2P9SA

Structure of bovine arp2/3 complex co-crystallized with atp/mg2+
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
414
structure length
397
Chain Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 127
structure length 397
sequence length 414
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 2p9sA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9sA04
1HJOA 1QHAA 3RSEB 3GL1A 4Y0WA 4EHTA 4BR9A 2J4RA 4PKGA 3MN5A 3IMXA 5BR9A 5EXWA 5KQ8A 3CJ9A 3VEZA 3CJ1A 4B1XB 2NRHA 4A2BA 1KAYA 2E2QA 4H5TA 4BG9A 4BRLA 2V51B 4FSVA 3C7NA 4H5RA 5AQGA 2P9NB 5CE3A 2A41A 4H03B 3ZX3A 5AQXA 1YVNA 1HUXA 5AQTA 1LCUA 1JCGA 2FSJA 1ZXOA 4BQZA 1NWKA 2Q1NA 3FR0A 2D1KA 3HBTA 3FZFA 3D2FA 4M7XA 1BUPA 3VF2A 3FZKA 3D2EA 1K8KB 3HZ6A 4BQLA 4EHUA 3H45C 1XC3A 4B9QA 1HLUA 4BC5A 1HKCA 3GOIA 4QS9A 4BRDA 4YDUC 2HF4A 3EN9A 3UKUB 3VGMA 5KPRA 3R6MA 1JCEA 1HX1A 4LC9B 3VGLA 4PKHA 5BN8A 1ATNA 2GUPA 3VETA 2WUSA 3WXIA 5FPEA 4F9OA 2F9TA 2ITMA 4CD3A 3QBWA 3AAQA 4NO7A 3CERA 5AQPA 1HPMA 3P4IA 3O4WA 2BUPA 3O6WA 5LY3A 5TKYA 3WT0A 3HI0A 1YAGA 3MN9A 4FWMA 1NGHA 5AQMA 2P9IA 3JXUA 4CI6A 1TYQA 4B1VA 5AQSA 4B1WB 1NLVA 2IVOA 1E4FT 3EZWA 3RSEA 1D4XA 4FWPA 2HF3A 1XUPO 2QWNA 5AZJB 3WQTA 4BRGA 4CJ7A 3L4IA 4CZJA 3CQYA 5EX5A 4JNEA 5JLHA 5FPNA 3ENOA 3VESA 3SK3A 3VEXA 2YHWA 2PAVA 2P9NA 4FWKA 3A0IX 1QZ6A 4EAHD 3FFKB 4ISFA 4FWLA 3VF6A 3EKSA 4DCHA 1U6ZA 1S22A 2Q97A 3WXLA 5BPNA 2QXLA 4C23A 2ASMA 3LL3A 1NGAA 3BF1A 3H3NO 2GTDA 3LDLA 2E88A 5F0XA 1T6CA 4FPBA 1H1VA 1RDWX 4MO5A 3UKUA 4BVPA 3MN6A 3UB5A 3O1WA 4B1ZA 5AQUA 1DGKN 1DKGD 3LDQA 4NB4A 4H0XB 2VWBA 3O1BA 3O08A 4KBOA 5AQWA 3R9PA 3KVGA 4JN4A 2QM1A 5EOYA 2CGLA 3WXJA 2H3GX 4BC3A 4FWQA 3ZEUB 2AP1A 4BR2A 1SAZA 3EL2A 1C0FA 3ATVA 2AA4A 3L0QA 4BRNA 1Z6RA 1Z05A 4AM6A 3TPQA 5JMVA 2E20A 4BRCA 3ENHA 4I6MB 4ISEA 4A2AA 3ZETB 4HTLA 2ZGYA 3A5OC 3ZX0A 4J8FA 3MN7A 2CH6A 5AQIA 5F2RA 4PL7A 2Q2RA 2V7YA 2IVPA 4HWIA 3SLCA 1U2VB 2CH5A 2E1YA 5AZJA 4B1YB 2HOEA 1ATSA 1GLAG 2ASOA 4FWRA 4Z94A 3U4LA 1NGGA 3VOVA 3OHRA 3CJCA 4PL8A 2DPNA 1KAXA 2YJFA 2QWPA 3I8BA 4H0YB 1IG8A 2P9UB 4FO0A 2P9LB 4FWNA 4H5WA 1GLFO 4BR0A 3A5LC 4IWVA 4H0PA 2A40A 3HTVA 5AQHA 2P9KB 4IZ9A 2IIRA 3MK6A 1EQYA 3L6QA 4WQ4A 2ZF5O 3CQXA 1QQOA 1XQSC 1P8ZA 4BGBA 1Q18A 1QZ5A 2A5XA 2QWMA 4BRMA 5AQJA 5LJVA 2I7PA 3WEEB 4CZEA 3CJ7A 4CZMA 2CGJA 1NMDA 4CZHA 1RFQA 5ADXH 4K41A 5AQLA 2QWRA 3DXMA 1NGIA 5ELZA 1TUUA 2OANA 1MWKA 3LDOA 3QDKA 5AQNA 5BREA 5AQZA 3ZEUA 4BRPA 4BRHA 4JAXA 1GLLO 3VERA 4H0VB 4E1JA 3TU5A 2GWKA 3M3ZA 3U9ZA 3QICA 3DWLA 1NGDA 4CZKA 1BOTO 1Y64A 1NBWA 4RCHA 3VEWA 4I6MA 3J8AA 1GLCG 3VGKA 4A61A 1X9JA 3ZETA 4QS7A 3GG4A 4CBXA 1ZC6A 2GELA 2A6AA 2ASPA 4BREA 2F9WA 5KPZA 3MDQA 2QWQA 4GY2B 2GEMA 1U2VA 4CZGA 4K25A 1NGBA 4WYBA 3BUZB 3CHWA 5KPTA 3C0BA 5AQFA 1QQNA 2P9UA 2I7NA 2P9LA 4K42A 4AM7A 4FWOA 3ULEA 3A8YA 2KHOA 5BN9A 2YJEA 3QB0A 1X3MA 3CJAA 4BRAA 1HKGA 4BROA 2VYPA 3CETA 4BRIA 2P9KA 1J6ZA 1S3XA 3LDNA 1HKBA 4BC2A 4RWTA 4PKIA 5AQYA 4WQ4C 1SQKA 2Q36A 3H1QA 2YHYA 3WEEA 4RTFD 3DXMB 4FOEA 4XH1A 5JLFA 4XH5A 3GDQA 4IXCA 3VENA 3FZLA 3GE1A 3IUCA 1R59O 5AQRA 3I33A 4BRKA 1E4GT 3SMSA 2E2PA 4FL9A 3WUHA 2W41A 4H5VA 4IO8A 4BGAA 1T6DA 3ID8A 4B1UB 1CZAN 2P9SB 2YCHA 1BU6O 3ATUA 4CZLA 4DHYA 4GNIA 3M1FA 5AQOA 1ESVA 3FGUA 5AZIB 5KQDA 4BR5A 4H5NA 2GWJA 2EWSA 3EKUA 3JS6A 3DAWA 4FWSA 3AAPA 3O5BA 4EIAA 2QWLA 1ATRA 3W0LA 2Q31A 1V4SA 2HMPA 5FPDA 3D7EO 1BA1A 3AARA 4DQ8A 2D0PA 3ULEB 3KHYA 4IJNA 5AQVA 3B8AX 4CBWA 2FF3B 4XEIA 3UE5A 4QS8A 5FPMA 3S41A 1GLBG 3LM2A 3MCPA 4JHDB 2IVNA 3BEXA 1BG3A 4MLEA 2QWOA 1JCFA 1OKJA 4CBUA 5BRDA 5E84A 4BR7A 3QBXA 3H1VX 4BRQA 3WXKA 2E2OA 3FLCO 5AQQA 4BG8A 1GLDG 1SZ2A 3EO3A 1NGCA 2E1ZA 1WUAA 2P9PB 1NM1A 4BRFA 2A42A 2V7ZA 3FE1A 3AY9A 3IFRA 3VEOA 3ZX2A 1KAZA 2PBDA 1DEJA 2NZTA 2YHXA 2FSNA 1BA0A 3O80A 3CI5A 2BTFA 3CIPA 2CGKA 5EVZA 4JD2B 2P9SA 3MMVA 3FZMA 5BRFA 4H0OA 5EY4A 3U9DA 4O5FA 4WQ5A 5BRHA 3UKRB 4IJAA 5B8HA 3KZBA 5AZIA 4EFHA 3A5MC 2D0OA 3DXKB 4CD1A 5I9EB 3LM9A 4L3QA 1BO5O 3QMLA 5AFUH 1YXQA 4FOIA 1G99A 4CZFA 2E8AA 3QFUA 3F9MA 5LJWA 5ADXA 2Q0UA 2Q0RA 3IDHA 1MDUB 1ZBSA 3G25A 2E2NA 4K43A 3CJBA 5AR0A 3H46O 3C7NB 3QFPA 2VCPA 3VPZA 2D4WA 1NGFA 2FF6A 1LOTB 1MWMA 5F1XA 1GLJO 4ISGA 2W40A 4JHDA 4A62A 1WOQA 3D2FB 4XH4A 4O8KA 5AQKA 3HSCA 4H0TB 3WQUA 3R8EA 3D2EB 1GLEG 4M7YA 2UYTA 1X3NA 4YDUA 3SMPA 1NGJA 2FSKA 2ZGZA 3BP8A 4BC4A 3LDPA 1RGIA 3H3OB 4MLHA 1TUYA 4M63C 2P9PA 1K8KA 2FXUA 3VEVA 4FPAA 1V4TA 3HM8A 1NGEA 2YI1A 4BR4A 5AFUA 2ZWHA 1BWFO 3O8MA 3SJHA 5BPMA 1YUWA 3GBTA 3H6EA 5JICA 1KXPA 3U8XA 5E26A 2A3ZA 3FZHA 2QW9A 3W3DA 1MA9B 1T44A 1BDGA 4JD2A 2NLXA 3M6GA 1C0GA 3UKRA 2V52B 4BVOA 2FLOA 4WQ5C 3VEYA 2P9IB 3VF4A 1IJJA 3DXKA 4CZIA 5BPLA 1TYQB 3A5NC 4MO4A 3DJCA 4DB3A 1QQMA 3BF3A
chains in the Genus database with same CATH superfamily
2O8EA 5JVHL 1QHAA 4X62K 2J4RA 2QA4N 4CFAA 3M8RA 2G8UA 5BR9A 3HPOA 1WSIA 5EXWA 3I0SA 2AJQA 1P90A 4H5RA 3HSTB 3P38A 4H03B 4FVUA 3J80O 4HUFA 2NUBA 1HUXA 4CGFA 1LCUA 2BDPA 4BQZA 2YKMA 1NWKA 4B8CA 4L8RB 3CMAN 3FZFA 5GIOA 3D2FA 4M7XA 1BUPA 1S72N 5K14A 3HZ6A 4DQQA 4YDUC 3EE8A 3EN9A 3UKUB 3KTQA 1VQNN 4LC9B 1LAWA 1DT9A 4B9MA 4HVJA 4Y1CA 4BDYA 3VETA 3MX5A 5FPEA 1RT1A 3IAYA 4Z4CA 2UXCK 1NKBA 3CCUN 4W5QA 2BUPA 4KREA 3WT0A 4KB0A 3ZSRA 3MN9A 3VQ8A 1SS6A 4M3RA 4FWMA 3O9SA 4DSFA 4GMJB 2JGUA 4CI6A 4M42A 3CFPA 2X6NA 3KKSA 2B4JA 2EHGA 1NLVA 3HJFA 3KD1E 5JS2A 1HNIA 2VGMA 1XUPO 5AZJB 3WQTA 4BRGA 4E1MA 1NKEA 3ZSYA 4HCCA 3CCMN 4BE0A 5EX5A 2F4VK 5JLHA 3VEXA 2E5LK 2PAVA 3CC7N 3HT3A 4EAHD 3VMFB 4FWLA 4DCHA 1S22A 1VSLA 3WXLA 3KK3A 4I2PA 4JS4A 2NNWA 4GVMA 2P51A 3UKUA 4DSLA 2Z1JA 4FXDA 2HHVA 5AQUA 3V9XA 2VWBA 3R9PA 3TTFA 1S1XA 4DF8A 4JN4A 2H3GX 4FWQA 3ZEUB 3LALA 4K8ZA 3V9WA 1C1BA 3B6OA 2HHWA 2AA4A 3VQAA 2HHIA 3PY8A 2G8HA 4FLTA 1L3TA 5JMVA 2E20A 4BRCA 3C6AA 3TSQA 3ENHA 4ISEA 3ZT2A 3ZSXA 1NK9A 1KLNA 4A2AA 2HHUA 3HK2A 4J8FA 4DTRA 1RTIA 3F73A 3SLCA 2OA8A 3AVHA 3TAEA 1W0HA 4W5RA 5AZJA 4B1YB 1QE1A 2ASOA 3LP0A 4WE1A 3OHRA 3A2FA 1KVCA 4PL8A 5CYQA 2DPNA 2YJFA 4DFJA 1TAQA 1IG8A 3R1XA 3RRGA 2P9LB 4FWNA 2UXDK 3R3LA 3A5LC 4JI5K 1VQON 2D0AA 3OYKA 2C1GA 2B6AA 1U45A 1EWQA 3VQ7A 4C8NA 5KGXA 4IFVA 1WSFA 1YTUA 2ZF5O 1QQOA 1JJ2M 1P8ZA 3SPYA 3B6PA 2IOCA 4CZMA 2CGJA 1RFQA 4C8OA 1BGXT 2HMIA 1TVRA 3ISNC 3DXMA 2WOMA 5ELZA 3J7AP 5AQZA 3ZEUA 4BRPA 1L3UA 4BE7B 4DQIA 5HLFA 1GLLO 3ZSVA 4H0VB 1XMOK 5JS1A 2GWKA 1JLEA 3VA0A 4CZKA 4BE1A 1BOTO 3TAFA 1Y64A 1NBWA 3VEWA 3QNNA 4JI2K 4CJ3A 3NBPA 4QS7A 3GG4A 4IBNA 4CJPA 1W9HA 4AHTA 3OS0A 3MDQA 3HPHA 3F9KA 2A1RA 4K25A 5KPTA 4EP4A 3QINA 2UU9K 1S9GA 4GKJK 3DI6A 3L2VA 2P9LA 3LZIA 4CEFA 4KTZA 4NCBA 3ULEA 5C12A 2KHOA 3LAKA 3QB0A 1T3VA 1UA1A 1IBKK 4BRIA 4FJLA 2GBZA 2Z1IA 2HBKA 4HTUA 1J6ZA 4FK0A 1HNXK 2HNZA 1WBBA 1S9EA 4IOCL 4PKIA 3QEPA 1FJGK 2Q36A 3H1QA 1NK8A 1BCOA 1T8EA 3EEQA 3O4NA 4AQYK 3SQ1A 3TWHA 3U3YA 1KVAA 3S9HA 3GDQA 5AQRA 1VSMA 3O9TA 3LP1A 1TK5A 3SMSA 3WUHA 4BGAA 4CF0A 3ID8A 1CZAN 3NF8A 4J2EA 2P9SB 3JYTA 3K9JA 1VRTA 3TTDA 3TABA 4GNIA 1BIUA 3QETA 3O3GA 4OLBA 2O8DB 1YVUA 1KLMA 3V1RA 3MEDA 4PY5A 1EXQA 3EKUA 4FWSA 2ZJPL 2VWJA 3W0LA 2Q31A 3TSPA 2X6SA 4CESA 2A1SA 4LD0A 1RT3A 4YOYA 4DQ8A 1NJWA 3OYHA 3B8AX 4C8KA 5J2PA 4QS8A 2P5GA 5C2FA 4MLEA 5BRDA 3ZLJA 2JLEA 4CERA 4KB1A 5AQQA 3OYJA 4KHSA 1C6VA 4DLGA 1NGCA 1Q86O 2P9PB 4DTUA 2O8FB 3IS9A 1ZBHA 2A42A 4DFMA 1BCMA 3ZYYX 1KAZA 4OKKA 2NZTA 4KH6A 5MLCQ 1EKEA 3ALYA 1BI4A 4CW7B 3FFIA 3CI5A 3I8DA 1OVQA 2P9SA 3FZMA 1BQNA 1U49A 5BRFA 3SI6A 4O5FA 2NRZA 4WQ5A 5BRHA 4WFBL 3VQ9A 3QEVA 1EX4A 2O8DA 1RTHA 1S1VA 2XY6A 3A5MC 3RMBA 3LM9A 5AFUH 4L3QA 4MQ3A 4CZFA 1NU0A 3CCQN 1NK5A 1J5EK 3OS1A 3F9MA 2OPRA 4B3OA 4GVEA 4DU3A 1CZ9A 1NK6A 1MDUB 3G4SN 1VRUA 3L8BA 4JKEA 3SUNA 1FKPA 4YOTA 5M1PA 2FF6A 4KHWA 3OYBA 2D0CA 5F1XA 1GLJO 1TKTA 3KWGA 3HOTA 3DRRA 3HSCA 3NE6A 3OY9A 3THWB 3IG1A 4FJIA 4DWIA 4PHTX 4YOUA 3V1OA 3Q7CA 3NF6A 