1NMDA

Crystal structure of d. discoideum actin-gelsolin segment 1 complex crystallized in presence of lithium atp
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
372
structure length
362
Chain Sequence
b'DVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin
publication title The Structure Of The Non-Vertebrate Actin: Implications For The ATP Hydrolytic Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 118
structure length 362
sequence length 372
ec nomenclature
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nmdA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nmdA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1nmdA03
3DXMB 4XEIA 2AP1A 4FWLA 5ADXA 3R6MA 2IVNA 1JCFA 3ZEUA 4A2AA 1U6ZA 4IXCA 3LM2A 1U2VA 1NGEA 1Z6RA 4RWTA 2QXLA 3HZ6A 3O8MA 4B1ZA 5AQHA 5AZJA 2A3ZA 3RSEA 3KZBA 2FSKA 4NO7A 4B1VA 1WOQA 4O5FA 3HBTA 3C7NA 3O4WA 4ISFA 1T6CA 4CZIA 3ENOA 4JNEA 3ZETA 1NMDA 5EOYA 4GNIA 4FPBA 4Y0WA 4QS9A 1HKBA 3EZWA 5BRFA 1K8KB 3IUCA 1WUAA 3EKSA 1LCUA 2QM1A 4GY2B 1T6DA 2P9NB 3HI0A 1U2VB 2E2PA 2Q31A 1X3MA 3VPZA 4H03B 3RSEB 2VWBA 2YHYA 2PBDA 4FWNA 1G99A 3C7NB 2QWQA 2FSNA 4IO8A 3DXKA 3FZKA 4MO5A 4E1JA 4FOIA 2ASPA 2IVPA 3ZETB 3GG4A 4BC2A 3UKUA 5JLFA 2D1KA 2NRHA 4CZMA 3D2EA 5EX5A 4CZJA 1BG3A 3ZX3A 4AM7A 4NB4A 3G25A 3SMSA 1GLEG 4BRCA 2D0PA 3UKRA 1GLJO 3H1VX 3SJHA 3WT0A 3CHWA 3FZHA 3A5LC 2EWSA 2P9IA 2QWPA 2ITMA 3UKUB 1BA0A 1ATSA 4IZ9A 5AQKA 2OANA 4BRQA 4FWOA 1SQKA 2E1YA 2VYPA 3JS6A 3D2EB 4JD2A 1LOTB 1DKGD 2D0OA 3VEWA 3U4LA 3O1WA 2Q2RA 1NWKA 4B1WB 5EXWA 2GELA 4RCHA 3W3DA 4WQ4C 1ATNA 4BRFA 3WEEA 4BR2A 2ASOA 3VEXA 5KQDA 2P9IB 5AR0A 3GBTA 4QS7A 3MN6A 4DCHA 3J8AA 3JXUA 2ZF5O 3R9PA 3BP8A 1QQNA 5F1XA 1X3NA 4BQZA 3S41A 2FSJA 4XH1A 3AARA 1XQSC 3EN9A 3CQXA 1X9JA 1HLUA 3QB0A 3VGLA 2J4RA 1QHAA 2P9KB 3HM8A 5BRHA 3H1QA 3WEEB 3BUZB 2KHOA 4CI6A 2CGKA 3L0QA 4JHDA 1H1VA 3FGUA 2WUSA 1BA1A 3EKUA 4WQ5A 4YDUC 1KAYA 3IDHA 4JAXA 4RTFD 4A62A 1NM1A 2QWMA 3ATUA 3CI5A 4BREA 4WYBA 3EO3A 2Q97A 3LDLA 5TKYA 5BN9A 5FPNA 1RFQA 3VERA 4BRDA 2F9WA 3TPQA 4MO4A 3ID8A 1CZAN 4BR9A 4CD3A 4H5RA 2E20A 4M7XA 3CJ1A 4O8KA 1KAZA 1ATRA 4FOEA 3H3OB 4H5WA 2ZGZA 5AQPA 4QS8A 2Q0RA 2DPNA 2I7PA 5KPTA 2A5XA 5BRDA 3VETA 3A5MC 3CETA 1E4FT 4M63C 3FR0A 3FZMA 2YHXA 3WXJA 1MWMA 4BC5A 3QMLA 3CJ7A 4H5NA 4BR5A 3ZEUB 3A5NC 3MCPA 3WXLA 2HOEA 3MN7A 2H3GX 5FPEA 2D4WA 5AZJB 4A2BA 1Z05A 3FFKB 5FPMA 5AQVA 2FF6A 1NGAA 1NGGA 5AZIA 2P9SA 1XC3A 1YVNA 3O1BA 4PL7A 1C0FA 2A41A 1QQOA 3DAWA 5BPMA 3LL3A 1HPMA 4IJAA 4ISEA 4BRLA 2P9LA 3ULEA 1QZ5A 4F9OA 2QWRA 1MWKA 2A42A 3KHYA 2QWNA 2E2QA 4BRIA 4FWRA 1TUUA 1JCGA 3QFUA 3H45C 3FE1A 3UB5A 3BF3A 4CBUA 2CGLA 2QWOA 3MN5A 4H5TA 2GTDA 3WUHA 3AAQA 1ESVA 4EHTA 3LM9A 5F0XA 5F2RA 4FWKA 3MK6A 3QDKA 2P9SB 5AZIB 5BPLA 3DXKB 2HF3A 3VF6A 3CJAA 1HJOA 4CZKA 4HWIA 4B1YB 2ASMA 4C23A 4FWPA 1DEJA 5AFUH 1HUXA 4BVOA 2P9LB 4PKHA 1R59O 1E4GT 3ULEB 2GWJA 4CJ7A 2CGJA 2V7ZA 2A6AA 4I6MA 1V4TA 5AQNA 3BEXA 3HSCA 4CBWA 3DWLA 4YDUA 1BU6O 3VF4A 3AAPA 2Q1NA 5AQGA 5AQIA 2V51B 3UKRB 4DQ8A 5KQ8A 3LDPA 5AQYA 3WXKA 2P9PA 4FWMA 3VEZA 4DHYA 4HTLA 3I33A 4BG9A 3VESA 4FL9A 5AQRA 4K41A 5KPRA 3U8XA 1NLVA 3SLCA 5BR9A 5AQUA 4H0XB 3U9ZA 2CH6A 3U9DA 1D4XA 4JD2B 4B9QA 1GLCG 3GE1A 3VEVA 4BRKA 1BO5O 4EIAA 1ZXOA 1NGHA 1TUYA 2E2OA 3LDQA 4BC3A 1DGKN 4Z94A 2BUPA 5AQOA 4DB3A 5LJVA 5EVZA 3IFRA 3L6QA 2Q0UA 5EY4A 3HTVA 1HKGA 3OHRA 2P9PB 1P8ZA 4BRMA 1S3XA 3M3ZA 2QW9A 5AQFA 5FPDA 4LC9B 5AQSA 1NGBA 2NLXA 4L3QA 4BRNA 3DXMA 1S22A 1NGDA 3FZLA 3W0LA 4M7YA 3A0IX 3QBWA 3LDNA 3MDQA 5JMVA 1TYQA 2CH5A 4EAHD 3P4IA 2IIRA 3QFPA 1MDUB 5AQTA 4CZEA 3AY9A 3VOVA 2VCPA 2YJFA 4EFHA 4BC4A 1BDGA 1BUPA 3BF1A 1J6ZA 1EQYA 3KVGA 2W41A 4JHDB 3GOIA 5LY3A 5AQWA 2GWKA 4CZFA 3TU5A 1T44A 3M6GA 1NGFA 1RDWX 1K8KA 3O80A 5B8HA 2P9NA 4BRHA 3WQTA 4BR4A 1TYQB 5JLHA 1KAXA 3D2FA 3MN9A 3CJ9A 1GLAG 2Q36A 3ATVA 4IWVA 4BQLA 4B1UB 4FSVA 4H5VA 4PL8A 3SMPA 1YAGA 3M1FA 3ZX0A 1GLBG 5E84A 2IVOA 4BRPA 1ZC6A 4FWQA 4BG8A 5AFUA 2QWLA 4BR0A 3CERA 1NBWA 2I7NA 3H46O 3O08A 4WQ4A 4PKIA 5ELZA 2P9UA 4FPAA 1IJJA 1IG8A 1GLLO 2F9TA 2FXUA 3D7EO 5I9EB 5ADXH 3O5BA 2GUPA 4PKGA 4B1XB 1NGJA 2E1ZA 5BPNA 3GDQA 3D2FB 4WQ5C 3CJBA 3VGKA 4CZGA 4BGAA 3GL1A 3EL2A 4BGBA 1XUPO 4IJNA 3VEYA 1HKCA 3C0BA 1NGCA 4CZHA 1YUWA 3WQUA 4MLHA 4BROA 5LJWA 2HF4A 1SAZA 3ENHA 1BOTO 3MMVA 2FF3B 4XH4A 1MA9B 2P9UB 5BREA 1ZBSA 2NZTA 3A5OC 4CD1A 3IMXA 3R8EA 2YJEA 5JICA 2E88A 5E26A 5AQJA 4J8FA 3F9MA 4K43A 3SK3A 3QBXA 3CQYA 4AM6A 4CZLA 2FLOA 3O6WA 4CBXA 1YXQA 1QZ6A 4FO0A 1RGIA 3WXIA 4H0YB 1JCEA 4A61A 3VENA 1Y64A 3L4IA 5AQZA 5CE3A 3I8BA 2E8AA 3VGMA 4XH5A 3CIPA 4EHUA 3H6EA 5AQLA 1HX1A 4K42A 2W40A 4I6MB 4BRAA 1SZ2A 4BR7A 1V4SA 2P9KA 4K25A 2YCHA 3B8AX 2HMPA 1OKJA 1Q18A 3UE5A 1NGIA 5KPZA 5AQXA 4BVPA 2GEMA 3ZX2A 4KBOA 3H3NO 4JN4A 4BRGA 4H0TB 4H0PA 2PAVA 5AQQA 3DJCA 2AA4A 2YI1A 1C0GA 2ZGYA 4FWSA 2UYTA 1BWFO 2YHWA 1KXPA 1GLDG 2BTFA 3QICA 2V7YA 3FZFA 3FLCO 1GLFO 3LDOA 4H0OA 4ISGA 5BN8A 4MLEA 3A8YA 2V52B 4H0VB 3CJCA 3VF2A 3VEOA 1QQMA 2E2NA 2A40A 2ZWHA 5AQMA
chains in the Genus database with same CATH superfamily
3DLGA 4LFCK 4FLZA 3EE9A 5HP1A 4KO0A 1UAXA 3K5NA 3J7ZO 3ZEUA 4IXCA 4LF8K 3TAMA 3LM2A 3TAEA 3MEGA 1WOQA 3ASMA 4O5FA 3HBTA 1LAWA 4KHYA 2NRVA 4BE7B 3TTDA 3ENOA 3LP3A 4M3UA 3ID6A 4K8ZA 5BRFA 4FZXC 1K8KB 3IUCA 2IGIA 3EKSA 2QKBA 3QEPA 2P5OA 2AJQA 5JENA 2P9NB 3ULDA 2Q31A 1X3MA 1YHQN 2RKIA 3KTQA 4CJ4A 1RTDA 3SV3A 2KW4A 2VWBA 3PUFA 1G99A 3C7NB 1RT6A 2QWQA 4FOIA 2IVPA 4LH5A 1Y97A 3ZETB 4BC2A 3K5MA 3OJSA 4DFMA 2NRHA 3Q7BA 1ASUA 4Z0UA 4CZJA 4JV5K 4BRCA 1GLJO 4FJNA 4H4OA 1JLBA 3WT0A 3KD5E 2QKKA 1B9DA 2EWSA 2HB5A 3NGIA 4O8UA 4JI8K 2P9IA 3RVCA 4CGHA 2KTQA 2OANA 4BRQA 4FWOA 2E1YA 2RPIA 4DTPA 3AVAA 1XC9A 4JKFA 2IDOA 2Q2RA 4FYDA 3W3DA 4WQ4C 4UY8O 5FRNA 5HL7L 2OCEA 4GV6A 3VEXA 4E72A 1CXUA 1BCMA 5AR0A 3GBTA 1EKEA 4CF9A 4DCHA 1WAJA 2ITGA 4CHZA 4IOXA 3BP8A 1QQNA 1WNSA 4KHUA 1BCOA 4UQGA 3CCUN 1HLUA 4A57A 3THWB 3VGLA 3NF9A 1IV0A 1SL0A 1U47A 2J4RA 1QHAA 3TI0A 3H1QA 4Y1DA 3K5OA 1S1WA 1SL1A 4HUEA 3PIOL 4KHPK 3O3GA 2NRXA 4JHDA 1VQMN 1BA1A 3EKUA 1S6QA 4WQ5A 2QXFA 4FM0A 2P5GA 4OKEA 1VSLA 1BGXT 3EYZA 4ELUA 1C1BA 3EO3A 4WYBA 2Q97A 3LDLA 5TKYA 4KB1A 3J80O 3OYLA 3TPQA 3CCEN 4DV7K 4CJPA 1HRHA 3OJUA 5HRPA 4OLAA 3PLAA 4FW1A 4CFAA 2KZMA 4M7XA 4OGCA 3IS9A 3MCAB 4FOEA 1EWRA 1RT2A 4DFJA 4CF1A 4B8CA 2Q0RA 1OH6A 3LPTA 2DPNA 3THVA 2I7PA 5M1KA 3HK2A 5KPTA 2A5XA 5BRDA 3VETA 3N4PA 2UXDK 4KPYA 3CETA 4M63C 3FZMA 1DTTA 4B3RK 4BWMA 1TGOA 4G9ZA 2Z1HA 4JKCA 5CHIA 3CJ7A 3A5NC 2B4JA 4U67L 3V81A 1SV5A 4N56A 2G8IA 3TSUA 2XY5A 4JRPA 2FF6A 1NGAA 2F8SA 5J2PA 5M1OA 4OX9K 1QQOA 3DAWA 3O9UA 4AHSA 4BRLA 1JLEA 3SBGA 3MEEA 1ZBFA 4OJRA 3KHYA 4LF4K 1TKZA 3SQ0A 1O13A 3H45C 3FE1A 4FVMA 5HRNA 4YY3K 3MN5A 3MX2A 4AQYK 3F5TA 4LD0A 5CYQA 3O4NA 4EHTA 3RTVA 3I55N 3MXIA 2O8CB 2P9SB 4BE0A 1ASWA 4NCAA 3DLEA 1CZBA 3NBPA 1EXQA 4CK3A 4HWIA 2HW3A 1WSFA 4BVOA 3KJVA 4KTQA 4F3TA 4CVNE 2QI2A 2CGJA 3HSTB 2A6AA 3VQ5A 1Q9XA 2G8UA 4CBWA 3HSCA 3DWLA 4YNQA 3AVMA 4DUYK 3PX0A 2Q1NA 1A5VA 3LP0A 3UKRB 2YX6A 4CHOA 3OYAA 3T7ZA 3C65A 3PV8A 4DHYA 3V1QA 1NK8A 3NHGA 2OA8A 3HPOA 1N6QA 1NLVA 3SLCA 1RTHA 5AQUA 4HCCA 3U9DA 2B6AA 5C2FA 1D4XA 3KD1E 5J1EA 2VG5A 3H08A 2EHGA 3DOLA 3AGRA 1SS6A 3LDQA 4B3MK 3TR8A 4Z94A 1R0AA 5EVZA 2OTJN 5EY4A 3HTVA 1HKGA 1TAUA 2P9PB 2DY4A 4BRMA 3FFIA 5TKWA 3M3ZA 1REVA 5AQFA 1Q9YA 4FXDA 4LC9B 1NGBA 2NLXA 3AGKA 4BDPA 1S22A 1KSPA 3L2UA 4FJ7A 4W5NA 2FBXA 3SBTA 3W0LA 4FJLA 4JI6K 4DLEA 3A0IX 1VHXA 4C8MA 1QVGM 3QBWA 4JI7K 4KB0A 1MDUB 4DTMA 2IS3A 1NOZA 3AY9A 3KVGA 3CCMN 1WBBA 3DM2A 1N33K 4DU3A 2UXBK 3L2RA 4J2EA 1FKOA 1EWQA 1T44A 1GOCA 4ID1A 1K8KA 1N34K 3ZSYA 3AVFA 4V19S 1C6VA 2P9NA 3S3MA 1J5OA 3Q7CA 2HHWA 4CEBA 3CF5L 1GLAG 3ATVA 2Q36A 4BQLA 5LMUK 3NFAA 1NJWA 1VQ7N 5M1QA 2Y1JA 4CESA 4BRPA 1ZC6A 4W5QA 4DWIA 4BG8A 4DR4K 5IWAK 3AA3A 3CERA 3A2FA 2FC0A 2BGGA 4X66K 2I7NA 