4BVYB

Crystal structure of the aimp3-mrs n-terminal domain complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
168
Chain Sequence
SMAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNDGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFSHIQHYPGIRQHLSSVVFIKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE--TRNA LIGASE, CYTOPLASMIC
publication title Crystal Structure of the Aimp3-Mrs N-Terminal Domain Complex
rcsb
source organism Homo sapiens
molecule tags Ligase/translation
total genus 57
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2013-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4bvyB02
3.40.30.90 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4bvyB01
1XWKA 4I97A 5DQSA 1F3BA 3FR3A 2VCWA 3R3EA 3PGTA 3P90A 4NAXA 1K0NA 5ECNB 1YKCA 4MPFA 3ZFLA 4MZWA 1U87A 3F63A 4GLTA 4BVYA 4IBPA 4YH2A 4OFTA 2HRKA 4YQUA 5A4VA 1EV4A 1Y6EA 2VD1A 4K0GA 5DAKB 19GSA 4Q5QA 4F0BA 3KJYA 3PPUA 4HOJA 4CHSA 3IK7A 1JZRA 1RK4A 4EXJA 5EVOA 3UBLA 5DJMA 2VCZA 1GWCA 4HJ2A 2CA8A 4IELA 12GSA 1BX9A 3O3TA 5D9TA 1U88A 4O92A 3VWXA 5DALA 1EOHA 2VCTA 1JLVA 2PERA 5AGYA 1GLQA 3M0FA 2DC5A 2IMIA 1YJ6A 1GSUA 1K0CA 3I6AA 1GTIA 3DGQA 4IJIA 2HSMB 3UVHA 5EY6A 3NIVA 1B8XA 2PBJA 3GSTA 3WYWA 4YAVA 4PNGA 1MD4A 4Q5NA 4MF7A 4GSNA 4MDCA 2C4JA 3LFLA 5JCUA 1U3IA 4BVXA 1GLPA 5ECMB 1F3AA 5HFKA 1YDKA 5G5FA 5DJLA 1GSEA 3CSHA 2R6KA 3M8NA 16GSA 3KXOA 1VF1A 2HRAA 1XWGA 2GDRA 3QAGA 4FQUA 4DEJA 6GSWA 1TU7A 3R2QA 1LJRA 3G7JA 4G19A 4YQMA 1XW5A 1R5AA 2PGTA 3N9JA 1GTBA 3F6FA 2R3XA 4G0IA 4G0KA 4JEDA 3M3MA 1E6BA 2ON5A 4AGSA 2CZ3A 2WRTA 1K0MA 3GSSA 4ACSA 5ECKB 1EOGA 4QQ7A 1ZL9A 5FWGA 4EDZA 1XW6A 2WS2A 2PVQA 4ISDA 5J5NA 5D9XA 4E8EA 1V40A 1K3LA 1GUKA 3IC8A 3KM6A 4KSMA 4BVYB 3CRUA 1G6WA 2HSNB 2HRKB 1VF4A 2R4VA 2N5FA 5ELGA 4G0LA 4WR5A 1G6YA 1GTAA 5J4UA 1GNEA 1PGTA 3TOUA 1V2AA 5AIXA 4ECIA 4IKHA 1NHYA 1Q4JA 3UARA 5ELAA 3BBYA 1HNCA 3LJRA 2WB9A 3GTUA 2C8UA 2YCDA 5ECOB 2VCXA 1VF3A 3KTLA 5DALB 3MDKA 3PR8A 1IYHA 4ZB9A 1AW9A 3EINA 6GSTA 3MAKA 2GSTA 1KBNA 5JCWA 2WJUA 3ISOA 3HJOA 4Q5RA 13GSA 4PX1A 2AB6A 3VPTA 4OMVA 4EE0A 5KEJA 1YQ1A 2OA7A 11GSA 3FR6A 1AQXA 2YV7A 2CAIA 1M99A 4BVXB 3D0ZA 4HZ2A 4WR4A 5A4WA 1M9BA 3GX0A 2LJRA 2VCQA 2IMKA 4ECCA 3LG6A 3N5OA 4G9HA 4ECJA 1GUMA 3LQ7A 3FR9A 3ZMLA 1K3YA 1PA3A 2PMTA 2A2SA 2UZ8A 3GH6A 3W8SA 2J9HA 2AHEA 1EEMA 1BAYA 3HKRA 2C3QA 1OE7A 2OACA 3H1NA 1A0FA 1UA5A 4N0VA 4PTSA 3CSJA 4IVFA 1BG5A 5AIVA 4ECBA 5FHIA 5F8BA 3VK9A 1K0AA 3FYGA 1GUHA 17GSA 2A2RA 5GSSA 2R5GA 4NHWA 4IGJA 3FRCA 4K0NA 1PMTA 3P8WA 5B7CA 4O7HA 5D9WA 4F03A 5LD0A 4PXOA 7GSSA 2NTOA 4L5OA 3LXZA 2HNLA 3IK9A 5F07A 4ZXGA 2C80A 4GTUA 3ERGA 1MTCA 3KMOA 3EE2A 1B4PA 5ECSA 5ECLB 1VF2A 2GTUA 4EDYA 4IS0A 2VD0A 4G10A 1GSQA 2IL3A 1TDIA 3I69A 5GZZB 3VLNA 2WDUA 4L5LA 2CVDA 4PQIA 3GTUB 5IQYA 4BL7A 3AY8A 1ML6A 3IE3A 5D73A 18GSA 2X64A 3TGZA 5BMUA 1M0UA 5FT3A 1FW1A 1B48A 5EL8A 4HZ4A 1PX7A 1PKWA 3RBTA 1PKZA 3ZMKA 1JLWA 3G7IA 5D9VA 14GSA 1YY7A 4YQVA 1ZGNA 6GSSA 1MD3A 22GSA 4USSA 4JZQA 1C72A 4KX4A 4Q5FA 5AISA 1G7OA 3O76A 1GSYA 4IQ1A 2FHEA 5DCGA 4TOPA 1M9AA 1PX6A 2V6KA 3LSZA 3LYKA 4ZBDA 9GSSA 1HNBA 4IQAA 1GSFA 4PURA 3CRTA 4MF5A 3QAWA 4MK3A 1K3OA 3VURA 3TOTA 2AAWA 3GURA 1HQOA 3WD6A 3SWLA 4YAPA 1BYEA 2C3TA 5AN1A 8GSSA 4PQHA 2F8FA 2ON7A 1K0OA 2CZ2A 2GSQA 2OADA 3LYPA 2CAQA 4ZB8A 1GSDA 5LCZA 5J41A 5ECRB 3Q19A 6GSUA 1TW9A 3Q18A 1N2AA 1AXDA 4KDYA 5F05A 5DAKA 4PNFA 2F3MA 2GLRA 1K0BA 3CSIA 4ZB6A 3UBKA 1HNAA 1F2EA 4ZBAA 1AQVA 2DSAA 3U6VA 5G5EA 4LMWA 1EV9A 3VI7A 1PD21 4GF0A 3QR6A 1OE8A 4KF9A 5ECIB 4EC0A 2GSRA 4BL7B 3IR4A 4MF6A 3VI5A 1IYIA 4RI7A 4KDXA 4PGTA 5GSTA 2D2ZA 1PN9A 1OYJA 2VO4A 1GSSA 3HJMA 1K0DA 1Z9HA 6GSYA 3KMNA 4IW9A 4KH7A 1GNWA 3M1GA 2HSMA 4MP4A 4KGIA 4J2FA 4OFMA 1PL2A 1LBKA 1AQWA 1DUGA 3LXTA 2GSSA 2YV9A 3Q74A 5ECQB 5F06A 1USBA 2JL4A 4JBBA 1GULA 2HQTA 3DD3A 3ZFBA 3C8EA 3IBHA 4KDUA 4NHZA 1PL1A 1FHEA 4KAEA 4L8EA 1OKTA 6GSVA 2FNOA 5A4UA 20GSA 3ERFA 4GCIA 4RI6A 4LMVA 1GTUA 5ECPB 10GSA 3FY7A 4GSSA 4MPGA 3CBUA 5ECHB 4ID0A 5F0GA 4PUAA 4KE3A 4OFNA 5A5KA 2VCVA 3QAVA 3VPQA 1TU8A 4GSTA 4E8HA 4F0CA 2C3NA 4ZBBA 4HI7A 5DDLA 3GUSA 3L0HA 6GSXA 3UAPA 3F6DA
chains in the Genus database with same CATH superfamily
1XWKA 4I97A 1F3BA 1VRSD 5IOWA 3IHGA 5KOWA 3FR3A 2VCWA 3KZQA 3P90A 4NAXA 1J0FA 4MPFA 3ZFLA 4MZWA 2IFQA 3F63A 4GLTA 3C1SA 5JCGA 2HSNA 5CRHA 4OFTA 2PVOC 5A4VA 1Y6EA 2VD1A 2WW3A 5DAKB 4Q5QA 4F0BA 2YWOA 2LS5A 2VAFA 4CHSA 1FOHA 1FOVA 1JZRA 5EVOA 4QL7A 1X5CA 2VCZA 5IMZA 1GWCA 1NM3A 4XS6A 2HI7A 3TJJA 1EOHA 2VCTA 4NV2A 5AGYA 1G7EA 2FWGA 4POBA 3M0FA 1F37A 2DIZA 2H30A 1GSUA 2NPBA 3I6AA 3BD2A 3VWWA 2L6CA 3NIVA 1W89A 4QL9A 2PBJA 4AKIA 5IMVA 2H0HA 4GDFA 3RAZA 2NDOA 3D4MA 3IHQA 5ECMB 2EFEA 2HXKA 5HFKA 1TRWA 1YDKA 2AJQB 1M2AA 2I1UA 2QSIA 3M8NA 4TR3A 3WT2A 2F9SA 2GDRA 2YJ7A 2H1DA 2WW2A 5D93A 4YKGA 2MMNA 3W8JA 1LJRA 1N25A 3GL3A 2PGTA 4PQ1A 2R3XA 5CREA 4POLA 4G0KA 2VOCA 2L6DA 3PH9A 4QQ7A 4EDZA 1XW6A 2GT6A 4K1FA 2WS2A 3PINA 3HZ8A 4PI2C 3CRUA 5COHA 1VF4A 4ZILA 3HVSA 1G6YA 4MH3A 4ECIA 2DBCA 5CAXA 4OCEA 1Q4JA 2X4AA 3LJRA 3GTUA 3RDWA 4CW9A 5J47A 1VF3A 5DALB 2DMLA 3ZRDA 2VLVA 3PR8A 1IYHA 3A2XA 4JE1A 3DEXA 3EINA 6GSTA 4TVEA 5JCWA 2HZEA 5G1LA 4AKHA 1B4QA 4O5RA 2RIIA 3JCML 4Q5RA 3D4TA 4PX1A 3VPTA 2JZRA 2DJ3A 1AC1A 3FR6A 2YV7A 1M99A 4BVXB 4IJ3A 5IM9A 4WR4A 5A4WA 1M3IA 1M2DA 2VL2A 4ECCA 4CY8A 3LG6A 3N5OA 2VIMA 4ECJA 1M2BA 1K3YA 2PMTA 2A2SA 1S3AA 2HRNA 4K7IA 4L0WA 2F51A 2YPMA 3M9KA 3EPTA 4FO5A 4V1Ag 3LW9A 4DSSA 2G2QA 2EFHA 1K0AA 2B7KA 4D73B 1TI1A 4HSCX 1SJ6A 1GUHA 5GSSA 2K18A 1RQMA 2WVZA 3FRCA 2B3SA 1SKSB 1H75A 4BWSA 2PWJA 4PXOA 2NTOA 2BMXA 4N30A 2C80A 3ZIVA 3ERGA 1MTCA 3EE2A 1B4PA 4A5PA 4EIPA 2XHFA 2LSTA 3IPZA 3E3EA 5GZZB 2IJYA 1ZYQB 2YANA 5IMDA 2CVDA 3SBCA 2FA4A 4O32A 1YKAA 1M0UA 2FGXA 2H70A 1TI3A 3HY2A 1FW1A 2PU9C 3APQA 5A5HB 1HYUA 3TKSE 5EL8A 4HZ4A 2OBIA 3RBTA 3IV4A 1PKZA 1UN2A 1JLWA 5D9VA 3HVNA 3DWVA 1JZDA 2C0EA 14GSA 1TOFA 2N5BA 4F9ZA 1ON4A 3ZIJA 4USSA 2R2JA 4KX4A 1QMVA 5AISA 1GSYA 4MLYA 1OC9A 1RW1A 1M9AA 1DSBA 2QC7A 2ZUPA 2V6KA 1MDIA 3LYKA 3TJBA 4O5UA 5HFIA 9GSSA 5A1NB 1SVLA 1T7PB 2IMFA 3CQFA 3DVWA 1WMJA 2K6VA 1SL1B 3VURA 2QGVA 3DKSA 5KN1A 1YEPA 2ZNMA 3SWLA 1Z6NA 2RM6A 5BRTA 2K9FA 2YWMA 2F8FA 2ON7A 1K0OA 1BEDA 4V1Ap 1GSDA 3FHKA 2VUPA 5A1NA 5ECRB 3ZTLA 1XG8A 2E2MA 2X49A 4KDYA 2E2GA 3RPNA 3WT1A 5F05A 4PNFA 2F3MA 1K0BA 4WF5A 1O81A 5ID2B 3US3A 1HNAA 4ZBAA 1V57A 3DVXA 2VLTA 2DJ0A 5G5EA 2R0CA 4LMWA 1EV9A 1V98A 3VI7A 4N0ZA 4GF0A 1OE8A 4KF9A 3HD5A 4BL7B 3VI5A 3I9V2 2H6XA 5GSTA 3L78A 2D2ZA 1PN9A 1OYJA 1K0DA 3TKSC 5ID2A 3KMNA 2O89A 2V6OA 4IW9A 4WEYA 4MP4A 4J2FA 2RUFA 5CRWA 1X5DA 4I5QA 1USBA 2H66A 1XFLA 1GULA 2HQTA 3DD3A 2M80A 2HT9A 1PL1A 3UEMA 3HXSA 4KAEA 4BWQA 4RI6A 2CX3A 3F3QA 3ZVJD 1GTUA 4MPGA 3L9UA 5ECHB 4ID0A 2L5OA 4KE3A 2R37A 3HVVA 1TU8A 2Z9SA 2H1GA 4X0XA 3GUSA 4V2LA 3QFAC 3EURA 2LRTA 1JZWA 2OJLA 4K2DA 1YF0A 2TRXA 4XS4A 1JFUA 2HFDA 2GQMA 3LGCA 4BVYA 4IBPA 3ZITA 4YH2A 4K7NA 5HFGA 3APOA 2QA2A 1AUCA 3IDVA 4MZCA 3KJYA 2JZSA 1WPIA 2JZTA 1W4VA 2C1YA 1X0RA 2EIRA 4PUFC 3IK7A 1Z6MA 4KCAA 1OKDA 3UBLA 5ABRA 1M3JA 3W6GA 2CA8A 2VL9A 1R4WA 12GSA 3O3TA 1MDKA 4HS1A 3P2AA 1YJ6A 4POMA 2WZ9A 1SKRB 4WBJA 3DGQA 2HSMB 3UVHA 2FY6A 5EY6A 2KHPA 1B8XA 3GSTA 3EYTA 4MJBA 3WYWA 1FVJA 3L4NA 4PNGA 4Q5NA 1R7HA 3LFLA 1A2LA 2I3YA 4Z2RA 4DSQA 4XIHA 3GMFA 2ZCTA 5G5FA 5DJLA 2L5LA 2AYTA 3CSHA 2R6KA 3E9JB 3KXOA 2M72A 2A4VA 3D6IA 1VF1A 1S3DA 2HRAA 4FQUA 1DE2A 6GSWA 2LV3A 3MWHA 3G7JA 3CMIA 1XW5A 3GKNA 4G0IA 4JEDA 3M3MA 3GSSA 4AKGA 1EOGA 2E7PA 3FKFA 1S3RA 2HRFA 2PVQA 5J5NA 1V40A 4OO4A 2IFQB 2V1MA 4KNDA 2DJ1A 1G6WA 2HSNB 4G0LA 2H72A 3GX8A 1B9YC 1GNEA 1PGTA 2ES7A 2MMOA 4JRRA 3F4TA 