4ID0A

Crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900011, with bound glutathione sulfinic acid (gso2h) and acetate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
204
structure length
204
Chain Sequence
SLTLFHNPASPYVRKVMVLLHETGQLNRVALQASQLSPVAPDAALNQDNPLGKIPALRLDNGQVLYDSRVILDYLDQQHVGNPLIPRDGSARWRRLTLAALADGIMDASVLVRYELALRAPEKHWEQWLDGQRDKIRRALAVLEAEAIAELASHFDIAAISVACALGYLDFRHPDLEWRQDHPQLAAWYFEISQRPSMLATRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a glutathione transferase family member from Pseudomonas fluorescens Pf-5, target EFI-900011, with bound glutathione sulfinic acid (gso2h) and acetate
rcsb
source organism Pseudomonas fluorescens
molecule tags Transferase
molecule keywords Glutathione S-transferase-like protein YibF
total genus 65
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4id0A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4id0A01
1SJZA 2OJLA 3F9UA 3LGCA 1B9XC 2RUEA 4EDZA 2MYGA 3CYNA 5GZZB 1YEPA 3WYWA 2YZUA 1I5GA 3ZIVA 1M2BA 4D73B 2P31A 4P3YB 5G2ZA 5D96A 1R5AA 2EC4A 4ECIA 2Z9SA 1K0DA 1E2YA 1XIYA 1IYHA 1ZYQB 3LXZA 4HQSA 5G1LA 4MABA 2NBSA 4KDYA 3EYTA 2QC7A 3D21A 3CTFA 2YN1A 1VF4A 2VD1A 3GKXA 4G19A 3FEUA 2DBCA 2NVLA 3IK7A 2L5LA 2VLUA 3A5WA 3P90A 1R4WA 1FG4A 3CSIA 3RDWA 2TRCP 4KNDA 5GAND 2YWOA 3UAPA 3EMXA 4ZIJA 3GL3A 3IR4A 3BOAA 3TB2A 1SD8A 2WDUA 2HZEA 5DJMA 2KLXA 2HRFA 3FZ5A 1YEXA 3ZMKA 5LCZA 4AJ7A 4ZBBA 4V2NA 3BJ5A 4NPBA 2FHEA 3PH9A 1UA5A 2DMMA 1G6WA 1YKCA 1T4ZA 4IP1A 1WIKA 2PU9C 4WBJA 3U6VA 2H66A 2H1DA 3F3QA 4HU9A 4WEYA 3TKRA 4BWQA 2ZCTA 4O5RA 3S9FA 3I9V2 2TRXA 1IYIA 2ALBA 3D6IA 4EXJA 3MDKA 3LXTA 4K1FA 4KA0A 5A5KA 4G0KA 1A2LA 3IK9A 5J3RA 5DDLA 1R26A 1XWCA 1ERUA 1F2EA 1FVJA 2OBIA 3VK9A 1GTUA 4WETA 4K0GA 2N5BA 2CVKA 5AGYA 3M9KA 1T8EB 1H4OA 4KH7A 2DJ0A 1F3BA 1BEDA 3EU4A 3KJYA 3KZQA 5G1KA 4K8MA 2JSYA 4MMMA 3OR5A 3G9BA 1Y6EA 3FR3A 2GZPA 3TKSE 4ZB9A 2F9SA 2B5XA 5HR3A 1MD3A 2HQTA 1JFUA 4KW6A 2FCHA 4N10A 1TI1A 2CV4A 2H72A 2QGVA 2YJHA 3P8WA 2GSSA 3APSA 2XC2A 5DALB 4PQIA 10GSA 1WOUA 4N0ZA 4MH2A 3H4KA 4OFMA 1NHOA 3QOUA 4BL7B 1NW2A 2VIMA 6GSXA 2CVBA 2IMFA 5IPGA 2MMNA 1K0BA 1PGTA 4ZL9A 5COHA 2H19A 5D9WA 3GN3A 1SENA 1QK8A 3F6FA 2LQOA 5LNKe 3UIWA 2HYXA 3GKMA 1WP0A 3APQA 2GSRA 2IN3A 1PX7A 5L71A 2PMTA 1WWJA 3UOMA 1TTZA 4CHSA 4LA1A 1TRWA 2LRNA 3FW2A 1JZDA 3CRUA 1XBSA 2L5OA 2I1UA 3C8EA 1Y25A 1YF0A 1QQ2A 4MH3A 4QL7A 3VI7A 5IMFA 3KM6A 4OFNA 1EEMA 2B6MA 5ECMB 3IA1A 2H75A 2B5EA 4KUNA 1OC3A 6GSWA 1SL2B 2B5YA 2FNOA 5DBQA 5J9BA 1G7EA 3O76A 3GH6A 4FYCA 4ZL8A 2X8CA 3M9JA 2H1BA 3IAM2 3GYKA 1ZZYA 3FYGA 2DIYA 3KH7A 2CA8A 1F37A 1XOBA 3CBUA 4ACSA 4HDEA 4TW5A 3R3EA 4V2MA 5D93A 3K8NA 3A3TA 3DVXA 3F6DA 4HU7A 4HQZA 2VLVA 2WRTA 4YH2A 1V9WA 2LEGA 4POLA 4L0WA 3EURA 2OBKA 2PWJA 4JE1A 4MJBA 3G7JA 3G7YA 3TKPA 2DJKA 1OE7A 1X5CA 1XPVA 4TR1B 1G0TA 2P5RA 4YQUA 4AGSA 3TRXA 5CP1A 2EIQA 3BD2A 2H1GA 1JLVA 4X1UA 3KCMA 1GH2A 5DALA 4WR5A 4KSOA 3DMLA 5J9CA 2PGTA 1A8YA 4TXOA 5HFGA 2A2SA 3NOFA 2HRAA 3FY7A 2DSAA 3VURA 2H0HA 4ZBAA 3ZVJD 1DE1A 1T00A 3GKKA 1M9AA 3HXSA 2F8AA 4PUAA 1PKWA 1O85A 2WULA 1X0RA 1ERTA 4O92A 5IOXA 2B7KA 1M99A 1EZKA 2DMLA 5F0GA 1O81A 3CRTA 2L57A 3LSZA 3C7MA 2JU5A 5IO2A 22GSA 4FYBA 1X5EA 4POKA 3ZRDA 2WS2A 3DXBA 2PBJA 1A23A 3GRXA 2P0GA 1YKAA 1SK0A 1SJIA 1KNGA 2VD0A 3HD5A 3WD6A 1T4YA 2MMOA 1Z7RA 5LD0A 6GSTA 5HR0A 2H73A 1XOAA 1FVKA 3M0FA 3RHCA 4G10A 1BQ7A 3L9VA 4JZQA 1ABAA 1SKSB 2HRNA 3Q74A 2C3QA 2YWIA 3GV1A 4POMA 3KMNA 2OACA 5HQPA 1WE0A 1SK2A 4XRAA 4PUFC 1K0CA 4X43A 3I69A 5CO3A 2GT6A 5H5RA 2IMKA 3WT1A 1B48A 4WBRD 3RAZA 1U88A 3EE2A 3VPTA 4RI7A 1PX6A 1VGLA 3O6TA 3GUSA 2TIRA 2R3XA 2OE1A 5HR1A 1XW6A 3F3RA 4LLRA 1M2AA 1RW1A 4TVEA 4ZBDA 1EGRA 4Q5RA 2YWMA 3D0ZA 1U3IA 2QSIA 1TRUA 2LKUA 2R37A 4NAXA 2CT6A 3HJMA 4EC0A 3EC3A 2VL2A 4RI6A 4O7HA 1SD9A 5IPHA 3A2XA 3F63A 4FH8A 1V2AA 4JU5A 3APOA 2O87A 3GFKA 2WJUA 2LS5A 1T7PB 3MSZA 2IFQA 2RM6A 4ZB6A 2NPBA 3GSTA 1U87A 1TOFA 2M46A 5IMVA 4XS4B 5J4UA 4IN0A 4G0LA 3UJ1A 3D4MA 4XHMA 4XS1A 1OVNA 3IDVA 5ECRB 4QL9A 3ED3A 5G31A 6GSYA 3G7IA 4K7IA 2J9HA 2VOCA 2GGTA 2GZYA 1YQ1A 4TR3A 3JCML 1QUWA 2BMXA 2O7KA 3QFAC 2YNXA 1EWXA 5FHIA 1O6JA 4ZXGA 5IMAA 1A8LA 4NXIA 4G2EA 2WB9A 1X5DA 3QPMA 2AAWA 2JADA 4I97A 1TK0B 2HSHA 5JWOB 2YWNA 3V1WA 1QFNA 5F07A 3HA9A 2XBQA 2DJJA 3FZAA 2FWFA 4HJ2A 5H5QA 4WF5A 2GLRA 1JZRA 5A4WA 1GTIA 5J5NA 4OD7A 1OAZA 2E7PA 2F3MA 4TXVA 4ZILA 4HOJA 1GSDA 3M1GA 1R5PA 2DJ1A 1SYXA 1EP8A 4GF0A 4FYUA 4E8EA 4AF2A 2FUG2 4F9ZA 4K7OA 3EU3A 3TKQA 5HFIA 4LMWA 5H5SA 1MTCA 5IQYA 1EOHA 4BA7A 3HKRA 3WGEA 5IMZA 3FKFA 2XPDA 1AQVA 1GSQA 1E6BA 1TXXA 3ZYWA 2IIYA 2PVOC 3H93A 1BX9A 1ZCPA 1AUCA 5D9XA 3MWHA 5ECSA 4JR6A 3IE3A 1GSYA 4OFTA 1SKWB 1TI3A 2VCTA 5CNWA 1M7TA 2H6ZA 2MBTA 3KXOA 2FLSA 4TN8A 2C8UA 1O73A 2FA4A 4XTSA 1S3CA 3ZTLA 5B6MA 4KDXA 4ML6A 4HJMA 4FO5A 3GTUA 2DJ2A 3R2QA 3A2WA 4V1Ap 2UZ8A 3KMOA 1FB6A 5ECKB 20GSA 4V2LA 4MDCA 1K0NA 3C1RA 2VCQA 3MNGA 4IP6A 4MPGA 5JWQB 1JZWA 4V1Ag 4OWYA 1BJXA 3KD0A 3HDCA 1S3AA 2F51A 1OKTA 1WJKA 3H1NA 1A0FA 1N2AA 5AISA 2OA7A 4DSSB 2DC5A 1ZOFA 4JEDA 1CQGA 1GLPA 2C0FA 1HNBA 1GSEA 3FZ4A 4OO4A 5ID2A 4O32A 1Z6NA 3NZNA 1KEBA 4KE3A 2A4VA 1EP7A 5ELAA 3FK8A 4L8EA 2LJRA 4TR1A 4MZCA 1B8XA 2GQLA 1WPIA 2PPTA 5F06A 4F03A 3TGZA 3ERWA 3D5JA 4AJ6A 4ISDA 1W4VA 3M8NA 1XWAA 1PL1A 2C80A 2L59A 3HY2A 1TRVA 2VCXA 1X9SB 1XVQA 1URMA 1M2DA 1PD21 1Z7PA 3Q18A 5ECQB 3W8JA 1RQMA 2LRCA 2KHPA 2YP6A 1S3DA 1AQWA 1MDJA 3CMIA 3SWLA 3ERGA 1PRXA 1EV9A 2VM1A 3UBKA 2I3YA 2CAQA 2X99A 4IHUA 14GSA 5HFKA 3N9JA 2H70A 4YAVA 3LJRA 3DGQA 1BG5A 1XWKA 1DE2A 3C1SA 2K8VA 2YV7A 5DCHA 4GQCA 4OO5A 5AN1A 4TXOB 1AW9A 2RUFA 1V40A 3TOTA 3PPUA 4MZWA 3IV4A 1F3AA 2ZUPA 5J41A 4MPFA 1PMTA 2V32A 4XIHA 2PUKC 3TRQA 3C71A 3VWVA 5DCGA 1AIUA 13GSA 1K0OA 1TKDB 3DKSA 1QMVA 4KCAA 4LL1B 4RQRA 1DBYA 2N5AA 1GWCA 1AC1A 1A2MA 1NM3A 4MJCA 4N11A 5JCWA 1ML6A 5E59A 4K0NA 1Q4JA 2HSYA 2RLIA 2V6OA 6GSVA 3GNJA 1VRSD 2YOIA 2O85A 2G0FA 3GURA 4TRXA 4RQXA 3WGDA 2HSMB 3UEMA 3PR8A 2R2JA 2L4CA 2JACA 3MAKA 3GH9A 4PQ1A 1YJ6A 2PVQA 3FZ9A 1TDIA 1THOA 3F4RA 1SL1B 1VF3A 3ME8A 3LQ7A 2IMIA 4F0BA 2OADA 3W6GA 3IOSA 2IMEA 3J7Yb 3KP8A 5DJLA 4KX4A 5D9VA 3TJGA 4HUAA 3HVXA 2VAFA 2WFCA 2X64A 2LTKA 5B8BA 1KBNA 1FHEA 1Z6MA 4IELA 1HNAA 1PKZA 1TP9A 1G6YA 1MDKA 2GTUA 3GMFA 5ABRA 2VCWA 2C1YA 4J56E 3LYPA 2F8FA 4BWSA 1OC9B 1TRSA 2DIZA 5F8BA 4D73A 3VPQA 7GSSA 4ECJA 1ST9A 1TW9A 4IVFA 5GSSA 4RUVA 2H6XA 1FAAA 3FR6A 2BJXA 4IBPA 4DSQA 1MD4A 5GSTA 3GIXA 3IC4A 4NMUA 1GUHA 3NIVA 5ENUA 1PSQA 4PXOA 2ES7A 1XFLA 5D8IA 1OC9A 2CZ2A 5IMDA 1ERWA 2CVDA 2HFDA 1OKDA 1V58A 5EVOA 4MCUA 5ELGA 4HS1A 4KF9A 4PQHA 1OYJA 1V98A 5B8AA 1HYUA 1PL2A 4Q5QA 12GSA 2GQKA 1B9YC 1BAYA 5ECLB 3WGXA 2L6CA 2H8LA 4DEJA 1GULA 4I8BA 2IFQB 3ME7A 2VM2A 3RHBA 2FD3A 2QKEA 3WT2A 4GLTA 3IAS2 2BTOT 2FGXA 4IQAA 2I81A 2O89A 5IIZA 2LV3A 4PNFA 4L0UA 2R4VA 3DD3A 4BL7A 1TK8B 5ECOB 2MMAA 2I9HA 2MMZA 2JZTA 4YQVA 3LYKA 1XW9A 2FA8A 4OMVA 2KP1A 1KTEA 3ERFA 1U3AA 5CRGA 2HZEB 1LU4A 4MF5A 3E3EA 2C3TA 2GDRA 2GZZA 3TJBA 3GX0A 2XHFA 3IXRA 5IO0A 3SBCA 1J08A 2H01A 3TJKA 2HNLA 1SKRB 4DSSA 3ZL5A 2IMDA 3RBTA 4EO3A 1G7OA 2JZSA 6GSSA 3CSHA 3H8QA 3KTLA 2B1KA 3VWUA 1HNCA 2V41A 3P7XA 1GP1A 5G30A 3GA4A 4LL4B 3TCOA 2FWGA 4KGIA 1K3YA 3QD9A 4N30A 3TJFA 4GSNA 3L9SA 4NV2A 4EVMA 1O7UA 4MJEA 3KP9A 2GQMA 2CQ9A 4BVXB 1ZYEA 1M0UA 1GNEA 3BBYA 4MP4A 2XBIA 2LQQA 1OE8A 3TJJA 1HD2A 1SYRA 3Q6OA 1ZGNA 3N5OA 1GL8A 4F2IA 1SU9A 5KEJA 1O8XA 2LJKA 4BVXA 3US3A 2GSQA 1FOVA 1EOGA 5IOWA 2OE0A 4ZL7A 3I6AA 2ON7A 3TRPA 4K2DA 4ULXA 2C0DA 4GXZA 4GQFA 3Q19A 1ERVA 3CTGA 2WGRA 3ZZXA 1AQXA 2FWEA 1ZMAA 1RK4A 4YQMA 2XPEA 4L5OA 4I5QA 3VI5A 2M72A 1NSWA 4PNGA 3VFIA 2YPMA 4EDYA 2X8GA 2CAIA 3TKSA 1GTAA 1MDIA 4MF6A 3ISOA 2YJ7A 1M9BA 1K3LA 2JZRA 4Z7XA 5IMCA 4FIWA 1ILOA 3GHAA 4QQ7A 3RPPA 1TK5B 1UC7A 2H74A 3ZIJA 5EY6A 2O8VB 4AJ8A 1C72A 3KGKA 2V2GA 3KIJA 9GSSA 3TKSC 1T1VA 2VLTA 1EGOA 5E4WA 2WCIA 2AJQB 4K6XA 3QFBC 4KDUA 4EKZA 4I6XA 1HQOA 2I4AA 1CQHA 4IJIA 1JLWA 3PINA 5AIVA 1A2JA 2VCZA 1GUKA 1QGVA 5BMUA 4PURA 2ON5A 4MA9A 1B4PA 2HI7A 1R7HA 3L0HA 3AY8A 3M3MA 3QR6A 5FWGA 1WRYA 1T3BA 2J23A 1UN2A 5DQYA 2DJ3A 2RIIA 1O8WA 4IS0A 1F6MC 1XW5A 4HI7A 3D22A 4EE0A 3UBLA 2KOKA 2H1AA 4EL1A 1PA3A 2E2GA 4L5LA 3EMPA 2AHEA 5JWRB 4DVCA 3EVIA 2H30A 5A4VA 2E0QA 3W8SA 2HT9A 2LUSA 4ILFA 3P2AA 4OCFA 2GT5A 2FWHA 5C00A 2WZ9A 3L4NA 3DWVA 3VWWA 2AB6A 3LORA 4I2UA 2OKAA 3QMXA 2HSMA 3VWXA 3TUEA 3QAVA 3KH9A 3GSSA 5DQSA 3U5RE 5HR2A 4G0IA 3TOUA 1K0MA 3IC8A 1V57A 4WXTA 3ZMLA 1VF2A 1GLQA 2NDOA 3EWLA 4BVYA 5ECHB 3E0UA 4WR4A 4IKHA 4IW9A 3UL3A 2IPAA 3A2VA 3GX8A 3L9UA 2CX3A 1PN9A 2MZCA 2VL3A 1QXHA 3HZ8A 1K0AA 4Q5NA 2OE3A 3F4TA 1GSFA 1USBA 4MLYA 3RPNA 2R5GA 4F0CA 4K9ZA 2V1MA 5IM9A 19GSA 1YZXA 2R6KA 1YF1A 2AYTA 2H0GA 1JZOA 4J57E 3HHVA 4HEA2 3HJOA 4USSA 4EUYA 3QAGA 3PGTA 4XRDA 2HLSA 1XZOA 4MJAA 5B6NA 2HRKB 2E2MA 3DIEA 3TDGA 2V6KA 1H75A 4CW9A 3BCKA 1ACVA 1FO5A 4X0XA 2HXKA 3LG6A 5C04A 4MZBA 1DSBA 4HZ4A 3IHQA 4OCEA 5B7CA 2M80A 2VO4A 2H6YA 2KP2A 3UMAA 4ZB8A 3GKNA 3CSJA 1JHBA 1J9BA 5KN3A 2CX4A 2C4JA 1OC8A 1ON4A 5DVBA 3UARA 4ID0A 2HZFA 4H86A 3ZITA 1GTBA 2RM5A 3ZVJA 4YAPA 5D9TA 17GSA 4XS6A 4GSSA 3IPZA 4TR0A 1EV4A 2LJAA 5A4UA 3HZ4A 1EEJA 3ZREA 2GSTA 2EIOA 2K6VA 1GSUA 1AXDA 4LMVA 2IJYA 5DAKA 1K3OA 3H79A 1GRXA 4KAEA 3F0IA 4JRRA 2B1LA 4NWYA 1TU8A 5EL8A 2YANA 1XVWA 2JSZA 5ECIB 5ECNB 1LBKA 4K7NA 1GSSA 3ZLPA 3HVSA 1SJ6A 2HRKA 3LFLA 2DLXA 3ZFLA 2B7JA 1Z5YE 2K9FA 1NHYA 4NHWA 1YY7A 1J0FA 1BYEA 5G5EA 1TJDA 1SK1A 5ID2B 4ML1A 5CRWA 3E9JB 4HZ2A 4E8HA 1ZL9A 2IWTA 3KTBA 1XCCA 2VUPA 3O3TA 3VLNA 1A0RP 1A24A 1I9DA 1AAZA 4GTUA 4WF4A 1XXUA 4ECCA 5CRHA 3QCPA 3GTUB 2VL9A 2MBSA 2C0GA 4F82A 2AV4A 4I2TA 5ECPB 4XCSA 2D2ZA 2A2RA 4BVYB 2LSTA 3HVVA 3HYPA 2P5QA 4IJ3A 2H76A 2YV9A 4BPYA 2ZNMA 1DUGA 2YCDA 2FY6A 2L4QA 5CAXA 3QDNA 3CXGA 2GVPA 4IQ1A 1TU7A 5KN1A 5KN2A 4KSMA 2AUVA 3LEFA 2YZHA 1X9MB 3LWAA 2H71A 18GSA 3IBHA 3QAWA 1W89A 2CZ3A 4N0VA 5JCGA 4PGTA 4TR4A 4FQUA 4NV5A 4NHZA 2L6DA 1Q98A 1Z9HA 5CRDA 4EF0A 1GUMA 1Z3EA 2H0IA 2VCVA 3FHKA 2PERA 3DVWA 2NTOA 3F8UA 1THXA 3UVTA 5INYA 2LNTA 4GRFA 4DSRA 4GCIA 4WKWA 5JCUA 5EPFA 2K8SA 1B4QA 2VL2C 5D73A 1U6TA 1XWBA 4IGJA 4TKYA 1UVZA 2KUCA 3FR9A 4KB3A 5KN0A 4TOPA 4ECBA 4KCEA 2G2QA 5AIXA 16GSA 1GNWA 4PX1A 1XWGA 3DRNA 3I43A 4POBA 5F05A 4J2FA 3FRCA 8GSSA 4GWRA 4JBBA 5G5FA 3IRAA 4PTSA 2PN8A 5FT3A 3GL5A 1YDKA 3DYRA 3UVHA 4GSTA 3KEBA 2C0EA 2REMA 1MEKA 3HCZA 1VF1A 1PQNA 3BCIA 4JR4A 1SL0B 1LJRA 4Q5FA 1N8JA 6GSUA 2JL4A 5DAKB 3C73A 3D4TA 3J7Yk 3HJPA 5GAPD 1WMJA 3F4SA 1F9MA 2LRTA 3DEXA 2B3SA 2IL3A 4XS4A 2X8HA 4MF7A 2C3NA 2HE3A 1X9WB 1FB0A 4MK3A 3ZFBA 2K18A 2HSNB 4CDOA 2N5FA 2GS3A 5CYYA 2LNSA 3L78A 3EINA 4G9HA 11GSA 5CREA 1FW1A 2EIRA
