2P9SA

Structure of bovine arp2/3 complex co-crystallized with atp/mg2+
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
414
structure length
397
Chain Sequence
b'AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
molecule tags Structural protein
source organism Bos taurus
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
total genus 127
structure length 397
sequence length 414
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 2p9sA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9sA04
3BUZB 3L6QA 4JHDB 2VWBA 4A2AA 2YCHA 3VEVA 4B1VA 3C7NB 4L3QA 4WQ4C 4BRAA 2NRHA 5AZIB 4HWIA 4FWRA 5JLFA 3L4IA 3VGKA 2P9IA 5AR0A 4CJ7A 3UKUB 4BROA 5E84A 5BN9A 4K43A 5AQQA 5AQVA 3UKUA 5AQZA 2F9WA 3AAPA 3I33A 2IVPA 5E26A 3R9PA 1V4TA 1BU6O 3A8YA 3VGMA 3WT0A 4H0OA 3LDLA 3IDHA 3SMPA 3D7EO 2P9PA 5AQMA 1ZC6A 3QDKA 4BRNA 1LCUA 3MMVA 4B1YB 1KXPA 4BRLA 4BRCA 1Z05A 4MO5A 4PKHA 4BR0A 4NO7A 2V52B 3UKRB 2P9NA 3LDNA 1NBWA 3U8XA 1MA9B 4YDUC 3S41A 1MWKA 2YI1A 4BG9A 1SAZA 2P9NB 3QFUA 4BRFA 5AQGA 1Y64A 1TUYA 3M6GA 3CETA 3IFRA 4BRIA 5AQXA 3WQUA 2FF3B 4BR5A 3M3ZA 1CZAN 1IG8A 3C0BA 1U2VA 3WQTA 4FPAA 3IUCA 2GTDA 4H5NA 2GELA 4LC9B 4A2BA 3DJCA 3ZEUB 3FR0A 4BRGA 1HKGA 4IO8A 4CZHA 2V7ZA 1NGFA 3U9ZA 5EX5A 1NM1A 2ASOA 1ZBSA 3O1WA 1KAXA 3EN9A 3ENOA 2A42A 1QZ5A 1XUPO 3A5NC 3MN5A 4BRPA 5AQWA 4CZFA 4CBXA 1BOTO 4BQZA 1S3XA 2W40A 3BP8A 3CJ1A 4ISFA 5BRDA 5KQ8A 5EXWA 5BPNA 4H0PA 5ELZA 1ATSA 2H3GX 4ISEA 4PKIA 3VF6A 3WXIA 1MDUB 4CZEA 2WUSA 3ZX3A 1KAYA 2BTFA 4O5FA 4CD3A 2YHXA 1NGAA 3SK3A 4EHTA 2FSJA 2P9IB 1BO5O 3DAWA 3VEYA 4PKGA 4QS8A 4JAXA 3SLCA 3MN7A 1BA1A 2CH5A 3VF4A 4BR4A 1G99A 2OANA 3ATVA 2IVOA 4EIAA 5EVZA 1K8KA 4AM6A 3O4WA 2P9UA 3DXMA 4BC3A 1V4SA 2HOEA 4A62A 4H5TA 5F2RA 3VOVA 2V51B 3FFKB 3C7NA 4B1UB 3MN9A 4FWMA 3H6EA 2ZF5O 3H45C 1T6DA 2Q0UA 4PL8A 5B8HA 4CD1A 1WOQA 3DXKA 2YHYA 3LDOA 2P9SB 4PL7A 2QWNA 4M7XA 1NGJA 1BDGA 2W41A 4J8FA 4H0TB 3A5OC 2IIRA 2IVNA 1BWFO 4BRKA 4BGAA 1QZ6A 1ATRA 2P9LB 3CJAA 3O5BA 3DXKB 3UKRA 1YUWA 4H5VA 2P9KB 2KHOA 4H0YB 2E88A 4FWQA 4FO0A 5CE3A 1GLAG 3B8AX 4NB4A 4K41A 2YHWA 3R8EA 2ITMA 4JNEA 3ZEUA 4BQLA 3FZKA 2D4WA 3QFPA 4M63C 4BVOA 1GLFO 2CGLA 5AQIA 5TKYA 3P4IA 2HMPA 3OHRA 4IZ9A 4BREA 1XQSC 3KZBA 1D4XA 3D2EB 2GWKA 5LJVA 1SZ2A 3WXKA 2J4RA 5AQSA 3BEXA 4Z94A 5AZJA 4JD2A 3O08A 3BF3A 5AQYA 4RCHA 2VYPA 5AZJB 3O8MA 2A41A 1H1VA 2Q2RA 3CERA 3CQXA 3TU5A 3TPQA 2FSKA 1JCEA 4FWLA 3J8AA 2E1YA 3HM8A 1ZXOA 3HI0A 4HTLA 4CZIA 4GNIA 2Q36A 3QB0A 4IXCA 3FE1A 4FWOA 1GLBG 1X3NA 3FLCO 1HKCA 2ZGYA 2F9TA 4JD2B 3L0QA 3U4LA 4IJNA 2D0PA 2CGKA 3SJHA 2A6AA 5BRFA 5AZIA 5JICA 2E1ZA 3QICA 1NGIA 1BG3A 4C23A 3LDQA 3MK6A 2QW9A 3DXMB 2Q0RA 4BR2A 2D1KA 5FPNA 4IWVA 4FWNA 4BRDA 5AQRA 3WEEB 2Q1NA 3H1QA 1TYQA 3ENHA 2PAVA 1GLLO 3RSEB 3EZWA 4I6MB 4AM7A 4CBWA 3CI5A 2A40A 2V7YA 3CJCA 4DQ8A 3QMLA 5AFUH 1NLVA 3HZ6A 1S22A 3ATUA 1X9JA 5KPRA 3G25A 1TYQB 3SMSA 3VEOA 4XH4A 5AFUA 3VEWA 3RSEA 3ULEA 4CZKA 1BUPA 1WUAA 1JCGA 5KPZA 1NWKA 1DGKN 5KPTA 3EKSA 5AQUA 2ASMA 3I8BA 2QXLA 4K25A 3HTVA 3VEXA 4IJAA 2P9LA 3ZETB 4KBOA 3QBXA 4O8KA 3FZMA 4DB3A 1NGCA 4E1JA 3EKUA 5BPMA 3WEEA 2P9KA 1XC3A 2P9SA 3KHYA 4BC5A 3VERA 2BUPA 4Y0WA 3FZLA 3GDQA 4BC4A 4EHUA 1DKGD 3ZETA 3DWLA 1E4GT 5AQOA 2EWSA 2GUPA 3GE1A 4B1WB 3VF2A 4MO4A 3AY9A 3BF1A 5F1XA 2E2NA 1BA0A 1ATNA 1C0GA 2YJEA 1QQNA 3JXUA 4BRHA 5FPEA 3MDQA 3EO3A 1HUXA 1T44A 1TUUA 5AQNA 3CJ7A 4BR7A 2A5XA 4QS9A 2A3ZA 2UYTA 4FSVA 5I9EB 4XEIA 3GBTA 2GWJA 5AQTA 2YJFA 2FXUA 4JN4A 2Q97A 1U2VB 2HF3A 1YAGA 1QQOA 4WQ4A 3AARA 3CJBA 3H1VX 1KAZA 3H46O 3MCPA 5AQFA 2QWRA 3LDPA 1U6ZA 3H3NO 4H03B 2E8AA 1T6CA 2FLOA 1YXQA 2I7NA 3QBWA 5FPDA 1GLEG 1NGHA 3MN6A 5LY3A 4K42A 4CBUA 5ADXA 2D0OA 2E20A 5AQJA 1Z6RA 2NLXA 3WUHA 2I7PA 1HLUA 5ADXH 3GL1A 2QM1A 4BR9A 2QWLA 3GG4A 4MLEA 3ZX2A 1SQKA 4BRQA 4F9OA 4WQ5C 4H0VB 3UB5A 5JMVA 4RTFD 1NGDA 1Q18A 3ID8A 4I6MA 4BG8A 2P9UB 4H5WA 3VEZA 3H3OB 1OKJA 2E2OA 2GEMA 3U9DA 1ESVA 5BPLA 1DEJA 4XH1A 2AP1A 4CZJA 3WXLA 3UE5A 1X3MA 1K8KB 4FWPA 3A5MC 4DCHA 3FZFA 3LM9A 3HSCA 4FOIA 4WYBA 4B1XB 5FPMA 3GOIA 2QWPA 3LM2A 3M1FA 3VPZA 5BR9A 4BRMA 1RFQA 3JS6A 3ULEB 2CGJA 3FGUA 2P9PB 3EL2A 3LL3A 5F0XA 3A5LC 4FPBA 5JLHA 4H5RA 4QS7A 2NZTA 4BVPA 2E2QA 3VESA 5AQKA 4FWSA 2E2PA 1QHAA 2HF4A 2QWMA 4B9QA 3WXJA 3D2FB 1P8ZA 4M7YA 2QWQA 5AQPA 5LJWA 2DPNA 1R59O 5BRHA 3R6MA 3AAQA 3D2FA 1HX1A 2FSNA 3CQYA 3FZHA 3D2EA 4XH5A 1C0FA 2Q31A 2FF6A 3VGLA 4B1ZA 4YDUA 1GLJO 1QQMA 4WQ5A 4EAHD 1IJJA 4CI6A 5AQLA 2CH6A 3W3DA 5AQHA 1RDWX 5EY4A 3VETA 3O80A 1NMDA 3CHWA 4FL9A 5EOYA 3W0LA 1LOTB 2ZWHA 2QWOA 3F9MA 4BC2A 4RWTA 3O1BA 4H0XB 2AA4A 5KQDA 1GLCG 1EQYA 4GY2B 3KVGA 4CZGA 5BN8A 2PBDA 4DHYA 4CZLA 3CIPA 1J6ZA 1HJOA 1NGBA 1E4FT 1MWMA 2ZGZA 4CZMA 1HKBA 1RGIA 3CJ9A 4JHDA 1YVNA 4A61A 1NGEA 3A0IX 3O6WA 1HPMA 1NGGA 3HBTA 5BREA 3VENA 4EFHA 4FWKA 2VCPA 4MLHA 4FOEA 4ISGA 3ZX0A 1JCFA 4BGBA 1GLDG 2ASPA 3IMXA
chains in the Genus database with same CATH superfamily
2YCHA 3WXMB 3C7NB 4L3QA 3CPWM 2NRHA 1UA1A 1U4BA 3RRGA 3WNGA 3L4IA 3VGKA 3PUFA 5AR0A 1QSLA 3UKUB 4X64K 2X6NA 1EXQA 4Z4FA 2F9WA 3TAMA 3KD5E 4F3TA 2HNZA 1VAZA 3I33A 3JYTA 3VGMA 4CJFA 5GINA 1BI4B 3D7EO 4CHNA 3WNEA 4E7JA 4BRNA 4CGFA 1LCUA 3OYGA 3AVKA 4B1YB 4FM2A 4EZ6A 4I2PA 1Z05A 4NLBA 2HNDA 3UKRB 4LD0A 3VN5A 1NBWA 3U8XA 1GOBA 1MA9B 3S41A 1LAWA 2YI1A 4BG9A 3CM6A 4BRFA 3SJJA 3VQQA 1S5JA 3B6OA 2XRIA 1TUYA 1TKDA 3CETA 3PY8A 4CK1A 4BRIA 2YX6A 2BANA 1GOCA 3CC2N 1UOCA 3C0BA 4DU3A 1WB9A 3QEVA 1UAXA 1Q81O 4FK4A 4B8AB 1T03A 3IUCA 4LC9B 3QERA 4A2BA 4IFVA 4BRGA 4JKDA 3THXB 2V7ZA 2PFUA 3U9ZA 1NM1A 2UXDK 4YORA 3THWB 4CJSA 3AVMA 4JI5K 1JKHA 4GVEA 4BRPA 1XNQK 1RBUA 4CZFA 5BRDA 4ISFA 2W40A 3BP8A 4JYAK 2HSTA 4UQGA 3KK1A 4AHSA 4DF4A 1QSSA 4H0PA 1DLOA 1OH8A 4A57A 3ZSOA 3RTVA 4LH4A 2BTFA 2FSJA 2UU9K 3DAWA 3THYA 4PKGA 3ASMA 4JAXA 3SLCA 3MN7A 4O8UA 3NCIA 3QEPA 3RMDA 2B6AA 3AA5X 1G99A 3RVCA 2OANA 4M3RA 2G8FA 2VGMA 3Q7CA 4EIAA 1XHZA 1EWRA 5EVZA 1YJ9N 3BY5A 2AJQA 3T1AA 4A62A 4M3ZA 1FKPA 4BDPA 3FFKB 5GAHP 3C7NA 3ZSXA 5C25A 4K8ZA 3MN9A 1YT3A 3H6EA 3P83D 1J53A 5JENA 3PIPL 5B8HA 3OYBA 4DR4K 3ZT0A 4OPKA 2QWNA 1T05A 4M7XA 1NGJA 1BDGA 4LSLA 4J8FA 5J2NA 2WOMA 1XWLA 4AILC 3ZSVA 1HNIA 2OPQA 4I9QA 4BGAA 4JRPA 4IBNA 1RCHA 1HR0K 1RT3A 3L4QA 4R79A 2YKNA 2Z1HA 2KHOA 3AGRA 4LF8K 4IG0A 4FWQA 4FO0A 4I9LA 2NUBA 1GLAG 2OTLN 3VQ8A 4KHWA 1JXEA 3LWMA 4BQLA 5AJ3K 2YNFA 4BVOA 3NDKA 2CGLA 4IDHA 4CCHA 5M1KA 1XQSC 4C1NI 4WE1A 3NF7A 2P5OA 3WNHA 1RDDA 3DOKA 2GWKA 5LJVA 2OA8A 1CZBA 2HHQA 4CESA 3N4QA 2J4RA 4CERA 4FK0A 4K0KK 1NMNA 5AQYA 4RCHA 2VYPA 4B8CA 3OBYA 4NCAA 3NH0A 3C6AA 3E1YA 4JI8K 3CERA 4DQRA 5FDLA 3HVTA 4FWLA 2HBMA 2Q36A 3QB0A 4IXCA 5DMRA 1GLBG 3U6FA 4CGIA 3K57A 4JD2B 4IJNA 2A6AA 3DOLA 4KHUA 1C6VA 4O44A 2YNHA 1JLGA 1EO1A 1NGIA 3MXIA 1W97L 4KHYA 1XMOK 4RW4A 3OYEA 3DXMB 2Q0RA 3BZKA 4FVUA 4IWVA 3AO1A 3CFPA 3WEEB 3CFOA 2HBKA 2OZSA 3H1QA 1TYQA 3LP2A 3RSEB 3I8DA 3J7AP 2DFFA 4W5TA 1HNVA 3NE6A 1ZBLA 1BCOA 3VQCA 3HZ6A 3TAGA 3G25A 4LH5A 3SMSA 5AFUA 2JLEA 4DU4A 1J5EK 4KKOA 3OA9A 1XC9A 4JEPA 1NK4A 1JCGA 4AHCA 3I0SA 2BGGA 4JI1K 4LF9K 1RTJA 2QXLA 3HTVA 4Z4CA 4IJAA 3OYAA 5HBMA 4E7IA 1KLNA 2XY6A 4DB3A 1N8RO 1VQ4N 2Z1JA 1KC8O 4E1JA 4JKGA 5DK5A 3C6UA 1XC3A 4N56A 3QEWA 3SUQA 3E9PA 3JAMO 1RT7A 2O8FB 2F4VK 5IT9O 3VF2A 1RTIA 3CCUN 4I2QA 4YNQA 3BF1A 4CFCA 5F1XA 4Q0BA 3O4NA 1ATNA 4HUEA 1C0GA 2YJEA 3KD1E 4BRHA 3KLEA 1VQON 3MDQA 3HOTA 1T44A 3M5RA 1HYSA 1TUUA 1VSMA 4FJ8A 1HYVA 4A59A 1WBBA 2UYTA 4FSVA 3GBTA 1OH5A 1IKVA 3CM5A 2Z1GA 4OGCA 2HHUA 1KFDA 3QNNA 4DTPA 2OPPA 5CYMA 1YAGA 1QQOA 1ASUA 3NH2A 3H1VX 3AVBA 3CMAN 3QIOA 3AVIA 2E8AA 3VTHA 4CJ4A 3QETA 4LF5K 4OLAA 1JLCA 2I7NA 5LY3A 1GLEG 4DTJA 3AA2A 2DFEA 3ZLJA 2NLXA 3WUHA 2ZD1A 4CGGA 3SYZA 4PUOA 2F8TA 2RHKA 5ADXH 4MLEA 3ZX2A 4CEAA 3MEEA 4F9OA 4FVMA 2PY5A 3ZSRA 4CJQA 2NRZA 1NGDA 1Q18A 2YV0X 3VEZA 3TAFA 4FJJA 4W5OA 5C24A 4A5BA 1TVRA 