1NMDA

Crystal structure of d. discoideum actin-gelsolin segment 1 complex crystallized in presence of lithium atp
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
372
structure length
362
Chain Sequence
DVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure Of The Non-Vertebrate Actin: Implications For The ATP Hydrolytic Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Actin
total genus 118
structure length 362
sequence length 372
ec nomenclature
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nmdA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nmdA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1nmdA03
3UB5A 4M7YA 4Y0WA 2A6AA 1HX1A 1KAZA 3VETA 1NGEA 2CGKA 3MK6A 3A5OC 4FPAA 2NZTA 4BR7A 2FSNA 4O8KA 1BWFO 3R8EA 4CZHA 3BF3A 5AFUA 4WQ5C 5AQGA 2EWSA 4J8FA 2GEMA 4BG9A 4BR4A 2FSKA 4CBXA 4CZFA 3O08A 3WT0A 1TYQA 2AP1A 4EHUA 5AQHA 1WOQA 4BQLA 3WUHA 2ASPA 4BRLA 5AQOA 1V4SA 1HLUA 1K8KA 2AA4A 3SJHA 2ZF5O 4M7XA 4QS7A 1T44A 3C7NA 3CI5A 3ENHA 1MDUB 3ZEUA 4BC5A 5AFUH 1ATRA 3JS6A 3QDKA 3ZX0A 4CZKA 3VEYA 2IIRA 2QWQA 2BTFA 4QS8A 3WEEB 4CZLA 5BRDA 3A0IX 2P9PA 1IG8A 3GE1A 1X3MA 3LM2A 3CJ1A 3M3ZA 4CD1A 2KHOA 4DQ8A 4EAHD 4K42A 1YVNA 4JHDB 2H3GX 1KAXA 3VERA 4B1XB 2P9SA 4FOIA 4NB4A 3UE5A 2W41A 3HI0A 3WXLA 2HMPA 1ATNA 3EKUA 1J6ZA 4LC9B 3U9DA 2Q0RA 3HSCA 2Q31A 3CJCA 3U4LA 3O4WA 2HOEA 1TUYA 4IJNA 5BPLA 2VWBA 4WYBA 4XEIA 2IVOA 1DGKN 4BR9A 1TUUA 5E26A 1SQKA 3VGKA 4BG8A 3A5LC 4IWVA 3ZEUB 1U2VB 2CH5A 3AAQA 4M63C 1T6CA 3BF1A 4CJ7A 4WQ4C 3H1QA 4MO4A 4PL8A 5KPZA 3KZBA 4BRFA 4E1JA 4H5TA 1HJOA 1GLBG 3AAPA 3I33A 3OHRA 3DXMB 3HM8A 3FGUA 1BDGA 4FWSA 1QQNA 2YHXA 5AQQA 2F9TA 4CI6A 3QMLA 1BUPA 3UKRB 4BRIA 2BUPA 3CQXA 1YXQA 3DJCA 3FZHA 4A2BA 5FPMA 2ITMA 3A5NC 1U2VA 1NGFA 5EY4A 1YAGA 2D0OA 4FO0A 3VF6A 4ISEA 2W40A 3O1BA 3MCPA 3WEEA 2GUPA 2A5XA 1V4TA 1JCFA 2J4RA 2FXUA 4BRHA 2P9IA 3HBTA 1EQYA 3FFKB 2YHWA 3TU5A 1NGIA 1NGCA 1LOTB 1BA0A 2E2QA 2P9LB 1ESVA 2ZWHA 1XQSC 3H1VX 4PKGA 2NLXA 3FZKA 1NGJA 2GWJA 4CZJA 5BPNA 3VEOA 3WXJA 3FR0A 2D1KA 2A40A 4BR5A 2CGJA 3ENOA 1NGGA 2Q2RA 3MN9A 1KAYA 1KXPA 2P9NA 4L3QA 5EVZA 2Q0UA 4IJAA 1U6ZA 2HF4A 2E2OA 5BPMA 4CBUA 5JLHA 3CETA 5FPNA 3F9MA 3LDPA 2NRHA 4BRAA 5AQLA 4H0OA 2VYPA 1G99A 4JN4A 3DWLA 1E4GT 2FF6A 1QZ5A 4BRCA 3A5MC 4BVPA 2Q1NA 3D7EO 4Z94A 5AZJA 3FLCO 3LL3A 5KPRA 3ATVA 3ZETB 4I6MA 3DXKB 2P9KA 2P9NB 1BU6O 3FZMA 3EN9A 3IFRA 1XC3A 3VEVA 4K25A 4FWPA 5F2RA 2ASMA 3EZWA 5KQDA 2V7YA 1QZ6A 1Q18A 5AZIA 2WUSA 3S41A 1QHAA 5AQSA 4AM7A 2A41A 5AQIA 4MO5A 3QFUA 5LJWA 2QW9A 3P4IA 3ID8A 4BC3A 2HF3A 3RSEA 2DPNA 5F1XA 4JAXA 2P9KB 3L0QA 4CBWA 1S22A 3C0BA 1X9JA 4JD2A 4CZEA 3O8MA 4FSVA 3IDHA 1RDWX 2YJEA 3VENA 4MLHA 3L4IA 4FWOA 5AZJB 4WQ4A 4H5WA 3EKSA 4IO8A 3A8YA 1GLCG 3R9PA 1HKCA 3C7NB 4O5FA 2V51B 4HWIA 4H5RA 2QM1A 4GY2B 3CJAA 5KPTA 3BEXA 3H46O 3WXIA 1Z05A 4EIAA 1SZ2A 3O5BA 4A61A 3LDOA 3O1WA 1T6DA 2GWKA 3ULEA 4K41A 3ULEB 5FPDA 2PBDA 4B9QA 1RFQA 2QWNA 1MWKA 1BG3A 4A62A 2YI1A 3B8AX 5F0XA 4RTFD 2I7NA 3QFPA 4PKHA 5BN8A 1JCEA 3O6WA 4FWNA 3EO3A 1HUXA 4XH4A 1NLVA 3H3NO 3CIPA 3SK3A 5ADXH 3SLCA 4KBOA 1X3NA 3BUZB 5BN9A 1ZBSA 3GL1A 1NGBA 1GLDG 4IXCA 2P9PB 4B1ZA 3GDQA 3QBWA 3VPZA 3O80A 4RCHA 4YDUA 1ZC6A 3JXUA 5AQRA 3UKUB 5E84A 4BRKA 5JMVA 1HKGA 5AQXA 2FLOA 1QQOA 3CJ9A 3VF2A 3ZX3A 2YCHA 1HKBA 3VESA 2P9SB 1GLEG 4BR0A 3H3OB 3HZ6A 4BGAA 4JD2B 5ADXA 2ZGYA 5EOYA 1WUAA 5BRHA 4IZ9A 3VGLA 4FPBA 4BRMA 1C0GA 4H0PA 2QWOA 4HTLA 5ELZA 5AQWA 3MN7A 4XH1A 2E1YA 3QB0A 3MN5A 3CERA 1SAZA 3DXMA 3QICA 3GOIA 3KHYA 2P9IB 3MN6A 5B8HA 3ZETA 4H0XB 3UKRA 4JHDA 4FWRA 2YJFA 3FE1A 1ATSA 2YHYA 5AQFA 3FZFA 4BRGA 3CJ7A 3DAWA 2QWPA 2FSJA 4ISGA 1BA1A 2D4WA 4YDUC 2E8AA 5TKYA 5AR0A 1NWKA 2VCPA 4XH5A 2QXLA 2UYTA 1MA9B 1DKGD 1ZXOA 1Y64A 4AM6A 4EHTA 1NGHA 3LDNA 4B1WB 2A42A 2GELA 3W3DA 5AQYA 4FWMA 4PKIA 4DB3A 3SMPA 5FPEA 2IVNA 3G25A 3J8AA 4RWTA 4BC2A 2E88A 4BRDA 1GLFO 2P9UA 4QS9A 5AQNA 4BR2A 3CJBA 1TYQB 1P8ZA 2E2NA 5LY3A 2E2PA 5AQKA 3MDQA 3QBXA 1GLJO 5AQTA 2E1ZA 1NGAA 3I8BA 3LDQA 4FOEA 1OKJA 4CZIA 3IMXA 1NM1A 1DEJA 4BROA 4MLEA 4PL7A 1BOTO 4H0VB 1LCUA 3FZLA 4CZMA 3TPQA 4BVOA 3M1FA 3R6MA 1Z6RA 1C0FA 3KVGA 3WQTA 5JICA 2P9UB 2QWMA 4NO7A 3LDLA 2ZGZA 1CZAN 2D0PA 3GG4A 1HPMA 4A2AA 5JLFA 4H5VA 3D2FB 3CHWA 4BRPA 4I6MB 3ATUA 2OANA 5AQJA 2IVPA 2P9LA 3SMSA 3VEZA 4F9OA 3MMVA 4GNIA 4BRQA 5AQPA 5EX5A 5AQMA 3VEXA 5EXWA 5AZIB 3U8XA 3H6EA 2FF3B 4BQZA 5BREA 1D4XA 3D2EA 4C23A 3U9ZA 1GLLO 1S3XA 2F9WA 5AQUA 1E4FT 5LJVA 4DHYA 5CE3A 3WXKA 4H5NA 4H03B 3WQUA 4CZGA 2V7ZA 4JNEA 5KQ8A 2Q36A 2I7PA 3GBTA 4FWKA 3HTVA 2PAVA 3BP8A 1MWMA 5BRFA 4ISFA 3W0LA 4BRNA 4FL9A 4BREA 4WQ5A 4CD3A 5I9EB 5AQZA 2CH6A 1H1VA 2CGLA 3DXKA 4FWLA 4B1YB 1YUWA 4EFHA 4FWQA 3H45C 3IUCA 4BC4A 2E20A 3M6GA 2QWRA 1QQMA 3VGMA 2QWLA 3ZX2A 4DCHA 3D2EB 1R59O 4B1UB 3UKUA 4B1VA 1BO5O 1GLAG 1RGIA 4H0YB 1JCGA 2A3ZA 3D2FA 3L6QA 3AARA 1K8KB 3VF4A 2V52B 3EL2A 3CQYA 5BR9A 1XUPO 3RSEB 2GTDA 1IJJA 1NBWA 2ASOA 4H0TB 2Q97A 4K43A 1NGDA 3VOVA 3LM9A 5AQVA 1NMDA 3AY9A 4BGBA 3VEWA
chains in the Genus database with same CATH superfamily
3UB5A 4M7YA 4K0KK 4UQGA 3OYGA 1KAZA 3VETA 3MK6A 1T03A 2NZTA 4IOXA 5C15A 3QEVA 2ETJA 4CZHA 5AQGA 5KGWA 4ICLA 3S3NA 5LMUK 1WLJA 1FXXA 3CCLN 3A2FA 2ASPA 3K59A 3O9UA 5AQOA 1V4SA 1NMNA 2HHWA 2AA4A 3SJHA 4QS7A 4R5PA 5GIPA 3ENHA 4FJIA 3SQ0A 1ILYA 2JWLA 2C1IA 3AO1A 4CZKA 3TSUA 1T3VA 3VEYA 3D45A 2IIRA 1HNXK 1KCFA 5BRDA 3A0IX 2P9PA 1IG8A 3AVBA 3AV9A 3GE1A 2E5LK 2OZMA 4IG3A 4CHZA 3RMDA 1E3MA 4OKJA 1YVNA 4CF9A 1L3SA 2NNWA 1S9EA 1KAXA 4B1XB 3R1XA 4FOIA 2F8TA 4NB4A 3HI0A 3WXLA 3EKUA 4XIUA 2Q0RA 2IAJA 4KPYA 2Q31A 3O4WA 1TL3A 2OZSA 4IJNA 5I42A 1NJWA 2OPQA 2IVOA 3OYIA 3SUQA 1TUUA 3SBGA 4YOUA 1QSSA 4O0JA 3ZEUB 3OYAA 4H4MA 1KFSA 1DTTA 2CH5A 4CJ7A 1NKCA 3H1QA 4MO4A 2UUBK 5KPZA 4RW4A 4BRFA 1GLBG 3AAPA 1YIJN 3NH0A 3AA3A 1RCHA 3TANA 3CCEN 2YHXA 1B9FA 4CI6A 4BRIA 3R3LA 4AHUA 4JKBA 4JKAA 4CJRA 2ITMA 4JK8A 5KGXA 3A5NC 5EY4A 1YAGA 2D0OA 4LF6K 5GAHP 3WEEA 2GUPA 2Y1JA 1V4TA 1ZBFA 3VQAA 1IG9A 2FXUA 4DSLA 2P9IA 4DFMA 2B4JA 3NVKA 2XHBA 3SPZA 1NGIA 2O8DB 1NGCA 1LOTB 1BA0A 3LP1A 4CEDA 2VG6A 4I7FA 4GV3A 1S6PA 3K5NA 5KRTA 1VQ5N 5CZ1A 3EE8A 2CGJA 3P31A 3DLHA 5JS2A 3MN9A 2Q2RA 1KXPA 1QHTA 2Q0UA 2O8EB 4XJXA 3CC4N 5BPMA 2O8FB 4CBUA 3THYA 3F9MA 3LDPA 2BGGA 3AVCA 2VYPA 4K8ZA 4FJXA 1QZ5A 2YNFA 3DOLA 3MEGA 4KHSA 2PFUA 3SJJA 2HNYA 1TGOA 4DMNA 4DG1A 3LL3A 3THXB 2W6LA 3ZETB 4I6MA 1KVBA 3NF8A 3IFRA 3J80O 3QEIA 1VSIA 4K25A 3OVNA 1LV5A 1RTJA 3DRRA 3WNEA 1I39A 5KQDA 1QZ6A 4EP5A 2WUSA 3N4PA 1L3VA 3O3GA 4HVJA 4LF9K 4HHTA 4DR7K 2RHKA 3ID8A 4E7IA 4Q0BA 1F21A 3TI0A 3E9PA 4JAXA 1S22A 5M1QA 4JD2A 4DV2K 4JS4A 3VENA 4MLHA 4ILGB 4CECA 4FCYA 1TV6A 4DFPA 4IO8A 2O8CA 4IDHA 3SAGA 4HWIA 1SKSA 2QM1A 2F7TA 4B9VA 3WXIA 4YFUA 5M1OA 4BE1A 1Q9XA 1R0AA 3U3GA 3O1WA 3OS0A 5FPDA 1RFQA 4CJ3A 1MWKA 1BG3A 3JSMA 3QETA 1Q8IA 5F0XA 2I7NA 4DR5K 3QNOA 5BN8A 1JCEA 2VWKA 3ZT4A 2HSTA 4JKHA 1Q81O 1HUXA 4W5NA 3PSIA 1RDBA 3CIPA 4C8LA 4LF5K 3E9LA 5AJ3K 3SLCA 3BUZB 1SUQA 3GL1A 3VQ6A 3AVJA 5J2QA 3GDQA 3KWIA 4CCHA 1ASWA 1QTMA 5AQRA 1VK0A 3E9OA 4BRKA 4E1NA 5HLFA 4DSKA 2FLOA 1IKWA 2X74A 3ZX3A 4ELUA 3I0RA 1GLEG 4BR0A 2NRXA 2NRZA 3H3OB 1GOAA 4JD2B 4NYFA 4B9LA 4E3SA 3PLAA 4JKCA 1WUAA 5BRHA 1TAQA 4FPBA 4FW2A 4ID1A 1C0GA 4C8NA 1XHZA 2HHHK 2NRWA 1LW0A 3LAMA 4C1NI 4M3WA 1Q86O 2IS3A 3MWTA 3WNHA 2HVHA 4IG0A 4XH1A 3K57A 1YVUA 2KQ2A 4F3OA 1TKZA 3GOIA 4LFAK 3OJUA 2HW3A 2HNZA 3AGKA 2YHAA 3O4NA 2DY4A 4JHDA 4CEOA 3SQ4A 2YJFA 4IKFA 5AQFA 5HP1A 3CJ7A 2QWPA 4X65K 1K73O 2VQEK 2FBYA 2XRIA 3VQQA 4DQIA 2QXLA 3V1OA 4DTXA 3U3YA 4FK4A 1KLMA 1DKGD 1LAWA 2R7YA 1Y64A 4AM6A 3K2PA 1NGHA 2HHUA 5KRSA 2A42A 2GELA 3THYB 3D6RA 4FWMA 5DMRA 4C1NK 3OYCA 4LF4K 2O8DA 3RMBA 1SL0A 1RT4A 3PX0A 2G8VA 4TSXA 1U49A 2E88A 4BRDA 1OVQA 4O55A 4OLAA 4DSJA 1IV0A 5LY3A 5CR4A 3HYFA 2OCEA 1GOCA 4BDYA 4N56A 1RBVA 2E1ZA 1KLNA 1YITN 4JS5A 