4BVYB

Crystal structure of the aimp3-mrs n-terminal domain complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
168
Chain Sequence
SMAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNDGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFSHIQHYPGIRQHLSSVVFIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/translation
molecule keywords METHIONINE--TRNA LIGASE, CYTOPLASMIC
publication title Crystal Structure of the Aimp3-Mrs N-Terminal Domain Complex
rcsb
source organism Homo sapiens
total genus 57
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2013-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4bvyB02
3.40.30.90 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4bvyB01
1U88A 2CA8A 1XWGA 2AHEA 5JCUA 4HOJA 3GSSA 1B4PA 3GH6A 2OACA 2GLRA 1VF1A 6GSYA 1G6WA 2JL4A 1K0MA 1TDIA 4PURA 5D73A 3GTUA 4ZB8A 1K0NA 4IGJA 4YAPA 3PR8A 5J4UA 1HNCA 4GLTA 1U3IA 2PVQA 5ECIB 1EOGA 5A4UA 4MF7A 2A2RA 4YAVA 2VCVA 5ECMB 4LMWA 3HJMA 4OMVA 6GSTA 17GSA 1B8XA 1ZL9A 4BVYB 4YH2A 1K0CA 3UBKA 4MK3A 3LYPA 4IQAA 1K0DA 1PD21 5ECLB 3FR9A 3SWLA 2OA7A 3O3TA 1GSEA 4RI7A 4EC0A 1YY7A 2AB6A 2V6KA 5EY6A 5IQYA 3DD3A 1C72A 1K3YA 3KJYA 5D9TA 4PX1A 1V2AA 4ZXGA 5F0GA 1PL1A 4G19A 3GURA 3Q18A 3I69A 3FY7A 3IR4A 5GSTA 1KBNA 4PUAA 4WR5A 4OFTA 4HI7A 5DCGA 4E8HA 22GSA 3CRTA 3G7IA 1OE8A 5F05A 3PGTA 3QR6A 2GSQA 2IMIA 5EVOA 3VPQA 4KAEA 4E8EA 1V40A 5ECOB 4GCIA 3EINA 1AW9A 2C8UA 3BBYA 3HKRA 4IQ1A 5A4VA 4IW9A 5D9WA 5ECQB 1JLWA 4G0IA 4KDUA 3F6DA 3P8WA 2GDRA 3U6VA 4ISDA 6GSXA 2VO4A 2A2SA 4KDYA 5G5FA 4KSMA 2VCWA 2HRKA 4GSSA 1PN9A 1EV4A 3KXOA 5DAKB 5A5KA 4PNGA 1GUKA 4L5LA 5DALB 1G7OA 3LXTA 4G0LA 4RI6A 3TGZA 5FT3A 2OADA 3CBUA 4PQIA 1LBKA 5DALA 1LJRA 1GLQA 1PGTA 4MP4A 5AIVA 5FWGA 1K0AA 4GF0A 5FHIA 4ECCA 2VCXA 2VCZA 3LXZA 3QAWA 4NAXA 1AQVA 1GNWA 1YJ6A 1AXDA 4JZQA 4IBPA 1K0BA 5GSSA 5LD0A 5F07A 4PGTA 2J9HA 4GSTA 4FQUA 7GSSA 1XW5A 2N5FA 3GTUB 5F06A 2LJRA 3FR6A 1FHEA 4LMVA 4Q5NA 3VLNA 2AAWA 3IK9A 4ACSA 9GSSA 1MD4A 2UZ8A 5G5EA 4AGSA 1GSQA 1A0FA 1HNAA 1VF2A 4MPGA 20GSA 1VF4A 3H1NA 1E6BA 1EEMA 2IL3A 2PMTA 5DJMA 4KH7A 3IBHA 3ERGA 5F8BA 16GSA 4IJIA 2R3XA 3GUSA 4YQVA 1GTIA 1YKCA 10GSA 3ZMLA 3LFLA 3VPTA 2VCQA 1GSUA 3NIVA 4IVFA 1GWCA 4MDCA 2WDUA 1Z9HA 1XW6A 4GSNA 3VI5A 4BL7B 1BAYA 2PBJA 4JEDA 3R2QA 3R3EA 2CAQA 1Q4JA 1F2EA 5J5NA 3GX0A 1R5AA 2HNLA 4BL7A 2HQTA 5ELGA 1HQOA 3ISOA 3FR3A 3Q19A 3UARA 2CAIA 5ECHB 3CSJA 2C3QA 3WYWA 4F0CA 1RK4A 3LYKA 3N5OA 2IMKA 3M3MA 1PKZA 2NTOA 3L0HA 5ECKB 8GSSA 2GSRA 4JBBA 3C8EA 3EE2A 4KDXA 3CSHA 2D2ZA 5A4WA 4HZ2A 1K3LA 3QAVA 4QQ7A 5GZZB 4YQMA 14GSA 4CHSA 1JZRA 18GSA 2HRKB 2WJUA 4GTUA 4IELA 1F3AA 4HJ2A 4O7HA 4PQHA 2ON5A 2VCTA 3VURA 1PA3A 3IE3A 4KGIA 2C3NA 1MTCA 1TU8A 3UVHA 5DDLA 4EXJA 3F63A 5KEJA 1U87A 4ZBDA 3TOUA 3ZMKA 6GSUA 5ELAA 3KTLA 3Q74A 3F6FA 3IK7A 1FW1A 2CZ3A 5AGYA 3W8SA 4WR4A 1GTUA 4PNFA 3KMOA 1PMTA 4BVXB 3KM6A 1OKTA 4G0KA 2ON7A 4ZBBA 6GSWA 1ML6A 5ECNB 3ZFBA 4BVXA 3QAGA 4ID0A 1BG5A 2CVDA 4G10A 2VD0A 1K0OA 3DGQA 5B7CA 4USSA 13GSA 3CSIA 1BYEA 2YV9A 4Q5QA 5D9VA 4N0VA 5J41A 1DUGA 2C4JA 4NHZA 4DEJA 3PPUA 4KF9A 1GSSA 2GSSA 4K0NA 4O92A 3CRUA 5AN1A 1Y6EA 1EV9A 1USBA 1PKWA 4ZB6A 1M9AA 5ECSA 3G7JA 3ERFA 4Q5RA 5DJLA 4K0GA 1BX9A 3M8NA 2FNOA 2YCDA 2HRAA 1PL2A 3TOTA 2HSMB 2C3TA 5EL8A 2R5GA 4TOPA 1JLVA 3UAPA 5JCWA 3RBTA 1GUHA 2HSMA 3VK9A 1UA5A 2DC5A 2X64A 3VWXA 3FYGA 5AISA 1ZGNA 1IYIA 3O76A 4EE0A 1MD3A 4KE3A 1F3BA 1GSYA 3ZFLA 4BVYA 4MZWA 4IKHA 5DQSA 2YV7A 4Q5FA 1OE7A 4YQUA 1OYJA 1GTAA 3MAKA 2FHEA 4KX4A 1VF3A 1TW9A 4L5OA 1TU7A 2CZ2A 3LJRA 3I6AA 2PERA 4F0BA 1GLPA 4OFMA 4G9HA 5AIXA 2F8FA 1GSFA 2WB9A 3KMNA 4ZB9A 1AQWA 2HSNB 1NHYA 4MF5A 3N9JA 1EOHA 4F03A 5ECPB 1GSDA 3LSZA 2WRTA 4PXOA 4ECBA 1IYHA 2GSTA 3HJOA 1HNBA 3GSTA 1GULA 4EDYA 1B48A 3FRCA 3UBLA 4ZBAA 5ECRB 1M0UA 1GTBA 1GUMA 19GSA 4EDZA 3D0ZA 3WD6A 1YQ1A 4ECIA 4OFNA 2PGTA 4PTSA 3LQ7A 4L8EA 3M0FA 4NHWA 5D9XA 3M1GA 5HFKA 5BMUA 12GSA 1AQXA 2C80A 11GSA 1PX6A 4ECJA 4MPFA 3LG6A 6GSVA 2WS2A 1M99A 1XWKA 3IC8A 5DAKA 2DSAA 1N2AA 2GTUA 1YDKA 6GSSA 4J2FA 1K3OA 2R6KA 2VD1A 3MDKA 3VI7A 5LCZA 1M9BA 3P90A 4HZ4A 4IS0A 1G6YA 1PX7A 4I97A 3AY8A 2R4VA 1GNEA 2F3MA 4MF6A
chains in the Genus database with same CATH superfamily
3CQFA 5G31A 4E68A 3H4KA 2B5XA 4AJ7A 4ML1A 3KP8A 1FOHA 2GLRA 5JCGA 3FK8A 1M2DA 4NWYA 1K0MA 3G9BA 4PURA 5D73A 1NM3A 1JZDA 1F6MC 2EFHA 4IGJA 4YAPA 3PR8A 1X9SB 1U3IA 4XS6A 2HRFA 3US3A 4POKA 2A2RA 2A2PA 3HJMA 4OMVA 6GSTA 2Z9SA 1ZL9A 4BVYB 4EIPA 3GHAA 1K0CA 3GL3A 3UBKA 3LWAA 3MNGA 3ZVJA 1T3BA 3FMWA 3LYPA 2H74A 3O3TA 1I1IP 4EC0A 5HQPA 5DVBA 5CRGA 3L9SA 2VM2A 4AKHA 1K3YA 5D9TA 2HSYA 4TXOB 1V2AA 1ON4A 1Z7RA 4G19A 3WGDA 5G1LA 3D21A 3I69A 4XRAA 4PUAA 1XWCA 4HI7A 5DCGA 2P31A 3CRTA 1XWAA 1OE8A 2UV8G 2WVXA 1MDJA 4DSQA 1GL8A 5ECOB 3BJ5A 4CY8A 1SENA 5INYA 2C8UA 4POBA 5A4VA 1JLWA 2XPEA 3F6DA 2GDRA 3U6VA 5LNKe 5G5FA 4BWSA 1XW9A 2O87A 1XVQA 2LV3A 2XBQA 1EV4A 1RW1A 1TRWA 3RFRC 1M2AA 1M3JA 4I8BA 2LQOA 3W6GA 1S4BP 4PNGA 1GUKA 1EGOA 4HQZA 4RI6A 3TGZA 5FT3A 1XWBA 2AYTA 3CBUA 3RPPA 3H79A 5FWGA 3TJKA 2YWOA 4OCEA 2VCXA 4BA7A 2LUSA 4NAXA 1EZKA 1F9MA 4K2XA 5F07A 3A2WA 4TR1A 2J23A 3FZ4A 4FQUA 7GSSA 1XW5A 1YEPA 1O6JA 1EP7A 1FHEA 5A5HA 4ACSA 3GIXA 1TOFA 1MD4A 5IMCA 2BMXA 1VF2A 20GSA 2O7KA 4GDFA 3GNJA 1OC9A 5J47A 5CAXA 2IL3A 3TKSE 4ZILA 3IBHA 2QKEA 3ZRDA 2PWJA 1VGLA 3APSA 1YKCA 10GSA 4WF5A 4KNDA 3NIVA 4IVFA 4ULXA 3EVIA 3FHKA 2H0HA 4GWRA 5IOXA 1F2EA 2WVXB 4LL1B 3GX0A 3ZYWA 4BL7A 2HQTA 2M80A 1TJDA 2PVOC 4BPYA 2JADA 3I9V2 5G2ZA 4F0CA 2IMDA 3KIJA 1H75A 3EPTA 2IMKA 2NTOA 1QFNA 1NW2A 2GSRA 1A8YA 2WFCA 5J9CA 4JBBA 4KA0A 2CT6A 1M3IA 3CSHA 2D2ZA 2XPDA 14GSA 4CHSA 1JZRA 2IIYA 2LTKA 4PI0C 2H70A 4PHZC 1TK8B 4G01A 4IELA 3TKQA 4O7HA 1LU4A 3C1RA 3VURA 1PA3A 5IPGA 3VWUA 5DDLA 5CRWA 5KEJA 5IIZA 4ZBDA 2H72A 3EWLA 3GRXA 3Q6OA 3F6FA 4PUFC 2FLSA 4HSCX 1YEXA 1GTUA 1PMTA 3HZ4A 1OKTA 4RQXA 2FWGA 3EYTA 5ID2B 4BVXA 4ID0A 2X8CA 4MA9A 4EL1A 1OC8A 1K0OA 1S3CA 3HVNA 3L9UA 5D9VA 2L4CA 3CWGA 5A5HB 1XOBA 4QL9A 2RUFA 4XS4B 4DEJA 3PPUA 1ABAA 1ACVA 5IPHA 3ED3A 1B9XC 1Y6EA 2H8LA 2LSTA 1OC9B 2V41A 4ZB6A 1JHBA 2DKHA 3ERFA 2FY6A 3F4RA 4Q5RA 5ABRA 4O32A 3M8NA 4POLA 2YCDA 3TOTA 1AC1A 2HSMB 4ZIJA 3GV1A 2OKAA 2ALBA 2EFDA 4AJ6A 4N10A 3IHQA 1MDIA 4HU9A 1N25A 3FYGA 5AISA 3F9UA 1IYIA 3O76A 2KP1A 4KE3A 2K9FA 1SU9A 2JU5A 2H6XA 1GSYA 1T4YA 2TRCP 5BRTA 3IOSA 2YWMA 1G7EA 3V1WA 1GTAA 4K8MA 4KX4A 3I43A 3TDGA 1UN2A 4L5OA 2VLTA 2I9HA 3LJRA 3I6AA 2PERA 1GLPA 4OFMA 1XBSA 1TKDB 3TJGA 2WB9A 2CVBA 2MZCA 3PINA 1SVLA 4KW6A 1ZMAA 3HVSA 4HEA2 3U5RE 4JE1A 3HJOA 4F2IA 3ME7A 3VWWA 3DKSA 3ZL5A 1FAAA 2X8HA 5H5SA 5J9BA 4JU5A 3D0ZA 1YQ1A 4OFNA 2LJKA 1M7TA 2PGTA 2VIMA 2AV4A 2RLIA 3HA9A 5KOWA 5D9XA 1ZYPA 3BCKA 2PU9C 5BMUA 2KHPA 4OCFA 4ECJA 6GSVA 2WS2A 3HVVA 1M99A 1TTZA 1XWKA 2IMFA 4K7OA 6GSSA 5CREA 1HYUA 1K3OA 1W89A 5LCZA 1M9BA 1U6TA 4AKIA 2N5AA 3L78A 2FWFA 4I97A 2BTOT 1U88A 2CA8A 1XWGA 4WBRD 3DRNA 1Y25A 5IM9A 4EKZA 3GSSA 2JZSA 1VRSD 2L57A 3OR5A 1GH2A 2R2JA 4DSRA 1VF1A 3BCIA 2GVPA 2GZPA 1TDIA 4LLRA 3GTUA 4ZB8A 3TRXA 4XS1A 5J4UA 4GLTA 1PQNA 4MF7A 4OD7A 2LRCA 3FKFA 4YH2A 2P5QA 4KB3A 1TXXA 1X9WB 2MMZA 3IDVA 5KOXA 2TRXA 1K0DA 1PD21 5ECLB 3FR9A 3SWLA 2OA7A 1SL0B 2N5BA 2YWIA 1GSEA 4RI7A 2AB6A 3TJJA 4TXVA 5EY6A 5GAPD 3A2XA 4FYCA 2EIQA 3KJYA 4MCUA 1XIYA 3KH7A 3VFIA 4A5PA 3BD2A 3GURA 3F3RA 3HVXA 3Q18A 4TKYA 3HDCA 3FY7A 5IO0A 4IN0A 4WR5A 4OFTA 4E8HA 1A8LA 3D22A 5J40A 5EVOA 3VPQA 3WT1A 4E8EA 5COHA 4GCIA 3EINA 2YJHA 1AW9A 1FO5A 3BBYA 3HKRA 5H5RA 5H5QA 3TJFA 1N8JA 4Z7XA 3QD9A 2VOCA 4G0IA 2QC7A 4KDUA 1TP9A 1SL1B 1BF5A 4GXZA 4ISDA 5BMUB 2VO4A 2A2SA 4KDYA 4KSMA 2H1LA 5HR0A 1WPIA 4GSSA 2KP2A 3KXOA 3TJBA 1BQ7A 1YEWC 4MABA 4L5LA 