2P9SA

Structure of bovine arp2/3 complex co-crystallized with atp/mg2+
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
414
structure length
397
Chain Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-like protein 3
total genus 127
structure length 397
sequence length 414
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 2p9sA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9sA04
2D0PA 1T6DA 1TYQA 4FOEA 2YHWA 1C0FA 1MDUB 5ELZA 2QWQA 3TU5A 5AQJA 1NGGA 1U6ZA 3O80A 3L0QA 3ULEB 3I8BA 3DJCA 1BUPA 2FSNA 2YJFA 2D4WA 4QS8A 5FPEA 4CZEA 1WUAA 1V4SA 2P9KA 3LM2A 3IFRA 3CJBA 3LM9A 5AQXA 3C7NA 3G25A 2ZF5O 4BRQA 3QDKA 1JCGA 5AQYA 3HZ6A 1X3NA 4BG8A 3IMXA 1H1VA 3FZHA 4GNIA 3A5NC 1EQYA 3VF6A 3VF4A 4BC4A 1QZ5A 3FZKA 1DGKN 4BRNA 2HF3A 2Q1NA 2KHOA 1KAXA 3O1BA 2D1KA 3WXKA 2I7PA 1HKCA 3ATUA 4H0YB 1OKJA 4M63C 2VWBA 3HTVA 1BU6O 3WEEA 4WQ5A 1YUWA 4EIAA 2E2PA 4XH1A 1LCUA 2V7ZA 3VGLA 4FWOA 3H45C 1NGAA 4ISFA 1Z6RA 4RCHA 1G99A 3LDPA 3WUHA 3CIPA 5LJVA 4IJAA 1QQMA 1RFQA 2P9NA 1NGIA 1TUUA 3DXKA 1D4XA 1WOQA 2P9LB 3O5BA 4CZFA 3ZX0A 3SK3A 4CZMA 1CZAN 5AZJA 2Q36A 4BVOA 3FLCO 4QS7A 1TYQB 3B8AX 5AQUA 2QWMA 4B1UB 4XH5A 4BRFA 3P4IA 4BVPA 4IO8A 2PBDA 3RSEA 3EZWA 4PL7A 3UE5A 3DXKB 5BRFA 3SJHA 4B1ZA 2IVOA 2W41A 4RWTA 3ZX2A 1S22A 3CETA 2CH6A 4BRDA 4DHYA 1XC3A 4JHDB 1NGEA 4FL9A 5AR0A 5AQWA 5BPNA 5AQMA 2Q0UA 4BR9A 1T6CA 1C0GA 5JICA 5EXWA 5AQVA 1ESVA 2GELA 1U2VA 1MA9B 1GLAG 3D2EA 3CJ7A 3M3ZA 4NB4A 3R6MA 5AQLA 1Y64A 4CD3A 5BN8A 1RDWX 3D2FA 3WXLA 3QFPA 2H3GX 4JHDA 2NRHA 3MDQA 3CERA 4RTFD 4CJ7A 4FWSA 2A41A 1NGDA 2P9SB 3UKRB 5AQGA 4BRPA 1HKGA 2P9IA 3TPQA 4CZIA 3DXMA 4XEIA 2P9UB 4WYBA 3W0LA 3A5LC 2E8AA 4H0OA 4JN4A 4DCHA 3EL2A 4YDUA 4HTLA 3CQYA 1K8KA 2IVNA 3EKSA 2QWPA 4A2AA 3R9PA 3VETA 3BUZB 3I33A 4FWQA 1T44A 2YJEA 4FWRA 1TUYA 1IJJA 3IUCA 4LC9B 3VENA 4NO7A 4BRIA 5AQQA 1QZ6A 2A6AA 3H46O 4CI6A 4A62A 2IIRA 2CGJA 3LDOA 4WQ5C 4B1VA 3QFUA 2QXLA 3M6GA 3UB5A 1ATRA 3FZMA 3VPZA 2P9NB 5EVZA 3FZLA 4MO4A 3A8YA 3LDLA 4CZLA 3ZETB 4B1WB 2FSKA 2Q0RA 4BRHA 1R59O 1HPMA 1NBWA 2QW9A 3R8EA 3VEVA 2GTDA 3MN7A 2HOEA 3EN9A 4O5FA 2Q97A 1E4FT 4K43A 2F9TA 3AAPA 3VEXA 1NM1A 2VYPA 5KPRA 4AM7A 3JS6A 1YAGA 2FSJA 2HMPA 3ENHA 3VOVA 4BR2A 1GLJO 4BQZA 1LOTB 1BOTO 3VESA 2DPNA 5KPTA 3BF3A 4CD1A 4JD2B 4AM6A 2FLOA 2QM1A 4M7YA 4BRLA 2ZWHA 1GLBG 2WUSA 3MMVA 2OANA 2E2QA 4K42A 4MO5A 4PL8A 1DKGD 5E84A 1ZBSA 3HSCA 4H5TA 1YXQA 4ISGA 1HLUA 3CI5A 3CQXA 3GBTA 4O8KA 5BR9A 1MWKA 3RSEB 3U9DA 4CBWA 5ADXH 2GUPA 2NLXA 2HF4A 3ATVA 3U4LA 3DWLA 1NGBA 3D7EO 5JMVA 4BREA 1KXPA 3VGKA 3FR0A 1NGJA 5ADXA 3O1WA 2CGLA 5KQDA 1SAZA 3O6WA 3A5MC 4MLEA 1GLFO 2NZTA 2GWKA 5LY3A 3ULEA 2QWNA 2A3ZA 3KHYA 1RGIA 3MN9A 1QQNA 3GOIA 4FSVA 2QWOA 5AZJB 3MCPA 3ZEUB 1QQOA 1GLDG 3ENOA 4BGAA 1BA1A 4L3QA 3UKRA 2P9SA 2Q2RA 4HWIA 3CJ9A 5F1XA 4CBUA 4F9OA 5AQSA 5FPDA 3GG4A 4WQ4A 3WXJA 3LDNA 4H0VB 3UKUB 5BPMA 3WQTA 3F9MA 4I6MB 5CE3A 3ZEUA 1BO5O 4BR7A 4BRCA 5JLFA 2ZGZA 4CZKA 4JNEA 4Z94A 2ASPA 2P9PA 2FF3B 4BGBA 3AAQA 4FWKA 4J8FA 4BG9A 2YI1A 3BEXA 1SQKA 2GEMA 2F9WA 5AQOA 5AQNA 4CZJA 2AA4A 4XH4A 1S3XA 2IVPA 1HUXA 4CBXA 1DEJA 4EAHD 5I9EB 5AQRA 1HJOA 5F2RA 1BDGA 4FWNA 4IZ9A 3QICA 4BROA 3VEYA 4FWMA 1SZ2A 1XUPO 2CH5A 5AQFA 3WT0A 4C23A 4FWLA 3FGUA 3OHRA 3QMLA 4B1YB 3MN5A 3LDQA 4MLHA 1BWFO 2E20A 3C0BA 4FOIA 5BRDA 4JAXA 2CGKA 3W3DA 4FO0A 5E26A 2E2OA 2P9LA 3UKUA 4CZHA 2V7YA 4GY2B 5AQTA 1KAYA 3IDHA 2YHYA 5AQHA 3EO3A 4DB3A 3EKUA 2ASMA 3GE1A 1ATNA 1BA0A 3U9ZA 4YDUC 1NMDA 3MN6A 4JD2A 4BC3A 2EWSA 5AZIA 2V51B 3FE1A 4K25A 4FWPA 2ZGYA 3H1VX 2I7NA 5EX5A 3BF1A 3GDQA 3ZETA 1V4TA 3H3OB 2A42A 3U8XA 3CJCA 2GWJA 5AQIA 4BR0A 3WXIA 3VGMA 3CJAA 5FPMA 4H0XB 5BPLA 1ZC6A 1HX1A 3L6QA 2UYTA 3A5OC 3MK6A 2FXUA 4IJNA 3D2EB 1E4GT 4B1XB 3D2FB 3M1FA 4IWVA 3SLCA 1JCEA 1JCFA 2P9PB 5AFUA 3HBTA 1ATSA 3SMPA 1XQSC 1X3MA 4BRGA 3J8AA 2QWRA 4FPAA 5AQKA 1BG3A 4BRAA 1NGHA 4E1JA 1IG8A 5AQZA 5BRHA 2A5XA 4WQ4C 3LL3A 2P9UA 1NGFA 2BUPA 1GLLO 4M7XA 3O4WA 2E1ZA 3O8MA 4EHUA 1HKBA 5AQPA 2V52B 4CZGA 2Q31A 4IXCA 3BP8A 3O08A 5AZIB 4B9QA 2QWLA 1QHAA 3KVGA 3ID8A 3GL1A 4K41A 1P8ZA 4BC5A 3JXUA 3VEWA 5JLHA 4PKHA 1KAZA 3H6EA 2FF6A 3HI0A 3S41A 2J4RA 3VERA 2PAVA 4H0PA 2AP1A 3SMSA 3WEEB 2P9KB 4H5NA 2A40A 2BTFA 5EY4A 3FFKB 2YHXA 4H0TB 5BREA 3H1QA 4QS9A 4BC2A 1NGCA 4H03B 3AY9A 4PKGA 4BRMA 1ZXOA 4H5VA 1NLVA 5F0XA 1YVNA 3QBXA 3FZFA 2D0OA 4EFHA 1U2VB 3DAWA 1Q18A 1NWKA 3A0IX 4DQ8A 5KPZA 4A2BA 4Y0WA 4A61A 4I6MA 4H5WA 4EHTA 4PKIA 5AFUH 2E1YA 3VF2A 2YCHA 1X9JA 5BN9A 4BRKA 1MWMA 2E2NA 4BR5A 2P9IB 3AARA 4ISEA 2E88A 3CJ1A 4KBOA 1Z05A 3QB0A 3L4IA 1GLCG 3C7NB 3DXMB 2ITMA 3HM8A 5LJWA 1GLEG 3VEZA 3QBWA 4H5RA 5B8HA 5EOYA 3VEOA 4BR4A 1K8KB 5TKYA 1J6ZA 2ASOA 3CHWA 3ZX3A 4BQLA 2VCPA 5KQ8A 4FPBA 3WQUA 3KZBA 5FPNA 2W40A 3H3NO
chains in the Genus database with same CATH superfamily
1SL1A 1NK4A 2XY7A 4OPHA 1D8YA 3VQAA 2DFHA 3CYGA 1C1BA 4DTPA 4WCEL 3PSFA 4WE1A 3ENBA 5AQJA 3OYHA 3L0QA 3VTIA 3ULEB 3I0RA 2FSNA 1NKBA 1KVBA 4QS8A 4M42A 3THYB 4KH6A 3LM2A 1K9MO 4G1QA 2ETJA 3G25A 1HPZA 2ZF5O 4KHYA 1JCGA 4JK8A 5AQYA 3HZ6A 4JRPA 4BG8A 2ZJRL 4GNIA 3OBYA 3V9UA 1EXQA 3AO5A 3VF6A 1NJZA 1QZ5A 1DGKN 4O5BA 1KQSM 2D1KA 2O8BB 2VG5A 4CK3A 3ATUA 4B3SK 4X65K 3M5RA 1LW0A 3WEEA 3SAHA 4WQ5A 4OVLA 1YUWA 1Q8IA 2E2PA 3VGLA 3H45C 4PQUA 3CC2N 3ASMA 1BGXT 4Z4GA 3WUHA 4N41A 5M1NA 4U67L 1NK9A 4CFAA 2HHIA 3ZSYA 4FW1A 4LF7K 3DXKA 4CZFA 1EX4A 2E4LA 1KD1O 3SK3A 1CZAN 2HBJA 4BVOA 3WNFA 2G8WA 3HOTA 5M1FA 3F2KA 3B8AX 5AQUA 3VQCA 3OYBA 4B1UB 2ZD1A 3P4IA 3SAGA 2DFEA 4DSFA 4IO8A 3EZWA 3IG1A 1VSIA 3UE5A 4CHNA 3NGZA 4YFUA 4DR1K 1VAZA 1OH5A 4RWTA 3CETA 2VGMA 4DHYA 3VQPA 2O4GA 1UA0A 5BPNA 3ZSQA 2O8DA 5AQVA 4DFPA 4EP5A 1TL3A 1GLAG 3KK2A 3TAPA 1MU2A 4CF2A 4CD3A 2G8KA 4BWJA 4FWSA 3PY8A 2A41A 1NGDA 2ZE2A 3UKRB 4LF5K 2AJQA 1Q7YO 2P9IA 4LSNA 1JJ2M 2IGIA 2Z1GA 4DV4K 3W0LA 1RT7A 2F7TA 1S1UA 4H0OA 4JN4A 4DCHA 4YDUA 4W5RA 4IG3A 4DLGA 3T1HK 3LP0A 1T7PA 5JENA 4LF8K 3ZT4A 4AHUA 1D9DA 3O4QA 1TUYA 1IJJA 1IH7A 4C8LA 3LP1A 1ITGA 1L3VA 4LC9B 3AVAA 4FJHA 3CM6A 3S3OA 4GV6A 2A6AA 4EZ9A 3AA4A 4ILGB 4A62A 3LDOA 3V4IA 1IBLK 1ATRA 3VQ9A 3VPZA 3KLGA 3FZLA 4Z4HA 3A8YA 3LDLA 4CZLA 4JYAK 3PIOL 1R59O 1HPMA 3R8EA 3P39A 2GTDA 2NRTA 4JI4K 2BE2A 3MN7A 1WNSA 1E4FT 4C8KA 2Y1IA 2HHSA 5KPRA 1TK0A 4EZ6A 1ZBHA 1YAGA 3ENHA 3L8BA 1LOTB 1RT6A 1BOTO 4JI2K 3VESA 4FLTA 3BF3A 5J2PA 2QM1A 2WFBA 1N8RO 3LP3A 4Z4IA 2ZWHA 2JGUA 2VWKA 2WOMA 3MMVA 2OANA 1YJ9N 3J80O 3SBGA 1VQLN 3HSCA 4H5TA 3V1RA 3CI5A 2YV0X 3ZSXA 3RSEB 4CBWA 2E5LK 3AO4A 3TANA 1EETA 1GOAA 4JKCA 2QXFA 1FKOA 2HNZA 3KLHA 3U4LA 1IKWA 4C8MA 4PUOA 4M3YA 3DWLA 3D7EO 1VSEA 3M8PA 2BGGA 4CEQA 3FR0A 1IKYA 1X9WA 3O1WA 4M41A 3O9UA 1SAZA 4ZTFA 3SCXA 4QCLA 3ULEA 4CIGA 3AA3A 2A3ZA 3MN9A 2OYQA 3G71N 4O4GA 4L8RB 4FJGA 5AZJB 5FRNA 4DG1A 3J81O 4WF9L 1GLDG 4AILC 2DY4A 1Q81O 1VRUA 4HWIA 1HRHA 3VQDA 3CCUN 4O8UA 3TWHA 1CLQA 2YHAA 4H0VB 4CK1A 3F9MA 1Q9XA 3ZLJA 4JKAA 4DU4A 1GOBA 3F9KA 4CZKA 2ASPA 4IOCL 3HK2A 3D45A 4FWKA 4O55A 1S1VA 1QSSA 4JS4A 1SQKA 5AQOA 4W5QA 3TTFA 2AA4A 