3UKRA

Crystal structure of bos taurus arp2/3 complex with bound inhibitor ck-666
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
415
structure length
401
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structural characterization and computer-aided optimization of a small-molecule inhibitor of the Arp2/3 complex, a key regulator of the actin cytoskeleton.
pubmed doi rcsb
molecule tags Structural protein
total genus 126
structure length 401
sequence length 415
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3ukrA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ukrA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ukrA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3ukrA04
3GOIA 1NGGA 1J6ZA 3ENHA 1GLJO 1TUUA 3DJCA 3ZETA 4Z94A 1LCUA 4H5NA 3QDKA 5AQYA 3HSCA 1BWFO 5AR0A 4BRCA 4FWQA 4CBUA 2QWLA 4PKIA 2KHOA 4B1YB 3MN9A 1ATNA 3O1WA 3R6MA 5B8HA 1BOTO 2Q31A 3AARA 3CQXA 3LDOA 5KPZA 5AQUA 2V7YA 3VF6A 3BEXA 3ULEB 5AQLA 2QWRA 3D2FA 3WUHA 3H45C 2NLXA 3LL3A 4KBOA 1EQYA 2Q1NA 3TPQA 2QWQA 2CGKA 2V7ZA 5AQVA 3ULEA 3L6QA 4H0PA 4WQ4C 5AZIB 3A8YA 1TUYA 2E20A 4I6MB 5AQRA 2HF4A 3DXKB 5BR9A 4I6MA 3DXKA 2FF6A 3VGKA 2CH6A 4BC5A 2Q97A 4BRLA 4CBXA 5LJWA 3D2EB 3IFRA 1G99A 3MMVA 5EOYA 3FE1A 1T44A 1Q18A 3D2EA 3ATVA 3CJBA 3AAQA 3UE5A 4BR9A 5AQKA 2IVPA 4FWOA 3LDQA 5FPMA 2A3ZA 3H3NO 3LDLA 3VEWA 4FPAA 4JAXA 3J8AA 4WQ5A 4CI6A 5FPDA 4IJNA 5TKYA 4BRIA 4NO7A 5BRFA 5EX5A 1QQNA 5AQNA 1KXPA 2I7NA 4CZFA 5KQDA 2E2NA 1U6ZA 2YJFA 3R9PA 1SZ2A 3CI5A 3H1VX 4M7YA 1QHAA 3SMPA 3S41A 1NBWA 1DEJA 3RSEB 4CZEA 2CH5A 5BPLA 5BPMA 1MWMA 3VENA 5AZJB 3FZFA 3RSEA 2P9NB 5LY3A 2Q0RA 1NGJA 4O8KA 4BC3A 1YXQA 4L3QA 2P9NA 4MO4A 4DCHA 2NZTA 3HM8A 3D7EO 4BRQA 3B8AX 4ISGA 1Z6RA 3L0QA 3BP8A 2A41A 3WQUA 3ZEUB 4JD2B 3FLCO 4YDUA 5BREA 4H0VB 4BRHA 2ASOA 1YUWA 3ZEUA 4BRMA 3HBTA 3SLCA 4FWSA 4MLHA 3R8EA 3DAWA 1TYQA 1BG3A 4CZIA 5F2RA 3VEYA 2E1ZA 2ASMA 5AQIA 2GWJA 5F1XA 3FR0A 1WOQA 1JCFA 1HX1A 2ZGYA 3MDQA 5ELZA 1WUAA 2F9WA 3CJ7A 5FPNA 3WEEB 3VEXA 3M3ZA 2A42A 3WEEA 3O5BA 3QBXA 4A62A 3GDQA 1V4TA 3O80A 4EIAA 3EN9A 3FFKB 4BR4A 3WXJA 4H5WA 2EWSA 2CGLA 4IWVA 4K42A 3DXMB 4EHTA 1Z05A 5BRHA 1NGIA 1NGDA 3DXMA 2E2OA 2E8AA 4FWLA 2P9KB 3C0BA 3C7NB 4FWMA 2ZGZA 3L4IA 2QWOA 4CD1A 3LM9A 4JHDB 2P9PB 1RFQA 3W0LA 1NGCA 4EAHD 2P9KA 3CETA 3VETA 2FLOA 1K8KB 4CZHA 4JHDA 3KVGA 4PKHA 4MO5A 2QWNA 4LC9B 1K8KA 4F9OA 1ZBSA 2FSJA 4BR0A 1NLVA 1SQKA 2VWBA 5AQWA 4B1UB 4K41A 2E2QA 4B1WB 1GLBG 3H6EA 1XQSC 4O5FA 3BUZB 4FO0A 4DHYA 3OHRA 2VCPA 2ITMA 3MCPA 2A6AA 4CZMA 5CE3A 3UB5A 4DQ8A 1QQMA 4XEIA 1KAZA 3DWLA 1C0GA 3O8MA 4B1VA 5F0XA 4RWTA 4WQ5C 2P9SB 1C0FA 3VEVA 2D0PA 2P9IB 1GLLO 1HKBA 1NWKA 5AZIA 4BVOA 2P9SA 2HF3A 1BA0A 2P9IA 3MN5A 4BG9A 5JICA 3WXIA 1X3NA 2FF3B 3EKSA 2ASPA 2P9LB 5AQJA 3QMLA 1RGIA 3ID8A 4RTFD 2P9LA 3CERA 4BVPA 1HKGA 5E84A 3SMSA 5ADXH 3CQYA 1HPMA 4HWIA 4IO8A 4M63C 3VESA 5EXWA 1NM1A 1S22A 4QS9A 2VYPA 1NGEA 3CJCA 4BQZA 5E26A 4QS8A 4CZGA 1OKJA 2IVOA 2V51B 3HI0A 3GG4A 4BRNA 3FZKA 1H1VA 3CIPA 3FZMA 4YDUC 1YVNA 2ZWHA 3QBWA 3A5OC 4XH5A 3G25A 2CGJA 4H5TA 5FPEA 1ESVA 3WT0A 5AQTA 4BR5A 3BF1A 5AZJA 3IDHA 5I9EB 4B9QA 1HUXA 5AFUH 3KHYA 4BRKA 1YAGA 2IVNA 4BROA 4WYBA 2YI1A 3LDPA 1GLFO 3F9MA 1XUPO 2W40A 3M6GA 5AQFA 3QFUA 3TU5A 4FWRA 3CJ9A 3AAPA 3ENOA 4FL9A 2J4RA 3A5LC 2E2PA 1R59O 3WQTA 4BRFA 4E1JA 4JD2A 3U4LA 2A5XA 4EHUA 3VGLA 3MN7A 5KPTA 2OANA 4BRGA 1IG8A 4AM7A 5LJVA 5AQHA 1KAXA 1XC3A 1DKGD 1HKCA 4H0OA 2BTFA 3I8BA 3A0IX 3VEOA 3ATUA 1HJOA 4A61A 3GE1A 4CZJA 3IMXA 4FOIA 2PBDA 4JN4A 3HZ6A 4BG8A 2FXUA 3UKUB 1RDWX 3VOVA 4FWPA 4XH1A 1JCGA 3WXKA 3A5NC 3UKRB 3UKUA 1NGBA 3LM2A 5BRDA 4B1XB 3KZBA 3MK6A 2D0OA 3UKRA 4K43A 2FSKA 4IJAA 3ZX0A 2UYTA 3JXUA 5AQOA 3EZWA 2GEMA 1GLDG 3JS6A 2D4WA 1LOTB 3FZLA 5JLFA 3H46O 3C7NA 2QXLA 1HLUA 3BF3A 3VEZA 4H03B 2P9PA 4K25A 3ZETB 1NGAA 3QFPA 4PKGA 2E1YA 3HTVA 3VGMA 5AQGA 4IXCA 4GNIA 4RCHA 4HTLA 4BRDA 2D1KA 3O6WA 2Q36A 4JNEA 4CJ7A 4FPBA 1QQOA 1Y64A 1GLEG 3EL2A 2PAVA 3EO3A 2I7PA 4EFHA 5JLHA 3O4WA 4A2AA 3CJAA 3LDNA 3O08A 4H0YB 3FZHA 4BR7A 4H5VA 5BPNA 1KAYA 3MN6A 1BA1A 3W3DA 1BDGA 4BGBA 3VERA 3D2FB 5KQ8A 2DPNA 4H5RA 4MLEA 2QW9A 3CJ1A 4DB3A 5AQXA 2WUSA 5KPRA 4BR2A 1SAZA 1BO5O 1BU6O 3P4IA 2AA4A 3H1QA 4CD3A 2AP1A 5AQSA 3WXLA 1BUPA 4BGAA 4CZKA 1MA9B 4FOEA 2A40A 1DGKN 4FWNA 3ZX2A 1NMDA 1ZXOA 3ZX3A 2P9UB 1MDUB 5AQZA 1ATSA 4ISFA 4A2BA 3SK3A 4AM6A 5AQQA 5JMVA 3VF4A 1V4SA 3SJHA 2P9UA 1ATRA 3U9ZA 2H3GX 1E4FT 3H3OB 4BRPA 4PL7A 4FSVA 5AQMA 2GUPA 1MWKA 1U2VB 1T6CA 4WQ4A 2NRHA 2BUPA 2E88A 5ADXA 2YCHA 2HOEA 1U2VA 2GWKA 5EVZA 3GL1A 2W41A 1QZ5A 4FWKA 1T6DA 4M7XA 1QZ6A 2QM1A 2F9TA 3AY9A 2GTDA 3GBTA 1GLAG 3EKUA 1X3MA 4BQLA 2ZF5O 3VF2A 3A5MC 4H0TB 1P8ZA 2YHYA 4ISEA 2GELA 3IUCA 4PL8A 2IIRA 4GY2B 3VPZA 2YHWA 3I33A 4NB4A 1NGFA 2YHXA 1X9JA 3QB0A 3FGUA 5AFUA 2Q0UA 1IJJA 1JCEA 4CZLA 3U9DA 4BC4A 1TYQB 4IZ9A 4Y0WA 2QWMA 3U8XA 4J8FA 1S3XA 1ZC6A 2V52B 3M1FA 4B1ZA 5AQPA 5BN8A 4C23A 1E4GT 4BRAA 3QICA 1D4XA 2HMPA 1GLCG 2FSNA 2Q2RA 4BC2A 1NGHA 3CHWA 4CBWA 3O1BA 4H0XB 4XH4A 5EY4A 4QS7A 2QWPA 4BREA 2YJEA 5BN9A 1CZAN
chains in the Genus database with same CATH superfamily
1BIUA 4F4KA 1J6ZA 1ASWA 4Z94A 3DRPA 1LCUA 1N36K 1C6VA 5AQYA 1GOAA 4NCGA 2DY4A 3J7ZO 2VWJA 1LV5A 3LP2A 3ZT4A 4CBUA 4DTUA 1L5UA 5LMNK 2KHOA 3F2KA 4M45A 1QHTA 3LPUA 3R6MA 3TARA 1CLQA 4DTXA 3K9KA 4KHYA 3SAHA 3LDOA 4BDZA 3MECA 3VF6A 3BEXA 3WUHA 3D2FA 3H45C 1EQYA 3TPQA 3KJVA 3ULEA 4CW7B 3O9UA 1S6QA 3HK2A 4HUFA 3NGIA 3DXKB 3Q7BA 1IKWA 2UUAK 3VQ8A 1U4BA 2FF6A 3ZYYX 5C2FA 1RILA 3RMCA 3HJFA 4KI6A 1W2BM 3ATVA 3VQBA 2IVPA 4QAGA 1TKXA 3MEGA 4CF2A 3VEWA 5GIOA 4OPKA 4JAXA 3ENBA 3CCRN 1QSLA 4BRIA 1KTQA 4HTUA 5JS1A 2HBLA 3AVGA 3J7AP 1XHXA 5GIPA 4FJXA 2WFBA 3SMPA 1BI4A 3AO3A 4CEOA 3IS9A 5BPLA 1D9FA 5BPMA 2VG6A 5AZJB 4CECA 3NGZA 3SQ0A 4Y1CA 2Q0RA 3C65A 5M1OA 4BC3A 5IWAK 3AV9A 1QVFM 2P9NA 3ID6A 3V1OA 5H1SQ 4YHHK 4ISGA 4DFJA 1VQLN 4JI3K 1XC9A 3I0RA 4KHNA 4KH6A 4E72A 3WQUA 1D5AA 1QS4A 3VQAA 1IKVA 2RKIA 1N34K 4BRHA 3B6OA 3AGRA 1NK7A 4A57A 4BE1A 3OS2A 3HBTA 3SLCA 2JWKA 1TYQA 1BG3A 3F73A 1X9MA 2ASMA 3M8SA 2QK9A 3AA2A 2WOMA 1IO2A 1WOQA 3VQPA 3DLEA 1VQ6N 1TAUA 5ELZA 1ZBIA 3OVNA 3SBTA 3BDPA 4B9LA 1SL2A 4LF5K 1LAWA 1U47A 2NRTA 2KTQA 3GDQA 2ETJA 5KI6A 4FZYA 3R3LA 5GADP 4BDYA 1HNVA 4CEDA 4OKKA 1D8YA 4N47A 3FFKB 1Q82O 4B8AB 4WCEL 3AA4A 3WXJA 4AF1A 1S1UA 2KFNA 2CGLA 4XIUA 4EHTA 2RE2A 1NGIA 5C25A 2E2OA 2E8AA 4CFCA 3TAQA 1RT2A 5HLFA 3LM9A 3VETA 2O8FB 5J2NA 4CHZA 3KVGA 4CJLA 4AH9A 1VQPN 1A5XA 1WSIA 3KLFA 2VWBA 3H6EA 5I42A 4IEIA 3V1RA 4FO0A 4DHYA 4DQ8A 4XEIA 1CZ9A 4KHUA 3V1QA 1C1BA 3DWLA 4B1VA 1BGXT 2O4IA 2OPPA 4DSLA 5AZIA 1YITN 2P9SA 3PV8A 2HF3A 2XY7A 3WXIA 4Z4EA 1ASUA 2FF3B 2VQFK 4Z4CA 1RT1A 3ID8A 1HR0K 4CJKA 2P9LA 3CERA 3OY9A 1WBDA 1HKGA 3SMSA 4HUEA 3CQYA 1HPMA 2AJQA 4M63C 4C1NK 2PZSA 2NRVA 1NM1A 3ZSZA 1Q9XA 1IH7A 1S22A 1JL1A 3QLHA 1SL0A 4MFBA 3NFAA 1YTUA 1NGEA 5E26A 4CZGA 1EP4A 3AGKA 3RMAA 3GG4A 1U04A 4E3SA 1H1VA 3CIPA 4YDUC 3V4IA 4O5BA 4HCCA 4NXNK 3V81A 4LH5A 3AVBA 4H8KA 3M5RA 3OYGA 3DLBA 4OLAA 5AQTA 2F4VK 2O8BA 5HBMA 3IDHA 4PQUA 5I9EB 4B9QA 1RBUA 1EWQA 3ZSQA 3H08A 3TWHA 3TU5A 2YNHA 3RMDA 4FL9A 2HVHA 1KCFA 1NK4A 1R59O 4CGDA 3NH0A 4DV0K 3RVCA 2OANA 4CEZA 3K57A 1R0AA 1HMVA 4YORA 1VRUA 5LJVA 4FJHA 5AQHA 3CCUN 2A1SA 3CCVN 4H0OA 1X9SA 1NG9A 2BTFA 1HJOA 4N5SA 4CJ4A 3S3NA 4CJRA 2XY6A 4FOIA 2PBDA 2Z1GA 3HZ6A 4W5TA 2UXBK 5CR4A 3E01A 1J9AA 3JYTA 4CIEA 3CM6A 5M1KA 3PSFA 3WXKA 5BRDA 4BDPA 1TK8A 3MK6A 1RCHA 4O44A 3UKRA 1WNSA 4ILHA 4IJAA 4CGHA 2UYTA 3KIOA 1NJWA 3HVTA 4DTNA 1OH8A 3HPGA 5GAGP 3SAGA 3L2WA 1OH6A 3H46O 3C7NA 1TKZA 1N5YA 3O3FA 3VGMA 3E9LA 3CCQN 1VSIA 4JRQA 4BRDA 2OCEA 3O6WA 1VSFA 4FPBA 2O8DB 1RT3A 3KWIA 4I9QA 3EO3A 3EL2A 1NU0A 3O08A 4H0YB 1LWFA 4W5QA 1KAYA 2HBKA 3MN6A 1JLEA 1YHQN 1BDGA 3NF7A 1QSSA 4IG0A 4MLEA 4DS4A 4DSEA 5AQXA 1WSFA 1ZBLA 4BR2A 3CG7A 4ZTJA 4B3SK 