5DALB 1SD8A 4G0LA 5IMZA 1WE0A 5AIVA 2HZEA 1XG8A 3F0IA 2CV4A 2WGRA 3KEBA 1GNWA 1AXDA 4JZQA 1PRXA 5GSSA 5LD0A 1EGRA 4PGTA 2NVLA 2I81A 2LRNA 3QCPA 2N5FA 3GTUB 2O36A 2LJRA 1YZXA 4CW9A 2ES7A 2AAWA 2TIRA 2H73A 5G5EA 3TKRA 4GQFA 1HNAA 2EFEA 4MPGA 3ZITA 2B6MA 2I1UA 1E6BA 2B1LA 4KCAA 4KH7A 3ERGA 5F8BA 3UMAA 2P0GA 1EEJA 3GUSA 1GTIA 1OC3A 4O5RA 3VPTA 2VCQA 2VL2C 1GSUA 4MDCA 3FW2A 4K5SA 1Z9HA 1XW6A 1A2LA 4YKGA 3GKKA 2DMLA 4TN8A 4MJEA 1F37A 2A4HA 2B5YA 3D5JA 3GH9A 3R3EA 2HNLA 4K7IA 2V2GA 2R0CA 3GL5A 1HQOA 2REMA 3HMJG 4RQRA 3UARA 3CSJA 2C3QA 2XHFA 1ZYEA 1RK4A 4XTSA 3LYKA 2HI7A 3L0HA 2MBTA 3F4TA 3EE2A 4KDXA 5A4WA 4HZ2A 1K3LA 3QAVA 3JCML 1Z3EA 1X5CA 4K9ZA 1WJKA 2H6ZA 5IO2A 4EO3A 3O6TA 3IHGA 2HSNA 5IMVA 4K2DA 1QMVA 1E2YA 2H0GA 1BG1A 2O85A 4X1UA 3IE3A 4KGIA 4D73B 4HJMA 1MTCA 1TU8A 1I9DA 1PN0A 2HZEB 6GSUA 5ELAA 2ZNMA 2H1DA 2CZ3A 1QUWA 2OBIA 1YF0A 5G1KA 3KM6A 1KEBA 5C00A 3MSZA 3ZFBA 2JSZA 3QAGA 5B6NA 2CVDA 2G0FA 4AKGA 5B7CA 3F3QA 1A0RP 4NMUA 4W66A 2B1KA 5ID2A 1SK1A 4FH8A 5J41A 3UOMA 2F9SA 3DYRA 4NHZA 1PFOA 3HZ8A 1AUCA 4XS4A 4EIQA 2L5LA 3QFBC 1EV9A 3GMFA 1M9AA 3FZ5A 4CY6A 2FA8A 4K0GA 2PPTA 4F9ZA 5IMDA 4TOPA 3UAPA 5JCWA 4OO5A 3TRQA 4XHMA 3DWVA 1GUHA 2HSMA 1TK5B 4MH3A 4ILFA 1WWJA 4EE0A 2MMOA 5IMAA 2DJ0A 3ZFLA 2CVKA 4Q5FA 1OVNA 4L0WA 2MBSA 3L4NA 2B7KA 5C04A 1OYJA 2FUG2 4Z2TA 1TW9A 2H6YA 4V1Ap 2WZSA 5KN0A 1GSFA 5CRHA 4X43A 4JR4A 3KMNA 2H71A 3E9JB 4MZCA 5D96A 4AF2A 1ZCPA 4TR0A 2HSNB 1SKWB 1NHYA 1EOHA 1GNEA 4GRFA 2WRTA 2YP6A 1SJZA 3LEFA 2GT5A 4O5UA 1IYHA 3E3EA 1HNBA 3GSTA 2K8SA 3HXSA 1GULA 1XZOA 4ZBAA 1W4VA 2DBCA 1DE1A 1M0UA 2E2GA 1GUMA 19GSA 1QXHA 3WD6A 1MDKA 5KN1A 3DEXA 2EIRA 4PTSA 4WF4A 3LQ7A 4NHWA 1DSBA 3M1GA 2WW1A 5HFKA 2ZUPA 3KD0A 2VLVA 11GSA 3UL3A 1T7PB 2I3YA 2DJ3A 2JZTA 3IC8A 5DAKA 1N2AA 2GTUA 2IWTA 5J4YA 3GKMA 2GZYA 3GFKA 3VI7A 1DBYA 1KNGA 3CYNA 5DQYA 2JZRA 2H1AA 2QSIA 3AY8A 2R4VA 4KF9A 2HT9A 4V2NA 1THOA 1XVWA 1T4ZA 1BEDA 3S9FA 1B4PA 3LGCA 3IC4A 3NZNA 4PQ1A 6GSYA 1A2MA 2FD3A 1G6WA 3MYDA 1K0NA 3A5IA 4ICYA 1YF1A 1EP8A 1HNCA 5ECIB 4TR3A 5HFIA 4LMWA 2F51A 2H1BA 17GSA 1B8XA 4LL4B 2WVZA 4IQAA 5L71A 4KUNA 2WW2A 4N0ZA 5IQYA 1C72A 2MMAA 2C1YA 4XCSA 2KOKA 4PX1A 3GKXA 4ZXGA 5G30A 2WW0A 1PL1A 2G2QA 1GRXA 1X0RA 3F4SA 5CNWA 1SVOA 1SL2B 3IR4A 2C0DA 3TKSA 2DJ2A 1I5GA 3PGTA 4NV2A 4XIHA 3QR6A 4XRDA 2GSQA 4KAEA 4MLYA 2LJAA 3FEUA 2LS5A 1XPVA 3ZTLA 1UVZA 4G2EA 3A5WA 4IW9A 5D9WA 1OKDA 4AKXB 1XXUA 2DJJA 3F8UA 4V2MA 3P8WA 2H66A 1AAZA 4N30A 4NV5A 6GSXA 4KSOA 2AJQB 1SKRB 2VCWA 1R4WA 4MNNA 4JR6A 5DAKB 4MJAA 3RPNA 2PUKC 2HXKA 1NHOA 4QMKA 2L59A 5A5KA 3CMIA 1G7OA 3HY2A 2OADA 2YANA 4PQIA 5DALA 1GLQA 1PGTA 4MP4A 2AUVA 2IFQA 5D93A 3ZZXA 2RM5A 1K0AA 4GF0A 5HR2A 3TRPA 4GQCA 2VCZA 3LXZA 1AQVA 1K0BA 2VAFA 2DJKA 1ZZYA 2RIIA 4F82A 3ERWA 4IJ3A 4JRRA 4FYUA 2EC4A 4LMVA 3VLNA 4J56E 4WXTA 3SBCA 9GSSA 1V58A 2V32A 3IA1A 3KCMA 1Z7PA 1SYXA 4RUVA 4AJ8A 1Z6MA 3H1NA 5HR1A 1O85A 3A2VA 1EEMA 1TXUA 1X5DA 5DJMA 3DMLA 3J7Yb 4LA1A 2OT3A 1QQ2A 4MZBA 5J4VA 2RUEA 3ZMLA 3LFLA 3G7YA 4I2TA 2WW3A 3WGXA 4GSNA 3W8JA 3VI5A 1BAYA 3R2QA 1Q4JA 5J5NA 1EWXA 3HYPA 1R7HA 2VLUA 2B7JA 4ZL7A 1WRYA 3ISOA 1YKAA 3FR3A 1Z6NA 2X4AA 4MH2A 4N11A 3WYWA 3M3MA 3GA4A 2WVYA 4POMA 3TU3B 2FCHA 2YZHA 5GZZB 4YQMA 2L6DA 3WT2A 5A1NA 18GSA 2OJLA 2M46A 3LW9A 2R0PA 2O89A 1F3AA 4PQHA 3EMPA 2ON5A 3FZAA 4X0XA 4CDOA 3UVHA 4EXJA 3F63A 1PSQA 1U87A 1KTEA 2IFQB 4D73A 2WULA 2E2MA 3Q74A 2H76A 3IK7A 2VUPA 1Z5YE 5AGYA 3W8SA 4PNFA 3KMOA 4N3ZA 1J08A 2GQMA 3P2AA 4G0KA 4BWQA 4ZBBA 3KGKA 5ECNB 3TB2A 3CHXC 4G10A 4V2LA 3DGQA 2YNXA 3RGBC 4USSA 1URMA 3CSIA 3HJPA 3HD5A 1WP0A 1BYEA 2CX3A 2K8VA 1MEKA 1DUGA 1V57A 2C4JA 5A34A 4ML6A 2YOIA 2GS3A 4OWYA 4I6XA 3CRUA 5AN1A 1QGVA 2OE0A 1USBA 1PKWA 2WZ9A 2JACA 1NSWA 2FWHA 3MIXA 2FNOA 2HRAA 1CQGA 3IV4A 1TRVA 5HR3A 1J0FA 3CTFA 1JLVA 3RBTA 1O73A 3QMXA 2V6OA 3P7XA 1ZGNA 1MD3A 4PI2C 1WOUA 5GAND 1JZOA 1Q98A 3LORA 2YV7A 3IRAA 1OE7A 2KUCA 3TKPA 4FIWA 4YQUA 2HZFA 3MAKA 1ZOFA 4IP1A 4DSSA 2OE1A 4WEYA 1ERWA 1VF3A 1TRSA 3APQA 2FGXA 3ME8A 3APOA 4F0BA 4G9HA 2C0FA 5AIXA 2F8FA 5A1NB 1B4QA 3C71A 2O5VA 1FB0A 3UEMA 2MYGA 1AQWA 4K7NA 2HLSA 1SJ6A 4PXOA 4ECBA 3PH9A 2GSTA 2LNSA 4EDYA 1XCCA 1B48A 3C1SA 3ZIVA 5ECRB 4AI6A 4ECIA 2OBKA 3IXRA 4WBJA 3DIEA 4Z2UA 12GSA 1AQXA 2C80A 2GZZA 4MPFA 3LG6A 4QL7A 2HSHA 3D4MA 5A34B 1YDKA 5B8BA 3RHBA 3MDKA 2C0EA 1G6YA 1PX7A 5KN2A 4MK3A 2F3MA 4MF6A 1J9BA 1ST9A 2AHEA 5JCUA 5J3RA 2L5OA 3K8NA 4HOJA 4ZB7A 4K1FA 3GH6A 2OACA 5CO3A 3QFAC 2B3SA 2RM6A 3EURA 2JL4A 2DLXA 2YZUA 4KCEA 3ZREA 1A24A 5ENUA 2X8GA 1WIKA 2LEGA 2PVQA 3H93A 1EOGA 5A4UA 4K5RA 4YAVA 2VCVA 5ECMB 1ZYQB 3UIWA 3M9KA 4ZL9A 2DIZA 5DBQA 3RAZA 4X4JA 1OAZA 1YY7A 4DSSB 2V6KA 4EF0A 3GN3A 1M2BA 3DD3A 2HE3A 5E59A 2ZCTA 4HUAA 1X9MB 5F0GA 5CP1A 2FWEA 2IPAA 1RQMA 4EUYA 2KLXA 2X49A 5GSTA 3MWHA 1KBNA 4BIKA 2QA1A 3WGEA 22GSA 3G7IA 3RDWA 5F05A 2FA4A 2IMIA 3RHCA 1ERUA 3A3TA 1ERVA 1V40A 4WETA 3DVXA 2H0IA 4IQ1A 3EMXA 5ECQB 2LKUA 1ILOA 1FVKA 1A23A 2L4QA 5DCHA 2OE3A 3KH9A 2HRKA 1V9WA 3DVWA 1PN9A 2LRTA 2JSYA 1V98A 2CX4A 2NDOA 5D8IA 1TRUA 3C7MA 5CRDA 5IOWA 1T1VA 1WMJA 5EPFA 3LXTA 4MJCA 1FVJA 1XOAA 1LBKA 1LJRA 4H86A 1SD9A 4ZL8A 1SVMA 4FXYP 5FHIA 4ECCA 2L6CA 3QAWA 4HS1A 4TR1B 1YJ6A 4IBPA 3TCOA 5E4WA 3FZ9A 1TK0B 4TW5A 1S3RA 2J9HA 4GSTA 5F06A 3C73A 1O8WA 3FR6A 2DKIA 1O7UA 4Q5NA 1X5EA 2NBSA 1T8EB 3IK9A 3E0UA 2UZ8A 4TRXA 4AGSA 2HYXA 1GSQA 1S3AA 1A0FA 1UC7A 1FB6A 3L9VA 1AIUA 1VF4A 1Y1UA 1A2JA 2I4AA 3GKNA 1CQHA 2PMTA 5KN3A 3BOAA 3KZQA 1GP1A 1SYRA 2YPMA 16GSA 2IN3A 4IJIA 2R3XA 3DXBA 1S3DA 3NOFA 4HQSA 4YQVA 2O3EA 2X99A 3QDNA 3EU3A 4NXIA 1GWCA 2WDUA 2GQLA 1SK0A 2IJYA 3TUEA 2H30A 3IAM2 2DIYA 1JFUA 4BL7B 1TI3A 2PBJA 4JEDA 2CAQA 3D4TA 2O8VB 2IMEA 2GGTA 2YJ7A 4IHUA 1R5AA 3VWVA 5ELGA 3HHVA 4I5QA 3Q19A 2CAIA 1B9YC 5ECHB 1FG4A 2V1MA 2GT6A 3N5OA 1PKZA 5ECKB 8GSSA 2DMMA 1H4OA 2K18A 3EU4A 5JWRB 3C8EA 2R0GA 4QQ7A 1BJXA 3GX8A 2HRKB 2R37A 3UJ1A 2WJUA 3H8QA 4GTUA 4IP6A 5CYYA 4HJ2A 3D6IA 3EC3A 2VCTA 2P5RA 4Z2RA 2GQKA 2C3NA 1O8XA 3QPMA 3TOUA 3ZMKA 3KTLA 1FW1A 2BJXA 4OO4A 1T00A 4WR4A 2VM1A 4BVXB 2H75A 4DVCA 2ON7A 6GSWA 1ML6A 1ZYNA 2B5EA 2VL3A 1SJIA 4O5QA 1BG5A 1ERTA 2VD0A 3J7Yk 4EVMA 4TVEA 13GSA 2H01A 1XFLA 2A4VA 2YV9A 4Q5QA 2PN8A 4N0VA 3ZLPA 2YN1A 1GSSA 2GSSA 4K0NA 4K6XA 4O92A 2VL2A 2LQQA 2QGVA 5ECSA 3G7JA 5DJLA 3ZIJA 1BX9A 4MJBA 2NPBA 1PL2A 5B6MA 2C3TA 5EL8A 2R5GA 2HFDA 3IAS2 2M72A 3VK9A 2CQ9A 1UA5A 2K6VA 2DC5A 2X64A 3VWXA 2LNTA 2C0GA 4V1Ag 1TI1A 4TR4A 1F3BA 3GYKA 2EFCA 4BVYA 4MZWA 4IKHA 2H1GA 5DQSA 4J57E 4HDEA 3QOUA 2FHEA 2XBIA 3M9JA 2YWNA 2MMNA 4FO5A 1TU7A 3UVTA 2H19A 2CZ2A 3CTGA 2WCIA 4TXOA 2VL9A 1DE2A 1SKSB 2XC2A 5B8AA 4NPBA 2E0QA 4ZB9A 1SK2A 4MF5A 3N9JA 4MMMA 4F03A 4L0UA 5ECPB 4WKWA 1GSDA 3LSZA 5JWQB 1O81A 3CXGA 1YVLA 5IMFA 2E7PA 5HFGA 3FRCA 3UBLA 4I2UA 1GTBA 3TKSC 4EDZA 3HCZA 1HD2A 2VKZG 3IPZA 2EIOA 4L8EA 3M0FA 2HRNA 1QK8A 4FYBA 4P3YB 3ZVJD 1PX6A 1FOVA 2QA2A 2F8AA 5JWOB 1R26A 4HU7A 2DSAA 3KTBA 4J2FA 2R6KA 1U3AA 2VD1A 2DJ1A 3P90A 4IS0A 3KP9A 4YKFA 1G0TA 1THXA 1R5PA 4HZ4A 1JZWA
chains in the Genus database with same CATH topology