4XH4A 4KHQA 3K5OA 1JLBA 4KHNA 4CF8A 3V9WA 5F2RA 1BDGA 4FWNA 4ID1A 3CC4N 2O8CA 4RW4A 4F3TA 4BROA 4FWMA 2C1GA 4C23A 3WNEA 4J2AA 4ELTA 3OHRA 3QMLA 1HJRA 4MLHA 2E20A 3C0BA 4FOIA 3ZSOA 4LD0A 1HYVA 4N5SA 3HPOA 2W00A 1BQNA 3TAGA 3LZIA 2V7YA 4A5BA 1KAYA 2YHYA 3EO3A 1WBDA 1RDCA 4CJQA 3AVIA 2ASMA 1BA0A 3MN6A 4JD2A 4BC3A 4J2DA 1RBVA 5AZIA 5J2MA 4K25A 4CEZA 4MFBA 4FWPA 3O3FA 1D9FA 2HVIA 1T03A 1HNWK 4JRQA 3THVA 4CIEA 5D3GA 3M8RA 3RR7A 4B8CA 4KB1A 3C6HA 3CJCA 1S9EA 1BCMA 5AQIA 3WXIA 1U4BA 4CVNE 5JS1A 4CEDA 3C65A 3MK6A 3HVTA 1VSDA 3VMFB 5GIPA 4HVJA 4JI6K 1I94K 4B9TA 3CD6N 4CHPA 2VWJA 4AH9A 3D2FB 1RTJA 4HTUA 1XQSC 2RE2A 3MX5A 4BRGA 4BRAA 1J54A 3QNOA 3U3GA 3SUOA 1Y97A 2HHUA 4QAGA 4WQ4C 2BUPA 4E7IA 3THWB 1GLLO 4K8ZA 1HQUA 2E1ZA 2W6LA 3PUFA 4RW8A 4FLXA 3AVBA 3NVMA 2UXDK 4ILJA 3OTOK 3O3HA 4PY5A 4KHWA 3QIPA 1RBSA 3LZJA 1J9AA 1RT1A 1FK9A 3MWPA 3LANA 2QWLA 1RT3A 3MAQA 1RT5A 2B5JA 3JXUA 1JL1A 5JLHA 4PKHA 1NOYA 3HI0A 4WFNL 3R1XA 4DF8A 4A5AA 1BL3A 4IDHA 4A59A 3FFKB 4H0TB 1W0HA 4JV5K 4F4KA 3CCSN 3T1YK 1X9MA 4OPJA 1QSYA 1U45A 2RPIA 3HSTB 4X64K 1NLVA 4JS5A 4DQRA 3FZFA 4EFHA 4NCAA 1Q18A 1S6QA 3A0IX 5KPZA 4YY3K 4PKIA 3THWA 1J53A 3KLFA 1RDBA 1ZBUA 4KTZA 4BRKA 3T3FA 1YHQN 1O1WA 3QB0A 3SZ2A 1R0AA 3DXMB 4U7BA 4CHOA 4CJPA 3ZT0A 3M8SA 1GLEG 1GOCA 3ALYA 4H5RA 4O44A 2UU9K 4F2RA 1RTHA 4E7KA 4JKEA 1Q86O 5TKYA 1J6ZA 2ASOA 4IG0A 1XWLA 1YF5L 2VCPA 1L3UA 4CJEA 3WQUA 4YOYA 1JLCA 3E9PA 3RRHA 2W40A 1U48A 4IFEA 3LAKA 3L4QA 2BH1A 4DUYK 4YHHK 1OVQA 5CZ1A 5GADP 1ZBLA 2YHWA 5LMUK 1MDUB 3DLRA 5ELZA 2QWQA 1WSGA 4FJLA 1NGGA 3O80A 3LPUA 3C6TA 1W2BM 4JKFA 3I8BA 1NJYA 3AA5X 3K58A 2OZSA 3TAEA 4CZEA 4CERA 4CJ3A 2P9KA 1DTQA 4DTMA 5HOOA 3CJBA 4FW2A 4FVMA 3C7NA 3AVMA 3QDKA 4OGEA 1H1VA 4KB0A 3A5NC 1Z25A 2NRVA 4TSXA 1RTIA 3ZSWA 1A5VA 3KK7A 4BRNA 1BISA 2Q1NA 1KAXA 3NH2A 4FJKA 3P1GA 1VSKA 2WTUA 1YT3A 3AGKA 1OKJA 3MEGA 5HRNA 2XO7A 1LCUA 1RILA 4FWOA 4FJXA 2D0AA 1Z6RA 5C10A 2YNGA 1G99A 4KTWA 3S3NA 4KV8A 5LJVA 4DQPA 1S9GA 4IJAA 1QQMA 1BI4A 3CPWM 3HPGA 1CXQA 1NGIA 1TUUA 1O13A 1D4XA 4JKGB 1RNHA 5GAEP 3PIPL 2Q36A 3OYJA 4QS7A 3SUQA 2X6SA 3KLEA 3RWUA 1N34K 4BVPA 3RSEA 4YOTA 3V9SA 4PA1A 4PL7A 3BGRA 3DXKB 4B1ZA 3RMAA 2O4IA 1S1XA 3QINA 3MEEA 2CH6A 2D0BA 1XC3A 4E3SA 5AR0A 1TV6A 3CMEN 1WN7A 4YOWA 5EXWA 4BACA 1ESVA 2GELA 1VQ5N 4CESA 1U2VA 3OYAA 1VQ7N 4M3XA 4KAZA 5HBMA 4DQIA 3CJ7A 1KFDA 1P90A 3M3ZA 2OA8A 1RDWX 3D2FA 3QFPA 3CMAN 2NRHA 3MECA 3K0SA 4N76A 3CERA 4JI3K 3DLGA 3OJSA 5AQGA 3TPQA 1ZYQA 4XEIA 4YOVA 3P5JA 3A5LC 3K2PA 3EL2A 2VG6A 4E1NA 3CQYA 2IVNA 4A2AA 3VETA 4FJIA 1LWFA 4FWRA 5C25A 3N4QA 4DR7K 4YOXA 4M3TA 1LV5A 4E7JA 3IUCA 3N4PA 3ZT1A 4DQSA 1QZ6A 3SAFA 4M3UA 2CGJA 1JLQA 5T7BA 2G8HA 1Q9YA 2E6LA 3FZMA 4FK4A 3S3MA 1NK8A 1RT2A 4HCBA 4Q5VA 2Q0RA 5KRTA 1NBWA 3HXMA 3VEVA 4C8NA 3U3YA 2HOEA 4K43A 4M3WA 4ZHRA 3VEXA 1NJXA 4R5PA 4IO9L 4NXNK 4X66K 3O9TA 3JS6A 3J7AP 3CFRA 4J2EA 2FSJA 4ELVA 4BR2A 4JEPA 4UY8O 2PZSA 3DLBA 4CJUA 3NCIA 1B9FA 4CD1A 3R3LA 4JD2B 4CJFA 5GAHP 1VQ4N 3DOKA 3KTQA 1GLBG 2WUSA 2XY6A 1SUQA 4N56A 4MO5A 4FLWA 1C0MA 5C24A 4IOXA 4FLYA 3TAMA 3SPZA 3CQXA 1NOZA 4ICLA 5C2FA 2GV9A 2JWLA 5E41A 2QTDA 2WONA 2GUPA 3ATVA 4KO0A 4HCCA 4DTSA 3QEXA 5A2QO 1KXPA 3VGKA 4FM1A 2RKIA 2CGLA 3AVCA 5KQDA 3RTVA 1XC9A 3O6WA 4CHYA 4ZTJA 1JLGA 1BI4B 4LFBK 5LY3A 4E7HA 2UUAK 3KHYA 1HYSA 4FSVA 4IDKA 1NU0A 4MDAA 3RVCA 3DLEA 3MCPA 1JLFA 3ZEUB 2YX6A 1QQOA 3SYZA 4BE7B 1U04A 3J7ZO 4AHVA 2A1SA 4BGAA 1BA1A 1REVA 4L3QA 1VQMN 3UKRA 1NMNA 5F1XA 3CJ9A 2HHXA 4KHPK 5AQSA 1S1TA 2EX3A 5FPDA 1C0TA 1C1CA 4WQ4A 1T05A 3E9LA 3AVKA 2OPPA 3QEWA 3G6EN 2C1IA 2UXCK 4JI8K 1QSLA 4LFAK 4CGDA 4Z94A 2YNFA 3IS9A 1M1KO 4CHZA 1QVGM 4DV6K 1L5UA 4BG9A 2YI1A 3ZSZA 2GEMA 2F9WA 3KWIA 3EE9A 4CZJA 5CZ2A 4JI1K 2IVPA 4DFMA 2OPSA 4CBXA 4NYFA 1DEJA 4H4OA 3KLIA 1DLOA 1VSMA 4DR6K 3L2RA 4IZ9A 3QICA 2G8FA 2YNIA 3VEYA 1SZ2A 5AQFA 3WT0A 3TAQA 4LF6K 1CZBA 4FWLA 3FGUA 1RBRA 4B1YB 3MN5A 4FJJA 3LDQA 2KKZA 3VQ4A 5J2QA 4KHSA 3V1QA 4OO1J 4B08A 5FROA 1TKTA 4FO0A 1LAVA 5E26A 3SV3A 1HNVA 3G4SN 3WNHA 2P9LA 4E7LA 4OPAA 4DS5A 4GY2B 5AQTA 4H4MA 5J1EA 3SI6A 4DB3A 4K0KK 1YJNN 3NVKA 2B6AA 1NMDA 3AVNA 3I56N 2V51B 4PWDA 1HNZK 3O9SA 3BF1A 1V4TA 2A42A 3U8XA 5FRMA 4BR0A 3CJAA 5FPMA 4GVMA 3O4NA 5BPLA 3LP2A 3L6QA 2UYTA 1QQCA 3DOLA 3VA3A 4AHSA 4IJNA 3D2EB 1E4GT 4LF9K 2HHWA 4B1XB 4CF1A 4B3TK 4F8RA 4CGIA 4IWVA 3SLCA 1JCFA 5AFUA 3HBTA 1X3MA 3J8AA 4NLBA 1BG3A 3G10A 1IG8A 5AQZA 2D0CA 3MXMA 3O3GA 4GV3A 4B9VA 1A5WA 4EHUA 1HKBA 2F8SA 5AQPA 3T19A 1U49A 1WB9A 4DSJA 3KVGA 4KFBA 3GL1A 3L2VA 4B3RK 3K9KA 4K41A 4BC5A 3VEWA 1WBBA 3H6EA 3S41A 1XI1A 3LAMA 4H0PA 4Y1DA 3SQ4A 4H5NA 3CFOA 2BTFA 5MLCQ 3HP9A 3DM2A 4Y1CA 4RG8A 1WSJA 5C15A 5BREA 3H1QA 1VHXA 4I2PA 1NGCA 3ZT2A 3V1OA 3NH1A 3H08A 4H5VA 3F5TA 3WNGA 2HW3A 4E0DA 5F0XA 1YVNA 3RMCA 1U2VB 3DAWA 1NWKA 4I6MA 1IKXA 3RMDA 4CW7B 4JI5K 5BN9A 1MWMA 2E2NA 3AARA 3HYFA 3CJ1A 4E1MA 3BY5A 1Z05A 4UQGA 3I8DA 4BECA 1GLCG 4IBNA 2ZJPL 5HRSA 2GUIA 3AVJA 4G9ZA 4MDBA 1RTDA 4FCYA 5LJWA 2LSNA 4JK7A 5CHIA 3OYKA 3EEQA 3BZKA 1X1PA 1JXEA 1YIJN 4I2QA 4BDPA 4KREA 3OYFA 1K8AO 2RF2A 4DR3K 1N6QA 5KQ8A 1ZBIA 3T69A 3KZBA 1B92A 3NAEA 4PHTX 5I3UA 3TSUA 2Q3SA 1VQ6N 5M1PA 4OKJA 3AO2A 4CGGA 4M3RA 3K5LA 4DTJA 1U6ZA 3RRGA 2WBNA 2W6KA 2JLEA 1BUPA 2YJFA 4OLAA 2D4WA 1DT9A 4HUEA 1RT4A 5HRPA 4DSKA 1LWEA 3TAFA 4K8XA 1NK5A 1QVFM 2O8DB 5AQXA 3PO5A 1EP4A 4JLHA 4NXMK 3SPYA 2HVHA 2WC9A 3AO3A 3F73A 4KRFA 4FYDA 1EQYA 3QLHA 4QOZB 4HHTA 1YTUA 3HL8A 3FZKA 2X74A 1RCHA 1WAFA 2HF3A 2KHOA 3O1BA 3D6RA 3QIOA 2HHTA 1KCFA 1HKCA 1VQPN 4LH4A 4H0YB 2VWBA 1BU6O 3B6OA 3PV8A 3CM5A 4O0IA 2V7ZA 5C12A 1ZBFA 3KIOA 2PFUA 1SKWA 1NGAA 1VQON 4RCHA 1WSEA 3P83D 3LDPA 2OPRA 1RFQA 3NF6A 1KRPA 3OS0A 2IS3A 2P9NA 3HO1A 3AV9A 2P9LB 3O5BA 4B9LA 1VSLA 5AZJA 2VQEK 2KFZA 1F21A 2FBXA 4XH5A 3KJVA 1NKCA 3SV4A 3MEDA 4BEBA 1TK5A 4CJVA 4CJSA 3MXJA 4BDYA 3KWGA 3SJHA 2IVOA 2W41A 4BRDA 1NJIO 4FM2A 3AGRA 3HRGA 1L3TA 4JHDB 1NGEA 4FL9A 4A57A 4DS4A 5AQWA 3L2QA 4DUZK 5AQMA 2Q0UA 3VQ6A 4BR9A 3MX2A 3QEVA 1RDDA 3AVGA 4DWIA 1MA9B 2X78A 4GMJB 3D2EA 4CJ4A 4NB4A 1UWBA 1Y64A 2H3GX 3MDQA 1QS4A 4RTFD 4CJ7A 2F4VK 2P9SB 3D0PA 3DLHA 5CYMA 1EKEA 4X62K 2QK9A 4CZIA 2KW4A 4WYBA 2YKNA 2KZMA 4CHQA 4B9MA 2E8AA 1RDAA 4DR2K 4JI7K 4HTLA 1K8KA 3EE8A 2OPQA 3EKSA 2QWPA 5KRSA 2GX9A 3BUZB 4CJ5A 3CG7A 3THXA 1T44A 2YJEA 3UIQA 4OKKA 1HR0K 3DLKA 5H1SQ 5EU7A 1W7AA 3OS2A 4NO7A 4BRIA 1UOCA 5AQQA 3H46O 4CI6A 4B1VA 5DK5A 2QXLA 1BHLA 3M6GA 3NE6A 4CEBA 3V9XA 2P9NB 5EVZA 4N47A 4MO4A 1I39A 2FSKA 2HBLA 2X6NA 4CCHA 2QW9A 1EO1A 1M90O 4DKWA 3CCMN 4F2SA 2F9TA 2HHVA 2VYPA 1S5JA 1FKPA 4DTRA 3CCEN 2OTJN 5AJ3K 3DRPA 2HMPA 3VOVA 1GLJO 3NDKA 4BWMA 4DSEA 5J2NA 5KPTA 5M1KA 2KTQA 2OTLN 4OGCA 3OYDA 4AM6A 4FJMA 2BANA 5C42A 3CPEA 2B4JA 3BZCA 4BRLA 2ZJQL 4JKHA 2E2QA 2G8IA 4K42A 3K57A 4PL8A 1DKGD 5E84A 1ZBSA 1YXQA 4ISGA 3L2WA 1HLUA 2W42A 5BR9A 4O8KA 3V9ZA 3QERA 3CCJN 1XMOK 2UUCK 2QKBA 4OPKA 2VQFK 5JMVA 4CK2A 3DRSA 1JL2A 3VQQA 5FDLA 2UUBK 2XY8A 3IAYA 3SNNA 3J7YP 4MLEA 3RMBA 1GLFO 3DLLL 1QHTA 