5BMUB

The crystal structure of the gst-like domains complex of aimp3-eprs mutant c92sc105sc123s
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
166
structure length
166
Chain Sequence
TLSLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLARVATTAGLYGSNLMEHTEIDHWLEFSATKLSSSDSFTSTINELNHSLSLRTYLVGNSLSLADLSVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/ligase
molecule keywords Eukaryotic translation elongation factor 1 epsilon-1
publication title Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 166
sequence length 166
chains with identical sequence D, F, H
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2015-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5bmuB00
5A34B 4AKIA 4AI6A 5BMUB 5A1NA 4ZB7A 5A5HA 5A34A 4AKHA 4AKGA 5A1NB 4W66A 5A5HB
chains in the Genus database with same CATH superfamily
2EFDA 3AY8A 3GSSA 4PX1A 1M0UA 16GSA 1YJ6A 3R2QA 6GSWA 4AKXB 1PKZA 1USBA 2YV9A 4WR4A 2WRTA 2WVXB 5DQSA 5J4YA 2VKZG 1E6BA 3F6FA 1F3AA 4IW9A 4RI7A 3ZMLA 1K0NA 2O36A 3LQ7A 4I97A 3IBHA 1OE7A 4W66A 2OA7A 4MF6A 4YAVA 3HJMA 1PD21 5LCZA 1GNWA 3VK9A 4AI6A 1K3LA 1YEWC 4EDYA 4ZB6A 1K3OA 1Q4JA 2EFEA 1GSYA 4L5LA 4GSTA 3UBKA 3CSIA 5A34A 5ECNB 4AKHA 6GSSA 7GSSA 2VCWA 3N9JA 5ECPB 3VURA 1V40A 4USSA 2GTUA 2WB9A 5LD0A 1GTAA 3ZFLA 1UA5A 2OT3A 22GSA 2PERA 4PXOA 5FWGA 5GSTA 3LYPA 4BVYB 1MD4A 5AGYA 3W8SA 5FT3A 1K3YA 3QAGA 5AIVA 4Q5RA 4OMVA 4KF9A 3NIVA 4G01A 5D73A 5JCWA 4G19A 2JL4A 3R3EA 4FQUA 3IK9A 4KDUA 3QAWA 1OE8A 2HQTA 2GSTA 1XWGA 4AKIA 5J4VA 1JZRA 2PMTA 3CBUA 4WR5A 3GTUA 5D9WA 1PX6A 1JLVA 4KE3A 1GWCA 2O5VA 4ISDA 2UV8G 2VCQA 1AXDA 4L8EA 2LJRA 4FXYP 1Y6EA 4OFTA 1ML6A 1I1IP 2V6KA 2F8FA 1B8XA 1OKTA 2VCZA 1B4PA 1BG1A 2HRKA 1TU7A 3UVHA 1PN9A 1XWKA 20GSA 5D9VA 2OACA 2WDUA 2VD1A 5A5HA 3KXOA 3WD6A 4BVXB 3MAKA 4IGJA 1M99A 2GSRA 4PI0C 2D2ZA 5D9XA 1TXUA 4F03A 4MZWA 3O3TA 1GLQA 4ECBA 4MF7A 3KTLA 3CSJA 2CVDA 3TOUA 1EOHA 3G7IA 5ECSA 1XW6A 1EEMA 1U87A 3LXTA 1U3IA 4E68A 1GNEA 3VI5A 3LG6A 5ECOB 3ZMKA 12GSA 3I6AA 4IBPA 1GSSA 4PNGA 5KEJA 4K0GA 4ACSA 1S4BP 2CA8A 4J2FA 5AN1A 3WYWA 4MK3A 1HNAA 2C3TA 2VCVA 4KGIA 5IQYA 5J47A 3GX0A 4EE0A 5BMUA 2DC5A 1OYJA 2WZSA 3LSZA 10GSA 2O3EA 1IYHA 3Q74A 3VPTA 3D0ZA 3LXZA 4IKHA 2X64A 3IC8A 1EV9A 3ERGA 1Y1UA 1M9BA 2HSMA 5GZZB 2HSNB 2CAQA 5ECMB 2HNLA 3RGBC 1AQWA 3O76A 3KMNA 5A4UA 4GLTA 4KDYA 1GTUA 1SVOA 1BAYA 4JBBA 3IR4A 4AGSA 3IK7A 3LJRA 4MPGA 3TGZA 4Q5QA 13GSA 4G0KA 5J40A 4BL7A 4IELA 5ECQB 4Q5NA 3F6DA 4DEJA 5F8BA 1YKCA 4RI6A 