5A1NB

The crystal structure of the gst-like domains complex of eprs-aimp2 mutant s156d
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
204
Chain Sequence
ALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHDSVKSVPENLLKCFDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGSVTVPANVQRWMRSCENLAPFNTALKLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASE
publication title The Crystal Structure of the Gst-Like Domains Complex of Eprs-Aimp2 Mutant S156D
rcsb
source organism Homo sapiens
total genus 64
structure length 204
sequence length 216
ec nomenclature
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
B PF18569 Thioredoxin_16 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a1nB00
5A1NB 5A34B 4AI6A 4AKGA 5A5HA 4ZB7A 4AKHA 5A34A 4AKIA 5BMUB 5A1NA 4W66A 5A5HB
chains in the Genus database with same CATH superfamily
3FR9A 3HJMA 2OA7A 4J2FA 5GSSA 1GUMA 12GSA 1M99A 6GSTA 3VLNA 1A0FA 3CRUA 2ON5A 1BYEA 5ECKB 3I69A 2FHEA 2X64A 4KF9A 3AY8A 4PI2C 4O92A 1V40A 2PERA 4IELA 4BVXB 1F2EA 1HNCA 2HSNA 1K0BA 4GLTA 3RFRC 1PGTA 3GURA 2GSTA 2C4JA 3IK7A 4ZBAA 1M9AA 22GSA 2VCTA 4KSMA 3I6AA 1GWCA 3Q19A 3Q74A 5D9VA 4GDFA 3PPUA 2DC5A 4ZB7A 2PGTA 4PUAA 3ZFBA 1HQOA 5A1NA 3IBHA 4MDCA 1GSSA 5F05A 2VCXA 4MP4A 2WZSA 2LJRA 3U6VA 4HZ2A 5DJLA 5D9XA 3FR6A 3LYKA 5A5KA 5ECSA 5F07A 1G7OA 1YKCA 1AQXA 4NHWA 1IYIA 3L0HA 4QQ7A 2VD1A 4OFMA 3CSJA 2R6KA 1R5AA 3CWGA 1GTAA 3TOUA 1MTCA 4L5LA 4G9HA 1BAYA 4PTSA 3ZMKA 5ECHB 2WVXA 4TOPA 4PNFA 5ECMB 2YV7A 3VI5A 1IYHA 4G01A 5ECLB 1SVLA 4E8EA 2GDRA 4AKIA 2HSNB 2F8FA 1MD3A 1OYJA 1V2AA 5ECRB 1EV4A 3GUSA 3M8NA 3RGBC 17GSA 2JL4A 2VKZG 2GSRA 3HJOA 1MD4A 2NTOA 3GH6A 6GSVA 4ZBBA 5AIVA 1YJ6A 5HFKA 2WJUA 3P8WA 4YAPA 3UARA 1B8XA 1M9BA 2J9HA 3RBTA 4MF5A 3N5OA 3LXZA 4I97A 4GSNA 1Y1UA 4KAEA 1K0DA 1I1IP 4ZB8A 3EE2A 1G6WA 5AISA 4ECIA 1AQWA 4KDUA 4F0BA 2O3EA 2WB9A 5F06A 4FXYP 3SWLA 1GNWA 1JZRA 3TGZA 5A34A 3GTUA 4PXOA 5D9TA 1SVMA 4IW9A 4EDYA 2VCVA 1VF3A 3DGQA 3EINA 5BMUB 1K3YA 1PKWA 2V6KA 2WW2A 3G7JA 4IVFA 3FR3A 2R4VA 4K0GA 3M1GA 3KXOA 4Q5QA 1SVOA 4HZ4A 5AN1A 4LMWA 4MPFA 4E68A 4Q5NA 4NHZA 1PN9A 2C80A 3IC8A 4HOJA 4ZB9A 3QAGA 4PI0C 2PMTA 3LQ7A 1N25A 5G5FA 3M0FA 4LMVA 5LD0A 4FQUA 4ZBDA 1K3LA 4GSSA 1PMTA 5A5HA 2IMKA 3UAPA 2EFEA 2GTUA 3KTLA 3O76A 2F3MA 2VO4A 5D9WA 2YV9A 2R5GA 3PGTA 3GSTA 4G10A 2IMIA 1K3OA 3ERFA 4ZXGA 5FT3A 4L5OA 3LSZA 3FRCA 1U88A 9GSSA 3C8EA 3GSSA 4K0NA 4WR4A 1BG1A 2HNLA 2R3XA 16GSA 1GUHA 5J4VA 1GSUA 3CHXC 3VWXA 5DQSA 1GNEA 