5SZTA 3SQ0A 4B9NA 2QWNA 1RGIA 1QQNA 3GOIA 2QWOA 3CCVN 4GV9A 5C0YA 3AVLA 3OY9A 4DMNA 4I9QA 2Q2RA 4CBUA 2OZMA 4KKOA 4ELUA 3M8QA 3GG4A 3WXJA 3LDNA 3WQTA 4I6MB 5CE3A 3ZEUA 1BO5O 5GINA 4DV3K 4BR7A 1OVYA 5JLFA 1KFSA 4CIFA 3U6FA 4CECA 4Z4FA 4CGFA 3BEXA 3ZCMA 1SKRA 2YNHA 1S3XA 3WXMB 1JXBA 1TKXA 4DU3A 3KD5E 5I9EB 3AO1A 4AF1A 3T1AA 4CJLA 3E9OA 5KGWA 2NUBA 4DR5K 3MXIA 3V81A 4LY7A 1XUPO 3OS1A 1KVCA 4AHCA 1WSHA 1QTMA 3VA0A 3S9HA 1UA1A 5HRRA 4CJWA 5BRDA 4GKJK 4JAXA 3KK1A 3EYZA 2CGKA 1X9SA 3W3DA 4AHRA 3P31A 4JKGA 3BDPA 4CZHA 1TAUA 3NF9A 3IDHA 1KC8O 5AQHA 3GE1A 1ATNA 3EZ5A 2BDPA 2P51A 1VQ9N 4V19S 1ASUA 2ZGYA 5EX5A 4FZXC 4IFYA 3JAMO 4B8AB 4FVUA 4CEEA 4DFKA 3OYIA 4FK2A 2P1JA 3VGMA 3OW2M 4DLEA 4H0XB 4YNQA 1ZC6A 4JK9A 4E72A 4Z0UA 2FXUA 1IKVA 3T7ZA 3M1FA 1JCEA 3MWTA 4F3OA 4M3ZA 4FPAA 2QWRA 2KLAA 1NGHA 4E1JA 4WFAL 1FW6A 5BRHA 3LL3A 2P9UA 2RN2A 3CXCM 4M7XA 3O4WA 4CGJA 4CEAA 2F96A 1C6VA 3PO4A 4CJRA 3NFAA 3THXB 5AZIB 5SWMA 4B9QA 3C95A 1QHAA 5KGXA 1XHXA 4CGHA 1WLJA 3JYTA 3P38A 2O8BA 3FFIA 3I0SA 1KAZA 2FF6A 3VERA 1U47A 2PAVA 3NF7A 2AP1A 3OYMA 3SMSA 3WEEB 2P9KB 1SKSA 5EY4A 1DTTA 2KZZA 3ZYYX 2YHXA 2KFNA 2PYLA 2FBVA 1HQEA 2Y1JA 3CC7N 4BC2A 4H03B 1Q82O 1TL1A 3AY9A 4DSLA 3O9RA 4PKGA 4OX9K 4BRMA 4LH5A 2RHKA 3KK3A 4DQQA 1BIUA 2D0OA 1RDUA 3ID6A 4DQ8A 4A2BA 1QE1A 4Y0WA 5CR4A 4H5WA 5AFUH 2E1YA 4E89A 1Z26A 3OJUA 1N32K 1HYZA 4DFJA 4H8KA 1VQKN 2DFFA 4KBOA 1IBMK 3L4IA 3C7NB 2ITMA 3HM8A 4DV7K 4B9SA 1FJGK 3IKMA 3VQ7A 1W97L 3OYGA 3SUPA 5B8HA 5GIOA 3VEOA 1SL0A 1W9HA 4BR4A 5JS2A 4DTNA 5IWAK 1K8KB 5M1OA 3SJJA 1VQ8N 5I42A 4OLBA 3CHWA 3ZX3A 4BQLA 2O8FB 1YTAA 1NNEA 4CJTA 2R7YA 5FPNA 4AHTA 2YKMA 2D5RA 2D0PA 3TSQA 1UAXA 1T6DA 2HMIA 1TYQA 4FOEA 4IKFA 2O8EA 1C0FA 1BIZA 5HL7L 3NF8A 4CFBA 3TU5A 4CEOA 3DJCA 3LWMA 2G8UA 4NCBA 2HSTA 3KD1E 5FPEA 1XNRK 1WUAA 4DTOA 3LALA 4NLCA 1V4SA 3SQ1A 3PLAA 3CCRN 2IAJA 3IFRA 2I5JA 3LM9A 1HMVA 4BRQA 1CZ9A 1B9DA 5DM7L 1C0UA 3SQ2A 1X3NA 3IMXA 3FZHA 3OA9A 4IEEA 3CQ8A 3PX6A 2HHQA 4O0JA 3VF4A 2HNDA 4BC4A 4DV5K 4OKEA 2PYJA 1KLMA 2ITGA 4CFCA 4C1NK 4DV1K 3O9QA 1KVAA 3WXKA 2I7PA 4CJKA 4C1NI 1JLAA 4DV0K 4RW7A 4Z4CA 4M63C 3OYEA 2O8CB 1NK0A 3HTVA 3K59A 5LMNK 1IBKK 2P5GA 2XRIA 4EIAA 2XY5A 4LFCK 4XH1A 3IRXA 2UXBK 2DTUA 3ZT3A 3QEIA 1ASVA 4ISFA 1WSFA 3Q7BA 4DSIA 3V6DA 1YJWN 3CIPA 4B9UA 5KI6A 4KI4A 4I9LA 1WOQA 3Q7CA 2GBZA 3ZX0A 3VQ5A 4CZMA 4FLZA 3DI6A 4RW6A 3FLCO 5JVHL 5KTQA 1TYQB 1ILYA 5BR8K 2QWMA 3A2FA 4BRFA 4FK0A 1T8EA 3CCLN 2PBDA 2FBTA 5HLFA 1HNXK 4DR4K 3TI0A 5BRFA 3ZX2A 1S22A 4Z4EA 1G15A 3NHGA 1VSFA 1T6CA 1TK8A 1C0GA 3NBPA 4JKBA 5JICA 1NK6A 3OYLA 2FC0A 3G0ZA 4FJNA 1LWCA 3R6MA 5AQLA 5BN8A 3WXLA 1WAJA 2NRZA 4JHDA 1BCOA 3I55N 3QO9A 4BRPA 1HKGA 1KTQA 3LDSA 3DXMA 1VSHA 4CF9A 3AA2A 2P9UB 4BE1A 3KKRA 1SL2A 1ASWA 4R79A 1FXXA 3R9PA 3I33A 3C94A 4FWQA 2JWKA 4IOAL 3OVNA 1OH6A 1NJWA 1TAQA 4KHUA 5FLXO 1TKDA 2O8FA 1KSPA 4Q0BA 3VENA 2QI2A 4EP4A 4HUFA 2IIRA 3E1YA 4WQ5C 3QFUA 3UB5A 3LPTA 3TSPA 4KTQA 4CEFA 4DTUA 3CF5L 2NNWA 4W5OA 1WSIA 3ZETB 4B1WB 4BRHA 4CE9A 4J2BA 1T3VA 3C6UA 2EHGA 1IG9A 3C6AA 3EN9A 4O5FA 2Q97A 3ZSVA 1J5OA 1N33K 2IOCA 4FJ5A 3AAPA 4BY9C 1NM1A 1IV0A 4AM7A 3HP6A 1IO2A 1BQMA 3HOSA 4FZZA 1S6PA 5LL6Z 4KH5A 4BQZA 1NK7A 2ATQA 5HROA 2DPNA 2NRWA 3SBTA 2FLOA 3CYMA 1N5YA 4M7YA 2G8VA 3TABA 3E66A 3DRRA 3ULDA 1XMQK 1VRTA 1XNQK 2QEXN 1L3SA 4FJ7A 3GBTA 5C2DA 3OYCA 1MWKA 3U9DA 1VK0A 2IDOA 4HUGA 1N36K 5ADXH 4YOUA 2HF4A 2NLXA 1XHZA 4DU1A 1NGBA 1K6YA 4JKDA 4BREA 1NGJA 3NGYA 5HP1A 4NCGA 5ADXA 3TTDA 4M45A 2XHBA 3A5MC 2A1RA 4GVEA 4KI6A 2NZTA 2GWKA 5JVGL 5K14A 3NH0A 4NYNA 3L2UA 2NRRA 5IT9O 1YI2N 3KKSA 3ENOA 4YORA 2HB5A 3THYA 2P9SA 1NG9A 4F9OA 3PSIA 2IC3A 3CCQN 3UKUB 3OBWA 5BPMA 4DV2K 2F8TA 4FJ9A 3CFPA 4BRCA 2P5OA 2ZGZA 4JNEA 2P9PA 2FF3B 3ZSRA 4ILHA 4BGBA 4FLUA 3EY1A 3AAQA 2ZQBA 4LSLA 4WFBL 4J8FA 5AQNA 1EWRA 1HUXA 2VGNA 1C1AA 1LAWA 4GW6A 3QESA 3TTCA 3MCAB 4EAHD 5AQRA 1HJOA 2QA4N 4W5TA 3TR8A 4IEIA 3JSMA 4OJRA 1OH7A 1JLEA 1SS6A 4MQ3A 3VN5A 1YVUA 4AQYK 2CH5A 2OCEA 3NMUA 3VQ8A 3K5NA 4KPYA 3HPHA 3ITHA 5TKWA 1BWFO 1JKHA 1VSJA 1OH8A 3QETA 1A5XA 4KH4A 2E2OA 3UKUA 1YITN 4XJXA 3EKUA 1NKEA 2ZM6K 3U9ZA 4YDUC 4E19A 1SV5A 5DM6L 2EWSA 4GKKK 1EWQA 3FE1A 1E3MA 3H1VX 2I7NA 3GDQA 3ZETA 3H3OB 2Z1JA 3QEPA 1I3AA 3RR8A 2QKKA 2O8EB 2GWJA 1J5EK 4FXDA 1HX1A 3ISNC 3A5OC 3HT3A 3OYNA 2Z1IA 3VQBA 2PY5A 4FJ8A 4DTXA 2P9PB 3DMJA 4BE2A 4FM0A 1ATSA 3SMPA 4FZYA 2HBMA 4XIUA 5AQKA 5CY4A 3VQEA 1S1WA 4B3MK 3E01A 4B3OA 2A5XA 3SUNA 1NGFA 4JI0K 3PX0A 4RW9A 3O8MA 4W5NA 2Z1HA 3K5MA 5M1QA 4CFDA 2KQ2A 2V52B 4CZGA 2YHBA 2Q31A 3AVHA 4IXCA 3AVFA 3BP8A 3O08A 1S72N 4FLVA 3ID8A 4ID5A 1P8ZA 2HNYA 1VQNN 1CXUA 2J4RA 1HNIA 2FBYA 1TVRA 3HJFA 3HVRA 5CYQA 2A40A 4DF4A 4IFVA 3B6PA 3HM9A 1LW2A 4QS9A 3L3UA 5GAGP 1RBUA 1ZXOA 1K73O 3QBXA 4BDZA 2HHHK 1D5AA 3K9JA 4A61A 4EHTA 2E6MA 4C8OA 3VF2A 2YCHA 3NGIA 1KLNA 3VTHA 1X9JA 4BR5A 2P9IB 4ISEA 2E88A 2NRXA 1TGOA 4LF4K 3DYAA 3S5TA 4CF0A 3TARA 1TKZA 3VEZA 3QBWA 5DMRA 4I7FA 5EOYA 3QNNA 3L3VA 2VG7A 1RBTA 4FPBA 3LWLA 3PX4A 2HBKA 4BE0A 3H3NO
chains in the Genus database with same CATH topology
4PHTX 2D0PA 3L4QA 2BH1A 3TSUA 3TSQA 4OPHA 1T6DA 1VQ6N 5M1PA 1TYQA 4FOEA 5GADP 2YHWA 1C0FA 4WCEL 5HL7L 1MDUB 5ELZA 2QWQA 3TU5A 3ENBA 5AQJA 1NGGA 1U6ZA 3O80A 3L0QA 3VTIA 3ULEB 2WBNA 1W2BM 4JKFA 3I8BA 3DJCA 1BUPA 2FSNA 2YJFA 2HSTA 2D4WA 4QS8A 1DT9A 5FPEA 4CZEA 1WUAA 4NLCA 1V4SA 4KH6A 2P9KA 3LM2A 3PLAA 5HOOA 1QVFM 3CCRN 1K9MO 3IFRA 3CJBA 3LM9A 5AQXA 3C7NA 3G25A 2ZF5O 4BRQA 3QDKA 5FPNA 1JCGA 4JK8A 5DM7L 5AQYA 3HZ6A 1X3NA 2WC9A 4BG8A 2ZJRL 3IMXA 1H1VA 3FZHA 3OA9A 3A5NC 4GNIA 2NRVA 1EQYA 3OBYA 4IEEA 3VF6A 3VF4A 4BC4A 1QZ5A 3FZKA 3KK7A 1DGKN 4BRNA 1KQSM 2HF3A 2Q1NA 2KHOA 1KAXA 3O1BA 3D6RA 4C1NK 3O9QA 2D1KA 3WXKA 2I7PA 1HKCA 3AGKA 4C1NI 1VQPN 3ATUA 4H0YB 1OKJA 3M5RA 4M63C 2VWBA 3HTVA 1BU6O 3WEEA 3SAHA 4WQ5A 1YUWA 4EIAA 2E2PA 4XH1A 1LCUA 2V7ZA 3VGLA 5C12A 4FWOA 3H45C 2PFUA 1NGAA 4ISFA 1Z6RA 5C10A 1VQON 3CC2N 4RCHA 1G99A 3Q7BA 3LDPA 3WUHA 3CIPA 5M1NA 1YJWN 4U67L 5LJVA 4IJAA 1QQMA 1RFQA 3CPWM 2P9NA 1NGIA 1TUUA 1O13A 3DXKA 1D4XA 1WOQA 2P9LB 3O5BA 3Q7CA 4JKGB 4CZFA 5GAEP 3ZX0A 3SK3A 4CZMA 1KD1O 1CZAN 2HBJA 2Q36A 5AZJA 3PIPL 4BVOA 3FLCO 4QS7A 5JVHL 1TYQB 5M1FA 3F2KA 3B8AX 5AQUA 3HOTA 1ILYA 2QWMA 4B1UB 4XH5A 4BRFA 3P4IA 3SAGA 4BVPA 3CCLN 4IO8A 2PBDA 3RSEA 3EZWA 4YOTA 4BEBA 4PL7A 3UE5A 3DXKB 3KWGA 5BRFA 3SJHA 4B1ZA 2IVOA 1VAZA 2W41A 4RWTA 3ZX2A 1S22A 3CETA 2CH6A 4BRDA 1NJIO 2VGMA 3AGRA 1XC3A 3HRGA 4DHYA 4JHDB 1NGEA 4FL9A 4A57A 5AR0A 5AQWA 5BPNA 5AQMA 3CMEN 2Q0UA 4BR9A 1T6CA 1C0GA 3MX2A 4JKBA 5JICA 4YOWA 5EXWA 5AQVA 1ESVA 2GELA 1VQ5N 1VQ7N 1U2VA 1MA9B 1GLAG 3D2EA 3CJ7A 1P90A 3M3ZA 4NB4A 3R6MA 5AQLA 1Y64A 4CD3A 5BN8A 1RDWX 3D2FA 3WXLA 3QFPA 2NRZA 2H3GX 4JHDA 2NRHA 3CMAN 3MDQA 3I55N 3CERA 4RTFD 4CJ7A 4FWSA 2A41A 1NGDA 2P9SB 3UKRB 5AQGA 4BRPA 1HKGA 1Q7YO 2P9IA 3TPQA 4CZIA 3DXMA 1JJ2M 4XEIA 2P9UB 4WYBA 3W0LA 4YOVA 2F7TA 3A5LC 2E8AA 4H0OA 4JN4A 4DCHA 3EL2A 4YDUA 4HTLA 4R79A 3CQYA 1K8KA 3EE8A 2IVNA 3EKSA 2QWPA 