4ID0A

Crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900011, with bound glutathione sulfinic acid (gso2h) and acetate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
204
structure length
204
Chain Sequence
SLTLFHNPASPYVRKVMVLLHETGQLNRVALQASQLSPVAPDAALNQDNPLGKIPALRLDNGQVLYDSRVILDYLDQQHVGNPLIPRDGSARWRRLTLAALADGIMDASVLVRYELALRAPEKHWEQWLDGQRDKIRRALAVLEAEAIAELASHFDIAAISVACALGYLDFRHPDLEWRQDHPQLAAWYFEISQRPSMLATRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase-like protein YibF
publication title Crystal structure of a glutathione transferase family member from Pseudomonas fluorescens Pf-5, target EFI-900011, with bound glutathione sulfinic acid (gso2h) and acetate
rcsb
source organism Pseudomonas fluorescens
total genus 65
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4id0A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4id0A01
2P0GA 3DEXA 4KA0A 5INYA 2HI7A 18GSA 3L0HA 2HSYA 2RUFA 3FR6A 2MZCA 2EIRA 4N10A 2YV9A 2KHPA 1V9WA 1TRUA 2H0IA 2P5QA 3H1NA 2VUPA 4ISDA 1A2LA 1ZZYA 3UBKA 5HR2A 4Q5FA 1XWAA 4MPGA 2QGVA 4MLYA 4FYBA 1A8LA 4JZQA 5LD0A 2IL3A 1VF3A 1U88A 4TXOA 1GWCA 3FKFA 8GSSA 1UVZA 1JZDA 5B7CA 2ON5A 2WJUA 5B8BA 3I69A 2UZ8A 1QGVA 1NW2A 5CRHA 1YEXA 2MBSA 3F8UA 3C8EA 2VL3A 1XIYA 5G1KA 9GSSA 4K7NA 6GSWA 1Y25A 3KMNA 2HRKB 3ZL5A 1SK0A 3BD2A 2VM1A 2YN1A 5DJMA 5ECQB 1TI1A 2VCVA 3GYKA 3DRNA 2JSZA 3QAGA 4KUNA 3FR3A 2FCHA 4ECBA 2LTKA 4K8MA 2YWOA 4NWYA 3KD0A 1GL8A 5ECOB 1SJZA 3D4MA 2MMNA 5DAKA 1XWGA 5C04A 4L5OA 1DE1A 2H1DA 2VCXA 1X0RA 2DIYA 4H86A 2KP2A 3J7Yb 1B48A 2VLUA 4F03A 2HZEA 3NOFA 5J41A 4IN0A 1EZKA 4BVXA 3CTGA 4XS6A 4XRDA 4WEYA 4ECJA 3VWUA 1F3BA 1SD8A 4RI7A 4N30A 2YJHA 2LKUA 1PKWA 2LV3A 4OO4A 2NTOA 2A2SA 3BCIA 1M9BA 3FRCA 5DBQA 1R4WA 3TKRA 4LL4B 2EC4A 2OBKA 5LCZA 4TKYA 2HYXA 3AY8A 5GAPD 5IQYA 1F6MC 3C73A 1GLPA 4ZBBA 2XC2A 5IPGA 3UVTA 1GRXA 2EIQA 2P31A 4PXOA 1Z3EA 1Z5YE 4XS4A 5CRGA 1R5AA 5AISA 2TRCP 1ZYEA 3TKSE 5E4WA 4ULXA 4XCSA 2DJ2A 3F6FA 4WKWA 3D22A 2K9FA 5COHA 3KCMA 1PL1A 1OC3A 2GQLA 1USBA 5DQSA 1M2AA 2WS2A 5ENUA 2LSTA 3I9V2 4KF9A 2IJYA 1XVQA 3IXRA 3ZLPA 1E2YA 4HEA2 2GVPA 4V2LA 3R3EA 2C0EA 4KX4A 4XHMA 13GSA 4I97A 3WT2A 1J9BA 4NV2A 3IHQA 2FLSA 4MABA 3VWXA 1TRVA 3GN3A 4YQUA 2XBIA 4Z7XA 2CVDA 4XIHA 3ZVJD 3P2AA 1TJDA 4POBA 3F0IA 4MF7A 4NHWA 3EMXA 4N11A 3GFKA 5AIVA 4HUAA 3ZIJA 1FB0A 2H30A 3KM6A 1TI3A 1EP7A 5HFIA 5B6NA 1JZWA 2HLSA 4BWSA 3PH9A 4MDCA 4MMMA 1X9MB 5JWOB 5FHIA 2YOIA 3D5JA 2ES7A 4KSMA 2HRFA 1T7PB 1PL2A 2H66A 4O7HA 1GUHA 3Q18A 1WRYA 4EDZA 3TJGA 2HE3A 5IMVA 3O6TA 2B5EA 2NBSA 3ZVJA 2M72A 1THOA 3KJYA 4ZL9A 1B8XA 1NHOA 2H1GA 4ZBDA 3GKMA 3ZZXA 4NAXA 4KDUA 4I5QA 1PQNA 1K0CA 2H01A 4XS1A 5ECPB 4O32A 2N5FA 2M80A 3ZRDA 2O85A 4F2IA 4Q5NA 3HY2A 3R2QA 1FAAA 5H5SA 2DSAA 3QDNA 1QK8A 3VI5A 3U6VA 3LGCA 4PX1A 5IM9A 4D73B 4L8EA 2H0GA 3FEUA 4TR1A 2GSTA 1ZOFA 1JZRA 5JWQB 1G6YA 3QMXA 3ERWA 4JU5A 2L5LA 4JEDA 22GSA 2BMXA 2X99A 20GSA 2ZNMA 4GF0A 2FNOA 2GS3A 2CZ3A 4TR4A 1B9XC 2IMEA 1YKCA 3UIWA 3TJKA 2OADA 4DSRA 2VL2C 1A0RP 5D8IA 2B7JA 3Q6OA 2C0FA 1UN2A 3TDGA 1XBSA 5G5FA 1PA3A 5DCGA 3HJOA 5F0GA 1AIUA 2TRXA 3RPNA 1S3CA 1PX7A 2LNTA 2CVBA 4V1Ag 3GIXA 1N2AA 5J9BA 3APQA 3CTFA 3K8NA 3ERFA 1ZL9A 2CZ2A 2CX3A 4I2UA 5CYYA 3F6DA 3BBYA 4OO5A 3MNGA 2VIMA 1G7EA 2OACA 2R5GA 2RM6A 3GTUB 1YY7A 3W8SA 1K3OA 3QR6A 2IMFA 3MWHA 3PINA 2KOKA 2CV4A 4KNDA 4IQ1A 1YEPA 4G9HA 4IHUA 4KCEA 5J9CA 4OFNA 3Q74A 3HA9A 4QL7A 4MH2A 3VWWA 3KEBA 1M7TA 3HD5A 1B9YC 3GH9A 3HDCA 1M99A 1B4QA 1SL0B 1A0FA 4HZ2A 4FO5A 1HNCA 2JACA 1SKRB 5JCGA 4G0IA 3DD3A 4IP6A 4BVYB 12GSA 1RK4A 2LS5A 2PPTA 1XOAA 6GSXA 2A2RA 2MMOA 4GSTA 3RDWA 3IOSA 2V41A 2C0DA 2FWGA 3TOUA 1SU9A 5H5QA 2GZZA 1EWXA 1O85A 4XTSA 5H5RA 2GQKA 2DIZA 4HQSA 2I81A 1TRSA 3DXBA 4ID0A 3GV1A 3G9BA 1URMA 4OD7A 3QOUA 3MDKA 1THXA 3HJMA 4WR4A 1GSUA 4YAPA 3PPUA 1K0MA 5KN1A 2PGTA 1GTBA 2WRTA 1WE0A 2E2MA 4HI7A 1BQ7A 1PSQA 4J2FA 1X5CA 4POMA 2H75A 1S3DA 2L6DA 2V1MA 4ZBAA 2PBJA 3FW2A 3HZ4A 3CSJA 3IE3A 2L5OA 4K6XA 4CHSA 3GX8A 3KP8A 1K3YA 2F9SA 5IPHA 3O3TA 6GSUA 1LBKA 4K2DA 4PNFA 3GL3A 3IDVA 2B1KA 3UEMA 2AJQB 2G0FA 4DSSB 2F8FA 2Z9SA 2HNLA 2E7PA 4FYUA 5A4UA 3QD9A 2H74A 3CSIA 1AC1A 5AN1A 1R7HA 3FZ9A 2LJAA 3HVVA 2JSYA 1YDKA 4PQIA 3IAM2 3KMOA 2IFQB 4YH2A 2LUSA 3MAKA 1AQVA 5D96A 5ECMB 1W89A 4V2MA 5A4WA 3FYGA 3L9SA 2CVKA 3LFLA 1PX6A 2GT6A 2KP1A 1H4OA 3HCZA 1FOVA 1HNAA 1TTZA 4NMUA 5AGYA 1V57A 1NHYA 5ID2A 1XXUA 5F06A 1M2DA 3P8WA 2HFDA 2DLXA 1EV9A 1GNEA 3GNJA 5DQYA 3EC3A 2O87A 3GTUA 2JL4A 5KN2A 2GSSA 1YJ6A 1O73A 5ELAA 2LRTA 1Q4JA 4FYCA 1MD4A 3M1GA 2CA8A 2YV7A 2GT5A 2H70A 2YJ7A 1XW5A 3GHAA 3CRTA 2R4VA 1TOFA 2GZYA 2RUEA 5F07A 3H79A 4G0LA 2EIOA 3QFAC 5D9XA 16GSA 2PMTA 4WR5A 3IK7A 3KZQA 2VCZA 4PQHA 1YZXA 4LA1A 2GQMA 3W6GA 2RIIA 2FGXA 4RQXA 2LQQA 2CT6A 2OE0A 1OC8A 3LORA 4BVYA 3CRUA 3UBLA 4GQFA 3TUEA 1HQOA 4GTUA 4K0NA 4E8EA 1IYIA 3TGZA 1PMTA 3KH9A 2IMDA 3ZMLA 3C1RA 1EGOA 1O8WA 3N9JA 1ZCPA 2DJJA 3M3MA 2VM2A 4KE3A 3KIJA 1CQHA 1AXDA 1ACVA 1FVKA 4OCEA 1O7UA 5EL8A 1OC9A 3QCPA 4ECIA 1U87A 3TB2A 3KXOA 4TN8A 2HSNB 2K8SA 3NIVA 4G19A 3ZMKA 2QC7A 4MPFA 3UJ1A 5B8AA 3ZFBA 1PD21 2I3YA 3WT1A 1XOBA 4F9ZA 1Y6EA 3NZNA 5EY6A 2B6MA 2WZ9A 4WBRD 4DSSA 3EYTA 3I43A 1KTEA 2G2QA 2TIRA 2X64A 1GSEA 4OCFA 1K0DA 2L6CA 2RLIA 4KGIA 4O92A 1TRWA 1SJIA 2AV4A 2IFQA 5D9TA 3GURA 1GSFA 4EL1A 1TP9A 2B7KA 5JWRB 5HFKA 2LRNA 1G6WA 3V1WA 4MJCA 1M0UA 1I9DA 4MH3A 4ZL8A 4EUYA 2F51A 1GH2A 3DVWA 2DJ0A 2H6YA 3RPPA 5ECNB 1TK0B 4WETA 2WDUA 5EVOA 1KEBA 2P5RA 4IJ3A 4HJ2A 2CX4A 1SK2A 4FH8A 1SL2B 1R5PA 1T00A 1EEJA 2VL2A 1ZYQB 5CRWA 2AAWA 1ABAA 1VF4A 3RHCA 4F82A 1EGRA 1WPIA 4TXVA 4JR6A 3RBTA 2R37A 5DCHA 2WULA 3EU3A 1A2MA 1FB6A 3EVIA 2YWMA 4USSA 1TK5B 5GAND 2HRKA 1GSSA 3KTLA 2R2JA 3APOA 3SBCA 3VPQA 4POLA 4JR4A 3IA1A 5IMFA 4LL1B 4I6XA 1K3LA 5ECRB 1SD9A 4IELA 2GSRA 3L9UA 5G31A 3D0ZA 1XPVA 3BCKA 2CAQA 1UC7A 3E3EA 1QFNA 5HQPA 4G0KA 1F2EA 1VF1A 3UOMA 3UMAA 3P7XA 4IS0A 2VO4A 4CW9A 3VURA 3F4RA 2C4JA 1MDKA 4NHZA 1S3AA 1GUMA 3TRPA 3U5RE 2HRNA 4IJIA 1YQ1A 3KTBA 1GULA 3DVXA 1OE8A 4EE0A 3F9UA 3VPTA 4ZXGA 2PU9C 2L59A 3ZYWA 2I9HA 3FY7A 4K1FA 4IKHA 1MDJA 5IIZA 5ABRA 3F3RA 3H93A 3A2VA 1ERWA 5JCWA 4WF5A 1SL1B 1KBNA 4KW6A 5IOWA 2MMZA 2H6XA 1GLQA 1RQMA 2X8GA 4RUVA 2B5XA 4EC0A 1SYRA 3PGTA 3QPMA 4MF5A 1DBYA 2WGRA 5GZZB 1WMJA 1TK8B 1FW1A 2NVLA 2NDOA 4DSQA 1HD2A 4N0ZA 3ZTLA 2VD1A 2DJ3A 5IO2A 5JCUA 5GSTA 4LLRA 4EXJA 4PGTA 3JCML 1GUKA 14GSA 5ECKB 3UL3A 4J57E 3WD6A 4K7OA 5IMDA 1K0OA 4Q5RA 2FA4A 1Z6NA 2WCIA 1X5EA 3GKNA 2DJKA 2VLVA 2HQTA 1K0BA 4HU9A 3GA4A 1GP1A 1Q98A 3RHBA 3IC4A 3W8JA 3G7YA 1A23A 3A5WA 5EPFA 5B6MA 3FZ4A 2FA8A 2J9HA 5D9VA 4PUAA 2YWNA 4WXTA 1OVNA 4DVCA 1XW6A 3CSHA 1WWJA 3PR8A 3VFIA 4ILFA 4AJ8A 2IPAA 3KP9A 2PVQA 2DMLA 1U3AA 5C00A 2WFCA 4IP1A 4EDYA 2CQ9A 2QKEA 3GH6A 4YAVA 2K6VA 1JLWA 2F8AA 4N0VA 3EURA 2NPBA 1X9SB 3GKKA 2HXKA 3HVSA 2KLXA 2OBIA 1KNGA 2AB6A 4KH7A 5DALB 3CBUA 7GSSA 1E6BA 1F9MA 3FR9A 1T3BA 2VCTA 3F4SA 1T4YA 4ML6A 4YQVA 3TKPA 4YQMA 2H1AA 1GNWA 4OMVA 4AF2A 1AQWA 4GSSA 4DEJA 3WGDA 4PQ1A 1X9WB 6GSVA 2FY6A 3TJJA 3N5OA 1J08A 3GSSA 1HYUA 2HSMB 2JZRA 3EMPA 3D4TA 3LYPA 3BOAA 5CNWA 5D93A 4MZCA 2N5BA 2YNXA 5F8BA 1XWKA 2DJ1A 4K7IA 4D73A 2JU5A 1FHEA 3C71A 2GGTA 2JADA 2V2GA 2OA7A 4OWYA 2GTUA 5A5KA 1EEMA 2YPMA 2VLTA 4HU7A 5ELGA 1JLVA 4FIWA 5IO0A 5DDLA 5DJLA 2YP6A 1EP8A 3D6IA 4QL9A 5DVBA 10GSA 2HT9A 2V6OA 1TXXA 3C1SA 1Z7RA 1SK1A 5FT3A 1AQXA 5A4VA 2E0QA 3DGQA 3LXZA 1WP0A 2JZSA 3QAWA 4HDEA 2WB9A 3SWLA 5G1LA 4PNGA 3S9FA 3IR4A 2FWEA 1TU8A 1IYHA 4G2EA 4LMVA 1T1VA 2MMAA 1OYJA 1X5DA 2IMKA 3FZ5A 1XW9A 5HR1A 4ZIJA 1U3IA 3C7MA 4GSNA 2LNSA 3IAS2 1UA5A 4ECCA 3HXSA 4TVEA 4XRAA 1K0AA 5IMCA 1BEDA 5HFGA 2AUVA 1TU7A 2A4VA 4P3YB 5ECIB 4EO3A 4MJAA 2VAFA 5F05A 4GCIA 1B4PA 1OAZA 4NXIA 4EF0A 4OFMA 1EV4A 1A24A 3ME7A 2K18A 2YZHA 5D73A 4KB3A 2H19A 5KEJA 2MYGA 3IK9A 2LRCA 1F37A 4BPYA 3O76A 3EWLA 4NV5A 3M8NA 3TJFA 1WOUA 5DALA 1ERTA 1I5GA 2IIYA 1MD3A 3WGXA 3HYPA 5ECHB 5GSSA 3FZAA 4K9ZA 3P90A 2L57A 3ERGA 1GTIA 2H8LA 4PURA 1MDIA 2GZPA 1EOGA 1A8YA 1ZGNA 2AHEA 3GL5A 4WF4A 1GTUA 3TOTA 1QUWA 2OE1A 2HSMA 4L0UA 2VL9A 2FWFA 2DC5A 3VWVA 5HR3A 1ON4A 3LWAA 4FQUA 1Z7PA 3H4KA 2VCQA 2YCDA 3LEFA 11GSA 1A2JA 3L9VA 4POKA 1CQGA 1ERUA 1FO5A 4HJMA 3G7JA 3RAZA 3GRXA 2GDRA 1HNBA 2F3MA 5CO3A 1TW9A 6GSTA 4ZILA 3FK8A 2PERA 3TKSC 1BYEA 3LQ7A 3H8QA 2PUKC 4ACSA 3WYWA 3ED3A 1G7OA 4MP4A 2H72A 4L5LA 4GQCA 1JFUA 1PRXA 1BJXA 2E2GA 2CAIA 3ME8A 4IVFA 5ECLB 5G2ZA 5CRDA 3I6AA 4TR1B 3DKSA 1PKZA 1PN9A 2LEGA 2BJXA 3LXTA 3IV4A 2MBTA 2H73A 2YANA 4AGSA 2L4QA 2N5AA 2VD0A 1MEKA 1BAYA 2C80A 1TKDB 1JZOA 2ALBA 4JRRA 5IOXA 4BA7A 4OFTA 2C3TA 1XVWA 2O7KA 1SYXA 1VF2A 3CYNA 3ZITA 2LJKA 4BL7B 3DWVA 3CXGA 4MCUA 3IC8A 3QAVA 2L4CA 1T4ZA 2C3QA 4ML1A 4HOJA 3LYKA 2X8CA 1V40A 3GX0A 3ZFLA 3LSZA 4X43A 1U6TA 4WBJA 3OR5A 3L4NA 1OKTA 3GSTA 2R3XA 5LNKe 1ST9A 4G10A 2XPEA 2HRAA 4I8BA 2O89A 4L0WA 1M9AA 4V2NA 2B1LA 2FD3A 2I1UA 3GUSA 2R6KA 4LMWA 4GRFA 1XZOA 1OE7A 3MSZA 4GWRA 4ZB8A 1GSDA 3LG6A 1MTCA 4NPBA 2HSHA 1J0FA 3D21A 5CAXA 1QMVA 3WGEA 2H0HA 5J4UA 4KDXA 2ZUPA 3F63A 3M0FA 1XCCA 3BJ5A 2OJLA 3HJPA 4O5RA 4JBBA 2KUCA 1BG5A 4MF6A 3UAPA 3TJBA 1ML6A 2V32A 1ILOA 2M46A 2IWTA 4RQRA 3A3TA 5E59A 3TKQA 4MZWA 4K0GA 4KSOA 1F3AA 5D9WA 1RW1A 2RM5A 1OKDA 3QFBC 2QSIA 4PUFC 5L71A 6GSSA 1TDIA 1NM3A 3M9KA 5IMAA 4TOPA 4MJBA 5AIXA 19GSA 4AJ6A 3LJRA 3UVHA 2XBQA 1PGTA 2XHFA 2BTOT 3IBHA 1FVJA 4TR0A 2GLRA 4EVMA 5KN0A 4KDYA 4E8HA 3GKXA 2OE3A 1XFLA 3E9JB 4MJEA 4HS1A 1Z6MA 3IPZA 3TRXA 2C1YA 4PTSA 4RI6A 5HR0A 1XWBA 1ERVA 1QXHA 4V1Ap 3VI7A 1XWCA 1O8XA 3UARA 5J5NA 4HQZA 1VRSD 2PN8A 1LJRA 3TCOA 3FHKA 1N8JA 2B3SA 3US3A 2D2ZA 2ZCTA 4GLTA 4KCAA 1H75A 4BL7A 5G30A 4MA9A 3EE2A 4ZB6A 2C8UA 3J7Yk 1SJ6A 3DIEA 2XPDA 3EU4A 2PWJA 4MZBA 1O6JA 4GXZA 2H71A 4EKZA 1R26A 2DBCA 1AUCA 3M9JA 2VOCA 3EINA 1LU4A 2DMMA 3A2XA 4TRXA 5ID2B 2HZFA 1V58A 3G7IA 4F0CA 2J23A 3ZIVA 1AAZA 5CREA 2REMA 1WIKA 3IRAA 2H76A 4TXOB 1DUGA 3E0UA 5KN3A 3ISOA 3HVXA 1SKSB 3F4TA 4IGJA 1AW9A 3ZREA 4BWQA 3Q19A 5ECSA 2K8VA 2YZUA 1WJKA 17GSA 1YKAA 4X0XA 1EOHA 4TR3A 1SENA 4Q5QA 6GSYA 4ZB9A 3APSA 2C0GA 2PVOC 3KH7A 1GSQA 4JE1A 2VCWA 2FHEA 3VLNA 1NSWA 2FUG2 4TW5A 1YF0A 3L78A 4F0BA 3DMLA 1C72A 4IW9A 1ZMAA 1FG4A 4CDOA 5J3RA 4ZL7A 1K0NA 2OKAA 1V2AA 5DAKB 1VGLA 5CP1A 4KAEA 1M2BA 5G5EA 1DE2A 1G0TA 1OC9B 3DYRA 2B5YA 2LJRA 1Z9HA 2X8HA 4I2TA 4X1UA 1O81A 2HZEB 2C3NA 2H1BA 5FWGA 4HZ4A 4BVXB 4IBPA 2O8VB 4IQAA 5BMUA 3VK9A 2GSQA 3A2WA 3TRQA 2H6ZA 2LQOA 3HZ8A 2IMIA 1W4VA 4MK3A 1SKWB 3CMIA 2AYTA 1DSBA 3KGKA 3HHVA 3F3QA 3GMFA 1GSYA 4AJ7A 2JZTA 2YWIA 2I4AA 2IN3A 1GTAA 1YF1A 1T8EB 2FWHA 4QQ7A 1JHBA 2V6KA 1QQ2A 2ON7A 4J56E 3TKSA 5IMZA 1BX9A 3HKRA 1V98A 4XS4B