1DTTA 3D45A 3PUFA 3S9HA 2AP1A 3THYB 4BGAA 3PLAA 1MA9B 5D3GA 4AILC 4IFVA 3HSTB 2QI2A 4JI5K 3I55N 1NMDA 1XHZA 1MDUB 1ATSA 4A2BA 3KTQA 5AQQA 3NH1A 3CC2N 1KLNA 2GUPA 1MWKA 1A5VA 2BUPA 2E88A 4IOCL 3KLGA 3CYMA 1QQCA 2YCHA 4FJLA 5CZ1A 4FLXA 4LFBK 3QEVA 3L2UA 1QVGM 1X1PA 2HBMA 1WSJA 4DQRA 2W6LA 3WNEA 1T6DA 2GUIA 4M7XA 4RW4A 3K5MA 2ZJPL 1VHXA 2F9TA 3ULDA 2GTDA 2O8EB 2I5JA 4Q0BA 4F2SA 4FXDA 4KO0A 2P5OA 3NVKA 3QEIA 4AHUA 5AFUA 1IJJA 3AVLA 4RW8A 1BISA 3N4PA 4DTJA 4BC4A 3ZSXA 2Z1JA 4Y0WA 3MAQA 4M3YA 4QCLA 1S3XA 1NJZA 5BN8A 4C23A 4FLWA 1RTHA 3QIPA 5LL6Z 4BRAA 3QICA 4PA1A 2FSNA 2Q2RA 4JKGA 4BC2A 3NF6A 4ZTFA 1SUQA 2QKKA 1NGHA 4CBWA 3O1BA 3K59A 3TI0A 4XH4A 1TVRA 3HP9A 5EY4A 1RDBA 1UOCA 4NCBA 4CF8A 5HL7L 3V9XA 1CZAN 3RWUA 3CCJN 2HVIA 3GOIA 4E7KA 3ENHA 1GLJO 1TUUA 4CGGA 4MQ3A 3L3VA 1NOYA 3QNOA 1Q81O 1NJIO 4FJMA 4BRCA 4FWQA 2W00A 1TAQA 4DV1K 4B1YB 3HXMA 3MN9A 1ATNA 3TAMA 4FYDA 5C0YA 4CJ5A 1BOTO 4LH4A 3F9KA 4RG8A 4DV5K 3CQXA 5AQUA 2V7YA 3KKSA 3LL3A 2NLXA 3HRGA 4HVJA 2NRWA 4O0JA 2V7ZA 1RBVA 1BQMA 4CJWA 4WQ4C 3A8YA 3ZSYA 1JXEA 2HF4A 2PYLA 5JS2A 4J2EA 2O8CA 4DLGA 3DXKA 4BRLA 2CH6A 1TKTA 3D2EB 1G99A 2B4JA 5C2DA 4Q5VA 3PX6A 2DFHA 1KVBA 1YI2N 3SV3A 5AQKA 1XNQK 4N56A 3DOLA 2ZJRL 4FPAA 4JS5A 1SKWA 3HT3A 2F7TA 3OJUA 4E0DA 1QQNA 5J1EA 1B9FA 1ZBFA 5AQNA 1KXPA 5KQDA 2E2NA 1KD1O 1U6ZA 4FK4A 3G6EN 3CI5A 3U3YA 4M7YA 4E7IA 1OH5A 1QE1A 5HRNA 3F5TA 1DEJA 4CZEA 4DR2K 2CH5A 1RTJA 1MWMA 2B6AA 5A2QO 4CGIA 3AVNA 3MWTA 4OJRA 4IBNA 4DR7K 1NGJA 3QO9A 4DCHA 2EHGA 4B9MA 1JLBA 4BRQA 3B8AX 3K58A 4JK7A 1C0UA 3EZ5A 4E7JA 4FJKA 1SL1A 5CYMA 2ZQBA 3ZEUB 4JD2B 3FLCO 4E89A 4YDUA 5BREA 3V9UA 4WFBL 1YUWA 2RN2A 3WNGA 4B9SA 5FRNA 4FWSA 3CF5L 2D0AA 1Q86O 4FZZA 5J2PA 3CMEN 1KC8O 4CFAA 5F1XA 3KD5E 4ILJA 2B5JA 3MDQA 4B9VA 3CJ7A 5FPNA 4DTMA 3OYMA 3WEEB 1N33K 4ID1A 5C12A 4CE9A 3AO2A 4A62A 3O80A 3AVKA 2X74A 3G10A 4DV3K 3EN9A 1JKHA 1HNZK 4FLYA 1NKEA 2EWSA 5DM7L 3OBWA 3BGRA 5CHIA 4KTWA 5BRHA 2P9KB 4CEQA 4WFNL 4FWMA 3L4IA 4LF6K 4CD1A 4JHDB 2P9PB 3AA3A 1NGCA 3VQDA 4LF7K 3CETA 1JLAA 2FBXA 4CZHA 2LSNA 5KGWA 1VSEA 4PKHA 1S6PA 4MO5A 2HHWA 1VQ5N 1GOBA 2FSJA 2O8FA 1S1VA 2HHHK 4FLVA 4FVMA 1SQKA 4DR1K 1K6YA 5C24A 4K41A 4B1UB 3THXB 1XQSC 4O5FA 3SAFA 2BANA 5EU7A 2QXFA 2YKNA 3VQ9A 3C94A 2ITMA 3MCPA 1IBMK 4B8CA 2WC9A 1KAZA 3CM5A 3TR8A 5F0XA 1M90O 4RWTA 4WQ5C 1C0FA 1GLLO 4BVOA 3O3GA 2NUBA 3MN5A 3KKRA 5JICA 3OYAA 1X3NA 1VQ7N 2G8FA 1VRTA 4YOXA 3LZIA 3EKSA 2ASPA 1WB9A 4DQQA 4JKFA 4FJGA 4KTZA 1VSMA 4BVPA 2OZMA 2IS3A 3RMBA 4BWMA 4IO8A 4M3WA 2X6NA 5KRTA 5EXWA 3HO1A 2D0BA 3AVMA 1S1TA 2VYPA 2OPQA 3U3GA 4LY7A 4CFBA 1OKJA 3DRRA 2V51B 3HI0A 4KPYA 3LP0A 1SS6A 4AHTA 1JLGA 1WAJA 3FZMA 3NBPA 4DFMA 4CHOA 3ZT1A 3G25A 4H5TA 1ESVA 4U67L 3O9RA 3WT0A 1SV5A 4BR5A 3BF1A 4JV5K 1HUXA 1LWEA 2BE2A 5AFUH 2W42A 1TK5A 2W40A 4CJVA 3QFUA 3AVIA 2FBVA 4FJ5A 4MDBA 3ENOA 2R7YA 1O1WA 2E2PA 4JRPA 4DV7K 4BRFA 4LSLA 4E1JA 3U4LA 4EHUA 4AHCA 3VGLA 3C95A 2C1IA 1XNRK 1NK5A 1IBLK 2QKBA 3QERA 4AM7A 3QEPA 4LD0A 1NJYA 1XC3A 3VQ6A 3LWMA 3WXMB 4RW7A 3THWA 1TKDA 1RTDA 3I8BA 3A0IX 3ALYA 3UIQA 3IMXA 4JN4A 1ZYQA 1HPZA 1VQKN 4DR5K 2PFUA 4EZ6A 4BG8A 3UKUB 4OPJA 4BACA 3VOVA 4CESA 3U6FA 1JCGA 4ELUA 3RRGA 3O9QA 2OYQA 4YOWA 4B1XB 5CYQA 4B08A 3NHGA 4K43A 3SJJA 3MX2A 2FSKA 1XMQK 1RBTA 3ZX0A 1UWBA 4DTRA 3TTFA 2HHXA 1L3UA 2JWLA 1SKRA 1NGAA 3QFPA 4PKGA 3OYIA 2E1YA 3HTVA 1IKXA 5AQGA 3SI6A 1ZBHA 1TL3A 4TSXA 4IXCA 4RCHA 3IRXA 4HTLA 2KW4A 3SUQA 2UU9K 2D1KA 3DLKA 4JNEA 4RW9A 4GKKK 4K8XA 1QQOA 1D9DA 1GLEG 2F8TA 1C1CA 2PAVA 2GX9A 1U45A 3EE8A 4AHSA 3CJAA 2O8DA 3HOSA 1VQMN 1F21A 2P1JA 5DM6L 3CC7N 4DR4K 4RW6A 3SZ2A 2HB5A 3SUOA 3VERA 3D2FB 5KGXA 3SV4A 2QW9A 4OKJA 4KFBA 5KPRA 3G0ZA 4FW2A 5C42A 4KHPK 1HNWK 1BO5O 3V9SA 4KREA 2OTJN 4A5BA 4CD3A 3TTCA 4IKFA 3C6AA 1W7AA 3I8DA 1T05A 4DR6K 1JLFA 5AQSA 4CZKA 4FOEA 2A40A 4FWNA 3ZX2A 3THYA 2RF2A 3WNFA 1B9DA 2F8SA 2P9UB 4DWIA 1G15A 2OTLN 3OYDA 4AM6A 1VQ8N 3VF4A 3AVAA 1ATRA 1T7PA 2H3GX 4IEEA 4PL7A 4FSVA 2Y1IA 4WQ4A 2X78A 1YJNN 1RTIA 4JI4K 3CMAN 1JJ2M 3NH2A 5KRSA 3AA5X 1TK0A 4DSJA 4E1MA 1BI4B 3O9SA 4FWKA 4A5AA 5MLCQ 4CERA 3CFRA 1RBRA 3KK7A 4OLBA 4BE0A 3VQ4A 4QOZB 3KD1E 1GLAG 3EKUA 1Z25A 4BE2A 1L3TA 3VF2A 2O8EA 3T69A 3VQCA 2BH1A 1I94K 4KTQA 2YHYA 4ISEA 1YJWN 2GELA 2KZMA 1C0MA 3VPZA 3TSUA 4NB4A 1NGFA 4LF8K 3OBYA 1X9JA 5HRSA 1JCEA 3V9ZA 1TYQB 3TAPA 3U8XA 3LPTA 4N41A 1ZC6A 2V52B 4HUGA 1VQNN 1IV0A 1L3VA 1E4GT 3PX0A 4FLUA 3CHWA 4YOYA 4BY9C 3B6PA 4H0XB 1J53A 4JKBA 4FJIA 1BCMA 4I2PA 2QWPA 4CI6A 1CXQA 4KHQA 3G71N 1NGGA 1I39A 2GBZA 4JI7K 2G8VA 3DJCA 3ZETA 2G8KA 1W97L 1ITGA 4YY3K 4CHQA 3HSCA 5AR0A 4LFAK 4M3RA 4Z4HA 4DU4A 1TV6A 2QWLA 2FBYA 3G4SN 1S5JA 2HHVA 4NXMK 2IAJA 3O1WA 4IOXA 1WSHA 3ASMA 3K0SA 3AARA 3CD6N 5KPZA 3DM2A 4CHPA 2OZSA 4DTOA 3J80O 4E7HA 5AQLA 3RRHA 4ICLA 2CGKA 5AQVA 1U49A 3L6QA 4H0PA 1S9EA 4JI6K 5AZIB 3SQ2A 1YT3A 1TUYA 4I6MB 1RDDA 4OGCA 1HYSA 3CCSN 3HPOA 4JK9A 5LJWA 3VGKA 2Q97A 4CBXA 1EX4A 4JS4A 3Q7CA 4KRFA 3FE1A 1T44A 4KI4A 3D2EA 3AAQA 3UE5A 3L4QA 1B92A 3OYLA 2A3ZA 3H3NO 2E6LA 5GINA 3J8AA 4WQ5A 4O8UA 5FPDA 4DR3K 4NO7A 5BRFA 3NF9A 4ILGB 4CFDA 2YHBA 4Y1DA 4CIFA 2XHBA 4CJFA 1SZ2A 3OYHA 3AO5A 1RDCA 3T3FA 1QHAA 3RSEB 1HRHA 4DV4K 3VENA 3TANA 5LY3A 4KB1A 2F96A 3DLGA 3T1YK 3WNHA 2HBJA 3K9JA 1Z6RA 3C6HA 3VQQA 4DFPA 2A41A 3VA3A 2UXCK 2YKMA 3FFIA 3D0PA 4X66K 4H0VB 2ASOA 2VGNA 3ZEUA 4CJ3A 1HJRA 4BRMA 4HHTA 4CGJA 1RT4A 3R8EA 3DAWA 4E1NA 3AVHA 3VEYA 1HQEA 5AQIA 2GWJA 2HNZA 4DU3A 1N8RO 3FR0A 1LAVA 1GOCA 2HHTA 1JCFA 1WUAA 4MDAA 3EE9A 4NCAA 1J5EK 3VTIA 5IT9O 3M3ZA 3KLIA 2A42A 3WEEA 3QBXA 3DOKA 1V4TA 2E6MA 3QEXA 2QEXN 4C8KA 4H4MA 1C1AA 2OPRA 4OPHA 4BR4A 5TKWA 3TAEA 1FKOA 2EX3A 3DXMB 1FW6A 5HOOA 1NGDA 1Q8IA 3C0BA 3C7NB 1NKCA 1JXBA 2ZGZA 2YNFA 2QWOA 5FROA 4EAHD 1DLOA 2P9KA 3OTOK 4DSFA 2FLOA 1K8KB 4M3UA 4GW6A 3EY1A 4JHDA 4CK3A 3MXJA 4LC9B 4BR0A 1RT6A 3SNNA 4EZ9A 2E2QA 4B1WB 1UAXA 4B9UA 2HMIA 4K8ZA 2VCPA 4WFAL 3THXA 3ITHA 1QQMA 2KKZA 4CJSA 4OVLA 4O55A 4AHRA 1C0GA 3O8MA 3MCAB 5BR8K 2IGIA 4Z4IA 2P9IB 2JLEA 3V6DA 4BG9A 3L2QA 5E41A 1UA0A 4FM1A 3QMLA 1RGIA 3P83D 5E84A 2ZJQL 1VQ4N 4HWIA 3RR8A 5M1PA 4JEPA 1VQON 3CCEN 2HHSA 4B3TK 1N32K 4BQZA 3L2RA 4DV2K 4JLHA 3EYZA 3C6UA 3KLEA 3FZKA 1CZBA 1XMOK 2ZWHA 3QBWA 3PIPL 2PYJA 1T8EA 4XH5A 4CIGA 3PIOL 2CGJA 5M1NA 1KFSA 4R79A 1KVCA 5AZJA 1W9HA 4V19S 4DG1A 1YVUA 4YNQA 3KHYA 5HRRA 1YAGA 2IVNA 4BROA 3BZCA 1GLFO 3OA9A 3M6GA 4KHSA 2KLAA 2NRRA 3OYJA 3LAKA 4CHNA 2DFEA 3AAPA 3S3MA 3N4QA 1VSJA 4UY8O 3NVMA 1WAFA 3QETA 3WQTA 3SPZA 2A5XA 4LF9K 5KPTA 4M3XA 4IFEA 2HSTA 4CF0A 5CY4A 3VQEA 2KZZA 1VSDA 3LANA 4DQIA 3ZCMA 3LDSA 2OA8A 1ZBUA 3VEOA 3ATUA 4CZJA 1K8AO 3QIOA 4JI8K 4JKAA 2VGMA 2VG5A 3OJSA 4CVNE 4DFKA 1MU2A 3O4NA 2XRIA 2QTDA 4F3TA 2FXUA 4CEAA 4FWPA 2C1GA 2UXDK 1OVQA 3A5NC 3MEDA 3UKUA 3LM2A 4AHVA 1UA1A 3KZBA 1S1WA 1VQ9N 5J2QA 4N76A 3AVFA 4GKJK 5AQOA 3EZWA 4X65K 2KQ2A 4F2RA 1LOTB 3E66A 3MWPA 2QXLA 4CF1A 1Q7YO 1HLUA 3BF3A 4NLBA 3VEZA 4H03B 4K25A 1NK8A 2Q3SA 4DSKA 3O3HA 4YOVA 1FJGK 4K0KK 4AQYK 1T03A 3SCXA 2Q36A 4C8NA 3LP3A 3ZT3A 1N6QA 1Y64A 5I3UA 1C0TA 1J54A 3T19A 4EFHA 3O4WA 4JKCA 4A2AA 4CEEA 3FZHA 1WBBA 4KV8A 4EP5A 4BR7A 1NMNA 1BA1A 3W3DA 4FZXC 3HP6A 3IG1A 4GMJB 4BGBA 5KQ8A 2DPNA 4H5RA 3CJ1A 4BWJA 3J81O 4JI1K 4WE1A 3AO1A 4OPAA 3CPWM 1YF5L 1SAZA 1BU6O 3P4IA 4FJJA 2AA4A 4LFCK 2O8CB 3LWLA 3C6TA 4GVEA 3E9PA 3P1GA 4DQPA 4B3RK 3WXLA 2YHAA 5CZ2A 3CCLN 4DUYK 3SBGA 1DGKN 4F3OA 1ZXOA 3ZX3A 2ITGA 3LAMA 2DTUA 5JVHL 2VG7A 4FM0A 1VAZA 4W5NA 3SK3A 3T7ZA 5JMVA 1V4SA 3SJHA 2P9UA 3QNNA 2IOCA 3CXCM 3U9ZA 3OYNA 4BRPA 5AQMA 1LW2A 1NOZA 1T6CA 1U2VB 3MEEA 5ADXA 2HOEA 3AVJA 1KSPA 2GWKA 5EVZA 1KFDA 3DI6A 2IDOA 2W41A 3LALA 4CGFA 4NYFA 4H4OA 2E4LA 5HRPA 2RHKA 1QZ6A 4DF8A 4O0IA 3NCIA 1XWLA 4DF4A 1KLMA 1FXXA 1X3MA 4BQLA 3A5MC 4H0TB 1P8ZA 2O4GA 4JKHA 2IC3A 4KH4A 4NYNA 3QB0A 3FGUA 4JK8A 2Q0UA 4JI0K 2HNDA 4XJXA 4CZLA 4DU1A 1LW0A 3HL8A 