4A2AA 2GX9A 3R9PA 3VETA 3BUZB 3I33A 4FWQA 1T44A 2YJEA 2JWKA 4IOAL 4FWRA 1TUYA 3N4QA 1IJJA 4YOXA 5H1SQ 3IUCA 3N4PA 4LC9B 3VENA 4NO7A 4BRIA 2QI2A 5AQQA 1QZ6A 2A6AA 4GV6A 3SAFA 3H46O 4CI6A 4A62A 2IIRA 4ILGB 2CGJA 3E1YA 3LDOA 4WQ5C 3QFUA 4B1VA 2QXLA 3M6GA 3UB5A 3TSPA 1ATRA 3FZMA 3VPZA 2P9NB 5EVZA 3CF5L 2NNWA 3FZLA 4MO4A 3A8YA 3LDLA 4CZLA 3ZETB 4B1WB 3PIOL 2FSKA 2Q0RA 2HBLA 4BRHA 1T3VA 1R59O 1HPMA 1NBWA 2QW9A 3R8EA 1M90O 1EO1A 3P39A 3VEVA 2GTDA 3C6AA 2NRTA 3MN7A 4DKWA 2HOEA 3EN9A 4O5FA 2Q97A 3CCMN 1E4FT 4K43A 2F9TA 3AAPA 3VEXA 1NM1A 2VYPA 5KPRA 4IO9L 4BY9C 4AM7A 2OTJN 3CCEN 3O9TA 3JS6A 1YAGA 2FSJA 2HMPA 3HOSA 3ENHA 3VOVA 4BR2A 4KH5A 1GLJO 4JEPA 4UY8O 4BQZA 1LOTB 1BOTO 3VESA 2DPNA 2NRWA 5KPTA 5M1KA 3BF3A 4CD1A 3SBTA 3R3LA 4JD2B 4AM6A 2FLOA 2OTLN 5GAHP 2QM1A 3CPEA 2WFBA 4M7YA 1N8RO 1VQ4N 4BRLA 2ZWHA 1GLBG 2WUSA 3MMVA 3E66A 2ZJQL 2OANA 4JKHA 2E2QA 1YJ9N 4K42A 4MO5A 4PL8A 1DKGD 3SBGA 5E84A 1ZBSA 1VQLN 3HSCA 4H5TA 1YXQA 4IOXA 2QEXN 4ISGA 1HLUA 3CI5A 3CQXA 3GBTA 4O8KA 5BR9A 5C2DA 1MWKA 5C2FA 3RSEB 3U9DA 4CBWA 2JWLA 3CCJN 4JKCA 2QTDA 5ADXH 2GUPA 2NLXA 2HF4A 4YOUA 3ATVA 3U4LA 3DWLA 1NGBA 3D7EO 4JKDA 5JMVA 4BREA 1KXPA 3VGKA 3FR0A 1NGJA 5ADXA 3O1WA 3TTDA 2CGLA 5KQDA 3O9UA 1SAZA 3O6WA 3A5MC 4MLEA 1GLFO 4GVEA 2NZTA 2GWKA 5LY3A 3ULEA 3DLLL 5JVGL 2QWNA 2A3ZA 3KHYA 1RGIA 3MN9A 1QQNA 3G71N 3GOIA 4FSVA 2NRRA 4MDAA 3RVCA 1YI2N 2QWOA 5AZJB 3MCPA 3CCVN 3ZEUB 2YX6A 1QQOA 4GV9A 5C0YA 4BE7B 4WF9L 1GLDG 3J7ZO 3ENOA 4YORA 1Q81O 4BGAA 1BA1A 1VQMN 4L3QA 3UKRA 2P9SA 2Q2RA 4HWIA 3CJ9A 5F1XA 4CBUA 4F9OA 5AQSA 5FPDA 3CCUN 4O8UA 3GG4A 3CCQN 4WQ4A 3WXJA 3LDNA 4H0VB 3UKUB 3OBWA 5BPMA 3WQTA 3F9MA 4I6MB 3E9LA 5CE3A 3ZEUA 1BO5O 5GINA 4BR7A 1OVYA 3G6EN 2C1IA 4JKAA 4BRCA 5JLFA 2ZGZA 4CZKA 4JNEA 4IOCL 4Z94A 2ASPA 2P9PA 2FF3B 4ILHA 4BGBA 1M1KO 3AAQA 4FWKA 1QVGM 4WFBL 4J8FA 4BG9A 2YI1A 3BEXA 1SQKA 2GEMA 2F9WA 3KWIA 3EE9A 5AQOA 5AQNA 2AA4A 3TTFA 4CZJA 4XH4A 1S3XA 2IVPA 1HUXA 2VGNA 3WXMB 4CBXA 1DEJA 3TTCA 3MCAB 4EAHD 5I9EB 5AQRA 1HJOA 4AF1A 2QA4N 4IEIA 1BDGA 4FWNA 5F2RA 3CC4N 4IZ9A 3E9OA 3QICA 1SS6A 4BROA 3VEYA 4FWMA 1SZ2A 2C1GA 1XUPO 2CH5A 5AQFA 3WT0A 4C23A 4FWLA 3NMUA 3FGUA 3OHRA 3QMLA 4B1YB 3MN5A 3LDQA 2KKZA 4MLHA 5TKWA 1BWFO 2E20A 3C0BA 4FOIA 5BRDA 4OO1J 4JAXA 2CGKA 2W00A 3W3DA 4FO0A 3P31A 5E26A 4KH4A 3G4SN 2E2OA 2P9LA 4JKGA 3UKUA 4CZHA 1YITN 4OPAA 2V7YA 4GY2B 5AQTA 4A5BA 1KAYA 3IDHA 1KC8O 4XJXA 2YHYA 5AQHA 3EO3A 4DB3A 3EKUA 1YJNN 2ASMA 3GE1A 1ATNA 1BA0A 3U9ZA 3NVKA 4YDUC 1NMDA 3MN6A 4JD2A 4BC3A 5DM6L 2EWSA 5AZIA 3I56N 2V51B 3FE1A 4K25A 1VQ9N 4FWPA 2ZGYA 3H1VX 2I7NA 3O9SA 5EX5A 3BF1A 3GDQA 3ZETA 1V4TA 3H3OB 4FVUA 2A42A 3C6HA 3U8XA 3CJCA 2GWJA 5AQIA 4BR0A 3WXIA 3VGMA 3CJAA 5FPMA 3OW2M 4H0XB 5BPLA 1ZC6A 1HX1A 4JK9A 3C65A 2UYTA 3L6QA 3A5OC 3MK6A 3VMFB 5GIPA 3CD6N 2FXUA 4IJNA 3D2EB 1E4GT 4B1XB 3D2FB 3T7ZA 3M1FA 4IWVA 3SLCA 1JCEA 1JCFA 2P9PB 3MWTA 5AFUA 3HBTA 1ATSA 3SMPA 1XQSC 2RE2A 1X3MA 3MX5A 4BRGA 3J8AA 2HBMA 2QWRA 4FPAA 4NLBA 2KLAA 5AQKA 1BG3A 4BRAA 1NGHA 4E1JA 4WFAL 1IG8A 5AQZA 5BRHA 2A5XA 4WQ4C 3LL3A 2P9UA 1NGFA 2BUPA 3CXCM 1GLLO 4GV3A 4M7XA 3O4WA 2E1ZA 3O8MA 4EHUA 1HKBA 3NVMA 4ILJA 5M1QA 5AQPA 2V52B 4CZGA 2Q31A 4IXCA 3BP8A 3O08A 3MWPA 5AZIB 1S72N 4B9QA 2QWLA 1QHAA 3KVGA 3ID8A 3GL1A 3K9KA 4K41A 1P8ZA 3P38A 4BC5A 3JXUA 3VEWA 5JLHA 4PKHA 1KAZA 2FF6A 3H6EA 1VQNN 3HI0A 3S41A 4WFNL 2J4RA 3VERA 2PAVA 4H0PA 2AP1A 3R1XA 3SMSA 3WEEB 2P9KB 4H5NA 2A40A 2BTFA 5EY4A 4IDHA 4A59A 4A5AA 5MLCQ 3ZYYX 3FFKB 2YHXA 4H0TB 5C15A 5BREA 3H1QA 4QS9A 3CCSN 3CC7N 4BC2A 1NGCA 4H03B 1Q82O 3AY9A 3O9RA 5GAGP 4PKGA 4BRMA 1ZXOA 4H5VA 3F5TA 2RHKA 1NLVA 5F0XA 1K73O 1YVNA 3QBXA 3FZFA 2D0OA 4EFHA 1RDUA 1U2VB 3ID6A 3DAWA 1Q18A 1NWKA 3A0IX 4DQ8A 5KPZA 4A2BA 3K9JA 4Y0WA 5CR4A 4I6MA 4H5WA 4A61A 4EHTA 4PKIA 5AFUH 2E1YA 3VF2A 2YCHA 3VTHA 1X9JA 5BN9A 4BRKA 1VQKN 1MWMA 2E2NA 4BR5A 2P9IB 3AARA 4ISEA 2E88A 3CJ1A 4KBOA 4BECA 1Z05A 3QB0A 3L4IA 1YHQN 1GLCG 2NRXA 3C7NB 3DXMB 4U7BA 2ZJPL 2ITMA 3HM8A 4G9ZA 4MDBA 5LJWA 4JK7A 5CHIA 1GLEG 3IKMA 3VEZA 3QBWA 4H5RA 1W97L 5B8HA 5EOYA 3VEOA 5GIOA 4BR4A 4JKEA 1Q86O 1K8KB 5M1OA 5TKYA 1YIJN 1J6ZA 1K8AO 2ASOA 1VQ8N 3CHWA 3ZX3A 1YF5L 4BQLA 2VCPA 5KQ8A 4FPBA 3T69A 3WQUA 2HBKA 4YOYA 3KZBA 3E9PA 2W40A 4IFEA 3H3NO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0P A;  1T6D A;  1TYQ A;  4FOE A;  2YHW A;  1C0F A;  1MDU B;  5ELZ A;  2QWQ A;  3TU5 A;  5AQJ A;  1NGG A;  1U6Z A;  3O80 A;  3L0Q A;  3ULE B;  3I8B A;  3DJC A;  1BUP A;  2FSN A;  2YJF A;  2D4W A;  4QS8 A;  5FPE A;  4CZE A;  1WUA A;  1V4S A;  2P9K A;  3LM2 A;  3IFR A;  3CJB A;  3LM9 A;  5AQX A;  3C7N A;  3G25 A;  2ZF5 O;  4BRQ A;  3QDK A;  1JCG A;  5AQY A;  3HZ6 A;  1X3N A;  4BG8 A;  3IMX A;  1H1V A;  3FZH A;  4GNI A;  3A5N C;  1EQY A;  3VF6 A;  3VF4 A;  4BC4 A;  1QZ5 A;  3FZK A;  1DGK N;  4BRN A;  2HF3 A;  2Q1N A;  2KHO A;  1KAX A;  3O1B A;  2D1K A;  3WXK A;  2I7P A;  1HKC A;  3ATU A;  4H0Y B;  1OKJ A;  4M63 C;  2VWB A;  3HTV A;  1BU6 O;  3WEE A;  4WQ5 A;  1YUW A;  4EIA A;  2E2P A;  4XH1 A;  1LCU A;  2V7Z A;  3VGL A;  4FWO A;  3H45 C;  1NGA A;  4ISF A;  1Z6R A;  4RCH A;  1G99 A;  3LDP A;  3WUH A;  3CIP A;  5LJV A;  4IJA A;  1QQM A;  1RFQ A;  2P9N A;  1NGI A;  1TUU A;  3DXK A;  1D4X A;  1WOQ A;  2P9L B;  3O5B A;  4CZF A;  3ZX0 A;  3SK3 A;  4CZM A;  1CZA N;  5AZJ A;  2Q36 A;  4BVO A;  3FLC O;  4QS7 A;  1TYQ B;  3B8A X;  5AQU A;  2QWM A;  4B1U B;  4XH5 A;  4BRF A;  3P4I A;  4BVP A;  4IO8 A;  2PBD A;  3RSE A;  3EZW A;  4PL7 A;  3UE5 A;  3DXK B;  5BRF A;  3SJH A;  4B1Z A;  2IVO A;  2W41 A;  4RWT A;  3ZX2 A;  1S22 A;  3CET A;  2CH6 A;  4BRD A;  4DHY A;  1XC3 A;  4JHD B;  1NGE A;  4FL9 A;  5AR0 A;  5AQW A;  5BPN A;  5AQM A;  2Q0U A;  4BR9 A;  1T6C A;  1C0G A;  5JIC A;  5EXW A;  5AQV A;  1ESV A;  2GEL A;  1U2V A;  1MA9 B;  1GLA G;  3D2E A;  3CJ7 A;  3M3Z A;  4NB4 A;  3R6M A;  5AQL A;  1Y64 A;  4CD3 A;  5BN8 A;  1RDW X;  3D2F A;  3WXL A;  3QFP A;  2H3G X;  4JHD A;  2NRH A;  3MDQ A;  3CER A;  4RTF D;  4CJ7 A;  4FWS A;  2A41 A;  1NGD A;  2P9S B;  3UKR B;  5AQG A;  4BRP A;  1HKG A;  2P9I A;  3TPQ A;  4CZI A;  3DXM A;  4XEI A;  2P9U B;  4WYB A;  3W0L A;  3A5L C;  2E8A A;  4H0O A;  4JN4 A;  4DCH A;  3EL2 A;  4YDU A;  4HTL A;  3CQY A;  1K8K A;  2IVN A;  3EKS A;  2QWP A;  4A2A A;  3R9P A;  3VET A;  3BUZ B;  3I33 A;  4FWQ A;  1T44 A;  2YJE A;  4FWR A;  1TUY A;  1IJJ A;  3IUC A;  4LC9 B;  3VEN A;  4NO7 A;  4BRI A;  5AQQ A;  1QZ6 A;  2A6A A;  3H46 O;  4CI6 A;  4A62 A;  2IIR A;  2CGJ A;  3LDO A;  4WQ5 C;  4B1V A;  3QFU A;  2QXL A;  3M6G A;  3UB5 A;  1ATR A;  3FZM A;  3VPZ A;  2P9N B;  5EVZ A;  3FZL A;  4MO4 A;  3A8Y A;  3LDL A;  4CZL A;  3ZET B;  4B1W B;  2FSK A;  2Q0R A;  4BRH A;  1R59 O;  1HPM A;  1NBW A;  2QW9 A;  3R8E A;  3VEV A;  2GTD A;  3MN7 A;  2HOE A;  3EN9 A;  4O5F A;  2Q97 A;  1E4F T;  4K43 A;  2F9T A;  3AAP A;  3VEX A;  1NM1 A;  2VYP A;  5KPR A;  4AM7 A;  3JS6 A;  1YAG A;  2FSJ A;  2HMP A;  3ENH