4WQ4A 2G8HA 5ELZA 2P9UA 4FM1A 5I9EB 1U49A 5ADXH 4BACA 2ETJA 4B1XB 1VSDA 5HBMA 3HRGA 1D9DA 4PA1A 3CJBA 3GL1A 3HVRA 1UWBA 4K0KK 3C6HA 1G15A 1NGCA 4BROA 2HF4A 3ENHA 3AO5A 4O55A 1C1AA 3ZT0A 3KKSA 3TWHA 2VG6A 2YJEA 5JICA 1L5UA 1NJYA 4IFYA 4J8FA 4ELVA 4FJ9A 2OPRA 1FKPA 4XIUA 2YNHA 4CJKA 3V9ZA 1YXQA 3WXIA 3MX5A 4H0YB 4YHHK 5AQZA 3VA3A 3OYFA 1UA0A 3ZLJA 2GUIA 2WBNA 4JI1K 3ITHA 4FK2A 3CD6N 3CIPA 4G1QA 4EHUA 1VSMA 4M3XA 4B9TA 4K42A 4QAGA 4FJIA 4I6MB 3THWA 2KZZA 1EO1A 4BR7A 2NUBA 3LPUA 4YFUA 4GVEA 1VQNN 2VWKA 4K25A 3S9HA 3IRXA 3C6UA 4I9LA 4M41A 4HHTA 1HPZA 3B8AX 1NK0A 3NF7A 2XO7A 2O8BB 3CYGA 3UE5A 3T3FA 1E3MA 5AQXA 4BVPA 3AVGA 3H3NO 4Y1CA 1LV5A 3I8DA 4H0TB 2X74A 3CFPA 2ZD1A 3TTFA 5KI6A 2YI1A 1C0GA 4JKDA 1UOCA 4DV0K 3HL8A 1YJWN 4KRFA 3ZCMA 1XI1A 3QEXA 3FLCO 2DFFA 3OYMA 1O1WA 4MLEA 4X64K 3QESA 4F4KA 1L3SA 4KI4A 2VGNA 2R7YA 5GINA 1QQMA 5DMRA 1BHLA 3NDKA 3LAKA 4JK9A 3DXMB 4XEIA 4FWLA 1HQUA 3TARA 1W97L 1YT3A 3OYBA 4CGDA 3G0ZA 4E7JA 1KVAA 1NGEA 2O8DB 2QXLA 3BDPA 4JKGB 4B9MA 3RSEA 4B1VA 5A2QO 4CF8A 3SV4A 1QTMA 4CZIA 4JNEA 5C0YA 1NMDA 2HSTA 3RMCA 4GNIA 3OYHA 4Y0WA 3EZWA 4JI0K 4RW6A 3OTOK 1NK4A 4MQ3A 4DTJA 1LCUA 3SI6A 1U2VB 5JVGL 3DLRA 2GV9A 4E0DA 2ZQBA 4E19A 2YKNA 1YIJN 1IKVA 2PBDA 4FK0A 1OH8A 3FZKA 4E1JA 3HT3A 2WONA 2ASPA 4ILGB 5JLFA 1VK0A 3THYA 4LF7K 5GAHP 2IOCA 3I0SA 2W6LA 1RNHA 5GADP 2JGUA 4DTOA 4AM7A 5GIPA 1GLEG 4ID5A 1IO2A 4CF0A 3UKRA 4F8RA 3H1VX 3SQ4A 1I3AA 3AVNA 3L3VA 1J53A 2ITMA 3UKUB 3PX4A 1NK7A 4FJMA 1KFDA 1XWLA 4C8LA 4FJ5A 3ZT1A 2PY5A 1SQKA 1X9MA 3D2EB 1QVFM 2VQEK 1DKGD 4KHQA 3ENBA 4FLVA 4CHQA 3SUPA 3SUOA 4DQPA 1NWKA 3L3UA 4B1WB 4BDYA 4MFBA 5EXWA 4RCHA 2OPPA 4M42A 1IBKK 4KREA 4O5BA 4OKJA 4BECA 1HMVA 3AVIA 4QS7A 3OYIA 5HOOA 2I5JA 3JXUA 3RMDA 1YJ9N 2ZF5O 2Q3SA 1VQPN 1X3NA 4GMJB 3S41A 4XH1A 3AV9A 3EN9A 3CQXA 4DQSA 1X9JA 2E4LA 3QB0A 3LZIA 4ZTJA 1Q7YO 2D0BA 4CJVA 3MXMA 4CJLA 3HM8A 5BRHA 1L3TA 3CM6A 3WEEB 4WE1A 3ZT2A 3OS1A 1N5YA 4DR6K 3U3GA 3FGUA 1FK9A 2WUSA 2W00A 2O4IA 1NKEA 4E1MA 3KLGA 1NM1A 2QWMA 3CI5A 5C2DA 1K9MO 4IG3A 2HBJA 4ILJA 1RFQA 3VERA 3QNNA 4MO4A 1RT5A 1TKDA 4DSFA 2NRWA 4H5RA 2E20A 1VSJA 4O8KA 3NVKA 1KAZA 2YHAA 4CHYA 4I2PA 4H5WA 3VQ8A 3TAFA 3M5RA 4RW7A 3WXJA 4BDZA 3VQ6A 4DLGA 1S5JA 1MWMA 3AA5X 3HOSA 4BC5A 3QMLA 1WSEA 4BR5A 3MCPA 4CEFA 1RBSA 3OYEA 2YV0X 4ICLA 3FFKB 5FPMA 1BIUA 3OW2M 4OGEA 2VQFK 1VQON 3DMJA 4JS5A 3SCXA 1NGGA 1HJRA 3O1BA 4GW6A 1QSYA 5BPMA 5LMNK 1TK8A 4ISEA 2P9LA 3LAMA 4DQQA 2Y1IA 1RBVA 2E2QA 4BRIA 4FWRA 5D3GA 2UXCK 2BH1A 4CBUA 2CGLA 4H5TA 1ZYQA 1ESVA 5F2RA 3G6EN 5AZIB 4KHNA 4Q5VA 1YJNN 1W2BM 5KRSA 4CZKA 4BE1A 3E66A 3QLHA 1KD1O 3HP9A 4CIFA 1DEJA 4R5PA 1XHXA 4DMNA 1KFSA 3VQPA 1E4GT 3ULEB 2GWJA 2VG7A 4CJ7A 2HHTA 3TABA 4I6MA 4Z4HA 2HHUA 1V4TA 3NMUA 4YOXA 3VF4A 3CPEA 5AQGA 1NJZA 1KVCA 5GIOA 1BISA 3NH0A 4PHTX 3ZSRA 1RBUA 4DFPA 3WXKA 3VQ9A 4HTLA 4BG9A 4OKKA 4K41A 4RW4A 5FDLA 2HBKA 5BR9A 2CH6A 4DFKA 4JD2B 4B9QA 2O8EA 1I94K 1KLMA 4DU1A 1NGHA 1Z26A 4AF1A 3O3HA 3THXA 4FLYA 1QSSA 3OY9A 3VMFB 1QHTA 4X65K 1KCFA 2P51A 1HNWK 2QW9A 1JLQA 4M3TA 4CJWA 5FPDA 5AQSA 1CXQA 1VQ6N 2WC9A 3DXMA 4OPJA 1WB9A 3HP6A 4CJEA 5GAEP 2HHIA 5JMVA 1IKYA 2YKMA 3VN5A 2O8DA 3HO1A 4CGFA 2IIRA 4JKGA 4C8OA 5AQTA 2E6LA 3VOVA 1N8RO 2YJFA 4AHRA 1BDGA 3RR7A 1SKWA 2PYLA 1VQKN 3BF1A 4CJFA 3VA0A 2W41A 4IO9L 1Q82O 3CMEN 4FLWA 1DTQA 4CZFA 4KTWA 4HUFA 1M90O 3M6GA 3K5LA 1XHZA 2F4VK 3NH1A 1NMNA 4IG0A 3O80A 1FXXA 3WQTA 4BR4A 1TYQB 5JLHA 2JWLA 2DFHA 3CJ9A 5KGXA 4CCHA 4PQUA 4BY9C 4FSVA 1U04A 1JJ2M 1YAGA 4KH5A 2IVOA 3RRGA 1J54A 4FWQA 4DV3K 2UUCK 2O8FB 1U4BA 1QQCA 2Z1IA 3SQ1A 4Q0BA 3CC4N 3O08A 4FPAA 3NGYA 2OPQA 4E7LA 1UA1A 2E1ZA 3GDQA 3D2FB 1IG9A 4BGBA 4E89A 3AO3A 1W9HA 3MEDA 5FLXO 5LJWA 1SAZA 4Z4GA 4Z4EA 1X9SA 1J5EK 3F2KA 3VQBA 4XH4A 3SUQA 5CZ1A 1ZBSA 2NZTA 1QE1A 2IAJA 3IMXA 3J7YP 5AQJA 2XY7A 1GOBA 1DLOA 3F9MA 4K43A 3SK3A 3QBXA 1KLNA 3CQYA 2G8KA 3L2VA 1JLAA 3ZSWA 1WBDA 1YTAA 1VSIA 1LWCA 3HJFA 2ZM6K 3CCJN 1RGIA 4HUGA 3OS2A 1HNXK 1NOYA 3VENA 3I0RA 3I8BA 2E8AA 4B8AB 2QTDA 1X9WA 3QEIA 4DSLA 1TL3A 3E9PA 3HVTA 5SZTA 1ITGA 4FZYA 1RDDA 4F3OA 4NYFA 3ZSZA 1YITN 4DTUA 3BY5A 3CG7A 3DLKA 1Q18A 1K8AO 4IOCL 3P38A 2GEMA 4BRGA 3K2PA 3F73A 1WSGA 3AVBA 3PSFA 5AQQA 2FBVA 1RDCA 1IBMK 3AVCA 4AH9A 4FWSA 4FJHA 2QEXN 2HVIA 2YHWA 2BTFA 3QICA 1IH7A 1GLFO 3JAMO 2Z1GA 3OA9A 4ISGA 3WNEA 4E7HA 4CFBA 3A8YA 2V52B 3CJCA 3O4QA 1CZ9A 4H4MA 5ADXA 3R6MA 1IKXA 1JCFA 3K58A 2PZSA 2KLAA 4A2AA 1RT4A 1U6ZA 5IT9O 2BANA 1Q81O 4KI6A 4RG8A 3HZ6A 1JXEA 4B1ZA 5AQHA 3D0PA 4CFDA 2A3ZA 3C95A 3KZBA 2FSKA 4NO7A 3S3OA 1CLQA 1K6YA 1S1VA 3C7NA 5DK5A 3O4WA 2DFEA 3P39A 4OVLA 1NJXA 1SUQA 3ZETA 3CCSN 1S72N 4QS9A 1HKBA 3NH2A 4NXMK 4B9LA 4LSNA 3DLLL 4DU4A 1WUAA 3TSQA 4CIEA 4OPAA 4GY2B 3HI0A 3VPZA 4H03B 4I7FA 2YHYA 4FWNA 4CJQA 4IO8A 3KK3A 4MO5A 3WNHA 3CM5A 2HNYA 4DQRA 3OYGA 2D1KA 5J2MA 4EZ6A 3PX6A 2YNGA 5JS1A 3M8SA 4CZMA 3MWPA 2KQ2A 3G4SN 3JSMA 3PSIA 4DQIA 1TL1A 1L3VA 3ZX3A 3DOKA 4DTNA 4B3OA 2D0PA 3CHWA 3FZHA 3A5LC 1OH5A 1FW6A 1ATSA 4IZ9A 4YOWA 2OPSA 4CECA 4JEPA 1ZBHA 3NAEA 2VYPA 1M1KO 4FLXA 4JYAK 4JD2A 1N32K 1LOTB 4NLBA 1WN7A 2D0OA 3VEWA 3U4LA 4B08A 3TAGA 1XMOK 3O1WA 1C1CA 3ZSQA 4CEQA 1SKRA 2BDPA 3AVJA 4HCBA 4F2SA 1OH7A 2A1SA 3NE6A 2YNFA 4BR2A 4DV5K 2ASOA 4B3SK 4JKEA 5C42A 2P9IB 4N47A 4WFAL 3RMAA 1KC8O 4JI5K 4O0JA 1B9FA 1N36K 2F96A 3NVMA 2VWJA 4B9NA 4FVUA 1JKHA 2P9KB 3DLHA 4LSLA 1LW2A 3E9OA 3BUZB 4ZTFA 4ZHRA 4CI6A 4CEOA 2CGKA 3L0QA 4DTSA 1H1VA 3DRSA 5C10A 4OO1J 4W5RA 3NF6A 1TAQA 3OS0A 1KAYA 3IDHA 5FRMA 4RTFD 4A62A 4OPHA 3NF8A 4BREA 3V9XA 2C1GA 2OZMA 1NKCA 2QK9A 5GAGP 5FPNA 3L2QA 4RW9A 3QEVA 4NCGA 4M45A 1TKXA 3ID8A 3AVKA 1CZAN 4BR9A 3CJ1A 4BE2A 3DRPA 3VTIA 1QS4A 3H3OB 4JS4A 2RF2A 2ZGZA 3SAGA 5AQPA 4QS8A 3CC7N 3L4QA 3NCIA 4FCYA 1BQNA 1E4FT 3FR0A 3CC2N 4Z4CA 3SUNA 2H3GX 4R79A 1VQ9N 5AZJB 4RW8A 4A2BA 1Z05A 2WFBA 3SPZA 4LY7A 4NXNK 2KFZA 5AQVA 4KV8A 4DR2K 4GV3A 2P9SA 1XC3A 4DTXA 2O8CA 4PL7A 2A41A 2HHXA 3P5JA 4KH6A 4IEIA 1HPMA 5JVHL 2QWRA 4Z4FA 3PY8A 2A42A 3TSPA 1VSEA 1JCGA 3BF3A 1S6PA 3O9RA 3WUHA 2QA4N 4IDHA 3AAQA 3LM9A 5F0XA 4FWKA 3QDKA 5BPLA 3DXKB 3K59A 4DV1K 5I3UA 1VRTA 1BIZA 3KK2A 3DYAA 5AFUH 1R59O 2RN2A 2V7ZA 4JLHA 3R1XA 4N41A 1BL3A 1GOAA 2ZJQL 3TANA 3BEXA 1HR0K 4YDUA 1KTQA 3O3FA 3AVLA 5AQIA 2V51B 3T1YK 4IFVA 3K9JA 3LDPA 3KK1A 4CGIA 4DSKA 2P9PA 4FWMA 3KLIA 4B9VA 2DTUA 3I33A 4CIGA 3RMBA 4FL9A 5AQRA 3LALA 1WAFA 5I42A 4PWDA 2D0CA 3PO5A 4H0XB 3U9ZA 3TAPA 3GE1A 1NKBA 2E5LK 4EIAA 1ZBLA 2W42A 1TUYA 2E2OA 4CJ5A 4FZZA 4BC3A 1F21A 3CXCM 4GVMA 2BUPA 3DRRA 4DB3A 3E01A 1P90A 2Q0UA 4JI3K 3J7AP 3OHRA 3SJJA 2X78A 3QEWA 5CR4A 2F8TA 4E3SA 4BRNA 2X6NA 3AO1A 4YOVA 3OYJA 3R3LA 4GKKK 4M7YA 2HNZA 1JLGA 3MDQA 1TV6A 1LWFA 3OBWA 4CF2A 5C25A 3P4IA 1EP4A 3F9KA 3QFPA 5CYMA 4EP5A 4WFBL 1WSHA 2VCPA 2XY8A 4YORA 2HNDA 5LY3A 5AQWA 4FJXA 2YNIA 3LP1A 2F7TA 1VRUA 1KQSM 4Z4IA 2HHSA 1ILYA 1NGFA 1RDWX 1Q86O 1J9AA 1OVQA 5T7BA 3T69A 4BRHA 3G10A 4FLTA 4IWVA 4A5AA 3K9KA 3HXMA 4H5VA 3M1FA 1GLBG 5E84A 1VAZA 1S9EA 3TAQA 4DV2K 3DI6A 1B92A 3P1GA 2QWLA 4BR0A 2ZJPL 1NBWA 3QIPA 3H46O 4PKIA 3T19A 1IG8A 1GLLO 3D7EO 2FXUA 1S1XA 3AVHA 3O5BA 4PKGA 3LZJA 4YOYA 1NGJA 2ZE2A 3VGKA 1EX4A 4BGAA 4W5TA 5HRSA 5FROA 1NG9A 1C0MA 4CK2A 4CZHA 1YUWA 3WQUA 4MLHA 4O44A 1YF5L 5C15A 4DR1K 4W5OA 4M3WA 1HYVA 1RDUA 2IC3A 2LSNA 1MA9B 2P9UB 5BREA 4CD1A 1T8EA 3R8EA 2E88A 5E26A 4IFEA 3T1HK 3V6DA 4I2QA 3KLHA 1TK5A 4A59A 4FM2A 4B9SA 2FLOA 2W6KA 3MXJA 3VQ7A 3ZT4A 2HBLA 2C1IA 1QZ6A 3VTHA 2O8BA 1NK6A 1NU0A 5LL6Z 1Y64A 3L4IA 2WTUA 5M1PA 3SAHA 4XH5A 5CY4A 4DS5A 4IKFA 5HROA 3H6EA 4KTZA 5AQLA 1HX1A 2W40A 4DSIA 3RWUA 4M3RA 4CEEA 1XNQK 4GKJK 1V4SA 2P9KA 1JLFA 3I56N 3KIOA 2YCHA 2HMIA 3S5TA 5KRTA 4CW7B 1VQ5N 2HMPA 1OKJA 4MDBA 3OYCA 1T03A 4JKBA 5KPZA 1FJGK 2D0AA 4KBOA 3ZX2A 3OYNA 3C6AA 1TK0A 3QNOA 1A5WA 3S3NA 1BI4B 3DJCA 3ZSXA 2AA4A 4AILC 3CYMA 4E1NA 3K0SA 4LH4A 4LF9K 3C6TA 4H8KA 