3UKRA

Crystal structure of bos taurus arp2/3 complex with bound inhibitor ck-666
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
415
structure length
401
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization and computer-aided optimization of a small-molecule inhibitor of the Arp2/3 complex, a key regulator of the actin cytoskeleton.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Actin-related protein 3
total genus 126
structure length 401
sequence length 415
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3ukrA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ukrA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ukrA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3ukrA04
4JN4A 2FSKA 5AZJB 3GG4A 3FZFA 1NGHA 2VWBA 1NLVA 2Q31A 4HTLA 3M1FA 3HTVA 4BRKA 5BR9A 3QFUA 3SJHA 3VF2A 1NGJA 3ZX3A 3QFPA 2P9KA 3IFRA 1U6ZA 2Q97A 4GNIA 5AQUA 4FL9A 1HLUA 3VEOA 3ULEA 3H1QA 5E26A 2YHXA 4FWRA 1TUYA 2QWRA 3BP8A 4FWKA 4B1XB 2GWKA 2V7ZA 3WUHA 1HX1A 3GBTA 4DHYA 2A5XA 3TPQA 4YDUA 2P9SB 1D4XA 5EOYA 2ZWHA 2IVPA 3VPZA 4CZJA 4BRPA 5AFUA 2ZF5O 3LDNA 1QQNA 4IJNA 3MN9A 4XH1A 3J8AA 1X3MA 4K25A 2GTDA 1P8ZA 5BPNA 1NGFA 1HUXA 2J4RA 3QBWA 2E20A 3DXKB 3O8MA 5AQTA 1ZXOA 4EHUA 1NGAA 5AQHA 2QWNA 3F9MA 3GL1A 2E2PA 3R9PA 1V4SA 4CBWA 3CJCA 1BO5O 4BVPA 4FOEA 5EY4A 3GOIA 1HPMA 2P9NB 3MN5A 3O1WA 1MA9B 3SLCA 2W40A 1S3XA 3VEWA 4BRHA 2E1YA 2HMPA 3VESA 3VOVA 3CETA 2P9KB 3HBTA 4BGBA 2H3GX 2E2QA 4FWMA 3U8XA 4IZ9A 1QQMA 5LJWA 3LM2A 1NGGA 3FLCO 3MN7A 3ATUA 5BRFA 1SQKA 3B8AX 3WQUA 1TUUA 3ZETA 4HWIA 4DB3A 1QHAA 3W0LA 3MN6A 3H1VX 5ADXA 3D2EA 2E88A 5AR0A 4KBOA 1ZC6A 4H5TA 1HKBA 5AQKA 5JICA 5KPZA 2A42A 4H5VA 3S41A 4BVOA 2F9WA 3L4IA 4FWQA 3IMXA 3FGUA 4EFHA 3QDKA 1GLBG 3DJCA 1NGIA 2CGLA 3EL2A 3VEYA 4BREA 4H0VB 4MO4A 4WYBA 5EX5A 2D0PA 4BR7A 3ZEUA 1JCFA 3MK6A 3BUZB 3WT0A 2V51B 1KAZA 3SK3A 4BRMA 4BG9A 4K41A 1QQOA 4PKGA 4FSVA 3WQTA 3ZX2A 1ATRA 2ZGYA 3HZ6A 3MCPA 2VCPA 3EN9A 5I9EB 5AQPA 3I8BA 4BR5A 4DCHA 3LL3A 3H6EA 3HI0A 1QZ6A 2BTFA 4CZLA 2NLXA 1JCEA 2YJEA 1NGEA 1YAGA 1RFQA 1Z6RA 1RGIA 2EWSA 4M7YA 5F0XA 3CHWA 4EHTA 4H0PA 3IUCA 4BRDA 1S22A 2P9UB 1JCGA 5AQXA 4WQ4A 4BQLA 2AA4A 2A6AA 4QS9A 4BRFA 1GLAG 3AARA 3C7NA 3WXLA 3ID8A 5AQSA 5BREA 3A0IX 4BRLA 3H3NO 3LM9A 2YI1A 4A2AA 5E84A 4H5NA 4M7XA 2HOEA 1MWMA 5F1XA 2A41A 3DXMA 4QS8A 2HF3A 4BR2A 4H5RA 4MLHA 4NO7A 3H45C 5AQLA 3QBXA 5BRDA 4A62A 2I7PA 2YCHA 2FLOA 3A5MC 3VF4A 3ATVA 5EXWA 1NGDA 3CERA 3EKSA 3ZEUB 1DEJA 3VEZA 1LCUA 3GDQA 4FWNA 4CZMA 4BG8A 4EAHD 5AQGA 1CZAN 5AQOA 3WEEB 1SZ2A 3TU5A 5AFUH 5JLFA 4H0OA 3R8EA 3C7NB 3M3ZA 2IIRA 2NRHA 5ELZA 4QS7A 3L0QA 2YHYA 3WXJA 3VF6A 4CJ7A 1IG8A 1BG3A 2QW9A 2AP1A 4BR4A 2BUPA 4BC5A 5AQIA 4ISFA 1BWFO 1K8KB 2FF6A 5AQQA 3LDQA 4NB4A 4BR0A 3GE1A 1T44A 5TKYA 4BRCA 3L6QA 3UKRB 4K43A 4XEIA 5BPMA 1NWKA 1X9JA 5BN9A 3VERA 2E2OA 1GLDG 3CJAA 4FPBA 4H0YB 5AZIA 3W3DA 1E4FT 2V52B 3MDQA 2ASOA 1ESVA 3EZWA 2P9PA 3BF1A 3O6WA 5B8HA 3D2FA 4FPAA 2FSNA 4H0XB 3MMVA 1BUPA 2DPNA 4BC2A 1EQYA 1HJOA 3M6GA 4K42A 3QB0A 1MWKA 1NGCA 4MO5A 4BC3A 1ZBSA 4DQ8A 1C0GA 2NZTA 2P9LA 2OANA 2E8AA 1U2VA 3FZKA 1GLFO 2GWJA 2FF3B 2GUPA 1Y64A 4WQ5A 1KAYA 3WEEA 5LY3A 3G25A 3U4LA 2GEMA 3A5OC 3EO3A 2IVNA 3EKUA 1XQSC 3C0BA 1RDWX 3A5NC 5KPTA 5BN8A 2CH5A 1WOQA 1TYQA 2P9IA 1ATSA 4EIAA 1G99A 5KPRA 3FR0A 2QWLA 2Q36A 4JD2A 2P9LB 2VYPA 3JS6A 4AM7A 2FSJA 2Q2RA 3CJ7A 3DXKA 4J8FA 3D2FB 4CZFA 4FO0A 4BRGA 1ATNA 4CD3A 4BQZA 4F9OA 5AQFA 2PBDA 3KHYA 3CIPA 4H03B 3DXMB 2P9PB 4CZHA 4FWPA 1MDUB 4WQ4C 4CZIA 2ASPA 4Y0WA 1BA0A 3O80A 3RSEB 3VGKA 3FE1A 1Z05A 3KZBA 3VEVA 1T6CA 4FWLA 1X3NA 5AQVA 3UKUA 4H0TB 2D4WA 2Q0RA 3O08A 1YXQA 3BF3A 3H3OB 3VENA 1WUAA 3O4WA 3ULEB 1NGBA 4LC9B 2QXLA 4BR9A 1E4GT 3A8YA 5FPMA 2ITMA 4GY2B 4CZKA 2IVOA 3CI5A 1LOTB 2HF4A 4JHDA 3FZLA 1QZ5A 3VEXA 4JD2B 1T6DA 4PKHA 5FPEA 3ZX0A 5AZJA 1YUWA 2P9SA 3OHRA 2ASMA 3VGMA 3WXKA 2E1ZA 2GELA 4I6MB 4M63C 2CGJA 3CJ1A 2P9NA 3WXIA 5AZIB 5AQYA 1V4TA 3BEXA 4RCHA 4FWSA 4A2BA 1BDGA 2A3ZA 5LJVA 3I33A 3UE5A 3FZHA 3ENOA 1BU6O 3CJBA 5BRHA 2QWPA 3KVGA 4I6MA 5F2RA 4JHDB 1K8KA 2D0OA 4BRNA 4CZEA 2FXUA 2QWOA 1U2VB 4O8KA 1YVNA 4H5WA 1GLCG 2ZGZA 3AAQA 2V7YA 5AQRA 2UYTA 2W41A 4CD1A 1SAZA 4B1WB 2CGKA 4C23A 5AQJA 5CE3A 4PL7A 5BPLA 4BRQA 4BC4A 2F9TA 4RWTA 4PKIA 3O1BA 1DKGD 3CQYA 2QM1A 4CBXA 4E1JA 2I7NA 3DAWA 1HKGA 2A40A 1GLJO 2E2NA 3RSEA 2YJFA 1XUPO 3IDHA 3P4IA 4B1ZA 4FOIA 2CH6A 4IJAA 4BRIA 5KQ8A 3LDOA 3VGLA 3U9DA 1OKJA 3QMLA 4JAXA 3D7EO 5JMVA 4XH5A 3A5LC 4IO8A 3ENHA 4Z94A 4BGAA 3U9ZA 1BOTO 3AAPA 1KXPA 4BRAA 4JNEA 1GLLO 4O5FA 4MLEA 4L3QA 3LDPA 5AQNA 4IXCA 4BROA 1DGKN 4B1YB 3H46O 5ADXH 1BA1A 3CJ9A 3SMSA 3VETA 5JLHA 4FWOA 3UKRA 5KQDA 5FPNA 2QWMA 1XC3A 4YDUC 1IJJA 1NM1A 2YHWA 4PL8A 5AQZA 4ISGA 3LDLA 5AQMA 1KAXA 3UB5A 2D1KA 4B1UB 5AQWA 4IWVA 1NBWA 4B1VA 4RTFD 2KHOA 1J6ZA 3AY9A 1TYQB 2P9IB 1GLEG 4A61A 3UKUB 4CZGA 1R59O 5EVZA 5FPDA 1HKCA 3QICA 4CBUA 1H1VA 2Q1NA 3DWLA 3R6MA 1Q18A 3CQXA 4B9QA 3D2EB 3HM8A 3HSCA 4XH4A 2P9UA 1C0FA 3FZMA 4AM6A 2Q0UA 2PAVA 3FFKB 2QWQA 4ISEA 3ZETB 1NMDA 4CI6A 2WUSA 3O5BA 3SMPA 3JXUA 4WQ5C
chains in the Genus database with same CATH superfamily
5AZJB 3GG4A 3FZFA 2BGGA 4FM2A 5BR9A 3ZX3A 3QFPA 2P9KA 3IFRA 5AQUA 1HLUA 1L5UA 3PLAA 3SUOA 4Z0UA 5E26A 2OZMA 4NYFA 4DTOA 4FK0A 4BE1A 1WLJA 2G8WA 4O4GA 4YOVA 4CJQA 4PWDA 3PV8A 1WN7A 1D4XA 2P9SB 3V9UA 2IVPA 3R3LA 2ZF5O 3LDNA 5E41A 4FJ8A 3RMBA 4KTQA 2GX9A 3J8AA 1X3MA 4K25A 4DTJA 2GTDA 3OBWA 3K57A 2J4RA 4TSXA 1VSLA 5AQTA 1ZXOA 3NGIA 1QSYA 1MU2A 5AQHA 4NYNA 4X64K 4C8MA 4FOEA 1FXXA 4HTUA 3GOIA 2E6MA 4JI8K 1YIJN 1MA9B 1REVA 1S3XA 4CHZA 4AH9A 1SUQA 3VESA 2W6LA 2O8FA 3K5OA 4CF0A 3U8XA 2OPSA 4IZ9A 4OKEA 1W9HA 1YF5L 5LJWA 3FLCO 2RPIA 1I94K 2ZD1A 1W2BM 2JGUA 5AR0A 1ZC6A 4H5TA 4PUOA 5JICA 5C12A 1WBDA 3MXIA 4H5VA 4Q0BA 3L4IA 3NFAA 3FGUA 3F73A 1XC9A 1NKBA 4OGEA 3G10A 4BDYA 3VEYA 4DV4K 4U7BA 1QS4A 4FLUA 2E5LK 3DI6A 2HBKA 4ICLA 4JS4A 3DRRA 4I2QA 1UWBA 4JK9A 2D0PA 3BUZB 4WFNL 3ALYA 1VSEA 1KAZA 1LAWA 3SK3A 5H1SQ 4DSJA 4I9LA 1OH7A 4FJHA 4BG9A 4BDZA 1EX4A 3WQTA 3T1YK 5M1QA 3HZ6A 4JK7A 5I9EB 3TAFA 5AQPA 3L4QA 4LSLA 3I8BA 4JI2K 2QI2A 3H6EA 1CXUA 4N47A 3HI0A 3EE9A 1JLAA 2Z1HA 4CZLA 2NLXA 1FK9A 4DU1A 3E9PA 1JCEA 4O8UA 1NJWA 3NH1A 3CCSN 3HP6A 3NF9A 1RDCA 3HT3A 1KD1O 1XMOK 2RF2A 3IUCA 4FJGA 3J7YP 2VQEK 1SKSA 4DU4A 4JKCA 1RT4A 1NK5A 4J2EA 4CF1A 3CCUN 3LZIA 1NU0A 1UA1A 1TK0A 4K8ZA 1TL3A 3NVKA 1KVAA 2A41A 1SKWA 3DXMA 3TABA 4OGCA 3H45C 3WNEA 3QBXA 5BRDA 4ELUA 4A62A 2O8DA 4CESA 4YOXA 2YCHA 3A5MC 3BZKA 3ATVA 1NGDA 5J1EA 3CERA 3VMFB 1UA0A 3VEZA 2O8CB 1FW6A 4FWNA 1JL2A 1ZBLA 5A2QO 4BG8A 5AQOA 4N5SA 3CCEN 3AO2A 4X65K 2QA4N 5AFUH 3M3ZA 2IIRA 3ZSXA 5ELZA 3BGRA 1YITN 4CIEA 4QS7A 2YHYA 4DUYK 3TAMA 1BG3A 3QINA 4CHNA 4FJXA 1TAUA 1A5VA 1NJIO 1S9EA 4KTZA 5AQIA 4HVJA 4Z4EA 2O8DB 3CCVN 1K8KB 2FF6A 4C8KA 5AQQA 2EX3A 1IG9A 1VQNN 4YOTA 3ID6A 3TSUA 4OX9K 3UKRB 4XEIA 4CJTA 4ZHRA 3NE6A 3BY5A 5AZIA 3SQ0A 2F8SA 1E4FT 1S1WA 2V52B 4M3ZA 1KCFA 3DMJA 2ASOA 1YTUA 3O6WA 4M3TA 3D2FA 4H0XB 3MMVA 3LP1A 1VSJA 5KRSA 3O9UA 4MO5A 1ZBSA 2NZTA 3Q7BA 1U2VA 2FF3B 3E9OA 4L8RB 4AHSA 5HOOA 1KAYA 2O8EB 4JI0K 3EO3A 3T1AA 2IVNA 4LY7A 1RDWX 1XI1A 3NF6A 5KPTA 2Q3SA 1L3VA 2F4VK 1TYQA 1XNQK 2BE2A 2VG6A 3THXA 2QWLA 2P9LB 2VYPA 3JS6A 5GINA 2KFZA 2O8BB 4KHNA 4DFMA 1K6YA 3PIPL 2ZJRL 4OKKA 4IFEA 2PBDA 1DTQA 3KHYA 1HNVA 3OA9A 3CIPA 4CZHA 4B08A 1NK6A 4WFAL 3SUPA 3ZSOA 2ASPA 4Y0WA 4R5PA 1TK5A 1VQMN 4R79A 3VQPA 3P38A 1TVRA 3LP2A 2OPRA 1YJ9N 5I3UA 1X3NA 2XRIA 4H0TB 4KPYA 4GVMA 2IC3A 3BF3A 4JKDA 3VENA 1WUAA 3ZT0A 1K9MO 3O4WA 4DWIA 4FJ5A 4BR9A 1E4GT 5FPMA 3NF7A 4ID1A 2HF4A 4JD2B 3ZX0A 4DV7K 2UXBK 4AHRA 3HRGA 4LF9K 3BEXA 2PYJA 4A2BA 5LJVA 3TWHA 4FW1A 3ENOA 1JLBA 1JKHA 2QWPA 1ZYQA 4ID5A 1K8KA 4HUFA 4B9TA 4ZTJA 4H5WA 1GLCG 3D6RA 4JKFA 3KK1A 4C23A 5CE3A 5BPLA 2RN2A 4W5NA 4BC4A 4RWTA 5LL6Z 2QM1A 4F3TA 3DAWA 3C6UA 4H4MA 