1NMDA

Crystal structure of d. discoideum actin-gelsolin segment 1 complex crystallized in presence of lithium atp
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
372
structure length
362
Chain Sequence
DVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure Of The Non-Vertebrate Actin: Implications For The ATP Hydrolytic Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Actin
total genus 118
structure length 362
sequence length 372
ec nomenclature
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nmdA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nmdA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1nmdA03
2QWPA 2I7NA 5BRDA 1H1VA 1GLCG 2Q36A 1YUWA 5AQLA 4CZGA 1BO5O 4FO0A 2D4WA 3D2FB 4K41A 3U9DA 3VOVA 3SK3A 3GG4A 4PL8A 5I9EB 3L6QA 3QFPA 4PKIA 4WQ4C 1JCEA 5AQFA 1V4TA 5EY4A 1T6CA 4FWKA 4IXCA 5AQYA 5AZJA 3BF1A 3VF2A 2CGKA 3TU5A 3KVGA 4RCHA 3ZEUB 3QBXA 4EIAA 1LCUA 3I8BA 4MLEA 4FWMA 1TUUA 3AARA 1HKCA 3I33A 3VEOA 3P4IA 5AQUA 1E4FT 5AQOA 3UKRA 4CZEA 1NGAA 2E2NA 4KBOA 4B1ZA 2Q1NA 4CJ7A 5AQWA 4MO4A 3MCPA 5LJWA 4IWVA 4JD2A 3HSCA 1NMDA 4J8FA 1EQYA 3GDQA 1J6ZA 5FPMA 2BTFA 3H1QA 3GOIA 2CGJA 4A61A 3B8AX 1BG3A 4L3QA 3M6GA 3AY9A 3LM2A 2E8AA 2YHXA 4EHTA 2YCHA 4BC5A 3WQTA 1SAZA 3HTVA 4EHUA 2P9LB 4F9OA 1RFQA 3QB0A 1BWFO 3ULEA 4GY2B 3UB5A 4EAHD 5AFUA 4QS9A 3AAPA 1HLUA 4BC3A 3O08A 3CIPA 1GLLO 4I6MA 3FZKA 5ADXH 2E1YA 1HKGA 2QWMA 5BRFA 5E26A 5AQQA 1NGDA 4RTFD 2P9UB 4DHYA 4M7YA 4BROA 2HF4A 4PKHA 5JLHA 4YDUA 4B9QA 1KAXA 5BN8A 3WEEA 3A0IX 4H5RA 1QZ6A 3J8AA 5BR9A 1QHAA 3M3ZA 1Y64A 2FXUA 4BRAA 1YVNA 4FWOA 4A62A 3WQUA 3VERA 2H3GX 3VEXA 4HWIA 1BOTO 3UKUB 3A5LC 1DKGD 3UKRB 2UYTA 1D4XA 4FSVA 3VGLA 5BN9A 3SMPA 4AM6A 4BR5A 4FPBA 3IFRA 4BRQA 5AQMA 5CE3A 4NO7A 4FWLA 4ISFA 3ATUA 3G25A 3VESA 2P9PA 3VEVA 2A42A 3WXLA 1TUYA 1TYQA 3GL1A 4BR0A 1HUXA 1Q18A 4BRGA 3D2EA 5ELZA 4FWNA 1X9JA 1GLAG 1GLDG 5AQRA 1RGIA 4CBXA 3VF6A 2W40A 4DB3A 3D2FA 2AP1A 5AQHA 1NGBA 1V4SA 3VENA 1KAZA 4IO8A 1QQNA 3CJ1A 4RWTA 2Q0UA 1K8KB 4E1JA 2ASPA 3MN5A 2FF3B 2A5XA 4H5TA 2FF6A 2NRHA 4IZ9A 3TPQA 3VGMA 1U6ZA 3S41A 4HTLA 3ZEUA 4PKGA 4H5NA 4IJAA 2P9SB 2Q31A 3EO3A 3VEZA 3RSEA 1NGGA 3MN7A 4FOIA 2AA4A 4O5FA 1YAGA 5KPRA 4FOEA 1ATNA 4GNIA 3U8XA 4CZIA 1KXPA 3ZX2A 2W41A 4B1UB 1SQKA 5AQTA 5AQZA 5AQVA 4CZLA 4BRCA 3FZHA 2OANA 3QICA 2Q2RA 3CJ9A 3VETA 2YJFA 2A40A 2P9UA 3R6MA 3LL3A 3BEXA 4BR9A 1S22A 4CZHA 4BRPA 3LM9A 3OHRA 1KAYA 2V52B 4H03B 2GELA 5LY3A 1BU6O 3D2EB 2HMPA 3CQYA 4MO5A 3FLCO 2HF3A 1U2VA 4K42A 3FE1A 1XUPO 1IG8A 3DWLA 3WUHA 1G99A 5BPNA 5EX5A 1NGIA 4XH4A 3FZFA 4BVOA 2WUSA 5JMVA 1GLBG 4CZMA 2Q0RA 2E1ZA 3O8MA 1HX1A 3EKUA 4CD1A 3A5MC 3ZX3A 3FR0A 2A41A 4BRDA 2FLOA 3JS6A 3BP8A 3C7NA 3O1BA 3MN6A 3VF4A 3DXKB 3F9MA 4I6MB 4BC4A 5AR0A 3WT0A 4BG9A 3L4IA 2ZF5O 3HM8A 5AQSA 4H0PA 4ISEA 2IVPA 4BRFA 4BQZA 2V7YA 5F0XA 3EL2A 1DGKN 3FFKB 5E84A 5FPNA 3WEEB 4WQ5C 3KHYA 3O1WA 5FPDA 4M7XA 2P9IB 3GE1A 3C0BA 1XC3A 3BUZB 2ZWHA 5AQGA 2P9NA 4JHDA 2YHWA 3ENOA 1NGCA 3DXMA 4H0OA 3RSEB 2EWSA 5KQDA 2DPNA 2A6AA 3QBWA 4BRMA 4AM7A 4NB4A 1ZXOA 1NM1A 4K25A 1CZAN 3ID8A 2VYPA 2YJEA 1S3XA 3CETA 3FZLA 3LDNA 3CJBA 4BRKA 2I7PA 3HBTA 3W3DA 4B1WB 4QS7A 4BR4A 4CZJA 4WYBA 2GTDA 2VCPA 3HZ6A 1GLEG 2E88A 2IVNA 3WXJA 1GLFO 4DQ8A 3ZETB 4FWPA 3WXIA 4BRLA 4BG8A 1OKJA 4A2AA 4IJNA 3O4WA 4BGBA 2P9SA 5KQ8A 3DAWA 2CH5A 2E2QA 2GWJA 2ZGYA 1Z05A 3SMSA 2GEMA 1NGFA 5ADXA 3R9PA 1BDGA 1NBWA 2GWKA 5AFUH 3CJAA 4BREA 1K8KA 3CI5A 1ZBSA 1IJJA 3HI0A 5BRHA 1U2VB 3FGUA 5AQPA 1C0GA 1NWKA 4Z94A 1DEJA 2FSJA 2E2PA 3A5NC 4A2BA 2IIRA 2IVOA 2QWNA 3MMVA 4XH5A 3L0QA 2V51B 1ATRA 4MLHA 4BGAA 3QDKA 3WXKA 2NZTA 3A5OC 5TKYA 4BRIA 2A3ZA 5AZJB 4B1VA 4FL9A 3C7NB 3EZWA 3CHWA 1JCGA 3H45C 4BR7A 4FWSA 2P9NB 5JLFA 2D0OA 4LC9B 1Z6RA 5AQJA 3DXMB 3H46O 1QQOA 5BPMA 2ZGZA 3A8YA 4C23A 4CD3A 2YHYA 1YXQA 5BPLA 3CJ7A 4CI6A 1WUAA 2PBDA 4BC2A 2QWRA 2J4RA 3FZMA 5KPTA 1T44A 3LDPA 2P9KB 1NGHA 1QQMA 1HJOA 1X3NA 4O8KA 4BRHA 3H6EA 5AQIA 3O6WA 1QZ5A 3H1VX 2F9WA 2F9TA 3CQXA 1NGEA 3M1FA 3DXKA 4BRNA 2QW9A 2Q97A 5BREA 2HOEA 3IMXA 3KZBA 3R8EA 4PL7A 1WOQA 4BR2A 3SJHA 4H0TB 4WQ4A 5B8HA 1MWMA 1NLVA 3ENHA 1BA1A 2QWLA 2VWBA 5AZIB 5EOYA 1XQSC 3QMLA 4JN4A 3ATVA 3D7EO 4CBWA 4FWQA 4FWRA 4JAXA 3LDLA 1MDUB 1R59O 4M63C 5F1XA 1RDWX 2E20A 3H3NO 4CZFA 4H5VA 4Y0WA 3IUCA 4K43A 3IDHA 3VGKA 3UE5A 3U4LA 4BVPA 3QFUA 2ITMA 3SLCA 4DCHA 5KPZA 2D1KA 3ULEB 3EKSA 3ZX0A 1ESVA 2ASMA 1ATSA 4BQLA 2P9IA 2NLXA 2KHOA 4H0VB 4XH1A 3MN9A 1MA9B 4JD2B 3VPZA 2QM1A 4B1YB 3O5BA 4H0XB 4H5WA 4JHDB 1BA0A 2PAVA 3DJCA 3UKUA 3LDQA 3MDQA 1X3MA 2V7ZA 2GUPA 2ASOA 3LDOA 4JNEA 5F2RA 1JCFA 3O80A 1SZ2A 3GBTA 2D0PA 1MWKA 1P8ZA 3MK6A 3W0LA 1T6DA 2BUPA 3CERA 1LOTB 2P9LA 1TYQB 3JXUA 1NGJA 2P9KA 4B1XB 5JICA 1BUPA 3EN9A 4H0YB 4ISGA 5AQXA 3BF3A 4WQ5A 4CZKA 4FPAA 1HKBA 2FSNA 2CGLA 1HPMA 2YI1A 3AAQA 3ZETA 1C0FA 3H3OB 5EXWA 5AQKA 4CBUA 1E4GT 5FPEA 2P9PB 2QWQA 1GLJO 2FSKA 2E2OA 4YDUC 5AZIA 4EFHA 4QS8A 2CH6A 3U9ZA 3VEWA 4XEIA 1ZC6A 2QWOA 5AQNA 3VEYA 5LJVA 2QXLA 3CJCA 5EVZA
chains in the Genus database with same CATH superfamily
2QWPA 3L2UA 5BRDA 1NK5A 4GV3A 3TSPA 3RRGA 2JWKA 2Q36A 1YUWA 1BO5O 4CJ3A 4CCHA 1C0TA 4FO0A 2D4WA 3ASMA 3U9DA 1P90A 3QFPA 4DQQA 1JCEA 3J81O 3AVIA 3DYAA 1FK9A 4CHOA 1T6CA 4IXCA 5AZJA 4DLGA 3BF1A 1Q9YA 1X9SA 1HR0K 1Y97A 4CJWA 3ZSOA 1J53A 3QIPA 1WN7A 3PSIA 3ZEUB 3RR7A 5CZ2A 1TUUA 4Y1DA 3AARA 1NK7A 2HHWA 3HO1A 5AQUA 4ZTFA 1CZ9A 3RR8A 1E4FT 4JI7K 2E2NA 4KBOA 3NGYA 4B1ZA 1LW0A 4CJ7A 5AQWA 4MO4A 4FYDA 1VQNN 4J8FA 3GDQA 1W7AA 3H1QA 4V19S 4JYAK 2KTQA 4BE2A 4JI5K 5J2NA 3M6GA 3CCEN 4YOTA 3P39A 3JYTA 5HLFA 2VGNA 2IS3A 1SAZA 3HTVA 4QOZB 2NNWA 4XJXA 1E3MA 3V9ZA 2P9LB 1QVGM 5J1EA 1RFQA 5HP1A 1BWFO 4DFMA 4GY2B 4JI2K 4N41A 5C42A 3O9SA 4CIEA 3QEIA 1CLQA 5E26A 1TKXA 5AQQA 1NGDA 4CJSA 4CEFA 4RTFD 1RTDA 2P9UB 4DHYA 3ZCMA 2OPPA 3VQ8A 5JLHA 2DFHA 1KAXA 3A2FA 4BEBA 1YITN 3EYZA 4H5RA 3J8AA 5BR9A 3M3ZA 4GKKK 3WNHA 3HL8A 2FXUA 2D5RA 2KZMA 3QLHA 2G8UA 3THWB 3VEXA 3UKUB 1BOTO 1ASUA 3UKRB 2UYTA 3AVMA 3BY5A 4FLVA 4AM6A 3TAEA 3IFRA 1NNEA 3AA5X 2QXFA 3NVKA 4ISFA 3WXLA 1YT3A 3VESA 2P9PA 2Z1JA 3VEVA 4CJQA 3TANA 1VQ5N 4B3RK 1UWBA 2D0CA 1K9MO 4BR0A 4B9VA 1HUXA 1Q18A 3CD6N 4CGJA 3BGRA 3OVNA 1NOZA 4CFCA 4Q0BA 1GLAG 1GLDG 5AQRA 2AJQA 2OZMA 4CBXA 4CECA 4DR1K 3RWUA 2HHXA 4O0JA 5GINA 3U6FA 3C65A 4RWTA 2ZJQL 4AHRA 1K8KB 1JLAA 3MN5A 3OJUA 4FJXA 2FF3B 2FF6A 4DF4A 4DR7K 2HBMA 4B8AB 3DI6A 3T1AA 4FJJA 4Z4HA 5C12A 2VG6A 2NRZA 1I94K 4IO9L 1GOAA 1VQ6N 4KB0A 1KC8O 4KB1A 4X64K 4GNIA 4CZIA 1TV6A 2W41A 4B1UB 5AQTA 3CM5A 3J80O 5CHIA 4BRCA 4LF9K 2OANA 4FVUA 2YJFA 3LL3A 3HT3A 4BRPA 4DV0K 4AHUA 3LM9A 1HRHA 2O8FB 3SAHA 4H03B 3DLRA 1A5WA 3CCMN 1SL1A 2Z1GA 3MXIA 1WLJA 2LSNA 3NBPA 1IKXA 2HMPA 4B8CA 3TTFA 4MO5A 1OH6A 5DM6L 3FLCO 3NF8A 2HF3A 3CCVN 2JWLA 3FE1A 3WUHA 1G99A 2C1GA 3PIPL 3IG1A 4KHNA 5JMVA 1W0HA 4CZMA 4CK3A 4O8UA 2A41A 2FLOA 3RMAA 4DSKA 1RDAA 4IOCL 5LMUK 4GKJK 1QVFM 4BC4A 2BGGA 3QIOA 4YOWA 1TKZA 4A5AA 2X78A 3L4IA 2ZF5O 3HM8A 4ISEA 3CYMA 2IVPA 5SWMA 2DFFA 3R1XA 3V9XA 4E19A 1L3SA 1DGKN 2IC3A 5E84A 5GAEP 5FPNA 3SCXA 3T19A 3CFPA 3O1WA 4M7XA 4KHPK 1ZBLA 1S1XA 4OX9K 1NJIO 1SKRA 1BIUA 3RSEB 2NRWA 3U3YA 3AVGA 1VSMA 3EEQA 2A6AA 3LAKA 4DFJA 4BRMA 4JLHA 4AM7A 4NB4A 2HNYA 4EP5A 1LAWA 1RBTA 3FZLA 3CJBA 4BRKA 1TL3A 4CJPA 2B5JA 4QS7A 4CZJA 4CF0A 4JS4A 1YHQN 2E88A 2XHBA 2IVNA 3WXJA 1GLFO 4FM1A 3S3MA 3ZSYA 4BGBA 2O4GA 3OYEA 2CH5A 5J2PA 4LFAK 1NBWA 3CI5A 1ZBSA 3FGUA 5AQPA 4N76A 2E2PA 3QO9A 3LWLA 4DV6K 2FBTA 2FBYA 4FZYA 4AHTA 3MMVA 4XH5A 3WXKA 1RILA 3ZSZA 4CHPA 3C7NB 3CHWA 1JCGA 4DV2K 3N4PA 3SQ2A 3L3VA 1JXBA 4FWSA 3TWHA 3SQ4A 3VQDA 1WBDA 4FW2A 4FJHA 3ZT2A 5AQJA 3DXMB 4JRPA 4OLBA 3UIQA 2ZGZA 4C23A 3KLHA 5BPLA 3THXA 3LPTA 3DLGA 2W00A 3QEWA 3SZ2A 4CF2A 1RT1A 2F4VK 2VWKA 4CJEA 4KH4A 3L2RA 3H6EA 2KW4A 3O6WA 1WSEA 3KD1E 3L8BA 1NGEA 3F73A 2QW9A 1NU0A 4PL7A 4X65K 5BR8K 