1NMDA

Crystal structure of d. discoideum actin-gelsolin segment 1 complex crystallized in presence of lithium atp
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
372
structure length
362
Chain Sequence
DVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin
publication title The Structure Of The Non-Vertebrate Actin: Implications For The ATP Hydrolytic Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 118
structure length 362
sequence length 372
ec nomenclature
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nmdA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nmdA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1nmdA03
2QW9A 2A42A 4BR9A 4PKGA 4AM6A 4MLEA 1MWKA 1DEJA 1QQOA 2DPNA 5AQUA 2AA4A 4BG8A 2D1KA 3BP8A 1V4TA 3A5LC 2BUPA 3ZETB 1T44A 4CZIA 4HTLA 1Y64A 1E4GT 5AQMA 1IG8A 5E84A 2ZGZA 1YXQA 3HZ6A 5AZIA 4MO5A 1ESVA 2E20A 5AQWA 4FWOA 3BF1A 4I6MB 3RSEB 2GEMA 3VEYA 4EAHD 2HOEA 3QFUA 1HX1A 3R9PA 1G99A 3HM8A 3ZETA 3IMXA 1NLVA 3WQUA 2F9TA 4CD1A 3MN9A 3ID8A 3UKUB 4BRKA 2QWPA 3O6WA 1QQNA 4BVPA 5LJVA 3QB0A 4B1UB 3SLCA 4B1ZA 1ZC6A 4BRDA 4JAXA 3LDPA 4GNIA 2A3ZA 2QWOA 3O4WA 3UKRA 3CJ1A 4FWSA 4JHDB 4BR2A 5FPMA 1TUUA 3GG4A 3O5BA 4I6MA 4CI6A 1MWMA 1NGJA 4FPAA 3MMVA 1R59O 3H46O 4CZHA 5FPNA 3GBTA 4QS8A 3WXJA 2GUPA 1LCUA 4EHUA 3U8XA 3UKUA 3VF4A 3MN5A 1SZ2A 4FWQA 4A2AA 4PL7A 2ASMA 3ENOA 5AR0A 2NRHA 3J8AA 2YJEA 3W0LA 3ZX2A 4BREA 3TPQA 2Q1NA 5AQRA 1BA1A 1S3XA 2QM1A 5LJWA 4BVOA 3R6MA 5KQDA 2I7NA 4FWMA 1E4FT 4BRNA 3H1VX 4CBUA 3LDOA 2V7YA 1NM1A 2E2PA 4M7XA 4QS7A 3VEWA 1KAZA 4DQ8A 2QWQA 2UYTA 4EFHA 3VF6A 3VOVA 5BPLA 2HF4A 4BRIA 3DAWA 3MK6A 1TUYA 2IVPA 4BR5A 5LY3A 3CJBA 2VWBA 3A5MC 2CH5A 3LDNA 4K41A 5AQLA 2CGJA 4IO8A 2QWNA 2V51B 5EVZA 5ELZA 2P9SA 2ZGYA 4MO4A 4BC2A 4WQ4C 3H45C 4O8KA 4RCHA 1U6ZA 1GLBG 3C7NB 5EY4A 3ATVA 4H5RA 4F9OA 4BR7A 5BRFA 5JLHA 3ENHA 3VENA 3O1WA 1HKCA 4M7YA 3CERA 2GWKA 3FZMA 2FSKA 1EQYA 1BWFO 3CQXA 4XH1A 4RWTA 2HF3A 4JD2B 5AQVA 2E2QA 2IIRA 3A5NC 4FOEA 2D4WA 2YHWA 1BU6O 1X9JA 2FSNA 3WXIA 4CZEA 2Q0UA 1QQMA 2W41A 2Q97A 4FO0A 4WQ5A 2F9WA 5AQTA 4B1VA 1CZAN 3A8YA 3BF3A 1ZBSA 3M3ZA 3C7NA 1WUAA 4ISGA 3SMPA 3IDHA 1HKBA 5AQYA 2QWRA 3EL2A 5F1XA 2QWLA 4FSVA 1ATSA 4NB4A 2GELA 1T6DA 5AZIB 4JD2A 1HJOA 3DWLA 3O8MA 4Y0WA 1BOTO 3SJHA 4CZLA 3L0QA 3GDQA 1S22A 2PAVA 4FWPA 1YUWA 1JCGA 3FGUA 3OHRA 2FLOA 4A61A 3AARA 3O1BA 5AQOA 4CJ7A 5B8HA 3DXMA 4H0TB 3UKRB 1GLLO 1SAZA 2V52B 3F9MA 5AQHA 4B1XB 2CGLA 4BRQA 3BUZB 2IVNA 4YDUA 3ZX0A 3QBXA 3WT0A 1HUXA 3ZEUB 3LM9A 1GLDG 5F0XA 1GLCG 3P4IA 3KZBA 3L4IA 4RTFD 2Q2RA 3I8BA 4BRHA 2VCPA 4BRAA 3VEXA 3WXLA 5KPTA 3FZLA 1GLFO 5AQQA 1P8ZA 2FSJA 2ZF5O 3CIPA 4BC3A 1LOTB 3U4LA 1J6ZA 2E2NA 4CZMA 3H3NO 3UB5A 3ZEUA 1ATRA 4WQ4A 4IZ9A 2YI1A 1HPMA 1Z6RA 1KXPA 1C0GA 5F2RA 3CQYA 4BQLA 2CH6A 2P9KA 3IUCA 3QFPA 2YJFA 5BN9A 3CJ9A 4K42A 1MA9B 4PKIA 3VEOA 3GOIA 3WUHA 1NGBA 3ZX3A 5BPNA 4DHYA 3JS6A 4CBWA 2I7PA 4ISFA 5AZJB 1C0FA 3VGMA 2P9SB 3H3OB 4IJAA 3CI5A 1JCFA 1GLJO 2V7ZA 4BC5A 4CZFA 1HKGA 5KPZA 5AQPA 4BRLA 3LDQA 1NGAA 3JXUA 2KHOA 1BA0A 1DGKN 3AAPA 3CJAA 1BO5O 4H5VA 4BRGA 4ISEA 3FZFA 1Z05A 3QICA 2QXLA 2IVOA 3CETA 4NO7A 1QZ6A 4Z94A 4BRPA 5AZJA 5AQZA 3QDKA 4K43A 1XC3A 1QZ5A 2EWSA 4H0PA 3I33A 5BR9A 1ATNA 5I9EB 5AQXA 4H5TA 2FXUA 3CHWA 4XH4A 4BRFA 1Q18A 1HLUA 2HMPA 4H0YB 4XEIA 1NGFA 4IJNA 2ASPA 1DKGD 3A5OC 4EHTA 4BRCA 2VYPA 3LM2A 3MN6A 3DXKB 4DB3A 1TYQA 5AQNA 2E1ZA 4FL9A 4IXCA 1T6CA 5AFUH 4FOIA 3VPZA 4A62A 1NMDA 4PL8A 3CJ7A 1YVNA 3TU5A 2ZWHA 3DXMB 1BG3A 4WYBA 3O08A 5ADXA 3VERA 5BN8A 2FF3B 3O80A 4FPBA 4QS9A 3VGKA 3D2FB 3U9ZA 5BRHA 1OKJA 3DXKA 4A2BA 5EXWA 3EKUA 4B9QA 2J4RA 5ADXH 1H1VA 5BRDA 3S41A 4H0OA 3VEVA 4BG9A 4BR0A 1U2VB 1KAXA 1NBWA 2Q31A 1GLAG 3HTVA 3EZWA 4FWKA 4L3QA 1NGEA 3CJCA 3W3DA 4B1YB 2GWJA 4BROA 5AQIA 3VESA 3U9DA 3D2FA 4FWNA 3GL1A 4E1JA 5JLFA 3VETA 2YHXA 2A40A 2P9KB 4K25A 2D0PA 2ITMA 3ULEB 4H5NA 1U2VA 3AAQA 3HSCA 4O5FA 5EOYA 5BREA 2D0OA 1K8KB 2WUSA 1NGGA 3FLCO 4CD3A 3KVGA 2A5XA 4HWIA 1NWKA 5JMVA 5JICA 2A6AA 2OANA 4B1WB 5KQ8A 1X3MA 4BQZA 3LDLA 5AQGA 4CZKA 3H1QA 3FFKB 3DJCA 2E1YA 1NGDA 4WQ5C 4H0VB 3ULEA 1ZXOA 4H03B 3MN7A 2P9IB 4JN4A 3G25A 2P9LB 4BC4A 2P9PB 1K8KA 3EN9A 4BR4A 4CZGA 3KHYA 2P9UB 1XUPO 4CBXA 4FWRA 3FZHA 3RSEA 3UE5A 1MDUB 2QWMA 3D7EO 1RGIA 4EIAA 3VF2A 3QMLA 3HI0A 1RFQA 3WQTA 4CZJA 2P9IA 3IFRA 2P9LA 4BGAA 2P9PA 3A0IX 1BUPA 3SMSA 4LC9B 3MDQA 3MCPA 3FE1A 4JHDA 2E88A 5KPRA 2P9UA 3AY9A 5FPEA 1D4XA 1WOQA 3EKSA 4DCHA 2NLXA 2PBDA 5E26A 5TKYA 4YDUC 1KAYA 1JCEA 1TYQB 2ASOA 3EO3A 4JNEA 1NGCA 3WEEB 2P9NB 1GLEG 4BGBA 3SK3A 2W40A 2YCHA 3C0BA 3FZKA 3VEZA 4AM7A 5FPDA 2Q36A 3M1FA 3D2EB 4M63C 1RDWX 5AFUA 1YAGA 1QHAA 1SQKA 2FF6A 5AQSA 3R8EA 5AQKA 1BDGA 4H0XB 5AQFA 5EX5A 3ATUA 1NGHA 1XQSC 4J8FA 2H3GX 1IJJA 3QBWA 3HBTA 4KBOA 3L6QA 3M6GA 2Q0RA 2YHYA 3WEEA 2GTDA 2P9NA 4H5WA 3H6EA 5CE3A 3GE1A 4XH5A 4GY2B 2A41A 4C23A 5AQJA 3D2EA 1V4SA 3B8AX 4MLHA 1X3NA 4FWLA 5BPMA 2AP1A 4IWVA 2CGKA 2NZTA 3BEXA 1NGIA 2E2OA 2E8AA 3FR0A 3LL3A 4PKHA 2BTFA 4BRMA 3WXKA 3VGLA
chains in the Genus database with same CATH superfamily
4JK9A 4ID1A 4NCGA 2QXFA 3NVMA 3VQCA 3TAQA 4DSJA 4PKGA 1WAFA 1HNWK 4JKCA 3O4QA 4OLBA 1DEJA 1HNZK 2AA4A 1SKRA 4BE0A 5M1PA 1Q82O 2D1KA 3ZT1A 1KFSA 3VQEA 3J80O 1YIJN 2UUCK 2DY4A 3ZETB 1T44A 4CZIA 4K8XA 4LF8K 3AA3A 1NJIO 4HTLA 4BECA 2B6AA 5DM6L 3L2RA 1YXQA 3IRXA 1C1BA 3CM6A 4MO5A 1ESVA 2ZE2A 1NK6A 1IG9A 3RSEB 2GEMA 1RBVA 4CJ4A 4HUFA 1G99A 3TABA 4OGEA 1IV0A 3TAGA 4M45A 2F9TA 4BRKA 3UKUB 2WONA 1NJZA 1QQNA 4BRDA 1VQ6N 1JLCA 4BR2A 4M3WA 3MWPA 4X66K 3N4PA 3K59A 3THVA 4CI6A 5DM7L 4OPAA 3ASMA 5M1NA 3O3GA 3H46O 4CZHA 3GBTA 4DV5K 1ZBHA 5HRNA 1RT5A 4DTOA 1CZ9A 3L2VA 3C6TA 4PL7A 1U48A 2HB5A 3K9JA 3SI6A 5AR0A 4M3UA 3J8AA 3TTCA 5D3GA 4BREA 4J2EA 5IT9O 1BA1A 4DF8A 2QM1A 4J2BA 2HHXA 2KW4A 5H1SQ 4CHQA 2E2PA 4TSXA 3VOVA 3CPEA 5BPLA 4ZTJA 4A59A 2KKZA 3MK6A 4CJTA 4WCEL 4KI6A 2CH5A 1L3UA 3MEDA 4DQSA 1EWRA 4IO8A 3QEIA 4G9ZA 4PHTX 2UXDK 1VQ7N 1VSFA 2ZGYA 4PA1A 4FK2A 1TGOA 4H4MA 3H08A 4FM0A 3TAPA 5EY4A 3K5LA 4BR7A 3C6AA 4CGHA 3ENHA 1I3AA 3O1WA 2GWKA 1JLFA 1EQYA 3CQXA 1BWFO 3EEQA 2E2QA 2HBLA 2YHWA 1UA0A 1FJGK 4CK2A 2F9WA 1YITN 3CCEN 3C7NA 4IFYA 3K5NA 4IFEA 5J2NA 1TK8A 3EL2A 2QWLA 1ATSA 1L3SA 1T6DA 3HP9A 3CXCM 4YORA 3MXIA 1BOTO 2RKIA 2IGIA 1YI2N 3AVGA 4CGIA 1S22A 1ZBFA 1JKHA 2O8CA 4GV6A 1JCGA 1SL0A 2FLOA 3AARA 2VGNA 2QA4N 4DQIA 4B08A 3TANA 3BUZB 4JI3K 4DR3K 4AHTA 1ASWA 3V1QA 4FM1A 1SS6A 5J2PA 4F4KA 4DV0K 1GLCG 3I8DA 3VA3A 1UA1A 1L5UA 1GLFO 4LH4A 1P8ZA 2ZF5O 3QINA 3U4LA 5CYMA 4Z0UA 3G6EN 3UB5A 4B3OA 3SAFA 1EKEA 4WQ4A 1KLMA 1HPMA 1Z6RA 1S1XA 4A5BA 3VA0A 3THXB 4B3MK 3L3VA 3K9KA 4NLBA 5CZ2A 5EU7A 3IS9A 4CIFA 2XY5A 4M41A 1MA9B 3WUHA 4DHYA 4DTXA 2KFZA 3HXMA 3LWMA 1ZBUA 4M42A 3JS6A 2KLAA 2I7PA 1C0FA 3VGMA 4IJAA 3CG7A 4IG3A 1VSHA 5AQPA 2XHBA 4BRLA 4YFUA 3LDQA 1NGAA 4X64K 2O8DB 3JXUA 2KHOA 4LFBK 1VAZA 1DGKN 3MEEA 3CJAA 3I56N 1BO5O 3DLBA 4JKBA 1Z05A 3BZKA 3OYLA 3RMDA 1ASVA 5AZJA 3E01A 4KH6A 3D0PA 4O5BA 1Z26A 5BR8K 1ZBIA 1XC3A 3HJFA 2UXCK 4I9QA 5AQXA 3KK2A 4YOWA 4Q0BA 3CHWA 3NBPA 4DU4A 4BRFA 4BWJA 1RCHA 4CGGA 3RTVA 1JLGA 1BI4B 3OS0A 3K58A 3HT3A 1MU2A 3V81A 3ZSRA 2O8CB 4CFCA 3THWA 2HBJA 3LP2A 3TAFA 4I7FA 4IXCA 3AGRA 1J54A 3KJVA 3R1XA 1NMDA 4RW8A 2W6KA 1DT9A 1BG3A 1S6QA 3O08A 3VERA 3JAMO 5BN8A 3EZ5A 3C94A 4KB1A 3O80A 4FPBA 3VGKA 1EXQA 5JVHL 3E1YA 3CCUN 3D2FB 4JI6K 4FJLA 4OX9K 3U9ZA 1OKJA 3DXKA 4DTSA 3QNOA 2DFFA 1W9HA 1TVRA 4CJRA 1RT7A 1LAWA 4OJRA 1S1TA 3I55N 5BRDA 4QOZB 3VEVA 4BR0A 2Q31A 4YOVA 3V9XA 4FLXA 4O55A 1X1PA 4FWKA 1VQ9N 1KVAA 4E7LA 4BDZA 4FXDA 4CIGA 4B1YB 3AVKA 3U9DA 1VQMN 3AVNA 3PSFA 3NFAA 5FDLA 1XC9A 2YHXA 4F2SA 4JYAK 2UXBK 4XJXA 3AA2A 1JXBA 1WSGA 2ITMA 3ULEB 4CF9A 4M3TA 1U2VA 3DRSA 4O5FA 3OVNA 4CJEA 4YNQA 1NK9A 1K8KB 1C0UA 2WUSA 5M1KA 1KLNA 2DFEA 1X9SA 1ILYA 5JICA 2LSNA 3HYFA 4CHPA 1VSKA 1X3MA 3BGRA 3FFKB 