3LG6A

Crystal structure of putative glutathione transferase from coccidioides immitis
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
229
structure length
229
Chain Sequence
TPNFELYGYFRSSCSGRLRIAFHLKSIPYTRHPVNLLKGEQHSDTYKSLNPTNTVPLLVVSNINNTVSPSSASFSIGQSLAALEYLEEALPTNARPLLPPISNPVARAHVRTICNIIACDVQPVTNLKIQKKVKALDGDPTVWSRDLATQGFGAVEKLLELSAGRFCVGDEITLADVCLVPAVWAAERVGMDLARFPITKRVFEEMLKEEAVQKAHWQKQEDTPEDLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a putative zeta-class glutathione S-transferase from the pathogenic fungus Coccidioides immitis.
pubmed doi rcsb
source organism Coccidioides immitis
molecule tags Transferase
molecule keywords putative glutathione transferase
total genus 78
structure length 229
sequence length 229
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2010-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3lg6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3lg6A01
4PTSA 1CQGA 5IMVA 4X1UA 2NBSA 3L78A 3I9V2 3M8NA 3LORA 1VF4A 4ACSA 1JFUA 5IPGA 4WF5A 4ZB8A 1TXXA 3MWHA 5DQSA 3CSHA 2MMNA 2TRCP 1EOGA 1HYUA 3KIJA 3GHAA 4WBRD 4F03A 2YZHA 4NWYA 4NHZA 3QOUA 1K3OA 1TKDB 2UZ8A 2VCZA 1O81A 5DAKA 1WMJA 2G2QA 4FYCA 2PMTA 3EU3A 2YCDA 2PGTA 3D22A 3VI5A 2H6XA 2NDOA 1CQHA 3FZ5A 1XCCA 2F8AA 1M99A 2QGVA 4O92A 5ECNB 4HQSA 2DJKA 2A2RA 4DSQA 2OBKA 5KN1A 1FHEA 3EYTA 4KH7A 1XW9A 4OCFA 3O76A 2IMKA 3LJRA 2N5BA 1PX7A 3L9UA 5G5FA 3ZFLA 4H86A 3IDVA 4I6XA 1ZGNA 1B8XA 2YV9A 1XXUA 1GTIA 3F9UA 1GULA 1YKCA 5E4WA 2I1UA 2HRFA 4MF7A 1WOUA 2MZCA 5CP1A 3Q74A 19GSA 5CREA 5F8BA 1IYHA 1ML6A 4NPBA 1AQVA 2H71A 1Z3EA 2FA4A 3QAWA 1EOHA 1MD3A 1G6YA 1TRWA 3WGDA 2GSQA 3TKSA 3G7JA 5FHIA 1HNBA 1TRSA 3HY2A 1XFLA 2EIRA 1GSEA 2H74A 3KJYA 2XBIA 5ELGA 1TOFA 2MMAA 3MAKA 3PINA 3UAPA 5JCGA 1GTBA 1SD9A 2FUG2 1PRXA 3ERWA 1O7UA 3FY7A 1A8YA 4DSSA 5DCGA 1ERVA 4AJ7A 1TP9A 1Z6NA 2H1AA 3TGZA 3KXOA 2QC7A 4ZL9A 1K0OA 2JADA 2TRXA 2X8HA 2CAQA 2MBSA 5G1KA 3GNJA 3VWUA 4TRXA 4WR4A 1DBYA 4Q5QA 2ZCTA 3TKQA 2IN3A 5D9XA 4EDYA 2O7KA 5G1LA 4XHMA 1B4PA 5D9VA 4IQAA 1VGLA 3LYPA 3QAGA 5J3RA 3C8EA 3QR6A 3ME8A 3I6AA 2EIQA 2HRAA 3ZL5A 3HJPA 5LNKe 1VF1A 2LEGA 2O89A 1HQOA 1SKWB 2LNTA 2VOCA 3LGCA 1ZL9A 5B7CA 2DJ0A 5F05A 1WPIA 4EO3A 4ULXA 4EXJA 3S9FA 4G0LA 3EMPA 1K3YA 4GSTA 1OYJA 2H19A 2C4JA 4EVMA 1ZYEA 2C8UA 3QFBC 1EGOA 4YQVA 3EE2A 3EINA 4DEJA 2VLTA 4KSOA 3US3A 4YAPA 2B5EA 5IM9A 2V6OA 4ML1A 1XWGA 2LV3A 4XS6A 4I2UA 1M7TA 4OFMA 2DLXA 4WKWA 4LL4B 2GSRA 1YF1A 3R2QA 4WXTA 2CA8A 5HR3A 1DSBA 1VRSD 3F4SA 4EC0A 2HZFA 2RIIA 1ILOA 3IHQA 4YQUA 5EL8A 4F82A 3KH9A 3FR6A 2OADA 4MMMA 1PL2A 2CVDA 1NM3A 4ZIJA 2KUCA 4X0XA 5LD0A 4MDCA 5F0GA 4L0UA 3IC4A 2HXKA 1FB0A 4E8HA 3M9JA 3TRXA 2C0GA 2C1YA 1PN9A 3MDKA 3EURA 3TCOA 1UVZA 2P5RA 1GSUA 1OE8A 5JCWA 1JLWA 4HOJA 3KEBA 3HXSA 3D21A 2WCIA 17GSA 2VLUA 3OR5A 4GQCA 4QL9A 2ZUPA 2H0GA 5J4UA 3BCKA 1RK4A 1BX9A 3LXTA 4WEYA 3V1WA 3RBTA 1M2AA 2FD3A 3CRTA 4Q5FA 1OAZA 5IO0A 1K0MA 2H73A 2M72A 1K3LA 4IS0A 3CTGA 3FZAA 2IL3A 1TRUA 5EY6A 4KF9A 4OMVA 4MF5A 3QPMA 1GTAA 3GA4A 3KP8A 1Z5YE 5FT3A 5H5SA 3EVIA 1R7HA 3F0IA 4EUYA 1YEPA 3VPQA 1ZZYA 3EU4A 1X5EA 2GQLA 2OBIA 3ZIVA 5A5KA 1KBNA 3LEFA 1GWCA 3QAVA 5CYYA 2ON7A 1JZOA 1A24A 1USBA 2L5OA 4OCEA 4BL7A 3EWLA 4V2NA 2OA7A 2L4QA 2XPEA 2LQQA 5J9BA 3QD9A 5GZZB 2BTOT 3PR8A 2H0IA 5INYA 4HU7A 1R5PA 1VF3A 3LXZA 1YKAA 3RAZA 1MTCA 3CRUA 1TK8B 3D4MA 3TJJA 1OC8A 2FCHA 3D4TA 1B9XC 3Q18A 3QFAC 4JRRA 4TOPA 2FGXA 2VLVA 4MH3A 3TJFA 4KA0A 5ECPB 1TW9A 1U3AA 2JSZA 2FWGA 3UARA 5D8IA 4HS1A 2R5GA 4TVEA 4RI7A 3DIEA 3PGTA 4LLRA 4JE1A 2LRTA 1NHYA 5G5EA 3SBCA 3FK8A 5JWOB 2V41A 3BD2A 1EV4A 3O3TA 1R5AA 5EPFA 2DBCA 1QQ2A 2YOIA 2I4AA 1SK1A 4MJBA 3HZ8A 3F4TA 3ME7A 3LG6A 4IQ1A 5CAXA 4JBBA 2H75A 4HJMA 5COHA 5DVBA 5CRHA 2OE0A 3UVTA 2H30A 3NIVA 5GSSA 3D5JA 4FYBA 5CRDA 3DRNA 3ZLPA 2GT6A 3O6TA 1TJDA 3GKKA 3FW2A 1NHOA 4MF6A 2JL4A 1ERTA 2C0FA 3IV4A 4X43A 3ZYWA 4NAXA 1A0RP 3VFIA 2H66A 1GUMA 4WETA 5HR2A 1TI3A 2H72A 4L5LA 1Q4JA 1J0FA 1JHBA 2VD0A 1FB6A 1XW6A 1GLPA 2HSMB 1U88A 3UIWA 2DJ2A 1U87A 3HKRA 3RPNA 3UL3A 1I5GA 4BWSA 3ED3A 2K6VA 5GAND 3I69A 2PPTA 4G2EA 2ALBA 3HA9A 2JU5A 4JR6A 2B7KA 4CHSA 2XHFA 5AN1A 4JZQA 3GL3A 4RQXA 2V6KA 1G7OA 4XIHA 4CDOA 4MJEA 5C00A 2DIYA 1AUCA 2REMA 3D6IA 1GUHA 4IJ3A 1MDKA 3LWAA 1PX6A 3ERGA 2CX3A 3DWVA 3FZ4A 5ECRB 4EL1A 2LJKA 5ECQB 2VL9A 4GSNA 3GL5A 1Z7PA 5IMDA 4KE3A 1N2AA 18GSA 2FWEA 1T1VA 4IBPA 1Y6EA 1Z7RA 1O6JA 3TDGA 4XS4B 3UVHA 4QL7A 3H8QA 4ZBBA 4ZBAA 3CSJA 2CVBA 3VWXA 2R4VA 2B7JA 2YPMA 1X9SB 4FQUA 5EVOA 3ZMKA 3RHCA 1A2MA 2HT9A 2YJHA 1X9MB 4AJ6A 4I97A 1M9BA 1E2YA 3TB2A 2G0FA 1BG5A 1MDIA 4I8BA 16GSA 2KOKA 1WE0A 1TK5B 2H6ZA 2X8CA 1GL8A 5IMZA 1F2EA 2YWMA 1PKZA 1EEJA 2I81A 1YJ6A 2VIMA 2C0DA 3CBUA 3AY8A 3GH6A 4MZWA 4HZ4A 1J08A 5HFIA 4J2FA 3H4KA 2KP2A 1OKTA 1G7EA 2WULA 2VL3A 1X0RA 4KNDA 2PWJA 1ON4A 2LKUA 2OE3A 1AQWA 1I9DA 4JR4A 3P7XA 1X9WB 4O32A 4MPGA 3GIXA 4WF4A 4K9ZA 4IHUA 4IP6A 1GTUA 4YH2A 3ZRDA 4G0KA 1OC9A 3HDCA 4L8EA 4ILFA 3TOTA 2WZ9A 2IPAA 5L71A 4HUAA 1AC1A 4RUVA 4G9HA 2HI7A 5ECIB 1N8JA 2P5QA 4XS4A 2H1DA 2FA8A 1YDKA 1TRVA 3N9JA 3E9JB 4PQHA 2IMFA 2DMLA 2B5YA 5IPHA 1V58A 5C04A 1MEKA 1AQXA 1R26A 1WRYA 3ZMLA 3M0FA 1PSQA 3F4RA 4GLTA 4BPYA 1C72A 1KEBA 1PKWA 2MMZA 2XBQA 4L5OA 4D73B 1TI1A 1GSYA 2IMDA 3C73A 3IA1A 5DAKB 1PA3A 3HJMA 2QKEA 2OKAA 3EMXA 4LA1A 3GRXA 2DJ3A 4ML6A 1VF2A 1F6MC 1SK0A 2YV7A 2VAFA 3UMAA 2VD1A 2E2GA 2YWNA 5B6NA 4FIWA 1GSFA 4ISDA 4PURA 2YN1A 3GX0A 3U6VA 1ERWA 4DVCA 2PN8A 2HQTA 2L57A 1FAAA 2HRNA 5DDLA 2YP6A 1S3AA 2I9HA 3GSTA 3P90A 1TDIA 5KN3A 3TJGA 3IBHA 3M1GA 1M2DA 2AJQB 4ZXGA 3DVWA 4OO5A 4KDXA 5IMCA 2P0GA 4TXOB 2NPBA 1T8EB 2H76A 1B4QA 1M9AA 2DJJA 3DVXA 3VWVA 3PH9A 4IW9A 2LSTA 1E6BA 1U3IA 1ZCPA 3GKNA 1SJ6A 5DBQA 1SL0B 4TXOA 1LBKA 2F9SA 5ABRA 4IJIA 4LMWA 4V1Ap 3DXBA 1IYIA 2HNLA 2LQOA 1H75A 1ABAA 2C3QA 5HQPA 1A0FA 4XTSA 5B8AA 4Z7XA 2H70A 3ZVJD 3IR4A 4HZ2A 4HU9A 2AYTA 2JZSA 5DALA 4ZL8A 4MH2A 3W8SA 3WGXA 5AIVA 1JZDA 2EIOA 1PMTA 3LFLA 3FYGA 3FZ9A 3GURA 1KTEA 2IMEA 4EF0A 5H5QA 4NMUA 5D96A 4G19A 2LS5A 1V2AA 2WB9A 1YY7A 4HEA2 1NSWA 1LU4A 1BYEA 4BVYB 1EWXA 3RPPA 4TR1B 1SKSB 3IOSA 4HI7A 4IKHA 3VPTA 2EC4A 4HJ2A 2HFDA 4I2TA 4MPFA 3ZTLA 4MJCA 3HCZA 4KSMA 4YQMA 4XRDA 1URMA 3D0ZA 3VURA 1QK8A 5D9WA 1T7PB 2H1GA 4PX1A 1DE2A 2PVOC 4I5QA 2HRKA 5F06A 2LTKA 2VCXA 2A4VA 1XWBA 2CZ3A 1GSQA 1M2BA 2NVLA 2RUFA 4IELA 3UOMA 1BAYA 1B9YC 2CZ2A 2O85A 3F63A 2LJAA 11GSA 4XRAA 4ZBDA 1H4OA 4Q5RA 2PBJA 2E0QA 2AHEA 3IK9A 2FWFA 1THOA 2R3XA 3KGKA 3HVVA 2YANA 1V57A 2PERA 4E8EA 4KAEA 4GWRA 3F6FA 1XOAA 3IAM2 2F51A 4G10A 5DQYA 5G30A 3GV1A 3J7Yb 4DSSB 2VCWA 5ENUA 4HQZA 3BCIA 2B1KA 4KGIA 4ZL7A 4G0IA 4J56E 2GZPA 6GSUA 4XCSA 2N5AA 5IOXA 2K9FA 1BJXA 2GQKA 3TRPA 3CSIA 1O73A 4OO4A 1SENA 5J9CA 3HVXA 3C1RA 2VCVA 1Z6MA 3UEMA 1SD8A 2LNSA 2DSAA 1XIYA 1SU9A 1HD2A 2X8GA 1UC7A 2M80A 1TU8A 3DYRA 3WGEA 2I3YA 4P3YB 4GCIA 1QMVA 3GSSA 2XC2A 2R37A 1HNCA 3RDWA 1SYXA 2CX4A 1SL1B 2CVKA 5AISA 5ECSA 6GSXA 2BJXA 4F2IA 6GSTA 3GUSA 2GVPA 5ECLB 1PQNA 5KN0A 3VI7A 3QDNA 3ERFA 1A2LA 1SL2B 2GZZA 2M46A 1GSDA 3L0HA 3CYNA 4TKYA 2N5FA 1YF0A 4MA9A 3NOFA 4RQRA 4TN8A 1FO5A 4NV5A 3IXRA 2JZRA 3TKSE 5HR1A 5CNWA 3JCML 5H5RA 3ISOA 3APSA 4TXVA 1W4VA 6GSSA 4KX4A 8GSSA 4K7IA 5JWQB 4GXZA 12GSA 2RUEA 1A2JA 1S3DA 4K2DA 2YJ7A 2GT5A 3G7IA 5B8BA 5ECOB 2H8LA 2IIYA 1YZXA 3IE3A 1GUKA 1GP1A 2MMOA 5J41A 1PD21 3CMIA 5E59A 3HJOA 1WIKA 1K0DA 5ID2B 3IRAA 1K0NA 4BVYA 4YAVA 2LUSA 2PVQA 2LRNA 3ZFBA 4JU5A 1HNAA 2WRTA 1FVJA 2F8FA 3BBYA 3H1NA 1BQ7A 3TOUA 3GN3A 1YQ1A 2V1MA 3H93A 3DKSA 2VCQA 5LCZA 4PQIA 3FR9A 2VUPA 2NTOA 5IIZA 4JEDA 1X5DA 1JLVA 5DJLA 3KM6A 3DD3A 2GGTA 3MSZA 2AUVA 2IJYA 1F9MA 2OACA 4NV2A 2HRKB 2R2JA 3WT2A 2YWOA 2OJLA 4F9ZA 4ECBA 4KUNA 10GSA 3ZITA 4Q5NA 2J23A 2CAIA 4MCUA 2MBTA 4OFTA 2KP1A 1ACVA 4GRFA 5ELAA 3ZREA 1XBSA 1W89A 5JCUA 1AW9A 3F8UA 4PUFC 3KZQA 4N11A 2CQ9A 13GSA 4ECIA 2RM5A 1FOVA 1Q98A 3KP9A 3WD6A 1SYRA 4OFNA 2C3NA 1JZRA 1Y25A 2X99A 4QQ7A 3I43A 2ES7A 2VO4A 2XPDA 4TR0A 2E7PA 2L59A 3BJ5A 3C7MA 3VWWA 4BL7B 4AGSA 3Q19A 1O8WA 1AAZA 1TK0B 4GF0A 5JWRB 3G7YA 3CTFA 4LMVA 1WP0A 5G2ZA 3PPUA 3IK7A 5D73A 3FEUA 1EZKA 2B6MA 4N10A 1M0UA 1ZYQB 4MZBA 1OC9B 3TJKA 1PGTA 1MD4A 1G6WA 3DGQA 3L9VA 2Z9SA 2JSYA 4WR5A 3SWLA 3FR3A 4ZB6A 2DMMA 3EC3A 3GTUA 20GSA 3C71A 2OE1A 3BOAA 2K8VA 4GSSA 1SJIA 1NW2A 4N30A 3NZNA 2O8VB 3GH9A 3KMOA 2V32A 4V2LA 1K0CA 5IMFA 4LL1B 3TKPA 3APOA 1OVNA 1RW1A 3KD0A 4PXOA 2H01A 4TR3A 4FH8A 2KLXA 1OE7A 1XW5A 4OD7A 2BMXA 4J57E 3RHBA 1WWJA 3TKSC 3LSZA 2HE3A 1Z9HA 4XS1A 1XWCA 2CT6A 2VCTA 3R3EA 5CO3A 1TU7A 4KCAA 2KHPA 2PU9C 3TUEA 4O5RA 2HZEB 3GKXA 2VM2A 1F3BA 2A2SA 4K6XA 2GSSA 3KH7A 4MP4A 2VM1A 5GAPD 4K0GA 2VL2C 4ZILA 3QMXA 2J9HA 4K0NA 2DIZA 5IMAA 1GNEA 4KB3A 2P31A 3VK9A 1EGRA 2L5LA 4F0BA 1TTZA 1G0TA 4TR1A 1U6TA 2FY6A 2HZEA 4F0CA 1A23A 2C3TA 6GSVA 1EP7A 3J7Yk 3ZZXA 1UA5A 1FVKA 4USSA 1ERUA 3Q6OA 3HVSA 1ZMAA 4DSRA 3IPZA 2L4CA 4D73A 3IAS2 5IOWA 1QGVA 1YEXA 3HHVA 2GQMA 4V2MA 4BVXB 4BA7A 4V1Ag 2JACA 2LRCA 5IO2A 3GTUB 1F3AA 4CW9A 3U5RE 2PUKC 3A5WA 2AAWA 3VLNA 5DCHA 2FLSA 3E0UA 1GNWA 1OKDA 5CRGA 2V2GA 1GRXA 22GSA 3DEXA 3HD5A 5J5NA 3FRCA 4KW6A 2B1LA 1MDJA 3LQ7A 3P8WA 4MABA 4AF2A 2FNOA 4POKA 9GSSA 1ST9A 2JZTA 1K0AA 2WJUA 3ZVJA 4RI6A 2L6CA 4WBJA 5D9TA 2X64A 1XWAA 3QCPA 5F07A 5A4WA 1EEMA 4PNGA 5A4VA 4ZB9A 7GSSA 1XWKA 3GYKA 4BWQA 3C1SA 1K0BA 3UBLA 1O85A 4ECJA 3F3RA 1QUWA 3WT1A 4POMA 5HFGA 1GH2A 2TIRA 4K7OA 3F3QA 4FO5A 2WFCA 3M3MA 4MK3A 5HR0A 4ECCA 3K8NA 1S3CA 2ON5A 2QSIA 1QXHA 2WGRA 5CRWA 4MZCA 1O8XA 4BVXA 4HDEA 5DJMA 2D2ZA 3M9KA 2L6DA 2K18A 1BEDA 2HLSA 3LYKA 4OWYA 1KNGA 5GSTA 2MYGA 3GMFA 1LJRA 4IP1A 3FHKA 2H6YA 1XVQA 3GKMA 1SKRB 4PGTA 3GX8A 2GLRA 3H79A 4EDZA 4MJAA 1XPVA 1DE1A 1XOBA 2DJ1A 3DMLA 5ECKB 3W8JA 2AB6A 1AIUA 3CXGA 1EP8A 2FWHA 2FHEA 2H1BA 4IGJA 2IFQB 1B48A 4O7HA 4EKZA 1T4ZA 3F6DA 5KEJA 1XVWA 6GSWA 2GS3A 2IMIA 2IWTA 1F37A 1FG4A 3TKRA 2C80A 4MLYA 2GTUA 1J9BA 2B5XA 2O87A 3KCMA 3W6GA 4POLA 3A2XA 3L9SA 2LJRA 4EE0A 2ZNMA 2HSNB 2AV4A 3A2WA 4NXIA 1FW1A 1AXDA 2RM6A 2C0EA 3KMNA 6GSYA 5KN2A 2HSHA 2HSMA 2E2MA 1PL1A 5ID2A 5AIXA 3HZ4A 2B3SA 3IC8A 3L4NA 5BMUA 1DUGA 3N5OA 2CV4A 5ECHB 2F3MA 4GQFA 1GSSA 5G31A 5A4UA 2WDUA 4L0WA 4GTUA 3A2VA 3E3EA 1OC3A 4KDUA 3G9BA 4AJ8A 5DALB 4N0ZA 5D93A 1T00A 2R6KA 5ECMB 4K1FA 3GFKA 4KDYA 1A8LA 1XZOA 2WS2A 4IVFA 1T3BA 4TR4A 3A3TA 1GLQA 4NHWA 2YWIA 2YNXA 3TJBA 1V98A 4PQ1A 3ZIJA 5IQYA 4K8MA 3TRQA 4FYUA 4N0VA 3HYPA 1EV9A 1V9WA 4KCEA 5HFKA 3MNGA 4POBA 2DC5A 3UJ1A 4PNFA 5FWGA 1T4YA 2IFQA 5AGYA 4TW5A 3FKFA 2VL2A 5B6MA 1SK2A 1WJKA 4K7NA 4IN0A 1THXA 1X5CA 1RQMA 1V40A 4PUAA 3KTBA 3KTLA 2GZYA 1QFNA 1ZOFA 14GSA 2GDRA 2YZUA 3UBKA 3WYWA 2GSTA 3P2AA 1UN2A 2HSYA 1R4WA 2K8SA 3APQA 1JZWA 1SJZA 2RLIA 2HYXA 2H0HA 4ID0A