3U3GA 2LSNA 4CZJA 4FM1A 1K8KB 3C94A 4FWPA 3RWUA 4DCHA 4CJRA 3FZFA 3LM9A 3CFRA 4PY5A 4KTQA 4FOIA 5M1OA 1W2BM 3P39A 4GMJB 3LPUA 4JK8A 3SBTA 1TKTA 3VPZA 4ELTA 5BR9A 4ELUA 1RFQA 4LF7K 2P9PB 1VHXA 3LL3A 3TSQA 4C1NK 4W5NA 2ZJPL 3PX4A 1J9AA 2NRRA 3NF8A 2YNGA 3SAGA 4G1QA 3VMFB 4CGJA 5AQKA 1IO2A 4B9QA 3WXJA 4WFBL 1N32K 4MFBA 3CCEN 5BRHA 3AAQA 1VSJA 1O13A 2FSNA 2NRXA 2BH1A 1C0FA 2FF6A 4IFEA 4O0JA 2FBVA 4KHNA 4CFBA 3NF9A 1QTMA 3CHWA 2HHIA 5HP1A 1LOTB 2QWOA 4Z4EA 3LANA 3O4QA 3UIQA 1EQYA 4GY2B 4Z4IA 4CZGA 5BN8A 3PX0A 2PBDA 4DV3K 1WSIA 3CIPA 1J6ZA 1S6QA 1HJOA 4X62K 4FM0A 2KKZA 3LZJA 4FJLA 3MX2A 5HOOA 3O9QA 1MWMA 2PYJA 1ZBHA 1RT6A 2UXBK 1L3UA 4JHDA 1WSJA 1UWBA 3OY9A 3D45A 4NLCA 3A0IX 1SL0A 1VK0A 3MECA 1WLJA 3LALA 4EFHA 4AF1A 2OTJN 4MLHA 1RBVA 2XO7A 3ZX0A 4BGBA 3J80O 2RKIA 3L6QA 3VEVA 4FLYA 3DLHA 5AZIB 3TAQA 2E6MA 1Q9XA 3M8RA 1BI4A 1VQ5N 1KD1O 1J54A 3SI6A 5E84A 3RR7A 5BN9A 3EE8A 3OYDA 5AQZA 3AAPA 1YTUA 4FLWA 2IVPA 5E26A 5JVGL 1BU6O 3IDHA 4CJKA 4Y1CA 5KTQA 3OS2A 3TAPA 3QDKA 3ZSWA 3CMEN 5MLCQ 4BRLA 4YOXA 4EP4A 4PKHA 4MO5A 3V9SA 2V52B 2IOCA 3K59A 3P1GA 4PWDA 3DLLL 1SKRA 1TKXA 2OCEA 1M90O 1LV5A 4AHUA 3NAEA 2VQEK 4K8XA 3NVMA 3IAYA 4ICLA 3M3ZA 4E0DA 1S6PA 1IG8A 3ULDA 5J2MA 4FJIA 4KH4A 2GTDA 3AV9A 3DRSA 3FR0A 1HKGA 4CZHA 1NGFA 5EX5A 5C12A 2ASOA 1ZBSA 3EN9A 2ZQBA 2A42A 3A5NC 4NCGA 2VG6A 1NJYA 3DLGA 3G0ZA 4JK7A 4FXDA 3NH1A 2G8HA 5AQWA 4CGHA 3IKMA 2OYQA 5DM6L 1WAJA 5KQ8A 5C15A 5BPNA 4DTOA 1SL2A 3KWGA 1D9FA 4NYFA 4JKEA 3VQ5A 3WXIA 1MDUB 4CZEA 1OH7A 2Q3SA 4GKKK 3HSTB 1KAYA 4M42A 4BDZA 4C8MA 2P9IB 1QHTA 3S3OA 3DLRA 4QS8A 4N47A 1VQNN 1B9FA 1KVCA 2F7TA 2CH5A 4BR4A 3QEIA 1NK0A 3QESA 3O9RA 3ZT4A 4IFYA 1C0UA 1MU2A 3F2KA 3O4WA 4CEFA 2R7YA 3MEDA 3RMAA 3E01A 3VOVA 2V51B 4OJRA 3MCAB 1RT5A 1NKCA 1VSHA 5M1NA 4FWMA 2XY8A 5I42A 2OPRA 1FK9A 3LDOA 4PL7A 1NJIO 4LFAK 2W41A 1WSFA 3DI6A 4IOAL 4ZHRA 2HHXA 4YOUA 2P1JA 4YOVA 1IBLK 3CJAA 3O5BA 4CJEA 5M1QA 4KB1A 3DXKB 1X9MA 1YUWA 4RG8A 3DLBA 5C2FA 2KTQA 3B8AX 4FLXA 3LP1A 4DV6K 4JNEA 4DLEA 3QFPA 5TKYA 3LDSA 4I7FA 3OHRA 4IZ9A 4YOTA 2KQ2A 3D2EB 4BWJA 4JKBA 3CCJN 5C10A 4LSNA 3J81O 1K6YA 4CJUA 1NOYA 3BEXA 3ZSYA 5AZJA 4O0IA 3O08A 3QO9A 4CJWA 5AZJB 4DLGA 2D5RA 4M3UA 4G9ZA 2Q2RA 1K9MO 2FSKA 3VQAA 2E1YA 1ZXOA 4HTLA 5CR4A 3T3FA 3FLCO 2NRTA 1HYZA 3MXMA 2F9TA 1JL2A 5CY4A 1BHLA 3PV8A 4CF0A 3L2UA 2CGKA 3L2WA 3SJHA 3OW2M 2O8DA 5AZIA 3QICA 1BG3A 4DG1A 3MK6A 4H4OA 4B9MA 1IH7A 4Y1DA 1L3SA 3ZT3A 1DT9A 1EP4A 4IEIA 4FZXC 3HO1A 3ALYA 4DSIA 1A5VA 4DKWA 4BRDA 4KI4A 2Q1NA 2O4GA 1SKSA 3RRHA 2V7YA 4F8RA 4CK3A 1NLVA 1VSLA 1VQ9N 4IOCL 3OYNA 1TYQB 4XH4A 3KTQA 3PLAA 3RSEA 1WBDA 3ULEA 1BUPA 1WUAA 2QTDA 1VQ7N 5KPZA 5KPTA 5FRNA 3EKSA 2ASMA 1LAVA 4Z4GA 2WFBA 3K2PA 4HVJA 2P9LA 4KBOA 3QBXA 4DSJA 1S9GA 3EKUA 4IOXA 4KB0A 3KHYA 1RT2A 4DV1K 3VERA 2BUPA 2IAJA 4B08A 4FJNA 4HUGA 1VSEA 4EHUA 1XHXA 1NJXA 1E4GT 2C1GA 1Q7YO 4LF6K 2EWSA 2GUPA 2IC3A 4MO4A 3CCVN 2O8FA 1N34K 1NK8A 2HMIA 4IEEA 4DF8A 1QQNA 2VGNA 5FPEA 3VQ7A 3VA3A 1IKWA 1HUXA 4KFBA 5AQNA 3WNFA 2FBTA 3NGZA 3THXA 4J2EA 4BR7A 3LP0A 5I9EB 3ZYYX 3VQ4A 4B9VA 2FXUA 4DR2K 2G8VA 3H08A 4WQ4A 4YHHK 3H46O 1KQSM 3MCPA 2GX9A 5AQFA 3RMBA 1T6CA 2QXFA 4E7LA 2BE2A 3V4IA 4CJVA 1YXQA 3KKRA 4DQQA 4MDAA 4K42A 3C95A 2D0OA 2FBXA 5J1EA 1C1BA 1QS4A 2HVIA 4BR9A 5I3UA 2QWLA 1VSFA 3GG4A 4BRQA 2KW4A 2FC0A 3CCLN 4E89A 3O9UA 4BG8A 2P9UB 3V81A 2E2OA 3DRPA 4LFBK 4XIUA 3WXLA 4OO1J 3A5MC 5CZ2A 5C2DA 4QCLA 1RBTA 4CW7B 4WF9L 2QWPA 4HTUA 4BWMA 4M41A 3OTOK 4BRMA 3JS6A 4EZ9A 1N33K 2ZE2A 3TAEA 4L8RB 4CHPA 3HOSA 4FPBA 5JLHA 1NJWA 4H5RA 3TWHA 4DQIA 4BVPA 3VESA 2G8IA 3OYMA 2QWMA 4CK2A 3K9KA 3KIOA 1W0HA 2O8BA 4B9TA 4CJTA 1R59O 1WN7A 3R6MA 2HHSA 2RN2A 4FLTA 3CXCM 1HX1A 3OBWA 4IKFA 4N5SA 3FZHA 1IV0A 4YDUA 1GLJO 4WQ5A 3AVLA 5AQLA 2JGUA 3W3DA 4M3WA 2FBYA 5EY4A 1LW0A 3O80A 3LWLA 1A5WA 1NK9A 5FROA 3W0LA 1C0MA 4H0XB 4LF4K 5KQDA 1YHQN 4NCBA 3THWA 4M3XA 1G15A 3K5MA 2JWLA 2PYLA 1ASVA 3EYZA 2Z1IA 3E9OA 3AO2A 1OVYA 4F4KA 1CXUA 1E4FT 3VTIA 2ZJRL 3AVGA 3AO5A 3MX5A 1C1AA 1IBKK 1KVAA 1BIZA 1S1TA 4A61A 4X65K 3P38A 4Q5VA 1LWFA 3T7ZA 4YOYA 1S72N 3VENA 4DFMA 4FWKA 4KV8A 3R3LA 4ISGA 4ILGB 3HPOA 1TK8A 1E3MA 1SL1A 3IMXA 4JHDB 4A2AA 2VWBA 5SZTA 2ZM6K 4HWIA 3NGIA 5JLFA 2WTUA 1J5OA 2P9IA 4JKAA 3TTCA 4CJ7A 4OPAA 4BROA 5LMNK 2B4JA 4OX9K 1YI2N 4K43A 3UKUA 1RBSA 4KHQA 1V4TA 1O1WA 3BZCA 3WT0A 1Y97A 3LDLA 5AQMA 3NHGA 3NVKA 1ILYA 3MMVA 4BRCA 3OYHA 4HCCA 3OYIA 4HHTA 1BISA 2EHGA 4FW1A 1RT4A 3E9LA 3KLHA 3OJUA 3HJFA 1WSEA 4E7KA 4MDBA 4KTZA 4CIEA 1VRUA 4QAGA 4FJKA 1WSGA 4ZTFA 5AQXA 4B9LA 1JLQA 3WQUA 4EP5A 1NKBA 2HHHK 4BR5A 3HM9A 3SQ2A 4CHOA 1VSIA 1BQNA 1U2VA 4DS5A 3WQTA 3G6EN 4H5NA 3V9WA 3C65A 2GELA 4H8KA 3DJCA 3ZEUB 1TL1A 4IO8A 1W7AA 4CE9A 4GV9A 5HL7L 4JS5A 1KAXA 1VQPN 3ENOA 3MN5A 4AHVA 3DM2A 4BE7B 3V1RA 3D0PA 4CBXA 1BOTO 3HP9A 4BQZA 1UA0A 3CJ1A 4E72A 4O5BA 3AVFA 5ELZA 1ATSA 2H3GX 4ISEA 4JI6K 3VF6A 3I56N 4ELVA 2WUSA 3SZ2A 1TK0A 3SQ1A 4DSFA 4O5FA 4CD3A 4KTWA 2QKBA 4EHTA 4DWIA 2KFZA 3VEYA 5JS1A 3HL8A 1BA1A 1RTHA 4FJ5A 3VF4A 4J2AA 1HQUA 4GW6A 2IVOA 4M45A 1K8AO 2HOEA 3SPYA 1DTQA 1S1UA 4N76A 5F2RA 1EKEA 1ZBIA 2O8CA 1VSDA 3TR8A 4B1UB 3O9SA 5HRPA 4KH5A 3VQ6A 4FZYA 4CEDA 2B5JA 3FFIA 1T6DA 4C8NA 3K5OA 5C42A 4WFAL 5KGXA 2DY4A 2YHYA 3P31A 2IDOA 2P9SB 4H0TB 1LWEA 3A5OC 4FJHA 2IIRA 1OH6A 1QZ6A 4YOWA 4FLVA 5M1FA 2HHWA 4JV5K 3UKRA 3S9HA 3SQ0A 4H0YB 3OS1A 3KLFA 1K73O 3VQEA 4K41A 2YHWA 2ITMA 4JKGB 3FZKA 1KVBA 4PA1A 1NK7A 5AQIA 1YTAA 3P4IA 3SV4A 4M3YA 4OGEA 4BREA 1S9EA 2O8BB 5CZ1A 2XHBA 3TSUA 2Y1IA 3V9UA 3CYMA 1SZ2A 3EEQA 3IRXA 3WXKA 5AQSA 4J2DA 4Z94A 1Q8IA 4CF9A 3ZSZA 3CCMN 1FKOA 4CEEA 3O8MA 1F21A 2A41A 3TU5A 3TPQA 3K0SA 1JCEA 3J8AA 1RDAA 3HM8A 1M1KO 5J2PA 3ZSQA 3FE1A 4FWOA 1X3NA 1HKCA 2ZGYA 3K5LA 2WBNA 3L0QA 3AO4A 2NRVA 2D0PA 4KRFA 2HNYA 4FZZA 3L3UA 3MWPA 3LDQA 4QOZB 4LY7A 2QKKA 3VQBA 4CIGA 4RW9A 2YHAA 4BR2A 1RDUA 4B3MK 4KO0A 4HCBA 3V1QA 3RMCA 4FWNA 2RF2A 3N4PA 5FLXO 5AQRA 4AQYK 2O8EA 3AA3A 3ITHA 4IG3A 1REVA 4CHYA 2PAVA 1IKYA 4I6MB 4CBWA 3CI5A 2KFNA 2A40A 4DV4K 3CJCA 3HT3A 1RBRA 4DQ8A 3QMLA 5AFUH 4OVLA 1BGXT 1QVFM 1C0TA 3ATUA 3HK2A 4DSKA 3SPZA 1YJWN 3VEWA 1IKXA 4OPHA 1TGOA 1NWKA 4JK9A 4BACA 5AQUA 4PQUA 3I8BA 3ID6A 3FZMA 3CPEA 3C6TA 1JLFA 1NGCA 3OYFA 1XMQK 4CEBA 3C6HA 5BPMA 2P9KA 4FJMA 3SNNA 2DFHA 3T1YK 3OYLA 4NXNK 2P9SA 3HRGA 4Y0WA 3FZLA 1ITGA 4ILHA 1DKGD 3ZETA 3DWLA 3TANA 4DMNA 4CHQA 4B1WB 3OYJA 1HJRA 2W42A 4KH6A 3AY9A 5E41A 2VG7A 3ZT1A 3KLIA 4Z4HA 3SUPA 1DTTA 3K58A 1KCFA 2X74A 4OKKA 1CLQA 2VWKA 3EO3A 3AVHA 2A5XA 5SWMA 1L5UA 4KHPK 5LMUK 1BQMA 1Q82O 2GWJA 5AQTA 2YJFA 4DR6K 4JN4A 2Q97A 5GAEP 2HF3A 3B6PA 5LL6Z 4DS4A 2QEXN 3CJBA 1KAZA 2ATQA 2QWRA 3LDPA 1U6ZA 3H3NO 1L3TA 5KI6A 3HXMA 2FLOA 3DLKA 3QNOA 1RDCA 3KWIA 4JKCA 1NGHA 3MN6A 4E1NA 3L3VA 2KZMA 4DR5K 3HYFA 5ADXA 4AH9A 2HBJA 2WONA 4ZTJA 4N41A 4DU1A 2QM1A 4DUZK 3SAHA 1JLEA 1SQKA 5GADP 3EY1A 4H4MA 3T69A 2UXCK 4WQ5C 4H0VB 3UB5A 5JMVA 4RTFD 4CJ3A 4I6MA 1D5AA 4H5WA 3H3OB 2BDPA 2GEMA 3U9DA 1ESVA 5BPLA 3PIOL 1DEJA 1EWQA 3AVCA 1WSHA 2D0CA 3HSCA 4WYBA 1S1XA 4DR3K 3GOIA 3Q7BA 3PSIA 4W5QA 4DUYK 3ULEB 1HNXK 3KJVA 2W6KA 1JL1A 1LW2A 5F0XA 1JLAA 4CFAA 4DV0K 4FW2A 3ISNC 4GVMA 3S3MA 1N5YA 4FWSA 1QHAA 1X9WA 1P90A 3D2FB 1SS6A 1P8ZA 4M7YA 2QWQA 5LJWA 2DPNA 4JI0K 3CCRN 5M1PA 4B3TK 5BR8K 1WAFA 4OLBA 4XH5A 3VGLA 2UUCK 4EAHD 1IJJA 1RT1A 2CH6A 5AQHA 1TKZA 2KZZA 4FL9A 4BC2A 5HLFA 3HPGA 4DHYA 3L2QA 3VQDA 1Z26A 2D0AA 1NGBA 3K9JA 1HMVA 3IG1A 1CXQA 4CZMA 1RGIA 2GV9A 3CJ9A 1VQ6N 3QINA 3O6WA 4U67L 4DR7K 1NGGA 4C8LA 4C8OA 1HPZA 2VCPA 4CF1A 1JCFA 1GLDG 3WEEA 4BEBA 3BUZB 4B1VA 4WQ4C 4BRAA 2EX3A 4E1MA 3K5NA 3SBGA 2A1SA 4IO9L 4C8KA 2P51A 1YVUA 4FWRA 5HROA 3TSPA 2O8EB 3MAQA 3QEXA 1KLMA 5HRSA 3THYB 4UY8O 3MXJA 1S1VA 3AGKA 3MEGA 5AQQA 5AQVA 3V6DA 3AVJA 3T1HK 3R9PA 1XI1A 3A8YA 4KPYA 5IWAK 4H0OA 3NGYA 4JI4K 3SMPA 2P9PA 1ZC6A 3I0RA 3A2FA 