3DJCA 4FZYA 1Q7YO 2VGMA 5KI6A 2P9IB 3P31A 4JN4A 4BC4A 4CF1A 4CFAA 4BR4A 4DTMA 3KHYA 2G8KA 1XUPO 3I0SA 3FZHA 2KZZA 4F2RA 2QWMA 1YJ9N 3SAHA 3QMLA 3HI0A 1CZBA 1RFQA 3WQTA 4CZJA 1L3VA 2P9LA 4BGAA 3A0IX 1BUPA 1W7AA 4LC9B 1S72N 3MCPA 2O8FA 2P9UA 1D4XA 3CF5L 4IOCL 2JGUA 3KK3A 1S5JA 4KHPK 4CESA 3EO3A 1RTIA 4HUGA 3WEEB 1NMNA 4BGBA 4UY8O 3B6PA 4IO9L 2RF2A 3C0BA 3FZKA 4EP5A 2A1SA 3VEZA 4GV3A 5HRSA 3M1FA 3OS2A 1TL3A 3KKSA 4CJKA 1SQKA 2FF6A 4KV8A 4DV7K 5AQKA 3MCAB 4J2AA 5AQFA 5EX5A 3ATUA 3MX5A 2ZJQL 4J8FA 3OYEA 1RTHA 1WSHA 5JENA 1NJXA 3Q7CA 3H6EA 1FKOA 5I42A 5CE3A 4C23A 5AQJA 3B8AX 2R7YA 3KWIA 4FWLA 1RNHA 3PLAA 5C0YA 2CGKA 3BEXA 3FR0A 2UU9K 1S1VA 4LF5K 4DLEA 1XMQK 1K8AO 4AH9A 3RRHA 2QI2A 3L8BA 4IFVA 1MWKA 4CEAA 3RR7A 1S9EA 2EHGA 1QQOA 2DPNA 5AQUA 4Q5VA 3M8SA 1V4TA 3A5LC 1VK0A 2ETJA 3EYZA 3SBTA 1OH6A 3ZSVA 2E5LK 3K2PA 4JS4A 3VQ5A 3HO1A 1Y64A 3V1RA 3DLLL 4N47A 1IG8A 2NRVA 2P1JA 2ZGZA 3HZ6A 4BACA 4E7IA 3WXMB 3NH1A 2A1RA 4FWOA 3QERA 1Q81O 4I6MB 3VEYA 3DRRA 2HOEA 3QFUA 3ZETA 4CGFA 4CJLA 1YTAA 1NLVA 3WQUA 4B9SA 4O4GA 4CD1A 3S3NA 3ID8A 4IKFA 1FKPA 1J9AA 4B1UB 4BDYA 3SLCA 4B1ZA 2OTJN 3V9SA 4GNIA 2A3ZA 2FBTA 1WN7A 1VQ5N 4DG1A 3NF7A 5FPMA 3CMEN 3GG4A 2OCEA 1JJ2M 3OYBA 4B9NA 1RT3A 3MMVA 3OYCA 3LANA 1N34K 4FJJA 4DV3K 3WXJA 4CK1A 4HCBA 5J2MA 4OVLA 1HNVA 2QTDA 4EHUA 3UKUA 3VF4A 1SZ2A 4FWQA 3HPHA 3VQAA 4JLHA 2ASMA 1BIZA 2KTQA 1T8EA 2YHBA 3NH2A 4FCYA 2W6LA 3AVBA 4DR5K 2Q1NA 4JI8K 4BVOA 4IOAL 3ZSXA 1QQCA 1E4FT 4NXMK 1KVCA 5J1EA 2V7YA 4IBNA 1JLQA 4CK3A 1VSJA 3VQ4A 4EFHA 3SAGA 3VQ8A 2HF4A 3QNNA 4C8KA 1Q8IA 4NCAA 1NOYA 2O8BA 4UQGA 1FK9A 4Z4CA 1N33K 4FM2A 2P9SA 2D0CA 3P39A 5C42A 3JYTA 4BC2A 2ZD1A 4WQ4C 4DF4A 5FRNA 1W0HA 1GOBA 3TSUA 1REVA 5LL6Z 5BRFA 4OPHA 3WNFA 4AHUA 4KHSA 4R5PA 4M7YA 2IDOA 5CR4A 3F73A 2FSKA 4JD2B 4YHHK 2IIRA 3AA4A 4CEEA 2D4WA 3V9ZA 4YOYA 2FSNA 3WXIA 3BDPA 1K6YA 4FO0A 1EETA 3A8YA 3M3ZA 2QKKA 2F8TA 4KHWA 1B9DA 1HKBA 5AQYA 3BZCA 5F1XA 2PYLA 4B8AB 4YOUA 3TTDA 4OKJA 1J5OA 1K9MO 2O8EA 3CCLN 3RVCA 3GDQA 5C15A 4CHOA 1VSIA 3AGKA 1I39A 3B6OA 4A61A 3J7ZO 3SQ4A 4N76A 4FLWA 3NGZA 1JLBA 1I94K 1S6PA 1VQNN 1M90O 5B8HA 4E7KA 3DXMA 4B1XB 1GLLO 4BRQA 4FJ9A 1BGXT 2CGLA 4MDBA 2IVNA 1QSLA 3QBXA 3EE9A 2C1IA 1GLDG 4Z4IA 3KZBA 4RTFD 4DKWA 4BRHA 3M8PA 1VSMA 1S1UA 4LSNA 1JXEA 3WXLA 5A2QO 2ATQA 4BE1A 3U6FA 5SWMA 4ID5A 1D5AA 4BC3A 4DTPA 1NK4A 1VQKN 1KC8O 1YVUA 1J6ZA 1SL1A 5KRTA 1JL2A 4LF9K 3H3NO 1C0MA 1ATRA 4CJFA 4DFKA 3S5TA 3SV3A 3OYNA 2YI1A 3Q7BA 1C0GA 1TL1A 4FLVA 5F2RA 4FYDA 4BQLA 4FK0A 2P9KA 1UAXA 3T19A 3F2KA 3D6RA 4LSLA 5BN9A 1RBUA 1HJRA 3MX2A 4PKIA 3OYMA 3GOIA 3NAEA 5JVGL 3O9RA 5BPNA 4HVJA 1WSJA 3QEWA 4CBWA 2O8BB 2P9SB 3H3OB 4CFBA 4C8OA 3CI5A 1IBKK 3THXA 4KB0A 1C1CA 2PYJA 5KRSA 5KPZA 1QSSA 1QSYA 1BA0A 3OYJA 1A5WA 3G4SN 3OYDA 4H5VA 4QAGA 2NUBA 2EX3A 4ISEA 4WFAL 1HR0K 4B9VA 3FZFA 3QICA 1LWCA 3CETA 4NO7A 1QZ6A 1T3VA 3CC2N 4AF1A 4DR4K 3QDKA 4K43A 3QEVA 1HQUA 2D0AA 1JL1A 1QZ5A 1T7PA 3I33A 3SPYA 2O8DA 3AO1A 4H5TA 2B4JA 2FXUA 2QKBA 4C8NA 1L3TA 1NJYA 3K57A 4R79A 2O8EB 2W00A 4RW4A 4KTQA 4IDHA 5GAEP 2NRTA 3CFRA 1R0AA 3KLIA 5E41A 4BRCA 3O3FA 4OGCA 4O8UA 4M3RA 3OW2M 1RILA 4FL9A 2OZSA 4E89A 1T6CA 4CIEA 4FVUA 4B9TA 1J53A 3SUQA 4M3ZA 1YVNA 2ZWHA 4BE7B 3DXMB 2F96A 1LV5A 1BI4A 4JKDA 3V6DA 2HSTA 4FK4A 3KD5E 2FF3B 3ZT2A 5C10A 4CCHA 3SQ0A 1YT3A 5BRHA 3E9OA 1U04A 4B9QA 3KK1A 2J4RA 3C95A 3HOSA 3L4QA 3P38A 1QHTA 2FBVA 4U67L 5GIPA 4DTNA 5FLXO 4CERA 3HTVA 3KTQA 4KTWA 3AVHA 2GX9A 1NGEA 3CJCA 3ZLJA 3W3DA 4BROA 5AQIA 5JS1A 3D2FA 2Z1JA 1VRTA 4FWNA 1KD1O 4KHYA 3GL1A 3WNHA 4DLGA 2C1GA 3T1HK 3CCVN 5HROA 3U3GA 2P9KB 4K25A 1QVGM 2Z1IA 3E9PA 4H5NA 3OTOK 3AAQA 5EOYA 5BREA 3FLCO 4DR7K 2RE2A 1A5XA 5JMVA 2A6AA 3NF8A 3AO3A 2WTUA 2G8IA 1D9DA 4CJ3A 4B3TK 3AVCA 3M8RA 5AQGA 3TTFA 4CZKA 3NVKA 4WQ5C 3ULEA 1RBTA 1ZXOA 2P9PB 1K8KA 4WFNL 4CZGA 4M3XA 4CGJA 4AHRA 3AO4A 1X9MA 2GUIA 4RG8A 3UIQA 4DQPA 5HRPA 3UE5A 3HP6A 1NK7A 1Q86O 4EIAA 2VWKA 1OVQA 1RDCA 1SV5A 2P9IA 3SMSA 2VG7A 3FE1A 4JHDA 2E88A 3PV8A 3I0RA 3AY9A 5C24A 4DCHA 4GW6A 1TAQA 2PBDA 4O0IA 1W2BM 4YDUC 2NRWA 2E6MA 3G71N 4E3SA 2ASOA 1BIUA 1NGCA 4AHSA 2P51A 4DR6K 1GLEG 4FJ8A 2YCHA 4LH5A 4CFDA 2KQ2A 1YF5L 5AFUA 1NOZA 2XY6A 1YAGA 2RHKA 3OYIA 3R8EA 4LF7K 3O9QA 4H0XB 3AVAA 1Z25A 3M5RA 2BDPA 3FFIA 3D45A 2H3GX 1TV6A 1W97L 1VQPN 3QBWA 5GAHP 4Z4FA 5KGXA 3MEGA 5GINA 3CMAN 3M6GA 3WEEA 4FJIA 3PX0A 4XH5A 2A41A 4CEDA 4JI0K 4JRPA 2HHIA 4MLHA 4B9LA 3L2QA 4E0DA 5BPMA 2AP1A 4IWVA 1XHZA 2HBMA 2NZTA 4NYFA 1NGIA 4PKHA 3ZSOA 2OYQA 3S3MA 3VGLA 1WAJA 2G8HA 3V9WA 3ZSYA 1G15A 2VG6A 4DWIA 4OPKA 1OVYA 4BG8A 4B8CA 2XY7A 2BUPA 4CEBA 2FC0A 3AV9A 3LAMA 4MFBA 4YOTA 1TK5A 1E4GT 3SCXA 1XNQK 3CD6N 5C12A 3O3HA 5AZIA 4DFJA 4O0JA 3E66A 4IOXA 2E20A 3QIPA 2IC3A 3BF1A 4FLUA 4EAHD 1RT4A 4KHNA 3AVJA 3R9PA 3IMXA 4CVNE 4PQUA 1EP4A 2O4GA 4FW2A 3MN9A 2KFNA 1KVBA 3QB0A 3LWLA 1ZC6A 3BY5A 4JAXA 3LDPA 2YX6A 5TKWA 1U45A 2QWOA 1C1AA 3O4WA 4CJ5A 3CJ1A 4FJ5A 4W5QA 5J2QA 4JHDB 2YNFA 1TUUA 3TSQA 4JKAA 4I6MA 1TKZA 4FPAA 1R59O 1ZBLA 4DSIA 3KWGA 3U3YA 2GUPA 3ZSWA 5T7BA 1VSDA 3CC7N 3U8XA 3MN5A 2OPQA 4A2AA 3DRPA 3ENOA 4Z4HA 2NRHA 3W0LA 2YJEA 4EZ9A 4JI4K 3OYAA 3TPQA 5AQRA 1S3XA 2NRRA 3R6MA 5KQDA 4KAZA 4KKOA 3PO5A 2NRZA 4CBUA 3KLGA 1VQ4N 1NM1A 2OTLN 3LP3A 4M7XA 4DTRA 1KAZA 4DQ8A 2UYTA 3VF6A 3ISNC 3DAWA 4BR5A 4DV4K 5LY3A 3CJBA 3LDNA 4K41A 5AQLA 2CGJA 2QWNA 2V51B 1JLAA 5EVZA 3VTHA 2HHQA 5ELZA 2WBNA 2E6LA 3IAYA 4MO4A 1FW6A 2HVHA 3H45C 4WFBL 3SJJA 3HK2A 3OJUA 3ATVA 4H5RA 4LF4K 3QLHA 3VENA 3O9TA 4HHTA 3CERA 3FZMA 2HF3A 3NDKA 3HL8A 4XIUA 4FOEA 2FBXA 3SZ2A 1BU6O 3KIOA 4CECA 3L2WA 4CZEA 2Q0UA 1QQMA 2ZJPL 4KI4A 2AJQA 2W41A 4W5RA 2Q97A 1BISA 4WQ5A 3TWHA 2Q3SA 3BF3A 3QO9A 1ZBSA 4OO1J 4ISGA 4C8LA 3SMPA 2YKNA 3SV4A 3LDSA 4FSVA 2GELA 5AZIB 4K0KK 5CHIA 4JD2A 4W5OA 3DWLA 4Y0WA 1TKXA 5FROA 2HHWA 4DUZK 3L0QA 3SUPA 2PY5A 4FWPA 3DLEA 1YUWA 3OHRA 3O1BA 2B5JA 5AQOA 4M3YA 4E7HA 4N56A 3WNGA 3CCQN 3HPGA 4H0TB 5DK5A 1WSFA 1N32K 4YDUA 3WT0A 2P5GA 3ZEUB 3ITHA 5F0XA 4JV5K 3P4IA 3WNEA 2Q2RA 1EWQA 3I8BA 1NK0A 1DTTA 1N5YA 2VCPA 5KTQA 4BRAA 3VEXA 3FZLA 3KKRA 2FSJA 3CIPA 1ITGA 3ZCMA 2JWLA 1RBSA 3LPTA 1EO1A 4DTJA 4H4OA 4DUYK 4BEBA 3SUNA 3OBWA 3MXMA 1RT1A 1BQMA 3HRGA 4JI2K 1HNIA 1IH7A 3NF6A 3ZSZA 1DTQA 2CH6A 3IUCA 3QFPA 1FXXA 4BDPA 2YJFA 3CJ9A 4CHZA 2XO7A 3OYFA 3VEOA 4LD0A 2D0BA 3RMAA 3R3LA 2YKMA 3CQ8A 3ZYYX 1M1KO 3O9UA 1HYSA 3ZSQA 1EX4A 3ENBA 4WE1A 4BC5A 1HKGA 2G8WA 2WC9A 2YNHA 4B9MA 1KQSM 4JI7K 3LAKA 4FLYA 4BRGA 4Y1DA 3QETA 5GADP 2QXLA 2IVOA 4GMJB 4CEZA 2Z1GA 1F21A 4CJSA 2E4LA 4DFPA 3THYB 4DS5A 4H0PA 4YY3K 1ATNA 4JRQA 4CEFA 1RTDA 4B9UA 1SKSA 4EP4A 1Q18A 1C6VA 1HLUA 2HMPA 4H0YB 1KCFA 4XEIA 2ASPA 1OH5A 3A5OC 5M1OA 1N8RO 1KRPA 1KTQA 2VYPA 3LALA 3LM2A 3MN6A 3V1OA 4DB3A 4DSFA 2XY8A 2E1ZA 5AQNA 3SUOA 4W5NA 4LFCK 1GOAA 4N41A 3VPZA 2RN2A 4PL8A 3TI0A 4JK8A 4W5TA 3LP1A 2YV0X 3F5TA 3OBYA 4WYBA 1YTUA 4J2DA 3HVTA 3AA5X 2BANA 4DSKA 2VG5A 3J81O 4CJUA 4A2BA 5EXWA 3EKUA 4H8KA 3RMBA 3MWTA 1SUQA 3PSIA 5ADXH 1H1VA 1IKWA 1S9GA 4H0OA 3S41A 4BG9A 2NNWA 1HYZA 1NBWA 1OH7A 1GLAG 3EZWA 4PWDA 3VQ9A 4DSEA 4KH4A 3CCRN 1WB9A 5FRMA 1RDBA 4FJGA 4ELUA 1TKTA 4E1JA 1XWLA 3DOLA 4IEEA 4RW9A 1YJWN 2D0PA 3AVLA 4JEPA 4KFBA 3HSCA 2D0OA 3QEPA 2G8VA 3CPWM 3TSPA 4JKGB 5LMNK 3KVGA 2F4VK 1KFDA 4JKHA 3EE8A 3LP0A 3PY8A 2OANA 4F3OA 4B1WB 1E3MA 4CF8A 1Q9XA 3M8QA 4ZHRA 4BQZA 3CCSN 4X62K 3H1QA 4GKKK 3K5MA 4H0VB 4H03B 1N6QA 3G25A 1D8YA 3ULDA 2I5JA 1C0TA 3CFOA 2HBKA 1O1WA 2GBZA 4FWRA 2F8SA 1QE1A 5HBMA 1MDUB 1U49A 3VF2A 3VQ6A 4CE9A 1NKEA 3K0SA 1NU0A 1HYVA 2JLEA 4ILJA 3AVFA 2P9PA 4HUEA 3MDQA 5KPRA 1WOQA 1JLEA 4V19S 3CCJN 3CYGA 1JCEA 3L3UA 4F3TA 3RWUA 1LWEA 2P9NB 4FJ7A 3OYHA 4JK7A 1BCOA 4AM7A 3NGYA 3LZIA 3D2EB 2Z1HA 1RDWX 3SNNA 1QHAA 3NE6A 4WF9L 4DTUA 3VQBA 2IS3A 1NG9A 1XHXA 1NGHA 4IDKA 5M1FA 1IJJA 3HBTA 2Q0RA 3AVIA 3DLKA 1U4BA 2GTDA 4KHUA 3JSMA 3GE1A 1DLOA 4HTUA 