A;  3VOV A;  4BR2 A;  1GLJ O;  4BQZ A;  1LOT B;  1BOT O;  3VES A;  2DPN A;  5KPT A;  3BF3 A;  4CD1 A;  4JD2 B;  4AM6 A;  2FLO A;  2QM1 A;  4M7Y A;  4BRL A;  2ZWH A;  1GLB G;  2WUS A;  3MMV A;  2OAN A;  2E2Q A;  4K42 A;  4MO5 A;  4PL8 A;  1DKG D;  5E84 A;  1ZBS A;  3HSC A;  4H5T A;  1YXQ A;  4ISG A;  1HLU A;  3CI5 A;  3CQX A;  3GBT A;  4O8K A;  5BR9 A;  1MWK A;  3RSE B;  3U9D A;  4CBW A;  5ADX H;  2GUP A;  2NLX A;  2HF4 A;  3ATV A;  3U4L A;  3DWL A;  1NGB A;  3D7E O;  5JMV A;  4BRE A;  1KXP A;  3VGK A;  3FR0 A;  1NGJ A;  5ADX A;  3O1W A;  2CGL A;  5KQD A;  1SAZ A;  3O6W A;  3A5M C;  4MLE A;  1GLF O;  2NZT A;  2GWK A;  5LY3 A;  3ULE A;  2QWN A;  2A3Z A;  3KHY A;  1RGI A;  3MN9 A;  1QQN A;  3GOI A;  4FSV A;  2QWO A;  5AZJ B;  3MCP A;  3ZEU B;  1QQO A;  1GLD G;  3ENO A;  4BGA A;  1BA1 A;  4L3Q A;  3UKR A;  2P9S A;  2Q2R A;  4HWI A;  3CJ9 A;  5F1X A;  4CBU A;  4F9O A;  5AQS A;  5FPD A;  3GG4 A;  4WQ4 A;  3WXJ A;  3LDN A;  4H0V B;  3UKU B;  5BPM A;  3WQT A;  3F9M A;  4I6M B;  5CE3 A;  3ZEU A;  1BO5 O;  4BR7 A;  4BRC A;  5JLF A;  2ZGZ A;  4CZK A;  4JNE A;  4Z94 A;  2ASP A;  2P9P A;  2FF3 B;  4BGB A;  3AAQ A;  4FWK A;  4J8F A;  4BG9 A;  2YI1 A;  3BEX A;  1SQK A;  2GEM A;  2F9W A;  5AQO A;  5AQN A;  4CZJ A;  2AA4 A;  4XH4 A;  1S3X A;  2IVP A;  1HUX A;  4CBX A;  1DEJ A;  4EAH D;  5I9E B;  5AQR A;  1HJO A;  5F2R A;  1BDG A;  4FWN A;  4IZ9 A;  3QIC A;  4BRO A;  3VEY A;  4FWM A;  1SZ2 A;  1XUP O;  2CH5 A;  5AQF A;  3WT0 A;  4C23 A;  4FWL A;  3FGU A;  3OHR A;  3QML A;  4B1Y B;  3MN5 A;  3LDQ A;  4MLH A;  1BWF O;  2E20 A;  3C0B A;  4FOI A;  5BRD A;  4JAX A;  2CGK A;  3W3D A;  4FO0 A;  5E26 A;  2E2O A;  2P9L A;  3UKU A;  4CZH A;  2V7Y A;  4GY2 B;  5AQT A;  1KAY A;  3IDH A;  2YHY A;  5AQH A;  3EO3 A;  4DB3 A;  3EKU A;  2ASM A;  3GE1 A;  1ATN A;  1BA0 A;  3U9Z A;  4YDU C;  1NMD A;  3MN6 A;  4JD2 A;  4BC3 A;  2EWS A;  5AZI A;  2V51 B;  3FE1 A;  4K25 A;  4FWP A;  2ZGY A;  3H1V X;  2I7N A;  5EX5 A;  3BF1 A;  3GDQ A;  3ZET A;  1V4T A;  3H3O B;  2A42 A;  3U8X A;  3CJC A;  2GWJ A;  5AQI A;  4BR0 A;  3WXI A;  3VGM A;  3CJA A;  5FPM A;  4H0X B;  5BPL A;  1ZC6 A;  1HX1 A;  3L6Q A;  2UYT A;  3A5O C;  3MK6 A;  2FXU A;  4IJN A;  3D2E B;  1E4G T;  4B1X B;  3D2F B;  3M1F A;  4IWV A;  3SLC A;  1JCE A;  1JCF A;  2P9P B;  5AFU A;  3HBT A;  1ATS A;  3SMP A;  1XQS C;  1X3M A;  4BRG A;  3J8A A;  2QWR A;  4FPA A;  5AQK A;  1BG3 A;  4BRA A;  1NGH A;  4E1J A;  1IG8 A;  5AQZ A;  5BRH A;  2A5X A;  4WQ4 C;  3LL3 A;  2P9U A;  1NGF A;  2BUP A;  1GLL O;  4M7X A;  3O4W A;  2E1Z A;  3O8M A;  4EHU A;  1HKB A;  5AQP A;  2V52 B;  4CZG A;  2Q31 A;  4IXC A;  3BP8 A;  3O08 A;  5AZI B;  4B9Q A;  2QWL A;  1QHA A;  3KVG A;  3ID8 A;  3GL1 A;  4K41 A;  1P8Z A;  4BC5 A;  3JXU A;  3VEW A;  5JLH A;  4PKH A;  1KAZ A;  3H6E A;  2FF6 A;  3HI0 A;  3S41 A;  2J4R A;  3VER A;  2PAV A;  4H0P A;  2AP1 A;  3SMS A;  3WEE B;  2P9K B;  4H5N A;  2A40 A;  2BTF A;  5EY4 A;  3FFK B;  2YHX A;  4H0T B;  5BRE A;  3H1Q A;  4QS9 A;  4BC2 A;  1NGC A;  4H03 B;  3AY9 A;  4PKG A;  4BRM A;  1ZXO A;  4H5V A;  1NLV A;  5F0X A;  1YVN A;  3QBX A;  3FZF A;  2D0O A;  4EFH A;  1U2V B;  3DAW A;  1Q18 A;  1NWK A;  3A0I X;  4DQ8 A;  5KPZ A;  4A2B A;  4Y0W A;  4A61 A;  4I6M A;  4H5W A;  4EHT A;  4PKI A;  5AFU H;  2E1Y A;  3VF2 A;  2YCH A;  1X9J A;  5BN9 A;  4BRK A;  1MWM A;  2E2N A;  4BR5 A;  2P9I B;  3AAR A;  4ISE A;  2E88 A;  3CJ1 A;  4KBO A;  1Z05 A;  3QB0 A;  3L4I A;  1GLC G;  3C7N B;  3DXM B;  2ITM A;  3HM8 A;  5LJW A;  1GLE G;  3VEZ A;  3QBW A;  4H5R A;  5B8H A;  5EOY A;  3VEO A;  4BR4 A;  1K8K B;  5TKY A;  1J6Z A;  2ASO A;  3CHW A;  3ZX3 A;  4BQL A;  2VCP A;  5KQ8 A;  4FPB A;  3WQU A;  3KZB A;  5FPN A;  2W40 A;  3H3N O; 
#chains in the Genus database with same CATH topology
 1SL1 A;  1NK4 A;  2XY7 A;  4OPH A;  1D8Y A;  3VQA A;  2DFH A;  3CYG A;  1C1B A;  4DTP A;  4WCE L;  3PSF A;  4WE1 A;  3ENB A;  5AQJ A;  3OYH A;  3L0Q A;  3VTI A;  3ULE B;  3I0R A;  2FSN A;  1NKB A;  1KVB A;  4QS8 A;  4M42 A;  3THY B;  4KH6 A;  3LM2 A;  1K9M O;  4G1Q A;  2ETJ A;  3G25 A;  1HPZ A;  2ZF5 O;  4KHY A;  1JCG A;  4JK8 A;  5AQY A;  3HZ6 A;  4JRP A;  4BG8 A;  2ZJR L;  4GNI A;  3OBY A;  3V9U A;  1EXQ A;  3AO5 A;  3VF6 A;  1NJZ A;  1QZ5 A;  1DGK N;  4O5B A;  1KQS M;  2D1K A;  2O8B B;  2VG5 A;  4CK3 A;  3ATU A;  4B3S K;  4X65 K;  3M5R A;  1LW0 A;  3WEE A;  3SAH A;  4WQ5 A;  4OVL A;  1YUW A;  1Q8I A;  2E2P A;  3VGL A;  3H45 C;  4PQU A;  3CC2 N;  3ASM A;  1BGX T;  4Z4G A;  3WUH A;  4N41 A;  5M1N A;  4U67 L;  1NK9 A;  4CFA A;  2HHI A;  3ZSY A;  4FW1 A;  4LF7 K;  3DXK A;  4CZF A;  1EX4 A;  2E4L A;  1KD1 O;  3SK3 A;  1CZA N;  2HBJ A;  4BVO A;  3WNF A;  2G8W A;  3HOT A;  5M1F A;  3F2K A;  3B8A X;  5AQU A;  3VQC A;  3OYB A;  4B1U B;  2ZD1 A;  3P4I A;  3SAG A;  2DFE A;  4DSF A;  4IO8 A;  3EZW A;  3IG1 A;  1VSI A;  3UE5 A;  4CHN A;  3NGZ A;  4YFU A;  4DR1 K;  1VAZ A;  1OH5 A;  4RWT A;  3CET A;  2VGM A;  4DHY A;  3VQP A;  2O4G A;  1UA0 A;  5BPN A;  3ZSQ A;  2O8D A;  5AQV A;  4DFP A;  4EP5 A;  1TL3 A;  1GLA G;  3KK2 A;  3TAP A;  1MU2 A;  4CF2 A;  4CD3 A;  2G8K A;  4BWJ A;  4FWS A;  3PY8 A;  2A41 A;  1NGD A;  2ZE2 A;  3UKR B;  4LF5 K;  2AJQ A;  1Q7Y O;  2P9I A;  4LSN A;  1JJ2 M;  2IGI A;  2Z1G A;  4DV4 K;  3W0L A;  1RT7 A;  2F7T A;  1S1U A;  4H0O A;  4JN4 A;  4DCH A;  4YDU A;  4W5R A;  4IG3 A;  4DLG A;  3T1H K;  3LP0 A;  1T7P A;  5JEN A;  4LF8 K;  3ZT4 A;  4AHU A;  1D9D A;  3O4Q A;  1TUY A;  1IJJ A;  1IH7 A;  4C8L A;  3LP1 A;  1ITG A;  1L3V A;  4LC9 B;  3AVA A;  4FJH A;  3CM6 A;  3S3O A;  4GV6 A;  2A6A A;  4EZ9 A;  3AA4 A;  4ILG B;  4A62 A;  3LDO A;  3V4I A;  1IBL K;  1ATR A;  3VQ9 A;  3VPZ A;  3KLG A;  3FZL A;  4Z4H A;  3A8Y A;  3LDL A;  4CZL A;  4JYA K;  3PIO L;  1R59 O;  1HPM A;  3R8E A;  3P39 A;  2GTD A;  2NRT A;  4JI4 K;  2BE2 A;  3MN7 A;  1WNS A;  1E4F T;  4C8K A;  2Y1I A;  2HHS A;  5KPR A;  1TK0 A;  4EZ6 A;  1ZBH A;  1YAG A;  3ENH A;  3L8B A;  1LOT B;  1RT6 A;  1BOT O;  4JI2 K;  3VES A;  4FLT A;  3BF3 A;  5J2P A;  2QM1 A;  2WFB A;  1N8R O;  3LP3 A;  4Z4I A;  2ZWH A;  2JGU A;  2VWK A;  2WOM A;  3MMV A;  2OAN A;  1YJ9 N;  3J80 O;  3SBG A;  1VQL N;  3HSC A;  4H5T A;  3V1R A;  3CI5 A;  2YV0 X;  3ZSX A;  3RSE B;  4CBW A;  2E5L K;  3AO4 A;  3TAN A;  1EET A;  1GOA A;  4JKC A;  2QXF A;  1FKO A;  2HNZ A;  3KLH A;  3U4L A;  1IKW A;  4C8M A;  4PUO A;  4M3Y A;  3DWL A;  3D7E O;  1VSE A;  3M8P A;  2BGG A;  4CEQ A;  3FR0 A;  1IKY A;  1X9W A;  3O1W A;  4M41 A;  3O9U A;  1SAZ A;  4ZTF A;  3SCX A;  4QCL A;  3ULE A;  4CIG A;  3AA3 A;  2A3Z A;  3MN9 A;  2OYQ A;  3G71 N;  4O4G A;  4L8R B;  4FJG A;  5AZJ B;  5FRN A;  4DG1 A;  3J81 O;  4WF9 L;  1GLD G;  4AIL C;  2DY4 A;  1Q81 O;  1VRU A;  4HWI A;  1HRH A;  3VQD A;  3CCU N;  4O8U A;  3TWH A;  1CLQ A;  2YHA A;  4H0V B;  4CK1 A;  3F9M A;  1Q9X A;  3ZLJ A;  4JKA A;  4DU4 A;  1GOB A;  