2HSMB

Structural basis of yeast aminoacyl-trna synthetase complex formation revealed by crystal structures of two binary sub-complexes
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
121
structure length
121
Chain Sequence
MSDLVTKFESLIISKYPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEINH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamyl-tRNA synthetase, cytoplasmic
publication title Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/rna binding protein
total genus 34
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2006-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2hsmB00
1PN9A 1YQ1A 2DSAA 19GSA 1DUGA 3UBKA 3M3MA 3VK9A 4N0VA 4NAXA 1GSUA 4GSTA 3IK9A 1IYIA 1OKTA 5HFKA 1B4PA 1E6BA 1F3AA 4J2FA 5D9WA 3QAGA 1OE8A 4OFTA 3Q74A 4ZB8A 4NHWA 1GSQA 2R6KA 5F8BA 1GUHA 2A2SA 5GSTA 1B48A 3VI5A 3GTUB 1RK4A 4USSA 1TU7A 3G7IA 5D73A 3C8EA 5DDLA 2YV7A 2VD1A 3P90A 1ZGNA 1VF2A 2VCZA 6GSTA 2GSTA 1GSDA 2PVQA 1Z9HA 5ECNB 3HKRA 5AISA 2JL4A 3N5OA 3TGZA 3F6FA 3LSZA 4DEJA 17GSA 4E8HA 3F6DA 1V2AA 5DAKB 2FNOA 1HQOA 4K0NA 1AQVA 4ECBA 4L5OA 1K0NA 4KE3A 1VF3A 1GNEA 1R5AA 4KSMA 4F0BA 7GSSA 3M1GA 20GSA 1LJRA 4HI7A 5ECHB 1K0OA 3Q19A 1PKWA 3IK7A 4BL7A 1GSYA 1V40A 1YY7A 2C8UA 5F07A 1GTUA 4IVFA 6GSUA 1JLWA 3PPUA 5ECSA 1FHEA 4ECIA 4O92A 2HSNB 3LYKA 2ON5A 4PXOA 5AN1A 1C72A 3GURA 1XW5A 1N2AA 3GSSA 11GSA 6GSSA 3LXTA 3FRCA 3ZMLA 1GSSA 4ZB6A 3WYWA 5ECLB 2C4JA 1PL1A 5AIXA 3QAWA 3EE2A 1GSFA 3UAPA 2HQTA 2DC5A 4EE0A 1GNWA 1PMTA 5J5NA 3H1NA 1K0CA 3CSIA 4BVXB 3KMOA 3P8WA 2VCQA 1GTBA 1JLVA 2C3TA 1AQWA 5GZZB 3VWXA 2AB6A 6GSXA 1EOHA 4MK3A 1LBKA 4ZBBA 3CSJA 2OADA 2OA7A 5DALB 2GDRA 2F3MA 2CZ2A 3LXZA 4PUAA 3NIVA 1EOGA 4HZ4A 4IQ1A 1EV9A 4NHZA 3QAVA 4O7HA 1GULA 4Q5FA 2IMIA 5EY6A 2X64A 1TDIA 5FT3A 4G10A 8GSSA 3GSTA 5ELAA 4L5LA 1HNCA 3AY8A 3U6VA 13GSA 1NHYA 5F0GA 3CRTA 5ECRB 4KH7A 4G9HA 3FR6A 1MD3A 4JBBA 3MDKA 2YV9A 3G7JA 1ZL9A 4LMVA 5FHIA 3RBTA 2AHEA 4GSNA 1GLPA 2VCTA 4BVYA 4KGIA 2VCXA 1PKZA 1M0UA 4GTUA 3FR3A 1G7OA 1VF1A 1PD21 1K0DA 5A4UA 16GSA 1B8XA 3UVHA 2HRKA 4G19A 5ECOB 4G0KA 5D9XA 4JZQA 1JZRA 1ML6A 4RI7A 2A2RA 1K3OA 2CA8A 3QR6A 4KAEA 5JCWA 4IELA 2WDUA 3M0FA 3VURA 4EC0A 2VCVA 1BG5A 2F8FA 3CBUA 2GSSA 1AQXA 2HSMA 1A0FA 2J9HA 2GTUA 2VD0A 1K0MA 4IQAA 3FR9A 3LQ7A 4MZWA 2CVDA 1YJ6A 4GF0A 10GSA 2CZ3A 9GSSA 3W8SA 5GSSA 3ZFLA 5G5EA 3O3TA 1F3BA 3GX0A 4GCIA 4Q5RA 4KDUA 5B7CA 4HZ2A 4PTSA 4TOPA 6GSYA 1GTAA 4PQIA 1VF4A 4PNGA 1USBA 1AXDA 4KF9A 1GSEA 3HJOA 2PGTA 5EVOA 3TOUA 4IW9A 18GSA 1FW1A 4ZBDA 3DD3A 1TW9A 1K0BA 1U3IA 2AAWA 4YAPA 1G6YA 3M8NA 1EV4A 4MF6A 2LJRA 1F2EA 4MP4A 2WRTA 5EL8A 4K0GA 3PGTA 1EEMA 3CRUA 2R5GA 4E8EA 3ERGA 14GSA 5JCUA 3LG6A 1GTIA 3KM6A 2PERA 3UARA 1AW9A 1GWCA 3GTUA 1PGTA 1OE7A 3UBLA 1M9AA 4MPFA 1U88A 2GSRA 4PGTA 4L8EA 5ECMB 1U87A 3KTLA 4Q5QA 4ZXGA 3F63A 5G5FA 3VI7A 2C3QA 4MF7A 3O76A 3Q18A 1XWGA 3LFLA 3MAKA 4HOJA 4JEDA 3I6AA 5D9TA 5IQYA 4ZBAA 4YQVA 1TU8A 1IYHA 1K0AA 12GSA 5ECKB 2IL3A 1Y6EA 1PL2A 4GLTA 5AIVA 5BMUA 1GLQA 2VCWA 1K3YA 1XWKA 4ID0A 3DGQA 4ECJA 4YQMA 1BYEA 4G0IA 5DAKA 4IGJA 3D0ZA 4EXJA 4HJ2A 4F03A 22GSA 5ECPB 3SWLA 3EINA 4ECCA 4MDCA 5ELGA 1KBNA 4AGSA 3LJRA 1G6WA 3VPTA 2PBJA 3IE3A 5FWGA 3ZFBA 6GSWA 2R3XA 4ISDA 1MTCA 1MD4A 3IR4A 4YAVA 3I69A 5J4UA 3R3EA 4GSSA 5DJMA 1K3LA 3FYGA 4ACSA 4CHSA 2NTOA 4WR4A 1HNBA 1GUKA 5DJLA 4G0LA 4RI6A 4WR5A 2PMTA 5LD0A 3WD6A 4OFMA 4MF5A 3VLNA 5ECIB 2N5FA 1Q4JA 2UZ8A 3N9JA 4PQHA 4BVXA 5AGYA 4PURA 4FQUA 4PX1A 2D2ZA 4ZB9A 2ON7A 2V6KA 1M9BA 1PX7A 4YH2A 4I97A 1UA5A 4IS0A 2IMKA 4BVYB 4KDXA 2HNLA 3HJMA 3KXOA 5DALA 4QQ7A 3ERFA 4Q5NA 5A4WA 2WJUA 3FY7A 2CAIA 5D9VA 3CSHA 5A5KA 2HRKB 5KEJA 2WB9A 2HRAA 2C3NA 1YKCA 1PA3A 2GLRA 5F06A 3BBYA 1XW6A 1GUMA 5ECQB 2WS2A 2YCDA 3GUSA 4KX4A 3ISOA 5LCZA 1BX9A 4OFNA 3TOTA 1BAYA 5J41A 2HSMB 4IBPA 3PR8A 3R2QA 5DCGA 3GH6A 5DQSA 2VO4A 6GSVA 2C80A 2CAQA 1YDKA 2GSQA 1PX6A 4IKHA 4BL7B 2FHEA 4IJIA 1M99A 4EDYA 3ZMKA 3IBHA 4MPGA 5A4VA 4OMVA 1OYJA 3LYPA 3VPQA 2OACA 2R4VA 3KMNA 4KDYA 3L0HA 4LMWA 3KJYA 3IC8A 5F05A 4F0CA 4EDZA 1HNAA 4YQUA 4PNFA