4IKHA 4OD7A 2WFCA 4EO3A 3BBYA 1R26A 2YCDA 1ST9A 2VCXA 1I5GA 3GHAA 5HR0A 1KEBA 4X1UA 2O7KA 1T8EB 1QXHA 2BJXA 3FZ9A 4J57E 3HYPA 4RUVA 5JWRB 1SK0A 3HJOA 3TRQA 4CY6A 2LKUA 2WVYA 13GSA 2DJKA 2ALBA 4BA7A 4OMVA 2GZYA 5G2ZA 4AJ7A 1AQXA 3D0ZA 3KTBA 1TKDB 1SENA 2KP2A 2LJRA 2UV8G 1O7UA 3ZZXA 4GWRA 1YEXA 4XRAA 2LQQA 2H75A 2UZ8A 1A23A 4TRXA 2J9HA 4EIQA 2XPEA 2C3QA 2G0FA 3TKRA 2XBQA 4F82A 2VL2C 2H1AA 3H1NA 1A0FA 3DYRA 4PTSA 2YZHA 3CSJA 2CVBA 1N8JA 3TRPA 4ECBA 2B7JA 5HR3A 3H79A 1BG1A 2JU5A 4WXTA 5DVBA 3FYGA 3KH9A 2WGRA 17GSA 3FZ5A 3P8WA 4O7HA 3FZ4A 4L5OA 1SK2A 2F8AA 1YEWC 4ZXGA 1QQ2A 3QFBC 5ECSA 5ECLB 2J23A 2YP6A 2JACA 4EDYA 4MA9A 1PFOA 1KTEA 2KLXA 4G10A 4FIWA 4K5RA 4WBRD 3WGXA 2IL3A 3I69A 1MDJA 5EPFA 4PQIA 3GTUB 5IQYA 3FEUA 4P3YB 3U5RE 3AY8A 2EIQA 3IE3A 2X64A 3TGZA 5BMUA 2YN1A 4EUYA 2RUEA 4XHMA 5FT3A 1A0RP 1B48A 3APSA 4TR4A 4AJ8A 1PKWA 5C00A 2HZEB 3HVXA 4HUAA 5GAND 4AJ6A 5IMFA 1JZOA 1ZOFA 2P5QA 5IPHA 3F4SA 1ZGNA 4JZQA 1Y25A 4Q5FA 4ZL7A 2PN8A 2EFDA 1TK5B 4IQ1A 3CXGA 2XPDA 2L4QA 5DCGA 2H6ZA 3CTGA 4I2UA 2IN3A 4K9ZA 5DCHA 1PX6A 1WRYA 1NSWA 4IQAA 1GSFA 4PURA 4MF5A 3Q6OA 3QAWA 3L9SA 2AAWA 3GURA 1Q98A 3WD6A 4PI0C 1BYEA 1T00A 4DSSB 4IP6A 4PQHA 2CZ2A 4MH2A 3DMLA 3Q19A 1TW9A 4W66A 2MMAA 2IWTA 1AXDA 2X99A 3QD9A 2OE3A 2K8VA 4NPBA 2OT3A 3U6VA 3GL5A 3QPMA 5G30A 1QK8A 1OC8A 2FWFA 3QR6A 3GKXA 2GS3A 1IYIA 4KDXA 4TXOA 3HJMA 4GQFA 2KUCA 1SD8A 2C0GA 2I81A 2X8GA 4IP1A 3L9VA 4TR1A 3VFIA 4KH7A 1SD9A 3ZLPA 5CO3A 2H19A 2O3EA 4KGIA 2CT6A 2MBSA 5ECQB 2GSSA 3Q74A 5IO0A 3K8NA 4DVCA 4X43A 2LJAA 3J7Yb 1ZMAA 1THXA 2MBTA 3ZFBA 4MJAA 4L8EA 1OKTA 1OC9B 4O5QA 1OVNA 4GCIA 4LMVA 3QCPA 3FY7A 1PRXA 4GSSA 2KOKA 2H1BA 3WGDA 5H5RA 4V2MA 1EZKA 4LLRA 3IC4A 1X9WB 2VM1A 1BF5A 2YJHA 5DDLA 1F9MA 1XPVA 4RQXA 3L0HA 4KSOA 1Y1UA 3ED3A 5G31A 3S9FA 3R3EA 3PGTA 1OAZA 1K0NA 5ECNB 1YKCA 5J9CA 1ZYEA 1XZOA 2HRKA 1OC3A 1TRUA 4TN8A 19GSA 4HOJA 1SU9A 5IO2A 1SKWB 1ILOA 1RK4A 1A2MA 2DJJA 5H5SA 5DJMA 1THOA 2WVXA 1SK1A 2LTKA 3HZ4A 5D96A 4EL1A 4IELA 3NOFA 1O73A 5IMCA 4HU9A 5D9TA 4O92A 3F9UA 2PERA 2RM5A 1GLQA 4ZL9A 2EC4A 4OWYA 4POKA 5H5QA 1SJIA 1U3AA 1T4YA 1URMA 2O8VB 1GTIA 4IJIA 1FG4A 4TKYA 3GKKA 3TKQA 4YAVA 4MF7A 4GSNA 2O85A 4MDCA 1YVLA 1U3IA 4G01A 1GLPA 4LA1A 2VKZG 5CRGA 5DQYA 3ZYWA 2FA8A 16GSA 1SYRA 1B9XC 2HE3A 1XWGA 4DEJA 3ZREA 1YF1A 3DIEA 3TCOA 2TRCP 2WULA 4G19A 4YQMA 1JHBA 2XBIA 1GTBA 3P7XA 3TKPA 2L57A 1E6BA 2H71A 4AGSA 2CZ3A 4ACSA 3UJ1A 4XS4B 5FWGA 2MMZA 1O6JA 4ISDA 4E8EA 2R0GA 4KCEA 3F4RA 1EGRA 3TRXA 1GUKA 3IC8A 3KM6A 4BVYB 1H4OA 3EU3A 5G1KA 2R4VA 2N5FA 1GTAA 2TIRA 3A5WA 1V2AA 2CQ9A 3BOAA 3EMPA 3ERWA 2YOIA 4PHZC 1S3CA 1T4ZA 1HD2A 3FW2A 2LQOA 5ELAA 4J56E 4JR4A 2I4AA 2C8UA 3I43A 1PQNA 3KTLA 5HR2A 5J4VA 3VWVA 4ZB9A 1UVZA 1MEKA 2AV4A 2DIYA 4HQSA 3GV1A 2WJUA 5J4YA 4BIKA 3D22A 1YZXA 2AB6A 3RHBA 2B5XA 3BCIA 1TK0B 3KH7A 1YQ1A 1J08A 3FK8A 2CAIA 3QOUA 4HZ2A 4XCSA 1XWAA 3GX0A 2IMKA 1GUMA 3LQ7A 1XXUA 1PA3A 5KN3A 2DMMA 1GP1A 3BJ5A 2AHEA 1BAYA 4L0UA 3HKRA 1OE7A 2VLUA 4TXVA 1UA5A 4N0VA 4IVFA 1EP7A 2O36A 5AIVA 5FHIA 3TKSA 5JWOB 3CYNA 3O6TA 2A2RA 4KUNA 4KW6A 1X5EA 2R5GA 5E4WA 4NHWA 4K0NA 2YNXA 1WP0A 5D9WA 5LD0A 2P0GA 3LXZA 2V41A 2HNLA 3IK9A 5F07A 3NZNA 3HMJG 1S4BP 1T3BA 2DLXA 2I9HA 3LORA 1AAZA 1VF2A 5ENUA 2NBSA 4TR0A 4IS0A 2O87A 2PPTA 3KD0A 4GRFA 1ML6A 3HDCA 2C0DA 4XTSA 5B8AA 2YWIA 3MIXA 5HR1A 2WW0A 3ME7A 1E2YA 3EWLA 3GYKA 2V32A 3G7IA 1SJZA 1YY7A 4YQVA 3EC3A 4ZB7A 5A34A 1QFNA 5D8IA 1MD3A 22GSA 3TUEA 1VGLA 4RQRA 1ABAA 3O76A 3EMXA 3GH9A 2FHEA 1GL8A 4TOPA 3C71A 3OR5A 1A24A 3IOSA 1SL2B 1TRSA 4N3ZA 3LSZA 1CQHA 4FYBA 1HNBA 3MNGA 1T1VA 4OO5A 2GQKA 1ERTA 1TJDA 2X8CA 1K3OA 3FMWA 3IXRA 3TOTA 2R0PA 4I6XA 1HQOA 4NWYA 2GQLA 2REMA 4MABA 2C3TA 5AN1A 2OE1A 3LYPA 2WW1A 5LCZA 4TW5A 5J41A 3G9BA 1XIYA 6GSUA 1XWBA 3EU4A 3Q18A 4ILFA 3RFRC 1FB6A 3RHCA 4WF4A 2K8SA 1WOUA 1FO5A 5DAKA 4NXIA 4DSRA 1CQGA 1FB0A 4MNNA 4ZB6A 2DJ2A 1TXXA 1F2EA 2H0GA 2H0IA 4MMMA 3E0UA 4FYUA 2GGTA 1NHOA 3RGBC 2JADA 1PD21 2E0QA 1V58A 5ECIB 2EIOA 2GSRA 3IR4A 4RI7A 4PGTA 5BMUB 2VO4A 1GSSA 5IOXA 1PSQA 1Z9HA 1X9MB 6GSYA 3ME8A 3HJPA 1DBYA 2P5RA 3M1GA 1NW2A 1UC7A 1LU4A 5B6NA 1KNGA 4OFMA 1PL2A 1LBKA 2L4CA 1AQWA 1DUGA 1O85A 4LL1B 2JL4A 2LNTA 4HU7A 4K6XA 3C8EA 3IBHA 4KDUA 4NHZA 5CYYA 2B5EA 2FNOA 5A4UA 4F2IA 3IAS2 4Z7XA 2VM2A 10GSA 4ML1A 4G2EA 2BTOT 4H86A 2VCVA 4HJMA 1SVOA 3F3RA 2C3NA 4ZBBA 2A2PA 2B6MA 3F8UA 3UAPA 3A2WA 5DQSA 3FZAA 1XOBA 5CNWA 5CP1A 5INYA 1TK8B 4HQZA 2IMEA 3QDNA 1U87A 2FWEA 4QMKA 4YQUA 1TTZA 1EV4A 4K0GA 1ZYPA 3UVTA 3PPUA 1I1IP 3H8QA 1ZZYA 3G7YA 1FAAA 2DKIA 3TDGA 4AI6A 4EXJA 4HJ2A 2HSYA 1EP8A 2QA1A 3IAM2 1BX9A 4EKZA 1U88A 3VWXA 5DALA 3IA1A 4TXOB 2H01A 5J40A 1JLVA 1O8WA 2DKHA 2DC5A 2IMIA 4X4JA 3MSZA 1K0CA 4TR1B 4KA0A 1ERUA 3TJFA 1A8LA 2CV4A 5IMAA 5KN0A 4MJCA 1MD4A 2AUVA 1QUWA 3F0IA 2JSZA 3KCMA 2C4JA 5JCUA 4MJEA 2WZSA 2B1KA 1PN0A 4BVXA 2IMDA 1F3AA 2LEGA 4K7OA 4EVMA 1WWJA 3CTFA 1GSEA 1XBSA 2VL3A 2HYXA 3GNJA 2L59A 3LWAA 3QAGA 1XWCA 1TU7A 3R2QA 4XRDA 4K5SA 3GN3A 3N9JA 1R5AA 3F6FA 5B6MA 3GRXA 3KP9A 3MYDA 2ON5A 2PUKC 3J7Yk 1V9WA 2WRTA 1K0MA 1AIUA 4OCFA 3TJGA 1WJKA 2OKAA 2B5YA 5ECKB 2OBKA 4Z2TA 4D73A 1TRVA 3KIJA 3UL3A 1ZL9A 4N11A 2LUSA 5D9XA 2H73A 1K3LA 4KSMA 2GZZA 3KGKA 2HRKB 3UMAA 5B8BA 4ICYA 5ELGA 2HSHA 4WR5A 5J4UA 2LJKA 3TOUA 2GT5A 3DRNA 1Z5YE 5KOXA 3V1WA 4AKXB 5AIXA 2JSYA 3KP8A 1O8XA 1NHYA 4I8BA 3UARA 2WVXB 2YWNA 1HNCA 4HEA2 4WETA 2WB9A 5IPGA 4ZIJA 3A2VA 5ECOB 4K2XA 3MDKA 1EGOA 3A3TA 1AW9A 5A5HA 3MAKA 2GSTA 1ACVA 1EWXA 1KBNA 1I9DA 2B1LA 2C0FA 2H8LA 3ISOA 5DBQA 1F6MC 3D21A 2V2GA 3HA9A 2QKEA 4WKWA 1A2JA 2P31A 4EE0A 5KEJA 2N5AA 2OA7A 11GSA 5J9BA 1TP9A 1M9BA 4BPYA 2M46A 2VCQA 4LL4B 4G9HA 5IIZA 4KB3A 2H76A 3FR9A 3ZMLA 2H74A 5E59A 4CDOA 3GH6A 3W8SA 3TJKA 4IHUA 1QGVA 4AF2A 1EEMA 4E68A 3GIXA 1Z7RA 2CX4A 2HLSA 4ML6A 1J9BA 2FLSA 2OACA 3M9JA 2FCHA 2H1LA 1BG5A 2KP1A 2GVPA 5CRDA 3C1RA 2FWHA 4NMUA 5F8BA 3VK9A 1ZCPA 3A5IA 4GQCA 4IGJA 2IPAA 1PMTA 5B7CA 2YZUA 4F03A 4FYCA 1FVKA 7GSSA 3LEFA 2FD3A 2X8HA 4GTUA 4I2TA 3BCKA 3KMOA 3HHVA 1XVQA 2GTUA 2LNSA 2VD0A 1GSQA 2XC2A 1BJXA 1TDIA 3VLNA 2WDUA 4L5LA 4BL7A 3ZVJA 5D73A 18GSA 4JR6A 1ERVA 1GRXA 4XS1A 1PX7A 4Z2UA 1WE0A 3ZMKA 4N10A 4EF0A 2WCIA 5HQPA 4MCUA 2O5VA 4V2NA 6GSSA 1C72A 4MZBA 5C04A 5KN2A 1G7OA 1GH2A 5GAPD 1SL0B 4K8MA 4ZBDA 4JU5A 3WGEA 3CRTA 3IRAA 4FH8A 4MK3A 2LRCA 3ZL5A 4YAPA 3UIWA 3CWGA 1XW9A 8GSSA 2GSQA 2OADA 2CAQA 4ZB8A 5LNKe 3CHXC 5L71A 1BQ7A 1ZYNA 2A4HA 2HZFA 3GA4A 3TB2A 3H93A 3UOMA 1SVMA 1N2AA 3KEBA 2H6YA 1XOAA 2GLRA 2LRNA 3CSIA 3UBKA 1AQVA 2DSAA 1TXUA 3D5JA 4FXYP 3DXBA 1XVWA 1A8YA 4IN0A 1ERWA 3RPPA 4EC0A 4MF6A 1U6TA 2OE0A 1Z7PA 2MZCA 2RLIA 4ZL8A 1Z3EA 4ULXA 3EVIA 1EEJA 1GNWA 2HSMA 3C7MA 4GXZA 5F06A 3LXTA 2YV9A 2FUG2 4JBBA 5A34B 3VWUA 5J3RA 2GZPA 3QMXA 2IIYA 1FHEA 4YKFA 6GSVA 1DE1A 2NVLA 3HCZA 20GSA 1M7TA 1R5PA 3C73A 3TU3B 3ERFA 1G0TA 1XCCA 1SYXA 3H4KA 5ECPB 2EFCA 4HDEA 3CBUA 5F0GA 4PUAA 1X9SB 4OFNA 5A5KA 3QAVA 3VPQA 4GSTA 4E8HA 4NV5A 4F0CA 5JWQB 4HI7A 1WIKA 2MYGA 3GFKA 6GSXA 3GKMA 3F6DA 2CVKA
chains in the Genus database with same CATH topology