3MDKA 1IYIA 5DALA 6GSVA 2IMIA 2WW0A 4JEDA 4TOPA 4ZBBA 1RK4A 2IL3A 3VLNA 1N2AA 4ZXGA 3FR9A 4YQUA 1K0MA 2C80A 2C3NA 1GUHA 1MTCA 2WW1A 4KH7A 4IQ1A 3CSHA 1F2EA 2DSAA 8GSSA 5ELAA 5DAKA 1PL1A 2OADA 2AB6A 4CHSA 3FR6A 1EOGA 3DD3A 2R4VA 1VF2A 1M9AA 4O92A 1MD3A 2AHEA 5A1NA 3KMOA 4HJ2A 3M1GA 4HOJA 3ZFBA 3G7JA 2WS2A 4G10A 3RFRC 1BF5A 1PA3A 4PQHA 5A34B 4F0CA 2VD0A 3SWLA 1BYEA 1HNBA 1GLPA 2WVZA 2YV7A 5DJLA 1TDIA 3P8WA 4MF5A 5DJMA 5GSSA 2VCXA 1YVLA 1ZL9A 1V2AA 3M0FA 1FW1A 3IE3A 2AAWA 1JLWA 4ECIA 3H1NA 1GTIA 3N5OA 1NHYA 4KSMA 4Q5FA 4F0BA 3HMJG 9GSSA 1GUMA 5ECRB 3UBLA 3L0HA 2N5FA 1Z9HA 3UAPA 4G0LA 4ZB9A 2WVXA 3GTUB 3RBTA 2HRAA 4ECJA 17GSA 11GSA 2GSQA 1PKWA 3TOTA 1YY7A 3VWXA 4IQAA 5G5FA 14GSA 1HNCA 4PGTA 2WW2A 4EC0A 5D9TA 5J4UA 3Q19A 4PTSA 4KDXA 1C72A 2ON5A 2HRKB 2CZ2A 3I69A 4LMWA 1K0AA 1GSFA 2CZ3A 1LBKA 2C3QA 3FY7A 4GCIA 4ID0A 2GDRA 2EFHA 5FHIA 5A5HB 3Q18A 2R5GA 2PBJA 5DDLA 1GUKA 2FHEA 6GSXA 4BVYA 2EFCA 3TU3B 3GSTA 2WW3A 3CHXC 2R3XA 2GLRA 3GUSA 3KM6A 4GF0A 3CRUA 3C8EA 3U6VA 1K0CA 1PL2A 4N3ZA 1ZGNA 2ON7A 4AKGA 1BX9A 3QAVA 2NTOA 1SVMA 2R6KA 5F0GA 3LFLA 4MP4A 5A4WA 5ECIB 1G6WA 2PVQA 5HFKA 3GH6A 1VF4A 4EXJA 1GSDA 5J5NA 3P90A 1GTBA 3EE2A 4IJIA 1YDKA 4MDCA 4PNFA 5F07A 4IVFA 4E8HA 5DCGA 5AISA 5EL8A 5B7CA 4GSSA 3FYGA 4EDZA 4PI2C 1PX7A 5BMUB 1EV4A 1FHEA 2UZ8A 2VO4A 4ZB8A 3PPUA 1GSUA 4YQVA 18GSA 4YAPA 5EY6A 4G9HA 4N0VA 4QQ7A 4GSNA 1U88A 2HSMB 2C4JA 2F3MA 1XW5A 2WVYA 2A2RA 1K0OA 1TW9A 4YQMA 4GDFA 1N25A 4NHWA 4BVXA 4NHZA 5A5KA 3HJOA 3QR6A 3EINA 5G5EA 3FR3A 4PQIA 2CAIA 6GSTA 2WJUA 1A0FA 1AW9A 3CWGA 3PGTA 2J9HA 4BL7B 4OFNA 1F3BA 4HZ2A 5ELGA 5JCUA 3CRTA 4KX4A 1GSQA 1VF3A 5DALB 5ECHB 2VCTA 2GSSA 4NAXA 3FRCA 5F05A 2C8UA 4KAEA 4QMKA 4ZBAA 4K0NA 2FNOA 1KBNA 3PR8A 3GURA 1G7OA 3LYKA 5DAKB 4HI7A 1AQXA 5ECLB 3ERFA 3UARA 1BG5A 4MPFA 5ECKB 4LMVA 4JZQA 6GSUA 1PGTA 4OFMA 19GSA 2YCDA 4ZB7A 5A4VA 1K0DA 4ZBDA 6GSYA 3VPQA 5A1NB 1AQVA 5J41A 3HKRA 4YH2A 4HZ4A 2HSNA 4ECCA 4GTUA 2IMKA 1R5AA 4PUAA 1GSEA 4PHZC 4G0IA 3ISOA 1TU8A 1SVLA 1LJRA 2H1LA 5AIXA 1DUGA 3M3MA 3KJYA 4IS0A 1VF1A 3M8NA 4O7HA 2A2SA 3VI7A 1PMTA 1HQOA 5F06A 2PGTA 3DGQA 4E8EA 1GULA 3BBYA 1YQ1A 5EVOA 4PURA 1G6YA 4L5OA 1B48A 3F63A 1K0BA
chains in the Genus database with same CATH topology
