2P9SA

Structure of bovine arp2/3 complex co-crystallized with atp/mg2+
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
414
structure length
397
Chain Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 127
structure length 397
sequence length 414
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 2p9sA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9sA04
2P9NA 2CGJA 5AQSA 3ZEUA 4PL7A 4H5RA 4JD2A 3VF6A 4E1JA 1NGFA 5AQLA 5AFUA 1BWFO 4WYBA 4PKHA 4M7XA 3A5OC 4BC3A 3FR0A 1X9JA 2YJFA 4BGAA 5BREA 1MA9B 4H03B 1IJJA 4MO5A 1LOTB 2VWBA 4B9QA 4RCHA 2IVPA 5AQVA 4A61A 3GOIA 3O4WA 5JLHA 1NMDA 2AP1A 3HI0A 4KBOA 4XH5A 3WEEA 3H3NO 4BQLA 2H3GX 5LJWA 4A2BA 5EY4A 2P9PA 3ZETB 2GWKA 1NGEA 4WQ5C 1U2VA 3GDQA 2NZTA 2A42A 3D2EA 5AQPA 1BA1A 3LDLA 3D2FA 3L0QA 4I6MB 3R6MA 3VF2A 5BPMA 5EOYA 5BRDA 2QM1A 3UKUA 4JHDB 4O5FA 4CBUA 1MDUB 1TYQB 2OANA 2A3ZA 1DKGD 3C0BA 1JCEA 5JICA 4EAHD 2EWSA 5AQHA 3VESA 4H0PA 3FE1A 4CZJA 5TKYA 4DHYA 3W0LA 5AZJB 4WQ4A 2P9KA 3MMVA 4EHUA 1C0FA 3SMPA 2VCPA 1WUAA 1T6DA 3MDQA 5AQOA 3IDHA 3VGMA 1JCGA 5AQTA 3QBWA 3BF3A 4BC5A 2YHXA 2E2QA 4QS8A 4DB3A 1YUWA 5BN9A 3QB0A 3RSEB 3C7NB 4CZEA 5JMVA 1U6ZA 1MWKA 3WT0A 4BRGA 3CQXA 2A6AA 4EHTA 5ADXA 5B8HA 4BVOA 4I6MA 4B1WB 1KAXA 2PAVA 3HTVA 1BA0A 3ULEB 4BRQA 3CETA 1BDGA 1QHAA 4H0YB 1K8KB 5JLFA 1XC3A 4RWTA 4IJNA 3VPZA 2NRHA 5AQJA 4IJAA 1SZ2A 1YVNA 4CZMA 1GLCG 5AQQA 5AQUA 2P9IB 3EKSA 4FWMA 5BR9A 2P9NB 3ZEUB 1ZC6A 5E26A 2A5XA 1P8ZA 4J8FA 4JD2B 3DXMA 3HSCA 3MN5A 1ZXOA 2V51B 3UB5A 5KPZA 4CZIA 3ATUA 3EL2A 5FPDA 3WXJA 4AM7A 3ZX0A 3LDQA 1GLBG 1NGJA 2HF4A 1YAGA 2E2PA 2YCHA 3U9DA 1KAZA 1GLFO 4XH4A 1BUPA 2I7PA 3WEEB 1QQOA 4YDUC 2P9PB 3EZWA 3CHWA 5AQIA 3MK6A 1U2VB 4BG9A 1T44A 3ATVA 3M1FA 3D2EB 4CJ7A 3AAQA 4EIAA 5E84A 3D2FB 1X3NA 2BUPA 3CJBA 3UKUB 1JCFA 3AARA 3U4LA 1HJOA 2FSNA 5F1XA 3SLCA 2YJEA 4FSVA 1T6CA 3FZLA 3QBXA 4H0OA 4B1UB 1ATSA 4BRFA 5KPTA 3OHRA 3CI5A 5LJVA 2P9KB 5KQDA 2Q2RA 3FFKB 3QICA 4H5WA 4FWQA 4FWOA 3VOVA 3I8BA 4FWPA 1HLUA 3A5NC 3O8MA 3O80A 2E2OA 2V52B 2CGKA 1BOTO 2GTDA 1QZ6A 4CZKA 2QWQA 3HM8A 2ZGZA 1RFQA 4EFHA 5AQGA 4PKIA 4H0XB 4BR9A 4HWIA 4DQ8A 3W3DA 1C0GA 3A5LC 2NLXA 3CJ1A 4M7YA 1IG8A 4C23A 3B8AX 1NGDA 5CE3A 1Y64A 4CZLA 4FWKA 3SJHA 2ASPA 1V4TA 2F9WA 4BG8A 2W41A 1S3XA 5F0XA 3LDNA 3CERA 3AY9A 4M63C 4BRNA 4Z94A 5ELZA 3KHYA 3J8AA 4JN4A 4CI6A 5BRHA 3DAWA 4FWLA 3DXMB 2HF3A 4AM6A 2HMPA 2E2NA 2YHYA 1Z6RA 4IWVA 4JAXA 3FGUA 2ZWHA 2A40A 1WOQA 1HPMA 3LDOA 4IXCA 5AQNA 1HX1A 2QWOA 3LM2A 1ATNA 5BRFA 4B1ZA 4BRPA 4FWNA 3DXKA 2D4WA 3TU5A 2Q31A 4CBWA 3AAPA 5BN8A 3R8EA 3QMLA 4BC2A 4BRLA 1QZ5A 1R59O 3CIPA 3JXUA 3FZFA 4BRDA 4BGBA 3SMSA 3CJ9A 3MN6A 4BRMA 3SK3A 3KVGA 3HBTA 4JNEA 3O1BA 3UKRA 4XEIA 4BR2A 1GLAG 5F2RA 2IIRA 2QXLA 5AZIB 1E4FT 3FLCO 4YDUA 4BREA 3IUCA 1YXQA 2J4RA 3P4IA 4H0VB 1MWMA 2V7YA 4FWSA 4CZGA 2F9TA 2Q97A 5AQFA 1X3MA 3H3OB 5EX5A 2DPNA 5ADXH 4DCHA 2P9LA 1NWKA 1NBWA 3M6GA 3VEWA 4H5VA 3H46O 3L4IA 3G25A 1RDWX 4FPAA 4PKGA 1TUUA 4NO7A 1E4GT 4L3QA 3O08A 1Z05A 3VEXA 5BPNA 1S22A 2FF3B 5BPLA 5AQWA 1NGGA 3TPQA 5AR0A 2ITMA 3D7EO 5AQKA 3WXKA 3LDPA 4FPBA 4BRHA 4BVPA 2ASOA 1V4SA 4H0TB 5AZIA 2ASMA 3DWLA 4BRCA 4FOEA 1KXPA 1HUXA 1DEJA 2P9UA 4WQ5A 1BO5O 4BRKA 2FSJA 3WQTA 3ZX3A 4F9OA 4MO4A 2YHWA 4K41A 3EKUA 4NB4A 4IZ9A 2E8AA 3MN9A 4XH1A 1H1VA 1QQMA 3WQUA 3IMXA 1NM1A 3A5MC 4K43A 2AA4A 4IO8A 2FF6A 2QWNA 3VGLA 2FXUA 2P9SA 2Q0UA 3JS6A 5I9EB 2FSKA 3EO3A 1TUYA 5EXWA 3BEXA 2FLOA 3ID8A 2D1KA 4PL8A 1DGKN 3ZX2A 3MCPA 1LCUA 2QWPA 1KAYA 3DXKB 4GNIA 4A62A 3GBTA 3BP8A 3H1QA 4K25A 1QQNA 3QDKA 4BR0A 5AFUH 2CH6A 1GLJO 1OKJA 3FZHA 2E88A 1ESVA 2W40A 3O5BA 4BQZA 3UKRB 4BR5A 4CD3A 1NGCA 2E1YA 4GY2B 4O8KA 2Q36A 4ISFA 1ATRA 3ENOA 5KQ8A 3KZBA 1SAZA 3UE5A 4BRAA 1HKGA 4MLHA 1J6ZA 3S41A 1GLLO 4MLEA 3VEVA 3H1VX 4BR7A 2GWJA 4FL9A 3WXIA 3H6EA 5FPMA 3VEOA 1NLVA 2P9LB 3DJCA 2GUPA 2KHOA 4HTLA 5EVZA 4H5TA 4LC9B 1BG3A 3I33A 2VYPA 3U9ZA 1NGAA 2BTFA 3QFPA 4BROA 3LM9A 3BF1A 2I7NA 1EQYA 3VGKA 4CZFA 3ENHA 2GELA 3WXLA 3MN7A 2E20A 3R9PA 1XQSC 1ZBSA 1SQKA 3ZETA 5LY3A 1RGIA 3GG4A 4Y0WA 3LL3A 4WQ4C 4FO0A 3HZ6A 3QFUA 2Q1NA 3EN9A 1GLDG 2P9UB 2QWRA 2YI1A 2QWMA 3F9MA 4JHDA 5AQZA 1G99A 4QS9A 2HOEA 1TYQA 2ZGYA 5KPRA 2GEMA 3O6WA 4ISGA 4CD1A 2A41A 2QW9A 3CJ7A 3CJAA 1D4XA 4CZHA 3H45C 3VEYA 3CJCA 2CGLA 2QWLA 3VF4A 1BU6O 5AQMA 1CZAN 3A0IX 4B1YB 5AQYA 4BRIA 1HKCA 1Q18A 5AZJA 1NGHA 2E1ZA 3O1WA 1HKBA 2CH5A 5AQXA 3L6QA 3U8XA 2P9SB 5FPEA 2D0OA 2UYTA 3GL1A 4RTFD 2PBDA 1GLEG 1NGBA 4BR4A 4A2AA 1XUPO 4BC4A 3VENA 3A8YA 3VERA 5FPNA 3VETA 3RSEA 3C7NA 4FWRA 4ISEA 5AQRA 3FZKA 2D0PA 2Q0RA 3WUHA 2IVNA 3ULEA 2V7ZA 3GE1A 1K8KA 3BUZB 4K42A 2WUSA 3M3ZA 2ZF5O 2IVOA 4CBXA 4B1XB 3VEZA 4H5NA 4QS7A 4FOIA 4B1VA 1NGIA 3FZMA 3IFRA 3CQYA 2P9IA
chains in the Genus database with same CATH superfamily
4MDBA 3SYZA 3VMFB 4GKJK 1IBLK 3KWIA 3OYGA 2JLEA 3WNFA 1CXQA 1NJYA 1RT4A 4CEEA 4FK4A 3NH2A 1WSEA 3TAPA 1SUQA 4DR2K 3SPZA 3CFRA 5AQVA 3ISNC 3O4WA 5JLHA 1NMNA 3EY1A 3PSFA 4N76A 4XH5A 4IOAL 3SQ0A 2P9PA 4JS5A 3ZT1A 1JKHA 3JYTA 4DKWA 4YHHK 4BE7B 4GVMA 3WNGA 4DQIA 5BPMA 3RMAA 5BRDA 5KTQA 1RDDA 4C8KA 2E4LA 1MDUB 4BDZA 3HSTB 1NJZA 3VQDA 4A57A 1DKGD 2Z1JA 3CCSN 1LWEA 4EAHD 2ZM6K 4H0PA 4YOWA 1RT2A 2OYQA 3T19A 5AZJB 1BISA 3MMVA 4EHUA 4JI3K 5GADP 1T6DA 2ZQBA 4CEQA 1KQSM 3QBWA 4LY7A 3LALA 3S9HA 2E2QA 4DB3A 3M8SA 2I5JA 1VHXA 3C7NB 4CZEA 1U6ZA 1MWKA 4GV6A 3OYJA 3CQXA 3OS0A 1NK6A 1VSEA 4EHTA 4I2QA 5ADXA 5B8HA 3TTFA 1KAXA 3RTVA 2KFZA 3ULEB 4O8UA 3CETA 1EXQA 5JLFA 1XC3A 3NF6A 4ILHA 1MU2A 2HMIA 1O13A 4KPYA 4MFBA 3FFIA 5DM6L 1WSIA 3JSMA 4E0DA 1IG9A 2KW4A 1Z25A 4JS4A 3V6DA 3CCUN 3HK2A 4F8RA 1G15A 5BR9A 3V9UA 1SL2A 5E26A 4BY9C 2A5XA 5CZ2A 1QE1A 1P8ZA 3DXMA 3G6EN 3THWA 2V51B 5KPZA 3EL2A 1ZBHA 5FPDA 1X9MA 1J53A 4AM7A 3LDQA 4KH4A 1VQLN 1NGJA 1S9GA 4E1NA 4BE0A 3L4QA 1YAGA 2E2PA 4IFVA 3U9DA 3BZKA 4XH4A 4F3OA 3SBGA 1S1TA 1BUPA 1VAZA 2I7PA 3P83D 4DSKA 3LP3A 2O8EA 3EZWA 3CHWA 3MK6A 4BG9A 3M1FA 3AAQA 3D45A 5C42A 5HRNA 5SZTA 2X6SA 4E7KA 3BDPA 1JLBA 3SV4A 3O9TA 5M1NA 1WSFA 4OPAA 4FLUA 3QESA 2VG7A 3CM6A 5GAEP 4W5NA 3E9PA 3E1YA 3FZLA 4DF8A 3E66A 3V1QA 3OYDA 3OHRA 5LJVA 1XHZA 1C6VA 4KFBA 4FWQA 3A5NC 5JS1A 4DV0K 4ELTA 2E2OA 4W5TA 3DI6A 3MCAB 1ZBLA 2HHWA 5LMNK 4OVLA 1VQ9N 1RTDA 4B9UA 2ZGZA 1RT7A 2NNWA 3MEEA 3OS1A 1WB9A 2D5RA 5C2FA 3KD5E 4BR9A 3A5LC 4CJVA 4DV5K 3KK7A 4FW1A 4C8NA 3CXCM 4BDYA 5CE3A 5I3UA 3P1GA 1B9FA 4FWKA 2O4IA 2W41A 2D0CA 1S3XA 3SQ2A 1LW2A 5C12A 4F2SA 3L3UA 3DLBA 4I7FA 4Z94A 4E72A 3HVTA 1WAJA 4JN4A 2YNHA 3TR8A 4CI6A 2UXBK 3RWUA 1N32K 4RW9A 2HF3A 2GUIA 3PV8A 3TWHA 2YHYA 4JAXA 4IWVA 4BWMA 3FGUA 4WFNL 2ZWHA 1WOQA 1B9DA 4DG1A 5SWMA 3DMJA 5KRTA 1ATNA 5BRFA 4FWNA 3TTDA 3TAMA 2QKKA 3TU5A 3O4QA 4CBWA 1CXUA 3QMLA 3R8EA 4BRLA 3L2QA 4EZ9A 3AVKA 4B08A 3CIPA 4OPJA 4BRDA 2BH1A 3SMSA 3CC7N 3TTCA 1K8AO 2G8KA 4FJ9A 4CF0A 3HXMA 4ILGB 3Q7CA 4JKCA 4AHTA 4J2BA 3TABA 3M8PA 3EEQA 1DTTA 4BREA 1YXQA 3P4IA 4AH9A 3P31A 1JXEA 4DSEA 2YNFA 5AQFA 3P5JA 2O8CB 3H3OB 3ZSWA 2P9LA 2UXCK 1NWKA 1HNXK 3VEWA 3L4IA 4BEBA 1TUUA 1E4GT 4L3QA 4NLCA 2B5JA 3R3LA 3ZSXA 1NK5A 1T7PA 1NGGA 2QXFA 3TAGA 5AQKA 4ICLA 4JKBA 3LDPA 3LZJA 4DQRA 4B9VA 2Y1JA 5KI6A 4KHWA 1U48A 4DTSA 4BRCA 4FOEA 4RW7A 1KXPA 4H4OA 4WQ5A 1BO5O 2FSJA 3WQTA 3ZX3A 4F9OA 4C1NK 2YHWA 3E01A 2P5GA 1RTJA 3LPUA 2E8AA 3MN9A 4O5BA 4XH1A 4CHQA 1QQMA 1WNSA 4CEBA 4CK1A 4CHNA 4E7IA 3IMXA 4CFDA 1RBVA 4K43A 4CIEA 4DF4A 1ZYQA 4NCAA 4CJWA 2QWNA 4DR1K 2P9SA 1TUYA 1Y97A 1XNQK 1ILYA 3AVLA 3VQ9A 1VSDA 1TKDA 1S1XA 4GNIA 1U49A 3GBTA 2O8DA 3BP8A 4CJPA 4FK2A 2DFHA 1QSLA 4LSNA 4IKFA 3CYMA 1RBUA 2B4JA 3THYB 2UUAK 1XHXA 3FZHA 3DRRA 4KH6A 3KKSA 2RF2A 5GAHP 3UKRB 4CD3A 5J2NA 1VQPN 2HHHK 1Q7YO 1VSLA 3DLGA 4JKDA 5KQ8A 5C0YA 1NK4A 1RTIA 4B9LA 1GLLO 3DOKA 3H1VX 2W00A 4CIFA 4BR7A 4ZHRA 3CM5A 4FL9A 3H6EA 5FPMA 4KH5A 1HMVA 3DJCA 4KV8A 3J7ZO 1NNEA 4HTLA 2KHOA 