1NMDA

Crystal structure of d. discoideum actin-gelsolin segment 1 complex crystallized in presence of lithium atp
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
372
structure length
362
Chain Sequence
b'DVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin
molecule tags Structural protein
source organism Homo sapiens
publication title The Structure Of The Non-Vertebrate Actin: Implications For The ATP Hydrolytic Mechanism
pubmed doi rcsb
total genus 118
structure length 362
sequence length 372
ec nomenclature
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nmdA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nmdA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1nmdA03
2W41A 4DCHA 4BGAA 3GG4A 4BRFA 4QS9A 5BN8A 4BVOA 1U6ZA 3SK3A 3VEXA 2E20A 2P9PA 3GOIA 2A40A 4H0OA 1WOQA 4ISFA 5BREA 4BRMA 1XQSC 2QWQA 1EQYA 1MDUB 3DXMB 5EVZA 3DWLA 3UKRA 2W40A 1NMDA 4XH5A 2E8AA 2YHXA 1HUXA 4A2AA 2FF3B 4O8KA 3WQUA 5BPNA 1Q18A 3EN9A 1NLVA 1TYQB 4BRNA 3VENA 3UKUB 4CZLA 3U4LA 1ATRA 1KAYA 3WEEA 5AQIA 2D4WA 3FZFA 3A8YA 4BQLA 3CERA 3ATVA 2P9NA 2ZF5O 5FPDA 5FPNA 3CJAA 1HKBA 3O08A 1GLCG 3OHRA 3P4IA 4CZHA 3ENOA 4LC9B 2A42A 2FF6A 4BRIA 3VEWA 5LY3A 1JCEA 3ID8A 3ZX3A 4FWSA 4H0TB 1ESVA 3G25A 3DAWA 4EIAA 3LDNA 2NLXA 3CJBA 4K25A 3ZEUB 4IWVA 4FWMA 3CQXA 3C0BA 3SLCA 4H5RA 2IVNA 3HTVA 2YHWA 1U2VB 4BRHA 2V7YA 1V4SA 1NGHA 4JD2A 2P9SA 1HKCA 1QQNA 2FSJA 4EHUA 3VETA 3WXKA 1X9JA 5AQKA 3EL2A 1SQKA 3L6QA 4BR2A 3H6EA 3WT0A 5AQVA 2E2QA 3VGMA 3O6WA 4RCHA 1HLUA 4NO7A 3R9PA 4I6MB 5F2RA 5F0XA 4H03B 5AQLA 2BUPA 2F9WA 5EX5A 5AZIA 2V51B 3AY9A 4IJAA 4H5TA 5KPTA 4WQ5A 4WQ4A 1ZBSA 2I7PA 3JS6A 3WEEB 4A62A 2Q36A 1P8ZA 2V7ZA 4FOIA 2NZTA 1BO5O 3O4WA 4FWPA 3ULEB 5AFUA 3FE1A 3O1BA 4BC2A 3BP8A 3A5NC 3KVGA 4JN4A 3HBTA 4H0XB 4BGBA 3ZEUA 3M3ZA 1GLFO 4CBUA 1YUWA 1E4FT 1NGBA 2CGJA 1C0FA 2YCHA 3KZBA 2YHYA 5B8HA 3H1VX 5TKYA 3GDQA 5AQFA 1GLAG 3LM9A 2P9UA 1X3MA 3D2EA 1NGAA 1XUPO 2J4RA 3TU5A 4BVPA 3SJHA 3UKUA 3U9DA 1CZAN 3M6GA 2V52B 4CI6A 3AAPA 4BQZA 4CZKA 1GLLO 3W3DA 2EWSA 1Y64A 1J6ZA 3D2FA 2QWNA 3EKUA 4FPBA 4DB3A 1IJJA 3L0QA 2D0PA 3CHWA 3LL3A 4E1JA 4H5WA 3FZMA 3HSCA 3DJCA 1KXPA 3FZLA 5FPEA 4Y0WA 3M1FA 2VWBA 5KPRA 3FFKB 5LJVA 1DEJA 5CE3A 3CJCA 2E2PA 4RWTA 3FR0A 3FLCO 3WXLA 4FWLA 4FL9A 4BRKA 1XC3A 3LM2A 5ADXA 1HX1A 4CZEA 5AQWA 1HJOA 1LCUA 3CIPA 1IG8A 3QB0A 3O80A 2F9TA 1V4TA 3QFPA 1BU6O 2H3GX 1NGJA 1S22A 4EAHD 2QW9A 2Q0RA 4K41A 1NGGA 3MCPA 4C23A 4M7YA 1BWFO 2BTFA 5JMVA 4NB4A 3SMSA 3W0LA 3VF6A 4KBOA 1ZC6A 3ATUA 1S3XA 2A5XA 3VGKA 4B1WB 2Q2RA 3H46O 2P9IA 3R8EA 4BR4A 2IIRA 3TPQA 4FWNA 4BROA 3L4IA 4M7XA 3QFUA 1ZXOA 5AQMA 2P9IB 4CZFA 4B9QA 3ZETA 4H0PA 5AQXA 5JICA 4FOEA 3D2FB 2AA4A 2QWMA 5FPMA 1K8KB 3LDPA 3B8AX 2A3ZA 2E88A 2FSNA 3ENHA 5LJWA 2P9NB 3BF1A 2YJFA 4FWRA 3AARA 2YJEA 1X3NA 2VYPA 4IXCA 3UE5A 3VEVA 4JHDA 3AAQA 3CJ1A 3FGUA 5BRDA 5BPMA 2D0OA 4BREA 4K43A 1RFQA 4BR7A 2Q0UA 5AQSA 3VEOA 4FO0A 2ASPA 3J8AA 4IJNA 3HI0A 5AQPA 2E2NA 4CBWA 3C7NB 3VF4A 1SAZA 5EOYA 3VERA 3DXMA 3U9ZA 5AQUA 1TUYA 4MLEA 4JNEA 1BOTO 2QM1A 2P9PB 1SZ2A 4BRDA 3IMXA 4BG9A 1MWKA 3FZKA 4PKGA 3O5BA 3ULEA 1BG3A 3JXUA 4ISGA 5AQOA 1HPMA 4EHTA 3QBXA 4BC5A 1ATSA 4HTLA 1QQMA 1GLJO 3I33A 1C0GA 1DKGD 2PAVA 3VESA 4XEIA 5KPZA 3QICA 4PL7A 4RTFD 5E26A 3IUCA 2AP1A 1KAXA 3BEXA 5AZIB 2PBDA 1D4XA 1NGDA 4MLHA 4K42A 3RSEB 4FWQA 2A41A 2E1ZA 2P9KA 4YDUA 2OANA 3O1WA 2I7NA 4M63C 2HF4A 4B1VA 3GL1A 4CJ7A 5AQJA 2CGLA 1WUAA 4WQ4C 4WQ5C 3O8MA 3VEYA 5BRFA 5BR9A 4BR0A 4AM7A 2P9SB 5EY4A 3I8BA 2DPNA 2IVOA 2VCPA 2E1YA 3A0IX 4FSVA 4MO4A 1YAGA 5AQNA 1QQOA 4DHYA 1QZ5A 3QBWA 1YVNA 2QWOA 3CQYA 4MO5A 4H0VB 4A2BA 2E2OA 4GNIA 4BR5A 3MDQA 2IVPA 4IZ9A 4F9OA 4FWOA 3H3OB 1HKGA 4QS8A 1E4GT 1NBWA 3WXIA 2UYTA 2QWLA 3GBTA 2GWKA 2D1KA 4IO8A 1NM1A 3SMPA 1NGCA 3EO3A 5JLHA 2ASMA 1QZ6A 3IFRA 1MA9B 3MN7A 4J8FA 4BRGA 2ZWHA 4BRAA 3C7NA 3FZHA 3WQTA 3A5MC 3MN9A 3VF2A 3UKRB 3CETA 1YXQA 4XH1A 4CZMA 4B1UB 3WUHA 1Z6RA 1ATNA 1T44A 1GLEG 1JCGA 2P9LA 3CI5A 4BRQA 4FWKA 2FLOA 4HWIA 3F9MA 4B1ZA 1NGIA 2Q1NA 1LOTB 3HM8A 2GWJA 5ELZA 1NGEA 4ISEA 3CJ7A 3R6MA 4AM6A 3WXJA 4PKIA 3UB5A 3QMLA 1MWMA 3A5OC 5AQRA 4PL8A 2ITMA 1H1VA 5BRHA 5E84A 3MK6A 1NWKA 2CGKA 3A5LC 3H3NO 1BDGA 3D2EB 2QWRA 3LDOA 5AQGA 1TUUA 4BRLA 1JCFA 4FPAA 4DQ8A 1K8KA 2GUPA 2HF3A 2FXUA 2QXLA 4B1XB 5JLFA 5AFUH 3KHYA 3VPZA 2WUSA 5AQQA 2ASOA 2ZGZA 4JAXA 3ZETB 2ZGYA 1BA0A 1G99A 4L3QA 3VGLA 4Z94A 3H45C 2A6AA 4XH4A 3BUZB 4CZIA 3LDLA 1BA1A 3MN6A 3IDHA 3ZX0A 4BC4A 4H5VA 4B1YB 4BC3A 4I6MA 5AQHA 5KQDA 5BPLA 5AQYA 5I9EB 3VEZA 2CH5A 1RGIA 3QDKA 4WYBA 3DXKA 3DXKB 1KAZA 4BR9A 5AZJB 5AZJA 4O5FA 4EFHA 4CBXA 1T6CA 1R59O 3CJ9A 3EKSA 3VOVA 3EZWA 1QHAA 3MN5A 4JD2B 2Q31A 4CD3A 1U2VA 1TYQA 2FSKA 3LDQA 1BUPA 4BG8A 2QWPA 2HOEA 3ZX2A 4BRPA 1OKJA 4YDUC 2CH6A 2GELA 5BN9A 4H5NA 1GLBG 5KQ8A 3S41A 4CD1A 5ADXH 1RDWX 1Z05A 2NRHA 3H1QA 3MMVA 4BRCA 4PKHA 2HMPA 3RSEA 2P9KB 2P9UB 3BF3A 4H0YB 3D7EO 1DGKN 5EXWA 5AR0A 2GEMA 4A61A 1GLDG 5AQZA 2KHOA 5AQTA 2YI1A 1T6DA 4QS7A 4CZGA 4CZJA 2Q97A 2GTDA 2P9LB 3GE1A 4JHDB 5F1XA 1NGFA 3U8XA 3HZ6A 4GY2B
chains in the Genus database with same CATH superfamily
4BGAA 4BRFA 2E20A 4F4KA 1GOAA 3THXA 4CW7B 1BISA 1I3AA 2F8TA 3ZT4A 1EQYA 1MDUB 5EVZA 3QLHA 2W40A 4KAZA 3DLGA 3NAEA 2PY5A 2E8AA 2FBVA 2YHXA 1JLAA 3WQUA 3CM5A 1BCOA 3SI6A 4CGFA 3U3GA 4KH6A 4CZLA 3WEEA 4BQLA 3CERA 3ATVA 5C2DA 3CCMN 1CLQA 5DM6L 5FPNA 1VQ6N 1HKBA 3CCRN 2B5JA 4FZYA 1GLCG 4CZHA 3MWPA 4YY3K 2O4GA 4H0TB 3K0SA 1S1UA 2E6MA 2OPPA 4KB1A 1HNIA 2QTDA 3DLHA 2R7YA 2P1JA 4NLBA 4CF8A 3CC4N 3SLCA 3K5LA 3MEEA 1B9FA 2GBZA 3R3LA 4YOWA 3HTVA 1U2VB 4I2PA 2V7YA 2XHBA 3MCAB 4LH5A 5AQKA 3EL2A 4W5TA 3VQAA 2E2QA 1FKOA 1NG9A 3SQ0A 3O9UA 2KZZA 5A2QO 3R9PA 3RMBA 2F7TA 4Q0BA 3AVGA 1VRTA 2VGNA 4IFYA 3S3OA 3AO3A 3KLIA 1O13A 5EX5A 1JLFA 5AZIA 3T1HK 1XNRK 3AY9A 4WQ5A 4Q5VA 5HRRA 4CJ5A 2E5LK 3HM9A 4J2BA 3AVJA 3TAMA 4JKCA 2Q36A 3G0ZA 1TK8A 3K2PA 1NKEA 1BO5O 3O4WA 4HVJA 4BC2A 1C0MA 3L3UA 4JRPA 1YT3A 3HBTA 4H0XB 4BGBA 4IBNA 3M3ZA 4CBUA 1YUWA 4I9LA 4IOCL 2CGJA 3C6HA 3LALA 4CK1A 2YCHA 5B8HA 2F96A 1SKSA 4RG8A 4FYDA 1L3SA 3SAGA 4FW2A 3IKMA 3LWMA 3SZ2A 4DF4A 2OZSA 4I7FA 3ZSVA 3KWIA 1Z25A 2UUCK 3M8SA 2WFBA 3M6GA 2DFFA 5C25A 1IKWA 4IOAL 2WTUA 3K5MA 1VK0A 1GLLO 4DSEA 4FK2A 4DTPA 3C6TA 1TKZA 1J53A 1VRUA 2WBNA 1D9DA 3TWHA 1QVFM 1QS4A 3LWLA 4FCYA 3EEQA 4Z4EA 4EP5A 3HSCA 4KB0A 1N6QA 1WNSA 1VSLA 5I42A 2B6AA 4CHPA 3PIOL 2VWBA 3FFKB 1VSJA 3WXLA 2QKKA 4FL9A 3DOKA 1XC3A 4F3TA 1RDAA 3QB0A 3O80A 4KHUA 4CE9A 1OH6A 2QW9A 2Q0RA 2ZJRL 3MCPA 4E7JA 2BTFA 4KBOA 3NH1A 2BANA 1VQON 1S3XA 3VGKA 4AHTA 4IDKA 3H46O 1VHXA 3L2VA 5IWAK 3R8EA 3NMUA 3OYEA 5AQMA 2BDPA 5C10A 1TKTA 2NRRA 4CHOA 4AHRA 3OYHA 4I2QA 3VQBA 4CEBA 3TABA 1D9FA 4OPJA 4TSXA 1QSLA 4WFNL 2E88A 3BF1A 3UE5A 4DSLA 4JHDA 3AAQA 2D0OA 1A5VA 1LWCA 3T19A 4K43A 4BR7A 3CCUN 3LP3A 4FO0A 3B6PA 2E2NA 4DV5K 3C7NB 3KIOA 4FJHA 1SV5A 4LF9K 3DXMA 3HT3A 1BOTO 5KTQA 1SZ2A 5EU7A 4HHTA 1QSYA 3ULEA 1BG3A 1RDUA 3KK1A 3E01A 2VG5A 5M1NA 3OYAA 4KHPK 4EHTA 1ATSA 2OZMA 1X9SA 4HTLA 1GLJO 3LP0A 4XEIA 4LF4K 3BEXA 5AZIB 2D0BA 4W5RA 2A41A 5C2FA 4JKBA 4EZ9A 4B1VA 3CCQN 5AQJA 4WQ4C 5KI6A 2RF2A 3PX4A 3EE8A 4M3WA 5BR9A 4BR0A 4BE1A 2P9SB 1RTIA 4NCAA 4DTJA 3HJFA 2VCPA 1EETA 4OKKA 3HVRA 3MAQA 4DV1K 3CXCM 1TL3A 4H8KA 4DHYA 1ZBLA 3O4NA 3ZLJA 1WSFA 4B9VA 2NRTA 3AVHA 2QWOA 4BR5A 2E2OA 1KLMA 3QEWA 2OA8A 4FWOA 3SQ1A 1HKGA 2W00A 4FLYA 3QEXA 1A5WA 3SAHA 4JK7A 3ULDA 2GWKA 1RT1A 2D1KA 4IO8A 1NM1A 3DYAA 3SMPA 3QEIA 5CHIA 4OGCA 4PY5A 1QZ6A 4J8FA 4BRGA 3AO1A 1IBKK 4E3SA 1X9MA 3PUFA 3C7NA 1X1PA 3A5MC 4NXMK 3CETA 1NK6A 4FJ8A 1EO1A 2KTQA 1ATNA 2YX6A 1GLEG 4C1NI 4BRQA 1NK9A 1QSSA 5FROA 1QTMA 1LOTB 3PSIA 1NGEA 1YJWN 3R6MA 4AM6A 4BECA 3QO9A 3WXJA 2RKIA 4PL8A 1H1VA 4UQGA 5M1PA 4B9UA 5GAGP 3MXJA 1BDGA 3MEGA 1N32K 1LWEA 1E3MA 2QWRA 4E7KA 3LZJA 4YOXA 1JCFA 4B9NA 2GUPA 3QNNA 3J7ZO 1NK4A 1T03A 