4CF2A 4ILJA 1KXPA 2YKMA 1NNEA 3O3FA 2RPIA 4BR0A 3ZT2A 4W5RA 4NO7A 2P9NA 4BE2A 3LDNA 3RR8A 3PX6A 4YDUC 1Z25A 2W6LA 1MWKA 1SAZA 2P9NB 3QFUA 4CIFA 5AQGA 1Y64A 3VA0A 1HQEA 3M6GA 3IFRA 4CEOA 4BDYA 2FF3B 2QA4N 3BDPA 3CCQN 2X6SA 1CZAN 2NNWA 2HW3A 2QK9A 4FJGA 4FPAA 1NKEA 4E19A 1SKWA 1RDBA 1U48A 4DSLA 3F73A 3IS9A 5JS2A 3S3NA 1SV5A 4DQPA 5HRRA 3O1WA 1QZ5A 4RW6A 3V9ZA 1U04A 1XUPO 5JVHL 4CGDA 1VQKN 3CD6N 4GKJK 4F3OA 3O9TA 1T8EA 3HVRA 2W00A 3OYCA 1S3XA 1NOZA 5EXWA 3G71N 4B3RK 5GIPA 1YJNN 1C1CA 4KAZA 4PKIA 2G8WA 3SAFA 2D0BA 5KRSA 3OS0A 3V9XA 3ZX3A 3LAMA 2E6LA 4Z0UA 4LFCK 1BL3A 4ID1A 2YHXA 1NGAA 3M8PA 3SK3A 1BO5O 2YNIA 4RW7A 2I5JA 4FJ7A 3ATVA 1K8KA 4AM6A 2XY7A 4BC3A 2P9UA 3DXMA 4KREA 1V4SA 4JI7K 4H5TA 4CJ5A 4DTUA 2E5LK 1BCMA 3OJSA 4BY9C 4R5PA 2ZF5O 4JLHA 3VQPA 4CJLA 3H45C 3TABA 2NRWA 2Q0UA 4NYNA 4RW8A 4PL8A 4CD1A 1WOQA 3DXKA 2HHTA 2UUAK 4OKEA 1Q86O 2IVNA 1BWFO 4BRKA 3KK2A 1ATRA 4DTMA 2G8KA 2P9LB 2WC9A 1KFSA 4TSXA 4DTXA 4JRQA 1IBMK 1NK5A 1QSYA 4H5VA 2P9KB 2E88A 1VRTA 5CE3A 2E4LA 4AHRA 4NB4A 3R8EA 3ZEUA 1I94K 3PO4A 4M3TA 4JKHA 2D4WA 4DV2K 4M63C 1XNRK 1GLFO 2HMPA 4FJ9A 3KZBA 2OPSA 1D4XA 1HNZK 1KTQA 1U45A 1FXXA 4V19S 3AVNA 1BIUA 3M8SA 3V1OA 1RILA 3G4SN 2RE2A 3DYAA 4JD2A 3L2RA 3LP3A 3QIPA 3BF3A 1LWCA 5FRMA 1TAUA 1HRHA 3QLHA 1H1VA 5J2QA 1YITN 1ASWA 3CQXA 3HI0A 4YY3K 4CZIA 1FW6A 4GNIA 2Y1JA 3TTDA 4BE1A 1T7PA 3OYKA 2HHVA 1W9HA 4DV5K 2X78A 3F5TA 3U4LA 1KRPA 4DTRA 3D6RA 1T3VA 5K14A 4OPJA 5BRFA 4DV7K 2QI2A 3L2VA 4GV3A 5JICA 2E1ZA 4DQSA 4C23A 1SUQA 2QW9A 2O4IA 2D1KA 1B92A 1A5XA 4WCEL 5FPNA 3O3GA 2ETJA 4CF8A 5D3GA 1S1WA 1VQLN 3ENHA 4FJXA 4B3OA 1GLLO 4JI3K 3EZWA 4AM7A 3PO5A 1ZBFA 2OZMA 2ITGA 2O8CB 1S22A 2P5GA 2HB5A 1X9JA 5KPRA 2GUIA 3VEOA 2DTUA 5KRTA 1NU0A 4CZKA 1ZYQA 1DGKN 4CHZA 4K25A 3VEXA 1X1PA 3ZETB 3EZ5A 5GIOA 4B9NA 4O8KA 3O3HA 3NBPA 3CCSN 1IG9A 3CC7N 1TK5A 2VQFK 3NMUA 4BE0A 3M8QA 4X66K 3SQ4A 4B3SK 4BC5A 4JKFA 3ENBA 2A1RA 3GDQA 4BC4A 3TARA 5KGWA 1JLBA 5AQOA 3SUOA 4DR1K 3GE1A 1OVQA 1JXBA 1I3AA 3KLGA 1U49A 4KHSA 3P5JA 2E2NA 1BA0A 2F8SA 3LPTA 2VWJA 4F2RA 1HNWK 5CHIA 1ZBUA 4CECA 3CYGA 3JXUA 4JS4A 4CFDA 5GAGP 3CJ7A 4E7HA 4QS9A 2A3ZA 4DSEA 4XEIA 3NF6A 2HBLA 1KSPA 1U2VB 1N36K 3E66A 3AARA 1VQMN 2YHBA 3DLEA 4O55A 4AHTA 1D9DA 4F2SA 1U47A 4H03B 3AO3A 2IS3A 3HPHA 2F96A 4XJXA 3DMJA 1WNSA 5T7BA 3QBWA 5FPDA 1CZ9A 3VQ9A 5CYQA 3J7YP 1EETA 4CBUA 2E20A 3SV3A 2KLAA 1Z6RA 5AQJA 2I7PA 1HLUA 3HP6A 3GL1A 2VG5A 4DTNA 1TL3A 1NK6A 5H1SQ 3CC4N 3KK7A 4CJPA 4B9SA 3ID8A 4U7BA 1N6QA 3PSFA 1OKJA 5DM7L 2ZJQL 3SUNA 3AA4A 2GBZA 4XH1A 2AP1A 3UE5A 1X3MA 4CVNE 5C0YA 4JI2K 2UUBK 4WFNL 3KKSA 3TI0A 4B1XB 5FPMA 3LM2A 4DFJA 3M1FA 4OKJA 1L3VA 3J7ZO 1I39A 2CGJA 3NFAA 3FGUA 3EL2A 1VSKA 4CEQA 3L8BA 3A5LC 3MWTA 4ID5A 4QS7A 2NZTA 4O4GA 2E2QA 5HRNA 1X9SA 2E2PA 2HF4A 4IDKA 3I55N 5AQPA 1YF5L 3D2FA 3TTFA 4DFPA 1EX4A 1TV6A 3LAKA 3JSMA 3CQYA 4DFKA 4FCYA 3THVA 1QE1A 3D2EA 2Q31A 4B1ZA 5EU7A 1B9DA 1QQMA 3EE9A 1JJ2M 2XY5A 3G10A 2IGIA 4CI6A 3LZIA 4GV6A 4CEZA 4HUFA 3OVNA 4A5AA 4E3SA 3CQ8A 2HVHA 1RDWX 3VETA 1D8YA 3AVAA 1R0AA 1NMDA 5EOYA 4FLZA 1QQCA 2ZWHA 1VQ8N 3F9MA 1NJZA 3ZCMA 4RWTA 4J2BA 3O1BA 4PHTX 2AA4A 1GLCG 5A2QO 4KI6A 4BECA 1FJGK 2PZSA 3KVGA 1RNHA 4YFUA 2JWKA 2G8UA 4FYDA 1Q9YA 4CZLA 1TAQA 4MQ3A 5TKWA 3BGRA 4FK2A 1NG9A 2ZGZA 1YIJN 1HKBA 3S5TA 4NXMK 3T19A 1YVNA 1NGEA 4DTSA 3R1XA 4B9UA 3U3YA 1HPMA 1QVGM 1RTDA 2C1IA 3DRRA 3HBTA 5BREA 1GOAA 2O8DB 4FLUA 3CF5L 3CG7A 4FOEA 3KK3A 3SCXA 3F9KA 2ASPA
chains in the Genus database with same CATH topology
3BUZB 3L6QA 4JHDB 2VWBA 4A2AA 2YCHA 3VEVA 3WXMB 3C7NB 4L3QA 4WQ4C 4B1VA 2NRHA 4BRAA 3SBGA 3CPWM 5AZIB 4IO9L 4HWIA 4FWRA 5JLFA 3L4IA 3TSPA 3VGKA 2P9IA 4JKAA 5AR0A 3TTCA 4CJ7A 3UKUB 1KD1O 4OPAA 1VQ5N 4BROA 4UY8O 3AGKA 5E84A 5BN9A 3EE8A 1YI2N 4K43A 5AQQA 5AQVA 3UKUA 5AQZA 2F9WA 3AAPA 3I33A 1VAZA 2IVPA 5E26A 3R9PA 5JVGL 1V4TA 1BU6O 3A8YA 3VGMA 5GINA 3WT0A 4H0OA 3LDLA 3IDHA 3SMPA 3D7EO 2P9PA 5AQMA 1ZC6A 3QDKA 4BRNA 3NVKA 3CMEN 1LCUA 1ILYA 4ILJA 5MLCQ 3MMVA 4B1YB 1KXPA 4BRLA 4YOXA 4BRCA 1Z05A 4MO5A 4NLBA 4PKHA 4BR0A 4NO7A 2V52B 3UKRB 2P9NA 3LDNA 1NBWA 3U8XA 1MA9B 4YDUC 3S41A 3E9LA 1MWKA 2YI1A 4BG9A 1SAZA 2P9NB 3QFUA 4BRFA 3DLLL 5AQGA 1Y64A 1TUYA 4MDBA 3M6GA 3CETA 3IFRA 1M90O 4BRIA 5AQXA 3WQUA 2FF3B 2YX6A 3NVMA 3CC2N 2QA4N 3CCQN 4BR5A 3M3ZA 1CZAN 2NNWA 1IG8A 3C0BA 1U2VA 3WQTA 4FPAA 1Q81O 3G6EN 4KH4A 3IUCA 2GTDA 4H5NA 3C65A 2GELA 4LC9B 4A2BA 3DJCA 3ZEUB 3FR0A 4BRGA 1HKGA 4IO8A 4JKDA 4CZHA 2V7ZA 4GV9A 1NGFA 2PFUA 5EX5A 3U9ZA 1NM1A 5C12A 5HL7L 2ASOA 1ZBSA 3O1WA 1KAXA 3EN9A 4YORA 1VQPN 3ENOA 2A42A 1QZ5A 1XUPO 3A5NC 5JVHL 4GVEA 3MN5A 4BRPA 4JK7A 1VQKN 3CD6N 4BE7B 5AQWA 3O9TA 3IKMA 4CZFA 4CBXA 2W00A 1BOTO 4BQZA 1S3XA 2W40A 3BP8A 3CJ1A 4ISFA 2HSTA 5BRDA 5EXWA 5C15A 5KQ8A 5DM6L 3G71N 5GIPA 5BPNA 1YJNN 4H0PA 5ELZA 1ATSA 2H3GX 3KWGA 4ISEA 4PKIA 3VF6A 4JKEA 4A57A 3WXIA 1MDUB 3SAFA 3I56N 4CZEA 2WUSA 3ZX3A 1KAYA 2BTFA 4O5FA 4CD3A 2YHXA 1NGAA 3SK3A 4EHTA 2FSJA 2P9IB 1BO5O 3DAWA 3VEYA 4PKGA 4QS8A 4JAXA 3SLCA 3MN7A 4O8UA 1VQNN 1BA1A 2F7TA 2CH5A 3VF4A 4BR4A 1G99A 3RVCA 2OANA 3O9RA 3ATVA 2VGMA 2IVOA 3Q7CA 4EIAA 5EVZA 1K8KA 4AM6A 1YJ9N 3F2KA 3O4WA 2P9UA 3DXMA 4BC3A 1K8AO 1V4SA 2HOEA 4A62A 4H5TA 5F2RA 3VOVA 2V51B 3FFKB 5GAHP 3C7NA 3MCAB 4B1UB 3O9SA 4KH5A 5M1NA 3MN9A 4FWMA 4BY9C 3H6EA 2ZF5O 3H45C 1T6DA 2NRWA 2Q0UA 3PIPL 4WFAL 4PL8A 5B8HA 4CD1A 1WOQA 3DXKA 2YHYA 3LDOA 3P31A 2P9SB 4PL7A 2QWNA 1NJIO 4M7XA 1NGJA 1BDGA 2W41A 4J8FA 4IOAL 1Q86O 4H0TB 3A5OC 2IIRA 2IVNA 1BWFO 4BRKA 4BGAA 1QZ6A 1ATRA 4YOUA 4YOWA 4YOVA 2P9LB 2WC9A 3CJAA 3O5BA 5M1FA 5M1QA 3DXKB 3UKRA 3L4QA 4R79A 1YUWA 4H5VA 2P9KB 2KHOA 4H0YB 2E88A 3AGRA 4FWQA 4FO0A 5CE3A 1K73O 5C2FA 1GLAG 3B8AX 2OTLN 4NB4A 4K41A 2YHWA 3R8EA 2ITMA 4JNEA 3ZEUA 4BQLA 4JKHA 4JKGB 3FZKA 2D4WA 3QFPA 4M63C 4BVOA 1GLFO 2CGLA 5AQIA 5TKYA 3P4IA 2HMPA 3OHRA 4IDHA 4IZ9A 5M1KA 4BREA 1XQSC 4C1NI 3KZBA 4YOTA 1D4XA 3D2EB 2GWKA 3TSUA 4JKBA 5LJVA 3CCJN 5C10A 1SZ2A 3N4QA 3WXKA 2J4RA 5AQSA 3BEXA 4Z94A 5AZJA 3G4SN 2RE2A 4JD2A 3O08A 3BF3A 5AQYA 3CCMN 4RCHA 2VYPA 5AZJB 3O8MA 3OBYA 4G9ZA 2A41A 1H1VA 3C6AA 3E1YA 2Q2RA 1YITN 3CERA 3CQXA 1K9MO 3TU5A 3TPQA 2FSKA 1JCEA 4FWLA 3J8AA 2E1YA 3HM8A 1ZXOA 3HI0A 4HTLA 2HBMA 4CZIA 5CR4A 4GNIA 2Q36A 1M1KO 3QB0A 4IXCA 3FE1A 3TTDA 4FWOA 1GLBG 1X3NA 2NRTA 3FLCO 1HKCA 2ZGYA 2WBNA 2F9TA 4JD2B 3L0QA 3F5TA 3U4LA 4IJNA 2NRVA 2D0PA 4BEBA 3D6RA 1T3VA 2CGKA 3SJHA 2A6AA 5BRFA 3OW2M 5AZIA 2QI2A 4GV3A 5JICA 2E1ZA 3QICA 1EO1A 1NGIA 3MWPA 1BG3A 1W97L 3LDQA 4C23A 3MK6A 2QW9A 3DXMB 2Q0RA 1DT9A 4BR2A 2D1KA 1RDUA 4IEIA 4FVUA 4WCEL 5FPNA 4IWVA 4DKWA 4FWNA 4BRDA 3N4PA 5AQRA 3WEEB 2HBKA 2Q1NA 3H1QA 1TYQA 1VQLN 3ENHA 2PAVA 1GLLO 3RSEB 3EZWA 4I6MB 4AM7A 4CBWA 3CI5A 2A40A 2V7YA 3CJCA 4DQ8A 3QMLA 5AFUH 1NLVA 3HZ6A 1QVFM 1S22A 3ATUA 1VQ9N 1X9JA 5KPRA 4IOCL 3G25A 1TYQB 3SMSA 3VEOA 4XH4A 5AFUA 1YJWN 3PLAA 3VEWA 3RSEA 4OPHA 3OA9A 3ULEA 4JEPA 1BUPA 4CZKA 1WUAA 2QTDA 1VQ7N 1JCGA 5KPZA 1NWKA 1DGKN 5KPTA 4JK9A 3EKSA 5AQUA 2ASMA 3I8BA 2QXLA 3ID6A 4K25A 2WFBA 3HTVA 3VEXA 4IJAA 2P9LA 3ZETB 5GIOA 4KBOA 3QBXA 4O8KA 3FZMA 3CPEA 3CCSN 4DB3A 1N8RO 1VQ4N 1NGCA 1KC8O 3C6HA 3EKUA 4E1JA 3WEEA 2P9KA 5BPMA 4JKGA 3CC7N 3NMUA 4IOXA 1XC3A 2P9SA 3KHYA 4BC5A 3E9PA 3HRGA 4JKFA 3VERA 3ENBA 2BUPA 4Y0WA 3FZLA 3GDQA 4ILHA 4BC4A 4EHUA 1DKGD 3ZETA 3DWLA 2C1GA 1E4GT 5AQOA 1Q7YO 2EWSA 2GUPA 3GE1A 4B1WB 3VF2A 3CCUN 4KH6A 4MO4A 3CCVN 3AY9A 3BF1A 5F1XA 2E2NA 1BA0A 1ATNA 1C0GA 2YJEA 4IEEA 5CHIA 1QQNA 2VGNA 3JXUA 4BRHA 5FPEA 3MDQA 3EO3A 3HOTA 1VQON 1HUXA 1T44A 3M5RA 1TUUA 5GAGP 5AQNA 3CJ7A 4BR7A 2A5XA 4QS9A 4A59A 2A3ZA 2UYTA 4FSVA 5I9EB 4XEIA 3GBTA 3ZYYX 1Q82O 2GWJA 2HBLA 5AQTA 2YJFA 2FXUA 4JN4A 2Q97A 1U2VB 5GAEP 2HF3A 1YAGA 1QQOA 4WQ4A 3E66A 2QEXN 3AARA 3CJBA 3H1VX 1KAZA 3H46O 3MCPA 3CMAN 2GX9A 5AQFA 1KQSM 1VQMN 2QWRA 3LDPA 1U6ZA 3H3NO 4H03B 