3NCIA 2G8KA 4IFVA 2E2NA 4CJSA 3CYGA 1ZBUA 4A5AA 3M8PA 4WE1A 3DYAA 2VGMA 2CH6A 4DR5K 1NK9A 1UOCA 3U9DA 4W5RA 1FKPA 4AHTA 2AJQA 5DMRA 3D7EO 4MDBA 1X9WA 1KTQA 1RBVA 3N4PA 4XH5A 3A5LC 3AVFA 4LH5A 3U3GA 4Z94A 4BGAA 1BOTO 3S3NA 3O3GA 1KXPA 3KLEA 4DTSA 3S9HA 5CYMA 1U49A 4F2RA 3QIPA 5AQNA 1DGKN 2HNZA 4B1YB 4FZYA 3H46O 4AQYK 4PY5A 4Y1CA 3K5LA 1B9FA 2C1GA 5FPNA 2QWMA 3CFRA 1XC3A 4YDUC 3IG1A 2ZJPL 1QVFM 3LDLA 4FJJA 1RBRA 3QEVA 3SV4A 4MFBA 1KAXA 4OPKA 2D1KA 5AQWA 4IWVA 4HCBA 1N8RO 4M41A 2XY5A 3NBPA 2DY4A 3CFPA 4FLVA 4M3XA 4JKHA 4E19A 3AY9A 3J7AP 5DK5A 3SUQA 2KKZA 1WNSA 1TKZA 4CK3A 1VSHA 4B9MA 1HKCA 3QICA 4DLGA 4CBUA 2Q1NA 1WBBA 4JI1K 1Q81O 4G9ZA 4B9QA 2WTUA 4B3RK 3AA4A 4CJWA 4DSEA 1C0FA 1WSGA 2HHSA 4CI6A 3SMSA 2C1IA 3JAMO 4I9QA 2VWBA 2E4LA 3HTVA 2KW4A 3QEIA 4FCYA 3S5TA 3QFUA 3VF2A 1NGJA 2XY7A 3KLGA 4ELTA 4Z4IA 2Q97A 4FL9A 3VEOA 1LWEA 5J2MA 5CHIA 3DLKA 3ULEA 2YHXA 5KGWA 1X9MA 2O8EA 1TUYA 2QWRA 3BP8A 4FWKA 2OPQA 2GWKA 2V7ZA 3HOSA 3WUHA 2A5XA 3RVCA 3J81O 1HYVA 3UIQA 1VSFA 4BRPA 3EE8A 3L3UA 2HNDA 1X9SA 4WCEL 1YTAA 1NGFA 3QBWA 2E20A 1HNZK 3DXKB 3KLHA 1NG9A 1IKVA 4OO1J 2HHHK 3OYBA 1JLQA 3F9MA 3DOLA 2E2PA 1V4SA 2XY8A 3HM9A 4IBNA 2ATQA 5EY4A 4C1NK 1VSIA 3K2PA 2HBJA 3AVLA 3HOTA 3MN5A 3THYA 2E1YA 1NKCA 2P9KB 3HBTA 3OS2A 2E2QA 2B6AA 3DOKA 5DM7L 4YHHK 3DM2A 3LM2A 4GKKK 3AVGA 5IT9O 3MWPA 3CG7A 3P31A 3K0SA 4HWIA 4DB3A 1QHAA 3W0LA 1TGOA 2IS3A 4KBOA 2D5RA 4IEIA 2A42A 1TKXA 2QKBA 2QEXN 3THWB 2F9WA 1I39A 1L3UA 3QDKA 1GLBG 4CJRA 4BY9C 4JV5K 4KFBA 4CGDA 2B4JA 1VQ5N 5C10A 4DQQA 4WYBA 4BECA 4ILGB 5GAEP 4RW8A 4CJPA 3WT0A 4CEOA 2V51B 3K59A 4BRMA 5IWAK 4CK1A 1LW0A 4DKWA 4PKGA 4F8RA 3ZX2A 1N33K 1ATRA 3PO5A 3SBGA 3MCPA 2VCPA 3EN9A 4NXNK 1NJXA 4BR5A 2E6LA 4MQ3A 3V1QA 5D3GA 3RWUA 2GV9A 1KLMA 4DTXA 5J2QA 2BTFA 1X1PA 4O0IA 1JJ2M 3E66A 1NNEA 1YAGA 2GBZA 1Z6RA 1RGIA 1DLOA 2EWSA 3NVMA 4OKJA 5F0XA 3CD6N 2WC9A 5CR4A 4FM1A 2P9UB 4O5BA 1WSIA 4CF8A 3CQ8A 3ZSQA 3I55N 2AA4A 3OYKA 4BRFA 4QS9A 3C7NA 3WXLA 3ID8A 5C24A 3SV3A 3C94A 3KWIA 4IOAL 4H4OA 4KAZA 1T7PA 4QS8A 3KD1E 3SNNA 1HR0K 3VF4A 3TARA 5EXWA 2VG7A 1VSKA 1JLCA 3THXB 3ZSZA 3VQ6A 3WNFA 1J5EK 4M3WA 5AQGA 3VQ4A 4NCBA 1D8YA 5KRTA 2HHIA 4N56A 3J80O 4UY8O 1LWCA 3R8EA 4DV3K 2I5JA 3SPZA 2KTQA 3P39A 3C7NB 2OPPA 2NRHA 3NHGA 1N32K 2BANA 3VQDA 3DLHA 3WXJA 4BDPA 1RDBA 3VA0A 1EKEA 3U6FA 4HUGA 3AVNA 3DRPA 4BC5A 4ISFA 1IBLK 3TSQA 4CJLA 4CJVA 3M8SA 3CYMA 4DF4A 3AA2A 4JLHA 3OYLA 2UUCK 3OS0A 3QNNA 3E1YA 5HBMA 5BPMA 3VERA 2OTJN 5M1KA 3CJAA 3B6PA 3NGYA 4H0YB 1C0TA 1KRPA 3AVJA 2P9PA 3ZSVA 4WFBL 3MX2A 3QEXA 1XWLA 1C0UA 2OZSA 3AVKA 1VRTA 1TKDA 4JRQA 4K42A 2OTLN 1JLEA 4E7HA 3ZT2A 2P9LA 2OANA 2E8AA 1BQNA 4CEZA 3FZKA 3LPTA 2D0AA 2GWJA 2GUPA 2KQ2A 1IKYA 3CPWM 2FBXA 3WEEA 5LY3A 4BE7B 1U47A 4CFBA 4M3UA 2JLEA 5BN8A 3PUFA 1WOQA 3HYFA 3OYAA 1ZBFA 1U45A 2Q36A 1OVQA 1ASWA 4CEFA 2FSJA 2Q2RA 4FZZA 1E3MA 3CJ7A 1W97L 3PIOL 2HHQA 4E89A 3LZJA 4CEAA 4BRGA 1ATNA 1QHTA 4FLYA 2W42A 4KHUA 4J2DA 4OPAA 2P9PB 1RTJA 1MDUB 3AV9A 4DLEA 4Z4GA 3OVNA 3O80A 1YJWN 1QVGM 3RSEB 1Z05A 3KZBA 1BI4A 1ITGA 4FWLA 1QQCA 2FBYA 4AF1A 1YXQA 3QO9A 3O3FA 4XJXA 3OYEA 3H08A 3ULEB 2YNGA 1NGBA 4CFDA 4DFPA 3QESA 2ITMA 4N76A 4JHDA 1KFDA 1SL0A 4KB1A 4PKHA 5FPEA 2X6SA 4W5QA 1BIZA 2E1ZA 3T1HK 5DM6L 1VAZA 3QLHA 1R0AA 5M1PA 4FWSA 2A3ZA 4Z4HA 4KI4A 5GIPA 1KFSA 3D0PA 4JI3K 3S3MA 2O8CA 4DF8A 4FLTA 3O9QA 4I6MA 3CXCM 1KLNA 1RT1A 2D0OA 4BRNA 4CZEA 5JENA 1RBTA 2GUIA 3AVIA 2QWOA 3OS1A 3RRHA 1RDUA 2V7YA 2W41A 4CD1A 1W0HA 2CGKA 1C1AA 4PKIA 3ENBA 4FM0A 2I7NA 3Q7CA 4E72A 1HKGA 2A40A 1GLJO 3RSEA 5HRRA 1J53A 1T3VA 3IDHA 2G8VA 2ZM6K 4FOIA 4IJAA 4BRIA 2Z1IA 1JLFA 1I3AA 3P83D 4E1MA 5J2PA 4DR2K 5JMVA 4JK8A 3RRGA 3ENHA 2HHXA 3MEEA 2O8FB 4BRAA 5MLCQ 4M3RA 4QCLA 3OYMA 1GLLO 1UAXA 1BL3A 4MLEA 4CIGA 3LDPA 4OPHA 2FBTA 1RCHA 4CFAA 5ADXH 1BA1A 3SCXA 4DTPA 1RT2A 3CMAN 3UKRA 5KQDA 4RW7A 2O4GA 1IJJA 1NM1A 2YHWA 1VRUA 3R1XA 4YFUA 1ILYA 3TSPA 4CW7B 3ASMA 4ISGA 4LF8K 3P1GA 2KZMA 3UB5A 4W5OA 3L2UA 4CK2A 4B1VA 3RMCA 3B6OA 3MX5A 4CVNE 3NF8A 3AVCA 4CEEA 1TYQB 1W7AA 4DV1K 1HYZA 3UKUB 4CZGA 2DFEA 4M42A 3TAEA 2UXCK 2NRRA 4KI6A 3I56N 3OYNA 1J5OA 4J2AA 5C2DA 4XH4A 3OBYA 2P9UA 4FJKA 4ILJA 2Q0UA 3LANA 2OCEA 5CYQA 3HK2A 5KGXA 3AO4A 2DFFA 3O5BA 3JXUA 2RHKA 2FSKA 4DSIA 2XHBA 3PX4A 1NOYA 3LWLA 4E0DA 1KVCA 3M1FA 4XIUA 3KK3A 4JI7K 2LSNA 4JEPA 3SJHA 2O8BA 4H8KA 1TK8A 1SL2A 4N41A 4GNIA 2HHWA 2HHTA 5SZTA 4B9NA 2R7YA 4Q5VA 3HJFA 4KH4A 1HX1A 4DHYA 1RNHA 2NRWA 4DR3K 3PSIA 4YDUA 3SZ2A 2ZWHA 3VPZA 4CF2A 3O9SA 3D45A 1TKTA 1HRHA 1QQNA 4A5BA 1D9FA 3MN9A 4M45A 5I42A 3V1RA 5BPNA 3G0ZA 3ZYYX 3O8MA 3IAYA 1YT3A 4CF9A 4CERA 3GL1A 3R9PA 5FLXO 4CBWA 5GADP 4DV6K 1GOBA 3OYGA 4BVPA 3EY1A 4CEQA 3CCRN 5HLFA 4JKBA 1YJNN 1VQLN 1HPMA 4IG3A 2P9NB 2IGIA 1EP4A 3M8RA 3O1WA 3SLCA 2JWKA 1RTDA 3VEWA 4BRHA 3LDSA 4GV3A 3K9KA 1CXQA 4RW9A 4DR6K 3RMAA 4CJEA 3MN7A 4E3SA 1D9DA 2ZE2A 3ATUA 3E01A 1EO1A 1RTIA 4FJLA 5KI6A 3WQUA 1TUUA 3ZETA 5M1FA 3MN6A 3H1VX 4K0KK 2E88A 1C1CA 5AQKA 3MXJA 3SAFA 3AVMA 3VQAA 4IKFA 4GKJK 3S41A 1WB9A 4FWQA 3IMXA 3J7ZO 3V81A 3A2FA 1ZBIA 3EL2A 1S6QA 3PSFA 1HNIA 4YOUA 4FZXC 5JS2A 4BREA 1IKXA 1OH8A 1S1VA 3MCAB 4MO4A 4KREA 4OPJA 2G8HA 3RR7A 2WFBA 2YKNA 5FROA 4B8AB 3VQ8A 5HRSA 1HMVA 2G8IA 1QQOA 3ZSRA 2IAJA 3THWA 2ZGYA 1RT5A 4LFAK 4QAGA 4M3YA 4DCHA 3LL3A 3KLFA 1QZ6A 3LALA 3I8DA 3O9TA 5HRNA 2YJEA 4KV8A 1EWRA 1RBSA 4M7YA 3CCQN 3CHWA 4EHTA 1S22A 2F7TA 1RT7A 5AQXA 1LV5A 3K5MA 4BQLA 3ZLJA 1GLAG 3AARA 4NXMK 5BREA 5SWMA 4BRLA 1VQKN 3H3NO 3LM9A 4A2AA 5E84A 1BCMA 1MWMA 5F1XA 4DG1A 2QK9A 3MEDA 1YVUA 2HF3A 4H5RA 4NO7A 1N5YA 3KKRA 4B8CA 1IKWA 3I0SA 3PX0A 4E7IA 1NK4A 4Z4FA 3T3FA 1QSSA 4KHPK 3AO3A 3EKSA 4BE0A 4CGFA 2VGNA 2OA8A 1LCUA 1NMNA 2P5OA 4I7FA 3GDQA 3CCJN 3ZT3A 3M8QA 3VQQA 4EAHD 1CZAN 1SKRA 4GV9A 1P90A 3RTVA 3BDPA 1SZ2A 2F8TA 3TU5A 4JYAK 5FRMA 2HHUA 5JLFA 3THVA 4C8LA 1YHQN 3E9LA 1J9AA 2IOCA 3CCLN 1O1WA 5LMNK 3OY9A 1S6PA 3V9WA 2QW9A 2AP1A 3JYTA 4BR4A 2BUPA 1NOZA 2HB5A 2P1JA 3KJVA 3LP0A 2UUAK 2DFHA 4CJUA 3V1OA 2NRTA 4NLBA 3LDQA 1CLQA 4PA1A 4BR0A 1Z26A 3GE1A 1T44A 1HQEA 4BRCA 3ISNC 4B9LA 4K43A 1NWKA 1X9JA 5BN9A 3TTDA 1GLDG 3DLGA 3HPHA 3T7ZA 3MECA 4KKOA 4C1NI 3MDQA 1OH6A 4FPAA 2FSNA 2Y1JA 3MXMA 1XHZA 1BUPA 4BC2A 1EQYA 1HJOA 3M6GA 3L8BA 2EHGA 3NH0A 1MWKA 1KSPA 4BC3A 1C0GA 3HPOA 4LF6K 4E7KA 3CC2N 1GLFO 4IDHA 4DTRA 3SQ1A 4WQ5A 1OH5A 2WOMA 3DLBA 1S72N 1TL1A 3U4LA 2GEMA 1TAQA 3A5OC 2YHAA 1CZBA 3OYCA 3TTFA 3C0BA 4JRPA 1T8EA 3A5NC 4WF9L 1BHLA 4HCCA 2CH5A 5GAGP 2P9IA 4B3OA 3HSTB 1ATSA 4EIAA 1G99A 1Q8IA 3FR0A 3JSMA 4FLXA 4JD2A 4Z4CA 1LW2A 3DXKA 4J8FA 3D2FB 4CZFA 3K5NA 3SYZA 4CD3A 4BQZA 4F9OA 1YI2N 4CGIA 1NJZA 3CM5A 3O9RA 4DTMA 1FJGK 4J2BA 2A1SA 4GW6A 3DXMB 3N4QA 2YHBA 4FWPA 4LF4K 3CPEA 4K8XA 4WQ4C 1HJRA 2HBLA 4CZIA 1BA0A 4FVMA 3VGKA 3VEVA 1T6CA 2X78A 4CHYA 5AQVA 2D4WA 2Q0RA 3O08A 5JVGL 4I2PA 3H3OB 4JI4K 3AGRA 4KRFA 1KQSM 3PX6A 1IV0A 2WBNA 4Y1DA 4KHYA 2HBMA 3A8YA 4BEBA 1C1BA 4GY2B 4KH6A 4F4KA 3SI6A 1U48A 1LOTB 1GOAA 1M90O 3ZT1A 3FZLA 1QZ5A 3VEXA 1T6DA 4PHTX 4F3OA 4IOXA 3OYHA 1K8AO 3ZSYA 2P9SA 3VGMA 3WXKA 3P5JA 4CHQA 2YNFA 1VQPN 2UU9K 3QEWA 2HHVA 3CJ1A 2P9NA 3M5RA 3TR8A 3WXIA 5AQYA 3MEGA 1V4TA 3I33A 3UE5A 4CGHA 4JI6K 4B9SA 1D5AA 4E7JA 3C6TA 2QXFA 5BRHA 3KVGA 2YNIA 1KC8O 4JHDB 3SAGA 3HO1A 3G71N 4DV5K 2FXUA 3QNOA 3KTQA 2ZGZA 5AQRA 4LFBK 2UYTA 1HNXK 2O4IA 3QIOA 1SAZA 4B1WB 4KHSA 2QKKA 4BRQA 2F9TA 4FJ7A 2KLAA 3CQYA 4E1JA 1RDDA 5AJ3K 3WNHA 3HL8A 2YJFA 1XUPO 3LPUA 5T7BA 1KVBA 5KQ8A 3HPGA 3VGLA 3L2QA 3LAMA 4ELVA 4JAXA 3IKMA 4CJFA 1WAFA 3CC4N 4U67L 1N36K 2BDPA 4JI5K 4IO8A 4O55A 3PO4A 2HNYA 4FJIA 3U9ZA 4FW2A 3AAPA 3V9SA 4JNEA 4A59A 2DTUA 3AVBA 2XY6A 1J54A 5TKWA 4W5TA 3SAHA 4BE2A 4CECA 4DS5A 4X62K 3CJ9A 3VETA 5JLHA 4F2SA 2WONA 4FWOA 5FRNA 3HP9A 4KHQA 3LAKA 1ASVA 4PL8A 5AQZA 5CY4A 3OYDA 3MAQA 1VSMA 5AQMA 2G8FA 3OJSA 1U4BA 1NBWA 3V4IA 4C8OA 1EETA 4YY3K 4FYDA 4RTFD 