chains in the Genus database with same CATH superfamily
4PTSA 1CQGA 5IMVA 4X1UA 2NBSA 3L78A 3I9V2 3M8NA 3LORA 1VF4A 4ACSA 1JFUA 5IPGA 4PI2C 4WF5A 4ZB8A 1TXXA 3MWHA 5DQSA 3CSHA 2MMNA 2TRCP 1EOGA 1HYUA 3KIJA 3GHAA 4WBRD 2WVZA 4F03A 2YZHA 2WW2A 4NWYA 4NHZA 3QOUA 1K3OA 1TKDB 2UZ8A 2VCZA 1O81A 5DAKA 1WMJA 2G2QA 4FYCA 2PMTA 3EU3A 2YCDA 2PGTA 3D22A 3VI5A 2H6XA 2O36A 2NDOA 1CQHA 3FZ5A 1PN0A 1XCCA 2F8AA 1M99A 2QGVA 4O92A 5ECNB 4HQSA 2DJKA 2A2RA 4DSQA 2OBKA 5KN1A 1FHEA 3EYTA 4KH7A 1XW9A 2WW0A 4OCFA 3O76A 2IMKA 3LJRA 2N5BA 1PX7A 3L9UA 5G5FA 3ZFLA 4H86A 3TU3B 3IDVA 4I6XA 1ZGNA 1B8XA 2YV9A 1XXUA 1GTIA 3F9UA 1GULA 1YKCA 5E4WA 2I1UA 2HRFA 4PHZC 4MF7A 1WOUA 2MZCA 5CP1A 3Q74A 19GSA 5CREA 5F8BA 1IYHA 1ML6A 4NPBA 1AQVA 2H71A 1Z3EA 2FA4A 3QAWA 1EOHA 1MD3A 1G6YA 1TRWA 2EFHA 3WGDA 2GSQA 1I1IP 3G7JA 3TKSA 5FHIA 3RGBC 1HNBA 1TRSA 3HY2A 5A5HA 1XFLA 2EIRA 1GSEA 2H74A 5KOXA 3KJYA 2XBIA 5ELGA 1TOFA 2MMAA 3MAKA 3PINA 3UAPA 5JCGA 1GTBA 1SD9A 2FUG2 5BMUB 1PRXA 3ERWA 2O3EA 1O7UA 3FY7A 4CY8A 1A8YA 4DSSA 5DCGA 1ERVA 4AJ7A 1TP9A 1Z6NA 2H1AA 3TGZA 3KXOA 2QC7A 4ZL9A 1K0OA 2JADA 2TRXA 2X8HA 2CAQA 2MBSA 5G1KA 3GNJA 3VWUA 4TRXA 4WR4A 1DBYA 4Q5QA 2ZCTA 3TKQA 2IN3A 5D9XA 4EDYA 2O7KA 5G1LA 4XHMA 1B4PA 5D9VA 1TXUA 4IQAA 1VGLA 3LYPA 3QAGA 5J3RA 3C8EA 3QR6A 3ME8A 3I6AA 2EIQA 2HRAA 3ZL5A 3HJPA 5LNKe 1VF1A 2OT3A 2LEGA 2O89A 1HQOA 1SKWB 2LNTA 2VOCA 3LGCA 1ZL9A 5B7CA 2DJ0A 5F05A 1WPIA 4EO3A 4ULXA 4EXJA 3S9FA 4G0LA 3EMPA 1K3YA 4GSTA 1OYJA 2H19A 2C4JA 4EVMA 1ZYEA 2C8UA 3QFBC 1EGOA 4YQVA 3EE2A 3EINA 4DEJA 2DKHA 2VLTA 4KSOA 3US3A 4YAPA 2B5EA 5IM9A 2V6OA 4ML1A 1XWGA 2LV3A 4XS6A 4I2UA 1M7TA 4OFMA 2DLXA 4WKWA 4LL4B 2GSRA 1YF1A 3R2QA 4WXTA 4O5QA 2CA8A 4HSCX 5HR3A 1DSBA 1VRSD 3F4SA 4EC0A 2HZFA 2RIIA 1ILOA 3IHQA 4YQUA 5EL8A 4F82A 3KH9A 3FR6A 2OADA 4MMMA 1PL2A 2CVDA 1NM3A 4ZIJA 2KUCA 4X0XA 5LD0A 4MDCA 5F0GA 4L0UA 3IC4A 2HXKA 2R0PA 1FB0A 4E8HA 3M9JA 3TRXA 2H1LA 2C0GA 2C1YA 1PN9A 3MDKA 3EURA 3TCOA 1UVZA 1XG8A 2P5RA 1GSUA 1OE8A 5JCWA 1JLWA 4HOJA 3KEBA 3HXSA 3LW9A 3D21A 2WCIA 17GSA 2VLUA 3OR5A 4GQCA 4QL9A 2ZUPA 2H0GA 5J4UA 3BCKA 1RK4A 1BX9A 3LXTA 4WEYA 3V1WA 3RBTA 1M2AA 2FD3A 3CRTA 4Q5FA 1OAZA 5IO0A 1K0MA 2M72A 2H73A 1K3LA 2WVXA 4IS0A 3CTGA 2WW3A 3FZAA 2EFDA 2IL3A 1TRUA 5EY6A 4KF9A 4OMVA 4MF5A 3QPMA 1GTAA 3GA4A 3KP8A 1Z5YE 5FT3A 5H5SA 3EVIA 1R7HA 3F0IA 4EUYA 1YEPA 3VPQA 1ZZYA 3EU4A 1X5EA 2GQLA 2OBIA 3ZIVA 1Y1UA 5A5KA 1KBNA 3LEFA 1GWCA 3QAVA 5CYYA 2ON7A 1JZOA 1A24A 1USBA 4AKHA 2L5OA 4OCEA 4BL7A 3EWLA 2OA7A 2L4QA 4V2NA 2XPEA 2LQQA 5J9BA 3QD9A 5GZZB 2BTOT 3PR8A 2H0IA 5INYA 4HU7A 1R5PA 1VF3A 3LXZA 1YKAA 3RAZA 1MTCA 3CRUA 1TK8B 3D4MA 3TJJA 1ZYNA 1OC8A 2FCHA 3D4TA 1B9XC 3Q18A 3QFAC 4JRRA 4TOPA 2FGXA 2VLVA 4MH3A 3TJFA 4KA0A 5ECPB 1TW9A 1U3AA 2JSZA 2FWGA 3UARA 5D8IA 3MIXA 2R5GA 4N3ZA 4HS1A 4RI7A 4TVEA 1N25A 3DIEA 3PGTA 2UV8G 4LLRA 4JE1A 2LRTA 1NHYA 5G5EA 3SBCA 3FK8A 5JWOB 2V41A 3BD2A 1EV4A 3O3TA 4ICYA 1R5AA 5EPFA 2DBCA 1QQ2A 2YOIA 2I4AA 2HSNA 1SK1A 4MJBA 3HZ8A 3F4TA 3ME7A 3LG6A 4IQ1A 5CAXA 4JBBA 2H75A 4HJMA 5COHA 5DVBA 5CRHA 2OE0A 3UVTA 2H30A 3NIVA 5GSSA 3D5JA 4FYBA 5CRDA 3DRNA 3ZLPA 2GT6A 3O6TA 1TJDA 3GKKA 3FW2A 1NHOA 4MF6A 2JL4A 1ERTA 2C0FA 3IV4A 4O5UA 4X43A 3ZYWA 4NAXA 1A0RP 3VFIA 2H66A 2R0GA 1GUMA 4WETA 5HR2A 1TI3A 2H72A 4L5LA 1Q4JA 1J0FA 1JHBA 2VD0A 1FB6A 1XW6A 1GLPA 2HSMB 1U88A 4K5SA 3UIWA 2DJ2A 1U87A 3HKRA 3RPNA 3UL3A 1I5GA 4BWSA 4AI6A 2A2PA 3ED3A 4MNNA 2K6VA 5GAND 3I69A 2PPTA 4G2EA 2ALBA 3HA9A 2JU5A 4JR6A 2B7KA 4CHSA 2XHFA 5AN1A 4JZQA 3GL3A 4RQXA 1S3RA 1YEWC 2V6KA 1G7OA 4XIHA 4CDOA 4MJEA 5C00A 2DIYA 1AUCA 1PFOA 2REMA 3D6IA 1GUHA 2VKZG 4IJ3A 1MDKA 3LWAA 1PX6A 3ERGA 2CX3A 3DWVA 3FZ4A 5ECRB 4EL1A 2LJKA 5ECQB 2VL9A 4GSNA 3GL5A 1Z7PA 5IMDA 4KE3A 1N2AA 18GSA 2FWEA 1T1VA 4IBPA 1Y6EA 1Z7RA 1O6JA 3TDGA 4XS4B 3UVHA 4QL7A 2A4HA 3H8QA 4ZBBA 4ZBAA 3CSJA 2CVBA 3VWXA 2R4VA 2B7JA 2YPMA 1X9SB 4FQUA 5EVOA 3ZMKA 3FMWA 3RHCA 1A2MA 2HT9A 2YJHA 1X9MB 4AJ6A 4I97A 1M9BA 1E2YA 3HVNA 3TB2A 2G0FA 1BG5A 1MDIA 4I8BA 16GSA 2KOKA 1WE0A 1TK5B 2H6ZA 4EIPA 2X8CA 1GL8A 5IMZA 1F2EA 2O5VA 4PI0C 2YWMA 1PKZA 1EEJA 2I81A 5A1NA 1YJ6A 2VIMA 2C0DA 4Z2UA 4X4JA 3CBUA 3AY8A 3GH6A 4MZWA 4HZ4A 1J08A 5HFIA 4J2FA 3H4KA 2KP2A 1OKTA 1G7EA 2WULA 2VL3A 1X0RA 4KNDA 2PWJA 1ON4A 2X49A 2LKUA 2OE3A 1AQWA 1I9DA 4JR4A 3P7XA 1X9WB 4O32A 4MPGA 3GIXA 4WF4A 4K9ZA 4IHUA 4IP6A 1GTUA 4YH2A 3ZRDA 4G0KA 1OC9A 3HDCA 4L8EA 4ILFA 3TOTA 2WZ9A 2IPAA 5L71A 4HUAA 1AC1A 4RUVA 4G9HA 2HI7A 5ECIB 1N8JA 2P5QA 4XS4A 2H1DA 2FA8A 1YDKA 1TRVA 2EFCA 3N9JA 3E9JB 4PQHA 2IMFA 2DMLA 2B5YA 5IPHA 1V58A 5C04A 1MEKA 1AQXA 1R26A 1WRYA 3ZMLA 3M0FA 1PSQA 3F4RA 4GLTA 4BPYA 1C72A 1KEBA 5J4YA 4AKIA 1PKWA 2MMZA 2XBQA 4L5OA 4D73B 1TI1A 2QA2A 1GSYA 2IMDA 3C73A 3IA1A 5DAKB 1PA3A 3HJMA 2QKEA 2OKAA 3EMXA 4LA1A 3GRXA 2DJ3A 4ML6A 1VF2A 1F6MC 1SK0A 2YV7A 2VAFA 3UMAA 2VD1A 2E2GA 2YWNA 5B6NA 4FIWA 5A34B 1GSFA 4ISDA 4PURA 2YN1A 2WZSA 3GX0A 3U6VA 1ERWA 4DVCA 2PN8A 2HQTA 2L57A 1FAAA 2HRNA 5DDLA 2YP6A 1S3AA 2I9HA 3GSTA 3P90A 1TDIA 5KN3A 3TJGA 3IBHA 3M1GA 1M2DA 2AJQB 4ZXGA 3DVWA 4OO5A 4KDXA 5IMCA 2P0GA 4TXOB 2NPBA 1T8EB 2H76A 1B4QA 1M9AA 2DJJA 3DVXA 1FOHA 3VWVA 3PH9A 4IW9A 2LSTA 1E6BA 1U3IA 1ZCPA 3GKNA 1SJ6A 5DBQA 1SL0B 4TXOA 1LBKA 2F9SA 5ABRA 4IJIA 4LMWA 4V1Ap 3DXBA 1IYIA 2HNLA 2LQOA 1H75A 1ABAA 3CQFA 2C3QA 5HQPA 1A0FA 4XTSA 5B8AA 4Z7XA 2H70A 1M3JA 3ZVJD 3IR4A 4HZ2A 4HU9A 2AYTA 2JZSA 5DALA 4ZL8A 4MH2A 3W8SA 3WGXA 5AIVA 1JZDA 2EIOA 1PMTA 3LFLA 3FYGA 3FZ9A 3GURA 1KTEA 2IMEA 4EF0A 5H5QA 4NMUA 5D96A 4G19A 2LS5A 1V2AA 2WB9A 1YY7A 4BIKA 2EFEA 4HEA2 1NSWA 1LU4A 1BYEA 4BVYB 1EWXA 3RPPA 1ZYPA 5J4VA 4TR1B 1SKSB 3IOSA 4HI7A 4IKHA 3VPTA 2EC4A 4HJ2A 2HFDA 4I2TA 4MPFA 3ZTLA 4MJCA 3HCZA 4KSMA 4YQMA 4XRDA 1URMA 3D0ZA 3VURA 1QK8A 5D9WA 1T7PB 2H1GA 4PX1A 1DE2A 2PVOC 4I5QA 5J47A 2HRKA 5F06A 2LTKA 2VCXA 2A4VA 1XWBA 2CZ3A 1GSQA 1M2BA 2NVLA 2RUFA 4IELA 3UOMA 1BAYA 1B9YC 2CZ2A 2WVYA 2O85A 3F63A 4AKGA 2LJAA 11GSA 4XRAA 4ZBDA 1H4OA 4Q5RA 2PBJA 2E0QA 4QMKA 2AHEA 3IK9A 2FWFA 1THOA 2R3XA 3KGKA 3HVVA 2YANA 1V57A 2PERA 4E8EA 4KAEA 3CHXC 4GWRA 3F6FA 1XOAA 3IAM2 2F51A 4G10A 5DQYA 5G30A 3GV1A 3J7Yb 4DSSB 2VCWA 5ENUA 4HQZA 3BCIA 2B1KA 4KGIA 4ZL7A 4G0IA 4J56E 2GZPA 6GSUA 4XCSA 1BF5A 2N5AA 5IOXA 2K9FA 1BJXA 2GQKA 3TRPA 3CSIA 1O73A 4OO4A 1SENA 5J9CA 3HVXA 3C1RA 2VCVA 1Z6MA 3UEMA 1SD8A 2LNSA 2DSAA 1XIYA 1SU9A 1HD2A 2X8GA 1UC7A 2M80A 1TU8A 3DYRA 3WGEA 2I3YA 5A5HB 4P3YB 4GCIA 1QMVA 3GSSA 2XC2A 2R37A 1HNCA 3RDWA 1SYXA 2CX4A 1SL1B 2CVKA 5AISA 5ECSA 6GSXA 2BJXA 4F2IA 6GSTA 3GUSA 2DKIA 5ECLB 2GVPA 1PQNA 5KN0A 3VI7A 3QDNA 3ERFA 1A2LA 1SL2B 2GZZA 2M46A 1GSDA 3L0HA 3CYNA 4TKYA 1SVMA 2N5FA 1YF0A 4MA9A 3NOFA 4RQRA 4TN8A 1FO5A 4NV5A 3IXRA 2JZRA 3TKSE 5HR1A 5CNWA 4YKGA 3JCML 5H5RA 3ISOA 3APSA 4TXVA 1W4VA 6GSSA 4KX4A 8GSSA 4K7IA 5JWQB 4GXZA 12GSA 2RUEA 1A2JA 1S3DA 4K2DA 2YJ7A 2GT5A 3G7IA 5B8BA 5ECOB 2H8LA 2IIYA 1YZXA 3IE3A 1GUKA 1GP1A 2MMOA 5J41A 1PD21 3CMIA 5E59A 3HJOA 1WIKA 1K0DA 5ID2B 3IRAA 1K0NA 4BVYA 4YAVA 2LUSA 2PVQA 2QA1A 2LRNA 3ZFBA 4JU5A 1HNAA 2WRTA 1FVJA 3IHGA 2F8FA 3BBYA 3H1NA 1BQ7A 3TOUA 3GN3A 1YQ1A 2V1MA 3H93A 3DKSA 2VCQA 5LCZA 4PQIA 3FR9A 2VUPA 2NTOA 5IIZA 4JEDA 1X5DA 1JLVA 5DJLA 3KM6A 3DD3A 2GGTA 3MSZA 2AUVA 2IJYA 1F9MA 2OACA 4NV2A 2HRKB 2R2JA 3WT2A 2YWOA 2OJLA 4F9ZA 4ECBA 4A5PA 4KUNA 10GSA 3ZITA 4Q5NA 2J23A 2CAIA 4MCUA 2MBTA 4OFTA 2KP1A 1ACVA 4GRFA 5ELAA 3ZREA 1XBSA 1W89A 5JCUA 1AW9A 3F8UA 4PUFC 3KZQA 4N11A 2CQ9A 13GSA 4ECIA 2RM5A 1FOVA 1Q98A 3KP9A 3WD6A 1SYRA 4OFNA 3A5IA 2C3NA 1JZRA 1Y25A 2X99A 4QQ7A 3I43A 2ES7A 2VO4A 2XPDA 4TR0A 2E7PA 2L59A 3BJ5A 3C7MA 5BRTA 3VWWA 4BL7B 1S4BP 4AGSA 3Q19A 1O8WA 1AAZA 1TK0B 4GF0A 5JWRB 3G7YA 3CTFA 4LMVA 1WP0A 5G2ZA 3PPUA 2R0CA 3IK7A 5D73A 3FEUA 1EZKA 2B6MA 4N10A 1M0UA 1ZYQB 4MZBA 1OC9B 3TJKA 1PGTA 1MD4A 1G6WA 3DGQA 3L9VA 2Z9SA 2JSYA 4WR5A 3SWLA 3FR3A 4ZB6A 2DMMA 3EC3A 3GTUA 20GSA 3C71A 2OE1A 3BOAA 2K8VA 4GSSA 4Z2TA 1SJIA 1NW2A 4N30A 3NZNA 2O8VB 3GH9A 3KMOA 2V32A 4V2LA 1K0CA 5IMFA 4LL1B 3TKPA 3APOA 1OVNA 1RW1A 3KD0A 4PXOA 2H01A 4TR3A 4FH8A 2KLXA 1OE7A 1XW5A 4G01A 4OD7A 2BMXA 4CY6A 4J57E 3RHBA 1WWJA 3TKSC 3LSZA 2HE3A 1Z9HA 4XS1A 1XWCA 2X4AA 2CT6A 2VCTA 3R3EA 5CO3A 1TU7A 4KCAA 2KHPA 2PU9C 3TUEA 4O5RA 2HZEB 3GKXA 2VM2A 1F3BA 2A2SA 4K6XA 2GSSA 3KH7A 4MP4A 2VM1A 5GAPD 4K0GA 2VL2C 4ZILA 3QMXA 2J9HA 4K0NA 2DIZA 4E68A 5IMAA 1GNEA 4KB3A 4FXYP 2P31A 3VK9A 1EGRA 2L5LA 4F0BA 1TTZA 1G0TA 4TR1A 1U6TA 2FY6A 2HZEA 4F0CA 1A23A 2C3TA 6GSVA 1EP7A 3J7Yk 3ZZXA 1UA5A 1FVKA 4USSA 1ERUA 3Q6OA 3HVSA 1ZMAA 4DSRA 3IPZA 2L4CA 4D73A 3IAS2 5IOWA 1QGVA 1YEXA 3HHVA 2GQMA 4V2MA 4BVXB 4BA7A 4V1Ag 2JACA 2LRCA 5IO2A 3GTUB 1F3AA 4CW9A 3U5RE 2PUKC 3A5WA 