4A5BA 3V9SA 1KXPA 1GLDG 1RBTA 3FZFA 3LDOA 3OVNA 5KTQA 4QOZB 4LFBK 4U7BA 4PUOA 5BN8A 4HTUA 4C8NA 4H0VB 2OZSA 4NYNA 3VF2A 3VEOA 4AHVA 1JXBA 1JLCA 2E2NA 2A40A 3SAFA 2BE2A 2AP1A 1IKWA 1LWEA 4N76A 2IVNA 1U2VA 2G8WA 2NRRA 1Z6RA 4RWTA 4I9QA 3O8MA 4NLCA 5AZJA 2JLEA 1Q8IA 4L8RB 2UUBK 3TTCA 1RCHA 4FW2A 5K14A 1KRPA 4ISFA 3ISNC 1T6CA 5JS2A 5EOYA 4FPBA 3AO4A 3CFRA 4DF4A 3IAYA 3WNFA 2O4GA 1W0HA 1XMQK 2HBMA 2QM1A 1T6DA 2E2PA 4F2RA 4K8XA 4E7IA 4M3YA 2RHKA 4DR3K 3RSEB 1RDBA 1ZBIA 3SYZA 1YVUA 4WCEL 3KLFA 2FSNA 4XJXA 3DXKA 4CJ3A 3CCVN 1VSHA 3GG4A 3UKUA 4J2DA 4EZ9A 5CZ2A 4CGGA 4LFAK 4CEZA 1RILA 3D2EA 1U48A 5EX5A 3LWMA 1X1PA 1BG3A 4NB4A 3G25A 3SMSA 1S1TA 3CFOA 4FJKA 2NNWA 3OBYA 4IDKA 4PY5A 3SJHA 5J2QA 1NNEA 4NCBA 3UIQA 4FJ8A 3QINA 2QWPA 2ZJRL 1BA0A 3THYB 1LW0A 5AQKA 3ZSOA 3N4QA 3JS6A 2OYQA 3B6OA 4AHCA 1SKSA 1RT3A 1S1UA 2GELA 3V9UA 3D45A 2X6SA 1ATNA 3ALYA 3BZKA 4KH4A 3AA4A 4BRFA 3WEEA 1D8YA 2FBTA 2JWKA 3ZT3A 2HHQA 4JRQA 1RBRA 3U6FA 5KQDA 1YTUA 3MN6A 3J8AA 3CCRN 3C94A 2ATQA 4CGJA 3R9PA 1VSKA 4MDAA 5F1XA 4BQZA 2FSJA 5AJ3K 3AARA 3HPGA 1XQSC 4LF6K 5M1FA 4JK8A 1NK5A 2G8VA 1HQEA 3MAQA 4CFCA 3PO4A 2KHOA 3E1YA 3O9SA 4FJJA 3AA2A 4CK1A 4E7KA 4YDUC 3L8BA 1RT1A 2RE2A 5BR8K 4JAXA 2HVHA 4TSXA 3ATUA 3E9LA 5BN9A 4KHWA 4BRDA 2F9WA 5C12A 4IBNA 4CD3A 4JI4K 2E6MA 2FBYA 1ATRA 3QIOA 5DM6L 4ILHA 3A5MC 1ASVA 2YHXA 1XNRK 3T1AA 4DV4K 3K57A 3BGRA 2UUAK 4H5NA 1LAVA 3ZEUB 3M8RA 1I39A 3WXLA 2HOEA 3MN7A 5C24A 5FPEA 1VQ4N 2D4WA 5J2NA 3LWLA 3KLEA 3EEQA 4AHTA 4DSEA 4CHNA 3VQ4A 5AZIA 3SNNA 1YVNA 2D5RA 1C0FA 4B3TK 4KHSA 3EZ5A 4ELTA 3LL3A 3J81O 4IJAA 1WSJA 3ULEA 1QZ5A 4F9OA 1MWKA 3D6RA 2QWNA 4GV9A 4DKWA 1TUUA 3QFUA 3UB5A 2PFUA 1WLJA 1Z25A 2QWOA 2GTDA 2VGMA 3U3YA 3SPYA 3QO9A 4DTRA 3MK6A 1RTJA 1A5XA 2PYJA 2HF3A 3VF6A 3CJAA 1HJOA 3VQAA 4B1YB 2ASMA 4C23A 3QERA 4FWPA 4BWJA 1HUXA 2P9LB 4PKHA 3G71N 1NJIO 1NK9A 1C0UA 3SZ2A 1K73O 4KAZA 3HYFA 5AQNA 4WF9L 1OVYA 4OPKA 1S9GA 1BU6O 3AAPA 4CEDA 5KQ8A 4DQ8A 2G8FA 1JL2A 5AQYA 1HNIA 3VEZA 4IEEA 5MLCQ 3EE8A 3P31A 3VESA 5KPRA 3U8XA 1BI4A 1VSFA 5KGWA 3M8QA 4J2AA 3M8PA 4J2BA 1GLCG 3VEVA 4BRKA 1BO5O 1ZXOA 3CPWM 1VQ8N 3SQ2A 1DGKN 5AQOA 5LJVA 3LDSA 1L3UA 3IFRA 3L6QA 4C1NI 2XRIA 4KKOA 3BZCA 3VQCA 3P83D 4EP4A 1P8ZA 1DT9A 3ZSVA 1S3XA 4C1NK 2HHHK 3RRHA 4DF8A 4L3QA 1NGDA 3KKRA 4DV6K 3FZLA 2O8EB 3CMAN 1U45A 1RTIA 3CCQN 3HPHA 3LDNA 1TYQA 2CH5A 4CJUA 3O9QA 4EAHD 2EX3A 1ZBUA 4C8KA 4DG1A 3THXB 4CZEA 4FJGA 4EFHA 3NGZA 4LF5K 4QCLA 3VQDA 4BC4A 1BUPA 2A1RA 1J6ZA 1T3VA 1EQYA 4CJTA 3HM9A 4JHDB 3GOIA 1D5AA 2GWKA 2O8FA 3CQ8A 4B9UA 3TU5A 4KFBA 3MWTA 4HVJA 3JYTA 3V4IA 1EETA 5HLFA 5B8HA 1YI2N 3LANA 1KAXA 3D2FA 3MN9A 4B1UB 2WOMA 4CE9A 4PL8A 3SMPA 3V1OA 3ZX0A 3WNGA 4AHUA 1HNZK 4IOAL 5AFUA 3HOTA 4DR7K 1C0TA 2GX9A 4DSJA 2NRTA 3O9TA 1TVRA 2NRZA 4DUZK 1IJJA 2F9TA 5E41A 2GUPA 4CERA 4JI2K 5BPNA 4DR5K 3KWIA 4WQ5C 2KKZA 4CZGA 3EL2A 2GBZA 1XUPO 4FK4A 1T7PA 4IJNA 1HYSA 4YOUA 3VEYA 1HKCA 1MU2A 1RDAA 3C0BA 2Z1JA 1KVBA 1BQMA 1BOTO 3MMVA 2FF3B 3ZYYX 3V1RA 3OYDA 3A5OC 1SL2A 4CHPA 1WSIA 3VQEA 4M3ZA 2B5JA 3IG1A 3OYKA 1W7AA 4CJSA 3VQQA 4AM6A 3IKMA 4JKHA 4CZLA 3RR8A 5H1SQ 4CJRA 3O6WA 2KFNA 4CBXA 4FO0A 1JCEA 4A61A 5CE3A 2XHBA 5SWMA 5HRRA 2HHVA 1HNVA 3DLBA 3VGMA 4JK7A 4O0IA 3KWGA 5EU7A 4DS4A 3WXMB 3L2WA 3AO2A 3QETA 1HYZA 4BRAA 1SZ2A 4FLUA 3LP2A 4N5SA 4X62K 4WFNL 5M1NA 4CEAA 3PIPL 1NGIA 1T05A 2UU9K 4O4GA 3MECA 4JN4A 5DM7L 1JL1A 4OLBA 4H0PA 4YOTA 2PAVA 3V9WA 1VQLN 2YHBA 1D9FA 1TKTA 2ZGYA 4JKAA 4BEBA 2UYTA 3EY1A 3CCLN 1BWFO 2P1JA 2V7YA 2OTLN 1IBLK 1RT7A 3B6PA 4H0OA 1QSLA 3KK7A 2XY6A 2ZWHA 5AQMA
chains in the Genus database with same CATH topology
3DXMB 4XEIA 2AP1A 4FWLA 5ADXA 1W97L 3EE9A 3R6MA 2IVNA 1JCFA 2KLAA 3J7ZO 3ZEUA 4A2AA 1U6ZA 4IXCA 3LM2A 1U2VA 1NGEA 2NRRA 1Q81O 1Z6RA 4RWTA 2QXLA 3HZ6A 3O8MA 4JKGB 4NLCA 5AQHA 4B1ZA 5AZJA 2A3ZA 3RSEA 3KZBA 2FSKA 4NO7A 4B1VA 3TTCA 1WOQA 4O5FA 3HBTA 3C7NA 2NRVA 3O4WA 3P39A 4ISFA 4BE7B 1T6CA 4CZIA 3TTDA 3ENOA 4JNEA 3ZETA 3CCSN 1NMDA 5C0YA 2HSTA 5EOYA 4GNIA 3ID6A 4FPBA 4Y0WA 1S72N 4QS9A 1HKBA 3EZWA 5BRFA 3DLLL 1K8KB 3IUCA 1WUAA 3EKSA 3TSQA 1LCUA 2HBMA 2QM1A 4GY2B 1T6DA 2P9NB 3HI0A 4OPAA 1U2VB 2E2PA 2Q31A 5JVGL 1X3MA 1YHQN 3VPZA 2RHKA 4H03B 3RSEB 1YIJN 4WCEL 2VWBA 2YHYA 2PBDA 4FWNA 1G99A 3C7NB 2QWQA 2FSNA 4IO8A 3DXKA 3FZKA 4XJXA 4MO5A 4E1JA 4FOIA 3CCVN 2ASPA 4ILGB 2IVPA 3ZETB 3GG4A 4BC2A 3UKUA 5JLFA 2D1KA 2NRHA 3Q7BA 5GAHP 4CZMA 3D2EA 5EX5A 5GADP 3MWPA 3G4SN 4CZJA 1BG3A 3ZX3A 4AM7A 4NB4A 3G25A 3SMSA 1GLEG 4BRCA 5GIPA 2D0PA 2NNWA 3UKRA 1GLJO 3H1VX 3OBYA 3SJHA 3WT0A 3CHWA 3FZHA 3A5LC 2EWSA 4O8UA 2P9IA 2QWPA 2ITMA 3RVCA 3UKUB 1BA0A 2ZJRL 1ATSA 4IZ9A 4YOWA 5AQKA 2OANA 3N4QA 4JEPA 4BRQA 4FWOA 1SQKA 2E1YA 2VYPA 3JS6A 1M1KO 3D2EB 1QVFM 4JD2A 1LOTB 4NLBA 1DKGD 2D0OA 3VEWA 3U4LA 3ENBA 4JKFA 3O1WA 2Q2RA 1NWKA 4B1WB 5EXWA 2GELA 4RCHA 3W3DA 4KH4A 1ATNA 4WQ4C 4UY8O 4BRFA 3WEEA 4BR2A 5HL7L 2ASOA 2JWKA 4GV6A 3VEXA 4BECA 4JKEA 5KQDA 2P9IB 5AR0A 3GBTA 4QS7A 3MN6A 4WFAL 4DCHA 3J8AA 5HOOA 3CCRN 1KC8O 3JXUA 1YJ9N 2ZF5O 4IOXA 3R9PA 3BP8A 4MDAA 1VQPN 1QQNA 5F1XA 1X3NA 4BQZA 3S41A 2FSJA 4XH1A 3AARA 3NVMA 1XQSC 3EN9A 3CQXA 1X9JA 1HLUA 3QB0A 4A57A 3CCUN 3VGLA 1Q7YO 4FVUA 5M1FA 4JK8A 2J4RA 1QHAA 2P9KB 3HM8A 5BRHA 3H1QA 3WEEB 3E9OA 3BUZB 2KHOA 3E1YA 3O9SA 4CI6A 3PIOL 2CGKA 2NRXA 3L0QA 4JHDA 1VQMN 1H1VA 3FGUA 2WUSA 1BA1A 3EKUA 5C10A 4OO1J 4WQ5A 4YDUC 2W00A 2RE2A 1KAYA 3IDHA 4JAXA 4RTFD 4A62A 4OPHA 1NM1A 2QWMA 3ATUA 3CI5A 4BREA 4WYBA 3EO3A 5C2DA 1K9MO 2Q97A 3LDLA 5TKYA 2C1GA 2HBJA 3E9LA 4ILJA 5BN9A 5GAGP 5FPNA 1RFQA 3VERA 4BRDA 2F9WA 3TPQA 5C12A 3CCEN 4MO4A 3ID8A 3PLAA 1CZAN 4BR9A 2NRWA 4H5RA 4CD3A 2E20A 4M7XA 3CJ1A 4O8KA 3NVKA 3MCAB 1KAZA 1ATRA 4FOEA 3VTIA 3H3OB 4H5WA 2ZGZA 3SAGA 5AQPA 4QS8A 3CC7N 2Q0RA 3L4QA 2DPNA 5DM6L 4ILHA 2I7PA 5M1KA 5KPTA 2A5XA 5BRDA 3VETA 3A5MC 3N4PA 3CETA 1E4FT 4M63C 3FR0A 3FZMA 3M5RA 2YHXA 3CC2N 3WXJA 4G9ZA 1MWMA 5CHIA 4JKCA 3HOSA 4BC5A 3QMLA 3CJ7A 4H5NA 4BR5A 3ZEUB 3A5NC 3MCPA 3WXLA 2HOEA 4U67L 3MN7A 2H3GX 4R79A 1VQ9N 5FPEA 1VQ4N 2D4WA 5AZJB 3TSUA 1Z05A 2WFBA 3FFKB 5FPMA 4A2BA 3OW2M 5AQVA 1VQON 2FF6A 1NGAA 1NGGA 5AZIA 2P9SA 1XC3A 1YVNA 3O1BA 5M1OA 4PL7A 4GV3A 1C0FA 2A41A 1QQOA 3DAWA 4KH6A 5BPMA 3O9UA 4IEIA 3LL3A 1HPMA 4IJAA 4ISEA 4BRLA 2P9LA 3SBGA 3ULEA 1QZ5A 4F9OA 5JVHL 2QWRA 1MWKA 3D6RA 2A42A 3TSPA 3KHYA 2QWNA 2E2QA 4GV9A 4BRIA 4DKWA 4FWRA 1O13A 1TUUA 1JCGA 3QFUA 3H45C 3FE1A 3UB5A 2PFUA 2BH1A 3BF3A 4CBUA 2CGLA 2QWOA 3MN5A 3MX2A 4H5TA 2GTDA 2VGMA 3O9RA 3F5TA 3WUHA 2QA4N 4IDHA 3AAQA 1ESVA 4EHTA 3LM9A 5F0XA 5F2RA 4FWKA 3MK6A 3I55N 3G6EN 3QDKA 2P9SB 5AZIB 1YJNN 5BPLA 1W2BM 3DXKB 2HF3A 3VF6A 3CJAA 1HJOA 4CZKA 3E66A 4HWIA 4B1YB 2ASMA 4C23A 1KD1O 4FWPA 1DEJA 5AFUH 1HUXA 4BVOA 2P9LB 4PKHA 1R59O 3G71N 1E4GT 3ULEB 2GWJA 4CJ7A 1NJIO 2QI2A 2CGJA 2V7ZA 2A6AA 3R1XA 4I6MA 1K73O 1V4TA 5AQNA 3NMUA 4WF9L 2ZJQL 1OVYA 3BEXA 3HSCA 4CBWA 3DWLA 4YDUA 4YOXA 1BU6O 3VF4A 3AAPA 3CPEA 2Q1NA 5AQGA 5AQIA 2V51B 3UKRB 4DQ8A 5KQ8A 5GIOA 2YX6A 3K9JA 4PHTX 3LDPA 5AQYA 3WXKA 3T7ZA 2P9PA 3C65A 4FWMA 3VEZA 4IEEA 4DHYA 4HTLA 3I33A 4BG9A 5MLCQ 3EE8A 3P31A 3VESA 4FL9A 5AQRA 4K41A 5KPRA 3U8XA 1NLVA 3SLCA 2HBKA 5BR9A 5AQUA 4H0XB 3U9ZA 2CH6A 3U9DA 5C2FA 1D4XA 4JD2B 4B9QA 1GLCG 3GE1A 3VEVA 4BRKA 1BO5O 3AGRA 1SS6A 1ZXOA 1NGHA 1TUYA 2E2OA 3LDQA 4AF1A 4EIAA 3CPWM 1VQ8N 4BC3A 1DGKN 4Z94A 3CXCM 2BUPA 5AQOA 4DB3A 5LJVA 5EVZA 1P90A 3IFRA 2OTJN 3L6QA 4C1NI 2Q0UA 3VMFB 5EY4A 3HTVA 1HKGA 3OHRA 2P9PB 1P8ZA 1DT9A 4BRMA 1S3XA 5TKWA 4C1NK 3M3ZA 2QW9A 5CR4A 5AQFA 5FPDA 4LC9B 5AQSA 1NGBA 2NLXA 3AGKA 4L3QA 4BRNA 2WC9A 1S22A 1NGDA 3DXMA 1VQ6N 3FZLA 4YOVA 3R3LA 3SBTA 3W0LA 4M7YA 3CMAN 3A0IX 3CCQN 1QVGM 3QBWA 5GAEP 3LDNA 3MDQA 5JMVA 1TYQA 2CH5A 3OBWA 3O9QA 4EAHD 3P4IA 2IIRA 3QFPA 4JKGA 1MDUB 4WFBL 5AQTA 4CZEA 3AY9A 3VOVA 2VCPA 2YJFA 4EFHA 1N8RO 4BC4A 1BDGA 1BUPA 4YORA 1VQKN 3BF1A 