4XJXA 3EY1A 5AFUH 3KHYA 5JVHL 5AJ3K 2WUSA 3NVMA 3P38A 2ASOA 1Q86O 2ETJA 2HW3A 1DT9A 4L3QA 3VGLA 2PZSA 4XH4A 3BUZB 5FLXO 2OPRA 4N5SA 2XRIA 4YHHK 4BC4A 3ZX0A 3IDHA 4B1YB 2HB5A 3IG1A 4I6MA 5AQHA 2B4JA 5AQYA 3RR7A 3KD1E 3VEZA 4IO9L 3F2KA 3QDKA 3NGYA 4BR9A 3THYB 1IO2A 4EFHA 4CBXA 1QE1A 3CJ9A 3NE6A 2G8KA 4DV4K 4A59A 1FW6A 3EKSA 3O3FA 4FJ5A 4G9ZA 4CJEA 1QHAA 2Q31A 4CD3A 1U2VA 3KTQA 3SNNA 3J7AP 1TL1A 1BL3A 4M3YA 4JKDA 2FBXA 1XNQK 3TSQA 3VQEA 1WSIA 5HP1A 2NRHA 3H1QA 4PQUA 2QEXN 2HMPA 4H0YB 3LDSA 3WXMB 5EXWA 4CJRA 1REVA 2AJQA 4DQPA 5AQZA 1BQMA 5AQTA 3SUPA 4QS7A 5J2QA 4CZGA 2FC0A 4CZJA 2ZE2A 2P9LB 5DMRA 4JHDB 1NGFA 1DLOA 1W2BM 1KLNA 3AV9A 3GG4A 1VQLN 3QERA 5BN8A 1U6ZA 3VEXA 2P9PA 3AO2A 3GOIA 4IG0A 3ZSQA 2A40A 5LMUK 4ISFA 1NK0A 4FJ9A 4N56A 1YTAA 5C42A 1S72N 1TKXA 2QWQA 1M90O 3DXMB 3SAFA 1VQ9N 2Z1JA 5SZTA 4NCBA 1NMDA 1U47A 1HUXA 2FF3B 4O8KA 1Q18A 3EN9A 4FLTA 1J54A 1TYQB 3HYFA 4BRNA 4IKFA 3K9KA 3UKUB 4FM1A 3PO4A 1ATRA 3VQDA 1KCFA 2KLAA 2P9NA 2XY5A 1BGXT 2Y1IA 3CJAA 2P5GA 3RMAA 1JXBA 3P4IA 4LC9B 1G15A 4AHCA 4BRIA 3OYBA 2Y1JA 3CCVN 3V9UA 2HNZA 1GOCA 3LDNA 2NLXA 4M3UA 2PFUA 2GUIA 2ZQBA 4FWMA 2UUAK 1Q82O 3ZSOA 4PHTX 1CXQA 2KQ2A 2KFZA 1EXQA 2P9SA 3J7YP 2X6SA 4EHUA 3WXKA 2P51A 1YJ9N 4CIFA 4RW7A 3WT0A 4FZXC 2GV9A 4NO7A 5H1SQ 2YNHA 4DR4K 4CEAA 3CF5L 3OYJA 3KK3A 3AVBA 5F0XA 3IRXA 2KKZA 3ISNC 1Y97A 1RCHA 2V51B 3LP1A 4IJAA 2JGUA 2HNDA 1KVBA 3WEEB 4DTRA 3HXMA 2V7ZA 4FOIA 3ALYA 4KHYA 4GMJB 2YV0X 1HNZK 3ZT0A 3A5NC 1Q9YA 3KVGA 4N47A 4FZZA 3HO1A 4JN4A 4DSKA 1SS6A 4CEEA 1GLFO 1XMQK 1NGBA 3DLEA 1C0FA 2YHYA 4JKGA 4OKEA 4KFBA 3OA9A 3DRRA 3ZSRA 4KTQA 5AQFA 3CD6N 3KK2A 3LM9A 1SL0A 4YFUA 1NGAA 1C1AA 3TU5A 1S9GA 4F3OA 4M41A 2OCEA 3TI0A 4ELUA 3WNGA 2WC9A 3OYGA 4DU4A 3AAPA 3QESA 4O4GA 4CZKA 1J5OA 3ZT2A 1Y64A 1J6ZA 3A2FA 3D2FA 2QWNA 2E4LA 1VSIA 3EKUA 5JS2A 4FJJA 4FPBA 2YNFA 4R5PA 4DB3A 1IJJA 1ZBIA 3LL3A 4DUZK 1EWQA 3DJCA 1LW0A 4DFMA 5KPRA 1RBRA 4RWTA 3FLCO 4FWLA 3RR8A 3LM2A 4CJUA 4GVEA 1HX1A 5AQWA 1S6QA 2IAJA 1HJOA 1JL1A 3OYIA 4FJ7A 3VQ7A 4M45A 1KFSA 3MXMA 1V4TA 1BU6O 1NGJA 2OPQA 4K41A 1NJIO 3CPWM 5MLCQ 4DF8A 4C23A 1BWFO 5JMVA 2DTUA 1ZC6A 2Q2RA 2VWJA 1RNHA 1A5XA 3TPQA 3D6RA 4FWNA 4BROA 3ZT3A 3L4IA 4M7XA 1DTQA 5HRSA 3L3VA 4CZFA 4IEEA 3ZETA 4H0PA 3NGIA 5JICA 2NRVA 4DSFA 4CEQA 4CIGA 4CEDA 3C6UA 4O0IA 3BGRA 3B8AX 3AO4A 2A3ZA 4W5OA 2FSNA 1NKBA 3V9ZA 2P9NB 4FWRA 3VEVA 3EZ5A 4E7HA 4DR6K 3FGUA 5BPMA 4BREA 4YOYA 3JYTA 4FLUA 1U49A 5AQSA 3ZSWA 4KV8A 3U6FA 4DU1A 4O0JA 3D45A 4FJLA 4CCHA 4CF1A 4FXDA 1JLGA 4MDAA 3U9ZA 3I8DA 4DQIA 2QM1A 3M8PA 3VN5A 3KKRA 1U4BA 1MWKA 4NXNK 3O5BA 3I56N 3JXUA 4B3MK 4ISGA 4JI7K 1HPMA 3O3GA 4BC5A 3RMCA 5GIPA 1S9EA 4CJSA 3I33A 5DK5A 5KPZA 4KREA 4PL7A 1VQNN 3TARA 4G1QA 4RTFD 4OX9K 2AP1A 4IDHA 2PBDA 4LY7A 4CJFA 1EP4A 1VQ7N 4X64K 1L3UA 3O1WA 4CJLA 3J80O 2HHHK 1JL2A 5GADP 1KTQA 4WE1A 4CJ7A 1L3TA 3AVCA 2CGLA 2NRWA 2NRXA 3ITHA 4HUEA 4AM7A 1I94K 4NCGA 2G8VA 2QK9A 3TANA 3E9PA 3LANA 3AVFA 3A0IX 3NH0A 4MO4A 1YAGA 5J2NA 4IOXA 4FJNA 1NOZA 1HRHA 1QQOA 3QBWA 1SKWA 2DFHA 4H0VB 3DLRA 3TAQA 3MDQA 3PV8A 5CZ1A 4OLAA 4IZ9A 4F9OA 2YNGA 3LP2A 3SBTA 1N36K 1E4GT 3T3FA 1IKXA 3WXIA 2ATQA 3QEPA 3GBTA 4JI6K 4AH9A 5DM7L 3OYCA 1NGCA 4FJKA 3EO3A 3TAEA 3MN7A 4CJQA 2C1GA 2E6LA 4ZHRA 5HBMA 3L8BA 4JKHA 1TKDA 2KW4A 4M3TA 4OVLA 4DR7K 1C1BA 3SQ4A 3SV4A 3FZHA 2IS3A 3WQTA 3VF2A 1S1WA 4CZMA 2RN2A 3KWGA 3WUHA 3CMEN 1TK5A 1Z6RA 1JCGA 2HMIA 1BI4B 3E9LA 1X9WA 2FLOA 3KK7A 4HWIA 3M8RA 2GWJA 1IKVA 3K5OA 2HHUA 4JI3K 1HYSA 1Z26A 4PKIA 3C94A 1RT4A 3A5OC 3O9SA 5AQRA 2ITMA 4JEPA 5E84A 2YKNA 1SL1A 4KO0A 1NWKA 3ZSXA 1IG9A 3LDOA 4UY8O 4DQ8A 1K8KA 1EKEA 3CFOA 3OTOK 2QXFA 4FVMA 2OTJN 4B1XB 3QETA 2HHIA 5AQQA 3ZETB 4FLXA 4JI2K 4LSNA 3T69A 1G99A 4BDZA 3VTIA 4CK2A 3H45C 4Z94A 4DFPA 1ZBHA 1EWRA 3N4QA 1BA1A 4AHSA 1QQCA 3MN6A 5CYMA 2HBKA 4LFAK 3TTFA 1ZBUA 4DR1K 4KI4A 2RHKA 4R79A 4HTUA 1KAZA 4O5FA 3MX2A 5HL7L 3MX5A 1TVRA 3P5JA 4CJ3A 5C15A 1YTUA 4JD2B 4E7LA 3I55N 3VQ4A 3EYZA 1HNVA 2HOEA 3ZX2A 4BRPA 3U3YA 2QKBA 3CYMA 4FJIA 4PWDA 2C1IA 2GELA 5GAEP 4B8CA 4H4OA 4N41A 4CD1A 3ZT1A 1RDWX 4JK8A 1YI2N 3KD5E 4CESA 4KRFA 2F8SA 4PKHA 3OYMA 1RBVA 3RSEA 2O8DA 2P9KB 2P9UB 4B9TA 4A61A 1XWLA 1FJGK 1LV5A 1S1VA 1NJWA 2W6KA 5KRSA 2Q97A 1W7AA 2GTDA 1FXXA 4CIEA 3U8XA 2YHAA 3V4IA 2NUBA 4QS9A 1TGOA 4BVOA 3BDPA 4DKWA 4AHVA 3BZKA 4JKGB 4DTXA 4KI6A 1WOQA 5BREA 1TAUA 1XQSC 4CJ4A 4DR3K 3DWLA 3UKRA 4CJTA 2XY6A 4LF8K 4LFBK 4JKEA 1LAWA 1R0AA 4KTZA 4A2AA 2VQEK 4DTOA 4DFKA 1XC9A 4DV3K 2KZMA 1NK5A 2BGGA 4JK9A 3L2QA 1KAYA 5AQIA 3O3HA 2G8UA 3PSFA 3A8YA 3M5RA 1HNXK 4M3XA 3C95A 4B8AB 5FDLA 3QINA 3NF6A 3O08A 1T8EA 4F8RA 2O8DB 4IFEA 3OHRA 4KTWA 3ENOA 3SYZA 2A42A 1RDDA 5LY3A 1T7PA 3NH2A 3ZX3A 1ESVA 3SPZA 4YORA 3SJJA 4JI5K 3ZEUB 3QNOA 1JLCA 4X65K 3OS1A 4FK4A 3C0BA 3F9KA 5CZ2A 5J1EA 4H5RA 1Q7YO 3K57A 4DV0K 1VSEA 1TK0A 3OYDA 1OH5A 2YHWA 3VQ9A 1RTDA 4DSJA 1V4SA 4JD2A 4BWMA 3IS9A 4M42A 1HNWK 2ZD1A 4A5AA 3VGMA 1TV6A 3L2RA 1ITGA 4DLGA 4MDBA 4F2RA 1UOCA 4FJMA 3CYGA 3DRSA 5F2RA 4IFVA 3AGKA 1L5UA 1YF5L 2O8CA 4DV2K 4MQ3A 4ID1A 1P90A 1UA1A 5KPTA 4RW4A 3AA5X 3NFAA 2I7PA 4CGDA 2UXCK 4U67L 4E0DA 5FRNA 4A62A 2QI2A 2NZTA 5M1OA 4FWPA 5AFUA 3SUNA 1XMOK 3FE1A 1UA0A 4K8ZA 3O1BA 2XO7A 4BE7B 2FBTA 3T7ZA 3RWUA 1W9HA 1IV0A 3HL8A 1SUQA 4DTUA 1NJZA 3DLBA 2HHXA 2W42A 3VA3A 3THXB 3V81A 1S1XA 3OYLA 1BIUA 3OS0A 3HOSA 3H1VX 3MWTA 4JV5K 4FM0A 3GDQA 3BZCA 4CEOA 2F4VK 1VAZA 3D2EA 2J4RA 3AVAA 4BVPA 3SJHA 4CJPA 1CZAN 1W0HA 3OVNA 4BWJA 4DTNA 5KGXA 2Q3SA 2V52B 4CI6A 3QIOA 4H4MA 4CECA 1VSMA 2D5RA 3W3DA 2EWSA 3ZSZA 4CEZA 2QA4N 5KGWA 1VQ8N 1VQ5N 3CHWA 1C1CA 4H5WA 1N34K 4ELVA 1KFDA 1KXPA 4Z4IA 3C6AA 4E1NA 1WAJA 5LJVA 2O8EA 2E2PA 3FR0A 4Y1DA 4BRKA 3LZIA 4CZEA 3VMFB 1IG8A 4YOUA 2OYQA 3DM2A 3OYKA 1S22A 4EAHD 4LF7K 3FFIA 4M7YA 3E9OA 4ELTA 2EHGA 4LF6K 1MU2A 3KKSA 3V9SA 2A5XA 2HNYA 4B1WB 4ZTJA 1XHXA 2P9IA 4WCEL 4BR4A 2IIRA 4RW8A 3ENBA 3NGZA 4CHNA 3QFUA 1ZXOA 4KPYA 4B9QA 4O5BA 5AQXA 4FK0A 3D2FB 5J2MA 2AA4A 3TTCA 1K8KB 4LFCK 2HHSA 4C8LA 3THWA 5LJWA 3AARA 1X3NA 2VYPA 4IXCA 4DLEA 5BRDA 4WFBL 5IT9O 3OBWA 1YITN 3CMAN 1NJYA 4GV9A 3VEOA 3VQQA 3J8AA 4AF1A 3HI0A 4K0KK 4HCBA 1NU0A 3VF4A 1SAZA 5EOYA 3VERA 4DFJA 1NKCA 3S5TA 1FKPA 2A1RA 5AQUA 1TUYA 4MLEA 4JNEA 2WONA 4CVNE 4ZTFA 4E89A 2P9PB 4OJRA 4BRDA 1IBLK 3SUQA 3FZKA 3JSMA 4CFAA 5C0YA 2YKMA 3SCXA 3V1RA 3QBXA 1XI1A 1QQMA 2X74A 3NF7A 4C8KA 4DQRA 2W6LA 1C0GA 1DKGD 2PAVA 3THYA 1LWFA 3DLKA 1TAQA 1T3VA 5E26A 3IUCA 1KAXA 4CFCA 3VQ5A 1NGDA 4K42A 3RSEB 1JLQA 2XY8A 2P9KA 4YDUA 1U04A 4M63C 2HF4A 4AQYK 1KSPA 3PLAA 4BACA 3CPEA 4QAGA 3OW2M 4BDPA 3WNFA 4CGIA 3Q7CA 3SPYA 5EY4A 3I8BA 3QIPA 5C24A 1WBBA 4PA1A 2E1YA 3TAPA 4FSVA 3K59A 5M1KA 5AQNA 5HROA 4A57A 1QZ5A 1YVNA 4B08A 4A2BA 1RBSA 3KLEA 1RT2A 1OVQA 4O44A 4DTMA 1YIJN 4EZ6A 2QWLA 1D8YA 4ILJA 3MEDA 3PY8A 2ASMA 1MA9B 3NBPA 3CCJN 3RVCA 3AVNA 3B6OA 2X6NA 4CHZA 3MN9A 4JLHA 5T7BA 3K5NA 2P5OA 1YXQA 4O8UA 4XH1A 4B1UB 4FLWA 3KJVA 2P9LA 3CI5A 1F21A 4FWKA 3UIQA 3F9MA 4B1ZA 4FLZA 1NGIA 2Q1NA 3HRGA 3I0SA 4E19A 1HQEA 4ISEA 5HOOA 4B3TK 3TSPA 2VG7A 2ZJQL 4LH4A 3O9QA 5BRHA 4Z4HA 4FJGA 4W5NA 3H3NO 2G8WA 4WF9L 3E1YA 3D2EB 1RT5A 1K73O 1TUUA 4BRLA 4CK3A 4OPKA 3OYFA 2HF3A 1D5AA 3K58A 4GKKK 2ZGZA 4JAXA 1VSDA 2ZGYA 1K8AO 1BA0A 5SWMA 1RTHA 5LMNK 2A6AA 4JI1K 4MFBA 2BE2A 4CZIA 3HPOA 3KLFA 3K9JA 4YNQA 4BC3A 3L2WA 1QVGM 2Z1GA 5BPLA 4GV6A 1J9AA 4CFDA 1RGIA 5KRTA 1VSHA 4WYBA 3DXKA 3DXKB 4JRQA 1HR0K 5AZJB 5AZJA 2IOCA 4NYFA 1GOBA 3AA4A 3VOVA 3MN5A 3LDQA 3CFPA 1BUPA 3J81O 3LAKA 2QWPA 3PX6A 4X62K 2HHVA 1C0TA 1KVAA 1RTJA 1BHLA 3OBYA 3AVIA 5BN9A 5KQ8A 4H5NA 3R1XA 1WAFA 4J2EA 3S41A 5ADXH 3CQ8A 2D0AA 1Q9XA 2FBYA 4LF5K 5HRPA 4BRCA 1WSHA 4E7IA 1DGKN 5AR0A 4JS4A 2GEMA 4I9QA 4J2AA 1OH7A 1T6DA 3DRPA 1VQPN 2ZJPL 2G8FA 1JLEA 4JS5A 5F1XA 3AVMA 2UXDK 3G4SN 4V19S 3HVTA 1VSKA 4DQQA 2W41A 4DCHA 2ITGA 3SK3A 3VA0A 4Z4FA 5C12A 3VQCA 3KLHA 4N76A 