3UKRA

Crystal structure of bos taurus arp2/3 complex with bound inhibitor ck-666
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
415
structure length
401
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-related protein 3
publication title Structural characterization and computer-aided optimization of a small-molecule inhibitor of the Arp2/3 complex, a key regulator of the actin cytoskeleton.
pubmed doi rcsb
total genus 126
structure length 401
sequence length 415
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3ukrA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ukrA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ukrA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3ukrA04
2P9LA 1JCFA 2PBDA 3H1VX 2P9PB 4BRFA 3VF4A 5BN8A 3DXKA 3FR0A 3LM2A 3MN5A 4DHYA 2QWNA 1NLVA 3VEVA 4BRDA 1S3XA 1ATNA 2GUPA 5BPMA 3TU5A 2AP1A 4FWSA 3WQTA 2H3GX 4H0YB 3A8YA 3VEOA 5AFUA 5AQZA 3VPZA 5BRDA 5KPRA 3ULEB 3QDKA 3CQXA 3A5MC 4M63C 4C23A 4XEIA 2NRHA 4MLEA 1GLBG 2J4RA 3MN6A 4RTFD 5BREA 4K43A 3FZFA 4K42A 3WXIA 3U8XA 3BF3A 3C7NB 3AAPA 3O80A 3W0LA 3IUCA 1V4TA 3CJ1A 3VENA 4CBUA 5EXWA 4GNIA 4BGBA 1NGIA 3AAQA 2YJFA 1HUXA 1E4GT 4WQ4A 1XUPO 3H3NO 4WQ5C 1BU6O 3FZMA 5B8HA 3WT0A 3R8EA 1NBWA 5AQNA 2HF4A 2ASMA 3EKUA 1C0FA 1IJJA 2Q2RA 4PL7A 3UB5A 1OKJA 1EQYA 2V7ZA 1T44A 3UKRA 1P8ZA 1NGAA 3UE5A 3IMXA 2GWKA 3LL3A 1GLFO 4CZLA 4BR9A 2YHYA 1TUUA 1K8KA 1HKGA 5FPMA 4BR0A 3I8BA 3IFRA 4HTLA 4B1YB 1SQKA 2F9TA 5JMVA 4CZGA 5F1XA 4BRLA 3CJCA 4BRIA 2YHWA 3CI5A 2E2NA 5AQWA 5ADXA 2Q36A 4AM7A 4JN4A 3FE1A 5AQVA 4BR5A 2P9IA 1BO5O 4FWPA 4RWTA 5KPZA 3D7EO 2P9LB 3AARA 4NB4A 3BP8A 4E1JA 1H1VA 1S22A 1TYQB 3DXMB 3S41A 3TPQA 1KXPA 1NMDA 2ASOA 4PL8A 3M3ZA 4BC2A 3H6EA 4XH1A 3EZWA 4JHDA 4GY2B 4IXCA 3SLCA 3QICA 4BC4A 2E88A 3SJHA 4O5FA 4DCHA 1IG8A 3QBXA 2CH5A 5AQIA 1DKGD 2ITMA 4Y0WA 4A61A 5AQQA 2P9UB 3WUHA 1X3NA 3CIPA 1NGBA 3VGKA 1DEJA 3BEXA 2VYPA 3CJ7A 1BG3A 5KPTA 4CZMA 4BRKA 4M7XA 1U6ZA 4B1VA 3H45C 4JAXA 4BRCA 1NGEA 4FPBA 3R6MA 4BRGA 4PKHA 4DB3A 3D2FA 5EOYA 1Z05A 3O1WA 3BUZB 4WYBA 4QS8A 5BPNA 3ATVA 3CETA 1X3MA 1G99A 1LCUA 3KHYA 4EHTA 2A6AA 5LJWA 1GLJO 1BA1A 1GLCG 4JD2A 4KBOA 1MDUB 3D2EA 2YHXA 4FOEA 3FGUA 3BF1A 1NGCA 3CJ9A 3L6QA 3LM9A 2IVPA 3VF6A 2IVNA 3ZETA 1K8KB 3O08A 3DWLA 4H0TB 4IO8A 3MK6A 3QFPA 4MLHA 3HSCA 4ISGA 3IDHA 1YUWA 4NO7A 1QQNA 4FL9A 2QXLA 5AQYA 4FWRA 2YI1A 2WUSA 4FWKA 2VWBA 3LDLA 4B1WB 4FWOA 3QBWA 2QW9A 3LDNA 3LDOA 1QZ6A 3VEYA 1YAGA 1CZAN 5KQ8A 5BPLA 5F2RA 4BG8A 4JHDB 4BREA 3EKSA 4BC5A 4BVPA 5AZIA 1NGGA 2D0PA 2P9NA 4BQLA 2CGKA 3A5NC 4RCHA 3R9PA 4YDUC 4CZHA 2P9KA 2E1ZA 3J8AA 2QWMA 3O8MA 1ATRA 3FZHA 3VETA 2FF3B 2HF3A 1D4XA 3FFKB 1MWKA 3ZX0A 2IIRA 5ELZA 3GG4A 1C0GA 1ZBSA 2E2OA 4HWIA 5AQHA 3H1QA 4CI6A 2I7NA 4A2BA 1MWMA 4JNEA 2HMPA 2QWPA 2EWSA 1MA9B 3G25A 3SK3A 2D1KA 3CJBA 2GELA 1GLEG 4H0XB 4A62A 2Q0UA 3U9ZA 4MO5A 2Q31A 5BRFA 4FSVA 3GE1A 3M6GA 4BRMA 3DXKB 3UKUA 3VEWA 5EVZA 3VEXA 3HTVA 2E2PA 4B9QA 3D2EB 1ZC6A 4DQ8A 5AQFA 3QFUA 5E84A 4H5RA 1QQOA 3JXUA 1T6CA 4AM6A 5AQOA 2PAVA 3F9MA 3RSEA 3ZETB 4H0VB 1X9JA 1Q18A 3A5LC 3O1BA 1RGIA 2CH6A 4CJ7A 5FPEA 4CZFA 1NGDA 3HI0A 4H5NA 3GOIA 5EY4A 2GWJA 4BRPA 4WQ4C 2FSKA 3QMLA 1TUYA 2QWOA 5AQXA 5AQMA 4BR7A 3MMVA 3O5BA 4WQ5A 1WUAA 3A5OC 1NM1A 3GL1A 4XH5A 2QM1A 1RDWX 3VESA 4BR2A 1HX1A 3ATUA 3U4LA 4H5VA 3EO3A 3MDQA 4FOIA 5AZIB 1J6ZA 2P9NB 4XH4A 3SMSA 5AQKA 1U2VA 1NWKA 5EX5A 1NGJA 3LDPA 3U9DA 3UKRB 4BROA 1HKBA 4BRQA 3WEEA 3I33A 2P9SA 1BWFO 4I6MA 2Q1NA 5AQSA 4L3QA 4EIAA 4BVOA 2A41A 2E20A 3KVGA 5ADXH 2ZF5O 1SAZA 2CGJA 1QHAA 3ZX3A 2FLOA 2ZGZA 1KAZA 5AQPA 4CZKA 2FF6A 1YVNA 3M1FA 2NZTA 3DXMA 1TYQA 2A40A 2W41A 5E26A 2P9IB 4M7YA 3KZBA 1HKCA 1BOTO 4FPAA 3HZ6A 1E4FT 1YXQA 1Y64A 4H0PA 4K41A 5AZJA 1DGKN 3VEZA 2YJEA 1HLUA 3QB0A 3CQYA 5AQUA 3UKUB 4F9OA 2UYTA 2QWRA 1BA0A 5AQGA 4CBXA 2BUPA 1T6DA 5AR0A 2E1YA 4BGAA 3LDQA 1V4SA 2P9UA 4A2AA 4ISEA 4H03B 3ENHA 3L0QA 2I7PA 3RSEB 4BC3A 3ZEUA 4BR4A 1SZ2A 2QWQA 3A0IX 2A42A 3CERA 2F9WA 3OHRA 3ZX2A 1HPMA 4H5TA 3VGLA 5LJVA 2W40A 2FXUA 3B8AX 4MO4A 4H0OA 4CBWA 1JCGA 4QS7A 5BRHA 3WXJA 3DAWA 3HM8A 2P9PA 5AQTA 3H3OB 4FWQA 2YCHA 1NGHA 3D2FB 1ZXOA 5AQLA 3GBTA 4IJNA 1RFQA 4EAHD 4BQZA 3ULEA 3P4IA 2E2QA 5AFUH 1NGFA 3JS6A 4B1UB 2D4WA 4K25A 5BN9A 3H46O 1U2VB 2OANA 2V7YA 2Q97A 2KHOA 1QZ5A 4PKIA 4JD2B 5LY3A 2A3ZA 4FWLA 1GLDG 3CHWA 1R59O 3WEEB 4FWNA 2BTFA 2Q0RA 4CZIA 2P9SB 5AQRA 4I6MB 3O6WA 3WXKA 3FZKA 1GLAG 3C7NA 4CZJA 5TKYA 2ZWHA 1QQMA 2E8AA 4CD1A 3MCPA 5AQJA 5CE3A 4O8KA 1KAYA 3VGMA 2GEMA 1BUPA 3O4WA 2FSJA 2NLXA 1JCEA 3MN9A 2A5XA 3L4IA 2GTDA 3EL2A 3MN7A 2QWLA 4QS9A 4BRAA 4B1ZA 3SMPA 1ATSA 4EHUA 1WOQA 4FWMA 3HBTA 1BDGA 5AZJB 3WXLA 5JLHA 5BR9A 2V52B 4IZ9A 3VOVA 2ZGYA 3W3DA 2AA4A 4J8FA 5I9EB 5JICA 3VERA 2VCPA 1XC3A 2FSNA 3GDQA 4CZEA 2V51B 4Z94A 1KAXA 2D0OA 3VF2A 4BRNA 4B1XB 4FO0A 5KQDA 5FPNA 3EN9A 4BG9A 4IJAA 2ASPA 2DPNA 1XQSC 3DJCA 4EFHA 4YDUA 3FZLA 5JLFA 1Z6RA 3AY9A 1GLLO 4BRHA 4IWVA 3CJAA 3ID8A 3ZEUB 2P9KB 3FLCO 4LC9B 2HOEA 5F0XA 1HJOA 4ISFA 4H5WA 5FPDA 4CD3A 3WQUA 4PKGA 3C0BA 2CGLA 3ENOA 2IVOA 1ESVA 1LOTB
chains in the Genus database with same CATH superfamily
2P9LA 2DFHA 3H1VX 5DK5A 4BRFA 2QXFA 3L8BA 3FR0A 3MN5A 4DHYA 3D45A 1QE1A 4B3OA 1JXEA 1NLVA 4CJLA 3TABA 1ATNA 3SUQA 2GUPA 3MX2A 4J2BA 3MECA 4FWSA 4C1NI 2VGMA 2NRZA 3A8YA 2UU9K 1HNVA 1HYZA 1VQLN 4C23A 4MLEA 1EX4A 4C8MA 4JI2K 3OJUA 3SZ2A 3P31A 4PUOA 4JKAA 2NRTA 4AHCA 4K42A 4CIEA 3LWMA 4FJJA 2WONA 3C7NB 3O80A 3W0LA 4MQ3A 2KKZA 2QTDA 5J1EA 4E7JA 3V6DA 4M41A 3TWHA 4CBUA 3DMJA 1HJRA 1S9EA 4CEDA 1E4GT 1XUPO 3H3NO 1XWLA 1BU6O 1VQ4N 4QCLA 3FZMA 4N47A 3RRGA 5FLXO 4YORA 4CHPA 4BEBA 1J5OA 5AQNA 2XY8A 2HF4A 2ASMA 4PL7A 3UB5A 5J2NA 4CHZA 2V7ZA 4V19S 1XHZA 1ASUA 4OVLA 1NGAA 2WFBA 4Z4IA 1JLBA 3KWGA 1Q9XA 4FM2A 4CZLA 5KRTA 5C10A 4BR9A 3CCEN 1C6VA 1K8KA 1ZBLA 4E7KA 5GINA 4HTLA 3JAMO 5C2FA 3QLHA 1S1UA 2YHWA 4AM7A 4JN4A 2G8KA 4N76A 4N56A 3KJVA 3RRHA 2RF2A 3AARA 1H1VA 3S41A 1VSDA 1NMDA 3THWA 1VSEA 3H6EA 1RT4A 1B9FA 4JHDA 1X9SA 4RW4A 5I3UA 4IXCA 1L3UA 4BC4A 4B3RK 4GVMA 4O5FA 1IG8A 5K14A 3E01A 3ZYYX 3QBXA 4IBNA 5AQIA 1K6YA 1X3NA 3V1RA 3VGKA 1S9GA 3L2QA 5M1NA 1DEJA 2KFZA 4BWJA 1WN7A 2VYPA 4WFNL 1BG3A 1TAQA 1U6ZA 4JAXA 1A5VA 4BRGA 3VN5A 3K5LA 2IC3A 3D2FA 1RT2A 4CFAA 1NKBA 3O1WA 5CY4A 3BUZB 3OS0A 4FW2A 4C8LA 1KSPA 3THXB 3HPHA 1VSMA 1G99A 2O8CA 1U48A 2A6AA 4FJ5A 4HHTA 1BA1A 1GLCG 3HJFA 1YF5L 1NKCA 2YHBA 3VQQA 4O0IA 3EY1A 3FGUA 4BECA 1NGCA 2O8BA 3LP1A 3VF6A 1ASVA 3V9UA 1VQ5N 3O08A 4IO8A 1YHQN 3MK6A 4KI6A 3QESA 3C95A 4B9LA 3ULDA 3PSIA 4B3MK 2YI1A 4CGGA 2WUSA 1NJWA 5DM6L 2PZSA 3TAFA 1LW2A 3LDLA 3PSFA 4BDPA 4FWOA 3ZSZA 4PQUA 2XO7A 3LDNA 4B9NA 3V4IA 3QEPA 3H08A 3TAPA 4BWMA 1YJ9N 3HK2A 4DSJA 5KQ8A 3S3MA 1RILA 3DLGA 5AZIA 2DFEA 3A5NC 4YHHK 3R9PA 4CFCA 3J8AA 1EKEA 3FZHA 3VETA 4LF8K 4B8AB 4DV0K 1LAWA 3CC2N 3OVNA 4KHYA 4B9TA 3LAMA 3J7YP 3NVMA 2ZJQL 4LF9K 4LF6K 2OTJN 4FYDA 4DQIA 4E19A 1MA9B 3F73A 3G25A 1VQMN 2GELA 1RTDA 1GLEG 1VQ8N 4H0XB 4A62A 2OZMA 5BRFA 5J2PA 3M6GA 3CPEA 5EVZA 3HTVA 3MWPA 3ZSVA 5GAHP 4F3OA 1ZC6A 2X6SA 2E6MA 4W5RA 4CE9A 5CZ1A 4CF2A 4JI5K 3CMAN 3QFUA 4GV3A 4O55A 5E84A 4H5RA 3JXUA 4AM6A 1WAJA 5AQOA 3RSEA 3ZETB 3A5LC 3BDPA 3OYJA 1RGIA 2Q3SA 3ZSQA 3HXMA 5EY4A 4RW9A 3RR8A 5H1SQ 3I55N 4BRPA 3CM6A 2C1GA 3QMLA 4N41A 5AQXA 3NF9A 5AQMA 4BR7A 3E1YA 4K8ZA 5KI6A 4LY7A 2VG6A 2QM1A 3U6FA 1M90O 1IBKK 4CHQA 3VESA 1CLQA 3ATUA 3U4LA 1YT3A 4HVJA 3K0SA 1K73O 3JYTA 2IGIA 3MDQA 4FJ7A 4KPYA 3AVMA 1NGJA 4BROA 3AV9A 1KFSA 3LDSA 3UIQA 4FJ8A 4Z4HA 4L3QA 4CFDA 2HVIA 3KVGA 3CFPA 2ZF5O 2CGJA 3LZIA 3AGKA 1T8EA 1QS4A 1KAZA 2FF6A 5LL6Z 1TYQA 5FDLA 3AVCA 4Q5VA 4JRPA 1JLGA 4M7YA 2X74A 1BCOA 1TGOA 4FPAA 5AZJA 1E4FT 4DMNA 4CCHA 1HLUA 1W0HA 3UKUB 3KLFA 4F9OA 4JYAK 2D0CA 3T1YK 3HSTB 4FW1A 1U47A 3THWB 4JLHA 3OYIA 2E1YA 1P90A 4FJ9A 5A2QO 3IS9A 4KH5A 4F8RA 3ZSWA 2DY4A 1C1CA 4X65K 1RTIA 