1XWKA 4I97A 1F3BA 1VRSD 5IOWA 3IHGA 5KOWA 3FR3A 2VCWA 3KZQA 3P90A 4NAXA 1J0FA 4MPFA 3ZFLA 4MZWA 2IFQA 3F63A 4GLTA 3C1SA 5JCGA 2HSNA 5CRHA 4OFTA 2PVOC 5A4VA 1Y6EA 2VD1A 5DAKB 4Q5QA 4F0BA 2YWOA 2LS5A 2VAFA 4CHSA 1FOHA 1FOVA 1JZRA 5EVOA 4QL7A 1X5CA 2VCZA 5IMZA 1GWCA 1NM3A 4XS6A 2HI7A 3TJJA 1EOHA 2VCTA 4NV2A 5AGYA 1G7EA 2FWGA 4POBA 3M0FA 1F37A 2DIZA 2H30A 1GSUA 2NPBA 3I6AA 3BD2A 3VWWA 2L6CA 3NIVA 1W89A 4QL9A 2PBJA 4AKIA 5IMVA 2H0HA 4GDFA 3RAZA 2NDOA 3D4MA 3IHQA 5ECMB 2EFEA 2HXKA 5HFKA 1TRWA 1YDKA 2AJQB 1M2AA 2I1UA 2QSIA 3M8NA 4TR3A 3WT2A 2F9SA 2GDRA 2YJ7A 2H1DA 5D93A 4YKGA 2MMNA 3W8JA 1LJRA 1N25A 3GL3A 2PGTA 4PQ1A 2R3XA 5CREA 4POLA 4G0KA 2VOCA 2L6DA 3PH9A 4QQ7A 4EDZA 1XW6A 2GT6A 4K1FA 2WS2A 3PINA 3HZ8A 3CRUA 5COHA 1VF4A 4ZILA 3HVSA 1G6YA 4MH3A 4ECIA 2DBCA 5CAXA 4OCEA 1Q4JA 2X4AA 3LJRA 3GTUA 3RDWA 4CW9A 5J47A 1VF3A 5DALB 2DMLA 3ZRDA 2VLVA 3PR8A 1IYHA 3A2XA 4JE1A 3DEXA 3EINA 6GSTA 4TVEA 5JCWA 2HZEA 5G1LA 4AKHA 1B4QA 4O5RA 2RIIA 3JCML 4Q5RA 3D4TA 4PX1A 3VPTA 2JZRA 2DJ3A 1AC1A 3FR6A 2YV7A 1M99A 4BVXB 4IJ3A 5IM9A 4WR4A 5A4WA 1M2DA 2VL2A 4ECCA 4CY8A 3LG6A 3N5OA 2VIMA 4ECJA 1M2BA 1K3YA 2PMTA 2A2SA 1S3AA 2HRNA 4K7IA 4L0WA 2F51A 2YPMA 3M9KA 3EPTA 4FO5A 4V1Ag 3LW9A 4DSSA 2G2QA 2EFHA 1K0AA 2B7KA 4D73B 1TI1A 1SJ6A 1GUHA 5GSSA 2K18A 1RQMA 3FRCA 2B3SA 1SKSB 1H75A 4BWSA 2PWJA 4PXOA 2NTOA 2BMXA 4N30A 2C80A 3ZIVA 3ERGA 1MTCA 3EE2A 1B4PA 4A5PA 4EIPA 2XHFA 2LSTA 3IPZA 3E3EA 5GZZB 2IJYA 1ZYQB 2YANA 5IMDA 2CVDA 3SBCA 2FA4A 4O32A 1YKAA 1M0UA 2FGXA 2H70A 1TI3A 3HY2A 1FW1A 2PU9C 3APQA 5A5HB 1HYUA 3TKSE 5EL8A 4HZ4A 2OBIA 3RBTA 3IV4A 1PKZA 1UN2A 1JLWA 5D9VA 3DWVA 1JZDA 2C0EA 14GSA 1TOFA 2N5BA 4F9ZA 1ON4A 3ZIJA 4USSA 2R2JA 4KX4A 1QMVA 5AISA 1GSYA 4MLYA 1OC9A 1RW1A 1M9AA 1DSBA 2QC7A 2ZUPA 2V6KA 1MDIA 3LYKA 3TJBA 4O5UA 5HFIA 9GSSA 5A1NB 1SVLA 1T7PB 2IMFA 3DVWA 1WMJA 2K6VA 1SL1B 3VURA 2QGVA 3DKSA 5KN1A 1YEPA 2ZNMA 3SWLA 1Z6NA 2RM6A 5BRTA 2K9FA 2YWMA 2F8FA 2ON7A 1K0OA 1BEDA 4V1Ap 1GSDA 3FHKA 2VUPA 5A1NA 5ECRB 3ZTLA 2E2MA 2X49A 4KDYA 2E2GA 3RPNA 3WT1A 5F05A 4PNFA 2F3MA 1K0BA 4WF5A 1O81A 5ID2B 3US3A 1HNAA 4ZBAA 1V57A 3DVXA 2VLTA 2DJ0A 5G5EA 2R0CA 4LMWA 1EV9A 1V98A 3VI7A 4N0ZA 4GF0A 1OE8A 4KF9A 3HD5A 4BL7B 3VI5A 3I9V2 2H6XA 5GSTA 3L78A 2D2ZA 1PN9A 1OYJA 1K0DA 3TKSC 5ID2A 3KMNA 2O89A 2V6OA 4IW9A 4WEYA 4MP4A 4J2FA 2RUFA 5CRWA 1X5DA 4I5QA 1USBA 2H66A 1XFLA 1GULA 2HQTA 3DD3A 2M80A 2HT9A 1PL1A 3UEMA 3HXSA 4KAEA 4BWQA 4RI6A 2CX3A 3F3QA 3ZVJD 1GTUA 4MPGA 3L9UA 5ECHB 4ID0A 2L5OA 4KE3A 2R37A 3HVVA 1TU8A 2Z9SA 2H1GA 4X0XA 3GUSA 4V2LA 3QFAC 3EURA 2LRTA 1JZWA 2OJLA 4K2DA 1YF0A 2TRXA 4XS4A 1JFUA 2HFDA 2GQMA 3LGCA 4BVYA 4IBPA 3ZITA 4YH2A 4K7NA 5HFGA 3APOA 2QA2A 1AUCA 3IDVA 4MZCA 3KJYA 2JZSA 1WPIA 2JZTA 1W4VA 2C1YA 1X0RA 2EIRA 4PUFC 3IK7A 1Z6MA 4KCAA 1OKDA 3UBLA 5ABRA 3W6GA 2CA8A 2VL9A 1R4WA 12GSA 3O3TA 1MDKA 4HS1A 3P2AA 1YJ6A 4POMA 2WZ9A 1SKRB 4WBJA 3DGQA 2HSMB 3UVHA 2FY6A 5EY6A 2KHPA 1B8XA 3GSTA 3EYTA 4MJBA 3WYWA 1FVJA 3L4NA 4PNGA 4Q5NA 1R7HA 3LFLA 1A2LA 2I3YA 4Z2RA 4DSQA 4XIHA 3GMFA 2ZCTA 5G5FA 5DJLA 2L5LA 2AYTA 3CSHA 2R6KA 3E9JB 3KXOA 2M72A 2A4VA 3D6IA 1VF1A 1S3DA 2HRAA 4FQUA 1DE2A 6GSWA 2LV3A 3MWHA 3G7JA 3CMIA 1XW5A 3GKNA 4G0IA 4JEDA 3M3MA 3GSSA 4AKGA 1EOGA 2E7PA 3FKFA 2HRFA 2PVQA 5J5NA 1V40A 4OO4A 2IFQB 2V1MA 4KNDA 2DJ1A 1G6WA 2HSNB 4G0LA 2H72A 3GX8A 1B9YC 1GNEA 1PGTA 2ES7A 2MMOA 4JRRA 3F4TA 4IKHA 4OD7A 2WFCA 4EO3A 3BBYA 1R26A 2YCDA 1ST9A 2VCXA 1I5GA 3GHAA 5HR0A 1KEBA 4X1UA 2O7KA 1T8EB 1QXHA 2BJXA 3FZ9A 4J57E 3HYPA 4RUVA 5JWRB 1SK0A 3HJOA 3TRQA 4CY6A 2LKUA 13GSA 2DJKA 2ALBA 4BA7A 4OMVA 2GZYA 5G2ZA 4AJ7A 1AQXA 3D0ZA 3KTBA 1TKDB 1SENA 2KP2A 2LJRA 2UV8G 1O7UA 3ZZXA 4GWRA 1YEXA 4XRAA 2LQQA 2H75A 2UZ8A 1A23A 4TRXA 2J9HA 4EIQA 2XPEA 2C3QA 2G0FA 3TKRA 2XBQA 4F82A 2VL2C 2H1AA 3H1NA 1A0FA 3DYRA 4PTSA 2YZHA 3CSJA 2CVBA 1N8JA 3TRPA 4ECBA 2B7JA 5HR3A 3H79A 1BG1A 2JU5A 4WXTA 5DVBA 3FYGA 3KH9A 2WGRA 17GSA 3FZ5A 3P8WA 4O7HA 3FZ4A 4L5OA 1SK2A 2F8AA 4ZXGA 1QQ2A 3QFBC 5ECSA 5ECLB 2J23A 2YP6A 2JACA 4EDYA 4MA9A 1KTEA 2KLXA 4G10A 4FIWA 4K5RA 4WBRD 3WGXA 2IL3A 3I69A 1MDJA 5EPFA 4PQIA 3GTUB 5IQYA 3FEUA 4P3YB 3U5RE 3AY8A 2EIQA 3IE3A 2X64A 3TGZA 5BMUA 2YN1A 4EUYA 2RUEA 4XHMA 5FT3A 1A0RP 1B48A 3APSA 4TR4A 4AJ8A 1PKWA 5C00A 2HZEB 3HVXA 4HUAA 5GAND 4AJ6A 5IMFA 1JZOA 1ZOFA 2P5QA 5IPHA 3F4SA 1ZGNA 4JZQA 1Y25A 4Q5FA 4ZL7A 2PN8A 2EFDA 1TK5B 4IQ1A 3CXGA 2XPDA 2L4QA 5DCGA 2H6ZA 3CTGA 4I2UA 2IN3A 4K9ZA 5DCHA 1PX6A 1WRYA 1NSWA 4IQAA 1GSFA 4PURA 4MF5A 3Q6OA 3QAWA 3L9SA 2AAWA 3GURA 1Q98A 3WD6A 1BYEA 1T00A 4DSSB 4IP6A 4PQHA 2CZ2A 4MH2A 3DMLA 3Q19A 1TW9A 4W66A 2MMAA 2IWTA 1AXDA 2X99A 3QD9A 2OE3A 2K8VA 4NPBA 2OT3A 3U6VA 3GL5A 3QPMA 5G30A 1QK8A 1OC8A 2FWFA 3QR6A 3GKXA 2GS3A 1IYIA 4KDXA 4TXOA 3HJMA 4GQFA 2KUCA 1SD8A 2C0GA 2I81A 2X8GA 4IP1A 3L9VA 4TR1A 3VFIA 4KH7A 1SD9A 3ZLPA 5CO3A 2H19A 4KGIA 2CT6A 2MBSA 5ECQB 2GSSA 3Q74A 5IO0A 3K8NA 4DVCA 4X43A 2LJAA 3J7Yb 1ZMAA 1THXA 2MBTA 3ZFBA 4MJAA 4L8EA 1OKTA 1OC9B 4O5QA 1OVNA 4GCIA 4LMVA 3QCPA 3FY7A 1PRXA 4GSSA 2KOKA 2H1BA 3WGDA 5H5RA 4V2MA 1EZKA 4LLRA 3IC4A 1X9WB 2VM1A 1BF5A 2YJHA 5DDLA 1F9MA 1XPVA 4RQXA 3L0HA 4KSOA 1Y1UA 3ED3A 5G31A 3S9FA 3R3EA 3PGTA 1OAZA 1K0NA 5ECNB 1YKCA 5J9CA 1ZYEA 1XZOA 2HRKA 1OC3A 1TRUA 4TN8A 19GSA 4HOJA 1SU9A 5IO2A 1SKWB 1ILOA 1RK4A 1A2MA 2DJJA 5H5SA 5DJMA 1THOA 1SK1A 3HZ4A 2LTKA 5D96A 4EL1A 4IELA 3NOFA 1O73A 5IMCA 4HU9A 5D9TA 4O92A 3F9UA 2PERA 2RM5A 1GLQA 4ZL9A 2EC4A 4OWYA 4POKA 5H5QA 1SJIA 1U3AA 1T4YA 1URMA 2O8VB 1GTIA 4IJIA 1FG4A 4TKYA 3GKKA 3TKQA 4YAVA 4MF7A 4GSNA 2O85A 4MDCA 1YVLA 1U3IA 4G01A 1GLPA 4LA1A 2VKZG 5CRGA 5DQYA 3ZYWA 2FA8A 16GSA 1SYRA 1B9XC 2HE3A 1XWGA 4DEJA 3ZREA 1YF1A 3DIEA 3TCOA 2TRCP 2WULA 4G19A 4YQMA 1JHBA 2XBIA 1GTBA 3P7XA 3TKPA 2L57A 1E6BA 2H71A 4AGSA 2CZ3A 4ACSA 3UJ1A 4XS4B 5FWGA 2MMZA 1O6JA 4ISDA 4E8EA 2R0GA 4KCEA 3F4RA 1EGRA 3TRXA 1GUKA 3IC8A 3KM6A 4BVYB 1H4OA 3EU3A 5G1KA 2R4VA 2N5FA 1GTAA 2TIRA 3A5WA 1V2AA 2CQ9A 3BOAA 3EMPA 3ERWA 2YOIA 1T4ZA 1S3CA 1HD2A 3FW2A 2LQOA 5ELAA 4J56E 4JR4A 2I4AA 2C8UA 3I43A 1PQNA 3KTLA 5HR2A 5J4VA 3VWVA 4ZB9A 1UVZA 1MEKA 2AV4A 2DIYA 4HQSA 3GV1A 2WJUA 5J4YA 3D22A 1YZXA 2AB6A 3RHBA 2B5XA 3BCIA 1TK0B 3KH7A 1YQ1A 1J08A 3FK8A 2CAIA 3QOUA 4HZ2A 4XCSA 1XWAA 3GX0A 2IMKA 1GUMA 3LQ7A 1XXUA 1PA3A 5KN3A 2DMMA 1GP1A 3BJ5A 2AHEA 1BAYA 4L0UA 3HKRA 1OE7A 2VLUA 4TXVA 1UA5A 4N0VA 4IVFA 1EP7A 5AIVA 5FHIA 3TKSA 5JWOB 3CYNA 3O6TA 2A2RA 4KUNA 4KW6A 1X5EA 2R5GA 5E4WA 4NHWA 4K0NA 2YNXA 1WP0A 5D9WA 5LD0A 2P0GA 3LXZA 2V41A 2HNLA 3IK9A 5F07A 3NZNA 3HMJG 3LORA 1T3BA 2DLXA 2I9HA 1AAZA 1VF2A 5ENUA 2NBSA 4TR0A 4IS0A 2O87A 2PPTA 3KD0A 4GRFA 1ML6A 3HDCA 2C0DA 4XTSA 5B8AA 2YWIA 3MIXA 5HR1A 3ME7A 1E2YA 3EWLA 3GYKA 2V32A 3G7IA 1SJZA 1YY7A 4YQVA 3EC3A 4ZB7A 5A34A 1QFNA 5D8IA 1MD3A 22GSA 3TUEA 1VGLA 4RQRA 1ABAA 3O76A 3EMXA 3GH9A 2FHEA 1GL8A 4TOPA 3C71A 3OR5A 1A24A 3IOSA 1SL2B 1TRSA 4N3ZA 3LSZA 1CQHA 4FYBA 1HNBA 3MNGA 1T1VA 4OO5A 2GQKA 1ERTA 1TJDA 2X8CA 1K3OA 3FMWA 3IXRA 3TOTA 2R0PA 4I6XA 1HQOA 4NWYA 2GQLA 2REMA 4MABA 2C3TA 5AN1A 2OE1A 3LYPA 5LCZA 4TW5A 5J41A 3G9BA 1XIYA 6GSUA 1XWBA 3EU4A 3Q18A 4ILFA 1FB6A 3RHCA 4WF4A 2K8SA 1WOUA 1FO5A 5DAKA 4NXIA 4DSRA 1CQGA 1FB0A 4MNNA 4ZB6A 2DJ2A 1TXXA 1F2EA 2H0GA 2H0IA 4MMMA 3E0UA 4FYUA 2GGTA 1NHOA 2JADA 1PD21 2E0QA 1V58A 5ECIB 2EIOA 2GSRA 3IR4A 4RI7A 4PGTA 5BMUB 2VO4A 1GSSA 5IOXA 1PSQA 1Z9HA 1X9MB 6GSYA 3ME8A 3HJPA 1DBYA 2P5RA 3M1GA 1NW2A 1UC7A 1LU4A 5B6NA 1KNGA 4OFMA 1PL2A 1LBKA 2L4CA 1AQWA 1DUGA 1O85A 4LL1B 2JL4A 2LNTA 4HU7A 4K6XA 3C8EA 3IBHA 4KDUA 4NHZA 5CYYA 2B5EA 2FNOA 5A4UA 4F2IA 3IAS2 4Z7XA 2VM2A 10GSA 4ML1A 4G2EA 2BTOT 4H86A 2VCVA 4HJMA 1SVOA 3F3RA 2C3NA 4ZBBA 2A2PA 2B6MA 3F8UA 3UAPA 3A2WA 5DQSA 3FZAA 1XOBA 5CNWA 5CP1A 5INYA 1TK8B 4HQZA 2IMEA 3QDNA 1U87A 2FWEA 4QMKA 4YQUA 1TTZA 1EV4A 4K0GA 1ZYPA 3UVTA 3PPUA 3H8QA 1ZZYA 3G7YA 1FAAA 2DKIA 3TDGA 4AI6A 4EXJA 4HJ2A 2HSYA 1EP8A 2QA1A 3IAM2 1BX9A 4EKZA 1U88A 3VWXA 5DALA 3IA1A 4TXOB 2H01A 5J40A 1JLVA 1O8WA 2DKHA 2DC5A 2IMIA 4X4JA 3MSZA 1K0CA 4TR1B 4KA0A 1ERUA 3TJFA 1A8LA 2CV4A 5IMAA 5KN0A 4MJCA 1MD4A 2AUVA 1QUWA 3F0IA 2JSZA 3KCMA 2C4JA 5JCUA 4MJEA 2B1KA 1PN0A 4BVXA 2IMDA 1F3AA 2LEGA 4K7OA 4EVMA 1WWJA 3CTFA 1GSEA 1XBSA 2VL3A 2HYXA 3GNJA 2L59A 3LWAA 3QAGA 1XWCA 1TU7A 3R2QA 4XRDA 4K5SA 3GN3A 3N9JA 1R5AA 3F6FA 5B6MA 3GRXA 3KP9A 