5K14A 3ZSWA 3SYZA 2QWMA 5LMUK 4J8FA 2NRZA 3PSIA 5AJ3K 3HPHA 3M1FA 1NKBA 4B1ZA 5AQPA 1IKYA 5HROA 4O4GA 3NDKA 4DTSA 3TABA 4J2AA 3L8BA 4DUZK 2YJEA 5BN9A 4C8LA 3PO5A 4OX9K 4ELVA 4IDHA 1U48A 2HW3A 4H5NA 1BCOA 3QDKA 1BWFO 3ZT0A 4YOUA 1WSEA 3ISNC 4GVMA 4CJUA 2Z1IA 4CJEA 4PKIA 3ZLJA 4E19A 3L3UA 3E1YA 5B8HA 5C15A 2Q31A 2WBNA 5FDLA 3S3OA 4LSNA 4PY5A 3ULEB 2QWRA 4I7FA 4KBOA 2Q1NA 4CK1A 2QWQA 2HHQA 4IOAL 2HNYA 5GAEP 3HYFA 2E20A 5AQRA 3K5OA 3K5NA 3D6RA 4M3TA 2G8WA 5BR9A 4I6MA 4JKDA 2BDPA 3CYGA 4BC5A 3IFRA 3MMVA 1O13A 3MX5A 5EOYA 4DKWA 1HQUA 3ZSVA 1Q18A 4BR9A 3CJBA 4NLCA 4FWOA 1RT5A 3LDQA 5FPMA 4KAZA 3AVCA 3LDLA 1CXUA 2E5LK 4OO1J 3SUNA 4FLTA 4EP4A 1BL3A 4IJNA 5TKYA 1BQNA 2JGUA 4JYAK 1HNXK 5EX5A 1S1XA 2I7NA 4CZFA 4GV6A 4CK2A 2OPSA 3KWGA 2YJFA 3R9PA 1S72N 1RBSA 3RTVA 3H1VX 3TAGA 3S41A 1NBWA 3FZFA 2VWKA 3RSEA 2P9NB 4GV9A 4O8KA 4HCBA 1S9GA 1X9WA 3OYKA 5KTQA 1YXQA 3P5JA 4L3QA 4MO4A 1IBKK 1QSYA 2NZTA 3HM8A 3D7EO 1YIJN 3SPYA 3L0QA 4YFUA 3BP8A 3OS0A 4CHYA 1QTMA 2RPIA 3SQ1A 2HHUA 3I0SA 3VQ7A 3HVRA 4FK0A 4MLHA 4J2DA 4CZIA 5F2RA 2G8IA 2E1ZA 5DMRA 3VMFB 4M3ZA 4FVUA 1Q9YA 3THWB 5T7BA 1HX1A 2ZGYA 1DTQA 2F9WA 1JL2A 3VEXA 3MXMA 3S5TA 3O5BA 4EIAA 4LF4K 4FJ8A 4G9ZA 4Z0UA 1NK6A 1KRPA 3TSQA 4H5WA 2Y1JA 4IWVA 4K42A 4OGEA 1Z05A 3O9TA 1LWCA 3DXMA 3BY5A 4FWLA 3VN5A 2VQEK 2YNIA 2FC0A 3W0LA 1RFQA 4IO9L 2ATQA 1A5WA 3TTDA 3QINA 1BHLA 2QWNA 4IDKA 1K8KA 4F9OA 1ZBSA 1NLVA 4C8MA 4CJTA 5AQWA 1GLBG 5HP1A 3NMUA 3BUZB 2WTUA 3AO4A 3DLLL 3OHRA 2A6AA 4DV6K 5FRMA 4CZMA 5CE3A 3UB5A 1I3AA 3KK1A 2P9SB 3VEVA 2D0PA 1HKBA 3CFOA 1FKPA 1NWKA 4U7BA 4KHWA 1RT7A 4PWDA 1BA0A 2FBTA 4B3MK 2P9IA 3V9WA 3P31A 3OYEA 1FK9A 2P9LB 3OW2M 5AQJA 1EXQA 1REVA 4ID5A 1EWRA 3THVA 4RTFD 5SZTA 4B3OA 4J2BA 4JI2K 5ADXH 1WSGA 5M1QA 1NK9A 2KFZA 3VESA 3ZSOA 4OKEA 2DFFA 1TL1A 3QESA 2WONA 4ZHRA 3IAYA 4QS9A 4CJPA 4W5RA 3DYAA 3CJCA 4QS8A 4Z4GA 2G8UA 2XY5A 2IVOA 4CEFA 3KLHA 4BRNA 2W6KA 3OYFA 1VSKA 1YVNA 3OYCA 3A5OC 1WLJA 2GV9A 4FJ7A 4W5OA 1YJ9N 2P5GA 3E9OA 2O8BB 2XY8A 5FPEA 4X62K 1Y97A 3RR7A 3CFPA 4M42A 4BRKA 2ZE2A 4WYBA 2YI1A 3LDPA 3HM9A 3F9MA 1XUPO 4FLZA 2NNWA 4F8RA 5AQFA 4FCYA 4KB0A 1EO1A 4FWRA 1K73O 4B9NA 3CJ9A 3MXIA 1YTAA 2J4RA 3A5LC 3NF8A 2UUBK 4JD2A 5FLXO 1VK0A 1VSLA 3MN7A 4CJQA 3JAMO 4BRGA 1OH7A 1IG8A 4DTPA 2Z1HA 1KAXA 3EEQA 1DKGD 1HKCA 3J7YP 5DK5A 3CQ8A 1RDUA 4A61A 3TSPA 3GE1A 3KK2A 4M41A 3ZT2A 1P90A 4BECA 3DRSA 4E7LA 1RDWX 1TGOA 4XH1A 3K2PA 5JENA 3UKRB 1NGBA 4BEBA 3DLHA 1Z26A 3O4QA 2D0OA 4UQGA 3P39A 4L8RB 3JXUA 2GEMA 1GLDG 1L3SA 3JS6A 2D4WA 3IKMA 3FZLA 5JLFA 3DLRA 1NNEA 3DMJA 2P9PA 3ZETB 5M1FA 3I56N 4GNIA 4GV3A 1EKEA 4ELTA 4CJ7A 3K5LA 3T1HK 3OS1A 5GAHP 1BIZA 2I7PA 1T3VA 5JLHA 3L2VA 2ZM6K 5JVGL 4CCHA 3LDNA 3ZSRA 1RDAA 2D5RA 3NGYA 2YV0X 4H5VA 4IFYA 5BPNA 2QA4N 3R1XA 4R5PA 4DS5A 3NE6A 4WF9L 1HYZA 4A59A 4X64K 1K9MO 4DB3A 3QEWA 1XI1A 4DQSA 3A2FA 1EETA 2WUSA 4FM2A 3LP1A 5J2MA 1DT9A 3H1QA 3HOTA 2P51A 1KQSM 4DLEA 2UUCK 1BUPA 4I2QA 2ZD1A 4FK2A 5C10A 4CEBA 5AQZA 4ISFA 3NAEA 3BZKA 4DMNA 1NJXA 1HNIA 3VA0A 3VQ5A 1NK0A 3M8QA 1ILYA 4CF9A 3OYBA 1E4FT 1KVAA 3H3OB 1ASVA 2YX6A 4DSIA 3SUPA 2NRHA 1U2VA 4FJ9A 2BGGA 2D0CA 3GL1A 2X6SA 1QZ5A 1OVYA 1SKSA 4PHTX 1WN7A 4B9TA 3T1AA 2HHIA 2G8HA 3M8RA 3PX4A 2QM1A 1RNHA 3AY9A 1M1KO 1E3MA 3SQ4A 2A1RA 1JLQA 3GBTA 1JLCA 4KKOA 2ZF5O 4KH5A 4I9LA 3VTHA 3IUCA 4PL8A 2XO7A 3CC4N 2IIRA 4GY2B 2YHWA 3I33A 3JSMA 1J5OA 4PUOA 4C1NI 2YHXA 3KK3A 3PY8A 4BE7B 3M8PA 3CPEA 3U9DA 1W0HA 3LZJA 4IZ9A 4FJNA 4C8OA 1HYVA 2YNGA 4FW1A 4JKGB 4JKEA 1D4XA 1VSHA 1GLCG 2HMPA 4YOTA 3PO4A 2NRXA 4G1QA 4Z4FA 1IG9A 4QS7A 3TAFA 2PY5A 3CCMN 4IG3A 3P38A 4BREA 5SWMA
chains in the Genus database with same CATH topology
3G71N 3CCJN 3GOIA 1NGGA 4IDHA 1J6ZA 3ENHA 1GLJO 1TUUA 3DJCA 3ZETA 1W97L 4Z94A 1LCUA 4H5NA 1Q81O 1NJIO 3QDKA 5AQYA 3HSCA 1BWFO 5AR0A 4BRCA 3J7ZO 4YOUA 4FWQA 4CBUA 2W00A 2QWLA 3G4SN 4PKIA 2KHOA 4B1YB 3MN9A 3F2KA 1ATNA 4IOXA 3E1YA 3O1WA 5C0YA 3R6MA 5B8HA 1BOTO 5C15A 2Q31A 2WBNA 3K9KA 3AARA 3CD6N 3SAHA 3CQXA 3LDOA 5KPZA 5AQUA 2V7YA 3VF6A 3BEXA 3ULEB 5AQLA 2QWRA 3D2FA 3WUHA 3H45C 2NLXA 3LL3A 3HRGA 1EQYA 2Q1NA 4KBOA 3TPQA 2NRWA 2QWQA 2CGKA 2V7ZA 5AQVA 3ULEA 3L6QA 4H0PA 4IOAL 3O9UA 5GAEP 4WQ4C 5AZIB 3A8YA 1TUYA 2E20A 4I6MB 5AQRA 2HF4A 3D6RA 3DXKB 3Q7BA 5BR9A 4I6MA 3CCSN 4JKDA 4JK9A 3DXKA 2FF6A 3VGKA 2CH6A 3ZYYX 2Q97A 4BC5A 4BRLA 4CBXA 5C2FA 3D2EB 3IFRA 1G99A 3MMVA 1O13A 5C2DA 3Q7CA 3MX5A 5EOYA 3FE1A 4DKWA 1T44A 1W2BM 1Q18A 3D2EA 3ATVA 3CJBA 3AAQA 4NLCA 3UE5A 5AQKA 4BR9A 1YI2N 2IVPA 4FWOA 3L4QA 3LDQA 5FPMA 2A3ZA 3H3NO 3LDLA 4OO1J 3VEWA 5GINA 5GIOA 2ZJRL 4FPAA 4JAXA 3J8AA 3ENBA 2F7TA 4WQ5A 4O8UA 4CI6A 5FPDA 4IJNA 3CCRN 5TKYA 4BRIA 4NO7A 5BRFA 5EX5A 1QQNA 4ILGB 5AQNA 1KXPA 2I7NA 4CZFA 2HBLA 5KQDA 4GV6A 2E2NA 1KD1O 1U6ZA 3KWGA 2YJFA 3R9PA 1SZ2A 1S72N 5GIPA 3G6EN 3CI5A 3H1VX 2WFBA 4M7YA 1QHAA 3SMPA 3S41A 3F5TA 1NBWA 1DEJA 3RSEB 4CZEA 2CH5A 5BPLA 5BPMA 1MWMA 3VENA 5AZJB 3FZFA 3RSEA 3MWTA 2P9NB 5LY3A 4GV9A 2Q0RA 1NGJA 3C65A 4O8KA 5M1OA 4BC3A 1YXQA 4L3QA 2P9NA 3ID6A 4MO4A 4DCHA 1QVFM 2NZTA 3HM8A 3D7EO 4BRQA 5H1SQ 3B8AX 4ISGA 2HBJA 3K9JA 1YIJN 4JK7A 1VQLN 1Z6RA 3C6HA 3L0QA 3BP8A 2A41A 4KH6A 3WQUA 3ZEUB 4JD2B 3FLCO 4YDUA 5BREA 4H0VB 4BRHA 4WFBL 2ASOA 1YUWA 2VGNA 3AGRA 3ZEUA 4A57A 4BRMA 3HBTA 3SLCA 2JWKA 4FWSA 4MLHA 3CF5L 3R8EA 3DAWA 1Q86O 1TYQA 1BG3A 4CZIA 5F2RA 3CMEN 3VEYA 2E1ZA 2ASMA 5AQIA 1KC8O 2GWJA 1N8RO 3VMFB 3FR0A 5F1XA 4FVUA 1WOQA 4ILJA 1VQ6N 1JCFA 1HX1A 2ZGYA 3MDQA 5ELZA 1WUAA 4MDAA 2F9WA 3CJ7A 3EE9A 5FPNA 3SBTA 3WEEB 3VTIA 3VEXA 3M3ZA 5C12A 2NRTA 2A42A 3WEEA 3O5BA 3QBXA 4A62A 3GDQA 1V4TA 3O80A 4EIAA 3R3LA 5GADP 2QEXN 4G9ZA 3EN9A 3FFKB 1Q82O 4OPHA 3TSQA 5TKWA 4H5WA 2EWSA 3WXJA 2CGLA 4IWVA 4K42A 3DXMB 4AF1A 5HOOA 4EHTA 3OBWA 1Z05A 2RE2A 3O9TA 5DM7L 5CHIA 5BRHA 1NGIA 1NGDA 3DXMA 2E2OA 2E8AA 4FWLA 2P9KB 3C0BA 3C7NB 4WFNL 4FWMA 2ZGZA 3L4IA 2QWOA 4CD1A 3LM9A 4JHDB 2P9PB 1RFQA 3W0LA 1NGCA 4EAHD 2P9KA 4IO9L 3CETA 3VETA 2FLOA 1K8KB 4CZHA 3TTDA 4JHDA 3KVGA 4PKHA 4MO5A 1VQPN 2QWNA 4LC9B 1K8KA 4F9OA 1VQ5N 1ZBSA 2FSJA 4BR0A 1NLVA 1SQKA 2VWBA 5AQWA 4B1UB 4K41A 2E2QA 4B1WB 1GLBG 3H6EA 1XQSC 4IEIA 3NMUA 4O5FA 4FO0A 3BUZB 3SAFA 4DHYA 3DLLL 3OHRA 2VCPA 2ITMA 4WFAL 3MCPA 2A6AA 4CZMA 5CE3A 2WC9A 3UB5A 4DQ8A 1QQMA 2KKZA 4XEIA 1KAZA 3DWLA 1C0GA 3O8MA 4B1VA 5F0XA 3MCAB 1M90O 4RWTA 4WQ5C 2P9SB 1C0FA 3VEVA 2D0PA 2P9IB 1GLLO 1HKBA 1NWKA 5AZIA 4BVOA 1YITN 4U7BA 2P9SA 2HF3A 5LJWA 1BA0A 2P9IA 3MN5A 4BG9A 5JICA 3WXIA 1X3NA 2FF3B 1VQ7N 3P31A 4YOXA 3EKSA 2ASPA 2P9LB 3OW2M 5AQJA 4JKFA 3QMLA 1RGIA 3ID8A 4RTFD 2P9LA 3CERA 4BVPA 1HKGA 5E84A 3SMSA 5ADXH 5M1QA 3CQYA 2ZJQL 1HPMA 4HWIA 4IO8A 4M63C 3VESA 1VQ4N 4C1NK 5EXWA 2NRVA 1NM1A 5M1PA 4JEPA 1S22A 1VQON 3CCEN 4QS9A 2VYPA 1NGEA 3CJCA 4BQZA 5E26A 4QS8A 4CZGA 1OKJA 3AGKA 4BR4A 2IVOA 2V51B 3HI0A 3GG4A 4BRNA 1SS6A 1H1VA 3FZKA 3CIPA 3FZMA 4YDUC 1YVNA 2ZWHA 3QBWA 3PIPL 3A5OC 4XH5A 3PIOL 1YJ9N 3E9OA 3G25A 2CGJA 4H5TA 5FPEA 1ESVA 3M5RA 5M1NA 4U67L 4R79A 3O9RA 3WT0A 5AQTA 4BR5A 3BF1A 5AZJA 3IDHA 5I9EB 4B9QA 1HUXA 5AFUH 3KHYA 4BRKA 1YAGA 2IVNA 4BROA 4WYBA 2YI1A 3LDPA 1GLFO 3F9MA 1XUPO 2W40A 3M6GA 3OA9A 2NNWA 5AQFA 1EO1A 3QFUA 3TU5A 2KLAA 2NRRA 4FWRA 1K73O 3CJ9A 3AAPA 3ENOA 3N4QA 4FL9A 4MDBA 4UY8O 2J4RA 3NVMA 3A5LC 2E2PA 1R59O 3WQTA 4BRFA 4E1JA 4JD2A 3U4LA 2A5XA 4EHUA 3VGLA 3MN7A 5KPTA 3RVCA 2C1IA 2OANA 4IFEA 4BRGA 2HSTA 1IG8A 4YORA 4AM7A 5LJVA 5AQHA 1KAXA 3CCUN 1XC3A 1DKGD 1HKCA 3CCVN 4H0OA 3WXMB 2BTFA 1RDUA 3A0IX 3I8BA 3ATUA 1HJOA 3VEOA 3TSPA 3GE1A 4A61A 4CZJA 3IMXA 4FOIA 2PBDA 4JN4A 1K8AO 4JKAA 1VQKN 2VGMA 3HZ6A 2PFUA 1P90A 4BECA 2QTDA 4BG8A 2FXUA 5CR4A 3UKUB 1RDWX 3VOVA 4FWPA 4XH1A 2C1GA 5M1KA 1JCGA 3WXKA 3A5NC 3UKRB 3O9QA 3UKUA 1NGBA 3LM2A 5BRDA 4B1XB 3KZBA 4YOWA 4BEBA 3MK6A 1VQ9N 2D0OA 3UKRA 3P39A 4ILHA 4K43A 3MX2A 2FSKA 4IJAA 3ZX0A 2UYTA 3JXUA 5AQOA 3EZWA 2GEMA 1GLDG 5GAGP 3JS6A 