A;  1T4Y A;  3RPN A;  4LL1 B;  2N5B A;  1T7P B;  2XC2 A;  1YQ1 A;  3GMF A;  18GS A;  3PR8 A;  2GZZ A;  4HZ2 A;  3A2X A;  2JZS A;  3DIE A;  2O87 A;  4ACS A;  2LUS A;  5J9B A;  1DE2 A;  5B6N A;  5DQS A;  4N10 A;  5D93 A;  1QK8 A;  3RPP A;  2YJH A;  3N9J A;  3UBK A;  7GSS A;  4WKW A;  5JCW A;  1TRU A;  1AUC A;  4NPB A;  1VF4 A;  4MDC A;  2YJ7 A;  2CA8 A;  5JWQ B;  2GQK A;  2VCT A;  4XTS A;  2G2Q A;  1YKA A;  1J08 A;  3GKN A;  4PUF C;  2LKU A;  4KX4 A;  2J9H A;  4G9H A;  2N5F A;  3I43 A;  4AGS A;  1K0D A;  2X8C A;  1B8X A;  4YQV A;  3TJF A;  4IVF A;  3TRP A;  2GSR A;  2DML A;  2OBI A;  4L5L A;  1BQ7 A;  5KN3 A;  3TDG A;  4NMU A;  4QQ7 A;  2H8L A;  1UA5 A;  3MAK A;  4TXO B;  4KF9 A;  4PNF A;  1FHE A;  1F37 A;  2HSY A;  3L9U A;  2YWN A;  4PGT A;  2IMI A;  2B1L A;  4HU7 A;  4NHW A;  3LXZ A;  1TJD A;  2YP6 A;  2C0F A;  3QPM A;  3UVH A;  6GSX A;  2ALB A;  2MZC A;  2H70 A;  2MMO A;  4MCU A;  3L9V A;  3UL3 A;  5CP1 A;  3DXB A;  4KAE A;  2IPA A;  3IAM 2;  4GRF A;  4IQ1 A;  1T8E B;  1U6T A;  1WE0 A;  3EE2 A;  1HQO A;  3KTB A;  3RHC A;  1EGR A;  3IK7 A;  4I2U A;  4Q5R A;  1TDI A;  2C3Q A;  3IE3 A;  3GA4 A;  1JZW A;  4L0W A;  1ZYQ B;  5KEJ A;  3KJY A;  3L0H A;  5IQY A;  2XBI A;  2H6Y A;  2B6M A;  1TTZ A;  3F3Q A;  1Y6E A;  1BX9 A;  2IJY A;  2VCV A;  4POM A;  2GLR A;  4PQ1 A;  3QR6 A;  1MD3 A;  4ILF A;  1XCC A;  2OAD A;  3CBU A;  22GS A;  5FWG A;  3MWH A;  2AJQ B;  1N2A A;  3CTG A;  2R5G A;  4V1A p;  1GLP A;  2WS2 A;  3PGT A;  4V2L A;  4ZL9 A;  2KUC A;  4EUY A;  1SYR A;  4HU9 A;  1X9S B;  3BCI A;  1R4W A;  1Q98 A;  2H1G A;  5B7C A;  2X8G A;  2JZR A;  4POL A;  3LQ7 A;  1T3B A;  1XOA A;  1YY7 A;  2DJ2 A;  5JWO B;  3EVI A;  1OKD A;  1W4V A;  2B7K A;  3C71 A;  20GS A;  2CAQ A;  3F6F A;  4BL7 B;  1A24 A;  1M9A A;  5DQY A;  3VWW A;  2H1A A;  3ME7 A;  4V2M A;  1HNA A;  2Z9S A;  2L57 A;  2HSM A;  2AB6 A;  2VM2 A;  1ON4 A;  1G7O A;  3I9V 2;  1OAZ A;  3DVW A;  1A23 A;  3PH9 A;  4JBB A;  5HR1 A;  1ERT A;  4I5Q A;  1RW1 A;  2GZY A;  3ZVJ D;  1DUG A;  4HQZ A;  4NV2 A;  3MSZ A;  2HYX A;  1B9Y C;  2KP1 A;  4FYC A;  4PX1 A;  4LMV A;  1TU8 A;  4MJA A;  1QXH A;  5DCG A;  5F05 A;  1V2A A;  1O7U A;  3A2V A;  2VM1 A;  4KSO A;  1WWJ A;  3DEX A;  3I6A A;  1BJX A;  5ID2 A;  5CRW A;  2IWT A;  4K7I A;  3UEM A;  3NIV A;  3JCM L;  1QMV A;  10GS A;  4GSN A;  3J7Y k;  4MH3 A;  2LTK A;  3GIX A;  3HY2 A;  5ABR A;  3HXS A;  1SL2 B;  4BWQ A;  3F9U A;  1CQG A;  3GN3 A;  3GTU A;  3BD2 A;  3APQ A;  1QUW A;  2I9H A;  2WFC A;  1XFL A;  2CZ3 A;  2I3Y A;  4PQI A;  4YH2 A;  2OE3 A;  2C1Y A;  1QQ2 A;  1MEK A;  3ZFL A;  1EZK A;  3ZIV A;  3DWV A;  3F4S A;  3M9J A;  5AIV A;  1ERU A;  2LS5 A;  1THO A; 
#chains in the Genus database with same CATH topology
 3FZ5 A;  2IFQ A;  2OE0 A;  3GHA A;  4P3Y B;  14GS A;  4F0C A;  3M1G A;  4MF5 A;  5ECP B;  1GSD A;  4JR6 A;  3TKQ A;  4K7O A;  4O5R A;  1N8J A;  2FWE A;  2WW3 A;  1B4P A;  4EC0 A;  2VIM A;  1U87 A;  3U6V A;  5A5H A;  2VLV A;  2YPM A;  3LOR A;  2VCW A;  1OC9 B;  1VGL A;  4LL4 B;  1T1V A;  3ZML A;  5A4W A;  2VL2 A;  4MAB A;  1I5G A;  2H74 A;  3VFI A;  3LW9 A;  1GTB A;  2WRT A;  4TW5 A;  2F8A A;  3EWL A;  1XW5 A;  1IYI A;  3IOS A;  4HSC X;  1UVZ A;  3ZRE A;  1B9X C;  4GQC A;  3KGK A;  2IMK A;  1YEW C;  1XW6 A;  3C7M A;  2AUV A;  1RQM A;  1K0N A;  4HJ2 A;  3A2W A;  5IPH A;  4L0U A;  2DJK A;  2WVX A;  3EMX A;  3A5W A;  1NM3 A;  1F2E A;  1H4O A;  4K7N A;  2BTO T;  2HI7 A;  1EP8 A;  4ML6 A;  2NVL A;  2REM A;  1WOU A;  4IEL A;  19GS A;  1WJK A;  2C80 A;  2VL3 A;  4OCF A;  4E8E A;  1TRV A;  2V6K A;  1JZO A;  1PD2 1;  5ID2 B;  2MBT A;  3KH7 A;  5CRH A;  4DSS B;  2V41 A;  5DJL A;  1YDK A;  1GSQ A;  3D4T A;  1XWK A;  4WET A;  5IMC A;  3LFL A;  3HVN A;  3D0Z A;  3P2A A;  4F0B A;  3GL3 A;  3GH6 A;  2GSQ A;  3EYT A;  5HFG A;  1Z5Y E;  1SU9 A;  2H72 A;  3SWL A;  5IOX A;  4PXO A;  4KUN A;  2DC5 A;  3GTU B;  2H0I A;  3HHV A;  3G7J A;  2D2Z A;  1F9M A;  1MDJ A;  3W8J A;  4XS4 B;  2KP2 A;  1SKW B;  6GSU A;  3P8W A;  5KOW A;  4JE1 A;  2R6K A;  8GSS A;  4TXO A;  2LNT A;  3L4N A;  6GSY A;  3ZMK A;  4I8B A;  4E68 A;  1SYX A;  4MH2 A;  2H6Z A;  4FH8 A;  4QL9 A;  4N0Z A;  4K0N A;  