3MYDA 2ON5A 2PUKC 3J7Yk 1V9WA 2WRTA 1K0MA 1AIUA 4OCFA 3TJGA 1WJKA 2OKAA 2B5YA 5ECKB 2OBKA 4Z2TA 4D73A 1TRVA 3KIJA 3UL3A 1ZL9A 4N11A 2LUSA 5D9XA 2H73A 1K3LA 4KSMA 2GZZA 3KGKA 2HRKB 3UMAA 5B8BA 4ICYA 5ELGA 2HSHA 4WR5A 5J4UA 2LJKA 3TOUA 2GT5A 3DRNA 1Z5YE 5KOXA 3V1WA 4AKXB 5AIXA 2JSYA 3KP8A 1O8XA 1NHYA 4I8BA 3UARA 2YWNA 1HNCA 4HEA2 4WETA 2WB9A 5IPGA 4ZIJA 3A2VA 5ECOB 4K2XA 3MDKA 1EGOA 3A3TA 1AW9A 5A5HA 3MAKA 2GSTA 1ACVA 1EWXA 1KBNA 1I9DA 2B1LA 2C0FA 2H8LA 3ISOA 5DBQA 1F6MC 3D21A 2V2GA 3HA9A 2QKEA 4WKWA 1A2JA 2P31A 4EE0A 5KEJA 2N5AA 2OA7A 11GSA 5J9BA 1TP9A 1M9BA 4BPYA 2M46A 2VCQA 4LL4B 4G9HA 5IIZA 4KB3A 2H76A 3FR9A 3ZMLA 2H74A 5E59A 4CDOA 3GH6A 3W8SA 3TJKA 4IHUA 1QGVA 4AF2A 1EEMA 4E68A 3GIXA 1Z7RA 2CX4A 2HLSA 4ML6A 1J9BA 2FLSA 2OACA 3M9JA 2FCHA 2H1LA 1BG5A 2KP1A 2GVPA 5CRDA 3C1RA 2FWHA 4NMUA 5F8BA 3VK9A 1ZCPA 3A5IA 4GQCA 4IGJA 2IPAA 1PMTA 5B7CA 2YZUA 4F03A 4FYCA 1FVKA 7GSSA 3LEFA 2FD3A 2X8HA 4GTUA 4I2TA 3BCKA 3KMOA 3HHVA 1XVQA 2GTUA 2LNSA 2VD0A 1GSQA 2XC2A 1BJXA 1TDIA 3VLNA 2WDUA 4L5LA 4BL7A 3ZVJA 5D73A 18GSA 4JR6A 1ERVA 1GRXA 4XS1A 1PX7A 4Z2UA 1WE0A 3ZMKA 4N10A 4EF0A 2WCIA 5HQPA 4MCUA 2O5VA 4V2NA 6GSSA 1C72A 4MZBA 5C04A 5KN2A 1G7OA 1GH2A 5GAPD 1SL0B 4K8MA 4ZBDA 4JU5A 3WGEA 3CRTA 3IRAA 4FH8A 4MK3A 2LRCA 3ZL5A 4YAPA 3UIWA 3CWGA 1XW9A 8GSSA 2GSQA 2OADA 2CAQA 4ZB8A 5LNKe 5L71A 1BQ7A 1ZYNA 2A4HA 2HZFA 3GA4A 3TB2A 3H93A 3UOMA 1SVMA 1N2AA 3KEBA 2H6YA 1XOAA 2GLRA 2LRNA 3CSIA 3UBKA 1AQVA 2DSAA 1TXUA 3D5JA 3DXBA 1XVWA 1A8YA 4IN0A 1ERWA 3RPPA 4EC0A 4MF6A 1U6TA 2OE0A 1Z7PA 2MZCA 2RLIA 4ZL8A 1Z3EA 4ULXA 3EVIA 1EEJA 1GNWA 2HSMA 3C7MA 4GXZA 5F06A 3LXTA 2YV9A 2FUG2 4JBBA 5A34B 3VWUA 5J3RA 2GZPA 3QMXA 2IIYA 1FHEA 4YKFA 6GSVA 1DE1A 2NVLA 3HCZA 20GSA 1M7TA 1R5PA 3C73A 3TU3B 3ERFA 1G0TA 1XCCA 1SYXA 3H4KA 5ECPB 2EFCA 4HDEA 3CBUA 5F0GA 4PUAA 1X9SB 4OFNA 5A5KA 3QAVA 3VPQA 4GSTA 4E8HA 4NV5A 4F0CA 5JWQB 4HI7A 1WIKA 2MYGA 3GFKA 6GSXA 3GKMA 3F6DA 2CVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWK A;  4I97 A;  5DQS A;  1F3B A;  3FR3 A;  2VCW A;  3R3E A;  3PGT A;  3P90 A;  4NAX A;  1K0N A;  5ECN B;  1YKC A;  4MPF A;  3ZFL A;  4MZW A;  1U87 A;  3F63 A;  4GLT A;  4BVY A;  4IBP A;  4YH2 A;  4OFT A;  2HRK A;  4YQU A;  5A4V A;  1EV4 A;  1Y6E A;  2VD1 A;  4K0G A;  5DAK B;  19GS A;  4Q5Q A;  4F0B A;  3KJY A;  3PPU A;  4HOJ A;  4CHS A;  3IK7 A;  1JZR A;  1RK4 A;  4EXJ A;  5EVO A;  3UBL A;  5DJM A;  2VCZ A;  1GWC A;  4HJ2 A;  2CA8 A;  4IEL A;  12GS A;  1BX9 A;  3O3T A;  5D9T A;  1U88 A;  4O92 A;  3VWX A;  5DAL A;  1EOH A;  2VCT A;  1JLV A;  2PER A;  5AGY A;  1GLQ A;  3M0F A;  2DC5 A;  2IMI A;  1YJ6 A;  1GSU A;  1K0C A;  3I6A A;  1GTI A;  3DGQ A;  4IJI A;  2HSM B;  3UVH A;  5EY6 A;  3NIV A;  1B8X A;  2PBJ A;  3GST A;  3WYW A;  4YAV A;  4PNG A;  1MD4 A;  4Q5N A;  4MF7 A;  4GSN A;  4MDC A;  2C4J A;  3LFL A;  5JCU A;  1U3I A;  4BVX A;  1GLP A;  5ECM B;  1F3A A;  5HFK A;  1YDK A;  5G5F A;  5DJL A;  1GSE A;  3CSH A;  2R6K A;  3M8N A;  16GS A;  3KXO A;  1VF1 A;  2HRA A;  1XWG A;  2GDR A;  3QAG A;  4FQU A;  4DEJ A;  6GSW A;  1TU7 A;  3R2Q A;  1LJR A;  3G7J A;  4G19 A;  4YQM A;  1XW5 A;  1R5A A;  2PGT A;  3N9J A;  1GTB A;  3F6F A;  2R3X A;  4G0I A;  4G0K A;  4JED A;  3M3M A;  1E6B A;  2ON5 A;  4AGS A;  2CZ3 A;  2WRT A;  1K0M A;  3GSS A;  4ACS A;  5ECK B;  1EOG A;  4QQ7 A;  1ZL9 A;  5FWG A;  4EDZ A;  1XW6 A;  2WS2 A;  2PVQ A;  4ISD A;  5J5N A;  5D9X A;  4E8E A;  1V40 A;  1K3L A;  1GUK A;  3IC8 A;  3KM6 A;  4KSM A;  4BVY B;  3CRU A;  1G6W A;  2HSN B;  2HRK B;  1VF4 A;  2R4V A;  2N5F A;  5ELG A;  4G0L A;  4WR5 A;  1G6Y A;  1GTA A;  5J4U A;  1GNE A;  1PGT A;  3TOU A;  1V2A A;  5AIX A;  4ECI A;  4IKH A;  1NHY A;  1Q4J A;  3UAR A;  5ELA A;  3BBY A;  1HNC A;  3LJR A;  2WB9 A;  3GTU A;  2C8U A;  2YCD A;  5ECO B;  2VCX A;  1VF3 A;  3KTL A;  5DAL B;  3MDK A;  3PR8 A;  1IYH A;  4ZB9 A;  1AW9 A;  3EIN A;  6GST A;  3MAK A;  2GST A;  1KBN A;  5JCW A;  2WJU A;  3ISO A;  3HJO A;  4Q5R A;  13GS A;  4PX1 A;  2AB6 A;  3VPT A;  4OMV A;  4EE0 A;  5KEJ A;  1YQ1 A;  2OA7 A;  11GS A;  3FR6 A;  1AQX A;  2YV7 A;  2CAI A;  1M99 A;  4BVX B;  3D0Z A;  4HZ2 A;  4WR4 A;  5A4W A;  1M9B A;  3GX0 A;  2LJR A;  2VCQ A;  2IMK A;  4ECC A;  3LG6 A;  3N5O A;  4G9H A;  4ECJ A;  1GUM A;  3LQ7 A;  3FR9 A;  3ZML A;  1K3Y A;  1PA3 A;  2PMT A;  2A2S A;  2UZ8 A;  3GH6 A;  3W8S A;  2J9H A;  2AHE A;  1EEM A;  1BAY A;  3HKR A;  2C3Q A;  1OE7 A;  2OAC A;  3H1N A;  1A0F A;  1UA5 A;  4N0V A;  4PTS A;  3CSJ A;  4IVF A;  1BG5 A;  5AIV A;  4ECB A;  5FHI A;  5F8B A;  3VK9 A;  1K0A A;  3FYG A;  1GUH A;  17GS A;  2A2R A;  5GSS A;  2R5G A;  4NHW A;  4IGJ A;  3FRC A;  4K0N A;  1PMT A;  3P8W A;  5B7C A;  4O7H A;  5D9W A;  4F03 A;  5LD0 A;  4PXO A;  7GSS A;  2NTO A;  4L5O A;  3LXZ A;  2HNL A;  3IK9 A;  5F07 A;  4ZXG A;  2C80 A;  4GTU A;  3ERG A;  1MTC A;  3KMO A;  3EE2 A;  1B4P A;  5ECS A;  5ECL B;  1VF2 A;  2GTU A;  4EDY A;  4IS0 A;  2VD0 A;  4G10 A;  1GSQ A;  2IL3 A;  1TDI A;  3I69 A;  5GZZ B;  3VLN A;  2WDU A;  4L5L A;  2CVD A;  4PQI A;  3GTU B;  5IQY A;  4BL7 A;  3AY8 A;  1ML6 A;  3IE3 A;  5D73 A;  18GS A;  2X64 A;  3TGZ A;  5BMU A;  1M0U A;  5FT3 A;  1FW1 A;  1B48 A;  5EL8 A;  4HZ4 A;  1PX7 A;  1PKW A;  3RBT A;  1PKZ A;  3ZMK A;  1JLW A;  3G7I A;  5D9V A;  14GS A;  1YY7 A;  4YQV A;  1ZGN A;  6GSS A;  1MD3 A;  22GS A;  4USS A;  4JZQ A;  1C72 A;  4KX4 A;  4Q5F A;  5AIS A;  1G7O A;  3O76 A;  1GSY A;  4IQ1 A;  2FHE A;  5DCG A;  4TOP A;  1M9A A;  1PX6 A;  2V6K A;  3LSZ A;  3LYK A;  4ZBD A;  9GSS A;  1HNB A;  4IQA A;  1GSF A;  4PUR A;  3CRT A;  4MF5 A;  3QAW A;  4MK3 A;  1K3O A;  3VUR A;  3TOT A;  2AAW A;  3GUR A;  1HQO A;  3WD6 A;  3SWL A;  4YAP A;  1BYE A;  2C3T A;  5AN1 A;  8GSS A;  4PQH A;  2F8F A;  2ON7 A;  1K0O A;  2CZ2 A;  2GSQ A;  2OAD A;  3LYP A;  2CAQ A;  4ZB8 A;  1GSD A;  5LCZ A;  5J41 A;  5ECR B;  3Q19 A;  6GSU A;  1TW9 A;  3Q18 A;  1N2A A;  1AXD A;  4KDY A;  5F05 A;  5DAK A;  4PNF A;  2F3M A;  2GLR A;  1K0B A;  3CSI A;  4ZB6 A;  3UBK A;  1HNA A;  1F2E A;  4ZBA A;  1AQV A;  2DSA A;  3U6V A;  5G5E A;  4LMW A;  1EV9 A;  3VI7 A;  1PD2 1;  4GF0 A;  3QR6 A;  1OE8 A;  4KF9 A;  5ECI B;  4EC0 A;  2GSR A;  4BL7 B;  3IR4 A;  4MF6 A;  3VI5 A;  1IYI A;  4RI7 A;  4KDX A;  4PGT A;  5GST A;  2D2Z A;  1PN9 A;  1OYJ A;  2VO4 A;  1GSS A;  3HJM A;  1K0D A;  1Z9H A;  6GSY A;  3KMN A;  4IW9 A;  4KH7 A;  1GNW A;  3M1G A;  2HSM A;  4MP4 A;  4KGI A;  4J2F A;  4OFM A;  1PL2 A;  1LBK A;  1AQW A;  1DUG A;  3LXT A;  2GSS A;  2YV9 A;  3Q74 A;  5ECQ B;  5F06 A;  1USB A;  2JL4 A;  4JBB A;  1GUL A;  2HQT A;  3DD3 A;  3ZFB A;  3C8E A;  3IBH A;  4KDU A;  4NHZ A;  1PL1 A;  1FHE A;  4KAE A;  4L8E A;  1OKT A;  6GSV A;  2FNO A;  5A4U A;  20GS A;  3ERF A;  4GCI A;  4RI6 A;  4LMV A;  1GTU A;  5ECP B;  10GS A;  3FY7 A;  4GSS A;  4MPG A;  3CBU A;  5ECH B;  4ID0 A;  5F0G A;  4PUA A;  4KE3 A;  4OFN A;  5A5K A;  2VCV A;  3QAV A;  3VPQ A;  1TU8 A;  4GST A;  4E8H A;  4F0C A;  2C3N A;  4ZBB A;  4HI7 A;  5DDL A;  3GUS A;  3L0H A;  6GSX A;  3UAP A;  3F6D A; 
#chains in the Genus database with same CATH topology