1J6ZA 1T3VA 1EQYA 3KVGA 2W41A 4JHDB 3GOIA 3CCMN 5LY3A 5AQWA 4IO9L 2GWKA 1Q82O 3CMEN 2F7TA 4CZFA 1M90O 1KQSM 1ILYA 3TU5A 1T44A 3M6GA 1NGFA 3MWTA 1RDWX 1Q86O 1K8KA 3O80A 3T69A 5B8HA 1YI2N 2P9NA 4BRHA 3WQTA 4BR4A 1TYQB 3Q7CA 5JLHA 3CF5L 1KAXA 3D2FA 2JWLA 1GLAG 3ATVA 2Q36A 3CJ9A 3MN9A 4IWVA 4B1UB 4BQLA 4A5AA 3K9KA 4BY9C 4FSVA 1JJ2M 4H5VA 4PL8A 3SMPA 1YAGA 1VQ7N 3M1FA 3ZX0A 1GLBG 5E84A 1VAZA 4KH5A 2IVOA 5M1QA 4BRPA 1ZC6A 4FWQA 4BG8A 4IOAL 5AFUA 3HOTA 2QWLA 4BR0A 2ZJPL 3CERA 3CC4N 2GX9A 1NBWA 2I7NA 3H46O 2NRTA 3O08A 4WQ4A 3O9TA 4PKIA 5ELZA 2NRZA 2P9UA 4FPAA 1IJJA 1IG8A 1GLLO 2F9TA 2FXUA 3D7EO 5I9EB 5ADXH 3O5BA 2GUPA 4PKGA 4B1XB 4YOYA 1NGJA 2E1ZA 3HRGA 5BPNA 3GDQA 3D2FB 3KWIA 2KKZA 3CJBA 4WQ5C 3VGKA 4BGAA 4CZGA 3GL1A 3EL2A 4BGBA 1XUPO 4IJNA 3C6HA 4YOUA 3VEYA 1HKCA 3C0BA 1NGCA 4CZHA 1YUWA 3WQUA 4MLHA 4BROA 5LJWA 2HF4A 1SAZA 1YF5L 3ENHA 1BOTO 3MMVA 5C15A 2FF3B 1RDUA 3F2KA 3ZYYX 4XH4A 1MA9B 2P9UB 5BREA 1ZBSA 2NZTA 3A5OC 4CD1A 3IMXA 3R8EA 2YJEA 5JICA 2E88A 5E26A 5AQJA 4J8FA 4IFEA 3F9MA 4K43A 3SK3A 3QBXA 3CQYA 4AM6A 4CZLA 3IKMA 4JKHA 4A59A 5H1SQ 2FLOA 3O6WA 2HBLA 4CBXA 1YXQA 1QZ6A 4FO0A 3CCJN 2C1IA 1RGIA 3WXIA 3VTHA 3MX5A 4H0YB 1JCEA 4A61A 3VENA 1Y64A 3L4IA 5AQZA 5CE3A 2WBNA 3I8BA 5M1PA 2E8AA 3SAHA 3VGMA 4XH5A 3CD6N 3CIPA 2QTDA 4JK7A 4EHUA 3KWGA 3H6EA 5AQLA 3WXMB 1HX1A 3E9PA 4K42A 2W40A 4I6MB 4BRAA 1EO1A 1SZ2A 4BR7A 1V4SA 4GVEA 1VQNN 2P9KA 1YITN 4K25A 3I56N 2YCHA 4WFNL 5M1NA 1VQ5N 3B8AX 2HMPA 1OKJA 1Q18A 4MDBA 3PIPL 1K8AO 3UE5A 1NGIA 4JKBA 5KPZA 5AQXA 4IOCL 4BVPA 3P38A 2GEMA 3ZX2A 4KBOA 3H3NO 4JN4A 4BRGA 5DM7L 4H0TB 3C6AA 4H0PA 4YOTA 2PAVA 5AQQA 3TTFA 3DJCA 1VQLN 2AA4A 2YI1A 1C0GA 4JKDA 2ZGYA 4FWSA 4JKAA 4BEBA 1YJWN 2UYTA 2QEXN 3CCLN 4A5BA 1BWFO 2YHWA 1KXPA 1GLDG 2BTFA 3SAFA 3QICA 2V7YA 3FZFA 2OTLN 3FLCO 1GLFO 3LDOA 3OA9A 4H0OA 4ISGA 4U7BA 5BN8A 4MLEA 3A8YA 2V52B 4H0VB 3CJCA 3VF2A 2VGNA 3KK7A 3VEOA 5GINA 1QQMA 2E2NA 2A40A 2ZWHA 5AQMA 4JK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXM B;  4XEI A;  2AP1 A;  4FWL A;  5ADX A;  3R6M A;  2IVN A;  1JCF A;  3ZEU A;  4A2A A;  1U6Z A;  4IXC A;  3LM2 A;  1U2V A;  1NGE A;  1Z6R A;  4RWT A;  2QXL A;  3HZ6 A;  3O8M A;  4B1Z A;  5AQH A;  5AZJ A;  2A3Z A;  3RSE A;  3KZB A;  2FSK A;  4NO7 A;  4B1V A;  1WOQ A;  4O5F A;  3HBT A;  3C7N A;  3O4W A;  4ISF A;  1T6C A;  4CZI A;  3ENO A;  4JNE A;  3ZET A;  1NMD A;  5EOY A;  4GNI A;  4FPB A;  4Y0W A;  4QS9 A;  1HKB A;  3EZW A;  5BRF A;  1K8K B;  3IUC A;  1WUA A;  3EKS A;  1LCU A;  2QM1 A;  4GY2 B;  1T6D A;  2P9N B;  3HI0 A;  1U2V B;  2E2P A;  2Q31 A;  1X3M A;  3VPZ A;  4H03 B;  3RSE B;  2VWB A;  2YHY A;  2PBD A;  4FWN A;  1G99 A;  3C7N B;  2QWQ A;  2FSN A;  4IO8 A;  3DXK A;  3FZK A;  4MO5 A;  4E1J A;  4FOI A;  2ASP A;  2IVP A;  3ZET B;  3GG4 A;  4BC2 A;  3UKU A;  5JLF A;  2D1K A;  2NRH A;  4CZM A;  3D2E A;  5EX5 A;  4CZJ A;  1BG3 A;  3ZX3 A;  4AM7 A;  4NB4 A;  3G25 A;  3SMS A;  1GLE G;  4BRC A;  2D0P A;  3UKR A;  1GLJ O;  3H1V X;  3SJH A;  3WT0 A;  3CHW A;  3FZH A;  3A5L C;  2EWS A;  2P9I A;  2QWP A;  2ITM A;  3UKU B;  1BA0 A;  1ATS A;  4IZ9 A;  5AQK A;  2OAN A;  4BRQ A;  4FWO A;  1SQK A;  2E1Y A;  2VYP A;  3JS6 A;  3D2E B;  4JD2 A;  1LOT B;  1DKG D;  2D0O A;  3VEW A;  3U4L A;  3O1W A;  2Q2R A;  1NWK A;  4B1W B;  5EXW A;  2GEL A;  4RCH A;  3W3D A;  4WQ4 C;  1ATN A;  4BRF A;  3WEE A;  4BR2 A;  2ASO A;  3VEX A;  5KQD A;  2P9I B;  5AR0 A;  3GBT A;  4QS7 A;  3MN6 A;  4DCH A;  3J8A A;  3JXU A;  2ZF5 O;  3R9P A;  3BP8 A;  1QQN A;  5F1X A;  1X3N A;  4BQZ A;  3S41 A;  2FSJ A;  4XH1 A;  3AAR A;  1XQS C;  3EN9 A;  3CQX A;  1X9J A;  1HLU A;  3QB0 A;  3VGL A;  2J4R A;  1QHA A;  2P9K B;  3HM8 A;  5BRH A;  3H1Q A;  3WEE B;  3BUZ B;  2KHO A;  4CI6 A;  2CGK A;  3L0Q A;  4JHD A;  1H1V A;  3FGU A;  2WUS A;  1BA1 A;  3EKU A;  4WQ5 A;  4YDU C;  1KAY A;  3IDH A;  4JAX A;  4RTF D;  4A62 A;  1NM1 A;  2QWM A;  3ATU A;  3CI5 A;  4BRE A;  4WYB A;  3EO3 A;  2Q97 A;  3LDL A;  5TKY A;  5BN9 A;  5FPN A;  1RFQ A;  3VER A;  4BRD A;  2F9W A;  3TPQ A;  4MO4 A;  3ID8 A;  1CZA N;  4BR9 A;  4CD3 A;  4H5R A;  2E20 A;  4M7X A;  3CJ1 A;  4O8K A;  1KAZ A;  1ATR A;  4FOE A;  3H3O B;  4H5W A;  2ZGZ A;  5AQP A;  4QS8 A;  2Q0R A;  2DPN A;  2I7P A;  5KPT A;  2A5X A;  5BRD A;  3VET A;  3A5M C;  3CET A;  1E4F T;  4M63 C;  3FR0 A;  3FZM A;  2YHX A;  3WXJ A;  1MWM A;  4BC5 A;  3QML A;  3CJ7 A;  4H5N A;  4BR5 A;  3ZEU B;  3A5N C;  3MCP A;  3WXL A;  2HOE A;  3MN7 A;  2H3G X;  5FPE A;  2D4W A;  5AZJ B;  4A2B A;  1Z05 A;  3FFK B;  5FPM A;  5AQV A;  2FF6 A;  1NGA A;  1NGG A;  5AZI A;  2P9S A;  1XC3 A;  1YVN A;  3O1B A;  4PL7 A;  1C0F A;  2A41 A;  1QQO A;  3DAW A;  5BPM A;  3LL3 A;  1HPM A;  4IJA A;  4ISE A;  4BRL A;  2P9L A;  3ULE A;  1QZ5 A;  4F9O A;  2QWR A;  1MWK A;  2A42 A;  3KHY A;  2QWN A;  2E2Q A;  4BRI A;  4FWR A;  1TUU A;  1JCG A;  3QFU A;  3H45 C;  3FE1 A;  3UB5 A;  3BF3 A;  4CBU A;  2CGL A;  2QWO A;  3MN5 A;  4H5T A;  2GTD A;  3WUH A;  3AAQ A;  1ESV A;  4EHT A;  3LM9 A;  5F0X A;  5F2R A;  4FWK A;  3MK6 A;  3QDK A;  2P9S B;  5AZI B;  5BPL A;  3DXK B;  2HF3 A;  3VF6 A;  3CJA A;  1HJO A;  4CZK A;  4HWI A;  4B1Y B;  2ASM A;  4C23 A;  4FWP A;  1DEJ A;  5AFU H;  1HUX A;  4BVO A;  2P9L B;  4PKH A;  1R59 O;  1E4G T;  3ULE B;  2GWJ A;  4CJ7 A;  2CGJ A;  2V7Z A;  2A6A A;  4I6M A;  1V4T A;  5AQN A;  3BEX A;  3HSC A;  4CBW A;  3DWL A;  4YDU A;  1BU6 O;  3VF4 A;  3AAP A;  2Q1N A;  5AQG A;  5AQI A;  2V51 B;  3UKR B;  4DQ8 A;  5KQ8 A;  3LDP A;  5AQY A;  3WXK A;  2P9P A;  4FWM A;  3VEZ A;  4DHY A;  4HTL A;  3I33 A;  4BG9 A;  3VES A;  4FL9 A;  5AQR A;  4K41 A;  5KPR A;  3U8X A;  1NLV A;  3SLC A;  5BR9 A;  5AQU A;  4H0X B;  3U9Z A;  2CH6 A;  3U9D A;  1D4X A;  4JD2 B;  4B9Q A;  1GLC G;  3GE1 A;  3VEV A;  4BRK A;  1BO5 O;  4EIA A;  1ZXO A;  1NGH A;  1TUY A;  2E2O A;  3LDQ A;  4BC3 A;  1DGK N;  4Z94 A;  2BUP A;  5AQO A;  4DB3 A;  5LJV A;  5EVZ A;  3IFR A;  3L6Q A;  2Q0U A;  5EY4 A;  3HTV A;  1HKG A;  3OHR A;  2P9P B;  1P8Z A;  4BRM A;  1S3X A;  3M3Z A;  2QW9 A;  5AQF A;  5FPD A;  4LC9 B;  5AQS A;  1NGB A;  2NLX A;  4L3Q A;  4BRN A;  3DXM A;  1S22 A;  1NGD A;  3FZL A;  3W0L A;  4M7Y A;  3A0I X;  3QBW A;  3LDN A;  3MDQ A;  5JMV A;  1TYQ A;  2CH5 A;  4EAH D;  3P4I A;  2IIR A;  3QFP A;  1MDU B;  5AQT A;  4CZE A;  3AY9 A;  3VOV A;  2VCP A;  2YJF A;  4EFH A;  4BC4 A;  1BDG A;  1BUP A;  3BF1 A;  1J6Z A;  1EQY A;  3KVG A;  2W41 A;  4JHD B;  3GOI A;  5LY3 A;  5AQW A;  2GWK A;  4CZF A;  3TU5 A;  1T44 A;  3M6G A;  1NGF A;  1RDW X;  1K8K A;  3O80 A;  5B8H A;  2P9N A;  4BRH A;  3WQT A;  4BR4 A;  1TYQ B;  5JLH A;  1KAX A;  3D2F A;  3MN9 A;  3CJ9 A;  1GLA G;  2Q36 A;  3ATV A;  4IWV A;  4BQL A;  4B1U B;  4FSV A;  4H5V A;  4PL8 A;  3SMP A;  1YAG A;  3M1F A;  3ZX0 A;  1GLB G;  5E84 A;  2IVO A;  4BRP A;  1ZC6 A;  4FWQ A;  4BG8 A;  5AFU A;  2QWL A;  4BR0 A;  3CER A;  1NBW A;  2I7N A;  3H46 O;  3O08 A;  4WQ4 A;  4PKI A;  5ELZ A;  2P9U A;  4FPA A;  1IJJ A;  1IG8 A;  1GLL O;  2F9T A;  2FXU A;  3D7E O;  5I9E B;  5ADX H;  3O5B A;  2GUP A;  4PKG A;  4B1X B;  1NGJ A;  2E1Z A;  5BPN A;  3GDQ A;  3D2F B;  4WQ5 C;  3CJB A;  3VGK A;  4CZG A;  4BGA A;  3GL1 A;  3EL2 A;  4BGB A;  1XUP O;  4IJN A;  3VEY A;  1HKC A;  3C0B A;  1NGC A;  4CZH A;  1YUW A;  3WQU A;  4MLH A;  4BRO A;  5LJW A;  2HF4 A;  1SAZ A;  3ENH A;  1BOT O;  3MMV A;  2FF3 B;  4XH4 A;  1MA9 B;  2P9U B;  5BRE A;  1ZBS A;  2NZT A;  3A5O C;  4CD1 A;  3IMX A;  3R8E A;  2YJE A;  5JIC A;  2E88 A;  5E26 A;  5AQJ A;  4J8F A;  3F9M A;  4K43 A;  3SK3 A;  3QBX A;  3CQY A;  4AM6 A;  4CZL A;  2FLO A;  3O6W A;  4CBX A;  1YXQ A;  1QZ6 A;  4FO0 A;  1RGI A;  3WXI A;  4H0Y B;  1JCE A;  4A61 A;  3VEN A;  1Y64 A;  3L4I A;  5AQZ A;  5CE3 A;  3I8B A;  2E8A A;  3VGM A;  4XH5 A;  3CIP A;  4EHU A;  3H6E A;  5AQL A;  1HX1 A;  4K42 A;  2W40 A;  4I6M B;  4BRA A;  1SZ2 A;  4BR7 A;  1V4S A;  2P9K A;  4K25 A;  2YCH A;  3B8A X;  2HMP A;  1OKJ A;  1Q18 A;  3UE5 A;  1NGI A;  5KPZ A;  5AQX A;  4BVP A;  2GEM A;  3ZX2 A;  4KBO A;  3H3N O;  4JN4 A;  4BRG A;  4H0T B;  4H0P A;  2PAV A;  5AQQ A;  3DJC A;  2AA4 A;  2YI1 A;  1C0G A;  2ZGY A;  4FWS A;  2UYT A;  1BWF O;  2YHW A;  1KXP A;  1GLD G;  2BTF A;  3QIC A;  2V7Y A;  3FZF A;  3FLC O;  1GLF O;  3LDO A;  4H0O A;  4ISG A;  5BN8 A;  4MLE A;  3A8Y A;  2V52 B;  4H0V B;  3CJC A;  3VF2 A;  3VEO A;  1QQM A;  2E2N A;  2A40 A;  2ZWH A;  5AQM A; 