3GTUB 5A34B 3F6FA 1TXUA 2C8UA 3R2QA 4YQVA 4HJ2A 3QR6A 1G6YA 4USSA 5J4YA 4Q5FA 4G0LA 4GF0A 4OFNA 1U87A 4ZB6A 4PNGA 19GSA 2WW0A 5F8BA 1PD21 2EFCA 4KGIA 3UBLA 2VCQA 5DJMA 5DDLA 3TOTA 1GUKA 2O36A 4YAVA 1AQVA 1BG5A 4PURA 1GTBA 3CRTA 1K0MA 4MF6A 2OADA 5BMUA 4E8HA 2UV8G 5LCZA 4IQ1A 5B7CA 5A5HB 5EVOA 1USBA 5GZZB 1E6BA 2O5VA 4YH2A 1HNAA 2CA8A 3UVHA 1GSEA 1ZGNA 2CZ3A 1XWKA 2HRKA 4GCIA 4F03A 1HNBA 20GSA 4MK3A 2C3QA 1EEMA 5J4UA 1GULA 2HRAA 1Y6EA 1KBNA 3VK9A 10GSA 3ZFLA 1XW5A 5FWGA 3M3MA 3WD6A 4KDXA 1VF1A 3P90A 4YQMA 2VCWA 2WW1A 3O3TA 2UZ8A 1K0CA 3FY7A 4PX1A 3Q18A 1ZL9A 2OACA 1GTIA 4ISDA 3W8SA 8GSSA 3N9JA 4AI6A 4EE0A 4ACSA 4BL7A 2N5FA 4KDYA 1K0OA 5G5EA 5FHIA 4KX4A 1M0UA 1RK4A 4N0VA 1YEWC 4PQIA 3KMOA 4OMVA 1PX6A 2WRTA 4HI7A 2PVQA 2YCDA 2A2SA 5DALA 4WR5A 1FW1A 4ECBA 5IQYA 2HRKB 5DAKA 3VPTA 2CVDA 3LFLA 3G7IA 2WDUA 6GSUA 2D2ZA 4GSTA 3FYGA 18GSA 1C72A 5AGYA 1TDIA 5ELAA 2HSMA 3VI7A 4JEDA 1EOHA 4AKGA 1OE7A 4ID0A 2WVZA 4IJIA 3UBKA 1JLWA 3IE3A 5A4WA 2WS2A 4MZWA 1BF5A 1LBKA 5ECPB 4ECJA 11GSA 5J5NA 5ELGA 3KMNA 2EFDA 3VURA 3MAKA 4BL7B 5EY6A 2CAQA 2PBJA 1GSDA 5ECIB 5GSTA 6GSYA 1GLQA 3QAVA 1TU7A 4EDZA 5JCUA 2AHEA 1OE8A 6GSXA 1BX9A 4AGSA 5DCGA 2OT3A 3IK9A 2GLRA 1PX7A 4G19A 1UA5A 4RI6A 1S4BP 5J47A 1B48A 1VF4A 5DALB 2A2RA 4EXJA 5AIXA 1GSQA 4JZQA 5DAKB 2CAIA 4JBBA 3ZMLA 2C3NA 4CHSA 2HQTA 4BVYB 2C3TA 4EC0A 1Q4JA 1TU8A 3GX0A 3CBUA 5ECNB 3R3EA 14GSA 1ML6A 4NAXA 6GSWA 2HSMB 1GTUA 3KM6A 1JLVA 3LJRA 1YVLA 3LXTA 4OFTA 2VCZA 3MDKA 2GSQA 6GSSA 3NIVA 1YDKA 1EV9A 4KH7A 4MPGA 2ON7A 5KEJA 1AW9A 4L8EA 4ECCA 4PHZC 3KJYA 4IS0A 2EFHA 1NHYA 3IR4A 1XWGA 3D0ZA 3LG6A 1K0AA 1XW6A 1YY7A 3HMJG 3QAWA 1B4PA 13GSA 1DUGA 2IL3A 4N3ZA 4QMKA 3PR8A 1U3IA 1YQ1A 5EL8A 1F3BA 5J41A 3BBYA 1GLPA 4G0IA 2VD0A 1FHEA 1PL2A 3VPQA 1GSYA 5ECQB 4IQAA 4W66A 1N2AA 5A1NB 5JCWA 3CSIA 3WYWA 4RI7A 3HKRA 3H1NA 4DEJA 1GSFA 1AXDA 4G0KA 2WVYA 4BVXA 4F0CA 5A4VA 4KE3A 4GTUA 1F3AA 4IKHA 3ERGA 4PQHA 1OKTA 3TU3B 4O7HA 7GSSA 4IGJA 5F0GA 2GSSA 4Q5RA 1Z9HA 2DSAA 1VF2A 4AKXB 3CSHA 2FNOA 5D73A 5A4UA 1PL1A 1EOGA 5ECOB 4YQUA 3ISOA 1LJRA 2AAWA 3F6DA 3LYPA 4IBPA 4MF7A 4PGTA 4BVYA 5J40A 2H1LA 2WW3A 2WVXB 1PA3A 3DD3A 2CZ2A 4AKHA 2AB6A 3F63A 1TW9A 1K0NA 1PKZA
chains in the Genus database with same CATH topology