 1XWK A;  4I97 A;  1F3B A;  1VRS D;  5IOW A;  3IHG A;  5KOW A;  3FR3 A;  2VCW A;  3KZQ A;  3P90 A;  4NAX A;  1J0F A;  4MPF A;  3ZFL A;  4MZW A;  2IFQ A;  3F63 A;  4GLT A;  3C1S A;  5JCG A;  2HSN A;  5CRH A;  4OFT A;  2PVO C;  5A4V A;  1Y6E A;  2VD1 A;  2WW3 A;  5DAK B;  4Q5Q A;  4F0B A;  2YWO A;  2LS5 A;  2VAF A;  4CHS A;  1FOH A;  1FOV A;  1JZR A;  5EVO A;  4QL7 A;  1X5C A;  2VCZ A;  5IMZ A;  1GWC A;  1NM3 A;  4XS6 A;  2HI7 A;  3TJJ A;  1EOH A;  2VCT A;  4NV2 A;  5AGY A;  1G7E A;  2FWG A;  4POB A;  3M0F A;  1F37 A;  2DIZ A;  2H30 A;  1GSU A;  2NPB A;  3I6A A;  3BD2 A;  3VWW A;  2L6C A;  3NIV A;  1W89 A;  4QL9 A;  2PBJ A;  4AKI A;  5IMV A;  2H0H A;  4GDF A;  3RAZ A;  2NDO A;  3D4M A;  3IHQ A;  5ECM B;  2EFE A;  2HXK A;  5HFK A;  1TRW A;  1YDK A;  2AJQ B;  1M2A A;  2I1U A;  2QSI A;  3M8N A;  4TR3 A;  3WT2 A;  2F9S A;  2GDR A;  2YJ7 A;  2H1D A;  2WW2 A;  5D93 A;  4YKG A;  2MMN A;  3W8J A;  1LJR A;  1N25 A;  3GL3 A;  2PGT A;  4PQ1 A;  2R3X A;  5CRE A;  4POL A;  4G0K A;  2VOC A;  2L6D A;  3PH9 A;  4QQ7 A;  4EDZ A;  1XW6 A;  2GT6 A;  4K1F A;  2WS2 A;  3PIN A;  3HZ8 A;  4PI2 C;  3CRU A;  5COH A;  1VF4 A;  4ZIL A;  3HVS A;  1G6Y A;  4MH3 A;  4ECI A;  2DBC A;  5CAX A;  4OCE A;  1Q4J A;  2X4A A;  3LJR A;  3GTU A;  3RDW A;  4CW9 A;  5J47 A;  1VF3 A;  5DAL B;  2DML A;  3ZRD A;  2VLV A;  3PR8 A;  1IYH A;  3A2X A;  4JE1 A;  3DEX A;  3EIN A;  6GST A;  4TVE A;  5JCW A;  2HZE A;  5G1L A;  4AKH A;  1B4Q A;  4O5R A;  2RII A;  3JCM L;  4Q5R A;  3D4T A;  4PX1 A;  3VPT A;  2JZR A;  2DJ3 A;  1AC1 A;  3FR6 A;  2YV7 A;  1M99 A;  4BVX B;  4IJ3 A;  5IM9 A;  4WR4 A;  5A4W A;  1M3I A;  1M2D A;  2VL2 A;  4ECC A;  4CY8 A;  3LG6 A;  3N5O A;  2VIM A;  4ECJ A;  1M2B A;  1K3Y A;  2PMT A;  2A2S A;  1S3A A;  2HRN A;  4K7I A;  4L0W A;  2F51 A;  2YPM A;  3M9K A;  3EPT A;  4FO5 A;  4V1A g;  3LW9 A;  4DSS A;  2G2Q A;  2EFH A;  1K0A A;  2B7K A;  4D73 B;  1TI1 A;  4HSC X;  1SJ6 A;  1GUH A;  5GSS A;  2K18 A;  1RQM A;  2WVZ A;  3FRC A;  2B3S A;  1SKS B;  1H75 A;  4BWS A;  2PWJ A;  4PXO A;  2NTO A;  2BMX A;  4N30 A;  2C80 A;  3ZIV A;  3ERG A;  1MTC A;  3EE2 A;  1B4P A;  4A5P A;  4EIP A;  2XHF A;  2LST A;  3IPZ A;  3E3E A;  5GZZ B;  2IJY A;  1ZYQ B;  2YAN A;  5IMD A;  2CVD A;  3SBC A;  2FA4 A;  4O32 A;  1YKA A;  1M0U A;  2FGX A;  2H70 A;  1TI3 A;  3HY2 A;  1FW1 A;  2PU9 C;  3APQ A;  5A5H B;  1HYU A;  3TKS E;  5EL8 A;  4HZ4 A;  2OBI A;  3RBT A;  3IV4 A;  1PKZ A;  1UN2 A;  1JLW A;  5D9V A;  3HVN A;  3DWV A;  1JZD A;  2C0E A;  14GS A;  1TOF A;  2N5B A;  4F9Z A;  1ON4 A;  3ZIJ A;  4USS A;  2R2J A;  4KX4 A;  1QMV A;  5AIS A;  1GSY A;  4MLY A;  1OC9 A;  1RW1 A;  1M9A A;  1DSB A;  2QC7 A;  2ZUP A;  2V6K A;  1MDI A;  3LYK A;  3TJB A;  4O5U A;  5HFI A;  9GSS A;  5A1N B;  1SVL A;  1T7P B;  2IMF A;  3CQF A;  3DVW A;  1WMJ A;  2K6V A;  1SL1 B;  3VUR A;  2QGV A;  3DKS A;  5KN1 A;  1YEP A;  2ZNM A;  3SWL A;  1Z6N A;  2RM6 A;  5BRT A;  2K9F A;  2YWM A;  2F8F A;  2ON7 A;  1K0O A;  1BED A;  4V1A p;  1GSD A;  3FHK A;  2VUP A;  5A1N A;  5ECR B;  3ZTL A;  1XG8 A;  2E2M A;  2X49 A;  4KDY A;  2E2G A;  3RPN A;  3WT1 A;  5F05 A;  4PNF A;  2F3M A;  1K0B A;  4WF5 A;  1O81 A;  5ID2 B;  3US3 A;  1HNA A;  4ZBA A;  1V57 A;  3DVX A;  2VLT A;  2DJ0 A;  5G5E A;  2R0C A;  4LMW A;  1EV9 A;  1V98 A;  3VI7 A;  4N0Z A;  4GF0 A;  1OE8 A;  4KF9 A;  3HD5 A;  4BL7 B;  3VI5 A;  3I9V 2;  2H6X A;  5GST A;  3L78 A;  2D2Z A;  1PN9 A;  1OYJ A;  1K0D A;  3TKS C;  5ID2 A;  3KMN A;  2O89 A;  2V6O A;  4IW9 A;  4WEY A;  4MP4 A;  4J2F A;  2RUF A;  5CRW A;  1X5D A;  4I5Q A;  1USB A;  2H66 A;  1XFL A;  1GUL A;  2HQT A;  3DD3 A;  2M80 A;  2HT9 A;  1PL1 A;  3UEM A;  3HXS A;  4KAE A;  4BWQ A;  4RI6 A;  2CX3 A;  3F3Q A;  3ZVJ D;  1GTU A;  4MPG A;  3L9U A;  5ECH B;  4ID0 A;  2L5O A;  4KE3 A;  2R37 A;  3HVV A;  1TU8 A;  2Z9S A;  2H1G A;  4X0X A;  3GUS A;  4V2L A;  3QFA C;  3EUR A;  2LRT A;  1JZW A;  2OJL A;  4K2D A;  1YF0 A;  2TRX A;  4XS4 A;  1JFU A;  2HFD A;  2GQM A;  3LGC A;  4BVY A;  4IBP A;  3ZIT A;  4YH2 A;  4K7N A;  5HFG A;  3APO A;  2QA2 A;  1AUC A;  3IDV A;  4MZC A;  3KJY A;  2JZS A;  1WPI A;  2JZT A;  1W4V A;  2C1Y A;  1X0R A;  2EIR A;  4PUF C;  3IK7 A;  1Z6M A;  4KCA A;  1OKD A;  3UBL A;  5ABR A;  1M3J A;  3W6G A;  2CA8 A;  2VL9 A;  1R4W A;  12GS A;  3O3T A;  1MDK A;  4HS1 A;  3P2A A;  1YJ6 A;  4POM A;  2WZ9 A;  1SKR B;  4WBJ A;  3DGQ A;  2HSM B;  3UVH A;  2FY6 A;  5EY6 A;  2KHP A;  1B8X A;  3GST A;  3EYT A;  4MJB A;  3WYW A;  1FVJ A;  3L4N A;  4PNG A;  4Q5N A;  1R7H A;  3LFL A;  1A2L A;  2I3Y A;  4Z2R A;  4DSQ A;  4XIH A;  3GMF A;  2ZCT A;  5G5F A;  5DJL A;  2L5L A;  2AYT A;  3CSH A;  2R6K A;  3E9J B;  3KXO A;  2M72 A;  2A4V A;  3D6I A;  1VF1 A;  1S3D A;  2HRA A;  4FQU A;  1DE2 A;  6GSW A;  2LV3 A;  3MWH A;  3G7J A;  3CMI A;  1XW5 A;  3GKN A;  4G0I A;  4JED A;  3M3M A;  3GSS A;  4AKG A;  1EOG A;  2E7P A;  3FKF A;  1S3R A;  2HRF A;  2PVQ A;  5J5N A;  1V40 A;  4OO4 A;  2IFQ B;  2V1M A;  4KND A;  2DJ1 A;  1G6W A;  2HSN B;  4G0L A;  2H72 A;  3GX8 A;  1B9Y C;  1GNE A;  1PGT A;  2ES7 A;  2MMO A;  4JRR A;  3F4T A;  4IKH A;  4OD7 A;  2WFC A;  4EO3 A;  3BBY A;  1R26 A;  2YCD A;  1ST9 A;  2VCX A;  1I5G A;  3GHA A;  5HR0 A;  1KEB A;  4X1U A;  2O7K A;  1T8E B;  1QXH A;  2BJX A;  3FZ9 A;  4J57 E;  3HYP A;  4RUV A;  5JWR B;  1SK0 A;  3HJO A;  3TRQ A;  4CY6 A;  2LKU A;  2WVY A;  13GS A;  2DJK A;  2ALB A;  4BA7 A;  4OMV A;  2GZY A;  5G2Z A;  4AJ7 A;  1AQX A;  3D0Z A;  3KTB A;  1TKD B;  1SEN A;  2KP2 A;  2LJR A;  2UV8 G;  1O7U A;  3ZZX A;  4GWR A;  1YEX A;  4XRA A;  2LQQ A;  2H75 A;  2UZ8 A;  1A23 A;  4TRX A;  2J9H A;  4EIQ A;  2XPE A;  2C3Q A;  2G0F A;  3TKR A;  2XBQ A;  4F82 A;  2VL2 C;  2H1A A;  3H1N A;  1A0F A;  3DYR A;  4PTS A;  2YZH A;  3CSJ A;  2CVB A;  1N8J A;  3TRP A;  4ECB A;  2B7J A;  5HR3 A;  3H79 A;  1BG1 A;  2JU5 A;  4WXT A;  5DVB A;  3FYG A;  3KH9 A;  2WGR A;  17GS A;  3FZ5 A;  3P8W A;  4O7H A;  3FZ4 A;  4L5O A;  1SK2 A;  2F8A A;  1YEW C;  4ZXG A;  1QQ2 A;  3QFB C;  5ECS A;  5ECL B;  2J23 A;  2YP6 A;  2JAC A;  4EDY A;  4MA9 A;  1PFO A;  1KTE A;  2KLX A;  4G10 A;  4FIW A;  4K5R A;  4WBR D;  3WGX A;  2IL3 A;  3I69 A;  1MDJ A;  5EPF A;  4PQI A;  3GTU B;  5IQY A;  3FEU A;  4P3Y B;  3U5R E;  3AY8 A;  2EIQ A;  3IE3 A;  2X64 A;  3TGZ A;  5BMU A;  2YN1 A;  4EUY A;  2RUE A;  4XHM A;  5FT3 A;  1A0R P;  1B48 A;  3APS A;  4TR4 A;  4AJ8 A;  1PKW A;  5C00 A;  2HZE B;  3HVX A;  4HUA A;  5GAN D;  4AJ6 A;  5IMF A;  1JZO A;  1ZOF A;  2P5Q A;  5IPH A;  3F4S A;  1ZGN A;  4JZQ A;  1Y25 A;  4Q5F A;  4ZL7 A;  2PN8 A;  2EFD A;  1TK5 B;  4IQ1 A;  3CXG A;  2XPD A;  2L4Q A;  5DCG A;  2H6Z A;  3CTG A;  4I2U A;  2IN3 A;  4K9Z A;  5DCH A;  1PX6 A;  1WRY A;  1NSW A;  4IQA A;  1GSF A;  4PUR A;  4MF5 A;  3Q6O A;  3QAW A;  3L9S A;  2AAW A;  3GUR A;  1Q98 A;  3WD6 A;  4PI0 C;  1BYE A;  1T00 A;  4DSS B;  4IP6 A;  4PQH A;  2CZ2 A;  4MH2 A;  3DML A;  3Q19 A;  1TW9 A;  4W66 A;  2MMA A;  2IWT A;  1AXD A;  2X99 A;  3QD9 A;  2OE3 A;  2K8V A;  4NPB A;  2OT3 A;  3U6V A;  3GL5 A;  3QPM A;  5G30 A;  1QK8 A;  1OC8 A;  2FWF A;  3QR6 A;  3GKX A;  2GS3 A;  1IYI A;  4KDX A;  4TXO A;  3HJM A;  4GQF A;  2KUC A;  1SD8 A;  2C0G A;  2I81 A;  2X8G A;  4IP1 A;  3L9V A;  4TR1 A;  3VFI A;  4KH7 A;  1SD9 A;  3ZLP A;  5CO3 A;  2H19 A;  2O3E A;  4KGI A;  2CT6 A;  2MBS A;  5ECQ B;  2GSS A;  3Q74 A;  5IO0 A;  3K8N A;  4DVC A;  4X43 A;  2LJA A;  3J7Y b;  1ZMA A;  1THX A;  2MBT A;  3ZFB A;  4MJA A;  4L8E A;  1OKT A;  1OC9 B;  4O5Q A;  1OVN A;  4GCI A;  4LMV A;  3QCP A;  3FY7 A;  1PRX A;  4GSS A;  2KOK A;  2H1B A;  3WGD A;  5H5R A;  4V2M A;  1EZK A;  4LLR A;  3IC4 A;  1X9W B;  2VM1 A;  1BF5 A;  2YJH A;  5DDL A;  1F9M A;  1XPV A;  4RQX A;  3L0H A;  4KSO A;  1Y1U A;  3ED3 A;  5G31 A;  3S9F A;  3R3E A;  3PGT A;  1OAZ A;  1K0N A;  5ECN B;  1YKC A;  5J9C A;  1ZYE A;  1XZO A;  2HRK A;  1OC3 A;  1TRU A;  4TN8 A;  19GS A;  4HOJ A;  1SU9 A;  5IO2 A;  1SKW B;  1ILO A;  1RK4 A;  1A2M A;  2DJJ A;  5H5S A;  5DJM A;  1THO A;  2WVX A;  1SK1 A;  2LTK