2AAWA 3VLNA 5DCHA 2FLSA 3E0UA 1SVLA 1GNWA 1OKDA 5CRGA 2V2GA 1GRXA 22GSA 3DEXA 3HD5A 5A34A 5J5NA 3FRCA 4KW6A 2B1LA 1MDJA 3LQ7A 3P8WA 4MABA 4AF2A 2FNOA 4POKA 9GSSA 4W66A 1ST9A 2JZTA 1K0AA 2WJUA 3ZVJA 4RI6A 2L6CA 4WBJA 4Z2RA 5D9TA 2X64A 1XWAA 3QCPA 5F07A 5A4WA 1EEMA 4PNGA 5A4VA 4ZB9A 7GSSA 5A1NB 3MYDA 1XWKA 3GYKA 4BWQA 3C1SA 1K0BA 3UBLA 1O85A 4ECJA 3F3RA 1QUWA 3WT1A 4POMA 5HFGA 1GH2A 2TIRA 4K7OA 3F3QA 4FO5A 2WFCA 3M3MA 4K5RA 4MK3A 5HR0A 4ECCA 3K8NA 1S3CA 2ON5A 2QSIA 1QXHA 2WGRA 5CRWA 4MZCA 1O8XA 4BVXA 4HDEA 5DJMA 3M9KA 2D2ZA 2L6DA 2K18A 1BEDA 2HLSA 3LYKA 4OWYA 1KNGA 5GSTA 2MYGA 3GMFA 1LJRA 4IP1A 3FHKA 3CWGA 2H6YA 1XVQA 3GKMA 1SKRB 4PGTA 1M3IA 3GX8A 2GLRA 3H79A 4EDZA 4MJAA 1XPVA 1DE1A 1XOBA 2DJ1A 3DMLA 5ECKB 3W8JA 2AB6A 1AIUA 3CXGA 1EP8A 2FWHA 2FHEA 2H1BA 1SVOA 4IGJA 2IFQB 1B48A 4O7HA 4EKZA 1T4ZA 1BG1A 3F6DA 5KEJA 4YKFA 1XVWA 6GSWA 2GS3A 2IMIA 2IWTA 1F37A 1FG4A 3TKRA 4EIQA 2C80A 4MLYA 2GTUA 1J9BA 2B5XA 2O87A 3KCMA 3W6GA 4POLA 3A2XA 3L9SA 2LJRA 4EE0A 2ZNMA 2HSNB 5J40A 2AV4A 3A2WA 4NXIA 1FW1A 1AXDA 2RM6A 2C0EA 3KMNA 6GSYA 5KN2A 2HSHA 3EPTA 2HSMA 2E2MA 5KOWA 1PL1A 5ID2A 5AIXA 3HZ4A 2B3SA 3IC8A 3L4NA 5BMUA 1DUGA 3N5OA 2CV4A 5ECHB 2F3MA 4GQFA 4K2XA 1GSSA 5G31A 5A4UA 2WDUA 4L0WA 4GTUA 3A2VA 3E3EA 1OC3A 4KDUA 3G9BA 4AJ8A 5DALB 4N0ZA 5D93A 1T00A 2R6KA 4K1FA 5ECMB 3GFKA 4KDYA 1A8LA 1XZOA 2WVXB 2WS2A 4IVFA 1T3BA 4TR4A 3A3TA 3RFRC 1GLQA 4NHWA 2YWIA 2YNXA 3TJBA 1V98A 4PQ1A 3ZIJA 5IQYA 4K8MA 1YVLA 3TRQA 4FYUA 4N0VA 3HYPA 1EV9A 1V9WA 4KCEA 5HFKA 3MNGA 4POBA 2DC5A 2WW1A 3UJ1A 4PNFA 4GDFA 5FWGA 1T4YA 2IFQA 5AGYA 4TW5A 3FKFA 2VL2A 5B6MA 1SK2A 1WJKA 4K7NA 3HMJG 4IN0A 1THXA 1X5CA 1RQMA 1V40A 4PUAA 3KTBA 3KTLA 2GZYA 1QFNA 1ZOFA 14GSA 2GDRA 2YZUA 3UBKA 3WYWA 2GSTA 4ZB7A 3P2AA 4AKXB 1UN2A 2HSYA 1R4WA 2K8SA 3APQA 1JZWA 1SJZA 2RLIA 2HYXA 2H0HA 4ID0A
chains in the Genus database with same CATH topology
4PTSA 1CQGA 5IMVA 4X1UA 2NBSA 3L78A 3I9V2 3M8NA 3LORA 1VF4A 4ACSA 1JFUA 5IPGA 4WF5A 4ZB8A 1TXXA 3MWHA 5DQSA 3CSHA 2MMNA 2TRCP 1EOGA 1HYUA 3KIJA 3GHAA 4WBRD 4F03A 2YZHA 4NWYA 4NHZA 3QOUA 1K3OA 1TKDB 2UZ8A 2VCZA 1O81A 5DAKA 1WMJA 2G2QA 4FYCA 2PMTA 3EU3A 2YCDA 2PGTA 3D22A 3VI5A 2H6XA 2NDOA 1CQHA 3FZ5A 1PN0A 1XCCA 2F8AA 1M99A 2QGVA 4O92A 5ECNB 4HQSA 2DJKA 2A2RA 4DSQA 2OBKA 5KN1A 1FHEA 3EYTA 4KH7A 1XW9A 4OCFA 3O76A 2IMKA 3LJRA 2N5BA 1PX7A 3L9UA 5G5FA 3ZFLA 4H86A 3TU3B 3IDVA 4I6XA 1ZGNA 1B8XA 2YV9A 1XXUA 1GTIA 3F9UA 1GULA 1YKCA 5E4WA 2I1UA 2HRFA 4MF7A 1WOUA 2MZCA 5CP1A 3Q74A 19GSA 5CREA 5F8BA 1IYHA 1ML6A 4NPBA 1AQVA 2H71A 1Z3EA 2FA4A 3QAWA 1EOHA 1MD3A 1G6YA 1TRWA 2EFHA 3WGDA 2GSQA 3TKSA 3G7JA 5FHIA 1HNBA 1TRSA 3HY2A 5A5HA 1XFLA 2EIRA 1GSEA 2H74A 5KOXA 3KJYA 2XBIA 5ELGA 1TOFA 2MMAA 3MAKA 3PINA 3UAPA 5JCGA 1GTBA 1SD9A 2FUG2 5BMUB 1PRXA 3ERWA 1O7UA 3FY7A 4CY8A 1A8YA 4DSSA 5DCGA 1ERVA 4AJ7A 1TP9A 1Z6NA 2H1AA 3TGZA 3KXOA 2QC7A 4ZL9A 1K0OA 2JADA 2TRXA 2X8HA 2CAQA 2MBSA 5G1KA 3GNJA 3VWUA 4TRXA 4WR4A 1DBYA 4Q5QA 2ZCTA 3TKQA 2IN3A 5D9XA 4EDYA 2O7KA 5G1LA 4XHMA 1B4PA 5D9VA 1TXUA 4IQAA 1VGLA 3LYPA 3QAGA 5J3RA 3C8EA 3QR6A 3ME8A 3I6AA 2EIQA 2HRAA 3ZL5A 3HJPA 5LNKe 1VF1A 2OT3A 2LEGA 2O89A 1HQOA 1SKWB 2LNTA 2VOCA 3LGCA 1ZL9A 5B7CA 2DJ0A 5F05A 1WPIA 4EO3A 4ULXA 4EXJA 3S9FA 4G0LA 3EMPA 1K3YA 4GSTA 1OYJA 2H19A 2C4JA 4EVMA 1ZYEA 2C8UA 3QFBC 1EGOA 4YQVA 3EE2A 3EINA 4DEJA 2DKHA 2VLTA 4KSOA 3US3A 4YAPA 2B5EA 5IM9A 2V6OA 4ML1A 1XWGA 2LV3A 4XS6A 4I2UA 1M7TA 4OFMA 2DLXA 4WKWA 4LL4B 2GSRA 1YF1A 3R2QA 4WXTA 4O5QA 2CA8A 5HR3A 1DSBA 1VRSD 3F4SA 4EC0A 2HZFA 2RIIA 1ILOA 3IHQA 4YQUA 5EL8A 4F82A 3KH9A 3FR6A 2OADA 4MMMA 1PL2A 2CVDA 1NM3A 4ZIJA 2KUCA 4X0XA 5LD0A 4MDCA 5F0GA 4L0UA 3IC4A 2HXKA 2R0PA 1FB0A 4E8HA 3M9JA 3TRXA 2H1LA 2C0GA 2C1YA 1PN9A 3MDKA 3EURA 3TCOA 1UVZA 2P5RA 1GSUA 1OE8A 5JCWA 1JLWA 4HOJA 3KEBA 3HXSA 3LW9A 3D21A 2WCIA 17GSA 2VLUA 3OR5A 4GQCA 4QL9A 2ZUPA 2H0GA 5J4UA 3BCKA 1RK4A 1BX9A 3LXTA 4WEYA 3V1WA 3RBTA 1M2AA 2FD3A 3CRTA 4Q5FA 1OAZA 5IO0A 1K0MA 2H73A 2M72A 1K3LA 4IS0A 3CTGA 3FZAA 2EFDA 2IL3A 1TRUA 5EY6A 4KF9A 4OMVA 4MF5A 3QPMA 1GTAA 3GA4A 3KP8A 1Z5YE 5FT3A 5H5SA 3EVIA 1R7HA 3F0IA 4EUYA 1YEPA 3VPQA 1ZZYA 3EU4A 1X5EA 2GQLA 2OBIA 3ZIVA 1Y1UA 5A5KA 1KBNA 3LEFA 1GWCA 3QAVA 5CYYA 2ON7A 1JZOA 1A24A 1USBA 4AKHA 2L5OA 4OCEA 4BL7A 3EWLA 2OA7A 2L4QA 4V2NA 2XPEA 2LQQA 5J9BA 3QD9A 5GZZB 2BTOT 3PR8A 2H0IA 5INYA 4HU7A 1R5PA 1VF3A 3LXZA 1YKAA 3RAZA 1MTCA 3CRUA 1TK8B 3D4MA 3TJJA 1ZYNA 1OC8A 2FCHA 3D4TA 1B9XC 3Q18A 3QFAC 4JRRA 4TOPA 2FGXA 2VLVA 4MH3A 3TJFA 4KA0A 5ECPB 1TW9A 1U3AA 2JSZA 2FWGA 3UARA 5D8IA 3MIXA 2R5GA 4N3ZA 4HS1A 4RI7A 4TVEA 1N25A 3DIEA 3PGTA 2UV8G 4LLRA 4JE1A 2LRTA 1NHYA 5G5EA 3SBCA 3FK8A 5JWOB 2V41A 3BD2A 1EV4A 3O3TA 4ICYA 1R5AA 5EPFA 2DBCA 1QQ2A 2YOIA 2I4AA 2HSNA 1SK1A 4MJBA 3HZ8A 3F4TA 3ME7A 3LG6A 4IQ1A 5CAXA 4JBBA 2H75A 4HJMA 5COHA 5DVBA 5CRHA 2OE0A 3UVTA 2H30A 3NIVA 5GSSA 3D5JA 4FYBA 5CRDA 3DRNA 3ZLPA 2GT6A 3O6TA 1TJDA 3GKKA 3FW2A 1NHOA 4MF6A 2JL4A 1ERTA 2C0FA 3IV4A 4O5UA 4X43A 3ZYWA 4NAXA 1A0RP 3VFIA 2H66A 2R0GA 1GUMA 4WETA 5HR2A 1TI3A 2H72A 4L5LA 1Q4JA 1J0FA 1JHBA 2VD0A 1FB6A 1XW6A 1GLPA 2HSMB 1U88A 4K5SA 3UIWA 2DJ2A 1U87A 3HKRA 3RPNA 3UL3A 1I5GA 4BWSA 4AI6A 2A2PA 3ED3A 4MNNA 2K6VA 5GAND 3I69A 2PPTA 4G2EA 2ALBA 3HA9A 2JU5A 4JR6A 2B7KA 4CHSA 2XHFA 5AN1A 4JZQA 3GL3A 4RQXA 2V6KA 1G7OA 4XIHA 4CDOA 4MJEA 5C00A 2DIYA 1AUCA 2REMA 3D6IA 1GUHA 2VKZG 4IJ3A 1MDKA 3LWAA 1PX6A 3ERGA 2CX3A 3DWVA 3FZ4A 5ECRB 4EL1A 2LJKA 5ECQB 2VL9A 4GSNA 3GL5A 1Z7PA 5IMDA 4KE3A 1N2AA 18GSA 2FWEA 1T1VA 4IBPA 1Y6EA 1Z7RA 1O6JA 3TDGA 4XS4B 3UVHA 4QL7A 2A4HA 3H8QA 4ZBBA 4ZBAA 3CSJA 2CVBA 3VWXA 2R4VA 2B7JA 2YPMA 1X9SB 4FQUA 5EVOA 3ZMKA 3FMWA 3RHCA 1A2MA 2HT9A 2YJHA 1X9MB 4AJ6A 4I97A 1M9BA 1E2YA 3TB2A 2G0FA 1BG5A 1MDIA 4I8BA 16GSA 2KOKA 1WE0A 1TK5B 2H6ZA 4EIPA 2X8CA 1GL8A 5IMZA 1F2EA 2O5VA 2YWMA 1PKZA 1EEJA 2I81A 5A1NA 1YJ6A 2VIMA 2C0DA 4Z2UA 4X4JA 3CBUA 3AY8A 3GH6A 4MZWA 4HZ4A 1J08A 5HFIA 4J2FA 3H4KA 2KP2A 1OKTA 1G7EA 2WULA 2VL3A 1X0RA 4KNDA 2PWJA 1ON4A 2X49A 2LKUA 2OE3A 1AQWA 1I9DA 4JR4A 3P7XA 1X9WB 4O32A 4MPGA 3GIXA 4WF4A 4K9ZA 4IHUA 4IP6A 1GTUA 4YH2A 3ZRDA 4G0KA 1OC9A 3HDCA 4L8EA 4ILFA 3TOTA 2WZ9A 2IPAA 5L71A 4HUAA 1AC1A 4RUVA 4G9HA 2HI7A 5ECIB 1N8JA 2P5QA 4XS4A 2H1DA 2FA8A 1YDKA 1TRVA 2EFCA 3N9JA 3E9JB 4PQHA 2IMFA 2DMLA 2B5YA 5IPHA 1V58A 5C04A 1MEKA 1AQXA 1R26A 1WRYA 3ZMLA 3M0FA 1PSQA 3F4RA 4GLTA 4BPYA 1C72A 1KEBA 5J4YA 4AKIA 1PKWA 2MMZA 2XBQA 4L5OA 4D73B 1TI1A 2QA2A 1GSYA 2IMDA 3C73A 3IA1A 5DAKB 1PA3A 3HJMA 2QKEA 2OKAA 3EMXA 4LA1A 3GRXA 2DJ3A 4ML6A 1VF2A 1F6MC 1SK0A 2YV7A 2VAFA 3UMAA 2VD1A 2E2GA 2YWNA 5B6NA 4FIWA 5A34B 1GSFA 4ISDA 4PURA 2YN1A 3GX0A 3U6VA 1ERWA 4DVCA 2PN8A 2HQTA 2L57A 1FAAA 2HRNA 5DDLA 2YP6A 1S3AA 2I9HA 3GSTA 3P90A 1TDIA 5KN3A 3TJGA 3IBHA 3M1GA 1M2DA 2AJQB 4ZXGA 3DVWA 4OO5A 4KDXA 5IMCA 2P0GA 4TXOB 2NPBA 1T8EB 2H76A 1B4QA 1M9AA 2DJJA 3DVXA 1FOHA 3VWVA 3PH9A 4IW9A 2LSTA 1E6BA 1U3IA 1ZCPA 3GKNA 1SJ6A 5DBQA 1SL0B 4TXOA 1LBKA 2F9SA 5ABRA 4IJIA 4LMWA 4V1Ap 3DXBA 1IYIA 2HNLA 2LQOA 1H75A 1ABAA 2C3QA 5HQPA 1A0FA 4XTSA 5B8AA 4Z7XA 2H70A 3ZVJD 3IR4A 4HZ2A 4HU9A 2AYTA 2JZSA 5DALA 4ZL8A 4MH2A 3W8SA 3WGXA 5AIVA 1JZDA 2EIOA 1PMTA 3LFLA 3FYGA 3FZ9A 3GURA 1KTEA 2IMEA 4EF0A 5H5QA 4NMUA 5D96A 4G19A 2LS5A 1V2AA 2WB9A 1YY7A 2EFEA 4HEA2 1NSWA 1LU4A 1BYEA 4BVYB 1EWXA 3RPPA 1ZYPA 5J4VA 4TR1B 1SKSB 3IOSA 4HI7A 4IKHA 3VPTA 2EC4A 4HJ2A 2HFDA 4I2TA 4MPFA 3ZTLA 4MJCA 3HCZA 4KSMA 4YQMA 4XRDA 1URMA 3D0ZA 3VURA 1QK8A 5D9WA 1T7PB 2H1GA 4PX1A 1DE2A 2PVOC 4I5QA 5J47A 2HRKA 5F06A 2LTKA 2VCXA 2A4VA 1XWBA 2CZ3A 1GSQA 1M2BA 2NVLA 2RUFA 4IELA 3UOMA 1BAYA 1B9YC 2CZ2A 2O85A 3F63A 4AKGA 2LJAA 11GSA 4XRAA 4ZBDA 1H4OA 4Q5RA 2PBJA 2E0QA 4QMKA 2AHEA 3IK9A 2FWFA 1THOA 2R3XA 3KGKA 3HVVA 2YANA 1V57A 2PERA 4E8EA 4KAEA 4GWRA 3F6FA 1XOAA 3IAM2 2F51A 4G10A 5DQYA 5G30A 3GV1A 3J7Yb 4DSSB 2VCWA 5ENUA 4HQZA 3BCIA 2B1KA 4KGIA 4ZL7A 4G0IA 4J56E 2GZPA 6GSUA 4XCSA 1BF5A 2N5AA 5IOXA 2K9FA 1BJXA 2GQKA 3TRPA 3CSIA 1O73A 4OO4A 1SENA 5J9CA 3HVXA 3C1RA 2VCVA 1Z6MA 3UEMA 1SD8A 2LNSA 2DSAA 1XIYA 1SU9A 1HD2A 2X8GA 1UC7A 2M80A 1TU8A 3DYRA 3WGEA 2I3YA 5A5HB 4P3YB 4GCIA 1QMVA 3GSSA 2XC2A 2R37A 1HNCA 3RDWA 1SYXA 2CX4A 1SL1B 2CVKA 5AISA 5ECSA 6GSXA 2BJXA 4F2IA 6GSTA 3GUSA 2DKIA 5ECLB 2GVPA 1PQNA 5KN0A 3VI7A 3QDNA 3ERFA 1A2LA 1SL2B 2GZZA 2M46A 1GSDA 3L0HA 3CYNA 4TKYA 1SVMA 2N5FA 1YF0A 4MA9A 3NOFA 4RQRA 4TN8A 1FO5A 4NV5A 3IXRA 2JZRA 3TKSE 5HR1A 5CNWA 4YKGA 3JCML 5H5RA 3ISOA 3APSA 4TXVA 1W4VA 6GSSA 4KX4A 8GSSA 4K7IA 5JWQB 4GXZA 12GSA 2RUEA 1A2JA 1S3DA 4K2DA 2YJ7A 2GT5A 3G7IA 5B8BA 5ECOB 2H8LA 2IIYA 1YZXA 3IE3A 1GUKA 1GP1A 2MMOA 5J41A 1PD21 3CMIA 5E59A 3HJOA 1WIKA 1K0DA 5ID2B 3IRAA 1K0NA 4BVYA 4YAVA 2LUSA 2PVQA 2QA1A 2LRNA 3ZFBA 4JU5A 1HNAA 2WRTA 1FVJA 3IHGA 2F8FA 3BBYA 3H1NA 1BQ7A 3TOUA 3GN3A 1YQ1A 2V1MA 3H93A 3DKSA 2VCQA 5LCZA 4PQIA 3FR9A 2VUPA 2NTOA 5IIZA 4JEDA 1X5DA 1JLVA 5DJLA 3KM6A 3DD3A 2GGTA 3MSZA 2AUVA 2IJYA 1F9MA 2OACA 4NV2A 2HRKB 2R2JA 3WT2A 2YWOA 2OJLA 4F9ZA 4ECBA 4A5PA 4KUNA 10GSA 3ZITA 4Q5NA 2J23A 2CAIA 4MCUA 2MBTA 4OFTA 2KP1A 1ACVA 4GRFA 5ELAA 3ZREA 1XBSA 1W89A 5JCUA 1AW9A 3F8UA 4PUFC 3KZQA 4N11A 2CQ9A 13GSA 4ECIA 2RM5A 1FOVA 1Q98A 3KP9A 3WD6A 1SYRA 4OFNA 3A5IA 2C3NA 1JZRA 1Y25A 2X99A 4QQ7A 3I43A 2ES7A 2VO4A 2XPDA 4TR0A 2E7PA 2L59A 3BJ5A 3C7MA 5BRTA 3VWWA 4BL7B 4AGSA 3Q19A 1O8WA 1AAZA 1TK0B 4GF0A 5JWRB 3G7YA 3CTFA 4LMVA 1WP0A 5G2ZA 3PPUA 2R0CA 3IK7A 5D73A 3FEUA 1EZKA 2B6MA 4N10A 1M0UA 1ZYQB 4MZBA 1OC9B 3TJKA 1PGTA 1MD4A 1G6WA 3DGQA 3L9VA 2Z9SA 2JSYA 4WR5A 3SWLA 3FR3A 4ZB6A 2DMMA 3EC3A 3GTUA 20GSA 3C71A 2OE1A 3BOAA 2K8VA 4GSSA 4Z2TA 1SJIA 1NW2A 4N30A 3NZNA 2O8VB 3GH9A 3KMOA 2V32A 4V2LA 1K0CA 5IMFA 4LL1B 