5A34A

The crystal structure of the gst-like domains complex of eprs-aimp2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
168
structure length
168
Chain Sequence
TLSLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLARVATTAGLYGSNLMEHTEIDHWLEFSATKLSSCDSFTSTINELNHCLSLRTYLVGNSLSLADLCVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWDVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASE
publication title Assembly of Multi-tRNA Synthetase Complex Via Heterotetrameric Glutathione Transferase-Homology Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 168
sequence length 168
chains with identical sequence C, E, G
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a34A00
5A5HA 4ZB7A 5A5HB 5A34B 5A1NA 4AKGA 5A1NB 5A34A 4AKHA 4AKIA 4W66A 5BMUB 4AI6A
chains in the Genus database with same CATH superfamily
5LD0A 3IK7A 5EY6A 4N3ZA 1YJ6A 4ZBDA 4BL7A 1PA3A 1SVOA 5J40A 3FR6A 3KMNA 5ECKB 2WB9A 1Q4JA 3ZFBA 2GSQA 5EVOA 3CBUA 3D0ZA 2HQTA 2VCZA 3O76A 1G6WA 4FXYP 4OMVA 5F05A 4FQUA 4AGSA 3GURA 2EFCA 1K0BA 4YAVA 3DD3A 5J4YA 4HOJA 5JCUA 1GSUA 5AN1A 4ZB6A 1GTBA 1K0MA 4IELA 3M8NA 5ELAA 4PI0C 5AIXA 5LCZA 3HKRA 2IMIA 1SVMA 4ZB9A 1AQXA 3C8EA 3FRCA 4PHZC 1R5AA 5F06A 3IK9A 3WYWA 6GSVA 3VPQA 1GSYA 1PL1A 2DC5A 4N0VA 4ZBBA 4Q5FA 3CSIA 1K3OA 3KTLA 3TGZA 3QAWA 1HNCA 3G7IA 1TW9A 2R5GA 5HFKA 4G01A 4MF5A 3GUSA 4MF7A 1GLPA 1GULA 3TOUA 5GSSA 3FR3A 3VI7A 4IVFA 4KE3A 5J5NA 2PVQA 3CSJA 3I6AA 4G9HA 3UARA 4MK3A 4I97A 4OFNA 3U6VA 3RGBC 1VF4A 1K0DA 1HNAA 2C4JA 2CZ3A 4AI6A 1B48A 2F3MA 2ON7A 3CHXC 2D2ZA 2OT3A 5J41A 4ZB8A 3GSTA 3F6FA 5ECOB 4PNFA 2A2RA 2HRAA 4JEDA 3N9JA 3NIVA 3PPUA 2GSTA 3CRTA 2J9HA 2VCTA 4KAEA 3N5OA 4Q5NA 5J4VA 5A5HB 1F2EA 1PMTA 1XW6A 3KJYA 2VCWA 2OA7A 2CA8A 1USBA 4WR5A 4PNGA 5JCWA 4KDYA 1PD21 5DJLA 2HSNB 3ZMKA 2HRKA 3L0HA 1TU8A 3UAPA 2R6KA 1VF2A 9GSSA 3CSHA 1SVLA 5ECHB 2HSMB 2WS2A 1K0CA 5A4WA 3MDKA 3M0FA 11GSA 4EDZA 3CRUA 1PGTA 2DSAA 4MDCA 5A34A 1GTAA 5ELGA 5DDLA 3ISOA 4GLTA 4GDFA 12GSA 3GH6A 14GSA 1GNEA 4AKGA 1AXDA 3KMOA 4KH7A 4ECJA 4RI7A 22GSA 1K0NA 1XWKA 4IW9A 1C72A 3VK9A 4J2FA 1JLVA 4ACSA 1K0AA 1GUHA 1N2AA 1GNWA 1YEWC 1RK4A 3GTUA 4YAPA 5A5HA 2YV9A 1MTCA 4YQUA 2OACA 4EE0A 3Q18A 2WW2A 3Q19A 3ZMLA 4F0CA 4AKIA 4MF6A 1ZL9A 4IS0A 4MPFA 2PMTA 1U87A 2HSNA 2UZ8A 3RBTA 1IYHA 1GSQA 5AISA 1KBNA 3EINA 2HSMA 1ML6A 5G5EA 2VCXA 2WVYA 4IBPA 4QMKA 2OADA 2CAIA 4BVXA 5FHIA 5D9VA 7GSSA 4O92A 4ZXGA 4EDYA 1NHYA 20GSA 4JZQA 5ECLB 1BYEA 1U3IA 4G0KA 1YVLA 3HMJG 3QAGA 