4C8LA 3MXIA 2P9PA 1K8KA 2FXUA 4ZHRA 2O8FA 2GV9A 1RBUA 4M3ZA 1EP4A 2E6LA 2FBTA 4JI8K 4KHYA 4E72A 3W3DA 1KRPA 1T44A 2PFUA 1JLGA 3L3VA 3M6GA 4BVOA 3DLKA 4WQ5C 1B9DA 3M8PA 4DR2K 3A5NC 4MO4A 1WSGA 1J53A 3DJCA 3KVGA 5CR4A 3DRPA 1QQMA 1VHXA 2RN2A 2XHBA 1HQEA 3CM5A 4IG3A 4PKGA 4B3RK 2QEXN 4DFKA 3K5MA 3VQDA 3VEZA 3CJ1A 1QTMA 4B1XB 4FZXC 1WB9A 1KAYA 4BG9A 3OS2A 4BRLA 1IKYA 1RDBA 2P9NB 4IOXA 1YVNA 1YHQN 5AQTA 1HNVA 1S6QA 3FR0A 3ZT3A 4CGDA 3ZSWA 4FLYA 1XMQK 3VF2A 3L2RA 1IKWA 4IDKA 5FDLA 3THWA 3M8SA 4FJ5A 3VTIA 4QS9A 4BRDA 4CF8A 3DM2A 2OYQA 5E41A 5KPRA 1HX1A 5BN8A 3HP9A 2GUPA 4ELTA 4YFUA 3VQCA 2QTDA 1CXQA 2ITMA 4YY3K 3QBWA 3MEEA 3AAQA 5AQPA 1HPMA 3O4WA 3S5TA 3TI0A 2NRTA 3E66A 5AQMA 3JXUA 3AVJA 1VQ7N 2D5RA 5C15A 3AA2A 4B1WB 3DLBA 1E4FT 4G1QA 1K9MO 4EZ6A 4OO1J 3CPEA 1D4XA 2W42A 4CJ7A 3KJVA 4CZJA 4CGHA 3CQYA 2XY7A 4JNEA 4CJFA 4KHQA 1NJIO 3LAMA 1I94K 2G8WA 4CE9A 4OKJA 3OBYA 2P9NA 1XWLA 4DV2K 1UA0A 4NCAA 1O13A 1RILA 1TKZA 5EU7A 3VF6A 1N34K 3QNOA 2Q97A 1J9AA 2HW3A 5M1FA 3LL3A 1NGAA 3PO5A 4A59A 1T6CA 4FPBA 4DMNA 4Z4HA 1H1VA 1RDWX 1TK8A 4KHPK 4KHNA 1LWEA 3UB5A 4B1ZA 4H0XB 4FJ7A 3O08A 3RMCA 4F2SA 2EX3A 3L3UA 1FW6A 1IO2A 5EOYA 2CGLA 1T05A 1SAZA 3L0QA 4BRNA 1Z6RA 2YNIA 1KFSA 1Z05A 4AM6A 4E0DA 4XJXA 3JAMO 5J2NA 1CXUA 4C1NI 3PX4A 4I6MB 3CMEN 1LW2A 4HTLA 3A5OC 3ZX0A 3MN7A 3E01A 3T19A 5GAHP 2V7YA 4H8KA 4DV7K 3PIPL 4HWIA 4FM0A 1U2VB 1RBTA 3BGRA 2E1YA 3VQBA 4CGJA 4CIGA 4OJRA 2HOEA 4U67L 3NGZA 4Z94A 3VOVA 1YTAA 4LF8K 1KAXA 4H0YB 4ID1A 2QWPA 3I8BA 1YF5L 4DUYK 2P9UB 2LSNA 4FO0A 2OZMA 3RRHA 2UUAK 2HNDA 2NRXA 3O3FA 2A40A 1JLAA 5TKWA 4ZTJA 1ASVA 1HYVA 4QCLA 3HTVA 2HHSA 1NJXA 2IIRA 3P83D 3OTOK 1X1PA 1QHTA 5I42A 2KTQA 2UUBK 4N5SA 4CFBA 1B92A 2VG7A 3SBGA 4YHHK 5JENA 4CZEA 3CJ7A 4CZHA 1XHZA 1NMDA 3SQ2A 3SAFA 5ADXH 3C94A 1HNZK 5DM7L 1RT5A 2ZD1A 3HPGA 4K41A 4PQUA 5AQLA 1HJRA 1VQ8N 1NGIA 4YORA 4OPHA 4AHSA 4CEAA 2OANA 4JRPA 3NGIA 1M1KO 2E4LA 4BRHA 4JRQA 3TU5A 3U9ZA 3QICA 1EWRA 1NGDA 2ATQA 4FLXA 2UUCK 3PSIA 4Z4IA 1CLQA 4JI6K 4I6MA 4KAZA 3OYCA 5HOOA 2ASPA 4OPJA 1TKDA 4BREA 3NH1A 4E7JA 1U2VA 4X64K 3T1HK 3SYZA 3AVFA 4WYBA 4FLWA 4CCHA 2KQ2A 3VA3A 3ZT0A 3DYAA 4TSXA 4CIEA 1WAFA 3DRSA 2P9UA 2I7NA 4K42A 4N76A 1ZBIA 4AM7A 3A8YA 1QS4A 4BE2A 2YHBA 3CJAA 2XY8A 2VG6A 2VYPA 1VSHA 2ZJRL 3AVIA 3HOSA 4IEEA 3ZSOA 4CVNE 4OGEA 3VQEA 3LDNA 1SQKA 1ASUA 3SQ0A 2YHYA 3VQQA 3DLGA 3DXMB 4CJ5A 3AVCA 4FOEA 4QOZB 1Y97A 1VSDA 2BH1A 4XH1A 3C6TA 3AA3A 3J81O 4IFEA 4IXCA 4M3YA 4OLAA 3GE1A 3IUCA 1R59O 1EETA 2E2PA 4EZ9A 4H5VA 4FZYA 1VSKA 3J7YP 1BU6O 4BEBA 1VQKN 2O4GA 3V4IA 4LY7A 4KKOA 5AZIB 3K57A 2O8BA 4H5NA 2GWJA 3UIQA 4KTWA 4EIAA 5FPDA 1V4SA 1RTDA 5FROA 3D7EO 4W5TA 1NJYA 4PA1A 3AARA 4CHZA 1N32K 4JV5K 4DSIA 3ULEB 3MCAB 3O9RA 4RW4A 1Q9XA 2BE2A 4I9LA 3IKMA 2FBYA 4JI7K 3WNFA 1GLBG 2R7YA 4JHDB 3N4QA 3BEXA 2KFZA 1BG3A 4E7KA 4B9SA 3P39A 3AVKA 5KRTA 3QBXA 1NK4A 3WXKA 3K5OA 5C10A 1SKRA 3AGKA 4DSKA 2WBNA 4BRFA 1GOBA 2G8FA 1U04A 1LAVA 4DV4K 3HVTA 1NNEA 4FZZA 2RHKA 4NXNK 3VN5A 3SJJA 2YHXA 2X74A 3LWMA 1OVYA 3G71N 3CIPA 1W97L 3SQ4A 4NYNA 2CGKA 2YNGA 4JD2B 3MMVA 5EVZA 3MXMA 4M3XA 4PWDA 4H0OA 4CJRA 3U9DA 5J1EA 4NXMK 3ZCMA 4J2DA 2ETJA 3KZBA 5AZIA 4RW7A 1CZBA 1BO5O 2RKIA 3QMLA 4FOIA 5C25A 3OYNA 1VSIA 1RBSA 2Q0UA 4F3TA 1Z25A 5AR0A 2OPSA 4B3MK 4OX9K 3H46O 5FLXO 3C7NB 3QFPA 4CJUA 1JLBA 2UXBK 1RBRA 3L2QA 2W40A 4ICLA 4JHDA 3O3HA 1DLOA 1X9SA 4CHNA 1WOQA 4IOAL 1VQMN 2KW4A 4XH4A 2HNYA 4BWMA 3WQUA 2OTLN 4DSJA 1IV0A 4ZTFA 1JKHA 2W00A 1RDAA 1NGJA 2FSKA 3BP8A 4BC4A 1RGIA 1QSYA 1S1TA 4JI1K 3VEVA 1YJ9N 1DTTA 1V4TA 3NH0A 2YI1A 5AFUA 2ZWHA 1IH7A 3AO3A 4MFBA 1L5UA 4Z4EA 1BI4B 3AO2A 1FXXA 1J5OA 5BPMA 1N5YA 5DMRA 4RW9A 2A3ZA 1JLQA 4KI6A 5KTQA 3NAEA 4N41A 1ILYA 4JD2A 1K8AO 5HL7L 3AO1A 1K6YA 1X9WA 1NKCA 3AVGA 1IKVA 3VEYA 4F8RA 3VF4A 5BPLA 1TYQB 3S3OA 4DQSA 4O0JA 4CGGA 4DB3A 5LMUK 1E3MA 1HJOA 1W2BM 1ASWA 1UWBA 3GL1A 4Y0WA 5M1QA 2HVHA 2I5JA 4BR9A 3ZT1A 1QSSA 3MN5A 2KZZA 4OPKA 4A2BA 3C65A 4IEIA 3TANA 3ZT4A 4LH5A 2HHQA 2RE2A 4FSVA 3C7NA 5AQGA 3ZSQA 5CE3A 2A41A 2QKKA 3NGYA 4FJ9A 4RW6A 4Z4GA 2FSJA 1NOZA 1SUQA 2Q1NA 2C1IA 3CCEN 5HBMA 4BWJA 3HBTA 4FK4A 2BGGA 3MECA 3KLHA 3V81A 1K8KB 3LPTA 1XC3A 2B5JA 1HLUA 3E9LA 4B9QA 1OH5A 1HKCA 4X66K 3THVA 1VSFA 3CYMA 4CJWA 2KZMA 2HF4A 3VGMA 1JCEA 3KK2A 3SUQA 3VGLA 4PKHA 1D9DA 4M45A 5I3UA 4RW8A 1ATNA 2IDOA 1ZBFA 3AA5X 3KLIA 4Y1DA 3MXJA 2WFBA 2WUSA 5CZ1A 3WXIA 4CD3A 4Q5VA 3I56N 3CC2N 3CERA 1XHXA 4CHPA 4CHQA 3MEGA 3P4IA 5LY3A 2KLAA 5TKYA 2X78A 3AVNA 3HI0A 1YAGA 3RR8A 4BECA 1C1CA 1TGOA 3V9ZA 1TYQA 2Q3SA 5AQSA 3DOLA 3K5LA 1DTQA 5LMNK 1XNQK 3EZWA 4FWPA 2FBXA 2HF3A 2QWNA 2OCEA 2Y1JA 2NRRA 4FJGA 3DOKA 3QEIA 5C24A 4QAGA 1NOYA 1IBMK 4UQGA 3CD6N 2YKNA 1FK9A 3A0IX 1QZ6A 2KFNA 1NK7A 2NRWA 3OW2M 3FFKB 3M8QA 4ISFA 1IG9A 1U6ZA 4FJNA 5BPNA 2QXLA 4C23A 2ASMA 5AJ3K 3H3NO 2GTDA 1B9FA 2E88A 4O4GA 5F0XA 4DG1A 4HUEA 4JLHA 3OJUA 4JKAA 4BVPA 1DGKN 1DKGD 4NB4A 4DQPA 3O1BA 1JL2A 4KBOA 4FCYA 5A2QO 4WCEL 1D5AA 3NMUA 4BC3A 4CEOA 2AP1A 3ID6A 1O1WA 3KD5E 3EL2A 3ATVA 3PUFA 3TPQA 1Q8IA 3NVMA 1WSJA 3D0PA 1L3SA 3ZETB 2QKBA 2CH6A 3EE9A 2VQFK 5F2RA 4CEZA 2Q2RA 4PL7A 5DM6L 3TARA 2CH5A 1GLAG 1KFDA 1NGGA 4CEQA 2O4IA 3QLHA 1HNWK 4FJHA 1C0TA 1RT6A 1NK0A 4BR0A 4IWVA 4V19S 3OJSA 4FW1A 3CCLN 4FM2A 1U4BA 3DMJA 2G8KA 2P9KB 4DV5K 4W5OA 3V1QA 4HUGA 3MK6A 3HL8A 3L6QA 3NF9A 4YOVA 4WQ4A 4LF5K 5CZ2A 3CQXA 4CJKA 2HBLA 1Q18A 2QWMA 2A5XA 5M1NA 5LJVA 2I7PA 3WEEB 4I2QA 4CF2A 2IAJA 3CXCM 4JS5A 3NCIA 1KQSM 4CFCA 4FYDA 3L4QA 4M3WA 2QWRA 3ENBA 3S3NA 4OPAA 1TUUA 1MWKA 5BREA 3QDKA 5AQNA 3ZSZA 4N47A 3VERA 2IGIA 2Z1HA 1RDUA 4OKEA 3KLEA 4DTPA 2HVIA 3J8AA 3VGKA 4A61A 4FW2A 3OYEA 1QVGM 4DR7K 3ZETA 1YJNN 1ZC6A 1YT3A 3QEWA 3SBTA 5C0YA 4DR3K 1S1UA 4GY2B 2GEMA 3LP2A 4CZGA 4IO9L 2WC9A 2VWKA 1RDCA 1IKXA 3C0BA 5AQFA 4FJ8A 4B3SK 1A5WA 1QQNA 4LSNA 4CEBA 3PIOL 4E7LA 3HO1A 2YHAA 2YJEA 3QO9A 1BISA 5D3GA 1HKGA 4ILHA 4BROA 1RT7A 2P9KA 3ITHA 2F8TA 2PZSA 4NYFA 1NG9A 4BDZA 1S3XA 4B3TK 4RWTA 4DTOA 4WQ4C 3WEEA 4DTMA 4RTFD 4GV3A 3OBWA 1UOCA 4DR6K 4WF9L 4DR5K 3VENA 3FZLA 3N4PA 4FL9A 3M5RA 1T6DA 3F2KA 2YCHA 3ATUA 3BZCA 4AHVA 5HP1A 5AQOA 4FJXA 3K2PA 3SAHA 3OYGA 1ESVA 5KQDA 4ILGB 4C8MA 4F2RA 2BANA 2EWSA 3JS6A 4DSEA 3DAWA 4JKCA 3O5BA 3L2WA 1TL1A 2QWLA 1ATRA 4U7BA 3C95A 1JLCA 3PO4A 2PYJA 1BA1A 3P1GA 1A5XA 1S1WA 2D0PA 4KRFA 4G9ZA 3KHYA 4IJNA 1GOAA 4CBWA 1T7PA 1TAUA 2FF3B 3UE5A 5FPMA 3NHGA 3LANA 2IVNA 1NJZA 1JCFA 1SKSA 4Z0UA 5HROA 3G6EN 3RMAA 4BR7A 3QIOA 3OYFA 3K0SA 2E2OA 4BG8A 5SZTA 4DU4A 2OZSA 2HHXA 1SZ2A 3CM6A 3EO3A 4CHOA 1GOCA 1Z26A 3VQ6A 4J2BA 4UY8O 3FE1A 3AY9A 3IFRA 3VEOA 1R0AA 3ZX2A 3E1YA 3K5NA 4DV0K 2PBDA 1VQPN 2OPQA 2FSNA 1LW0A 2BTFA 2O8BB 3PLAA 3AVMA 1ZYQA 1D9FA 1OH8A 4JKBA 3DLRA 3AA4A 4DTJA 4IJAA 3KKRA 5B8HA 4FM1A 1W7AA 4CD1A 1HPZA 2F8SA 5I9EB 1RNHA 1KVBA 1WAJA 4IDHA 3S3MA 3G0ZA 3OYMA 1TV6A 4NLBA 3SUPA 1L3VA 2HHHK 3QERA 4CIFA 1VAZA 1VQ9N 1KSPA 2E8AA 3QFUA 4IG0A 3T1YK 1WSEA 5LJWA 1ZBLA 1WLJA 3G25A 2E2NA 3I55N 4W5NA 1SL0A 3SPZA 2VCPA 1LWFA 3PX6A 2D4WA 1NGFA 2QI2A 1LOTB 4ILJA 1Q81O 4O44A 5HRRA 1OH6A 3VTHA 1XI1A 3CFOA 3I0RA 4O8KA 3LWLA 4H0TB 3H08A 4LF7K 3D2EB 1GLEG 4JK7A 2UYTA 1HRHA 1X3NA 4LFAK 3SMPA 2ZGZA 4CK3A 3ULDA 3LDPA 3DLLL 3H3OB 3MWTA 3U6FA 1TUYA 4M63C 5GAGP 1RCHA 4FPAA 3AO4A 3HM8A 1NGEA 2GX9A 3WNEA 5T7BA 4BR4A 4H4OA 1SKWA 3WNGA 5CHIA 3BY5A 5SWMA 4O55A 4OVLA 1BWFO 1YUWA 3H6EA 1KXPA 2E6MA 3VQ4A 3QIPA 5E26A 1LV5A 2YV0X 4DS5A 3TAGA 1D8YA 5JVGL 2NLXA 1C0GA 3RR7A 2FLOA 3CQ8A 2P9IB 4CZIA 1KD1O 4YOWA 4A5AA 3PSFA 3U3GA 2VGNA 3THYB 3BF3A 4OGCA 1BHLA 5LL6Z 3RSEB 4GW6A 4EHTA 3TAMA 2HB5A 3CPWM 3IMXA 3NF7A 3T1AA 5KQ8A 4KI4A 2YX6A 3CJ9A 1OH7A 2NRHA 2E2QA 4H5TA 4M3UA 4CJSA 1Q9YA 4LF9K 2V51B 4GV6A 4R79A 1QQCA 2O8CB 3HM9A 3ZX3A 4B8AB 5AQXA 1JCGA 4O0IA 1ZXOA 3HP6A 4IFYA 2D1KA 4K8XA 4O8UA 3TTCA 2VG5A 4HCBA 2OPPA 4E89A 3FZKA 1N8RO 