chains in the Genus database with same CATH superfamily
1SJZA 2OJLA 3F9UA 3LGCA 1B9XC 2RUEA 4EDZA 2MYGA 3CYNA 5GZZB 5KOXA 1YEPA 3WYWA 2YZUA 1I5GA 3ZIVA 1M2BA 4D73B 2P31A 4P3YB 5G2ZA 5D96A 1R5AA 2EC4A 4ECIA 2Z9SA 1K0DA 1E2YA 1XIYA 1IYHA 1ZYQB 3LXZA 4HQSA 5G1LA 4MABA 2NBSA 4KDYA 3EYTA 4EIPA 2QC7A 3D21A 3CTFA 2YN1A 1VF4A 2VD1A 3GKXA 4G19A 3FEUA 2DBCA 2NVLA 3IK7A 2L5LA 2VLUA 3A5WA 3P90A 1R4WA 1FG4A 3CSIA 3RDWA 2TRCP 4KNDA 5GAND 2YWOA 3UAPA 3EMXA 4ZIJA 3GL3A 3IR4A 3BOAA 3TB2A 1SD8A 2WDUA 2HZEA 5DJMA 2KLXA 2HRFA 3FZ5A 1YEXA 3ZMKA 5LCZA 4AJ7A 4ZBBA 4V2NA 4AKGA 3BJ5A 4NPBA 2FHEA 3PH9A 1UA5A 2DMMA 2R0PA 1G6WA 3CQFA 1YKCA 1T4ZA 2EFDA 1WIKA 1XG8A 2PU9C 4IP1A 4WBJA 3U6VA 2H66A 2H1DA 3F3QA 4HU9A 4WEYA 3TKRA 4BWQA 2ZCTA 4O5RA 3S9FA 3I9V2 2TRXA 1IYIA 2ALBA 3D6IA 4ICYA 4EXJA 3MDKA 3LXTA 4K1FA 4KA0A 3A5IA 5A5KA 4G0KA 1A2LA 3IK9A 5J3RA 5DDLA 1R26A 1XWCA 1ERUA 1F2EA 1FVJA 2O3EA 3VK9A 2OBIA 1GTUA 4WETA 4K0GA 2N5BA 2CVKA 5AGYA 3M9KA 1T8EB 1H4OA 4KH7A 2DJ0A 1F3BA 1BEDA 3EU4A 3KJYA 3KZQA 5G1KA 4K8MA 2JSYA 4MMMA 3OR5A 3G9BA 1Y6EA 3FR3A 2GZPA 3TKSE 4ZB9A 2F9SA 2B5XA 5HR3A 1MD3A 2HQTA 1JFUA 4KW6A 2FCHA 4N10A 1TI1A 2CV4A 2H72A 2QGVA 2YJHA 3P8WA 2GSSA 3APSA 2XC2A 5DALB 4PQIA 10GSA 1WOUA 4N0ZA 4MH2A 3H4KA 4OFMA 1NHOA 3QOUA 4BL7B 1NW2A 2VIMA 2X49A 6GSXA 2R0GA 2CVBA 2IMFA 5IPGA 2MMNA 1K0BA 1PGTA 4ZL9A 5COHA 2H19A 5D9WA 3GN3A 1SENA 1QK8A 3F6FA 2LQOA 5LNKe 3UIWA 2HYXA 3GKMA 2VKZG 1WP0A 3APQA 2GSRA 2IN3A 1PX7A 5L71A 2PMTA 1WWJA 3UOMA 1TTZA 4CHSA 4LA1A 1TRWA 2LRNA 3FW2A 1JZDA 3CRUA 1XBSA 2L5OA 2I1UA 3C8EA 5A1NB 1Y25A 1YF0A 1QQ2A 4MH3A 4QL7A 3VI7A 5IMFA 3KM6A 4OFNA 1EEMA 2B6MA 5ECMB 3IA1A 2H75A 2B5EA 4KUNA 1OC3A 2EFHA 6GSWA 1SL2B 2B5YA 2FNOA 5DBQA 5J9BA 1G7EA 3O76A 3GH6A 4FYCA 4ZL8A 2X8CA 3M9JA 2H1BA 3IAM2 3GYKA 5A1NA 1ZZYA 3FYGA 2DIYA 4A5PA 3KH7A 2CA8A 1F37A 1XOBA 3CBUA 4ACSA 4HDEA 4TW5A 3R3EA 4V2MA 5D93A 3K8NA 3DVXA 3A3TA 3F6DA 4HU7A 4HQZA 2VLVA 2WRTA 4YH2A 1V9WA 2LEGA 4POLA 4L0WA 3EURA 2OBKA 2PWJA 4JE1A 4MJBA 3G7JA 3G7YA 3TKPA 2DJKA 1OE7A 4AKHA 1X5CA 2WW3A 1XPVA 4TR1B 1G0TA 2P5RA 4YQUA 4AGSA 3TRXA 5CP1A 2EIQA 3BD2A 2H1GA 1JLVA 4X1UA 3KCMA 1GH2A 5DALA 4WR5A 4KSOA 3DMLA 5J9CA 2PGTA 1A8YA 4TXOA 5HFGA 4Z2UA 2A2SA 3NOFA 2HRAA 1N25A 3FY7A 2DSAA 3VURA 2H0HA 4ZBAA 3ZVJD 1DE1A 1T00A 3GKKA 1M9AA 3HXSA 2F8AA 4PUAA 1PKWA 1O85A 1S4BP 5J40A 2WULA 1X0RA 1ERTA 4O92A 5IOXA 2B7KA 1M99A 1EZKA 2DMLA 5F0GA 1O81A 3CRTA 2L57A 3LSZA 3C7MA 2JU5A 5IO2A 22GSA 4FYBA 1X5EA 4POKA 3ZRDA 2WS2A 3DXBA 2PBJA 1A23A 3GRXA 2P0GA 2R0CA 1YKAA 1SK0A 1SJIA 1KNGA 2VD0A 3HD5A 3WD6A 1T4YA 2MMOA 1Z7RA 5LD0A 6GSTA 5HR0A 2H73A 1XOAA 5A34B 1FVKA 3M0FA 3RHCA 4G10A 1BQ7A 3L9VA 4JZQA 1ABAA 1SKSB 2HRNA 3Q74A 2C3QA 2YWIA 3GV1A 4POMA 3KMNA 2OACA 5HQPA 1WE0A 3FMWA 4YKGA 1SK2A 4XRAA 4PUFC 1K0CA 4X43A 3I69A 2WZSA 5CO3A 2GT6A 5H5RA 2IMKA 3WT1A 1B48A 4WBRD 3RAZA 1U88A 2O36A 3EE2A 4YKFA 3VPTA 4RI7A 1PX6A 1VGLA 3O6TA 3GUSA 2TIRA 2R3XA 2OE1A 5HR1A 1XW6A 3F3RA 4LLRA 1M2AA 1RW1A 4TVEA 4ZBDA 1EGRA 4Q5RA 2YWMA 3D0ZA 1U3IA 2QSIA 1TRUA 2LKUA 2R37A 4NAXA 2CT6A 3HJMA 4EC0A 3EC3A 2VL2A 4RI6A 4O7HA 1SD9A 5IPHA 3A2XA 3F63A 4FH8A 1V2AA 4JU5A 3APOA 2O87A 3GFKA 2WJUA 2LS5A 1T7PB 3MSZA 2IFQA 2RM6A 4ZB6A 2NPBA 3GSTA 1U87A 1TOFA 2M46A 5IMVA 4XS4B 5J4UA 2A4HA 4IN0A 4G0LA 3UJ1A 3D4MA 4XHMA 4XS1A 1M3IA 1OVNA 3IDVA 4E68A 1TXUA 5ECRB 4QL9A 3ED3A 5G31A 6GSYA 3G7IA 4K7IA 1PN0A 2J9HA 2VOCA 2GGTA 2GZYA 1YQ1A 4TR3A 3JCML 1QUWA 2BMXA 2O7KA 3QFAC 2YNXA 1EWXA 4CY8A 5FHIA 1O6JA 4ZXGA 5IMAA 1A8LA 4NXIA 4G2EA 2WB9A 1X5DA 3QPMA 2AAWA 2DKHA 2JADA 4I97A 1TK0B 2HSHA 5JWOB 2YWNA 3V1WA 1QFNA 5F07A 3HA9A 2XBQA 2DJJA 4AKIA 3FZAA 2FWFA 4HJ2A 5H5QA 4WF5A 2GLRA 1JZRA 5A4WA 1GTIA 5J5NA 4OD7A 4G01A 1OAZA 2WW1A 2E7PA 2F3MA 4TXVA 4ZILA 4HOJA 1GSDA 3M1GA 1R5PA 2DJ1A 1SYXA 1EP8A 4GF0A 4FYUA 4E8EA 4AF2A 1ZYPA 2FUG2 5J47A 4F9ZA 4K7OA 3EU3A 3TKQA 5HFIA 4LMWA 5H5SA 1MTCA 2X4AA 5IQYA 1ZYNA 1EOHA 4BA7A 3HKRA 3WGEA 5IMZA 3FKFA 2XPDA 3IHGA 1AQVA 1GSQA 1E6BA 1TXXA 3HVNA 3ZYWA 2IIYA 2PVOC 3H93A 1BX9A 1ZCPA 1AUCA 5D9XA 3MWHA 5ECSA 4JR6A 3IE3A 1GSYA 4OFTA 1SKWB 1TI3A 2VCTA 5CNWA 1M7TA 2H6ZA 2MBTA 3KXOA 2FLSA 4TN8A 2C8UA 1O73A 2FA4A 4XTSA 4W66A 1S3CA 1SVLA 3ZTLA 5B6MA 4KDXA 4ML6A 4HJMA 4FO5A 3GTUA 2DJ2A 5J4YA 3R2QA 3A2WA 4V1Ap 2UZ8A 3KMOA 4PI0C 1FB6A 5ECKB 20GSA 4V2LA 4MDCA 1K0NA 3C1RA 2VCQA 3MNGA 4IP6A 4MPGA 5JWQB 1JZWA 4V1Ag 4OWYA 1BJXA 3KD0A 3HDCA 1S3AA 2F51A 1OKTA 1WJKA 3H1NA 1M3JA 1A0FA 1N2AA 5AISA 2OA7A 4DSSB 2DC5A 1ZOFA 4JEDA 1CQGA 1GLPA 2C0FA 1HNBA 1GSEA 3FZ4A 4OO4A 5ID2A 4O32A 1Z6NA 3NZNA 2H1LA 1KEBA 5BRTA 4KE3A 2A4VA 2WVZA 4AKXB 4ZB7A 1EP7A 5ELAA 3FK8A 4L8EA 4Z2RA 2LJRA 4TR1A 4MZCA 1B8XA 2GQLA 1WPIA 2PPTA 5F06A 2QA1A 4F03A 3TGZA 3ERWA 3D5JA 4AJ6A 4ISDA 1W4VA 3M8NA 1XWAA 1PL1A 2C80A 2L59A 3HY2A 1TRVA 2VCXA 1X9SB 1XVQA 1URMA 1M2DA 1PD21 1Z7PA 3Q18A 5ECQB 3W8JA 1RQMA 2LRCA 2KHPA 2YP6A 4FXYP 1S3DA 1AQWA 1MDJA 3CMIA 3SWLA 3ERGA 1PRXA 1EV9A 2VM1A 3UBKA 2I3YA 2CAQA 2X99A 4IHUA 14GSA 5HFKA 3RGBC 3N9JA 2H70A 4YAVA 3LJRA 3DGQA 1BG5A 1XWKA 1DE2A 3C1SA 2K8VA 2YV7A 5DCHA 4GQCA 4OO5A 5AN1A 4TXOB 1AW9A 2RUFA 1V40A 3TOTA 3PPUA 4MZWA 3IV4A 1F3AA 2ZUPA 5J41A 4MPFA 1PMTA 2V32A 4XIHA 2PUKC 3TRQA 3C71A 3VWVA 5DCGA 1AIUA 13GSA 1K0OA 1TKDB 3DKSA 1QMVA 4KCAA 4LL1B 4RQRA 1DBYA 2N5AA 1GWCA 1AC1A 1Y1UA 1A2MA 1NM3A 4MJCA 4N11A 5JCWA 1ML6A 5E59A 4K0NA 1Q4JA 2HSYA 2RLIA 2V6OA 6GSVA 3GNJA 1VRSD 2YOIA 2O85A 2A2PA 2G0FA 3GURA 4TRXA 4RQXA 3WGDA 2HSMB 3UEMA 3PR8A 2R2JA 2L4CA 2JACA 3MAKA 3GH9A 4PQ1A 1YJ6A 2PVQA 3FZ9A 1TDIA 1THOA 3F4RA 1SL1B 1VF3A 3ME8A 3RFRC 3LQ7A 2IMIA 4F0BA 2OADA 3W6GA 3IOSA 2IMEA 3J7Yb 3KP8A 5DJLA 4KX4A 5D9VA 3TJGA 4HUAA 3HVXA 2VAFA 2WFCA 2X64A 2LTKA 5B8BA 1KBNA 1FHEA 1Z6MA 4IELA 2WVXB 4K2XA 1HNAA 1PKZA 1TP9A 1G6YA 1MDKA 2GTUA 3GMFA 5ABRA 2VCWA 2C1YA 4J56E 3LYPA 2UV8G 2F8FA 4BWSA 1OC9B 1TRSA 2DIZA 5F8BA 4D73A 3VPQA 7GSSA 4ECJA 1ST9A 1TW9A 4IVFA 1FOHA 5GSSA 4RUVA 2H6XA 1FAAA 3FR6A 2BJXA 4IBPA 4DSQA 1MD4A 5GSTA 3GIXA 3IC4A 4NMUA 1GUHA 2WVYA 3NIVA 5ENUA 1PSQA 4PXOA 2ES7A 1XFLA 4HSCX 5D8IA 1OC9A 2CZ2A 5IMDA 1ERWA 2CVDA 2HFDA 1OKDA 1V58A 5EVOA 4MCUA 5ELGA 4HS1A 4KF9A 4PQHA 1OYJA 1V98A 5B8AA 1HYUA 1PL2A 4Q5QA 12GSA 2EFCA 1B9YC 2GQKA 1BAYA 1SVOA 5ECLB 3WGXA 2L6CA 2H8LA 4DEJA 1GULA 4I8BA 2IFQB 3ME7A 2VM2A 3RHBA 2FD3A 2QKEA 3WT2A 4GLTA 3IAS2 2BTOT 2FGXA 4IQAA 2I81A 2O89A 5IIZA 2LV3A 4PNFA 4L0UA 2R4VA 1BG1A 3DD3A 4BL7A 1TK8B 5ECOB 2MMAA 2I9HA 2MMZA 4Z2TA 2JZTA 4YQVA 3LYKA 1XW9A 2FA8A 4OMVA 2KP1A 1KTEA 3ERFA 1U3AA 5CRGA 2HZEB 1LU4A 4MF5A 3E3EA 2C3TA 2GDRA 2GZZA 3TJBA 3GX0A 2XHFA 3IXRA 5IO0A 4EIQA 3SBCA 1J08A 2H01A 3TJKA 2HNLA 1SKRB 4DSSA 3ZL5A 2IMDA 3RBTA 4EO3A 1G7OA 2JZSA 3CWGA 6GSSA 3CSHA 4AI6A 3H8QA 3KTLA 2B1KA 3VWUA 1HNCA 2V41A 3P7XA 1GP1A 5G30A 3GA4A 4LL4B 2QA2A 3TCOA 2FWGA 4KGIA 1K3YA 3QD9A 4N30A 3TJFA 4GSNA 3L9SA 4NV2A 4EVMA 1O7UA 4MJEA 3KP9A 2GQMA 2CQ9A 4BVXB 1ZYEA 2XBIA 1M0UA 1GNEA 3BBYA 4MP4A 2LQQA 1OE8A 3TJJA 1HD2A 1SYRA 3Q6OA 1ZGNA 3N5OA 1GL8A 4F2IA 1SU9A 5KEJA 2HSNA 1O8XA 2LJKA 4BVXA 3US3A 2GSQA 1FOVA 1EOGA 5IOWA 2OE0A 4ZL7A 3I6AA 2ON7A 3TRPA 4K2DA 4ULXA 2C0DA 4GXZA 4GQFA 3Q19A 1S3RA 1ERVA 3CTGA 2WGRA 3ZZXA 1AQXA 2FWEA 1ZMAA 1RK4A 4YQMA 2XPEA 4L5OA 4I5QA 3VI5A 5A5HB 2M72A 1NSWA 4PNGA 3VFIA 2YPMA 4EDYA 2X8GA 2CAIA 3TKSA 1GTAA 1MDIA 4MF6A 3ISOA 2YJ7A 1M9BA 1K3LA 2JZRA 4Z7XA 5IMCA 4FIWA 1ILOA 3GHAA 4QQ7A 3RPPA 4QMKA 1TK5B 1UC7A 2H74A 3ZIJA 5EY6A 2EFEA 2O8VB 4AJ8A 1C72A 3KGKA 2V2GA 3KIJA 9GSSA 3TKSC 1T1VA 2VLTA 1EGOA 5E4WA 2WCIA 2AJQB 4K6XA 3QFBC 4KDUA 4EKZA 4I6XA 4X4JA 1HQOA 2I4AA 1CQHA 4IJIA 1JLWA 3PINA 5AIVA 1A2JA 2VCZA 1GUKA 1QGVA 5BMUA 4PURA 2ON5A 4MA9A 1B4PA 2HI7A 1R7HA 3L0HA 3AY8A 3M3MA 3QR6A 5FWGA 1WRYA 1T3BA 2J23A 1UN2A 5DQYA 2DJ3A 2RIIA 1O8WA 4IS0A 1F6MC 1XW5A 4HI7A 3D22A 2WVXA 4EE0A 3UBLA 2KOKA 2H1AA 4EL1A 5A5HA 1PA3A 2E2GA 4L5LA 3EMPA 2AHEA 5JWRB 4DVCA 3EVIA 2H30A 5A4VA 2E0QA 3W8SA 2HT9A 2LUSA 4ILFA 3P2AA 5KOWA 4OCFA 2GT5A 2FWHA 5C00A 3MIXA 2WZ9A 3L4NA 3DWVA 3VWWA 2AB6A 3LORA 4I2UA 2OKAA 3QMXA 2HSMA 3VWXA 3TUEA 3QAVA 3KH9A 3GSSA 5DQSA 3U5RE 4K5RA 5HR2A 4G0IA 3TOUA 1K0MA 3IC8A 1V57A 4WXTA 3ZMLA 1VF2A 4MNNA 1GLQA 2NDOA 3EWLA 4BVYA 2O5VA 5ECHB 3E0UA 4WR4A 4IKHA 4IW9A 3UL3A 2IPAA 3A2VA 3GX8A 3L9UA 2CX3A 1PN9A 2MZCA 2VL3A 1QXHA 3HZ8A 1K0AA 4Q5NA 2OE3A 3F4TA 1GSFA 1USBA 4MLYA 3RPNA 2R5GA 4F0CA 4K9ZA 2V1MA 5IM9A 19GSA 1YZXA 2R6KA 1YF1A 2AYTA 2H0GA 1JZOA 4J57E 3HHVA 4HEA2 3HJOA 4K5SA 4USSA 4EUYA 3QAGA 4PHZC 3PGTA 4XRDA 2HLSA 3TU3B 1XZOA 4MJAA 5B6NA 2HRKB 2E2MA 3DIEA 3TDGA 2V6KA 1H75A 4CW9A 3BCKA 1ACVA 1FO5A 4X0XA 3MYDA 2HXKA 3LG6A 5C04A 4MZBA 4O5QA 1DSBA 4HZ4A 3IHQA 4OCEA 5B7CA 2M80A 2VO4A 2H6YA 2KP2A 3UMAA 4ZB8A 3GKNA 