2LRT A;  3GKX A;  2O7K A;  1MDI A;  2JAC A;  3ERF A;  1K3Y A;  1UN2 A;  3TCO A;  1GSE A;  2KOK A;  2R0C A;  4PQH A;  1A8Y A;  5F0G A;  3RGB C;  5KN1 A;  2PVQ A;  4LA1 A;  5F06 A;  1MTC A;  3LYP A;  5D8I A;  1K0M A;  1R7H A;  1FO5 A;  4BVY A;  4ZB6 A;  3PPU A;  2YNX A;  5GSS A;  4AI6 A;  1Z6N A;  1GP1 A;  4XIH A;  3CMI A;  3QAV A;  4J2F A;  4K1F A;  5G2Z A;  4GTU A;  4HJM A;  3GUS A;  3KMN A;  1NSW A;  1GUL A;  2R0G A;  1A2M A;  2F9S A;  1X5D A;  4XS1 A;  4MMM A;  1PGT A;  4KGI A;  5IIZ A;  3IHQ A;  1GTI A;  3E3E A;  1YEP A;  3VWX A;  3HA9 A;  4KH7 A;  5D73 A;  5E4W A;  4YQU A;  1TP9 A;  2YZH A;  1EGO A;  2CVD A;  4IHU A;  4HI7 A;  1O85 A;  3QOU A;  4TOP A;  5HFK A;  3FMW A;  3D21 A;  3LJR A;  2HRA A;  1J9B A;  3DYR A;  4GQF A;  2LQQ A;  3RBT A;  1AQW A;  3VPT A;  2B1K A;  2YWO A;  3HVV A;  5INY A;  1M0U A;  5KN2 A;  3SBC A;  2VL2 C;  2P5Q A;  2XHF A;  4TXV A;  4F82 A;  3G9B A;  2ON7 A;  1X5E A;  4BL7 A;  3QFA C;  5HR0 A;  2CZ2 A;  4RQX A;  2A2S A;  3GL5 A;  2PWJ A;  4BVX A;  4BPY A;  1K3O A;  3HCZ A;  1U88 A;  5AIS A;  2AYT A;  3TRX A;  4PTS A;  3ERW A;  4ML1 A;  3WGE A;  2GGT A;  3TJJ A;  1FB6 A;  2C3N A;  2H1D A;  2VOC A;  4X0X A;  4EF0 A;  5ECI B;  3QFB C;  2PVO C;  1YJ6 A;  2K18 A;  4AJ8 A;  1BG5 A;  1G7E A;  5J41 A;  2H75 A;  2J23 A;  5A4U A;  1V40 A;  2M46 A;  2FWH A;  3FR6 A;  2X99 A;  1THX A;  3UOM A;  1TK0 B;  4CHS A;  3G7Y A;  4XS6 A;  1TOF A;  1H75 A;  3ZYW A;  1PA3 A;  3FYG A;  1FOH A;  5B6M A;  2C0E A;  5IM9 A;  2K8V A;  1GLQ A;  1TXX A;  4OMV A;  2A4V A;  3KZQ A;  5G31 A;  1A2L A;  1B48 A;  3P7X A;  4JU5 A;  3ZIT A;  1GSY A;  3WGD A;  3DRN A;  2C3T A;  3Q74 A;  3ZTL A;  4X43 A;  5A4V A;  5JWR B;  4BVY B;  4POB A;  2MMZ A;  5D96 A;  3R2Q A;  5ENU A;  3DD3 A;  3FHK A;  3KEB A;  1YEX A;  2ZUP A;  3F6D A;  1EEJ A;  4V2N A;  5CRE A;  2AHE A;  2FHE A;  3O6T A;  2WW0 A;  5IPG A;  3M8N A;  3GKK A;  3S9F A;  2G0F A;  3W6G A;  1ML6 A;  3ISO A;  2VLU A;  2CV4 A;  5DJM A;  1AXD A;  4KDY A;  4FO5 A;  4AJ6 A;  4JRR A;  1URM A;  2H73 A;  2HLS A;  2LJR A;  3IC8 A;  1M9B A;  2B5Y A;  3F4R A;  1R5A A;  4WEY A;  3GNJ A;  4MZW A;  2OT3 A;  1RK4 A;  2RM6 A;  2QA1 A;  2FWG A;  2HQT A;  1Y25 A;  2JU5 A;  2YV7 A;  1OE7 A;  5IO2 A;  1XVW A;  4GXZ A;  3KIJ A;  1AQX A;  4WR4 A;  1M2D A;  5D9X A;  3F63 A;  3O3T A;  5IOW A;  4JZQ A;  1VF1 A;  3FKF A;  2FUG 2;  3DKS A;  3BJ5 A;  3WT2 A;  1GTA A;  1K0A A;  1OC9 A;  4OWY A;  4BVX B;  4F9Z A;  5LCZ A;  1G0T A;  4WBJ A;  3A5I A;  4RUV A;  5ECQ B;  2GSS A;  2DIY A;  1DBY A;  5J47 A;  2NPB A;  2JSZ A;  4MF7 A;  3TKS A;  2L5L A;  4AJ7 A;  4F03 A;  1C72 A;  1EWX A;  3CSH A;  1TXU A;  4POK A;  3TKP A;  3GX0 A;  2EFD A;  4DEJ A;  2YV9 A;  1XWA A;  4TN8 A;  5G5F A;  5J9C A;  1HYU A;  4KCA A;  3L9S A;  4X1U A;  4K9Z A;  3P90 A;  1FVK A;  2FLS A;  2YN1 A;  2WUL A;  2WJU A;  1ST9 A;  5DCH A;  1ZCP A;  4Q5F A;  5GAN D;  3E9J B;  1PX6 A;  2VAF A;  2EIQ A;  4DSS A;  1X5C A;  1A0R P;  2GZP A;  3MDK A;  4G10 A;  3UVT A;  3US3 A;  2KHP A;  3GV1 A;  2R4V A;  2YCD A;  4HOJ A;  2PGT A;  2DBC A;  1XXU A;  5GST A;  3H79 A;  3MYD A;  2VCX A;  3D6I A;  2HXK A;  2HZE B;  4X4J A;  4MZB A;  2R2J A;  1GWC A;  1XWC A;  5CRD A;  2I81 A;  4XS4 A;  1SJ6 A;  4ZXG A;  2F8F A;  1ZZY A;  4Z2T A;  2QC7 A;  2OAC A;  2OE1 A;  5L71 A;  4OD7 A;  4G2E A;  2ZCT A;  3HVS A;  4G0L A;  5IMD A;  4AKH A;  3PIN A;  4D73 B;  1SVL A;  2PU9 C;  3WGX A;  1Z6M A;  1BED A;  2LNS A;  2PER A;  1BYE A;  4O92 A;  2CAI A;  3ZZX A;  1KNG A;  4J56 E;  3BCK A;  2PPT A;  3QD9 A;  2R3X A;  1GNW A;  5G1L A;  3I69 A;  4MNN A;  1PMT A;  3OR5 A;  1IYH A;  1SL1 B;  2HE3 A;  2DJ3 A;  1Q4J A;  3E0U A;  3KP8 A;  2H66 A;  4Z2R A;  5IMZ A;  2OKA A;  2JSY A;  4GLT A;  2B7J A;  5J4Y A;  2L4Q A;  4CW9 A;  2L6C A;  1X9M B;  1JLW A;  1S3C A;  2NTO A;  2TRX A;  1S3D A;  3A3T A;  1F6M C;  4KE3 A;  3FEU A;  4EIQ A;  4XHM A;  1KBN A;  2N5A A;  5D9W A;  2WDU A;  2FGX A;  2X8H A;  4ICY A;  1GUM A;  2B5E A;  2RUE A;  2UZ8 A;  2GVP A;  4IJ3 A;  2RM5 A;  1LBK A;  4ECC A;  2WZ9 A;  1GL8 A;  1PN9 A;  3ZRD A;  4G19 A;  4N30 A;  1VF2 A;  16GS A;  2V6O A;  1TK8 B;  4MK3 A;  3ZLP A;  2YWM A;  11GS A;  