4H0OA 4BRMA 3NDKA 1RT3A 4OPAA 2HSTA 4CJVA 2ZM6K 1B92A 4XH5A 3VQ8A 5BPNA 4ICLA 2YNIA 1NLVA 4XIUA 2HHQA 3VENA 1JXEA 4CGGA 3O9RA 3V9XA 2YHBA 3U4LA 1RDBA 2D4WA 4AHUA 3FZFA 1JLBA 2HBLA 5JVGL 2ZF5O 4HUFA 5FPDA 3IAYA 3V1OA 2FF6A 3VEWA 1KRPA 1JCEA 3ID8A 3F5TA 1RILA 4FWSA 4DMNA 4QOZB 3G25A 3DAWA 4EIAA 3CJBA 4K25A 3EE9A 4IWVA 3CFRA 4CERA 3CQXA 5FRMA 3P39A 4M3RA 1RDCA 2LSNA 2IVNA 3S9HA 2UXBK 4BRHA 1NGHA 4JKAA 1HKCA 1QQNA 2FSJA 3VETA 3PIPL 4FVUA 1X9JA 1YHQN 3OJSA 1SQKA 3L6QA 2EX3A 4ID5A 4BR2A 4B9SA 3H6EA 1NJXA 5AQVA 1HPZA 1N8RO 3O6WA 3MECA 1HLUA 4RCHA 1N33K 1M1KO 4DV7K 4KHSA 4A5BA 4GW6A 4Z4GA 4I6MB 5E41A 2HHTA 4H03B 5AQLA 2BUPA 2F9WA 2Z1HA 4IEIA 4OKJA 5M1FA 1XHZA 4DR2K 1ZBFA 2UU9K 4H5TA 4WQ4A 4ILGB 3T1YK 3P31A 3NF9A 1ZBSA 3JS6A 3L2UA 3HOTA 3AVLA 1P8ZA 1VQMN 5BR8K 3TTDA 3ULEB 1DTTA 2A1SA 3BP8A 5J2PA 3PO5A 1WSJA 3ZEUA 3SUOA 3E66A 1Q8IA 1E4FT 3M8QA 4GKJK 1BQNA 3RTVA 2Z1IA 2OPSA 4J2DA 3KZBA 1O1WA 1HJRA 1S5JA 4FJXA 3AA3A 3P1GA 3CCLN 4BY9C 5TKYA 1GLAG 4O55A 3WNHA 2P9UA 4M3ZA 5TKWA 1X3MA 1XUPO 1OVYA 3UKUA 3AO5A 2RPIA 3U9DA 5HLFA 3CCSN 4Y1CA 4B9LA 4GVMA 1OH8A 4OO1J 4BQZA 4JKFA 3DMJA 3MXIA 1YVUA 1K6YA 4GV3A 4DSIA 3L0QA 4U7BA 2D0PA 1WBDA 4OLBA 4E1JA 3FZMA 3VTHA 1WLJA 3FZLA 4L8RB 5FPEA 1VSFA 1SKRA 4Y0WA 1RBUA 3M1FA 1NMNA 1DEJA 5CE3A 4PUOA 1LAVA 3CJCA 4CJKA 4B3RK 4WFAL 5ADXA 2IC3A 4B9MA 1NK7A 1LCUA 3CIPA 3D0PA 3QEVA 1UWBA 2D0CA 2F9TA 4KH5A 5LL6Z 4NLCA 4DS4A 3S3NA 2VGMA 3QFPA 2H3GX 4C8MA 4Z0UA 3G71N 1U45A 2PYLA 4KHWA 1NGGA 1RBTA 3TAGA 1C0UA 4NB4A 3SMSA 3W0LA 4B3SK 1N5YA 3VF6A 1WN7A 2O8FB 3ATUA 3HPHA 1KD1O 3AGRA 1K9MO 1IH7A 1FK9A 1S1TA 2HVIA 2P9IB 1WB9A 3TSUA 3CG7A 4E72A 4FOEA 2QWMA 3L4QA 5FPMA 2KFNA 3LDPA 3C65A 2JWLA 4W5QA 4DQSA 3ENHA 4KHQA 4DV6K 2YJFA 1WSGA 2YJEA 2DY4A 3OS2A 2HBMA 3THVA 3CJ1A 4HUGA 1CXUA 1IKYA 4DTSA 4CHQA 1RFQA 2Q0UA 4KHNA 3ZSYA 2NNWA 2ASPA 4IJNA 3HPGA 2HHWA 2WOMA 5AQPA 3CCEN 4CBWA 1HYVA 3HP6A 1B9DA 2BH1A 5CY4A 4C1NK 3TAFA 2G8IA 3OJUA 5I3UA 1EX4A 1NOYA 3DI6A 4OGEA 4YOVA 3IMXA 4BG9A 2IGIA 4BEBA 4RW6A 2PYJA 3DOLA 3ID6A 2VG6A 4PKGA 4X66K 3KLGA 3P83D 1IBMK 5GIOA 4ILHA 4LD0A 5AQOA 4KKOA 1ASWA 2NRZA 3WNEA 4DUYK 3VESA 2DFEA 3QICA 3OY9A 3HK2A 1NNEA 1Q81O 2HVHA 1D4XA 3LPTA 4MLHA 3NHGA 2HBJA 4C8NA 4FWQA 2E1ZA 1KQSM 3F73A 5K14A 1L3VA 2OANA 4FM2A 2I7NA 4LSLA 5JENA 2JWKA 3GL1A 4CJWA 4NYNA 3OYNA 3DLLL 1WUAA 4DG1A 4WQ5C 3TR8A 3O8MA 3VEYA 3V6DA 5BRFA 3PX0A 3NVKA 2O8FA 4DU3A 4KH4A 2DPNA 3RRHA 3ASMA 3G10A 4CF2A 2IVOA 3S3MA 2GX9A 1NK8A 4Z4CA 1JJ2M 4B3OA 3AA2A 4YOTA 3CQYA 4MO5A 4GNIA 2IVPA 3H3OB 1QHTA 4C8OA 4QS8A 1NBWA 3RMDA 3VQPA 1J5EK 1YJNN 2OTLN 2UYTA 5GINA 4OPHA 4CHYA 3O4QA 4CF9A 4CEFA 5JLHA 3ZYYX 3IFRA 4AILC 3SV3A 3ZCMA 4DWIA 1BCMA 3VQ6A 1I39A 2ZWHA 4BRAA 1ASUA 1U48A 3CM6A 2O4IA 3V1QA 3CC7N 4JI8K 3UKRB 1HYZA 4FW1A 1KC8O 3O9TA 1T44A 2I5JA 4JYAK 3HM8A 5ELZA 3CJ7A 4JI4K 1CZBA 3G6EN 4JI0K 3THWB 2IDOA 3UB5A 2O8BA 3QMLA 1MWMA 4IG3A 1W97L 3MK6A 3SQ2A 2CGKA 3A5LC 4CFBA 1HMVA 3H08A 5AQGA 4DR5K 2O8BB 1HQUA 5M1QA 4F2SA 3AVKA 4FPAA 3N4PA 1SL2A 3V9WA 2FXUA 2UUBK 2QXLA 5JLFA 1VQ4N 3VPZA 1BI4A 1T05A 5CYQA 5HRNA 2VWKA 3LAMA 1ILYA 1UAXA 1C6VA 1KVCA 3LDLA 1WSEA 3HSTB 4BE0A 4CGJA 4H5VA 2X78A 5KQDA 3T1AA 5I9EB 3SBGA 5GAHP 4CGHA 3RRGA 2CH5A 4K8XA 2O8EB 2XY7A 4HCCA 4CF0A 4QCLA 1RT7A 4DS5A 2O8CB 1VQKN 1T6CA 1R59O 2JLEA 5CR4A 2RE2A 3EZWA 1RT6A 1LW2A 1BIZA 4BE2A 1ASVA 4E1MA 1ZYQA 2FSKA 1TYQA 4FLVA 4BDYA 4BG8A 1OKJA 4YDUC 2CH6A 5JS1A 1JKHA 1GLBG 1S6PA 1Z05A 3MMVA 3CC2N 3BY5A 3JAMO 3NCIA 3BF3A 4RW9A 3D7EO 5D3GA 3LPUA 3NF8A 2G8HA 1GLDG 2KHOA 2VQFK 2YI1A 3Q7BA 1CZ9A 3GE1A 3I0RA 3HP9A 4EP4A 3HZ6A 4GY2B
chains in the Genus database with same CATH topology
1W2BM 2W41A 4DCHA 4BGAA 3GG4A 4BRFA 1VQLN 4QS9A 5BN8A 4BVOA 4DKWA 1U6ZA 3SK3A 3VEXA 2E20A 2P9PA 4JKGB 3GOIA 5C12A 2A40A 4H0OA 1WOQA 4ISFA 5BREA 4BRMA 1XQSC 1S72N 2QWQA 4OPAA 1M90O 1EQYA 1MDUB 2HSTA 3DXMB 5EVZA 3SAFA 3DWLA 3UKRA 1VQ9N 2W40A 4JKEA 1NMDA 4XH5A 2E8AA 2YHXA 1HUXA 4A2AA 2FF3B 4O8KA 3WQUA 5BPNA 1Q18A 3EN9A 1NLVA 1TYQB 4BRNA 3VENA 3K9KA 3O9RA 4KH6A 4JK9A 3UKUB 4CZLA 3U4LA 1ATRA 1KAYA 3WEEA 5AQIA 2D4WA 3FZFA 2HBLA 3A8YA 3M5RA 4BQLA 3CERA 5JVGL 3ATVA 2KLAA 2P9NA 2ZF5O 5C2DA 3CCMN 5DM6L 5FPDA 5FPNA 1VQ6N 3CJAA 1HKBA 3O08A 3CCRN 4IFEA 1GLCG 3OHRA 3MWPA 3P4IA 4CZHA 3ENOA 4LC9B 2A42A 2FF6A 4BRIA 3VEWA 5LY3A 3CCVN 1JCEA 3ID8A 3ZX3A 3F5TA 4FWSA 4H0TB 1ESVA 3G25A 3DAWA 4YORA 4EIAA 3LDNA 2NLXA 3CJBA 4K25A 3EE9A 3ZEUB 2QTDA 4IWVA 2PFUA 4FWMA 4NLBA 3CQXA 3C0BA 3P39A 3CC4N 3SLCA 1Q82O 4H5RA 1Q7YO 4PHTX 3R3LA 4YOWA 2IVNA 3HTVA 2YHWA 1U2VB 4BRHA 2V7YA 1V4SA 1NGHA 4JD2A 2P9SA 1HKCA 1QQNA 2FSJA 4JKAA 4EHUA 3MCAB 3VETA 3WXKA 3PIPL 1X9JA 5AQKA 3EL2A 1SQKA 3L6QA 1YHQN 4FVUA 4BR2A 1YJ9N 3H6EA 4A5AA 3WT0A 5AQVA 2E2QA 3VGMA 1N8RO 3O6WA 4RCHA 1HLUA 4NO7A 3O9UA 4MDBA 1M1KO 3R9PA 5H1SQ 3CF5L 4A5BA 2F7TA 4I6MB 5F2RA 5F0XA 2KKZA 2VGNA 3AGKA 4H03B 5AQLA 2BUPA 2F9WA 1O13A 1YF5L 4IEIA 5EX5A 5AZIA 2V51B 5M1FA 3AY9A 1P90A 4IJAA 4H5TA 5KPTA 4WQ5A 4ILGB 4WQ4A 3P31A 1ZBSA 2I7PA 3JS6A 4U67L 3HOTA 3WEEB 4JKCA 4A62A 2Q36A 1P8ZA 2V7ZA 4FOIA 2QI2A 2NZTA 1BO5O 3O4WA 5M1OA 1VQMN 4FWPA 3TTDA 3ULEB 5AFUA 3FE1A 3O1BA 4BC2A 3BP8A 4BE7B 3A5NC 3KVGA 3T7ZA 4JN4A 3HBTA 4H0XB 4BGBA 1SS6A 3ZEUA 3M3ZA 1GLFO 4CBUA 3E66A 1YUWA 1E4FT 4IOCL 1NGBA 2CGJA 3C6HA 1C0FA 2YCHA 3KZBA 2YHYA 4JKGA 5B8HA 3OA9A 3HOSA 3H1VX 3MWTA 3CCLN 3SAGA 4BY9C 5TKYA 3GDQA 5AQFA 1GLAG 3CD6N 3LM9A 2P9UA 1VAZA 5TKWA 1X3MA 3D2EA 3IKMA 1NGAA 1XUPO 2J4RA 1OVYA 3TU5A 4BVPA 3SJHA 3UKUA 3KWIA 3U9DA 1CZAN 2WFBA 3CCSN 3M6GA 2WC9A 4OO1J 2V52B 4CI6A 4IOAL 3AAPA 4BQZA 4CZKA 1GLLO 3W3DA 2EWSA 1Y64A 1J6ZA 3D2FA 2QWNA 3EKUA 3G4SN 4JKFA 4FPBA 2QA4N 1VQ8N 2WBNA 1QVFM 4DB3A 4GV3A 1IJJA 3L0QA 4U7BA 2D0PA 1VQ5N 3CHWA 3LL3A 4E1JA 4H5WA 3FZMA 3VTHA 3HSCA 3DJCA 1KXPA 3FZLA 5FPEA 3C6AA 4Y0WA 3PIOL 3M1FA 2VWBA 5KPRA 3FFKB 5LJVA 1DEJA 5CE3A 3CJCA 2E2PA 4RWTA 3FR0A 3FLCO 3WXLA 4FWLA 4FL9A 4BRKA 1XC3A 3LM2A 4WFAL 4GVEA 5ADXA 1HX1A 4CZEA 5AQWA 3VMFB 1HJOA 1LCUA 3CIPA 1IG8A 3QB0A 4YOUA 3O80A 2F9TA 4KH5A 4NLCA 1V4TA 2VGMA 3QFPA 1BU6O 2H3GX 1NGJA 3G71N 1S22A 4EAHD 2QW9A 2Q0RA 4K41A 1NJIO 2ZJRL 3CPWM 5MLCQ 1NGGA 3MCPA 4C23A 4M7YA 1BWFO 3E9OA 2BTFA 5JMVA 4NB4A 3SMSA 3W0LA 3VF6A 4KBOA 1VQON 1ZC6A 3ATUA 1S3XA 2A5XA 3VGKA 4B1WB 2Q2RA 3H46O 2P9IA 3R8EA 4BR4A 4WCEL 1KD1O 2IIRA 3TPQA 3NMUA 3D6RA 4FWNA 4BROA 3ENBA 3L4IA 4M7XA 3AGRA 1K9MO 3QFUA 1ZXOA 5AQMA 2P9IB 4CZFA 4B9QA 4IEEA 3TSUA 3ZETA 4H0PA 5C10A 5AQXA 2NRVA 5JICA 4FOEA 2NRRA 3D2FB 2AA4A 2QWMA 3L4QA 5FPMA 3TTCA 1K8KB 3LDPA 3C65A 3B8AX 2JWLA 2A3ZA 4WFNL 2E88A 2FSNA 3ENHA 5LJWA 2P9NB 3BF1A 2YJFA 4FWRA 3AARA 2YJEA 1X3NA 2VYPA 4IXCA 3UE5A 3VEVA 2HBMA 4JHDA 3AAQA 3CJ1A 3FGUA 5BRDA 5BPMA 4WFBL 2D0OA 3HZ6A 4BREA 3OBWA 4K43A 4YOYA 1RFQA 4BR7A 1YITN 2Q0UA 5AQSA 3CMAN 3CCUN 4GV9A 3VEOA 2NNWA 4FO0A 2ASPA 3J8AA 4IJNA 4AF1A 3HI0A 5AQPA 2E2NA 3CCEN 4CBWA 3C7NB 3VF4A 1SAZA 2BH1A 5EOYA 3VERA 4MDAA 4C1NK 3DXMA 3U9ZA 5AQUA 1TUYA 4MLEA 4JNEA 1BOTO 2QM1A 2P9PB 1SZ2A 4BRDA 4YOVA 3IMXA 4BG9A 1MWKA 3FZKA 4BEBA 3ID6A 4PKGA 3O5BA 3ULEA 1BG3A 1RDUA 3I56N 5C0YA 3JXUA 5M1NA 5GIOA 4ILHA 4ISGA 5AQOA 1HPMA 4EHTA 3QBXA 4BC5A 1ATSA 2NRZA 4HTLA 1QQMA 5GIPA 1GLJO 3I33A 1C0GA 1DKGD 2PAVA 3VESA 4XEIA 5KPZA 3QICA 4PL7A 1T3VA 1VQNN 4RTFD 5E26A 3IUCA 2AP1A 1KAXA 3BEXA 5AZIB 4IDHA 2PBDA 1Q81O 1D4XA 1NGDA 4MLHA 4K42A 2HBJA 3RSEB 4FWQA 2A41A 2E1ZA 2P9KA 4YDUA 1KQSM 1VQ7N 5C2FA 2OANA 3O1WA 2I7NA 2JWKA 4JKBA 4M63C 2HF4A 4B1VA 5GADP 3GL1A 3CCQN 4CJ7A 5AQJA 3PLAA 3DLLL 2CGLA 2NRWA 1WUAA 3CPEA 3OW2M 4WQ4C 2NRXA 4WQ5C 3O8MA 3VEYA 3EE8A 5BRFA 5BR9A 4BR0A 3NVKA 4AM7A 2P9SB 3Q7CA 5EY4A 3I8BA 2DPNA 4KH4A 2IVOA 2VCPA 3E9PA 2E1YA 3CXCM 2GX9A 3A0IX 4FSVA 4MO4A 1YAGA 5M1KA 4IOXA 5AQNA 1JJ2M 4A57A 1QQOA 4DHYA 1QZ5A 3QBWA 4YOTA 2NRTA 1YVNA 2QWOA 3CQYA 4MO5A 4H0VB 4A2BA 2E2OA 4GNIA 4BR5A 3MDQA 2IVPA 4IZ9A 