3CSJA 1JHBA 1J9BA 5KN3A 2CX4A 2OT3A 2C4JA 1OC8A 1ON4A 5DVBA 3UARA 4ID0A 2HZFA 4H86A 3ZITA 1GTBA 2RM5A 3ZVJA 4YAPA 5D9TA 3LW9A 17GSA 4XS6A 4GSSA 3IPZA 4TR0A 1EV4A 2LJAA 5A4UA 3CHXC 3HZ4A 1EEJA 1SVMA 3ZREA 3HMJG 2GSTA 2EIOA 2K6VA 1GSUA 1AXDA 4LMVA 2IJYA 5DAKA 1K3OA 3H79A 1GRXA 4KAEA 3F0IA 4JRRA 2B1LA 4NWYA 1TU8A 5EL8A 2YANA 1XVWA 2JSZA 5ECIB 5ECNB 1LBKA 4K7NA 1GSSA 3ZLPA 3HVSA 1SJ6A 4GDFA 2HRKA 3LFLA 2DLXA 3ZFLA 4CY6A 2B7JA 1Z5YE 2K9FA 1NHYA 4NHWA 1YY7A 1J0FA 1BYEA 5G5EA 1TJDA 1SK1A 4N3ZA 5ID2B 4ML1A 5CRWA 3E9JB 4HZ2A 4E8HA 4O5UA 1ZL9A 2IWTA 3KTBA 1XCCA 2VUPA 4BIKA 3O3TA 3VLNA 1A0RP 3EPTA 1A24A 1I9DA 1AAZA 4GTUA 4WF4A 1XXUA 4ECCA 5CRHA 3QCPA 3GTUB 2VL9A 2MBSA 2C0GA 4F82A 2AV4A 4I2TA 5ECPB 4XCSA 2D2ZA 2A2RA 4BVYB 2LSTA 3HVVA 3HYPA 2P5QA 4IJ3A 2H76A 2YV9A 5J4VA 4BPYA 2ZNMA 1DUGA 2YCDA 2FY6A 2L4QA 5CAXA 3QDNA 3CXGA 2GVPA 4IQ1A 1TU7A 5KN1A 5KN2A 4KSMA 2AUVA 3LEFA 2YZHA 1X9MB 3LWAA 2H71A 18GSA 3IBHA 1PFOA 3QAWA 2WW0A 1W89A 2CZ3A 4N0VA 5JCGA 4PGTA 4TR4A 4FQUA 4NV5A 4NHZA 2L6DA 1Q98A 1Z9HA 5CRDA 4EF0A 1GUMA 5A34A 1Z3EA 2H0IA 2VCVA 3FHKA 2PERA 3DVWA 2NTOA 3F8UA 1THXA 3UVTA 5INYA 1YVLA 2LNTA 4GRFA 4DSRA 4GCIA 4WKWA 5JCUA 5EPFA 2K8SA 1B4QA 2VL2C 5D73A 1U6TA 1XWBA 2WW2A 4IGJA 4TKYA 1UVZA 2KUCA 3FR9A 4KB3A 5KN0A 4TOPA 4ECBA 4KCEA 2G2QA 5BMUB 4PI2C 5AIXA 16GSA 1GNWA 4PX1A 1XWGA 3DRNA 3I43A 4POBA 5F05A 4J2FA 3FRCA 8GSSA 4GWRA 4JBBA 5G5FA 3IRAA 4PTSA 2PN8A 5FT3A 3GL5A 1YDKA 3DYRA 3UVHA 4GSTA 1YEWC 3KEBA 2C0EA 2REMA 1MEKA 3HCZA 1VF1A 1PQNA 3BCIA 4JR4A 1SL0B 1LJRA 4Q5FA 1BF5A 1N8JA 6GSUA 2JL4A 5DAKB 3C73A 3D4TA 3J7Yk 3HJPA 1I1IP 5GAPD 1WMJA 3F4SA 1F9MA 2LRTA 3DEXA 2B3SA 2IL3A 2DKIA 4XS4A 2X8HA 4MF7A 2C3NA 2HE3A 1X9WB 1FB0A 4MK3A 3ZFBA 2K18A 2HSNB 4CDOA 2N5FA 2GS3A 5CYYA 2LNSA 3L78A 3EINA 4G9HA 11GSA 5CREA 1FW1A 2EIRA
chains in the Genus database with same CATH topology
1SJZA 2OJLA 3F9UA 3LGCA 1B9XC 2RUEA 4EDZA 2MYGA 3CYNA 5GZZB 5KOXA 1YEPA 3WYWA 2YZUA 1I5GA 3ZIVA 1M2BA 4D73B 2P31A 4P3YB 5G2ZA 5D96A 1R5AA 2EC4A 4ECIA 2Z9SA 1K0DA 1E2YA 1XIYA 1IYHA 1ZYQB 3LXZA 4HQSA 5G1LA 4MABA 2NBSA 4KDYA 3EYTA 4EIPA 2QC7A 3D21A 3CTFA 2YN1A 1VF4A 2VD1A 3GKXA 4G19A 3FEUA 2DBCA 2NVLA 3IK7A 2L5LA 2VLUA 3A5WA 3P90A 1R4WA 1FG4A 3CSIA 3RDWA 2TRCP 4KNDA 5GAND 2YWOA 3UAPA 3EMXA 4ZIJA 3GL3A 3IR4A 3BOAA 3TB2A 1SD8A 2WDUA 2HZEA 5DJMA 2KLXA 2HRFA 3FZ5A 1YEXA 3ZMKA 5LCZA 4AJ7A 4ZBBA 4V2NA 4AKGA 3BJ5A 4NPBA 2FHEA 3PH9A 1UA5A 2DMMA 2R0PA 1G6WA 1YKCA 1T4ZA 2EFDA 1WIKA 4IP1A 2PU9C 4WBJA 3U6VA 2H66A 2H1DA 3F3QA 4HU9A 4WEYA 3TKRA 4BWQA 2ZCTA 4O5RA 3S9FA 3I9V2 2TRXA 1IYIA 2ALBA 3D6IA 4ICYA 4EXJA 3MDKA 3LXTA 4K1FA 4KA0A 3A5IA 5A5KA 4G0KA 1A2LA 3IK9A 5J3RA 5DDLA 1R26A 1XWCA 1ERUA 1F2EA 1FVJA 2OBIA 3VK9A 1GTUA 4WETA 4K0GA 2N5BA 2CVKA 5AGYA 3M9KA 1T8EB 1H4OA 4KH7A 2DJ0A 1F3BA 1BEDA 3EU4A 3KJYA 3KZQA 5G1KA 4K8MA 2JSYA 4MMMA 3OR5A 3G9BA 1Y6EA 3FR3A 2GZPA 3TKSE 4ZB9A 2F9SA 2B5XA 5HR3A 1MD3A 2HQTA 1JFUA 4KW6A 2FCHA 4N10A 1TI1A 2CV4A 2H72A 2QGVA 2YJHA 3P8WA 2GSSA 3APSA 2XC2A 5DALB 4PQIA 10GSA 1WOUA 4N0ZA 4MH2A 3H4KA 4OFMA 1NHOA 3QOUA 4BL7B 1NW2A 2VIMA 2X49A 6GSXA 2R0GA 2CVBA 2IMFA 5IPGA 2MMNA 1K0BA 1PGTA 4ZL9A 5COHA 2H19A 5D9WA 3GN3A 1SENA 1QK8A 3F6FA 2LQOA 5LNKe 3UIWA 2HYXA 3GKMA 2VKZG 1WP0A 3APQA 2GSRA 2IN3A 1PX7A 5L71A 2PMTA 1WWJA 3UOMA 1TTZA 4CHSA 4LA1A 1TRWA 2LRNA 3FW2A 1JZDA 3CRUA 1XBSA 2L5OA 2I1UA 3C8EA 5A1NB 1Y25A 1YF0A 1QQ2A 4MH3A 4QL7A 3VI7A 5IMFA 3KM6A 4OFNA 1EEMA 2B6MA 5ECMB 3IA1A 2H75A 2B5EA 4KUNA 1OC3A 2EFHA 6GSWA 1SL2B 2B5YA 2FNOA 5DBQA 5J9BA 1G7EA 3O76A 3GH6A 4FYCA 4ZL8A 2X8CA 3M9JA 2H1BA 3IAM2 3GYKA 5A1NA 1ZZYA 3FYGA 2DIYA 4A5PA 3KH7A 2CA8A 1F37A 1XOBA 3CBUA 4ACSA 4HDEA 4TW5A 3R3EA 4V2MA 5D93A 3K8NA 3A3TA 3DVXA 3F6DA 4HU7A 4HQZA 2VLVA 2WRTA 4YH2A 1V9WA 2LEGA 4POLA 4L0WA 3EURA 2OBKA 2PWJA 4JE1A 4MJBA 3G7JA 3G7YA 3TKPA 2DJKA 1OE7A 4AKHA 1X5CA 1XPVA 4TR1B 1G0TA 2P5RA 4YQUA 4AGSA 3TRXA 5CP1A 2EIQA 3BD2A 2H1GA 1JLVA 4X1UA 3KCMA 1GH2A 5DALA 4WR5A 4KSOA 3DMLA 5J9CA 2PGTA 1A8YA 4TXOA 5HFGA 4Z2UA 2A2SA 3NOFA 2HRAA 1N25A 3FY7A 2DSAA 3VURA 2H0HA 4ZBAA 3ZVJD 1DE1A 1T00A 3GKKA 1M9AA 3HXSA 2F8AA 4PUAA 1PKWA 1O85A 5J40A 2WULA 1X0RA 1ERTA 4O92A 5IOXA 2B7KA 1M99A 1EZKA 2DMLA 5F0GA 1O81A 3CRTA 2L57A 3LSZA 3C7MA 2JU5A 5IO2A 22GSA 4FYBA 1X5EA 4POKA 3ZRDA 2WS2A 3DXBA 2PBJA 1A23A 3GRXA 2P0GA 2R0CA 1YKAA 1SK0A 1SJIA 1KNGA 2VD0A 3HD5A 3WD6A 1T4YA 2MMOA 1Z7RA 5LD0A 6GSTA 5HR0A 2H73A 1XOAA 5A34B 1FVKA 3M0FA 3RHCA 4G10A 1BQ7A 3L9VA 4JZQA 1ABAA 1SKSB 2HRNA 3Q74A 2C3QA 2YWIA 3GV1A 4POMA 3KMNA 2OACA 5HQPA 1WE0A 3FMWA 4YKGA 1SK2A 4XRAA 4PUFC 1K0CA 4X43A 3I69A 5CO3A 2GT6A 5H5RA 2IMKA 3WT1A 1B48A 4WBRD 3RAZA 1U88A 3EE2A 4YKFA 3VPTA 4RI7A 1PX6A 1VGLA 3O6TA 3GUSA 2TIRA 2R3XA 2OE1A 5HR1A 1XW6A 3F3RA 4LLRA 1M2AA 1RW1A 4TVEA 4ZBDA 1EGRA 4Q5RA 2YWMA 3D0ZA 1U3IA 2QSIA 1TRUA 2LKUA 2R37A 4NAXA 2CT6A 3HJMA 4EC0A 3EC3A 2VL2A 4RI6A 4O7HA 1SD9A 5IPHA 3A2XA 3F63A 4FH8A 1V2AA 4JU5A 3APOA 2O87A 3GFKA 2WJUA 2LS5A 1T7PB 3MSZA 2IFQA 2RM6A 4ZB6A 2NPBA 3GSTA 1U87A 1TOFA 2M46A 5IMVA 4XS4B 5J4UA 2A4HA 4IN0A 4G0LA 3UJ1A 3D4MA 4XHMA 4XS1A 1OVNA 3IDVA 4E68A 1TXUA 5ECRB 4QL9A 3ED3A 5G31A 6GSYA 3G7IA 4K7IA 1PN0A 2J9HA 2VOCA 2GGTA 2GZYA 1YQ1A 4TR3A 3JCML 1QUWA 2BMXA 2O7KA 3QFAC 2YNXA 1EWXA 4CY8A 5FHIA 1O6JA 4ZXGA 5IMAA 1A8LA 4NXIA 4G2EA 2WB9A 1X5DA 3QPMA 2AAWA 2DKHA 2JADA 4I97A 1TK0B 2HSHA 5JWOB 2YWNA 3V1WA 1QFNA 5F07A 3HA9A 2XBQA 2DJJA 4AKIA 3FZAA 2FWFA 4HJ2A 5H5QA 4WF5A 2GLRA 1JZRA 5A4WA 1GTIA 5J5NA 4OD7A 4G01A 1OAZA 2E7PA 2F3MA 4TXVA 4ZILA 4HOJA 1GSDA 3M1GA 1R5PA 2DJ1A 1SYXA 1EP8A 4GF0A 4FYUA 4E8EA 4AF2A 1ZYPA 2FUG2 5J47A 4F9ZA 4K7OA 3EU3A 3TKQA 5HFIA 4LMWA 5H5SA 1MTCA 2X4AA 5IQYA 1ZYNA 1EOHA 4BA7A 3HKRA 3WGEA 5IMZA 3FKFA 2XPDA 3IHGA 1AQVA 1GSQA 1E6BA 1TXXA 3ZYWA 2IIYA 2PVOC 3H93A 1BX9A 1ZCPA 1AUCA 5D9XA 3MWHA 5ECSA 4JR6A 3IE3A 1GSYA 4OFTA 1SKWB 1TI3A 2VCTA 5CNWA 1M7TA 2H6ZA 2MBTA 3KXOA 2FLSA 4TN8A 2C8UA 1O73A 2FA4A 4XTSA 4W66A 1S3CA 1SVLA 3ZTLA 5B6MA 4KDXA 4ML6A 4HJMA 4FO5A 3GTUA 2DJ2A 5J4YA 3R2QA 3A2WA 4V1Ap 2UZ8A 3KMOA 1FB6A 5ECKB 20GSA 4V2LA 4MDCA 1K0NA 3C1RA 2VCQA 3MNGA 4IP6A 4MPGA 5JWQB 1JZWA 4V1Ag 4OWYA 1BJXA 3KD0A 3HDCA 1S3AA 2F51A 1OKTA 1WJKA 3H1NA 1A0FA 1N2AA 5AISA 2OA7A 4DSSB 2DC5A 1ZOFA 4JEDA 1CQGA 1GLPA 2C0FA 1HNBA 1GSEA 3FZ4A 4OO4A 5ID2A 4O32A 1Z6NA 3NZNA 2H1LA 1KEBA 5BRTA 4KE3A 2A4VA 4AKXB 4ZB7A 1EP7A 5ELAA 3FK8A 4L8EA 4Z2RA 2LJRA 4TR1A 4MZCA 1B8XA 2GQLA 1WPIA 2PPTA 5F06A 2QA1A 4F03A 3TGZA 3ERWA 3D5JA 4AJ6A 4ISDA 1W4VA 3M8NA 1XWAA 1PL1A 2C80A 2L59A 3HY2A 1TRVA 2VCXA 1X9SB 1XVQA 1URMA 1M2DA 1PD21 1Z7PA 3Q18A 5ECQB 3W8JA 1RQMA 2LRCA 2KHPA 2YP6A 1S3DA 1AQWA 1MDJA 3CMIA 3SWLA 3ERGA 1PRXA 1EV9A 2VM1A 3UBKA 2I3YA 2CAQA 2X99A 4IHUA 14GSA 5HFKA 3N9JA 2H70A 4YAVA 3LJRA 3DGQA 1BG5A 1XWKA 1DE2A 3C1SA 2K8VA 2YV7A 5DCHA 4GQCA 4OO5A 5AN1A 4TXOB 1AW9A 2RUFA 1V40A 3TOTA 3PPUA 4MZWA 3IV4A 1F3AA 2ZUPA 5J41A 4MPFA 1PMTA 2V32A 4XIHA 2PUKC 3TRQA 3C71A 3VWVA 5DCGA 1AIUA 13GSA 1K0OA 1TKDB 3DKSA 1QMVA 4KCAA 4LL1B 4RQRA 1DBYA 2N5AA 1GWCA 1AC1A 1Y1UA 1A2MA 1NM3A 4MJCA 4N11A 5JCWA 1ML6A 5E59A 4K0NA 1Q4JA 2HSYA 2RLIA 2V6OA 6GSVA 3GNJA 1VRSD 2YOIA 2O85A 2A2PA 2G0FA 3GURA 4TRXA 4RQXA 3WGDA 2HSMB 3UEMA 3PR8A 2R2JA 2L4CA 2JACA 3MAKA 3GH9A 4PQ1A 1YJ6A 2PVQA 3FZ9A 1TDIA 1THOA 3F4RA 1SL1B 1VF3A 3ME8A 3LQ7A 2IMIA 4F0BA 2OADA 3W6GA 3IOSA 2IMEA 3J7Yb 3KP8A 5DJLA 4KX4A 5D9VA 3TJGA 4HUAA 3HVXA 2VAFA 2WFCA 2X64A 2LTKA 5B8BA 1KBNA 1FHEA 1Z6MA 4IELA 4K2XA 1HNAA 1PKZA 1TP9A 1G6YA 1MDKA 2GTUA 3GMFA 5ABRA 2VCWA 2C1YA 4J56E 3LYPA 2UV8G 2F8FA 4BWSA 1OC9B 1TRSA 2DIZA 5F8BA 4D73A 3VPQA 7GSSA 4ECJA 1ST9A 1TW9A 4IVFA 1FOHA 5GSSA 4RUVA 2H6XA 1FAAA 3FR6A 2BJXA 4IBPA 4DSQA 1MD4A 5GSTA 3GIXA 3IC4A 4NMUA 1GUHA 3NIVA 5ENUA 1PSQA 4PXOA 2ES7A 1XFLA 5D8IA 1OC9A 2CZ2A 5IMDA 1ERWA 2CVDA 2HFDA 1OKDA 1V58A 5EVOA 4MCUA 5ELGA 4HS1A 4KF9A 4PQHA 1OYJA 1V98A 5B8AA 1HYUA 1PL2A 4Q5QA 12GSA 2EFCA 1B9YC 2GQKA 1BAYA 1SVOA 5ECLB 3WGXA 2L6CA 2H8LA 4DEJA 1GULA 4I8BA 2IFQB 3ME7A 2VM2A 3RHBA 2FD3A 2QKEA 3WT2A 4GLTA 3IAS2 2BTOT 2FGXA 4IQAA 2I81A 2O89A 5IIZA 2LV3A 4PNFA 4L0UA 2R4VA 1BG1A 3DD3A 4BL7A 1TK8B 5ECOB 2MMAA 2I9HA 2MMZA 4Z2TA 2JZTA 4YQVA 3LYKA 1XW9A 2FA8A 4OMVA 2KP1A 1KTEA 3ERFA 1U3AA 5CRGA 2HZEB 1LU4A 4MF5A 3E3EA 2C3TA 2GDRA 2GZZA 3TJBA 3GX0A 2XHFA 3IXRA 5IO0A 4EIQA 3SBCA 1J08A 2H01A 3TJKA 2HNLA 1SKRB 4DSSA 3ZL5A 2IMDA 3RBTA 4EO3A 1G7OA 2JZSA 3CWGA 6GSSA 3CSHA 4AI6A 3H8QA 3KTLA 2B1KA 3VWUA 1HNCA 2V41A 3P7XA 1GP1A 5G30A 3GA4A 4LL4B 2QA2A 3TCOA 2FWGA 4KGIA 1K3YA 3QD9A 4N30A 3TJFA 4GSNA 3L9SA 4NV2A 4EVMA 1O7UA 4MJEA 3KP9A 2GQMA 2CQ9A 4BVXB 1ZYEA 1M0UA 1GNEA 3BBYA 4MP4A 2XBIA 2LQQA 1OE8A 3TJJA 1HD2A 1SYRA 3Q6OA 1ZGNA 3N5OA 1GL8A 4F2IA 1SU9A 5KEJA 2HSNA 1O8XA 2LJKA 4BVXA 3US3A 2GSQA 1FOVA 1EOGA 5IOWA 2OE0A 4ZL7A 3I6AA 2ON7A 3TRPA 4K2DA 4ULXA 2C0DA 4GXZA 4GQFA 3Q19A 1ERVA 3CTGA 2WGRA 3ZZXA 1AQXA 2FWEA 1ZMAA 1RK4A 4YQMA 2XPEA 4L5OA 4I5QA 3VI5A 5A5HB 2M72A 1NSWA 4PNGA 3VFIA 2YPMA 4EDYA 2X8GA 2CAIA 3TKSA 1GTAA 1MDIA 4MF6A 3ISOA 2YJ7A 1M9BA 1K3LA 2JZRA 4Z7XA 5IMCA 4FIWA 1ILOA 3GHAA 4QQ7A 3RPPA 4QMKA 1TK5B 1UC7A 2H74A 3ZIJA 5EY6A 2EFEA 2O8VB 4AJ8A 1C72A 3KGKA 2V2GA 3KIJA 9GSSA 3TKSC 1T1VA 2VLTA 1EGOA 5E4WA 2WCIA 2AJQB 4K6XA 3QFBC 4KDUA 4EKZA 4I6XA 4X4JA 1HQOA 2I4AA 1CQHA 4IJIA 1JLWA 3PINA 5AIVA 1A2JA 2VCZA 1GUKA 1QGVA 5BMUA 4PURA 2ON5A 4MA9A 1B4PA 2HI7A 1R7HA 3L0HA 3AY8A 3M3MA 3QR6A 5FWGA 1WRYA 1T3BA 2J23A 1UN2A 5DQYA 2DJ3A 2RIIA 1O8WA 4IS0A 1F6MC 1XW5A 4HI7A 3D22A 4EE0A 3UBLA 2KOKA 2H1AA 4EL1A 5A5HA 1PA3A 2E2GA 4L5LA 3EMPA 2AHEA 5JWRB 4DVCA 3EVIA 2H30A 5A4VA 2E0QA 3W8SA 2HT9A 2LUSA 4ILFA 3P2AA 5KOWA 4OCFA 2GT5A 2FWHA 5C00A 3MIXA 2WZ9A 3L4NA 