#chains in the Genus database with same CATH topology
 3DLG A;  4LFC K;  4FLZ A;  3EE9 A;  5HP1 A;  4KO0 A;  1UAX A;  3K5N A;  3J7Z O;  3ZEU A;  4IXC A;  4LF8 K;  3TAM A;  3LM2 A;  3TAE A;  3MEG A;  1WOQ A;  3ASM A;  4O5F A;  3HBT A;  1LAW A;  4KHY A;  2NRV A;  4BE7 B;  3TTD A;  3ENO A;  3LP3 A;  4M3U A;  3ID6 A;  4K8Z A;  5BRF A;  4FZX C;  1K8K B;  3IUC A;  2IGI A;  3EKS A;  2QKB A;  3QEP A;  2P5O A;  2AJQ A;  5JEN A;  2P9N B;  3ULD A;  2Q31 A;  1X3M A;  1YHQ N;  2RKI A;  3KTQ A;  4CJ4 A;  1RTD A;  3SV3 A;  2KW4 A;  2VWB A;  3PUF A;  1G99 A;  3C7N B;  1RT6 A;  2QWQ A;  4FOI A;  2IVP A;  4LH5 A;  1Y97 A;  3ZET B;  4BC2 A;  3K5M A;  3OJS A;  4DFM A;  2NRH A;  3Q7B A;  1ASU A;  4Z0U A;  4CZJ A;  4JV5 K;  4BRC A;  1GLJ O;  4FJN A;  4H4O A;  1JLB A;  3WT0 A;  3KD5 E;  2QKK A;  1B9D A;  2EWS A;  2HB5 A;  3NGI A;  4O8U A;  4JI8 K;  2P9I A;  3RVC A;  4CGH A;  2KTQ A;  2OAN A;  4BRQ A;  4FWO A;  2E1Y A;  2RPI A;  4DTP A;  3AVA A;  1XC9 A;  4JKF A;  2IDO A;  2Q2R A;  4FYD A;  3W3D A;  4WQ4 C;  4UY8 O;  5FRN A;  5HL7 L;  2OCE A;  4GV6 A;  3VEX A;  4E72 A;  1CXU A;  1BCM A;  5AR0 A;  3GBT A;  1EKE A;  4CF9 A;  4DCH A;  1WAJ A;  2ITG A;  4CHZ A;  4IOX A;  3BP8 A;  1QQN A;  1WNS A;  4KHU A;  1BCO A;  4UQG A;  3CCU N;  1HLU A;  4A57 A;  3THW B;  3VGL A;  3NF9 A;  1IV0 A;  1SL0 A;  1U47 A;  2J4R A;  1QHA A;  3TI0 A;  3H1Q A;  4Y1D A;  3K5O A;  1S1W A;  1SL1 A;  4HUE A;  3PIO L;  4KHP K;  3O3G A;  2NRX A;  4JHD A;  1VQM N;  1BA1 A;  3EKU A;  1S6Q A;  4WQ5 A;  2QXF A;  4FM0 A;  2P5G A;  4OKE A;  1VSL A;  1BGX T;  3EYZ A;  4ELU A;  1C1B A;  3EO3 A;  4WYB A;  2Q97 A;  3LDL A;  5TKY A;  4KB1 A;  3J80 O;  3OYL A;  3TPQ A;  3CCE N;  4DV7 K;  4CJP A;  1HRH A;  3OJU A;  5HRP A;  4OLA A;  3PLA A;  4FW1 A;  4CFA A;  2KZM A;  4M7X A;  4OGC A;  3IS9 A;  3MCA B;  4FOE A;  1EWR A;  1RT2 A;  4DFJ A;  4CF1 A;  4B8C A;  2Q0R A;  1OH6 A;  3LPT A;  2DPN A;  3THV A;  2I7P A;  5M1K A;  3HK2 A;  5KPT A;  2A5X A;  5BRD A;  3VET A;  3N4P A;  2UXD K;  4KPY A;  3CET A;  4M63 C;  3FZM A;  1DTT A;  4B3R K;  4BWM A;  1TGO A;  4G9Z A;  2Z1H A;  4JKC A;  5CHI A;  3CJ7 A;  3A5N C;  2B4J A;  4U67 L;  3V81 A;  1SV5 A;  4N56 A;  2G8I A;  3TSU A;  2XY5 A;  4JRP A;  2FF6 A;  1NGA A;  2F8S A;  5J2P A;  5M1O A;  4OX9 K;  1QQO A;  3DAW A;  3O9U A;  4AHS A;  4BRL A;  1JLE A;  3SBG A;  3MEE A;  1ZBF A;  4OJR A;  3KHY A;  4LF4 K;  1TKZ A;  3SQ0 A;  1O13 A;  3H45 C;  3FE1 A;  4FVM A;  5HRN A;  4YY3 K;  3MN5 A;  3MX2 A;  4AQY K;  3F5T A;  4LD0 A;  5CYQ A;  3O4N A;  4EHT A;  3RTV A;  3I55 N;  3MXI A;  2O8C B;  2P9S B;  4BE0 A;  1ASW A;  4NCA A;  3DLE A;  1CZB A;  3NBP A;  1EXQ A;  4CK3 A;  4HWI A;  2HW3 A;  1WSF A;  4BVO A;  3KJV A;  4KTQ A;  4F3T A;  4CVN E;  2QI2 A;  2CGJ A;  3HST B;  2A6A A;  3VQ5 A;  1Q9X A;  2G8U A;  4CBW A;  3HSC A;  3DWL A;  4YNQ A;  3AVM A;  4DUY K;  3PX0 A;  2Q1N A;  1A5V A;  3LP0 A;  3UKR B;  2YX6 A;  4CHO A;  3OYA A;  3T7Z A;  3C65 A;  3PV8 A;  4DHY A;  3V1Q A;  1NK8 A;  3NHG A;  2OA8 A;  3HPO A;  1N6Q A;  1NLV A;  3SLC A;  1RTH A;  5AQU A;  4HCC A;  3U9D A;  2B6A A;  5C2F A;  1D4X A;  3KD1 E;  5J1E A;  2VG5 A;  3H08 A;  2EHG A;  3DOL A;  3AGR A;  1SS6 A;  3LDQ A;  4B3M K;  3TR8 A;  4Z94 A;  1R0A A;  5EVZ A;  2OTJ N;  5EY4 A;  3HTV A;  1HKG A;  1TAU A;  2P9P B;  2DY4 A;  4BRM A;  3FFI A;  5TKW A;  3M3Z A;  1REV A;  5AQF A;  1Q9Y A;  4FXD A;  4LC9 B;  1NGB A;  2NLX A;  3AGK A;  4BDP A;  1S22 A;  1KSP A;  3L2U A;  4FJ7 A;  4W5N A;  2FBX A;  3SBT A;  3W0L A;  4FJL A;  4JI6 K;  4DLE A;  3A0I X;  1VHX A;  4C8M A;  1QVG M;  3QBW A;  4JI7 K;  4KB0 A;  1MDU B;  4DTM A;  2IS3 A;  1NOZ A;  3AY9 A;  3KVG A;  3CCM N;  1WBB A;  3DM2 A;  1N33 K;  4DU3 A;  2UXB K;  3L2R A;  4J2E A;  1FKO A;  1EWQ A;  1T44 A;  1GOC A;  4ID1 A;  1K8K A;  1N34 K;  3ZSY A;  3AVF A;  4V19 S;  1C6V A;  2P9N A;  3S3M A;  1J5O A;  3Q7C A;  2HHW A;  4CEB A;  3CF5 L;  1GLA G;  3ATV A;  2Q36 A;  4BQL A;  5LMU K;  3NFA A;  1NJW A;  1VQ7 N;  5M1Q A;  2Y1J A;  4CES A;  4BRP A;  1ZC6 A;  4W5Q A;  4DWI A;  4BG8 A;  4DR4 K;  5IWA K;  3AA3 A;  3CER A;  3A2F A;  2FC0 A;  2BGG A;  4X66 K;  2I7N A;  4WQ4 A;  2G8H A;  5ELZ A;  2P9U A;  4FM1 A;  5I9E B;  1U49 A;  5ADX H;  4BAC A;  2ETJ A;  4B1X B;  1VSD A;  5HBM A;  3HRG A;  1D9D A;  4PA1 A;  3CJB A;  3GL1 A;  3HVR A;  1UWB A;  4K0K K;  3C6H A;  1G15 A;  1NGC A;  4BRO A;  2HF4 A;  3ENH A;  3AO5 A;  4O55 A;  1C1A A;  3ZT0 A;  3KKS A;  3TWH A;  2VG6 A;  2YJE A;  5JIC A;  1L5U A;  1NJY A;  4IFY A;  4J8F A;  4ELV A;  4FJ9 A;  2OPR A;  1FKP A;  4XIU A;  2YNH A;  4CJK A;  3V9Z A;  1YXQ A;  3WXI A;  3MX5 A;  4H0Y B;  4YHH K;  5AQZ A;  3VA3 A;  3OYF A;  1UA0 A;  3ZLJ A;  2GUI A;  2WBN A;  4JI1 K;  3ITH A;  4FK2 A;  3CD6 N;  3CIP A;  4G1Q A;  4EHU A;  1VSM A;  4M3X A;  4B9T A;  4K42 A;  4QAG A;  4FJI A;  4I6M B;  3THW A;  2KZZ A;  1EO1 A;  4BR7 A;  2NUB A;  3LPU A;  4YFU A;  4GVE A;  1VQN N;  2VWK A;  4K25 A;  3S9H A;  3IRX A;  3C6U A;  4I9L A;  4M41 A;  4HHT A;  1HPZ A;  3B8A X;  1NK0 A;  3NF7 A;  2XO7 A;  2O8B B;  3CYG A;  3UE5 A;  3T3F A;  1E3M A;  5AQX A;  4BVP A;  3AVG A;  3H3N O;  4Y1C A;  1LV5 A;  3I8D A;  4H0T B;  2X74 A;  3CFP A;  2ZD1 A;  3TTF A;  5KI6 A;  2YI1 A;  1C0G A;  4JKD A;  1UOC A;  4DV0 K;  3HL8 A;  1YJW N;  4KRF A;  3ZCM A;  1XI1 A;  3QEX A;  3FLC O;  2DFF A;  3OYM A;  1O1W A;  4MLE A;  4X64 K;  3QES A;  4F4K A;  1L3S A;  4KI4 A;  2VGN A;  2R7Y A;  5GIN A;  1QQM A;  5DMR A;  1BHL A;  3NDK A;  3LAK A;  4JK9 A;  3DXM B;  4XEI A;  4FWL A;  1HQU A;  3TAR A;  1W97 L;  1YT3 A;  3OYB A;  4CGD A;  3G0Z A;  4E7J A;  1KVA A;  1NGE A;  2O8D B;  2QXL A;  3BDP A;  4JKG B;  4B9M A;  3RSE A;  4B1V A;  5A2Q O;  4CF8 A;  3SV4 A;  1QTM A;  4CZI A;  4JNE A;  5C0Y A;  1NMD A;  2HST A;  3RMC A;  4GNI A;  3OYH A;  4Y0W A;  3EZW A;  4JI0 K;  4RW6 A;  3OTO K;  1NK4 A;  4MQ3 A;  4DTJ A;  1LCU A;  3SI6 A;  1U2V B;  5JVG L;  3DLR A;  2GV9 A;  4E0D A;  2ZQB A;  4E19 A;  2YKN A;  1YIJ N;  1IKV A;  2PBD A;  4FK0 A;  1OH8 A;  3FZK A;  4E1J A;  3HT3 A;  2WON A;  2ASP A;  4ILG B;  5JLF A;  1VK0 A;  3THY A;  4LF7 K;  5GAH P;  2IOC A;  3I0S A;  2W6L A;  1RNH A;  5GAD P;  2JGU A;  4DTO A;  4AM7 A;  5GIP A;  1GLE G;  4ID5 A;  1IO2 A;  4CF0 A;  3UKR A;  4F8R A;  3H1V X;  3SQ4 A;  1I3A A;  3AVN A;  3L3V A;  1J53 A;  2ITM A;  3UKU B;  3PX4 A;  1NK7 A;  4FJM A;  1KFD A;  1XWL A;  4C8L A;  4FJ5 A;  3ZT1 A;  2PY5 A;  1SQK A;  1X9M A;  3D2E B;  1QVF M;  2VQE K;  1DKG D;  4KHQ A;  3ENB A;  4FLV A;  4CHQ A;  3SUP A;  3SUO A;  4DQP A;  1NWK A;  3L3U A;  4B1W B;  4BDY A;  4MFB A;  5EXW A;  4RCH A;  2OPP A;  4M42 A;  1IBK K;  4KRE A;  4O5B A;  4OKJ A;  4BEC A;  1HMV A;  3AVI A;  4QS7 A;  3OYI A;  5HOO A;  2I5J A;  3JXU A;  3RMD A;  1YJ9 N;  2ZF5 O;  2Q3S A;  1VQP N;  1X3N A;  4GMJ B;  3S41 A;  4XH1 A;  3AV9 A;  3EN9 A;  3CQX A;  4DQS A;  1X9J A;  2E4L A;  3QB0 A;  3LZI A;  4ZTJ A;  1Q7Y O;  2D0B A;  4CJV A;  3MXM A;  4CJL A;  3HM8 A;  5BRH A;  1L3T A;  3CM6 A;  3WEE B;  4WE1 A;  3ZT2 A;  3OS1 A;  1N5Y A;  4DR6 K;  3U3G A;  3FGU A;  1FK9 A;  2WUS