3P8WA 5KEJA 6GSXA 4OFMA 4Q5QA 5FT3A 4AKXB 2WZSA 4JBBA 4CHSA 4PX1A 2UV8G 1GUMA 2R3XA 13GSA 2WVXB 2VKZG 4NHZA 4KDUA 3LXZA 1GSSA 1HNBA 2IMKA 1GSFA 4IGJA 5DQSA 2WDUA 4ISDA 5B7CA 4F03A 4L5OA 1F3AA 1LBKA 2GSRA 5ECIB 1PKZA 3BBYA 1Y1UA 1K3YA 3HJMA 1K3LA 4QQ7A 5GSTA 3LFLA 3MAKA 1BX9A 16GSA 5ECSA 4E68A 2GDRA 10GSA 4PXOA 1YQ1A 4Q5RA 4KGIA 5D9TA 3UVHA 2WW3A 3P90A 1Y6EA 1BAYA 1VF1A 4G0IA 3KM6A 4HI7A 1U88A 1F3BA 1A0FA 4PGTA 1Z9HA 1YKCA 2EFEA 2O5VA 1BG5A 2LJRA 5F07A 2IL3A 4LMVA 3HJOA 1G7OA 1MD3A 1TXUA 2O36A 4G19A 5DALB 1M9AA 4K0GA 3Q74A 5J4UA 1EV9A 4HZ4A 1VF3A 5ECMB 3FY7A 1M0UA 18GSA 3IE3A 5BMUB 1IYIA 4PTSA 4ZB7A 4BL7B 5FWGA 2AHEA 4O7HA 2VD1A 1LJRA 4ID0A 3VWXA 1B8XA 5G5FA 5IQYA 2EFHA 4YQMA 19GSA 2WVXA 5ECPB 2HNLA 3GSSA 4OFTA 2CVDA 4GSSA 5A5KA 1ZGNA 3VPTA 1V40A 3H1NA 4KDXA 3GX0A 3F63A 4BVYB 1OYJA 4EXJA 3VURA 3IR4A 1PKWA 2GLRA 3O3TA 4LMWA 4USSA 1OE8A 5A4VA 4PUAA 1PX7A 2O3EA 4W66A 2EFDA 4GF0A 4GSTA 3WD6A 1FHEA 4IJIA 4PQHA 3FYGA 2C8UA 3UBKA 2WW1A 3ERGA 2VO4A 3VI5A 3KXOA 1EEMA 1JLWA 3R3EA 1AW9A 5BMUA 4MPGA 2VCVA 6GSYA 4HJ2A 3LG6A 4YH2A 1I1IP 4KSMA 3PR8A 2AB6A 4E8HA 3DGQA 2N5FA 6GSWA 5AGYA 4ZBAA 1DUGA 1UA5A 4NHWA 4PQIA 1K0OA 1TU7A 2CZ2A 3VLNA 4L5LA 3SWLA 4F0BA 1GTIA 3PGTA 4BVYA 6GSUA 2AAWA 2X64A 17GSA 4NAXA 1YY7A 1YDKA 1PL2A 1MD4A 5D73A 3FR9A 3IBHA 5F0GA 2FHEA 4GCIA 2PBJA 3LYPA 3TOTA 5AIVA 1G6YA 2R4VA 4GSNA 4WR4A 5D9XA 2YCDA 5ECQB 4GTUA 1XW5A 2C3NA 3F6DA 2V6KA 5DJMA 3M3MA 4K0NA 5DAKB 4PURA 1E6BA 3CWGA 4YQVA 5GZZB 2PGTA 3LSZA 1AQWA 2WVZA 2VD0A 1GSDA 4L8EA 1PN9A 1XWGA 1EOGA 2HRKB 2WW0A 2YV7A 1GLQA 3LJRA 3QAVA 1JZRA 1PX6A 4IQ1A 4AKHA 4KX4A 2WJUA 3ERFA 1S4BP 3ZFLA 4PI2C 5DCGA 5A34B 2ON5A 2JL4A 3UBLA 5EL8A 4MZWA 5A1NB 1GUKA 3G7JA 8GSSA 3W8SA 1GSEA 1V2AA 2C3QA 2WRTA 1HQOA 1GWCA 4G10A 1BF5A 5F8BA 4ECCA 4EC0A 2CAQA 4DEJA 3I69A 4E8EA 1OE7A 3M1GA 3GTUB 2GSSA 3IC8A 1EOHA 5DAKA 2GTUA 5D9WA 4RI6A 5A4UA 1TDIA 3TU3B 4HZ2A 2FNOA 6GSTA 3R2QA 1N25A 1EV4A 3LYKA 1BG1A 4KF9A 1FW1A 2VCQA 2F8FA 2PERA 3QR6A 3LQ7A 2C80A 1AQVA 1GTUA 3EE2A 4BVXB 2H1LA 5DALA 4MP4A 4ECBA 1OKTA 2A2SA 3AY8A 4TOPA 2NTOA 6GSSA 1M9BA 1M99A 2C3TA 3LXTA 3RFRC 4ECIA 5J47A 5A1NA 4IQAA 4G0LA 5ECNB 1B4PA 4IKHA 5ECRB
chains in the Genus database with same CATH topology