1SZ2A 5HBMA 3K59A 3KD1E 1HPMA 1W2BM 3VGLA 5LJVA 2ZD1A 3F5TA 2UUBK 1YVUA 4MO4A 4QS7A 1TV6A 3TTCA 3WXJA 5BRHA 4BDZA 4CF1A 1N5YA 1NK7A 3D2FB 3NGYA 4X62K 1VHXA 1TKXA 1ZXOA 3NGIA 3GBTA 4CF8A 1RFQA 4CK1A 3VA0A 4I9QA 2UXCK 1VQKN 2E2QA 5BN9A 3H46O 2PYJA 4KHNA 1U2VB 3EZ5A 2O8CB 3T3FA 4FLWA 4IKFA 4CERA 4BACA 1GLDG 3WEEB 2HBLA 4FWNA 2Q0RA 4CZIA 2YKNA 3NF7A 4I6MB 4KHUA 3C7NA 4CZJA 1ZBHA 1FKPA 3QERA 2E8AA 4NCGA 2HHWA 3EEQA 3C94A 3VGMA 2WTUA 3SAGA 4DTPA 1C1BA 2XY5A 3MN9A 3LP0A 1JCEA 4DS4A 3L4IA 4CEEA 3CXCM 4CGJA 3SMPA 1NK0A 1XHXA 3KK1A 4HUFA 3Q7BA 3E9OA 3WXLA 5JLHA 4IO9L 5BR9A 4F2RA 4IEIA 3AVHA 3NCIA 3B6OA 2X78A 5JICA 1ZBFA 4M42A 5HRRA 3VERA 1T03A 4IDKA 3O9TA 3MXIA 1QSLA 1IKVA 4EFHA 2XRIA 3FZLA 1D9FA 5JLFA 3HYFA 3AY9A 1U45A 1IH7A 1GLLO 3HPGA 3L2VA 3AO3A 3ID8A 3ZEUB 3OYBA 4DV5K 4OX9K 4KREA 1HPZA 2HOEA 1HJOA 2YKMA 4ILGB 4H5WA 5FPDA 4PKGA 2OPQA 3ZT1A 2CGLA 3OYLA 4FZXC 2EX3A 4FJXA 2PBDA 2YX6A 2BH1A 3LM2A 3SV4A 4BRDA 3PUFA 2RHKA 3CG7A 3TU5A 3WQTA 3TR8A 4DG1A 4H0YB 1NK6A 5AQZA 3VPZA 1BIUA 4FJGA 3PX6A 2O8FB 3CQXA 3AVFA 1RBTA 2QI2A 3RMCA 1Q82O 3G4SN 5BREA 2QK9A 1TKTA 3J7AP 3FZFA 1VSLA 3WXIA 3SQ1A 1OH5A 3VQ7A 3U8XA 1KD1O 4FJIA 1FXXA 3CJ1A 1W9HA 3VENA 4DR4K 1NJIO 4KTZA 2YJFA 1WNSA 4CEAA 4DTRA 4AH9A 3SCXA 3OYHA 5B8HA 4OKEA 3WT0A 3WXMB 3R8EA 5M1KA 2GV9A 3THXA 3O4QA 2Q2RA 4B9UA 1XMQK 3THYB 5JS2A 3UE5A 3IMXA 4CHOA 4O8UA 1GLFO 4IOXA 2YHYA 1TUUA 5FPMA 4BR0A 3I8BA 4CJQA 1HRHA 2F9TA 4DV4K 4DTSA 4CZGA 3MXMA 3CI5A 4AF1A 3SYZA 2E2NA 3FE1A 4RWTA 3FFIA 2P9IA 3V9SA 5KPZA 3D7EO 3ZLJA 2KQ2A 3CM5A 4OPAA 5C25A 1NOZA 4Q0BA 3U3GA 2YHAA 3SBGA 3CPWM 1Q7YO 1TYQB 5T7BA 3EZWA 1KTQA 2GX9A 4GY2B 3V9XA 3BGRA 3C6TA 3SLCA 1I39A 2E88A 3SJHA 4DCHA 1VQ9N 4A5AA 1OH8A 4Y0WA 3LP2A 4A61A 4CJTA 3QETA 3OW2M 1ZYQA 4CJFA 3DLKA 4DUZK 4DQRA 4BDYA 3SNNA 3BEXA 3CJ7A 4LSNA 4CZMA 1C0TA 4M7XA 4CHYA 1NOYA 2KFNA 4IG3A 4FPBA 4DSKA 4ZTFA 4DFJA 4PKHA 4N5SA 4FVMA 4IFEA 1JLQA 2P51A 2PY5A 5BPNA 4ELTA 3V9WA 4Z0UA 4GVEA 3KHYA 4IFYA 4KH4A 4EHTA 5LJWA 1GLJO 3NMUA 4KBOA 4JD2A 4DR1K 1GOBA 3JSMA 1TL3A 1YJWN 1QQCA 1I3AA 3NDKA 1CZ9A 3L6QA 4E0DA 3VTHA 3ZETA 3DWLA 2E6LA 4CEQA 4ISGA 1BIZA 3IDHA 1YUWA 4O44A 4FZYA 4G1QA 2A1RA 1ILYA 4B1WB 2OCEA 1SL1A 3QBWA 5J2MA 4NXNK 2VG7A 1VAZA 4XJXA 3THVA 1Z26A 4DFKA 3TTFA 5F2RA 4BC5A 4BY9C 3NH1A 2CGKA 2VQFK 1BCMA 2FBXA 3O8MA 4AHSA 3PO5A 1MWKA 1TK5A 1HQUA 3C6UA 1S1TA 4DKWA 4AHRA 2ATQA 3H1QA 2UXBK 4K0KK 4A2BA 2IS3A 4PY5A 4CF9A 1MWMA 2HMPA 4YY3K 5LMNK 3CJBA 3VMFB 3DM2A 5M1FA 3U9ZA 4BRMA 4DF8A 1NJZA 3UKUA 3CCLN 3VEXA 1SKWA 2B5JA 3DLHA 3NGZA 3K5NA 3RMAA 3D2EB 4DV7K 5KTQA 4DQ8A 4R5PA 3OYDA 1TVRA 2D0BA 1QQOA 2HMIA 4CEZA 3F9MA 2F8TA 1RDAA 4DR3K 2AJQA 1Q18A 4OGEA 2I5JA 4CJ7A 5FPEA 1RDCA 1J53A 3HI0A 1TL1A 3AVAA 4H5NA 3RWUA 1S6QA 2VWKA 3CQ8A 3ASMA 1TK8A 1XNQK 3TSQA 2FSKA 4CJWA 3F9KA 1IBMK 3MXJA 2NRVA 4WQ5A 4JKEA 4JKHA 3DRRA 1RBSA 2O8EA 3KD5E 1KVAA 1LWFA 4CJRA 3EO3A 3K9KA 5JENA 1YIJN 4FOIA 3SMSA 1KLNA 1U2VA 2HHVA 2W6KA 2RKIA 1VRTA 3LDPA 1REVA 4KO0A 5GAGP 4H4MA 4LFCK 3WEEA 4I6MA 1GOCA 5AQSA 3TSUA 4BVOA 1HYVA 1SAZA 2GUIA 2RPIA 3QINA 3NAEA 3D6RA 2ZGZA 2NZTA 3O9RA 5MLCQ 5CYQA 3DXMA 5IT9O 2P9IB 4CFBA 3KZBA 3CD6N 3F2KA 3MEEA 4H0PA 4K41A 3SI6A 3CQYA 5AQUA 4CJEA 2UYTA 1KC8O 4CBXA 1XI1A 1KLMA 2BUPA 1T6DA 3M8QA 4KFBA 4DR7K 4OGCA 3V1OA 4BGAA 1KQSM 2P9UA 4A2AA 4H03B 2ZJPL 4LF4K 4IDHA 4IOCL 3L0QA 4YNQA 3ZEUA 2HVHA 1DT9A 2KLAA 5CYMA 4BR4A 3A0IX 4FCYA 2F9WA 5DM7L 1EP4A 1NK8A 4QOZB 2W40A 4KAZA 3C6AA 3CYMA 3B8AX 4K8XA 1BQNA 4CIGA 4AILC 3DAWA 4M3UA 5AQTA 3H3OB 4FWQA 2G8HA 2X6NA 4LSLA 4TSXA 1FJGK 4CJUA 1EXQA 1ZBIA 4OPJA 4CECA 5AQLA 3AA3A 2NRXA 2O8FA 3AA2A 4B1UB 2O8DB 1BGXT 2OANA 3QEXA 4C1NK 4W5NA 2V7YA 4KTWA 4JD2B 3CHWA 1VQ6N 4Y1CA 1W97L 2HBJA 5EU7A 4O5BA 2ZWHA 2VQEK 3M8RA 4O8KA 3OY9A 4Z4FA 4DFPA 3O4WA 2FSJA 3CMEN 4CK2A 2GTDA 2OPPA 1ATSA 4KRFA 2YNHA 1RBRA 4EHUA 3HBTA 1JL1A 3QNNA 1EO1A 2V52B 5M1PA 2BANA 2ZGYA 4JKCA 4JK9A 1YITN 1OVYA 4J8FA 5I9EB 3VTIA 2VCPA 1RT6A 3GDQA 4ILJA 2F4VK 2V51B 4LH5A 4Z94A 3AVJA 4JI0K 2D0OA 1VSHA 2KZZA 4FO0A 1RNHA 3THYA 2ETJA 5KQDA 3ENBA 5FPNA 3SQ4A 2HHXA 3EN9A 4BG9A 3DLBA 2ASPA 2G8WA 3SV3A 1S72N 1L3SA 2QEXN 1JXBA 2HB5A 4DTMA 2XY7A 3CJAA 2Z1HA 4LC9B 2E5LK 3M8SA 5F0XA 3DI6A 1XC9A 2YNIA 1KFDA 4FM1A 3BY5A 3DRSA 5M1QA 3T1HK 2IVOA 2HHIA 5AJ3K 1SV5A 4CK3A 4IG0A 4IFVA 2QWNA 1S3XA 1K9MO 3KIOA 3KWIA 2AP1A 2H3GX 5HROA 3KK3A 1WSIA 3AO4A 4B3SK 3IAYA 4LD0A 1SKRA 3A5MC 3KLIA 4FK4A 4M63C 4XEIA 2NRHA 2J4RA 3MN6A 4RTFD 4M3WA 3BF3A 3AAPA 3L2UA 1OH6A 1V4TA 1T3VA 4JKBA 4FK2A 5EXWA 2RE2A 4BGBA 3S3OA 1U4BA 4IEEA 3NHGA 4WQ5C 4AHVA 4NCAA 3S5TA 4A59A 4W5QA 3VQ6A 1RTHA 4B08A 3UKRA 1I94K 4NLCA 4M3TA 2O8EB 3PX4A 4PHTX 4DTXA 2OA8A 2GWKA 4KHSA 3KKSA 3L3UA 4ELUA 1HKGA 4B1YB 3R3LA 1LV5A 3TTDA 2IAJA 5JMVA 2GBZA 4BRLA 4DV6K 4BRIA 5AQWA 4BE2A 1HYSA 4ID5A 2ITGA 5AQVA 4BR5A 1BO5O 4FWPA 4FJMA 3AO2A 1C0UA 2KTQA 5KGWA 1X1PA 2UUCK 2R7YA 1J54A 4H8KA 3L4QA 3RR7A 4NB4A 3BP8A 2VGNA 1S22A 3DXMB 3TPQA 1VQPN 1WBBA 1N36K 4PL8A 1WSJA 4KHQA 4BC2A 4XH1A 1UAXA 1U49A 2QA4N 2ZM6K 4FJLA 3QICA 3TAMA 3K5MA 1JJ2M 4NYFA 3SQ2A 2CH5A 1NKEA 1X9MA 1CXQA 5AQQA 1IBLK 1VSFA 4OJRA 2P9UB 3AVBA 3WUHA 4ZHRA 3U3YA 4GKKK 2F7TA 4Z4EA 4WFBL 4M3ZA 2Z1GA 5GIPA 4GV6A 4JV5K 1RT3A 2WBNA 4BRCA 1NGEA 2HBKA 3P5JA 3R6MA 4FLYA 4KHWA 4JI6K 4E72A 5EOYA 4I2QA 3EYZA 1LAVA 1Z05A 3HP6A 4WYBA 4QS8A 2O4GA 5CHIA 3HT3A 1X3MA 4F3TA 2UUAK 3ITHA 1MDUB 4EZ6A 3RMBA 3D2EA 1J5EK 3I56N 2D5RA 3A2FA 5E41A 4ZTJA 4DTOA 3BF1A 3DOKA 3CJ9A 1S5JA 3LM9A 4LFBK 4M45A 5GAEP 2BDPA 2JWKA 4H0TB 3RMDA 3NH0A 4JI4K 3QFPA 3OYNA 2E4LA 5HRSA 1NNEA 2QXLA 3IKMA 4BE1A 4FWRA 2QKBA 4FWKA 2W6LA 1YI2N 4CEOA 4E89A 2UXDK 2QW9A 3IRXA 5SWMA 1N8RO 1QZ6A 1JKHA 1YAGA 3LAKA 4X66K 1HNWK 1M1KO 3LANA 5BPLA 4C8KA 1OH7A 3VQCA 4FJHA 4BREA 2DFFA 2P5GA 2ZQBA 3EKSA 1GOAA 1VSJA 5HP1A 1NGGA 2D0PA 4RCHA 2JGUA 4JKFA 4DV1K 1NMNA 2BE2A 2QWMA 1FK9A 1ATRA 5LMUK 3MCAB 3TARA 4ICLA 4OLAA 1D4XA 4HCCA 3FFKB 3VQDA 4FJNA 3GG4A 5DMRA 1ZBSA 2LSNA 4CJ3A 3CCJN 1VQON 3VQEA 3SPYA 3MEGA 2WOMA 5GIOA 4CGDA 3QNOA 1UWBA 2Y1IA 3SK3A 2KZMA 2FBTA 1B9DA 1VSKA 3O4NA 1Y97A 3LPTA 4MO5A 2Q31A 4JI1K 1WSHA 3GE1A 2W42A 3D0PA 1EWQA 4FZZA 3ALYA 3VEWA 3HP9A 4FLTA 3G0ZA 1RCHA 4B9QA 4DTUA 2YNFA 4LF5K 5FRNA 2VG5A 1HQEA 4WE1A 4H4OA 4FLXA 4H0VB 4CW7B 1D5AA 2CH6A 3LP3A 3S9HA 4CZFA 1NGDA 4BE7B 1NJXA 4DV2K 1NU0A 3KLGA 5CZ2A 1TUYA 2QWOA 1WSFA 3R1XA 3HRGA 3MMVA 3T7ZA 4U7BA 1WUAA 3OYFA 4OKJA 3AVNA 3A5OC 1NM1A 4WF9L 5JVGL 3VQPA 4XH5A 1RDWX 3SBTA 4NLBA 3P1GA 1HX1A 3AA4A 1SKSA 1VQNN 3KKRA 4ELVA 2O4IA 2O8DA 3NF8A 2P9NB 5C2DA 3PLAA 4KHPK 4M3RA 3DLRA 5EX5A 4MFBA 3UKRB 2OZSA 1HKBA 4BRQA 3PY8A 3N4QA 3I33A 4JEPA 1A5XA 1BWFO 3OBYA 2Q1NA 1R0AA 4CJKA 3CCUN 3CC4N 4EIAA 1E3MA 2E20A 5ADXH 1QHAA 1CXUA 3PX0A 5AQPA 4J2DA 1YVNA 3E66A 3M1FA 1YTAA 1WBDA 4E7HA 2A40A 2W41A 3NF6A 3ZSYA 1BL3A 2FC0A 2NNWA 3VQ8A 5JVHL 3PO4A 1BOTO 3HZ6A 1YXQA 3LWLA 3VEZA 4KTQA 5FRMA 1SUQA 1EWRA 4HCBA 2Y1JA 3KLEA 2Z1IA 4E3SA 3LDQA 5JS1A 1HNXK 3KK7A 2FBYA 4GKJK 3V9ZA 4ISEA 3K2PA 1N6QA 4KB0A 1BHLA 2QWQA 3RVCA 3I8DA 2A42A 3ZX2A 4H5TA 4DU3A 4CGHA 3C65A 4DQPA 4FVUA 1IKYA 2IDOA 3CC7N 1SL2A 4B9VA 3AVKA 1JCGA 1BISA 1TK0A 4G9ZA 3P39A 3K58A 1D8YA 1LW0A 2YCHA 1KVBA 4JKGB 1WSEA 4YOWA 4DFMA 4GW6A 1XNRK 1Q86O 4CJPA 4EAHD 2YNGA 2HHTA 1NGFA 3JS6A 2NRRA 2D4WA 4K25A 2HBMA 3PIOL 2OYQA 1TKDA 2KHOA 4PKIA 5LY3A 4JRQA 1BI4B 4FWLA 4CJ5A 2VWJA 2BGGA 2P9SB 5AQRA 3O6WA 3WXKA 5C24A 3FZKA 4DWIA 5M1OA 5TKYA 1QQMA 3QEIA 4DQSA 3K9JA 5AQJA 4Z4GA 2ZE2A 4DSIA 3AVLA 2A5XA 3EL2A 3MN7A 2QWLA 4RW6A 4BRAA 2KW4A 4CGIA 5KGXA 4PA1A 4R79A 2P1JA 2G8VA 3MX5A 4FLZA 2F8SA 4FWMA 4KI4A 1VK0A 2PFUA 4DR5K 4U67L 3AO5A 3O3HA 3VOVA 4IZ9A 1A5WA 3T19A 4JS4A 2AA4A 4CJ4A 1XC3A 4CZEA 1JL2A 4B1XB 1N34K 4B9MA 3T69A 3KTQA 4IJAA 4YDUA 1Z6RA 4DTJA 4CEFA 4BRHA 2B6AA 4GV9A 4LF7K 4KKOA 3QEVA 2OPSA 3C6HA 1N32K 2XY6A 4JK7A 3ID6A 3WQUA 4OO1J 4FXDA 1ESVA 1LOTB 