4JI7K 4H5TA 4CK3A 3L2RA 1TV6A 4BROA 4CGJA 2OTJN 4CJEA 3VGKA 4FK0A 4DFMA 5HROA 1XWLA 1NJWA 4NYFA 3V9SA 2E20A 3ZETA 3QERA 4CF8A 3L8BA 1RGIA 4Y0WA 4CJUA 1S6PA 5BR8K 1LAVA 4C8MA 4JRPA 3C65A 3QFUA 2IDOA 3EN9A 4IEIA 4IG0A 3V1OA 4FVUA 2YI1A 3DLLL 4OX9K 1JLAA 4OLAA 4CJ3A 3ENBA 3TSQA 2IOCA 1TYQA 3O9UA 5KPRA 2W42A 4GKKK 3CJ7A 3CJAA 4CZHA 4DTJA 3ZT2A 1NK8A 4IFYA 3VTHA 2PY5A 5AQYA 3OYHA 2KZMA 1SS6A 1NJXA 2E1ZA 3KLGA 3KK1A 3WNHA 2D0OA 2UYTA 1L3SA 4FZXC 4OGEA 1GLEG 4BR4A 4A2AA 3HP9A 3K57A 4IG3A 1J5OA 3SJJA 3VERA 3ZSZA 3QO9A 5CYQA 3LWLA 2UUBK 2KFNA 4IOXA 2Q0RA 4Y1CA 1EETA 1KSPA 4W5RA 3SUQA 3BUZB 3RRGA 2IVOA 3HOSA 3F5TA 4CESA 3AO1A 4DR6K 3NAEA 4E1MA 4E19A 2F7TA 1KTQA 3G4SN 3FZMA 3IFRA 2IAJA 4ELVA 2QI2A 1S1WA 2P9NA 2CGJA 1KVAA 3ZEUA 3SQ4A 4C8LA 4Z4IA 1NGFA 1S1UA 4WYBA 4M7XA 1HQEA 3RMCA 2YJFA 4BGAA 4J2EA 3BY5A 1MA9B 1ASVA 1RT5A 4H03B 1EWQA 1VSMA 2VWBA 4RCHA 2HHXA 4PHTX 3PX6A 4A61A 2NRXA 3HI0A 4KBOA 2DTUA 3SUPA 3WEEA 4FLTA 1TK8A 4A2BA 4UY8O 4CF1A 3VTIA 2NZTA 3D2EA 3TSUA 5AQPA 3K0SA 3C6HA 1BA1A 3D2FA 3L0QA 3R6MA 3S3MA 4KO0A 2KKZA 2FBTA 2XY5A 4KI6A 5J1EA 4JHDB 3ZSRA 3NH1A 4B9MA 2GBZA 3CPWM 5DM7L 3HP6A 4LFAK 4Z4FA 2NRRA 3PSIA 5TKYA 4M42A 3W0LA 2X74A 1RNHA 4JI5K 4KAZA 3TI0A 2VCPA 3VGMA 4FJKA 1S1VA 2EX3A 1E3MA 1LV5A 4K8ZA 5AQTA 3BF3A 4JI1K 4BC5A 3HT3A 2YHXA 4AHUA 4KI4A 1QHTA 4QS8A 4DTPA 1YUWA 5BN9A 3SI6A 3QB0A 4BWJA 4YFUA 3MEDA 2WOMA 4CGDA 2D0BA 2VWKA 4N41A 4DTXA 1YF5L 4FYDA 4JI0K 3K5NA 2A6AA 4BVOA 4DSLA 3G0ZA 4B1WB 1BA0A 3HRGA 2YHAA 4H0YB 1XMOK 1K8KB 4CCHA 3MXIA 3QINA 4RWTA 4IJNA 3K58A 3NFAA 1DTQA 1QS4A 4PQUA 3ALYA 2NRHA 4O44A 2G8WA 1YVNA 4ID1A 1FXXA 4CZMA 2BDPA 2HW3A 5AQQA 3EKSA 4AHVA 4RW4A 4CFAA 1J9AA 1C0MA 4A5AA 4DR4K 1BI4A 4JD2B 3HSCA 3MN5A 1HRHA 4CZIA 3ATUA 1WBBA 1NK7A 5HLFA 3ZX0A 3C6AA 4DWIA 4DLEA 1GLBG 2FBVA 3QIPA 4R79A 4CHZA 1QQOA 3T1AA 3P39A 2F8SA 1KFDA 5AQIA 2VQEK 1U2VB 4CJ7A 1JL2A 3CYGA 4EIAA 3MX2A 4CJTA 1L3VA 2O8BA 1L3UA 1WAFA 3OYMA 3CJBA 3UKUB 5GAGP 1X9WA 2C1IA 4DV7K 4I9QA 4JI4K 5F1XA 3SLCA 3ZYYX 3THVA 1I39A 3UIQA 1SL0A 2YJEA 2QKBA 1OVYA 3QBXA 1VRUA 1VSJA 1ATSA 3L3VA 1KVCA 3SAGA 1NK0A 2P9KB 4YOXA 5KQDA 3FFKB 4H5WA 1LWFA 3DOLA 3CCJN 1HLUA 3CCVN 4YOUA 2A1SA 2HBLA 5HL7L 1EWRA 4CZKA 2WONA 1RDBA 4EFHA 5AQGA 4PKIA 4AF1A 4GV3A 4HWIA 1C0TA 4JKGB 1C0GA 3T3FA 4DV2K 3QEVA 1IKWA 4C23A 4FJ5A 3B8AX 4NXNK 3NHGA 1U4BA 3LDNA 3CERA 4J2AA 4BRNA 5ELZA 3J8AA 3KLIA 3K2PA 5BRHA 4M3RA 2B6AA 4AM6A 2HMPA 3AA3A 2E2NA 1I94K 1Z6RA 3LAMA 4CGHA 2A40A 3AO5A 3LDOA 4IXCA 2QWOA 4KHPK 4BRPA 5KGXA 5M1OA 1HNWK 4JI6K 4B3RK 3S5TA 4FJMA 2Q31A 4BC2A 1HQUA 3FZFA 4YOVA 3AVCA 1UOCA 3CJ9A 3MN6A 4J2DA 4KB0A 3HBTA 4O55A 2IIRA 4N56A 1E4FT 1N33K 1F21A 2XY6A 3IUCA 2J4RA 1HYZA 4FWSA 4EP4A 2YKMA 2F9TA 2Q97A 1LWCA 1BQNA 5EX5A 3CCMN 4NCBA 1WLJA 3M6GA 3CFPA 4EZ6A 3G25A 1RDWX 4FPAA 4PKGA 4RG8A 1FJGK 5HBMA 3QNOA 3RMDA 1Z05A 3VEXA 1S22A 2FF3B 1N34K 1NOYA 3Q7BA 5AR0A 3NVKA 2HNZA 4KRFA 5J2PA 4FPBA 3T69A 4BRHA 1YITN 2ZJRL 4BVPA 1GOCA 2JWKA 4X66K 1LW0A 1X9SA 4N47A 1RT3A 4E7LA 2P9UA 4Z0UA 1NU0A 4BRKA 1T8EA 4KHQA 3ZSVA 1WSHA 4MO4A 4K41A 3EKUA 1NOZA 3QIOA 4PWDA 3SV3A 3A5MC 3SAFA 2AA4A 3KIOA 2BANA 4IO8A 1QVFM 4BE2A 2FF6A 2FXUA 3JS6A 2O8FA 2UU9K 1HJRA 3ID8A 3HPHA 4B3SK 3J7AP 2NUBA 3AO2A 1NKEA 1LCUA 3DXKB 1KAYA 4CGIA 3LDSA 4DU1A 3OYBA 1C1CA 4JRQA 3O3GA 2RHKA 4NYNA 3QDKA 2LSNA 1D5AA 4BR0A 2NRTA 2CH6A 4KHUA 1OKJA 3HL8A 2E88A 5C10A 3HYFA 2W40A 1BQMA 4DUZK 2OPSA 4GY2B 5GIOA 4FM0A 3LZIA 4O8KA 3QEWA 4QCLA 3KZBA 1JLQA 1SAZA 4IDHA 3UE5A 4BRAA 4LF7K 2R7YA 3NGZA 3S41A 1ASWA 4FLZA 3LP1A 3VEVA 2OPPA 1VSHA 4QAGA 4I2PA 2GWJA 4DR5K 2W6KA 3CCRN 4KHYA 3O9SA 4F4KA 4FM1A 5EVZA 3HPOA 3IAYA 1BG3A 4OGCA 1NGAA 2BTFA 1WSJA 3AGKA 1TK0A 2QK9A 1JLCA 1C1BA 1EQYA 3RVCA 4CZFA 1VQMN 1VQON 4OKJA 3WXLA 3MN7A 4YY3K 3R9PA 3I0SA 1CZBA 5LY3A 5FDLA 3KLFA 3SPYA 3VQEA 4WQ4C 3MEGA 3ZSYA 3SUOA 4CIGA 2F4VK 4X65K 4DTRA 3DYAA 1GLDG 2HBJA 3AGRA 4CGGA 4DFJA 3F9MA 5AQZA 2HHSA 1RT1A 4DUYK 2GEMA 3O6WA 1D8YA 3EE8A 1YJWN 1FW6A 3VF4A 1BU6O 5AQMA 1CZAN 3TSPA 4BRIA 5AZJA 2F8TA 4HUGA 3TAEA 3O1WA 5AQXA 3G10A 3L6QA 1DT9A 5FPEA 5IT9O 1ZBIA 3GL1A 4FLXA 4RTFD 2HHTA 1NGBA 4G9ZA 1VQ7N 3VETA 4DQQA 3C7NA 2KQ2A 4FWRA 3OYAA 1Q9XA 3PUFA 4V19S 3HJFA 4B9TA 1C1AA 1KD1O 4HCBA 4HTUA 2IVNA 3S3OA 1ZBFA 3ULEA 2GX9A 1Q82O 4M3XA 3ZSOA 3GE1A 4K42A 2WUSA 2ZF5O 4IDKA 3OYKA 3SBTA 4U7BA 4KHSA 4H5NA 3F2KA 4ILJA 4C1NI 4DV6K 3OJSA 3T1YK 3CQYA 4DV4K 1RDAA 4PL7A 1N36K 4E1JA 5AQLA 5AFUA 4AHSA 4BC3A 3A5OC 2RKIA 4JYAK 1RDCA 1Z26A 5BREA 1EX4A 2WC9A 4B9QA 3GOIA 1LAWA 1RBSA 1GOAA 1NMDA 1WSGA 4WCEL 4CJFA 4KB1A 2H3GX 5JS2A 5EY4A 3CMEN 4F3TA 3GDQA 1TKXA 1WBDA 2RPIA 2JGUA 3VQBA 3VF2A 3VA3A 3MX5A 2QM1A 5HRRA 4CJRA 2A3ZA 3LP2A 2G8UA 4LFBK 1JCEA 3U3YA 2Z1HA 2KZZA 2G8IA 1TAQA 5AQHA 4M3ZA 3P38A 4CZJA 3K5MA 1VQKN 4WQ4A 1N5YA 3KD1E 1C0FA 2HHVA 4AILC 5AQOA 3IDHA 4CHOA 2RN2A 3IRXA 2XO7A 3RSEB 4ID5A 3C6UA 1K6YA 4OLBA 1JL1A 2HVHA 1A5XA 4I6MA 3NBPA 2XHBA 1NG9A 1BDGA 1QHAA 3AV9A 5FLXO 3NDKA 3VPZA 4Z4HA 5CHIA 5CZ1A 2KTQA 4FM2A 4IJAA 4HVJA 3DLKA 1GLCG 4LFCK 2P9IB 4K8XA 3OJUA 1ZC6A 1W97L 1ITGA 4JKAA 3MXMA 1ZXOA 4CJKA 2VG6A 3SQ1A 4O4GA 1XMQK 3DLHA 3WXJA 3OW2M 1W0HA 4Z4CA 2O4GA 3OA9A 2HF4A 2YCHA 1GLFO 1J5EK 2OZSA 2ITGA 1SKWA 3S3NA 3NH0A 2P9PB 1N8RO 4DSJA 4O0JA 1JLEA 5DK5A 2E5LK 5E84A 2Y1IA 2BUPA 4WFAL 3AARA 4DS5A 1O1WA 1HJOA 4Q0BA 2FSNA 1M1KO 2YX6A 5EU7A 4N5SA 3OY9A 4M3YA 3DM2A 1T6CA 3KLHA 3V81A 1S72N 5KPTA 3U3GA 1Q8IA 3CI5A 3OVNA 2O8CA 2Q2RA 4B8AB 1VSFA 3I8BA 3NF8A 4FWPA 5HOOA 5J2QA 1TAUA 3J7YP 4GV9A 4ZTFA 2P51A 1BOTO 1L3TA 4OPHA 3NF9A 2QWQA 4JV5K 4IO9L 4WE1A 5GIPA 3CPEA 3HVRA 4CEOA 4Z4EA 3DRPA 4IBNA 3WNEA 1IG8A 1Y64A 3SJHA 2ASPA 1YJ9N 1V4TA 5E41A 2F9WA 4DR3K 4FZZA 3QEXA 3AY9A 3CFOA 4M63C 1VQ8N 4ELUA 3KHYA 3NE6A 2XRIA 3E9LA 2G8VA 1HPZA 4DMNA 1P90A 3DXMB 3THWB 2C1GA 1JXBA 3VQ8A 4FJ8A 3OS2A 4JKEA 1HPMA 3MWTA 1TKTA 1Q9YA 1OH7A 4CW7B 1KFSA 4JK8A 1QTMA 3QETA 2D4WA 3IS9A 4IEEA 3C95A 3BGRA 2O8EB 3AAPA 4G1QA 5BN8A 1QZ5A 3KTQA 1R59O 5JVHL 4OO1J 3THXA 3WXMB 3THYA 4X64K 3KVGA 3L2WA 3O1BA 3UKRA 3AVJA 1GLAG 5F2RA 1TGOA 4HUEA 2QXLA 3M8RA 4JKHA 2XY8A 1MWMA 4BECA 1L5UA 3AA4A 4CZGA 2PYLA 3AVBA 3VQCA 3SUNA 2P1JA 4X62K 4DCHA 3AVAA 1NBWA 1YJNN 2ZJQL 1QQCA 4LF4K 3LPTA 4NO7A 4DTUA 2O8FB 3B6PA 4GVEA 5BPNA 2VGMA 5BPLA 3TPQA 4E89A 3M5RA 2QTDA 3RR7A 2YKNA 3AO4A 4JK7A 3WXKA 1VQ5N 4FZYA 1RCHA 1YIJN 2ASOA 1V4SA 1IO2A 4H0TB 5AZIA 1VSKA 3QEIA 1IBMK 3OBWA 3PO4A 3K5LA 4IZ9A 3O3HA 4OKKA 3KKRA 1OH6A 3LWMA 3WQUA 2GV9A 1NM1A 2VGNA 4LF8K 3J80O 5I9EB 2FSKA 5EXWA 2D1KA 4PL8A 5HRSA 4E7HA 2ZJPL 4FJIA 4LH4A 3ZX2A 3MCPA 1CLQA 3SAHA 2QWPA 3DLRA 4FXDA 2ZD1A 3K5OA 5C2DA 3H1QA 3N4QA 2FBXA 4K25A 3V9XA 1QQNA 1W9HA 1RT6A 1Q81O 2YV0X 2RE2A 5AFUH 1GLJO 3SCXA 1ESVA 2ATQA 4BQZA 4BR5A 4UQGA 1NGCA 4MDAA 2E1YA 1REVA 2Q36A 1ATRA 3C6TA 2DY4A 2BGGA 1J6ZA 1VQ4N 3R1XA 1Q86O 2NRVA 3ITHA 1S5JA 4WF9L 4ZTJA 3VEOA 3CC4N 3KK3A 3VQ6A 4FJNA 2P9LB 3VQ4A 4LC9B 2PZSA 3U9ZA 4XJXA 1I3AA 3CCEN 3LM9A 5H1SQ 3BF1A 5CR4A 3KK2A 1KLMA 2I7NA 3I56N 1TL1A 4KHNA 1ZBSA 1SQKA 3B6OA 3GG4A 3LL3A 1KRPA 4FO0A 3HZ6A 4JI2K 2OTLN 2Q1NA 3EE9A 3NGYA 5FRNA 3NF7A 3VA0A 2QWRA 5M1QA 4JHDA 5IWAK 4QS9A 2HOEA 2ZGYA 4ISGA 3NCIA 2QW9A 4GW6A 1YHQN 2HBKA 3VEYA 4FJXA 3CJCA 2WBNA 4DQSA 1YI2N 1BGXT 2QWLA 4B1YB 1NKCA 1XI1A 1HKCA 1NGHA 4FW2A 4PA1A 2VQFK 2HVIA 1HKBA 3DLEA 4NCGA 4W5QA 2P9SB 4B8CA 2PBDA 4DU4A 4BC4A 2IS3A 3PX0A 4H4MA 5FPNA 3RMBA 2O8DB 3O3FA 5AQRA 3AVNA 3I0RA 3FZKA 3VQPA 3BZCA 2D0PA 3K9JA 1RBTA 3WUHA 1K73O 1K8KA 5T7BA 3HO1A 2UXDK 4CBXA 4B3TK 4B1XB 4QS7A 3OYIA 1NGIA 3V9ZA 5AQSA 4DR7K 4M3TA 4DS4A 4CERA 4H5RA 4JD2A 3VF6A 1HNIA 4CE9A 1BWFO 4PKHA 3FR0A 3PY8A 1X9JA 3T7ZA 4Y1DA 4MO5A 1IJJA 4E7JA 1LOTB 3CC2N 3AA5X 2IVPA 3O4NA 4CEAA 1UA1A 3OYFA 2AP1A 3PO5A 3DRSA 3H3NO 1HYVA 4BQLA 5LJWA 1J54A 5I42A 2ZE2A 2GWKA 3ZETB 1NGEA 4WQ5C 4E3SA 2A1RA 