2EFDA 3AY8A 3GSSA 4PX1A 1M0UA 16GSA 1YJ6A 3R2QA 6GSWA 4AKXB 1PKZA 1USBA 2YV9A 4WR4A 2WRTA 5DQSA 5J4YA 2VKZG 1E6BA 3F6FA 1F3AA 4IW9A 4RI7A 3ZMLA 1K0NA 3LQ7A 4I97A 3IBHA 1OE7A 4W66A 2OA7A 4MF6A 4YAVA 3HJMA 1PD21 5LCZA 1GNWA 3VK9A 4AI6A 1K3LA 4EDYA 4ZB6A 1K3OA 1Q4JA 2EFEA 1GSYA 4L5LA 4GSTA 3UBKA 3CSIA 5A34A 5ECNB 4AKHA 6GSSA 7GSSA 2VCWA 3N9JA 5ECPB 3VURA 1V40A 4USSA 2GTUA 2WB9A 5LD0A 1GTAA 3ZFLA 1UA5A 2OT3A 22GSA 2PERA 4PXOA 5FWGA 5GSTA 3LYPA 4BVYB 1MD4A 5AGYA 3W8SA 5FT3A 1K3YA 3QAGA 5AIVA 4Q5RA 4OMVA 4KF9A 3NIVA 4G01A 5D73A 5JCWA 4G19A 2JL4A 3R3EA 4FQUA 3IK9A 4KDUA 3QAWA 1OE8A 2HQTA 2GSTA 1XWGA 4AKIA 5J4VA 1JZRA 2PMTA 3CBUA 4WR5A 3GTUA 5D9WA 1PX6A 1JLVA 4KE3A 1GWCA 2O5VA 4ISDA 2UV8G 2VCQA 1AXDA 4L8EA 2LJRA 1Y6EA 4OFTA 1ML6A 2V6KA 2F8FA 1B8XA 1OKTA 2VCZA 1B4PA 1BG1A 2HRKA 1TU7A 3UVHA 1PN9A 1XWKA 20GSA 5D9VA 2OACA 2WDUA 2VD1A 5A5HA 3KXOA 3WD6A 4BVXB 3MAKA 4IGJA 1M99A 2GSRA 2D2ZA 5D9XA 1TXUA 4F03A 4MZWA 3O3TA 1GLQA 4ECBA 4MF7A 3KTLA 3CSJA 2CVDA 3TOUA 1EOHA 3G7IA 5ECSA 1XW6A 1EEMA 1U87A 3LXTA 1U3IA 4E68A 1GNEA 3VI5A 3LG6A 5ECOB 3ZMKA 12GSA 3I6AA 4IBPA 1GSSA 4PNGA 5KEJA 4K0GA 4ACSA 2CA8A 4J2FA 5AN1A 3WYWA 4MK3A 1HNAA 2C3TA 2VCVA 4KGIA 5IQYA 5J47A 3GX0A 4EE0A 5BMUA 2DC5A 1OYJA 3LSZA 10GSA 1IYHA 3Q74A 3VPTA 3D0ZA 3LXZA 4IKHA 2X64A 3IC8A 1EV9A 3ERGA 1Y1UA 1M9BA 2HSMA 5GZZB 2HSNB 2CAQA 5ECMB 2HNLA 1AQWA 3O76A 3KMNA 5A4UA 4GLTA 4KDYA 1GTUA 1SVOA 1BAYA 4JBBA 3IR4A 4AGSA 3IK7A 3LJRA 4MPGA 3TGZA 4Q5QA 13GSA 4G0KA 5J40A 4BL7A 4IELA 5ECQB 4Q5NA 3F6DA 4DEJA 5F8BA 1YKCA 4RI6A 3MDKA 1IYIA 5DALA 6GSVA 2IMIA 4JEDA 4TOPA 4ZBBA 1RK4A 2IL3A 3VLNA 1N2AA 4ZXGA 3FR9A 4YQUA 1K0MA 2C80A 2C3NA 1GUHA 1MTCA 4KH7A 4IQ1A 3CSHA 1F2EA 2DSAA 8GSSA 5ELAA 5DAKA 1PL1A 2OADA 2AB6A 4CHSA 3FR6A 1EOGA 3DD3A 2R4VA 1VF2A 1M9AA 4O92A 1MD3A 2AHEA 5A1NA 3KMOA 4HJ2A 3M1GA 4HOJA 3ZFBA 3G7JA 2WS2A 4G10A 1BF5A 1PA3A 4PQHA 5A34B 4F0CA 2VD0A 3SWLA 1BYEA 1HNBA 1GLPA 2YV7A 5DJLA 1TDIA 3P8WA 4MF5A 5DJMA 5GSSA 2VCXA 1YVLA 1ZL9A 1V2AA 3M0FA 1FW1A 3IE3A 2AAWA 1JLWA 4ECIA 3H1NA 1GTIA 3N5OA 1NHYA 4KSMA 4Q5FA 4F0BA 3HMJG 9GSSA 1GUMA 5ECRB 3UBLA 3L0HA 2N5FA 1K0BA 1Z9HA 3UAPA 4G0LA 4ZB9A 3GTUB 3RBTA 2HRAA 4ECJA 17GSA 11GSA 2GSQA 1PKWA 3TOTA 1YY7A 3VWXA 4IQAA 5G5FA 14GSA 1HNCA 4PGTA 4EC0A 5D9TA 5J4UA 3Q19A 4PTSA 4KDXA 1C72A 2ON5A 2HRKB 2CZ2A 3I69A 4LMWA 1K0AA 1GSFA 2CZ3A 1LBKA 2C3QA 3FY7A 4GCIA 4ID0A 2GDRA 2EFHA 5FHIA 5A5HB 3Q18A 2R5GA 2PBJA 5DDLA 1GUKA 2FHEA 6GSXA 4BVYA 2EFCA 3TU3B 3GSTA 2R3XA 2GLRA 3GUSA 3KM6A 4GF0A 3CRUA 3C8EA 3U6VA 1K0CA 1PL2A 4N3ZA 1ZGNA 2ON7A 4AKGA 1BX9A 3QAVA 2NTOA 1SVMA 2R6KA 5F0GA 3LFLA 4MP4A 5A4WA 5ECIB 1G6WA 2PVQA 5HFKA 3GH6A 1VF4A 4EXJA 1GSDA 5J5NA 3P90A 1GTBA 3EE2A 4IJIA 1YDKA 4MDCA 4PNFA 5F07A 4IVFA 4E8HA 5DCGA 