3SUOA 4NLCA 3SJHA 3AVFA 3IKMA 1WAJA 3QMLA 1U47A 1ZBUA 4FWQA 4KV8A 1NK8A 1Q9XA 3LDLA 3KK7A 4FK4A 1XHZA 4DLEA 4JEPA 3H3NO 1JL1A 2QEXN 3ENBA 3U3GA 4CEDA 3MECA 3UE5A 4I9LA 3D0PA 3QFUA 4CGFA 4DCHA 4M3ZA 2D1KA 3VTIA 2G8HA 3ULEB 4FJLA 1XI1A 2A1RA 1L5UA 1BIZA 1ESVA 3ZX0A 3V1RA 2P9IA 4XH1A 2QTDA 4ILHA 3VPZA 1VSKA 1BISA 1HYZA 3SPYA 4JHDB 3KK3A 4FLZA 4YOXA 1X3MA 4CFDA 3QNOA 4CJKA 4C8NA 4LF5K 2O8EA 4JKDA 1P8ZA 4LSLA 3W0LA 2P9LA 1TYQB 4B1XB 3OBYA 4J2BA 4CK2A 4JI6K 4WQ5A 1IBMK 4FPAA 3OTOK 4LSNA 1HPMA 3FFIA 4O4GA 1J5EK 3D6RA 3OYNA 5EXWA 3VQCA 5AQKA 3SI6A 1IBKK 5FPEA 4DV5K 4C8MA 2E2OA 2NRVA 4EFHA 3H08A 4K8ZA 1VSIA 4F2RA 4XEIA 5LJVA 3CJCA 3TTDA 4DQRA 5M1QA 1T03A 4WFNL 4FLYA 3K9KA 1SKWA 1C0UA 4I9QA 4EP4A 5AQFA 4EZ6A 2UU9K 4HCCA 3TI0A 5EY4A 1Q7YO 4FWKA 5AQYA 5SZTA 5HROA 4DR6K 3VF2A 2HMIA 2CGKA 3TU5A 4RCHA 4JS5A 3ZSXA 5AJ3K 3I8BA 4FJIA 1RCHA 3G6EN 4OJRA 3DLEA 1HKCA 4O0IA 3VEOA 4KI6A 3P4IA 5C2FA 3I55N 1RT3A 4CEAA 3VTHA 3M8RA 4B9TA 4J2DA 3MEEA 3THXB 1BQNA 2Q1NA 3HPOA 1NJYA 1NMDA 4DFKA 2E4LA 5FPMA 1J6ZA 5HRNA 4BDPA 1Z25A 2RE2A 4A61A 1Q86O 3VQ9A 3MAQA 3T69A 4YORA 1RBSA 2E8AA 2YCHA 2GBZA 1T3VA 4LH5A 3WQTA 1K73O 4NCBA 4B3OA 3E9OA 3DRSA 2QA4N 1FW6A 4KKOA 3OA9A 3VQ7A 3VN5A 2E6MA 3UB5A 2RF2A 4EAHD 5AFUA 3AAPA 3Q7CA 1S72N 2QWMA 5BRFA 3DLHA 4YY3K 3ZLJA 3MEDA 2HVHA 3ZYYX 4Q5VA 2HF4A 1LWCA 4YDUA 1EP4A 3F2KA 4FW1A 3NGIA 1VSLA 3THYB 3ZT3A 2PY5A 4BWJA 2FBXA 4NXMK 5MLCQ 1JLFA 4BRAA 1REVA 1N36K 4FZZA 3WQUA 1N34K 2H3GX 4BE7B 4DG1A 3DRRA 4KFBA 4CFAA 4FSVA 3VGLA 5BN9A 3SMPA 3PO4A 1S1TA 3AO5A 4Y1CA 3MWTA 5CR4A 4PY5A 4NO7A 4DSEA 3ATUA 2KFZA 2QI2A 3V9WA 1TYQA 4CESA 3LP2A 1KVCA 4DR2K 4BRGA 5ELZA 4FWNA 2EX3A 4DQIA 1VHXA 4R5PA 4DR5K 3OS1A 1BI4A 1X9JA 3T1YK 5DK5A 1DTTA 1RTHA 4IDKA 1N32K 5LL6Z 1GOBA 3D2FA 4DU1A 1NGBA 1KVAA 2Q0UA 4E1JA 1GOCA 3WXMB 1KLNA 4HTLA 1L3UA 3VMFB 3ZEUA 1VQMN 2P9SB 4OKKA 2Q31A 3VEZA 3MN7A 2AA4A 3V1OA 4IOAL 2YKMA 1KXPA 1ZBIA 5AQVA 4CZLA 1U48A 3S9HA 3DLLL 4B9LA 1B9DA 3NH0A 2A40A 2P9UA 5KTQA 1M90O 3BEXA 4BR9A 4O5BA 4K0KK 3KTQA 1B9FA 3KKSA 3F5TA 1KAYA 3P31A 4ILGB 3V9UA 4DWIA 2A1SA 1BU6O 2OA8A 2HHVA 1EX4A 5J2MA 3THWA 1QQCA 1RBRA 4MDBA 4CGGA 3LWMA 1VK0A 4K42A 1FKOA 1XUPO 1IG8A 4ILJA 4AH9A 4CJTA 1T05A 4B9MA 2WUSA 1GLBG 4CHQA 3VQ5A 2WTUA 3O8MA 1OH7A 3L2QA 1J54A 3A5MC 5GAGP 1XMQK 1TVRA 4BRDA 3JS6A 4O55A 3TABA 3VF4A 1C1CA 1VSDA 4CF9A 3HOSA 1C6VA 3NF6A 1D8YA 1EKEA 3EL2A 2UXDK 2OTLN 3AVAA 1RDDA 4WQ5C 3KHYA 4CHNA 5HBMA 5C24A 3AO2A 1QE1A 3KLFA 2ZWHA 2G8WA 2YHWA 2F8SA 4KO0A 5CZ1A 4KH5A 5HL7L 3DXMA 2NUBA 4JK7A 4KPYA 1VSEA 2DPNA 3QBWA 4YFUA 4DSLA 1ZXOA 2WC9A 1CZAN 1S3XA 1U4BA 3LDNA 4PQUA 1OVQA 4JI4K 5EU7A 3NGZA 3HBTA 3W3DA 4BR4A 2OTJN 2P1JA 4WF9L 4WYBA 2GTDA 3V6DA 4BDYA 3ZETB 4FWPA 3WXIA 1OKJA 2IDOA 2YNIA 3R3LA 4RW7A 3J7ZO 3C6TA 4Z0UA 5GADP 2RKIA 1LW2A 5KQ8A 4FJNA 4KI4A 1KSPA 3P5JA 2GWJA 4YNQA 3SMSA 2GEMA 5ADXA 3CMEN 2DFEA 3CJAA 2HSTA 4WFBL 3DOKA 1IJJA 3HI0A 3L4QA 5BRHA 1SS6A 4DTOA 1OVYA 1NWKA 1RT2A 2FSJA 4JKGA 4AHVA 4GVMA 2FBVA 4NYFA 2IIRA 3WNEA 4LF7K 1UA1A 2WONA 4MLHA 3AVKA 3QDKA 4HUFA 3A5OC 4DR3K 5TKYA 3MX5A 3CMAN 3HRGA 4BR7A 4JKFA 3LANA 1KQSM 5JLFA 1YJWN 1B92A 5FDLA 1RT4A 2D0OA 4JKCA 4LC9B 4JRQA 3I0SA 3ZT4A 3H46O 4KAZA 3K5MA 4FLUA 4FJ8A 3QINA 1Q81O 4Z4GA 3A8YA 4QAGA 4Z4EA 4IKFA 4CI6A 1WUAA 4E7HA 4C8KA 3O3FA 3K59A 3NDKA 1LV5A 3LDSA 5KPTA 1Z26A 1HJOA 2E6LA 1K8AO 2G8IA 3H1VX 3I8DA 3CQXA 1QSYA 2XY7A 1WB9A 2D0AA 1JLQA 3R8EA 2YNFA 4E7KA 1J9AA 3AA2A 4M41A 4G9ZA 2JGUA 2OPRA 4B3TK 2QWLA 5AZIB 5EOYA 4W5RA 1YF5L 4JN4A 3D7EO 3CCLN 4CBWA 4FWRA 1RTJA 1N33K 1W9HA 1RDWX 4CZFA 3SV4A 4H5VA 4Y0WA 1EO1A 3IUCA 4K43A 4CF1A 3IDHA 1NOYA 4IFEA 2ITMA 3SLCA 2RHKA 2O4IA 5KPZA 3CC7N 3CYGA 4W5OA 1HNXK 4OPKA 3OYGA 4BECA 2KHOA 4B1YB 4YHHK 2PAVA 3UKUA 1XC9A 2NRTA 2GUPA 3ZT0A 2VWJA 3HXMA 2ASOA 4JNEA 3LDOA 5F2RA 3TAPA 3OYKA 4FJ7A 1LWEA 4NCAA 4RW4A 3V81A 4J2AA 1LOTB 2HHSA 1NGJA 3KD5E 3NF7A 1VQ4N 1RNHA 4H0YB 3RMDA 2O8CB 4ISGA 5AQXA 4KHSA 4CZKA 5C25A 1RT6A 1HKBA 2CGLA 3NAEA 4M45A 1QS4A 3PX4A 3K57A 3PLAA 3LZIA 4DV1K 3ZETA 4KTWA 4KH6A 3H3OB 1QSLA 4CBUA 1E4GT 5CYMA 5FLXO 5JVHL 2Y1IA 1GLJO 5E41A 4YDUC 2CH6A 1ZC6A 4RW8A 3VEYA 1T8EA 2QXLA 1H1VA 1GLCG 2ZE2A 3LP1A 5AQLA 4PUOA 2F8TA 1I3AA 3C95A 2F96A 4JKEA 4K41A 1IKYA 3D2FB 3VOVA 3GG4A 4PL8A 4M3UA 4CE9A 3K5OA 4CJRA 1V4TA 2QKBA 4NCGA 3NE6A 4M3XA 3THYA 3KWIA 4YOYA 3KVGA 3HOTA 3CCJN 3QBXA 3AVCA 3OW2M 3G10A 4PA1A 4W5QA 5KRSA 3PIOL 5DMRA 1IO2A 4MFBA 1SUQA 2O8DB 4F8RA 3MCPA 5LJWA 1EQYA 4FM2A 2DTUA 4DTXA 2QK9A 1TAUA 3GOIA 2CGJA 4OKEA 1SL2A 1BG3A 5KRTA 2XY5A 2X6SA 4L3QA 4ZHRA 4JK8A 4FXDA 4BE1A 3QEXA 3AY9A 3LM2A 4X62K 5I3UA 3TSQA 5JVGL 4DTSA 2WOMA 3MEGA 4F9OA 5M1NA 3SV3A 1D9DA 1S1UA 2D0BA 2ZQBA 3QB0A 1RDCA 3B6PA 3ULEA 1GLLO 4GV6A 4I6MA 1VRUA 2E1YA 4IG3A 1HKGA 3K58A 3O9TA 4IFVA 4L8RB 4M7YA 3CCRN 5HRSA 4PKHA 3ZT1A 5CYQA 4U67L 4GMJB 3MWPA 2HVIA 3WEEA 2HHIA 1QZ6A 5JS2A 4YOVA 4BWMA 4OVLA 2PYLA 1S6PA 4FJ9A 3ITHA 1Y64A 1YVNA 4FWOA 3QEPA 4A62A 4CEEA 4CERA 4HWIA 1TGOA 1N8RO 3K2PA 4B9UA 1DKGD 1D4XA 3WNFA 2Y1JA 1NJWA 4BDZA 4BRQA 4F2SA 5AQMA 1X9WA 4FZXC 1EWRA 3LZJA 3G25A 4B3MK 1WSHA 2A42A 4QCLA 2W42A 2PZSA 4HVJA 3HSTB 1ZYQA 1JLGA 4MDAA 2EHGA 4CEQA 5LMNK 5GAHP 3OYBA 1Q8IA 3T1HK 1RBUA 1RGIA 2GX9A 4HUGA 3VF6A 4R79A 4M3YA 4DB3A 4MQ3A 4JKHA 5AQHA 1V4SA 4RW9A 4C1NK 4CFBA 1KAZA 4ZTJA 1KD1O 4DV7K 4FJGA 3CJ1A 2VQEK 3QEVA 2KZZA 3SAGA 4LD0A 3LP0A 2ASPA 3CPWM 2F7TA 4IZ9A 3PV8A 1U6ZA 1BQMA 2ATQA 4PKGA 4NYNA 3K5NA 4H5NA 5C2DA 1HNVA 3OS2A 2G8FA 4AHSA 3VQAA 4LF6K 1NGGA 2UUAK 4FOIA 3G4SN 4O5FA 4N47A 1YAGA 3VQBA 4CW7B 5KPRA 1VQ8N 3CM6A 4IEEA 2KLAA 4FLTA 1SQKA 5AQZA 3PX6A 1BCOA 1DLOA 4JKGB 3FZHA 3OYAA 4OGEA 3VETA 1VQON 1YJ9N 1LAVA 4BY9C 3PUFA 1S22A 4CZHA 4DSJA 3AGRA 4CHYA 4GVEA 1KRPA 3AVLA 3LAMA 2V52B 3K9JA 2KQ2A 2GELA 3OBWA 1BHLA 3L2VA 3D2EB 3MXJA 3LPUA 3CQYA 3SYZA 3TAGA 1HNZK 1BI4B 3E1YA 4WE1A 5BPNA 3QERA 3FZFA 2ZM6K 1SKSA 4BVOA 4IOXA 1VRTA 1X1PA 2E1ZA 3SBTA 4CD1A 2HB5A 2VG7A 1NK9A 3DXKB 3F9KA 4I6MB 5AR0A 4DSIA 4BG9A 1RDBA 4H0PA 4BRFA 4DTJA 3HPHA 4BQZA 5F0XA 3O9QA 4CF8A 3OS0A 2P5OA 3BZKA 3FFKB 4IFYA 3WEEB 2HNZA 4JKBA 2PYJA 1FJGK 2P9IB 4FJKA 3C0BA 3BUZB 4KTZA 1I39A 5AQGA 4JHDA 4DV4K 3E66A 3V9SA 4WFAL 3OYFA 1U04A 1WSGA 2XRIA 1JLCA 1VSJA 2EWSA 4I2QA 4AHCA 4E89A 4N56A 3CQ8A 5KQDA 3P38A 3B6OA 4DQSA 1QTMA 4K25A 3ID8A 1KCFA 2VYPA 2YJEA 3CETA 4Z4CA 1NK6A 2G8VA 4ID5A 3CC2N 2I7PA 2P5GA 4B1WB 3HZ6A 4DQ8A 4IJNA 3VQ6A 2IGIA 2P9SA 1OH5A 2ZGYA 1QSSA 1Z05A 1NGFA 4DUZK 5AFUH 1BDGA 3CCUN 1TAQA 3E9PA 1K8KA 4BREA 1UA0A 4JI3K 3VQQA 1U2VB 3JAMO 5T7BA 4Z94A 4M3WA 1DEJA 4FCYA 1NKEA 3A5NC 3HM9A 2IVOA 3P83D 1BL3A 1D9FA 2V51B 4BGAA 2NZTA 4BRIA 2A3ZA 4B1VA 4FL9A 1FKPA 3OYIA 3RRHA 4FK0A 4ELTA 1ILYA 2OZSA 2P9NB 3DOLA 4FM0A 3E9LA 4KHQA 3J7YP 2YHBA 1Z6RA 3AO3A 3HVTA 5BPMA 2OYQA 1QQOA 2IOCA 3IS9A 2NRXA 2B4JA 2ZJRL 4CIGA 3TAMA 1YIJN 1VQLN 3CJ7A 3AVJA 2RPIA 4DS5A 4J2EA 4JI8K 4DTPA 3SBGA 2QWRA 4ELUA 2J4RA 3FZMA 4HCBA 3CG7A 4W5TA 1T44A 2P9KB 1NGHA 1QQMA 4OPJA 2QKKA 1X3NA 1S1WA 4BRHA 1A5VA 5AQIA 3CPEA 2F9WA 3M8QA 2F9TA 1JXEA 3M1FA 3HPGA 1N6QA 2ETJA 4BRNA 2Q97A 4CJ5A 3CF5L 3KZBA 5DM7L 3O4QA 4BR2A 3CFRA 3Q7BA 4WQ4A 5B8HA 1MWMA 3CCSN 4I7FA 2VWBA 1TKTA 1C1AA 3ATVA 2BDPA 4Z4FA 3HVRA 1TK0A 4PHTX 4AQYK 2BH1A 1MDUB 2UUBK 3THVA 1R59O 1N5YA 2E20A 3AA3A 4E1NA 4N5SA 2YNHA 3TR8A 4CGDA 3U4LA 4DTUA 4F3TA 4DFPA 4JK9A 2PFUA 5KI6A 1NKBA 3OY9A 2ASMA 4BQLA 4OPHA 2NLXA 5D3GA 4H0VB 4CK1A 3SJJA 2QM1A 3O5BA 4H0XB 4XIUA 4H5WA 4K8XA 1WSFA 1RDUA 2UUCK 1HQUA 3LDQA 3KK1A 5IWAK 3MDQA 4GV9A 2V7ZA 5CY4A 3AV9A 1EXQA 2IAJA 3O80A 3KWGA 1XHXA 1X9MA 3NVMA 3QNNA 5C15A 4DF8A 3T3FA 2BUPA 3JXUA 5JICA 3O4NA 1S1VA 3NF9A 3EN9A 3M5RA 4OLAA 3BF3A 2B6AA 5TKWA 2FSNA 2YI1A 1WSIA 4OGCA 3C94A 1ASWA 4H4OA 3V1QA 4E1MA 4A5BA 1C0FA 3O9UA 1IBLK 3AA4A 2P9PB 2FSKA 3M8SA 5AZIA 4QS8A 4Z4IA 1NK0A 3U9ZA 3VEWA 4UY8O 4M3RA 2O8BB 2I7NA 1VQKN 4RG8A 