5G31A 4E68A 3H4KA 2B5XA 4AJ7A 4ML1A 3KP8A 1FOHA 2GLRA 5JCGA 3FK8A 1M2DA 4NWYA 1K0MA 3G9BA 4PURA 5D73A 1NM3A 1JZDA 1F6MC 2EFHA 4IGJA 4YAPA 3PR8A 1X9SB 1U3IA 4XS6A 2HRFA 3US3A 4POKA 2A2RA 2A2PA 3HJMA 4OMVA 6GSTA 2Z9SA 1ZL9A 4BVYB 4EIPA 3GHAA 1K0CA 3GL3A 3UBKA 3LWAA 3MNGA 3ZVJA 1T3BA 3FMWA 3LYPA 2H74A 3O3TA 4EC0A 5HQPA 5DVBA 5CRGA 3L9SA 2VM2A 4AKHA 1K3YA 5D9TA 2HSYA 4TXOB 1V2AA 1ON4A 1Z7RA 4G19A 3WGDA 5G1LA 3D21A 3I69A 4XRAA 4PUAA 1XWCA 4HI7A 5DCGA 2P31A 3CRTA 1XWAA 1OE8A 2UV8G 1MDJA 4DSQA 1GL8A 5ECOB 3BJ5A 4CY8A 1SENA 5INYA 2C8UA 4POBA 5A4VA 1JLWA 2XPEA 3F6DA 2GDRA 3U6VA 5LNKe 5G5FA 4BWSA 1XW9A 2O87A 1XVQA 2LV3A 2XBQA 1EV4A 1RW1A 1TRWA 1M2AA 4I8BA 2LQOA 3W6GA 4PNGA 1GUKA 1EGOA 4HQZA 4RI6A 3TGZA 5FT3A 1XWBA 2AYTA 3CBUA 3RPPA 3H79A 5FWGA 3TJKA 2YWOA 4OCEA 2VCXA 4BA7A 2LUSA 4NAXA 1EZKA 1F9MA 4K2XA 5F07A 3A2WA 4TR1A 2J23A 3FZ4A 4FQUA 7GSSA 1XW5A 1YEPA 1O6JA 1EP7A 1FHEA 5A5HA 4ACSA 3GIXA 1TOFA 1MD4A 5IMCA 2BMXA 1VF2A 20GSA 2O7KA 4GDFA 3GNJA 1OC9A 5J47A 5CAXA 2IL3A 3TKSE 4ZILA 3IBHA 2QKEA 3ZRDA 2PWJA 1VGLA 3APSA 1YKCA 10GSA 4WF5A 4KNDA 3NIVA 4IVFA 4ULXA 3EVIA 3FHKA 2H0HA 4GWRA 5IOXA 1F2EA 4LL1B 3GX0A 3ZYWA 4BL7A 2HQTA 2M80A 1TJDA 2PVOC 4BPYA 2JADA 3I9V2 5G2ZA 4F0CA 2IMDA 3KIJA 1H75A 3EPTA 2IMKA 2NTOA 1QFNA 1NW2A 2GSRA 1A8YA 2WFCA 5J9CA 4JBBA 4KA0A 2CT6A 3CSHA 2D2ZA 2XPDA 14GSA 4CHSA 1JZRA 2IIYA 2LTKA 2H70A 1TK8B 4G01A 4IELA 3TKQA 4O7HA 1LU4A 3C1RA 3VURA 1PA3A 5IPGA 3VWUA 5DDLA 5CRWA 5KEJA 5IIZA 4ZBDA 2H72A 3EWLA 3GRXA 3Q6OA 3F6FA 4PUFC 2FLSA 1YEXA 1GTUA 1PMTA 3HZ4A 1OKTA 4RQXA 2FWGA 3EYTA 5ID2B 4BVXA 4ID0A 2X8CA 4MA9A 4EL1A 1OC8A 1K0OA 1S3CA 3L9UA 5D9VA 2L4CA 3CWGA 5A5HB 1XOBA 4QL9A 2RUFA 4XS4B 4DEJA 3PPUA 1ABAA 1ACVA 5IPHA 3ED3A 1B9XC 1Y6EA 2H8LA 2LSTA 1OC9B 2V41A 4ZB6A 1JHBA 2DKHA 3ERFA 2FY6A 3F4RA 4Q5RA 5ABRA 4O32A 3M8NA 4POLA 2YCDA 3TOTA 1AC1A 2HSMB 4ZIJA 3GV1A 2OKAA 2ALBA 2EFDA 4AJ6A 4N10A 3IHQA 1MDIA 4HU9A 1N25A 3FYGA 5AISA 3F9UA 1IYIA 3O76A 2KP1A 4KE3A 2K9FA 1SU9A 2JU5A 2H6XA 1GSYA 1T4YA 2TRCP 5BRTA 3IOSA 2YWMA 1G7EA 3V1WA 1GTAA 4K8MA 4KX4A 3I43A 3TDGA 1UN2A 4L5OA 2VLTA 2I9HA 3LJRA 3I6AA 2PERA 1GLPA 4OFMA 1XBSA 1TKDB 3TJGA 2WB9A 2CVBA 2MZCA 3PINA 1SVLA 4KW6A 1ZMAA 3HVSA 4HEA2 3U5RE 4JE1A 3HJOA 4F2IA 3ME7A 3VWWA 3DKSA 3ZL5A 1FAAA 2X8HA 5H5SA 5J9BA 4JU5A 3D0ZA 1YQ1A 4OFNA 2LJKA 1M7TA 2PGTA 2VIMA 2AV4A 2RLIA 3HA9A 5KOWA 5D9XA 1ZYPA 3BCKA 2PU9C 5BMUA 2KHPA 4OCFA 4ECJA 6GSVA 2WS2A 3HVVA 1M99A 1TTZA 1XWKA 2IMFA 4K7OA 6GSSA 5CREA 1HYUA 1K3OA 1W89A 5LCZA 1M9BA 1U6TA 4AKIA 2N5AA 3L78A 2FWFA 4I97A 2BTOT 1U88A 2CA8A 1XWGA 4WBRD 3DRNA 1Y25A 5IM9A 4EKZA 3GSSA 2JZSA 1VRSD 2L57A 3OR5A 1GH2A 2R2JA 4DSRA 1VF1A 3BCIA 2GVPA 2GZPA 1TDIA 4LLRA 3GTUA 4ZB8A 3TRXA 4XS1A 5J4UA 4GLTA 1PQNA 4MF7A 4OD7A 2LRCA 3FKFA 4YH2A 2P5QA 4KB3A 1TXXA 1X9WB 2MMZA 3IDVA 5KOXA 2TRXA 1K0DA 1PD21 5ECLB 3FR9A 3SWLA 2OA7A 1SL0B 2N5BA 2YWIA 1GSEA 4RI7A 2AB6A 3TJJA 4TXVA 5EY6A 5GAPD 3A2XA 4FYCA 2EIQA 3KJYA 4MCUA 1XIYA 3KH7A 3VFIA 4A5PA 3BD2A 3GURA 3F3RA 3HVXA 3Q18A 4TKYA 3HDCA 3FY7A 5IO0A 4IN0A 4WR5A 4OFTA 4E8HA 1A8LA 3D22A 5J40A 5EVOA 3VPQA 3WT1A 4E8EA 5COHA 4GCIA 3EINA 2YJHA 1AW9A 1FO5A 3BBYA 3HKRA 5H5RA 5H5QA 3TJFA 1N8JA 4Z7XA 3QD9A 2VOCA 4G0IA 2QC7A 4KDUA 1TP9A 1SL1B 1BF5A 4GXZA 4ISDA 5BMUB 2VO4A 2A2SA 4KDYA 4KSMA 2H1LA 5HR0A 1WPIA 4GSSA 2KP2A 3KXOA 3TJBA 1BQ7A 4MABA 4L5LA 5DALB 1SD8A 4G0LA 5IMZA 1WE0A 5AIVA 2HZEA 3F0IA 2CV4A 2WGRA 3KEBA 1GNWA 1AXDA 4JZQA 1PRXA 5GSSA 5LD0A 1EGRA 4PGTA 2NVLA 2I81A 2LRNA 3QCPA 2N5FA 3GTUB 2LJRA 1YZXA 4CW9A 2ES7A 2AAWA 2TIRA 2H73A 5G5EA 3TKRA 4GQFA 1HNAA 2EFEA 4MPGA 3ZITA 2B6MA 2I1UA 1E6BA 2B1LA 4KCAA 4KH7A 3ERGA 5F8BA 3UMAA 2P0GA 1EEJA 3GUSA 1GTIA 1OC3A 4O5RA 3VPTA 2VCQA 2VL2C 1GSUA 4MDCA 3FW2A 4K5SA 1Z9HA 1XW6A 1A2LA 4YKGA 3GKKA 2DMLA 4TN8A 4MJEA 1F37A 2A4HA 2B5YA 3D5JA 3GH9A 3R3EA 2HNLA 4K7IA 2V2GA 2R0CA 3GL5A 1HQOA 2REMA 3HMJG 4RQRA 3UARA 3CSJA 2C3QA 2XHFA 1ZYEA 1RK4A 4XTSA 3LYKA 2HI7A 3L0HA 2MBTA 3EE2A 4KDXA 3F4TA 5A4WA 4HZ2A 1K3LA 3QAVA 3JCML 1Z3EA 1X5CA 4K9ZA 1WJKA 2H6ZA 5IO2A 4EO3A 3O6TA 3IHGA 2HSNA 5IMVA 4K2DA 1QMVA 1E2YA 2H0GA 1BG1A 2O85A 4X1UA 3IE3A 4KGIA 4D73B 4HJMA 1MTCA 1TU8A 1I9DA 1PN0A 2HZEB 6GSUA 5ELAA 2ZNMA 2H1DA 2CZ3A 1QUWA 2OBIA 1YF0A 5G1KA 3KM6A 1KEBA 5C00A 3MSZA 3ZFBA 2JSZA 3QAGA 5B6NA 2CVDA 2G0FA 4AKGA 5B7CA 3F3QA 1A0RP 4NMUA 4W66A 2B1KA 5ID2A 1SK1A 4FH8A 5J41A 3UOMA 2F9SA 3DYRA 4NHZA 3HZ8A 1AUCA 4XS4A 4EIQA 2L5LA 3QFBC 1EV9A 3GMFA 1M9AA 3FZ5A 4CY6A 2FA8A 4K0GA 2PPTA 4F9ZA 5IMDA 4TOPA 3UAPA 5JCWA 4OO5A 3TRQA 4XHMA 3DWVA 1GUHA 2HSMA 1TK5B 4MH3A 4ILFA 1WWJA 4EE0A 2MMOA 5IMAA 2DJ0A 3ZFLA 2CVKA 4Q5FA 1OVNA 4L0WA 2MBSA 3L4NA 2B7KA 5C04A 1OYJA 2FUG2 4Z2TA 1TW9A 2H6YA 4V1Ap 5KN0A 1GSFA 5CRHA 4X43A 4JR4A 3KMNA 2H71A 3E9JB 4MZCA 5D96A 4AF2A 1ZCPA 4TR0A 2HSNB 1SKWB 1NHYA 1EOHA 1GNEA 4GRFA 2WRTA 2YP6A 1SJZA 3LEFA 2GT5A 4O5UA 1IYHA 3E3EA 1HNBA 3GSTA 2K8SA 3HXSA 1GULA 1XZOA 4ZBAA 1W4VA 2DBCA 1DE1A 1M0UA 2E2GA 1GUMA 19GSA 1QXHA 3WD6A 1MDKA 5KN1A 3DEXA 2EIRA 4PTSA 4WF4A 3LQ7A 4NHWA 1DSBA 3M1GA 5HFKA 2ZUPA 3KD0A 2VLVA 11GSA 3UL3A 1T7PB 2I3YA 2DJ3A 2JZTA 3IC8A 5DAKA 1N2AA 2GTUA 2IWTA 5J4YA 3GKMA 2GZYA 3GFKA 3VI7A 1DBYA 1KNGA 3CYNA 5DQYA 2JZRA 2H1AA 2QSIA 3AY8A 2R4VA 4KF9A 2HT9A 4V2NA 1THOA 1XVWA 1T4ZA 1BEDA 3S9FA 1B4PA 3LGCA 3IC4A 3NZNA 4PQ1A 6GSYA 1A2MA 2FD3A 1G6WA 3MYDA 1K0NA 3A5IA 4ICYA 1YF1A 1EP8A 1HNCA 5ECIB 4TR3A 5HFIA 4LMWA 2F51A 2H1BA 17GSA 1B8XA 4LL4B 4IQAA 5L71A 4KUNA 4N0ZA 5IQYA 1C72A 2MMAA 2C1YA 4XCSA 2KOKA 4PX1A 3GKXA 4ZXGA 5G30A 1PL1A 2G2QA 1GRXA 1X0RA 3F4SA 5CNWA 1SVOA 1SL2B 3IR4A 2C0DA 3TKSA 2DJ2A 1I5GA 3PGTA 4NV2A 4XIHA 3QR6A 4XRDA 2GSQA 4KAEA 4MLYA 2LJAA 3FEUA 2LS5A 1XPVA 3ZTLA 1UVZA 4G2EA 3A5WA 4IW9A 5D9WA 1OKDA 4AKXB 1XXUA 2DJJA 3F8UA 4V2MA 3P8WA 2H66A 1AAZA 4N30A 4NV5A 6GSXA 4KSOA 2AJQB 1SKRB 2VCWA 1R4WA 4MNNA 4JR6A 5DAKB 4MJAA 3RPNA 2PUKC 2HXKA 1NHOA 4QMKA 2L59A 5A5KA 3CMIA 1G7OA 3HY2A 2OADA 2YANA 4PQIA 5DALA 1GLQA 1PGTA 4MP4A 2AUVA 2IFQA 5D93A 3ZZXA 2RM5A 1K0AA 4GF0A 5HR2A 3TRPA 4GQCA 2VCZA 3LXZA 1AQVA 1K0BA 2VAFA 2DJKA 1ZZYA 2RIIA 4F82A 3ERWA 4IJ3A 4JRRA 4FYUA 2EC4A 4LMVA 3VLNA 4J56E 4WXTA 3SBCA 9GSSA 1V58A 2V32A 3IA1A 3KCMA 1Z7PA 1SYXA 4RUVA 4AJ8A 1Z6MA 3H1NA 5HR1A 1O85A 3A2VA 1EEMA 1TXUA 1X5DA 5DJMA 3DMLA 3J7Yb 4LA1A 2OT3A 1QQ2A 4MZBA 5J4VA 2RUEA 3ZMLA 3LFLA 3G7YA 4I2TA 3WGXA 4GSNA 3W8JA 3VI5A 1BAYA 3R2QA 1Q4JA 5J5NA 1EWXA 3HYPA 1R7HA 2VLUA 2B7JA 4ZL7A 1WRYA 3ISOA 1YKAA 3FR3A 1Z6NA 2X4AA 4MH2A 4N11A 3WYWA 3M3MA 3GA4A 4POMA 3TU3B 2FCHA 2YZHA 5GZZB 4YQMA 2L6DA 3WT2A 5A1NA 18GSA 2OJLA 2M46A 3LW9A 2R0PA 2O89A 1F3AA 4PQHA 3EMPA 2ON5A 3FZAA 4X0XA 4CDOA 3UVHA 4EXJA 3F63A 1PSQA 1U87A 1KTEA 2IFQB 4D73A 2WULA 2E2MA 3Q74A 2H76A 3IK7A 2VUPA 1Z5YE 5AGYA 3W8SA 4PNFA 3KMOA 4N3ZA 1J08A 2GQMA 3P2AA 4G0KA 4BWQA 4ZBBA 3KGKA 5ECNB 3TB2A 4G10A 4V2LA 3DGQA 2YNXA 1URMA 4USSA 3CSIA 3HJPA 3HD5A 1WP0A 1BYEA 2CX3A 2K8VA 1MEKA 1DUGA 1V57A 2C4JA 5A34A 4ML6A 2YOIA 2GS3A 4OWYA 4I6XA 3CRUA 5AN1A 1QGVA 2OE0A 1USBA 1PKWA 2WZ9A 2JACA 1NSWA 2FWHA 3MIXA 2FNOA 2HRAA 1CQGA 3IV4A 1TRVA 5HR3A 1J0FA 3CTFA 1JLVA 3RBTA 1O73A 3QMXA 2V6OA 3P7XA 1ZGNA 1MD3A 1WOUA 5GAND 1JZOA 1Q98A 3LORA 2YV7A 3IRAA 1OE7A 2KUCA 3TKPA 4FIWA 4YQUA 2HZFA 3MAKA 1ZOFA 4IP1A 4DSSA 2OE1A 4WEYA 1ERWA 1VF3A 1TRSA 3APQA 2FGXA 3ME8A 3APOA 4F0BA 4G9HA 2C0FA 5AIXA 2F8FA 5A1NB 1B4QA 3C71A 2O5VA 1FB0A 3UEMA 2MYGA 1AQWA 4K7NA 2HLSA 1SJ6A 4PXOA 4ECBA 3PH9A 2GSTA 2LNSA 4EDYA 1XCCA 1B48A 3C1SA 3ZIVA 5ECRB 4AI6A 4ECIA 2OBKA 3IXRA 4WBJA 3DIEA 4Z2UA 12GSA 1AQXA 2C80A 2GZZA 4MPFA 3LG6A 4QL7A 2HSHA 3D4MA 5A34B 1YDKA 5B8BA 3RHBA 3MDKA 2C0EA 1G6YA 1PX7A 5KN2A 4MK3A 2F3MA 4MF6A 1J9BA 1ST9A 2AHEA 5JCUA 5J3RA 2L5OA 3K8NA 4HOJA 4ZB7A 4K1FA 3GH6A 2OACA 5CO3A 3QFAC 2B3SA 2RM6A 3EURA 2JL4A 2DLXA 2YZUA 4KCEA 3ZREA 1A24A 5ENUA 2X8GA 1WIKA 2LEGA 2PVQA 3H93A 1EOGA 5A4UA 4K5RA 4YAVA 2VCVA 5ECMB 1ZYQB 3UIWA 3M9KA 4ZL9A 2DIZA 5DBQA 3RAZA 4X4JA 1OAZA 1YY7A 4DSSB 2V6KA 4EF0A 3GN3A 1M2BA 3DD3A 2HE3A 5E59A 2ZCTA 4HUAA 1X9MB 5F0GA 5CP1A 2FWEA 2IPAA 1RQMA 4EUYA 2KLXA 2X49A 5GSTA 3MWHA 1KBNA 2QA1A 3WGEA 22GSA 3G7IA 3RDWA 5F05A 2FA4A 2IMIA 3RHCA 1ERUA 3A3TA 1ERVA 1V40A 4WETA 3DVXA 2H0IA 4IQ1A 3EMXA 5ECQB 2LKUA 1ILOA 1FVKA 1A23A 2L4QA 5DCHA 2OE3A 3KH9A 2HRKA 1V9WA 3DVWA 1PN9A 2LRTA 2JSYA 1V98A 