5A34B

The crystal structure of the gst-like domains complex of eprs-aimp2
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
214
structure length
204
Chain Sequence
DLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQISVTVPANVQRWMRSCENLAPFNTALKLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASE
publication title Assembly of Multi-tRNA Synthetase Complex Via Heterotetrameric Glutathione Transferase-Homology Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 204
sequence length 214
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
B PF18569 Thioredoxin_16 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a34B00
4AKIA 5A5HB 5A5HA 4ZB7A 5A1NA 5BMUB 4AKGA 5A1NB 4AI6A 5A34A 4AKHA 5A34B 4W66A
chains in the Genus database with same CATH superfamily
4YH2A 1TXUA 3GX0A 1YEWC 2VKZG 3CWGA 1PN9A 3DGQA 3M3MA 3M1GA 4OMVA 3UBKA 5A34A 4PURA 4PNFA 5D73A 5ECQB 4PNGA 1PGTA 2GSQA 1YJ6A 4KDUA 3TOTA 3KXOA 5A5HB 1BAYA 5BMUA 2VD1A 3IE3A 3CSHA 2A2RA 4IQAA 4N0VA 5JCUA 2F8FA 1TW9A 1PKZA 1GTUA 3ZMKA 4ACSA 1OKTA 1Y1UA 2WDUA 1GWCA 4YQMA 3VI5A 3FRCA 3WD6A 3Q19A 1PKWA 1YQ1A 5GSTA 2HQTA 3CSIA 1M99A 2UV8G 2FHEA 2WW0A 2OACA 3QAWA 5A5HA 4MDCA 1K0OA 4MK3A 2CZ2A 4KSMA 4IW9A 1K3YA 1FHEA 5ELAA 6GSWA 11GSA 1U87A 4KAEA 1FW1A 1GSSA 1K3OA 1F3BA 4ZB6A 5A4WA 1OE7A 1A0FA 3HJMA 5A5KA 3P90A 1K0BA 4CHSA 1M0UA 3FY7A 4AKIA 3ERFA 2WJUA 4BL7B 2VCVA 5FWGA 1ZL9A 3GSTA 1EV9A 2H1LA 4IQ1A 3R3EA 4EC0A 2CAIA 4F03A 4GCIA 6GSYA 2C80A 1GNEA 1MTCA 5DAKB 4JZQA 1IYHA 2UZ8A 4HZ4A 2WRTA 10GSA 3GUSA 4GLTA 4E8EA 4BVXB 4OFNA 1YVLA 4KX4A 3RBTA 2FNOA 4GTUA 3ZFLA 2C8UA 5ECMB 4EE0A 1PL2A 3LXZA 4BL7A 1GUHA 4HJ2A 2GDRA 5D9WA 5ECLB 7GSSA 1GTBA 17GSA 5FHIA 3ZFBA 3VI7A 2VCWA 1RK4A 4WR4A 2C3NA 2EFEA 3KM6A 1VF2A 4GSTA 18GSA 2X64A 1EEMA 2C4JA 5F8BA 1Y6EA 4AGSA 4ECCA 1B48A 1AXDA 8GSSA 5BMUB 1PX6A 1DUGA 4FQUA 2ON5A 4IKHA 2CZ3A 1XWGA 5DJMA 1G7OA 3F6DA 22GSA 4BVYA 3LSZA 3M8NA 3Q74A 2HNLA 4PGTA 2IMIA 3W8SA 4HOJA 4MF7A 4QMKA 1K0AA 3RFRC 5KEJA 2HRAA 1GULA 3C8EA 3QR6A 4GSSA 2HSMB 1MD4A 3EINA 3GTUB 1N2AA 3H1NA 5J4VA 3VWXA 4YAPA 3L0HA 2AAWA 4ECJA 5J5NA 5DJLA 3LYPA 1C72A 4IELA 1SVLA 3CBUA 1VF4A 3ISOA 1BYEA 2WW2A 1PX7A 1S4BP 2WVXA 1JZRA 2PGTA 2GSRA 1JLVA 1AQVA 4LMVA 4F0BA 1GNWA 1I1IP 5D9XA 1GUKA 1GTIA 2R5GA 2LJRA 2DSAA 4MP4A 4L5OA 4PHZC 1SVMA 5JCWA 2HSMA 5AIVA 3GTUA 1G6WA 6GSSA 3UBLA 1SVOA 5AIXA 20GSA 4NHWA 4MF6A 1HNBA 3R2QA 1LBKA 5D9VA 1LJRA 5AN1A 12GSA 4ZBBA 14GSA 4JEDA 1IYIA 2WW1A 1MD3A 4IJIA 4MZWA 