4O44A 4PWDA 4CZGA 3QESA 1SL0A 4DSFA 3TAQA 3SK3A 3PY8A 4DS4A 5I9EB 1O1WA 3L6QA 4C8OA 4PKIA 4E7JA 1W97L 4LFBK 4WQ4C 4CJFA 4JKAA 4JI0K 2RN2A 1LWFA 4H8KA 3DLBA 1ITGA 4EIAA 1LCUA 4MLEA 4FWMA 2GV9A 3I33A 1YTAA 3L2WA 5H1SQ 5AQOA 3UKRA 4CZEA 1NGAA 1WAFA 4CEOA 4KTQA 3SUNA 2VQFK 1F21A 2BANA 1G15A 4IWVA 4JD2A 3HSCA 2BTFA 3ZSVA 4LF4K 4YOUA 3SUQA 3SPZA 3B8AX 1ZBFA 2UXCK 3VQEA 1TL1A 2Z1HA 1NK4A 3N4QA 1M1KO 5J2QA 4F3OA 4CJVA 2YHXA 4EHTA 4BC5A 1KFDA 3S5TA 3EE9A 3SQ1A 4EHUA 5FRMA 3LP3A 3ULDA 3IRXA 1RBVA 1HNWK 4QS9A 4G1QA 4BC3A 1HLUA 3O08A 3CIPA 1KTQA 3FZKA 5ADXH 4CVNE 3NFAA 1WBBA 3OJSA 4BROA 3E01A 4BACA 1VQ9N 4B9QA 5BN8A 3A0IX 3AO4A 3NHGA 1NJXA 1QHAA 2Z1IA 3K5LA 2O8FA 1BCMA 4CJ4A 1YI2N 4CJLA 1YVUA 1K6YA 4LF8K 5JS1A 2ITGA 3SAFA 4KHUA 4DMNA 3VERA 3TTCA 1Q82O 3OYLA 1T7PA 2HBKA 3A5LC 2HBLA 4DQPA 4BR5A 4FPBA 3IAYA 3SQ0A 1OH8A 3K0SA 3MXMA 2W6LA 5C10A 5CE3A 3HP6A 4FWLA 1IH7A 4CJUA 1L3TA 1TUYA 2VGMA 3C6UA 3GL1A 5A2QO 4GW6A 3D2EA 2X74A 1DT9A 3AO1A 3TSUA 3MX2A 4FLWA 1YJNN 4I2PA 2ZD1A 2W40A 2AP1A 1NKCA 3VENA 3VA0A 5GIPA 3QETA 4IO8A 1QQNA 2E5LK 4OO1J 3EY1A 1HYSA 4TSXA 1S9GA 2A5XA 4H5TA 3VGMA 2NRHA 4LY7A 3TPQA 4CEZA 1WNSA 3S41A 3OYMA 1NMNA 4E7LA 3SUPA 4IJAA 2HHQA 3EO3A 4F4KA 2UXBK 3HJFA 2HBJA 3RSEA 4HHTA 3NCIA 1VSFA 4ID1A 4FOEA 1ATNA 1NJZA 3HK2A 3OYJA 3U8XA 1JLBA 1BGXT 3ZX2A 4BE0A 4ICLA 2O8DA 4U7BA 4CGHA 1WSJA 3QICA 2Q2RA 3CJ9A 1YTUA 4DUYK 3R6MA 4UQGA 4DTRA 3PSFA 1U49A 3V4IA 1XNRK 3OHRA 1KVBA 4NLBA 4CIFA 3G0ZA 4FJ5A 1VSHA 3RTVA 1RT7A 1UAXA 4OPAA 5LY3A 2YV0X 4HUEA 1TK5A 4E7IA 3HYFA 3DMJA 1U2VA 3ZSRA 3DWLA 1ASVA 5EX5A 1NGIA 4XH4A 3PX0A 2XY6A 3O3HA 2Q0RA 3TAFA 1HX1A 3EKUA 3ZX3A 3FR0A 3M8PA 3CC4N 3BP8A 3P1GA 3C7NA 3O1BA 3MN6A 2YX6A 3F9MA 5K14A 1C1BA 3WT0A 4JI1K 2KKZA 2YKNA 1D5AA 1JLEA 3G71N 5HRPA 2C1IA 1HJRA 3S3OA 3C6HA 5AQSA 1CZBA 4HTUA 2GUIA 2BE2A 4E0DA 2V7YA 5FRNA 5KGXA 1J5OA 4LFCK 1KLMA 1IKVA 2W6KA 1EWQA 3DLKA 4B9NA 4KRFA 5FPDA 4X66K 3GE1A 1CXUA 1XC3A 2WFBA 2P9NA 1S6QA 3ENOA 1NGCA 4H0OA 3LALA 4FVMA 4FLXA 1NM1A 4IEIA 2O8CA 5M1FA 4DV3K 4KREA 3VA3A 2VG5A 2HW3A 2VCPA 3KIOA 1GLEG 1XWLA 3S3NA 4BRLA 4BG8A 4A2AA 3ID6A 3AVBA 3O4WA 4CEBA 1HQEA 4B3SK 4KHYA 1O13A 3DAWA 3ZSQA 2OPQA 3I0RA 4IBNA 2E2QA 1VAZA 3R9PA 2OCEA 2P51A 1RTIA 2GWKA 4ELVA 3EZ5A 1HPZA 4LH4A 1C0GA 3NMUA 5C0YA 3OYCA 3EE8A 4A2BA 5M1OA 2QWNA 3KLIA 3L0QA 1EETA 1XMOK 1ATRA 3DRPA 3CXCM 1IKWA 5M1PA 5AZJB 4DR4K 3EZWA 2FC0A 3AGKA 3H45C 2HHHK 1QHTA 5JENA 4C1NI 5IT9O 5HOOA 3NH1A 4CHZA 4M42A 3I56N 4B08A 4RW6A 3RMBA 3CFOA 4CD3A 1CXQA 2YHYA 1TKDA 3VQ4A 1YXQA 3J7AP 4CGIA 1RT5A 2PBDA 2O8EB 4BC2A 2HHTA 1R0AA 2HHUA 4DTMA 1W2BM 3LDPA 4NXNK 4O8KA 1VQ7N 4IG0A 1QZ5A 3SNNA 3L3UA 2XY8A 4DKWA 1XNQK 1S5JA 3DXKA 5GIOA 3BDPA 4KHWA 4EZ9A 4W5NA 5BREA 1TK8A 4FK2A 2HOEA 3IMXA 4M3TA 1WOQA 2OPSA 2ZJPL 1JL2A 4H0TB 3KJVA 3OYHA 1NLVA 3ENHA 5FROA 1BA1A 4E72A 3C6AA 4AF1A 1XQSC 1KFSA 3VQPA 1FXXA 4JAXA 1DTQA 2O8BA 3HP9A 1UOCA 3DM2A 4M63C 5F1XA 4A59A 3PO5A 2G8KA 2Q3SA 3VGKA 3CCQN 1NG9A 2XO7A 4IDHA 4BVPA 3TARA 4DU4A 2JLEA 3OYDA 3EKSA 1HYVA 3AVNA 3AVHA 1JKHA 1ATSA 3JSMA 3O9RA 2NRRA 2YHAA 3MN9A 5HRRA 1MA9B 4JD2B 1VQPN 3KK2A 3RVCA 3KLEA 1BA0A 5KGWA 3DJCA 1HNIA 3NH2A 1HMVA 4AILC 1C0MA 1SV5A 1JCFA 1MU2A 2HNDA 3T7ZA 4WCEL 3MCAB 2KFNA 1SZ2A 3GBTA 3BZCA 3KLGA 2D0PA 2R7YA 3O3GA 1IV0A 1MWKA 4A57A 3MK6A 2DY4A 1T6DA 4DU3A 3CERA 3D45A 2P9KA 3WNGA 4JV5K 4H4MA 1BUPA 3ALYA 3KKRA 4FJMA 3RMCA 3ISNC 2YNGA 1U45A 3AAQA 1IG9A 5I42A 1L3VA 4B9SA 4DTNA 2X6NA 2QWQA 4E3SA 4OKJA 2I5JA 1A5XA 5M1KA 1JJ2M 1ZBHA 4C8LA 2QWOA 2WBNA 5AQNA 3ZSWA 1S9EA 5EVZA
chains in the Genus database with same CATH topology
2QWPA 3TTDA 2I7NA 5M1QA 5BRDA 1VQKN 4GV3A 1H1VA 1GLCG 3TSPA 2JWKA 2Q36A 1YUWA 5AQLA 4WFNL 4CZGA 1BO5O 3K9KA 4FO0A 2D4WA 3D2FB 4JKEA 1P90A 4K41A 3SK3A 3U9DA 3VOVA 3GG4A 4PL8A 5I9EB 3L6QA 3QFPA 4PKIA 1W97L 4WQ4C 1JCEA 4JKAA 5AQFA 1V4TA 5EY4A 1Q7YO 1T6CA 4FWKA 4IXCA 5AQYA 5AZJA 3BF1A 3KWIA 3VF2A 2CGKA 3TU5A 4YOYA 3KVGA 4RCHA 3HOTA 3CCJN 3ZEUB 3QBXA 4EIAA 1LCUA 3OW2M 3I8BA 4MLEA 4FWMA 1TUUA 3AARA 3G6EN 1HKCA 3I33A 3VEOA 3P4IA 5AQUA 3PIOL 5C2FA 3I55N 3VTHA 5H1SQ 1E4FT 5AQOA 3UKRA 4CZEA 1NGAA 2E2NA 4KBOA 4B1ZA 2Q1NA 4CJ7A 5AQWA 4MO4A 3MCPA 5LJWA 4IWVA 4JD2A 1VQNN 3HSCA 1NMDA 4J8FA 1EQYA 3GDQA 1J6ZA 5FPMA 2BTFA 3H1QA 3GOIA 2RE2A 2CGJA 4YOUA 4A61A 1Q86O 3T69A 3B8AX 1BG3A 4L3QA 4JK8A 3M6GA 3N4QA 1M1KO 4YORA 3CCEN 4YOTA 3AY9A 3LM2A 2E8AA 2YHXA 3P39A 4EHTA 2VGNA 2YCHA 1T3VA 3WQTA 4BC5A 1K73O 1SAZA 3EE9A 3HTVA 2NNWA 3E9OA 3TSQA 4EHUA 5JVGL 4XJXA 2P9LB 2QA4N 1QVGM 4F9OA 5M1NA 3OA9A 1RFQA 3QB0A 1BWFO 3ULEA 4GY2B 3UB5A 4EAHD 5AFUA 4QS9A 3AAPA 1HLUA 3O9SA 3O08A 4BC3A 3CIPA 1GLLO 3Q7CA 4I6MA 3FZKA 5ADXH 2E1YA 1S72N 4GV6A 1HKGA 2QWMA 5BRFA 5E26A 5AQQA 1NGDA 3O9TA 4RTFD 2P9UB 4DHYA 3ZYYX 4M7YA 4BROA 3CCRN 2HF4A 4PKHA 1VQ9N 5JLHA 4U67L 3MWPA 4YDUA 4B9QA 1KAXA 5BN8A 3WEEA 3F2KA 1YITN 4BEBA 3A0IX 4H5RA 1QZ6A 3J8AA 4YOVA 5BR9A 1QHAA 3M3ZA 1YI2N 1Y64A 5MLCQ 2FXUA 4BRAA 1YVNA 4FWOA 4A62A 3SAFA 3WQUA 3VERA 3TTCA 1Q82O 2H3GX 4BE7B 3VEXA 4HWIA 1BOTO 3UKUB 2HBKA 3A5LC 1N8RO 1DKGD 3UKRB 2HBLA 2UYTA 1D4XA 4FSVA 3VGLA 5BN9A 3SMPA 4AM6A 4BR5A 4FPBA 3IFRA 4BRQA 3MWTA 5CR4A 5AQMA 5C10A 3NVKA 5CE3A 4NO7A 4FWLA 4ISFA 3ATUA 3G25A 3VESA 2P9PA 2QI2A 2A42A 3VEVA 3WXLA 1VQ5N 1TUYA 2VGMA 1K9MO 1TYQA 3GL1A 4BR0A 1HUXA 1Q18A 3CD6N 4MDAA 4BRGA 3D2EA 1DT9A 5ELZA 4FWNA 5GAHP 3TSUA 1X9JA 3MX2A 1GLAG 1GLDG 1YJNN 5AQRA 1RGIA 2GX9A 4CBXA 3VF6A 4R79A 2W40A 4DB3A 3D2FA 2AP1A 4JKHA 1NGBA 1V4SA 5AQHA 4C1NK 3VENA 1KAZA 5GIPA 4IO8A 1KD1O 5GINA 3C65A 1QQNA 3CJ1A 1VQPN 4RWTA 2ZJQL 4OO1J 2Q0UA 3SAGA 1K8KB 4E1JA 2ASPA 3MN5A 3CPWM 2FF3B 2A5XA 2F7TA 2FF6A 2NRHA 4H5TA 4IZ9A 3TPQA 3VGMA 1U6ZA 3S41A 3WXMB 4HTLA 2HBMA 3VMFB 3ZEUA 4PKGA 1VQMN 4H5NA 5C12A 4IJAA 5C2DA 2P9SB 2Q31A 3EO3A 3VEZA 2HBJA 2NRZA 1NGGA 3RSEA 4IO9L 3MN7A 4FOIA 3G4SN 1VQ6N 2AA4A 4O5FA 1YAGA 1VQ8N 5KPRA 1KC8O 4FOEA 1ATNA 4IEEA 4GNIA 3U8XA 4CZIA 4IOAL 1KXPA 3ZX2A 2KLAA 2W41A 4B1UB 1SQKA 5AQTA 5AQZA 5AQVA 4CZLA 4U7BA 4JKGB 5CHIA 4BRCA 3FZHA 3DLLL 2OANA 3QICA 4FVUA 2Q2RA 3CJ9A 3VETA 2YJFA 1VQON 2A40A 2P9UA 1YJ9N 3R6MA 1M90O 3LL3A 3BEXA 4BR9A 4BY9C 1S22A 4CZHA 4BRPA 3AGRA 3LM9A 3F5TA 3OHRA 4NLBA 1KAYA 3P31A 4GVEA 4ILGB 3SAHA 2V52B 4H03B 3K9JA 2GELA 3OBWA 3CCMN 4OPAA 5LY3A 1BU6O 3D2EB 2HMPA 3CQYA 4MDBA 3TTFA 4MO5A 5DM6L 3FLCO 2HF3A 3CCVN 1U2VA 4K42A 3E1YA 2JWLA 3FE1A 1XUPO 1IG8A 3DWLA 3WUHA 4ILJA 1G99A 5BPNA 5EX5A 1NGIA 2C1GA 4XH4A 3FZFA 3PIPL 4BVOA 2WUSA 5JMVA 4IOXA 1GLBG 4CZMA 2Q0RA 3SBTA 2E1ZA 3O8MA 1HX1A 3EKUA 4CD1A 3A5MC 3ZX3A 4O8UA 3FR0A 5GAGP 2A41A 4BRDA 2FLOA 3JS6A 3CC4N 3BP8A 3C7NA 3O1BA 4IOCL 3MN6A 2YX6A 3VF4A 3DXKB 1QVFM 3F9MA 4I6MB 4BC4A 5AR0A 4YOWA 3WT0A 2KKZA 4A5AA 4BG9A 3G71N 3L4IA 2C1IA 2ZF5O 3HM8A 3C6HA 4H0PA 4ISEA 5AQSA 3HOSA 2IVPA 4BRFA 3R1XA 2V7YA 4BQZA 5F0XA 3O9QA 3EL2A 1DGKN 3FFKB 5E84A 5GAEP 5FPNA 2OTLN 3WEEB 4WQ5C 3KHYA 4JKBA 3O1WA 5FPDA 4M7XA 2P9IB 3GE1A 3C0BA 1XC3A 3BUZB 2WFBA 2ZWHA 5AQGA 2P9NA 4JHDA 1NJIO 2YHWA 3E66A 3ENOA 1NGCA 4KH5A 5HL7L 4WFAL 3DXMA 4H0OA 3RSEB 2EWSA 2NRWA 4JK7A 5KQDA 2DPNA 2A6AA 3QBWA 3P38A 4BRMA 4AM7A 4NB4A 1ZXOA 1NM1A 2WC9A 4IEIA 4K25A 1CZAN 3ID8A 2VYPA 2YJEA 1S3XA 3CETA 3FZLA 3LDNA 3CJBA 4BRKA 3CC2N 2I7PA 3HBTA 3W3DA 4B1WB 4QS7A 4BR4A 4CZJA 5M1FA 2OTJN 4WF9L 4WYBA 2GTDA 2VCPA 3HZ6A 1GLEG 1YHQN 2E88A 2IVNA 3WXJA 1GLFO 4DQ8A 3ZETB 4FWPA 3WXIA 4BRLA 4BG8A 1OKJA 3R3LA 4A2AA 4IJNA 3J7ZO 3ID6A 3O4WA 4BGBA 5GADP 2P9SA 5KQ8A 1O13A 3DAWA 2CH5A 2E2QA 2ZGYA 2GWJA 1Z05A 3SMSA 2GEMA 1NGFA 1VAZA 5ADXA 3CMEN 3R9PA 1BDGA 1NBWA 2GWKA 5AFUH 3CJAA 3CCUN 2HSTA 3E9PA 1K8KA 3CI5A 1ZBSA 4BREA 4WFBL 1IJJA 3HI0A 3L4QA 5BRHA 1SS6A 1U2VB 3FGUA 5AQPA 1OVYA 1C0GA 1NWKA 4Z94A 3NMUA 1DEJA 2FSJA 5C0YA 2E2PA 4JKGA 3A5NC 3EE8A 4A2BA 5M1OA 2IIRA 2IVOA 2QWNA 3MMVA 4XH5A 3L0QA 2V51B 1ATRA 4MLHA 4BGAA 3QDKA 3WXKA 