3UKRA

Crystal structure of bos taurus arp2/3 complex with bound inhibitor ck-666
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
415
structure length
401
Chain Sequence
b'GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structural characterization and computer-aided optimization of a small-molecule inhibitor of the Arp2/3 complex, a key regulator of the actin cytoskeleton.
pubmed doi rcsb
molecule tags Structural protein
total genus 126
structure length 401
sequence length 415
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3ukrA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ukrA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ukrA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3ukrA04
2YJFA 1GLLO 5FPDA 2V7ZA 3CJ9A 3O6WA 1G99A 1NGDA 1SZ2A 2AA4A 3FLCO 3FZMA 4FOEA 4HTLA 4IXCA 3ZETA 5AQVA 4BRIA 4BRAA 3CQYA 3LDLA 3FZKA 4BRCA 4H0OA 1R59O 4MO5A 3LDQA 3KZBA 3FZHA 1BOTO 3D2FA 1JCGA 3CHWA 5AQTA 1TUYA 3CJ1A 4PL8A 2E20A 3BUZB 4FPAA 2OANA 3HZ6A 4CJ7A 4H0PA 3R9PA 4CBWA 2V51B 2P9LB 1QQNA 2YHYA 2KHOA 1GLEG 3IDHA 3CJCA 1BUPA 1JCEA 1V4SA 4WQ4C 4CI6A 2VCPA 1KAXA 3H1QA 3A5NC 1BU6O 2FXUA 3I33A 4L3QA 5AQQA 5AQWA 3ZEUB 1RGIA 1NGJA 2NZTA 2P9UA 4BC3A 1TUUA 2ZF5O 3IMXA 4A2BA 2P9NB 4IO8A 2FF3B 2VYPA 3CI5A 5AQLA 2W41A 3ZETB 5ADXA 2IIRA 3CETA 4BGAA 3DJCA 2P9KA 2QM1A 3QICA 1EQYA 3DXKA 1S3XA 1GLDG 2F9TA 3UKUB 3A0IX 1NGAA 4RCHA 3CQXA 5E26A 3S41A 5CE3A 4BRKA 3CJ7A 1NWKA 1HPMA 5TKYA 4H5WA 1E4GT 1RFQA 4E1JA 3MK6A 3UB5A 3LDPA 2FF6A 3BEXA 4A62A 5E84A 3IFRA 4MLHA 3WT0A 5KPZA 4BR7A 3L0QA 1Z05A 5EOYA 2IVOA 3SMSA 2I7NA 3O08A 1K8KA 4DHYA 2CGJA 4H5TA 4CZLA 1ESVA 4EFHA 4ISEA 1QZ6A 2ZGYA 4K43A 3WEEA 2Q36A 4WQ5A 1WOQA 3VETA 3CERA 1GLFO 2J4RA 4A2AA 4B1VA 2CGKA 1X9JA 1QQOA 4H5NA 1MA9B 5BR9A 4MO4A 1ATNA 2QWPA 2P9KB 4K41A 3MN9A 5F2RA 4PKGA 1NLVA 3DXKB 3EZWA 4BC5A 1ZC6A 3ZX3A 4CZIA 1BA0A 4BRMA 3DWLA 4KBOA 3WXJA 4CBXA 2A3ZA 1T6CA 4DB3A 4PKIA 3WUHA 4BR2A 1DKGD 3HM8A 3MCPA 5F1XA 2E2OA 2QWLA 3O5BA 3ID8A 3VESA 1IJJA 2A42A 2D1KA 3VENA 4CD1A 2FLOA 4H5RA 2V52B 1C0GA 4QS9A 4BRHA 2QWQA 1K8KB 3A8YA 4BRNA 4K42A 2UYTA 2Q97A 3TPQA 4CZMA 1SQKA 4H03B 4BR5A 3DXMB 1X3NA 4JHDA 4NB4A 2E2NA 4A61A 2P9IA 4XEIA 2P9SB 3EO3A 1NGFA 2YHWA 4CZKA 4BRPA 2A41A 3GE1A 5AQHA 1BA1A 1JCFA 4RWTA 2QWRA 4B1UB 2NLXA 3LL3A 3TU5A 3VEWA 2GTDA 3VF4A 4JD2B 4ISGA 2W40A 2I7PA 5F0XA 2P9PB 1MDUB 3EL2A 2HF3A 4WQ5C 4YDUC 1P8ZA 3O8MA 1NGEA 3VEYA 5AQMA 3A5MC 3CJAA 3LDNA 5AZIA 2ASPA 2A6AA 2IVPA 2Q1NA 5BN8A 4BVPA 4CZGA 5BPLA 2QWMA 2YJEA 3FZLA 1Z6RA 4Z94A 3ATVA 3VOVA 4BREA 3MN6A 2FSJA 5AQSA 4BR0A 5LJVA 3J8AA 1IG8A 3VF6A 1S22A 4BR9A 3SLCA 3H1VX 3C7NA 4MLEA 1XC3A 4IWVA 1RDWX 3GBTA 5JMVA 4BQZA 2GWKA 2CH5A 1BO5O 3H6EA 2ZWHA 1SAZA 4FWSA 1NGCA 3D2FB 4EIAA 2VWBA 3A5LC 2E2QA 5JLHA 1YVNA 2A5XA 5EY4A 5ADXH 4BRGA 5LY3A 2YI1A 2QXLA 3AAQA 1HUXA 3QFUA 4RTFD 5AFUH 2BUPA 3CIPA 3VF2A 2GEMA 2HOEA 1NGGA 3CJBA 4F9OA 1U2VA 5AZIB 3RSEA 2QWNA 3QB0A 3IUCA 3D2EA 4BC2A 3UKRA 4LC9B 3MN7A 2AP1A 4FPBA 5AQXA 3VEVA 3QBWA 3GDQA 2QW9A 5AR0A 3SK3A 2ASMA 2P9UB 4B1XB 2H3GX 1T44A 3HBTA 1T6DA 2DPNA 4BVOA 3LM2A 5BREA 2E8AA 4DCHA 2IVNA 3FFKB 1ZXOA 2Q0RA 1DEJA 3AARA 1MWMA 3JXUA 4B9QA 2WUSA 3GG4A 1H1VA 5AQFA 3GL1A 5AQYA 3VEOA 4CZHA 5BPMA 5BRHA 3I8BA 3DAWA 1J6ZA 4CBUA 1KXPA 1X3MA 1V4TA 2D0OA 3M1FA 3ULEA 5JLFA 1QZ5A 2E1ZA 3U4LA 3O1WA 4PL7A 3O1BA 2F9WA 2GWJA 5KQDA 4J8FA 4WQ4A 4O5FA 2ASOA 4JN4A 3BF1A 4C23A 4FWQA 1NGIA 3OHRA 4FWMA 1CZAN 4XH1A 2YHXA 2E1YA 5AZJA 3VEZA 3QMLA 4FL9A 3QBXA 3VERA 1TYQA 4BQLA 4QS8A 4B1YB 1D4XA 3H46O 1YUWA 2E88A 2HMPA 3D2EB 3FZFA 3UKRB 2ZGZA 3M3ZA 4BG8A 5AQKA 4FWNA 3WEEB 3ZX2A 2V7YA 2FSNA 3VEXA 2FSKA 3FE1A 4XH5A 4DQ8A 4AM7A 2D4WA 5BPNA 5KPRA 3VGKA 1NMDA 3ZEUA 1GLCG 4H0YB 3VGLA 1Y64A 1HX1A 3WQUA 4BRFA 4M7XA 2E2PA 2P9NA 2A40A 2ITMA 1C0FA 1HLUA 5AQPA 3VGMA 4BC4A 5AQGA 3ULEB 1YXQA 4BRLA 1XQSC 5FPNA 1OKJA 3ATUA 3FR0A 3UE5A 3C0BA 2D0PA 3WXKA 4ISFA 3WQTA 4I6MA 3UKUA 3WXIA 4IZ9A 3D7EO 2NRHA 3BP8A 2QWOA 5AZJB 4XH4A 2Q2RA 4FSVA 2PBDA 3H3NO 1TYQB 3JS6A 1BG3A 4EHUA 1NGBA 3LDOA 3SMPA 4JNEA 1MWKA 4JHDB 5AQOA 3W3DA 3G25A 5AQJA 1LCUA 2P9IB 3U9ZA 3U9DA 1HKGA 1E4FT 3B8AX 4CZJA 1YAGA 4FOIA 5JICA 1QHAA 3EKSA 4EAHD 3ZX0A 3HSCA 3GOIA 1NBWA 5AQRA 2BTFA 5FPMA 4FWPA 3KHYA 4H0XB 1ATSA 5AQUA 4GY2B 4QS7A 1KAYA 4EHTA 3HI0A 4BROA 3O80A 3L4IA 4O8KA 4Y0WA 4B1WB 4H0TB 3H3OB 4BR4A 3O4WA 1Q18A 5EVZA 4BG9A 4JAXA 1ZBSA 4M7YA 3U8XA 1NM1A 4I6MB 4B1ZA 5AFUA 3P4IA 4H0VB 4WYBA 2GUPA 4IJAA 1GLJO 3F9MA 5ELZA 4HWIA 3R6MA 5LJWA 5KQ8A 1HKBA 4FWKA 3R8EA 1WUAA 3KVGA 4FO0A 5BN9A 3W0LA 3C7NB 3AAPA 3MDQA 4BRDA 4GNIA 3H45C 3A5OC 1KAZA 2Q0UA 4PKHA 4K25A 3BF3A 5BRFA 3WXLA 1DGKN 5EX5A 3HTVA 1BWFO 1BDGA 4CZFA 3QFPA 4AM6A 3EN9A 4CZEA 5B8HA 3DXMA 3FGUA 3L6QA 4FWLA 2Q31A 4YDUA 3QDKA 2CH6A 2GELA 2EWSA 3VPZA 4BGBA 3LM9A 2HF4A 2P9SA 5FPEA 4M63C 5KPTA 5BRDA 1U6ZA 5I9EB 1LOTB 2CGLA 4IJNA 1XUPO 1HJOA 4H5VA 1U2VB 1GLAG 2YCHA 4FWRA 4JD2A 3RSEB 5EXWA 1NGHA 3EKUA 2P9LA 5AQIA 2P9PA 3ENOA 4NO7A 1ATRA 5AQNA 4FWOA 4CD3A 3M6GA 3MN5A 2PAVA 3ENHA 3SJHA 4BRQA 1HKCA 3MMVA 5AQZA 1QQMA 1GLBG 3AY9A
chains in the Genus database with same CATH superfamily
1GLLO 4A5BA 4IBNA 2V7ZA 3CJ9A 2AA4A 4FOEA 3CPWM 3FZMA 4IXCA 4HTLA 1N8RO 3IG1A 1IKWA 1A5XA 3ISNC 4QOZB 4DR4K 2IOCA 1JLBA 4B8AB 2HHQA 4MO5A 4DQPA 2NRZA 4I2QA 4NYFA 3NH2A 5I3UA 3NCIA 3KZBA 3FZHA 1BOTO 3B6OA 1JCGA 3CHWA 4N41A 4PL8A 3SCXA 3R9PA 3KLEA 4FLWA 1P90A 4CBWA 1QQNA 2KHOA 3VQ8A 1BUPA 4NXNK 2F8TA 4YOXA 4FJNA 5AQWA 1SKRA 4CGHA 3THXA 2YNFA 4BC3A 1WNSA 2YHBA 4DR7K 1EO1A 5M1KA 1RT2A 2FF3B 2VYPA 3QIPA 5AQLA 2VG6A 4A59A 5J2PA 2IIRA 2RN2A 4BGAA 3L2WA 4AHVA 3QICA 1RT1A 1Q86O 1S9GA 1S3XA 2KQ2A 3A0IX 1NGAA 2DY4A 3SI6A 1VQPN 3V1OA 3DLHA 1WSEA 4JS4A 4I9LA 5TKYA 4H5WA 1RFQA 4E1JA 1CXQA 4B08A 3LDPA 2P51A 4A62A 2NRTA 3P38A 3L3UA 1X9WA 3L0QA 4KTWA 3K5OA 3KIOA 4LF5K 3HVTA 4EFHA 2QEXN 4B9TA 4DLGA 4QCLA 3NF7A 3NMUA 3OA9A 3OYFA 4B3MK 3L2QA 3HT3A 3WEEA 1VSLA 1WOQA 1GLFO 4B1VA 2W42A 3CXCM 1NK9A 1HNIA 2OZMA 3HJFA 1MA9B 4KKOA 3KLGA 1ATNA 5EU7A 3U3GA 3CCRN 4CZIA 1BA0A 3TTFA 1EETA 3ASMA 1YTUA 1U49A 4C8MA 3Q7CA 2PYJA 4BRMA 4FK2A 3DWLA 2A3ZA 4DB3A 4CFBA 4PKIA 1C0TA 1RTIA 3CCMN 5K14A 3HM8A 4CF8A 3VESA 2A42A 3DRPA 3KK7A 3RRGA 4GMJB 4QS9A 4K42A 3CCUN 4JK8A 3S5TA 3TPQA 2ZJQL 1NK7A 5HRRA 3DXMB 1X3NA 4JHDA 4NB4A 1TKTA 2QI2A 3EE9A 4BWJA 1NGFA 4CZKA 4DS5A 2A41A 3PX4A 4TSXA 1XHXA 1BA1A 4LH4A 5CZ1A 4AHRA 1HR0K 4EZ6A 2I5JA 3OYJA 4WQ5C 4CK2A 1NGEA 3V81A 4CFCA 1LWEA 4B9VA 3A5MC 5GADP 3G71N 2Q1NA 5BN8A 3AO4A 5BPLA 4E7KA 1VQ8N 2QWMA 3QO9A 4H4MA 2YJEA 2P5GA 5CHIA 4FZYA 1S1UA 5LJVA 3J8AA 1IG8A 1WN7A 3DLGA 4BR9A 3SLCA 3TSPA 4FJ7A 1RDWX 3AO2A 3V1RA 5CYMA 3ZT2A 4M3YA 2CH5A 1BO5O 5KI6A 2PFUA 5H1SQ 4DFMA 2ZWHA 1SAZA 2XHBA 3D2FB 2BE2A 3I0RA 3PO4A 4E7HA 5EY4A 4K8XA 3ZSQA 4J2EA 2DFFA 3ZCMA 3ZT3A 3NGYA 4FM0A 4CW7B 3N4PA 3QFUA 3SAFA 5HP1A 3OS0A 3VF2A 3THVA 1JLEA 5C42A 1VSIA 5HRPA 4JRPA 1LWCA 1DTQA 5AZIB 2EX3A 2VWJA 3QB0A 4B9SA 2O8BA 4LC9B 3MN7A 1J9AA 3QBWA 5AR0A 2ASMA 1S6QA 4F8RA 1ZBUA 1TKXA 2E8AA 1Q9XA 3HM9A 3FFKB 1ZXOA 4B3OA 2Q0RA 4F3OA 1YT3A 1EX4A 3AARA 4M3RA 2F4VK 3GG4A 5AQFA 5LMUK 3I8BA 2AJQA 1BL3A 4DV1K 1J6ZA 1DLOA 4UQGA 1V4TA 1VHXA 3OYGA 4B3SK 1NNEA 4FWQA 3OHRA 5C2FA 4DU1A 2PY5A 1BQNA 3EEQA 1QSSA 3AVIA 2YHXA 2E1YA 5AZJA 4HTUA 4CK3A 3VEZA 3ALYA 2O8CA 1D4XA 1RBSA 2HMPA 3UKRB 2ZGZA 3O3GA 4BG8A 4HUEA 5A2QO 4FK0A 4WFBL 4OPAA 4E7LA 1RDCA 1VSJA 1JLFA 2FSKA 3FE1A 3ZSYA 3DRRA 4CFAA 3VQ9A 1RT6A 4H0YB 3DLRA 3VGLA 4CJTA 2KZMA 4BE2A 1HX1A 3OYBA 3O3HA 3I56N 5AQPA 4BC4A 4WCEL 4DR6K 4BRLA 1XQSC 2UXCK 3V9WA 4YOTA 4JI5K 3WQTA 1I39A 3WXIA 3UKUA 4IZ9A 1S5JA 4PUOA 3BP8A 4CECA 3LP3A 4XH4A 4FSVA 3HP9A 1TYQB 4DWIA 1L3VA 3LDOA 1TV6A 1RDDA 4HVJA 3O9TA 1MWKA 1YITN 4YOWA 4WF9L 1U47A 2P9IB 3RMBA 4MDBA 4LFCK 2HHTA 4C1NI 5JICA 4M3ZA 1W2BM 3G0ZA 3CFOA 4N47A 5KGXA 2BTFA 3KHYA 3MXJA 1YI2N 