5LD0A 3IK7A 5EY6A 4N3ZA 1YJ6A 4ZBDA 4BL7A 1PA3A 1SVOA 5J40A 3FR6A 3KMNA 5ECKB 2WB9A 1Q4JA 3ZFBA 2GSQA 5EVOA 3CBUA 3D0ZA 2HQTA 2VCZA 3O76A 1G6WA 4OMVA 5F05A 4FQUA 4AGSA 3GURA 2EFCA 1K0BA 4YAVA 3DD3A 5J4YA 4HOJA 5JCUA 1GSUA 5AN1A 4ZB6A 1GTBA 1K0MA 4IELA 3M8NA 5ELAA 5AIXA 5LCZA 3HKRA 2IMIA 1SVMA 4ZB9A 1AQXA 3C8EA 3FRCA 1R5AA 5F06A 3IK9A 3WYWA 6GSVA 3VPQA 1GSYA 1PL1A 2DC5A 4N0VA 4ZBBA 4Q5FA 3CSIA 1K3OA 3KTLA 3TGZA 3QAWA 1HNCA 3G7IA 1TW9A 2R5GA 5HFKA 4G01A 4MF5A 3GUSA 4MF7A 1GLPA 1GULA 3TOUA 5GSSA 3FR3A 3VI7A 4IVFA 4KE3A 5J5NA 2PVQA 3CSJA 3I6AA 4G9HA 3UARA 4MK3A 4I97A 4OFNA 3U6VA 1VF4A 1K0DA 1HNAA 2C4JA 2CZ3A 4AI6A 1B48A 2F3MA 2ON7A 2D2ZA 2OT3A 5J41A 4ZB8A 3GSTA 3F6FA 5ECOB 4PNFA 2A2RA 2HRAA 4JEDA 3N9JA 3NIVA 3PPUA 2GSTA 3CRTA 2J9HA 2VCTA 4KAEA 3N5OA 4Q5NA 5J4VA 5A5HB 1F2EA 1PMTA 1XW6A 3KJYA 2VCWA 2OA7A 2CA8A 1USBA 4WR5A 4PNGA 5JCWA 4KDYA 1PD21 5DJLA 2HSNB 3ZMKA 2HRKA 3L0HA 1TU8A 3UAPA 2R6KA 1VF2A 9GSSA 3CSHA 1SVLA 5ECHB 2HSMB 2WS2A 1K0CA 5A4WA 3MDKA 3M0FA 11GSA 4EDZA 3CRUA 1PGTA 2DSAA 4MDCA 5A34A 1GTAA 5ELGA 5DDLA 3ISOA 4GLTA 4GDFA 12GSA 3GH6A 14GSA 1GNEA 4AKGA 1AXDA 3KMOA 4KH7A 4ECJA 4RI7A 22GSA 1K0NA 1XWKA 4IW9A 1C72A 3VK9A 4J2FA 1JLVA 4ACSA 1K0AA 1GUHA 1N2AA 1GNWA 3GTUA 1RK4A 4YAPA 5A5HA 2YV9A 1MTCA 4YQUA 2OACA 4EE0A 3Q18A 3Q19A 3ZMLA 4F0CA 4AKIA 4MF6A 1ZL9A 4IS0A 4MPFA 2PMTA 1U87A 2HSNA 2UZ8A 3RBTA 1IYHA 1GSQA 5AISA 1KBNA 3EINA 2HSMA 1ML6A 5G5EA 2VCXA 4IBPA 4QMKA 2OADA 2CAIA 4BVXA 5FHIA 5D9VA 7GSSA 4O92A 4ZXGA 4EDYA 1NHYA 20GSA 4JZQA 5ECLB 1BYEA 1U3IA 4G0KA 1YVLA 3HMJG 3QAGA 3P8WA 5KEJA 6GSXA 4OFMA 4Q5QA 5FT3A 4AKXB 4JBBA 4CHSA 4PX1A 2UV8G 1GUMA 2R3XA 13GSA 2VKZG 4NHZA 4KDUA 3LXZA 1GSSA 1HNBA 2IMKA 1GSFA 4IGJA 5DQSA 2WDUA 4ISDA 5B7CA 4F03A 4L5OA 1F3AA 1LBKA 2GSRA 5ECIB 1PKZA 3BBYA 1Y1UA 1K3YA 3HJMA 1K3LA 4QQ7A 5GSTA 3LFLA 3MAKA 1BX9A 16GSA 5ECSA 4E68A 2GDRA 10GSA 4PXOA 1YQ1A 4Q5RA 4KGIA 5D9TA 3UVHA 3P90A 1Y6EA 1BAYA 1VF1A 4G0IA 3KM6A 4HI7A 1U88A 1F3BA 1A0FA 4PGTA 1Z9HA 1YKCA 2EFEA 2O5VA 1BG5A 2LJRA 5F07A 2IL3A 4LMVA 3HJOA 1G7OA 1MD3A 1TXUA 4G19A 5DALB 1M9AA 4K0GA 3Q74A 5J4UA 1EV9A 4HZ4A 1VF3A 5ECMB 3FY7A 1M0UA 18GSA 3IE3A 5BMUB 1IYIA 4PTSA 4ZB7A 4BL7B 5FWGA 2AHEA 4O7HA 2VD1A 1LJRA 4ID0A 3VWXA 1B8XA 5G5FA 5IQYA 2EFHA 4YQMA 19GSA 5ECPB 2HNLA 3GSSA 4OFTA 2CVDA 4GSSA 5A5KA 1ZGNA 3VPTA 1V40A 3H1NA 4KDXA 3GX0A 3F63A 4BVYB 1OYJA 4EXJA 3VURA 3IR4A 1PKWA 2GLRA 3O3TA 4LMWA 4USSA 1OE8A 5A4VA 4PUAA 1PX7A 4W66A 2EFDA 4GF0A 4GSTA 3WD6A 1FHEA 4IJIA 4PQHA 3FYGA 2C8UA 3UBKA 3ERGA 2VO4A 3VI5A 3KXOA 1EEMA 1JLWA 3R3EA 1AW9A 5BMUA 4MPGA 2VCVA 6GSYA 4HJ2A 3LG6A 4YH2A 4KSMA 3PR8A 2AB6A 4E8HA 3DGQA 2N5FA 6GSWA 5AGYA 4ZBAA 1DUGA 1UA5A 4NHWA 4PQIA 1K0OA 1TU7A 2CZ2A 3VLNA 4L5LA 3SWLA 4F0BA 1GTIA 3PGTA 