2D4WA 3IKMA 3SAGA 1LOTB 3FZLA 5JLFA 3H46O 3C7NA 3E66A 3MWPA 2QXLA 3TTFA 1Q7YO 1HLUA 3BF3A 4NLBA 3VEZA 4H03B 2P9PA 2JWLA 4K25A 1NGAA 3QFPA 4PKGA 3ZETB 2E1YA 3HTVA 3VGMA 5M1FA 5AQGA 3I56N 4YOVA 3E9LA 4IXCA 3CCQN 4GNIA 4GV3A 4RCHA 4HTLA 4BRDA 2D1KA 3O6WA 2Q36A 4JNEA 4CJ7A 4FPBA 1QQOA 5GAHP 3KWIA 1Y64A 1GLEG 3EL2A 2PAVA 3EO3A 2GX9A 2I7PA 1T3VA 4EFHA 5JLHA 5JVGL 3EE8A 3O4WA 3CJAA 3LDNA 4JKCA 4A2AA 3O08A 4H0YB 3FZHA 3HOSA 1VQMN 4BR7A 4H5VA 5BPNA 2QA4N 5DM6L 1KAYA 2HBKA 3MN6A 3R1XA 1BA1A 3W3DA 1YHQN 1BDGA 3CC7N 4WF9L 4BGBA 3VERA 3D2FB 4A59A 5KQ8A 2DPNA 4H5RA 4MLEA 2QW9A 3CJ1A 1K9MO 4DB3A 5AQXA 2WUSA 3CPWM 4OPAA 5KPRA 4BR2A 1YF5L 1SAZA 1BO5O 1BU6O 3P4IA 1DT9A 2AA4A 3H1QA 4A5BA 2OTJN 4CD3A 3HOTA 3TTCA 1KQSM 3C6AA 4GVEA 2AP1A 3E9PA 5AQSA 3WXLA 1BUPA 4BGAA 4CZKA 3CCLN 1MA9B 3PLAA 4FOEA 3SBGA 2A40A 1DGKN 4FWNA 2QI2A 3ZX2A 1NMDA 1ZXOA 3ZX3A 5C10A 3I55N 2P9UB 1MDUB 5AQZA 1ATSA 4ISFA 5JVHL 4WCEL 1VAZA 2OTLN 4A2BA 3SK3A 4AM6A 5AQQA 3T7ZA 3VF4A 1V4SA 3SJHA 2P9UA 5JMVA 1ATRA 3CXCM 1VQ8N 1ILYA 3U9ZA 2H3GX 1E4FT 4IEEA 3CC2N 3H3OB 4BRPA 2YX6A 4PL7A 4FSVA 5AQMA 2GUPA 1MWKA 1U2VB 1T6CA 4WQ4A 2NRHA 2BUPA 4IOCL 2E88A 5ADXA 2YCHA 2HOEA 3CMAN 1YJNN 1U2VA 1JJ2M 2GWKA 5EVZA 1QVGM 2HBMA 3GL1A 2W41A 1QZ5A 3O9SA 1OVYA 4FWKA 4A5AA 5MLCQ 4PHTX 1T6DA 4M7XA 2RHKA 1QZ6A 2ZJPL 2QM1A 3KK7A 2F9TA 3AY9A 1M1KO 2GTDA 3GBTA 1GLAG 3EKUA 1X3MA 4BQLA 2ZF5O 3VF2A 3A5MC 4H0TB 3T69A 2BH1A 4KH5A 1P8ZA 2YHYA 4ISEA 3VTHA 1YJWN 2GELA 3IUCA 4PL8A 3CC4N 2IIRA 4GY2B 4JKHA 3TSUA 2YHWA 3I33A 4NB4A 4KH4A 3VPZA 3NVKA 1NGFA 4C1NI 3OBYA 2YHXA 1X9JA 3QB0A 3FGUA 4JK8A 5AFUA 2Q0UA 1IJJA 4XJXA 4BE7B 1JCEA 4CZLA 3CPEA 3N4PA 3U9DA 4BC4A 1TYQB 4IZ9A 4Y0WA 2QWMA 3U8XA 4J8FA 2NRZA 1S3XA 1ZC6A 2V52B 3M1FA 4B1ZA 4JKGB 5AQPA 1VQNN 5BN8A 4C23A 4JKEA 1E4GT 4BRAA 3QICA 1D4XA 2HMPA 1GLCG 2FSNA 2Q2RA 4JKGA 4YOTA 4BC2A 1NGHA 3CHWA 4YOYA 2NRXA 4CBWA 4BY9C 3O1BA 4H0XB 4JKBA 4XH4A 5EY4A 4QS7A 3CCMN 2QWPA 3P38A 2YJEA 4BREA 5HL7L 5BN9A 1CZAN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GOI A;  1NGG A;  1J6Z A;  3ENH A;  1GLJ O;  1TUU A;  3DJC A;  3ZET A;  4Z94 A;  1LCU A;  4H5N A;  3QDK A;  5AQY A;  3HSC A;  1BWF O;  5AR0 A;  4BRC A;  4FWQ A;  4CBU A;  2QWL A;  4PKI A;  2KHO A;  4B1Y B;  3MN9 A;  1ATN A;  3O1W A;  3R6M A;  5B8H A;  1BOT O;  2Q31 A;  3AAR A;  3CQX A;  3LDO A;  5KPZ A;  5AQU A;  2V7Y A;  3VF6 A;  3BEX A;  3ULE B;  5AQL A;  2QWR A;  3D2F A;  3WUH A;  3H45 C;  2NLX A;  3LL3 A;  4KBO A;  1EQY A;  2Q1N A;  3TPQ A;  2QWQ A;  2CGK A;  2V7Z A;  5AQV A;  3ULE A;  3L6Q A;  4H0P A;  4WQ4 C;  5AZI B;  3A8Y A;  1TUY A;  2E20 A;  4I6M B;  5AQR A;  2HF4 A;  3DXK B;  5BR9 A;  4I6M A;  3DXK A;  2FF6 A;  3VGK A;  2CH6 A;  4BC5 A;  2Q97 A;  4BRL A;  4CBX A;  5LJW A;  3D2E B;  3IFR A;  1G99 A;  3MMV A;  5EOY A;  3FE1 A;  1T44 A;  1Q18 A;  3D2E A;  3ATV A;  3CJB A;  3AAQ A;  3UE5 A;  4BR9 A;  5AQK A;  2IVP A;  4FWO A;  3LDQ A;  5FPM A;  2A3Z A;  3H3N O;  3LDL A;  3VEW A;  4FPA A;  4JAX A;  3J8A A;  4WQ5 A;  4CI6 A;  5FPD A;  4IJN A;  5TKY A;  4BRI A;  4NO7 A;  5BRF A;  5EX5 A;  1QQN A;  5AQN A;  1KXP A;  2I7N A;  4CZF A;  5KQD A;  2E2N A;  1U6Z A;  2YJF A;  3R9P A;  1SZ2 A;  3CI5 A;  3H1V X;  4M7Y A;  1QHA A;  3SMP A;  3S41 A;  1NBW A;  1DEJ A;  3RSE B;  4CZE A;  2CH5 A;  5BPL A;  5BPM A;  1MWM A;  3VEN A;  5AZJ B;  3FZF A;  3RSE A;  2P9N B;  5LY3 A;  2Q0R A;  1NGJ A;  4O8K A;  4BC3 A;  1YXQ A;  4L3Q A;  2P9N A;  4MO4 A;  4DCH A;  2NZT A;  3HM8 A;  3D7E O;  4BRQ A;  3B8A X;  4ISG A;  1Z6R A;  3L0Q A;  3BP8 A;  2A41 A;  3WQU A;  3ZEU B;  4JD2 B;  3FLC O;  4YDU A;  5BRE A;  4H0V B;  4BRH A;  2ASO A;  1YUW A;  3ZEU A;  4BRM A;  3HBT A;  3SLC A;  4FWS A;  4MLH A;  3R8E A;  3DAW A;  1TYQ A;  1BG3 A;  4CZI A;  5F2R A;  3VEY A;  2E1Z A;  2ASM A;  5AQI A;  2GWJ A;  5F1X A;  3FR0 A;  1WOQ A;  1JCF A;  1HX1 A;  2ZGY A;  3MDQ A;  5ELZ A;  1WUA A;  2F9W A;  3CJ7 A;  5FPN A;  3WEE B;  3VEX A;  3M3Z A;  2A42 A;  3WEE A;  3O5B A;  3QBX A;  4A62 A;  3GDQ A;  1V4T A;  3O80 A;  4EIA A;  3EN9 A;  3FFK B;  4BR4 A;  3WXJ A;  4H5W A;  2EWS A;  2CGL A;  4IWV A;  4K42 A;  3DXM B;  4EHT A;  1Z05 A;  5BRH A;  1NGI A;  1NGD A;  3DXM A;  2E2O A;  2E8A A;  4FWL A;  2P9K B;  3C0B A;  3C7N B;  4FWM A;  2ZGZ A;  3L4I A;  2QWO A;  4CD1 A;  3LM9 A;  4JHD B;  2P9P B;  1RFQ A;  3W0L A;  1NGC A;  4EAH D;  2P9K A;  3CET A;  3VET A;  2FLO A;  1K8K B;  4CZH A;  4JHD A;  3KVG A;  4PKH A;  4MO5 A;  2QWN A;  4LC9 B;  1K8K A;  4F9O A;  1ZBS A;  2FSJ A;  4BR0 A;  1NLV A;  1SQK A;  2VWB A;  5AQW A;  4B1U B;  4K41 A;  2E2Q A;  4B1W B;  1GLB G;  3H6E A;  1XQS C;  4O5F A;  3BUZ B;  4FO0 A;  4DHY A;  3OHR A;  2VCP A;  2ITM A;  3MCP A;  2A6A A;  4CZM A;  5CE3 A;  3UB5 A;  4DQ8 A;  1QQM A;  4XEI A;  1KAZ A;  3DWL A;  1C0G A;  3O8M A;  4B1V A;  5F0X A;  4RWT A;  4WQ5 C;  2P9S B;  1C0F A;  3VEV A;  2D0P A;  2P9I B;  1GLL O;  1HKB A;  1NWK A;  5AZI A;  4BVO A;  2P9S A;  2HF3 A;  1BA0 A;  2P9I A;  3MN5 A;  4BG9 A;  5JIC A;  3WXI A;  1X3N A;  2FF3 B;  3EKS A;  2ASP A;  2P9L B;  5AQJ A;  3QML A;  1RGI A;  3ID8 A;  4RTF D;  2P9L A;  3CER A;  4BVP A;  1HKG A;  5E84 A;  3SMS A;  5ADX H;  3CQY A;  1HPM A;  4HWI A;  4IO8 A;  4M63 C;  3VES A;  5EXW A;  1NM1 A;  1S22 A;  4QS9 A;  2VYP A;  1NGE A;  3CJC A;  4BQZ A;  5E26 A;  4QS8 A;  4CZG A;  1OKJ A;  2IVO A;  2V51 B;  3HI0 A;  3GG4 A;  4BRN A;  3FZK A;  1H1V A;  3CIP A;  3FZM A;  4YDU C;  1YVN A;  2ZWH A;  3QBW A;  3A5O C;  4XH5 A;  3G25 A;  2CGJ A;  4H5T A;  5FPE A;  1ESV A;  3WT0 A;  5AQT A;  4BR5 A;  3BF1 A;  5AZJ A;  3IDH A;  5I9E B;  4B9Q A;  1HUX A;  5AFU H;  3KHY A;  4BRK A;  1YAG A;  2IVN A;  4BRO A;  4WYB A;  2YI1 A;  3LDP A;  1GLF O;  3F9M A;  1XUP O;  2W40 A;  3M6G A;  5AQF A;  3QFU A;  3TU5 A;  4FWR A;  3CJ9 A;  3AAP A;  3ENO A;  4FL9 A;  2J4R A;  3A5L C;  2E2P A;  1R59 O;  3WQT A;  4BRF A;  4E1J A;  4JD2 A;  3U4L A;  2A5X A;  4EHU A;  3VGL A;  3MN7 A;  5KPT A;  2OAN A;  4BRG A;  1IG8 A;  4AM7 A;  5LJV A;  5AQH A;  1KAX A;  1XC3 A;  1DKG D;  1HKC A;  4H0O A;  2BTF A;  3I8B A;  3A0I X;  3VEO A;  3ATU A;  1HJO A;  4A61 A;  3GE1 A;  4CZJ A;  3IMX A;  4FOI A;  2PBD A;  4JN4 A;  3HZ6 A;  4BG8 A;  2FXU A;  3UKU B;  1RDW X;  3VOV A;  4FWP A;  4XH1 A;  1JCG A;  3WXK A;  3A5N C;  3UKR B;  3UKU A;  1NGB A;  3LM2 A;  5BRD A;  4B1X B;  3KZB A;  3MK6 A;  2D0O A;  3UKR A;  4K43 A;  2FSK A;  4IJA A;  3ZX0 A;  2UYT A;  3JXU A;  5AQO A;  3EZW A;  2GEM A;  1GLD G;  3JS6 A;  2D4W A;  1LOT B;  3FZL A;  5JLF A;  3H46 O;  3C7N A;  2QXL A;  1HLU A;  3BF3 A;  3VEZ A;  4H03 B;  2P9P A;  4K25 A;  3ZET B;  1NGA A;  3QFP A;  4PKG A;  2E1Y A;  3HTV A;  3VGM A;  5AQG A;  4IXC A;  4GNI A;  4RCH A;  4HTL A;  4BRD A;  2D1K A;  3O6W A;  2Q36 A;  4JNE A;  4CJ7 A;  4FPB A;  1QQO A;  1Y64 A;  1GLE G;  3EL2 A;  2PAV A;  3EO3 A;  2I7P A;  4EFH A;  5JLH A;  3O4W A;  4A2A A;  3CJA A;  3LDN A;  3O08 A;  4H0Y B;  3FZH A;  4BR7 A;  4H5V A;  5BPN A;  1KAY A;  3MN6 A;  1BA1 A;  3W3D A;  1BDG A;  4BGB A;  3VER A;  3D2F B;  5KQ8 A;  2DPN A;  4H5R A;  4MLE A;  2QW9 A;  3CJ1 A;  4DB3 A;  5AQX A;  2WUS A;  5KPR A;  4BR2 A;  1SAZ A;  1BO5 O;  1BU6 O;  3P4I A;  2AA4 A;  3H1Q A;  4CD3 A;  2AP1 A;  5AQS A;  3WXL A;  1BUP A;  4BGA A;  4CZK A;  1MA9 B;  4FOE A;  2A40 A;  1DGK N;  4FWN A;  3ZX2 A;  1NMD A;  1ZXO A;  3ZX3 A;  2P9U B;  1MDU B;  5AQZ A;  1ATS A;  4ISF A;  4A2B A;  3SK3 A;  4AM6 A;  5AQQ A;  5JMV A;  3VF4 A;  1V4S A;  3SJH A;  2P9U A;  1ATR A;  3U9Z A;  2H3G X;  1E4F T;  3H3O B;  4BRP A;  4PL7 A;  4FSV A;  5AQM A;  2GUP A;  1MWK A;  1U2V B;  1T6C A;  4WQ4 A;  2NRH A;  2BUP A;  2E88 A;  5ADX A;  2YCH A;  2HOE A;  1U2V A;  2GWK A;  5EVZ A;  3GL1 A;  2W41 A;  1QZ5 A;  4FWK A;  1T6D A;  4M7X A;  1QZ6 A;  2QM1 A;  2F9T A;  3AY9 A;  2GTD A;  3GBT A;  1GLA G;  3EKU A;  1X3M A;  4BQL A;  2ZF5 O;  3VF2 A;  3A5M C;  4H0T B;  1P8Z A;  2YHY A;  4ISE A;  2GEL A;  3IUC A;  4PL8 A;  2IIR A;  4GY2 B;  3VPZ A;  2YHW A;  3I33 A;  4NB4 A;  1NGF A;  2YHX A;  1X9J A;  3QB0 A;  3FGU A;  5AFU A;  2Q0U A;  1IJJ A;  1JCE A;  4CZL A;  3U9D A;  4BC4 A;  1TYQ B;  4IZ9 A;  4Y0W A;  2QWM A;  3U8X A;  4J8F A;  1S3X A;  1ZC6 A;  2V52 B;  3M1F A;  4B1Z A;  5AQP A;  5BN8 A;  4C23 A;  1E4G T;  4BRA A;  3QIC A;  1D4X A;  2HMP A;  1GLC G;  2FSN A;  2Q2R A;  4BC2 A;  1NGH A;  3CHW A;  4CBW A;  3O1B A;  4H0X B;  4XH4 A;  5EY4 A;  4QS7 A;  2QWP A;  4BRE A;  2YJE A;  5BN9 A;  1CZA N; 