1DEJA 1RT6A 4DQRA 2RE2A 1UA1A 2BH1A 3TPQA 3TTCA 3L2WA 1QS4A 2HMIA 1HJRA 1IH7A 4O0IA 4W5RA 4CEAA 3KVGA 1CZAN 2D0PA 5JLFA 1HPMA 1HYSA 3ENBA 5E41A 1I3AA 3ZSZA 1U4BA 3ATUA 5AQJA 2IVPA 1Y97A 4YORA 2XY6A 4F9OA 2WC9A 4W5OA 1WSGA 5EX5A 3VEXA 2FF3B 4BQZA 5BREA 4FLTA 3HO1A 4NCAA 2UUAK 1TVRA 3U9ZA 1S3XA 2F9WA 5AQUA 4B3RK 3OW2M 3EZ5A 4F2RA 2OPPA 4H03B 4YOTA 3CF5L 2AJQA 3PO5A 3OYEA 1BISA 3BP8A 1MWMA 2FC0A 3ASMA 1VQ8N 3IS9A 1WB9A 1VQLN 1NKBA 2O4IA 4CHPA 1RT5A 1VQ9N 2F8SA 3H45C 4CK1A 2KW4A 4BC4A 3KK7A 1QQCA 2QWRA 1X9SA 4KHWA 1SKRA 1UOCA 1YTAA 4B1UB 4ILJA 4CGDA 4M3TA 4B1VA 2E6MA 4CEQA 3L6QA 3NHGA 2D0AA 3CQYA 5BR9A 1LWEA 2GTDA 2NRVA 2ASOA 4PQUA 3VOVA 1K8AO 3AY9A 4E7KA 3P83D 4DS5A 2A6AA 4Y1CA 1ASUA 1YF5L 4NCGA 3KK1A 3KWGA 4FPAA 4BR7A 4I2PA 3CFPA 2BANA 3R8EA 4WQ5C 2EWSA 1JLGA 4C8MA 4BR4A 1CXUA 4CBXA 4CIEA 4CZFA 3O08A 3WT0A 2AP1A 4EHUA 3KLEA 1WOQA 4BQLA 2QXFA 5FROA 1K8KA 3DMJA 2ZF5O 4GMJB 4CJTA 1T44A 1MDUB 4CFBA 2WOMA 3ZEUA 3QESA 3QDKA 3JS6A 3ZX0A 4RW7A 5SWMA 4QS8A 4CZLA 4QCLA 4CFAA 3BY5A 4Z0UA 1KVAA 5KTQA 1X3MA 3HOTA 3TSPA 3ZT0A 1B9DA 4DQ8A 4DR1K 4JHDB 4M41A 3MXMA 1XC9A 3VERA 2QKBA 4JKFA 4YOXA 1BL3A 1WSIA 5C2FA 4CJVA 3L2VA 2ZM6K 3TABA 4XEIA 1DGKN 1Z26A 5GINA 3A5LC 2NRTA 2ZQBA 3AAQA 1BHLA 3SI6A 1UA0A 4WQ4C 2HB5A 4PL8A 4CIFA 4Z4IA 1SS6A 2QEXN 4H5TA 4DSEA 3I33A 3OHRA 3OS2A 4DSIA 3HM8A 1QQNA 2G8WA 3SUNA 2DFEA 3UKRB 3M5RA 1DLOA 2BUPA 3CQXA 1YXQA 2O8EA 1VSKA 4A2BA 2VG7A 3SQ2A 3KLFA 1U2VA 1NGFA 2P5OA 1IBKK 3QLHA 5J2NA 4DTNA 2W40A 3SBTA 3NAEA 3ZSRA 1X9WA 3IRXA 4OPJA 1JCFA 4FJ7A 1VSFA 1EQYA 2G8IA 2YHWA 3TU5A 1W9HA 1JL1A 1ESVA 2NLXA 3WXJA 4HTUA 2BDPA 2A40A 1JLCA 2HBJA 2EX3A 4IOCL 1NGGA 1KAYA 4L3QA 5EVZA 5FDLA 1ZBIA 3TR8A 5FPNA 4B3MK 4GKJK 2HNDA 4BRAA 3THWA 1G99A 4FJGA 3DRSA 1XHXA 1TAUA 3T7ZA 1C1AA 4Z94A 3MXJA 4HUFA 4RW8A 2VGNA 5KPRA 3RMCA 3ATVA 5J1EA 3S5TA 1VHXA 3DXKB 1TKTA 2P9NB 3NF6A 4B8CA 1L3UA 1XC3A 3VEVA 5F2RA 4OGEA 3AVAA 2UU9K 4IEIA 1S1WA 4B9NA 2HBLA 3NF9A 3S41A 4PWDA 1QHAA 5AQSA 3HJFA 1N6QA 2E4LA 3T1HK 4JI1K 3T3FA 2BE2A 3CPWM 4E72A 3CCUN 3RSEA 4F2SA 1RDWX 4CHNA 2YJEA 4GV9A 5AZJB 3VN5A 4H5WA 4EP4A 4A57A 4O5FA 2F96A 4J2EA 5FRNA 4C8KA 2V51B 1CLQA 4GY2B 1W0HA 4B9SA 3O5BA 4ELTA 4LD0A 4PUOA 3DYAA 3LDOA 1T6DA 4DV5K 2GWKA 1KD1O 3ULEA 4K41A 1D8YA 4B9QA 2IGIA 4PHTX 3K5MA 4A62A 3T1AA 4RTFD 3CFRA 4CEFA 1OH8A 1RT2A 5JENA 1WBBA 4AF1A 2Z1GA 3HL8A 3AA4A 3EO3A 2YV0X 3ZYYX 4KTZA 4DLGA 4OKEA 1NGBA 2WONA 2A1RA 4E1MA 1M1KO 2KLAA 1A5VA 4B1ZA 4X62K 3O80A 4YDUA 4ILHA 3KKSA 3C65A 2WTUA 1JLAA 3PX4A 1HKGA 3BZCA 3PO4A 2KZZA 3LP2A 1YJNN 3CJ9A 5DM7L 4DV3K 4B3OA 1HKBA 3VESA 4YOVA 4IDKA 4BGAA 4NLBA 4FJKA 1HQUA 5ADXA 2ZGYA 5EOYA 4KHPK 1ITGA 4HUGA 4FM0A 4AQYK 4BE2A 3RTVA 4KH6A 4HTLA 5LL6Z 3V1QA 2E6LA 3MN7A 1S9GA 2E1YA 3QB0A 3VA0A 3SQ1A 1NK5A 3ZT1A 1SAZA 3DLEA 3DXMA 2D0CA 5HRNA 2HHVA 4OPKA 1QVGM 1J5EK 2FBXA 4FLXA 3ITHA 3T1YK 4ISGA 3V9XA 2E8AA 5TKYA 1CXQA 1NWKA 2QK9A 3LALA 4U67L 4Q5VA 2UYTA 2UXDK 5SZTA 4LSNA 1NJYA 1WNSA 1CZBA 3LDNA 4IO9L 4B1WB 3VQDA 3IKMA 1YHQN 4PKIA 1UWBA 1VSEA 2QA4N 4DB3A 3SMPA 5FPEA 1NU0A 1N5YA 4LFCK 3J8AA 3JYTA 2O8BA 4RWTA 4BC2A 4CJKA 4QS9A 4BR2A 3CJBA 4GW6A 4BEBA 1TYQB 4KRFA 2GBZA 4FLUA 5IT9O 1RDCA 2E2PA 5AQKA 3MDQA 3QBXA 1W7AA 1X9MA 2W42A 4Z4FA 4BE0A 3TAEA 5M1FA 3I8BA 3LDQA 4FOEA 5GAEP 1NM1A 1NG9A 3VQPA 1IKVA 4MLEA 3PY8A 4H0VB 1LCUA 3OTOK 3P5JA 3FZLA 3SAHA 1IKYA 3SZ2A 3NCIA 3WXMB 4YHHK 3R6MA 4F3TA 1Z6RA 1C0FA 3CM5A 3RR8A 4NO7A 3LDLA 2ZGZA 4KB1A 4A2AA 3RWUA 3C6AA 4H5VA 4KO0A 3OS1A 1EKEA 3D2FB 3CHWA 4AHTA 3TARA 4BRPA 4UY8O 3KJVA 2X6NA 1BGXT 3TTDA 4DUYK 4FM2A 5HRPA 4R79A 3VEZA 1RT3A 1RBTA 4GNIA 3T19A 1VQMN 1HR0K 4F4KA 3KD5E 1XNRK 1RT7A 1RTDA 1IKXA 3U8XA 1RILA 3H6EA 4KKOA 3LWMA 4M3RA 3QEPA 3CMEN 4M3UA 2O4GA 3D2EA 1VQ7N 1GLLO 2P5GA 1YI2N 1E4FT 4IBNA 5C42A 2RKIA 3KKRA 4E19A 3J7ZO 4JI2K 3G6EN 3ID6A 2Q36A 4QAGA 3GBTA 4O4GA 1Q9YA 1VRUA 3OY9A 3W0LA 1NNEA 4JRPA 5K14A 4FL9A 1YT3A 1RTIA 4FW1A 1H1VA 3I8DA 5LMNK 2JGUA 3AVMA 3AVFA 4B1YB 4X64K 4FLYA 2D5RA 4B8AB 4KI4A 5CYQA 4DR3K 3HP6A 2PY5A 1UAXA 2B6AA 4DU4A 1YTUA 3NDKA 2QWLA 4G9ZA 3ZX2A 3D2EB 1D9FA 1DTQA 3QEWA 1U04A 3OYJA 1D5AA 4DV7K 5CYMA 1IO2A 4FYDA 1FW6A 1BO5O 1RGIA 3G0ZA 2ATQA 4KV8A 4JI0K 3J7YP 4FK2A 1NBWA 2ITGA 4H0TB 2Q97A 4K43A 3O3FA 1C0TA 3EY1A 2RPIA 4W5QA 4BGBA 4DU3A 3VEWA 1I94K 3LPUA 1S5JA 1NGEA 2VWJA 1IBLK 3U6FA 2XY5A 3ZT2A 3Q7CA 1N8RO 1J9AA 2F4VK 4HCBA 1BWFO 2Q3SA 1N36K 3BF3A 5AFUA 4J8FA 2GEMA 4BG9A 4JK7A 2FSKA 1N34K 4KH4A 4CVNE 1LWCA 3KK2A 1REVA 5C0YA 3HM9A 3SYZA 2UXCK 4BRLA 1RDAA 3H08A 5GIOA 4M7XA 4M3ZA 4J2AA 5CZ2A 5M1NA 4BC5A 2I5JA 1ATRA 1W2BM 1VRTA 2BTFA 3F73A 4HCCA 3LM2A 3CJ1A 3M3ZA 4CD1A 2KHOA 1MU2A 3KLHA 4JEPA 3AVNA 4OKKA 3VQ9A 4KTWA 2W41A 3MAQA 2HMPA 1J6ZA 3U9DA 3P38A 5DK5A 3CJCA 1TUYA 5BPLA 3PIOL 4WYBA 2QKKA 4AILC 4N47A 1SQKA 1EX4A 5KI6A 3ZSOA 4BG8A 3VGKA 3TAGA 4M63C 4HUEA 2W00A 3BF1A 1T7PA 3SV3A 3LDSA 5TKWA 4E1JA 1HJOA 4KAZA 3HVTA 3NF7A 3IAYA 5AQQA 3QMLA 4CGHA 4E7HA 3HPGA 4CF2A 5JVHL 3DJCA 5HRSA 3CCVN 5D3GA 1C6VA 3ZSQA 4W5TA 2HBMA 4FZZA 4DUZK 3I0SA 1VQNN 3VF6A 4ISEA 1TK5A 3O1BA 3MCPA 2FBTA 2A5XA 3PV8A 3OYLA 4N41A 4BY9C 3HBTA 1XMOK 4GV6A 4B08A 5BR8K 1M90O 4FZXC 2E2QA 3G4SN 1XQSC 4PKGA 3FZKA 1NGJA 4CZJA 3FR0A 3QNNA 4V19S 1L3TA 4BR5A 5T7BA 3E1YA 1RBUA 3ENOA 2HVIA 4CERA 4IJAA 1U6ZA 5IWAK 4WFAL 1FKPA 4CF8A 1CZ9A 3CETA 5JLHA 2G8HA 2PYJA 3K5LA 4LFBK 3N4QA 3T69A 2JWKA 3HT3A 4AHRA 3SNNA 4BRCA 2GV9A 4BVPA 2Q1NA 3BZKA 4DLEA 4PY5A 3K0SA 5AZJA 3FLCO 4Z4CA 2G8FA 3VQ7A 3OBYA 3EN9A 4FWPA 2ASMA 3O9TA 3OYHA 4CJPA 3EZWA 4JKEA 2V7YA 3LP0A 4X66K 4CJSA 4NLCA 2A41A 1NJIO 5AQIA 4MO5A 4CEZA 4DV4K 4JI5K 3E66A 3MCAB 3IG1A 5LJWA 2QW9A 3P4IA 1EO1A 2HF3A 4F8RA 5F1XA 3L0QA 1S1VA 3C0BA 3O3HA 1LWFA 4CZEA 3O8MA 4FSVA 3IDHA 4A5AA 5FRMA 1O1WA 4WCEL 1RNHA 3EKSA 3QEXA 3VQ4A 4DTSA 1FKOA 4J2DA 3A8YA 3CG7A 1GLCG 1HKCA 4RG8A 4H5RA 3OYFA 3CJAA 3BEXA 5HROA 1Z05A 1SZ2A 3VQEA 1NOYA 4JLHA 4CFDA 2KKZA 4KFBA 5EU7A 5GADP 2PBDA 2QI2A 1VSLA 2QWNA 1BQNA 3WNGA 2YI1A 4FVMA 3MECA 4PKHA 1NJZA 3VTHA 5DM6L 1ZBUA 3PSFA 2EHGA 4FWNA 4JK9A 3EYZA 3THVA 2KTQA 4XH4A 1NLVA 2C1GA 3H3NO 1SL1A 3EEQA 4NXNK 4KBOA 3KTQA 5JVGL 1X3NA 1ZBSA 1GLDG 4IXCA 2P9PB 4O44A 3QBWA 2NRRA 3ZLJA 3CMAN 1SV5A 1QSYA 3UKUB 3RRHA 3PIPL 5JMVA 2JLEA 5AQXA 1J54A 1JL2A 2YCHA 4YOWA 3KLGA 4FLZA 2P9SB 3HZ6A 3HK2A 3NE6A 1QSLA 1BIZA 1HYVA 2YNGA 3E01A 3C6TA 1BI4B 3RVCA 3B6OA 3DLBA 4H0PA 3VMFB 4CF1A 5ELZA 4KHUA 3MN5A 3CERA 3AVIA 3QICA 4KTQA 4B9UA 4KHYA 3ZSXA 4DF8A 1OH6A 4JI6K 1ATSA 2GUIA 2YHYA 3AA2A 4PA1A 4BRGA 4G1QA 3DAWA 2FSJA 4CHYA 4CJLA 2D4WA 4YDUC 2Z1IA 3SUOA 4J2BA 4DTRA 4DF4A 3PX6A 4JI3K 1MA9B 4GVMA 1C1CA 4RW6A 1RDDA 3L3UA 4FJ8A 2VGMA 3W3DA 5AQYA 3CPEA 4DWIA 1JLFA 4GKKK 1HMVA 3G25A 4WFNL 4WE1A 3NGZA 3TTFA 1GLFO 2P9UA 1J5OA 4DQQA 4U7BA 1P8ZA 2E2NA 1KFDA 1IBMK 2P51A 2WFBA 1GLJO 1QVFM 1NGAA 3V9SA 4CZIA 1TKXA 4BROA 1NJXA 4PL7A 2DFFA 4CK3A 4KHNA 3CYGA 4MDBA 2ZD1A 4CZMA 3CCQN 4DU1A 3M1FA 2OA8A 2UUCK 3HSTB 1OVYA 5C12A 3CC7N 3CCRN 3P1GA 2ZJQL 3AO5A 1OH7A 3VQ5A 3THXA 4OJRA 4KREA 3LPTA 2OANA 3ULDA 2P9LA 1S1XA 2XY8A 3F9KA 3DI6A 3MMVA 4ELVA 4FJNA 3CQ8A 4BRQA 2HHQA 3CCSN 2XO7A 4DKWA 5EXWA 4CJUA 4DR2K 1D4XA 3L3VA 4C23A 1YJWN 1RBSA 4DHYA 1HRHA 4RW9A 1RTHA 3C95A 3ZSYA 5CE3A 4H5NA 3WQUA 4CZGA 2V7ZA 5KQ8A 4CW7B 4YNQA 1JLBA 4B9TA 3S3OA 3HTVA 1OH5A 4YOYA 4IOAL 4E89A 4BREA 3K58A 4CD3A 4OVLA 5I9EB 1DT9A 5AQZA 2CGLA 4IEEA 3DXKA 4FWLA 1BQMA 1YUWA 2QTDA 4AHSA 4FWQA 3OA9A 4EFHA 3L8BA 3SCXA 1NK0A 5CY4A 3IUCA 4OX9K 1J53A 1SKWA 2HHIA 3P39A 1ZBLA 2FBVA 3UKUA 1GLAG 1JCGA 4JYAK 3D2FA 4ZTFA 3AARA 3VF4A 4CJ4A 1C1BA 1N32K 3RSEB 3NH2A 1NGDA 4DFJA 3S3MA 1TK8A 2HHTA 1NMDA 5E84A 4EHTA 3MEDA 3V81A 4Y0WA 1HX1A 4LH5A 3OYBA 2CGKA 4NXMK 1ZYQA 3A5OC 3CCJN 2FSNA 4BECA 3NFAA 4O8KA 2GX9A 3V1RA 4CIGA 4IFVA 1TYQA 3AA5X 5AQHA 4A59A 4LSLA 4DR6K 3CM6A 4JV5K 4CFCA 1U45A 3WUHA 2P1JA 3V9UA 3ZSWA 1S1TA 5HRRA 