chains in the Genus database with same CATH superfamily
4EIPA 2P0GA 3DEXA 4KA0A 5INYA 2HI7A 18GSA 3L0HA 2HSYA 2RUFA 3FR6A 2MZCA 4O5UA 2EIRA 4N10A 2YV9A 2KHPA 1V9WA 1TRUA 2H0IA 2P5QA 3H1NA 2VUPA 4ISDA 1A2LA 1ZZYA 3UBKA 5HR2A 4Q5FA 1XWAA 4MPGA 2QGVA 4MLYA 4FYBA 1A8LA 4JZQA 5LD0A 2IL3A 1VF3A 1U88A 4TXOA 1GWCA 3FKFA 8GSSA 1UVZA 1JZDA 5B7CA 2ON5A 2WJUA 5B8BA 3I69A 2UZ8A 1QGVA 1NW2A 5CRHA 1YEXA 2MBSA 3F8UA 3C8EA 2VL3A 1XIYA 5G1KA 9GSSA 4K7NA 6GSWA 1Y25A 4CY8A 3KMNA 2HRKB 3ZL5A 1SK0A 3BD2A 2VM1A 2YN1A 5DJMA 5ECQB 1TI1A 2VCVA 3GYKA 3DRNA 2JSZA 3QAGA 4KUNA 3FR3A 2FCHA 4ECBA 2LTKA 5KOWA 4K8MA 2YWOA 4NWYA 3KD0A 4G01A 1GL8A 5ECOB 1SJZA 3D4MA 2MMNA 5DAKA 1XWGA 5C04A 4L5OA 1DE1A 2H1DA 2VCXA 1X0RA 2DIYA 4H86A 2KP2A 3J7Yb 1B48A 2VLUA 4F03A 2HZEA 3NOFA 5J41A 1I1IP 4IN0A 1EZKA 4BVXA 5A34B 3CTGA 4XS6A 4XRDA 4WEYA 4ECJA 3VWUA 1F3BA 1SD8A 4RI7A 4N30A 2YJHA 2LKUA 1PKWA 2LV3A 4OO4A 2NTOA 2A2SA 3BCIA 1M9BA 3FRCA 5DBQA 1R4WA 3TKRA 4LL4B 2EC4A 2OBKA 5LCZA 4TKYA 4GDFA 4PI0C 2HYXA 3AY8A 5GAPD 5IQYA 1F6MC 3C73A 1GLPA 4ZBBA 2XC2A 5IPGA 3UVTA 1GRXA 2EIQA 2P31A 4PXOA 1Z3EA 1Z5YE 4XS4A 5CRGA 1R5AA 5AISA 2TRCP 1ZYEA 3TKSE 5E4WA 4ULXA 4XCSA 2WVXB 3F6FA 2DJ2A 4WKWA 1ZYPA 3D22A 2K9FA 1S4BP 5COHA 3KCMA 1PL1A 1OC3A 2GQLA 1USBA 5DQSA 1M2AA 2WS2A 5ENUA 2LSTA 3I9V2 4KF9A 2IJYA 1XVQA 3IXRA 3ZLPA 1E2YA 4HEA2 2GVPA 4V2LA 3R3EA 2C0EA 4KX4A 4XHMA 13GSA 4I97A 3WT2A 1J9BA 4NV2A 3IHQA 5A5HA 2FLSA 4MABA 3VWXA 1TRVA 3GN3A 3RFRC 4YQUA 2XBIA 4Z7XA 2CVDA 4XIHA 3ZVJD 3P2AA 1TJDA 4POBA 3F0IA 4MF7A 4NHWA 3EMXA 4N11A 2QA1A 3GFKA 5AIVA 4HUAA 3ZIJA 1FB0A 3CWGA 2H30A 3KM6A 1TI3A 5J47A 1EP7A 5HFIA 5B6NA 1JZWA 2HLSA 4BWSA 3PH9A 4MDCA 4MMMA 1X9MB 5JWOB 5FHIA 2YOIA 3D5JA 2ES7A 4KSMA 2HRFA 1T7PB 1PL2A 2H66A 4O7HA 1GUHA 3Q18A 1WRYA 4EDZA 3TJGA 2HE3A 5IMVA 3O6TA 2B5EA 2NBSA 3ZVJA 2M72A 5BRTA 1THOA 3RGBC 3KJYA 4ZL9A 1B8XA 1NHOA 2H1GA 4ZBDA 3GKMA 3ZZXA 4NAXA 4KDUA 4I5QA 1PQNA 1K0CA 2H01A 4XS1A 5ECPB 4O32A 2N5FA 5A34A 2M80A 3ZRDA 2O85A 5J4VA 4F2IA 4Q5NA 3HY2A 3R2QA 1FAAA 5H5SA 2DSAA 3QDNA 1QK8A 3VI5A 3U6VA 3LGCA 4PX1A 5IM9A 4D73B 4L8EA 2H0GA 3FEUA 4TR1A 2GSTA 1ZOFA 1JZRA 5JWQB 1G6YA 3QMXA 3ERWA 4JU5A 2L5LA 4JEDA 22GSA 2BMXA 2X99A 20GSA 2ZNMA 4GF0A 2FNOA 2GS3A 2CZ3A 4TR4A 1B9XC 4A5PA 2IMEA 1YKCA 3UIWA 3TJKA 2OADA 4DSRA 2VL2C 1A0RP 5D8IA 2B7JA 3Q6OA 2C0FA 1UN2A 3TDGA 1XBSA 5G5FA 1PA3A 5DCGA 3HJOA 5F0GA 1AIUA 2TRXA 3RPNA 1S3CA 1PX7A 2LNTA 2CVBA 4V1Ag 3GIXA 1N2AA 5J9BA 3APQA 1PFOA 3CTFA 3K8NA 3ERFA 1ZL9A 2CZ2A 2CX3A 4I2UA 4Z2TA 5CYYA 3F6DA 3BBYA 4OO5A 3MNGA 2VIMA 1G7EA 2OACA 2R5GA 2RM6A 3GTUB 1YY7A 3W8SA 1K3OA 3QR6A 2IMFA 3MWHA 3PINA 2KOKA 2CV4A 2A4HA 3IHGA 4IQ1A 4KNDA 1YEPA 4G9HA 4IHUA 4KCEA 5J9CA 4OFNA 3Q74A 3HA9A 4QL7A 4MH2A 3VWWA 3KEBA 1M7TA 3HD5A 1B9YC 3GH9A 2WW3A 3HDCA 1M99A 1B4QA 1SL0B 1A0FA 4HZ2A 4FO5A 1HNCA 2X49A 2JACA 1SKRB 5JCGA 4G0IA 3DD3A 4IP6A 4BVYB 12GSA 1RK4A 2LS5A 2PPTA 1XOAA 6GSXA 2A2RA 2MMOA 4GSTA 3RDWA 4X4JA 3IOSA 2V41A 2C0DA 2FWGA 3TOUA 1SU9A 5H5QA 2GZZA 1EWXA 1O85A 4XTSA 5H5RA 2WVZA 2GQKA 2DIZA 4HQSA 2I81A 4YKGA 1TRSA 3DXBA 4ID0A 3GV1A 3G9BA 5KOXA 1URMA 1PN0A 4OD7A 3QOUA 3MDKA 1THXA 4AKIA 3HJMA 4WR4A 4PHZC 4YKFA 1GSUA 4YAPA 3PPUA 1K0MA 5KN1A 2PGTA 1GTBA 2WRTA 1WE0A 2E2MA 4HI7A 1BQ7A 1PSQA 4J2FA 2EFDA 1X5CA 4POMA 2H75A 1YVLA 1S3DA 2L6DA 2V1MA 4ZBAA 2PBJA 3FW2A 3HZ4A 3CSJA 3IE3A 2L5OA 3EPTA 4K6XA 4CHSA 3GX8A 3KP8A 1K3YA 2F9SA 5IPHA 3O3TA 6GSUA 1LBKA 4K2DA 4PNFA 3GL3A 3IDVA 2B1KA 3UEMA 2AJQB 2G0FA 4DSSB 2F8FA 2Z9SA 2HNLA 2E7PA 4FYUA 5A4UA 3QD9A 2H74A 3CSIA 1AC1A 5AN1A 1R7HA 3FZ9A 2LJAA 3HVVA 2JSYA 1YDKA 4PQIA 3IAM2 3KMOA 2IFQB 4YH2A 2LUSA 3MAKA 1AQVA 5D96A 5ECMB 1W89A 4V2MA 5A4WA 3FYGA 3L9SA 2CVKA 3LFLA 1PX6A 2R0GA 2GT6A 2KP1A 1H4OA 3HCZA 1FOVA 1HNAA 1TTZA 4NMUA 5AGYA 1V57A 2QA2A 1NHYA 5ID2A 1XXUA 5F06A 1M2DA 3P8WA 2HFDA 2DLXA 1EV9A 1GNEA 3GNJA 5DQYA 3EC3A 2O87A 3GTUA 2JL4A 5KN2A 2GSSA 1YJ6A 1O73A 5ELAA 2LRTA 1Q4JA 4FYCA 1MD4A 3M1GA 2CA8A 2YV7A 2GT5A 2H70A 2YJ7A 3MIXA 1XW5A 3GHAA 3CRTA 2R4VA 1TOFA 2GZYA 2RUEA 2EFEA 5F07A 3H79A 4G0LA 2EIOA 3QFAC 5D9XA 16GSA 2PMTA 4WR5A 3IK7A 3KZQA 2VCZA 4PQHA 1YZXA 4LA1A 2GQMA 3W6GA 2RIIA 2FGXA 4RQXA 2LQQA 2CT6A 2OE0A 1OC8A 2VKZG 3LORA 4BVYA 4QMKA 3CRUA 3UBLA 4GQFA 3TUEA 1HQOA 4GTUA 4K0NA 4E8EA 1IYIA 1YEWC 3TGZA 1PMTA 3KH9A 2IMDA 3ZMLA 3C1RA 1EGOA 1O8WA 5J40A 3N9JA 1ZCPA 2DJJA 3M3MA 2VM2A 4KE3A 3KIJA 1CQHA 1Y1UA 1AXDA 1ACVA 1FVKA 4OCEA 1O7UA 5EL8A 1OC9A 3QCPA 4ECIA 1U87A 3TB2A 3KXOA 4TN8A 2HSNB 2K8SA 3NIVA 4G19A 3ZMKA 2EFCA 2QC7A 4MPFA 3UJ1A 5B8AA 3ZFBA 2R0CA 1S3RA 1PD21 2I3YA 4Z2RA 3WT1A 1XOBA 4F9ZA 1Y6EA 3NZNA 5EY6A 3FMWA 1N25A 2B6MA 2WZ9A 4WBRD 4DSSA 3EYTA 3I43A 1KTEA 2G2QA 2TIRA 2X64A 1GSEA 4OCFA 1K0DA 2L6CA 2UV8G 2RLIA 4KGIA 4O92A 1TRWA 1SJIA 2AV4A 2IFQA 5D9TA 3GURA 4MNNA 1GSFA 4EL1A 1TP9A 2B7KA 5JWRB 5HFKA 2LRNA 1G6WA 3V1WA 4MJCA 1M0UA 5A1NB 1I9DA 4MH3A 4ZL8A 4EUYA 2F51A 1GH2A 3DVWA 2DJ0A 2H6YA 3RPPA 5ECNB 1TK0B 4WETA 2WDUA 5EVOA 1KEBA 2P5RA 4IJ3A 4HJ2A 2CX4A 1SK2A 4FH8A 1SL2B 1R5PA 1T00A 1EEJA 2VL2A 1ZYQB 5CRWA 2AAWA 1ABAA 1VF4A 3RHCA 4F82A 1EGRA 1WPIA 4TXVA 4JR6A 3RBTA 2R37A 5DCHA 2WULA 1BF5A 3EU3A 1A2MA 1FB6A 3EVIA 2YWMA 4USSA 1TK5B 5GAND 2HRKA 1GSSA 3KTLA 2R2JA 3APOA 3SBCA 3VPQA 4POLA 4JR4A 4EIQA 3IA1A 5IMFA 4LL1B 4I6XA 1K3LA 5ECRB 1SD9A 4IELA 2GSRA 3L9UA 5G31A 3D0ZA 1XPVA 3BCKA 2CAQA 1UC7A 3E3EA 1QFNA 5HQPA 4G0KA 1F2EA 1VF1A 3UOMA 3UMAA 3P7XA 4IS0A 2VO4A 4CW9A 3VURA 3F4RA 2C4JA 1MDKA 4NHZA 1S3AA 4BIKA 1GUMA 3TRPA 3U5RE 2HRNA 4IJIA 1YQ1A 3KTBA 2HSNA 1GULA 3DVXA 1OE8A 4EE0A 3F9UA 3VPTA 4ZXGA 2PU9C 2L59A 3ZYWA 2I9HA 3FY7A 4K1FA 4IKHA 1MDJA 5IIZA 5ABRA 3F3RA 3H93A 3A2VA 1ERWA 5JCWA 4WF5A 1SL1B 1KBNA 4KW6A 5IOWA 2MMZA 2H6XA 1GLQA 1TXUA 1RQMA 2X8GA 4RUVA 2B5XA 4EC0A 1SYRA 3PGTA 3QPMA 4MF5A 1DBYA 2WGRA 5GZZB 1SVOA 1WMJA 1TK8B 1FW1A 2NVLA 2NDOA 4DSQA 1HD2A 4N0ZA 3ZTLA 2VD1A 2DJ3A 5IO2A 5JCUA 5GSTA 4LLRA 4EXJA 4PGTA 3JCML 1GUKA 14GSA 2WVXA 5ECKB 3TU3B 3UL3A 4J57E 3WD6A 4K7OA 5IMDA 1K0OA 4Q5RA 2FA4A 1Z6NA 2WCIA 1X5EA 3GKNA 2DJKA 3MYDA 2VLVA 2HQTA 1K0BA 4HU9A 3GA4A 1GP1A 1Q98A 3RHBA 3IC4A 3W8JA 3G7YA 1A23A 3A5WA 5EPFA 5B6MA 3FZ4A 1FOHA 2FA8A 2J9HA 5D9VA 4PUAA 2YWNA 4WXTA 1OVNA 4DVCA 1XW6A 3CSHA 1WWJA 3PR8A 3VFIA 4ILFA 4AJ8A 2IPAA 3KP9A 2PVQA 2DMLA 1U3AA 5C00A 2WFCA 4IP1A 4EDYA 2CQ9A 2QKEA 3GH6A 4YAVA 2K6VA 1JLWA 2F8AA 4N0VA 3EURA 2NPBA 1X9SB 3GKKA 2HXKA 3HVSA 2KLXA 2OBIA 1KNGA 2WW1A 2AB6A 4KH7A 5DALB 3CBUA 7GSSA 1E6BA 1F9MA 3FR9A 1XG8A 1T3BA 2VCTA 3A5IA 3F4SA 1T4YA 4ML6A 4YQVA 3TKPA 4YQMA 2H1AA 1GNWA 4OMVA 4AF2A 1AQWA 4GSSA 4DEJA 3WGDA 2OT3A 4PQ1A 1X9WB 6GSVA 2FY6A 3TJJA 3N5OA 1J08A 3GSSA 1HYUA 2HSMB 2JZRA 3EMPA 3D4TA 3LYPA 3BOAA 5CNWA 5D93A 4MZCA 2N5BA 2YNXA 5F8BA 1XWKA 2DJ1A 4K7IA 4D73A 3LW9A 2JU5A 1FHEA 2WW0A 3C71A 2GGTA 2JADA 2V2GA 2OA7A 4OWYA 2GTUA 5A5KA 4ZB7A 1EEMA 2YPMA 2VLTA 2X4AA 4HU7A 5ELGA 1JLVA 4FIWA 5IO0A 5DDLA 5DJLA 2YP6A 1EP8A 3D6IA 4QL9A 5DVBA 10GSA 2HT9A 2V6OA 1TXXA 3C1SA 3CHXC 1Z7RA 1SK1A 5FT3A 1AQXA 5A4VA 2E0QA 3DGQA 3LXZA 1WP0A 2JZSA 5J4YA 3QAWA 4HDEA 2WB9A 3SWLA 5G1LA 4PNGA 4K2XA 3S9FA 3IR4A 4W66A 1BG1A 2FWEA 1TU8A 1IYHA 4G2EA 4LMVA 1T1VA 2MMAA 4O5QA 1OYJA 1X5DA 2IMKA 3FZ5A 1XW9A 5HR1A 4ZIJA 1U3IA 3C7MA 4GSNA 2LNSA 3IAS2 1UA5A 1M3JA 4ECCA 3HXSA 4TVEA 4XRAA 1K0AA 5IMCA 1BEDA 5HFGA 2AUVA 1TU7A 2A4VA 4P3YB 5ECIB 4EO3A 4MJAA 2VAFA 5F05A 4GCIA 1B4PA 1OAZA 4NXIA 4EF0A 4OFMA 1EV4A 1SVMA 1A24A 3ME7A 2K18A 2YZHA 5A5HB 5D73A 4KB3A 2H19A 5KEJA 2MYGA 3IK9A 2LRCA 1F37A 4BPYA 3O76A 3EWLA 4NV5A 2WVYA 3M8NA 3TJFA 1WOUA 5DALA 1ERTA 1I5GA 2IIYA 1MD3A 3WGXA 3HYPA 5ECHB 5GSSA 3FZAA 4K9ZA 3P90A 2L57A 2O3EA 3ERGA 1GTIA 2H8LA 4PURA 1MDIA 2GZPA 1EOGA 1A8YA 1ZGNA 3GL5A 2AHEA 4WF4A 1GTUA 2R0PA 3TOTA 1QUWA 2OE1A 2HSMA 4L0UA 2VL9A 2FWFA 2DC5A 4AI6A 3VWVA 5HR3A 4K5SA 1ON4A 3LWAA 4FQUA 1Z7PA 3H4KA 2VCQA 2YCDA 3LEFA 4E68A 11GSA 1A2JA 3L9VA 4POKA 1CQGA 1ERUA 1FO5A 4HJMA 3G7JA 3RAZA 3GRXA 2GDRA 1HNBA 2F3MA 5CO3A 1TW9A 6GSTA 4ZILA 3FK8A 2PERA 3TKSC 1BYEA 3LQ7A 3H8QA 2PUKC 4ACSA 3HVNA 3WYWA 3ED3A 1G7OA 2DKIA 4MP4A 2H72A 4L5LA 4GQCA 1JFUA 1PRXA 1BJXA 2E2GA 1SVLA 2CAIA 3ME8A 4IVFA 5ECLB 5G2ZA 5CRDA 3I6AA 4TR1B 3DKSA 3HMJG 1PKZA 1PN9A 2LEGA 2BJXA 3LXTA 3IV4A 2MBTA 2H73A 2YANA 4AGSA 2L4QA 2N5AA 2VD0A 1MEKA 1BAYA 2C80A 1TKDB 1JZOA 2ALBA 4JRRA 5IOXA 4AKGA 4PI2C 4BA7A 4OFTA 2C3TA 1XVWA 2O7KA 1SYXA 1VF2A 3CYNA 3ZITA 2LJKA 4BL7B 3DWVA 3CXGA 4MCUA 3IC8A 3QAVA 2L4CA 1T4ZA 2EFHA 2C3QA 4N3ZA 4ML1A 4AKHA 4HOJA 3LYKA 4ICYA 2X8CA 1V40A 3GX0A 3ZFLA 2O5VA 3LSZA 4X43A 1U6TA 4WBJA 3OR5A 3L4NA 1OKTA 3GSTA 2R3XA 5LNKe 1ST9A 1M3IA 4G10A 2XPEA 2HRAA 4I8BA 2O89A 4L0WA 1M9AA 4V2NA 2B1LA 2FD3A 2I1UA 3GUSA 2R6KA 4LMWA 4GRFA 1XZOA 1OE7A 3MSZA 