4ID0A

Crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900011, with bound glutathione sulfinic acid (gso2h) and acetate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
204
structure length
204
Chain Sequence
SLTLFHNPASPYVRKVMVLLHETGQLNRVALQASQLSPVAPDAALNQDNPLGKIPALRLDNGQVLYDSRVILDYLDQQHVGNPLIPRDGSARWRRLTLAALADGIMDASVLVRYELALRAPEKHWEQWLDGQRDKIRRALAVLEAEAIAELASHFDIAAISVACALGYLDFRHPDLEWRQDHPQLAAWYFEISQRPSMLATRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase-like protein YibF
publication title Crystal structure of a glutathione transferase family member from Pseudomonas fluorescens Pf-5, target EFI-900011, with bound glutathione sulfinic acid (gso2h) and acetate
rcsb
source organism Pseudomonas fluorescens
molecule tags Transferase
total genus 65
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4id0A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4id0A01
1T8EB 2M72A 2YZHA 1N2AA 5EL8A 2OADA 5IMAA 3TDGA 4HDEA 2DMLA 1GSDA 3D0ZA 5DJLA 4MPGA 2F9SA 2G2QA 5D9VA 4EKZA 3IHQA 1XOAA 5JWRB 3TJFA 3MSZA 4HU7A 1THXA 2B7JA 1K0CA 1GNEA 2R4VA 2H76A 3HCZA 1I5GA 1AQWA 1GSFA 5DCGA 4V1Ag 2FD3A 2LRTA 1EV9A 4WR4A 2RUEA 2ON7A 6GSVA 4MCUA 9GSSA 1N8JA 5IO0A 1YF1A 4KDUA 1JZDA 2K18A 4IP1A 1K3LA 1PA3A 1Y6EA 3TCOA 2H30A 4XS4B 3IPZA 4MZBA 1GNWA 4PQHA 3H8QA 4N10A 2NVLA 3ZIVA 2V6KA 4I2UA 2H75A 5EPFA 2RM5A 4XTSA 2VCQA 2GZYA 3H79A 1SJIA 3KXOA 2XPDA 4OCFA 1AUCA 2VD0A 4MK3A 5G30A 3KCMA 4ZXGA 4MZCA 1EZKA 5ECNB 2ZCTA 4EL1A 3HVXA 2DJ2A 1VF1A 5INYA 4DSRA 3IC8A 2N5FA 3U6VA 13GSA 2I1UA 2FWEA 1A2JA 1CQGA 2VD1A 4WF4A 4G0LA 4KW6A 4ECJA 3E0UA 3P90A 3WT1A 1ZL9A 3GMFA 1MD4A 2IMEA 2KP2A 1ZCPA 5D8IA 1GULA 2OACA 4G2EA 4QL7A 5D9TA 1B4PA 2HRKB 4KF9A 1SU9A 4X0XA 3IK9A 2PWJA 4G0IA 2LQQA 4HZ2A 2D2ZA 2WZ9A 5DQYA 2WJUA 2J23A 1LU4A 3IR4A 5D73A 5IO2A 2WULA 3R3EA 4BVXA 4NHWA 1GSEA 2MMOA 2JL4A 5DALB 2GT5A 4QQ7A 2YANA 1O85A 3WGDA 2P31A 2GQKA 3FZ5A 4YH2A 5KN3A 4OMVA 1ABAA 1GP1A 2FNOA 1NSWA 5G31A 3DD3A 1EOGA 1K0DA 3VWWA 4PQIA 5H5RA 4D73B 2E2MA 2H1BA 1AAZA 2L4QA 4NV2A 1PL1A 2C0GA 17GSA 4KE3A 3UVHA 2L59A 2TIRA 3VK9A 3GNJA 1XVQA 1V58A 3G7IA 4I5QA 3ZL5A 2KLXA 3JCML 3UVTA 2R3XA 1BX9A 1OAZA 1T1VA 1O8WA 2CV4A 2G0FA 1TRVA 2IL3A 2DIYA 3VPTA 1SYRA 4XRDA 1QK8A 1EV4A 3CRUA 2JADA 2QGVA 3FRCA 3FK8A 2GQMA 3I43A 4IHUA 3CYNA 3HYPA 3IDVA 3FZAA 3P8WA 4NMUA 4KSMA 4I8BA 5FHIA 5F05A 4XHMA 4PTSA 5JCGA 1KBNA 2YV9A 1EGOA 2K8SA 6GSWA 2JSYA 2I9HA 4OWYA 5HFKA 1XWBA 5IPHA 3QAVA 1THOA 3TJKA 2LRCA 3KH9A 1G6WA 4MJCA 1M7TA 3MWHA 2B3SA 2IMKA 2K9FA 4V1Ap 1GUMA 4MZWA 2HZEA 1FHEA 4L0WA 3EU4A 3E9JB 3F63A 2GVPA 4OO4A 1YKCA 2IWTA 4IELA 1E2YA 4TR0A 5A4UA 2NTOA 4ISDA 2H1GA 3F9UA 3PGTA 5GAPD 4JEDA 1F6MC 1ACVA 3A5WA 2HLSA 5A4VA 2DJJA 4YQUA 3GTUA 5J5NA 3BCIA 3TUEA 2C3NA 3ERWA 4GQCA 3PINA 4MMMA 3QOUA 2HZFA 4EC0A 3GUSA 2REMA 4OFMA 4N0VA 3ZIJA 4KSOA 5G5FA 2AB6A 2WS2A 1WWJA 3OR5A 5DAKB 2LNSA 4Q5FA 2PVQA 4NV5A 2VCTA 3D21A 1ERWA 1K3OA 5GSSA 4K8MA 4WR5A 1Z5YE 2PPTA 1J08A 1O73A 3BOAA 3ZYWA 1DBYA 3GYKA 4CHSA 5CNWA 4HI7A 19GSA 4J57E 4K1FA 1ZGNA 4IQ1A 3GL5A 1XW6A 2A2RA 2DJKA 4BWSA 4KUNA 2VLVA 1ZYEA 3HVSA 3F6DA 1PKWA 3GX8A 4HS1A 4J2FA 3KZQA 1PX7A 2FA8A 1JZWA 3DYRA 4BL7B 2A4VA 1DE2A 1O8XA 4FYBA 3A2WA 4TR1B 1GSYA 4BVYB 1FVJA 1R5AA 2OJLA 4KGIA 3ISOA 3KP9A 2B5EA 4FIWA 2HYXA 2VCZA 3TKQA 3NIVA 4MH3A 5CO3A 2O7KA 5DDLA 2LKUA 2TRXA 2H1AA 1ZMAA 4FH8A 2JZTA 3IC4A 2NPBA 4IKHA 2HSHA 3GRXA 2B6MA 4P3YB 1EWXA 3IAM2 1JZRA 2FGXA 2EC4A 2O89A 20GSA 1K0AA 1KNGA 1VRSD 4AGSA 5G1KA 4RQRA 1FB6A 2MYGA 3RHCA 2X99A 1F2EA 1PL2A 2CVDA 4PX1A 2RM6A 2LS5A 3V1WA 1X0RA 3VLNA 3C7MA 3D5JA 4I97A 1EEJA 3HDCA 1OC9A 4K2DA 4PGTA 1RK4A 2YV7A 1PD21 5C04A 2H1DA 4FO5A 2DLXA 3VURA 2FCHA 1V57A 2C0DA 3C1SA 3M0FA 2LUSA 3DEXA 1XW5A 2MBTA 3WD6A 1X5CA 4XS4A 2YOIA 5J3RA 1GTAA 5ECKB 2PGTA 5BMUA 2FWFA 3LYKA 3ERFA 1C72A 1XWCA 1FB0A 3L9SA 5G5EA 5ABRA 1T00A 4DSSA 1JLWA 3FKFA 2ZNMA 1YY7A 1WJKA 2HRNA 2O87A 3LEFA 4HEA2 3EC3A 3IE3A 1H75A 1YF0A 5C00A 1K0MA 1GTBA 3N5OA 1V9WA 2YWMA 2WB9A 3WGXA 3FEUA 1PRXA 3ME7A 3W6GA 3FR9A 5CRWA 1F3AA 1HYUA 1B9YC 3KTLA 4KX4A 5IMCA 4K7OA 5JCWA 1XIYA 4EF0A 2HRKA 4ML1A 3ZZXA 1AQVA 1Z7PA 4XCSA 3DVWA 5IMDA 2NDOA 1GLQA 2P0GA 1QGVA 1TRUA 2X8HA 4LA1A 1JLVA 2V41A 1T3BA 6GSSA 4TXOA 2X64A 2GSSA 2H19A 4EXJA 10GSA 1ML6A 3NOFA 2CQ9A 5DALA 5G2ZA 1AW9A 4ZL8A 2C80A 1QFNA 4G19A 5LD0A 5AIXA 1TK0B 3D4TA 3F4TA 2YNXA 4I2TA 1URMA 5CRDA 1Y25A 1YQ1A 2IIYA 1GLPA 1SJ6A 1NHOA 4IJIA 3TJBA 1OC3A 4ZL9A 1X5DA 1R26A 1GL8A 1Z3EA 3KMNA 2GSTA 3A2XA 4N11A 3TKPA 1Q98A 2DMMA 4YQVA 2DC5A 5E59A 4EE0A 2FUG2 4NPBA 2C4JA 4BWQA 4AF2A 2XBIA 3DGQA 3TKSC 2VOCA 4O5RA 3FR6A 5F06A 1OE8A 1OE7A 1AQXA 4MABA 5IMZA 1YKAA 1A23A 2EIOA 2F8AA 3TGZA 3WGEA 1O6JA 1LJRA 2K8VA 5AISA 3FY7A 2QC7A 2X8CA 4K0GA 4EVMA 2HQTA 1G7EA 4X43A 2OA7A 3UMAA 2BTOT 3LGCA 5D9XA 5ECOB 4GXZA 3TKSA 1A24A 3A3TA 1BYEA 1GSUA 1LBKA 2IPAA 3EVIA 4ZB6A 1FAAA 5JWQB 1TKDB 2DJ0A 3M9JA 4HJ2A 3GSTA 2OKAA 3L9UA 4OO5A 3VI7A 2C8UA 22GSA 4FYUA 3UOMA 4XS6A 4F9ZA 5G1LA 1BEDA 1SKWB 2LQOA 3AY8A 3NZNA 3APQA 3FHKA 4HQSA 3VWVA 2X8GA 2E7PA 2FWHA 1M9BA 2HSMA 3UL3A 3SBCA 4HZ4A 12GSA 3Q74A 1XW9A 1VF2A 4ID0A 4HQZA 2VL3A 3J7Yk 2HSNB 3I9V2 1S3CA 4MA9A 3TJJA 1G0TA 2FA4A 2AYTA 5HR0A 4OFTA 4WF5A 3KM6A 1SKSB 3FYGA 4NHZA 4O7HA 4K7IA 2CZ3A 5B8BA 1ERVA 4QL9A 2HSYA 4N0ZA 3CXGA 5F8BA 3HA9A 3RAZA 1PQNA 4ZIJA 2IJYA 3UBLA 1WOUA 1M0UA 1M2BA 4POKA 2KUCA 2HT9A 2VM2A 2WFCA 4WEYA 4YAVA 3ZRDA 5HR2A 2M80A 3H4KA 3GKNA 2YJHA 5LNKe 5CAXA 3LJRA 4NAXA 1EOHA 2TRCP 2YWOA 2B7KA 2AJQB 5AN1A 2VCVA 1FW1A 3O6TA 3EMXA 5ECRB 2YWIA 3HXSA 4JBBA 2C0FA 2IFQA 1X9MB 1USBA 4X1UA 3L0HA 2HRFA 1T4YA 5L71A 5CRHA 5HFIA 2VLTA 2ON5A 4IVFA 2F51A 2HI7A 3L9VA 3D6IA 2B5XA 2H66A 4MPFA 4TR1A 4WBJA 1RW1A 3G9BA 4BVYA 3Q18A 4TOPA 11GSA 1SK0A 1M2AA 2LSTA 3H93A 2GGTA 2LJAA 4GTUA 1V40A 2CT6A 5H5QA 3GKMA 3D22A 2PVOC 1SD9A 2JZRA 3EINA 4KNDA 1ON4A 1UC7A 4F82A 4HOJA 2DIZA 4ACSA 2KOKA 5KN1A 3GKXA 3M1GA 4H86A 2V6OA 1FO5A 4BVXB 1AC1A 3RPNA 1BG5A 3HZ4A 4KDYA 4G0KA 2LNTA 1B4QA 1ST9A 1X5EA 5IMVA 5KN2A 1XFLA 1S3AA 1OC8A 3CTGA 2AAWA 4HUAA 3F0IA 1MDJA 1WP0A 2DSAA 5D9WA 2H72A 4EDYA 4FQUA 3F4RA 3Q19A 1AXDA 5IM9A 3PPUA 3GKKA 3QDNA 1WE0A 5CYYA 2L57A 5EY6A 1HNBA 4PNGA 4BPYA 2IMFA 2BJXA 4G9HA 4KH7A 2H0IA 2OE3A 2R6KA 3F3RA 1XZOA 4MP4A 2HFDA 4IS0A 5IIZA 1MD3A 3GH6A 3TJGA 5IPGA 1UN2A 3MNGA 2N5AA 5F07A 1YEXA 3IXRA 1FVKA 2GSQA 1YZXA 2MMAA 5ELAA 1PSQA 1QUWA 2GQLA 4F2IA 1H4OA 3KP8A 4MF5A 1WRYA 2C3QA 3ZITA 5FT3A 1QMVA 4KCAA 2E0QA 3QFBC 3QR6A 3DIEA 5HR3A 4Z7XA 3RBTA 2F3MA 2L6DA 1BJXA 2VL2C 3UEMA 3SWLA 2LRNA 4ML6A 1A8YA 2H0GA 2CX3A 2VAFA 1FOVA 4PUAA 3RDWA 3A2VA 3IBHA 1ZYQB 1NHYA 1Q4JA 3C73A 2JZSA 1K0BA 1K3YA 1GTIA 4RUVA 1WIKA 1W89A 2QKEA 3CSJA 4ZBBA 4N30A 4ECIA 1M99A 1F37A 1TU7A 2CAIA 5ENUA 2YWNA 3EYTA 2IN3A 1UA5A 1GSSA 5AGYA 2I81A 2VL2A 1WMJA 4KDXA 2PUKC 1U88A 3FR3A 1PN9A 4POLA 1PKZA 4O32A 1TK8B 4IW9A 3VWUA 3GTUB 2PN8A 2GDRA 4ECBA 3F3QA 1MEKA 3BBYA 5E4WA 2C1YA 5F0GA 2I4AA 2CA8A 4PQ1A 6GSUA 1MTCA 3M8NA 2VLUA 4JRRA 4GLTA 1ERUA 2LJKA 2WGRA 2MBSA 3KH7A 4AJ6A 3TKRA 2VCWA 3HVVA 5DVBA 4IJ3A 2UZ8A 2GZPA 3P2AA 2ES7A 1XPVA 4V2NA 6GSXA 3MDKA 1PMTA 4MJAA 5A5KA 5CP1A 4EUYA 5B6NA 1HNCA 4YQMA 5B8AA 2GTUA 2E2GA 3PH9A 3W8JA 4CDOA 4PURA 4IQAA 1YDKA 1OKDA 1HQOA 2CX4A 4EDZA 2XPEA 1R5PA 4JU5A 2H70A 1GWCA 5ECLB 3KMOA 2O85A 3TRXA 4OCEA 1A0RP 3EU3A 3ZMKA 1Z6NA 2M46A 3LFLA 3APSA 4MJEA 1TW9A 4MLYA 5GAND 1Z9HA 4K0NA 4ULXA 1G7OA 3LQ7A 1GH2A 2VCXA 2B5YA 2OBKA 2YZUA 4BA7A 2H6YA 2P5QA 1EP8A 2O8VB 2PERA 3WYWA 5ID2B 1TI1A 2Z9SA 4GF0A 3S9FA 3RHBA 1B9XC 3TRPA 5ECPB 4JR6A 5ECMB 1TOFA 4ZB8A 4D73A 1M2DA 3QAGA 3UBKA 1MDKA 1OC9B 1IYHA 3O76A 4KB3A 5ECSA 1GTUA 1WPIA 2H0HA 4MH2A 3MAKA 1GUKA 4RI6A 5DJMA 1SJZA 1EP7A 5HQPA 2V2GA 3FW2A 2GS3A 4IGJA 2OE1A 16GSA 3TRQA 2KHPA 4TR3A 3E3EA 4POBA 3TOUA 2XC2A 2EIRA 1M9AA 4ZBDA 2LEGA 2XBQA 2PBJA 4RQXA 5KEJA 2LTKA 1SENA 3LXTA 6GSTA 3U5RE 4DSSB 4PXOA 3I69A 3QPMA 4K6XA 4XS1A 1QXHA 1YJ6A 1BAYA 3DMLA 4TN8A 1F3BA 2RLIA 2VL9A 3QFAC 3IK7A 1TXXA 1XWGA 4Q5RA 5ECQB 2R2JA 5J41A 1SD8A 7GSSA 2IMDA 2FHEA 4IP6A 2XHFA 2HE3A 5DQSA 1NW2A 1VF3A 5CREA 3EMPA 1G6YA 2V32A 3CTFA 3EWLA 1O81A 1U6TA 4KAEA 1TRWA 1X9WB 3DVXA 3IAS2 2K6VA 4Q5QA 3HY2A 5B7CA 1VGLA 1A8LA 2BMXA 3DKSA 3TKSE 3M9KA 3ZVJA 2H6XA 1A2LA 1U87A 4TXOB 2WRTA 1GRXA 1ZZYA 3GURA 4POMA 5EVOA 4AJ7A 4GQFA 8GSSA 1TU8A 3KTBA 2JU5A 1J9BA 4IBPA 3EURA 4AJ8A 1J0FA 4OFNA 1XCCA 4OD7A 3P7XA 4GRFA 3KIJA 2P5RA 3HZ8A 4LLRA 3DXBA 2YP6A 4FYCA 2LV3A 3C1RA 2YN1A 2H73A 4TKYA 2AHEA 5IOWA 3O3TA 1E6BA 2V1MA 2J9HA 2YCDA 5DAKA 1BQ7A 4LMWA 2OE0A 2IMIA 4LL1B 4LMVA 4DEJA 2JSZA 5DCHA 3M3MA 2JACA 4F0BA 4TRXA 4TXVA 4KA0A 4LL4B 4PNFA 2ZUPA 3G7JA 4I6XA 4JZQA 1F9MA 3GN3A 2C3TA 5IMFA 2C0EA 4TW5A 1O7UA 3CSIA 4E8HA 4Q5NA 2NBSA 2H6ZA 1VF4A 3C8EA 1OYJA 2RIIA 3ZREA 3Q6OA 1A2MA 1AIUA 1SK2A 4BL7A 3GHAA 18GSA 4F03A 3DRNA 3ED3A 1TTZA 2MMNA 3FZ4A 1ERTA 3TB2A 1SKRB 4EO3A 3H1NA 3APOA 1XOBA 1TJDA 5J9BA 3IV4A 1QQ2A 4NWYA 2B1KA 2L5LA 2MMZA 3DWVA 3GIXA 4J56E 3ZLPA 3L78A 2H8LA 4USSA 5GSTA 1TP9A 3IRAA 2CAQA 3ERGA 4ZILA 3BJ5A 5J4UA 3ZVJD 3WT2A 3EE2A 2HRAA 1XWKA 5IOXA 4NXIA 3ME8A 1EEMA 2HSMB 4O92A 1PGTA 1K0NA 4DSQA 1YEPA 3BCKA 4XRAA 3F6FA 1KEBA 1U3AA 3CSHA 4IN0A 2L4CA 4E8EA 1EGRA 5KN0A 1Z6MA 1XVWA 2KP1A 4TR4A 5LCZA 3VFIA 2GZZA 4JE1A 3RPPA 1DSBA 2OBIA 4MF6A 4WETA 1V98A 3QCPA 1Z7RA 1XWAA 2L5OA 2YPMA 1GUHA 5ECIB 5DBQA 2CVBA 4ZBAA 2H71A 3HHVA 3HJOA 1XBSA 5ELGA 2CZ2A 2QSIA 3TOTA 4WBRD 5JCUA 3QD9A 4F0CA 2B1LA 3FZ9A 5J9CA 1RQMA 2GSRA 2AV4A 4ECCA 2GLRA 3KGKA 1K0OA 3LG6A 6GSYA 1I9DA 1DE1A 3HD5A 3KEBA 1U3IA 2IFQB 1B8XA 2WDUA 1V2AA 3ZFBA 4G10A 4WXTA 5H5SA 3QMXA 3UARA 1ILOA 1UVZA 2H74A 1S3DA 5AIVA 2H01A 3R2QA 1MDIA 4ZL7A 4GCIA 2GT6A 1PX6A 2AUVA 3GX0A 1B48A 2N5BA 4GSTA 4K9ZA 2HXKA 5A4WA 3C71A 4RI7A 2HZEB 5D93A 1SK1A 5IQYA 3VWXA 1T7PB 1JFUA 2F8FA 1HNAA 3IA1A 3UAPA 4KCEA 4PUFC 1OKTA 1TDIA 5CRGA 5ECHB 3K8NA 4ILFA 4K7NA 2R5GA 3VI5A 3CBUA 4WKWA 5ID2A 2L6CA 1CQHA 1X9SB 1OVNA 1T4ZA 5GZZB 1NM3A 1SYXA 4V2MA 3ZMLA 2YJ7A 2EIQA 2VO4A 1A0FA 4DVCA 3GH9A 1ZOFA 1TI3A 3CMIA 3L4NA 3PR8A 5JWOB 5B6MA 2I3YA 4L0UA 5FWGA 3N9JA 3HJPA 4CW9A 4L8EA 3LYPA 2PU9C 3W8SA 3CRTA 4TVEA 3GFKA 2A2SA 4GSSA 1TRSA 3G7YA 3BD2A 5HFGA 3GL3A 3GSSA 3LSZA 2FWGA 3LWAA 4GWRA 4HU9A 2RUFA 3F4SA 4YAPA 2VIMA 1SL1B 3GA4A 4L5OA 1JHBA 4V2LA 3D4MA 1DUGA 3UIWA 1R7HA 1HD2A 3LORA 3HKRA 2MZCA 3GV1A 2CVKA 3I6AA 3ZFLA 2DJ1A 1IYIA 5COHA 2FLSA 4MDCA 3KD0A 1SL2B 5HR1A 2LJRA 2ALBA 1KTEA 3VPQA 1XXUA 4HJMA 4L5LA 1TK5B 5D96A 3F8UA 2FY6A 2DJ3A 4ZB9A 4GSNA 3UJ1A 2DBCA 2R37A 2PMTA 3HJMA 3KJYA 3LXZA 4MJBA 3QAWA 2VUPA 3IOSA 1R4WA 1GSQA 2WCIA 1FG4A 3ZTLA 2VM1A 4XIHA 1JZOA 14GSA 3J7Yb 1SL0B 4JR4A 2HNLA 1W4VA 4MF7A 3US3A