2E8AA 1T6CA 3VTHA 2FLOA 4XJXA 1YXQA 2I7NA 3KWIA 3QBWA 1GLEG 1NGHA 3MN6A 4JKCA 4MDAA 4K42A 5FPDA 5LY3A 4CBUA 5ADXA 2D0OA 2E20A 2KLAA 1Z6RA 2HBJA 2NLXA 5AQJA 3WUHA 2I7PA 1HLUA 2RHKA 5ADXH 3GL1A 2QM1A 4BR9A 2QWLA 3SAHA 3GG4A 4MLEA 3ZX2A 1SQKA 4BRQA 5GADP 4F9OA 3T69A 5H1SQ 3CC4N 3CCLN 4WQ5C 4H0VB 3KK7A 3UB5A 2NRZA 4RTFD 1NGDA 1Q18A 5JMVA 3ID8A 3O9UA 4I6MA 4BG8A 2P9UB 4H5WA 3VEZA 3H3OB 4U7BA 1OKJA 2E2OA 2GEMA 3U9DA 4A5BA 1ESVA 5BPLA 5DM7L 1DEJA 3PIOL 2ZJQL 4XH1A 2AP1A 4CZJA 3WXLA 3UE5A 1X3MA 1K8KB 4FWPA 4OO1J 5C0YA 3A5MC 4DCHA 3FZFA 3LM9A 5C2DA 4WFNL 3HSCA 4FOIA 5M1OA 4WYBA 4B1XB 4WF9L 5FPMA 1W2BM 3GOIA 2QWPA 3LM2A 3P39A 3M1FA 3Q7BA 4JK8A 3SBTA 3VPZA 5BR9A 3J7ZO 4BRMA 1RFQA 3JS6A 3ULEB 2CGJA 3FGUA 2P9PB 3EL2A 3LL3A 3TSQA 3HOSA 5F0XA 4C1NK 3A5LC 4FPBA 3MWTA 5JLHA 2ZJPL 4H5RA 2NRRA 4QS7A 2NZTA 3SAGA 4BVPA 2E2QA 3VMFB 3VESA 5AQKA 4FWSA 2E2PA 1QHAA 2HF4A 2QWMA 4B9QA 3WXJA 3K9KA 1P90A 4WFBL 3D2FB 1SS6A 1P8ZA 3I55N 4M7YA 2QWQA 5AQPA 5LJWA 3CCEN 2DPNA 1R59O 5BRHA 3R6MA 1YF5L 3AAQA 3D2FA 3TTFA 3CXCM 3CCRN 5M1PA 1HX1A 1O13A 3OBWA 2FSNA 2NRXA 3CQYA 3FZHA 3D2EA 2BH1A 4XH5A 1C0FA 2Q31A 2FF6A 3VGLA 4B1ZA 4YDUA 1GLJO 1JJ2M 1QQMA 3EE9A 4IFEA 4WQ5A 4EAHD 1IJJA 4CI6A 4GV6A 5AQLA 2CH6A 4A5AA 3W3DA 5AQHA 1RDWX 5EY4A 3VETA 3O80A 1NMDA 3CHWA 4FL9A 5EOYA 3W0LA 1LOTB 2ZWHA 2QWOA 1VQ8N 3F9MA 4BC2A 4RWTA 3O1BA 4PHTX 4H0XB 2AA4A 5KQDA 1GLCG 1YHQN 1EQYA 4BECA 4GY2B 3KVGA 4CZGA 5BN8A 2JWKA 2PBDA 2JWLA 4DHYA 4CZLA 3CIPA 1J6ZA 3E9OA 5TKWA 1HJOA 1OVYA 1NGBA 3K9JA 2KKZA 1E4FT 3VTIA 3MX2A 2ZJRL 5HOOA 3O9QA 1MWMA 2ZGZA 4CZMA 1YIJN 1HKBA 1RGIA 3MX5A 3CJ9A 4JHDA 1YVNA 1VQ6N 4A61A 1NGEA 3P38A 3R1XA 3A0IX 3O6WA 4NLCA 4U67L 1HPMA 3T7ZA 1NGGA 4YOYA 1S72N 1QVGM 2C1IA 3HBTA 5BREA 3VENA 3CF5L 4EFHA 4FWKA 4AF1A 2VCPA 4MLHA 2OTJN 4FOEA 3R3LA 4ISGA 4ILGB 3ZX0A 1JCFA 4BGBA 1GLDG 2ASPA 3IMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BUZ B;  3L6Q A;  4JHD B;  2VWB A;  4A2A A;  2YCH A;  3VEV A;  4B1V A;  3C7N B;  4L3Q A;  4WQ4 C;  4BRA A;  2NRH A;  5AZI B;  4HWI A;  4FWR A;  5JLF A;  3L4I A;  3VGK A;  2P9I A;  5AR0 A;  4CJ7 A;  3UKU B;  4BRO A;  5E84 A;  5BN9 A;  4K43 A;  5AQQ A;  5AQV A;  3UKU A;  5AQZ A;  2F9W A;  3AAP A;  3I33 A;  2IVP A;  5E26 A;  3R9P A;  1V4T A;  1BU6 O;  3A8Y A;  3VGM A;  3WT0 A;  4H0O A;  3LDL A;  3IDH A;  3SMP A;  3D7E O;  2P9P A;  5AQM A;  1ZC6 A;  3QDK A;  4BRN A;  1LCU A;  3MMV A;  4B1Y B;  1KXP A;  4BRL A;  4BRC A;  1Z05 A;  4MO5 A;  4PKH A;  4BR0 A;  4NO7 A;  2V52 B;  3UKR B;  2P9N A;  3LDN A;  1NBW A;  3U8X A;  1MA9 B;  4YDU C;  3S41 A;  1MWK A;  2YI1 A;  4BG9 A;  1SAZ A;  2P9N B;  3QFU A;  4BRF A;  5AQG A;  1Y64 A;  1TUY A;  3M6G A;  3CET A;  3IFR A;  4BRI A;  5AQX A;  3WQU A;  2FF3 B;  4BR5 A;  3M3Z A;  1CZA N;  1IG8 A;  3C0B A;  1U2V A;  3WQT A;  4FPA A;  3IUC A;  2GTD A;  4H5N A;  2GEL A;  4LC9 B;  4A2B A;  3DJC A;  3ZEU B;  3FR0 A;  4BRG A;  1HKG A;  4IO8 A;  4CZH A;  2V7Z A;  1NGF A;  3U9Z A;  5EX5 A;  1NM1 A;  2ASO A;  1ZBS A;  3O1W A;  1KAX A;  3EN9 A;  3ENO A;  2A42 A;  1QZ5 A;  1XUP O;  3A5N C;  3MN5 A;  4BRP A;  5AQW A;  4CZF A;  4CBX A;  1BOT O;  4BQZ A;  1S3X A;  2W40 A;  3BP8 A;  3CJ1 A;  4ISF A;  5BRD A;  5KQ8 A;  5EXW A;  5BPN A;  4H0P A;  5ELZ A;  1ATS A;  2H3G X;  4ISE A;  4PKI A;  3VF6 A;  3WXI A;  1MDU B;  4CZE A;  2WUS A;  3ZX3 A;  1KAY A;  2BTF A;  4O5F A;  4CD3 A;  2YHX A;  1NGA A;  3SK3 A;  4EHT A;  2FSJ A;  2P9I B;  1BO5 O;  3DAW A;  3VEY A;  4PKG A;  4QS8 A;  4JAX A;  3SLC A;  3MN7 A;  1BA1 A;  2CH5 A;  3VF4 A;  4BR4 A;  1G99 A;  2OAN A;  3ATV A;  2IVO A;  4EIA A;  5EVZ A;  1K8K A;  4AM6 A;  3O4W A;  2P9U A;  3DXM A;  4BC3 A;  1V4S A;  2HOE A;  4A62 A;  4H5T A;  5F2R A;  3VOV A;  2V51 B;  3FFK B;  3C7N A;  4B1U B;  3MN9 A;  4FWM A;  3H6E A;  2ZF5 O;  3H45 C;  1T6D A;  2Q0U A;  4PL8 A;  5B8H A;  4CD1 A;  1WOQ A;  3DXK A;  2YHY A;  3LDO A;  2P9S B;  4PL7 A;  2QWN A;  4M7X A;  1NGJ A;  1BDG A;  2W41 A;  4J8F A;  4H0T B;  3A5O C;  2IIR A;  2IVN A;  1BWF O;  4BRK A;  4BGA A;  1QZ6 A;  1ATR A;  2P9L B;  3CJA A;  3O5B A;  3DXK B;  3UKR A;  1YUW A;  4H5V A;  2P9K B;  2KHO A;  4H0Y B;  2E88 A;  4FWQ A;  4FO0 A;  5CE3 A;  1GLA G;  3B8A X;  4NB4 A;  4K41 A;  2YHW A;  3R8E A;  2ITM A;  4JNE A;  3ZEU A;  4BQL A;  3FZK A;  2D4W A;  3QFP A;  4M63 C;  4BVO A;  1GLF O;  2CGL A;  5AQI A;  5TKY A;  3P4I A;  2HMP A;  3OHR A;  4IZ9 A;  4BRE A;  1XQS C;  3KZB A;  1D4X A;  3D2E B;  2GWK A;  5LJV A;  1SZ2 A;  3WXK A;  2J4R A;  5AQS A;  3BEX A;  4Z94 A;  5AZJ A;  4JD2 A;  3O08 A;  3BF3 A;  5AQY A;  4RCH A;  2VYP A;  5AZJ B;  3O8M A;  2A41 A;  1H1V A;  2Q2R A;  3CER A;  3CQX A;  3TU5 A;  3TPQ A;  2FSK A;  1JCE A;  4FWL A;  3J8A A;  2E1Y A;  3HM8 A;  1ZXO A;  3HI0 A;  4HTL A;  4CZI A;  4GNI A;  2Q36 A;  3QB0 A;  4IXC A;  3FE1 A;  4FWO A;  1GLB G;  1X3N A;  3FLC O;  1HKC A;  2ZGY A;  2F9T A;  4JD2 B;  3L0Q A;  3U4L A;  4IJN A;  2D0P A;  2CGK A;  3SJH A;  2A6A A;  5BRF A;  5AZI A;  5JIC A;  2E1Z A;  3QIC A;  1NGI A;  1BG3 A;  4C23 A;  3LDQ A;  3MK6 A;  2QW9 A;  3DXM B;  2Q0R A;  4BR2 A;  2D1K A;  5FPN A;  4IWV A;  4FWN A;  4BRD A;  5AQR A;  3WEE B;  2Q1N A;  3H1Q A;  1TYQ A;  3ENH A;  2PAV A;  1GLL O;  3RSE B;  3EZW A;  4I6M B;  4AM7 A;  4CBW A;  3CI5 A;  2A40 A;  2V7Y A;  3CJC A;  4DQ8 A;  3QML A;  5AFU H;  1NLV A;  3HZ6 A;  1S22 A;  3ATU A;  1X9J A;  5KPR A;  3G25 A;  1TYQ B;  3SMS A;  3VEO A;  4XH4 A;  5AFU A;  3VEW A;  3RSE A;  3ULE A;  4CZK A;  1BUP A;  1WUA A;  1JCG A;  5KPZ A;  1NWK A;  1DGK N;  5KPT A;  3EKS A;  5AQU A;  2ASM A;  3I8B A;  2QXL A;  4K25 A;  3HTV A;  3VEX A;  4IJA A;  2P9L A;  3ZET B;  4KBO A;  3QBX A;  4O8K A;  3FZM A;  4DB3 A;  1NGC A;  4E1J A;  3EKU A;  5BPM A;  3WEE A;  2P9K A;  1XC3 A;  2P9S A;  3KHY A;  4BC5 A;  3VER A;  2BUP A;  4Y0W A;  3FZL A;  3GDQ A;  4BC4 A;  4EHU A;  1DKG D;  3ZET A;  3DWL A;  1E4G T;  5AQO A;  2EWS A;  2GUP A;  3GE1 A;  4B1W B;  3VF2 A;  4MO4 A;  3AY9 A;  3BF1 A;  5F1X A;  2E2N A;  1BA0 A;  1ATN A;  1C0G A;  2YJE A;  1QQN A;  3JXU A;  4BRH A;  5FPE A;  3MDQ A;  3EO3 A;  1HUX A;  1T44 A;  1TUU A;  5AQN A;  3CJ7 A;  4BR7 A;  2A5X A;  4QS9 A;  2A3Z A;  2UYT A;  4FSV A;  5I9E B;  4XEI A;  3GBT A;  2GWJ A;  5AQT A;  2YJF A;  2FXU A;  4JN4 A;  2Q97 A;  1U2V B;  2HF3 A;  1YAG A;  1QQO A;  4WQ4 A;  3AAR A;  3CJB A;  3H1V X;  1KAZ A;  3H46 O;  3MCP A;  5AQF A;  2QWR A;  3LDP A;  1U6Z A;  3H3N O;  4H03 B;  2E8A A;  1T6C A;  2FLO A;  1YXQ A;  2I7N A;  3QBW A;  5FPD A;  1GLE G;  1NGH A;  3MN6 A;  5LY3 A;  4K42 A;  4CBU A;  5ADX A;  2D0O A;  2E20 A;  5AQJ A;  1Z6R A;  2NLX A;  3WUH A;  2I7P A;  1HLU A;  5ADX H;  3GL1 A;  2QM1 A;  4BR9 A;  2QWL A;  3GG4 A;  4MLE A;  3ZX2 A;  1SQK A;  4BRQ A;  4F9O A;  4WQ5 C;  4H0V B;  3UB5 A;  5JMV A;  4RTF D;  1NGD A;  1Q18 A;  3ID8 A;  4I6M A;  4BG8 A;  2P9U B;  4H5W A;  3VEZ A;  3H3O B;  1OKJ A;  2E2O A;  2GEM A;  3U9D A;  1ESV A;  5BPL A;  1DEJ A;  4XH1 A;  2AP1 A;  4CZJ A;  3WXL A;  3UE5 A;  1X3M A;  1K8K B;  4FWP A;  3A5M C;  4DCH A;  3FZF A;  3LM9 A;  3HSC A;  4FOI A;  4WYB A;  4B1X B;  5FPM A;  3GOI A;  2QWP A;  3LM2 A;  3M1F A;  3VPZ A;  5BR9 A;  4BRM A;  1RFQ A;  3JS6 A;  3ULE B;  2CGJ A;  3FGU A;  2P9P B;  3EL2 A;  3LL3 A;  5F0X A;  3A5L C;  4FPB A;  5JLH A;  4H5R A;  4QS7 A;  2NZT A;  4BVP A;  2E2Q A;  3VES A;  5AQK A;  4FWS A;  2E2P A;  1QHA A;  2HF4 A;  2QWM A;  4B9Q A;  3WXJ A;  3D2F B;  1P8Z A;  4M7Y A;  2QWQ A;  5AQP A;  5LJW A;  2DPN A;  1R59 O;  5BRH A;  3R6M A;  3AAQ A;  3D2F A;  1HX1 A;  2FSN A;  3CQY A;  3FZH A;  3D2E A;  4XH5 A;  1C0F A;  2Q31 A;  2FF6 A;  3VGL A;  4B1Z A;  4YDU A;  1GLJ O;  1QQM A;  4WQ5 A;  4EAH D;  1IJJ A;  4CI6 A;  5AQL A;  2CH6 A;  3W3D A;  5AQH A;  1RDW X;  5EY4 A;  3VET A;  3O80 A;  1NMD A;  3CHW A;  4FL9 A;  5EOY A;  3W0L A;  1LOT B;  2ZWH A;  2QWO A;  3F9M A;  4BC2 A;  4RWT A;  3O1B A;  4H0X B;  2AA4 A;  5KQD A;  1GLC G;  1EQY A;  4GY2 B;  3KVG A;  4CZG A;  5BN8 A;  2PBD A;  4DHY A;  4CZL A;  3CIP A;  1J6Z A;  1HJO A;  1NGB A;  1E4F T;  1MWM A;  2ZGZ A;  4CZM A;  1HKB A;  1RGI A;  3CJ9 A;  4JHD A;  1YVN A;  4A61 A;  1NGE A;  3A0I X;  3O6W A;  1HPM A;  1NGG A;  3HBT A;  5BRE A;  3VEN A;  4EFH A;  4FWK A;  2VCP A;  4MLH A;  4FOE A;  4ISG A;  3ZX0 A;  1JCF A;  4BGB A;  1GLD G;  2ASP A;  3IMX A; 