5AISA 5EL8A 5B7CA 4GSSA 3FYGA 4EDZA 1PX7A 5BMUB 1EV4A 1FHEA 2UZ8A 2VO4A 4ZB8A 3PPUA 1GSUA 4YQVA 18GSA 4YAPA 5EY6A 4G9HA 4N0VA 4QQ7A 4GSNA 1U88A 2HSMB 2C4JA 2F3MA 1XW5A 2A2RA 1K0OA 1TW9A 4YQMA 4GDFA 1N25A 4NHWA 4BVXA 4NHZA 5A5KA 3HJOA 3QR6A 3EINA 5G5EA 3FR3A 4PQIA 2CAIA 6GSTA 2WJUA 1A0FA 1AW9A 3CWGA 3PGTA 2J9HA 4BL7B 4OFNA 1F3BA 4HZ2A 5ELGA 5JCUA 3CRTA 4KX4A 1GSQA 1VF3A 5DALB 5ECHB 2VCTA 2GSSA 4NAXA 3FRCA 5F05A 2C8UA 4KAEA 4QMKA 4ZBAA 4K0NA 2FNOA 1KBNA 3PR8A 3GURA 1G7OA 3LYKA 5DAKB 4HI7A 1AQXA 5ECLB 3ERFA 3UARA 1BG5A 4MPFA 5ECKB 4LMVA 4JZQA 6GSUA 1PGTA 4OFMA 19GSA 2YCDA 4ZB7A 5A4VA 1K0DA 4ZBDA 6GSYA 3VPQA 5A1NB 1AQVA 5J41A 3HKRA 4YH2A 4HZ4A 2HSNA 4ECCA 4GTUA 2IMKA 1R5AA 4PUAA 1GSEA 4G0IA 1TU8A 3ISOA 1SVLA 1LJRA 2H1LA 5AIXA 1DUGA 3KJYA 4IS0A 1VF1A 3M8NA 4O7HA 2A2SA 3VI7A 1PMTA 1HQOA 5F06A 2PGTA 3DGQA 4E8EA 1GULA 3BBYA 1YQ1A 5EVOA 4PURA 1G6YA 4L5OA 1B48A 3F63A 3M3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A34 B;  4AKI A;  4AI6 A;  5BMU B;  5A1N A;  4ZB7 A;  5A5H A;  5A34 A;  4AKH A;  4AKG A;  5A1N B;  4W66 A;  5A5H B; 
#chains in the Genus database with same CATH topology
 2EFD A;  3AY8 A;  3GSS A;  4PX1 A;  1M0U A;  16GS A;  1YJ6 A;  3R2Q A;  6GSW A;  4AKX B;  1PKZ A;  1USB A;  2YV9 A;  4WR4 A;  2WRT A;  2WVX B;  5DQS A;  5J4Y A;  2VKZ G;  1E6B A;  3F6F A;  1F3A A;  4IW9 A;  4RI7 A;  3ZML A;  1K0N A;  2O36 A;  3LQ7 A;  4I97 A;  3IBH A;  1OE7 A;  4W66 A;  2OA7 A;  4MF6 A;  4YAV A;  3HJM A;  1PD2 1;  5LCZ A;  1GNW A;  3VK9 A;  4AI6 A;  1K3L A;  1YEW C;  4EDY A;  4ZB6 A;  1K3O A;  1Q4J A;  2EFE A;  1GSY A;  4L5L A;  4GST A;  3UBK A;  3CSI A;  5A34 A;  5ECN B;  4AKH A;  6GSS A;  7GSS A;  2VCW A;  3N9J A;  5ECP B;  3VUR A;  1V40 A;  4USS A;  2GTU A;  2WB9 A;  5LD0 A;  1GTA A;  3ZFL A;  1UA5 A;  2OT3 A;  22GS A;  2PER A;  4PXO A;  5FWG A;  5GST A;  3LYP A;  4BVY B;  1MD4 A;  5AGY A;  3W8S A;  5FT3 A;  1K3Y A;  3QAG A;  5AIV A;  4Q5R A;  4OMV A;  4KF9 A;  3NIV A;  4G01 A;  5D73 A;  5JCW A;  4G19 A;  2JL4 A;  3R3E A;  4FQU A;  3IK9 A;  4KDU A;  3QAW A;  1OE8 A;  2HQT A;  2GST A;  1XWG A;  4AKI A;  5J4V A;  1JZR A;  2PMT A;  3CBU A;  4WR5 A;  3GTU A;  5D9W A;  1PX6 A;  1JLV A;  4KE3 A;  1GWC A;  2O5V A;  4ISD A;  2UV8 G;  2VCQ A;  1AXD A;  4L8E A;  2LJR A;  4FXY P;  1Y6E A;  4OFT A;  1ML6 A;  1I1I P;  2V6K A;  2F8F A;  1B8X A;  1OKT A;  2VCZ A;  1B4P A;  1BG1 A;  2HRK A;  1TU7 A;  3UVH A;  1PN9 A;  1XWK A;  20GS A;  5D9V A;  2OAC A;  