6GSXA 1BG5A 1F2EA 3O3TA 1HNCA 3QAGA 3LG6A 4ECIA 4NAXA 1JLWA 3LJRA 3VURA 4PQHA 3QAVA 1OE8A 4AKGA 2R4VA 4HI7A 5IQYA 1EOHA 3VK9A 4HZ2A 1PL1A 3TGZA 2O3EA 4PUAA 3KJYA 4G01A 16GSA 4ZB7A 1V2AA 4PXOA 4AI6A 19GSA 4PTSA 3IK7A 5ECPB 3U6VA 5AGYA 5EY6A 4MF5A 2PMTA 5F07A 6GSUA 2PERA 4EDZA 3I6AA 4FXYP 2NTOA 4GSNA 4IS0A 4PQIA 2A2SA 3KMOA 2GTUA 3GSSA 2WVYA 2R3XA 1B8XA 2JL4A 2AB6A 2J9HA 2YV7A 3EE2A 3DD3A 3WYWA 4PI0C 4MPGA 1XW6A 4IGJA 5J41A 4E8HA 3MDKA 2EFHA 5FT3A 1XWKA 2VO4A 4YQVA 6GSTA 5F05A 1Z9HA 3LFLA 1K0MA 1BG1A 3G7JA 3IBHA 1VF1A 4BVYB 2WB9A 1TDIA 3RGBC 2O5VA 4RI6A 1KBNA 3ZMLA 2YV9A 5DQSA 4RI7A 3HMJG 5G5FA 3PGTA 2VCTA 5GZZB 1EV4A 1K0DA 4PI2C 2DC5A 2OADA 3TU3B 3VPTA 5ECSA 1GLPA 1GSQA 3O76A 3BBYA 5D9TA 5ECIB 4TOPA 5A1NA 1AW9A 1F3AA 3IC8A 4USSA 5EVOA 2OT3A 4Q5NA 5ECNB 2WVXB 4L8EA 2PBJA 2HSNA 5EL8A 4O7HA 1ZGNA 4OFTA 3M0FA 1GSDA 2WS2A 4F0CA 1YDKA 3CRTA 3N5OA 3UARA 2CVDA 2WVZA 1M9AA 2WZSA 1OYJA 4GDFA 3I69A 4OFMA 3FR6A 2PVQA 3HKRA 5B7CA 3KTLA 4LMWA 1BX9A 1AQWA 2GLRA 3NIVA 1R5AA 2D2ZA 4YQUA 5ELGA 2HRKB 2VD0A 1ML6A 3GURA 1XW5A 5LCZA 3IR4A 4KDXA 3HJOA 4WR5A 4DEJA 2IMKA 3F6FA 4ID0A 5G5EA 2EFCA 2N5FA 3UAPA 5J47A 5J4YA 3FR3A 3ERGA 1U88A 3KMNA 1GTAA 2AHEA 5ECKB 1PD21 5HFKA 1USBA 2ON7A 2GSSA 3VPQA 4KF9A 4EXJA 1G6YA 1HNAA 3Q18A 2C3QA 4KGIA 2HRKA 1VF3A 3N9JA 3TOUA 4EDYA 1GSUA 1HQOA 1K0CA 3CSJA 5AISA 4K0NA 1Q4JA 3UVHA 2V6KA 1TU7A 3PR8A 3CHXC 2OA7A 4ZXGA 2VCQA 4Q5FA 3D0ZA 6GSVA 1GSEA 2VCXA 4G19A 4J2FA 3VLNA 4ECBA 2O36A 5ECRB 1K0NA 5DDLA 5ECHB 9GSSA 4ZBAA 5DALB 1V40A 3G7IA 3SWLA 4G0KA 3LQ7A 5A1NB 4MPFA 5J40A 4KH7A 4IVFA 3FR9A 4W66A 1AQXA 2IL3A 4ZBDA 4Q5RA 1N25A 2EFDA 4ISDA 4JBBA 4G9HA 1YY7A 1K3LA 1GLQA 2HSNB 3AY8A 1GSYA 1U3IA 4ZB9A 4G0IA 2C3TA 5F06A 4AKHA 3GH6A 3MAKA 3LXTA 5F0GA 1PMTA 4KE3A 5DALA 5ECOB 4G0LA 3F63A 3IK9A 4NHZA 1NHYA 1TU8A 2CAQA 5LD0A 4G10A 4Q5QA 3P8WA 2WW3A 4IBPA 1YKCA 5GSSA 1M9BA 2R6KA 5DAKA 1UA5A 2GSTA 1B4PA 4QQ7A 5J4UA 1PA3A 4E68A 4L5LA 2VCZA 4PX1A 5A34B 3FYGA 4AKXB 5A4UA 5A4VA 1EOGA 1GSFA 4BVXA 4ZB8A 1GUMA 3CRUA 2F3MA 4O92A 4KDYA 3LYKA 4K0GA 4YAVA 1E6BA 5DCGA 3PPUA 2YCDA 4GF0A 4I97A 13GSA 4N3ZA 1BF5A 2CA8A
chains in the Genus database with same CATH topology