4BVYA 6GSUA 2AAWA 2X64A 17GSA 4NAXA 1YY7A 1YDKA 1PL2A 1MD4A 5D73A 3FR9A 3IBHA 5F0GA 2FHEA 4GCIA 2PBJA 3LYPA 3TOTA 5AIVA 1G6YA 2R4VA 4GSNA 4WR4A 5D9XA 2YCDA 5ECQB 4GTUA 1XW5A 2C3NA 3F6DA 2V6KA 5DJMA 3M3MA 4K0NA 5DAKB 4PURA 1E6BA 3CWGA 4YQVA 5GZZB 2PGTA 3LSZA 1AQWA 2VD0A 1GSDA 4L8EA 1PN9A 1XWGA 1EOGA 2HRKB 2YV7A 1GLQA 3LJRA 3QAVA 1JZRA 1PX6A 4IQ1A 4AKHA 4KX4A 2WJUA 3ERFA 3ZFLA 5DCGA 5A34B 2ON5A 2JL4A 3UBLA 5EL8A 4MZWA 5A1NB 1GUKA 3G7JA 8GSSA 3W8SA 1GSEA 1V2AA 2C3QA 2WRTA 1HQOA 1GWCA 4G10A 1BF5A 5F8BA 4ECCA 4EC0A 2CAQA 4DEJA 3I69A 4E8EA 1OE7A 3M1GA 3GTUB 2GSSA 3IC8A 1EOHA 5DAKA 2GTUA 5D9WA 4RI6A 5A4UA 1TDIA 3TU3B 4HZ2A 2FNOA 6GSTA 3R2QA 1N25A 1EV4A 3LYKA 1BG1A 4KF9A 1FW1A 2VCQA 2F8FA 2PERA 3QR6A 3LQ7A 2C80A 1AQVA 1GTUA 3EE2A 4BVXB 2H1LA 5DALA 4MP4A 4ECBA 1OKTA 2A2SA 3AY8A 4TOPA 2NTOA 6GSSA 1M9BA 1M99A 2C3TA 3LXTA 4ECIA 5J47A 5A1NA 4IQAA 4G0LA 5ECNB 1B4PA 4IKHA 5ECRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A5H A;  4ZB7 A;  5A5H B;  5A34 B;  5A1N A;  4AKG A;  5A1N B;  5A34 A;  4AKH A;  4AKI A;  4W66 A;  5BMU B;  4AI6 A; 
#chains in the Genus database with same CATH topology
 5LD0 A;  3IK7 A;  5EY6 A;  4N3Z A;  1YJ6 A;  4ZBD A;  4BL7 A;  1PA3 A;  1SVO A;  5J40 A;  3FR6 A;  3KMN A;  5ECK B;  2WB9 A;  1Q4J A;  3ZFB A;  2GSQ A;  5EVO A;  3CBU A;  3D0Z A;  2HQT A;  2VCZ A;  3O76 A;  1G6W A;  4FXY P;  4OMV A;  5F05 A;  4FQU A;  4AGS A;  3GUR A;  2EFC A;  1K0B A;  4YAV A;  3DD3 A;  5J4Y A;  4HOJ A;  5JCU A;  1GSU A;  5AN1 A;  4ZB6 A;  1GTB A;  1K0M A;  4IEL A;  3M8N A;  5ELA A;  4PI0 C;  5AIX A;  5LCZ A;  3HKR A;  2IMI A;  1SVM A;  4ZB9 A;  1AQX A;  3C8E A;  3FRC A;  4PHZ C;  1R5A A;  5F06 A;  3IK9 A;  3WYW A;  6GSV A;  3VPQ A;  1GSY A;  1PL1 A;  2DC5 A;  4N0V A;  4ZBB A;  4Q5F A;  3CSI A;  1K3O A;  3KTL A;  3TGZ A;  3QAW A;  1HNC A;  3G7I A;  1TW9 A;  2R5G A;  5HFK A;  4G01 A;  4MF5 A;  3GUS A;  4MF7 A;  1GLP A;  1GUL A;  3TOU A;  5GSS A;  3FR3 A;  3VI7 A;  4IVF A;  4KE3 A;  5J5N A;  2PVQ A;  3CSJ A;  3I6A A;  4G9H A;  3UAR A;  4MK3 A;  4I97 A;  4OFN A;  3U6V A;  3RGB C;  1VF4 A;  1K0D A;  1HNA A;  2C4J A;  2CZ3 A;  4AI6 A;  1B48 A;  2F3M A;  2ON7 A;  3CHX C;  2D2Z A;  2OT3 A;  5J41 A;  4ZB8 A;  3GST A;  3F6F A;  5ECO B;  4PNF A;  2A2R A;  2HRA A;  4JED A;  3N9J A;  3NIV A;  3PPU A;  2GST A;  3CRT A;  2J9H A;  2VCT A;  4KAE A;  3N5O A;  4Q5N A;  5J4V A;  5A5H B;  1F2E A;  1PMT A;  1XW6 A;  3KJY A;  2VCW A;  2OA7 A;  2CA8 A;  1USB A;  4WR5 