3FR9A 3HJMA 2OA7A 4J2FA 5GSSA 1GUMA 12GSA 1M99A 6GSTA 3VLNA 1A0FA 3CRUA 2ON5A 1BYEA 5ECKB 3I69A 2FHEA 2X64A 4KF9A 3AY8A 4O92A 1V40A 2PERA 4IELA 4BVXB 1F2EA 1HNCA 2HSNA 1K0BA 4GLTA 1PGTA 3GURA 2GSTA 2C4JA 3IK7A 4ZBAA 1M9AA 22GSA 2VCTA 4KSMA 3I6AA 1GWCA 3Q19A 3Q74A 5D9VA 4GDFA 3PPUA 2DC5A 4ZB7A 2PGTA 4PUAA 3ZFBA 1HQOA 5A1NA 3IBHA 4MDCA 1GSSA 5F05A 2VCXA 4MP4A 2LJRA 3U6VA 4HZ2A 5DJLA 5D9XA 3FR6A 3LYKA 5A5KA 5ECSA 5F07A 1G7OA 1YKCA 1AQXA 4NHWA 1IYIA 3L0HA 4QQ7A 2VD1A 4OFMA 3CSJA 2R6KA 1R5AA 3CWGA 1GTAA 3TOUA 1MTCA 4L5LA 4G9HA 1BAYA 4PTSA 3ZMKA 5ECHB 4TOPA 4PNFA 5ECMB 2YV7A 3VI5A 1IYHA 4G01A 5ECLB 1SVLA 4E8EA 2GDRA 4AKIA 2HSNB 2F8FA 1MD3A 1OYJA 1V2AA 5ECRB 1EV4A 3GUSA 3M8NA 17GSA 2JL4A 2VKZG 2GSRA 3HJOA 1MD4A 2NTOA 3GH6A 6GSVA 4ZBBA 5AIVA 1YJ6A 5HFKA 2WJUA 3P8WA 4YAPA 3UARA 1B8XA 1M9BA 2J9HA 3RBTA 4MF5A 3N5OA 3LXZA 4I97A 4GSNA 1Y1UA 4KAEA 1K0DA 4ZB8A 3EE2A 1G6WA 5AISA 4ECIA 1AQWA 4KDUA 4F0BA 2WB9A 5F06A 3SWLA 1GNWA 1JZRA 3TGZA 5A34A 3GTUA 4PXOA 5D9TA 1SVMA 4IW9A 4EDYA 2VCVA 1VF3A 3DGQA 3EINA 5BMUB 1K3YA 1PKWA 2V6KA 3G7JA 4IVFA 3FR3A 2R4VA 4K0GA 3M1GA 3KXOA 4Q5QA 1SVOA 4HZ4A 5AN1A 4LMWA 4MPFA 4E68A 4Q5NA 4NHZA 1PN9A 2C80A 3IC8A 4HOJA 4ZB9A 3QAGA 2PMTA 3LQ7A 1N25A 5G5FA 3M0FA 4LMVA 5LD0A 4FQUA 4ZBDA 1K3LA 4GSSA 1PMTA 5A5HA 2IMKA 3UAPA 2EFEA 2GTUA 3KTLA 3O76A 2F3MA 2VO4A 5D9WA 2YV9A 2R5GA 3PGTA 3GSTA 4G10A 2IMIA 1K3OA 3ERFA 4ZXGA 5FT3A 4L5OA 3LSZA 3FRCA 1U88A 9GSSA 3C8EA 3GSSA 4K0NA 4WR4A 1BG1A 2HNLA 2R3XA 16GSA 1GUHA 5J4VA 1GSUA 3VWXA 5A34B 5DQSA 1GNEA 3GTUB 3F6FA 1TXUA 2C8UA 3R2QA 4YQVA 4HJ2A 3QR6A 1G6YA 4USSA 5J4YA 4Q5FA 4G0LA 4GF0A 4OFNA 1U87A 4ZB6A 4PNGA 19GSA 5F8BA 1PD21 2EFCA 4KGIA 3UBLA 2VCQA 5DJMA 5DDLA 3TOTA 1GUKA 4YAVA 1AQVA 1BG5A 4PURA 1GTBA 3CRTA 1K0MA 4MF6A 2OADA 5BMUA 4E8HA 2UV8G 5LCZA 4IQ1A 5B7CA 5A5HB 5EVOA 1USBA 5GZZB 1E6BA 2O5VA 4YH2A 1HNAA 2CA8A 3UVHA 1GSEA 1ZGNA 2CZ3A 1XWKA 2HRKA 4GCIA 4F03A 1HNBA 20GSA 4MK3A 2C3QA 1EEMA 5J4UA 1GULA 2HRAA 1Y6EA 1KBNA 3VK9A 10GSA 3ZFLA 1XW5A 5FWGA 3M3MA 3WD6A 4KDXA 1VF1A 3P90A 4YQMA 2VCWA 3O3TA 2UZ8A 1K0CA 3FY7A 4PX1A 3Q18A 1ZL9A 2OACA 1GTIA 4ISDA 3W8SA 8GSSA 3N9JA 4AI6A 4EE0A 4ACSA 4BL7A 2N5FA 4KDYA 1K0OA 5G5EA 5FHIA 4KX4A 1M0UA 1RK4A 4N0VA 4PQIA 3KMOA 4OMVA 1PX6A 2WRTA 4HI7A 2PVQA 2YCDA 2A2SA 5DALA 4WR5A 1FW1A 4ECBA 5IQYA 2HRKB 5DAKA 3VPTA 2CVDA 3LFLA 3G7IA 2WDUA 6GSUA 2D2ZA 4GSTA 3FYGA 18GSA 1C72A 5AGYA 1TDIA 5ELAA 2HSMA 3VI7A 4JEDA 1EOHA 4AKGA 1OE7A 4ID0A 4IJIA 3UBKA 1JLWA 3IE3A 5A4WA 2WS2A 4MZWA 1BF5A 1LBKA 5ECPB 4ECJA 11GSA 5J5NA 5ELGA 3KMNA 2EFDA 3VURA 3MAKA 4BL7B 5EY6A 2CAQA 2PBJA 1GSDA 5ECIB 5GSTA 6GSYA 1GLQA 3QAVA 1TU7A 4EDZA 5JCUA 2AHEA 1OE8A 6GSXA 1BX9A 4AGSA 5DCGA 2OT3A 3IK9A 2GLRA 1PX7A 4G19A 1UA5A 4RI6A 