2ZE2A 3D2EA 5KGWA 5DK5A 4BQLA 4EHUA 3H45C 3OA9A 5HRNA 4BC5A 4LH4A 3GOIA 4YNQA 4DFPA 3R6MA 4DTNA 4DTXA 4ELVA 3L2UA 3LPUA 4DR1K 3PX0A 5GAEP 4JK9A 3SV3A 1EO1A 1S5JA 4DKWA 4XIUA 4F9OA 1MU2A 2F9TA 1S6PA 4B9NA 5GIPA 4NO7A 4FLZA 3NVKA 3O6WA 2JWKA 4I7FA 2G8IA 1SL2A 4B9VA 4CJQA 1NGHA 3OVNA 2P9IA 4YOXA 1XNRK 4JKGB 1VQ4N 4B1VA 1SL1A 4FK2A 5C42A 3THYA 4DV1K 2IVOA 1BL3A 5HRSA 5GINA 4CGIA 1C1AA 3RSEA 4JYAK 2ITGA 1A5VA 3L4IA 2QXFA 2HBJA 4E19A 3BDPA 5FPNA 3HXMA 3ENOA 3VESA 3SK3A 2YHWA 2W6KA 1RT2A 4AILC 1WN7A 2O8CA 4CFDA 4FWKA 4DU1A 1UAXA 2WTUA 3CFRA 3EKSA 2PY5A 4Z4FA 3Q7BA 4KV8A 5KRSA 1KTQA 3BF1A 1KC8O 3OYIA 3LDLA 1Q7YO 3V6DA 1IBLK 3JSMA 4CJ4A 2DFFA 4CK2A 2D0BA 4CHYA 4MO5A 3OYLA 4Q0BA 3MN6A 3SCXA 3O1WA 4B9LA 4KTQA 3LDQA 2ZJQL 2NRVA 3T7ZA 5AQWA 1QVFM 3SV4A 2QM1A 3WXJA 4I9QA 5J2MA 4EP5A 1YI2N 3HVRA 4BR2A 4CJEA 2F96A 1HR0K 4CF9A 1C0FA 3IRXA 4F4KA 3K9KA 1VQLN 5J2QA 3AV9A 3RVCA 3LZJA 3KWIA 4ID5A 1U47A 4CK1A 5BR8K 2ZGYA 3C6HA 4JKGA 3G10A 3KK7A 1VSEA 4ELUA 3V9SA 5AQIA 3K58A 2RF2A 2IVPA 2XY5A 5FRNA 2F7TA 4AH9A 1ATSA 4FWRA 3U4LA 4CJVA 3CJCA 4CJTA 4KO0A 3OYDA 4GKKK 4B9TA 1VK0A 3NDKA 4H5WA 1GLFO 2DFHA 3RMDA 1YJWN 4KFBA 4H0PA 2Y1IA 5AQHA 3AO5A 3OYAA 3TAPA 4IZ9A 2OTJN 3D45A 2DFEA 1LWCA 3MWPA 1EQYA 2FBVA 4KH5A 1XQSC 4BGBA 4BRMA 1WSHA 1QZ5A 5AQJA 3HRGA 4IKFA 3O9QA 3O4QA 3T69A 4DLEA 3NFAA 1JXBA 4LFCK 1JLFA 1WBDA 1N6QA 3KLFA 5M1KA 4X65K 2PYLA 3LDOA 4AHCA 4NLCA 3EYZA 4JAXA 1RBVA 4E1JA 3M3ZA 4PUOA 3DWLA 3WXMB 4AHUA 1N36K 2YNHA 4RCHA 1GLCG 1X9JA 4CBXA 2GELA 2A6AA 2F9WA 2HSTA 5KPZA 2QWQA 1U48A 2IS3A 3SAGA 1NGBA 3BUZB 3CHWA 3THXB 4RG8A 4DUZK 2ZQBA 5HRPA 1C0UA 4LF6K 2DTUA 4DF4A 1ZBUA 3KK1A 4CF1A 4BDPA 3P5JA 4LFBK 4JI3K 4FWOA 5BN9A 2DY4A 4NCGA 1WNSA 1X3MA 4BRAA 3CETA 3TSUA 4DR4K 1VSJA 1I3AA 3BZKA 1HKBA 4AF1A 4BC2A 5AQYA 3P31A 3EZ5A 2WONA 5JLFA 2KKZA 3DLHA 4FJMA 4CEDA 4F3OA 2G8VA 4XH5A 3CYGA 1TL3A 3I33A 4BRKA 2XRIA 1E4GT 3WNHA 5H1SQ 3EY1A 1Q82O 4B9UA 1ITGA 4B08A 2W41A 4IO8A 4B1UB 1NMNA 4CZLA 4DHYA 4E3SA 4JI4K 3LP3A 4E7HA 3M1FA 3J7ZO 3FGUA 4A57A 4M41A 4BR5A 4J2AA 5CYMA 3RTVA 4FVMA 1REVA 1F21A 2VQEK 3K59A 3CCRN 4E1NA 3AAPA 3AVLA 1TKXA 2HMPA 1HYSA 3AGRA 1M90O 2HHTA 3THXA 4GV9A 4JEPA 4DTSA 4MDAA 5IWAK 5AQVA 1RT4A 3O9UA 4XEIA 4FJJA 4C1NK 3S41A 3VQPA 4CECA 4R5PA 4N56A 2ZM6K 3LM2A 1K73O 1JL1A 2JWLA 3MCPA 4LSLA 1HYZA 1J54A 2QWOA 1OKJA 4CBUA 3LDSA 5E84A 3H1VX 4BRQA 3FLCO 3T3FA 1GLDG 3KIOA 1G15A 2E1ZA 3KLGA 3CF5L 4AHRA 3SUOA 1WUAA 1BQMA 1NM1A 2YNFA 4WFAL 1YIJN 4JK8A 2HBMA 2V7ZA 3AVAA 1JXEA 3C6UA 4FJKA 1XC9A 4BACA 4K0KK 1DEJA 1KCFA 4DV3K 1BA0A 3O80A 1TK0A 4FLUA 1VQ5N 5KI6A 4M3TA 4CEEA 4DQRA 5EY4A 3MAQA 3TAQA 3E9OA 3CG7A 3UKRB 1N33K 4BY9C 4KPYA 3QESA 4EFHA 2QK9A 2D0OA 3DXKB 3ASMA 4DV6K 2Z1GA 1YXQA 4JKHA 1G99A 2IC3A 3NH2A 2O8EB 3QEXA 4JKDA 1X9MA 2P5OA 3SNNA 4O5BA 5ADXA 2Q0RA 3IDHA 3E9PA 1ZBSA 4K43A 3CJBA 1VQ6N 3D6RA 3F5TA 3CCJN 3VPZA 4HHTA 1FKOA 2W6LA 3TR8A 2XO7A 1BIZA 3HYFA 1MWMA 2P1JA 4ISGA 4KHUA 3CCSN 1YITN 4A62A 4WFNL 3D2FB 5AQKA 3VQ5A 3R8EA 4M7YA 4JI0K 4YDUA 4MDBA 3SZ2A 1HQUA 1QSLA 5FRMA 4MLHA 3V9UA 3RWUA 3MX2A 3AVBA 3CCVN 1C0MA 5CY4A 3DLEA 5GADP 2GUIA 1I39A 1SV5A 3O8MA 3SJHA 3GBTA 3PV8A 2RPIA 1RDDA 3U8XA 4A5BA 5JICA 3FZHA 4CJLA 1HMVA 2QW9A 3CC4N 4E7IA 5C2DA 2FC0A 4JKFA 4KH4A 1MA9B 1BDGA 4H4MA 3UKRA 2V52B 1RTJA 4LF4K 1T03A 4FLVA 4DS4A 1IJJA 3DXKA 5IT9O 5M1OA
chains in the Genus database with same CATH topology
1HJOA 5JVHL 1W2BM 1QHAA 3RSEB 3GL1A 4Y0WA 5M1QA 4EHTA 4BR9A 2J4RA 4PKGA 2QA4N 3MN5A 2QEXN 3CPWM 3IMXA 5BR9A 5EXWA 5KQ8A 2YX6A 3CJ9A 3VEZA 3CJ1A 4B1XB 2NRHA 4A2BA 3C65A 1KAYA 2E2QA 4IEIA 4H5TA 4BG9A 4BRLA 2RE2A 1P90A 2V51B 3C7NA 4FSVA 4H5RA 2P9NB 5AQGA 4R79A 5CE3A 4GV6A 2A41A 3P38A 4H03B 4IOXA 3ZX3A 4FVUA 5AQXA 1YVNA 1HUXA 5AQTA 1YHQN 1LCUA 1JCGA 2FSJA 1ZXOA 4BQZA 1NWKA 2Q1NA 2C1IA 3FR0A 2D1KA 3CCEN 4O8UA 3HBTA 3CMAN 3FZFA 3TTCA 5GIOA 3D2FA 4M7XA 1BUPA 3VF2A 1N8RO 3FZKA 1S72N 3D2EA 1K8KB 3HZ6A 4BQLA 4EHUA 3H45C 1XC3A 3OA9A 1HLUA 3E9LA 3VTIA 4BC5A 1HKCA 3GOIA 4B9QA 4QS9A 4BRDA 4YDUC 2HF4A 3EE8A 3EN9A 3UKUB 3VGMA 3R6MA 5KPRA 1JCEA 1VQNN 1HX1A 4LC9B 3VGLA 4PKHA 5BN8A 1DT9A 1ATNA 2GUPA 5GAEP 4JK9A 1EO1A 4DKWA 2QTDA 3VETA 2WFBA 2WUSA 3WXIA 3MX5A 5FPEA 4F9OA 2F9TA 2ITMA 4CD3A 5GIPA 3QBWA 3AAQA 4NO7A 3I56N 3CERA 3CCUN 3CC2N 5AQPA 1HPMA 3P4IA 3O4WA 3NVKA 2BUPA 3O6WA 2JWKA 5LY3A 2KLAA 5TKYA 2NRTA 3WT0A 3HI0A 1YAGA 3MN9A 3E66A 1SS6A 4BECA 4FWMA 3O9SA 1NGHA 5AQMA 2P9IA 3JXUA 4YOXA 4CI6A 1VQ7N 4JKGB 1TYQA 1VQ4N 4B1VA 5AQSA 5C15A 4B1WB 1NLVA 2IVOA 1E4FT 3EZWA 5GINA 1K9MO 3RSEA 3CPEA 1D4XA 4FWPA 2VGMA 2QWNA 2HF3A 1XUPO 5AZJB 3WQTA 4BRGA 4CJ7A 2NRRA 3L4IA 4CZJA 3CCMN 3CQYA 2HBJA 5EX5A 4JNEA 5JLHA 1NJIO 5FPNA 3ENOA 3VESA 3SK3A 3VEXA 2YHWA 2PAVA 3OBYA 2P9NA 3CD6N 3CC7N 4FWKA 1O13A 3A0IX 1QZ6A 2NRWA 4EAHD 3FFKB 4ISFA 4FWLA 3VF6A 3VMFB 3EKSA 3G4SN 4DCHA 1U6ZA 1S22A 2Q97A 3Q7BA 3WXLA 5BPNA 2QXLA 4C23A 5M1FA 2ASMA 3LL3A 1NGAA 3BF1A 3H3NO 2GTDA 1KC8O 3LDLA 4A59A 1Q7YO 2E88A 5F0XA 2NNWA 1T6CA 4FPBA 1H1VA 1RDWX 4MO5A 4JKAA 3UKUA 4BVPA 3MN6A 3UB5A 3O1WA 4B1ZA 5AQUA 1DGKN 1DKGD 3LDQA 4NB4A 2ZJQL 2NRVA 3T7ZA 4H0XB 2VWBA 3O1BA 3O08A 4KBOA 5AQWA 3R9PA 3TTFA 1QQMA 3KVGA 1QVFM 4WCEL 4JN4A 2QM1A 5EOYA 2CGLA 3WXJA 2H3GX 3NMUA 4BC3A 1YI2N 4FWQA 3ZEUB 2AP1A 3ID6A 4BR2A 1SAZA 3EL2A 1C0FA 3ATVA 2AA4A 3L0QA 4BRNA 1Z6RA 1Z05A 3K9KA 1VQLN 4AM6A 3TPQA 5JMVA 2E20A 3RVCA 4BRCA 3C6AA 4XJXA 3KWIA 3TSQA 4C1NI 3ENHA 3NVMA 4I6MB 4ISEA 3CMEN 4A2AA 3ZETB 4HTLA 2ZGYA 3A5OC 3C6HA 4JKGA 3KK7A 3MN7A 4J8FA 3ZX0A 2CH6A 3EE9A 5AQIA 5F2RA 5GAHP 4PL7A 2Q2RA 2V7YA 2IVPA 3PIPL 4HWIA 3SLCA 1U2VB 5DM6L 2CH5A 2F7TA 2E1YA 4U67L 4B1YB 5AZJA 2HOEA 1ATSA 1GLAG 2ASOA 4FWRA 4Z94A 3U4LA 1NGGA 3VOVA 3OHRA 3CJCA 4PL8A 2DPNA 1KAXA 2YJFA 2QWPA 3I8BA 4H0YB 1YF5L 1IG8A 2P9UB 4FO0A 3R1XA 2P9LB 4FWNA 4H5WA 1GLFO 4BR0A 3R3LA 1YJWN 3A5LC 4IWVA 2NRXA 4H0PA 3CCLN 2A40A 5TKWA 1VQON 3HTVA 5AQHA 2C1GA 2P9KB 4IZ9A 5CR4A 2IIRA 2OTJN 3MK6A 3MWPA 5M1NA 1EQYA 4OO1J 3L6QA 4YOVA 4WQ4A 2ZF5O 4KH5A 3CQXA 1QQOA 1XQSC 1P8ZA 2HBLA 1Q18A 1QZ5A 2A5XA 2QWMA 4BGBA 5AQJA 4BRMA 3SBGA 2I7PA 3HRGA 3WEEB 5LJVA 4CZEA 3CJ7A 4CZMA 2CGJA 1NMDA 4CZHA 3CXCM 1RFQA 3SAFA 3O9QA 5ADXH 3T69A 1KQSM 5DM7L 4K41A 3L4QA 5AQLA 1VQ8N 5M1KA 2QWRA 3DXMA 1NGIA 3ENBA 4OPAA 4OPHA 1TUUA 2OANA 4YORA 5ELZA 1MWKA 3LDOA 3QDKA 5AQNA 5BREA 5AQZA 1M1KO 4NLCA 3ZEUA 4BRPA 4BE7B 4BRHA 4JAXA 1GLLO 3VERA 4H0VB 1JJ2M 4E1JA 3TU5A 2GWKA 3M3ZA 3U9ZA 3QICA 3DWLA 3WXMB 1NGDA 4CZKA 1RDUA 1BOTO 1Y64A 1NBWA 4RCHA 3VEWA 4I6MA 3J8AA 1GLCG 3VGKA 4A61A 1QVGM 1X9JA 3ZETA 4QS7A 3GG4A 5HOOA 1YJNN 4CBXA 1ZC6A 2GELA 2A6AA 2ASPA 3SBTA 4BREA 2F9WA 2HSTA 5KPZA 5C0YA 3MDQA 2QWQA 4GY2B 2GEMA 1U2VA 4CZGA 4IO9L 3SAGA 4K25A 2WC9A 1NGBA 4WYBA 3BUZB 3CHWA 5KPTA 3C0BA 5AQFA 1QQNA 2P9UA 2I7NA 2P9LA 3PIOL 4K42A 4AM7A 4FWOA 3ULEA 3A8YA 5C12A 2KHOA 5BN9A 2YJEA 3QB0A 1X3MA 1T3VA 3CJAA 1HKGA 4ILHA 2VYPA 3CETA 4BROA 4BRAA 4BRIA 2ZJRL 3HOSA 4IEEA 2P9KA 2HBKA 3TSUA 1J6ZA 1S3XA 1VQ6N 3LDNA 1HKBA 4AF1A 4BC2A 4PKIA 4RWTA 4IOCL 5AQYA 4WQ4C 1SQKA 2Q36A 3H1QA 2YHYA 3WEEA 4RTFD 3DXMB 4GV3A 3P31A 4FOEA 3OBWA 2BH1A 4XH1A 5JLFA 2KKZA 4WF9L 4IFEA 4XH5A 3GDQA 4IXCA 3VENA 3FZLA 3GE1A 3IUCA 1R59O 3O9TA 5AQRA 3I33A 3N4PA 4BRKA 1E4GT 1Q82O 3SMSA 5H1SQ 2E2PA 4FL9A 3WUHA 3M5RA 2W41A 4H5VA 4IO8A 4BGAA 1T6DA 3ID8A 4B1UB 1CZAN 3F2KA 2P9SB 2YCHA 1BU6O 3ATUA 3K9JA 4CZLA 4DHYA 3TTDA 4BEBA 4GNIA 3M1FA 5AQOA 1VQKN 3SAHA 3J7ZO 1ESVA 3FGUA 4A57A 5AZIB 5KQDA 4BR5A 4ILGB 4H5NA 2GWJA 3CCRN 2EWSA 3EKUA 3JS6A 3DAWA 4FWSA 2ZJPL 4JKCA 3AAPA 3O5BA 4EIAA 2QWLA 1ATRA 3W0LA 2Q31A 1V4SA 2HMPA 3TSPA 5FPDA 4U7BA 3AGRA 1M90O 3D7EO 4GV9A 4JEPA 1BA1A 3AARA 4YOYA 4DQ8A 2D0PA 4MDAA 3ULEB 4G9ZA 3KHYA 3MCAB 3O9RA 4IJNA 5AQVA 3IKMA 3B8AX 3O9UA 4CBWA 2FF3B 4XEIA 3UE5A 4QS8A 5FPMA 4C1NK 3S41A 1GLBG 1K73O 5C2FA 3LM2A 2JWLA 3MCPA 3N4QA 2IVNA 3BEXA 1BG3A 4JHDB 4MLEA 2QWOA 1JCFA 1OKJA 4CBUA 5BRDA 3P39A 3G6EN 5E84A 4BR7A 3QBXA 3H1VX 4BRQA 3WXKA 2E2OA 3FLCO 5AQQA 4BG8A 1GLDG 5C10A 3AGKA 1SZ2A 3EO3A 1NGCA 2E1ZA 3CF5L 1Q86O 1WUAA 2P9PB 4WFAL 1NM1A 2WBNA 1YIJN 4JK8A 4BRFA 2HBMA 4UY8O 2A42A 2V7ZA 3FE1A 3AY9A 3IFRA 3VEOA 3ZX2A 3ZYYX 1KAZA 3E1YA 3OW2M 2PBDA 1VQPN 1DEJA 2RHKA 2NZTA 4KH6A 2YHXA 2FSNA 5MLCQ 1BA0A 1OVYA 3O80A 3G71N 2BTFA 3CI5A 3CIPA 1VQ5N 1W97L 2CGKA 5EVZA 4JD2B 2P9SA 3MMVA 3FZMA 3PLAA 5BRFA 4H0OA 5EY4A 4JKBA 3U9DA 3E9OA 2NRZA 4O5FA 4WQ5A 3UKRB 4IJAA 5BRHA 4WFBL 5B8HA 4BY9C 3KZBA 5AZIA 4EFHA 3A5MC 2D0OA 3DXKB 4CD1A 5I9EB 3LM9A 4IDHA 4L3QA 1BO5O 3QMLA 5AFUH 1YXQA 4JKHA 4FOIA 1G99A 4CZFA 4NLBA 3CCQN 4JKDA 1VAZA 1VQ9N 2E8AA 3QFUA 3F9MA 5LJWA 5ADXA 2Q0UA 4GVEA 2Q0RA 3IDHA 3E9PA 1MDUB 1ZBSA 3G25A 2E2NA 4K43A 3CJBA 5AR0A 3H46O 3D6RA 3F5TA 4JKEA 3I55N 3CCJN 3C7NB 3QFPA 2VCPA 3VPZA 2D4WA 4YOTA 1NGFA 5M1PA 2FF6A 2QI2A 1LOTB 1MWMA 5F1XA 4ILJA 1GLJO 4ISGA 3KWGA 3CCSN 1Q81O 3HOTA 2W40A 4JHDA 1YITN 4A62A 3VTHA 1WOQA 4IOAL 4WFNL 3D2FB 1VQMN 4XH4A 4O8KA 5AQKA 2OTLN 3HSCA 4H0TB 3WQUA 3R8EA 3D2EB 1GLEG 4JK7A 2UYTA 4M7YA 2W00A 1X3NA 4YDUA 3SMPA 4MDBA 4PHTX 1NGJA 2FSKA 2ZGZA 3BP8A 4YOUA 4BC4A 3LDPA 3DLLL 1RGIA 3H3OB 3MWTA 3Q7CA 4MLHA 1TUYA 4M63C 2P9PA 1K8KA 2FXUA 3VEVA 5GAGP 4FPAA 1V4TA 3HM8A 1YJ9N 1NGEA 2GX9A 2YI1A 3MX2A 4BR4A 5AFUA 2ZWHA 3CCVN 5CHIA 5GADP 1BWFO 3O8MA 3SJHA 5BPMA 1YUWA 3GBTA 3H6EA 5JICA 1KXPA 3U8XA 4A5BA 5E26A 2A3ZA 3FZHA 2QW9A 3CC4N 5C2DA 5JVGL 3W3DA 4JKFA 4KH4A 1ILYA 1MA9B 1T44A 1BDGA 2PFUA 4JD2A 2NLXA 5HL7L 1K8AO 3M6GA 1C0GA 3UKRA 2V52B 4BVOA 2FLOA 4WQ5C 3VEYA 2P9IB 3VF4A 1IJJA 3DXKA 4CZIA 5BPLA 1TYQB 3A5NC 4MO4A 4A5AA 4YOWA 3DJCA 1KD1O 5M1OA 4DB3A 2VGNA 3BF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJO A;  1QHA A;  3RSE B;  3GL1 A;  4Y0W A;  4EHT A;  4BR9 A;  2J4R A;  4PKG A;  3MN5 A;  3IMX A;  5BR9 A;  5EXW A;  5KQ8 A;  3CJ9 A;  3VEZ A;  3CJ1 A;  4B1X B;  2NRH A;  4A2B A;  1KAY A;  2E2Q A;  4H5T A;  4BG9 A;  4BRL A;  2V51 B;  4FSV A;  3C7N A;  4H5R A;  5AQG A;  2P9N B;  5CE3 A;  2A41 A;  4H03 B;  3ZX3 A;  5AQX A;  1YVN A;  1HUX A;  5AQT A;  1LCU A;  1JCG A;  2FSJ A;  1ZXO A;  4BQZ A;  1NWK A;  2Q1N A;  3FR0 A;  2D1K A;  3HBT A;  3FZF A;  3D2F A;  4M7X A;  1BUP A;  3VF2 A;  3FZK A;  3D2E A;  1K8K B;  3HZ6 A;  4BQL A;  4EHU A;  3H45 C;  1XC3 A;  4B9Q A;  1HLU A;  4BC5 A;  1HKC A;  3GOI A;  4QS9 A;  4BRD A;  4YDU C;  2HF4 A;  3EN9 A;  3UKU B;  3VGM A;  5KPR A;  3R6M A;  1JCE A;  1HX1 A;  4LC9 B;  3VGL A;  4PKH A;  5BN8 A;  1ATN A;  2GUP A;  3VET A;  2WUS A;  3WXI A;  5FPE A;  4F9O A;  2F9T A;  2ITM A;  4CD3 A;  3QBW A;  3AAQ A;  4NO7 A;  3CER A;  5AQP A;  1HPM A;  3P4I A;  3O4W A;  2BUP A;  3O6W A;  5LY3 A;  5TKY A;  3WT0 A;  3HI0 A;  1YAG A;  3MN9 A;  4FWM A;  1NGH A;  5AQM A;  2P9I A;  3JXU A;  4CI6 A;  1TYQ A;  4B1V A;  5AQS A;  4B1W B;  1NLV A;  2IVO A;  1E4F T;  3EZW A;  3RSE A;  1D4X A;  4FWP A;  2HF3 A;  1XUP O;  2QWN A;  5AZJ B;  3WQT A;  4BRG A;  4CJ7 A;  3L4I A;  4CZJ A;  3CQY A;  5EX5 A;  4JNE A;  5JLH A;  5FPN A;  3ENO A;  3VES A;  3SK3 A;  3VEX A;  2YHW A;  2PAV A;  2P9N A;  4FWK A;  3A0I X;  1QZ6 A;  4EAH D;  3FFK B;  4ISF A;  4FWL A;  3VF6 A;  3EKS A;  4DCH A;  1U6Z A;  1S22 A;  2Q97 A;  3WXL A;  5BPN A;  2QXL A;  4C23 A;  2ASM A;  3LL3 A;  1NGA A;  3BF1 A;  3H3N O;  2GTD A;  3LDL A;  2E88 A;  5F0X A;  1T6C A;  4FPB A;  1H1V A;  1RDW X;  4MO5 A;  3UKU A;  4BVP A;  3MN6 A;  3UB5 A;  3O1W A;  4B1Z A;  5AQU A;  1DGK N;  1DKG D;  3LDQ A;  4NB4 A;  4H0X B;  2VWB A;  3O1B A;  3O08 A;  4KBO A;  5AQW A;  3R9P A;  3KVG A;  4JN4 A;  2QM1 A;  5EOY A;  2CGL A;  3WXJ A;  2H3G X;  4BC3 A;  4FWQ A;  3ZEU B;  2AP1 A;  4BR2 A;  1SAZ A;  3EL2 A;  1C0F A;  3ATV A;  2AA4 A;  3L0Q A;  4BRN A;  1Z6R A;  1Z05 A;  4AM6 A;  3TPQ A;  5JMV A;  2E20 A;  4BRC A;  3ENH A;  4I6M B;  4ISE A;  4A2A A;  3ZET B;  4HTL A;  2ZGY A;  3A5O C;  3ZX0 A;  4J8F A;  3MN7 A;  2CH6 A;  5AQI A;  5F2R A;  4PL7 A;  2Q2R A;  2V7Y A;  2IVP A;  4HWI A;  3SLC A;  1U2V B;  2CH5 A;  2E1Y A;  5AZJ A;  4B1Y B;  2HOE A;  1ATS A;  1GLA G;  2ASO A;  4FWR A;  4Z94 A;  3U4L A;  1NGG A;  3VOV A;  3OHR A;  3CJC A;  4PL8 A;  2DPN A;  1KAX A;  2YJF A;  2QWP A;  3I8B A;  4H0Y B;  1IG8 A;  2P9U B;  4FO0 A;  2P9L B;  4FWN A;  4H5W A;  1GLF O;  4BR0 A;  3A5L C;  4IWV A;  4H0P A;  2A40 A;  3HTV A;  5AQH A;  2P9K B;  4IZ9 A;  2IIR A;  3MK6 A;  1EQY A;  3L6Q A;  4WQ4 A;  2ZF5 O;  3CQX A;  1QQO A;  1XQS C;  1P8Z A;  4BGB A;  1Q18 A;  1QZ5 A;  2A5X A;  2QWM A;  4BRM A;  5AQJ A;  5LJV A;  2I7P A;  3WEE B;  4CZE A;  3CJ7 A;  4CZM A;  2CGJ A;  1NMD A;  4CZH A;  1RFQ A;  5ADX H;  4K41 A;  5AQL A;  2QWR A;  3DXM A;  1NGI A;  5ELZ A;  1TUU A;  2OAN A;  1MWK A;  3LDO A;  3QDK A;  5AQN A;  5BRE A;  5AQZ A;  3ZEU A;  4BRP A;  4BRH A;  4JAX A;  1GLL O;  3VER A;  4H0V B;  4E1J A;  3TU5 A;  2GWK A;  3M3Z A;  3U9Z A;  3QIC A;  3DWL A;  1NGD A;  4CZK A;  1BOT O;  1Y64 A;  1NBW A;  4RCH A;  3VEW A;  4I6M A;  3J8A A;  1GLC G;  3VGK A;  4A61 A;  1X9J A;  3ZET A;  4QS7 A;  3GG4 A;  4CBX A;  1ZC6 A;  2GEL A;  2A6A A;  2ASP A;  4BRE A;  2F9W A;  5KPZ A;  3MDQ A;  2QWQ A;  4GY2 B;  2GEM A;  1U2V A;  4CZG A;  4K25 A;  1NGB A;  4WYB A;  3BUZ B;  3CHW A;  5KPT A;  3C0B A;  5AQF A;  1QQN A;  2P9U A;  2I7N A;  2P9L A;  4K42 A;  4AM7 A;  4FWO A;  3ULE A;  3A8Y A;  2KHO A;  5BN9 A;  2YJE A;  3QB0 A;  1X3M A;  3CJA A;  4BRA A;  1HKG A;  4BRO A;  2VYP A;  3CET A;  4BRI A;  2P9K A;  1J6Z A;  1S3X A;  3LDN A;  1HKB A;  4BC2 A;  4RWT A;  4PKI A;  5AQY A;  4WQ4 C;  1SQK A;  2Q36 A;  3H1Q A;  2YHY A;  3WEE A;  4RTF D;  3DXM B;  4FOE A;  4XH1 A;  5JLF A;  4XH5 A;  3GDQ A;  4IXC A;  3VEN A;  3FZL A;  3GE1 A;  3IUC A;  1R59 O;  5AQR A;  3I33 A;  4BRK A;  1E4G T;  3SMS A;  2E2P A;  4FL9 A;  3WUH A;  2W41 A;  4H5V A;  4IO8 A;  4BGA A;  1T6D A;  3ID8 A;  4B1U B;  1CZA N;  2P9S B;  2YCH A;  1BU6 O;  3ATU A;  4CZL A;  4DHY A;  4GNI A;  3M1F A;  5AQO A;  1ESV A;  3FGU A;  5AZI B;  5KQD A;  4BR5 A;  4H5N A;  2GWJ A;  2EWS A;  3EKU A;  3JS6 A;  3DAW A;  4FWS A;  3AAP A;  3O5B A;  4EIA A;  2QWL A;  1ATR A;  3W0L A;  2Q31 A;  1V4S A;  2HMP A;  5FPD A;  3D7E O;  1BA1 A;  3AAR A;  4DQ8 A;  2D0P A;  3ULE B;  3KHY A;  4IJN A;  5AQV A;  3B8A X;  4CBW A;  2FF3 B;  4XEI A;  3UE5 A;  4QS8 A;  5FPM A;  3S41 A;  1GLB G;  3LM2 A;  3MCP A;  4JHD B;  2IVN A;  3BEX A;  1BG3 A;  4MLE A;  2QWO A;  1JCF A;  1OKJ A;  4CBU A;  5BRD A;  5E84 A;  4BR7 A;  3QBX A;  3H1V X;  4BRQ A;  3WXK A;  2E2O A;  3FLC O;  5AQQ A;  4BG8 A;  1GLD G;  1SZ2 A;  3EO3 A;  1NGC A;  2E1Z A;  1WUA A;  2P9P B;  1NM1 A;  4BRF A;  2A42 A;  2V7Z A;  3FE1 A;  3AY9 A;  3IFR A;  3VEO A;  3ZX2 A;  1KAZ A;  2PBD A;  1DEJ A;  2NZT A;  2YHX A;  2FSN A;  1BA0 A;  3O80 A;  3CI5 A;  2BTF A;  3CIP A;  2CGK A;  5EVZ A;  4JD2 B;  2P9S A;  3MMV A;  3FZM A;  5BRF A;  4H0O A;  5EY4 A;  3U9D A;  4O5F A;  4WQ5 A;  5BRH A;  3UKR B;  4IJA A;  5B8H A;  3KZB A;  5AZI A;  4EFH A;  3A5M C;  2D0O A;  3DXK B;  4CD1 A;  5I9E B;  3LM9 A;  4L3Q A;  1BO5 O;  3QML A;  5AFU H;  1YXQ A;  4FOI A;  1G99 A;  4CZF A;  2E8A A;  3QFU A;  3F9M A;  5LJW A;  5ADX A;  2Q0U A;  2Q0R A;  3IDH A;  1MDU B;  1ZBS A;  3G25 A;  2E2N A;  4K43 A;  3CJB A;  5AR0 A;  3H46 O;  3C7N B;  3QFP A;  2VCP A;  3VPZ A;  2D4W A;  1NGF A;  2FF6 A;  1LOT B;  1MWM A;  5F1X A;  1GLJ O;  4ISG A;  2W40 A;  4JHD A;  4A62 A;  1WOQ A;  3D2F B;  4XH4 A;  4O8K A;  5AQK A;  3HSC A;  4H0T B;  3WQU A;  3R8E A;  3D2E B;  1GLE G;  4M7Y A;  2UYT A;  1X3N A;  4YDU A;  3SMP A;  1NGJ A;  2FSK A;  2ZGZ A;  3BP8 A;  4BC4 A;  3LDP A;  1RGI A;  3H3O B;  4MLH A;  1TUY A;  4M63 C;  2P9P A;  1K8K A;  2FXU A;  3VEV A;  4FPA A;  1V4T A;  3HM8 A;  1NGE A;  2YI1 A;  4BR4 A;  5AFU A;  2ZWH A;  1BWF O;  3O8M A;  3SJH A;  5BPM A;  1YUW A;  3GBT A;  3H6E A;  5JIC A;  1KXP A;  3U8X A;  5E26 A;  2A3Z A;  3FZH A;  2QW9 A;  3W3D A;  1MA9 B;  1T44 A;  1BDG A;  4JD2 A;  2NLX A;  3M6G A;  1C0G A;  3UKR A;  2V52 B;  4BVO A;  2FLO A;  4WQ5 C;  3VEY A;  2P9I B;  3VF4 A;  1IJJ A;  3DXK A;  4CZI A;  5BPL A;  1TYQ B;  3A5N C;  4MO4 A;  3DJC A;  4DB3 A;  1QQM A;  3BF3 A; 