1JCFA 4KH6A 1S1VA 2P9PB 3J80O 3VF4A 5BN8A 1RT5A 4M3YA 3DXKA 5HL7L 3CF5L 2OPRA 3K5OA 1S1XA 3VEVA 4DUYK 1IG9A 5BPMA 2W00A 2RN2A 5FROA 5KPRA 3VEOA 5AFUA 5BRDA 1RDDA 1QSYA 1L3VA 3ULEB 3QDKA 1RT7A 4OKKA 4WCEL 1IKWA 5D3GA 4WFAL 5HOOA 3DOLA 1GLBG 1O1WA 3EE9A 4K43A 3RTVA 2DTUA 3CCVN 3AGRA 4YOTA 3IUCA 1XMOK 1IV0A 5C15A 4FK0A 4GNIA 3I0RA 1CZBA 1NK5A 1WB9A 4ILHA 1NGIA 3AAQA 1HUXA 4WQ4A 1IO2A 1WSGA 1NK9A 3OA9A 3NFAA 3G71N 1ZBUA 1RDBA 2HHQA 1NBWA 1RDUA 3EKUA 2G8IA 1C0FA 1IJJA 4FLUA 3VQAA 3ZT4A 1OKJA 3WNEA 1EQYA 1T44A 5SZTA 3HOTA 2FBVA 1P8ZA 3OBWA 1QVGM 3LL3A 3WNHA 2P5OA 4JI8K 3CYGA 3VA3A 1QSSA 3IFRA 3LPUA 4RG8A 1SQKA 4HUGA 3V1QA 5F1XA 3CJCA 5ADXA 2Q36A 1SL0A 4F2SA 1G15A 2P9LB 2YV0X 1L5UA 4JS5A 1Q81O 5HLFA 4E1JA 4Y1DA 1NG9A 5I42A 4DR6K 1JLCA 1KXPA 2ASOA 4I9LA 3M3ZA 3OYMA 3P38A 3MAQA 1W7AA 3TAGA 3VQBA 3QIOA 1WLJA 3DYAA 1DKGD 2ITMA 3CIPA 1NGBA 4CJSA 1VSIA 1K8AO 3AVGA 1HNIA 3M8PA 5KPTA 3S3NA 4BRKA 1J9AA 4YOVA 4B1VA 3TI0A 3H45C 3DLLL 3QO9A 3V81A 3SUOA 4DB3A 1IKXA 4NXMK 3ZSRA 1HMVA 3OYKA 4YOXA 4OPHA 3ATVA 4YOUA 3CETA 4MDAA 4DS5A 1LCUA 3HVRA 4EP4A 4OLBA 3DRPA 1HR0K 2YHXA 4FOEA 2HHSA 5GADP 2IVPA 4BE0A 2IVNA 2Z1JA 3SJJA 1JLEA 1K8KB 4GMJB 4MLHA 3HSCA 4DR2K 1Q8IA 4AHUA 1JLFA 4NO7A 1QQNA 4FL9A 4C8NA 3B6PA 3VQ5A 1RT1A 3SUNA 5AQYA 4DSFA 1KCFA 2VWBA 3HVTA 4HTUA 2G8UA 1QHTA 3OYCA 1TAUA 1UA1A 2EHGA 3LDOA 2D0AA 1OVQA 3VEYA 3OTOK 1CZAN 3E9LA 3G10A 1X9WA 4BG8A 4JHDB 4DQQA 3SQ0A 4BVPA 4NCBA 1NJYA 4BQLA 2P9NA 3LALA 4YDUC 4CZHA 2P9KA 2E1ZA 4QAGA 4X64K 4YOYA 2FF3B 2HF3A 3ZX0A 4CIFA 3CCRN 2IIRA 5ELZA 1C0GA 2E2OA 4HWIA 5AQHA 2HNZA 1N33K 4CI6A 3M5RA 2I7NA 1DTTA 3CCSN 3LZJA 4KV8A 1KRPA 3ZT2A 4JNEA 4C8OA 2QWPA 2EWSA 1TKZA 4EP5A 3HM9A 1NK4A 1Q9YA 4HUEA 2D1KA 3TANA 2HHHK 2C1IA 3ZT3A 2Q0UA 4FSVA 1MU2A 4W5TA 3DXKB 3WNGA 3HO1A 4E1NA 2E2PA 2QKKA 2PYLA 3NBPA 4DSEA 1UA0A 4B9SA 4RW8A 3PIPL 1RBUA 1B92A 3KLHA 5AQFA 1C1AA 3IG1A 2O8BB 4JI3K 1T6CA 4CEBA 4XIUA 1BQMA 2PAVA 3DLEA 4JKDA 3ZSOA 1X9JA 3MEDA 3SAHA 3O1BA 2OTLN 4Z4CA 3GOIA 5J2QA 4E1MA 3O9QA 2GWJA 3L3VA 3O9UA 4WQ4C 5C42A 3G6EN 4AQYK 3HL8A 3O5BA 5BR8K 4I2PA 4FJKA 1QVFM 1LWCA 3GL1A 4JKGA 3ZCMA 3J7ZO 3N4PA 4M3XA 3VQ4A 4BR2A 3BZKA 4H5VA 3OJSA 4E7LA 5AZIB 1J6ZA 4XH4A 5AQKA 1NWKA 1YTUA 1EETA 3U9DA 1BI4A 4J2EA 4L8RB 3AO1A 4CJVA 2A1SA 2P9SA 1DLOA 4YFUA 4EZ9A 4DLEA 2NRWA 1RBVA 1FKOA 1LWEA 4O4GA 1YJNN 1D9DA 4B3TK 2A41A 1SS6A 1U04A 3ZX3A 1O13A 2FLOA 5KRSA 2HW3A 4CZKA 3OS2A 4LH4A 3NE6A 5E26A 1HKCA 1Y64A 4LFAK 1DGKN 3MWTA 4DU4A 2YJEA 4KB1A 3QB0A 2ZJRL 2QWRA 5TKWA 3O9SA 4IOAL 1BA0A 5AQGA 3CFOA 4W5OA 1JLAA 5AR0A 1V4SA 1ITGA 3ZT0A 1S6PA 2F96A 3ENHA 1L3TA 2I7PA 3QIPA 2JLEA 4DV3K 3PV8A 3CCMN 3RSEB 4BC3A 4UQGA 3Q7CA 3CERA 4O0JA 4NYNA 2IOCA 3OHRA 3ZSXA 4JI7K 3K57A 2HNYA 4CF0A 3TSPA 4B8CA 3NH2A 1FW6A 3SUPA 2FXUA 3QEWA 4H0OA 5C12A 4CBWA 3HM8A 3TAQA 1S1WA 2P9PA 5IWAK 4AHTA 4FM0A 3AA5X 3T1AA 3SPZA 1UOCA 2G8FA 1NGHA 4I7FA 4DU1A 4IJNA 1F21A 4OPKA 3AVIA 4DF4A 4BQZA 3ULEA 3P4IA 4JK8A 5AFUH 4J2AA 1QTMA 4DTNA 1HNZK 3E9PA 3I0SA 1DTQA 5HRNA 2Q97A 1QZ5A 2A3ZA 1R59O 1VQ7N 2HSTA 2BTFA 4CGFA 3CFRA 3EE8A 3HPOA 1RTJA 1GLAG 3P83D 3NVKA 3KK2A 4DSLA 2HHUA 4MDBA 3L2RA 3CCQN 4CD1A 3BZCA 3MCPA 5CE3A 3OYEA 4FLVA 1KAYA 2XHBA 2GEMA 1BUPA 2NLXA 3OYAA 3ISNC 1WAFA 4F4KA 4QS9A 3O3GA 4B1ZA 4CVNE 4E7IA 5HRPA 1T7PA 1ASWA 4CHNA 3L2WA 1WOQA 4RW7A 1BDGA 3VQ9A 5AZJB 4UY8O 3W3DA 2WC9A 2HNDA 3OYGA 2FSNA 1C0MA 3WNFA 4A5BA 1T05A 3VF2A 1KAXA 4BRNA 2JWLA 2B4JA 3J81O 2DPNA 1XQSC 3DJCA 3OS1A 3TAEA 2NUBA 4IWVA 3O3FA 2P9KB 3FLCO 4A57A 5C0YA 1KVCA 4ISFA 4PWDA 3HOSA 1VRUA 1Z25A 4ID1A 3SAFA 4CD3A 3C0BA 3ENOA 4CESA 4DLGA 5CR4A
chains in the Genus database with same CATH topology
2P9LA 1JCFA 2PBDA 2YX6A 4KH6A 2BH1A 3H1VX 2P9PB 4BRFA 3VF4A 5BN8A 3DXKA 3FR0A 3LM2A 3MN5A 4DHYA 5HL7L 3CF5L 2QWNA 1NLVA 3VEVA 4BRDA 1S3XA 1K9MO 1ATNA 2GUPA 3MX2A 5BPMA 2RHKA 3KWIA 3TU5A 2AP1A 4FWSA 3WQTA 4C1NI 2H3GX 4H0YB 2VGMA 2NRZA 3A8YA 5AQZA 3VEOA 3VPZA 5AFUA 5BRDA 5KPRA 3ULEB 3QDKA 3CQXA 4WCEL 3A5MC 4WFAL 1VQLN 2QI2A 4M63C 4C23A 4XEIA 5HOOA 1Q82O 2NRHA 4MLEA 3G4SN 1GLBG 2J4RA 3MN6A 3P31A 4RTFD 5BREA 3EE9A 4K43A 4JKAA 2NRTA 3FZFA 4K42A 3WXIA 3U8XA 3BF3A 3CCVN 1KD1O 3C7NB 3AAPA 3O80A 3AGRA 4YOTA 3W0LA 2KKZA 2QTDA 3IUCA 1V4TA 1T3VA 3CJ1A 4JKBA 3VENA 4CBUA 5EXWA 5C15A 4GNIA 2RE2A 4BGBA 1NJIO 4ILHA 1NGIA 3AAQA 2YJFA 1HUXA 1E4GT 4IEEA 4WQ4A 1XUPO 3H3NO 4WQ5C 1BU6O 3OA9A 1VQ4N 3FZMA 3G71N 4YORA 5B8HA 4BEBA 3WT0A 3WXMB 3R8EA 1NBWA 5AQNA 2HF4A 1RDUA 5M1KA 2ASMA 3EKUA 1C0FA 1IJJA 4A59A 2Q2RA 4PL7A 3UB5A 1OKJA 1EQYA 2V7ZA 1T44A 3UKRA 4NLCA 3HOTA 4PHTX 1P8ZA 1NGAA 3UE5A 3IMXA 3OBWA 2GWKA 2WFBA 1QVGM 3LL3A 3KWGA 4O8UA 1GLFO 4CZLA 4IOXA 5C10A 4BR9A 2YHYA 3CCEN 1TUUA 1K8KA 1HKGA 5FPMA 4BR0A 3I8BA 3IFRA 3R3LA 4HTLA 4B1YB 5GINA 1SQKA 3TTDA 2F9TA 5C2FA 5JMVA 4CZGA 5F1XA 4BRLA 3CJCA 4BRIA 2YHWA 3CI5A 4AF1A 2E2NA 5AQWA 5ADXA 2Q36A 4AM7A 4JN4A 3FE1A 5AQVA 4BR5A 2P9IA 1BO5O 4FWPA 4RWTA 5KPZA 3D7EO 2P9LB 4OPAA 3AARA 1Q81O 3L4QA 4NB4A 3BP8A 4E1JA 3SBGA 2VGNA 1H1VA 1S22A 1TYQB 3DXMB 3S41A 3TPQA 3CPWM 1KXPA 1NMDA 2ASOA 4PL8A 3M3ZA 3P38A 4BC2A 3H6EA 4XH1A 3EZWA 2GX9A 4JHDA 4GY2B 2QA4N 4IXCA 3SLCA 3QICA 4BC4A 2E88A 3SJHA 4O5FA 4DCHA 1IG8A 4A5AA 1VQ9N 1JJ2M 3ZYYX 3QBXA 2CH5A 5AQIA 1DKGD 2ITMA 4Y0WA 4A61A 5AQQA 2P9UB 3WUHA 1X3NA 3CIPA 1NGBA 3OW2M 3VGKA 5M1NA 1DEJA 2F7TA 1K8AO 3BEXA 2VYPA 3CJ7A 4WFNL 1BG3A 4WFBL 5KPTA 5GIPA 4GV6A 4CZMA 4BRKA 4M7XA 1U6ZA 4YOVA 4B1VA 3H45C 4JAXA 2WBNA 4BRCA 1NGEA 2HBKA 3R6MA 4FPBA 4BRGA 3DLLL 4PKHA 4DB3A 3D2FA 5EOYA 1Z05A 3O1WA 3BUZB 4IFEA 4WYBA 4QS8A 5BPNA 5CHIA 4YOXA 4OPHA 3ATVA 4YOUA 3CETA 4MDAA 1X3MA 1G99A 4GVEA 1LCUA 3KHYA 4KH4A 4EHTA 2A6AA 5LJWA 1GLJO 3NMUA 1BA1A 1GLCG 4JD2A 4KBOA 1MDUB 3D2EA 1YF5L 3I56N 1YJWN 2YHXA 4FOEA 3FGUA 3BF1A 4BECA 1NGCA 5GADP 3CJ9A 3L6QA 3LM9A 2IVPA 3VF6A 2IVNA 5GAEP 3VTHA 3ZETA 1K8KB 1VQ5N 2JWKA 3O08A 3DWLA 4H0TB 4IO8A 1YHQN 3MK6A 3QFPA 4MLHA 3HSCA 4ISGA 3IDHA 1YUWA 4NO7A 1QQNA 4FL9A 2QXLA 3IKMA 5AQYA 4FWRA 2YI1A 1ILYA 2WUSA 4FWKA 5DM6L 2VWBA 1YI2N 3LDLA 4B1WB 4FWOA 3QBWA 2QW9A 3LDNA 1VAZA 3LDOA 1QZ6A 1N8RO 3VEYA 1VQPN 1YAGA 1YJ9N 4XJXA 1CZAN 3E9LA 5KQ8A 1M1KO 3TTFA 5BPLA 5F2RA 4BG8A 4JHDB 4BREA 3EKSA 4BC5A 4BVPA 5AZIA 1NGGA 2D0PA 2P9NA 4BQLA 2CGKA 3A5NC 4RCHA 4BY9C 4JKFA 3R9PA 4YDUC 4CZHA 2P9KA 2E1ZA 3J8AA 2QWMA 3O8MA 1ATRA 3FZHA 3VETA 3MCAB 4YOYA 2FF3B 2HF3A 3CC2N 1D4XA 3FFKB 1MWKA 3ZX0A 3CCRN 2IIRA 5ELZA 3GG4A 1C0GA 1ZBSA 2E2OA 3CCJN 4DKWA 3NVMA 4HWIA 5AQHA 2ZJQL 1VQON 3H1QA 4CI6A 3M5RA 2I7NA 3CCSN 2OTJN 4A2BA 1MWMA 4JNEA 5GIOA 2HMPA 2QWPA 2EWSA 1MA9B 3G25A 3SK3A 1VQMN 2D1KA 3CJBA 2GELA 3VMFB 1GLEG 1VQ8N 4H0XB 4A62A 2C1IA 5M1FA 2Q0UA 3U9ZA 4MO5A 2Q31A 5BRFA 4FSVA 3GE1A 3M6GA 4BRMA 3DXKB 3CPEA 3UKUA 3CCLN 3VEWA 5EVZA 3VEXA 3HTVA 2E2PA 4B9QA 3MWPA 5GAHP 3D2EB 1ZC6A 4DQ8A 3PIPL 5AQFA 3CMAN 3QFUA 4GV3A 5E84A 4H5RA 1QQOA 3JXUA 1T6CA 4AM6A 5AQOA 2PAVA 3F9MA 3RSEA 3ZETB 4JKDA 4H0VB 1X9JA 1Q18A 3A5LC 3SAHA 3O1BA 1RGIA 2CH6A 4CJ7A 5FPEA 4CZFA 2OTLN 1NGDA 3HI0A 4H5NA 3GOIA 4BE7B 5EY4A 3O9QA 2GWJA 3O9UA 5H1SQ 3I55N 4BRPA 4WQ4C 3TSQA 2C1GA 2FSKA 3QMLA 3G6EN 1TUYA 2QWOA 3R1XA 5AQMA 5AQXA 4BR7A 3HRGA 3MMVA 3T7ZA 3O5BA 2NRVA 3E1YA 4JKEA 4WQ5A 4U7BA 1WUAA 3A5OC 4JKHA 1NM1A 1QVFM 4WF9L 3GL1A 4JKGA 4XH5A 5JVGL 1M90O 2QM1A 3J7ZO 3N4PA 1RDWX 3SBTA 4NLBA 3VESA 4BR2A 1HX1A 3ATUA 3U4LA 4H5VA 3EO3A 1VQNN 3K9KA 1K73O 3MDQA 1YIJN 4FOIA 5AZIB 1J6ZA 2P9NB 4XH4A 3SMSA 5C2DA 3PLAA 5AQKA 1U2VA 1NWKA 5EX5A 1NGJA 3LDPA 3U9DA 3UKRB 4BROA 1HKBA 4BRQA 5GAGP 1EO1A 3WEEA 3N4QA 3I33A 4JEPA 2P9SA 3OBYA 1BWFO 4I6MA 2Q1NA 5AQSA 3TSUA 2NRWA 3CCUN 3CC4N 1YJNN 4L3QA 4EIAA 4BVOA 2A41A 2E20A 3KVGA 5ADXH 1SS6A 2ZF5O 1SAZA 2CGJA 1QHAA 3ZX3A 3AGKA 1O13A 2FLOA 3D6RA 2ZGZA 1KAZA 5AQPA 4CZKA 2FF6A 1YVNA 3E66A 3M1FA 2NZTA 3O9RA 5MLCQ 3DXMA 1TYQA 2A40A 2W41A 5E26A 2P9IB 4M7YA 3KZBA 3CD6N 