3C65A 1S1XA 4CHYA 1YVUA 1KAYA 4DFKA 1ZBFA 4BROA 3CC7N 3HOTA 4ELVA 4G1QA 3TAEA 1N5YA 1LV5A 4BG9A 4JAXA 3BZCA 4RW6A 3U8XA 2UUBK 4JI0K 4JI1K 4X62K 3P4IA 4IJAA 2GUPA 2HB5A 1F21A 3R6MA 1D5AA 2E6LA 2WBNA 4JLHA 4CF0A 4CF2A 5BN9A 4DSJA 4DLEA 2O8DB 3C7NB 4DTSA 3V6DA 2YV0X 4BRDA 4GNIA 4CJ5A 2Q0UA 1L3TA 2UUAK 4K25A 3BF3A 1DGKN 2IAJA 3PIOL 1NU0A 4F3TA 1JXBA 3ZSVA 3EN9A 3LZJA 3NFAA 3FGUA 2X74A 3O9UA 1KCFA 2EWSA 3VPZA 3LM9A 2HF4A 2P9SA 4M63C 4X64K 1EP4A 1U6ZA 2Y1IA 2OPSA 4KB1A 3AVHA 2CGLA 2VQEK 4N56A 4H5VA 1J53A 3ULDA 1TAUA 4FLXA 4E19A 3MXIA 3VA3A 4DR2K 4BDYA 3F5TA 3AVCA 4YNQA 1T8EA 1ATRA 4YOYA 1N36K 2DFHA 4DQSA 4FWOA 3U3YA 5MLCQ 4BRQA 3ENHA 4Z4EA 3CF5L 2B5JA 3MMVA 4GV6A 4HHTA 3IKMA 1GLBG 5KRSA 2YJFA 1K6YA 1FK9A 4CIFA 2YNIA 1T05A 1VQMN 4XJXA 2HNDA 3BGRA 4CJ3A 2FBVA 5J1EA 1R59O 3QEXA 1QE1A 3E01A 3LDQA 4M3UA 3J7ZO 1QSLA 4C8NA 4JK7A 2E20A 3BUZB 5KTQA 4FPAA 2OANA 4H0PA 1DT9A 3THWA 2V51B 2VG7A 3VQ7A 1JCEA 4OKEA 3OYKA 1VQ4N 1IKVA 4O5BA 3THYA 3CCVN 3A5NC 5AQQA 3I33A 4L3QA 2YNHA 2YHAA 2NZTA 5FLXO 2P9UA 2VQFK 2D0BA 2P9NB 4DSKA 3CI5A 1C0MA 2Q3SA 4HUFA 1N6QA 3CETA 2VGNA 2P9KA 1EQYA 4KAZA 3AA3A 1VSMA 4CHOA 2KLAA 1GLDG 4FJXA 3VMFB 4IEIA 1XC9A 4JKFA 3CQXA 1NJYA 3HK2A 1RTHA 4BRKA 3AGKA 3CJ7A 1D8YA 2RHKA 1OVYA 4JKCA 4JI2K 5J2MA 2FF6A 2G8HA 4IO9L 1LW2A 4MLHA 2KZZA 1D9DA 3ZT4A 1NKCA 1IV0A 5KGWA 2IVOA 4FW1A 4OX9K 1ASWA 3QLHA 4DHYA 3SZ2A 4H5TA 1ESVA 4DTRA 4BDPA 3OVNA 2ETJA 2HHIA 3L8BA 4FCYA 1VSDA 4F4KA 3J80O 2Q36A 2UXDK 3VETA 3CERA 3PSIA 1NG9A 3MX5A 2CGKA 1KQSM 1ITGA 1LW0A 1YJNN 3D6RA 4MO4A 5HBMA 2QWPA 4KI6A 5F2RA 1NLVA 4CERA 3LDSA 1G15A 1UWBA 3KLFA 2GV9A 3C6HA 4C8KA 3WUHA 4IDKA 3SJJA 3CFRA 4DTOA 5F1XA 3WNHA 2QWLA 3S3NA 3ID8A 2FBTA 2OPQA 4CGIA 4Z4GA 1C6VA 3CM6A 4CD1A 4KPYA 1VQLN 4JK9A 4CHNA 4CK1A 1M1KO 1OVQA 2UYTA 4DTXA 1JLAA 5C24A 3JYTA 5DM7L 4K8ZA 4H03B 4BR5A 1BCOA 3QETA 4E89A 2HHSA 3SUPA 3OS1A 4A61A 4LH5A 1E3MA 2NRXA 4DFPA 3EO3A 4LY7A 3TAMA 2QTDA 4DSFA 3AVFA 3OW2M 3CFPA 4FJJA 3VEWA 4FLYA 3VF4A 4JD2B 5GIOA 1UOCA 4ISGA 2W40A 2I7PA 3TI0A 3L4QA 1RCHA 3CPEA 1RBUA 3ZT1A 3AVKA 3EL2A 3O8MA 2P5OA 3VEYA 4ZTJA 4GV9A 3QEVA 3SNNA 2ASPA 2A6AA 4JS5A 4JKHA 3FZLA 4Z94A 1XI1A 4RW4A 1KC8O 3MN6A 2FSJA 4BR0A 2O8EA 3VTIA 3FFIA 2DTUA 4FJMA 3KWGA 1S22A 4CJRA 5M1PA 3NGZA 4IWVA 2HBLA 4OVLA 5JMVA 2LSNA 4A5AA 4W5OA 3I55N 5J2QA 5CZ2A 5IWAK 3E9OA 5GIPA 2KFZA 4OPJA 5GAHP 4EIAA 4IOXA 4DSIA 3A5LC 5LY3A 2YI1A 4NYNA 1BHLA 4BDZA 4YOVA 4FYDA 2BH1A 3KKSA 4CJLA 3SAGA 4M3WA 3CIPA 4FVMA 1NGGA 3CJBA 2F8SA 1U2VA 3RSEA 4JKGB 4IOAL 3C94A 3IUCA 4GW6A 1IKYA 3WXMB 1YIJN 3CD6N 5AQXA 4ILHA 1Q8IA 2Z1HA 2DPNA 4BVOA 4FJLA 1BGXT 1QSYA 1W97L 4KHYA 3CCJN 1RT5A 3LWLA 1W7AA 1T03A 3AA5X 4B9QA 2OPRA 1N32K 5BPMA 3PIPL 2QXFA 4CBUA 5JLFA 1QZ5A 2E1ZA 3U4LA 3RMCA 4XIUA 4WFNL 3O1WA 2GWJA 4AH9A 4J8FA 4NCGA 4O5FA 2QKBA 2FBXA 4CIEA 1NGIA 5C25A 1CZAN 4XH1A 1VQON 3QMLA 4O55A 1RTDA 3QBXA 4ID5A 3CMAN 4BQLA 4B1YB 5M1FA 3VQCA 2PZSA 2O8BB 2OPPA 4OGEA 2D5RA 3D0PA 3RRHA 3SUOA 4XH5A 2ZM6K 3C6TA 4AM7A 4DUZK 4EP4A 2PYLA 2R7YA 1NMDA 4IFVA 2HVIA 1Y64A 1IBMK 4OGCA 2QKKA 4OPHA 1C0FA 2YKMA 2ITMA 3QEIA 4R79A 2WC9A 1YXQA 4JEPA 3S3OA 5FPNA 4CJEA 2XY5A 1OKJA 3ATUA 3UE5A 3C0BA 3WXKA 4B9MA 4ISFA 4RW8A 1IBLK 3D7EO 1SL2A 3NH0A 3G10A 3CCSN 3SQ1A 5AZJB 4CJWA 3NF6A 5HROA 2RE2A 4FM1A 2X6SA 3JS6A 1ZBLA 1ZBHA 3MX2A 2O8CB 2NNWA 3SUQA 2KFNA 1HMVA 4I2PA 1NGBA 3SMPA 3P1GA 2G8KA 1UA0A 4IFEA 1T7PA 5AQOA 4IDHA 1WSIA 1D9FA 3KLHA 1LCUA 4M3TA 3DRSA 2BGGA 4CZJA 4FOIA 3ZX0A 3HSCA 4JKDA 1NBWA 5FPMA 1ATSA 3SYZA 3PX0A 2OTJN 1TAQA 3V9ZA 4GY2B 1J54A 1NK5A 1X9SA 4EHTA 4JV5K 3HI0A 3K59A 3O80A 4O8KA 3JSMA 4B1WB 4ILGB 1Q18A 3M8RA 4GVEA 3TWHA 3G4SN 4M7YA 3OS2A 4B1ZA 5AFUA 4LD0A 1Q7YO 4JKEA 2P1JA 4WYBA 1GLJO 4YOUA 3G6EN 2XY8A 4HWIA 1BI4B 2FC0A 3JAMO 4CGDA 3HOSA 3K2PA 3SBTA 3ID6A 3P39A 1J5EK 3KVGA 1QQCA 4FO0A 3OYAA 1HRHA 5HLFA 3A5OC 1RTJA 4HUGA 1HPZA 4LSLA 1HNWK 5BRFA 3HXMA 3CCQN 3KD5E 1VQNN 3QFPA 4GKKK 4AM6A 1BQMA 2NRRA 3BDPA 3DXMA 2ITGA 4FWLA 4CGGA 3VN5A 4CESA 2CH6A 3AVJA 2GELA 1ZYQA 1WBDA 3VQ6A 1IO2A 1VRUA 4E72A 3E9PA 4IJNA 1WLJA 3K5LA 4DTUA 4E1MA 3NHGA 4U7BA 4DSEA 2P9LA 1U45A 1HQUA 4FM2A 4CJUA 1VQ9N 2NUBA 4CD3A 1JLGA 3MN5A 3SJHA 4KV8A 3KD1E 1HKCA 2HW3A 4Y1CA 4O4GA 3SBGA 2HVHA 2KW4A 2F7TA 3VQ4A 1G99A 2RF2A 3ZETA 5LL6Z 5AQVA 4KHNA 2W6KA 3NVKA 5C2DA 3EY1A 3AA2A 3CQYA 3DMJA 3I0SA 3LDLA 4BRCA 4H0OA 3PSFA 2NRWA 3J7YP 4DG1A 3D2FA 5AQTA 2QA4N 2OTLN 2Z1JA 3MXMA 1YHQN 1QVGM 4O0JA 3D45A 3HZ6A 4CJ7A 3NBPA 1K9MO 2YHYA 1KD1O 1GLEG 3CC2N 3IDHA 3LP0A 3CJCA 4G9ZA 3DLKA 2ZJRL 4WQ4C 3O9SA 3H1QA 1NKBA 1BU6O 3ZEUB 3TR8A 1RDBA 1RGIA 1FJGK 4K0KK 3EZ5A 3IMXA 3PX6A 3SPZA 1NK0A 2W41A 5ADXA 1QHTA 3O4NA 5T7BA 2QM1A 5KRTA 3DXKA 2HHVA 2A1RA 2F9TA 3NE6A 1RNHA 1ASUA 4KH4A 2JGUA 1OH8A 3S41A 5CE3A 4LF9K 1NK4A 1HPMA 1E4GT 4KRFA 3UB5A 4J2AA 2O8FA 3BEXA 3MWTA 1HNVA 5C15A 5E84A 1CZBA 3WT0A 5KPZA 4DR3K 4ID1A 2EHGA 4BR7A 5EOYA 3PUFA 3SMSA 4YFUA 3OY9A 2I7NA 1K8KA 2W6LA 2OCEA 3ZSZA 2KKZA 4ZTFA 4CF9A 2WTUA 3WNGA 1RDAA 4DUYK 3K9KA 3HYFA 3TAGA 4WQ5A 4JI6K 4A2AA 3CMEN 1X9JA 3OJUA 5C0YA 1QQOA 3OYNA 3DI6A 2P9KB 3DLLL 4K41A 3PV8A 2YKNA 1ZC6A 3E66A 3ZX3A 4Q5VA 4FVUA 3Q7BA 3T69A 3OYLA 4FK4A 2Z1IA 3H08A 3K0SA 3AGRA 1KFSA 4KBOA 3WXJA 4F2SA 4DQRA 1VSFA 4NCBA 4IG0A 4BR2A 1CLQA 1NOYA 1DKGD 2GX9A 3IRXA 1U48A 3AV9A 2D1KA 3VENA 3AVNA 2FLOA 4H5RA 2V52B 3OYEA 1VSKA 4BRHA 3L2UA 1SS6A 3OYMA 3OYIA 3AVBA 1SQKA 1S9EA 3TSQA 4JI8K 5HL7L 1TK0A 5FRMA 2P9IA 1NJWA 1TK8A 1A5VA 1O1WA 4C8LA 4PWDA 2YHWA 4DS4A 3GE1A 5AQHA 3U6FA 2G8WA 3KLIA 3R3LA 4B1UB 4CJSA 2NLXA 3LL3A 4GKJK 3TU5A 5GINA 4FJHA 2GTDA 3HPGA 3LALA 3EE8A 3HO1A 1WSFA 1JLCA 4RW7A 2P9PB 2IDOA 5CYQA 4CGJA 4JRQA 4CIGA 2RPIA 3CJAA 3LDNA 1KVCA 5HOOA 3O4QA 3OYCA 4I7FA 1Z6RA 1RILA 1L5UA 1HNXK 3ATVA 4AF1A 3LAMA 1JLQA 5FDLA 3VF6A 3QEWA 3SPYA 3K5NA 3H1VX 3C7NA 2O8DA 4MLEA 2UXBK 3GBTA 3OBWA 4BQZA 4CHPA 4FW2A 2GWKA 3BY5A 1VQKN 4AHCA 5DK5A 3SQ4A 4FWSA 4MFBA 4GVMA 2VWBA 1SKSA 1T3VA 4MDAA 5ADXH 3I8DA 1C1AA 4BRGA 1SL0A 4YHHK 2QXLA 3AAQA 1I3AA 1RBTA 1HUXA 4W5TA 5M1NA 2E6MA 4RTFD 2GEMA 1RBVA 4LF7K 3F9KA 4E1NA 4PHTX 2HOEA 1NK8A 3D2EA 4BC2A 3QNOA 1HQEA 3VEVA 3GDQA 3SK3A 3THXB 2G8FA 4JI7K 5M1OA 1T44A 3NH1A 2O8EB 1XWLA 4DCHA 5BREA 1WSGA 2FBYA 3ZSRA 1W0HA 1DEJA 3N4QA 2WUSA 3T1YK 1FKOA 5AQYA 3GL1A 1BISA 5BRHA 5JVHL 4CVNE 1KLNA 3DAWA 1EKEA 1KXPA 1X3MA 3ULEA 2BDPA 3O1BA 3QEPA 4BECA 4WQ4A 2ASOA 3BF1A 2VG5A 2B4JA 4WFAL 4FWMA 1LWFA 3M8SA 1J5OA 4FJIA 3NF9A 1OH6A 3TABA 3RMAA 3VERA 2G8VA 1Q82O 3P31A 4QS8A 1YUWA 3E9LA 1L3UA 4ILJA 3FZFA 3O9RA 3LAKA 2ZJPL 5AQKA 3WEEB 1BCMA 3ZSOA 3IS9A 3ZX2A 4DQ8A 5BPNA 1HJRA 1FKPA 1NJIO 1JKHA 3TTCA 3WQUA 3SQ2A 3KK1A 2UUCK 4M7XA 5HRNA 2P9NA 2A40A 4Y1DA 4NCAA 3M5RA 1KVBA 3V1QA 3ZT0A 1XMOK 4E7IA 4BE1A 4KTQA 4DFJA 4JI3K 2D0PA 3DM2A 4C8OA 1VSEA 4I6MA 4R5PA 2HBKA 1K73O 4M41A 2QWOA 4B9LA 3SQ0A 5C12A 3OYHA 4W5QA 3B6PA 1ZBIA 3H3NO 4CEBA 5FROA 4JNEA 1VK0A 5M1QA 4JI4K 1TVRA 3DOLA 1S1WA 4JHDB 3LZIA 3G25A 5AQJA 3U9DA 1HKGA 3CM5A 4CEFA 3J81O 1E4FT 3B8AX 1REVA 3VQPA 1QHAA 3IAYA 3GOIA 5AQRA 4FWPA 4H0XB 4GV3A 1NOZA 2XRIA 3QINA 1KVAA 4Y0WA 4BR4A 1YF5L 3O4WA 1ZBSA 4FJ8A 1NM1A 1KLMA 4DQIA 3AA4A 5JVGL 4IEEA 4H4OA 3VQAA 3LPUA 4E0DA 1TK5A 4H0VB 1CZ9A 4E7JA 3RVCA 1NK6A 2ZQBA 5ELZA 4IKFA 5LJWA 4CEZA 4OKJA 1HKBA 3R8EA 2KTQA 1FXXA 1IKXA 3AAPA 3M8QA 3MDQA 1EWQA 3H45C 4DU3A 3AVAA 1KAZA 4PKHA 1LAWA 1WBBA 1TKDA 3VTHA 3HTVA 3DYAA 2HNZA 4KTZA 4B3TK 4CZEA 5B8HA 4W5RA 3AO1A 3L6QA 2JWLA 2Q31A 1N34K 3QDKA 4KI4A 4KHUA 5DM6L 3E1YA 4AHTA 4O8UA 4KHWA 5KPTA 5BRDA 3NGIA 5I9EB 1LOTB 3CCEN 4HCBA 4AILC 1B92A 1HJOA 4BWMA 1GLAG 2YCHA 2C1GA 4FWRA 1VQ7N 3ZLJA 4JD2A 4W5NA 1ILYA 3WNEA 3EKUA 5AQIA 3NAEA 4X66K 1XNRK 3KJVA 4NO7A 4ICLA 1NJZA 5BR8K 4OJRA 3WNFA 3M8PA 5HRSA 2IC3A 3NF8A 3CCLN 3TTDA 4OLAA 2PAVA 1N33K 1VSHA 4DF8A 1LAVA 1QQMA 3AY9A 4DTNA 4LF4K 5FPDA 3MECA 4DMNA 3O6WA 3FLCO 1NGDA 1SZ2A 2HBJA 1IH7A 