2CX4A 2NDOA 5D8IA 1TRUA 3C7MA 5CRDA 5IOWA 1T1VA 1WMJA 5EPFA 3LXTA 4MJCA 1FVJA 1XOAA 1LBKA 1LJRA 4H86A 1SD9A 4ZL8A 1SVMA 5FHIA 4ECCA 2L6CA 3QAWA 4HS1A 4TR1B 1YJ6A 4IBPA 3TCOA 5E4WA 3FZ9A 1TK0B 4TW5A 2J9HA 4GSTA 5F06A 3C73A 1O8WA 3FR6A 2DKIA 1O7UA 4Q5NA 1X5EA 2NBSA 1T8EB 3IK9A 3E0UA 2UZ8A 4TRXA 4AGSA 2HYXA 1GSQA 1S3AA 1A0FA 1UC7A 1FB6A 3L9VA 1AIUA 1VF4A 1Y1UA 1A2JA 2I4AA 3GKNA 1CQHA 2PMTA 5KN3A 3BOAA 3KZQA 1GP1A 1SYRA 2YPMA 16GSA 2IN3A 4IJIA 2R3XA 3DXBA 1S3DA 3NOFA 4HQSA 4YQVA 2X99A 3QDNA 3EU3A 4NXIA 1GWCA 2WDUA 2GQLA 1SK0A 2IJYA 3TUEA 2H30A 3IAM2 2DIYA 1JFUA 4BL7B 1TI3A 2PBJA 4JEDA 2CAQA 3D4TA 2O8VB 2IMEA 2GGTA 2YJ7A 4IHUA 1R5AA 3VWVA 5ELGA 3HHVA 4I5QA 3Q19A 2CAIA 1B9YC 5ECHB 1FG4A 2V1MA 2GT6A 3N5OA 1PKZA 5ECKB 8GSSA 2DMMA 1H4OA 2K18A 3EU4A 5JWRB 3C8EA 2R0GA 4QQ7A 1BJXA 3GX8A 2HRKB 2R37A 3UJ1A 2WJUA 3H8QA 4GTUA 4IP6A 5CYYA 4HJ2A 3D6IA 3EC3A 2VCTA 2P5RA 4Z2RA 2GQKA 2C3NA 1O8XA 3QPMA 3TOUA 3ZMKA 3KTLA 1FW1A 2BJXA 4OO4A 1T00A 4WR4A 2VM1A 4BVXB 2H75A 4DVCA 2ON7A 6GSWA 1ML6A 1ZYNA 2B5EA 2VL3A 1SJIA 4O5QA 1BG5A 1ERTA 2VD0A 3J7Yk 4EVMA 4TVEA 13GSA 2H01A 1XFLA 2A4VA 2YV9A 4Q5QA 2PN8A 4N0VA 3ZLPA 2YN1A 1GSSA 2GSSA 4K0NA 4K6XA 4O92A 2VL2A 2LQQA 2QGVA 5ECSA 3G7JA 5DJLA 3ZIJA 1BX9A 4MJBA 2NPBA 1PL2A 5B6MA 2C3TA 5EL8A 2R5GA 2HFDA 3IAS2 2M72A 3VK9A 2CQ9A 1UA5A 2K6VA 2DC5A 2X64A 3VWXA 2LNTA 2C0GA 4V1Ag 1TI1A 4TR4A 1F3BA 3GYKA 2EFCA 4BVYA 4MZWA 4IKHA 2H1GA 5DQSA 4J57E 4HDEA 3QOUA 2FHEA 2XBIA 3M9JA 2YWNA 2MMNA 4FO5A 1TU7A 3UVTA 2H19A 2CZ2A 3CTGA 2WCIA 4TXOA 2VL9A 1DE2A 1SKSB 2XC2A 5B8AA 4NPBA 2E0QA 4ZB9A 1SK2A 4MF5A 3N9JA 4MMMA 4F03A 4L0UA 5ECPB 4WKWA 1GSDA 3LSZA 5JWQB 1O81A 3CXGA 1YVLA 5IMFA 2E7PA 5HFGA 3FRCA 3UBLA 4I2UA 1GTBA 3TKSC 4EDZA 3HCZA 1HD2A 2VKZG 3IPZA 2EIOA 4L8EA 3M0FA 2HRNA 1QK8A 4FYBA 4P3YB 3ZVJD 1PX6A 1FOVA 2QA2A 2F8AA 5JWOB 1R26A 4HU7A 2DSAA 3KTBA 4J2FA 2R6KA 1U3AA 2VD1A 2DJ1A 3P90A 4IS0A 3KP9A 4YKFA 1G0TA 1THXA 1R5PA 4HZ4A 1JZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U88 A;  2CA8 A;  1XWG A;  2AHE A;  5JCU A;  4HOJ A;  3GSS A;  1B4P A;  3GH6 A;  2OAC A;  2GLR A;  1VF1 A;  6GSY A;  1G6W A;  2JL4 A;  1K0M A;  1TDI A;  4PUR A;  5D73 A;  3GTU A;  4ZB8 A;  1K0N A;  4IGJ A;  4YAP A;  3PR8 A;  5J4U A;  1HNC A;  4GLT A;  1U3I A;  2PVQ A;  5ECI B;  1EOG A;  5A4U A;  4MF7 A;  2A2R A;  4YAV A;  2VCV A;  5ECM B;  4LMW A;  3HJM A;  4OMV A;  6GST A;  17GS A;  1B8X A;  1ZL9 A;  4BVY B;  4YH2 A;  1K0C A;  3UBK A;  4MK3 A;  3LYP A;  4IQA A;  1K0D A;  1PD2 1;  5ECL B;  3FR9 A;  3SWL A;  2OA7 A;  3O3T A;  1GSE A;  4RI7 A;  4EC0 A;  1YY7 A;  2AB6 A;  2V6K A;  5EY6 A;  5IQY A;  3DD3 A;  1C72 A;  1K3Y A;  3KJY A;  5D9T A;  4PX1 A;  1V2A A;  4ZXG A;  5F0G A;  1PL1 A;  4G19 A;  3GUR A;  3Q18 A;  3I69 A;  3FY7 A;  3IR4 A;  5GST A;  1KBN A;  4PUA A;  4WR5 A;  4OFT A;  4HI7 A;  5DCG A;  4E8H A;  22GS A;  3CRT A;  3G7I A;  1OE8 A;  5F05 A;  3PGT A;  3QR6 A;  2GSQ A;  2IMI A;  5EVO A;  3VPQ A;  4KAE A;  4E8E A;  1V40 A;  5ECO B;  4GCI A;  3EIN A;  1AW9 A;  2C8U A;  3BBY A;  3HKR A;  4IQ1 A;  5A4V A;  4IW9 A;  5D9W A;  5ECQ B;  1JLW A;  4G0I A;  4KDU A;  3F6D A;  3P8W A;  2GDR A;  3U6V A;  4ISD A;  6GSX A;  2VO4 A;  2A2S A;  4KDY A;  5G5F A;  4KSM A;  2VCW A;  2HRK A;  4GSS A;  1PN9 A;  1EV4 A;  3KXO A;  5DAK B;  5A5K A;  4PNG A;  1GUK A;  4L5L A;  5DAL B;  1G7O A;  3LXT A;  4G0L A;  4RI6 A;  3TGZ A;  5FT3 A;  2OAD A;  3CBU A;  4PQI A;  1LBK A;  5DAL A;  1LJR A;  1GLQ A;  1PGT A;  4MP4 A;  5AIV A;  5FWG A;  1K0A A;  4GF0 A;  5FHI A;  4ECC A;  2VCX A;  2VCZ A;  3LXZ A;  3QAW A;  4NAX A;  1AQV A;  1GNW A;  1YJ6 A;  1AXD A;  4JZQ A;  4IBP A;  1K0B A;  5GSS A;  5LD0 A;  5F07 A;  4PGT A;  2J9H A;  4GST A;  4FQU A;  7GSS A;  1XW5 A;  2N5F A;  3GTU B;  5F06 A;  2LJR A;  3FR6 A;  1FHE A;  4LMV A;  4Q5N A;  3VLN A;  2AAW A;  3IK9 A;  4ACS A;  9GSS A;  1MD4 A;  2UZ8 A;  5G5E A;  4AGS A;  1GSQ A;  1A0F A;  1HNA A;  1VF2 A;  4MPG A;  20GS A;  1VF4 A;  3H1N A;  1E6B A;  1EEM A;  2IL3 A;  2PMT A;  5DJM A;  4KH7 A;  3IBH A;  3ERG A;  5F8B A;  16GS A;  4IJI A;  2R3X A;  3GUS A;  4YQV A;  1GTI A;  1YKC A;  10GS A;  3ZML A;  3LFL A;  3VPT A;  2VCQ A;  1GSU A;  3NIV A;  4IVF A;  1GWC A;  4MDC A;  2WDU A;  1Z9H A;  1XW6 A;  4GSN A;  3VI5 A;  4BL7 B;  1BAY A;  2PBJ A;  4JED A;  3R2Q A;  3R3E A;  2CAQ A;  1Q4J A;  1F2E A;  5J5N A;  3GX0 A;  1R5A A;  2HNL A;  4BL7 A;  2HQT A;  5ELG A;  1HQO A;  3ISO A;  3FR3 A;  3Q19 A;  3UAR A;  2CAI A;  5ECH B;  3CSJ A;  2C3Q A;  3WYW A;  4F0C A;  1RK4 A;  3LYK A;  3N5O A;  2IMK A;  3M3M A;  1PKZ A;  2NTO A;  3L0H A;  5ECK B;  8GSS A;  2GSR A;  4JBB A;  3C8E A;  3EE2 A;  4KDX A;  3CSH A;  2D2Z A;  5A4W A;  4HZ2 A;  1K3L A;  3QAV A;  4QQ7 A;  5GZZ B;  4YQM A;  14GS A;  4CHS A;  1JZR A;  18GS A;  2HRK B;  2WJU A;  4GTU A;  4IEL A;  1F3A A;  4HJ2 A;  4O7H A;  4PQH A;  2ON5 A;  2VCT A;  3VUR A;  1PA3 A;  3IE3 A;  4KGI A;  2C3N A;  1MTC A;  1TU8 A;  3UVH A;  5DDL A;  4EXJ A;  3F63 A;  5KEJ A;  1U87 A;  4ZBD A;  3TOU A;  3ZMK A;  6GSU A;  5ELA A;  3KTL A;  3Q74 A;  3F6F A;  3IK7 A;  1FW1 A;  2CZ3 A;  5AGY A;  3W8S A;  4WR4 A;  1GTU A;  4PNF A;  3KMO A;  1PMT A;  4BVX B;  3KM6 A;  1OKT A;  4G0K A;  2ON7 A;  4ZBB A;  6GSW A;  1ML6 A;  5ECN B;  3ZFB A;  4BVX A;  3QAG A;  4ID0 A;  1BG5 A;  2CVD A;  4G10 A;  2VD0 A;  1K0O A;  3DGQ A;  5B7C A;  4USS A;  13GS A;  3CSI A;  1BYE A;  2YV9 A;  4Q5Q A;  5D9V A;  4N0V A;  5J41 A;  1DUG A;  2C4J A;  4NHZ A;  4DEJ A;  3PPU A;  4KF9 A;  1GSS A;  2GSS A;  4K0N A;  4O92 A;  3CRU A;  5AN1 A;  1Y6E A;  1EV9 A;  1USB A;  1PKW A;  4ZB6 A;  1M9A A;  5ECS A;  3G7J A;  3ERF A;  4Q5R A;  5DJL A;  4K0G A;  1BX9 A;  3M8N A;  2FNO A;  2YCD A;  2HRA A;  1PL2 A;  3TOT A;  2HSM B;  2C3T A;  5EL8 A;  2R5G A;  4TOP A;  1JLV A;  3UAP A;  5JCW A;  3RBT A;  1GUH A;  2HSM A;  3VK9 A;  1UA5 A;  2DC5 A;  2X64 A;  3VWX A;  3FYG A;  5AIS A;  1ZGN A;  1IYI A;  3O76 A;  4EE0 A;  1MD3 A;  4KE3 A;  1F3B A;  1GSY A;  3ZFL A;  4BVY A;  4MZW A;  4IKH A;  5DQS A;  2YV7 A;  4Q5F A;  1OE7 A;  4YQU A;  1OYJ A;  1GTA A;  3MAK A;  2FHE A;  4KX4 A;  1VF3 A;  1TW9 A;  4L5O A;  1TU7 A;  2CZ2 A;  3LJR A;  3I6A A;  2PER A;  4F0B A;  1GLP A;  4OFM A;  4G9H A;  5AIX A;  2F8F A;  1GSF A;  2WB9 A;  3KMN A;  4ZB9 A;  1AQW A;  2HSN B;  1NHY A;  4MF5 A;  3N9J A;  1EOH A;  4F03 A;  5ECP B;  1GSD A;  3LSZ A;  2WRT A;  4PXO A;  4ECB A;  1IYH A;  2GST A;  3HJO A;  1HNB A;  3GST A;  1GUL A;  4EDY A;  1B48 A;  3FRC A;  3UBL A;  4ZBA A;  5ECR B;  1M0U A;  1GTB A;  1GUM A;  19GS A;  4EDZ A;  3D0Z A;  3WD6 A;  1YQ1 A;  4ECI A;  4OFN A;  2PGT A;  4PTS A;  3LQ7 A;  4L8E A;  3M0F A;  4NHW A;  5D9X A;  3M1G A;  5HFK A;  5BMU A;  12GS A;  1AQX A;  2C80 A;  11GS A;  1PX6 A;  4ECJ A;  4MPF A;  3LG6 A;  6GSV A;  2WS2 A;  1M99 A;  1XWK A;  3IC8 A;  5DAK A;  2DSA A;  1N2A A;  2GTU A;  1YDK A;  6GSS A;  4J2F A;  1K3O A;  2R6K A;  2VD1 A;  3MDK A;  3VI7 A;  5LCZ A;  1M9B A;  3P90 A;  4HZ4 A;  4IS0 A;  1G6Y A;  1PX7 A;  4I97 A;  3AY8 A;  2R4V A;  1GNE A;  2F3M A;  4MF6 A; 
#chains in the Genus database with same CATH topology