chains in the Genus database with same CATH superfamily
1PN9A 1YQ1A 2DSAA 19GSA 1DUGA 3UBKA 2EFEA 3M3MA 3VK9A 4N0VA 4NAXA 1GSUA 1S4BP 4GSTA 3IK9A 1IYIA 1OKTA 2O36A 5HFKA 5A5HB 1B4PA 1E6BA 1F3AA 4J2FA 5D9WA 3QAGA 1OE8A 4OFTA 3Q74A 2WW1A 4ZB8A 4NHWA 1GSQA 2R6KA 5F8BA 1GUHA 2A2SA 5GSTA 1B48A 3VI5A 3GTUB 4PHZC 1RK4A 4USSA 1TU7A 3G7IA 5D73A 3C8EA 5DDLA 2YV7A 2VD1A 3P90A 5J40A 1ZGNA 1VF2A 2VCZA 6GSTA 2GSTA 5J47A 1GSDA 2PVQA 1Z9HA 2WZSA 5ECNB 5BMUB 3HKRA 5AISA 2JL4A 3N5OA 3TGZA 3F6FA 3LSZA 4ZB7A 4DEJA 17GSA 2EFHA 4E8HA 1BF5A 2H1LA 3F6DA 1V2AA 5DAKB 2FNOA 1HQOA 4K0NA 1AQVA 4ECBA 4L5OA 1K0NA 4KE3A 1VF3A 1GNEA 1R5AA 4KSMA 4F0BA 4FXYP 7GSSA 3M1GA 20GSA 1LJRA 4HI7A 5ECHB 1K0OA 1YVLA 3Q19A 3IK7A 1PKWA 4BL7A 1GSYA 2UV8G 1V40A 1YY7A 2C8UA 2WW0A 5F07A 1GTUA 4IVFA 6GSUA 1JLWA 2WVXB 3PPUA 5ECSA 1FHEA 4ECIA 4O92A 2HSNB 1YEWC 3LYKA 2ON5A 4PXOA 5AN1A 1C72A 3GURA 1XW5A 1N2AA 3GSSA 11GSA 6GSSA 3LXTA 3FRCA 3TU3B 3ZMLA 4PI2C 1GSSA 4ZB6A 3WYWA 2WVZA 5ECLB 2C4JA 1PL1A 5AIXA 3QAWA 3EE2A 1GSFA 3UAPA 2HQTA 2DC5A 4EE0A 1GNWA 1PMTA 5J5NA 3H1NA 1K0CA 3CSIA 4BVXB 3KMOA 3P8WA 2VCQA 1GTBA 1JLVA 2C3TA 1AQWA 5GZZB 3VWXA 2AB6A 6GSXA 1EOHA 4E68A 5A1NB 4MK3A 1LBKA 4ZBBA 3CSJA 2OADA 4N3ZA 2OA7A 5DALB 2GDRA 2F3MA 3RGBC 2CZ2A 3LXZA 4PUAA 3NIVA 1EOGA 4HZ4A 4IQ1A 1EV9A 4NHZA 3QAVA 2WW2A 1GULA 4O7HA 4Q5FA 2IMIA 5EY6A 2X64A 1TDIA 5FT3A 4G10A 8GSSA 3GSTA 5ELAA 4L5LA 1HNCA 3AY8A 3U6VA 13GSA 1NHYA 5F0GA 3CRTA 5ECRB 4KH7A 4G9HA 3FR6A 1MD3A 4JBBA 3MDKA 2YV9A 3G7JA 1ZL9A 4W66A 4LMVA 5FHIA 3RBTA 2AHEA 4GSNA 1GLPA 2VCTA 4BVYA 3CWGA 4KGIA 2VCXA 1PKZA 3RFRC 1M0UA 4GTUA 3FR3A 1G7OA 1VF1A 1PD21 1K0DA 5A4UA 16GSA 1B8XA 2WW3A 2HRKA 4G19A 3UVHA 5ECOB 4G0KA 5D9XA 4JZQA 1JZRA 1ML6A 4RI7A 2WVXA 2A2RA 1K3OA 2CA8A 3QR6A 4KAEA 5JCWA 4IELA 2WDUA 3M0FA 3VURA 4EC0A 2VCVA 4AKHA 1BG5A 2F8FA 3CBUA 2GSSA 1AQXA 2HSMA 1A0FA 1SVOA 2GTUA 2J9HA 2VD0A 1K0MA 2O5VA 4IQAA 3FR9A 3LQ7A 4MZWA 2CVDA 1YJ6A 4GF0A 10GSA 2CZ3A 9GSSA 5A34B 3W8SA 5GSSA 3ZFLA 5G5EA 3O3TA 1F3BA 4QMKA 3GX0A 4GCIA 4Q5RA 4KDUA 5B7CA 4HZ2A 4PTSA 4TOPA 6GSYA 1GTAA 4PQIA 1VF4A 4PNGA 5J4YA 1USBA 1AXDA 4KF9A 5J4VA 1GSEA 3HJOA 2PGTA 5EVOA 3TOUA 4IW9A 18GSA 1FW1A 4ZBDA 3DD3A 1TW9A 1K0BA 1U3IA 2AAWA 4YAPA 1G6YA 3M8NA 1EV4A 4MF6A 2LJRA 1F2EA 4MP4A 2WRTA 5EL8A 4K0GA 3PGTA 1EEMA 5A5HA 3CRUA 2R5GA 4GDFA 4E8EA 2EFCA 3ERGA 14GSA 5JCUA 3LG6A 1GTIA 3KM6A 2PERA 3UARA 1AW9A 1GWCA 3GTUA 1PGTA 1OE7A 3UBLA 1M9AA 4MPFA 1U88A 2GSRA 4PGTA 4L8EA 5ECMB 1U87A 3KTLA 4Q5QA 4ZXGA 3F63A 5G5FA 3VI7A 2C3QA 4MF7A 3O76A 3Q18A 1XWGA 3LFLA 3MAKA 4HOJA 4JEDA 3I6AA 5D9TA 5IQYA 4ZBAA 4AKXB 4YQVA 1TU8A 1IYHA 1K0AA 12GSA 5ECKB 2IL3A 1Y6EA 2O3EA 1I1IP 1PL2A 4GLTA 5AIVA 5BMUA 1GLQA 2VCWA 1K3YA 1XWKA 4ID0A 3DGQA 4ECJA 4YQMA 1BYEA 4G0IA 5DAKA 2VKZG 4IGJA 3D0ZA 4EXJA 4HJ2A 4F03A 22GSA 5ECPB 1Y1UA 3SWLA 3EINA 1TXUA 4ECCA 4MDCA 5ELGA 1KBNA 4AGSA 3LJRA 1G6WA 5A34A 3VPTA 2PBJA 3IE3A 3HMJG 4AKIA 5FWGA 3ZFBA 6GSWA 2R3XA 4ISDA 1MTCA 1MD4A 3CHXC 3IR4A 4YAVA 3I69A 5J4UA 4PI0C 