4NV5 A;  3IR4 A;  2I4A A;  1MDK A;  1TI3 A;  4L5O A;  3CRT A;  4QMK A;  5DAL B;  3GSS A;  1DSB A;  4ZBA A;  5EVO A;  2X64 A;  2VCQ A;  2E0Q A;  1SD9 A;  4EVM A;  1O6J A;  3FR9 A;  3KTL A;  1QGV A;  1AC1 A;  2FWF A;  3L78 A;  2LRN A;  2R0P A;  1GTU A;  2GT5 A;  2ON5 A;  3UAP A;  1JFU A;  2DKH A;  2EIR A;  1NHY A;  3UJ1 A;  3IHG A;  4MPF A;  4ECJ A;  3TKS C;  2VD1 A;  1SK2 A;  4YQM A;  5B8B A;  3D5J A;  3Q19 A;  2GT6 A;  1SK1 A;  1VRS D;  1JZD A;  4OFM A;  1V58 A;  5G5E A;  5ELG A;  3HJO A;  1FVJ A;  1WP0 A;  2H0G A;  3C1R A;  3EMP A;  2K8S A;  1GSF A;  3ZL5 A;  1GSS A;  4OCE A;  1GRX A;  5LNK e;  1VF3 A;  4GCI A;  1V57 A;  4WXT A;  1ZYE A;  4GWR A;  2CT6 A;  3IK9 A;  3VWV A;  2RUF A;  4N3Z A;  5E59 A;  5AIX A;  4ZBB A;  3CQF A;  3M0F A;  1PSQ A;  2CX4 A;  2H01 A;  5GAP D;  4ZBD A;  1SL0 B;  1XG8 A;  2WGR A;  3AY8 A;  3RFR C;  2QSI A;  3LEF A;  4K2X A;  4K6X A;  4RI7 A;  4ZB8 A;  3HKR A;  3EUR A;  4USS A;  3KM6 A;  3HZ4 A;  1AQV A;  1W89 A;  4L8E A;  2I1U A;  2TRC P;  1K0B A;  3LYK A;  2H71 A;  4Z7X A;  2GTU A;  1OC3 A;  2H1L A;  3NZN A;  1U3A A;  2JL4 A;  2HSH A;  4XRA A;  4MF6 A;  4H86 A;  2L59 A;  2PMT A;  4JED A;  3QAG A;  1R5P A;  2WVY A;  2DMM A;  1S3R A;  3TKS E;  4MJC A;  1WIK A;  4ZL8 A;  1WMJ A;  2OJL A;  1GSU A;  1SVM A;  4NHZ A;  1N25 A;  2DKI A;  4YAP A;  3VWU A;  3VK9 A;  3GKM A;  5JCU A;  3NOF A;  5KOX A;  3Q6O A;  1BAY A;  3M9K A;  2UV8 G;  3ZVJ A;  4XCS A;  4RI6 A;  2DLX A;  3TGZ A;  1USB A;  1WRY A;  3DML A;  4TRX A;  4MJE A;  2PBJ A;  3IC4 A;  2AV4 A;  1TI1 A;  2EC4 A;  3WYW A;  3CYN A;  4FYU A;  4Z2U A;  4N11 A;  2NDO A;  1O81 A;  4PNG A;  1G6Y A;  1ZOF A;  1NW2 A;  2K9F A;  3RHB A;  3J7Y b;  5ECO B;  1ACV A;  3C1S A;  5EPF A;  4K8M A;  3ZIJ A;  5KN0 A;  3IA1 A;  2HZF A;  2DJJ A;  1TW9 A;  3F3R A;  1FOV A;  4BA7 A;  2O5V A;  2P0G A;  2CVB A;  2V32 A;  5EY6 A;  1TRS A;  1O8W A;  2EFC A;  5CNW A;  5G1K A;  2K6V A;  2HRK B;  5J3R A;  2HRF A;  5BMU A;  1A0F A;  2EFE A;  4YAV A;  3EC3 A;  1SD8 A;  2PN8 A;  1EOH A;  3HD5 A;  2DSA A;  1JZR A;  3ZFB A;  5F07 A;  1F3A A;  3QCP A;  4K5S A;  1JHB A;  1FG4 A;  1PKW A;  3U5R E;  4JR4 A;  4QL7 A;  1ZGN A;  3MNG A;  2KLX A;  3DVX A;  4HEA 2;  3H4K A;  2OBK A;  1ZYN A;  1SVO A;  1AIU A;  3UIW A;  2FCH A;  4NXI A;  4EIP A;  2E2G A;  1K3L A;  2FA4 A;  2F3M A;  1G6W A;  5COH A;  3H1N A;  1SK0 A;  1PN0 A;  2MMN A;  4WR5 A;  4GST A;  4F2I A;  1LJR A;  3IPZ A;  2XBQ A;  1OKT A;  2LEG A;  3HYP A;  4TR1 A;  2B3S A;  2XPE A;  2H6X A;  4ULX A;  2QKE A;  1EP7 A;  2BMX A;  2HZE A;  2V1M A;  3GX8 A;  3BOA A;  1XWB A;  5H5R A;  4MP4 A;  4RQR A;  4EO3 A;  3FW2 A;  1I1I P;  2HFD A;  4K2D A;  1M2A A;  3EU4 A;  2L6D A;  1EV4 A;  3EU3 A;  1ABA A;  1ZYP A;  4MZC A;  1X9W B;  1XBS A;  1V9W A;  4KCE A;  3HDC A;  3HZ8 A;  1TU7 A;  2E7P A;  1KEB A;  3GYK A;  2JZT A;  1SKR B;  2B5X A;  4I2T A;  4D73 A;  1JLV A;  3TOU A;  9GSS A;  1XPV A;  2CQ9 A;  5C00 A;  3EIN A;  3TJG A;  1U3I A;  17GS A;  5ECK B;  1PKZ A;  3DGQ A;  3GH9 A;  3CRU A;  2ES7 A;  4W66 A;  4ZB9 A;  3CSI A;  3FK8 A;  1EV9 A;  12GS A;  1M3I A;  1YKC A;  4MLY A;  3QMX A;  2YAN A;  5AGY A;  3LXT A;  4ECB A;  4OFN A;  1ZL9 A;  4WF4 A;  2IMF A;  3TB2 A;  3VI7 A;  4XRD A;  4J57 E;  3WD6 A;  2LQO A;  2CVK A;  4IN0 A;  3UMA A;  2GS3 A;  2O8V B;  2DJ1 A;  1GNE A;  4Q5Q A;  5IO0 A;  3IXR A;  5BMU B;  3ERG A;  3F0I A;  2BJX A;  1XWG A;  4AKG A;  4PHZ C;  5J5N A;  5G30 A;  3ED3 A;  3G7I A;  2E2M A;  1SJI A;  4OFT A;  4BWS A;  2F51 A;  2MYG A;  6GSS A;  3Q18 A;  2OA7 A;  4O7H A;  1M3J A;  3FRC A;  5DAL A;  5CYY A;  5A34 B;  4MPG A;  3C8E A;  2LV3 A;  2GST A;  2DIZ A;  1PQN A;  4FYB A;  4IS0 A;  4FIW A;  1J0F A;  3O76 A;  1HNB A;  4G0I A;  4PUR A;  1PFO A;  1SKS B;  2GQL A;  5GZZ B;  4EDY A;  3TJB A;  4GSS A;  5J4U A;  4K0G A;  1FAA A;  3K8N A;  1AAZ A;  4EL1 A;  1PL2 A;  3ME8 A;  1X0R A;  2P5R A;  2C4J A;  1LU4 A;  3GFK A;  2FY6 A;  2A2R A;  1AW9 A;  2VD0 A;  3IDV A;  2IL3 A;  2RII A;  4TR3 A;  4EDZ A;  4TR1 B;  4OO5 A;  1TK5 B;  3FZA A;  1V98 A;  4ID0 A;  1OYJ A;  4HZ4 A;  2YWI A;  3KXO A;  1EEM A;  1A2J A;  1Z9H A;  3KD0 A;  5ELA A;  3RAZ A;  1TKD B;  4KND A;  3F8U