4F9OA 4FWOA 3H3OB 3SBTA 1HKGA 4QS8A 1E4GT 1NBWA 2W00A 3WXIA 3SAHA 4JK7A 1YIJN 1YJNN 2OTLN 2UYTA 2QWLA 4OPHA 5GINA 3GBTA 5DM7L 2GWKA 4ILJA 2D1KA 4IO8A 1NM1A 3SMPA 1NGCA 3EO3A 5JLHA 2ASMA 3ZYYX 1QZ6A 3IFRA 5CHIA 1MA9B 3MN7A 2C1GA 4J8FA 3CCJN 4BRGA 4JKHA 3RVCA 2ZWHA 4BRAA 3C7NA 3FZHA 3WQTA 3A5MC 3MN9A 3CC7N 3VF2A 3UKRB 3CETA 1YXQA 4O8UA 4XH1A 4CZMA 3KWGA 4B1UB 3WUHA 1KC8O 3CMEN 3O9TA 1EO1A 1Z6RA 1ATNA 1T44A 2YX6A 1GLEG 1JCGA 4C1NI 2P9LA 3CI5A 4BRQA 3E9LA 4FWKA 2FLOA 3KK7A 3F9MA 4HWIA 4B1ZA 1NGIA 2Q1NA 3HRGA 1LOTB 3HM8A 2GWJA 5ELZA 1NGEA 4ISEA 5HOOA 3CJ7A 1YJWN 3R6MA 3TSPA 4AM6A 4BECA 3WXJA 2ZJQL 3G6EN 4PKIA 3UB5A 3QMLA 1MWMA 3A5OC 3O9SA 4PL8A 5AQRA 3O9QA 1H1VA 2ITMA 4JEPA 5BRHA 5E84A 1W97L 3MK6A 5M1PA 1NWKA 2CGKA 5GAGP 3A5LC 3H3NO 1BDGA 4WF9L 3E1YA 3D2EB 1K73O 2QWRA 3LDOA 4UY8O 5AQGA 1TUUA 4YOXA 4BRLA 1JCFA 5M1QA 4FPAA 4DQ8A 1K8KA 3N4PA 2GUPA 2HF3A 2FXUA 3J7ZO 2OTJN 4XJXA 2QXLA 4B1XB 5JLFA 5AFUH 1VQ4N 3KHYA 3VPZA 5JVHL 2WUSA 3NVMA 3P38A 2ASOA 5AQQA 1Q86O 2ZGZA 4JAXA 3ZETB 2ZGYA 1DT9A 1K8AO 1BA0A 1G99A 4L3QA 3T69A 3VGLA 3VTIA 3H45C 2A6AA 4XH4A 4Z94A 3BUZB 3N4QA 4CZIA 1ILYA 3LDLA 1BA1A 3MN6A 2HBKA 3K9JA 3IDHA 3ZX0A 4BC4A 4H5VA 3TTFA 4B1YB 4I6MA 5AQHA 4BC3A 5BPLA 5AQYA 5KQDA 1QVGM 4GV6A 5I9EB 3SBGA 5GAHP 3VEZA 2RHKA 2CH5A 1RGIA 4R79A 4IO9L 3F2KA 3QDKA 4WYBA 3DXKA 3DXKB 1KAZA 4BR9A 5AZJB 5AZJA 4O5FA 4EFHA 3MX2A 4CBXA 1VQKN 5HL7L 1T6CA 1R59O 3CJ9A 3MX5A 5CR4A 4A59A 5C15A 3EKSA 3VOVA 2RE2A 3EZWA 1QHAA 3MN5A 4JD2B 2Q31A 4G9ZA 4CD3A 3I55N 1U2VA 1TYQA 2FSKA 3LDQA 1BUPA 4BG8A 2QWPA 2HOEA 3ZX2A 4BRPA 2C1IA 3OBYA 1OKJA 4JKDA 4YDUC 2CH6A 2GELA 5BN9A 4H5NA 1GLBG 3TSQA 5GAEP 3R1XA 5KQ8A 3S41A 4CD1A 5ADXH 1RDWX 1Z05A 2NRHA 3H1QA 3MMVA 4JK8A 4BRCA 1YI2N 3CC2N 2QEXN 4PKHA 2HMPA 3RSEA 2P9KB 2P9UB 3BF3A 4H0YB 3D7EO 1DGKN 3WXMB 5EXWA 5AR0A 2GEMA 4A61A 1GLDG 5AQZA 2KHOA 5AQTA 2YI1A 1T6DA 3Q7BA 4QS7A 4CZGA 4CZJA 2Q97A 1VQPN 2ZJPL 2P9LB 3GE1A 4JHDB 5F1XA 1NGFA 3U8XA 2GTDA 4GY2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W41 A;  4DCH A;  4BGA A;  3GG4 A;  4BRF A;  4QS9 A;  5BN8 A;  4BVO A;  1U6Z A;  3SK3 A;  3VEX A;  2E20 A;  2P9P A;  3GOI A;  2A40 A;  4H0O A;  1WOQ A;  4ISF A;  5BRE A;  4BRM A;  1XQS C;  2QWQ A;  1EQY A;  1MDU B;  3DXM B;  5EVZ A;  3DWL A;  3UKR A;  2W40 A;  1NMD A;  4XH5 A;  2E8A A;  2YHX A;  1HUX A;  4A2A A;  2FF3 B;  4O8K A;  3WQU A;  5BPN A;  1Q18 A;  3EN9 A;  1NLV A;  1TYQ B;  4BRN A;  3VEN A;  3UKU B;  4CZL A;  3U4L A;  1ATR A;  1KAY A;  3WEE A;  5AQI A;  2D4W A;  3FZF A;  3A8Y A;  4BQL A;  3CER A;  3ATV A;  2P9N A;  2ZF5 O;  5FPD A;  5FPN A;  3CJA A;  1HKB A;  3O08 A;  1GLC G;  3OHR A;  3P4I A;  4CZH A;  3ENO A;  4LC9 B;  2A42 A;  2FF6 A;  4BRI A;  3VEW A;  5LY3 A;  1JCE A;  3ID8 A;  3ZX3 A;  4FWS A;  4H0T B;  1ESV A;  3G25 A;  3DAW A;  4EIA A;  3LDN A;  2NLX A;  3CJB A;  4K25 A;  3ZEU B;  4IWV A;  4FWM A;  3CQX A;  3C0B A;  3SLC A;  4H5R A;  2IVN A;  3HTV A;  2YHW A;  1U2V B;  4BRH A;  2V7Y A;  1V4S A;  1NGH A;  4JD2 A;  2P9S A;  1HKC A;  1QQN A;  2FSJ A;  4EHU A;  3VET A;  3WXK A;  1X9J A;  5AQK A;  3EL2 A;  1SQK A;  3L6Q A;  4BR2 A;  3H6E A;  3WT0 A;  5AQV A;  2E2Q A;  3VGM A;  3O6W A;  4RCH A;  1HLU A;  4NO7 A;  3R9P A;  4I6M B;  5F2R A;  5F0X A;  4H03 B;  5AQL A;  2BUP A;  2F9W A;  5EX5 A;  5AZI A;  2V51 B;  3AY9 A;  4IJA A;  4H5T A;  5KPT A;  4WQ5 A;  4WQ4 A;  1ZBS A;  2I7P A;  3JS6 A;  3WEE B;  4A62 A;  2Q36 A;  1P8Z A;  2V7Z A;  4FOI A;  2NZT A;  1BO5 O;  3O4W A;  4FWP A;  3ULE B;  5AFU A;  3FE1 A;  3O1B A;  4BC2 A;  3BP8 A;  3A5N C;  3KVG A;  4JN4 A;  3HBT A;  4H0X B;  4BGB A;  3ZEU A;  3M3Z A;  1GLF O;  4CBU A;  1YUW A;  1E4F T;  1NGB A;  2CGJ A;  1C0F A;  2YCH A;  3KZB A;  2YHY A;  5B8H A;  3H1V X;  5TKY A;  3GDQ A;  5AQF A;  1GLA G;  3LM9 A;  2P9U A;  1X3M A;  3D2E A;  1NGA A;  1XUP O;  2J4R A;  3TU5 A;  4BVP A;  3SJH A;  3UKU A;  3U9D A;  1CZA N;  3M6G A;  2V52 B;  4CI6 A;  3AAP A;  4BQZ A;  4CZK A;  1GLL O;  3W3D A;  2EWS A;  1Y64 A;  1J6Z A;  3D2F A;  2QWN A;  3EKU A;  4FPB A;  4DB3 A;  1IJJ A;  3L0Q A;  2D0P A;  3CHW A;  3LL3 A;  4E1J A;  4H5W A;  3FZM A;  3HSC A;  3DJC A;  1KXP A;  3FZL A;  5FPE A;  4Y0W A;  3M1F A;  2VWB A;  5KPR A;  3FFK B;  5LJV A;  1DEJ A;  5CE3 A;  3CJC A;  2E2P A;  4RWT A;  3FR0 A;  3FLC O;  3WXL A;  4FWL A;  4FL9 A;  4BRK A;  1XC3 A;  3LM2 A;  5ADX A;  1HX1 A;  4CZE A;  5AQW A;  1HJO A;  1LCU A;  3CIP A;  1IG8 A;  3QB0 A;  3O80 A;  2F9T A;  1V4T A;  3QFP A;  1BU6 O;  2H3G X;  1NGJ A;  1S22 A;  4EAH D;  2QW9 A;  2Q0R A;  4K41 A;  1NGG A;  3MCP A;  4C23 A;  4M7Y A;  1BWF O;  2BTF A;  5JMV A;  4NB4 A;  3SMS A;  3W0L A;  3VF6 A;  4KBO A;  1ZC6 A;  3ATU A;  1S3X A;  2A5X A;  3VGK A;  4B1W B;  2Q2R A;  3H46 O;  2P9I A;  3R8E A;  4BR4 A;  2IIR A;  3TPQ A;  4FWN A;  4BRO A;  3L4I A;  4M7X A;  3QFU A;  1ZXO A;  5AQM A;  2P9I B;  4CZF A;  4B9Q A;  3ZET A;  4H0P A;  5AQX A;  5JIC A;  4FOE A;  3D2F B;  2AA4 A;  2QWM A;  5FPM A;  1K8K B;  3LDP A;  3B8A X;  2A3Z A;  2E88 A;  2FSN A;  3ENH A;  5LJW A;  2P9N B;  3BF1 A;  2YJF A;  4FWR A;  3AAR A;  2YJE A;  1X3N A;  2VYP A;  4IXC A;  3UE5 A;  3VEV A;  4JHD A;  3AAQ A;  3CJ1 A;  3FGU A;  5BRD A;  5BPM A;  2D0O A;  4BRE A;  4K43 A;  1RFQ A;  4BR7 A;  2Q0U A;  5AQS A;  3VEO A;  4FO0 A;  2ASP A;  3J8A A;  4IJN A;  3HI0 A;  5AQP A;  2E2N A;  4CBW A;  3C7N B;  3VF4 A;  1SAZ A;  5EOY A;  3VER A;  3DXM A;  3U9Z A;  5AQU A;  1TUY A;  4MLE A;  4JNE A;  1BOT O;  2QM1 A;  2P9P B;  1SZ2 A;  4BRD A;  3IMX A;  4BG9 A;  1MWK A;  3FZK A;  4PKG A;  3O5B A;  3ULE A;  1BG3 A;  3JXU A;  4ISG A;  5AQO A;  1HPM A;  4EHT A;  3QBX A;  4BC5 A;  1ATS A;  4HTL A;  1QQM A;  1GLJ O;  3I33 A;  1C0G A;  1DKG D;  2PAV A;  3VES A;  4XEI A;  5KPZ A;  3QIC A;  4PL7 A;  4RTF D;  5E26 A;  3IUC A;  2AP1 A;  1KAX A;  3BEX A;  5AZI B;  2PBD A;  1D4X A;  1NGD A;  4MLH A;  4K42 A;  3RSE B;  4FWQ A;  2A41 A;  2E1Z A;  2P9K A;  4YDU A;  2OAN A;  3O1W A;  2I7N A;  4M63 C;  2HF4 A;  4B1V A;  3GL1 A;  4CJ7 A;  5AQJ A;  2CGL A;  1WUA A;  4WQ4 C;  4WQ5 C;  3O8M A;  3VEY A;  5BRF A;  5BR9 A;  4BR0 A;  4AM7 A;  2P9S B;  5EY4 A;  3I8B A;  2DPN A;  2IVO A;  2VCP A;  2E1Y A;  3A0I X;  4FSV A;  4MO4 A;  1YAG A;  5AQN A;  1QQO A;  4DHY A;  1QZ5 A;  3QBW A;  1YVN A;  2QWO A;  3CQY A;  4MO5 A;  4H0V B;  4A2B A;  2E2O A;  4GNI A;  4BR5 A;  3MDQ A;  2IVP A;  4IZ9 A;  4F9O A;  4FWO A;  3H3O B;  1HKG A;  4QS8 A;  1E4G T;  1NBW A;  3WXI A;  2UYT A;  2QWL A;  3GBT A;  2GWK A;  2D1K A;  4IO8 A;  1NM1 A;  3SMP A;  1NGC A;  3EO3 A;  5JLH A;  2ASM A;  1QZ6 A;  3IFR A;  1MA9 B;  3MN7 A;  4J8F A;  4BRG A;  2ZWH A;  4BRA A;  3C7N A;  3FZH A;  3WQT A;  3A5M C;  3MN9 A;  3VF2 A;  3UKR B;  3CET A;  1YXQ A;  4XH1 A;  4CZM A;  4B1U B;  3WUH A;  1Z6R A;  1ATN A;  1T44 A;  1GLE G;  1JCG A;  2P9L A;  3CI5 A;  4BRQ A;  4FWK A;  2FLO A;  4HWI A;  3F9M A;  4B1Z A;  1NGI A;  2Q1N A;  1LOT B;  3HM8 A;  2GWJ A;  5ELZ A;  1NGE A;  4ISE A;  3CJ7 A;  3R6M A;  4AM6 A;  3WXJ A;  4PKI A;  3UB5 A;  3QML A;  1MWM A;  3A5O C;  5AQR A;  4PL8 A;  2ITM A;  1H1V A;  5BRH A;  5E84 A;  3MK6 A;  1NWK A;  2CGK A;  3A5L C;  3H3N O;  1BDG A;  3D2E B;  2QWR A;  3LDO A;  5AQG A;  1TUU A;  4BRL A;  1JCF A;  4FPA A;  4DQ8 A;  1K8K A;  2GUP A;  2HF3 A;  2FXU A;  2QXL A;  4B1X B;  5JLF A;  5AFU H;  3KHY A;  3VPZ A;  2WUS A;  5AQQ A;  2ASO A;  2ZGZ A;  4JAX A;  3ZET B;  2ZGY A;  1BA0 A;  1G99 A;  4L3Q A;  3VGL A;  4Z94 A;  3H45 C;  2A6A A;  4XH4 A;  3BUZ B;  4CZI A;  3LDL A;  1BA1 A;  3MN6 A;  3IDH A;  3ZX0 A;  4BC4 A;  4H5V A;  4B1Y B;  4BC3 A;  4I6M A;  5AQH A;  5KQD A;  5BPL A;  5AQY A;  5I9E B;  3VEZ A;  2CH5 A;  1RGI A;  3QDK A;  4WYB A;  3DXK A;  3DXK B;  1KAZ A;  4BR9 A;  5AZJ B;  5AZJ A;  4O5F A;  4EFH A;  4CBX A;  1T6C A;  1R59 O;  3CJ9 A;  3EKS A;  3VOV A;  3EZW A;  1QHA A;  3MN5 A;  4JD2 B;  2Q31 A;  4CD3 A;  1U2V A;  1TYQ A;  2FSK A;  3LDQ A;  1BUP A;  4BG8 A;  2QWP A;  2HOE A;  3ZX2 A;  4BRP A;  1OKJ A;  4YDU C;  2CH6 A;  2GEL A;  5BN9 A;  4H5N A;  1GLB G;  5KQ8 A;  3S41 A;  4CD1 A;  5ADX H;  1RDW X;  1Z05 A;  2NRH A;  3H1Q A;  3MMV A;  4BRC A;  4PKH A;  2HMP A;  3RSE A;  2P9K B;  2P9U B;  3BF3 A;  4H0Y B;  3D7E O;  1DGK N;  5EXW A;  5AR0 A;  2GEM A;  4A61 A;  1GLD G;  5AQZ A;  2KHO A;  5AQT A;  2YI1 A;  1T6D A;  4QS7 A;  4CZG A;  4CZJ A;  2Q97 A;  2GTD A;  2P9L B;  3GE1 A;  4JHD B;  5F1X A;  1NGF A;  3U8X A;  3HZ6 A;  4GY2 B; 