A;  4PNG A;  5JCW A;  4KDY A;  1PD2 1;  5DJL A;  2HSN B;  3ZMK A;  2HRK A;  3L0H A;  1TU8 A;  3UAP A;  2R6K A;  1VF2 A;  9GSS A;  3CSH A;  1SVL A;  5ECH B;  2HSM B;  2WS2 A;  1K0C A;  5A4W A;  3MDK A;  3M0F A;  11GS A;  4EDZ A;  3CRU A;  1PGT A;  2DSA A;  4MDC A;  5A34 A;  1GTA A;  5ELG A;  5DDL A;  3ISO A;  4GLT A;  4GDF A;  12GS A;  3GH6 A;  14GS A;  1GNE A;  4AKG A;  1AXD A;  3KMO A;  4KH7 A;  4ECJ A;  4RI7 A;  22GS A;  1K0N A;  1XWK A;  4IW9 A;  1C72 A;  3VK9 A;  4J2F A;  1JLV A;  4ACS A;  1K0A A;  1GUH A;  1N2A A;  1GNW A;  1YEW C;  1RK4 A;  3GTU A;  4YAP A;  5A5H A;  2YV9 A;  1MTC A;  4YQU A;  2OAC A;  4EE0 A;  3Q18 A;  2WW2 A;  3Q19 A;  3ZML A;  4F0C A;  4AKI A;  4MF6 A;  1ZL9 A;  4IS0 A;  4MPF A;  2PMT A;  1U87 A;  2HSN A;  2UZ8 A;  3RBT A;  1IYH A;  1GSQ A;  5AIS A;  1KBN A;  3EIN A;  2HSM A;  1ML6 A;  5G5E A;  2VCX A;  2WVY A;  4IBP A;  4QMK A;  2OAD A;  2CAI A;  4BVX A;  5FHI A;  5D9V A;  7GSS A;  4O92 A;  4ZXG A;  4EDY A;  1NHY A;  20GS A;  4JZQ A;  5ECL B;  1BYE A;  1U3I A;  4G0K A;  1YVL A;  3HMJ G;  3QAG A;  3P8W A;  5KEJ A;  6GSX A;  4OFM A;  4Q5Q A;  5FT3 A;  4AKX B;  2WZS A;  4JBB A;  4CHS A;  4PX1 A;  2UV8 G;  1GUM A;  2R3X A;  13GS A;  2WVX B;  2VKZ G;  4NHZ A;  4KDU A;  3LXZ A;  1GSS A;  1HNB A;  2IMK A;  1GSF A;  4IGJ A;  5DQS A;  2WDU A;  4ISD A;  5B7C A;  4F03 A;  4L5O A;  1F3A A;  1LBK A;  2GSR A;  5ECI B;  1PKZ A;  3BBY A;  1Y1U A;  1K3Y A;  3HJM A;  1K3L A;  4QQ7 A;  5GST A;  3LFL A;  3MAK A;  1BX9 A;  16GS A;  5ECS A;  4E68 A;  2GDR A;  10GS A;  4PXO A;  1YQ1 A;  4Q5R A;  4KGI A;  5D9T A;  3UVH A;  2WW3 A;  3P90 A;  1Y6E A;  1BAY A;  1VF1 A;  4G0I A;  3KM6 A;  4HI7 A;  1U88 A;  1F3B A;  1A0F A;  4PGT A;  1Z9H A;  1YKC A;  2EFE A;  2O5V A;  1BG5 A;  2LJR A;  5F07 A;  2IL3 A;  4LMV A;  3HJO A;  1G7O A;  1MD3 A;  1TXU A;  2O36 A;  4G19 A;  5DAL B;  1M9A A;  4K0G A;  3Q74 A;  5J4U A;  1EV9 A;  4HZ4 A;  1VF3 A;  5ECM B;  3FY7 A;  1M0U A;  18GS A;  3IE3 A;  5BMU B;  1IYI A;  4PTS A;  4ZB7 A;  4BL7 B;  5FWG A;  2AHE A;  4O7H A;  2VD1 A;  1LJR A;  4ID0 A;  3VWX A;  1B8X A;  5G5F A;  5IQY A;  2EFH A;  4YQM A;  19GS A;  2WVX A;  5ECP B;  2HNL A;  3GSS A;  4OFT A;  2CVD A;  4GSS A;  5A5K A;  1ZGN A;  3VPT A;  1V40 A;  3H1N A;  4KDX A;  3GX0 A;  3F63 A;  4BVY B;  1OYJ A;  4EXJ A;  3VUR A;  3IR4 A;  1PKW A;  2GLR A;  3O3T A;  4LMW A;  4USS A;  1OE8 A;  5A4V A;  4PUA A;  1PX7 A;  2O3E A;  4W66 A;  2EFD A;  4GF0 A;  4GST