2NZTA 3A5OC 3CXCM 5M1PA 5TKYA 2A3ZA 5AZJB 4B1VA 4BRIA 4FL9A 3C7NB 3EZWA 3CHWA 3MX5A 3CMAN 4XH1A 1JCGA 3AGKA 3HRGA 3H45C 3N4PA 4BR7A 4JKFA 4FWSA 1ILYA 2P9NB 1KQSM 4C1NI 3E9LA 5JLFA 1YJWN 2D0OA 4JKCA 4LC9B 5HOOA 1Z6RA 5AQJA 3DXMB 3H46O 1QQOA 5BPMA 3I56N 2NRXA 2ZGZA 2ZJRL 1Q81O 3A8YA 4C23A 4CD3A 2YHYA 1YIJN 1YXQA 5BPLA 1VQLN 3CJ7A 4CI6A 1WUAA 2PBDA 2W00A 4BC2A 3SBGA 2QWRA 2J4RA 3FZMA 1W2BM 5KPTA 1T44A 3LDPA 2P9KB 1NGHA 4KH4A 1QQMA 1HJOA 1X3NA 4O8KA 4BRHA 1K8AO 3H6EA 1VQ7N 5AQIA 3O6WA 1QZ5A 3CPEA 2F9WA 3H1VX 2F9TA 3CQXA 1NGEA 3M1FA 4DKWA 3DXKA 4BRNA 2QW9A 5GIOA 2Q97A 5BREA 3CF5L 2HOEA 3IMXA 3KZBA 3R8EA 4PL7A 5DM7L 1WOQA 4BR2A 2ZJPL 4NLCA 3SJHA 4H0TB 3Q7BA 4WQ4A 5B8HA 4G9ZA 1MWMA 1NLVA 3ENHA 3CCSN 1BA1A 2QWLA 2VWBA 3C6AA 5AZIB 5EOYA 1XQSC 1YF5L 3IKMA 4AF1A 3QMLA 4JN4A 3ATVA 3D7EO 4CBWA 4FWQA 3CCLN 4FWRA 4PHTX 2BH1A 4JAXA 3LDLA 3KK7A 1MDUB 1R59O 4JEPA 4M63C 5F1XA 1RDWX 2E20A 3H3NO 4A59A 4CZFA 4H5VA 4Y0WA 1EO1A 3IUCA 4K43A 3IDHA 2QEXN 3VGKA 3ENBA 3CCQN 3UE5A 3U4LA 4IDHA 4IFEA 4BVPA 3QFUA 2ITMA 2RHKA 3SLCA 4DCHA 5KPZA 2D1KA 3VTIA 4JK9A 3ULEB 3CC7N 3EKSA 2PFUA 3ZX0A 1ESVA 2ASMA 4BECA 1ATSA 4BQLA 4OPHA 2P9IA 2NLXA 2KHOA 2NRRA 2QTDA 3O9RA 4H0VB 3MN9A 1MA9B 4ILHA 4JD2B 2QM1A 3VPZA 3O5BA 4B1YB 4H0XB 3RVCA 4H5WA 4JHDB 1BA0A 2PAVA 1RDUA 3DJCA 3UKUA 3LDQA 4YOXA 3MDQA 1X3MA 4GV9A 2NRTA 2V7ZA 2GUPA 2ASOA 3LDOA 4JNEA 5F2RA 1JCFA 3O80A 3KWGA 3T7ZA 4WCEL 3MCAB 1SZ2A 3GBTA 3NVMA 2D0PA 4JKDA 1MWKA 1P8ZA 5C15A 4A57A 3MK6A 3W0LA 1T6DA 2BUPA 3CERA 1LOTB 2P9LA 1TYQB 3JXUA 1NGJA 2P9KA 4B1XB 5JICA 3OBYA 1BUPA 3EN9A 3M5RA 4H0YB 1VQ4N 4ISGA 5AQXA 3BF3A 4WQ5A 4CZKA 4FPAA 5TKWA 1HKBA 2FSNA 2CGLA 1HPMA 2YI1A 3AAQA 3D6RA 3PLAA 3ZETA 4A5BA 4KH6A 1C0FA 3H3OB 5EXWA 5AQKA 4CBUA 1E4GT 3O9UA 5FPEA 2P9PB 2QWQA 5JVHL 1GLJO 2FSKA 2E2OA 4YDUC 5AZIA 2NRVA 4QS8A 4EFHA 2CH6A 5M1KA 1JJ2M 3U9ZA 3VEWA 4UY8O 4XEIA 1ZC6A 2QWOA 2WBNA 5AQNA 3VEYA 5LJVA 2QXLA 3CJCA 5EVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWP A;  2I7N A;  5BRD A;  1H1V A;  1GLC G;  2Q36 A;  1YUW A;  5AQL A;  4CZG A;  1BO5 O;  4FO0 A;  2D4W A;  3D2F B;  4K41 A;  3U9D A;  3VOV A;  3SK3 A;  3GG4 A;  4PL8 A;  5I9E B;  3L6Q A;  3QFP A;  4PKI A;  4WQ4 C;  1JCE A;  5AQF A;  1V4T A;  5EY4 A;  1T6C A;  4FWK A;  4IXC A;  5AQY A;  5AZJ A;  3BF1 A;  3VF2 A;  2CGK A;  3TU5 A;  3KVG A;  4RCH A;  3ZEU B;  3QBX A;  4EIA A;  1LCU A;  3I8B A;  4MLE A;  4FWM A;  1TUU A;  3AAR A;  1HKC A;  3I33 A;  3VEO A;  3P4I A;  5AQU A;  1E4F T;  5AQO A;  3UKR A;  4CZE A;  1NGA A;  2E2N A;  4KBO A;  4B1Z A;  2Q1N A;  4CJ7 A;  5AQW A;  4MO4 A;  3MCP A;  5LJW A;  4IWV A;  4JD2 A;  3HSC A;  1NMD A;  4J8F A;  1EQY A;  3GDQ A;  1J6Z A;  5FPM A;  2BTF A;  3H1Q A;  3GOI A;  2CGJ A;  4A61 A;  3B8A X;  1BG3 A;  4L3Q A;  3M6G A;  3AY9 A;  3LM2 A;  2E8A A;  2YHX A;  4EHT A;  2YCH A;  4BC5 A;  3WQT A;  1SAZ A;  3HTV A;  4EHU A;  2P9L B;  4F9O A;  1RFQ A;  3QB0 A;  1BWF O;  3ULE A;  4GY2 B;  3UB5 A;  4EAH D;  5AFU A;  4QS9 A;  3AAP A;  1HLU A;  4BC3 A;  3O08 A;  3CIP A;  1GLL O;  4I6M A;  3FZK A;  5ADX H;  2E1Y A;  1HKG A;  2QWM A;  5BRF A;  5E26 A;  5AQQ A;  1NGD A;  4RTF D;  2P9U B;  4DHY A;  4M7Y A;  4BRO A;  2HF4 A;  4PKH A;  5JLH A;  4YDU A;  4B9Q A;  1KAX A;  5BN8 A;  3WEE A;  3A0I X;  4H5R A;  1QZ6 A;  3J8A A;  5BR9 A;  1QHA A;  3M3Z A;  1Y64 A;  2FXU A;  4BRA A;  1YVN A;  4FWO A;  4A62 A;  3WQU A;  3VER A;  2H3G X;  3VEX A;  4HWI A;  1BOT O;  3UKU B;  3A5L C;  1DKG D;  3UKR B;  2UYT A;  1D4X A;  4FSV A;  3VGL A;  5BN9 A;  3SMP A;  4AM6 A;  4BR5 A;  4FPB A;  3IFR A;  4BRQ A;  5AQM A;  5CE3 A;  4NO7 A;  4FWL A;  4ISF A;  3ATU A;  3G25 A;  3VES A;  2P9P A;  3VEV A;  2A42 A;  3WXL A;  1TUY A;  1TYQ A;  3GL1 A;  4BR0 A;  1HUX A;  1Q18 A;  4BRG A;  3D2E A;  5ELZ A;  4FWN A;  1X9J A;  1GLA G;  1GLD G;  5AQR A;  1RGI A;  4CBX A;  3VF6 A;  2W40 A;  4DB3 A;  3D2F A;  2AP1 A;  5AQH A;  1NGB A;  1V4S A;  3VEN A;  1KAZ A;  4IO8 A;  1QQN A;  3CJ1 A;  4RWT A;  2Q0U A;  1K8K B;  4E1J A;  2ASP A;  3MN5 A;  2FF3 B;  2A5X A;  4H5T A;  2FF6 A;  2NRH A;  4IZ9 A;  3TPQ A;  3VGM A;  1U6Z A;  3S41 A;  4HTL A;  3ZEU A;  4PKG A;  4H5N A;  4IJA A;  2P9S B;  2Q31 A;  3EO3 A;  3VEZ A;  3RSE A;  1NGG A;  3MN7 A;  4FOI A;  2AA4 A;  4O5F A;  1YAG A;  5KPR A;  4FOE A;  1ATN A;  4GNI A;  3U8X A;  4CZI A;  1KXP A;  3ZX2 A;  2W41 A;  4B1U B;  1SQK A;  5AQT A;  5AQZ A;  5AQV A;  4CZL A;  4BRC A;  3FZH A;  2OAN A;  3QIC A;  2Q2R A;  3CJ9 A;  3VET A;  2YJF A;  2A40 A;  2P9U A;  3R6M A;  3LL3 A;  3BEX A;  4BR9 A;  1S22 A;  4CZH A;  4BRP A;  3LM9 A;  3OHR A;  1KAY A;  2V52 B;  4H03 B;  2GEL A;  5LY3 A;  1BU6 O;  3D2E B;  2HMP A;  3CQY A;  4MO5 A;  3FLC O;  2HF3 A;  1U2V A;  4K42 A;  3FE1 A;  1XUP O;  1IG8 A;  3DWL A;  3WUH A;  1G99 A;  5BPN A;  5EX5 A;  1NGI A;  4XH4 A;  3FZF A;  4BVO A;  2WUS A;  5JMV A;  1GLB G;  4CZM A;  2Q0R A;  2E1Z A;  3O8M A;  1HX1 A;  3EKU A;  4CD1 A;  3A5M C;  3ZX3 A;  3FR0 A;  2A41 A;  4BRD A;  2FLO A;  3JS6 A;  3BP8 A;  3C7N A;  3O1B A;  3MN6 A;  3VF4 A;  3DXK B;  3F9M A;  4I6M B;  4BC4 A;  5AR0 A;  3WT0 A;  4BG9 A;  3L4I A;  2ZF5 O;  3HM8 A;  5AQS A;  4H0P A;  4ISE A;  2IVP A;  4BRF A;  4BQZ A;  2V7Y A;  5F0X A;  3EL2 A;  1DGK N;  3FFK B;  5E84 A;  5FPN A;  3WEE B;  4WQ5 C;  3KHY A;  3O1W A;  5FPD A;  4M7X A;  2P9I B;  3GE1 A;  3C0B A;  1XC3 A;  3BUZ B;  2ZWH A;  5AQG A;  2P9N A;  4JHD A;  2YHW A;  3ENO A;  1NGC A;  3DXM A;  4H0O A;  3RSE B;  2EWS A;  5KQD A;  2DPN A;  2A6A A;  3QBW A;  4BRM A;  4AM7 A;  4NB4 A;  1ZXO A;  1NM1 A;  4K25 A;  1CZA N;  3ID8 A;  2VYP A;  2YJE A;  1S3X A;  3CET A;  3FZL A;  3LDN A;  3CJB A;  4BRK A;  2I7P A;  3HBT A;  3W3D A;  4B1W B;  4QS7 A;  4BR4 A;  4CZJ A;  4WYB A;  2GTD A;  2VCP A;  3HZ6 A;  1GLE G;  2E88 A;  2IVN A;  3WXJ A;  1GLF O;  4DQ8 A;  3ZET B;  4FWP A;  3WXI A;  4BRL A;  4BG8 A;  1OKJ A;  4A2A A;  4IJN A;  3O4W A;  4BGB A;  2P9S A;  5KQ8 A;  3DAW A;  2CH5 A;  2E2Q A;  2GWJ A;  2ZGY A;  1Z05 A;  3SMS A;  2GEM A;  1NGF A;  5ADX A;  3R9P A;  1BDG A;  1NBW A;  2GWK A;  5AFU H;  3CJA A;  4BRE A;  1K8K A;  3CI5 A;  1ZBS A;  1IJJ A;  3HI0 A;  5BRH A;  1U2V B;  3FGU A;  5AQP A;  1C0G A;  1NWK A;  4Z94 A;  1DEJ A;  2FSJ A;  2E2P A;  3A5N C;  4A2B A;  2IIR A;  2IVO A;  2QWN A;  3MMV A;  4XH5 A;  3L0Q A;  2V51 B;  1ATR A;  4MLH A;  4BGA A;  3QDK A;  3WXK A;  2NZT A;  3A5O C;  5TKY A;  4BRI A;  2A3Z A;  5AZJ B;  4B1V A;  4FL9 A;  3C7N B;  3EZW A;  3CHW A;  1JCG A;  3H45 C;  4BR7 A;  4FWS A;  2P9N B;  5JLF A;  2D0O A;  4LC9 B;  1Z6R A;  5AQJ A;  3DXM B;  3H46 O;  1QQO A;  5BPM A;  2ZGZ A;  3A8Y A;  4C23 A;  4CD3 A;  2YHY A;  1YXQ A;  5BPL A;  3CJ7 A;  4CI6 A;  1WUA A;  2PBD A;  4BC2 A;  2QWR A;  2J4R A;  3FZM A;  5KPT A;  1T44 A;  3LDP A;  2P9K B;  1NGH A;  1QQM A;  1HJO A;  1X3N A;  4O8K A;  4BRH A;  3H6E A;  5AQI A;  3O6W A;  1QZ5 A;  3H1V X;  2F9W A;  2F9T A;  3CQX A;  1NGE A;  3M1F A;  3DXK A;  4BRN A;  2QW9 A;  2Q97 A;  5BRE A;  2HOE A;  3IMX A;  3KZB A;  3R8E A;  4PL7 A;  1WOQ A;  4BR2 A;  3SJH A;  4H0T B;  4WQ4 A;  5B8H A;  1MWM A;  1NLV A;  3ENH A;  1BA1 A;  2QWL A;  2VWB A;  5AZI B;  5EOY A;  1XQS C;  3QML A;  4JN4 A;  3ATV A;  3D7E O;  4CBW A;  4FWQ A;  4FWR A;  4JAX A;  3LDL A;  1MDU B;  1R59 O;  4M63 C;  5F1X A;  1RDW X;  2E20 A;  3H3N O;  4CZF A;  4H5V A;  4Y0W A;  3IUC A;  4K43 A;  3IDH A;  3VGK A;  3UE5 A;  3U4L A;  4BVP A;  3QFU A;  2ITM A;  3SLC A;  4DCH A;  5KPZ A;  2D1K A;  3ULE B;  3EKS A;  3ZX0 A;  1ESV A;  2ASM A;  1ATS A;  4BQL A;  2P9I A;  2NLX A;  2KHO A;  4H0V B;  4XH1 A;  3MN9 A;  1MA9 B;  4JD2 B;  3VPZ A;  2QM1 A;  4B1Y B;  3O5B A;  4H0X B;  4H5W A;  4JHD B;  1BA0 A;  2PAV A;  3DJC A;  3UKU A;  3LDQ A;  3MDQ A;  1X3M A;  2V7Z A;  2GUP A;  2ASO A;  3LDO A;  4JNE A;  5F2R A;  1JCF A;  3O80 A;  1SZ2 A;  3GBT A;  2D0P A;  1MWK A;  1P8Z A;  3MK6 A;  3W0L A;  1T6D A;  2BUP A;  3CER A;  1LOT B;  2P9L A;  1TYQ B;  3JXU A;  1NGJ A;  2P9K A;  4B1X B;  5JIC A;  1BUP A;  3EN9 A;  4H0Y B;  4ISG A;  5AQX A;  3BF3 A;  4WQ5 A;  4CZK A;  4FPA A;  1HKB A;  2FSN A;  2CGL A;  1HPM A;  2YI1 A;  3AAQ A;  3ZET A;  1C0F A;  3H3O B;  5EXW A;  5AQK A;  4CBU A;  1E4G T;  5FPE A;  2P9P B;  2QWQ A;  1GLJ O;  2FSK A;  2E2O A;  4YDU C;  5AZI A;  4EFH A;  4QS8 A;  2CH6 A;  3U9Z A;  3VEW A;  4XEI A;  1ZC6 A;  2QWO A;  5AQN A;  3VEY A;  5LJV A;  2QXL A;  3CJC A;  5EVZ A; 