1U2VA 3MECA 2A42A 3LDLA 4I6MB 2VG5A 1IBKK 3D0PA 5EOYA 5FRMA 3UKUA 4O5FA 4CBUA 4MQ3A 1TYQB 2OANA 3C0BA 5JICA 2EWSA 3VESA 3VQAA 4JEPA 3FE1A 4KTQA 3K59A 4DHYA 3HM9A 3T1HK 4AHRA 2P9KA 3SNNA 1D9FA 3SMPA 1WUAA 3MDQA 4TSXA 1KLNA 1JCGA 5J2MA 5M1FA 2WFBA 4RW8A 3VQ7A 1IV0A 3NVMA 4DTMA 2HNDA 4HHTA 5JMVA 4CEZA 5LMUK 1M90O 3RR8A 3WT0A 4BRGA 4Q5VA 2OPRA 2AJQA 3ZLJA 3QLHA 4HUFA 2WTUA 1TVRA 2JWLA 4CFBA 2PAVA 3F9KA 3HTVA 4JKGA 4BRQA 3CCLN 1HNZK 3V9WA 1KC8O 4CFCA 2YNIA 2OA8A 4DV1K 5C25A 3OYLA 5AQJA 2HHQA 2X6NA 4CJ5A 1SZ2A 5CYMA 3EZ5A 2UUCK 3ZT3A 2Z1GA 3J81O 5AQUA 3V4IA 4FWMA 2P9NB 3KJVA 1KVBA 3ZEUB 4M3UA 2VWJA 4J8FA 4CF9A 5LL6Z 2EHGA 3UB5A 3KLEA 1B92A 2FC0A 2HHIA 4DQPA 1ASUA 4KKOA 3PIOL 5TKWA 2HB5A 4OPKA 1KAZA 4B9SA 3ULDA 1FKOA 1TKZA 3ZSQA 3WEEB 1W2BM 2YHBA 4YDUC 1IKVA 4DSFA 4R5PA 5D3GA 1T44A 3ATVA 3D2EB 4LH5A 3D2FB 1X3NA 1JCFA 4XIUA 3U4LA 4LF5K 4I9LA 3VN5A 2QEXN 3AA2A 4FSVA 3I55N 1HR0K 3CD6N 4CEFA 4H0OA 1CZ9A 4B1UB 4BRFA 1VRTA 4CJQA 1SV5A 4CJLA 3QICA 4FWOA 3VOVA 3O8MA 3O80A 2V52B 4U67L 4IFEA 4CECA 2CGKA 2GTDA 1FK9A 4KTWA 1QZ6A 1SKRA 4DFPA 4B9NA 4EP5A 3MWPA 3ASMA 3HM8A 3M8QA 4DFKA 4FLWA 1RFQA 1BCOA 4AQYK 4H0XB 5HP1A 1NKBA 4DQ8A 3W3DA 2NLXA 1R0AA 3CJ1A 4M7YA 1UA0A 1NGDA 4CZLA 1SKSA 4FJJA 3THXB 4BG8A 1OH5A 4FJHA 3OTOK 5F0XA 4DTNA 4M3WA 4FJLA 4CHYA 5GINA 1T3VA 4FJ7A 1UAXA 5MLCQ 4CJSA 3ZCMA 2XY7A 1YTUA 1XNRK 2OPQA 3DAWA 1IKYA 1BI4B 3MXJA 4FWLA 2NRWA 4A59A 2E6MA 5M1KA 3HPGA 5M1PA 5AQNA 1HX1A 1SL1A 3LM2A 5KRSA 3O9QA 3PLAA 4B1ZA 3MAQA 3DXKA 1VSIA 2HHUA 2ETJA 4JK9A 1U47A 1C0UA 3JXUA 4BGBA 5K14A 3VQ5A 3QEPA 4BRMA 3SK3A 4W5OA 3F73A 1OH8A 2O8BB 2DFFA 3SZ2A 4JNEA 1S9EA 4YOTA 4XEIA 4BR2A 5AZIB 3FLCO 4YDUA 4H0VB 2V7YA 3CQ8A 4OJRA 4FLVA 1X3MA 3I8DA 3LANA 1BL3A 4DU3A 4WFBL 2DPNA 5ADXH 2BE2A 4H5VA 3H46O 4QOZB 5JVGL 4HCCA 3OYEA 3IG1A 3O08A 1FKPA 4C8OA 5AQWA 1U04A 1JLGA 1UWBA 4GMJB 2ITMA 3D7EO 1XC9A 1T03A 1T05A 2OZMA 3JAMO 2DFEA 4B3OA 4CJ4A 2IGIA 4NXMK 2Q3SA 3H08A 5A2QO 4JLHA 1JLFA 2ASMA 3DWLA 4PY5A 4CF2A 3CF5L 1HUXA 1TL3A 3N4PA 5FROA 1A5VA 4BDPA 1DEJA 5AJ3K 4KTZA 4CGFA 4NB4A 1HNVA 3PIPL 1H1VA 4YORA 3QNNA 4NLBA 3G71N 1WN7A 1VQ6N 4FLYA 3VGLA 2PFUA 2Q0UA 1BCMA 2E6LA 1YVUA 3EO3A 2G8FA 3AVHA 4PUOA 3BEXA 2FLOA 2OCEA 3ZT4A 3TARA 3NMUA 3L2VA 1DGKN 3OBYA 1A5WA 4OKEA 2W6LA 4JKFA 4A62A 5HRPA 4KREA 4FVMA 3EYZA 1RDUA 4B3MK 1BIZA 3TAQA 3O9RA 1BIUA 4YNQA 3OYCA 1ZBUA 4Z4GA 4FCYA 4DSIA 4LSLA 3O5BA 1VQNN 4LF6K 5C15A 5CY4A 2NRZA 2FBYA 3AVIA 3ZT0A 1KCFA 4IOCL 4ISFA 3PX4A 3ENOA 4M41A 2KLAA 3RRHA 1HKGA 1RTHA 4MLHA 4LD0A 1TK5A 4MLEA 3E9OA 1RILA 3C94A 2HBMA 4M45A 2HSTA 1HYSA 2F96A 2PYJA 3WXIA 1X1PA 4JI8K 3ID6A 3D6RA 1NLVA 2GUPA 3I33A 2VYPA 1YTAA 3TAFA 1QSSA 3QFPA 4DTOA 1EKEA 4F2RA 4DLGA 2IC3A 4K0KK 2HNYA 3ENHA 1RBRA 5JENA 2GELA 3L2UA 4DV3K 1XQSC 1U45A 3AVGA 4FJGA 1GOBA 1D9DA 1IKXA 3IKMA 1QSYA 5DMRA 3NGIA 3V1RA 1N6QA 2P9UB 3AO3A 3VQQA 2QWMA 4A5BA 4CEDA 5C24A 1W7AA 1G99A 3U6FA 4CD1A 2A41A 3LAKA 1D4XA 1OVQA 3H45C 2X78A 1DLOA 2CGLA 4RW6A 2P5OA 1S6QA 3A0IX 3TANA 1Q18A 2QA4N 2CH5A 4L8RB 3U8XA 1NK9A 2Z1IA 1VK0A 3OYNA 4CK2A 4BE1A 1XUPO 1JJ2M 3VENA 4CHPA 3A8YA 1NJIO 3K9KA 1EO1A 1YT3A 3RSEA 1IH7A 4ISEA 4H8KA 4CVNE 3LP0A 1EP4A 3HOTA 2YNGA 1BHLA 3KWGA 2V7ZA 4YOYA 3CG7A 3M3ZA 3AVMA 2G8HA 4O0IA 4BACA 4AHCA 3AVFA 3CCQN 5KGWA 3VEZA 2D0AA 1QVGM 4FOIA 3CMAN 4B1VA 4LF9K 3A2FA 2P9IA 1K9MO
chains in the Genus database with same CATH topology
2P9NA 2CGJA 4MDBA 5AQSA 3VMFB 3ZEUA 3KWIA 4PL7A 4H5RA 4JD2A 3VF6A 4E1JA 1NGFA 5AQLA 5AFUA 1BWFO 4WYBA 4PKHA 4M7XA 3A5OC 4BC3A 3FR0A 1X9JA 2YJFA 3T7ZA 4BGAA 5BREA 1MA9B 4H03B 1IJJA 4MO5A 1LOTB 2VWBA 2WC9A 4RCHA 4B9QA 3CC2N 2IVPA 4PHTX 5AQVA 4A61A 3GOIA 3O4WA 5JLHA 1NMDA 4WCEL 2AP1A 2NRXA 3HI0A 4KBOA 4XH5A 4IOAL 3WEEA 3H3NO 4BQLA 2H3GX 5LJWA 4A2BA 5EY4A 2P9PA 3ZETB 2GWKA 4UY8O 1NGEA 4WQ5C 3CMEN 1U2VA 3GDQA 3VTIA 2NZTA 2A42A 3D2EA 3TSUA 4DKWA 5AQPA 3C6HA 1BA1A 3LDLA 3D2FA 3L0QA 4I6MB 3R6MA 4BE7B 3VF2A 2KKZA 5BPMA 5EOYA 3MX5A 2QM1A 5BRDA 3UKUA 4JHDB 4O5FA 4CBUA 1MDUB 1TYQB 2OANA 3CPWM 2A3ZA 4A57A 5DM7L 1DKGD 3C0BA 1JCEA 5JICA 2NRRA 3CCSN 4EAHD 2EWSA 5AQHA 3VESA 4JEPA 4H0PA 3FE1A 3P38A 4CZJA 5TKYA 4DHYA 4YOWA 3W0LA 5AZJB 1VQKN 4WQ4A 2P9KA 3MMVA 4EHUA 1C0FA 3SMPA 5GADP 2VCPA 1WUAA 1T6DA 3MDQA 5AQOA 3IDHA 3VGMA 1JCGA 1KQSM 5AQTA 3QBWA 5M1FA 3BF3A 4BC5A 2WFBA 2YHXA 2E2QA 4QS8A 4DB3A 1YUWA 5BN9A 3NVMA 3QB0A 3RSEB 3C7NB 4CZEA 5JMVA 1M90O 1U6ZA 1YF5L 1MWKA 3WT0A 4BRGA 4GV6A 3CQXA 2A6AA 4EHTA 5ADXA 5B8HA 3TTFA 4BVOA 2JWLA 4I6MA 4B1WB 1KAXA 2PAVA 3HTVA 1BA0A 4JKGA 4O8UA 3ULEB 3CETA 1BDGA 1QHAA 3HRGA 4H0YB 4BRQA 1K8KB 5JLFA 1XC3A 4ILHA 3CCLN 4RWTA 4IJNA 1KC8O 1O13A 3VPZA 5DM6L 5CHIA 2NRHA 5AQJA 4IJAA 1SZ2A 1YVNA 4CZMA 1GLCG 3CCUN 5AQQA 5AQUA 2P9IB 3EKSA 4FWMA 5BR9A 2P9NB 3ZEUB 1ZC6A 1W97L 5E26A 4BY9C 4A5AA 2A5XA 1P8ZA 4JKAA 4J8FA 4JD2B 3DXMA 3G6EN 3HSCA 3MN5A 1ZXOA 2V51B 3UB5A 5KPZA 4CZIA 3ATUA 3EL2A 5FPDA 3WXJA 4AM7A 3OW2M 3ZX0A 3C6AA 3LDQA 4KH4A 1VQLN 1GLBG 1NGJA 3OA9A 3PIOL 5TKWA 2HF4A 1YAGA 2E2PA 2YCHA 3L4QA 3U9DA 1KAZA 1GLFO 4XH4A 3SBGA 4R79A 1VAZA 1BUPA 2I7PA 3WEEB 1W2BM 1QQOA 4YDUC 2P9PB 3P39A 1N8RO 3EZWA 3CHWA 5AQIA 3MK6A 1U2VB 4BG9A 1T44A 3ATVA 3M1FA 3D2EB 4CJ7A 3AAQA 4EIAA 5E84A 3D2FB 3MX2A 1X3NA 2BUPA 4WFAL 3CJBA 3O9TA 1JCFA 3UKUB 3AARA 5GAGP 5M1NA 3U4LA 1HJOA 4OPAA 2C1IA 2FSNA 1M1KO 5F1XA 3SLCA 3ZYYX 2YX6A 5GAEP 2QEXN 2YJEA 3E9PA 3E1YA 4FSVA 3I55N 3CD6N 1OVYA 1T6CA 3FZLA 3QBXA 4H0OA 4B1UB 1S72N 3E66A 1ATSA 4BRFA 5KPTA 3OHRA 3CI5A 5LJVA 3SAGA 2P9KB 4YOXA 5KQDA 2Q2RA 3FFKB 3QICA 4H5WA 4FWQA 4FWOA 3VOVA 3I8BA 4FWPA 5HOOA 3CCJN 1HLUA 3A5NC 3O8MA 4YOUA 3CCVN 3O80A 4GV9A 2E2OA 2V52B 4U67L 4IFEA 3MCAB 2CGKA 1BOTO 2GTDA 2HBLA 5HL7L 1QZ6A 4OPHA 2QWQA 4CZKA 4IO9L 1VQ9N 3MWPA 3HM8A 2ZGZA 1RFQA 4EFHA 2NNWA 5AQGA 4PKIA 4AF1A 5GIPA 3CPEA 4H0XB 4GV3A 5C2FA 4BR9A 4HWIA 4DQ8A 4JKGB 3W3DA 1C0GA 3A5LC 3KK7A 3CXCM 2NLXA 3CJ1A 4M7YA 1IG8A 4C23A 3B8AX 1NGDA 5CE3A 1Y64A 4CZLA 4FWKA 3SJHA 2ASPA 1YJ9N 1V4TA 2F9WA 4BG8A 2W41A 1S3XA 5F0XA 3LDNA 3CERA 3AY9A 5C12A 4M63C 1VQ8N 4BRNA 4Z94A 5ELZA 5GINA 1T3VA 3KHYA 3J8AA 4JN4A 4CI6A 5MLCQ 3E9LA 5BRHA 3DAWA 4A59A 4FWLA 1P90A 2NRWA 2HF3A 3DXMB 2C1GA 4AM6A 2HMPA 2E2NA 2YHYA 1Z6RA 4IWVA 4JAXA 3FGUA 4WFNL 2ZWHA 2A40A 4JKEA 5M1KA 5M1PA 1WOQA 1HPMA 3MWTA 3LDOA 4IXCA 5AQNA 1HX1A 2QWOA 3LM2A 1ATNA 5BRFA 3O9QA 3PLAA 4B1ZA 4JK8A 4BRPA 4FWNA 3TTDA 5M1OA 3DXKA 2D4WA 3TU5A 4IEEA 2Q31A 4CBWA 3AAPA 5BN8A 3R8EA 3QMLA 4JK9A 4BC2A 4BRLA 1QZ5A 1R59O 5JVHL 3CIPA 4OO1J 3JXUA 3FZFA 3WXMB 4YOVA 4BRDA 2BH1A 4BGBA 3SMSA 3CC7N 3TTCA 1K8AO 3CJ9A 3MN6A 4BRMA 3SK3A 3KVGA 3HBTA 4JNEA 3O1BA 3UKRA 4ILGB 4YOTA 4XEIA 4BR2A 3Q7CA 1GLAG 4JKCA 5F2RA 2IIRA 2QXLA 5AZIB 1E4FT 3FLCO 4YDUA 4BREA 3IUCA 1YXQA 2J4RA 3P4IA 4H0VB 1MWMA 4JKHA 2V7YA 4BECA 3P31A 4FWSA 4CZGA 2F9TA 2Q97A 5AQFA 1X3MA 3H3OB 5EX5A 3CCMN 4WFBL 2DPNA 5ADXH 4DCHA 2P9LA 1NWKA 1NBWA 3M6GA 3VEWA 1YJNN 4H5VA 3H46O 3L4IA 3G25A 4BEBA 2ZJQL 5JVGL 1RDWX 4FPAA 4PKGA 1TUUA 4NO7A 1E4GT 4L3QA 4NLCA 3O08A 1Z05A 4GVEA 3VEXA 5BPNA 1S22A 2VGMA 3R3LA 2FF3B 5BPLA 5AQWA 1NGGA 3Q7BA 5AR0A 3TPQA 3NVKA 2ITMA 3D7EO 3M5RA 2QTDA 5AQKA 4JKBA 4JK7A 3WXKA 3LDPA 4FPBA 3T69A 4BRHA 1VQ5N 1YITN 2ZJRL 4BVPA 1YIJN 2ASOA 1V4SA 2JWKA 4H0TB 5AZIA 2ASMA 3DWLA 4BRCA 4FOEA 3CF5L 1KXPA 1HUXA 3N4PA 1DEJA 2P9UA 4WQ5A 1BO5O 4BRKA 2FSJA 3WQTA 3OBWA 3ZX3A 4F9OA 4C1NK 4MO4A 2YHWA 4K41A 3EKUA 4NB4A 4IZ9A 2E8AA 3MN9A 4XH1A 3PIPL 1H1VA 1QQMA 3WQUA 3IMXA 1NM1A 2VGNA 3A5MC 4YORA 3SAFA 4K43A 2AA4A 4NLBA 3G71N 4IO8A 1VQ6N 1QVFM 2FF6A 2QWNA 3VGLA 2FXUA 2PFUA 2P9SA 2Q0UA 3JS6A 5I9EB 2FSKA 3EO3A 1TUYA 5EXWA 3BEXA 2FLOA 3ID8A 2D1KA 4PL8A 3NMUA 1DGKN 2ZJPL 3OBYA 1ILYA 3ZX2A 3MCPA 3SAHA 1LCUA 2QWPA 1KAYA 3DXKB 4GNIA 4JKFA 4A62A 3GBTA 5C2DA 3BP8A 3H1QA 3N4QA 2RHKA 4K25A 1QQNA 1RDUA 1Q81O 3QDKA 4BR0A 3O9RA 