4GY2B 4AHCA 1J5EK 4BWMA 4CJWA 2PZSA 3TAEA 1NK8A 1LW0A 1YHQN 2E2OA 2E8AA 3TAMA 1X9WA 4BRMA 3ZT4A 5C25A 4DFMA 3HOTA 1LW2A 1VRUA 4I9LA 2QW9A 2A42A 5C2DA 4BR9A 2YNIA 3VQ7A 4AM6A 4CGDA 2KZMA 4MLEA 5KGWA 4DV6K 3DOKA 2VQFK 2HNYA 4NXNK 2BE2A 2HHSA 4B3SK 3BP8A 4CF0A 1Y97A 3CFPA 3P1GA 4CJQA 1NK5A 5GAGP 3OS1A 1IBLK 5AQMA 4ELTA 2HHUA 5HP1A 5E84A 4ILGB 5JS2A 1HPZA 1QVFM 1BHLA 2QEXN 4E19A 1S1WA 1IKYA 1SKWA 3C6HA 5AQWA 1NJWA 4AHVA 3DM2A 3J7YP 4BY9C 1HX1A 3HM8A 4RW6A 3HVRA 1RDDA 3OA9A 2QWPA 3O6WA 4CW7B 3MAQA 4BVPA 5LJVA 1WBDA 3IG1A 4CJPA 4E72A 3C65A 4MDAA 4L8RB 3UKRA 1TKDA 4FWSA 3OYGA 3DI6A 1GOCA 4NYNA 3O5BA 1BCMA 1MWMA 1NGJA 5FPNA 1WSEA 4QS8A 3NGIA 4N5SA 4IEIA 1LCUA 2X74A 3DMJA 4E1MA 4U7BA 3LPUA 3OYKA 3ZX2A 1NKCA 4NLCA 1IKVA 3TR8A 1IBMK 5LJWA 2DTUA 4DR2K 2OPPA 4DQRA 5HLFA 2I7NA 4E1NA 4FWMA 1VQON 2HMIA 4DS4A 3G10A 4BRNA 3H1VX 1RTJA 3RMCA 5CYQA 4FLTA 3LDOA 1QS4A 4GVMA 2RPIA 4QS7A 3VEWA 1HMVA 1RBRA 2QWQA 5K14A 1RDUA 4I2QA 4BRIA 1TUYA 2IVPA 2VWBA 3A5MC 3TARA 3G0ZA 3CC4N 4LF6K 2X78A 3V4IA 1WSIA 2DFHA 3CCMN 4C1NK 4ILHA 1HQEA 1WNSA 3AVMA 4O8KA 1U6ZA 4RCHA 1GLBG 3C7NB 5CY4A 4KREA 4F9OA 5JLHA 4DU3A 1HKCA 4RWTA 4XH1A 4B3RK 5AQVA 3A5NC 3DLRA 1VQ8N 3OJSA 1X9JA 4X65K 1VQLN 4FW1A 5AQTA 4B1VA 2YHAA 1CZAN 2Y1IA 1CXUA 3S9HA 3VN5A 3MXJA 1WUAA 2OPSA 3IDHA 2QWRA 2X6NA 4NB4A 4GKJK 4YOXA 1HJOA 3O8MA 3SJHA 4CZLA 3SQ1A 3PX6A 2IAJA 2PAVA 4CF2A 3EY1A 1N36K 4GVEA 4C8MA 4KO0A 3A2FA 3FGUA 4A57A 4ZTFA 1KSPA 1ZYQA 4CJ7A 4CHNA 4EZ6A 3CM5A 3T69A 3VMFB 2FBYA 2P5OA 1TAUA 4PUOA 3UKRB 1SAZA 2V52B 3F9MA 5AQHA 3ZX0A 1CLQA 1HUXA 3LM9A 3KLFA 4DSLA 4CEQA 2VQEK 5CZ1A 3L4IA 1YJNN 3J7AP 5DMRA 3RRGA 5KPTA 3VQPA 1BL3A 3HSTB 5AQQA 4JI1K 4JKEA 2G8FA 1LOTB 5M1QA 2JWKA 2E2NA 4CZMA 2ITGA 3SQ2A 4O44A 3ZEUA 1UWBA 4QCLA 1UOCA 3MECA 3VQQA 4IZ9A 2YNGA 4Z4GA 2ZJRL 3SYZA 1KXPA 2OZMA 3CQYA 2HHTA 3F9KA 3VTIA 1WBBA 4KRFA 4K42A 1SL2A 1NGBA 2UUBK 3ZX3A 3L2UA 4RW7A 1D9FA 3QESA 2W42A 4JS5A 3AO5A 4ISFA 5AZJB 5C2FA 2GV9A 1NNEA 4OPJA 3ALYA 1JCFA 1GLJO 4F8RA 2V7ZA 4CZFA 4LY7A 3PIOL 4AILC 3SBGA 5LMUK 1XMOK 4KPYA 2XRIA 4ELVA 4IG0A 3AAPA 2BH1A 1LAVA 3V9UA 3QEXA 3T7ZA 4DU1A 4Z94A 4BRPA 2NRXA 5AQZA 3THWB 3NHGA 2EWSA 4OKKA 5BR9A 2Y1JA 5I9EB 2WFBA 1WLJA 4NCBA 4DV1K 4XH4A 3QIOA 4I2PA 3DLHA 3T3FA 3P5JA 4E7JA 1NGFA 4IJNA 1TK0A 1DKGD 3VQDA 4EHTA 2VWJA 1HNXK 3DXKB 4FJMA 2IOCA 1TYQA 3THYA 4LFAK 4G1QA 3KLEA 4FVMA 5AFUH 1QTMA 2HNDA 4FOIA 4A62A 3NCIA 3CJ7A 4PY5A 3TU5A 3S3OA 4FZXC 5ADXA 4Y1CA 4CJVA 3CYMA 4QS9A 1VSEA 2UUAK 1A5VA 1RDAA 4CEOA 1RT2A 5GIOA 4HCCA 3HPOA 4GV9A 2BGGA 2HHHK 2HHVA 3O4NA 4DQQA 1O13A 1U2VB 1CXQA 1KAXA 4FJHA 3ZT0A 1T05A 3AO2A 3ID6A 4C1NI 3NH0A 2ZM6K 1HRHA 4L3QA 2GWJA 3VESA 1XNRK 1B92A 3SPZA 4ICLA 3HM9A 5JLFA 3VETA 1P90A 3N4QA 2A40A 4FJXA 4BE2A 1XI1A 1BQNA 3RR8A 5IWAK 1NGGA 4CD3A 2A5XA 1T03A 2QK9A 2G8UA 1NKBA 4HWIA 1NWKA 2X6SA 2HW3A 2PFUA 5MLCQ 5KQ8A 3PIPL 4OLAA 3LDLA 3KD1E 2E1YA 1NGDA 5HL7L 3MN7A 4K8ZA 2P9LB 1U47A 3EN9A 3IKMA 4JKGA 1IKXA 2O8FB 2P9UB 4CBXA 3PUFA 3KK7A 4CHYA 5I3UA 1LWFA 5HOOA 3RSEA 1VSLA 3P83D 1IO2A 3C6UA 3K5OA 3D7EO 4KH5A 1RGIA 1B9FA 2HNZA 1VHXA 3LZJA 2OPRA 4FLZA 3NMUA 4AQYK 3IFRA 3ZT3A 5HRRA 4FJNA 4KTZA 2F7TA 4A5AA 3KLHA 4DR1K 4OKEA 5FPEA 3EKSA 2NLXA 5E26A 5TKYA 1KAYA 1K73O 1TYQB 4FZZA 4JNEA 3PX4A 3DLGA 3SK3A 2D5RA 2W40A 5FPDA 3OY9A 4FJKA 4DMNA 2HVIA 2Q36A 4KHQA 1Q9YA 4M63C 5AQSA 2OA8A 1BDGA 5SZTA 4DV2K 1RT6A 3PO4A 1XQSC 3NF9A 2O4IA 4JKFA 4KBOA 5AJ3K 3O9SA 3L6QA 3T1YK 2WOMA 2YHYA 2P9NA 3E9LA 3T1AA 4H5WA 4MQ3A 4Z4EA 3D2EA 3DYAA 2ZQBA 1V4SA 1OH8A 1ASUA 1X3NA 4JI5K 3LL3A 2BTFA 3WXKA
chains in the Genus database with same CATH topology
4JK9A 3HOTA 2QW9A 3NVMA 2A42A 5C2DA 2QI2A 4BR9A 4PKGA 4AM6A 4MLEA 1MWKA 4JKCA 1DEJA 1QQOA 2DPNA 5AQUA 2AA4A 1OVYA 4BG8A 5M1PA 1Q82O 2D1KA 3BP8A 1V4TA 3A5LC 2BUPA 1YIJN 3SBTA 3ZETB 1T44A 4CZIA 1NJIO 4HTLA 5GAGP 1Y64A 4YOTA 3DLLL 4BECA 1E4GT 5AQMA 1IG8A 2NRVA 5E84A 5DM6L 3CD6N 4ILGB 2ZGZA 5C12A 1QVFM 1YXQA 3HZ6A 5AZIA 2QEXN 3E66A 4IOXA 4MO5A 1ESVA 3WXMB 2E20A 3C6HA 4FWOA 5AQWA 3BF1A 1Q81O 4I6MB 3RSEB 2GEMA 3VEYA 4EAHD 4BY9C 2HOEA 3QFUA 1HX1A 3R9PA 1G99A 3HM8A 3ZETA 3IMXA 1NLVA 3WQUA 2F9TA 4CD1A 3MN9A 3ID8A 3UKUB 4BRKA 3OA9A 2QWPA 3O6WA 1QQNA 4BVPA 5LJVA 3QB0A 4B1UB 3SLCA 4B1ZA 1ZC6A 5TKWA 4JAXA 3LDPA 2YX6A 3C65A 2A3ZA 2QWOA 4GNIA 4MDAA 1VQ6N 3O4WA 3UKRA 3CJ1A 4FWSA 4JHDB 4BR2A 1VQ5N 5FPMA 1TUUA 3CMEN 3GG4A 3MWPA 3TSQA 1JJ2M 3O5BA 4JKAA 3N4PA 4I6MA 4CI6A 1MWMA 5DM7L 4OPAA 1NGJA 4FPAA 5M1NA 3MMVA 1R59O 3H46O 4CZHA 3KWGA 3GBTA 5FPNA 4QS8A 3WXJA 2GUPA 4IEIA 1LCUA 2QTDA 4EHUA 3CC7N 3U8XA 3UKUA 3VF4A 3MN5A 1SZ2A 4FWQA 4A2AA 4PL7A 3K9JA 2ASMA 3ENOA 4U7BA 5AR0A 2NRHA 3J8AA 2YJEA 3W0LA 3ZX2A 3TTCA 4BREA 4NLCA 3TPQA 2Q1NA 5AQRA 1BA1A 1S3XA 2QM1A 5LJWA 2NRRA 4BVOA 3R6MA 5KQDA 4IOAL 2I7NA 4FWMA 1VQON 1E4FT 2NRZA 3H1VX 4BRNA 4CBUA 5H1SQ 1VQ4N 3LDOA 2V7YA 1NM1A 2OTLN 2E2PA 4M7XA 4QS7A 3VEWA 1KAZA 4DQ8A 2QWQA 2UYTA 4EFHA 3VF6A 3VOVA 3CPEA 3SAGA 1RDUA 5BPLA 2HF4A 4A59A 4BRIA 2KKZA 3DAWA 3MK6A 1TUYA 4WCEL 2IVPA 4BR5A 5LY3A 3CJBA 2VWBA 3A5MC 2CH5A 3LDNA 4K41A 3CC4N 5AQLA 2CGJA 4IO8A 2QWNA 2V51B 5EVZA 3VTHA 4G9ZA 5ELZA 4PHTX 2WBNA 2P9SA 3CCMN 3P39A 1VQ7N 2ZGYA 4MO4A 4BC2A 4C1NK 4ILHA 4WQ4C 3H45C 4O8KA 4RCHA 1U6ZA 4WFBL 1GLBG 3C7NB 5EY4A 3ATVA 4H5RA 3TSUA 4BR7A 4F9OA 4BRDA 3C6AA 5BRFA 5JLHA 3ENHA 4OPHA 3VENA 3O9TA 3O1WA 1HKCA 4M7YA 3CERA 5CR4A 2GWKA 2FSKA 1EQYA 3CQXA 1BWFO 3FZMA 4XH1A 4RWTA 2HF3A 4JD2B 5AQVA 2E2QA 2IIRA 3A5NC 4FOEA 2D4WA 2HBLA 1VQ8N 2YHWA 4YOYA 1BU6O 1X9JA 2FSNA 3WXIA 4CZEA 2Q0UA 1QQMA 2ZJPL 1VQLN 2W41A 2Q97A 4FO0A 4WQ5A 2F9WA 5AQTA 4B1VA 1YITN 1CZAN 3A8YA 3BF3A 1ZBSA 3M3ZA 3CCEN 3C7NA 4OO1J 1WUAA 4ISGA 3SMPA 3IDHA 4IFEA 1HKBA 5AQYA 2QWRA 3EL2A 5F1XA 2QWLA 4FSVA 1ATSA 4NB4A 4YOUA 3TTDA 2GELA 1K9MO 1T6DA 5AZIB 5CHIA 4JD2A 3CXCM 4YOXA 1HJOA 4YORA 3DWLA 3O8MA 4Y0WA 3CCLN 1BOTO 3SJHA 1YI2N 4CZLA 3RVCA 3L0QA 3GDQA 5C15A 1S22A 2PAVA 4FWPA 4GVEA 4GV6A 1YUWA 1JCGA 3AGKA 3FGUA 3OHRA 2FLOA 4A57A 4A61A 3AARA 2VGNA 3J7ZO 3O1BA 5AQOA 4CJ7A 2QA4N 1VQNN 1M90O 5B8HA 3CCQN 3T69A 3VMFB 3DXMA 4H0TB 3UKRB 1GLLO 1SAZA 2V52B 3F9MA 5AQHA 4B1XB 2CGLA 4MDBA 4BRQA 3BUZB 1K8AO 2IVNA 4YDUA 3ZX0A 3QBXA 3EE9A 3WT0A 1HUXA 3ZEUB 2C1IA 3LM9A 1GLDG 1SS6A 5F0XA 1GLCG 3P4IA 3KZBA 3L4IA 4RTFD 2Q2RA 1YJNN 3I8BA 4BRHA 4DKWA 2VCPA 4BRAA 3VEXA 3WXLA 5KPTA 3FZLA 1GLFO 5AQQA 1P8ZA 2OTJN 4JKEA 2FSJA 2ZF5O 3CIPA 4BC3A 2JWLA 1VQKN 1LOTB 1KC8O 5M1QA 3U4LA 2JWKA 1EO1A 1J6ZA 2E2NA 4CZMA 3G6EN 4BEBA 3H3NO 3OBWA 3UB5A 3ZEUA 1ATRA 3SAFA 4WQ4A 3HRGA 4IZ9A 2YI1A 3Q7BA 2ZJRL 1HPMA 1Z6RA 1KXPA 1C0GA 4A5BA 5F2RA 3CQYA 4BQLA 2CH6A 2P9KA 3IUCA 3QFPA 3VTIA 3F2KA 3K9KA 4NLBA 2YJFA 3D6RA 5BN9A 3CJ9A 3MX2A 1MA9B 4K42A 4PKIA 3GOIA 3VEOA 1NGBA 3WUHA 5JVGL 3ZX3A 3O9RA 5BPNA 3R3LA 4DHYA 3ZYYX 1M1KO 3O9UA 3JS6A 4CBWA 2KLAA 2I7PA 3ENBA 4ISFA 1C0FA 5AZJB 3VGMA 5C2FA 2P9SB 3H3OB 4IJAA 3CI5A 1JCFA 1GLJO 2V7ZA 4BC5A 4CZFA 1HKGA 5KPZA 5AQPA 4BRLA 3LDQA 1NGAA 3PIOL 3JXUA 3SBGA 2KHOA 1BA0A 1VAZA 1DGKN 2WC9A 3G4SN 3AAPA 1KQSM 2BH1A 3CJAA 1BO5O 4H5VA 3I56N 3T7ZA 4JKBA 4ISEA 4BRGA 4WFAL 3FZFA 1Z05A 3QICA 2QXLA 2IVOA 3CETA 4NO7A 1QZ6A 1T3VA 4BRPA 4Z94A 2NRXA 4AF1A 5AZJA 3CC2N 4KH6A 5AQZA 3QDKA 4K43A 1XC3A 1QZ5A 2EWSA 4H0PA 3I33A 5BR9A 1ATNA 5I9EB 5AQXA 2WFBA 4YOWA 4H5TA 2FXUA 3CHWA 4XH4A 4BRFA 1Q18A 4R79A 2W00A 1HLUA 2HMPA 4H0YB 4IDHA 5GAEP 2NRTA 4XEIA 1NGFA 4IJNA 2ASPA 1DKGD 3A5OC 5M1OA 1N8RO 4EHTA 4BRCA 2VYPA 3LM2A 3MN6A 3DXKB 4DB3A 4O8UA 2HBJA 3OW2M 1TYQA 5AQNA 2E1ZA 4FL9A 4IXCA 1T6CA 3AGRA 5AFUH 4FVUA 3R1XA 4FOIA 3VPZA 4A62A 1NMDA 4PL8A 4JK8A 3CJ7A 1YVNA 3TU5A 2ZWHA 3F5TA 3OBYA 4BE7B 3DXMB 1DT9A 1BG3A 4WYBA 3O08A 5ADXA 3VERA 5BN8A 4JKDA 2HSTA 2FF3B 3O80A 4FPBA 4QS9A 3VGKA 5JVHL 5C10A 3E1YA 3CCUN 3D2FB 3U9ZA 5BRHA 3E9OA 1OKJA 5GIOA 3DXKA 4A2BA 5EXWA 3EKUA 4GV9A 4B9QA 3MWTA 2J4RA 3HOSA 3I55N 