#chains in the Genus database with same CATH topology
 4BGA A;  4BRF A;  2E20 A;  4F4K A;  1GOA A;  3THX A;  4CW7 B;  1BIS A;  1I3A A;  2F8T A;  3ZT4 A;  1EQY A;  1MDU B;  5EVZ A;  3QLH A;  2W40 A;  4KAZ A;  3DLG A;  3NAE A;  2PY5 A;  2E8A A;  2FBV A;  2YHX A;  1JLA A;  3WQU A;  3CM5 A;  1BCO A;  3SI6 A;  4CGF A;  3U3G A;  4KH6 A;  4CZL A;  3WEE A;  4BQL A;  3CER A;  3ATV A;  5C2D A;  3CCM N;  1CLQ A;  5DM6 L;  5FPN A;  1VQ6 N;  1HKB A;  3CCR N;  2B5J A;  4FZY A;  1GLC G;  4CZH A;  3MWP A;  4YY3 K;  2O4G A;  4H0T B;  3K0S A;  1S1U A;  2E6M A;  2OPP A;  4KB1 A;  1HNI A;  2QTD A;  3DLH A;  2R7Y A;  2P1J A;  4NLB A;  4CF8 A;  3CC4 N;  3SLC A;  3K5L A;  3MEE A;  1B9F A;  2GBZ A;  3R3L A;  4YOW A;  3HTV A;  1U2V B;  4I2P A;  2V7Y A;  2XHB A;  3MCA B;  4LH5 A;  5AQK A;  3EL2 A;  4W5T A;  3VQA A;  2E2Q A;  1FKO A;  1NG9 A;  3SQ0 A;  3O9U A;  2KZZ A;  5A2Q O;  3R9P A;  3RMB A;  2F7T A;  4Q0B A;  3AVG A;  1VRT A;  2VGN A;  4IFY A;  3S3O A;  3AO3 A;  3KLI A;  1O13 A;  5EX5 A;  1JLF A;  5AZI A;  3T1H K;  1XNR K;  3AY9 A;  4WQ5 A;  4Q5V A;  5HRR A;  4CJ5 A;  2E5L K;  3HM9 A;  4J2B A;  3AVJ A;  3TAM A;  4JKC A;  2Q36 A;  3G0Z A;  1TK8 A;  3K2P A;  1NKE A;  1BO5 O;  3O4W A;  4HVJ A;  4BC2 A;  1C0M A;  3L3U A;  4JRP A;  1YT3 A;  3HBT A;  4H0X B;  4BGB A;  4IBN A;  3M3Z A;  4CBU A;  1YUW A;  4I9L A;  4IOC L;  2CGJ A;  3C6H A;  3LAL A;  4CK1 A;  2YCH A;  5B8H A;  2F96 A;  1SKS A;  4RG8 A;  4FYD A;  1L3S A;  3SAG A;  4FW2 A;  3IKM A;  3LWM A;  3SZ2 A;  4DF4 A;  2OZS A;  4I7F A;  3ZSV A;  3KWI A;  1Z25 A;  2UUC K;  3M8S A;  2WFB A;  3M6G A;  2DFF A;  5C25 A;  1IKW A;  4IOA L;  2WTU A;  3K5M A;  1VK0 A;  1GLL O;  4DSE A;  4FK2 A;  4DTP A;  3C6T A;  1TKZ A;  1J53 A;  1VRU A;  2WBN A;  1D9D A;  3TWH A;  1QVF M;  1QS4 A;  3LWL A;  4FCY A;  3EEQ A;  4Z4E A;  4EP5 A;  3HSC A;  4KB0 A;  1N6Q A;  1WNS A;  1VSL A;  5I42 A;  2B6A A;  4CHP A;  3PIO L;  2VWB A;  3FFK B;  1VSJ A;  3WXL A;  2QKK A;  4FL9 A;  3DOK A;  1XC3 A;  4F3T A;  1RDA A;  3QB0 A;  3O80 A;  4KHU A;  4CE9 A;  1OH6 A;  2QW9 A;  2Q0R A;  2ZJR L;  3MCP A;  4E7J A;  2BTF A;  4KBO A;  3NH1 A;  2BAN A;  1VQO N;  1S3X A;  3VGK A;  4AHT A;  4IDK A;  3H46 O;  1VHX A;  3L2V A;  5IWA K;  3R8E A;  3NMU A;  3OYE A;  5AQM A;  2BDP A;  5C10 A;  1TKT A;  2NRR A;  4CHO A;  4AHR A;  3OYH A;  4I2Q A;  3VQB A;  4CEB A;  3TAB A;  1D9F A;  4OPJ A;  4TSX A;  1QSL A;  4WFN L;  2E88 A;  3BF1 A;  3UE5 A;  4DSL A;  4JHD A;  3AAQ A;  2D0O A;  1A5V A;  1LWC A;  3T19 A;  4K43 A;  4BR7 A;  3CCU N;  3LP3 A;  4FO0 A;  3B6P A;  2E2N A;  4DV5 K;  3C7N B;  3KIO A;  4FJH A;  1SV5 A;  4LF9 K;  3DXM A;  3HT3 A;  1BOT O;  5KTQ A;  1SZ2 A;  5EU7 A;  4HHT A;  1QSY A;  3ULE A;  1BG3 A;  1RDU A;  3KK1 A;  3E01 A;  2VG5 A;  5M1N A;  3OYA A;  4KHP K;  4EHT A;  1ATS A;  2OZM A;  1X9S A;  4HTL A;  1GLJ O;  3LP0 A;  4XEI A;  4LF4 K;  3BEX A;  5AZI B;  2D0B A;  4W5R A;  2A41 A;  5C2F A;  4JKB A;  4EZ9 A;  4B1V A;  3CCQ N;  5AQJ A;  4WQ4 C;  5KI6 A;  2RF2 A;  3PX4 A;  3EE8 A;  4M3W A;  5BR9 A;  4BR0 A;  4BE1 A;  2P9S B;  1RTI A;  4NCA A;  4DTJ A;  3HJF A;  2VCP A;  1EET A;  4OKK A;  3HVR A;  3MAQ A;  4DV1 K;  3CXC M;  1TL3 A;  4H8K A;  4DHY A;  1ZBL A;  3O4N A;  3ZLJ A;  1WSF A;  4B9V A;  2NRT A;  3AVH A;  2QWO A;  4BR5 A;  2E2O A;  1KLM A;  3QEW A;  2OA8 A;  4FWO A;  3SQ1 A;  1HKG A;  2W00 A;  4FLY A;  3QEX A;  1A5W A;  3SAH A;  4JK7 A;  3ULD A;  2GWK A;  1RT1 A;  2D1K A;  4IO8 A;  1NM1 A;  3DYA A;  3SMP A;  3QEI A;  5CHI A;  4OGC A;  4PY5 A;  1QZ6 A;  4J8F A;  4BRG A;  3AO1 A;  1IBK K;  4E3S A;  1X9M A;  3PUF A;  3C7N A;  1X1P A;  3A5M C;  4NXM K;  3CET A;  1NK6 A;  4FJ8 A;  1EO1 A;  2KTQ A;  1ATN A;  2YX6 A;  1GLE G;  4C1N I;  4BRQ A;  1NK9 A;  1QSS A;  5FRO A;  1QTM A;  1LOT B;  3PSI A;  1NGE A;  1YJW N;  3R6M A;  4AM6 A;  4BEC A;  3QO9 A;  3WXJ A;  2RKI A;  4PL8 A;  1H1V A;  4UQG A;  5M1P A;  4B9U A;  5GAG P;  3MXJ A;  1BDG A;  3MEG A;  1N32 K;  1LWE A;  1E3M A;  2QWR A;  4E7K A;  3LZJ A;  4YOX A;  1JCF A;  4B9N A;  2GUP A;  3QNN A;  3J7Z O;  1NK4 A;  1T03 A;  4XJX A;  3EY1 A;  5AFU H;  3KHY A;  5JVH L;  5AJ3 K;  2WUS A;  3NVM A;  3P38 A;  2ASO A;  1Q86 O;  2ETJ A;  2HW3 A;  1DT9 A;  4L3Q A;  3VGL A;  2PZS A;  4XH4 A;  3BUZ B;  5FLX O;  2OPR A;  4N5S A;  2XRI A;  4YHH K;  4BC4 A;  3ZX0 A;  3IDH A;  4B1Y B;  2HB5 A;  3IG1 A;  4I6M A;  5AQH A;  2B4J A;  5AQY A;  3RR7 A;  3KD1 E;  3VEZ A;  4IO9 L;  3F2K A;  3QDK A;  3NGY A;  4BR9 A;  3THY B;  1IO2 A;  4EFH A;  4CBX A;  1QE1 A;  3CJ9 A;  3NE6 A;  2G8K A;  4DV4 K;  4A59 A;  1FW6 A;  3EKS A;  3O3F A;  4FJ5 A;  4G9Z A;  4CJE A;  1QHA A;  2Q31 A;  4CD3 A;  1U2V A;  3KTQ A;  3SNN A;  3J7A P;  1TL1 A;  1BL3 A;  4M3Y A;  4JKD A;  2FBX A;  1XNQ K;  3TSQ A;  3VQE A;  1WSI A;  5HP1 A;  2NRH A;  3H1Q A;  4PQU A;  2QEX N;  2HMP A;  4H0Y B;  3LDS A;  3WXM B;  5EXW A;  4CJR A;  1REV A;  2AJQ A;  4DQP A;  5AQZ A;  1BQM A;  5AQT A;  3SUP A;  4QS7 A;  5J2Q A;  4CZG A;  2FC0 A;  4CZJ A;  2ZE2 A;  2P9L B;  5DMR A;  4JHD B;  1NGF A;  1DLO A;  1W2B M;  1KLN A;  3AV9 A;  3GG4 A;  1VQL N;  3QER A;  5BN8 A;  1U6Z A;  3VEX A;  2P9P A;  3AO2 A;  3GOI A;  4IG0 A;  3ZSQ A;  2A40 A;  5LMU K;  4ISF A;  1NK0 A;  4FJ9 A;  4N56 A;  1YTA A;  5C42 A;  1S72 N;  1TKX A;  2QWQ A;  1M90 O;  3DXM B;  3SAF A;  1VQ9 N;  2Z1J A;  5SZT A;  4NCB A;  1NMD A;  1U47 A;  1HUX A;  2FF3 B;  4O8K A;  1Q18 A;  3EN9 A;  4FLT A;  1J54 A;  1TYQ B;  3HYF A;  4BRN A;  4IKF A;  3K9K A;  3UKU B;  4FM1 A;  3PO4 A;  1ATR A;  3VQD A;  1KCF A;  2KLA A;  2P9N A;  2XY5 A;  1BGX T;  2Y1I A;  3CJA A;  2P5G A;  3RMA A;  1JXB A;  3P4I A;  4LC9 B;  1G15 A;  4AHC A;  4BRI A;  3OYB A;  2Y1J A;  3CCV N;  3V9U A;  2HNZ A;  1GOC A;  3LDN A;  2NLX A;  4M3U A;  2PFU A;  2GUI A;  2ZQB A;  4FWM A;  2UUA K;  1Q82 O;  3ZSO A;  4PHT X;  1CXQ A;  2KQ2 A;  2KFZ A;  1EXQ A;  2P9S A;  3J7Y P;  2X6S A;  4EHU A;  3WXK A;  2P51 A;  1YJ9 N;  4CIF A;  4RW7 A;  3WT0 A;  4FZX C;  2GV9 A;  4NO7 A;  5H1S Q;  2YNH A;  4DR4 K;  4CEA A;  3CF5 L;  3OYJ A;  3KK3 A;  3AVB A;  5F0X A;  3IRX A;  2KKZ A;  3ISN C;  1Y97 A;  1RCH A;  2V51 B;  3LP1 A;  4IJA A;  2JGU A;  2HND A;  1KVB A;  3WEE B;  4DTR A;  3HXM A;  2V7Z A;  4FOI A;  3ALY A;  4KHY A;  4GMJ B;  2YV0 X;  1HNZ K;  3ZT0 A;  3A5N C;  1Q9Y A;  3KVG A;  4N47 A;  4FZZ A;  3HO1 A;  4JN4 A;  4DSK A;  1SS6 A;  4CEE A;  1GLF O;  1XMQ K;  1NGB A;  3DLE A;  1C0F A;  2YHY A;  4JKG A;  4OKE A;  4KFB A;  3OA9 A;  3DRR A;  3ZSR A;  4KTQ A;  5AQF A;  3CD6 N;  3KK2 A;  3LM9 A;  1SL0 A;  4YFU A;  1NGA A;  1C1A A;  3TU5 A;  1S9G A;  4F3O A;  4M41 A;  2OCE A;  3TI0 A;  4ELU A;  3WNG A;  2WC9 A;  3OYG A;  4DU4 A;  3AAP A;  3QES A;  4O4G A;  4CZK A;  1J5O A;  3ZT2 A;  1Y64 A;  1J6Z A;  3A2F A;  3D2F A;  2QWN A;  2E4L A;  1VSI A;  3EKU A;  5JS2 A;  4FJJ A;  4FPB A;  2YNF A;  4R5P A;  4DB3 A;  1IJJ A;  1ZBI A;  3LL3 A;  4DUZ K;  1EWQ A;  3DJC A;  1LW0 A;  4DFM A;  5KPR A;  1RBR A;  4RWT A;  3FLC O;  4FWL A;  3RR8 A;  3LM2 A;  4CJU A;  4GVE A;  1HX1 A;  5AQW A;  1S6Q A;  2IAJ A;  1HJO