5J47A 1B48A 1VF4A 5DALB 2A2RA 4EXJA 5AIXA 1GSQA 4JZQA 5DAKB 2CAIA 4JBBA 3ZMLA 2C3NA 4CHSA 2HQTA 4BVYB 2C3TA 4EC0A 1Q4JA 1TU8A 3GX0A 3CBUA 5ECNB 3R3EA 14GSA 1ML6A 4NAXA 6GSWA 2HSMB 1GTUA 3KM6A 1JLVA 3LJRA 1YVLA 3LXTA 4OFTA 2VCZA 3MDKA 2GSQA 6GSSA 3NIVA 1YDKA 1EV9A 4KH7A 4MPGA 2ON7A 5KEJA 1AW9A 4L8EA 4ECCA 3KJYA 4IS0A 2EFHA 1NHYA 3IR4A 1XWGA 3D0ZA 3LG6A 1K0AA 1XW6A 1YY7A 3HMJG 3QAWA 1B4PA 13GSA 1DUGA 2IL3A 4N3ZA 4QMKA 3PR8A 1U3IA 1YQ1A 5EL8A 1F3BA 5J41A 3BBYA 1GLPA 4G0IA 2VD0A 1FHEA 1PL2A 3VPQA 1GSYA 5ECQB 4IQAA 4W66A 1N2AA 5A1NB 5JCWA 3CSIA 3WYWA 4RI7A 3HKRA 3H1NA 4DEJA 1GSFA 1AXDA 4G0KA 4BVXA 4F0CA 5A4VA 4KE3A 4GTUA 1F3AA 4IKHA 3ERGA 4PQHA 1OKTA 3TU3B 4O7HA 7GSSA 4IGJA 5F0GA 2GSSA 4Q5RA 1Z9HA 2DSAA 1VF2A 4AKXB 3CSHA 2FNOA 5D73A 5A4UA 1PL1A 1EOGA 5ECOB 4YQUA 3ISOA 1LJRA 2AAWA 3F6DA 3LYPA 4IBPA 4MF7A 4PGTA 4BVYA 5J40A 2H1LA 1PA3A 3DD3A 2CZ2A 4AKHA 2AB6A 3F63A 1TW9A 1K0NA 1PKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A1N B;  5A34 B;  4AI6 A;  4AKG A;  5A5H A;  4ZB7 A;  4AKH A;  5A34 A;  4AKI A;  5BMU B;  5A1N A;  4W66 A;  5A5H B; 
#chains in the Genus database with same CATH topology
 3FR9 A;  3HJM A;  2OA7 A;  4J2F A;  5GSS A;  1GUM A;  12GS A;  1M99 A;  6GST A;  3VLN A;  1A0F A;  3CRU A;  2ON5 A;  1BYE A;  5ECK B;  3I69 A;  2FHE A;  2X64 A;  4KF9 A;  3AY8 A;  4PI2 C;  4O92 A;  1V40 A;  2PER A;  4IEL A;  4BVX B;  1F2E A;  1HNC A;  2HSN A;  1K0B A;  4GLT A;  3RFR C;  1PGT A;  3GUR A;  2GST A;  2C4J A;  3IK7 A;  4ZBA A;  1M9A A;  22GS A;  2VCT A;  4KSM A;  3I6A A;  1GWC A;  3Q19 A;  3Q74 A;  5D9V A;  4GDF A;  3PPU A;  2DC5 A;  4ZB7 A;  2PGT A;  4PUA A;  3ZFB A;  1HQO A;  5A1N A;  3IBH A;  4MDC A;  1GSS A;  5F05 A;  2VCX A;  4MP4 A;  2WZS A;  2LJR A;  3U6V A;  4HZ2 A;  5DJL A;  5D9X A;  3FR6 A;  3LYK A;  5A5K A;  5ECS A;  5F07 A;  1G7O A;  1YKC A;  1AQX A;  4NHW A;  1IYI A;  3L0H A;  4QQ7 A;  2VD1 A;  4OFM A;  3CSJ A;  2R6K A;  1R5A A;  3CWG A;  1GTA A;  3TOU A;  1MTC A;  4L5L A;  4G9H A;  1BAY A;  4PTS A;  3ZMK A;  5ECH B;  2WVX A;  4TOP A;  4PNF A;  5ECM B;  2YV7 A;  3VI5 A;  1IYH A;  4G01 A;  5ECL B;  1SVL A;  4E8E A;  2GDR A;  4AKI A;  2HSN B;  2F8F A;  1MD3 A;  1OYJ A;  1V2A A;  5ECR B;  1EV4 A;  3GUS A;  3M8N A;  3RGB C;  17GS A;  2JL4 A;  2VKZ G;  2GSR A;  3HJO A;  1MD4 A;  2NTO A;  3GH6 A;  6GSV A;  4ZBB A;  5AIV A;  1YJ6 A;  5HFK A;  2WJU A;  3P8W A;  4YAP A;  3UAR A;  1B8X A;  1M9B A;  2J9H A;  3RBT A;  4MF5 A;  3N5O A;  3LXZ A;  4I97 A;  4GSN A;  1Y1U A;  4KAE A;  1K0D A;  1I1I P;  4ZB8 A;  3EE2 A;  1G6W A;  5AIS A;  4ECI A;  1AQW A;  4KDU A;  4F0B A;  2O3E A;  2WB9 A;  5F06 A;  4FXY P;  3SWL A;  1GNW A;  1JZR A;  3TGZ A;  5A34 A;  3GTU A;  4PXO A;  5D9T A;  1SVM A;  4IW9 A;  4EDY A;  2VCV A;  1VF3 A;  3DGQ A;  3EIN A;  5BMU B;  1K3Y A;  1PKW A;  2V6K A;  2WW2 A;  3G7J A;  4IVF A;  3FR3 A;  2R4V A;  4K0G A;  3M1G A;  3KXO A;  4Q5Q A;  1SVO A;  4HZ4 A;  5AN1 A;  4LMW A;  4MPF A;  4E68 A;  4Q5N A;  4NHZ A;  1PN9 A;  2C80 A;  3IC8 A;  4HOJ A;  4ZB9 A;  3QAG A;  4PI0 C;  2PMT A;  3LQ7 A;  1N25 A;  5G5F A;  3M0F A;  4LMV A;  5LD0 A;  4FQU A;  4ZBD A;  1K3L A;  4GSS A;  1PMT A;  5A5H A;  2IMK A;  3UAP A;  2EFE A;  2GTU A;  3KTL A;  3O76 A;  2F3M A;  2VO4 A;  5D9W A;  2YV9 A;  2R5G A;  3PGT A;  3GST A;  4G10 A;  2IMI A;  1K3O A;  3ERF A;  4ZXG A;  5FT3 A;  4L5O A;  3LSZ A;  3FRC A;  1U88 A;  9GSS A;  3C8E A;  3GSS A;  4K0N A;  4WR4 A;  1BG1 A;  2HNL A;  2R3X A;  16GS A;  1GUH A;  5J4V A;  1GSU A;  3CHX C;  3VWX A;  5DQS A;  1GNE A;  3GTU B;  5A34 B;  3F6F A;  1TXU A;  2C8U A;  3R2Q A;  4YQV A;  4HJ2 A;  3QR6 A;  1G6Y A;  4USS A;  5J4Y A;  4Q5F A;  4G0L A;  4GF0 A;  4OFN A;  1U87 A;  4ZB6 A;  4PNG A;  19GS A;  2WW0 A;  5F8B A;  1PD2 1;  2EFC A;  4KGI A;  3UBL A;  2VCQ A;  5DJM A;  5DDL A;  3TOT A;  1GUK A;  2O36 A;  4YAV A;  1AQV A;  1BG5 A;  4PUR A;  1GTB A;  3CRT A;  1K0M A;  4MF6 A;  2OAD A;  5BMU A;  4E8H A;  2UV8 G;  5LCZ A;  4IQ1 A;  5B7C A;  5A5H B;  5EVO A;  1USB A;  5GZZ B;  1E6B A;  2O5V A;  4YH2 A;  1HNA A;  2CA8 A;  3UVH A;  1GSE A;  1ZGN A;  2CZ3 A;  1XWK A;  2HRK A;  4GCI A;  4F03 A;  1HNB A;  20GS A;  4MK3 A;  2C3Q A;  1EEM A;  5J4U A;  1GUL A;  2HRA A;  1Y6E A;  1KBN A;  3VK9 A;  10GS A;  3ZFL A;  1XW5 A;  5FWG A;  3M3M A;  3WD6 A;  4KDX A;  1VF1 A;  3P90 A;  4YQM A;  2VCW A;  2WW1 A;  3O3T A;  2UZ8 A;  1K0C A;  3FY7 A;  4PX1 A;  3Q18 A;  1ZL9 A;  2OAC A;  1GTI A;  4ISD A;  3W8S A;  8GSS A;  3N9J A;  4AI6 A;  4EE0 A;  4ACS A;  4BL7 A;  2N5F A;  4KDY A;  1K0O A;  5G5E A;  5FHI A;  4KX4 A;  1M0U A;  1RK4 A;  4N0V A;  1YEW C;  4PQI A;  3KMO A;  4OMV A;  1PX6 A;  2WRT A;  4HI7 A;  2PVQ A;  2YCD A;  2A2S A;  5DAL A;  4WR5 A;  1FW1 A;  4ECB A;  5IQY A;  2HRK B;  5DAK A;  3VPT A;  2CVD A;  3LFL A;  3G7I A;  2WDU A;  6GSU A;  2D2Z A;  4GST A;  3FYG A;  18GS A;  1C72 A;  5AGY A;  1TDI A;  5ELA A;  2HSM A;  3VI7 A;  4JED A;  1EOH A;  4AKG A;  1OE7 A;  4ID0 