2NNWA 1HKCA 5JVHL 3F2KA 1BOTO 4FPAA 3HZ6A 1E4FT 1YXQA 1Y64A 4H0PA 4K41A 5AZJA 1DGKN 3MWTA 3VEZA 2YJEA 1HLUA 3QB0A 3CQYA 2ZJRL 5AQUA 3UKUB 4F9OA 2UYTA 1KC8O 2QWRA 5TKWA 3O9SA 4IOAL 1BA0A 5AQGA 4CBXA 2BUPA 1T6DA 5AR0A 2E1YA 4BGAA 3LDQA 1P90A 3KK7A 1KQSM 1V4SA 2P9UA 4A2AA 4ISEA 4H03B 4KH5A 2ZJPL 3ENHA 4IDHA 4IOCL 1Q7YO 3L0QA 2I7PA 3CCMN 3RSEB 4BC3A 3ZEUA 1DT9A 1SZ2A 2KLAA 3Q7CA 4BR4A 2QWQA 3RVCA 3A0IX 2A42A 3CERA 2F9WA 3OHRA 3ZX2A 1HPMA 5DM7L 1W2BM 4H5TA 3VGLA 5LJVA 2W40A 3TSPA 3F5TA 3C6AA 3C65A 2FXUA 4FVUA 3B8AX 3CC7N 4MO4A 4H0OA 5C12A 4CBWA 1JCGA 4QS7A 3TTCA 3WXJA 5BRHA 3DAWA 3HM8A 2P9PA 5AQTA 3H3OB 4G9ZA 3P39A 4FWQA 2YCHA 1NGHA 3D2FB 4JKGB 4YOWA 1ZXOA 5AQLA 3GBTA 4IJNA 1RFQA 1Q86O 4EAHD 1VQKN 4BQZA 2NRXA 3ULEA 3P4IA 2E2QA 4JK8A 5AFUH 1NGFA 3JS6A 2NRRA 2D4WA 4K25A 4B1UB 2HBMA 3PIOL 5BN9A 3H46O 1U2VB 3E9PA 2OANA 4C1NK 2V7YA 2Q97A 2KHOA 1QZ5A 4PKIA 4JD2B 5LY3A 2A3ZA 4FWLA 1GLDG 3CHWA 1R59O 3WEEB 2HBLA 2HSTA 2BTFA 2Q0RA 4FWNA 4CZIA 1VQ7N 2P9SB 1VQ6N 3EE8A 4I6MB 3O6WA 5AQRA 3WXKA 3FZKA 1GLAG 3NVKA 1W97L 3C7NA 2HBJA 4CZJA 4MDBA 5M1OA 5TKYA 2ZWHA 1QQMA 2E8AA 3CCQN 4CD1A 3MCPA 3K9JA 5AQJA 5CE3A 4O8KA 1KAYA 3VGMA 3SAGA 2GEMA 1BUPA 3O4WA 2FSJA 2NLXA 1JCEA 3MN9A 2A5XA 3CMEN 3L4IA 2GTDA 3EL2A 3MN7A 2QWLA 4QS9A 4BRAA 4B1ZA 3CXCM 3SMPA 1ATSA 4R79A 3MX5A 4EHUA 1WOQA 4FWMA 3HBTA 1BDGA 5AZJB 3Q7BA 2PFUA 3E9OA 3WXLA 4U67L 5JLHA 5BR9A 4IO9L 2V52B 4IZ9A 5M1PA 3VOVA 4UY8O 2ZGYA 3W3DA 2WC9A 4IEIA 4JKCA 2AA4A 4JK9A 1YITN 1OVYA 4J8FA 5I9EB 5JICA 3VERA 3VTIA 2VCPA 1XC3A 2FSNA 3GDQA 4ILJA 2V51B 4CZEA 4Z94A 4A5BA 1KAXA 2D0OA 3VF2A 4BRNA 4B1XB 2JWLA 4FO0A 3T69A 5KQDA 3ENBA 3O9TA 5FPNA 3EN9A 4BG9A 4IJAA 2ASPA 2DPNA 1XQSC 3DJCA 4EFHA 4YDUA 1S72N 2QEXN 3FZLA 5JLFA 1Z6RA 3AY9A 1GLLO 4BRHA 4IWVA 3CJAA 3ID8A 3ZEUB 2P9KB 3FLCO 4A57A 4GV9A 4LC9B 2HOEA 5F0XA 5C0YA 1HJOA 4ILGB 4ISFA 3HOSA 3C6HA 4H5WA 5FPDA 3SAFA 4CD3A 4JK7A 3ID6A 3WQUA 2W00A 4PKGA 5M1QA 3C0BA 4OO1J 2CGLA 3ENOA 2IVOA 1ESVA 1LOTB 5CR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9L A;  1JCF A;  2PBD A;  3H1V X;  2P9P B;  4BRF A;  3VF4 A;  5BN8 A;  3DXK A;  3FR0 A;  3LM2 A;  3MN5 A;  4DHY A;  2QWN A;  1NLV A;  3VEV A;  4BRD A;  1S3X A;  1ATN A;  2GUP A;  5BPM A;  3TU5 A;  2AP1 A;  4FWS A;  3WQT A;  2H3G X;  4H0Y B;  3A8Y A;  3VEO A;  5AFU A;  5AQZ A;  3VPZ A;  5BRD A;  5KPR A;  3ULE B;  3QDK A;  3CQX A;  3A5M C;  4M63 C;  4C23 A;  4XEI A;  2NRH A;  4MLE A;  1GLB G;  2J4R A;  3MN6 A;  4RTF D;  5BRE A;  4K43 A;  3FZF A;  4K42 A;  3WXI A;  3U8X A;  3BF3 A;  3C7N B;  3AAP A;  3O80 A;  3W0L A;  3IUC A;  1V4T A;  3CJ1 A;  3VEN A;  4CBU A;  5EXW A;  4GNI A;  4BGB A;  1NGI A;  3AAQ A;  2YJF A;  1HUX A;  1E4G T;  4WQ4 A;  1XUP O;  3H3N O;  4WQ5 C;  1BU6 O;  3FZM A;  5B8H A;  3WT0 A;  3R8E A;  1NBW A;  5AQN A;  2HF4 A;  2ASM A;  3EKU A;  1C0F A;  1IJJ A;  2Q2R A;  4PL7 A;  3UB5 A;  1OKJ A;  1EQY A;  2V7Z A;  1T44 A;  3UKR A;  1P8Z A;  1NGA A;  3UE5 A;  3IMX A;  2GWK A;  3LL3 A;  1GLF O;  4CZL A;  4BR9 A;  2YHY A;  1TUU A;  1K8K A;  1HKG A;  5FPM A;  4BR0 A;  3I8B A;  3IFR A;  4HTL A;  4B1Y B;  1SQK A;  2F9T A;  5JMV A;  4CZG A;  5F1X A;  4BRL A;  3CJC A;  4BRI A;  2YHW A;  3CI5 A;  2E2N A;  5AQW A;  5ADX A;  2Q36 A;  4AM7 A;  4JN4 A;  3FE1 A;  5AQV A;  4BR5 A;  2P9I A;  1BO5 O;  4FWP A;  4RWT A;  5KPZ A;  3D7E O;  2P9L B;  3AAR A;  4NB4 A;  3BP8 A;  4E1J A;  1H1V A;  1S22 A;  1TYQ B;  3DXM B;  3S41 A;  3TPQ A;  1KXP A;  1NMD A;  2ASO A;  4PL8 A;  3M3Z A;  4BC2 A;  3H6E A;  4XH1 A;  3EZW A;  4JHD A;  4GY2 B;  4IXC A;  3SLC A;  3QIC A;  4BC4 A;  2E88 A;  3SJH A;  4O5F A;  4DCH A;  1IG8 A;  3QBX A;  2CH5 A;  5AQI A;  1DKG D;  2ITM A;  4Y0W A;  4A61 A;  5AQQ A;  2P9U B;  3WUH A;  1X3N A;  3CIP A;  1NGB A;  3VGK A;  1DEJ A;  3BEX A;  2VYP A;  3CJ7 A;  1BG3 A;  5KPT A;  4CZM A;  4BRK A;  4M7X A;  1U6Z A;  4B1V A;  3H45 C;  4JAX A;  4BRC A;  1NGE A;  4FPB A;  3R6M A;  4BRG A;  4PKH A;  4DB3 A;  3D2F A;  5EOY A;  1Z05 A;  3O1W A;  3BUZ B;  4WYB A;  4QS8 A;  5BPN A;  3ATV A;  3CET A;  1X3M A;  1G99 A;  1LCU A;  3KHY A;  4EHT A;  2A6A A;  5LJW A;  1GLJ O;  1BA1 A;  1GLC G;  4JD2 A;  4KBO A;  1MDU B;  3D2E A;  2YHX A;  4FOE A;  3FGU A;  3BF1 A;  1NGC A;  3CJ9 A;  3L6Q A;  3LM9 A;  2IVP A;  3VF6 A;  2IVN A;  3ZET A;  1K8K B;  3O08 A;  3DWL A;  4H0T B;  4IO8 A;  3MK6 A;  3QFP A;  4MLH A;  3HSC A;  4ISG A;  3IDH A;  1YUW A;  4NO7 A;  1QQN A;  4FL9 A;  2QXL A;  5AQY A;  4FWR A;  2YI1 A;  2WUS A;  4FWK A;  2VWB A;  3LDL A;  4B1W B;  4FWO A;  3QBW A;  2QW9 A;  3LDN A;  3LDO A;  1QZ6 A;  3VEY A;  1YAG A;  1CZA N;  5KQ8 A;  5BPL A;  5F2R A;  4BG8 A;  4JHD B;  4BRE A;  3EKS A;  4BC5 A;  4BVP A;  5AZI A;  1NGG A;  2D0P A;  2P9N A;  4BQL A;  2CGK A;  3A5N C;  4RCH A;  3R9P A;  4YDU C;  4CZH A;  2P9K A;  2E1Z A;  3J8A A;  2QWM A;  3O8M A;  1ATR A;  3FZH A;  3VET A;  2FF3 B;  2HF3 A;  1D4X A;  3FFK B;  1MWK A;  3ZX0 A;  2IIR A;  5ELZ A;  3GG4 A;  1C0G A;  1ZBS A;  2E2O A;  4HWI A;  5AQH A;  3H1Q A;  4CI6 A;  2I7N A;  4A2B A;  1MWM A;  4JNE A;  2HMP A;  2QWP A;  2EWS A;  1MA9 B;  3G25 A;  3SK3 A;  2D1K A;  3CJB A;  2GEL A;  1GLE G;  4H0X B;  4A62 A;  2Q0U A;  3U9Z A;  4MO5 A;  2Q31 A;  5BRF A;  4FSV A;  3GE1 A;  3M6G A;  4BRM A;  3DXK B;  3UKU A;  3VEW A;  5EVZ A;  3VEX A;  3HTV A;  2E2P A;  4B9Q A;  3D2E B;  1ZC6 A;  4DQ8 A;  5AQF A;  3QFU A;  5E84 A;  4H5R A;  1QQO A;  3JXU A;  1T6C A;  4AM6 A;  5AQO A;  2PAV A;  3F9M A;  3RSE A;  3ZET B;  4H0V B;  1X9J A;  1Q18 A;  3A5L C;  3O1B A;  1RGI A;  2CH6 A;  4CJ7 A;  5FPE A;  4CZF A;  1NGD A;  3HI0 A;  4H5N A;  3GOI A;  5EY4 A;  2GWJ A;  4BRP A;  4WQ4 C;  2FSK A;  3QML A;  1TUY A;  2QWO A;  5AQX A;  5AQM A;  4BR7 A;  3MMV A;  3O5B A;  4WQ5 A;  1WUA A;  3A5O C;  1NM1 A;  3GL1 A;  4XH5 A;  2QM1 A;  1RDW X;  3VES A;  4BR2 A;  1HX1 A;  3ATU A;  3U4L A;  4H5V A;  3EO3 A;  3MDQ A;  4FOI A;  5AZI B;  1J6Z A;  2P9N B;  4XH4 A;  3SMS A;  5AQK A;  1U2V A;  1NWK A;  5EX5 A;  1NGJ A;  3LDP A;  3U9D A;  3UKR B;  4BRO A;  1HKB A;  4BRQ A;  3WEE A;  3I33 A;  2P9S A;  1BWF O;  4I6M A;  2Q1N A;  5AQS A;  4L3Q A;  4EIA A;  4BVO A;  2A41 A;  2E20 A;  3KVG A;  5ADX H;  2ZF5 O;  1SAZ A;  2CGJ A;  1QHA A;  3ZX3 A;  2FLO A;  2ZGZ A;  1KAZ A;  5AQP A;  4CZK A;  2FF6 A;  1YVN A;  3M1F A;  2NZT A;  3DXM A;  1TYQ A;  2A40 A;  2W41 A;  5E26 A;  2P9I B;  4M7Y A;  3KZB A;  1HKC A;  1BOT O;  4FPA A;  3HZ6 A;  1E4F T;  1YXQ A;  1Y64 A;  4H0P A;  4K41 A;  5AZJ A;  1DGK N;  3VEZ A;  2YJE A;  1HLU A;  3QB0 A;  3CQY A;  5AQU A;  3UKU B;  4F9O A;  2UYT A;  2QWR A;  1BA0 A;  5AQG A;  4CBX A;  2BUP A;  1T6D A;  5AR0 A;  2E1Y A;  4BGA A;  3LDQ A;  1V4S A;  2P9U A;  4A2A A;  4ISE A;  4H03 B;  3ENH A;  3L0Q A;  2I7P A;  3RSE B;  4BC3 A;  3ZEU A;  4BR4 A;  1SZ2 A;  2QWQ A;  3A0I X;  2A42 A;  3CER A;  2F9W A;  3OHR A;  3ZX2 A;  1HPM A;  4H5T A;  3VGL A;  5LJV A;  2W40 A;  2FXU A;  3B8A X;  4MO4 A;  4H0O A;  4CBW A;  1JCG A;  4QS7 A;  5BRH A;  3WXJ A;  3DAW A;  3HM8 A;  2P9P A;  5AQT A;  3H3O B;  4FWQ A;  2YCH A;  1NGH A;  3D2F B;  1ZXO A;  5AQL A;  3GBT A;  4IJN A;  1RFQ A;  4EAH D;  4BQZ A;  3ULE A;  3P4I A;  2E2Q A;  5AFU H;  1NGF A;  3JS6 A;  4B1U B;  2D4W A;  4K25 A;  5BN9 A;  3H46 O;  1U2V B;  2OAN A;  2V7Y A;  2Q97 A;  2KHO A;  1QZ5 A;  4PKI A;  4JD2 B;  5LY3 A;  2A3Z A;  4FWL A;  1GLD G;  3CHW A;  1R59 O;  3WEE B;  4FWN A;  2BTF A;  2Q0R A;  4CZI A;  2P9S B;  5AQR A;  4I6M B;  3O6W A;  3WXK A;  3FZK A;  1GLA G;  3C7N A;  4CZJ A;  5TKY A;  2ZWH A;  1QQM A;  2E8A A;  4CD1 A;  3MCP A;  5AQJ A;  5CE3 A;  4O8K A;  1KAY A;  3VGM A;  2GEM A;  1BUP A;  3O4W A;  2FSJ A;  2NLX A;  1JCE A;  3MN9 A;  2A5X A;  3L4I A;  2GTD A;  3EL2 A;  3MN7 A;  2QWL A;  4QS9 A;  4BRA A;  4B1Z A;  3SMP A;  1ATS A;  4EHU A;  1WOQ A;  4FWM A;  3HBT A;  1BDG A;  5AZJ B;  3WXL A;  5JLH A;  5BR9 A;  2V52 B;  4IZ9 A;  3VOV A;  2ZGY A;  3W3D A;  2AA4 A;  4J8F A;  5I9E B;  5JIC A;  3VER A;  2VCP A;  1XC3 A;  2FSN A;  3GDQ A;  4CZE A;  2V51 B;  4Z94 A;  1KAX A;  2D0O A;  3VF2 A;  4BRN A;  4B1X B;  4FO0 A;  5KQD A;  5FPN A;  3EN9 A;  4BG9 A;  4IJA A;  2ASP A;  2DPN A;  1XQS C;  3DJC A;  4EFH A;  4YDU A;  3FZL A;  5JLF A;  1Z6R A;  3AY9 A;  1GLL O;  4BRH A;  4IWV A;  3CJA A;  3ID8 A;  3ZEU B;  2P9K B;  3FLC O;  4LC9 B;  2HOE A;  5F0X A;  1HJO A;  4ISF A;  4H5W A;  5FPD A;  4CD3 A;  3WQU A;  4PKG A;  3C0B A;  2CGL A;  3ENO A;  2IVO A;  1ESV A;  1LOT B; 