4FZZA 4FLVA 3T3FA 4BRIA 3QIOA 4CJ4A 4BRAA 1RT7A 3VQQA 2HBMA 3LP1A 4LF8K 4DV6K 3FZKA 4BE0A 2A1SA 3HP6A 3L3VA 2QK9A 3OBYA 3S9HA 1TUYA 3CJ1A 1W9HA 2WFBA 4DTJA 3SAHA 1KRPA 4DR5K 3O9QA 4CEOA 2P9LB 2XY7A 3T19A 1RBRA 3ZSXA 4PQUA 4KFBA 1V4SA 1GOAA 4KHQA 4CI6A 2HHWA 2VCPA 1KAXA 3PY8A 4JKGA 2FXUA 1NGJA 3OJSA 4N76A 1TUUA 2ZF5O 4MQ3A 4A2BA 4DV2K 4IO8A 4CEEA 3MWPA 2HNYA 2HHXA 2NRVA 3ZETB 1M90O 3DJCA 4CJPA 4CFDA 4KHSA 1WSHA 3UKUB 4B8CA 4Z4IA 3TAQA 4X65K 4NLCA 4RCHA 4LSNA 5E26A 4DTMA 1NWKA 3RR8A 3KWIA 1BIZA 3MK6A 4IFYA 1MU2A 4YY3K 1WSJA 1K8AO 3IFRA 3VA0A 1Z05A 4KREA 4EZ9A 3HSTB 4IG3A 1SV5A 3O08A 4JKAA 1U4BA 4M45A 2CGJA 2JWKA 4CZLA 3T7ZA 4ISEA 4EP5A 2D0CA 4DSLA 4PY5A 2HHUA 1QZ6A 2ZGYA 4WE1A 4K43A 2E5LK 1HYVA 3TAFA 4CEQA 4DV7K 2J4RA 2BANA 3ZSWA 3L2VA 4RW9A 4M3XA 3LANA 3DOKA 4FXDA 4H5NA 5JS2A 5BR9A 4AHUA 1JL2A 3MN9A 1CXUA 4PKGA 3K58A 3DXKB 3VQBA 3EZWA 4BC5A 3ZYYX 1B9FA 4B9UA 2OZSA 1S72N 3LP2A 4Z4FA 1NJXA 4CJFA 4CBXA 4DKWA 4HCCA 1T6CA 4KH5A 2Y1JA 2O8FB 3MCPA 2E2OA 3O5BA 3AVGA 1IJJA 3CC4N 3A2FA 1B9DA 3F73A 1C0GA 4DF4A 2Z1GA 4N5SA 2QWQA 1K8KB 3A8YA 5TKWA 4BRNA 5DMRA 1EXQA 1XMQK 4KB0A 2Q97A 1GOBA 4NXMK 3HL8A 2GBZA 4CZMA 2E2NA 4Z0UA 4CF1A 4FZXC 2JLEA 4XEIA 3LWMA 2P9SB 4J2BA 1YJWN 3CQ8A 4DQQA 1TKZA 2G8IA 3HPHA 4BRPA 4IOCL 1C1BA 1JCFA 4RWTA 2QWRA 4Z4CA 4B3RK 1XHZA 4LFAK 5F0XA 4YORA 3RWUA 1MDUB 4FJ9A 3TARA 2HF3A 4YDUC 1P8ZA 2ZE2A 4KH6A 3EYZA 5D3GA 5AQMA 2YX6A 5AZIA 3KK2A 4CJQA 2XY6A 2IVPA 3NVMA 4BVPA 1OH5A 4CZGA 1S1TA 5C10A 1QS4A 1RT4A 1BI4A 3VOVA 4BREA 3HVRA 5AQSA 3P5JA 1OH7A 2X78A 4E3SA 3LPTA 4DU4A 1XC3A 1R0AA 3C6AA 1ASVA 1SUQA 2E4LA 3RMDA 4ELUA 1YTAA 3H6EA 4BE7B 4RG8A 1NGCA 3J7AP 4FJGA 2E2QA 5JLHA 1YVNA 1KFDA 2A5XA 2F96A 2OYQA 2D0AA 1HNZK 3V4IA 1UAXA 4F2RA 3THWB 2O4IA 2W00A 1QTMA 5AFUH 2BUPA 4L8RB 1Y97A 1O13A 4F9OA 2IGIA 3T1HK 3THYB 1U04A 2QWNA 1Q9YA 3CYMA 3UKRA 4OKKA 2AP1A 4FPBA 4CHZA 3DLBA 2QW9A 3MEDA 2P9UB 4B1XB 2B6AA 4OPKA 2H3GX 3HBTA 1T6DA 3P83D 3LM2A 1GOCA 2IVNA 3MAQA 2XO7A 4BEBA 3AVLA 3S3MA 5JS1A 1MWMA 4FJ5A 3JXUA 1VQ5N 3UIQA 5I42A 1H1VA 3R1XA 4CZHA 3VEOA 1QVFM 1JJ2M 4O0IA 1S1VA 3RR7A 2HMIA 1NKEA 3M1FA 2D0OA 4CCHA 3PLAA 1KTQA 3VQ5A 3BZKA 1S6PA 4PL7A 2F9WA 4H8KA 5KQDA 1IBKK 4V19S 1HYSA 4ELTA 4KHPK 4JN4A 4C23A 4DV5K 4DR1K 3ITHA 4LF6K 4CEAA 4DV4K 5JENA 2WONA 4FL9A 1TYQA 1X9MA 3H46O 2E88A 1NMNA 3D2EB 3M3ZA 4DTPA 1L3SA 3AVMA 3C95A 3AO5A 4FWNA 2V7YA 2FSNA 3VEXA 2HSTA 1TGOA 2D4WA 2ZD1A 5KPRA 3VGKA 3NDKA 1XNQK 3ZEUA 1GLCG 4A57A 3ENBA 4BRFA 1FW6A 4Z4HA 2E2PA 1HYZA 3HRGA 5AJ3K 1SL1A 1HLUA 3VGMA 2VGMA 3DLEA 5AQGA 3ULEB 4Q0BA 3PO5A 3MCAB 4DV3K 3FR0A 1Q81O 4UY8O 3TAPA 4DV0K 4FLUA 2NRHA 5LMNK 4CJKA 2Q2RA 4KO0A 2PBDA 1BG3A 4EHUA 1EWRA 4FLTA 4BY9C 4PA1A 4CGFA 1RT3A 3OTOK 3SV4A 3W3DA 1BIUA 3K57A 3U9ZA 4CE9A 2YNGA 4B9NA 2G8UA 1YAGA 2VWKA 4EAHD 3EKSA 5GAEP 4J2DA 4O44A 4FLZA 2O4GA 5GAGP 3C6UA 3HPOA 5AQUA 3K5MA 3L2RA 4OLBA 1Z26A 5CR4A 5FRNA 4CHQA 4QS7A 2HHHK 3L4IA 3V9UA 1VAZA 1DTTA 4FJKA 4H0TB 3H3OB 2RKIA 5EVZA 1RDUA 4C1NK 2WOMA 3SV3A 4I6MB 2X6NA 3K9JA 3MEGA 1JL1A 3F9MA 4M42A 5KQ8A 4FWKA 3VQEA 1WUAA 4BACA 3AO3A 4AHSA 3OYDA 2C1IA 3W0LA 1WAJA 3TANA 1JXEA 1KSPA 4I9QA 4CEDA 2IS3A 3VQDA 1TL3A 3WXLA 5EX5A 1BWFO 1TL1A 1BDGA 4CZFA 3QERA 4JYAK 3KKRA 3RTVA 4ZHRA 5J2NA 3QNNA 1IG9A 4YDUA 3KK3A 3F2KA 3MEEA 4JKBA 4BGBA 1SKWA 4AQYK 3T1AA 4NLBA 5FPEA 4OO1J 3CG7A 3TSUA 3CYGA 3O3FA 1WB9A 1XUPO 5SWMA 1U2VB 2GUIA 3QESA 2OA8A 3RSEB 5EXWA 4CJVA 1NGHA 2DFEA 3SUNA 2UU9K 2P9PA 1VQ6N 3V9SA 3KTQA 3ENOA 5SZTA 1A5WA 5CY4A 5E41A 1C1CA 1I94K 5AQNA 1C0UA 1X1PA 1Z25A 1UA1A 4QAGA 3M6GA 3V9XA 4U67L 5IT9O 1VRTA 5AQZA 2ATQA 1YJ9N 4LFBK 1WAFA
chains in the Genus database with same CATH topology
2YJFA 1GLLO 5FPDA 4A5BA 2F7TA 2V7ZA 3CJ9A 3O6WA 1G99A 1NGDA 1SZ2A 2HBJA 2AA4A 3FLCO 3FZMA 4FOEA 4HTLA 4IXCA 3ZETA 1N8RO 5AQVA 1VQMN 4BRIA 4XJXA 4BRAA 2HBMA 5C2DA 3NVKA 3CQYA 3LDLA 3FZKA 4BRCA 4H0OA 1R59O 2NRZA 4MO5A 3LDQA 3KZBA 3OBYA 3J7ZO 2NRWA 3FZHA 1BOTO 3D2FA 1JCGA 3CHWA 5AQTA 2QA4N 2OTLN 1TUYA 3CJ1A 4PL8A 4JK7A 2WFBA 2E20A 3BUZB 1YHQN 1QVGM 3SAHA 4FPAA 2OANA 3HZ6A 4CJ7A 4H0PA 3R9PA 1DT9A 1P90A 4CBWA 3O9QA 2V51B 2P9LB 1K9MO 1QQNA 2YHYA 2KHOA 1KD1O 1GLEG 3CC2N 3IDHA 3CJCA 1BUPA 1JCEA 4G9ZA 1V4SA 2ZJRL 4WQ4C 1VQ4N 4CI6A 3O9SA 2VCPA 1KAXA 3CCVN 4JKGA 3H1QA 4YOXA 3A5NC 1BU6O 2FXUA 3I33A 4L3QA 5AQQA 5AQWA 3ZEUB 1RGIA 1NGJA 2NZTA 2P9UA 4BC3A 1EO1A 1TUUA 2ZF5O 3IMXA 4A2BA 5M1KA 2P9NB 4IO8A 2FF3B 2VYPA 3CI5A 5AQLA 2W41A 3MWPA 2NRVA 4A59A 3ZETB 5ADXA 2IIRA 3CETA 4BGAA 1M90O 2VGNA 3DJCA 2P9KA 2QM1A 3QICA 1EQYA 1Q86O 3DXKA 2KLAA 1S3XA 1GLDG 2F9TA 3UKUB 4KH4A 3VMFB 4IEIA 4NLCA 3A0IX 1NGAA 4JKFA 3CQXA 4RCHA 5E26A 3S41A 5CE3A 1VQPN 4BRKA 3AGKA 3CJ7A 2RHKA 1NWKA 1HPMA 1OVYA 5TKYA 3KWIA 1E4GT 1RFQA 4H5WA 3MK6A 4E1JA 4JKCA 3UB5A 3LDPA 2FF6A 3BEXA 4A62A 3MWTA 5C15A 2NRTA 1K8AO 5E84A 4IO9L 3IFRA 4MLHA 3P38A 3WT0A 5KPZA 4BR7A 3L0QA 1Z05A 5EOYA 2IVOA 3SMSA 2I7NA 3O08A 4JKAA 1K8KA 4DHYA 2CGJA 2JWKA 4H5TA 1ESVA 4CZLA 4EFHA 2QEXN 3T7ZA 2KKZA 4ISEA 3NMUA 3OA9A 1QZ6A 2ZGYA 3K9KA 4K43A 3WEEA 2Q36A 4WQ5A 1WOQA 3VETA 3CERA 1GLFO 2J4RA 4A2AA 4B1VA 3CXCM 3MX5A 2CGKA 1KQSM 3CMEN 1X9JA 5C0YA 1QQOA 4H5NA 1MA9B 5BR9A 1YJNN 3D6RA 4MO4A 1ATNA 2QWPA 3DLLL 2P9KB 4K41A 3MN9A 5F2RA 4PKGA 1NLVA 3DXKB 3EZWA 4BC5A 1ZC6A 3ZYYX 3E66A 3ZX3A 3CCRN 4FVUA 3Q7BA 4CZIA 3T69A 1BA0A 3TTFA 1S72N 3Q7CA 3AGRA 4BRMA 3DWLA 4KBOA 3WXJA 4CBXA 3C6HA 4DKWA 2A3ZA 1T6CA 4KH5A 4DB3A 4PKIA 3WUHA 3CCMN 4BR2A 1DKGD 3HM8A 3MCPA 5F1XA 2E2OA 2QWLA 3O5BA 3ID8A 3VESA 1IJJA 2GX9A 2A42A 3KK7A 2D1KA 3VENA 3CC4N 4CD1A 2FLOA 4H5RA 2V52B 4JK9A 1C0GA 1VQLN 4QS9A 4BRHA 2QWQA 1K8KB 3A8YA 1SS6A 4K42A 5TKWA 4BRNA 4JK8A 3CCUN 2UYTA 1M1KO 2Q97A 5DM7L 3TPQA 2ZJQL 4CZMA 1SQKA 3TSQA 4H03B 4BR5A 5HL7L 3DXMB 1X3NA 4JHDA 4NB4A 2E2NA 4A61A 2P9IA 2QI2A 3EE9A 2NRXA 4XEIA 2P9SB 3EO3A 1NGFA 2YHWA 1YJWN 4CZKA 2QTDA 4BRPA 4IOCL 2A41A 3GE1A 5AQHA 3OW2M 1BA1A 1JCFA 4RWTA 2QWRA 3R3LA 4B1UB 2NLXA 3LL3A 3TU5A 3VEWA 5GINA 2GTDA 3VF4A 4JD2B 3EE8A 5GIOA 4ISGA 2W40A 2I7PA 5F0XA 4YORA 3L4QA 2P9PB 3CPEA 1MDUB 3EL2A 2HF3A 4WQ5C 4YDUC 1P8ZA 3O8MA 4KH6A 1NGEA 3VEYA 4GV9A 5AQMA 3A5MC 2YX6A 3CJAA 3LDNA 2ASPA 2A6AA 5AZIA 2IVPA 3NVMA 2Q1NA 5GADP 3G71N 5BN8A 4BVPA 5HOOA 4CZGA 5BPLA 4JKHA 2QWMA 1VQ8N 2YJEA 3FZLA 5C10A 1Z6RA 4Z94A 3ATVA 3VOVA 5CHIA 4AF1A 4BREA 1KC8O 3MN6A 2FSJA 5AQSA 4BR0A 3VTIA 5LJVA 3J8AA 1IG8A 3VF6A 3KWGA 3CPWM 1S22A 4BR9A 3SLCA 3H1VX 3C7NA 3TSPA 4MLEA 1XC3A 5M1PA 4IWVA 2HBLA 1RDWX 3GBTA 5JMVA 3C6AA 3OBWA 4BQZA 4A5AA 3I55N 2GWKA 2CH5A 1BO5O 1VQKN 2PFUA 5H1SQ 3E9OA 3H6EA 5GIPA 2ZWHA 4BE7B 1SAZA 5GAHP 4FWSA 1NGCA 3D2FB 4EIAA 4IOXA 2VWBA 1T3VA 3A5LC 2E2QA 5JLHA 1YVNA 2A5XA 4MDAA 5EY4A 5ADXH 4BRGA 5LY3A 2YI1A 2QXLA 3AAQA 4YOVA 1HUXA 2W00A 2BH1A 3N4PA 5M1NA 3QFUA 4RTFD 3SAFA 5AFUH 3SAGA 2BUPA 3CIPA 3VF2A 2GEMA 4PHTX 2HOEA 1NGGA 3CJBA 1O13A 4F9OA 1U2VA 5AZIB 3RSEA 4JKGB 4IOAL 2QWNA 3QB0A 3IUCA 3D2EA 4BC2A 3UKRA 3WXMB 4LC9B 3MN7A 1YIJN 3CD6N 2AP1A 4FPBA 5AQXA 4ILHA 3QBWA 3GDQA 2QW9A 5AR0A 3VEVA 3SK3A 2ASMA 2P9UB 4B1XB 2H3GX 1T44A 3HBTA 5M1OA 1T6DA 2DPNA 4BVOA 3LM2A 5BREA 2E8AA 4DCHA 1W97L 2IVNA 3FFKB 1ZXOA 3CCJN 4BEBA 2Q0RA 1DEJA 3AARA 3N4QA 1MWMA 3JXUA 4B9QA 2WUSA 1VQ5N 3GG4A 1H1VA 3R1XA 3GL1A 5AQFA 5AQYA 3VEOA 4CZHA 5BPMA 5BRHA 1JJ2M 1QVFM 5JVHL 3I8BA 3PIPL 3DAWA 1J6ZA 4CBUA 1KXPA 1X3MA 1V4TA 2D0OA 3M1FA 3ULEA 5JLFA 3PLAA 1QZ5A 2E1ZA 3U4LA 4WFNL 3O1WA 4PL7A 3O1BA 2F9WA 2GWJA 5KQDA 4J8FA 4BECA 4WQ4A 4O5FA 2ASOA 4JN4A 3BF1A 4C23A 4FWQA 1NGIA 4WFAL 3OHRA 5C2FA 4FWMA 1CZAN 4XH1A 1VQON 2YHXA 2E1YA 5AZJA 3VEZA 3QMLA 4FL9A 3QBXA 3VERA 3CMAN 1TYQA 4BQLA 1Q82O 3P31A 4QS8A 4B1YB 1D4XA 3H46O 1YUWA 2E88A 2HMPA 3E9LA 4ILJA 3D2EB 5M1FA 3FZFA 3UKRB 2ZGZA 3O9RA 3M3ZA 4BG8A 2ZJPL 5AQKA 4FWNA 3WEEB 4WFBL 4OPAA 3ZX2A 2V7YA 2FSNA 3VEXA 2FSKA 3FE1A 2HSTA 4XH5A 4DQ8A 4AM7A 2D4WA 5BPNA 5KPRA 