 3CQF A;  5G31 A;  4E68 A;  3H4K A;  2B5X A;  4AJ7 A;  4ML1 A;  3KP8 A;  1FOH A;  2GLR A;  5JCG A;  3FK8 A;  1M2D A;  4NWY A;  1K0M A;  3G9B A;  4PUR A;  5D73 A;  1NM3 A;  1JZD A;  1F6M C;  2EFH A;  4IGJ A;  4YAP A;  3PR8 A;  1X9S B;  1U3I A;  4XS6 A;  2HRF A;  3US3 A;  4POK A;  2A2R A;  2A2P A;  3HJM A;  4OMV A;  6GST A;  2Z9S A;  1ZL9 A;  4BVY B;  4EIP A;  3GHA A;  1K0C A;  3GL3 A;  3UBK A;  3LWA A;  3MNG A;  3ZVJ A;  1T3B A;  3FMW A;  3LYP A;  2H74 A;  3O3T A;  1I1I P;  4EC0 A;  5HQP A;  5DVB A;  5CRG A;  3L9S A;  2VM2 A;  4AKH A;  1K3Y A;  5D9T A;  2HSY A;  4TXO B;  1V2A A;  1ON4 A;  1Z7R A;  4G19 A;  3WGD A;  5G1L A;  3D21 A;  3I69 A;  4XRA A;  4PUA A;  1XWC A;  4HI7 A;  5DCG A;  2P31 A;  3CRT A;  1XWA A;  1OE8 A;  2UV8 G;  2WVX A;  1MDJ A;  4DSQ A;  1GL8 A;  5ECO B;  3BJ5 A;  4CY8 A;  1SEN A;  5INY A;  2C8U A;  4POB A;  5A4V A;  1JLW A;  2XPE A;  3F6D A;  2GDR A;  3U6V A;  5LNK e;  5G5F A;  4BWS A;  1XW9 A;  2O87 A;  1XVQ A;  2LV3 A;  2XBQ A;  1EV4 A;  1RW1 A;  1TRW A;  3RFR C;  1M2A A;  1M3J A;  4I8B A;  2LQO A;  3W6G A;  1S4B P;  4PNG A;  1GUK A;  1EGO A;  4HQZ A;  4RI6 A;  3TGZ A;  5FT3 A;  1XWB A;  2AYT A;  3CBU A;  3RPP A;  3H79 A;  5FWG A;  3TJK A;  2YWO A;  4OCE A;  2VCX A;  4BA7 A;  2LUS A;  4NAX A;  1EZK A;  1F9M A;  4K2X A;  5F07 A;  3A2W A;  4TR1 A;  2J23 A;  3FZ4 A;  4FQU A;  7GSS A;  1XW5 A;  1YEP A;  1O6J A;  1EP7 A;  1FHE A;  5A5H A;  4ACS A;  3GIX A;  1TOF A;  1MD4 A;  5IMC A;  2BMX A;  1VF2 A;  20GS A;  2O7K A;  4GDF A;  3GNJ A;  1OC9 A;  5J47 A;  5CAX A;  2IL3 A;  3TKS E;  4ZIL A;  3IBH A;  2QKE A;  3ZRD A;  2PWJ A;  1VGL A;  3APS A;  1YKC A;  10GS A;  4WF5 A;  4KND A;  3NIV A;  4IVF A;  4ULX A;  3EVI A;  3FHK A;  2H0H A;  4GWR A;  5IOX A;  1F2E A;  2WVX B;  4LL1 B;  3GX0 A;  3ZYW A;  4BL7 A;  2HQT A;  2M80 A;  1TJD A;  2PVO C;  4BPY A;  2JAD A;  3I9V 2;  5G2Z A;  4F0C A;  2IMD A;  3KIJ A;  1H75 A;  3EPT A;  2IMK A;  2NTO A;  1QFN A;  1NW2 A;  2GSR A;  1A8Y A;  2WFC A;  5J9C A;  4JBB A;  4KA0 A;  2CT6 A;  1M3I A;  3CSH A;  2D2Z A;  2XPD A;  14GS A;  4CHS A;  1JZR A;  2IIY A;  2LTK A;  4PI0 C;  2H70 A;  4PHZ C;  1TK8 B;  4G01 A;  4IEL A;  3TKQ A;  4O7H A;  1LU4 A;  3C1R A;  3VUR A;  1PA3 A;  5IPG A;  3VWU A;  5DDL A;  5CRW A;  5KEJ A;  5IIZ A;  4ZBD A;  2H72 A;  3EWL A;  3GRX A;  3Q6O A;  3F6F A;  4PUF C;  2FLS A;  4HSC X;  1YEX A;  1GTU A;  1PMT A;  3HZ4 A;  1OKT A;  4RQX A;  2FWG A;  3EYT A;  5ID2 B;  4BVX A;  4ID0 A;  2X8C A;  4MA9 A;  4EL1 A;  1OC8 A;  1K0O A;  1S3C A;  3HVN A;  3L9U A;  5D9V A;  2L4C A;  3CWG A;  5A5H B;  1XOB A;  4QL9 A;  2RUF A;  4XS4 B;  4DEJ A;  3PPU A;  1ABA A;  1ACV A;  5IPH A;  3ED3 A;  1B9X C;  1Y6E A;  2H8L A;  2LST A;  1OC9 B;  2V41 A;  4ZB6 A;  1JHB A;  2DKH A;  3ERF A;  2FY6 A;  3F4R A;  4Q5R A;  5ABR A;  4O32 A;  3M8N A;  4POL A;  2YCD A;  3TOT A;  1AC1 A;  2HSM B;  4ZIJ A;  3GV1 A;  2OKA A;  2ALB A;  2EFD A;  4AJ6 A;  4N10 A;  3IHQ A;  1MDI A;  4HU9 A;  1N25 A;  3FYG A;  5AIS A;  3F9U A;  1IYI A;  3O76 A;  2KP1 A;  4KE3 A;  2K9F A;  1SU9 A;  2JU5 A;  2H6X A;  1GSY A;  1T4Y A;  2TRC P;  5BRT A;  3IOS A;  2YWM A;  1G7E A;  3V1W A;  1GTA A;  4K8M A;  4KX4 A;  3I43 A;  3TDG A;  1UN2 A;  4L5O A;  2VLT A;  2I9H A;  3LJR A;  3I6A A;  2PER A;  1GLP A;  4OFM A;  1XBS A;  1TKD B;  3TJG A;  2WB9 A;  2CVB A;  2MZC A;  3PIN A;  1SVL A;  4KW6 A;  1ZMA A;  3HVS A;  4HEA 2;  3U5R E;  4JE1 A;  3HJO A;  4F2I A;  3ME7 A;  3VWW A;  3DKS A;  3ZL5 A;  1FAA A;  2X8H A;  5H5S A;  5J9B A;  4JU5 A;  3D0Z A;  1YQ1 A;  4OFN A;  2LJK A;  1M7T A;  2PGT A;  2VIM A;  2AV4 A;  2RLI A;  3HA9 A;  5KOW A;  5D9X A;  1ZYP A;  3BCK A;  2PU9 C;  5BMU A;  2KHP A;  4OCF A;  4ECJ A;  6GSV A;  2WS2 A;  3HVV A;  1M99 A;  1TTZ A;  1XWK A;  2IMF A;  4K7O A;  6GSS A;  5CRE A;  1HYU A;  1K3O A;  1W89 A;  5LCZ A;  1M9B A;  1U6T A;  4AKI A;  2N5A A;  3L78 A;  2FWF A;  4I97 A;  2BTO T;  1U88 A;  2CA8 A;  1XWG A;  4WBR D;  3DRN A;  1Y25 A;  5IM9 A;  4EKZ A;  3GSS A;  2JZS A;  1VRS D;  2L57 A;  3OR5 A;  1GH2 A;  2R2J A;  4DSR A;  1VF1 A;  3BCI A;  2GVP A;  2GZP A;  1TDI A;  4LLR A;  3GTU A;  4ZB8 A;  3TRX A;  4XS1 A;  5J4U A;  4GLT A;  1PQN A;  4MF7 A;  4OD7 A;  2LRC A;  3FKF A;  4YH2 A;  2P5Q A;  4KB3 A;  1TXX A;  1X9W B;  2MMZ A;  3IDV A;  5KOX A;  2TRX A;  1K0D A;  1PD2 1;  5ECL B;  3FR9 A;  3SWL A;  2OA7 A;  1SL0 B;  2N5B A;  2YWI A;  1GSE A;  4RI7 A;  2AB6 A;  3TJJ A;  4TXV A;  5EY6 A;  5GAP D;  3A2X A;  4FYC A;  2EIQ A;  3KJY A;  4MCU A;  1XIY A;  3KH7 A;  3VFI A;  4A5P A;  3BD2 A;  3GUR A;  3F3R A;  3HVX A;  3Q18 A;  4TKY A;  3HDC A;  3FY7 A;  5IO0 A;  4IN0 A;  4WR5 A;  4OFT A;  4E8H A;  1A8L A;  3D22 A;  5J40 A;  5EVO A;  3VPQ A;  3WT1 A;  4E8E A;  5COH A;  4GCI A;  3EIN A;  2YJH A;  1AW9 A;  1FO5 A;  3BBY A;  3HKR A;  5H5R A;  5H5Q A;  3TJF A;  1N8J A;  4Z7X A;  3QD9 A;  2VOC A;  4G0I A;  2QC7 A;  4KDU A;  1TP9 A;  1SL1 B;  1BF5 A;  4GXZ A;  4ISD A;  5BMU B;  2VO4 A;  2A2S A;  4KDY A;  4KSM A;  2H1L A;  5HR0 A;  1WPI A;  4GSS A;  2KP2 A;  3KXO A;  3TJB A;  1BQ7 A;  1YEW C;  4MAB A;  4L5L A;  5DAL B;  1SD8 A;  4G0L A;  5IMZ A;  1WE0 A;  5AIV A;  2HZE A;  1XG8 A;  3F0I A;  2CV4 A;  2WGR A;  3KEB A;  1GNW A;  1AXD A;  4JZQ A;  1PRX A;  5GSS A;  5LD0 A;  1EGR A;  4PGT A;  2NVL A;  2I81 A;  2LRN A;  3QCP A;  2N5F A;  3GTU B;  2O36 A;  2LJR A;  1YZX A;  4CW9 A;  2ES7 A;  2AAW A;  2TIR A;  2H73 A;  5G5E A;  3TKR A;  4GQF A;  1HNA A;  2EFE A;  4MPG A;  3ZIT A;  2B6M A;  2I1U A;  1E6B A;  2B1L A;  4KCA A;  4KH7 A;  3ERG A;  5F8B A;  3UMA A;  2P0G A;  1EEJ A;  3GUS A;  1GTI A;  1OC3 A;  4O5R A;  3VPT A;  2VCQ A;  2VL2 C;  1GSU A;  4MDC A;  3FW2 A;  4K5S A;  1Z9H A;  1XW6 A;  1A2L A;  4YKG A;  3GKK A;  2DML A;  4TN8 A;  4MJE A;  1F37 A;  2A4H A;  2B5Y A;  3D5J A;  3GH9 A;  3R3E A;  2HNL A;  4K7I A;  2V2G A;  2R0C A;  3GL5 A;  1HQO A;  2REM A;  3HMJ G;  4RQR A;  3UAR A;  3CSJ A;  2C3Q A;  2XHF A;  1ZYE A;  1RK4 A;  4XTS A;  3LYK A;  2HI7 A;  3L0H A;  2MBT A;  3F4T A;  3EE2 A;  4KDX A;  5A4W A;  4HZ2 A;  1K3L A;  3QAV A;  3JCM L;  1Z3E A;  1X5C A;  4K9Z A;  1WJK A;  2H6Z A;  5IO2 A;  4EO3 A;  3O6T A;  3IHG A;  2HSN A;  5IMV A;  4K2D A;  1QMV A;  1E2Y A;  2H0G A;  1BG1 A;  2O85 A;  4X1U A;  3IE3 A;  4KGI A;  4D73 B;  4HJM A;  1MTC A;  1TU8 A;  1I9D A;  1PN0 A;  2HZE B;  6GSU A;  5ELA A;  2ZNM A;  2H1D A;  2CZ3 A;  1QUW A;  2OBI A;  1YF0 A;  5G1K A;  3KM6 A;  1KEB A;  5C00 A;  3MSZ A;  3ZFB A;  2JSZ A;  3QAG A;  5B6N A;  2CVD A;  2G0F A;  4AKG A;  5B7C A;  3F3Q A;  1A0R P;  4NMU A;  4W66 A;  2B1K A;  5ID2 A;  1SK1 A;  4FH8 A;  5J41 A;  3UOM A;  2F9S A;  3DYR A;  4NHZ A;  1PFO A;  3HZ8 A;  1AUC A;  4XS4 A;  4EIQ A;  2L5L A;  3QFB C;  1EV9 A;  3GMF A;  1M9A A;  3FZ5 A;  4CY6 A;  2FA8 A;  4K0G A;  2PPT A;  4F9Z A;  5IMD A;  4TOP A;  3UAP A;  5JCW A;  4OO5 A;  3TRQ A;  4XHM A;  3DWV A;  1GUH A;  2HSM A;  1TK5 B;  4MH3 A;  4ILF A;  1WWJ A;  4EE0 A;  2MMO A;  5IMA A;  2DJ0 A;  3ZFL A;  2CVK A;  4Q5F A;  1OVN A;  4L0W A;  2MBS A;  3L4N A;  2B7K A;  5C04 A;  1OYJ A;  2FUG 2;  4Z2T A;  1TW9 A;  2H6Y A;  4V1A p;  2WZS A;  5KN0 A;  1GSF A;  5CRH A;  4X43 A;  4JR4 A;  3KMN A;  2H71 A;  3E9J B;  4MZC A;  5D96 A;  4AF2 A;  1ZCP A;  4TR0 A;  2HSN B;  1SKW B;  1NHY A;  1EOH A;  1GNE A;  4GRF A;  2WRT A;  2YP6 A;  1SJZ A;  3LEF A;  2GT5 A;  4O5U A;  1IYH A;  3E3E A;  1HNB A;  3GST A;  2K8S A;  3HXS A;  1GUL A;  1XZO A;  4ZBA A;  1W4V A;  2DBC A;  1DE1 A;  1M0U A;  2E2G A;  1GUM A;  19GS A;  1QXH A;  3WD6 A;  1MDK A;  5KN1 A;  3DEX A;  2EIR A;  4PTS A;  4WF4 A;  3LQ7 A;  4NHW A;  1DSB A;  3M1G A;  2WW1 A;  5HFK A;  2ZUP A;  3KD0 A;  2VLV A;  11GS A;  3UL3 A;  1T7P B;  2I3Y A;  2DJ3 A;  2JZT A;  3IC8 A;  5DAK A;  1N2A A;  2GTU A;  2IWT A;  5J4Y A;  3GKM A;  2GZY A;  3GFK A;  3VI7 A;  1DBY A;  1KNG A;  3CYN A;  5DQY A;  2JZR A;  2H1A A;  2QSI A;  3AY8 A;  2R4V A;  4KF9 A;  2HT9 A;  4V2N A;  1THO A;  1XVW A;  1T4Z A;  1BED A;  3S9F A;  1B4P A;  3LGC A;  3IC4 A;  3NZN A;  4PQ1 A;  6GSY A;  1A2M