A;  4I6X A;  4G0K A;  4O5U A;  1YZX A;  4ECI A;  1B4Q A;  3WT1 A;  1NHO A;  3APO A;  2L4C A;  1FB0 A;  1E2Y A;  5B8A A;  2WCI A;  1CQH A;  3VUR A;  3LGC A;  2JAD A;  3UBL A;  4ISD A;  5CRG A;  5ECH B;  2VO4 A;  3RDW A;  3VI5 A;  1WPI A;  2O3E A;  1T00 A;  1XZO A;  5A1N A;  1EOG A;  5IMA A;  3EPT A;  4TR4 A;  4DVC A;  5ECL B;  5DAK A;  1Y1U A;  2NBS A;  2O36 A;  2VUP A;  2LRC A;  6GSV A;  5AN1 A;  5CAX A;  5ECS A;  2PUK C;  3CTF A;  2FNO A;  4IW9 A;  1M2B A;  4EXJ A;  4CY8 A;  4TR0 A;  2FD3 A;  2L5O A;  1XIY A;  4WF5 A;  2O85 A;  2M80 A;  1DE1 A;  1OE8 A;  2FA8 A;  2H30 A;  1SEN A;  4Q5N A;  3QDN A;  2IN3 A;  5ECN B;  5DDL A;  1Z7P A;  2LJK A;  1PL1 A;  5CO3 A;  1HD2 A;  3TU3 B;  1XOB A;  4IJI A;  2YOI A;  2HSN B;  4HUA A;  2HRN A;  1GH2 A;  3FZ4 A;  3IV4 A;  3GUR A;  2LJA A;  4ZB7 A;  1ZMA A;  5H5Q A;  5C04 A;  2RLI A;  4MJB A;  4I97 A;  13GS A;  1I9D A;  2V2G A;  4LLR A;  4O32 A;  2HNL A;  5EL8 A;  4KW6 A;  5DVB A;  2HSM B;  4IP1 A;  1YF0 A;  3UAR A;  4PI2 C;  1M7T A;  3D4M A;  2IIY A;  2CX3 A;  1ERV A;  3IBH A;  3M3M A;  3VLN A;  3N5O A;  1OC8 A;  2IME A;  3V1W A;  2A4H A;  3LG6 A;  3KH9 A;  3LSZ A;  4MA9 A;  4IBP A;  4V1A g;  1GUK A;  3GRX A;  6GSW A;  5HR2 A;  4ZIL A;  3C73 A;  4KA0 A;  1Z7R A;  2IMD A;  4IP6 A;  4KB3 A;  1T4Z A;  4HS1 A;  5HFI A;  3LWA A;  2H1B A;  4WBR D;  2MMA A;  5IMF A;  1ILO A;  1HNC A;  1F3B A;  2P31 A;  5F8B A;  5FT3 A;  1KTE A;  1XW9 A;  2HRK A;  2YZU A;  4TVE A;  2GQM A;  2M72 A;  5H5S A;  5FHI A;  5ECM B;  4N0V A;  5BRT A;  1M99 A;  2H19 A;  5DBQ A;  4FQU A;  1PRX A;  5D9T A;  1K0O A;  4NAX A;  3VPQ A;  3HMJ G;  1MD4 A;  3BBY A;  2EIO A;  4KDX A;  4TKY A;  2C8U A;  4E8H A;  2R37 A;  3FR3 A;  3R3E A;  1YF1 A;  4BIK A;  4HDE A;  1TRW A;  2H0H A;  4DSQ A;  4KDU A;  2C0G A;  3CXG A;  5HR3 A;  2VLT A;  1GUH A;  2VL9 A;  3CSJ A;  3TRQ A;  4IKH A;  4AF2 A;  4GDF A;  4LMW A;  5ECR B;  5A1N B;  4ZL7 A;  4EKZ A;  2O89 A;  5A5K A;  4ZIJ A;  5DAK B;  3GST A;  5D9V A;  4GF0 A;  4CY6 A;  1PX7 A;  1ERW A;  5IMV A;  1A8L A;  3HVX A;  3HJP A;  3FY7 A;  4YKF A;  3KCM A;  1UC7 A;  2XPD A;  1Z3E A;  4KSM A;  2IFQ B;  2AAW A;  4IGJ A;  3TUE A;  4O5Q A;  2DJ0 A;  2TIR A;  4NWY A;  5LD0 A;  3KMO A;  3H8Q A;  4CDO A;  1E6B A;  3QAW A;  1S3A A;  4EE0 A;  2QGV A;  1QFN A;  4PUA A;  3IRA A;  2GDR A;  1SJZ A;  3APS A;  3H93 A;  2HT9 A;  1YVL A;  2ZNM A;  5HQP A;  3CWG A;  4IQA A;  3F4T A;  4OO4 A;  2MBS A;  4A5P A;  3D22 A;  5A5H B;  3TOT A;  1XVQ A;  1O73 A;  4AKI A;  1FW1 A;  1S4B P;  1R26 A;  2H76 A;  3IAS 2;  3W8S A;  6GST A;  1K0C A;  3KP9 A;  5JCG A;  3HJM A;  1O8X A;  1OVN A;  2WW2 A;  2WB9 A;  2C0D A;  2LST A;  3TKR A;  3TJK A;  4FXY P;  4HQS A;  2VCZ A;  4G01 A;  3FZ9 A;  4DSR A;  1T4Y A;  3RPN A;  4LL1 B;  2N5B A;  1T7P B;  2XC2 A;  1YQ1 A;  3GMF A;  18GS A;  3PR8 A;  2GZZ A;  4HZ2 A;  3A2X A;  2WVX B;  2JZS A;  3DIE A;  2O87 A;  4ACS A;  2LUS A;  1BG1 A;  2WW1 A;  5J4V A;  5J9B A;  1DE2 A;  5B6N A;  5DQS A;  4N10 A;  5D93 A;  1QK8 A;  3RPP A;  2YJH A;  2EFH A;  3N9J A;  3UBK A;  7GSS A;  4WKW A;  5JCW A;  1TRU A;  1AUC A;  4NPB A;  1VF4 A;  4MDC A;  2YJ7 A;  2CA8 A;  5JWQ B;  2GQK A;  2VCT A;  4XTS A;  2G2Q A;  1YKA A;  1J08 A;  3GKN A;  4PUF C;  2LKU A;  4KX4 A;  2J9H A;  5A34 A;  4G9H A;  2N5F A;  3I43 A;  4AGS A;  1K0D A;  2X8C A;  1B8X A;  4YQV A;  3TJF A;  4IVF A;  3TRP A;  2GSR A;  2DML A;  2OBI A;  4L5L A;  1BQ7 A;  5KN3 A;  3TDG A;  4NMU A;  2X4A A;  4QQ7 A;  2H8L A;  1UA5 A;  3MAK A;  4TXO B;  4KF9 A;  4PNF A;  1FHE A;  1F37 A;  2HSY A;  3L9U A;  2YWN A;  4PGT A;  2IMI A;  2B1L A;  4HU7 A;  4NHW A;  3LXZ A;  1TJD A;  2YP6 A;  2C0F A;  3QPM A;  3UVH A;  6GSX A;  2ALB A;  2MZC A;  2H70 A;  2MMO A;  4MCU A;  3L9V A;  3UL3 A;  5CP1 A;  3DXB A;  4KAE A;  2IPA A;  3IAM 2;  4GRF A;  4IQ1 A;  1T8E B;  1U6T A;  1WE0 A;  3EE2 A;  1HQO A;  3KTB A;  3RHC A;  1EGR A;  3IK7 A;  4I2U A;  4Q5R A;  1TDI A;  2C3Q A;  3IE3 A;  3GA4 A;  1JZW A;  4K5R A;  4L0W A;  1ZYQ B;  5KEJ A;  3KJY A;  3L0H A;  5IQY A;  2XBI A;  2H6Y A;  2B6M A;  1TTZ A;  3F3Q A;  1Y6E A;  1BX9 A;  2IJY A;  2VCV A;  4PI0 C;  4POM A;  2GLR A;  4PQ1 A;  2QA2 A;  2A2P A;  