#chains in the Genus database with same CATH topology
 2QWP A;  3L2U A;  5BRD A;  1NK5 A;  4GV3 A;  3TSP A;  3RRG A;  2JWK A;  2Q36 A;  1YUW A;  1BO5 O;  4CJ3 A;  4CCH A;  1C0T A;  4FO0 A;  2D4W A;  3ASM A;  3U9D A;  1P90 A;  3QFP A;  4DQQ A;  1JCE A;  3J81 O;  3AVI A;  3DYA A;  1FK9 A;  4CHO A;  1T6C A;  4IXC A;  5AZJ A;  4DLG A;  3BF1 A;  1Q9Y A;  1X9S A;  1HR0 K;  1Y97 A;  4CJW A;  3ZSO A;  1J53 A;  3QIP A;  1WN7 A;  3PSI A;  3ZEU B;  3RR7 A;  5CZ2 A;  1TUU A;  4Y1D A;  3AAR A;  1NK7 A;  2HHW A;  3HO1 A;  5AQU A;  4ZTF A;  1CZ9 A;  3RR8 A;  1E4F T;  4JI7 K;  2E2N A;  4KBO A;  3NGY A;  4B1Z A;  1LW0 A;  4CJ7 A;  5AQW A;  4MO4 A;  4FYD A;  1VQN N;  4J8F A;  3GDQ A;  1W7A A;  3H1Q A;  4V19 S;  4JYA K;  2KTQ A;  4BE2 A;  4JI5 K;  5J2N A;  3M6G A;  3CCE N;  4YOT A;  3P39 A;  3JYT A;  5HLF A;  2VGN A;  2IS3 A;  1SAZ A;  3HTV A;  4QOZ B;  2NNW A;  4XJX A;  1E3M A;  3V9Z A;  2P9L B;  1QVG M;  5J1E A;  1RFQ A;  5HP1 A;  1BWF O;  4DFM A;  4GY2 B;  4JI2 K;  4N41 A;  5C42 A;  3O9S A;  4CIE A;  3QEI A;  1CLQ A;  5E26 A;  1TKX A;  5AQQ A;  1NGD A;  4CJS A;  4CEF A;  4RTF D;  1RTD A;  2P9U B;  4DHY A;  3ZCM A;  2OPP A;  3VQ8 A;  5JLH A;  2DFH A;  1KAX A;  3A2F A;  4BEB A;  1YIT N;  3EYZ A;  4H5R A;  3J8A A;  5BR9 A;  3M3Z A;  4GKK K;  3WNH A;  3HL8 A;  2FXU A;  2D5R A;  2KZM A;  3QLH A;  2G8U A;  3THW B;  3VEX A;  3UKU B;  1BOT O;  1ASU A;  3UKR B;  2UYT A;  3AVM A;  3BY5 A;  4FLV A;  4AM6 A;  3TAE A;  3IFR A;  1NNE A;  3AA5 X;  2QXF A;  3NVK A;  4ISF A;  3WXL A;  1YT3 A;  3VES A;  2P9P A;  2Z1J A;  3VEV A;  4CJQ A;  3TAN A;  1VQ5 N;  4B3R K;  1UWB A;  2D0C A;  1K9M O;  4BR0 A;  4B9V A;  1HUX A;  1Q18 A;  3CD6 N;  4CGJ A;  3BGR A;  3OVN A;  1NOZ A;  4CFC A;  4Q0B A;  1GLA G;  1GLD G;  5AQR A;  2AJQ A;  2OZM A;  4CBX A;  4CEC A;  4DR1 K;  3RWU A;  2HHX A;  4O0J A;  5GIN A;  3U6F A;  3C65 A;  4RWT A;  2ZJQ L;  4AHR A;  1K8K B;  1JLA A;  3MN5 A;  3OJU A;  4FJX A;  2FF3 B;  2FF6 A;  4DF4 A;  4DR7 K;  2HBM A;  4B8A B;  3DI6 A;  3T1A A;  4FJJ A;  4Z4H A;  5C12 A;  2VG6 A;  2NRZ A;  1I94 K;  4IO9 L;  1GOA A;  1VQ6 N;  4KB0 A;  1KC8 O;  4KB1 A;  4X64 K;  4GNI A;  4CZI A;  1TV6 A;  2W41 A;  4B1U B;  5AQT A;  3CM5 A;  3J80 O;  5CHI A;  4BRC A;  4LF9 K;  2OAN A;  4FVU A;  2YJF A;  3LL3 A;  3HT3 A;  4BRP A;  4DV0 K;  4AHU A;  3LM9 A;  1HRH A;  2O8F B;  3SAH A;  4H03 B;  3DLR A;  1A5W A;  3CCM N;  1SL1 A;  2Z1G A;  3MXI A;  1WLJ A;  2LSN A;  3NBP A;  1IKX A;  2HMP A;  4B8C A;  3TTF A;  4MO5 A;  1OH6 A;  5DM6 L;  3FLC O;  3NF8 A;  2HF3 A;  3CCV N;  2JWL A;  3FE1 A;  3WUH A;  1G99 A;  2C1G A;  3PIP L;  3IG1 A;  4KHN A;  5JMV A;  1W0H A;  4CZM A;  4CK3 A;  4O8U A;  2A41 A;  2FLO A;  3RMA A;  4DSK A;  1RDA A;  4IOC L;  5LMU K;  4GKJ K;  1QVF M;  4BC4 A;  2BGG A;  3QIO A;  4YOW A;  1TKZ A;  4A5A A;  2X78 A;  3L4I A;  2ZF5 O;  3HM8 A;  4ISE A;  3CYM A;  2IVP A;  5SWM A;  2DFF A;  3R1X A;  3V9X A;  4E19 A;  1L3S A;  1DGK N;  2IC3 A;  5E84 A;  5GAE P;  5FPN A;  3SCX A;  3T19 A;  3CFP A;  3O1W A;  4M7X A;  4KHP K;  1ZBL A;  1S1X A;  4OX9 K;  1NJI O;  1SKR A;  1BIU A;  3RSE B;  2NRW A;  3U3Y A;  3AVG A;  1VSM A;  3EEQ A;  2A6A A;  3LAK A;  4DFJ A;  4BRM A;  4JLH A;  4AM7 A;  4NB4 A;  2HNY A;  4EP5 A;  1LAW A;  1RBT A;  3FZL A;  3CJB A;  4BRK A;  1TL3 A;  4CJP A;  2B5J A;  4QS7 A;  4CZJ A;  4CF0 A;  4JS4 A;  1YHQ N;  2E88 A;  2XHB A;  2IVN A;  3WXJ A;  1GLF O;  4FM1 A;  3S3M A;  3ZSY A;  4BGB A;  2O4G A;  3OYE A;  2CH5 A;  5J2P A;  4LFA K;  1NBW A;  3CI5 A;  1ZBS A;  3FGU A;  5AQP A;  4N76 A;  2E2P A;  3QO9 A;  3LWL A;  4DV6 K;  2FBT A;  2FBY A;  4FZY A;  4AHT A;  3MMV A;  4XH5 A;  3WXK A;  1RIL A;  3ZSZ A;  4CHP A;  3C7N B;  3CHW A;  1JCG A;  4DV2 K;  3N4P A;  3SQ2 A;  3L3V A;  1JXB A;  4FWS A;  3TWH A;  3SQ4 A;  3VQD A;  1WBD A;  4FW2 A;  4FJH A;  3ZT2 A;  5AQJ A;  3DXM B;  4JRP A;  4OLB A;  3UIQ A;  2ZGZ A;  4C23 A;  3KLH A;  5BPL A;  3THX A;  3LPT A;  3DLG A;  2W00 A;  3QEW A;  3SZ2 A;  4CF2 A;  1RT1 A;  2F4V K;  2VWK A;  4CJE A;  4KH4 A;  3L2R A;  3H6E A;  2KW4 A;  3O6W A;  1WSE A;  3KD1 E;  3L8B A;  1NGE A;  3F73 A;  2QW9 A;  1NU0 A;  4PL7 A;  4X65 K;  5BR8 K;  3SUO A;  4NLC A;  3SJH A;  3AVF A;  3IKM A;  1WAJ A;  3QML A;  1U47 A;  1ZBU A;  4FWQ A;  4KV8 A;  1NK8 A;  1Q9X A;  3LDL A;  3KK7 A;  4FK4 A;  1XHZ A;  4DLE A;  4JEP A;  3H3N O;  1JL1 A;  2QEX N;  3ENB A;  3U3G A;  4CED A;  3MEC A;  3UE5 A;  4I9L A;  3D0P A;  3QFU A;  4CGF A;  4DCH A;  4M3Z A;  2D1K A;  3VTI A;  2G8H A;  3ULE B;  4FJL A;  1XI1 A;  2A1R A;  1L5U A;  1BIZ A;  1ESV A;  3ZX0 A;  3V1R A;  2P9I A;  4XH1 A;  2QTD A;  4ILH A;  3VPZ A;  1VSK A;  1BIS A;  1HYZ A;  3SPY A;  4JHD B;  3KK3 A;  4FLZ A;  4YOX A;  1X3M A;  4CFD A;  3QNO A;  4CJK A;  4C8N A;  4LF5 K;  2O8E A;  4JKD A;  1P8Z A;  4LSL A;  3W0L A;  2P9L A;  1TYQ B;  4B1X B;  3OBY A;  4J2B A;  4CK2 A;  4JI6 K;  4WQ5 A;  1IBM K;  4FPA A;  3OTO K;  4LSN A;  1HPM A;  3FFI A;  4O4G A;  1J5E K;  3D6R A;  3OYN A;  5EXW A;  3VQC A;  5AQK A;  3SI6 A;  1IBK K;  5FPE A;  4DV5 K;  4C8M A;  2E2O A;  2NRV A;  4EFH A;  3H08 A;  4K8Z A;  1VSI A;  4F2R A;  4XEI A;  5LJV A;  3CJC A;  3TTD A;  4DQR A;  5M1Q A;  1T03 A;  4WFN L;  4FLY A;  3K9K A;  1SKW A;  1C0U A;  4I9Q A;  4EP4 A;  5AQF A;  4EZ6 A;  2UU9 K;  4HCC A;  3TI0 A;  5EY4 A;  1Q7Y O;  4FWK A;  5AQY A;  5SZT A;  5HRO A;  4DR6 K;  3VF2 A;  2HMI A;  2CGK A;  3TU5 A;  4RCH A;  4JS5 A;  3ZSX A;  5AJ3 K;  3I8B A;  4FJI A;  1RCH A;  3G6E N;  4OJR A;  3DLE A;  1HKC A;  4O0I A;  3VEO A;  4KI6 A;  3P4I A;  5C2F A;  3I55 N;  1RT3 A;  4CEA A;  3VTH A;  3M8R A;  4B9T A;  4J2D A;  3MEE A;  3THX B;  1BQN A;  2Q1N A;  3HPO A;  1NJY A;  1NMD A;  4DFK A;  2E4L A;  5FPM A;  1J6Z A;  5HRN A;  4BDP A;  1Z25 A;  2RE2 A;  4A61 A;  1Q86 O;  3VQ9 A;  3MAQ A;  3T69 A;  4YOR A;  1RBS A;  2E8A A;  2YCH A;  2GBZ A;  1T3V A;  4LH5 A;  3WQT A;  1K73 O;  4NCB A;  4B3O A;  3E9O A;  3DRS A;  2QA4 N;  1FW6 A;  4KKO A;  3OA9 A;  3VQ7 A;  3VN5 A;  2E6M A;  3UB5 A;  2RF2 A;  4EAH D;  5AFU A;  3AAP A;  3Q7C A;  1S72 N;  2QWM A;  5BRF A;  3DLH A;  4YY3 K;  3ZLJ A;  3MED A;  2HVH A;  3ZYY X;  4Q5V A;  2HF4 A;  1LWC A;  4YDU A;  1EP4 A;  3F2K A;  4FW1 A;  3NGI A;  1VSL A;  3THY B;  3ZT3 A;  2PY5 A;  4BWJ A;  2FBX A;  4NXM K;  5MLC Q;  1JLF A;  4BRA A;  1REV A;  1N36 K;  4FZZ A;  3WQU A;  1N34 K;  2H3G X;  4BE7 B;  4DG1 A;  3DRR A;  4KFB A;  4CFA A;  4FSV A;  3VGL A;  5BN9 A;  3SMP A;  3PO4 A;  1S1T A;  3AO5 A;  4Y1C A;  3MWT A;  5CR4 A;  4PY5 A;  4NO7 A;  4DSE A;  3ATU A;  2KFZ A;  2QI2 A;  3V9W A;  1TYQ A;  4CES A;  3LP2 A;  1KVC A;  4DR2 K;  4BRG A;  5ELZ A;  4FWN A;  2EX3 A;  4DQI A;  1VHX A;  4R5P A;  4DR5 K;  3OS1 A;  1BI4 A;  1X9J A;  3T1Y K;  5DK5 A;  1DTT A;  1RTH A;  4IDK A;  1N32 K;  5LL6 Z;  1GOB A;  3D2F A;  4DU1 A;  1NGB A;  1KVA A;  2Q0U A;  4E1J A;  1GOC A;  3WXM B;  1KLN A;  4HTL A;  1L3U A;  3VMF B;  3ZEU A;  1VQM N;  2P9S B;  4OKK A;  2Q31 A;  3VEZ A;  3MN7 A;  2AA4 A;  3V1O A;  4IOA L;  2YKM A;  1KXP A;  1ZBI A;  5AQV A;  4CZL A;  1U48 A;  3S9H A;  3DLL L;  4B9L A;  