A;  3HZ4 A;  5D96 A;  4EL1 A;  4IEL A;  3NOF A;  1O73 A;  5IMC A;  4HU9 A;  5D9T A;  4O92 A;  3F9U A;  2PER A;  2RM5 A;  1GLQ A;  4ZL9 A;  2EC4 A;  4OWY A;  4POK A;  5H5Q A;  1SJI A;  1U3A A;  1T4Y A;  1URM A;  2O8V B;  1GTI A;  4IJI A;  1FG4 A;  4TKY A;  3GKK A;  3TKQ A;  4YAV A;  4MF7 A;  4GSN A;  2O85 A;  4MDC A;  1YVL A;  1U3I A;  4G01 A;  1GLP A;  4LA1 A;  2VKZ G;  5CRG A;  5DQY A;  3ZYW A;  2FA8 A;  16GS A;  1SYR A;  1B9X C;  2HE3 A;  1XWG A;  4DEJ A;  3ZRE A;  1YF1 A;  3DIE A;  3TCO A;  2TRC P;  2WUL A;  4G19 A;  4YQM A;  1JHB A;  2XBI A;  1GTB A;  3P7X A;  3TKP A;  2L57 A;  1E6B A;  2H71 A;  4AGS A;  2CZ3 A;  4ACS A;  3UJ1 A;  4XS4 B;  5FWG A;  2MMZ A;  1O6J A;  4ISD A;  4E8E A;  2R0G A;  4KCE A;  3F4R A;  1EGR A;  3TRX A;  1GUK A;  3IC8 A;  3KM6 A;  4BVY B;  1H4O A;  3EU3 A;  5G1K A;  2R4V A;  2N5F A;  1GTA A;  2TIR A;  3A5W A;  1V2A A;  2CQ9 A;  3BOA A;  3EMP A;  3ERW A;  2YOI A;  4PHZ C;  1S3C A;  1T4Z A;  1HD2 A;  3FW2 A;  2LQO A;  5ELA A;  4J56 E;  4JR4 A;  2I4A A;  2C8U A;  3I43 A;  1PQN A;  3KTL A;  5HR2 A;  5J4V A;  3VWV A;  4ZB9 A;  1UVZ A;  1MEK A;  2AV4 A;  2DIY A;  4HQS A;  3GV1 A;  2WJU A;  5J4Y A;  4BIK A;  3D22 A;  1YZX A;  2AB6 A;  3RHB A;  2B5X A;  3BCI A;  1TK0 B;  3KH7 A;  1YQ1 A;  1J08 A;  3FK8 A;  2CAI A;  3QOU A;  4HZ2 A;  4XCS A;  1XWA A;  3GX0 A;  2IMK A;  1GUM A;  3LQ7 A;  1XXU A;  1PA3 A;  5KN3 A;  2DMM A;  1GP1 A;  3BJ5 A;  2AHE A;  1BAY A;  4L0U A;  3HKR A;  1OE7 A;  2VLU A;  4TXV A;  1UA5 A;  4N0V A;  4IVF A;  1EP7 A;  2O36 A;  5AIV A;  5FHI A;  3TKS A;  5JWO B;  3CYN A;  3O6T A;  2A2R A;  4KUN A;  4KW6 A;  1X5E A;  2R5G A;  5E4W A;  4NHW A;  4K0N A;  2YNX A;  1WP0 A;  5D9W A;  5LD0 A;  2P0G A;  3LXZ A;  2V41 A;  2HNL A;  3IK9 A;  5F07 A;  3NZN A;  3HMJ G;  1S4B P;  1T3B A;  2DLX A;  2I9H A;  3LOR A;  1AAZ A;  1VF2 A;  5ENU A;  2NBS A;  4TR0 A;  4IS0 A;  2O87 A;  2PPT A;  3KD0 A;  4GRF A;  1ML6 A;  3HDC A;  2C0D A;  4XTS A;  5B8A A;  2YWI A;  3MIX A;  5HR1 A;  2WW0 A;  3ME7 A;  1E2Y A;  3EWL A;  3GYK A;  2V32 A;  3G7I A;  1SJZ A;  1YY7 A;  4YQV A;  3EC3 A;  4ZB7 A;  5A34 A;  1QFN A;  5D8I A;  1MD3 A;  22GS A;  3TUE A;  1VGL A;  4RQR A;  1ABA A;  3O76 A;  3EMX A;  3GH9 A;  2FHE A;  1GL8 A;  4TOP A;  3C71 A;  3OR5 A;  1A24 A;  3IOS A;  1SL2 B;  1TRS A;  4N3Z A;  3LSZ A;  1CQH A;  4FYB A;  1HNB A;  3MNG A;  1T1V A;  4OO5 A;  2GQK A;  1ERT A;  1TJD A;  2X8C A;  1K3O A;  3FMW A;  3IXR A;  3TOT A;  2R0P A;  4I6X A;  1HQO A;  4NWY A;  2GQL A;  2REM A;  4MAB A;  2C3T A;  5AN1 A;  2OE1 A;  3LYP A;  2WW1 A;  5LCZ A;  4TW5 A;  5J41 A;  3G9B A;  1XIY A;  6GSU A;  1XWB A;  3EU4 A;  3Q18 A;  4ILF A;  3RFR C;  1FB6 A;  3RHC A;  4WF4 A;  2K8S A;  1WOU A;  1FO5 A;  5DAK A;  4NXI A;  4DSR A;  1CQG A;  1FB0 A;  4MNN A;  4ZB6 A;  2DJ2 A;  1TXX A;  1F2E A;  2H0G A;  2H0I A;  4MMM A;  3E0U A;  4FYU A;  2GGT A;  1NHO A;  3RGB C;  2JAD A;  1PD2 1;  2E0Q A;  1V58 A;  5ECI B;  2EIO A;  2GSR A;  3IR4 A;  4RI7 A;  4PGT A;  5BMU B;  2VO4 A;  1GSS A;  5IOX A;  1PSQ A;  1Z9H A;  1X9M B;  6GSY A;  3ME8 A;  3HJP A;  1DBY A;  2P5R A;  3M1G A;  1NW2 A;  1UC7 A;  1LU4 A;  5B6N A;  1KNG A;  4OFM A;  1PL2 A;  1LBK A;  2L4C A;  1AQW A;  1DUG A;  1O85 A;  4LL1 B;  2JL4 A;  2LNT A;  4HU7 A;  4K6X A;  3C8E A;  3IBH A;  4KDU A;  4NHZ A;  5CYY A;  2B5E A;  2FNO A;  5A4U A;  4F2I A;  3IAS 2;  4Z7X A;  2VM2 A;  10GS A;  4ML1 A;  4G2E A;  2BTO T;  4H86 A;  2VCV A;  4HJM A;  1SVO A;  3F3R A;  2C3N A;  4ZBB A;  2A2P A;  2B6M A;  3F8U A;  3UAP A;  3A2W A;  5DQS A;  3FZA A;  1XOB A;  5CNW A;  5CP1 A;  5INY A;  1TK8 B;  4HQZ A;  2IME A;  3QDN A;  1U87 A;  2FWE A;  4QMK A;  4YQU A;  1TTZ A;  1EV4 A;  4K0G A;  1ZYP A;  3UVT A;  3PPU A;  1I1I P;  3H8Q A;  1ZZY A;  3G7Y A;  1FAA A;  2DKI A;  3TDG A;  4AI6 A;  4EXJ A;  4HJ2 A;  2HSY A;  1EP8 A;  2QA1 A;  3IAM 2;  1BX9 A;  4EKZ A;  1U88 A;  3VWX A;  5DAL A;  3IA1 A;  4TXO B;  2H01 A;  5J40 A;  1JLV A;  1O8W A;  2DKH A;  2DC5 A;  2IMI A;  4X4J A;  3MSZ A;  1K0C A;  4TR1 B;  4KA0 A;  1ERU A;  3TJF A;  1A8L A;  2CV4 A;  5IMA A;  5KN0 A;  4MJC A;  1MD4 A;  2AUV A;  1QUW A;  3F0I A;  2JSZ A;  3KCM A;  2C4J A;  5JCU A;  4MJE A;  2WZS A;  2B1K A;  1PN0 A;  4BVX A;  2IMD A;  1F3A A;  2LEG A;  4K7O A;  4EVM A;  1WWJ A;  3CTF A;  1GSE A;  1XBS A;  2VL3 A;  2HYX A;  3GNJ A;  2L59 A;  3LWA A;  3QAG A;  1XWC A;  1TU7 A;  3R2Q A;  4XRD A;  4K5S A;  3GN3 A;  3N9J A;  1R5A A;  3F6F A;  5B6M A;  3GRX A;  3KP9 A;  3MYD A;  2ON5 A;  2PUK C;  3J7Y k;  1V9W A;  2WRT A;  1K0M A;  1AIU A;  4OCF A;  3TJG A;  1WJK A;  2OKA A;  2B5Y A;  5ECK B;  2OBK A;  4Z2T A;  4D73 A;  1TRV A;  3KIJ A;  3UL3 A;  1ZL9 A;  4N11 A;  2LUS A;  5D9X A;  2H73 A;  1K3L A;  4KSM A;  2GZZ A;  3KGK A;  2HRK B;  3UMA A;  5B8B A;  4ICY A;  5ELG A;  2HSH A;  4WR5 A;  5J4U A;  2LJK A;  3TOU A;  2GT5 A;  3DRN A;  1Z5Y E;  5KOX A;  3V1W A;  4AKX B;  5AIX A;  2JSY A;  3KP8 A;  1O8X A;  1NHY A;  4I8B A;  3UAR A;  2WVX B;  2YWN A;  1HNC A;  4HEA 2;  4WET A;  2WB9 A;  5IPG A;  4ZIJ A;  3A2V A;  5ECO B;  4K2X A;  3MDK A;  1EGO A;  3A3T A;  1AW9 A;  5A5H A;  3MAK A;  2GST A;  1ACV A;  1EWX A;  1KBN A;  1I9D A;  2B1L A;  2C0F A;  2H8L A;  3ISO A;  5DBQ A;  1F6M C;  3D21 A;  2V2G A;  3HA9 A;  2QKE A;  4WKW A;  1A2J A;  2P31 A;  4EE0 A;  5KEJ A;  2N5A A;  2OA7 A;  11GS A;  5J9B A;  1TP9 A;  1M9B A;  4BPY A;  2M46 A;  2VCQ A;  4LL4 B;  4G9H A;  5IIZ A;  4KB3 A;  2H76 A;  3FR9 A;  3ZML A;  2H74 A;  5E59 A;  4CDO A;  3GH6 A;  3W8S A;  3TJK A;  4IHU A;  1QGV A;  4AF2 A;  1EEM A;  4E68 A;  3GIX A;  1Z7R A;  2CX4 A;  2HLS A;  4ML6 A;  1J9B A;  2FLS A;  2OAC A;  3M9J A;  2FCH A;  2H1L A;  1BG5 A;  2KP1 A;  2GVP A;  5CRD A;  3C1R A;  2FWH A;  4NMU A;  5F8B A;  3VK9 A;  1ZCP A;  3A5I A;  4GQC A;  4IGJ A;  2IPA A;  1PMT A;  5B7C A;  2YZU A;  4F03 A;  4FYC A;  1FVK A;  7GSS A;  3LEF A;  2FD3 A;  2X8H A;  4GTU A;  4I2T A;  3BCK A;  3KMO A;  3HHV A;  1XVQ A;  2GTU A;  2LNS A;  2VD0 A;  1GSQ A;  2XC2 A;  1BJX A;  1TDI A;  3VLN A;  2WDU A;  4L5L A;  4BL7 A;  3ZVJ A;  5D73 A;  18GS A;  4JR6 A;  1ERV A;  1GRX A;  4XS1 A;  1PX7 A;  4Z2U A;  1WE0 A;  3ZMK A;  4N10 A;  4EF0 A;  2WCI A;  5HQP A;  4MCU A;  2O5V A;  4V2N A;  6GSS A;  1C72 A;  4MZB A;  5C04 A;  5KN2 A;  1G7O A;  1GH2 A;  5GAP D;  1SL0 B;  4K8M A;  4ZBD A;  4JU5 A;  3WGE A;  3CRT A;  3IRA A;  4FH8 A;  4MK3 A;  2LRC A;  3ZL5 A;  4YAP A;  3UIW A;  3CWG A;  1XW9 A;  8GSS A;  2GSQ A;  2OAD A;  2CAQ A;  4ZB8 A;  5LNK e;  3CHX C;  5L71 A;  1BQ7 A;  1ZYN A;  2A4H A;  2HZF A;  3GA4 A;  3TB2 A;  3H93 A;  3UOM A;  1SVM A;  1N2A A;  3KEB A;  2H6Y A;  1XOA A;  2GLR A;  2LRN A;  3CSI A;  3UBK A;  1AQV A;  2DSA A;  1TXU A;  3D5J A;  4FXY P;  3DXB A;  1XVW A;  1A8Y A;  4IN0 A;  1ERW A;  3RPP A;  4EC0 A;  4MF6 A;  1U6T A;  2OE0 A;  1Z7P A;  2MZC A;  2RLI A;  4ZL8 A;  1Z3E A;  4ULX A;  3EVI A;  1EEJ A;  1GNW A;  2HSM A;  3C7M A;  4GXZ A;  5F06 A;  3LXT A;  2YV9 A;  2FUG 2;  4JBB A;  5A34 B;  3VWU A;  5J3R A;  2GZP A;  3QMX A;  2IIY A;  1FHE A;  4YKF A;  6GSV A;  1DE1 A;  2NVL A;  3HCZ A;  20GS A;  1M7T A;  1R5P A;  3C73 A;  3TU3 B;  3ERF A;  1G0T A;  1XCC A;  1SYX A;  3H4K A;  5ECP B;  2EFC A;  4HDE A;  3CBU A;  5F0G A;  4PUA A;  1X9S B;  4OFN A;  5A5K A;  3QAV A;  3VPQ A;  4GST A;  4E8H A;  4NV5 A;  4F0C A;  5JWQ B;  4HI7 A;  1WIK A;  2MYG A;  3GFK A;  6GSX A;  3GKM A;  3F6D A;  2CVK A; 
#chains in the Genus database with same CATH homology
