1NMDA

Crystal structure of d. discoideum actin-gelsolin segment 1 complex crystallized in presence of lithium atp
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
372
structure length
362
Chain Sequence
DVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin
publication title The Structure Of The Non-Vertebrate Actin: Implications For The ATP Hydrolytic Mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 118
structure length 362
sequence length 372
ec nomenclature
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nmdA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nmdA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1nmdA03
2FSNA 3HZ6A 4WQ4A 2YHWA 3FZLA 2I7NA 5BRHA 1RFQA 1ZXOA 1KAXA 2I7PA 2D0PA 3FZMA 5JLFA 3ZEUB 3LM9A 5AQTA 4J8FA 3UKRB 4RTFD 4BG9A 1ZC6A 4JD2B 2ASOA 2P9NA 5AQQA 3BEXA 3CJ9A 3ZX0A 3WEEB 1GLBG 2ASMA 1T44A 2D4WA 4ISGA 3ENOA 3ZETA 2J4RA 5F1XA 3IDHA 1HLUA 3WXKA 2QWPA 2Q1NA 4C23A 4NB4A 4EHUA 1GLDG 4BGAA 3SJHA 5EXWA 4B1WB 4O5FA 1U2VA 3VOVA 3VENA 3HTVA 3A8YA 3HSCA 4CZHA 4QS7A 4BRDA 1ESVA 1ZBSA 4BRCA 2VYPA 3SMPA 2PBDA 5AZJA 2FSJA 1BA0A 3BUZB 4MLEA 1Y64A 2QWQA 2AP1A 4FWMA 4CI6A 3VF6A 1S3XA 3FZFA 5AQLA 2V51B 1NGDA 2A6AA 3LL3A 1YAGA 3FZHA 3MN6A 3OHRA 4FWQA 2IVPA 2FF3B 3ULEA 4FO0A 2GWKA 4GY2B 2E20A 3GE1A 3HBTA 4H5TA 2E1ZA 4EHTA 2PAVA 2P9LA 3U9DA 4PKIA 1K8KA 3CERA 2F9TA 2Q36A 3H3OB 3HI0A 2UYTA 3ID8A 2YJEA 4B1ZA 2E1YA 2W41A 4FOEA 4BRMA 3WUHA 5AQHA 2A3ZA 4XH5A 4BRIA 4NO7A 1RGIA 1BU6O 3D7EO 2EWSA 3R6MA 2FLOA 2GEMA 4ISEA 2ZGZA 3A0IX 3DXMB 4IWVA 3WQUA 4K42A 3CJ7A 1V4TA 2NZTA 3O08A 1C0FA 4CZGA 4JAXA 3GL1A 3JXUA 4A62A 4IJAA 4BC3A 4IXCA 4BR9A 3W3DA 2BTFA 1TUYA 3CQXA 5BN8A 1BA1A 3LDPA 5AQOA 3MN5A 2CGJA 5AQUA 4XH4A 2CH5A 3AAPA 4L3QA 1GLJO 2E8AA 1YVNA 3EN9A 2VCPA 5LJWA 3J8AA 3BP8A 3O8MA 4FWRA 2ZF5O 3QBWA 3UKUA 1GLFO 2QWRA 3TPQA 1NBWA 1NLVA 3DAWA 3EO3A 4Y0WA 2ZGYA 3VEWA 4BRAA 2YI1A 2QM1A 2IIRA 4KBOA 1H1VA 3IUCA 1QHAA 3UB5A 2P9IA 3I33A 1T6DA 4YDUC 5AZIA 1ATNA 2D0OA 3G25A 5E26A 4QS8A 3CI5A 5JLHA 4FPBA 2P9PB 5ELZA 3ZEUA 4BR0A 5FPDA 1HX1A 5AQNA 4JHDA 5BREA 3EZWA 1MA9B 3CIPA 4IO8A 3GBTA 3UKRA 4DB3A 5LJVA 1Z05A 1MDUB 4ISFA 5KQ8A 2P9UB 1X9JA 2A5XA 2HOEA 2HF4A 4CJ7A 1NMDA 3QDKA 3ENHA 4H0TB 4IJNA 2Q0RA 1T6CA 2WUSA 1BDGA 3CJAA 4PL8A 2E88A 1TYQB 4FPAA 1HUXA 4BC2A 3M1FA 4BQLA 2DPNA 3CHWA 3VERA 2IVNA 3AY9A 4EFHA 4FWNA 5FPNA 4CZLA 3MN9A 5AFUH 3ATUA 2CGKA 3C7NB 1RDWX 3ZX2A 5EOYA 4H0YB 2ASPA 1KAYA 3KVGA 3VF2A 5BRFA 2Q31A 3ATVA 4A61A 4K25A 4F9OA 3DWLA 4A2BA 4BR2A 4AM7A 4RWTA 4H03B 4JN4A 4B1UB 3H46O 3GDQA 3KZBA 3VEXA 4BREA 1U6ZA 4H0XB 5AQYA 4CZEA 2QWNA 3D2EA 4WQ5A 4HTLA 2YCHA 4HWIA 1SQKA 3SMSA 5AZJB 3VESA 2OANA 3H1QA 1JCGA 3O4WA 3DJCA 5AQXA 3SK3A 2W40A 1KAZA 4FWLA 2HMPA 3CJCA 1MWKA 5BPLA 2QWLA 3JS6A 5AQIA 1HKCA 3FZKA 1IG8A 2CH6A 1XC3A 1NGJA 1CZAN 5KPTA 3DXMA 3QBXA 3ULEB 4BR5A 4WQ4C 4FOIA 1GLCG 4I6MB 1JCEA 1GLEG 3WXLA 4FL9A 1BWFO 4M7XA 1X3NA 3QFPA 1NGFA 1WOQA 4M7YA 3BF1A 3EL2A 3D2FA 3TU5A 3A5LC 5KPRA 2E2PA 2FF6A 4CD1A 1WUAA 4H0OA 1QZ6A 2P9KB 1NM1A 3CETA 3DXKA 3VGMA 2V7ZA 5AQJA 1SZ2A 4CBUA 5JICA 1DGKN 1QQNA 1E4GT 4MLHA 1GLAG 3H6EA 4JNEA 3LDQA 5AQZA 5BN9A 5F2RA 1NGBA 3O80A 3VEVA 3M6GA 3O1WA 4IZ9A 4BVOA 4B1XB 3WXJA 4EAHD 1EQYA 4PKHA 4BC4A 1NWKA 1HKBA 4BQZA 4H5RA 2A42A 1Z6RA 3O5BA 5EY4A 5AQGA 4K43A 2P9PA 2QWMA 3KHYA 3GOIA 2Q2RA 3EKSA 1YUWA 1BOTO 5EX5A 4BRLA 1S22A 1HKGA 4RCHA 2Q97A 4WYBA 4BRKA 4CD3A 3RSEB 5AFUA 3ZX3A 3B8AX 4JD2A 2P9UA 1QQMA 2ZWHA 3WEEA 2E2NA 1V4SA 3S41A 2P9SB 5AQRA 5AQPA 1TYQA 4Z94A 1HJOA 3QB0A 4CZMA 5AZIB 1DEJA 2YHYA 4BR4A 3MDQA 5F0XA 3C7NA 4LC9B 4CBWA 1X3MA 2ITMA 3MN7A 3BF3A 3C0BA 3U8XA 4JHDB 3MK6A 3GG4A 5AQKA 4O8KA 4BC5A 4EIAA 1NGGA 4PL7A 2V7YA 3LDNA 2A41A 4CZJA 4BRFA 2D1KA 3VF4A 4FWPA 4BRGA 1Q18A 2P9NB 4E1JA 5JMVA 3AAQA 4BRPA 2BUPA 4MO5A 4GNIA 1MWMA 4BRNA 4A2AA 5B8HA 2QXLA 3WT0A 3ZETB 4DHYA 2CGLA 2E2QA 3MMVA 3FLCO 1XQSC 3LM2A 3O1BA 1U2VB 2QWOA 2HF3A 3VGKA 3U9ZA 5AQVA 3U4LA 5AQFA 4H0PA 1E4FT 5AQSA 1ATRA 4YDUA 5AQMA 1BO5O 3L6QA 2GTDA 4B9QA 5I9EB 4BVPA 5CE3A 4M63C 5TKYA 3QICA 2NRHA 3WXIA 3LDOA 5EVZA 3FE1A 4BR7A 3HM8A 4CZKA 3QMLA 5BPNA 4PKGA 1NGHA 1YXQA 4FWSA 3I8BA 2GWJA 4I6MA 5KQDA 3H1VX 3QFUA 1NGEA 5BR9A 3D2EB 1NGCA 2P9LB 2FXUA 3H3NO 4K41A 1K8KB 3VEZA 2A40A 2H3GX 2VWBA 4QS9A 3VEYA 4DCHA 2P9KA 3FR0A 4CZFA 4FSVA 3R8EA 4BRQA 4DQ8A 2E2OA 3EKUA 1NGIA 3H45C 1BUPA 5BRDA 1LCUA 3W0LA 1OKJA 4CZIA 4H5WA 4BGBA 3WQTA 5E84A 1QZ5A 1JCFA 3P4IA 4BG8A 2Q0UA 5AR0A 5FPMA 3VPZA 1LOTB 5BPMA 3A5MC 1D4XA 3L0QA 5ADXA 1XUPO 1ATSA 1IJJA 5AQWA 5KPZA 2IVOA 3FGUA 4CBXA 2QW9A 2NLXA 1DKGD 1GLLO 3R9PA 3VETA 1TUUA 2AA4A 3LDLA 1P8ZA 3D2FB 3IMXA 3VGLA 3AARA 4BRHA 4XH1A 1C0GA 1HPMA 3F9MA 2KHOA 3DXKB 3FFKB 3A5OC 4B1VA 4H0VB 4B1YB 1NGAA 3L4IA 4H5VA 3O6WA 1KXPA 5LY3A 5FPEA 4FWOA 3RSEA 3UKUB 4FWKA 2V52B 3CJ1A 5ADXH 2F9WA 4H5NA 3CJBA 1QQOA 3CQYA 1BG3A 2YJFA 3IFRA 3M3ZA 2FSKA 4AM6A 2YHXA 2GUPA 4MO4A 2P9SA 4WQ5C 3VEOA 1R59O 3UE5A 1SAZA 4BROA 3MCPA 1G99A 1J6ZA 2GELA 3SLCA 3A5NC 2P9IB 4XEIA
chains in the Genus database with same CATH superfamily
3A2FA 4A5BA 4DSEA 1N5YA 1KAXA 4JKGB 4NCAA 3AVFA 5JLFA 3B6PA 3PSFA 3SV3A 4FJ7A 3ZT4A 1RDCA 2ASOA 4GKKK 4OPAA 5AQQA 4ICLA 4YORA 3WEEB 2HHQA 2D4WA 1T3VA 1P90A 1GOBA 5M1KA 2QWPA 3LP0A 1L3VA 4EHUA 2NRWA 1U2VA 2HHXA 4CZHA 3U3GA 5JVGL 3EYZA 1KFDA 1ESVA 3TAGA 4BWJA 2PBDA 3SMPA 5AZJA 2FSJA 4NYNA 1NMNA 1TKZA 4GVMA 4J2AA 4FCYA 4CHPA 1YJ9N 1FJGK 4FWMA 1S3XA 5AQLA 4E1NA 1CXUA 3SV4A 4FK4A 4V19S 3T1HK 1NK5A 4E3SA 3FZHA 3ZSQA 4JKFA 5T7BA 3SAFA 2JLEA 2IVPA 4FO0A 2GWKA 4GY2B 4JV5K 2X74A 3ZCMA 2OA8A 2YNHA 4M3YA 3CERA 4JKCA 3NGZA 2B4JA 4CF9A 3H3OB 3HI0A 5SWMA 4YNQA 4FK0A 1RBVA 3CD6N 4DV6K 2A3ZA 4NO7A 4Z4HA 2X6NA 2EWSA 5DMRA 4C8NA 4CJUA 2FLOA 4DUZK 2ZGZA 2I5JA 3F73A 3CCQN 1K73O 3WQUA 1V4TA 3CJ7A 1LV5A 3O08A 5J2MA 1C0FA 4CZGA 1M90O 3CMAN 3JXUA 4CESA 5J1EA 3QEVA 3W3DA 4IFYA 1D8YA 2D0AA 1BA1A 5AQOA 3MN5A 5CY4A 4HCCA 2O8DB 3AAPA 1XNQK 3G6EN 2G8UA 1IH7A 1GLJO 4M3WA 1NK8A 3O4QA 3G4SN 1IBKK 4Z4GA 4CW7B 1TAQA 2VQEK 2VG6A 4NCBA 3MX5A 3K5NA 3KTQA 4JK7A 4BRAA 4DU4A 4X62K 4JI8K 3CM6A 1NOYA 1T05A 1RBSA 1E3MA 2QM1A 2IIRA 2HHWA 4DR2K 1QHAA 3L2UA 3V4IA 1U48A 1JL1A 3ZYYX 3VA0A 4JKEA 2RF2A 3MXMA 4B9SA 1HRHA 3DOLA 1SUQA 5ELZA 2G8KA 4JHDA 1Z05A 2G8HA 4ISFA 5IWAK 2P9UB 1X9JA 5HRRA 1NMDA 1NU0A 3NVMA 4IJNA 5JS2A 3CC7N 4PL8A 3DOKA 4LF9K 1RT3A 3KD5E 3QETA 4FWNA 4CZLA 1QQCA 4Q5VA 3ATUA 3PUFA 1RDWX 4J2EA 3DLGA 4H0YB 4DU3A 1TL3A 1D9DA 4CF1A 4FK2A 3HSTB 3AVAA 4A2BA 4DV0K 4B3MK 2KFZA 4MQ3A 2UU9K 4DR6K 4B1UB 3GDQA 3VEXA 1TVRA 4BREA 1EWQA 2O4GA 4H0XB 4CZEA 1U04A 1UOCA 3H1QA 2IAJA 2YV0X 1XMOK 3BZKA 3DJCA 3KD1E 5LMNK 3V9UA 1KAZA 1HQUA 5JVHL 4KTWA 3Q7CA 5AQIA 3FZKA 1IG8A 5MLCQ 2DTUA 2UUAK 1KD1O 4JK8A 4BR5A 4W5NA 1EX4A 1KRPA 1VHXA 2WFBA 4FL9A 4M7XA 3V9WA 3QFPA 1NGFA 1XHXA 2RPIA 1T7PA 2VWKA 4PHTX 4CVNE 2GV9A 1RTDA 3ZSOA 4BEBA 2OTJN 4H0OA 4JRPA 2UXDK 1KSPA 3CETA 1Z25A 1SZ2A 3NF6A 1REVA 1DGKN 4OPJA 4JI7K 1IKVA 3SYZA 1E4GT 3H6EA 2BE2A 5F2RA 4DQPA 1XWLA 5C10A 3O80A 3T19A 3QIPA 3M6GA 2RHKA 4IZ9A 3LANA 5KRSA 3L4QA 4FZXC 4G9ZA 3L2RA 1IKYA 3KLGA 4LH4A 4H5RA 4BQZA 4M42A 1Z6RA 1WSGA 3FFIA 3MEDA 4KPYA 5AQGA 3KHYA 1BISA 5CYMA 5EX5A 4F2RA 1HKGA 1I39A 1VQ5N 4R5PA 2Q97A 3IS9A 4CD3A 3RSEB 3ZX3A 3B8AX 3I8DA 1X9MA 4K0KK 2P9UA 1QQMA 5FDLA 1M1KO 2BDPA 5C42A 1W0HA 4IOXA 4ILHA 2AJQA 2P9SB 2UUBK 4OPKA 4Z94A 4DR1K 1KLNA 2OPQA 3K5LA 4DV5K 5CYQA 3TAEA 4CJSA 1HNVA 4CBWA 3N4PA 3U8XA 1ASWA 4GV3A 4BC5A 4FJIA 2OCEA 4I9QA 4PQUA 4WE1A 3QIOA 4OX9K 2A41A 3J7YP 1CZ9A 4MFBA 3I0SA 2P9NB 4W5OA 4JI6K 3QLHA 4MO5A 1TKXA 2HVIA 2QXLA 1NJWA 3QNOA 3KKRA 2E2QA 4CEFA 1B9DA 3OBWA 3THVA 3NCIA 3AVHA 4CIFA 3VGKA 3PSIA 1WB9A 1O13A 1NJZA 4O0IA 5I3UA 4YDUA 4B9QA 1IV0A 4KRFA 3LDSA 4DQRA 1JLCA 4M63C 2NNWA 3MECA 5DM7L 2NRTA 3L3VA 3P1GA 2NRHA 1SKRA 1R0AA 1S1TA 4DSJA 4CGIA 3ZSXA 1IKXA 3VQ6A 