3VGKA 1NMDA 1NJIO 3ZEUA 1GLCG 4H0YB 3VGLA 1Y64A 3TTCA 1HX1A 3WQUA 4A57A 3ENBA 4BRFA 4M7XA 2E2PA 3HRGA 2P9NA 2A40A 3I56N 4OPHA 1C0FA 1HLUA 5AQPA 2ITMA 3VGMA 2VGMA 4BC4A 5AQGA 4WCEL 4R79A 2WC9A 1YXQA 3ULEB 3M5RA 4JEPA 4BRLA 3MCAB 1XQSC 5FPNA 1OKJA 3ATUA 3FR0A 3UE5A 1Q81O 4UY8O 3C0BA 2D0PA 4YOTA 3WXKA 4ISFA 3WQTA 4I6MA 3UKUA 3WXIA 4IZ9A 3D7EO 2HBKA 1K73O 2NRHA 3BP8A 3CCSN 2QWOA 5C12A 5AZJB 4XH4A 2Q2RA 4FSVA 2RE2A 2PBDA 3H3NO 1TYQB 3JS6A 1BG3A 3MX2A 2NNWA 4EHUA 1NGBA 3LDOA 3SMPA 4BY9C 4JNEA 3O9TA 1MWKA 5M1QA 1YITN 4YOWA 4IFEA 4JHDB 4IDHA 5AQOA 4WF9L 3W3DA 3G25A 5AQJA 1LCUA 2P9IB 4MDBA 3U9ZA 3U9DA 1HKGA 1E4FT 3B8AX 4C1NI 1YAGA 4FOIA 4CZJA 5JICA 1W2BM 1QHAA 3EKSA 4EAHD 3ZX0A 5GAEP 3HSCA 3GOIA 4JKDA 1NBWA 5AQRA 2BTFA 5FPMA 5GAGP 4FWPA 3KHYA 4H0XB 1ATSA 1YI2N 3C65A 4GV3A 5AQUA 2OTJN 4GY2B 5CR4A 4QS7A 1KAYA 4EHTA 3HI0A 4BROA 3O80A 3L4IA 4O8KA 3CC7N 1VAZA 3HOTA 4Y0WA 4B1WB 4H0TB 1YF5L 3H3OB 4ILGB 4BR4A 3O4WA 1Q18A 1RDUA 4GVEA 5EVZA 4BG9A 3G4SN 4JAXA 1ZBSA 4M7YA 4C1NK 3U8XA 1NM1A 4I6MB 4B1ZA 5AFUA 4IEEA 3K9JA 5JVGL 3P4IA 4H0VB 4JKEA 1Q7YO 4WYBA 2GUPA 4IJAA 1GLJO 4YOUA 3RVCA 3F9MA 5ELZA 4HWIA 3G6EN 3R6MA 5LJWA 3HOSA 5KQ8A 3SBTA 1HKBA 4FWKA 3R8EA 3ID6A 3P39A 1WUAA 3KVGA 2WBNA 2C1IA 4FO0A 5BN9A 3W0LA 3C7NB 3AAPA 3MDQA 4BRDA 4GNIA 3H45C 3A5OC 1KAZA 2Q0UA 4PKHA 4K25A 3BF3A 5BRFA 3WXLA 1DGKN 5EX5A 3CCQN 3VTHA 3HTVA 1BWFO 3PIOL 1VQNN 1BDGA 4CZFA 3QFPA 4AM6A 2NRRA 3EN9A 4CZEA 5B8HA 3DXMA 3FGUA 3L6QA 4FWLA 2JWLA 2Q31A 4YDUA 3QDKA 3O9UA 3F2KA 2CH6A 5DM6L 2GELA 2EWSA 4JKBA 3VPZA 3LM9A 4BGBA 3E1YA 2HF4A 2P9SA 4NLBA 5FPEA 4O8UA 4M63C 5KPTA 5BRDA 1U6ZA 4OO1J 3TSUA 5I9EB 1LOTB 2CGLA 3CCEN 3E9PA 4IJNA 1XUPO 1HJOA 4H5VA 1U2VB 1GLAG 2YCHA 2C1GA 4FWRA 1VQ7N 4JD2A 3RSEB 5EXWA 1ILYA 1NGHA 3EKUA 4U7BA 2P9LA 5AQIA 2P9PA 1VQ6N 3F5TA 3ENOA 4NO7A 1ATRA 4YOYA 1VQ9N 5AQNA 4FWOA 4CD3A 3M6GA 3CCLN 3TTDA 5MLCQ 4U67L 3MN5A 2PAVA 3ENHA 3SJHA 4BRQA 1HKCA 3CF5L 3MMVA 5AQZA 4GV6A 1YJ9N 3IKMA 3SBGA 1QQMA 1GLBG 3AY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJF A;  1GLL O;  5FPD A;  2V7Z A;  3CJ9 A;  3O6W A;  1G99 A;  1NGD A;  1SZ2 A;  2AA4 A;  3FLC O;  3FZM A;  4FOE A;  4HTL A;  4IXC A;  3ZET A;  5AQV A;  4BRI A;  4BRA A;  3CQY A;  3LDL A;  3FZK A;  4BRC A;  4H0O A;  1R59 O;  4MO5 A;  3LDQ A;  3KZB A;  3FZH A;  1BOT O;  3D2F A;  1JCG A;  3CHW A;  5AQT A;  1TUY A;  3CJ1 A;  4PL8 A;  2E20 A;  3BUZ B;  4FPA A;  2OAN A;  3HZ6 A;  4CJ7 A;  4H0P A;  3R9P A;  4CBW A;  2V51 B;  2P9L B;  1QQN A;  2YHY A;  2KHO A;  1GLE G;  3IDH A;  3CJC A;  1BUP A;  1JCE A;  1V4S A;  4WQ4 C;  4CI6 A;  2VCP A;  1KAX A;  3H1Q A;  3A5N C;  1BU6 O;  2FXU A;  3I33 A;  4L3Q A;  5AQQ A;  5AQW A;  3ZEU B;  1RGI A;  1NGJ A;  2NZT A;  2P9U A;  4BC3 A;  1TUU A;  2ZF5 O;  3IMX A;  4A2B A;  2P9N B;  4IO8 A;  2FF3 B;  2VYP A;  3CI5 A;  5AQL A;  2W41 A;  3ZET B;  5ADX A;  2IIR A;  3CET A;  4BGA A;  3DJC A;  2P9K A;  2QM1 A;  3QIC A;  1EQY A;  3DXK A;  1S3X A;  1GLD G;  2F9T A;  3UKU B;  3A0I X;  1NGA A;  4RCH A;  3CQX A;  5E26 A;  3S41 A;  5CE3 A;  4BRK A;  3CJ7 A;  1NWK A;  1HPM A;  5TKY A;  4H5W A;  1E4G T;  1RFQ A;  4E1J A;  3MK6 A;  3UB5 A;  3LDP A;  2FF6 A;  3BEX A;  4A62 A;  5E84 A;  3IFR A;  4MLH A;  3WT0 A;  5KPZ A;  4BR7 A;  3L0Q A;  1Z05 A;  5EOY A;  2IVO A;  3SMS A;  2I7N A;  3O08 A;  1K8K A;  4DHY A;  2CGJ A;  4H5T A;  4CZL A;  1ESV A;  4EFH A;  4ISE A;  1QZ6 A;  2ZGY A;  4K43 A;  3WEE A;  2Q36 A;  4WQ5 A;  1WOQ A;  3VET A;  3CER A;  1GLF O;  2J4R A;  4A2A A;  4B1V A;  2CGK A;  1X9J A;  1QQO A;  4H5N A;  1MA9 B;  5BR9 A;  4MO4 A;  1ATN A;  2QWP A;  2P9K B;  4K41 A;  3MN9 A;  5F2R A;  4PKG A;  1NLV A;  3DXK B;  3EZW A;  4BC5 A;  1ZC6 A;  3ZX3 A;  4CZI A;  1BA0 A;  4BRM A;  3DWL A;  4KBO A;  3WXJ A;  4CBX A;  2A3Z A;  1T6C A;  4DB3 A;  4PKI A;  3WUH A;  4BR2 A;  1DKG D;  3HM8 A;  3MCP A;  5F1X A;  2E2O A;  2QWL A;  3O5B A;  3ID8 A;  3VES A;  1IJJ A;  2A42 A;  2D1K A;  3VEN A;  4CD1 A;  2FLO A;  4H5R A;  2V52 B;  1C0G A;  4QS9 A;  4BRH A;  2QWQ A;  1K8K B;  3A8Y A;  4BRN A;  4K42 A;  2UYT A;  2Q97 A;  3TPQ A;  4CZM A;  1SQK A;  4H03 B;  4BR5 A;  3DXM B;  1X3N A;  4JHD A;  4NB4 A;  2E2N A;  4A61 A;  2P9I A;  4XEI A;  2P9S B;  3EO3 A;  1NGF A;  2YHW A;  4CZK A;  4BRP A;  2A41 A;  3GE1 A;  5AQH A;  1BA1 A;  1JCF A;  4RWT A;  2QWR A;  4B1U B;  2NLX A;  3LL3 A;  3TU5 A;  3VEW A;  2GTD A;  3VF4 A;  4JD2 B;  4ISG A;  2W40 A;  2I7P A;  5F0X A;  2P9P B;  1MDU B;  3EL2 A;  2HF3 A;  4WQ5 C;  4YDU C;  1P8Z A;  3O8M A;  1NGE A;  3VEY A;  5AQM A;  3A5M C;  3CJA A;  3LDN A;  5AZI A;  2ASP A;  2A6A A;  2IVP A;  2Q1N A;  5BN8 A;  4BVP A;  4CZG A;  5BPL A;  2QWM A;  2YJE A;  3FZL A;  1Z6R A;  4Z94 A;  3ATV A;  3VOV A;  4BRE A;  3MN6 A;  2FSJ A;  5AQS A;  4BR0 A;  5LJV A;  3J8A A;  1IG8 A;  3VF6 A;  1S22 A;  4BR9 A;  3SLC A;  3H1V X;  3C7N A;  4MLE A;  1XC3 A;  4IWV A;  1RDW X;  3GBT A;  5JMV A;  4BQZ A;  2GWK A;  2CH5 A;  1BO5 O;  3H6E A;  2ZWH A;  1SAZ A;  4FWS A;  1NGC A;  3D2F B;  4EIA A;  2VWB A;  3A5L C;  2E2Q A;  5JLH A;  1YVN A;  2A5X A;  5EY4 A;  5ADX H;  4BRG A;  5LY3 A;  2YI1 A;  2QXL A;  3AAQ A;  1HUX A;  3QFU A;  4RTF D;  5AFU H;  2BUP A;  3CIP A;  3VF2 A;  2GEM A;  2HOE A;  1NGG A;  3CJB A;  4F9O A;  1U2V A;  5AZI B;  3RSE A;  2QWN A;  3QB0 A;  3IUC A;  3D2E A;  4BC2 A;  3UKR A;  4LC9 B;  3MN7 A;  2AP1 A;  4FPB A;  5AQX A;  3VEV A;  3QBW A;  3GDQ A;  2QW9 A;  5AR0 A;  3SK3 A;  2ASM A;  2P9U B;  4B1X B;  2H3G X;  1T44 A;  3HBT A;  1T6D A;  2DPN A;  4BVO A;  3LM2 A;  5BRE A;  2E8A A;  4DCH A;  2IVN A;  3FFK B;  1ZXO A;  2Q0R A;  1DEJ A;  3AAR A;  1MWM A;  3JXU A;  4B9Q A;  2WUS A;  3GG4 A;  1H1V A;  5AQF A;  3GL1 A;  5AQY A;  3VEO A;  4CZH A;  5BPM A;  5BRH A;  3I8B A;  3DAW A;  1J6Z A;  4CBU A;  1KXP A;  1X3M A;  1V4T A;  2D0O A;  3M1F A;  3ULE A;  5JLF A;  1QZ5 A;  2E1Z A;  3U4L A;  3O1W A;  4PL7 A;  3O1B A;  2F9W A;  2GWJ A;  5KQD A;  4J8F A;  4WQ4 A;  4O5F A;  2ASO A;  4JN4 A;  3BF1 A;  4C23 A;  4FWQ A;  1NGI A;  3OHR A;  4FWM A;  1CZA N;  4XH1 A;  2YHX A;  2E1Y A;  5AZJ A;  3VEZ A;  3QML A;  4FL9 A;  3QBX A;  3VER A;  1TYQ A;  4BQL A;  4QS8 A;  4B1Y B;  1D4X A;  3H46 O;  1YUW A;  2E88 A;  2HMP A;  3D2E B;  3FZF A;  3UKR B;  2ZGZ A;  3M3Z A;  4BG8 A;  5AQK A;  4FWN A;  3WEE B;  3ZX2 A;  2V7Y A;  2FSN A;  3VEX A;  2FSK A;  3FE1 A;  4XH5 A;  4DQ8 A;  4AM7 A;  2D4W A;  5BPN A;  5KPR A;  3VGK A;  1NMD A;  3ZEU A;  1GLC G;  4H0Y B;  3VGL A;  1Y64 A;  1HX1 A;  3WQU A;  4BRF A;  4M7X A;  2E2P A;  2P9N A;  2A40 A;  2ITM A;  1C0F A;  1HLU A;  5AQP A;  3VGM A;  4BC4 A;  5AQG A;  3ULE B;  1YXQ A;  4BRL A;  1XQS C;  5FPN A;  1OKJ A;  3ATU A;  3FR0 A;  3UE5 A;  3C0B A;  2D0P A;  3WXK A;  4ISF A;  3WQT A;  4I6M A;  3UKU A;  3WXI A;  4IZ9 A;  3D7E O;  2NRH A;  3BP8 A;  2QWO A;  5AZJ B;  4XH4 A;  2Q2R A;  4FSV A;  2PBD A;  3H3N O;  1TYQ B;  3JS6 A;  1BG3 A;  4EHU A;  1NGB A;  3LDO A;  3SMP A;  4JNE A;  1MWK A;  4JHD B;  5AQO A;  3W3D A;  3G25 A;  5AQJ A;  1LCU A;  2P9I B;  3U9Z A;  3U9D A;  1HKG A;  1E4F T;  3B8A X;  4CZJ A;  1YAG A;  4FOI A;  5JIC A;  1QHA A;  3EKS A;  4EAH D;  3ZX0 A;  3HSC A;  3GOI A;  1NBW A;  5AQR A;  2BTF A;  5FPM A;  4FWP A;  3KHY A;  4H0X B;  1ATS A;  5AQU A;  4GY2 B;  4QS7 A;  1KAY A;  4EHT A;  3HI0 A;  4BRO A;  3O80 A;  3L4I A;  4O8K A;  4Y0W A;  4B1W B;  4H0T B;  3H3O B;  4BR4 A;  3O4W A;  1Q18 A;  5EVZ A;  4BG9 A;  4JAX A;  1ZBS A;  4M7Y A;  3U8X A;  1NM1 A;  4I6M B;  4B1Z A;  5AFU A;  3P4I A;  4H0V B;  4WYB A;  2GUP A;  4IJA A;  1GLJ O;  3F9M A;  5ELZ A;  4HWI A;  3R6M A;  5LJW A;  5KQ8 A;  1HKB A;  4FWK A;  3R8E A;  1WUA A;  3KVG A;  4FO0 A;  5BN9 A;  3W0L A;  3C7N B;  3AAP A;  3MDQ A;  4BRD A;  4GNI A;  3H45 C;  3A5O C;  1KAZ A;  2Q0U A;  4PKH A;  4K25 A;  3BF3 A;  5BRF A;  3WXL A;  1DGK N;  5EX5 A;  3HTV A;  1BWF O;  1BDG A;  4CZF A;  3QFP A;  4AM6 A;  3EN9 A;  4CZE A;  5B8H A;  3DXM A;  3FGU A;  3L6Q A;  4FWL A;  2Q31 A;  4YDU A;  3QDK A;  2CH6 A;  2GEL A;  2EWS A;  3VPZ A;  4BGB A;  3LM9 A;  2HF4 A;  2P9S A;  5FPE A;  4M63 C;  5KPT A;  5BRD A;  1U6Z A;  5I9E B;  1LOT B;  2CGL A;  4IJN A;  1XUP O;  1HJO A;  4H5V A;  1U2V B;  1GLA G;  2YCH A;  4FWR A;  4JD2 A;  3RSE B;  5EXW A;  1NGH A;  3EKU A;  2P9L A;  5AQI A;  2P9P A;  3ENO A;  4NO7 A;  1ATR A;  5AQN A;  4FWO A;  4CD3 A;  3M6G A;  3MN5 A;  2PAV A;  3ENH A;  3SJH A;  4BRQ A;  1HKC A;  3MMV A;  5AQZ A;  1QQM A;  1GLB G;  3AY9 A; 