chains in the Genus database with same CATH superfamily
1T8EB 1PFOA 2M72A 2YZHA 1N2AA 5EL8A 2OADA 5J4YA 5IMAA 3TDGA 4HDEA 2DMLA 1GSDA 3D0ZA 5DJLA 4MPGA 2F9SA 2G2QA 5D9VA 4EKZA 3IHQA 1XOAA 2WW0A 5JWRB 3TJFA 3MSZA 4HU7A 1THXA 2B7JA 1K0CA 2WW3A 1GNEA 2R4VA 2H76A 3HCZA 1I5GA 1AQWA 1GSFA 5DCGA 4V1Ag 4Z2UA 2FD3A 2LRTA 1EV9A 4WR4A 2RUEA 2ON7A 6GSVA 4MCUA 9GSSA 1N8JA 5IO0A 1YF1A 4KDUA 1JZDA 2K18A 4IP1A 1K3LA 1PA3A 1Y6EA 3TCOA 2H30A 4XS4B 3IPZA 4MZBA 1GNWA 4PQHA 3H8QA 4N10A 2NVLA 4BIKA 3ZIVA 2V6KA 4I2UA 2H75A 5EPFA 2RM5A 4XTSA 2GZYA 2VCQA 3H79A 1SJIA 3KXOA 2XPDA 4OCFA 1AUCA 1TXUA 2VD0A 4MK3A 5G30A 3KCMA 4ZXGA 4MZCA 1EZKA 5ECNB 2ZCTA 4EL1A 3HVXA 2DJ2A 1VF1A 5INYA 4DSRA 3IC8A 2N5FA 3U6VA 13GSA 2I1UA 2FWEA 1A2JA 1CQGA 2VD1A 4WF4A 4G0LA 4KW6A 4ECJA 4PI2C 3E0UA 3P90A 1SVMA 3WT1A 1ZL9A 3GMFA 1MD4A 2IMEA 2KP2A 1ZCPA 5D8IA 1GULA 2OACA 4G2EA 4QL7A 5D9TA 1B4PA 2HRKB 4KF9A 1SU9A 1BG1A 4X0XA 3IK9A 2PWJA 4G0IA 2LQQA 4HZ2A 2D2ZA 2WZ9A 5DQYA 2WJUA 2J23A 1LU4A 3IR4A 5D73A 5IO2A 2WULA 3R3EA 4BVXA 4NHWA 1S3RA 1GSEA 2WVXB 2MMOA 2JL4A 5DALB 2GT5A 4QQ7A 2YANA 1O85A 3WGDA 2P31A 2GQKA 3FZ5A 4YH2A 5KN3A 4OMVA 1ABAA 1GP1A 2FNOA 1NSWA 5G31A 3DD3A 1EOGA 1K0DA 3VWWA 4PQIA 5H5RA 4D73B 2EFCA 2E2MA 2H1BA 1AAZA 2L4QA 4NV2A 1PL1A 2C0GA 17GSA 4KE3A 3UVHA 2L59A 2TIRA 3VK9A 3GNJA 1XVQA 4EIQA 1V58A 3G7IA 4I5QA 3CHXC 3ZL5A 2KLXA 3JCML 3UVTA 2R3XA 1BX9A 1OAZA 1T1VA 1O8WA 2CV4A 2G0FA 1TRVA 2IL3A 2DIYA 3VPTA 1SYRA 2X4AA 1QK8A 4XRDA 1EV4A 3CRUA 2JADA 2QGVA 3FRCA 3FK8A 2GQMA 3I43A 4IHUA 3CYNA 4AKGA 3HYPA 3IDVA 3FZAA 3P8WA 4NMUA 4KSMA 4I8BA 5FHIA 4CY8A 1M3IA 5F05A 4XHMA 4ICYA 4PTSA 5JCGA 1KBNA 2YV9A 1EGOA 2K8SA 6GSWA 2JSYA 2I9HA 4OWYA 5HFKA 1XWBA 5IPHA 3QAVA 1THOA 3TJKA 2WW1A 2LRCA 3KH9A 1G6WA 4MJCA 2EFEA 1M7TA 3MWHA 2B3SA 2IMKA 2K9FA 4V1Ap 2A4HA 1GUMA 4MZWA 2HZEA 1FHEA 4L0WA 3EU4A 3E9JB 3F63A 2GVPA 4OO4A 1YKCA 2IWTA 4IELA 4Z2RA 1E2YA 4TR0A 5A4UA 2NTOA 4ISDA 2H1GA 3F9UA 3PGTA 5GAPD 4JEDA 1F6MC 1ACVA 3A5WA 5J40A 2HLSA 5A4VA 2DJJA 4YQUA 3GTUA 5J5NA 3BCIA 3TUEA 2C3NA 3ERWA 4GQCA 3PINA 4MMMA 3QOUA 2HZFA 4EC0A 3GUSA 2REMA 4OFMA 4N0VA 3RFRC 3ZIJA 4KSOA 5G5FA 2AB6A 2WS2A 1WWJA 3OR5A 5DAKB 2LNSA 4Q5FA 2X49A 2PVQA 4NV5A 2VCTA 3D21A 1ERWA 1K3OA 5GSSA 4K8MA 4WR5A 1Z5YE 2PPTA 1J08A 1O73A 3BOAA 3ZYWA 1DBYA 3GYKA 4CHSA 5CNWA 4HI7A 3HMJG 19GSA 4J57E 4K1FA 1ZGNA 4IQ1A 3GL5A 1XW6A 2A2RA 2DJKA 4BWSA 4KUNA 2VLVA 1ZYEA 3HVSA 3F6DA 1PKWA 3GX8A 4HS1A 4J2FA 3KZQA 5A5HA 1PX7A 2FA8A 1JZWA 3DYRA 4BL7B 2A4VA 1DE2A 1O8XA 3A2WA 4FYBA 4TR1B 1GSYA 4BVYB 1FVJA 1R5AA 4X4JA 2OJLA 4KGIA 3ISOA 3KP9A 2B5EA 4FIWA 2HYXA 2VCZA 3TKQA 3NIVA 4MH3A 5CO3A 2O7KA 5DDLA 2LKUA 2TRXA 2H1AA 1ZMAA 3FMWA 4FH8A 3EPTA 2JZTA 3IC4A 2NPBA 4IKHA 2HSHA 3GRXA 2B6MA 4P3YB 1EWXA 3IAM2 1JZRA 2FGXA 2EC4A 2O89A 20GSA 1K0AA 1KNGA 1VRSD 4AGSA 5G1KA 4RQRA 1FB6A 2MYGA 3RHCA 2X99A 1F2EA 1PL2A 2CVDA 4PX1A 2RM6A 2LS5A 3V1WA 4Z2TA 1X0RA 3VLNA 3C7MA 3D5JA 4I97A 1EEJA 3HDCA 1OC9A 4K2DA 4PGTA 1RK4A 2YV7A 1PD21 5C04A 2H1DA 4FO5A 4CY6A 2DLXA 3VURA 2FCHA 1V57A 2C0DA 3C1SA 3M0FA 2LUSA 3DEXA 1XW5A 2MBTA 3WD6A 1X5CA 4XS4A 1S4BP 2YOIA 5J3RA 1GTAA 5ECKB 2PGTA 5BMUA 2FWFA 3LYKA 3ERFA 1C72A 1XWCA 1FB0A 3L9SA 5G5EA 5ABRA 1T00A 4DSSA 1JLWA 3FKFA 2ZNMA 1YY7A 1WJKA 4N3ZA 2HRNA 2O87A 3LEFA 4HEA2 3EC3A 3IE3A 1H75A 1YF0A 5C00A 1K0MA 1GTBA 3N5OA 1V9WA 2YWMA 2WB9A 3WGXA 3FEUA 1PRXA 3ME7A 3W6GA 3FR9A 5CRWA 1F3AA 1HYUA 1B9YC 3KTLA 4KX4A 5IMCA 4K7OA 5JCWA 1XIYA 4EF0A 2HRKA 4ML1A 4ZB7A 3ZZXA 1AQVA 1Z7PA 4XCSA 3DVWA 5IMDA 2NDOA 1GLQA 3HVNA 2P0GA 1QGVA 1TRUA 2X8HA 4LA1A 1JLVA 2V41A 3TU3B 1T3BA 6GSSA 4TXOA 2X64A 2GSSA 2WVXA 2H19A 4EXJA 10GSA 1ML6A 3NOFA 2CQ9A 5DALA 5G2ZA 1AW9A 4ZL8A 2C80A 1QFNA 4G19A 5LD0A 5AIXA 1TK0B 3D4TA 4G01A 3F4TA 2YNXA 4I2TA 1URMA 5CRDA 1Y25A 1XG8A 1YQ1A 2IIYA 1GLPA 1SJ6A 1NHOA 4IJIA 3TJBA 1OC3A 4ZL9A 1X5DA 1R26A 1GL8A 1Z3EA 3KMNA 2GSTA 3A2XA 4N11A 2R0CA 3TKPA 1Q98A 2H1LA 2DMMA 4YQVA 2DC5A 5E59A 4EE0A 2FUG2 4NPBA 2C4JA 4BWQA 4AF2A 2XBIA 3DGQA 3TKSC 2VOCA 4O5RA 3FR6A 5F06A 1OE8A 1OE7A 1AQXA 4MABA 5IMZA 1YKAA 1A23A 3CWGA 2EIOA 2F8AA 3TGZA 3WGEA 1O6JA 1LJRA 2K8VA 5AISA 3FY7A 2QC7A 2X8CA 4K0GA 4EVMA 2HQTA 1M3JA 1G7EA 4X43A 2OA7A 3UMAA 2BTOT 3LGCA 5D9XA 5ECOB 4GXZA 3TKSA 1A24A 3A3TA 3EVIA 1BYEA 1GSUA 1LBKA 2IPAA 4ZB6A 1FAAA 5JWQB 1TKDB 2DJ0A 4GDFA 3M9JA 4HJ2A 3GSTA 2OKAA 3L9UA 4OO5A 3VI7A 2C8UA 22GSA 4FYUA 1PN0A 3UOMA 4XS6A 4F9ZA 5G1LA 1BEDA 1SKWB 2LQOA 3AY8A 3NZNA 3APQA 3FHKA 4HQSA 3VWVA 2X8GA 2E7PA 2FWHA 1M9BA 2HSMA 3UL3A 3SBCA 4HZ4A 12GSA 3Q74A 4AKXB 1XW9A 5BRTA 1VF2A 4ID0A 4HQZA 2VL3A 3J7Yk 2HSNB 3I9V2 1S3CA 4MA9A 3TJJA 1G0TA 2FA4A 2AYTA 5HR0A 4OFTA 4WF5A 3KM6A 1SKSB 1SVOA 3FYGA 4NHZA 4O7HA 4K7IA 2CZ3A 5B8BA 1ERVA 4QL9A 2HSYA 4N0ZA 3CXGA 5F8BA 3HA9A 2O3EA 3RAZA 1PQNA 4ZIJA 2IJYA 3UBLA 1WOUA 1M0UA 1M2BA 4POKA 2KUCA 2HT9A 2VM2A 2WFCA 4WEYA 4YAVA 3ZRDA 5HR2A 2M80A 3H4KA 3GKNA 2YJHA 5LNKe 1N25A 5CAXA 3LJRA 4NAXA 1EOHA 2TRCP 2YWOA 2B7KA 2AJQB 1Y1UA 5AN1A 2VCVA 1FW1A 3O6TA 3EMXA 5ECRB 2YWIA 3HXSA 4JBBA 2C0FA 2IFQA 1X9MB 1USBA 5A34B 4X1UA 3L0HA 2HRFA 1T4YA 3MIXA 5L71A 5CRHA 5HFIA 2VLTA 2ON5A 4IVFA 2F51A 2HI7A 3L9VA 3D6IA 2B5XA 2H66A 4MPFA 4TR1A 4WBJA 1RW1A 3G9BA 4BVYA 3Q18A 4TOPA 11GSA 1SK0A 1M2AA 2LSTA 3H93A 2GGTA 2LJAA 4GTUA 1V40A 2CT6A 5H5QA 3GKMA 3D22A 2PVOC 1SD9A 2JZRA 3EINA 4KNDA 1ON4A 1UC7A 4F82A 4HOJA 4A5PA 2DIZA 4ACSA 2KOKA 5KN1A 3GKXA 3M1GA 4H86A 2V6OA 1FO5A 4BVXB 1AC1A 3RPNA 1BG5A 3HZ4A 4KDYA 4G0KA 2LNTA 1B4QA 1ST9A 1X5EA 5IMVA 5KN2A 4K2XA 1XFLA 1S3AA 1OC8A 3CTGA 2AAWA 4HUAA 3F0IA 1MDJA 1WP0A 2DSAA 5D9WA 2H72A 4QMKA 4EDYA 4FQUA 3F4RA 3Q19A 1AXDA 5IM9A 3PPUA 3GKKA 3QDNA 1WE0A 1YVLA 5CYYA 2L57A 5EY6A 1HNBA 4PNGA 4BPYA 2IMFA 2BJXA 4FXYP 4G9HA 4KH7A 2H0IA 2OE3A 2R6KA 3F3RA 1XZOA 4MP4A 2HFDA 4IS0A 5IIZA 1MD3A 3GH6A 3TJGA 5IPGA 1UN2A 3MNGA 2N5AA 5F07A 4AI6A 1YEXA 3IXRA 1FVKA 2GSQA 1YZXA 2MMAA 5ELAA 1PSQA 1QUWA 2GQLA 4F2IA 1H4OA 3KP8A 4MF5A 1WRYA 2C3QA 3ZITA 5FT3A 1QMVA 4KCAA 2E0QA 3QFBC 3QR6A 3DIEA 5HR3A 4Z7XA 3RBTA 2F3MA 2L6DA 1BJXA 2VL2C 3UEMA 3SWLA 2LRNA 4ML6A 1A8YA 2H0GA 2CX3A 2VAFA 1FOVA 4PUAA 3RDWA 3A2VA 3IBHA 1ZYQB 1NHYA 1Q4JA 3C73A 2JZSA 1K0BA 1K3YA 1GTIA 4RUVA 1WIKA 1W89A 2QKEA 3CSJA 4ZBBA 4N30A 4ECIA 1M99A 1F37A 1TU7A 2CAIA 5ENUA 2YWNA 4K5SA 3EYTA 2IN3A 1UA5A 1GSSA 5AGYA 2I81A 2VL2A 1WMJA 4KDXA 2PUKC 3LW9A 1U88A 3FR3A 2EFHA 1PN9A 4POLA 1PKZA 4O32A 1TK8B 4IW9A 3CQFA 3VWUA 3GTUB 2PN8A 2GDRA 4ECBA 3F3QA 1MEKA 3BBYA 5E4WA 2C1YA 5F0GA 2I4AA 2CA8A 4PQ1A 6GSUA 1MTCA 3M8NA 2VLUA 4JRRA 4GLTA 1ERUA 2LJKA 2WGRA 2MBSA 3KH7A 4AJ6A 3TKRA 2VCWA 3HVVA 5DVBA 4IJ3A 2UZ8A 2GZPA 3P2AA 2ES7A 1XPVA 4V2NA 2UV8G 6GSXA 3MDKA 1PMTA 4MJAA 5A5KA 5CP1A 4EUYA 5B6NA 1HNCA 4YQMA 5B8AA 2GTUA 2E2GA 3PH9A 3W8JA 4CDOA 4PURA 4IQAA 1YDKA 1OKDA 1HQOA 2CX4A 1SVLA 4MNNA 4EDZA 3MYDA 2XPEA 1R5PA 4JU5A 2H70A 1GWCA 5ECLB 3KMOA 2O85A 3TRXA 2WVYA 4OCEA 1A0RP 3EU3A 3ZMKA 1Z6NA 2M46A 3LFLA 3APSA 4MJEA 1TW9A 4MLYA 5GAND 1Z9HA 4K0NA 4ULXA 1G7OA 3LQ7A 1GH2A 2VCXA 2B5YA 2R0GA 2OBKA 2YZUA 4BA7A 2H6YA 2P5QA 1EP8A 2O8VB 2PERA 3WYWA 5ID2B 1TI1A 2Z9SA 4GF0A 3S9FA 3RHBA 1B9XC 3TRPA 5ECPB 4JR6A 2HSNA 5ECMB 1TOFA 4ZB8A 4D73A 2QA1A 1M2DA 4E68A 3QAGA 3UBKA 1MDKA 1OC9B 1IYHA 4O5UA 3O76A 4KB3A 5ECSA 1GTUA 1WPIA 2H0HA 4MH2A 3MAKA 1GUKA 4RI6A 5DJMA 2WZSA 1SJZA 2QA2A 1EP7A 5HQPA 2V2GA 3FW2A 2GS3A 4IGJA 2OE1A 16GSA 3TRQA 2KHPA 4TR3A 3E3EA 4POBA 3TOUA 2XC2A 2EIRA 1M9AA 4ZBDA 5BMUB 2LEGA 2XBQA 2PBJA 4RQXA 5KEJA 2LTKA 1SENA 3LXTA 6GSTA 3U5RE 4DSSB 4PXOA 3I69A 3QPMA 4K6XA 4XS1A 1QXHA 1YJ6A 1BAYA 5A1NB 3DMLA 4TN8A 1F3BA 2RLIA 2VL9A 3QFAC 5A34A 3IK7A 1TXXA 1XWGA 1BF5A 4Q5RA 1I1IP 5ECQB 4EIPA 2R2JA 5J41A 1SD8A 7GSSA 2IMDA 2FHEA 4IP6A 2XHFA 2HE3A 5DQSA 1NW2A 1VF3A 5CREA 3EMPA 1G6YA 2V32A 3CTFA 3EWLA 1O81A 1ZYNA 1U6TA 4KAEA 1TRWA 4YKGA 1X9WB 4PI0C 3DVXA 3IAS2 2K6VA 4Q5QA 3HY2A 5B7CA 1VGLA 1A8LA 2BMXA 3DKSA 3TKSE 3M9KA 3ZVJA 2H6XA 1A2LA 1U87A 4TXOB 2WRTA 1GRXA 1ZZYA 3GURA 4POMA 4W66A 5EVOA 4AJ7A 4GQFA 8GSSA 1TU8A 3KTBA 2JU5A 1J9BA 4IBPA 3EURA 4AJ8A 1J0FA 4OFNA 1XCCA 4OD7A 3P7XA 4GRFA 3KIJA 2P5RA 3HZ8A 4LLRA 3DXBA 2YP6A 4FYCA 2LV3A 3C1RA 2YN1A 2H73A 4TKYA 2AHEA 5IOWA 3O3TA 1E6BA 2V1MA 2J9HA 2YCDA 5DAKA 1BQ7A 4LMWA 2OE0A 2IMIA 4LL1B 4LMVA 4DEJA 2JSZA 5DCHA 3M3MA 2JACA 4F0BA 4TRXA 4TXVA 4KA0A 4LL4B 4PNFA 2ZUPA 3G7JA 4PHZC 4I6XA 4JZQA 1F9MA 3GN3A 2C3TA 5IMFA 2C0EA 4TW5A 1O7UA 3CSIA 4E8HA 4Q5NA 2NBSA 2H6ZA 1VF4A 3C8EA 1OYJA 2RIIA 3ZREA 3Q6OA 1A2MA 1AIUA 1SK2A 4BL7A 3GHAA 18GSA 4F03A 3DRNA 5KOXA 3ED3A 1TTZA 2MMNA 3FZ4A 1ERTA 3TB2A 1SKRB 4EO3A 3H1NA 3APOA 1XOBA 1TJDA 4O5QA 5J9BA 3IV4A 1QQ2A 4NWYA 2B1KA 2L5LA 2MMZA 2DKIA 3DWVA 3GIXA 4J56E 3ZLPA 3L78A 2H8LA 4USSA 5GSTA 