 1XWK A;  4I97 A;  1F3B A;  1VRS D;  5IOW A;  3IHG A;  5KOW A;  3FR3 A;  2VCW A;  3KZQ A;  3P90 A;  4NAX A;  1J0F A;  4MPF A;  3ZFL A;  4MZW A;  2IFQ A;  3F63 A;  4GLT A;  3C1S A;  5JCG A;  2HSN A;  5CRH A;  4OFT A;  2PVO C;  5A4V A;  1Y6E A;  2VD1 A;  5DAK B;  4Q5Q A;  4F0B A;  2YWO A;  2LS5 A;  2VAF A;  4CHS A;  1FOH A;  1FOV A;  1JZR A;  5EVO A;  4QL7 A;  1X5C A;  2VCZ A;  5IMZ A;  1GWC A;  1NM3 A;  4XS6 A;  2HI7 A;  3TJJ A;  1EOH A;  2VCT A;  4NV2 A;  5AGY A;  1G7E A;  2FWG A;  4POB A;  3M0F A;  1F37 A;  2DIZ A;  2H30 A;  1GSU A;  2NPB A;  3I6A A;  3BD2 A;  3VWW A;  2L6C A;  3NIV A;  1W89 A;  4QL9 A;  2PBJ A;  4AKI A;  5IMV A;  2H0H A;  4GDF A;  3RAZ A;  2NDO A;  3D4M A;  3IHQ A;  5ECM B;  2EFE A;  2HXK A;  5HFK A;  1TRW A;  1YDK A;  2AJQ B;  1M2A A;  2I1U A;  2QSI A;  3M8N A;  4TR3 A;  3WT2 A;  2F9S A;  2GDR A;  2YJ7 A;  2H1D A;  5D93 A;  4YKG A;  2MMN A;  3W8J A;  1LJR A;  1N25 A;  3GL3 A;  2PGT A;  4PQ1 A;  2R3X A;  5CRE A;  4POL A;  4G0K A;  2VOC A;  2L6D A;  3PH9 A;  4QQ7 A;  4EDZ A;  1XW6 A;  2GT6 A;  4K1F A;  2WS2 A;  3PIN A;  3HZ8 A;  3CRU A;  5COH A;  1VF4 A;  4ZIL A;  3HVS A;  1G6Y A;  4MH3 A;  4ECI A;  2DBC A;  5CAX A;  4OCE A;  1Q4J A;  2X4A A;  3LJR A;  3GTU A;  3RDW A;  4CW9 A;  5J47 A;  1VF3 A;  5DAL B;  2DML A;  3ZRD A;  2VLV A;  3PR8 A;  1IYH A;  3A2X A;  4JE1 A;  3DEX A;  3EIN A;  6GST A;  4TVE A;  5JCW A;  2HZE A;  5G1L A;  4AKH A;  1B4Q A;  4O5R A;  2RII A;  3JCM L;  4Q5R A;  3D4T A;  4PX1 A;  3VPT A;  2JZR A;  2DJ3 A;  1AC1 A;  3FR6 A;  2YV7 A;  1M99 A;  4BVX B;  4IJ3 A;  5IM9 A;  4WR4 A;  5A4W A;  1M2D A;  2VL2 A;  4ECC A;  4CY8 A;  3LG6 A;  3N5O A;  2VIM A;  4ECJ A;  1M2B A;  1K3Y A;  2PMT A;  2A2S A;  1S3A A;  2HRN A;  4K7I A;  4L0W A;  2F51 A;  2YPM A;  3M9K A;  3EPT A;  4FO5 A;  4V1A g;  3LW9 A;  4DSS A;  2G2Q A;  2EFH A;  1K0A A;  2B7K A;  4D73 B;  1TI1 A;  1SJ6 A;  1GUH A;  5GSS A;  2K18 A;  1RQM A;  3FRC A;  2B3S A;  1SKS B;  1H75 A;  4BWS A;  2PWJ A;  4PXO A;  2NTO A;  2BMX A;  4N30 A;  2C80 A;  3ZIV A;  3ERG A;  1MTC A;  3EE2 A;  1B4P A;  4A5P A;  4EIP A;  2XHF A;  2LST A;  3IPZ A;  3E3E A;  5GZZ B;  2IJY A;  1ZYQ B;  2YAN A;  5IMD A;  2CVD A;  3SBC A;  2FA4 A;  4O32 A;  1YKA A;  1M0U A;  2FGX A;  2H70 A;  1TI3 A;  3HY2 A;  1FW1 A;  2PU9 C;  3APQ A;  5A5H B;  1HYU A;  3TKS E;  5EL8 A;  4HZ4 A;  2OBI A;  3RBT A;  3IV4 A;  1PKZ A;  1UN2 A;  1JLW A;  5D9V A;  3DWV A;  1JZD A;  2C0E A;  14GS A;  1TOF A;  2N5B A;  4F9Z A;  1ON4 A;  3ZIJ A;  4USS A;  2R2J A;  4KX4 A;  1QMV A;  5AIS A;  1GSY A;  4MLY A;  1OC9 A;  1RW1 A;  1M9A A;  1DSB A;  2QC7 A;  2ZUP A;  2V6K A;  1MDI A;  3LYK A;  3TJB A;  4O5U A;  5HFI A;  9GSS A;  5A1N B;  1SVL A;  1T7P B;  2IMF A;  3DVW A;  1WMJ A;  2K6V A;  1SL1 B;  3VUR A;  2QGV A;  3DKS A;  5KN1 A;  1YEP A;  2ZNM A;  3SWL A;  1Z6N A;  2RM6 A;  5BRT A;  2K9F A;  2YWM A;  2F8F A;  2ON7 A;  1K0O A;  1BED A;  4V1A p;  1GSD A;  3FHK A;  2VUP A;  5A1N A;  5ECR B;  3ZTL A;  2E2M A;  2X49 A;  4KDY A;  2E2G A;  3RPN A;  3WT1 A;  5F05 A;  4PNF A;  2F3M A;  1K0B A;  4WF5 A;  1O81 A;  5ID2 B;  3US3 A;  1HNA A;  4ZBA A;  1V57 A;  3DVX A;  2VLT A;  2DJ0 A;  5G5E A;  2R0C A;  4LMW A;  1EV9 A;  1V98 A;  3VI7 A;  4N0Z A;  4GF0 A;  1OE8 A;  4KF9 A;  3HD5 A;  4BL7 B;  3VI5 A;  3I9V 2;  2H6X A;  5GST A;  3L78 A;  2D2Z A;  1PN9 A;  1OYJ A;  1K0D A;  3TKS C;  5ID2 A;  3KMN A;  2O89 A;  2V6O A;  4IW9 A;  4WEY A;  4MP4 A;  4J2F A;  2RUF A;  5CRW A;  1X5D A;  4I5Q A;  1USB A;  2H66 A;  1XFL A;  1GUL A;  2HQT A;  3DD3 A;  2M80 A;  2HT9 A;  1PL1 A;  3UEM A;  3HXS A;  4KAE A;  4BWQ A;  4RI6 A;  2CX3 A;  3F3Q A;  3ZVJ D;  1GTU A;  4MPG A;  3L9U A;  5ECH B;  4ID0 A;  2L5O A;  4KE3 A;  2R37 A;  3HVV A;  1TU8 A;  2Z9S A;  2H1G A;  4X0X A;  3GUS A;  4V2L A;  3QFA C;  3EUR A;  2LRT A;  1JZW A;  2OJL A;  4K2D A;  1YF0 A;  2TRX A;  4XS4 A;  1JFU A;  2HFD A;  2GQM A;  3LGC A;  4BVY A;  4IBP A;  3ZIT A;  4YH2 A;  4K7N A;  5HFG A;  3APO A;  2QA2 A;  1AUC A;  3IDV A;  4MZC A;  3KJY A;  2JZS A;  1WPI A;  2JZT A;  1W4V A;  2C1Y A;  1X0R A;  2EIR A;  4PUF C;  3IK7 A;  1Z6M A;  4KCA A;  1OKD A;  3UBL A;  5ABR A;  3W6G A;  2CA8 A;  2VL9 A;  1R4W A;  12GS A;  3O3T A;  1MDK A;  4HS1 A;  3P2A A;  1YJ6 A;  4POM A;  2WZ9 A;  1SKR B;  4WBJ A;  3DGQ A;  2HSM B;  3UVH A;  2FY6 A;  5EY6 A;  2KHP A;  1B8X A;  3GST A;  3EYT A;  4MJB A;  3WYW A;  1FVJ A;  3L4N A;  4PNG A;  4Q5N A;  1R7H A;  3LFL A;  1A2L A;  2I3Y A;  4Z2R A;  4DSQ A;  4XIH A;  3GMF A;  2ZCT A;  5G5F A;  5DJL A;  2L5L A;  2AYT A;  3CSH A;  2R6K A;  3E9J B;  3KXO A;  2M72 A;  2A4V A;  3D6I A;  1VF1 A;  1S3D A;  2HRA A;  4FQU A;  1DE2 A;  6GSW A;  2LV3 A;  3MWH A;  3G7J A;  3CMI A;  1XW5 A;  3GKN A;  4G0I A;  4JED A;  3M3M A;  3GSS A;  4AKG A;  1EOG A;  2E7P A;  3FKF A;  2HRF A;  2PVQ A;  5J5N A;  1V40 A;  4OO4 A;  2IFQ B;  2V1M A;  4KND A;  2DJ1 A;  1G6W A;  2HSN B;  4G0L A;  2H72 A;  3GX8 A;  1B9Y C;  1GNE A;  1PGT A;  2ES7 A;  2MMO A;  4JRR A;  3F4T A;  4IKH A;  4OD7 A;  2WFC A;  4EO3 A;  3BBY A;  1R26 A;  2YCD A;  1ST9 A;  2VCX A;  1I5G A;  3GHA A;  5HR0 A;  1KEB A;  4X1U A;  2O7K A;  1T8E B;  1QXH A;  2BJX A;  3FZ9 A;  4J57 E;  3HYP A;  4RUV A;  5JWR B;  1SK0 A;  3HJO A;  3TRQ A;  4CY6 A;  2LKU A;  13GS A;  2DJK A;  2ALB A;  4BA7 A;  4OMV A;  2GZY A;  5G2Z A;  4AJ7 A;  1AQX A;  3D0Z A;  3KTB A;  1TKD B;  1SEN A;  2KP2 A;  2LJR A;  2UV8 G;  1O7U A;  3ZZX A;  4GWR A;  1YEX A;  4XRA A;  2LQQ A;  2H75 A;  2UZ8 A;  1A23 A;  4TRX A;  2J9H A;  4EIQ A;  2XPE A;  2C3Q A;  2G0F A;  3TKR A;  2XBQ A;  4F82 A;  2VL2 C;  2H1A A;  3H1N A;  1A0F A;  3DYR A;  4PTS A;  2YZH A;  3CSJ A;  2CVB A;  1N8J A;  3TRP A;  4ECB A;  2B7J A;  5HR3 A;  3H79 A;  1BG1 A;  2JU5 A;  4WXT A;  5DVB A;  3FYG A;  3KH9 A;  2WGR A;  17GS A;  3FZ5 A;  3P8W A;  4O7H A;  3FZ4 A;  4L5O A;  1SK2 A;  2F8A A;  4ZXG A;  1QQ2 A;  3QFB C;  5ECS A;  5ECL B;  2J23 A;  2YP6 A;  2JAC A;  4EDY A;  4MA9 A;  1KTE A;  2KLX A;  4G10 A;  4FIW A;  4K5R A;  4WBR D;  3WGX A;  2IL3 A;  3I69 A;  1MDJ A;  5EPF A;  4PQI A;  3GTU B;  5IQY A;  3FEU A;  4P3Y B;  3U5R E;  3AY8 A;  2EIQ A;  3IE3 A;  2X64 A;  3TGZ A;  5BMU A;  2YN1 A;  4EUY A;  2RUE A;  4XHM A;  5FT3 A;  1A0R P;  1B48 A;  3APS A;  4TR4 A;  4AJ8 A;  1PKW A;  5C00 A;  2HZE B;  3HVX A;  4HUA A;  5GAN D;  4AJ6 A;  5IMF A;  1JZO A;  1ZOF A;  2P5Q A;  5IPH A;  3F4S A;  1ZGN A;  4JZQ A;  1Y25 A;  4Q5F A;  4ZL7 A;  2PN8 A;  2EFD A;  1TK5 B;  4IQ1 A;  3CXG A;  2XPD A;  2L4Q A;  5DCG A;  2H6Z A;  3CTG A;  4I2U A;  2IN3 A;  4K9Z A;  5DCH A;  1PX6 A;  1WRY A;  1NSW A;  4IQA A;  1GSF A;  4PUR A;  4MF5 A;  3Q6O A;  3QAW A;  3L9S A;  2AAW A;  3GUR A;  1Q98 A;  3WD6 A;  1BYE A;  1T00 A;  4DSS B;  4IP6 A;  4PQH A;  2CZ2 A;  4MH2 A;  3DML A;  3Q19 A;  1TW9 A;  4W66 A;  2MMA A;  2IWT A;  1AXD A;  2X99 A;  3QD9 A;  2OE3 A;  2K8V A;  4NPB A;  2OT3 A;  3U6V A;  3GL5 A;  3QPM A;  5G30 A;  1QK8 A;  1OC8 A;  2FWF A;  3QR6 A;  3GKX A;  2GS3 A;  1IYI A;  4KDX A;  4TXO A;  3HJM A;  4GQF A;  2KUC A;  1SD8 A;  2C0G A;  2I81 A;  2X8G A;  4IP1 A;  3L9V A;  4TR1 A;  3VFI A;  4KH7 A;  1SD9 A;  3ZLP A;  5CO3 A;  2H19 A;  4KGI A;  2CT6 A;  2MBS A;  5ECQ B;  2GSS A;  3Q74 A;  5IO0 A;  3K8N A;  4DVC A;  4X43 A;  2LJA A;  3J7Y b;  1ZMA A;  1THX A;  2MBT A;  3ZFB A;  4MJA A;  4L8E A;  1OKT A;  1OC9 B;  4O5Q A;  1OVN A;  4GCI A;  4LMV A;  3QCP A;  3FY7 A;  1PRX A;  4GSS A;  2KOK A;  2H1B A;  3WGD A;  5H5R A;  4V2M A;  1EZK A;  4LLR A;  3IC4 A;  1X9W B;  2VM1 A;  1BF5 A;  2YJH A;  5DDL A;  1F9M A;  1XPV A;  4RQX A;  3L0H A;  4KSO A;  1Y1U A;  3ED3 A;  5G31 A;  3S9F A;  3R3E A;  3PGT A;  1OAZ A;  