1WSJA 3TAFA 1EWQA 3DLKA 3ZSVA 5JS1A 1HLUA 1N33K 3L4QA 3C7NA 3CI5A 4M3YA 3L2RA 2YHBA 4AHVA 5AFUH 3C6HA 4GVEA 4LF7K 2QWQA 3BGRA 3WEEB 1XNQK 1VQ4N 3RMAA 4MQ3A 1Z25A 5C2DA 1U48A 4EAHD 5CHIA 4K42A 3OYNA 1WSEA 4FJLA 1HNIA 1GOBA 3AVKA 2H3GX 1T8EA 2P9SA 1NK8A 2PZSA 3UE5A 1BIUA 5HOOA 1ATNA 3CXCM 4LC9B 3J7AP 4DQSA 3HSCA 4B3SK 3U4LA 3B6PA 2HOEA 1B92A 1KVCA 3F5TA 2VWBA 4BR9A 5E26A 3HOSA 4IWVA 1U2VB 1S72N 1A5XA 1T6CA 4FJMA 1WSHA 4CGIA 3NBPA 3J81O 3KZBA 4KI6A 5MLCQ 2W6KA 5FLXO 3DXMB 2UXBK 3FGUA 2PYLA 4JKDA 1BDGA 4FWSA 2F9TA 1KRPA 1BUPA 4K8XA 3C94A 5HL7L 4QOZB 4OLBA 2IDOA 3JAMO 3FZHA 5GAGP 3HPOA 4LY7A 5FPMA 4O8UA 4JI7K 1EXQA 5C10A 4FO0A 5HBMA 1EETA 4E0DA 3F2KA 2J4RA 1HNVA 2HHXA 4BRHA 3MWPA 3FFKB 1RBRA 2P9LB 2ZWHA 4KB0A 3H1VX 4DR4K 4CE9A 1BCOA 2GWJA 4DTUA 5BPNA 3VEOA 4B3TK 4WF9L 2D1KA 3OBWA 3L2UA 3KK3A 3QIPA 4H4OA 4FJJA 3VA3A 3HXMA 3PUFA 3HVRA 3SUPA 4CESA 2P9NA 3TSQA 3QIOA 2HF4A 3DLRA 2E2OA 1Q7YO 3QERA 4A5BA 3LZJA 1JLQA 2NRHA 3THWB 2XY7A 5AQLA 2LSNA 1RDUA 4H0OA 4JN4A 3DWLA 1E4GT 2G8UA 5H1SQ 2FF6A 3V4IA 3A5MC 4ZHRA 3HPHA 3D7EO 4JKGA 2DFHA 4WFBL 4N76A 1JXBA 2P9KA 3AO2A 1BU6O 3FZMA 4CHOA 1WAFA 3VQBA 3ZT3A 2YKNA 4FJ5A 1XWLA 5C25A 1Q18A 5AZIA 4KH5A 1NKEA 3I56N 3LWLA 1HYZA 4AM7A 5C24A 4DV6K 3QFUA 5J2MA 3M8PA 1LW2A 4M3XA 4BDZA 4BC3A 1TL1A 1JLEA 2IOCA 2DPNA 4DTMA 2O8BB 2P9KB 2Z1HA 4CBWA 1SL2A 3KLIA 4BE7B 1KTQA 1X9JA 3SAFA 1D9DA 3TAMA 3MXIA 4DTPA 3L4IA 3VQ8A 4FWOA 2B5JA 3O9QA 3QO9A 4WQ4A 3SPYA 4NYNA 3R9PA 3C7NB 3NGYA 4MDAA 3VTIA 3G71N 3Q7BA 5KPTA 3H46O 4CK2A 2VQFK 3NGIA 4EIAA 1L5UA 1S1UA 3O9SA 1NK4A 4A61A 1FK9A 3HP9A 4EZ9A 3DLLL 4FJHA 2A1SA 3ULEB 4E7LA 1ASVA 3B8AX 4JKGB 4FLVA 3OYMA 3QFPA 4H8KA 3NMUA 4OO1J 4CJFA 2O8CB 3OYDA 1VSJA 4IFYA 1LAVA 2OPRA 3O6WA 3LP3A 3V9WA 4FXDA 3V9ZA 3SK3A 4L8RB 5ADXH 4CHQA 2IC3A 5BN9A 3LZIA 1WAJA 1S6QA 3QINA 3VQCA 1FJGK 3VPZA 4RCHA 5J2PA 1ZC6A 3JXUA 1P90A 2HHSA 3KIOA 5M1KA 4OPHA 4OGCA 1QQOA 3VF2A 2RF2A 3HRGA 4CGFA 4FZYA 1BCMA 1O13A 4IZ9A 2WBNA 1HNZK 3VGLA 3K9JA 4M42A 4DTOA 1BI4A 4I9LA 4BWMA 1VQON 4BRMA 1WN7A 2QWOA 3EE9A 4Y1DA 3I55N 3OJSA 2NUBA 4EZ6A 4AHCA 4BACA 4CEBA 2YKMA 4Z4GA 5AQWA 4OPAA 4DFKA 1KQSM 3RR7A 3G10A 4KHQA 1JJ2M 2KFNA 4C8OA 1X1PA 3KHYA 2ZJPL 2P9IB 3MN6A 3CCMN 3CD6N 4LH4A 5B8HA 1TK0A 3AO4A 1NK6A 3ZETA 4H0XB 3UKRA 4E7JA 4FWRA 2ZE2A 3FE1A 3FZFA 2HBKA 4BWJA 4DS4A 1BA1A 3AVHA 3ZCMA 5AR0A 2VCPA 4XH5A 4YY3K 3M8SA 2RN2A 1NK9A 1ZXOA 3CC2N 3C6UA 4JI4K 3CFOA 1XI1A 1QE1A 2IVNA 3FFIA 4FLWA 3DRPA 1W97L 5AQNA 3UIQA 1U47A 4Z4EA 4DTJA 4CGGA 4DSFA 3MX2A 1VSHA 1T05A 3TAQA 3BDPA 5I3UA 5AQTA 3TAPA 4I2QA 1EP4A 1OKJA 1VQPN 3IMXA 1JKHA 3MX5A 1BOTO 3ISNC 1XMQK 2X6SA 1VAZA 2OTLN 4ID5A 2DTUA 1HPZA 1RT1A 3AGRA 4BVOA 4FVUA 4IFEA 1VQKN 3WQTA 5JICA 2P9UB 2QWMA 2OPSA 2KFZA 3GG4A 4CJQA 4CF0A 1WSFA 4LF8K 1HQEA 4I6MB 3WNFA 3O4QA 4CJWA 1Q82O 2YNHA 3SMSA 3AVGA 3LANA 3L2QA 2X78A 5AQPA 5AQMA 5AZIB 3DM2A 2YNIA 4CJEA 3V6DA 3NVMA 4FJ9A 4DV1K 2O8FA 4JI8K 3K9KA 5LJVA 2KZMA 4MFBA 3WXKA 1KSPA 5A2QO 1VSMA 4JRQA 1A5WA 4JNEA 3SV4A 2VG5A 3DOKA 4O5BA 2YX6A 3K5OA 2I7PA 4FWKA 2PAVA 4CEEA 5BRFA 1KC8O 1NK7A 2G8KA 3S9HA 4ISFA 1C0UA 4BRNA 3M8QA 3CYMA 1NOZA 4WQ5A 3RRGA 2CH6A 3D0PA 3O9RA 1VSDA 4B9MA 2Z1JA 4M45A 1WBDA 4BDPA 4DQPA 1EWRA 3MEEA 4DV0K 2OTJN 4Z4HA 2E20A 1JXEA 3M6GA 1HNWK 3LAKA 2D0BA 4I9QA 1K9MO 1QQMA 3VGMA 1VQ6N 1ZBHA 4DCHA 1R59O 4ZTJA 3ALYA 2ZJRL 3NH1A 3DLGA 3AO3A 4FK0A 3OYKA 1C0MA 4H0YB 4N5SA 2A3ZA 4FM1A 4NCBA 3TWHA 1K8KB 3M8RA 1K6YA 2V52B 3EL2A 4AH9A 1TKDA 1XUPO 4CGJA 1IJJA 1G15A 2Y1IA 3KD1E 2OYQA 3AVLA 1YJ9N 3LM9A 5AQVA 4CJ5A 5M1PA
chains in the Genus database with same CATH topology
3UB5A 4M7YA 4Y0WA 2A6AA 1HX1A 1KAZA 1YF5L 3VETA 1NGEA 2CGKA 3MK6A 3A5OC 3KWGA 2NZTA 4FPAA 4IOXA 4BR7A 3Q7CA 2FSNA 5C15A 3CCJN 4BECA 1N8RO 4O8KA 2GX9A 1BWFO 3R8EA 4CZHA 3BF3A 5AFUA 4WQ5C 5AQGA 2EWSA 4J8FA 2GEMA 4BG9A 4JK7A 4BR4A 2FSKA 4KH4A 4CBXA 4CZFA 3O08A 3WT0A 1TYQA 2AP1A 4EHUA 3CCLN 5AQHA 4A59A 1WOQA 4BQLA 5C0YA 3WUHA 2ASPA 4BRLA 3O9UA 5AQOA 1V4SA 1HLUA 1K8KA 2AA4A 3SJHA 5GIOA 2ZF5O 4M7XA 4QS7A 3L4QA 1T44A 3C7NA 3CI5A 3ENHA 1MDUB 5GIPA 1ILYA 2JWLA 3ZEUA 5M1NA 2C1IA 4BC5A 5AFUH 3C6HA 1ATRA 3JS6A 3QDKA 3ZX0A 4CZKA 4GVEA 1W2BM 3TSUA 1T3VA 3VEYA 2IIRA 2QWQA 2BTFA 4QS8A 3WEEB 4CZLA 5BRDA 3A0IX 1VQ4N 2P9PA 1IG8A 3GE1A 1X3MA 3LM2A 3HOTA 3CJ1A 3M3ZA 3TSPA 4CD1A 5C2DA 2KHOA 4DQ8A 4JEPA 4K42A 4EAHD 5CHIA 1YVNA 4JHDB 2NNWA 2H3GX 1KAXA 3VERA 4B1XB 3R1XA 2P9SA 4FOIA 4NB4A 4JKFA 3UE5A 5HOOA 2W41A 3HI0A 3WXLA 2HMPA 1ATNA 4YOXA 3CXCM 3EKUA 1J6ZA 4LC9B 3U9DA 2Q0RA 3P38A 3HSCA 5C2FA 2Q31A 3CJCA 3U4LA 3O4WA 2HOEA 1TUYA 4IJNA 5BPLA 3F5TA 2VWBA 4WYBA 3PIOL 4XEIA 2IVOA 1DGKN 4BR9A 1TUUA 3SBGA 5GINA 4YOUA 1SQKA 5E26A 3VGKA 4BG8A 3A5LC 3HOSA 4IWVA 3ZEUB 2NRTA 1U2VB 2CH5A 3AAQA 4M63C 1S72N 2W00A 1T6CA 3BF1A 4CJ7A 4WQ4C 3H1QA 4MO4A 4PL8A 5KPZA 1SS6A 3KZBA 2QEXN 5TKWA 4BRFA 4E1JA 4H5TA 1HJOA 1GLBG 3AAPA 5MLCQ 3I33A 1YIJN 3OHRA 3DXMB 3HM8A 3FGUA 4JKDA 1BDGA 4FWSA 3CCEN 1QQNA 2YHXA 5AQQA 2F9TA 4CI6A 3QMLA 1BUPA 3UKRB 4BRIA 5HL7L 3R3LA 3M5RA 2BUPA 3CQXA 1YXQA 4JKBA 5JVHL 3DJCA 4JKAA 3FZHA 4A2BA 3CCVN 5GAGP 5FPMA 4O8UA 2ITMA 4JK8A 2HBMA 3A5NC 1U2VA 1NGFA 5EY4A 1YAGA 5C10A 2D0OA 4FO0A 3VF6A 1VQNN 4ISEA 2W40A 3O1BA 3SBTA 5GAHP 3MCPA 3WEEA 2GUPA 2A5XA 1V4TA 1JCFA 3F2KA 2J4RA 4BY9C 2FXUA 4BRHA 2P9IA 3HBTA 1EQYA 4GV6A 3MWPA 3NVKA 3FFKB 2YHWA 1M90O 3TU5A 1NGIA 1NGCA 1LOTB 1BA0A 2E2QA 2P9LB 3G4SN 1ESVA 2ZWHA 1XQSC 3H1VX 4PKGA 2NLXA 4GV3A 3FZKA 1NGJA 2GWJA 4CZJA 5BPNA 3VEOA 3WXJA 3FR0A 4WF9L 2D1KA 3OBWA 1VQ5N 2A40A 3EE8A 4BR5A 2CGJA 2HBJA 3E1YA 3P31A 4IOCL 3ENOA 1NGGA 2Q2RA 3MN9A 1KAYA 1KXPA 2P9NA 4L3QA 5EVZA 3TSQA 2Q0UA 4XJXA 3CC4N 4IJAA 1U6ZA 2HF4A 2E2OA 4WFAL 5BPMA 4CBUA 5JLHA 3CETA 1Q7YO 5FPNA 4A5BA 3F9MA 3LDPA 2NRHA 4BRAA 5AQLA 4H0OA 1RDUA 2VYPA 1G99A 3N4QA 4JN4A 3DWLA 1E4GT 3T69A 2JWKA 3T7ZA 5H1SQ 2FF6A 1QZ5A 4BRCA 3A5MC 4BVPA 2Q1NA 3D7EO 2PFUA 4JKGA 4WFBL 4Z94A 5AZJA 2VGNA 3FLCO 3LL3A 5KPRA 3ATVA 3ZETB 4I6MA 3DXKB 2P9KA 2P9NB 1BU6O 3FZMA 3OBYA 3EN9A 3IFRA 1XC3A 3VEVA 4K25A 4FWPA 5F2RA 2ASMA 3O9TA 3EZWA 4JKEA 5KQDA 2V7YA 1QZ6A 1Q18A 4IEIA 5AZIA 2HBLA 4KH5A 2WUSA 3N4PA 3S41A 3I56N 1QHAA 4NLCA 5AQSA 4AM7A 2A41A 1NJIO 5AQIA 4MO5A 3QFUA 3E66A 3MCAB 5LJWA 2QW9A 3CPWM 2RHKA 3P4IA 3ID8A 1EO1A 4BC3A 3CCUN 2HF3A 3RSEA 2DPNA 5F1XA 3E9PA 4JAXA 2P9KB 3L0QA 4CBWA 1S22A 3C0BA 5M1QA 1X9JA 4BE7B 4JD2A 4CZEA 3O8MA 4FSVA 3SAFA 3IDHA 1RDWX 2YJEA 3VENA 4MLHA 4ILGB 3L4IA 4A5AA 4GV9A 4FWOA 5AZJB 3O9QA 4WQ4A 4WCEL 4H5WA 3EKSA 4IO8A 4A57A 3A8YA 1GLCG 3R9PA 1HKCA 3C7NB 4MDAA 4O5FA 4IDHA 3VTIA 3SAGA 2V51B 4HWIA 4H5RA 3G71N 2QM1A 4GY2B 2F7TA 3CJAA 3Q7BA 5KPTA 3BEXA 3H46O 3WXIA 1Z05A 5M1OA 4EIAA 1SZ2A 3O5BA 3O9SA 4A61A 2KKZA 3DLLL 3LDOA 3O1WA 1T6DA 2GWKA 1KD1O 3ULEA 4K41A 3ULEB 5GADP 5FPDA 2PBDA 4B9QA 2QI2A 1RFQA 2QWNA 1MWKA 4PHTX 1BG3A 4A62A 2YI1A 3B8AX 4JKGB 5F0XA 4RTFD 2I7NA 3QFPA 3NMUA 4OO1J 4PKHA 3VTHA 5BN8A 4AF1A 1JCEA 5DM6L 3O6WA 2HSTA 4FWNA 4JKHA 1Q81O 3EO3A 4JK9A 1HUXA 4XH4A 1NLVA 2C1GA 3H3NO 3CIPA 3ZYYX 3SK3A 3E9LA 5ADXH 3SLCA 4KBOA 5JVGL 1X3NA 3BUZB 5BN9A 1ZBSA 3GL1A 1NGBA 3VEWA 1GLDG 4IXCA 1M1KO 2P9PB 2KLAA 4B1ZA 3GDQA 3KWIA 3QBWA 2NRRA 3VPZA 3O80A 4RCHA 4YDUA 3CMAN 4ILHA 1ZC6A 3JXUA 5AQRA 1P90A 3UKUB 5E84A 5M1KA 3E9OA 4OPHA 4BRKA 3PIPL 5JMVA 3C65A 1HKGA 5AQXA 2FLOA 1QQOA 3CJ9A 3VF2A 3ZX3A 2YCHA 5DM7L 4YOWA 1YJNN 1HKBA 3VESA 2P9SB 1GLEG 4YOVA 4BR0A 2NRXA 2NRZA 3H3OB 3HZ6A 4JD2B 4NLBA 3HRGA 4BGAA 2ZGYA 5EOYA 4JKCA 5ADXA 3PLAA 1O13A 1WUAA 4IZ9A 5BRHA 2WBNA 3VGLA 3K9JA 4FPBA 3RVCA 1VQON 4BRMA 1C0GA 4H0PA 4KH6A 3VMFB 2QWOA 4HTLA 3EE9A 2NRWA 3I55N 5ELZA 4C1NI 1Q86O 3MWTA 5AQWA 4OPAA 3MN7A 4XH1A 2E1YA 3QB0A 1KQSM 3MN5A 3CERA 1SAZA 3DXMA 3QICA 3GOIA 1JJ2M 3CD6N 3KHYA 2ZJPL 2P9IB 3MN6A 3CCMN 5B8HA 3AGKA 1QVGM 3ZETA 4H0XB 3UKRA 4JHDA 4FWRA 2YJFA 1ATSA 3FE1A 2YHYA 5AQFA 3FZFA 