1TP9A 3IRAA 2CAQA 3ERGA 4ZILA 3BJ5A 3RGBC 5J4UA 3ZVJD 3WT2A 3EE2A 2HRAA 4AKIA 1XWKA 5IOXA 4NXIA 3ME8A 1EEMA 2WW2A 2HSMB 4O92A 1PGTA 2O36A 1K0NA 4DSQA 1YEPA 3BCKA 4XRAA 3F6FA 1KEBA 1U3AA 3CSHA 4IN0A 2L4CA 4E8EA 1EGRA 5KN0A 2DKHA 1Z6MA 1XVWA 2KP1A 1FOHA 5LCZA 4TR4A 3VFIA 2GZZA 4JE1A 3RPPA 1DSBA 2OBIA 4MF6A 4WETA 1V98A 3QCPA 1Z7RA 1XWAA 2L5OA 2YPMA 1GUHA 5ECIB 5DBQA 2CVBA 4ZBAA 2H71A 2O5VA 3HHVA 3HJOA 1XBSA 5ELGA 2CZ2A 2QSIA 3TOTA 4WBRD 5JCUA 3QD9A 4F0CA 2B1LA 3FZ9A 5J9CA 1RQMA 2GSRA 2VKZG 2AV4A 4ECCA 2GLRA 3KGKA 1K0OA 3LG6A 6GSYA 1I9DA 1YEWC 1DE1A 3HD5A 3KEBA 1U3IA 2IFQB 1B8XA 2WDUA 1V2AA 3ZFBA 4G10A 4WXTA 5H5SA 3QMXA 3UARA 1ILOA 5J4VA 1UVZA 2H74A 2WVZA 1S3DA 5AIVA 2H01A 5KOWA 3R2QA 1MDIA 4ZL7A 4GCIA 2GT6A 1PX6A 2AUVA 3GX0A 1B48A 2OT3A 4GSTA 2N5BA 2HXKA 4K9ZA 5A4WA 3C71A 4RI7A 2HZEB 5D93A 1SK1A 5IQYA 3VWXA 1T7PB 1JFUA 2F8FA 4HSCX 1HNAA 3IA1A 3UAPA 4KCEA 4PUFC 1OKTA 1TDIA 5CRGA 5ECHB 3K8NA 4ILFA 4K7NA 2R5GA 3VI5A 3CBUA 4WKWA 5ID2A 2L6CA 1CQHA 1X9SB 1OVNA 1T4ZA 5GZZB 4YKFA 1NM3A 1SYXA 4V2MA 3ZMLA 2YJ7A 2EIQA 2VO4A 1A0FA 4DVCA 3GH9A 1ZOFA 1TI3A 3CMIA 3L4NA 3PR8A 5JWOB 5B6MA 4K5RA 2I3YA 4L0UA 5FWGA 3N9JA 3HJPA 4CW9A 4L8EA 3LYPA 2PU9C 3W8SA 2R0PA 3CRTA 4TVEA 3GFKA 2A2SA 4GSSA 1TRSA 3G7YA 3BD2A 5HFGA 3GL3A 3GSSA 3LSZA 2FWGA 3LWAA 4GWRA 4HU9A 2RUFA 3F4SA 4YAPA 2VIMA 1SL1B 3GA4A 4L5OA 1JHBA 4V2LA 5A5HB 1ZYPA 3D4MA 1DUGA 3UIWA 1R7HA 1HD2A 3LORA 5A1NA 3HKRA 2MZCA 3GV1A 2CVKA 3I6AA 3ZFLA 2DJ1A 1IYIA 5COHA 2FLSA 4MDCA 3KD0A 1SL2B 5HR1A 2LJRA 2ALBA 1KTEA 3VPQA 3A5IA 1XXUA 4HJMA 4L5LA 1TK5B 5D96A 3F8UA 2FY6A 2DJ3A 4ZB9A 4GSNA 3UJ1A 2DBCA 2R37A 2PMTA 3HJMA 3KJYA 3LXZA 3IHGA 4MJBA 3QAWA 5J47A 2VUPA 3IOSA 1R4WA 1GSQA 2WCIA 1FG4A 3ZTLA 2VM1A 4XIHA 2EFDA 4AKHA 1JZOA 14GSA 2A2PA 3J7Yb 1SL0B 4JR4A 2HNLA 1W4VA 4MF7A 3US3A
chains in the Genus database with same CATH topology
1T8EB 2M72A 2YZHA 1N2AA 5EL8A 2OADA 5J4YA 5IMAA 3TDGA 4HDEA 2DMLA 1GSDA 3D0ZA 5DJLA 4MPGA 2F9SA 2G2QA 5D9VA 4EKZA 3IHQA 1XOAA 5JWRB 3TJFA 3MSZA 4HU7A 1THXA 2B7JA 1K0CA 1GNEA 2R4VA 2H76A 3HCZA 1I5GA 1AQWA 1GSFA 5DCGA 4V1Ag 4Z2UA 2FD3A 2LRTA 1EV9A 4WR4A 2RUEA 2ON7A 6GSVA 4MCUA 9GSSA 1N8JA 5IO0A 1YF1A 4KDUA 1JZDA 2K18A 4IP1A 1K3LA 1PA3A 1Y6EA 3TCOA 2H30A 4XS4B 3IPZA 4MZBA 1GNWA 4PQHA 3H8QA 4N10A 2NVLA 3ZIVA 2V6KA 4I2UA 2H75A 5EPFA 2RM5A 4XTSA 2VCQA 2GZYA 3H79A 1SJIA 3KXOA 2XPDA 4OCFA 1AUCA 1TXUA 2VD0A 4MK3A 5G30A 3KCMA 4ZXGA 4MZCA 1EZKA 5ECNB 2ZCTA 4EL1A 3HVXA 2DJ2A 1VF1A 5INYA 4DSRA 3IC8A 2N5FA 3U6VA 13GSA 2I1UA 2FWEA 1A2JA 1CQGA 2VD1A 4WF4A 4G0LA 4KW6A 4ECJA 3E0UA 3P90A 1SVMA 3WT1A 1ZL9A 3GMFA 1MD4A 2IMEA 2KP2A 1ZCPA 5D8IA 1GULA 2OACA 4G2EA 4QL7A 5D9TA 1B4PA 2HRKB 4KF9A 1SU9A 1BG1A 4X0XA 3IK9A 2PWJA 4G0IA 2LQQA 4HZ2A 2D2ZA 2WZ9A 5DQYA 2WJUA 2J23A 1LU4A 3IR4A 5D73A 5IO2A 2WULA 3R3EA 4BVXA 4NHWA 1GSEA 2MMOA 2JL4A 5DALB 2GT5A 4QQ7A 2YANA 1O85A 3WGDA 2P31A 2GQKA 3FZ5A 4YH2A 5KN3A 4OMVA 1ABAA 1GP1A 2FNOA 1NSWA 5G31A 3DD3A 1EOGA 1K0DA 3VWWA 4PQIA 5H5RA 4D73B 2EFCA 2E2MA 2H1BA 1AAZA 2L4QA 4NV2A 1PL1A 2C0GA 17GSA 4KE3A 3UVHA 2L59A 2TIRA 3VK9A 3GNJA 1XVQA 4EIQA 1V58A 3G7IA 4I5QA 3ZL5A 2KLXA 3JCML 3UVTA 2R3XA 1BX9A 1OAZA 1T1VA 1O8WA 2CV4A 2G0FA 1TRVA 2IL3A 2DIYA 3VPTA 1SYRA 2X4AA 1QK8A 4XRDA 1EV4A 3CRUA 2JADA 2QGVA 3FRCA 3FK8A 2GQMA 3I43A 4IHUA 3CYNA 4AKGA 3HYPA 3IDVA 3FZAA 3P8WA 4NMUA 4KSMA 4I8BA 5FHIA 4CY8A 5F05A 4XHMA 4ICYA 4PTSA 5JCGA 1KBNA 2YV9A 1EGOA 2K8SA 6GSWA 2JSYA 2I9HA 4OWYA 5HFKA 1XWBA 5IPHA 3QAVA 1THOA 3TJKA 2LRCA 3KH9A 1G6WA 4MJCA 2EFEA 1M7TA 3MWHA 2B3SA 2IMKA 2K9FA 4V1Ap 2A4HA 1GUMA 4MZWA 2HZEA 1FHEA 4L0WA 3EU4A 3E9JB 3F63A 2GVPA 4OO4A 1YKCA 2IWTA 4IELA 4Z2RA 1E2YA 4TR0A 5A4UA 2NTOA 4ISDA 2H1GA 3F9UA 3PGTA 5GAPD 4JEDA 1F6MC 1ACVA 3A5WA 5J40A 2HLSA 5A4VA 2DJJA 4YQUA 3GTUA 5J5NA 3BCIA 3TUEA 2C3NA 3ERWA 4GQCA 3PINA 4MMMA 3QOUA 2HZFA 4EC0A 3GUSA 2REMA 4OFMA 4N0VA 3ZIJA 4KSOA 5G5FA 2AB6A 2WS2A 1WWJA 3OR5A 5DAKB 2LNSA 4Q5FA 2X49A 2PVQA 4NV5A 2VCTA 3D21A 1ERWA 1K3OA 5GSSA 4K8MA 4WR5A 1Z5YE 2PPTA 1J08A 1O73A 3BOAA 3ZYWA 1DBYA 3GYKA 4CHSA 5CNWA 4HI7A 3HMJG 19GSA 4J57E 4K1FA 1ZGNA 4IQ1A 3GL5A 1XW6A 2A2RA 2DJKA 4BWSA 4KUNA 2VLVA 1ZYEA 3HVSA 3F6DA 1PKWA 3GX8A 4HS1A 4J2FA 3KZQA 5A5HA 1PX7A 2FA8A 1JZWA 3DYRA 4BL7B 2A4VA 1DE2A 1O8XA 3A2WA 4FYBA 4TR1B 1GSYA 4BVYB 1FVJA 1R5AA 4X4JA 2OJLA 4KGIA 3ISOA 3KP9A 2B5EA 4FIWA 2HYXA 2VCZA 3TKQA 3NIVA 4MH3A 5CO3A 2O7KA 5DDLA 2LKUA 2TRXA 2H1AA 1ZMAA 3FMWA 4FH8A 3EPTA 2JZTA 3IC4A 2NPBA 4IKHA 2HSHA 3GRXA 2B6MA 4P3YB 1EWXA 3IAM2 1JZRA 2FGXA 2EC4A 2O89A 20GSA 1K0AA 1KNGA 1VRSD 4AGSA 5G1KA 4RQRA 1FB6A 2MYGA 3RHCA 2X99A 1F2EA 1PL2A 2CVDA 4PX1A 2RM6A 2LS5A 3V1WA 4Z2TA 1X0RA 3VLNA 3C7MA 3D5JA 4I97A 1EEJA 3HDCA 1OC9A 4K2DA 4PGTA 1RK4A 2YV7A 1PD21 5C04A 2H1DA 4FO5A 4CY6A 2DLXA 3VURA 2FCHA 1V57A 2C0DA 3C1SA 3M0FA 2LUSA 3DEXA 1XW5A 2MBTA 3WD6A 1X5CA 4XS4A 2YOIA 5J3RA 1GTAA 5ECKB 2PGTA 5BMUA 2FWFA 3LYKA 3ERFA 1C72A 1XWCA 1FB0A 3L9SA 5G5EA 5ABRA 1T00A 4DSSA 1JLWA 3FKFA 2ZNMA 1YY7A 1WJKA 4N3ZA 2HRNA 2O87A 3LEFA 4HEA2 3EC3A 3IE3A 1H75A 1YF0A 5C00A 1K0MA 1GTBA 3N5OA 1V9WA 2YWMA 2WB9A 3WGXA 3FEUA 1PRXA 3ME7A 3W6GA 3FR9A 5CRWA 1F3AA 1HYUA 1B9YC 3KTLA 4KX4A 5IMCA 4K7OA 5JCWA 1XIYA 4EF0A 2HRKA 4ML1A 4ZB7A 3ZZXA 1AQVA 1Z7PA 4XCSA 3DVWA 5IMDA 2NDOA 1GLQA 2P0GA 1QGVA 1TRUA 2X8HA 4LA1A 1JLVA 2V41A 3TU3B 1T3BA 6GSSA 4TXOA 2X64A 2GSSA 2H19A 4EXJA 10GSA 1ML6A 3NOFA 2CQ9A 5DALA 5G2ZA 1AW9A 4ZL8A 2C80A 1QFNA 4G19A 5LD0A 5AIXA 1TK0B 3D4TA 4G01A 3F4TA 2YNXA 4I2TA 1URMA 5CRDA 1Y25A 1YQ1A 2IIYA 1GLPA 1SJ6A 1NHOA 4IJIA 3TJBA 1OC3A 4ZL9A 1X5DA 1R26A 1GL8A 1Z3EA 3KMNA 2GSTA 3A2XA 4N11A 2R0CA 3TKPA 1Q98A 2H1LA 2DMMA 4YQVA 2DC5A 5E59A 4EE0A 2FUG2 4NPBA 2C4JA 4BWQA 4AF2A 2XBIA 3DGQA 3TKSC 2VOCA 4O5RA 3FR6A 5F06A 1OE8A 1OE7A 1AQXA 4MABA 5IMZA 1YKAA 1A23A 3CWGA 2EIOA 2F8AA 3TGZA 3WGEA 1O6JA 1LJRA 2K8VA 5AISA 3FY7A 2QC7A 2X8CA 4K0GA 4EVMA 2HQTA 1G7EA 4X43A 2OA7A 3UMAA 2BTOT 3LGCA 5D9XA 5ECOB 4GXZA 3TKSA 1A24A 3A3TA 1BYEA 1GSUA 1LBKA 2IPAA 3EVIA 4ZB6A 1FAAA 5JWQB 1TKDB 2DJ0A 4GDFA 3M9JA 4HJ2A 3GSTA 2OKAA 3L9UA 4OO5A 3VI7A 2C8UA 22GSA 4FYUA 1PN0A 3UOMA 4XS6A 4F9ZA 5G1LA 1BEDA 1SKWB 2LQOA 3AY8A 3NZNA 3APQA 3FHKA 4HQSA 3VWVA 2X8GA 2E7PA 2FWHA 1M9BA 2HSMA 3UL3A 3SBCA 4HZ4A 12GSA 3Q74A 4AKXB 1XW9A 5BRTA 1VF2A 4ID0A 4HQZA 2VL3A 3J7Yk 2HSNB 3I9V2 1S3CA 4MA9A 3TJJA 1G0TA 2FA4A 2AYTA 5HR0A 4OFTA 4WF5A 3KM6A 1SKSB 1SVOA 3FYGA 4NHZA 4O7HA 4K7IA 2CZ3A 5B8BA 1ERVA 4QL9A 2HSYA 4N0ZA 3CXGA 5F8BA 3HA9A 3RAZA 1PQNA 4ZIJA 2IJYA 3UBLA 1WOUA 1M0UA 1M2BA 4POKA 2KUCA 2HT9A 2VM2A 2WFCA 4WEYA 4YAVA 3ZRDA 5HR2A 2M80A 3H4KA 3GKNA 2YJHA 5LNKe 1N25A 5CAXA 3LJRA 4NAXA 1EOHA 2TRCP 2YWOA 2B7KA 2AJQB 1Y1UA 5AN1A 2VCVA 1FW1A 3O6TA 3EMXA 5ECRB 2YWIA 3HXSA 4JBBA 2C0FA 2IFQA 1X9MB 1USBA 5A34B 4X1UA 3L0HA 2HRFA 1T4YA 3MIXA 5L71A 5CRHA 5HFIA 2VLTA 2ON5A 4IVFA 2F51A 2HI7A 3L9VA 3D6IA 2B5XA 2H66A 4MPFA 4TR1A 4WBJA 1RW1A 3G9BA 4BVYA 3Q18A 4TOPA 11GSA 1SK0A 1M2AA 2LSTA 3H93A 2GGTA 2LJAA 4GTUA 1V40A 2CT6A 5H5QA 3GKMA 3D22A 2PVOC 1SD9A 2JZRA 3EINA 4KNDA 1ON4A 1UC7A 4F82A 4HOJA 4A5PA 2DIZA 4ACSA 2KOKA 5KN1A 3GKXA 3M1GA 4H86A 2V6OA 1FO5A 4BVXB 1AC1A 3RPNA 1BG5A 3HZ4A 4KDYA 4G0KA 2LNTA 1B4QA 1ST9A 1X5EA 5IMVA 5KN2A 4K2XA 1XFLA 1S3AA 1OC8A 3CTGA 2AAWA 4HUAA 3F0IA 1MDJA 1WP0A 2DSAA 5D9WA 2H72A 4QMKA 4EDYA 4FQUA 3F4RA 3Q19A 1AXDA 5IM9A 3PPUA 3GKKA 3QDNA 1WE0A 1YVLA 5CYYA 2L57A 5EY6A 1HNBA 4PNGA 4BPYA 2IMFA 2BJXA 4G9HA 4KH7A 2H0IA 2OE3A 2R6KA 3F3RA 1XZOA 4MP4A 2HFDA 4IS0A 5IIZA 1MD3A 3GH6A 3TJGA 5IPGA 1UN2A 3MNGA 2N5AA 5F07A 4AI6A 1YEXA 3IXRA 1FVKA 2GSQA 1YZXA 2MMAA 5ELAA 1PSQA 1QUWA 2GQLA 4F2IA 1H4OA 3KP8A 4MF5A 1WRYA 2C3QA 3ZITA 5FT3A 1QMVA 4KCAA 2E0QA 3QFBC 3QR6A 3DIEA 5HR3A 4Z7XA 3RBTA 2F3MA 2L6DA 1BJXA 2VL2C 3UEMA 3SWLA 2LRNA 4ML6A 1A8YA 2H0GA 2CX3A 2VAFA 1FOVA 4PUAA 3RDWA 3A2VA 3IBHA 1ZYQB 1NHYA 1Q4JA 3C73A 2JZSA 1K0BA 1K3YA 1GTIA 4RUVA 1WIKA 1W89A 2QKEA 3CSJA 4ZBBA 4N30A 4ECIA 1M99A 1F37A 1TU7A 2CAIA 5ENUA 2YWNA 4K5SA 3EYTA 2IN3A 1UA5A 1GSSA 5AGYA 2I81A 2VL2A 1WMJA 4KDXA 2PUKC 3LW9A 1U88A 3FR3A 2EFHA 1PN9A 4POLA 1PKZA 4O32A 1TK8B 4IW9A 3VWUA 3GTUB 2PN8A 2GDRA 4ECBA 3F3QA 1MEKA 3BBYA 5E4WA 2C1YA 5F0GA 2I4AA 2CA8A 4PQ1A 6GSUA 1MTCA 3M8NA 2VLUA 4JRRA 4GLTA 1ERUA 2LJKA 2WGRA 2MBSA 3KH7A 4AJ6A 3TKRA 2VCWA 3HVVA 5DVBA 4IJ3A 2UZ8A 2GZPA 3P2AA 2ES7A 1XPVA 4V2NA 2UV8G 6GSXA 3MDKA 1PMTA 4MJAA 5A5KA 5CP1A 4EUYA 5B6NA 1HNCA 4YQMA 5B8AA 2GTUA 2E2GA 3PH9A 3W8JA 4CDOA 4PURA 4IQAA 1YDKA 1OKDA 1HQOA 2CX4A 1SVLA 4MNNA 4EDZA 3MYDA 2XPEA 1R5PA 4JU5A 2H70A 1GWCA 5ECLB 3KMOA 2O85A 3TRXA 4OCEA 1A0RP 3EU3A 3ZMKA 1Z6NA 2M46A 3LFLA 3APSA 4MJEA 1TW9A 4MLYA 5GAND 1Z9HA 4K0NA 4ULXA 1G7OA 3LQ7A 1GH2A 2VCXA 2B5YA 2R0GA 2OBKA 2YZUA 4BA7A 2H6YA 2P5QA 1EP8A 2O8VB 2PERA 3WYWA 5ID2B 1TI1A 2Z9SA 4GF0A 3S9FA 3RHBA 1B9XC 3TRPA 5ECPB 4JR6A 2HSNA 5ECMB 1TOFA 4ZB8A 4D73A 2QA1A 1M2DA 4E68A 3QAGA 3UBKA 1MDKA 1OC9B 1IYHA 4O5UA 3O76A 4KB3A 5ECSA 1GTUA 1WPIA 2H0HA 4MH2A 3MAKA 1GUKA 4RI6A 5DJMA 1SJZA 2QA2A 1EP7A 5HQPA 2V2GA 3FW2A 2GS3A 4IGJA 2OE1A 16GSA 3TRQA 2KHPA 4TR3A 3E3EA 4POBA 3TOUA 2XC2A 2EIRA 1M9AA 4ZBDA 5BMUB 2LEGA 2XBQA 2PBJA 4RQXA 5KEJA 2LTKA 1SENA 3LXTA 6GSTA 3U5RE 4DSSB 4PXOA 3I69A 3QPMA 4K6XA 4XS1A 1QXHA 1YJ6A 1BAYA 5A1NB 3DMLA 4TN8A 1F3BA 2RLIA 2VL9A 3QFAC 5A34A 3IK7A 1TXXA 1XWGA 1BF5A 4Q5RA 5ECQB 4EIPA 2R2JA 5J41A 1SD8A 7GSSA 2IMDA 2FHEA 4IP6A 2XHFA 2HE3A 5DQSA 1NW2A 1VF3A 5CREA 3EMPA 1G6YA 2V32A 3CTFA 3EWLA 1O81A 1ZYNA 1U6TA 4KAEA 1TRWA 4YKGA 1X9WB 3DVXA 3IAS2 2K6VA 4Q5QA 3HY2A 5B7CA 1VGLA 1A8LA 2BMXA 3DKSA 3TKSE 3M9KA 3ZVJA 2H6XA 1A2LA 1U87A 4TXOB 2WRTA 1GRXA 1ZZYA 3GURA 4POMA 4W66A 5EVOA 4AJ7A 4GQFA 8GSSA 1TU8A 