5C25A 2KHOA 4BWMA 2D0BA 4DUZK 1GLEG 3VQ5A 5C2FA 4CCHA 5FPDA 3O4NA 1H1VA 3DWLA 3R6MA 1Q18A 4KO0A 3SBTA 5K14A 1DTTA 2NNWA 3T19A 5FDLA 3HSCA 4FJNA 1NK8A 2QWQA 1NK0A 4ISEA 3ZETB 1RTHA 2YKMA 2WUSA 4O0JA 3IS9A 5C42A 1S5JA 1NK7A 4WQ5C 3OYIA 4JN4A 1SV5A 4EP5A 4OJRA 1NGHA 2VWJA 4PQUA 3AA5X 1NLVA 2Q31A 4HTLA 4G1QA 2F96A 4BRKA 1Q9YA 1RT3A 1U6ZA 4IFYA 3TI0A 4RW6A 3H1QA 4FWRA 4OLBA 2HVHA 3I0RA 4B9VA 1BISA 4B1XB 3SQ2A 3VTIA 3GBTA 5LMUK 3F5TA 3TPQA 1RILA 4YORA 1JL1A 3EZ5A 5EOYA 5M1OA 4GVEA 4CZJA 5AFUA 3T69A 3FFIA 1S1TA 4IJNA 1RDAA 4XH1A 1C6VA 3IRXA 1P8ZA 1HUXA 4LD0A 4EHUA 1NGAA 4KB0A 2FC0A 2QWNA 4RG8A 3C6AA 3ZT4A 2NUBA 3QEPA 1VQ6N 3CJCA 1BO5O 1VQ9N 1RBUA 1S1XA 2HVIA 4DV0K 4UQGA 2W40A 2HMPA 3VOVA 5C15A 3EYZA 3CETA 2Z1JA 4BGBA 1Z25A 1Q82O 2H3GX 3SUNA 4FWMA 1WSEA 4AHCA 4ZTFA 1QQMA 3VA3A 1NGGA 3DRSA 5BRFA 1SQKA 3B8AX 3VQBA 3V9ZA 5ADXA 3D2EA 1HKBA 5KPZA 1Q7YO 4DQPA 1VHXA 3C65A 3G6EN 4FLZA 1LWFA 4BVOA 3RR8A 4EFHA 3NH2A 2PYLA 2YV0X 4DQSA 4CJ3A 3DJCA 1NGIA 2CGLA 4B3TK 3VTHA 4AHUA 2X6NA 1VQ4N 4H0VB 2Z1GA 3LP3A 5EX5A 5GIOA 4BR7A 4FVUA 3ZEUA 1JCFA 3MK6A 3ZSWA 1LAVA 1B9DA 1HQUA 3NAEA 3KWGA 4K41A 4FSVA 3ULDA 3CMEN 3EEQA 1ASUA 1DT9A 4DR4K 3G4SN 5JVHL 2X74A 3SPYA 3O3HA 3AA3A 4X66K 4CIFA 4FK2A 4B3MK 1A5XA 3CCMN 2YNHA 4HHTA 1NGEA 1RFQA 1QSLA 4BACA 3NMUA 5HRPA 4H0PA 4BRDA 4DSFA 3QETA 4JS5A 1JCGA 4WQ4A 2NRVA 4HUEA 2PY5A 4YOWA 2A6AA 4C8NA 5AQSA 5KTQA 3A0IX 3OW2M 4B3SK 2D0CA 2YI1A 1FKOA 4H5NA 4M7XA 2HOEA 3WXMB 4BR2A 1N34K 4MLHA 2ITGA 5AQLA 3KD5E 1A5WA 2I7PA 4MDAA 2FLOA 2PFUA 4E1NA 3SQ4A 3ZEUB 3MWTA 1DEJA 4BWJA 3ZCMA 1SS6A 3QERA 4EZ6A 1M1KO 1U04A 4CZMA 3L3VA 4ILHA 3KK2A 3WEEB 3WNGA 3CF5L 4E7LA 2ZJQL 3VN5A 3CFOA 4H0OA 5C0YA 4KTWA 3L0QA 2UUBK 1VSDA 3VF6A 4AHVA 4CJ7A 1T05A 4B9UA 1IG8A 5HP1A 2RE2A 4IG0A 2OYQA 1L3TA 1BWFO 2NRXA 3DLRA 3C95A 5M1NA 1B92A 4NB4A 3VQ7A 1BQMA 1JXEA 5TKYA 4EP4A 3L6QA 4DFJA 4JKGA 2W00A 1QE1A 2E2OA 5HL7L 4FPBA 1IH7A 3S3OA 2Y1IA 4DR7K 4V19S 3W3DA 3KIOA 4LF5K 1ESVA 3BF1A 3EZWA 5B8HA 2UXDK 4YNQA 2DPNA 2VWKA 3QB0A 1IBKK 4A57A 3TAQA 1NGCA 4DQ8A 4CE9A 4CJKA 1IBMK 4DS4A 4YOYA 4OLAA 1Y64A 4NCAA 1Q9XA 2VG5A 2ZQBA 3AVHA 5HROA 3G25A 4KHWA 4LH4A 3V9XA 2HSTA 2B5JA 3EKUA 1XQSC 4LFCK 4GV6A 1NKEA 2RKIA 1N6QA 5KPRA 3LWMA 1WAJA 1BCOA 3AO1A 1JLGA 4AM7A 2P51A 3VQCA 4FO0A 3KLIA 4CHPA 3TAPA 5AQFA 4DTUA 4CFCA 1O13A 2YX6A 3U3YA 3ITHA 4H03B 4IDKA 4FJ9A 2KZZA 4JKGB 3PY8A 3FE1A 3AGKA 1JXBA 1VQ7N 3UKUA 3K58A 1HNWK 4NCGA 1VQ8N 1BIUA 4CHOA 1HYSA 3AVAA 2QXLA 4LC9B 3L2WA 1C0MA 3TANA 4CJ5A 3F2KA 2QTDA 1WSJA 4QOZB 4CZKA 2IVOA 4FJMA 3CI5A 4IO9L 5GAHP 2P5GA 3AO5A 4JKAA 4JKEA 5AZJA 1YUWA 3K9JA 3OHRA 2ASMA 2NRZA 4DQIA 2GELA 4I6MB 3F9KA 4M63C 3OYJA 4DQRA 2CGJA 2BH1A 5AZIB 3THYB 5JS1A 4RCHA 4CGGA 1BDGA 1QTMA 5CZ1A 3FZHA 4NLCA 1BU6O 3CJBA 1ZBHA 1OVYA 5F2RA 4DV2K 1SL1A 1K73O 2KFNA 1RT6A 1S9GA 4CJ4A 1U2VB 2ETJA 4O8KA 1YVNA 3AAQA 1XMQK 4PL7A 5AQJA 1HPZA 1S1UA 3O1BA 1DKGD 3KKSA 4CBXA 3TTCA 1XNRK 2G8UA 4DMNA 2FBVA 1XHXA 3NDKA 2A1RA 3P4IA 4IEEA 3NGZA 4FXDA 3V6DA 1L3SA 4B1ZA 3VQEA 4IOCL 3LDOA 1Y97A 1OKJA 3QMLA 3CM6A 1EXQA 5EU7A 1WSFA 4OVLA 1F21A 4CEBA 4O5FA 1GOCA 4L3QA 1IO2A 4EZ9A 4IXCA 4DR1K 1NJYA 4BROA 3BZCA 3O4QA 3RMDA 1BGXT 5BR8K 4KH5A 2XO7A 3HVTA 3DLEA 2JWLA 4B1UB 3DLLL 3OYFA 2PZSA 3HXMA 4DFKA 4FLWA 1Q86O 3C6HA 4FK4A 3KK7A 2VQFK 2IDOA 1VQON 4DSKA 1J6ZA 1G15A 4DU3A 4O44A 2P9IB 1BI4B 4A61A 4CEDA 1R59O 1TV6A 3SJJA 5EVZA 1T03A 5CZ2A 3VQ9A 4LSNA 4LF7K 2HW3A 1VK0A 3CQXA 4GMJB 3D2EB 3HM8A 5J2NA 3L2RA 3TAGA 2HMIA 3FZMA 4AM6A 3L2VA 4DTNA 2PAVA 3FFKB 1CZ9A 1WSHA 2W6KA 3OTOK 1EWQA 3OJUA 4DSLA 1NMDA 3HVRA 4RW4A 3SMPA 4CGJA 3CC7N 4AILC
chains in the Genus database with same CATH topology
4JN4A 2FSKA 5AZJB 3GG4A 3FZFA 1NGHA 2VWBA 1NLVA 2Q31A 4HTLA 3M1FA 3HTVA 4BRKA 5BR9A 3QFUA 4JEPA 3SJHA 3VF2A 1NGJA 3ZX3A 3QFPA 2P9KA 3IFRA 1U6ZA 2Q97A 4GNIA 5AQUA 4FL9A 1HLUA 3VEOA 3PLAA 5CHIA 3ULEA 3H1QA 5E26A 2YHXA 4FWRA 1TUYA 2QWRA 3BP8A 4FWKA 4B1XB 2GWKA 2V7ZA 3HOSA 4KH4A 3WUHA 3VTIA 4YOVA 1HX1A 3GBTA 4DHYA 2A5XA 3F5TA 3RVCA 3TPQA 2NRWA 4YORA 4YDUA 2P9SB 1D4XA 5EOYA 5M1OA 2ZWHA 2IVPA 3R3LA 3O9SA 3EE8A 4GVEA 3VPZA 4BRPA 4CZJA 5AFUA 3T69A 2ZF5O 3LDNA 1QQNA 4IJNA 4A5BA 3MN9A 4XH1A 2GX9A 3J8AA 1X3MA 4K25A 4WCEL 2GTDA 1P8ZA 3OBWA 5BPNA 1NGFA 1HUXA 2J4RA 3QBWA 2E20A 3ZYYX 3DXKB 3O8MA 5AQTA 1ZXOA 4EHUA 1NGAA 4OO1J 5AQHA 2QWNA 3F9MA 3C6AA 3GL1A 2E2PA 3R9PA 1V4SA 4CBWA 5GADP 1VQ6N 3CJCA 1BO5O 4BVPA 4FOEA 5EY4A 4C1NK 1VQ9N 3CCRN 2HBJA 4JKBA 1YJNN 1VQLN 3GOIA 1HPMA 2P9NB 3HOTA 3MN5A 1YIJN 3O1WA 1MA9B 3SLCA 2JWKA 2W40A 1S3XA 3VEWA 4BRHA 2E1YA 2HMPA 3VESA 3VOVA 5C15A 4GV3A 3CETA 2P9KB 3HBTA 3K9KA 4BGBA 1Q82O 2H3GX 2E2QA 4FWMA 3U8XA 4IZ9A 5DM7L 1YF5L 1QQMA 5LJWA 3LM2A 1NGGA 3FLCO 3MN7A 3MWPA 3ATUA 5BRFA 3P31A 1SQKA 1EO1A 3B8AX 3WQUA 1TUUA 3ZETA 4HWIA 4DB3A 1QHAA 3W0LA 3MN6A 5M1FA 3H1VX 5ADXA 1W2BM 3D2EA 2E88A 5AR0A 4KBOA 1ZC6A 4H5TA 1HKBA 5AQKA 5JICA 5KPZA 3SAFA 4IEIA 2A42A 5C12A 1Q7YO 3C65A 3G6EN 4H5VA 2QEXN 3S41A 4BVOA 2F9WA 3L4IA 4FWQA 3IMXA 3J7ZO 3FGUA 4EFHA 3QDKA 1GLBG 4BY9C 3DJCA 1NGIA 2CGLA 3EL2A 3VEYA 4U7BA 3VTHA 4YOUA 2HBKA 1VQ4N 4BREA 4H0VB 3MCAB 4MO4A 5C10A 1VQ5N 4WYBA 4JK9A 5EX5A 2D0PA 4BR7A 5GIOA 4BECA 4ILGB 4FVUA 3ZEUA 1JCFA 5GAEP 3MK6A 3BUZB 4WFNL 2WFBA 3WT0A 2V51B 1KAZA 3SK3A 4BRMA 5H1SQ 3KWGA 4BG9A 4DKWA 4K41A 1QQOA 4PKGA 4FSVA 3WQTA 3ZX2A 3CMEN 5M1QA 1ATRA 2ZGYA 3HZ6A 3SBGA 1DT9A 3MCPA 2VCPA 3EN9A 4JK7A 5I9EB 5AQPA 3G4SN 3L4QA 5JVHL 3I8BA 2QI2A 4BR5A 4DCHA 3LL3A 3H6EA 3HI0A 3EE9A 1QZ6A 2BTFA 4CZLA 2NLXA 1JJ2M 3E9PA 1JCEA 3O9TA 4O8UA 3E66A 3CCMN 3CCSN 2YJEA 1NGEA 1YAGA 1RFQA 1Z6RA 1RGIA 3NMUA 1KD1O 2EWSA 3NVMA 4M7YA 5F0XA 3CD6N 2WC9A 3CCQN 3CHWA 5CR4A 4EHTA 4H0PA 3IUCA 4BRDA 1S22A 2F7TA 1JCGA 2P9UB 4JKCA 5AQXA 4WQ4A 2NRVA 3I55N 3CCUN 4BQLA 2AA4A 4YOWA 2A6AA 4QS9A 4BRFA 1GLAG 3AARA 3C7NA 3WXLA 3ID8A 5AQSA 5BREA 3A0IX 3OW2M 4BRLA 3KWIA 3H3NO 3LM9A 1VQKN 2YI1A 4IOAL 4A2AA 5E84A 3NVKA 4H5NA 4M7XA 2HOEA 1MWMA 5F1XA 2A41A 3DXMA 4QS8A 2HF3A 3WXMB 4BR2A 4H5RA 4MLHA 4NO7A 3H45C 5AQLA 3QBXA 5BRDA 4A62A 2I7PA 4MDAA 4YOXA 2YCHA 2FLOA 2PFUA 3A5MC 3VF4A 3ATVA 5EXWA 1NGDA 3CERA 3EKSA 3VMFB 3ZEUB 3MWTA 1DEJA 2VGNA 3VEZA 1LCUA 1SS6A 1M1KO 3GDQA 3CCJN 4FWNA 4CZMA 4BG8A 4EAHD 5AQGA 1CZAN 4ILHA 5AQOA 3CCEN 1P90A 4GV9A 3CF5L 3WEEB 1SZ2A 2ZJQL 3TU5A 2QA4N 5AFUH 4UY8O 5JLFA 4H0OA 1YHQN 3E9LA 3R8EA 5C0YA 3P39A 3C7NB 3M3ZA 2IIRA 2NRHA 5ELZA 1YITN 3CCLN 4QS7A 3L0QA 2YHYA 3WXJA 3VF6A 4CJ7A 1IG8A 1BG3A 2QW9A 2AP1A 2RE2A 4BR4A 2BUPA 1NJIO 4BC5A 5AQIA 4ISFA 1BWFO 2NRXA 3TSQA 3CCVN 1K8KB 2FF6A 2NRTA 5M1NA 4NLBA 5AQQA 3LDQA 4NB4A 1VQNN 4YOTA 4BR0A 3GE1A 1T44A 3ID6A 3TSUA 5TKYA 4BRCA 3L6QA 3E1YA 3UKRB 4K43A 4XEIA 4JKGA 1NWKA 5BPMA 1X9JA 5BN9A 2W00A 3VERA 2OTJN 2E2OA 3TTDA 5M1KA 1GLDG 5HL7L 3CJAA 4FPBA 3T7ZA 4H0YB 5AZIA 3W3DA 1E4FT 4C1NI 2V52B 3MDQA 2ASOA 1ESVA 3BF1A 2P9PA 3EZWA 3O6WA 5B8HA 3D2FA 3MX2A 2FSNA 4FPAA 4H0XB 4WFBL 3MMVA 1BUPA 2DPNA 4BC2A 1EQYA 1HJOA 3M6GA 4K42A 3QB0A 2OTLN 3O9UA 4A57A 1MWKA 1NGCA 4MO5A 4BC3A 1ZBSA 4DQ8A 1C0GA 2NZTA 2P9LA 2OANA 2E8AA 3Q7BA 1U2VA 3FZKA 4YOYA 1GLFO 3CC2N 2GWJA 2FF3B 3E9OA 2GUPA 4IDHA 1Y64A 4WQ5A 5HOOA 3CPWM 1KAYA 3WEEA 5LY3A 1S72N 4BE7B 3G25A 3U4LA 2GEMA 2HSTA 3A5OC 3EO3A 3TTFA 2IVNA 3EKUA 1XQSC 3C0BA 1RDWX 3A5NC 4WF9L 5KPTA 5BN8A 4GV6A 2CH5A 1WOQA 5GAGP 1TYQA 2P9IA 1ATSA 4EIAA 1G99A 5KPRA 3FR0A 2QWLA 2Q36A 4JD2A 2P9LB 2VYPA 3JS6A 5GINA 4AM7A 2FSJA 2Q2RA 3CJ7A 1W97L 3DXKA 3PIOL 4J8FA 3D2FB 4CZFA 4FO0A 3PIPL 2ZJRL 4BRGA 1ATNA 4CD3A 4BQZA 4F9OA 1YI2N 5AQFA 3O9RA 4IFEA 2PBDA 1O13A 2YX6A 3KHYA 3OA9A 3CIPA 4H03B 4OPAA 3DXMB 2P9PB 3N4QA 4CZHA 4WFAL 4FWPA 1MDUB 3CPEA 4JKGB 4WQ4C 2HBLA 2ASPA 4Y0WA 4CZIA 1VQMN 4R79A 1BA0A 3O80A 1YJWN 1QVGM 3RSEB 3P38A 3VGKA 3FE1A 1Z05A 3AGKA 3KZBA 1YJ9N 3VEVA 1T6CA 4FWLA 1X3NA 5AQVA 1VQ7N 3UKUA 4H0TB 2D4WA 4AF1A 2Q0RA 3O08A 1VQ8N 1YXQA 