4BRGA 3CJ7A 2HBKA 3DAWA 2QWPA 2FSJA 4ISGA 1BA1A 1K73O 2D4WA 4YDUC 2E8AA 5TKYA 5AR0A 1NWKA 2VCPA 4XH5A 4U67L 2QXLA 2UYTA 1MA9B 1DKGD 1ZXOA 3CC2N 1YITN 1Y64A 4AM6A 4EHTA 1NGHA 3LDNA 4IO9L 4B1WB 2A42A 2GELA 2VGMA 3D6RA 3IKMA 3W3DA 5AQYA 1YHQN 3CPEA 4FWMA 4PKIA 4C1NK 2QA4N 4DB3A 3SMPA 5FPEA 2IVNA 3G25A 3J8AA 4RWTA 4BC2A 4WFNL 2E88A 3TTFA 4BRDA 1GLFO 2P9UA 1W97L 4QS9A 5AQNA 4BR2A 3CJBA 4BEBA 4U7BA 1TYQB 1P8ZA 2E2NA 5LY3A 5CR4A 3MX2A 2E2PA 5AQKA 3MDQA 3QBXA 2WFBA 1GLJO 5AQTA 2E1ZA 1QVFM 5M1FA 1NGAA 3I8BA 3LDQA 4FOEA 1OKJA 4CZIA 5GAEP 3IMXA 1NM1A 1DEJA 4BROA 4MLEA 3MX5A 4PL7A 1VQPN 1BOTO 4H0VB 1LCUA 4MDBA 2RE2A 1VAZA 2OTLN 3FZLA 4CZMA 3SAHA 2BH1A 3TPQA 3AGRA 3TTCA 3CCQN 4BVOA 3M1FA 3WXMB 4FVUA 4IFEA 3R6MA 1Z6RA 1VQKN 1OVYA 1C0FA 3KVGA 3WQTA 5C12A 2P9UB 2QWMA 4NO7A 5JICA 3LDLA 2ZGZA 3CCRN 3CC7N 1CZAN 2D0PA 3GG4A 1HPMA 4A2AA 3ENBA 5JLFA 3C6AA 2ZJQL 4H5VA 3D2FB 3CHWA 4BRPA 4I6MB 3ATUA 2OANA 5AQJA 4UY8O 3TTDA 2IVPA 1Q82O 2P9LA 3SMSA 4YORA 4R79A 3VEZA 4F9OA 3MMVA 2WC9A 4GNIA 1VQMN 4BRQA 5AQPA 5EX5A 3CCSN 5AQMA 3VEXA 4DKWA 5EXWA 5AZIB 3U8XA 3H6EA 2FF3B 4BQZA 5BREA 1D4XA 3CMEN 3NVMA 3D2EA 4C23A 3U9ZA 1YJWN 1VQ7N 1GLLO 1S3XA 2F9WA 5AQUA 1YI2N 1E4FT 3K9KA 5LJVA 4DHYA 3OW2M 5CE3A 3WXKA 4H5NA 3J7ZO 4H03B 3G6EN 4YOTA 3ID6A 3WQUA 2V7ZA 4JNEA 4CZGA 5KQ8A 3CF5L 2YX6A 2Q36A 2I7PA 3GBTA 4FWKA 3HTVA 2PAVA 1KC8O 3BP8A 1MWMA 5BRFA 4YOYA 4IOAL 4ISFA 3W0LA 4BRNA 4FL9A 4BREA 1VQ8N 4WQ5A 4CD3A 1VQLN 5I9EB 1DT9A 2CH6A 1H1VA 3O9RA 5AQZA 2CGLA 1VQ9N 4IEEA 3DXKA 4FWLA 4B1YB 1YUWA 2QTDA 4EFHA 4FWQA 3OA9A 3H45C 2OTJN 3IUCA 4BC4A 2E20A 3KK7A 3M6GA 2QWRA 1K9MO 1QQMA 3VGMA 2QWLA 1VQ6N 3ZX2A 4DCHA 3D2EB 4G9ZA 1R59O 4B1UB 4ILJA 3P39A 2ZJRL 3UKUA 4B1VA 1BO5O 1GLAG 1RGIA 4H0YB 1JCGA 2A3ZA 3D2FA 3L6QA 3AARA 1K8KB 3VF4A 2V52B 3EL2A 3CQYA 5BR9A 1XUPO 3RSEB 2GTDA 2NRVA 1IJJA 1NBWA 2ASOA 4H0TB 2Q97A 4K43A 1NGDA 3VOVA 1K8AO 1YJ9N 3LM9A 5AQVA 1NMDA 3AY9A 4BGBA 5M1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UB5 A;  4M7Y A;  4Y0W A;  2A6A A;  1HX1 A;  1KAZ A;  3VET A;  1NGE A;  2CGK A;  3MK6 A;  3A5O C;  4FPA A;  2NZT A;  4BR7 A;  2FSN A;  4O8K A;  1BWF O;  3R8E A;  4CZH A;  3BF3 A;  5AFU A;  4WQ5 C;  5AQG A;  2EWS A;  4J8F A;  2GEM A;  4BG9 A;  4BR4 A;  2FSK A;  4CBX A;  4CZF A;  3O08 A;  3WT0 A;  1TYQ A;  2AP1 A;  4EHU A;  5AQH A;  1WOQ A;  4BQL A;  3WUH A;  2ASP A;  4BRL A;  5AQO A;  1V4S A;  1HLU A;  1K8K A;  2AA4 A;  3SJH A;  2ZF5 O;  4M7X A;  4QS7 A;  1T44 A;  3C7N A;  3CI5 A;  3ENH A;  1MDU B;  3ZEU A;  4BC5 A;  5AFU H;  1ATR A;  3JS6 A;  3QDK A;  3ZX0 A;  4CZK A;  3VEY A;  2IIR A;  2QWQ A;  2BTF A;  4QS8 A;  3WEE B;  4CZL A;  5BRD A;  3A0I X;  2P9P A;  1IG8 A;  3GE1 A;  1X3M A;  3LM2 A;  3CJ1 A;  3M3Z A;  4CD1 A;  2KHO A;  4DQ8 A;  4EAH D;  4K42 A;  1YVN A;  4JHD B;  2H3G X;  1KAX A;  3VER A;  4B1X B;  2P9S A;  4FOI A;  4NB4 A;  3UE5 A;  2W41 A;  3HI0 A;  3WXL A;  2HMP A;  1ATN A;  3EKU A;  1J6Z A;  4LC9 B;  3U9D A;  2Q0R A;  3HSC A;  2Q31 A;  3CJC A;  3U4L A;  3O4W A;  2HOE A;  1TUY A;  4IJN A;  5BPL A;  2VWB A;  4WYB A;  4XEI A;  2IVO A;  1DGK N;  4BR9 A;  1TUU A;  5E26 A;  1SQK A;  3VGK A;  4BG8 A;  3A5L C;  4IWV A;  3ZEU B;  1U2V B;  2CH5 A;  3AAQ A;  4M63 C;  1T6C A;  3BF1 A;  4CJ7 A;  4WQ4 C;  3H1Q A;  4MO4 A;  4PL8 A;  5KPZ A;  3KZB A;  4BRF A;  4E1J A;  4H5T A;  1HJO A;  1GLB G;  3AAP A;  3I33 A;  3OHR A;  3DXM B;  3HM8 A;  3FGU A;  1BDG A;  4FWS A;  1QQN A;  2YHX A;  5AQQ A;  2F9T A;  4CI6 A;  3QML A;  1BUP A;  3UKR B;  4BRI A;  2BUP A;  3CQX A;  1YXQ A;  3DJC A;  3FZH A;  4A2B A;  5FPM A;  2ITM A;  3A5N C;  1U2V A;  1NGF A;  5EY4 A;  1YAG A;  2D0O A;  4FO0 A;  3VF6 A;  4ISE A;  2W40 A;  3O1B A;  3MCP A;  3WEE A;  2GUP A;  2A5X A;  1V4T A;  1JCF A;  2J4R A;  2FXU A;  4BRH A;  2P9I A;  3HBT A;  1EQY A;  3FFK B;  2YHW A;  3TU5 A;  1NGI A;  1NGC A;  1LOT B;  1BA0 A;  2E2Q A;  2P9L B;  1ESV A;  2ZWH A;  1XQS C;  3H1V X;  4PKG A;  2NLX A;  3FZK A;  1NGJ A;  2GWJ A;  4CZJ A;  5BPN A;  3VEO A;  3WXJ A;  3FR0 A;  2D1K A;  2A40 A;  4BR5 A;  2CGJ A;  3ENO A;  1NGG A;  2Q2R A;  3MN9 A;  1KAY A;  1KXP A;  2P9N A;  4L3Q A;  5EVZ A;  2Q0U A;  4IJA A;  1U6Z A;  2HF4 A;  2E2O A;  5BPM A;  4CBU A;  5JLH A;  3CET A;  5FPN A;  3F9M A;  3LDP A;  2NRH A;  4BRA A;  5AQL A;  4H0O A;  2VYP A;  1G99 A;  4JN4 A;  3DWL A;  1E4G T;  2FF6 A;  1QZ5 A;  4BRC A;  3A5M C;  4BVP A;  2Q1N A;  3D7E O;  4Z94 A;  5AZJ A;  3FLC O;  3LL3 A;  5KPR A;  3ATV A;  3ZET B;  4I6M A;  3DXK B;  2P9K A;  2P9N B;  1BU6 O;  3FZM A;  3EN9 A;  3IFR A;  1XC3 A;  3VEV A;  4K25 A;  4FWP A;  5F2R A;  2ASM A;  3EZW A;  5KQD A;  2V7Y A;  1QZ6 A;  1Q18 A;  5AZI A;  2WUS A;  3S41 A;  1QHA A;  5AQS A;  4AM7 A;  2A41 A;  5AQI A;  4MO5 A;  3QFU A;  5LJW A;  2QW9 A;  3P4I A;  3ID8 A;  4BC3 A;  2HF3 A;  3RSE A;  2DPN A;  5F1X A;  4JAX A;  2P9K B;  3L0Q A;  4CBW A;  1S22 A;  3C0B A;  1X9J A;  4JD2 A;  4CZE A;  3O8M A;  4FSV A;  3IDH A;  1RDW X;  2YJE A;  3VEN A;  4MLH A;  3L4I A;  4FWO A;  5AZJ B;  4WQ4 A;  4H5W A;  3EKS A;  4IO8 A;  3A8Y A;  1GLC G;  3R9P A;  1HKC A;  3C7N B;  4O5F A;  2V51 B;  4HWI A;  4H5R A;  2QM1 A;  4GY2 B;  3CJA A;  5KPT A;  3BEX A;  3H46 O;  3WXI A;  1Z05 A;  4EIA A;  1SZ2 A;  3O5B A;  4A61 A;  3LDO A;  3O1W A;  1T6D A;  2GWK A;  3ULE A;  4K41 A;  3ULE B;  5FPD A;  2PBD A;  4B9Q A;  1RFQ A;  2QWN A;  1MWK A;  1BG3 A;  4A62 A;  2YI1 A;  3B8A X;  5F0X A;  4RTF D;  2I7N A;  3QFP A;  4PKH A;  5BN8 A;  1JCE A;  3O6W A;  4FWN A;  3EO3 A;  1HUX A;  4XH4 A;  1NLV A;  3H3N O;  3CIP A;  3SK3 A;  5ADX H;  3SLC A;  4KBO A;  1X3N A;  3BUZ B;  5BN9 A;  1ZBS A;  3GL1 A;  1NGB A;  1GLD G;  4IXC A;  2P9P B;  4B1Z A;  3GDQ A;  3QBW A;  3VPZ A;  3O80 A;  4RCH A;  4YDU A;  1ZC6 A;  3JXU A;  5AQR A;  3UKU B;  5E84 A;  4BRK A;  5JMV A;  1HKG A;  5AQX A;  2FLO A;  1QQO A;  3CJ9 A;  3VF2 A;  3ZX3 A;  2YCH A;  1HKB A;  3VES A;  2P9S B;  1GLE G;  4BR0 A;  3H3O B;  3HZ6 A;  4BGA A;  4JD2 B;  5ADX A;  2ZGY A;  5EOY A;  1WUA A;  5BRH A;  4IZ9 A;  3VGL A;  4FPB A;  4BRM A;  1C0G A;  4H0P A;  2QWO A;  4HTL A;  5ELZ A;  5AQW A;  3MN7 A;  4XH1 A;  2E1Y A;  3QB0 A;  3MN5 A;  3CER A;  1SAZ A;  3DXM A;  3QIC A;  3GOI A;  3KHY A;  2P9I B;  3MN6 A;  5B8H A;  3ZET A;  4H0X B;  3UKR A;  4JHD A;  4FWR A;  2YJF A;  3FE1 A;  1ATS A;  2YHY A;  5AQF A;  3FZF A;  4BRG A;  3CJ7 A;  3DAW A;  2QWP A;  2FSJ A;  4ISG A;  1BA1 A;  2D4W A;  4YDU C;  2E8A A;  5TKY A;  5AR0 A;  1NWK A;  2VCP A;  4XH5 A;  2QXL A;  2UYT A;  1MA9 B;  1DKG D;  1ZXO A;  1Y64 A;  4AM6 A;  4EHT A;  1NGH A;  3LDN A;  4B1W B;  2A42 A;  2GEL A;  3W3D A;  5AQY A;  4FWM A;  4PKI A;  4DB3 A;  3SMP A;  5FPE A;  2IVN A;  3G25 A;  3J8A A;  4RWT A;  4BC2 A;  2E88 A;  4BRD A;  1GLF O;  2P9U A;  4QS9 A;  5AQN A;  4BR2 A;  3CJB A;  1TYQ B;  1P8Z A;  2E2N A;  5LY3 A;  2E2P A;  5AQK A;  3MDQ A;  3QBX A;  1GLJ O;  5AQT A;  2E1Z A;  1NGA A;  3I8B A;  3LDQ A;  4FOE A;  1OKJ A;  4CZI A;  3IMX A;  1NM1 A;  1DEJ A;  4BRO A;  4MLE A;  4PL7 A;  1BOT O;  4H0V B;  1LCU A;  3FZL A;  4CZM A;  3TPQ A;  4BVO A;  3M1F A;  3R6M A;  1Z6R A;  1C0F A;  3KVG A;  3WQT A;  5JIC A;  2P9U B;  2QWM A;  4NO7 A;  3LDL A;  2ZGZ A;  1CZA N;  2D0P A;  3GG4 A;  1HPM A;  4A2A A;  5JLF A;  4H5V A;  3D2F B;  3CHW A;  4BRP A;  4I6M B;  3ATU A;  2OAN A;  5AQJ A;  2IVP A;  2P9L A;  3SMS A;  3VEZ A;  4F9O A;  3MMV A;  4GNI A;  4BRQ A;  5AQP A;  5EX5 A;  5AQM A;  3VEX A;  5EXW A;  5AZI B;  3U8X A;  3H6E A;  2FF3 B;  4BQZ A;  5BRE A;  1D4X A;  3D2E A;  4C23 A;  3U9Z A;  1GLL O;  1S3X A;  2F9W A;  5AQU A;  1E4F T;  5LJV A;  4DHY A;  5CE3 A;  3WXK A;  4H5N A;  4H03 B;  3WQU A;  4CZG A;  2V7Z A;  4JNE A;  5KQ8 A;  2Q36 A;  2I7P A;  3GBT A;  4FWK A;  3HTV A;  2PAV A;  3BP8 A;  1MWM A;  5BRF A;  4ISF A;  3W0L A;  4BRN A;  4FL9 A;  4BRE A;  4WQ5 A;  4CD3 A;  5I9E B;  5AQZ A;  2CH6 A;  1H1V A;  2CGL A;  3DXK A;  4FWL A;  4B1Y B;  1YUW A;  4EFH A;  4FWQ A;  3H45 C;  3IUC A;  4BC4 A;  2E20 A;  3M6G A;  2QWR A;  1QQM A;  3VGM A;  2QWL A;  3ZX2 A;  4DCH A;  3D2E B;  1R59 O;  4B1U B;  3UKU A;  4B1V A;  1BO5 O;  1GLA G;  1RGI A;  4H0Y B;  1JCG A;  2A3Z A;  3D2F A;  3L6Q A;  3AAR A;  1K8K B;  3VF4 A;  2V52 B;  3EL2 A;  3CQY A;  5BR9 A;  1XUP O;  3RSE B;  2GTD A;  1IJJ A;  1NBW A;  2ASO A;  4H0T B;  2Q97 A;  4K43 A;  1NGD A;  3VOV A;  3LM9 A;  5AQV A;  1NMD A;  3AY9 A;  4BGB A;  3VEW A; 