3KTBA 2JU5A 1J9BA 4IBPA 3EURA 4AJ8A 1J0FA 4OFNA 1XCCA 4OD7A 3P7XA 4GRFA 3KIJA 2P5RA 3HZ8A 4LLRA 3DXBA 2YP6A 4FYCA 2LV3A 3C1RA 2YN1A 2H73A 4TKYA 2AHEA 5IOWA 3O3TA 1E6BA 2V1MA 2J9HA 2YCDA 5DAKA 1BQ7A 4LMWA 2OE0A 2IMIA 4LL1B 4LMVA 4DEJA 2JSZA 5DCHA 3M3MA 2JACA 4F0BA 4TRXA 4TXVA 4KA0A 4LL4B 4PNFA 2ZUPA 3G7JA 4I6XA 4JZQA 1F9MA 3GN3A 2C3TA 5IMFA 2C0EA 4TW5A 1O7UA 3CSIA 4E8HA 4Q5NA 2NBSA 2H6ZA 1VF4A 3C8EA 1OYJA 2RIIA 3ZREA 3Q6OA 1A2MA 1AIUA 1SK2A 4BL7A 3GHAA 18GSA 4F03A 3DRNA 5KOXA 3ED3A 1TTZA 2MMNA 3FZ4A 1ERTA 3TB2A 1SKRB 4EO3A 3H1NA 3APOA 1XOBA 1TJDA 4O5QA 5J9BA 3IV4A 1QQ2A 4NWYA 2B1KA 2L5LA 2MMZA 2DKIA 3DWVA 3GIXA 4J56E 3ZLPA 3L78A 2H8LA 4USSA 5GSTA 1TP9A 3IRAA 2CAQA 3ERGA 4ZILA 3BJ5A 5J4UA 3ZVJD 3WT2A 3EE2A 2HRAA 4AKIA 1XWKA 5IOXA 4NXIA 3ME8A 1EEMA 2HSMB 4O92A 1PGTA 1K0NA 4DSQA 1YEPA 3BCKA 4XRAA 3F6FA 1KEBA 1U3AA 3CSHA 4IN0A 2L4CA 4E8EA 1EGRA 5KN0A 2DKHA 1Z6MA 1XVWA 2KP1A 1FOHA 5LCZA 4TR4A 3VFIA 2GZZA 4JE1A 3RPPA 1DSBA 2OBIA 4MF6A 4WETA 1V98A 3QCPA 1Z7RA 1XWAA 2L5OA 2YPMA 1GUHA 5ECIB 5DBQA 2CVBA 4ZBAA 2H71A 2O5VA 3HHVA 3HJOA 1XBSA 5ELGA 2CZ2A 2QSIA 3TOTA 4WBRD 5JCUA 3QD9A 4F0CA 2B1LA 3FZ9A 5J9CA 1RQMA 2GSRA 2VKZG 2AV4A 4ECCA 2GLRA 3KGKA 1K0OA 3LG6A 6GSYA 1I9DA 1DE1A 3HD5A 3KEBA 1U3IA 2IFQB 1B8XA 2WDUA 1V2AA 3ZFBA 4G10A 4WXTA 5H5SA 3QMXA 3UARA 1ILOA 5J4VA 1UVZA 2H74A 1S3DA 5AIVA 2H01A 5KOWA 3R2QA 1MDIA 4ZL7A 4GCIA 2GT6A 1PX6A 2AUVA 3GX0A 1B48A 2OT3A 4GSTA 2N5BA 2HXKA 4K9ZA 5A4WA 3C71A 4RI7A 2HZEB 5D93A 1SK1A 5IQYA 3VWXA 1T7PB 1JFUA 2F8FA 1HNAA 3IA1A 3UAPA 4KCEA 4PUFC 1OKTA 1TDIA 5CRGA 5ECHB 3K8NA 4ILFA 4K7NA 2R5GA 3VI5A 3CBUA 4WKWA 5ID2A 2L6CA 1CQHA 1X9SB 1OVNA 1T4ZA 5GZZB 4YKFA 1NM3A 1SYXA 4V2MA 3ZMLA 2YJ7A 2EIQA 2VO4A 1A0FA 4DVCA 3GH9A 1ZOFA 1TI3A 3CMIA 3L4NA 3PR8A 5JWOB 5B6MA 4K5RA 2I3YA 4L0UA 5FWGA 3N9JA 3HJPA 4CW9A 4L8EA 3LYPA 2PU9C 3W8SA 2R0PA 3CRTA 4TVEA 3GFKA 2A2SA 4GSSA 1TRSA 3G7YA 3BD2A 5HFGA 3GL3A 3GSSA 3LSZA 2FWGA 3LWAA 4GWRA 4HU9A 2RUFA 3F4SA 4YAPA 2VIMA 1SL1B 3GA4A 4L5OA 1JHBA 4V2LA 5A5HB 1ZYPA 3D4MA 1DUGA 3UIWA 1R7HA 1HD2A 3LORA 5A1NA 3HKRA 2MZCA 3GV1A 2CVKA 3I6AA 3ZFLA 2DJ1A 1IYIA 5COHA 2FLSA 4MDCA 3KD0A 1SL2B 5HR1A 2LJRA 2ALBA 1KTEA 3VPQA 3A5IA 1XXUA 4HJMA 4L5LA 1TK5B 5D96A 3F8UA 2FY6A 2DJ3A 4ZB9A 4GSNA 3UJ1A 2DBCA 2R37A 2PMTA 3HJMA 3KJYA 3LXZA 3IHGA 4MJBA 3QAWA 5J47A 2VUPA 3IOSA 1R4WA 1GSQA 2WCIA 1FG4A 3ZTLA 2VM1A 4XIHA 2EFDA 4AKHA 1JZOA 14GSA 2A2PA 3J7Yb 1SL0B 4JR4A 2HNLA 1W4VA 4MF7A 3US3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T8E B;  2M72 A;  2YZH A;  1N2A A;  5EL8 A;  2OAD A;  5IMA A;  3TDG A;  4HDE A;  2DML A;  1GSD A;  3D0Z A;  5DJL A;  4MPG A;  2F9S A;  2G2Q A;  5D9V A;  4EKZ A;  3IHQ A;  1XOA A;  5JWR B;  3TJF A;  3MSZ A;  4HU7 A;  1THX A;  2B7J A;  1K0C A;  1GNE A;  2R4V A;  2H76 A;  3HCZ A;  1I5G A;  1AQW A;  1GSF A;  5DCG A;  4V1A g;  2FD3 A;  2LRT A;  1EV9 A;  4WR4 A;  2RUE A;  2ON7 A;  6GSV A;  4MCU A;  9GSS A;  1N8J A;  5IO0 A;  1YF1 A;  4KDU A;  1JZD A;  2K18 A;  4IP1 A;  1K3L A;  1PA3 A;  1Y6E A;  3TCO A;  2H30 A;  4XS4 B;  3IPZ A;  4MZB A;  1GNW A;  4PQH A;  3H8Q A;  4N10 A;  2NVL A;  3ZIV A;  2V6K A;  4I2U A;  2H75 A;  5EPF A;  2RM5 A;  4XTS A;  2VCQ A;  2GZY A;  3H79 A;  1SJI A;  3KXO A;  2XPD A;  4OCF A;  1AUC A;  2VD0 A;  4MK3 A;  5G30 A;  3KCM A;  4ZXG A;  4MZC A;  1EZK A;  5ECN B;  2ZCT A;  4EL1 A;  3HVX A;  2DJ2 A;  1VF1 A;  5INY A;  4DSR A;  3IC8 A;  2N5F A;  3U6V A;  13GS A;  2I1U A;  2FWE A;  1A2J A;  1CQG A;  2VD1 A;  4WF4 A;  4G0L A;  4KW6 A;  4ECJ A;  3E0U A;  3P90 A;  3WT1 A;  1ZL9 A;  3GMF A;  1MD4 A;  2IME A;  2KP2 A;  1ZCP A;  5D8I A;  1GUL A;  2OAC A;  4G2E A;  4QL7 A;  5D9T A;  1B4P A;  2HRK B;  4KF9 A;  1SU9 A;  4X0X A;  3IK9 A;  2PWJ A;  4G0I A;  2LQQ A;  4HZ2 A;  2D2Z A;  2WZ9 A;  5DQY A;  2WJU A;  2J23 A;  1LU4 A;  3IR4 A;  5D73 A;  5IO2 A;  2WUL A;  3R3E A;  4BVX A;  4NHW A;  1GSE A;  2MMO A;  2JL4 A;  5DAL B;  2GT5 A;  4QQ7 A;  2YAN A;  1O85 A;  3WGD A;  2P31 A;  2GQK A;  3FZ5 A;  4YH2 A;  5KN3 A;  4OMV A;  1ABA A;  1GP1 A;  2FNO A;  1NSW A;  5G31 A;  3DD3 A;  1EOG A;  1K0D A;  3VWW A;  4PQI A;  5H5R A;  4D73 B;  2E2M A;  2H1B A;  1AAZ A;  2L4Q A;  4NV2 A;  1PL1 A;  2C0G A;  17GS A;  4KE3 A;  3UVH A;  2L59 A;  2TIR A;  3VK9 A;  3GNJ A;  1XVQ A;  1V58 A;  3G7I A;  4I5Q A;  3ZL5 A;  2KLX A;  3JCM L;  3UVT A;  2R3X A;  1BX9 A;  1OAZ A;  1T1V A;  1O8W A;  2CV4 A;  2G0F A;  1TRV A;  2IL3 A;  2DIY A;  3VPT A;  1SYR A;  4XRD A;  1QK8 A;  1EV4 A;  3CRU A;  2JAD A;  2QGV A;  3FRC A;  3FK8 A;  2GQM A;  3I43 A;  4IHU A;  3CYN A;  3HYP A;  3IDV A;  3FZA A;  3P8W A;  4NMU A;  4KSM A;  4I8B A;  5FHI A;  5F05 A;  4XHM A;  4PTS A;  5JCG A;  1KBN A;  2YV9 A;  1EGO A;  2K8S A;  6GSW A;  2JSY A;  2I9H A;  4OWY A;  5HFK A;  1XWB A;  5IPH A;  3QAV A;  1THO A;  3TJK A;  2LRC A;  3KH9 A;  1G6W A;  4MJC A;  1M7T A;  3MWH A;  2B3S A;  2IMK A;  2K9F A;  4V1A p;  1GUM A;  4MZW A;  2HZE A;  1FHE A;  4L0W A;  3EU4 A;  3E9J B;  3F63 A;  2GVP A;  4OO4 A;  1YKC A;  2IWT A;  4IEL A;  1E2Y A;  4TR0 A;  5A4U A;  2NTO A;  4ISD A;  2H1G A;  3F9U A;  3PGT A;  5GAP D;  4JED A;  1F6M C;  1ACV A;  3A5W A;  2HLS A;  5A4V A;  2DJJ A;  4YQU A;  3GTU A;  5J5N A;  3BCI A;  3TUE A;  2C3N A;  3ERW A;  4GQC A;  3PIN A;  4MMM A;  3QOU A;  2HZF A;  4EC0 A;  3GUS A;  2REM A;  4OFM A;  4N0V A;  3ZIJ A;  4KSO A;  5G5F A;  2AB6 A;  2WS2 A;  1WWJ A;  3OR5 A;  5DAK B;  2LNS A;  4Q5F A;  2PVQ A;  4NV5 A;  2VCT A;  3D21 A;  1ERW A;  1K3O A;  5GSS A;  4K8M A;  4WR5 A;  1Z5Y E;  2PPT A;  1J08 A;  1O73 A;  3BOA A;  3ZYW A;  1DBY A;  3GYK A;  4CHS A;  5CNW A;  4HI7 A;  19GS A;  4J57 E;  4K1F A;  1ZGN A;  4IQ1 A;  3GL5 A;  1XW6 A;  2A2R A;  2DJK A;  4BWS A;  4KUN A;  2VLV A;  1ZYE A;  3HVS A;  3F6D A;  1PKW A;  3GX8 A;  4HS1 A;  4J2F A;  3KZQ A;  1PX7 A;  2FA8 A;  1JZW A;  3DYR A;  4BL7 B;  2A4V A;  1DE2 A;  1O8X A;  4FYB A;  3A2W A;  4TR1 B;  1GSY A;  4BVY B;  1FVJ A;  1R5A A;  2OJL A;  4KGI A;  3ISO A;  3KP9 A;  2B5E A;  4FIW A;  2HYX A;  2VCZ A;  3TKQ A;  3NIV A;  4MH3 A;  5CO3 A;  2O7K A;  5DDL A;  2LKU A;  2TRX A;  2H1A A;  1ZMA A;  4FH8 A;  2JZT A;  3IC4 A;  2NPB A;  4IKH A;  2HSH A;  3GRX A;  2B6M A;  4P3Y B;  1EWX A;  3IAM 2;  1JZR A;  2FGX A;  2EC4 A;  2O89 A;  20GS A;  1K0A A;  1KNG A;  1VRS D;  4AGS A;  5G1K A;  4RQR A;  1FB6 A;  2MYG A;  3RHC A;  2X99 A;  1F2E A;  1PL2 A;  2CVD A;  4PX1 A;  2RM6 A;  2LS5 A;  3V1W A;  1X0R A;  3VLN A;  3C7M A;  3D5J A;  4I97 A;  1EEJ A;  3HDC A;  1OC9 A;  4K2D A;  4PGT A;  1RK4 A;  2YV7 A;  1PD2 1;  5C04 A;  2H1D A;  4FO5 A;  2DLX A;  3VUR A;  2FCH A;  1V57 A;  2C0D A;  3C1S A;  3M0F A;  2LUS A;  3DEX A;  1XW5 A;  2MBT A;  3WD6 A;  1X5C A;  4XS4 A;  2YOI A;  5J3R A;  1GTA A;  5ECK B;  2PGT A;  5BMU A;  2FWF A;  3LYK A;  3ERF A;  1C72 A;  1XWC A;  1FB0 A;  3L9S A;  5G5E A;  5ABR A;  1T00 A;  4DSS A;  1JLW A;  3FKF A;  2ZNM A;  1YY7 A;  1WJK A;  2HRN A;  2O87 A;  3LEF A;  4HEA 2;  3EC3 A;  3IE3 A;  1H75 A;  1YF0 A;  5C00 A;  1K0M A;  1GTB A;  3N5O A;  1V9W A;  2YWM A;  2WB9 A;  3WGX A;  3FEU A;  1PRX A;  3ME7 A;  3W6G A;  3FR9 A;  5CRW A;  1F3A A;  1HYU A;  1B9Y C;  3KTL A;  4KX4 A;  5IMC A;  4K7O A;  5JCW A;  1XIY A;  4EF0 A;  2HRK A;  4ML1 A;  3ZZX A;  1AQV A;  1Z7P A;  4XCS A;  3DVW A;  5IMD A;  2NDO A;  1GLQ A;  2P0G A;  1QGV A;  1TRU A;  2X8H A;  4LA1 A;  1JLV A;  2V41 A;  1T3B A;  6GSS A;  4TXO A;  2X64 A;  2GSS A;  2H19 A;  4EXJ A;  10GS A;  1ML6 A;  3NOF A;  2CQ9 A;  5DAL A;  5G2Z A;  1AW9 A;  4ZL8 A;  2C80 A;  1QFN A;  4G19 A;  5LD0 A;  5AIX A;  1TK0 B;  3D4T A;  3F4T A;  2YNX A;  4I2T A;  1URM A;  5CRD A;  1Y25 A;  1YQ1 A;  2IIY A;  1GLP A;  1SJ6 A;  1NHO A;  4IJI A;  3TJB A;  1OC3 A;  4ZL9 A;  1X5D A;  1R26 A;  1GL8 A;  1Z3E A;  3KMN A;  2GST A;  3A2X A;  4N11 A;  3TKP A;  1Q98 A;  2DMM A;  4YQV A;  2DC5 A;  5E59 A;  4EE0 A;  2FUG 2;  4NPB A;  2C4J A;  4BWQ A;  4AF2 A;  2XBI A;  3DGQ A;  3TKS C;  2VOC A;  4O5R A;  3FR6 A;  5F06 A;  1OE8 A;  1OE7 A;  1AQX A;  4MAB A;  5IMZ A;  1YKA A;  1A23 A;  2EIO A;  2F8A A;  3TGZ A;  3WGE A;  1O6J A;  1LJR A;  2K8V A;  5AIS A;  3FY7 A;  2QC7 A;  2X8C A;  4K0G A;  4EVM A;  2HQT A;  1G7E A;  4X43 A;  2OA7 A;  3UMA A;  2BTO T;  3LGC A;  5D9X A;  5ECO B;  4GXZ A;  3TKS A;  1A24 A;  3A3T A;  1BYE A;  1GSU A;  1LBK A;  2IPA A;  3EVI A;  4ZB6 A;  1FAA A;  5JWQ B;  1TKD B;  2DJ0 A;  3M9J A;  4HJ2 A;  3GST A;  2OKA A;  3L9U A;  4OO5 A;  3VI7 A;  2C8U A;  22GS A;  4FYU A;  3UOM A;  4XS6 A;  4F9Z A;  5G1L A;  1BED A;  1SKW B;  2LQO A;  3AY8 A;  3NZN A;  3APQ A;  3FHK A;  4HQS A;  3VWV A;  2X8G A;  2E7P A;  2FWH A;  1M9B A;  2HSM A;  3UL3 A;  3SBC A;  4HZ4 A;  12GS A;  3Q74 A;  1XW9 A;  1VF2 A;  4ID0 A;  4HQZ A;  2VL3 A;  3J7Y k;  2HSN B;  3I9V 2;  1S3C A;  4MA9 A;  3TJJ A;  1G0T A;  2FA4 A;  2AYT A;  5HR0 A;  4OFT A;  4WF5 A;  3KM6 A;  1SKS B;  3FYG A;  4NHZ A;  4O7H A;  4K7I A;  2CZ3 A;  5B8B A;  1ERV A;  4QL9 A;  2HSY A;  4N0Z A;  3CXG A;  5F8B A;  3HA9 A;  3RAZ A;  1PQN A;  4ZIJ A;  2IJY A;  3UBL A;  1WOU A;  1M0U A;  1M2B A;  4POK A;  2KUC A;  2HT9 A;  2VM2 A;  2WFC A;  4WEY A;  4YAV A;  3ZRD A;  5HR2 A;  2M80 A;  3H4K A;  3GKN A;  2YJH A;  5LNK e;  5CAX A;  3LJR A;  4NAX A;  1EOH A;  2TRC P;  2YWO A;  2B7K A;  2AJQ B;  5AN1 A;  2VCV A;  1FW1 A;  3O6T A;  3EMX A;  5ECR B;  2YWI A;  3HXS A;  4JBB A;  2C0F A;  2IFQ A;  1X9M B;  1USB A;  4X1U A;  3L0H A;  2HRF A;  1T4Y A;  5L71 A;  5CRH A;  5HFI A;  2VLT A;  2ON5 A;  4IVF A;  2F51 A;  2HI7 A;  3L9V A;  3D6I A;  2B5X A;  2H66 A;  4MPF A;  