3BF3A 4JKDA 3H3OB 5JVGL 4XJXA 3VENA 1WUAA 3AGRA 1K9MO 3O4WA 1KQSM 3ULEB 1NGBA 2WBNA 4LC9B 2QXLA 2HBMA 4BR9A 1E4GT 3A8YA 3F2KA 5FPMA 2QTDA 2ITMA 4GY2B 4KH6A 4CZKA 4BEBA 2IVOA 3CI5A 1LOTB 4IO9L 2HF4A 4JHDA 5GAHP 4JKAA 1M90O 3FZLA 1QZ5A 3VEXA 4JD2B 1T6DA 4PKHA 4PHTX 5FPEA 4JKEA 4IOXA 3ZX0A 5AZJA 1YUWA 3K9JA 1K8AO 2P9SA 3OHRA 2ASMA 2NRZA 3VGMA 2E1ZA 3WXKA 1VQPN 2GELA 4I6MB 4M63C 5DM6L 2CGJA 2BH1A 3CJ1A 2P9NA 3M5RA 3HRGA 1VAZA 5AZIB 3WXIA 5AQYA 1V4TA 3BEXA 5M1PA 4RCHA 4FWSA 4A2BA 1BDGA 2A3ZA 5LJVA 3I33A 3UE5A 5GIPA 3FZHA 3ENOA 4NLCA 1BU6O 3CJBA 5BRHA 2QWPA 1OVYA 3KVGA 3O9QA 4I6MA 5F2RA 3CXCM 1KC8O 4JHDB 3SAGA 1K8KA 1K73O 2D0OA 4BRNA 4CZEA 3G71N 2FXUA 2QWOA 1U2VB 4O8KA 1YVNA 4H5WA 1GLCG 1RDUA 2ZGZA 2V7YA 3AAQA 2UYTA 3D6RA 5AQRA 2W41A 4JKFA 4CD1A 1SAZA 4B1WB 2CGKA 4C23A 5AQJA 5CE3A 4PL7A 5BPLA 4BRQA 4BC4A 2F9TA 4RWTA 4PKIA 3O1BA 2KLAA 1DKGD 3CQYA 2QM1A 3ENBA 4CBXA 4E1JA 2I7NA 3TTCA 3Q7CA 3DAWA 1HKGA 2A40A 1GLJO 2E2NA 3RSEA 1T3VA 2YJFA 1XUPO 3IDHA 4A5AA 3P4IA 4IEEA 4B1ZA 2VGMA 4FOIA 2CH6A 4IJAA 4BRIA 5KQ8A 3LDOA 4IOCL 3VGLA 3U9DA 1OKJA 3QMLA 4JAXA 3IKMA 3D7EO 4MDBA 3CC4N 5JMVA 4U67L 4JK8A 3N4PA 4XH5A 3A5LC 4IO8A 3ENHA 4Z94A 4BGAA 3U9ZA 1BOTO 3AAPA 3CC7N 1KXPA 4BRAA 4JNEA 5MLCQ 1GLLO 4A59A 4O5FA 4MLEA 4L3QA 3LDPA 4OPHA 5AQNA 5TKWA 4IXCA 4BROA 3SAHA 1DGKN 4B1YB 3H46O 5ADXH 1BA1A 3CJ9A 3SMSA 3VETA 5JLHA 2C1GA 4FWOA 3CMAN 3UKRA 5KQDA 5FPNA 2QWMA 4KH5A 1XC3A 4YDUC 1IJJA 1NM1A 2YHWA 3R1XA 2ZJPL 1QVFM 1ILYA 4PL8A 3TSPA 5AQZA 4ISGA 2JWLA 3LDLA 5AQMA 1KAXA 3UB5A 2D1KA 4B1UB 3DLLL 5AQWA 4IWVA 1Q86O 1NBWA 4B1VA 3C6HA 1N8RO 3KK7A 3MX5A 4RTFD 1VQON 4JKHA 2KHOA 1J6ZA 3AY9A 1TYQB 2P9IB 2KKZA 1GLEG 4A61A 3UKUB 4CZGA 5C2FA 1R59O 5EVZA 5FPDA 1HKCA 3QICA 4CBUA 1H1VA 2Q1NA 3DWLA 3R6MA 2NRRA 3I56N 1Q18A 3CQXA 3SBTA 1Q81O 4G9ZA 4B9QA 3D2EB 3HM8A 5C2DA 2NNWA 3HSCA 4XH4A 3OBYA 2P9UA 1C0FA 3FZMA 4ILJA 2Q0UA 2PAVA 3FFKB 2QWQA 4AM6A 4ISEA 3ZETB 1NMDA 4CI6A 2WUSA 3O5BA 3SMPA 3JXUA 2C1IA 4WQ5C 2RHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JN4 A;  2FSK A;  5AZJ B;  3GG4 A;  3FZF A;  1NGH A;  2VWB A;  1NLV A;  2Q31 A;  4HTL A;  3M1F A;  3HTV A;  4BRK A;  5BR9 A;  3QFU A;  3SJH A;  3VF2 A;  1NGJ A;  3ZX3 A;  3QFP A;  2P9K A;  3IFR A;  1U6Z A;  2Q97 A;  4GNI A;  5AQU A;  4FL9 A;  1HLU A;  3VEO A;  3ULE A;  3H1Q A;  5E26 A;  2YHX A;  4FWR A;  1TUY A;  2QWR A;  3BP8 A;  4FWK A;  4B1X B;  2GWK A;  2V7Z A;  3WUH A;  1HX1 A;  3GBT A;  4DHY A;  2A5X A;  3TPQ A;  4YDU A;  2P9S B;  1D4X A;  5EOY A;  2ZWH A;  2IVP A;  3VPZ A;  4CZJ A;  4BRP A;  5AFU A;  2ZF5 O;  3LDN A;  1QQN A;  4IJN A;  3MN9 A;  4XH1 A;  3J8A A;  1X3M A;  4K25 A;  2GTD A;  1P8Z A;  5BPN A;  1NGF A;  1HUX A;  2J4R A;  3QBW A;  2E20 A;  3DXK B;  3O8M A;  5AQT A;  1ZXO A;  4EHU A;  1NGA A;  5AQH A;  2QWN A;  3F9M A;  3GL1 A;  2E2P A;  3R9P A;  1V4S A;  4CBW A;  3CJC A;  1BO5 O;  4BVP A;  4FOE A;  5EY4 A;  3GOI A;  1HPM A;  2P9N B;  3MN5 A;  3O1W A;  1MA9 B;  3SLC A;  2W40 A;  1S3X A;  3VEW A;  4BRH A;  2E1Y A;  2HMP A;  3VES A;  3VOV A;  3CET A;  2P9K B;  3HBT A;  4BGB A;  2H3G X;  2E2Q A;  4FWM A;  3U8X A;  4IZ9 A;  1QQM A;  5LJW A;  3LM2 A;  1NGG A;  3FLC O;  3MN7 A;  3ATU A;  5BRF A;  1SQK A;  3B8A X;  3WQU A;  1TUU A;  3ZET A;  4HWI A;  4DB3 A;  1QHA A;  3W0L A;  3MN6 A;  3H1V X;  5ADX A;  3D2E A;  2E88 A;  5AR0 A;  4KBO A;  1ZC6 A;  4H5T A;  1HKB A;  5AQK A;  5JIC A;  5KPZ A;  2A42 A;  4H5V A;  3S41 A;  4BVO A;  2F9W A;  3L4I A;  4FWQ A;  3IMX A;  3FGU A;  4EFH A;  3QDK A;  1GLB G;  3DJC A;  1NGI A;  2CGL A;  3EL2 A;  3VEY A;  4BRE A;  4H0V B;  4MO4 A;  4WYB A;  5EX5 A;  2D0P A;  4BR7 A;  3ZEU A;  1JCF A;  3MK6 A;  3BUZ B;  3WT0 A;  2V51 B;  1KAZ A;  3SK3 A;  4BRM A;  4BG9 A;  4K41 A;  1QQO A;  4PKG A;  4FSV A;  3WQT A;  3ZX2 A;  1ATR A;  2ZGY A;  3HZ6 A;  3MCP A;  2VCP A;  3EN9 A;  5I9E B;  5AQP A;  3I8B A;  4BR5 A;  4DCH A;  3LL3 A;  3H6E A;  3HI0 A;  1QZ6 A;  2BTF A;  4CZL A;  2NLX A;  1JCE A;  2YJE A;  1NGE A;  1YAG A;  1RFQ A;  1Z6R A;  1RGI A;  2EWS A;  4M7Y A;  5F0X A;  3CHW A;  4EHT A;  4H0P A;  3IUC A;  4BRD A;  1S22 A;  2P9U B;  1JCG A;  5AQX A;  4WQ4 A;  4BQL A;  2AA4 A;  2A6A A;  4QS9 A;  4BRF A;  1GLA G;  3AAR A;  3C7N A;  3WXL A;  3ID8 A;  5AQS A;  5BRE A;  3A0I X;  4BRL A;  3H3N O;  3LM9 A;  2YI1 A;  4A2A A;  5E84 A;  4H5N A;  4M7X A;  2HOE A;  1MWM A;  5F1X A;  2A41 A;  3DXM A;  4QS8 A;  2HF3 A;  4BR2 A;  4H5R A;  4MLH A;  4NO7 A;  3H45 C;  5AQL A;  3QBX A;  5BRD A;  4A62 A;  2I7P A;  2YCH A;  2FLO A;  3A5M C;  3VF4 A;  3ATV A;  5EXW A;  1NGD A;  3CER A;  3EKS A;  3ZEU B;  1DEJ A;  3VEZ A;  1LCU A;  3GDQ A;  4FWN A;  4CZM A;  4BG8 A;  4EAH D;  5AQG A;  1CZA N;  5AQO A;  3WEE B;  1SZ2 A;  3TU5 A;  5AFU H;  5JLF A;  4H0O A;  3R8E A;  3C7N B;  3M3Z A;  2IIR A;  2NRH A;  5ELZ A;  4QS7 A;  3L0Q A;  2YHY A;  3WXJ A;  3VF6 A;  4CJ7 A;  1IG8 A;  1BG3 A;  2QW9 A;  2AP1 A;  4BR4 A;  2BUP A;  4BC5 A;  5AQI A;  4ISF A;  1BWF O;  1K8K B;  2FF6 A;  5AQQ A;  3LDQ A;  4NB4 A;  4BR0 A;  3GE1 A;  1T44 A;  5TKY A;  4BRC A;  3L6Q A;  3UKR B;  4K43 A;  4XEI A;  5BPM A;  1NWK A;  1X9J A;  5BN9 A;  3VER A;  2E2O A;  1GLD G;  3CJA A;  4FPB A;  4H0Y B;  5AZI A;  3W3D A;  1E4F T;  2V52 B;  3MDQ A;  2ASO A;  1ESV A;  3EZW A;  2P9P A;  3BF1 A;  3O6W A;  5B8H A;  3D2F A;  4FPA A;  2FSN A;  4H0X B;  3MMV A;  1BUP A;  2DPN A;  4BC2 A;  1EQY A;  1HJO A;  3M6G A;  4K42 A;  3QB0 A;  1MWK A;  1NGC A;  4MO5 A;  4BC3 A;  1ZBS A;  4DQ8 A;  1C0G A;  2NZT A;  2P9L A;  2OAN A;  2E8A A;  1U2V A;  3FZK A;  1GLF O;  2GWJ A;  2FF3 B;  2GUP A;  1Y64 A;  4WQ5 A;  1KAY A;  3WEE A;  5LY3 A;  3G25 A;  3U4L A;  2GEM A;  3A5O C;  3EO3 A;  2IVN A;  3EKU A;  1XQS C;  3C0B A;  1RDW X;  3A5N C;  5KPT A;  5BN8 A;  2CH5 A;  1WOQ A;  1TYQ A;  2P9I A;  1ATS A;  4EIA A;  1G99 A;  5KPR A;  3FR0 A;  2QWL A;  2Q36 A;  4JD2 A;  2P9L B;  2VYP A;  3JS6 A;  4AM7 A;  2FSJ A;  2Q2R A;  3CJ7 A;  3DXK A;  4J8F A;  3D2F B;  4CZF A;  4FO0 A;  4BRG A;  1ATN A;  4CD3 A;  4BQZ A;  4F9O A;  5AQF A;  2PBD A;  3KHY A;  3CIP A;  4H03 B;  3DXM B;  2P9P B;  4CZH A;  4FWP A;  1MDU B;  4WQ4 C;  4CZI A;  2ASP A;  4Y0W A;  1BA0 A;  3O80 A;  3RSE B;  3VGK A;  3FE1 A;  1Z05 A;  3KZB A;  3VEV A;  1T6C A;  4FWL A;  1X3N A;  5AQV A;  3UKU A;  4H0T B;  2D4W A;  2Q0R A;  3O08 A;  1YXQ A;  3BF3 A;  3H3O B;  3VEN A;  1WUA A;  3O4W A;  3ULE B;  1NGB A;  4LC9 B;  2QXL A;  4BR9 A;  1E4G T;  3A8Y A;  5FPM A;  2ITM A;  4GY2 B;  4CZK A;  2IVO A;  3CI5 A;  1LOT B;  2HF4 A;  4JHD A;  3FZL A;  1QZ5 A;  3VEX A;  4JD2 B;  1T6D A;  4PKH A;  5FPE A;  3ZX0 A;  5AZJ A;  1YUW A;  2P9S A;  3OHR A;  2ASM A;  3VGM A;  3WXK A;  2E1Z A;  2GEL A;  4I6M B;  4M63 C;  2CGJ A;  3CJ1 A;  2P9N A;  3WXI A;  5AZI B;  5AQY A;  1V4T A;  3BEX A;  4RCH A;  4FWS A;  4A2B A;  1BDG A;  2A3Z A;  5LJV A;  3I33 A;  3UE5 A;  3FZH A;  3ENO A;  1BU6 O;  3CJB A;  5BRH A;  2QWP A;  3KVG A;  4I6M A;  5F2R A;  4JHD B;  1K8K A;  2D0O A;  4BRN A;  4CZE A;  2FXU A;  2QWO A;  1U2V B;  4O8K A;  1YVN A;  4H5W A;  1GLC G;  2ZGZ A;  3AAQ A;  2V7Y A;  5AQR A;  2UYT A;  2W41 A;  4CD1 A;  1SAZ A;  4B1W B;  2CGK A;  4C23 A;  5AQJ A;  5CE3 A;  4PL7 A;  5BPL A;  4BRQ A;  4BC4 A;  2F9T A;  4RWT A;  4PKI A;  3O1B A;  1DKG D;  3CQY A;  2QM1 A;  4CBX A;  4E1J A;  2I7N A;  3DAW A;  1HKG A;  2A40 A;  1GLJ O;  2E2N A;  3RSE A;  2YJF A;  1XUP O;  3IDH A;  3P4I A;  4B1Z A;  4FOI A;  2CH6 A;  4IJA A;  4BRI A;  5KQ8 A;  3LDO A;  3VGL A;  3U9D A;  1OKJ A;  3QML A;  4JAX A;  3D7E O;  5JMV A;  4XH5 A;  3A5L C;  4IO8 A;  3ENH A;  4Z94 A;  4BGA A;  3U9Z A;  1BOT O;  3AAP A;  1KXP A;  4BRA A;  4JNE A;  1GLL O;  4O5F A;  4MLE A;  4L3Q A;  3LDP A;  5AQN A;  4IXC A;  4BRO A;  1DGK N;  4B1Y B;  3H46 O;  5ADX H;  1BA1 A;  3CJ9 A;  3SMS A;  3VET A;  5JLH A;  4FWO A;  3UKR A;  5KQD A;  5FPN A;  2QWM A;  1XC3 A;  4YDU C;  1IJJ A;  1NM1 A;  2YHW A;  4PL8 A;  5AQZ A;  4ISG A;  3LDL A;  5AQM A;  1KAX A;  3UB5 A;  2D1K A;  4B1U B;  5AQW A;  4IWV A;  1NBW A;  4B1V A;  4RTF D;  2KHO A;  1J6Z A;  3AY9 A;  1TYQ B;  2P9I B;  1GLE G;  4A61 A;  3UKU B;  4CZG A;  1R59 O;  5EVZ A;  5FPD A;  1HKC A;  3QIC A;  4CBU A;  1H1V A;  2Q1N A;  3DWL A;  3R6M A;  1Q18 A;  3CQX A;  4B9Q A;  3D2E B;  3HM8 A;  3HSC A;  4XH4 A;  2P9U A;  1C0F A;  3FZM A;  4AM6 A;  2Q0U A;  2PAV A;  3FFK B;  2QWQ A;  4ISE A;  3ZET B;  1NMD A;  4CI6 A;  2WUS A;  3O5B A;  3SMP A;  3JXU A;  4WQ5 C; 