4GWRA 4ZB8A 1GSDA 3LG6A 1MTCA 4NPBA 2HSHA 1J0FA 3D21A 5CAXA 1QMVA 3WGEA 2H0HA 5J4UA 4KDXA 2ZUPA 3F63A 3M0FA 1XCCA 3BJ5A 2OJLA 3HJPA 4O5RA 4JBBA 2KUCA 1BG5A 4MF6A 3UAPA 3TJBA 1ML6A 2V32A 4HSCX 1ILOA 2M46A 2IWTA 4RQRA 3A3TA 5E59A 3TKQA 4MZWA 4K0GA 4KSOA 1F3AA 5D9WA 1RW1A 2RM5A 1OKDA 3QFBC 2QSIA 4PUFC 5L71A 6GSSA 1TDIA 1NM3A 3M9KA 5IMAA 4TOPA 4MJBA 5AIXA 19GSA 4AJ6A 3LJRA 3UVHA 2XBQA 1PGTA 2XHFA 2BTOT 5BMUB 3IBHA 1FVJA 4TR0A 2GLRA 4EVMA 5KN0A 4KDYA 4E8HA 3GKXA 2H1LA 2OE3A 1XFLA 3E9JB 4MJEA 4HS1A 1Z6MA 3IPZA 3TRXA 2C1YA 4PTSA 4RI6A 5HR0A 1XWBA 1ERVA 1QXHA 4V1Ap 5A1NA 3VI7A 1XWCA 1O8XA 3UARA 5J5NA 4HQZA 1VRSD 2PN8A 1LJRA 3TCOA 3FHKA 1N8JA 2B3SA 3US3A 2D2ZA 2ZCTA 4GLTA 4KCAA 1H75A 4BL7A 5G30A 4MA9A 3EE2A 4ZB6A 2C8UA 3J7Yk 1SJ6A 3DIEA 2XPDA 3EU4A 2PWJA 4K5RA 4MZBA 1O6JA 4GXZA 2H71A 4EKZA 1R26A 2DBCA 1AUCA 3M9JA 2VOCA 3EINA 1LU4A 2DMMA 3A2XA 4TRXA 5ID2B 2HZFA 1V58A 3G7IA 4F0CA 2J23A 3ZIVA 1AAZA 5CREA 2REMA 1WIKA 3IRAA 2H76A 4TXOB 1DUGA 3E0UA 5KN3A 3ISOA 2O36A 3HVXA 1SKSB 3F4TA 4IGJA 1AW9A 3ZREA 4AKXB 4BWQA 3Q19A 5ECSA 2K8VA 2YZUA 1WJKA 17GSA 1YKAA 4X0XA 1EOHA 4TR3A 1SENA 4Q5QA 6GSYA 4ZB9A 3APSA 2C0GA 2PVOC 3KH7A 1GSQA 4JE1A 2VCWA 2FHEA 3VLNA 4Z2UA 4FXYP 1NSWA 2FUG2 4TW5A 2WW2A 1YF0A 3L78A 4F0BA 3DMLA 1C72A 4IW9A 1ZMAA 1FG4A 4CDOA 3CQFA 5J3RA 4ZL7A 1K0NA 2OKAA 1ZYNA 1V2AA 5DAKB 1VGLA 5CP1A 4KAEA 1M2BA 5G5EA 1DE2A 1G0TA 1OC9B 3DYRA 2B5YA 2LJRA 1Z9HA 2X8HA 4I2TA 4X1UA 1O81A 2HZEB 2C3NA 2H1BA 5FWGA 4HZ4A 4BVXB 4IBPA 2O8VB 4IQAA 5BMUA 3VK9A 2GSQA 3A2WA 2DKHA 3TRQA 2H6ZA 2LQOA 3HZ8A 2IMIA 4CY6A 1W4VA 4MK3A 1SKWB 3CMIA 2AYTA 1DSBA 3KGKA 3HHVA 2A2PA 3F3QA 3GMFA 1GSYA 4AJ7A 2JZTA 2YWIA 2I4AA 2IN3A 2WZSA 1GTAA 1YF1A 1T8EB 2FWHA 4QQ7A 1JHBA 2V6KA 1QQ2A 2ON7A 4J56E 3TKSA 5IMZA 1BX9A 3HKRA 1V98A 4XS4B
chains in the Genus database with same CATH topology
4EIPA 2P0GA 3DEXA 4KA0A 5INYA 2HI7A 18GSA 3L0HA 2HSYA 2RUFA 3FR6A 2MZCA 4O5UA 2EIRA 4N10A 2YV9A 2KHPA 1V9WA 1TRUA 2H0IA 2P5QA 3H1NA 2VUPA 4ISDA 1A2LA 1ZZYA 3UBKA 5HR2A 4Q5FA 1XWAA 4MPGA 2QGVA 4MLYA 4FYBA 1A8LA 4JZQA 5LD0A 2IL3A 1VF3A 1U88A 4TXOA 1GWCA 3FKFA 8GSSA 1UVZA 1JZDA 5B7CA 2ON5A 2WJUA 5B8BA 3I69A 2UZ8A 1QGVA 1NW2A 5CRHA 1YEXA 2MBSA 3F8UA 3C8EA 2VL3A 1XIYA 5G1KA 9GSSA 4K7NA 6GSWA 1Y25A 4CY8A 3KMNA 2HRKB 3ZL5A 1SK0A 3BD2A 2VM1A 2YN1A 5DJMA 5ECQB 1TI1A 2VCVA 3GYKA 3DRNA 2JSZA 3QAGA 4KUNA 3FR3A 2FCHA 4ECBA 2LTKA 5KOWA 4K8MA 2YWOA 4NWYA 3KD0A 4G01A 1GL8A 5ECOB 1SJZA 3D4MA 2MMNA 5DAKA 1XWGA 5C04A 4L5OA 1DE1A 2H1DA 2VCXA 1X0RA 2DIYA 4H86A 2KP2A 3J7Yb 1B48A 2VLUA 4F03A 2HZEA 3NOFA 5J41A 4IN0A 1EZKA 4BVXA 5A34B 3CTGA 4XS6A 4XRDA 4WEYA 4ECJA 3VWUA 1F3BA 1SD8A 4RI7A 4N30A 2YJHA 2LKUA 1PKWA 2LV3A 4OO4A 2NTOA 2A2SA 3BCIA 1M9BA 3FRCA 5DBQA 1R4WA 3TKRA 4LL4B 2EC4A 2OBKA 5LCZA 4TKYA 4GDFA 2HYXA 3AY8A 5GAPD 5IQYA 1F6MC 3C73A 1GLPA 4ZBBA 2XC2A 5IPGA 3UVTA 1GRXA 2EIQA 2P31A 4PXOA 1Z3EA 1Z5YE 4XS4A 5CRGA 1R5AA 5AISA 2TRCP 1ZYEA 3TKSE 5E4WA 4ULXA 4XCSA 2DJ2A 3F6FA 4WKWA 1ZYPA 3D22A 2K9FA 5COHA 3KCMA 1PL1A 1OC3A 2GQLA 1USBA 5DQSA 1M2AA 2WS2A 5ENUA 2LSTA 3I9V2 4KF9A 2IJYA 1XVQA 3IXRA 3ZLPA 1E2YA 4HEA2 2GVPA 4V2LA 3R3EA 2C0EA 4KX4A 4XHMA 13GSA 4I97A 3WT2A 1J9BA 4NV2A 3IHQA 5A5HA 2FLSA 4MABA 3VWXA 1TRVA 3GN3A 4YQUA 2XBIA 4Z7XA 2CVDA 4XIHA 3ZVJD 3P2AA 1TJDA 4POBA 3F0IA 4MF7A 4NHWA 3EMXA 4N11A 2QA1A 3GFKA 5AIVA 4HUAA 3ZIJA 1FB0A 3CWGA 2H30A 3KM6A 1TI3A 5J47A 1EP7A 5HFIA 5B6NA 1JZWA 2HLSA 4BWSA 3PH9A 4MDCA 4MMMA 1X9MB 5JWOB 5FHIA 2YOIA 3D5JA 2ES7A 4KSMA 2HRFA 1T7PB 1PL2A 2H66A 4O7HA 1GUHA 3Q18A 1WRYA 4EDZA 3TJGA 2HE3A 5IMVA 3O6TA 2B5EA 2NBSA 3ZVJA 2M72A 5BRTA 1THOA 3KJYA 4ZL9A 1B8XA 1NHOA 2H1GA 4ZBDA 3GKMA 3ZZXA 4NAXA 4KDUA 4I5QA 1PQNA 1K0CA 2H01A 4XS1A 5ECPB 4O32A 2N5FA 5A34A 2M80A 3ZRDA 2O85A 5J4VA 4F2IA 4Q5NA 3HY2A 3R2QA 1FAAA 5H5SA 2DSAA 3QDNA 1QK8A 3VI5A 3U6VA 3LGCA 4PX1A 5IM9A 4D73B 4L8EA 2H0GA 3FEUA 4TR1A 2GSTA 1ZOFA 1JZRA 5JWQB 1G6YA 3QMXA 3ERWA 4JU5A 2L5LA 4JEDA 22GSA 2BMXA 2X99A 20GSA 2ZNMA 4GF0A 2FNOA 2GS3A 2CZ3A 4TR4A 1B9XC 4A5PA 2IMEA 1YKCA 3UIWA 3TJKA 2OADA 4DSRA 2VL2C 1A0RP 5D8IA 2B7JA 3Q6OA 2C0FA 1UN2A 3TDGA 1XBSA 5G5FA 1PA3A 5DCGA 3HJOA 5F0GA 1AIUA 2TRXA 3RPNA 1S3CA 1PX7A 2LNTA 2CVBA 4V1Ag 3GIXA 1N2AA 5J9BA 3APQA 3CTFA 3K8NA 3ERFA 1ZL9A 2CZ2A 2CX3A 4I2UA 4Z2TA 5CYYA 3F6DA 3BBYA 4OO5A 3MNGA 2VIMA 1G7EA 2OACA 2R5GA 2RM6A 3GTUB 1YY7A 3W8SA 1K3OA 3QR6A 2IMFA 3MWHA 3PINA 2KOKA 2CV4A 2A4HA 3IHGA 4IQ1A 4KNDA 1YEPA 4G9HA 4IHUA 4KCEA 5J9CA 4OFNA 3Q74A 3HA9A 4QL7A 4MH2A 3VWWA 3KEBA 1M7TA 3HD5A 1B9YC 3GH9A 3HDCA 1M99A 1B4QA 1SL0B 1A0FA 4HZ2A 4FO5A 1HNCA 2X49A 2JACA 1SKRB 5JCGA 4G0IA 3DD3A 4IP6A 4BVYB 12GSA 1RK4A 2LS5A 2PPTA 1XOAA 6GSXA 2A2RA 2MMOA 4GSTA 3RDWA 4X4JA 3IOSA 2V41A 2C0DA 2FWGA 3TOUA 1SU9A 5H5QA 2GZZA 1EWXA 1O85A 4XTSA 5H5RA 2GQKA 2DIZA 4HQSA 2I81A 4YKGA 1TRSA 3DXBA 4ID0A 3GV1A 3G9BA 5KOXA 1URMA 1PN0A 4OD7A 3QOUA 3MDKA 1THXA 4AKIA 3HJMA 4WR4A 4YKFA 1GSUA 4YAPA 3PPUA 1K0MA 5KN1A 2PGTA 1GTBA 2WRTA 1WE0A 2E2MA 4HI7A 1BQ7A 1PSQA 4J2FA 2EFDA 1X5CA 4POMA 2H75A 1YVLA 1S3DA 2L6DA 2V1MA 4ZBAA 2PBJA 3FW2A 3HZ4A 3CSJA 3IE3A 2L5OA 3EPTA 4K6XA 4CHSA 3GX8A 3KP8A 1K3YA 2F9SA 5IPHA 3O3TA 6GSUA 1LBKA 4K2DA 4PNFA 3GL3A 3IDVA 2B1KA 3UEMA 2AJQB 2G0FA 4DSSB 2F8FA 2Z9SA 2HNLA 2E7PA 4FYUA 5A4UA 3QD9A 2H74A 3CSIA 1AC1A 5AN1A 1R7HA 3FZ9A 2LJAA 3HVVA 2JSYA 1YDKA 4PQIA 3IAM2 3KMOA 2IFQB 4YH2A 2LUSA 3MAKA 1AQVA 5D96A 5ECMB 1W89A 4V2MA 5A4WA 3FYGA 3L9SA 2CVKA 3LFLA 1PX6A 2R0GA 2GT6A 2KP1A 1H4OA 3HCZA 1FOVA 1HNAA 1TTZA 4NMUA 5AGYA 1V57A 2QA2A 1NHYA 5ID2A 1XXUA 5F06A 1M2DA 3P8WA 2HFDA 2DLXA 1EV9A 1GNEA 3GNJA 5DQYA 3EC3A 2O87A 3GTUA 2JL4A 5KN2A 2GSSA 1YJ6A 1O73A 5ELAA 2LRTA 1Q4JA 4FYCA 1MD4A 3M1GA 2CA8A 2YV7A 2GT5A 2H70A 2YJ7A 3MIXA 1XW5A 3GHAA 3CRTA 2R4VA 1TOFA 2GZYA 2RUEA 2EFEA 5F07A 3H79A 4G0LA 2EIOA 3QFAC 5D9XA 16GSA 2PMTA 4WR5A 3IK7A 3KZQA 2VCZA 4PQHA 1YZXA 4LA1A 2GQMA 3W6GA 2RIIA 2FGXA 4RQXA 2LQQA 2CT6A 2OE0A 1OC8A 2VKZG 3LORA 4BVYA 4QMKA 3CRUA 3UBLA 4GQFA 3TUEA 1HQOA 4GTUA 4K0NA 4E8EA 1IYIA 3TGZA 1PMTA 3KH9A 2IMDA 3ZMLA 3C1RA 1EGOA 1O8WA 5J40A 3N9JA 1ZCPA 2DJJA 3M3MA 2VM2A 4KE3A 3KIJA 1CQHA 1Y1UA 1AXDA 1ACVA 1FVKA 4OCEA 1O7UA 5EL8A 1OC9A 3QCPA 4ECIA 1U87A 3TB2A 3KXOA 4TN8A 2HSNB 2K8SA 3NIVA 4G19A 3ZMKA 2EFCA 2QC7A 4MPFA 3UJ1A 5B8AA 3ZFBA 2R0CA 1PD21 2I3YA 4Z2RA 3WT1A 1XOBA 4F9ZA 1Y6EA 3NZNA 5EY6A 3FMWA 1N25A 2B6MA 2WZ9A 4WBRD 4DSSA 3EYTA 3I43A 1KTEA 2G2QA 2TIRA 2X64A 1GSEA 4OCFA 1K0DA 2L6CA 2UV8G 2RLIA 4KGIA 4O92A 1TRWA 1SJIA 2AV4A 2IFQA 5D9TA 3GURA 4MNNA 1GSFA 4EL1A 1TP9A 2B7KA 5JWRB 5HFKA 2LRNA 1G6WA 3V1WA 4MJCA 1M0UA 5A1NB 1I9DA 4MH3A 4ZL8A 4EUYA 2F51A 1GH2A 3DVWA 2DJ0A 2H6YA 3RPPA 5ECNB 1TK0B 4WETA 2WDUA 5EVOA 1KEBA 2P5RA 4IJ3A 4HJ2A 2CX4A 1SK2A 4FH8A 1SL2B 1R5PA 1T00A 1EEJA 2VL2A 1ZYQB 5CRWA 2AAWA 1ABAA 1VF4A 3RHCA 4F82A 1EGRA 1WPIA 4TXVA 4JR6A 3RBTA 2R37A 5DCHA 2WULA 1BF5A 3EU3A 1A2MA 1FB6A 3EVIA 2YWMA 4USSA 1TK5B 5GAND 2HRKA 1GSSA 3KTLA 2R2JA 3APOA 3SBCA 3VPQA 4POLA 4JR4A 4EIQA 3IA1A 5IMFA 4LL1B 4I6XA 1K3LA 5ECRB 1SD9A 4IELA 2GSRA 3L9UA 5G31A 3D0ZA 1XPVA 3BCKA 2CAQA 1UC7A 3E3EA 1QFNA 5HQPA 4G0KA 1F2EA 1VF1A 3UOMA 3UMAA 3P7XA 4IS0A 2VO4A 4CW9A 3VURA 3F4RA 2C4JA 1MDKA 4NHZA 1S3AA 1GUMA 3TRPA 3U5RE 2HRNA 4IJIA 1YQ1A 3KTBA 2HSNA 1GULA 3DVXA 1OE8A 4EE0A 3F9UA 3VPTA 4ZXGA 2PU9C 2L59A 3ZYWA 2I9HA 3FY7A 4K1FA 4IKHA 1MDJA 5IIZA 5ABRA 3F3RA 3H93A 3A2VA 1ERWA 5JCWA 4WF5A 1SL1B 1KBNA 4KW6A 5IOWA 2MMZA 2H6XA 1GLQA 1TXUA 1RQMA 2X8GA 4RUVA 2B5XA 4EC0A 1SYRA 3PGTA 3QPMA 4MF5A 1DBYA 2WGRA 5GZZB 1SVOA 1WMJA 1TK8B 1FW1A 2NVLA 2NDOA 4DSQA 1HD2A 4N0ZA 3ZTLA 2VD1A 2DJ3A 5IO2A 5JCUA 5GSTA 4LLRA 4EXJA 4PGTA 3JCML 1GUKA 14GSA 5ECKB 3TU3B 3UL3A 4J57E 3WD6A 4K7OA 5IMDA 1K0OA 4Q5RA 2FA4A 1Z6NA 2WCIA 1X5EA 3GKNA 2DJKA 3MYDA 2VLVA 2HQTA 1K0BA 4HU9A 3GA4A 1GP1A 1Q98A 3RHBA 3IC4A 3W8JA 3G7YA 1A23A 3A5WA 5EPFA 5B6MA 3FZ4A 1FOHA 2FA8A 2J9HA 5D9VA 4PUAA 2YWNA 4WXTA 1OVNA 4DVCA 1XW6A 3CSHA 1WWJA 3PR8A 3VFIA 4ILFA 4AJ8A 2IPAA 3KP9A 2PVQA 2DMLA 1U3AA 5C00A 2WFCA 4IP1A 4EDYA 2CQ9A 2QKEA 3GH6A 4YAVA 2K6VA 1JLWA 2F8AA 4N0VA 3EURA 2NPBA 1X9SB 3GKKA 2HXKA 3HVSA 2KLXA 2OBIA 1KNGA 2AB6A 4KH7A 5DALB 3CBUA 7GSSA 1E6BA 1F9MA 3FR9A 1T3BA 2VCTA 3A5IA 3F4SA 1T4YA 4ML6A 4YQVA 3TKPA 4YQMA 2H1AA 1GNWA 4OMVA 4AF2A 1AQWA 4GSSA 4DEJA 3WGDA 2OT3A 4PQ1A 1X9WB 6GSVA 2FY6A 3TJJA 3N5OA 1J08A 3GSSA 1HYUA 2HSMB 2JZRA 3EMPA 3D4TA 3LYPA 3BOAA 5CNWA 5D93A 4MZCA 2N5BA 2YNXA 5F8BA 1XWKA 2DJ1A 4K7IA 4D73A 3LW9A 2JU5A 1FHEA 3C71A 2GGTA 2JADA 2V2GA 2OA7A 4OWYA 2GTUA 5A5KA 4ZB7A 1EEMA 2YPMA 2VLTA 2X4AA 4HU7A 5ELGA 1JLVA 4FIWA 5IO0A 5DDLA 5DJLA 2YP6A 1EP8A 3D6IA 4QL9A 5DVBA 10GSA 2HT9A 2V6OA 1TXXA 3C1SA 1Z7RA 1SK1A 5FT3A 1AQXA 5A4VA 2E0QA 3DGQA 3LXZA 1WP0A 2JZSA 5J4YA 3QAWA 4HDEA 2WB9A 3SWLA 5G1LA 4PNGA 4K2XA 3S9FA 3IR4A 4W66A 1BG1A 2FWEA 1TU8A 1IYHA 4G2EA 4LMVA 1T1VA 2MMAA 4O5QA 1OYJA 1X5DA 2IMKA 3FZ5A 1XW9A 5HR1A 4ZIJA 1U3IA 3C7MA 4GSNA 2LNSA 3IAS2 1UA5A 4ECCA 3HXSA 4TVEA 4XRAA 1K0AA 5IMCA 1BEDA 5HFGA 2AUVA 1TU7A 2A4VA 4P3YB 5ECIB 4EO3A 4MJAA 2VAFA 5F05A 4GCIA 1B4PA 1OAZA 4NXIA 4EF0A 4OFMA 1EV4A 1SVMA 1A24A 3ME7A 2K18A 2YZHA 5A5HB 5D73A 4KB3A 2H19A 5KEJA 2MYGA 3IK9A 2LRCA 1F37A 4BPYA 3O76A 3EWLA 4NV5A 3M8NA 3TJFA 1WOUA 5DALA 1ERTA 1I5GA 2IIYA 1MD3A 3WGXA 3HYPA 5ECHB 5GSSA 3FZAA 4K9ZA 3P90A 2L57A 3ERGA 1GTIA 2H8LA 4PURA 1MDIA 2GZPA 1EOGA 1A8YA 1ZGNA 3GL5A 2AHEA 4WF4A 1GTUA 2R0PA 3TOTA 1QUWA 2OE1A 2HSMA 4L0UA 2VL9A 2FWFA 2DC5A 4AI6A 3VWVA 5HR3A 4K5SA 1ON4A 3LWAA 4FQUA 1Z7PA 3H4KA 2VCQA 2YCDA 3LEFA 4E68A 11GSA 1A2JA 3L9VA 4POKA 1CQGA 1ERUA 1FO5A 4HJMA 3G7JA 3RAZA 3GRXA 2GDRA 1HNBA 2F3MA 5CO3A 1TW9A 6GSTA 4ZILA 3FK8A 2PERA 3TKSC 1BYEA 