4TR1 A;  4WBJ A;  1RW1 A;  3G9B A;  4BVY A;  3Q18 A;  4TOP A;  11GS A;  1SK0 A;  1M2A A;  2LST A;  3H93 A;  2GGT A;  2LJA A;  4GTU A;  1V40 A;  2CT6 A;  5H5Q A;  3GKM A;  3D22 A;  2PVO C;  1SD9 A;  2JZR A;  3EIN A;  4KND A;  1ON4 A;  1UC7 A;  4F82 A;  4HOJ A;  2DIZ A;  4ACS A;  2KOK A;  5KN1 A;  3GKX A;  3M1G A;  4H86 A;  2V6O A;  1FO5 A;  4BVX B;  1AC1 A;  3RPN A;  1BG5 A;  3HZ4 A;  4KDY A;  4G0K A;  2LNT A;  1B4Q A;  1ST9 A;  1X5E A;  5IMV A;  5KN2 A;  1XFL A;  1S3A A;  1OC8 A;  3CTG A;  2AAW A;  4HUA A;  3F0I A;  1MDJ A;  1WP0 A;  2DSA A;  5D9W A;  2H72 A;  4EDY A;  4FQU A;  3F4R A;  3Q19 A;  1AXD A;  5IM9 A;  3PPU A;  3GKK A;  3QDN A;  1WE0 A;  5CYY A;  2L57 A;  5EY6 A;  1HNB A;  4PNG A;  4BPY A;  2IMF A;  2BJX A;  4G9H A;  4KH7 A;  2H0I A;  2OE3 A;  2R6K A;  3F3R A;  1XZO A;  4MP4 A;  2HFD A;  4IS0 A;  5IIZ A;  1MD3 A;  3GH6 A;  3TJG A;  5IPG A;  1UN2 A;  3MNG A;  2N5A A;  5F07 A;  1YEX A;  3IXR A;  1FVK A;  2GSQ A;  1YZX A;  2MMA A;  5ELA A;  1PSQ A;  1QUW A;  2GQL A;  4F2I A;  1H4O A;  3KP8 A;  4MF5 A;  1WRY A;  2C3Q A;  3ZIT A;  5FT3 A;  1QMV A;  4KCA A;  2E0Q A;  3QFB C;  3QR6 A;  3DIE A;  5HR3 A;  4Z7X A;  3RBT A;  2F3M A;  2L6D A;  1BJX A;  2VL2 C;  3UEM A;  3SWL A;  2LRN A;  4ML6 A;  1A8Y A;  2H0G A;  2CX3 A;  2VAF A;  1FOV A;  4PUA A;  3RDW A;  3A2V A;  3IBH A;  1ZYQ B;  1NHY A;  1Q4J A;  3C73 A;  2JZS A;  1K0B A;  1K3Y A;  1GTI A;  4RUV A;  1WIK A;  1W89 A;  2QKE A;  3CSJ A;  4ZBB A;  4N30 A;  4ECI A;  1M99 A;  1F37 A;  1TU7 A;  2CAI A;  5ENU A;  2YWN A;  3EYT A;  2IN3 A;  1UA5 A;  1GSS A;  5AGY A;  2I81 A;  2VL2 A;  1WMJ A;  4KDX A;  2PUK C;  1U88 A;  3FR3 A;  1PN9 A;  4POL A;  1PKZ A;  4O32 A;  1TK8 B;  4IW9 A;  3VWU A;  3GTU B;  2PN8 A;  2GDR A;  4ECB A;  3F3Q A;  1MEK A;  3BBY A;  5E4W A;  2C1Y A;  5F0G A;  2I4A A;  2CA8 A;  4PQ1 A;  6GSU A;  1MTC A;  3M8N A;  2VLU A;  4JRR A;  4GLT A;  1ERU A;  2LJK A;  2WGR A;  2MBS A;  3KH7 A;  4AJ6 A;  3TKR A;  2VCW A;  3HVV A;  5DVB A;  4IJ3 A;  2UZ8 A;  2GZP A;  3P2A A;  2ES7 A;  1XPV A;  4V2N A;  6GSX A;  3MDK A;  1PMT A;  4MJA A;  5A5K A;  5CP1 A;  4EUY A;  5B6N A;  1HNC A;  4YQM A;  5B8A A;  2GTU A;  2E2G A;  3PH9 A;  3W8J A;  4CDO A;  4PUR A;  4IQA A;  1YDK A;  1OKD A;  1HQO A;  2CX4 A;  4EDZ A;  2XPE A;  1R5P A;  4JU5 A;  2H70 A;  1GWC A;  5ECL B;  3KMO A;  2O85 A;  3TRX A;  4OCE A;  1A0R P;  3EU3 A;  3ZMK A;  1Z6N A;  2M46 A;  3LFL A;  3APS A;  4MJE A;  1TW9 A;  4MLY A;  5GAN D;  1Z9H A;  4K0N A;  4ULX A;  1G7O A;  3LQ7 A;  1GH2 A;  2VCX A;  2B5Y A;  2OBK A;  2YZU A;  4BA7 A;  2H6Y A;  2P5Q A;  1EP8 A;  2O8V B;  2PER A;  3WYW A;  5ID2 B;  1TI1 A;  2Z9S A;  4GF0 A;  3S9F A;  3RHB A;  1B9X C;  3TRP A;  5ECP B;  4JR6 A;  5ECM B;  1TOF A;  4ZB8 A;  4D73 A;  1M2D A;  3QAG A;  3UBK A;  1MDK A;  1OC9 B;  1IYH A;  3O76 A;  4KB3 A;  5ECS A;  1GTU A;  1WPI A;  2H0H A;  4MH2 A;  3MAK A;  1GUK A;  4RI6 A;  5DJM A;  1SJZ A;  1EP7 A;  5HQP A;  2V2G A;  3FW2 A;  2GS3 A;  4IGJ A;  2OE1 A;  16GS A;  3TRQ A;  2KHP A;  4TR3 A;  3E3E A;  4POB A;  3TOU A;  2XC2 A;  2EIR A;  1M9A A;  4ZBD A;  2LEG A;  2XBQ A;  2PBJ A;  4RQX A;  5KEJ A;  2LTK A;  1SEN A;  3LXT A;  6GST A;  3U5R E;  4DSS B;  4PXO A;  3I69 A;  3QPM A;  4K6X A;  4XS1 A;  1QXH A;  1YJ6 A;  1BAY A;  3DML A;  4TN8 A;  1F3B A;  2RLI A;  2VL9 A;  3QFA C;  3IK7 A;  1TXX A;  1XWG A;  4Q5R A;  5ECQ B;  2R2J A;  5J41 A;  1SD8 A;  7GSS A;  2IMD A;  2FHE A;  4IP6 A;  2XHF A;  2HE3 A;  5DQS A;  1NW2 A;  1VF3 A;  5CRE A;  3EMP A;  1G6Y A;  2V32 A;  3CTF A;  3EWL A;  1O81 A;  1U6T A;  4KAE A;  1TRW A;  1X9W B;  3DVX A;  3IAS 2;  2K6V A;  4Q5Q A;  3HY2 A;  5B7C A;  1VGL A;  1A8L A;  2BMX A;  3DKS A;  3TKS E;  3M9K A;  3ZVJ A;  2H6X A;  1A2L A;  1U87 A;  4TXO B;  2WRT A;  1GRX A;  1ZZY A;  3GUR A;  4POM A;  5EVO A;  4AJ7 A;  4GQF A;  8GSS A;  1TU8 A;  3KTB A;  2JU5 A;  1J9B A;  4IBP A;  3EUR A;  4AJ8 A;  1J0F A;  4OFN A;  1XCC A;  4OD7 A;  3P7X A;  4GRF A;  3KIJ A;  2P5R A;  3HZ8 A;  4LLR A;  3DXB A;  2YP6 A;  4FYC A;  2LV3 A;  3C1R A;  2YN1 A;  2H73 A;  4TKY A;  2AHE A;  5IOW A;  3O3T A;  1E6B A;  2V1M A;  2J9H A;  2YCD A;  5DAK A;  1BQ7 A;  4LMW A;  2OE0 A;  2IMI A;  4LL1 B;  4LMV A;  4DEJ A;  2JSZ A;  5DCH A;  3M3M A;  2JAC A;  4F0B A;  4TRX A;  4TXV A;  4KA0 A;  4LL4 B;  4PNF A;  2ZUP A;  3G7J A;  4I6X A;  4JZQ A;  1F9M A;  3GN3 A;  2C3T A;  5IMF A;  2C0E A;  4TW5 A;  1O7U A;  3CSI A;  4E8H A;  4Q5N A;  2NBS A;  2H6Z A;  1VF4 A;  3C8E A;  1OYJ A;  2RII A;  3ZRE A;  3Q6O A;  1A2M A;  1AIU A;  1SK2 A;  4BL7 A;  3GHA A;  18GS A;  4F03 A;  3DRN A;  3ED3 A;  1TTZ A;  2MMN A;  3FZ4 A;  1ERT A;  3TB2 A;  1SKR B;  4EO3 A;  3H1N A;  3APO A;  1XOB A;  1TJD A;  5J9B A;  3IV4 A;  1QQ2 A;  4NWY A;  2B1K A;  2L5L A;  2MMZ A;  3DWV A;  3GIX A;  4J56 E;  3ZLP A;  3L78 A;  2H8L A;  4USS A;  5GST A;  1TP9 A;  3IRA A;  2CAQ A;  3ERG A;  4ZIL A;  3BJ5 A;  5J4U A;  3ZVJ D;  3WT2 A;  3EE2 A;  2HRA A;  1XWK A;  5IOX A;  4NXI A;  3ME8 A;  1EEM A;  2HSM B;  4O92 A;  1PGT A;  1K0N A;  4DSQ A;  1YEP A;  3BCK A;  4XRA A;  3F6F A;  1KEB A;  1U3A A;  3CSH A;  4IN0 A;  2L4C A;  4E8E A;  1EGR A;  5KN0 A;  1Z6M A;  1XVW A;  2KP1 A;  4TR4 A;  5LCZ A;  3VFI A;  2GZZ A;  4JE1 A;  3RPP A;  1DSB A;  2OBI A;  4MF6 A;  4WET A;  1V98 A;  3QCP A;  1Z7R A;  1XWA A;  2L5O A;  2YPM A;  1GUH A;  5ECI B;  5DBQ A;  2CVB A;  4ZBA A;  2H71 A;  3HHV A;  3HJO A;  1XBS A;  5ELG A;  2CZ2 A;  2QSI A;  3TOT A;  4WBR D;  5JCU A;  3QD9 A;  4F0C A;  2B1L A;  3FZ9 A;  5J9C A;  1RQM A;  2GSR A;  2AV4 A;  4ECC A;  2GLR A;  3KGK A;  1K0O A;  3LG6 A;  6GSY A;  1I9D A;  1DE1 A;  3HD5 A;  3KEB A;  1U3I A;  2IFQ B;  1B8X A;  2WDU A;  1V2A A;  3ZFB A;  4G10 A;  4WXT A;  5H5S A;  3QMX A;  3UAR A;  1ILO A;  1UVZ A;  2H74 A;  1S3D A;  5AIV A;  2H01 A;  3R2Q A;  1MDI A;  4ZL7 A;  4GCI A;  2GT6 A;  1PX6 A;  2AUV A;  3GX0 A;  1B48 A;  2N5B A;  4GST A;  4K9Z A;  2HXK A;  5A4W A;  3C71 A;  4RI7 A;  2HZE B;  5D93 A;  1SK1 A;  5IQY A;  3VWX A;  1T7P B;  1JFU A;  2F8F A;  1HNA A;  3IA1 A;  3UAP A;  4KCE A;  4PUF C;  1OKT A;  1TDI A;  5CRG A;  5ECH B;  3K8N A;  4ILF A;  4K7N A;  2R5G A;  3VI5 A;  3CBU A;  4WKW A;  5ID2 A;  2L6C A;  1CQH A;  1X9S B;  1OVN A;  1T4Z A;  5GZZ B;  1NM3 A;  1SYX A;  4V2M A;  3ZML A;  2YJ7 A;  2EIQ A;  2VO4 A;  1A0F A;  4DVC A;  3GH9 A;  1ZOF A;  1TI3 A;  3CMI A;  3L4N A;  3PR8 A;  5JWO B;  5B6M A;  2I3Y A;  4L0U A;  5FWG A;  3N9J A;  3HJP A;  4CW9 A;  4L8E A;  3LYP A;  2PU9 C;  3W8S A;  3CRT A;  4TVE A;  3GFK A;  2A2S A;  4GSS A;  1TRS A;  3G7Y A;  3BD2 A;  5HFG A;  3GL3 A;  3GSS A;  3LSZ A;  2FWG A;  3LWA A;  4GWR A;  4HU9 A;  2RUF A;  3F4S A;  4YAP A;  2VIM A;  1SL1 B;  3GA4 A;  4L5O A;  1JHB A;  4V2L A;  3D4M A;  1DUG A;  3UIW A;  1R7H A;  1HD2 A;  3LOR A;  3HKR A;  2MZC A;  3GV1 A;  2CVK A;  3I6A A;  3ZFL A;  2DJ1 A;  1IYI A;  5COH A;  2FLS A;  4MDC A;  3KD0 A;  1SL2 B;  5HR1 A;  2LJR A;  2ALB A;  1KTE A;  3VPQ A;  1XXU A;  4HJM A;  4L5L A;  1TK5 B;  5D96 A;  3F8U A;  2FY6 A;  2DJ3 A;  4ZB9 A;  4GSN A;  3UJ1 A;  2DBC A;  2R37 A;  2PMT A;  3HJM A;  3KJY A;  3LXZ A;  4MJB A;  3QAW A;  2VUP A;  3IOS A;  1R4W A;  1GSQ A;  2WCI A;  1FG4 A;  3ZTL A;  2VM1 A;  4XIH A;  1JZO A;  14GS A;  3J7Y b;  1SL0 B;  4JR4 A;  2HNL A;  1W4V A;  4MF7 A;  3US3 A; 
#chains in the Genus database with same CATH topology
 1T8E B;  1PFO A;  2M72 A;  2YZH A;  1N2A A;  5EL8 A;  2OAD A;  5J4Y A;  5IMA A;  3TDG A;  4HDE A;  2DML A;  1GSD A;  3D0Z A;  5DJL A;  4MPG A;  2F9S A;  2G2Q A;  5D9V A;  4EKZ A;  3IHQ A;  1XOA A;  2WW0 A;  5JWR B;  3TJF A;  3MSZ A;  4HU7 A;  1THX A;  2B7J A;  1K0C A;  2WW3 A;  1GNE A;  2R4V A;  2H76 A;  3HCZ A;  1I5G A;  1AQW A;  1GSF A;  5DCG A;  4V1A g;  4Z2U A;  2FD3 A;  2LRT A;  1EV9 A;  4WR4 A;  2RUE A;  2ON7 A;  6GSV A;  4MCU A;  9GSS A;  1N8J A;  5IO0 A;  1YF1 A;  4KDU A;  1JZD A;  2K18 A;  4IP1 A;  1K3L A;  1PA3 A;  1Y6E A;  3TCO A;  2H30 A;  4XS4 B;  3IPZ A;  4MZB A;  1GNW A;  4PQH A;  3H8Q A;  4N10 A;  2NVL A;  4BIK A;  3ZIV A;  2V6K A;  4I2U A;  2H75 A;  5EPF A;  2RM5 A;  4XTS A;  2GZY A;  2VCQ A;  3H79 A;  1SJI A;  3KXO A;  2XPD A;  4OCF A;  1AUC A;  1TXU A;  2VD0 A;  4MK3 A;  5G30 A;  3KCM A;  4ZXG A;  4MZC A;  1EZK A;  5ECN B;  2ZCT A;  4EL1 A;  3HVX A;  2DJ2 A;  1VF1 A;  5INY A;  4DSR A;  3IC8 A;  2N5F A;  3U6V A;  13GS A;  2I1U A;  2FWE A;  1A2J A;  1CQG A;  2VD1 A;  4WF4 A;  4G0L A;  4KW6 A;  4ECJ A;  4PI2 C;  3E0U A;  3P90 A;  1SVM A;  3WT1 A;  1ZL9 A;  3GMF A;  1MD4 A;  2IME A;  2KP2 A;  1ZCP A;  5D8I A;  1GUL A;  2OAC A;  4G2E A;  4QL7 A;  5D9T A;  1B4P A;  2HRK B;  4KF9 A;  1SU9 A;  1BG1 A;  4X0X A;  3IK9 A;  2PWJ A;  4G0I A;  2LQQ A;  4HZ2 A;  2D2Z A;  2WZ9 A;  5DQY A;  2WJU A;  2J23 A;  1LU4 A;  3IR4 A;  5D73 A;  5IO2 A;  2WUL A;  3R3E A;  4BVX A;  4NHW A;  1S3R A;  1GSE A;  2WVX B;  2MMO A;  2JL4 A;  5DAL B;  2GT5 A;  4QQ7 A;  2YAN A;  1O85 A;  3WGD A;  2P31 A;  2GQK A;  3FZ5 A;  4YH2 A;  5KN3 A;  4OMV A;  1ABA A;  1GP1 A;  2FNO A;  1NSW A;  5G31 A;  3DD3 A;  1EOG A;  1K0D A;  3VWW A;  4PQI A;  5H5R A;  4D73 B;  2EFC A;  2E2M A;  2H1B A;  1AAZ A;  2L4Q A;  4NV2 A;  1PL1 A;  2C0G A;  17GS A;  4KE3 A;  3UVH A;  2L59 A;  2TIR A;  3VK9 A;  3GNJ A;  1XVQ A;  4EIQ A;  1V58 A;  3G7I A;  4I5Q A;  3CHX C;  3ZL5 A;  2KLX A;  3JCM L;  3UVT A;  2R3X A;  1BX9 A;  1OAZ A;  1T1V A;  1O8W A;  2CV4 A;  2G0F A;  1TRV A;  2IL3 A;  2DIY A;  3VPT A;  1SYR A;  2X4A A;  1QK8 A;  4XRD A;  1EV4 A;  3CRU A;  2JAD A;  2QGV A;  3FRC