A;  2FD3 A;  1G6W A;  3MYD A;  1K0N A;  3A5I A;  4ICY A;  1YF1 A;  1EP8 A;  1HNC A;  5ECI B;  4TR3 A;  5HFI A;  4LMW A;  2F51 A;  2H1B A;  17GS A;  1B8X A;  4LL4 B;  2WVZ A;  4IQA A;  5L71 A;  4KUN A;  2WW2 A;  4N0Z A;  5IQY A;  1C72 A;  2MMA A;  2C1Y A;  4XCS A;  2KOK A;  4PX1 A;  3GKX A;  4ZXG A;  5G30 A;  2WW0 A;  1PL1 A;  2G2Q A;  1GRX A;  1X0R A;  3F4S A;  5CNW A;  1SVO A;  1SL2 B;  3IR4 A;  2C0D A;  3TKS A;  2DJ2 A;  1I5G A;  3PGT A;  4NV2 A;  4XIH A;  3QR6 A;  4XRD A;  2GSQ A;  4KAE A;  4MLY A;  2LJA A;  3FEU A;  2LS5 A;  1XPV A;  3ZTL A;  1UVZ A;  4G2E A;  3A5W A;  4IW9 A;  5D9W A;  1OKD A;  4AKX B;  1XXU A;  2DJJ A;  3F8U A;  4V2M A;  3P8W A;  2H66 A;  1AAZ A;  4N30 A;  4NV5 A;  6GSX A;  4KSO A;  2AJQ B;  1SKR B;  2VCW A;  1R4W A;  4MNN A;  4JR6 A;  5DAK B;  4MJA A;  3RPN A;  2PUK C;  2HXK A;  1NHO A;  4QMK A;  2L59 A;  5A5K A;  3CMI A;  1G7O A;  3HY2 A;  2OAD A;  2YAN A;  4PQI A;  5DAL A;  1GLQ A;  1PGT A;  4MP4 A;  2AUV A;  2IFQ A;  5D93 A;  3ZZX A;  2RM5 A;  1K0A A;  4GF0 A;  5HR2 A;  3TRP A;  4GQC A;  2VCZ A;  3LXZ A;  1AQV A;  1K0B A;  2VAF A;  2DJK A;  1ZZY A;  2RII A;  4F82 A;  3ERW A;  4IJ3 A;  4JRR A;  4FYU A;  2EC4 A;  4LMV A;  3VLN A;  4J56 E;  4WXT A;  3SBC A;  9GSS A;  1V58 A;  2V32 A;  3IA1 A;  3KCM A;  1Z7P A;  1SYX A;  4RUV A;  4AJ8 A;  1Z6M A;  3H1N A;  5HR1 A;  1O85 A;  3A2V A;  1EEM A;  1TXU A;  1X5D A;  5DJM A;  3DML A;  3J7Y b;  4LA1 A;  2OT3 A;  1QQ2 A;  4MZB A;  5J4V A;  2RUE A;  3ZML A;  3LFL A;  3G7Y A;  4I2T A;  2WW3 A;  3WGX A;  4GSN A;  3W8J A;  3VI5 A;  1BAY A;  3R2Q A;  1Q4J A;  5J5N A;  1EWX A;  3HYP A;  1R7H A;  2VLU A;  2B7J A;  4ZL7 A;  1WRY A;  3ISO A;  1YKA A;  3FR3 A;  1Z6N A;  2X4A A;  4MH2 A;  4N11 A;  3WYW A;  3M3M A;  3GA4 A;  2WVY A;  4POM A;  3TU3 B;  2FCH A;  2YZH A;  5GZZ B;  4YQM A;  2L6D A;  3WT2 A;  5A1N A;  18GS A;  2OJL A;  2M46 A;  3LW9 A;  2R0P A;  2O89 A;  1F3A A;  4PQH A;  3EMP A;  2ON5 A;  3FZA A;  4X0X A;  4CDO A;  3UVH A;  4EXJ A;  3F63 A;  1PSQ A;  1U87 A;  1KTE A;  2IFQ B;  4D73 A;  2WUL A;  2E2M A;  3Q74 A;  2H76 A;  3IK7 A;  2VUP A;  1Z5Y E;  5AGY A;  3W8S A;  4PNF A;  3KMO A;  4N3Z A;  1J08 A;  2GQM A;  3P2A A;  4G0K A;  4BWQ A;  4ZBB A;  3KGK A;  5ECN B;  3TB2 A;  3CHX C;  4G10 A;  4V2L A;  3DGQ A;  2YNX A;  3RGB C;  4USS A;  1URM A;  3CSI A;  3HJP A;  3HD5 A;  1WP0 A;  1BYE A;  2CX3 A;  2K8V A;  1MEK A;  1DUG A;  1V57 A;  2C4J A;  5A34 A;  4ML6 A;  2YOI A;  2GS3 A;  4OWY A;  4I6X A;  3CRU A;  5AN1 A;  1QGV A;  2OE0 A;  1USB A;  1PKW A;  2WZ9 A;  2JAC A;  1NSW A;  2FWH A;  3MIX A;  2FNO A;  2HRA A;  1CQG A;  3IV4 A;  1TRV A;  5HR3 A;  1J0F A;  3CTF A;  1JLV A;  3RBT A;  1O73 A;  3QMX A;  2V6O A;  3P7X A;  1ZGN A;  1MD3 A;  4PI2 C;  1WOU A;  5GAN D;  1JZO A;  1Q98 A;  3LOR A;  2YV7 A;  3IRA A;  1OE7 A;  2KUC A;  3TKP A;  4FIW A;  4YQU A;  2HZF A;  3MAK A;  1ZOF A;  4IP1 A;  4DSS A;  2OE1 A;  4WEY A;  1ERW A;  1VF3 A;  1TRS A;  3APQ A;  2FGX A;  3ME8 A;  3APO A;  4F0B A;  4G9H A;  2C0F A;  5AIX A;  2F8F A;  5A1N B;  1B4Q A;  3C71 A;  2O5V A;  1FB0 A;  3UEM A;  2MYG A;  1AQW A;  4K7N A;  2HLS A;  1SJ6 A;  4PXO A;  4ECB A;  3PH9 A;  2GST A;  2LNS A;  4EDY A;  1XCC A;  1B48 A;  3C1S A;  3ZIV A;  5ECR B;  4AI6 A;  4ECI A;  2OBK A;  3IXR A;  4WBJ A;  3DIE A;  4Z2U A;  12GS A;  1AQX A;  2C80 A;  2GZZ A;  4MPF A;  3LG6 A;  4QL7 A;  2HSH A;  3D4M A;  5A34 B;  1YDK A;  5B8B A;  3RHB A;  3MDK A;  2C0E A;  1G6Y A;  1PX7 A;  5KN2 A;  4MK3 A;  2F3M A;  4MF6 A;  1J9B A;  1ST9 A;  2AHE A;  5JCU A;  5J3R A;  2L5O A;  3K8N A;  4HOJ A;  4ZB7 A;  4K1F A;  3GH6 A;  2OAC A;  5CO3 A;  3QFA C;  2B3S A;  2RM6 A;  3EUR A;  2JL4 A;  2DLX A;  2YZU A;  4KCE A;  3ZRE A;  1A24 A;  5ENU A;  2X8G A;  1WIK A;  2LEG A;  2PVQ A;  3H93 A;  1EOG A;  5A4U A;  4K5R A;  4YAV A;  2VCV A;  5ECM B;  1ZYQ B;  3UIW A;  3M9K A;  4ZL9 A;  2DIZ A;  5DBQ A;  3RAZ A;  4X4J A;  1OAZ A;  1YY7 A;  4DSS B;  2V6K A;  4EF0 A;  3GN3 A;  1M2B A;  3DD3 A;  2HE3 A;  5E59 A;  2ZCT A;  4HUA A;  1X9M B;  5F0G A;  5CP1 A;  2FWE A;  2IPA A;  1RQM A;  4EUY A;  2KLX A;  2X49 A;  5GST A;  3MWH A;  1KBN A;  4BIK A;  2QA1 A;  3WGE A;  22GS A;  3G7I A;  3RDW A;  5F05 A;  2FA4 A;  2IMI A;  3RHC A;  1ERU A;  3A3T A;  1ERV A;  1V40 A;  4WET A;  3DVX A;  2H0I A;  4IQ1 A;  3EMX A;  5ECQ B;  2LKU A;  1ILO A;  1FVK A;  1A23 A;  2L4Q A;  5DCH A;  2OE3 A;  3KH9 A;  2HRK A;  1V9W A;  3DVW A;  1PN9 A;  2LRT A;  2JSY A;  1V98 A;  2CX4 A;  2NDO A;  5D8I A;  1TRU A;  3C7M A;  5CRD A;  5IOW A;  1T1V A;  1WMJ A;  5EPF A;  3LXT A;  4MJC A;  1FVJ A;  1XOA A;  1LBK A;  1LJR A;  4H86 A;  1SD9 A;  4ZL8 A;  1SVM A;  4FXY P;  5FHI A;  4ECC A;  2L6C A;  3QAW A;  4HS1 A;  4TR1 B;  1YJ6 A;  4IBP A;  3TCO A;  5E4W A;  3FZ9 A;  1TK0 B;  4TW5 A;  1S3R A;  2J9H A;  4GST A;  5F06 A;  3C73 A;  1O8W A;  3FR6 A;  2DKI A;  1O7U A;  4Q5N A;  1X5E A;  2NBS A;  1T8E B;  3IK9 A;  3E0U A;  2UZ8 A;  4TRX A;  4AGS A;  2HYX A;  1GSQ A;  1S3A A;  1A0F A;  1UC7 A;  1FB6 A;  3L9V A;  1AIU A;  1VF4 A;  1Y1U A;  1A2J A;  2I4A A;  3GKN A;  1CQH A;  2PMT A;  5KN3 A;  3BOA A;  3KZQ A;  1GP1 A;  1SYR A;  2YPM A;  16GS A;  2IN3 A;  4IJI A;  2R3X A;  3DXB A;  1S3D A;  3NOF A;  4HQS A;  4YQV A;  2O3E A;  2X99 A;  3QDN A;  3EU3 A;  4NXI A;  1GWC A;  2WDU A;  2GQL A;  1SK0 A;  2IJY A;  3TUE A;  2H30 A;  3IAM 2;  2DIY A;  1JFU A;  4BL7 B;  1TI3 A;  2PBJ A;  4JED A;  2CAQ A;  3D4T A;  2O8V B;  2IME A;  2GGT A;  2YJ7 A;  4IHU A;  1R5A A;  3VWV A;  5ELG A;  3HHV A;  4I5Q A;  3Q19 A;  2CAI A;  1B9Y C;  5ECH B;  1FG4 A;  2V1M A;  2GT6 A;  3N5O A;  1PKZ A;  5ECK B;  8GSS A;  2DMM A;  1H4O A;  2K18 A;  3EU4 A;  5JWR B;  3C8E A;  2R0G A;  4QQ7 A;  1BJX A;  3GX8 A;  2HRK B;  2R37 A;  3UJ1 A;  2WJU A;  3H8Q A;  4GTU A;  4IP6 A;  5CYY A;  4HJ2 A;  3D6I A;  3EC3 A;  2VCT A;  2P5R A;  4Z2R A;  2GQK A;  2C3N A;  1O8X A;  3QPM A;  3TOU A;  3ZMK A;  3KTL A;  1FW1 A;  2BJX A;  4OO4 A;  1T00 A;  4WR4 A;  2VM1 A;  4BVX B;  2H75 A;  4DVC A;  2ON7 A;  6GSW A;  1ML6 A;  1ZYN A;  2B5E A;  2VL3 A;  1SJI A;  4O5Q A;  1BG5 A;  1ERT A;  2VD0 A;  3J7Y k;  4EVM A;  4TVE A;  13GS A;  2H01 A;  1XFL A;  2A4V A;  2YV9 A;  4Q5Q A;  2PN8 A;  4N0V A;  3ZLP A;  2YN1 A;  1GSS A;  2GSS A;  4K0N A;  4K6X A;  4O92 A;  2VL2 A;  2LQQ A;  2QGV A;  5ECS A;  3G7J A;  5DJL A;  3ZIJ A;  1BX9 A;  4MJB A;  2NPB A;  1PL2 A;  5B6M A;  2C3T A;  5EL8 A;  2R5G A;  2HFD A;  3IAS 2;  2M72 A;  3VK9 A;  2CQ9 A;  1UA5 A;  2K6V A;  2DC5 A;  2X64 A;  3VWX A;  2LNT A;  2C0G A;  4V1A g;  1TI1 A;  4TR4 A;  1F3B A;  3GYK A;  2EFC A;  4BVY A;  4MZW A;  4IKH A;  2H1G A;  5DQS A;  4J57 E;  4HDE A;  3QOU A;  2FHE A;  2XBI A;  3M9J A;  2YWN A;  2MMN A;  4FO5 A;  1TU7 A;  3UVT A;  2H19 A;  2CZ2 A;  3CTG A;  2WCI A;  4TXO A;  2VL9 A;  1DE2 A;  1SKS B;  2XC2 A;  5B8A A;  4NPB A;  2E0Q A;  4ZB9 A;  1SK2 A;  4MF5 A;  3N9J A;  4MMM A;  4F03 A;  4L0U A;  5ECP B;  4WKW A;  1GSD A;  3LSZ A;  5JWQ B;  1O81 A;  3CXG A;  1YVL A;  5IMF A;  2E7P A;  5HFG A;  3FRC A;  3UBL A;  4I2U A;  1GTB A;  3TKS C;  4EDZ A;  3HCZ A;  1HD2 A;  2VKZ G;  3IPZ A;  2EIO A;  4L8E A;  3M0F A;  2HRN A;  1QK8 A;  4FYB A;  4P3Y B;  3ZVJ D;  1PX6 A;  1FOV A;  2QA2 A;  2F8A A;  5JWO B;  1R26 A;  4HU7 A;  2DSA A;  3KTB A;  4J2F A;  2R6K A;  1U3A A;  2VD1 A;  2DJ1 A;  3P90 A;  4IS0 A;  3KP9 A;  4YKF A;  1G0T A;  1THX A;  1R5P A;  4HZ4 A;  1JZW A; 
#chains in the Genus database with same CATH homology