A;  1JL1 A;  3OYI A;  4FJ7 A;  3VQ7 A;  4M45 A;  1KFS A;  3MXM A;  1V4T A;  1BU6 O;  1NGJ A;  2OPQ A;  4K41 A;  1NJI O;  3CPW M;  5MLC Q;  4DF8 A;  4C23 A;  1BWF O;  5JMV A;  2DTU A;  1ZC6 A;  2Q2R A;  2VWJ A;  1RNH A;  1A5X A;  3TPQ A;  3D6R A;  4FWN A;  4BRO A;  3ZT3 A;  3L4I A;  4M7X A;  1DTQ A;  5HRS A;  3L3V A;  4CZF A;  4IEE A;  3ZET A;  4H0P A;  3NGI A;  5JIC A;  2NRV A;  4DSF A;  4CEQ A;  4CIG A;  4CED A;  3C6U A;  4O0I A;  3BGR A;  3B8A X;  3AO4 A;  2A3Z A;  4W5O A;  2FSN A;  1NKB A;  3V9Z A;  2P9N B;  4FWR A;  3VEV A;  3EZ5 A;  4E7H A;  4DR6 K;  3FGU A;  5BPM A;  4BRE A;  4YOY A;  3JYT A;  4FLU A;  1U49 A;  5AQS A;  3ZSW A;  4KV8 A;  3U6F A;  4DU1 A;  4O0J A;  3D45 A;  4FJL A;  4CCH A;  4CF1 A;  4FXD A;  1JLG A;  4MDA A;  3U9Z A;  3I8D A;  4DQI A;  2QM1 A;  3M8P A;  3VN5 A;  3KKR A;  1U4B A;  1MWK A;  4NXN K;  3O5B A;  3I56 N;  3JXU A;  4B3M K;  4ISG A;  4JI7 K;  1HPM A;  3O3G A;  4BC5 A;  3RMC A;  5GIP A;  1S9E A;  4CJS A;  3I33 A;  5DK5 A;  5KPZ A;  4KRE A;  4PL7 A;  1VQN N;  3TAR A;  4G1Q A;  4RTF D;  4OX9 K;  2AP1 A;  4IDH A;  2PBD A;  4LY7 A;  4CJF A;  1EP4 A;  1VQ7 N;  4X64 K;  1L3U A;  3O1W A;  4CJL A;  3J80 O;  2HHH K;  1JL2 A;  5GAD P;  1KTQ A;  4WE1 A;  4CJ7 A;  1L3T A;  3AVC A;  2CGL A;  2NRW A;  2NRX A;  3ITH A;  4HUE A;  4AM7 A;  1I94 K;  4NCG A;  2G8V A;  2QK9 A;  3TAN A;  3E9P A;  3LAN A;  3AVF A;  3A0I X;  3NH0 A;  4MO4 A;  1YAG A;  5J2N A;  4IOX A;  4FJN A;  1NOZ A;  1HRH A;  1QQO A;  3QBW A;  1SKW A;  2DFH A;  4H0V B;  3DLR A;  3TAQ A;  3MDQ A;  3PV8 A;  5CZ1 A;  4OLA A;  4IZ9 A;  4F9O A;  2YNG A;  3LP2 A;  3SBT A;  1N36 K;  1E4G T;  3T3F A;  1IKX A;  3WXI A;  2ATQ A;  3QEP A;  3GBT A;  4JI6 K;  4AH9 A;  5DM7 L;  3OYC A;  1NGC A;  4FJK A;  3EO3 A;  3TAE A;  3MN7 A;  4CJQ A;  2C1G A;  2E6L A;  4ZHR A;  5HBM A;  3L8B A;  4JKH A;  1TKD A;  2KW4 A;  4M3T A;  4OVL A;  4DR7 K;  1C1B A;  3SQ4 A;  3SV4 A;  3FZH A;  2IS3 A;  3WQT A;  3VF2 A;  1S1W A;  4CZM A;  2RN2 A;  3KWG A;  3WUH A;  3CME N;  1TK5 A;  1Z6R A;  1JCG A;  2HMI A;  1BI4 B;  3E9L A;  1X9W A;  2FLO A;  3KK7 A;  4HWI A;  3M8R A;  2GWJ A;  1IKV A;  3K5O A;  2HHU A;  4JI3 K;  1HYS A;  1Z26 A;  4PKI A;  3C94 A;  1RT4 A;  3A5O C;  3O9S A;  5AQR A;  2ITM A;  4JEP A;  5E84 A;  2YKN A;  1SL1 A;  4KO0 A;  1NWK A;  3ZSX A;  1IG9 A;  3LDO A;  4UY8 O;  4DQ8 A;  1K8K A;  1EKE A;  3CFO A;  3OTO K;  2QXF A;  4FVM A;  2OTJ N;  4B1X B;  3QET A;  2HHI A;  5AQQ A;  3ZET B;  4FLX A;  4JI2 K;  4LSN A;  3T69 A;  1G99 A;  4BDZ A;  3VTI A;  4CK2 A;  3H45 C;  4Z94 A;  4DFP A;  1ZBH A;  1EWR A;  3N4Q A;  1BA1 A;  4AHS A;  1QQC A;  3MN6 A;  5CYM A;  2HBK A;  4LFA K;  3TTF A;  1ZBU A;  4DR1 K;  4KI4 A;  2RHK A;  4R79 A;  4HTU A;  1KAZ A;  4O5F A;  3MX2 A;  5HL7 L;  3MX5 A;  1TVR A;  3P5J A;  4CJ3 A;  5C15 A;  1YTU A;  4JD2 B;  4E7L A;  3I55 N;  3VQ4 A;  3EYZ A;  1HNV A;  2HOE A;  3ZX2 A;  4BRP A;  3U3Y A;  2QKB A;  3CYM A;  4FJI A;  4PWD A;  2C1I A;  2GEL A;  5GAE P;  4B8C A;  4H4O A;  4N41 A;  4CD1 A;  3ZT1 A;  1RDW X;  4JK8 A;  1YI2 N;  3KD5 E;  4CES A;  4KRF A;  2F8S A;  4PKH A;  3OYM A;  1RBV A;  3RSE A;  2O8D A;  2P9K B;  2P9U B;  4B9T A;  4A61 A;  1XWL A;  1FJG K;  1LV5 A;  1S1V A;  1NJW A;  2W6K A;  5KRS A;  2Q97 A;  1W7A A;  2GTD A;  1FXX A;  4CIE A;  3U8X A;  2YHA A;  3V4I A;  2NUB A;  4QS9 A;  1TGO A;  4BVO A;  3BDP A;  4DKW A;  4AHV A;  3BZK A;  4JKG B;  4DTX A;  4KI6 A;  1WOQ A;  5BRE A;  1TAU A;  1XQS C;  4CJ4 A;  4DR3 K;  3DWL A;  3UKR A;  4CJT A;  2XY6 A;  4LF8 K;  4LFB K;  4JKE A;  1LAW A;  1R0A A;  4KTZ A;  4A2A A;  2VQE K;  4DTO A;  4DFK A;  1XC9 A;  4DV3 K;  2KZM A;  1NK5 A;  2BGG A;  4JK9 A;  3L2Q A;  1KAY A;  5AQI A;  3O3H A;  2G8U A;  3PSF A;  3A8Y A;  3M5R A;  1HNX K;  4M3X A;  3C95 A;  4B8A B;  5FDL A;  3QIN A;  3NF6 A;  3O08 A;  1T8E A;  4F8R A;  2O8D B;  4IFE A;  3OHR A;  4KTW A;  3ENO A;  3SYZ A;  2A42 A;  1RDD A;  5LY3 A;  1T7P A;  3NH2 A;  3ZX3 A;  1ESV A;  3SPZ A;  4YOR A;  3SJJ A;  4JI5 K;  3ZEU B;  3QNO A;  1JLC A;  4X65 K;  3OS1 A;  4FK4 A;  3C0B A;  3F9K A;  5CZ2 A;  5J1E A;  4H5R A;  1Q7Y O;  3K57 A;  4DV0 K;  1VSE A;  1TK0 A;  3OYD A;  1OH5 A;  2YHW A;  3VQ9 A;  1RTD A;  4DSJ A;  1V4S A;  4JD2 A;  4BWM A;  3IS9 A;  4M42 A;  1HNW K;  2ZD1 A;  4A5A A;  3VGM A;  1TV6 A;  3L2R A;  1ITG A;  4DLG A;  4MDB A;  4F2R A;  1UOC A;  4FJM A;  3CYG A;  3DRS A;  5F2R A;  4IFV A;  3AGK A;  1L5U A;  1YF5 L;  2O8C A;  4DV2 K;  4MQ3 A;  4ID1 A;  1P90 A;  1UA1 A;  5KPT A;  4RW4 A;  3AA5 X;  3NFA A;  2I7P A;  4CGD A;  2UXC K;  4U67 L;  4E0D A;  5FRN A;  4A62 A;  2QI2 A;  2NZT A;  5M1O A;  4FWP A;  5AFU A;  3SUN A;  1XMO K;  3FE1 A;  1UA0 A;  4K8Z A;  3O1B A;  2XO7 A;  4BE7 B;  2FBT A;  3T7Z A;  3RWU A;  1W9H A;  1IV0 A;  3HL8 A;  1SUQ A;  4DTU A;  1NJZ A;  3DLB A;  2HHX A;  2W42 A;  3VA3 A;  3THX B;  3V81 A;  1S1X A;  3OYL A;  1BIU A;  3OS0 A;  3HOS A;  3H1V X;  3MWT A;  4JV5 K;  4FM0 A;  3GDQ A;  3BZC A;  4CEO A;  2F4V K;  1VAZ A;  3D2E A;  2J4R A;  3AVA A;  4BVP A;  3SJH A;  4CJP A;  1CZA N;  1W0H A;  3OVN A;  4BWJ A;  4DTN A;  5KGX A;  2Q3S A;  2V52 B;  4CI6 A;  3QIO A;  4H4M A;  4CEC A;  1VSM A;  2D5R A;  3W3D A;  2EWS A;  3ZSZ A;  4CEZ A;  2QA4 N;  5KGW A;  1VQ8 N;  1VQ5 N;  3CHW A;  1C1C A;  4H5W A;  1N34 K;  4ELV A;  1KFD A;  1KXP A;  4Z4I A;  3C6A A;  4E1N A;  1WAJ A;  5LJV A;  2O8E A;  2E2P A;  3FR0 A;  4Y1D A;  4BRK A;  3LZI A;  4CZE A;  3VMF B;  1IG8 A;  4YOU A;  2OYQ A;  3DM2 A;  3OYK A;  1S22 A;  4EAH D;  4LF7 K;  3FFI A;  4M7Y A;  3E9O A;  4ELT A;  2EHG A;  4LF6 K;  1MU2 A;  3KKS A;  3V9S A;  2A5X A;  2HNY A;  4B1W B;  4ZTJ A;  1XHX A;  2P9I A;  4WCE L;  4BR4 A;  2IIR A;  4RW8 A;  3ENB A;  3NGZ A;  4CHN A;  3QFU A;  1ZXO A;  4KPY A;  4B9Q A;  4O5B A;  5AQX A;  4FK0 A;  3D2F B;  5J2M A;  2AA4 A;  3TTC A;  1K8K B;  4LFC K;  2HHS A;  4C8L A;  3THW A;  5LJW A;  3AAR A;  1X3N A;  2VYP A;  4IXC A;  4DLE A;  5BRD A;  4WFB L;  5IT9 O;  3OBW A;  1YIT N;  3CMA N;  1NJY A;  4GV9 A;  3VEO A;  3VQQ A;  3J8A A;  4AF1 A;  3HI0 A;  4K0K K;  4HCB A;  1NU0 A;  3VF4 A;  1SAZ A;  5EOY A;  3VER A;  4DFJ A;  1NKC A;  3S5T A;  1FKP A;  2A1R A;  5AQU A;  1TUY A;  4MLE A;  4JNE A;  2WON A;  4CVN E;  4ZTF A;  4E89 A;  2P9P B;  4OJR A;  4BRD A;  1IBL K;  3SUQ A;  3FZK A;  3JSM A;  4CFA A;  5C0Y A;  2YKM A;  3SCX A;  3V1R A;  3QBX A;  1XI1 A;  1QQM A;  2X74 A;  3NF7 A;  4C8K A;  4DQR A;  2W6L A;  1C0G A;  1DKG D;  2PAV A;  3THY A;  1LWF A;  3DLK A;  1TAQ A;  1T3V A;  5E26 A;  3IUC A;  1KAX A;  4CFC A;  3VQ5 A;  1NGD A;  4K42 A;  3RSE B;  1JLQ A;  2XY8 A;  2P9K A;  4YDU A;  1U04 A;  4M63 C;  2HF4 A;  4AQY K;  1KSP A;  3PLA A;  4BAC A;  3CPE A;  4QAG A;  3OW2 M;  4BDP A;  3WNF A;  4CGI A;  3Q7C A;  3SPY A;  5EY4 A;  3I8B A;  3QIP A;  5C24 A;  1WBB A;  4PA1 A;  2E1Y A;  3TAP A;  4FSV A;  3K59 A;  5M1K A;  5AQN A;  5HRO A;  4A57 A;  1QZ5 A;  1YVN A;  4B08 A;  4A2B A;  1RBS A;  3KLE A;  1RT2 A;  1OVQ A;  4O44 A;  4DTM A;  1YIJ N;  4EZ6 A;  2QWL A;  1D8Y A;  4ILJ A;  3MED A;  3PY8 A;  2ASM A;  1MA9 B;  3NBP A;  3CCJ N;  3RVC A;  3AVN A;  3B6O A;  2X6N A;  4CHZ A;  3MN9 A;  4JLH A;  5T7B A;  3K5N A;  2P5O A;  1YXQ A;  4O8U A;  4XH1 A;  4B1U B;  4FLW A;  3KJV A;  2P9L A;  3CI5 A;  1F21 A;  4FWK A;  3UIQ A;  3F9M A;  4B1Z A;  4FLZ A;  1NGI A;  2Q1N A;  3HRG A;  3I0S A;  4E19 A;  1HQE A;  4ISE A;  5HOO A;  4B3T K;  3TSP A;  2VG7 A;  2ZJQ L;  4LH4 A;  3O9Q A;  5BRH A;  4Z4H A;  4FJG A;  4W5N A;  3H3N O;  2G8W A;  4WF9 L;  3E1Y A;  3D2E B;  1RT5 A;  1K73 O;  1TUU A;  4BRL A;  4CK3 A;  4OPK A;  3OYF A;  2HF3 A;  1D5A A;  3K58 A;  4GKK K;  2ZGZ A;  4JAX A;  1VSD A;  2ZGY A;  1K8A O;  1BA0 A;  5SWM A;  1RTH A;  5LMN K;  2A6A A;  4JI1 K;  