3TKPA 3APOA 1OVNA 1RW1A 3KD0A 4PXOA 2H01A 4TR3A 4FH8A 2KLXA 1OE7A 1XW5A 4G01A 4OD7A 2BMXA 4CY6A 4J57E 3RHBA 1WWJA 3TKSC 3LSZA 2HE3A 1Z9HA 4XS1A 1XWCA 2X4AA 2CT6A 2VCTA 3R3EA 5CO3A 1TU7A 4KCAA 2KHPA 2PU9C 3TUEA 4O5RA 2HZEB 3GKXA 2VM2A 1F3BA 2A2SA 4K6XA 2GSSA 3KH7A 4MP4A 2VM1A 5GAPD 4K0GA 2VL2C 4ZILA 3QMXA 2J9HA 4K0NA 2DIZA 4E68A 5IMAA 1GNEA 4KB3A 2P31A 3VK9A 1EGRA 2L5LA 4F0BA 1TTZA 1G0TA 4TR1A 1U6TA 2FY6A 2HZEA 4F0CA 1A23A 2C3TA 6GSVA 1EP7A 3J7Yk 3ZZXA 1UA5A 1FVKA 4USSA 1ERUA 3Q6OA 3HVSA 1ZMAA 4DSRA 3IPZA 2L4CA 4D73A 3IAS2 5IOWA 1QGVA 1YEXA 3HHVA 2GQMA 4V2MA 4BVXB 4BA7A 4V1Ag 2JACA 2LRCA 5IO2A 3GTUB 1F3AA 4CW9A 3U5RE 2PUKC 3A5WA 2AAWA 3VLNA 5DCHA 2FLSA 3E0UA 1SVLA 1GNWA 1OKDA 5CRGA 2V2GA 1GRXA 22GSA 3DEXA 3HD5A 5A34A 5J5NA 3FRCA 4KW6A 2B1LA 1MDJA 3LQ7A 3P8WA 4MABA 4AF2A 2FNOA 4POKA 9GSSA 4W66A 1ST9A 2JZTA 1K0AA 2WJUA 3ZVJA 4RI6A 2L6CA 4WBJA 4Z2RA 5D9TA 2X64A 1XWAA 3QCPA 5F07A 5A4WA 1EEMA 4PNGA 5A4VA 4ZB9A 7GSSA 5A1NB 3MYDA 1XWKA 3GYKA 4BWQA 3C1SA 1K0BA 3UBLA 1O85A 4ECJA 3F3RA 1QUWA 3WT1A 4POMA 5HFGA 1GH2A 2TIRA 4K7OA 3F3QA 4FO5A 2WFCA 3M3MA 4K5RA 4MK3A 5HR0A 4ECCA 3K8NA 1S3CA 2ON5A 2QSIA 1QXHA 2WGRA 5CRWA 4MZCA 1O8XA 4BVXA 4HDEA 5DJMA 3M9KA 2D2ZA 2L6DA 2K18A 1BEDA 2HLSA 3LYKA 4OWYA 1KNGA 5GSTA 2MYGA 3GMFA 1LJRA 4IP1A 3FHKA 3CWGA 2H6YA 1XVQA 3GKMA 1SKRB 4PGTA 3GX8A 2GLRA 3H79A 4EDZA 4MJAA 1XPVA 1DE1A 1XOBA 2DJ1A 3DMLA 5ECKB 3W8JA 2AB6A 1AIUA 3CXGA 1EP8A 2FWHA 2FHEA 2H1BA 1SVOA 4IGJA 2IFQB 1B48A 4O7HA 4EKZA 1T4ZA 1BG1A 3F6DA 5KEJA 4YKFA 1XVWA 6GSWA 2GS3A 2IMIA 2IWTA 1F37A 1FG4A 3TKRA 4EIQA 2C80A 4MLYA 2GTUA 1J9BA 2B5XA 2O87A 3KCMA 3W6GA 4POLA 3A2XA 3L9SA 2LJRA 4EE0A 2ZNMA 2HSNB 5J40A 2AV4A 3A2WA 4NXIA 1FW1A 1AXDA 2RM6A 2C0EA 3KMNA 6GSYA 5KN2A 3EPTA 2HSHA 2HSMA 2E2MA 5KOWA 1PL1A 5ID2A 5AIXA 3HZ4A 2B3SA 3IC8A 3L4NA 5BMUA 1DUGA 3N5OA 2CV4A 5ECHB 2F3MA 4GQFA 4K2XA 1GSSA 5G31A 5A4UA 2WDUA 4L0WA 4GTUA 3A2VA 3E3EA 1OC3A 4KDUA 3G9BA 4AJ8A 5DALB 4N0ZA 5D93A 1T00A 2R6KA 4K1FA 5ECMB 3GFKA 4KDYA 1A8LA 1XZOA 2WS2A 4IVFA 1T3BA 4TR4A 3A3TA 1GLQA 4NHWA 2YWIA 2YNXA 3TJBA 1V98A 4PQ1A 3ZIJA 5IQYA 4K8MA 1YVLA 3TRQA 4FYUA 4N0VA 3HYPA 1EV9A 1V9WA 4KCEA 5HFKA 3MNGA 4POBA 2DC5A 3UJ1A 4PNFA 4GDFA 5FWGA 1T4YA 2IFQA 5AGYA 4TW5A 3FKFA 2VL2A 5B6MA 1SK2A 1WJKA 4K7NA 3HMJG 4IN0A 1THXA 1X5CA 1RQMA 1V40A 4PUAA 3KTBA 3KTLA 2GZYA 1QFNA 1ZOFA 14GSA 2GDRA 2YZUA 3UBKA 3WYWA 2GSTA 4ZB7A 3P2AA 4AKXB 1UN2A 2HSYA 1R4WA 2K8SA 3APQA 1JZWA 1SJZA 2RLIA 2HYXA 2H0HA 4ID0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PTS A;  1CQG A;  5IMV A;  4X1U A;  2NBS A;  3L78 A;  3I9V 2;  3M8N A;  3LOR A;  1VF4 A;  4ACS A;  1JFU A;  5IPG A;  4WF5 A;  4ZB8 A;  1TXX A;  3MWH A;  5DQS A;  3CSH A;  2MMN A;  2TRC P;  1EOG A;  1HYU A;  3KIJ A;  3GHA A;  4WBR D;  4F03 A;  2YZH A;  4NWY A;  4NHZ A;  3QOU A;  1K3O A;  1TKD B;  2UZ8 A;  2VCZ A;  1O81 A;  5DAK A;  1WMJ A;  2G2Q A;  4FYC A;  2PMT A;  3EU3 A;  2YCD A;  2PGT A;  3D22 A;  3VI5 A;  2H6X A;  2NDO A;  1CQH A;  3FZ5 A;  1XCC A;  2F8A A;  1M99 A;  2QGV A;  4O92 A;  5ECN B;  4HQS A;  2DJK A;  2A2R A;  4DSQ A;  2OBK A;  5KN1 A;  1FHE A;  3EYT A;  4KH7 A;  1XW9 A;  4OCF A;  3O76 A;  2IMK A;  3LJR A;  2N5B A;  1PX7 A;  3L9U A;  5G5F A;  3ZFL A;  4H86 A;  3IDV A;  4I6X A;  1ZGN A;  1B8X A;  2YV9 A;  1XXU A;  1GTI A;  3F9U A;  1GUL A;  1YKC A;  5E4W A;  2I1U A;  2HRF A;  4MF7 A;  1WOU A;  2MZC A;  5CP1 A;  3Q74 A;  19GS A;  5CRE A;  5F8B A;  1IYH A;  1ML6 A;  4NPB A;  1AQV A;  2H71 A;  1Z3E A;  2FA4 A;  3QAW A;  1EOH A;  1MD3 A;  1G6Y A;  1TRW A;  3WGD A;  2GSQ A;  3TKS A;  3G7J A;  5FHI A;  1HNB A;  1TRS A;  3HY2 A;  1XFL A;  2EIR A;  1GSE A;  2H74 A;  3KJY A;  2XBI A;  5ELG A;  1TOF A;  2MMA A;  3MAK A;  3PIN A;  3UAP A;  5JCG A;  1GTB A;  1SD9 A;  2FUG 2;  1PRX A;  3ERW A;  1O7U A;  3FY7 A;  1A8Y A;  4DSS A;  5DCG A;  1ERV A;  4AJ7 A;  1TP9 A;  1Z6N A;  2H1A A;  3TGZ A;  3KXO A;  2QC7 A;  4ZL9 A;  1K0O A;  2JAD A;  2TRX A;  2X8H A;  2CAQ A;  2MBS A;  5G1K A;  3GNJ A;  3VWU A;  4TRX A;  4WR4 A;  1DBY A;  4Q5Q A;  2ZCT A;  3TKQ A;  2IN3 A;  5D9X A;  4EDY A;  2O7K A;  5G1L A;  4XHM A;  1B4P A;  5D9V A;  4IQA A;  1VGL A;  3LYP A;  3QAG A;  5J3R A;  3C8E A;  3QR6 A;  3ME8 A;  3I6A A;  2EIQ A;  2HRA A;  3ZL5 A;  3HJP A;  5LNK e;  1VF1 A;  2LEG A;  2O89 A;  1HQO A;  1SKW B;  2LNT A;  2VOC A;  3LGC A;  1ZL9 A;  5B7C A;  2DJ0 A;  5F05 A;  1WPI A;  4EO3 A;  4ULX A;  4EXJ A;  3S9F A;  4G0L A;  3EMP A;  1K3Y A;  4GST A;  1OYJ A;  2H19 A;  2C4J A;  4EVM A;  1ZYE A;  2C8U A;  3QFB C;  1EGO A;  4YQV A;  3EE2 A;  3EIN A;  4DEJ A;  2VLT A;  4KSO A;  3US3 A;  4YAP A;  2B5E A;  5IM9 A;  2V6O A;  4ML1 A;  1XWG A;  2LV3 A;  4XS6 A;  4I2U A;  1M7T A;  4OFM A;  2DLX A;  4WKW A;  4LL4 B;  2GSR A;  1YF1 A;  3R2Q A;  4WXT A;  2CA8 A;  5HR3 A;  1DSB A;  1VRS D;  3F4S A;  4EC0 A;  2HZF A;  2RII A;  1ILO A;  3IHQ A;  4YQU A;  5EL8 A;  4F82 A;  3KH9 A;  3FR6 A;  2OAD A;  4MMM A;  1PL2 A;  2CVD A;  1NM3 A;  4ZIJ A;  2KUC A;  4X0X A;  5LD0 A;  4MDC A;  5F0G A;  4L0U A;  3IC4 A;  2HXK A;  1FB0 A;  4E8H A;  3M9J A;  3TRX A;  2C0G A;  2C1Y A;  1PN9 A;  3MDK A;  3EUR A;  3TCO A;  1UVZ A;  2P5R A;  1GSU A;  1OE8 A;  5JCW A;  1JLW A;  4HOJ A;  3KEB A;  3HXS A;  3D21 A;  2WCI A;  17GS A;  2VLU A;  3OR5 A;  4GQC A;  4QL9 A;  2ZUP A;  2H0G A;  5J4U A;  3BCK A;  1RK4 A;  1BX9 A;  3LXT A;  4WEY A;  3V1W A;  3RBT A;  1M2A A;  2FD3 A;  3CRT A;  4Q5F A;  1OAZ A;  5IO0 A;  1K0M A;  2H73 A;  2M72 A;  1K3L A;  4IS0 A;  3CTG A;  3FZA A;  2IL3 A;  1TRU A;  5EY6 A;  4KF9 A;  4OMV A;  4MF5 A;  3QPM A;  1GTA A;  3GA4 A;  3KP8 A;  1Z5Y E;  5FT3 A;  5H5S A;  3EVI A;  1R7H A;  3F0I A;  4EUY A;  1YEP A;  3VPQ A;  1ZZY A;  3EU4 A;  1X5E A;  2GQL A;  2OBI A;  3ZIV A;  5A5K A;  1KBN A;  3LEF A;  1GWC A;  3QAV A;  5CYY A;  2ON7 A;  1JZO A;  1A24 A;  1USB A;  2L5O A;  4OCE A;  4BL7 A;  3EWL A;  4V2N A;  2OA7 A;  2L4Q A;  2XPE A;  2LQQ A;  5J9B A;  3QD9 A;  5GZZ B;  2BTO T;  3PR8 A;  2H0I A;  5INY A;  4HU7 A;  1R5P A;  1VF3 A;  3LXZ A;  1YKA A;  3RAZ A;  1MTC A;  3CRU A;  1TK8 B;  3D4M A;  3TJJ A;  1OC8 A;  2FCH A;  3D4T A;  1B9X C;  3Q18 A;  3QFA C;  4JRR A;  4TOP A;  2FGX A;  2VLV A;  4MH3 A;  3TJF A;  4KA0 A;  5ECP B;  1TW9 A;  1U3A A;  2JSZ A;  2FWG A;  3UAR A;  5D8I A;  4HS1 A;  2R5G A;  4TVE A;  4RI7 A;  3DIE A;  3PGT A;  4LLR A;  4JE1 A;  2LRT A;  1NHY A;  5G5E A;  3SBC A;  3FK8 A;  5JWO B;  2V41 A;  3BD2 A;  1EV4 A;  3O3T A;  1R5A A;  5EPF A;  2DBC A;  1QQ2 A;  2YOI A;  2I4A A;  1SK1 A;  4MJB A;  3HZ8 A;  3F4T A;  3ME7 A;  3LG6 A;  4IQ1 A;  5CAX A;  4JBB A;  2H75 A;  4HJM A;  5COH A;  5DVB A;  5CRH A;  2OE0 A;  3UVT A;  2H30 A;  3NIV A;  5GSS A;  3D5J A;  4FYB A;  5CRD A;  3DRN A;  3ZLP A;  2GT6 A;  3O6T A;  1TJD A;  3GKK A;  3FW2 A;  1NHO A;  4MF6 A;  2JL4 A;  1ERT A;  2C0F A;  3IV4 A;  4X43 A;  3ZYW A;  4NAX A;  1A0R P;  3VFI A;  2H66 A;  1GUM A;  4WET A;  5HR2 A;  1TI3 A;  2H72 A;  4L5L A;  1Q4J A;  1J0F A;  1JHB A;  2VD0 A;  1FB6 A;  1XW6 A;  1GLP A;  2HSM B;  1U88 A;  3UIW A;  2DJ2 A;  1U87 A;  3HKR A;  3RPN A;  3UL3 A;  1I5G A;  4BWS A;  3ED3 A;  2K6V A;  5GAN D;  3I69 A;  2PPT A;  4G2E A;  2ALB A;  3HA9 A;  2JU5 A;  4JR6 A;  2B7K A;  4CHS A;  2XHF A;  5AN1 A;  4JZQ A;  3GL3 A;  4RQX A;  2V6K A;  1G7O A;  4XIH A;  4CDO A;  4MJE A;  5C00 A;  2DIY A;  1AUC A;  2REM A;  3D6I A;  1GUH A;  4IJ3 A;  1MDK A;  3LWA A;  1PX6 A;  3ERG A;  2CX3 A;  3DWV A;  3FZ4 A;  5ECR B;  4EL1 A;  2LJK A;  5ECQ B;  2VL9 A;  4GSN A;  3GL5 A;  1Z7P A;  5IMD A;  4KE3 A;  1N2A A;  18GS A;  2FWE A;  1T1V A;  4IBP A;  1Y6E A;  1Z7R A;  1O6J A;  3TDG A;  4XS4 B;  3UVH A;  4QL7 A;  3H8Q A;  4ZBB A;  4ZBA A;  3CSJ A;  2CVB A;  3VWX A;  2R4V A;  2B7J A;  2YPM A;  1X9S B;  4FQU A;  5EVO A;  3ZMK A;  3RHC A;  1A2M A;  2HT9 A;  2YJH A;  1X9M B;  4AJ6 A;  4I97 A;  1M9B A;  1E2Y A;  3TB2 A;  2G0F A;  1BG5 A;  1MDI A;  4I8B A;  16GS A;  2KOK A;  1WE0 A;  1TK5 B;  2H6Z A;  2X8C A;  1GL8 A;  5IMZ A;  1F2E A;  2YWM A;  1PKZ A;  1EEJ A;  2I81 A;  1YJ6 A;  2VIM A;  2C0D A;  3CBU A;  3AY8 A;  3GH6 A;  4MZW A;  4HZ4 A;  1J08 A;  5HFI A;  4J2F A;  3H4K A;  2KP2 A;  1OKT A;  1G7E A;  2WUL A;  2VL3 A;  1X0R A;  4KND A;  2PWJ A;  1ON4 A;  2LKU A;  2OE3 A;  1AQW A;  1I9D A;  4JR4 A;  3P7X A;  1X9W B;  4O32 A;  4MPG A;  3GIX A;  4WF4 A;  4K9Z A;  4IHU A;  4IP6 A;  1GTU A;  4YH2 A;  3ZRD A;  4G0K A;  1OC9 A;  3HDC A;  4L8E A;  4ILF A;  3TOT A;  2WZ9 A;  2IPA A;  5L71 A;  4HUA A;  1AC1 A;  4RUV A;  4G9H A;  2HI7 A;  5ECI B;  1N8J A;  2P5Q A;  4XS4 A;  2H1D A;  2FA8 A;  1YDK A;  1TRV A;  3N9J A;  3E9J B;  4PQH A;  2IMF A;  2DML A;  2B5Y A;  5IPH A;  1V58 A;  5C04 A;  1MEK A;  1AQX A;  1R26 A;  1WRY A;  3ZML A;  3M0F A;  1PSQ A;  3F4R A;  4GLT A;  4BPY A;  1C72 A;  1KEB A;  1PKW A;  2MMZ A;  2XBQ A;  4L5O A;  4D73 B;  1TI1 A;  1GSY A;  2IMD A;  3C73 A;  3IA1 A;  5DAK B;  1PA3 A;  3HJM A;  2QKE A;  2OKA A;  3EMX A;  4LA1 A;  3GRX A;  2DJ3 A;  4ML6 A;  1VF2 A;  1F6M C;  1SK0 A;  2YV7 A;  2VAF A;  3UMA A;  2VD1 A;  2E2G A;  2YWN A;  5B6N A;  4FIW A;  1GSF A;  4ISD A;  4PUR A;  2YN1 A;  3GX0 A;  3U6V A;  1ERW A;  4DVC A;  2PN8 A;  2HQT A;  2L57 A;  1FAA A;  2HRN A;  5DDL A;  2YP6 A;  1S3A A;  2I9H A;  3GST A;  3P90 A;  1TDI A;  5KN3 A;  3TJG A;  3IBH A;  3M1G A;  1M2D A;  2AJQ B;  4ZXG A;  3DVW A;  4OO5 A;  4KDX A;  5IMC A;  2P0G A;  4TXO B;  2NPB A;  1T8E B;  2H76 A;  1B4Q A;  1M9A A;  2DJJ A;  3DVX A;  3VWV A;  3PH9 A;  4IW9 A;  2LST A;  1E6B A;  1U3I A;  1ZCP A;  3GKN A;  1SJ6 A;  5DBQ A;  1SL0 B;  4TXO A;  1LBK A;  2F9S A;  5ABR A;  4IJI A;  4LMW A;  4V1A p;  3DXB A;  1IYI A;  2HNL A;  2LQO A;  1H75 A;  1ABA A;  2C3Q A;  5HQP A;  1A0F A;  4XTS A;  5B8A A;  4Z7X A;  2H70 A;  3ZVJ D;  3IR4 A;  4HZ2 A;  4HU9 A;  2AYT A;  2JZS A;  5DAL A;  4ZL8 A;  4MH2 A;  3W8S A;  3WGX A;  5AIV A;  1JZD A;  2EIO A;  1PMT A;  3LFL A;  3FYG A;  3FZ9 A;  3GUR A;  1KTE A;  2IME A;  4EF0 A;  5H5Q A;  4NMU A;  5D96 A;  4G19 A;  2LS5 A;  1V2A A;  2WB9 A;  1YY7 A;  4HEA 2;  1NSW A;  1LU4 A;  1BYE A;  4BVY B;  1EWX A;  3RPP A;  4TR1 B;  1SKS B;  3IOS A;  4HI7 A;  4IKH A;  3VPT A;  2EC4 A;  4HJ2 A;  2HFD A;  4I2T A;  4MPF A;  3ZTL A;  4MJC A;  3HCZ A;  4KSM A;  4YQM A;  4XRD A;  1URM A;  3D0Z A;  3VUR A;  1QK8 A;  5D9W A;  1T7P B;  2H1G A;  4PX1 A;  1DE2 A;  2PVO C;  4I5Q A;  2HRK A;  5F06 A;  2LTK A;  2VCX A;  2A4V A;  1XWB A;  2CZ3 A;  1GSQ A;  1M2B A;  2NVL A;  2RUF A;  4IEL A;  3UOM A;  1BAY A;  1B9Y C;  2CZ2 A;  2O85 A;  3F63 A;  2LJA A;  11GS A;  4XRA A;  4ZBD A;  1H4O A;  4Q5R A;  2PBJ A;  2E0Q A;  2AHE A;  3IK9 A;  2FWF A;  1THO A;  2R3X A;  3KGK A;  3HVV A;  2YAN A;  1V57 A;  2PER A;  4E8E A;  4KAE A;  4GWR A;  3F6F A;  1XOA A;  3IAM 2;  2F51 A;  4G10 A;  5DQY A;  5G30 A;  3GV1 A;  3J7Y b;  4DSS B;  2VCW A;  5ENU A;  4HQZ A;  3BCI A;  2B1K A;  4KGI A;  4ZL7 A;  4G0I A;  4J56 E;  2GZP A;  6GSU A;  4XCS A;  2N5A A;  5IOX A;  2K9F A;  1BJX A;  2GQK A;  3TRP A;  3CSI A;  1O73 A;  4OO4 A;  1SEN A;  5J9C A;  3HVX A;  3C1R A;  2VCV A;  1Z6M A;  3UEM A;  1SD8 A;  2LNS A;  2DSA A;  1XIY A;  1SU9 A;  1HD2 A;  2X8G A;  1UC7 A;  2M80 A;  1TU8 A;  3DYR A;  3WGE A;  2I3Y A;  4P3Y B;  4GCI A;  1QMV A;  3GSS A;  2XC2 A;  2R37 A;  1HNC A;  3RDW A;  1SYX A;  2CX4 A;  1SL1 B;  2CVK A;  5AIS A;  5ECS A;  6GSX A;  2BJX A;  4F2I A;  6GST A;  3GUS A;  2GVP A;  5ECL B;  1PQN A;  5KN0 A;  3VI7 A;  3QDN A;  3ERF A;  1A2L A;  1SL2 B;  2GZZ A;  2M46 A;  1GSD A;  3L0H A;  3CYN A;  4TKY A;  2N5F A;  1YF0 A;  4MA9 A;  3NOF A;  4RQR A;  4TN8 A;  1FO5 A;  4NV5 A;  3IXR A;  2JZR A;  3TKS E;  5HR1 A;  5CNW A;  3JCM L;  5H5R A;  3ISO A;  3APS A;  4TXV A;  1W4V A;  6GSS A;  4KX4 A;  8GSS A;  4K7I A;  5JWQ B;  4GXZ A;  12GS A;  2RUE A;  1A2J A;  1S3D A;  4K2D A;  2YJ7 A;  2GT5 A;  3G7I A;  5B8B A;  5ECO B;  2H8L A;  2IIY A;  1YZX A;  3IE3 A;  1GUK A;  1GP1 A;  2MMO A;  5J41 A;  1PD2 1;  3CMI A;  5E59 A;  3HJO A;  1WIK A;  1K0D A;  5ID2 B;  3IRA A;  1K0N A;  4BVY A;  4YAV A;  2LUS A;  2PVQ A;  2LRN A;  3ZFB A;  4JU5 A;  1HNA A;  2WRT A;  1FVJ A;  2F8F A;  3BBY A;  3H1N A;  1BQ7 A;  3TOU A;  3GN3 A;  1YQ1 A;  2V1M A;  3H93 A;  3DKS A;  2VCQ A;  5LCZ A;  4PQI A;  3FR9 A;  2VUP A;  2NTO A;  5IIZ A;  4JED A;  1X5D A;  1JLV A;  5DJL A;  3KM6 A;  3DD3 A;  2GGT A;  3MSZ A;  2AUV A;  2IJY A;  1F9M A;  2OAC A;  4NV2 A;  2HRK B;  2R2J A;  3WT2 A;  2YWO A;  2OJL A;  4F9Z A;  4ECB A;  4KUN A;  10GS A;  3ZIT A;  4Q5N A;  2J23 A;  2CAI A;  4MCU A;  2MBT A;  4OFT A;  2KP1 A;  1ACV A;  4GRF A;  5ELA A;  3ZRE A;  1XBS A;  1W89 A;  5JCU A;  1AW9 A;  3F8U A;  4PUF C;  3KZQ A;  4N11 A;  2CQ9 A;  13GS A;  4ECI A;  2RM5 A;  1FOV A;  1Q98 A;  3KP9 A;  3WD6 A;  1SYR A;  4OFN A;  2C3N A;  1JZR A;  1Y25 A;  2X99 A;  4QQ7 A;  3I43 A;  2ES7 A;  2VO4 A;  2XPD A;  4TR0 A;  2E7P A;  2L59 A;  3BJ5 A;  3C7M A;  3VWW A;  4BL7 B;  4AGS A;  3Q19 A;  1O8W A;  1AAZ A;  1TK0 B;  4GF0 A;  5JWR B;  3G7Y A;  3CTF A;  4LMV A;  1WP0 A;  5G2Z A;  3PPU A;  3IK7 A;  5D73 A;  3FEU A;  1EZK A;  2B6M A;  4N10 A;  1M0U A;  1ZYQ B;  4MZB A;  1OC9 B;  3TJK A;  1PGT A;  1MD4 A;  1G6W A;  3DGQ A;  3L9V A;  2Z9S A;  2JSY A;  4WR5 A;  3SWL A;  3FR3 A;  4ZB6 A;  2DMM A;  3EC3 A;  3GTU A;  20GS A;  3C71 A;  2OE1 A;  3BOA A;  2K8V A;  4GSS A;  1SJI A;  1NW2 A;  4N30 A;  3NZN A;  2O8V B;  3GH9 A;  3KMO A;  2V32 A;  4V2L A;  1K0C A;  5IMF A;  4LL1 B;  3TKP A;  3APO A;  1OVN A;  1RW1 A;  3KD0 A;  4PXO A;  2H01 A;  4TR3 A;  4FH8 A;  2KLX A;  1OE7 A;  1XW5 A;  4OD7 A;  2BMX A;  4J57 E;  3RHB A;  1WWJ A;  3TKS C;  3LSZ A;  2HE3 A;  1Z9H A;  4XS1 A;  1XWC A;  2CT6 A;  2VCT A;  3R3E A;  5CO3 A;  1TU7 A;  4KCA A;  2KHP A;  2PU9 C;  3TUE A;  4O5R A;  2HZE B;  3GKX A;  2VM2 A;  1F3B A;  2A2S A;  4K6X A;  2GSS A;  3KH7 A;  4MP4 A;  2VM1 A;  5GAP D;  4K0G A;  2VL2 C;  4ZIL A;  3QMX A;  2J9H A;  4K0N A;  2DIZ A;  5IMA A;  1GNE A;  4KB3 A;  2P31 A;  3VK9 A;  1EGR A;  2L5L A;  4F0B A;  1TTZ A;  1G0T A;  4TR1 A;  1U6T A;  2FY6 A;  2HZE A;  4F0C A;  1A23 A;  2C3T A;  6GSV A;  1EP7 A;  3J7Y k;  3ZZX A;  1UA5 A;  1FVK A;  4USS A;  1ERU A;  3Q6O A;  3HVS A;  1ZMA A;  4DSR A;  3IPZ A;  2L4C A;  4D73 A;  3IAS 2;  5IOW A;  1QGV A;  1YEX A;  3HHV A;  2GQM A;  4V2M A;  4BVX B;  4BA7 A;  4V1A g;  2JAC A;  2LRC A;  5IO2 A;  3GTU B;  1F3A A;  4CW9 A;  3U5R E;  2PUK C;  3A5W A;  2AAW A;  3VLN A;  5DCH A;  2FLS A;  3E0U A;  1GNW A;  1OKD A;  5CRG A;  2V2G A;  1GRX A;  22GS A;  3DEX A;  3HD5 A;  5J5N A;  3FRC A;  4KW6 A;  2B1L A;  1MDJ A;  3LQ7 A;  3P8W A;  4MAB A;  4AF2 A;  2FNO A;  4POK A;  9GSS A;  1ST9 A;  2JZT A;  1K0A A;  2WJU A;  3ZVJ A;  4RI6 A;  2L6C A;  4WBJ A;  5D9T A;  2X64 A;  1XWA A;  3QCP A;  5F07 A;  5A4W A;  1EEM A;  4PNG A;  5A4V A;  4ZB9 A;  7GSS A;  1XWK A;  3GYK A;  4BWQ A;  3C1S A;  1K0B A;  3UBL A;  1O85 A;  4ECJ A;  3F3R A;  1QUW A;  3WT1 A;  4POM A;  5HFG A;  1GH2 A;  2TIR A;  4K7O A;  3F3Q A;  4FO5 A;  2WFC A;  3M3M A;  4MK3 A;  5HR0 A;  4ECC A;  3K8N A;  1S3C A;  2ON5 A;  2QSI A;  1QXH A;  2WGR A;  5CRW A;  4MZC A;  1O8X A;  4BVX A;  4HDE A;  5DJM A;  2D2Z A;  3M9K A;  2L6D A;  2K18 A;  1BED A;  2HLS A;  3LYK A;  4OWY A;  1KNG A;  5GST A;  2MYG A;  3GMF A;  1LJR A;  4IP1 A;  3FHK A;  2H6Y A;  1XVQ A;  3GKM A;  1SKR B;  4PGT A;  3GX8 A;  2GLR A;  3H79 A;  4EDZ A;  4MJA A;  1XPV A;  1DE1 A;  1XOB A;  2DJ1 A;  3DML A;  5ECK B;  3W8J A;  2AB6 A;  1AIU A;  3CXG A;  1EP8 A;  2FWH A;  2FHE A;  2H1B A;  4IGJ A;  2IFQ B;  1B48 A;  4O7H A;  4EKZ A;  1T4Z A;  3F6D A;  5KEJ A;  1XVW A;  6GSW A;  2GS3 A;  2IMI A;  2IWT A;  1F37 A;  1FG4 A;  3TKR A;  2C80 A;  4MLY A;  2GTU A;  1J9B A;  2B5X A;  2O87 A;  3KCM A;  3W6G A;  4POL A;  3A2X A;  3L9S A;  2LJR A;  4EE0 A;  2ZNM A;  2HSN B;  2AV4 A;  3A2W A;  4NXI A;  1FW1 A;  1AXD A;  2RM6 A;  2C0E A;  3KMN A;  6GSY A;  5KN2 A;  2HSH A;  2HSM A;  2E2M A;  1PL1 A;  5ID2 A;  5AIX A;  3HZ4 A;  2B3S A;  3IC8 A;  3L4N A;  5BMU A;  1DUG A;  3N5O A;  2CV4 A;  5ECH B;  2F3M A;  4GQF A;  1GSS A;  5G31 A;  5A4U A;  2WDU A;  4L0W A;  4GTU A;  3A2V A;  3E3E A;  1OC3 A;  4KDU A;  3G9B A;  4AJ8 A;  5DAL B;  4N0Z A;  5D93 A;  1T00 A;  2R6K A;  5ECM B;  4K1F A;  3GFK A;  4KDY A;  1A8L A;  1XZO A;  2WS2 A;  4IVF A;  1T3B A;  4TR4 A;  3A3T A;  1GLQ A;  4NHW A;  2YWI A;  2YNX A;  3TJB A;  1V98 A;  4PQ1 A;  3ZIJ A;  5IQY A;  4K8M A;  3TRQ A;  4FYU A;  4N0V A;  3HYP A;  1EV9 A;  1V9W A;  4KCE A;  5HFK A;  3MNG A;  4POB A;  2DC5 A;  3UJ1 A;  4PNF A;  5FWG A;  1T4Y A;  2IFQ A;  5AGY A;  4TW5 A;  3FKF A;  2VL2 A;  5B6M A;  1SK2 A;  1WJK A;  4K7N A;  4IN0 A;  1THX A;  1X5C A;  1RQM A;  1V40 A;  4PUA A;  3KTB A;  3KTL A;  2GZY A;  1QFN A;  1ZOF A;  14GS A;  2GDR A;  2YZU A;  3UBK A;  3WYW A;  2GST A;  3P2A A;  1UN2 A;  2HSY A;  1R4W A;  2K8S A;  3APQ A;  1JZW A;  1SJZ A;  2RLI A;  2HYX A;  2H0H A;  4ID0 A; 
#chains in the Genus database with same CATH topology
 4PTS A;  1CQG A;  5IMV A;  4X1U A;  2NBS A;  3L78 A;  3I9V 2;  3M8N A;  3LOR A;  1VF4 A;  4ACS A;  1JFU A;  5IPG A;  4PI2 C;  4WF5 A;  4ZB8 A;  1TXX A;  3MWH A;  5DQS A;  3CSH A;  2MMN A;  2TRC P;  1EOG A;  1HYU A;  3KIJ A;  3GHA A;  4WBR D;  2WVZ A;  4F03 A;  2YZH A;  2WW2 A;  4NWY A;  4NHZ A;  3QOU A;  1K3O A;  1TKD B;  2UZ8 A;  2VCZ A;  1O81 A;  5DAK A;  1WMJ A;  2G2Q A;  4FYC A;  2PMT A;  3EU3 A;  2YCD A;  2PGT A;  3D22 A;  3VI5 A;  2H6X A;  2O36 A;  2NDO A;  1CQH A;  3FZ5 A;  1PN0 A;  1XCC A;  2F8A A;  1M99 A;  2QGV A;  4O92 A;  5ECN B;  4HQS A;  2DJK A;  2A2R A;  4DSQ A;  2OBK A;  5KN1 A;  1FHE A;  3EYT A;  4KH7 A;  1XW9 A;  2WW0 A;  4OCF A;  3O76 A;  2IMK A;  3LJR A;  2N5B A;  1PX7 A;  3L9U A;  5G5F A;  3ZFL A;  4H86 A;  3TU3 B;  3IDV A;  4I6X A;  1ZGN A;  1B8X A;  2YV9 A;  1XXU A;  1GTI A;  3F9U A;  1GUL A;  1YKC A;  5E4W A;  2I1U A;  2HRF A;  4PHZ C;  4MF7 A;  1WOU A;  2MZC A;  5CP1 A;  3Q74 A;  19GS A;  5CRE A;  5F8B A;  1IYH A;  1ML6 A;  4NPB A;  1AQV A;  2H71 A;  1Z3E A;  2FA4 A;  3QAW A;  1EOH A;  1MD3 A;  1G6Y A;  1TRW A;  2EFH A;  3WGD A;  2GSQ A;  1I1I P;  3G7J A;  3TKS A;  5FHI A;  3RGB C;  1HNB A;  1TRS A;  3HY2 A;  5A5H A;  1XFL A;  2EIR A;  1GSE A;  2H74 A;  5KOX A;  3KJY A;  2XBI A;  5ELG A;  1TOF A;  2MMA A;  3MAK A;  3PIN A;  3UAP A;  5JCG A;  1GTB A;  1SD9 A;  2FUG 2;  5BMU B;  1PRX A;  3ERW A;  2O3E A;  1O7U A;  3FY7 A;  4CY8 A;  1A8Y A;  4DSS A;  5DCG A;  1ERV A;  4AJ7 A;  1TP9 A;  1Z6N A;  2H1A A;  3TGZ A;  3KXO A;  2QC7 A;  4ZL9 A;  1K0O A;  2JAD A;  2TRX A;  2X8H A;  2CAQ A;  2MBS A;  5G1K A;  3GNJ A;  3VWU A;  4TRX A;  4WR4 A;  1DBY A;  4Q5Q A;  2ZCT A;  3TKQ A;  2IN3 A;  5D9X A;  4EDY A;  2O7K A;  5G1L A;  4XHM A;  1B4P A;  5D9V A;  1TXU A;  4IQA A;  1VGL A;  3LYP A;  3QAG A;  5J3R A;  3C8E A;  3QR6 A;  3ME8 A;  3I6A A;  2EIQ A;  2HRA A;  3ZL5 A;  3HJP A;  5LNK e;  1VF1 A;  2OT3 A;  2LEG A;  2O89 A;  1HQO A;  1SKW B;  2LNT A;  2VOC A;  3LGC A;  1ZL9 A;  5B7C A;  2DJ0 A;  5F05 A;  1WPI A;  4EO3 A;  4ULX A;  4EXJ A;  3S9F A;  4G0L A;  3EMP A;  1K3Y A;  4GST A;  1OYJ A;  2H19 A;  2C4J A;  4EVM