#chains in the Genus database with same CATH topology
 1GLL O;  4A5B A;  4IBN A;  2V7Z A;  3CJ9 A;  2AA4 A;  4FOE A;  3CPW M;  3FZM A;  4IXC A;  4HTL A;  1N8R O;  3IG1 A;  1IKW A;  1A5X A;  3ISN C;  4QOZ B;  4DR4 K;  2IOC A;  1JLB A;  4B8A B;  2HHQ A;  4MO5 A;  4DQP A;  2NRZ A;  4I2Q A;  4NYF A;  3NH2 A;  5I3U A;  3NCI A;  3KZB A;  3FZH A;  1BOT O;  3B6O A;  1JCG A;  3CHW A;  4N41 A;  4PL8 A;  3SCX A;  3R9P A;  3KLE A;  4FLW A;  1P90 A;  4CBW A;  1QQN A;  2KHO A;  3VQ8 A;  1BUP A;  4NXN K;  2F8T A;  4YOX A;  4FJN A;  5AQW A;  1SKR A;  4CGH A;  3THX A;  2YNF A;  4BC3 A;  1WNS A;  2YHB A;  4DR7 K;  1EO1 A;  5M1K A;  1RT2 A;  2FF3 B;  2VYP A;  3QIP A;  5AQL A;  2VG6 A;  4A59 A;  5J2P A;  2IIR A;  2RN2 A;  4BGA A;  3L2W A;  4AHV A;  3QIC A;  1RT1 A;  1Q86 O;  1S9G A;  1S3X A;  2KQ2 A;  3A0I X;  1NGA A;  2DY4 A;  3SI6 A;  1VQP N;  3V1O A;  3DLH A;  1WSE A;  4JS4 A;  4I9L A;  5TKY A;  4H5W A;  1RFQ A;  4E1J A;  1CXQ A;  4B08 A;  3LDP A;  2P51 A;  4A62 A;  2NRT A;  3P38 A;  3L3U A;  1X9W A;  3L0Q A;  4KTW A;  3K5O A;  3KIO A;  4LF5 K;  3HVT A;  4EFH A;  2QEX N;  4B9T A;  4DLG A;  4QCL A;  3NF7 A;  3NMU A;  3OA9 A;  3OYF A;  4B3M K;  3L2Q A;  3HT3 A;  3WEE A;  1VSL A;  1WOQ A;  1GLF O;  4B1V A;  2W42 A;  3CXC M;  1NK9 A;  1HNI A;  2OZM A;  3HJF A;  1MA9 B;  4KKO A;  3KLG A;  1ATN A;  5EU7 A;  3U3G A;  3CCR N;  4CZI A;  1BA0 A;  3TTF A;  1EET A;  3ASM A;  1YTU A;  1U49 A;  4C8M A;  3Q7C A;  2PYJ A;  4BRM A;  4FK2 A;  3DWL A;  2A3Z A;  4DB3 A;  4CFB A;  4PKI A;  1C0T A;  1RTI A;  3CCM N;  5K14 A;  3HM8 A;  4CF8 A;  3VES A;  2A42 A;  3DRP A;  3KK7 A;  3RRG A;  4GMJ B;  4QS9 A;  4K42 A;  3CCU N;  4JK8 A;  3S5T A;  3TPQ A;  2ZJQ L;  1NK7 A;  5HRR A;  3DXM B;  1X3N A;  4JHD A;  4NB4 A;  1TKT A;  2QI2 A;  3EE9 A;  4BWJ A;  1NGF A;  4CZK A;  4DS5 A;  2A41 A;  3PX4 A;  4TSX A;  1XHX A;  1BA1 A;  4LH4 A;  5CZ1 A;  4AHR A;  1HR0 K;  4EZ6 A;  2I5J A;  3OYJ A;  4WQ5 C;  4CK2 A;  1NGE A;  3V81 A;  4CFC A;  1LWE A;  4B9V A;  3A5M C;  5GAD P;  3G71 N;  2Q1N A;  5BN8 A;  3AO4 A;  5BPL A;  4E7K A;  1VQ8 N;  2QWM A;  3QO9 A;  4H4M A;  2YJE A;  2P5G A;  5CHI A;  4FZY A;  1S1U A;  5LJV A;  3J8A A;  1IG8 A;  1WN7 A;  3DLG A;  4BR9 A;  3SLC A;  3TSP A;  4FJ7 A;  1RDW X;  3AO2 A;  3V1R A;  5CYM A;  3ZT2 A;  4M3Y A;  2CH5 A;  1BO5 O;  5KI6 A;  2PFU A;  5H1S Q;  4DFM A;  2ZWH A;  1SAZ A;  2XHB A;  3D2F B;  2BE2 A;  3I0R A;  3PO4 A;  4E7H A;  5EY4 A;  4K8X A;  3ZSQ A;  4J2E A;  2DFF A;  3ZCM A;  3ZT3 A;  3NGY A;  4FM0 A;  4CW7 B;  3N4P A;  3QFU A;  3SAF A;  5HP1 A;  3OS0 A;  3VF2 A;  3THV A;  1JLE A;  5C42 A;  1VSI A;  5HRP A;  4JRP A;  1LWC A;  1DTQ A;  5AZI B;  2EX3 A;  2VWJ A;  3QB0 A;  4B9S A;  2O8B A;  4LC9 B;  3MN7 A;  1J9A A;  3QBW A;  5AR0 A;  2ASM A;  1S6Q A;  4F8R A;  1ZBU A;  1TKX A;  2E8A A;  1Q9X A;  3HM9 A;  3FFK B;  1ZXO A;  4B3O A;  2Q0R A;  4F3O A;  1YT3 A;  1EX4 A;  3AAR A;  4M3R A;  2F4V K;  3GG4 A;  5AQF A;  5LMU K;  3I8B A;  2AJQ A;  1BL3 A;  4DV1 K;  1J6Z A;  1DLO A;  4UQG A;  1V4T A;  1VHX A;  3OYG A;  4B3S K;  1NNE A;  4FWQ A;  3OHR A;  5C2F A;  4DU1 A;  2PY5 A;  1BQN A;  3EEQ A;  1QSS A;  3AVI A;  2YHX A;  2E1Y A;  5AZJ A;  4HTU A;  4CK3 A;  3VEZ A;  3ALY A;  2O8C A;  1D4X A;  1RBS A;  2HMP A;  3UKR B;  2ZGZ A;  3O3G A;  4BG8 A;  4HUE A;  5A2Q O;  4FK0 A;  4WFB L;  4OPA A;  4E7L A;  1RDC A;  1VSJ A;  1JLF A;  2FSK A;  3FE1 A;  3ZSY A;  3DRR A;  4CFA A;  3VQ9 A;  1RT6 A;  4H0Y B;  3DLR A;  3VGL A;  4CJT A;  2KZM A;  4BE2 A;  1HX1 A;  3OYB A;  3O3H A;  3I56 N;  5AQP A;  4BC4 A;  4WCE L;  4DR6 K;  4BRL A;  1XQS C;  2UXC K;  3V9W A;  4YOT A;  4JI5 K;  3WQT A;  1I39 A;  3WXI A;  3UKU A;  4IZ9 A;  1S5J A;  4PUO A;  3BP8 A;  4CEC A;  3LP3 A;  4XH4 A;  4FSV A;  3HP9 A;  1TYQ B;  4DWI A;  1L3V A;  3LDO A;  1TV6 A;  1RDD A;  4HVJ A;  3O9T A;  1MWK A;  1YIT N;  4YOW A;  4WF9 L;  1U47 A;  2P9I B;  3RMB A;  4MDB A;  4LFC K;  2HHT A;  4C1N I;  5JIC A;  4M3Z A;  1W2B M;  3G0Z A;  3CFO A;  4N47 A;  5KGX A;  2BTF A;  3KHY A;  3MXJ A;  1YI2 N;  3C65 A;  1S1X A;  4CHY A;  1YVU A;  1KAY A;  4DFK A;  1ZBF A;  4BRO A;  3CC7 N;  3HOT A;  4ELV A;  4G1Q A;  3TAE A;  1N5Y A;  1LV5 A;  4BG9 A;  4JAX A;  3BZC A;  4RW6 A;  3U8X A;  2UUB K;  4JI0 K;  4JI1 K;  4X62 K;  3P4I A;  4IJA A;  2GUP A;  2HB5 A;  1F21 A;  3R6M A;  1D5A A;  2E6L A;  2WBN A;  4JLH A;  4CF0 A;  4CF2 A;  5BN9 A;  4DSJ A;  4DLE A;  2O8D B;  3C7N B;  4DTS A;  3V6D A;  2YV0 X;  4BRD A;  4GNI A;  4CJ5 A;  2Q0U A;  1L3T A;  2UUA K;  4K25 A;  3BF3 A;  1DGK N;  2IAJ A;  3PIO L;  1NU0 A;  4F3T A;  1JXB A;  3ZSV A;  3EN9 A;  3LZJ A;  3NFA A;  3FGU A;  2X74 A;  3O9U A;  1KCF A;  2EWS A;  3VPZ A;  3LM9 A;  2HF4 A;  2P9S A;  4M63 C;  4X64 K;  1EP4 A;  1U6Z A;  2Y1I A;  2OPS A;  4KB1 A;  3AVH A;  2CGL A;  2VQE K;  4N56 A;  4H5V A;  1J53 A;  3ULD A;  1TAU A;  4FLX A;  4E19 A;  3MXI A;  3VA3 A;  4DR2 K;  4BDY A;  3F5T A;  3AVC A;  4YNQ A;  1T8E A;  1ATR A;  4YOY A;  1N36 K;  2DFH A;  4DQS A;  4FWO A;  3U3Y A;  5MLC Q;  4BRQ A;  3ENH A;  4Z4E A;  3CF5 L;  2B5J A;  3MMV A;  4GV6 A;  4HHT A;  3IKM A;  1GLB G;  5KRS A;  2YJF A;  1K6Y A;  1FK9 A;  4CIF A;  2YNI A;  1T05 A;  1VQM N;  4XJX A;  2HND A;  3BGR A;  4CJ3 A;  2FBV A;  5J1E A;  1R59 O;  3QEX A;  1QE1 A;  3E01 A;  3LDQ A;  4M3U A;  3J7Z O;  1QSL A;  4C8N A;  4JK7 A;  2E20 A;  3BUZ B;  5KTQ A;  4FPA A;  2OAN A;  4H0P A;  1DT9 A;  3THW A;  2V51 B;  2VG7 A;  3VQ7 A;  1JCE A;  4OKE A;  3OYK A;  1VQ4 N;  1IKV A;  4O5B A;  3THY A;  3CCV N;  3A5N C;  5AQQ A;  3I33 A;  4L3Q A;  2YNH A;  2YHA A;  2NZT A;  5FLX O;  2P9U A;  2VQF K;  2D0B A;  2P9N B;  4DSK A;  3CI5 A;  1C0M A;  2Q3S A;  4HUF A;  1N6Q A;  3CET A;  2VGN A;  2P9K A;  1EQY A;  4KAZ A;  3AA3 A;  1VSM A;  4CHO A;  2KLA A;  1GLD G;  4FJX A;  3VMF B;  4IEI A;  1XC9 A;  4JKF A;  3CQX A;  1NJY A;  3HK2 A;  1RTH A;  4BRK A;  3AGK A;  3CJ7 A;  1D8Y A;  2RHK A;  1OVY A;  4JKC A;  4JI2 K;  5J2M A;  2FF6 A;  2G8H A;  4IO9 L;  1LW2 A;  4MLH A;  2KZZ A;  1D9D A;  3ZT4 A;  1NKC A;  1IV0 A;  5KGW A;  2IVO A;  4FW1 A;  4OX9 K;  1ASW A;  3QLH A;  4DHY A;  3SZ2 A;  4H5T A;  1ESV A;  4DTR A;  4BDP A;  3OVN A;  2ETJ A;  2HHI A;  3L8B A;  4FCY A;  1VSD A;  4F4K A;  3J80 O;  2Q36 A;  2UXD K;  3VET A;  3CER A;  3PSI A;  1NG9 A;  3MX5 A;  2CGK A;  1KQS M;  1ITG A;  1LW0 A;  1YJN N;  3D6R A;  4MO4 A;  5HBM A;  2QWP A;  4KI6 A;  5F2R A;  1NLV A;  4CER A;  3LDS A;  1G15 A;  1UWB A;  3KLF A;  2GV9 A;  3C6H A;  4C8K A;  3WUH A;  4IDK A;  3SJJ A;  3CFR A;  4DTO A;  5F1X A;  3WNH A;  2QWL A;  3S3N A;  3ID8 A;  2FBT A;  2OPQ A;  4CGI A;  4Z4G A;  1C6V A;  3CM6 A;  4CD1 A;  4KPY A;  1VQL N;  4JK9 A;  4CHN A;  4CK1 A;  1M1K O;  1OVQ A;  2UYT A;  4DTX A;  1JLA A;  5C24 A;  3JYT A;  5DM7 L;  4K8Z A;  4H03 B;  4BR5 A;  1BCO A;  3QET A;  4E89 A;  2HHS A;  3SUP A;  3OS1 A;  4A61 A;  4LH5 A;  1E3M A;  2NRX A;  4DFP A;  3EO3 A;  4LY7 A;  3TAM A;  2QTD A;  4DSF A;  3AVF A;  3OW2 M;  3CFP A;  4FJJ A;  3VEW A;  4FLY A;  3VF4 A;  4JD2 B;  5GIO A;  1UOC A;  4ISG A;  2W40 