A;  3WD6 A;  1FHE A;  4IJI A;  4PQH A;  3FYG A;  2C8U A;  3UBK A;  2WW1 A;  3ERG A;  2VO4 A;  3VI5 A;  3KXO A;  1EEM A;  1JLW A;  3R3E A;  1AW9 A;  5BMU A;  4MPG A;  2VCV A;  6GSY A;  4HJ2 A;  3LG6 A;  4YH2 A;  1I1I P;  4KSM A;  3PR8 A;  2AB6 A;  4E8H A;  3DGQ A;  2N5F A;  6GSW A;  5AGY A;  4ZBA A;  1DUG A;  1UA5 A;  4NHW A;  4PQI A;  1K0O A;  1TU7 A;  2CZ2 A;  3VLN A;  4L5L A;  3SWL A;  4F0B A;  1GTI A;  3PGT A;  4BVY A;  6GSU A;  2AAW A;  2X64 A;  17GS A;  4NAX A;  1YY7 A;  1YDK A;  1PL2 A;  1MD4 A;  5D73 A;  3FR9 A;  3IBH A;  5F0G A;  2FHE A;  4GCI A;  2PBJ A;  3LYP A;  3TOT A;  5AIV A;  1G6Y A;  2R4V A;  4GSN A;  4WR4 A;  5D9X A;  2YCD A;  5ECQ B;  4GTU A;  1XW5 A;  2C3N A;  3F6D A;  2V6K A;  5DJM A;  3M3M A;  4K0N A;  5DAK B;  4PUR A;  1E6B A;  3CWG A;  4YQV A;  5GZZ B;  2PGT A;  3LSZ A;  1AQW A;  2WVZ A;  2VD0 A;  1GSD A;  4L8E A;  1PN9 A;  1XWG A;  1EOG A;  2HRK B;  2WW0 A;  2YV7 A;  1GLQ A;  3LJR A;  3QAV A;  1JZR A;  1PX6 A;  4IQ1 A;  4AKH A;  4KX4 A;  2WJU A;  3ERF A;  1S4B P;  3ZFL A;  4PI2 C;  5DCG A;  5A34 B;  2ON5 A;  2JL4 A;  3UBL A;  5EL8 A;  4MZW A;  5A1N B;  1GUK A;  3G7J A;  8GSS A;  3W8S A;  1GSE A;  1V2A A;  2C3Q A;  2WRT A;  1HQO A;  1GWC A;  4G10 A;  1BF5 A;  5F8B A;  4ECC A;  4EC0 A;  2CAQ A;  4DEJ A;  3I69 A;  4E8E A;  1OE7 A;  3M1G A;  3GTU B;  2GSS A;  3IC8 A;  1EOH A;  5DAK A;  2GTU A;  5D9W A;  4RI6 A;  5A4U A;  1TDI A;  3TU3 B;  4HZ2 A;  2FNO A;  6GST A;  3R2Q A;  1N25 A;  1EV4 A;  3LYK A;  1BG1 A;  4KF9 A;  1FW1 A;  2VCQ A;  2F8F A;  2PER A;  3QR6 A;  3LQ7 A;  2C80 A;  1AQV A;  1GTU A;  3EE2 A;  4BVX B;  2H1L A;  5DAL A;  4MP4 A;  4ECB A;  1OKT A;  2A2S A;  3AY8 A;  4TOP A;  2NTO A;  6GSS A;  1M9B A;  1M99 A;  2C3T A;  3LXT A;  3RFR C;  4ECI A;  5J47 A;  5A1N A;  4IQA A;  4G0L A;  5ECN B;  1B4P A;  4IKH A;  5ECR B; 
#chains in the Genus database with same CATH homology
 5LD0 A;  3IK7 A;  5EY6 A;  4N3Z A;  1YJ6 A;  4ZBD A;  4BL7 A;  1PA3 A;  1SVO A;  5J40 A;  3FR6 A;  3KMN A;  5ECK B;  2WB9 A;  1Q4J A;  3ZFB A;  2GSQ A;  5EVO A;  3CBU A;  3D0Z A;  2HQT A;  2VCZ A;  3O76 A;  1G6W A;  4OMV A;  5F05 A;  4FQU A;  4AGS A;  3GUR A;  2EFC A;  1K0B A;  4YAV A;  3DD3 A;  5J4Y A;  4HOJ A;  5JCU A;  1GSU A;  5AN1 A;  4ZB6 A;  1GTB A;  1K0M A;  4IEL A;  3M8N A;  5ELA A;  5AIX A;  5LCZ A;  3HKR A;  2IMI A;  1SVM A;  4ZB9 A;  1AQX A;  3C8E A;  3FRC A;  1R5A A;  5F06 A;  3IK9 A;  3WYW A;  6GSV A;  3VPQ A;  1GSY A;  1PL1 