#chains in the Genus database with same CATH topology
 2YCH A;  3WXM B;  3C7N B;  4L3Q A;  3CPW M;  2NRH A;  1UA1 A;  1U4B A;  3RRG A;  3WNG A;  3L4I A;  3VGK A;  3PUF A;  5AR0 A;  1QSL A;  3UKU B;  4X64 K;  2X6N A;  1EXQ A;  4Z4F A;  2F9W A;  3TAM A;  3KD5 E;  4F3T A;  2HNZ A;  1VAZ A;  3I33 A;  3JYT A;  3VGM A;  4CJF A;  5GIN A;  1BI4 B;  3D7E O;  4CHN A;  3WNE A;  4E7J A;  4BRN A;  4CGF A;  1LCU A;  3OYG A;  3AVK A;  4B1Y B;  4FM2 A;  4EZ6 A;  4I2P A;  1Z05 A;  4NLB A;  2HND A;  3UKR B;  4LD0 A;  3VN5 A;  1NBW A;  3U8X A;  1GOB A;  1MA9 B;  3S41 A;  1LAW A;  2YI1 A;  4BG9 A;  3CM6 A;  4BRF A;  3SJJ A;  3VQQ A;  1S5J A;  3B6O A;  2XRI A;  1TUY A;  1TKD A;  3CET A;  3PY8 A;  4CK1 A;  4BRI A;  2YX6 A;  2BAN A;  1GOC A;  3CC2 N;  1UOC A;  3C0B A;  4DU3 A;  1WB9 A;  3QEV A;  1UAX A;  1Q81 O;  4FK4 A;  4B8A B;  1T03 A;  3IUC A;  4LC9 B;  3QER A;  4A2B A;  4IFV A;  4BRG A;  4JKD A;  3THX B;  2V7Z A;  2PFU A;  3U9Z A;  1NM1 A;  2UXD K;  4YOR A;  3THW B;  4CJS A;  3AVM A;  4JI5 K;  1JKH A;  4GVE A;  4BRP A;  1XNQ K;  1RBU A;  4CZF A;  5BRD A;  4ISF A;  2W40 A;  3BP8 A;  4JYA K;  2HST A;  4UQG A;  3KK1 A;  4AHS A;  4DF4 A;  1QSS A;  4H0P A;  1DLO A;  1OH8 A;  4A57 A;  3ZSO A;  3RTV A;  4LH4 A;  2BTF A;  2FSJ A;  2UU9 K;  3DAW A;  3THY A;  4PKG A;  3ASM A;  4JAX A;  3SLC A;  3MN7 A;  4O8U A;  3NCI A;  3QEP A;  3RMD A;  2B6A A;  3AA5 X;  1G99 A;  3RVC A;  2OAN A;  4M3R A;  2G8F A;  2VGM A;  3Q7C A;  4EIA A;  1XHZ A;  1EWR A;  5EVZ A;  1YJ9 N;  3BY5 A;  2AJQ A;  3T1A A;  4A62 A;  4M3Z A;  1FKP A;  4BDP A;  3FFK B;  5GAH P;  3C7N A;  3ZSX A;  5C25 A;  4K8Z A;  3MN9 A;  1YT3 A;  3H6E A;  3P83 D;  1J53 A;  5JEN A;  3PIP L;  5B8H A;  3OYB A;  4DR4 K;  3ZT0 A;  4OPK A;  2QWN A;  1T05 A;  4M7X A;  1NGJ A;  1BDG A;  4LSL A;  4J8F A;  5J2N A;  2WOM A;  1XWL A;  4AIL C;  3ZSV A;  1HNI A;  2OPQ A;  4I9Q A;  4BGA A;  4JRP A;  4IBN A;  1RCH A;  1HR0 K;  1RT3 A;  3L4Q A;  4R79 A;  2YKN A;  2Z1H A;  2KHO A;  3AGR A;  4LF8 K;  4IG0 A;  4FWQ A;  4FO0 A;  4I9L A;  2NUB A;  1GLA G;  2OTL N;  3VQ8 A;  4KHW A;  1JXE A;  3LWM A;  4BQL A;  5AJ3 K;  2YNF A;  4BVO A;  3NDK A;  2CGL A;  4IDH A;  4CCH A;  5M1K A;  1XQS C;  4C1N I;  4WE1 A;  3NF7 A;  2P5O A;  3WNH A;  1RDD A;  3DOK A;  2GWK A;  5LJV A;  2OA8 A;  1CZB A;  2HHQ A;  4CES A;  3N4Q A;  2J4R A;  4CER A;  4FK0 A;  4K0K K;  1NMN A;  5AQY A;  4RCH A;  2VYP A;  4B8C A;  3OBY A;  4NCA A;  3NH0 A;  3C6A A;  3E1Y A;  4JI8 K;  3CER A;  4DQR A;  5FDL A;  3HVT A;  4FWL A;  2HBM A;  2Q36 A;  3QB0 A;  4IXC A;  5DMR A;  1GLB G;  3U6F A;  4CGI A;  3K57 A;  4JD2 B;  4IJN A;  2A6A A;  3DOL A;  4KHU A;  1C6V A;  4O44 A;  2YNH A;  1JLG A;  1EO1 A;  1NGI A;  3MXI A;  1W97 L;  4KHY A;  1XMO K;  4RW4 A;  3OYE A;  3DXM B;  2Q0R A;  3BZK A;  4FVU A;  4IWV A;  3AO1 A;  3CFP A;  3WEE B;  3CFO A;  2HBK A;  2OZS A;  3H1Q A;  1TYQ A;  3LP2 A;  3RSE B;  3I8D A;  3J7A P;  2DFF A;  4W5T A;  1HNV A;  3NE6 A;  1ZBL A;  1BCO A;  3VQC A;  3HZ6 A;  3TAG A;  3G25 A;  4LH5 A;  3SMS A;  5AFU A;  2JLE A;  4DU4 A;  1J5E K;  4KKO A;  3OA9 A;  1XC9 A;  4JEP A;  1NK4 A;  1JCG A;  4AHC A;  3I0S A;  2BGG A;  4JI1 K;  4LF9 K;  1RTJ A;  2QXL A;  3HTV A;  4Z4C A;  4IJA A;  3OYA A;  5HBM A;  4E7I A;  1KLN A;  2XY6 A;  4DB3 A;  1N8R O;  1VQ4 N;  2Z1J A;  1KC8 O;  4E1J A;  4JKG A;  5DK5 A;  3C6U A;  1XC3 A;  4N56 A;  3QEW A;  3SUQ A;  3E9P A;  3JAM O;  1RT7 A;  2O8F B;  2F4V K;  5IT9 O;  3VF2 A;  1RTI A;  3CCU N;  4I2Q A;  4YNQ A;  3BF1 A;  4CFC A;  5F1X A;  4Q0B A;  3O4N A;  1ATN A;  4HUE A;  1C0G A;  2YJE A;  3KD1 E;  4BRH A;  3KLE A;  1VQO N;  3MDQ A;  3HOT A;  1T44 A;  3M5R A;  1HYS A;  1TUU A;  1VSM A;  4FJ8 A;  1HYV A;  4A59 A;  1WBB A;  2UYT A;  4FSV A;  3GBT A;  1OH5 A;  1IKV A;  3CM5 A;  2Z1G A;  4OGC A;  2HHU A;  1KFD A;  3QNN A;  4DTP A;  2OPP A;  5CYM A;  1YAG A;  1QQO A;  1ASU A;  3NH2 A;  3H1V X;  3AVB A;  3CMA N;  3QIO A;  3AVI A;  2E8A A;  3VTH A;  4CJ4 A;  3QET A;  4LF5 K;  4OLA A;  1JLC A;  2I7N A;  5LY3 A;  1GLE G;  4DTJ A;  3AA2 A;  2DFE A;  3ZLJ A;  2NLX A;  3WUH A;  2ZD1 A;  4CGG A;  3SYZ A;  4PUO A;  2F8T A;  2RHK A;  5ADX H;  4MLE A;  3ZX2 A;  4CEA A;  3MEE A;  4F9O A;  4FVM A;  2PY5 A;  3ZSR A;  4CJQ A;  2NRZ A;  1NGD A;  1Q18 A;  2YV0 X;  3VEZ A;  3TAF A;  4FJJ A;  4W5O A;  5C24 A;  4A5B A;  1TVR A;  3U3G A;  2LSN A;  4CZJ A;  4FM1 A;  1K8K B;  3C94 A;  4FWP A;  3RWU A;  4DCH A;  4CJR A;  3FZF A;  3LM9 A;  3CFR A;  4PY5 A;  4KTQ A;  4FOI A;  5M1O A;  1W2B M;  3P39 A;  4GMJ B;  3LPU A;  4JK8 A;  3SBT A;  1TKT A;  3VPZ A;  4ELT A;  5BR9 A;  4ELU A;  1RFQ A;  4LF7 K;  2P9P B;  1VHX A;  3LL3 A;  3TSQ A;  4C1N K;  4W5N A;  2ZJP L;  3PX4 A;  1J9A A;  2NRR A;  3NF8 A;  2YNG A;  3SAG A;  4G1Q A;  3VMF B;  4CGJ A;  5AQK A;  1IO2 A;  4B9Q A;  3WXJ A;  4WFB L;  1N32 K;  4MFB A;  3CCE N;  5BRH A;  3AAQ A;  1VSJ A;  1O13 A;  2FSN A;  2NRX A;  2BH1 A;  1C0F A;  2FF6 A;  4IFE A;  4O0J A;  2FBV A;  4KHN A;  4CFB A;  3NF9 A;  1QTM A;  3CHW A;  2HHI A;  5HP1 A;  1LOT B;  2QWO A;  4Z4E A;  3LAN A;  3O4Q A;  3UIQ A;  1EQY A;  4GY2 B;  4Z4I A;  4CZG A;  5BN8 A;  3PX0 A;  2PBD A;  4DV3 K;  1WSI A;  3CIP A;  1J6Z A;  1S6Q A;  1HJO A;  4X62 K;  4FM0 A;  2KKZ A;  3LZJ A;  4FJL A;  3MX2 A;  5HOO A;  3O9Q A;  1MWM A;  2PYJ A;  1ZBH A;  1RT6 A;  2UXB K;  1L3U A;  4JHD A;  1WSJ A;  1UWB A;  3OY9 A;  3D45 A;  4NLC A;  3A0I X;  1SL0 A;  1VK0 A;  3MEC A;  1WLJ A;  3LAL A;  4EFH A;  4AF1 A;  2OTJ N;  4MLH A;  1RBV A;  2XO7 A;  3ZX0 A;  4BGB A;  3J80 O;  2RKI A;  3L6Q A;  3VEV A;  4FLY A;  3DLH A;  5AZI B;  3TAQ A;  2E6M A;  1Q9X A;  3M8R A;  1BI4 A;  1VQ5 N;  1KD1 O;  1J54 A;  3SI6 A;  5E84 A;  3RR7 A;  5BN9 A;  3EE8 A;  3OYD A;  5AQZ A;  3AAP A;  1YTU A;  4FLW A;  2IVP A;  5E26 A;  5JVG L;  1BU6 O;  3IDH A;  4CJK A;  4Y1C A;  5KTQ A;  3OS2 A;  3TAP A;  3QDK A;  3ZSW A;  3CME N;  5MLC Q;  4BRL A;  4YOX A;  4EP4 A;  4PKH A;  4MO5 A;  3V9S A;  2V52 B;  2IOC A;  3K59 A;  3P1G A;  4PWD A;  3DLL L;  1SKR A;  1TKX A;  2OCE A;  1M90 O;  1LV5 A;  4AHU A;  3NAE A;  2VQE K;  4K8X A;  3NVM A;  3IAY A;  4ICL A;  3M3Z A;  4E0D A;  1S6P A;  1IG8 A;  3ULD A;  5J2M A;  4FJI A;  4KH4 A;  2GTD A;  3AV9 A;  3DRS A;  3FR0 A;  1HKG A;  4CZH A;  1NGF A;  5EX5 A;  5C12 A;  2ASO A;  1ZBS A;  3EN9 A;  2ZQB A;  2A42 A;  3A5N C;  4NCG A;  2VG6 A;  1NJY A;  3DLG A;  3G0Z A;  4JK7 A;  4FXD A;  3NH1 A;  2G8H A;  5AQW A;  4CGH A;  3IKM A;  2OYQ A;  5DM6 L;  1WAJ A;  5KQ8 A;  5C15 A;  5BPN A;  4DTO A;  1SL2 A;  3KWG A;  1D9F A;  4NYF A;  4JKE A;  3VQ5 A;  3WXI A;  1MDU B;  4CZE A;  1OH7 A;  2Q3S A;  4GKK K;  3HST B;  1KAY A;  4M42 A;  4BDZ A;  4C8M A;  2P9I B;  1QHT A;  3S3O A;  3DLR A;  4QS8 A;  4N47 A;  1VQN N;  1B9F A;  1KVC A;  2F7T A;  2CH5 A;  4BR4 A;  3QEI A;  1NK0 A;  3QES A;  3O9R A;  3ZT4 A;  4IFY A;  1C0U A;  1MU2 A;  3F2K A;  3O4W A;  4CEF A;  2R7Y A;  3MED A;  3RMA A;  3E01 A;  3VOV A;  2V51 B;  4OJR A;  3MCA B;  1RT5 A;  1NKC A;  1VSH A;  5M1N A;  4FWM A;  2XY8 A;  5I42 A;  2OPR A;  1FK9 A;  3LDO A;  4PL7 A;  1NJI O;  4LFA K;  2W41 A;  1WSF A;  3DI6 A;  4IOA L;  4ZHR A;  