3F9K A;  4CZK A;  2ASP A;  4IOC L;  3HK2 A;  3D45 A;  4FWK A;  4O55 A;  1S1V A;  1QSS A;  4JS4 A;  1SQK A;  5AQO A;  4W5Q A;  3TTF A;  2AA4 A;  4XH4 A;  4KHQ A;  3K5O A;  1JLB A;  4KHN A;  4CF8 A;  3V9W A;  5F2R A;  1BDG A;  4FWN A;  4ID1 A;  3CC4 N;  2O8C A;  4RW4 A;  4F3T A;  4BRO A;  4FWM A;  2C1G A;  4C23 A;  3WNE A;  4J2A A;  4ELT A;  3OHR A;  3QML A;  1HJR A;  4MLH A;  2E20 A;  3C0B A;  4FOI A;  3ZSO A;  4LD0 A;  1HYV A;  4N5S A;  3HPO A;  2W00 A;  1BQN A;  3TAG A;  3LZI A;  2V7Y A;  4A5B A;  1KAY A;  2YHY A;  3EO3 A;  1WBD A;  1RDC A;  4CJQ A;  3AVI A;  2ASM A;  1BA0 A;  3MN6 A;  4JD2 A;  4BC3 A;  4J2D A;  1RBV A;  5AZI A;  5J2M A;  4K25 A;  4CEZ A;  4MFB A;  4FWP A;  3O3F A;  1D9F A;  2HVI A;  1T03 A;  1HNW K;  4JRQ A;  3THV A;  4CIE A;  5D3G A;  3M8R A;  3RR7 A;  4B8C A;  4KB1 A;  3C6H A;  3CJC A;  1S9E A;  1BCM A;  5AQI A;  3WXI A;  1U4B A;  4CVN E;  5JS1 A;  4CED A;  3C65 A;  3MK6 A;  3HVT A;  1VSD A;  3VMF B;  5GIP A;  4HVJ A;  4JI6 K;  1I94 K;  4B9T A;  3CD6 N;  4CHP A;  2VWJ A;  4AH9 A;  3D2F B;  1RTJ A;  4HTU A;  1XQS C;  2RE2 A;  3MX5 A;  4BRG A;  4BRA A;  1J54 A;  3QNO A;  3U3G A;  3SUO A;  1Y97 A;  2HHU A;  4QAG A;  4WQ4 C;  2BUP A;  4E7I A;  3THW B;  1GLL O;  4K8Z A;  1HQU A;  2E1Z A;  2W6L A;  3PUF A;  4RW8 A;  4FLX A;  3AVB A;  3NVM A;  2UXD K;  4ILJ A;  3OTO K;  3O3H A;  4PY5 A;  4KHW A;  3QIP A;  1RBS A;  3LZJ A;  1J9A A;  1RT1 A;  1FK9 A;  3MWP A;  3LAN A;  2QWL A;  1RT3 A;  3MAQ A;  1RT5 A;  2B5J A;  3JXU A;  1JL1 A;  5JLH A;  4PKH A;  1NOY A;  3HI0 A;  4WFN L;  3R1X A;  4DF8 A;  4A5A A;  1BL3 A;  4IDH A;  4A59 A;  3FFK B;  4H0T B;  1W0H A;  4JV5 K;  4F4K A;  3CCS N;  3T1Y K;  1X9M A;  4OPJ A;  1QSY A;  1U45 A;  2RPI A;  3HST B;  4X64 K;  1NLV A;  4JS5 A;  4DQR A;  3FZF A;  4EFH A;  4NCA A;  1Q18 A;  1S6Q A;  3A0I X;  5KPZ A;  4YY3 K;  4PKI A;  3THW A;  1J53 A;  3KLF A;  1RDB A;  1ZBU A;  4KTZ A;  4BRK A;  3T3F A;  1YHQ N;  1O1W A;  3QB0 A;  3SZ2 A;  1R0A A;  3DXM B;  4U7B A;  4CHO A;  4CJP A;  3ZT0 A;  3M8S A;  1GLE G;  1GOC A;  3ALY A;  4H5R A;  4O44 A;  2UU9 K;  4F2R A;  1RTH A;  4E7K A;  4JKE A;  1Q86 O;  5TKY A;  1J6Z A;  2ASO A;  4IG0 A;  1XWL A;  1YF5 L;  2VCP A;  1L3U A;  4CJE A;  3WQU A;  4YOY A;  1JLC A;  3E9P A;  3RRH A;  2W40 A;  1U48 A;  4IFE A;  3LAK A;  3L4Q A;  2BH1 A;  4DUY K;  4YHH K;  1OVQ A;  5CZ1 A;  5GAD P;  1ZBL A;  2YHW A;  5LMU K;  1MDU B;  3DLR A;  5ELZ A;  2QWQ A;  1WSG A;  4FJL A;  1NGG A;  3O80 A;  3LPU A;  3C6T A;  1W2B M;  4JKF A;  3I8B A;  1NJY A;  3AA5 X;  3K58 A;  2OZS A;  3TAE A;  4CZE A;  4CER A;  4CJ3 A;  2P9K A;  1DTQ A;  4DTM A;  5HOO A;  3CJB A;  4FW2 A;  4FVM A;  3C7N A;  3AVM A;  3QDK A;  4OGE A;  1H1V A;  4KB0 A;  3A5N C;  1Z25 A;  2NRV A;  4TSX A;  1RTI A;  3ZSW A;  1A5V A;  3KK7 A;  4BRN A;  1BIS A;  2Q1N A;  1KAX A;  3NH2 A;  4FJK A;  3P1G A;  1VSK A;  2WTU A;  1YT3 A;  3AGK A;  1OKJ A;  3MEG A;  5HRN A;  2XO7 A;  1LCU A;  1RIL A;  4FWO A;  4FJX A;  2D0A A;  1Z6R A;  5C10 A;  2YNG A;  1G99 A;  4KTW A;  3S3N A;  4KV8 A;  5LJV A;  4DQP A;  1S9G A;  4IJA A;  1QQM A;  1BI4 A;  3CPW M;  3HPG A;  1CXQ A;  1NGI A;  1TUU A;  1O13 A;  1D4X A;  4JKG B;  1RNH A;  5GAE P;  3PIP L;  2Q36 A;  3OYJ A;  4QS7 A;  3SUQ A;  2X6S A;  3KLE A;  3RWU A;  1N34 K;  4BVP A;  3RSE A;  4YOT A;  3V9S A;  4PA1 A;  4PL7 A;  3BGR A;  3DXK B;  4B1Z A;  3RMA A;  2O4I A;  1S1X A;  3QIN A;  3MEE A;  2CH6 A;  2D0B A;  1XC3 A;  4E3S A;  5AR0 A;  1TV6 A;  3CME N;  1WN7 A;  4YOW A;  5EXW A;  4BAC A;  1ESV A;  2GEL A;  1VQ5 N;  4CES A;  1U2V A;  3OYA A;  1VQ7 N;  4M3X A;  4KAZ A;  5HBM A;  4DQI A;  3CJ7 A;  1KFD A;  1P90 A;  3M3Z A;  2OA8 A;  1RDW X;  3D2F A;  3QFP A;  3CMA N;  2NRH A;  3MEC A;  3K0S A;  4N76 A;  3CER A;  4JI3 K;  3DLG A;  3OJS A;  5AQG A;  3TPQ A;  1ZYQ A;  4XEI A;  4YOV A;  3P5J A;  3A5L C;  3K2P A;  3EL2 A;  2VG6 A;  4E1N A;  3CQY A;  2IVN A;  4A2A A;  3VET A;  4FJI A;  1LWF A;  4FWR A;  5C25 A;  3N4Q A;  4DR7 K;  4YOX A;  4M3T A;  1LV5 A;  4E7J A;  3IUC A;  3N4P A;  3ZT1 A;  4DQS A;  1QZ6 A;  3SAF A;  4M3U A;  2CGJ A;  1JLQ A;  5T7B A;  2G8H A;  1Q9Y A;  2E6L A;  3FZM A;  4FK4 A;  3S3M A;  1NK8 A;  1RT2 A;  4HCB A;  4Q5V A;  2Q0R A;  5KRT A;  1NBW A;  3HXM A;  3VEV A;  4C8N A;  3U3Y A;  2HOE A;  4K43 A;  4M3W A;  4ZHR A;  3VEX A;  1NJX A;  4R5P A;  4IO9 L;  4NXN K;  4X66 K;  3O9T A;  3JS6 A;  3J7A P;  3CFR A;  4J2E A;  2FSJ A;  4ELV A;  4BR2 A;  4JEP A;  4UY8 O;  2PZS A;  3DLB A;  4CJU A;  3NCI A;  1B9F A;  4CD1 A;  3R3L A;  4JD2 B;  4CJF A;  5GAH P;  1VQ4 N;  3DOK A;  3KTQ A;  1GLB G;  2WUS A;  2XY6 A;  1SUQ A;  4N56 A;  4MO5 A;  4FLW A;  1C0M A;  5C24 A;  4IOX A;  4FLY A;  3TAM A;  3SPZ A;  3CQX A;  1NOZ A;  4ICL A;  5C2F A;  2GV9 A;  2JWL A;  5E41 A;  2QTD A;  2WON A;  2GUP A;  3ATV A;  4KO0 A;  4HCC A;  4DTS A;  3QEX A;  5A2Q O;  1KXP A;  3VGK A;  4FM1 A;  2RKI A;  2CGL A;  3AVC A;  5KQD A;  3RTV A;  1XC9 A;  3O6W A;  4CHY A;  4ZTJ A;  1JLG A;  1BI4 B;  4LFB K;  5LY3 A;  4E7H A;  2UUA K;  3KHY A;  1HYS A;  4FSV A;  4IDK A;  1NU0 A;  4MDA A;  3RVC A;  3DLE A;  3MCP A;  1JLF A;  3ZEU B;  2YX6 A;  1QQO A;  3SYZ A;  4BE7 B;  1U04 A;  3J7Z O;  4AHV A;  2A1S A;  4BGA A;  1BA1 A;  1REV A;  4L3Q A;  1VQM N;  3UKR A;  1NMN A;  5F1X A;  3CJ9 A;  2HHX A;  4KHP K;  5AQS A;  1S1T A;  2EX3 A;  5FPD A;  1C0T A;  1C1C A;  4WQ4 A;  1T05 A;  3E9L A;  3AVK A;  2OPP A;  3QEW A;  3G6E N;  2C1I A;  2UXC K;  4JI8 K;  1QSL A;  4LFA K;  4CGD A;  4Z94 A;  2YNF A;  3IS9 A;  1M1K O;  4CHZ A;  1QVG M;  4DV6 K;  1L5U A;  4BG9 A;  2YI1 A;  3ZSZ A;  2GEM A;  2F9W A;  3KWI A;  3EE9 A;  4CZJ A;  5CZ2 A;  4JI1 K;  2IVP A;  4DFM A;  2OPS A;  4CBX A;  4NYF A;  1DEJ A;  4H4O A;  3KLI A;  1DLO A;  1VSM A;  4DR6 K;  3L2R A;  4IZ9 A;  3QIC A;  2G8F A;  2YNI A;  3VEY A;  1SZ2 A;  5AQF A;  3WT0 A;  3TAQ A;  4LF6 K;  1CZB A;  4FWL A;  3FGU A;  1RBR A;  4B1Y B;  3MN5 A;  4FJJ A;  3LDQ A;  2KKZ A;  3VQ4 A;  5J2Q A;  4KHS A;  3V1Q A;  4OO1 J;  4B08 A;  5FRO A;  1TKT A;  4FO0 A;  1LAV A;  5E26 A;  3SV3 A;  1HNV A;  3G4S N;  3WNH A;  2P9L A;  4E7L A;  4OPA A;  4DS5 A;  4GY2 B;  5AQT A;  4H4M A;  5J1E A;  3SI6 A;  4DB3 A;  4K0K K;  1YJN N;  3NVK A;  2B6A A;  1NMD A;  3AVN A;  3I56 N;  2V51 B;  4PWD A;  1HNZ K;  3O9S A;  3BF1 A;  1V4T A;  2A42 A;  3U8X A;  5FRM A;  4BR0 A;  3CJA A;  5FPM A;  4GVM A;  3O4N A;  5BPL A;  3LP2 A;  3L6Q A;  2UYT A;  1QQC A;  3DOL A;  3VA3 A;  4AHS A;  4IJN A;  3D2E B;  1E4G T;  4LF9 K;  2HHW A;  4B1X B;  4CF1 A;  4B3T K;  4F8R A;  4CGI A;  4IWV A;  3SLC A;  1JCF A;  5AFU A;  3HBT A;  1X3M A;  3J8A A;  4NLB A;  1BG3 A;  3G10 A;  1IG8 A;  5AQZ A;  2D0C A;  3MXM A;  3O3G A;  4GV3 A;  4B9V A;  1A5W A;  4EHU A;  1HKB A;  2F8S A;  5AQP A;  3T19 A;  1U49 A;  1WB9 A;  4DSJ A;  3KVG A;  4KFB A;  3GL1 A;  3L2V A;  4B3R K;  3K9K A;  4K41 A;  4BC5 A;  3VEW A;  1WBB