A;  1ZYE A;  2C8U A;  3QFB C;  1EGO A;  4YQV A;  3EE2 A;  3EIN A;  4DEJ A;  2DKH A;  2VLT A;  4KSO A;  3US3 A;  4YAP A;  2B5E A;  5IM9 A;  2V6O A;  4ML1 A;  1XWG A;  2LV3 A;  4XS6 A;  4I2U A;  1M7T A;  4OFM A;  2DLX A;  4WKW A;  4LL4 B;  2GSR A;  1YF1 A;  3R2Q A;  4WXT A;  4O5Q A;  2CA8 A;  4HSC X;  5HR3 A;  1DSB A;  1VRS D;  3F4S A;  4EC0 A;  2HZF A;  2RII A;  1ILO A;  3IHQ A;  4YQU A;  5EL8 A;  4F82 A;  3KH9 A;  3FR6 A;  2OAD A;  4MMM A;  1PL2 A;  2CVD A;  1NM3 A;  4ZIJ A;  2KUC A;  4X0X A;  5LD0 A;  4MDC A;  5F0G A;  4L0U A;  3IC4 A;  2HXK A;  2R0P A;  1FB0 A;  4E8H A;  3M9J A;  3TRX A;  2H1L A;  2C0G A;  2C1Y A;  1PN9 A;  3MDK A;  3EUR A;  3TCO A;  1UVZ A;  1XG8 A;  2P5R A;  1GSU A;  1OE8 A;  5JCW A;  1JLW A;  4HOJ A;  3KEB A;  3HXS A;  3LW9 A;  3D21 A;  2WCI A;  17GS A;  2VLU A;  3OR5 A;  4GQC A;  4QL9 A;  2ZUP A;  2H0G A;  5J4U A;  3BCK A;  1RK4 A;  1BX9 A;  3LXT A;  4WEY A;  3V1W A;  3RBT A;  1M2A A;  2FD3 A;  3CRT A;  4Q5F A;  1OAZ A;  5IO0 A;  1K0M A;  2M72 A;  2H73 A;  1K3L A;  2WVX A;  4IS0 A;  3CTG A;  2WW3 A;  3FZA A;  2EFD A;  2IL3 A;  1TRU A;  5EY6 A;  4KF9 A;  4OMV A;  4MF5 A;  3QPM A;  1GTA A;  3GA4 A;  3KP8 A;  1Z5Y E;  5FT3 A;  5H5S A;  3EVI A;  1R7H A;  3F0I A;  4EUY A;  1YEP A;  3VPQ A;  1ZZY A;  3EU4 A;  1X5E A;  2GQL A;  2OBI A;  3ZIV A;  1Y1U A;  5A5K A;  1KBN A;  3LEF A;  1GWC A;  3QAV A;  5CYY A;  2ON7 A;  1JZO A;  1A24 A;  1USB A;  4AKH A;  2L5O A;  4OCE A;  4BL7 A;  3EWL A;  2OA7 A;  2L4Q A;  4V2N A;  2XPE A;  2LQQ A;  5J9B A;  3QD9 A;  5GZZ B;  2BTO T;  3PR8 A;  2H0I A;  5INY A;  4HU7 A;  1R5P A;  1VF3 A;  3LXZ A;  1YKA A;  3RAZ A;  1MTC A;  3CRU A;  1TK8 B;  3D4M A;  3TJJ A;  1ZYN A;  1OC8 A;  2FCH A;  3D4T A;  1B9X C;  3Q18 A;  3QFA C;  4JRR A;  4TOP A;  2FGX A;  2VLV A;  4MH3 A;  3TJF A;  4KA0 A;  5ECP B;  1TW9 A;  1U3A A;  2JSZ A;  2FWG A;  3UAR A;  5D8I A;  3MIX A;  2R5G A;  4N3Z A;  4HS1 A;  4RI7 A;  4TVE A;  1N25 A;  3DIE A;  3PGT A;  2UV8 G;  4LLR A;  4JE1 A;  2LRT A;  1NHY A;  5G5E A;  3SBC A;  3FK8 A;  5JWO B;  2V41 A;  3BD2 A;  1EV4 A;  3O3T A;  4ICY A;  1R5A A;  5EPF A;  2DBC A;  1QQ2 A;  2YOI A;  2I4A A;  2HSN A;  1SK1 A;  4MJB A;  3HZ8 A;  3F4T A;  3ME7 A;  3LG6 A;  4IQ1 A;  5CAX A;  4JBB A;  2H75 A;  4HJM A;  5COH A;  5DVB A;  5CRH A;  2OE0 A;  3UVT A;  2H30 A;  3NIV A;  5GSS A;  3D5J A;  4FYB A;  5CRD A;  3DRN A;  3ZLP A;  2GT6 A;  3O6T A;  1TJD A;  3GKK A;  3FW2 A;  1NHO A;  4MF6 A;  2JL4 A;  1ERT A;  2C0F A;  3IV4 A;  4O5U A;  4X43 A;  3ZYW A;  4NAX A;  1A0R P;  3VFI A;  2H66 A;  2R0G A;  1GUM A;  4WET A;  5HR2 A;  1TI3 A;  2H72 A;  4L5L A;  1Q4J A;  1J0F A;  1JHB A;  2VD0 A;  1FB6 A;  1XW6 A;  1GLP A;  2HSM B;  1U88 A;  4K5S A;  3UIW A;  2DJ2 A;  1U87 A;  3HKR A;  3RPN A;  3UL3 A;  1I5G A;  4BWS A;  4AI6 A;  2A2P A;  3ED3 A;  4MNN A;  2K6V A;  5GAN D;  3I69 A;  2PPT A;  4G2E A;  2ALB A;  3HA9 A;  2JU5 A;  4JR6 A;  2B7K A;  4CHS A;  2XHF A;  5AN1 A;  4JZQ A;  3GL3 A;  4RQX A;  1S3R A;  1YEW C;  2V6K A;  1G7O A;  4XIH A;  4CDO A;  4MJE A;  5C00 A;  2DIY A;  1AUC A;  1PFO A;  2REM A;  3D6I A;  1GUH A;  2VKZ G;  4IJ3 A;  1MDK A;  3LWA A;  1PX6 A;  3ERG A;  2CX3 A;  3DWV A;  3FZ4 A;  5ECR B;  4EL1 A;  2LJK A;  5ECQ B;  2VL9 A;  4GSN A;  3GL5 A;  1Z7P A;  5IMD A;  4KE3 A;  1N2A A;  18GS A;  2FWE A;  1T1V A;  4IBP A;  1Y6E A;  1Z7R A;  1O6J A;  3TDG A;  4XS4 B;  3UVH A;  4QL7 A;  2A4H A;  3H8Q A;  4ZBB A;  4ZBA A;  3CSJ A;  2CVB A;  3VWX A;  2R4V A;  2B7J A;  2YPM A;  1X9S B;  4FQU A;  5EVO A;  3ZMK A;  3FMW A;  3RHC A;  1A2M A;  2HT9 A;  2YJH A;  1X9M B;  4AJ6 A;  4I97 A;  1M9B A;  1E2Y A;  3HVN A;  3TB2 A;  2G0F A;  1BG5 A;  1MDI A;  4I8B A;  16GS A;  2KOK A;  1WE0 A;  1TK5 B;  2H6Z A;  4EIP A;  2X8C A;  1GL8 A;  5IMZ A;  1F2E A;  2O5V A;  4PI0 C;  2YWM A;  1PKZ A;  1EEJ A;  2I81 A;  5A1N A;  1YJ6 A;  2VIM A;  2C0D A;  4Z2U A;  4X4J A;  3CBU A;  3AY8 A;  3GH6 A;  4MZW A;  4HZ4 A;  1J08 A;  5HFI A;  4J2F A;  3H4K A;  2KP2 A;  1OKT A;  1G7E A;  2WUL A;  2VL3 A;  1X0R A;  4KND A;  2PWJ A;  1ON4 A;  2X49 A;  2LKU A;  2OE3 A;  1AQW A;  1I9D A;  4JR4 A;  3P7X A;  1X9W B;  4O32 A;  4MPG A;  3GIX A;  4WF4 A;  4K9Z A;  4IHU A;  4IP6 A;  1GTU A;  4YH2 A;  3ZRD A;  4G0K A;  1OC9 A;  3HDC A;  4L8E A;  4ILF A;  3TOT A;  2WZ9 A;  2IPA A;  5L71 A;  4HUA A;  1AC1 A;  4RUV A;  4G9H A;  2HI7 A;  5ECI B;  1N8J A;  2P5Q A;  4XS4 A;  2H1D A;  2FA8 A;  1YDK A;  1TRV A;  2EFC A;  3N9J A;  3E9J B;  4PQH A;  2IMF A;  2DML A;  2B5Y A;  5IPH A;  1V58 A;  5C04 A;  1MEK A;  1AQX A;  1R26 A;  1WRY A;  3ZML A;  3M0F A;  1PSQ A;  3F4R A;  4GLT A;  4BPY A;  1C72 A;  1KEB A;  5J4Y A;  4AKI A;  1PKW A;  2MMZ A;  2XBQ A;  4L5O A;  4D73 B;  1TI1 A;  2QA2 A;  1GSY A;  2IMD A;  3C73 A;  3IA1 A;  5DAK B;  1PA3 A;  3HJM A;  2QKE A;  2OKA A;  3EMX A;  4LA1 A;  3GRX A;  2DJ3 A;  4ML6 A;  1VF2 A;  1F6M C;  1SK0 A;  2YV7 A;  2VAF A;  3UMA A;  2VD1 A;  2E2G A;  2YWN A;  5B6N A;  4FIW A;  5A34 B;  1GSF A;  4ISD A;  4PUR A;  2YN1 A;  2WZS A;  3GX0 A;  3U6V A;  1ERW A;  4DVC A;  2PN8 A;  2HQT A;  2L57 A;  1FAA A;  2HRN A;  5DDL A;  2YP6 A;  1S3A A;  2I9H A;  3GST A;  3P90 A;  1TDI A;  5KN3 A;  3TJG A;  3IBH A;  3M1G A;  1M2D A;  2AJQ B;  4ZXG A;  3DVW A;  4OO5 A;  4KDX A;  5IMC A;  2P0G A;  4TXO B;  2NPB A;  1T8E B;  2H76 A;  1B4Q A;  1M9A A;  2DJJ A;  3DVX A;  1FOH A;  3VWV A;  3PH9 A;  4IW9 A;  2LST A;  1E6B A;  1U3I A;  1ZCP A;  3GKN A;  1SJ6 A;  5DBQ A;  1SL0 B;  4TXO A;  1LBK A;  2F9S A;  5ABR A;  4IJI A;  4LMW A;  4V1A p;  3DXB A;  1IYI A;  2HNL A;  2LQO A;  1H75 A;  1ABA A;  3CQF A;  2C3Q A;  5HQP A;  1A0F A;  4XTS A;  5B8A A;  4Z7X A;  2H70 A;  1M3J A;  3ZVJ D;  3IR4 A;  4HZ2 A;  4HU9 A;  2AYT A;  2JZS A;  5DAL A;  4ZL8 A;  4MH2 A;  3W8S A;  3WGX A;  5AIV A;  1JZD A;  2EIO A;  1PMT A;  3LFL A;  3FYG A;  3FZ9 A;  3GUR A;  1KTE A;  2IME A;  4EF0 A;  5H5Q A;  4NMU A;  5D96 A;  4G19 A;  2LS5 A;  1V2A A;  2WB9 A;  1YY7 A;  4BIK A;  2EFE A;  4HEA 2;  1NSW A;  1LU4 A;  1BYE A;  4BVY B;  1EWX A;  3RPP A;  1ZYP A;  5J4V A;  4TR1 B;  1SKS B;  3IOS A;  4HI7 A;  4IKH A;  3VPT A;  2EC4 A;  4HJ2 A;  2HFD A;  4I2T A;  4MPF A;  3ZTL A;  4MJC A;  3HCZ A;  4KSM A;  4YQM A;  4XRD A;  1URM A;  3D0Z A;  3VUR A;  1QK8 A;  5D9W A;  1T7P B;  2H1G A;  4PX1 A;  1DE2 A;  2PVO C;  4I5Q A;  5J47 A;  2HRK A;  5F06 A;  2LTK A;  2VCX A;  2A4V A;  1XWB A;  2CZ3 A;  1GSQ A;  1M2B A;  2NVL A;  2RUF A;  4IEL A;  3UOM A;  1BAY A;  1B9Y C;  2CZ2 A;  2WVY A;  2O85 A;  3F63 A;  4AKG A;  2LJA A;  11GS A;  4XRA A;  4ZBD A;  1H4O A;  4Q5R A;  2PBJ A;  2E0Q A;  4QMK A;  2AHE A;  3IK9 A;  2FWF A;  1THO A;  2R3X A;  3KGK A;  3HVV A;  2YAN A;  1V57 A;  2PER A;  4E8E A;  4KAE A;  3CHX C;  4GWR A;  3F6F A;  1XOA A;  3IAM 2;  2F51 A;  4G10 A;  5DQY A;  5G30 A;  3GV1 A;  3J7Y b;  4DSS B;  2VCW A;  5ENU A;  4HQZ A;  3BCI A;  2B1K A;  4KGI A;  4ZL7 A;  4G0I A;  4J56 E;  2GZP A;  6GSU A;  4XCS A;  1BF5 A;  2N5A A;  5IOX A;  2K9F A;  1BJX A;  2GQK A;  3TRP A;  3CSI A;  1O73 A;  4OO4 A;  1SEN A;  5J9C A;  3HVX A;  3C1R A;  2VCV A;  1Z6M A;  3UEM A;  1SD8 A;  2LNS A;  2DSA A;  1XIY A;  1SU9 A;  1HD2 A;  2X8G A;  1UC7 A;  2M80 A;  1TU8 A;  3DYR A;  3WGE A;  2I3Y A;  5A5H B;  4P3Y B;  4GCI A;  1QMV A;  3GSS A;  2XC2 A;  2R37 A;  1HNC A;  3RDW A;  1SYX A;  2CX4 A;  1SL1 B;  2CVK A;  5AIS A;  5ECS A;  6GSX A;  2BJX A;  4F2I A;  6GST A;  3GUS A;  2DKI A;  5ECL B;  2GVP A;  1PQN A;  5KN0 A;  3VI7 A;  3QDN A;  3ERF A;  1A2L A;  1SL2 B;  2GZZ A;  2M46 A;  1GSD A;  3L0H A;  3CYN A;  4TKY A;  1SVM A;  2N5F A;  1YF0 A;  4MA9 A;  3NOF A;  4RQR A;  4TN8 A;  1FO5 A;  4NV5 A;  3IXR A;  2JZR A;  3TKS E;  5HR1 A;  5CNW A;  4YKG A;  3JCM L;  5H5R A;  3ISO A;  3APS A;  4TXV A;  1W4V A;  6GSS A;  4KX4 A;  8GSS A;  4K7I A;  5JWQ B;  4GXZ A;  12GS A;  2RUE A;  1A2J A;  1S3D A;  4K2D A;  2YJ7 A;  2GT5 A;  3G7I A;  5B8B A;  5ECO B;  2H8L A;  2IIY A;  1YZX A;  3IE3 A;  1GUK A;  1GP1 A;  2MMO A;  5J41 A;  1PD2 1;  3CMI A;  5E59 A;  3HJO A;  1WIK A;  1K0D A;  5ID2 B;  3IRA A;  1K0N A;  4BVY A;  4YAV A;  2LUS A;  2PVQ A;  2QA1 A;  2LRN A;  3ZFB A;  4JU5 A;  1HNA A;  2WRT A;  1FVJ A;  3IHG A;  2F8F A;  3BBY A;  3H1N A;  1BQ7 A;  3TOU A;  3GN3 A;  1YQ1 A;  2V1M A;  3H93 A;  3DKS A;  2VCQ A;  5LCZ A;  4PQI A;  3FR9 A;  2VUP A;  2NTO A;  5IIZ A;  4JED A;  1X5D A;  1JLV A;  5DJL A;  3KM6 A;  3DD3 A;  2GGT A;  3MSZ A;  2AUV A;  2IJY A;  1F9M A;  2OAC A;  4NV2 A;  2HRK B;  2R2J A;  3WT2 A;  2YWO A;  2OJL A;  4F9Z A;  4ECB A;  4A5P A;  4KUN A;  10GS A;  3ZIT A;  4Q5N A;  2J23 A;  2CAI A;  4MCU A;  2MBT A;  4OFT A;  2KP1 A;  1ACV A;  4GRF A;  5ELA A;  3ZRE A;  1XBS A;  1W89 A;  5JCU A;  1AW9 A;  3F8U A;  4PUF C;  3KZQ A;  4N11 A;  2CQ9 A;  13GS A;  4ECI A;  2RM5 A;  1FOV A;  1Q98 A;  3KP9 A;  3WD6 A;  1SYR A;  4OFN A;  3A5I A;  2C3N A;  1JZR A;  1Y25 A;  2X99 A;  4QQ7 A;  3I43 A;  2ES7 A;  2VO4 A;  2XPD A;  4TR0 A;  2E7P A;  2L59 A;  3BJ5 A;  3C7M A;  5BRT A;  3VWW A;  4BL7 B;  1S4B P;  4AGS A;  3Q19 A;  1O8W A;  1AAZ A;  1TK0 B;  4GF0 A;  5JWR B;  3G7Y A;  3CTF A;  4LMV A;  1WP0 A;  5G2Z A;  3PPU A;  2R0C A;  3IK7 A;  5D73 A;  3FEU A;  1EZK A;  2B6M A;  4N10 A;  1M0U A;  1ZYQ B;  4MZB A;  1OC9 B;  3TJK A;  1PGT A;  1MD4 A;  1G6W A;  3DGQ A;  3L9V A;  2Z9S A;  2JSY A;  4WR5 A;  3SWL A;  3FR3 A;  4ZB6 A;  2DMM A;  3EC3 A;  3GTU A;  20GS A;  3C71 A;  2OE1 A;  3BOA A;  2K8V A;  4GSS A;  4Z2T A;  1SJI A;  1NW2 A;  4N30 A;  3NZN A;  2O8V B;  3GH9 A;  3KMO A;  2V32 A;  