A;  2I7P A;  3TI0 A;  3L4Q A;  1RCH A;  3CPE A;  1RBU A;  3ZT1 A;  3AVK A;  3EL2 A;  3O8M A;  2P5O A;  3VEY A;  4ZTJ A;  4GV9 A;  3QEV A;  3SNN A;  2ASP A;  2A6A A;  4JS5 A;  4JKH A;  3FZL A;  4Z94 A;  1XI1 A;  4RW4 A;  1KC8 O;  3MN6 A;  2FSJ A;  4BR0 A;  2O8E A;  3VTI A;  3FFI A;  2DTU A;  4FJM A;  3KWG A;  1S22 A;  4CJR A;  5M1P A;  3NGZ A;  4IWV A;  2HBL A;  4OVL A;  5JMV A;  2LSN A;  4A5A A;  4W5O A;  3I55 N;  5J2Q A;  5CZ2 A;  5IWA K;  3E9O A;  5GIP A;  2KFZ A;  4OPJ A;  5GAH P;  4EIA A;  4IOX A;  4DSI A;  3A5L C;  5LY3 A;  2YI1 A;  4NYN A;  1BHL A;  4BDZ A;  4YOV A;  4FYD A;  2BH1 A;  3KKS A;  4CJL A;  3SAG A;  4M3W A;  3CIP A;  4FVM A;  1NGG A;  3CJB A;  2F8S A;  1U2V A;  3RSE A;  4JKG B;  4IOA L;  3C94 A;  3IUC A;  4GW6 A;  1IKY A;  3WXM B;  1YIJ N;  3CD6 N;  5AQX A;  4ILH A;  1Q8I A;  2Z1H A;  2DPN A;  4BVO A;  4FJL A;  1BGX T;  1QSY A;  1W97 L;  4KHY A;  3CCJ N;  1RT5 A;  3LWL A;  1W7A A;  1T03 A;  3AA5 X;  4B9Q A;  2OPR A;  1N32 K;  5BPM A;  3PIP L;  2QXF A;  4CBU A;  5JLF A;  1QZ5 A;  2E1Z A;  3U4L A;  3RMC A;  4XIU A;  4WFN L;  3O1W A;  2GWJ A;  4AH9 A;  4J8F A;  4NCG A;  4O5F A;  2QKB A;  2FBX A;  4CIE A;  1NGI A;  5C25 A;  1CZA N;  4XH1 A;  1VQO N;  3QML A;  4O55 A;  1RTD A;  3QBX A;  4ID5 A;  3CMA N;  4BQL A;  4B1Y B;  5M1F A;  3VQC A;  2PZS A;  2O8B B;  2OPP A;  4OGE A;  2D5R A;  3D0P A;  3RRH A;  3SUO A;  4XH5 A;  2ZM6 K;  3C6T A;  4AM7 A;  4DUZ K;  4EP4 A;  2PYL A;  2R7Y A;  1NMD A;  4IFV A;  2HVI A;  1Y64 A;  1IBM K;  4OGC A;  2QKK A;  4OPH A;  1C0F A;  2YKM A;  2ITM A;  3QEI A;  4R79 A;  2WC9 A;  1YXQ A;  4JEP A;  3S3O A;  5FPN A;  4CJE A;  2XY5 A;  1OKJ A;  3ATU A;  3UE5 A;  3C0B A;  3WXK A;  4B9M A;  4ISF A;  4RW8 A;  1IBL K;  3D7E O;  1SL2 A;  3NH0 A;  3G10 A;  3CCS N;  3SQ1 A;  5AZJ B;  4CJW A;  3NF6 A;  5HRO A;  2RE2 A;  4FM1 A;  2X6S A;  3JS6 A;  1ZBL A;  1ZBH A;  3MX2 A;  2O8C B;  2NNW A;  3SUQ A;  2KFN A;  1HMV A;  4I2P A;  1NGB A;  3SMP A;  3P1G A;  2G8K A;  1UA0 A;  4IFE A;  1T7P A;  5AQO A;  4IDH A;  1WSI A;  1D9F A;  3KLH A;  1LCU A;  4M3T A;  3DRS A;  2BGG A;  4CZJ A;  4FOI A;  3ZX0 A;  3HSC A;  4JKD A;  1NBW A;  5FPM A;  1ATS A;  3SYZ A;  3PX0 A;  2OTJ N;  1TAQ A;  3V9Z A;  4GY2 B;  1J54 A;  1NK5 A;  1X9S A;  4EHT A;  4JV5 K;  3HI0 A;  3K59 A;  3O80 A;  4O8K A;  3JSM A;  4B1W B;  4ILG B;  1Q18 A;  3M8R A;  4GVE A;  3TWH A;  3G4S N;  4M7Y A;  3OS2 A;  4B1Z A;  5AFU A;  4LD0 A;  1Q7Y O;  4JKE A;  2P1J A;  4WYB A;  1GLJ O;  4YOU A;  3G6E N;  2XY8 A;  4HWI A;  1BI4 B;  2FC0 A;  3JAM O;  4CGD A;  3HOS A;  3K2P A;  3SBT A;  3ID6 A;  3P39 A;  1J5E K;  3KVG A;  1QQC A;  4FO0 A;  3OYA A;  1HRH A;  5HLF A;  3A5O C;  1RTJ A;  4HUG A;  1HPZ A;  4LSL A;  1HNW K;  5BRF A;  3HXM A;  3CCQ N;  3KD5 E;  1VQN N;  3QFP A;  4GKK K;  4AM6 A;  1BQM A;  2NRR A;  3BDP A;  3DXM A;  2ITG A;  4FWL A;  4CGG A;  3VN5 A;  4CES A;  2CH6 A;  3AVJ A;  2GEL A;  1ZYQ A;  1WBD A;  3VQ6 A;  1IO2 A;  1VRU A;  4E72 A;  3E9P A;  4IJN A;  1WLJ A;  3K5L A;  4DTU A;  4E1M A;  3NHG A;  4U7B A;  4DSE A;  2P9L A;  1U45 A;  1HQU A;  4FM2 A;  4CJU A;  1VQ9 N;  2NUB A;  4CD3 A;  1JLG A;  3MN5 A;  3SJH A;  4KV8 A;  3KD1 E;  1HKC A;  2HW3 A;  4Y1C A;  4O4G A;  3SBG A;  2HVH A;  2KW4 A;  2F7T A;  3VQ4 A;  1G99 A;  2RF2 A;  3ZET A;  5LL6 Z;  5AQV A;  4KHN A;  2W6K A;  3NVK A;  5C2D A;  3EY1 A;  3AA2 A;  3CQY A;  3DMJ A;  3I0S A;  3LDL A;  4BRC A;  4H0O A;  3PSF A;  2NRW A;  3J7Y P;  4DG1 A;  3D2F A;  5AQT A;  2QA4 N;  2OTL N;  2Z1J A;  3MXM A;  1YHQ N;  1QVG M;  4O0J A;  3D45 A;  3HZ6 A;  4CJ7 A;  3NBP A;  1K9M O;  2YHY A;  1KD1 O;  1GLE G;  3CC2 N;  3IDH A;  3LP0 A;  3CJC A;  4G9Z A;  3DLK A;  2ZJR L;  4WQ4 C;  3O9S A;  3H1Q A;  1NKB A;  1BU6 O;  3ZEU B;  3TR8 A;  1RDB A;  1RGI A;  1FJG K;  4K0K K;  3EZ5 A;  3IMX A;  3PX6 A;  3SPZ A;  1NK0 A;  2W41 A;  5ADX A;  1QHT A;  3O4N A;  5T7B A;  2QM1 A;  5KRT A;  3DXK A;  2HHV A;  2A1R A;  2F9T A;  3NE6 A;  1RNH A;  1ASU A;  4KH4 A;  2JGU A;  1OH8 A;  3S41 A;  5CE3 A;  4LF9 K;  1NK4 A;  1HPM A;  1E4G T;  4KRF A;  3UB5 A;  4J2A A;  2O8F A;  3BEX A;  3MWT A;  1HNV A;  5C15 A;  5E84 A;  1CZB A;  3WT0 A;  5KPZ A;  4DR3 K;  4ID1 A;  2EHG A;  4BR7 A;  5EOY A;  3PUF A;  3SMS A;  4YFU A;  3OY9 A;  2I7N A;  1K8K A;  2W6L A;  2OCE A;  3ZSZ A;  2KKZ A;  4ZTF A;  4CF9 A;  2WTU A;  3WNG A;  1RDA A;  4DUY K;  3K9K A;  3HYF A;  3TAG A;  4WQ5 A;  4JI6 K;  4A2A A;  3CME N;  1X9J A;  3OJU A;  5C0Y A;  1QQO A;  3OYN A;  3DI6 A;  2P9K B;  3DLL L;  4K41 A;  3PV8 A;  2YKN A;  1ZC6 A;  3E66 A;  3ZX3 A;  4Q5V A;  4FVU A;  3Q7B A;  3T69 A;  3OYL A;  4FK4 A;  2Z1I A;  3H08 A;  3K0S A;  3AGR A;  1KFS A;  4KBO A;  3WXJ A;  4F2S A;  4DQR A;  1VSF A;  4NCB A;  4IG0 A;  4BR2 A;  1CLQ A;  1NOY A;  1DKG D;  2GX9 A;  3IRX A;  1U48 A;  3AV9 A;  2D1K A;  3VEN A;  3AVN A;  2FLO A;  4H5R A;  2V52 B;  3OYE A;  1VSK A;  4BRH A;  3L2U A;  1SS6 A;  3OYM A;  3OYI A;  3AVB A;  1SQK A;  1S9E A;  3TSQ A;  4JI8 K;  5HL7 L;  1TK0 A;  5FRM A;  2P9I A;  1NJW A;  1TK8 A;  1A5V A;  1O1W A;  4C8L A;  4PWD A;  2YHW A;  4DS4 A;  3GE1 A;  5AQH A;  3U6F A;  2G8W A;  3KLI A;  3R3L A;  4B1U B;  4CJS A;  2NLX A;  3LL3 A;  4GKJ K;  3TU5 A;  5GIN A;  4FJH A;  2GTD A;  3HPG A;  3LAL A;  3EE8 A;  3HO1 A;  1WSF A;  1JLC A;  4RW7 A;  2P9P B;  2IDO A;  5CYQ A;  4CGJ A;  4JRQ A;  4CIG A;  2RPI A;  3CJA A;  3LDN A;  1KVC A;  5HOO A;  3O4Q A;  3OYC A;  4I7F A;  1Z6R A;  1RIL A;  1L5U A;  1HNX K;  3ATV A;  4AF1 A;  3LAM A;  1JLQ A;  5FDL A;  3VF6 A;  3QEW A;  3SPY A;  3K5N A;  3H1V X;  3C7N A;  2O8D A;  4MLE A;  2UXB K;  3GBT A;  3OBW A;  4BQZ A;  4CHP A;  4FW2 A;  2GWK A;  3BY5 A;  1VQK N;  4AHC A;  5DK5 A;  3SQ4 A;  4FWS A;  4MFB A;  4GVM A;  2VWB A;  1SKS A;  1T3V A;  4MDA A;  5ADX H;  3I8D A;  1C1A A;  4BRG A;  1SL0 A;  4YHH K;  2QXL A;  3AAQ A;  1I3A A;  1RBT A;  1HUX A;  4W5T A;  5M1N A;  2E6M A;  4RTF D;  2GEM A;  1RBV A;  4LF7 K;  3F9K A;  4E1N A;  4PHT X;  2HOE A;  1NK8 A;  3D2E A;  4BC2 A;  3QNO A;  1HQE A;  3VEV A;  3GDQ A;  3SK3 A;  3THX B;  2G8F A;  4JI7 K;  5M1O A;  1T44 A;  3NH1 A;  2O8E B;  1XWL A;  4DCH A;  5BRE A;  1WSG A;  2FBY A;  3ZSR A;  1W0H A;  1DEJ A;  3N4Q A;  2WUS A;  3T1Y K;  1FKO A;  5AQY A;  3GL1 A;  1BIS A;  5BRH A;  5JVH L;  4CVN E;  1KLN A;  3DAW A;  1EKE A;  1KXP A;  1X3M A;  3ULE A;  2BDP A;  3O1B A;  3QEP A;  4BEC A;  4WQ4 A;  2ASO A;  3BF1 A;  2VG5 A;  2B4J A;  4WFA L;  4FWM A;  1LWF A;  3M8S A;  1J5O A;  4FJI A;  3NF9 A;  1OH6 A;  3TAB A;  3RMA A;  3VER A;  2G8V A;  1Q82 O;  3P31 A;  4QS8 A;  1YUW A;  3E9L A;  1L3U A;  4ILJ A;  3FZF A;  3O9R A;  3LAK A;  2ZJP L;  5AQK A;  3WEE B;  1BCM A;  3ZSO A;  3IS9 A;  3ZX2 A;  4DQ8 A;  5BPN A;  1HJR A;  1FKP A;  1NJI O;  1JKH A;  3TTC A;  3WQU A;  3SQ2 A;  3KK1 A;  2UUC K;  4M7X A;  5HRN A;  2P9N A;  2A40 A;  4Y1D A;  4NCA A;  3M5R A;  1KVB A;  3V1Q A;  3ZT0 A;  1XMO K;  4E7I A;  4BE1 A;  4KTQ A;  4DFJ A;  4JI3 K;  2D0P A;  3DM2 A;  4C8O A;  1VSE A;  4I6M A;  4R5P A;  2HBK A;  1K73 O;  4M41 A;  2QWO A;  4B9L A;  3SQ0 A;  5C12 A;  3OYH A;  4W5Q A;  3B6P A;  1ZBI A;  3H3N O;  4CEB A;  5FRO A;  4JNE A;  1VK0 A;  5M1Q A;  4JI4 K;  1TVR A;  3DOL A;  1S1W A;  4JHD B;  3LZI A;  3G25 A;  5AQJ A;  3U9D A;  1HKG A;  3CM5 A;  4CEF A;  3J81 O;  1E4F T;  3B8A X;  1REV A;  3VQP A;  1QHA A;  3IAY A;  3GOI A;  5AQR A;  4FWP A;  4H0X B;  4GV3 A;  1NOZ A;  2XRI A;  3QIN A;  1KVA A;  4Y0W A;  4BR4 A;  1YF5 L;  3O4W A;  1ZBS A;  4FJ8 A;  1NM1 A;  1KLM A;  4DQI A;  3AA4 A;  5JVG L;  4IEE A;  4H4O A;  3VQA A;  3LPU A;  4E0D A;  1TK5 A;  4H0V B;  1CZ9 A;  4E7J A;  3RVC A;  1NK6 A;  2ZQB A;  5ELZ A;  4IKF A;  5LJW A;  4CEZ A;  4OKJ A;  1HKB A;  3R8E A;  2KTQ A;  1FXX A;  1IKX