#chains in the Genus database with same CATH topology
 2P9L A;  2DFH A;  3H1V X;  5DK5 A;  4BRF A;  2QXF A;  3L8B A;  3FR0 A;  3MN5 A;  4DHY A;  3D45 A;  1QE1 A;  4B3O A;  1JXE A;  1NLV A;  4CJL A;  3TAB A;  1ATN A;  3SUQ A;  2GUP A;  3MX2 A;  4J2B A;  3MEC A;  4FWS A;  4C1N I;  2VGM A;  2NRZ A;  3A8Y A;  2UU9 K;  1HNV A;  1HYZ A;  1VQL N;  4C23 A;  4MLE A;  1EX4 A;  4C8M A;  4JI2 K;  3OJU A;  3SZ2 A;  3P31 A;  4PUO A;  4JKA A;  2NRT A;  4AHC A;  4K42 A;  4CIE A;  3LWM A;  4FJJ A;  2WON A;  3C7N B;  3O80 A;  3W0L A;  4MQ3 A;  2KKZ A;  2QTD A;  5J1E A;  4E7J A;  3V6D A;  4M41 A;  3TWH A;  4CBU A;  3DMJ A;  1HJR A;  1S9E A;  4CED A;  1E4G T;  1XUP O;  3H3N O;  1XWL A;  1BU6 O;  1VQ4 N;  4QCL A;  3FZM A;  4N47 A;  3RRG A;  5FLX O;  4YOR A;  4CHP A;  4BEB A;  1J5O A;  5AQN A;  2XY8 A;  2HF4 A;  2ASM A;  4PL7 A;  3UB5 A;  5J2N A;  4CHZ A;  2V7Z A;  4V19 S;  1XHZ A;  1ASU A;  4OVL A;  1NGA A;  2WFB A;  4Z4I A;  1JLB A;  3KWG A;  1Q9X A;  4FM2 A;  4CZL A;  5KRT A;  5C10 A;  4BR9 A;  3CCE N;  1C6V A;  1K8K A;  1ZBL A;  4E7K A;  5GIN A;  4HTL A;  3JAM O;  5C2F A;  3QLH A;  1S1U A;  2YHW A;  4AM7 A;  4JN4 A;  2G8K A;  4N76 A;  4N56 A;  3KJV A;  3RRH A;  2RF2 A;  3AAR A;  1H1V A;  3S41 A;  1VSD A;  1NMD A;  3THW A;  1VSE A;  3H6E A;  1RT4 A;  1B9F A;  4JHD A;  1X9S A;  4RW4 A;  5I3U A;  4IXC A;  1L3U A;  4BC4 A;  4B3R K;  4GVM A;  4O5F A;  1IG8 A;  5K14 A;  3E01 A;  3ZYY X;  3QBX A;  4IBN A;  5AQI A;  1K6Y A;  1X3N A;  3V1R A;  3VGK A;  1S9G A;  3L2Q A;  5M1N A;  1DEJ A;  2KFZ A;  4BWJ A;  1WN7 A;  2VYP A;  4WFN L;  1BG3 A;  1TAQ A;  1U6Z A;  4JAX A;  1A5V A;  4BRG A;  3VN5 A;  3K5L A;  2IC3 A;  3D2F A;  1RT2 A;  4CFA A;  1NKB A;  3O1W A;  5CY4 A;  3BUZ B;  3OS0 A;  4FW2 A;  4C8L A;  1KSP A;  3THX B;  3HPH A;  1VSM A;  1G99 A;  2O8C A;  1U48 A;  2A6A A;  4FJ5 A;  4HHT A;  1BA1 A;  1GLC G;  3HJF A;  1YF5 L;  1NKC A;  2YHB A;  3VQQ A;  4O0I A;  3EY1 A;  3FGU A;  4BEC A;  1NGC A;  2O8B A;  3LP1 A;  3VF6 A;  1ASV A;  3V9U A;  1VQ5 N;  3O08 A;  4IO8 A;  1YHQ N;  3MK6 A;  4KI6 A;  3QES A;  3C95 A;  4B9L A;  3ULD A;  3PSI A;  4B3M K;  2YI1 A;  4CGG A;  2WUS A;  1NJW A;  5DM6 L;  2PZS A;  3TAF A;  1LW2 A;  3LDL A;  3PSF A;  4BDP A;  4FWO A;  3ZSZ A;  4PQU A;  2XO7 A;  3LDN A;  4B9N A;  3V4I A;  3QEP A;  3H08 A;  3TAP A;  4BWM A;  1YJ9 N;  3HK2 A;  4DSJ A;  5KQ8 A;  3S3M A;  1RIL A;  3DLG A;  5AZI A;  2DFE A;  3A5N C;  4YHH K;  3R9P A;  4CFC A;  3J8A A;  1EKE A;  3FZH A;  3VET A;  4LF8 K;  4B8A B;  4DV0 K;  1LAW A;  3CC2 N;  3OVN A;  4KHY A;  4B9T A;  3LAM A;  3J7Y P;  3NVM A;  2ZJQ L;  4LF9 K;  4LF6 K;  2OTJ N;  4FYD A;  4DQI A;  4E19 A;  1MA9 B;  3F73 A;  3G25 A;  1VQM N;  2GEL A;  1RTD A;  1GLE G;  1VQ8 N;  4H0X B;  4A62 A;  2OZM A;  5BRF A;  5J2P A;  3M6G A;  3CPE A;  5EVZ A;  3HTV A;  3MWP A;  3ZSV A;  5GAH P;  4F3O A;  1ZC6 A;  2X6S A;  2E6M A;  4W5R A;  4CE9 A;  5CZ1 A;  4CF2 A;  4JI5 K;  3CMA N;  3QFU A;  4GV3 A;  4O55 A;  5E84 A;  4H5R A;  3JXU A;  4AM6 A;  1WAJ A;  5AQO A;  3RSE A;  3ZET B;  3A5L C;  3BDP A;  3OYJ A;  1RGI A;  2Q3S A;  3ZSQ A;  3HXM A;  5EY4 A;  4RW9 A;  3RR8 A;  5H1S Q;  3I55 N;  4BRP A;  3CM6 A;  2C1G A;  3QML A;  4N41 A;  5AQX A;  3NF9 A;  5AQM A;  4BR7 A;  3E1Y A;  4K8Z A;  5KI6 A;  4LY7 A;  2VG6 A;  2QM1 A;  3U6F A;  1M90 O;  1IBK K;  4CHQ A;  3VES A;  1CLQ A;  3ATU A;  3U4L A;  1YT3 A;  4HVJ A;  3K0S A;  1K73 O;  3JYT A;  2IGI A;  3MDQ A;  4FJ7 A;  4KPY A;  3AVM A;  1NGJ A;  4BRO A;  3AV9 A;  1KFS A;  3LDS A;  3UIQ A;  4FJ8 A;  4Z4H A;  4L3Q A;  4CFD A;  2HVI A;  3KVG A;  3CFP A;  2ZF5 O;  2CGJ A;  3LZI A;  3AGK A;  1T8E A;  1QS4 A;  1KAZ A;  2FF6 A;  5LL6 Z;  1TYQ A;  5FDL A;  3AVC A;  4Q5V A;  4JRP A;  1JLG A;  4M7Y A;  2X74 A;  1BCO A;  1TGO A;  4FPA A;  5AZJ A;  1E4F T;  4DMN A;  4CCH A;  1HLU A;  1W0H A;  3UKU B;  3KLF A;  4F9O A;  4JYA K;  2D0C A;  3T1Y K;  3HST B;  4FW1 A;  1U47 A;  3THW B;  4JLH A;  3OYI A;  2E1Y A;  1P90 A;  4FJ9 A;  5A2Q O;  3IS9 A;  4KH5 A;  4F8R A;  3ZSW A;  2DY4 A;  1C1C A;  4X65 K;  1RTI A;  1SZ2 A;  5HBM A;  3K59 A;  3KD1 E;  1HPM A;  1W2B M;  3VGL A;  5LJV A;  2ZD1 A;  3F5T A;  2UUB K;  1YVU A;  4MO4 A;  4QS7 A;  1TV6 A;  3TTC A;  3WXJ A;  5BRH A;  4BDZ A;  4CF1 A;  1N5Y A;  1NK7 A;  3D2F B;  3NGY A;  4X62 K;  1VHX A;  1TKX A;  1ZXO A;  3NGI A;  3GBT A;  4CF8 A;  1RFQ A;  4CK1 A;  3VA0 A;  4I9Q A;  2UXC K;  1VQK N;  2E2Q A;  5BN9 A;  3H46 O;  2PYJ A;  4KHN A;  1U2V B;  3EZ5 A;  2O8C B;  3T3F A;  4FLW A;  4IKF A;  4CER A;  4BAC A;  1GLD G;  3WEE B;  2HBL A;  4FWN A;  2Q0R A;  4CZI A;  2YKN A;  3NF7 A;  4I6M B;  4KHU A;  3C7N A;  4CZJ A;  1ZBH A;  1FKP A;  3QER A;  2E8A A;  4NCG A;  2HHW A;  3EEQ A;  3C94 A;  3VGM A;  2WTU A;  3SAG A;  4DTP A;  1C1B A;  2XY5 A;  3MN9 A;  3LP0 A;  1JCE A;  4DS4 A;  3L4I A;  4CEE A;  3CXC M;  4CGJ A;  3SMP A;  1NK0 A;  1XHX A;  3KK1 A;  4HUF A;  3Q7B A;  3E9O A;  3WXL A;  5JLH A;  4IO9 L;  5BR9 A;  4F2R A;  4IEI A;  3AVH A;  3NCI A;  3B6O A;  2X78 A;  5JIC A;  1ZBF A;  4M42 A;  5HRR A;  3VER A;  1T03 A;  4IDK A;  3O9T A;  3MXI A;  1QSL A;  1IKV A;  4EFH A;  2XRI A;  3FZL A;  1D9F A;  5JLF A;  3HYF A;  3AY9 A;  1U45 A;  1IH7 A;  1GLL O;  3HPG A;  3L2V A;  3AO3 A;  3ID8 A;  3ZEU B;  3OYB A;  4DV5 K;  4OX9 K;  4KRE A;  1HPZ A;  2HOE A;  1HJO A;  2YKM A;  4ILG B;  4H5W A;  5FPD A;  4PKG A;  2OPQ A;  3ZT1 A;  2CGL A;  3OYL A;  4FZX C;  2EX3 A;  4FJX A;  2PBD A;  2YX6 A;  2BH1 A;  3LM2 A;  3SV4 A;  4BRD A;  3PUF A;  2RHK A;  3CG7 A;  3TU5 A;  3WQT A;  3TR8 A;  4DG1 A;  4H0Y B;  1NK6 A;  5AQZ A;  3VPZ A;  1BIU A;  4FJG A;  3PX6 A;  2O8F B;  3CQX A;  3AVF A;  1RBT A;  2QI2 A;  3RMC A;  1Q82 O;  3G4S N;  5BRE A;  2QK9 A;  1TKT A;  3J7A P;  3FZF A;  1VSL A;  3WXI A;  3SQ1 A;  1OH5 A;  3VQ7 A;  3U8X A;  1KD1 O;  4FJI A;  1FXX A;  3CJ1 A;  1W9H A;  3VEN A;  4DR4 K;  1NJI O;  4KTZ A;  2YJF A;  1WNS A;  4CEA A;  4DTR A;  4AH9 A;  3SCX A;  3OYH A;  5B8H A;  4OKE A;  3WT0 A;  3WXM B;  3R8E A;  5M1K A;  2GV9 A;  3THX A;  3O4Q A;  2Q2R A;  4B9U A;  1XMQ K;  3THY B;  5JS2 A;  3UE5 A;  3IMX A;  4CHO A;  4O8U A;  1GLF O;  4IOX A;  2YHY A;  1TUU A;  5FPM A;  4BR0 A;  3I8B A;  4CJQ A;  1HRH A;  2F9T A;  4DV4 K;  4DTS A;  4CZG A;  3MXM A;  3CI5 A;  4AF1 A;  3SYZ A;  2E2N A;  3FE1 A;  4RWT A;  3FFI A;  2P9I A;  3V9S A;  5KPZ A;  3D7E O;  3ZLJ A;  2KQ2 A;  3CM5 A;  4OPA A;  5C25 A;  1NOZ A;  4Q0B A;  3U3G A;  2YHA A;  3SBG A;  3CPW M;  1Q7Y O;  1TYQ B;  5T7B A;  3EZW A;  1KTQ A;  2GX9 A;  4GY2 B;  3V9X A;  3BGR A;  3C6T A;  3SLC A;  1I39 A;  2E88 A;  3SJH A;  4DCH A;  1VQ9 N;  4A5A A;  1OH8 A;  4Y0W A;  3LP2 A;  4A61 A;  4CJT A;  3QET A;  3OW2 M;  1ZYQ A;  4CJF A;  3DLK A;  4DUZ K;  4DQR A;  4BDY A;  3SNN A;  3BEX A;  3CJ7 A;  4LSN A;  4CZM A;  1C0T A;  4M7X A;  4CHY A;  1NOY A;  2KFN A;  4IG3 A;  4FPB A;  4DSK A;  4ZTF A;  4DFJ A;  4PKH A;  4N5S A;  4FVM A;  4IFE A;  1JLQ A;  2P51 A;  2PY5 A;  5BPN A;  4ELT A;  3V9W A;  4Z0U A;  4GVE A;  3KHY A;  4IFY A;  4KH4 A;  4EHT A;  5LJW A;  1GLJ O;  3NMU A;  