#chains in the Genus database with same CATH topology
 1BIU A;  4F4K A;  1J6Z A;  1ASW A;  4Z94 A;  3DRP A;  1LCU A;  1N36 K;  1C6V A;  5AQY A;  1GOA A;  4NCG A;  2DY4 A;  3J7Z O;  2VWJ A;  1LV5 A;  3LP2 A;  3ZT4 A;  4CBU A;  4DTU A;  1L5U A;  5LMN K;  2KHO A;  3F2K A;  4M45 A;  1QHT A;  3LPU A;  3R6M A;  3TAR A;  1CLQ A;  4DTX A;  3K9K A;  4KHY A;  3SAH A;  3LDO A;  4BDZ A;  3MEC A;  3VF6 A;  3BEX A;  3WUH A;  3D2F A;  3H45 C;  1EQY A;  3TPQ A;  3KJV A;  3ULE A;  4CW7 B;  3O9U A;  1S6Q A;  3HK2 A;  4HUF A;  3NGI A;  3DXK B;  3Q7B A;  1IKW A;  2UUA K;  3VQ8 A;  1U4B A;  2FF6 A;  3ZYY X;  5C2F A;  1RIL A;  3RMC A;  3HJF A;  4KI6 A;  1W2B M;  3ATV A;  3VQB A;  2IVP A;  4QAG A;  1TKX A;  3MEG A;  4CF2 A;  3VEW A;  5GIO A;  4OPK A;  4JAX A;  3ENB A;  3CCR N;  1QSL A;  4BRI A;  1KTQ A;  4HTU A;  5JS1 A;  2HBL A;  3AVG A;  3J7A P;  1XHX A;  5GIP A;  4FJX A;  2WFB A;  3SMP A;  1BI4 A;  3AO3 A;  4CEO A;  3IS9 A;  5BPL A;  1D9F A;  5BPM A;  2VG6 A;  5AZJ B;  4CEC A;  3NGZ A;  3SQ0 A;  4Y1C A;  2Q0R A;  3C65 A;  5M1O A;  4BC3 A;  5IWA K;  3AV9 A;  1QVF M;  2P9N A;  3ID6 A;  3V1O A;  5H1S Q;  4YHH K;  4ISG A;  4DFJ A;  1VQL N;  4JI3 K;  1XC9 A;  3I0R A;  4KHN A;  4KH6 A;  4E72 A;  3WQU A;  1D5A A;  1QS4 A;  3VQA A;  1IKV A;  2RKI A;  1N34 K;  4BRH A;  3B6O A;  3AGR A;  1NK7 A;  4A57 A;  4BE1 A;  3OS2 A;  3HBT A;  3SLC A;  2JWK A;  1TYQ A;  1BG3 A;  3F73 A;  1X9M A;  2ASM A;  3M8S A;  2QK9 A;  3AA2 A;  2WOM A;  1IO2 A;  1WOQ A;  3VQP A;  3DLE A;  1VQ6 N;  1TAU A;  5ELZ A;  1ZBI A;  3OVN A;  3SBT A;  3BDP A;  4B9L A;  1SL2 A;  4LF5 K;  1LAW A;  1U47 A;  2NRT A;  2KTQ A;  3GDQ A;  2ETJ A;  5KI6 A;  4FZY A;  3R3L A;  5GAD P;  4BDY A;  1HNV A;  4CED A;  4OKK A;  1D8Y A;  4N47 A;  3FFK B;  1Q82 O;  4B8A B;  4WCE L;  3AA4 A;  3WXJ A;  4AF1 A;  1S1U A;  2KFN A;  2CGL A;  4XIU A;  4EHT A;  2RE2 A;  1NGI A;  5C25 A;  2E2O A;  2E8A A;  4CFC A;  3TAQ A;  1RT2 A;  5HLF A;  3LM9 A;  3VET A;  2O8F B;  5J2N A;  4CHZ A;  3KVG A;  4CJL A;  4AH9 A;  1VQP N;  1A5X A;  1WSI A;  3KLF A;  2VWB A;  3H6E A;  5I42 A;  4IEI A;  3V1R A;  4FO0 A;  4DHY A;  4DQ8 A;  4XEI A;  1CZ9 A;  4KHU A;  3V1Q A;  1C1B A;  3DWL A;  4B1V A;  1BGX T;  2O4I A;  2OPP A;  4DSL A;  5AZI A;  1YIT N;  2P9S A;  3PV8 A;  2HF3 A;  2XY7 A;  3WXI A;  4Z4E A;  1ASU A;  2FF3 B;  2VQF K;  4Z4C A;  1RT1 A;  3ID8 A;  1HR0 K;  4CJK A;  2P9L A;  3CER A;  3OY9 A;  1WBD A;  1HKG A;  3SMS A;  4HUE A;  3CQY A;  1HPM A;  2AJQ A;  4M63 C;  4C1N K;  2PZS A;  2NRV A;  1NM1 A;  3ZSZ A;  1Q9X A;  1IH7 A;  1S22 A;  1JL1 A;  3QLH A;  1SL0 A;  4MFB A;  3NFA A;  1YTU A;  1NGE A;  5E26 A;  4CZG A;  1EP4 A;  3AGK A;  3RMA A;  3GG4 A;  1U04 A;  4E3S A;  1H1V A;  3CIP A;  4YDU C;  3V4I A;  4O5B A;  4HCC A;  4NXN K;  3V81 A;  4LH5 A;  3AVB A;  4H8K A;  3M5R A;  3OYG A;  3DLB A;  4OLA A;  5AQT A;  2F4V K;  2O8B A;  5HBM A;  3IDH A;  4PQU A;  5I9E B;  4B9Q A;  1RBU A;  1EWQ A;  3ZSQ A;  3H08 A;  3TWH A;  3TU5 A;  2YNH A;  3RMD A;  4FL9 A;  2HVH A;  1KCF A;  1NK4 A;  1R59 O;  4CGD A;  3NH0 A;  4DV0 K;  3RVC A;  2OAN A;  4CEZ A;  3K57 A;  1R0A A;  1HMV A;  4YOR A;  1VRU A;  5LJV A;  4FJH A;  5AQH A;  3CCU N;  2A1S A;  3CCV N;  4H0O A;  1X9S A;  1NG9 A;  2BTF A;  1HJO A;  4N5S A;  4CJ4 A;  3S3N A;  4CJR A;  2XY6 A;  4FOI A;  2PBD A;  2Z1G A;  3HZ6 A;  4W5T A;  2UXB K;  5CR4 A;  3E01 A;  1J9A A;  3JYT A;  4CIE A;  3CM6 A;  5M1K A;  3PSF A;  3WXK A;  5BRD A;  4BDP A;  1TK8 A;  3MK6 A;  1RCH A;  4O44 A;  3UKR A;  1WNS A;  4ILH A;  4IJA A;  4CGH A;  2UYT A;  3KIO A;  1NJW A;  3HVT A;  4DTN A;  1OH8 A;  3HPG A;  5GAG P;  3SAG A;  3L2W A;  1OH6 A;  3H46 O;  3C7N A;  1TKZ A;  1N5Y A;  3O3F A;  3VGM A;  3E9L A;  3CCQ N;  1VSI A;  4JRQ A;  4BRD A;  2OCE A;  3O6W A;  1VSF A;  4FPB A;  2O8D B;  1RT3 A;  3KWI A;  4I9Q A;  3EO3 A;  3EL2 A;  1NU0 A;  3O08 A;  4H0Y B;  1LWF A;  4W5Q A;  1KAY A;  2HBK A;  3MN6 A;  1JLE A;  1YHQ N;  1BDG A;  3NF7 A;  1QSS A;  4IG0 A;  4MLE A;  4DS4 A;  4DSE A;  5AQX A;  1WSF A;  1ZBL A;  4BR2 A;  3CG7 A;  4ZTJ A;  4B3S K;  1DTT A;  3D45 A;  3PUF A;  3S9H A;  2AP1 A;  3THY B;  4BGA A;  3PLA A;  1MA9 B;  5D3G A;  4AIL C;  4IFV A;  3HST B;  2QI2 A;  4JI5 K;  3I55 N;  1NMD A;  1XHZ A;  1MDU B;  1ATS A;  4A2B A;  3KTQ A;  5AQQ A;  3NH1 A;  3CC2 N;  1KLN A;  2GUP A;  1MWK A;  1A5V A;  2BUP A;  2E88 A;  4IOC L;  3KLG A;  3CYM A;  1QQC A;  2YCH A;  4FJL A;  5CZ1 A;  4FLX A;  4LFB K;  3QEV A;  3L2U A;  1QVG M;  1X1P A;  2HBM A;  1WSJ A;  4DQR A;  2W6L A;  3WNE A;  1T6D A;  2GUI A;  4M7X A;  4RW4 A;  3K5M A;  2ZJP L;  1VHX A;  2F9T A;  3ULD A;  2GTD A;  2O8E B;  2I5J A;  4Q0B A;  4F2S A;  4FXD A;  4KO0 A;  2P5O A;  3NVK A;  3QEI A;  4AHU A;  5AFU A;  1IJJ A;  3AVL A;  4RW8 A;  1BIS A;  3N4P A;  4DTJ A;  4BC4 A;  3ZSX A;  2Z1J A;  4Y0W A;  3MAQ A;  4M3Y A;  4QCL A;  1S3X A;  1NJZ A;  5BN8 A;  4C23 A;  4FLW A;  1RTH A;  3QIP A;  5LL6 Z;  4BRA A;  3QIC A;  4PA1 A;  2FSN A;  2Q2R A;  4JKG A;  4BC2 A;  3NF6 A;  4ZTF A;  1SUQ A;  2QKK A;  1NGH A;  4CBW A;  3O1B A;  3K59 A;  3TI0 A;  4XH4 A;  1TVR A;  3HP9 A;  5EY4 A;  1RDB A;  1UOC A;  4NCB A;  4CF8 A;  5HL7 L;  3V9X A;  1CZA N;  3RWU A;  3CCJ N;  2HVI A;  3GOI A;  4E7K A;  3ENH A;  1GLJ O;  1TUU A;  4CGG A;  4MQ3 A;  3L3V A;  1NOY A;  3QNO A;  1Q81 O;  1NJI O;  4FJM A;  4BRC A;  4FWQ A;  2W00 A;  1TAQ A;  4DV1 K;  4B1Y B;  3HXM A;  3MN9 A;  1ATN A;  3TAM A;  4FYD A;  5C0Y A;  4CJ5 A;  1BOT O;  4LH4 A;  3F9K A;  4RG8 A;  4DV5 K;  3CQX A;  5AQU A;  2V7Y A;  3KKS A;  3LL3 A;  2NLX A;  3HRG A;  4HVJ A;  2NRW A;  4O0J A;  2V7Z A;  1RBV A;  1BQM A;  4CJW A;  4WQ4 C;  3A8Y A;  3ZSY A;  1JXE A;  2HF4 A;  2PYL A;  5JS2 A;  4J2E A;  2O8C A;  4DLG A;  3DXK A;  4BRL A;  2CH6 A;  1TKT A;  3D2E B;  1G99 A;  2B4J A;  5C2D A;  4Q5V A;  3PX6 A;  2DFH A;  1KVB A;  1YI2 N;  3SV3 A;  5AQK A;  1XNQ K;  4N56 A;  3DOL A;  2ZJR L;  4FPA A;  4JS5 A;  1SKW A;  3HT3 A;  2F7T A;  3OJU A;  4E0D A;  1QQN A;  5J1E A;  1B9F A;  1ZBF A;  5AQN A;  1KXP A;  5KQD A;  2E2N A;  1KD1 O;  1U6Z A;  4FK4 A;  3G6E N;  3CI5 A;  3U3Y A;  4M7Y A;  4E7I A;  1OH5 A;  1QE1 A;  5HRN A;  3F5T A;  1DEJ A;  4CZE A;  4DR2 K;  2CH5 A;  1RTJ A;  1MWM A;  2B6A A;  5A2Q O;  4CGI A;  3AVN A;  3MWT A;  4OJR A;  4IBN A;  4DR7 K;  1NGJ A;  3QO9 A;  4DCH A;  2EHG A;  4B9M A;  1JLB A;  4BRQ A;  3B8A X;  3K58 A;  4JK7 A;  1C0U A;  3EZ5 A;  4E7J A;  4FJK A;  1SL1 A;  5CYM A;  2ZQB A;  3ZEU B;  4JD2 B;  3FLC O;  4E89 A;  4YDU A;  5BRE A;  3V9U A;  4WFB L;  1YUW A;  2RN2 A;  3WNG A;  4B9S A;  5FRN A;  4FWS A;  3CF5 L;  2D0A A;  1Q86 O;  4FZZ A;  5J2P A;  3CME N;  1KC8 O;  4CFA A;  5F1X A;  3KD5 E;  4ILJ A;  2B5J A;  3MDQ A;  4B9V A;  3CJ7 A;  5FPN A;  4DTM A;  3OYM A;  3WEE B;  1N33 K;  4ID1 A;  5C12 A;  4CE9 A;  3AO2 A;  4A62 A;  3O80 A;  3AVK A;  2X74 A;  3G10 A;  4DV3 K;  3EN9 A;  1JKH A;  1HNZ K;  4FLY A;  1NKE A;  2EWS A;  5DM7 L;  3OBW A;  3BGR A;  5CHI A;  4KTW A;  5BRH A;  2P9K B;  4CEQ A;  4WFN L;  4FWM A;  3L4I A;  4LF6 K;  4CD1 A;  4JHD B;  2P9P B;  