2RE2A 2NRTA 5AFUH 2CH6A 1GLJO 1OKJA 3FZHA 2E88A 5C10A 1ESVA 2W40A 3O5BA 4KH6A 4BQZA 3UKRB 4BR5A 5GAHP 1VQNN 4CD3A 1NGCA 4MDAA 2E1YA 4GY2B 5GIOA 1VQPN 5C15A 4O8KA 2NRZA 1Q7YO 4JKDA 2Q36A 4IOCL 4ISFA 1ATRA 3ENOA 5KQ8A 3KZBA 1SAZA 2KLAA 4IDHA 3UE5A 5C0YA 4BRAA 1HKGA 4MLHA 1J6ZA 3S41A 1GLLO 1VQ4N 3R1XA 3E9OA 4MLEA 3VEVA 3H1VX 1Q86O 2W00A 2HBMA 2NRVA 4BR7A 2GWJA 2HSTA 4FL9A 3WXIA 4WF9L 3H6EA 3ID6A 5FPMA 3D6RA 3VEOA 3CC4N 3CCRN 3O9SA 4KH5A 1NLVA 2P9LB 3DJCA 3J7ZO 2GUPA 2KHOA 4HTLA 5EVZA 4H5TA 4LC9B 1BG3A 3I33A 2VYPA 3U9ZA 1NGAA 2BTFA 4XJXA 3AGKA 3QFPA 3CCEN 4BROA 3LM9A 5H1SQ 2OTJN 3BF1A 5CR4A 3RVCA 2I7NA 1EQYA 3VGKA 4CZFA 3ENHA 3I56N 1VQON 1VQMN 2GELA 3WXLA 3MN7A 2E20A 3R9PA 1XQSC 1ZBSA 1SQKA 3ZETA 5LY3A 1RGIA 3GG4A 4Y0WA 3LL3A 4WQ4C 4FO0A 3HZ6A 3C65A 3IKMA 3QFUA 2OTLN 2Q1NA 3EE9A 3EN9A 1GLDG 4IEIA 2HBJA 3AGRA 4FVUA 2P9UB 2QWRA 2YI1A 5M1QA 3DLLL 2QWMA 3F9MA 4JHDA 5AQZA 3ENBA 4A5BA 3TSQA 1G99A 4QS9A 2HOEA 1TYQA 2ZGYA 3O9UA 2GEMA 3O6WA 4ISGA 4CD1A 2A41A 5KPRA 2QW9A 3CJ7A 3CJAA 1D4XA 3EE8A 2HBKA 4CZHA 1YHQN 3H45C 3VEYA 3CJCA 2WBNA 3VTHA 2CGLA 1YI2N 1YJWN 2QWLA 3VF4A 1BU6O 5AQMA 1CZAN 3A0IX 3TSPA 5AQYA 4B1YB 4BRIA 1HKCA 1Q18A 5AZJA 1NGHA 2QA4N 1SS6A 2E1ZA 3O1WA 1HKBA 2CH5A 5AQXA 3L6QA 3U8XA 1DT9A 2P9SB 2D0OA 5FPEA 2UYTA 3GL1A 4RTFD 2PBDA 1GLEG 1NGBA 4BR4A 4A2AA 4G9ZA 1XUPO 4BC4A 1JJ2M 3VENA 1VQ7N 3A8YA 3VERA 1NJIO 3K9KA 1EO1A 5FPNA 3VETA 3RSEA 3C7NA 4FWRA 4ISEA 5AQRA 3HOTA 3FZKA 1KD1O 4IOXA 2D0PA 2Q0RA 3K9JA 3KWGA 3WUHA 2IVNA 2GX9A 3ULEA 1K73O 2V7ZA 1Q82O 3GE1A 1K8KA 3BUZB 4YOYA 4K42A 2WUSA 3M3ZA 2ZF5O 2IVOA 3HOSA 4CBXA 3F5TA 3SBTA 4U7BA 4B1XB 3CCQN 3VEZA 4H5NA 3F2KA 4ILJA 4QS7A 4C1NI 1QVGM 4FOIA 3CMAN 2F7TA 3G4SN 4B1VA 1NGIA 3FZMA 3IFRA 3CQYA 2P9IA 2QI2A 1K9MO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9N A;  2CGJ A;  5AQS A;  3ZEU A;  4PL7 A;  4H5R A;  4JD2 A;  3VF6 A;  4E1J A;  1NGF A;  5AQL A;  5AFU A;  1BWF O;  4WYB A;  4PKH A;  4M7X A;  3A5O C;  4BC3 A;  3FR0 A;  1X9J A;  2YJF A;  4BGA A;  5BRE A;  1MA9 B;  4H03 B;  1IJJ A;  4MO5 A;  1LOT B;  2VWB A;  4B9Q A;  4RCH A;  2IVP A;  5AQV A;  4A61 A;  3GOI A;  3O4W A;  5JLH A;  1NMD A;  2AP1 A;  3HI0 A;  4KBO A;  4XH5 A;  3WEE A;  3H3N O;  4BQL A;  2H3G X;  5LJW A;  4A2B A;  5EY4 A;  2P9P A;  3ZET B;  2GWK A;  1NGE A;  4WQ5 C;  1U2V A;  3GDQ A;  2NZT A;  2A42 A;  3D2E A;  5AQP A;  1BA1 A;  3LDL A;  3D2F A;  3L0Q A;  4I6M B;  3R6M A;  3VF2 A;  5BPM A;  5EOY A;  5BRD A;  2QM1 A;  3UKU A;  4JHD B;  4O5F A;  4CBU A;  1MDU B;  1TYQ B;  2OAN A;  2A3Z A;  1DKG D;  3C0B A;  1JCE A;  5JIC A;  4EAH D;  2EWS A;  5AQH A;  3VES A;  4H0P A;  3FE1 A;  4CZJ A;  5TKY A;  4DHY A;  3W0L A;  5AZJ B;  4WQ4 A;  2P9K A;  3MMV A;  4EHU A;  1C0F A;  3SMP A;  2VCP A;  1WUA A;  1T6D A;  3MDQ A;  5AQO A;  3IDH A;  3VGM A;  1JCG A;  5AQT A;  3QBW A;  3BF3 A;  4BC5 A;  2YHX A;  2E2Q A;  4QS8 A;  4DB3 A;  1YUW A;  5BN9 A;  3QB0 A;  3RSE B;  3C7N B;  4CZE A;  5JMV A;  1U6Z A;  1MWK A;  3WT0 A;  4BRG A;  3CQX A;  2A6A A;  4EHT A;  5ADX A;  5B8H A;  4BVO A;  4I6M A;  4B1W B;  1KAX A;  2PAV A;  3HTV A;  1BA0 A;  3ULE B;  4BRQ A;  3CET A;  1BDG A;  1QHA A;  4H0Y B;  1K8K B;  5JLF A;  1XC3 A;  4RWT A;  4IJN A;  3VPZ A;  2NRH A;  5AQJ A;  4IJA A;  1SZ2 A;  1YVN A;  4CZM A;  1GLC G;  5AQQ A;  5AQU A;  2P9I B;  3EKS A;  4FWM A;  5BR9 A;  2P9N B;  3ZEU B;  1ZC6 A;  5E26 A;  2A5X A;  1P8Z A;  4J8F A;  4JD2 B;  3DXM A;  3HSC A;  3MN5 A;  1ZXO A;  2V51 B;  3UB5 A;  5KPZ A;  4CZI A;  3ATU A;  3EL2 A;  5FPD A;  3WXJ A;  4AM7 A;  3ZX0 A;  3LDQ A;  1GLB G;  1NGJ A;  2HF4 A;  1YAG A;  2E2P A;  2YCH A;  3U9D A;  1KAZ A;  1GLF O;  4XH4 A;  1BUP A;  2I7P A;  3WEE B;  1QQO A;  4YDU C;  2P9P B;  3EZW A;  3CHW A;  5AQI A;  3MK6 A;  1U2V B;  4BG9 A;  1T44 A;  3ATV A;  3M1F A;  3D2E B;  4CJ7 A;  3AAQ A;  4EIA A;  5E84 A;  3D2F B;  1X3N A;  2BUP A;  3CJB A;  3UKU B;  1JCF A;  3AAR A;  3U4L A;  1HJO A;  2FSN A;  5F1X A;  3SLC A;  2YJE A;  4FSV A;  1T6C A;  3FZL A;  3QBX A;  4H0O A;  4B1U B;  1ATS A;  4BRF A;  5KPT A;  3OHR A;  3CI5 A;  5LJV A;  2P9K B;  5KQD A;  2Q2R A;  3FFK B;  3QIC A;  4H5W A;  4FWQ A;  4FWO A;  3VOV A;  3I8B A;  4FWP A;  1HLU A;  3A5N C;  3O8M A;  3O80 A;  2E2O A;  2V52 B;  2CGK A;  1BOT O;  2GTD A;  1QZ6 A;  4CZK A;  2QWQ A;  3HM8 A;  2ZGZ A;  1RFQ A;  4EFH A;  5AQG A;  4PKI A;  4H0X B;  4BR9 A;  4HWI A;  4DQ8 A;  3W3D A;  1C0G A;  3A5L C;  2NLX A;  3CJ1 A;  4M7Y A;  1IG8 A;  4C23 A;  3B8A X;  1NGD A;  5CE3 A;  1Y64 A;  4CZL A;  4FWK A;  3SJH A;  2ASP A;  1V4T A;  2F9W A;  4BG8 A;  2W41 A;  1S3X A;  5F0X A;  3LDN A;  3CER A;  3AY9 A;  4M63 C;  4BRN A;  4Z94 A;  5ELZ A;  3KHY A;  3J8A A;  4JN4 A;  4CI6 A;  5BRH A;  3DAW A;  4FWL A;  3DXM B;  2HF3 A;  4AM6 A;  2HMP A;  2E2N A;  2YHY A;  1Z6R A;  4IWV A;  4JAX A;  3FGU A;  2ZWH A;  2A40 A;  1WOQ A;  1HPM A;  3LDO A;  4IXC A;  5AQN A;  1HX1 A;  2QWO A;  3LM2 A;  1ATN A;  5BRF A;  4B1Z A;  4BRP A;  4FWN A;  3DXK A;  2D4W A;  3TU5 A;  2Q31 A;  4CBW A;  3AAP A;  5BN8 A;  3R8E A;  3QML A;  4BC2 A;  4BRL A;  1QZ5 A;  1R59 O;  3CIP A;  3JXU A;  3FZF A;  4BRD A;  4BGB A;  3SMS A;  3CJ9 A;  3MN6 A;  4BRM A;  3SK3 A;  3KVG A;  3HBT A;  4JNE A;  3O1B A;  3UKR A;  4XEI A;  4BR2 A;  1GLA G;  5F2R A;  2IIR A;  2QXL A;  5AZI B;  1E4F T;  3FLC O;  4YDU A;  4BRE A;  3IUC A;  1YXQ A;  2J4R A;  3P4I A;  4H0V B;  1MWM A;  2V7Y A;  4FWS A;  4CZG A;  2F9T A;  2Q97 A;  5AQF A;  1X3M A;  3H3O B;  5EX5 A;  2DPN A;  5ADX H;  4DCH A;  2P9L A;  1NWK A;  1NBW A;  3M6G A;  3VEW A;  4H5V A;  3H46 O;  3L4I A;  3G25 A;  1RDW X;  4FPA A;  4PKG A;  1TUU A;  4NO7 A;  1E4G T;  4L3Q A;  3O08 A;  1Z05 A;  3VEX A;  5BPN A;  1S22 A;  2FF3 B;  5BPL A;  5AQW A;  1NGG A;  3TPQ A;  5AR0 A;  2ITM A;  3D7E O;  5AQK A;  3WXK A;  3LDP A;  4FPB A;  4BRH A;  4BVP A;  2ASO A;  1V4S A;  4H0T B;  5AZI A;  2ASM A;  3DWL A;  4BRC A;  4FOE A;  1KXP A;  1HUX A;  1DEJ A;  2P9U A;  4WQ5 A;  1BO5 O;  4BRK A;  2FSJ A;  3WQT A;  3ZX3 A;  4F9O A;  4MO4 A;  2YHW A;  4K41 A;  3EKU A;  4NB4 A;  4IZ9 A;  2E8A A;  3MN9 A;  4XH1 A;  1H1V A;  1QQM A;  3WQU A;  3IMX A;  1NM1 A;  3A5M C;  4K43 A;  2AA4 A;  4IO8 A;  2FF6 A;  2QWN A;  3VGL A;  2FXU A;  2P9S A;  2Q0U A;  3JS6 A;  5I9E B;  2FSK A;  3EO3 A;  1TUY A;  5EXW A;  3BEX A;  2FLO A;  3ID8 A;  2D1K A;  4PL8 A;  1DGK N;  3ZX2 A;  3MCP A;  1LCU A;  2QWP A;  1KAY A;  3DXK B;  4GNI A;  4A62 A;  3GBT A;  3BP8 A;  3H1Q A;  4K25 A;  1QQN A;  3QDK A;  4BR0 A;  5AFU H;  2CH6 A;  1GLJ O;  1OKJ A;  3FZH A;  2E88 A;  1ESV A;  2W40 A;  3O5B A;  4BQZ A;  3UKR B;  4BR5 A;  4CD3 A;  1NGC A;  2E1Y A;  4GY2 B;  4O8K A;  2Q36 A;  4ISF A;  1ATR A;  3ENO A;  5KQ8 A;  3KZB A;  1SAZ A;  3UE5 A;  4BRA A;  1HKG A;  4MLH A;  1J6Z A;  3S41 A;  1GLL O;  4MLE A;  3VEV A;  3H1V X;  4BR7 A;  2GWJ A;  4FL9 A;  3WXI A;  3H6E A;  5FPM A;  3VEO A;  1NLV A;  2P9L B;  3DJC A;  2GUP A;  2KHO A;  4HTL A;  5EVZ A;  4H5T A;  4LC9 B;  1BG3 A;  3I33 A;  2VYP A;  3U9Z A;  1NGA A;  2BTF A;  3QFP A;  4BRO A;  3LM9 A;  3BF1 A;  2I7N A;  1EQY A;  3VGK A;  4CZF A;  3ENH A;  2GEL A;  3WXL A;  3MN7 A;  2E20 A;  3R9P A;  1XQS C;  1ZBS A;  1SQK A;  3ZET A;  5LY3 A;  1RGI A;  3GG4 A;  4Y0W A;  3LL3 A;  4WQ4 C;  4FO0 A;  3HZ6 A;  3QFU A;  2Q1N A;  3EN9 A;  1GLD G;  2P9U B;  2QWR A;  2YI1 A;  2QWM A;  3F9M A;  4JHD A;  5AQZ A;  1G99 A;  4QS9 A;  2HOE A;  1TYQ A;  2ZGY A;  5KPR A;  2GEM A;  3O6W A;  4ISG A;  4CD1 A;  2A41 A;  2QW9 A;  3CJ7 A;  3CJA A;  1D4X A;  4CZH A;  3H45 C;  3VEY A;  3CJC A;  2CGL A;  2QWL A;  3VF4 A;  1BU6 O;  5AQM A;  1CZA N;  3A0I X;  4B1Y B;  5AQY A;  4BRI A;  1HKC A;  1Q18 A;  5AZJ A;  1NGH A;  2E1Z A;  3O1W A;  1HKB A;  2CH5 A;  5AQX A;  3L6Q A;  3U8X A;  2P9S B;  5FPE A;  2D0O A;  2UYT A;  3GL1 A;  4RTF D;  2PBD A;  1GLE G;  1NGB A;  4BR4 A;  4A2A A;  1XUP O;  4BC4 A;  3VEN A;  3A8Y A;  3VER A;  5FPN A;  3VET A;  3RSE A;  3C7N A;  4FWR A;  4ISE A;  5AQR A;  3FZK A;  2D0P A;  2Q0R A;  3WUH A;  2IVN A;  3ULE A;  2V7Z A;  3GE1 A;  1K8K A;  3BUZ B;  4K42 A;  2WUS A;  3M3Z A;  2ZF5 O;  2IVO A;  4CBX A;  4B1X B;  3VEZ A;  4H5N A;  4QS7 A;  4FOI A;  4B1V A;  1NGI A;  3FZM A;  3IFR A;  3CQY A;  2P9I A; 