A;  2WVZ A;  4IJI A;  3UBK A;  1JLW A;  3IE3 A;  5A4W A;  2WS2 A;  4MZW A;  1BF5 A;  1LBK A;  5ECP B;  4ECJ A;  11GS A;  5J5N A;  5ELG A;  3KMN A;  2EFD A;  3VUR A;  3MAK A;  4BL7 B;  5EY6 A;  2CAQ A;  2PBJ A;  1GSD A;  5ECI B;  5GST A;  6GSY A;  1GLQ A;  3QAV A;  1TU7 A;  4EDZ A;  5JCU A;  2AHE A;  1OE8 A;  6GSX A;  1BX9 A;  4AGS A;  5DCG A;  2OT3 A;  3IK9 A;  2GLR A;  1PX7 A;  4G19 A;  1UA5 A;  4RI6 A;  1S4B P;  5J47 A;  1B48 A;  1VF4 A;  5DAL B;  2A2R A;  4EXJ A;  5AIX A;  1GSQ A;  4JZQ A;  5DAK B;  2CAI A;  4JBB A;  3ZML A;  2C3N A;  4CHS A;  2HQT A;  4BVY B;  2C3T A;  4EC0 A;  1Q4J A;  1TU8 A;  3GX0 A;  3CBU A;  5ECN B;  3R3E A;  14GS A;  1ML6 A;  4NAX A;  6GSW A;  2HSM B;  1GTU A;  3KM6 A;  1JLV A;  3LJR A;  1YVL A;  3LXT A;  4OFT A;  2VCZ A;  3MDK A;  2GSQ A;  6GSS A;  3NIV A;  1YDK A;  1EV9 A;  4KH7 A;  4MPG A;  2ON7 A;  5KEJ A;  1AW9 A;  4L8E A;  4ECC A;  4PHZ C;  3KJY A;  4IS0 A;  2EFH A;  1NHY A;  3IR4 A;  1XWG A;  3D0Z A;  3LG6 A;  1K0A A;  1XW6 A;  1YY7 A;  3HMJ G;  3QAW A;  1B4P A;  13GS A;  1DUG A;  2IL3 A;  4N3Z A;  4QMK A;  3PR8 A;  1U3I A;  1YQ1 A;  5EL8 A;  1F3B A;  5J41 A;  3BBY A;  1GLP A;  4G0I A;  2VD0 A;  1FHE A;  1PL2 A;  3VPQ A;  1GSY A;  5ECQ B;  4IQA A;  4W66 A;  1N2A A;  5A1N B;  5JCW A;  3CSI A;  3WYW A;  4RI7 A;  3HKR A;  3H1N A;  4DEJ A;  1GSF A;  1AXD A;  4G0K A;  2WVY A;  4BVX A;  4F0C A;  5A4V A;  4KE3 A;  4GTU A;  1F3A A;  4IKH A;  3ERG A;  4PQH A;  1OKT A;  3TU3 B;  4O7H A;  7GSS A;  4IGJ A;  5F0G A;  2GSS A;  4Q5R A;  1Z9H A;  2DSA A;  1VF2 A;  4AKX B;  3CSH A;  2FNO A;  5D73 A;  5A4U A;  1PL1 A;  1EOG A;  5ECO B;  4YQU A;  3ISO A;  1LJR A;  2AAW A;  3F6D A;  3LYP A;  4IBP A;  4MF7 A;  4PGT A;  4BVY A;  5J40 A;  2H1L A;  2WW3 A;  2WVX B;  1PA3 A;  3DD3 A;  2CZ2 A;  4AKH A;  2AB6 A;  3F63 A;  1TW9 A;  1K0N A;  1PKZ A; 
#chains in the Genus database with same CATH homology
 3FR9 A;  3HJM A;  2OA7 A;  4J2F A;  5GSS A;  1GUM A;  12GS A;  1M99 A;  6GST A;  3VLN A;  1A0F A;  3CRU A;  2ON5 A;  1BYE A;  5ECK B;  3I69 A;  2FHE A;  2X64 A;  4KF9 A;  3AY8 A;  4O92 A;  1V40 A;  2PER A;  4IEL A;  4BVX B;  1F2E A;  1HNC A;  2HSN A;  1K0B A;  4GLT A;  1PGT A;  3GUR A;  2GST A;  2C4J A;  3IK7 A;  4ZBA A;  1M9A A;  22GS A;  2VCT A;  4KSM A;  3I6A A;  1GWC A;  3Q19 A;  3Q74 A;  5D9V A;  4GDF A;  3PPU A;  2DC5 A;  4ZB7 A;  2PGT A;  4PUA A;  3ZFB A;  1HQO A;  5A1N A;  3IBH A;  4MDC A;  1GSS A;  5F05 A;  2VCX A;  4MP4 A;  