2WDU A;  2VD1 A;  5A5H A;  3KXO A;  3WD6 A;  4BVX B;  3MAK A;  4IGJ A;  1M99 A;  2GSR A;  4PI0 C;  2D2Z A;  5D9X A;  1TXU A;  4F03 A;  4MZW A;  3O3T A;  1GLQ A;  4ECB A;  4MF7 A;  3KTL A;  3CSJ A;  2CVD A;  3TOU A;  1EOH A;  3G7I A;  5ECS A;  1XW6 A;  1EEM A;  1U87 A;  3LXT A;  1U3I A;  4E68 A;  1GNE A;  3VI5 A;  3LG6 A;  5ECO B;  3ZMK A;  12GS A;  3I6A A;  4IBP A;  1GSS A;  4PNG A;  5KEJ A;  4K0G A;  4ACS A;  1S4B P;  2CA8 A;  4J2F A;  5AN1 A;  3WYW A;  4MK3 A;  1HNA A;  2C3T A;  2VCV A;  4KGI A;  5IQY A;  5J47 A;  3GX0 A;  4EE0 A;  5BMU A;  2DC5 A;  1OYJ A;  2WZS A;  3LSZ A;  10GS A;  2O3E A;  1IYH A;  3Q74 A;  3VPT A;  3D0Z A;  3LXZ A;  4IKH A;  2X64 A;  3IC8 A;  1EV9 A;  3ERG A;  1Y1U A;  1M9B A;  2HSM A;  5GZZ B;  2HSN B;  2CAQ A;  5ECM B;  2HNL A;  3RGB C;  1AQW A;  3O76 A;  3KMN A;  5A4U A;  4GLT A;  4KDY A;  1GTU A;  1SVO A;  1BAY A;  4JBB A;  3IR4 A;  4AGS A;  3IK7 A;  3LJR A;  4MPG A;  3TGZ A;  4Q5Q A;  13GS A;  4G0K A;  5J40 A;  4BL7 A;  4IEL A;  5ECQ B;  4Q5N A;  3F6D A;  4DEJ A;  5F8B A;  1YKC A;  4RI6 A;  3MDK A;  1IYI A;  5DAL A;  6GSV A;  2IMI A;  2WW0 A;  4JED A;  4TOP A;  4ZBB A;  1RK4 A;  2IL3 A;  3VLN A;  1N2A A;  4ZXG A;  3FR9 A;  4YQU A;  1K0M A;  2C80 A;  2C3N A;  1GUH A;  1MTC A;  2WW1 A;  4KH7 A;  4IQ1 A;  3CSH A;  1F2E A;  2DSA A;  8GSS A;  5ELA A;  5DAK A;  1PL1 A;  2OAD A;  2AB6 A;  4CHS A;  3FR6 A;  1EOG A;  3DD3 A;  2R4V A;  1VF2 A;  1M9A A;  4O92 A;  1MD3 A;  2AHE A;  5A1N A;  3KMO A;  4HJ2 A;  3M1G A;  4HOJ A;  3ZFB A;  3G7J A;  2WS2 A;  4G10 A;  3RFR C;  1BF5 A;  1PA3 A;  4PQH A;  5A34 B;  4F0C A;  2VD0 A;  3SWL A;  1BYE A;  1HNB A;  1GLP A;  2WVZ A;  2YV7 A;  5DJL A;  1TDI A;  3P8W A;  4MF5 A;  5DJM A;  5GSS A;  2VCX A;  1YVL A;  1ZL9 A;  1V2A A;  3M0F A;  1FW1 A;  3IE3 A;  2AAW A;  1JLW A;  4ECI A;  3H1N A;  1GTI A;  3N5O A;  1NHY A;  4KSM A;  4Q5F A;  4F0B A;  3HMJ G;  9GSS A;  1GUM A;  5ECR B;  3UBL A;  3L0H A;  2N5F A;  1Z9H A;  3UAP A;  4G0L A;  4ZB9 A;  2WVX A;  3GTU B;  3RBT A;  2HRA A;  4ECJ A;  17GS A;  11GS A;  2GSQ A;  1PKW A;  3TOT A;  1YY7 A;  3VWX A;  4IQA A;  5G5F A;  14GS A;  1HNC A;  4PGT A;  2WW2 A;  4EC0 A;  5D9T A;  5J4U A;  3Q19 A;  4PTS A;  4KDX A;  1C72 A;  2ON5 A;  2HRK B;  2CZ2 A;  3I69 A;  4LMW A;  1K0A A;  1GSF A;  2CZ3 A;  1LBK A;  2C3Q A;  3FY7 A;  4GCI A;  4ID0 A;  2GDR A;  2EFH A;  5FHI A;  5A5H B;  3Q18 A;  2R5G A;  2PBJ A;  5DDL A;  1GUK A;  2FHE A;  6GSX A;  4BVY A;  