4YH2A 1TXUA 3GX0A 2VKZG 3CWGA 1PN9A 3DGQA 3M3MA 3M1GA 4OMVA 3UBKA 5A34A 4PURA 4PNFA 5D73A 5ECQB 4PNGA 1PGTA 2GSQA 1YJ6A 4KDUA 3TOTA 3KXOA 5A5HB 1BAYA 5BMUA 2VD1A 3IE3A 3CSHA 2A2RA 4IQAA 4N0VA 5JCUA 2F8FA 1TW9A 1PKZA 1GTUA 3ZMKA 4ACSA 1OKTA 1Y1UA 2WDUA 1GWCA 4YQMA 3VI5A 3FRCA 3WD6A 3Q19A 1PKWA 1YQ1A 5GSTA 2HQTA 3CSIA 1M99A 2UV8G 2FHEA 2OACA 3QAWA 5A5HA 4MDCA 1K0OA 4MK3A 2CZ2A 4KSMA 4IW9A 1K3YA 1FHEA 5ELAA 6GSWA 11GSA 1U87A 4KAEA 1FW1A 1GSSA 1K3OA 1F3BA 4ZB6A 5A4WA 1OE7A 1A0FA 3HJMA 5A5KA 3P90A 1K0BA 4CHSA 1M0UA 3FY7A 4AKIA 3ERFA 2WJUA 4BL7B 2VCVA 5FWGA 1ZL9A 3GSTA 1EV9A 2H1LA 4IQ1A 3R3EA 4EC0A 2CAIA 4F03A 4GCIA 6GSYA 2C80A 1GNEA 1MTCA 5DAKB 4JZQA 1IYHA 2UZ8A 4HZ4A 2WRTA 10GSA 3GUSA 4GLTA 4E8EA 4BVXB 4OFNA 1YVLA 4KX4A 3RBTA 2FNOA 4GTUA 3ZFLA 2C8UA 5ECMB 4EE0A 1PL2A 3LXZA 4BL7A 1GUHA 4HJ2A 2GDRA 5D9WA 5ECLB 7GSSA 1GTBA 17GSA 5FHIA 3ZFBA 3VI7A 2VCWA 1RK4A 4WR4A 2C3NA 2EFEA 3KM6A 1VF2A 4GSTA 18GSA 2X64A 1EEMA 2C4JA 5F8BA 1Y6EA 4AGSA 4ECCA 1B48A 1AXDA 8GSSA 5BMUB 1PX6A 1DUGA 4FQUA 2ON5A 4IKHA 2CZ3A 1XWGA 5DJMA 1G7OA 3F6DA 22GSA 4BVYA 3LSZA 3M8NA 3Q74A 2HNLA 4PGTA 2IMIA 3W8SA 4HOJA 4MF7A 4QMKA 1K0AA 5KEJA 2HRAA 1GULA 3C8EA 3QR6A 4GSSA 2HSMB 1MD4A 3EINA 3GTUB 1N2AA 3H1NA 5J4VA 3VWXA 4YAPA 3L0HA 2AAWA 4ECJA 5J5NA 5DJLA 3LYPA 1C72A 4IELA 1SVLA 3CBUA 1VF4A 3ISOA 1BYEA 1PX7A 1JZRA 2PGTA 2GSRA 1JLVA 1AQVA 4LMVA 4F0BA 1GNWA 5D9XA 1GUKA 1GTIA 2R5GA 2LJRA 2DSAA 4MP4A 4L5OA 1SVMA 5JCWA 2HSMA 5AIVA 3GTUA 1G6WA 6GSSA 3UBLA 1SVOA 5AIXA 20GSA 4NHWA 4MF6A 1HNBA 3R2QA 1LBKA 5D9VA 1LJRA 5AN1A 12GSA 4ZBBA 14GSA 4JEDA 1IYIA 4MZWA 1MD3A 4IJIA 6GSXA 1BG5A 1F2EA 3O3TA 1HNCA 3QAGA 3LG6A 4ECIA 4NAXA 1JLWA 3LJRA 3VURA 4PQHA 3QAVA 1OE8A 4AKGA 2R4VA 4HI7A 5IQYA 1EOHA 3VK9A 4HZ2A 1PL1A 3TGZA 4PUAA 3KJYA 4G01A 16GSA 4ZB7A 1V2AA 4PXOA 4AI6A 19GSA 4PTSA 3IK7A 5ECPB 3U6VA 5AGYA 5EY6A 4MF5A 2PMTA 5F07A 6GSUA 2PERA 4EDZA 3I6AA 2NTOA 4GSNA 4IS0A 4PQIA 2A2SA 3KMOA 2GTUA 3GSSA 2R3XA 1B8XA 2JL4A 2AB6A 2J9HA 2YV7A 3EE2A 3DD3A 3WYWA 4MPGA 1XW6A 4IGJA 5J41A 4E8HA 3MDKA 2EFHA 5FT3A 1XWKA 2VO4A 4YQVA 6GSTA 5F05A 1Z9HA 3LFLA 1K0MA 1BG1A 3G7JA 3IBHA 1VF1A 4BVYB 2WB9A 1TDIA 2O5VA 4RI6A 1KBNA 3ZMLA 2YV9A 5DQSA 4RI7A 3HMJG 5G5FA 3PGTA 2VCTA 5GZZB 1EV4A 1K0DA 2DC5A 2OADA 3TU3B 3VPTA 5ECSA 1GLPA 1GSQA 3O76A 3BBYA 5D9TA 5ECIB 4TOPA 5A1NA 1AW9A 1F3AA 3IC8A 4USSA 5EVOA 2OT3A 4Q5NA 5ECNB 4L8EA 2PBJA 2HSNA 5EL8A 4O7HA 1ZGNA 4OFTA 3M0FA 1GSDA 2WS2A 4F0CA 1YDKA 3CRTA 3N5OA 3UARA 2CVDA 1M9AA 1OYJA 4GDFA 3I69A 4OFMA 3FR6A 2PVQA 3HKRA 5B7CA 3KTLA 4LMWA 1BX9A 1AQWA 2GLRA 3NIVA 1R5AA 2D2ZA 4YQUA 5ELGA 2HRKB 2VD0A 1ML6A 3GURA 1XW5A 5LCZA 3IR4A 4KDXA 3HJOA 4WR5A 4DEJA 2IMKA 3F6FA 4ID0A 5G5EA 2EFCA 2N5FA 3UAPA 5J47A 5J4YA 3FR3A 3ERGA 1U88A 3KMNA 1GTAA 2AHEA 5ECKB 1PD21 5HFKA 1USBA 