 5G31 A;  4E68 A;  3H4K A;  2B5X A;  4AJ7 A;  4ML1 A;  3KP8 A;  1FOH A;  2GLR A;  5JCG A;  3FK8 A;  1M2D A;  4NWY A;  1K0M A;  3G9B A;  4PUR A;  5D73 A;  1NM3 A;  1JZD A;  1F6M C;  2EFH A;  4IGJ A;  4YAP A;  3PR8 A;  1X9S B;  1U3I A;  4XS6 A;  2HRF A;  3US3 A;  4POK A;  2A2R A;  2A2P A;  3HJM A;  4OMV A;  6GST A;  2Z9S A;  1ZL9 A;  4BVY B;  4EIP A;  3GHA A;  1K0C A;  3GL3 A;  3UBK A;  3LWA A;  3MNG A;  3ZVJ A;  1T3B A;  3FMW A;  3LYP A;  2H74 A;  3O3T A;  4EC0 A;  5HQP A;  5DVB A;  5CRG A;  3L9S A;  2VM2 A;  4AKH A;  1K3Y A;  5D9T A;  2HSY A;  4TXO B;  1V2A A;  1ON4 A;  1Z7R A;  4G19 A;  3WGD A;  5G1L A;  3D21 A;  3I69 A;  4XRA A;  4PUA A;  1XWC A;  4HI7 A;  5DCG A;  2P31 A;  3CRT A;  1XWA A;  1OE8 A;  2UV8 G;  1MDJ A;  4DSQ A;  1GL8 A;  5ECO B;  3BJ5 A;  4CY8 A;  1SEN A;  5INY A;  2C8U A;  4POB A;  5A4V A;  1JLW A;  2XPE A;  3F6D A;  2GDR A;  3U6V A;  5LNK e;  5G5F A;  4BWS A;  1XW9 A;  2O87 A;  1XVQ A;  2LV3 A;  2XBQ A;  1EV4 A;  1RW1 A;  1TRW A;  1M2A A;  4I8B A;  2LQO A;  3W6G A;  4PNG A;  1GUK A;  1EGO A;  4HQZ A;  4RI6 A;  3TGZ A;  5FT3 A;  1XWB A;  2AYT A;  3CBU A;  3RPP A;  3H79 A;  5FWG A;  3TJK A;  2YWO A;  4OCE A;  2VCX A;  4BA7 A;  2LUS A;  4NAX A;  1EZK A;  1F9M A;  4K2X A;  5F07 A;  3A2W A;  4TR1 A;  2J23 A;  3FZ4 A;  4FQU A;  7GSS A;  1XW5 A;  1YEP A;  1O6J A;  1EP7 A;  1FHE A;  5A5H A;  4ACS A;  3GIX A;  1TOF A;  1MD4 A;  5IMC A;  2BMX A;  1VF2 A;  20GS A;  2O7K A;  4GDF A;  3GNJ A;  1OC9 A;  5J47 A;  5CAX A;  2IL3 A;  3TKS E;  4ZIL A;  3IBH A;  2QKE A;  3ZRD A;  2PWJ A;  1VGL A;  3APS A;  1YKC A;  10GS A;  4WF5 A;  4KND A;  3NIV A;  4IVF A;  4ULX A;  3EVI A;  3FHK A;  2H0H A;  4GWR A;  5IOX A;  1F2E A;  4LL1 B;  3GX0 A;  3ZYW A;  4BL7 A;  2HQT A;  2M80 A;  1TJD A;  2PVO C;  4BPY A;  2JAD A;  3I9V 2;  5G2Z A;  4F0C A;  2IMD A;  3KIJ A;  1H75 A;  3EPT A;  2IMK A;  2NTO A;  1QFN A;  1NW2 A;  2GSR A;  1A8Y A;  2WFC A;  5J9C A;  4JBB A;  4KA0 A;  2CT6 A;  3CSH A;  2D2Z A;  2XPD A;  14GS A;  4CHS A;  1JZR A;  2IIY A;  2LTK A;  2H70 A;  1TK8 B;  4G01 A;  4IEL A;  3TKQ A;  4O7H A;  1LU4 A;  3C1R A;  3VUR A;  1PA3 A;  5IPG A;  3VWU A;  5DDL A;  5CRW A;  5KEJ A;  5IIZ A;  4ZBD A;  2H72 A;  3EWL A;  3GRX A;  3Q6O A;  3F6F A;  4PUF C;  2FLS A;  1YEX A;  1GTU A;  1PMT A;  3HZ4 A;  1OKT A;  4RQX A;  2FWG A;  3EYT A;  5ID2 B;  4BVX A;  4ID0 A;  2X8C A;  4MA9 A;  4EL1 A;  1OC8 A;  1K0O A;  1S3C A;  3L9U A;  5D9V A;  2L4C A;  3CWG A;  5A5H B;  1XOB A;  4QL9 A;  2RUF A;  4XS4 B;  4DEJ A;  3PPU A;  1ABA A;  1ACV A;  5IPH A;  3ED3 A;  1B9X C;  1Y6E A;  2H8L A;  2LST A;  1OC9 B;  2V41 A;  4ZB6 A;  1JHB A;  2DKH A;  3ERF A;  2FY6 A;  3F4R A;  4Q5R A;  5ABR A;  4O32 A;  3M8N A;  4POL A;  2YCD A;  3TOT A;  1AC1 A;  2HSM B;  4ZIJ A;  3GV1 A;  2OKA A;  2ALB A;  2EFD A;  4AJ6 A;  4N10 A;  3IHQ A;  1MDI A;  4HU9 A;  1N25 A;  3FYG A;  5AIS A;  3F9U A;  1IYI A;  3O76 A;  2KP1 A;  4KE3 A;  2K9F A;  1SU9 A;  2JU5 A;  2H6X A;  1GSY A;  1T4Y A;  2TRC P;  5BRT A;  3IOS A;  2YWM A;  1G7E A;  3V1W A;  1GTA A;  4K8M A;  4KX4 A;  3I43 A;  3TDG A;  1UN2 A;  4L5O A;  2VLT A;  2I9H A;  3LJR A;  3I6A A;  2PER A;  1GLP A;  4OFM A;  1XBS A;  1TKD B;  3TJG A;  2WB9 A;  2CVB A;  2MZC A;  3PIN A;  1SVL A;  4KW6 A;  1ZMA A;  3HVS A;  4HEA 2;  3U5R E;  4JE1 A;  3HJO A;  4F2I A;  3ME7 A;  3VWW A;  3DKS A;  3ZL5 A;  1FAA A;  2X8H A;  5H5S A;  5J9B A;  4JU5 A;  3D0Z A;  1YQ1 A;  4OFN A;  2LJK A;  1M7T A;  2PGT A;  2VIM A;  2AV4 A;  2RLI A;  3HA9 A;  5KOW A;  5D9X A;  1ZYP A;  3BCK A;  2PU9 C;  5BMU A;  2KHP A;  4OCF A;  4ECJ A;  6GSV A;  2WS2 A;  3HVV A;  1M99 A;  1TTZ A;  1XWK A;  2IMF A;  4K7O A;  6GSS A;  5CRE A;  1HYU A;  1K3O A;  1W89 A;  5LCZ A;  1M9B A;  1U6T A;  4AKI A;  2N5A A;  3L78 A;  2FWF A;  4I97 A;  2BTO T;  1U88 A;  2CA8 A;  1XWG A;  4WBR D;  3DRN A;  1Y25 A;  5IM9 A;  4EKZ A;  3GSS A;  2JZS A;  1VRS D;  2L57 A;  3OR5 A;  1GH2 A;  2R2J A;  4DSR A;  1VF1 A;  3BCI A;  2GVP A;  2GZP A;  1TDI A;  4LLR A;  3GTU A;  4ZB8 A;  3TRX A;  4XS1 A;  5J4U A;  4GLT A;  1PQN A;  4MF7 A;  4OD7 A;  2LRC A;  3FKF A;  4YH2 A;  2P5Q A;  4KB3 A;  1TXX A;  1X9W B;  2MMZ A;  3IDV A;  5KOX A;  2TRX A;  1K0D A;  1PD2 1;  5ECL B;  3FR9 A;  3SWL A;  2OA7 A;  1SL0 B;  2N5B A;  2YWI A;  1GSE A;  4RI7 A;  2AB6 A;  3TJJ A;  4TXV A;  5EY6 A;  5GAP D;  3A2X A;  4FYC A;  2EIQ A;  3KJY A;  4MCU A;  1XIY A;  3KH7 A;  3VFI A;  4A5P A;  3BD2 A;  3GUR A;  3F3R A;  3HVX A;  3Q18 A;  4TKY A;  3HDC A;  3FY7 A;  5IO0 A;  4IN0 A;  4WR5 A;  4OFT A;  4E8H A;  1A8L A;  3D22 A;  5J40 A;  5EVO A;  3VPQ A;  3WT1 A;  4E8E A;  5COH A;  4GCI A;  3EIN A;  2YJH A;  1AW9 A;  1FO5 A;  3BBY A;  3HKR A;  5H5R A;  5H5Q A;  3TJF A;  1N8J A;  4Z7X A;  3QD9 A;  2VOC A;  4G0I A;  2QC7 A;  4KDU A;  1TP9 A;  1SL1 B;  1BF5 A;  4GXZ A;  4ISD A;  5BMU B;  2VO4 A;  2A2S A;  4KDY A;  4KSM A;  2H1L A;  5HR0 A;  1WPI A;  4GSS A;  2KP2 A;  3KXO A;  3TJB A;  1BQ7 A;  4MAB A;  4L5L A;  5DAL B;  1SD8 A;  4G0L A;  5IMZ A;  1WE0 A;  5AIV A;  2HZE A;  3F0I A;  2CV4 A;  2WGR A;  3KEB A;  1GNW A;  1AXD A;  4JZQ A;  1PRX A;  5GSS A;  5LD0 A;  1EGR A;  4PGT A;  2NVL A;  2I81 A;  2LRN A;  3QCP A;  2N5F A;  3GTU B;  2LJR A;  1YZX A;  4CW9 A;  2ES7 A;  2AAW A;  2TIR A;  2H73 A;  5G5E A;  3TKR A;  4GQF A;  1HNA A;  2EFE A;  4MPG A;  3ZIT A;  2B6M A;  2I1U A;  1E6B A;  2B1L A;  4KCA A;  4KH7 A;  3ERG A;  5F8B A;  3UMA A;  2P0G A;  1EEJ A;  3GUS A;  1GTI A;  1OC3 A;  4O5R A;  3VPT A;  2VCQ A;  2VL2 C;  1GSU A;  4MDC A;  3FW2 A;  4K5S A;  1Z9H A;  1XW6 A;  1A2L A;  4YKG A;  3GKK A;  2DML A;  4TN8 A;  4MJE A;  1F37 A;  2A4H A;  2B5Y A;  3D5J A;  3GH9 A;  3R3E A;  2HNL A;  4K7I A;  2V2G A;  2R0C A;  3GL5 A;  1HQO A;  2REM A;  3HMJ G;  4RQR A;  3UAR A;  3CSJ A;  2C3Q A;  2XHF A;  1ZYE A;  1RK4 A;  4XTS A;  3LYK A;  2HI7 A;  3L0H A;  2MBT A;  3EE2 A;  4KDX A;  3F4T A;  5A4W A;  4HZ2 A;  1K3L A;  3QAV A;  3JCM L;  1Z3E A;  1X5C A;  4K9Z A;  1WJK A;  2H6Z A;  5IO2 A;  4EO3 A;  3O6T A;  3IHG A;  2HSN A;  5IMV A;  4K2D A;  1QMV A;  1E2Y A;  2H0G A;  1BG1 A;  2O85 A;  4X1U A;  3IE3 A;  4KGI A;  4D73 B;  4HJM A;  1MTC A;  1TU8 A;  1I9D A;  1PN0 A;  2HZE B;  6GSU A;  5ELA A;  2ZNM A;  2H1D A;  2CZ3 A;  1QUW A;  2OBI A;  1YF0 A;  5G1K A;  3KM6 A;  1KEB A;  5C00 A;  3MSZ A;  3ZFB A;  2JSZ A;  3QAG A;  5B6N A;  2CVD A;  2G0F A;  4AKG A;  5B7C A;  3F3Q A;  1A0R P;  4NMU A;  4W66 A;  2B1K A;  5ID2 A;  1SK1 A;  4FH8 A;  5J41 A;  3UOM A;  2F9S A;  3DYR A;  4NHZ A;  3HZ8 A;  1AUC A;  4XS4 A;  4EIQ A;  2L5L A;  3QFB C;  1EV9 A;  3GMF A;  1M9A A;  3FZ5 A;  4CY6 A;  2FA8 A;  4K0G A;  2PPT A;  4F9Z A;  5IMD A;  4TOP A;  3UAP A;  5JCW A;  4OO5 A;  3TRQ A;  4XHM A;  3DWV A;  1GUH A;  2HSM A;  1TK5 B;  4MH3 A;  4ILF A;  1WWJ A;  4EE0 A;  2MMO A;  5IMA A;  2DJ0 A;  3ZFL A;  2CVK A;  4Q5F A;  1OVN A;  4L0W A;  2MBS A;  3L4N A;  2B7K A;  5C04 A;  1OYJ A;  2FUG 2;  4Z2T A;  1TW9 A;  2H6Y A;  4V1A p;  5KN0 A;  1GSF A;  5CRH A;  4X43 A;  4JR4 A;  3KMN A;  2H71 A;  3E9J B;  4MZC A;  5D96 A;  4AF2 A;  1ZCP A;  4TR0 A;  2HSN B;  1SKW B;  1NHY A;  1EOH A;  1GNE A;  4GRF A;  2WRT A;  2YP6 A;  1SJZ A;  3LEF A;  2GT5 A;  4O5U A;  1IYH A;  3E3E A;  1HNB A;  3GST A;  2K8S A;  3HXS A;  1GUL A;  1XZO A;  4ZBA A;  1W4V A;  2DBC A;  1DE1 A;  1M0U A;  2E2G A;  1GUM A;  19GS A;  1QXH A;  3WD6 A;  1MDK A;  5KN1 A;  3DEX A;  2EIR A;  4PTS A;  4WF4 A;  3LQ7 A;  4NHW A;  1DSB A;  3M1G A;  5HFK A;  2ZUP A;  3KD0 A;  2VLV A;  11GS A;  3UL3 A;  1T7P B;  2I3Y A;  2DJ3 A;  2JZT A;  3IC8 A;  5DAK A;  1N2A A;  2GTU A;  2IWT A;  5J4Y A;  3GKM A;  2GZY A;  3GFK A;  3VI7 A;  1DBY