4MFB A;  2BE2 A;  4CZI A;  3HPO A;  3KLF A;  3K9J A;  4YNQ A;  4BC3 A;  3L2W A;  1QVG M;  2Z1G A;  5BPL A;  4GV6 A;  1J9A A;  4CFD A;  1RGI A;  5KRT A;  1VSH A;  4WYB A;  3DXK A;  3DXK B;  4JRQ A;  1HR0 K;  5AZJ B;  5AZJ A;  2IOC A;  4NYF A;  1GOB A;  3AA4 A;  3VOV A;  3MN5 A;  3LDQ A;  3CFP A;  1BUP A;  3J81 O;  3LAK A;  2QWP A;  3PX6 A;  4X62 K;  2HHV A;  1C0T A;  1KVA A;  1RTJ A;  1BHL A;  3OBY A;  3AVI A;  5BN9 A;  5KQ8 A;  4H5N A;  3R1X A;  1WAF A;  4J2E A;  3S41 A;  5ADX H;  3CQ8 A;  2D0A A;  1Q9X A;  2FBY A;  4LF5 K;  5HRP A;  4BRC A;  1WSH A;  4E7I A;  1DGK N;  5AR0 A;  4JS4 A;  2GEM A;  4I9Q A;  4J2A A;  1OH7 A;  1T6D A;  3DRP A;  1VQP N;  2ZJP L;  2G8F A;  1JLE A;  4JS5 A;  5F1X A;  3AVM A;  2UXD K;  3G4S N;  4V19 S;  3HVT A;  1VSK A;  4DQQ A;  2W41 A;  4DCH A;  2ITG A;  3SK3 A;  3VA0 A;  4Z4F A;  5C12 A;  3VQC A;  3KLH A;  4N76 A;  4H0O A;  4BRM A;  3NDK A;  1RT3 A;  4OPA A;  2HST A;  4CJV A;  2ZM6 K;  1B92 A;  4XH5 A;  3VQ8 A;  5BPN A;  4ICL A;  2YNI A;  1NLV A;  4XIU A;  2HHQ A;  3VEN A;  1JXE A;  4CGG A;  3O9R A;  3V9X A;  2YHB A;  3U4L A;  1RDB A;  2D4W A;  4AHU A;  3FZF A;  1JLB A;  2HBL A;  5JVG L;  2ZF5 O;  4HUF A;  5FPD A;  3IAY A;  3V1O A;  2FF6 A;  3VEW A;  1KRP A;  1JCE A;  3ID8 A;  3F5T A;  1RIL A;  4FWS A;  4DMN A;  4QOZ B;  3G25 A;  3DAW A;  4EIA A;  3CJB A;  4K25 A;  3EE9 A;  4IWV A;  3CFR A;  4CER A;  3CQX A;  5FRM A;  3P39 A;  4M3R A;  1RDC A;  2LSN A;  2IVN A;  3S9H A;  2UXB K;  4BRH A;  1NGH A;  4JKA A;  1HKC A;  1QQN A;  2FSJ A;  3VET A;  3PIP L;  4FVU A;  1X9J A;  1YHQ N;  3OJS A;  1SQK A;  3L6Q A;  2EX3 A;  4ID5 A;  4BR2 A;  4B9S A;  3H6E A;  1NJX A;  5AQV A;  1HPZ A;  1N8R O;  3O6W A;  3MEC A;  1HLU A;  4RCH A;  1N33 K;  1M1K O;  4DV7 K;  4KHS A;  4A5B A;  4GW6 A;  4Z4G A;  4I6M B;  5E41 A;  2HHT A;  4H03 B;  5AQL A;  2BUP A;  2F9W A;  2Z1H A;  4IEI A;  4OKJ A;  5M1F A;  1XHZ A;  4DR2 K;  1ZBF A;  2UU9 K;  4H5T A;  4WQ4 A;  4ILG B;  3T1Y K;  3P31 A;  3NF9 A;  1ZBS A;  3JS6 A;  3L2U A;  3HOT A;  3AVL A;  1P8Z A;  1VQM N;  5BR8 K;  3TTD A;  3ULE B;  1DTT A;  2A1S A;  3BP8 A;  5J2P A;  3PO5 A;  1WSJ A;  3ZEU A;  3SUO A;  3E66 A;  1Q8I A;  1E4F T;  3M8Q A;  4GKJ K;  1BQN A;  3RTV A;  2Z1I A;  2OPS A;  4J2D A;  3KZB A;  1O1W A;  1HJR A;  1S5J A;  4FJX A;  3AA3 A;  3P1G A;  3CCL N;  4BY9 C;  5TKY A;  1GLA G;  4O55 A;  3WNH A;  2P9U A;  4M3Z A;  5TKW A;  1X3M A;  1XUP O;  1OVY A;  3UKU A;  3AO5 A;  2RPI A;  3U9D A;  5HLF A;  3CCS N;  4Y1C A;  4B9L A;  4GVM A;  1OH8 A;  4OO1 J;  4BQZ A;  4JKF A;  3DMJ A;  3MXI A;  1YVU A;  1K6Y A;  4GV3 A;  4DSI A;  3L0Q A;  4U7B A;  2D0P A;  1WBD A;  4OLB A;  4E1J A;  3FZM A;  3VTH A;  1WLJ A;  3FZL A;  4L8R B;  5FPE A;  1VSF A;  1SKR A;  4Y0W A;  1RBU A;  3M1F A;  1NMN A;  1DEJ A;  5CE3 A;  4PUO A;  1LAV A;  3CJC A;  4CJK A;  4B3R K;  4WFA L;  5ADX A;  2IC3 A;  4B9M A;  1NK7 A;  1LCU A;  3CIP A;  3D0P A;  3QEV A;  1UWB A;  2D0C A;  2F9T A;  4KH5 A;  5LL6 Z;  4NLC A;  4DS4 A;  3S3N A;  2VGM A;  3QFP A;  2H3G X;  4C8M A;  4Z0U A;  3G71 N;  1U45 A;  2PYL A;  4KHW A;  1NGG A;  1RBT A;  3TAG A;  1C0U A;  4NB4 A;  3SMS A;  3W0L A;  4B3S K;  1N5Y A;  3VF6 A;  1WN7 A;  2O8F B;  3ATU A;  3HPH A;  1KD1 O;  3AGR A;  1K9M O;  1IH7 A;  1FK9 A;  1S1T A;  2HVI A;  2P9I B;  1WB9 A;  3TSU A;  3CG7 A;  4E72 A;  4FOE A;  2QWM A;  3L4Q A;  5FPM A;  2KFN A;  3LDP A;  3C65 A;  2JWL A;  4W5Q A;  4DQS A;  3ENH A;  4KHQ A;  4DV6 K;  2YJF A;  1WSG A;  2YJE A;  2DY4 A;  3OS2 A;  2HBM A;  3THV A;  3CJ1 A;  4HUG A;  1CXU A;  1IKY A;  4DTS A;  4CHQ A;  1RFQ A;  2Q0U A;  4KHN A;  3ZSY A;  2NNW A;  2ASP A;  4IJN A;  3HPG A;  2HHW A;  2WOM A;  5AQP A;  3CCE N;  4CBW A;  1HYV A;  3HP6 A;  1B9D A;  2BH1 A;  5CY4 A;  4C1N K;  3TAF A;  2G8I A;  3OJU A;  5I3U A;  1EX4 A;  1NOY A;  3DI6 A;  4OGE A;  4YOV A;  3IMX A;  4BG9 A;  2IGI A;  4BEB A;  4RW6 A;  2PYJ A;  3DOL A;  3ID6 A;  2VG6 A;  4PKG A;  4X66 K;  3KLG A;  3P83 D;  1IBM K;  5GIO A;  4ILH A;  4LD0 A;  5AQO A;  4KKO A;  1ASW A;  2NRZ A;  3WNE A;  4DUY K;  3VES A;  2DFE A;  3QIC A;  3OY9 A;  3HK2 A;  1NNE A;  1Q81 O;  2HVH A;  1D4X A;  3LPT A;  4MLH A;  3NHG A;  2HBJ A;  4C8N A;  4FWQ A;  2E1Z A;  1KQS M;  3F73 A;  5K14 A;  1L3V A;  2OAN A;  4FM2 A;  2I7N A;  4LSL A;  5JEN A;  2JWK A;  3GL1 A;  4CJW A;  4NYN A;  3OYN A;  3DLL L;  1WUA A;  4DG1 A;  4WQ5 C;  3TR8 A;  3O8M A;  3VEY A;  3V6D A;  5BRF A;  3PX0 A;  3NVK A;  2O8F A;  4DU3 A;  4KH4 A;  2DPN A;  3RRH A;  3ASM A;  3G10 A;  4CF2 A;  2IVO A;  3S3M A;  2GX9 A;  1NK8 A;  4Z4C A;  1JJ2 M;  4B3O A;  3AA2 A;  4YOT A;  3CQY A;  4MO5 A;  4GNI A;  2IVP A;  3H3O B;  1QHT A;  4C8O A;  4QS8 A;  1NBW A;  3RMD A;  3VQP A;  1J5E K;  1YJN N;  2OTL N;  2UYT A;  5GIN A;  4OPH A;  4CHY A;  3O4Q A;  4CF9 A;  4CEF A;  5JLH A;  3ZYY X;  3IFR A;  4AIL C;  3SV3 A;  3ZCM A;  4DWI A;  1BCM A;  3VQ6 A;  1I39 A;  2ZWH A;  4BRA A;  1ASU A;  1U48 A;  3CM6 A;  2O4I A;  3V1Q A;  3CC7 N;  4JI8 K;  3UKR B;  1HYZ A;  4FW1 A;  1KC8 O;  3O9T A;  1T44 A;  2I5J A;  4JYA K;  3HM8 A;  5ELZ A;  3CJ7 A;  4JI4 K;  1CZB A;  3G6E N;  4JI0 K;  3THW B;  2IDO A;  3UB5 A;  2O8B A;  3QML A;  1MWM A;  4IG3 A;  1W97 L;  3MK6 A;  3SQ2 A;  2CGK A;  3A5L C;  4CFB A;  1HMV A;  3H08 A;  5AQG A;  4DR5 K;  2O8B B;  1HQU A;  5M1Q A;  4F2S A;  3AVK A;  4FPA A;  3N4P A;  1SL2 A;  3V9W A;  2FXU A;  2UUB K;  2QXL A;  5JLF A;  1VQ4 N;  3VPZ A;  1BI4 A;  1T05 A;  5CYQ A;  5HRN A;  2VWK A;  3LAM A;  1ILY A;  1UAX A;  1C6V A;  1KVC A;  3LDL A;  1WSE A;  3HST B;  4BE0 A;  4CGJ A;  4H5V A;  2X78 A;  5KQD A;  3T1A A;  5I9E B;  3SBG A;  5GAH P;  4CGH A;  3RRG A;  2CH5 A;  4K8X A;  2O8E B;  2XY7 A;  4HCC A;  4CF0 A;  4QCL A;  1RT7 A;  4DS5 A;  2O8C B;  1VQK N;  1T6C A;  1R59 O;  2JLE A;  5CR4 A;  2RE2 A;  3EZW A;  1RT6 A;  1LW2 A;  1BIZ A;  4BE2 A;  1ASV A;  4E1M A;  1ZYQ A;  2FSK A;  1TYQ A;  4FLV A;  4BDY A;  4BG8 A;  1OKJ A;  4YDU C;  2CH6 A;  5JS1 A;  1JKH A;  1GLB G;  1S6P A;  1Z05 A;  3MMV A;  3CC2 N;  3BY5 A;  3JAM O;  3NCI A;  3BF3 A;  4RW9 A;  3D7E O;  5D3G A;  3LPU A;  3NF8 A;  2G8H A;  1GLD G;  2KHO A;  2VQF K;  2YI1 A;  3Q7B A;  1CZ9 A;  3GE1 A;  3I0R A;  3HP9 A;  4EP4 A;  3HZ6 A;  4GY2 B; 
#chains in the Genus database with same CATH homology
 1W2B M;  2W41 A;  4DCH A;  4BGA A;  3GG4 A;  4BRF A;  1VQL N;  4QS9 A;  5BN8 A;  4BVO A;  4DKW A;  1U6Z A;  3SK3 A;  3VEX A;  2E20 A;  2P9P A;  4JKG B;  3GOI A;  5C12 A;  2A40 A;  4H0O A;  1WOQ A;  4ISF A;  5BRE A;  4BRM A;  1XQS C;  1S72 N;  2QWQ A;  4OPA A;  1M90 O;  1EQY A;  1MDU B;  2HST A;  3DXM B;  5EVZ A;  3SAF A;  3DWL A;  3UKR A;  1VQ9 N;  2W40 A;  4JKE A;  1NMD A;  4XH5 A;  2E8A A;  2YHX A;  1HUX A;  4A2A A;  2FF3 B;  4O8K A;  3WQU A;  5BPN A;  1Q18 A;  3EN9 A;  1NLV A;  1TYQ B;  4BRN A;  3VEN A;  3K9K A;  3O9R A;  4KH6 A;  4JK9 A;  3UKU B;  4CZL A;  3U4L A;  1ATR A;  1KAY A;  3WEE A;  5AQI A;  2D4W A;  3FZF A;  2HBL A;  3A8Y A;  3M5R A;  4BQL A;  3CER A;  5JVG L;  3ATV A;  2KLA A;  2P9N A;  2ZF5 O;  5C2D A;  3CCM N;  5DM6 L;  5FPD A;  5FPN A;  1VQ6 N;  3CJA A;  1HKB A;  3O08 A;  3CCR N;  4IFE A;  1GLC G;  3OHR A;  3MWP A;  3P4I A;  4CZH A;  3ENO A;  4LC9 B;  2A42 A;  2FF6 A;  4BRI A;  3VEW A;  5LY3 A;  3CCV N;  1JCE A;  3ID8 A;  3ZX3 A;  3F5T A;  4FWS A;  4H0T B;  1ESV A;  3G25 A;  3DAW A;  4YOR A;  4EIA A;  3LDN A;  2NLX A;  3CJB A;  4K25 A;  3EE9 A;  3ZEU B;  2QTD A;  4IWV A;  2PFU A;  4FWM A;  4NLB A;  3CQX A;  3C0B A;  3P39 A;  3CC4 N;  3SLC A;  1Q82 O;  4H5R A;  1Q7Y O;  4PHT X;  3R3L A;  4YOW A;  2IVN A;  3HTV A;  2YHW A;  1U2V B;  4BRH A;  2V7Y A;  1V4S A;  1NGH A;  4JD2 A;  2P9S A;  1HKC A;  1QQN A;  2FSJ A;  4JKA A;  4EHU A;  3MCA B;  3VET A;  3WXK A;  