1B9D A;  3NH0 A;  2A40 A;  2P9U A;  5KTQ A;  1M90 O;  3BEX A;  4BR9 A;  4O5B A;  4K0K K;  3KTQ A;  1B9F A;  3KKS A;  3F5T A;  1KAY A;  3P31 A;  4ILG B;  3V9U A;  4DWI A;  2A1S A;  1BU6 O;  2OA8 A;  2HHV A;  1EX4 A;  5J2M A;  3THW A;  1QQC A;  1RBR A;  4MDB A;  4CGG A;  3LWM A;  1VK0 A;  4K42 A;  1FKO A;  1XUP O;  1IG8 A;  4ILJ A;  4AH9 A;  4CJT A;  1T05 A;  4B9M A;  2WUS A;  1GLB G;  4CHQ A;  3VQ5 A;  2WTU A;  3O8M A;  1OH7 A;  3L2Q A;  1J54 A;  3A5M C;  5GAG P;  1XMQ K;  1TVR A;  4BRD A;  3JS6 A;  4O55 A;  3TAB A;  3VF4 A;  1C1C A;  1VSD A;  4CF9 A;  3HOS A;  1C6V A;  3NF6 A;  1D8Y A;  1EKE A;  3EL2 A;  2UXD K;  2OTL N;  3AVA A;  1RDD A;  4WQ5 C;  3KHY A;  4CHN A;  5HBM A;  5C24 A;  3AO2 A;  1QE1 A;  3KLF A;  2ZWH A;  2G8W A;  2YHW A;  2F8S A;  4KO0 A;  5CZ1 A;  4KH5 A;  5HL7 L;  3DXM A;  2NUB A;  4JK7 A;  4KPY A;  1VSE A;  2DPN A;  3QBW A;  4YFU A;  4DSL A;  1ZXO A;  2WC9 A;  1CZA N;  1S3X A;  1U4B A;  3LDN A;  4PQU A;  1OVQ A;  4JI4 K;  5EU7 A;  3NGZ A;  3HBT A;  3W3D A;  4BR4 A;  2OTJ N;  2P1J A;  4WF9 L;  4WYB A;  2GTD A;  3V6D A;  4BDY A;  3ZET B;  4FWP A;  3WXI A;  1OKJ A;  2IDO A;  2YNI A;  3R3L A;  4RW7 A;  3J7Z O;  3C6T A;  4Z0U A;  5GAD P;  2RKI A;  1LW2 A;  5KQ8 A;  4FJN A;  4KI4 A;  1KSP A;  3P5J A;  2GWJ A;  4YNQ A;  3SMS A;  2GEM A;  5ADX A;  3CME N;  2DFE A;  3CJA A;  2HST A;  4WFB L;  3DOK A;  1IJJ A;  3HI0 A;  3L4Q A;  5BRH A;  1SS6 A;  4DTO A;  1OVY A;  1NWK A;  1RT2 A;  2FSJ A;  4JKG A;  4AHV A;  4GVM A;  2FBV A;  4NYF A;  2IIR A;  3WNE A;  4LF7 K;  1UA1 A;  2WON A;  4MLH A;  3AVK A;  3QDK A;  4HUF A;  3A5O C;  4DR3 K;  5TKY A;  3MX5 A;  3CMA N;  3HRG A;  4BR7 A;  4JKF A;  3LAN A;  1KQS M;  5JLF A;  1YJW N;  1B92 A;  5FDL A;  1RT4 A;  2D0O A;  4JKC A;  4LC9 B;  4JRQ A;  3I0S A;  3ZT4 A;  3H46 O;  4KAZ A;  3K5M A;  4FLU A;  4FJ8 A;  3QIN A;  1Q81 O;  4Z4G A;  3A8Y A;  4QAG A;  4Z4E A;  4IKF A;  4CI6 A;  1WUA A;  4E7H A;  4C8K A;  3O3F A;  3K59 A;  3NDK A;  1LV5 A;  3LDS A;  5KPT A;  1Z26 A;  1HJO A;  2E6L A;  1K8A O;  2G8I A;  3H1V X;  3I8D A;  3CQX A;  1QSY A;  2XY7 A;  1WB9 A;  2D0A A;  1JLQ A;  3R8E A;  2YNF A;  4E7K A;  1J9A A;  3AA2 A;  4M41 A;  4G9Z A;  2JGU A;  2OPR A;  4B3T K;  2QWL A;  5AZI B;  5EOY A;  4W5R A;  1YF5 L;  4JN4 A;  3D7E O;  3CCL N;  4CBW A;  4FWR A;  1RTJ A;  1N33 K;  1W9H A;  1RDW X;  4CZF A;  3SV4 A;  4H5V A;  4Y0W A;  1EO1 A;  3IUC A;  4K43 A;  4CF1 A;  3IDH A;  1NOY A;  4IFE A;  2ITM A;  3SLC A;  2RHK A;  2O4I A;  5KPZ A;  3CC7 N;  3CYG A;  4W5O A;  1HNX K;  4OPK A;  3OYG A;  4BEC A;  2KHO A;  4B1Y B;  4YHH K;  2PAV A;  3UKU A;  1XC9 A;  2NRT A;  2GUP A;  3ZT0 A;  2VWJ A;  3HXM A;  2ASO A;  4JNE A;  3LDO A;  5F2R A;  3TAP A;  3OYK A;  4FJ7 A;  1LWE A;  4NCA A;  4RW4 A;  3V81 A;  4J2A A;  1LOT B;  2HHS A;  1NGJ A;  3KD5 E;  3NF7 A;  1VQ4 N;  1RNH A;  4H0Y B;  3RMD A;  2O8C B;  4ISG A;  5AQX A;  4KHS A;  4CZK A;  5C25 A;  1RT6 A;  1HKB A;  2CGL A;  3NAE A;  4M45 A;  1QS4 A;  3PX4 A;  3K57 A;  3PLA A;  3LZI A;  4DV1 K;  3ZET A;  4KTW A;  4KH6 A;  3H3O B;  1QSL A;  4CBU A;  1E4G T;  5CYM A;  5FLX O;  5JVH L;  2Y1I A;  1GLJ O;  5E41 A;  4YDU C;  2CH6 A;  1ZC6 A;  4RW8 A;  3VEY A;  1T8E A;  2QXL A;  1H1V A;  1GLC G;  2ZE2 A;  3LP1 A;  5AQL A;  4PUO A;  2F8T A;  1I3A A;  3C95 A;  2F96 A;  4JKE A;  4K41 A;  1IKY A;  3D2F B;  3VOV A;  3GG4 A;  4PL8 A;  4M3U A;  4CE9 A;  3K5O A;  4CJR A;  1V4T A;  2QKB A;  4NCG A;  3NE6 A;  4M3X A;  3THY A;  3KWI A;  4YOY A;  3KVG A;  3HOT A;  3CCJ N;  3QBX A;  3AVC A;  3OW2 M;  3G10 A;  4PA1 A;  4W5Q A;  5KRS A;  3PIO L;  5DMR A;  1IO2 A;  4MFB A;  1SUQ A;  2O8D B;  4F8R A;  3MCP A;  5LJW A;  1EQY A;  4FM2 A;  2DTU A;  4DTX A;  2QK9 A;  1TAU A;  3GOI A;  2CGJ A;  4OKE A;  1SL2 A;  1BG3 A;  5KRT A;  2XY5 A;  2X6S A;  4L3Q A;  4ZHR A;  4JK8 A;  4FXD A;  4BE1 A;  3QEX A;  3AY9 A;  3LM2 A;  4X62 K;  5I3U A;  3TSQ A;  5JVG L;  4DTS A;  2WOM A;  3MEG A;  4F9O A;  5M1N A;  3SV3 A;  1D9D A;  1S1U A;  2D0B A;  2ZQB A;  3QB0 A;  1RDC A;  3B6P A;  3ULE A;  1GLL O;  4GV6 A;  4I6M A;  1VRU A;  2E1Y A;  4IG3 A;  1HKG A;  3K58 A;  3O9T A;  4IFV A;  4L8R B;  4M7Y A;  3CCR N;  5HRS A;  4PKH A;  3ZT1 A;  5CYQ A;  4U67 L;  4GMJ B;  3MWP A;  2HVI A;  3WEE A;  2HHI A;  1QZ6 A;  5JS2 A;  4YOV A;  4BWM A;  4OVL A;  2PYL A;  1S6P A;  4FJ9 A;  3ITH A;  1Y64 A;  1YVN A;  4FWO A;  3QEP A;  4A62 A;  4CEE A;  4CER A;  4HWI A;  1TGO A;  1N8R O;  3K2P A;  4B9U A;  1DKG D;  1D4X A;  3WNF A;  2Y1J A;  1NJW A;  4BDZ A;  4BRQ A;  4F2S A;  5AQM A;  1X9W A;  4FZX C;  1EWR A;  3LZJ A;  3G25 A;  4B3M K;  1WSH A;  2A42 A;  4QCL A;  2W42 A;  2PZS A;  4HVJ A;  3HST B;  1ZYQ A;  1JLG A;  4MDA A;  2EHG A;  4CEQ A;  5LMN K;  5GAH P;  3OYB A;  1Q8I A;  3T1H K;  1RBU A;  1RGI A;  2GX9 A;  4HUG A;  3VF6 A;  4R79 A;  4M3Y A;  4DB3 A;  4MQ3 A;  4JKH A;  5AQH A;  1V4S A;  4RW9 A;  4C1N K;  4CFB A;  1KAZ A;  4ZTJ A;  1KD1 O;  4DV7 K;  4FJG A;  3CJ1 A;  2VQE K;  3QEV A;  2KZZ A;  3SAG A;  4LD0 A;  3LP0 A;  2ASP A;  3CPW M;  2F7T A;  4IZ9 A;  3PV8 A;  1U6Z A;  1BQM A;  2ATQ A;  4PKG A;  4NYN A;  3K5N A;  4H5N A;  5C2D A;  1HNV A;  3OS2 A;  2G8F A;  4AHS A;  3VQA A;  4LF6 K;  1NGG A;  2UUA K;  4FOI A;  3G4S N;  4O5F A;  4N47 A;  1YAG A;  3VQB A;  4CW7 B;  5KPR A;  1VQ8 N;  3CM6 A;  4IEE A;  2KLA A;  4FLT A;  1SQK A;  5AQZ A;  3PX6 A;  1BCO A;  1DLO A;  4JKG B;  3FZH A;  3OYA A;  4OGE A;  3VET A;  1VQO N;  1YJ9 N;  1LAV A;  4BY9 C;  3PUF A;  1S22 A;  4CZH A;  4DSJ A;  3AGR A;  4CHY A;  4GVE A;  1KRP A;  3AVL A;  3LAM A;  2V52 B;  3K9J A;  2KQ2 A;  2GEL A;  3OBW A;  1BHL A;  3L2V A;  3D2E B;  3MXJ A;  3LPU A;  3CQY A;  3SYZ A;  3TAG A;  1HNZ K;  1BI4 B;  3E1Y A;  4WE1 A;  5BPN A;  3QER A;  3FZF A;  2ZM6 K;  1SKS A;  4BVO A;  4IOX A;  1VRT A;  1X1P A;  2E1Z A;  3SBT A;  4CD1 A;  2HB5 A;  2VG7 A;  1NK9 A;  3DXK B;  3F9K A;  4I6M B;  5AR0 A;  4DSI A;  4BG9 A;  1RDB A;  4H0P A;  4BRF A;  4DTJ A;  3HPH A;  4BQZ A;  5F0X A;  3O9Q A;  4CF8 A;  3OS0 A;  2P5O A;  3BZK A;  3FFK B;  4IFY A;  3WEE B;  2HNZ A;  4JKB A;  2PYJ A;  1FJG K;  2P9I B;  4FJK A;  3C0B A;  3BUZ B;  4KTZ A;  1I39 A;  5AQG A;  4JHD A;  4DV4 K;  3E66 A;  3V9S A;  4WFA L;  3OYF A;  1U04 A;  1WSG A;  2XRI A;  1JLC A;  1VSJ A;  2EWS A;  4I2Q A;  4AHC A;  4E89 A;  4N56 A;  3CQ8 A;  5KQD A;  3P38 A;  3B6O A;  4DQS A;  1QTM A;  4K25 A;  3ID8 A;  1KCF A;  2VYP A;  2YJE A;  3CET A;  4Z4C A;  1NK6 A;  2G8V A;  4ID5 A;  3CC2 N;  2I7P A;  2P5G A;  4B1W B;  3HZ6 A;  4DQ8 A;  4IJN A;  3VQ6 A;  2IGI A;  2P9S A;  1OH5 A;  2ZGY A;  1QSS A;  1Z05 A;  1NGF A;  4DUZ K;  5AFU H;  1BDG A;  3CCU N;  1TAQ A;  3E9P A;  1K8K A;  4BRE A;  1UA0 A;  4JI3 K;  3VQQ A;  1U2V B;  3JAM O;  5T7B A;  4Z94 A;  4M3W A;  1DEJ A;  4FCY A;  1NKE A;  3A5N C;  3HM9 A;  2IVO A;  3P83 D;  1BL3 A;  1D9F A;  2V51 B;  4BGA A;  2NZT A;  4BRI A;  2A3Z A;  4B1V A;  4FL9 A;  1FKP A;  3OYI A;  3RRH A;  4FK0 A;  4ELT A;  1ILY A;  2OZS A;  2P9N B;  3DOL A;  4FM0 A;  3E9L A;  4KHQ A;  3J7Y P;  2YHB A;  1Z6R A;  3AO3 A;  3HVT A;  5BPM A;  2OYQ A;  1QQO A;  2IOC A;  3IS9 A;  2NRX A;  2B4J A;  2ZJR L;  4CIG A;  3TAM A;  1YIJ N;  1VQL N;  3CJ7 A;  3AVJ A;  2RPI A;  4DS5 A;  4J2E A;  4JI8 K;  4DTP A;  3SBG A;  2QWR A;  4ELU A;  2J4R A;  3FZM A;  4HCB A;  3CG7 A;  4W5T A;  1T44 A;  2P9K B;  1NGH A;  1QQM A;  4OPJ A;  2QKK A;  1X3N A;  1S1W A;  4BRH A;  1A5V A;  5AQI A;  3CPE A;  2F9W A;  3M8Q A;  2F9T A;  1JXE A;  3M1F A;  3HPG A;  1N6Q A;  2ETJ A;  4BRN A;  2Q97 A;  4CJ5 A;  3CF5 L;  3KZB A;  5DM7 L;  3O4Q A;  4BR2 A;  3CFR A;  3Q7B A;  4WQ4 A;  5B8H A;  1MWM A;  3CCS N;  4I7F A;  2VWB A;  1TKT A;  1C1A A;  3ATV A;  2BDP A;  4Z4F A;  3HVR A;  1TK0 A;  4PHT X;  