1K0N A;  5ECN B;  1YKC A;  5J9C A;  1ZYE A;  1XZO A;  2HRK A;  1OC3 A;  1TRU A;  4TN8 A;  19GS A;  4HOJ A;  1SU9 A;  5IO2 A;  1SKW B;  1ILO A;  1RK4 A;  1A2M A;  2DJJ A;  5H5S A;  5DJM A;  1THO A;  1SK1 A;  3HZ4 A;  2LTK A;  5D96 A;  4EL1 A;  4IEL A;  3NOF A;  1O73 A;  5IMC A;  4HU9 A;  5D9T A;  4O92 A;  3F9U A;  2PER A;  2RM5 A;  1GLQ A;  4ZL9 A;  2EC4 A;  4OWY A;  4POK A;  5H5Q A;  1SJI A;  1U3A A;  1T4Y A;  1URM A;  2O8V B;  1GTI A;  4IJI A;  1FG4 A;  4TKY A;  3GKK A;  3TKQ A;  4YAV A;  4MF7 A;  4GSN A;  2O85 A;  4MDC A;  1YVL A;  1U3I A;  4G01 A;  1GLP A;  4LA1 A;  2VKZ G;  5CRG A;  5DQY A;  3ZYW A;  2FA8 A;  16GS A;  1SYR A;  1B9X C;  2HE3 A;  1XWG A;  4DEJ A;  3ZRE A;  1YF1 A;  3DIE A;  3TCO A;  2TRC P;  2WUL A;  4G19 A;  4YQM A;  1JHB A;  2XBI A;  1GTB A;  3P7X A;  3TKP A;  2L57 A;  1E6B A;  2H71 A;  4AGS A;  2CZ3 A;  4ACS A;  3UJ1 A;  4XS4 B;  5FWG A;  2MMZ A;  1O6J A;  4ISD A;  4E8E A;  2R0G A;  4KCE A;  3F4R A;  1EGR A;  3TRX A;  1GUK A;  3IC8 A;  3KM6 A;  4BVY B;  1H4O A;  3EU3 A;  5G1K A;  2R4V A;  2N5F A;  1GTA A;  2TIR A;  3A5W A;  1V2A A;  2CQ9 A;  3BOA A;  3EMP A;  3ERW A;  2YOI A;  1T4Z A;  1S3C A;  1HD2 A;  3FW2 A;  2LQO A;  5ELA A;  4J56 E;  4JR4 A;  2I4A A;  2C8U A;  3I43 A;  1PQN A;  3KTL A;  5HR2 A;  5J4V A;  3VWV A;  4ZB9 A;  1UVZ A;  1MEK A;  2AV4 A;  2DIY A;  4HQS A;  3GV1 A;  2WJU A;  5J4Y A;  3D22 A;  1YZX A;  2AB6 A;  3RHB A;  2B5X A;  3BCI A;  1TK0 B;  3KH7 A;  1YQ1 A;  1J08 A;  3FK8 A;  2CAI A;  3QOU A;  4HZ2 A;  4XCS A;  1XWA A;  3GX0 A;  2IMK A;  1GUM A;  3LQ7 A;  1XXU A;  1PA3 A;  5KN3 A;  2DMM A;  1GP1 A;  3BJ5 A;  2AHE A;  1BAY A;  4L0U A;  3HKR A;  1OE7 A;  2VLU A;  4TXV A;  1UA5 A;  4N0V A;  4IVF A;  1EP7 A;  5AIV A;  5FHI A;  3TKS A;  5JWO B;  3CYN A;  3O6T A;  2A2R A;  4KUN A;  4KW6 A;  1X5E A;  2R5G A;  5E4W A;  4NHW A;  4K0N A;  2YNX A;  1WP0 A;  5D9W A;  5LD0 A;  2P0G A;  3LXZ A;  2V41 A;  2HNL A;  3IK9 A;  5F07 A;  3NZN A;  3HMJ G;  3LOR A;  1T3B A;  2DLX A;  2I9H A;  1AAZ A;  1VF2 A;  5ENU A;  2NBS A;  4TR0 A;  4IS0 A;  2O87 A;  2PPT A;  3KD0 A;  4GRF A;  1ML6 A;  3HDC A;  2C0D A;  4XTS A;  5B8A A;  2YWI A;  3MIX A;  5HR1 A;  3ME7 A;  1E2Y A;  3EWL A;  3GYK A;  2V32 A;  3G7I A;  1SJZ A;  1YY7 A;  4YQV A;  3EC3 A;  4ZB7 A;  5A34 A;  1QFN A;  5D8I A;  1MD3 A;  22GS A;  3TUE A;  1VGL A;  4RQR A;  1ABA A;  3O76 A;  3EMX A;  3GH9 A;  2FHE A;  1GL8 A;  4TOP A;  3C71 A;  3OR5 A;  1A24 A;  3IOS A;  1SL2 B;  1TRS A;  4N3Z A;  3LSZ A;  1CQH A;  4FYB A;  1HNB A;  3MNG A;  1T1V A;  4OO5 A;  2GQK A;  1ERT A;  1TJD A;  2X8C A;  1K3O A;  3FMW A;  3IXR A;  3TOT A;  2R0P A;  4I6X A;  1HQO A;  4NWY A;  2GQL A;  2REM A;  4MAB A;  2C3T A;  5AN1 A;  2OE1 A;  3LYP A;  5LCZ A;  4TW5 A;  5J41 A;  3G9B A;  1XIY A;  6GSU A;  1XWB A;  3EU4 A;  3Q18 A;  4ILF A;  1FB6 A;  3RHC A;  4WF4 A;  2K8S A;  1WOU A;  1FO5 A;  5DAK A;  4NXI A;  4DSR A;  1CQG A;  1FB0 A;  4MNN A;  4ZB6 A;  2DJ2 A;  1TXX A;  1F2E A;  2H0G A;  2H0I A;  4MMM A;  3E0U A;  4FYU A;  2GGT A;  1NHO A;  2JAD A;  1PD2 1;  2E0Q A;  1V58 A;  5ECI B;  2EIO A;  2GSR A;  3IR4 A;  4RI7 A;  4PGT A;  5BMU B;  2VO4 A;  1GSS A;  5IOX A;  1PSQ A;  1Z9H A;  1X9M B;  6GSY A;  3ME8 A;  3HJP A;  1DBY A;  2P5R A;  3M1G A;  1NW2 A;  1UC7 A;  1LU4 A;  5B6N A;  1KNG A;  4OFM A;  1PL2 A;  1LBK A;  2L4C A;  1AQW A;  1DUG A;  1O85 A;  4LL1 B;  2JL4 A;  2LNT A;  4HU7 A;  4K6X A;  3C8E A;  3IBH A;  4KDU A;  4NHZ A;  5CYY A;  2B5E A;  2FNO A;  5A4U A;  4F2I A;  3IAS 2;  4Z7X A;  2VM2 A;  10GS A;  4ML1 A;  4G2E A;  2BTO T;  4H86 A;  2VCV A;  4HJM A;  1SVO A;  3F3R A;  2C3N A;  4ZBB A;  2A2P A;  2B6M A;  3F8U A;  3UAP A;  3A2W A;  5DQS A;  3FZA A;  1XOB A;  5CNW A;  5CP1 A;  5INY A;  1TK8 B;  4HQZ A;  2IME A;  3QDN A;  1U87 A;  2FWE A;  4QMK A;  4YQU A;  1TTZ A;  1EV4 A;  4K0G A;  1ZYP A;  3UVT A;  3PPU A;  3H8Q A;  1ZZY A;  3G7Y A;  1FAA A;  2DKI A;  3TDG A;  4AI6 A;  4EXJ A;  4HJ2 A;  2HSY A;  1EP8 A;  2QA1 A;  3IAM 2;  1BX9 A;  4EKZ A;  1U88 A;  3VWX A;  5DAL A;  3IA1 A;  4TXO B;  2H01 A;  5J40 A;  1JLV A;  1O8W A;  2DKH A;  2DC5 A;  2IMI A;  4X4J A;  3MSZ A;  1K0C A;  4TR1 B;  4KA0 A;  1ERU A;  3TJF A;  1A8L A;  2CV4 A;  5IMA A;  5KN0 A;  4MJC A;  1MD4 A;  2AUV A;  1QUW A;  3F0I A;  2JSZ A;  3KCM A;  2C4J A;  5JCU A;  4MJE A;  2B1K A;  1PN0 A;  4BVX A;  2IMD A;  1F3A A;  2LEG A;  4K7O A;  4EVM A;  1WWJ A;  3CTF A;  1GSE A;  1XBS A;  2VL3 A;  2HYX A;  3GNJ A;  2L59 A;  3LWA A;  3QAG A;  1XWC A;  1TU7 A;  3R2Q A;  4XRD A;  4K5S A;  3GN3 A;  3N9J A;  1R5A A;  3F6F A;  5B6M A;  3GRX A;  3KP9 A;  3MYD A;  2ON5 A;  2PUK C;  3J7Y k;  1V9W A;  2WRT A;  1K0M A;  1AIU A;  4OCF A;  3TJG A;  1WJK A;  2OKA A;  2B5Y A;  5ECK B;  2OBK A;  4Z2T A;  4D73 A;  1TRV A;  3KIJ A;  3UL3 A;  1ZL9 A;  4N11 A;  2LUS A;  5D9X A;  2H73 A;  1K3L A;  4KSM A;  2GZZ A;  3KGK A;  2HRK B;  3UMA A;  5B8B A;  4ICY A;  5ELG A;  2HSH A;  4WR5 A;  5J4U A;  2LJK A;  3TOU A;  2GT5 A;  3DRN A;  1Z5Y E;  5KOX A;  3V1W A;  4AKX B;  5AIX A;  2JSY A;  3KP8 A;  1O8X A;  1NHY A;  4I8B A;  3UAR A;  2YWN A;  1HNC A;  4HEA 2;  4WET A;  2WB9 A;  5IPG A;  4ZIJ A;  3A2V A;  5ECO B;  4K2X A;  3MDK A;  1EGO A;  3A3T A;  1AW9 A;  5A5H A;  3MAK A;  2GST A;  1ACV A;  1EWX A;  1KBN A;  1I9D A;  2B1L A;  2C0F A;  2H8L A;  3ISO A;  5DBQ A;  1F6M C;  3D21 A;  2V2G A;  3HA9 A;  2QKE A;  4WKW A;  1A2J A;  2P31 A;  4EE0 A;  5KEJ A;  2N5A A;  2OA7 A;  11GS A;  5J9B A;  1TP9 A;  1M9B A;  4BPY A;  2M46 A;  2VCQ A;  4LL4 B;  4G9H A;  5IIZ A;  4KB3 A;  2H76 A;  3FR9 A;  3ZML A;  2H74 A;  5E59 A;  4CDO A;  3GH6 A;  3W8S A;  3TJK A;  4IHU A;  1QGV A;  4AF2 A;  1EEM A;  4E68 A;  3GIX A;  1Z7R A;  2CX4 A;  2HLS A;  4ML6 A;  1J9B A;  2FLS A;  2OAC A;  3M9J A;  2FCH A;  2H1L A;  1BG5 A;  2KP1 A;  2GVP A;  5CRD A;  3C1R A;  2FWH A;  4NMU A;  5F8B A;  3VK9 A;  1ZCP A;  3A5I A;  4GQC A;  4IGJ A;  2IPA A;  1PMT A;  5B7C A;  2YZU A;  4F03 A;  4FYC A;  1FVK A;  7GSS A;  3LEF A;  2FD3 A;  2X8H A;  4GTU A;  4I2T A;  3BCK A;  3KMO A;  3HHV A;  1XVQ A;  2GTU A;  2LNS A;  2VD0 A;  1GSQ A;  2XC2 A;  1BJX A;  1TDI A;  3VLN A;  2WDU A;  4L5L A;  4BL7 A;  3ZVJ A;  5D73 A;  18GS A;  4JR6 A;  1ERV A;  1GRX A;  4XS1 A;  1PX7 A;  4Z2U A;  1WE0 A;  3ZMK A;  4N10 A;  4EF0 A;  2WCI A;  5HQP A;  4MCU A;  2O5V A;  4V2N A;  6GSS A;  1C72 A;  4MZB A;  5C04 A;  5KN2 A;  1G7O A;  1GH2 A;  5GAP D;  1SL0 B;  4K8M A;  4ZBD A;  4JU5 A;  3WGE A;  3CRT A;  3IRA A;  4FH8 A;  4MK3 A;  2LRC A;  3ZL5 A;  4YAP A;  3UIW A;  3CWG A;  1XW9 A;  8GSS A;  2GSQ A;  2OAD A;  2CAQ A;  4ZB8 A;  5LNK e;  5L71 A;  1BQ7 A;  1ZYN A;  2A4H A;  2HZF A;  3GA4 A;  3TB2 A;  3H93 A;  3UOM A;  1SVM A;  1N2A A;  3KEB A;  2H6Y A;  1XOA A;  2GLR A;  2LRN A;  3CSI A;  3UBK A;  1AQV A;  2DSA A;  1TXU A;  3D5J A;  3DXB A;  1XVW A;  1A8Y A;  4IN0 A;  1ERW A;  3RPP A;  4EC0 A;  4MF6 A;  1U6T A;  2OE0 A;  1Z7P A;  2MZC A;  2RLI A;  4ZL8 A;  1Z3E A;  4ULX A;  3EVI A;  1EEJ A;  1GNW A;  2HSM A;  3C7M A;  4GXZ A;  5F06 A;  3LXT A;  2YV9 A;  2FUG 2;  4JBB A;  5A34 B;  3VWU A;  5J3R A;  2GZP A;  3QMX A;  2IIY A;  1FHE A;  4YKF A;  6GSV A;  1DE1 A;  2NVL A;  3HCZ A;  20GS A;  1M7T A;  1R5P A;  3C73 A;  3TU3 B;  3ERF A;  1G0T A;  1XCC A;  1SYX A;  3H4K A;  5ECP B;  2EFC A;  4HDE A;  3CBU A;  5F0G A;  4PUA A;  1X9S B;  4OFN A;  5A5K A;  3QAV A;  3VPQ A;  4GST A;  4E8H A;  4NV5 A;  4F0C A;  5JWQ B;  4HI7 A;  1WIK A;  2MYG A;  3GFK A;  6GSX A;  3GKM A;  3F6D A;  2CVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...