2EFC A;  3TU3 B;  3GST A;  2WW3 A;  3CHX C;  2R3X A;  2GLR A;  3GUS A;  3KM6 A;  4GF0 A;  3CRU A;  3C8E A;  3U6V A;  1K0C A;  1PL2 A;  4N3Z A;  1ZGN A;  2ON7 A;  4AKG A;  1BX9 A;  3QAV A;  2NTO A;  1SVM A;  2R6K A;  5F0G A;  3LFL A;  4MP4 A;  5A4W A;  5ECI B;  1G6W A;  2PVQ A;  5HFK A;  3GH6 A;  1VF4 A;  4EXJ A;  1GSD A;  5J5N A;  3P90 A;  1GTB A;  3EE2 A;  4IJI A;  1YDK A;  4MDC A;  4PNF A;  5F07 A;  4IVF A;  4E8H A;  5DCG A;  5AIS A;  5EL8 A;  5B7C A;  4GSS A;  3FYG A;  4EDZ A;  4PI2 C;  1PX7 A;  5BMU B;  1EV4 A;  1FHE A;  2UZ8 A;  2VO4 A;  4ZB8 A;  3PPU A;  1GSU A;  4YQV A;  18GS A;  4YAP A;  5EY6 A;  4G9H A;  4N0V A;  4QQ7 A;  4GSN A;  1U88 A;  2HSM B;  2C4J A;  2F3M A;  1XW5 A;  2WVY A;  2A2R A;  1K0O A;  1TW9 A;  4YQM A;  4GDF A;  1N25 A;  4NHW A;  4BVX A;  4NHZ A;  5A5K A;  3HJO A;  3QR6 A;  3EIN A;  5G5E A;  3FR3 A;  4PQI A;  2CAI A;  6GST A;  2WJU A;  1A0F A;  1AW9 A;  3CWG A;  3PGT A;  2J9H A;  4BL7 B;  4OFN A;  1F3B A;  4HZ2 A;  5ELG A;  5JCU A;  3CRT A;  4KX4 A;  1GSQ A;  1VF3 A;  5DAL B;  5ECH B;  2VCT A;  2GSS A;  4NAX A;  3FRC A;  5F05 A;  2C8U A;  4KAE A;  4QMK A;  4ZBA A;  4K0N A;  2FNO A;  1KBN A;  3PR8 A;  3GUR A;  1G7O A;  3LYK A;  5DAK B;  4HI7 A;  1AQX A;  5ECL B;  3ERF A;  3UAR A;  1BG5 A;  4MPF A;  5ECK B;  4LMV A;  4JZQ A;  6GSU A;  1PGT A;  4OFM A;  19GS A;  2YCD A;  4ZB7 A;  5A4V A;  1K0D A;  4ZBD A;  6GSY A;  3VPQ A;  5A1N B;  1AQV A;  5J41 A;  3HKR A;  4YH2 A;  4HZ4 A;  2HSN A;  4ECC A;  4GTU A;  2IMK A;  1R5A A;  4PUA A;  1GSE A;  4PHZ C;  4G0I A;  3ISO A;  1TU8 A;  1SVL A;  1LJR A;  2H1L A;  5AIX A;  1DUG A;  3M3M A;  3KJY A;  4IS0 A;  1VF1 A;  3M8N A;  4O7H A;  2A2S A;  3VI7 A;  1PMT A;  1HQO A;  5F06 A;  2PGT A;  3DGQ A;  4E8E A;  1GUL A;  3BBY A;  1YQ1 A;  5EVO A;  4PUR A;  1G6Y A;  4L5O A;  1B48 A;  3F63 A;  1K0B A; 
#chains in the Genus database with same CATH homology
 2EFD A;  3AY8 A;  3GSS A;  4PX1 A;  1M0U A;  16GS A;  1YJ6 A;  3R2Q A;  6GSW A;  4AKX B;  1PKZ A;  1USB A;  2YV9 A;  4WR4 A;  2WRT A;  5DQS A;  5J4Y A;  2VKZ G;  1E6B A;  3F6F A;  1F3A A;  4IW9 A;  4RI7 A;  3ZML A;  1K0N A;  3LQ7 A;  4I97 A;  3IBH A;  1OE7 A;  4W66 A;  2OA7 A;  4MF6 A;  4YAV A;  3HJM A;  1PD2 1;  5LCZ A;  1GNW A;  3VK9 A;  4AI6 A;  1K3L A;  4EDY A;  4ZB6 A;  1K3O A;  1Q4J A;  2EFE A;  1GSY A;  4L5L A;  4GST A;  3UBK A;  3CSI A;  5A34 A;  5ECN B;  4AKH A;  6GSS A;  7GSS A;  2VCW A;  3N9J A;  5ECP B;  3VUR A;  1V40 A;  