2ON7A 2GSSA 3VPQA 4KF9A 4EXJA 1G6YA 1HNAA 3Q18A 2C3QA 4KGIA 2HRKA 1VF3A 3N9JA 3TOUA 4EDYA 1GSUA 1HQOA 1K0CA 3CSJA 5AISA 4K0NA 1Q4JA 3UVHA 2V6KA 1TU7A 3PR8A 2OA7A 4ZXGA 2VCQA 4Q5FA 3D0ZA 6GSVA 1GSEA 2VCXA 4G19A 4J2FA 3VLNA 4ECBA 5ECRB 1K0NA 5DDLA 5ECHB 9GSSA 4ZBAA 5DALB 1V40A 3G7IA 3SWLA 4G0KA 3LQ7A 5A1NB 4MPFA 5J40A 4KH7A 4IVFA 3FR9A 4W66A 1AQXA 2IL3A 4ZBDA 4Q5RA 1N25A 2EFDA 4ISDA 4JBBA 4G9HA 1YY7A 1K3LA 1GLQA 2HSNB 3AY8A 1GSYA 1U3IA 4ZB9A 4G0IA 2C3TA 5F06A 4AKHA 3GH6A 3MAKA 3LXTA 5F0GA 1PMTA 4KE3A 5DALA 5ECOB 4G0LA 3F63A 3IK9A 4NHZA 1NHYA 1TU8A 2CAQA 5LD0A 4G10A 4Q5QA 3P8WA 4IBPA 1YKCA 5GSSA 1M9BA 2R6KA 5DAKA 1UA5A 2GSTA 1B4PA 4QQ7A 5J4UA 1PA3A 4E68A 4L5LA 2VCZA 4PX1A 5A34B 3FYGA 4AKXB 5A4UA 5A4VA 1EOGA 1GSFA 4BVXA 4ZB8A 1GUMA 3CRUA 2F3MA 4O92A 4KDYA 3LYKA 4K0GA 4YAVA 1E6BA 5DCGA 3PPUA 2YCDA 4GF0A 4I97A 13GSA 4N3ZA 1BF5A 2CA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKI A;  5A5H B;  5A5H A;  4ZB7 A;  5A1N A;  5BMU B;  4AKG A;  5A1N B;  4AI6 A;  5A34 A;  4AKH A;  5A34 B;  4W66 A; 
#chains in the Genus database with same CATH topology
 4YH2 A;  1TXU A;  3GX0 A;  1YEW C;  2VKZ G;  3CWG A;  1PN9 A;  3DGQ A;  3M3M A;  3M1G A;  4OMV A;  3UBK A;  5A34 A;  4PUR A;  4PNF A;  5D73 A;  5ECQ B;  4PNG A;  1PGT A;  2GSQ A;  1YJ6 A;  4KDU A;  3TOT A;  3KXO A;  5A5H B;  1BAY A;  5BMU A;  2VD1 A;  3IE3 A;  3CSH A;  2A2R A;  4IQA A;  4N0V A;  5JCU A;  2F8F A;  1TW9 A;  1PKZ A;  1GTU A;  3ZMK A;  4ACS A;  1OKT A;  1Y1U A;  2WDU A;  1GWC A;  4YQM A;  3VI5 A;  3FRC A;  3WD6 A;  3Q19 A;  1PKW A;  1YQ1 A;  5GST A;  2HQT A;  3CSI A;  1M99 A;  2UV8 G;  2FHE A;  2WW0 A;  2OAC A;  3QAW A;  5A5H A;  4MDC A;  1K0O A;  4MK3 A;  2CZ2 A;  4KSM A;  4IW9 A;  1K3Y A;  1FHE A;  5ELA A;  6GSW A;  11GS A;  1U87 A;  4KAE A;  1FW1 A;  1GSS A;  1K3O A;  1F3B A;  4ZB6 A;  5A4W A;  1OE7 A;  1A0F A;  3HJM A;  5A5K A;  3P90 A;  1K0B A;  4CHS A;  1M0U A;  3FY7 A;  4AKI A;  3ERF A;  2WJU A;  4BL7 B;  2VCV A;  5FWG A;  1ZL9 A;  3GST A;  1EV9 A;  2H1L A;  4IQ1 A;  3R3E A;  4EC0 A;  2CAI A;  4F03 A;  4GCI A;  6GSY A;  2C80 A;  1GNE A;  1MTC A;  5DAK B;  4JZQ A;  1IYH A;  2UZ8 A;  4HZ4 A;  2WRT A;  10GS A;  3GUS A;  4GLT A;  4E8E A;  4BVX B;  4OFN A;  1YVL A;  4KX4 A;  3RBT A;  2FNO A;  4GTU A;  3ZFL A;  2C8U A;  5ECM B;  4EE0 A;  1PL2 A;  3LXZ A;  4BL7 A;  1GUH A;  4HJ2 A;  2GDR A;  5D9W A;  5ECL B;  7GSS A;  1GTB A;  17GS A;  5FHI A;  3ZFB A;  3VI7 A;  2VCW A;  1RK4 