4KBO A;  4JD2 A;  4DR1 K;  1GOB A;  3JSM A;  1TL3 A;  1YJW N;  1QQC A;  1I3A A;  3NDK A;  1CZ9 A;  3L6Q A;  4E0D A;  3VTH A;  3ZET A;  3DWL A;  2E6L A;  4CEQ A;  4ISG A;  1BIZ A;  3IDH A;  1YUW A;  4O44 A;  4FZY A;  4G1Q A;  2A1R A;  1ILY A;  4B1W B;  2OCE A;  1SL1 A;  3QBW A;  5J2M A;  4NXN K;  2VG7 A;  1VAZ A;  4XJX A;  3THV A;  1Z26 A;  4DFK A;  3TTF A;  5F2R A;  4BC5 A;  4BY9 C;  3NH1 A;  2CGK A;  2VQF K;  1BCM A;  2FBX A;  3O8M A;  4AHS A;  3PO5 A;  1MWK A;  1TK5 A;  1HQU A;  3C6U A;  1S1T A;  4DKW A;  4AHR A;  2ATQ A;  3H1Q A;  2UXB K;  4K0K K;  4A2B A;  2IS3 A;  4PY5 A;  4CF9 A;  1MWM A;  2HMP A;  4YY3 K;  5LMN K;  3CJB A;  3VMF B;  3DM2 A;  5M1F A;  3U9Z A;  4BRM A;  4DF8 A;  1NJZ A;  3UKU A;  3CCL N;  3VEX A;  1SKW A;  2B5J A;  3DLH A;  3NGZ A;  3K5N A;  3RMA A;  3D2E B;  4DV7 K;  5KTQ A;  4DQ8 A;  4R5P A;  3OYD A;  1TVR A;  2D0B A;  1QQO A;  2HMI A;  4CEZ A;  3F9M A;  2F8T A;  1RDA A;  4DR3 K;  2AJQ A;  1Q18 A;  4OGE A;  2I5J A;  4CJ7 A;  5FPE A;  1RDC A;  1J53 A;  3HI0 A;  1TL1 A;  3AVA A;  4H5N A;  3RWU A;  1S6Q A;  2VWK A;  3CQ8 A;  3ASM A;  1TK8 A;  1XNQ K;  3TSQ A;  2FSK A;  4CJW A;  3F9K A;  1IBM K;  3MXJ A;  2NRV A;  4WQ5 A;  4JKE A;  4JKH A;  3DRR A;  1RBS A;  2O8E A;  3KD5 E;  1KVA A;  1LWF A;  4CJR A;  3EO3 A;  3K9K A;  5JEN A;  1YIJ N;  4FOI A;  3SMS A;  1KLN A;  1U2V A;  2HHV A;  2W6K A;  2RKI A;  1VRT A;  3LDP A;  1REV A;  4KO0 A;  5GAG P;  4H4M A;  4LFC K;  3WEE A;  4I6M A;  1GOC A;  5AQS A;  3TSU A;  4BVO A;  1HYV A;  1SAZ A;  2GUI A;  2RPI A;  3QIN A;  3NAE A;  3D6R A;  2ZGZ A;  2NZT A;  3O9R A;  5MLC Q;  5CYQ A;  3DXM A;  5IT9 O;  2P9I B;  4CFB A;  3KZB A;  3CD6 N;  3F2K A;  3MEE A;  4H0P A;  4K41 A;  3SI6 A;  3CQY A;  5AQU A;  4CJE A;  2UYT A;  1KC8 O;  4CBX A;  1XI1 A;  1KLM A;  2BUP A;  1T6D A;  3M8Q A;  4KFB A;  4DR7 K;  4OGC A;  3V1O A;  4BGA A;  1KQS M;  2P9U A;  4A2A A;  4H03 B;  2ZJP L;  4LF4 K;  4IDH A;  4IOC L;  3L0Q A;  4YNQ A;  3ZEU A;  2HVH A;  1DT9 A;  2KLA A;  5CYM A;  4BR4 A;  3A0I X;  4FCY A;  2F9W A;  5DM7 L;  1EP4 A;  1NK8 A;  4QOZ B;  2W40 A;  4KAZ A;  3C6A A;  3CYM A;  3B8A X;  4K8X A;  1BQN A;  4CIG A;  4AIL C;  3DAW A;  4M3U A;  5AQT A;  3H3O B;  4FWQ A;  2G8H A;  2X6N A;  4LSL A;  4TSX A;  1FJG K;  4CJU A;  1EXQ A;  1ZBI A;  4OPJ A;  4CEC A;  5AQL A;  3AA3 A;  2NRX A;  2O8F A;  3AA2 A;  4B1U B;  2O8D B;  1BGX T;  2OAN A;  3QEX A;  4C1N K;  4W5N A;  2V7Y A;  4KTW A;  4JD2 B;  3CHW A;  1VQ6 N;  4Y1C A;  1W97 L;  2HBJ A;  5EU7 A;  4O5B A;  2ZWH A;  2VQE K;  3M8R A;  4O8K A;  3OY9 A;  4Z4F A;  4DFP A;  3O4W A;  2FSJ A;  3CME N;  4CK2 A;  2GTD A;  2OPP A;  1ATS A;  4KRF A;  2YNH A;  1RBR A;  4EHU A;  3HBT A;  1JL1 A;  3QNN A;  1EO1 A;  2V52 B;  5M1P A;  2BAN A;  2ZGY A;  4JKC A;  4JK9 A;  1YIT N;  1OVY A;  4J8F A;  5I9E B;  3VTI A;  2VCP A;  1RT6 A;  3GDQ A;  4ILJ A;  2F4V K;  2V51 B;  4LH5 A;  4Z94 A;  3AVJ A;  4JI0 K;  2D0O A;  1VSH A;  2KZZ A;  4FO0 A;  1RNH A;  3THY A;  2ETJ A;  5KQD A;  3ENB A;  5FPN A;  3SQ4 A;  2HHX A;  3EN9 A;  4BG9 A;  3DLB A;  2ASP A;  2G8W A;  3SV3 A;  1S72 N;  1L3S A;  2QEX N;  1JXB A;  2HB5 A;  4DTM A;  2XY7 A;  3CJA A;  2Z1H A;  4LC9 B;  2E5L K;  3M8S A;  5F0X A;  3DI6 A;  1XC9 A;  2YNI A;  1KFD A;  4FM1 A;  3BY5 A;  3DRS A;  5M1Q A;  3T1H K;  2IVO A;  2HHI A;  5AJ3 K;  1SV5 A;  4CK3 A;  4IG0 A;  4IFV A;  2QWN A;  1S3X A;  1K9M O;  3KIO A;  3KWI A;  2AP1 A;  2H3G X;  5HRO A;  3KK3 A;  1WSI A;  3AO4 A;  4B3S K;  3IAY A;  4LD0 A;  1SKR A;  3A5M C;  3KLI A;  4FK4 A;  4M63 C;  4XEI A;  2NRH A;  2J4R A;  3MN6 A;  4RTF D;  4M3W A;  3BF3 A;  3AAP A;  3L2U A;  1OH6 A;  1V4T A;  1T3V A;  4JKB A;  4FK2 A;  5EXW A;  2RE2 A;  4BGB A;  3S3O A;  1U4B A;  4IEE A;  3NHG A;  4WQ5 C;  4AHV A;  4NCA A;  3S5T A;  4A59 A;  4W5Q A;  3VQ6 A;  1RTH A;  4B08 A;  3UKR A;  1I94 K;  4NLC A;  4M3T A;  2O8E B;  3PX4 A;  4PHT X;  4DTX A;  2OA8 A;  2GWK A;  4KHS A;  3KKS A;  3L3U A;  4ELU A;  1HKG A;  4B1Y B;  3R3L A;  1LV5 A;  3TTD A;  2IAJ A;  5JMV A;  2GBZ A;  4BRL A;  4DV6 K;  4BRI A;  5AQW A;  4BE2 A;  1HYS A;  4ID5 A;  2ITG A;  5AQV A;  4BR5 A;  1BO5 O;  4FWP A;  4FJM A;  3AO2 A;  1C0U A;  2KTQ A;  5KGW A;  1X1P A;  2UUC K;  2R7Y A;  1J54 A;  4H8K A;  3L4Q A;  3RR7 A;  4NB4 A;  3BP8 A;  2VGN A;  1S22 A;  3DXM B;  3TPQ A;  1VQP N;  1WBB A;  1N36 K;  4PL8 A;  1WSJ A;  4KHQ A;  4BC2 A;  4XH1 A;  1UAX A;  1U49 A;  2QA4 N;  2ZM6 K;  4FJL A;  3QIC A;  3TAM A;  3K5M A;  1JJ2 M;  4NYF A;  3SQ2 A;  2CH5 A;  1NKE A;  1X9M A;  1CXQ A;  5AQQ A;  1IBL K;  1VSF A;  4OJR A;  2P9U B;  3AVB A;  3WUH A;  4ZHR A;  3U3Y A;  4GKK K;  2F7T A;  4Z4E A;  4WFB L;  4M3Z A;  2Z1G A;  5GIP A;  4GV6 A;  4JV5 K;  1RT3 A;  2WBN A;  4BRC A;  1NGE A;  2HBK A;  3P5J A;  3R6M A;  4FLY A;  4KHW A;  4JI6 K;  4E72 A;  5EOY A;  4I2Q A;  3EYZ A;  1LAV A;  1Z05 A;  3HP6 A;  4WYB A;  4QS8 A;  2O4G A;  5CHI A;  3HT3 A;  1X3M A;  4F3T A;  2UUA K;  3ITH A;  1MDU B;  4EZ6 A;  3RMB A;  3D2E A;  1J5E K;  3I56 N;  2D5R A;  3A2F A;  5E41 A;  4ZTJ A;  4DTO A;  3BF1 A;  3DOK A;  3CJ9 A;  1S5J A;  3LM9 A;  4LFB K;  4M45 A;  5GAE P;  2BDP A;  2JWK A;  4H0T B;  3RMD A;  3NH0 A;  4JI4 K;  3QFP A;  3OYN A;  2E4L A;  5HRS A;  1NNE A;  2QXL A;  3IKM A;  4BE1 A;  4FWR A;  2QKB A;  4FWK A;  2W6L A;  1YI2 N;  4CEO A;  4E89 A;  2UXD K;  2QW9 A;  3IRX A;  5SWM A;  1N8R O;  1QZ6 A;  1JKH A;  1YAG A;  3LAK A;  4X66 K;  1HNW K;  1M1K O;  3LAN A;  5BPL A;  4C8K A;  1OH7 A;  3VQC A;  4FJH A;  4BRE A;  2DFF A;  2P5G A;  2ZQB A;  3EKS A;  1GOA A;  1VSJ A;  5HP1 A;  1NGG A;  2D0P A;  4RCH A;  2JGU A;  4JKF A;  4DV1 K;  1NMN A;  2BE2 A;  2QWM A;  1FK9 A;  1ATR A;  5LMU K;  3MCA B;  3TAR A;  4ICL A;  4OLA A;  1D4X A;  4HCC A;  3FFK B;  3VQD A;  4FJN A;  3GG4 A;  5DMR A;  1ZBS A;  2LSN A;  4CJ3 A;  3CCJ N;  1VQO N;  3VQE A;  3SPY A;  3MEG A;  2WOM A;  5GIO A;  4CGD A;  3QNO A;  1UWB A;  2Y1I A;  3SK3 A;  2KZM A;  2FBT A;  1B9D A;  1VSK A;  3O4N A;  1Y97 A;  3LPT A;  4MO5 A;  2Q31 A;  4JI1 K;  1WSH A;  3GE1 A;  2W42 A;  3D0P A;  1EWQ A;  4FZZ A;  3ALY A;  3VEW A;  3HP9 A;  4FLT A;  3G0Z A;  1RCH A;  4B9Q A;  4DTU A;  2YNF A;  4LF5 K;  5FRN A;  2VG5 A;  1HQE A;  4WE1 A;  4H4O A;  4FLX A;  4H0V B;  4CW7 B;  1D5A A;  2CH6 A;  3LP3 A;  3S9H A;  4CZF A;  1NGD A;  4BE7 B;  1NJX A;  4DV2 K;  1NU0 A;  3KLG A;  5CZ2 A;  1TUY A;  2QWO A;  1WSF A;  3R1X A;  3HRG A;  3MMV A;  3T7Z A;  4U7B A;  1WUA A;  3OYF A;  4OKJ A;  3AVN A;  3A5O C;  1NM1 A;  4WF9 L;  5JVG L;  3VQP A;  4XH5 A;  1RDW X;  3SBT A;  4NLB A;  3P1G A;  1HX1 A;  3AA4 A;  1SKS A;  1VQN N;  3KKR A;  4ELV A;  2O4I A;  2O8D A;  3NF8 A;  2P9N B;  5C2D A;  3PLA A;  4KHP K;  4M3R A;  3DLR A;  5EX5 A;  4MFB A;  3UKR B;  2OZS A;  1HKB A;  4BRQ A;  3PY8 A;  3N4Q A;  3I33 A;  4JEP A;  1A5X A;  1BWF O;  3OBY A;  2Q1N A;  1R0A A;  4CJK A;  3CCU N;  3CC4 N;  4EIA A;  1E3M A;  2E20 A;  5ADX H;  1QHA A;  1CXU A;  3PX0 A;  5AQP A;  4J2D A;  1YVN A;  3E66 A;  3M1F A;  1YTA A;  1WBD A;  4E7H A;  2A40 A;  2W41 A;  3NF6 A;  3ZSY A;  1BL3 A;  2FC0 A;  2NNW A;  3VQ8 A;  5JVH L;  3PO4 A;  1BOT O;  3HZ6 A;  1YXQ A;  3LWL A;  3VEZ A;  4KTQ A;  5FRM A;  1SUQ A;  1EWR A;  4HCB A;  2Y1J A;  3KLE A;  2Z1I A;  4E3S A;  3LDQ A;  5JS1 A;  1HNX K;  3KK7 A;  2FBY A;  4GKJ K;  3V9Z A;  4ISE A;  3K2P A;  1N6Q A;  4KB0 A;  1BHL A;  2QWQ A;  3RVC A;  3I8D A;  2A42 A;  3ZX2 A;  4H5T A;  4DU3 A;  4CGH A;  3C65 A;  4DQP A;  4FVU A;  1IKY A;  2IDO A;  3CC7 N;  1SL2 A;  4B9V A;  3AVK A;  1JCG A;  1BIS A;  1TK0 A;  4G9Z A;  3P39 A;  3K58 A;  1D8Y A;  1LW0 A;  2YCH A;  1KVB A;  4JKG B;  1WSE A;  4YOW A;  4DFM A;  4GW6 A;  1XNR K;  1Q86 O;  4CJP A;  4EAH D;  2YNG A;  2HHT A;  1NGF A;  3JS6 A;  2NRR A;  