3L4QA 5ADXH 1H1VA 3P38A 5BRDA 3S41A 4H0OA 3VEVA 4BG9A 1O13A 4BR0A 1U2VB 2NNWA 4U67L 1KAXA 1NBWA 5GIPA 2Q31A 4YOVA 1GLAG 3ID6A 3HTVA 4C1NI 3EZWA 4FWKA 1VQ9N 2GX9A 4L3QA 1NGEA 4KH4A 3CCRN 3CJCA 3W3DA 4B1YB 2GWJA 4BROA 5AQIA 3VESA 3U9DA 3D2FA 1VQMN 4FWNA 1KD1O 3GL1A 4E1JA 5JLFA 3VETA 2C1GA 2YHXA 1P90A 3CCVN 4IEEA 3N4QA 4XJXA 2A40A 2P9KB 4K25A 1YJWN 2D0PA 1QVGM 4JEPA 2ITMA 3ULEB 3E9PA 4H5NA 1U2VA 3AAQA 3HSCA 4O5FA 5EOYA 5BREA 2D0OA 1K8KB 2WUSA 1NGGA 3TSPA 3FLCO 5M1KA 3CPWM 4JKGB 2RE2A 4CD3A 3KVGA 2A5XA 1ILYA 4JKHA 3EE8A 4HWIA 1NWKA 5JMVA 5JICA 2A6AA 2OANA 4B1WB 2PFUA 5MLCQ 5KQ8A 3PIPL 1X3MA 4BQZA 3CCSN 3LDLA 5AQGA 3TTFA 4CZKA 3H1QA 3FFKB 3DJCA 2E1YA 1NGDA 4WQ5C 3NVKA 4H0VB 3ULEA 2VGMA 5HL7L 1ZXOA 5GADP 4H03B 1Q7YO 3MN7A 2P9IB 3P31A 4JN4A 3G25A 2P9LB 4BC4A 2P9PB 1K8KA 3EN9A 3IKMA 4BR4A 4WFNL 4JKGA 4CZGA 3KHYA 2HBKA 2P9UB 1XUPO 4CBXA 3KK7A 4FWRA 5HOOA 3FZHA 3RSEA 3UE5A 1Q86O 1MDUB 2QWMA 3D7EO 4KH5A 1YJ9N 1RGIA 4EIAA 3VF2A 3SAHA 3NMUA 3QMLA 3HI0A 1RFQA 3WQTA 4CZJA 2P9IA 3IFRA 4ILJA 2P9LA 4BGAA 2P9PA 3A0IX 1BUPA 3SMSA 4LC9B 2F7TA 4A5AA 1S72N 3MDQA 3MCPA 3FE1A 4JHDA 2E88A 5KPRA 2P9UA 3AY9A 5FPEA 1D4XA 1WOQA 3EKSA 4DCHA 2NLXA 3CF5L 4IOCL 2PBDA 1W2BM 5E26A 5TKYA 3CCJN 4YDUC 1KAYA 2NRWA 3G71N 1JCEA 1K73O 1TYQB 2ASOA 3EO3A 4JNEA 1NGCA 3WEEB 2P9NB 1GLEG 4BGBA 4UY8O 4IO9L 4JK7A 3SK3A 2W40A 2YCHA 3C0BA 3FZKA 3VEZA 4AM7A 5FPDA 4GV3A 2Q36A 3M1FA 1YF5L 3D2EB 4M63C 1RDWX 5AFUA 1YAGA 2RHKA 1QHAA 1SQKA 2FF6A 5AQSA 3R8EA 3O9QA 5AQKA 3MCAB 1BDGA 3M5RA 4H0XB 5AQFA 5EX5A 4WF9L 3ATUA 3MX5A 1NGHA 5M1FA 1XQSC 2ZJQL 4J8FA 2H3GX 1W97L 4JKFA 1VQPN 1IJJA 3QBWA 5GAHP 3HBTA 4KBOA 3O9SA 3L6QA 5GINA 3CMAN 3M6GA 2Q0RA 2YHYA 3Q7CA 3WEEA 2GTDA 2P9NA 3E9LA 4H5WA 3H6EA 5CE3A 3GE1A 4XH5A 4GY2B 2A41A 4C23A 5AQJA 3D2EA 1V4SA 3B8AX 4MLHA 1X3NA 3KWIA 4FWLA 5BPMA 2AP1A 4IWVA 2HBMA 3PLAA 5C0YA 2CGKA 2NZTA 3BEXA 1NGIA 2E2OA 2E8AA 3FR0A 3LL3A 4PKHA 1YHQN 2BTFA 4BRMA 3WXKA 3VGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QW9 A;  2A42 A;  4BR9 A;  4PKG A;  4AM6 A;  4MLE A;  1MWK A;  1DEJ A;  1QQO A;  2DPN A;  5AQU A;  2AA4 A;  4BG8 A;  2D1K A;  3BP8 A;  1V4T A;  3A5L C;  2BUP A;  3ZET B;  1T44 A;  4CZI A;  4HTL A;  1Y64 A;  1E4G T;  5AQM A;  1IG8 A;  5E84 A;  2ZGZ A;  1YXQ A;  3HZ6 A;  5AZI A;  4MO5 A;  1ESV A;  2E20 A;  5AQW A;  4FWO A;  3BF1 A;  4I6M B;  3RSE B;  2GEM A;  3VEY A;  4EAH D;  2HOE A;  3QFU A;  1HX1 A;  3R9P A;  1G99 A;  3HM8 A;  3ZET A;  3IMX A;  1NLV A;  3WQU A;  2F9T A;  4CD1 A;  3MN9 A;  3ID8 A;  3UKU B;  4BRK A;  2QWP A;  3O6W A;  1QQN A;  4BVP A;  5LJV A;  3QB0 A;  4B1U B;  3SLC A;  4B1Z A;  1ZC6 A;  4BRD A;  4JAX A;  3LDP A;  4GNI A;  2A3Z A;  2QWO A;  3O4W A;  3UKR A;  3CJ1 A;  4FWS A;  4JHD B;  4BR2 A;  5FPM A;  1TUU A;  3GG4 A;  3O5B A;  4I6M A;  4CI6 A;  1MWM A;  1NGJ A;  4FPA A;  3MMV A;  1R59 O;  3H46 O;  4CZH A;  5FPN A;  3GBT A;  4QS8 A;  3WXJ A;  2GUP A;  1LCU A;  4EHU A;  3U8X A;  3UKU A;  3VF4 A;  3MN5 A;  1SZ2 A;  4FWQ A;  4A2A A;  4PL7 A;  2ASM A;  3ENO A;  5AR0 A;  2NRH A;  3J8A A;  2YJE A;  3W0L A;  3ZX2 A;  4BRE A;  3TPQ A;  2Q1N A;  5AQR A;  1BA1 A;  1S3X A;  2QM1 A;  5LJW A;  4BVO A;  3R6M A;  5KQD A;  2I7N A;  4FWM A;  1E4F T;  4BRN A;  3H1V X;  4CBU A;  3LDO A;  2V7Y A;  1NM1 A;  2E2P A;  4M7X A;  4QS7 A;  3VEW A;  1KAZ A;  4DQ8 A;  2QWQ A;  2UYT A;  4EFH A;  3VF6 A;  3VOV A;  5BPL A;  2HF4 A;  4BRI A;  3DAW A;  3MK6 A;  1TUY A;  2IVP A;  4BR5 A;  5LY3 A;  3CJB A;  2VWB A;  3A5M C;  2CH5 A;  3LDN A;  4K41 A;  5AQL A;  2CGJ A;  4IO8 A;  2QWN A;  2V51 B;  5EVZ A;  5ELZ A;  2P9S A;  2ZGY A;  4MO4 A;  4BC2 A;  4WQ4 C;  3H45 C;  4O8K A;  4RCH A;  1U6Z A;  1GLB G;  3C7N B;  5EY4 A;  3ATV A;  4H5R A;  4F9O A;  4BR7 A;  5BRF A;  5JLH A;  3ENH A;  3VEN A;  3O1W A;  1HKC A;  4M7Y A;  3CER A;  2GWK A;  3FZM A;  2FSK A;  1EQY A;  1BWF O;  3CQX A;  4XH1 A;  4RWT A;  2HF3 A;  4JD2 B;  5AQV A;  2E2Q A;  2IIR A;  3A5N C;  4FOE A;  2D4W A;  2YHW A;  1BU6 O;  1X9J A;  2FSN A;  3WXI A;  4CZE A;  2Q0U A;  1QQM A;  2W41 A;  2Q97 A;  4FO0 A;  4WQ5 A;  2F9W A;  5AQT A;  4B1V A;  1CZA N;  3A8Y A;  3BF3 A;  1ZBS A;  3M3Z A;  3C7N A;  1WUA A;  4ISG A;  3SMP A;  3IDH A;  1HKB A;  5AQY A;  2QWR A;  3EL2 A;  5F1X A;  2QWL A;  4FSV A;  1ATS A;  4NB4 A;  2GEL A;  1T6D A;  5AZI B;  4JD2 A;  1HJO A;  3DWL A;  3O8M A;  4Y0W A;  1BOT O;  3SJH A;  4CZL A;  3L0Q A;  3GDQ A;  1S22 A;  2PAV A;  4FWP A;  1YUW A;  1JCG A;  3FGU A;  3OHR A;  2FLO A;  4A61 A;  3AAR A;  3O1B A;  5AQO A;  4CJ7 A;  5B8H A;  3DXM A;  4H0T B;  3UKR B;  1GLL O;  1SAZ A;  2V52 B;  3F9M A;  5AQH A;  4B1X B;  2CGL A;  4BRQ A;  3BUZ B;  2IVN A;  4YDU A;  3ZX0 A;  3QBX A;  3WT0 A;  1HUX A;  3ZEU B;  3LM9 A;  1GLD G;  5F0X A;  1GLC G;  3P4I A;  3KZB A;  3L4I A;  4RTF D;  2Q2R A;  3I8B A;  4BRH A;  2VCP A;  4BRA A;  3VEX A;  3WXL A;  5KPT A;  3FZL A;  1GLF O;  5AQQ A;  1P8Z A;  2FSJ A;  2ZF5 O;  3CIP A;  4BC3 A;  1LOT B;  3U4L A;  1J6Z A;  2E2N A;  4CZM A;  3H3N O;  3UB5 A;  3ZEU A;  1ATR A;  4WQ4 A;  4IZ9 A;  2YI1 A;  1HPM A;  1Z6R A;  1KXP A;  1C0G A;  5F2R A;  3CQY A;  4BQL A;  2CH6 A;  2P9K A;  3IUC A;  3QFP A;  2YJF A;  5BN9 A;  3CJ9 A;  4K42 A;  1MA9 B;  4PKI A;  3VEO A;  3GOI A;  3WUH A;  1NGB A;  3ZX3 A;  5BPN A;  4DHY A;  3JS6 A;  4CBW A;  2I7P A;  4ISF A;  5AZJ B;  1C0F A;  3VGM A;  2P9S B;  3H3O B;  4IJA A;  3CI5 A;  1JCF A;  1GLJ O;  2V7Z A;  4BC5 A;  4CZF A;  1HKG A;  5KPZ A;  5AQP A;  4BRL A;  3LDQ A;  1NGA A;  3JXU A;  2KHO A;  1BA0 A;  1DGK N;  3AAP A;  3CJA A;  1BO5 O;  4H5V A;  4BRG A;  4ISE A;  3FZF A;  1Z05 A;  3QIC A;  2QXL A;  2IVO A;  3CET A;  4NO7 A;  1QZ6 A;  4Z94 A;  4BRP A;  5AZJ A;  5AQZ A;  3QDK A;  4K43 A;  1XC3 A;  1QZ5 A;  2EWS A;  4H0P A;  3I33 A;  5BR9 A;  1ATN A;  5I9E B;  5AQX A;  4H5T A;  2FXU A;  3CHW A;  4XH4 A;  4BRF A;  1Q18 A;  1HLU A;  2HMP A;  4H0Y B;  4XEI A;  1NGF A;  4IJN A;  2ASP A;  1DKG D;  3A5O C;  4EHT A;  4BRC A;  2VYP A;  3LM2 A;  3MN6 A;  3DXK B;  4DB3 A;  1TYQ A;  5AQN A;  2E1Z A;  4FL9 A;  4IXC A;  1T6C A;  5AFU H;  4FOI A;  3VPZ A;  4A62 A;  1NMD A;  4PL8 A;  3CJ7 A;  1YVN A;  3TU5 A;  2ZWH A;  3DXM B;  1BG3 A;  4WYB A;  3O08 A;  5ADX A;  3VER A;  5BN8 A;  2FF3 B;  3O80 A;  4FPB A;  4QS9 A;  3VGK A;  3D2F B;  3U9Z A;  5BRH A;  1OKJ A;  3DXK A;  4A2B A;  5EXW A;  3EKU A;  4B9Q A;  2J4R A;  5ADX H;  1H1V A;  5BRD A;  3S41 A;  4H0O A;  3VEV A;  4BG9 A;  4BR0 A;  1U2V B;  1KAX A;  1NBW A;  2Q31 A;  1GLA G;  3HTV A;  3EZW A;  4FWK A;  4L3Q A;  1NGE A;  3CJC A;  3W3D A;  4B1Y B;  2GWJ A;  4BRO A;  5AQI A;  3VES A;  3U9D A;  3D2F A;  4FWN A;  3GL1 A;  4E1J A;  5JLF A;  3VET A;  2YHX A;  2A40 A;  2P9K B;  4K25 A;  2D0P A;  2ITM A;  3ULE B;  4H5N A;  1U2V A;  3AAQ A;  3HSC A;  4O5F A;  5EOY A;  5BRE A;  2D0O A;  1K8K B;  2WUS A;  1NGG A;  3FLC O;  4CD3 A;  3KVG A;  2A5X A;  4HWI A;  1NWK A;  5JMV A;  5JIC A;  2A6A A;  2OAN A;  4B1W B;  5KQ8 A;  1X3M A;  4BQZ A;  3LDL A;  5AQG A;  4CZK A;  3H1Q A;  3FFK B;  3DJC A;  2E1Y A;  1NGD A;  4WQ5 C;  4H0V B;  3ULE A;  1ZXO A;  4H03 B;  3MN7 A;  2P9I B;  4JN4 A;  3G25 A;  2P9L B;  4BC4 A;  2P9P B;  1K8K A;  3EN9 A;  4BR4 A;  4CZG A;  3KHY A;  2P9U B;  1XUP O;  4CBX A;  4FWR A;  3FZH A;  3RSE A;  3UE5 A;  1MDU B;  2QWM A;  3D7E O;  1RGI A;  4EIA A;  3VF2 A;  3QML A;  3HI0 A;  1RFQ A;  3WQT A;  4CZJ A;  2P9I A;  3IFR A;  2P9L A;  4BGA A;  2P9P A;  3A0I X;  1BUP A;  3SMS A;  4LC9 B;  3MDQ A;  3MCP A;  3FE1 A;  4JHD A;  2E88 A;  5KPR A;  2P9U A;  3AY9 A;  5FPE A;  1D4X A;  1WOQ A;  3EKS A;  4DCH A;  2NLX A;  2PBD A;  5E26 A;  5TKY A;  4YDU C;  1KAY A;  1JCE A;  1TYQ B;  2ASO A;  3EO3 A;  4JNE A;  1NGC A;  3WEE B;  2P9N B;  1GLE G;  4BGB A;  3SK3 A;  2W40 A;  2YCH A;  3C0B A;  3FZK A;  3VEZ A;  4AM7 A;  5FPD A;  2Q36 A;  3M1F A;  3D2E B;  4M63 C;  1RDW X;  5AFU A;  1YAG A;  1QHA A;  1SQK A;  2FF6 A;  5AQS A;  3R8E A;  5AQK A;  1BDG A;  4H0X B;  5AQF A;  5EX5 A;  3ATU A;  1NGH A;  1XQS C;  4J8F A;  2H3G X;  1IJJ A;  3QBW A;  3HBT A;  4KBO A;  3L6Q A;  3M6G A;  2Q0R A;  2YHY A;  3WEE A;  2GTD A;  2P9N A;  4H5W A;  3H6E A;  5CE3 A;  3GE1 A;  4XH5 A;  4GY2 B;  2A41 A;  4C23 A;  5AQJ A;  3D2E A;  1V4S A;  3B8A X;  4MLH A;  1X3N A;  4FWL A;  5BPM A;  2AP1 A;  4IWV A;  2CGK A;  2NZT A;  3BEX A;  1NGI A;  2E2O A;  2E8A A;  3FR0 A;  3LL3 A;  4PKH A;  2BTF A;  4BRM A;  3WXK A;  3VGL A; 