A;  3FK8 A;  2GQM A;  3I43 A;  4IHU A;  3CYN A;  4AKG A;  3HYP A;  3IDV A;  3FZA A;  3P8W A;  4NMU A;  4KSM A;  4I8B A;  5FHI A;  4CY8 A;  1M3I A;  5F05 A;  4XHM A;  4ICY A;  4PTS A;  5JCG A;  1KBN A;  2YV9 A;  1EGO A;  2K8S A;  6GSW A;  2JSY A;  2I9H A;  4OWY A;  5HFK A;  1XWB A;  5IPH A;  3QAV A;  1THO A;  3TJK A;  2WW1 A;  2LRC A;  3KH9 A;  1G6W A;  4MJC A;  2EFE A;  1M7T A;  3MWH A;  2B3S A;  2IMK A;  2K9F A;  4V1A p;  2A4H A;  1GUM A;  4MZW A;  2HZE A;  1FHE A;  4L0W A;  3EU4 A;  3E9J B;  3F63 A;  2GVP A;  4OO4 A;  1YKC A;  2IWT A;  4IEL A;  4Z2R A;  1E2Y A;  4TR0 A;  5A4U A;  2NTO A;  4ISD A;  2H1G A;  3F9U A;  3PGT A;  5GAP D;  4JED A;  1F6M C;  1ACV A;  3A5W A;  5J40 A;  2HLS A;  5A4V A;  2DJJ A;  4YQU A;  3GTU A;  5J5N A;  3BCI A;  3TUE A;  2C3N A;  3ERW A;  4GQC A;  3PIN A;  4MMM A;  3QOU A;  2HZF A;  4EC0 A;  3GUS A;  2REM A;  4OFM A;  4N0V A;  3RFR C;  3ZIJ A;  4KSO A;  5G5F A;  2AB6 A;  2WS2 A;  1WWJ A;  3OR5 A;  5DAK B;  2LNS A;  4Q5F A;  2X49 A;  2PVQ A;  4NV5 A;  2VCT A;  3D21 A;  1ERW A;  1K3O A;  5GSS A;  4K8M A;  4WR5 A;  1Z5Y E;  2PPT A;  1J08 A;  1O73 A;  3BOA A;  3ZYW A;  1DBY A;  3GYK A;  4CHS A;  5CNW A;  4HI7 A;  3HMJ G;  19GS A;  4J57 E;  4K1F A;  1ZGN A;  4IQ1 A;  3GL5 A;  1XW6 A;  2A2R A;  2DJK A;  4BWS A;  4KUN A;  2VLV A;  1ZYE A;  3HVS A;  3F6D A;  1PKW A;  3GX8 A;  4HS1 A;  4J2F A;  3KZQ A;  5A5H A;  1PX7 A;  2FA8 A;  1JZW A;  3DYR A;  4BL7 B;  2A4V A;  1DE2 A;  1O8X A;  3A2W A;  4FYB A;  4TR1 B;  1GSY A;  4BVY B;  1FVJ A;  1R5A A;  4X4J A;  2OJL A;  4KGI A;  3ISO A;  3KP9 A;  2B5E A;  4FIW A;  2HYX A;  2VCZ A;  3TKQ A;  3NIV A;  4MH3 A;  5CO3 A;  2O7K A;  5DDL A;  2LKU A;  2TRX A;  2H1A A;  1ZMA A;  3FMW A;  4FH8 A;  3EPT A;  2JZT A;  3IC4 A;  2NPB A;  4IKH A;  2HSH A;  3GRX A;  2B6M A;  4P3Y B;  1EWX A;  3IAM 2;  1JZR A;  2FGX A;  2EC4 A;  2O89 A;  20GS A;  1K0A A;  1KNG A;  1VRS D;  4AGS A;  5G1K A;  4RQR A;  1FB6 A;  2MYG A;  3RHC A;  2X99 A;  1F2E A;  1PL2 A;  2CVD A;  4PX1 A;  2RM6 A;  2LS5 A;  3V1W A;  4Z2T A;  1X0R A;  3VLN A;  3C7M A;  3D5J A;  4I97 A;  1EEJ A;  3HDC A;  1OC9 A;  4K2D A;  4PGT A;  1RK4 A;  2YV7 A;  1PD2 1;  5C04 A;  2H1D A;  4FO5 A;  4CY6 A;  2DLX A;  3VUR A;  2FCH A;  1V57 A;  2C0D A;  3C1S A;  3M0F A;  2LUS A;  3DEX A;  1XW5 A;  2MBT A;  3WD6 A;  1X5C A;  4XS4 A;  1S4B P;  2YOI A;  5J3R A;  1GTA A;  5ECK B;  2PGT A;  5BMU A;  2FWF A;  3LYK A;  3ERF A;  1C72 A;  1XWC A;  1FB0 A;  3L9S A;  5G5E A;  5ABR A;  1T00 A;  4DSS A;  1JLW A;  3FKF A;  2ZNM A;  1YY7 A;  1WJK A;  4N3Z A;  2HRN A;  2O87 A;  3LEF A;  4HEA 2;  3EC3 A;  3IE3 A;  1H75 A;  1YF0 A;  5C00 A;  1K0M A;  1GTB A;  3N5O A;  1V9W A;  2YWM A;  2WB9 A;  3WGX A;  3FEU A;  1PRX A;  3ME7 A;  3W6G A;  3FR9 A;  5CRW A;  1F3A A;  1HYU A;  1B9Y C;  3KTL A;  4KX4 A;  5IMC A;  4K7O A;  5JCW A;  1XIY A;  4EF0 A;  2HRK A;  4ML1 A;  4ZB7 A;  3ZZX A;  1AQV A;  1Z7P A;  4XCS A;  3DVW A;  5IMD A;  2NDO A;  1GLQ A;  3HVN A;  2P0G A;  1QGV A;  1TRU A;  2X8H A;  4LA1 A;  1JLV A;  2V41 A;  3TU3 B;  1T3B A;  6GSS A;  4TXO A;  2X64 A;  2GSS A;  2WVX A;  2H19 A;  4EXJ A;  10GS A;  1ML6 A;  3NOF A;  2CQ9 A;  5DAL A;  5G2Z A;  1AW9 A;  4ZL8 A;  2C80 A;  1QFN A;  4G19 A;  5LD0 A;  5AIX A;  1TK0 B;  3D4T A;  4G01 A;  3F4T A;  2YNX A;  4I2T A;  1URM A;  5CRD A;  1Y25 A;  1XG8 A;  1YQ1 A;  2IIY A;  1GLP A;  1SJ6 A;  1NHO A;  4IJI A;  3TJB A;  1OC3 A;  4ZL9 A;  1X5D A;  1R26 A;  1GL8 A;  1Z3E A;  3KMN A;  2GST A;  3A2X A;  4N11 A;  2R0C A;  3TKP A;  1Q98 A;  2H1L A;  2DMM A;  4YQV A;  2DC5 A;  5E59 A;  4EE0 A;  2FUG 2;  4NPB A;  2C4J A;  4BWQ A;  4AF2 A;  2XBI A;  3DGQ A;  3TKS C;  2VOC A;  4O5R A;  3FR6 A;  5F06 A;  1OE8 A;  1OE7 A;  1AQX A;  4MAB A;  5IMZ A;  1YKA A;  1A23 A;  3CWG A;  2EIO A;  2F8A A;  3TGZ A;  3WGE A;  1O6J A;  1LJR A;  2K8V A;  5AIS A;  3FY7 A;  2QC7 A;  2X8C A;  4K0G A;  4EVM A;  2HQT A;  1M3J A;  1G7E A;  4X43 A;  2OA7 A;  3UMA A;  2BTO T;  3LGC A;  5D9X A;  5ECO B;  4GXZ A;  3TKS A;  1A24 A;  3A3T A;  3EVI A;  1BYE A;  1GSU A;  1LBK A;  2IPA A;  4ZB6 A;  1FAA A;  5JWQ B;  1TKD B;  2DJ0 A;  4GDF A;  3M9J A;  4HJ2 A;  3GST A;  2OKA A;  3L9U A;  4OO5 A;  3VI7 A;  2C8U A;  22GS A;  4FYU A;  1PN0 A;  3UOM A;  4XS6 A;  4F9Z A;  5G1L A;  1BED A;  1SKW B;  2LQO A;  3AY8 A;  3NZN A;  3APQ A;  3FHK A;  4HQS A;  3VWV A;  2X8G A;  2E7P A;  2FWH A;  1M9B A;  2HSM A;  3UL3 A;  3SBC A;  4HZ4 A;  12GS A;  3Q74 A;  4AKX B;  1XW9 A;  5BRT A;  1VF2 A;  4ID0 A;  4HQZ A;  2VL3 A;  3J7Y k;  2HSN B;  3I9V 2;  1S3C A;  4MA9 A;  3TJJ A;  1G0T A;  2FA4 A;  2AYT A;  5HR0 A;  4OFT A;  4WF5 A;  3KM6 A;  1SKS B;  1SVO A;  3FYG A;  4NHZ A;  4O7H A;  4K7I A;  2CZ3 A;  5B8B A;  1ERV A;  4QL9 A;  2HSY A;  4N0Z A;  3CXG A;  5F8B A;  3HA9 A;  2O3E A;  3RAZ A;  1PQN A;  4ZIJ A;  2IJY A;  3UBL A;  1WOU A;  1M0U A;  1M2B A;  4POK A;  2KUC A;  2HT9 A;  2VM2 A;  2WFC A;  4WEY A;  4YAV A;  3ZRD A;  5HR2 A;  2M80 A;  3H4K A;  3GKN A;  2YJH A;  5LNK e;  1N25 A;  5CAX A;  3LJR A;  4NAX A;  1EOH A;  2TRC P;  2YWO A;  2B7K A;  2AJQ B;  1Y1U A;  5AN1 A;  2VCV A;  1FW1 A;  3O6T A;  3EMX A;  5ECR B;  2YWI A;  3HXS A;  4JBB A;  2C0F A;  2IFQ A;  1X9M B;  1USB A;  5A34 B;  4X1U A;  3L0H A;  2HRF A;  1T4Y A;  3MIX A;  5L71 A;  5CRH A;  5HFI A;  2VLT A;  2ON5 A;  4IVF A;  2F51 A;  2HI7 A;  3L9V A;  3D6I A;  2B5X A;  2H66 A;  4MPF A;  4TR1 A;  4WBJ A;  1RW1 A;  3G9B A;  4BVY A;  3Q18 A;  4TOP A;  11GS A;  1SK0 A;  1M2A A;  2LST A;  3H93 A;  2GGT A;  2LJA A;  4GTU A;  1V40 A;  2CT6 A;  5H5Q A;  3GKM A;  3D22 A;  2PVO C;  1SD9 A;  2JZR A;  3EIN A;  4KND A;  1ON4 A;  1UC7 A;  4F82 A;  4HOJ A;  4A5P A;  2DIZ A;  4ACS A;  2KOK A;  5KN1 A;  3GKX A;  3M1G A;  4H86 A;  2V6O A;  1FO5 A;  4BVX B;  1AC1 A;  3RPN A;  1BG5 A;  3HZ4 A;  4KDY A;  4G0K A;  2LNT A;  1B4Q A;  1ST9 A;  1X5E A;  5IMV A;  5KN2 A;  4K2X A;  1XFL A;  1S3A A;  1OC8 A;  3CTG A;  2AAW A;  4HUA A;  3F0I A;  1MDJ A;  1WP0 A;  2DSA A;  5D9W A;  2H72 A;  4QMK A;  4EDY A;  4FQU A;  3F4R A;  3Q19 A;  1AXD A;  5IM9 A;  3PPU A;  3GKK A;  3QDN A;  1WE0 A;  1YVL A;  5CYY A;  2L57 A;  5EY6 A;  1HNB A;  4PNG A;  4BPY A;  2IMF A;  2BJX A;  4FXY P;  4G9H A;  4KH7 A;  2H0I A;  2OE3 A;  2R6K A;  3F3R A;  1XZO A;  4MP4 A;  2HFD A;  4IS0 A;  5IIZ A;  1MD3 A;  3GH6 A;  3TJG A;  5IPG A;  1UN2 A;  3MNG A;  2N5A A;  5F07 A;  4AI6 A;  1YEX A;  3IXR A;  1FVK A;  2GSQ A;  1YZX A;  2MMA A;  5ELA A;  1PSQ A;  1QUW A;  2GQL A;  4F2I A;  1H4O A;  3KP8 A;  4MF5 A;  1WRY A;  2C3Q A;  3ZIT A;  5FT3 A;  1QMV A;  4KCA A;  2E0Q A;  3QFB C;  3QR6 A;  3DIE A;  5HR3 A;  4Z7X A;  3RBT A;  2F3M A;  2L6D A;  1BJX A;  2VL2 C;  3UEM A;  3SWL A;  2LRN A;  4ML6 A;  1A8Y A;  2H0G A;  2CX3 A;  2VAF A;  1FOV A;  4PUA A;  3RDW A;  3A2V A;  3IBH A;  1ZYQ B;  1NHY A;  1Q4J A;  3C73 A;  2JZS A;  1K0B A;  1K3Y A;  1GTI A;  4RUV A;  1WIK A;  1W89 A;  2QKE A;  3CSJ A;  4ZBB A;  4N30 A;  4ECI A;  1M99 A;  1F37 A;  1TU7 A;  2CAI A;  5ENU A;  2YWN A;  4K5S A;  3EYT A;  2IN3 A;  1UA5 A;  1GSS A;  5AGY A;  2I81 A;  2VL2 A;  1WMJ A;  4KDX A;  2PUK C;  3LW9 A;  1U88 A;  3FR3 A;  2EFH A;  1PN9 A;  4POL A;  1PKZ A;  4O32 A;  1TK8 B;  4IW9 A;  3CQF A;  3VWU A;  3GTU B;  2PN8 A;  2GDR A;  4ECB A;  3F3Q A;  1MEK A;  3BBY A;  5E4W A;  2C1Y A;  5F0G A;  2I4A A;  2CA8 A;  4PQ1 A;  6GSU A;  1MTC A;  3M8N A;  2VLU A;  4JRR A;  4GLT A;  1ERU A;  2LJK A;  2WGR A;  2MBS A;  3KH7 A;  4AJ6 A;  3TKR A;  2VCW A;  3HVV A;  5DVB A;  4IJ3 A;  2UZ8 A;  2GZP A;  3P2A A;  2ES7 A;  1XPV A;  4V2N A;  2UV8 G;  6GSX A;  3MDK A;  1PMT A;  4MJA A;  5A5K A;  5CP1 A;  4EUY A;  5B6N A;  1HNC A;  4YQM A;  5B8A A;  2GTU A;  2E2G A;  3PH9 A;  3W8J A;  4CDO A;  4PUR A;  4IQA A;  1YDK A;  1OKD A;  1HQO A;  2CX4 A;  1SVL A;  4MNN A;  4EDZ A;  3MYD A;  2XPE A;  1R5P A;  4JU5 A;  2H70 A;  1GWC A;  5ECL B;  3KMO A;  2O85 A;  3TRX A;  2WVY A;  4OCE A;  1A0R P;  3EU3 A;  3ZMK A;  1Z6N A;  2M46 A;  3LFL A;  3APS A;  4MJE A;  1TW9 A;  4MLY A;  5GAN D;  1Z9H A;  4K0N A;  4ULX A;  1G7O A;  3LQ7 A;  1GH2 A;  2VCX A;  2B5Y A;  2R0G A;  2OBK A;  2YZU A;  4BA7 A;  2H6Y A;  2P5Q A;  1EP8 A;  2O8V B;  2PER A;  3WYW A;  5ID2 B;  1TI1 A;  2Z9S A;  4GF0 A;  3S9F A;  3RHB A;  1B9X C;  3TRP A;  5ECP B;  4JR6 A;  2HSN A;  5ECM B;  1TOF A;  4ZB8 A;  4D73 A;  2QA1 A;  1M2D A;  4E68 A;  3QAG A;  3UBK A;  1MDK A;  1OC9 B;  1IYH A;  4O5U A;  3O76 A;  4KB3 A;  5ECS A;  1GTU A;  1WPI A;  2H0H A;  4MH2 A;  3MAK A;  1GUK A;  4RI6 A;  5DJM A;  2WZS A;  1SJZ A;  2QA2 A;  1EP7 A;  5HQP A;  2V2G A;  3FW2 A;  2GS3 A;  4IGJ A;  2OE1 A;  16GS A;  3TRQ A;  2KHP A;  4TR3 A;  3E3E A;  4POB A;  3TOU A;  2XC2 A;  2EIR A;  1M9A A;  4ZBD A;  5BMU B;  2LEG A;  2XBQ A;  2PBJ A;  4RQX A;  5KEJ A;  2LTK A;  1SEN A;  3LXT A;  6GST A;  3U5R E;  4DSS B;  4PXO A;  3I69 A;  3QPM A;  4K6X A;  4XS1 A;  1QXH A;  1YJ6 A;  1BAY A;  5A1N B;  3DML A;  4TN8 A;  1F3B A;  2RLI A;  2VL9 A;  3QFA C;  5A34 A;  3IK7 A;  1TXX A;  1XWG A;  1BF5 A;  4Q5R A;  1I1I P;  5ECQ B;  4EIP A;  2R2J A;  5J41 A;  1SD8 A;  7GSS A;  2IMD A;  2FHE A;  4IP6 A;  2XHF A;  2HE3 A;  5DQS A;  1NW2 A;  1VF3 A;  5CRE A;  3EMP A;  1G6Y A;  2V32 A;  3CTF A;  3EWL A;  1O81 A;  1ZYN A;  1U6T A;  4KAE A;  1TRW A;  4YKG A;  1X9W B;  4PI0 C;  3DVX A;  3IAS 2;  2K6V A;  4Q5Q A;  3HY2 A;  5B7C A;  1VGL A;  1A8L A;  2BMX A;  3DKS A;  3TKS E;  3M9K A;  3ZVJ A;  2H6X A;  1A2L A;  1U87 A;  4TXO B;  2WRT A;  1GRX A;  1ZZY A;  3GUR A;  4POM A;  4W66 A;  5EVO