A;  4WR4 A;  2C3N A;  2EFE A;  3KM6 A;  1VF2 A;  4GST A;  18GS A;  2X64 A;  1EEM A;  2C4J A;  5F8B A;  1Y6E A;  4AGS A;  4ECC A;  1B48 A;  1AXD A;  8GSS A;  5BMU B;  1PX6 A;  1DUG A;  4FQU A;  2ON5 A;  4IKH A;  2CZ3 A;  1XWG A;  5DJM A;  1G7O A;  3F6D A;  22GS A;  4BVY A;  3LSZ A;  3M8N A;  3Q74 A;  2HNL A;  4PGT A;  2IMI A;  3W8S A;  4HOJ A;  4MF7 A;  4QMK A;  1K0A A;  3RFR C;  5KEJ A;  2HRA A;  1GUL A;  3C8E A;  3QR6 A;  4GSS A;  2HSM B;  1MD4 A;  3EIN A;  3GTU B;  1N2A A;  3H1N A;  5J4V A;  3VWX A;  4YAP A;  3L0H A;  2AAW A;  4ECJ A;  5J5N A;  5DJL A;  3LYP A;  1C72 A;  4IEL A;  1SVL A;  3CBU A;  1VF4 A;  3ISO A;  1BYE A;  2WW2 A;  1PX7 A;  1S4B P;  2WVX A;  1JZR A;  2PGT A;  2GSR A;  1JLV A;  1AQV A;  4LMV A;  4F0B A;  1GNW A;  1I1I P;  5D9X A;  1GUK A;  1GTI A;  2R5G A;  2LJR A;  2DSA A;  4MP4 A;  4L5O A;  4PHZ C;  1SVM A;  5JCW A;  2HSM A;  5AIV A;  3GTU A;  1G6W A;  6GSS A;  3UBL A;  1SVO A;  5AIX A;  20GS A;  4NHW A;  4MF6 A;  1HNB A;  3R2Q A;  1LBK A;  5D9V A;  1LJR A;  5AN1 A;  12GS A;  4ZBB A;  14GS A;  4JED A;  1IYI A;  2WW1 A;  1MD3 A;  4IJI A;  4MZW A;  6GSX A;  1BG5 A;  1F2E A;  3O3T A;  1HNC A;  3QAG A;  3LG6 A;  4ECI A;  4NAX A;  1JLW A;  3LJR A;  3VUR A;  4PQH A;  3QAV A;  1OE8 A;  4AKG A;  2R4V A;  4HI7 A;  5IQY A;  1EOH A;  3VK9 A;  4HZ2 A;  1PL1 A;  3TGZ A;  2O3E A;  4PUA A;  3KJY A;  4G01 A;  16GS A;  4ZB7 A;  1V2A A;  4PXO A;  4AI6 A;  19GS A;  4PTS A;  3IK7 A;  5ECP B;  3U6V A;  5AGY A;  5EY6 A;  4MF5 A;  2PMT A;  5F07 A;  6GSU A;  2PER A;  4EDZ A;  3I6A A;  4FXY P;  2NTO A;  4GSN A;  4IS0 A;  4PQI A;  2A2S A;  3KMO A;  2GTU A;  3GSS A;  2WVY A;  2R3X A;  1B8X A;  2JL4 A;  2AB6 A;  2J9H A;  2YV7 A;  3EE2 A;  3DD3 A;  3WYW A;  4PI0 C;  4MPG A;  1XW6 A;  4IGJ A;  5J41 A;  4E8H A;  3MDK A;  2EFH A;  5FT3 A;  1XWK A;  2VO4 A;  4YQV A;  6GST A;  5F05 A;  1Z9H A;  3LFL A;  1K0M A;  1BG1 A;  3G7J A;  3IBH A;  1VF1 A;  4BVY B;  2WB9 A;  1TDI A;  3RGB C;  2O5V A;  4RI6 A;  1KBN A;  3ZML A;  2YV9 A;  5DQS A;  4RI7 A;  3HMJ G;  5G5F A;  3PGT A;  2VCT A;  5GZZ B;  1EV4 A;  1K0D A;  4PI2 C;  2DC5 A;  2OAD A;  3TU3 B;  3VPT A;  5ECS A;  1GLP A;  1GSQ A;  3O76 A;  3BBY A;  5D9T A;  5ECI B;  4TOP A;  5A1N A;  1AW9 A;  1F3A A;  3IC8 A;  4USS A;  5EVO A;  2OT3 A;  4Q5N A;  5ECN B;  2WVX B;  4L8E A;  2PBJ A;  2HSN A;  5EL8 A;  4O7H A;  1ZGN A;  4OFT A;  3M0F A;  1GSD A;  2WS2 A;  4F0C A;  1YDK A;  3CRT A;  3N5O A;  3UAR A;  