#chains in the Genus database with same CATH topology
 5AZJ B;  3GG4 A;  3FZF A;  2BGG A;  4FM2 A;  5BR9 A;  3ZX3 A;  3QFP A;  2P9K A;  3IFR A;  5AQU A;  1HLU A;  1L5U A;  3PLA A;  3SUO A;  4Z0U A;  5E26 A;  2OZM A;  4NYF A;  4DTO A;  4FK0 A;  4BE1 A;  1WLJ A;  2G8W A;  4O4G A;  4YOV A;  4CJQ A;  4PWD A;  3PV8 A;  1WN7 A;  1D4X A;  2P9S B;  3V9U A;  2IVP A;  3R3L A;  2ZF5 O;  3LDN A;  5E41 A;  4FJ8 A;  3RMB A;  4KTQ A;  2GX9 A;  3J8A A;  1X3M A;  4K25 A;  4DTJ A;  2GTD A;  3OBW A;  3K57 A;  2J4R A;  4TSX A;  1VSL A;  5AQT A;  1ZXO A;  3NGI A;  1QSY A;  1MU2 A;  5AQH A;  4NYN A;  4X64 K;  4C8M A;  4FOE A;  1FXX A;  4HTU A;  3GOI A;  2E6M A;  4JI8 K;  1YIJ N;  1MA9 B;  1REV A;  1S3X A;  4CHZ A;  4AH9 A;  1SUQ A;  3VES A;  2W6L A;  2O8F A;  3K5O A;  4CF0 A;  3U8X A;  2OPS A;  4IZ9 A;  4OKE A;  1W9H A;  1YF5 L;  5LJW A;  3FLC O;  2RPI A;  1I94 K;  2ZD1 A;  1W2B M;  2JGU A;  5AR0 A;  1ZC6 A;  4H5T A;  4PUO A;  5JIC A;  5C12 A;  1WBD A;  3MXI A;  4H5V A;  4Q0B A;  3L4I A;  3NFA A;  3FGU A;  3F73 A;  1XC9 A;  1NKB A;  4OGE A;  3G10 A;  4BDY A;  3VEY A;  4DV4 K;  4U7B A;  1QS4 A;  4FLU A;  2E5L K;  3DI6 A;  2HBK A;  4ICL A;  4JS4 A;  3DRR A;  4I2Q A;  1UWB A;  4JK9 A;  2D0P A;  3BUZ B;  4WFN L;  3ALY A;  1VSE A;  1KAZ A;  1LAW A;  3SK3 A;  5H1S Q;  4DSJ A;  4I9L A;  1OH7 A;  4FJH A;  4BG9 A;  4BDZ A;  1EX4 A;  3WQT A;  3T1Y K;  5M1Q A;  3HZ6 A;  4JK7 A;  5I9E B;  3TAF A;  5AQP A;  3L4Q A;  4LSL A;  3I8B A;  4JI2 K;  2QI2 A;  3H6E A;  1CXU A;  4N47 A;  3HI0 A;  3EE9 A;  1JLA A;  2Z1H A;  4CZL A;  2NLX A;  1FK9 A;  4DU1 A;  3E9P A;  1JCE A;  4O8U A;  1NJW A;  3NH1 A;  3CCS N;  3HP6 A;  3NF9 A;  1RDC A;  3HT3 A;  1KD1 O;  1XMO K;  2RF2 A;  3IUC A;  4FJG A;  3J7Y P;  2VQE K;  1SKS A;  4DU4 A;  4JKC A;  1RT4 A;  1NK5 A;  4J2E A;  4CF1 A;  3CCU N;  3LZI A;  1NU0 A;  1UA1 A;  1TK0 A;  4K8Z A;  1TL3 A;  3NVK A;  1KVA A;  2A41 A;  1SKW A;  3DXM A;  3TAB A;  4OGC A;  3H45 C;  3WNE A;  3QBX A;  5BRD A;  4ELU A;  4A62 A;  2O8D A;  4CES A;  4YOX A;  2YCH A;  3A5M C;  3BZK A;  3ATV A;  1NGD A;  5J1E A;  3CER A;  3VMF B;  1UA0 A;  3VEZ A;  2O8C B;  1FW6 A;  4FWN A;  1JL2 A;  1ZBL A;  5A2Q O;  4BG8 A;  5AQO A;  4N5S A;  3CCE N;  3AO2 A;  4X65 K;  2QA4 N;  5AFU H;  3M3Z A;  2IIR A;  3ZSX A;  5ELZ A;  3BGR A;  1YIT N;  4CIE A;  4QS7 A;  2YHY A;  4DUY K;  3TAM A;  1BG3 A;  3QIN A;  4CHN A;  4FJX A;  1TAU A;  1A5V A;  1NJI O;  1S9E A;  4KTZ A;  5AQI A;  4HVJ A;  4Z4E A;  2O8D B;  3CCV N;  1K8K B;  2FF6 A;  4C8K A;  5AQQ A;  2EX3 A;  1IG9 A;  1VQN N;  4YOT A;  3ID6 A;  3TSU A;  4OX9 K;  3UKR B;  4XEI A;  4CJT A;  4ZHR A;  3NE6 A;  3BY5 A;  5AZI A;  3SQ0 A;  2F8S A;  1E4F T;  1S1W A;  2V52 B;  4M3Z A;  1KCF A;  3DMJ A;  2ASO A;  1YTU A;  3O6W A;  4M3T A;  3D2F A;  4H0X B;  3MMV A;  3LP1 A;  1VSJ A;  5KRS A;  3O9U A;  4MO5 A;  1ZBS A;  2NZT A;  3Q7B A;  1U2V A;  2FF3 B;  3E9O A;  4L8R B;  4AHS A;  5HOO A;  1KAY A;  2O8E B;  4JI0 K;  3EO3 A;  3T1A A;  2IVN A;  4LY7 A;  1RDW X;  1XI1 A;  3NF6 A;  5KPT A;  2Q3S A;  1L3V A;  2F4V K;  1TYQ A;  1XNQ K;  2BE2 A;  2VG6 A;  3THX A;  2QWL A;  2P9L B;  2VYP A;  3JS6 A;  5GIN A;  2KFZ A;  2O8B B;  4KHN A;  4DFM A;  1K6Y A;  3PIP L;  2ZJR L;  4OKK A;  4IFE A;  2PBD A;  1DTQ A;  3KHY A;  1HNV A;  3OA9 A;  3CIP A;  4CZH A;  4B08 A;  1NK6 A;  4WFA L;  3SUP A;  3ZSO A;  2ASP A;  4Y0W A;  4R5P A;  1TK5 A;  1VQM N;  4R79 A;  3VQP A;  3P38 A;  1TVR A;  3LP2 A;  2OPR A;  1YJ9 N;  5I3U A;  1X3N A;  2XRI A;  4H0T B;  4KPY A;  4GVM A;  2IC3 A;  3BF3 A;  4JKD A;  3VEN A;  1WUA A;  3ZT0 A;  1K9M O;  3O4W A;  4DWI A;  4FJ5 A;  4BR9 A;  1E4G T;  5FPM A;  3NF7 A;  4ID1 A;  2HF4 A;  4JD2 B;  3ZX0 A;  4DV7 K;  2UXB K;  4AHR A;  3HRG A;  4LF9 K;  3BEX A;  2PYJ A;  4A2B A;  5LJV A;  3TWH A;  4FW1 A;  3ENO A;  1JLB A;  1JKH A;  2QWP A;  1ZYQ A;  4ID5 A;  1K8K A;  4HUF A;  4B9T A;  4ZTJ A;  4H5W A;  1GLC G;  3D6R A;  4JKF A;  3KK1 A;  4C23 A;  5CE3 A;  5BPL A;  2RN2 A;  4W5N A;  4BC4 A;  4RWT A;  5LL6 Z;  2QM1 A;  4F3T A;  3DAW A;  3C6U A;  4H4M A;  3NCI A;  2G8K A;  4IFV A;  2E2N A;  4CJS A;  3CYG A;  1ZBU A;  4A5A A;  3M8P A;  4WE1 A;  3DYA A;  2VGM A;  2CH6 A;  4DR5 K;  1NK9 A;  1UOC A;  3U9D A;  4W5R A;  1FKP A;  4AHT A;  2AJQ A;  5DMR A;  3D7E O;  4MDB A;  1X9W A;  1KTQ A;  1RBV A;  3N4P A;  4XH5 A;  3A5L C;  3AVF A;  4LH5 A;  3U3G A;  4Z94 A;  4BGA A;  1BOT O;  3S3N A;  3O3G A;  1KXP A;  3KLE A;  4DTS A;  3S9H A;  5CYM A;  1U49 A;  4F2R A;  3QIP A;  5AQN A;  1DGK N;  2HNZ A;  4B1Y B;  4FZY A;  3H46 O;  4AQY K;  4PY5 A;  4Y1C A;  3K5L A;  1B9F A;  2C1G A;  5FPN A;  2QWM A;  3CFR A;  1XC3 A;  4YDU C;  3IG1 A;  2ZJP L;  1QVF M;  3LDL A;  4FJJ A;  1RBR A;  3QEV A;  3SV4 A;  4MFB A;  1KAX A;  4OPK A;  2D1K A;  5AQW A;  4IWV A;  4HCB A;  1N8R O;  4M41 A;  2XY5 A;  3NBP A;  2DY4 A;  3CFP A;  4FLV A;  4M3X A;  4JKH A;  4E19 A;  3AY9 A;  3J7A P;  5DK5 A;  3SUQ A;  2KKZ A;  1WNS A;  1TKZ A;  4CK3 A;  1VSH A;  4B9M A;  1HKC A;  3QIC A;  4DLG A;  4CBU A;  2Q1N A;  1WBB A;  4JI1 K;  1Q81 O;  4G9Z A;  4B9Q A;  2WTU A;  4B3R K;  3AA4 A;  4CJW A;  4DSE A;  1C0F A;  1WSG A;  2HHS A;  4CI6 A;  3SMS A;  2C1I A;  3JAM O;  4I9Q A;  2VWB A;  2E4L A;  3HTV A;  2KW4 A;  3QEI A;  4FCY A;  3S5T A;  3QFU A;  3VF2 A;  1NGJ A;  2XY7 A;  3KLG A;  4ELT A;  4Z4I A;  2Q97 A;  4FL9 A;  3VEO A;  1LWE A;  5J2M A;  5CHI A;  3DLK A;  3ULE A;  2YHX A;  5KGW A;  1X9M A;  2O8E A;  1TUY A;  2QWR A;  3BP8 A;  4FWK A;  2OPQ A;  2GWK A;  2V7Z A;  3HOS A;  3WUH A;  2A5X A;  3RVC A;  3J81 O;  1HYV A;  3UIQ A;  1VSF A;  4BRP A;  3EE8 A;  3L3U A;  2HND A;  1X9S A;  4WCE L;  1YTA A;  1NGF A;  3QBW A;  2E20 A;  1HNZ K;  3DXK B;  3KLH A;  1NG9 A;  1IKV A;  4OO1 J;  2HHH K;  3OYB A;  1JLQ A;  3F9M A;  3DOL A;  2E2P A;  1V4S A;  2XY8 A;  3HM9 A;  4IBN A;  2ATQ A;  5EY4 A;  4C1N K;  1VSI A;  3K2P A;  2HBJ A;  3AVL A;  3HOT A;  3MN5 A;  3THY A;  2E1Y A;  1NKC A;  2P9K B;  3HBT A;  3OS2 A;  2E2Q A;  2B6A A;  3DOK A;  5DM7 L;  4YHH K;  3DM2 A;  3LM2 A;  4GKK K;  3AVG A;  5IT9 O;  3MWP A;  3CG7 A;  3P31 A;  3K0S A;  4HWI A;  4DB3 A;  1QHA A;  3W0L A;  1TGO A;  2IS3 A;  4KBO A;  2D5R A;  4IEI A;  2A42 A;  1TKX A;  2QKB A;  2QEX N;  3THW B;  2F9W A;  1I39 A;  1L3U A;  3QDK A;  1GLB G;  4CJR A;  4BY9 C;  4JV5 K;  4KFB A;  4CGD A;  2B4J A;  1VQ5 N;  5C10 A;  4DQQ A;  4WYB A;  4BEC A;  4ILG B;  5GAE P;  4RW8 A;  4CJP A;  3WT0 A;  4CEO A;  2V51 B;  3K59 A;  4BRM A;  5IWA K;  4CK1 A;  1LW0 A;  4DKW A;  4PKG A;  4F8R A;  3ZX2 A;  1N33 K;  1ATR A;  3PO5 A;  3SBG A;  3MCP A;  2VCP A;  3EN9 A;  4NXN K;  1NJX A;  4BR5 A;  2E6L A;  4MQ3 A;  3V1Q A;  5D3G A;  3RWU A;  2GV9 A;  1KLM A;  4DTX A;  5J2Q A;  2BTF A;  1X1P A;  4O0I A;  1JJ2 M;  3E66 A;  1NNE A;  1YAG A;  2GBZ A;  1Z6R A;  1RGI A;  1DLO A;  2EWS A;  3NVM A;  4OKJ A;  5F0X A;  3CD6 N;  2WC9 A;  5CR4 A;  4FM1 A;  2P9U B;  4O5B A;  1WSI A;  4CF8 A;  3CQ8 A;  3ZSQ A;  3I55 N;  2AA4 A;  3OYK A;  4BRF A;  4QS9 A;  3C7N A;  3WXL A;  3ID8 A;  5C24 A;  3SV3 A;  3C94 A;  3KWI