A;  4AJ7 A;  4GQF A;  8GSS A;  1TU8 A;  3KTB A;  2JU5 A;  1J9B A;  4IBP A;  3EUR A;  4AJ8 A;  1J0F A;  4OFN A;  1XCC A;  4OD7 A;  3P7X A;  4GRF A;  3KIJ A;  2P5R A;  3HZ8 A;  4LLR A;  3DXB A;  2YP6 A;  4FYC A;  2LV3 A;  3C1R A;  2YN1 A;  2H73 A;  4TKY A;  2AHE A;  5IOW A;  3O3T A;  1E6B A;  2V1M A;  2J9H A;  2YCD A;  5DAK A;  1BQ7 A;  4LMW A;  2OE0 A;  2IMI A;  4LL1 B;  4LMV A;  4DEJ A;  2JSZ A;  5DCH A;  3M3M A;  2JAC A;  4F0B A;  4TRX A;  4TXV A;  4KA0 A;  4LL4 B;  4PNF A;  2ZUP A;  3G7J A;  4PHZ C;  4I6X A;  4JZQ A;  1F9M A;  3GN3 A;  2C3T A;  5IMF A;  2C0E A;  4TW5 A;  1O7U A;  3CSI A;  4E8H A;  4Q5N A;  2NBS A;  2H6Z A;  1VF4 A;  3C8E A;  1OYJ A;  2RII A;  3ZRE A;  3Q6O A;  1A2M A;  1AIU A;  1SK2 A;  4BL7 A;  3GHA A;  18GS A;  4F03 A;  3DRN A;  5KOX A;  3ED3 A;  1TTZ A;  2MMN A;  3FZ4 A;  1ERT A;  3TB2 A;  1SKR B;  4EO3 A;  3H1N A;  3APO A;  1XOB A;  1TJD A;  4O5Q A;  5J9B A;  3IV4 A;  1QQ2 A;  4NWY A;  2B1K A;  2L5L A;  2MMZ A;  2DKI A;  3DWV A;  3GIX A;  4J56 E;  3ZLP A;  3L78 A;  2H8L A;  4USS A;  5GST A;  1TP9 A;  3IRA A;  2CAQ A;  3ERG A;  4ZIL A;  3BJ5 A;  3RGB C;  5J4U A;  3ZVJ D;  3WT2 A;  3EE2 A;  2HRA A;  4AKI A;  1XWK A;  5IOX A;  4NXI A;  3ME8 A;  1EEM A;  2WW2 A;  2HSM B;  4O92 A;  1PGT A;  2O36 A;  1K0N A;  4DSQ A;  1YEP A;  3BCK A;  4XRA A;  3F6F A;  1KEB A;  1U3A A;  3CSH A;  4IN0 A;  2L4C A;  4E8E A;  1EGR A;  5KN0 A;  2DKH A;  1Z6M A;  1XVW A;  2KP1 A;  1FOH A;  5LCZ A;  4TR4 A;  3VFI A;  2GZZ A;  4JE1 A;  3RPP A;  1DSB A;  2OBI A;  4MF6 A;  4WET A;  1V98 A;  3QCP A;  1Z7R A;  1XWA A;  2L5O A;  2YPM A;  1GUH A;  5ECI B;  5DBQ A;  2CVB A;  4ZBA A;  2H71 A;  2O5V A;  3HHV A;  3HJO A;  1XBS A;  5ELG A;  2CZ2 A;  2QSI A;  3TOT A;  4WBR D;  5JCU A;  3QD9 A;  4F0C A;  2B1L A;  3FZ9 A;  5J9C A;  1RQM A;  2GSR A;  2VKZ G;  2AV4 A;  4ECC A;  2GLR A;  3KGK A;  1K0O A;  3LG6 A;  6GSY A;  1I9D A;  1YEW C;  1DE1 A;  3HD5 A;  3KEB A;  1U3I A;  2IFQ B;  1B8X A;  2WDU A;  1V2A A;  3ZFB A;  4G10 A;  4WXT A;  5H5S A;  3QMX A;  3UAR A;  1ILO A;  5J4V A;  1UVZ A;  2H74 A;  2WVZ A;  1S3D A;  5AIV A;  2H01 A;  5KOW A;  3R2Q A;  1MDI A;  4ZL7 A;  4GCI A;  2GT6 A;  1PX6 A;  2AUV A;  3GX0 A;  1B48 A;  2OT3 A;  4GST A;  2N5B A;  2HXK A;  4K9Z A;  5A4W A;  3C71 A;  4RI7 A;  2HZE B;  5D93 A;  1SK1 A;  5IQY A;  3VWX A;  1T7P B;  1JFU A;  2F8F A;  4HSC X;  1HNA A;  3IA1 A;  3UAP A;  4KCE A;  4PUF C;  1OKT A;  1TDI A;  5CRG A;  5ECH B;  3K8N A;  4ILF A;  4K7N A;  2R5G A;  3VI5 A;  3CBU A;  4WKW A;  5ID2 A;  2L6C A;  1CQH A;  1X9S B;  1OVN A;  1T4Z A;  5GZZ B;  4YKF A;  1NM3 A;  1SYX A;  4V2M A;  3ZML A;  2YJ7 A;  2EIQ A;  2VO4 A;  1A0F A;  4DVC A;  3GH9 A;  1ZOF A;  1TI3 A;  3CMI A;  3L4N A;  3PR8 A;  5JWO B;  5B6M A;  4K5R A;  2I3Y A;  4L0U A;  5FWG A;  3N9J A;  3HJP A;  4CW9 A;  4L8E A;  3LYP A;  2PU9 C;  3W8S A;  2R0P A;  3CRT A;  4TVE A;  3GFK A;  2A2S A;  4GSS A;  1TRS A;  3G7Y A;  3BD2 A;  5HFG A;  3GL3 A;  3GSS A;  3LSZ A;  2FWG A;  3LWA A;  4GWR A;  4HU9 A;  2RUF A;  3F4S A;  4YAP A;  2VIM A;  1SL1 B;  3GA4 A;  4L5O A;  1JHB A;  4V2L A;  5A5H B;  1ZYP A;  3D4M A;  1DUG A;  3UIW A;  1R7H A;  1HD2 A;  3LOR A;  5A1N A;  3HKR A;  2MZC A;  3GV1 A;  2CVK A;  3I6A A;  3ZFL A;  2DJ1 A;  1IYI A;  5COH A;  2FLS A;  4MDC A;  3KD0 A;  1SL2 B;  5HR1 A;  2LJR A;  2ALB A;  1KTE A;  3VPQ A;  3A5I A;  1XXU A;  4HJM A;  4L5L A;  1TK5 B;  5D96 A;  3F8U A;  2FY6 A;  2DJ3 A;  4ZB9 A;  4GSN A;  3UJ1 A;  2DBC A;  2R37 A;  2PMT A;  3HJM A;  3KJY A;  3LXZ A;  3IHG A;  4MJB A;  3QAW A;  5J47 A;  2VUP A;  3IOS A;  1R4W A;  1GSQ A;  2WCI A;  1FG4 A;  3ZTL A;  2VM1 A;  4XIH A;  2EFD A;  4AKH A;  1JZO A;  14GS A;  2A2P A;  3J7Y b;  1SL0 B;  4JR4 A;  2HNL A;  1W4V A;  4MF7 A;  3US3 A; 
#chains in the Genus database with same CATH homology
 1T8E B;  2M72 A;  2YZH A;  1N2A A;  5EL8 A;  2OAD A;  5J4Y A;  5IMA A;  3TDG A;  4HDE A;  2DML A;  1GSD A;  3D0Z A;  5DJL A;  4MPG A;  2F9S A;  2G2Q A;  5D9V A;  4EKZ A;  3IHQ A;  1XOA A;  5JWR B;  3TJF A;  3MSZ A;  4HU7 A;  1THX A;  2B7J A;  1K0C A;  1GNE A;  2R4V A;  2H76 A;  3HCZ A;  1I5G A;  1AQW A;  1GSF A;  5DCG A;  4V1A g;  4Z2U A;  2FD3 A;  2LRT A;  1EV9 A;  4WR4 A;  2RUE A;  2ON7 A;  6GSV A;  4MCU A;  9GSS A;  1N8J A;  5IO0 A;  1YF1 A;  4KDU A;  1JZD A;  2K18 A;  4IP1 A;  1K3L A;  1PA3 A;  1Y6E A;  3TCO A;  2H30 A;  4XS4 B;  3IPZ A;  4MZB A;  1GNW A;  4PQH A;  3H8Q A;  4N10 A;  2NVL A;  3ZIV A;  2V6K A;  4I2U A;  2H75 A;  5EPF A;  2RM5 A;  4XTS A;  2VCQ A;  2GZY A;  3H79 A;  1SJI A;  3KXO A;  2XPD A;  4OCF A;  1AUC A;  1TXU A;  2VD0 A;  4MK3 A;  5G30 A;  3KCM A;  4ZXG A;  4MZC A;  1EZK A;  5ECN B;  2ZCT A;  4EL1 A;  3HVX A;  2DJ2 A;  1VF1 A;  5INY A;  4DSR A;  3IC8 A;  2N5F A;  3U6V A;  13GS A;  2I1U A;  2FWE A;  1A2J A;  1CQG A;  2VD1 A;  4WF4 A;  4G0L A;  4KW6 A;  4ECJ A;  3E0U A;  3P90 A;  1SVM A;  3WT1 A;  1ZL9 A;  3GMF A;  1MD4 A;  2IME A;  2KP2 A;  1ZCP A;  5D8I A;  1GUL A;  2OAC A;  4G2E A;  4QL7 A;  5D9T A;  1B4P A;  2HRK B;  4KF9 A;  1SU9 A;  1BG1 A;  4X0X A;  3IK9 A;  2PWJ A;  4G0I A;  2LQQ A;  4HZ2 A;  2D2Z A;  2WZ9 A;  5DQY A;  2WJU A;  2J23 A;  1LU4 A;  3IR4 A;  5D73 A;  5IO2 A;  2WUL A;  3R3E A;  4BVX A;  4NHW A;  1GSE A;  2MMO A;  2JL4 A;  5DAL B;  2GT5 A;  4QQ7 A;  2YAN A;  1O85 A;  3WGD A;  2P31 A;  2GQK A;  3FZ5 A;  4YH2 A;  5KN3 A;  4OMV A;  1ABA A;  1GP1 A;  2FNO A;  1NSW A;  5G31 A;  3DD3 A;  1EOG A;  1K0D A;  3VWW A;  4PQI A;  5H5R A;  4D73 B;  2EFC A;  2E2M A;  2H1B A;  1AAZ A;  2L4Q A;  4NV2 A;  1PL1 A;  2C0G A;  17GS A;  4KE3 A;  3UVH A;  2L59 A;  2TIR A;  3VK9 A;  3GNJ A;  1XVQ A;  4EIQ A;  1V58 A;  3G7I A;  4I5Q A;  3ZL5 A;  2KLX A;  3JCM L;  3UVT A;  2R3X A;  1BX9 A;  1OAZ A;  1T1V A;  1O8W A;  2CV4 A;  2G0F A;  1TRV A;  2IL3 A;  2DIY A;  3VPT A;  1SYR A;  2X4A A;  1QK8 A;  4XRD A;  1EV4 A;  3CRU A;  2JAD A;  2QGV A;  3FRC A;  3FK8 A;  2GQM A;  3I43 A;  4IHU A;  3CYN A;  4AKG A;  3HYP A;  3IDV A;  3FZA A;  3P8W A;  4NMU A;  4KSM A;  4I8B A;  5FHI A;  4CY8 A;  5F05 A;  4XHM A;  4ICY A;  4PTS A;  5JCG A;  1KBN A;  2YV9 A;  1EGO A;  2K8S A;  6GSW A;  2JSY A;  2I9H A;  4OWY A;  5HFK A;  1XWB A;  5IPH A;  3QAV A;  1THO A;  3TJK A;  2LRC A;  3KH9 A;  1G6W A;  4MJC A;  2EFE A;  1M7T A;  3MWH A;  2B3S A;  2IMK A;  2K9F A;  4V1A p;  2A4H A;  1GUM A;  4MZW A;  2HZE A;  1FHE A;  4L0W A;  3EU4 A;  3E9J B;  3F63 A;  2GVP A;  4OO4 A;  1YKC A;  2IWT A;  4IEL A;  4Z2R A;  1E2Y A;  4TR0 A;  5A4U A;  2NTO A;  4ISD A;  2H1G A;  3F9U A;  3PGT A;  5GAP D;  4JED A;  1F6M C;  1ACV A;  3A5W A;  5J40 A;  2HLS A;  5A4V A;  2DJJ A;  4YQU A;  3GTU A;  5J5N A;  3BCI A;  3TUE A;  2C3N A;  3ERW A;  4GQC A;  3PIN A;  4MMM A;  3QOU A;  2HZF A;  4EC0 A;  3GUS A;  2REM A;  4OFM A;  4N0V A;  3ZIJ A;  4KSO A;  5G5F A;  2AB6 A;  2WS2 A;  1WWJ A;  3OR5 A;  5DAK B;  2LNS A;  4Q5F A;  2X49 A;  2PVQ A;  4NV5 A;  2VCT A;  3D21 A;  1ERW A;  1K3O A;  5GSS A;  4K8M A;  4WR5 A;  1Z5Y E;  2PPT A;  1J08 A;  1O73 A;  3BOA A;  3ZYW A;  1DBY A;  3GYK A;  4CHS A;  5CNW A;  4HI7 A;  3HMJ G;  19GS A;  4J57 E;  4K1F A;  1ZGN A;  4IQ1 A;  3GL5 A;  1XW6 A;  2A2R A;  2DJK A;  4BWS A;  4KUN A;  2VLV A;  1ZYE A;  3HVS A;  3F6D A;  1PKW A;  3GX8 A;  4HS1 A;  4J2F A;  3KZQ A;  5A5H A;  1PX7 A;  2FA8 A;  1JZW A;  3DYR A;  4BL7 B;  2A4V A;  1DE2 A;  1O8X A;  3A2W A;  4FYB A;  4TR1 B;  1GSY A;  4BVY B;  1FVJ A;  1R5A A;  4X4J A;  2OJL A;  4KGI A;  3ISO A;  3KP9 A;  2B5E A;  4FIW A;  2HYX A;  2VCZ A;  3TKQ A;  3NIV A;  4MH3 A;  5CO3 A;  2O7K A;  5DDL A;  2LKU A;  2TRX A;  2H1A A;  1ZMA A;  3FMW A;  4FH8 A;  3EPT A;  2JZT A;  3IC4 A;  2NPB A;  4IKH A;  2HSH A;  3GRX A;  2B6M A;  4P3Y B;  1EWX A;  3IAM 2;  1JZR A;  2FGX A;  2EC4 A;  2O89 A;  20GS A;  1K0A A;  1KNG A;  1VRS D;  4AGS A;  5G1K A;  4RQR A;  1FB6 A;  2MYG A;  3RHC A;  2X99 A;  1F2E A;  1PL2 A;  2CVD A;  4PX1 A;  2RM6 A;  2LS5 A;  3V1W A;  4Z2T A;  1X0R A;  3VLN A;  3C7M A;  3D5J A;  4I97 A;  1EEJ A;  3HDC A;  1OC9 A;  4K2D A;  4PGT A;  1RK4 A;  2YV7 A;  1PD2 1;  5C04 A;  2H1D A;  4FO5 A;  4CY6 A;  2DLX A;  3VUR A;  2FCH A;  1V57 A;  2C0D A;  3C1S A;  3M0F A;  2LUS A;  3DEX A;  1XW5 A;  2MBT A;  3WD6 A;  1X5C A;  4XS4 A;  2YOI A;  5J3R A;  1GTA A;  5ECK B;  2PGT A;  5BMU A;  2FWF A;  3LYK A;  3ERF A;  1C72 A;  1XWC A;  1FB0 A;  3L9S A;  5G5E A;  5ABR A;  1T00 A;  4DSS A;  1JLW A;  3FKF A;  2ZNM A;  1YY7 A;  1WJK A;  4N3Z A;  2HRN A;  2O87 A;  3LEF A;  4HEA 2;  3EC3 A;  3IE3 A;  1H75 A;  1YF0 A;  5C00 A;  1K0M A;  1GTB A;  3N5O A;  1V9W A;  2YWM A;  2WB9 A;  3WGX A;  3FEU A;  1PRX A;  3ME7 A;  3W6G A;  3FR9 A;  5CRW A;  1F3A A;  1HYU A;  1B9Y C;  3KTL A;  4KX4 A;  5IMC A;  4K7O A;  5JCW A;  1XIY A;  4EF0 A;  2HRK A;  4ML1 A;  4ZB7 A;  3ZZX A;  1AQV A;  1Z7P A;  4XCS A;  3DVW A;  5IMD A;  2NDO A;  1GLQ A;  2P0G A;  1QGV A;  1TRU A;  2X8H A;  4LA1 A;  1JLV A;  2V41 A;  3TU3 B;  1T3B A;  6GSS A;  4TXO A;  2X64 A;  2GSS A;  2H19 A;  4EXJ A;  10GS A;  1ML6 A;  3NOF A;  2CQ9 A;  5DAL A;  5G2Z A;  1AW9 A;  4ZL8 A;  2C80 A;  1QFN A;  4G19 A;  5LD0 A;  5AIX A;  1TK0 B;  3D4T A;  4G01 A;  3F4T A;  2YNX A;  4I2T A;  1URM A;  5CRD A;  1Y25 A;  1YQ1 A;  2IIY A;  1GLP A;  1SJ6 A;  1NHO A;  4IJI A;  3TJB A;  1OC3 A;  4ZL9 A;  1X5D A;  1R26 A;  1GL8 A;  1Z3E A;  3KMN A;  2GST A;  3A2X A;  4N11 A;  2R0C A;  3TKP A;  1Q98 A;  2H1L A;  2DMM A;  4YQV A;  2DC5 A;  5E59 A;  4EE0 A;  2FUG 2;  4NPB A;  2C4J A;  4BWQ A;  4AF2 A;  2XBI A;  3DGQ A;  3TKS C;  2VOC