A;  3AAP A;  3M8Q A;  3MDQ A;  1EWQ A;  3H45 C;  4DU3 A;  3AVA A;  1KAZ A;  4PKH A;  1LAW A;  1WBB A;  1TKD A;  3VTH A;  3HTV A;  3DYA A;  2HNZ A;  4KTZ A;  4B3T K;  4CZE A;  5B8H A;  4W5R A;  3AO1 A;  3L6Q A;  2JWL A;  2Q31 A;  1N34 K;  3QDK A;  4KI4 A;  4KHU A;  5DM6 L;  3E1Y A;  4AHT A;  4O8U A;  4KHW A;  5KPT A;  5BRD A;  3NGI A;  5I9E B;  1LOT B;  3CCE N;  4HCB A;  4AIL C;  1B92 A;  1HJO A;  4BWM A;  1GLA G;  2YCH A;  2C1G A;  4FWR A;  1VQ7 N;  3ZLJ A;  4JD2 A;  4W5N A;  1ILY A;  3WNE A;  3EKU A;  5AQI A;  3NAE A;  4X66 K;  1XNR K;  3KJV A;  4NO7 A;  4ICL A;  1NJZ A;  5BR8 K;  4OJR A;  3WNF A;  3M8P A;  5HRS A;  2IC3 A;  3NF8 A;  3CCL N;  3TTD A;  4OLA A;  2PAV A;  1N33 K;  1VSH A;  4DF8 A;  1LAV A;  1QQM A;  3AY9 A;  4DTN A;  4LF4 K;  5FPD A;  3MEC A;  4DMN A;  3O6W A;  3FLC O;  1NGD A;  1SZ2 A;  2HBJ A;  1IH7 A;  4FZZ A;  4FLV A;  3T3F A;  4BRI A;  3QIO A;  4CJ4 A;  4BRA A;  1RT7 A;  3VQQ A;  2HBM A;  3LP1 A;  4LF8 K;  4DV6 K;  3FZK A;  4BE0 A;  2A1S A;  3HP6 A;  3L3V A;  2QK9 A;  3OBY A;  3S9H A;  1TUY A;  3CJ1 A;  1W9H A;  2WFB A;  4DTJ A;  3SAH A;  1KRP A;  4DR5 K;  3O9Q A;  4CEO A;  2P9L B;  2XY7 A;  3T19 A;  1RBR A;  3ZSX A;  4PQU A;  4KFB A;  1V4S A;  1GOA A;  4KHQ A;  4CI6 A;  2HHW A;  2VCP A;  1KAX A;  3PY8 A;  4JKG A;  2FXU A;  1NGJ A;  3OJS A;  4N76 A;  1TUU A;  2ZF5 O;  4MQ3 A;  4A2B A;  4DV2 K;  4IO8 A;  4CEE A;  3MWP A;  2HNY A;  2HHX A;  2NRV A;  3ZET B;  1M90 O;  3DJC A;  4CJP A;  4CFD A;  4KHS A;  1WSH A;  3UKU B;  4B8C A;  4Z4I A;  3TAQ A;  4X65 K;  4NLC A;  4RCH A;  4LSN A;  5E26 A;  4DTM A;  1NWK A;  3RR8 A;  3KWI A;  1BIZ A;  3MK6 A;  4IFY A;  1MU2 A;  4YY3 K;  1WSJ A;  1K8A O;  3IFR A;  3VA0 A;  1Z05 A;  4KRE A;  4EZ9 A;  3HST B;  4IG3 A;  1SV5 A;  3O08 A;  4JKA A;  1U4B A;  4M45 A;  2CGJ A;  2JWK A;  4CZL A;  3T7Z A;  4ISE A;  4EP5 A;  2D0C A;  4DSL A;  4PY5 A;  2HHU A;  1QZ6 A;  2ZGY A;  4WE1 A;  4K43 A;  2E5L K;  1HYV A;  3TAF A;  4CEQ A;  4DV7 K;  2J4R A;  2BAN A;  3ZSW A;  3L2V A;  4RW9 A;  4M3X A;  3LAN A;  3DOK A;  4FXD A;  4H5N A;  5JS2 A;  5BR9 A;  4AHU A;  1JL2 A;  3MN9 A;  1CXU A;  4PKG A;  3K58 A;  3DXK B;  3VQB A;  3EZW A;  4BC5 A;  3ZYY X;  1B9F A;  4B9U A;  2OZS A;  1S72 N;  3LP2 A;  4Z4F A;  1NJX A;  4CJF A;  4CBX A;  4DKW A;  4HCC A;  1T6C A;  4KH5 A;  2Y1J A;  2O8F B;  3MCP A;  2E2O A;  3O5B A;  3AVG A;  1IJJ A;  3CC4 N;  3A2F A;  1B9D A;  3F73 A;  1C0G A;  4DF4 A;  2Z1G A;  4N5S A;  2QWQ A;  1K8K B;  3A8Y A;  5TKW A;  4BRN A;  5DMR A;  1EXQ A;  1XMQ K;  4KB0 A;  2Q97 A;  1GOB A;  4NXM K;  3HL8 A;  2GBZ A;  4CZM A;  2E2N A;  4Z0U A;  4CF1 A;  4FZX C;  2JLE A;  4XEI A;  3LWM A;  2P9S B;  4J2B A;  1YJW N;  3CQ8 A;  4DQQ A;  1TKZ A;  2G8I A;  3HPH A;  4BRP A;  4IOC L;  1C1B A;  1JCF A;  4RWT A;  2QWR A;  4Z4C A;  4B3R K;  1XHZ A;  4LFA K;  5F0X A;  4YOR A;  3RWU A;  1MDU B;  4FJ9 A;  3TAR A;  2HF3 A;  4YDU C;  1P8Z A;  2ZE2 A;  4KH6 A;  3EYZ A;  5D3G A;  5AQM A;  2YX6 A;  5AZI A;  3KK2 A;  4CJQ A;  2XY6 A;  2IVP A;  3NVM A;  4BVP A;  1OH5 A;  4CZG A;  1S1T A;  5C10 A;  1QS4 A;  1RT4 A;  1BI4 A;  3VOV A;  4BRE A;  3HVR A;  5AQS A;  3P5J A;  1OH7 A;  2X78 A;  4E3S A;  3LPT A;  4DU4 A;  1XC3 A;  1R0A A;  3C6A A;  1ASV A;  1SUQ A;  2E4L A;  3RMD A;  4ELU A;  1YTA A;  3H6E A;  4BE7 B;  4RG8 A;  1NGC A;  3J7A P;  4FJG A;  2E2Q A;  5JLH A;  1YVN A;  1KFD A;  2A5X A;  2F96 A;  2OYQ A;  2D0A A;  1HNZ K;  3V4I A;  1UAX A;  4F2R A;  3THW B;  2O4I A;  2W00 A;  1QTM A;  5AFU H;  2BUP A;  4L8R B;  1Y97 A;  1O13 A;  4F9O A;  2IGI A;  3T1H K;  3THY B;  1U04 A;  2QWN A;  1Q9Y A;  3CYM A;  3UKR A;  4OKK A;  2AP1 A;  4FPB A;  4CHZ A;  3DLB A;  2QW9 A;  3MED A;  2P9U B;  4B1X B;  2B6A A;  4OPK A;  2H3G X;  3HBT A;  1T6D A;  3P83 D;  3LM2 A;  1GOC A;  2IVN A;  3MAQ A;  2XO7 A;  4BEB A;  3AVL A;  3S3M A;  5JS1 A;  1MWM A;  4FJ5 A;  3JXU A;  1VQ5 N;  3UIQ A;  5I42 A;  1H1V A;  3R1X A;  4CZH A;  3VEO A;  1QVF M;  1JJ2 M;  4O0I A;  1S1V A;  3RR7 A;  2HMI A;  1NKE A;  3M1F A;  2D0O A;  4CCH A;  3PLA A;  1KTQ A;  3VQ5 A;  3BZK A;  1S6P A;  4PL7 A;  2F9W A;  4H8K A;  5KQD A;  1IBK K;  4V19 S;  1HYS A;  4ELT A;  4KHP K;  4JN4 A;  4C23 A;  4DV5 K;  4DR1 K;  3ITH A;  4LF6 K;  4CEA A;  4DV4 K;  5JEN A;  2WON A;  4FL9 A;  1TYQ A;  1X9M A;  3H46 O;  2E88 A;  1NMN A;  3D2E B;  3M3Z A;  4DTP A;  1L3S A;  3AVM A;  3C95 A;  3AO5 A;  4FWN A;  2V7Y A;  2FSN A;  3VEX A;  2HST A;  1TGO A;  2D4W A;  2ZD1 A;  5KPR A;  3VGK A;  3NDK A;  1XNQ K;  3ZEU A;  1GLC G;  4A57 A;  3ENB A;  4BRF A;  1FW6 A;  4Z4H A;  2E2P A;  1HYZ A;  3HRG A;  5AJ3 K;  1SL1 A;  1HLU A;  3VGM A;  2VGM A;  3DLE A;  5AQG A;  3ULE B;  4Q0B A;  3PO5 A;  3MCA B;  4DV3 K;  3FR0 A;  1Q81 O;  4UY8 O;  3TAP A;  4DV0 K;  4FLU A;  2NRH A;  5LMN K;  4CJK A;  2Q2R A;  4KO0 A;  2PBD A;  1BG3 A;  4EHU A;  1EWR A;  4FLT A;  4BY9 C;  4PA1 A;  4CGF A;  1RT3 A;  3OTO K;  3SV4 A;  3W3D A;  1BIU A;  3K57 A;  3U9Z A;  4CE9 A;  2YNG A;  4B9N A;  2G8U A;  1YAG A;  2VWK A;  4EAH D;  3EKS A;  5GAE P;  4J2D A;  4O44 A;  4FLZ A;  2O4G A;  5GAG P;  3C6U A;  3HPO A;  5AQU A;  3K5M A;  3L2R A;  4OLB A;  1Z26 A;  5CR4 A;  5FRN A;  4CHQ A;  4QS7 A;  2HHH K;  3L4I A;  3V9U A;  1VAZ A;  1DTT A;  4FJK A;  4H0T B;  3H3O B;  2RKI A;  5EVZ A;  1RDU A;  4C1N K;  2WOM A;  3SV3 A;  4I6M B;  2X6N A;  3K9J A;  3MEG A;  1JL1 A;  3F9M A;  4M42 A;  5KQ8 A;  4FWK A;  3VQE A;  1WUA A;  4BAC A;  3AO3 A;  4AHS A;  3OYD A;  2C1I A;  3W0L A;  1WAJ A;  3TAN A;  1JXE A;  1KSP A;  4I9Q A;  4CED A;  2IS3 A;  3VQD A;  1TL3 A;  3WXL A;  5EX5 A;  1BWF O;  1TL1 A;  1BDG A;  4CZF A;  3QER A;  4JYA K;  3KKR A;  3RTV A;  4ZHR A;  5J2N A;  3QNN A;  1IG9 A;  4YDU A;  3KK3 A;  3F2K A;  3MEE A;  4JKB A;  4BGB A;  1SKW A;  4AQY K;  3T1A A;  4NLB A;  5FPE A;  4OO1 J;  3CG7 A;  3TSU A;  3CYG A;  3O3F A;  1WB9 A;  1XUP O;  5SWM A;  1U2V B;  2GUI A;  3QES A;  2OA8 A;  3RSE B;  5EXW A;  4CJV A;  1NGH A;  2DFE A;  3SUN A;  2UU9 K;  2P9P A;  1VQ6 N;  3V9S A;  3KTQ A;  3ENO A;  5SZT A;  1A5W A;  5CY4 A;  5E41 A;  1C1C A;  1I94 K;  5AQN A;  1C0U A;  1X1P A;  1Z25 A;  1UA1 A;  4QAG A;  3M6G A;  3V9X A;  4U67 L;  5IT9 O;  1VRT A;  5AQZ A;  2ATQ A;  1YJ9 N;  4LFB K;  1WAF A; 
#chains in the Genus database with same CATH homology
 2YJF A;  1GLL O;  5FPD A;  4A5B A;  2F7T A;  2V7Z A;  3CJ9 A;  3O6W A;  1G99 A;  1NGD A;  1SZ2 A;  2HBJ A;  2AA4 A;  3FLC O;  3FZM A;  4FOE A;  4HTL A;  4IXC A;  3ZET A;  1N8R O;  5AQV A;  1VQM N;  4BRI A;  4XJX A;  4BRA A;  2HBM A;  5C2D A;  3NVK A;  3CQY A;  3LDL A;  3FZK A;  4BRC A;  4H0O A;  1R59 O;  2NRZ A;  4MO5 A;  3LDQ A;  3KZB A;  3OBY A;  3J7Z O;  2NRW A;  3FZH A;  1BOT O;  3D2F A;  1JCG A;  3CHW A;  5AQT A;  2QA4 N;  2OTL N;  1TUY A;  3CJ1 A;  4PL8 A;  4JK7 A;  2WFB A;  2E20 A;  3BUZ B;  1YHQ N;  1QVG M;  3SAH A;  4FPA A;  2OAN A;  3HZ6 A;  4CJ7 A;  4H0P A;  3R9P A;  1DT9 A;  1P90 A;  4CBW A;  3O9Q A;  2V51 B;  2P9L B;  1K9M O;  1QQN A;  2YHY A;  2KHO A;  1KD1 O;  1GLE G;  3CC2 N;  3IDH A;  3CJC A;  1BUP A;  1JCE A;  4G9Z A;  1V4S A;  2ZJR L;  4WQ4 C;  1VQ4 N;  4CI6 A;  3O9S A;  2VCP A;  1KAX A;  3CCV N;  4JKG A;  3H1Q A;  4YOX A;  3A5N C;  1BU6 O;  2FXU A;  3I33 A;  4L3Q A;  5AQQ A;  5AQW A;  3ZEU B;  1RGI A;  1NGJ A;  2NZT A;  2P9U A;  4BC3 A;  1EO1 A;  1TUU A;  2ZF5 O;  3IMX A;  4A2B A;  5M1K A;  2P9N B;  4IO8 A;  2FF3 B;  2VYP A;  3CI5 A;  5AQL A;  2W41 A;  3MWP A;  2NRV A;  4A59 A;  3ZET B;  5ADX A;  2IIR A;  3CET A;  4BGA A;  1M90 O;  2VGN A;  3DJC A;  2P9K A;  2QM1 A;  3QIC A;  1EQY A;  1Q86 O;  3DXK A;  2KLA A;  1S3X A;  1GLD G;  2F9T A;  3UKU B;  4KH4 A;  3VMF B;  4IEI A;  4NLC A;  3A0I X;  1NGA A;  4JKF A;  3CQX A;  4RCH A;  5E26 A;  3S41 A;  5CE3 