#chains in the Genus database with same CATH topology
 4MDB A;  3SYZ A;  3VMF B;  4GKJ K;  1IBL K;  3KWI A;  3OYG A;  2JLE A;  3WNF A;  1CXQ A;  1NJY A;  1RT4 A;  4CEE A;  4FK4 A;  3NH2 A;  1WSE A;  3TAP A;  1SUQ A;  4DR2 K;  3SPZ A;  3CFR A;  5AQV A;  3ISN C;  3O4W A;  5JLH A;  1NMN A;  3EY1 A;  3PSF A;  4N76 A;  4XH5 A;  4IOA L;  3SQ0 A;  2P9P A;  4JS5 A;  3ZT1 A;  1JKH A;  3JYT A;  4DKW A;  4YHH K;  4BE7 B;  4GVM A;  3WNG A;  4DQI A;  5BPM A;  3RMA A;  5BRD A;  5KTQ A;  1RDD A;  4C8K A;  2E4L A;  1MDU B;  4BDZ A;  3HST B;  1NJZ A;  3VQD A;  4A57 A;  1DKG D;  2Z1J A;  3CCS N;  1LWE A;  4EAH D;  2ZM6 K;  4H0P A;  4YOW A;  1RT2 A;  2OYQ A;  3T19 A;  5AZJ B;  1BIS A;  3MMV A;  4EHU A;  4JI3 K;  5GAD P;  1T6D A;  2ZQB A;  4CEQ A;  1KQS M;  3QBW A;  4LY7 A;  3LAL A;  3S9H A;  2E2Q A;  4DB3 A;  3M8S A;  2I5J A;  1VHX A;  3C7N B;  4CZE A;  1U6Z A;  1MWK A;  4GV6 A;  3OYJ A;  3CQX A;  3OS0 A;  1NK6 A;  1VSE A;  4EHT A;  4I2Q A;  5ADX A;  5B8H A;  3TTF A;  1KAX A;  3RTV A;  2KFZ A;  3ULE B;  4O8U A;  3CET A;  1EXQ A;  5JLF A;  1XC3 A;  3NF6 A;  4ILH A;  1MU2 A;  2HMI A;  1O13 A;  4KPY A;  4MFB A;  3FFI A;  5DM6 L;  1WSI A;  3JSM A;  4E0D A;  1IG9 A;  2KW4 A;  1Z25 A;  4JS4 A;  3V6D A;  3CCU N;  3HK2 A;  4F8R A;  1G15 A;  5BR9 A;  3V9U A;  1SL2 A;  5E26 A;  4BY9 C;  2A5X A;  5CZ2 A;  1QE1 A;  1P8Z A;  3DXM A;  3G6E N;  3THW A;  2V51 B;  5KPZ A;  3EL2 A;  1ZBH A;  5FPD A;  1X9M A;  1J53 A;  4AM7 A;  3LDQ A;  4KH4 A;  1VQL N;  1NGJ A;  1S9G A;  4E1N A;  4BE0 A;  3L4Q A;  1YAG A;  2E2P A;  4IFV A;  3U9D A;  3BZK A;  4XH4 A;  4F3O A;  3SBG A;  1S1T A;  1BUP A;  1VAZ A;  2I7P A;  3P83 D;  4DSK A;  3LP3 A;  2O8E A;  3EZW A;  3CHW A;  3MK6 A;  4BG9 A;  3M1F A;  3AAQ A;  3D45 A;  5C42 A;  5HRN A;  5SZT A;  2X6S A;  4E7K A;  3BDP A;  1JLB A;  3SV4 A;  3O9T A;  5M1N A;  1WSF A;  4OPA A;  4FLU A;  3QES A;  2VG7 A;  3CM6 A;  5GAE P;  4W5N A;  3E9P A;  3E1Y A;  3FZL A;  4DF8 A;  3E66 A;  3V1Q A;  3OYD A;  3OHR A;  5LJV A;  1XHZ A;  1C6V A;  4KFB A;  4FWQ A;  3A5N C;  5JS1 A;  4DV0 K;  4ELT A;  2E2O A;  4W5T A;  3DI6 A;  3MCA B;  1ZBL A;  2HHW A;  5LMN K;  4OVL A;  1VQ9 N;  1RTD A;  4B9U A;  2ZGZ A;  1RT7 A;  2NNW A;  3MEE A;  3OS1 A;  1WB9 A;  2D5R A;  5C2F A;  3KD5 E;  4BR9 A;  3A5L C;  4CJV A;  4DV5 K;  3KK7 A;  4FW1 A;  4C8N A;  3CXC M;  4BDY A;  5CE3 A;  5I3U A;  3P1G A;  1B9F A;  4FWK A;  2O4I A;  2W41 A;  2D0C A;  1S3X A;  3SQ2 A;  1LW2 A;  5C12 A;  4F2S A;  3L3U A;  3DLB A;  4I7F A;  4Z94 A;  4E72 A;  3HVT A;  1WAJ A;  4JN4 A;  2YNH A;  3TR8 A;  4CI6 A;  2UXB K;  3RWU A;  1N32 K;  4RW9 A;  2HF3 A;  2GUI A;  3PV8 A;  3TWH A;  2YHY A;  4JAX A;  4IWV A;  4BWM A;  3FGU A;  4WFN L;  2ZWH A;  1WOQ A;  1B9D A;  4DG1 A;  5SWM A;  3DMJ A;  5KRT A;  1ATN A;  5BRF A;  4FWN A;  3TTD A;  3TAM A;  2QKK A;  3TU5 A;  3O4Q A;  4CBW A;  1CXU A;  3QML A;  3R8E A;  4BRL A;  3L2Q A;  4EZ9 A;  3AVK A;  4B08 A;  3CIP A;  4OPJ A;  4BRD A;  2BH1 A;  3SMS A;  3CC7 N;  3TTC A;  1K8A O;  2G8K A;  4FJ9 A;  4CF0 A;  3HXM A;  4ILG B;  3Q7C A;  4JKC A;  4AHT A;  4J2B A;  3TAB A;  3M8P A;  3EEQ A;  1DTT A;  4BRE A;  1YXQ A;  3P4I A;  4AH9 A;  3P31 A;  1JXE A;  4DSE A;  2YNF A;  5AQF A;  3P5J A;  2O8C B;  3H3O B;  3ZSW A;  2P9L A;  2UXC K;  1NWK A;  1HNX K;  3VEW A;  3L4I A;  4BEB A;  1TUU A;  1E4G T;  4L3Q A;  4NLC A;  2B5J A;  3R3L A;  3ZSX A;  1NK5 A;  1T7P A;  1NGG A;  2QXF A;  3TAG A;  5AQK A;  4ICL A;  4JKB A;  3LDP A;  3LZJ A;  4DQR A;  4B9V A;  2Y1J A;  5KI6 A;  4KHW A;  1U48 A;  4DTS A;  4BRC A;  4FOE A;  4RW7 A;  1KXP A;  4H4O A;  4WQ5 A;  1BO5 O;  2FSJ A;  3WQT A;  3ZX3 A;  4F9O A;  4C1N K;  2YHW A;  3E01 A;  2P5G A;  1RTJ A;  3LPU A;  2E8A A;  3MN9 A;  4O5B A;  4XH1 A;  4CHQ A;  1QQM A;  1WNS A;  4CEB A;  4CK1 A;  4CHN A;  4E7I A;  3IMX A;  4CFD A;  1RBV A;  4K43 A;  4CIE A;  4DF4 A;  1ZYQ A;  4NCA A;  4CJW A;  2QWN A;  4DR1 K;  2P9S A;  1TUY A;  1Y97 A;  1XNQ K;  1ILY A;  3AVL A;  3VQ9 A;  1VSD A;  1TKD A;  1S1X A;  4GNI A;  1U49 A;  3GBT A;  2O8D A;  3BP8 A;  4CJP A;  4FK2 A;  2DFH A;  1QSL A;  4LSN A;  4IKF A;  3CYM A;  1RBU A;  2B4J A;  3THY B;  2UUA K;  1XHX A;  3FZH A;  3DRR A;  4KH6 A;  3KKS A;  2RF2 A;  5GAH P;  3UKR B;  4CD3 A;  5J2N A;  1VQP N;  2HHH K;  1Q7Y O;  1VSL A;  3DLG A;  4JKD A;  5KQ8 A;  5C0Y A;  1NK4 A;  1RTI A;  4B9L A;  1GLL O;  3DOK A;  3H1V X;  2W00 A;  4CIF A;  4BR7 A;  4ZHR A;  3CM5 A;  4FL9 A;  3H6E A;  5FPM A;  4KH5 A;  1HMV A;  3DJC A;  4KV8 A;  3J7Z O;  1NNE A;  4HTL A;  2KHO A;  4JI7 K;  4H5T A;  4CK3 A;  3L2R A;  1TV6 A;  4BRO A;  4CGJ A;  2OTJ N;  4CJE A;  3VGK A;  4FK0 A;  4DFM A;  5HRO A;  1XWL A;  1NJW A;  4NYF A;  3V9S A;  2E20 A;  3ZET A;  3QER A;  4CF8 A;  3L8B A;  1RGI A;  4Y0W A;  4CJU A;  1S6P A;  5BR8 K;  1LAV A;  4C8M A;  4JRP A;  3C65 A;  3QFU A;  2IDO A;  3EN9 A;  4IEI A;  4IG0 A;  3V1O A;  4FVU A;  2YI1 A;  3DLL L;  4OX9 K;  1JLA A;  4OLA A;  4CJ3 A;  3ENB A;  3TSQ A;  2IOC A;  1TYQ A;  3O9U A;  5KPR A;  2W42 A;  4GKK K;  3CJ7 A;  3CJA A;  4CZH A;  4DTJ A;  3ZT2 A;  1NK8 A;  4IFY A;  3VTH A;  2PY5 A;  5AQY A;  3OYH A;  2KZM A;  1SS6 A;  1NJX A;  2E1Z A;  3KLG A;  3KK1 A;  3WNH A;  2D0O A;  2UYT A;  1L3S A;  4FZX C;  4OGE A;  1GLE G;  4BR4 A;  4A2A A;  3HP9 A;  3K57 A;  4IG3 A;  1J5O A;  3SJJ A;  3VER A;  3ZSZ A;  3QO9 A;  5CYQ A;  3LWL A;  2UUB K;  2KFN A;  4IOX A;  2Q0R A;  4Y1C A;  1EET A;  1KSP A;  4W5R A;  3SUQ A;  3BUZ B;  3RRG A;  2IVO A;  3HOS A;  3F5T A;  4CES A;  3AO1 A;  4DR6 K;  3NAE A;  4E1M A;  4E19 A;  2F7T A;  1KTQ A;  3G4S N;  3FZM A;  3IFR A;  2IAJ A;  4ELV A;  2QI2 A;  1S1W A;  2P9N A;  2CGJ A;  1KVA A;  3ZEU A;  3SQ4 A;  4C8L A;  4Z4I A;  1NGF A;  1S1U A;  4WYB A;  4M7X A;  1HQE A;  3RMC A;  2YJF A;  4BGA A;  4J2E A;  3BY5 A;  1MA9 B;  1ASV A;  1RT5 A;  4H03 B;  1EWQ A;  1VSM A;  2VWB A;  4RCH A;  2HHX A;  4PHT X;  3PX6 A;  4A61 A;  2NRX A;  3HI0 A;  4KBO A;  2DTU A;  3SUP A;  3WEE A;  4FLT A;  1TK8 A;  4A2B A;  4UY8 O;  4CF1 A;  3VTI A;  2NZT A;  3D2E A;  3TSU A;  5AQP A;  3K0S A;  3C6H A;  1BA1 A;  3D2F A;  3L0Q A;  3R6M A;  3S3M A;  4KO0 A;  2KKZ A;  2FBT A;  2XY5 A;  4KI6 A;  5J1E A;  4JHD B;  3ZSR A;  3NH1 A;  4B9M A;  2GBZ A;  3CPW M;  5DM7 L;  3HP6 A;  4LFA K;  4Z4F A;  2NRR A;  3PSI A;  5TKY A;  4M42 A;  3W0L A;  2X74 A;  1RNH A;  4JI5 K;  4KAZ A;  3TI0 A;  2VCP A;  3VGM A;  4FJK A;  1S1V A;  2EX3 A;  1E3M A;  1LV5 A;  4K8Z A;  5AQT A;  3BF3 A;  4JI1 K;  4BC5 A;  3HT3 A;  2YHX A;  4AHU A;  4KI4 A;  1QHT A;  4QS8 A;  4DTP A;  1YUW A;  5BN9 A;  3SI6 A;  3QB0 A;  4BWJ A;  4YFU A;  3MED A;  2WOM A;  4CGD A;  2D0B A;  2VWK A;  4N41 A;  4DTX A;  1YF5 L;  4FYD A;  4JI0 K;  3K5N A;  2A6A A;  4BVO A;  4DSL A;  3G0Z A;  4B1W B;  1BA0 A;  3HRG A;  2YHA A;  4H0Y B;  1XMO K;  1K8K B;  4CCH A;  3MXI A;  3QIN A;  4RWT A;  4IJN A;  3K58 A;  3NFA A;  1DTQ A;  1QS4 A;  4PQU A;  3ALY A;  2NRH A;  4O44 A;  2G8W A;  1YVN A;  4ID1 A;  1FXX A;  4CZM A;  2BDP A;  2HW3 A;  5AQQ A;  3EKS A;  4AHV A;  4RW4 A;  4CFA A;  1J9A A;  1C0M A;  4A5A A;  4DR4 K;  1BI4 A;  4JD2 B;  3HSC A;  3MN5 A;  1HRH A;  4CZI A;  3ATU A;  1WBB A;  1NK7 A;  5HLF A;  3ZX0 A;  3C6A A;  