3DWVA 3VWWA 2AB6A 3LORA 4I2UA 2OKAA 3QMXA 2HSMA 3VWXA 3TUEA 3QAVA 3KH9A 3GSSA 5DQSA 3U5RE 4K5RA 5HR2A 4G0IA 3TOUA 1K0MA 3IC8A 1V57A 4WXTA 3ZMLA 1VF2A 4MNNA 1GLQA 2NDOA 3EWLA 4BVYA 2O5VA 5ECHB 3E0UA 4WR4A 4IKHA 4IW9A 3UL3A 2IPAA 3A2VA 3GX8A 3L9UA 2CX3A 1PN9A 2MZCA 2VL3A 1QXHA 3HZ8A 1K0AA 4Q5NA 2OE3A 3F4TA 1GSFA 1USBA 4MLYA 3RPNA 2R5GA 4F0CA 4K9ZA 2V1MA 5IM9A 19GSA 1YZXA 2R6KA 1YF1A 2AYTA 2H0GA 1JZOA 4J57E 3HHVA 4HEA2 3HJOA 4K5SA 4USSA 4EUYA 3QAGA 3PGTA 4XRDA 2HLSA 3TU3B 1XZOA 4MJAA 5B6NA 2HRKB 2E2MA 3DIEA 3TDGA 2V6KA 1H75A 4CW9A 3BCKA 1ACVA 1FO5A 4X0XA 3MYDA 2HXKA 3LG6A 5C04A 4MZBA 4O5QA 1DSBA 4HZ4A 3IHQA 4OCEA 5B7CA 2M80A 2VO4A 2H6YA 2KP2A 3UMAA 4ZB8A 3GKNA 3CSJA 1JHBA 1J9BA 5KN3A 2CX4A 2OT3A 2C4JA 1OC8A 1ON4A 5DVBA 3UARA 4ID0A 2HZFA 4H86A 3ZITA 1GTBA 2RM5A 3ZVJA 4YAPA 5D9TA 3LW9A 17GSA 4XS6A 4GSSA 3IPZA 4TR0A 1EV4A 2LJAA 5A4UA 3HZ4A 1EEJA 1SVMA 3ZREA 3HMJG 2GSTA 2EIOA 2K6VA 1GSUA 1AXDA 4LMVA 2IJYA 5DAKA 1K3OA 3H79A 1GRXA 4KAEA 3F0IA 4JRRA 2B1LA 4NWYA 1TU8A 5EL8A 2YANA 1XVWA 2JSZA 5ECIB 5ECNB 1LBKA 4K7NA 1GSSA 3ZLPA 3HVSA 1SJ6A 4GDFA 2HRKA 3LFLA 2DLXA 3ZFLA 4CY6A 2B7JA 1Z5YE 2K9FA 1NHYA 4NHWA 1YY7A 1J0FA 1BYEA 5G5EA 1TJDA 1SK1A 4N3ZA 5ID2B 4ML1A 5CRWA 3E9JB 4HZ2A 4E8HA 4O5UA 1ZL9A 2IWTA 3KTBA 1XCCA 2VUPA 3O3TA 3VLNA 1A0RP 3EPTA 1A24A 1I9DA 1AAZA 4GTUA 4WF4A 1XXUA 4ECCA 5CRHA 3QCPA 3GTUB 2VL9A 2MBSA 2C0GA 4F82A 2AV4A 4I2TA 5ECPB 4XCSA 2D2ZA 2A2RA 4BVYB 2LSTA 3HVVA 3HYPA 2P5QA 4IJ3A 2H76A 2YV9A 5J4VA 4BPYA 2ZNMA 1DUGA 2YCDA 2FY6A 2L4QA 5CAXA 3QDNA 3CXGA 2GVPA 4IQ1A 1TU7A 5KN1A 5KN2A 4KSMA 2AUVA 3LEFA 2YZHA 1X9MB 3LWAA 2H71A 18GSA 3IBHA 3QAWA 1W89A 2CZ3A 4N0VA 5JCGA 4PGTA 4TR4A 4FQUA 4NV5A 4NHZA 2L6DA 1Q98A 1Z9HA 5CRDA 4EF0A 1GUMA 5A34A 1Z3EA 2H0IA 2VCVA 3FHKA 2PERA 3DVWA 2NTOA 3F8UA 1THXA 3UVTA 5INYA 1YVLA 2LNTA 4GRFA 4DSRA 4GCIA 4WKWA 5JCUA 5EPFA 2K8SA 1B4QA 2VL2C 5D73A 1U6TA 1XWBA 4IGJA 4TKYA 1UVZA 2KUCA 3FR9A 4KB3A 5KN0A 4TOPA 4ECBA 4KCEA 2G2QA 5BMUB 5AIXA 16GSA 1GNWA 4PX1A 1XWGA 3DRNA 3I43A 4POBA 5F05A 4J2FA 3FRCA 8GSSA 4GWRA 4JBBA 5G5FA 3IRAA 4PTSA 2PN8A 5FT3A 3GL5A 1YDKA 3DYRA 3UVHA 4GSTA 3KEBA 2C0EA 2REMA 1MEKA 3HCZA 1VF1A 1PQNA 3BCIA 4JR4A 1SL0B 1LJRA 4Q5FA 1BF5A 1N8JA 6GSUA 2JL4A 5DAKB 3C73A 3D4TA 3J7Yk 3HJPA 5GAPD 1WMJA 3F4SA 1F9MA 2LRTA 3DEXA 2B3SA 2IL3A 2DKIA 4XS4A 2X8HA 4MF7A 2C3NA 2HE3A 1X9WB 1FB0A 4MK3A 3ZFBA 2K18A 2HSNB 4CDOA 2N5FA 2GS3A 5CYYA 2LNSA 3L78A 3EINA 4G9HA 11GSA 5CREA 1FW1A 2EIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SJZ A;  2OJL A;  3F9U A;  3LGC A;  1B9X C;  2RUE A;  4EDZ A;  2MYG A;  3CYN A;  5GZZ B;  1YEP A;  3WYW A;  2YZU A;  1I5G A;  3ZIV A;  1M2B A;  4D73 B;  2P31 A;  4P3Y B;  5G2Z A;  5D96 A;  1R5A A;  2EC4 A;  4ECI A;  2Z9S A;  1K0D A;  1E2Y A;  1XIY A;  1IYH A;  1ZYQ B;  3LXZ A;  4HQS A;  5G1L A;  4MAB A;  2NBS A;  4KDY A;  3EYT A;  2QC7 A;  3D21 A;  3CTF A;  2YN1 A;  1VF4 A;  2VD1 A;  3GKX A;  4G19 A;  3FEU A;  2DBC A;  2NVL A;  3IK7 A;  2L5L A;  2VLU A;  3A5W A;  3P90 A;  1R4W A;  1FG4 A;  3CSI A;  3RDW A;  2TRC P;  4KND A;  5GAN D;  2YWO A;  3UAP A;  3EMX A;  4ZIJ A;  3GL3 A;  3IR4 A;  3BOA A;  3TB2 A;  1SD8 A;  2WDU A;  2HZE A;  5DJM A;  2KLX A;  2HRF A;  3FZ5 A;  1YEX A;  3ZMK A;  5LCZ A;  4AJ7 A;  4ZBB A;  4V2N A;  3BJ5 A;  4NPB A;  2FHE A;  3PH9 A;  1UA5 A;  2DMM A;  1G6W A;  1YKC A;  1T4Z A;  4IP1 A;  1WIK A;  2PU9 C;  4WBJ A;  3U6V A;  2H66 A;  2H1D A;  3F3Q A;  4HU9 A;  4WEY A;  3TKR A;  4BWQ A;  2ZCT A;  4O5R A;  3S9F A;  3I9V 2;  2TRX A;  1IYI A;  2ALB A;  3D6I A;  4EXJ A;  3MDK A;  3LXT A;  4K1F A;  4KA0 A;  5A5K A;  4G0K A;  1A2L A;  3IK9 A;  5J3R A;  5DDL A;  1R26 A;  1XWC A;  1ERU A;  1F2E A;  1FVJ A;  2OBI A;  3VK9 A;  1GTU A;  4WET A;  4K0G A;  2N5B A;  2CVK A;  5AGY A;  3M9K A;  1T8E B;  1H4O A;  4KH7 A;  2DJ0 A;  1F3B A;  1BED A;  3EU4 A;  3KJY A;  3KZQ A;  5G1K A;  4K8M A;  2JSY A;  4MMM A;  3OR5 A;  3G9B A;  1Y6E A;  3FR3 A;  2GZP A;  3TKS E;  4ZB9 A;  2F9S A;  2B5X A;  5HR3 A;  1MD3 A;  2HQT A;  1JFU A;  4KW6 A;  2FCH A;  4N10 A;  1TI1 A;  2CV4 A;  2H72 A;  2QGV A;  2YJH A;  3P8W A;  2GSS A;  3APS A;  2XC2 A;  5DAL B;  4PQI A;  10GS A;  1WOU A;  4N0Z A;  4MH2 A;  3H4K A;  4OFM A;  1NHO A;  3QOU A;  4BL7 B;  1NW2 A;  2VIM A;  6GSX A;  2CVB A;  2IMF A;  5IPG A;  2MMN A;  1K0B A;  1PGT A;  4ZL9 A;  5COH A;  2H19 A;  5D9W A;  3GN3 A;  1SEN A;  1QK8 A;  3F6F A;  2LQO A;  5LNK e;  3UIW A;  2HYX A;  3GKM A;  1WP0 A;  3APQ A;  2GSR A;  2IN3 A;  1PX7 A;  5L71 A;  2PMT A;  1WWJ A;  3UOM A;  1TTZ A;  4CHS A;  4LA1 A;  1TRW A;  2LRN A;  3FW2 A;  1JZD A;  3CRU A;  1XBS A;  2L5O A;  2I1U A;  3C8E A;  1Y25 A;  1YF0 A;  1QQ2 A;  4MH3 A;  4QL7 A;  3VI7 A;  5IMF A;  3KM6 A;  4OFN A;  1EEM A;  2B6M A;  5ECM B;  3IA1 A;  2H75 A;  2B5E A;  4KUN A;  1OC3 A;  6GSW A;  1SL2 B;  2B5Y A;  2FNO A;  5DBQ A;  5J9B A;  1G7E A;  3O76 A;  3GH6 A;  4FYC A;  4ZL8 A;  2X8C A;  3M9J A;  2H1B A;  3IAM 2;  3GYK A;  1ZZY A;  3FYG A;  2DIY A;  3KH7 A;  2CA8 A;  1F37 A;  1XOB A;  3CBU A;  4ACS A;  4HDE A;  4TW5 A;  3R3E A;  4V2M A;  5D93 A;  3K8N A;  3A3T A;  3DVX A;  3F6D A;  4HU7 A;  4HQZ A;  2VLV A;  2WRT A;  4YH2 A;  1V9W A;  2LEG A;  4POL A;  4L0W A;  3EUR A;  2OBK A;  2PWJ A;  4JE1 A;  4MJB A;  3G7J A;  3G7Y A;  3TKP A;  2DJK A;  1OE7 A;  1X5C A;  1XPV A;  4TR1 B;  1G0T A;  2P5R A;  4YQU A;  4AGS A;  3TRX A;  5CP1 A;  2EIQ A;  3BD2 A;  2H1G A;  1JLV A;  4X1U A;  3KCM A;  1GH2 A;  5DAL A;  4WR5 A;  4KSO A;  3DML A;  5J9C A;  2PGT A;  1A8Y A;  4TXO A;  5HFG A;  2A2S A;  3NOF A;  2HRA A;  3FY7 A;  2DSA A;  3VUR A;  2H0H A;  4ZBA A;  3ZVJ D;  1DE1 A;  1T00 A;  3GKK A;  1M9A A;  3HXS A;  2F8A A;  4PUA A;  1PKW A;  1O85 A;  2WUL A;  1X0R A;  1ERT A;  4O92 A;  5IOX A;  2B7K A;  1M99 A;  1EZK A;  2DML A;  5F0G A;  1O81 A;  3CRT A;  2L57 A;  3LSZ A;  3C7M A;  2JU5 A;  5IO2 A;  22GS A;  4FYB A;  1X5E A;  4POK A;  3ZRD A;  2WS2 A;  3DXB A;  2PBJ A;  1A23 A;  3GRX A;  2P0G A;  1YKA A;  1SK0 A;  1SJI A;  1KNG A;  2VD0 A;  3HD5 A;  3WD6 A;  1T4Y A;  2MMO A;  1Z7R A;  5LD0 A;  6GST A;  5HR0 A;  2H73 A;  1XOA A;  1FVK A;  3M0F A;  3RHC A;  4G10 A;  1BQ7 A;  3L9V A;  4JZQ A;  1ABA A;  1SKS B;  2HRN A;  3Q74 A;  2C3Q A;  2YWI A;  3GV1 A;  4POM A;  3KMN A;  2OAC A;  5HQP A;  1WE0 A;  1SK2 A;  4XRA A;  4PUF C;  1K0C A;  4X43 A;  3I69 A;  5CO3 A;  2GT6 A;  5H5R A;  2IMK A;  3WT1 A;  1B48 A;  4WBR D;  3RAZ A;  1U88 A;  3EE2 A;  3VPT A;  4RI7 A;  1PX6 A;  1VGL A;  3O6T A;  3GUS A;  2TIR A;  2R3X A;  2OE1 A;  5HR1 A;  1XW6 A;  3F3R A;  4LLR A;  1M2A A;  1RW1 A;  4TVE A;  4ZBD A;  1EGR A;  4Q5R A;  2YWM A;  3D0Z A;  1U3I A;  2QSI A;  1TRU A;  2LKU A;  2R37 A;  4NAX A;  2CT6 A;  3HJM A;  4EC0 A;  3EC3 A;  2VL2 A;  4RI6 A;  4O7H A;  1SD9 A;  5IPH A;  3A2X A;  3F63 A;  4FH8 A;  1V2A A;  4JU5 A;  3APO A;  2O87 A;  3GFK A;  2WJU A;  2LS5 A;  1T7P B;  3MSZ A;  2IFQ A;  2RM6 A;  4ZB6 A;  2NPB A;  3GST A;  1U87 A;  1TOF A;  2M46 A;  5IMV A;  4XS4 B;  5J4U A;  4IN0 A;  4G0L A;  3UJ1 A;  3D4M A;  4XHM A;  4XS1 A;  1OVN A;  3IDV A;  5ECR B;  4QL9 A;  3ED3 A;  5G31 A;  6GSY A;  3G7I A;  4K7I A;  2J9H A;  2VOC A;  2GGT A;  2GZY A;  1YQ1 A;  4TR3 A;  3JCM L;  1QUW A;  2BMX A;  2O7K A;  3QFA C;  2YNX A;  1EWX A;  5FHI A;  1O6J A;  4ZXG A;  5IMA A;  1A8L A;  4NXI A;  4G2E A;  2WB9 A;  1X5D A;  3QPM A;  2AAW A;  2JAD A;  4I97 A;  1TK0 B;  2HSH A;  5JWO B;  2YWN A;  3V1W A;  1QFN A;  5F07 A;  3HA9 A;  2XBQ A;  2DJJ A;  3FZA A;  2FWF A;  4HJ2 A;  5H5Q A;  4WF5 A;  2GLR A;  1JZR A;  5A4W A;  1GTI A;  5J5N A;  4OD7 A;  1OAZ A;  2E7P A;  2F3M A;  4TXV A;  4ZIL A;  4HOJ A;  1GSD A;  3M1G A;  1R5P A;  2DJ1 A;  1SYX A;  1EP8 A;  4GF0 A;  4FYU A;  4E8E A;  4AF2 A;  2FUG 2;  4F9Z A;  4K7O A;  3EU3 A;  3TKQ A;  5HFI A;  4LMW A;  5H5S A;  1MTC A;  5IQY A;  1EOH A;  4BA7 A;  3HKR A;  3WGE A;  5IMZ A;  3FKF A;  2XPD A;  1AQV A;  1GSQ A;  1E6B A;  1TXX A;  3ZYW A;  2IIY A;  2PVO C;  3H93 A;  1BX9 A;  1ZCP A;  1AUC A;  5D9X A;  3MWH A;  5ECS A;  4JR6 A;  3IE3 A;  1GSY A;  4OFT A;  1SKW B;  1TI3 A;  2VCT A;  5CNW A;  1M7T A;  2H6Z A;  2MBT A;  3KXO A;  2FLS A;  4TN8 A;  2C8U A;  1O73 A;  2FA4 A;  4XTS A;  1S3C A;  3ZTL A;  5B6M A;  4KDX A;  4ML6 A;  4HJM A;  4FO5 A;  3GTU A;  2DJ2 A;  3R2Q A;  3A2W A;  4V1A p;  2UZ8 A;  3KMO A;  1FB6 A;  5ECK B;  20GS A;  4V2L A;  4MDC A;  1K0N A;  3C1R A;  2VCQ A;  3MNG A;  4IP6 A;  4MPG A;  5JWQ B;  1JZW A;  4V1A g;  4OWY A;  1BJX A;  3KD0 A;  3HDC A;  1S3A A;  2F51 A;  1OKT A;  1WJK A;  3H1N A;  1A0F A;  1N2A A;  5AIS A;  2OA7 A;  4DSS B;  2DC5 A;  1ZOF A;  4JED A;  1CQG A;  1GLP A;  2C0F A;  1HNB A;  1GSE A;  3FZ4 A;  4OO4 A;  5ID2 A;  4O32 A;  1Z6N A;  3NZN A;  1KEB A;  4KE3 A;  2A4V A;  1EP7 A;  5ELA A;  3FK8 A;  4L8E A;  2LJR A;  4TR1 A;  4MZC A;  1B8X A;  2GQL A;  1WPI A;  2PPT A;  5F06 A;  4F03 A;  3TGZ A;  3ERW A;  3D5J A;  4AJ6 A;  4ISD A;  1W4V A;  3M8N A;  1XWA A;  1PL1 A;  2C80 A;  2L59 A;  3HY2 A;  1TRV A;  2VCX A;  1X9S B;  1XVQ A;  1URM A;  1M2D A;  1PD2 1;  1Z7P A;  3Q18 A;  5ECQ B;  3W8J A;  1RQM A;  2LRC A;  2KHP A;  2YP6 A;  1S3D A;  1AQW A;  1MDJ A;  3CMI A;  3SWL A;  3ERG A;  1PRX A;  1EV9 A;  2VM1 A;  3UBK A;  2I3Y A;  2CAQ A;  2X99 A;  4IHU A;  14GS A;  5HFK A;  3N9J A;  2H70 A;  4YAV A;  3LJR A;  3DGQ A;  1BG5 A;  1XWK A;  1DE2 A;  3C1S A;  2K8V A;  2YV7 A;  5DCH A;  4GQC A;  4OO5 A;  5AN1 A;  4TXO B;  1AW9 A;  2RUF A;  1V40 A;  3TOT A;  3PPU A;  4MZW A;  3IV4 A;  1F3A A;  2ZUP A;  5J41 A;  4MPF A;  1PMT A;  2V32 A;  4XIH A;  2PUK C;  