A;  3H6E A;  3S41 A;  1XI1 A;  3LAM A;  4H0P A;  4Y1D A;  3SQ4 A;  4H5N A;  3CFO A;  2BTF A;  5MLC Q;  3HP9 A;  3DM2 A;  4Y1C A;  4RG8 A;  1WSJ A;  5C15 A;  5BRE A;  3H1Q A;  1VHX A;  4I2P A;  1NGC A;  3ZT2 A;  3V1O A;  3NH1 A;  3H08 A;  4H5V A;  3F5T A;  3WNG A;  2HW3 A;  4E0D A;  5F0X A;  1YVN A;  3RMC A;  1U2V B;  3DAW A;  1NWK A;  4I6M A;  1IKX A;  3RMD A;  4CW7 B;  4JI5 K;  5BN9 A;  1MWM A;  2E2N A;  3AAR A;  3HYF A;  3CJ1 A;  4E1M A;  3BY5 A;  1Z05 A;  4UQG A;  3I8D A;  4BEC A;  1GLC G;  4IBN A;  2ZJP L;  5HRS A;  2GUI A;  3AVJ A;  4G9Z A;  4MDB A;  1RTD A;  4FCY A;  5LJW A;  2LSN A;  4JK7 A;  5CHI A;  3OYK A;  3EEQ A;  3BZK A;  1X1P A;  1JXE A;  1YIJ N;  4I2Q A;  4BDP A;  4KRE A;  3OYF A;  1K8A O;  2RF2 A;  4DR3 K;  1N6Q A;  5KQ8 A;  1ZBI A;  3T69 A;  3KZB A;  1B92 A;  3NAE A;  4PHT X;  5I3U A;  3TSU A;  2Q3S A;  1VQ6 N;  5M1P A;  4OKJ A;  3AO2 A;  4CGG A;  4M3R A;  3K5L A;  4DTJ A;  1U6Z A;  3RRG A;  2WBN A;  2W6K A;  2JLE A;  1BUP A;  2YJF A;  4OLA A;  2D4W A;  1DT9 A;  4HUE A;  1RT4 A;  5HRP A;  4DSK A;  1LWE A;  3TAF A;  4K8X A;  1NK5 A;  1QVF M;  2O8D B;  5AQX A;  3PO5 A;  1EP4 A;  4JLH A;  4NXM K;  3SPY A;  2HVH A;  2WC9 A;  3AO3 A;  3F73 A;  4KRF A;  4FYD A;  1EQY A;  3QLH A;  4QOZ B;  4HHT A;  1YTU A;  3HL8 A;  3FZK A;  2X74 A;  1RCH A;  1WAF A;  2HF3 A;  2KHO A;  3O1B A;  3D6R A;  3QIO A;  2HHT A;  1KCF A;  1HKC A;  1VQP N;  4LH4 A;  4H0Y B;  2VWB A;  1BU6 O;  3B6O A;  3PV8 A;  3CM5 A;  4O0I A;  2V7Z A;  5C12 A;  1ZBF A;  3KIO A;  2PFU A;  1SKW A;  1NGA A;  1VQO N;  4RCH A;  1WSE A;  3P83 D;  3LDP A;  2OPR A;  1RFQ A;  3NF6 A;  1KRP A;  3OS0 A;  2IS3 A;  2P9N A;  3HO1 A;  3AV9 A;  2P9L B;  3O5B A;  4B9L A;  1VSL A;  5AZJ A;  2VQE K;  2KFZ A;  1F21 A;  2FBX A;  4XH5 A;  3KJV A;  1NKC A;  3SV4 A;  3MED A;  4BEB A;  1TK5 A;  4CJV A;  4CJS A;  3MXJ A;  4BDY A;  3KWG A;  3SJH A;  2IVO A;  2W41 A;  4BRD A;  1NJI O;  4FM2 A;  3AGR A;  3HRG A;  1L3T A;  4JHD B;  1NGE A;  4FL9 A;  4A57 A;  4DS4 A;  5AQW A;  3L2Q A;  4DUZ K;  5AQM A;  2Q0U A;  3VQ6 A;  4BR9 A;  3MX2 A;  3QEV A;  1RDD A;  3AVG A;  4DWI A;  1MA9 B;  2X78 A;  4GMJ B;  3D2E A;  4CJ4 A;  4NB4 A;  1UWB A;  1Y64 A;  2H3G X;  3MDQ A;  1QS4 A;  4RTF D;  4CJ7 A;  2F4V K;  2P9S B;  3D0P A;  3DLH A;  5CYM A;  1EKE A;  4X62 K;  2QK9 A;  4CZI A;  2KW4 A;  4WYB A;  2YKN A;  2KZM A;  4CHQ A;  4B9M A;  2E8A A;  1RDA A;  4DR2 K;  4JI7 K;  4HTL A;  1K8K A;  3EE8 A;  2OPQ A;  3EKS A;  2QWP A;  5KRS A;  2GX9 A;  3BUZ B;  4CJ5 A;  3CG7 A;  3THX A;  1T44 A;  2YJE A;  3UIQ A;  4OKK A;  1HR0 K;  3DLK A;  5H1S Q;  5EU7 A;  1W7A A;  3OS2 A;  4NO7 A;  4BRI A;  1UOC A;  5AQQ A;  3H46 O;  4CI6 A;  4B1V A;  5DK5 A;  2QXL A;  1BHL A;  3M6G A;  3NE6 A;  4CEB A;  3V9X A;  2P9N B;  5EVZ A;  4N47 A;  4MO4 A;  1I39 A;  2FSK A;  2HBL A;  2X6N A;  4CCH A;  2QW9 A;  1EO1 A;  1M90 O;  4DKW A;  3CCM N;  4F2S A;  2F9T A;  2HHV A;  2VYP A;  1S5J A;  1FKP A;  4DTR A;  3CCE N;  2OTJ N;  5AJ3 K;  3DRP A;  2HMP A;  3VOV A;  1GLJ O;  3NDK A;  4BWM A;  4DSE A;  5J2N A;  5KPT A;  5M1K A;  2KTQ A;  2OTL N;  4OGC A;  3OYD A;  4AM6 A;  4FJM A;  2BAN A;  5C42 A;  3CPE A;  2B4J A;  3BZC A;  4BRL A;  2ZJQ L;  4JKH A;  2E2Q A;  2G8I A;  4K42 A;  3K57 A;  4PL8 A;  1DKG D;  5E84 A;  1ZBS A;  1YXQ A;  4ISG A;  3L2W A;  1HLU A;  2W42 A;  5BR9 A;  4O8K A;  3V9Z A;  3QER A;  3CCJ N;  1XMO K;  2UUC K;  2QKB A;  4OPK A;  2VQF K;  5JMV A;  4CK2 A;  3DRS A;  1JL2 A;  3VQQ A;  5FDL A;  2UUB K;  2XY8 A;  3IAY A;  3SNN A;  3J7Y P;  4MLE A;  3RMB A;  1GLF O;  3DLL L;  1QHT A;  5SZT A;  3SQ0 A;  4B9N A;  2QWN A;  1RGI A;  1QQN A;  3GOI A;  2QWO A;  3CCV N;  4GV9 A;  5C0Y A;  3AVL A;  3OY9 A;  4DMN A;  4I9Q A;  2Q2R A;  4CBU A;  2OZM A;  4KKO A;  4ELU A;  3M8Q A;  3GG4 A;  3WXJ A;  3LDN A;  3WQT A;  4I6M B;  5CE3 A;  3ZEU A;  1BO5 O;  5GIN A;  4DV3 K;  4BR7 A;  1OVY A;  5JLF A;  1KFS A;  4CIF A;  3U6F A;  4CEC A;  4Z4F A;  4CGF A;  3BEX A;  3ZCM A;  1SKR A;  2YNH A;  1S3X A;  3WXM B;  1JXB A;  1TKX A;  4DU3 A;  3KD5 E;  5I9E B;  3AO1 A;  4AF1 A;  3T1A A;  4CJL A;  3E9O A;  5KGW A;  2NUB A;  4DR5 K;  3MXI A;  3V81 A;  4LY7 A;  1XUP O;  3OS1 A;  1KVC A;  4AHC A;  1WSH A;  1QTM A;  3VA0 A;  3S9H A;  1UA1 A;  5HRR A;  4CJW A;  5BRD A;  4GKJ K;  4JAX A;  3KK1 A;  3EYZ A;  2CGK A;  1X9S A;  3W3D A;  4AHR A;  3P31 A;  4JKG A;  3BDP A;  4CZH A;  1TAU A;  3NF9 A;  3IDH A;  1KC8 O;  5AQH A;  3GE1 A;  1ATN A;  3EZ5 A;  2BDP A;  2P51 A;  1VQ9 N;  4V19 S;  1ASU A;  2ZGY A;  5EX5 A;  4FZX C;  4IFY A;  3JAM O;  4B8A B;  4FVU A;  4CEE A;  4DFK A;  3OYI A;  4FK2 A;  2P1J A;  3VGM A;  3OW2 M;  4DLE A;  4H0X B;  4YNQ A;  1ZC6 A;  4JK9 A;  4E72 A;  4Z0U A;  2FXU A;  1IKV A;  3T7Z A;  3M1F A;  1JCE A;  3MWT A;  4F3O A;  4M3Z A;  4FPA A;  2QWR A;  2KLA A;  1NGH A;  4E1J A;  4WFA L;  1FW6 A;  5BRH A;  3LL3 A;  2P9U A;  2RN2 A;  3CXC M;  4M7X A;  3O4W A;  4CGJ A;  4CEA A;  2F96 A;  1C6V A;  3PO4 A;  4CJR A;  3NFA A;  3THX B;  5AZI B;  5SWM A;  4B9Q A;  3C95 A;  1QHA A;  5KGX A;  1XHX A;  4CGH A;  1WLJ A;  3JYT A;  3P38 A;  2O8B A;  3FFI A;  3I0S A;  1KAZ A;  2FF6 A;  3VER A;  1U47 A;  2PAV A;  3NF7 A;  2AP1 A;  3OYM A;  3SMS A;  3WEE B;  2P9K B;  1SKS A;  5EY4 A;  1DTT A;  2KZZ A;  3ZYY X;  2YHX A;  2KFN A;  2PYL A;  2FBV A;  1HQE A;  2Y1J A;  3CC7 N;  4BC2 A;  4H03 B;  1Q82 O;  1TL1 A;  3AY9 A;  4DSL A;  3O9R A;  4PKG A;  4OX9 K;  4BRM A;  4LH5 A;  2RHK A;  3KK3 A;  4DQQ A;  1BIU A;  2D0O A;  1RDU A;  3ID6 A;  4DQ8 A;  4A2B A;  1QE1 A;  4Y0W A;  5CR4 A;  4H5W A;  5AFU H;  2E1Y A;  4E89 A;  1Z26 A;  3OJU A;  1N32 K;  1HYZ A;  4DFJ A;  4H8K A;  1VQK N;  2DFF A;  4KBO A;  1IBM K;  3L4I A;  3C7N B;  2ITM A;  3HM8 A;  4DV7 K;  4B9S A;  1FJG K;  3IKM A;  3VQ7 A;  1W97 L;  3OYG A;  3SUP A;  5B8H A;  5GIO A;  3VEO A;  1SL0 A;  1W9H A;  4BR4 A;  5JS2 A;  4DTN A;  5IWA K;  1K8K B;  5M1O A;  3SJJ A;  1VQ8 N;  5I42 A;  4OLB A;  3CHW A;  3ZX3 A;  4BQL A;  2O8F B;  1YTA A;  1NNE A;  4CJT A;  2R7Y A;  5FPN A;  4AHT A;  2YKM A;  2D5R A;  2D0P A;  3TSQ A;  1UAX A;  1T6D A;  2HMI A;  1TYQ A;  4FOE A;  4IKF A;  2O8E A;  1C0F A;  1BIZ A;  5HL7 L;  3NF8 A;  4CFB A;  3TU5 A;  4CEO A;  3DJC A;  3LWM A;  2G8U A;  4NCB A;  2HST A;  3KD1 E;  5FPE A;  1XNR K;  1WUA A;  4DTO A;  3LAL A;  4NLC A;  1V4S A;  3SQ1 A;  3PLA A;  3CCR N;  2IAJ A;  3IFR A;  2I5J A;  3LM9 A;  1HMV A;  4BRQ A;  1CZ9 A;  1B9D A;  5DM7 L;  1C0U A;  3SQ2 A;  1X3N A;  3IMX A;  3FZH A;  3OA9 A;  4IEE A;  3CQ8 A;  3PX6 A;  2HHQ A;  4O0J A;  3VF4 A;  2HND A;  4BC4 A;  4DV5 K;  4OKE A;  2PYJ A;  1KLM A;  2ITG A;  4CFC A;  4C1N K;  4DV1 K;  3O9Q A;  1KVA A;  3WXK A;  2I7P A;  4CJK A;  4C1N I;  1JLA A;  4DV0 K;  4RW7 A;  4Z4C A;  4M63 C;  3OYE A;  2O8C B;  1NK0 A;  3HTV A;  3K59 A;  5LMN K;  1IBK K;  2P5G A;  2XRI A;  4EIA A;  2XY5 A;  4LFC K;  4XH1 A;  3IRX A;  2UXB K;  