#chains in the Genus database with same CATH topology
 4JK9 A;  4ID1 A;  4NCG A;  2QXF A;  3NVM A;  3VQC A;  3TAQ A;  4DSJ A;  4PKG A;  1WAF A;  1HNW K;  4JKC A;  3O4Q A;  4OLB A;  1DEJ A;  1HNZ K;  2AA4 A;  1SKR A;  4BE0 A;  5M1P A;  1Q82 O;  2D1K A;  3ZT1 A;  1KFS A;  3VQE A;  3J80 O;  1YIJ N;  2UUC K;  2DY4 A;  3ZET B;  1T44 A;  4CZI A;  4K8X A;  4LF8 K;  3AA3 A;  1NJI O;  4HTL A;  4BEC A;  2B6A A;  5DM6 L;  3L2R A;  1YXQ A;  3IRX A;  1C1B A;  3CM6 A;  4MO5 A;  1ESV A;  2ZE2 A;  1NK6 A;  1IG9 A;  3RSE B;  2GEM A;  1RBV A;  4CJ4 A;  4HUF A;  1G99 A;  3TAB A;  4OGE A;  1IV0 A;  3TAG A;  4M45 A;  2F9T A;  4BRK A;  3UKU B;  2WON A;  1NJZ A;  1QQN A;  4BRD A;  1VQ6 N;  1JLC A;  4BR2 A;  4M3W A;  3MWP A;  4X66 K;  3N4P A;  3K59 A;  3THV A;  4CI6 A;  5DM7 L;  4OPA A;  3ASM A;  5M1N A;  3O3G A;  3H46 O;  4CZH A;  3GBT A;  4DV5 K;  1ZBH A;  5HRN A;  1RT5 A;  4DTO A;  1CZ9 A;  3L2V A;  3C6T A;  4PL7 A;  1U48 A;  2HB5 A;  3K9J A;  3SI6 A;  5AR0 A;  4M3U A;  3J8A A;  3TTC A;  5D3G A;  4BRE A;  4J2E A;  5IT9 O;  1BA1 A;  4DF8 A;  2QM1 A;  4J2B A;  2HHX A;  2KW4 A;  5H1S Q;  4CHQ A;  2E2P A;  4TSX A;  3VOV A;  3CPE A;  5BPL A;  4ZTJ A;  4A59 A;  2KKZ A;  3MK6 A;  4CJT A;  4WCE L;  4KI6 A;  2CH5 A;  1L3U A;  3MED A;  4DQS A;  1EWR A;  4IO8 A;  3QEI A;  4G9Z A;  4PHT X;  2UXD K;  1VQ7 N;  1VSF A;  2ZGY A;  4PA1 A;  4FK2 A;  1TGO A;  4H4M A;  3H08 A;  4FM0 A;  3TAP A;  5EY4 A;  3K5L A;  4BR7 A;  3C6A A;  4CGH A;  3ENH A;  1I3A A;  3O1W A;  2GWK A;  1JLF A;  1EQY A;  3CQX A;  1BWF O;  3EEQ A;  2E2Q A;  2HBL A;  2YHW A;  1UA0 A;  1FJG K;  4CK2 A;  2F9W A;  1YIT N;  3CCE N;  3C7N A;  4IFY A;  3K5N A;  4IFE A;  5J2N A;  1TK8 A;  3EL2 A;  2QWL A;  1ATS A;  1L3S A;  1T6D A;  3HP9 A;  3CXC M;  4YOR A;  3MXI A;  1BOT O;  2RKI A;  2IGI A;  1YI2 N;  3AVG A;  4CGI A;  1S22 A;  1ZBF A;  1JKH A;  2O8C A;  4GV6 A;  1JCG A;  1SL0 A;  2FLO A;  3AAR A;  2VGN A;  2QA4 N;  4DQI A;  4B08 A;  3TAN A;  3BUZ B;  4JI3 K;  4DR3 K;  4AHT A;  1ASW A;  3V1Q A;  4FM1 A;  1SS6 A;  5J2P A;  4F4K A;  4DV0 K;  1GLC G;  3I8D A;  3VA3 A;  1UA1 A;  1L5U A;  1GLF O;  4LH4 A;  1P8Z A;  2ZF5 O;  3QIN A;  3U4L A;  5CYM A;  4Z0U A;  3G6E N;  3UB5 A;  4B3O A;  3SAF A;  1EKE A;  4WQ4 A;  1KLM A;  1HPM A;  1Z6R A;  1S1X A;  4A5B A;  3VA0 A;  3THX B;  4B3M K;  3L3V A;  3K9K A;  4NLB A;  5CZ2 A;  5EU7 A;  3IS9 A;  4CIF A;  2XY5 A;  4M41 A;  1MA9 B;  3WUH A;  4DHY A;  4DTX A;  2KFZ A;  3HXM A;  3LWM A;  1ZBU A;  4M42 A;  3JS6 A;  2KLA A;  2I7P A;  1C0F A;  3VGM A;  4IJA A;  3CG7 A;  4IG3 A;  1VSH A;  5AQP A;  2XHB A;  4BRL A;  4YFU A;  3LDQ A;  1NGA A;  4X64 K;  2O8D B;  3JXU A;  2KHO A;  4LFB K;  1VAZ A;  1DGK N;  3MEE A;  3CJA A;  3I56 N;  1BO5 O;  3DLB A;  4JKB A;  1Z05 A;  3BZK A;  3OYL A;  3RMD A;  1ASV A;  5AZJ A;  3E01 A;  4KH6 A;  3D0P A;  4O5B A;  1Z26 A;  5BR8 K;  1ZBI A;  1XC3 A;  3HJF A;  2UXC K;  4I9Q A;  5AQX A;  3KK2 A;  4YOW A;  4Q0B A;  3CHW A;  3NBP A;  4DU4 A;  4BRF A;  4BWJ A;  1RCH A;  4CGG A;  3RTV A;  1JLG A;  1BI4 B;  3OS0 A;  3K58 A;  3HT3 A;  1MU2 A;  3V81 A;  3ZSR A;  2O8C B;  4CFC A;  3THW A;  2HBJ A;  3LP2 A;  3TAF A;  4I7F A;  4IXC A;  3AGR A;  1J54 A;  3KJV A;  3R1X A;  1NMD A;  4RW8 A;  2W6K A;  1DT9 A;  1BG3 A;  1S6Q A;  3O08 A;  3VER A;  3JAM O;  5BN8 A;  3EZ5 A;  3C94 A;  4KB1 A;  3O80 A;  4FPB A;  3VGK A;  1EXQ A;  5JVH L;  3E1Y A;  3CCU N;  3D2F B;  4JI6 K;  4FJL A;  4OX9 K;  3U9Z A;  1OKJ A;  3DXK A;  4DTS A;  3QNO A;  2DFF A;  1W9H A;  1TVR A;  4CJR A;  1RT7 A;  1LAW A;  4OJR A;  1S1T A;  3I55 N;  5BRD A;  4QOZ B;  3VEV A;  4BR0 A;  2Q31 A;  4YOV A;  3V9X A;  4FLX A;  4O55 A;  1X1P A;  4FWK A;  1VQ9 N;  1KVA A;  4E7L A;  4BDZ A;  4FXD A;  4CIG A;  4B1Y B;  3AVK A;  3U9D A;  1VQM N;  3AVN A;  3PSF A;  3NFA A;  5FDL A;  1XC9 A;  2YHX A;  4F2S A;  4JYA K;  2UXB K;  4XJX A;  3AA2 A;  1JXB A;  1WSG A;  2ITM A;  3ULE B;  4CF9 A;  4M3T A;  1U2V A;  3DRS A;  4O5F A;  3OVN A;  4CJE A;  4YNQ A;  1NK9 A;  1K8K B;  1C0U A;  2WUS A;  5M1K A;  1KLN A;  2DFE A;  1X9S A;  1ILY A;  5JIC A;  2LSN A;  3HYF A;  4CHP A;  1VSK A;  1X3M A;  3BGR A;  3FFK B;  3DJC A;  4FZY A;  1Q7Y O;  2VGM A;  5KI6 A;  2P9I B;  3P31 A;  4JN4 A;  4BC4 A;  4CF1 A;  4CFA A;  4BR4 A;  4DTM A;  3KHY A;  2G8K A;  1XUP O;  3I0S A;  3FZH A;  2KZZ A;  4F2R A;  2QWM A;  1YJ9 N;  3SAH A;  3QML A;  3HI0 A;  1CZB A;  1RFQ A;  3WQT A;  4CZJ A;  1L3V A;  2P9L A;  4BGA A;  3A0I X;  1BUP A;  1W7A A;  4LC9 B;  1S72 N;  3MCP A;  2O8F A;  2P9U A;  1D4X A;  3CF5 L;  4IOC L;  2JGU A;  3KK3 A;  1S5J A;  4KHP K;  4CES A;  3EO3 A;  1RTI A;  4HUG A;  3WEE B;  1NMN A;  4BGB A;  4UY8 O;  3B6P A;  4IO9 L;  2RF2 A;  3C0B A;  3FZK A;  4EP5 A;  2A1S A;  3VEZ A;  4GV3 A;  5HRS A;  3M1F A;  3OS2 A;  1TL3 A;  3KKS A;  4CJK A;  1SQK A;  2FF6 A;  4KV8 A;  4DV7 K;  5AQK A;  3MCA B;  4J2A A;  5AQF A;  5EX5 A;  3ATU A;  3MX5 A;  2ZJQ L;  4J8F A;  3OYE A;  1RTH A;  1WSH A;  5JEN A;  1NJX A;  3Q7C A;  3H6E A;  1FKO A;  5I42 A;  5CE3 A;  4C23 A;  5AQJ A;  3B8A X;  2R7Y A;  3KWI A;  4FWL A;  1RNH A;  3PLA A;  5C0Y A;  2CGK A;  3BEX A;  3FR0 A;  2UU9 K;  1S1V A;  4LF5 K;  4DLE A;  1XMQ K;  1K8A O;  4AH9 A;  3RRH A;  2QI2 A;  3L8B A;  4IFV A;  1MWK A;  4CEA A;  3RR7 A;  1S9E A;  2EHG A;  1QQO A;  2DPN A;  5AQU A;  4Q5V A;  3M8S A;  1V4T A;  3A5L C;  1VK0 A;  2ETJ A;  3EYZ A;  3SBT A;  1OH6 A;  3ZSV A;  2E5L K;  3K2P A;  4JS4 A;  3VQ5 A;  3HO1 A;  1Y64 A;  3V1R A;  3DLL L;  4N47 A;  1IG8 A;  2NRV A;  2P1J A;  2ZGZ A;  3HZ6 A;  4BAC A;  4E7I A;  3WXM B;  3NH1 A;  2A1R A;  4FWO A;  3QER A;  1Q81 O;  4I6M B;  3VEY A;  3DRR A;  2HOE A;  3QFU A;  3ZET A;  4CGF A;  4CJL A;  1YTA A;  1NLV A;  3WQU A;  4B9S A;  4O4G A;  4CD1 A;  3S3N A;  3ID8 A;  4IKF A;  1FKP A;  1J9A A;  4B1U B;  4BDY A;  3SLC A;  4B1Z A;  2OTJ N;  3V9S A;  4GNI A;  2A3Z A;  2FBT A;  1WN7 A;  1VQ5 N;  4DG1 A;  3NF7 A;  5FPM A;  3CME N;  3GG4 A;  2OCE A;  1JJ2 M;  3OYB A;  4B9N A;  1RT3 A;  3MMV A;  3OYC A;  3LAN A;  1N34 K;  4FJJ A;  4DV3 K;  3WXJ A;  4CK1 A;  4HCB A;  5J2M A;  4OVL A;  1HNV A;  2QTD A;  4EHU A;  3UKU A;  3VF4 A;  1SZ2 A;  4FWQ A;  3HPH A;  3VQA A;  4JLH A;  2ASM A;  1BIZ A;  2KTQ A;  1T8E A;  2YHB A;  3NH2 A;  4FCY A;  2W6L A;  3AVB A;  4DR5 K;  2Q1N A;  4JI8 K;  4BVO A;  4IOA L;  3ZSX A;  1QQC A;  1E4F T;  4NXM K;  1KVC A;  5J1E A;  2V7Y A;  4IBN A;  1JLQ A;  4CK3 A;  1VSJ A;  3VQ4 A;  4EFH A;  3SAG A;  3VQ8 A;  2HF4 A;  3QNN A;  4C8K A;  1Q8I A;  4NCA A;  1NOY A;  2O8B A;  4UQG A;  1FK9 A;  4Z4C A;  1N33 K;  4FM2 A;  2P9S A;  2D0C A;  3P39 A;  5C42 A;  3JYT A;  4BC2 A;  2ZD1 A;  4WQ4 C;  4DF4 A;  5FRN A;  1W0H A;  1GOB A;  3TSU A;  1REV A;  5LL6 Z;  5BRF A;  4OPH A;  3WNF A;  4AHU A;  4KHS A;  4R5P A;  4M7Y A;  2IDO A;  5CR4 A;  3F73 A;  2FSK A;  4JD2 B;  4YHH K;  2IIR A;  3AA4 A;  4CEE A;  2D4W A;  3V9Z A;  4YOY A;  2FSN A;  3WXI A;  3BDP A;  1K6Y A;  4FO0 A;  1EET A;  3A8Y A;  3M3Z A;  2QKK A;  2F8T A;  4KHW A;  1B9D A;  1HKB A;  5AQY A;  3BZC A;  5F1X A;  2PYL A;  4B8A B;  4YOU A;  3TTD A;  4OKJ A;  1J5O A;  1K9M O;  2O8E A;  3CCL N;  3RVC A;  3GDQ A;  5C15 A;  4CHO A;  1VSI A;  3AGK A;  1I39 A;  3B6O A;  4A61 A;  3J7Z O;  3SQ4 A;  4N76 A;  4FLW A;  3NGZ A;  1JLB A;  1I94 K;  1S6P A;  1VQN N;  1M90 O;  5B8H A;  4E7K A;  3DXM A;  4B1X B;  1GLL O;  4BRQ A;  4FJ9 A;  1BGX T;  2CGL A;  4MDB A;  2IVN A;  1QSL A;  3QBX A;  3EE9 A;  2C1I A;  1GLD G;  4Z4I A;  3KZB A;  4RTF D;  4DKW A;  4BRH A;  3M8P A;  1VSM A;  1S1U A;  4LSN A;  1JXE A;  3WXL A;  5A2Q O;  2ATQ A;  4BE1 A;  3U6F A;  5SWM A;  4ID5 A;  1D5A A;  4BC3 A;  4DTP A;  1NK4 A;  1VQK N;  1KC8 O;  1YVU A;  1J6Z A;  1SL1 A;  5KRT A;  1JL2 A;  4LF9 K;  3H3N O;  1C0M A;  1ATR A;  4CJF A;  4DFK A;  3S5T A;  3SV3 A;  3OYN A;  2YI1 A;  3Q7B A;  1C0G A;  1TL1 A;  4FLV A;  5F2R A;  4FYD A;  4BQL A;  4FK0 A;  2P9K A;  1UAX A;  3T19 A;  3F2K A;  3D6R A;  4LSL A;  5BN9 A;  1RBU A;  1HJR A;  3MX2 A;  4PKI A;  3OYM A;  3GOI A;  3NAE A;  5JVG L;  3O9R A;  5BPN A;  4HVJ A;  1WSJ A;  3QEW A;  4CBW A;  2O8B B;  2P9S B;  3H3O B;  4CFB A;  4C8O A;  3CI5 A;  1IBK K;  3THX A;  4KB0 A;  1C1C A;  2PYJ A;  5KRS A;  5KPZ A;  1QSS A;  1QSY A;  1BA0 A;  3OYJ A;  1A5W A;  3G4S N;  3OYD A;  4H5V A;  4QAG A;  2NUB A;  2EX3 A;  4ISE A;  4WFA L;  1HR0 K;  4B9V A;  3FZF A;  3QIC A;  1LWC A;  3CET A;  4NO7 A;  1QZ6 A;  1T3V A;  3CC2 N;  4AF1 A;  4DR4 K;  3QDK A;  4K43 A;  3QEV A;  1HQU A;  2D0A A;  1JL1 A;  1QZ5 A;  1T7P A;  3I33 A;  3SPY A;  2O8D A;  3AO1 A;  4H5T A;  2B4J A;  2FXU A;  2QKB A;  4C8N A;  1L3T A;  1NJY A;  3K57 A;  4R79 A;  2O8E B;  2W00 A;  4RW4 A;  4KTQ A;  4IDH A;  5GAE P;  2NRT A;  3CFR A;  1R0A A;  3KLI A;  5E41 A;  4BRC A;  3O3F A;  4OGC A;  4O8U A;  4M3R A;  3OW2 M;  1RIL A;  4FL9 A;  2OZS A;  4E89 A;  1T6C A;  4CIE A;  4FVU A;  4B9T A;  1J53 A;  3SUQ A;  4M3Z A;  1YVN A;  2ZWH A;  4BE7 B;  3DXM B;  2F96 A;  1LV5 A;  1BI4 A;  4JKD A;  3V6D A;  2HST A;  4FK4 A;  3KD5 E;  2FF3 B;  3ZT2 A;  5C10 A;  4CCH A;  3SQ0 A;  1YT3 A;  5BRH A;  3E9O A;  1U04 A;  4B9Q A;  3KK1 A;  2J4R A;  3C95 A;  3HOS A;  3L4Q A;  3P38 A;  1QHT A;  2FBV A;  4U67 L;  5GIP A;  4DTN A;  5FLX O;  4CER A;  3HTV A;  3KTQ A;  4KTW A;  3AVH A;  2GX9 A;  1NGE A;  3CJC A;  3ZLJ A;  3W3D A;  4BRO A;  5AQI A;  5JS1 A;  3D2F A;  2Z1J A;  1VRT A;  4FWN A;  1KD1 O;  4KHY A;  3GL1 A;  3WNH A;  4DLG A;  2C1G A;  3T1H K;  3CCV N;  5HRO A;  3U3G A;  2P9K B;  4K25 A;  1QVG M;  2Z1I A;  3E9P A;  4H5N A;  3OTO K;  3AAQ A;  5EOY A;  5BRE A;  3FLC O;  4DR7 K;  2RE2 A;  1A5X A;  5JMV A;  2A6A A;  3NF8 A;  3AO3 A;  2WTU A;  2G8I A;  1D9D A;  4CJ3 A;  4B3T K;  3AVC A;  3M8R A;  5AQG A;  3TTF A;  4CZK A;  3NVK A;  4WQ5 C;  3ULE A;  1RBT A;  1ZXO A;  2P9P B;  1K8K A;  4WFN L;  4CZG A;  4M3X A;  4CGJ A;  4AHR A;  3AO4 A;  1X9M A;  2GUI A;  4RG8 A;  3UIQ A;  4DQP A;  5HRP A;  3UE5 A;  3HP6 A;  1NK7 A;  1Q86 O;  4EIA A;  2VWK A;  1OVQ A;  1RDC A;  1SV5 A;  2P9I A;  3SMS A;  2VG7 A;  3FE1 A;  4JHD A;  2E88 A;  3PV8 A;  3I0R A;  3AY9 A;  5C24 A;  4DCH A;  4GW6 A;  1TAQ A;  2PBD A;  4O0I A;  1W2B M;  4YDU C;  2NRW A;  2E6M A;  3G71 N;  4E3S A;  2ASO A;  1BIU A;  1NGC A;  4AHS A;  2P51 A;  4DR6 K;  1GLE G;  4FJ8 A;  2YCH A;  4LH5 A;  4CFD A;  2KQ2 A;  1YF5 L;  5AFU A;  1NOZ A;  2XY6 A;  1YAG A;  2RHK A;  3OYI A;  3R8E A;  4LF7 K;  3O9Q A;  4H0X B;  3AVA A;  1Z25 A;  3M5R A;  2BDP A;  3FFI A;  3D45 A;  2H3G X;  1TV6 A;  1W97 L;  1VQP N;  3QBW A;  5GAH P;  4Z4F A;  5KGX A;  3MEG A;  5GIN A;  3CMA N;  3M6G A;  3WEE A;  4FJI A;  3PX0 A;  4XH5 A;  2A41 A;  4CED A;  4JI0 K;  4JRP A;  2HHI A;  4MLH A;  4B9L A;  3L2Q A;  4E0D A;  5BPM A;  2AP1 A;  4IWV A;  1XHZ A;  2HBM A;  2NZT A;  4NYF A;  1NGI A;  4PKH A;  3ZSO A;  2OYQ A;  3S3M A;  3VGL A;  1WAJ A;  2G8H A;  3V9W A;  3ZSY A;  1G15 A;  2VG6 A;  4DWI A;  4OPK A;  1OVY A;  4BG8 A;  4B8C A;  2XY7 A;  2BUP A;  4CEB A;  2FC0 A;  3AV9 A;  3LAM A;  4MFB A;  4YOT A;  1TK5 A;  1E4G T;  3SCX A;  1XNQ K;  3CD6 N;  5C12 A;  3O3H A;  5AZI A;  4DFJ A;  4O0J A;  3E66 A;  4IOX A;  2E20 A;  3QIP A;  2IC3 A;  3BF1 A;  4FLU A;  4EAH D;  1RT4 A;  4KHN A;  3AVJ A;  3R9P A;  3IMX A;  4CVN E;  4PQU A;  1EP4 A;  2O4G A;  4FW2 A;  3MN9 A;  2KFN A;  1KVB A;  3QB0 A;  3LWL A;  1ZC6 A;  3BY5 A;  4JAX A;  3LDP A;  2YX6 A;  5TKW A;  1U45 A;  2QWO A;  1C1A A;  3O4W A;  4CJ5 A;  3CJ1 A;  4FJ5 A;  4W5Q A;  5J2Q A;  4JHD B;  2YNF A;  1TUU A;  3TSQ A;  4JKA A;  4I6M A;  1TKZ A;  4FPA A;  1R59 O;  1ZBL A;  4DSI A;  3KWG A;  3U3Y A;  2GUP A;  3ZSW A;  5T7B A;  1VSD A;  3CC7 N;  3U8X A;  3MN5 A;  2OPQ A;  4A2A A;  3DRP A;  3ENO A;  4Z4H A;  2NRH A;  3W0L A;  2YJE A;  4EZ9 A;  4JI4 K;  3OYA A;  3TPQ A;  5AQR A;  1S3X A;  2NRR A;  3R6M A;  5KQD A;  4KAZ A;  4KKO A;  3PO5 A;  2NRZ A;  4CBU A;  3KLG A;  1VQ4 N;  1NM1 A;  2OTL N;  3LP3 A;  4M7X A;  4DTR A;  1KAZ A;  4DQ8 A;  2UYT A;  3VF6 A;  3ISN C;  3DAW A;  4BR5 A;  4DV4 K;  5LY3 A;  3CJB A;  3LDN A;  4K41 A;  5AQL A;  2CGJ A;  2QWN A;  2V51 B;  1JLA A;  5EVZ A;  3VTH A;  2HHQ A;  5ELZ A;  2WBN A;  2E6L A;  3IAY A;  4MO4 A;  1FW6 A;  2HVH A;  3H45 C;  4WFB L;  3SJJ A;  3HK2 A;  3OJU A;  3ATV A;  4H5R A;  4LF4 K;  3QLH A;  3VEN A;  3O9T A;  4HHT A;  3CER A;  3FZM A;  2HF3 A;  3NDK A;  3HL8 A;  4XIU A;  4FOE A;  2FBX A;  3SZ2 A;  1BU6 O;  3KIO A;  4CEC A;  3L2W A;  4CZE A;  2Q0U A;  1QQM A;  2ZJP L;  4KI4 A;  2AJQ A;  2W41 A;  4W5R A;  2Q97 A;  1BIS A;  4WQ5 A;  3TWH A;  2Q3S A;  3BF3 A;  3QO9 A;  1ZBS A;  4OO1 J;  4ISG A;  4C8L A;  3SMP A;  2YKN A;  3SV4 A;  3LDS A;  4FSV A;  2GEL A;  5AZI B;  4K0K K;  5CHI A;  4JD2 A;  4W5O A;  3DWL A;  4Y0W A;  1TKX A;  5FRO A;  2HHW A;  4DUZ K;  3L0Q A;  3SUP A;  2PY5 A;  4FWP A;  3DLE A;  1YUW A;  3OHR A;  3O1B A;  2B5J A;  5AQO A;  4M3Y A;  4E7H A;  4N56 A;  3WNG A;  3CCQ N;  3HPG A;  4H0T B;  5DK5 A;  1WSF A;  1N32 K;  4YDU A;  3WT0 A;  2P5G A;  3ZEU B;  3ITH A;  5F0X A;  4JV5 K;  3P4I A;  3WNE A;  2Q2R A;  1EWQ A;  3I8B A;  1NK0 A;  1DTT A;  1N5Y A;  2VCP A;  5KTQ A;  4BRA A;  3VEX A;  3FZL A;  3KKR A;  2FSJ A;  3CIP A;  1ITG A;  3ZCM A;  2JWL A;  1RBS A;  3LPT A;  1EO1 A;  4DTJ A;  4H4O A;  4DUY K;  4BEB A;  3SUN A;  3OBW A;  3MXM A;  1RT1 A;  1BQM A;  3HRG A;  4JI2 K;  1HNI A;  1IH7 A;  3NF6 A;  3ZSZ A;  1DTQ A;  2CH6 A;  3IUC A;  3QFP A;  1FXX A;  4BDP A;  2YJF A;  3CJ9 A;  4CHZ A;  2XO7 A;  3OYF A;  3VEO A;  4LD0 A;  2D0B A;  3RMA A;  3R3L A;  2YKM A;  3CQ8 A;  3ZYY X;  1M1K O;  3O9U A;  1HYS A;  3ZSQ A;  1EX4 A;  3ENB A;  4WE1 A;  4BC5 A;  1HKG A;  2G8W A;  2WC9 A;  2YNH A;  4B9M A;  1KQS M;  4JI7 K;  3LAK A;  4FLY A;  4BRG A;  4Y1D A;  3QET A;  5GAD P;  2QXL A;  2IVO A;  4GMJ B;  4CEZ A;  2Z1G A;  1F21 A;  4CJS A;  2E4L A;  4DFP A;  3THY B;  4DS5 A;  4H0P A;  4YY3 K;  1ATN A;  4JRQ A;  4CEF A;  1RTD A;  4B9U A;  1SKS A;  4EP4 A;  1Q18 A;  1C6V A;  1HLU A;  2HMP A;  4H0Y B;  1KCF A;  4XEI A;  2ASP A;  1OH5 A;  3A5O C;  5M1O A;  1N8R O;  1KRP A;  1KTQ A;  2VYP A;  3LAL A;  3LM2 A;  3MN6 A;  3V1O A;  4DB3 A;  4DSF A;  2XY8 A;  2E1Z A;  5AQN A;  3SUO A;  4W5N A;  4LFC K;  1GOA A;  4N41 A;  3VPZ A;  2RN2 A;  4PL8 A;  3TI0 A;  4JK8 A;  4W5T A;  3LP1 A;  2YV0 X;  3F5T A;  3OBY A;  4WYB A;  1YTU A;  4J2D A;  3HVT A;  3AA5 X;  2BAN A;  4DSK A;  2VG5 A;  3J81 O;  4CJU A;  4A2B A;  5EXW A;  3EKU A;  4H8K A;  3RMB A;  3MWT A;  1SUQ A;  3PSI A;  5ADX H;  1H1V A;  1IKW A;  1S9G A;  4H0O A;  3S41 A;  4BG9 A;  2NNW A;  1HYZ A;  1NBW A;  1OH7 A;  1GLA G;  3EZW A;  4PWD A;  3VQ9 A;  4DSE A;  4KH4 A;  3CCR N;  1WB9 A;  5FRM A;  1RDB A;  4FJG A;  4ELU A;  1TKT A;  4E1J A;  1XWL A;  3DOL A;  4IEE A;  4RW9 A;  1YJW N;  2D0P A;  3AVL A;  4JEP A;  4KFB A;  3HSC A;  2D0O A;  3QEP A;  2G8V A;  3CPW M;  3TSP A;  4JKG