A;  4IOA L;  4H4O A;  4KAZ A;  1T7P A;  4QS8 A;  3KD1 E;  3SNN A;  1HR0 K;  3VF4 A;  3TAR A;  5EXW A;  2VG7 A;  1VSK A;  1JLC A;  3THX B;  3ZSZ A;  3VQ6 A;  3WNF A;  1J5E K;  4M3W A;  5AQG A;  3VQ4 A;  4NCB A;  1D8Y A;  5KRT A;  2HHI A;  4N56 A;  3J80 O;  4UY8 O;  1LWC A;  3R8E A;  4DV3 K;  2I5J A;  3SPZ A;  2KTQ A;  3P39 A;  3C7N B;  2OPP A;  2NRH A;  3NHG A;  1N32 K;  2BAN A;  3VQD A;  3DLH A;  3WXJ A;  4BDP A;  1RDB A;  3VA0 A;  1EKE A;  3U6F A;  4HUG A;  3AVN A;  3DRP A;  4BC5 A;  4ISF A;  1IBL K;  3TSQ A;  4CJL A;  4CJV A;  3M8S A;  3CYM A;  4DF4 A;  3AA2 A;  4JLH A;  3OYL A;  2UUC K;  3OS0 A;  3QNN A;  3E1Y A;  5HBM A;  5BPM A;  3VER A;  2OTJ N;  5M1K A;  3CJA A;  3B6P A;  3NGY A;  4H0Y B;  1C0T A;  1KRP A;  3AVJ A;  2P9P A;  3ZSV A;  4WFB L;  3MX2 A;  3QEX A;  1XWL A;  1C0U A;  2OZS A;  3AVK A;  1VRT A;  1TKD A;  4JRQ A;  4K42 A;  2OTL N;  1JLE A;  4E7H A;  3ZT2 A;  2P9L A;  2OAN A;  2E8A A;  1BQN A;  4CEZ A;  3FZK A;  3LPT A;  2D0A A;  2GWJ A;  2GUP A;  2KQ2 A;  1IKY A;  3CPW M;  2FBX A;  3WEE A;  5LY3 A;  4BE7 B;  1U47 A;  4CFB A;  4M3U A;  2JLE A;  5BN8 A;  3PUF A;  1WOQ A;  3HYF A;  3OYA A;  1ZBF A;  1U45 A;  2Q36 A;  1OVQ A;  1ASW A;  4CEF A;  2FSJ A;  2Q2R A;  4FZZ A;  1E3M A;  3CJ7 A;  1W97 L;  3PIO L;  2HHQ A;  4E89 A;  3LZJ A;  4CEA A;  4BRG A;  1ATN A;  1QHT A;  4FLY A;  2W42 A;  4KHU A;  4J2D A;  4OPA A;  2P9P B;  1RTJ A;  1MDU B;  3AV9 A;  4DLE A;  4Z4G A;  3OVN A;  3O80 A;  1YJW N;  1QVG M;  3RSE B;  1Z05 A;  3KZB A;  1BI4 A;  1ITG A;  4FWL A;  1QQC A;  2FBY A;  4AF1 A;  1YXQ A;  3QO9 A;  3O3F A;  4XJX A;  3OYE A;  3H08 A;  3ULE B;  2YNG A;  1NGB A;  4CFD A;  4DFP A;  3QES A;  2ITM A;  4N76 A;  4JHD A;  1KFD A;  1SL0 A;  4KB1 A;  4PKH A;  5FPE A;  2X6S A;  4W5Q A;  1BIZ A;  2E1Z A;  3T1H K;  5DM6 L;  1VAZ A;  3QLH A;  1R0A A;  5M1P A;  4FWS A;  2A3Z A;  4Z4H A;  4KI4 A;  5GIP A;  1KFS A;  3D0P A;  4JI3 K;  3S3M A;  2O8C A;  4DF8 A;  4FLT A;  3O9Q A;  4I6M A;  3CXC M;  1KLN A;  1RT1 A;  2D0O A;  4BRN A;  4CZE A;  5JEN A;  1RBT A;  2GUI A;  3AVI A;  2QWO A;  3OS1 A;  3RRH A;  1RDU A;  2V7Y A;  2W41 A;  4CD1 A;  1W0H A;  2CGK A;  1C1A A;  4PKI A;  3ENB A;  4FM0 A;  2I7N A;  3Q7C A;  4E72 A;  1HKG A;  2A40 A;  1GLJ O;  3RSE A;  5HRR A;  1J53 A;  1T3V A;  3IDH A;  2G8V A;  2ZM6 K;  4FOI A;  4IJA A;  4BRI A;  2Z1I A;  1JLF A;  1I3A A;  3P83 D;  4E1M A;  5J2P A;  4DR2 K;  5JMV A;  4JK8 A;  3RRG A;  3ENH A;  2HHX A;  3MEE A;  2O8F B;  4BRA A;  5MLC Q;  4M3R A;  4QCL A;  3OYM A;  1GLL O;  1UAX A;  1BL3 A;  4MLE A;  4CIG A;  3LDP A;  4OPH A;  2FBT A;  1RCH A;  4CFA A;  5ADX H;  1BA1 A;  3SCX A;  4DTP A;  1RT2 A;  3CMA N;  3UKR A;  5KQD A;  4RW7 A;  2O4G A;  1IJJ A;  1NM1 A;  2YHW A;  1VRU A;  3R1X A;  4YFU A;  1ILY A;  3TSP A;  4CW7 B;  3ASM A;  4ISG A;  4LF8 K;  3P1G A;  2KZM A;  3UB5 A;  4W5O A;  3L2U A;  4CK2 A;  4B1V A;  3RMC A;  3B6O A;  3MX5 A;  4CVN E;  3NF8 A;  3AVC A;  4CEE A;  1TYQ B;  1W7A A;  4DV1 K;  1HYZ A;  3UKU B;  4CZG A;  2DFE A;  4M42 A;  3TAE A;  2UXC K;  2NRR A;  4KI6 A;  3I56 N;  3OYN A;  1J5O A;  4J2A A;  5C2D A;  4XH4 A;  3OBY A;  2P9U A;  4FJK A;  4ILJ A;  2Q0U A;  3LAN A;  2OCE A;  5CYQ A;  3HK2 A;  5KGX A;  3AO4 A;  2DFF A;  3O5B A;  3JXU A;  2RHK A;  2FSK A;  4DSI A;  2XHB A;  3PX4 A;  1NOY A;  3LWL A;  4E0D A;  1KVC A;  3M1F A;  4XIU A;  3KK3 A;  4JI7 K;  2LSN A;  4JEP A;  3SJH A;  2O8B A;  4H8K A;  1TK8 A;  1SL2 A;  4N41 A;  4GNI A;  2HHW A;  2HHT A;  5SZT A;  4B9N A;  2R7Y A;  4Q5V A;  3HJF A;  4KH4 A;  1HX1 A;  4DHY A;  1RNH A;  2NRW A;  4DR3 K;  3PSI A;  4YDU A;  3SZ2 A;  2ZWH A;  3VPZ A;  4CF2 A;  3O9S A;  3D45 A;  1TKT A;  1HRH A;  1QQN A;  4A5B A;  1D9F A;  3MN9 A;  4M45 A;  5I42 A;  3V1R A;  5BPN A;  3G0Z A;  3ZYY X;  3O8M A;  3IAY A;  1YT3 A;  4CF9 A;  4CER A;  3GL1 A;  3R9P A;  5FLX O;  4CBW A;  5GAD P;  4DV6 K;  1GOB A;  3OYG A;  4BVP A;  3EY1 A;  4CEQ A;  3CCR N;  5HLF A;  4JKB A;  1YJN N;  1VQL N;  1HPM A;  4IG3 A;  2P9N B;  2IGI A;  1EP4 A;  3M8R A;  3O1W A;  3SLC A;  2JWK A;  1RTD A;  3VEW A;  4BRH A;  3LDS A;  4GV3 A;  3K9K A;  1CXQ A;  4RW9 A;  4DR6 K;  3RMA A;  4CJE A;  3MN7 A;  4E3S A;  1D9D A;  2ZE2 A;  3ATU A;  3E01 A;  1EO1 A;  1RTI A;  4FJL A;  5KI6 A;  3WQU A;  1TUU A;  3ZET A;  5M1F A;  3MN6 A;  3H1V X;  4K0K K;  2E88 A;  1C1C A;  5AQK A;  3MXJ A;  3SAF A;  3AVM A;  3VQA A;  4IKF A;  4GKJ K;  3S41 A;  1WB9 A;  4FWQ A;  3IMX A;  3J7Z O;  3V81 A;  3A2F A;  1ZBI A;  3EL2 A;  1S6Q A;  3PSF A;  1HNI A;  4YOU A;  4FZX C;  5JS2 A;  4BRE A;  1IKX A;  1OH8 A;  1S1V A;  3MCA B;  4MO4 A;  4KRE A;  4OPJ A;  2G8H A;  3RR7 A;  2WFB A;  2YKN A;  5FRO A;  4B8A B;  3VQ8 A;  5HRS A;  1HMV A;  2G8I A;  1QQO A;  3ZSR A;  2IAJ A;  3THW A;  2ZGY A;  1RT5 A;  4LFA K;  4QAG A;  4M3Y A;  4DCH A;  3LL3 A;  3KLF A;  1QZ6 A;  3LAL A;  3I8D A;  3O9T A;  5HRN A;  2YJE A;  4KV8 A;  1EWR A;  1RBS A;  4M7Y A;  3CCQ N;  3CHW A;  4EHT A;  1S22 A;  2F7T A;  1RT7 A;  5AQX A;  1LV5 A;  3K5M A;  4BQL A;  3ZLJ A;  1GLA G;  3AAR A;  4NXM K;  5BRE A;  5SWM A;  4BRL A;  1VQK N;  3H3N O;  3LM9 A;  4A2A A;  5E84 A;  1BCM A;  1MWM A;  5F1X A;  4DG1 A;  2QK9 A;  3MED A;  1YVU A;  2HF3 A;  4H5R A;  4NO7 A;  1N5Y A;  3KKR A;  4B8C A;  1IKW A;  3I0S A;  3PX0 A;  4E7I A;  1NK4 A;  4Z4F A;  3T3F A;  1QSS A;  4KHP K;  3AO3 A;  3EKS A;  4BE0 A;  4CGF A;  2VGN A;  2OA8 A;  1LCU A;  1NMN A;  2P5O A;  4I7F A;  3GDQ A;  3CCJ N;  3ZT3 A;  3M8Q A;  3VQQ A;  4EAH D;  1CZA N;  1SKR A;  4GV9 A;  1P90 A;  3RTV A;  3BDP A;  1SZ2 A;  2F8T A;  3TU5 A;  4JYA K;  5FRM A;  2HHU A;  5JLF A;  3THV A;  4C8L A;  1YHQ N;  3E9L A;  1J9A A;  2IOC A;  3CCL N;  1O1W A;  5LMN K;  3OY9 A;  1S6P A;  3V9W A;  2QW9 A;  2AP1 A;  3JYT A;  4BR4 A;  2BUP A;  1NOZ A;  2HB5 A;  2P1J A;  3KJV A;  3LP0 A;  2UUA K;  2DFH A;  4CJU A;  3V1O A;  2NRT A;  4NLB A;  3LDQ A;  1CLQ A;  4PA1 A;  4BR0 A;  1Z26 A;  3GE1 A;  1T44 A;  1HQE A;  4BRC A;  3ISN C;  4B9L A;  4K43 A;  1NWK A;  1X9J A;  5BN9 A;  3TTD A;  1GLD G;  3DLG A;  3HPH A;  3T7Z A;  3MEC A;  4KKO A;  4C1N I;  3MDQ A;  1OH6 A;  4FPA A;  2FSN A;  2Y1J A;  3MXM A;  1XHZ A;  1BUP A;  4BC2 A;  1EQY A;  1HJO A;  3M6G A;  3L8B A;  2EHG A;  3NH0 A;  1MWK A;  1KSP A;  4BC3 A;  1C0G A;  3HPO A;  4LF6 K;  4E7K A;  3CC2 N;  1GLF O;  4IDH A;  4DTR A;  3SQ1 A;  4WQ5 A;  1OH5 A;  2WOM A;  3DLB A;  1S72 N;  1TL1 A;  3U4L A;  2GEM A;  1TAQ A;  3A5O C;  2YHA A;  1CZB A;  3OYC A;  3TTF A;  3C0B A;  4JRP A;  1T8E A;  3A5N C;  4WF9 L;  1BHL A;  4HCC A;  2CH5 A;  5GAG P;  2P9I A;  4B3O A;  3HST B;  1ATS A;  4EIA A;  1G99 A;  1Q8I A;  3FR0 A;  3JSM A;  4FLX A;  4JD2 A;  4Z4C A;  1LW2 A;  3DXK A;  4J8F A;  3D2F B;  4CZF A;  3K5N A;  3SYZ A;  4CD3 A;  4BQZ A;  4F9O A;  1YI2 N;  4CGI A;  1NJZ A;  3CM5 A;  3O9R A;  4DTM A;  1FJG K;  4J2B A;  2A1S A;  4GW6 A;  3DXM B;  3N4Q A;  2YHB A;  4FWP A;  4LF4 K;  3CPE A;  4K8X A;  4WQ4 C;  1HJR A;  2HBL A;  4CZI A;  1BA0 A;  4FVM A;  3VGK A;  3VEV A;  1T6C A;  2X78 A;  4CHY A;  5AQV A;  2D4W A;  2Q0R A;  3O08 A;  5JVG L;  4I2P A;  3H3O B;  4JI4 K;  3AGR A;  4KRF A;  1KQS M;  3PX6 A;  1IV0 A;  2WBN A;  4Y1D A;  4KHY A;  2HBM A;  3A8Y A;  4BEB A;  1C1B A;  4GY2 B;  4KH6 A;  4F4K A;  3SI6 A;  1U48 A;  1LOT B;  1GOA A;  1M90 O;  3ZT1 A;  3FZL A;  1QZ5 A;  3VEX A;  1T6D A;  4PHT X;  4F3O A;  4IOX A;  3OYH A;  1K8A O;  3ZSY A;  2P9S A;  3VGM A;  3WXK A;  3P5J A;  4CHQ A;  2YNF A;  1VQP N;  2UU9 K;  3QEW A;  2HHV A;  3CJ1 A;  2P9N A;  3M5R A;  3TR8 A;  3WXI A;  5AQY A;  3MEG A;  1V4T A;  3I33 A;  3UE5 A;  4CGH A;  4JI6 K;  4B9S A;  1D5A A;  4E7J A;  3C6T A;  2QXF A;  5BRH A;  3KVG A;  2YNI A;  1KC8 O;  4JHD B;  3SAG A;  3HO1 A;  3G71 N;  4DV5 K;  2FXU