3QR6 A;  1MD3 A;  4ILF A;  1XCC A;  2OAD A;  3CBU A;  22GS A;  5FWG A;  3MWH A;  2AJQ B;  1N2A A;  3CTG A;  2R5G A;  4V1A p;  1GLP A;  2WS2 A;  3PGT A;  4V2L A;  4ZL9 A;  2KUC A;  4EUY A;  1SYR A;  4HU9 A;  1X9S B;  3BCI A;  1R4W A;  1Q98 A;  2H1G A;  5B7C A;  2X8G A;  2JZR A;  4POL A;  2HSN A;  3LQ7 A;  1T3B A;  1XOA A;  1YY7 A;  2DJ2 A;  5JWO B;  3EVI A;  1OKD A;  1W4V A;  2B7K A;  3C71 A;  20GS A;  2CAQ A;  3F6F A;  4BL7 B;  1A24 A;  1M9A A;  5DQY A;  3VWW A;  2H1A A;  3ME7 A;  4V2M A;  1HNA A;  2Z9S A;  2L57 A;  2HSM A;  2AB6 A;  5J40 A;  2VM2 A;  1ON4 A;  1G7O A;  3I9V 2;  1OAZ A;  3DVW A;  3CHX C;  1A23 A;  3PH9 A;  4JBB A;  2WVZ A;  2VKZ G;  5HR1 A;  1ERT A;  4I5Q A;  1RW1 A;  2GZY A;  3ZVJ D;  1DUG A;  2WZS A;  4HQZ A;  4NV2 A;  3MSZ A;  2HYX A;  1B9Y C;  2KP1 A;  4FYC A;  4PX1 A;  4LMV A;  1TU8 A;  4MJA A;  1QXH A;  5DCG A;  5F05 A;  1V2A A;  1O7U A;  3A2V A;  2VM1 A;  4KSO A;  1WWJ A;  3DEX A;  3I6A A;  1BJX A;  5ID2 A;  5CRW A;  2IWT A;  4K7I A;  3UEM A;  3NIV A;  3MIX A;  3JCM L;  4AKX B;  1QMV A;  10GS A;  4GSN A;  3J7Y k;  4MH3 A;  2LTK A;  3GIX A;  3HY2 A;  5ABR A;  3HXS A;  1SL2 B;  4BWQ A;  3F9U A;  2X49 A;  1CQG A;  3GN3 A;  3GTU A;  3BD2 A;  3APQ A;  1QUW A;  1BF5 A;  2I9H A;  2WFC A;  1XFL A;  2CZ3 A;  2I3Y A;  4PQI A;  4YH2 A;  2OE3 A;  4YKG A;  2C1Y A;  1QQ2 A;  1MEK A;  3ZFL A;  1EZK A;  3ZIV A;  3DWV A;  3F4S A;  3M9J A;  5AIV A;  1ERU A;  2LS5 A;  1THO A; 
#chains in the Genus database with same CATH homology
 3FZ5 A;  2IFQ A;  2OE0 A;  3GHA A;  4P3Y B;  14GS A;  4F0C A;  3M1G A;  4MF5 A;  5ECP B;  1GSD A;  4JR6 A;  3TKQ A;  4K7O A;  4O5R A;  1N8J A;  2FWE A;  1B4P A;  4EC0 A;  2VIM A;  1U87 A;  3U6V A;  5A5H A;  2VLV A;  2YPM A;  3LOR A;  2VCW A;  1OC9 B;  1VGL A;  4LL4 B;  1T1V A;  3ZML A;  5A4W A;  2VL2 A;  4MAB A;  1I5G A;  2H74 A;  3VFI A;  3LW9 A;  1GTB A;  2WRT A;  4TW5 A;  2F8A A;  3EWL A;  1XW5 A;  1IYI A;  3IOS A;  1UVZ A;  3ZRE A;  1B9X C;  4GQC A;  3KGK A;  2IMK A;  1XW6 A;  3C7M A;  2AUV A;  1RQM A;  1K0N A;  4HJ2 A;  3A2W A;  5IPH A;  4L0U A;  2DJK A;  3EMX A;  3A5W A;  1NM3 A;  1F2E A;  1H4O A;  4K7N A;  2BTO T;  2HI7 A;  1EP8 A;  4ML6 A;  2NVL A;  2REM A;  1WOU A;  4IEL A;  19GS A;  1WJK A;  2C80 A;  2VL3 A;  4OCF A;  4E8E A;  1TRV A;  2V6K A;  1JZO A;  1PD2 1;  5ID2 B;  2MBT A;  3KH7 A;  5CRH A;  4DSS B;  2V41 A;  5DJL A;  1YDK A;  1GSQ A;  3D4T A;  1XWK A;  4WET A;  5IMC A;  3LFL A;  3D0Z A;  3P2A A;  4F0B A;  3GL3 A;  3GH6 A;  2GSQ A;  3EYT A;  5HFG A;  1Z5Y E;  1SU9 A;  2H72 A;  3SWL A;  5IOX A;  4PXO A;  4KUN A;  2DC5 A;  3GTU B;  2H0I A;  3HHV A;  3G7J A;  2D2Z A;  1F9M A;  1MDJ A;  3W8J A;  4XS4 B;  2KP2 A;  1SKW B;  6GSU A;  3P8W A;  5KOW A;  4JE1 A;  2R6K A;  8GSS A;  4TXO A;  2LNT A;  3L4N A;  6GSY A;  3ZMK A;  4I8B A;  4E68 A;  1SYX A;  4MH2 A;  2H6Z A;  4FH8 A;  4QL9 A;  4N0Z A;  4K0N A;  2LRT A;  3GKX A;  2O7K A;  1MDI A;  2JAC A;  3ERF A;  1K3Y A;  1UN2 A;  3TCO A;  1GSE A;  2KOK A;  2R0C A;  4PQH A;  1A8Y A;  5F0G A;  5KN1 A;  2PVQ A;  4LA1 A;  5F06 A;  1MTC A;  3LYP A;  5D8I A;  1K0M A;  1R7H A;  1FO5 A;  4BVY A;  4ZB6 A;  3PPU A;  2YNX A;  5GSS A;  4AI6 A;  1Z6N A;  1GP1 A;  4XIH A;  3CMI A;  3QAV A;  4J2F A;  4K1F A;  5G2Z A;  4GTU A;  4HJM A;  3GUS A;  3KMN A;  1NSW A;  1GUL A;  2R0G A;  1A2M A;  2F9S A;  1X5D A;  4XS1 A;  4MMM A;  1PGT A;  4KGI A;  5IIZ A;  3IHQ A;  1GTI A;  3E3E A;  1YEP A;  3VWX A;  3HA9 A;  4KH7 A;  5D73 A;  5E4W A;  4YQU A;  1TP9 A;  2YZH A;  1EGO A;  2CVD A;  4IHU A;  4HI7 A;  1O85 A;  3QOU A;  4TOP A;  5HFK A;  3FMW A;  3D21 A;  3LJR A;  2HRA A;  1J9B A;  3DYR A;  4GQF A;  2LQQ A;  3RBT A;  1AQW A;  3VPT A;  2B1K A;  2YWO A;  3HVV A;  5INY A;  1M0U A;  5KN2 A;  3SBC A;  2VL2 C;  2P5Q A;  2XHF A;  4TXV A;  4F82 A;  3G9B A;  2ON7 A;  1X5E A;  4BL7 A;  3QFA C;  5HR0 A;  2CZ2 A;  4RQX A;  2A2S A;  3GL5 A;  2PWJ A;  4BVX A;  4BPY A;  1K3O A;  3HCZ A;  1U88 A;  5AIS A;  2AYT A;  3TRX A;  4PTS A;  3ERW A;  4ML1 A;  3WGE A;  2GGT A;  3TJJ A;  1FB6 A;  2C3N A;  2H1D A;  2VOC A;  4X0X A;  4EF0 A;  5ECI B;  3QFB C;  2PVO C;  1YJ6 A;  2K18 A;  4AJ8 A;  1BG5 A;  1G7E A;  5J41 