A;  2W00 A;  2O4I A;  1NKE A;  4E1M A;  3KLG A;  1NM1 A;  2QWM A;  3CI5 A;  5C2D A;  1K9M O;  4IG3 A;  2HBJ A;  4ILJ A;  1RFQ A;  3VER A;  3QNN A;  4MO4 A;  1RT5 A;  1TKD A;  4DSF A;  2NRW A;  4H5R A;  2E20 A;  1VSJ A;  4O8K A;  3NVK A;  1KAZ A;  2YHA A;  4CHY A;  4I2P A;  4H5W A;  3VQ8 A;  3TAF A;  3M5R A;  4RW7 A;  3WXJ A;  4BDZ A;  3VQ6 A;  4DLG A;  1S5J A;  1MWM A;  3AA5 X;  3HOS A;  4BC5 A;  3QML A;  1WSE A;  4BR5 A;  3MCP A;  4CEF A;  1RBS A;  3OYE A;  2YV0 X;  4ICL A;  3FFK B;  5FPM A;  1BIU A;  3OW2 M;  4OGE A;  2VQF K;  1VQO N;  3DMJ A;  4JS5 A;  3SCX A;  1NGG A;  1HJR A;  3O1B A;  4GW6 A;  1QSY A;  5BPM A;  5LMN K;  1TK8 A;  4ISE A;  2P9L A;  3LAM A;  4DQQ A;  2Y1I A;  1RBV A;  2E2Q A;  4BRI A;  4FWR A;  5D3G A;  2UXC K;  2BH1 A;  4CBU A;  2CGL A;  4H5T A;  1ZYQ A;  1ESV A;  5F2R A;  3G6E N;  5AZI B;  4KHN A;  4Q5V A;  1YJN N;  1W2B M;  5KRS A;  4CZK A;  4BE1 A;  3E66 A;  3QLH A;  1KD1 O;  3HP9 A;  4CIF A;  1DEJ A;  4R5P A;  1XHX A;  4DMN A;  1KFS A;  3VQP A;  1E4G T;  3ULE B;  2GWJ A;  2VG7 A;  4CJ7 A;  2HHT A;  3TAB A;  4I6M A;  4Z4H A;  2HHU A;  1V4T A;  3NMU A;  4YOX A;  3VF4 A;  3CPE A;  5AQG A;  1NJZ A;  1KVC A;  5GIO A;  1BIS A;  3NH0 A;  4PHT X;  3ZSR A;  1RBU A;  4DFP A;  3WXK A;  3VQ9 A;  4HTL A;  4BG9 A;  4OKK A;  4K41 A;  4RW4 A;  5FDL A;  2HBK A;  5BR9 A;  2CH6 A;  4DFK A;  4JD2 B;  4B9Q A;  2O8E A;  1I94 K;  1KLM A;  4DU1 A;  1NGH A;  1Z26 A;  4AF1 A;  3O3H A;  3THX A;  4FLY A;  1QSS A;  3OY9 A;  3VMF B;  1QHT A;  4X65 K;  1KCF A;  2P51 A;  1HNW K;  2QW9 A;  1JLQ A;  4M3T A;  4CJW A;  5FPD A;  5AQS A;  1CXQ A;  1VQ6 N;  2WC9 A;  3DXM A;  4OPJ A;  1WB9 A;  3HP6 A;  4CJE A;  5GAE P;  2HHI A;  5JMV A;  1IKY A;  2YKM A;  3VN5 A;  2O8D A;  3HO1 A;  4CGF A;  2IIR A;  4JKG A;  4C8O A;  5AQT A;  2E6L A;  3VOV A;  1N8R O;  2YJF A;  4AHR A;  1BDG A;  3RR7 A;  1SKW A;  2PYL A;  1VQK N;  3BF1 A;  4CJF A;  3VA0 A;  2W41 A;  4IO9 L;  1Q82 O;  3CME N;  4FLW A;  1DTQ A;  4CZF A;  4KTW A;  4HUF A;  1M90 O;  3M6G A;  3K5L A;  1XHZ A;  2F4V K;  3NH1 A;  1NMN A;  4IG0 A;  3O80 A;  1FXX A;  3WQT A;  4BR4 A;  1TYQ B;  5JLH A;  2JWL A;  2DFH A;  3CJ9 A;  5KGX A;  4CCH A;  4PQU A;  4BY9 C;  4FSV A;  1U04 A;  1JJ2 M;  1YAG A;  4KH5 A;  2IVO A;  3RRG A;  1J54 A;  4FWQ A;  4DV3 K;  2UUC K;  2O8F B;  1U4B A;  1QQC A;  2Z1I A;  3SQ1 A;  4Q0B A;  3CC4 N;  3O08 A;  4FPA A;  3NGY A;  2OPQ A;  4E7L A;  1UA1 A;  2E1Z A;  3GDQ A;  3D2F B;  1IG9 A;  4BGB A;  4E89 A;  3AO3 A;  1W9H A;  3MED A;  5FLX O;  5LJW A;  1SAZ A;  4Z4G A;  4Z4E A;  1X9S A;  1J5E K;  3F2K A;  3VQB A;  4XH4 A;  3SUQ A;  5CZ1 A;  1ZBS A;  2NZT A;  1QE1 A;  2IAJ A;  3IMX A;  3J7Y P;  5AQJ A;  2XY7 A;  1GOB A;  1DLO A;  3F9M A;  4K43 A;  3SK3 A;  3QBX A;  1KLN A;  3CQY A;  2G8K A;  3L2V A;  1JLA A;  3ZSW A;  1WBD A;  1YTA A;  1VSI A;  1LWC A;  3HJF A;  2ZM6 K;  3CCJ N;  1RGI A;  4HUG A;  3OS2 A;  1HNX K;  1NOY A;  3VEN A;  3I0R A;  3I8B A;  2E8A A;  4B8A B;  2QTD A;  1X9W A;  3QEI A;  4DSL A;  1TL3 A;  3E9P A;  3HVT A;  5SZT A;  1ITG A;  4FZY A;  1RDD A;  4F3O A;  4NYF A;  3ZSZ A;  1YIT N;  4DTU A;  3BY5 A;  3CG7 A;  3DLK A;  1Q18 A;  1K8A O;  4IOC L;  3P38 A;  2GEM A;  4BRG A;  3K2P A;  3F73 A;  1WSG A;  3AVB A;  3PSF A;  5AQQ A;  2FBV A;  1RDC A;  1IBM K;  3AVC A;  4AH9 A;  4FWS A;  4FJH A;  2QEX N;  2HVI A;  2YHW A;  2BTF A;  3QIC A;  1IH7 A;  1GLF O;  3JAM O;  2Z1G A;  3OA9 A;  4ISG A;  3WNE A;  4E7H A;  4CFB A;  3A8Y A;  2V52 B;  3CJC A;  3O4Q A;  1CZ9 A;  4H4M A;  5ADX A;  3R6M A;  1IKX A;  1JCF A;  3K58 A;  2PZS A;  2KLA A;  4A2A A;  1RT4 A;  1U6Z A;  5IT9 O;  2BAN A;  1Q81 O;  4KI6 A;  4RG8 A;  3HZ6 A;  1JXE A;  4B1Z A;  5AQH A;  3D0P A;  4CFD A;  2A3Z A;  3C95 A;  3KZB A;  2FSK A;  4NO7 A;  3S3O A;  1CLQ A;  1K6Y A;  1S1V A;  3C7N A;  5DK5 A;  3O4W A;  2DFE A;  3P39 A;  4OVL A;  1NJX A;  1SUQ A;  3ZET A;  3CCS N;  1S72 N;  4QS9 A;  1HKB A;  3NH2 A;  4NXM K;  4B9L A;  4LSN A;  3DLL L;  4DU4 A;  1WUA A;  3TSQ A;  4CIE A;  4OPA A;  4GY2 B;  3HI0 A;  3VPZ A;  4H03 B;  4I7F A;  2YHY A;  4FWN A;  4CJQ A;  4IO8 A;  3KK3 A;  4MO5 A;  3WNH A;  3CM5 A;  2HNY A;  4DQR A;  3OYG A;  2D1K A;  5J2M A;  4EZ6 A;  3PX6 A;  2YNG A;  5JS1 A;  3M8S A;  4CZM A;  3MWP A;  2KQ2 A;  3G4S N;  3JSM A;  3PSI A;  4DQI A;  1TL1 A;  1L3V A;  3ZX3 A;  3DOK A;  4DTN A;  4B3O A;  2D0P A;  3CHW A;  3FZH A;  3A5L C;  1OH5 A;  1FW6 A;  1ATS A;  4IZ9 A;  4YOW A;  2OPS A;  4CEC A;  4JEP A;  1ZBH A;  3NAE A;  2VYP A;  1M1K O;  4FLX A;  4JYA K;  4JD2 A;  1N32 K;  1LOT B;  4NLB A;  1WN7 A;  2D0O A;  3VEW A;  3U4L A;  4B08 A;  3TAG A;  1XMO K;  3O1W A;  1C1C A;  3ZSQ A;  4CEQ A;  1SKR A;  2BDP A;  3AVJ A;  4HCB A;  4F2S A;  1OH7 A;  2A1S A;  3NE6 A;  2YNF A;  4BR2 A;  4DV5 K;  2ASO A;  4B3S K;  4JKE A;  5C42 A;  2P9I B;  4N47 A;  4WFA L;  3RMA A;  1KC8 O;  4JI5 K;  4O0J A;  1B9F A;  1N36 K;  2F96 A;  3NVM A;  2VWJ A;  4B9N A;  4FVU A;  1JKH A;  2P9K B;  3DLH A;  4LSL A;  1LW2 A;  3E9O A;  3BUZ B;  4ZTF A;  4ZHR A;  4CI6 A;  4CEO A;  2CGK A;  3L0Q A;  4DTS A;  1H1V A;  3DRS A;  5C10 A;  4OO1 J;  4W5R A;  3NF6 A;  1TAQ A;  3OS0 A;  1KAY A;  3IDH A;  5FRM A;  4RTF D;  4A62 A;  4OPH A;  3NF8 A;  4BRE A;  3V9X A;  2C1G A;  2OZM A;  1NKC A;  2QK9 A;  5GAG P;  5FPN A;  3L2Q A;  4RW9 A;  3QEV A;  4NCG A;  4M45 A;  1TKX A;  3ID8 A;  3AVK A;  1CZA N;  4BR9 A;  3CJ1 A;  4BE2 A;  3DRP A;  3VTI A;  1QS4 A;  3H3O B;  4JS4 A;  2RF2 A;  2ZGZ A;  3SAG A;  5AQP A;  4QS8 A;  3CC7 N;  3L4Q A;  3NCI A;  4FCY A;  1BQN A;  1E4F T;  3FR0 A;  3CC2 N;  4Z4C A;  3SUN A;  2H3G X;  4R79 A;  1VQ9 N;  5AZJ B;  4RW8 A;  4A2B A;  1Z05 A;  2WFB A;  3SPZ A;  4LY7 A;  4NXN K;  2KFZ A;  5AQV A;  4KV8 A;  4DR2 K;  4GV3 A;  2P9S A;  1XC3 A;  4DTX A;  2O8C A;  4PL7 A;  2A41 A;  2HHX A;  3P5J A;  4KH6 A;  4IEI A;  1HPM A;  5JVH L;  2QWR A;  4Z4F A;  3PY8 A;  2A42 A;  3TSP A;  1VSE A;  1JCG A;  3BF3 A;  1S6P A;  3O9R A;  3WUH A;  2QA4 N;  4IDH A;  3AAQ A;  3LM9 A;  5F0X A;  4FWK A;  3QDK A;  5BPL A;  3DXK B;  3K59 A;  4DV1 K;  5I3U A;  1VRT A;  1BIZ A;  3KK2 A;  3DYA A;  5AFU H;  1R59 O;  2RN2 A;  2V7Z A;  4JLH A;  3R1X A;  4N41 A;  1BL3 A;  1GOA A;  2ZJQ L;  3TAN A;  3BEX A;  1HR0 K;  4YDU A;  1KTQ A;  3O3F A;  3AVL A;  5AQI A;  2V51 B;  3T1Y K;  4IFV A;  3K9J A;  3LDP A;  3KK1 A;  4CGI A;  4DSK A;  2P9P A;  4FWM A;  3KLI A;  4B9V A;  2DTU A;  3I33 A;  4CIG A;  3RMB A;  4FL9 A;  5AQR A;  3LAL A;  1WAF A;  5I42 A;  4PWD A;  2D0C A;  3PO5 A;  4H0X B;  3U9Z A;  3TAP A;  3GE1 A;  1NKB A;  2E5L K;  4EIA A;  1ZBL A;  2W42 A;  1TUY A;  2E2O A;  4CJ5 A;  4FZZ A;  4BC3 A;  1F21 A;  3CXC M;  4GVM A;  2BUP A;  3DRR A;  4DB3 A;  3E01 A;  1P90 A;  2Q0U A;  4JI3 K;  3J7A P;  3OHR A;  3SJJ A;  2X78 A;  3QEW A;  5CR4 A;  2F8T A;  4E3S A;  4BRN A;  2X6N A;  3AO1 A;  4YOV A;  3OYJ A;  3R3L A;  4GKK K;  4M7Y A;  2HNZ A;  1JLG A;  3MDQ A;  1TV6 A;  1LWF A;  3OBW A;  4CF2 A;  5C25 A;  3P4I A;  1EP4 A;  3F9K A;  3QFP A;  5CYM A;  4EP5 A;  4WFB L;  1WSH A;  2VCP A;  2XY8 A;  4YOR A;  2HND A;  5LY3 A;  5AQW A;  4FJX A;  2YNI A;  3LP1 A;  2F7T A;  1VRU A;  1KQS M;  4Z4I A;  2HHS A;  1ILY A;  1NGF A;  1RDW X;  1Q86 O;  1J9A A;  1OVQ A;  5T7B A;  3T69 A;  4BRH A;  3G10 A;  4FLT A;  4IWV A;  4A5A A;  3K9K A;  3HXM A;  4H5V A;  3M1F A;  1GLB G;  5E84 A;  1VAZ A;  1S9E A;  3TAQ A;  4DV2 K;  3DI6 A;  1B92 A;  3P1G A;  2QWL A;  4BR0 A;  2ZJP L;  1NBW A;  3QIP A;  3H46 O;  4PKI A;  3T19 A;  1IG8 A;  1GLL O;  3D7E O;  2FXU A;  1S1X A;  3AVH A;  3O5B A;  4PKG A;  3LZJ A;  4YOY A;  1NGJ A;  2ZE2 A;  3VGK A;  1EX4 A;  4BGA A;  4W5T A;  5HRS A;  5FRO A;  1NG9 A;  1C0M A;  4CK2 A;  4CZH A;  1YUW A;  3WQU A;  4MLH A;  4O44 A;  1YF5 