B;  5LMN K;  3KVG A;  2F4V K;  1KFD A;  4JKH A;  3EE8 A;  3LP0 A;  3PY8 A;  2OAN A;  4F3O A;  4B1W B;  1E3M A;  4CF8 A;  1Q9X A;  3M8Q A;  4ZHR A;  4BQZ A;  3CCS N;  4X62 K;  3H1Q A;  4GKK K;  3K5M A;  4H0V B;  4H03 B;  1N6Q A;  3G25 A;  1D8Y A;  3ULD A;  2I5J A;  1C0T A;  3CFO A;  2HBK A;  1O1W A;  2GBZ A;  4FWR A;  2F8S A;  1QE1 A;  5HBM A;  1MDU B;  1U49 A;  3VF2 A;  3VQ6 A;  4CE9 A;  1NKE A;  3K0S A;  1NU0 A;  1HYV A;  2JLE A;  4ILJ A;  3AVF A;  2P9P A;  4HUE A;  3MDQ A;  5KPR A;  1WOQ A;  1JLE A;  4V19 S;  3CCJ N;  3CYG A;  1JCE A;  3L3U A;  4F3T A;  3RWU A;  1LWE A;  2P9N B;  4FJ7 A;  3OYH A;  4JK7 A;  1BCO A;  4AM7 A;  3NGY A;  3LZI A;  3D2E B;  2Z1H A;  1RDW X;  3SNN A;  1QHA A;  3NE6 A;  4WF9 L;  4DTU A;  3VQB A;  2IS3 A;  1NG9 A;  1XHX A;  1NGH A;  4IDK A;  5M1F A;  1IJJ A;  3HBT A;  2Q0R A;  3AVI A;  3DLK A;  1U4B A;  2GTD A;  4KHU A;  3JSM A;  3GE1 A;  1DLO A;  4HTU A;  4GY2 B;  4AHC A;  1J5E K;  4BWM A;  4CJW A;  2PZS A;  3TAE A;  1NK8 A;  1LW0 A;  1YHQ N;  2E2O A;  2E8A A;  3TAM A;  1X9W A;  4BRM A;  3ZT4 A;  5C25 A;  4DFM A;  3HOT A;  1LW2 A;  1VRU A;  4I9L A;  2QW9 A;  2A42 A;  5C2D A;  4BR9 A;  2YNI A;  3VQ7 A;  4AM6 A;  4CGD A;  2KZM A;  4MLE A;  5KGW A;  4DV6 K;  3DOK A;  2VQF K;  2HNY A;  4NXN K;  2BE2 A;  2HHS A;  4B3S K;  3BP8 A;  4CF0 A;  1Y97 A;  3CFP A;  3P1G A;  4CJQ A;  1NK5 A;  5GAG P;  3OS1 A;  1IBL K;  5AQM A;  4ELT A;  2HHU A;  5HP1 A;  5E84 A;  4ILG B;  5JS2 A;  1HPZ A;  1QVF M;  1BHL A;  2QEX N;  4E19 A;  1S1W A;  1IKY A;  1SKW A;  3C6H A;  5AQW A;  1NJW A;  4AHV A;  3DM2 A;  3J7Y P;  4BY9 C;  1HX1 A;  3HM8 A;  4RW6 A;  3HVR A;  1RDD A;  3OA9 A;  2QWP A;  3O6W A;  4CW7 B;  3MAQ A;  4BVP A;  5LJV A;  1WBD A;  3IG1 A;  4CJP A;  4E72 A;  3C65 A;  4MDA A;  4L8R B;  3UKR A;  1TKD A;  4FWS A;  3OYG A;  3DI6 A;  1GOC A;  4NYN A;  3O5B A;  1BCM A;  1MWM A;  1NGJ A;  5FPN A;  1WSE A;  4QS8 A;  3NGI A;  4N5S A;  4IEI A;  1LCU A;  2X74 A;  3DMJ A;  4E1M A;  4U7B A;  3LPU A;  3OYK A;  3ZX2 A;  1NKC A;  4NLC A;  1IKV A;  3TR8 A;  1IBM K;  5LJW A;  2DTU A;  4DR2 K;  2OPP A;  4DQR A;  5HLF A;  2I7N A;  4E1N A;  4FWM A;  1VQO N;  2HMI A;  4DS4 A;  3G10 A;  4BRN A;  3H1V X;  1RTJ A;  3RMC A;  5CYQ A;  4FLT A;  3LDO A;  1QS4 A;  4GVM A;  2RPI A;  4QS7 A;  3VEW A;  1HMV A;  1RBR A;  2QWQ A;  5K14 A;  1RDU A;  4I2Q A;  4BRI A;  1TUY A;  2IVP A;  2VWB A;  3A5M C;  3TAR A;  3G0Z A;  3CC4 N;  4LF6 K;  2X78 A;  3V4I A;  1WSI A;  2DFH A;  3CCM N;  4C1N K;  4ILH A;  1HQE A;  1WNS A;  3AVM A;  4O8K A;  1U6Z A;  4RCH A;  1GLB G;  3C7N B;  5CY4 A;  4KRE A;  4F9O A;  5JLH A;  4DU3 A;  1HKC A;  4RWT A;  4XH1 A;  4B3R K;  5AQV A;  3A5N C;  3DLR A;  1VQ8 N;  3OJS A;  1X9J A;  4X65 K;  1VQL N;  4FW1 A;  5AQT A;  4B1V A;  2YHA A;  1CZA N;  2Y1I A;  1CXU A;  3S9H A;  3VN5 A;  3MXJ A;  1WUA A;  2OPS A;  3IDH A;  2QWR A;  2X6N A;  4NB4 A;  4GKJ K;  4YOX A;  1HJO A;  3O8M A;  3SJH A;  4CZL A;  3SQ1 A;  3PX6 A;  2IAJ A;  2PAV A;  4CF2 A;  3EY1 A;  1N36 K;  4GVE A;  4C8M A;  4KO0 A;  3A2F A;  3FGU A;  4A57 A;  4ZTF A;  1KSP A;  1ZYQ A;  4CJ7 A;  4CHN A;  4EZ6 A;  3CM5 A;  3T69 A;  3VMF B;  2FBY A;  2P5O A;  1TAU A;  4PUO A;  3UKR B;  1SAZ A;  2V52 B;  3F9M A;  5AQH A;  3ZX0 A;  1CLQ A;  1HUX A;  3LM9 A;  3KLF A;  4DSL A;  4CEQ A;  2VQE K;  5CZ1 A;  3L4I A;  1YJN N;  3J7A P;  5DMR A;  3RRG A;  5KPT A;  3VQP A;  1BL3 A;  3HST B;  5AQQ A;  4JI1 K;  4JKE A;  2G8F A;  1LOT B;  5M1Q A;  2JWK A;  2E2N A;  4CZM A;  2ITG A;  3SQ2 A;  4O44 A;  3ZEU A;  1UWB A;  4QCL A;  1UOC A;  3MEC A;  3VQQ A;  4IZ9 A;  2YNG A;  4Z4G A;  2ZJR L;  3SYZ A;  1KXP A;  2OZM A;  3CQY A;  2HHT A;  3F9K A;  3VTI A;  1WBB A;  4KRF A;  4K42 A;  1SL2 A;  1NGB A;  2UUB K;  3ZX3 A;  3L2U A;  4RW7 A;  1D9F A;  3QES A;  2W42 A;  4JS5 A;  3AO5 A;  4ISF A;  5AZJ B;  5C2F A;  2GV9 A;  1NNE A;  4OPJ A;  3ALY A;  1JCF A;  1GLJ O;  4F8R A;  2V7Z A;  4CZF A;  4LY7 A;  3PIO L;  4AIL C;  3SBG A;  5LMU K;  1XMO K;  4KPY A;  2XRI A;  4ELV A;  4IG0 A;  3AAP A;  2BH1 A;  1LAV A;  3V9U A;  3QEX A;  3T7Z A;  4DU1 A;  4Z94 A;  4BRP A;  2NRX A;  5AQZ A;  3THW B;  3NHG A;  2EWS A;  4OKK A;  5BR9 A;  2Y1J A;  5I9E B;  2WFB A;  1WLJ A;  4NCB A;  4DV1 K;  4XH4 A;  3QIO A;  4I2P A;  3DLH A;  3T3F A;  3P5J A;  4E7J A;  1NGF A;  4IJN A;  1TK0 A;  1DKG D;  3VQD A;  4EHT A;  2VWJ A;  1HNX K;  3DXK B;  4FJM A;  2IOC A;  1TYQ A;  3THY A;  4LFA K;  4G1Q A;  3KLE A;  4FVM A;  5AFU H;  1QTM A;  2HND A;  4FOI A;  4A62 A;  3NCI A;  3CJ7 A;  4PY5 A;  3TU5 A;  3S3O A;  4FZX C;  5ADX A;  4Y1C A;  4CJV A;  3CYM A;  4QS9 A;  1VSE A;  2UUA K;  1A5V A;  1RDA A;  4CEO A;  1RT2 A;  5GIO A;  4HCC A;  3HPO A;  4GV9 A;  2BGG A;  2HHH K;  2HHV A;  3O4N A;  4DQQ A;  1O13 A;  1U2V B;  1CXQ A;  1KAX A;  4FJH A;  3ZT0 A;  1T05 A;  3AO2 A;  3ID6 A;  4C1N I;  3NH0 A;  2ZM6 K;  1HRH A;  4L3Q A;  2GWJ A;  3VES A;  1XNR K;  1B92 A;  3SPZ A;  4ICL A;  3HM9 A;  5JLF A;  3VET A;  1P90 A;  3N4Q A;  2A40 A;  4FJX A;  4BE2 A;  1XI1 A;  1BQN A;  3RR8 A;  5IWA K;  1NGG A;  4CD3 A;  2A5X A;  1T03 A;  2QK9 A;  2G8U A;  1NKB A;  4HWI A;  1NWK A;  2X6S A;  2HW3 A;  2PFU A;  5MLC Q;  5KQ8 A;  3PIP L;  4OLA A;  3LDL A;  3KD1 E;  2E1Y A;  1NGD A;  5HL7 L;  3MN7 A;  4K8Z A;  2P9L B;  1U47 A;  3EN9 A;  3IKM A;  4JKG A;  1IKX A;  2O8F B;  2P9U B;  4CBX A;  3PUF A;  3KK7 A;  4CHY A;  5I3U A;  1LWF A;  5HOO A;  3RSE A;  1VSL A;  3P83 D;  1IO2 A;  3C6U A;  3K5O A;  3D7E O;  4KH5 A;  1RGI A;  1B9F A;  2HNZ A;  1VHX A;  3LZJ A;  2OPR A;  4FLZ A;  3NMU A;  4AQY K;  3IFR A;  3ZT3 A;  5HRR A;  4FJN A;  4KTZ A;  2F7T A;  4A5A A;  3KLH A;  4DR1 K;  4OKE A;  5FPE A;  3EKS A;  2NLX A;  5E26 A;  5TKY A;  1KAY A;  1K73 O;  1TYQ B;  4FZZ A;  4JNE A;  3PX4 A;  3DLG A;  3SK3 A;  2D5R A;  2W40 A;  5FPD A;  3OY9 A;  4FJK A;  4DMN A;  2HVI A;  2Q36 A;  4KHQ A;  1Q9Y A;  4M63 C;  5AQS A;  2OA8 A;  1BDG A;  5SZT A;  4DV2 K;  1RT6 A;  3PO4 A;  1XQS C;  3NF9 A;  2O4I A;  4JKF A;  4KBO A;  5AJ3 K;  3O9S A;  3L6Q A;  3T1Y K;  2WOM A;  2YHY A;  2P9N A;  3E9L A;  3T1A A;  4H5W A;  4MQ3 A;  4Z4E A;  3D2E A;  3DYA A;  2ZQB A;  1V4S A;  1OH8 A;  1ASU A;  1X3N A;  4JI5 K;  3LL3 A;  2BTF A;  3WXK A; 
#chains in the Genus database with same CATH homology
 4JK9 A;  3HOT A;  2QW9 A;  3NVM A;  2A42 A;  5C2D A;  2QI2 A;  4BR9 A;  4PKG A;  4AM6 A;  4MLE A;  1MWK A;  4JKC A;  1DEJ A;  1QQO A;  2DPN A;  5AQU A;  2AA4 A;  1OVY A;  4BG8 A;  5M1P A;  1Q82 O;  2D1K A;  3BP8 A;  1V4T A;  3A5L C;  2BUP A;  1YIJ N;  3SBT A;  3ZET B;  1T44 A;  4CZI A;  1NJI O;  4HTL A;  5GAG P;  1Y64 A;  4YOT A;  3DLL L;  4BEC A;  1E4G T;  5AQM A;  1IG8 A;  2NRV A;  5E84 A;  5DM6 L;  3CD6 N;  4ILG B;  2ZGZ A;  5C12 A;  1QVF M;  1YXQ A;  3HZ6 A;  5AZI A;  2QEX N;  3E66 A;  4IOX A;  4MO5 A;  1ESV A;  3WXM B;  2E20 A;  3C6H A;  4FWO A;  5AQW A;  3BF1 A;  1Q81 O;  4I6M B;  3RSE B;  2GEM A;  3VEY A;  4EAH D;  4BY9 C;  2HOE A;  3QFU A;  1HX1 A;  3R9P A;  1G99 A;  3HM8 A;  3ZET A;  3IMX A;  1NLV A;  3WQU A;  2F9T A;  4CD1 A;  3MN9 A;  3ID8 A;  3UKU B;  4BRK A;  3OA9 A;  2QWP A;  3O6W A;  1QQN A;  4BVP A;  5LJV A;  3QB0 A;  4B1U B;  3SLC A;  4B1Z A;  1ZC6 A;  5TKW A;  4JAX A;  3LDP A;  2YX6 A;  3C65 A;  2A3Z A;  2QWO A;  4GNI A;  4MDA A;  1VQ6 N;  3O4W A;  3UKR A;  3CJ1 A;  4FWS A;  4JHD B;  4BR2 A;  1VQ5 N;  5FPM A;  1TUU A;  3CME N;  3GG4 A;  3MWP A;  3TSQ A;  1JJ2 M;  3O5B A;  4JKA A;  3N4P A;  4I6M A;  4CI6 A;  1MWM A;  5DM7 L;  4OPA A;  1NGJ A;  4FPA A;  5M1N A;  3MMV A;  1R59 O;  3H46 O;  4CZH A;  3KWG A;  3GBT A;  5FPN A;  4QS8 A;  3WXJ A;  2GUP A;  4IEI A;  1LCU A;  2QTD A;  4EHU A;  3CC7 N;  3U8X A;  3UKU A;  3VF4 A;  3MN5 A;  1SZ2 A;  4FWQ A;  4A2A A;  4PL7 