3HRGA 5KQDA 1YF5L 1HYZA 1RBRA 4N5SA 3RRGA 3MEEA 3D2EB 1S6PA 1NGCA 2Z1JA 4DTOA 1K8KB 4CJQA 2A40A 2KW4A 4CF2A 2VWBA 3C6TA 4DCHA 3NDKA 4CGFA 1VSEA 4FSVA 3SBTA 3R8EA 4E7LA 1K8AO 2E2OA 5BRDA 3V81A 4HHTA 4RW4A 1QZ5A 3ZT1A 1JCFA 3J7ZO 4BECA 5FRMA 3P4IA 1J5EK 1KVCA 5AR0A 5FPMA 1X9WA 4FJJA 1YT3A 4PY5A 5BPMA 3A5MC 4H8KA 5A2QO 3VQDA 5ADXA 1ATSA 2VWJA 4F3TA 2IVOA 2QW9A 2NLXA 1NK6A 2KQ2A 3CPEA 2Z1HA 2PYLA 3HPHA 2VGNA 3IMXA 4Q0BA 3TANA 3SUQA 4CJVA 4XH1A 4MDAA 4GV9A 2KHOA 3FFKB 4CJWA 3KK3A 4B1YB 1NGAA 4IFEA 3L4IA 1KXPA 5LY3A 2O4IA 4BE0A 1VK0A 1KTQA 3RSEA 1VSDA 4FWKA 5ADXH 3CJ1A 1GOAA 3IFRA 4FW1A 2FSKA 4FYDA 5GIPA 1TL1A 5C12A 2P9SA 3AVJA 1KC8O 1R59O 4JI4K 4KHWA 1SAZA 3DLKA 3IKMA 1G15A 2GELA 4CJKA 3AY9A 3A5NC 3FLCO 4XEIA 4WQ4A 2YHWA 2I7NA 2E6MA 1RBTA 1I94K 3ZEUB 4CEBA 3CC4N 3OW2M 5M1OA 1VQ9N 4JD2B 4E7JA 2P9NA 3AVMA 5M1PA 3SQ2A 3BEXA 3G71N 3ZX0A 2DFEA 2X78A 1GLBG 4CK2A 3TTFA 4E19A 4WF9L 1X1PA 5F1XA 3KIOA 3LAKA 4C23A 4NB4A 4OO1J 3TAMA 4B1WB 3P5JA 4YOYA 5I42A 3VOVA 3VENA 3HTVA 2XY8A 4AF1A 3SAHA 4UQGA 1A5WA 1QE1A 4QS7A 2VYPA 1RNHA 5LL6Z 4DV3K 3AVGA 4LD0A 4B3OA 2QWQA 2AP1A 2BANA 4JKHA 3G10A 4CI6A 4YOXA 4ELTA 4DTPA 1NGDA 3CFOA 4M3RA 1SL1A 3MN6A 1OVQA 3OHRA 2LSNA 3PO4A 4DFMA 1VQ7N 4E1MA 1TK8A 3GE1A 1DLOA 2E1ZA 4EHTA 4HCBA 4RW8A 3NF9A 1YI2N 1A5XA 4PKIA 1K8KA 1KFSA 5D3GA 3NFAA 1WN7A 4FM2A 3CFPA 2UYTA 1ASUA 1J9AA 2YJEA 2E1YA 3K9JA 3PLAA 3EZ5A 3M8RA 1XI1A 4G1QA 3DRSA 4BRIA 4FJ8A 1RGIA 4JI0K 2PY5A 1VQMN 3ZT2A 5C2FA 3G0ZA 1NOZA 2GEMA 4ISEA 3DLHA 4IWVA 4K42A 4KI6A 1FKOA 3VMFB 4A62A 4IJAA 2HNDA 4CERA 4DTSA 3E1YA 4IXCA 3NGYA 4BC3A 2E5LK 1TUYA 5BN8A 4CF0A 4FVMA 5AQUA 3SPYA 2XY7A 2CH5A 4GV6A 4L3QA 2RE2A 4DTRA 3OYNA 1EP4A 1Q81O 1YVNA 3EN9A 3CM5A 3TSUA 2VCPA 5LJWA 4IKFA 1JLEA 1S1XA 3O8MA 4FWRA 3RTVA 4OKEA 3TPQA 3DAWA 1VSHA 2ZGYA 1L3UA 4FLZA 1NG9A 2YI1A 3SUNA 4CJPA 4M3XA 3AVNA 3V1OA 3F5TA 4KBOA 1H1VA 5J2NA 3IUCA 3OBYA 2ZE2A 4N47A 1L3TA 1QSSA 1ATNA 4PA1A 4EP4A 3PX6A 2ZM6K 2Y1JA 4B3SK 4O44A 3ZEUA 4AHVA 5FPDA 4KB1A 4DSIA 3EZWA 1U49A 1BQNA 4Y1DA 4DB3A 4FZYA 5LJVA 1JKHA 4I2PA 2VGMA 4DR5K 1ZBFA 2HOEA 2GUIA 1VSKA 3L8BA 3ENHA 3HXMA 5C15A 1XC9A 4FJ5A 3HVRA 2KZZA 4LFCK 1ASVA 2FBXA 5KI6A 3AO1A 4CHOA 1XMQK 3KWGA 1HUXA 1VRTA 4BQLA 1WSJA 4FJNA 2DPNA 1RT7A 2G8VA 5FPNA 2YHBA 1ILYA 3MN9A 4ELUA 1KVAA 3O3HA 4ID1A 3VQ7A 4DV1K 1D9FA 2HHUA 2B5JA 1OH6A 3KVGA 4J2BA 3OYCA 3ATVA 4A61A 3S5TA 4B9UA 5CZ1A 4BR2A 2G8WA 4AM7A 4IDHA 2W00A 3RR8A 1TKTA 3M5RA 1BIZA 3KZBA 1VQ6N 4DSLA 4OKJA 2XY5A 1CXQA 3V1QA 1C1BA 5CR4A 2Q3SA 2HBKA 4CFCA 2YKMA 2OANA 1JCGA 3VTHA 2W40A 1IKWA 4UY8O 3TAPA 2HMPA 2RKIA 4ELVA 1B9FA 1C1AA 4IFVA 4FJHA 4YOTA 1HKCA 2CH6A 4CFAA 4BE7B 3OYIA 5KPTA 3O3FA 4BDZA 3QBXA 3CYGA 3ULEB 4WFBL 4FJKA 1GLCG 3EE9A 4YHHK 3KK1A 1OVYA 2HHHK 4C8OA 1X3NA 4YOWA 3M8SA 3THXB 4I9LA 3EL2A 4LF7K 3D2FA 3A5LC 5KPRA 2E2PA 2HBJA 5SZTA 3TARA 4C8MA 2P9KB 5C2DA 4LF8K 2NRVA 2IOCA 3J81O 5JICA 4HVJA 1N33K 3IG1A 4DKWA 3U6FA 1QQNA 4M41A 4BACA 4MLHA 4JNEA 3LDQA 1RDDA 1ZBUA 4MDBA 3VEVA 3O1WA 4B1XB 3ZSYA 1EQYA 1VSJA 4Y1CA 3O4NA 4LH5A 4C1NK 4CEDA 3QESA 1RT4A 4DR7K 1SL0A 3O5BA 1LWEA 4JKGA 3GOIA 2HVHA 1BOTO 4CGJA 3WNGA 3KLEA 4E7KA 4RCHA 4DQQA 1OH7A 5FLXO 1VRUA 1LWFA 4DV2K 4CHZA 5TKWA 2F8TA 2UUCK 3V6DA 3WEEA 1EWRA 1V4SA 3S41A 3MCAB 4LY7A 3OYHA 1HJOA 4W5TA 4F3OA 5AZIB 3NHGA 2YHYA 3PO5A 4DV7K 4CHNA 3MEGA 1SL2A 1VSLA 3MN7A 2ITMA 3QEIA 1F21A 3SUPA 5DM6L 1EXQA 3GG4A 2KZMA 1HNIA 2KLAA 1NGGA 4BE1A 2V7YA 3LDNA 1VQ4N 1JXBA 1L5UA 1FK9A 1Q18A 2WC9A 3MWTA 4BRGA 5JMVA 3AA5X 4KAZA 2BUPA 4IDKA 4C8KA 3QINA 1C0UA 4AQYK 4L8RB 5B8HA 3WT0A 4CF8A 3ZETB 2CGLA 4JKDA 4U7BA 3MMVA 3SAGA 3UIQA 1W9HA 4DLGA 3VQ4A 3O1BA 4DTXA 1RILA 2QWOA 1VSFA 2XRIA 4ILJA 1JJ2M 4KO0A 3U9ZA 3CXCM 4AHSA 5AQFA 4H0PA 1E4FT 1C0MA 5AQSA 3T69A 1HJRA 2NRZA 3L6QA 5CE3A 5C0YA 4ID5A 3SJJA 1NK9A 3K0SA 1OH8A 3LDOA 2FBTA 4BDPA 1EO1A 2R7YA 4BDYA 5BPNA 4FWSA 3I8BA 4DS4A 2GWJA 3E9PA 3SQ1A 3AVLA 3S3NA 1ZBLA 5KRTA 1S6QA 3KKSA 1QVFM 1UWBA 3F9KA 3THXA 3RMBA 3ZLJA 3HOTA 4LF6K 2H3GX 4QS9A 2O8DA 4YOVA 2P9KA 3RR7A 1BI4B 4DQ8A 1NGIA 3EKUA 4YFUA 1BUPA 3OYDA 3W0LA 3K58A 4CZIA 4H5WA 3VQ9A 3DRRA 2ZQBA 3S3MA 3D6RA 2ZD1A 3NE6A 2Q0UA 3VPZA 3L0QA 3NAEA 3CQ8A 1XUPO 4DUYK 1IJJA 1N6QA 5AQWA 1GOCA 3FGUA 1DKGD 3CF5L 4IG0A 2AA4A 3LDLA 1WBBA 2NRRA 3VGLA 4N76A 4O4GA 4BRHA 5GIOA 3L2WA 4CJLA 4LFAK 1HPMA 3DXKB 2OPSA 4DMNA 3A5OC 4HTUA 4B1VA 4H5VA 3KWIA 2HHVA 4BWMA 4FLWA 3I0RA 1QS4A 2V52B 4DR3K 1QQOA 4OGEA 3CCJN 2YHXA 4MO4A 4WQ5C 2A1RA 3BZCA 3DMJA 3DLLL 4CECA 3ITHA 4BROA 3SZ2A 2YX6A 2P9IB 1Q8IA 4NCGA 4O55A 3HZ6A 4LFBK 2GBZA 1LAWA 5BRHA 1DT9A 3OS1A 4DTMA 4F2SA 1RFQA 1ZXOA 2HB5A 4ZTJA 1D5AA 2B6AA 2QEXN 2D0PA 4AHUA 3LWMA 4B9NA 4J8FA 1EKEA 3UKRB 4RTFD 4DF4A 4B3RK 4W5RA 1SS6A 4DSFA 3OYLA 3RRHA 3CJ9A 3ISNC 4FLXA 2ASMA 1T44A 1S9EA 1LW0A 3ZETA 2J4RA 3IDHA 4C1NI 1HLUA 5BR8K 4DQIA 4BGAA 2W42A 5EXWA 2BH1A 1TAUA 5IT9O 5C25A 3HSCA 1QSLA 3LALA 1ZBSA 2WBNA 1CZBA 2HBLA 1BA0A 2YKNA 1NK4A 2JWLA 4MLEA 1Y64A 4FJXA 1J53A 2IS3A 3O9SA 1WSIA 3VF6A 2V51B 3DLBA 1HYSA 3TTCA 4GVEA 3OYJA 1RT6A 4CK1A 3D0PA 1IG9A 3WNFA 4KHUA 1IBLK 3VQQA 4H5TA 4A5AA 2G8IA 4M45A 3U9DA 3CCVN 3TAFA 4KFBA 5C24A 4DTUA 1J5OA 3ID8A 4GKJK 2OPPA 2W41A 4FOEA 4H4OA 4BRMA 3CCUN 1BU6O 3D7EO 3K2PA 3R6MA 1VQPN 3F2KA 1U45A 1Q82O 3K5OA 3A0IX 3DXMB 3CCMN 2NZTA 5GAEP 3OYFA 4JAXA 4FLUA 4BR9A 4AH9A 4CHYA 2F96A 3CQXA 4QOZB 3LDPA 2CGJA 4CEAA 5HRNA 1TK5A 4XH4A 3ENBA 3PX0A 4OLBA 1BQMA 2O8FB 1JLGA 3KJVA 4DS5A 3VQAA 3J8AA 1TGOA 4A59A 4NLCA 3MWPA 3DLRA 4KI4A 1GLFO 2FBYA 3MXIA 2O8EB 2QWRA 4X64K 4DLEA 1NKEA 2E6LA 4KH6A 3T1YK 4JI5K 3EO3A 4KTQA 3VEWA 4AHCA 3K9KA 1J54A 5GADP 1NJIO 3RWUA 1U47A 3T7ZA 4Z0UA 3UB5A 2P9IA 2F4VK 3I33A 1T6DA 3TWHA 5E26A 2C1GA 4QS8A 3CI5A 4LSLA 1WSFA 4BR0A 4CJTA 5BREA 2FC0A 4KHSA 3CIPA 4FW2A 4IO8A 3UKRA 4JS4A 4HUGA 3KLIA 3SUOA 3VQ5A 1VSMA 1C1CA 3AVCA 3TTDA 3E9LA 2A5XA 1HR0K 2HF4A 4CJ7A 1BL3A 2Q0RA 4M3ZA 2WUSA 1BDGA 2E88A 4IOAL 3BY5A 4FPAA 3OYGA 4BC2A 3M1FA 4KKOA 3CHWA 4IO9L 2ITGA 4EFHA 1FKPA 1HPZA 2YNIA 3TI0A 5AFUH 2CGKA 3ZX2A 4KH5A 5EOYA 2OYQA 4H4MA 2ASPA 3TSQA 4E7IA 2P5GA 2Q31A 3JAMO 4K25A 4NLBA 2KKZA 4IOCL 5JS1A 3DWLA 3AVIA 4CGDA 4RWTA 4JN4A 3O3GA 3H46O 1S72N 4B9VA 3E9OA 4AILC 4XIUA 1U6ZA 5AQYA 2QWNA 3D2EA 4TSXA 1UA0A 4HWIA 4KB0A 1SQKA 3ALYA 3SMSA 5AZJB 3VESA 3K59A 3KK2A 3O4WA 1RT1A 3AVKA 1W7AA 4FWLA 3CJCA 4IG3A 1MWKA 4FJMA 5BPLA 2QA4N 3OS2A 3DXMA 1TV6A 3OVNA 3L3UA 4KHPK 4AHTA 1W2BM 3WXMB 1NK0A 4Z4IA 1JCEA 1GLEG 4RG8A 1BWFO 1WOQA 4M7YA 3BF1A 1N32K 2FF6A 2PZSA 1WUAA 1CLQA 1QZ6A 3HP9A 1C6VA 1WAFA 3V1RA 5CHIA 2WOMA 4C8LA 2V7ZA 5AQJA 3QO9A 2O8EA 3B6OA 4CBUA 4DF8A 4OKKA 3CFRA 1GLAG 4EZ9A 3E66A 5KGXA 5BN9A 4JS5A 3EY1A 1NGBA 5GAGP 3HK2A 4CEOA 4PKHA 2O8BB 4LSNA 4BC4A 1HKBA 3HP6A 3T3FA 4GMJB 4CJ4A 1T03A 4B9TA 3AA2A 1VQKN 1X9SA 2Q2RA 1YUWA 3EKSA 2YNFA 4Z4EA 1NNEA 3QERA 4LF4K 3KK7A 4Z4FA 1IBMK 5LMUK 4JD2A 3LWLA 4CIEA 3CMEN 1RCHA 2ZWHA 2E2NA 4DSKA 1U4BA 5AQRA 4ILGB 2GX9A 2X6SA 5AQPA 2VQFK 3BGRA 4O8UA 2VG5A 4FZZA 4DWIA 3MDQA 5F0XA 4LC9B 1X3MA 1BHLA 1RTIA 4DFJA 4JHDB 3DI6A 5JENA 5AQKA 4EIAA 3V9XA 3NMUA 4W5QA 3OTOK 3H08A 3PIOL 5J2QA 1YHQN 4KV8A 3VF4A 4FWPA 2ZJRL 4BRNA 4GNIA 1MWMA 4CJ5A 5GAHP 4E72A 1S1VA 3M8PA 3LAMA 4B3TK 1NJYA 1QTMA 3LM2A 3NGIA 4BE2A 1RDAA 3WNHA 2HF3A 2D0CA 5FRNA 3U3YA 3ASMA 2WONA 3VA3A 3VQ8A 1VSIA 4HUEA 1HNXK 1KQSM 5HLFA 1LW2A 3ZSWA 3FE1A 3HM8A 3QMLA 4PKGA 1NGHA 1YXQA 3TABA 2KFNA 4WCEL 2YNGA 1NGEA 2P5OA 4CHQA 1JLAA 2P9LB 1Q9YA 2FXUA 4HUFA 4K41A 3VEZA 1FXXA 3DLEA 3AGKA 3HPOA 4DTJA 4N41A 2VG7A 3VEYA 5M1NA 3NH2A 5K14A 3FR0A 4CZFA 3ZSRA 4FM1A 3AO3A 2HSTA 1LCUA 3NVKA 4BGBA 3WQTA 3S3OA 5AJ3K 2P1JA 5M1FA 4BG8A 2Y1IA 4CFBA 4FJ9A 4DFPA 1LAVA 5FROA 3SCXA 3VN5A 2WTUA 1VAZA 3R9PA 3VETA 2O8BA 1TUUA 3T1AA 3ID6A 1S9GA 3O9RA 4N56A 3SQ0A 1XHZA 3AARA 4CJFA 5GINA 1NJXA 3AA4A 3SBGA 3F9MA 4YOUA 4DQSA 4H0VB 3O6WA 5FPEA 2QKBA 4FWOA 3UKUB 