4DWI A;  4DLE A;  1GLB G;  2FBV A;  3QIP A;  4R79 A;  4CHZ A;  1QQO A;  3T1A A;  3P39 A;  2F8S A;  1KFD A;  5AQI A;  2VQE K;  1U2V B;  4CJ7 A;  1JL2 A;  3CYG A;  4EIA A;  3MX2 A;  4CJT A;  1L3V A;  2O8B A;  1L3U A;  1WAF A;  3OYM A;  3CJB A;  3UKU B;  5GAG P;  1X9W A;  2C1I A;  4DV7 K;  4I9Q A;  4JI4 K;  5F1X A;  3SLC A;  3ZYY X;  3THV A;  1I39 A;  3UIQ A;  1SL0 A;  2YJE A;  2QKB A;  1OVY A;  3QBX A;  1VRU A;  1VSJ A;  1ATS A;  3L3V A;  1KVC A;  3SAG A;  1NK0 A;  2P9K B;  4YOX A;  5KQD A;  3FFK B;  4H5W A;  1LWF A;  3DOL A;  3CCJ N;  1HLU A;  3CCV N;  4YOU A;  2A1S A;  2HBL A;  5HL7 L;  1EWR A;  4CZK A;  2WON A;  1RDB A;  4EFH A;  5AQG A;  4PKI A;  4AF1 A;  4GV3 A;  4HWI A;  1C0T A;  4JKG B;  1C0G A;  3T3F A;  4DV2 K;  3QEV A;  1IKW A;  4C23 A;  4FJ5 A;  3B8A X;  4NXN K;  3NHG A;  1U4B A;  3LDN A;  3CER A;  4J2A A;  4BRN A;  5ELZ A;  3J8A A;  3KLI A;  3K2P A;  5BRH A;  4M3R A;  2B6A A;  4AM6 A;  2HMP A;  3AA3 A;  2E2N A;  1I94 K;  1Z6R A;  3LAM A;  4CGH A;  2A40 A;  3AO5 A;  3LDO A;  4IXC A;  2QWO A;  4KHP K;  4BRP A;  5KGX A;  5M1O A;  1HNW K;  4JI6 K;  4B3R K;  3S5T A;  4FJM A;  2Q31 A;  4BC2 A;  1HQU A;  3FZF A;  4YOV A;  3AVC A;  1UOC A;  3CJ9 A;  3MN6 A;  4J2D A;  4KB0 A;  3HBT A;  4O55 A;  2IIR A;  4N56 A;  1E4F T;  1N33 K;  1F21 A;  2XY6 A;  3IUC A;  2J4R A;  1HYZ A;  4FWS A;  4EP4 A;  2YKM A;  2F9T A;  2Q97 A;  1LWC A;  1BQN A;  5EX5 A;  3CCM N;  4NCB A;  1WLJ A;  3M6G A;  3CFP A;  4EZ6 A;  3G25 A;  1RDW X;  4FPA A;  4PKG A;  4RG8 A;  1FJG K;  5HBM A;  3QNO A;  3RMD A;  1Z05 A;  3VEX A;  1S22 A;  2FF3 B;  1N34 K;  1NOY A;  3Q7B A;  5AR0 A;  3NVK A;  2HNZ A;  4KRF A;  5J2P A;  4FPB A;  3T69 A;  4BRH A;  1YIT N;  2ZJR L;  4BVP A;  1GOC A;  2JWK A;  4X66 K;  1LW0 A;  1X9S A;  4N47 A;  1RT3 A;  4E7L A;  2P9U A;  4Z0U A;  1NU0 A;  4BRK A;  1T8E A;  4KHQ A;  3ZSV A;  1WSH A;  4MO4 A;  4K41 A;  3EKU A;  1NOZ A;  3QIO A;  4PWD A;  3SV3 A;  3A5M C;  3SAF A;  2AA4 A;  3KIO A;  2BAN A;  4IO8 A;  1QVF M;  4BE2 A;  2FF6 A;  2FXU A;  3JS6 A;  2O8F A;  2UU9 K;  1HJR A;  3ID8 A;  3HPH A;  4B3S K;  3J7A P;  2NUB A;  3AO2 A;  1NKE A;  1LCU A;  3DXK B;  1KAY A;  4CGI A;  3LDS A;  4DU1 A;  3OYB A;  1C1C A;  4JRQ A;  3O3G A;  2RHK A;  4NYN A;  3QDK A;  2LSN A;  1D5A A;  4BR0 A;  2NRT A;  2CH6 A;  4KHU A;  1OKJ A;  3HL8 A;  2E88 A;  5C10 A;  3HYF A;  2W40 A;  1BQM A;  4DUZ K;  2OPS A;  4GY2 B;  5GIO A;  4FM0 A;  3LZI A;  4O8K A;  3QEW A;  4QCL A;  3KZB A;  1JLQ A;  1SAZ A;  4IDH A;  3UE5 A;  4BRA A;  4LF7 K;  2R7Y A;  3NGZ A;  3S41 A;  1ASW A;  4FLZ A;  3LP1 A;  3VEV A;  2OPP A;  1VSH A;  4QAG A;  4I2P A;  2GWJ A;  4DR5 K;  2W6K A;  3CCR N;  4KHY A;  3O9S A;  4F4K A;  4FM1 A;  5EVZ A;  3HPO A;  3IAY A;  1BG3 A;  4OGC A;  1NGA A;  2BTF A;  1WSJ A;  3AGK A;  1TK0 A;  2QK9 A;  1JLC A;  1C1B A;  1EQY A;  3RVC A;  4CZF A;  1VQM N;  1VQO N;  4OKJ A;  3WXL A;  3MN7 A;  4YY3 K;  3R9P A;  3I0S A;  1CZB A;  5LY3 A;  5FDL A;  3KLF A;  3SPY A;  3VQE A;  4WQ4 C;  3MEG A;  3ZSY A;  3SUO A;  4CIG A;  2F4V K;  4X65 K;  4DTR A;  3DYA A;  1GLD G;  2HBJ A;  3AGR A;  4CGG A;  4DFJ A;  3F9M A;  5AQZ A;  2HHS A;  1RT1 A;  4DUY K;  2GEM A;  3O6W A;  1D8Y A;  3EE8 A;  1YJW N;  1FW6 A;  3VF4 A;  1BU6 O;  5AQM A;  1CZA N;  3TSP A;  4BRI A;  5AZJ A;  2F8T A;  4HUG A;  3TAE A;  3O1W A;  5AQX A;  3G10 A;  3L6Q A;  1DT9 A;  5FPE A;  5IT9 O;  1ZBI A;  3GL1 A;  4FLX A;  4RTF D;  2HHT A;  1NGB A;  4G9Z A;  1VQ7 N;  3VET A;  4DQQ A;  3C7N A;  2KQ2 A;  4FWR A;  3OYA A;  1Q9X A;  3PUF A;  4V19 S;  3HJF A;  4B9T A;  1C1A A;  1KD1 O;  4HCB A;  4HTU A;  2IVN A;  3S3O A;  1ZBF A;  3ULE A;  2GX9 A;  1Q82 O;  4M3X A;  3ZSO A;  3GE1 A;  4K42 A;  2WUS A;  2ZF5 O;  4IDK A;  3OYK A;  3SBT A;  4U7B A;  4KHS A;  4H5N A;  3F2K A;  4ILJ A;  4C1N I;  4DV6 K;  3OJS A;  3T1Y K;  3CQY A;  4DV4 K;  1RDA A;  4PL7 A;  1N36 K;  4E1J A;  5AQL A;  5AFU A;  4AHS A;  4BC3 A;  3A5O C;  2RKI A;  4JYA K;  1RDC A;  1Z26 A;  5BRE A;  1EX4 A;  2WC9 A;  4B9Q A;  3GOI A;  1LAW A;  1RBS A;  1GOA A;  1NMD A;  1WSG A;  4WCE L;  4CJF A;  4KB1 A;  2H3G X;  5JS2 A;  5EY4 A;  3CME N;  4F3T A;  3GDQ A;  1TKX A;  1WBD A;  2RPI A;  2JGU A;  3VQB A;  3VF2 A;  3VA3 A;  3MX5 A;  2QM1 A;  5HRR A;  4CJR A;  2A3Z A;  3LP2 A;  2G8U A;  4LFB K;  1JCE A;  3U3Y A;  2Z1H A;  2KZZ A;  2G8I A;  1TAQ A;  5AQH A;  4M3Z A;  3P38 A;  4CZJ A;  3K5M A;  1VQK N;  4WQ4 A;  1N5Y A;  3KD1 E;  1C0F A;  2HHV A;  4AIL C;  5AQO A;  3IDH A;  4CHO A;  2RN2 A;  3IRX A;  2XO7 A;  3RSE B;  4ID5 A;  3C6U A;  1K6Y A;  4OLB A;  1JL1 A;  2HVH A;  1A5X A;  4I6M A;  3NBP A;  2XHB A;  1NG9 A;  1BDG A;  1QHA A;  3AV9 A;  5FLX O;  3NDK A;  3VPZ A;  4Z4H A;  5CHI A;  5CZ1 A;  2KTQ A;  4FM2 A;  4IJA A;  4HVJ A;  3DLK A;  1GLC G;  4LFC K;  2P9I B;  4K8X A;  3OJU A;  1ZC6 A;  1W97 L;  1ITG A;  4JKA A;  3MXM A;  1ZXO A;  4CJK A;  2VG6 A;  3SQ1 A;  4O4G A;  1XMQ K;  3DLH A;  3WXJ A;  3OW2 M;  1W0H A;  4Z4C A;  2O4G A;  3OA9 A;  2HF4 A;  2YCH A;  1GLF O;  1J5E K;  2OZS A;  2ITG A;  1SKW A;  3S3N A;  3NH0 A;  2P9P B;  1N8R O;  4DSJ A;  4O0J A;  1JLE A;  5DK5 A;  2E5L K;  5E84 A;  2Y1I A;  2BUP A;  4WFA L;  3AAR A;  4DS5 A;  1O1W A;  1HJO A;  4Q0B A;  2FSN A;  1M1K O;  2YX6 A;  5EU7 A;  4N5S A;  3OY9 A;  4M3Y A;  3DM2 A;  1T6C A;  3KLH A;  3V81 A;  1S72 N;  5KPT A;  3U3G A;  1Q8I A;  3CI5 A;  3OVN A;  2O8C A;  2Q2R A;  4B8A B;  1VSF A;  3I8B A;  3NF8 A;  4FWP A;  5HOO A;  5J2Q A;  1TAU A;  3J7Y P;  4GV9 A;  4ZTF A;  2P51 A;  1BOT O;  1L3T A;  4OPH A;  3NF9 A;  2QWQ A;  4JV5 K;  4IO9 L;  4WE1 A;  5GIP A;  3CPE A;  3HVR A;  4CEO A;  4Z4E A;  3DRP A;  4IBN A;  3WNE A;  1IG8 A;  1Y64 A;  3SJH A;  2ASP A;  1YJ9 N;  1V4T A;  5E41 A;  2F9W A;  4DR3 K;  4FZZ A;  3QEX A;  3AY9 A;  3CFO A;  4M63 C;  1VQ8 N;  4ELU A;  3KHY A;  3NE6 A;  2XRI A;  3E9L A;  2G8V A;  1HPZ A;  4DMN A;  1P90 A;  3DXM B;  3THW B;  2C1G A;  1JXB A;  3VQ8 A;  4FJ8 A;  3OS2 A;  4JKE A;  1HPM A;  3MWT A;  1TKT A;  1Q9Y A;  1OH7 A;  4CW7 B;  1KFS A;  4JK8 A;  1QTM A;  3QET A;  2D4W A;  3IS9 A;  4IEE A;  3C95 A;  3BGR A;  2O8E B;  3AAP A;  4G1Q A;  5BN8 A;  1QZ5 A;  3KTQ A;  1R59 O;  5JVH L;  4OO1 J;  3THX A;  3WXM B;  3THY A;  4X64 K;  3KVG A;  3L2W A;  3O1B A;  3UKR A;  3AVJ A;  1GLA G;  5F2R A;  1TGO A;  4HUE A;  2QXL A;  3M8R A;  4JKH A;  2XY8 A;  1MWM A;  4BEC A;  1L5U A;  3AA4 A;  4CZG A;  2PYL A;  3AVB A;  3VQC A;  3SUN A;  2P1J A;  4X62 K;  4DCH A;  3AVA A;  1NBW A;  1YJN N;  2ZJQ L;  1QQC A;  4LF4 K;  3LPT A;  4NO7 A;  4DTU A;  2O8F B;  3B6P A;  4GVE A;  5BPN A;  2VGM A;  5BPL A;  3TPQ A;  4E89 A;  3M5R A;  2QTD A;  3RR7 A;  2YKN A;  3AO4 A;  4JK7 A;  3WXK A;  1VQ5 N;  4FZY A;  1RCH A;  1YIJ N;  2ASO A;  1V4S A;  1IO2 A;  4H0T B;  5AZI A;  1VSK A;  3QEI A;  1IBM K;  3OBW A;  3PO4 A;  3K5L A;  4IZ9 A;  3O3H A;  4OKK A;  3KKR A;  1OH6 A;  3LWM A;  3WQU A;  2GV9 A;  1NM1 A;  2VGN A;  4LF8 K;  3J80 O;  5I9E B;  2FSK A;  5EXW A;  2D1K A;  4PL8 A;  5HRS A;  4E7H A;  2ZJP L;  4FJI A;  4LH4 A;  3ZX2 A;  3MCP A;  1CLQ A;  3SAH A;  2QWP A;  3DLR A;  4FXD A;  2ZD1 A;  3K5O A;  5C2D A;  3H1Q A;  3N4Q A;  2FBX A;  4K25 A;  3V9X A;  1QQN A;  1W9H A;  1RT6 A;  1Q81 O;  2YV0 X;  2RE2 A;  5AFU H;  1GLJ O;  3SCX A;  1ESV A;  2ATQ A;  4BQZ A;  4BR5 A;  4UQG A;  1NGC A;  4MDA A;  2E1Y A;  1REV A;  2Q36 A;  1ATR A;  3C6T A;  2DY4 A;  2BGG A;  1J6Z A;  1VQ4 N;  3R1X A;  1Q86 O;  2NRV A;  3ITH A;  1S5J A;  4WF9 L;  4ZTJ A;  3VEO A;  3CC4 N;  3KK3 A;  3VQ6 A;  4FJN A;  2P9L B;  3VQ4 A;  4LC9 B;  2PZS A;  3U9Z A;  4XJX A;  1I3A A;  3CCE N;  3LM9 A;  5H1S Q;  3BF1 A;  5CR4 A;  3KK2 A;  1KLM A;  2I7N A;  3I56 N;  1TL1 A;  4KHN A;  1ZBS A;  1SQK