3TRQ A;  3C71 A;  3VWV A;  5DCG A;  1AIU A;  13GS A;  1K0O A;  1TKD B;  3DKS A;  1QMV A;  4KCA A;  4LL1 B;  4RQR A;  1DBY A;  2N5A A;  1GWC A;  1AC1 A;  1A2M A;  1NM3 A;  4MJC A;  4N11 A;  5JCW A;  1ML6 A;  5E59 A;  4K0N A;  1Q4J A;  2HSY A;  2RLI A;  2V6O A;  6GSV A;  3GNJ A;  1VRS D;  2YOI A;  2O85 A;  2G0F A;  3GUR A;  4TRX A;  4RQX A;  3WGD A;  2HSM B;  3UEM A;  3PR8 A;  2R2J A;  2L4C A;  2JAC A;  3MAK A;  3GH9 A;  4PQ1 A;  1YJ6 A;  2PVQ A;  3FZ9 A;  1TDI A;  1THO A;  3F4R A;  1SL1 B;  1VF3 A;  3ME8 A;  3LQ7 A;  2IMI A;  4F0B A;  2OAD A;  3W6G A;  3IOS A;  2IME A;  3J7Y b;  3KP8 A;  5DJL A;  4KX4 A;  5D9V A;  3TJG A;  4HUA A;  3HVX A;  2VAF A;  2WFC A;  2X64 A;  2LTK A;  5B8B A;  1KBN A;  1FHE A;  1Z6M A;  4IEL A;  1HNA A;  1PKZ A;  1TP9 A;  1G6Y A;  1MDK A;  2GTU A;  3GMF A;  5ABR A;  2VCW A;  2C1Y A;  4J56 E;  3LYP A;  2F8F A;  4BWS A;  1OC9 B;  1TRS A;  2DIZ A;  5F8B A;  4D73 A;  3VPQ A;  7GSS A;  4ECJ A;  1ST9 A;  1TW9 A;  4IVF A;  5GSS A;  4RUV A;  2H6X A;  1FAA A;  3FR6 A;  2BJX A;  4IBP A;  4DSQ A;  1MD4 A;  5GST A;  3GIX A;  3IC4 A;  4NMU A;  1GUH A;  3NIV A;  5ENU A;  1PSQ A;  4PXO A;  2ES7 A;  1XFL A;  5D8I A;  1OC9 A;  2CZ2 A;  5IMD A;  1ERW A;  2CVD A;  2HFD A;  1OKD A;  1V58 A;  5EVO A;  4MCU A;  5ELG A;  4HS1 A;  4KF9 A;  4PQH A;  1OYJ A;  1V98 A;  5B8A A;  1HYU A;  1PL2 A;  4Q5Q A;  12GS A;  2GQK A;  1B9Y C;  1BAY A;  5ECL B;  3WGX A;  2L6C A;  2H8L A;  4DEJ A;  1GUL A;  4I8B A;  2IFQ B;  3ME7 A;  2VM2 A;  3RHB A;  2FD3 A;  2QKE A;  3WT2 A;  4GLT A;  3IAS 2;  2BTO T;  2FGX A;  4IQA A;  2I81 A;  2O89 A;  5IIZ A;  2LV3 A;  4PNF A;  4L0U A;  2R4V A;  3DD3 A;  4BL7 A;  1TK8 B;  5ECO B;  2MMA A;  2I9H A;  2MMZ A;  2JZT A;  4YQV A;  3LYK A;  1XW9 A;  2FA8 A;  4OMV A;  2KP1 A;  1KTE A;  3ERF A;  1U3A A;  5CRG A;  2HZE B;  1LU4 A;  4MF5 A;  3E3E A;  2C3T A;  2GDR A;  2GZZ A;  3TJB A;  3GX0 A;  2XHF A;  3IXR A;  5IO0 A;  3SBC A;  1J08 A;  2H01 A;  3TJK A;  2HNL A;  1SKR B;  4DSS A;  3ZL5 A;  2IMD A;  3RBT A;  4EO3 A;  1G7O A;  2JZS A;  6GSS A;  3CSH A;  3H8Q A;  3KTL A;  2B1K A;  3VWU A;  1HNC A;  2V41 A;  3P7X A;  1GP1 A;  5G30 A;  3GA4 A;  4LL4 B;  3TCO A;  2FWG A;  4KGI A;  1K3Y A;  3QD9 A;  4N30 A;  3TJF A;  4GSN A;  3L9S A;  4NV2 A;  4EVM A;  1O7U A;  4MJE A;  3KP9 A;  2GQM A;  2CQ9 A;  4BVX B;  1ZYE A;  1M0U A;  1GNE A;  3BBY A;  4MP4 A;  2XBI A;  2LQQ A;  1OE8 A;  3TJJ A;  1HD2 A;  1SYR A;  3Q6O A;  1ZGN A;  3N5O A;  1GL8 A;  4F2I A;  1SU9 A;  5KEJ A;  1O8X A;  2LJK A;  4BVX A;  3US3 A;  2GSQ A;  1FOV A;  1EOG A;  5IOW A;  2OE0 A;  4ZL7 A;  3I6A A;  2ON7 A;  3TRP A;  4K2D A;  4ULX A;  2C0D A;  4GXZ A;  4GQF A;  3Q19 A;  1ERV A;  3CTG A;  2WGR A;  3ZZX A;  1AQX A;  2FWE A;  1ZMA A;  1RK4 A;  4YQM A;  2XPE A;  4L5O A;  4I5Q A;  3VI5 A;  2M72 A;  1NSW A;  4PNG A;  3VFI A;  2YPM A;  4EDY A;  2X8G A;  2CAI A;  3TKS A;  1GTA A;  1MDI A;  4MF6 A;  3ISO A;  2YJ7 A;  1M9B A;  1K3L A;  2JZR A;  4Z7X A;  5IMC A;  4FIW A;  1ILO A;  3GHA A;  4QQ7 A;  3RPP A;  1TK5 B;  1UC7 A;  2H74 A;  3ZIJ A;  5EY6 A;  2O8V B;  4AJ8 A;  1C72 A;  3KGK A;  2V2G A;  3KIJ A;  9GSS A;  3TKS C;  1T1V A;  2VLT A;  1EGO A;  5E4W A;  2WCI A;  2AJQ B;  4K6X A;  3QFB C;  4KDU A;  4EKZ A;  4I6X A;  1HQO A;  2I4A A;  1CQH A;  4IJI A;  1JLW A;  3PIN A;  5AIV A;  1A2J A;  2VCZ A;  1GUK A;  1QGV A;  5BMU A;  4PUR A;  2ON5 A;  4MA9 A;  1B4P A;  2HI7 A;  1R7H A;  3L0H A;  3AY8 A;  3M3M A;  3QR6 A;  5FWG A;  1WRY A;  1T3B A;  2J23 A;  1UN2 A;  5DQY A;  2DJ3 A;  2RII A;  1O8W A;  4IS0 A;  1F6M C;  1XW5 A;  4HI7 A;  3D22 A;  4EE0 A;  3UBL A;  2KOK A;  2H1A A;  4EL1 A;  1PA3 A;  2E2G A;  4L5L A;  3EMP A;  2AHE A;  5JWR B;  4DVC A;  3EVI A;  2H30 A;  5A4V A;  2E0Q A;  3W8S A;  2HT9 A;  2LUS A;  4ILF A;  3P2A A;  4OCF A;  2GT5 A;  2FWH A;  5C00 A;  2WZ9 A;  3L4N A;  3DWV A;  3VWW A;  2AB6 A;  3LOR A;  4I2U A;  2OKA A;  3QMX A;  2HSM A;  3VWX A;  3TUE A;  3QAV A;  3KH9 A;  3GSS A;  5DQS A;  3U5R E;  5HR2 A;  4G0I A;  3TOU A;  1K0M A;  3IC8 A;  1V57 A;  4WXT A;  3ZML A;  1VF2 A;  1GLQ A;  2NDO A;  3EWL A;  4BVY A;  5ECH B;  3E0U A;  4WR4 A;  4IKH A;  4IW9 A;  3UL3 A;  2IPA A;  3A2V A;  3GX8 A;  3L9U A;  2CX3 A;  1PN9 A;  2MZC A;  2VL3 A;  1QXH A;  3HZ8 A;  1K0A A;  4Q5N A;  2OE3 A;  3F4T A;  1GSF A;  1USB A;  4MLY A;  3RPN A;  2R5G A;  4F0C A;  4K9Z A;  2V1M A;  5IM9 A;  19GS A;  1YZX A;  2R6K A;  1YF1 A;  2AYT A;  2H0G A;  1JZO A;  4J57 E;  3HHV A;  4HEA 2;  3HJO A;  4USS A;  4EUY A;  3QAG A;  3PGT A;  4XRD A;  2HLS A;  1XZO A;  4MJA A;  5B6N A;  2HRK B;  2E2M A;  3DIE A;  3TDG A;  2V6K A;  1H75 A;  4CW9 A;  3BCK A;  1ACV A;  1FO5 A;  4X0X A;  2HXK A;  3LG6 A;  5C04 A;  4MZB A;  1DSB A;  4HZ4 A;  3IHQ A;  4OCE A;  5B7C A;  2M80 A;  2VO4 A;  2H6Y A;  2KP2 A;  3UMA A;  4ZB8 A;  3GKN A;  3CSJ A;  1JHB A;  1J9B A;  5KN3 A;  2CX4 A;  2C4J A;  1OC8 A;  1ON4 A;  5DVB A;  3UAR A;  4ID0 A;  2HZF A;  4H86 A;  3ZIT A;  1GTB A;  2RM5 A;  3ZVJ A;  4YAP A;  5D9T A;  17GS A;  4XS6 A;  4GSS A;  3IPZ A;  4TR0 A;  1EV4 A;  2LJA A;  5A4U A;  3HZ4 A;  1EEJ A;  3ZRE A;  2GST A;  2EIO A;  2K6V A;  1GSU A;  1AXD A;  4LMV A;  2IJY A;  5DAK A;  1K3O A;  3H79 A;  1GRX A;  4KAE A;  3F0I A;  4JRR A;  2B1L A;  4NWY A;  1TU8 A;  5EL8 A;  2YAN A;  1XVW A;  2JSZ A;  5ECI B;  5ECN B;  1LBK A;  4K7N A;  1GSS A;  3ZLP A;  3HVS A;  1SJ6 A;  2HRK A;  3LFL A;  2DLX A;  3ZFL A;  2B7J A;  1Z5Y E;  2K9F A;  1NHY A;  4NHW A;  1YY7 A;  1J0F A;  1BYE A;  5G5E A;  1TJD A;  1SK1 A;  5ID2 B;  4ML1 A;  5CRW A;  3E9J B;  4HZ2 A;  4E8H A;  1ZL9 A;  2IWT A;  3KTB A;  1XCC A;  2VUP A;  3O3T A;  3VLN A;  1A0R P;  1A24 A;  1I9D A;  1AAZ A;  4GTU A;  4WF4 A;  1XXU A;  4ECC A;  5CRH A;  3QCP A;  3GTU B;  2VL9 A;  2MBS A;  2C0G A;  4F82 A;  2AV4 A;  4I2T A;  5ECP B;  4XCS A;  2D2Z A;  2A2R A;  4BVY B;  2LST A;  3HVV A;  3HYP A;  2P5Q A;  4IJ3 A;  2H76 A;  2YV9 A;  4BPY A;  2ZNM A;  1DUG A;  2YCD A;  2FY6 A;  2L4Q A;  5CAX A;  3QDN A;  3CXG A;  2GVP A;  4IQ1 A;  1TU7 A;  5KN1 A;  5KN2 A;  4KSM A;  2AUV A;  3LEF A;  2YZH A;  1X9M B;  3LWA A;  2H71 A;  18GS A;  3IBH A;  3QAW A;  1W89 A;  2CZ3 A;  4N0V A;  5JCG A;  4PGT A;  4TR4 A;  4FQU A;  4NV5 A;  4NHZ A;  2L6D A;  1Q98 A;  1Z9H A;  5CRD A;  4EF0 A;  1GUM A;  1Z3E A;  2H0I A;  2VCV A;  3FHK A;  2PER A;  3DVW A;  2NTO A;  3F8U A;  1THX A;  3UVT A;  5INY A;  2LNT A;  4GRF A;  4DSR A;  4GCI A;  4WKW A;  5JCU A;  5EPF A;  2K8S A;  1B4Q A;  2VL2 C;  5D73 A;  1U6T A;  1XWB A;  4IGJ A;  4TKY A;  1UVZ A;  2KUC A;  3FR9 A;  4KB3 A;  5KN0 A;  4TOP A;  4ECB A;  4KCE A;  2G2Q A;  5AIX A;  16GS A;  1GNW A;  4PX1 A;  1XWG A;  3DRN A;  3I43 A;  4POB A;  5F05 A;  4J2F A;  3FRC A;  8GSS A;  4GWR A;  4JBB A;  5G5F A;  3IRA A;  4PTS A;  2PN8 A;  5FT3 A;  3GL5 A;  1YDK A;  3DYR A;  3UVH A;  4GST A;  3KEB A;  2C0E A;  2REM A;  1MEK A;  3HCZ A;  1VF1 A;  1PQN A;  3BCI A;  4JR4 A;  1SL0 B;  1LJR A;  4Q5F A;  1N8J A;  6GSU A;  2JL4 A;  5DAK B;  3C73 A;  3D4T A;  3J7Y k;  3HJP A;  5GAP D;  1WMJ A;  3F4S A;  1F9M A;  2LRT A;  3DEX A;  2B3S A;  2IL3 A;  4XS4 A;  2X8H A;  4MF7 A;  2C3N A;  2HE3 A;  1X9W B;  1FB0 A;  4MK3 A;  3ZFB A;  2K18 A;  2HSN B;  4CDO A;  2N5F A;  2GS3 A;  5CYY A;  2LNS A;  3L78 A;  3EIN A;  4G9H A;  11GS A;  5CRE A;  1FW1 A;  2EIR A; 
#chains in the Genus database with same CATH topology
 1SJZ A;  2OJL A;  3F9U A;  3LGC A;  1B9X C;  2RUE A;  4EDZ A;  2MYG A;  3CYN A;  5GZZ B;  5KOX A;  1YEP A;  3WYW A;  2YZU A;  1I5G A;  3ZIV A;  1M2B A;  4D73 B;  2P31 A;  4P3Y B;  5G2Z A;  5D96 A;  1R5A A;  2EC4 A;  4ECI A;  2Z9S A;  1K0D A;  1E2Y A;  1XIY A;  1IYH A;  1ZYQ B;  3LXZ A;  4HQS A;  5G1L A;  4MAB A;  2NBS A;  4KDY A;  3EYT A;  4EIP A;  2QC7 A;  3D21 A;  3CTF A;  2YN1 A;  1VF4 A;  2VD1 A;  3GKX A;  4G19 A;  3FEU A;  2DBC A;  2NVL A;  3IK7 A;  2L5L A;  2VLU A;  3A5W A;  3P90 A;  1R4W A;  1FG4 A;  3CSI A;  3RDW A;  2TRC P;  4KND A;  5GAN D;  2YWO A;  3UAP A;  3EMX A;  4ZIJ A;  3GL3 A;  3IR4 A;  3BOA A;  3TB2 A;  1SD8 A;  2WDU A;  2HZE A;  5DJM A;  2KLX A;  2HRF A;  3FZ5 A;  1YEX A;  3ZMK A;  5LCZ A;  4AJ7 A;  4ZBB A;  4V2N A;  4AKG A;  3BJ5 A;  4NPB A;  2FHE A;  3PH9 A;  1UA5 A;  2DMM A;  2R0P A;  1G6W A;  3CQF A;  1YKC A;  1T4Z A;  2EFD A;  1WIK A;  1XG8 A;  2PU9 C;  4IP1 A;  4WBJ A;  3U6V A;  2H66 A;  2H1D A;  3F3Q A;  4HU9 A;  4WEY A;  3TKR A;  4BWQ A;  2ZCT A;  4O5R A;  3S9F A;  3I9V 2;  2TRX A;  1IYI A;  2ALB A;  3D6I A;  4ICY A;  4EXJ A;  3MDK A;  3LXT A;  4K1F A;  4KA0 A;  3A5I A;  5A5K A;  4G0K A;  1A2L A;  3IK9 A;  5J3R A;  5DDL A;  1R26 A;  1XWC A;  1ERU A;  1F2E A;  1FVJ A;  2O3E A;  3VK9 A;  2OBI A;  1GTU A;  4WET A;  4K0G A;  2N5B A;  2CVK A;  5AGY A;  3M9K A;  1T8E B;  1H4O A;  4KH7 A;  2DJ0 A;  1F3B A;  1BED A;  3EU4 A;  3KJY A;  3KZQ A;  5G1K A;  4K8M A;  2JSY A;  4MMM A;  3OR5 A;  3G9B A;  1Y6E A;  3FR3 A;  2GZP A;  3TKS E;  4ZB9 A;  2F9S A;  2B5X A;  5HR3 A;  1MD3 A;  2HQT A;  1JFU A;  4KW6 A;  2FCH A;  4N10 A;  1TI1 A;  2CV4 A;  2H72 A;  2QGV A;  2YJH A;  3P8W A;  2GSS A;  3APS A;  2XC2 A;  5DAL B;  4PQI A;  10GS A;  1WOU A;  4N0Z A;  4MH2 A;  3H4K A;  4OFM A;  1NHO A;  3QOU A;  4BL7 B;  1NW2 A;  2VIM A;  2X49 A;  6GSX A;  2R0G A;  2CVB A;  2IMF A;  5IPG A;  2MMN A;  1K0B A;  1PGT A;  4ZL9 A;  5COH A;  2H19 A;  5D9W A;  3GN3 A;  1SEN A;  1QK8 A;  3F6F A;  2LQO A;  5LNK e;  3UIW A;  2HYX A;  3GKM A;  2VKZ G;  1WP0 A;  3APQ A;  2GSR A;  2IN3 A;  1PX7 A;  5L71 A;  2PMT A;  1WWJ A;  3UOM A;  1TTZ A;  4CHS