1S1UA 4H5NA 3TSPA 1IO2A 3CQYA 3OYKA 2O8CB 2YJFA 3M3ZA 2HHIA 3JSMA 1ZBIA 3OJUA 1WLJA 4JKBA 3UE5A 3DRPA 2F7TA 1NK7A 3MCPA 1KVBA 1UA1A 2FSNA 2Z1GA 3FZLA 4M3UA 2I7PA 1NKBA 3O9UA 4IEIA 2JGUA 3FZMA 3LM9A 5AQTA 4WFNL 1RTHA 4BG9A 4JI1K 3VTIA 1ZC6A 3RMAA 3OS0A 5CZ2A 4OJRA 1WBDA 3CYMA 1O1WA 4KHQA 2YHAA 4ISGA 1VQNN 3VQBA 3ENOA 2JWKA 3HPGA 3WXKA 2Q1NA 2ETJA 3BDPA 1GLDG 4KHYA 3SJHA 1JL2A 4O5FA 1YIJN 3WNEA 3AO4A 4I2QA 3HL8A 3A8YA 4I7FA 2DFFA 2HNZA 4IEEA 4BRDA 4CCHA 4BRCA 2OZSA 1QHTA 4FLVA 3BUZB 3CCLN 1SV5A 5HP1A 3JYTA 4FXDA 3FZFA 3RVCA 1JLBA 2A6AA 3LL3A 1YAGA 3P38A 3CPWM 4CK3A 3SI6A 4FWQA 2EHGA 3N4QA 3OYEA 2FF3B 3ULEA 1N8RO 4CEEA 1HNZK 2E20A 3HBTA 3L2VA 2PAVA 4JI3K 1T8EA 2P9LA 5J2PA 3THYB 1FW6A 2OZMA 1NKCA 3MAQA 2F9TA 2Q36A 3R1XA 4B1ZA 4PUOA 3WUHA 2F8SA 5AQHA 4XH5A 1WSEA 4B8CA 2ZJQL 2UXCK 1XNRK 2HHSA 3HOSA 3OY9A 1S5JA 2W6LA 4KREA 2XO7A 4CFDA 2XY6A 4J2DA 5M1QA 3GL1A 2BTFA 2HHTA 3RMDA 4A57A 1SKWA 3AO2A 3SQ4A 1HQEA 3NF8A 1HYVA 2E8AA 1YTAA 2RN2A 3BP8A 2ZF5O 1MU2A 3QBWA 3UKUA 3RMCA 3C95A 2IGIA 3I55N 2DY4A 1NBWA 3EE8A 1NLVA 3LP3A 2O8CA 1B92A 5HRPA 4Z4CA 1KCFA 4KHNA 4Y0WA 3TR8A 1KLMA 2C1IA 4FLTA 3AVBA 4ZTFA 2IDOA 5HRSA 3C6AA 3CG7A 4YDUC 5AZIA 3AGRA 2D0OA 3G25A 3HO1A 5JLHA 4FPBA 2QI2A 2P9PB 3THWB 4K8ZA 1HX1A 5AQNA 1MA9B 3GBTA 3P39A 3I56N 1MDUB 5KQ8A 1SKSA 4CGHA 2KTQA 3QEWA 3QDKA 4CJRA 3AV9A 4AHRA 1T6CA 1RT5A 3LPUA 4OVLA 3CJAA 4NXMK 1YJNN 4OPHA 2G8FA 4JRQA 1TYQB 1BIUA 3VERA 4DV4K 2IVNA 2A1SA 1N34K 3C6UA 3QEPA 1JLQA 3C7NB 4JEPA 5HBMA 1KAYA 3VF2A 3AO5A 5BRFA 5DK5A 4JYAK 3QEXA 3R3LA 4F9OA 1ZBHA 4QCLA 4WFAL 1VQON 4H03B 2QK9A 2UXBK 3L2QA 3LZJA 4CEZA 3THYA 3LP2A 2OTLN 4DU1A 4WQ5A 1C0TA 4HTLA 3TAQA 2YCHA 1RDUA 3C65A 4B9MA 3SNNA 1Q9XA 5AQXA 3SK3A 2EX3A 2NRXA 1BI4A 1OH5A 2QWLA 3JS6A 1JLFA 1LWCA 1XC3A 4CE9A 1NGJA 1CZAN 1HNWK 2P51A 4B8AB 4DFKA 4K8XA 4XJXA 4WQ4C 4FOIA 4I6MB 3WXLA 1BGXT 3J7AP 1Z26A 5HROA 4JKAA 3TU5A 4B9LA 2HMIA 2W6KA 4CD1A 4JK9A 3KLHA 1NM1A 4CJEA 3V9SA 2D5RA 1N36K 3DXKA 3VGMA 1W97L 3S9HA 2FBVA 3OYAA 3MXJA 3IRXA 4NXNK 5EU7A 4JI2K 2HW3A 5AQZA 1Q7YO 3P83D 3NH0A 4O5BA 3QNNA 3DYAA 4BVOA 3WXJA 4EAHD 3VQPA 5KTQA 1YJWN 3LZIA 3ZT0A 1NWKA 2QTDA 4EZ6A 3LPTA 2A42A 4OGCA 2QKKA 3D45A 1L3SA 5EY4A 4DTNA 4K43A 3AA3A 2E4LA 2P9PA 3THWA 2QWMA 3OJSA 3HVTA 4E7HA 4BRLA 3Q7BA 1S22A 3K57A 4U67L 4WYBA 4BRKA 3DM2A 1WNSA 5AFUA 4O0JA 3C6HA 4E89A 4FM0A 2HNYA 4F8RA 2DFHA 4PWDA 2XHBA 2ATQA 4EP5A 4R79A 2OPRA 5E41A 1TYQA 3QB0A 4CZMA 1I3AA 3LP1A 3VQEA 3PIPL 1YITN 3ULDA 4JLHA 3MX2A 2PYJA 1DEJA 1HMVA 4BR4A 3C7NA 3CCRN 4CEQA 3NH1A 3BF3A 3C0BA 3CCSN 3SPZA 1Q86O 3MK6A 4O8KA 1EETA 2HBMA 3HM9A 4PL7A 4CZJA 1K6YA 4BRFA 2D1KA 4E1JA 3AAQA 4BRPA 4A2AA 3HT3A 4RW6A 3PY8A 4DHYA 3OYMA 1BCOA 1K9MO 2QXFA 3ZSVA 1YTUA 3HJFA 1XQSC 1U2VB 4ZHRA 1ZYQA 4DG1A 3IAYA 1BCMA 5AQVA 3U4LA 1TKDA 4X65K 4E0DA 1WSHA 1TK0A 1ATRA 2IC3A 5AQMA 4B08A 1BO5O 2GTDA 5I9EB 4BVPA 4FLYA 5H1SQ 5TKYA 3QICA 4QAGA 3WXIA 4BY9C 4IBNA 5EVZA 4BR7A 4CZKA 4OLAA 4I6MA 4KH4A 1VQ8N 4YY3K 3H1VX 3C94A 3QFUA 5BR9A 4LF5K 3O9TA 4NYFA 3CC2N 1Y97A 4FVUA 3H3NO 2D0BA 1RTJA 3M8QA 4RW9A 3V9ZA 4CGGA 1A5VA 4KTZA 4BRQA 2O8FA 3H45C 3ZSZA 3E01A 1OKJA 5E84A 1RT2A 3P31A 4F4KA 1LOTB 3NF7A 1VQLN 2PFUA 1D4XA 3CCEN 5KPZA 4CBXA 2Z1IA 1GLLO 3K5MA 1QVGM 4RW7A 5HL7L 1P8ZA 1WAJA 2NUBA 3VQCA 1QSYA 3PV8A 4FJLA 1YVUA 3D2FB 1ITGA 3OYBA 5HOOA 3J80O 1C0GA 4DR4K 4GW6A 1UAXA 3PX4A 3ZT3A 1DTTA 2BGGA 3OA9A 4FJGA 3KLFA 2F9WA 1DTQA 5KGWA 3O9QA 3CJBA 2ZJPL 1BG3A 3HYFA 4AM6A 4M3TA 3VEOA 2GUPA 3NBPA 1S1WA 1RBUA 4CJ3A 1JXEA 1G99A 1J6ZA 4X66K 4CIGA 3SLCA 1RDBA 3EEQA 4H0TB
chains in the Genus database with same CATH topology
2FSNA 3HZ6A 4WQ4A 2YHWA 3FZLA 4A5BA 2I7NA 5BRHA 1DT9A 1RFQA 1ZXOA 1KAXA 4JKGB 2I7PA 2QEXN 3O9UA 4IEIA 2D0PA 3FZMA 5JLFA 3ZEUB 3LM9A 5AQTA 4WFNL 3CC4N 4J8FA 3OW2M 3UKRB 4RTFD 4BG9A 5M1OA 1ZC6A 3VTIA 1VQ9N 1SS6A 4JD2B 2ASOA 2P9NA 4OPAA 5M1PA 5AQQA 4YORA 2YX6A 3BEXA 3CJ9A 3ZX0A 3G71N 3WEEB 1GLBG 2ASMA 1T44A 3TTFA 2D4WA 4ISGA 4WF9L 1VQNN 1T3VA 3ENOA 2JWKA 1P90A 3ZETA 2J4RA 5F1XA 3IDHA 4C1NI 1HLUA 3WXKA 2QWPA 2Q1NA 4C23A 4NB4A 4EHUA 5M1KA 4OO1J 1GLDG 2NRWA 4BGAA 3SJHA 5EXWA 4B1WB 2BH1A 4O5FA 4YOYA 1YIJN 1U2VA 3VOVA 3VENA 3HTVA 3SAHA 4AF1A 3A8YA 3HSCA 4CZHA 4IEEA 5JVGL 4QS7A 4BRDA 1ESVA 1ZBSA 4BRCA 2VYPA 3SMPA 2PBDA 2WBNA 5AZJA 2FSJA 2HBLA 1BA0A 3BUZB 2JWLA 4MLEA 1Y64A 3CCLN 3O9SA 2QWQA 1YJ9N 2AP1A 4FWMA 4JKHA 3VF6A 1S3XA 3FZFA 4CI6A 4YOXA 5AQLA 2V51B 3RVCA 1NGDA 2A6AA 3LL3A 1YAGA 3FZHA 3TTCA 3P38A 3MN6A 4GVEA 4JKFA 3CPWM 3OHRA 4FWQA 3SAFA 1VQ7N 2IVPA 3N4QA 1N8RO 2FF3B 3ULEA 4FO0A 2GWKA 4GY2B 2E20A 3GE1A 3HBTA 4H5TA 4A5AA 2E1ZA 4EHTA 2PAVA 2P9LA 3U9DA 3CCVN 1YI2N 4PKIA 1K8KA 3CERA 4JKCA 2F9TA 2Q36A 3R1XA 3H3OB 3HI0A 2UYTA 3ID8A 2YJEA 4B1ZA 2E1YA 3K9JA 2W41A 4FOEA 4BRMA 3PLAA 3WUHA 3CCUN 5AQHA 3CD6N 2A3ZA 4XH5A 4BRIA 2ZJQL 4NO7A 1RGIA 1BU6O 3D7EO 2EWSA 3R6MA 1VQPN 1VQMN 3F2KA 5C2FA 3HOSA 1Q82O 2FLOA 2GEMA 4ISEA 2ZGZA 3A0IX 3DXMB 4IWVA 3CCQN 3CCMN 3WQUA 1K73O 4K42A 1V4TA 3CJ7A 2NZTA 5GAEP 3VMFB 3O08A 1M90O 1C0FA 4CZGA 5M1QA 4JAXA 3CMAN 3GL1A 3JXUA 4A62A 4IJAA 3E1YA 4IXCA 4BC3A 4BR9A 3W3DA 2BTFA 1TUYA 3CQXA 4A57A 5BN8A 1BA1A 3LDPA 5AQOA 3MN5A 2CGJA 5AQUA 4XH4A 2CH5A 3AAPA 3ENBA 3G6EN 4L3QA 2RE2A 4GV6A 1GLJO 1Q81O 2E8AA 1YVNA 3EN9A 3TSUA 3G4SN 2VCPA 5LJWA 3J8AA 4A59A 4NLCA 3MWPA 3BP8A 3O8MA 4FWRA 2ZF5O 3QBWA 3UKUA 1GLFO 2QWRA 3I55N 3TPQA 1NBWA 3EE8A 1NLVA 4KH6A 3DAWA 3MX5A 3EO3A 4JK7A 2ZGYA 4Y0WA 3VEWA 4BRAA 3K9KA 2YI1A 5GADP 2C1IA 3F5TA 1NJIO 2QM1A 2IIRA 4KBOA 1H1VA 3IUCA 3T7ZA 3OBYA 1QHAA 3UB5A 2P9IA 3C6AA 3I33A 1T6DA 4YDUC 5AZIA 1ATNA 2D0OA 3AGRA 3G25A 5E26A 4QS8A 2C1GA 3ZYYX 3CI5A 5JLHA 4FPBA 2QI2A 4JKEA 2P9PB 5ELZA 3ZEUA 4BR0A 5FPDA 1HX1A 5AQNA 4JHDA 5BREA 3EZWA 1MA9B 3CIPA 4IO8A 3GBTA 3P39A 3UKRA 4DB3A 5LJVA 1Z05A 3I56N 1MDUB 2VGMA 4ISFA 5KQ8A 2P9UB 1X9JA 2A5XA 2HOEA 2HF4A 3E9LA 3TTDA 1NMDA 3QDKA 3NVMA 4CJ7A 3ENHA 4H0TB 4IJNA 2Q0RA 5C15A 3CC7N 1T6CA 2WUSA 1BDGA 3CJAA 4PL8A 2E88A 1YJNN 4IOAL 4OPHA 1TYQB 4FPAA 3KWGA 1HUXA 4BC2A 3M1FA 4BQLA 2DPNA 3CHWA 3VERA 4IO9L 2IVNA 3AY9A 4EFHA 4FWNA 5FPNA 4CZLA 1ILYA 3MN9A 5AFUH 3ATUA 2CGKA 3C7NB 1RDWX 3ZX2A 4KH5A 5EOYA 4H0YB 4JEPA 2ASPA 3TSQA 1KAYA 3KVGA 3VF2A 5BRFA 2Q31A 3ATVA 4A61A 4K25A 3R3LA 4NLBA 4F9OA 2KKZA 4IOCL 3DWLA 4A2BA 4BR2A 4WFAL 1VQON 4AM7A 4IDHA 4RWTA 4H03B 2W00A 4JN4A 4B1UB 3H46O 3M5RA 1S72N 3GDQA 3KZBA 3VEXA 1VQ6N 3E9OA 4BREA 1U6ZA 4H0XB 5AQYA 4CZEA 2QWNA 2OTLN 3D2EA 4WQ5A 5CR4A 4HTLA 2YCHA 1RDUA 2HBKA 1SQKA 4HWIA 3C65A 3SMSA 5AZJB 3VESA 2OANA 3H1QA 1JCGA 3O4WA 3DJCA 3VTHA 5AQXA 3SK3A 2W40A 1KAZA 5JVHL 4UY8O 4FWLA 2HMPA 2NRXA 3CJCA 1MWKA 5BPLA 2QA4N 3Q7CA 2QWLA 3JS6A 4YOTA 5AQIA 1HKCA 3FZKA 1IG8A 2CH6A 4BE7B 1XC3A 5MLCQ 1NGJA 1CZAN 5KPTA 3DXMA 3QBXA 3ULEB 1KD1O 4JK8A 4WFBL 4BR5A 4XJXA 4WQ4C 1W2BM 4FOIA 1GLCG 3WXMB 4I6MB 3EE9A 1JCEA 1GLEG 2WFBA 3WXLA 4FL9A 1BWFO 1OVYA 4M7XA 1X3NA 3QFPA 1NGFA 1WOQA 4YOWA 4M7YA 3BF1A 4PHTX 3EL2A 3D2FA 4JKAA 3TU5A 4BEBA 3A5LC 5KPRA 2E2PA 2HBJA 2OTJN 2FF6A 4CD1A 1WUAA 4H0OA 1QZ6A 4JK9A 5C2DA 2P9KB 1NM1A 5CHIA 3CETA 3DXKA 3VGMA 2V7ZA 1W97L 5AQJA 1SZ2A 2NRVA 4CBUA 5JICA 1DGKN 4DKWA 1QQNA 1E4GT 4MLHA 1GLAG 3H6EA 4JNEA 3E66A 3LDQA 5AQZA 5BN9A 1Q7YO 5F2RA 1NGBA 5C10A 4MDBA 3O80A 3VEVA 5GAGP 3M6GA 3O1WA 2RHKA 4IZ9A 4BVOA 4B1XB 3WXJA 3L4QA 1EQYA 4EAHD 4PKHA 1YJWN 4G9ZA 4C1NK 4BC4A 1NWKA 1HKBA 2QTDA 4BQZA 4H5RA 2A42A 1Z6RA 3O5BA 5EY4A 5AQGA 1VQKN 4K43A 2P9PA 2QWMA 3KHYA 4JKGA 3GOIA 2Q2RA 1YUWA 3EKSA 1BOTO 3Q7BA 5EX5A 1S22A 4BRLA 1HKGA 4U67L 1VQ5N 4RCHA 2Q97A 4WYBA 4BRKA 3KK7A 4CD3A 3RSEB 5AFUA 3ZX3A 3B8AX 4JD2A 2P9UA 1QQMA 3C6HA 5TKWA 3CMEN 1M1KO 2ZWHA 3WEEA 2E2NA 1V4SA 3S41A 4IOXA 4ILHA 2P9SB 4R79A 5AQRA 4ILGB 2GX9A 5AQPA 3MCAB 1TYQA 4Z94A 1HJOA 3QB0A 4CZMA 4O8UA 5AZIB 3PIPL 1YITN 3MX2A 1DEJA 2YHYA 4BR4A 3MDQA 5F0XA 3C7NA 4LC9B 4CBWA 1X3MA 