#chains in the Genus database with same CATH topology
 3UB5 A;  4M7Y A;  4K0K K;  4UQG A;  3OYG A;  1KAZ A;  3VET A;  3MK6 A;  1T03 A;  2NZT A;  4IOX A;  5C15 A;  3QEV A;  2ETJ A;  4CZH A;  5AQG A;  5KGW A;  4ICL A;  3S3N A;  5LMU K;  1WLJ A;  1FXX A;  3CCL N;  3A2F A;  2ASP A;  3K59 A;  3O9U A;  5AQO A;  1V4S A;  1NMN A;  2HHW A;  2AA4 A;  3SJH A;  4QS7 A;  4R5P A;  5GIP A;  3ENH A;  4FJI A;  3SQ0 A;  1ILY A;  2JWL A;  2C1I A;  3AO1 A;  4CZK A;  3TSU A;  1T3V A;  3VEY A;  3D45 A;  2IIR A;  1HNX K;  1KCF A;  5BRD A;  3A0I X;  2P9P A;  1IG8 A;  3AVB A;  3AV9 A;  3GE1 A;  2E5L K;  2OZM A;  4IG3 A;  4CHZ A;  3RMD A;  1E3M A;  4OKJ A;  1YVN A;  4CF9 A;  1L3S A;  2NNW A;  1S9E A;  1KAX A;  4B1X B;  3R1X A;  4FOI A;  2F8T A;  4NB4 A;  3HI0 A;  3WXL A;  3EKU A;  4XIU A;  2Q0R A;  2IAJ A;  4KPY A;  2Q31 A;  3O4W A;  1TL3 A;  2OZS A;  4IJN A;  5I42 A;  1NJW A;  2OPQ A;  2IVO A;  3OYI A;  3SUQ A;  1TUU A;  3SBG A;  4YOU A;  1QSS A;  4O0J A;  3ZEU B;  3OYA A;  4H4M A;  1KFS A;  1DTT A;  2CH5 A;  4CJ7 A;  1NKC A;  3H1Q A;  4MO4 A;  2UUB K;  5KPZ A;  4RW4 A;  4BRF A;  1GLB G;  3AAP A;  1YIJ N;  3NH0 A;  3AA3 A;  1RCH A;  3TAN A;  3CCE N;  2YHX A;  1B9F A;  4CI6 A;  4BRI A;  3R3L A;  4AHU A;  4JKB A;  4JKA A;  4CJR A;  2ITM A;  4JK8 A;  5KGX A;  3A5N C;  5EY4 A;  1YAG A;  2D0O A;  4LF6 K;  5GAH P;  3WEE A;  2GUP A;  2Y1J A;  1V4T A;  1ZBF A;  3VQA A;  1IG9 A;  2FXU A;  4DSL A;  2P9I A;  4DFM A;  2B4J A;  3NVK A;  2XHB A;  3SPZ A;  1NGI A;  2O8D B;  1NGC A;  1LOT B;  1BA0 A;  3LP1 A;  4CED A;  2VG6 A;  4I7F A;  4GV3 A;  1S6P A;  3K5N A;  5KRT A;  1VQ5 N;  5CZ1 A;  3EE8 A;  2CGJ A;  3P31 A;  3DLH A;  5JS2 A;  3MN9 A;  2Q2R A;  1KXP A;  1QHT A;  2Q0U A;  2O8E B;  4XJX A;  3CC4 N;  5BPM A;  2O8F B;  4CBU A;  3THY A;  3F9M A;  3LDP A;  2BGG A;  3AVC A;  2VYP A;  4K8Z A;  4FJX A;  1QZ5 A;  2YNF A;  3DOL A;  3MEG A;  4KHS A;  2PFU A;  3SJJ A;  2HNY A;  1TGO A;  4DMN A;  4DG1 A;  3LL3 A;  3THX B;  2W6L A;  3ZET B;  4I6M A;  1KVB A;  3NF8 A;  3IFR A;  3J80 O;  3QEI A;  1VSI A;  4K25 A;  3OVN A;  1LV5 A;  1RTJ A;  3DRR A;  3WNE A;  1I39 A;  5KQD A;  1QZ6 A;  4EP5 A;  2WUS A;  3N4P A;  1L3V A;  3O3G A;  4HVJ A;  4LF9 K;  4HHT A;  4DR7 K;  2RHK A;  3ID8 A;  4E7I A;  4Q0B A;  1F21 A;  3TI0 A;  3E9P A;  4JAX A;  1S22 A;  5M1Q A;  4JD2 A;  4DV2 K;  4JS4 A;  3VEN A;  4MLH A;  4ILG B;  4CEC A;  4FCY A;  1TV6 A;  4DFP A;  4IO8 A;  2O8C A;  4IDH A;  3SAG A;  4HWI A;  1SKS A;  2QM1 A;  2F7T A;  4B9V A;  3WXI A;  4YFU A;  5M1O A;  4BE1 A;  1Q9X A;  1R0A A;  3U3G A;  3O1W A;  3OS0 A;  5FPD A;  1RFQ A;  4CJ3 A;  1MWK A;  1BG3 A;  3JSM A;  3QET A;  1Q8I A;  5F0X A;  2I7N A;  4DR5 K;  3QNO A;  5BN8 A;  1JCE A;  2VWK A;  3ZT4 A;  2HST A;  4JKH A;  1Q81 O;  1HUX A;  4W5N A;  3PSI A;  1RDB A;  3CIP A;  4C8L A;  4LF5 K;  3E9L A;  5AJ3 K;  3SLC A;  3BUZ B;  1SUQ A;  3GL1 A;  3VQ6 A;  3AVJ A;  5J2Q A;  3GDQ A;  3KWI A;  4CCH A;  1ASW A;  1QTM A;  5AQR A;  1VK0 A;  3E9O A;  4BRK A;  4E1N A;  5HLF A;  4DSK A;  2FLO A;  1IKW A;  2X74 A;  3ZX3 A;  4ELU A;  3I0R A;  1GLE G;  4BR0 A;  2NRX A;  2NRZ A;  3H3O B;  1GOA A;  4JD2 B;  4NYF A;  4B9L A;  4E3S A;  3PLA A;  4JKC A;  1WUA A;  5BRH A;  1TAQ A;  4FPB A;  4FW2 A;  4ID1 A;  1C0G A;  4C8N A;  1XHZ A;  2HHH K;  2NRW A;  1LW0 A;  3LAM A;  4C1N I;  4M3W A;  1Q86 O;  2IS3 A;  3MWT A;  3WNH A;  2HVH A;  4IG0 A;  4XH1 A;  3K57 A;  1YVU A;  2KQ2 A;  4F3O A;  1TKZ A;  3GOI A;  4LFA K;  3OJU A;  2HW3 A;  2HNZ A;  3AGK A;  2YHA A;  3O4N A;  2DY4 A;  4JHD A;  4CEO A;  3SQ4 A;  2YJF A;  4IKF A;  5AQF A;  5HP1 A;  3CJ7 A;  2QWP A;  4X65 K;  1K73 O;  2VQE K;  2FBY A;  2XRI A;  3VQQ A;  4DQI A;  2QXL A;  3V1O A;  4DTX A;  3U3Y A;  4FK4 A;  1KLM A;  1DKG D;  1LAW A;  2R7Y A;  1Y64 A;  4AM6 A;  3K2P A;  1NGH A;  2HHU A;  5KRS A;  2A42 A;  2GEL A;  3THY B;  3D6R A;  4FWM A;  5DMR A;  4C1N K;  3OYC A;  4LF4 K;  2O8D A;  3RMB A;  1SL0 A;  1RT4 A;  3PX0 A;  2G8V A;  4TSX A;  1U49 A;  2E88 A;  4BRD A;  1OVQ A;  4O55 A;  4OLA A;  4DSJ A;  1IV0 A;  5LY3 A;  5CR4 A;  3HYF A;  2OCE A;  1GOC A;  4BDY A;  4N56 A;  1RBV A;  2E1Z A;  1KLN A;  1YIT N;  4JS5 A;  1DEJ A;  1RT6 A;  4DQR A;  2RE2 A;  1UA1 A;  2BH1 A;  3TPQ A;  3TTC A;  3L2W A;  1QS4 A;  2HMI A;  1HJR A;  1IH7 A;  4O0I A;  4W5R A;  4CEA A;  3KVG A;  1CZA N;  2D0P A;  5JLF A;  1HPM A;  1HYS A;  3ENB A;  5E41 A;  1I3A A;  3ZSZ A;  1U4B A;  3ATU A;  5AQJ A;  2IVP A;  1Y97 A;  4YOR A;  2XY6 A;  4F9O A;  2WC9 A;  4W5O A;  1WSG A;  5EX5 A;  3VEX A;  2FF3 B;  4BQZ A;  5BRE A;  4FLT A;  3HO1 A;  4NCA A;  2UUA K;  1TVR A;  3U9Z A;  1S3X A;  2F9W A;  5AQU A;  4B3R K;  3OW2 M;  3EZ5 A;  4F2R A;  2OPP A;  4H03 B;  4YOT A;  3CF5 L;  2AJQ A;  3PO5 A;  3OYE A;  1BIS A;  3BP8 A;  1MWM A;  2FC0 A;  3ASM A;  1VQ8 N;  3IS9 A;  1WB9 A;  1VQL N;  1NKB A;  2O4I A;  4CHP A;  1RT5 A;  1VQ9 N;  2F8S A;  3H45 C;  4CK1 A;  2KW4 A;  4BC4 A;  3KK7 A;  1QQC A;  2QWR A;  1X9S A;  4KHW A;  1SKR A;  1UOC A;  1YTA A;  4B1U B;  4ILJ A;  4CGD A;  4M3T A;  4B1V A;  2E6M A;  4CEQ A;  3L6Q A;  3NHG A;  2D0A A;  3CQY A;  5BR9 A;  1LWE A;  2GTD A;  2NRV A;  2ASO A;  4PQU A;  3VOV A;  1K8A O;  3AY9 A;  4E7K A;  3P83 D;  4DS5 A;  2A6A A;  4Y1C A;  1ASU A;  1YF5 L;  4NCG A;  3KK1 A;  3KWG A;  4FPA A;  4BR7 A;  4I2P A;  3CFP A;  2BAN A;  3R8E A;  4WQ5 C;  2EWS A;  1JLG A;  4C8M A;  4BR4 A;  1CXU A;  4CBX A;  4CIE A;  4CZF A;  3O08 A;  3WT0 A;  2AP1 A;  4EHU A;  3KLE A;  1WOQ A;  4BQL A;  2QXF A;  5FRO A;  1K8K A;  3DMJ A;  2ZF5 O;  4GMJ B;  4CJT A;  1T44 A;  1MDU B;  4CFB A;  2WOM A;  3ZEU A;  3QES A;  3QDK A;  3JS6 A;  3ZX0 A;  4RW7 A;  5SWM A;  4QS8 A;  4CZL A;  4QCL A;  4CFA A;  3BY5 A;  4Z0U A;  1KVA A;  5KTQ A;  1X3M A;  3HOT A;  3TSP A;  3ZT0 A;  1B9D A;  4DQ8 A;  4DR1 K;  4JHD B;  4M41 A;  3MXM A;  1XC9 A;  3VER A;  2QKB A;  4JKF A;  4YOX A;  1BL3 A;  1WSI A;  5C2F A;  4CJV A;  3L2V A;  2ZM6 K;  3TAB A;  4XEI A;  1DGK N;  1Z26 A;  5GIN A;  3A5L C;  2NRT A;  2ZQB A;  3AAQ A;  1BHL A;  3SI6 A;  1UA0 A;  4WQ4 C;  2HB5 A;  4PL8 A;  4CIF A;  4Z4I A;  1SS6 A;  2QEX N;  4H5T A;  4DSE A;  3I33 A;  3OHR A;  3OS2 A;  4DSI A;  3HM8 A;  1QQN A;  2G8W A;  3SUN A;  2DFE A;  3UKR B;  3M5R A;  1DLO A;  2BUP A;  3CQX A;  1YXQ A;  2O8E A;  1VSK A;  4A2B A;  2VG7 A;  3SQ2 A;  3KLF A;  1U2V A;  1NGF A;  2P5O A;  1IBK K;  3QLH A;  5J2N A;  4DTN A;  2W40 A;  3SBT A;  3NAE A;  3ZSR A;  1X9W A;  3IRX A;  4OPJ A;  1JCF A;  4FJ7 A;  1VSF A;  1EQY A;  2G8I A;  2YHW A;  3TU5 A;  1W9H A;  1JL1 A;  1ESV A;  2NLX A;  3WXJ A;  4HTU A;  2BDP A;  2A40 A;  1JLC A;  2HBJ A;  2EX3 A;  4IOC L;  1NGG A;  1KAY A;  4L3Q A;  5EVZ A;  5FDL A;  1ZBI A;  3TR8 A;  5FPN A;  4B3M K;  4GKJ K;  2HND A;  4BRA A;  3THW A;  1G99 A;  4FJG A;  3DRS A;  1XHX A;  1TAU A;  3T7Z A;  1C1A A;  4Z94 A;  3MXJ A;  4HUF A;  4RW8 A;  2VGN A;  5KPR A;  3RMC A;  3ATV A;  5J1E A;  3S5T A;  1VHX A;  3DXK B;  1TKT A;  2P9N B;  3NF6 A;  4B8C A;  1L3U A;  1XC3 A;  3VEV A;  5F2R A;  4OGE A;  3AVA A;  2UU9 K;  4IEI A;  1S1W A;  4B9N A;  2HBL A;  3NF9 A;  