A;  4LA1 A;  1TRW A;  2LRN A;  3FW2 A;  1JZD A;  3CRU A;  1XBS A;  2L5O A;  2I1U A;  3C8E A;  5A1N B;  1Y25 A;  1YF0 A;  1QQ2 A;  4MH3 A;  4QL7 A;  3VI7 A;  5IMF A;  3KM6 A;  4OFN A;  1EEM A;  2B6M A;  5ECM B;  3IA1 A;  2H75 A;  2B5E A;  4KUN A;  1OC3 A;  2EFH A;  6GSW A;  1SL2 B;  2B5Y A;  2FNO A;  5DBQ A;  5J9B A;  1G7E A;  3O76 A;  3GH6 A;  4FYC A;  4ZL8 A;  2X8C A;  3M9J A;  2H1B A;  3IAM 2;  3GYK A;  5A1N A;  1ZZY A;  3FYG A;  2DIY A;  4A5P A;  3KH7 A;  2CA8 A;  1F37 A;  1XOB A;  3CBU A;  4ACS A;  4HDE A;  4TW5 A;  3R3E A;  4V2M A;  5D93 A;  3K8N A;  3DVX A;  3A3T A;  3F6D A;  4HU7 A;  4HQZ A;  2VLV A;  2WRT A;  4YH2 A;  1V9W A;  2LEG A;  4POL A;  4L0W A;  3EUR A;  2OBK A;  2PWJ A;  4JE1 A;  4MJB A;  3G7J A;  3G7Y A;  3TKP A;  2DJK A;  1OE7 A;  4AKH A;  1X5C A;  2WW3 A;  1XPV A;  4TR1 B;  1G0T A;  2P5R A;  4YQU A;  4AGS A;  3TRX A;  5CP1 A;  2EIQ A;  3BD2 A;  2H1G A;  1JLV A;  4X1U A;  3KCM A;  1GH2 A;  5DAL A;  4WR5 A;  4KSO A;  3DML A;  5J9C A;  2PGT A;  1A8Y A;  4TXO A;  5HFG A;  4Z2U A;  2A2S A;  3NOF A;  2HRA A;  1N25 A;  3FY7 A;  2DSA A;  3VUR A;  2H0H A;  4ZBA A;  3ZVJ D;  1DE1 A;  1T00 A;  3GKK A;  1M9A A;  3HXS A;  2F8A A;  4PUA A;  1PKW A;  1O85 A;  1S4B P;  5J40 A;  2WUL A;  1X0R A;  1ERT A;  4O92 A;  5IOX A;  2B7K A;  1M99 A;  1EZK A;  2DML A;  5F0G A;  1O81 A;  3CRT A;  2L57 A;  3LSZ A;  3C7M A;  2JU5 A;  5IO2 A;  22GS A;  4FYB A;  1X5E A;  4POK A;  3ZRD A;  2WS2 A;  3DXB A;  2PBJ A;  1A23 A;  3GRX A;  2P0G A;  2R0C A;  1YKA A;  1SK0 A;  1SJI A;  1KNG A;  2VD0 A;  3HD5 A;  3WD6 A;  1T4Y A;  2MMO A;  1Z7R A;  5LD0 A;  6GST A;  5HR0 A;  2H73 A;  1XOA A;  5A34 B;  1FVK A;  3M0F A;  3RHC A;  4G10 A;  1BQ7 A;  3L9V A;  4JZQ A;  1ABA A;  1SKS B;  2HRN A;  3Q74 A;  2C3Q A;  2YWI A;  3GV1 A;  4POM A;  3KMN A;  2OAC A;  5HQP A;  1WE0 A;  3FMW A;  4YKG A;  1SK2 A;  4XRA A;  4PUF C;  1K0C A;  4X43 A;  3I69 A;  2WZS A;  5CO3 A;  2GT6 A;  5H5R A;  2IMK A;  3WT1 A;  1B48 A;  4WBR D;  3RAZ A;  1U88 A;  2O36 A;  3EE2 A;  4YKF A;  3VPT A;  4RI7 A;  1PX6 A;  1VGL A;  3O6T A;  3GUS A;  2TIR A;  2R3X A;  2OE1 A;  5HR1 A;  1XW6 A;  3F3R A;  4LLR A;  1M2A A;  1RW1 A;  4TVE A;  4ZBD A;  1EGR A;  4Q5R A;  2YWM A;  3D0Z A;  1U3I A;  2QSI A;  1TRU A;  2LKU A;  2R37 A;  4NAX A;  2CT6 A;  3HJM A;  4EC0 A;  3EC3 A;  2VL2 A;  4RI6 A;  4O7H A;  1SD9 A;  5IPH A;  3A2X A;  3F63 A;  4FH8 A;  1V2A A;  4JU5 A;  3APO A;  2O87 A;  3GFK A;  2WJU A;  2LS5 A;  1T7P B;  3MSZ A;  2IFQ A;  2RM6 A;  4ZB6 A;  2NPB A;  3GST A;  1U87 A;  1TOF A;  2M46 A;  5IMV A;  4XS4 B;  5J4U A;  2A4H A;  4IN0 A;  4G0L A;  3UJ1 A;  3D4M A;  4XHM A;  4XS1 A;  1M3I A;  1OVN A;  3IDV A;  4E68 A;  1TXU A;  5ECR B;  4QL9 A;  3ED3 A;  5G31 A;  6GSY A;  3G7I A;  4K7I A;  1PN0 A;  2J9H A;  2VOC A;  2GGT A;  2GZY A;  1YQ1 A;  4TR3 A;  3JCM L;  1QUW A;  2BMX A;  2O7K A;  3QFA C;  2YNX A;  1EWX A;  4CY8 A;  5FHI A;  1O6J A;  4ZXG A;  5IMA A;  1A8L A;  4NXI A;  4G2E A;  2WB9 A;  1X5D A;  3QPM A;  2AAW A;  2DKH A;  2JAD A;  4I97 A;  1TK0 B;  2HSH A;  5JWO B;  2YWN A;  3V1W A;  1QFN A;  5F07 A;  3HA9 A;  2XBQ A;  2DJJ A;  4AKI A;  3FZA A;  2FWF A;  4HJ2 A;  5H5Q A;  4WF5 A;  2GLR A;  1JZR A;  5A4W A;  1GTI A;  5J5N A;  4OD7 A;  4G01 A;  1OAZ A;  2WW1 A;  2E7P A;  2F3M A;  4TXV A;  4ZIL A;  4HOJ A;  1GSD A;  3M1G A;  1R5P A;  2DJ1 A;  1SYX A;  1EP8 A;  4GF0 A;  4FYU A;  4E8E A;  4AF2 A;  1ZYP A;  2FUG 2;  5J47 A;  4F9Z A;  4K7O A;  3EU3 A;  3TKQ A;  5HFI A;  4LMW A;  5H5S A;  1MTC A;  2X4A A;  5IQY A;  1ZYN A;  1EOH A;  4BA7 A;  3HKR A;  3WGE A;  5IMZ A;  3FKF A;  2XPD A;  3IHG A;  1AQV A;  1GSQ A;  1E6B A;  1TXX A;  3HVN A;  3ZYW A;  2IIY A;  2PVO C;  3H93 A;  1BX9 A;  1ZCP A;  1AUC A;  5D9X A;  3MWH A;  5ECS A;  4JR6 A;  3IE3 A;  1GSY A;  4OFT A;  1SKW B;  1TI3 A;  2VCT A;  5CNW A;  1M7T A;  2H6Z A;  2MBT A;  3KXO A;  2FLS A;  4TN8 A;  2C8U A;  1O73 A;  2FA4 A;  4XTS A;  4W66 A;  1S3C A;  1SVL A;  3ZTL A;  5B6M A;  4KDX A;  4ML6 A;  4HJM A;  4FO5 A;  3GTU A;  2DJ2 A;  5J4Y A;  3R2Q A;  3A2W A;  4V1A p;  2UZ8 A;  3KMO A;  4PI0 C;  1FB6 A;  5ECK B;  20GS A;  4V2L A;  4MDC A;  1K0N A;  3C1R A;  2VCQ A;  3MNG A;  4IP6 A;  4MPG A;  5JWQ B;  1JZW A;  4V1A g;  4OWY A;  1BJX A;  3KD0 A;  3HDC A;  1S3A A;  2F51 A;  1OKT A;  1WJK A;  3H1N A;  1M3J A;  1A0F A;  1N2A A;  5AIS A;  2OA7 A;  4DSS B;  2DC5 A;  1ZOF A;  4JED A;  1CQG A;  1GLP A;  2C0F A;  1HNB A;  1GSE A;  3FZ4 A;  4OO4 A;  5ID2 A;  4O32 A;  1Z6N A;  3NZN A;  2H1L A;  1KEB A;  5BRT A;  4KE3 A;  2A4V A;  2WVZ A;  4AKX B;  4ZB7 A;  1EP7 A;  5ELA A;  3FK8 A;  4L8E A;  4Z2R A;  2LJR A;  4TR1 A;  4MZC A;  1B8X A;  2GQL A;  1WPI A;  2PPT A;  5F06 A;  2QA1 A;  4F03 A;  3TGZ A;  3ERW A;  3D5J A;  4AJ6 A;  4ISD A;  1W4V A;  3M8N A;  1XWA A;  1PL1 A;  2C80 A;  2L59 A;  3HY2 A;  1TRV A;  2VCX A;  1X9S B;  1XVQ A;  1URM A;  1M2D A;  1PD2 1;  1Z7P A;  3Q18 A;  5ECQ B;  3W8J A;  1RQM A;  2LRC A;  2KHP A;  2YP6 A;  4FXY P;  1S3D A;  1AQW A;  1MDJ A;  3CMI A;  3SWL A;  3ERG A;  1PRX A;  1EV9 A;  2VM1 A;  3UBK A;  2I3Y A;  2CAQ A;  2X99 A;  4IHU A;  14GS A;  5HFK A;  3RGB C;  3N9J A;  2H70 A;  4YAV A;  3LJR A;  3DGQ A;  1BG5 A;  1XWK A;  1DE2 A;  3C1S A;  2K8V A;  2YV7 A;  5DCH A;  4GQC A;  4OO5 A;  5AN1 A;  4TXO B;  1AW9 A;  2RUF A;  1V40 A;  3TOT A;  3PPU A;  4MZW A;  3IV4 A;  1F3A A;  2ZUP A;  5J41 A;  4MPF A;  1PMT A;  2V32 A;  4XIH A;  2PUK C;  3TRQ A;  3C71 A;  3VWV A;  5DCG A;  1AIU A;  13GS A;  1K0O A;  1TKD B;  3DKS A;  1QMV A;  4KCA A;  4LL1 B;  4RQR A;  1DBY A;  2N5A A;  1GWC A;  1AC1 A;  1Y1U A;  1A2M A;  1NM3 A;  4MJC A;  4N11 A;  5JCW A;  1ML6 A;  5E59 A;  4K0N A;  1Q4J A;  2HSY A;  2RLI A;  2V6O A;  6GSV A;  3GNJ A;  1VRS D;  2YOI A;  2O85 A;  2A2P A;  2G0F A;  3GUR A;  4TRX A;  4RQX A;  3WGD A;  2HSM B;  3UEM A;  3PR8 A;  2R2J A;  2L4C A;  2JAC A;  3MAK A;  3GH9 A;  4PQ1 A;  1YJ6 A;  2PVQ A;  3FZ9 A;  1TDI A;  1THO A;  3F4R A;  1SL1 B;  1VF3 A;  3ME8 A;  3RFR C;  3LQ7 A;  2IMI A;  4F0B A;  2OAD A;  3W6G A;  3IOS A;  2IME A;  3J7Y b;  3KP8 A;  5DJL A;  4KX4 A;  5D9V A;  3TJG A;  4HUA A;  3HVX A;  2VAF A;  2WFC A;  2X64 A;  2LTK A;  5B8B A;  1KBN A;  1FHE A;  1Z6M A;  4IEL A;  2WVX B;  4K2X A;  1HNA A;  1PKZ A;  1TP9 A;  1G6Y A;  1MDK A;  2GTU A;  3GMF A;  5ABR A;  2VCW A;  2C1Y A;  4J56 E;  3LYP A;  2UV8 G;  2F8F A;  4BWS A;  1OC9 B;  1TRS A;  2DIZ A;  5F8B A;  4D73 A;  3VPQ A;  7GSS A;  4ECJ A;  1ST9 A;  1TW9 A;  4IVF A;  1FOH A;  5GSS A;  4RUV A;  2H6X A;  1FAA A;  3FR6 A;  2BJX A;  4IBP A;  4DSQ A;  1MD4 A;  5GST A;  3GIX A;  3IC4 A;  4NMU A;  1GUH A;  2WVY A;  3NIV A;  5ENU A;  1PSQ A;  4PXO A;  2ES7 A;  1XFL A;  4HSC X;  5D8I A;  1OC9 A;  2CZ2 A;  5IMD A;  1ERW A;  2CVD A;  2HFD A;  1OKD A;  1V58 A;  5EVO A;  4MCU A;  5ELG A;  4HS1 A;  4KF9 A;  4PQH A;  1OYJ A;  1V98 A;  5B8A A;  1HYU A;  1PL2 A;  4Q5Q A;  12GS A;  2EFC A;  1B9Y C;  2GQK A;  1BAY A;  1SVO A;  5ECL B;  3WGX A;  2L6C A;  2H8L A;  4DEJ A;  1GUL A;  4I8B A;  2IFQ B;  3ME7 A;  2VM2 A;  3RHB A;  2FD3 A;  2QKE A;  3WT2 A;  4GLT A;  3IAS 2;  2BTO T;  2FGX A;  4IQA A;  2I81 A;  2O89 A;  5IIZ A;  2LV3 A;  4PNF A;  4L0U A;  2R4V A;  1BG1 A;  3DD3 A;  4BL7 A;  1TK8 B;  5ECO B;  2MMA A;  2I9H A;  2MMZ A;  4Z2T A;  2JZT A;  4YQV A;  3LYK A;  1XW9 A;  2FA8 A;  4OMV A;  2KP1 A;  1KTE A;  3ERF A;  1U3A A;  5CRG A;  2HZE B;  1LU4 A;  4MF5 A;  3E3E A;  2C3T A;  2GDR A;  2GZZ A;  3TJB A;  3GX0 A;  2XHF A;  3IXR A;  5IO0 A;  4EIQ A;  3SBC A;  1J08 A;  2H01 A;  3TJK A;  2HNL A;  1SKR B;  4DSS A;  3ZL5 A;  2IMD A;  3RBT A;  4EO3 A;  1G7O A;  2JZS A;  3CWG A;  6GSS A;  3CSH A;  4AI6 A;  3H8Q A;  3KTL A;  2B1K A;  3VWU A;  1HNC A;  2V41 A;  3P7X A;  1GP1 A;  5G30 A;  3GA4 A;  4LL4 B;  2QA2 A;  3TCO A;  2FWG A;  4KGI A;  1K3Y A;  3QD9 A;  4N30 A;  3TJF A;  4GSN A;  3L9S A;  4NV2 A;  4EVM A;  1O7U A;  4MJE A;  3KP9 A;  2GQM A;  2CQ9 A;  4BVX B;  1ZYE A;  2XBI A;  1M0U A;  1GNE A;  3BBY A;  4MP4 A;  2LQQ A;  1OE8 A;  3TJJ A;  1HD2 A;  1SYR A;  3Q6O A;  1ZGN A;  3N5O A;  1GL8 A;  4F2I A;  1SU9 A;  5KEJ A;  2HSN A;  1O8X A;  2LJK A;  4BVX A;  3US3 A;  2GSQ A;  1FOV A;  1EOG A;  5IOW A;  2OE0 A;  4ZL7 A;  3I6A A;  2ON7 A;  3TRP A;  4K2D A;  4ULX A;  2C0D A;  4GXZ A;  4GQF A;  3Q19 A;  1S3R A;  1ERV A;  3CTG A;  2WGR A;  3ZZX A;  1AQX A;  2FWE A;  1ZMA A;  1RK4 A;  4YQM A;  2XPE A;  4L5O A;  4I5Q A;  3VI5 A;  5A5H B;  2M72 A;  1NSW A;  4PNG A;  3VFI A;  2YPM A;  4EDY A;  2X8G A;  2CAI A;  3TKS A;  1GTA A;  1MDI A;  4MF6 A;  3ISO A;  2YJ7 A;  1M9B A;  1K3L A;  2JZR A;  4Z7X A;  5IMC A;  4FIW A;  1ILO A;  3GHA A;  4QQ7 A;  3RPP A;  4QMK A;  1TK5 B;  1UC7 A;  2H74 A;  3ZIJ A;  5EY6 A;  2EFE A;  2O8V B;  4AJ8 A;  1C72 A;  3KGK A;  2V2G A;  3KIJ A;  9GSS A;  3TKS C;  1T1V A;  2VLT A;  1EGO A;  5E4W A;  2WCI A;  2AJQ B;  4K6X A;  3QFB C;  4KDU A;  4EKZ A;  4I6X A;  4X4J A;  1HQO A;  2I4A A;  1CQH A;  4IJI A;  1JLW A;  3PIN A;  5AIV A;  1A2J A;  2VCZ A;  1GUK A;  1QGV A;  5BMU A;  4PUR A;  2ON5 A;  4MA9 A;  1B4P A;  2HI7 A;  1R7H A;  3L0H A;  3AY8 A;  3M3M A;  3QR6 A;  5FWG A;  1WRY A;  1T3B A;  2J23 A;  1UN2 A;  5DQY A;  2DJ3 A;  2RII A;  1O8W A;  4IS0 A;  1F6M C;  1XW5 A;  4HI7 A;  3D22 A;  2WVX A;  4EE0 A;  3UBL A;  2KOK A;  2H1A A;  4EL1 A;  5A5H A;  1PA3 A;  2E2G A;  4L5L A;  3EMP A;  2AHE A;  5JWR B;  4DVC A;  3EVI A;  2H30 A;  5A4V A;  2E0Q A;  3W8S A;  2HT9 A;  2LUS A;  4ILF A;  3P2A A;  5KOW A;  4OCF A;  2GT5 A;  2FWH A;  5C00 A;  3MIX