2D4W A;  4K25 A;  2HBM A;  3PIO L;  2OYQ A;  1TKD A;  2KHO A;  4PKI A;  5LY3 A;  4JRQ A;  1BI4 B;  4FWL A;  4CJ5 A;  2VWJ A;  2BGG A;  2P9S B;  5AQR A;  3O6W A;  3WXK A;  5C24 A;  3FZK A;  4DWI A;  5M1O A;  5TKY A;  1QQM A;  3QEI A;  4DQS A;  3K9J A;  5AQJ A;  4Z4G A;  2ZE2 A;  4DSI A;  3AVL A;  2A5X A;  3EL2 A;  3MN7 A;  2QWL A;  4RW6 A;  4BRA A;  2KW4 A;  4CGI A;  5KGX A;  4PA1 A;  4R79 A;  2P1J A;  2G8V A;  3MX5 A;  4FLZ A;  2F8S A;  4FWM A;  4KI4 A;  1VK0 A;  2PFU A;  4DR5 K;  4U67 L;  3AO5 A;  3O3H A;  3VOV A;  4IZ9 A;  1A5W A;  3T19 A;  4JS4 A;  2AA4 A;  4CJ4 A;  1XC3 A;  4CZE A;  1JL2 A;  4B1X B;  1N34 K;  4B9M A;  3T69 A;  3KTQ A;  4IJA A;  4YDU A;  1Z6R A;  4DTJ A;  4CEF A;  4BRH A;  2B6A A;  4GV9 A;  4LF7 K;  4KKO A;  3QEV A;  2OPS A;  3C6H A;  1N32 K;  2XY6 A;  4JK7 A;  3ID6 A;  3WQU A;  4OO1 J;  4FXD A;  1ESV A;  1LOT B;  1JCF A;  4KH6 A;  1S1V A;  2P9P B;  3J80 O;  3VF4 A;  5BN8 A;  1RT5 A;  4M3Y A;  3DXK A;  5HL7 L;  3CF5 L;  2OPR A;  3K5O A;  1S1X A;  3VEV A;  4DUY K;  1IG9 A;  5BPM A;  2W00 A;  2RN2 A;  5FRO A;  5KPR A;  3VEO A;  5AFU A;  5BRD A;  1RDD A;  1QSY A;  1L3V A;  3ULE B;  3QDK A;  1RT7 A;  4OKK A;  4WCE L;  1IKW A;  5D3G A;  4WFA L;  5HOO A;  3DOL A;  1GLB G;  1O1W A;  3EE9 A;  4K43 A;  3RTV A;  2DTU A;  3CCV N;  3AGR A;  4YOT A;  3IUC A;  1XMO K;  1IV0 A;  5C15 A;  4FK0 A;  4GNI A;  3I0R A;  1CZB A;  1NK5 A;  1WB9 A;  4ILH A;  1NGI A;  3AAQ A;  1HUX A;  4WQ4 A;  1IO2 A;  1WSG A;  1NK9 A;  3OA9 A;  3NFA A;  3G71 N;  1ZBU A;  1RDB A;  2HHQ A;  1NBW A;  1RDU A;  3EKU A;  2G8I A;  1C0F A;  1IJJ A;  4FLU A;  3VQA A;  3ZT4 A;  1OKJ A;  3WNE A;  1EQY A;  1T44 A;  5SZT A;  3HOT A;  2FBV A;  1P8Z A;  3OBW A;  1QVG M;  3LL3 A;  3WNH A;  2P5O A;  4JI8 K;  3CYG A;  3VA3 A;  1QSS A;  3IFR A;  3LPU A;  4RG8 A;  1SQK A;  4HUG A;  3V1Q A;  5F1X A;  3CJC A;  5ADX A;  2Q36 A;  1SL0 A;  4F2S A;  1G15 A;  2P9L B;  2YV0 X;  1L5U A;  4JS5 A;  1Q81 O;  5HLF A;  4E1J A;  4Y1D A;  1NG9 A;  5I42 A;  4DR6 K;  1JLC A;  1KXP A;  2ASO A;  4I9L A;  3M3Z A;  3OYM A;  3P38 A;  3MAQ A;  1W7A A;  3TAG A;  3VQB A;  3QIO A;  1WLJ A;  3DYA A;  1DKG D;  2ITM A;  3CIP A;  1NGB A;  4CJS A;  1VSI A;  1K8A O;  3AVG A;  1HNI A;  3M8P A;  5KPT A;  3S3N A;  4BRK A;  1J9A A;  4YOV A;  4B1V A;  3TI0 A;  3H45 C;  3DLL L;  3QO9 A;  3V81 A;  3SUO A;  4DB3 A;  1IKX A;  4NXM K;  3ZSR A;  1HMV A;  3OYK A;  4YOX A;  4OPH A;  3ATV A;  4YOU A;  3CET A;  4MDA A;  4DS5 A;  1LCU A;  3HVR A;  4EP4 A;  4OLB A;  3DRP A;  1HR0 K;  2YHX A;  4FOE A;  2HHS A;  5GAD P;  2IVP A;  4BE0 A;  2IVN A;  2Z1J A;  3SJJ A;  1JLE A;  1K8K B;  4GMJ B;  4MLH A;  3HSC A;  4DR2 K;  1Q8I A;  4AHU A;  1JLF A;  4NO7 A;  1QQN A;  4FL9 A;  4C8N A;  3B6P A;  3VQ5 A;  1RT1 A;  3SUN A;  5AQY A;  4DSF A;  1KCF A;  2VWB A;  3HVT A;  4HTU A;  2G8U A;  1QHT A;  3OYC A;  1TAU A;  1UA1 A;  2EHG A;  3LDO A;  2D0A A;  1OVQ A;  3VEY A;  3OTO K;  1CZA N;  3E9L A;  3G10 A;  1X9W A;  4BG8 A;  4JHD B;  4DQQ A;  3SQ0 A;  4BVP A;  4NCB A;  1NJY A;  4BQL A;  2P9N A;  3LAL A;  4YDU C;  4CZH A;  2P9K A;  2E1Z A;  4QAG A;  4X64 K;  4YOY A;  2FF3 B;  2HF3 A;  3ZX0 A;  4CIF A;  3CCR N;  2IIR A;  5ELZ A;  1C0G A;  2E2O A;  4HWI A;  5AQH A;  2HNZ A;  1N33 K;  4CI6 A;  3M5R A;  2I7N A;  1DTT A;  3CCS N;  3LZJ A;  4KV8 A;  1KRP A;  3ZT2 A;  4JNE A;  4C8O A;  2QWP A;  2EWS A;  1TKZ A;  4EP5 A;  3HM9 A;  1NK4 A;  1Q9Y A;  4HUE A;  2D1K A;  3TAN A;  2HHH K;  2C1I A;  3ZT3 A;  2Q0U A;  4FSV A;  1MU2 A;  4W5T A;  3DXK B;  3WNG A;  3HO1 A;  4E1N A;  2E2P A;  2QKK A;  2PYL A;  3NBP A;  4DSE A;  1UA0 A;  4B9S A;  4RW8 A;  3PIP L;  1RBU A;  1B92 A;  3KLH A;  5AQF A;  1C1A A;  3IG1 A;  2O8B B;  4JI3 K;  1T6C A;  4CEB A;  4XIU A;  1BQM A;  2PAV A;  3DLE A;  4JKD A;  3ZSO A;  1X9J A;  3MED A;  3SAH A;  3O1B A;  2OTL N;  4Z4C A;  3GOI A;  5J2Q A;  4E1M A;  3O9Q A;  2GWJ A;  3L3V A;  3O9U A;  4WQ4 C;  5C42 A;  3G6E N;  4AQY K;  3HL8 A;  3O5B A;  5BR8 K;  4I2P A;  4FJK A;  1QVF M;  1LWC A;  3GL1 A;  4JKG A;  3ZCM A;  3J7Z O;  3N4P A;  4M3X A;  3VQ4 A;  4BR2 A;  3BZK A;  4H5V A;  3OJS A;  4E7L A;  5AZI B;  1J6Z A;  4XH4 A;  5AQK A;  1NWK A;  1YTU A;  1EET A;  3U9D A;  1BI4 A;  4J2E A;  4L8R B;  3AO1 A;  4CJV A;  2A1S A;  2P9S A;  1DLO A;  4YFU A;  4EZ9 A;  4DLE A;  2NRW A;  1RBV A;  1FKO A;  1LWE A;  4O4G A;  1YJN N;  1D9D A;  4B3T K;  2A41 A;  1SS6 A;  1U04 A;  3ZX3 A;  1O13 A;  2FLO A;  5KRS A;  2HW3 A;  4CZK A;  3OS2 A;  4LH4 A;  3NE6 A;  5E26 A;  1HKC A;  1Y64 A;  4LFA K;  1DGK N;  3MWT A;  4DU4 A;  2YJE A;  4KB1 A;  3QB0 A;  2ZJR L;  2QWR A;  5TKW A;  3O9S A;  4IOA L;  1BA0 A;  5AQG A;  3CFO A;  4W5O A;  1JLA A;  5AR0 A;  1V4S A;  1ITG A;  3ZT0 A;  1S6P A;  2F96 A;  3ENH A;  1L3T A;  2I7P A;  3QIP A;  2JLE A;  4DV3 K;  3PV8 A;  3CCM N;  3RSE B;  4BC3 A;  4UQG A;  3Q7C A;  3CER A;  4O0J A;  4NYN A;  2IOC A;  3OHR A;  3ZSX A;  4JI7 K;  3K57 A;  2HNY A;  4CF0 A;  3TSP A;  4B8C A;  3NH2 A;  1FW6 A;  3SUP A;  2FXU A;  3QEW A;  4H0O A;  5C12 A;  4CBW A;  3HM8 A;  3TAQ A;  1S1W A;  2P9P A;  5IWA K;  4AHT A;  4FM0 A;  3AA5 X;  3T1A A;  3SPZ A;  1UOC A;  2G8F A;  1NGH A;  4I7F A;  4DU1 A;  4IJN A;  1F21 A;  4OPK A;  3AVI A;  4DF4 A;  4BQZ A;  3ULE A;  3P4I A;  4JK8 A;  5AFU H;  4J2A A;  1QTM A;  4DTN A;  1HNZ K;  3E9P A;  3I0S A;  1DTQ A;  5HRN A;  2Q97 A;  1QZ5 A;  2A3Z A;  1R59 O;  1VQ7 N;  2HST A;  2BTF A;  4CGF A;  3CFR A;  3EE8 A;  3HPO A;  1RTJ A;  1GLA G;  3P83 D;  3NVK A;  3KK2 A;  4DSL A;  2HHU A;  4MDB A;  3L2R A;  3CCQ N;  4CD1 A;  3BZC A;  3MCP A;  5CE3 A;  3OYE A;  4FLV A;  1KAY A;  2XHB A;  2GEM A;  1BUP A;  2NLX A;  3OYA A;  3ISN C;  1WAF A;  4F4K A;  4QS9 A;  3O3G A;  4B1Z A;  4CVN E;  4E7I A;  5HRP A;  1T7P A;  1ASW A;  4CHN A;  3L2W A;  1WOQ A;  4RW7 A;  1BDG A;  3VQ9 A;  5AZJ B;  4UY8 O;  3W3D A;  2WC9 A;  2HND A;  3OYG A;  2FSN A;  1C0M A;  3WNF A;  4A5B A;  1T05 A;  3VF2 A;  1KAX A;  4BRN A;  2JWL A;  2B4J A;  3J81 O;  2DPN A;  1XQS C;  3DJC A;  3OS1 A;  3TAE A;  2NUB A;  4IWV A;  3O3F A;  2P9K B;  3FLC O;  4A57 A;  5C0Y A;  1KVC A;  4ISF A;  4PWD A;  3HOS A;  1VRU A;  1Z25 A;  4ID1 A;  3SAF A;  4CD3 A;  3C0B A;  3ENO A;  4CES A;  4DLG A;  5CR4 A; 
#chains in the Genus database with same CATH homology
 2P9L A;  1JCF A;  2PBD A;  2YX6 A;  4KH6 A;  2BH1 A;  3H1V X;  2P9P B;  4BRF A;  3VF4 A;  5BN8 A;  3DXK A;  3FR0 A;  3LM2 A;  3MN5 A;  4DHY A;  5HL7 L;  3CF5 L;  2QWN A;  1NLV A;  3VEV A;  4BRD A;  1S3X A;  1K9M O;  1ATN A;  2GUP A;  3MX2 A;  5BPM A;  2RHK A;  3KWI A;  3TU5 A;  2AP1 A;  4FWS A;  3WQT A;  4C1N I;  2H3G X;  4H0Y B;  2VGM A;  2NRZ A;  3A8Y A;  5AQZ A;  3VEO A;  3VPZ A;  5AFU A;  5BRD A;  5KPR A;  3ULE B;  3QDK A;  3CQX A;  4WCE L;  3A5M C;  4WFA L;  1VQL N;  2QI2 A;  4M63 C;  4C23 A;  4XEI A;  5HOO A;  1Q82 O;  2NRH A;  4MLE A;  3G4S N;  1GLB G;  2J4R A;  3MN6 A;  3P31 A;  4RTF D;  5BRE A;  3EE9 A;  4K43 A;  4JKA A;  2NRT A;  3FZF A;  4K42 A;  3WXI A;  3U8X A;  3BF3 A;  3CCV N;  1KD1 O;  3C7N B;  3AAP A;  3O80 A;  3AGR A;  4YOT A;  3W0L A;  2KKZ A;  2QTD A;  3IUC A;  1V4T A;  1T3V A;  3CJ1 A;  4JKB A;  3VEN A;  4CBU A;  5EXW A;  5C15 A;  4GNI A;  2RE2 A;  4BGB A;  1NJI O;  4ILH A;  1NGI A;  3AAQ A;  2YJF A;  1HUX A;  1E4G T;  4IEE A;  4WQ4 A;  1XUP O;  3H3N O;  4WQ5 C;  1BU6 O;  3OA9 A;  1VQ4 N;  3FZM A;  3G71 N;  4YOR A;  5B8H A;  4BEB A;  3WT0 A;  3WXM B;  3R8E A;  1NBW A;  5AQN A;  2HF4 A;  1RDU A;  5M1K A;  2ASM A;  3EKU A;  1C0F A;  1IJJ A;  4A59 A;  2Q2R A;  4PL7 A;  3UB5 A;  1OKJ A;  1EQY A;  2V7Z A;  1T44 A;  3UKR A;  4NLC A;  3HOT A;  4PHT X;  1P8Z A;  1NGA A;  3UE5 A;  3IMX A;  3OBW A;  2GWK A;  2WFB A;  1QVG M;  3LL3 A;  3KWG A;  4O8U A;  1GLF