2HHX A;  4YOU A;  2P1J A;  4YOV A;  1IBL K;  3CJA A;  3O5B A;  4CJE A;  5M1Q A;  4KB1 A;  3DXK B;  1X9M A;  1YUW A;  4RG8 A;  3DLB A;  5C2F A;  2KTQ A;  3B8A X;  4FLX A;  3LP1 A;  4DV6 K;  4JNE A;  4DLE A;  3QFP A;  5TKY A;  3LDS A;  4I7F A;  3OHR A;  4IZ9 A;  4YOT A;  2KQ2 A;  3D2E B;  4BWJ A;  4JKB A;  3CCJ N;  5C10 A;  4LSN A;  3J81 O;  1K6Y A;  4CJU A;  1NOY A;  3BEX A;  3ZSY A;  5AZJ A;  4O0I A;  3O08 A;  3QO9 A;  4CJW A;  5AZJ B;  4DLG A;  2D5R A;  4M3U A;  4G9Z A;  2Q2R A;  1K9M O;  2FSK A;  3VQA A;  2E1Y A;  1ZXO A;  4HTL A;  5CR4 A;  3T3F A;  3FLC O;  2NRT A;  1HYZ A;  3MXM A;  2F9T A;  1JL2 A;  5CY4 A;  1BHL A;  3PV8 A;  4CF0 A;  3L2U A;  2CGK A;  3L2W A;  3SJH A;  3OW2 M;  2O8D A;  5AZI A;  3QIC A;  1BG3 A;  4DG1 A;  3MK6 A;  4H4O A;  4B9M A;  1IH7 A;  4Y1D A;  1L3S A;  3ZT3 A;  1DT9 A;  1EP4 A;  4IEI A;  4FZX C;  3HO1 A;  3ALY A;  4DSI A;  1A5V A;  4DKW A;  4BRD A;  4KI4 A;  2Q1N A;  2O4G A;  1SKS A;  3RRH A;  2V7Y A;  4F8R A;  4CK3 A;  1NLV A;  1VSL A;  1VQ9 N;  4IOC L;  3OYN A;  1TYQ B;  4XH4 A;  3KTQ A;  3PLA A;  3RSE A;  1WBD A;  3ULE A;  1BUP A;  1WUA A;  2QTD A;  1VQ7 N;  5KPZ A;  5KPT A;  5FRN A;  3EKS A;  2ASM A;  1LAV A;  4Z4G A;  2WFB A;  3K2P A;  4HVJ A;  2P9L A;  4KBO A;  3QBX A;  4DSJ A;  1S9G A;  3EKU A;  4IOX A;  4KB0 A;  3KHY A;  1RT2 A;  4DV1 K;  3VER A;  2BUP A;  2IAJ A;  4B08 A;  4FJN A;  4HUG A;  1VSE A;  4EHU A;  1XHX A;  1NJX A;  1E4G T;  2C1G A;  1Q7Y O;  4LF6 K;  2EWS A;  2GUP A;  2IC3 A;  4MO4 A;  3CCV N;  2O8F A;  1N34 K;  1NK8 A;  2HMI A;  4IEE A;  4DF8 A;  1QQN A;  2VGN A;  5FPE A;  3VQ7 A;  3VA3 A;  1IKW A;  1HUX A;  4KFB A;  5AQN A;  3WNF A;  2FBT A;  3NGZ A;  3THX A;  4J2E A;  4BR7 A;  3LP0 A;  5I9E B;  3ZYY X;  3VQ4 A;  4B9V A;  2FXU A;  4DR2 K;  2G8V A;  3H08 A;  4WQ4 A;  4YHH K;  3H46 O;  1KQS M;  3MCP A;  2GX9 A;  5AQF A;  3RMB A;  1T6C A;  2QXF A;  4E7L A;  2BE2 A;  3V4I A;  4CJV A;  1YXQ A;  3KKR A;  4DQQ A;  4MDA A;  4K42 A;  3C95 A;  2D0O A;  2FBX A;  5J1E A;  1C1B A;  1QS4 A;  2HVI A;  4BR9 A;  5I3U A;  2QWL A;  1VSF A;  3GG4 A;  4BRQ A;  2KW4 A;  2FC0 A;  3CCL N;  4E89 A;  3O9U A;  4BG8 A;  2P9U B;  3V81 A;  2E2O A;  3DRP A;  4LFB K;  4XIU A;  3WXL A;  4OO1 J;  3A5M C;  5CZ2 A;  5C2D A;  4QCL A;  1RBT A;  4CW7 B;  4WF9 L;  2QWP A;  4HTU A;  4BWM A;  4M41 A;  3OTO K;  4BRM A;  3JS6 A;  4EZ9 A;  1N33 K;  2ZE2 A;  3TAE A;  4L8R B;  4CHP A;  3HOS A;  4FPB A;  5JLH A;  1NJW A;  4H5R A;  3TWH A;  4DQI A;  4BVP A;  3VES A;  2G8I A;  3OYM A;  2QWM A;  4CK2 A;  3K9K A;  3KIO A;  1W0H A;  2O8B A;  4B9T A;  4CJT A;  1R59 O;  1WN7 A;  3R6M A;  2HHS A;  2RN2 A;  4FLT A;  3CXC M;  1HX1 A;  3OBW A;  4IKF A;  4N5S A;  3FZH A;  1IV0 A;  4YDU A;  1GLJ O;  4WQ5 A;  3AVL A;  5AQL A;  2JGU A;  3W3D A;  4M3W A;  2FBY A;  5EY4 A;  1LW0 A;  3O80 A;  3LWL A;  1A5W A;  1NK9 A;  5FRO A;  3W0L A;  1C0M A;  4H0X B;  4LF4 K;  5KQD A;  1YHQ N;  4NCB A;  3THW A;  4M3X A;  1G15 A;  3K5M A;  2JWL A;  2PYL A;  1ASV A;  3EYZ A;  2Z1I A;  3E9O A;  3AO2 A;  1OVY A;  4F4K A;  1CXU A;  1E4F T;  3VTI A;  2ZJR L;  3AVG A;  3AO5 A;  3MX5 A;  1C1A A;  1IBK K;  1KVA A;  1BIZ A;  1S1T A;  4A61 A;  4X65 K;  3P38 A;  4Q5V A;  1LWF A;  3T7Z A;  4YOY A;  1S72 N;  3VEN A;  4DFM A;  4FWK A;  4KV8 A;  3R3L A;  4ISG A;  4ILG B;  3HPO A;  1TK8 A;  1E3M A;  1SL1 A;  3IMX A;  4JHD B;  4A2A A;  2VWB A;  5SZT A;  2ZM6 K;  4HWI A;  3NGI A;  5JLF A;  2WTU A;  1J5O A;  2P9I A;  4JKA A;  3TTC A;  4CJ7 A;  4OPA A;  4BRO A;  5LMN K;  2B4J A;  4OX9 K;  1YI2 N;  4K43 A;  3UKU A;  1RBS A;  4KHQ A;  1V4T A;  1O1W A;  3BZC A;  3WT0 A;  1Y97 A;  3LDL A;  5AQM A;  3NHG A;  3NVK A;  1ILY A;  3MMV A;  4BRC A;  3OYH A;  4HCC A;  3OYI A;  4HHT A;  1BIS A;  2EHG A;  4FW1 A;  1RT4 A;  3E9L A;  3KLH A;  3OJU A;  3HJF A;  1WSE A;  4E7K A;  4MDB A;  4KTZ A;  4CIE A;  1VRU A;  4QAG A;  4FJK A;  1WSG A;  4ZTF A;  5AQX A;  4B9L A;  1JLQ A;  3WQU A;  4EP5 A;  1NKB A;  2HHH K;  4BR5 A;  3HM9 A;  3SQ2 A;  4CHO A;  1VSI A;  1BQN A;  1U2V A;  4DS5 A;  3WQT A;  3G6E N;  4H5N A;  3V9W A;  3C65 A;  2GEL A;  4H8K A;  3DJC A;  3ZEU B;  1TL1 A;  4IO8 A;  1W7A A;  4CE9 A;  4GV9 A;  5HL7 L;  4JS5 A;  1KAX A;  1VQP N;  3ENO A;  3MN5 A;  4AHV A;  3DM2 A;  4BE7 B;  3V1R A;  3D0P A;  4CBX A;  1BOT O;  3HP9 A;  4BQZ A;  1UA0 A;  3CJ1 A;  4E72 A;  4O5B A;  3AVF A;  5ELZ A;  1ATS A;  2H3G X;  4ISE A;  4JI6 K;  3VF6 A;  3I56 N;  4ELV A;  2WUS A;  3SZ2 A;  1TK0 A;  3SQ1 A;  4DSF A;  4O5F A;  4CD3 A;  4KTW A;  2QKB A;  4EHT A;  4DWI A;  2KFZ A;  3VEY A;  5JS1 A;  3HL8 A;  1BA1 A;  1RTH A;  4FJ5 A;  3VF4 A;  4J2A A;  1HQU A;  4GW6 A;  2IVO A;  4M45 A;  1K8A O;  2HOE A;  3SPY A;  1DTQ A;  1S1U A;  4N76 A;  5F2R A;  1EKE A;  1ZBI A;  2O8C A;  1VSD A;  3TR8 A;  4B1U B;  3O9S A;  5HRP A;  4KH5 A;  3VQ6 A;  4FZY A;  4CED A;  2B5J A;  3FFI A;  1T6D A;  4C8N A;  3K5O A;  5C42 A;  4WFA L;  5KGX A;  2DY4 A;  2YHY A;  3P31 A;  2IDO A;  2P9S B;  4H0T B;  1LWE A;  3A5O C;  4FJH A;  2IIR A;  1OH6 A;  1QZ6 A;  4YOW A;  4FLV A;  5M1F A;  2HHW A;  4JV5 K;  3UKR A;  3S9H A;  3SQ0 A;  4H0Y B;  3OS1 A;  3KLF A;  1K73 O;  3VQE A;  4K41 A;  2YHW A;  2ITM A;  4JKG B;  3FZK A;  1KVB A;  4PA1 A;  1NK7 A;  5AQI A;  1YTA A;  3P4I A;  3SV4 A;  4M3Y A;  4OGE A;  4BRE A;  1S9E A;  2O8B B;  5CZ1 A;  2XHB A;  3TSU A;  2Y1I A;  3V9U A;  3CYM A;  1SZ2 A;  3EEQ A;  3IRX A;  3WXK A;  5AQS A;  4J2D A;  4Z94 A;  1Q8I A;  4CF9 A;  3ZSZ A;  3CCM N;  1FKO A;  4CEE A;  3O8M A;  1F21 A;  2A41 A;  3TU5 A;  3TPQ A;  3K0S A;  1JCE A;  3J8A A;  1RDA A;  3HM8 A;  1M1K O;  5J2P A;  3ZSQ A;  3FE1 A;  4FWO A;  1X3N A;  1HKC A;  2ZGY A;  3K5L A;  2WBN A;  3L0Q A;  3AO4 A;  2NRV A;  2D0P A;  4KRF A;  2HNY A;  4FZZ A;  3L3U A;  3MWP A;  3LDQ A;  4QOZ B;  4LY7 A;  2QKK A;  3VQB A;  4CIG A;  4RW9 A;  2YHA A;  4BR2 A;  1RDU A;  4B3M K;  4KO0 A;  4HCB A;  3V1Q A;  3RMC A;  4FWN A;  2RF2 A;  3N4P A;  5FLX O;  5AQR A;  4AQY K;  2O8E A;  3AA3 A;  3ITH A;  4IG3 A;  1REV A;  4CHY A;  2PAV A;  1IKY A;  4I6M B;  4CBW A;  3CI5 A;  2KFN A;  2A40 A;  4DV4 K;  3CJC A;  3HT3 A;  1RBR A;  4DQ8 A;  3QML A;  5AFU H;  4OVL A;  1BGX T;  1QVF M;  1C0T A;  3ATU A;  3HK2 A;  4DSK A;  3SPZ A;  1YJW N;  3VEW A;  1IKX A;  4OPH A;  1TGO A;  1NWK A;  4JK9 A;  4BAC A;  5AQU A;  4PQU A;  3I8B A;  3ID6 A;  3FZM A;  3CPE A;  3C6T A;  1JLF A;  1NGC A;  3OYF A;  1XMQ K;  4CEB A;  3C6H A;  5BPM A;  2P9K A;  4FJM A;  3SNN A;  2DFH A;  3T1Y K;  3OYL A;  4NXN K;  2P9S A;  3HRG A;  4Y0W A;  3FZL A;  1ITG A;  4ILH A;  1DKG D;  3ZET A;  3DWL A;  3TAN A;  4DMN A;  4CHQ A;  4B1W B;  3OYJ A;  1HJR A;  2W42 A;  4KH6 A;  3AY9 A;  5E41 A;  2VG7 A;  3ZT1 A;  3KLI A;  4Z4H A;  3SUP A;  1DTT A;  3K58 A;  1KCF A;  2X74 A;  4OKK A;  1CLQ A;  2VWK A;  3EO3 A;  3AVH A;  2A5X A;  5SWM A;  1L5U A;  4KHP K;  5LMU K;  1BQM A;  1Q82 O;  2GWJ A;  5AQT A;  2YJF A;  4DR6 K;  4JN4 A;  2Q97 A;  5GAE P;  2HF3 A;  3B6P A;  5LL6 Z;  4DS4 A;  2QEX N;  3CJB A;  1KAZ A;  2ATQ A;  2QWR A;  3LDP A;  1U6Z A;  3H3N O;  1L3T A;  5KI6 A;  3HXM A;  2FLO A;  3DLK A;  3QNO A;  1RDC A;  3KWI A;  4JKC A;  1NGH A;  3MN6 A;  4E1N A;  3L3V A;  2KZM A;  4DR5 K;  3HYF A;  5ADX A;  4AH9 A;  2HBJ A;  2WON A;  4ZTJ A;  4N41 A;  4DU1 A;  2QM1 A;  4DUZ K;  3SAH A;  1JLE A;  1SQK A;  5GAD P;  3EY1 A;  4H4M A;  3T69 A;  2UXC K;  4WQ5 C;  4H0V B;  3UB5 A;  5JMV A;  4RTF D;  4CJ3 A;  4I6M A;  1D5A A;  4H5W A;  3H3O B;  2BDP A;  2GEM A;  3U9D A;  1ESV A;  5BPL A;  3PIO L;  1DEJ A;  1EWQ A;  3AVC A;  1WSH A;  2D0C A;  3HSC A;  4WYB A;  1S1X A;  4DR3 K;  3GOI A;  3Q7B A;  3PSI A;  4W5Q A;  4DUY K;  3ULE B;  1HNX K;  3KJV A;  2W6K A;  1JL1 A;  1LW2 A;  5F0X A;  1JLA