3S41 A;  4PWD A;  1QHA A;  5AQS A;  3HJF A;  1N6Q A;  2E4L A;  3T1H K;  4JI1 K;  3T3F A;  2BE2 A;  3CPW M;  4E72 A;  3CCU N;  3RSE A;  4F2S A;  1RDW X;  4CHN A;  2YJE A;  4GV9 A;  5AZJ B;  3VN5 A;  4H5W A;  4EP4 A;  4A57 A;  4O5F A;  2F96 A;  4J2E A;  5FRN A;  4C8K A;  2V51 B;  1CLQ A;  4GY2 B;  1W0H A;  4B9S A;  3O5B A;  4ELT A;  4LD0 A;  4PUO A;  3DYA A;  3LDO A;  1T6D A;  4DV5 K;  2GWK A;  1KD1 O;  3ULE A;  4K41 A;  1D8Y A;  4B9Q A;  2IGI A;  4PHT X;  3K5M A;  4A62 A;  3T1A A;  4RTF D;  3CFR A;  4CEF A;  1OH8 A;  1RT2 A;  5JEN A;  1WBB A;  4AF1 A;  2Z1G A;  3HL8 A;  3AA4 A;  3EO3 A;  2YV0 X;  3ZYY X;  4KTZ A;  4DLG A;  4OKE A;  1NGB A;  2WON A;  2A1R A;  4E1M A;  1M1K O;  2KLA A;  1A5V A;  4B1Z A;  4X62 K;  3O80 A;  4YDU A;  4ILH A;  3KKS A;  3C65 A;  2WTU A;  1JLA A;  3PX4 A;  1HKG A;  3BZC A;  3PO4 A;  2KZZ A;  3LP2 A;  1YJN N;  3CJ9 A;  5DM7 L;  4DV3 K;  4B3O A;  1HKB A;  3VES A;  4YOV A;  4IDK A;  4BGA A;  4NLB A;  4FJK A;  1HQU A;  5ADX A;  2ZGY A;  5EOY A;  4KHP K;  1ITG A;  4HUG A;  4FM0 A;  4AQY K;  4BE2 A;  3RTV A;  4KH6 A;  4HTL A;  5LL6 Z;  3V1Q A;  2E6L A;  3MN7 A;  1S9G A;  2E1Y A;  3QB0 A;  3VA0 A;  3SQ1 A;  1NK5 A;  3ZT1 A;  1SAZ A;  3DLE A;  3DXM A;  2D0C A;  5HRN A;  2HHV A;  4OPK A;  1QVG M;  1J5E K;  2FBX A;  4FLX A;  3ITH A;  3T1Y K;  4ISG A;  3V9X A;  2E8A A;  5TKY A;  1CXQ A;  1NWK A;  2QK9 A;  3LAL A;  4U67 L;  4Q5V A;  2UYT A;  2UXD K;  5SZT A;  4LSN A;  1NJY A;  1WNS A;  1CZB A;  3LDN A;  4IO9 L;  4B1W B;  3VQD A;  3IKM A;  1YHQ N;  4PKI A;  1UWB A;  1VSE A;  2QA4 N;  4DB3 A;  3SMP A;  5FPE A;  1NU0 A;  1N5Y A;  4LFC K;  3J8A A;  3JYT A;  2O8B A;  4RWT A;  4BC2 A;  4CJK A;  4QS9 A;  4BR2 A;  3CJB A;  4GW6 A;  4BEB A;  1TYQ B;  4KRF A;  2GBZ A;  4FLU A;  5IT9 O;  1RDC A;  2E2P A;  5AQK A;  3MDQ A;  3QBX A;  1W7A A;  1X9M A;  2W42 A;  4Z4F A;  4BE0 A;  3TAE A;  5M1F A;  3I8B A;  3LDQ A;  4FOE A;  5GAE P;  1NM1 A;  1NG9 A;  3VQP A;  1IKV A;  4MLE A;  3PY8 A;  4H0V B;  1LCU A;  3OTO K;  3P5J A;  3FZL A;  3SAH A;  1IKY A;  3SZ2 A;  3NCI A;  3WXM B;  4YHH K;  3R6M A;  4F3T A;  1Z6R A;  1C0F A;  3CM5 A;  3RR8 A;  4NO7 A;  3LDL A;  2ZGZ A;  4KB1 A;  4A2A A;  3RWU A;  3C6A A;  4H5V A;  4KO0 A;  3OS1 A;  1EKE A;  3D2F B;  3CHW A;  4AHT A;  3TAR A;  4BRP A;  4UY8 O;  3KJV A;  2X6N A;  1BGX T;  3TTD A;  4DUY K;  4FM2 A;  5HRP A;  4R79 A;  3VEZ A;  1RT3 A;  1RBT A;  4GNI A;  3T19 A;  1VQM N;  1HR0 K;  4F4K A;  3KD5 E;  1XNR K;  1RT7 A;  1RTD A;  1IKX A;  3U8X A;  1RIL A;  3H6E A;  4KKO A;  3LWM A;  4M3R A;  3QEP A;  3CME N;  4M3U A;  2O4G A;  3D2E A;  1VQ7 N;  1GLL O;  2P5G A;  1YI2 N;  1E4F T;  4IBN A;  5C42 A;  2RKI A;  3KKR A;  4E19 A;  3J7Z O;  4JI2 K;  3G6E N;  3ID6 A;  2Q36 A;  4QAG A;  3GBT A;  4O4G A;  1Q9Y A;  1VRU A;  3OY9 A;  3W0L A;  1NNE A;  4JRP A;  5K14 A;  4FL9 A;  1YT3 A;  1RTI A;  4FW1 A;  1H1V A;  3I8D A;  5LMN K;  2JGU A;  3AVM A;  3AVF A;  4B1Y B;  4X64 K;  4FLY A;  2D5R A;  4B8A B;  4KI4 A;  5CYQ A;  4DR3 K;  3HP6 A;  2PY5 A;  1UAX A;  2B6A A;  4DU4 A;  1YTU A;  3NDK A;  2QWL A;  4G9Z A;  3ZX2 A;  3D2E B;  1D9F A;  1DTQ A;  3QEW A;  1U04 A;  3OYJ A;  1D5A A;  4DV7 K;  5CYM A;  1IO2 A;  4FYD A;  1FW6 A;  1BO5 O;  1RGI A;  3G0Z A;  2ATQ A;  4KV8 A;  4JI0 K;  3J7Y P;  4FK2 A;  1NBW A;  2ITG A;  4H0T B;  2Q97 A;  4K43 A;  3O3F A;  1C0T A;  3EY1 A;  2RPI A;  4W5Q A;  4BGB A;  4DU3 A;  3VEW A;  1I94 K;  3LPU A;  1S5J A;  1NGE A;  2VWJ A;  1IBL K;  3U6F A;  2XY5 A;  3ZT2 A;  3Q7C A;  1N8R O;  1J9A A;  2F4V K;  4HCB A;  1BWF O;  2Q3S A;  1N36 K;  3BF3 A;  5AFU A;  4J8F A;  2GEM A;  4BG9 A;  4JK7 A;  2FSK A;  1N34 K;  4KH4 A;  4CVN E;  1LWC A;  3KK2 A;  1REV A;  5C0Y A;  3HM9 A;  3SYZ A;  2UXC K;  4BRL A;  1RDA A;  3H08 A;  5GIO A;  4M7X A;  4M3Z A;  4J2A A;  5CZ2 A;  5M1N A;  4BC5 A;  2I5J A;  1ATR A;  1W2B M;  1VRT A;  2BTF A;  3F73 A;  4HCC A;  3LM2 A;  3CJ1 A;  3M3Z A;  4CD1 A;  2KHO A;  1MU2 A;  3KLH A;  4JEP A;  3AVN A;  4OKK A;  3VQ9 A;  4KTW A;  2W41 A;  3MAQ A;  2HMP A;  1J6Z A;  3U9D A;  3P38 A;  5DK5 A;  3CJC A;  1TUY A;  5BPL A;  3PIO L;  4WYB A;  2QKK A;  4AIL C;  4N47 A;  1SQK A;  1EX4 A;  5KI6 A;  3ZSO A;  4BG8 A;  3VGK A;  3TAG A;  4M63 C;  4HUE A;  2W00 A;  3BF1 A;  1T7P A;  3SV3 A;  3LDS A;  5TKW A;  4E1J A;  1HJO A;  4KAZ A;  3HVT A;  3NF7 A;  3IAY A;  5AQQ A;  3QML A;  4CGH A;  4E7H A;  3HPG A;  4CF2 A;  5JVH L;  3DJC A;  5HRS A;  3CCV N;  5D3G A;  1C6V A;  3ZSQ A;  4W5T A;  2HBM A;  4FZZ A;  4DUZ K;  3I0S A;  1VQN N;  3VF6 A;  4ISE A;  1TK5 A;  3O1B A;  3MCP A;  2FBT A;  2A5X A;  3PV8 A;  3OYL A;  4N41 A;  4BY9 C;  3HBT A;  1XMO K;  4GV6 A;  4B08 A;  5BR8 K;  1M90 O;  4FZX C;  2E2Q A;  3G4S N;  1XQS C;  4PKG A;  3FZK A;  1NGJ A;  4CZJ A;  3FR0 A;  3QNN A;  4V19 S;  1L3T A;  4BR5 A;  5T7B A;  3E1Y A;  1RBU A;  3ENO A;  2HVI A;  4CER A;  4IJA A;  1U6Z A;  5IWA K;  4WFA L;  1FKP A;  4CF8 A;  1CZ9 A;  3CET A;  5JLH A;  2G8H A;  2PYJ A;  3K5L A;  4LFB K;  3N4Q A;  3T69 A;  2JWK A;  3HT3 A;  4AHR A;  3SNN A;  4BRC A;  2GV9 A;  4BVP A;  2Q1N A;  3BZK A;  4DLE A;  4PY5 A;  3K0S A;  5AZJ A;  3FLC O;  4Z4C A;  2G8F A;  3VQ7 A;  3OBY A;  3EN9 A;  4FWP A;  2ASM A;  3O9T A;  3OYH A;  4CJP A;  3EZW A;  4JKE A;  2V7Y A;  3LP0 A;  4X66 K;  4CJS A;  4NLC A;  2A41 A;  1NJI O;  5AQI A;  4MO5 A;  4CEZ A;  4DV4 K;  4JI5 K;  3E66 A;  3MCA B;  3IG1 A;  5LJW A;  2QW9 A;  3P4I A;  1EO1 A;  2HF3 A;  4F8R A;  5F1X A;  3L0Q A;  1S1V A;  3C0B A;  3O3H A;  1LWF A;  4CZE A;  3O8M A;  4FSV A;  3IDH A;  4A5A A;  5FRM A;  1O1W A;  4WCE L;  1RNH A;  3EKS A;  3QEX A;  3VQ4 A;  4DTS A;  1FKO A;  4J2D A;  3A8Y A;  3CG7 A;  1GLC G;  1HKC A;  4RG8 A;  4H5R A;  3OYF A;  3CJA A;  3BEX A;  5HRO A;  1Z05 A;  1SZ2 A;  3VQE A;  1NOY A;  4JLH A;  4CFD A;  2KKZ A;  4KFB A;  5EU7 A;  5GAD P;  2PBD A;  2QI2 A;  1VSL A;  2QWN A;  1BQN A;  3WNG A;  2YI1 A;  4FVM A;  3MEC A;  4PKH A;  1NJZ A;  3VTH A;  5DM6 L;  1ZBU A;  3PSF A;  2EHG A;  4FWN A;  4JK9 A;  3EYZ A;  3THV A;  2KTQ A;  4XH4 A;  1NLV A;  2C1G A;  3H3N O;  1SL1 A;  3EEQ A;  4NXN K;  4KBO A;  3KTQ A;  5JVG L;  1X3N A;  1ZBS A;  1GLD G;  4IXC A;  2P9P B;  4O44 A;  3QBW A;  2NRR A;  3ZLJ A;  3CMA N;  1SV5 A;  1QSY A;  3UKU B;  3RRH A;  3PIP L;  5JMV A;  2JLE A;  5AQX A;  1J54 A;  1JL2 A;  2YCH A;  4YOW A;  3KLG A;  4FLZ A;  2P9S B;  3HZ6 A;  3HK2 A;  3NE6 A;  1QSL A;  1BIZ A;  1HYV A;  2YNG A;  3E01 A;  3C6T A;  1BI4 B;  3RVC A;  3B6O A;  3DLB A;  4H0P A;  3VMF B;  4CF1 A;  5ELZ A;  4KHU A;  3MN5 A;  3CER A;  3AVI A;  3QIC A;  4KTQ A;  4B9U A;  4KHY A;  3ZSX A;  4DF8 A;  1OH6 A;  4JI6 K;  1ATS A;  2GUI A;  2YHY A;  3AA2 A;  4PA1 A;  4BRG A;  4G1Q A;  3DAW A;  2FSJ A;  4CHY A;  4CJL A;  2D4W A;  4YDU C;  2Z1I A;  3SUO A;  4J2B A;  4DTR A;  4DF4 A;  3PX6 A;  4JI3 K;  1MA9 B;  4GVM A;  1C1C A;  4RW6 A;  1RDD A;  3L3U A;  4FJ8 A;  2VGM A;  3W3D A;  5AQY A;  3CPE A;  4DWI A;  1JLF A;  4GKK K;  1HMV A;  3G25 A;  4WFN L;  4WE1 A;  3NGZ A;  3TTF A;  1GLF O;  2P9U A;  1J5O A;  4DQQ A;  4U7B A;  1P8Z A;  2E2N A;  1KFD A;  1IBM K;  2P51 A;  2WFB A;  1GLJ O;  1QVF M;  1NGA A;  3V9S A;  4CZI A;  1TKX A;  4BRO A;  1NJX A;  4PL7 A;  2DFF A;  4CK3 A;  4KHN A;  3CYG A;  4MDB A;  2ZD1 A;  4CZM A;  3CCQ N;  4DU1 A;  3M1F A;  2OA8 A;  2UUC K;  3HST B;  1OVY A;  5C12 A;  3CC7 N;  3CCR N;  3P1G A;  2ZJQ L;  3AO5 A;  1OH7 A;  3VQ5 A;  3THX A;  4OJR A;  4KRE A;  3LPT A;  2OAN A;  3ULD A;  2P9L A;  1S1X A;  2XY8 A;  3F9K A;  3DI6 A;  3MMV A;  4ELV A;  4FJN A;  3CQ8 A;  4BRQ A;  2HHQ A;  3CCS N;  2XO7 A;  4DKW A;  5EXW A;  4CJU A;  4DR2 K;  1D4X A;  3L3V A;  4C23 A;  1YJW N;  1RBS A;  4DHY A;  1HRH A;  4RW9 A;  1RTH A;  3C95 A;  3ZSY A;  5CE3 A;  