3R3EA 2HSNA 1N25A 4GSSA 5DJMA 1K3LA 3FYGA 4ACSA 4CHSA 2EFDA 2NTOA 4WR4A 1HNBA 1GUKA 5DJLA 4G0LA 4RI6A 4WR5A 2PMTA 5LD0A 3WD6A 4OFMA 4MF5A 3VLNA 5ECIB 2N5FA 1Q4JA 2UZ8A 3N9JA 4PQHA 4BVXA 5AGYA 4PURA 4FQUA 4PX1A 2D2ZA 4ZB9A 2ON7A 4AI6A 2OT3A 2V6KA 1M9BA 1PX7A 4YH2A 4I97A 4AKGA 1UA5A 4IS0A 2IMKA 5A1NA 4BVYB 1SVLA 2WVYA 4KDXA 2HNLA 3HJMA 3KXOA 5DALA 4QQ7A 3ERFA 1BG1A 4Q5NA 5A4WA 2WJUA 3FY7A 2CAIA 5D9VA 3CSHA 5A5KA 2HRKB 5KEJA 2WB9A 2HRAA 2C3NA 1YKCA 1PA3A 2GLRA 5F06A 3BBYA 1SVMA 1XW6A 1GUMA 5ECQB 2WS2A 2YCDA 3GUSA 4KX4A 3ISOA 5LCZA 1BX9A 4OFNA 3TOTA 1BAYA 5J41A 2HSMB 4IBPA 3PR8A 3R2QA 5DCGA 3GH6A 5DQSA 2VO4A 6GSVA 2C80A 2CAQA 1YDKA 2GSQA 1PX6A 4IKHA 4BL7B 2FHEA 4IJIA 1M99A 4EDYA 3ZMKA 3IBHA 4G01A 4MPGA 5A4VA 4OMVA 1OYJA 3LYPA 3VPQA 2OACA 3KMNA 2R4VA 4KDYA 3L0HA 4LMWA 3KJYA 3IC8A 5F05A 4F0CA 4EDZA 1HNAA 4YQUA 4PNFA
chains in the Genus database with same CATH topology
1PN9A 1YQ1A 2DSAA 19GSA 1DUGA 3UBKA 2EFEA 3M3MA 3VK9A 4N0VA 4NAXA 1GSUA 4GSTA 3IK9A 1IYIA 1OKTA 5HFKA 5A5HB 1B4PA 1E6BA 1F3AA 4J2FA 5D9WA 3QAGA 1OE8A 4OFTA 3Q74A 4ZB8A 4NHWA 1GSQA 2R6KA 5F8BA 1GUHA 2A2SA 5GSTA 1B48A 3VI5A 3GTUB 1RK4A 4USSA 1TU7A 3G7IA 5D73A 3C8EA 5DDLA 2YV7A 2VD1A 3P90A 5J40A 1ZGNA 1VF2A 2VCZA 6GSTA 2GSTA 5J47A 1GSDA 2PVQA 1Z9HA 5ECNB 5BMUB 3HKRA 5AISA 2JL4A 3N5OA 3TGZA 3F6FA 3LSZA 4ZB7A 4DEJA 17GSA 2EFHA 4E8HA 1BF5A 2H1LA 3F6DA 1V2AA 5DAKB 2FNOA 1HQOA 4K0NA 1AQVA 4ECBA 4L5OA 1K0NA 4KE3A 1VF3A 1GNEA 1R5AA 4KSMA 4F0BA 7GSSA 3M1GA 20GSA 1LJRA 4HI7A 5ECHB 1K0OA 1YVLA 3Q19A 3IK7A 1PKWA 4BL7A 1GSYA 2UV8G 1V40A 1YY7A 2C8UA 5F07A 1GTUA 4IVFA 6GSUA 1JLWA 3PPUA 5ECSA 1FHEA 4ECIA 4O92A 2HSNB 3LYKA 2ON5A 4PXOA 5AN1A 1C72A 3GURA 1XW5A 1N2AA 3GSSA 11GSA 6GSSA 3LXTA 3FRCA 3TU3B 3ZMLA 1GSSA 4ZB6A 3WYWA 5ECLB 2C4JA 1PL1A 5AIXA 3QAWA 3EE2A 1GSFA 3UAPA 2HQTA 2DC5A 4EE0A 1GNWA 1PMTA 5J5NA 3H1NA 1K0CA 3CSIA 4BVXB 3KMOA 3P8WA 2VCQA 1GTBA 1JLVA 2C3TA 1AQWA 5GZZB 3VWXA 2AB6A 6GSXA 1EOHA 4E68A 5A1NB 4MK3A 1LBKA 4ZBBA 3CSJA 2OADA 4N3ZA 2OA7A 5DALB 2GDRA 2F3MA 2CZ2A 3LXZA 4PUAA 3NIVA 1EOGA 4HZ4A 4IQ1A 1EV9A 4NHZA 3QAVA 4O7HA 1GULA 4Q5FA 2IMIA 5EY6A 2X64A 1TDIA 5FT3A 4G10A 8GSSA 3GSTA 5ELAA 4L5LA 1HNCA 3AY8A 3U6VA 13GSA 1NHYA 5F0GA 3CRTA 5ECRB 4KH7A 4G9HA 3FR6A 1MD3A 4JBBA 3MDKA 2YV9A 3G7JA 1ZL9A 4W66A 4LMVA 5FHIA 3RBTA 2AHEA 4GSNA 1GLPA 2VCTA 4BVYA 3CWGA 4KGIA 2VCXA 1PKZA 1M0UA 4GTUA 3FR3A 1G7OA 1VF1A 1PD21 1K0DA 5A4UA 16GSA 1B8XA 3UVHA 2HRKA 4G19A 5ECOB 4G0KA 5D9XA 4JZQA 1JZRA 1ML6A 4RI7A 2A2RA 1K3OA 2CA8A 3QR6A 4KAEA 5JCWA 4IELA 2WDUA 3M0FA 3VURA 4EC0A 2VCVA 4AKHA 1BG5A 2F8FA 3CBUA 2GSSA 1AQXA 2HSMA 1A0FA 1SVOA 2GTUA 2J9HA 2VD0A 1K0MA 2O5VA 4IQAA 3FR9A 3LQ7A 4MZWA 2CVDA 1YJ6A 4GF0A 10GSA 2CZ3A 9GSSA 5A34B 3W8SA 5GSSA 3ZFLA 5G5EA 3O3TA 1F3BA 4QMKA 3GX0A 4GCIA 4Q5RA 4KDUA 5B7CA 4HZ2A 4PTSA 4TOPA 6GSYA 1GTAA 4PQIA 1VF4A 4PNGA 5J4YA 1USBA 1AXDA 4KF9A 5J4VA 1GSEA 3HJOA 2PGTA 5EVOA 3TOUA 4IW9A 18GSA 1FW1A 4ZBDA 3DD3A 1TW9A 1K0BA 1U3IA 2AAWA 4YAPA 1G6YA 3M8NA 1EV4A 4MF6A 2LJRA 1F2EA 4MP4A 2WRTA 5EL8A 4K0GA 3PGTA 1EEMA 5A5HA 3CRUA 2R5GA 4GDFA 4E8EA 2EFCA 3ERGA 14GSA 5JCUA 3LG6A 1GTIA 3KM6A 2PERA 3UARA 1AW9A 1GWCA 3GTUA 1PGTA 1OE7A 3UBLA 1M9AA 4MPFA 1U88A 2GSRA 4PGTA 4L8EA 5ECMB 1U87A 3KTLA 4Q5QA 4ZXGA 3F63A 5G5FA 3VI7A 2C3QA 4MF7A 3O76A 3Q18A 1XWGA 3LFLA 3MAKA 4HOJA 4JEDA 3I6AA 5D9TA 5IQYA 4ZBAA 4AKXB 4YQVA 1TU8A 1IYHA 1K0AA 12GSA 5ECKB 2IL3A 1Y6EA 1PL2A 4GLTA 5AIVA 5BMUA 1GLQA 2VCWA 1K3YA 1XWKA 4ID0A 3DGQA 4ECJA 4YQMA 1BYEA 4G0IA 5DAKA 2VKZG 4IGJA 