4USS A;  2GTU A;  2WB9 A;  5LD0 A;  1GTA A;  3ZFL A;  1UA5 A;  2OT3 A;  22GS A;  2PER A;  4PXO A;  5FWG A;  5GST A;  3LYP A;  4BVY B;  1MD4 A;  5AGY A;  3W8S A;  5FT3 A;  1K3Y A;  3QAG A;  5AIV A;  4Q5R A;  4OMV A;  4KF9 A;  3NIV A;  4G01 A;  5D73 A;  5JCW A;  4G19 A;  2JL4 A;  3R3E A;  4FQU A;  3IK9 A;  4KDU A;  3QAW A;  1OE8 A;  2HQT A;  2GST A;  1XWG A;  4AKI A;  5J4V A;  1JZR A;  2PMT A;  3CBU A;  4WR5 A;  3GTU A;  5D9W A;  1PX6 A;  1JLV A;  4KE3 A;  1GWC A;  2O5V A;  4ISD A;  2UV8 G;  2VCQ A;  1AXD A;  4L8E A;  2LJR A;  1Y6E A;  4OFT A;  1ML6 A;  2V6K A;  2F8F A;  1B8X A;  1OKT A;  2VCZ A;  1B4P A;  1BG1 A;  2HRK A;  1TU7 A;  3UVH A;  1PN9 A;  1XWK A;  20GS A;  5D9V A;  2OAC A;  2WDU A;  2VD1 A;  5A5H A;  3KXO A;  3WD6 A;  4BVX B;  3MAK A;  4IGJ A;  1M99 A;  2GSR A;  2D2Z A;  5D9X A;  1TXU A;  4F03 A;  4MZW A;  3O3T A;  1GLQ A;  4ECB A;  4MF7 A;  3KTL A;  3CSJ A;  2CVD A;  3TOU A;  1EOH A;  3G7I A;  5ECS A;  1XW6 A;  1EEM A;  1U87 A;  3LXT A;  1U3I A;  4E68 A;  1GNE A;  3VI5 A;  3LG6 A;  5ECO B;  3ZMK A;  12GS A;  3I6A A;  4IBP A;  1GSS A;  4PNG A;  5KEJ A;  4K0G A;  4ACS A;  2CA8 A;  4J2F A;  5AN1 A;  3WYW A;  4MK3 A;  1HNA A;  2C3T A;  2VCV A;  4KGI A;  5IQY A;  5J47 A;  3GX0 A;  4EE0 A;  5BMU A;  2DC5 A;  1OYJ A;  3LSZ A;  10GS A;  1IYH A;  3Q74 A;  3VPT A;  3D0Z A;  3LXZ A;  4IKH A;  2X64 A;  3IC8 A;  1EV9 A;  3ERG A;  1Y1U A;  1M9B A;  2HSM A;  5GZZ B;  2HSN B;  2CAQ A;  5ECM B;  2HNL A;  1AQW A;  3O76 A;  3KMN A;  5A4U A;  4GLT A;  4KDY A;  1GTU A;  1SVO A;  1BAY A;  4JBB A;  3IR4 A;  4AGS A;  3IK7 A;  3LJR A;  4MPG A;  3TGZ A;  4Q5Q A;  13GS A;  4G0K A;  5J40 A;  4BL7 A;  4IEL A;  5ECQ B;  4Q5N A;  3F6D A;  4DEJ A;  5F8B A;  1YKC A;  4RI6 A;  3MDK A;  1IYI A;  5DAL A;  6GSV A;  2IMI A;  4JED A;  4TOP A;  4ZBB A;  1RK4 A;  2IL3 A;  3VLN A;  1N2A A;  4ZXG A;  3FR9 A;  4YQU A;  1K0M A;  2C80 A;  2C3N A;  1GUH A;  1MTC A;  4KH7 A;  4IQ1 A;  3CSH A;  1F2E A;  2DSA A;  8GSS A;  5ELA A;  5DAK A;  1PL1 A;  2OAD A;  2AB6 A;  4CHS A;  3FR6 A;  1EOG A;  3DD3 A;  2R4V A;  1VF2 A;  1M9A A;  4O92 A;  1MD3 A;  2AHE A;  5A1N A;  3KMO A;  4HJ2 A;  3M1G A;  4HOJ A;  3ZFB A;  3G7J A;  2WS2 A;  4G10 A;  1BF5 A;  1PA3 A;  4PQH A;  5A34 B;  4F0C A;  2VD0 A;  3SWL A;  1BYE A;  1HNB A;  1GLP A;  2YV7 A;  5DJL A;  1TDI A;  3P8W A;  4MF5 A;  5DJM A;  5GSS A;  2VCX A;  1YVL A;  1ZL9 A;  1V2A A;  3M0F A;  1FW1 A;  3IE3 A;  2AAW A;  1JLW A;  4ECI A;  3H1N