3LQ7A 3H8QA 2PUKC 4ACSA 3WYWA 3ED3A 1G7OA 2DKIA 4MP4A 2H72A 4L5LA 4GQCA 1JFUA 1PRXA 1BJXA 2E2GA 1SVLA 2CAIA 3ME8A 4IVFA 5ECLB 5G2ZA 5CRDA 3I6AA 4TR1B 3DKSA 3HMJG 1PKZA 1PN9A 2LEGA 2BJXA 3LXTA 3IV4A 2MBTA 2H73A 2YANA 4AGSA 2L4QA 2N5AA 2VD0A 1MEKA 1BAYA 2C80A 1TKDB 1JZOA 2ALBA 4JRRA 5IOXA 4AKGA 4BA7A 4OFTA 2C3TA 1XVWA 2O7KA 1SYXA 1VF2A 3CYNA 3ZITA 2LJKA 4BL7B 3DWVA 3CXGA 4MCUA 3IC8A 3QAVA 2L4CA 1T4ZA 2EFHA 2C3QA 4N3ZA 4ML1A 4AKHA 4HOJA 3LYKA 4ICYA 2X8CA 1V40A 3GX0A 3ZFLA 2O5VA 3LSZA 4X43A 1U6TA 4WBJA 3OR5A 3L4NA 1OKTA 3GSTA 2R3XA 5LNKe 1ST9A 4G10A 2XPEA 2HRAA 4I8BA 2O89A 4L0WA 1M9AA 4V2NA 2B1LA 2FD3A 2I1UA 3GUSA 2R6KA 4LMWA 4GRFA 1XZOA 1OE7A 3MSZA 4GWRA 4ZB8A 1GSDA 3LG6A 1MTCA 4NPBA 2HSHA 1J0FA 3D21A 5CAXA 1QMVA 3WGEA 2H0HA 5J4UA 4KDXA 2ZUPA 3F63A 3M0FA 1XCCA 3BJ5A 2OJLA 3HJPA 4O5RA 4JBBA 2KUCA 1BG5A 4MF6A 3UAPA 3TJBA 1ML6A 2V32A 1ILOA 2M46A 2IWTA 4RQRA 3A3TA 5E59A 3TKQA 4MZWA 4K0GA 4KSOA 1F3AA 5D9WA 1RW1A 2RM5A 1OKDA 3QFBC 2QSIA 4PUFC 5L71A 6GSSA 1TDIA 1NM3A 3M9KA 5IMAA 4TOPA 4MJBA 5AIXA 19GSA 4AJ6A 3LJRA 3UVHA 2XBQA 1PGTA 2XHFA 2BTOT 5BMUB 3IBHA 1FVJA 4TR0A 2GLRA 4EVMA 5KN0A 4KDYA 4E8HA 3GKXA 2H1LA 2OE3A 1XFLA 3E9JB 4MJEA 4HS1A 1Z6MA 3IPZA 3TRXA 2C1YA 4PTSA 4RI6A 5HR0A 1XWBA 1ERVA 1QXHA 4V1Ap 5A1NA 3VI7A 1XWCA 1O8XA 3UARA 5J5NA 4HQZA 1VRSD 2PN8A 1LJRA 3TCOA 3FHKA 1N8JA 2B3SA 3US3A 2D2ZA 2ZCTA 4GLTA 4KCAA 1H75A 4BL7A 5G30A 4MA9A 3EE2A 4ZB6A 2C8UA 3J7Yk 1SJ6A 3DIEA 2XPDA 3EU4A 2PWJA 4K5RA 4MZBA 1O6JA 4GXZA 2H71A 4EKZA 1R26A 2DBCA 1AUCA 3M9JA 2VOCA 3EINA 1LU4A 2DMMA 3A2XA 4TRXA 5ID2B 2HZFA 1V58A 3G7IA 4F0CA 2J23A 3ZIVA 1AAZA 5CREA 2REMA 1WIKA 3IRAA 2H76A 4TXOB 1DUGA 3E0UA 5KN3A 3ISOA 3HVXA 1SKSB 3F4TA 4IGJA 1AW9A 3ZREA 4AKXB 4BWQA 3Q19A 5ECSA 2K8VA 2YZUA 1WJKA 17GSA 1YKAA 4X0XA 1EOHA 4TR3A 1SENA 4Q5QA 6GSYA 4ZB9A 3APSA 2C0GA 2PVOC 3KH7A 1GSQA 4JE1A 2VCWA 2FHEA 3VLNA 4Z2UA 1NSWA 2FUG2 4TW5A 1YF0A 3L78A 4F0BA 3DMLA 1C72A 4IW9A 1ZMAA 1FG4A 4CDOA 5J3RA 4ZL7A 1K0NA 2OKAA 1ZYNA 1V2AA 5DAKB 1VGLA 5CP1A 4KAEA 1M2BA 5G5EA 1DE2A 1G0TA 1OC9B 3DYRA 2B5YA 2LJRA 1Z9HA 2X8HA 4I2TA 4X1UA 1O81A 2HZEB 2C3NA 2H1BA 5FWGA 4HZ4A 4BVXB 4IBPA 2O8VB 4IQAA 5BMUA 3VK9A 2GSQA 3A2WA 2DKHA 3TRQA 2H6ZA 2LQOA 3HZ8A 2IMIA 4CY6A 1W4VA 4MK3A 1SKWB 3CMIA 2AYTA 1DSBA 3KGKA 3HHVA 2A2PA 3F3QA 3GMFA 1GSYA 4AJ7A 2JZTA 2YWIA 2I4AA 2IN3A 1GTAA 1YF1A 1T8EB 2FWHA 4QQ7A 1JHBA 2V6KA 1QQ2A 2ON7A 4J56E 3TKSA 5IMZA 1BX9A 3HKRA 1V98A 4XS4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0G A;  3DEX A;  4KA0 A;  5INY A;  2HI7 A;  18GS A;  3L0H A;  2HSY A;  2RUF A;  3FR6 A;  2MZC A;  2EIR A;  4N10 A;  2YV9 A;  2KHP A;  1V9W A;  1TRU A;  2H0I A;  2P5Q A;  3H1N A;  2VUP A;  4ISD A;  1A2L A;  1ZZY A;  3UBK A;  5HR2 A;  4Q5F A;  1XWA A;  4MPG A;  2QGV A;  4MLY A;  4FYB A;  1A8L A;  4JZQ A;  5LD0 A;  2IL3 A;  1VF3 A;  1U88 A;  4TXO A;  1GWC A;  3FKF A;  8GSS A;  1UVZ A;  1JZD A;  5B7C A;  2ON5 A;  2WJU A;  5B8B A;  3I69 A;  2UZ8 A;  1QGV A;  1NW2 A;  5CRH A;  1YEX A;  2MBS A;  3F8U A;  3C8E A;  2VL3 A;  1XIY A;  5G1K A;  9GSS A;  4K7N A;  6GSW A;  1Y25 A;  3KMN A;  2HRK B;  3ZL5 A;  1SK0 A;  3BD2 A;  2VM1 A;  2YN1 A;  5DJM A;  5ECQ B;  1TI1 A;  2VCV A;  3GYK A;  3DRN A;  2JSZ A;  3QAG A;  4KUN A;  3FR3 A;  2FCH A;  4ECB A;  2LTK A;  4K8M A;  2YWO A;  4NWY A;  3KD0 A;  1GL8 A;  5ECO B;  1SJZ A;  3D4M A;  2MMN A;  5DAK A;  1XWG A;  5C04 A;  4L5O A;  1DE1 A;  2H1D A;  2VCX A;  1X0R A;  2DIY A;  4H86 A;  2KP2 A;  3J7Y b;  1B48 A;  2VLU A;  4F03 A;  2HZE A;  3NOF A;  5J41 A;  4IN0 A;  1EZK A;  4BVX A;  3CTG A;  4XS6 A;  4XRD A;  4WEY A;  4ECJ A;  3VWU A;  1F3B A;  1SD8 A;  4RI7 A;  4N30 A;  2YJH A;  2LKU A;  1PKW A;  2LV3 A;  4OO4 A;  2NTO A;  2A2S A;  3BCI A;  1M9B A;  3FRC A;  5DBQ A;  1R4W A;  3TKR A;  4LL4 B;  2EC4 A;  2OBK A;  5LCZ A;  4TKY A;  2HYX A;  3AY8 A;  5GAP D;  5IQY A;  1F6M C;  3C73 A;  1GLP A;  4ZBB A;  2XC2 A;  5IPG A;  3UVT A;  1GRX A;  2EIQ A;  2P31 A;  4PXO A;  1Z3E A;  1Z5Y E;  4XS4 A;  5CRG A;  1R5A A;  5AIS A;  2TRC P;  1ZYE A;  3TKS E;  5E4W A;  4ULX A;  4XCS A;  2DJ2 A;  3F6F A;  4WKW A;  3D22 A;  2K9F A;  5COH A;  3KCM A;  1PL1 A;  1OC3 A;  2GQL A;  1USB A;  5DQS A;  1M2A A;  2WS2 A;  5ENU A;  2LST A;  3I9V 2;  4KF9 A;  2IJY A;  1XVQ A;  3IXR A;  3ZLP A;  1E2Y A;  4HEA 2;  2GVP A;  4V2L A;  3R3E A;  2C0E A;  4KX4 A;  4XHM A;  13GS A;  4I97 A;  3WT2 A;  1J9B A;  4NV2 A;  3IHQ A;  2FLS A;  4MAB A;  3VWX A;  1TRV A;  3GN3 A;  4YQU A;  2XBI A;  4Z7X A;  2CVD A;  4XIH A;  3ZVJ D;  3P2A A;  1TJD A;  4POB A;  3F0I A;  4MF7 A;  4NHW A;  3EMX A;  4N11 A;  3GFK A;  5AIV A;  4HUA A;  3ZIJ A;  1FB0 A;  2H30 A;  3KM6 A;  1TI3 A;  1EP7 A;  5HFI A;  5B6N A;  1JZW A;  2HLS A;  4BWS A;  3PH9 A;  4MDC A;  4MMM A;  1X9M B;  5JWO B;  5FHI A;  2YOI A;  3D5J A;  2ES7 A;  4KSM A;  2HRF A;  1T7P B;  1PL2 A;  2H66 A;  4O7H A;  1GUH A;  3Q18 A;  1WRY A;  4EDZ A;  3TJG A;  2HE3 A;  5IMV A;  3O6T A;  2B5E A;  2NBS A;  3ZVJ A;  2M72 A;  1THO A;  3KJY A;  4ZL9 A;  1B8X A;  1NHO A;  2H1G A;  4ZBD A;  3GKM A;  3ZZX A;  4NAX A;  4KDU A;  4I5Q A;  1PQN A;  1K0C A;  2H01 A;  4XS1 A;  5ECP B;  4O32 A;  2N5F A;  2M80 A;  3ZRD A;  2O85 A;  4F2I A;  4Q5N A;  3HY2 A;  3R2Q A;  1FAA A;  5H5S A;  2DSA A;  3QDN A;  1QK8 A;  3VI5 A;  3U6V A;  3LGC A;  4PX1 A;  5IM9 A;  4D73 B;  4L8E A;  2H0G A;  3FEU A;  4TR1 A;  2GST A;  1ZOF A;  1JZR A;  5JWQ B;  1G6Y A;  3QMX A;  3ERW A;  4JU5 A;  2L5L A;  4JED A;  22GS A;  2BMX A;  2X99 A;  20GS A;  2ZNM A;  4GF0 A;  2FNO A;  2GS3 A;  2CZ3 A;  4TR4 A;  1B9X C;  2IME A;  1YKC A;  3UIW A;  3TJK A;  2OAD A;  4DSR A;  2VL2 C;  1A0R P;  5D8I A;  2B7J A;  3Q6O A;  2C0F A;  1UN2 A;  3TDG A;  1XBS A;  5G5F A;  1PA3 A;  5DCG A;  3HJO A;  5F0G A;  1AIU A;  2TRX A;  3RPN A;  1S3C A;  1PX7 A;  2LNT A;  2CVB A;  4V1A g;  3GIX A;  1N2A A;  5J9B A;  3APQ A;  3CTF A;  3K8N A;  3ERF A;  1ZL9 A;  2CZ2 A;  2CX3 A;  4I2U A;  5CYY A;  3F6D A;  3BBY A;  4OO5 A;  3MNG A;  2VIM A;  1G7E A;  2OAC A;  2R5G A;  2RM6 A;  3GTU B;  1YY7 A;  3W8S A;  1K3O A;  3QR6 A;  2IMF A;  3MWH A;  3PIN A;  2KOK A;  2CV4 A;  4KND A;  4IQ1 A;  1YEP A;  4G9H A;  4IHU A;  4KCE A;  5J9C A;  4OFN A;  3Q74 A;  3HA9 A;  4QL7 A;  4MH2 A;  3VWW A;  3KEB A;  1M7T A;  3HD5 A;  1B9Y C;  3GH9 A;  3HDC A;  1M99 A;  1B4Q A;  1SL0 B;  1A0F A;  4HZ2 A;  4FO5 A;  1HNC A;  2JAC A;  1SKR B;  5JCG A;  4G0I A;  3DD3 A;  4IP6 A;  4BVY B;  12GS A;  1RK4 A;  2LS5 A;  2PPT A;  1XOA A;  6GSX A;  2A2R A;  2MMO A;  4GST A;  3RDW A;  3IOS A;  2V41 A;  2C0D A;  2FWG A;  3TOU A;  1SU9 A;  5H5Q A;  2GZZ A;  1EWX A;  1O85 A;  4XTS A;  5H5R A;  2GQK A;  2DIZ A;  4HQS A;  2I81 A;  1TRS A;  3DXB A;  4ID0 A;  3GV1 A;  3G9B A;  1URM A;  4OD7 A;  3QOU A;  3MDK A;  1THX A;  3HJM A;  4WR4 A;  1GSU A;  4YAP A;  3PPU A;  1K0M A;  5KN1 A;  2PGT A;  1GTB A;  2WRT A;  1WE0 A;  2E2M A;  4HI7 A;  1BQ7 A;  1PSQ A;  4J2F A;  1X5C A;  4POM A;  2H75 A;  1S3D A;  2L6D A;  2V1M A;  4ZBA A;  2PBJ A;  3FW2 A;  3HZ4 A;  3CSJ A;  3IE3 A;  2L5O A;  4K6X A;  4CHS A;  3GX8 A;  3KP8 A;  1K3Y A;  2F9S A;  5IPH A;  3O3T A;  6GSU A;  1LBK A;  4K2D A;  4PNF A;  3GL3 A;  3IDV A;  2B1K A;  3UEM A;  2AJQ B;  2G0F A;  4DSS B;  2F8F A;  2Z9S A;  2HNL A;  2E7P A;  4FYU A;  5A4U A;  3QD9 A;  2H74 A;  3CSI A;  1AC1 A;  5AN1 A;  1R7H A;  3FZ9 A;  2LJA A;  3HVV A;  2JSY A;  1YDK A;  4PQI A;  3IAM 2;  3KMO A;  2IFQ B;  4YH2 A;  2LUS A;  3MAK A;  1AQV A;  5D96 A;  5ECM B;  1W89 A;  4V2M A;  5A4W A;  3FYG A;  3L9S A;  2CVK A;  3LFL A;  1PX6 A;  2GT6 A;  2KP1 A;  1H4O A;  3HCZ A;  1FOV A;  1HNA A;  1TTZ A;  4NMU A;  5AGY A;  1V57 A;  1NHY A;  5ID2 A;  1XXU A;  5F06 A;  1M2D A;  3P8W A;  2HFD A;  2DLX A;  1EV9 A;  1GNE A;  3GNJ A;  5DQY A;  3EC3 A;  2O87 A;  3GTU A;  2JL4 A;  5KN2 A;  2GSS A;  1YJ6 A;  1O73 A;  5ELA A;  2LRT A;  1Q4J A;  4FYC A;  1MD4 A;  3M1G A;  2CA8 A;  2YV7 A;  2GT5 A;  2H70 A;  2YJ7 A;  1XW5 A;  3GHA A;  3CRT A;  2R4V A;  1TOF A;  2GZY A;  2RUE A;  5F07 A;  3H79 A;  4G0L A;  2EIO A;  3QFA C;  5D9X A;  16GS A;  2PMT A;  4WR5 A;  3IK7 A;  3KZQ A;  2VCZ A;  4PQH A;  1YZX A;  4LA1 A;  2GQM A;  3W6G A;  2RII A;  2FGX A;  4RQX A;  2LQQ A;  2CT6 A;  2OE0 A;  1OC8 A;  3LOR A;  4BVY A;  3CRU A;  3UBL A;  4GQF A;  3TUE A;  1HQO A;  4GTU A;  4K0N A;  4E8E A;  1IYI A;  3TGZ A;  1PMT A;  3KH9 A;  2IMD A;  3ZML A;  3C1R A;  1EGO A;  1O8W A;  3N9J A;  1ZCP A;  2DJJ A;  3M3M A;  2VM2 A;  4KE3 A;  3KIJ A;  1CQH A;  1AXD A;  1ACV A;  1FVK A;  4OCE A;  1O7U A;  5EL8 A;  1OC9 A;  3QCP A;  4ECI A;  1U87 A;  3TB2 A;  3KXO A;  4TN8 A;  2HSN B;  2K8S A;  3NIV A;  4G19 A;  3ZMK A;  2QC7 A;  4MPF A;  3UJ1 A;  5B8A A;  3ZFB A;  1PD2 1;  2I3Y A;  3WT1 A;  1XOB A;  4F9Z A;  1Y6E A;  3NZN A;  5EY6 A;  2B6M A;  2WZ9 A;  4WBR D;  4DSS A;  3EYT A;  3I43 A;  1KTE A;  2G2Q A;  2TIR A;  2X64 A;  1GSE A;  4OCF A;  1K0D A;  2L6C A;  2RLI A;  4KGI A;  4O92 A;  1TRW A;  1SJI A;  2AV4 A;  2IFQ A;  5D9T A;  3GUR A;  1GSF A;  4EL1 A;  1TP9 A;  2B7K A;  5JWR B;  5HFK A;  2LRN A;  1G6W A;  3V1W A;  4MJC A;  1M0U A;  1I9D A;  4MH3 A;  4ZL8 A;  4EUY A;  2F51 A;  1GH2 A;  3DVW A;  2DJ0 A;  2H6Y A;  3RPP A;  5ECN B;  1TK0 B;  4WET A;  2WDU A;  5EVO A;  1KEB A;  2P5R A;  4IJ3 A;  4HJ2 A;  2CX4 A;  1SK2 A;  4FH8 A;  1SL2 B;  1R5P A;  1T00 A;  1EEJ A;  2VL2 A;  1ZYQ B;  5CRW A;  2AAW A;  1ABA A;  1VF4 A;  3RHC A;  4F82 A;  1EGR A;  1WPI A;  4TXV A;  4JR6 A;  3RBT A;  2R37 A;  5DCH A;  2WUL A;  3EU3 A;  1A2M A;  1FB6 A;  3EVI A;  2YWM A;  4USS A;  1TK5 B;  5GAN