2ITMA 3MN7A 3CCRN 3BF3A 3C0BA 3N4PA 3U8XA 4JHDB 5DM6L 3CCSN 1Q86O 4GV3A 3MK6A 3GG4A 5AQKA 4O8KA 4BC5A 4EIAA 2KLAA 3NMUA 2HBMA 1NGGA 4PL7A 2V7YA 3LDNA 2A41A 4CZJA 3PIOL 1VQ4N 1YHQN 4BRFA 2D1KA 3VF4A 4FWPA 2ZJRL 4BRGA 1Q18A 2P9NB 2WC9A 3MWTA 4E1JA 3AAQA 5JMVA 4BRPA 2BUPA 4MO5A 4GNIA 1MWMA 4BRNA 5GAHP 4A2AA 5B8HA 2QXLA 3WT0A 3ZETB 4DHYA 2CGLA 2E2QA 4JKDA 4U7BA 3OBWA 3MMVA 1K9MO 3SAGA 3FLCO 1XQSC 3LM2A 3O1BA 1U2VB 2QWOA 4ILJA 2HF3A 3VGKA 1JJ2M 3U9ZA 1O13A 3CXCM 5AQVA 3U4LA 5AQFA 4H0PA 1E4FT 5AQSA 3T69A 1ATRA 4YDUA 2NRZA 1BO5O 3L6QA 5AQMA 2GTDA 4B9QA 5I9EB 1KQSM 4BVPA 5CE3A 4M63C 5C0YA 2NNWA 5DM7L 5H1SQ 2NRTA 5TKYA 3QICA 2NRHA 3WXIA 3LDOA 4BY9C 5EVZA 3FE1A 4BR7A 3HM8A 1EO1A 4CZKA 3QMLA 5BPNA 4PKGA 1NGHA 1YXQA 4FWSA 3I8BA 2GWJA 3E9PA 4I6MA 3HRGA 4KH4A 1YF5L 5KQDA 4WCEL 3H1VX 3QFUA 1VQ8N 1NGEA 5BR9A 1QVFM 3O9TA 3D2EB 3CC2N 1NGCA 2P9LB 3HOTA 2FXUA 3H3NO 4K41A 4FVUA 1K8KB 3VEZA 2A40A 3AGKA 2H3GX 2VWBA 4QS9A 3VEYA 4DCHA 4YOVA 2P9KA 5M1NA 3FR0A 4CZFA 3SBTA 4FSVA 3R8EA 4BRQA 1K8AO 4DQ8A 2E2OA 1NGIA 2HSTA 3EKUA 1BUPA 3H45C 1LCUA 3W0LA 5BRDA 1OKJA 4CZIA 3NVKA 4H5WA 4BGBA 3WQTA 5E84A 1QZ5A 1JCFA 3J7ZO 3D6RA 5M1FA 4BECA 3P4IA 4BG8A 3P31A 2Q0UA 5AR0A 5FPMA 3VPZA 1LOTB 5BPMA 1VQLN 2PFUA 1D4XA 3A5MC 3L0QA 3CCEN 5ADXA 1XUPO 1ATSA 1IJJA 5AQWA 5KPZA 2IVOA 3FGUA 4CBXA 2QW9A 2NLXA 1DKGD 3CF5L 1GLLO 1VAZA 3R9PA 3CPEA 3VETA 1QVGM 1TUUA 2AA4A 5HL7L 3LDLA 1P8ZA 3ID6A 3O9RA 3D2FB 2VGNA 3IMXA 2NRRA 3VGLA 3AARA 4BRHA 5GIOA 5GINA 5HOOA 4XH1A 1C0GA 4MDAA 3SBGA 1HPMA 3F9MA 4YOUA 4GV9A 2KHOA 3DXKB 3FFKB 3A5OC 4B1VA 4H0VB 4B1YB 1NGAA 4IFEA 3L4IA 4H5VA 3O6WA 1KXPA 3KWIA 5LY3A 5FPEA 3OA9A 4FWOA 3RSEA 3UKUB 4FWKA 2V52B 3CJ1A 5ADXH 2F9WA 4H5NA 3O9QA 3TSPA 3CJBA 1QQOA 3CQYA 2ZJPL 1BG3A 3CCJN 2YJFA 3IFRA 3M3ZA 2FSKA 4AM6A 5GIPA 2YHXA 2GUPA 4MO4A 2P9SA 4WQ5C 3VEOA 1R59O 5C12A 1KC8O 4JKBA 3DLLL 3UE5A 1SAZA 2F7TA 4BROA 3IKMA 3MCPA 1G99A 1J6ZA 2GELA 3SLCA 3A5NC 2P9IB 4XEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FSN A;  3HZ6 A;  4WQ4 A;  2YHW A;  3FZL A;  2I7N A;  5BRH A;  1RFQ A;  1ZXO A;  1KAX A;  2I7P A;  2D0P A;  3FZM A;  5JLF A;  3ZEU B;  3LM9 A;  5AQT A;  4J8F A;  3UKR B;  4RTF D;  4BG9 A;  1ZC6 A;  4JD2 B;  2ASO A;  2P9N A;  5AQQ A;  3BEX A;  3CJ9 A;  3ZX0 A;  3WEE B;  1GLB G;  2ASM A;  1T44 A;  2D4W A;  4ISG A;  3ENO A;  3ZET A;  2J4R A;  5F1X A;  3IDH A;  1HLU A;  3WXK A;  2QWP A;  2Q1N A;  4C23 A;  4NB4 A;  4EHU A;  1GLD G;  4BGA A;  3SJH A;  5EXW A;  4B1W B;  4O5F A;  1U2V A;  3VOV A;  3VEN A;  3HTV A;  3A8Y A;  3HSC A;  4CZH A;  4QS7 A;  4BRD A;  1ESV A;  1ZBS A;  4BRC A;  2VYP A;  3SMP A;  2PBD A;  5AZJ A;  2FSJ A;  1BA0 A;  3BUZ B;  4MLE A;  1Y64 A;  2QWQ A;  2AP1 A;  4FWM A;  4CI6 A;  3VF6 A;  1S3X A;  3FZF A;  5AQL A;  2V51 B;  1NGD A;  2A6A A;  3LL3 A;  1YAG A;  3FZH A;  3MN6 A;  3OHR A;  4FWQ A;  2IVP A;  2FF3 B;  3ULE A;  4FO0 A;  2GWK A;  4GY2 B;  2E20 A;  3GE1 A;  3HBT A;  4H5T A;  2E1Z A;  4EHT A;  2PAV A;  2P9L A;  3U9D A;  4PKI A;  1K8K A;  3CER A;  2F9T A;  2Q36 A;  3H3O B;  3HI0 A;  2UYT A;  3ID8 A;  2YJE A;  4B1Z A;  2E1Y A;  2W41 A;  4FOE A;  4BRM A;  3WUH A;  5AQH A;  2A3Z A;  4XH5 A;  4BRI A;  4NO7 A;  1RGI A;  1BU6 O;  3D7E O;  2EWS A;  3R6M A;  2FLO A;  2GEM A;  4ISE A;  2ZGZ A;  3A0I X;  3DXM B;  4IWV A;  3WQU A;  4K42 A;  3CJ7 A;  1V4T A;  2NZT A;  3O08 A;  1C0F A;  4CZG A;  4JAX A;  3GL1 A;  3JXU A;  4A62 A;  4IJA A;  4BC3 A;  4IXC A;  4BR9 A;  3W3D A;  2BTF A;  1TUY A;  3CQX A;  5BN8 A;  1BA1 A;  3LDP A;  5AQO A;  3MN5 A;  2CGJ A;  5AQU A;  4XH4 A;  2CH5 A;  3AAP A;  4L3Q A;  1GLJ O;  2E8A A;  1YVN A;  3EN9 A;  2VCP A;  5LJW A;  3J8A A;  3BP8 A;  3O8M A;  4FWR A;  2ZF5 O;  3QBW A;  3UKU A;  1GLF O;  2QWR A;  3TPQ A;  1NBW A;  1NLV A;  3DAW A;  3EO3 A;  4Y0W A;  2ZGY A;  3VEW A;  4BRA A;  2YI1 A;  2QM1 A;  2IIR A;  4KBO A;  1H1V A;  3IUC A;  1QHA A;  3UB5 A;  2P9I A;  3I33 A;  1T6D A;  4YDU C;  5AZI A;  1ATN A;  2D0O A;  3G25 A;  5E26 A;  4QS8 A;  3CI5 A;  5JLH A;  4FPB A;  2P9P B;  5ELZ A;  3ZEU A;  4BR0 A;  5FPD A;  1HX1 A;  5AQN A;  4JHD A;  5BRE A;  3EZW A;  1MA9 B;  3CIP A;  4IO8 A;  3GBT A;  3UKR A;  4DB3 A;  5LJV A;  1Z05 A;  1MDU B;  4ISF A;  5KQ8 A;  2P9U B;  1X9J A;  2A5X A;  2HOE A;  2HF4 A;  4CJ7 A;  1NMD A;  3QDK A;  3ENH A;  4H0T B;  4IJN A;  2Q0R A;  1T6C A;  2WUS A;  1BDG A;  3CJA A;  4PL8 A;  2E88 A;  1TYQ B;  4FPA A;  1HUX A;  4BC2 A;  3M1F A;  4BQL A;  2DPN A;  3CHW A;  3VER A;  2IVN A;  3AY9 A;  4EFH A;  4FWN A;  5FPN A;  4CZL A;  3MN9 A;  5AFU H;  3ATU A;  2CGK A;  3C7N B;  1RDW X;  3ZX2 A;  5EOY A;  4H0Y B;  2ASP A;  1KAY A;  3KVG A;  3VF2 A;  5BRF A;  2Q31 A;  3ATV A;  4A61 A;  4K25 A;  4F9O A;  3DWL A;  4A2B A;  4BR2 A;  4AM7 A;  4RWT A;  4H03 B;  4JN4 A;  4B1U B;  3H46 O;  3GDQ A;  3KZB A;  3VEX A;  4BRE A;  1U6Z A;  4H0X B;  5AQY A;  4CZE A;  2QWN A;  3D2E A;  4WQ5 A;  4HTL A;  2YCH A;  4HWI A;  1SQK A;  3SMS A;  5AZJ B;  3VES A;  2OAN A;  3H1Q A;  1JCG A;  3O4W A;  3DJC A;  5AQX A;  3SK3 A;  2W40 A;  1KAZ A;  4FWL A;  2HMP A;  3CJC A;  1MWK A;  5BPL A;  2QWL A;  3JS6 A;  5AQI A;  1HKC A;  3FZK A;  1IG8 A;  2CH6 A;  1XC3 A;  1NGJ A;  1CZA N;  5KPT A;  3DXM A;  3QBX A;  3ULE B;  4BR5 A;  4WQ4 C;  4FOI A;  1GLC G;  4I6M B;  1JCE A;  1GLE G;  3WXL A;  4FL9 A;  1BWF O;  4M7X A;  1X3N A;  3QFP A;  1NGF A;  1WOQ A;  4M7Y A;  3BF1 A;  3EL2 A;  3D2F A;  3TU5 A;  3A5L C;  5KPR A;  2E2P A;  2FF6 A;  4CD1 A;  1WUA A;  4H0O A;  1QZ6 A;  2P9K B;  1NM1 A;  3CET A;  3DXK A;  3VGM A;  2V7Z A;  5AQJ A;  1SZ2 A;  4CBU A;  5JIC A;  1DGK N;  1QQN A;  1E4G T;  4MLH A;  1GLA G;  3H6E A;  4JNE A;  3LDQ A;  5AQZ A;  5BN9 A;  5F2R A;  1NGB A;  3O80 A;  3VEV A;  3M6G A;  3O1W A;  4IZ9 A;  4BVO A;  4B1X B;  3WXJ A;  4EAH D;  1EQY A;  4PKH A;  4BC4 A;  1NWK A;  1HKB A;  4BQZ A;  4H5R A;  2A42 A;  1Z6R A;  3O5B A;  5EY4 A;  5AQG A;  4K43 A;  2P9P A;  2QWM A;  3KHY A;  3GOI A;  2Q2R A;  3EKS A;  1YUW A;  1BOT O;  5EX5 A;  4BRL A;  1S22 A;  1HKG A;  4RCH A;  2Q97 A;  4WYB A;  4BRK A;  4CD3 A;  3RSE B;  5AFU A;  3ZX3 A;  3B8A X;  4JD2 A;  2P9U A;  1QQM A;  2ZWH A;  3WEE A;  2E2N A;  1V4S A;  3S41 A;  2P9S B;  5AQR A;  5AQP A;  1TYQ A;  4Z94 A;  1HJO A;  3QB0 A;  4CZM A;  5AZI B;  1DEJ A;  2YHY A;  4BR4 A;  3MDQ A;  5F0X A;  3C7N A;  4LC9 B;  4CBW A;  1X3M A;  2ITM A;  3MN7 A;  3BF3 A;  3C0B A;  3U8X A;  4JHD B;  3MK6 A;  3GG4 A;  5AQK A;  4O8K A;  4BC5 A;  4EIA A;  1NGG A;  4PL7 A;  2V7Y A;  3LDN A;  2A41 A;  4CZJ A;  4BRF A;  2D1K A;  3VF4 A;  4FWP A;  4BRG A;  1Q18 A;  2P9N B;  4E1J A;  5JMV A;  3AAQ A;  4BRP A;  2BUP A;  4MO5 A;  4GNI A;  1MWM A;  4BRN A;  4A2A A;  5B8H A;  2QXL A;  3WT0 A;  3ZET B;  4DHY A;  2CGL A;  2E2Q A;  3MMV A;  3FLC O;  1XQS C;  3LM2 A;  3O1B A;  1U2V B;  2QWO A;  2HF3 A;  3VGK A;  3U9Z A;  5AQV A;  3U4L A;  5AQF A;  4H0P A;  1E4F T;  5AQS A;  1ATR A;  4YDU A;  5AQM A;  1BO5 O;  3L6Q A;  2GTD A;  4B9Q A;  5I9E B;  4BVP A;  5CE3 A;  4M63 C;  5TKY A;  3QIC A;  2NRH A;  3WXI A;  3LDO A;  5EVZ A;  3FE1 A;  4BR7 A;  3HM8 A;  4CZK A;  3QML A;  5BPN A;  4PKG A;  1NGH A;  1YXQ A;  4FWS A;  3I8B A;  2GWJ A;  4I6M A;  5KQD A;  3H1V X;  3QFU A;  1NGE A;  5BR9 A;  3D2E B;  1NGC A;  2P9L B;  2FXU A;  3H3N O;  4K41 A;  1K8K B;  3VEZ A;  2A40 A;  2H3G X;  2VWB A;  4QS9 A;  3VEY A;  4DCH A;  2P9K A;  3FR0 A;  4CZF A;  4FSV A;  3R8E A;  4BRQ A;  4DQ8 A;  2E2O A;  3EKU A;  1NGI A;  3H45 C;  1BUP A;  5BRD A;  1LCU A;  3W0L A;  1OKJ A;  4CZI A;  4H5W A;  4BGB A;  3WQT A;  5E84 A;  1QZ5 A;  1JCF A;  3P4I A;  4BG8 A;  2Q0U A;  5AR0 A;  5FPM A;  3VPZ A;  1LOT B;  5BPM A;  3A5M C;  1D4X A;  3L0Q A;  5ADX A;  1XUP O;  1ATS A;  1IJJ A;  5AQW A;  5KPZ A;  2IVO A;  3FGU A;  4CBX A;  2QW9 A;  2NLX A;  1DKG D;  1GLL O;  3R9P A;  3VET A;  1TUU A;  2AA4 A;  3LDL A;  1P8Z A;  3D2F B;  3IMX A;  3VGL A;  3AAR A;  4BRH A;  4XH1 A;  1C0G A;  1HPM A;  3F9M A;  2KHO A;  3DXK B;  3FFK B;  3A5O C;  4B1V A;  4H0V B;  4B1Y B;  1NGA A;  3L4I A;  4H5V A;  3O6W A;  1KXP A;  5LY3 A;  5FPE A;  4FWO A;  3RSE A;  3UKU B;  4FWK A;  2V52 B;  3CJ1 A;  5ADX H;  2F9W A;  4H5N A;  3CJB A;  1QQO A;  3CQY A;  1BG3 A;  2YJF A;  3IFR A;  3M3Z A;  2FSK A;  4AM6 A;  2YHX A;  2GUP A;  4MO4 A;  2P9S A;  4WQ5 C;  3VEO A;  1R59 O;  3UE5 A;  1SAZ A;  4BRO A;  3MCP A;  1G99 A;  1J6Z A;  2GEL A;  3SLC A;  3A5N C;  2P9I B;  4XEI A; 