A;  2WZ9 A;  3L4N A;  3DWV A;  3VWW A;  2AB6 A;  3LOR A;  4I2U A;  2OKA A;  3QMX A;  2HSM A;  3VWX A;  3TUE A;  3QAV A;  3KH9 A;  3GSS A;  5DQS A;  3U5R E;  4K5R A;  5HR2 A;  4G0I A;  3TOU A;  1K0M A;  3IC8 A;  1V57 A;  4WXT A;  3ZML A;  1VF2 A;  4MNN A;  1GLQ A;  2NDO A;  3EWL A;  4BVY A;  2O5V A;  5ECH B;  3E0U A;  4WR4 A;  4IKH A;  4IW9 A;  3UL3 A;  2IPA A;  3A2V A;  3GX8 A;  3L9U A;  2CX3 A;  1PN9 A;  2MZC A;  2VL3 A;  1QXH A;  3HZ8 A;  1K0A A;  4Q5N A;  2OE3 A;  3F4T A;  1GSF A;  1USB A;  4MLY A;  3RPN A;  2R5G A;  4F0C A;  4K9Z A;  2V1M A;  5IM9 A;  19GS A;  1YZX A;  2R6K A;  1YF1 A;  2AYT A;  2H0G A;  1JZO A;  4J57 E;  3HHV A;  4HEA 2;  3HJO A;  4K5S A;  4USS A;  4EUY A;  3QAG A;  4PHZ C;  3PGT A;  4XRD A;  2HLS A;  3TU3 B;  1XZO A;  4MJA A;  5B6N A;  2HRK B;  2E2M A;  3DIE A;  3TDG A;  2V6K A;  1H75 A;  4CW9 A;  3BCK A;  1ACV A;  1FO5 A;  4X0X A;  3MYD A;  2HXK A;  3LG6 A;  5C04 A;  4MZB A;  4O5Q A;  1DSB A;  4HZ4 A;  3IHQ A;  4OCE A;  5B7C A;  2M80 A;  2VO4 A;  2H6Y A;  2KP2 A;  3UMA A;  4ZB8 A;  3GKN A;  3CSJ A;  1JHB A;  1J9B A;  5KN3 A;  2CX4 A;  2OT3 A;  2C4J A;  1OC8 A;  1ON4 A;  5DVB A;  3UAR A;  4ID0 A;  2HZF A;  4H86 A;  3ZIT A;  1GTB A;  2RM5 A;  3ZVJ A;  4YAP A;  5D9T A;  3LW9 A;  17GS A;  4XS6 A;  4GSS A;  3IPZ A;  4TR0 A;  1EV4 A;  2LJA A;  5A4U A;  3CHX C;  3HZ4 A;  1EEJ A;  1SVM A;  3ZRE A;  3HMJ G;  2GST A;  2EIO A;  2K6V A;  1GSU A;  1AXD A;  4LMV A;  2IJY A;  5DAK A;  1K3O A;  3H79 A;  1GRX A;  4KAE A;  3F0I A;  4JRR A;  2B1L A;  4NWY A;  1TU8 A;  5EL8 A;  2YAN A;  1XVW A;  2JSZ A;  5ECI B;  5ECN B;  1LBK A;  4K7N A;  1GSS A;  3ZLP A;  3HVS A;  1SJ6 A;  4GDF A;  2HRK A;  3LFL A;  2DLX A;  3ZFL A;  4CY6 A;  2B7J A;  1Z5Y E;  2K9F A;  1NHY A;  4NHW A;  1YY7 A;  1J0F A;  1BYE A;  5G5E A;  1TJD A;  1SK1 A;  4N3Z A;  5ID2 B;  4ML1 A;  5CRW A;  3E9J B;  4HZ2 A;  4E8H A;  4O5U A;  1ZL9 A;  2IWT A;  3KTB A;  1XCC A;  2VUP A;  4BIK A;  3O3T A;  3VLN A;  1A0R P;  3EPT A;  1A24 A;  1I9D A;  1AAZ A;  4GTU A;  4WF4 A;  1XXU A;  4ECC A;  5CRH A;  3QCP A;  3GTU B;  2VL9 A;  2MBS A;  2C0G A;  4F82 A;  2AV4 A;  4I2T A;  5ECP B;  4XCS A;  2D2Z A;  2A2R A;  4BVY B;  2LST A;  3HVV A;  3HYP A;  2P5Q A;  4IJ3 A;  2H76 A;  2YV9 A;  5J4V A;  4BPY A;  2ZNM A;  1DUG A;  2YCD A;  2FY6 A;  2L4Q A;  5CAX A;  3QDN A;  3CXG A;  2GVP A;  4IQ1 A;  1TU7 A;  5KN1 A;  5KN2 A;  4KSM A;  2AUV A;  3LEF A;  2YZH A;  1X9M B;  3LWA A;  2H71 A;  18GS A;  3IBH A;  1PFO A;  3QAW A;  2WW0 A;  1W89 A;  2CZ3 A;  4N0V A;  5JCG A;  4PGT A;  4TR4 A;  4FQU A;  4NV5 A;  4NHZ A;  2L6D A;  1Q98 A;  1Z9H A;  5CRD A;  4EF0 A;  1GUM A;  5A34 A;  1Z3E A;  2H0I A;  2VCV A;  3FHK A;  2PER A;  3DVW A;  2NTO A;  3F8U A;  1THX A;  3UVT A;  5INY A;  1YVL A;  2LNT A;  4GRF A;  4DSR A;  4GCI A;  4WKW A;  5JCU A;  5EPF A;  2K8S A;  1B4Q A;  2VL2 C;  5D73 A;  1U6T A;  1XWB A;  2WW2 A;  4IGJ A;  4TKY A;  1UVZ A;  2KUC A;  3FR9 A;  4KB3 A;  5KN0 A;  4TOP A;  4ECB A;  4KCE A;  2G2Q A;  5BMU B;  4PI2 C;  5AIX A;  16GS A;  1GNW A;  4PX1 A;  1XWG A;  3DRN A;  3I43 A;  4POB A;  5F05 A;  4J2F A;  3FRC A;  8GSS A;  4GWR A;  4JBB A;  5G5F A;  3IRA A;  4PTS A;  2PN8 A;  5FT3 A;  3GL5 A;  1YDK A;  3DYR A;  3UVH A;  4GST A;  1YEW C;  3KEB A;  2C0E A;  2REM A;  1MEK A;  3HCZ A;  1VF1 A;  1PQN A;  3BCI A;  4JR4 A;  1SL0 B;  1LJR A;  4Q5F A;  1BF5 A;  1N8J A;  6GSU A;  2JL4 A;  5DAK B;  3C73 A;  3D4T A;  3J7Y k;  3HJP A;  1I1I P;  5GAP D;  1WMJ A;  3F4S A;  1F9M A;  2LRT A;  3DEX A;  2B3S A;  2IL3 A;  2DKI A;  4XS4 A;  2X8H A;  4MF7 A;  2C3N A;  2HE3 A;  1X9W B;  1FB0 A;  4MK3 A;  3ZFB A;  2K18 A;  2HSN B;  4CDO A;  2N5F A;  2GS3 A;  5CYY A;  2LNS A;  3L78 A;  3EIN A;  4G9H A;  11GS A;  5CRE A;  1FW1 A;  2EIR A; 
#chains in the Genus database with same CATH homology
 1SJZ A;  2OJL A;  3F9U A;  3LGC A;  1B9X C;  2RUE A;  4EDZ A;  2MYG A;  3CYN A;  5GZZ B;  5KOX A;  1YEP A;  3WYW A;  2YZU A;  1I5G A;  3ZIV A;  1M2B A;  4D73 B;  2P31 A;  4P3Y B;  5G2Z A;  5D96 A;  1R5A A;  2EC4 A;  4ECI A;  2Z9S A;  1K0D A;  1E2Y A;  1XIY A;  1IYH A;  1ZYQ B;  3LXZ A;  4HQS A;  5G1L A;  4MAB A;  2NBS A;  4KDY A;  3EYT A;  4EIP A;  2QC7 A;  3D21 A;  3CTF A;  2YN1 A;  1VF4 A;  2VD1 A;  3GKX A;  4G19 A;  3FEU A;  2DBC A;  2NVL A;  3IK7 A;  2L5L A;  2VLU A;  3A5W A;  3P90 A;  1R4W A;  1FG4 A;  3CSI A;  3RDW A;  2TRC P;  4KND A;  5GAN D;  2YWO A;  3UAP A;  3EMX A;  4ZIJ A;  3GL3 A;  3IR4 A;  3BOA A;  3TB2 A;  1SD8 A;  2WDU A;  2HZE A;  5DJM A;  2KLX A;  2HRF A;  3FZ5 A;  1YEX A;  3ZMK A;  5LCZ A;  4AJ7 A;  4ZBB A;  4V2N A;  4AKG A;  3BJ5 A;  4NPB A;  2FHE A;  3PH9 A;  1UA5 A;  2DMM A;  2R0P A;  1G6W A;  1YKC A;  1T4Z A;  2EFD A;  1WIK A;  4IP1 A;  2PU9 C;  4WBJ A;  3U6V A;  2H66 A;  2H1D A;  3F3Q A;  4HU9 A;  4WEY A;  3TKR A;  4BWQ A;  2ZCT A;  4O5R A;  3S9F A;  3I9V 2;  2TRX A;  1IYI A;  2ALB A;  3D6I A;  4ICY A;  4EXJ A;  3MDK A;  3LXT A;  4K1F A;  4KA0 A;  3A5I A;  5A5K A;  4G0K A;  1A2L A;  3IK9 A;  5J3R A;  5DDL A;  1R26 A;  1XWC A;  1ERU A;  1F2E A;  1FVJ A;  2OBI A;  3VK9 A;  1GTU A;  4WET A;  4K0G A;  2N5B A;  2CVK A;  5AGY A;  3M9K A;  1T8E B;  1H4O A;  4KH7 A;  2DJ0 A;  1F3B A;  1BED A;  3EU4 A;  3KJY A;  3KZQ A;  5G1K A;  4K8M A;  2JSY A;  4MMM A;  3OR5 A;  3G9B A;  1Y6E A;  3FR3 A;  2GZP A;  3TKS E;  4ZB9 A;  2F9S A;  2B5X A;  5HR3 A;  1MD3 A;  2HQT A;  1JFU A;  4KW6 A;  2FCH A;  4N10 A;  1TI1 A;  2CV4 A;  2H72 A;  2QGV A;  2YJH A;  3P8W A;  2GSS A;  3APS A;  2XC2 A;  5DAL B;  4PQI A;  10GS A;  1WOU A;  4N0Z A;  4MH2 A;  3H4K A;  4OFM A;  1NHO A;  3QOU A;  4BL7 B;  1NW2 A;  2VIM A;  2X49 A;  6GSX A;  2R0G A;  2CVB A;  2IMF A;  5IPG A;  2MMN A;  1K0B A;  1PGT A;  4ZL9 A;  5COH A;  2H19 A;  5D9W A;  3GN3 A;  1SEN A;  1QK8 A;  3F6F A;  2LQO A;  5LNK e;  3UIW A;  2HYX A;  3GKM A;  2VKZ G;  1WP0 A;  3APQ A;  2GSR A;  2IN3 A;  1PX7 A;  5L71 A;  2PMT A;  1WWJ A;  3UOM A;  1TTZ A;  4CHS A;  4LA1 A;  1TRW A;  2LRN A;  3FW2 A;  1JZD A;  3CRU A;  1XBS A;  2L5O A;  2I1U A;  3C8E A;  5A1N B;  1Y25 A;  1YF0 A;  1QQ2 A;  4MH3 A;  4QL7 A;  3VI7 A;  5IMF A;  3KM6 A;  4OFN A;  1EEM A;  2B6M A;  5ECM B;  3IA1 A;  2H75 A;  2B5E A;  4KUN A;  1OC3 A;  2EFH A;  6GSW A;  1SL2 B;  2B5Y A;  2FNO A;  5DBQ A;  5J9B A;  1G7E A;  3O76 A;  3GH6 A;  4FYC A;  4ZL8 A;  2X8C A;  3M9J A;  2H1B A;  3IAM 2;  3GYK A;  5A1N A;  1ZZY A;  3FYG A;  2DIY A;  4A5P A;  3KH7 A;  2CA8 A;  1F37 A;  1XOB A;  3CBU A;  4ACS A;  4HDE A;  4TW5 A;  3R3E A;  4V2M A;  5D93 A;  3K8N A;  3A3T A;  3DVX A;  3F6D A;  4HU7 A;  4HQZ A;  2VLV A;  2WRT A;  4YH2 A;  1V9W A;  2LEG A;  4POL A;  4L0W A;  3EUR A;  2OBK A;  2PWJ A;  4JE1 A;  4MJB A;  3G7J A;  3G7Y A;  3TKP A;  2DJK A;  1OE7 A;  4AKH A;  1X5C A;  1XPV A;  4TR1 B;  1G0T A;  2P5R A;  4YQU A;  4AGS A;  3TRX A;  5CP1 A;  2EIQ A;  3BD2 A;  2H1G A;  1JLV A;  4X1U A;  3KCM A;  1GH2 A;  5DAL A;  4WR5 A;  4KSO A;  3DML A;  5J9C A;  2PGT A;  1A8Y A;  4TXO A;  5HFG A;  4Z2U A;  2A2S A;  3NOF A;  2HRA A;  1N25 A;  3FY7 A;  2DSA A;  3VUR A;  2H0H A;  4ZBA A;  3ZVJ D;  1DE1 A;  1T00 A;  3GKK A;  1M9A A;  3HXS A;  2F8A A;  4PUA A;  1PKW A;  1O85 A;  5J40 A;  2WUL A;  1X0R A;  1ERT A;  4O92 A;  5IOX A;  2B7K A;  1M99 A;  1EZK A;  2DML A;  5F0G A;  1O81 A;  3CRT A;  2L57 A;  3LSZ A;  3C7M A;  2JU5 A;  5IO2 A;  22GS A;  4FYB A;  1X5E A;  4POK A;  3ZRD A;  2WS2 A;  3DXB A;  2PBJ A;  1A23 A;  3GRX A;  2P0G A;  2R0C A;  1YKA A;  1SK0 A;  1SJI A;  1KNG A;  2VD0 A;  3HD5 A;  3WD6 A;  1T4Y A;  2MMO A;  1Z7R A;  5LD0 A;  6GST A;  5HR0 A;  2H73 A;  1XOA A;  5A34 B;  1FVK A;  3M0F A;  3RHC A;  4G10 A;  1BQ7 A;  3L9V A;  4JZQ A;  1ABA A;  1SKS B;  2HRN A;  3Q74 A;  2C3Q A;  2YWI A;  3GV1 A;  4POM A;  3KMN A;  2OAC A;  5HQP A;  1WE0 A;  3FMW A;  4YKG A;  1SK2 A;  4XRA A;  4PUF C;  1K0C A;  4X43 A;  3I69 A;  5CO3 A;  2GT6 A;  5H5R A;  2IMK A;  3WT1 A;  1B48 A;  4WBR D;  3RAZ A;  1U88 A;  3EE2 A;  4YKF A;  3VPT A;  4RI7 A;  1PX6 A;  1VGL A;  3O6T A;  3GUS A;  2TIR A;  2R3X A;  2OE1 A;  5HR1 A;  1XW6 A;  3F3R A;  4LLR A;  1M2A A;  1RW1 A;  4TVE A;  4ZBD A;  1EGR A;  4Q5R A;  2YWM A;  3D0Z A;  1U3I A;  2QSI A;  1TRU A;  2LKU A;  2R37 A;  4NAX A;  2CT6 A;  3HJM A;  4EC0 A;  3EC3 A;  2VL2 A;  4RI6 A;  4O7H A;  1SD9 A;  5IPH A;  3A2X A;  3F63 A;  4FH8 A;  1V2A A;  4JU5 A;  3APO A;  2O87 A;  3GFK A;  2WJU A;  2LS5 A;  1T7P B;  3MSZ A;  2IFQ A;  2RM6 A;  4ZB6 A;  2NPB A;  3GST A;  1U87 A;  1TOF A;  2M46 A;  5IMV A;  4XS4 B;  5J4U A;  2A4H A;  4IN0 A;  4G0L A;  3UJ1 A;  3D4M A;  4XHM A;  4XS1 A;  1OVN A;  3IDV A;  4E68 A;  1TXU A;  5ECR B;  4QL9 A;  3ED3 A;  5G31 A;  6GSY A;  3G7I A;  4K7I A;  1PN0 A;  2J9H A;  2VOC A;  2GGT A;  2GZY A;  1YQ1 A;  4TR3 A;  3JCM L;  1QUW A;  2BMX A;  2O7K A;  3QFA C;  2YNX A;  1EWX A;  4CY8 A;  5FHI A;  1O6J A;  4ZXG A;  5IMA A;  1A8L A;  4NXI A;  4G2E A;  2WB9 A;  1X5D A;  3QPM A;  2AAW A;  2DKH A;  2JAD A;  4I97 A;  1TK0 B;  2HSH A;  5JWO B;  2YWN A;  3V1W A;  1QFN A;  5F07 A;  3HA9 A;  2XBQ A;  2DJJ A;  4AKI A;  3FZA A;  2FWF A;  4HJ2 A;  5H5Q A;  4WF5 A;  2GLR A;  1JZR A;  5A4W A;  1GTI A;  5J5N A;  4OD7 A;  4G01 A;  1OAZ A;  2E7P A;  2F3M A;  4TXV A;  4ZIL A;  4HOJ A;  1GSD A;  3M1G A;  1R5P A;  2DJ1 A;  1SYX A;  1EP8 A;  4GF0 A;  4FYU A;  4E8E A;  4AF2 A;  1ZYP A;  2FUG 2;  5J47 A;  4F9Z A;  4K7O A;  3EU3 A;  3TKQ A;  5HFI A;  4LMW A;  5H5S A;  1MTC A;  2X4A A;  5IQY A;  1ZYN A;  1EOH A;  4BA7 A;  3HKR A;  3WGE A;  5IMZ A;  3FKF A;  2XPD A;  3IHG