A;  4O5R A;  3FR6 A;  5F06 A;  1OE8 A;  1OE7 A;  1AQX A;  4MAB A;  5IMZ A;  1YKA A;  1A23 A;  3CWG A;  2EIO A;  2F8A A;  3TGZ A;  3WGE A;  1O6J A;  1LJR A;  2K8V A;  5AIS A;  3FY7 A;  2QC7 A;  2X8C A;  4K0G A;  4EVM A;  2HQT A;  1G7E A;  4X43 A;  2OA7 A;  3UMA A;  2BTO T;  3LGC A;  5D9X A;  5ECO B;  4GXZ A;  3TKS A;  1A24 A;  3A3T A;  1BYE A;  1GSU A;  1LBK A;  2IPA A;  3EVI A;  4ZB6 A;  1FAA A;  5JWQ B;  1TKD B;  2DJ0 A;  4GDF A;  3M9J A;  4HJ2 A;  3GST A;  2OKA A;  3L9U A;  4OO5 A;  3VI7 A;  2C8U A;  22GS A;  4FYU A;  1PN0 A;  3UOM A;  4XS6 A;  4F9Z A;  5G1L A;  1BED A;  1SKW B;  2LQO A;  3AY8 A;  3NZN A;  3APQ A;  3FHK A;  4HQS A;  3VWV A;  2X8G A;  2E7P A;  2FWH A;  1M9B A;  2HSM A;  3UL3 A;  3SBC A;  4HZ4 A;  12GS A;  3Q74 A;  4AKX B;  1XW9 A;  5BRT A;  1VF2 A;  4ID0 A;  4HQZ A;  2VL3 A;  3J7Y k;  2HSN B;  3I9V 2;  1S3C A;  4MA9 A;  3TJJ A;  1G0T A;  2FA4 A;  2AYT A;  5HR0 A;  4OFT A;  4WF5 A;  3KM6 A;  1SKS B;  1SVO A;  3FYG A;  4NHZ A;  4O7H A;  4K7I A;  2CZ3 A;  5B8B A;  1ERV A;  4QL9 A;  2HSY A;  4N0Z A;  3CXG A;  5F8B A;  3HA9 A;  3RAZ A;  1PQN A;  4ZIJ A;  2IJY A;  3UBL A;  1WOU A;  1M0U A;  1M2B A;  4POK A;  2KUC A;  2HT9 A;  2VM2 A;  2WFC A;  4WEY A;  4YAV A;  3ZRD A;  5HR2 A;  2M80 A;  3H4K A;  3GKN A;  2YJH A;  5LNK e;  1N25 A;  5CAX A;  3LJR A;  4NAX A;  1EOH A;  2TRC P;  2YWO A;  2B7K A;  2AJQ B;  1Y1U A;  5AN1 A;  2VCV A;  1FW1 A;  3O6T A;  3EMX A;  5ECR B;  2YWI A;  3HXS A;  4JBB A;  2C0F A;  2IFQ A;  1X9M B;  1USB A;  5A34 B;  4X1U A;  3L0H A;  2HRF A;  1T4Y A;  3MIX A;  5L71 A;  5CRH A;  5HFI A;  2VLT A;  2ON5 A;  4IVF A;  2F51 A;  2HI7 A;  3L9V A;  3D6I A;  2B5X A;  2H66 A;  4MPF A;  4TR1 A;  4WBJ A;  1RW1 A;  3G9B A;  4BVY A;  3Q18 A;  4TOP A;  11GS A;  1SK0 A;  1M2A A;  2LST A;  3H93 A;  2GGT A;  2LJA A;  4GTU A;  1V40 A;  2CT6 A;  5H5Q A;  3GKM A;  3D22 A;  2PVO C;  1SD9 A;  2JZR A;  3EIN A;  4KND A;  1ON4 A;  1UC7 A;  4F82 A;  4HOJ A;  4A5P A;  2DIZ A;  4ACS A;  2KOK A;  5KN1 A;  3GKX A;  3M1G A;  4H86 A;  2V6O A;  1FO5 A;  4BVX B;  1AC1 A;  3RPN A;  1BG5 A;  3HZ4 A;  4KDY A;  4G0K A;  2LNT A;  1B4Q A;  1ST9 A;  1X5E A;  5IMV A;  5KN2 A;  4K2X A;  1XFL A;  1S3A A;  1OC8 A;  3CTG A;  2AAW A;  4HUA A;  3F0I A;  1MDJ A;  1WP0 A;  2DSA A;  5D9W A;  2H72 A;  4QMK A;  4EDY A;  4FQU A;  3F4R A;  3Q19 A;  1AXD A;  5IM9 A;  3PPU A;  3GKK A;  3QDN A;  1WE0 A;  1YVL A;  5CYY A;  2L57 A;  5EY6 A;  1HNB A;  4PNG A;  4BPY A;  2IMF A;  2BJX A;  4G9H A;  4KH7 A;  2H0I A;  2OE3 A;  2R6K A;  3F3R A;  1XZO A;  4MP4 A;  2HFD A;  4IS0 A;  5IIZ A;  1MD3 A;  3GH6 A;  3TJG A;  5IPG A;  1UN2 A;  3MNG A;  2N5A A;  5F07 A;  4AI6 A;  1YEX A;  3IXR A;  1FVK A;  2GSQ A;  1YZX A;  2MMA A;  5ELA A;  1PSQ A;  1QUW A;  2GQL A;  4F2I A;  1H4O A;  3KP8 A;  4MF5 A;  1WRY A;  2C3Q A;  3ZIT A;  5FT3 A;  1QMV A;  4KCA A;  2E0Q A;  3QFB C;  3QR6 A;  3DIE A;  5HR3 A;  4Z7X A;  3RBT A;  2F3M A;  2L6D A;  1BJX A;  2VL2 C;  3UEM A;  3SWL A;  2LRN A;  4ML6 A;  1A8Y A;  2H0G A;  2CX3 A;  2VAF A;  1FOV A;  4PUA A;  3RDW A;  3A2V A;  3IBH A;  1ZYQ B;  1NHY A;  1Q4J A;  3C73 A;  2JZS A;  1K0B A;  1K3Y A;  1GTI A;  4RUV A;  1WIK A;  1W89 A;  2QKE A;  3CSJ A;  4ZBB A;  4N30 A;  4ECI A;  1M99 A;  1F37 A;  1TU7 A;  2CAI A;  5ENU A;  2YWN A;  4K5S A;  3EYT A;  2IN3 A;  1UA5 A;  1GSS A;  5AGY A;  2I81 A;  2VL2 A;  1WMJ A;  4KDX A;  2PUK C;  3LW9 A;  1U88 A;  3FR3 A;  2EFH A;  1PN9 A;  4POL A;  1PKZ A;  4O32 A;  1TK8 B;  4IW9 A;  3VWU A;  3GTU B;  2PN8 A;  2GDR A;  4ECB A;  3F3Q A;  1MEK A;  3BBY A;  5E4W A;  2C1Y A;  5F0G A;  2I4A A;  2CA8 A;  4PQ1 A;  6GSU A;  1MTC A;  3M8N A;  2VLU A;  4JRR A;  4GLT A;  1ERU A;  2LJK A;  2WGR A;  2MBS A;  3KH7 A;  4AJ6 A;  3TKR A;  2VCW A;  3HVV A;  5DVB A;  4IJ3 A;  2UZ8 A;  2GZP A;  3P2A A;  2ES7 A;  1XPV A;  4V2N A;  2UV8 G;  6GSX A;  3MDK A;  1PMT A;  4MJA A;  5A5K A;  5CP1 A;  4EUY A;  5B6N A;  1HNC A;  4YQM A;  5B8A A;  2GTU A;  2E2G A;  3PH9 A;  3W8J A;  4CDO A;  4PUR A;  4IQA A;  1YDK A;  1OKD A;  1HQO A;  2CX4 A;  1SVL A;  4MNN A;  4EDZ A;  3MYD A;  2XPE A;  1R5P A;  4JU5 A;  2H70 A;  1GWC A;  5ECL B;  3KMO A;  2O85 A;  3TRX A;  4OCE A;  1A0R P;  3EU3 A;  3ZMK A;  1Z6N A;  2M46 A;  3LFL A;  3APS A;  4MJE A;  1TW9 A;  4MLY A;  5GAN D;  1Z9H A;  4K0N A;  4ULX A;  1G7O A;  3LQ7 A;  1GH2 A;  2VCX A;  2B5Y A;  2R0G A;  2OBK A;  2YZU A;  4BA7 A;  2H6Y A;  2P5Q A;  1EP8 A;  2O8V B;  2PER A;  3WYW A;  5ID2 B;  1TI1 A;  2Z9S A;  4GF0 A;  3S9F A;  3RHB A;  1B9X C;  3TRP A;  5ECP B;  4JR6 A;  2HSN A;  5ECM B;  1TOF A;  4ZB8 A;  4D73 A;  2QA1 A;  1M2D A;  4E68 A;  3QAG A;  3UBK A;  1MDK A;  1OC9 B;  1IYH A;  4O5U A;  3O76 A;  4KB3 A;  5ECS A;  1GTU A;  1WPI A;  2H0H A;  4MH2 A;  3MAK A;  1GUK A;  4RI6 A;  5DJM A;  1SJZ A;  2QA2 A;  1EP7 A;  5HQP A;  2V2G A;  3FW2 A;  2GS3 A;  4IGJ A;  2OE1 A;  16GS A;  3TRQ A;  2KHP A;  4TR3 A;  3E3E A;  4POB A;  3TOU A;  2XC2 A;  2EIR A;  1M9A A;  4ZBD A;  5BMU B;  2LEG A;  2XBQ A;  2PBJ A;  4RQX A;  5KEJ A;  2LTK A;  1SEN A;  3LXT A;  6GST A;  3U5R E;  4DSS B;  4PXO A;  3I69 A;  3QPM A;  4K6X A;  4XS1 A;  1QXH A;  1YJ6 A;  1BAY A;  5A1N B;  3DML A;  4TN8 A;  1F3B A;  2RLI A;  2VL9 A;  3QFA C;  5A34 A;  3IK7 A;  1TXX A;  1XWG A;  1BF5 A;  4Q5R A;  5ECQ B;  4EIP A;  2R2J A;  5J41 A;  1SD8 A;  7GSS A;  2IMD A;  2FHE A;  4IP6 A;  2XHF A;  2HE3 A;  5DQS A;  1NW2 A;  1VF3 A;  5CRE A;  3EMP A;  1G6Y A;  2V32 A;  3CTF A;  3EWL A;  1O81 A;  1ZYN A;  1U6T A;  4KAE A;  1TRW A;  4YKG A;  1X9W B;  3DVX A;  3IAS 2;  2K6V A;  4Q5Q A;  3HY2 A;  5B7C A;  1VGL A;  1A8L A;  2BMX A;  3DKS A;  3TKS E;  3M9K A;  3ZVJ A;  2H6X A;  1A2L A;  1U87 A;  4TXO B;  2WRT A;  1GRX A;  1ZZY A;  3GUR A;  4POM A;  4W66 A;  5EVO A;  4AJ7 A;  4GQF A;  8GSS A;  1TU8 A;  3KTB A;  2JU5 A;  1J9B A;  4IBP A;  3EUR A;  4AJ8 A;  1J0F A;  4OFN A;  1XCC A;  4OD7 A;  3P7X A;  4GRF A;  3KIJ A;  2P5R A;  3HZ8 A;  4LLR A;  3DXB A;  2YP6 A;  4FYC A;  2LV3 A;  3C1R A;  2YN1 A;  2H73 A;  4TKY A;  2AHE A;  5IOW A;  3O3T A;  1E6B A;  2V1M A;  2J9H A;  2YCD A;  5DAK A;  1BQ7 A;  4LMW A;  2OE0 A;  2IMI A;  4LL1 B;  4LMV A;  4DEJ A;  2JSZ A;  5DCH A;  3M3M A;  2JAC A;  4F0B A;  4TRX A;  4TXV A;  4KA0 A;  4LL4 B;  4PNF A;  2ZUP A;  3G7J A;  4I6X A;  4JZQ A;  1F9M A;  3GN3 A;  2C3T A;  5IMF A;  2C0E A;  4TW5 A;  1O7U A;  3CSI A;  4E8H A;  4Q5N A;  2NBS A;  2H6Z A;  1VF4 A;  3C8E A;  1OYJ A;  2RII A;  3ZRE A;  3Q6O A;  1A2M A;  1AIU A;  1SK2 A;  4BL7 A;  3GHA A;  18GS A;  4F03 A;  3DRN A;  5KOX A;  3ED3 A;  1TTZ A;  2MMN A;  3FZ4 A;  1ERT A;  3TB2 A;  1SKR B;  4EO3 A;  3H1N A;  3APO A;  1XOB A;  1TJD A;  4O5Q A;  5J9B A;  3IV4 A;  1QQ2 A;  4NWY A;  2B1K A;  2L5L A;  2MMZ A;  2DKI A;  3DWV A;  3GIX A;  4J56 E;  3ZLP A;  3L78 A;  2H8L A;  4USS A;  5GST A;  1TP9 A;  3IRA A;  2CAQ A;  3ERG A;  4ZIL A;  3BJ5 A;  5J4U A;  3ZVJ D;  3WT2 A;  3EE2 A;  2HRA A;  4AKI A;  1XWK A;  5IOX A;  4NXI A;  3ME8 A;  1EEM A;  2HSM B;  4O92 A;  1PGT A;  1K0N A;  4DSQ A;  1YEP A;  3BCK A;  4XRA A;  3F6F A;  1KEB A;  1U3A A;  3CSH A;  4IN0 A;  2L4C A;  4E8E A;  1EGR A;  5KN0 A;  2DKH A;  1Z6M A;  1XVW A;  2KP1 A;  1FOH A;  5LCZ A;  4TR4 A;  3VFI A;  2GZZ A;  4JE1 A;  3RPP A;  1DSB A;  2OBI A;  4MF6 A;  4WET A;  1V98 A;  3QCP A;  1Z7R A;  1XWA A;  2L5O A;  2YPM A;  1GUH A;  5ECI B;  5DBQ A;  2CVB A;  4ZBA A;  2H71 A;  2O5V A;  3HHV A;  3HJO A;  1XBS A;  5ELG A;  2CZ2 A;  2QSI A;  3TOT A;  4WBR D;  5JCU A;  3QD9 A;  4F0C A;  2B1L A;  3FZ9 A;  5J9C A;  1RQM A;  2GSR A;  2VKZ G;  2AV4 A;  4ECC A;  2GLR A;  3KGK A;  1K0O A;  3LG6 A;  6GSY A;  1I9D A;  1DE1 A;  3HD5 A;  3KEB A;  1U3I A;  2IFQ B;  1B8X A;  2WDU A;  1V2A A;  3ZFB A;  4G10 A;  4WXT A;  5H5S A;  3QMX A;  3UAR A;  1ILO A;  5J4V A;  1UVZ A;  2H74 A;  1S3D A;  5AIV A;  2H01 A;  5KOW A;  3R2Q A;  1MDI A;  4ZL7 A;  4GCI A;  2GT6 A;  1PX6 A;  2AUV A;  3GX0 A;  1B48 A;  2OT3 A;  4GST A;  2N5B A;  2HXK A;  4K9Z A;  5A4W A;  3C71 A;  4RI7 A;  2HZE B;  5D93 A;  1SK1 A;  5IQY A;  3VWX A;  1T7P B;  1JFU A;  2F8F A;  1HNA A;  3IA1 A;  3UAP A;  4KCE A;  4PUF C;  1OKT A;  1TDI A;  5CRG A;  5ECH B;  3K8N A;  4ILF A;  4K7N A;  2R5G A;  3VI5 A;  3CBU A;  4WKW A;  5ID2 A;  2L6C A;  1CQH A;  1X9S B;  1OVN A;  1T4Z A;  5GZZ B;  4YKF A;  1NM3 A;  1SYX A;  4V2M A;  3ZML A;  2YJ7 A;  2EIQ A;  2VO4 A;  1A0F A;  4DVC A;  3GH9 A;  1ZOF A;  1TI3 A;  3CMI A;  3L4N A;  3PR8 A;  5JWO B;  5B6M A;  4K5R A;  2I3Y A;  4L0U A;  5FWG A;  3N9J A;  3HJP A;  4CW9 A;  4L8E A;  3LYP A;  2PU9 C;  3W8S A;  2R0P A;  3CRT A;  4TVE A;  3GFK A;  2A2S A;  4GSS A;  1TRS A;  3G7Y A;  3BD2 A;  5HFG A;  3GL3 A;  3GSS A;  3LSZ A;  2FWG A;  3LWA A;  4GWR A;  4HU9 A;  2RUF A;  3F4S A;  4YAP A;  2VIM A;  1SL1 B;  3GA4 A;  4L5O A;  1JHB A;  4V2L A;  5A5H B;  1ZYP A;  3D4M A;  1DUG A;  3UIW A;  1R7H A;  1HD2 A;  3LOR A;  5A1N A;  3HKR A;  2MZC A;  3GV1 A;  2CVK A;  3I6A A;  3ZFL A;  2DJ1 A;  1IYI A;  5COH A;  2FLS A;  4MDC A;  3KD0 A;  1SL2 B;  5HR1 A;  2LJR A;  2ALB A;  1KTE A;  3VPQ A;  3A5I A;  1XXU A;  4HJM A;  4L5L A;  1TK5 B;  5D96 A;  3F8U A;  2FY6 A;  2DJ3 A;  4ZB9 A;  4GSN A;  3UJ1 A;  2DBC A;  2R37 A;  2PMT A;  3HJM A;  3KJY A;  3LXZ A;  3IHG A;  4MJB A;  3QAW A;  5J47 A;  2VUP A;  3IOS A;  1R4W A;  1GSQ A;  2WCI A;  1FG4 A;  3ZTL A;  2VM1 A;  4XIH A;  2EFD A;  4AKH A;  1JZO A;  14GS A;  2A2P A;  3J7Y b;  1SL0 B;  4JR4 A;  2HNL A;  1W4V A;  4MF7 A;  3US3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...