#chains in the Genus database with same CATH topology
 3A2F A;  4A5B A;  4DSE A;  1N5Y A;  1KAX A;  4JKG B;  4NCA A;  3AVF A;  5JLF A;  3B6P A;  3PSF A;  3SV3 A;  4FJ7 A;  3ZT4 A;  1RDC A;  2ASO A;  4GKK K;  4OPA A;  5AQQ A;  4ICL A;  4YOR A;  3WEE B;  2HHQ A;  2D4W A;  1T3V A;  1P90 A;  1GOB A;  5M1K A;  2QWP A;  3LP0 A;  1L3V A;  4EHU A;  2NRW A;  1U2V A;  2HHX A;  4CZH A;  3U3G A;  5JVG L;  3EYZ A;  1KFD A;  1ESV A;  3TAG A;  4BWJ A;  2PBD A;  3SMP A;  5AZJ A;  2FSJ A;  4NYN A;  1NMN A;  1TKZ A;  4GVM A;  4J2A A;  4FCY A;  4CHP A;  1YJ9 N;  1FJG K;  4FWM A;  1S3X A;  5AQL A;  4E1N A;  1CXU A;  3SV4 A;  4FK4 A;  4V19 S;  3T1H K;  1NK5 A;  4E3S A;  3FZH A;  3ZSQ A;  4JKF A;  5T7B A;  3SAF A;  2JLE A;  2IVP A;  4FO0 A;  2GWK A;  4GY2 B;  4JV5 K;  2X74 A;  3ZCM A;  2OA8 A;  2YNH A;  4M3Y A;  3CER A;  4JKC A;  3NGZ A;  2B4J A;  4CF9 A;  3H3O B;  3HI0 A;  5SWM A;  4YNQ A;  4FK0 A;  1RBV A;  3CD6 N;  4DV6 K;  2A3Z A;  4NO7 A;  4Z4H A;  2X6N A;  2EWS A;  5DMR A;  4C8N A;  4CJU A;  2FLO A;  4DUZ K;  2ZGZ A;  2I5J A;  3F73 A;  3CCQ N;  1K73 O;  3WQU A;  1V4T A;  3CJ7 A;  1LV5 A;  3O08 A;  5J2M A;  1C0F A;  4CZG A;  1M90 O;  3CMA N;  3JXU A;  4CES A;  5J1E A;  3QEV A;  3W3D A;  4IFY A;  1D8Y A;  2D0A A;  1BA1 A;  5AQO A;  3MN5 A;  5CY4 A;  4HCC A;  2O8D B;  3AAP A;  1XNQ K;  3G6E N;  2G8U A;  1IH7 A;  1GLJ O;  4M3W A;  1NK8 A;  3O4Q A;  3G4S N;  1IBK K;  4Z4G A;  4CW7 B;  1TAQ A;  2VQE K;  2VG6 A;  4NCB A;  3MX5 A;  3K5N A;  3KTQ A;  4JK7 A;  4BRA A;  4DU4 A;  4X62 K;  4JI8 K;  3CM6 A;  1NOY A;  1T05 A;  1RBS A;  1E3M A;  2QM1 A;  2IIR A;  2HHW A;  4DR2 K;  1QHA A;  3L2U A;  3V4I A;  1U48 A;  1JL1 A;  3ZYY X;  3VA0 A;  4JKE A;  2RF2 A;  3MXM A;  4B9S A;  1HRH A;  3DOL A;  1SUQ A;  5ELZ A;  2G8K A;  4JHD A;  1Z05 A;  2G8H A;  4ISF A;  5IWA K;  2P9U B;  1X9J A;  5HRR A;  1NMD A;  1NU0 A;  3NVM A;  4IJN A;  5JS2 A;  3CC7 N;  4PL8 A;  3DOK A;  4LF9 K;  1RT3 A;  3KD5 E;  3QET A;  4FWN A;  4CZL A;  1QQC A;  4Q5V A;  3ATU A;  3PUF A;  1RDW X;  4J2E A;  3DLG A;  4H0Y B;  4DU3 A;  1TL3 A;  1D9D A;  4CF1 A;  4FK2 A;  3HST B;  3AVA A;  4A2B A;  4DV0 K;  4B3M K;  2KFZ A;  4MQ3 A;  2UU9 K;  4DR6 K;  4B1U B;  3GDQ A;  3VEX A;  1TVR A;  4BRE A;  1EWQ A;  2O4G A;  4H0X B;  4CZE A;  1U04 A;  1UOC A;  3H1Q A;  2IAJ A;  2YV0 X;  1XMO K;  3BZK A;  3DJC A;  3KD1 E;  5LMN K;  3V9U A;  1KAZ A;  1HQU A;  5JVH L;  4KTW A;  3Q7C A;  5AQI A;  3FZK A;  1IG8 A;  5MLC Q;  2DTU A;  2UUA K;  1KD1 O;  4JK8 A;  4BR5 A;  4W5N A;  1EX4 A;  1KRP A;  1VHX A;  2WFB A;  4FL9 A;  4M7X A;  3V9W A;  3QFP A;  1NGF A;  1XHX A;  2RPI A;  1T7P A;  2VWK A;  4PHT X;  4CVN E;  2GV9 A;  1RTD A;  3ZSO A;  4BEB A;  2OTJ N;  4H0O A;  4JRP A;  2UXD K;  1KSP A;  3CET A;  1Z25 A;  1SZ2 A;  3NF6 A;  1REV A;  1DGK N;  4OPJ A;  4JI7 K;  1IKV A;  3SYZ A;  1E4G T;  3H6E A;  2BE2 A;  5F2R A;  4DQP A;  1XWL A;  5C10 A;  3O80 A;  3T19 A;  3QIP A;  3M6G A;  2RHK A;  4IZ9 A;  3LAN A;  5KRS A;  3L4Q A;  4FZX C;  4G9Z A;  3L2R A;  1IKY A;  3KLG A;  4LH4 A;  4H5R A;  4BQZ A;  4M42 A;  1Z6R A;  1WSG A;  3FFI A;  3MED A;  4KPY A;  5AQG A;  3KHY A;  1BIS A;  5CYM A;  5EX5 A;  4F2R A;  1HKG A;  1I39 A;  1VQ5 N;  4R5P A;  2Q97 A;  3IS9 A;  4CD3 A;  3RSE B;  3ZX3 A;  3B8A X;  3I8D A;  1X9M A;  4K0K K;  2P9U A;  1QQM A;  5FDL A;  1M1K O;  2BDP A;  5C42 A;  1W0H A;  4IOX A;  4ILH A;  2AJQ A;  2P9S B;  2UUB K;  4OPK A;  4Z94 A;  4DR1 K;  1KLN A;  2OPQ A;  3K5L A;  4DV5 K;  5CYQ A;  3TAE A;  4CJS A;  1HNV A;  4CBW A;  3N4P A;  3U8X A;  1ASW A;  4GV3 A;  4BC5 A;  4FJI A;  2OCE A;  4I9Q A;  4PQU A;  4WE1 A;  3QIO A;  4OX9 K;  2A41 A;  3J7Y P;  1CZ9 A;  4MFB A;  3I0S A;  2P9N B;  4W5O A;  4JI6 K;  3QLH A;  4MO5 A;  1TKX A;  2HVI A;  2QXL A;  1NJW A;  3QNO A;  3KKR A;  2E2Q A;  4CEF A;  1B9D A;  3OBW A;  3THV A;  3NCI A;  3AVH A;  4CIF A;  3VGK A;  3PSI A;  1WB9 A;  1O13 A;  1NJZ A;  4O0I A;  5I3U A;  4YDU A;  4B9Q A;  1IV0 A;  4KRF A;  3LDS A;  4DQR A;  1JLC A;  4M63 C;  2NNW A;  3MEC A;  5DM7 L;  2NRT A;  3L3V A;  3P1G A;  2NRH A;  1SKR A;  1R0A A;  1S1T A;  4DSJ A;  4CGI A;  3ZSX A;  1IKX A;  3VQ6 A;  3HRG A;  5KQD A;  1YF5 L;  1HYZ A;  1RBR A;  4N5S A;  3RRG A;  3MEE A;  3D2E B;  1S6P A;  1NGC A;  2Z1J A;  4DTO A;  1K8K B;  4CJQ A;  2A40 A;  2KW4 A;  4CF2 A;  2VWB A;  3C6T A;  4DCH A;  3NDK A;  4CGF A;  1VSE A;  4FSV A;  3SBT A;  3R8E A;  4E7L A;  1K8A O;  2E2O A;  5BRD A;  3V81 A;  4HHT A;  4RW4 A;  1QZ5 A;  3ZT1 A;  1JCF A;  3J7Z O;  4BEC A;  5FRM A;  3P4I A;  1J5E K;  1KVC A;  5AR0 A;  5FPM A;  1X9W A;  4FJJ A;  1YT3 A;  4PY5 A;  5BPM A;  3A5M C;  4H8K A;  5A2Q O;  3VQD A;  5ADX A;  1ATS A;  2VWJ A;  4F3T A;  2IVO A;  2QW9 A;  2NLX A;  1NK6 A;  2KQ2 A;  3CPE A;  2Z1H A;  2PYL A;  3HPH A;  2VGN A;  3IMX A;  4Q0B A;  3TAN A;  3SUQ A;  4CJV A;  4XH1 A;  4MDA A;  4GV9 A;  2KHO A;  3FFK B;  4CJW A;  3KK3 A;  4B1Y B;  1NGA A;  4IFE A;  3L4I A;  1KXP A;  5LY3 A;  2O4I A;  4BE0 A;  1VK0 A;  1KTQ A;  3RSE A;  1VSD A;  4FWK A;  5ADX H;  3CJ1 A;  1GOA A;  3IFR A;  4FW1 A;  2FSK A;  4FYD A;  5GIP A;  1TL1 A;  5C12 A;  2P9S A;  3AVJ A;  1KC8 O;  1R59 O;  4JI4 K;  4KHW A;  1SAZ A;  3DLK A;  3IKM A;  1G15 A;  2GEL A;  4CJK A;  3AY9 A;  3A5N C;  3FLC O;  4XEI A;  4WQ4 A;  2YHW A;  2I7N A;  2E6M A;  1RBT A;  1I94 K;  3ZEU B;  4CEB A;  3CC4 N;  3OW2 M;  5M1O A;  1VQ9 N;  4JD2 B;  4E7J A;  2P9N A;  3AVM A;  5M1P A;  3SQ2 A;  3BEX A;  3G71 N;  3ZX0 A;  2DFE A;  2X78 A;  1GLB G;  4CK2 A;  3TTF A;  4E19 A;  4WF9 L;  1X1P A;  5F1X A;  3KIO A;  3LAK A;  4C23 A;  4NB4 A;  4OO1 J;  3TAM A;  4B1W B;  3P5J A;  4YOY A;  5I42 A;  3VOV A;  3VEN A;  3HTV A;  2XY8 A;  4AF1 A;  3SAH A;  4UQG A;  1A5W A;  1QE1 A;  4QS7 A;  2VYP A;  1RNH A;  5LL6 Z;  4DV3 K;  3AVG A;  4LD0 A;  4B3O A;  2QWQ A;  2AP1 A;  2BAN A;  4JKH A;  3G10 A;  4CI6 A;  4YOX A;  4ELT A;  4DTP A;  1NGD A;  3CFO A;  4M3R A;  1SL1 A;  3MN6 A;  1OVQ A;  3OHR A;  2LSN A;  3PO4 A;  4DFM A;  1VQ7 N;  4E1M A;  1TK8 A;  3GE1 A;  1DLO A;  2E1Z A;  4EHT A;  4HCB A;  4RW8 A;  3NF9 A;  1YI2 N;  1A5X A;  4PKI A;  1K8K A;  1KFS A;  5D3G A;  3NFA A;  1WN7 A;  4FM2 A;  3CFP A;  2UYT A;  1ASU A;  1J9A A;  2YJE A;  2E1Y A;  3K9J A;  3PLA A;  3EZ5 A;  3M8R A;  1XI1 A;  4G1Q A;  3DRS A;  4BRI A;  4FJ8 A;  1RGI A;  4JI0 K;  2PY5 A;  1VQM N;  3ZT2 A;  5C2F A;  3G0Z A;  1NOZ A;  2GEM A;  4ISE A;  3DLH A;  4IWV A;  4K42 A;  4KI6 A;  1FKO A;  3VMF B;  4A62 A;  4IJA A;  2HND A;  4CER A;  4DTS A;  3E1Y A;  4IXC A;  3NGY A;  4BC3 A;  2E5L K;  1TUY A;  5BN8 A;  4CF0 A;  4FVM A;  5AQU A;  3SPY A;  2XY7 A;  2CH5 A;  4GV6 A;  4L3Q A;  2RE2 A;  4DTR A;  3OYN A;  1EP4 A;  1Q81 O;  1YVN A;  3EN9 A;  3CM5 A;  3TSU A;  2VCP A;  5LJW A;  4IKF A;  1JLE A;  1S1X A;  3O8M A;  4FWR A;  3RTV A;  4OKE A;  3TPQ A;  3DAW A;  1VSH A;  2ZGY A;  1L3U A;  4FLZ A;  1NG9 A;  2YI1 A;  3SUN A;  4CJP A;  4M3X A;  3AVN A;  3V1O A;  3F5T A;  4KBO A;  1H1V A;  5J2N A;  3IUC A;  3OBY A;  2ZE2 A;  4N47 A;  1L3T A;  1QSS A;  1ATN A;  4PA1 A;  4EP4 A;  3PX6 A;  2ZM6 K;  2Y1J A;  