A;  1KNG A;  3CYN A;  5DQY A;  2JZR A;  2H1A A;  2QSI A;  3AY8 A;  2R4V A;  4KF9 A;  2HT9 A;  4V2N A;  1THO A;  1XVW A;  1T4Z A;  1BED A;  3S9F A;  1B4P A;  3LGC A;  3IC4 A;  3NZN A;  4PQ1 A;  6GSY A;  1A2M A;  2FD3 A;  1G6W A;  3MYD A;  1K0N A;  3A5I A;  4ICY A;  1YF1 A;  1EP8 A;  1HNC A;  5ECI B;  4TR3 A;  5HFI A;  4LMW A;  2F51 A;  2H1B A;  17GS A;  1B8X A;  4LL4 B;  4IQA A;  5L71 A;  4KUN A;  4N0Z A;  5IQY A;  1C72 A;  2MMA A;  2C1Y A;  4XCS A;  2KOK A;  4PX1 A;  3GKX A;  4ZXG A;  5G30 A;  1PL1 A;  2G2Q A;  1GRX A;  1X0R A;  3F4S A;  5CNW A;  1SVO A;  1SL2 B;  3IR4 A;  2C0D A;  3TKS A;  2DJ2 A;  1I5G A;  3PGT A;  4NV2 A;  4XIH A;  3QR6 A;  4XRD A;  2GSQ A;  4KAE A;  4MLY A;  2LJA A;  3FEU A;  2LS5 A;  1XPV A;  3ZTL A;  1UVZ A;  4G2E A;  3A5W A;  4IW9 A;  5D9W A;  1OKD A;  4AKX B;  1XXU A;  2DJJ A;  3F8U A;  4V2M A;  3P8W A;  2H66 A;  1AAZ A;  4N30 A;  4NV5 A;  6GSX A;  4KSO A;  2AJQ B;  1SKR B;  2VCW A;  1R4W A;  4MNN A;  4JR6 A;  5DAK B;  4MJA A;  3RPN A;  2PUK C;  2HXK A;  1NHO A;  4QMK A;  2L59 A;  5A5K A;  3CMI A;  1G7O A;  3HY2 A;  2OAD A;  2YAN A;  4PQI A;  5DAL A;  1GLQ A;  1PGT A;  4MP4 A;  2AUV A;  2IFQ A;  5D93 A;  3ZZX A;  2RM5 A;  1K0A A;  4GF0 A;  5HR2 A;  3TRP A;  4GQC A;  2VCZ A;  3LXZ A;  1AQV A;  1K0B A;  2VAF A;  2DJK A;  1ZZY A;  2RII A;  4F82 A;  3ERW A;  4IJ3 A;  4JRR A;  4FYU A;  2EC4 A;  4LMV A;  3VLN A;  4J56 E;  4WXT A;  3SBC A;  9GSS A;  1V58 A;  2V32 A;  3IA1 A;  3KCM A;  1Z7P A;  1SYX A;  4RUV A;  4AJ8 A;  1Z6M A;  3H1N A;  5HR1 A;  1O85 A;  3A2V A;  1EEM A;  1TXU A;  1X5D A;  5DJM A;  3DML A;  3J7Y b;  4LA1 A;  2OT3 A;  1QQ2 A;  4MZB A;  5J4V A;  2RUE A;  3ZML A;  3LFL A;  3G7Y A;  4I2T A;  3WGX A;  4GSN A;  3W8J A;  3VI5 A;  1BAY A;  3R2Q A;  1Q4J A;  5J5N A;  1EWX A;  3HYP A;  1R7H A;  2VLU A;  2B7J A;  4ZL7 A;  1WRY A;  3ISO A;  1YKA A;  3FR3 A;  1Z6N A;  2X4A A;  4MH2 A;  4N11 A;  3WYW A;  3M3M A;  3GA4 A;  4POM A;  3TU3 B;  2FCH A;  2YZH A;  5GZZ B;  4YQM A;  2L6D A;  3WT2 A;  5A1N A;  18GS A;  2OJL A;  2M46 A;  3LW9 A;  2R0P A;  2O89 A;  1F3A A;  4PQH A;  3EMP A;  2ON5 A;  3FZA A;  4X0X A;  4CDO A;  3UVH A;  4EXJ A;  3F63 A;  1PSQ A;  1U87 A;  1KTE A;  2IFQ B;  4D73 A;  2WUL A;  2E2M A;  3Q74 A;  2H76 A;  3IK7 A;  2VUP A;  1Z5Y E;  5AGY A;  3W8S A;  4PNF A;  3KMO A;  4N3Z A;  1J08 A;  2GQM A;  3P2A A;  4G0K A;  4BWQ A;  4ZBB A;  3KGK A;  5ECN B;  3TB2 A;  4G10 A;  4V2L A;  3DGQ A;  2YNX A;  1URM A;  4USS A;  3CSI A;  3HJP A;  3HD5 A;  1WP0 A;  1BYE A;  2CX3 A;  2K8V A;  1MEK A;  1DUG A;  1V57 A;  2C4J A;  5A34 A;  4ML6 A;  2YOI A;  2GS3 A;  4OWY A;  4I6X A;  3CRU A;  5AN1 A;  1QGV A;  2OE0 A;  1USB A;  1PKW A;  2WZ9 A;  2JAC A;  1NSW A;  2FWH A;  3MIX A;  2FNO A;  2HRA A;  1CQG A;  3IV4 A;  1TRV A;  5HR3 A;  1J0F A;  3CTF A;  1JLV A;  3RBT A;  1O73 A;  3QMX A;  2V6O A;  3P7X A;  1ZGN A;  1MD3 A;  1WOU A;  5GAN D;  1JZO A;  1Q98 A;  3LOR A;  2YV7 A;  3IRA A;  1OE7 A;  2KUC A;  3TKP A;  4FIW A;  4YQU A;  2HZF A;  3MAK A;  1ZOF A;  4IP1 A;  4DSS A;  2OE1 A;  4WEY A;  1ERW A;  1VF3 A;  1TRS A;  3APQ A;  2FGX A;  3ME8 A;  3APO A;  4F0B A;  4G9H A;  2C0F A;  5AIX A;  2F8F A;  5A1N B;  1B4Q A;  3C71 A;  2O5V A;  1FB0 A;  3UEM A;  2MYG A;  1AQW A;  4K7N A;  2HLS A;  1SJ6 A;  4PXO A;  4ECB A;  3PH9 A;  2GST A;  2LNS A;  4EDY A;  1XCC A;  1B48 A;  3C1S A;  3ZIV A;  5ECR B;  4AI6 A;  4ECI A;  2OBK A;  3IXR A;  4WBJ A;  3DIE A;  4Z2U A;  12GS A;  1AQX A;  2C80 A;  2GZZ A;  4MPF A;  3LG6 A;  4QL7 A;  2HSH A;  3D4M A;  5A34 B;  1YDK A;  5B8B A;  3RHB A;  3MDK A;  2C0E A;  1G6Y A;  1PX7 A;  5KN2 A;  4MK3 A;  2F3M A;  4MF6 A;  1J9B A;  1ST9 A;  2AHE A;  5JCU A;  5J3R A;  2L5O A;  3K8N A;  4HOJ A;  4ZB7 A;  4K1F A;  3GH6 A;  2OAC A;  5CO3 A;  3QFA C;  2B3S A;  2RM6 A;  3EUR A;  2JL4 A;  2DLX A;  2YZU A;  4KCE A;  3ZRE A;  1A24 A;  5ENU A;  2X8G A;  1WIK A;  2LEG A;  2PVQ A;  3H93 A;  1EOG A;  5A4U A;  4K5R A;  4YAV A;  2VCV A;  5ECM B;  1ZYQ B;  3UIW A;  3M9K A;  4ZL9 A;  2DIZ A;  5DBQ A;  3RAZ A;  4X4J A;  1OAZ A;  1YY7 A;  4DSS B;  2V6K A;  4EF0 A;  3GN3 A;  1M2B A;  3DD3 A;  2HE3 A;  5E59 A;  2ZCT A;  4HUA A;  1X9M B;  5F0G A;  5CP1 A;  2FWE A;  2IPA A;  1RQM A;  4EUY A;  2KLX A;  2X49 A;  5GST A;  3MWH A;  1KBN A;  2QA1 A;  3WGE A;  22GS A;  3G7I A;  3RDW A;  5F05 A;  2FA4 A;  2IMI A;  3RHC A;  1ERU A;  3A3T A;  1ERV A;  1V40 A;  4WET A;  3DVX A;  2H0I A;  4IQ1 A;  3EMX A;  5ECQ B;  2LKU A;  1ILO A;  1FVK A;  1A23 A;  2L4Q A;  5DCH A;  2OE3 A;  3KH9 A;  2HRK A;  1V9W A;  3DVW A;  1PN9 A;  2LRT A;  2JSY A;  1V98 A;  2CX4 A;  2NDO A;  5D8I A;  1TRU A;  3C7M A;  5CRD A;  5IOW A;  1T1V A;  1WMJ A;  5EPF A;  3LXT A;  4MJC A;  1FVJ A;  1XOA A;  1LBK A;  1LJR A;  4H86 A;  1SD9 A;  4ZL8 A;  1SVM A;  5FHI A;  4ECC A;  2L6C A;  3QAW A;  4HS1 A;  4TR1 B;  1YJ6 A;  4IBP A;  3TCO A;  5E4W A;  3FZ9 A;  1TK0 B;  4TW5 A;  2J9H A;  4GST A;  5F06 A;  3C73 A;  1O8W A;  3FR6 A;  2DKI A;  1O7U A;  4Q5N A;  1X5E A;  2NBS A;  1T8E B;  3IK9 A;  3E0U A;  2UZ8 A;  4TRX A;  4AGS A;  2HYX A;  1GSQ A;  1S3A A;  1A0F A;  1UC7 A;  1FB6 A;  3L9V A;  1AIU A;  1VF4 A;  1Y1U A;  1A2J A;  2I4A A;  3GKN A;  1CQH A;  2PMT A;  5KN3 A;  3BOA A;  3KZQ A;  1GP1 A;  1SYR A;  2YPM A;  16GS A;  2IN3 A;  4IJI A;  2R3X A;  3DXB A;  1S3D A;  3NOF A;  4HQS A;  4YQV A;  2X99 A;  3QDN A;  3EU3 A;  4NXI A;  1GWC A;  2WDU A;  2GQL A;  1SK0 A;  2IJY A;  3TUE A;  2H30 A;  3IAM 2;  2DIY A;  1JFU A;  4BL7 B;  1TI3 A;  2PBJ A;  4JED A;  2CAQ A;  3D4T A;  2O8V B;  2IME A;  2GGT A;  2YJ7 A;  4IHU A;  1R5A A;  3VWV A;  5ELG A;  3HHV A;  4I5Q A;  3Q19 A;  2CAI A;  1B9Y C;  5ECH B;  1FG4 A;  2V1M A;  2GT6 A;  3N5O A;  1PKZ A;  5ECK B;  8GSS A;  2DMM A;  1H4O A;  2K18 A;  3EU4 A;  5JWR B;  3C8E A;  2R0G A;  4QQ7 A;  1BJX A;  3GX8 A;  2HRK B;  2R37 A;  3UJ1 A;  2WJU A;  3H8Q A;  4GTU A;  4IP6 A;  5CYY A;  4HJ2 A;  3D6I A;  3EC3 A;  2VCT A;  2P5R A;  4Z2R A;  2GQK A;  2C3N A;  1O8X A;  3QPM A;  3TOU A;  3ZMK A;  3KTL A;  1FW1 A;  2BJX A;  4OO4 A;  1T00 A;  4WR4 A;  2VM1 A;  4BVX B;  2H75 A;  4DVC A;  2ON7 A;  6GSW A;  1ML6 A;  1ZYN A;  2B5E A;  2VL3 A;  1SJI A;  4O5Q A;  1BG5 A;  1ERT A;  2VD0 A;  3J7Y k;  4EVM A;  4TVE A;  13GS A;  2H01 A;  1XFL A;  2A4V A;  2YV9 A;  4Q5Q A;  2PN8 A;  4N0V A;  3ZLP A;  2YN1 A;  1GSS A;  2GSS A;  4K0N A;  4K6X A;  4O92 A;  2VL2 A;  2LQQ A;  2QGV A;  5ECS A;  3G7J A;  5DJL A;  3ZIJ A;  1BX9 A;  4MJB A;  2NPB A;  1PL2 A;  5B6M A;  2C3T A;  5EL8 A;  2R5G A;  2HFD A;  3IAS 2;  2M72 A;  3VK9 A;  2CQ9 A;  1UA5 A;  2K6V A;  2DC5 A;  2X64 A;  3VWX A;  2LNT A;  2C0G A;  4V1A g;  1TI1 A;  4TR4 A;  1F3B A;  3GYK A;  2EFC A;  4BVY A;  4MZW A;  4IKH A;  2H1G A;  5DQS A;  4J57 E;  4HDE A;  3QOU A;  2FHE A;  2XBI A;  3M9J A;  2YWN A;  2MMN A;  4FO5 A;  1TU7 A;  3UVT A;  2H19 A;  2CZ2 A;  3CTG A;  2WCI A;  4TXO A;  2VL9 A;  1DE2 A;  1SKS B;  2XC2 A;  5B8A A;  4NPB A;  2E0Q A;  4ZB9 A;  1SK2 A;  4MF5 A;  3N9J A;  4MMM A;  4F03 A;  4L0U A;  5ECP B;  4WKW A;  1GSD A;  3LSZ A;  5JWQ B;  1O81 A;  3CXG A;  1YVL A;  5IMF A;  2E7P A;  5HFG A;  3FRC A;  3UBL A;  4I2U A;  1GTB A;  3TKS C;  4EDZ A;  3HCZ A;  1HD2 A;  2VKZ G;  3IPZ A;  2EIO A;  4L8E A;  3M0F A;  2HRN A;  1QK8 A;  4FYB A;  4P3Y B;  3ZVJ D;  1PX6 A;  1FOV A;  2QA2 A;  2F8A A;  5JWO B;  1R26 A;  4HU7 A;  2DSA A;  3KTB A;  4J2F A;  2R6K A;  1U3A A;  2VD1 A;  2DJ1 A;  3P90 A;  4IS0 A;  3KP9 A;  4YKF A;  1G0T A;  1THX A;  1R5P A;  4HZ4 A;  1JZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...