A;  3K9J A;  2ASM A;  3ENO A;  4U7B A;  5AR0 A;  2NRH A;  3J8A A;  2YJE A;  3W0L A;  3ZX2 A;  3TTC A;  4BRE A;  4NLC A;  3TPQ A;  2Q1N A;  5AQR A;  1BA1 A;  1S3X A;  2QM1 A;  5LJW A;  2NRR A;  4BVO A;  3R6M A;  5KQD A;  4IOA L;  2I7N A;  4FWM A;  1VQO N;  1E4F T;  2NRZ A;  3H1V X;  4BRN A;  4CBU A;  5H1S Q;  1VQ4 N;  3LDO A;  2V7Y A;  1NM1 A;  2OTL N;  2E2P A;  4M7X A;  4QS7 A;  3VEW A;  1KAZ A;  4DQ8 A;  2QWQ A;  2UYT A;  4EFH A;  3VF6 A;  3VOV A;  3CPE A;  3SAG A;  1RDU A;  5BPL A;  2HF4 A;  4A59 A;  4BRI A;  2KKZ A;  3DAW A;  3MK6 A;  1TUY A;  4WCE L;  2IVP A;  4BR5 A;  5LY3 A;  3CJB A;  2VWB A;  3A5M C;  2CH5 A;  3LDN A;  4K41 A;  3CC4 N;  5AQL A;  2CGJ A;  4IO8 A;  2QWN A;  2V51 B;  5EVZ A;  3VTH A;  4G9Z A;  5ELZ A;  4PHT X;  2WBN A;  2P9S A;  3CCM N;  3P39 A;  1VQ7 N;  2ZGY A;  4MO4 A;  4BC2 A;  4C1N K;  4ILH A;  4WQ4 C;  3H45 C;  4O8K A;  4RCH A;  1U6Z A;  4WFB L;  1GLB G;  3C7N B;  5EY4 A;  3ATV A;  4H5R A;  3TSU A;  4BR7 A;  4F9O A;  4BRD A;  3C6A A;  5BRF A;  5JLH A;  3ENH A;  4OPH A;  3VEN A;  3O9T A;  3O1W A;  1HKC A;  4M7Y A;  3CER A;  5CR4 A;  2GWK A;  2FSK A;  1EQY A;  3CQX A;  1BWF O;  3FZM A;  4XH1 A;  4RWT A;  2HF3 A;  4JD2 B;  5AQV A;  2E2Q A;  2IIR A;  3A5N C;  4FOE A;  2D4W A;  2HBL A;  1VQ8 N;  2YHW A;  4YOY A;  1BU6 O;  1X9J A;  2FSN A;  3WXI A;  4CZE A;  2Q0U A;  1QQM A;  2ZJP L;  1VQL N;  2W41 A;  2Q97 A;  4FO0 A;  4WQ5 A;  2F9W A;  5AQT A;  4B1V A;  1YIT N;  1CZA N;  3A8Y A;  3BF3 A;  1ZBS A;  3M3Z A;  3CCE N;  3C7N A;  4OO1 J;  1WUA A;  4ISG A;  3SMP A;  3IDH A;  4IFE A;  1HKB A;  5AQY A;  2QWR A;  3EL2 A;  5F1X A;  2QWL A;  4FSV A;  1ATS A;  4NB4 A;  4YOU A;  3TTD A;  2GEL A;  1K9M O;  1T6D A;  5AZI B;  5CHI A;  4JD2 A;  3CXC M;  4YOX A;  1HJO A;  4YOR A;  3DWL A;  3O8M A;  4Y0W A;  3CCL N;  1BOT O;  3SJH A;  1YI2 N;  4CZL A;  3RVC A;  3L0Q A;  3GDQ A;  5C15 A;  1S22 A;  2PAV A;  4FWP A;  4GVE A;  4GV6 A;  1YUW A;  1JCG A;  3AGK A;  3FGU A;  3OHR A;  2FLO A;  4A57 A;  4A61 A;  3AAR A;  2VGN A;  3J7Z O;  3O1B A;  5AQO A;  4CJ7 A;  2QA4 N;  1VQN N;  1M90 O;  5B8H A;  3CCQ N;  3T69 A;  3VMF B;  3DXM A;  4H0T B;  3UKR B;  1GLL O;  1SAZ A;  2V52 B;  3F9M A;  5AQH A;  4B1X B;  2CGL A;  4MDB A;  4BRQ A;  3BUZ B;  1K8A O;  2IVN A;  4YDU A;  3ZX0 A;  3QBX A;  3EE9 A;  3WT0 A;  1HUX A;  3ZEU B;  2C1I A;  3LM9 A;  1GLD G;  1SS6 A;  5F0X A;  1GLC G;  3P4I A;  3KZB A;  3L4I A;  4RTF D;  2Q2R A;  1YJN N;  3I8B A;  4BRH A;  4DKW A;  2VCP A;  4BRA A;  3VEX A;  3WXL A;  5KPT A;  3FZL A;  1GLF O;  5AQQ A;  1P8Z A;  2OTJ N;  4JKE A;  2FSJ A;  2ZF5 O;  3CIP A;  4BC3 A;  2JWL A;  1VQK N;  1LOT B;  1KC8 O;  5M1Q A;  3U4L A;  2JWK A;  1EO1 A;  1J6Z A;  2E2N A;  4CZM A;  3G6E N;  4BEB A;  3H3N O;  3OBW A;  3UB5 A;  3ZEU A;  1ATR A;  3SAF A;  4WQ4 A;  3HRG A;  4IZ9 A;  2YI1 A;  3Q7B A;  2ZJR L;  1HPM A;  1Z6R A;  1KXP A;  1C0G A;  4A5B A;  5F2R A;  3CQY A;  4BQL A;  2CH6 A;  2P9K A;  3IUC A;  3QFP A;  3VTI A;  3F2K A;  3K9K A;  4NLB A;  2YJF A;  3D6R A;  5BN9 A;  3CJ9 A;  3MX2 A;  1MA9 B;  4K42 A;  4PKI A;  3GOI A;  3VEO A;  1NGB A;  3WUH A;  5JVG L;  3ZX3 A;  3O9R A;  5BPN A;  3R3L A;  4DHY A;  3ZYY X;  1M1K O;  3O9U A;  3JS6 A;  4CBW A;  2KLA A;  2I7P A;  3ENB A;  4ISF A;  1C0F A;  5AZJ B;  3VGM A;  5C2F A;  2P9S B;  3H3O B;  4IJA A;  3CI5 A;  1JCF A;  1GLJ O;  2V7Z A;  4BC5 A;  4CZF A;  1HKG A;  5KPZ A;  5AQP A;  4BRL A;  3LDQ A;  1NGA A;  3PIO L;  3JXU A;  3SBG A;  2KHO A;  1BA0 A;  1VAZ A;  1DGK N;  2WC9 A;  3G4S N;  3AAP A;  1KQS M;  2BH1 A;  3CJA A;  1BO5 O;  4H5V A;  3I56 N;  3T7Z A;  4JKB A;  4ISE A;  4BRG A;  4WFA L;  3FZF A;  1Z05 A;  3QIC A;  2QXL A;  2IVO A;  3CET A;  4NO7 A;  1QZ6 A;  1T3V A;  4BRP A;  4Z94 A;  2NRX A;  4AF1 A;  5AZJ A;  3CC2 N;  4KH6 A;  5AQZ A;  3QDK A;  4K43 A;  1XC3 A;  1QZ5 A;  2EWS A;  4H0P A;  3I33 A;  5BR9 A;  1ATN A;  5I9E B;  5AQX A;  2WFB A;  4YOW A;  4H5T A;  2FXU A;  3CHW A;  4XH4 A;  4BRF A;  1Q18 A;  4R79 A;  2W00 A;  1HLU A;  2HMP A;  4H0Y B;  4IDH A;  5GAE P;  2NRT A;  4XEI A;  1NGF A;  4IJN A;  2ASP A;  1DKG D;  3A5O C;  5M1O A;  1N8R O;  4EHT A;  4BRC A;  2VYP A;  3LM2 A;  3MN6 A;  3DXK B;  4DB3 A;  4O8U A;  2HBJ A;  3OW2 M;  1TYQ A;  5AQN A;  2E1Z A;  4FL9 A;  4IXC A;  1T6C A;  3AGR A;  5AFU H;  4FVU A;  3R1X A;  4FOI A;  3VPZ A;  4A62 A;  1NMD A;  4PL8 A;  4JK8 A;  3CJ7 A;  1YVN A;  3TU5 A;  2ZWH A;  3F5T A;  3OBY A;  4BE7 B;  3DXM B;  1DT9 A;  1BG3 A;  4WYB A;  3O08 A;  5ADX A;  3VER A;  5BN8 A;  4JKD A;  2HST A;  2FF3 B;  3O80 A;  4FPB A;  4QS9 A;  3VGK A;  5JVH L;  5C10 A;  3E1Y A;  3CCU N;  3D2F B;  3U9Z A;  5BRH A;  3E9O A;  1OKJ A;  5GIO A;  3DXK A;  4A2B A;  5EXW A;  3EKU A;  4GV9 A;  4B9Q A;  3MWT A;  2J4R A;  3HOS A;  3I55 N;  3L4Q A;  5ADX H;  1H1V A;  3P38 A;  5BRD A;  3S41 A;  4H0O A;  3VEV A;  4BG9 A;  1O13 A;  4BR0 A;  1U2V B;  2NNW A;  4U67 L;  1KAX A;  1NBW A;  5GIP A;  2Q31 A;  4YOV A;  1GLA G;  3ID6 A;  3HTV A;  4C1N I;  3EZW A;  4FWK A;  1VQ9 N;  2GX9 A;  4L3Q A;  1NGE A;  4KH4 A;  3CCR N;  3CJC A;  3W3D A;  4B1Y B;  2GWJ A;  4BRO A;  5AQI A;  3VES A;  3U9D A;  3D2F A;  1VQM N;  4FWN A;  1KD1 O;  3GL1 A;  4E1J A;  5JLF A;  3VET A;  2C1G A;  2YHX A;  1P90 A;  3CCV N;  4IEE A;  3N4Q A;  4XJX A;  2A40 A;  2P9K B;  4K25 A;  1YJW N;  2D0P A;  1QVG M;  4JEP A;  2ITM A;  3ULE B;  3E9P A;  4H5N A;  1U2V A;  3AAQ A;  3HSC A;  4O5F A;  5EOY A;  5BRE A;  2D0O A;  1K8K B;  2WUS A;  1NGG A;  3TSP A;  3FLC O;  5M1K A;  3CPW M;  4JKG B;  2RE2 A;  4CD3 A;  3KVG A;  2A5X A;  1ILY A;  4JKH A;  3EE8 A;  4HWI A;  1NWK A;  5JMV A;  5JIC A;  2A6A A;  2OAN A;  4B1W B;  2PFU A;  5MLC Q;  5KQ8 A;  3PIP L;  1X3M A;  4BQZ A;  3CCS N;  3LDL A;  5AQG A;  3TTF A;  4CZK A;  3H1Q A;  3FFK B;  3DJC A;  2E1Y A;  1NGD A;  4WQ5 C;  3NVK A;  4H0V B;  3ULE A;  2VGM A;  5HL7 L;  1ZXO A;  5GAD P;  4H03 B;  1Q7Y O;  3MN7 A;  2P9I B;  3P31 A;  4JN4 A;  3G25 A;  2P9L B;  4BC4 A;  2P9P B;  1K8K A;  3EN9 A;  3IKM A;  4BR4 A;  4WFN L;  4JKG A;  4CZG A;  3KHY A;  2HBK A;  2P9U B;  1XUP O;  4CBX A;  3KK7 A;  4FWR A;  5HOO A;  3FZH A;  3RSE A;  3UE5 A;  1Q86 O;  1MDU B;  2QWM A;  3D7E O;  4KH5 A;  1YJ9 N;  1RGI A;  4EIA A;  3VF2 A;  3SAH A;  3NMU A;  3QML A;  3HI0 A;  1RFQ A;  3WQT A;  4CZJ A;  2P9I A;  3IFR A;  4ILJ A;  2P9L A;  4BGA A;  2P9P A;  3A0I X;  1BUP A;  3SMS A;  4LC9 B;  2F7T A;  4A5A A;  1S72 N;  3MDQ A;  3MCP A;  3FE1 A;  4JHD A;  2E88 A;  5KPR A;  2P9U A;  3AY9 A;  5FPE A;  1D4X A;  1WOQ A;  3EKS A;  4DCH A;  2NLX A;  3CF5 L;  4IOC L;  2PBD A;  1W2B M;  5E26 A;  5TKY A;  3CCJ N;  4YDU C;  1KAY A;  2NRW A;  3G71 N;  1JCE A;  1K73 O;  1TYQ B;  2ASO A;  3EO3 A;  4JNE A;  1NGC A;  3WEE B;  2P9N B;  1GLE G;  4BGB A;  4UY8 O;  4IO9 L;  4JK7 A;  3SK3 A;  2W40 A;  2YCH A;  3C0B A;  3FZK A;  3VEZ A;  4AM7 A;  5FPD A;  4GV3 A;  2Q36 A;  3M1F A;  1YF5 L;  3D2E B;  4M63 C;  1RDW X;  5AFU A;  1YAG A;  2RHK A;  1QHA A;  1SQK A;  2FF6 A;  5AQS A;  3R8E A;  3O9Q A;  5AQK A;  3MCA B;  1BDG A;  3M5R A;  4H0X B;  5AQF A;  5EX5 A;  4WF9 L;  3ATU A;  3MX5 A;  1NGH A;  5M1F A;  1XQS C;  2ZJQ L;  4J8F A;  2H3G X;  1W97 L;  4JKF A;  1VQP N;  1IJJ A;  3QBW A;  5GAH P;  3HBT A;  4KBO A;  3O9S A;  3L6Q A;  5GIN A;  3CMA N;  3M6G A;  2Q0R A;  2YHY A;  3Q7C A;  3WEE A;  2GTD A;  2P9N A;  3E9L A;  4H5W A;  3H6E A;  5CE3 A;  3GE1 A;  4XH5 A;  4GY2 B;  2A41 A;  4C23 A;  5AQJ A;  3D2E A;  1V4S A;  3B8A X;  4MLH A;  1X3N A;  3KWI A;  4FWL A;  5BPM A;  2AP1 A;  4IWV A;  2HBM A;  3PLA A;  5C0Y A;  2CGK A;  2NZT A;  3BEX A;  1NGI A;  2E2O A;  2E8A A;  3FR0 A;  3LL3 A;  4PKH A;  1YHQ N;  2BTF A;  4BRM A;  3WXK A;  3VGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...