A;  1VQP N;  4BRK A;  3AGK A;  3CJ7 A;  2RHK A;  1NWK A;  1HPM A;  1OVY A;  5TKY A;  3KWI A;  1E4G T;  1RFQ A;  4H5W A;  3MK6 A;  4E1J A;  4JKC A;  3UB5 A;  3LDP A;  2FF6 A;  3BEX A;  4A62 A;  3MWT A;  5C15 A;  2NRT A;  1K8A O;  5E84 A;  4IO9 L;  3IFR A;  4MLH A;  3P38 A;  3WT0 A;  5KPZ A;  4BR7 A;  3L0Q A;  1Z05 A;  5EOY A;  2IVO A;  3SMS A;  2I7N A;  3O08 A;  4JKA A;  1K8K A;  4DHY A;  2CGJ A;  2JWK A;  4H5T A;  1ESV A;  4CZL A;  4EFH A;  2QEX N;  3T7Z A;  2KKZ A;  4ISE A;  3NMU A;  3OA9 A;  1QZ6 A;  2ZGY A;  3K9K A;  4K43 A;  3WEE A;  2Q36 A;  4WQ5 A;  1WOQ A;  3VET A;  3CER A;  1GLF O;  2J4R A;  4A2A A;  4B1V A;  3CXC M;  3MX5 A;  2CGK A;  1KQS M;  3CME N;  1X9J A;  5C0Y A;  1QQO A;  4H5N A;  1MA9 B;  5BR9 A;  1YJN N;  3D6R A;  4MO4 A;  1ATN A;  2QWP A;  3DLL L;  2P9K B;  4K41 A;  3MN9 A;  5F2R A;  4PKG A;  1NLV A;  3DXK B;  3EZW A;  4BC5 A;  1ZC6 A;  3ZYY X;  3E66 A;  3ZX3 A;  3CCR N;  4FVU A;  3Q7B A;  4CZI A;  3T69 A;  1BA0 A;  3TTF A;  1S72 N;  3Q7C A;  3AGR A;  4BRM A;  3DWL A;  4KBO A;  3WXJ A;  4CBX A;  3C6H A;  4DKW A;  2A3Z A;  1T6C A;  4KH5 A;  4DB3 A;  4PKI A;  3WUH A;  3CCM N;  4BR2 A;  1DKG D;  3HM8 A;  3MCP A;  5F1X A;  2E2O A;  2QWL A;  3O5B A;  3ID8 A;  3VES A;  1IJJ A;  2GX9 A;  2A42 A;  3KK7 A;  2D1K A;  3VEN A;  3CC4 N;  4CD1 A;  2FLO A;  4H5R A;  2V52 B;  4JK9 A;  1C0G A;  1VQL N;  4QS9 A;  4BRH A;  2QWQ A;  1K8K B;  3A8Y A;  1SS6 A;  4K42 A;  5TKW A;  4BRN A;  4JK8 A;  3CCU N;  2UYT A;  1M1K O;  2Q97 A;  5DM7 L;  3TPQ A;  2ZJQ L;  4CZM A;  1SQK A;  3TSQ A;  4H03 B;  4BR5 A;  5HL7 L;  3DXM B;  1X3N A;  4JHD A;  4NB4 A;  2E2N A;  4A61 A;  2P9I A;  2QI2 A;  3EE9 A;  2NRX A;  4XEI A;  2P9S B;  3EO3 A;  1NGF A;  2YHW A;  1YJW N;  4CZK A;  2QTD A;  4BRP A;  4IOC L;  2A41 A;  3GE1 A;  5AQH A;  3OW2 M;  1BA1 A;  1JCF A;  4RWT A;  2QWR A;  3R3L A;  4B1U B;  2NLX A;  3LL3 A;  3TU5 A;  3VEW A;  5GIN A;  2GTD A;  3VF4 A;  4JD2 B;  3EE8 A;  5GIO A;  4ISG A;  2W40 A;  2I7P A;  5F0X A;  4YOR A;  3L4Q A;  2P9P B;  3CPE A;  1MDU B;  3EL2 A;  2HF3 A;  4WQ5 C;  4YDU C;  1P8Z A;  3O8M A;  4KH6 A;  1NGE A;  3VEY A;  4GV9 A;  5AQM A;  3A5M C;  2YX6 A;  3CJA A;  3LDN A;  2ASP A;  2A6A A;  5AZI A;  2IVP A;  3NVM A;  2Q1N A;  5GAD P;  3G71 N;  5BN8 A;  4BVP A;  5HOO A;  4CZG A;  5BPL A;  4JKH A;  2QWM A;  1VQ8 N;  2YJE A;  3FZL A;  5C10 A;  1Z6R A;  4Z94 A;  3ATV A;  3VOV A;  5CHI A;  4AF1 A;  4BRE A;  1KC8 O;  3MN6 A;  2FSJ A;  5AQS A;  4BR0 A;  3VTI A;  5LJV A;  3J8A A;  1IG8 A;  3VF6 A;  3KWG A;  3CPW M;  1S22 A;  4BR9 A;  3SLC A;  3H1V X;  3C7N A;  3TSP A;  4MLE A;  1XC3 A;  5M1P A;  4IWV A;  2HBL A;  1RDW X;  3GBT A;  5JMV A;  3C6A A;  3OBW A;  4BQZ A;  4A5A A;  3I55 N;  2GWK A;  2CH5 A;  1BO5 O;  1VQK N;  2PFU A;  5H1S Q;  3E9O A;  3H6E A;  5GIP A;  2ZWH A;  4BE7 B;  1SAZ A;  5GAH P;  4FWS A;  1NGC A;  3D2F B;  4EIA A;  4IOX A;  2VWB A;  1T3V A;  3A5L C;  2E2Q A;  5JLH A;  1YVN A;  2A5X A;  4MDA A;  5EY4 A;  5ADX H;  4BRG A;  5LY3 A;  2YI1 A;  2QXL A;  3AAQ A;  4YOV A;  1HUX A;  2W00 A;  2BH1 A;  3N4P A;  5M1N A;  3QFU A;  4RTF D;  3SAF A;  5AFU H;  3SAG A;  2BUP A;  3CIP A;  3VF2 A;  2GEM A;  4PHT X;  2HOE A;  1NGG A;  3CJB A;  1O13 A;  4F9O A;  1U2V A;  5AZI B;  3RSE A;  4JKG B;  4IOA L;  2QWN A;  3QB0 A;  3IUC A;  3D2E A;  4BC2 A;  3UKR A;  3WXM B;  4LC9 B;  3MN7 A;  1YIJ N;  3CD6 N;  2AP1 A;  4FPB A;  5AQX A;  4ILH A;  3QBW A;  3GDQ A;  2QW9 A;  5AR0 A;  3VEV A;  3SK3 A;  2ASM A;  2P9U B;  4B1X B;  2H3G X;  1T44 A;  3HBT A;  5M1O A;  1T6D A;  2DPN A;  4BVO A;  3LM2 A;  5BRE A;  2E8A A;  4DCH A;  1W97 L;  2IVN A;  3FFK B;  1ZXO A;  3CCJ N;  4BEB A;  2Q0R A;  1DEJ A;  3AAR A;  3N4Q A;  1MWM A;  3JXU A;  4B9Q A;  2WUS A;  1VQ5 N;  3GG4 A;  1H1V A;  3R1X A;  3GL1 A;  5AQF A;  5AQY A;  3VEO A;  4CZH A;  5BPM A;  5BRH A;  1JJ2 M;  1QVF M;  5JVH L;  3I8B A;  3PIP L;  3DAW A;  1J6Z A;  4CBU A;  1KXP A;  1X3M A;  1V4T A;  2D0O A;  3M1F A;  3ULE A;  5JLF A;  3PLA A;  1QZ5 A;  2E1Z A;  3U4L A;  4WFN L;  3O1W A;  4PL7 A;  3O1B A;  2F9W A;  2GWJ A;  5KQD A;  4J8F A;  4BEC A;  4WQ4 A;  4O5F A;  2ASO A;  4JN4 A;  3BF1 A;  4C23 A;  4FWQ A;  1NGI A;  4WFA L;  3OHR A;  5C2F A;  4FWM A;  1CZA N;  4XH1 A;  1VQO N;  2YHX A;  2E1Y A;  5AZJ A;  3VEZ A;  3QML A;  4FL9 A;  3QBX A;  3VER A;  3CMA N;  1TYQ A;  4BQL A;  1Q82 O;  3P31 A;  4QS8 A;  4B1Y B;  1D4X A;  3H46 O;  1YUW A;  2E88 A;  2HMP A;  3E9L A;  4ILJ A;  3D2E B;  5M1F A;  3FZF A;  3UKR B;  2ZGZ A;  3O9R A;  3M3Z A;  4BG8 A;  2ZJP L;  5AQK A;  4FWN A;  3WEE B;  4WFB L;  4OPA A;  3ZX2 A;  2V7Y A;  2FSN A;  3VEX A;  2FSK A;  3FE1 A;  2HST A;  4XH5 A;  4DQ8 A;  4AM7 A;  2D4W A;  5BPN A;  5KPR A;  3VGK A;  1NMD A;  1NJI O;  3ZEU A;  1GLC G;  4H0Y B;  3VGL A;  1Y64 A;  3TTC A;  1HX1 A;  3WQU A;  4A57 A;  3ENB A;  4BRF A;  4M7X A;  2E2P A;  3HRG A;  2P9N A;  2A40 A;  3I56 N;  4OPH A;  1C0F A;  1HLU A;  5AQP A;  2ITM A;  3VGM A;  2VGM A;  4BC4 A;  5AQG A;  4WCE L;  4R79 A;  2WC9 A;  1YXQ A;  3ULE B;  3M5R A;  4JEP A;  4BRL A;  3MCA B;  1XQS C;  5FPN A;  1OKJ A;  3ATU A;  3FR0 A;  3UE5 A;  1Q81 O;  4UY8 O;  3C0B A;  2D0P A;  4YOT A;  3WXK A;  4ISF A;  3WQT A;  4I6M A;  3UKU A;  3WXI A;  4IZ9 A;  3D7E O;  2HBK A;  1K73 O;  2NRH A;  3BP8 A;  3CCS N;  2QWO A;  5C12 A;  5AZJ B;  4XH4 A;  2Q2R A;  4FSV A;  2RE2 A;  2PBD A;  3H3N O;  1TYQ B;  3JS6 A;  1BG3 A;  3MX2 A;  2NNW A;  4EHU A;  1NGB A;  3LDO A;  3SMP A;  4BY9 C;  4JNE A;  3O9T A;  1MWK A;  5M1Q A;  1YIT N;  4YOW A;  4IFE A;  4JHD B;  4IDH A;  5AQO A;  4WF9 L;  3W3D A;  3G25 A;  5AQJ A;  1LCU A;  2P9I B;  4MDB A;  3U9Z A;  3U9D A;  1HKG A;  1E4F T;  3B8A X;  4C1N I;  1YAG A;  4FOI A;  4CZJ A;  5JIC A;  1W2B M;  1QHA A;  3EKS A;  4EAH D;  3ZX0 A;  5GAE P;  3HSC A;  3GOI A;  4JKD A;  1NBW A;  5AQR A;  2BTF A;  5FPM A;  5GAG P;  4FWP A;  3KHY A;  4H0X B;  1ATS A;  1YI2 N;  3C65 A;  4GV3 A;  5AQU A;  2OTJ N;  4GY2 B;  5CR4 A;  4QS7 A;  1KAY A;  4EHT A;  3HI0 A;  4BRO A;  3O80 A;  3L4I A;  4O8K A;  3CC7 N;  1VAZ A;  3HOT A;  4Y0W A;  4B1W B;  4H0T B;  1YF5 L;  3H3O B;  4ILG B;  4BR4 A;  3O4W A;  1Q18 A;  1RDU A;  4GVE A;  5EVZ A;  4BG9 A;  3G4S N;  4JAX A;  1ZBS A;  4M7Y A;  4C1N K;  3U8X A;  1NM1 A;  4I6M B;  4B1Z A;  5AFU A;  4IEE A;  3K9J A;  5JVG L;  3P4I A;  4H0V B;  4JKE A;  1Q7Y O;  4WYB A;  2GUP A;  4IJA A;  1GLJ O;  4YOU A;  3RVC A;  3F9M A;  5ELZ A;  4HWI A;  3G6E N;  3R6M A;  5LJW A;  3HOS A;  5KQ8 A;  3SBT A;  1HKB A;  4FWK A;  3R8E A;  3ID6 A;  3P39 A;  1WUA A;  3KVG A;  2WBN A;  2C1I A;  4FO0 A;  5BN9 A;  3W0L A;  3C7N B;  3AAP A;  3MDQ A;  4BRD A;  4GNI A;  3H45 C;  3A5O C;  1KAZ A;  2Q0U A;  4PKH A;  4K25 A;  3BF3 A;  5BRF A;  3WXL A;  1DGK N;  5EX5 A;  3CCQ N;  3VTH A;  3HTV A;  1BWF O;  3PIO L;  1VQN N;  1BDG A;  4CZF A;  3QFP A;  4AM6 A;  2NRR A;  3EN9 A;  4CZE A;  5B8H A;  3DXM A;  3FGU A;  3L6Q A;  4FWL A;  2JWL A;  2Q31 A;  4YDU A;  3QDK A;  3O9U A;  3F2K A;  2CH6 A;  5DM6 L;  2GEL A;  2EWS A;  4JKB A;  3VPZ A;  3LM9 A;  4BGB A;  3E1Y A;  2HF4 A;  2P9S A;  4NLB A;  5FPE A;  4O8U A;  4M63 C;  5KPT A;  5BRD A;  1U6Z A;  4OO1 J;  3TSU A;  5I9E B;  1LOT B;  2CGL A;  3CCE N;  3E9P A;  4IJN A;  1XUP O;  1HJO A;  4H5V A;  1U2V B;  1GLA G;  2YCH A;  2C1G A;  4FWR A;  1VQ7 N;  4JD2 A;  3RSE B;  5EXW A;  1ILY A;  1NGH A;  3EKU A;  4U7B A;  2P9L A;  5AQI A;  2P9P A;  1VQ6 N;  3F5T A;  3ENO A;  4NO7 A;  1ATR A;  4YOY A;  1VQ9 N;  5AQN A;  4FWO A;  4CD3 A;  3M6G A;  3CCL N;  3TTD A;  5MLC Q;  4U67 L;  3MN5 A;  2PAV A;  3ENH A;  3SJH A;  4BRQ A;  1HKC A;  3CF5 L;  3MMV A;  5AQZ A;  4GV6 A;  1YJ9 N;  3IKM A;  3SBG A;  1QQM A;  1GLB G;  3AY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...