A;  3B6O A;  3GG4 A;  3LL3 A;  1KRP A;  4FO0 A;  3HZ6 A;  4JI2 K;  2OTL N;  2Q1N A;  3EE9 A;  3NGY A;  5FRN A;  3NF7 A;  3VA0 A;  2QWR A;  5M1Q A;  4JHD A;  5IWA K;  4QS9 A;  2HOE A;  2ZGY A;  4ISG A;  3NCI A;  2QW9 A;  4GW6 A;  1YHQ N;  2HBK A;  3VEY A;  4FJX A;  3CJC A;  2WBN A;  4DQS A;  1YI2 N;  1BGX T;  2QWL A;  4B1Y B;  1NKC A;  1XI1 A;  1HKC A;  1NGH A;  4FW2 A;  4PA1 A;  2VQF K;  2HVI A;  1HKB A;  3DLE A;  4NCG A;  4W5Q A;  2P9S B;  4B8C A;  2PBD A;  4DU4 A;  4BC4 A;  2IS3 A;  3PX0 A;  4H4M A;  5FPN A;  3RMB A;  2O8D B;  3O3F A;  5AQR A;  3AVN A;  3I0R A;  3FZK A;  3VQP A;  3BZC A;  2D0P A;  3K9J A;  1RBT A;  3WUH A;  1K73 O;  1K8K A;  5T7B A;  3HO1 A;  2UXD K;  4CBX A;  4B3T K;  4B1X B;  4QS7 A;  3OYI A;  1NGI A;  3V9Z A;  5AQS A;  4DR7 K;  4M3T A;  4DS4 A;  4CER A;  4H5R A;  4JD2 A;  3VF6 A;  1HNI A;  4CE9 A;  1BWF O;  4PKH A;  3FR0 A;  3PY8 A;  1X9J A;  3T7Z A;  4Y1D A;  4MO5 A;  1IJJ A;  4E7J A;  1LOT B;  3CC2 N;  3AA5 X;  2IVP A;  3O4N A;  4CEA A;  1UA1 A;  3OYF A;  2AP1 A;  3PO5 A;  3DRS A;  3H3N O;  1HYV A;  4BQL A;  5LJW A;  1J54 A;  5I42 A;  2ZE2 A;  2GWK A;  3ZET B;  1NGE A;  4WQ5 C;  4E3S A;  2A1R A;  1U2V A;  3MEC A;  2A42 A;  3LDL A;  4I6M B;  2VG5 A;  1IBK K;  3D0P A;  5EOY A;  5FRM A;  3UKU A;  4O5F A;  4CBU A;  4MQ3 A;  1TYQ B;  2OAN A;  3C0B A;  5JIC A;  2EWS A;  3VES A;  3VQA A;  4JEP A;  3FE1 A;  4KTQ A;  3K59 A;  4DHY A;  3HM9 A;  3T1H K;  4AHR A;  2P9K A;  3SNN A;  1D9F A;  3SMP A;  1WUA A;  3MDQ A;  4TSX A;  1KLN A;  1JCG A;  5J2M A;  5M1F A;  2WFB A;  4RW8 A;  3VQ7 A;  1IV0 A;  3NVM A;  4DTM A;  2HND A;  4HHT A;  5JMV A;  4CEZ A;  5LMU K;  1M90 O;  3RR8 A;  3WT0 A;  4BRG A;  4Q5V A;  2OPR A;  2AJQ A;  3ZLJ A;  3QLH A;  4HUF A;  2WTU A;  1TVR A;  2JWL A;  4CFB A;  2PAV A;  3F9K A;  3HTV A;  4JKG A;  4BRQ A;  3CCL N;  1HNZ K;  3V9W A;  1KC8 O;  4CFC A;  2YNI A;  2OA8 A;  4DV1 K;  5C25 A;  3OYL A;  5AQJ A;  2HHQ A;  2X6N A;  4CJ5 A;  1SZ2 A;  5CYM A;  3EZ5 A;  2UUC K;  3ZT3 A;  2Z1G A;  3J81 O;  5AQU A;  3V4I A;  4FWM A;  2P9N B;  3KJV A;  1KVB A;  3ZEU B;  4M3U A;  2VWJ A;  4J8F A;  4CF9 A;  5LL6 Z;  2EHG A;  3UB5 A;  3KLE A;  1B92 A;  2FC0 A;  2HHI A;  4DQP A;  1ASU A;  4KKO A;  3PIO L;  5TKW A;  2HB5 A;  4OPK A;  1KAZ A;  4B9S A;  3ULD A;  1FKO A;  1TKZ A;  3ZSQ A;  3WEE B;  1W2B M;  2YHB A;  4YDU C;  1IKV A;  4DSF A;  4R5P A;  5D3G A;  1T44 A;  3ATV A;  3D2E B;  4LH5 A;  3D2F B;  1X3N A;  1JCF A;  4XIU A;  3U4L A;  4LF5 K;  4I9L A;  3VN5 A;  2QEX N;  3AA2 A;  4FSV A;  3I55 N;  1HR0 K;  3CD6 N;  4CEF A;  4H0O A;  1CZ9 A;  4B1U B;  4BRF A;  1VRT A;  4CJQ A;  1SV5 A;  4CJL A;  3QIC A;  4FWO A;  3VOV A;  3O8M A;  3O80 A;  2V52 B;  4U67 L;  4IFE A;  4CEC A;  2CGK A;  2GTD A;  1FK9 A;  4KTW A;  1QZ6 A;  1SKR A;  4DFP A;  4B9N A;  4EP5 A;  3MWP A;  3ASM A;  3HM8 A;  3M8Q A;  4DFK A;  4FLW A;  1RFQ A;  1BCO A;  4AQY K;  4H0X B;  5HP1 A;  1NKB A;  4DQ8 A;  3W3D A;  2NLX A;  1R0A A;  3CJ1 A;  4M7Y A;  1UA0 A;  1NGD A;  4CZL A;  1SKS A;  4FJJ A;  3THX B;  4BG8 A;  1OH5 A;  4FJH A;  3OTO K;  5F0X A;  4DTN A;  4M3W A;  4FJL A;  4CHY A;  5GIN A;  1T3V A;  4FJ7 A;  1UAX A;  5MLC Q;  4CJS A;  3ZCM A;  2XY7 A;  1YTU A;  1XNR K;  2OPQ A;  3DAW A;  1IKY A;  1BI4 B;  3MXJ A;  4FWL A;  2NRW A;  4A59 A;  2E6M A;  5M1K A;  3HPG A;  5M1P A;  5AQN A;  1HX1 A;  1SL1 A;  3LM2 A;  5KRS A;  3O9Q A;  3PLA A;  4B1Z A;  3MAQ A;  3DXK A;  1VSI A;  2HHU A;  2ETJ A;  4JK9 A;  1U47 A;  1C0U A;  3JXU A;  4BGB A;  5K14 A;  3VQ5 A;  3QEP A;  4BRM A;  3SK3 A;  4W5O A;  3F73 A;  1OH8 A;  2O8B B;  2DFF A;  3SZ2 A;  4JNE A;  1S9E A;  4YOT A;  4XEI A;  4BR2 A;  5AZI B;  3FLC O;  4YDU A;  4H0V B;  2V7Y A;  3CQ8 A;  4OJR A;  4FLV A;  1X3M A;  3I8D A;  3LAN A;  1BL3 A;  4DU3 A;  4WFB L;  2DPN A;  5ADX H;  2BE2 A;  4H5V A;  3H46 O;  4QOZ B;  5JVG L;  4HCC A;  3OYE A;  3IG1 A;  3O08 A;  1FKP A;  4C8O A;  5AQW A;  1U04 A;  1JLG A;  1UWB A;  4GMJ B;  2ITM A;  3D7E O;  1XC9 A;  1T03 A;  1T05 A;  2OZM A;  3JAM O;  2DFE A;  4B3O A;  4CJ4 A;  2IGI A;  4NXM K;  2Q3S A;  3H08 A;  5A2Q O;  4JLH A;  1JLF A;  2ASM A;  3DWL A;  4PY5 A;  4CF2 A;  3CF5 L;  1HUX A;  1TL3 A;  3N4P A;  5FRO A;  1A5V A;  4BDP A;  1DEJ A;  5AJ3 K;  4KTZ A;  4CGF A;  4NB4 A;  1HNV A;  3PIP L;  1H1V A;  4YOR A;  3QNN A;  4NLB A;  3G71 N;  1WN7 A;  1VQ6 N;  4FLY A;  3VGL A;  2PFU A;  2Q0U A;  1BCM A;  2E6L A;  1YVU A;  3EO3 A;  2G8F A;  3AVH A;  4PUO A;  3BEX A;  2FLO A;  2OCE A;  3ZT4 A;  3TAR A;  3NMU A;  3L2V A;  1DGK N;  3OBY A;  1A5W A;  4OKE A;  2W6L A;  4JKF A;  4A62 A;  5HRP A;  4KRE A;  4FVM A;  3EYZ A;  1RDU A;  4B3M K;  1BIZ A;  3TAQ A;  3O9R A;  1BIU A;  4YNQ A;  3OYC A;  1ZBU A;  4Z4G A;  4FCY A;  4DSI A;  4LSL A;  3O5B A;  1VQN N;  4LF6 K;  5C15 A;  5CY4 A;  2NRZ A;  2FBY A;  3AVI A;  3ZT0 A;  1KCF A;  4IOC L;  4ISF A;  3PX4 A;  3ENO A;  4M41 A;  2KLA A;  3RRH A;  1HKG A;  1RTH A;  4MLH A;  4LD0 A;  1TK5 A;  4MLE A;  3E9O A;  1RIL A;  3C94 A;  2HBM A;  4M45 A;  2HST A;  1HYS A;  2F96 A;  2PYJ A;  3WXI A;  1X1P A;  4JI8 K;  3ID6 A;  3D6R A;  1NLV A;  2GUP A;  3I33 A;  2VYP A;  1YTA A;  3TAF A;  1QSS A;  3QFP A;  4DTO A;  1EKE A;  4F2R A;  4DLG A;  2IC3 A;  4K0K K;  2HNY A;  3ENH A;  1RBR A;  5JEN A;  2GEL A;  3L2U A;  4DV3 K;  1XQS C;  1U45 A;  3AVG A;  4FJG A;  1GOB A;  1D9D A;  1IKX A;  3IKM A;  1QSY A;  5DMR A;  3NGI A;  3V1R A;  1N6Q A;  2P9U B;  3AO3 A;  3VQQ A;  2QWM A;  4A5B A;  4CED A;  5C24 A;  1W7A A;  1G99 A;  3U6F A;  4CD1 A;  2A41 A;  3LAK A;  1D4X A;  1OVQ A;  3H45 C;  2X78 A;  1DLO A;  2CGL A;  4RW6 A;  2P5O A;  1S6Q A;  3A0I X;  3TAN A;  1Q18 A;  2QA4 N;  2CH5 A;  4L8R B;  3U8X A;  1NK9 A;  2Z1I A;  1VK0 A;  3OYN A;  4CK2 A;  4BE1 A;  1XUP O;  1JJ2 M;  3VEN A;  4CHP A;  3A8Y A;  1NJI O;  3K9K A;  1EO1 A;  1YT3 A;  3RSE A;  1IH7 A;  4ISE A;  4H8K A;  4CVN E;  3LP0 A;  1EP4 A;  3HOT A;  2YNG A;  1BHL A;  3KWG A;  2V7Z A;  4YOY A;  3CG7 A;  3M3Z A;  3AVM A;  2G8H A;  4O0I A;  4BAC A;  4AHC A;  3AVF A;  3CCQ N;  5KGW A;  3VEZ A;  2D0A A;  1QVG M;  4FOI A;  3CMA N;  4B1V A;  4LF9 K;  3A2F A;  2P9I A;  1K9M O; 
#chains in the Genus database with same CATH homology
 2P9N A;  2CGJ A;  4MDB A;  5AQS A;  3VMF B;  3ZEU A;  3KWI A;  4PL7 A;  4H5R A;  4JD2 A;  3VF6 A;  4E1J A;  1NGF A;  5AQL A;  5AFU A;  1BWF O;  4WYB A;  4PKH A;  4M7X A;  3A5O C;  4BC3 A;  3FR0 A;  1X9J A;  2YJF A;  3T7Z A;  4BGA A;  5BRE A;  1MA9 B;  4H03 B;  1IJJ A;  4MO5 A;  1LOT B;  2VWB A;  2WC9 A;  4RCH A;  4B9Q A;  3CC2 N;  2IVP A;  4PHT X;  5AQV A;  4A61 A;  3GOI A;  3O4W A;  5JLH A;  1NMD A;  4WCE L;  2AP1 A;  2NRX A;  3HI0 A;  4KBO A;  4XH5 A;  4IOA L;  3WEE A;  3H3N O;  4BQL A;  2H3G X;  5LJW A;  4A2B A;  5EY4 A;  2P9P A;  3ZET B;  2GWK A;  4UY8 O;  1NGE A;  4WQ5 C;  3CME N;  1U2V A;  3GDQ A;  3VTI A;  2NZT A;  2A42 A;  3D2E A;  3TSU A;  4DKW A;  5AQP A;  3C6H A;  1BA1 A;  3LDL A;  3D2F A;  3L0Q A;  4I6M B;  3R6M A;  4BE7 B;  3VF2 A;  2KKZ A;  5BPM A;  5EOY A;  3MX5 A;  2QM1 A;  5BRD A;  3UKU A;  4JHD B;  4O5F A;  4CBU A;  1MDU B;  1TYQ B;  2OAN A;  3CPW M;  2A3Z A;  4A57 A;  5DM7 L;  1DKG D;  3C0B A;  1JCE A;  5JIC A;  2NRR A;  3CCS N;  4EAH D;  2EWS A;  5AQH A;  3VES A;  4JEP A;  4H0P A;  3FE1 A;  3P38 A;  4CZJ A;  5TKY A;  4DHY A;  4YOW A;  3W0L A;  5AZJ B;  1VQK N;  4WQ4 A;  2P9K A;  3MMV A;  4EHU A;  1C0F A;  3SMP A;  5GAD P;  2VCP A;  1WUA A;  1T6D A;  3MDQ A;  5AQO A;  3IDH A;  3VGM A;  1JCG A;  1KQS M;  5AQT A;  3QBW A;  5M1F A;  3BF3 A;  4BC5 A;  2WFB A;  2YHX A;  2E2Q A;  4QS8 A;  4DB3 A;  1YUW A;  5BN9 A;  3NVM A;  3QB0 A;  3RSE B;  3C7N B;  4CZE A;  5JMV A;  1M90 O;  1U6Z A;  1YF5 L;  1MWK