D;  2HRK A;  1GSS A;  3KTL A;  2R2J A;  3APO A;  3SBC A;  3VPQ A;  4POL A;  4JR4 A;  3IA1 A;  5IMF A;  4LL1 B;  4I6X A;  1K3L A;  5ECR B;  1SD9 A;  4IEL A;  2GSR A;  3L9U A;  5G31 A;  3D0Z A;  1XPV A;  3BCK A;  2CAQ A;  1UC7 A;  3E3E A;  1QFN A;  5HQP A;  4G0K A;  1F2E A;  1VF1 A;  3UOM A;  3UMA A;  3P7X A;  4IS0 A;  2VO4 A;  4CW9 A;  3VUR A;  3F4R A;  2C4J A;  1MDK A;  4NHZ A;  1S3A A;  1GUM A;  3TRP A;  3U5R E;  2HRN A;  4IJI A;  1YQ1 A;  3KTB A;  1GUL A;  3DVX A;  1OE8 A;  4EE0 A;  3F9U A;  3VPT A;  4ZXG A;  2PU9 C;  2L59 A;  3ZYW A;  2I9H A;  3FY7 A;  4K1F A;  4IKH A;  1MDJ A;  5IIZ A;  5ABR A;  3F3R A;  3H93 A;  3A2V A;  1ERW A;  5JCW A;  4WF5 A;  1SL1 B;  1KBN A;  4KW6 A;  5IOW A;  2MMZ A;  2H6X A;  1GLQ A;  1RQM A;  2X8G A;  4RUV A;  2B5X A;  4EC0 A;  1SYR A;  3PGT A;  3QPM A;  4MF5 A;  1DBY A;  2WGR A;  5GZZ B;  1WMJ A;  1TK8 B;  1FW1 A;  2NVL A;  2NDO A;  4DSQ A;  1HD2 A;  4N0Z A;  3ZTL A;  2VD1 A;  2DJ3 A;  5IO2 A;  5JCU A;  5GST A;  4LLR A;  4EXJ A;  4PGT A;  3JCM L;  1GUK A;  14GS A;  5ECK B;  3UL3 A;  4J57 E;  3WD6 A;  4K7O A;  5IMD A;  1K0O A;  4Q5R A;  2FA4 A;  1Z6N A;  2WCI A;  1X5E A;  3GKN A;  2DJK A;  2VLV A;  2HQT A;  1K0B A;  4HU9 A;  3GA4 A;  1GP1 A;  1Q98 A;  3RHB A;  3IC4 A;  3W8J A;  3G7Y A;  1A23 A;  3A5W A;  5EPF A;  5B6M A;  3FZ4 A;  2FA8 A;  2J9H A;  5D9V A;  4PUA A;  2YWN A;  4WXT A;  1OVN A;  4DVC A;  1XW6 A;  3CSH A;  1WWJ A;  3PR8 A;  3VFI A;  4ILF A;  4AJ8 A;  2IPA A;  3KP9 A;  2PVQ A;  2DML A;  1U3A A;  5C00 A;  2WFC A;  4IP1 A;  4EDY A;  2CQ9 A;  2QKE A;  3GH6 A;  4YAV A;  2K6V A;  1JLW A;  2F8A A;  4N0V A;  3EUR A;  2NPB A;  1X9S B;  3GKK A;  2HXK A;  3HVS A;  2KLX A;  2OBI A;  1KNG A;  2AB6 A;  4KH7 A;  5DAL B;  3CBU A;  7GSS A;  1E6B A;  1F9M A;  3FR9 A;  1T3B A;  2VCT A;  3F4S A;  1T4Y A;  4ML6 A;  4YQV A;  3TKP A;  4YQM A;  2H1A A;  1GNW A;  4OMV A;  4AF2 A;  1AQW A;  4GSS A;  4DEJ A;  3WGD A;  4PQ1 A;  1X9W B;  6GSV A;  2FY6 A;  3TJJ A;  3N5O A;  1J08 A;  3GSS A;  1HYU A;  2HSM B;  2JZR A;  3EMP A;  3D4T A;  3LYP A;  3BOA A;  5CNW A;  5D93 A;  4MZC A;  2N5B A;  2YNX A;  5F8B A;  1XWK A;  2DJ1 A;  4K7I A;  4D73 A;  2JU5 A;  1FHE A;  3C71 A;  2GGT A;  2JAD A;  2V2G A;  2OA7 A;  4OWY A;  2GTU A;  5A5K A;  1EEM A;  2YPM A;  2VLT A;  4HU7 A;  5ELG A;  1JLV A;  4FIW A;  5IO0 A;  5DDL A;  5DJL A;  2YP6 A;  1EP8 A;  3D6I A;  4QL9 A;  5DVB A;  10GS A;  2HT9 A;  2V6O A;  1TXX A;  3C1S A;  1Z7R A;  1SK1 A;  5FT3 A;  1AQX A;  5A4V A;  2E0Q A;  3DGQ A;  3LXZ A;  1WP0 A;  2JZS A;  3QAW A;  4HDE A;  2WB9 A;  3SWL A;  5G1L A;  4PNG A;  3S9F A;  3IR4 A;  2FWE A;  1TU8 A;  1IYH A;  4G2E A;  4LMV A;  1T1V A;  2MMA A;  1OYJ A;  1X5D A;  2IMK A;  3FZ5 A;  1XW9 A;  5HR1 A;  4ZIJ A;  1U3I A;  3C7M A;  4GSN A;  2LNS A;  3IAS 2;  1UA5 A;  4ECC A;  3HXS A;  4TVE A;  4XRA A;  1K0A A;  5IMC A;  1BED A;  5HFG A;  2AUV A;  1TU7 A;  2A4V A;  4P3Y B;  5ECI B;  4EO3 A;  4MJA A;  2VAF A;  5F05 A;  4GCI A;  1B4P A;  1OAZ A;  4NXI A;  4EF0 A;  4OFM A;  1EV4 A;  1A24 A;  3ME7 A;  2K18 A;  2YZH A;  5D73 A;  4KB3 A;  2H19 A;  5KEJ A;  2MYG A;  3IK9 A;  2LRC A;  1F37 A;  4BPY A;  3O76 A;  3EWL A;  4NV5 A;  3M8N A;  3TJF A;  1WOU A;  5DAL A;  1ERT A;  1I5G A;  2IIY A;  1MD3 A;  3WGX A;  3HYP A;  5ECH B;  5GSS A;  3FZA A;  4K9Z A;  3P90 A;  2L57 A;  3ERG A;  1GTI A;  2H8L A;  4PUR A;  1MDI A;  2GZP A;  1EOG A;  1A8Y A;  1ZGN A;  2AHE A;  3GL5 A;  4WF4 A;  1GTU A;  3TOT A;  1QUW A;  2OE1 A;  2HSM A;  4L0U A;  2VL9 A;  2FWF A;  2DC5 A;  3VWV A;  5HR3 A;  1ON4 A;  3LWA A;  4FQU A;  1Z7P A;  3H4K A;  2VCQ A;  2YCD A;  3LEF A;  11GS A;  1A2J A;  3L9V A;  4POK A;  1CQG A;  1ERU A;  1FO5 A;  4HJM A;  3G7J A;  3RAZ A;  3GRX A;  2GDR A;  1HNB A;  2F3M A;  5CO3 A;  1TW9 A;  6GST A;  4ZIL A;  3FK8 A;  2PER A;  3TKS C;  1BYE A;  3LQ7 A;  3H8Q A;  2PUK C;  4ACS A;  3WYW A;  3ED3 A;  1G7O A;  4MP4 A;  2H72 A;  4L5L A;  4GQC A;  1JFU A;  1PRX A;  1BJX A;  2E2G A;  2CAI A;  3ME8 A;  4IVF A;  5ECL B;  5G2Z A;  5CRD A;  3I6A A;  4TR1 B;  3DKS A;  1PKZ A;  1PN9 A;  2LEG A;  2BJX A;  3LXT A;  3IV4 A;  2MBT A;  2H73 A;  2YAN A;  4AGS A;  2L4Q A;  2N5A A;  2VD0 A;  1MEK A;  1BAY A;  2C80 A;  1TKD B;  1JZO A;  2ALB A;  4JRR A;  5IOX A;  4BA7 A;  4OFT A;  2C3T A;  1XVW A;  2O7K A;  1SYX A;  1VF2 A;  3CYN A;  3ZIT A;  2LJK A;  4BL7 B;  3DWV A;  3CXG A;  4MCU A;  3IC8 A;  3QAV A;  2L4C A;  1T4Z A;  2C3Q A;  4ML1 A;  4HOJ A;  3LYK A;  2X8C A;  1V40 A;  3GX0 A;  3ZFL A;  3LSZ A;  4X43 A;  1U6T A;  4WBJ A;  3OR5 A;  3L4N A;  1OKT A;  3GST A;  2R3X A;  5LNK e;  1ST9 A;  4G10 A;  2XPE A;  2HRA A;  4I8B A;  2O89 A;  4L0W A;  1M9A A;  4V2N A;  2B1L A;  2FD3 A;  2I1U A;  3GUS A;  2R6K A;  4LMW A;  4GRF A;  1XZO A;  1OE7 A;  3MSZ A;  4GWR A;  4ZB8 A;  1GSD A;  3LG6 A;  1MTC A;  4NPB A;  2HSH A;  1J0F A;  3D21 A;  5CAX A;  1QMV A;  3WGE A;  2H0H A;  5J4U A;  4KDX A;  2ZUP A;  3F63 A;  3M0F A;  1XCC A;  3BJ5 A;  2OJL A;  3HJP A;  4O5R A;  4JBB A;  2KUC A;  1BG5 A;  4MF6 A;  3UAP A;  3TJB A;  1ML6 A;  2V32 A;  1ILO A;  2M46 A;  2IWT A;  4RQR A;  3A3T A;  5E59 A;  3TKQ A;  4MZW A;  4K0G A;  4KSO A;  1F3A A;  5D9W A;  1RW1 A;  2RM5 A;  1OKD A;  3QFB C;  2QSI A;  4PUF C;  5L71 A;  6GSS A;  1TDI A;  1NM3 A;  3M9K A;  5IMA A;  4TOP A;  4MJB A;  5AIX A;  19GS A;  4AJ6 A;  3LJR A;  3UVH A;  2XBQ A;  1PGT A;  2XHF A;  2BTO T;  3IBH A;  1FVJ A;  4TR0 A;  2GLR A;  4EVM A;  5KN0 A;  4KDY A;  4E8H A;  3GKX A;  2OE3 A;  1XFL A;  3E9J B;  4MJE A;  4HS1 A;  1Z6M A;  3IPZ A;  3TRX A;  2C1Y A;  4PTS A;  4RI6 A;  5HR0 A;  1XWB A;  1ERV A;  1QXH A;  4V1A p;  3VI7 A;  1XWC A;  1O8X A;  3UAR A;  5J5N A;  4HQZ A;  1VRS D;  2PN8 A;  1LJR A;  3TCO A;  3FHK A;  1N8J A;  2B3S A;  3US3 A;  2D2Z A;  2ZCT A;  4GLT A;  4KCA A;  1H75 A;  4BL7 A;  5G30 A;  4MA9 A;  3EE2 A;  4ZB6 A;  2C8U A;  3J7Y k;  1SJ6 A;  3DIE A;  2XPD A;  3EU4 A;  2PWJ A;  4MZB A;  1O6J A;  4GXZ A;  2H71 A;  4EKZ A;  1R26 A;  2DBC A;  1AUC A;  3M9J A;  2VOC A;  3EIN A;  1LU4 A;  2DMM A;  3A2X A;  4TRX A;  5ID2 B;  2HZF A;  1V58 A;  3G7I A;  4F0C A;  2J23 A;  3ZIV A;  1AAZ A;  5CRE A;  2REM A;  1WIK A;  3IRA A;  2H76 A;  4TXO B;  1DUG A;  3E0U A;  5KN3 A;  3ISO A;  3HVX A;  1SKS B;  3F4T A;  4IGJ A;  1AW9 A;  3ZRE A;  4BWQ A;  3Q19 A;  5ECS A;  2K8V A;  2YZU A;  1WJK A;  17GS A;  1YKA A;  4X0X A;  1EOH A;  4TR3 A;  1SEN A;  4Q5Q A;  6GSY A;  4ZB9 A;  3APS A;  2C0G A;  2PVO C;  3KH7 A;  1GSQ A;  4JE1 A;  2VCW A;  2FHE A;  3VLN A;  1NSW A;  2FUG 2;  4TW5 A;  1YF0 A;  3L78 A;  4F0B A;  3DML A;  1C72 A;  4IW9 A;  1ZMA A;  1FG4 A;  4CDO A;  5J3R A;  4ZL7 A;  1K0N A;  2OKA A;  1V2A A;  5DAK B;  1VGL A;  5CP1 A;  4KAE A;  1M2B A;  5G5E A;  1DE2 A;  1G0T A;  1OC9 B;  3DYR A;  2B5Y A;  2LJR A;  1Z9H A;  2X8H A;  4I2T A;  4X1U A;  1O81 A;  2HZE B;  2C3N A;  2H1B A;  5FWG A;  4HZ4 A;  4BVX B;  4IBP A;  2O8V B;  4IQA A;  5BMU A;  3VK9 A;  2GSQ A;  3A2W A;  3TRQ A;  2H6Z A;  2LQO A;  3HZ8 A;  2IMI A;  1W4V A;  4MK3 A;  1SKW B;  3CMI A;  2AYT A;  1DSB A;  3KGK A;  3HHV A;  3F3Q A;  3GMF A;  1GSY A;  4AJ7 A;  2JZT A;  2YWI A;  2I4A A;  2IN3 A;  1GTA A;  1YF1 A;  1T8E B;  2FWH A;  4QQ7 A;  1JHB A;  2V6K A;  1QQ2 A;  2ON7 A;  4J56 E;  3TKS A;  5IMZ A;  1BX9 A;  3HKR A;  1V98 A;  4XS4 B; 
#chains in the Genus database with same CATH topology
 4EIP A;  2P0G A;  3DEX A;  4KA0 A;  5INY A;  2HI7 A;  18GS A;  3L0H A;  2HSY A;  2RUF A;  3FR6 A;  2MZC A;  4O5U A;  2EIR A;  4N10 A;  2YV9 A;  2KHP A;  1V9W A;  1TRU A;  2H0I A;  2P5Q A;  3H1N A;  2VUP A;  4ISD A;  1A2L A;  1ZZY A;  3UBK A;  5HR2 A;  4Q5F A;  1XWA A;  4MPG A;  2QGV A;  4MLY A;  4FYB A;  1A8L A;  4JZQ A;  5LD0 A;  2IL3 A;  1VF3 A;  1U88 A;  4TXO A;  1GWC A;  3FKF A;  8GSS A;  1UVZ A;  1JZD A;  5B7C A;  2ON5 A;  2WJU A;  5B8B A;  3I69 A;  2UZ8 A;  1QGV A;  1NW2 A;  5CRH A;  1YEX A;  2MBS A;  3F8U A;  3C8E A;  2VL3 A;  1XIY A;  5G1K A;  9GSS A;  4K7N A;  6GSW A;  1Y25 A;  4CY8 A;  3KMN A;  2HRK B;  3ZL5 A;  1SK0 A;  3BD2 A;  2VM1 A;  2YN1 A;  5DJM A;  5ECQ B;  1TI1 A;  2VCV A;  3GYK A;  3DRN A;  2JSZ A;  3QAG A;  4KUN A;  3FR3 A;  2FCH A;  4ECB A;  2LTK A;  5KOW A;  4K8M A;  2YWO A;  4NWY A;  3KD0 A;  4G01 A;  1GL8 A;  5ECO B;  1SJZ A;  3D4M A;  2MMN A;  5DAK A;  1XWG A;  5C04 A;  4L5O A;  1DE1 A;  2H1D A;  2VCX A;  1X0R A;  2DIY A;  4H86 A;  2KP2 A;  3J7Y b;  1B48 A;  2VLU A;  4F03 A;  2HZE A;  3NOF A;  5J41 A;  1I1I P;  4IN0 A;  1EZK A;  4BVX A;  5A34 B;  3CTG A;  4XS6 A;  4XRD A;  4WEY A;  4ECJ A;  3VWU A;  1F3B A;  1SD8 A;  4RI7 A;  4N30 A;  2YJH A;  2LKU A;  1PKW A;  2LV3 A;  4OO4 A;  2NTO A;  2A2S A;  3BCI A;  1M9B A;  3FRC A;  5DBQ A;  1R4W A;  3TKR A;  4LL4 B;  2EC4 A;  2OBK A;  5LCZ A;  4TKY A;  4GDF A;  4PI0 C;  2HYX A;  3AY8 A;  5GAP D;  5IQY A;  1F6M C;  3C73 A;  1GLP A;  4ZBB A;  2XC2 A;  5IPG A;  3UVT A;  1GRX A;  2EIQ A;  2P31 A;  4PXO A;  1Z3E A;  1Z5Y E;  4XS4 A;  5CRG A;  1R5A A;  5AIS A;  2TRC P;  1ZYE A;  3TKS E;  5E4W A;  4ULX A;  4XCS A;  2WVX B;  3F6F A;  2DJ2 A;  4WKW A;  1ZYP A;  3D22 A;  2K9F A;  1S4B P;  5COH A;  3KCM A;  1PL1 A;  1OC3 A;  2GQL A;  1USB A;  5DQS A;  1M2A A;  2WS2 A;  5ENU A;  2LST A;  3I9V 2;  4KF9 A;  2IJY A;  1XVQ A;  3IXR A;  3ZLP A;  1E2Y A;  4HEA 2;  2GVP A;  4V2L A;  3R3E A;  2C0E A;  4KX4 A;  4XHM A;  13GS A;  4I97 A;  3WT2 A;  1J9B A;  4NV2 A;  3IHQ A;  5A5H A;  2FLS A;  4MAB A;  3VWX A;  1TRV A;  3GN3 A;  3RFR C;  4YQU A;  2XBI A;  4Z7X A;  2CVD A;  4XIH A;  3ZVJ D;  3P2A A;  