4H5N A;  3WQU A;  4CZG A;  2V7Z A;  5KQ8 A;  4CW7 B;  4YNQ A;  1JLB A;  4B9T A;  3S3O A;  3HTV A;  1OH5 A;  4YOY A;  4IOA L;  4E89 A;  4BRE A;  3K58 A;  4CD3 A;  4OVL A;  5I9E B;  1DT9 A;  5AQZ A;  2CGL A;  4IEE A;  3DXK A;  4FWL A;  1BQM A;  1YUW A;  2QTD A;  4AHS A;  4FWQ A;  3OA9 A;  4EFH A;  3L8B A;  3SCX A;  1NK0 A;  5CY4 A;  3IUC A;  4OX9 K;  1J53 A;  1SKW A;  2HHI A;  3P39 A;  1ZBL A;  2FBV A;  3UKU A;  1GLA G;  1JCG A;  4JYA K;  3D2F A;  4ZTF A;  3AAR A;  3VF4 A;  4CJ4 A;  1C1B A;  1N32 K;  3RSE B;  3NH2 A;  1NGD A;  4DFJ A;  3S3M A;  1TK8 A;  2HHT A;  1NMD A;  5E84 A;  4EHT A;  3MED A;  3V81 A;  4Y0W A;  1HX1 A;  4LH5 A;  3OYB A;  2CGK A;  4NXM K;  1ZYQ A;  3A5O C;  3CCJ N;  2FSN A;  4BEC A;  3NFA A;  4O8K A;  2GX9 A;  3V1R A;  4CIG A;  4IFV A;  1TYQ A;  3AA5 X;  5AQH A;  4A59 A;  4LSL A;  4DR6 K;  3CM6 A;  4JV5 K;  4CFC A;  1U45 A;  3WUH A;  2P1J A;  3V9U A;  3ZSW A;  1S1T A;  5HRR A;  1WSJ A;  3TAF A;  1EWQ A;  3DLK A;  3ZSV A;  5JS1 A;  1HLU A;  1N33 K;  3L4Q A;  3C7N A;  3CI5 A;  4M3Y A;  3L2R A;  2YHB A;  4AHV A;  5AFU H;  3C6H A;  4GVE A;  4LF7 K;  2QWQ A;  3BGR A;  3WEE B;  1XNQ K;  1VQ4 N;  3RMA A;  4MQ3 A;  1Z25 A;  5C2D A;  1U48 A;  4EAH D;  5CHI A;  4K42 A;  3OYN A;  1WSE A;  4FJL A;  1HNI A;  1GOB A;  3AVK A;  2H3G X;  1T8E A;  2P9S A;  1NK8 A;  2PZS A;  3UE5 A;  1BIU A;  5HOO A;  1ATN A;  3CXC M;  4LC9 B;  3J7A P;  4DQS A;  3HSC A;  4B3S K;  3U4L A;  3B6P A;  2HOE A;  1B92 A;  1KVC A;  3F5T A;  2VWB A;  4BR9 A;  5E26 A;  3HOS A;  4IWV A;  1U2V B;  1S72 N;  1A5X A;  1T6C A;  4FJM A;  1WSH A;  4CGI A;  3NBP A;  3J81 O;  3KZB A;  4KI6 A;  5MLC Q;  2W6K A;  5FLX O;  3DXM B;  2UXB K;  3FGU A;  2PYL A;  4JKD A;  1BDG A;  4FWS A;  2F9T A;  1KRP A;  1BUP A;  4K8X A;  3C94 A;  5HL7 L;  4QOZ B;  4OLB A;  2IDO A;  3JAM O;  3FZH A;  5GAG P;  3HPO A;  4LY7 A;  5FPM A;  4O8U A;  4JI7 K;  1EXQ A;  5C10 A;  4FO0 A;  5HBM A;  1EET A;  4E0D A;  3F2K A;  2J4R A;  1HNV A;  2HHX A;  4BRH A;  3MWP A;  3FFK B;  1RBR A;  2P9L B;  2ZWH A;  4KB0 A;  3H1V X;  4DR4 K;  4CE9 A;  1BCO A;  2GWJ A;  4DTU A;  5BPN A;  3VEO A;  4B3T K;  4WF9 L;  2D1K A;  3OBW A;  3L2U A;  3KK3 A;  3QIP A;  4H4O A;  4FJJ A;  3VA3 A;  3HXM A;  3PUF A;  3HVR A;  3SUP A;  4CES A;  2P9N A;  3TSQ A;  3QIO A;  2HF4 A;  3DLR A;  2E2O A;  1Q7Y O;  3QER A;  4A5B A;  3LZJ A;  1JLQ A;  2NRH A;  3THW B;  2XY7 A;  5AQL A;  2LSN A;  1RDU A;  4H0O A;  4JN4 A;  3DWL A;  1E4G T;  2G8U A;  5H1S Q;  2FF6 A;  3V4I A;  3A5M C;  4ZHR A;  3HPH A;  3D7E O;  4JKG A;  2DFH A;  4WFB L;  4N76 A;  1JXB A;  2P9K A;  3AO2 A;  1BU6 O;  3FZM A;  4CHO A;  1WAF A;  3VQB A;  3ZT3 A;  2YKN A;  4FJ5 A;  1XWL A;  5C25 A;  1Q18 A;  5AZI A;  4KH5 A;  1NKE A;  3I56 N;  3LWL A;  1HYZ A;  4AM7 A;  5C24 A;  4DV6 K;  3QFU A;  5J2M A;  3M8P A;  1LW2 A;  4M3X A;  4BDZ A;  4BC3 A;  1TL1 A;  1JLE A;  2IOC A;  2DPN A;  4DTM A;  2O8B B;  2P9K B;  2Z1H A;  4CBW A;  1SL2 A;  3KLI A;  4BE7 B;  1KTQ A;  1X9J A;  3SAF A;  1D9D A;  3TAM A;  3MXI A;  4DTP A;  3L4I A;  3VQ8 A;  4FWO A;  2B5J A;  3O9Q A;  3QO9 A;  4WQ4 A;  3SPY A;  4NYN A;  3R9P A;  3C7N B;  3NGY A;  4MDA A;  3VTI A;  3G71 N;  3Q7B A;  5KPT A;  3H46 O;  4CK2 A;  2VQF K;  3NGI A;  4EIA A;  1L5U A;  1S1U A;  3O9S A;  1NK4 A;  4A61 A;  1FK9 A;  3HP9 A;  4EZ9 A;  3DLL L;  4FJH A;  2A1S A;  3ULE B;  4E7L A;  1ASV A;  3B8A X;  4JKG B;  4FLV A;  3OYM A;  3QFP A;  4H8K A;  3NMU A;  4OO1 J;  4CJF A;  2O8C B;  3OYD A;  1VSJ A;  4IFY A;  1LAV A;  2OPR A;  3O6W A;  3LP3 A;  3V9W A;  4FXD A;  3V9Z A;  3SK3 A;  4L8R B;  5ADX H;  4CHQ A;  2IC3 A;  5BN9 A;  3LZI A;  1WAJ A;  1S6Q A;  3QIN A;  3VQC A;  1FJG K;  3VPZ A;  4RCH A;  5J2P A;  1ZC6 A;  3JXU A;  1P90 A;  2HHS A;  3KIO A;  5M1K A;  4OPH A;  4OGC A;  1QQO A;  3VF2 A;  2RF2 A;  3HRG A;  4CGF A;  4FZY A;  1BCM A;  1O13 A;  4IZ9 A;  2WBN A;  1HNZ K;  3VGL A;  3K9J A;  4M42 A;  4DTO A;  1BI4 A;  4I9L A;  4BWM A;  1VQO N;  4BRM A;  1WN7 A;  2QWO A;  3EE9 A;  4Y1D A;  3I55 N;  3OJS A;  2NUB A;  4EZ6 A;  4AHC A;  4BAC A;  4CEB A;  2YKM A;  4Z4G A;  5AQW A;  4OPA A;  4DFK A;  1KQS M;  3RR7 A;  3G10 A;  4KHQ A;  1JJ2 M;  2KFN A;  4C8O A;  1X1P A;  3KHY A;  2ZJP L;  2P9I B;  3MN6 A;  3CCM N;  3CD6 N;  4LH4 A;  5B8H A;  1TK0 A;  3AO4 A;  1NK6 A;  3ZET A;  4H0X B;  3UKR A;  4E7J A;  4FWR A;  2ZE2 A;  3FE1 A;  3FZF A;  2HBK A;  4BWJ A;  4DS4 A;  1BA1 A;  3AVH A;  3ZCM A;  5AR0 A;  2VCP A;  4XH5 A;  4YY3 K;  3M8S A;  2RN2 A;  1NK9 A;  1ZXO A;  3CC2 N;  3C6U A;  4JI4 K;  3CFO A;  1XI1 A;  1QE1 A;  2IVN A;  3FFI A;  4FLW A;  3DRP A;  1W97 L;  5AQN A;  3UIQ A;  1U47 A;  4Z4E A;  4DTJ A;  4CGG A;  4DSF A;  3MX2 A;  1VSH A;  1T05 A;  3TAQ A;  3BDP A;  5I3U A;  5AQT A;  3TAP A;  4I2Q A;  1EP4 A;  1OKJ A;  1VQP N;  3IMX A;  1JKH A;  3MX5 A;  1BOT O;  3ISN C;  1XMQ K;  2X6S A;  1VAZ A;  2OTL N;  4ID5 A;  2DTU A;  1HPZ A;  1RT1 A;  3AGR A;  4BVO A;  4FVU A;  4IFE A;  1VQK N;  3WQT A;  5JIC A;  2P9U B;  2QWM A;  2OPS A;  2KFZ A;  3GG4 A;  4CJQ A;  4CF0 A;  1WSF A;  4LF8 K;  1HQE A;  4I6M B;  3WNF A;  3O4Q A;  4CJW A;  1Q82 O;  2YNH A;  3SMS A;  3AVG A;  3LAN A;  3L2Q A;  2X78 A;  5AQP A;  5AQM A;  5AZI B;  3DM2 A;  2YNI A;  4CJE A;  3V6D A;  3NVM A;  4FJ9 A;  4DV1 K;  2O8F A;  4JI8 K;  3K9K A;  5LJV A;  2KZM A;  4MFB A;  3WXK A;  1KSP A;  5A2Q O;  1VSM A;  4JRQ A;  1A5W A;  4JNE A;  3SV4 A;  2VG5 A;  3DOK A;  4O5B A;  2YX6 A;  3K5O A;  2I7P A;  4FWK A;  2PAV A;  4CEE A;  5BRF A;  1KC8 O;  1NK7 A;  2G8K A;  3S9H A;  4ISF A;  1C0U A;  4BRN A;  3M8Q A;  3CYM A;  1NOZ A;  4WQ5 A;  3RRG A;  2CH6 A;  3D0P A;  3O9R A;  1VSD A;  4B9M A;  2Z1J A;  4M45 A;  1WBD A;  4BDP A;  4DQP A;  1EWR A;  3MEE A;  4DV0 K;  2OTJ N;  4Z4H A;  2E20 A;  1JXE A;  3M6G A;  1HNW K;  3LAK A;  2D0B A;  4I9Q A;  1K9M O;  1QQM A;  3VGM A;  1VQ6 N;  1ZBH A;  4DCH A;  1R59 O;  4ZTJ A;  3ALY A;  2ZJR L;  3NH1 A;  3DLG A;  3AO3 A;  4FK0 A;  3OYK A;  1C0M A;  4H0Y B;  4N5S A;  2A3Z A;  4FM1 A;  4NCB A;  3TWH A;  1K8K B;  3M8R A;  1K6Y A;  2V52 B;  3EL2 A;  4AH9 A;  1TKD A;  1XUP O;  4CGJ A;  1IJJ A;  1G15 A;  2Y1I A;  3KD1 E;  2OYQ A;  3AVL A;  1YJ9 N;  3LM9 A;  5AQV A;  4CJ5 A;  5M1P A; 
#chains in the Genus database with same CATH homology
 3UB5 A;  4M7Y A;  4Y0W A;  2A6A A;  1HX1 A;  1KAZ A;  1YF5 L;  3VET A;  1NGE A;  2CGK A;  3MK6 A;  3A5O C;  3KWG A;  2NZT A;  4FPA A;  4IOX A;  4BR7 A;  3Q7C A;  2FSN A;  5C15 A;  3CCJ N;  4BEC A;  1N8R O;  4O8K A;  2GX9 A;  1BWF O;  3R8E A;  4CZH A;  3BF3 A;  5AFU A;  4WQ5 C;  5AQG A;  2EWS A;  4J8F A;  2GEM A;  4BG9 A;  4JK7 A;  4BR4 A;  2FSK A;  4KH4 A;  4CBX A;  4CZF A;  3O08 A;  3WT0 A;  1TYQ A;  2AP1 A;  4EHU A;  3CCL N;  5AQH A;  4A59 A;  1WOQ A;  4BQL A;  5C0Y A;  3WUH A;  2ASP A;  4BRL A;  3O9U A;  5AQO A;  1V4S A;  1HLU A;  1K8K A;  2AA4 A;  3SJH A;  5GIO A;  2ZF5 O;  4M7X A;  4QS7 A;  3L4Q A;  1T44 A;  3C7N A;  3CI5 A;  3ENH A;  1MDU B;  5GIP A;  1ILY A;  2JWL A;  3ZEU A;  5M1N A;  2C1I A;  4BC5 A;  5AFU H;  3C6H A;  1ATR A;  3JS6 A;  3QDK A;  3ZX0 A;  4CZK A;  4GVE A;  1W2B M;  3TSU A;  1T3V A;  3VEY A;  2IIR A;  2QWQ A;  2BTF A;  4QS8 A;  3WEE B;  4CZL A;  5BRD A;  3A0I X;  1VQ4 N;  2P9P A;  1IG8 A;  3GE1 A;  1X3M A;  3LM2 A;  3HOT A;  3CJ1 A;  3M3Z A;  3TSP A;  4CD1 A;  5C2D A;  2KHO A;  4DQ8 A;  4JEP A;  4K42 A;  4EAH D;  5CHI A;  1YVN A;  4JHD B;  2NNW A;  2H3G X;  1KAX A;  3VER A;  4B1X B;  3R1X A;  2P9S A;  4FOI A;  4NB4 A;  4JKF A;  3UE5 A;  5HOO A;  2W41 A;  3HI0 A;  3WXL A;  2HMP A;  1ATN A;  4YOX A;  3CXC M;  3EKU A;  1J6Z A;  4LC9 B;  3U9D A;  2Q0R A;  3P38 A;  3HSC A;  5C2F A;  2Q31 A;  3CJC A;  3U4L A;  3O4W A;  2HOE A;  1TUY A;  4IJN A;  5BPL A;  3F5T