A;  3WT0 A;  4BRG A;  4GV6 A;  3CQX A;  2A6A A;  4EHT A;  5ADX A;  5B8H A;  3TTF A;  4BVO A;  2JWL A;  4I6M A;  4B1W B;  1KAX A;  2PAV A;  3HTV A;  1BA0 A;  4JKG A;  4O8U A;  3ULE B;  3CET A;  1BDG A;  1QHA A;  3HRG A;  4H0Y B;  4BRQ A;  1K8K B;  5JLF A;  1XC3 A;  4ILH A;  3CCL N;  4RWT A;  4IJN A;  1KC8 O;  1O13 A;  3VPZ A;  5DM6 L;  5CHI A;  2NRH A;  5AQJ A;  4IJA A;  1SZ2 A;  1YVN A;  4CZM A;  1GLC G;  3CCU N;  5AQQ A;  5AQU A;  2P9I B;  3EKS A;  4FWM A;  5BR9 A;  2P9N B;  3ZEU B;  1ZC6 A;  1W97 L;  5E26 A;  4BY9 C;  4A5A A;  2A5X A;  1P8Z A;  4JKA A;  4J8F A;  4JD2 B;  3DXM A;  3G6E N;  3HSC A;  3MN5 A;  1ZXO A;  2V51 B;  3UB5 A;  5KPZ A;  4CZI A;  3ATU A;  3EL2 A;  5FPD A;  3WXJ A;  4AM7 A;  3OW2 M;  3ZX0 A;  3C6A A;  3LDQ A;  4KH4 A;  1VQL N;  1GLB G;  1NGJ A;  3OA9 A;  3PIO L;  5TKW A;  2HF4 A;  1YAG A;  2E2P A;  2YCH A;  3L4Q A;  3U9D A;  1KAZ A;  1GLF O;  4XH4 A;  3SBG A;  4R79 A;  1VAZ A;  1BUP A;  2I7P A;  3WEE B;  1W2B M;  1QQO A;  4YDU C;  2P9P B;  3P39 A;  1N8R O;  3EZW A;  3CHW A;  5AQI A;  3MK6 A;  1U2V B;  4BG9 A;  1T44 A;  3ATV A;  3M1F A;  3D2E B;  4CJ7 A;  3AAQ A;  4EIA A;  5E84 A;  3D2F B;  3MX2 A;  1X3N A;  2BUP A;  4WFA L;  3CJB A;  3O9T A;  1JCF A;  3UKU B;  3AAR A;  5GAG P;  5M1N A;  3U4L A;  1HJO A;  4OPA A;  2C1I A;  2FSN A;  1M1K O;  5F1X A;  3SLC A;  3ZYY X;  2YX6 A;  5GAE P;  2QEX N;  2YJE A;  3E9P A;  3E1Y A;  4FSV A;  3I55 N;  3CD6 N;  1OVY A;  1T6C A;  3FZL A;  3QBX A;  4H0O A;  4B1U B;  1S72 N;  3E66 A;  1ATS A;  4BRF A;  5KPT A;  3OHR A;  3CI5 A;  5LJV A;  3SAG A;  2P9K B;  4YOX A;  5KQD A;  2Q2R A;  3FFK B;  3QIC A;  4H5W A;  4FWQ A;  4FWO A;  3VOV A;  3I8B A;  4FWP A;  5HOO A;  3CCJ N;  1HLU A;  3A5N C;  3O8M A;  4YOU A;  3CCV N;  3O80 A;  4GV9 A;  2E2O A;  2V52 B;  4U67 L;  4IFE A;  3MCA B;  2CGK A;  1BOT O;  2GTD A;  2HBL A;  5HL7 L;  1QZ6 A;  4OPH A;  2QWQ A;  4CZK A;  4IO9 L;  1VQ9 N;  3MWP A;  3HM8 A;  2ZGZ A;  1RFQ A;  4EFH A;  2NNW A;  5AQG A;  4PKI A;  4AF1 A;  5GIP A;  3CPE A;  4H0X B;  4GV3 A;  5C2F A;  4BR9 A;  4HWI A;  4DQ8 A;  4JKG B;  3W3D A;  1C0G A;  3A5L C;  3KK7 A;  3CXC M;  2NLX A;  3CJ1 A;  4M7Y A;  1IG8 A;  4C23 A;  3B8A X;  1NGD A;  5CE3 A;  1Y64 A;  4CZL A;  4FWK A;  3SJH A;  2ASP A;  1YJ9 N;  1V4T A;  2F9W A;  4BG8 A;  2W41 A;  1S3X A;  5F0X A;  3LDN A;  3CER A;  3AY9 A;  5C12 A;  4M63 C;  1VQ8 N;  4BRN A;  4Z94 A;  5ELZ A;  5GIN A;  1T3V A;  3KHY A;  3J8A A;  4JN4 A;  4CI6 A;  5MLC Q;  3E9L A;  5BRH A;  3DAW A;  4A59 A;  4FWL A;  1P90 A;  2NRW A;  2HF3 A;  3DXM B;  2C1G A;  4AM6 A;  2HMP A;  2E2N A;  2YHY A;  1Z6R A;  4IWV A;  4JAX A;  3FGU A;  4WFN L;  2ZWH A;  2A40 A;  4JKE A;  5M1K A;  5M1P A;  1WOQ A;  1HPM A;  3MWT A;  3LDO A;  4IXC A;  5AQN A;  1HX1 A;  2QWO A;  3LM2 A;  1ATN A;  5BRF A;  3O9Q A;  3PLA A;  4B1Z A;  4JK8 A;  4BRP A;  4FWN A;  3TTD A;  5M1O A;  3DXK A;  2D4W A;  3TU5 A;  4IEE A;  2Q31 A;  4CBW A;  3AAP A;  5BN8 A;  3R8E A;  3QML A;  4JK9 A;  4BC2 A;  4BRL A;  1QZ5 A;  1R59 O;  5JVH L;  3CIP A;  4OO1 J;  3JXU A;  3FZF A;  3WXM B;  4YOV A;  4BRD A;  2BH1 A;  4BGB A;  3SMS A;  3CC7 N;  3TTC A;  1K8A O;  3CJ9 A;  3MN6 A;  4BRM A;  3SK3 A;  3KVG A;  3HBT A;  4JNE A;  3O1B A;  3UKR A;  4ILG B;  4YOT A;  4XEI A;  4BR2 A;  3Q7C A;  1GLA G;  4JKC A;  5F2R A;  2IIR A;  2QXL A;  5AZI B;  1E4F T;  3FLC O;  4YDU A;  4BRE A;  3IUC A;  1YXQ A;  2J4R A;  3P4I A;  4H0V B;  1MWM A;  4JKH A;  2V7Y A;  4BEC A;  3P31 A;  4FWS A;  4CZG A;  2F9T A;  2Q97 A;  5AQF A;  1X3M A;  3H3O B;  5EX5 A;  3CCM N;  4WFB L;  2DPN A;  5ADX H;  4DCH A;  2P9L A;  1NWK A;  1NBW A;  3M6G A;  3VEW A;  1YJN N;  4H5V A;  3H46 O;  3L4I A;  3G25 A;  4BEB A;  2ZJQ L;  5JVG L;  1RDW X;  4FPA A;  4PKG A;  1TUU A;  4NO7 A;  1E4G T;  4L3Q A;  4NLC A;  3O08 A;  1Z05 A;  4GVE A;  3VEX A;  5BPN A;  1S22 A;  2VGM A;  3R3L A;  2FF3 B;  5BPL A;  5AQW A;  1NGG A;  3Q7B A;  5AR0 A;  3TPQ A;  3NVK A;  2ITM A;  3D7E O;  3M5R A;  2QTD A;  5AQK A;  4JKB A;  4JK7 A;  3WXK A;  3LDP A;  4FPB A;  3T69 A;  4BRH A;  1VQ5 N;  1YIT N;  2ZJR L;  4BVP A;  1YIJ N;  2ASO A;  1V4S A;  2JWK A;  4H0T B;  5AZI A;  2ASM A;  3DWL A;  4BRC A;  4FOE A;  3CF5 L;  1KXP A;  1HUX A;  3N4P A;  1DEJ A;  2P9U A;  4WQ5 A;  1BO5 O;  4BRK A;  2FSJ A;  3WQT A;  3OBW A;  3ZX3 A;  4F9O A;  4C1N K;  4MO4 A;  2YHW A;  4K41 A;  3EKU A;  4NB4 A;  4IZ9 A;  2E8A A;  3MN9 A;  4XH1 A;  3PIP L;  1H1V A;  1QQM A;  3WQU A;  3IMX A;  1NM1 A;  2VGN A;  3A5M C;  4YOR A;  3SAF A;  4K43 A;  2AA4 A;  4NLB A;  3G71 N;  4IO8 A;  1VQ6 N;  1QVF M;  2FF6 A;  2QWN A;  3VGL A;  2FXU A;  2PFU A;  2P9S A;  2Q0U A;  3JS6 A;  5I9E B;  2FSK A;  3EO3 A;  1TUY A;  5EXW A;  3BEX A;  2FLO A;  3ID8 A;  2D1K A;  4PL8 A;  3NMU A;  1DGK N;  2ZJP L;  3OBY A;  1ILY A;  3ZX2 A;  3MCP A;  3SAH A;  1LCU A;  2QWP A;  1KAY A;  3DXK B;  4GNI A;  4JKF A;  4A62 A;  3GBT A;  5C2D A;  3BP8 A;  3H1Q A;  3N4Q A;  2RHK A;  4K25 A;  1QQN A;  1RDU A;  1Q81 O;  3QDK A;  4BR0 A;  3O9R A;  2RE2 A;  2NRT A;  5AFU H;  2CH6 A;  1GLJ O;  1OKJ A;  3FZH A;  2E88 A;  5C10 A;  1ESV A;  2W40 A;  3O5B A;  4KH6 A;  4BQZ A;  3UKR B;  4BR5 A;  5GAH P;  1VQN N;  4CD3 A;  1NGC A;  4MDA A;  2E1Y A;  4GY2 B;  5GIO A;  1VQP N;  5C15 A;  4O8K A;  2NRZ A;  1Q7Y O;  4JKD A;  2Q36 A;  4IOC L;  4ISF A;  1ATR A;  3ENO A;  5KQ8 A;  3KZB A;  1SAZ A;  2KLA A;  4IDH A;  3UE5 A;  5C0Y A;  4BRA A;  1HKG A;  4MLH A;  1J6Z A;  3S41 A;  1GLL O;  1VQ4 N;  3R1X A;  3E9O A;  4MLE A;  3VEV A;  3H1V X;  1Q86 O;  2W00 A;  2HBM A;  2NRV A;  4BR7 A;  2GWJ A;  2HST A;  4FL9 A;  3WXI A;  4WF9 L;  3H6E A;  3ID6 A;  5FPM A;  3D6R A;  3VEO A;  3CC4 N;  3CCR N;  3O9S A;  4KH5 A;  1NLV A;  2P9L B;  3DJC A;  3J7Z O;  2GUP A;  2KHO A;  4HTL A;  5EVZ A;  4H5T A;  4LC9 B;  1BG3 A;  3I33 A;  2VYP A;  3U9Z A;  1NGA A;  2BTF A;  4XJX A;  3AGK A;  3QFP A;  3CCE N;  4BRO A;  3LM9 A;  5H1S Q;  2OTJ N;  3BF1 A;  5CR4 A;  3RVC A;  2I7N A;  1EQY A;  3VGK A;  4CZF A;  3ENH A;  3I56 N;  1VQO N;  1VQM N;  2GEL A;  3WXL A;  3MN7 A;  2E20 A;  3R9P A;  1XQS C;  1ZBS A;  1SQK A;  3ZET A;  5LY3 A;  1RGI A;  3GG4 A;  4Y0W A;  3LL3 A;  4WQ4 C;  4FO0 A;  3HZ6 A;  3C65 A;  3IKM A;  3QFU A;  2OTL N;  2Q1N A;  3EE9 A;  3EN9 A;  1GLD G;  4IEI A;  2HBJ A;  3AGR A;  4FVU A;  2P9U B;  2QWR A;  2YI1 A;  5M1Q A;  3DLL L;  2QWM A;  3F9M A;  4JHD A;  5AQZ A;  3ENB A;  4A5B A;  3TSQ A;  1G99 A;  4QS9 A;  2HOE A;  1TYQ A;  2ZGY A;  3O9U A;  2GEM A;  3O6W A;  4ISG A;  4CD1 A;  2A41 A;  5KPR A;  2QW9 A;  3CJ7 A;  3CJA A;  1D4X A;  3EE8 A;  2HBK A;  4CZH A;  1YHQ N;  3H45 C;  3VEY A;  3CJC A;  2WBN A;  3VTH A;  2CGL A;  1YI2 N;  1YJW N;  2QWL A;  3VF4 A;  1BU6 O;  5AQM A;  1CZA N;  3A0I X;  3TSP A;  5AQY A;  4B1Y B;  4BRI A;  1HKC A;  1Q18 A;  5AZJ A;  1NGH A;  2QA4 N;  1SS6 A;  2E1Z A;  3O1W A;  1HKB A;  2CH5 A;  5AQX A;  3L6Q A;  3U8X A;  1DT9 A;  2P9S B;  2D0O A;  5FPE A;  2UYT A;  3GL1 A;  4RTF D;  2PBD A;  1GLE G;  1NGB A;  4BR4 A;  4A2A A;  4G9Z A;  1XUP O;  4BC4 A;  1JJ2 M;  3VEN A;  1VQ7 N;  3A8Y A;  3VER A;  1NJI O;  3K9K A;  1EO1 A;  5FPN A;  3VET A;  3RSE A;  3C7N A;  4FWR A;  4ISE A;  5AQR A;  3HOT A;  3FZK A;  1KD1 O;  4IOX A;  2D0P A;  2Q0R A;  3K9J A;  3KWG A;  3WUH A;  2IVN A;  2GX9 A;  3ULE A;  1K73 O;  2V7Z A;  1Q82 O;  3GE1 A;  1K8K A;  3BUZ B;  4YOY A;  4K42 A;  2WUS A;  3M3Z A;  2ZF5 O;  2IVO A;  3HOS A;  4CBX A;  3F5T A;  3SBT A;  4U7B A;  4B1X B;  3CCQ N;  3VEZ A;  4H5N A;  3F2K A;  4ILJ A;  4QS7 A;  4C1N I;  1QVG M;  4FOI A;  3CMA N;  2F7T A;  3G4S N;  4B1V A;  1NGI A;  3FZM A;  3IFR A;  3CQY A;  2P9I A;  2QI2 A;  1K9M O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...