4B3S K;  4O44 A;  3ZEU A;  4AHV A;  5FPD A;  4KB1 A;  4DSI A;  3EZW A;  1U49 A;  1BQN A;  4Y1D A;  4DB3 A;  4FZY A;  5LJV A;  1JKH A;  4I2P A;  2VGM A;  4DR5 K;  1ZBF A;  2HOE A;  2GUI A;  1VSK A;  3L8B A;  3ENH A;  3HXM A;  5C15 A;  1XC9 A;  4FJ5 A;  3HVR A;  2KZZ A;  4LFC K;  1ASV A;  2FBX A;  5KI6 A;  3AO1 A;  4CHO A;  1XMQ K;  3KWG A;  1HUX A;  1VRT A;  4BQL A;  1WSJ A;  4FJN A;  2DPN A;  1RT7 A;  2G8V A;  5FPN A;  2YHB A;  1ILY A;  3MN9 A;  4ELU A;  1KVA A;  3O3H A;  4ID1 A;  3VQ7 A;  4DV1 K;  1D9F A;  2HHU A;  2B5J A;  1OH6 A;  3KVG A;  4J2B A;  3OYC A;  3ATV A;  4A61 A;  3S5T A;  4B9U A;  5CZ1 A;  4BR2 A;  2G8W A;  4AM7 A;  4IDH A;  2W00 A;  3RR8 A;  1TKT A;  3M5R A;  1BIZ A;  3KZB A;  1VQ6 N;  4DSL A;  4OKJ A;  2XY5 A;  1CXQ A;  3V1Q A;  1C1B A;  5CR4 A;  2Q3S A;  2HBK A;  4CFC A;  2YKM A;  2OAN A;  1JCG A;  3VTH A;  2W40 A;  1IKW A;  4UY8 O;  3TAP A;  2HMP A;  2RKI A;  4ELV A;  1B9F A;  1C1A A;  4IFV A;  4FJH A;  4YOT A;  1HKC A;  2CH6 A;  4CFA A;  4BE7 B;  3OYI A;  5KPT A;  3O3F A;  4BDZ A;  3QBX A;  3CYG A;  3ULE B;  4WFB L;  4FJK A;  1GLC G;  3EE9 A;  4YHH K;  3KK1 A;  1OVY A;  2HHH K;  4C8O A;  1X3N A;  4YOW A;  3M8S A;  3THX B;  4I9L A;  3EL2 A;  4LF7 K;  3D2F A;  3A5L C;  5KPR A;  2E2P A;  2HBJ A;  5SZT A;  3TAR A;  4C8M A;  2P9K B;  5C2D A;  4LF8 K;  2NRV A;  2IOC A;  3J81 O;  5JIC A;  4HVJ A;  1N33 K;  3IG1 A;  4DKW A;  3U6F A;  1QQN A;  4M41 A;  4BAC A;  4MLH A;  4JNE A;  3LDQ A;  1RDD A;  1ZBU A;  4MDB A;  3VEV A;  3O1W A;  4B1X B;  3ZSY A;  1EQY A;  1VSJ A;  4Y1C A;  3O4N A;  4LH5 A;  4C1N K;  4CED A;  3QES A;  1RT4 A;  4DR7 K;  1SL0 A;  3O5B A;  1LWE A;  4JKG A;  3GOI A;  2HVH A;  1BOT O;  4CGJ A;  3WNG A;  3KLE A;  4E7K A;  4RCH A;  4DQQ A;  1OH7 A;  5FLX O;  1VRU A;  1LWF A;  4DV2 K;  4CHZ A;  5TKW A;  2F8T A;  2UUC K;  3V6D A;  3WEE A;  1EWR A;  1V4S A;  3S41 A;  3MCA B;  4LY7 A;  3OYH A;  1HJO A;  4W5T A;  4F3O A;  5AZI B;  3NHG A;  2YHY A;  3PO5 A;  4DV7 K;  4CHN A;  3MEG A;  1SL2 A;  1VSL A;  3MN7 A;  2ITM A;  3QEI A;  1F21 A;  3SUP A;  5DM6 L;  1EXQ A;  3GG4 A;  2KZM A;  1HNI A;  2KLA A;  1NGG A;  4BE1 A;  2V7Y A;  3LDN A;  1VQ4 N;  1JXB A;  1L5U A;  1FK9 A;  1Q18 A;  2WC9 A;  3MWT A;  4BRG A;  5JMV A;  3AA5 X;  4KAZ A;  2BUP A;  4IDK A;  4C8K A;  3QIN A;  1C0U A;  4AQY K;  4L8R B;  5B8H A;  3WT0 A;  4CF8 A;  3ZET B;  2CGL A;  4JKD A;  4U7B A;  3MMV A;  3SAG A;  3UIQ A;  1W9H A;  4DLG A;  3VQ4 A;  3O1B A;  4DTX A;  1RIL A;  2QWO A;  1VSF A;  2XRI A;  4ILJ A;  1JJ2 M;  4KO0 A;  3U9Z A;  3CXC M;  4AHS A;  5AQF A;  4H0P A;  1E4F T;  1C0M A;  5AQS A;  3T69 A;  1HJR A;  2NRZ A;  3L6Q A;  5CE3 A;  5C0Y A;  4ID5 A;  3SJJ A;  1NK9 A;  3K0S A;  1OH8 A;  3LDO A;  2FBT A;  4BDP A;  1EO1 A;  2R7Y A;  4BDY A;  5BPN A;  4FWS A;  3I8B A;  4DS4 A;  2GWJ A;  3E9P A;  3SQ1 A;  3AVL A;  3S3N A;  1ZBL A;  5KRT A;  1S6Q A;  3KKS A;  1QVF M;  1UWB A;  3F9K A;  3THX A;  3RMB A;  3ZLJ A;  3HOT A;  4LF6 K;  2H3G X;  4QS9 A;  2O8D A;  4YOV A;  2P9K A;  3RR7 A;  1BI4 B;  4DQ8 A;  1NGI A;  3EKU A;  4YFU A;  1BUP A;  3OYD A;  3W0L A;  3K58 A;  4CZI A;  4H5W A;  3VQ9 A;  3DRR A;  2ZQB A;  3S3M A;  3D6R A;  2ZD1 A;  3NE6 A;  2Q0U A;  3VPZ A;  3L0Q A;  3NAE A;  3CQ8 A;  1XUP O;  4DUY K;  1IJJ A;  1N6Q A;  5AQW A;  1GOC A;  3FGU A;  1DKG D;  3CF5 L;  4IG0 A;  2AA4 A;  3LDL A;  1WBB A;  2NRR A;  3VGL A;  4N76 A;  4O4G A;  4BRH A;  5GIO A;  3L2W A;  4CJL A;  4LFA K;  1HPM A;  3DXK B;  2OPS A;  4DMN A;  3A5O C;  4HTU A;  4B1V A;  4H5V A;  3KWI A;  2HHV A;  4BWM A;  4FLW A;  3I0R A;  1QS4 A;  2V52 B;  4DR3 K;  1QQO A;  4OGE A;  3CCJ N;  2YHX A;  4MO4 A;  4WQ5 C;  2A1R A;  3BZC A;  3DMJ A;  3DLL L;  4CEC A;  3ITH A;  4BRO A;  3SZ2 A;  2YX6 A;  2P9I B;  1Q8I A;  4NCG A;  4O55 A;  3HZ6 A;  4LFB K;  2GBZ A;  1LAW A;  5BRH A;  1DT9 A;  3OS1 A;  4DTM A;  4F2S A;  1RFQ A;  1ZXO A;  2HB5 A;  4ZTJ A;  1D5A A;  2B6A A;  2QEX N;  2D0P A;  4AHU A;  3LWM A;  4B9N A;  4J8F A;  1EKE A;  3UKR B;  4RTF D;  4DF4 A;  4B3R K;  4W5R A;  1SS6 A;  4DSF A;  3OYL A;  3RRH A;  3CJ9 A;  3ISN C;  4FLX A;  2ASM A;  1T44 A;  1S9E A;  1LW0 A;  3ZET A;  2J4R A;  3IDH A;  4C1N I;  1HLU A;  5BR8 K;  4DQI A;  4BGA A;  2W42 A;  5EXW A;  2BH1 A;  1TAU A;  5IT9 O;  5C25 A;  3HSC A;  1QSL A;  3LAL A;  1ZBS A;  2WBN A;  1CZB A;  2HBL A;  1BA0 A;  2YKN A;  1NK4 A;  2JWL A;  4MLE A;  1Y64 A;  4FJX A;  1J53 A;  2IS3 A;  3O9S A;  1WSI A;  3VF6 A;  2V51 B;  3DLB A;  1HYS A;  3TTC A;  4GVE A;  3OYJ A;  1RT6 A;  4CK1 A;  3D0P A;  1IG9 A;  3WNF A;  4KHU A;  1IBL K;  3VQQ A;  4H5T A;  4A5A A;  2G8I A;  4M45 A;  3U9D A;  3CCV N;  3TAF A;  4KFB A;  5C24 A;  4DTU A;  1J5O A;  3ID8 A;  4GKJ K;  2OPP A;  2W41 A;  4FOE A;  4H4O A;  4BRM A;  3CCU N;  1BU6 O;  3D7E O;  3K2P A;  3R6M A;  1VQP N;  3F2K A;  1U45 A;  1Q82 O;  3K5O A;  3A0I X;  3DXM B;  3CCM N;  2NZT A;  5GAE P;  3OYF A;  4JAX A;  4FLU A;  4BR9 A;  4AH9 A;  4CHY A;  2F96 A;  3CQX A;  4QOZ B;  3LDP A;  2CGJ A;  4CEA A;  5HRN A;  1TK5 A;  4XH4 A;  3ENB A;  3PX0 A;  4OLB A;  1BQM A;  2O8F B;  1JLG A;  3KJV A;  4DS5 A;  3VQA A;  3J8A A;  1TGO A;  4A59 A;  4NLC A;  3MWP A;  3DLR A;  4KI4 A;  1GLF O;  2FBY A;  3MXI A;  2O8E B;  2QWR A;  4X64 K;  4DLE A;  1NKE A;  2E6L A;  4KH6 A;  3T1Y K;  4JI5 K;  3EO3 A;  4KTQ A;  3VEW A;  4AHC A;  3K9K A;  1J54 A;  5GAD P;  1NJI O;  3RWU A;  1U47 A;  3T7Z A;  4Z0U A;  3UB5 A;  2P9I A;  2F4V K;  3I33 A;  1T6D A;  3TWH A;  5E26 A;  2C1G A;  4QS8 A;  3CI5 A;  4LSL A;  1WSF A;  4BR0 A;  4CJT A;  5BRE A;  2FC0 A;  4KHS A;  3CIP A;  4FW2 A;  4IO8 A;  3UKR A;  4JS4 A;  4HUG A;  3KLI A;  3SUO A;  3VQ5 A;  1VSM A;  1C1C A;  3AVC A;  3TTD A;  3E9L A;  2A5X A;  1HR0 K;  2HF4 A;  4CJ7 A;  1BL3 A;  2Q0R A;  4M3Z A;  2WUS A;  1BDG A;  2E88 A;  4IOA L;  3BY5 A;  4FPA A;  3OYG A;  4BC2 A;  3M1F A;  4KKO A;  3CHW A;  4IO9 L;  2ITG A;  4EFH A;  1FKP A;  1HPZ A;  2YNI A;  3TI0 A;  5AFU H;  2CGK A;  3ZX2 A;  4KH5 A;  5EOY A;  2OYQ A;  4H4M A;  2ASP A;  3TSQ A;  4E7I A;  2P5G A;  2Q31 A;  3JAM O;  4K25 A;  4NLB A;  2KKZ A;  4IOC L;  5JS1 A;  3DWL A;  3AVI A;  4CGD A;  4RWT A;  4JN4 A;  3O3G A;  3H46 O;  1S72 N;  4B9V A;  3E9O A;  4AIL C;  4XIU A;  1U6Z A;  5AQY A;  2QWN A;  3D2E A;  4TSX A;  1UA0 A;  4HWI A;  4KB0 A;  1SQK A;  3ALY A;  3SMS A;  5AZJ B;  3VES A;  3K59 A;  3KK2 A;  3O4W A;  1RT1 A;  3AVK A;  1W7A A;  4FWL A;  3CJC A;  4IG3 A;  1MWK A;  4FJM A;  5BPL A;  2QA4 N;  3OS2 A;  3DXM A;  1TV6 A;  3OVN A;  3L3U A;  4KHP K;  4AHT A;  1W2B M;  3WXM B;  1NK0 A;  4Z4I A;  1JCE A;  1GLE G;  4RG8 A;  1BWF O;  1WOQ A;  4M7Y A;  3BF1 A;  1N32 K;  2FF6 A;  2PZS A;  1WUA A;  1CLQ A;  1QZ6 A;  3HP9 A;  1C6V A;  1WAF A;  3V1R A;  5CHI A;  2WOM A;  4C8L A;  2V7Z A;  5AQJ A;  3QO9 A;  2O8E A;  3B6O A;  4CBU A;  4DF8 A;  4OKK A;  3CFR A;  1GLA G;  4EZ9 A;  3E66 A;  5KGX A;  5BN9 A;  4JS5 A;  3EY1 A;  1NGB A;  5GAG P;  3HK2 A;  4CEO A;  4PKH A;  2O8B B;  4LSN A;  4BC4 A;  1HKB A;  3HP6 A;  3T3F A;  4GMJ B;  4CJ4 A;  1T03 A;  4B9T A;  3AA2 A;  1VQK N;  1X9S A;  2Q2R A;  1YUW A;  3EKS A;  2YNF A;  4Z4E A;  1NNE A;  3QER A;  4LF4 K;  3KK7 A;  4Z4F A;  1IBM K;  5LMU K;  4JD2 A;  3LWL A;  4CIE A;  3CME N;  1RCH A;  2ZWH A;  2E2N A;  4DSK A;  1U4B A;  5AQR A;  4ILG B;  2GX9 A;  2X6S A;  5AQP A;  2VQF K;  3BGR A;  4O8U A;  2VG5 A;  4FZZ A;  4DWI A;  3MDQ A;  5F0X A;  4LC9 B;  1X3M A;  1BHL A;  1RTI A;  4DFJ A;  4JHD B;  3DI6 A;  5JEN A;  5AQK A;  4EIA A;  3V9X A;  3NMU A;  4W5Q A;  3OTO K;  3H08 A;  3PIO L;  5J2Q A;  1YHQ N;  4KV8 A;  3VF4 A;  4FWP A;  2ZJR L;  4BRN A;  4GNI A;  1MWM A;  4CJ5 A;  5GAH P;  4E72 A;  1S1V A;  3M8P A;  3LAM A;  4B3T K;  1NJY A;  1QTM A;  3LM2 A;  3NGI A;  4BE2 