4AQY K;  2BH1 A;  1MDU B;  2UUB K;  3THV A;  1R59 O;  1N5Y A;  2E20 A;  3AA3 A;  4E1N A;  4N5S A;  2YNH A;  3TR8 A;  4CGD A;  3U4L A;  4DTU A;  4F3T A;  4DFP A;  4JK9 A;  2PFU A;  5KI6 A;  1NKB A;  3OY9 A;  2ASM A;  4BQL A;  4OPH A;  2NLX A;  5D3G A;  4H0V B;  4CK1 A;  3SJJ A;  2QM1 A;  3O5B A;  4H0X B;  4XIU A;  4H5W A;  4K8X A;  1WSF A;  1RDU A;  2UUC K;  1HQU A;  3LDQ A;  3KK1 A;  5IWA K;  3MDQ A;  4GV9 A;  2V7Z A;  5CY4 A;  3AV9 A;  1EXQ A;  2IAJ A;  3O80 A;  3KWG A;  1XHX A;  1X9M A;  3NVM A;  3QNN A;  5C15 A;  4DF8 A;  3T3F A;  2BUP A;  3JXU A;  5JIC A;  3O4N A;  1S1V A;  3NF9 A;  3EN9 A;  3M5R A;  4OLA A;  3BF3 A;  2B6A A;  5TKW A;  2FSN A;  2YI1 A;  1WSI A;  4OGC A;  3C94 A;  1ASW A;  4H4O A;  3V1Q A;  4E1M A;  4A5B A;  1C0F A;  3O9U A;  1IBL K;  3AA4 A;  2P9P B;  2FSK A;  3M8S A;  5AZI A;  4QS8 A;  4Z4I A;  1NK0 A;  3U9Z A;  3VEW A;  4UY8 O;  4M3R A;  2O8B B;  2I7N A;  1VQK N;  4RG8 A;  4O44 A;  4PWD A;  4CZG A;  3QES A;  1SL0 A;  4DSF A;  3TAQ A;  3SK3 A;  3PY8 A;  4DS4 A;  5I9E B;  1O1W A;  3L6Q A;  4C8O A;  4PKI A;  4E7J A;  1W97 L;  4LFB K;  4WQ4 C;  4CJF A;  4JKA A;  4JI0 K;  2RN2 A;  1LWF A;  4H8K A;  3DLB A;  1ITG A;  4EIA A;  1LCU A;  4MLE A;  4FWM A;  2GV9 A;  3I33 A;  1YTA A;  3L2W A;  5H1S Q;  5AQO A;  3UKR A;  4CZE A;  1NGA A;  1WAF A;  4CEO A;  4KTQ A;  3SUN A;  2VQF K;  1F21 A;  2BAN A;  1G15 A;  4IWV A;  4JD2 A;  3HSC A;  2BTF A;  3ZSV A;  4LF4 K;  4YOU A;  3SUQ A;  3SPZ A;  3B8A X;  1ZBF A;  2UXC K;  3VQE A;  1TL1 A;  2Z1H A;  1NK4 A;  3N4Q A;  1M1K O;  5J2Q A;  4F3O A;  4CJV A;  2YHX A;  4EHT A;  4BC5 A;  1KFD A;  3S5T A;  3EE9 A;  3SQ1 A;  4EHU A;  5FRM A;  3LP3 A;  3ULD A;  3IRX A;  1RBV A;  1HNW K;  4QS9 A;  4G1Q A;  4BC3 A;  1HLU A;  3O08 A;  3CIP A;  1KTQ A;  3FZK A;  5ADX H;  4CVN E;  3NFA A;  1WBB A;  3OJS A;  4BRO A;  3E01 A;  4BAC A;  1VQ9 N;  4B9Q A;  5BN8 A;  3A0I X;  3AO4 A;  3NHG A;  1NJX A;  1QHA A;  2Z1I A;  3K5L A;  2O8F A;  1BCM A;  4CJ4 A;  1YI2 N;  4CJL A;  1YVU A;  1K6Y A;  4LF8 K;  5JS1 A;  2ITG A;  3SAF A;  4KHU A;  4DMN A;  3VER A;  3TTC A;  1Q82 O;  3OYL A;  1T7P A;  2HBK A;  3A5L C;  2HBL A;  4DQP A;  4BR5 A;  4FPB A;  3IAY A;  3SQ0 A;  1OH8 A;  3K0S A;  3MXM A;  2W6L A;  5C10 A;  5CE3 A;  3HP6 A;  4FWL A;  1IH7 A;  4CJU A;  1L3T A;  1TUY A;  2VGM A;  3C6U A;  3GL1 A;  5A2Q O;  4GW6 A;  3D2E A;  2X74 A;  1DT9 A;  3AO1 A;  3TSU A;  3MX2 A;  4FLW A;  1YJN N;  4I2P A;  2ZD1 A;  2W40 A;  2AP1 A;  1NKC A;  3VEN A;  3VA0 A;  5GIP A;  3QET A;  4IO8 A;  1QQN A;  2E5L K;  4OO1 J;  3EY1 A;  1HYS A;  4TSX A;  1S9G A;  2A5X A;  4H5T A;  3VGM A;  2NRH A;  4LY7 A;  3TPQ A;  4CEZ A;  1WNS A;  3S41 A;  3OYM A;  1NMN A;  4E7L A;  3SUP A;  4IJA A;  2HHQ A;  3EO3 A;  4F4K A;  2UXB K;  3HJF A;  2HBJ A;  3RSE A;  4HHT A;  3NCI A;  1VSF A;  4ID1 A;  4FOE A;  1ATN A;  1NJZ A;  3HK2 A;  3OYJ A;  3U8X A;  1JLB A;  1BGX T;  3ZX2 A;  4BE0 A;  4ICL A;  2O8D A;  4U7B A;  4CGH A;  1WSJ A;  3QIC A;  2Q2R A;  3CJ9 A;  1YTU A;  4DUY K;  3R6M A;  4UQG A;  4DTR A;  3PSF A;  1U49 A;  3V4I A;  1XNR K;  3OHR A;  1KVB A;  4NLB A;  4CIF A;  3G0Z A;  4FJ5 A;  1VSH A;  3RTV A;  1RT7 A;  1UAX A;  4OPA A;  5LY3 A;  2YV0 X;  4HUE A;  1TK5 A;  4E7I A;  3HYF A;  3DMJ A;  1U2V A;  3ZSR A;  3DWL A;  1ASV A;  5EX5 A;  1NGI A;  4XH4 A;  3PX0 A;  2XY6 A;  3O3H A;  2Q0R A;  3TAF A;  1HX1 A;  3EKU A;  3ZX3 A;  3FR0 A;  3M8P A;  3CC4 N;  3BP8 A;  3P1G A;  3C7N A;  3O1B A;  3MN6 A;  2YX6 A;  3F9M A;  5K14 A;  1C1B A;  3WT0 A;  4JI1 K;  2KKZ A;  2YKN A;  1D5A A;  1JLE A;  3G71 N;  5HRP A;  2C1I A;  1HJR A;  3S3O A;  3C6H A;  5AQS A;  1CZB A;  4HTU A;  2GUI A;  2BE2 A;  4E0D A;  2V7Y A;  5FRN A;  5KGX A;  1J5O A;  4LFC K;  1KLM A;  1IKV A;  2W6K A;  1EWQ A;  3DLK A;  4B9N A;  4KRF A;  5FPD A;  4X66 K;  3GE1 A;  1CXU A;  1XC3 A;  2WFB A;  2P9N A;  1S6Q A;  3ENO A;  1NGC A;  4H0O A;  3LAL A;  4FVM A;  4FLX A;  1NM1 A;  4IEI A;  2O8C A;  5M1F A;  4DV3 K;  4KRE A;  3VA3 A;  2VG5 A;  2HW3 A;  2VCP A;  3KIO A;  1GLE G;  1XWL A;  3S3N A;  4BRL A;  4BG8 A;  4A2A A;  3ID6 A;  3AVB A;  3O4W A;  4CEB A;  1HQE A;  4B3S K;  4KHY A;  1O13 A;  3DAW A;  3ZSQ A;  2OPQ A;  3I0R A;  4IBN A;  2E2Q A;  1VAZ A;  3R9P A;  2OCE A;  2P51 A;  1RTI A;  2GWK A;  4ELV A;  3EZ5 A;  1HPZ A;  4LH4 A;  1C0G A;  3NMU A;  5C0Y A;  3OYC A;  3EE8 A;  4A2B A;  5M1O A;  2QWN A;  3KLI A;  3L0Q A;  1EET A;  1XMO K;  1ATR A;  3DRP A;  3CXC M;  1IKW A;  5M1P A;  5AZJ B;  4DR4 K;  3EZW A;  2FC0 A;  3AGK A;  3H45 C;  2HHH K;  1QHT A;  5JEN A;  4C1N I;  5IT9 O;  5HOO A;  3NH1 A;  4CHZ A;  4M42 A;  3I56 N;  4B08 A;  4RW6 A;  3RMB A;  3CFO A;  4CD3 A;  1CXQ A;  2YHY A;  1TKD A;  3VQ4 A;  1YXQ A;  3J7A P;  4CGI A;  1RT5 A;  2PBD A;  2O8E B;  4BC2 A;  2HHT A;  1R0A A;  2HHU A;  4DTM A;  1W2B M;  3LDP A;  4NXN K;  4O8K A;  1VQ7 N;  4IG0 A;  1QZ5 A;  3SNN A;  3L3U A;  2XY8 A;  4DKW A;  1XNQ K;  1S5J A;  3DXK A;  5GIO A;  3BDP A;  4KHW A;  4EZ9 A;  4W5N A;  5BRE A;  1TK8 A;  4FK2 A;  2HOE A;  3IMX A;  4M3T A;  1WOQ A;  2OPS A;  2ZJP L;  1JL2 A;  4H0T B;  3KJV A;  3OYH A;  1NLV A;  3ENH A;  5FRO A;  1BA1 A;  4E72 A;  3C6A A;  4AF1 A;  1XQS C;  1KFS A;  3VQP A;  1FXX A;  4JAX A;  1DTQ A;  2O8B A;  3HP9 A;  1UOC A;  3DM2 A;  4M63 C;  5F1X A;  4A59 A;  3PO5 A;  2G8K A;  2Q3S A;  3VGK A;  3CCQ N;  1NG9 A;  2XO7 A;  4IDH A;  4BVP A;  3TAR A;  4DU4 A;  2JLE A;  3OYD A;  3EKS A;  1HYV A;  3AVN A;  3AVH A;  1JKH A;  1ATS A;  3JSM A;  3O9R A;  2NRR A;  2YHA A;  3MN9 A;  5HRR A;  1MA9 B;  4JD2 B;  1VQP N;  3KK2 A;  3RVC A;  3KLE A;  1BA0 A;  5KGW A;  3DJC A;  1HNI A;  3NH2 A;  1HMV A;  4AIL C;  1C0M A;  1SV5 A;  1JCF A;  1MU2 A;  2HND A;  3T7Z A;  4WCE L;  3MCA B;  2KFN A;  1SZ2 A;  3GBT A;  3BZC A;  3KLG A;  2D0P A;  2R7Y A;  3O3G A;  1IV0 A;  1MWK A;  4A57 A;  3MK6 A;  2DY4 A;  1T6D A;  4DU3 A;  3CER A;  3D45 A;  2P9K A;  3WNG A;  4JV5 K;  4H4M A;  1BUP A;  3ALY A;  3KKR A;  4FJM A;  3RMC A;  3ISN C;  2YNG A;  1U45 A;  3AAQ A;  1IG9 A;  5I42 A;  1L3V A;  4B9S A;  4DTN A;  2X6N A;  2QWQ A;  4E3S A;  4OKJ A;  2I5J A;  1A5X A;  5M1K A;  1JJ2 M;  1ZBH A;  4C8L A;  2QWO A;  2WBN A;  5AQN A;  3ZSW A;  1S9E A;  5EVZ A; 
#chains in the Genus database with same CATH homology
 2QWP A;  3TTD A;  2I7N A;  5M1Q A;  5BRD A;  1VQK N;  4GV3 A;  1H1V A;  1GLC G;  3TSP A;  2JWK A;  2Q36 A;  1YUW A;  5AQL A;  4WFN L;  4CZG A;  1BO5 O;  3K9K A;  4FO0 A;  2D4W A;  3D2F B;  4JKE A;  1P90 A;  4K41 A;  3SK3 A;  3U9D A;  3VOV A;  3GG4 A;  4PL8 A;  5I9E B;  3L6Q A;  3QFP A;  4PKI A;  1W97 L;  4WQ4 C;  1JCE A;  4JKA A;  5AQF A;  1V4T A;  5EY4 A;  1Q7Y O;  1T6C A;  4FWK A;  4IXC A;  5AQY A;  5AZJ A;  3BF1 A;  3KWI A;  3VF2 A;  2CGK A;  3TU5 A;  4YOY A;  3KVG A;  4RCH A;  3HOT A;  3CCJ N;  3ZEU B;  3QBX A;  4EIA A;  1LCU A;  3OW2 M;  3I8B A;  4MLE A;  4FWM A;  1TUU A;  3AAR A;  3G6E N;  1HKC A;  3I33 A;  3VEO A;  3P4I A;  5AQU A;  3PIO L;  5C2F A;  3I55 N;  3VTH A;  5H1S Q;  1E4F T;  5AQO A;  3UKR A;  4CZE A;  1NGA A;  2E2N A;  4KBO A;  4B1Z A;  2Q1N A;  4CJ7 A;  5AQW A;  4MO4 A;  3MCP A;  5LJW A;  4IWV A;  4JD2 A;  1VQN N;  3HSC A;  1NMD A;  4J8F A;  1EQY A;  3GDQ A;  1J6Z A;  5FPM A;  2BTF A;  3H1Q A;  3GOI A;  2RE2 A;  2CGJ A;  4YOU A;  4A61 A;  1Q86 O;  3T69 A;  3B8A X;  1BG3 A;  4L3Q A;  4JK8 A;  3M6G A;  3N4Q A;  1M1K O;  4YOR A;  3CCE N;  4YOT A;  3AY9 A;  3LM2 A;  2E8A A;  2YHX A;  3P39 A;  4EHT A;  2VGN A;  2YCH A;  1T3V A;  3WQT A;  4BC5 A;  1K73 O;  1SAZ A;  3EE9 A;  3HTV A;  2NNW A;  3E9O A;  3TSQ A;  4EHU A;  5JVG L;  4XJX A;  2P9L B;  2QA4 N;  1QVG M;  4F9O A;  5M1N A;  3OA9 A;  1RFQ A;  3QB0 A;  1BWF O;  3ULE A;  4GY2 B;  3UB5 A;  4EAH D;  5AFU A;  4QS9 