3PIP L;  1X9J A;  5AQK A;  3EL2 A;  1SQK A;  3L6Q A;  1YHQ N;  4FVU A;  4BR2 A;  1YJ9 N;  3H6E A;  4A5A A;  3WT0 A;  5AQV A;  2E2Q A;  3VGM A;  1N8R O;  3O6W A;  4RCH A;  1HLU A;  4NO7 A;  3O9U A;  4MDB A;  1M1K O;  3R9P A;  5H1S Q;  3CF5 L;  4A5B A;  2F7T A;  4I6M B;  5F2R A;  5F0X A;  2KKZ A;  2VGN A;  3AGK A;  4H03 B;  5AQL A;  2BUP A;  2F9W A;  1O13 A;  1YF5 L;  4IEI A;  5EX5 A;  5AZI A;  2V51 B;  5M1F A;  3AY9 A;  1P90 A;  4IJA A;  4H5T A;  5KPT A;  4WQ5 A;  4ILG B;  4WQ4 A;  3P31 A;  1ZBS A;  2I7P A;  3JS6 A;  4U67 L;  3HOT A;  3WEE B;  4JKC A;  4A62 A;  2Q36 A;  1P8Z A;  2V7Z A;  4FOI A;  2QI2 A;  2NZT A;  1BO5 O;  3O4W A;  5M1O A;  1VQM N;  4FWP A;  3TTD A;  3ULE B;  5AFU A;  3FE1 A;  3O1B A;  4BC2 A;  3BP8 A;  4BE7 B;  3A5N C;  3KVG A;  3T7Z A;  4JN4 A;  3HBT A;  4H0X B;  4BGB A;  1SS6 A;  3ZEU A;  3M3Z A;  1GLF O;  4CBU A;  3E66 A;  1YUW A;  1E4F T;  4IOC L;  1NGB A;  2CGJ A;  3C6H A;  1C0F A;  2YCH A;  3KZB A;  2YHY A;  4JKG A;  5B8H A;  3OA9 A;  3HOS A;  3H1V X;  3MWT A;  3CCL N;  3SAG A;  4BY9 C;  5TKY A;  3GDQ A;  5AQF A;  1GLA G;  3CD6 N;  3LM9 A;  2P9U A;  1VAZ A;  5TKW A;  1X3M A;  3D2E A;  3IKM A;  1NGA A;  1XUP O;  2J4R A;  1OVY A;  3TU5 A;  4BVP A;  3SJH A;  3UKU A;  3KWI A;  3U9D A;  1CZA N;  2WFB A;  3CCS N;  3M6G A;  2WC9 A;  4OO1 J;  2V52 B;  4CI6 A;  4IOA L;  3AAP A;  4BQZ A;  4CZK A;  1GLL O;  3W3D A;  2EWS A;  1Y64 A;  1J6Z A;  3D2F A;  2QWN A;  3EKU A;  3G4S N;  4JKF A;  4FPB A;  2QA4 N;  1VQ8 N;  2WBN A;  1QVF M;  4DB3 A;  4GV3 A;  1IJJ A;  3L0Q A;  4U7B A;  2D0P A;  1VQ5 N;  3CHW A;  3LL3 A;  4E1J A;  4H5W A;  3FZM A;  3VTH A;  3HSC A;  3DJC A;  1KXP A;  3FZL A;  5FPE A;  3C6A A;  4Y0W A;  3PIO L;  3M1F A;  2VWB A;  5KPR A;  3FFK B;  5LJV A;  1DEJ A;  5CE3 A;  3CJC A;  2E2P A;  4RWT A;  3FR0 A;  3FLC O;  3WXL A;  4FWL A;  4FL9 A;  4BRK A;  1XC3 A;  3LM2 A;  4WFA L;  4GVE A;  5ADX A;  1HX1 A;  4CZE A;  5AQW A;  3VMF B;  1HJO A;  1LCU A;  3CIP A;  1IG8 A;  3QB0 A;  4YOU A;  3O80 A;  2F9T A;  4KH5 A;  4NLC A;  1V4T A;  2VGM A;  3QFP A;  1BU6 O;  2H3G X;  1NGJ A;  3G71 N;  1S22 A;  4EAH D;  2QW9 A;  2Q0R A;  4K41 A;  1NJI O;  2ZJR L;  3CPW M;  5MLC Q;  1NGG A;  3MCP A;  4C23 A;  4M7Y A;  1BWF O;  3E9O A;  2BTF A;  5JMV A;  4NB4 A;  3SMS A;  3W0L A;  3VF6 A;  4KBO A;  1VQO N;  1ZC6 A;  3ATU A;  1S3X A;  2A5X A;  3VGK A;  4B1W B;  2Q2R A;  3H46 O;  2P9I A;  3R8E A;  4BR4 A;  4WCE L;  1KD1 O;  2IIR A;  3TPQ A;  3NMU A;  3D6R A;  4FWN A;  4BRO A;  3ENB A;  3L4I A;  4M7X A;  3AGR A;  1K9M O;  3QFU A;  1ZXO A;  5AQM A;  2P9I B;  4CZF A;  4B9Q A;  4IEE A;  3TSU A;  3ZET A;  4H0P A;  5C10 A;  5AQX A;  2NRV A;  5JIC A;  4FOE A;  2NRR A;  3D2F B;  2AA4 A;  2QWM A;  3L4Q A;  5FPM A;  3TTC A;  1K8K B;  3LDP A;  3C65 A;  3B8A X;  2JWL A;  2A3Z A;  4WFN L;  2E88 A;  2FSN A;  3ENH A;  5LJW A;  2P9N B;  3BF1 A;  2YJF A;  4FWR A;  3AAR A;  2YJE A;  1X3N A;  2VYP A;  4IXC A;  3UE5 A;  3VEV A;  2HBM A;  4JHD A;  3AAQ A;  3CJ1 A;  3FGU A;  5BRD A;  5BPM A;  4WFB L;  2D0O A;  3HZ6 A;  4BRE A;  3OBW A;  4K43 A;  4YOY A;  1RFQ A;  4BR7 A;  1YIT N;  2Q0U A;  5AQS A;  3CMA N;  3CCU N;  4GV9 A;  3VEO A;  2NNW A;  4FO0 A;  2ASP A;  3J8A A;  4IJN A;  4AF1 A;  3HI0 A;  5AQP A;  2E2N A;  3CCE N;  4CBW A;  3C7N B;  3VF4 A;  1SAZ A;  2BH1 A;  5EOY A;  3VER A;  4MDA A;  4C1N K;  3DXM A;  3U9Z A;  5AQU A;  1TUY A;  4MLE A;  4JNE A;  1BOT O;  2QM1 A;  2P9P B;  1SZ2 A;  4BRD A;  4YOV A;  3IMX A;  4BG9 A;  1MWK A;  3FZK A;  4BEB A;  3ID6 A;  4PKG A;  3O5B A;  3ULE A;  1BG3 A;  1RDU A;  3I56 N;  5C0Y A;  3JXU A;  5M1N A;  5GIO A;  4ILH A;  4ISG A;  5AQO A;  1HPM A;  4EHT A;  3QBX A;  4BC5 A;  1ATS A;  2NRZ A;  4HTL A;  1QQM A;  5GIP A;  1GLJ O;  3I33 A;  1C0G A;  1DKG D;  2PAV A;  3VES A;  4XEI A;  5KPZ A;  3QIC A;  4PL7 A;  1T3V A;  1VQN N;  4RTF D;  5E26 A;  3IUC A;  2AP1 A;  1KAX A;  3BEX A;  5AZI B;  4IDH A;  2PBD A;  1Q81 O;  1D4X A;  1NGD A;  4MLH A;  4K42 A;  2HBJ A;  3RSE B;  4FWQ A;  2A41 A;  2E1Z A;  2P9K A;  4YDU A;  1KQS M;  1VQ7 N;  5C2F A;  2OAN A;  3O1W A;  2I7N A;  2JWK A;  4JKB A;  4M63 C;  2HF4 A;  4B1V A;  5GAD P;  3GL1 A;  3CCQ N;  4CJ7 A;  5AQJ A;  3PLA A;  3DLL L;  2CGL A;  2NRW A;  1WUA A;  3CPE A;  3OW2 M;  4WQ4 C;  2NRX A;  4WQ5 C;  3O8M A;  3VEY A;  3EE8 A;  5BRF A;  5BR9 A;  4BR0 A;  3NVK A;  4AM7 A;  2P9S B;  3Q7C A;  5EY4 A;  3I8B A;  2DPN A;  4KH4 A;  2IVO A;  2VCP A;  3E9P A;  2E1Y A;  3CXC M;  2GX9 A;  3A0I X;  4FSV A;  4MO4 A;  1YAG A;  5M1K A;  4IOX A;  5AQN A;  1JJ2 M;  4A57 A;  1QQO A;  4DHY A;  1QZ5 A;  3QBW A;  4YOT A;  2NRT A;  1YVN A;  2QWO A;  3CQY A;  4MO5 A;  4H0V B;  4A2B A;  2E2O A;  4GNI A;  4BR5 A;  3MDQ A;  2IVP A;  4IZ9 A;  4F9O A;  4FWO A;  3H3O B;  3SBT A;  1HKG A;  4QS8 A;  1E4G T;  1NBW A;  2W00 A;  3WXI A;  3SAH A;  4JK7 A;  1YIJ N;  1YJN N;  2OTL N;  2UYT A;  2QWL A;  4OPH A;  5GIN A;  3GBT A;  5DM7 L;  2GWK A;  4ILJ A;  2D1K A;  4IO8 A;  1NM1 A;  3SMP A;  1NGC A;  3EO3 A;  5JLH A;  2ASM A;  3ZYY X;  1QZ6 A;  3IFR A;  5CHI A;  1MA9 B;  3MN7 A;  2C1G A;  4J8F A;  3CCJ N;  4BRG A;  4JKH A;  3RVC A;  2ZWH A;  4BRA A;  3C7N A;  3FZH A;  3WQT A;  3A5M C;  3MN9 A;  3CC7 N;  3VF2 A;  3UKR B;  3CET A;  1YXQ A;  4O8U A;  4XH1 A;  4CZM A;  3KWG A;  4B1U B;  3WUH A;  1KC8 O;  3CME N;  3O9T A;  1EO1 A;  1Z6R A;  1ATN A;  1T44 A;  2YX6 A;  1GLE G;  1JCG A;  4C1N I;  2P9L A;  3CI5 A;  4BRQ A;  3E9L A;  4FWK A;  2FLO A;  3KK7 A;  3F9M A;  4HWI A;  4B1Z A;  1NGI A;  2Q1N A;  3HRG A;  1LOT B;  3HM8 A;  2GWJ A;  5ELZ A;  1NGE A;  4ISE A;  5HOO A;  3CJ7 A;  1YJW N;  3R6M A;  3TSP A;  4AM6 A;  4BEC A;  3WXJ A;  2ZJQ L;  3G6E N;  4PKI A;  3UB5 A;  3QML A;  1MWM A;  3A5O C;  3O9S A;  4PL8 A;  5AQR A;  3O9Q A;  1H1V A;  2ITM A;  4JEP A;  5BRH A;  5E84 A;  1W97 L;  3MK6 A;  5M1P A;  1NWK A;  2CGK A;  5GAG P;  3A5L C;  3H3N O;  1BDG A;  4WF9 L;  3E1Y A;  3D2E B;  1K73 O;  2QWR A;  3LDO A;  4UY8 O;  5AQG A;  1TUU A;  4YOX A;  4BRL A;  1JCF A;  5M1Q A;  4FPA A;  4DQ8 A;  1K8K A;  3N4P A;  2GUP A;  2HF3 A;  2FXU A;  3J7Z O;  2OTJ N;  4XJX A;  2QXL A;  4B1X B;  5JLF A;  5AFU H;  1VQ4 N;  3KHY A;  3VPZ A;  5JVH L;  2WUS A;  3NVM A;  3P38 A;  2ASO A;  5AQQ A;  1Q86 O;  2ZGZ A;  4JAX A;  3ZET B;  2ZGY A;  1DT9 A;  1K8A O;  1BA0 A;  1G99 A;  4L3Q A;  3T69 A;  3VGL A;  3VTI A;  3H45 C;  2A6A A;  4XH4 A;  4Z94 A;  3BUZ B;  3N4Q A;  4CZI A;  1ILY A;  3LDL A;  1BA1 A;  3MN6 A;  2HBK A;  3K9J A;  3IDH A;  3ZX0 A;  4BC4 A;  4H5V A;  3TTF A;  4B1Y B;  4I6M A;  5AQH A;  4BC3 A;  5BPL A;  5AQY A;  5KQD A;  1QVG M;  4GV6 A;  5I9E B;  3SBG A;  5GAH P;  3VEZ A;  2RHK A;  2CH5 A;  1RGI A;  4R79 A;  4IO9 L;  3F2K A;  3QDK A;  4WYB A;  3DXK A;  3DXK B;  1KAZ A;  4BR9 A;  5AZJ B;  5AZJ A;  4O5F A;  4EFH A;  3MX2 A;  4CBX A;  1VQK N;  5HL7 L;  1T6C A;  1R59 O;  3CJ9 A;  3MX5 A;  5CR4 A;  4A59 A;  5C15 A;  3EKS A;  3VOV A;  2RE2 A;  3EZW A;  1QHA A;  3MN5 A;  4JD2 B;  2Q31 A;  4G9Z A;  4CD3 A;  3I55 N;  1U2V A;  1TYQ A;  2FSK A;  3LDQ A;  1BUP A;  4BG8 A;  2QWP A;  2HOE A;  3ZX2 A;  4BRP A;  2C1I A;  3OBY A;  1OKJ A;  4JKD A;  4YDU C;  2CH6 A;  2GEL A;  5BN9 A;  4H5N A;  1GLB G;  3TSQ A;  5GAE P;  3R1X A;  5KQ8 A;  3S41 A;  4CD1 A;  5ADX H;  1RDW X;  1Z05 A;  2NRH A;  3H1Q A;  3MMV A;  4JK8 A;  4BRC A;  1YI2 N;  3CC2 N;  2QEX N;  4PKH A;  2HMP A;  3RSE A;  2P9K B;  2P9U B;  3BF3 A;  4H0Y B;  3D7E O;  1DGK N;  3WXM B;  5EXW A;  5AR0 A;  2GEM A;  4A61 A;  1GLD G;  5AQZ A;  2KHO A;  5AQT A;  2YI1 A;  1T6D A;  3Q7B A;  4QS7 A;  4CZG A;  4CZJ A;  2Q97 A;  1VQP N;  2ZJP L;  2P9L B;  3GE1 A;  4JHD B;  5F1X A;  1NGF A;  3U8X A;  2GTD A;  4GY2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...