3D0ZA 4EXJA 4HJ2A 4F03A 22GSA 5ECPB 1Y1UA 3SWLA 3EINA 1TXUA 4ECCA 4MDCA 5ELGA 1KBNA 4AGSA 3LJRA 1G6WA 5A34A 3VPTA 2PBJA 3IE3A 3HMJG 4AKIA 5FWGA 3ZFBA 6GSWA 2R3XA 4ISDA 1MTCA 1MD4A 3IR4A 4YAVA 3I69A 5J4UA 3R3EA 2HSNA 1N25A 4GSSA 5DJMA 1K3LA 3FYGA 4ACSA 4CHSA 2EFDA 2NTOA 4WR4A 1HNBA 1GUKA 5DJLA 4G0LA 4RI6A 4WR5A 2PMTA 5LD0A 3WD6A 4OFMA 4MF5A 3VLNA 5ECIB 2N5FA 1Q4JA 2UZ8A 3N9JA 4PQHA 4BVXA 5AGYA 4PURA 4FQUA 4PX1A 2D2ZA 4ZB9A 2ON7A 4AI6A 2OT3A 2V6KA 1M9BA 1PX7A 4YH2A 4I97A 4AKGA 1UA5A 4IS0A 2IMKA 5A1NA 4BVYB 1SVLA 4KDXA 2HNLA 3HJMA 3KXOA 5DALA 4QQ7A 3ERFA 1BG1A 4Q5NA 5A4WA 2WJUA 3FY7A 2CAIA 5D9VA 3CSHA 5A5KA 2HRKB 5KEJA 2WB9A 2HRAA 2C3NA 1YKCA 1PA3A 2GLRA 5F06A 3BBYA 1SVMA 1XW6A 1GUMA 5ECQB 2WS2A 2YCDA 3GUSA 4KX4A 3ISOA 5LCZA 1BX9A 4OFNA 3TOTA 1BAYA 5J41A 2HSMB 4IBPA 3PR8A 3R2QA 5DCGA 3GH6A 5DQSA 2VO4A 6GSVA 2C80A 2CAQA 1YDKA 2GSQA 1PX6A 4IKHA 4BL7B 2FHEA 4IJIA 1M99A 4EDYA 3ZMKA 3IBHA 4G01A 4MPGA 5A4VA 4OMVA 1OYJA 3LYPA 3VPQA 2OACA 3KMNA 2R4VA 4KDYA 3L0HA 4LMWA 3KJYA 3IC8A 5F05A 4F0CA 4EDZA 1HNAA 4YQUA 4PNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PN9 A;  1YQ1 A;  2DSA A;  19GS A;  1DUG A;  3UBK A;  3M3M A;  3VK9 A;  4N0V A;  4NAX A;  1GSU A;  4GST A;  3IK9 A;  1IYI A;  1OKT A;  5HFK A;  1B4P A;  1E6B A;  1F3A A;  4J2F A;  5D9W A;  3QAG A;  1OE8 A;  4OFT A;  3Q74 A;  4ZB8 A;  4NHW A;  1GSQ A;  2R6K A;  5F8B A;  1GUH A;  2A2S A;  5GST A;  1B48 A;  3VI5 A;  3GTU B;  1RK4 A;  4USS A;  1TU7 A;  3G7I A;  5D73 A;  3C8E A;  5DDL A;  2YV7 A;  2VD1 A;  3P90 A;  1ZGN A;  1VF2 A;  2VCZ A;  6GST A;  2GST A;  1GSD A;  2PVQ A;  1Z9H A;  5ECN B;  3HKR A;  5AIS A;  2JL4 A;  3N5O A;  3TGZ A;  3F6F A;  3LSZ A;  4DEJ A;  17GS A;  4E8H A;  3F6D A;  1V2A A;  5DAK B;  2FNO A;  1HQO A;  4K0N A;  1AQV A;  4ECB A;  4L5O A;  1K0N A;  4KE3 A;  1VF3 A;  1GNE A;  1R5A A;  4KSM A;  4F0B A;  7GSS A;  3M1G A;  20GS A;  1LJR A;  4HI7 A;  5ECH B;  1K0O A;  3Q19 A;  1PKW A;  3IK7 A;  4BL7 A;  1GSY A;  1V40 A;  1YY7 A;  2C8U A;  5F07 A;  1GTU A;  4IVF A;  6GSU A;  1JLW A;  3PPU A;  5ECS A;  1FHE A;  4ECI A;  4O92 A;  2HSN B;  3LYK A;  2ON5 A;  4PXO A;  5AN1 A;  1C72 A;  3GUR A;  1XW5 A;  1N2A A;  3GSS A;  11GS A;  6GSS A;  3LXT A;  3FRC A;  3ZML A;  1GSS A;  4ZB6 A;  3WYW A;  5ECL B;  2C4J A;  1PL1 A;  5AIX A;  3QAW A;  3EE2 A;  1GSF A;  3UAP A;  2HQT A;  2DC5 A;  4EE0 A;  1GNW A;  1PMT A;  5J5N A;  3H1N A;  1K0C A;  3CSI A;  4BVX B;  3KMO A;  3P8W A;  2VCQ A;  1GTB A;  1JLV A;  2C3T A;  1AQW A;  5GZZ B;  3VWX A;  2AB6 A;  6GSX A;  1EOH A;  4MK3 A;  1LBK A;  4ZBB A;  3CSJ A;  2OAD A;  2OA7 A;  5DAL B;  2GDR A;  2F3M A;  2CZ2 A;  3LXZ A;  4PUA A;  3NIV A;  1EOG A;  4HZ4 A;  4IQ1 A;  1EV9 A;  4NHZ A;  3QAV A;  4O7H A;  1GUL A;  4Q5F A;  2IMI A;  5EY6 A;  2X64 A;  1TDI A;  5FT3 A;  4G10 A;  8GSS A;  3GST A;  5ELA A;  4L5L A;  1HNC A;  3AY8 A;  3U6V A;  13GS A;  1NHY A;  5F0G A;  3CRT A;  5ECR B;  4KH7 A;  4G9H A;  3FR6 A;  1MD3 A;  4JBB A;  3MDK A;  2YV9 A;  3G7J A;  1ZL9 A;  4LMV A;  5FHI A;  3RBT A;  2AHE A;  4GSN A;  1GLP A;  2VCT A;  4BVY A;  4KGI A;  2VCX A;  1PKZ A;  1M0U A;  4GTU A;  3FR3 A;  1G7O A;  1VF1 A;  1PD2 1;  1K0D A;  5A4U A;  16GS A;  1B8X A;  3UVH A;  2HRK A;  4G19 A;  5ECO B;  4G0K A;  5D9X A;  4JZQ A;  1JZR A;  1ML6 A;  4RI7 A;  2A2R A;  1K3O A;  2CA8 A;  3QR6 A;  4KAE A;  5JCW A;  4IEL A;  2WDU A;  3M0F A;  3VUR A;  4EC0 A;  2VCV A;  1BG5 A;  2F8F A;  3CBU A;  2GSS A;  1AQX A;  2HSM A;  1A0F A;  2J9H