#chains in the Genus database with same CATH topology
 2O8E A;  5JVH L;  1QHA A;  4X62 K;  2J4R A;  2QA4 N;  4CFA A;  3M8R A;  2G8U A;  5BR9 A;  3HPO A;  1WSI A;  5EXW A;  3I0S A;  2AJQ A;  1P90 A;  4H5R A;  3HST B;  3P38 A;  4H03 B;  4FVU A;  3J80 O;  4HUF A;  2NUB A;  1HUX A;  4CGF A;  1LCU A;  2BDP A;  4BQZ A;  2YKM A;  1NWK A;  4B8C A;  4L8R B;  3CMA N;  3FZF A;  5GIO A;  3D2F A;  4M7X A;  1BUP A;  1S72 N;  5K14 A;  3HZ6 A;  4DQQ A;  4YDU C;  3EE8 A;  3EN9 A;  3UKU B;  3KTQ A;  1VQN N;  4LC9 B;  1LAW A;  1DT9 A;  4B9M A;  4HVJ A;  4Y1C A;  4BDY A;  3VET A;  3MX5 A;  5FPE A;  1RT1 A;  3IAY A;  4Z4C A;  2UXC K;  1NKB A;  3CCU N;  4W5Q A;  2BUP A;  4KRE A;  3WT0 A;  4KB0 A;  3ZSR A;  3MN9 A;  3VQ8 A;  1SS6 A;  4M3R A;  4FWM A;  3O9S A;  4DSF A;  4GMJ B;  2JGU A;  4CI6 A;  4M42 A;  3CFP A;  2X6N A;  3KKS A;  2B4J A;  2EHG A;  1NLV A;  3HJF A;  3KD1 E;  5JS2 A;  1HNI A;  2VGM A;  1XUP O;  5AZJ B;  3WQT A;  4BRG A;  4E1M A;  1NKE A;  3ZSY A;  4HCC A;  3CCM N;  4BE0 A;  5EX5 A;  2F4V K;  5JLH A;  3VEX A;  2E5L K;  2PAV A;  3CC7 N;  3HT3 A;  4EAH D;  3VMF B;  4FWL A;  4DCH A;  1S22 A;  1VSL A;  3WXL A;  3KK3 A;  4I2P A;  4JS4 A;  2NNW A;  4GVM A;  2P51 A;  3UKU A;  4DSL A;  2Z1J A;  4FXD A;  2HHV A;  5AQU A;  3V9X A;  2VWB A;  3R9P A;  3TTF A;  1S1X A;  4DF8 A;  4JN4 A;  2H3G X;  4FWQ A;  3ZEU B;  3LAL A;  4K8Z A;  3V9W A;  1C1B A;  3B6O A;  2HHW A;  2AA4 A;  3VQA A;  2HHI A;  3PY8 A;  2G8H A;  4FLT A;  1L3T A;  5JMV A;  2E20 A;  4BRC A;  3C6A A;  3TSQ A;  3ENH A;  4ISE A;  3ZT2 A;  3ZSX A;  1NK9 A;  1KLN A;  4A2A A;  2HHU A;  3HK2 A;  4J8F A;  4DTR A;  1RTI A;  3F73 A;  3SLC A;  2OA8 A;  3AVH A;  3TAE A;  1W0H A;  4W5R A;  5AZJ A;  4B1Y B;  1QE1 A;  2ASO A;  3LP0 A;  4WE1 A;  3OHR A;  3A2F A;  1KVC A;  4PL8 A;  5CYQ A;  2DPN A;  2YJF A;  4DFJ A;  1TAQ A;  1IG8 A;  3R1X A;  3RRG A;  2P9L B;  4FWN A;  2UXD K;  3R3L A;  3A5L C;  4JI5 K;  1VQO N;  2D0A A;  3OYK A;  2C1G A;  2B6A A;  1U45 A;  1EWQ A;  3VQ7 A;  4C8N A;  5KGX A;  4IFV A;  1WSF A;  1YTU A;  2ZF5 O;  1QQO A;  1JJ2 M;  1P8Z A;  3SPY A;  3B6P A;  2IOC A;  4CZM A;  2CGJ A;  1RFQ A;  4C8O A;  1BGX T;  2HMI A;  1TVR A;  3ISN C;  3DXM A;  2WOM A;  5ELZ A;  3J7A P;  5AQZ A;  3ZEU A;  4BRP A;  1L3U A;  4BE7 B;  4DQI A;  5HLF A;  1GLL O;  3ZSV A;  4H0V B;  1XMO K;  5JS1 A;  2GWK A;  1JLE A;  3VA0 A;  4CZK A;  4BE1 A;  1BOT O;  3TAF A;  1Y64 A;  1NBW A;  3VEW A;  3QNN A;  4JI2 K;  4CJ3 A;  3NBP A;  4QS7 A;  3GG4 A;  4IBN A;  4CJP A;  1W9H A;  4AHT A;  3OS0 A;  3MDQ A;  3HPH A;  3F9K A;  2A1R A;  4K25 A;  5KPT A;  4EP4 A;  3QIN A;  2UU9 K;  1S9G A;  4GKJ K;  3DI6 A;  3L2V A;  2P9L A;  3LZI A;  4CEF A;  4KTZ A;  4NCB A;  3ULE A;  5C12 A;  2KHO A;  3LAK A;  3QB0 A;  1T3V A;  1UA1 A;  1IBK K;  4BRI A;  4FJL A;  2GBZ A;  2Z1I A;  2HBK A;  4HTU A;  1J6Z A;  4FK0 A;  1HNX K;  2HNZ A;  1WBB A;  1S9E A;  4IOC L;  4PKI A;  3QEP A;  1FJG K;  2Q36 A;  3H1Q A;  1NK8 A;  1BCO A;  1T8E A;  3EEQ A;  3O4N A;  4AQY K;  3SQ1 A;  3TWH A;  3U3Y A;  1KVA A;  3S9H A;  3GDQ A;  5AQR A;  1VSM A;  3O9T A;  3LP1 A;  1TK5 A;  3SMS A;  3WUH A;  4BGA A;  4CF0 A;  3ID8 A;  1CZA N;  3NF8 A;  4J2E A;  2P9S B;  3JYT A;  3K9J A;  1VRT A;  3TTD A;  3TAB A;  4GNI A;  1BIU A;  3QET A;  3O3G A;  4OLB A;  2O8D B;  1YVU A;  1KLM A;  3V1R A;  3MED A;  4PY5 A;  1EXQ A;  3EKU A;  4FWS A;  2ZJP L;  2VWJ A;  3W0L A;  2Q31 A;  3TSP A;  2X6S A;  4CES A;  2A1S A;  4LD0 A;  1RT3 A;  4YOY A;  4DQ8 A;  1NJW A;  3OYH A;  3B8A X;  4C8K A;  5J2P A;  4QS8 A;  2P5G A;  5C2F A;  4MLE A;  5BRD A;  3ZLJ A;  2JLE A;  4CER A;  4KB1 A;  5AQQ A;  3OYJ A;  4KHS A;  1C6V A;  4DLG A;  1NGC A;  1Q86 O;  2P9P B;  4DTU A;  2O8F B;  3IS9 A;  1ZBH A;  2A42 A;  4DFM A;  1BCM A;  3ZYY X;  1KAZ A;  4OKK A;  2NZT A;  4KH6 A;  5MLC Q;  1EKE A;  3ALY A;  1BI4 A;  4CW7 B;  3FFI A;  3CI5 A;  3I8D A;  1OVQ A;  2P9S A;  3FZM A;  1BQN A;  1U49 A;  5BRF A;  3SI6 A;  4O5F A;  2NRZ A;  4WQ5 A;  5BRH A;  4WFB L;  3VQ9 A;  3QEV A;  1EX4 A;  2O8D A;  1RTH A;  1S1V A;  2XY6 A;  3A5M C;  3RMB A;  3LM9 A;  5AFU H;  4L3Q A;  4MQ3 A;  4CZF A;  1NU0 A;  3CCQ N;  1NK5 A;  1J5E K;  3OS1 A;  3F9M A;  2OPR A;  4B3O A;  4GVE A;  4DU3 A;  1CZ9 A;  1NK6 A;  1MDU B;  3G4S N;  1VRU A;  3L8B A;  4JKE A;  3SUN A;  1FKP A;  4YOT A;  5M1P A;  2FF6 A;  4KHW A;  3OYB A;  2D0C A;  5F1X A;  1GLJ O;  1TKT A;  3KWG A;  3HOT A;  3DRR A;  3HSC A;  3NE6 A;  3OY9 A;  3THW B;  3IG1 A;  4FJI A;  4DWI A;  4PHT X;  4YOU A;  3V1O A;  3Q7C A;  3NF6 A;  4C8L A;  3MXI A;  2P9P A;  1K8K A;  2FXU A;  4ZHR A;  2O8F A;  2GV9 A;  1RBU A;  4M3Z A;  1EP4 A;  2E6L A;  2FBT A;  4JI8 K;  4KHY A;  4E72 A;  3W3D A;  1KRP A;  1T44 A;  2PFU A;  1JLG A;  3L3V A;  3M6G A;  4BVO A;  3DLK A;  4WQ5 C;  1B9D A;  3M8P A;  4DR2 K;  3A5N C;  4MO4 A;  1WSG A;  1J53 A;  3DJC A;  3KVG A;  5CR4 A;  3DRP A;  1QQM A;  1VHX A;  2RN2 A;  2XHB A;  1HQE A;  3CM5 A;  4IG3 A;  4PKG A;  4B3R K;  2QEX N;  4DFK A;  3K5M A;  3VQD A;  3VEZ A;  3CJ1 A;  1QTM A;  4B1X B;  4FZX C;  1WB9 A;  1KAY A;  4BG9 A;  3OS2 A;  4BRL A;  1IKY A;  1RDB A;  2P9N B;  4IOX A;  1YVN A;  1YHQ N;  5AQT A;  1HNV A;  1S6Q A;  3FR0 A;  3ZT3 A;  4CGD A;  3ZSW A;  4FLY A;  1XMQ K;  3VF2 A;  3L2R A;  1IKW A;  4IDK A;  5FDL A;  3THW A;  3M8S A;  4FJ5 A;  3VTI A;  4QS9 A;  4BRD A;  4CF8 A;  3DM2 A;  2OYQ A;  5E41 A;  5KPR A;  1HX1 A;  5BN8 A;  3HP9 A;  2GUP A;  4ELT A;  4YFU A;  3VQC A;  2QTD A;  1CXQ A;  2ITM A;  4YY3 K;  3QBW A;  3MEE A;  3AAQ A;  5AQP A;  1HPM A;  3O4W A;  3S5T A;  3TI0 A;  2NRT A;  3E66 A;  5AQM A;  3JXU A;  3AVJ A;  1VQ7 N;  2D5R A;  5C15 A;  3AA2 A;  4B1W B;  3DLB A;  1E4F T;  4G1Q A;  1K9M O;  4EZ6 A;  4OO1 J;  3CPE A;  1D4X A;  2W42 A;  4CJ7 A;  3KJV A;  4CZJ A;  4CGH A;  3CQY A;  2XY7 A;  4JNE A;  4CJF A;  4KHQ A;  1NJI O;  3LAM A;  1I94 K;  2G8W A;  4CE9 A;  4OKJ A;  3OBY A;  2P9N A;  1XWL A;  4DV2 K;  1UA0 A;  4NCA A;  1O13 A;  1RIL A;  1TKZ A;  5EU7 A;  3VF6 A;  1N34 K;  3QNO A;  2Q97 A;  1J9A A;  2HW3 A;  5M1F A;  3LL3 A;  1NGA A;  3PO5 A;  4A59 A;  1T6C A;  4FPB A;  4DMN A;  4Z4H A;  1H1V A;  1RDW X;  1TK8 A;  4KHP K;  4KHN A;  1LWE A;  3UB5 A;  4B1Z A;  4H0X B;  4FJ7 A;  3O08 A;  3RMC A;  4F2S A;  2EX3 A;  3L3U A;  1FW6 A;  1IO2 A;  5EOY A;  2CGL A;  1T05 A;  1SAZ A;  3L0Q A;  4BRN A;  1Z6R A;  2YNI A;  1KFS A;  1Z05 A;  4AM6 A;  4E0D A;  4XJX A;  3JAM O;  5J2N A;  1CXU A;  4C1N I;  3PX4 A;  4I6M B;  3CME N;  1LW2 A;  4HTL A;  3A5O C;  3ZX0 A;  3MN7 A;  3E01 A;  3T19 A;  5GAH P;  2V7Y A;  4H8K A;  4DV7 K;  3PIP L;  4HWI A;  4FM0 A;  1U2V B;  1RBT A;  3BGR A;  2E1Y A;  3VQB A;  4CGJ A;  4CIG A;  4OJR A;  2HOE A;  4U67 L;  3NGZ A;  4Z94 A;  3VOV A;  1YTA A;  4LF8 K;  1KAX A;  4H0Y B;  4ID1 A;  2QWP A;  3I8B A;  1YF5 L;  4DUY K;  2P9U B;  2LSN A;  4FO0 A;  2OZM A;  3RRH A;  2UUA K;  2HND A;  2NRX A;  3O3F A;  2A40 A;  1JLA A;  5TKW A;  4ZTJ A;  1ASV A;  1HYV A;  4QCL A;  3HTV A;  2HHS A;  1NJX A;  2IIR A;  3P83 D;  3OTO K;  1X1P A;  1QHT A;  5I42 A;  2KTQ A;  2UUB K;  4N5S A;  4CFB A;  1B92 A;  2VG7 A;  3SBG A;  4YHH K;  5JEN A;  4CZE A;  3CJ7 A;  4CZH A;  1XHZ A;  1NMD A;  3SQ2 A;  3SAF A;  