3AA3 A;  1NGC A;  3VQD A;  4LF7 K;  3CET A;  1JLA A;  2FBX A;  4CZH A;  2LSN A;  5KGW A;  1VSE A;  4PKH A;  1S6P A;  4MO5 A;  2HHW A;  1VQ5 N;  1GOB A;  2FSJ A;  2O8F A;  1S1V A;  2HHH K;  4FLV A;  4FVM A;  1SQK A;  4DR1 K;  1K6Y A;  5C24 A;  4K41 A;  4B1U B;  3THX B;  1XQS C;  4O5F A;  3SAF A;  2BAN A;  5EU7 A;  2QXF A;  2YKN A;  3VQ9 A;  3C94 A;  2ITM A;  3MCP A;  1IBM K;  4B8C A;  2WC9 A;  1KAZ A;  3CM5 A;  3TR8 A;  5F0X A;  1M90 O;  4RWT A;  4WQ5 C;  1C0F A;  1GLL O;  4BVO A;  3O3G A;  2NUB A;  3MN5 A;  3KKR A;  5JIC A;  3OYA A;  1X3N A;  1VQ7 N;  2G8F A;  1VRT A;  4YOX A;  3LZI A;  3EKS A;  2ASP A;  1WB9 A;  4DQQ A;  4JKF A;  4FJG A;  4KTZ A;  1VSM A;  4BVP A;  2OZM A;  2IS3 A;  3RMB A;  4BWM A;  4IO8 A;  4M3W A;  2X6N A;  5KRT A;  5EXW A;  3HO1 A;  2D0B A;  3AVM A;  1S1T A;  2VYP A;  2OPQ A;  3U3G A;  4LY7 A;  4CFB A;  1OKJ A;  3DRR A;  2V51 B;  3HI0 A;  4KPY A;  3LP0 A;  1SS6 A;  4AHT A;  1JLG A;  1WAJ A;  3FZM A;  3NBP A;  4DFM A;  4CHO A;  3ZT1 A;  3G25 A;  4H5T A;  1ESV A;  4U67 L;  3O9R A;  3WT0 A;  1SV5 A;  4BR5 A;  3BF1 A;  4JV5 K;  1HUX A;  1LWE A;  2BE2 A;  5AFU H;  2W42 A;  1TK5 A;  2W40 A;  4CJV A;  3QFU A;  3AVI A;  2FBV A;  4FJ5 A;  4MDB A;  3ENO A;  2R7Y A;  1O1W A;  2E2P A;  4JRP A;  4DV7 K;  4BRF A;  4LSL A;  4E1J A;  3U4L A;  4EHU A;  4AHC A;  3VGL A;  3C95 A;  2C1I A;  1XNR K;  1NK5 A;  1IBL K;  2QKB A;  3QER A;  4AM7 A;  3QEP A;  4LD0 A;  1NJY A;  1XC3 A;  3VQ6 A;  3LWM A;  3WXM B;  4RW7 A;  3THW A;  1TKD A;  1RTD A;  3I8B A;  3A0I X;  3ALY A;  3UIQ A;  3IMX A;  4JN4 A;  1ZYQ A;  1HPZ A;  1VQK N;  4DR5 K;  2PFU A;  4EZ6 A;  4BG8 A;  3UKU B;  4OPJ A;  4BAC A;  3VOV A;  4CES A;  3U6F A;  1JCG A;  4ELU A;  3RRG A;  3O9Q A;  2OYQ A;  4YOW A;  4B1X B;  5CYQ A;  4B08 A;  3NHG A;  4K43 A;  3SJJ A;  3MX2 A;  2FSK A;  1XMQ K;  1RBT A;  3ZX0 A;  1UWB A;  4DTR A;  3TTF A;  2HHX A;  1L3U A;  2JWL A;  1SKR A;  1NGA A;  3QFP A;  4PKG A;  3OYI A;  2E1Y A;  3HTV A;  1IKX A;  5AQG A;  3SI6 A;  1ZBH A;  1TL3 A;  4TSX A;  4IXC A;  4RCH A;  3IRX A;  4HTL A;  2KW4 A;  3SUQ A;  2UU9 K;  2D1K A;  3DLK A;  4JNE A;  4RW9 A;  4GKK K;  4K8X A;  1QQO A;  1D9D A;  1GLE G;  2F8T A;  1C1C A;  2PAV A;  2GX9 A;  1U45 A;  3EE8 A;  4AHS A;  3CJA A;  2O8D A;  3HOS A;  1VQM N;  1F21 A;  2P1J A;  5DM6 L;  3CC7 N;  4DR4 K;  4RW6 A;  3SZ2 A;  2HB5 A;  3SUO A;  3VER A;  3D2F B;  5KGX A;  3SV4 A;  2QW9 A;  4OKJ A;  4KFB A;  5KPR A;  3G0Z A;  4FW2 A;  5C42 A;  4KHP K;  1HNW K;  1BO5 O;  3V9S A;  4KRE A;  2OTJ N;  4A5B A;  4CD3 A;  3TTC A;  4IKF A;  3C6A A;  1W7A A;  3I8D A;  1T05 A;  4DR6 K;  1JLF A;  5AQS A;  4CZK A;  4FOE A;  2A40 A;  4FWN A;  3ZX2 A;  3THY A;  2RF2 A;  3WNF A;  1B9D A;  2F8S A;  2P9U B;  4DWI A;  1G15 A;  2OTL N;  3OYD A;  4AM6 A;  1VQ8 N;  3VF4 A;  3AVA A;  1ATR A;  1T7P A;  2H3G X;  4IEE A;  4PL7 A;  4FSV A;  2Y1I A;  4WQ4 A;  2X78 A;  1YJN N;  1RTI A;  4JI4 K;  3CMA N;  1JJ2 M;  3NH2 A;  5KRS A;  3AA5 X;  1TK0 A;  4DSJ A;  4E1M A;  1BI4 B;  3O9S A;  4FWK A;  4A5A A;  5MLC Q;  4CER A;  3CFR A;  1RBR A;  3KK7 A;  4OLB A;  4BE0 A;  3VQ4 A;  4QOZ B;  3KD1 E;  1GLA G;  3EKU A;  1Z25 A;  4BE2 A;  1L3T A;  3VF2 A;  2O8E A;  3T69 A;  3VQC A;  2BH1 A;  1I94 K;  4KTQ A;  2YHY A;  4ISE A;  1YJW N;  2GEL A;  2KZM A;  1C0M A;  3VPZ A;  3TSU A;  4NB4 A;  1NGF A;  4LF8 K;  3OBY A;  1X9J A;  5HRS A;  1JCE A;  3V9Z A;  1TYQ B;  3TAP A;  3U8X A;  3LPT A;  4N41 A;  1ZC6 A;  2V52 B;  4HUG A;  1VQN N;  1IV0 A;  1L3V A;  1E4G T;  3PX0 A;  4FLU A;  3CHW A;  4YOY A;  4BY9 C;  3B6P A;  4H0X B;  1J53 A;  4JKB A;  4FJI A;  1BCM A;  4I2P A;  2QWP A;  4CI6 A;  1CXQ A;  4KHQ A;  3G71 N;  1NGG A;  1I39 A;  2GBZ A;  4JI7 K;  2G8V A;  3DJC A;  3ZET A;  2G8K A;  1W97 L;  1ITG A;  4YY3 K;  4CHQ A;  3HSC A;  5AR0 A;  4LFA K;  4M3R A;  4Z4H A;  4DU4 A;  1TV6 A;  2QWL A;  2FBY A;  3G4S N;  1S5J A;  2HHV A;  4NXM K;  2IAJ A;  3O1W A;  4IOX A;  1WSH A;  3ASM A;  3K0S A;  3AAR A;  3CD6 N;  5KPZ A;  3DM2 A;  4CHP A;  2OZS A;  4DTO A;  3J80 O;  4E7H A;  5AQL A;  3RRH A;  4ICL A;  2CGK A;  5AQV A;  1U49 A;  3L6Q A;  4H0P A;  1S9E A;  4JI6 K;  5AZI B;  3SQ2 A;  1YT3 A;  1TUY A;  4I6M B;  1RDD A;  4OGC A;  1HYS A;  3CCS N;  3HPO A;  4JK9 A;  5LJW A;  3VGK A;  2Q97 A;  4CBX A;  1EX4 A;  4JS4 A;  3Q7C A;  4KRF A;  3FE1 A;  1T44 A;  4KI4 A;  3D2E A;  3AAQ A;  3UE5 A;  3L4Q A;  1B92 A;  3OYL A;  2A3Z A;  3H3N O;  2E6L A;  5GIN A;  3J8A A;  4WQ5 A;  4O8U A;  5FPD A;  4DR3 K;  4NO7 A;  5BRF A;  3NF9 A;  4ILG B;  4CFD A;  2YHB A;  4Y1D A;  4CIF A;  2XHB A;  4CJF A;  1SZ2 A;  3OYH A;  3AO5 A;  1RDC A;  3T3F A;  1QHA A;  3RSE B;  1HRH A;  4DV4 K;  3VEN A;  3TAN A;  5LY3 A;  4KB1 A;  2F96 A;  3DLG A;  3T1Y K;  3WNH A;  2HBJ A;  3K9J A;  1Z6R A;  3C6H A;  3VQQ A;  4DFP A;  2A41 A;  3VA3 A;  2UXC K;  2YKM A;  3FFI A;  3D0P A;  4X66 K;  4H0V B;  2ASO A;  2VGN A;  3ZEU A;  4CJ3 A;  1HJR A;  4BRM A;  4HHT A;  4CGJ A;  1RT4 A;  3R8E A;  3DAW A;  4E1N A;  3AVH A;  3VEY A;  1HQE A;  5AQI A;  2GWJ A;  2HNZ A;  4DU3 A;  1N8R O;  3FR0 A;  1LAV A;  1GOC A;  2HHT A;  1JCF A;  1WUA A;  4MDA A;  3EE9 A;  4NCA A;  1J5E K;  3VTI A;  5IT9 O;  3M3Z A;  3KLI A;  2A42 A;  3WEE A;  3QBX A;  3DOK A;  1V4T A;  2E6M A;  3QEX A;  2QEX N;  4C8K A;  4H4M A;  1C1A A;  2OPR A;  4OPH A;  4BR4 A;  5TKW A;  3TAE A;  1FKO A;  2EX3 A;  3DXM B;  1FW6 A;  5HOO A;  1NGD A;  1Q8I A;  3C0B A;  3C7N B;  1NKC A;  1JXB A;  2ZGZ A;  2YNF A;  2QWO A;  5FRO A;  4EAH D;  1DLO A;  2P9K A;  3OTO K;  4DSF A;  2FLO A;  1K8K B;  4M3U A;  4GW6 A;  3EY1 A;  4JHD A;  4CK3 A;  3MXJ A;  4LC9 B;  4BR0 A;  1RT6 A;  3SNN A;  4EZ9 A;  2E2Q A;  4B1W B;  1UAX A;  4B9U A;  2HMI A;  4K8Z A;  2VCP A;  4WFA L;  3THX A;  3ITH A;  1QQM A;  2KKZ A;  4CJS A;  4OVL A;  4O55 A;  4AHR A;  1C0G A;  3O8M A;  3MCA B;  5BR8 K;  2IGI A;  4Z4I A;  2P9I B;  2JLE A;  3V6D A;  4BG9 A;  3L2Q A;  5E41 A;  1UA0 A;  4FM1 A;  3QML A;  1RGI A;  3P83 D;  5E84 A;  2ZJQ L;  1VQ4 N;  4HWI A;  3RR8 A;  5M1P A;  4JEP A;  1VQO N;  3CCE N;  2HHS A;  4B3T K;  1N32 K;  4BQZ A;  3L2R A;  4DV2 K;  4JLH A;  3EYZ A;  3C6U A;  3KLE A;  3FZK A;  1CZB A;  1XMO K;  2ZWH A;  3QBW A;  3PIP L;  2PYJ A;  1T8E A;  4XH5 A;  4CIG A;  3PIO L;  2CGJ A;  5M1N A;  1KFS A;  4R79 A;  1KVC A;  5AZJ A;  1W9H A;  4V19 S;  4DG1 A;  1YVU A;  4YNQ A;  3KHY A;  5HRR A;  1YAG A;  2IVN A;  4BRO A;  3BZC A;  1GLF O;  3OA9 A;  3M6G A;  4KHS A;  2KLA A;  2NRR A;  3OYJ A;  3LAK A;  4CHN A;  2DFE A;  3AAP A;  3S3M A;  3N4Q A;  1VSJ A;  4UY8 O;  3NVM A;  1WAF A;  3QET A;  3WQT A;  3SPZ A;  2A5X A;  4LF9 K;  5KPT A;  4M3X A;  4IFE A;  2HST A;  4CF0 A;  5CY4 A;  3VQE A;  2KZZ A;  1VSD A;  3LAN A;  4DQI A;  3ZCM A;  3LDS A;  2OA8 A;  1ZBU A;  3VEO A;  3ATU A;  4CZJ A;  1K8A O;  3QIO A;  4JI8 K;  4JKA A;  2VGM A;  2VG5 A;  3OJS A;  4CVN E;  4DFK A;  1MU2 A;  3O4N A;  2XRI A;  2QTD A;  4F3T A;  2FXU A;  4CEA A;  4FWP A;  2C1G A;  2UXD K;  1OVQ A;  3A5N C;  3MED A;  3UKU A;  3LM2 A;  4AHV A;  1UA1 A;  3KZB A;  1S1W A;  1VQ9 N;  5J2Q A;  4N76 A;  3AVF A;  4GKJ K;  5AQO A;  3EZW A;  4X65 K;  2KQ2 A;  4F2R A;  1LOT B;  3E66 A;  3MWP A;  2QXL A;  4CF1 A;  1Q7Y O;  1HLU A;  3BF3 A;  4NLB A;  3VEZ A;  4H03 B;  4K25 A;  1NK8 A;  2Q3S A;  4DSK A;  3O3H A;  4YOV A;  1FJG K;  4K0K K;  4AQY K;  1T03 A;  3SCX A;  2Q36 A;  4C8N A;  3LP3 A;  3ZT3 A;  1N6Q A;  1Y64 A;  5I3U A;  1C0T A;  1J54 A;  3T19 A;  4EFH A;  3O4W A;  4JKC A;  4A2A A;  4CEE A;  3FZH A;  1WBB A;  4KV8 A;  4EP5 A;  4BR7 A;  1NMN A;  1BA1 A;  3W3D A;  4FZX C;  3HP6 A;  3IG1 A;  4GMJ B;  4BGB A;  5KQ8 A;  2DPN A;  4H5R A;  3CJ1 A;  4BWJ A;  3J81 O;  4JI1 K;  4WE1 A;  3AO1 A;  4OPA A;  3CPW M;  1YF5 L;  1SAZ A;  1BU6 O;  