A;  2H75 A;  2J23 A;  5A4U A;  1V40 A;  2M46 A;  2FWH A;  3FR6 A;  2X99 A;  1THX A;  3UOM A;  1TK0 B;  4CHS A;  3G7Y A;  4XS6 A;  1TOF A;  1H75 A;  3ZYW A;  1PA3 A;  3FYG A;  1FOH A;  5B6M A;  2C0E A;  5IM9 A;  2K8V A;  1GLQ A;  1TXX A;  4OMV A;  2A4V A;  3KZQ A;  5G31 A;  1A2L A;  1B48 A;  3P7X A;  4JU5 A;  3ZIT A;  1GSY A;  3WGD A;  3DRN A;  2C3T A;  3Q74 A;  3ZTL A;  4X43 A;  5A4V A;  5JWR B;  4BVY B;  4POB A;  2MMZ A;  5D96 A;  3R2Q A;  5ENU A;  3DD3 A;  3FHK A;  3KEB A;  1YEX A;  2ZUP A;  3F6D A;  1EEJ A;  4V2N A;  5CRE A;  2AHE A;  2FHE A;  3O6T A;  5IPG A;  3M8N A;  3GKK A;  3S9F A;  2G0F A;  3W6G A;  1ML6 A;  3ISO A;  2VLU A;  2CV4 A;  5DJM A;  1AXD A;  4KDY A;  4FO5 A;  4AJ6 A;  4JRR A;  1URM A;  2H73 A;  2HLS A;  2LJR A;  3IC8 A;  1M9B A;  2B5Y A;  3F4R A;  1R5A A;  4WEY A;  3GNJ A;  4MZW A;  2OT3 A;  1RK4 A;  2RM6 A;  2QA1 A;  2FWG A;  2HQT A;  1Y25 A;  2JU5 A;  2YV7 A;  1OE7 A;  5IO2 A;  1XVW A;  4GXZ A;  3KIJ A;  1AQX A;  4WR4 A;  1M2D A;  5D9X A;  3F63 A;  3O3T A;  5IOW A;  4JZQ A;  1VF1 A;  3FKF A;  2FUG 2;  3DKS A;  3BJ5 A;  3WT2 A;  1GTA A;  1K0A A;  1OC9 A;  4OWY A;  4BVX B;  4F9Z A;  5LCZ A;  1G0T A;  4WBJ A;  3A5I A;  4RUV A;  5ECQ B;  2GSS A;  2DIY A;  1DBY A;  5J47 A;  2NPB A;  2JSZ A;  4MF7 A;  3TKS A;  2L5L A;  4AJ7 A;  4F03 A;  1C72 A;  1EWX A;  3CSH A;  1TXU A;  4POK A;  3TKP A;  3GX0 A;  2EFD A;  4DEJ A;  2YV9 A;  1XWA A;  4TN8 A;  5G5F A;  5J9C A;  1HYU A;  4KCA A;  3L9S A;  4X1U A;  4K9Z A;  3P90 A;  1FVK A;  2FLS A;  2YN1 A;  2WUL A;  2WJU A;  1ST9 A;  5DCH A;  1ZCP A;  4Q5F A;  5GAN D;  3E9J B;  1PX6 A;  2VAF A;  2EIQ A;  4DSS A;  1X5C A;  1A0R P;  2GZP A;  3MDK A;  4G10 A;  3UVT A;  3US3 A;  2KHP A;  3GV1 A;  2R4V A;  2YCD A;  4HOJ A;  2PGT A;  2DBC A;  1XXU A;  5GST A;  3H79 A;  3MYD A;  2VCX A;  3D6I A;  2HXK A;  2HZE B;  4X4J A;  4MZB A;  2R2J A;  1GWC A;  1XWC A;  5CRD A;  2I81 A;  4XS4 A;  1SJ6 A;  4ZXG A;  2F8F A;  1ZZY A;  4Z2T A;  2QC7 A;  2OAC A;  2OE1 A;  5L71 A;  4OD7 A;  4G2E A;  2ZCT A;  3HVS A;  4G0L A;  5IMD A;  4AKH A;  3PIN A;  4D73 B;  1SVL A;  2PU9 C;  3WGX A;  1Z6M A;  1BED A;  2LNS A;  2PER A;  1BYE A;  4O92 A;  2CAI A;  3ZZX A;  1KNG A;  4J56 E;  3BCK A;  2PPT A;  3QD9 A;  2R3X A;  1GNW A;  5G1L A;  3I69 A;  4MNN A;  1PMT A;  3OR5 A;  1IYH A;  1SL1 B;  2HE3 A;  2DJ3 A;  1Q4J A;  3E0U A;  3KP8 A;  2H66 A;  4Z2R A;  5IMZ A;  2OKA A;  2JSY A;  4GLT A;  2B7J A;  5J4Y A;  2L4Q A;  4CW9 A;  2L6C A;  1X9M B;  1JLW A;  1S3C A;  2NTO A;  2TRX A;  1S3D A;  3A3T A;  1F6M C;  4KE3 A;  3FEU A;  4EIQ A;  4XHM A;  1KBN A;  2N5A A;  5D9W A;  2WDU A;  2FGX A;  2X8H A;  4ICY A;  1GUM A;  2B5E A;  2RUE A;  2UZ8 A;  2GVP A;  4IJ3 A;  2RM5 A;  1LBK A;  4ECC A;  2WZ9 A;  1GL8 A;  1PN9 A;  3ZRD A;  4G19 A;  4N30 A;  1VF2 A;  16GS A;  2V6O A;  1TK8 B;  4MK3 A;  3ZLP A;  2YWM A;  11GS A;  4NV5 A;  3IR4 A;  2I4A A;  1MDK A;  1TI3 A;  4L5O A;  3CRT A;  4QMK A;  5DAL B;  3GSS A;  1DSB A;  4ZBA A;  5EVO A;  2X64 A;  2VCQ A;  2E0Q A;  1SD9 A;  4EVM A;  1O6J A;  3FR9 A;  3KTL A;  1QGV A;  1AC1 A;  2FWF A;  3L78 A;  2LRN A;  2R0P A;  1GTU A;  2GT5 A;  2ON5 A;  3UAP A;  1JFU A;  2DKH A;  2EIR A;  1NHY A;  3UJ1 A;  3IHG A;  4MPF A;  4ECJ A;  3TKS C;  2VD1 A;  1SK2 A;  4YQM A;  5B8B A;  3D5J A;  3Q19 A;  2GT6 A;  1SK1 A;  1VRS D;  1JZD A;  4OFM A;  1V58 A;  5G5E A;  5ELG A;  3HJO A;  1FVJ A;  1WP0 A;  2H0G A;  3C1R A;  3EMP A;  2K8S A;  1GSF A;  3ZL5 A;  1GSS A;  4OCE A;  1GRX A;  5LNK e;  1VF3 A;  4GCI A;  1V57 A;  4WXT A;  1ZYE A;  4GWR A;  2CT6 A;  3IK9 A;  3VWV A;  2RUF A;  4N3Z A;  5E59 A;  5AIX A;  4ZBB A;  3M0F A;  1PSQ A;  2CX4 A;  2H01 A;  5GAP D;  4ZBD A;  1SL0 B;  2WGR A;  3AY8 A;  2QSI A;  3LEF A;  4K2X A;  4K6X A;  4RI7 A;  4ZB8 A;  3HKR A;  3EUR A;  4USS A;  3KM6 A;  3HZ4 A;  1AQV A;  1W89 A;  4L8E A;  2I1U A;  2TRC P;  1K0B A;  3LYK A;  2H71 A;  4Z7X A;  2GTU A;  1OC3 A;  2H1L A;  3NZN A;  1U3A A;  2JL4 A;  2HSH A;  4XRA A;  4MF6 A;  4H86 A;  2L59 A;  2PMT A;  4JED A;  3QAG A;  1R5P A;  2DMM A;  3TKS E;  4MJC A;  1WIK A;  4ZL8 A;  1WMJ A;  2OJL A;  1GSU A;  1SVM A;  4NHZ A;  1N25 A;  2DKI A;  4YAP A;  3VWU A;  