A;  3AAP A;  1HLU A;  3O9S A;  3O08 A;  4BC3 A;  3CIP A;  1GLL O;  3Q7C A;  4I6M A;  3FZK A;  5ADX H;  2E1Y A;  1S72 N;  4GV6 A;  1HKG A;  2QWM A;  5BRF A;  5E26 A;  5AQQ A;  1NGD A;  3O9T A;  4RTF D;  2P9U B;  4DHY A;  3ZYY X;  4M7Y A;  4BRO A;  3CCR N;  2HF4 A;  4PKH A;  1VQ9 N;  5JLH A;  4U67 L;  3MWP A;  4YDU A;  4B9Q A;  1KAX A;  5BN8 A;  3WEE A;  3F2K A;  1YIT N;  4BEB A;  3A0I X;  4H5R A;  1QZ6 A;  3J8A A;  4YOV A;  5BR9 A;  1QHA A;  3M3Z A;  1YI2 N;  1Y64 A;  5MLC Q;  2FXU A;  4BRA A;  1YVN A;  4FWO A;  4A62 A;  3SAF A;  3WQU A;  3VER A;  3TTC A;  1Q82 O;  2H3G X;  4BE7 B;  3VEX A;  4HWI A;  1BOT O;  3UKU B;  2HBK A;  3A5L C;  1N8R O;  1DKG D;  3UKR B;  2HBL A;  2UYT A;  1D4X A;  4FSV A;  3VGL A;  5BN9 A;  3SMP A;  4AM6 A;  4BR5 A;  4FPB A;  3IFR A;  4BRQ A;  3MWT A;  5CR4 A;  5AQM A;  5C10 A;  3NVK A;  5CE3 A;  4NO7 A;  4FWL A;  4ISF A;  3ATU A;  3G25 A;  3VES A;  2P9P A;  2QI2 A;  2A42 A;  3VEV A;  3WXL A;  1VQ5 N;  1TUY A;  2VGM A;  1K9M O;  1TYQ A;  3GL1 A;  4BR0 A;  1HUX A;  1Q18 A;  3CD6 N;  4MDA A;  4BRG A;  3D2E A;  1DT9 A;  5ELZ A;  4FWN A;  5GAH P;  3TSU A;  1X9J A;  3MX2 A;  1GLA G;  1GLD G;  1YJN N;  5AQR A;  1RGI A;  2GX9 A;  4CBX A;  3VF6 A;  4R79 A;  2W40 A;  4DB3 A;  3D2F A;  2AP1 A;  4JKH A;  1NGB A;  1V4S A;  5AQH A;  4C1N K;  3VEN A;  1KAZ A;  5GIP A;  4IO8 A;  1KD1 O;  5GIN A;  3C65 A;  1QQN A;  3CJ1 A;  1VQP N;  4RWT A;  2ZJQ L;  4OO1 J;  2Q0U A;  3SAG A;  1K8K B;  4E1J A;  2ASP A;  3MN5 A;  3CPW M;  2FF3 B;  2A5X A;  2F7T A;  2FF6 A;  2NRH A;  4H5T A;  4IZ9 A;  3TPQ A;  3VGM A;  1U6Z A;  3S41 A;  3WXM B;  4HTL A;  2HBM A;  3VMF B;  3ZEU A;  4PKG A;  1VQM N;  4H5N A;  5C12 A;  4IJA A;  5C2D A;  2P9S B;  2Q31 A;  3EO3 A;  3VEZ A;  2HBJ A;  2NRZ A;  1NGG A;  3RSE A;  4IO9 L;  3MN7 A;  4FOI A;  3G4S N;  1VQ6 N;  2AA4 A;  4O5F A;  1YAG A;  1VQ8 N;  5KPR A;  1KC8 O;  4FOE A;  1ATN A;  4IEE A;  4GNI A;  3U8X A;  4CZI A;  4IOA L;  1KXP A;  3ZX2 A;  2KLA A;  2W41 A;  4B1U B;  1SQK A;  5AQT A;  5AQZ A;  5AQV A;  4CZL A;  4U7B A;  4JKG B;  5CHI A;  4BRC A;  3FZH A;  3DLL L;  2OAN A;  3QIC A;  4FVU A;  2Q2R A;  3CJ9 A;  3VET A;  2YJF A;  1VQO N;  2A40 A;  2P9U A;  1YJ9 N;  3R6M A;  1M90 O;  3LL3 A;  3BEX A;  4BR9 A;  4BY9 C;  1S22 A;  4CZH A;  4BRP A;  3AGR A;  3LM9 A;  3F5T A;  3OHR A;  4NLB A;  1KAY A;  3P31 A;  4GVE A;  4ILG B;  3SAH A;  2V52 B;  4H03 B;  3K9J A;  2GEL A;  3OBW A;  3CCM N;  4OPA A;  5LY3 A;  1BU6 O;  3D2E B;  2HMP A;  3CQY A;  4MDB A;  3TTF A;  4MO5 A;  5DM6 L;  3FLC O;  2HF3 A;  3CCV N;  1U2V A;  4K42 A;  3E1Y A;  2JWL A;  3FE1 A;  1XUP O;  1IG8 A;  3DWL A;  3WUH A;  4ILJ A;  1G99 A;  5BPN A;  5EX5 A;  1NGI A;  2C1G A;  4XH4 A;  3FZF A;  3PIP L;  4BVO A;  2WUS A;  5JMV A;  4IOX A;  1GLB G;  4CZM A;  2Q0R A;  3SBT A;  2E1Z A;  3O8M A;  1HX1 A;  3EKU A;  4CD1 A;  3A5M C;  3ZX3 A;  4O8U A;  3FR0 A;  5GAG P;  2A41 A;  4BRD A;  2FLO A;  3JS6 A;  3CC4 N;  3BP8 A;  3C7N A;  3O1B A;  4IOC L;  3MN6 A;  2YX6 A;  3VF4 A;  3DXK B;  1QVF M;  3F9M A;  4I6M B;  4BC4 A;  5AR0 A;  4YOW A;  3WT0 A;  2KKZ A;  4A5A A;  4BG9 A;  3G71 N;  3L4I A;  2C1I A;  2ZF5 O;  3HM8 A;  3C6H A;  4H0P A;  4ISE A;  5AQS A;  3HOS A;  2IVP A;  4BRF A;  3R1X A;  2V7Y A;  4BQZ A;  5F0X A;  3O9Q A;  3EL2 A;  1DGK N;  3FFK B;  5E84 A;  5GAE P;  5FPN A;  2OTL N;  3WEE B;  4WQ5 C;  3KHY A;  4JKB A;  3O1W A;  5FPD A;  4M7X A;  2P9I B;  3GE1 A;  3C0B A;  1XC3 A;  3BUZ B;  2WFB A;  2ZWH A;  5AQG A;  2P9N A;  4JHD A;  1NJI O;  2YHW A;  3E66 A;  3ENO A;  1NGC A;  4KH5 A;  5HL7 L;  4WFA L;  3DXM A;  4H0O A;  3RSE B;  2EWS A;  2NRW A;  4JK7 A;  5KQD A;  2DPN A;  2A6A A;  3QBW A;  3P38 A;  4BRM A;  4AM7 A;  4NB4 A;  1ZXO A;  1NM1 A;  2WC9 A;  4IEI A;  4K25 A;  1CZA N;  3ID8 A;  2VYP A;  2YJE A;  1S3X A;  3CET A;  3FZL A;  3LDN A;  3CJB A;  4BRK A;  3CC2 N;  2I7P A;  3HBT A;  3W3D A;  4B1W B;  4QS7 A;  4BR4 A;  4CZJ A;  5M1F A;  2OTJ N;  4WF9 L;  4WYB A;  2GTD A;  2VCP A;  3HZ6 A;  1GLE G;  1YHQ N;  2E88 A;  2IVN A;  3WXJ A;  1GLF O;  4DQ8 A;  3ZET B;  4FWP A;  3WXI A;  4BRL A;  4BG8 A;  1OKJ A;  3R3L A;  4A2A A;  4IJN A;  3J7Z O;  3ID6 A;  3O4W A;  4BGB A;  5GAD P;  2P9S A;  5KQ8 A;  1O13 A;  3DAW A;  2CH5 A;  2E2Q A;  2ZGY A;  2GWJ A;  1Z05 A;  3SMS A;  2GEM A;  1NGF A;  1VAZ A;  5ADX A;  3CME N;  3R9P A;  1BDG A;  1NBW A;  2GWK A;  5AFU H;  3CJA A;  3CCU N;  2HST A;  3E9P A;  1K8K A;  3CI5 A;  1ZBS A;  4BRE A;  4WFB L;  1IJJ A;  3HI0 A;  3L4Q A;  5BRH A;  1SS6 A;  1U2V B;  3FGU A;  5AQP A;  1OVY A;  1C0G A;  1NWK A;  4Z94 A;  3NMU A;  1DEJ A;  2FSJ A;  5C0Y A;  2E2P A;  4JKG A;  3A5N C;  3EE8 A;  4A2B A;  5M1O A;  2IIR A;  2IVO A;  2QWN A;  3MMV A;  4XH5 A;  3L0Q A;  2V51 B;  1ATR A;  4MLH A;  4BGA A;  3QDK A;  3WXK A;  2NZT A;  3A5O C;  3CXC M;  5M1P A;  5TKY A;  2A3Z A;  5AZJ B;  4B1V A;  4BRI A;  4FL9 A;  3C7N B;  3EZW A;  3CHW A;  3MX5 A;  3CMA N;  4XH1 A;  1JCG A;  3AGK A;  3HRG A;  3H45 C;  3N4P A;  4BR7 A;  4JKF A;  4FWS A;  1ILY A;  2P9N B;  1KQS M;  4C1N I;  3E9L A;  5JLF A;  1YJW N;  2D0O A;  4JKC A;  4LC9 B;  5HOO A;  1Z6R A;  5AQJ A;  3DXM B;  3H46 O;  1QQO A;  5BPM A;  3I56 N;  2NRX A;  2ZGZ A;  2ZJR L;  1Q81 O;  3A8Y A;  4C23 A;  4CD3 A;  2YHY A;  1YIJ N;  1YXQ A;  5BPL A;  1VQL N;  3CJ7 A;  4CI6 A;  1WUA A;  2PBD A;  2W00 A;  4BC2 A;  3SBG A;  2QWR A;  2J4R A;  3FZM A;  1W2B M;  5KPT A;  1T44 A;  3LDP A;  2P9K B;  1NGH A;  4KH4 A;  1QQM A;  1HJO A;  1X3N A;  4O8K A;  4BRH A;  1K8A O;  3H6E A;  1VQ7 N;  5AQI A;  3O6W A;  1QZ5 A;  3CPE A;  2F9W A;  3H1V X;  2F9T A;  3CQX A;  1NGE A;  3M1F A;  4DKW A;  3DXK A;  4BRN A;  2QW9 A;  5GIO A;  2Q97 A;  5BRE A;  3CF5 L;  2HOE A;  3IMX A;  3KZB A;  3R8E A;  4PL7 A;  5DM7 L;  1WOQ A;  4BR2 A;  2ZJP L;  4NLC A;  3SJH A;  4H0T B;  3Q7B A;  4WQ4 A;  5B8H A;  4G9Z A;  1MWM A;  1NLV A;  3ENH A;  3CCS N;  1BA1 A;  2QWL A;  2VWB A;  3C6A A;  5AZI B;  5EOY A;  1XQS C;  1YF5 L;  3IKM A;  4AF1 A;  3QML A;  4JN4 A;  3ATV A;  3D7E O;  4CBW A;  4FWQ A;  3CCL N;  4FWR A;  4PHT X;  2BH1 A;  4JAX A;  3LDL A;  3KK7 A;  1MDU B;  1R59 O;  4JEP A;  4M63 C;  5F1X A;  1RDW X;  2E20 A;  3H3N O;  4A59 A;  4CZF A;  4H5V A;  4Y0W A;  1EO1 A;  3IUC A;  4K43 A;  3IDH A;  2QEX N;  3VGK A;  3ENB A;  3CCQ N;  3UE5 A;  3U4L A;  4IDH A;  4IFE A;  4BVP A;  3QFU A;  2ITM A;  2RHK A;  3SLC A;  4DCH A;  5KPZ A;  2D1K A;  3VTI A;  4JK9 A;  3ULE B;  3CC7 N;  3EKS A;  2PFU A;  3ZX0 A;  1ESV A;  2ASM A;  4BEC A;  1ATS A;  4BQL A;  4OPH A;  2P9I A;  2NLX A;  2KHO A;  2NRR A;  2QTD A;  3O9R A;  4H0V B;  3MN9 A;  1MA9 B;  4ILH A;  4JD2 B;  2QM1 A;  3VPZ A;  3O5B A;  4B1Y B;  4H0X B;  3RVC A;  4H5W A;  4JHD B;  1BA0 A;  2PAV A;  1RDU A;  3DJC A;  3UKU A;  3LDQ A;  4YOX A;  3MDQ A;  1X3M A;  4GV9 A;  2NRT A;  2V7Z A;  2GUP A;  2ASO A;  3LDO A;  4JNE A;  5F2R A;  1JCF A;  3O80 A;  3KWG A;  3T7Z A;  4WCE L;  3MCA B;  1SZ2 A;  3GBT A;  3NVM A;  2D0P A;  4JKD A;  1MWK A;  1P8Z A;  5C15 A;  4A57 A;  3MK6 A;  3W0L A;  1T6D A;  2BUP A;  3CER A;  1LOT B;  2P9L A;  1TYQ B;  3JXU A;  1NGJ A;  2P9K A;  4B1X B;  5JIC A;  3OBY A;  1BUP A;  3EN9 A;  3M5R A;  4H0Y B;  1VQ4 N;  4ISG A;  5AQX A;  3BF3 A;  4WQ5 A;  4CZK A;  4FPA A;  5TKW A;  1HKB A;  2FSN A;  2CGL A;  1HPM A;  2YI1 A;  3AAQ A;  3D6R A;  3PLA A;  3ZET A;  4A5B A;  4KH6 A;  1C0F A;  3H3O B;  5EXW A;  5AQK A;  4CBU A;  1E4G T;  3O9U A;  5FPE A;  2P9P B;  2QWQ A;  5JVH L;  1GLJ O;  2FSK A;  2E2O A;  4YDU C;  5AZI A;  2NRV A;  4QS8 A;  4EFH A;  2CH6 A;  5M1K A;  1JJ2 M;  3U9Z A;  3VEW A;  4UY8 O;  4XEI A;  1ZC6 A;  2QWO A;  2WBN A;  5AQN A;  3VEY A;  5LJV A;  2QXL A;  3CJC A;  5EVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...