3P4I A;  4FJJ A;  2AA4 A;  4LFC K;  2O8C B;  3LWL A;  3C6T A;  4GVE A;  3E9P A;  3P1G A;  4DQP A;  4B3R K;  3WXL A;  2YHA A;  5CZ2 A;  3CCL N;  4DUY K;  3SBG A;  1DGK N;  4F3O A;  1ZXO A;  3ZX3 A;  2ITG A;  3LAM A;  2DTU A;  5JVH L;  2VG7 A;  4FM0 A;  1VAZ A;  4W5N A;  3SK3 A;  3T7Z A;  5JMV A;  1V4S A;  3SJH A;  2P9U A;  3QNN A;  2IOC A;  3CXC M;  3U9Z A;  3OYN A;  4BRP A;  5AQM A;  1LW2 A;  1NOZ A;  1T6C A;  1U2V B;  3MEE A;  5ADX A;  2HOE A;  3AVJ A;  1KSP A;  2GWK A;  5EVZ A;  1KFD A;  3DI6 A;  2IDO A;  2W41 A;  3LAL A;  4CGF A;  4NYF A;  4H4O A;  2E4L A;  5HRP A;  2RHK A;  1QZ6 A;  4DF8 A;  4O0I A;  3NCI A;  1XWL A;  4DF4 A;  1KLM A;  1FXX A;  1X3M A;  4BQL A;  3A5M C;  4H0T B;  1P8Z A;  2O4G A;  4JKH A;  2IC3 A;  4KH4 A;  4NYN A;  3QB0 A;  3FGU A;  4JK8 A;  2Q0U A;  4JI0 K;  2HND A;  4XJX A;  4CZL A;  4DU1 A;  1LW0 A;  3HL8 A;  5K14 A;  3ZSW A;  3SYZ A;  2QWM A;  5LMU K;  4J8F A;  2NRZ A;  3PSI A;  5AJ3 K;  3HPH A;  3M1F A;  1NKB A;  4B1Z A;  5AQP A;  1IKY A;  5HRO A;  4O4G A;  3NDK A;  4DTS A;  3TAB A;  4J2A A;  3L8B A;  4DUZ K;  2YJE A;  5BN9 A;  4C8L A;  3PO5 A;  4OX9 K;  4ELV A;  4IDH A;  1U48 A;  2HW3 A;  4H5N A;  1BCO A;  3QDK A;  1BWF O;  3ZT0 A;  4YOU A;  1WSE A;  3ISN C;  4GVM A;  4CJU A;  2Z1I A;  4CJE A;  4PKI A;  3ZLJ A;  4E19 A;  3L3U A;  3E1Y A;  5B8H A;  5C15 A;  2Q31 A;  2WBN A;  5FDL A;  3S3O A;  4LSN A;  4PY5 A;  3ULE B;  2QWR A;  4I7F A;  4KBO A;  2Q1N A;  4CK1 A;  2QWQ A;  2HHQ A;  4IOA L;  2HNY A;  5GAE P;  3HYF A;  2E20 A;  5AQR A;  3K5O A;  3K5N A;  3D6R A;  4M3T A;  2G8W A;  5BR9 A;  4I6M A;  4JKD A;  2BDP A;  3CYG A;  4BC5 A;  3IFR A;  3MMV A;  1O13 A;  3MX5 A;  5EOY A;  4DKW A;  1HQU A;  3ZSV A;  1Q18 A;  4BR9 A;  3CJB A;  4NLC A;  4FWO A;  1RT5 A;  3LDQ A;  5FPM A;  4KAZ A;  3AVC A;  3LDL A;  1CXU A;  2E5L K;  4OO1 J;  3SUN A;  4FLT A;  4EP4 A;  1BL3 A;  4IJN A;  5TKY A;  1BQN A;  2JGU A;  4JYA K;  1HNX K;  5EX5 A;  1S1X A;  2I7N A;  4CZF A;  4GV6 A;  4CK2 A;  2OPS A;  3KWG A;  2YJF A;  3R9P A;  1S72 N;  1RBS A;  3RTV A;  3H1V X;  3TAG A;  3S41 A;  1NBW A;  3FZF A;  2VWK A;  3RSE A;  2P9N B;  4GV9 A;  4O8K A;  4HCB A;  1S9G A;  1X9W A;  3OYK A;  5KTQ A;  1YXQ A;  3P5J A;  4L3Q A;  4MO4 A;  1IBK K;  1QSY A;  2NZT A;  3HM8 A;  3D7E O;  1YIJ N;  3SPY A;  3L0Q A;  4YFU A;  3BP8 A;  3OS0 A;  4CHY A;  1QTM A;  2RPI A;  3SQ1 A;  2HHU A;  3I0S A;  3VQ7 A;  3HVR A;  4FK0 A;  4MLH A;  4J2D A;  4CZI A;  5F2R A;  2G8I A;  2E1Z A;  5DMR A;  3VMF B;  4M3Z A;  4FVU A;  1Q9Y A;  3THW B;  5T7B A;  1HX1 A;  2ZGY A;  1DTQ A;  2F9W A;  1JL2 A;  3VEX A;  3MXM A;  3S5T A;  3O5B A;  4EIA A;  4LF4 K;  4FJ8 A;  4G9Z A;  4Z0U A;  1NK6 A;  1KRP A;  3TSQ A;  4H5W A;  2Y1J A;  4IWV A;  4K42 A;  4OGE A;  1Z05 A;  3O9T A;  1LWC A;  3DXM A;  3BY5 A;  4FWL A;  3VN5 A;  2VQE K;  2YNI A;  2FC0 A;  3W0L A;  1RFQ A;  4IO9 L;  2ATQ A;  1A5W A;  3TTD A;  3QIN A;  1BHL A;  2QWN A;  4IDK A;  1K8K A;  4F9O A;  1ZBS A;  1NLV A;  4C8M A;  4CJT A;  5AQW A;  1GLB G;  5HP1 A;  3NMU A;  3BUZ B;  2WTU A;  3AO4 A;  3DLL L;  3OHR A;  2A6A A;  4DV6 K;  5FRM A;  4CZM A;  5CE3 A;  3UB5 A;  1I3A A;  3KK1 A;  2P9S B;  3VEV A;  2D0P A;  1HKB A;  3CFO A;  1FKP A;  1NWK A;  4U7B A;  4KHW A;  1RT7 A;  4PWD A;  1BA0 A;  2FBT A;  4B3M K;  2P9I A;  3V9W A;  3P31 A;  3OYE A;  1FK9 A;  2P9L B;  3OW2 M;  5AQJ A;  1EXQ A;  1REV A;  4ID5 A;  1EWR A;  3THV A;  4RTF D;  5SZT A;  4B3O A;  4J2B A;  4JI2 K;  5ADX H;  1WSG A;  5M1Q A;  1NK9 A;  2KFZ A;  3VES A;  3ZSO A;  4OKE A;  2DFF A;  1TL1 A;  3QES A;  2WON A;  4ZHR A;  3IAY A;  4QS9 A;  4CJP A;  4W5R A;  3DYA A;  3CJC A;  4QS8 A;  4Z4G A;  2G8U A;  2XY5 A;  2IVO A;  4CEF A;  3KLH A;  4BRN A;  2W6K A;  3OYF A;  1VSK A;  1YVN A;  3OYC A;  3A5O C;  1WLJ A;  2GV9 A;  4FJ7 A;  4W5O A;  1YJ9 N;  2P5G A;  3E9O A;  2O8B B;  2XY8 A;  5FPE A;  4X62 K;  1Y97 A;  3RR7 A;  3CFP A;  4M42 A;  4BRK A;  2ZE2 A;  4WYB A;  2YI1 A;  3LDP A;  3HM9 A;  3F9M A;  1XUP O;  4FLZ A;  2NNW A;  4F8R A;  5AQF A;  4FCY A;  4KB0 A;  1EO1 A;  4FWR A;  1K73 O;  4B9N A;  3CJ9 A;  3MXI A;  1YTA A;  2J4R A;  3A5L C;  3NF8 A;  2UUB K;  4JD2 A;  5FLX O;  1VK0 A;  1VSL A;  3MN7 A;  4CJQ A;  3JAM O;  4BRG A;  1OH7 A;  1IG8 A;  4DTP A;  2Z1H A;  1KAX A;  3EEQ A;  1DKG D;  1HKC A;  3J7Y P;  5DK5 A;  3CQ8 A;  1RDU A;  4A61 A;  3TSP A;  3GE1 A;  3KK2 A;  4M41 A;  3ZT2 A;  1P90 A;  4BEC A;  3DRS A;  4E7L A;  1RDW X;  1TGO A;  4XH1 A;  3K2P A;  5JEN A;  3UKR B;  1NGB A;  4BEB A;  3DLH A;  1Z26 A;  3O4Q A;  2D0O A;  4UQG A;  3P39 A;  4L8R B;  3JXU A;  2GEM A;  1GLD G;  1L3S A;  3JS6 A;  2D4W A;  3IKM A;  3FZL A;  5JLF A;  3DLR A;  1NNE A;  3DMJ A;  2P9P A;  3ZET B;  5M1F A;  3I56 N;  4GNI A;  4GV3 A;  1EKE A;  4ELT A;  4CJ7 A;  3K5L A;  3T1H K;  3OS1 A;  5GAH P;  1BIZ A;  2I7P A;  1T3V A;  5JLH A;  3L2V A;  2ZM6 K;  5JVG L;  4CCH A;  3LDN A;  3ZSR A;  1RDA A;  2D5R A;  3NGY A;  2YV0 X;  4H5V A;  4IFY A;  5BPN A;  2QA4 N;  3R1X A;  4R5P A;  4DS5 A;  3NE6 A;  4WF9 L;  1HYZ A;  4A59 A;  4X64 K;  1K9M O;  4DB3 A;  3QEW A;  1XI1 A;  4DQS A;  3A2F A;  1EET A;  2WUS A;  4FM2 A;  3LP1 A;  5J2M A;  1DT9 A;  3H1Q A;  3HOT A;  2P51 A;  1KQS M;  4DLE A;  2UUC K;  1BUP A;  4I2Q A;  2ZD1 A;  4FK2 A;  5C10 A;  4CEB A;  5AQZ A;  4ISF A;  3NAE A;  3BZK A;  4DMN A;  1NJX A;  1HNI A;  3VA0 A;  3VQ5 A;  1NK0 A;  3M8Q A;  1ILY A;  4CF9 A;  3OYB A;  1E4F T;  1KVA A;  3H3O B;  1ASV A;  2YX6 A;  4DSI A;  3SUP A;  2NRH A;  1U2V A;  4FJ9 A;  2BGG A;  2D0C A;  3GL1 A;  2X6S A;  1QZ5 A;  1OVY A;  1SKS A;  4PHT X;  1WN7 A;  4B9T A;  3T1A A;  2HHI A;  2G8H A;  3M8R A;  3PX4 A;  2QM1 A;  1RNH A;  3AY9 A;  1M1K O;  1E3M A;  3SQ4 A;  2A1R A;  1JLQ A;  3GBT A;  1JLC A;  4KKO A;  2ZF5 O;  4KH5 A;  4I9L A;  3VTH A;  3IUC A;  4PL8 A;  2XO7 A;  3CC4 N;  2IIR A;  4GY2 B;  2YHW A;  3I33 A;  3JSM A;  1J5O A;  4PUO A;  4C1N I;  2YHX A;  3KK3 A;  3PY8 A;  4BE7 B;  3M8P A;  3CPE A;  3U9D A;  1W0H A;  3LZJ A;  4IZ9 A;  4FJN A;  4C8O A;  1HYV A;  2YNG A;  4FW1 A;  4JKG B;  4JKE A;  1D4X A;  1VSH A;  1GLC G;  2HMP A;  4YOT A;  3PO4 A;  2NRX A;  4G1Q A;  4Z4F A;  1IG9 A;  4QS7 A;  3TAF A;  2PY5 A;  3CCM N;  4IG3 A;  3P38 A;  4BRE A;  5SWM A; 
#chains in the Genus database with same CATH homology
 3G71 N;  3CCJ N;  3GOI A;  1NGG A;  4IDH A;  1J6Z A;  3ENH A;  1GLJ O;  1TUU A;  3DJC A;  3ZET A;  1W97 L;  4Z94 A;  1LCU A;  4H5N A;  1Q81 O;  1NJI O;  3QDK A;  5AQY A;  3HSC A;  1BWF O;  5AR0 A;  4BRC A;  3J7Z O;  4YOU A;  4FWQ A;  4CBU A;  2W00 A;  2QWL A;  3G4S N;  4PKI A;  2KHO A;  4B1Y B;  3MN9 A;  3F2K A;  1ATN A;  4IOX A;  3E1Y A;  3O1W A;  5C0Y A;  3R6M A;  5B8H A;  1BOT O;  5C15 A;  2Q31 A;  2WBN A;  3K9K A;  3AAR A;  3CD6 N;  3SAH A;  3CQX A;  3LDO A;  5KPZ A;  5AQU A;  2V7Y A;  3VF6 A;  3BEX A;  3ULE B;  5AQL A;  2QWR A;  3D2F A;  3WUH A;  3H45 C;  2NLX A;  3LL3 A;  3HRG A;  1EQY A;  2Q1N A;  4KBO A;  3TPQ A;  2NRW A;  2QWQ A;  2CGK A;  2V7Z A;  5AQV A;  3ULE A;  3L6Q A;  4H0P A;  4IOA L;  3O9U A;  5GAE P;  4WQ4 C;  5AZI B;  3A8Y A;  1TUY A;  2E20 A;  4I6M B;  5AQR A;  2HF4 A;  3D6R A;  3DXK B;  3Q7B A;  5BR9 A;  4I6M A;  3CCS N;  4JKD A;  4JK9 A;  3DXK A;  2FF6 A;  3VGK A;  2CH6 A;  3ZYY X;  2Q97 A;  4BC5 A;  4BRL A;  4CBX A;  5C2F A;  3D2E B;  3IFR A;  1G99 A;  3MMV A;  1O13 A;  5C2D A;  3Q7C A;  3MX5 A;  5EOY A;  3FE1 A;  4DKW A;  1T44 A;  1W2B M;  1Q18 A;  3D2E A;  3ATV A;  3CJB A;  3AAQ A;  4NLC A;  3UE5 A;  5AQK A;  4BR9 A;  1YI2 N;  2IVP A;  4FWO A;  3L4Q A;  3LDQ A;  5FPM A;  2A3Z A;  3H3N O;  3LDL A;  4OO1 J;  3VEW A;  5GIN A;  5GIO A;  2ZJR L;  4FPA A;  4JAX A;  3J8A A;  3ENB A;  2F7T A;  4WQ5 A;  4O8U A;  4CI6 A;  5FPD A;  4IJN A;  3CCR N;  5TKY A;  