L;  5C15 A;  4DR1 K;  4W5O A;  4M3W A;  1HYV A;  1RDU A;  2IC3 A;  2LSN A;  1MA9 B;  2P9U B;  5BRE A;  4CD1 A;  1T8E A;  3R8E A;  2E88 A;  5E26 A;  4IFE A;  3T1H K;  3V6D A;  4I2Q A;  3KLH A;  1TK5 A;  4A59 A;  4FM2 A;  4B9S A;  2FLO A;  2W6K A;  3MXJ A;  3VQ7 A;  3ZT4 A;  2HBL A;  2C1I A;  1QZ6 A;  3VTH A;  2O8B A;  1NK6 A;  1NU0 A;  5LL6 Z;  1Y64 A;  3L4I A;  2WTU A;  5M1P A;  3SAH A;  4XH5 A;  5CY4 A;  4DS5 A;  4IKF A;  5HRO A;  3H6E A;  4KTZ A;  5AQL A;  1HX1 A;  2W40 A;  4DSI A;  3RWU A;  4M3R A;  4CEE A;  1XNQ K;  4GKJ K;  1V4S A;  2P9K A;  1JLF A;  3I56 N;  3KIO A;  2YCH A;  2HMI A;  3S5T A;  5KRT A;  4CW7 B;  1VQ5 N;  2HMP A;  1OKJ A;  4MDB A;  3OYC A;  1T03 A;  4JKB A;  5KPZ A;  1FJG K;  2D0A A;  4KBO A;  3ZX2 A;  3OYN A;  3C6A A;  1TK0 A;  3QNO A;  1A5W A;  3S3N A;  1BI4 B;  3DJC A;  3ZSX A;  2AA4 A;  4AIL C;  3CYM A;  4E1N A;  3K0S A;  4LH4 A;  4LF9 K;  3C6T A;  4H8K A;  4A5B A;  3V9S A;  1KXP A;  1GLD G;  1RBT A;  3FZF A;  3LDO A;  3OVN A;  5KTQ A;  4QOZ B;  4LFB K;  4U7B A;  4PUO A;  5BN8 A;  4HTU A;  4C8N A;  4H0V B;  2OZS A;  4NYN A;  3VF2 A;  3VEO A;  4AHV A;  1JXB A;  1JLC A;  2E2N A;  2A40 A;  3SAF A;  2BE2 A;  2AP1 A;  1IKW A;  1LWE A;  4N76 A;  2IVN A;  1U2V A;  2G8W A;  2NRR A;  1Z6R A;  4RWT A;  4I9Q A;  3O8M A;  4NLC A;  5AZJ A;  2JLE A;  1Q8I A;  4L8R B;  2UUB K;  3TTC A;  1RCH A;  4FW2 A;  5K14 A;  1KRP A;  4ISF A;  3ISN C;  1T6C A;  5JS2 A;  5EOY A;  4FPB A;  3AO4 A;  3CFR A;  4DF4 A;  3IAY A;  3WNF A;  2O4G A;  1W0H A;  1XMQ K;  2HBM A;  2QM1 A;  1T6D A;  2E2P A;  4F2R A;  4K8X A;  4E7I A;  4M3Y A;  2RHK A;  4DR3 K;  3RSE B;  1RDB A;  1ZBI A;  3SYZ A;  1YVU A;  4WCE L;  3KLF A;  2FSN A;  4XJX A;  3DXK A;  4CJ3 A;  3CCV N;  1VSH A;  3GG4 A;  3UKU A;  4J2D A;  4EZ9 A;  5CZ2 A;  4CGG A;  4LFA K;  4CEZ A;  1RIL A;  3D2E A;  1U48 A;  5EX5 A;  3LWM A;  1X1P A;  1BG3 A;  4NB4 A;  3G25 A;  3SMS A;  1S1T A;  3CFO A;  4FJK A;  2NNW A;  3OBY A;  4IDK A;  4PY5 A;  3SJH A;  5J2Q A;  1NNE A;  4NCB A;  3UIQ A;  4FJ8 A;  3QIN A;  2QWP A;  2ZJR L;  1BA0 A;  3THY B;  1LW0 A;  5AQK A;  3ZSO A;  3N4Q A;  3JS6 A;  2OYQ A;  3B6O A;  4AHC A;  1SKS A;  1RT3 A;  1S1U A;  2GEL A;  3V9U A;  3D45 A;  2X6S A;  1ATN A;  3ALY A;  3BZK A;  4KH4 A;  3AA4 A;  4BRF A;  3WEE A;  1D8Y A;  2FBT A;  2JWK A;  3ZT3 A;  2HHQ A;  4JRQ A;  1RBR A;  3U6F A;  5KQD A;  1YTU A;  3MN6 A;  3J8A A;  3CCR N;  3C94 A;  2ATQ A;  4CGJ A;  3R9P A;  1VSK A;  4MDA A;  5F1X A;  4BQZ A;  2FSJ A;  5AJ3 K;  3AAR A;  3HPG A;  1XQS C;  4LF6 K;  5M1F A;  4JK8 A;  1NK5 A;  2G8V A;  1HQE A;  3MAQ A;  4CFC A;  3PO4 A;  2KHO A;  3E1Y A;  3O9S A;  4FJJ A;  3AA2 A;  4CK1 A;  4E7K A;  4YDU C;  3L8B A;  1RT1 A;  2RE2 A;  5BR8 K;  4JAX A;  2HVH A;  4TSX A;  3ATU A;  3E9L A;  5BN9 A;  4KHW A;  4BRD A;  2F9W A;  5C12 A;  4IBN A;  4CD3 A;  4JI4 K;  2E6M A;  2FBY A;  1ATR A;  3QIO A;  5DM6 L;  4ILH A;  3A5M C;  1ASV A;  2YHX A;  1XNR K;  3T1A A;  4DV4 K;  3K57 A;  3BGR A;  2UUA K;  4H5N A;  1LAV A;  3ZEU B;  3M8R A;  1I39 A;  3WXL A;  2HOE A;  3MN7 A;  5C24 A;  5FPE A;  1VQ4 N;  2D4W A;  5J2N A;  3LWL A;  3KLE A;  3EEQ A;  4AHT A;  4DSE A;  4CHN A;  3VQ4 A;  5AZI A;  3SNN A;  1YVN A;  2D5R A;  1C0F A;  4B3T K;  4KHS A;  3EZ5 A;  4ELT A;  3LL3 A;  3J81 O;  4IJA A;  1WSJ A;  3ULE A;  1QZ5 A;  4F9O A;  1MWK A;  3D6R A;  2QWN A;  4GV9 A;  4DKW A;  1TUU A;  3QFU A;  3UB5 A;  2PFU A;  1WLJ A;  1Z25 A;  2QWO A;  2GTD A;  2VGM A;  3U3Y A;  3SPY A;  3QO9 A;  4DTR A;  3MK6 A;  1RTJ A;  1A5X A;  2PYJ A;  2HF3 A;  3VF6 A;  3CJA A;  1HJO A;  3VQA A;  4B1Y B;  2ASM A;  4C23 A;  3QER A;  4FWP A;  4BWJ A;  1HUX A;  2P9L B;  4PKH A;  3G71 N;  1NJI O;  1NK9 A;  1C0U A;  3SZ2 A;  1K73 O;  4KAZ A;  3HYF A;  5AQN A;  4WF9 L;  1OVY A;  4OPK A;  1S9G A;  1BU6 O;  3AAP A;  4CED A;  5KQ8 A;  4DQ8 A;  2G8F A;  1JL2 A;  5AQY A;  1HNI A;  3VEZ A;  4IEE A;  5MLC Q;  3EE8 A;  3P31 A;  3VES A;  5KPR A;  3U8X A;  1BI4 A;  1VSF A;  5KGW A;  3M8Q A;  4J2A A;  3M8P A;  4J2B A;  1GLC G;  3VEV A;  4BRK A;  1BO5 O;  1ZXO A;  3CPW M;  1VQ8 N;  3SQ2 A;  1DGK N;  5AQO A;  5LJV A;  3LDS A;  1L3U A;  3IFR A;  3L6Q A;  4C1N I;  2XRI A;  4KKO A;  3BZC A;  3VQC A;  3P83 D;  4EP4 A;  1P8Z A;  1DT9 A;  3ZSV A;  1S3X A;  4C1N K;  2HHH K;  3RRH A;  4DF8 A;  4L3Q A;  1NGD A;  3KKR A;  4DV6 K;  3FZL A;  2O8E B;  3CMA N;  1U45 A;  1RTI A;  3CCQ N;  3HPH A;  3LDN A;  1TYQ A;  2CH5 A;  4CJU A;  3O9Q A;  4EAH D;  2EX3 A;  1ZBU A;  4C8K A;  4DG1 A;  3THX B;  4CZE A;  4FJG A;  4EFH A;  3NGZ A;  4LF5 K;  4QCL A;  3VQD A;  4BC4 A;  1BUP A;  2A1R A;  1J6Z A;  1T3V A;  1EQY A;  4CJT A;  3HM9 A;  4JHD B;  3GOI A;  1D5A A;  2GWK A;  2O8F A;  3CQ8 A;  4B9U A;  3TU5 A;  4KFB A;  3MWT A;  4HVJ A;  3JYT A;  3V4I A;  1EET A;  5HLF A;  5B8H A;  1YI2 N;  3LAN A;  1KAX A;  3D2F A;  3MN9 A;  4B1U B;  2WOM A;  4CE9 A;  4PL8 A;  3SMP A;  3V1O A;  3ZX0 A;  3WNG A;  4AHU A;  1HNZ K;  4IOA L;  5AFU A;  3HOT A;  4DR7 K;  1C0T A;  2GX9 A;  4DSJ A;  2NRT A;  3O9T A;  1TVR A;  2NRZ A;  4DUZ K;  1IJJ A;  2F9T A;  5E41 A;  2GUP A;  4CER A;  4JI2 K;  5BPN A;  4DR5 K;  3KWI A;  4WQ5 C;  2KKZ A;  4CZG A;  3EL2 A;  2GBZ A;  1XUP O;  4FK4 A;  1T7P A;  4IJN A;  1HYS A;  4YOU A;  3VEY A;  1HKC A;  1MU2 A;  1RDA A;  3C0B A;  2Z1J A;  1KVB A;  1BQM A;  1BOT O;  3MMV A;  2FF3 B;  3ZYY X;  3V1R A;  3OYD A;  3A5O C;  1SL2 A;  4CHP A;  1WSI A;  3VQE A;  4M3Z A;  2B5J A;  3IG1 A;  3OYK A;  1W7A A;  4CJS A;  3VQQ A;  4AM6 A;  3IKM A;  4JKH A;  4CZL A;  3RR8 A;  5H1S Q;  4CJR A;  3O6W A;  2KFN A;  4CBX A;  4FO0 A;  1JCE A;  4A61 A;  5CE3 A;  2XHB A;  5SWM A;  5HRR A;  2HHV A;  1HNV A;  3DLB A;  3VGM A;  4JK7 A;  4O0I A;  3KWG A;  5EU7 A;  4DS4 A;  3WXM B;  3L2W A;  3AO2 A;  3QET A;  1HYZ A;  4BRA A;  1SZ2 A;  4FLU A;  3LP2 A;  4N5S A;  4X62 K;  4WFN L;  5M1N A;  4CEA A;  3PIP L;  1NGI A;  1T05 A;  2UU9 K;  4O4G A;  3MEC A;  4JN4 A;  5DM7 L;  1JL1 A;  4OLB A;  4H0P A;  4YOT A;  2PAV A;  3V9W A;  1VQL N;  2YHB A;  1D9F A;  1TKT A;  2ZGY A;  4JKA A;  4BEB A;  2UYT A;  3EY1 A;  3CCL N;  1BWF O;  2P1J A;  2V7Y A;  2OTL N;  1IBL K;  1RT7 A;  3B6P A;  4H0O A;  1QSL A;  3KK7 A;  2XY6 A;  2ZWH A;  5AQM A; 
#chains in the Genus database with same CATH homology
 3DXM B;  4XEI A;  2AP1 A;  4FWL A;  5ADX A;  1W97 L;  3EE9 A;  3R6M A;  2IVN A;  1JCF A;  2KLA A;  3J7Z O;  3ZEU A;  4A2A A;  1U6Z A;  4IXC A;  3LM2 A;  1U2V A;  1NGE A;  2NRR A;  1Q81 O;  1Z6R A;  4RWT A;  2QXL A;  3HZ6 A;  3O8M A;  4JKG B;  4NLC A;  5AQH A;  4B1Z A;  5AZJ A;  2A3Z A;  3RSE A;  3KZB A;  2FSK A;  4NO7 A;  4B1V A;  3TTC A;  1WOQ A;  4O5F A;  3HBT A;  3C7N A;  2NRV A;  3O4W A;  3P39 A;  4ISF A;  4BE7 B;  1T6C A;  4CZI A;  3TTD A;  3ENO A;  4JNE A;  3ZET A;  3CCS N;  1NMD A;  5C0Y A;  2HST A;  5EOY A;  4GNI A;  3ID6 A;  4FPB A;  4Y0W A;  1S72 N;  4QS9 A;  1HKB A;  3EZW A;  5BRF A;  3DLL L;  1K8K B;  3IUC A;  1WUA A;  3EKS A;  3TSQ A;  1LCU A;  2HBM A;  2QM1 A;  4GY2 B;  1T6D A;  2P9N B;  3HI0 A;  4OPA A;  1U2V B;  2E2P A;  2Q31 A;  5JVG L;  1X3M A;  1YHQ N;  3VPZ A;  2RHK A;  4H03 B;  3RSE B;  1YIJ N;  4WCE L;  2VWB A;  2YHY A;  2PBD A;  4FWN A;  1G99 A;  3C7N B;  2QWQ A;  2FSN A;  4IO8 A;  3DXK A;  3FZK A;  4XJX A;  4MO5 A;  4E1J A;  4FOI A;  3CCV N;  2ASP A;  4ILG B;  2IVP A;  3ZET B;  3GG4 A;  4BC2 A;  3UKU A;  5JLF A;  2D1K A;  2NRH A;  3Q7B A;  5GAH P;  4CZM A;  3D2E A;  5EX5 A;  5GAD P;  3MWP A;  3G4S N;  4CZJ A;  1BG3 A;  3ZX3 A;  4AM7 A;  4NB4 A;  3G25 A;  3SMS A;  1GLE G;  4BRC A;  5GIP A;  2D0P A;  2NNW A;  3UKR A;  1GLJ O;  3H1V X;  3OBY A;  3SJH A;  3WT0 A;  3CHW A;  3FZH A;  3A5L C;  2EWS A;  4O8U A;  2P9I A;  2QWP A;  2ITM A;  3RVC A;  3UKU B;  1BA0 