A;  1AQV A;  1GSQ A;  1E6B A;  1TXX A;  3ZYW A;  2IIY A;  2PVO C;  3H93 A;  1BX9 A;  1ZCP A;  1AUC A;  5D9X A;  3MWH A;  5ECS A;  4JR6 A;  3IE3 A;  1GSY A;  4OFT A;  1SKW B;  1TI3 A;  2VCT A;  5CNW A;  1M7T A;  2H6Z A;  2MBT A;  3KXO A;  2FLS A;  4TN8 A;  2C8U A;  1O73 A;  2FA4 A;  4XTS A;  4W66 A;  1S3C A;  1SVL A;  3ZTL A;  5B6M A;  4KDX A;  4ML6 A;  4HJM A;  4FO5 A;  3GTU A;  2DJ2 A;  5J4Y A;  3R2Q A;  3A2W A;  4V1A p;  2UZ8 A;  3KMO A;  1FB6 A;  5ECK B;  20GS A;  4V2L A;  4MDC A;  1K0N A;  3C1R A;  2VCQ A;  3MNG A;  4IP6 A;  4MPG A;  5JWQ B;  1JZW A;  4V1A g;  4OWY A;  1BJX A;  3KD0 A;  3HDC A;  1S3A A;  2F51 A;  1OKT A;  1WJK A;  3H1N A;  1A0F A;  1N2A A;  5AIS A;  2OA7 A;  4DSS B;  2DC5 A;  1ZOF A;  4JED A;  1CQG A;  1GLP A;  2C0F A;  1HNB A;  1GSE A;  3FZ4 A;  4OO4 A;  5ID2 A;  4O32 A;  1Z6N A;  3NZN A;  2H1L A;  1KEB A;  5BRT A;  4KE3 A;  2A4V A;  4AKX B;  4ZB7 A;  1EP7 A;  5ELA A;  3FK8 A;  4L8E A;  4Z2R A;  2LJR A;  4TR1 A;  4MZC A;  1B8X A;  2GQL A;  1WPI A;  2PPT A;  5F06 A;  2QA1 A;  4F03 A;  3TGZ A;  3ERW A;  3D5J A;  4AJ6 A;  4ISD A;  1W4V A;  3M8N A;  1XWA A;  1PL1 A;  2C80 A;  2L59 A;  3HY2 A;  1TRV A;  2VCX A;  1X9S B;  1XVQ A;  1URM A;  1M2D A;  1PD2 1;  1Z7P A;  3Q18 A;  5ECQ B;  3W8J A;  1RQM A;  2LRC A;  2KHP A;  2YP6 A;  1S3D A;  1AQW A;  1MDJ A;  3CMI A;  3SWL A;  3ERG A;  1PRX A;  1EV9 A;  2VM1 A;  3UBK A;  2I3Y A;  2CAQ A;  2X99 A;  4IHU A;  14GS A;  5HFK A;  3N9J A;  2H70 A;  4YAV A;  3LJR A;  3DGQ A;  1BG5 A;  1XWK A;  1DE2 A;  3C1S A;  2K8V A;  2YV7 A;  5DCH A;  4GQC A;  4OO5 A;  5AN1 A;  4TXO B;  1AW9 A;  2RUF A;  1V40 A;  3TOT A;  3PPU A;  4MZW A;  3IV4 A;  1F3A A;  2ZUP A;  5J41 A;  4MPF A;  1PMT A;  2V32 A;  4XIH A;  2PUK C;  3TRQ A;  3C71 A;  3VWV A;  5DCG A;  1AIU A;  13GS A;  1K0O A;  1TKD B;  3DKS A;  1QMV A;  4KCA A;  4LL1 B;  4RQR A;  1DBY A;  2N5A A;  1GWC A;  1AC1 A;  1Y1U A;  1A2M A;  1NM3 A;  4MJC A;  4N11 A;  5JCW A;  1ML6 A;  5E59 A;  4K0N A;  1Q4J A;  2HSY A;  2RLI A;  2V6O A;  6GSV A;  3GNJ A;  1VRS D;  2YOI A;  2O85 A;  2A2P A;  2G0F A;  3GUR A;  4TRX A;  4RQX A;  3WGD A;  2HSM B;  3UEM A;  3PR8 A;  2R2J A;  2L4C A;  2JAC A;  3MAK A;  3GH9 A;  4PQ1 A;  1YJ6 A;  2PVQ A;  3FZ9 A;  1TDI A;  1THO A;  3F4R A;  1SL1 B;  1VF3 A;  3ME8 A;  3LQ7 A;  2IMI A;  4F0B A;  2OAD A;  3W6G A;  3IOS A;  2IME A;  3J7Y b;  3KP8 A;  5DJL A;  4KX4 A;  5D9V A;  3TJG A;  4HUA A;  3HVX A;  2VAF A;  2WFC A;  2X64 A;  2LTK A;  5B8B A;  1KBN A;  1FHE A;  1Z6M A;  4IEL A;  4K2X A;  1HNA A;  1PKZ A;  1TP9 A;  1G6Y A;  1MDK A;  2GTU A;  3GMF A;  5ABR A;  2VCW A;  2C1Y A;  4J56 E;  3LYP A;  2UV8 G;  2F8F A;  4BWS A;  1OC9 B;  1TRS A;  2DIZ A;  5F8B A;  4D73 A;  3VPQ A;  7GSS A;  4ECJ A;  1ST9 A;  1TW9 A;  4IVF A;  1FOH A;  5GSS A;  4RUV A;  2H6X A;  1FAA A;  3FR6 A;  2BJX A;  4IBP A;  4DSQ A;  1MD4 A;  5GST A;  3GIX A;  3IC4 A;  4NMU A;  1GUH A;  3NIV A;  5ENU A;  1PSQ A;  4PXO A;  2ES7 A;  1XFL A;  5D8I A;  1OC9 A;  2CZ2 A;  5IMD A;  1ERW A;  2CVD A;  2HFD A;  1OKD A;  1V58 A;  5EVO A;  4MCU A;  5ELG A;  4HS1 A;  4KF9 A;  4PQH A;  1OYJ A;  1V98 A;  5B8A A;  1HYU A;  1PL2 A;  4Q5Q A;  12GS A;  2EFC A;  1B9Y C;  2GQK A;  1BAY A;  1SVO A;  5ECL B;  3WGX A;  2L6C A;  2H8L A;  4DEJ A;  1GUL A;  4I8B A;  2IFQ B;  3ME7 A;  2VM2 A;  3RHB A;  2FD3 A;  2QKE A;  3WT2 A;  4GLT A;  3IAS 2;  2BTO T;  2FGX A;  4IQA A;  2I81 A;  2O89 A;  5IIZ A;  2LV3 A;  4PNF A;  4L0U A;  2R4V A;  1BG1 A;  3DD3 A;  4BL7 A;  1TK8 B;  5ECO B;  2MMA A;  2I9H A;  2MMZ A;  4Z2T A;  2JZT A;  4YQV A;  3LYK A;  1XW9 A;  2FA8 A;  4OMV A;  2KP1 A;  1KTE A;  3ERF A;  1U3A A;  5CRG A;  2HZE B;  1LU4 A;  4MF5 A;  3E3E A;  2C3T A;  2GDR A;  2GZZ A;  3TJB A;  3GX0 A;  2XHF A;  3IXR A;  5IO0 A;  4EIQ A;  3SBC A;  1J08 A;  2H01 A;  3TJK A;  2HNL A;  1SKR B;  4DSS A;  3ZL5 A;  2IMD A;  3RBT A;  4EO3 A;  1G7O A;  2JZS A;  3CWG A;  6GSS A;  3CSH A;  4AI6 A;  3H8Q A;  3KTL A;  2B1K A;  3VWU A;  1HNC A;  2V41 A;  3P7X A;  1GP1 A;  5G30 A;  3GA4 A;  4LL4 B;  2QA2 A;  3TCO A;  2FWG A;  4KGI A;  1K3Y A;  3QD9 A;  4N30 A;  3TJF A;  4GSN A;  3L9S A;  4NV2 A;  4EVM A;  1O7U A;  4MJE A;  3KP9 A;  2GQM A;  2CQ9 A;  4BVX B;  1ZYE A;  1M0U A;  1GNE A;  3BBY A;  4MP4 A;  2XBI A;  2LQQ A;  1OE8 A;  3TJJ A;  1HD2 A;  1SYR A;  3Q6O A;  1ZGN A;  3N5O A;  1GL8 A;  4F2I A;  1SU9 A;  5KEJ A;  2HSN A;  1O8X A;  2LJK A;  4BVX A;  3US3 A;  2GSQ A;  1FOV A;  1EOG A;  5IOW A;  2OE0 A;  4ZL7 A;  3I6A A;  2ON7 A;  3TRP A;  4K2D A;  4ULX A;  2C0D A;  4GXZ A;  4GQF A;  3Q19 A;  1ERV A;  3CTG A;  2WGR A;  3ZZX A;  1AQX A;  2FWE A;  1ZMA A;  1RK4 A;  4YQM A;  2XPE A;  4L5O A;  4I5Q A;  3VI5 A;  5A5H B;  2M72 A;  1NSW A;  4PNG A;  3VFI A;  2YPM A;  4EDY A;  2X8G A;  2CAI A;  3TKS A;  1GTA A;  1MDI A;  4MF6 A;  3ISO A;  2YJ7 A;  1M9B A;  1K3L A;  2JZR A;  4Z7X A;  5IMC A;  4FIW A;  1ILO A;  3GHA A;  4QQ7 A;  3RPP A;  4QMK A;  1TK5 B;  1UC7 A;  2H74 A;  3ZIJ A;  5EY6 A;  2EFE A;  2O8V B;  4AJ8 A;  1C72 A;  3KGK A;  2V2G A;  3KIJ A;  9GSS A;  3TKS C;  1T1V A;  2VLT A;  1EGO A;  5E4W A;  2WCI A;  2AJQ B;  4K6X A;  3QFB C;  4KDU A;  4EKZ A;  4I6X A;  4X4J A;  1HQO A;  2I4A A;  1CQH A;  4IJI A;  1JLW A;  3PIN A;  5AIV A;  1A2J A;  2VCZ A;  1GUK A;  1QGV A;  5BMU A;  4PUR A;  2ON5 A;  4MA9 A;  1B4P A;  2HI7 A;  1R7H A;  3L0H A;  3AY8 A;  3M3M A;  3QR6 A;  5FWG A;  1WRY A;  1T3B A;  2J23 A;  1UN2 A;  5DQY A;  2DJ3 A;  2RII A;  1O8W A;  4IS0 A;  1F6M C;  1XW5 A;  4HI7 A;  3D22 A;  4EE0 A;  3UBL A;  2KOK A;  2H1A A;  4EL1 A;  5A5H A;  1PA3 A;  2E2G A;  4L5L A;  3EMP A;  2AHE A;  5JWR B;  4DVC A;  3EVI A;  2H30 A;  5A4V A;  2E0Q A;  3W8S A;  2HT9 A;  2LUS A;  4ILF A;  3P2A A;  5KOW A;  4OCF A;  2GT5 A;  2FWH A;  5C00 A;  3MIX A;  2WZ9 A;  3L4N A;  3DWV A;  3VWW A;  2AB6 A;  3LOR A;  4I2U A;  2OKA A;  3QMX A;  2HSM A;  3VWX A;  3TUE A;  3QAV A;  3KH9 A;  3GSS A;  5DQS A;  3U5R E;  4K5R A;  5HR2 A;  4G0I A;  3TOU A;  1K0M A;  3IC8 A;  1V57 A;  4WXT A;  3ZML A;  1VF2 A;  4MNN A;  1GLQ A;  2NDO A;  3EWL A;  4BVY A;  2O5V A;  5ECH B;  3E0U A;  4WR4 A;  4IKH A;  4IW9 A;  3UL3 A;  2IPA A;  3A2V A;  3GX8 A;  3L9U A;  2CX3 A;  1PN9 A;  2MZC A;  2VL3 A;  1QXH A;  3HZ8 A;  1K0A A;  4Q5N A;  2OE3 A;  3F4T A;  1GSF A;  1USB A;  4MLY A;  3RPN A;  2R5G A;  4F0C A;  4K9Z A;  2V1M A;  5IM9 A;  19GS A;  1YZX A;  2R6K A;  1YF1 A;  2AYT A;  2H0G A;  1JZO A;  4J57 E;  3HHV A;  4HEA 2;  3HJO A;  4K5S A;  4USS A;  4EUY A;  3QAG A;  3PGT A;  4XRD A;  2HLS A;  3TU3 B;  1XZO A;  4MJA A;  5B6N A;  2HRK B;  2E2M A;  3DIE A;  3TDG A;  2V6K A;  1H75 A;  4CW9 A;  3BCK A;  1ACV A;  1FO5 A;  4X0X A;  3MYD A;  2HXK A;  3LG6 A;  5C04 A;  4MZB A;  4O5Q A;  1DSB A;  4HZ4 A;  3IHQ A;  4OCE A;  5B7C A;  2M80 A;  2VO4 A;  2H6Y A;  2KP2 A;  3UMA A;  4ZB8 A;  3GKN A;  3CSJ A;  1JHB A;  1J9B A;  5KN3 A;  2CX4 A;  2OT3 A;  2C4J A;  1OC8 A;  1ON4 A;  5DVB A;  3UAR A;  4ID0 A;  2HZF A;  4H86 A;  3ZIT A;  1GTB A;  2RM5 A;  3ZVJ A;  4YAP A;  5D9T A;  3LW9 A;  17GS A;  4XS6 A;  4GSS A;  3IPZ A;  4TR0 A;  1EV4 A;  2LJA A;  5A4U A;  3HZ4 A;  1EEJ A;  1SVM A;  3ZRE A;  3HMJ G;  2GST A;  2EIO A;  2K6V A;  1GSU A;  1AXD A;  4LMV A;  2IJY A;  5DAK A;  1K3O A;  3H79 A;  1GRX A;  4KAE A;  3F0I A;  4JRR A;  2B1L A;  4NWY A;  1TU8 A;  5EL8 A;  2YAN A;  1XVW A;  2JSZ A;  5ECI B;  5ECN B;  1LBK A;  4K7N A;  1GSS A;  3ZLP A;  3HVS A;  1SJ6 A;  4GDF A;  2HRK A;  3LFL A;  2DLX A;  3ZFL A;  4CY6 A;  2B7J A;  1Z5Y E;  2K9F A;  1NHY A;  4NHW A;  1YY7 A;  1J0F A;  1BYE A;  5G5E A;  1TJD A;  1SK1 A;  4N3Z A;  5ID2 B;  4ML1 A;  5CRW A;  3E9J B;  4HZ2 A;  4E8H A;  4O5U A;  1ZL9 A;  2IWT A;  3KTB A;  1XCC A;  2VUP A;  3O3T A;  3VLN A;  1A0R P;  3EPT A;  1A24 A;  1I9D A;  1AAZ A;  4GTU A;  4WF4 A;  1XXU A;  4ECC A;  5CRH A;  3QCP A;  3GTU B;  2VL9 A;  2MBS A;  2C0G A;  4F82 A;  2AV4 A;  4I2T A;  5ECP B;  4XCS A;  2D2Z A;  2A2R A;  4BVY B;  2LST A;  3HVV A;  3HYP A;  2P5Q A;  4IJ3 A;  2H76 A;  2YV9 A;  5J4V A;  4BPY A;  2ZNM A;  1DUG A;  2YCD A;  2FY6 A;  2L4Q A;  5CAX A;  3QDN A;  3CXG A;  2GVP A;  4IQ1 A;  1TU7 A;  5KN1 A;  5KN2 A;  4KSM A;  2AUV A;  3LEF A;  2YZH A;  1X9M B;  3LWA A;  2H71 A;  18GS A;  3IBH A;  3QAW A;  1W89 A;  2CZ3 A;  4N0V A;  5JCG A;  4PGT A;  4TR4 A;  4FQU A;  4NV5 A;  4NHZ A;  2L6D A;  1Q98 A;  1Z9H A;  5CRD A;  4EF0 A;  1GUM A;  5A34 A;  1Z3E A;  2H0I A;  2VCV A;  3FHK A;  2PER A;  3DVW A;  2NTO A;  3F8U A;  1THX A;  3UVT A;  5INY A;  1YVL A;  2LNT A;  4GRF A;  4DSR A;  4GCI A;  4WKW A;  5JCU A;  5EPF A;  2K8S A;  1B4Q A;  2VL2 C;  5D73 A;  1U6T A;  1XWB A;  4IGJ A;  4TKY A;  1UVZ A;  2KUC A;  3FR9 A;  4KB3 A;  5KN0 A;  4TOP A;  4ECB A;  4KCE A;  2G2Q A;  5BMU B;  5AIX A;  16GS A;  1GNW A;  4PX1 A;  1XWG A;  3DRN A;  3I43 A;  4POB A;  5F05 A;  4J2F A;  3FRC A;  8GSS A;  4GWR A;  4JBB A;  5G5F A;  3IRA A;  4PTS A;  2PN8 A;  5FT3 A;  3GL5 A;  1YDK A;  3DYR A;  3UVH A;  4GST A;  3KEB A;  2C0E A;  2REM A;  1MEK A;  3HCZ A;  1VF1 A;  1PQN A;  3BCI A;  4JR4 A;  1SL0 B;  1LJR A;  4Q5F A;  1BF5 A;  1N8J A;  6GSU A;  2JL4 A;  5DAK B;  3C73 A;  3D4T A;  3J7Y k;  3HJP A;  5GAP D;  1WMJ A;  3F4S A;  1F9M A;  2LRT A;  3DEX A;  2B3S A;  2IL3 A;  2DKI A;  4XS4 A;  2X8H A;  4MF7 A;  2C3N A;  2HE3 A;  1X9W B;  1FB0 A;  4MK3 A;  3ZFB A;  2K18 A;  2HSN B;  4CDO A;  2N5F A;  2GS3 A;  5CYY A;  2LNS A;  3L78 A;  3EIN A;  4G9H A;  11GS A;  5CRE A;  1FW1 A;  2EIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...