A;  1RDA A;  3WNH A;  2HF3 A;  2D0C A;  5FRN A;  3U3Y A;  3ASM A;  2WON A;  3VA3 A;  3VQ8 A;  1VSI A;  4HUE A;  1HNX K;  1KQS M;  5HLF A;  1LW2 A;  3ZSW A;  3FE1 A;  3HM8 A;  3QML A;  4PKG A;  1NGH A;  1YXQ A;  3TAB A;  2KFN A;  4WCE L;  2YNG A;  1NGE A;  2P5O A;  4CHQ A;  1JLA A;  2P9L B;  1Q9Y A;  2FXU A;  4HUF A;  4K41 A;  3VEZ A;  1FXX A;  3DLE A;  3AGK A;  3HPO A;  4DTJ A;  4N41 A;  2VG7 A;  3VEY A;  5M1N A;  3NH2 A;  5K14 A;  3FR0 A;  4CZF A;  3ZSR A;  4FM1 A;  3AO3 A;  2HST A;  1LCU A;  3NVK A;  4BGB A;  3WQT A;  3S3O A;  5AJ3 K;  2P1J A;  5M1F A;  4BG8 A;  2Y1I A;  4CFB A;  4FJ9 A;  4DFP A;  1LAV A;  5FRO A;  3SCX A;  3VN5 A;  2WTU A;  1VAZ A;  3R9P A;  3VET A;  2O8B A;  1TUU A;  3T1A A;  3ID6 A;  1S9G A;  3O9R A;  4N56 A;  3SQ0 A;  1XHZ A;  3AAR A;  4CJF A;  5GIN A;  1NJX A;  3AA4 A;  3SBG A;  3F9M A;  4YOU A;  4DQS A;  4H0V B;  3O6W A;  5FPE A;  2QKB A;  4FWO A;  3UKU B;  1S1U A;  4H5N A;  3TSP A;  1IO2 A;  3CQY A;  3OYK A;  2O8C B;  2YJF A;  3M3Z A;  2HHI A;  3JSM A;  1ZBI A;  3OJU A;  1WLJ A;  4JKB A;  3UE5 A;  3DRP A;  2F7T A;  1NK7 A;  3MCP A;  1KVB A;  1UA1 A;  2FSN A;  2Z1G A;  3FZL A;  4M3U A;  2I7P A;  1NKB A;  3O9U A;  4IEI A;  2JGU A;  3FZM A;  3LM9 A;  5AQT A;  4WFN L;  1RTH A;  4BG9 A;  4JI1 K;  3VTI A;  1ZC6 A;  3RMA A;  3OS0 A;  5CZ2 A;  4OJR A;  1WBD A;  3CYM A;  1O1W A;  4KHQ A;  2YHA A;  4ISG A;  1VQN N;  3VQB A;  3ENO A;  2JWK A;  3HPG A;  3WXK A;  2Q1N A;  2ETJ A;  3BDP A;  1GLD G;  4KHY A;  3SJH A;  1JL2 A;  4O5F A;  1YIJ N;  3WNE A;  3AO4 A;  4I2Q A;  3HL8 A;  3A8Y A;  4I7F A;  2DFF A;  2HNZ A;  4IEE A;  4BRD A;  4CCH A;  4BRC A;  2OZS A;  1QHT A;  4FLV A;  3BUZ B;  3CCL N;  1SV5 A;  5HP1 A;  3JYT A;  4FXD A;  3FZF A;  3RVC A;  1JLB A;  2A6A A;  3LL3 A;  1YAG A;  3P38 A;  3CPW M;  4CK3 A;  3SI6 A;  4FWQ A;  2EHG A;  3N4Q A;  3OYE A;  2FF3 B;  3ULE A;  1N8R O;  4CEE A;  1HNZ K;  2E20 A;  3HBT A;  3L2V A;  2PAV A;  4JI3 K;  1T8E A;  2P9L A;  5J2P A;  3THY B;  1FW6 A;  2OZM A;  1NKC A;  3MAQ A;  2F9T A;  2Q36 A;  3R1X A;  4B1Z A;  4PUO A;  3WUH A;  2F8S A;  5AQH A;  4XH5 A;  1WSE A;  4B8C A;  2ZJQ L;  2UXC K;  1XNR K;  2HHS A;  3HOS A;  3OY9 A;  1S5J A;  2W6L A;  4KRE A;  2XO7 A;  4CFD A;  2XY6 A;  4J2D A;  5M1Q A;  3GL1 A;  2BTF A;  2HHT A;  3RMD A;  4A57 A;  1SKW A;  3AO2 A;  3SQ4 A;  1HQE A;  3NF8 A;  1HYV A;  2E8A A;  1YTA A;  2RN2 A;  3BP8 A;  2ZF5 O;  1MU2 A;  3QBW A;  3UKU A;  3RMC A;  3C95 A;  2IGI A;  3I55 N;  2DY4 A;  1NBW A;  3EE8 A;  1NLV A;  3LP3 A;  2O8C A;  1B92 A;  5HRP A;  4Z4C A;  1KCF A;  4KHN A;  4Y0W A;  3TR8 A;  1KLM A;  2C1I A;  4FLT A;  3AVB A;  4ZTF A;  2IDO A;  5HRS A;  3C6A A;  3CG7 A;  4YDU C;  5AZI A;  3AGR A;  2D0O A;  3G25 A;  3HO1 A;  5JLH A;  4FPB A;  2QI2 A;  2P9P B;  3THW B;  4K8Z A;  1HX1 A;  5AQN A;  1MA9 B;  3GBT A;  3P39 A;  3I56 N;  1MDU B;  5KQ8 A;  1SKS A;  4CGH A;  2KTQ A;  3QEW A;  3QDK A;  4CJR A;  3AV9 A;  4AHR A;  1T6C A;  1RT5 A;  3LPU A;  4OVL A;  3CJA A;  4NXM K;  1YJN N;  4OPH A;  2G8F A;  4JRQ A;  1TYQ B;  1BIU A;  3VER A;  4DV4 K;  2IVN A;  2A1S A;  1N34 K;  3C6U A;  3QEP A;  1JLQ A;  3C7N B;  4JEP A;  5HBM A;  1KAY A;  3VF2 A;  3AO5 A;  5BRF A;  5DK5 A;  4JYA K;  3QEX A;  3R3L A;  4F9O A;  1ZBH A;  4QCL A;  4WFA L;  1VQO N;  4H03 B;  2QK9 A;  2UXB K;  3L2Q A;  3LZJ A;  4CEZ A;  3THY A;  3LP2 A;  2OTL N;  4DU1 A;  4WQ5 A;  1C0T A;  4HTL A;  3TAQ A;  2YCH A;  1RDU A;  3C65 A;  4B9M A;  3SNN A;  1Q9X A;  5AQX A;  3SK3 A;  2EX3 A;  2NRX A;  1BI4 A;  1OH5 A;  2QWL A;  3JS6 A;  1JLF A;  1LWC A;  1XC3 A;  4CE9 A;  1NGJ A;  1CZA N;  1HNW K;  2P51 A;  4B8A B;  4DFK A;  4K8X A;  4XJX A;  4WQ4 C;  4FOI A;  4I6M B;  3WXL A;  1BGX T;  3J7A P;  1Z26 A;  5HRO A;  4JKA A;  3TU5 A;  4B9L A;  2HMI A;  2W6K A;  4CD1 A;  4JK9 A;  3KLH A;  1NM1 A;  4CJE A;  3V9S A;  2D5R A;  1N36 K;  3DXK A;  3VGM A;  1W97 L;  3S9H A;  2FBV A;  3OYA A;  3MXJ A;  3IRX A;  4NXN K;  5EU7 A;  4JI2 K;  2HW3 A;  5AQZ A;  1Q7Y O;  3P83 D;  3NH0 A;  4O5B A;  3QNN A;  3DYA A;  4BVO A;  3WXJ A;  4EAH D;  3VQP A;  5KTQ A;  1YJW N;  3LZI A;  3ZT0 A;  1NWK A;  2QTD A;  4EZ6 A;  3LPT A;  2A42 A;  4OGC A;  2QKK A;  3D45 A;  1L3S A;  5EY4 A;  4DTN A;  4K43 A;  3AA3 A;  2E4L A;  2P9P A;  3THW A;  2QWM A;  3OJS A;  3HVT A;  4E7H A;  4BRL A;  3Q7B A;  1S22 A;  3K57 A;  4U67 L;  4WYB A;  4BRK A;  3DM2 A;  1WNS A;  5AFU A;  4O0J A;  3C6H A;  4E89 A;  4FM0 A;  2HNY A;  4F8R A;  2DFH A;  4PWD A;  2XHB A;  2ATQ A;  4EP5 A;  4R79 A;  2OPR A;  5E41 A;  1TYQ A;  3QB0 A;  4CZM A;  1I3A A;  3LP1 A;  3VQE A;  3PIP L;  1YIT N;  3ULD A;  4JLH A;  3MX2 A;  2PYJ A;  1DEJ A;  1HMV A;  4BR4 A;  3C7N A;  3CCR N;  4CEQ A;  3NH1 A;  3BF3 A;  3C0B A;  3CCS N;  3SPZ A;  1Q86 O;  3MK6 A;  4O8K A;  1EET A;  2HBM A;  3HM9 A;  4PL7 A;  4CZJ A;  1K6Y A;  4BRF A;  2D1K A;  4E1J A;  3AAQ A;  4BRP A;  4A2A A;  3HT3 A;  4RW6 A;  3PY8 A;  4DHY A;  3OYM A;  1BCO A;  1K9M O;  2QXF A;  3ZSV A;  1YTU A;  3HJF A;  1XQS C;  1U2V B;  4ZHR A;  1ZYQ A;  4DG1 A;  3IAY A;  1BCM A;  5AQV A;  3U4L A;  1TKD A;  4X65 K;  4E0D A;  1WSH A;  1TK0 A;  1ATR A;  2IC3 A;  5AQM A;  4B08 A;  1BO5 O;  2GTD A;  5I9E B;  4BVP A;  4FLY A;  5H1S Q;  5TKY A;  3QIC A;  4QAG A;  3WXI A;  4BY9 C;  4IBN A;  5EVZ A;  4BR7 A;  4CZK A;  4OLA A;  4I6M A;  4KH4 A;  1VQ8 N;  4YY3 K;  3H1V X;  3C94 A;  3QFU A;  5BR9 A;  4LF5 K;  3O9T A;  4NYF A;  3CC2 N;  1Y97 A;  4FVU A;  3H3N O;  2D0B A;  1RTJ A;  3M8Q A;  4RW9 A;  3V9Z A;  4CGG A;  1A5V A;  4KTZ A;  4BRQ A;  2O8F A;  3H45 C;  3ZSZ A;  3E01 A;  1OKJ A;  5E84 A;  1RT2 A;  3P31 A;  4F4K A;  1LOT B;  3NF7 A;  1VQL N;  2PFU A;  1D4X A;  3CCE N;  5KPZ A;  4CBX A;  2Z1I A;  1GLL O;  3K5M A;  1QVG M;  4RW7 A;  5HL7 L;  1P8Z A;  1WAJ A;  2NUB A;  3VQC A;  1QSY A;  3PV8 A;  4FJL A;  1YVU A;  3D2F B;  1ITG A;  3OYB A;  5HOO A;  3J80 O;  1C0G A;  4DR4 K;  4GW6 A;  1UAX A;  3PX4 A;  3ZT3 A;  1DTT A;  2BGG A;  3OA9 A;  4FJG A;  3KLF A;  2F9W A;  1DTQ A;  5KGW A;  3O9Q A;  3CJB A;  2ZJP L;  1BG3 A;  3HYF A;  4AM6 A;  4M3T A;  3VEO A;  2GUP A;  3NBP A;  1S1W A;  1RBU A;  4CJ3 A;  1JXE A;  1G99 A;  1J6Z A;  4X66 K;  4CIG A;  3SLC A;  1RDB A;  3EEQ A;  4H0T B; 
#chains in the Genus database with same CATH homology
 2FSN A;  3HZ6 A;  4WQ4 A;  2YHW A;  3FZL A;  4A5B A;  2I7N A;  5BRH A;  1DT9 A;  1RFQ A;  1ZXO A;  1KAX A;  4JKG B;  2I7P A;  2QEX N;  3O9U A;  4IEI A;  2D0P A;  3FZM A;  5JLF A;  3ZEU B;  3LM9 A;  5AQT A;  4WFN L;  3CC4 N;  4J8F A;  3OW2 M;  3UKR B;  4RTF D;  4BG9 A;  5M1O A;  1ZC6 A;  3VTI A;  1VQ9 N;  1SS6 A;  4JD2 B;  2ASO A;  2P9N A;  4OPA A;  5M1P A;  5AQQ A;  4YOR A;  2YX6 A;  3BEX A;  3CJ9 A;  3ZX0 A;  3G71 N;  3WEE B;  1GLB G;  2ASM A;  1T44 A;  3TTF A;  2D4W A;  4ISG A;  4WF9 L;  1VQN N;  1T3V A;  3ENO A;  2JWK A;  1P90 A;  3ZET A;  2J4R A;  5F1X A;  3IDH A;  4C1N I;  1HLU A;  3WXK A;  2QWP A;  2Q1N A;  4C23 A;  4NB4 A;  4EHU A;  5M1K A;  4OO1 J;  1GLD G;  2NRW A;  4BGA A;  3SJH A;  5EXW A;  4B1W B;  2BH1 A;  4O5F A;  4YOY A;  1YIJ N;  1U2V A;  3VOV A;  3VEN A;  3HTV A;  3SAH A;  4AF1 A;  3A8Y A;  3HSC A;  4CZH A;  4IEE A;  5JVG L;  4QS7 A;  4BRD A;  1ESV A;  1ZBS A;  4BRC A;  2VYP A;  3SMP A;  2PBD A;  2WBN A;  5AZJ A;  2FSJ A;  2HBL A;  1BA0 A;  3BUZ B;  2JWL A;  4MLE A;  1Y64 A;  3CCL N;  3O9S A;  2QWQ A;  1YJ9 N;  2AP1 A;  4FWM A;  4JKH A;  3VF6 A;  1S3X A;  3FZF A;  4CI6 A;  4YOX A;  5AQL A;  2V51 B;  3RVC A;  1NGD A;  2A6A A;  3LL3 A;  1YAG A;  3FZH A;  3TTC A;  3P38 A;  3MN6 A;  4GVE A;  4JKF A;  3CPW M;  3OHR A;  4FWQ A;  3SAF A;  1VQ7 N;  2IVP A;  3N4Q A;  1N8R O;  2FF3 B;  3ULE A;  4FO0 A;  2GWK A;  4GY2 B;  2E20 A;  3GE1 A;  3HBT A;  4H5T A;  4A5A A;  2E1Z