3VK9 A;  3GKM A;  5JCU A;  3NOF A;  5KOX A;  3Q6O A;  1BAY A;  3M9K A;  2UV8 G;  3ZVJ A;  4XCS A;  4RI6 A;  2DLX A;  3TGZ A;  1USB A;  1WRY A;  3DML A;  4TRX A;  4MJE A;  2PBJ A;  3IC4 A;  2AV4 A;  1TI1 A;  2EC4 A;  3WYW A;  3CYN A;  4FYU A;  4Z2U A;  4N11 A;  2NDO A;  1O81 A;  4PNG A;  1G6Y A;  1ZOF A;  1NW2 A;  2K9F A;  3RHB A;  3J7Y b;  5ECO B;  1ACV A;  3C1S A;  5EPF A;  4K8M A;  3ZIJ A;  5KN0 A;  3IA1 A;  2HZF A;  2DJJ A;  1TW9 A;  3F3R A;  1FOV A;  4BA7 A;  2O5V A;  2P0G A;  2CVB A;  2V32 A;  5EY6 A;  1TRS A;  1O8W A;  2EFC A;  5CNW A;  5G1K A;  2K6V A;  2HRK B;  5J3R A;  2HRF A;  5BMU A;  1A0F A;  2EFE A;  4YAV A;  3EC3 A;  1SD8 A;  2PN8 A;  1EOH A;  3HD5 A;  2DSA A;  1JZR A;  3ZFB A;  5F07 A;  1F3A A;  3QCP A;  4K5S A;  1JHB A;  1FG4 A;  1PKW A;  3U5R E;  4JR4 A;  4QL7 A;  1ZGN A;  3MNG A;  2KLX A;  3DVX A;  4HEA 2;  3H4K A;  2OBK A;  1ZYN A;  1SVO A;  1AIU A;  3UIW A;  2FCH A;  4NXI A;  4EIP A;  2E2G A;  1K3L A;  2FA4 A;  2F3M A;  1G6W A;  5COH A;  3H1N A;  1SK0 A;  1PN0 A;  2MMN A;  4WR5 A;  4GST A;  4F2I A;  1LJR A;  3IPZ A;  2XBQ A;  1OKT A;  2LEG A;  3HYP A;  4TR1 A;  2B3S A;  2XPE A;  2H6X A;  4ULX A;  2QKE A;  1EP7 A;  2BMX A;  2HZE A;  2V1M A;  3GX8 A;  3BOA A;  1XWB A;  5H5R A;  4MP4 A;  4RQR A;  4EO3 A;  3FW2 A;  2HFD A;  4K2D A;  1M2A A;  3EU4 A;  2L6D A;  1EV4 A;  3EU3 A;  1ABA A;  1ZYP A;  4MZC A;  1X9W B;  1XBS A;  1V9W A;  4KCE A;  3HDC A;  3HZ8 A;  1TU7 A;  2E7P A;  1KEB A;  3GYK A;  2JZT A;  1SKR B;  2B5X A;  4I2T A;  4D73 A;  1JLV A;  3TOU A;  9GSS A;  1XPV A;  2CQ9 A;  5C00 A;  3EIN A;  3TJG A;  1U3I A;  17GS A;  5ECK B;  1PKZ A;  3DGQ A;  3GH9 A;  3CRU A;  2ES7 A;  4W66 A;  4ZB9 A;  3CSI A;  3FK8 A;  1EV9 A;  12GS A;  1YKC A;  4MLY A;  3QMX A;  2YAN A;  5AGY A;  3LXT A;  4ECB A;  4OFN A;  1ZL9 A;  4WF4 A;  2IMF A;  3TB2 A;  3VI7 A;  4XRD A;  4J57 E;  3WD6 A;  2LQO A;  2CVK A;  4IN0 A;  3UMA A;  2GS3 A;  2O8V B;  2DJ1 A;  1GNE A;  4Q5Q A;  5IO0 A;  3IXR A;  5BMU B;  3ERG A;  3F0I A;  2BJX A;  1XWG A;  4AKG A;  5J5N A;  5G30 A;  3ED3 A;  3G7I A;  2E2M A;  1SJI A;  4OFT A;  4BWS A;  2F51 A;  2MYG A;  6GSS A;  3Q18 A;  2OA7 A;  4O7H A;  3FRC A;  5DAL A;  5CYY A;  5A34 B;  4MPG A;  3C8E A;  2LV3 A;  2GST A;  2DIZ A;  1PQN A;  4FYB A;  4IS0 A;  4FIW A;  1J0F A;  3O76 A;  1HNB A;  4G0I A;  4PUR A;  1SKS B;  2GQL A;  5GZZ B;  4EDY A;  3TJB A;  4GSS A;  5J4U A;  4K0G A;  1FAA A;  3K8N A;  1AAZ A;  4EL1 A;  1PL2 A;  3ME8 A;  1X0R A;  2P5R A;  2C4J A;  1LU4 A;  3GFK A;  2FY6 A;  2A2R A;  1AW9 A;  2VD0 A;  3IDV A;  2IL3 A;  2RII A;  4TR3 A;  4EDZ A;  4TR1 B;  4OO5 A;  1TK5 B;  3FZA A;  1V98 A;  4ID0 A;  1OYJ A;  4HZ4 A;  2YWI A;  3KXO A;  1EEM A;  1A2J A;  1Z9H A;  3KD0 A;  5ELA A;  3RAZ A;  1TKD B;  4KND A;  3F8U A;  4I6X A;  4G0K A;  4O5U A;  1YZX A;  4ECI A;  1B4Q A;  3WT1 A;  1NHO A;  3APO A;  2L4C A;  1FB0 A;  1E2Y A;  5B8A A;  2WCI A;  1CQH A;  3VUR A;  3LGC A;  2JAD A;  3UBL A;  4ISD A;  5CRG A;  5ECH B;  2VO4 A;  3RDW A;  3VI5 A;  1WPI A;  1XZO A;  1T00 A;  5A1N A;  1EOG A;  5IMA A;  3EPT A;  4TR4 A;  4DVC A;  5ECL B;  5DAK A;  1Y1U A;  2NBS A;  2VUP A;  2LRC A;  6GSV A;  5AN1 A;  5CAX A;  5ECS A;  2PUK C;  3CTF A;  2FNO A;  4IW9 A;  1M2B A;  4EXJ A;  4CY8 A;  4TR0 A;  2FD3 A;  2L5O A;  1XIY A;  4WF5 A;  2O85 A;  2M80 A;  1DE1 A;  1OE8 A;  2FA8 A;  2H30 A;  1SEN A;  4Q5N A;  3QDN A;  2IN3 A;  5ECN B;  5DDL A;  1Z7P A;  2LJK A;  1PL1 A;  5CO3 A;  1HD2 A;  3TU3 B;  1XOB A;  4IJI A;  2YOI A;  2HSN B;  4HUA A;  2HRN A;  1GH2 A;  3FZ4 A;  3IV4 A;  3GUR A;  2LJA A;  4ZB7 A;  1ZMA A;  5H5Q A;  5C04 A;  2RLI A;  4MJB A;  4I97 A;  13GS A;  1I9D A;  2V2G A;  4LLR A;  4O32 A;  2HNL A;  5EL8 A;  4KW6 A;  5DVB A;  2HSM B;  4IP1 A;  1YF0 A;  3UAR A;  1M7T A;  3D4M A;  2IIY A;  2CX3 A;  1ERV A;  3IBH A;  3M3M A;  3VLN A;  3N5O A;  1OC8 A;  2IME A;  3V1W A;  2A4H A;  3LG6 A;  3KH9 A;  3LSZ A;  4MA9 A;  4IBP A;  4V1A g;  1GUK A;  3GRX A;  6GSW A;  5HR2 A;  4ZIL A;  3C73 A;  4KA0 A;  1Z7R A;  2IMD A;  4IP6 A;  4KB3 A;  1T4Z A;  4HS1 A;  5HFI A;  3LWA A;  2H1B A;  4WBR D;  2MMA A;  5IMF A;  1ILO A;  1HNC A;  1F3B A;  2P31 A;  5F8B A;  