2CVD A;  2WVZ A;  1M9A A;  2WZS A;  1OYJ A;  4GDF A;  3I69 A;  4OFM A;  3FR6 A;  2PVQ A;  3HKR A;  5B7C A;  3KTL A;  4LMW A;  1BX9 A;  1AQW A;  2GLR A;  3NIV A;  1R5A A;  2D2Z A;  4YQU A;  5ELG A;  2HRK B;  2VD0 A;  1ML6 A;  3GUR A;  1XW5 A;  5LCZ A;  3IR4 A;  4KDX A;  3HJO A;  4WR5 A;  4DEJ A;  2IMK A;  3F6F A;  4ID0 A;  5G5E A;  2EFC A;  2N5F A;  3UAP A;  5J47 A;  5J4Y A;  3FR3 A;  3ERG A;  1U88 A;  3KMN A;  1GTA A;  2AHE A;  5ECK B;  1PD2 1;  5HFK A;  1USB A;  2ON7 A;  2GSS A;  3VPQ A;  4KF9 A;  4EXJ A;  1G6Y A;  1HNA A;  3Q18 A;  2C3Q A;  4KGI A;  2HRK A;  1VF3 A;  3N9J A;  3TOU A;  4EDY A;  1GSU A;  1HQO A;  1K0C A;  3CSJ A;  5AIS A;  4K0N A;  1Q4J A;  3UVH A;  2V6K A;  1TU7 A;  3PR8 A;  3CHX C;  2OA7 A;  4ZXG A;  2VCQ A;  4Q5F A;  3D0Z A;  6GSV A;  1GSE A;  2VCX A;  4G19 A;  4J2F A;  3VLN A;  4ECB A;  2O36 A;  5ECR B;  1K0N A;  5DDL A;  5ECH B;  9GSS A;  4ZBA A;  5DAL B;  1V40 A;  3G7I A;  3SWL A;  4G0K A;  3LQ7 A;  5A1N B;  4MPF A;  5J40 A;  4KH7 A;  4IVF A;  3FR9 A;  4W66 A;  1AQX A;  2IL3 A;  4ZBD A;  4Q5R A;  1N25 A;  2EFD A;  4ISD A;  4JBB A;  4G9H A;  1YY7 A;  1K3L A;  1GLQ A;  2HSN B;  3AY8 A;  1GSY A;  1U3I A;  4ZB9 A;  4G0I A;  2C3T A;  5F06 A;  4AKH A;  3GH6 A;  3MAK A;  3LXT A;  5F0G A;  1PMT A;  4KE3 A;  5DAL A;  5ECO B;  4G0L A;  3F63 A;  3IK9 A;  4NHZ A;  1NHY A;  1TU8 A;  2CAQ A;  5LD0 A;  4G10 A;  4Q5Q A;  3P8W A;  2WW3 A;  4IBP A;  1YKC A;  5GSS A;  1M9B A;  2R6K A;  5DAK A;  1UA5 A;  2GST A;  1B4P A;  4QQ7 A;  5J4U A;  1PA3 A;  4E68 A;  4L5L A;  2VCZ A;  4PX1 A;  5A34 B;  3FYG A;  4AKX B;  5A4U A;  5A4V A;  1EOG A;  1GSF A;  4BVX A;  4ZB8 A;  1GUM A;  3CRU A;  2F3M A;  4O92 A;  4KDY A;  3LYK A;  4K0G A;  4YAV A;  1E6B A;  5DCG A;  3PPU A;  2YCD A;  4GF0 A;  4I97 A;  13GS A;  4N3Z A;  1BF5 A;  2CA8 A; 
#chains in the Genus database with same CATH homology
 4YH2 A;  1TXU A;  3GX0 A;  2VKZ G;  3CWG A;  1PN9 A;  3DGQ A;  3M3M A;  3M1G A;  4OMV A;  3UBK A;  5A34 A;  4PUR A;  4PNF A;  5D73 A;  5ECQ B;  4PNG A;  1PGT A;  2GSQ A;  1YJ6 A;  4KDU A;  3TOT A;  3KXO A;  5A5H B;  1BAY A;  5BMU A;  2VD1 A;  3IE3 A;  3CSH A;  2A2R A;  4IQA A;  4N0V A;  5JCU A;  2F8F A;  1TW9 A;  1PKZ A;  1GTU A;  3ZMK A;  4ACS A;  1OKT A;  1Y1U A;  2WDU A;  1GWC A;  4YQM A;  3VI5 A;  3FRC A;  3WD6 A;  3Q19 A;  1PKW A;  1YQ1 A;  5GST A;  2HQT A;  3CSI A;  1M99 A;  2UV8 G;  2FHE A;  2OAC A;  3QAW A;  5A5H A;  4MDC A;  1K0O A;  4MK3 A;  