1TJD A;  4POB A;  3F0I A;  4MF7 A;  4NHW A;  3EMX A;  4N11 A;  2QA1 A;  3GFK A;  5AIV A;  4HUA A;  3ZIJ A;  1FB0 A;  3CWG A;  2H30 A;  3KM6 A;  1TI3 A;  5J47 A;  1EP7 A;  5HFI A;  5B6N A;  1JZW A;  2HLS A;  4BWS A;  3PH9 A;  4MDC A;  4MMM A;  1X9M B;  5JWO B;  5FHI A;  2YOI A;  3D5J A;  2ES7 A;  4KSM A;  2HRF A;  1T7P B;  1PL2 A;  2H66 A;  4O7H A;  1GUH A;  3Q18 A;  1WRY A;  4EDZ A;  3TJG A;  2HE3 A;  5IMV A;  3O6T A;  2B5E A;  2NBS A;  3ZVJ A;  2M72 A;  5BRT A;  1THO A;  3RGB C;  3KJY A;  4ZL9 A;  1B8X A;  1NHO A;  2H1G A;  4ZBD A;  3GKM A;  3ZZX A;  4NAX A;  4KDU A;  4I5Q A;  1PQN A;  1K0C A;  2H01 A;  4XS1 A;  5ECP B;  4O32 A;  2N5F A;  5A34 A;  2M80 A;  3ZRD A;  2O85 A;  5J4V A;  4F2I A;  4Q5N A;  3HY2 A;  3R2Q A;  1FAA A;  5H5S A;  2DSA A;  3QDN A;  1QK8 A;  3VI5 A;  3U6V A;  3LGC A;  4PX1 A;  5IM9 A;  4D73 B;  4L8E A;  2H0G A;  3FEU A;  4TR1 A;  2GST A;  1ZOF A;  1JZR A;  5JWQ B;  1G6Y A;  3QMX A;  3ERW A;  4JU5 A;  2L5L A;  4JED A;  22GS A;  2BMX A;  2X99 A;  20GS A;  2ZNM A;  4GF0 A;  2FNO A;  2GS3 A;  2CZ3 A;  4TR4 A;  1B9X C;  4A5P A;  2IME A;  1YKC A;  3UIW A;  3TJK A;  2OAD A;  4DSR A;  2VL2 C;  1A0R P;  5D8I A;  2B7J A;  3Q6O A;  2C0F A;  1UN2 A;  3TDG A;  1XBS A;  5G5F A;  1PA3 A;  5DCG A;  3HJO A;  5F0G A;  1AIU A;  2TRX A;  3RPN A;  1S3C A;  1PX7 A;  2LNT A;  2CVB A;  4V1A g;  3GIX A;  1N2A A;  5J9B A;  3APQ A;  1PFO A;  3CTF A;  3K8N A;  3ERF A;  1ZL9 A;  2CZ2 A;  2CX3 A;  4I2U A;  4Z2T A;  5CYY A;  3F6D A;  3BBY A;  4OO5 A;  3MNG A;  2VIM A;  1G7E A;  2OAC A;  2R5G A;  2RM6 A;  3GTU B;  1YY7 A;  3W8S A;  1K3O A;  3QR6 A;  2IMF A;  3MWH A;  3PIN A;  2KOK A;  2CV4 A;  2A4H A;  3IHG A;  4IQ1 A;  4KND A;  1YEP A;  4G9H A;  4IHU A;  4KCE A;  5J9C A;  4OFN A;  3Q74 A;  3HA9 A;  4QL7 A;  4MH2 A;  3VWW A;  3KEB A;  1M7T A;  3HD5 A;  1B9Y C;  3GH9 A;  2WW3 A;  3HDC A;  1M99 A;  1B4Q A;  1SL0 B;  1A0F A;  4HZ2 A;  4FO5 A;  1HNC A;  2X49 A;  2JAC A;  1SKR B;  5JCG A;  4G0I A;  3DD3 A;  4IP6 A;  4BVY B;  12GS A;  1RK4 A;  2LS5 A;  2PPT A;  1XOA A;  6GSX A;  2A2R A;  2MMO A;  4GST A;  3RDW A;  4X4J A;  3IOS A;  2V41 A;  2C0D A;  2FWG A;  3TOU A;  1SU9 A;  5H5Q A;  2GZZ A;  1EWX A;  1O85 A;  4XTS A;  5H5R A;  2WVZ A;  2GQK A;  2DIZ A;  4HQS A;  2I81 A;  4YKG A;  1TRS A;  3DXB A;  4ID0 A;  3GV1 A;  3G9B A;  5KOX A;  1URM A;  1PN0 A;  4OD7 A;  3QOU A;  3MDK A;  1THX A;  4AKI A;  3HJM A;  4WR4 A;  4PHZ C;  4YKF A;  1GSU A;  4YAP A;  3PPU A;  1K0M A;  5KN1 A;  2PGT A;  1GTB A;  2WRT A;  1WE0 A;  2E2M A;  4HI7 A;  1BQ7 A;  1PSQ A;  4J2F A;  2EFD A;  1X5C A;  4POM A;  2H75 A;  1YVL A;  1S3D A;  2L6D A;  2V1M A;  4ZBA A;  2PBJ A;  3FW2 A;  3HZ4 A;  3CSJ A;  3IE3 A;  2L5O A;  3EPT A;  4K6X A;  4CHS A;  3GX8 A;  3KP8 A;  1K3Y A;  2F9S A;  5IPH A;  3O3T A;  6GSU A;  1LBK A;  4K2D A;  4PNF A;  3GL3 A;  3IDV A;  2B1K A;  3UEM A;  2AJQ B;  2G0F A;  4DSS B;  2F8F A;  2Z9S A;  2HNL A;  2E7P A;  4FYU A;  5A4U A;  3QD9 A;  2H74 A;  3CSI A;  1AC1 A;  5AN1 A;  1R7H A;  3FZ9 A;  2LJA A;  3HVV A;  2JSY A;  1YDK A;  4PQI A;  3IAM 2;  3KMO A;  2IFQ B;  4YH2 A;  2LUS A;  3MAK A;  1AQV A;  5D96 A;  5ECM B;  1W89 A;  4V2M A;  5A4W A;  3FYG A;  3L9S A;  2CVK A;  3LFL A;  1PX6 A;  2R0G A;  2GT6 A;  2KP1 A;  1H4O A;  3HCZ A;  1FOV A;  1HNA A;  1TTZ A;  4NMU A;  5AGY A;  1V57 A;  2QA2 A;  1NHY A;  5ID2 A;  1XXU A;  5F06 A;  1M2D A;  3P8W A;  2HFD A;  2DLX A;  1EV9 A;  1GNE A;  3GNJ A;  5DQY A;  3EC3 A;  2O87 A;  3GTU A;  2JL4 A;  5KN2 A;  2GSS A;  1YJ6 A;  1O73 A;  5ELA A;  2LRT A;  1Q4J A;  4FYC A;  1MD4 A;  3M1G A;  2CA8 A;  2YV7 A;  2GT5 A;  2H70 A;  2YJ7 A;  3MIX A;  1XW5 A;  3GHA A;  3CRT A;  2R4V A;  1TOF A;  2GZY A;  2RUE A;  2EFE A;  5F07 A;  3H79 A;  4G0L A;  2EIO A;  3QFA C;  5D9X A;  16GS A;  2PMT A;  4WR5 A;  3IK7 A;  3KZQ A;  2VCZ A;  4PQH A;  1YZX A;  4LA1 A;  2GQM A;  3W6G A;  2RII A;  2FGX A;  4RQX A;  2LQQ A;  2CT6 A;  2OE0 A;  1OC8 A;  2VKZ G;  3LOR A;  4BVY A;  4QMK A;  3CRU A;  3UBL A;  4GQF A;  3TUE A;  1HQO A;  4GTU A;  4K0N A;  4E8E A;  1IYI A;  1YEW C;  3TGZ A;  1PMT A;  3KH9 A;  2IMD A;  3ZML A;  3C1R A;  1EGO A;  1O8W A;  5J40 A;  3N9J A;  1ZCP A;  2DJJ A;  3M3M A;  2VM2 A;  4KE3 A;  3KIJ A;  1CQH A;  1Y1U A;  1AXD A;  1ACV A;  1FVK A;  4OCE A;  1O7U A;  5EL8 A;  1OC9 A;  3QCP A;  4ECI A;  1U87 A;  3TB2 A;  3KXO A;  4TN8 A;  2HSN B;  2K8S A;  3NIV A;  4G19 A;  3ZMK A;  2EFC A;  2QC7 A;  4MPF A;  3UJ1 A;  5B8A A;  3ZFB A;  2R0C A;  1S3R A;  1PD2 1;  2I3Y A;  4Z2R A;  3WT1 A;  1XOB A;  4F9Z A;  1Y6E A;  3NZN A;  5EY6 A;  3FMW A;  1N25 A;  2B6M A;  2WZ9 A;  4WBR D;  4DSS A;  3EYT A;  3I43 A;  1KTE A;  2G2Q A;  2TIR A;  2X64 A;  1GSE A;  4OCF A;  1K0D A;  2L6C A;  2UV8 G;  2RLI A;  4KGI A;  4O92 A;  1TRW A;  1SJI A;  2AV4 A;  2IFQ A;  5D9T A;  3GUR A;  4MNN A;  1GSF A;  4EL1 A;  1TP9 A;  2B7K A;  5JWR B;  5HFK A;  2LRN A;  1G6W A;  3V1W A;  4MJC A;  1M0U A;  5A1N B;  1I9D A;  4MH3 A;  4ZL8 A;  4EUY A;  2F51 A;  1GH2 A;  3DVW A;  2DJ0 A;  2H6Y A;  3RPP A;  5ECN B;  1TK0 B;  4WET A;  2WDU A;  5EVO A;  1KEB A;  2P5R A;  4IJ3 A;  4HJ2 A;  2CX4 A;  1SK2 A;  4FH8 A;  1SL2 B;  1R5P A;  1T00 A;  1EEJ A;  2VL2 A;  1ZYQ B;  5CRW A;  2AAW A;  1ABA A;  1VF4 A;  3RHC A;  4F82 A;  1EGR A;  1WPI A;  4TXV A;  4JR6 A;  3RBT A;  2R37 A;  5DCH A;  2WUL A;  1BF5 A;  3EU3 A;  1A2M A;  1FB6 A;  3EVI A;  2YWM A;  4USS A;  1TK5 B;  5GAN D;  2HRK A;  1GSS A;  3KTL A;  2R2J A;  3APO A;  3SBC A;  3VPQ A;  4POL A;  4JR4 A;  4EIQ A;  3IA1 A;  5IMF A;  4LL1 B;  4I6X A;  1K3L A;  5ECR B;  1SD9 A;  4IEL A;  2GSR A;  3L9U A;  5G31 A;  3D0Z A;  1XPV A;  3BCK A;  2CAQ A;  1UC7 A;  3E3E A;  1QFN A;  5HQP A;  4G0K A;  1F2E A;  1VF1 A;  3UOM A;  3UMA A;  3P7X A;  4IS0 A;  2VO4 A;  4CW9 A;  3VUR A;  3F4R A;  2C4J A;  1MDK A;  4NHZ A;  1S3A A;  4BIK A;  1GUM A;  3TRP A;  3U5R E;  2HRN A;  4IJI A;  1YQ1 A;  3KTB A;  2HSN A;  1GUL A;  3DVX A;  1OE8 A;  4EE0 A;  3F9U A;  3VPT A;  4ZXG A;  2PU9 C;  2L59 A;  3ZYW A;  2I9H A;  3FY7 A;  4K1F A;  4IKH A;  1MDJ A;  5IIZ A;  5ABR A;  3F3R A;  3H93 A;  3A2V A;  1ERW A;  5JCW A;  4WF5 A;  1SL1 B;  1KBN A;  4KW6 A;  5IOW A;  2MMZ A;  2H6X A;  1GLQ A;  1TXU A;  1RQM A;  2X8G A;  4RUV A;  2B5X A;  4EC0 A;  1SYR A;  3PGT A;  3QPM A;  4MF5 A;  1DBY A;  2WGR A;  5GZZ B;  1SVO A;  1WMJ A;  1TK8 B;  1FW1 A;  2NVL A;  2NDO A;  4DSQ A;  1HD2 A;  4N0Z A;  3ZTL A;  2VD1 A;  2DJ3 A;  5IO2 A;  5JCU A;  5GST A;  4LLR A;  4EXJ A;  4PGT A;  3JCM L;  1GUK A;  14GS A;  2WVX A;  5ECK B;  3TU3 B;  3UL3 A;  4J57 E;  3WD6 A;  4K7O A;  5IMD A;  1K0O A;  4Q5R A;  2FA4 A;  1Z6N A;  2WCI A;  1X5E A;  3GKN A;  2DJK A;  3MYD A;  2VLV A;  2HQT A;  1K0B A;  4HU9 A;  3GA4 A;  1GP1 A;  1Q98 A;  3RHB A;  3IC4 A;  3W8J A;  3G7Y A;  1A23 A;  3A5W A;  5EPF A;  5B6M A;  3FZ4 A;  1FOH A;  2FA8 A;  2J9H A;  5D9V A;  4PUA A;  2YWN A;  4WXT A;  1OVN A;  4DVC A;  1XW6 A;  3CSH A;  1WWJ A;  3PR8 A;  3VFI A;  4ILF A;  4AJ8 A;  2IPA A;  3KP9 A;  2PVQ A;  2DML A;  1U3A A;  5C00 A;  2WFC A;  4IP1 A;  4EDY A;  2CQ9 A;  2QKE A;  3GH6 A;  4YAV A;  2K6V A;  1JLW A;  2F8A A;  4N0V A;  3EUR A;  2NPB A;  1X9S B;  3GKK A;  2HXK A;  3HVS A;  2KLX A;  2OBI A;  1KNG A;  2WW1 A;  2AB6 A;  4KH7 A;  5DAL B;  3CBU A;  7GSS A;  1E6B A;  1F9M A;  3FR9 A;  1XG8 A;  1T3B A;  2VCT A;  3A5I A;  3F4S A;  1T4Y A;  4ML6 A;  4YQV A;  3TKP A;  4YQM A;  2H1A A;  1GNW A;  4OMV A;  4AF2 A;  1AQW A;  4GSS A;  4DEJ A;  3WGD A;  2OT3 A;  4PQ1 A;  1X9W B;  6GSV A;  2FY6 A;  3TJJ A;  3N5O A;  1J08 A;  3GSS A;  1HYU A;  2HSM B;  2JZR A;  3EMP A;  3D4T A;  3LYP A;  3BOA A;  5CNW A;  5D93 A;  4MZC A;  2N5B A;  2YNX A;  5F8B A;  1XWK A;  2DJ1 A;  4K7I A;  4D73 A;  3LW9 A;  2JU5 A;  1FHE A;  2WW0 A;  3C71 A;  2GGT A;  2JAD A;  2V2G A;  2OA7 A;  4OWY A;  2GTU A;  5A5K A;  4ZB7 A;  1EEM A;  2YPM A;  2VLT A;  2X4A A;  4HU7 A;  5ELG A;  1JLV A;  4FIW A;  5IO0 A;  5DDL A;  5DJL A;  2YP6 A;  1EP8 A;  3D6I A;  4QL9 A;  5DVB A;  10GS A;  2HT9 A;  2V6O A;  1TXX A;  3C1S A;  3CHX C;  1Z7R A;  1SK1 A;  5FT3 A;  1AQX A;  5A4V A;  2E0Q A;  3DGQ A;  3LXZ A;  1WP0 A;  2JZS A;  5J4Y A;  3QAW A;  4HDE A;  2WB9 A;  3SWL A;  5G1L A;  4PNG A;  4K2X A;  3S9F A;  3IR4 A;  4W66 A;  1BG1 A;  2FWE A;  1TU8 A;  1IYH A;  4G2E A;  4LMV A;  1T1V A;  2MMA A;  4O5Q A;  1OYJ A;  1X5D A;  2IMK A;  3FZ5 A;  1XW9 A;  5HR1 A;  4ZIJ A;  1U3I A;  3C7M A;  4GSN A;  2LNS A;  3IAS 2;  1UA5 A;  1M3J A;  4ECC A;  3HXS A;  4TVE A;  4XRA A;  1K0A A;  5IMC A;  1BED A;  5HFG A;  2AUV A;  1TU7 A;  2A4V A;  4P3Y B;  5ECI B;  4EO3 A;  4MJA A;  2VAF A;  5F05 A;  4GCI A;  1B4P A;  1OAZ A;  4NXI A;  4EF0 A;  4OFM A;  1EV4 A;  1SVM A;  1A24 A;  3ME7 A;  2K18 A;  2YZH A;  5A5H B;  5D73 A;  4KB3 A;  2H19 A;  5KEJ A;  2MYG A;  3IK9 A;  2LRC A;  1F37 A;  4BPY A;  3O76 A;  3EWL A;  4NV5 A;  2WVY A;  3M8N A;  3TJF A;  1WOU A;  5DAL A;  1ERT A;  1I5G A;  2IIY A;  1MD3 A;  3WGX A;  3HYP A;  5ECH B;  5GSS A;  3FZA A;  4K9Z A;  3P90 A;  2L57 A;  2O3E A;  3ERG A;  1GTI A;  2H8L A;  4PUR A;  1MDI A;  2GZP A;  1EOG A;  1A8Y A;  1ZGN A;  3GL5 A;  2AHE A;  4WF4 A;  1GTU A;  2R0P A;  3TOT A;  1QUW A;  2OE1 A;  2HSM A;  4L0U A;  2VL9 A;  2FWF A;  2DC5 A;  4AI6 A;  3VWV A;  5HR3 A;  4K5S A;  1ON4 A;  3LWA A;  4FQU A;  1Z7P A;  3H4K A;  2VCQ A;  2YCD A;  3LEF A;  4E68 A;  11GS A;  1A2J A;  3L9V A;  4POK A;  1CQG A;  1ERU A;  1FO5 A;  4HJM A;  3G7J A;  3RAZ A;  3GRX A;  2GDR A;  1HNB A;  2F3M A;  5CO3 A;  1TW9 A;  6GST A;  4ZIL