4V2L A;  1K0C A;  5IMF A;  4LL1 B;  3TKP A;  3APO A;  1OVN A;  1RW1 A;  3KD0 A;  4PXO A;  2H01 A;  4TR3 A;  4FH8 A;  2KLX A;  1OE7 A;  1XW5 A;  4G01 A;  4OD7 A;  2BMX A;  4CY6 A;  4J57 E;  3RHB A;  1WWJ A;  3TKS C;  3LSZ A;  2HE3 A;  1Z9H A;  4XS1 A;  1XWC A;  2X4A A;  2CT6 A;  2VCT A;  3R3E A;  5CO3 A;  1TU7 A;  4KCA A;  2KHP A;  2PU9 C;  3TUE A;  4O5R A;  2HZE B;  3GKX A;  2VM2 A;  1F3B A;  2A2S A;  4K6X A;  2GSS A;  3KH7 A;  4MP4 A;  2VM1 A;  5GAP D;  4K0G A;  2VL2 C;  4ZIL A;  3QMX A;  2J9H A;  4K0N A;  2DIZ A;  4E68 A;  5IMA A;  1GNE A;  4KB3 A;  4FXY P;  2P31 A;  3VK9 A;  1EGR A;  2L5L A;  4F0B A;  1TTZ A;  1G0T A;  4TR1 A;  1U6T A;  2FY6 A;  2HZE A;  4F0C A;  1A23 A;  2C3T A;  6GSV A;  1EP7 A;  3J7Y k;  3ZZX A;  1UA5 A;  1FVK A;  4USS A;  1ERU A;  3Q6O A;  3HVS A;  1ZMA A;  4DSR A;  3IPZ A;  2L4C A;  4D73 A;  3IAS 2;  5IOW A;  1QGV A;  1YEX A;  3HHV A;  2GQM A;  4V2M A;  4BVX B;  4BA7 A;  4V1A g;  2JAC A;  2LRC A;  5IO2 A;  3GTU B;  1F3A A;  4CW9 A;  3U5R E;  2PUK C;  3A5W A;  2AAW A;  3VLN A;  5DCH A;  2FLS A;  3E0U A;  1SVL A;  1GNW A;  1OKD A;  5CRG A;  2V2G A;  1GRX A;  22GS A;  3DEX A;  3HD5 A;  5A34 A;  5J5N A;  3FRC A;  4KW6 A;  2B1L A;  1MDJ A;  3LQ7 A;  3P8W A;  4MAB A;  4AF2 A;  2FNO A;  4POK A;  9GSS A;  4W66 A;  1ST9 A;  2JZT A;  1K0A A;  2WJU A;  3ZVJ A;  4RI6 A;  2L6C A;  4WBJ A;  4Z2R A;  5D9T A;  2X64 A;  1XWA A;  3QCP A;  5F07 A;  5A4W A;  1EEM A;  4PNG A;  5A4V A;  4ZB9 A;  7GSS A;  5A1N B;  3MYD A;  1XWK A;  3GYK A;  4BWQ A;  3C1S A;  1K0B A;  3UBL A;  1O85 A;  4ECJ A;  3F3R A;  1QUW A;  3WT1 A;  4POM A;  5HFG A;  1GH2 A;  2TIR A;  4K7O A;  3F3Q A;  4FO5 A;  2WFC A;  3M3M A;  4K5R A;  4MK3 A;  5HR0 A;  4ECC A;  3K8N A;  1S3C A;  2ON5 A;  2QSI A;  1QXH A;  2WGR A;  5CRW A;  4MZC A;  1O8X A;  4BVX A;  4HDE A;  5DJM A;  3M9K A;  2D2Z A;  2L6D A;  2K18 A;  1BED A;  2HLS A;  3LYK A;  4OWY A;  1KNG A;  5GST A;  2MYG A;  3GMF A;  1LJR A;  4IP1 A;  3FHK A;  3CWG A;  2H6Y A;  1XVQ A;  3GKM A;  1SKR B;  4PGT A;  1M3I A;  3GX8 A;  2GLR A;  3H79 A;  4EDZ A;  4MJA A;  1XPV A;  1DE1 A;  1XOB A;  2DJ1 A;  3DML A;  5ECK B;  3W8J A;  2AB6 A;  1AIU A;  3CXG A;  1EP8 A;  2FWH A;  2FHE A;  2H1B A;  1SVO A;  4IGJ A;  2IFQ B;  1B48 A;  4O7H A;  4EKZ A;  1T4Z A;  1BG1 A;  3F6D A;  5KEJ A;  4YKF A;  1XVW A;  6GSW A;  2GS3 A;  2IMI A;  2IWT A;  1F37 A;  1FG4 A;  3TKR A;  4EIQ A;  2C80 A;  4MLY A;  2GTU A;  1J9B A;  2B5X A;  2O87 A;  3KCM A;  3W6G A;  4POL A;  3A2X A;  3L9S A;  2LJR A;  4EE0 A;  2ZNM A;  2HSN B;  5J40 A;  2AV4 A;  3A2W A;  4NXI A;  1FW1 A;  1AXD A;  2RM6 A;  2C0E A;  3KMN A;  6GSY A;  5KN2 A;  2HSH A;  3EPT A;  2HSM A;  2E2M A;  5KOW A;  1PL1 A;  5ID2 A;  5AIX A;  3HZ4 A;  2B3S A;  3IC8 A;  3L4N A;  5BMU A;  1DUG A;  3N5O A;  2CV4 A;  5ECH B;  2F3M A;  4GQF A;  4K2X A;  1GSS A;  5G31 A;  5A4U A;  2WDU A;  4L0W A;  4GTU A;  3A2V A;  3E3E A;  1OC3 A;  4KDU A;  3G9B A;  4AJ8 A;  5DAL B;  4N0Z A;  5D93 A;  1T00 A;  2R6K A;  4K1F A;  5ECM B;  3GFK A;  4KDY A;  1A8L A;  1XZO A;  2WVX B;  2WS2 A;  4IVF A;  1T3B A;  4TR4 A;  3A3T A;  3RFR C;  1GLQ A;  4NHW A;  2YWI A;  2YNX A;  3TJB A;  1V98 A;  4PQ1 A;  3ZIJ A;  5IQY A;  4K8M A;  1YVL A;  3TRQ A;  4FYU A;  4N0V A;  3HYP A;  1EV9 A;  1V9W A;  4KCE A;  5HFK A;  3MNG A;  4POB A;  2DC5 A;  2WW1 A;  3UJ1 A;  4PNF A;  4GDF A;  5FWG A;  1T4Y A;  2IFQ A;  5AGY A;  4TW5 A;  3FKF A;  2VL2 A;  5B6M A;  1SK2 A;  1WJK A;  4K7N A;  3HMJ G;  4IN0 A;  1THX A;  1X5C A;  1RQM A;  1V40 A;  4PUA A;  3KTB A;  3KTL A;  2GZY A;  1QFN A;  1ZOF A;  14GS A;  2GDR A;  2YZU A;  3UBK A;  3WYW A;  2GST A;  4ZB7 A;  3P2A A;  4AKX B;  1UN2 A;  2HSY A;  1R4W A;  2K8S A;  3APQ A;  1JZW A;  1SJZ A;  2RLI A;  2HYX A;  2H0H A;  4ID0 A; 
#chains in the Genus database with same CATH homology
 4PTS A;  1CQG A;  5IMV A;  4X1U A;  2NBS A;  3L78 A;  3I9V 2;  3M8N A;  3LOR A;  1VF4 A;  4ACS A;  1JFU A;  5IPG A;  4WF5 A;  4ZB8 A;  1TXX A;  3MWH A;  5DQS A;  3CSH A;  2MMN A;  2TRC P;  1EOG A;  1HYU A;  3KIJ A;  3GHA A;  4WBR D;  4F03 A;  2YZH A;  4NWY A;  4NHZ A;  3QOU A;  1K3O A;  1TKD B;  2UZ8 A;  2VCZ A;  1O81 A;  5DAK A;  1WMJ A;  2G2Q A;  4FYC A;  2PMT A;  3EU3 A;  2YCD A;  2PGT A;  3D22 A;  3VI5 A;  2H6X A;  2NDO A;  1CQH A;  3FZ5 A;  1PN0 A;  1XCC A;  2F8A A;  1M99 A;  2QGV A;  4O92 A;  5ECN B;  4HQS A;  2DJK A;  2A2R A;  4DSQ A;  2OBK A;  5KN1 A;  1FHE A;  3EYT A;  4KH7 A;  1XW9 A;  4OCF A;  3O76 A;  2IMK A;  3LJR A;  2N5B A;  1PX7 A;  3L9U A;  5G5F A;  3ZFL A;  4H86 A;  3TU3 B;  3IDV A;  4I6X A;  1ZGN A;  1B8X A;  2YV9 A;  1XXU A;  1GTI A;  3F9U A;  1GUL A;  1YKC A;  5E4W A;  2I1U A;  2HRF A;  4MF7 A;  1WOU A;  2MZC A;  5CP1 A;  3Q74 A;  19GS A;  5CRE A;  5F8B A;  1IYH A;  1ML6 A;  4NPB A;  1AQV A;  2H71 A;  1Z3E A;  2FA4 A;  3QAW A;  1EOH A;  1MD3 A;  1G6Y A;  1TRW A;  2EFH A;  3WGD A;  2GSQ A;  3TKS A;  3G7J A;  5FHI A;  1HNB A;  1TRS A;  3HY2 A;  5A5H A;  1XFL A;  2EIR A;  1GSE A;  2H74 A;  5KOX A;  3KJY A;  2XBI A;  5ELG A;  1TOF A;  2MMA A;  3MAK A;  3PIN A;  3UAP A;  5JCG A;  1GTB A;  1SD9 A;  2FUG 2;  5BMU B;  1PRX A;  3ERW A;  1O7U A;  3FY7 A;  4CY8 A;  1A8Y A;  4DSS A;  5DCG A;  1ERV A;  4AJ7 A;  1TP9 A;  1Z6N A;  2H1A A;  3TGZ A;  3KXO A;  2QC7 A;  4ZL9 A;  1K0O A;  2JAD A;  2TRX A;  2X8H A;  2CAQ A;  2MBS A;  5G1K A;  3GNJ A;  3VWU A;  4TRX A;  4WR4 A;  1DBY A;  4Q5Q A;  2ZCT A;  3TKQ A;  2IN3 A;  5D9X A;  4EDY A;  2O7K A;  5G1L A;  4XHM A;  1B4P A;  5D9V A;  1TXU A;  4IQA A;  1VGL A;  3LYP A;  3QAG A;  5J3R A;  3C8E A;  3QR6 A;  3ME8 A;  3I6A A;  2EIQ A;  2HRA A;  3ZL5 A;  3HJP A;  5LNK e;  1VF1 A;  2OT3 A;  2LEG A;  2O89 A;  1HQO A;  1SKW B;  2LNT A;  2VOC A;  3LGC A;  1ZL9 A;  5B7C A;  2DJ0 A;  5F05 A;  1WPI A;  4EO3 A;  4ULX A;  4EXJ A;  3S9F A;  4G0L A;  3EMP A;  1K3Y A;  4GST A;  1OYJ A;  2H19 A;  2C4J A;  4EVM A;  1ZYE A;  2C8U A;  3QFB C;  1EGO A;  4YQV A;  3EE2 A;  3EIN A;  4DEJ A;  2DKH A;  2VLT A;  4KSO A;  3US3 A;  4YAP A;  2B5E A;  5IM9 A;  2V6O A;  4ML1 A;  1XWG A;  2LV3 A;  4XS6 A;  4I2U A;  1M7T A;  4OFM A;  2DLX A;  4WKW A;  4LL4 B;  2GSR A;  1YF1 A;  3R2Q A;  4WXT A;  4O5Q A;  2CA8 A;  5HR3 A;  1DSB A;  1VRS D;  3F4S A;  4EC0 A;  2HZF A;  2RII A;  1ILO A;  3IHQ A;  4YQU A;  5EL8 A;  4F82 A;  3KH9 A;  3FR6 A;  2OAD A;  4MMM A;  1PL2 A;  2CVD A;  1NM3 A;  4ZIJ A;  2KUC A;  4X0X A;  5LD0 A;  4MDC A;  5F0G A;  4L0U A;  3IC4 A;  2HXK A;  2R0P A;  1FB0 A;  4E8H A;  3M9J A;  3TRX A;  2H1L A;  2C0G A;  2C1Y A;  1PN9 A;  3MDK A;  3EUR A;  3TCO A;  1UVZ A;  2P5R A;  1GSU A;  1OE8 A;  5JCW A;  1JLW A;  4HOJ A;  3KEB A;  3HXS A;  3LW9 A;  3D21 A;  2WCI A;  17GS A;  2VLU A;  3OR5 A;  4GQC A;  4QL9 A;  2ZUP A;  2H0G A;  5J4U A;  3BCK A;  1RK4 A;  1BX9 A;  3LXT A;  4WEY A;  3V1W A;  3RBT A;  1M2A A;  2FD3 A;  3CRT A;  4Q5F A;  1OAZ A;  5IO0 A;  1K0M A;  2H73 A;  2M72 A;  1K3L A;  4IS0 A;  3CTG A;  3FZA A;  2EFD A;  2IL3 A;  1TRU A;  5EY6 A;  4KF9 A;  4OMV A;  4MF5 A;  3QPM A;  1GTA A;  3GA4 A;  3KP8 A;  1Z5Y E;  5FT3 A;  5H5S A;  3EVI A;  1R7H A;  3F0I A;  4EUY A;  1YEP A;  3VPQ A;  1ZZY A;  3EU4 A;  1X5E A;  2GQL A;  2OBI A;  3ZIV A;  1Y1U A;  5A5K A;  1KBN A;  3LEF A;  1GWC A;  3QAV A;  5CYY A;  2ON7 A;  1JZO A;  1A24 A;  1USB A;  4AKH A;  2L5O A;  4OCE A;  4BL7 A;  3EWL A;  2OA7 A;  2L4Q A;  4V2N A;  2XPE A;  2LQQ A;  5J9B A;  3QD9 A;  5GZZ B;  2BTO T;  3PR8 A;  2H0I A;  5INY A;  4HU7 A;  1R5P A;  1VF3 A;  3LXZ A;  1YKA A;  3RAZ A;  1MTC A;  3CRU A;  1TK8 B;  3D4M A;  3TJJ A;  1ZYN A;  1OC8 A;  2FCH A;  3D4T A;  1B9X C;  3Q18 A;  3QFA C;  4JRR A;  4TOP A;  2FGX A;  2VLV A;  4MH3 A;  3TJF A;  4KA0 A;  5ECP B;  1TW9 A;  1U3A A;  2JSZ A;  2FWG A;  3UAR A;  5D8I A;  3MIX A;  2R5G A;  4N3Z A;  4HS1 A;  4RI7 A;  4TVE A;  1N25 A;  3DIE A;  3PGT A;  2UV8 G;  4LLR A;  4JE1 A;  2LRT A;  1NHY A;  5G5E A;  3SBC A;  3FK8 A;  5JWO B;  2V41 A;  3BD2 A;  1EV4 A;  3O3T A;  4ICY A;  1R5A A;  5EPF A;  2DBC A;  1QQ2 A;  2YOI A;  2I4A A;  2HSN A;  1SK1 A;  4MJB A;  3HZ8 A;  3F4T A;  3ME7 A;  3LG6 A;  4IQ1 A;  5CAX A;  4JBB A;  2H75 A;  4HJM A;  5COH A;  5DVB A;  5CRH A;  2OE0 A;  3UVT A;  2H30 A;  3NIV A;  5GSS A;  3D5J A;  4FYB A;  5CRD A;  3DRN A;  3ZLP A;  2GT6 A;  3O6T A;  1TJD A;  3GKK A;  3FW2 A;  1NHO A;  4MF6 A;  2JL4 A;  1ERT A;  2C0F A;  3IV4 A;  4O5U A;  4X43 A;  3ZYW A;  4NAX A;  1A0R P;  3VFI A;  2H66 A;  2R0G A;  1GUM A;  4WET A;  5HR2 A;  1TI3 A;  2H72 A;  4L5L A;  1Q4J A;  1J0F A;  1JHB A;  2VD0 A;  1FB6 A;  1XW6 A;  1GLP A;  2HSM B;  1U88 A;  4K5S A;  3UIW A;  2DJ2 A;  1U87 A;  3HKR A;  3RPN A;  3UL3 A;  1I5G A;  4BWS A;  4AI6 A;  2A2P A;  3ED3 A;  4MNN A;  2K6V A;  5GAN D;  3I69 A;  2PPT A;  4G2E A;  2ALB A;  3HA9 A;  2JU5 A;  4JR6 A;  2B7K A;  4CHS A;  2XHF A;  5AN1 A;  4JZQ A;  3GL3 A;  4RQX A;  2V6K A;  1G7O A;  4XIH A;  4CDO A;  4MJE A;  5C00 A;  2DIY A;  1AUC A;  2REM A;  3D6I A;  1GUH A;  2VKZ G;  4IJ3 A;  1MDK A;  3LWA A;  1PX6 A;  3ERG A;  2CX3 A;  3DWV A;  3FZ4 A;  5ECR B;  4EL1 A;  2LJK A;  5ECQ B;  2VL9 A;  4GSN A;  3GL5 A;  1Z7P A;  5IMD A;  4KE3 A;  1N2A A;  18GS A;  2FWE A;  1T1V A;  4IBP A;  1Y6E A;  1Z7R A;  1O6J A;  3TDG A;  4XS4 B;  3UVH A;  4QL7 A;  2A4H A;  3H8Q A;  4ZBB A;  4ZBA A;  3CSJ A;  2CVB A;  3VWX A;  2R4V A;  2B7J A;  2YPM A;  1X9S B;  4FQU A;  5EVO A;  3ZMK A;  3FMW A;  3RHC A;  1A2M A;  2HT9 A;  2YJH A;  1X9M B;  4AJ6 A;  4I97 A;  1M9B A;  1E2Y A;  3TB2 A;  2G0F A;  1BG5 A;  1MDI A;  4I8B A;  16GS A;  