2CZ2 A;  4KSM A;  4IW9 A;  1K3Y A;  1FHE A;  5ELA A;  6GSW A;  11GS A;  1U87 A;  4KAE A;  1FW1 A;  1GSS A;  1K3O A;  1F3B A;  4ZB6 A;  5A4W A;  1OE7 A;  1A0F A;  3HJM A;  5A5K A;  3P90 A;  1K0B A;  4CHS A;  1M0U A;  3FY7 A;  4AKI A;  3ERF A;  2WJU A;  4BL7 B;  2VCV A;  5FWG A;  1ZL9 A;  3GST A;  1EV9 A;  2H1L A;  4IQ1 A;  3R3E A;  4EC0 A;  2CAI A;  4F03 A;  4GCI A;  6GSY A;  2C80 A;  1GNE A;  1MTC A;  5DAK B;  4JZQ A;  1IYH A;  2UZ8 A;  4HZ4 A;  2WRT A;  10GS A;  3GUS A;  4GLT A;  4E8E A;  4BVX B;  4OFN A;  1YVL A;  4KX4 A;  3RBT A;  2FNO A;  4GTU A;  3ZFL A;  2C8U A;  5ECM B;  4EE0 A;  1PL2 A;  3LXZ A;  4BL7 A;  1GUH A;  4HJ2 A;  2GDR A;  5D9W A;  5ECL B;  7GSS A;  1GTB A;  17GS A;  5FHI A;  3ZFB A;  3VI7 A;  2VCW A;  1RK4 A;  4WR4 A;  2C3N A;  2EFE A;  3KM6 A;  1VF2 A;  4GST A;  18GS A;  2X64 A;  1EEM A;  2C4J A;  5F8B A;  1Y6E A;  4AGS A;  4ECC A;  1B48 A;  1AXD A;  8GSS A;  5BMU B;  1PX6 A;  1DUG A;  4FQU A;  2ON5 A;  4IKH A;  2CZ3 A;  1XWG A;  5DJM A;  1G7O A;  3F6D A;  22GS A;  4BVY A;  3LSZ A;  3M8N A;  3Q74 A;  2HNL A;  4PGT A;  2IMI A;  3W8S A;  4HOJ A;  4MF7 A;  4QMK A;  1K0A A;  5KEJ A;  2HRA A;  1GUL A;  3C8E A;  3QR6 A;  4GSS A;  2HSM B;  1MD4 A;  3EIN A;  3GTU B;  1N2A A;  3H1N A;  5J4V A;  3VWX A;  4YAP A;  3L0H A;  2AAW A;  4ECJ A;  5J5N A;  5DJL A;  3LYP A;  1C72 A;  4IEL A;  1SVL A;  3CBU A;  1VF4 A;  3ISO A;  1BYE A;  1PX7 A;  1JZR A;  2PGT A;  2GSR A;  1JLV A;  1AQV A;  4LMV A;  4F0B A;  1GNW A;  5D9X A;  1GUK A;  1GTI A;  2R5G A;  2LJR A;  2DSA A;  4MP4 A;  4L5O A;  1SVM A;  5JCW A;  2HSM A;  5AIV A;  3GTU A;  1G6W A;  6GSS A;  3UBL A;  1SVO A;  5AIX A;  20GS A;  4NHW A;  4MF6 A;  1HNB A;  3R2Q A;  1LBK A;  5D9V A;  1LJR A;  5AN1 A;  12GS A;  4ZBB A;  14GS A;  4JED A;  1IYI A;  4MZW A;  1MD3 A;  4IJI A;  6GSX A;  1BG5 A;  1F2E A;  3O3T A;  1HNC A;  3QAG A;  3LG6 A;  4ECI A;  4NAX A;  1JLW A;  3LJR A;  3VUR A;  4PQH A;  3QAV A;  1OE8 A;  4AKG A;  2R4V A;  4HI7 A;  5IQY A;  1EOH A;  3VK9 A;  4HZ2 A;  1PL1 A;  3TGZ A;  4PUA A;  3KJY A;  4G01 A;  16GS A;  4ZB7 A;  1V2A A;  4PXO A;  4AI6 A;  19GS A;  4PTS A;  3IK7 A;  5ECP B;  3U6V A;  5AGY A;  5EY6 A;  4MF5 A;  2PMT A;  5F07 A;  6GSU A;  2PER A;  4EDZ A;  3I6A A;  2NTO A;  4GSN A;  4IS0 A;  4PQI A;  2A2S A;  3KMO A;  2GTU A;  3GSS A;  2R3X A;  1B8X A;  2JL4 A;  2AB6 A;  2J9H A;  2YV7 A;  3EE2 A;  3DD3 A;  3WYW A;  4MPG A;  1XW6 A;  4IGJ A;  5J41 A;  4E8H A;  