A;  2DC5 A;  4N0V A;  4ZBB A;  4Q5F A;  3CSI A;  1K3O A;  3KTL A;  3TGZ A;  3QAW A;  1HNC A;  3G7I A;  1TW9 A;  2R5G A;  5HFK A;  4G01 A;  4MF5 A;  3GUS A;  4MF7 A;  1GLP A;  1GUL A;  3TOU A;  5GSS A;  3FR3 A;  3VI7 A;  4IVF A;  4KE3 A;  5J5N A;  2PVQ A;  3CSJ A;  3I6A A;  4G9H A;  3UAR A;  4MK3 A;  4I97 A;  4OFN A;  3U6V A;  1VF4 A;  1K0D A;  1HNA A;  2C4J A;  2CZ3 A;  4AI6 A;  1B48 A;  2F3M A;  2ON7 A;  2D2Z A;  2OT3 A;  5J41 A;  4ZB8 A;  3GST A;  3F6F A;  5ECO B;  4PNF A;  2A2R A;  2HRA A;  4JED A;  3N9J A;  3NIV A;  3PPU A;  2GST A;  3CRT A;  2J9H A;  2VCT A;  4KAE A;  3N5O A;  4Q5N A;  5J4V A;  5A5H B;  1F2E A;  1PMT A;  1XW6 A;  3KJY A;  2VCW A;  2OA7 A;  2CA8 A;  1USB A;  4WR5 A;  4PNG A;  5JCW A;  4KDY A;  1PD2 1;  5DJL A;  2HSN B;  3ZMK A;  2HRK A;  3L0H A;  1TU8 A;  3UAP A;  2R6K A;  1VF2 A;  9GSS A;  3CSH A;  1SVL A;  5ECH B;  2HSM B;  2WS2 A;  1K0C A;  5A4W A;  3MDK A;  3M0F A;  11GS A;  4EDZ A;  3CRU A;  1PGT A;  2DSA A;  4MDC A;  5A34 A;  1GTA A;  5ELG A;  5DDL A;  3ISO A;  4GLT A;  4GDF A;  12GS A;  3GH6 A;  14GS A;  1GNE A;  4AKG A;  1AXD A;  3KMO A;  4KH7 A;  4ECJ A;  4RI7 A;  22GS A;  1K0N A;  1XWK A;  4IW9 A;  1C72 A;  3VK9 A;  4J2F A;  1JLV A;  4ACS A;  1K0A A;  1GUH A;  1N2A A;  1GNW A;  3GTU A;  1RK4 A;  4YAP A;  5A5H A;  2YV9 A;  1MTC A;  4YQU A;  2OAC A;  4EE0 A;  3Q18 A;  3Q19 A;  3ZML A;  4F0C A;  4AKI A;  4MF6 A;  1ZL9 A;  4IS0 A;  4MPF A;  2PMT A;  1U87 A;  2HSN A;  2UZ8 A;  3RBT A;  1IYH A;  1GSQ A;  5AIS A;  1KBN A;  3EIN A;  2HSM A;  1ML6 A;  5G5E A;  2VCX A;  4IBP A;  4QMK A;  2OAD A;  2CAI A;  4BVX A;  5FHI A;  5D9V A;  7GSS A;  4O92 A;  4ZXG A;  4EDY A;  1NHY A;  20GS A;  4JZQ A;  5ECL B;  1BYE A;  1U3I A;  4G0K A;  1YVL A;  3HMJ G;  3QAG A;  3P8W A;  5KEJ A;  6GSX A;  4OFM A;  4Q5Q A;  5FT3 A;  4AKX B;  4JBB A;  4CHS A;  4PX1 A;  2UV8 G;  1GUM A;  2R3X A;  13GS A;  2VKZ G;  4NHZ A;  4KDU A;  3LXZ A;  1GSS A;  1HNB A;  2IMK A;  1GSF A;  4IGJ A;  5DQS A;  2WDU A;  4ISD A;  5B7C A;  4F03 A;  4L5O A;  1F3A A;  1LBK A;  2GSR A;  5ECI B;  1PKZ A;  3BBY A;  1Y1U A;  1K3Y A;  3HJM A;  1K3L A;  4QQ7 A;  5GST A;  3LFL A;  3MAK A;  1BX9 A;  16GS A;  5ECS A;  4E68 A;  2GDR A;  10GS A;  4PXO A;  1YQ1 A;  4Q5R A;  4KGI A;  5D9T A;  3UVH A;  3P90 A;  1Y6E A;  1BAY A;  1VF1 A;  4G0I A;  3KM6 A;  4HI7 A;  1U88 A;  1F3B A;  1A0F A;  4PGT A;  1Z9H A;  1YKC A;  2EFE A;  2O5V A;  1BG5 A;  2LJR A;  5F07 A;  2IL3 A;  4LMV