O;  4CZL A;  4IOX A;  5C10 A;  4BR9 A;  2YHY A;  3CCE N;  1TUU A;  1K8K A;  1HKG A;  5FPM A;  4BR0 A;  3I8B A;  3IFR A;  3R3L A;  4HTL A;  4B1Y B;  5GIN A;  1SQK A;  3TTD A;  2F9T A;  5C2F A;  5JMV A;  4CZG A;  5F1X A;  4BRL A;  3CJC A;  4BRI A;  2YHW A;  3CI5 A;  4AF1 A;  2E2N A;  5AQW A;  5ADX A;  2Q36 A;  4AM7 A;  4JN4 A;  3FE1 A;  5AQV A;  4BR5 A;  2P9I A;  1BO5 O;  4FWP A;  4RWT A;  5KPZ A;  3D7E O;  2P9L B;  4OPA A;  3AAR A;  1Q81 O;  3L4Q A;  4NB4 A;  3BP8 A;  4E1J A;  3SBG A;  2VGN A;  1H1V A;  1S22 A;  1TYQ B;  3DXM B;  3S41 A;  3TPQ A;  3CPW M;  1KXP A;  1NMD A;  2ASO A;  4PL8 A;  3M3Z A;  3P38 A;  4BC2 A;  3H6E A;  4XH1 A;  3EZW A;  2GX9 A;  4JHD A;  4GY2 B;  2QA4 N;  4IXC A;  3SLC A;  3QIC A;  4BC4 A;  2E88 A;  3SJH A;  4O5F A;  4DCH A;  1IG8 A;  4A5A A;  1VQ9 N;  1JJ2 M;  3ZYY X;  3QBX A;  2CH5 A;  5AQI A;  1DKG D;  2ITM A;  4Y0W A;  4A61 A;  5AQQ A;  2P9U B;  3WUH A;  1X3N A;  3CIP A;  1NGB A;  3OW2 M;  3VGK A;  5M1N A;  1DEJ A;  2F7T A;  1K8A O;  3BEX A;  2VYP A;  3CJ7 A;  4WFN L;  1BG3 A;  4WFB L;  5KPT A;  5GIP A;  4GV6 A;  4CZM A;  4BRK A;  4M7X A;  1U6Z A;  4YOV A;  4B1V A;  3H45 C;  4JAX A;  2WBN A;  4BRC A;  1NGE A;  2HBK A;  3R6M A;  4FPB A;  4BRG A;  3DLL L;  4PKH A;  4DB3 A;  3D2F A;  5EOY A;  1Z05 A;  3O1W A;  3BUZ B;  4IFE A;  4WYB A;  4QS8 A;  5BPN A;  5CHI A;  4YOX A;  4OPH A;  3ATV A;  4YOU A;  3CET A;  4MDA A;  1X3M A;  1G99 A;  4GVE A;  1LCU A;  3KHY A;  4KH4 A;  4EHT A;  2A6A A;  5LJW A;  1GLJ O;  3NMU A;  1BA1 A;  1GLC G;  4JD2 A;  4KBO A;  1MDU B;  3D2E A;  1YF5 L;  3I56 N;  1YJW N;  2YHX A;  4FOE A;  3FGU A;  3BF1 A;  4BEC A;  1NGC A;  5GAD P;  3CJ9 A;  3L6Q A;  3LM9 A;  2IVP A;  3VF6 A;  2IVN A;  5GAE P;  3VTH A;  3ZET A;  1K8K B;  1VQ5 N;  2JWK A;  3O08 A;  3DWL A;  4H0T B;  4IO8 A;  1YHQ N;  3MK6 A;  3QFP A;  4MLH A;  3HSC A;  4ISG A;  3IDH A;  1YUW A;  4NO7 A;  1QQN A;  4FL9 A;  2QXL A;  3IKM A;  5AQY A;  4FWR A;  2YI1 A;  1ILY A;  2WUS A;  4FWK A;  5DM6 L;  2VWB A;  1YI2 N;  3LDL A;  4B1W B;  4FWO A;  3QBW A;  2QW9 A;  3LDN A;  1VAZ A;  3LDO A;  1QZ6 A;  1N8R O;  3VEY A;  1VQP N;  1YAG A;  1YJ9 N;  4XJX A;  1CZA N;  3E9L A;  5KQ8 A;  1M1K O;  3TTF A;  5BPL A;  5F2R A;  4BG8 A;  4JHD B;  4BRE A;  3EKS A;  4BC5 A;  4BVP A;  5AZI A;  1NGG A;  2D0P A;  2P9N A;  4BQL A;  2CGK A;  3A5N C;  4RCH A;  4BY9 C;  4JKF A;  3R9P A;  4YDU C;  4CZH A;  2P9K A;  2E1Z A;  3J8A A;  2QWM A;  3O8M A;  1ATR A;  3FZH A;  3VET A;  3MCA B;  4YOY A;  2FF3 B;  2HF3 A;  3CC2 N;  1D4X A;  3FFK B;  1MWK A;  3ZX0 A;  3CCR N;  2IIR A;  5ELZ A;  3GG4 A;  1C0G A;  1ZBS A;  2E2O A;  3CCJ N;  4DKW A;  3NVM A;  4HWI A;  5AQH A;  2ZJQ L;  1VQO N;  3H1Q A;  4CI6 A;  3M5R A;  2I7N A;  3CCS N;  2OTJ N;  4A2B A;  1MWM A;  4JNE A;  5GIO A;  2HMP A;  2QWP A;  2EWS A;  1MA9 B;  3G25 A;  3SK3 A;  1VQM N;  2D1K A;  3CJB A;  2GEL A;  3VMF B;  1GLE G;  1VQ8 N;  4H0X B;  4A62 A;  2C1I A;  5M1F A;  2Q0U A;  3U9Z A;  4MO5 A;  2Q31 A;  5BRF A;  4FSV A;  3GE1 A;  3M6G A;  4BRM A;  3DXK B;  3CPE A;  3UKU A;  3CCL N;  3VEW A;  5EVZ A;  3VEX A;  3HTV A;  2E2P A;  4B9Q A;  3MWP A;  5GAH P;  3D2E B;  1ZC6 A;  4DQ8 A;  3PIP L;  5AQF A;  3CMA N;  3QFU A;  4GV3 A;  5E84 A;  4H5R A;  1QQO A;  3JXU A;  1T6C A;  4AM6 A;  5AQO A;  2PAV A;  3F9M A;  3RSE A;  3ZET B;  4JKD A;  4H0V B;  1X9J A;  1Q18 A;  3A5L C;  3SAH A;  3O1B A;  1RGI A;  2CH6 A;  4CJ7 A;  5FPE A;  4CZF A;  2OTL N;  1NGD A;  3HI0 A;  4H5N A;  3GOI A;  4BE7 B;  5EY4 A;  3O9Q A;  2GWJ A;  3O9U A;  5H1S Q;  3I55 N;  4BRP A;  4WQ4 C;  3TSQ A;  2C1G A;  2FSK A;  3QML A;  3G6E N;  1TUY A;  2QWO A;  3R1X A;  5AQM A;  5AQX A;  4BR7 A;  3HRG A;  3MMV A;  3T7Z A;  3O5B A;  2NRV A;  3E1Y A;  4JKE A;  4WQ5 A;  4U7B A;  1WUA A;  3A5O C;  4JKH A;  1NM1 A;  1QVF M;  4WF9 L;  3GL1 A;  4JKG A;  4XH5 A;  5JVG L;  1M90 O;  2QM1 A;  3J7Z O;  3N4P A;  1RDW X;  3SBT A;  4NLB A;  3VES A;  4BR2 A;  1HX1 A;  3ATU A;  3U4L A;  4H5V A;  3EO3 A;  1VQN N;  3K9K A;  1K73 O;  3MDQ A;  1YIJ N;  4FOI A;  5AZI B;  1J6Z A;  2P9N B;  4XH4 A;  3SMS A;  5C2D A;  3PLA A;  5AQK A;  1U2V A;  1NWK A;  5EX5 A;  1NGJ A;  3LDP A;  3U9D A;  3UKR B;  4BRO A;  1HKB A;  4BRQ A;  5GAG P;  1EO1 A;  3WEE A;  3N4Q A;  3I33 A;  4JEP A;  2P9S A;  3OBY A;  1BWF O;  4I6M A;  2Q1N A;  5AQS A;  3TSU A;  2NRW A;  3CCU N;  3CC4 N;  1YJN N;  4L3Q A;  4EIA A;  4BVO A;  2A41 A;  2E20 A;  3KVG A;  5ADX H;  1SS6 A;  2ZF5 O;  1SAZ A;  2CGJ A;  1QHA A;  3ZX3 A;  3AGK A;  1O13 A;  2FLO A;  3D6R A;  2ZGZ A;  1KAZ A;  5AQP A;  4CZK A;  2FF6 A;  1YVN A;  3E66 A;  3M1F A;  2NZT A;  3O9R A;  5MLC Q;  3DXM A;  1TYQ A;  2A40 A;  2W41 A;  5E26 A;  2P9I B;  4M7Y A;  3KZB A;  3CD6 N;  2NNW A;  1HKC A;  5JVH L;  3F2K A;  1BOT O;  4FPA A;  3HZ6 A;  1E4F T;  1YXQ A;  1Y64 A;  4H0P A;  4K41 A;  5AZJ A;  1DGK N;  3MWT A;  3VEZ A;  2YJE A;  1HLU A;  3QB0 A;  3CQY A;  2ZJR L;  5AQU A;  3UKU B;  4F9O A;  2UYT A;  1KC8 O;  2QWR A;  5TKW A;  3O9S A;  4IOA L;  1BA0 A;  5AQG A;  4CBX A;  2BUP A;  1T6D A;  5AR0 A;  2E1Y A;  4BGA A;  3LDQ A;  1P90 A;  3KK7 A;  1KQS M;  1V4S A;  2P9U A;  4A2A A;  4ISE A;  4H03 B;  4KH5 A;  2ZJP L;  3ENH A;  4IDH A;  4IOC L;  1Q7Y O;  3L0Q A;  2I7P A;  3CCM N;  3RSE B;  4BC3 A;  3ZEU A;  1DT9 A;  1SZ2 A;  2KLA A;  3Q7C A;  4BR4 A;  2QWQ A;  3RVC A;  3A0I X;  2A42 A;  3CER A;  2F9W A;  3OHR A;  3ZX2 A;  1HPM A;  5DM7 L;  1W2B M;  4H5T A;  3VGL A;  5LJV A;  2W40 A;  3TSP A;  3F5T A;  3C6A A;  3C65 A;  2FXU A;  4FVU A;  3B8A X;  3CC7 N;  4MO4 A;  4H0O A;  5C12 A;  4CBW A;  1JCG A;  4QS7 A;  3TTC A;  3WXJ A;  5BRH A;  3DAW A;  3HM8 A;  2P9P A;  5AQT A;  3H3O B;  4G9Z A;  3P39 A;  4FWQ A;  2YCH A;  1NGH A;  3D2F B;  4JKG B;  4YOW A;  1ZXO A;  5AQL A;  3GBT A;  4IJN A;  1RFQ A;  1Q86 O;  4EAH D;  1VQK N;  4BQZ A;  2NRX A;  3ULE A;  3P4I A;  2E2Q A;  4JK8 A;  5AFU H;  1NGF A;  3JS6 A;  2NRR A;  2D4W A;  4K25 A;  4B1U B;  2HBM A;  3PIO L;  5BN9 A;  3H46 O;  1U2V B;  3E9P A;  2OAN A;  4C1N K;  2V7Y A;  2Q97 A;  2KHO A;  1QZ5 A;  4PKI A;  4JD2 B;  5LY3 A;  2A3Z A;  4FWL A;  1GLD G;  3CHW A;  1R59 O;  3WEE B;  2HBL A;  2HST A;  2BTF A;  2Q0R A;  4FWN A;  4CZI A;  1VQ7 N;  2P9S B;  1VQ6 N;  3EE8 A;  4I6M B;  3O6W A;  5AQR A;  3WXK A;  3FZK A;  1GLA G;  3NVK A;  1W97 L;  3C7N A;  2HBJ A;  4CZJ A;  4MDB A;  5M1O A;  5TKY A;  2ZWH A;  1QQM A;  2E8A A;  3CCQ N;  4CD1 A;  3MCP A;  3K9J A;  5AQJ A;  5CE3 A;  4O8K A;  1KAY A;  3VGM A;  3SAG A;  2GEM A;  1BUP A;  3O4W A;  2FSJ A;  2NLX A;  1JCE A;  3MN9 A;  2A5X A;  3CME N;  3L4I A;  2GTD A;  3EL2 A;  3MN7 A;  2QWL A;  4QS9 A;  4BRA A;  4B1Z A;  3CXC M;  3SMP A;  1ATS A;  4R79 A;  3MX5 A;  4EHU A;  1WOQ A;  4FWM A;  3HBT A;  1BDG A;  5AZJ B;  3Q7B A;  2PFU A;  3E9O A;  3WXL A;  4U67 L;  5JLH A;  5BR9 A;  4IO9 L;  2V52 B;  4IZ9 A;  5M1P A;  3VOV A;  4UY8 O;  2ZGY A;  3W3D A;  2WC9 A;  4IEI A;  4JKC A;  2AA4 A;  4JK9 A;  1YIT N;  1OVY A;  4J8F A;  5I9E B;  5JIC A;  3VER A;  3VTI A;  2VCP A;  1XC3 A;  2FSN A;  3GDQ A;  4ILJ A;  2V51 B;  4CZE A;  4Z94 A;  4A5B A;  1KAX A;  2D0O A;  3VF2 A;  4BRN A;  4B1X B;  2JWL A;  4FO0 A;  3T69 A;  5KQD A;  3ENB A;  3O9T A;  5FPN A;  3EN9 A;  4BG9 A;  4IJA A;  2ASP A;  2DPN A;  1XQS C;  3DJC A;  4EFH A;  4YDU A;  1S72 N;  2QEX N;  3FZL A;  5JLF A;  1Z6R A;  3AY9 A;  1GLL O;  4BRH A;  4IWV A;  3CJA A;  3ID8 A;  3ZEU B;  2P9K B;  3FLC O;  4A57 A;  4GV9 A;  4LC9 B;  2HOE A;  5F0X A;  5C0Y A;  1HJO A;  4ILG B;  4ISF A;  3HOS A;  3C6H A;  4H5W A;  5FPD A;  3SAF A;  4CD3 A;  4JK7 A;  3ID6 A;  3WQU A;  2W00 A;  4PKG A;  5M1Q A;  3C0B A;  4OO1 J;  2CGL A;  3ENO A;  2IVO A;  1ESV A;  1LOT B;  5CR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...