2LJR A;  3U6V A;  4HZ2 A;  5DJL A;  5D9X A;  3FR6 A;  3LYK A;  5A5K A;  5ECS A;  5F07 A;  1G7O A;  1YKC A;  1AQX A;  4NHW A;  1IYI A;  3L0H A;  4QQ7 A;  2VD1 A;  4OFM A;  3CSJ A;  2R6K A;  1R5A A;  3CWG A;  1GTA A;  3TOU A;  1MTC A;  4L5L A;  4G9H A;  1BAY A;  4PTS A;  3ZMK A;  5ECH B;  4TOP A;  4PNF A;  5ECM B;  2YV7 A;  3VI5 A;  1IYH A;  4G01 A;  5ECL B;  1SVL A;  4E8E A;  2GDR A;  4AKI A;  2HSN B;  2F8F A;  1MD3 A;  1OYJ A;  1V2A A;  5ECR B;  1EV4 A;  3GUS A;  3M8N A;  17GS A;  2JL4 A;  2VKZ G;  2GSR A;  3HJO A;  1MD4 A;  2NTO A;  3GH6 A;  6GSV A;  4ZBB A;  5AIV A;  1YJ6 A;  5HFK A;  2WJU A;  3P8W A;  4YAP A;  3UAR A;  1B8X A;  1M9B A;  2J9H A;  3RBT A;  4MF5 A;  3N5O A;  3LXZ A;  4I97 A;  4GSN A;  1Y1U A;  4KAE A;  1K0D A;  4ZB8 A;  3EE2 A;  1G6W A;  5AIS A;  4ECI A;  1AQW A;  4KDU A;  4F0B A;  2WB9 A;  5F06 A;  3SWL A;  1GNW A;  1JZR A;  3TGZ A;  5A34 A;  3GTU A;  4PXO A;  5D9T A;  1SVM A;  4IW9 A;  4EDY A;  2VCV A;  1VF3 A;  3DGQ A;  3EIN A;  5BMU B;  1K3Y A;  1PKW A;  2V6K A;  3G7J A;  4IVF A;  3FR3 A;  2R4V A;  4K0G A;  3M1G A;  3KXO A;  4Q5Q A;  1SVO A;  4HZ4 A;  5AN1 A;  4LMW A;  4MPF A;  4E68 A;  4Q5N A;  4NHZ A;  1PN9 A;  2C80 A;  3IC8 A;  4HOJ A;  4ZB9 A;  3QAG A;  2PMT A;  3LQ7 A;  1N25 A;  5G5F A;  3M0F A;  4LMV A;  5LD0 A;  4FQU A;  4ZBD A;  1K3L A;  4GSS A;  1PMT A;  5A5H A;  2IMK A;  3UAP A;  2EFE A;  2GTU A;  3KTL A;  3O76 A;  2F3M A;  2VO4 A;  5D9W A;  2YV9 A;  2R5G A;  3PGT A;  3GST A;  4G10 A;  2IMI A;  1K3O A;  3ERF A;  4ZXG A;  5FT3 A;  4L5O A;  3LSZ A;  3FRC A;  1U88 A;  9GSS A;  3C8E A;  3GSS A;  4K0N A;  4WR4 A;  1BG1 A;  2HNL A;  2R3X A;  16GS A;  1GUH A;  5J4V A;  1GSU A;  3VWX A;  5A34 B;  5DQS A;  1GNE A;  3GTU B;  3F6F A;  1TXU A;  2C8U A;  3R2Q A;  4YQV A;  4HJ2 A;  3QR6 A;  1G6Y A;  4USS A;  5J4Y A;  4Q5F A;  4G0L A;  4GF0 A;  4OFN A;  1U87 A;  4ZB6 A;  4PNG A;  19GS A;  5F8B A;  1PD2 1;  2EFC A;  4KGI A;  3UBL A;  2VCQ A;  5DJM A;  5DDL A;  3TOT A;  1GUK A;  4YAV A;  1AQV A;  1BG5 A;  4PUR A;  1GTB A;  3CRT A;  1K0M A;  4MF6 A;  2OAD A;  5BMU A;  4E8H A;  2UV8 G;  5LCZ A;  4IQ1 A;  5B7C A;  5A5H B;  5EVO A;  1USB A;  5GZZ B;  1E6B A;  2O5V A;  4YH2 A;  1HNA A;  2CA8 A;  3UVH A;  1GSE A;  1ZGN A;  2CZ3 A;  1XWK A;  2HRK A;  4GCI A;  4F03 A;  1HNB A;  20GS A;  4MK3 A;  2C3Q A;  1EEM A;  5J4U A;  1GUL A;  2HRA A;  1Y6E A;  1KBN A;  3VK9 A;  10GS A;  3ZFL A;  1XW5 A;  5FWG A;  3M3M A;  3WD6 A;  4KDX A;  