A;  3HJO A;  1G7O A;  1MD3 A;  1TXU A;  4G19 A;  5DAL B;  1M9A A;  4K0G A;  3Q74 A;  5J4U A;  1EV9 A;  4HZ4 A;  1VF3 A;  5ECM B;  3FY7 A;  1M0U A;  18GS A;  3IE3 A;  5BMU B;  1IYI A;  4PTS A;  4ZB7 A;  4BL7 B;  5FWG A;  2AHE A;  4O7H A;  2VD1 A;  1LJR A;  4ID0 A;  3VWX A;  1B8X A;  5G5F A;  5IQY A;  2EFH A;  4YQM A;  19GS A;  5ECP B;  2HNL A;  3GSS A;  4OFT A;  2CVD A;  4GSS A;  5A5K A;  1ZGN A;  3VPT A;  1V40 A;  3H1N A;  4KDX A;  3GX0 A;  3F63 A;  4BVY B;  1OYJ A;  4EXJ A;  3VUR A;  3IR4 A;  1PKW A;  2GLR A;  3O3T A;  4LMW A;  4USS A;  1OE8 A;  5A4V A;  4PUA A;  1PX7 A;  4W66 A;  2EFD A;  4GF0 A;  4GST A;  3WD6 A;  1FHE A;  4IJI A;  4PQH A;  3FYG A;  2C8U A;  3UBK A;  3ERG A;  2VO4 A;  3VI5 A;  3KXO A;  1EEM A;  1JLW A;  3R3E A;  1AW9 A;  5BMU A;  4MPG A;  2VCV A;  6GSY A;  4HJ2 A;  3LG6 A;  4YH2 A;  4KSM A;  3PR8 A;  2AB6 A;  4E8H A;  3DGQ A;  2N5F A;  6GSW A;  5AGY A;  4ZBA A;  1DUG A;  1UA5 A;  4NHW A;  4PQI A;  1K0O A;  1TU7 A;  2CZ2 A;  3VLN A;  4L5L A;  3SWL A;  4F0B A;  1GTI A;  3PGT A;  4BVY A;  6GSU A;  2AAW A;  2X64 A;  17GS A;  4NAX A;  1YY7 A;  1YDK A;  1PL2 A;  1MD4 A;  5D73 A;  3FR9 A;  3IBH A;  5F0G A;  2FHE A;  4GCI A;  2PBJ A;  3LYP A;  3TOT A;  5AIV A;  1G6Y A;  2R4V A;  4GSN A;  4WR4 A;  5D9X A;  2YCD A;  5ECQ B;  4GTU A;  1XW5 A;  2C3N A;  3F6D A;  2V6K A;  5DJM A;  3M3M A;  4K0N A;  5DAK B;  4PUR A;  1E6B A;  3CWG A;  4YQV A;  5GZZ B;  2PGT A;  3LSZ A;  1AQW A;  2VD0 A;  1GSD A;  4L8E A;  1PN9 A;  1XWG A;  1EOG A;  2HRK B;  2YV7 A;  1GLQ A;  3LJR A;  3QAV A;  1JZR A;  1PX6 A;  4IQ1 A;  4AKH A;  4KX4 A;  2WJU A;  3ERF A;  3ZFL A;  5DCG A;  5A34 B;  2ON5 A;  2JL4 A;  3UBL A;  5EL8 A;  4MZW A;  5A1N B;  1GUK A;  3G7J A;  8GSS A;  3W8S A;  1GSE A;  1V2A A;  2C3Q A;  2WRT A;  1HQO A;  1GWC A;  4G10 A;  1BF5 A;  5F8B A;  4ECC A;  4EC0 A;  2CAQ A;  4DEJ A;  3I69 A;  4E8E A;  1OE7 A;  3M1G A;  3GTU B;  2GSS A;  3IC8 A;  1EOH A;  5DAK A;  2GTU A;  5D9W A;  4RI6 A;  5A4U A;  1TDI A;  3TU3 B;  4HZ2 A;  2FNO A;  6GST A;  3R2Q A;  1N25 A;  1EV4 A;  3LYK A;  1BG1 A;  4KF9 A;  1FW1 A;  2VCQ A;  2F8F A;  2PER A;  3QR6 A;  3LQ7 A;  2C80 A;  1AQV A;  1GTU A;  3EE2 A;  4BVX B;  2H1L A;  5DAL A;  4MP4 A;  4ECB A;  1OKT A;  2A2S A;  3AY8 A;  4TOP A;  2NTO A;  6GSS A;  1M9B A;  1M99 A;  2C3T A;  3LXT A;  4ECI A;  5J47 A;  5A1N A;  4IQA A;  4G0L A;  5ECN B;  1B4P A;  4IKH A;  5ECR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...