A;  2GTU A;  2VD0 A;  1K0M A;  4IQA A;  3FR9 A;  3LQ7 A;  4MZW A;  2CVD A;  1YJ6 A;  4GF0 A;  10GS A;  2CZ3 A;  9GSS A;  3W8S A;  5GSS A;  3ZFL A;  5G5E A;  3O3T A;  1F3B A;  3GX0 A;  4GCI A;  4Q5R A;  4KDU A;  5B7C A;  4HZ2 A;  4PTS A;  4TOP A;  6GSY A;  1GTA A;  4PQI A;  1VF4 A;  4PNG A;  1USB A;  1AXD A;  4KF9 A;  1GSE A;  3HJO A;  2PGT A;  5EVO A;  3TOU A;  4IW9 A;  18GS A;  1FW1 A;  4ZBD A;  3DD3 A;  1TW9 A;  1K0B A;  1U3I A;  2AAW A;  4YAP A;  1G6Y A;  3M8N A;  1EV4 A;  4MF6 A;  2LJR A;  1F2E A;  4MP4 A;  2WRT A;  5EL8 A;  4K0G A;  3PGT A;  1EEM A;  3CRU A;  2R5G A;  4E8E A;  3ERG A;  14GS A;  5JCU A;  3LG6 A;  1GTI A;  3KM6 A;  2PER A;  3UAR A;  1AW9 A;  1GWC A;  3GTU A;  1PGT A;  1OE7 A;  3UBL A;  1M9A A;  4MPF A;  1U88 A;  2GSR A;  4PGT A;  4L8E A;  5ECM B;  1U87 A;  3KTL A;  4Q5Q A;  4ZXG A;  3F63 A;  5G5F A;  3VI7 A;  2C3Q A;  4MF7 A;  3O76 A;  3Q18 A;  1XWG A;  3LFL A;  3MAK A;  4HOJ A;  4JED A;  3I6A A;  5D9T A;  5IQY A;  4ZBA A;  4YQV A;  1TU8 A;  1IYH A;  1K0A A;  12GS A;  5ECK B;  2IL3 A;  1Y6E A;  1PL2 A;  4GLT A;  5AIV A;  5BMU A;  1GLQ A;  2VCW A;  1K3Y A;  1XWK A;  4ID0 A;  3DGQ A;  4ECJ A;  4YQM A;  1BYE A;  4G0I A;  5DAK A;  4IGJ A;  3D0Z A;  4EXJ A;  4HJ2 A;  4F03 A;  22GS A;  5ECP B;  3SWL A;  3EIN A;  4ECC A;  4MDC A;  5ELG A;  1KBN A;  4AGS A;  3LJR A;  1G6W A;  3VPT A;  2PBJ A;  3IE3 A;  5FWG A;  3ZFB A;  6GSW A;  2R3X A;  4ISD A;  1MTC A;  1MD4 A;  3IR4 A;  4YAV A;  3I69 A;  5J4U A;  3R3E A;  4GSS A;  5DJM A;  1K3L A;  3FYG A;  4ACS A;  4CHS A;  2NTO A;  4WR4 A;  1HNB A;  1GUK A;  5DJL A;  4G0L A;  4RI6 A;  4WR5 A;  2PMT A;  5LD0 A;  3WD6 A;  4OFM A;  4MF5 A;  3VLN A;  5ECI B;  2N5F A;  1Q4J A;  2UZ8 A;  3N9J A;  4PQH A;  4BVX A;  5AGY A;  4PUR A;  4FQU A;  4PX1 A;  2D2Z A;  4ZB9 A;  2ON7 A;  2V6K A;  1M9B A;  1PX7 A;  4YH2 A;  4I97 A;  1UA5 A;  4IS0 A;  2IMK A;  4BVY B;  4KDX A;  2HNL A;  3HJM A;  3KXO A;  5DAL A;  4QQ7 A;  3ERF A;  4Q5N A;  5A4W A;  2WJU A;  3FY7 A;  2CAI A;  5D9V A;  3CSH A;  5A5K A;  2HRK B;  5KEJ A;  2WB9 A;  2HRA A;  2C3N A;  1YKC A;  1PA3 A;  2GLR A;  5F06 A;  3BBY A;  1XW6 A;  1GUM A;  5ECQ B;  2WS2 A;  2YCD A;  3GUS A;  4KX4 A;  3ISO A;  5LCZ A;  1BX9 A;  4OFN A;  3TOT A;  1BAY A;  5J41 A;  2HSM B;  4IBP A;  3PR8 A;  3R2Q A;  5DCG A;  3GH6 A;  5DQS A;  2VO4 A;  6GSV A;  2C80 A;  2CAQ A;  1YDK A;  2GSQ A;  1PX6 A;  4IKH A;  4BL7 B;  2FHE A;  4IJI A;  1M99 A;  4EDY A;  3ZMK A;  3IBH A;  4MPG A;  5A4V A;  4OMV A;  1OYJ A;  3LYP A;  3VPQ A;  2OAC A;  2R4V A;  3KMN A;  4KDY A;  3L0H A;  4LMW A;  3KJY A;  3IC8 A;  5F05 A;  4F0C A;  4EDZ A;  1HNA A;  4YQU A;  4PNF A; 
#chains in the Genus database with same CATH topology
 1PN9 A;  1YQ1 A;  2DSA A;  19GS A;  1DUG A;  3UBK A;  2EFE A;  3M3M A;  3VK9 A;  4N0V A;  4NAX A;  1GSU A;  1S4B P;  4GST A;  3IK9 A;  1IYI A;  1OKT A;  2O36 A;  5HFK A;  5A5H B;  1B4P A;  1E6B A;  1F3A A;  4J2F A;  5D9W A;  3QAG A;  1OE8 A;  4OFT A;  3Q74 A;  2WW1 A;  4ZB8 A;  4NHW A;  1GSQ A;  2R6K A;  5F8B A;  1GUH A;  2A2S A;  5GST A;  1B48 A;  3VI5 A;  3GTU B;  4PHZ C;  1RK4 A;  4USS A;  1TU7 A;  3G7I A;  5D73 A;  3C8E A;  5DDL A;  2YV7 A;  2VD1 A;  3P90 A;  5J40 A;  1ZGN A;  1VF2 A;  2VCZ A;  6GST A;  2GST A;  5J47 A;  1GSD A;  2PVQ A;  1Z9H A;  2WZS A;  5ECN B;  5BMU B;  3HKR A;  5AIS A;  2JL4 A;  3N5O A;  3TGZ A;  3F6F A;  3LSZ A;  4ZB7 A;  4DEJ A;  17GS A;  2EFH A;  4E8H A;  1BF5 A;  2H1L A;  3F6D A;  1V2A A;  5DAK