1VF1 A;  3P90 A;  4YQM A;  2VCW A;  3O3T A;  2UZ8 A;  1K0C A;  3FY7 A;  4PX1 A;  3Q18 A;  1ZL9 A;  2OAC A;  1GTI A;  4ISD A;  3W8S A;  8GSS A;  3N9J A;  4AI6 A;  4EE0 A;  4ACS A;  4BL7 A;  2N5F A;  4KDY A;  1K0O A;  5G5E A;  5FHI A;  4KX4 A;  1M0U A;  1RK4 A;  4N0V A;  4PQI A;  3KMO A;  4OMV A;  1PX6 A;  2WRT A;  4HI7 A;  2PVQ A;  2YCD A;  2A2S A;  5DAL A;  4WR5 A;  1FW1 A;  4ECB A;  5IQY A;  2HRK B;  5DAK A;  3VPT A;  2CVD A;  3LFL A;  3G7I A;  2WDU A;  6GSU A;  2D2Z A;  4GST A;  3FYG A;  18GS A;  1C72 A;  5AGY A;  1TDI A;  5ELA A;  2HSM A;  3VI7 A;  4JED A;  1EOH A;  4AKG A;  1OE7 A;  4ID0 A;  4IJI A;  3UBK A;  1JLW A;  3IE3 A;  5A4W A;  2WS2 A;  4MZW A;  1BF5 A;  1LBK A;  5ECP B;  4ECJ A;  11GS A;  5J5N A;  5ELG A;  3KMN A;  2EFD A;  3VUR A;  3MAK A;  4BL7 B;  5EY6 A;  2CAQ A;  2PBJ A;  1GSD A;  5ECI B;  5GST A;  6GSY A;  1GLQ A;  3QAV A;  1TU7 A;  4EDZ A;  5JCU A;  2AHE A;  1OE8 A;  6GSX A;  1BX9 A;  4AGS A;  5DCG A;  2OT3 A;  3IK9 A;  2GLR A;  1PX7 A;  4G19 A;  1UA5 A;  4RI6 A;  5J47 A;  1B48 A;  1VF4 A;  5DAL B;  2A2R A;  4EXJ A;  5AIX A;  1GSQ A;  4JZQ A;  5DAK B;  2CAI A;  4JBB A;  3ZML A;  2C3N A;  4CHS A;  2HQT A;  4BVY B;  2C3T A;  4EC0 A;  1Q4J A;  1TU8 A;  3GX0 A;  3CBU A;  5ECN B;  3R3E A;  14GS A;  1ML6 A;  4NAX A;  6GSW A;  2HSM B;  1GTU A;  3KM6 A;  1JLV A;  3LJR A;  1YVL A;  3LXT A;  4OFT A;  2VCZ A;  3MDK A;  2GSQ A;  6GSS A;  3NIV A;  1YDK A;  1EV9 A;  4KH7 A;  4MPG A;  2ON7 A;  5KEJ A;  1AW9 A;  4L8E A;  4ECC A;  3KJY A;  4IS0 A;  2EFH A;  1NHY A;  3IR4 A;  1XWG A;  3D0Z A;  3LG6 A;  1K0A A;  1XW6 A;  1YY7 A;  3HMJ G;  3QAW A;  1B4P A;  13GS A;  1DUG A;  2IL3 A;  4N3Z A;  4QMK A;  3PR8 A;  1U3I A;  1YQ1 A;  5EL8 A;  1F3B A;  5J41 A;  3BBY A;  1GLP A;  4G0I A;  2VD0 A;  1FHE A;  1PL2 A;  3VPQ A;  1GSY A;  5ECQ B;  4IQA A;  4W66 A;  1N2A A;  5A1N B;  5JCW A;  3CSI A;  3WYW A;  4RI7 A;  3HKR A;  3H1N A;  4DEJ A;  1GSF A;  1AXD A;  4G0K A;  4BVX A;  4F0C A;  5A4V A;  4KE3 A;  4GTU A;  1F3A A;  4IKH A;  3ERG A;  4PQH A;  1OKT A;  3TU3 B;  4O7H A;  7GSS A;  4IGJ A;  5F0G A;  2GSS A;  4Q5R A;  1Z9H A;  2DSA A;  1VF2 A;  4AKX B;  3CSH A;  2FNO A;  5D73 A;  5A4U A;  1PL1 A;  1EOG A;  5ECO B;  4YQU A;  3ISO A;  1LJR A;  2AAW A;  3F6D A;  3LYP A;  4IBP A;  4MF7 A;  4PGT A;  4BVY A;  5J40 A;  2H1L A;  1PA3 A;  3DD3 A;  2CZ2 A;  4AKH A;  2AB6 A;  3F63 A;  1TW9 A;  1K0N A;  1PKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...