A;  4CFA A;  4DV0 K;  4FW2 A;  3ISN C;  4GVM A;  3S3M A;  1N5Y A;  4FWS A;  1QHA A;  1X9W A;  1P90 A;  3D2F B;  1SS6 A;  1P8Z A;  4M7Y A;  2QWQ A;  5LJW A;  2DPN A;  4JI0 K;  3CCR N;  5M1P A;  4B3T K;  5BR8 K;  1WAF A;  4OLB A;  4XH5 A;  3VGL A;  2UUC K;  4EAH D;  1IJJ A;  1RT1 A;  2CH6 A;  5AQH A;  1TKZ A;  2KZZ A;  4FL9 A;  4BC2 A;  5HLF A;  3HPG A;  4DHY A;  3L2Q A;  3VQD A;  1Z26 A;  2D0A A;  1NGB A;  3K9J A;  1HMV A;  3IG1 A;  1CXQ A;  4CZM A;  1RGI A;  2GV9 A;  3CJ9 A;  1VQ6 N;  3QIN A;  3O6W A;  4U67 L;  4DR7 K;  1NGG A;  4C8L A;  4C8O A;  1HPZ A;  2VCP A;  4CF1 A;  1JCF A;  1GLD G;  3WEE A;  4BEB A;  3BUZ B;  4B1V A;  4WQ4 C;  4BRA A;  2EX3 A;  4E1M A;  3K5N A;  3SBG A;  2A1S A;  4IO9 L;  4C8K A;  2P51 A;  1YVU A;  4FWR A;  5HRO A;  3TSP A;  2O8E B;  3MAQ A;  3QEX A;  1KLM A;  5HRS A;  3THY B;  4UY8 O;  3MXJ A;  1S1V A;  3AGK A;  3MEG A;  5AQQ A;  5AQV A;  3V6D A;  3AVJ A;  3T1H K;  3R9P A;  1XI1 A;  3A8Y A;  4KPY A;  5IWA K;  4H0O A;  3NGY A;  4JI4 K;  3SMP A;  2P9P A;  1ZC6 A;  3I0R A;  3A2F A;  4CF2 A;  4ILJ A;  1KXP A;  2YKM A;  1NNE A;  3O3F A;  2RPI A;  4BR0 A;  3ZT2 A;  4W5R A;  4NO7 A;  2P9N A;  4BE2 A;  3LDN A;  3RR8 A;  3PX6 A;  4YDU C;  1Z25 A;  2W6L A;  1MWK A;  1SAZ A;  2P9N B;  3QFU A;  4CIF A;  5AQG A;  1Y64 A;  3VA0 A;  1HQE A;  3M6G A;  3IFR A;  4CEO A;  4BDY A;  2FF3 B;  2QA4 N;  3BDP A;  3CCQ N;  2X6S A;  1CZA N;  2NNW A;  2HW3 A;  2QK9 A;  4FJG A;  4FPA A;  1NKE A;  4E19 A;  1SKW A;  1RDB A;  1U48 A;  4DSL A;  3F73 A;  3IS9 A;  5JS2 A;  3S3N A;  1SV5 A;  4DQP A;  5HRR A;  3O1W A;  1QZ5 A;  4RW6 A;  3V9Z A;  1U04 A;  1XUP O;  5JVH L;  4CGD A;  1VQK N;  3CD6 N;  4GKJ K;  4F3O A;  3O9T A;  1T8E A;  3HVR A;  2W00 A;  3OYC A;  1S3X A;  1NOZ A;  5EXW A;  3G71 N;  4B3R K;  5GIP A;  1YJN N;  1C1C A;  4KAZ A;  4PKI A;  2G8W A;  3SAF A;  2D0B A;  5KRS A;  3OS0 A;  3V9X A;  3ZX3 A;  3LAM A;  2E6L A;  4Z0U A;  4LFC K;  1BL3 A;  4ID1 A;  2YHX A;  1NGA A;  3M8P A;  3SK3 A;  1BO5 O;  2YNI A;  4RW7 A;  2I5J A;  4FJ7 A;  3ATV A;  1K8K A;  4AM6 A;  2XY7 A;  4BC3 A;  2P9U A;  3DXM A;  4KRE A;  1V4S A;  4JI7 K;  4H5T A;  4CJ5 A;  4DTU A;  2E5L K;  1BCM A;  3OJS A;  4BY9 C;  4R5P A;  2ZF5 O;  4JLH A;  3VQP A;  4CJL A;  3H45 C;  3TAB A;  2NRW A;  2Q0U A;  4NYN A;  4RW8 A;  4PL8 A;  4CD1 A;  1WOQ A;  3DXK A;  2HHT A;  2UUA K;  4OKE A;  1Q86 O;  2IVN A;  1BWF O;  4BRK A;  3KK2 A;  1ATR A;  4DTM A;  2G8K A;  2P9L B;  2WC9 A;  1KFS A;  4TSX A;  4DTX A;  4JRQ A;  1IBM K;  1NK5 A;  1QSY A;  4H5V A;  2P9K B;  2E88 A;  1VRT A;  5CE3 A;  2E4L A;  4AHR A;  4NB4 A;  3R8E A;  3ZEU A;  1I94 K;  3PO4 A;  4M3T A;  4JKH A;  2D4W A;  4DV2 K;  4M63 C;  1XNR K;  1GLF O;  2HMP A;  4FJ9 A;  3KZB A;  2OPS A;  1D4X A;  1HNZ K;  1KTQ A;  1U45 A;  1FXX A;  4V19 S;  3AVN A;  1BIU A;  3M8S A;  3V1O A;  1RIL A;  3G4S N;  2RE2 A;  3DYA A;  4JD2 A;  3L2R A;  3LP3 A;  3QIP A;  3BF3 A;  1LWC A;  5FRM A;  1TAU A;  1HRH A;  3QLH A;  1H1V A;  5J2Q A;  1YIT N;  1ASW A;  3CQX A;  3HI0 A;  4YY3 K;  4CZI A;  1FW6 A;  4GNI A;  2Y1J A;  3TTD A;  4BE1 A;  1T7P A;  3OYK A;  2HHV A;  1W9H A;  4DV5 K;  2X78 A;  3F5T A;  3U4L A;  1KRP A;  4DTR A;  3D6R A;  1T3V A;  5K14 A;  4OPJ A;  5BRF A;  4DV7 K;  2QI2 A;  3L2V A;  4GV3 A;  5JIC A;  2E1Z A;  4DQS A;  4C23 A;  1SUQ A;  2QW9 A;  2O4I A;  2D1K A;  1B92 A;  1A5X A;  4WCE L;  5FPN A;  3O3G A;  2ETJ A;  4CF8 A;  5D3G A;  1S1W A;  1VQL N;  3ENH A;  4FJX A;  4B3O A;  1GLL O;  4JI3 K;  3EZW A;  4AM7 A;  3PO5 A;  1ZBF A;  2OZM A;  2ITG A;  2O8C B;  1S22 A;  2P5G A;  2HB5 A;  1X9J A;  5KPR A;  2GUI A;  3VEO A;  2DTU A;  5KRT A;  1NU0 A;  4CZK A;  1ZYQ A;  1DGK N;  4CHZ A;  4K25 A;  3VEX A;  1X1P A;  3ZET B;  3EZ5 A;  5GIO A;  4B9N A;  4O8K A;  3O3H A;  3NBP A;  3CCS N;  1IG9 A;  3CC7 N;  1TK5 A;  2VQF K;  3NMU A;  4BE0 A;  3M8Q A;  4X66 K;  3SQ4 A;  4B3S K;  4BC5 A;  4JKF A;  3ENB A;  2A1R A;  3GDQ A;  4BC4 A;  3TAR A;  5KGW A;  1JLB A;  5AQO A;  3SUO A;  4DR1 K;  3GE1 A;  1OVQ A;  1JXB A;  1I3A A;  3KLG A;  1U49 A;  4KHS A;  3P5J A;  2E2N A;  1BA0 A;  2F8S A;  3LPT A;  2VWJ A;  4F2R A;  1HNW K;  5CHI A;  1ZBU A;  4CEC A;  3CYG A;  3JXU A;  4JS4 A;  4CFD A;  5GAG P;  3CJ7 A;  4E7H A;  4QS9 A;  2A3Z A;  4DSE A;  4XEI A;  3NF6 A;  2HBL A;  1KSP A;  1U2V B;  1N36 K;  3E66 A;  3AAR A;  1VQM N;  2YHB A;  3DLE A;  4O55 A;  4AHT A;  1D9D A;  4F2S A;  1U47 A;  4H03 B;  3AO3 A;  2IS3 A;  3HPH A;  2F96 A;  4XJX A;  3DMJ A;  1WNS A;  5T7B A;  3QBW A;  5FPD A;  1CZ9 A;  3VQ9 A;  5CYQ A;  3J7Y P;  1EET A;  4CBU A;  2E20 A;  3SV3 A;  2KLA A;  1Z6R A;  5AQJ A;  2I7P A;  1HLU A;  3HP6 A;  3GL1 A;  2VG5 A;  4DTN A;  1TL3 A;  1NK6 A;  5H1S Q;  3CC4 N;  3KK7 A;  4CJP A;  4B9S A;  3ID8 A;  4U7B A;  1N6Q A;  3PSF A;  1OKJ A;  5DM7 L;  2ZJQ L;  3SUN A;  3AA4 A;  2GBZ A;  4XH1 A;  2AP1 A;  3UE5 A;  1X3M A;  4CVN E;  5C0Y A;  4JI2 K;  2UUB K;  4WFN L;  3KKS A;  3TI0 A;  4B1X B;  5FPM A;  3LM2 A;  4DFJ A;  3M1F A;  4OKJ A;  1L3V A;  3J7Z O;  1I39 A;  2CGJ A;  3NFA A;  3FGU A;  3EL2 A;  1VSK A;  4CEQ A;  3L8B A;  3A5L C;  3MWT A;  4ID5 A;  4QS7 A;  2NZT A;  4O4G A;  2E2Q A;  5HRN A;  1X9S A;  2E2P A;  2HF4 A;  4IDK A;  3I55 N;  5AQP A;  1YF5 L;  3D2F A;  3TTF A;  4DFP A;  1EX4 A;  1TV6 A;  3LAK A;  3JSM A;  3CQY A;  4DFK A;  4FCY A;  3THV A;  1QE1 A;  3D2E A;  2Q31 A;  4B1Z A;  5EU7 A;  1B9D A;  1QQM A;  3EE9 A;  1JJ2 M;  2XY5 A;  3G10 A;  2IGI A;  4CI6 A;  3LZI A;  4GV6 A;  4CEZ A;  4HUF A;  3OVN A;  4A5A A;  4E3S A;  3CQ8 A;  2HVH A;  1RDW X;  3VET A;  1D8Y A;  3AVA A;  1R0A A;  1NMD A;  5EOY A;  4FLZ A;  1QQC A;  2ZWH A;  1VQ8 N;  3F9M A;  1NJZ A;  3ZCM A;  4RWT A;  4J2B A;  3O1B A;  4PHT X;  2AA4 A;  1GLC G;  5A2Q O;  4KI6 A;  4BEC A;  1FJG K;  2PZS A;  3KVG A;  1RNH A;  4YFU A;  2JWK A;  2G8U A;  4FYD A;  1Q9Y A;  4CZL A;  1TAQ A;  4MQ3 A;  5TKW A;  3BGR A;  4FK2 A;  1NG9 A;  2ZGZ A;  1YIJ N;  1HKB A;  3S5T A;  4NXM K;  3T19 A;  1YVN A;  1NGE A;  4DTS A;  3R1X A;  4B9U A;  3U3Y A;  1HPM A;  1QVG M;  1RTD A;  2C1I A;  3DRR A;  3HBT A;  5BRE A;  1GOA A;  2O8D B;  4FLU A;  3CF5 L;  3CG7 A;  4FOE A;  3KK3 A;  3SCX A;  3F9K A;  2ASP A; 
#chains in the Genus database with same CATH homology
 3BUZ B;  3L6Q A;  4JHD B;  2VWB A;  4A2A A;  2YCH A;  3VEV A;  3WXM B;  3C7N B;  4L3Q A;  4WQ4 C;  4B1V A;  2NRH A;  4BRA A;  3SBG A;  3CPW M;  5AZI B;  4IO9 L;  4HWI A;  4FWR A;  5JLF A;  3L4I A;  3TSP A;  3VGK A;  2P9I A;  4JKA A;  5AR0 A;  3TTC A;  4CJ7 A;  3UKU B;  1KD1 O;  4OPA A;  1VQ5 N;  4BRO A;  4UY8 O;  3AGK A;  5E84 A;  5BN9 A;  3EE8 A;  1YI2 N;  4K43 A;  5AQQ A;  5AQV A;  3UKU A;  5AQZ A;  2F9W A;  3AAP A;  3I33 A;  1VAZ A;  2IVP A;  5E26 A;  3R9P A;  5JVG L;  1V4T A;  1BU6 O;  3A8Y A;  3VGM A;  5GIN A;  3WT0 A;  4H0O A;  3LDL A;  3IDH A;  3SMP A;  3D7E O;  2P9P A;  5AQM A;  1ZC6 A;  3QDK A;  4BRN A;  3NVK A;  3CME N;  1LCU A;  1ILY A;  4ILJ A;  5MLC Q;  3MMV A;  4B1Y B;  1KXP A;  4BRL A;  4YOX A;  4BRC A;  1Z05 A;  4MO5 A;  4NLB A;  4PKH A;  4BR0 A;  4NO7 A;  2V52 B;  3UKR B;  2P9N A;  3LDN A;  1NBW A;  3U8X A;  1MA9 B;  4YDU C;  3S41 A;  3E9L A;  1MWK A;  2YI1 A;  4BG9 A;  1SAZ A;  2P9N B;  3QFU A;  4BRF A;  3DLL L;  5AQG A;  1Y64 A;  1TUY A;  4MDB A;  3M6G A;  3CET A;  3IFR A;  1M90 O;  4BRI A;  5AQX A;  3WQU A;  2FF3 B;  2YX6 A;  3NVM A;  3CC2 N;  2QA4 N;  3CCQ N;  4BR5 A;  3M3Z A;  1CZA N;  2NNW A;  1IG8 A;  3C0B A;  1U2V A;  3WQT A;  4FPA A;  1Q81 O;  3G6E N;  4KH4 A;  3IUC A;  2GTD A;  4H5N A;  3C65 A;  2GEL A;  4LC9 B;  4A2B A;  3DJC A;  3ZEU B;  3FR0 A;  4BRG A;  1HKG A;  4IO8 A;  4JKD A;  4CZH A;  2V7Z A;  4GV9 A;  1NGF A;  2PFU A;  5EX5 A;  3U9Z A;  1NM1 A;  5C12 A;  5HL7 