B;  2FNO A;  1HQO A;  4K0N A;  1AQV A;  4ECB A;  4L5O A;  1K0N A;  4KE3 A;  1VF3 A;  1GNE A;  1R5A A;  4KSM A;  4F0B A;  4FXY P;  7GSS A;  3M1G A;  20GS A;  1LJR A;  4HI7 A;  5ECH B;  1K0O A;  1YVL A;  3Q19 A;  3IK7 A;  1PKW A;  4BL7 A;  1GSY A;  2UV8 G;  1V40 A;  1YY7 A;  2C8U A;  2WW0 A;  5F07 A;  1GTU A;  4IVF A;  6GSU A;  1JLW A;  2WVX B;  3PPU A;  5ECS A;  1FHE A;  4ECI A;  4O92 A;  2HSN B;  1YEW C;  3LYK A;  2ON5 A;  4PXO A;  5AN1 A;  1C72 A;  3GUR A;  1XW5 A;  1N2A A;  3GSS A;  11GS A;  6GSS A;  3LXT A;  3FRC A;  3TU3 B;  3ZML A;  4PI2 C;  1GSS A;  4ZB6 A;  3WYW A;  2WVZ A;  5ECL B;  2C4J A;  1PL1 A;  5AIX A;  3QAW A;  3EE2 A;  1GSF A;  3UAP A;  2HQT A;  2DC5 A;  4EE0 A;  1GNW A;  1PMT A;  5J5N A;  3H1N A;  1K0C A;  3CSI A;  4BVX B;  3KMO A;  3P8W A;  2VCQ A;  1GTB A;  1JLV A;  2C3T A;  1AQW A;  5GZZ B;  3VWX A;  2AB6 A;  6GSX A;  1EOH A;  4E68 A;  5A1N B;  4MK3 A;  1LBK A;  4ZBB A;  3CSJ A;  2OAD A;  4N3Z A;  2OA7 A;  5DAL B;  2GDR A;  2F3M A;  3RGB C;  2CZ2 A;  3LXZ A;  4PUA A;  3NIV A;  1EOG A;  4HZ4 A;  4IQ1 A;  1EV9 A;  4NHZ A;  3QAV A;  2WW2 A;  1GUL A;  4O7H A;  4Q5F A;  2IMI A;  5EY6 A;  2X64 A;  1TDI A;  5FT3 A;  4G10 A;  8GSS A;  3GST A;  5ELA A;  4L5L A;  1HNC A;  3AY8 A;  3U6V A;  13GS A;  1NHY A;  5F0G A;  3CRT A;  5ECR B;  4KH7 A;  4G9H A;  3FR6 A;  1MD3 A;  4JBB A;  3MDK A;  2YV9 A;  3G7J A;  1ZL9 A;  4W66 A;  4LMV A;  5FHI A;  3RBT A;  2AHE A;  4GSN A;  1GLP A;  2VCT A;  4BVY A;  3CWG A;  4KGI A;  2VCX A;  1PKZ A;  3RFR C;  1M0U A;  4GTU A;  3FR3 A;  1G7O A;  1VF1 A;  1PD2 1;  1K0D A;  5A4U A;  16GS A;  1B8X A;  2WW3 A;  2HRK A;  4G19 A;  3UVH A;  5ECO B;  4G0K A;  5D9X A;  4JZQ A;  1JZR A;  1ML6 A;  4RI7 A;  2WVX A;  2A2R A;  1K3O A;  2CA8 A;  3QR6 A;  4KAE A;  5JCW A;  4IEL A;  2WDU A;  3M0F A;  3VUR A;  4EC0 A;  2VCV A;  4AKH A;  1BG5 A;  2F8F A;  3CBU A;  2GSS A;  1AQX A;  2HSM A;  1A0F A;  1SVO A;  2GTU A;  2J9H A;  2VD0 A;  1K0M A;  2O5V A;  4IQA A;  3FR9 A;  3LQ7 A;  4MZW A;  2CVD A;  1YJ6 A;  4GF0 A;  10GS A;  2CZ3 A;  9GSS A;  5A34 B;  3W8S A;  5GSS A;  3ZFL A;  5G5E A;  3O3T A;  1F3B A;  4QMK A;  3GX0 A;  4GCI A;  4Q5R A;  4KDU A;  5B7C A;  4HZ2 A;  4PTS A;  4TOP A;  6GSY A;  1GTA A;  4PQI A;  1VF4 A;  4PNG A;  5J4Y A;  1USB A;  1AXD A;  4KF9 A;  5J4V A;  1GSE A;  3HJO A;  2PGT A;  5EVO A;  3TOU A;  4IW9 A;  18GS A;  1FW1 A;  4ZBD A;  3DD3 A;  1TW9 A;  1K0B A;  1U3I A;  2AAW A;  4YAP A;  1G6Y A;  3M8N A;  1EV4 A;  4MF6 A;  2LJR A;  1F2E A;  4MP4 A;  2WRT A;  5EL8 A;  4K0G A;  3PGT A;  1EEM A;  5A5H A;  3CRU A;  2R5G A;  4GDF A;  4E8E A;  2EFC A;  3ERG A;  14GS A;  5JCU A;  3LG6 A;  1GTI A;  3KM6 A;  2PER A;  3UAR A;  1AW9 A;  1GWC A;  3GTU A;  1PGT A;  1OE7 A;  3UBL A;  1M9A A;  4MPF A;  1U88 A;  2GSR A;  4PGT A;  4L8E A;  5ECM B;  1U87 A;  3KTL A;  4Q5Q A;  4ZXG A;  3F63 A;  5G5F A;  3VI7 A;  2C3Q A;  4MF7 A;  3O76 A;  3Q18 A;  1XWG A;  3LFL A;  3MAK A;  4HOJ A;  4JED A;  3I6A A;  5D9T A;  5IQY A;  4ZBA A;  4AKX B;  4YQV A;  1TU8 A;  1IYH A;  1K0A A;  12GS A;  5ECK B;  2IL3 A;  1Y6E A;  2O3E A;  1I1I P;  1PL2 A;  4GLT A;  5AIV A;  5BMU A;  1GLQ A;  2VCW A;  1K3Y A;  1XWK A;  4ID0 A;  3DGQ A;  4ECJ A;  4YQM A;  1BYE A;  4G0I A;  5DAK A;  2VKZ G;  4IGJ A;  3D0Z A;  4EXJ A;  4HJ2 A;  4F03 A;  22GS A;  5ECP B;  1Y1U A;  3SWL A;  3EIN A;  1TXU A;  4ECC A;  4MDC A;  5ELG A;  1KBN A;  4AGS A;  3LJR A;  1G6W A;  5A34 A;  3VPT A;  2PBJ A;  3IE3 A;  3HMJ G;  4AKI A;  