A;  3FK8 A;  2PER A;  3TKS C;  1BYE A;  3LQ7 A;  3H8Q A;  2PUK C;  4ACS A;  3HVN A;  3WYW A;  3ED3 A;  1G7O A;  2DKI A;  4MP4 A;  2H72 A;  4L5L A;  4GQC A;  1JFU A;  1PRX A;  1BJX A;  2E2G A;  1SVL A;  2CAI A;  3ME8 A;  4IVF A;  5ECL B;  5G2Z A;  5CRD A;  3I6A A;  4TR1 B;  3DKS A;  3HMJ G;  1PKZ A;  1PN9 A;  2LEG A;  2BJX A;  3LXT A;  3IV4 A;  2MBT A;  2H73 A;  2YAN A;  4AGS A;  2L4Q A;  2N5A A;  2VD0 A;  1MEK A;  1BAY A;  2C80 A;  1TKD B;  1JZO A;  2ALB A;  4JRR A;  5IOX A;  4AKG A;  4PI2 C;  4BA7 A;  4OFT A;  2C3T A;  1XVW A;  2O7K A;  1SYX A;  1VF2 A;  3CYN A;  3ZIT A;  2LJK A;  4BL7 B;  3DWV A;  3CXG A;  4MCU A;  3IC8 A;  3QAV A;  2L4C A;  1T4Z A;  2EFH A;  2C3Q A;  4N3Z A;  4ML1 A;  4AKH A;  4HOJ A;  3LYK A;  4ICY A;  2X8C A;  1V40 A;  3GX0 A;  3ZFL A;  2O5V A;  3LSZ A;  4X43 A;  1U6T A;  4WBJ A;  3OR5 A;  3L4N A;  1OKT A;  3GST A;  2R3X A;  5LNK e;  1ST9 A;  1M3I A;  4G10 A;  2XPE A;  2HRA A;  4I8B A;  2O89 A;  4L0W A;  1M9A A;  4V2N A;  2B1L A;  2FD3 A;  2I1U A;  3GUS A;  2R6K A;  4LMW A;  4GRF A;  1XZO A;  1OE7 A;  3MSZ A;  4GWR A;  4ZB8 A;  1GSD A;  3LG6 A;  1MTC A;  4NPB A;  2HSH A;  1J0F A;  3D21 A;  5CAX A;  1QMV A;  3WGE A;  2H0H A;  5J4U A;  4KDX A;  2ZUP A;  3F63 A;  3M0F A;  1XCC A;  3BJ5 A;  2OJL A;  3HJP A;  4O5R A;  4JBB A;  2KUC A;  1BG5 A;  4MF6 A;  3UAP A;  3TJB A;  1ML6 A;  2V32 A;  4HSC X;  1ILO A;  2M46 A;  2IWT A;  4RQR A;  3A3T A;  5E59 A;  3TKQ A;  4MZW A;  4K0G A;  4KSO A;  1F3A A;  5D9W A;  1RW1 A;  2RM5 A;  1OKD A;  3QFB C;  2QSI A;  4PUF C;  5L71 A;  6GSS A;  1TDI A;  1NM3 A;  3M9K A;  5IMA A;  4TOP A;  4MJB A;  5AIX A;  19GS A;  4AJ6 A;  3LJR A;  3UVH A;  2XBQ A;  1PGT A;  2XHF A;  2BTO T;  5BMU B;  3IBH A;  1FVJ A;  4TR0 A;  2GLR A;  4EVM A;  5KN0 A;  4KDY A;  4E8H A;  3GKX A;  2H1L A;  2OE3 A;  1XFL A;  3E9J B;  4MJE A;  4HS1 A;  1Z6M A;  3IPZ A;  3TRX A;  2C1Y A;  4PTS A;  4RI6 A;  5HR0 A;  1XWB A;  1ERV A;  1QXH A;  4V1A p;  5A1N A;  3VI7 A;  1XWC A;  1O8X A;  3UAR A;  5J5N A;  4HQZ A;  1VRS D;  2PN8 A;  1LJR A;  3TCO A;  3FHK A;  1N8J A;  2B3S A;  3US3 A;  2D2Z A;  2ZCT A;  4GLT A;  4KCA A;  1H75 A;  4BL7 A;  5G30 A;  4MA9 A;  3EE2 A;  4ZB6 A;  2C8U A;  3J7Y k;  1SJ6 A;  3DIE A;  2XPD A;  3EU4 A;  2PWJ A;  4K5R A;  4MZB A;  1O6J A;  4GXZ A;  2H71 A;  4EKZ A;  1R26 A;  2DBC A;  1AUC A;  3M9J A;  2VOC A;  3EIN A;  1LU4 A;  2DMM A;  3A2X A;  4TRX A;  5ID2 B;  2HZF A;  1V58 A;  3G7I A;  4F0C A;  2J23 A;  3ZIV A;  1AAZ A;  5CRE A;  2REM A;  1WIK A;  3IRA A;  2H76 A;  4TXO B;  1DUG A;  3E0U A;  5KN3 A;  3ISO A;  2O36 A;  3HVX A;  1SKS B;  3F4T A;  4IGJ A;  1AW9 A;  3ZRE A;  4AKX B;  4BWQ A;  3Q19 A;  5ECS A;  2K8V A;  2YZU A;  1WJK A;  17GS A;  1YKA A;  4X0X A;  1EOH A;  4TR3 A;  1SEN A;  4Q5Q A;  6GSY A;  4ZB9 A;  3APS A;  2C0G A;  2PVO C;  3KH7 A;  1GSQ A;  4JE1 A;  2VCW A;  2FHE A;  3VLN A;  4Z2U A;  4FXY P;  1NSW A;  2FUG 2;  4TW5 A;  2WW2 A;  1YF0 A;  3L78 A;  4F0B A;  3DML A;  1C72 A;  4IW9 A;  1ZMA A;  1FG4 A;  4CDO A;  3CQF A;  5J3R A;  4ZL7 A;  1K0N A;  2OKA A;  1ZYN A;  1V2A A;  5DAK B;  1VGL A;  5CP1 A;  4KAE A;  1M2B A;  5G5E A;  1DE2 A;  1G0T A;  1OC9 B;  3DYR A;  2B5Y A;  2LJR A;  1Z9H A;  2X8H A;  4I2T A;  4X1U A;  1O81 A;  2HZE B;  2C3N A;  2H1B A;  5FWG A;  4HZ4 A;  4BVX B;  4IBP A;  2O8V B;  4IQA A;  5BMU A;  3VK9 A;  2GSQ A;  3A2W A;  2DKH A;  3TRQ A;  2H6Z A;  2LQO A;  3HZ8 A;  2IMI A;  4CY6 A;  1W4V A;  4MK3 A;  1SKW B;  3CMI A;  2AYT A;  1DSB A;  3KGK A;  3HHV A;  2A2P A;  3F3Q A;  3GMF A;  1GSY A;  4AJ7 A;  2JZT A;  2YWI A;  2I4A A;  2IN3 A;  2WZS A;  1GTA A;  1YF1 A;  1T8E B;  2FWH A;  4QQ7 A;  1JHB A;  2V6K A;  1QQ2 A;  2ON7 A;  4J56 E;  3TKS A;  5IMZ A;  1BX9 A;  3HKR A;  1V98 A;  4XS4 B; 
#chains in the Genus database with same CATH homology
 4EIP A;  2P0G A;  3DEX A;  4KA0 A;  5INY A;  2HI7 A;  18GS A;  3L0H A;  2HSY A;  2RUF A;  3FR6 A;  2MZC A;  4O5U A;  2EIR A;  4N10 A;  2YV9 A;  2KHP A;  1V9W A;  1TRU A;  2H0I A;  2P5Q A;  3H1N A;  2VUP A;  4ISD A;  1A2L A;  1ZZY A;  3UBK A;  5HR2 A;  4Q5F A;  1XWA A;  4MPG A;  2QGV A;  4MLY A;  4FYB A;  1A8L A;  4JZQ A;  5LD0 A;  2IL3 A;  1VF3 A;  1U88 A;  4TXO A;  1GWC A;  3FKF A;  8GSS A;  1UVZ A;  1JZD A;  5B7C A;  2ON5 A;  2WJU A;  5B8B A;  3I69 A;  2UZ8 A;  1QGV A;  1NW2 A;  5CRH A;  1YEX A;  2MBS A;  3F8U A;  3C8E A;  2VL3 A;  1XIY A;  5G1K A;  9GSS A;  4K7N A;  6GSW A;  1Y25 A;  4CY8 A;  3KMN A;  2HRK B;  3ZL5 A;  1SK0 A;  3BD2 A;  2VM1 A;  2YN1 A;  5DJM A;  5ECQ B;  1TI1 A;  2VCV A;  3GYK A;  3DRN A;  2JSZ A;  3QAG A;  4KUN A;  3FR3 A;  2FCH A;  4ECB A;  2LTK A;  5KOW A;  4K8M A;  2YWO A;  4NWY A;  3KD0 A;  4G01 A;  1GL8 A;  5ECO B;  1SJZ A;  3D4M A;  2MMN A;  5DAK A;  1XWG A;  5C04 A;  4L5O A;  1DE1 A;  2H1D A;  2VCX A;  1X0R A;  2DIY A;  4H86 A;  2KP2 A;  3J7Y b;  1B48 A;  2VLU A;  4F03 A;  2HZE A;  3NOF A;  5J41 A;  4IN0 A;  1EZK A;  4BVX A;  5A34 B;  3CTG A;  4XS6 A;  4XRD A;  4WEY A;  4ECJ A;  3VWU A;  1F3B A;  1SD8 A;  4RI7 A;  4N30 A;  2YJH A;  2LKU A;  1PKW A;  2LV3 A;  4OO4 A;  2NTO A;  2A2S A;  3BCI A;  1M9B A;  3FRC A;  5DBQ A;  1R4W A;  3TKR A;  4LL4 B;  2EC4 A;  2OBK A;  5LCZ A;  4TKY A;  4GDF A;  2HYX A;  3AY8 A;  5GAP D;  5IQY A;  1F6M C;  3C73 A;  1GLP A;  4ZBB A;  2XC2 A;  5IPG A;  3UVT A;  1GRX A;  2EIQ A;  2P31 A;  4PXO A;  1Z3E A;  1Z5Y E;  4XS4 A;  5CRG A;  1R5A A;  5AIS A;  2TRC P;  1ZYE A;  3TKS E;  5E4W A;  4ULX A;  4XCS A;  2DJ2 A;  3F6F A;  4WKW A;  1ZYP A;  3D22 A;  2K9F A;  5COH A;  3KCM A;  1PL1 A;  1OC3 A;  2GQL A;  1USB A;  5DQS A;  1M2A A;  2WS2 A;  5ENU A;  2LST A;  3I9V 2;  4KF9 A;  2IJY A;  1XVQ A;  3IXR A;  3ZLP A;  1E2Y A;  4HEA 2;  2GVP A;  4V2L A;  3R3E A;  2C0E A;  4KX4 A;  4XHM A;  13GS A;  4I97 A;  3WT2 A;  1J9B A;  4NV2 A;  3IHQ A;  5A5H A;  2FLS A;  4MAB A;  3VWX A;  1TRV A;  3GN3 A;  4YQU A;  2XBI A;  4Z7X A;  2CVD A;  4XIH A;  3ZVJ D;  3P2A A;  1TJD A;  4POB A;  3F0I A;  4MF7 A;  4NHW A;  3EMX A;  4N11 A;  2QA1 A;  3GFK A;  5AIV A;  4HUA A;  3ZIJ A;  1FB0 A;  3CWG A;  2H30 A;  3KM6 A;  1TI3 A;  5J47 A;  1EP7 A;  5HFI A;  5B6N A;  1JZW A;  2HLS A;  4BWS A;  3PH9 A;  4MDC A;  4MMM A;  1X9M B;  5JWO B;  5FHI A;  2YOI A;  3D5J A;  2ES7 A;  4KSM A;  2HRF A;  1T7P B;  1PL2 A;  2H66 A;  4O7H A;  1GUH A;  3Q18 A;  1WRY A;  4EDZ A;  3TJG A;  2HE3 A;  5IMV A;  3O6T A;  2B5E A;  2NBS A;  3ZVJ A;  2M72 A;  5BRT A;  1THO A;  3KJY A;  4ZL9 A;  1B8X A;  1NHO A;  2H1G A;  4ZBD A;  3GKM A;  3ZZX A;  4NAX A;  4KDU A;  4I5Q A;  1PQN A;  1K0C A;  2H01 A;  4XS1 A;  5ECP B;  4O32 A;  2N5F A;  5A34 A;  2M80 A;  3ZRD A;  2O85 A;  5J4V A;  4F2I A;  4Q5N A;  3HY2 A;  3R2Q A;  1FAA A;  5H5S A;  2DSA A;  3QDN A;  1QK8 A;  3VI5 A;  3U6V A;  3LGC A;  4PX1 A;  5IM9 A;  4D73 B;  4L8E A;  2H0G A;  3FEU A;  4TR1 A;  2GST A;  1ZOF A;  1JZR A;  5JWQ B;  1G6Y A;  3QMX A;  3ERW A;  4JU5 A;  2L5L A;  4JED A;  22GS A;  2BMX A;  2X99 A;  20GS A;  2ZNM A;  4GF0 A;  2FNO A;  2GS3 A;  2CZ3 A;  4TR4 A;  1B9X C;  4A5P A;  2IME A;  1YKC A;  3UIW A;  3TJK A;  2OAD A;  4DSR A;  2VL2 C;  1A0R P;  5D8I A;  2B7J A;  3Q6O A;  2C0F A;  1UN2 A;  3TDG A;  1XBS A;  5G5F A;  1PA3 A;  5DCG A;  3HJO A;  5F0G A;  1AIU A;  2TRX A;  3RPN A;  1S3C A;  1PX7 A;  2LNT A;  2CVB A;  4V1A g;  3GIX A;  1N2A A;  5J9B A;  3APQ A;  3CTF A;  3K8N A;  3ERF A;  1ZL9 A;  2CZ2 A;  2CX3 A;  4I2U A;  4Z2T A;  5CYY A;  3F6D A;  3BBY A;  4OO5 A;  3MNG A;  2VIM A;  1G7E A;  2OAC A;  2R5G A;  2RM6 A;  3GTU B;  1YY7 A;  3W8S A;  1K3O A;  3QR6 A;  2IMF A;  3MWH A;  3PIN A;  2KOK A;  2CV4 A;  2A4H A;  3IHG A;  4IQ1 A;  4KND A;  1YEP A;  4G9H A;  4IHU A;  4KCE A;  5J9C A;  4OFN A;  3Q74 A;  3HA9 A;  4QL7 A;  4MH2 A;  3VWW A;  3KEB A;  1M7T A;  3HD5 A;  1B9Y C;  3GH9 A;  3HDC A;  1M99 A;  1B4Q A;  1SL0 B;  1A0F A;  4HZ2 A;  4FO5 A;  1HNC A;  2X49 A;  2JAC A;  1SKR B;  5JCG A;  4G0I A;  3DD3 A;  4IP6 A;  4BVY B;  12GS A;  1RK4 A;  2LS5 A;  2PPT A;  1XOA A;  6GSX A;  2A2R A;  2MMO A;  4GST A;  3RDW A;  4X4J A;  3IOS A;  2V41 A;  2C0D A;  2FWG A;  3TOU A;  1SU9 A;  5H5Q A;  2GZZ A;  1EWX A;  1O85 A;  4XTS A;  5H5R A;  2GQK A;  2DIZ A;  4HQS A;  2I81 A;  4YKG A;  1TRS A;  3DXB A;  4ID0 A;  3GV1 A;  3G9B A;  5KOX A;  1URM A;  1PN0 A;  4OD7 A;  3QOU A;  3MDK A;  1THX A;  4AKI A;  3HJM A;  4WR4 A;  4YKF A;  1GSU A;  4YAP A;  3PPU A;  1K0M A;  5KN1 A;  2PGT A;  1GTB A;  2WRT A;  1WE0 A;  2E2M A;  4HI7 A;  1BQ7 A;  1PSQ A;  4J2F A;  2EFD A;  1X5C A;  4POM A;  2H75 A;  1YVL A;  1S3D A;  2L6D A;  2V1M A;  4ZBA A;  2PBJ A;  3FW2 A;  3HZ4 A;  3CSJ A;  3IE3 A;  2L5O A;  3EPT A;  4K6X A;  4CHS A;  3GX8 A;  3KP8 A;  1K3Y A;  2F9S A;  5IPH A;  3O3T A;  6GSU A;  1LBK A;  4K2D A;  4PNF A;  3GL3 A;  3IDV A;  2B1K A;  3UEM A;  2AJQ B;  2G0F A;  4DSS B;  2F8F A;  2Z9S A;  2HNL A;  2E7P A;  4FYU A;  5A4U A;  3QD9 A;  2H74 A;  3CSI A;  1AC1 A;  5AN1 A;  1R7H A;  3FZ9 A;  2LJA A;  3HVV A;  2JSY A;  1YDK A;  4PQI A;  3IAM 2;  3KMO A;  2IFQ B;  4YH2 A;  2LUS A;  3MAK A;  1AQV A;  5D96 A;  5ECM B;  1W89 A;  4V2M A;  5A4W A;  3FYG A;  3L9S A;  2CVK A;  3LFL A;  1PX6 A;  2R0G A;  2GT6 A;  2KP1 A;  1H4O A;  3HCZ A;  1FOV A;  1HNA A;  1TTZ A;  4NMU A;  5AGY A;  1V57 A;  2QA2 A;  1NHY A;  5ID2 A;  1XXU A;  5F06 A;  1M2D A;  3P8W A;  2HFD A;  2DLX A;  1EV9 A;  1GNE A;  3GNJ A;  5DQY A;  3EC3 A;  2O87 A;  3GTU A;  2JL4 A;  5KN2 A;  2GSS A;  1YJ6 A;  1O73 A;  5ELA A;  2LRT A;  1Q4J A;  4FYC A;  1MD4 A;  3M1G A;  2CA8 A;  2YV7 A;  2GT5 A;  