A;  3QNO A;  3KTQ A;  2ZGZ A;  5AQR A;  4LFB K;  2UYT A;  1HNX K;  2O4I A;  3QIO A;  1SAZ A;  4B1W B;  4KHS A;  2QKK A;  4BRQ A;  2F9T A;  4FJ7 A;  2KLA A;  3CQY A;  4E1J A;  1RDD A;  5AJ3 K;  3WNH A;  3HL8 A;  2YJF A;  1XUP O;  3LPU A;  5T7B A;  1KVB A;  5KQ8 A;  3HPG A;  3VGL A;  3L2Q A;  3LAM A;  4ELV A;  4JAX A;  3IKM A;  4CJF A;  1WAF A;  3CC4 N;  4U67 L;  1N36 K;  2BDP A;  4JI5 K;  4IO8 A;  4O55 A;  3PO4 A;  2HNY A;  4FJI A;  3U9Z A;  4FW2 A;  3AAP A;  3V9S A;  4JNE A;  4A59 A;  2DTU A;  3AVB A;  2XY6 A;  1J54 A;  5TKW A;  4W5T A;  3SAH A;  4BE2 A;  4CEC A;  4DS5 A;  4X62 K;  3CJ9 A;  3VET A;  5JLH A;  4F2S A;  2WON A;  4FWO A;  5FRN A;  3HP9 A;  4KHQ A;  3LAK A;  1ASV A;  4PL8 A;  5AQZ A;  5CY4 A;  3OYD A;  3MAQ A;  1VSM A;  5AQM A;  2G8F A;  3OJS A;  1U4B A;  1NBW A;  3V4I A;  4C8O A;  1EET A;  4YY3 K;  4FYD A;  4RTF D;  5C25 A;  2KHO A;  4BWM A;  2D0B A;  4DUZ K;  1GLE G;  3VQ5 A;  5C2F A;  4CCH A;  5FPD A;  3O4N A;  1H1V A;  3DWL A;  3R6M A;  1Q18 A;  4KO0 A;  3SBT A;  5K14 A;  1DTT A;  2NNW A;  3T19 A;  5FDL A;  3HSC A;  4FJN A;  1NK8 A;  2QWQ A;  1NK0 A;  4ISE A;  3ZET B;  1RTH A;  2YKM A;  2WUS A;  4O0J A;  3IS9 A;  5C42 A;  1S5J A;  1NK7 A;  4WQ5 C;  3OYI A;  4JN4 A;  1SV5 A;  4EP5 A;  4OJR A;  1NGH A;  2VWJ A;  4PQU A;  3AA5 X;  1NLV A;  2Q31 A;  4HTL A;  4G1Q A;  2F96 A;  4BRK A;  1Q9Y A;  1RT3 A;  1U6Z A;  4IFY A;  3TI0 A;  4RW6 A;  3H1Q A;  4FWR A;  4OLB A;  2HVH A;  3I0R A;  4B9V A;  1BIS A;  4B1X B;  3SQ2 A;  3VTI A;  3GBT A;  5LMU K;  3F5T A;  3TPQ A;  1RIL A;  4YOR A;  1JL1 A;  3EZ5 A;  5EOY A;  5M1O A;  4GVE A;  4CZJ A;  5AFU A;  3T69 A;  3FFI A;  1S1T A;  4IJN A;  1RDA A;  4XH1 A;  1C6V A;  3IRX A;  1P8Z A;  1HUX A;  4LD0 A;  4EHU A;  1NGA A;  4KB0 A;  2FC0 A;  2QWN A;  4RG8 A;  3C6A A;  3ZT4 A;  2NUB A;  3QEP A;  1VQ6 N;  3CJC A;  1BO5 O;  1VQ9 N;  1RBU A;  1S1X A;  2HVI A;  4DV0 K;  4UQG A;  2W40 A;  2HMP A;  3VOV A;  5C15 A;  3EYZ A;  3CET A;  2Z1J A;  4BGB A;  1Z25 A;  1Q82 O;  2H3G X;  3SUN A;  4FWM A;  1WSE A;  4AHC A;  4ZTF A;  1QQM A;  3VA3 A;  1NGG A;  3DRS A;  5BRF A;  1SQK A;  3B8A X;  3VQB A;  3V9Z A;  5ADX A;  3D2E A;  1HKB A;  5KPZ A;  1Q7Y O;  4DQP A;  1VHX A;  3C65 A;  3G6E N;  4FLZ A;  1LWF A;  4BVO A;  3RR8 A;  4EFH A;  3NH2 A;  2PYL A;  2YV0 X;  4DQS A;  4CJ3 A;  3DJC A;  1NGI A;  2CGL A;  4B3T K;  3VTH A;  4AHU A;  2X6N A;  1VQ4 N;  4H0V B;  2Z1G A;  3LP3 A;  5EX5 A;  5GIO A;  4BR7 A;  4FVU A;  3ZEU A;  1JCF A;  3MK6 A;  3ZSW A;  1LAV A;  1B9D A;  1HQU A;  3NAE A;  3KWG A;  4K41 A;  4FSV A;  3ULD A;  3CME N;  3EEQ A;  1ASU A;  1DT9 A;  4DR4 K;  3G4S N;  5JVH L;  2X74 A;  3SPY A;  3O3H A;  3AA3 A;  4X66 K;  4CIF A;  4FK2 A;  4B3M K;  1A5X A;  3CCM N;  2YNH A;  4HHT A;  1NGE A;  1RFQ A;  1QSL A;  4BAC A;  3NMU A;  5HRP A;  4H0P A;  4BRD A;  4DSF A;  3QET A;  4JS5 A;  1JCG A;  4WQ4 A;  2NRV A;  4HUE A;  2PY5 A;  4YOW A;  2A6A A;  4C8N A;  5AQS A;  5KTQ A;  3A0I X;  3OW2 M;  4B3S K;  2D0C A;  2YI1 A;  1FKO A;  4H5N A;  4M7X A;  2HOE A;  3WXM B;  4BR2 A;  1N34 K;  4MLH A;  2ITG A;  5AQL A;  3KD5 E;  1A5W A;  2I7P A;  4MDA A;  2FLO A;  2PFU A;  4E1N A;  3SQ4 A;  3ZEU B;  3MWT A;  1DEJ A;  4BWJ A;  3ZCM A;  1SS6 A;  3QER A;  4EZ6 A;  1M1K O;  1U04 A;  4CZM A;  3L3V A;  4ILH A;  3KK2 A;  3WEE B;  3WNG A;  3CF5 L;  4E7L A;  2ZJQ L;  3VN5 A;  3CFO A;  4H0O A;  5C0Y A;  4KTW A;  3L0Q A;  2UUB K;  1VSD A;  3VF6 A;  4AHV A;  4CJ7 A;  1T05 A;  4B9U A;  1IG8 A;  5HP1 A;  2RE2 A;  4IG0 A;  2OYQ A;  1L3T A;  1BWF O;  2NRX A;  3DLR A;  3C95 A;  5M1N A;  1B92 A;  4NB4 A;  3VQ7 A;  1BQM A;  1JXE A;  5TKY A;  4EP4 A;  3L6Q A;  4DFJ A;  4JKG A;  2W00 A;  1QE1 A;  2E2O A;  5HL7 L;  4FPB A;  1IH7 A;  3S3O A;  2Y1I A;  4DR7 K;  4V19 S;  3W3D A;  3KIO A;  4LF5 K;  1ESV A;  3BF1 A;  3EZW A;  5B8H A;  2UXD K;  4YNQ A;  2DPN A;  2VWK A;  3QB0 A;  1IBK K;  4A57 A;  3TAQ A;  1NGC A;  4DQ8 A;  4CE9 A;  4CJK A;  1IBM K;  4DS4 A;  4YOY A;  4OLA A;  1Y64 A;  4NCA A;  1Q9X A;  2VG5 A;  2ZQB A;  3AVH A;  5HRO A;  3G25 A;  4KHW A;  4LH4 A;  3V9X A;  2HST A;  2B5J A;  3EKU A;  1XQS C;  4LFC K;  4GV6 A;  1NKE A;  2RKI A;  1N6Q A;  5KPR A;  3LWM A;  1WAJ A;  1BCO A;  3AO1 A;  1JLG A;  4AM7 A;  2P51 A;  3VQC A;  4FO0 A;  3KLI A;  4CHP A;  3TAP A;  5AQF A;  4DTU A;  4CFC A;  1O13 A;  2YX6 A;  3U3Y A;  3ITH A;  4H03 B;  4IDK A;  4FJ9 A;  2KZZ A;  4JKG B;  3PY8 A;  3FE1 A;  3AGK A;  1JXB A;  1VQ7 N;  3UKU A;  3K58 A;  1HNW K;  4NCG A;  1VQ8 N;  1BIU A;  4CHO A;  1HYS A;  3AVA A;  2QXL A;  4LC9 B;  3L2W A;  1C0M A;  3TAN A;  4CJ5 A;  3F2K A;  2QTD A;  1WSJ A;  4QOZ B;  4CZK A;  2IVO A;  4FJM A;  3CI5 A;  4IO9 L;  5GAH P;  2P5G A;  3AO5 A;  4JKA A;  4JKE A;  5AZJ A;  1YUW A;  3K9J A;  3OHR A;  2ASM A;  2NRZ A;  4DQI A;  2GEL A;  4I6M B;  3F9K A;  4M63 C;  3OYJ A;  4DQR A;  2CGJ A;  2BH1 A;  5AZI B;  3THY B;  5JS1 A;  4RCH A;  4CGG A;  1BDG A;  1QTM A;  5CZ1 A;  3FZH A;  4NLC A;  1BU6 O;  3CJB A;  1ZBH A;  1OVY A;  5F2R A;  4DV2 K;  1SL1 A;  1K73 O;  2KFN A;  1RT6 A;  1S9G A;  4CJ4 A;  1U2V B;  2ETJ A;  4O8K A;  1YVN A;  3AAQ A;  1XMQ K;  4PL7 A;  5AQJ A;  1HPZ A;  1S1U A;  3O1B A;  1DKG D;  3KKS A;  4CBX A;  3TTC A;  1XNR K;  2G8U A;  4DMN A;  2FBV A;  1XHX A;  3NDK A;  2A1R A;  3P4I A;  4IEE A;  3NGZ A;  4FXD A;  3V6D A;  1L3S A;  4B1Z A;  3VQE A;  4IOC L;  3LDO A;  1Y97 A;  1OKJ A;  3QML A;  3CM6 A;  1EXQ A;  5EU7 A;  1WSF A;  4OVL A;  1F21 A;  4CEB A;  4O5F A;  1GOC A;  4L3Q A;  1IO2 A;  4EZ9 A;  4IXC A;  4DR1 K;  1NJY A;  4BRO A;  3BZC A;  3O4Q A;  3RMD A;  1BGX T;  5BR8 K;  4KH5 A;  2XO7 A;  3HVT A;  3DLE A;  2JWL A;  4B1U B;  3DLL L;  3OYF A;  2PZS A;  3HXM A;  4DFK A;  4FLW A;  1Q86 O;  3C6H A;  4FK4 A;  3KK7 A;  2VQF K;  2IDO A;  1VQO N;  4DSK A;  1J6Z A;  1G15 A;  4DU3 A;  4O44 A;  2P9I B;  1BI4 B;  4A61 A;  4CED A;  1R59 O;  1TV6 A;  3SJJ A;  5EVZ A;  1T03 A;  5CZ2 A;  3VQ9 A;  4LSN A;  4LF7 K;  2HW3 A;  1VK0 A;  3CQX A;  4GMJ B;  3D2E B;  3HM8 A;  5J2N A;  3L2R A;  3TAG A;  2HMI A;  3FZM A;  4AM6 A;  3L2V A;  4DTN A;  2PAV A;  3FFK B;  1CZ9 A;  1WSH A;  2W6K A;  3OTO K;  1EWQ A;  3OJU A;  4DSL A;  1NMD A;  3HVR A;  4RW4 A;  3SMP A;  4CGJ A;  3CC7 N;  4AIL C; 
#chains in the Genus database with same CATH homology
 4JN4 A;  2FSK A;  5AZJ B;  3GG4 A;  3FZF A;  1NGH A;  2VWB A;  1NLV A;  2Q31 A;  4HTL A;  3M1F A;  3HTV A;  4BRK A;  5BR9 A;  3QFU A;  4JEP A;  3SJH A;  3VF2 A;  1NGJ A;  3ZX3 A;  3QFP A;  2P9K A;  3IFR A;  1U6Z A;  2Q97 A;  4GNI A;  5AQU A;  4FL9 A;  1HLU A;  3VEO A;  3PLA A;  5CHI A;  3ULE A;  3H1Q A;  5E26 A;  2YHX A;  4FWR A;  1TUY A;  2QWR A;  3BP8 A;  4FWK A;  4B1X B;  2GWK A;  2V7Z A;  3HOS A;  4KH4 A;  3WUH A;  3VTI A;  4YOV A;  1HX1 A;  3GBT A;  4DHY A;  2A5X A;  3F5T A;  3RVC A;  3TPQ A;  2NRW A;  4YOR A;  4YDU A;  2P9S B;  1D4X A;  5EOY A;  5M1O A;  2ZWH A;  2IVP A;  3R3L A;  3O9S A;  3EE8 A;  4GVE A;  3VPZ A;  4BRP A;  4CZJ A;  5AFU A;  3T69 A;  2ZF5 O;  3LDN A;  1QQN A;  4IJN A;  4A5B A;  3MN9 A;  4XH1 A;  2GX9 A;  3J8A A;  1X3M A;  4K25 A;  4WCE L;  2GTD A;  1P8Z A;  3OBW A;  5BPN A;  1NGF A;  1HUX A;  2J4R A;  3QBW A;  2E20 A;  3ZYY X;  3DXK B;  3O8M A;  5AQT A;  1ZXO A;  4EHU A;  1NGA A;  4OO1 J;  5AQH A;  2QWN A;  3F9M A;  3C6A A;  3GL1 A;  2E2P A;  3R9P A;  1V4S A;  4CBW A;  5GAD P;  1VQ6 N;  3CJC A;  1BO5 O;  4BVP A;  4FOE A;  5EY4 A;  4C1N K;  1VQ9 N;  3CCR N;  2HBJ A;  4JKB A;  1YJN N;  1VQL N;  3GOI A;  1HPM A;  2P9N B;  3HOT A;  3MN5 A;  1YIJ N;  3O1W A;  1MA9 B;  3SLC A;  2JWK A;  2W40 A;  1S3X A;  3VEW A;  4BRH A;  2E1Y A;  2HMP A;  3VES A;  3VOV A;  5C15 A;  4GV3 A;  3CET A;  2P9K B;  3HBT A;  3K9K A;  4BGB A;  1Q82 O;  2H3G X;  2E2Q A;  4FWM