L;  2ASO A;  1ZBS A;  3O1W A;  1KAX A;  3EN9 A;  4YOR A;  1VQP N;  3ENO A;  2A42 A;  1QZ5 A;  1XUP O;  3A5N C;  5JVH L;  4GVE A;  3MN5 A;  4BRP A;  4JK7 A;  1VQK N;  3CD6 N;  4BE7 B;  5AQW A;  3O9T A;  3IKM A;  4CZF A;  4CBX A;  2W00 A;  1BOT O;  4BQZ A;  1S3X A;  2W40 A;  3BP8 A;  3CJ1 A;  4ISF A;  2HST A;  5BRD A;  5EXW A;  5C15 A;  5KQ8 A;  5DM6 L;  3G71 N;  5GIP A;  5BPN A;  1YJN N;  4H0P A;  5ELZ A;  1ATS A;  2H3G X;  3KWG A;  4ISE A;  4PKI A;  3VF6 A;  4JKE A;  4A57 A;  3WXI A;  1MDU B;  3SAF A;  3I56 N;  4CZE A;  2WUS A;  3ZX3 A;  1KAY A;  2BTF A;  4O5F A;  4CD3 A;  2YHX A;  1NGA A;  3SK3 A;  4EHT A;  2FSJ A;  2P9I B;  1BO5 O;  3DAW A;  3VEY A;  4PKG A;  4QS8 A;  4JAX A;  3SLC A;  3MN7 A;  4O8U A;  1VQN N;  1BA1 A;  2F7T A;  2CH5 A;  3VF4 A;  4BR4 A;  1G99 A;  3RVC A;  2OAN A;  3O9R A;  3ATV A;  2VGM A;  2IVO A;  3Q7C A;  4EIA A;  5EVZ A;  1K8K A;  4AM6 A;  1YJ9 N;  3F2K A;  3O4W A;  2P9U A;  3DXM A;  4BC3 A;  1K8A O;  1V4S A;  2HOE A;  4A62 A;  4H5T A;  5F2R A;  3VOV A;  2V51 B;  3FFK B;  5GAH P;  3C7N A;  3MCA B;  4B1U B;  3O9S A;  4KH5 A;  5M1N A;  3MN9 A;  4FWM A;  4BY9 C;  3H6E A;  2ZF5 O;  3H45 C;  1T6D A;  2NRW A;  2Q0U A;  3PIP L;  4WFA L;  4PL8 A;  5B8H A;  4CD1 A;  1WOQ A;  3DXK A;  2YHY A;  3LDO A;  3P31 A;  2P9S B;  4PL7 A;  2QWN A;  1NJI O;  4M7X A;  1NGJ A;  1BDG A;  2W41 A;  4J8F A;  4IOA L;  1Q86 O;  4H0T B;  3A5O C;  2IIR A;  2IVN A;  1BWF O;  4BRK A;  4BGA A;  1QZ6 A;  1ATR A;  4YOU A;  4YOW A;  4YOV A;  2P9L B;  2WC9 A;  3CJA A;  3O5B A;  5M1F A;  5M1Q A;  3DXK B;  3UKR A;  3L4Q A;  4R79 A;  1YUW A;  4H5V A;  2P9K B;  2KHO A;  4H0Y B;  2E88 A;  3AGR A;  4FWQ A;  4FO0 A;  5CE3 A;  1K73 O;  5C2F A;  1GLA G;  3B8A X;  2OTL N;  4NB4 A;  4K41 A;  2YHW A;  3R8E A;  2ITM A;  4JNE A;  3ZEU A;  4BQL A;  4JKH A;  4JKG B;  3FZK A;  2D4W A;  3QFP A;  4M63 C;  4BVO A;  1GLF O;  2CGL A;  5AQI A;  5TKY A;  3P4I A;  2HMP A;  3OHR A;  4IDH A;  4IZ9 A;  5M1K A;  4BRE A;  1XQS C;  4C1N I;  3KZB A;  4YOT A;  1D4X A;  3D2E B;  2GWK A;  3TSU A;  4JKB A;  5LJV A;  3CCJ N;  5C10 A;  1SZ2 A;  3N4Q A;  3WXK A;  2J4R A;  5AQS A;  3BEX A;  4Z94 A;  5AZJ A;  3G4S N;  2RE2 A;  4JD2 A;  3O08 A;  3BF3 A;  5AQY A;  3CCM N;  4RCH A;  2VYP A;  5AZJ B;  3O8M A;  3OBY A;  4G9Z A;  2A41 A;  1H1V A;  3C6A A;  3E1Y A;  2Q2R A;  1YIT N;  3CER A;  3CQX A;  1K9M O;  3TU5 A;  3TPQ A;  2FSK A;  1JCE A;  4FWL A;  3J8A A;  2E1Y A;  3HM8 A;  1ZXO A;  3HI0 A;  4HTL A;  2HBM A;  4CZI A;  5CR4 A;  4GNI A;  2Q36 A;  1M1K O;  3QB0 A;  4IXC A;  3FE1 A;  3TTD A;  4FWO A;  1GLB G;  1X3N A;  2NRT A;  3FLC O;  1HKC A;  2ZGY A;  2WBN A;  2F9T A;  4JD2 B;  3L0Q A;  3F5T A;  3U4L A;  4IJN A;  2NRV A;  2D0P A;  4BEB A;  3D6R A;  1T3V A;  2CGK A;  3SJH A;  2A6A A;  5BRF A;  3OW2 M;  5AZI A;  2QI2 A;  4GV3 A;  5JIC A;  2E1Z A;  3QIC A;  1EO1 A;  1NGI A;  3MWP A;  1BG3 A;  1W97 L;  3LDQ A;  4C23 A;  3MK6 A;  2QW9 A;  3DXM B;  2Q0R A;  1DT9 A;  4BR2 A;  2D1K A;  1RDU A;  4IEI A;  4FVU A;  4WCE L;  5FPN A;  4IWV A;  4DKW A;  4FWN A;  4BRD A;  3N4P A;  5AQR A;  3WEE B;  2HBK A;  2Q1N A;  3H1Q A;  1TYQ A;  1VQL N;  3ENH A;  2PAV A;  1GLL O;  3RSE B;  3EZW A;  4I6M B;  4AM7 A;  4CBW A;  3CI5 A;  2A40 A;  2V7Y A;  3CJC A;  4DQ8 A;  3QML A;  5AFU H;  1NLV A;  3HZ6 A;  1QVF M;  1S22 A;  3ATU A;  1VQ9 N;  1X9J A;  5KPR A;  4IOC L;  3G25 A;  1TYQ B;  3SMS A;  3VEO A;  4XH4 A;  5AFU A;  1YJW N;  3PLA A;  3VEW A;  3RSE A;  4OPH A;  3OA9 A;  3ULE A;  4JEP A;  1BUP A;  4CZK A;  1WUA A;  2QTD A;  1VQ7 N;  1JCG A;  5KPZ A;  1NWK A;  1DGK N;  5KPT A;  4JK9 A;  3EKS A;  5AQU A;  2ASM A;  3I8B A;  2QXL A;  3ID6 A;  4K25 A;  2WFB A;  3HTV A;  3VEX A;  4IJA A;  2P9L A;  3ZET B;  5GIO A;  4KBO A;  3QBX A;  4O8K A;  3FZM A;  3CPE A;  3CCS N;  4DB3 A;  1N8R O;  1VQ4 N;  1NGC A;  1KC8 O;  3C6H A;  3EKU A;  4E1J A;  3WEE A;  2P9K A;  5BPM A;  4JKG A;  3CC7 N;  3NMU A;  4IOX A;  1XC3 A;  2P9S A;  3KHY A;  4BC5 A;  3E9P A;  3HRG A;  4JKF A;  3VER A;  3ENB A;  2BUP A;  4Y0W A;  3FZL A;  3GDQ A;  4ILH A;  4BC4 A;  4EHU A;  1DKG D;  3ZET A;  3DWL A;  2C1G A;  1E4G T;  5AQO A;  1Q7Y O;  2EWS A;  2GUP A;  3GE1 A;  4B1W B;  3VF2 A;  3CCU N;  4KH6 A;  4MO4 A;  3CCV N;  3AY9 A;  3BF1 A;  5F1X A;  2E2N A;  1BA0 A;  1ATN A;  1C0G A;  2YJE A;  4IEE A;  5CHI A;  1QQN A;  2VGN A;  3JXU A;  4BRH A;  5FPE A;  3MDQ A;  3EO3 A;  3HOT A;  1VQO N;  1HUX A;  1T44 A;  3M5R A;  1TUU A;  5GAG P;  5AQN A;  3CJ7 A;  4BR7 A;  2A5X A;  4QS9 A;  4A59 A;  2A3Z A;  2UYT A;  4FSV A;  5I9E B;  4XEI A;  3GBT A;  3ZYY X;  1Q82 O;  2GWJ A;  2HBL A;  5AQT A;  2YJF A;  2FXU A;  4JN4 A;  2Q97 A;  1U2V B;  5GAE P;  2HF3 A;  1YAG A;  1QQO A;  4WQ4 A;  3E66 A;  2QEX N;  3AAR A;  3CJB A;  3H1V X;  1KAZ A;  3H46 O;  3MCP A;  3CMA N;  2GX9 A;  5AQF A;  1KQS M;  1VQM N;  2QWR A;  3LDP A;  1U6Z A;  3H3N O;  4H03 B;  2E8A A;  1T6C A;  3VTH A;  2FLO A;  4XJX A;  1YXQ A;  2I7N A;  3KWI A;  3QBW A;  1GLE G;  1NGH A;  3MN6 A;  4JKC A;  4MDA A;  4K42 A;  5FPD A;  5LY3 A;  4CBU A;  5ADX A;  2D0O A;  2E20 A;  2KLA A;  1Z6R A;  2HBJ A;  2NLX A;  5AQJ A;  3WUH A;  2I7P A;  1HLU A;  2RHK A;  5ADX H;  3GL1 A;  2QM1 A;  4BR9 A;  2QWL A;  3SAH A;  3GG4 A;  4MLE A;  3ZX2 A;  1SQK A;  4BRQ A;  5GAD P;  4F9O A;  3T69 A;  5H1S Q;  3CC4 N;  3CCL N;  4WQ5 C;  4H0V B;  3KK7 A;  3UB5 A;  2NRZ A;  4RTF D;  1NGD A;  1Q18 A;  5JMV A;  3ID8 A;  3O9U A;  4I6M A;  4BG8 A;  2P9U B;  4H5W A;  3VEZ A;  3H3O B;  4U7B A;  1OKJ A;  2E2O A;  2GEM A;  3U9D A;  4A5B A;  1ESV A;  5BPL A;  5DM7 L;  1DEJ A;  3PIO L;  2ZJQ L;  4XH1 A;  2AP1 A;  4CZJ A;  3WXL A;  3UE5 A;  1X3M A;  1K8K B;  4FWP A;  4OO1 J;  5C0Y A;  3A5M C;  4DCH A;  3FZF A;  3LM9 A;  5C2D A;  4WFN L;  3HSC A;  4FOI A;  5M1O A;  4WYB A;  4B1X B;  4WF9 L;  5FPM A;  1W2B M;  3GOI A;  2QWP A;  3LM2 A;  3P39 A;  3M1F A;  3Q7B A;  4JK8 A;  3SBT A;  3VPZ A;  5BR9 A;  3J7Z O;  4BRM A;  1RFQ A;  3JS6 A;  3ULE B;  2CGJ A;  3FGU A;  2P9P B;  3EL2 A;  3LL3 A;  3TSQ A;  3HOS A;  5F0X A;  4C1N K;  3A5L C;  4FPB A;  3MWT A;  5JLH A;  2ZJP L;  4H5R A;  2NRR A;  4QS7 A;  2NZT A;  3SAG A;  4BVP A;  2E2Q A;  3VMF B;  3VES A;  5AQK A;  4FWS A;  2E2P A;  1QHA A;  2HF4 A;  2QWM A;  4B9Q A;  3WXJ A;  3K9K A;  1P90 A;  4WFB L;  3D2F B;  1SS6 A;  1P8Z A;  3I55 N;  4M7Y A;  2QWQ A;  5AQP A;  5LJW A;  3CCE N;  2DPN A;  1R59 O;  5BRH A;  3R6M A;  1YF5 L;  3AAQ A;  3D2F A;  3TTF A;  3CXC M;  3CCR N;  5M1P A;  1HX1 A;  1O13 A;  3OBW A;  2FSN A;  2NRX A;  3CQY A;  3FZH A;  3D2E A;  2BH1 A;  4XH5 A;  1C0F A;  2Q31 A;  2FF6 A;  3VGL A;  4B1Z A;  4YDU A;  1GLJ O;  1JJ2 M;  1QQM A;  3EE9 A;  4IFE A;  4WQ5 A;  4EAH D;  1IJJ A;  4CI6 A;  4GV6 A;  5AQL A;  2CH6 A;  4A5A A;  3W3D A;  5AQH A;  1RDW X;  5EY4 A;  3VET A;  3O80 A;  1NMD A;  3CHW A;  4FL9 A;  5EOY A;  3W0L A;  1LOT B;  2ZWH A;  2QWO A;  1VQ8 N;  3F9M A;  4BC2 A;  4RWT A;  3O1B A;  4PHT X;  4H0X B;  2AA4 A;  5KQD A;  1GLC G;  1YHQ N;  1EQY A;  4BEC A;  4GY2 B;  3KVG A;  4CZG A;  5BN8 A;  2JWK A;  2PBD A;  2JWL A;  4DHY A;  4CZL A;  3CIP A;  1J6Z A;  3E9O A;  5TKW A;  1HJO A;  1OVY A;  1NGB A;  3K9J A;  2KKZ A;  1E4F T;  3VTI A;  3MX2 A;  2ZJR L;  5HOO A;  3O9Q A;  1MWM A;  2ZGZ A;  4CZM A;  1YIJ N;  1HKB A;  1RGI A;  3MX5 A;  3CJ9 A;  4JHD A;  1YVN A;  1VQ6 N;  4A61 A;  1NGE A;  3P38 A;  3R1X A;  3A0I X;  3O6W A;  4NLC A;  4U67 L;  1HPM A;  3T7Z A;  1NGG A;  4YOY A;  1S72 N;  1QVG M;  2C1I A;  3HBT A;  5BRE A;  3VEN A;  3CF5 L;  4EFH A;  4FWK A;  4AF1 A;  2VCP A;  4MLH A;  2OTJ N;  4FOE A;  3R3L A;  4ISG A;  4ILG B;  3ZX0 A;  1JCF A;  4BGB A;  1GLD G;  2ASP A;  3IMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...