A;  2VWB A;  4WYB A;  3PIO L;  4XEI A;  2IVO A;  1DGK N;  4BR9 A;  1TUU A;  3SBG A;  5GIN A;  4YOU A;  1SQK A;  5E26 A;  3VGK A;  4BG8 A;  3A5L C;  3HOS A;  4IWV A;  3ZEU B;  2NRT A;  1U2V B;  2CH5 A;  3AAQ A;  4M63 C;  1S72 N;  2W00 A;  1T6C A;  3BF1 A;  4CJ7 A;  4WQ4 C;  3H1Q A;  4MO4 A;  4PL8 A;  5KPZ A;  1SS6 A;  3KZB A;  2QEX N;  5TKW A;  4BRF A;  4E1J A;  4H5T A;  1HJO A;  1GLB G;  3AAP A;  5MLC Q;  3I33 A;  1YIJ N;  3OHR A;  3DXM B;  3HM8 A;  3FGU A;  4JKD A;  1BDG A;  4FWS A;  3CCE N;  1QQN A;  2YHX A;  5AQQ A;  2F9T A;  4CI6 A;  3QML A;  1BUP A;  3UKR B;  4BRI A;  5HL7 L;  3R3L A;  3M5R A;  2BUP A;  3CQX A;  1YXQ A;  4JKB A;  5JVH L;  3DJC A;  4JKA A;  3FZH A;  4A2B A;  3CCV N;  5GAG P;  5FPM A;  4O8U A;  2ITM A;  4JK8 A;  2HBM A;  3A5N C;  1U2V A;  1NGF A;  5EY4 A;  1YAG A;  5C10 A;  2D0O A;  4FO0 A;  3VF6 A;  1VQN N;  4ISE A;  2W40 A;  3O1B A;  3SBT A;  5GAH P;  3MCP A;  3WEE A;  2GUP A;  2A5X A;  1V4T A;  1JCF A;  3F2K A;  2J4R A;  4BY9 C;  2FXU A;  4BRH A;  2P9I A;  3HBT A;  1EQY A;  4GV6 A;  3MWP A;  3NVK A;  3FFK B;  2YHW A;  1M90 O;  3TU5 A;  1NGI A;  1NGC A;  1LOT B;  1BA0 A;  2E2Q A;  2P9L B;  3G4S N;  1ESV A;  2ZWH A;  1XQS C;  3H1V X;  4PKG A;  2NLX A;  4GV3 A;  3FZK A;  1NGJ A;  2GWJ A;  4CZJ A;  5BPN A;  3VEO A;  3WXJ A;  3FR0 A;  4WF9 L;  2D1K A;  3OBW A;  1VQ5 N;  2A40 A;  3EE8 A;  4BR5 A;  2CGJ A;  2HBJ A;  3E1Y A;  3P31 A;  4IOC L;  3ENO A;  1NGG A;  2Q2R A;  3MN9 A;  1KAY A;  1KXP A;  2P9N A;  4L3Q A;  5EVZ A;  3TSQ A;  2Q0U A;  4XJX A;  3CC4 N;  4IJA A;  1U6Z A;  2HF4 A;  2E2O A;  4WFA L;  5BPM A;  4CBU A;  5JLH A;  3CET A;  1Q7Y O;  5FPN A;  4A5B A;  3F9M A;  3LDP A;  2NRH A;  4BRA A;  5AQL A;  4H0O A;  1RDU A;  2VYP A;  1G99 A;  3N4Q A;  4JN4 A;  3DWL A;  1E4G T;  3T69 A;  2JWK A;  3T7Z A;  5H1S Q;  2FF6 A;  1QZ5 A;  4BRC A;  3A5M C;  4BVP A;  2Q1N A;  3D7E O;  2PFU A;  4JKG A;  4WFB L;  4Z94 A;  5AZJ A;  2VGN A;  3FLC O;  3LL3 A;  5KPR A;  3ATV A;  3ZET B;  4I6M A;  3DXK B;  2P9K A;  2P9N B;  1BU6 O;  3FZM A;  3OBY A;  3EN9 A;  3IFR A;  1XC3 A;  3VEV A;  4K25 A;  4FWP A;  5F2R A;  2ASM A;  3O9T A;  3EZW A;  4JKE A;  5KQD A;  2V7Y A;  1QZ6 A;  1Q18 A;  4IEI A;  5AZI A;  2HBL A;  4KH5 A;  2WUS A;  3N4P A;  3S41 A;  3I56 N;  1QHA A;  4NLC A;  5AQS A;  4AM7 A;  2A41 A;  1NJI O;  5AQI A;  4MO5 A;  3QFU A;  3E66 A;  3MCA B;  5LJW A;  2QW9 A;  3CPW M;  2RHK A;  3P4I A;  3ID8 A;  1EO1 A;  4BC3 A;  3CCU N;  2HF3 A;  3RSE A;  2DPN A;  5F1X A;  3E9P A;  4JAX A;  2P9K B;  3L0Q A;  4CBW A;  1S22 A;  3C0B A;  5M1Q A;  1X9J A;  4BE7 B;  4JD2 A;  4CZE A;  3O8M A;  4FSV A;  3SAF A;  3IDH A;  1RDW X;  2YJE A;  3VEN A;  4MLH A;  4ILG B;  3L4I A;  4A5A A;  4GV9 A;  4FWO A;  5AZJ B;  3O9Q A;  4WQ4 A;  4WCE L;  4H5W A;  3EKS A;  4IO8 A;  4A57 A;  3A8Y A;  1GLC G;  3R9P A;  1HKC A;  3C7N B;  4MDA A;  4O5F A;  4IDH A;  3VTI A;  3SAG A;  2V51 B;  4HWI A;  4H5R A;  3G71 N;  2QM1 A;  4GY2 B;  2F7T A;  3CJA A;  3Q7B A;  5KPT A;  3BEX A;  3H46 O;  3WXI A;  1Z05 A;  5M1O A;  4EIA A;  1SZ2 A;  3O5B A;  3O9S A;  4A61 A;  2KKZ A;  3DLL L;  3LDO A;  3O1W A;  1T6D A;  2GWK A;  1KD1 O;  3ULE A;  4K41 A;  3ULE B;  5GAD P;  5FPD A;  2PBD A;  4B9Q A;  2QI2 A;  1RFQ A;  2QWN A;  1MWK A;  4PHT X;  1BG3 A;  4A62 A;  2YI1 A;  3B8A X;  4JKG B;  5F0X A;  4RTF D;  2I7N A;  3QFP A;  3NMU A;  4OO1 J;  4PKH A;  3VTH A;  5BN8 A;  4AF1 A;  1JCE A;  5DM6 L;  3O6W A;  2HST A;  4FWN A;  4JKH A;  1Q81 O;  3EO3 A;  4JK9 A;  1HUX A;  4XH4 A;  1NLV A;  2C1G A;  3H3N O;  3CIP A;  3ZYY X;  3SK3 A;  3E9L A;  5ADX H;  3SLC A;  4KBO A;  5JVG L;  1X3N A;  3BUZ B;  5BN9 A;  1ZBS A;  3GL1 A;  1NGB A;  3VEW A;  1GLD G;  4IXC A;  1M1K O;  2P9P B;  2KLA A;  4B1Z A;  3GDQ A;  3KWI A;  3QBW A;  2NRR A;  3VPZ A;  3O80 A;  4RCH A;  4YDU A;  3CMA N;  4ILH A;  1ZC6 A;  3JXU A;  5AQR A;  1P90 A;  3UKU B;  5E84 A;  5M1K A;  3E9O A;  4OPH A;  4BRK A;  3PIP L;  5JMV A;  3C65 A;  1HKG A;  5AQX A;  2FLO A;  1QQO A;  3CJ9 A;  3VF2 A;  3ZX3 A;  2YCH A;  5DM7 L;  4YOW A;  1YJN N;  1HKB A;  3VES A;  2P9S B;  1GLE G;  4YOV A;  4BR0 A;  2NRX A;  2NRZ A;  3H3O B;  3HZ6 A;  4JD2 B;  4NLB A;  3HRG A;  4BGA A;  2ZGY A;  5EOY A;  4JKC A;  5ADX A;  3PLA A;  1O13 A;  1WUA A;  4IZ9 A;  5BRH A;  2WBN A;  3VGL A;  3K9J A;  4FPB A;  3RVC A;  1VQO N;  4BRM A;  1C0G A;  4H0P A;  4KH6 A;  3VMF B;  2QWO A;  4HTL A;  3EE9 A;  2NRW A;  3I55 N;  5ELZ A;  4C1N I;  1Q86 O;  3MWT A;  5AQW A;  4OPA A;  3MN7 A;  4XH1 A;  2E1Y A;  3QB0 A;  1KQS M;  3MN5 A;  3CER A;  1SAZ A;  3DXM A;  3QIC A;  3GOI A;  1JJ2 M;  3CD6 N;  3KHY A;  2ZJP L;  2P9I B;  3MN6 A;  3CCM N;  5B8H A;  3AGK A;  1QVG M;  3ZET A;  4H0X B;  3UKR A;  4JHD A;  4FWR A;  2YJF A;  1ATS A;  3FE1 A;  2YHY A;  5AQF A;  3FZF A;  4BRG A;  3CJ7 A;  2HBK A;  3DAW A;  2QWP A;  2FSJ A;  4ISG A;  1BA1 A;  1K73 O;  2D4W A;  4YDU C;  2E8A A;  5TKY A;  5AR0 A;  1NWK A;  2VCP A;  4XH5 A;  4U67 L;  2QXL A;  2UYT A;  1MA9 B;  1DKG D;  1ZXO A;  3CC2 N;  1YIT N;  1Y64 A;  4AM6 A;  4EHT A;  1NGH A;  3LDN A;  4IO9 L;  4B1W B;  2A42 A;  2GEL A;  2VGM A;  3D6R A;  3IKM A;  3W3D A;  5AQY A;  1YHQ N;  3CPE A;  4FWM A;  4PKI A;  4C1N K;  2QA4 N;  4DB3 A;  3SMP A;  5FPE A;  2IVN A;  3G25 A;  3J8A A;  4RWT A;  4BC2 A;  4WFN L;  2E88 A;  3TTF A;  4BRD A;  1GLF O;  2P9U A;  1W97 L;  4QS9 A;  5AQN A;  4BR2 A;  3CJB A;  4BEB A;  4U7B A;  1TYQ B;  1P8Z A;  2E2N A;  5LY3 A;  5CR4 A;  3MX2 A;  2E2P A;  5AQK A;  3MDQ A;  3QBX A;  2WFB A;  1GLJ O;  5AQT A;  2E1Z A;  1QVF M;  5M1F A;  1NGA A;  3I8B A;  3LDQ A;  4FOE A;  1OKJ A;  4CZI A;  5GAE P;  3IMX A;  1NM1 A;  1DEJ A;  4BRO A;  4MLE A;  3MX5 A;  4PL7 A;  1VQP N;  1BOT O;  4H0V B;  1LCU A;  4MDB A;  2RE2 A;  1VAZ A;  2OTL N;  3FZL A;  4CZM A;  3SAH A;  2BH1 A;  3TPQ A;  3AGR A;  3TTC A;  3CCQ N;  4BVO A;  3M1F A;  3WXM B;  4FVU A;  4IFE A;  3R6M A;  1Z6R A;  1VQK N;  1OVY A;  1C0F A;  3KVG A;  3WQT A;  5C12 A;  2P9U B;  2QWM A;  4NO7 A;  5JIC A;  3LDL A;  2ZGZ A;  3CCR N;  3CC7 N;  1CZA N;  2D0P A;  3GG4 A;  1HPM A;  4A2A A;  3ENB A;  5JLF A;  3C6A A;  2ZJQ L;  4H5V A;  3D2F B;  3CHW A;  4BRP A;  4I6M B;  3ATU A;  2OAN A;  5AQJ A;  4UY8 O;  3TTD A;  2IVP A;  1Q82 O;  2P9L A;  3SMS A;  4YOR A;  4R79 A;  3VEZ A;  4F9O A;  3MMV A;  2WC9 A;  4GNI A;  1VQM N;  4BRQ A;  5AQP A;  5EX5 A;  3CCS N;  5AQM A;  3VEX A;  4DKW A;  5EXW A;  5AZI B;  3U8X A;  3H6E A;  2FF3 B;  4BQZ A;  5BRE A;  1D4X A;  3CME N;  3NVM A;  3D2E A;  4C23 A;  3U9Z A;  1YJW N;  1VQ7 N;  1GLL O;  1S3X A;  2F9W A;  5AQU A;  1YI2 N;  1E4F T;  3K9K A;  5LJV A;  4DHY A;  3OW2 M;  5CE3 A;  3WXK A;  4H5N A;  3J7Z O;  4H03 B;  3G6E N;  4YOT A;  3ID6 A;  3WQU A;  2V7Z A;  4JNE A;  4CZG A;  5KQ8 A;  3CF5 L;  2YX6 A;  2Q36 A;  2I7P A;  3GBT A;  4FWK A;  3HTV A;  2PAV A;  1KC8 O;  3BP8 A;  1MWM A;  5BRF A;  4YOY A;  4IOA L;  4ISF A;  3W0L A;  4BRN A;  4FL9 A;  4BRE A;  1VQ8 N;  4WQ5 A;  4CD3 A;  1VQL N;  5I9E B;  1DT9 A;  2CH6 A;  1H1V A;  3O9R A;  5AQZ A;  2CGL A;  1VQ9 N;  4IEE A;  3DXK A;  4FWL A;  4B1Y B;  1YUW A;  2QTD A;  4EFH A;  4FWQ A;  3OA9 A;  3H45 C;  2OTJ N;  3IUC A;  4BC4 A;  2E20 A;  3KK7 A;  3M6G A;  2QWR A;  1K9M O;  1QQM A;  3VGM A;  2QWL A;  1VQ6 N;  3ZX2 A;  4DCH A;  3D2E B;  4G9Z A;  1R59 O;  4B1U B;  4ILJ A;  3P39 A;  2ZJR L;  3UKU A;  4B1V A;  1BO5 O;  1GLA G;  1RGI A;  4H0Y B;  1JCG A;  2A3Z A;  3D2F A;  3L6Q A;  3AAR A;  1K8K B;  3VF4 A;  2V52 B;  3EL2 A;  3CQY A;  5BR9 A;  1XUP O;  3RSE B;  2GTD A;  2NRV A;  1IJJ A;  1NBW A;  2ASO A;  4H0T B;  2Q97 A;  4K43 A;  1NGD A;  3VOV A;  1K8A O;  1YJ9 N;  3LM9 A;  5AQV A;  1NMD A;  3AY9 A;  4BGB A;  5M1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...