5ADX H;  3C94 A;  1HNZ K;  5DM7 L;  1RT5 A;  2ZD1 A;  3HPG A;  4K41 A;  4PQU A;  5AQL A;  1HJR A;  1VQ8 N;  1NGI A;  4YOR A;  4OPH A;  4AHS A;  4CEA A;  2OAN A;  4JRP A;  3NGI A;  1M1K O;  2E4L A;  4BRH A;  4JRQ A;  3TU5 A;  3U9Z A;  3QIC A;  1EWR A;  1NGD A;  2ATQ A;  4FLX A;  2UUC K;  3PSI A;  4Z4I A;  1CLQ A;  4JI6 K;  4I6M A;  4KAZ A;  3OYC A;  5HOO A;  2ASP A;  4OPJ A;  1TKD A;  4BRE A;  3NH1 A;  4E7J A;  1U2V A;  4X64 K;  3T1H K;  3SYZ A;  3AVF A;  4WYB A;  4FLW A;  4CCH A;  2KQ2 A;  3VA3 A;  3ZT0 A;  3DYA A;  4TSX A;  4CIE A;  1WAF A;  3DRS A;  2P9U A;  2I7N A;  4K42 A;  4N76 A;  1ZBI A;  4AM7 A;  3A8Y A;  1QS4 A;  4BE2 A;  2YHB A;  3CJA A;  2XY8 A;  2VG6 A;  2VYP A;  1VSH A;  2ZJR L;  3AVI A;  3HOS A;  4IEE A;  3ZSO A;  4CVN E;  4OGE A;  3VQE A;  3LDN A;  1SQK A;  1ASU A;  3SQ0 A;  2YHY A;  3VQQ A;  3DLG A;  3DXM B;  4CJ5 A;  3AVC A;  4FOE A;  4QOZ B;  1Y97 A;  1VSD A;  2BH1 A;  4XH1 A;  3C6T A;  3AA3 A;  3J81 O;  4IFE A;  4IXC A;  4M3Y A;  4OLA A;  3GE1 A;  3IUC A;  1R59 O;  1EET A;  2E2P A;  4EZ9 A;  4H5V A;  4FZY A;  1VSK A;  3J7Y P;  1BU6 O;  4BEB A;  1VQK N;  2O4G A;  3V4I A;  4LY7 A;  4KKO A;  5AZI B;  3K57 A;  2O8B A;  4H5N A;  2GWJ A;  3UIQ A;  4KTW A;  4EIA A;  5FPD A;  1V4S A;  1RTD A;  5FRO A;  3D7E O;  4W5T A;  1NJY A;  4PA1 A;  3AAR A;  4CHZ A;  1N32 K;  4JV5 K;  4DSI A;  3ULE B;  3MCA B;  3O9R A;  4RW4 A;  1Q9X A;  2BE2 A;  4I9L A;  3IKM A;  2FBY A;  4JI7 K;  3WNF A;  1GLB G;  2R7Y A;  4JHD B;  3N4Q A;  3BEX A;  2KFZ A;  1BG3 A;  4E7K A;  4B9S A;  3P39 A;  3AVK A;  5KRT A;  3QBX A;  1NK4 A;  3WXK A;  3K5O A;  5C10 A;  1SKR A;  3AGK A;  4DSK A;  2WBN A;  4BRF A;  1GOB A;  2G8F A;  1U04 A;  1LAV A;  4DV4 K;  3HVT A;  1NNE A;  4FZZ A;  2RHK A;  4NXN K;  3VN5 A;  3SJJ A;  2YHX A;  2X74 A;  3LWM A;  1OVY A;  3G71 N;  3CIP A;  1W97 L;  3SQ4 A;  4NYN A;  2CGK A;  2YNG A;  4JD2 B;  3MMV A;  5EVZ A;  3MXM A;  4M3X A;  4PWD A;  4H0O A;  4CJR A;  3U9D A;  5J1E A;  4NXM K;  3ZCM A;  4J2D A;  2ETJ A;  3KZB A;  5AZI A;  4RW7 A;  1CZB A;  1BO5 O;  2RKI A;  3QML A;  4FOI A;  5C25 A;  3OYN A;  1VSI A;  1RBS A;  2Q0U A;  4F3T A;  1Z25 A;  5AR0 A;  2OPS A;  4B3M K;  4OX9 K;  3H46 O;  5FLX O;  3C7N B;  3QFP A;  4CJU A;  1JLB A;  2UXB K;  1RBR A;  3L2Q A;  2W40 A;  4ICL A;  4JHD A;  3O3H A;  1DLO A;  1X9S A;  4CHN A;  1WOQ A;  4IOA L;  1VQM N;  2KW4 A;  4XH4 A;  2HNY A;  4BWM A;  3WQU A;  2OTL N;  4DSJ A;  1IV0 A;  4ZTF A;  1JKH A;  2W00 A;  1RDA A;  1NGJ A;  2FSK A;  3BP8 A;  4BC4 A;  1RGI A;  1QSY A;  1S1T A;  4JI1 K;  3VEV A;  1YJ9 N;  1DTT A;  1V4T A;  3NH0 A;  2YI1 A;  5AFU A;  2ZWH A;  1IH7 A;  3AO3 A;  4MFB A;  1L5U A;  4Z4E A;  1BI4 B;  3AO2 A;  1FXX A;  1J5O A;  5BPM A;  1N5Y A;  5DMR A;  4RW9 A;  2A3Z A;  1JLQ A;  4KI6 A;  5KTQ A;  3NAE A;  4N41 A;  1ILY A;  4JD2 A;  1K8A O;  5HL7 L;  3AO1 A;  1K6Y A;  1X9W A;  1NKC A;  3AVG A;  1IKV A;  3VEY A;  4F8R A;  3VF4 A;  5BPL A;  1TYQ B;  3S3O A;  4DQS A;  4O0J A;  4CGG A;  4DB3 A;  5LMU K;  1E3M A;  1HJO A;  1W2B M;  1ASW A;  1UWB A;  3GL1 A;  4Y0W A;  5M1Q A;  2HVH A;  2I5J A;  4BR9 A;  3ZT1 A;  1QSS A;  3MN5 A;  2KZZ A;  4OPK A;  4A2B A;  3C65 A;  4IEI A;  3TAN A;  3ZT4 A;  4LH5 A;  2HHQ A;  2RE2 A;  4FSV A;  3C7N A;  5AQG A;  3ZSQ A;  5CE3 A;  2A41 A;  2QKK A;  3NGY A;  4FJ9 A;  4RW6 A;  4Z4G A;  2FSJ A;  1NOZ A;  1SUQ A;  2Q1N A;  2C1I A;  3CCE N;  5HBM A;  4BWJ A;  3HBT A;  4FK4 A;  2BGG A;  3MEC A;  3KLH A;  3V81 A;  1K8K B;  3LPT A;  1XC3 A;  2B5J A;  1HLU A;  3E9L A;  4B9Q A;  1OH5 A;  1HKC A;  4X66 K;  3THV A;  1VSF A;  3CYM A;  4CJW A;  2KZM A;  2HF4 A;  3VGM A;  1JCE A;  3KK2 A;  3SUQ A;  3VGL A;  4PKH A;  1D9D A;  4M45 A;  5I3U A;  4RW8 A;  1ATN A;  2IDO A;  1ZBF A;  3AA5 X;  3KLI A;  4Y1D A;  3MXJ A;  2WFB A;  2WUS A;  5CZ1 A;  3WXI A;  4CD3 A;  4Q5V A;  3I56 N;  3CC2 N;  3CER A;  1XHX A;  4CHP A;  4CHQ A;  3MEG A;  3P4I A;  5LY3 A;  2KLA A;  5TKY A;  2X78 A;  3AVN A;  3HI0 A;  1YAG A;  3RR8 A;  4BEC A;  1C1C A;  1TGO A;  3V9Z A;  1TYQ A;  2Q3S A;  5AQS A;  3DOL A;  3K5L A;  1DTQ A;  5LMN K;  1XNQ K;  3EZW A;  4FWP A;  2FBX A;  2HF3 A;  2QWN A;  2OCE A;  2Y1J A;  2NRR A;  4FJG A;  3DOK A;  3QEI A;  5C24 A;  4QAG A;  1NOY A;  1IBM K;  4UQG A;  3CD6 N;  2YKN A;  1FK9 A;  3A0I X;  1QZ6 A;  2KFN A;  1NK7 A;  2NRW A;  3OW2 M;  3FFK B;  3M8Q A;  4ISF A;  1IG9 A;  1U6Z A;  4FJN A;  5BPN A;  2QXL A;  4C23 A;  2ASM A;  5AJ3 K;  3H3N O;  2GTD A;  1B9F A;  2E88 A;  4O4G A;  5F0X A;  4DG1 A;  4HUE A;  4JLH A;  3OJU A;  4JKA A;  4BVP A;  1DGK N;  1DKG D;  4NB4 A;  4DQP A;  3O1B A;  1JL2 A;  4KBO A;  4FCY A;  5A2Q O;  4WCE L;  1D5A A;  3NMU A;  4BC3 A;  4CEO A;  2AP1 A;  3ID6 A;  1O1W A;  3KD5 E;  3EL2 A;  3ATV A;  3PUF A;  3TPQ A;  1Q8I A;  3NVM A;  1WSJ A;  3D0P A;  1L3S A;  3ZET B;  2QKB A;  2CH6 A;  3EE9 A;  2VQF K;  5F2R A;  4CEZ A;  2Q2R A;  4PL7 A;  5DM6 L;  3TAR A;  2CH5 A;  1GLA G;  1KFD A;  1NGG A;  4CEQ A;  2O4I A;  3QLH A;  1HNW K;  4FJH A;  1C0T A;  1RT6 A;  1NK0 A;  4BR0 A;  4IWV A;  4V19 S;  3OJS A;  4FW1 A;  3CCL N;  4FM2 A;  1U4B A;  3DMJ A;  2G8K A;  2P9K B;  4DV5 K;  4W5O A;  3V1Q A;  4HUG A;  3MK6 A;  3HL8 A;  3L6Q A;  3NF9 A;  4YOV A;  4WQ4 A;  4LF5 K;  5CZ2 A;  3CQX A;  4CJK A;  2HBL A;  1Q18 A;  2QWM A;  2A5X A;  5M1N A;  5LJV A;  2I7P A;  3WEE B;  4I2Q A;  4CF2 A;  2IAJ A;  3CXC M;  4JS5 A;  3NCI A;  1KQS M;  4CFC A;  4FYD A;  3L4Q A;  4M3W A;  2QWR A;  3ENB A;  3S3N A;  4OPA A;  1TUU A;  1MWK A;  5BRE A;  3QDK A;  5AQN A;  3ZSZ A;  4N47 A;  3VER A;  2IGI A;  2Z1H A;  1RDU A;  4OKE A;  3KLE A;  4DTP A;  2HVI A;  3J8A A;  3VGK A;  4A61 A;  4FW2 A;  3OYE A;  1QVG M;  4DR7 K;  3ZET A;  1YJN N;  1ZC6 A;  1YT3 A;  3QEW A;  3SBT A;  5C0Y A;  4DR3 K;  1S1U A;  4GY2 B;  2GEM A;  3LP2 A;  4CZG A;  4IO9 L;  2WC9 A;  2VWK A;  1RDC A;  1IKX A;  3C0B A;  5AQF A;  4FJ8 A;  4B3S K;  1A5W A;  1QQN A;  4LSN A;  4CEB A;  3PIO L;  4E7L A;  3HO1 A;  2YHA A;  2YJE A;  3QO9 A;  1BIS A;  5D3G A;  1HKG A;  4ILH A;  4BRO A;  1RT7 A;  2P9K A;  3ITH A;  2F8T A;  2PZS A;  4NYF A;  1NG9 A;  4BDZ A;  1S3X A;  4B3T K;  4RWT A;  4DTO A;  4WQ4 C;  3WEE A;  4DTM A;  4RTF D;  4GV3 A;  3OBW A;  1UOC A;  4DR6 K;  4WF9 L;  4DR5 K;  3VEN A;  3FZL A;  3N4P A;  4FL9 A;  3M5R A;  1T6D A;  3F2K A;  2YCH A;  3ATU A;  3BZC A;  4AHV A;  5HP1 A;  5AQO A;  4FJX A;  3K2P A;  3SAH A;  3OYG A;  1ESV A;  5KQD A;  4ILG B;  4C8M A;  4F2R A;  2BAN A;  2EWS A;  3JS6 A;  4DSE A;  3DAW A;  4JKC A;  3O5B A;  3L2W A;  1TL1 A;  2QWL A;  1ATR A;  4U7B A;  3C95 A;  1JLC A;  3PO4 A;  2PYJ A;  1BA1 A;  3P1G A;  1A5X A;  1S1W A;  2D0P A;  4KRF A;  4G9Z A;  3KHY A;  4IJN A;  1GOA A;  4CBW A;  1T7P A;  1TAU A;  2FF3 B;  3UE5 A;  5FPM A;  3NHG A;  3LAN A;  2IVN A;  1NJZ A;  1JCF A;  1SKS A;  4Z0U A;  5HRO A;  3G6E N;  3RMA A;  4BR7 A;  3QIO A;  3OYF A;  3K0S A;  2E2O A;  4BG8 A;  5SZT A;  4DU4 A;  2OZS A;  2HHX A;  1SZ2 A;  3CM6 A;  3EO3 A;  4CHO A;  1GOC A;  1Z26 A;  3VQ6 A;  4J2B A;  4UY8 O;  3FE1 A;  3AY9 A;  3IFR A;  3VEO A;  1R0A A;  3ZX2 A;  3E1Y A;  3K5N A;  4DV0 K;  2PBD A;  1VQP N;  2OPQ A;  2FSN A;  1LW0 A;  2BTF A;  2O8B B;  3PLA A;  3AVM A;  1ZYQ A;  1D9F A;  1OH8 A;  4JKB A;  3DLR A;  3AA4 A;  4DTJ A;  4IJA A;  3KKR A;  5B8H A;  4FM1 A;  1W7A A;  4CD1 A;  1HPZ A;  2F8S A;  5I9E B;  1RNH A;  1KVB A;  1WAJ A;  4IDH A;  3S3M A;  3G0Z A;  3OYM A;  1TV6 A;  4NLB A;  3SUP A;  1L3V A;  2HHH K;  3QER A;  4CIF A;  1VAZ A;  1VQ9 N;  1KSP A;  2E8A A;  3QFU A;  4IG0 A;  3T1Y K;  1WSE A;  5LJW A;  1ZBL A;  1WLJ A;  3G25 A;  2E2N A;  3I55 N;  4W5N A;  1SL0 A;  3SPZ A;  2VCP A;  1LWF A;  3PX6 A;  2D4W A;  1NGF A;  2QI2 A;  1LOT B;  