A;  4EHT A;  2PAV A;  2P9L A;  3U9D A;  3CCV N;  1YI2 N;  4PKI A;  1K8K A;  3CER A;  4JKC A;  2F9T A;  2Q36 A;  3R1X A;  3H3O B;  3HI0 A;  2UYT A;  3ID8 A;  2YJE A;  4B1Z A;  2E1Y A;  3K9J A;  2W41 A;  4FOE A;  4BRM A;  3PLA A;  3WUH A;  3CCU N;  5AQH A;  3CD6 N;  2A3Z A;  4XH5 A;  4BRI A;  2ZJQ L;  4NO7 A;  1RGI A;  1BU6 O;  3D7E O;  2EWS A;  3R6M A;  1VQP N;  1VQM N;  3F2K A;  5C2F A;  3HOS A;  1Q82 O;  2FLO A;  2GEM A;  4ISE A;  2ZGZ A;  3A0I X;  3DXM B;  4IWV A;  3CCQ N;  3CCM N;  3WQU A;  1K73 O;  4K42 A;  1V4T A;  3CJ7 A;  2NZT A;  5GAE P;  3VMF B;  3O08 A;  1M90 O;  1C0F A;  4CZG A;  5M1Q A;  4JAX A;  3CMA N;  3GL1 A;  3JXU A;  4A62 A;  4IJA A;  3E1Y A;  4IXC A;  4BC3 A;  4BR9 A;  3W3D A;  2BTF A;  1TUY A;  3CQX A;  4A57 A;  5BN8 A;  1BA1 A;  3LDP A;  5AQO A;  3MN5 A;  2CGJ A;  5AQU A;  4XH4 A;  2CH5 A;  3AAP A;  3ENB A;  3G6E N;  4L3Q A;  2RE2 A;  4GV6 A;  1GLJ O;  1Q81 O;  2E8A A;  1YVN A;  3EN9 A;  3TSU A;  3G4S N;  2VCP A;  5LJW A;  3J8A A;  4A59 A;  4NLC A;  3MWP A;  3BP8 A;  3O8M A;  4FWR A;  2ZF5 O;  3QBW A;  3UKU A;  1GLF O;  2QWR A;  3I55 N;  3TPQ A;  1NBW A;  3EE8 A;  1NLV A;  4KH6 A;  3DAW A;  3MX5 A;  3EO3 A;  4JK7 A;  2ZGY A;  4Y0W A;  3VEW A;  4BRA A;  3K9K A;  2YI1 A;  5GAD P;  2C1I A;  3F5T A;  1NJI O;  2QM1 A;  2IIR A;  4KBO A;  1H1V A;  3IUC A;  3T7Z A;  3OBY A;  1QHA A;  3UB5 A;  2P9I A;  3C6A A;  3I33 A;  1T6D A;  4YDU C;  5AZI A;  1ATN A;  2D0O A;  3AGR A;  3G25 A;  5E26 A;  4QS8 A;  2C1G A;  3ZYY X;  3CI5 A;  5JLH A;  4FPB A;  2QI2 A;  4JKE A;  2P9P B;  5ELZ A;  3ZEU A;  4BR0 A;  5FPD A;  1HX1 A;  5AQN A;  4JHD A;  5BRE A;  3EZW A;  1MA9 B;  3CIP A;  4IO8 A;  3GBT A;  3P39 A;  3UKR A;  4DB3 A;  5LJV A;  1Z05 A;  3I56 N;  1MDU B;  2VGM A;  4ISF A;  5KQ8 A;  2P9U B;  1X9J A;  2A5X A;  2HOE A;  2HF4 A;  3E9L A;  3TTD A;  1NMD A;  3QDK A;  3NVM A;  4CJ7 A;  3ENH A;  4H0T B;  4IJN A;  2Q0R A;  5C15 A;  3CC7 N;  1T6C A;  2WUS A;  1BDG A;  3CJA A;  4PL8 A;  2E88 A;  1YJN N;  4IOA L;  4OPH A;  1TYQ B;  4FPA A;  3KWG A;  1HUX A;  4BC2 A;  3M1F A;  4BQL A;  2DPN A;  3CHW A;  3VER A;  4IO9 L;  2IVN A;  3AY9 A;  4EFH A;  4FWN A;  5FPN A;  4CZL A;  1ILY A;  3MN9 A;  5AFU H;  3ATU A;  2CGK A;  3C7N B;  1RDW X;  3ZX2 A;  4KH5 A;  5EOY A;  4H0Y B;  4JEP A;  2ASP A;  3TSQ A;  1KAY A;  3KVG A;  3VF2 A;  5BRF A;  2Q31 A;  3ATV A;  4A61 A;  4K25 A;  3R3L A;  4NLB A;  4F9O A;  2KKZ A;  4IOC L;  3DWL A;  4A2B A;  4BR2 A;  4WFA L;  1VQO N;  4AM7 A;  4IDH A;  4RWT A;  4H03 B;  2W00 A;  4JN4 A;  4B1U B;  3H46 O;  3M5R A;  1S72 N;  3GDQ A;  3KZB A;  3VEX A;  1VQ6 N;  3E9O A;  4BRE A;  1U6Z A;  4H0X B;  5AQY A;  4CZE A;  2QWN A;  2OTL N;  3D2E A;  4WQ5 A;  5CR4 A;  4HTL A;  2YCH A;  1RDU A;  2HBK A;  1SQK A;  4HWI A;  3C65 A;  3SMS A;  5AZJ B;  3VES A;  2OAN A;  3H1Q A;  1JCG A;  3O4W A;  3DJC A;  3VTH A;  5AQX A;  3SK3 A;  2W40 A;  1KAZ A;  5JVH L;  4UY8 O;  4FWL A;  2HMP A;  2NRX A;  3CJC A;  1MWK A;  5BPL A;  2QA4 N;  3Q7C A;  2QWL A;  3JS6 A;  4YOT A;  5AQI A;  1HKC A;  3FZK A;  1IG8 A;  2CH6 A;  4BE7 B;  1XC3 A;  5MLC Q;  1NGJ A;  1CZA N;  5KPT A;  3DXM A;  3QBX A;  3ULE B;  1KD1 O;  4JK8 A;  4WFB L;  4BR5 A;  4XJX A;  4WQ4 C;  1W2B M;  4FOI A;  1GLC G;  3WXM B;  4I6M B;  3EE9 A;  1JCE A;  1GLE G;  2WFB A;  3WXL A;  4FL9 A;  1BWF O;  1OVY A;  4M7X A;  1X3N A;  3QFP A;  1NGF A;  1WOQ A;  4YOW A;  4M7Y A;  3BF1 A;  4PHT X;  3EL2 A;  3D2F A;  4JKA A;  3TU5 A;  4BEB A;  3A5L C;  5KPR A;  2E2P A;  2HBJ A;  2OTJ N;  2FF6 A;  4CD1 A;  1WUA A;  4H0O A;  1QZ6 A;  4JK9 A;  5C2D A;  2P9K B;  1NM1 A;  5CHI A;  3CET A;  3DXK A;  3VGM A;  2V7Z A;  1W97 L;  5AQJ A;  1SZ2 A;  2NRV A;  4CBU A;  5JIC A;  1DGK N;  4DKW A;  1QQN A;  1E4G T;  4MLH A;  1GLA G;  3H6E A;  4JNE A;  3E66 A;  3LDQ A;  5AQZ A;  5BN9 A;  1Q7Y O;  5F2R A;  1NGB A;  5C10 A;  4MDB A;  3O80 A;  3VEV A;  5GAG P;  3M6G A;  3O1W A;  2RHK A;  4IZ9 A;  4BVO A;  4B1X B;  3WXJ A;  3L4Q A;  1EQY A;  4EAH D;  4PKH A;  1YJW N;  4G9Z A;  4C1N K;  4BC4 A;  1NWK A;  1HKB A;  2QTD A;  4BQZ A;  4H5R A;  2A42 A;  1Z6R A;  3O5B A;  5EY4 A;  5AQG A;  1VQK N;  4K43 A;  2P9P A;  2QWM A;  3KHY A;  4JKG A;  3GOI A;  2Q2R A;  1YUW A;  3EKS A;  1BOT O;  3Q7B A;  5EX5 A;  1S22 A;  4BRL A;  1HKG A;  4U67 L;  1VQ5 N;  4RCH A;  2Q97 A;  4WYB A;  4BRK A;  3KK7 A;  4CD3 A;  3RSE B;  5AFU A;  3ZX3 A;  3B8A X;  4JD2 A;  2P9U A;  1QQM A;  3C6H A;  5TKW A;  3CME N;  1M1K O;  2ZWH A;  3WEE A;  2E2N A;  1V4S A;  3S41 A;  4IOX A;  4ILH A;  2P9S B;  4R79 A;  5AQR A;  4ILG B;  2GX9 A;  5AQP A;  3MCA B;  1TYQ A;  4Z94 A;  1HJO A;  3QB0 A;  4CZM A;  4O8U A;  5AZI B;  3PIP L;  1YIT N;  3MX2 A;  1DEJ A;  2YHY A;  4BR4 A;  3MDQ A;  5F0X A;  3C7N A;  4LC9 B;  4CBW A;  1X3M A;  2ITM A;  3MN7 A;  3CCR N;  3BF3 A;  3C0B A;  3N4P A;  3U8X A;  4JHD B;  5DM6 L;  3CCS N;  1Q86 O;  4GV3 A;  3MK6 A;  3GG4 A;  5AQK A;  4O8K A;  4BC5 A;  4EIA A;  2KLA A;  3NMU A;  2HBM A;  1NGG A;  4PL7 A;  2V7Y A;  3LDN A;  2A41 A;  4CZJ A;  3PIO L;  1VQ4 N;  1YHQ N;  4BRF A;  2D1K A;  3VF4 A;  4FWP A;  2ZJR L;  4BRG A;  1Q18 A;  2P9N B;  2WC9 A;  3MWT A;  4E1J A;  3AAQ A;  5JMV A;  4BRP A;  2BUP A;  4MO5 A;  4GNI A;  1MWM A;  4BRN A;  5GAH P;  4A2A A;  5B8H A;  2QXL A;  3WT0 A;  3ZET B;  4DHY A;  2CGL A;  2E2Q A;  4JKD A;  4U7B A;  3OBW A;  3MMV A;  1K9M O;  3SAG A;  3FLC O;  1XQS C;  3LM2 A;  3O1B A;  1U2V B;  2QWO A;  4ILJ A;  2HF3 A;  3VGK A;  1JJ2 M;  3U9Z A;  1O13 A;  3CXC M;  5AQV A;  3U4L A;  5AQF A;  4H0P A;  1E4F T;  5AQS A;  3T69 A;  1ATR A;  4YDU A;  2NRZ A;  1BO5 O;  3L6Q A;  5AQM A;  2GTD A;  4B9Q A;  5I9E B;  1KQS M;  4BVP A;  5CE3 A;  4M63 C;  5C0Y A;  2NNW A;  5DM7 L;  5H1S Q;  2NRT A;  5TKY A;  3QIC A;  2NRH A;  3WXI A;  3LDO A;  4BY9 C;  5EVZ A;  3FE1 A;  4BR7 A;  3HM8 A;  1EO1 A;  4CZK A;  3QML A;  5BPN A;  4PKG A;  1NGH A;  1YXQ A;  4FWS A;  3I8B A;  2GWJ A;  3E9P A;  4I6M A;  3HRG A;  4KH4 A;  1YF5 L;  5KQD A;  4WCE L;  3H1V X;  3QFU A;  1VQ8 N;  1NGE A;  5BR9 A;  1QVF M;  3O9T A;  3D2E B;  3CC2 N;  1NGC A;  2P9L B;  3HOT A;  2FXU A;  3H3N O;  4K41 A;  4FVU A;  1K8K B;  3VEZ A;  2A40 A;  3AGK A;  2H3G X;  2VWB A;  4QS9 A;  3VEY A;  4DCH A;  4YOV A;  2P9K A;  5M1N A;  3FR0 A;  4CZF A;  3SBT A;  4FSV A;  3R8E A;  4BRQ A;  1K8A O;  4DQ8 A;  2E2O A;  1NGI A;  2HST A;  3EKU A;  1BUP A;  3H45 C;  1LCU A;  3W0L A;  5BRD A;  1OKJ A;  4CZI A;  3NVK A;  4H5W A;  4BGB A;  3WQT A;  5E84 A;  1QZ5 A;  1JCF A;  3J7Z O;  3D6R A;  5M1F A;  4BEC A;  3P4I A;  4BG8 A;  3P31 A;  2Q0U A;  5AR0 A;  5FPM A;  3VPZ A;  1LOT B;  5BPM A;  1VQL N;  2PFU A;  1D4X A;  3A5M C;  3L0Q A;  3CCE N;  5ADX A;  1XUP O;  1ATS A;  1IJJ A;  5AQW A;  5KPZ A;  2IVO A;  3FGU A;  4CBX A;  2QW9 A;  2NLX A;  1DKG D;  3CF5 L;  1GLL O;  1VAZ A;  3R9P A;  3CPE A;  3VET A;  1QVG M;  1TUU A;  2AA4 A;  5HL7 L;  3LDL A;  1P8Z A;  3ID6 A;  3O9R A;  3D2F B;  2VGN A;  3IMX A;  2NRR A;  3VGL A;  3AAR A;  4BRH A;  5GIO A;  5GIN A;  5HOO A;  4XH1 A;  1C0G A;  4MDA A;  3SBG A;  1HPM A;  3F9M A;  4YOU A;  4GV9 A;  2KHO A;  3DXK B;  3FFK B;  3A5O C;  4B1V A;  4H0V B;  4B1Y B;  1NGA A;  4IFE A;  3L4I A;  4H5V A;  3O6W A;  1KXP A;  3KWI A;  5LY3 A;  5FPE A;  3OA9 A;  4FWO A;  3RSE A;  3UKU B;  4FWK A;  2V52 B;  3CJ1 A;  5ADX H;  2F9W A;  4H5N A;  3O9Q A;  3TSP A;  3CJB A;  1QQO A;  3CQY A;  2ZJP L;  1BG3 A;  3CCJ N;  2YJF A;  3IFR A;  3M3Z A;  2FSK A;  4AM6 A;  5GIP A;  2YHX A;  2GUP A;  4MO4 A;  2P9S A;  4WQ5 C;  3VEO A;  1R59 O;  5C12 A;  1KC8 O;  4JKB A;  3DLL L;  3UE5 A;  1SAZ A;  2F7T A;  4BRO A;  3IKM A;  3MCP A;  1G99 A;  1J6Z A;  2GEL A;  3SLC A;  3A5N C;  2P9I B;  4XEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...