2H70 A;  2YJ7 A;  3MIX A;  1XW5 A;  3GHA A;  3CRT A;  2R4V A;  1TOF A;  2GZY A;  2RUE A;  2EFE A;  5F07 A;  3H79 A;  4G0L A;  2EIO A;  3QFA C;  5D9X A;  16GS A;  2PMT A;  4WR5 A;  3IK7 A;  3KZQ A;  2VCZ A;  4PQH A;  1YZX A;  4LA1 A;  2GQM A;  3W6G A;  2RII A;  2FGX A;  4RQX A;  2LQQ A;  2CT6 A;  2OE0 A;  1OC8 A;  2VKZ G;  3LOR A;  4BVY A;  4QMK A;  3CRU A;  3UBL A;  4GQF A;  3TUE A;  1HQO A;  4GTU A;  4K0N A;  4E8E A;  1IYI A;  3TGZ A;  1PMT A;  3KH9 A;  2IMD A;  3ZML A;  3C1R A;  1EGO A;  1O8W A;  5J40 A;  3N9J A;  1ZCP A;  2DJJ A;  3M3M A;  2VM2 A;  4KE3 A;  3KIJ A;  1CQH A;  1Y1U A;  1AXD A;  1ACV A;  1FVK A;  4OCE A;  1O7U A;  5EL8 A;  1OC9 A;  3QCP A;  4ECI A;  1U87 A;  3TB2 A;  3KXO A;  4TN8 A;  2HSN B;  2K8S A;  3NIV A;  4G19 A;  3ZMK A;  2EFC A;  2QC7 A;  4MPF A;  3UJ1 A;  5B8A A;  3ZFB A;  2R0C A;  1PD2 1;  2I3Y A;  4Z2R A;  3WT1 A;  1XOB A;  4F9Z A;  1Y6E A;  3NZN A;  5EY6 A;  3FMW A;  1N25 A;  2B6M A;  2WZ9 A;  4WBR D;  4DSS A;  3EYT A;  3I43 A;  1KTE A;  2G2Q A;  2TIR A;  2X64 A;  1GSE A;  4OCF A;  1K0D A;  2L6C A;  2UV8 G;  2RLI A;  4KGI A;  4O92 A;  1TRW A;  1SJI A;  2AV4 A;  2IFQ A;  5D9T A;  3GUR A;  4MNN A;  1GSF A;  4EL1 A;  1TP9 A;  2B7K A;  5JWR B;  5HFK A;  2LRN A;  1G6W A;  3V1W A;  4MJC A;  1M0U A;  5A1N B;  1I9D A;  4MH3 A;  4ZL8 A;  4EUY A;  2F51 A;  1GH2 A;  3DVW A;  2DJ0 A;  2H6Y A;  3RPP A;  5ECN B;  1TK0 B;  4WET A;  2WDU A;  5EVO A;  1KEB A;  2P5R A;  4IJ3 A;  4HJ2 A;  2CX4 A;  1SK2 A;  4FH8 A;  1SL2 B;  1R5P A;  1T00 A;  1EEJ A;  2VL2 A;  1ZYQ B;  5CRW A;  2AAW A;  1ABA A;  1VF4 A;  3RHC A;  4F82 A;  1EGR A;  1WPI A;  4TXV A;  4JR6 A;  3RBT A;  2R37 A;  5DCH A;  2WUL A;  1BF5 A;  3EU3 A;  1A2M A;  1FB6 A;  3EVI A;  2YWM A;  4USS A;  1TK5 B;  5GAN D;  2HRK A;  1GSS A;  3KTL A;  2R2J A;  3APO A;  3SBC A;  3VPQ A;  4POL A;  4JR4 A;  4EIQ A;  3IA1 A;  5IMF A;  4LL1 B;  4I6X A;  1K3L A;  5ECR B;  1SD9 A;  4IEL A;  2GSR A;  3L9U A;  5G31 A;  3D0Z A;  1XPV A;  3BCK A;  2CAQ A;  1UC7 A;  3E3E A;  1QFN A;  5HQP A;  4G0K A;  1F2E A;  1VF1 A;  3UOM A;  3UMA A;  3P7X A;  4IS0 A;  2VO4 A;  4CW9 A;  3VUR A;  3F4R A;  2C4J A;  1MDK A;  4NHZ A;  1S3A A;  1GUM A;  3TRP A;  3U5R E;  2HRN A;  4IJI A;  1YQ1 A;  3KTB A;  2HSN A;  1GUL A;  3DVX A;  1OE8 A;  4EE0 A;  3F9U A;  3VPT A;  4ZXG A;  2PU9 C;  2L59 A;  3ZYW A;  2I9H A;  3FY7 A;  4K1F A;  4IKH A;  1MDJ A;  5IIZ A;  5ABR A;  3F3R A;  3H93 A;  3A2V A;  1ERW A;  5JCW A;  4WF5 A;  1SL1 B;  1KBN A;  4KW6 A;  5IOW A;  2MMZ A;  2H6X A;  1GLQ A;  1TXU A;  1RQM A;  2X8G A;  4RUV A;  2B5X A;  4EC0 A;  1SYR A;  3PGT A;  3QPM A;  4MF5 A;  1DBY A;  2WGR A;  5GZZ B;  1SVO A;  1WMJ A;  1TK8 B;  1FW1 A;  2NVL A;  2NDO A;  4DSQ A;  1HD2 A;  4N0Z A;  3ZTL A;  2VD1 A;  2DJ3 A;  5IO2 A;  5JCU A;  5GST A;  4LLR A;  4EXJ A;  4PGT A;  3JCM L;  1GUK A;  14GS A;  5ECK B;  3TU3 B;  3UL3 A;  4J57 E;  3WD6 A;  4K7O A;  5IMD A;  1K0O A;  4Q5R A;  2FA4 A;  1Z6N A;  2WCI A;  1X5E A;  3GKN A;  2DJK A;  3MYD A;  2VLV A;  2HQT A;  1K0B A;  4HU9 A;  3GA4 A;  1GP1 A;  1Q98 A;  3RHB A;  3IC4 A;  3W8J A;  3G7Y A;  1A23 A;  3A5W A;  5EPF A;  5B6M A;  3FZ4 A;  1FOH A;  2FA8 A;  2J9H A;  5D9V A;  4PUA A;  2YWN A;  4WXT A;  1OVN A;  4DVC A;  1XW6 A;  3CSH A;  1WWJ A;  3PR8 A;  3VFI A;  4ILF A;  4AJ8 A;  2IPA A;  3KP9 A;  2PVQ A;  2DML A;  1U3A A;  5C00 A;  2WFC A;  4IP1 A;  4EDY A;  2CQ9 A;  2QKE A;  3GH6 A;  4YAV A;  2K6V A;  1JLW A;  2F8A A;  4N0V A;  3EUR A;  2NPB A;  1X9S B;  3GKK A;  2HXK A;  3HVS A;  2KLX A;  2OBI A;  1KNG A;  2AB6 A;  4KH7 A;  5DAL B;  3CBU A;  7GSS A;  1E6B A;  1F9M A;  3FR9 A;  1T3B A;  2VCT A;  3A5I A;  3F4S A;  1T4Y A;  4ML6 A;  4YQV A;  3TKP A;  4YQM A;  2H1A A;  1GNW A;  4OMV A;  4AF2 A;  1AQW A;  4GSS A;  4DEJ A;  3WGD A;  2OT3 A;  4PQ1 A;  1X9W B;  6GSV A;  2FY6 A;  3TJJ A;  3N5O A;  1J08 A;  3GSS A;  1HYU A;  2HSM B;  2JZR A;  3EMP A;  3D4T A;  3LYP A;  3BOA A;  5CNW A;  5D93 A;  4MZC A;  2N5B A;  2YNX A;  5F8B A;  1XWK A;  2DJ1 A;  4K7I A;  4D73 A;  3LW9 A;  2JU5 A;  1FHE A;  3C71 A;  2GGT A;  2JAD A;  2V2G A;  2OA7 A;  4OWY A;  2GTU A;  5A5K A;  4ZB7 A;  1EEM A;  2YPM A;  2VLT A;  2X4A A;  4HU7 A;  5ELG A;  1JLV A;  4FIW A;  5IO0 A;  5DDL A;  5DJL A;  2YP6 A;  1EP8 A;  3D6I A;  4QL9 A;  5DVB A;  10GS A;  2HT9 A;  2V6O A;  1TXX A;  3C1S A;  1Z7R A;  1SK1 A;  5FT3 A;  1AQX A;  5A4V A;  2E0Q A;  3DGQ A;  3LXZ A;  1WP0 A;  2JZS A;  5J4Y A;  3QAW A;  4HDE A;  2WB9 A;  3SWL A;  5G1L A;  4PNG A;  4K2X A;  3S9F A;  3IR4 A;  4W66 A;  1BG1 A;  2FWE A;  1TU8 A;  1IYH A;  4G2E A;  4LMV A;  1T1V A;  2MMA A;  4O5Q A;  1OYJ A;  1X5D A;  2IMK A;  3FZ5 A;  1XW9 A;  5HR1 A;  4ZIJ A;  1U3I A;  3C7M A;  4GSN A;  2LNS A;  3IAS 2;  1UA5 A;  4ECC A;  3HXS A;  4TVE A;  4XRA A;  1K0A A;  5IMC A;  1BED A;  5HFG A;  2AUV A;  1TU7 A;  2A4V A;  4P3Y B;  5ECI B;  4EO3 A;  4MJA A;  2VAF A;  5F05 A;  4GCI A;  1B4P A;  1OAZ A;  4NXI A;  4EF0 A;  4OFM A;  1EV4 A;  1SVM A;  1A24 A;  3ME7 A;  2K18 A;  2YZH A;  5A5H B;  5D73 A;  4KB3 A;  2H19 A;  5KEJ A;  2MYG A;  3IK9 A;  2LRC A;  1F37 A;  4BPY A;  3O76 A;  3EWL A;  4NV5 A;  3M8N A;  3TJF A;  1WOU A;  5DAL A;  1ERT A;  1I5G A;  2IIY A;  1MD3 A;  3WGX A;  3HYP A;  5ECH B;  5GSS A;  3FZA A;  4K9Z A;  3P90 A;  2L57 A;  3ERG A;  1GTI A;  2H8L A;  4PUR A;  1MDI A;  2GZP A;  1EOG A;  1A8Y A;  1ZGN A;  3GL5 A;  2AHE A;  4WF4 A;  1GTU A;  2R0P A;  3TOT A;  1QUW A;  2OE1 A;  2HSM A;  4L0U A;  2VL9 A;  2FWF A;  2DC5 A;  4AI6 A;  3VWV A;  5HR3 A;  4K5S A;  1ON4 A;  3LWA A;  4FQU A;  1Z7P A;  3H4K A;  2VCQ A;  2YCD A;  3LEF A;  4E68 A;  11GS A;  1A2J A;  3L9V A;  4POK A;  1CQG A;  1ERU A;  1FO5 A;  4HJM A;  3G7J A;  3RAZ A;  3GRX A;  2GDR A;  1HNB A;  2F3M A;  5CO3 A;  1TW9 A;  6GST A;  4ZIL A;  3FK8 A;  2PER A;  3TKS C;  1BYE A;  3LQ7 A;  3H8Q A;  2PUK C;  4ACS A;  3WYW A;  3ED3 A;  1G7O A;  2DKI A;  4MP4 A;  2H72 A;  4L5L A;  4GQC A;  1JFU A;  1PRX A;  1BJX A;  2E2G A;  1SVL A;  2CAI A;  3ME8 A;  4IVF A;  5ECL B;  5G2Z A;  5CRD A;  3I6A A;  4TR1 B;  3DKS A;  3HMJ G;  1PKZ A;  1PN9 A;  2LEG A;  2BJX A;  3LXT A;  3IV4 A;  2MBT A;  2H73 A;  2YAN A;  4AGS A;  2L4Q A;  2N5A A;  2VD0 A;  1MEK A;  1BAY A;  2C80 A;  1TKD B;  1JZO A;  2ALB A;  4JRR A;  5IOX A;  4AKG A;  4BA7 A;  4OFT A;  2C3T A;  1XVW A;  2O7K A;  1SYX A;  1VF2 A;  3CYN A;  3ZIT A;  2LJK A;  4BL7 B;  3DWV A;  3CXG A;  4MCU A;  3IC8 A;  3QAV A;  2L4C A;  1T4Z A;  2EFH A;  2C3Q A;  4N3Z A;  4ML1 A;  4AKH A;  4HOJ A;  3LYK A;  4ICY A;  2X8C A;  1V40 A;  3GX0 A;  3ZFL A;  2O5V A;  3LSZ A;  4X43 A;  1U6T A;  4WBJ A;  3OR5 A;  3L4N A;  1OKT A;  3GST A;  2R3X A;  5LNK e;  1ST9 A;  4G10 A;  2XPE A;  2HRA A;  4I8B A;  2O89 A;  4L0W A;  1M9A A;  4V2N A;  2B1L A;  2FD3 A;  2I1U A;  3GUS A;  2R6K A;  4LMW A;  4GRF A;  1XZO A;  1OE7 A;  3MSZ A;  4GWR A;  4ZB8 A;  1GSD A;  3LG6 A;  1MTC A;  4NPB A;  2HSH A;  1J0F A;  3D21 A;  5CAX A;  1QMV A;  3WGE A;  2H0H A;  5J4U A;  4KDX A;  2ZUP A;  3F63 A;  3M0F A;  1XCC A;  3BJ5 A;  2OJL A;  3HJP A;  4O5R A;  4JBB A;  2KUC A;  1BG5 A;  4MF6 A;  3UAP A;  3TJB A;  1ML6 A;  2V32 A;  1ILO A;  2M46 A;  2IWT A;  4RQR A;  3A3T A;  5E59 A;  3TKQ A;  4MZW A;  4K0G A;  4KSO A;  1F3A A;  5D9W A;  1RW1 A;  2RM5 A;  1OKD A;  3QFB C;  2QSI A;  4PUF C;  5L71 A;  6GSS A;  1TDI A;  1NM3 A;  3M9K A;  5IMA A;  4TOP A;  4MJB A;  5AIX A;  19GS A;  4AJ6 A;  3LJR A;  3UVH A;  2XBQ A;  1PGT A;  2XHF A;  2BTO T;  5BMU B;  3IBH A;  1FVJ A;  4TR0 A;  2GLR A;  4EVM A;  5KN0 A;  4KDY A;  4E8H A;  3GKX A;  2H1L A;  2OE3 A;  1XFL A;  3E9J B;  4MJE A;  4HS1 A;  1Z6M A;  3IPZ A;  3TRX A;  2C1Y A;  4PTS A;  4RI6 A;  5HR0 A;  1XWB A;  1ERV A;  1QXH A;  4V1A p;  5A1N A;  3VI7 A;  1XWC A;  1O8X A;  3UAR A;  5J5N A;  4HQZ A;  1VRS D;  2PN8 A;  1LJR A;  3TCO A;  3FHK A;  1N8J A;  2B3S A;  3US3 A;  2D2Z A;  2ZCT A;  4GLT A;  4KCA A;  1H75 A;  4BL7 A;  5G30 A;  4MA9 A;  3EE2 A;  4ZB6 A;  2C8U A;  3J7Y k;  1SJ6 A;  3DIE A;  2XPD A;  3EU4 A;  2PWJ A;  4K5R A;  4MZB A;  1O6J A;  4GXZ A;  2H71 A;  4EKZ A;  1R26 A;  2DBC A;  1AUC A;  3M9J A;  2VOC A;  3EIN A;  1LU4 A;  2DMM A;  3A2X A;  4TRX A;  5ID2 B;  2HZF A;  1V58 A;  3G7I A;  4F0C A;  2J23 A;  3ZIV A;  1AAZ A;  5CRE A;  2REM A;  1WIK A;  3IRA A;  2H76 A;  4TXO B;  1DUG A;  3E0U A;  5KN3 A;  3ISO A;  3HVX A;  1SKS B;  3F4T A;  4IGJ A;  1AW9 A;  3ZRE A;  4AKX B;  4BWQ A;  3Q19 A;  5ECS A;  2K8V A;  2YZU A;  1WJK A;  17GS A;  1YKA A;  4X0X A;  1EOH A;  4TR3 A;  1SEN A;  4Q5Q A;  6GSY A;  4ZB9 A;  3APS A;  2C0G A;  2PVO C;  3KH7 A;  1GSQ A;  4JE1 A;  2VCW A;  2FHE A;  3VLN A;  4Z2U A;  1NSW A;  2FUG 2;  4TW5 A;  1YF0 A;  3L78 A;  4F0B A;  3DML A;  1C72 A;  4IW9 A;  1ZMA A;  1FG4 A;  4CDO A;  5J3R A;  4ZL7 A;  1K0N A;  2OKA A;  1ZYN A;  1V2A A;  5DAK B;  1VGL A;  5CP1 A;  4KAE A;  1M2B A;  5G5E A;  1DE2 A;  1G0T A;  1OC9 B;  3DYR A;  2B5Y A;  2LJR A;  1Z9H A;  2X8H A;  4I2T A;  4X1U A;  1O81 A;  2HZE B;  2C3N A;  2H1B A;  5FWG A;  4HZ4 A;  4BVX B;  4IBP A;  2O8V B;  4IQA A;  5BMU A;  3VK9 A;  2GSQ A;  3A2W A;  2DKH A;  3TRQ A;  2H6Z A;  2LQO A;  3HZ8 A;  2IMI A;  4CY6 A;  1W4V A;  4MK3 A;  1SKW B;  3CMI A;  2AYT A;  1DSB A;  3KGK A;  3HHV A;  2A2P A;  3F3Q A;  3GMF A;  1GSY A;  4AJ7 A;  2JZT A;  2YWI A;  2I4A A;  2IN3 A;  1GTA A;  1YF1 A;  1T8E B;  2FWH A;  4QQ7 A;  1JHB A;  2V6K A;  1QQ2 A;  2ON7 A;  4J56 E;  3TKS A;  5IMZ A;  1BX9 A;  3HKR A;  1V98 A;  4XS4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...