4ILJ A;  1Q81 O;  4O44 A;  5HRR A;  1OH6 A;  3VTH A;  1XI1 A;  3CFO A;  3I0R A;  4O8K A;  3LWL A;  4H0T B;  3H08 A;  4LF7 K;  3D2E B;  1GLE G;  4JK7 A;  2UYT A;  1HRH A;  1X3N A;  4LFA K;  3SMP A;  2ZGZ A;  4CK3 A;  3ULD A;  3LDP A;  3DLL L;  3H3O B;  3MWT A;  3U6F A;  1TUY A;  4M63 C;  5GAG P;  1RCH A;  4FPA A;  3AO4 A;  3HM8 A;  1NGE A;  2GX9 A;  3WNE A;  5T7B A;  4BR4 A;  4H4O A;  1SKW A;  3WNG A;  5CHI A;  3BY5 A;  5SWM A;  4O55 A;  4OVL A;  1BWF O;  1YUW A;  3H6E A;  1KXP A;  2E6M A;  3VQ4 A;  3QIP A;  5E26 A;  1LV5 A;  2YV0 X;  4DS5 A;  3TAG A;  1D8Y A;  5JVG L;  2NLX A;  1C0G A;  3RR7 A;  2FLO A;  3CQ8 A;  2P9I B;  4CZI A;  1KD1 O;  4YOW A;  4A5A A;  3PSF A;  3U3G A;  2VGN A;  3THY B;  3BF3 A;  4OGC A;  1BHL A;  5LL6 Z;  3RSE B;  4GW6 A;  4EHT A;  3TAM A;  2HB5 A;  3CPW M;  3IMX A;  3NF7 A;  3T1A A;  5KQ8 A;  4KI4 A;  2YX6 A;  3CJ9 A;  1OH7 A;  2NRH A;  2E2Q A;  4H5T A;  4M3U A;  4CJS A;  1Q9Y A;  4LF9 K;  2V51 B;  4GV6 A;  4R79 A;  1QQC A;  2O8C B;  3HM9 A;  3ZX3 A;  4B8A B;  5AQX A;  1JCG A;  4O0I A;  1ZXO A;  3HP6 A;  4IFY A;  2D1K A;  4K8X A;  4O8U A;  3TTC A;  2VG5 A;  4HCB A;  2OPP A;  4E89 A;  3FZK A;  1N8R O;  2ZE2 A;  3D2E A;  5KGW A;  5DK5 A;  4BQL A;  4EHU A;  3H45 C;  3OA9 A;  5HRN A;  4BC5 A;  4LH4 A;  3GOI A;  4YNQ A;  4DFP A;  3R6M A;  4DTN A;  4DTX A;  4ELV A;  3L2U A;  3LPU A;  4DR1 K;  3PX0 A;  5GAE P;  4JK9 A;  3SV3 A;  1EO1 A;  1S5J A;  4DKW A;  4XIU A;  4F9O A;  1MU2 A;  2F9T A;  1S6P A;  4B9N A;  5GIP A;  4NO7 A;  4FLZ A;  3NVK A;  3O6W A;  2JWK A;  4I7F A;  2G8I A;  1SL2 A;  4B9V A;  4CJQ A;  1NGH A;  3OVN A;  2P9I A;  4YOX A;  1XNR K;  4JKG B;  1VQ4 N;  4B1V A;  1SL1 A;  4FK2 A;  5C42 A;  3THY A;  4DV1 K;  2IVO A;  1BL3 A;  5HRS A;  5GIN A;  4CGI A;  1C1A A;  3RSE A;  4JYA K;  2ITG A;  1A5V A;  3L4I A;  2QXF A;  2HBJ A;  4E19 A;  3BDP A;  5FPN A;  3HXM A;  3ENO A;  3VES A;  3SK3 A;  2YHW A;  2W6K A;  1RT2 A;  4AIL C;  1WN7 A;  2O8C A;  4CFD A;  4FWK A;  4DU1 A;  1UAX A;  2WTU A;  3CFR A;  3EKS A;  2PY5 A;  4Z4F A;  3Q7B A;  4KV8 A;  5KRS A;  1KTQ A;  3BF1 A;  1KC8 O;  3OYI A;  3LDL A;  1Q7Y O;  3V6D A;  1IBL K;  3JSM A;  4CJ4 A;  2DFF A;  4CK2 A;  2D0B A;  4CHY A;  4MO5 A;  3OYL A;  4Q0B A;  3MN6 A;  3SCX A;  3O1W A;  4B9L A;  4KTQ A;  3LDQ A;  2ZJQ L;  2NRV A;  3T7Z A;  5AQW A;  1QVF M;  3SV4 A;  2QM1 A;  3WXJ A;  4I9Q A;  5J2M A;  4EP5 A;  1YI2 N;  3HVR A;  4BR2 A;  4CJE A;  2F96 A;  1HR0 K;  4CF9 A;  1C0F A;  3IRX A;  4F4K A;  3K9K A;  1VQL N;  5J2Q A;  3AV9 A;  3RVC A;  3LZJ A;  3KWI A;  4ID5 A;  1U47 A;  4CK1 A;  5BR8 K;  2ZGY A;  3C6H A;  4JKG A;  3G10 A;  3KK7 A;  1VSE A;  4ELU A;  3V9S A;  5AQI A;  3K58 A;  2RF2 A;  2IVP A;  2XY5 A;  5FRN A;  2F7T A;  4AH9 A;  1ATS A;  4FWR A;  3U4L A;  4CJV A;  3CJC A;  4CJT A;  4KO0 A;  3OYD A;  4GKK K;  4B9T A;  1VK0 A;  3NDK A;  4H5W A;  1GLF O;  2DFH A;  3RMD A;  1YJW N;  4KFB A;  4H0P A;  2Y1I A;  5AQH A;  3AO5 A;  3OYA A;  3TAP A;  4IZ9 A;  2OTJ N;  3D45 A;  2DFE A;  1LWC A;  3MWP A;  1EQY A;  2FBV A;  4KH5 A;  1XQS C;  4BGB A;  4BRM A;  1WSH A;  1QZ5 A;  5AQJ A;  3HRG A;  4IKF A;  3O9Q A;  3O4Q A;  3T69 A;  4DLE A;  3NFA A;  1JXB A;  4LFC K;  1JLF A;  1WBD A;  1N6Q A;  3KLF A;  5M1K A;  4X65 K;  2PYL A;  3LDO A;  4AHC A;  4NLC A;  3EYZ A;  4JAX A;  1RBV A;  4E1J A;  3M3Z A;  4PUO A;  3DWL A;  3WXM B;  4AHU A;  1N36 K;  2YNH A;  4RCH A;  1GLC G;  1X9J A;  4CBX A;  2GEL A;  2A6A A;  2F9W A;  2HST A;  5KPZ A;  2QWQ A;  1U48 A;  2IS3 A;  3SAG A;  1NGB A;  3BUZ B;  3CHW A;  3THX B;  4RG8 A;  4DUZ K;  2ZQB A;  5HRP A;  1C0U A;  4LF6 K;  2DTU A;  4DF4 A;  1ZBU A;  3KK1 A;  4CF1 A;  4BDP A;  3P5J A;  4LFB K;  4JI3 K;  4FWO A;  5BN9 A;  2DY4 A;  4NCG A;  1WNS A;  1X3M A;  4BRA A;  3CET A;  3TSU A;  4DR4 K;  1VSJ A;  1I3A A;  3BZK A;  1HKB A;  4AF1 A;  4BC2 A;  5AQY A;  3P31 A;  3EZ5 A;  2WON A;  5JLF A;  2KKZ A;  3DLH A;  4FJM A;  4CED A;  4F3O A;  2G8V A;  4XH5 A;  3CYG A;  1TL3 A;  3I33 A;  4BRK A;  2XRI A;  1E4G T;  3WNH A;  5H1S Q;  3EY1 A;  1Q82 O;  4B9U A;  1ITG A;  4B08 A;  2W41 A;  4IO8 A;  4B1U B;  1NMN A;  4CZL A;  4DHY A;  4E3S A;  4JI4 K;  3LP3 A;  4E7H A;  3M1F A;  3J7Z O;  3FGU A;  4A57 A;  4M41 A;  4BR5 A;  4J2A A;  5CYM A;  3RTV A;  4FVM A;  1REV A;  1F21 A;  2VQE K;  3K59 A;  3CCR N;  4E1N A;  3AAP A;  3AVL A;  1TKX A;  2HMP A;  1HYS A;  3AGR A;  1M90 O;  2HHT A;  3THX A;  4GV9 A;  4JEP A;  4DTS A;  4MDA A;  5IWA K;  5AQV A;  1RT4 A;  3O9U A;  4XEI A;  4FJJ A;  4C1N K;  3S41 A;  3VQP A;  4CEC A;  4R5P A;  4N56 A;  2ZM6 K;  3LM2 A;  1K73 O;  1JL1 A;  2JWL A;  3MCP A;  4LSL A;  1HYZ A;  1J54 A;  2QWO A;  1OKJ A;  4CBU A;  3LDS A;  5E84 A;  3H1V X;  4BRQ A;  3FLC O;  3T3F A;  1GLD G;  3KIO A;  1G15 A;  2E1Z A;  3KLG A;  3CF5 L;  4AHR A;  3SUO A;  1WUA A;  1BQM A;  1NM1 A;  2YNF A;  4WFA L;  1YIJ N;  4JK8 A;  2HBM A;  2V7Z A;  3AVA A;  1JXE A;  3C6U A;  4FJK A;  1XC9 A;  4BAC A;  4K0K K;  1DEJ A;  1KCF A;  4DV3 K;  1BA0 A;  3O80 A;  1TK0 A;  4FLU A;  1VQ5 N;  5KI6 A;  4M3T A;  4CEE A;  4DQR A;  5EY4 A;  3MAQ A;  3TAQ A;  3E9O A;  3CG7 A;  3UKR B;  1N33 K;  4BY9 C;  4KPY A;  3QES A;  4EFH A;  2QK9 A;  2D0O A;  3DXK B;  3ASM A;  4DV6 K;  2Z1G A;  1YXQ A;  4JKH A;  1G99 A;  2IC3 A;  3NH2 A;  2O8E B;  3QEX A;  4JKD A;  1X9M A;  2P5O A;  3SNN A;  4O5B A;  5ADX A;  2Q0R A;  3IDH A;  3E9P A;  1ZBS A;  4K43 A;  3CJB A;  1VQ6 N;  3D6R A;  3F5T A;  3CCJ N;  3VPZ A;  4HHT A;  1FKO A;  2W6L A;  3TR8 A;  2XO7 A;  1BIZ A;  3HYF A;  1MWM A;  2P1J A;  4ISG A;  4KHU A;  3CCS N;  1YIT N;  4A62 A;  4WFN L;  3D2F B;  5AQK A;  3VQ5 A;  3R8E A;  4M7Y A;  4JI0 K;  4YDU A;  4MDB A;  3SZ2 A;  1HQU A;  1QSL A;  5FRM A;  4MLH A;  3V9U A;  3RWU A;  3MX2 A;  3AVB A;  3CCV N;  1C0M A;  5CY4 A;  3DLE A;  5GAD P;  2GUI A;  1I39 A;  1SV5 A;  3O8M A;  3SJH A;  3GBT A;  3PV8 A;  2RPI A;  1RDD A;  3U8X A;  4A5B A;  5JIC A;  3FZH A;  4CJL A;  1HMV A;  2QW9 A;  3CC4 N;  4E7I A;  5C2D A;  2FC0 A;  4JKF A;  4KH4 A;  1MA9 B;  1BDG A;  4H4M A;  3UKR A;  2V52 B;  1RTJ A;  4LF4 K;  1T03 A;  4FLV A;  4DS4 A;  1IJJ A;  3DXK A;  5IT9 O;  5M1O A; 
#chains in the Genus database with same CATH homology
 1HJO A;  5JVH L;  1W2B M;  1QHA A;  3RSE B;  3GL1 A;  4Y0W A;  5M1Q A;  4EHT A;  4BR9 A;  2J4R A;  4PKG A;  2QA4 N;  3MN5 A;  2QEX N;  3CPW M;  3IMX A;  5BR9 A;  5EXW A;  5KQ8 A;  2YX6 A;  3CJ9 A;  3VEZ A;  3CJ1 A;  4B1X B;  2NRH A;  4A2B A;  3C65 A;  1KAY A;  2E2Q A;  4IEI A;  4H5T A;  4BG9 A;  4BRL A;  2RE2 A;  1P90 A;  2V51 B;  3C7N A;  4FSV A;  4H5R A;  2P9N B;  5AQG A;  4R79 A;  5CE3 A;  4GV6 A;  2A41 A;  3P38 A;  4H03 B;  4IOX A;  3ZX3 A;  4FVU A;  5AQX A;  1YVN A;  1HUX A;  5AQT A;  1YHQ N;  1LCU A;  1JCG A;  2FSJ A;  1ZXO A;  4BQZ A;  1NWK A;  2Q1N A;  2C1I A;  3FR0 A;  2D1K A;  3CCE N;  4O8U A;  3HBT A;  3CMA N;  3FZF A;  3TTC A;  5GIO A;  3D2F A;  4M7X A;  1BUP A;  3VF2 A;  1N8R O;  3FZK A;  1S72 N;  3D2E A;  1K8K B;  3HZ6 A;  4BQL A;  4EHU A;  3H45 C;  1XC3 A;  3OA9 A;  1HLU A;  3E9L A;  3VTI A;  4BC5 A;  1HKC A;  3GOI A;  4B9Q A;  4QS9 A;  4BRD A;  4YDU C;  2HF4 A;  3EE8 A;  3EN9 A;  3UKU B;  3VGM A;  3R6M A;  5KPR A;  1JCE A;  1VQN N;  1HX1 A;  4LC9 B;  3VGL A;  4PKH A;  5BN8 A;  1DT9 A;  1ATN A;  2GUP A;  5GAE P;  4JK9 A;  1EO1 A;  4DKW A;  2QTD A;  3VET A;  2WFB A;  2WUS A;  3WXI A;  3MX5 A;  5FPE A;  4F9O A;  2F9T A;  2ITM A;  4CD3 A;  5GIP A;  3QBW A;  3AAQ A;  4NO7 A;  3I56 N;  3CER A;  3CCU N;  3CC2 N;  5AQP A;  1HPM A;  3P4I A;  3O4W A;  3NVK A;  2BUP A;  3O6W A;  2JWK A;  5LY3 A;  2KLA A;  5TKY A;  2NRT A;  3WT0 A;  3HI0 A;  1YAG A;  3MN9 A;  3E66 A;  1SS6 A;  4BEC A;  4FWM A;  3O9S A;  1NGH