5FT3 A;  1KTE A;  1XW9 A;  2HRK A;  2YZU A;  4TVE A;  2GQM A;  2M72 A;  5H5S A;  5FHI A;  5ECM B;  4N0V A;  5BRT A;  1M99 A;  2H19 A;  5DBQ A;  4FQU A;  1PRX A;  5D9T A;  1K0O A;  4NAX A;  3VPQ A;  3HMJ G;  1MD4 A;  3BBY A;  2EIO A;  4KDX A;  4TKY A;  2C8U A;  4E8H A;  2R37 A;  3FR3 A;  3R3E A;  1YF1 A;  4HDE A;  1TRW A;  2H0H A;  4DSQ A;  4KDU A;  2C0G A;  3CXG A;  5HR3 A;  2VLT A;  1GUH A;  2VL9 A;  3CSJ A;  3TRQ A;  4IKH A;  4AF2 A;  4GDF A;  4LMW A;  5ECR B;  5A1N B;  4ZL7 A;  4EKZ A;  2O89 A;  5A5K A;  4ZIJ A;  5DAK B;  3GST A;  5D9V A;  4GF0 A;  4CY6 A;  1PX7 A;  1ERW A;  5IMV A;  1A8L A;  3HVX A;  3HJP A;  3FY7 A;  4YKF A;  3KCM A;  1UC7 A;  2XPD A;  1Z3E A;  4KSM A;  2IFQ B;  2AAW A;  4IGJ A;  3TUE A;  4O5Q A;  2DJ0 A;  2TIR A;  4NWY A;  5LD0 A;  3KMO A;  3H8Q A;  4CDO A;  1E6B A;  3QAW A;  1S3A A;  4EE0 A;  2QGV A;  1QFN A;  4PUA A;  3IRA A;  2GDR A;  1SJZ A;  3APS A;  3H93 A;  2HT9 A;  1YVL A;  2ZNM A;  5HQP A;  3CWG A;  4IQA A;  3F4T A;  4OO4 A;  2MBS A;  4A5P A;  3D22 A;  5A5H B;  3TOT A;  1XVQ A;  1O73 A;  4AKI A;  1FW1 A;  1R26 A;  2H76 A;  3IAS 2;  3W8S A;  6GST A;  1K0C A;  3KP9 A;  5JCG A;  3HJM A;  1O8X A;  1OVN A;  2WB9 A;  2C0D A;  2LST A;  3TKR A;  3TJK A;  4HQS A;  2VCZ A;  4G01 A;  3FZ9 A;  4DSR A;  1T4Y A;  3RPN A;  4LL1 B;  2N5B A;  1T7P B;  2XC2 A;  1YQ1 A;  3GMF A;  18GS A;  3PR8 A;  2GZZ A;  4HZ2 A;  3A2X A;  2JZS A;  3DIE A;  2O87 A;  4ACS A;  2LUS A;  1BG1 A;  5J4V A;  5J9B A;  1DE2 A;  5B6N A;  5DQS A;  4N10 A;  5D93 A;  1QK8 A;  3RPP A;  2YJH A;  2EFH A;  3N9J A;  3UBK A;  7GSS A;  4WKW A;  5JCW A;  1TRU A;  1AUC A;  4NPB A;  1VF4 A;  4MDC A;  2YJ7 A;  2CA8 A;  5JWQ B;  2GQK A;  2VCT A;  4XTS A;  2G2Q A;  1YKA A;  1J08 A;  3GKN A;  4PUF C;  2LKU A;  4KX4 A;  2J9H A;  5A34 A;  4G9H A;  2N5F A;  3I43 A;  4AGS A;  1K0D A;  2X8C A;  1B8X A;  4YQV A;  3TJF A;  4IVF A;  3TRP A;  2GSR A;  2DML A;  2OBI A;  4L5L A;  1BQ7 A;  5KN3 A;  3TDG A;  4NMU A;  2X4A A;  4QQ7 A;  2H8L A;  1UA5 A;  3MAK A;  4TXO B;  4KF9 A;  4PNF A;  1FHE A;  1F37 A;  2HSY A;  3L9U A;  2YWN A;  4PGT A;  2IMI A;  2B1L A;  4HU7 A;  4NHW A;  3LXZ A;  1TJD A;  2YP6 A;  2C0F A;  3QPM A;  3UVH A;  6GSX A;  2ALB A;  2MZC A;  2H70 A;  2MMO A;  4MCU A;  3L9V A;  3UL3 A;  5CP1 A;  3DXB A;  4KAE A;  2IPA A;  3IAM 2;  4GRF A;  4IQ1 A;  1T8E B;  1U6T A;  1WE0 A;  3EE2 A;  1HQO A;  3KTB A;  3RHC A;  1EGR A;  3IK7 A;  4I2U A;  4Q5R A;  1TDI A;  2C3Q A;  3IE3 A;  3GA4 A;  1JZW A;  4K5R A;  4L0W A;  1ZYQ B;  5KEJ A;  3KJY A;  3L0H A;  5IQY A;  2XBI A;  2H6Y A;  2B6M A;  1TTZ A;  3F3Q A;  1Y6E A;  1BX9 A;  2IJY A;  2VCV A;  4POM A;  2GLR A;  4PQ1 A;  2QA2 A;  2A2P A;  3QR6 A;  1MD3 A;  4ILF A;  1XCC A;  2OAD A;  3CBU A;  22GS A;  5FWG A;  3MWH A;  2AJQ B;  1N2A A;  3CTG A;  2R5G A;  4V1A p;  1GLP A;  2WS2 A;  3PGT A;  4V2L A;  4ZL9 A;  2KUC A;  4EUY A;  1SYR A;  4HU9 A;  1X9S B;  3BCI A;  1R4W A;  1Q98 A;  2H1G A;  5B7C A;  2X8G A;  2JZR A;  4POL A;  2HSN A;  3LQ7 A;  1T3B A;  1XOA A;  1YY7 A;  2DJ2 A;  5JWO B;  3EVI A;  1OKD A;  1W4V A;  2B7K A;  3C71 A;  20GS A;  2CAQ A;  3F6F A;  4BL7 B;  1A24 A;  1M9A A;  5DQY A;  3VWW A;  2H1A A;  3ME7 A;  4V2M A;  1HNA A;  2Z9S A;  2L57 A;  2HSM A;  2AB6 A;  5J40 A;  2VM2 A;  1ON4 A;  1G7O A;  3I9V 2;  1OAZ A;  3DVW A;  1A23 A;  3PH9 A;  4JBB A;  2VKZ G;  5HR1 A;  1ERT A;  4I5Q A;  1RW1 A;  2GZY A;  3ZVJ D;  1DUG A;  4HQZ A;  4NV2 A;  3MSZ A;  2HYX A;  1B9Y C;  2KP1 A;  4FYC A;  4PX1 A;  4LMV A;  1TU8 A;  4MJA A;  1QXH A;  5DCG A;  5F05 A;  1V2A A;  1O7U A;  3A2V A;  2VM1 A;  4KSO A;  1WWJ A;  3DEX A;  3I6A A;  1BJX A;  5ID2 A;  5CRW A;  2IWT A;  4K7I A;  3UEM A;  3NIV A;  3MIX A;  3JCM L;  4AKX B;  1QMV A;  10GS A;  4GSN A;  3J7Y k;  4MH3 A;  2LTK A;  3GIX A;  3HY2 A;  5ABR A;  3HXS A;  1SL2 B;  4BWQ A;  3F9U A;  2X49 A;  1CQG A;  3GN3 A;  3GTU A;  3BD2 A;  3APQ A;  1QUW A;  1BF5 A;  2I9H A;  2WFC A;  1XFL A;  2CZ3 A;  2I3Y A;  4PQI A;  4YH2 A;  2OE3 A;  4YKG A;  2C1Y A;  1QQ2 A;  1MEK A;  3ZFL A;  1EZK A;  3ZIV A;  3DWV A;  3F4S A;  3M9J A;  5AIV A;  1ERU A;  2LS5 A;  1THO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...