2KOK A;  1WE0 A;  1TK5 B;  2H6Z A;  4EIP A;  2X8C A;  1GL8 A;  5IMZ A;  1F2E A;  2O5V A;  2YWM A;  1PKZ A;  1EEJ A;  2I81 A;  5A1N A;  1YJ6 A;  2VIM A;  2C0D A;  4Z2U A;  4X4J A;  3CBU A;  3AY8 A;  3GH6 A;  4MZW A;  4HZ4 A;  1J08 A;  5HFI A;  4J2F A;  3H4K A;  2KP2 A;  1OKT A;  1G7E A;  2WUL A;  2VL3 A;  1X0R A;  4KND A;  2PWJ A;  1ON4 A;  2X49 A;  2LKU A;  2OE3 A;  1AQW A;  1I9D A;  4JR4 A;  3P7X A;  1X9W B;  4O32 A;  4MPG A;  3GIX A;  4WF4 A;  4K9Z A;  4IHU A;  4IP6 A;  1GTU A;  4YH2 A;  3ZRD A;  4G0K A;  1OC9 A;  3HDC A;  4L8E A;  4ILF A;  3TOT A;  2WZ9 A;  2IPA A;  5L71 A;  4HUA A;  1AC1 A;  4RUV A;  4G9H A;  2HI7 A;  5ECI B;  1N8J A;  2P5Q A;  4XS4 A;  2H1D A;  2FA8 A;  1YDK A;  1TRV A;  2EFC A;  3N9J A;  3E9J B;  4PQH A;  2IMF A;  2DML A;  2B5Y A;  5IPH A;  1V58 A;  5C04 A;  1MEK A;  1AQX A;  1R26 A;  1WRY A;  3ZML A;  3M0F A;  1PSQ A;  3F4R A;  4GLT A;  4BPY A;  1C72 A;  1KEB A;  5J4Y A;  4AKI A;  1PKW A;  2MMZ A;  2XBQ A;  4L5O A;  4D73 B;  1TI1 A;  2QA2 A;  1GSY A;  2IMD A;  3C73 A;  3IA1 A;  5DAK B;  1PA3 A;  3HJM A;  2QKE A;  2OKA A;  3EMX A;  4LA1 A;  3GRX A;  2DJ3 A;  4ML6 A;  1VF2 A;  1F6M C;  1SK0 A;  2YV7 A;  2VAF A;  3UMA A;  2VD1 A;  2E2G A;  2YWN A;  5B6N A;  4FIW A;  5A34 B;  1GSF A;  4ISD A;  4PUR A;  2YN1 A;  3GX0 A;  3U6V A;  1ERW A;  4DVC A;  2PN8 A;  2HQT A;  2L57 A;  1FAA A;  2HRN A;  5DDL A;  2YP6 A;  1S3A A;  2I9H A;  3GST A;  3P90 A;  1TDI A;  5KN3 A;  3TJG A;  3IBH A;  3M1G A;  1M2D A;  2AJQ B;  4ZXG A;  3DVW A;  4OO5 A;  4KDX A;  5IMC A;  2P0G A;  4TXO B;  2NPB A;  1T8E B;  2H76 A;  1B4Q A;  1M9A A;  2DJJ A;  3DVX A;  1FOH A;  3VWV A;  3PH9 A;  4IW9 A;  2LST A;  1E6B A;  1U3I A;  1ZCP A;  3GKN A;  1SJ6 A;  5DBQ A;  1SL0 B;  4TXO A;  1LBK A;  2F9S A;  5ABR A;  4IJI A;  4LMW A;  4V1A p;  3DXB A;  1IYI A;  2HNL A;  2LQO A;  1H75 A;  1ABA A;  2C3Q A;  5HQP A;  1A0F A;  4XTS A;  5B8A A;  4Z7X A;  2H70 A;  3ZVJ D;  3IR4 A;  4HZ2 A;  4HU9 A;  2AYT A;  2JZS A;  5DAL A;  4ZL8 A;  4MH2 A;  3W8S A;  3WGX A;  5AIV A;  1JZD A;  2EIO A;  1PMT A;  3LFL A;  3FYG A;  3FZ9 A;  3GUR A;  1KTE A;  2IME A;  4EF0 A;  5H5Q A;  4NMU A;  5D96 A;  4G19 A;  2LS5 A;  1V2A A;  2WB9 A;  1YY7 A;  2EFE A;  4HEA 2;  1NSW A;  1LU4 A;  1BYE A;  4BVY B;  1EWX A;  3RPP A;  1ZYP A;  5J4V A;  4TR1 B;  1SKS B;  3IOS A;  4HI7 A;  4IKH A;  3VPT A;  2EC4 A;  4HJ2 A;  2HFD A;  4I2T A;  4MPF A;  3ZTL A;  4MJC A;  3HCZ A;  4KSM A;  4YQM A;  4XRD A;  1URM A;  3D0Z A;  3VUR A;  1QK8 A;  5D9W A;  1T7P B;  2H1G A;  4PX1 A;  1DE2 A;  2PVO C;  4I5Q A;  5J47 A;  2HRK A;  5F06 A;  2LTK A;  2VCX A;  2A4V A;  1XWB A;  2CZ3 A;  1GSQ A;  1M2B A;  2NVL A;  2RUF A;  4IEL A;  3UOM A;  1BAY A;  1B9Y C;  2CZ2 A;  2O85 A;  3F63 A;  4AKG A;  2LJA A;  11GS A;  4XRA A;  4ZBD A;  1H4O A;  4Q5R A;  2PBJ A;  2E0Q A;  4QMK A;  2AHE A;  3IK9 A;  2FWF A;  1THO A;  2R3X A;  3KGK A;  3HVV A;  2YAN A;  1V57 A;  2PER A;  4E8E A;  4KAE A;  4GWR A;  3F6F A;  1XOA A;  3IAM 2;  2F51 A;  4G10 A;  5DQY A;  5G30 A;  3GV1 A;  3J7Y b;  4DSS B;  2VCW A;  5ENU A;  4HQZ A;  3BCI A;  2B1K A;  4KGI A;  4ZL7 A;  4G0I A;  4J56 E;  2GZP A;  6GSU A;  4XCS A;  1BF5 A;  2N5A A;  5IOX A;  2K9F A;  1BJX A;  2GQK A;  3TRP A;  3CSI A;  1O73 A;  4OO4 A;  1SEN A;  5J9C A;  3HVX A;  3C1R A;  2VCV A;  1Z6M A;  3UEM A;  1SD8 A;  2LNS A;  2DSA A;  1XIY A;  1SU9 A;  1HD2 A;  2X8G A;  1UC7 A;  2M80 A;  1TU8 A;  3DYR A;  3WGE A;  2I3Y A;  5A5H B;  4P3Y B;  4GCI A;  1QMV A;  3GSS A;  2XC2 A;  2R37 A;  1HNC A;  3RDW A;  1SYX A;  2CX4 A;  1SL1 B;  2CVK A;  5AIS A;  5ECS A;  6GSX A;  2BJX A;  4F2I A;  6GST A;  3GUS A;  2DKI A;  5ECL B;  2GVP A;  1PQN A;  5KN0 A;  3VI7 A;  3QDN A;  3ERF A;  1A2L A;  1SL2 B;  2GZZ A;  2M46 A;  1GSD A;  3L0H A;  3CYN A;  4TKY A;  1SVM A;  2N5F A;  1YF0 A;  4MA9 A;  3NOF A;  4RQR A;  4TN8 A;  1FO5 A;  4NV5 A;  3IXR A;  2JZR A;  3TKS E;  5HR1 A;  5CNW A;  4YKG A;  3JCM L;  5H5R A;  3ISO A;  3APS A;  4TXV A;  1W4V A;  6GSS A;  4KX4 A;  8GSS A;  4K7I A;  5JWQ B;  4GXZ A;  12GS A;  2RUE A;  1A2J A;  1S3D A;  4K2D A;  2YJ7 A;  2GT5 A;  3G7I A;  5B8B A;  5ECO B;  2H8L A;  2IIY A;  1YZX A;  3IE3 A;  1GUK A;  1GP1 A;  2MMO A;  5J41 A;  1PD2 1;  3CMI A;  5E59 A;  3HJO A;  1WIK A;  1K0D A;  5ID2 B;  3IRA A;  1K0N A;  4BVY A;  4YAV A;  2LUS A;  2PVQ A;  2QA1 A;  2LRN A;  3ZFB A;  4JU5 A;  1HNA A;  2WRT A;  1FVJ A;  3IHG A;  2F8F A;  3BBY A;  3H1N A;  1BQ7 A;  3TOU A;  3GN3 A;  1YQ1 A;  2V1M A;  3H93 A;  3DKS A;  2VCQ A;  5LCZ A;  4PQI A;  3FR9 A;  2VUP A;  2NTO A;  5IIZ A;  4JED A;  1X5D A;  1JLV A;  5DJL A;  3KM6 A;  3DD3 A;  2GGT A;  3MSZ A;  2AUV A;  2IJY A;  1F9M A;  2OAC A;  4NV2 A;  2HRK B;  2R2J A;  3WT2 A;  2YWO A;  2OJL A;  4F9Z A;  4ECB A;  4A5P A;  4KUN A;  10GS A;  3ZIT A;  4Q5N A;  2J23 A;  2CAI A;  4MCU A;  2MBT A;  4OFT A;  2KP1 A;  1ACV A;  4GRF A;  5ELA A;  3ZRE A;  1XBS A;  1W89 A;  5JCU A;  1AW9 A;  3F8U A;  4PUF C;  3KZQ A;  4N11 A;  2CQ9 A;  13GS A;  4ECI A;  2RM5 A;  1FOV A;  1Q98 A;  3KP9 A;  3WD6 A;  1SYR A;  4OFN A;  3A5I A;  2C3N A;  1JZR A;  1Y25 A;  2X99 A;  4QQ7 A;  3I43 A;  2ES7 A;  2VO4 A;  2XPD A;  4TR0 A;  2E7P A;  2L59 A;  3BJ5 A;  3C7M A;  5BRT A;  3VWW A;  4BL7 B;  4AGS A;  3Q19 A;  1O8W A;  1AAZ A;  1TK0 B;  4GF0 A;  5JWR B;  3G7Y A;  3CTF A;  4LMV A;  1WP0 A;  5G2Z A;  3PPU A;  2R0C A;  3IK7 A;  5D73 A;  3FEU A;  1EZK A;  2B6M A;  4N10 A;  1M0U A;  1ZYQ B;  4MZB A;  1OC9 B;  3TJK A;  1PGT A;  1MD4 A;  1G6W A;  3DGQ A;  3L9V A;  2Z9S A;  2JSY A;  4WR5 A;  3SWL A;  3FR3 A;  4ZB6 A;  2DMM A;  3EC3 A;  3GTU A;  20GS A;  3C71 A;  2OE1 A;  3BOA A;  2K8V A;  4GSS A;  4Z2T A;  1SJI A;  1NW2 A;  4N30 A;  3NZN A;  2O8V B;  3GH9 A;  3KMO A;  2V32 A;  4V2L A;  1K0C A;  5IMF A;  4LL1 B;  3TKP A;  3APO A;  1OVN A;  1RW1 A;  3KD0 A;  4PXO A;  2H01 A;  4TR3 A;  4FH8 A;  2KLX A;  1OE7 A;  1XW5 A;  4G01 A;  4OD7 A;  2BMX A;  4CY6 A;  4J57 E;  3RHB A;  1WWJ A;  3TKS C;  3LSZ A;  2HE3 A;  1Z9H A;  4XS1 A;  1XWC A;  2X4A A;  2CT6 A;  2VCT A;  3R3E A;  5CO3 A;  1TU7 A;  4KCA A;  2KHP A;  2PU9 C;  3TUE A;  4O5R A;  2HZE B;  3GKX A;  2VM2 A;  1F3B A;  2A2S A;  4K6X A;  2GSS A;  3KH7 A;  4MP4 A;  2VM1 A;  5GAP D;  4K0G A;  2VL2 C;  4ZIL A;  3QMX A;  2J9H A;  4K0N A;  2DIZ A;  4E68 A;  5IMA A;  1GNE A;  4KB3 A;  2P31 A;  3VK9 A;  1EGR A;  2L5L A;  4F0B A;  1TTZ A;  1G0T A;  4TR1 A;  1U6T A;  2FY6 A;  2HZE A;  4F0C A;  1A23 A;  2C3T A;  6GSV A;  1EP7 A;  3J7Y k;  3ZZX A;  1UA5 A;  1FVK A;  4USS A;  1ERU A;  3Q6O A;  3HVS A;  1ZMA A;  4DSR A;  3IPZ A;  2L4C A;  4D73 A;  3IAS 2;  5IOW A;  1QGV A;  1YEX A;  3HHV A;  2GQM A;  4V2M A;  4BVX B;  4BA7 A;  4V1A g;  2JAC A;  2LRC A;  5IO2 A;  3GTU B;  1F3A A;  4CW9 A;  3U5R E;  2PUK C;  3A5W A;  2AAW A;  3VLN A;  5DCH A;  2FLS A;  3E0U A;  1SVL A;  1GNW A;  1OKD A;  5CRG A;  2V2G A;  1GRX A;  22GS A;  3DEX A;  3HD5 A;  5A34 A;  5J5N A;  3FRC A;  4KW6 A;  2B1L A;  1MDJ A;  3LQ7 A;  3P8W A;  4MAB A;  4AF2 A;  2FNO A;  4POK A;  9GSS A;  4W66 A;  1ST9 A;  2JZT A;  1K0A A;  2WJU A;  3ZVJ A;  4RI6 A;  2L6C A;  4WBJ A;  4Z2R A;  5D9T A;  2X64 A;  1XWA A;  3QCP A;  5F07 A;  5A4W A;  1EEM A;  4PNG A;  5A4V A;  4ZB9 A;  7GSS A;  5A1N B;  3MYD A;  1XWK A;  3GYK A;  4BWQ A;  3C1S A;  1K0B A;  3UBL A;  1O85 A;  4ECJ A;  3F3R A;  1QUW A;  3WT1 A;  4POM A;  5HFG A;  1GH2 A;  2TIR A;  4K7O A;  3F3Q A;  4FO5 A;  2WFC A;  3M3M A;  4K5R A;  4MK3 A;  5HR0 A;  4ECC A;  3K8N A;  1S3C A;  2ON5 A;  2QSI A;  1QXH A;  2WGR A;  5CRW A;  4MZC A;  1O8X A;  4BVX A;  4HDE A;  5DJM A;  3M9K A;  2D2Z A;  2L6D A;  2K18 A;  1BED A;  2HLS A;  3LYK A;  4OWY A;  1KNG A;  5GST A;  2MYG A;  3GMF A;  1LJR A;  4IP1 A;  3FHK A;  3CWG A;  2H6Y A;  1XVQ A;  3GKM A;  1SKR B;  4PGT A;  3GX8 A;  2GLR A;  3H79 A;  4EDZ A;  4MJA A;  1XPV A;  1DE1 A;  1XOB A;  2DJ1 A;  3DML A;  5ECK B;  3W8J A;  2AB6 A;  1AIU A;  3CXG A;  1EP8 A;  2FWH A;  2FHE A;  2H1B A;  1SVO A;  4IGJ A;  2IFQ B;  1B48 A;  4O7H A;  4EKZ A;  1T4Z A;  1BG1 A;  3F6D A;  5KEJ A;  4YKF A;  1XVW A;  6GSW A;  2GS3 A;  2IMI A;  2IWT A;  1F37 A;  1FG4 A;  3TKR A;  4EIQ A;  2C80 A;  4MLY A;  2GTU A;  1J9B A;  2B5X A;  2O87 A;  3KCM A;  3W6G A;  4POL A;  3A2X A;  3L9S A;  2LJR A;  4EE0 A;  2ZNM A;  2HSN B;  5J40 A;  2AV4 A;  3A2W A;  4NXI A;  1FW1 A;  1AXD A;  2RM6 A;  2C0E A;  3KMN A;  6GSY A;  5KN2 A;  3EPT A;  2HSH A;  2HSM A;  2E2M A;  5KOW A;  1PL1 A;  5ID2 A;  5AIX A;  3HZ4 A;  2B3S A;  3IC8 A;  3L4N A;  5BMU A;  1DUG A;  3N5O A;  2CV4 A;  5ECH B;  2F3M A;  4GQF A;  4K2X A;  1GSS A;  5G31 A;  5A4U A;  2WDU A;  4L0W A;  4GTU A;  3A2V A;  3E3E A;  1OC3 A;  4KDU A;  3G9B A;  4AJ8 A;  5DAL B;  4N0Z A;  5D93 A;  1T00 A;  2R6K A;  4K1F A;  5ECM B;  3GFK A;  4KDY A;  1A8L A;  1XZO A;  2WS2 A;  4IVF A;  1T3B A;  4TR4 A;  3A3T A;  1GLQ A;  4NHW A;  2YWI A;  2YNX A;  3TJB A;  1V98 A;  4PQ1 A;  3ZIJ A;  5IQY A;  4K8M A;  1YVL A;  3TRQ A;  4FYU A;  4N0V A;  3HYP A;  1EV9 A;  1V9W A;  4KCE A;  5HFK A;  3MNG A;  4POB A;  2DC5 A;  3UJ1 A;  4PNF A;  4GDF A;  5FWG A;  1T4Y A;  2IFQ A;  5AGY A;  4TW5 A;  3FKF A;  2VL2 A;  5B6M A;  1SK2 A;  1WJK A;  4K7N A;  3HMJ G;  4IN0 A;  1THX A;  1X5C A;  1RQM A;  1V40 A;  4PUA A;  3KTB A;  3KTL A;  2GZY A;  1QFN A;  1ZOF A;  14GS A;  2GDR A;  2YZU A;  3UBK A;  3WYW A;  2GST A;  4ZB7 A;  3P2A A;  4AKX B;  1UN2 A;  2HSY A;  1R4W A;  2K8S A;  3APQ A;  1JZW A;  1SJZ A;  2RLI A;  2HYX A;  2H0H A;  4ID0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...