A;  5AQM A;  2P9I A;  3JXU A;  4YOX A;  4CI6 A;  1VQ7 N;  4JKG B;  1TYQ A;  1VQ4 N;  4B1V A;  5AQS A;  5C15 A;  4B1W B;  1NLV A;  2IVO A;  1E4F T;  3EZW A;  5GIN A;  1K9M O;  3RSE A;  3CPE A;  1D4X A;  4FWP A;  2VGM A;  2QWN A;  2HF3 A;  1XUP O;  5AZJ B;  3WQT A;  4BRG A;  4CJ7 A;  2NRR A;  3L4I A;  4CZJ A;  3CCM N;  3CQY A;  2HBJ A;  5EX5 A;  4JNE A;  5JLH A;  1NJI O;  5FPN A;  3ENO A;  3VES A;  3SK3 A;  3VEX A;  2YHW A;  2PAV A;  3OBY A;  2P9N A;  3CD6 N;  3CC7 N;  4FWK A;  1O13 A;  3A0I X;  1QZ6 A;  2NRW A;  4EAH D;  3FFK B;  4ISF A;  4FWL A;  3VF6 A;  3VMF B;  3EKS A;  3G4S N;  4DCH A;  1U6Z A;  1S22 A;  2Q97 A;  3Q7B A;  3WXL A;  5BPN A;  2QXL A;  4C23 A;  5M1F A;  2ASM A;  3LL3 A;  1NGA A;  3BF1 A;  3H3N O;  2GTD A;  1KC8 O;  3LDL A;  4A59 A;  1Q7Y O;  2E88 A;  5F0X A;  2NNW A;  1T6C A;  4FPB A;  1H1V A;  1RDW X;  4MO5 A;  4JKA A;  3UKU A;  4BVP A;  3MN6 A;  3UB5 A;  3O1W A;  4B1Z A;  5AQU A;  1DGK N;  1DKG D;  3LDQ A;  4NB4 A;  2ZJQ L;  2NRV A;  3T7Z A;  4H0X B;  2VWB A;  3O1B A;  3O08 A;  4KBO A;  5AQW A;  3R9P A;  3TTF A;  1QQM A;  3KVG A;  1QVF M;  4WCE L;  4JN4 A;  2QM1 A;  5EOY A;  2CGL A;  3WXJ A;  2H3G X;  3NMU A;  4BC3 A;  1YI2 N;  4FWQ A;  3ZEU B;  2AP1 A;  3ID6 A;  4BR2 A;  1SAZ A;  3EL2 A;  1C0F A;  3ATV A;  2AA4 A;  3L0Q A;  4BRN A;  1Z6R A;  1Z05 A;  3K9K A;  1VQL N;  4AM6 A;  3TPQ A;  5JMV A;  2E20 A;  3RVC A;  4BRC A;  3C6A A;  4XJX A;  3KWI A;  3TSQ A;  4C1N I;  3ENH A;  3NVM A;  4I6M B;  4ISE A;  3CME N;  4A2A A;  3ZET B;  4HTL A;  2ZGY A;  3A5O C;  3C6H A;  4JKG A;  3KK7 A;  3MN7 A;  4J8F A;  3ZX0 A;  2CH6 A;  3EE9 A;  5AQI A;  5F2R A;  5GAH P;  4PL7 A;  2Q2R A;  2V7Y A;  2IVP A;  3PIP L;  4HWI A;  3SLC A;  1U2V B;  5DM6 L;  2CH5 A;  2F7T A;  2E1Y A;  4U67 L;  4B1Y B;  5AZJ A;  2HOE A;  1ATS A;  1GLA G;  2ASO A;  4FWR A;  4Z94 A;  3U4L A;  1NGG A;  3VOV A;  3OHR A;  3CJC A;  4PL8 A;  2DPN A;  1KAX A;  2YJF A;  2QWP A;  3I8B A;  4H0Y B;  1YF5 L;  1IG8 A;  2P9U B;  4FO0 A;  3R1X A;  2P9L B;  4FWN A;  4H5W A;  1GLF O;  4BR0 A;  3R3L A;  1YJW N;  3A5L C;  4IWV A;  2NRX A;  4H0P A;  3CCL N;  2A40 A;  5TKW A;  1VQO N;  3HTV A;  5AQH A;  2C1G A;  2P9K B;  4IZ9 A;  5CR4 A;  2IIR A;  2OTJ N;  3MK6 A;  3MWP A;  5M1N A;  1EQY A;  4OO1 J;  3L6Q A;  4YOV A;  4WQ4 A;  2ZF5 O;  4KH5 A;  3CQX A;  1QQO A;  1XQS C;  1P8Z A;  2HBL A;  1Q18 A;  1QZ5 A;  2A5X A;  2QWM A;  4BGB A;  5AQJ A;  4BRM A;  3SBG A;  2I7P A;  3HRG A;  3WEE B;  5LJV A;  4CZE A;  3CJ7 A;  4CZM A;  2CGJ A;  1NMD A;  4CZH A;  3CXC M;  1RFQ A;  3SAF A;  3O9Q A;  5ADX H;  3T69 A;  1KQS M;  5DM7 L;  4K41 A;  3L4Q A;  5AQL A;  1VQ8 N;  5M1K A;  2QWR A;  3DXM A;  1NGI A;  3ENB A;  4OPA A;  4OPH A;  1TUU A;  2OAN A;  4YOR A;  5ELZ A;  1MWK A;  3LDO A;  3QDK A;  5AQN A;  5BRE A;  5AQZ A;  1M1K O;  4NLC A;  3ZEU A;  4BRP A;  4BE7 B;  4BRH A;  4JAX A;  1GLL O;  3VER A;  4H0V B;  1JJ2 M;  4E1J A;  3TU5 A;  2GWK A;  3M3Z A;  3U9Z A;  3QIC A;  3DWL A;  3WXM B;  1NGD A;  4CZK A;  1RDU A;  1BOT O;  1Y64 A;  1NBW A;  4RCH A;  3VEW A;  4I6M A;  3J8A A;  1GLC G;  3VGK A;  4A61 A;  1QVG M;  1X9J A;  3ZET A;  4QS7 A;  3GG4 A;  5HOO A;  1YJN N;  4CBX A;  1ZC6 A;  2GEL A;  2A6A A;  2ASP A;  3SBT A;  4BRE A;  2F9W A;  2HST A;  5KPZ A;  5C0Y A;  3MDQ A;  2QWQ A;  4GY2 B;  2GEM A;  1U2V A;  4CZG A;  4IO9 L;  3SAG A;  4K25 A;  2WC9 A;  1NGB A;  4WYB A;  3BUZ B;  3CHW A;  5KPT A;  3C0B A;  5AQF A;  1QQN A;  2P9U A;  2I7N A;  2P9L A;  3PIO L;  4K42 A;  4AM7 A;  4FWO A;  3ULE A;  3A8Y A;  5C12 A;  2KHO A;  5BN9 A;  2YJE A;  3QB0 A;  1X3M A;  1T3V A;  3CJA A;  1HKG A;  4ILH A;  2VYP A;  3CET A;  4BRO A;  4BRA A;  4BRI A;  2ZJR L;  3HOS A;  4IEE A;  2P9K A;  2HBK A;  3TSU A;  1J6Z A;  1S3X A;  1VQ6 N;  3LDN A;  1HKB A;  4AF1 A;  4BC2 A;  4PKI A;  4RWT A;  4IOC L;  5AQY A;  4WQ4 C;  1SQK A;  2Q36 A;  3H1Q A;  2YHY A;  3WEE A;  4RTF D;  3DXM B;  4GV3 A;  3P31 A;  4FOE A;  3OBW A;  2BH1 A;  4XH1 A;  5JLF A;  2KKZ A;  4WF9 L;  4IFE A;  4XH5 A;  3GDQ A;  4IXC A;  3VEN A;  3FZL A;  3GE1 A;  3IUC A;  1R59 O;  3O9T A;  5AQR A;  3I33 A;  3N4P A;  4BRK A;  1E4G T;  1Q82 O;  3SMS A;  5H1S Q;  2E2P A;  4FL9 A;  3WUH A;  3M5R A;  2W41 A;  4H5V A;  4IO8 A;  4BGA A;  1T6D A;  3ID8 A;  4B1U B;  1CZA N;  3F2K A;  2P9S B;  2YCH A;  1BU6 O;  3ATU A;  3K9J A;  4CZL A;  4DHY A;  3TTD A;  4BEB A;  4GNI A;  3M1F A;  5AQO A;  1VQK N;  3SAH A;  3J7Z O;  1ESV A;  3FGU A;  4A57 A;  5AZI B;  5KQD A;  4BR5 A;  4ILG B;  4H5N A;  2GWJ A;  3CCR N;  2EWS A;  3EKU A;  3JS6 A;  3DAW A;  4FWS A;  2ZJP L;  4JKC A;  3AAP A;  3O5B A;  4EIA A;  2QWL A;  1ATR A;  3W0L A;  2Q31 A;  1V4S A;  2HMP A;  3TSP A;  5FPD A;  4U7B A;  3AGR A;  1M90 O;  3D7E O;  4GV9 A;  4JEP A;  1BA1 A;  3AAR A;  4YOY A;  4DQ8 A;  2D0P A;  4MDA A;  3ULE B;  4G9Z A;  3KHY A;  3MCA B;  3O9R A;  4IJN A;  5AQV A;  3IKM A;  3B8A X;  3O9U A;  4CBW A;  2FF3 B;  4XEI A;  3UE5 A;  4QS8 A;  5FPM A;  4C1N K;  3S41 A;  1GLB G;  1K73 O;  5C2F A;  3LM2 A;  2JWL A;  3MCP A;  3N4Q A;  2IVN A;  3BEX A;  1BG3 A;  4JHD B;  4MLE A;  2QWO A;  1JCF A;  1OKJ A;  4CBU A;  5BRD A;  3P39 A;  3G6E N;  5E84 A;  4BR7 A;  3QBX A;  3H1V X;  4BRQ A;  3WXK A;  2E2O A;  3FLC O;  5AQQ A;  4BG8 A;  1GLD G;  5C10 A;  3AGK A;  1SZ2 A;  3EO3 A;  1NGC A;  2E1Z A;  3CF5 L;  1Q86 O;  1WUA A;  2P9P B;  4WFA L;  1NM1 A;  2WBN A;  1YIJ N;  4JK8 A;  4BRF A;  2HBM A;  4UY8 O;  2A42 A;  2V7Z A;  3FE1 A;  3AY9 A;  3IFR A;  3VEO A;  3ZX2 A;  3ZYY X;  1KAZ A;  3E1Y A;  3OW2 M;  2PBD A;  1VQP N;  1DEJ A;  2RHK A;  2NZT A;  4KH6 A;  2YHX A;  2FSN A;  5MLC Q;  1BA0 A;  1OVY A;  3O80 A;  3G71 N;  2BTF A;  3CI5 A;  3CIP A;  1VQ5 N;  1W97 L;  2CGK A;  5EVZ A;  4JD2 B;  2P9S A;  3MMV A;  3FZM A;  3PLA A;  5BRF A;  4H0O A;  5EY4 A;  4JKB A;  3U9D A;  3E9O A;  2NRZ A;  4O5F A;  4WQ5 A;  3UKR B;  4IJA A;  5BRH A;  4WFB L;  5B8H A;  4BY9 C;  3KZB A;  5AZI A;  4EFH A;  3A5M C;  2D0O A;  3DXK B;  4CD1 A;  5I9E B;  3LM9 A;  4IDH A;  4L3Q A;  1BO5 O;  3QML A;  5AFU H;  1YXQ A;  4JKH A;  4FOI A;  1G99 A;  4CZF A;  4NLB A;  3CCQ N;  4JKD A;  1VAZ A;  1VQ9 N;  2E8A A;  3QFU A;  3F9M A;  5LJW A;  5ADX A;  2Q0U A;  4GVE A;  2Q0R A;  3IDH A;  3E9P A;  1MDU B;  1ZBS A;  3G25 A;  2E2N A;  4K43 A;  3CJB A;  5AR0 A;  3H46 O;  3D6R A;  3F5T A;  4JKE A;  3I55 N;  3CCJ N;  3C7N B;  3QFP A;  2VCP A;  3VPZ A;  2D4W A;  4YOT A;  1NGF A;  5M1P A;  2FF6 A;  2QI2 A;  1LOT B;  1MWM A;  5F1X A;  4ILJ A;  1GLJ O;  4ISG A;  3KWG A;  3CCS N;  1Q81 O;  3HOT A;  2W40 A;  4JHD A;  1YIT N;  4A62 A;  3VTH A;  1WOQ A;  4IOA L;  4WFN L;  3D2F B;  1VQM N;  4XH4 A;  4O8K A;  5AQK A;  2OTL N;  3HSC A;  4H0T B;  3WQU A;  3R8E A;  3D2E B;  1GLE G;  4JK7 A;  2UYT A;  4M7Y A;  2W00 A;  1X3N A;  4YDU A;  3SMP A;  4MDB A;  4PHT X;  1NGJ A;  2FSK A;  2ZGZ A;  3BP8 A;  4YOU A;  4BC4 A;  3LDP A;  3DLL L;  1RGI A;  3H3O B;  3MWT A;  3Q7C A;  4MLH A;  1TUY A;  4M63 C;  2P9P A;  1K8K A;  2FXU A;  3VEV A;  5GAG P;  4FPA A;  1V4T A;  3HM8 A;  1YJ9 N;  1NGE A;  2GX9 A;  2YI1 A;  3MX2 A;  4BR4 A;  5AFU A;  2ZWH A;  3CCV N;  5CHI A;  5GAD P;  1BWF O;  3O8M A;  3SJH A;  5BPM A;  1YUW A;  3GBT A;  3H6E A;  5JIC A;  1KXP A;  3U8X A;  4A5B A;  5E26 A;  2A3Z A;  3FZH A;  2QW9 A;  3CC4 N;  5C2D A;  5JVG L;  3W3D A;  4JKF A;  4KH4 A;  1ILY A;  1MA9 B;  1T44 A;  1BDG A;  2PFU A;  4JD2 A;  2NLX A;  5HL7 L;  1K8A O;  3M6G A;  1C0G A;  3UKR A;  2V52 B;  4BVO A;  2FLO A;  4WQ5 C;  3VEY A;  2P9I B;  3VF4 A;  1IJJ A;  3DXK A;  4CZI A;  5BPL A;  1TYQ B;  3A5N C;  4MO4 A;  4A5A A;  4YOW A;  3DJC A;  1KD1 O;  5M1O A;  4DB3 A;  2VGN A;  3BF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...