5FWG A;  3ZFB A;  6GSW A;  2R3X A;  4ISD A;  1MTC A;  1MD4 A;  3CHX C;  3IR4 A;  4YAV A;  3I69 A;  5J4U A;  4PI0 C;  3R3E A;  2HSN A;  1N25 A;  4GSS A;  5DJM A;  1K3L A;  3FYG A;  4ACS A;  4CHS A;  2EFD A;  2NTO A;  4WR4 A;  1HNB A;  1GUK A;  5DJL A;  4G0L A;  4RI6 A;  4WR5 A;  2PMT A;  5LD0 A;  3WD6 A;  4OFM A;  4MF5 A;  3VLN A;  5ECI B;  2N5F A;  1Q4J A;  2UZ8 A;  3N9J A;  4PQH A;  4BVX A;  5AGY A;  4PUR A;  4FQU A;  4PX1 A;  2D2Z A;  4ZB9 A;  2ON7 A;  4AI6 A;  2OT3 A;  2V6K A;  1M9B A;  1PX7 A;  4YH2 A;  4I97 A;  4AKG A;  1UA5 A;  4IS0 A;  2IMK A;  5A1N A;  4BVY B;  1SVL A;  2WVY A;  4KDX A;  2HNL A;  3HJM A;  3KXO A;  5DAL A;  4QQ7 A;  3ERF A;  1BG1 A;  4Q5N A;  5A4W A;  2WJU A;  3FY7 A;  2CAI A;  5D9V A;  3CSH A;  5A5K A;  2HRK B;  5KEJ A;  2WB9 A;  2HRA A;  2C3N A;  1YKC A;  1PA3 A;  2GLR A;  5F06 A;  3BBY A;  1SVM A;  1XW6 A;  1GUM A;  5ECQ B;  2WS2 A;  2YCD A;  3GUS A;  4KX4 A;  3ISO A;  5LCZ A;  1BX9 A;  4OFN A;  3TOT A;  1BAY A;  5J41 A;  2HSM B;  4IBP A;  3PR8 A;  3R2Q A;  5DCG A;  3GH6 A;  5DQS A;  2VO4 A;  6GSV A;  2C80 A;  2CAQ A;  1YDK A;  2GSQ A;  1PX6 A;  4IKH A;  4BL7 B;  2FHE A;  4IJI A;  1M99 A;  4EDY A;  3ZMK A;  3IBH A;  4G01 A;  4MPG A;  5A4V A;  4OMV A;  1OYJ A;  3LYP A;  3VPQ A;  2OAC A;  3KMN A;  2R4V A;  4KDY A;  3L0H A;  4LMW A;  3KJY A;  3IC8 A;  5F05 A;  4F0C A;  4EDZ A;  1HNA A;  4YQU A;  4PNF A; 
#chains in the Genus database with same CATH homology
 1PN9 A;  1YQ1 A;  2DSA A;  19GS A;  1DUG A;  3UBK A;  2EFE A;  3M3M A;  3VK9 A;  4N0V A;  4NAX A;  1GSU A;  4GST A;  3IK9 A;  1IYI A;  1OKT A;  5HFK A;  5A5H B;  1B4P A;  1E6B A;  1F3A A;  4J2F A;  5D9W A;  3QAG A;  1OE8 A;  4OFT A;  3Q74 A;  4ZB8 A;  4NHW A;  1GSQ A;  2R6K A;  5F8B A;  1GUH A;  2A2S A;  5GST A;  1B48 A;  3VI5 A;  3GTU B;  1RK4 A;  4USS A;  1TU7 A;  3G7I A;  5D73 A;  3C8E A;  5DDL A;  2YV7 A;  2VD1 A;  3P90 A;  5J40 A;  1ZGN A;  1VF2 A;  2VCZ A;  6GST A;  2GST A;  5J47 A;  1GSD A;  2PVQ A;  1Z9H A;  5ECN B;  5BMU B;  3HKR A;  5AIS A;  2JL4 A;  3N5O A;  3TGZ A;  3F6F A;  3LSZ A;  4ZB7 A;  4DEJ A;  17GS A;  2EFH A;  4E8H A;  1BF5 A;  2H1L A;  3F6D A;  1V2A A;  5DAK B;  2FNO A;  1HQO A;  4K0N A;  1AQV A;  4ECB A;  4L5O A;  1K0N A;  4KE3 A;  1VF3 A;  1GNE A;  1R5A A;  4KSM A;  4F0B A;  7GSS A;  3M1G A;  20GS A;  1LJR A;  4HI7 A;  5ECH B;  1K0O A;  1YVL A;  3Q19 A;  3IK7 A;  1PKW A;  4BL7 A;  1GSY A;  2UV8 G;  1V40 A;  1YY7 A;  2C8U A;  5F07 A;  1GTU A;  4IVF A;  6GSU A;  1JLW A;  3PPU A;  5ECS A;  1FHE A;  4ECI A;  4O92 A;  2HSN B;  3LYK A;  2ON5 A;  4PXO A;  5AN1 A;  1C72 A;  3GUR A;  1XW5 A;  1N2A A;  3GSS A;  11GS A;  6GSS A;  3LXT A;  3FRC A;  3TU3 B;  3ZML A;  1GSS A;  4ZB6 A;  3WYW A;  5ECL B;  2C4J A;  1PL1 A;  5AIX A;  3QAW A;  3EE2 A;  1GSF A;  3UAP A;  2HQT A;  2DC5 A;  4EE0 A;  1GNW A;  1PMT A;  5J5N A;  3H1N A;  1K0C A;  3CSI A;  4BVX B;  3KMO A;  3P8W A;  2VCQ A;  1GTB A;  1JLV A;  2C3T A;  1AQW A;  5GZZ B;  3VWX A;  2AB6 A;  6GSX A;  1EOH A;  4E68 A;  5A1N B;  4MK3 A;  1LBK A;  4ZBB A;  3CSJ A;  2OAD A;  4N3Z A;  2OA7 A;  5DAL B;  2GDR A;  2F3M A;  2CZ2 A;  3LXZ A;  4PUA A;  3NIV A;  1EOG A;  4HZ4 A;  4IQ1 A;  1EV9 A;  4NHZ A;  3QAV A;  4O7H A;  1GUL A;  4Q5F A;  2IMI A;  5EY6 A;  2X64 A;  1TDI A;  5FT3 A;  4G10 A;  8GSS A;  3GST A;  5ELA A;  4L5L A;  1HNC A;  3AY8 A;  3U6V A;  13GS A;  1NHY A;  5F0G A;  3CRT A;  5ECR B;  4KH7 A;  4G9H A;  3FR6 A;  1MD3 A;  4JBB A;  3MDK A;  2YV9 A;  