A;  3U8X A;  4IZ9 A;  5DM7 L;  1YF5 L;  1QQM A;  5LJW A;  3LM2 A;  1NGG A;  3FLC O;  3MN7 A;  3MWP A;  3ATU A;  5BRF A;  3P31 A;  1SQK A;  1EO1 A;  3B8A X;  3WQU A;  1TUU A;  3ZET A;  4HWI A;  4DB3 A;  1QHA A;  3W0L A;  3MN6 A;  5M1F A;  3H1V X;  5ADX A;  1W2B M;  3D2E A;  2E88 A;  5AR0 A;  4KBO A;  1ZC6 A;  4H5T A;  1HKB A;  5AQK A;  5JIC A;  5KPZ A;  3SAF A;  4IEI A;  2A42 A;  5C12 A;  1Q7Y O;  3C65 A;  3G6E N;  4H5V A;  2QEX N;  3S41 A;  4BVO A;  2F9W A;  3L4I A;  4FWQ A;  3IMX A;  3J7Z O;  3FGU A;  4EFH A;  3QDK A;  1GLB G;  4BY9 C;  3DJC A;  1NGI A;  2CGL A;  3EL2 A;  3VEY A;  4U7B A;  3VTH A;  4YOU A;  2HBK A;  1VQ4 N;  4BRE A;  4H0V B;  3MCA B;  4MO4 A;  5C10 A;  1VQ5 N;  4WYB A;  4JK9 A;  5EX5 A;  2D0P A;  4BR7 A;  5GIO A;  4BEC A;  4ILG B;  4FVU A;  3ZEU A;  1JCF A;  5GAE P;  3MK6 A;  3BUZ B;  4WFN L;  2WFB A;  3WT0 A;  2V51 B;  1KAZ A;  3SK3 A;  4BRM A;  5H1S Q;  3KWG A;  4BG9 A;  4DKW A;  4K41 A;  1QQO A;  4PKG A;  4FSV A;  3WQT A;  3ZX2 A;  3CME N;  5M1Q A;  1ATR A;  2ZGY A;  3HZ6 A;  3SBG A;  1DT9 A;  3MCP A;  2VCP A;  3EN9 A;  4JK7 A;  5I9E B;  5AQP A;  3G4S N;  3L4Q A;  5JVH L;  3I8B A;  2QI2 A;  4BR5 A;  4DCH A;  3LL3 A;  3H6E A;  3HI0 A;  3EE9 A;  1QZ6 A;  2BTF A;  4CZL A;  2NLX A;  1JJ2 M;  3E9P A;  1JCE A;  3O9T A;  4O8U A;  3E66 A;  3CCM N;  3CCS N;  2YJE A;  1NGE A;  1YAG A;  1RFQ A;  1Z6R A;  1RGI A;  3NMU A;  1KD1 O;  2EWS A;  3NVM A;  4M7Y A;  5F0X A;  3CD6 N;  2WC9 A;  3CCQ N;  3CHW A;  5CR4 A;  4EHT A;  4H0P A;  3IUC A;  4BRD A;  1S22 A;  2F7T A;  1JCG A;  2P9U B;  4JKC A;  5AQX A;  4WQ4 A;  2NRV A;  3I55 N;  3CCU N;  4BQL A;  2AA4 A;  4YOW A;  2A6A A;  4QS9 A;  4BRF A;  1GLA G;  3AAR A;  3C7N A;  3WXL A;  3ID8 A;  5AQS A;  5BRE A;  3A0I X;  3OW2 M;  4BRL A;  3KWI A;  3H3N O;  3LM9 A;  1VQK N;  2YI1 A;  4IOA L;  4A2A A;  5E84 A;  3NVK A;  4H5N A;  4M7X A;  2HOE A;  1MWM A;  5F1X A;  2A41 A;  3DXM A;  4QS8 A;  2HF3 A;  3WXM B;  4BR2 A;  4H5R A;  4MLH A;  4NO7 A;  3H45 C;  5AQL A;  3QBX A;  5BRD A;  4A62 A;  2I7P A;  4MDA A;  4YOX A;  2YCH A;  2FLO A;  2PFU A;  3A5M C;  3VF4 A;  3ATV A;  5EXW A;  1NGD A;  3CER A;  3EKS A;  3VMF B;  3ZEU B;  3MWT A;  1DEJ A;  2VGN A;  3VEZ A;  1LCU A;  1SS6 A;  1M1K O;  3GDQ A;  3CCJ N;  4FWN A;  4CZM A;  4BG8 A;  4EAH D;  5AQG A;  1CZA N;  4ILH A;  5AQO A;  3CCE N;  1P90 A;  4GV9 A;  3CF5 L;  3WEE B;  1SZ2 A;  2ZJQ L;  3TU5 A;  2QA4 N;  5AFU H;  4UY8 O;  5JLF A;  4H0O A;  1YHQ N;  3E9L A;  3R8E A;  5C0Y A;  3P39 A;  3C7N B;  3M3Z A;  2IIR A;  2NRH A;  5ELZ A;  1YIT N;  3CCL N;  4QS7 A;  3L0Q A;  2YHY A;  3WXJ A;  3VF6 A;  4CJ7 A;  1IG8 A;  1BG3 A;  2QW9 A;  2AP1 A;  2RE2 A;  4BR4 A;  2BUP A;  1NJI O;  4BC5 A;  5AQI A;  4ISF A;  1BWF O;  2NRX A;  3TSQ A;  3CCV N;  1K8K B;  2FF6 A;  2NRT A;  5M1N A;  4NLB A;  5AQQ A;  3LDQ A;  4NB4 A;  1VQN N;  4YOT A;  4BR0 A;  3GE1 A;  1T44 A;  3ID6 A;  3TSU A;  5TKY A;  4BRC A;  3L6Q A;  3E1Y A;  3UKR B;  4K43 A;  4XEI A;  4JKG A;  1NWK A;  5BPM A;  1X9J A;  5BN9 A;  2W00 A;  3VER A;  2OTJ N;  2E2O A;  3TTD A;  5M1K A;  1GLD G;  5HL7 L;  3CJA A;  4FPB A;  3T7Z A;  4H0Y B;  5AZI A;  3W3D A;  1E4F T;  4C1N I;  2V52 B;  3MDQ A;  2ASO A;  1ESV A;  3BF1 A;  2P9P A;  3EZW A;  3O6W A;  5B8H A;  3D2F A;  3MX2 A;  2FSN A;  4FPA A;  4H0X B;  4WFB L;  3MMV A;  1BUP A;  2DPN A;  4BC2 A;  1EQY A;  1HJO A;  3M6G A;  4K42 A;  3QB0 A;  2OTL N;  3O9U A;  4A57 A;  1MWK A;  1NGC A;  4MO5 A;  4BC3 A;  1ZBS A;  4DQ8 A;  1C0G A;  2NZT A;  2P9L A;  2OAN A;  2E8A A;  3Q7B A;  1U2V A;  3FZK A;  4YOY A;  1GLF O;  3CC2 N;  2GWJ A;  2FF3 B;  3E9O A;  2GUP A;  4IDH A;  1Y64 A;  4WQ5 A;  5HOO A;  3CPW M;  1KAY A;  3WEE A;  5LY3 A;  1S72 N;  4BE7 B;  3G25 A;  3U4L A;  2GEM A;  2HST A;  3A5O C;  3EO3 A;  3TTF A;  2IVN A;  3EKU A;  1XQS C;  3C0B A;  1RDW X;  3A5N C;  4WF9 L;  5KPT A;  5BN8 A;  4GV6 A;  2CH5 A;  1WOQ A;  5GAG P;  1TYQ A;  2P9I A;  1ATS A;  4EIA A;  1G99 A;  5KPR A;  3FR0 A;  2QWL A;  2Q36 A;  4JD2 A;  2P9L B;  2VYP A;  3JS6 A;  5GIN A;  4AM7 A;  2FSJ A;  2Q2R A;  3CJ7 A;  1W97 L;  3DXK A;  3PIO L;  4J8F A;  3D2F B;  4CZF A;  4FO0 A;  3PIP L;  2ZJR L;  4BRG A;  1ATN A;  4CD3 A;  4BQZ A;  4F9O A;  1YI2 N;  5AQF A;  3O9R A;  4IFE A;  2PBD A;  1O13 A;  2YX6 A;  3KHY A;  3OA9 A;  3CIP A;  4H03 B;  4OPA A;  3DXM B;  2P9P B;  3N4Q A;  4CZH A;  4WFA L;  4FWP A;  1MDU B;  3CPE A;  4JKG B;  4WQ4 C;  2HBL A;  2ASP A;  4Y0W A;  4CZI A;  1VQM N;  4R79 A;  1BA0 A;  3O80 A;  1YJW N;  1QVG M;  3RSE B;  3P38 A;  3VGK A;  3FE1 A;  1Z05 A;  3AGK A;  3KZB A;  1YJ9 N;  3VEV A;  1T6C A;  4FWL A;  1X3N A;  5AQV A;  1VQ7 N;  3UKU A;  4H0T B;  2D4W A;  4AF1 A;  2Q0R A;  3O08 A;  1VQ8 N;  1YXQ A;  3BF3 A;  4JKD A;  3H3O B;  5JVG L;  4XJX A;  3VEN A;  1WUA A;  3AGR A;  1K9M O;  3O4W A;  1KQS M;  3ULE B;  1NGB A;  2WBN A;  4LC9 B;  2QXL A;  2HBM A;  4BR9 A;  1E4G T;  3A8Y A;  3F2K A;  5FPM A;  2QTD A;  2ITM A;  4GY2 B;  4KH6 A;  4CZK A;  4BEB A;  2IVO A;  3CI5 A;  1LOT B;  4IO9 L;  2HF4 A;  4JHD A;  5GAH P;  4JKA A;  1M90 O;  3FZL A;  1QZ5 A;  3VEX A;  4JD2 B;  1T6D A;  4PKH A;  4PHT X;  5FPE A;  4JKE A;  4IOX A;  3ZX0 A;  5AZJ A;  1YUW A;  3K9J A;  1K8A O;  2P9S A;  3OHR A;  2ASM A;  2NRZ A;  3VGM A;  2E1Z A;  3WXK A;  1VQP N;  2GEL A;  4I6M B;  4M63 C;  5DM6 L;  2CGJ A;  2BH1 A;  3CJ1 A;  2P9N A;  3M5R A;  3HRG A;  1VAZ A;  5AZI B;  3WXI A;  5AQY A;  1V4T A;  3BEX A;  5M1P A;  4RCH A;  4FWS A;  4A2B A;  1BDG A;  2A3Z A;  5LJV A;  3I33 A;  3UE5 A;  5GIP A;  3FZH A;  3ENO A;  4NLC A;  1BU6 O;  3CJB A;  5BRH A;  2QWP A;  1OVY A;  3KVG A;  3O9Q A;  4I6M A;  5F2R A;  3CXC M;  1KC8 O;  4JHD B;  3SAG A;  1K8K A;  1K73 O;  2D0O A;  4BRN A;  4CZE A;  3G71 N;  2FXU A;  2QWO A;  1U2V B;  4O8K A;  1YVN A;  4H5W A;  1GLC G;  1RDU A;  2ZGZ A;  2V7Y A;  3AAQ A;  2UYT A;  3D6R A;  5AQR A;  2W41 A;  4JKF A;  4CD1 A;  1SAZ A;  4B1W B;  2CGK A;  4C23 A;  5AQJ A;  5CE3 A;  4PL7 A;  5BPL A;  4BRQ A;  4BC4 A;  2F9T A;  4RWT A;  4PKI A;  3O1B A;  2KLA A;  1DKG D;  3CQY A;  2QM1 A;  3ENB A;  4CBX A;  4E1J A;  2I7N A;  3TTC A;  3Q7C A;  3DAW A;  1HKG A;  2A40 A;  1GLJ O;  2E2N A;  3RSE A;  1T3V A;  2YJF A;  1XUP O;  3IDH A;  4A5A A;  3P4I A;  4IEE A;  4B1Z A;  2VGM A;  4FOI A;  2CH6 A;  4IJA A;  4BRI A;  5KQ8 A;  3LDO A;  4IOC L;  3VGL A;  3U9D A;  1OKJ A;  3QML A;  4JAX A;  3IKM A;  3D7E O;  4MDB A;  3CC4 N;  5JMV A;  4U67 L;  4JK8 A;  3N4P A;  4XH5 A;  3A5L C;  4IO8 A;  3ENH A;  4Z94 A;  4BGA A;  3U9Z A;  1BOT O;  3AAP A;  3CC7 N;  1KXP A;  4BRA A;  4JNE A;  5MLC Q;  1GLL O;  4A59 A;  4O5F A;  4MLE A;  4L3Q A;  3LDP A;  4OPH A;  5AQN A;  5TKW A;  4IXC A;  4BRO A;  3SAH A;  1DGK N;  4B1Y B;  3H46 O;  5ADX H;  1BA1 A;  3CJ9 A;  3SMS A;  3VET A;  5JLH A;  2C1G A;  4FWO A;  3CMA N;  3UKR A;  5KQD A;  5FPN A;  2QWM A;  4KH5 A;  1XC3 A;  4YDU C;  1IJJ A;  1NM1 A;  2YHW A;  3R1X A;  2ZJP L;  1QVF M;  1ILY A;  4PL8 A;  3TSP A;  5AQZ A;  4ISG A;  2JWL A;  3LDL A;  5AQM A;  1KAX A;  3UB5 A;  2D1K A;  4B1U B;  3DLL L;  5AQW A;  4IWV A;  1Q86 O;  1NBW A;  4B1V A;  3C6H A;  1N8R O;  3KK7 A;  3MX5 A;  4RTF D;  1VQO N;  4JKH A;  2KHO A;  1J6Z A;  3AY9 A;  1TYQ B;  2P9I B;  2KKZ A;  1GLE G;  4A61 A;  3UKU B;  4CZG A;  5C2F A;  1R59 O;  5EVZ A;  5FPD A;  1HKC A;  3QIC A;  4CBU A;  1H1V A;  2Q1N A;  3DWL A;  3R6M A;  2NRR A;  3I56 N;  1Q18 A;  3CQX A;  3SBT A;  1Q81 O;  4G9Z A;  4B9Q A;  3D2E B;  3HM8 A;  5C2D A;  2NNW A;  3HSC A;  4XH4 A;  3OBY A;  2P9U A;  1C0F A;  3FZM A;  4ILJ A;  2Q0U A;  2PAV A;  3FFK B;  2QWQ A;  4AM6 A;  4ISE A;  3ZET B;  1NMD A;  4CI6 A;  2WUS A;  3O5B A;  3SMP A;  3JXU A;  2C1I A;  4WQ5 C;  2RHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...