4BRI A;  4NO7 A;  5BRF A;  5EX5 A;  1QQN A;  4ILG B;  5AQN A;  1KXP A;  2I7N A;  4CZF A;  2HBL A;  5KQD A;  4GV6 A;  2E2N A;  1KD1 O;  1U6Z A;  3KWG A;  2YJF A;  3R9P A;  1SZ2 A;  1S72 N;  5GIP A;  3G6E N;  3CI5 A;  3H1V X;  2WFB A;  4M7Y A;  1QHA A;  3SMP A;  3S41 A;  3F5T A;  1NBW A;  1DEJ A;  3RSE B;  4CZE A;  2CH5 A;  5BPL A;  5BPM A;  1MWM A;  3VEN A;  5AZJ B;  3FZF A;  3RSE A;  3MWT A;  2P9N B;  5LY3 A;  4GV9 A;  2Q0R A;  1NGJ A;  3C65 A;  4O8K A;  5M1O A;  4BC3 A;  1YXQ A;  4L3Q A;  2P9N A;  3ID6 A;  4MO4 A;  4DCH A;  1QVF M;  2NZT A;  3HM8 A;  3D7E O;  4BRQ A;  5H1S Q;  3B8A X;  4ISG A;  2HBJ A;  3K9J A;  1YIJ N;  4JK7 A;  1VQL N;  1Z6R A;  3C6H A;  3L0Q A;  3BP8 A;  2A41 A;  4KH6 A;  3WQU A;  3ZEU B;  4JD2 B;  3FLC O;  4YDU A;  5BRE A;  4H0V B;  4BRH A;  4WFB L;  2ASO A;  1YUW A;  2VGN A;  3AGR A;  3ZEU A;  4A57 A;  4BRM A;  3HBT A;  3SLC A;  2JWK A;  4FWS A;  4MLH A;  3CF5 L;  3R8E A;  3DAW A;  1Q86 O;  1TYQ A;  1BG3 A;  4CZI A;  5F2R A;  3CME N;  3VEY A;  2E1Z A;  2ASM A;  5AQI A;  1KC8 O;  2GWJ A;  1N8R O;  3VMF B;  3FR0 A;  5F1X A;  4FVU A;  1WOQ A;  4ILJ A;  1VQ6 N;  1JCF A;  1HX1 A;  2ZGY A;  3MDQ A;  5ELZ A;  1WUA A;  4MDA A;  2F9W A;  3CJ7 A;  3EE9 A;  5FPN A;  3SBT A;  3WEE B;  3VTI A;  3VEX A;  3M3Z A;  5C12 A;  2NRT A;  2A42 A;  3WEE A;  3O5B A;  3QBX A;  4A62 A;  3GDQ A;  1V4T A;  3O80 A;  4EIA A;  3R3L A;  5GAD P;  2QEX N;  4G9Z A;  3EN9 A;  3FFK B;  1Q82 O;  4OPH A;  3TSQ A;  5TKW A;  4H5W A;  2EWS A;  3WXJ A;  2CGL A;  4IWV A;  4K42 A;  3DXM B;  4AF1 A;  5HOO A;  4EHT A;  3OBW A;  1Z05 A;  2RE2 A;  3O9T A;  5DM7 L;  5CHI A;  5BRH A;  1NGI A;  1NGD A;  3DXM A;  2E2O A;  2E8A A;  4FWL A;  2P9K B;  3C0B A;  3C7N B;  4WFN L;  4FWM A;  2ZGZ A;  3L4I A;  2QWO A;  4CD1 A;  3LM9 A;  4JHD B;  2P9P B;  1RFQ A;  3W0L A;  1NGC A;  4EAH D;  2P9K A;  4IO9 L;  3CET A;  3VET A;  2FLO A;  1K8K B;  4CZH A;  3TTD A;  4JHD A;  3KVG A;  4PKH A;  4MO5 A;  1VQP N;  2QWN A;  4LC9 B;  1K8K A;  4F9O A;  1VQ5 N;  1ZBS A;  2FSJ A;  4BR0 A;  1NLV A;  1SQK A;  2VWB A;  5AQW A;  4B1U B;  4K41 A;  2E2Q A;  4B1W B;  1GLB G;  3H6E A;  1XQS C;  4IEI A;  3NMU A;  4O5F A;  4FO0 A;  3BUZ B;  3SAF A;  4DHY A;  3DLL L;  3OHR A;  2VCP A;  2ITM A;  4WFA L;  3MCP A;  2A6A A;  4CZM A;  5CE3 A;  2WC9 A;  3UB5 A;  4DQ8 A;  1QQM A;  2KKZ A;  4XEI A;  1KAZ A;  3DWL A;  1C0G A;  3O8M A;  4B1V A;  5F0X A;  3MCA B;  1M90 O;  4RWT A;  4WQ5 C;  2P9S B;  1C0F A;  3VEV A;  2D0P A;  2P9I B;  1GLL O;  1HKB A;  1NWK A;  5AZI A;  4BVO A;  1YIT N;  4U7B A;  2P9S A;  2HF3 A;  5LJW A;  1BA0 A;  2P9I A;  3MN5 A;  4BG9 A;  5JIC A;  3WXI A;  1X3N A;  2FF3 B;  1VQ7 N;  3P31 A;  4YOX A;  3EKS A;  2ASP A;  2P9L B;  3OW2 M;  5AQJ A;  4JKF A;  3QML A;  1RGI A;  3ID8 A;  4RTF D;  2P9L A;  3CER A;  4BVP A;  1HKG A;  5E84 A;  3SMS A;  5ADX H;  5M1Q A;  3CQY A;  2ZJQ L;  1HPM A;  4HWI A;  4IO8 A;  4M63 C;  3VES A;  1VQ4 N;  4C1N K;  5EXW A;  2NRV A;  1NM1 A;  5M1P A;  4JEP A;  1S22 A;  1VQO N;  3CCE N;  4QS9 A;  2VYP A;  1NGE A;  3CJC A;  4BQZ A;  5E26 A;  4QS8 A;  4CZG A;  1OKJ A;  3AGK A;  4BR4 A;  2IVO A;  2V51 B;  3HI0 A;  3GG4 A;  4BRN A;  1SS6 A;  1H1V A;  3FZK A;  3CIP A;  3FZM A;  4YDU C;  1YVN A;  2ZWH A;  3QBW A;  3PIP L;  3A5O C;  4XH5 A;  3PIO L;  1YJ9 N;  3E9O A;  3G25 A;  2CGJ A;  4H5T A;  5FPE A;  1ESV A;  3M5R A;  5M1N A;  4U67 L;  4R79 A;  3O9R A;  3WT0 A;  5AQT A;  4BR5 A;  3BF1 A;  5AZJ A;  3IDH A;  5I9E B;  4B9Q A;  1HUX A;  5AFU H;  3KHY A;  4BRK A;  1YAG A;  2IVN A;  4BRO A;  4WYB A;  2YI1 A;  3LDP A;  1GLF O;  3F9M A;  1XUP O;  2W40 A;  3M6G A;  3OA9 A;  2NNW A;  5AQF A;  1EO1 A;  3QFU A;  3TU5 A;  2KLA A;  2NRR A;  4FWR A;  1K73 O;  3CJ9 A;  3AAP A;  3ENO A;  3N4Q A;  4FL9 A;  4MDB A;  4UY8 O;  2J4R A;  3NVM A;  3A5L C;  2E2P A;  1R59 O;  3WQT A;  4BRF A;  4E1J A;  4JD2 A;  3U4L A;  2A5X A;  4EHU A;  3VGL A;  3MN7 A;  5KPT A;  3RVC A;  2C1I A;  2OAN A;  4IFE A;  4BRG A;  2HST A;  1IG8 A;  4YOR A;  4AM7 A;  5LJV A;  5AQH A;  1KAX A;  3CCU N;  1XC3 A;  1DKG D;  1HKC A;  3CCV N;  4H0O A;  3WXM B;  2BTF A;  1RDU A;  3A0I X;  3I8B A;  3ATU A;  1HJO A;  3VEO A;  3TSP A;  3GE1 A;  4A61 A;  4CZJ A;  3IMX A;  4FOI A;  2PBD A;  4JN4 A;  1K8A O;  4JKA A;  1VQK N;  2VGM A;  3HZ6 A;  2PFU A;  1P90 A;  4BEC A;  2QTD A;  4BG8 A;  2FXU A;  5CR4 A;  3UKU B;  1RDW X;  3VOV A;  4FWP A;  4XH1 A;  2C1G A;  5M1K A;  1JCG A;  3WXK A;  3A5N C;  3UKR B;  3O9Q A;  3UKU A;  1NGB A;  3LM2 A;  5BRD A;  4B1X B;  3KZB A;  4YOW A;  4BEB A;  3MK6 A;  1VQ9 N;  2D0O A;  3UKR A;  3P39 A;  4ILH A;  4K43 A;  3MX2 A;  2FSK A;  4IJA A;  3ZX0 A;  2UYT A;  3JXU A;  5AQO A;  3EZW A;  2GEM A;  1GLD G;  5GAG P;  3JS6 A;  2D4W A;  3IKM A;  3SAG A;  1LOT B;  3FZL A;  5JLF A;  3H46 O;  3C7N A;  3E66 A;  3MWP A;  2QXL A;  3TTF A;  1Q7Y O;  1HLU A;  3BF3 A;  4NLB A;  3VEZ A;  4H03 B;  2P9P A;  2JWL A;  4K25 A;  1NGA A;  3QFP A;  4PKG A;  3ZET B;  2E1Y A;  3HTV A;  3VGM A;  5M1F A;  5AQG A;  3I56 N;  4YOV A;  3E9L A;  4IXC A;  3CCQ N;  4GNI A;  4GV3 A;  4RCH A;  4HTL A;  4BRD A;  2D1K A;  3O6W A;  2Q36 A;  4JNE A;  4CJ7 A;  4FPB A;  1QQO A;  5GAH P;  3KWI A;  1Y64 A;  1GLE G;  3EL2 A;  2PAV A;  3EO3 A;  2GX9 A;  2I7P A;  1T3V A;  4EFH A;  5JLH A;  5JVG L;  3EE8 A;  3O4W A;  3CJA A;  3LDN A;  4JKC A;  4A2A A;  3O08 A;  4H0Y B;  3FZH A;  3HOS A;  1VQM N;  4BR7 A;  4H5V A;  5BPN A;  2QA4 N;  5DM6 L;  1KAY A;  2HBK A;  3MN6 A;  3R1X A;  1BA1 A;  3W3D A;  1YHQ N;  1BDG A;  3CC7 N;  4WF9 L;  4BGB A;  3VER A;  3D2F B;  4A59 A;  5KQ8 A;  2DPN A;  4H5R A;  4MLE A;  2QW9 A;  3CJ1 A;  1K9M O;  4DB3 A;  5AQX A;  2WUS A;  3CPW M;  4OPA A;  5KPR A;  4BR2 A;  1YF5 L;  1SAZ A;  1BO5 O;  1BU6 O;  3P4I A;  1DT9 A;  2AA4 A;  3H1Q A;  4A5B A;  2OTJ N;  4CD3 A;  3HOT A;  3TTC A;  1KQS M;  3C6A A;  4GVE A;  2AP1 A;  3E9P A;  5AQS A;  3WXL A;  1BUP A;  4BGA A;  4CZK A;  3CCL N;  1MA9 B;  3PLA A;  4FOE A;  3SBG A;  2A40 A;  1DGK N;  4FWN A;  2QI2 A;  3ZX2 A;  1NMD A;  1ZXO A;  3ZX3 A;  5C10 A;  3I55 N;  2P9U B;  1MDU B;  5AQZ A;  1ATS A;  4ISF A;  5JVH L;  4WCE L;  1VAZ A;  2OTL N;  4A2B A;  3SK3 A;  4AM6 A;  5AQQ A;  3T7Z A;  3VF4 A;  1V4S A;  3SJH A;  2P9U A;  5JMV A;  1ATR A;  3CXC M;  1VQ8 N;  1ILY A;  3U9Z A;  2H3G X;  1E4F T;  4IEE A;  3CC2 N;  3H3O B;  4BRP A;  2YX6 A;  4PL7 A;  4FSV A;  5AQM A;  2GUP A;  1MWK A;  1U2V B;  1T6C A;  4WQ4 A;  2NRH A;  2BUP A;  4IOC L;  2E88 A;  5ADX A;  2YCH A;  2HOE A;  3CMA N;  1YJN N;  1U2V A;  1JJ2 M;  2GWK A;  5EVZ A;  1QVG M;  2HBM A;  3GL1 A;  2W41 A;  1QZ5 A;  3O9S A;  1OVY A;  4FWK A;  4A5A A;  5MLC Q;  4PHT X;  1T6D A;  4M7X A;  2RHK A;  1QZ6 A;  2ZJP L;  2QM1 A;  3KK7 A;  2F9T A;  3AY9 A;  1M1K O;  2GTD A;  3GBT A;  1GLA G;  3EKU A;  1X3M A;  4BQL A;  2ZF5 O;  3VF2 A;  3A5M C;  4H0T B;  3T69 A;  2BH1 A;  4KH5 A;  1P8Z A;  2YHY A;  4ISE A;  3VTH A;  1YJW N;  2GEL A;  3IUC A;  4PL8 A;  3CC4 N;  2IIR A;  4GY2 B;  4JKH A;  3TSU A;  2YHW A;  3I33 A;  4NB4 A;  4KH4 A;  3VPZ A;  3NVK A;  1NGF A;  4C1N I;  3OBY A;  2YHX A;  1X9J A;  3QB0 A;  3FGU A;  4JK8 A;  5AFU A;  2Q0U A;  1IJJ A;  4XJX A;  4BE7 B;  1JCE A;  4CZL A;  3CPE A;  3N4P A;  3U9D A;  4BC4 A;  1TYQ B;  4IZ9 A;  4Y0W A;  2QWM A;  3U8X A;  4J8F A;  2NRZ A;  1S3X A;  1ZC6 A;  2V52 B;  3M1F A;  4B1Z A;  4JKG B;  5AQP A;  1VQN N;  5BN8 A;  4C23 A;  4JKE A;  1E4G T;  4BRA A;  3QIC A;  1D4X A;  2HMP A;  1GLC G;  2FSN A;  2Q2R A;  4JKG A;  4YOT A;  4BC2 A;  1NGH A;  3CHW A;  4YOY A;  2NRX A;  4CBW A;  4BY9 C;  3O1B A;  4H0X B;  4JKB A;  4XH4 A;  5EY4 A;  4QS7 A;  3CCM N;  2QWP A;  3P38 A;  2YJE A;  4BRE A;  5HL7 L;  5BN9 A;  1CZA N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...