3G7J A;  1ZL9 A;  4W66 A;  4LMV A;  5FHI A;  3RBT A;  2AHE A;  4GSN A;  1GLP A;  2VCT A;  4BVY A;  3CWG A;  4KGI A;  2VCX A;  1PKZ A;  1M0U A;  4GTU A;  3FR3 A;  1G7O A;  1VF1 A;  1PD2 1;  1K0D A;  5A4U A;  16GS A;  1B8X A;  3UVH A;  2HRK A;  4G19 A;  5ECO B;  4G0K A;  5D9X A;  4JZQ A;  1JZR A;  1ML6 A;  4RI7 A;  2A2R A;  1K3O A;  2CA8 A;  3QR6 A;  4KAE A;  5JCW A;  4IEL A;  2WDU A;  3M0F A;  3VUR A;  4EC0 A;  2VCV A;  4AKH A;  1BG5 A;  2F8F A;  3CBU A;  2GSS A;  1AQX A;  2HSM A;  1A0F A;  1SVO A;  2GTU A;  2J9H A;  2VD0 A;  1K0M A;  2O5V A;  4IQA A;  3FR9 A;  3LQ7 A;  4MZW A;  2CVD A;  1YJ6 A;  4GF0 A;  10GS A;  2CZ3 A;  9GSS A;  5A34 B;  3W8S A;  5GSS A;  3ZFL A;  5G5E A;  3O3T A;  1F3B A;  4QMK A;  3GX0 A;  4GCI A;  4Q5R A;  4KDU A;  5B7C A;  4HZ2 A;  4PTS A;  4TOP A;  6GSY A;  1GTA A;  4PQI A;  1VF4 A;  4PNG A;  5J4Y A;  1USB A;  1AXD A;  4KF9 A;  5J4V A;  1GSE A;  3HJO A;  2PGT A;  5EVO A;  3TOU A;  4IW9 A;  18GS A;  1FW1 A;  4ZBD A;  3DD3 A;  1TW9 A;  1K0B A;  1U3I A;  2AAW A;  4YAP A;  1G6Y A;  3M8N A;  1EV4 A;  4MF6 A;  2LJR A;  1F2E A;  4MP4 A;  2WRT A;  5EL8 A;  4K0G A;  3PGT A;  1EEM A;  5A5H A;  3CRU A;  2R5G A;  4GDF A;  4E8E A;  2EFC A;  3ERG A;  14GS A;  5JCU A;  3LG6 A;  1GTI A;  3KM6 A;  2PER A;  3UAR A;  1AW9 A;  1GWC A;  3GTU A;  1PGT A;  1OE7 A;  3UBL A;  1M9A A;  4MPF A;  1U88 A;  2GSR A;  4PGT A;  4L8E A;  5ECM B;  1U87 A;  3KTL A;  4Q5Q A;  4ZXG A;  3F63 A;  5G5F A;  3VI7 A;  2C3Q A;  4MF7 A;  3O76 A;  3Q18 A;  1XWG A;  3LFL A;  3MAK A;  4HOJ A;  4JED A;  3I6A A;  5D9T A;  5IQY A;  4ZBA A;  4AKX B;  4YQV A;  1TU8 A;  1IYH A;  1K0A A;  12GS A;  5ECK B;  2IL3 A;  1Y6E A;  1PL2 A;  4GLT A;  5AIV A;  5BMU A;  1GLQ A;  2VCW A;  1K3Y A;  1XWK A;  4ID0 A;  3DGQ A;  4ECJ A;  4YQM A;  1BYE A;  4G0I A;  5DAK A;  2VKZ G;  4IGJ A;  3D0Z A;  4EXJ A;  4HJ2 A;  4F03 A;  22GS A;  5ECP B;  1Y1U A;  3SWL A;  3EIN A;  1TXU A;  4ECC A;  4MDC A;  5ELG A;  1KBN A;  4AGS A;  3LJR A;  1G6W A;  5A34 A;  3VPT A;  2PBJ A;  3IE3 A;  3HMJ G;  4AKI A;  5FWG A;  3ZFB A;  6GSW A;  2R3X A;  4ISD A;  1MTC A;  1MD4 A;  3IR4 A;  4YAV A;  3I69 A;  5J4U A;  3R3E A;  2HSN A;  1N25 A;  4GSS A;  5DJM A;  1K3L A;  3FYG A;  4ACS A;  4CHS A;  2EFD A;  2NTO A;  4WR4 A;  1HNB A;  1GUK A;  5DJL A;  4G0L A;  4RI6 A;  4WR5 A;  2PMT A;  5LD0 A;  3WD6 A;  4OFM A;  4MF5 A;  3VLN A;  5ECI B;  2N5F A;  1Q4J A;  2UZ8 A;  3N9J A;  4PQH A;  4BVX A;  5AGY A;  4PUR A;  4FQU A;  4PX1 A;  2D2Z A;  4ZB9 A;  2ON7 A;  4AI6 A;  2OT3 A;  2V6K A;  1M9B A;  1PX7 A;  4YH2 A;  4I97 A;  4AKG A;  1UA5 A;  4IS0 A;  2IMK A;  5A1N A;  4BVY B;  1SVL A;  4KDX A;  2HNL A;  3HJM A;  3KXO A;  5DAL A;  4QQ7 A;  3ERF A;  1BG1 A;  4Q5N A;  5A4W A;  2WJU A;  3FY7 A;  2CAI A;  5D9V A;  3CSH A;  5A5K A;  2HRK B;  5KEJ A;  2WB9 A;  2HRA A;  2C3N A;  1YKC A;  1PA3 A;  2GLR A;  5F06 A;  3BBY A;  1SVM A;  1XW6 A;  1GUM A;  5ECQ B;  2WS2 A;  2YCD A;  3GUS A;  4KX4 A;  3ISO A;  5LCZ A;  1BX9 A;  4OFN A;  3TOT A;  1BAY A;  5J41 A;  2HSM B;  4IBP A;  3PR8 A;  3R2Q A;  5DCG A;  3GH6 A;  5DQS A;  2VO4 A;  6GSV A;  2C80 A;  2CAQ A;  1YDK A;  2GSQ A;  1PX6 A;  4IKH A;  4BL7 B;  2FHE A;  4IJI A;  1M99 A;  4EDY A;  3ZMK A;  3IBH A;  4G01 A;  4MPG A;  5A4V A;  4OMV A;  1OYJ A;  3LYP A;  3VPQ A;  2OAC A;  3KMN A;  2R4V A;  4KDY A;  3L0H A;  4LMW A;  3KJY A;  3IC8 A;  5F05 A;  4F0C A;  4EDZ A;  1HNA A;  4YQU A;  4PNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...