3MDK A;  2EFH A;  5FT3 A;  1XWK A;  2VO4 A;  4YQV A;  6GST A;  5F05 A;  1Z9H A;  3LFL A;  1K0M A;  1BG1 A;  3G7J A;  3IBH A;  1VF1 A;  4BVY B;  2WB9 A;  1TDI A;  2O5V A;  4RI6 A;  1KBN A;  3ZML A;  2YV9 A;  5DQS A;  4RI7 A;  3HMJ G;  5G5F A;  3PGT A;  2VCT A;  5GZZ B;  1EV4 A;  1K0D A;  2DC5 A;  2OAD A;  3TU3 B;  3VPT A;  5ECS A;  1GLP A;  1GSQ A;  3O76 A;  3BBY A;  5D9T A;  5ECI B;  4TOP A;  5A1N A;  1AW9 A;  1F3A A;  3IC8 A;  4USS A;  5EVO A;  2OT3 A;  4Q5N A;  5ECN B;  4L8E A;  2PBJ A;  2HSN A;  5EL8 A;  4O7H A;  1ZGN A;  4OFT A;  3M0F A;  1GSD A;  2WS2 A;  4F0C A;  1YDK A;  3CRT A;  3N5O A;  3UAR A;  2CVD A;  1M9A A;  1OYJ A;  4GDF A;  3I69 A;  4OFM A;  3FR6 A;  2PVQ A;  3HKR A;  5B7C A;  3KTL A;  4LMW A;  1BX9 A;  1AQW A;  2GLR A;  3NIV A;  1R5A A;  2D2Z A;  4YQU A;  5ELG A;  2HRK B;  2VD0 A;  1ML6 A;  3GUR A;  1XW5 A;  5LCZ A;  3IR4 A;  4KDX A;  3HJO A;  4WR5 A;  4DEJ A;  2IMK A;  3F6F A;  4ID0 A;  5G5E A;  2EFC A;  2N5F A;  3UAP A;  5J47 A;  5J4Y A;  3FR3 A;  3ERG A;  1U88 A;  3KMN A;  1GTA A;  2AHE A;  5ECK B;  1PD2 1;  5HFK A;  1USB A;  2ON7 A;  2GSS A;  3VPQ A;  4KF9 A;  4EXJ A;  1G6Y A;  1HNA A;  3Q18 A;  2C3Q A;  4KGI A;  2HRK A;  1VF3 A;  3N9J A;  3TOU A;  4EDY A;  1GSU A;  1HQO A;  1K0C A;  3CSJ A;  5AIS A;  4K0N A;  1Q4J A;  3UVH A;  2V6K A;  1TU7 A;  3PR8 A;  2OA7 A;  4ZXG A;  2VCQ A;  4Q5F A;  3D0Z A;  6GSV A;  1GSE A;  2VCX A;  4G19 A;  4J2F A;  3VLN A;  4ECB A;  5ECR B;  1K0N A;  5DDL A;  5ECH B;  9GSS A;  4ZBA A;  5DAL B;  1V40 A;  3G7I A;  3SWL A;  4G0K A;  3LQ7 A;  5A1N B;  4MPF A;  5J40 A;  4KH7 A;  4IVF A;  3FR9 A;  4W66 A;  1AQX A;  2IL3 A;  4ZBD A;  4Q5R A;  1N25 A;  2EFD A;  4ISD A;  4JBB A;  4G9H A;  1YY7 A;  1K3L A;  1GLQ A;  2HSN B;  3AY8 A;  1GSY A;  1U3I A;  4ZB9 A;  4G0I A;  2C3T A;  5F06 A;  4AKH A;  3GH6 A;  3MAK A;  3LXT A;  5F0G A;  1PMT A;  4KE3 A;  5DAL A;  5ECO B;  4G0L A;  3F63 A;  3IK9 A;  4NHZ A;  1NHY A;  1TU8 A;  2CAQ A;  5LD0 A;  4G10 A;  4Q5Q A;  3P8W A;  4IBP A;  1YKC A;  5GSS A;  1M9B A;  2R6K A;  5DAK A;  1UA5 A;  2GST A;  1B4P A;  4QQ7 A;  5J4U A;  1PA3 A;  4E68 A;  4L5L A;  2VCZ A;  4PX1 A;  5A34 B;  3FYG A;  4AKX B;  5A4U A;  5A4V A;  1EOG A;  1GSF A;  4BVX A;  4ZB8 A;  1GUM A;  3CRU A;  2F3M A;  4O92 A;  4KDY A;  3LYK A;  4K0G A;  4YAV A;  1E6B A;  5DCG A;  3PPU A;  2YCD A;  4GF0 A;  4I97 A;  13GS A;  4N3Z A;  1BF5 A;  2CA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...