A;  1GTI A;  3N5O A;  1NHY A;  4KSM A;  4Q5F A;  4F0B A;  3HMJ G;  9GSS A;  1GUM A;  5ECR B;  3UBL A;  3L0H A;  2N5F A;  1K0B A;  1Z9H A;  3UAP A;  4G0L A;  4ZB9 A;  3GTU B;  3RBT A;  2HRA A;  4ECJ A;  17GS A;  11GS A;  2GSQ A;  1PKW A;  3TOT A;  1YY7 A;  3VWX A;  4IQA A;  5G5F A;  14GS A;  1HNC A;  4PGT A;  4EC0 A;  5D9T A;  5J4U A;  3Q19 A;  4PTS A;  4KDX A;  1C72 A;  2ON5 A;  2HRK B;  2CZ2 A;  3I69 A;  4LMW A;  1K0A A;  1GSF A;  2CZ3 A;  1LBK A;  2C3Q A;  3FY7 A;  4GCI A;  4ID0 A;  2GDR A;  2EFH A;  5FHI A;  5A5H B;  3Q18 A;  2R5G A;  2PBJ A;  5DDL A;  1GUK A;  2FHE A;  6GSX A;  4BVY A;  2EFC A;  3TU3 B;  3GST A;  2R3X A;  2GLR A;  3GUS A;  3KM6 A;  4GF0 A;  3CRU A;  3C8E A;  3U6V A;  1K0C A;  1PL2 A;  4N3Z A;  1ZGN A;  2ON7 A;  4AKG A;  1BX9 A;  3QAV A;  2NTO A;  1SVM A;  2R6K A;  5F0G A;  3LFL A;  4MP4 A;  5A4W A;  5ECI B;  1G6W A;  2PVQ A;  5HFK A;  3GH6 A;  1VF4 A;  4EXJ A;  1GSD A;  5J5N A;  3P90 A;  1GTB A;  3EE2 A;  4IJI A;  1YDK A;  4MDC A;  4PNF A;  5F07 A;  4IVF A;  4E8H A;  5DCG A;  5AIS A;  5EL8 A;  5B7C A;  4GSS A;  3FYG A;  4EDZ A;  1PX7 A;  5BMU B;  1EV4 A;  1FHE A;  2UZ8 A;  2VO4 A;  4ZB8 A;  3PPU A;  1GSU A;  4YQV A;  18GS A;  4YAP A;  5EY6 A;  4G9H A;  4N0V A;  4QQ7 A;  4GSN A;  1U88 A;  2HSM B;  2C4J A;  2F3M A;  1XW5 A;  2A2R A;  1K0O A;  1TW9 A;  4YQM A;  4GDF A;  1N25 A;  4NHW A;  4BVX A;  4NHZ A;  5A5K A;  3HJO A;  3QR6 A;  3EIN A;  5G5E A;  3FR3 A;  4PQI A;  2CAI A;  6GST A;  2WJU A;  1A0F A;  1AW9 A;  3CWG A;  3PGT A;  2J9H A;  4BL7 B;  4OFN A;  1F3B A;  4HZ2 A;  5ELG A;  5JCU A;  3CRT A;  4KX4 A;  1GSQ A;  1VF3 A;  5DAL B;  5ECH B;  2VCT A;  2GSS A;  4NAX A;  3FRC A;  5F05 A;  2C8U A;  4KAE A;  4QMK A;  4ZBA A;  4K0N A;  2FNO A;  1KBN A;  3PR8 A;  3GUR A;  1G7O A;  3LYK A;  5DAK B;  4HI7 A;  1AQX A;  5ECL B;  3ERF A;  3UAR A;  1BG5 A;  4MPF A;  5ECK B;  4LMV A;  4JZQ A;  6GSU A;  1PGT A;  4OFM A;  19GS A;  2YCD A;  4ZB7 A;  5A4V A;  1K0D A;  4ZBD A;  6GSY A;  3VPQ A;  5A1N B;  1AQV A;  5J41 A;  3HKR A;  4YH2 A;  4HZ4 A;  2HSN A;  4ECC A;  4GTU A;  2IMK A;  1R5A A;  4PUA A;  1GSE A;  4G0I A;  1TU8 A;  3ISO A;  1SVL A;  1LJR A;  2H1L A;  5AIX A;  1DUG A;  3KJY A;  4IS0 A;  1VF1 A;  3M8N A;  4O7H A;  2A2S A;  3VI7 A;  1PMT A;  1HQO A;  5F06 A;  2PGT A;  3DGQ A;  4E8E A;  1GUL A;  3BBY A;  1YQ1 A;  5EVO A;  4PUR A;  1G6Y A;  4L5O A;  1B48 A;  3F63 A;  3M3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...