A;  2ZJR L;  1ATS A;  4IZ9 A;  4YOW A;  5AQK A;  2OAN A;  3N4Q A;  4JEP A;  4BRQ A;  4FWO A;  1SQK A;  2E1Y A;  2VYP A;  3JS6 A;  1M1K O;  3D2E B;  1QVF M;  4JD2 A;  1LOT B;  4NLB A;  1DKG D;  2D0O A;  3VEW A;  3U4L A;  3ENB A;  4JKF A;  3O1W A;  2Q2R A;  1NWK A;  4B1W B;  5EXW A;  2GEL A;  4RCH A;  3W3D A;  4KH4 A;  1ATN A;  4WQ4 C;  4UY8 O;  4BRF A;  3WEE A;  4BR2 A;  5HL7 L;  2ASO A;  2JWK A;  4GV6 A;  3VEX A;  4BEC A;  4JKE A;  5KQD A;  2P9I B;  5AR0 A;  3GBT A;  4QS7 A;  3MN6 A;  4WFA L;  4DCH A;  3J8A A;  5HOO A;  3CCR N;  1KC8 O;  3JXU A;  1YJ9 N;  2ZF5 O;  4IOX A;  3R9P A;  3BP8 A;  4MDA A;  1VQP N;  1QQN A;  5F1X A;  1X3N A;  4BQZ A;  3S41 A;  2FSJ A;  4XH1 A;  3AAR A;  3NVM A;  1XQS C;  3EN9 A;  3CQX A;  1X9J A;  1HLU A;  3QB0 A;  4A57 A;  3CCU N;  3VGL A;  1Q7Y O;  4FVU A;  5M1F A;  4JK8 A;  2J4R A;  1QHA A;  2P9K B;  3HM8 A;  5BRH A;  3H1Q A;  3WEE B;  3E9O A;  3BUZ B;  2KHO A;  3E1Y A;  3O9S A;  4CI6 A;  3PIO L;  2CGK A;  2NRX A;  3L0Q A;  4JHD A;  1VQM N;  1H1V A;  3FGU A;  2WUS A;  1BA1 A;  3EKU A;  5C10 A;  4OO1 J;  4WQ5 A;  4YDU C;  2W00 A;  2RE2 A;  1KAY A;  3IDH A;  4JAX A;  4RTF D;  4A62 A;  4OPH A;  1NM1 A;  2QWM A;  3ATU A;  3CI5 A;  4BRE A;  4WYB A;  3EO3 A;  5C2D A;  1K9M O;  2Q97 A;  3LDL A;  5TKY A;  2C1G A;  2HBJ A;  3E9L A;  4ILJ A;  5BN9 A;  5GAG P;  5FPN A;  1RFQ A;  3VER A;  4BRD A;  2F9W A;  3TPQ A;  5C12 A;  3CCE N;  4MO4 A;  3ID8 A;  3PLA A;  1CZA N;  4BR9 A;  2NRW A;  4H5R A;  4CD3 A;  2E20 A;  4M7X A;  3CJ1 A;  4O8K A;  3NVK A;  3MCA B;  1KAZ A;  1ATR A;  4FOE A;  3VTI A;  3H3O B;  4H5W A;  2ZGZ A;  3SAG A;  5AQP A;  4QS8 A;  3CC7 N;  2Q0R A;  3L4Q A;  2DPN A;  5DM6 L;  4ILH A;  2I7P A;  5M1K A;  5KPT A;  2A5X A;  5BRD A;  3VET A;  3A5M C;  3N4P A;  3CET A;  1E4F T;  4M63 C;  3FR0 A;  3FZM A;  3M5R A;  2YHX A;  3CC2 N;  3WXJ A;  4G9Z A;  1MWM A;  5CHI A;  4JKC A;  3HOS A;  4BC5 A;  3QML A;  3CJ7 A;  4H5N A;  4BR5 A;  3ZEU B;  3A5N C;  3MCP A;  3WXL A;  2HOE A;  4U67 L;  3MN7 A;  2H3G X;  4R79 A;  1VQ9 N;  5FPE A;  1VQ4 N;  2D4W A;  5AZJ B;  3TSU A;  1Z05 A;  2WFB A;  3FFK B;  5FPM A;  4A2B A;  3OW2 M;  5AQV A;  1VQO N;  2FF6 A;  1NGA A;  1NGG A;  5AZI A;  2P9S A;  1XC3 A;  1YVN A;  3O1B A;  5M1O A;  4PL7 A;  4GV3 A;  1C0F A;  2A41 A;  1QQO A;  3DAW A;  4KH6 A;  5BPM A;  3O9U A;  4IEI A;  3LL3 A;  1HPM A;  4IJA A;  4ISE A;  4BRL A;  2P9L A;  3SBG A;  3ULE A;  1QZ5 A;  4F9O A;  5JVH L;  2QWR A;  1MWK A;  3D6R A;  2A42 A;  3TSP A;  3KHY A;  2QWN A;  2E2Q A;  4GV9 A;  4BRI A;  4DKW A;  4FWR A;  1O13 A;  1TUU A;  1JCG A;  3QFU A;  3H45 C;  3FE1 A;  3UB5 A;  2PFU A;  2BH1 A;  3BF3 A;  4CBU A;  2CGL A;  2QWO A;  3MN5 A;  3MX2 A;  4H5T A;  2GTD A;  2VGM A;  3O9R A;  3F5T A;  3WUH A;  2QA4 N;  4IDH A;  3AAQ A;  1ESV A;  4EHT A;  3LM9 A;  5F0X A;  5F2R A;  4FWK A;  3MK6 A;  3I55 N;  3G6E N;  3QDK A;  2P9S B;  5AZI B;  1YJN N;  5BPL A;  1W2B M;  3DXK B;  2HF3 A;  3VF6 A;  3CJA A;  1HJO A;  4CZK A;  3E66 A;  4HWI A;  4B1Y B;  2ASM A;  4C23 A;  1KD1 O;  4FWP A;  1DEJ A;  5AFU H;  1HUX A;  4BVO A;  2P9L B;  4PKH A;  1R59 O;  3G71 N;  1E4G T;  3ULE B;  2GWJ A;  4CJ7 A;  1NJI O;  2QI2 A;  2CGJ A;  2V7Z A;  2A6A A;  3R1X A;  4I6M A;  1K73 O;  1V4T A;  5AQN A;  3NMU A;  4WF9 L;  2ZJQ L;  1OVY A;  3BEX A;  3HSC A;  4CBW A;  3DWL A;  4YDU A;  4YOX A;  1BU6 O;  3VF4 A;  3AAP A;  3CPE A;  2Q1N A;  5AQG A;  5AQI A;  2V51 B;  3UKR B;  4DQ8 A;  5KQ8 A;  5GIO A;  2YX6 A;  3K9J A;  4PHT X;  3LDP A;  5AQY A;  3WXK A;  3T7Z A;  2P9P A;  3C65 A;  4FWM A;  3VEZ A;  4IEE A;  4DHY A;  4HTL A;  3I33 A;  4BG9 A;  5MLC Q;  3EE8 A;  3P31 A;  3VES A;  4FL9 A;  5AQR A;  4K41 A;  5KPR A;  3U8X A;  1NLV A;  3SLC A;  2HBK A;  5BR9 A;  5AQU A;  4H0X B;  3U9Z A;  2CH6 A;  3U9D A;  5C2F A;  1D4X A;  4JD2 B;  4B9Q A;  1GLC G;  3GE1 A;  3VEV A;  4BRK A;  1BO5 O;  3AGR A;  1SS6 A;  1ZXO A;  1NGH A;  1TUY A;  2E2O A;  3LDQ A;  4AF1 A;  4EIA A;  3CPW M;  1VQ8 N;  4BC3 A;  1DGK N;  4Z94 A;  3CXC M;  2BUP A;  5AQO A;  4DB3 A;  5LJV A;  5EVZ A;  1P90 A;  3IFR A;  2OTJ N;  3L6Q A;  4C1N I;  2Q0U A;  3VMF B;  5EY4 A;  3HTV A;  1HKG A;  3OHR A;  2P9P B;  1P8Z A;  1DT9 A;  4BRM A;  1S3X A;  5TKW A;  4C1N K;  3M3Z A;  2QW9 A;  5CR4 A;  5AQF A;  5FPD A;  4LC9 B;  5AQS A;  1NGB A;  2NLX A;  3AGK A;  4L3Q A;  4BRN A;  2WC9 A;  1S22 A;  1NGD A;  3DXM A;  1VQ6 N;  3FZL A;  4YOV A;  3R3L A;  3SBT A;  3W0L A;  4M7Y A;  3CMA N;  3A0I X;  3CCQ N;  1QVG M;  3QBW A;  5GAE P;  3LDN A;  3MDQ A;  5JMV A;  1TYQ A;  2CH5 A;  3OBW A;  3O9Q A;  4EAH D;  3P4I A;  2IIR A;  3QFP A;  4JKG A;  1MDU B;  4WFB L;  5AQT A;  4CZE A;  3AY9 A;  3VOV A;  2VCP A;  2YJF A;  4EFH A;  1N8R O;  4BC4 A;  1BDG A;  1BUP A;  4YOR A;  1VQK N;  3BF1 A;  1J6Z A;  1T3V A;  1EQY A;  3KVG A;  2W41 A;  4JHD B;  3GOI A;  3CCM N;  5LY3 A;  5AQW A;  4IO9 L;  2GWK A;  1Q82 O;  3CME N;  2F7T A;  4CZF A;  1M90 O;  1KQS M;  1ILY A;  3TU5 A;  1T44 A;  3M6G A;  1NGF A;  3MWT A;  1RDW X;  1Q86 O;  1K8K A;  3O80 A;  3T69 A;  5B8H A;  1YI2 N;  2P9N A;  4BRH A;  3WQT A;  4BR4 A;  1TYQ B;  3Q7C A;  5JLH A;  3CF5 L;  1KAX A;  3D2F A;  2JWL A;  1GLA G;  3ATV A;  2Q36 A;  3CJ9 A;  3MN9 A;  4IWV A;  4B1U B;  4BQL A;  4A5A A;  3K9K A;  4BY9 C;  4FSV A;  1JJ2 M;  4H5V A;  4PL8 A;  3SMP A;  1YAG A;  1VQ7 N;  3M1F A;  3ZX0 A;  1GLB G;  5E84 A;  1VAZ A;  4KH5 A;  2IVO A;  5M1Q A;  4BRP A;  1ZC6 A;  4FWQ A;  4BG8 A;  4IOA L;  5AFU A;  3HOT A;  2QWL A;  4BR0 A;  2ZJP L;  3CER A;  3CC4 N;  2GX9 A;  1NBW A;  2I7N A;  3H46 O;  2NRT A;  3O08 A;  4WQ4 A;  3O9T A;  4PKI A;  5ELZ A;  2NRZ A;  2P9U A;  4FPA A;  1IJJ A;  1IG8 A;  1GLL O;  2F9T A;  2FXU A;  3D7E O;  5I9E B;  5ADX H;  3O5B A;  2GUP A;  4PKG A;  4B1X B;  4YOY A;  1NGJ A;  2E1Z A;  3HRG A;  5BPN A;  3GDQ A;  3D2F B;  3KWI A;  2KKZ A;  3CJB A;  4WQ5 C;  3VGK A;  4BGA A;  4CZG A;  3GL1 A;  3EL2 A;  4BGB A;  1XUP O;  4IJN A;  3C6H A;  4YOU A;  3VEY A;  1HKC A;  3C0B A;  1NGC A;  4CZH A;  1YUW A;  3WQU A;  4MLH A;  4BRO A;  5LJW A;  2HF4 A;  1SAZ A;  1YF5 L;  3ENH A;  1BOT O;  3MMV A;  5C15 A;  2FF3 B;  1RDU A;  3F2K A;  3ZYY X;  4XH4 A;  1MA9 B;  2P9U B;  5BRE A;  1ZBS A;  2NZT A;  3A5O C;  4CD1 A;  3IMX A;  3R8E A;  2YJE A;  5JIC A;  2E88 A;  5E26 A;  5AQJ A;  4J8F A;  4IFE A;  3F9M A;  4K43 A;  3SK3 A;  3QBX A;  3CQY A;  4AM6 A;  4CZL A;  3IKM A;  4JKH A;  4A59 A;  5H1S Q;  2FLO A;  3O6W A;  2HBL A;  4CBX A;  1YXQ A;  1QZ6 A;  4FO0 A;  3CCJ N;  2C1I A;  1RGI A;  3WXI A;  3VTH A;  3MX5 A;  4H0Y B;  1JCE A;  4A61 A;  3VEN A;  1Y64 A;  3L4I A;  5AQZ A;  5CE3 A;  2WBN A;  3I8B A;  5M1P A;  2E8A A;  3SAH A;  3VGM A;  4XH5 A;  3CD6 N;  3CIP A;  2QTD A;  4JK7 A;  4EHU A;  3KWG A;  3H6E A;  5AQL A;  3WXM B;  1HX1 A;  3E9P A;  4K42 A;  2W40 A;  4I6M B;  4BRA A;  1EO1 A;  1SZ2 A;  4BR7 A;  1V4S A;  4GVE A;  1VQN N;  2P9K A;  1YIT N;  4K25 A;  3I56 N;  2YCH A;  4WFN L;  5M1N A;  1VQ5 N;  3B8A X;  2HMP A;  1OKJ A;  1Q18 A;  4MDB A;  3PIP L;  1K8A O;  3UE5 A;  1NGI A;  4JKB A;  5KPZ A;  5AQX A;  4IOC L;  4BVP A;  3P38 A;  2GEM A;  3ZX2 A;  4KBO A;  3H3N O;  4JN4 A;  4BRG A;  5DM7 L;  4H0T B;  3C6A A;  4H0P A;  4YOT A;  2PAV A;  5AQQ A;  3TTF A;  3DJC A;  1VQL N;  2AA4 A;  2YI1 A;  1C0G A;  4JKD A;  2ZGY A;  4FWS A;  4JKA A;  4BEB A;  1YJW N;  2UYT A;  2QEX N;  3CCL N;  4A5B A;  1BWF O;  2YHW A;  1KXP A;  1GLD G;  2BTF A;  3SAF A;  3QIC A;  2V7Y A;  3FZF A;  2OTL N;  3FLC O;  1GLF O;  3LDO A;  3OA9 A;  4H0O A;  4ISG A;  4U7B A;  5BN8 A;  4MLE A;  3A8Y A;  2V52 B;  4H0V B;  3CJC A;  3VF2 A;  2VGN A;  3KK7 A;  3VEO A;  5GIN A;  1QQM A;  2E2N A;  2A40 A;  2ZWH A;  5AQM A;  4JK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...