2DTU A;  3ZT3 A;  3QEI A;  1ASV A;  4ISF A;  1WSF A;  3Q7B A;  4DSI A;  3V6D A;  1YJW N;  3CIP A;  4B9U A;  5KI6 A;  4KI4 A;  4I9L A;  1WOQ A;  3Q7C A;  2GBZ A;  3ZX0 A;  3VQ5 A;  4CZM A;  4FLZ A;  3DI6 A;  4RW6 A;  3FLC O;  5JVH L;  5KTQ A;  1TYQ B;  1ILY A;  5BR8 K;  2QWM A;  3A2F A;  4BRF A;  4FK0 A;  1T8E A;  3CCL N;  2PBD A;  2FBT A;  5HLF A;  1HNX K;  4DR4 K;  3TI0 A;  5BRF A;  3ZX2 A;  1S22 A;  4Z4E A;  1G15 A;  3NHG A;  1VSF A;  1T6C A;  1TK8 A;  1C0G A;  3NBP A;  4JKB A;  5JIC A;  1NK6 A;  3OYL A;  2FC0 A;  3G0Z A;  4FJN A;  1LWC A;  3R6M A;  5AQL A;  5BN8 A;  3WXL A;  1WAJ A;  2NRZ A;  4JHD A;  1BCO A;  3I55 N;  3QO9 A;  4BRP A;  1HKG A;  1KTQ A;  3LDS A;  3DXM A;  1VSH A;  4CF9 A;  3AA2 A;  2P9U B;  4BE1 A;  3KKR A;  1SL2 A;  1ASW A;  4R79 A;  1FXX A;  3R9P A;  3I33 A;  3C94 A;  4FWQ A;  2JWK A;  4IOA L;  3OVN A;  1OH6 A;  1NJW A;  1TAQ A;  4KHU A;  5FLX O;  1TKD A;  2O8F A;  1KSP A;  4Q0B A;  3VEN A;  2QI2 A;  4EP4 A;  4HUF A;  2IIR A;  3E1Y A;  4WQ5 C;  3QFU A;  3UB5 A;  3LPT A;  3TSP A;  4KTQ A;  4CEF A;  4DTU A;  3CF5 L;  2NNW A;  4W5O A;  1WSI A;  3ZET B;  4B1W B;  4BRH A;  4CE9 A;  4J2B A;  1T3V A;  3C6U A;  2EHG A;  1IG9 A;  3C6A A;  3EN9 A;  4O5F A;  2Q97 A;  3ZSV A;  1J5O A;  1N33 K;  2IOC A;  4FJ5 A;  3AAP A;  4BY9 C;  1NM1 A;  1IV0 A;  4AM7 A;  3HP6 A;  1IO2 A;  1BQM A;  3HOS A;  4FZZ A;  1S6P A;  5LL6 Z;  4KH5 A;  4BQZ A;  1NK7 A;  2ATQ A;  5HRO A;  2DPN A;  2NRW A;  3SBT A;  2FLO A;  3CYM A;  1N5Y A;  4M7Y A;  2G8V A;  3TAB A;  3E66 A;  3DRR A;  3ULD A;  1XMQ K;  1VRT A;  1XNQ K;  2QEX N;  1L3S A;  4FJ7 A;  3GBT A;  5C2D A;  3OYC A;  1MWK A;  3U9D A;  1VK0 A;  2IDO A;  4HUG A;  1N36 K;  5ADX H;  4YOU A;  2HF4 A;  2NLX A;  1XHZ A;  4DU1 A;  1NGB A;  1K6Y A;  4JKD A;  4BRE A;  1NGJ A;  3NGY A;  5HP1 A;  4NCG A;  5ADX A;  3TTD A;  4M45 A;  2XHB A;  3A5M C;  2A1R A;  4GVE A;  4KI6 A;  2NZT A;  2GWK A;  5JVG L;  5K14 A;  3NH0 A;  4NYN A;  3L2U A;  2NRR A;  5IT9 O;  1YI2 N;  3KKS A;  3ENO A;  4YOR A;  2HB5 A;  3THY A;  2P9S A;  1NG9 A;  4F9O A;  3PSI A;  2IC3 A;  3CCQ N;  3UKU B;  3OBW A;  5BPM A;  4DV2 K;  2F8T A;  4FJ9 A;  3CFP A;  4BRC A;  2P5O A;  2ZGZ A;  4JNE A;  2P9P A;  2FF3 B;  3ZSR A;  4ILH A;  4BGB A;  4FLU A;  3EY1 A;  3AAQ A;  2ZQB A;  4LSL A;  4WFB L;  4J8F A;  5AQN A;  1EWR A;  1HUX A;  2VGN A;  1C1A A;  1LAW A;  4GW6 A;  3QES A;  3TTC A;  3MCA B;  4EAH D;  5AQR A;  1HJO A;  2QA4 N;  4W5T A;  3TR8 A;  4IEI A;  3JSM A;  4OJR A;  1OH7 A;  1JLE A;  1SS6 A;  4MQ3 A;  3VN5 A;  1YVU A;  4AQY K;  2CH5 A;  2OCE A;  3NMU A;  3VQ8 A;  3K5N A;  4KPY A;  3HPH A;  3ITH A;  5TKW A;  1BWF O;  1JKH A;  1VSJ A;  1OH8 A;  3QET A;  1A5X A;  4KH4 A;  2E2O A;  3UKU A;  1YIT N;  4XJX A;  3EKU A;  1NKE A;  2ZM6 K;  3U9Z A;  4YDU C;  4E19 A;  1SV5 A;  5DM6 L;  2EWS A;  4GKK K;  1EWQ A;  3FE1 A;  1E3M A;  3H1V X;  2I7N A;  3GDQ A;  3ZET A;  3H3O B;  2Z1J A;  3QEP A;  1I3A A;  3RR8 A;  2QKK A;  2O8E B;  2GWJ A;  1J5E K;  4FXD A;  1HX1 A;  3ISN C;  3A5O C;  3HT3 A;  3OYN A;  2Z1I A;  3VQB A;  2PY5 A;  4FJ8 A;  4DTX A;  2P9P B;  3DMJ A;  4BE2 A;  4FM0 A;  1ATS A;  3SMP A;  4FZY A;  2HBM A;  4XIU A;  5AQK A;  5CY4 A;  3VQE A;  1S1W A;  4B3M K;  3E01 A;  4B3O A;  2A5X A;  3SUN A;  1NGF A;  4JI0 K;  3PX0 A;  4RW9 A;  3O8M A;  4W5N A;  2Z1H A;  3K5M A;  5M1Q A;  4CFD A;  2KQ2 A;  2V52 B;  4CZG A;  2YHB A;  2Q31 A;  3AVH A;  4IXC A;  3AVF A;  3BP8 A;  3O08 A;  1S72 N;  4FLV A;  3ID8 A;  4ID5 A;  1P8Z A;  2HNY A;  1VQN N;  1CXU A;  2J4R A;  1HNI A;  2FBY A;  1TVR A;  3HJF A;  3HVR A;  5CYQ A;  2A40 A;  4DF4 A;  4IFV A;  3B6P A;  3HM9 A;  1LW2 A;  4QS9 A;  3L3U A;  5GAG P;  1RBU A;  1ZXO A;  1K73 O;  3QBX A;  4BDZ A;  2HHH K;  1D5A A;  3K9J A;  4A61 A;  4EHT A;  2E6M A;  4C8O A;  3VF2 A;  2YCH A;  3NGI A;  1KLN A;  3VTH A;  1X9J A;  4BR5 A;  2P9I B;  4ISE A;  2E88 A;  2NRX A;  1TGO A;  4LF4 K;  3DYA A;  3S5T A;  4CF0 A;  3TAR A;  1TKZ A;  3VEZ A;  3QBW A;  5DMR A;  4I7F A;  5EOY A;  3QNN A;  3L3V A;  2VG7 A;  1RBT A;  4FPB A;  3LWL A;  3PX4 A;  2HBK A;  4BE0 A;  3H3N O; 
#chains in the Genus database with same CATH homology
 4PHT X;  2D0P A;  3L4Q A;  2BH1 A;  3TSU A;  3TSQ A;  4OPH A;  1T6D A;  1VQ6 N;  5M1P A;  1TYQ A;  4FOE A;  5GAD P;  2YHW A;  1C0F A;  4WCE L;  5HL7 L;  1MDU B;  5ELZ A;  2QWQ A;  3TU5 A;  3ENB A;  5AQJ A;  1NGG A;  1U6Z A;  3O80 A;  3L0Q A;  3VTI A;  3ULE B;  2WBN A;  1W2B M;  4JKF A;  3I8B A;  3DJC A;  1BUP A;  2FSN A;  2YJF A;  2HST A;  2D4W A;  4QS8 A;  1DT9 A;  5FPE A;  4CZE A;  1WUA A;  4NLC A;  1V4S A;  4KH6 A;  2P9K A;  3LM2 A;  3PLA A;  5HOO A;  1QVF M;  3CCR N;  1K9M O;  3IFR A;  3CJB A;  3LM9 A;  5AQX A;  3C7N A;  3G25 A;  2ZF5 O;  4BRQ A;  3QDK A;  5FPN A;  1JCG A;  4JK8 A;  5DM7 L;  5AQY A;  3HZ6 A;  1X3N A;  2WC9 A;  4BG8 A;  2ZJR L;  3IMX A;  1H1V A;  3FZH A;  3OA9 A;  3A5N C;  4GNI A;  2NRV A;  1EQY A;  3OBY A;  4IEE A;  3VF6 A;  3VF4 A;  4BC4 A;  1QZ5 A;  3FZK A;  3KK7 A;  1DGK N;  4BRN A;  1KQS M;  2HF3 A;  2Q1N A;  2KHO A;  1KAX A;  3O1B A;  3D6R A;  4C1N K;  3O9Q A;  2D1K A;  3WXK A;  2I7P A;  1HKC A;  3AGK A;  4C1N I;  1VQP N;  3ATU A;  4H0Y B;  1OKJ A;  3M5R A;  4M63 C;  2VWB A;  3HTV A;  1BU6 O;  3WEE A;  3SAH A;  4WQ5 A;  1YUW A;  4EIA A;  2E2P A;  4XH1 A;  1LCU A;  2V7Z A;  3VGL A;  5C12 A;  4FWO A;  3H45 C;  2PFU A;  1NGA A;  4ISF A;  1Z6R A;  5C10 A;  1VQO N;  3CC2 N;  4RCH A;  1G99 A;  3Q7B A;  3LDP A;  3WUH A;  3CIP A;  5M1N A;  1YJW N;  4U67 L;  5LJV A;  4IJA A;  1QQM A;  1RFQ A;  3CPW M;  2P9N A;  1NGI A;  1TUU A;  1O13 A;  3DXK A;  1D4X A;  1WOQ A;  2P9L B;  3O5B A;  3Q7C A;  4JKG B;  4CZF A;  5GAE P;  3ZX0 A;  3SK3 A;  4CZM A;  1KD1 O;  1CZA N;  2HBJ A;  2Q36 A;  5AZJ A;  3PIP L;  4BVO A;  3FLC O;  4QS7 A;  5JVH L;  1TYQ B;  5M1F A;  3F2K A;  3B8A X;  5AQU A;  3HOT A;  1ILY A;  2QWM A;  4B1U B;  4XH5 A;  4BRF A;  3P4I A;  3SAG A;  4BVP A;  3CCL N;  4IO8 A;  2PBD A;  3RSE A;  3EZW A;  4YOT A;  4BEB A;  4PL7 A;  3UE5 A;  3DXK B;  3KWG A;  5BRF A;  3SJH A;  4B1Z A;  2IVO A;  1VAZ A;  2W41 A;  4RWT A;  3ZX2 A;  1S22 A;  3CET A;  2CH6 A;  4BRD A;  1NJI O;  2VGM A;  3AGR A;  1XC3 A;  3HRG A;  4DHY A;  4JHD B;  1NGE A;  4FL9 A;  4A57 A;  5AR0 A;  5AQW A;  5BPN A;  5AQM A;  3CME N;  2Q0U A;  4BR9 A;  1T6C A;  1C0G A;  3MX2 A;  4JKB A;  5JIC A;  4YOW A;  5EXW A;  5AQV A;  1ESV A;  2GEL A;  1VQ5 N;  1VQ7 N;  1U2V A;  1MA9 B;  1GLA G;  3D2E A;  3CJ7 A;  1P90 A;  3M3Z A;  4NB4 A;  3R6M A;  5AQL A;  1Y64 A;  4CD3 A;  5BN8 A;  1RDW X;  3D2F A;  3WXL A;  3QFP A;  2NRZ A;  2H3G X;  4JHD A;  2NRH A;  3CMA N;  3MDQ A;  3I55 N;  3CER A;  4RTF D;  4CJ7 A;  4FWS A;  2A41 A;  1NGD A;  2P9S B;  3UKR B;  5AQG A;  4BRP A;  1HKG A;  1Q7Y O;  2P9I A;  3TPQ A;  4CZI A;  3DXM A;  1JJ2 M;  4XEI A;  2P9U B;  4WYB A;  3W0L A;  4YOV A;  2F7T A;  3A5L C;  2E8A A;  4H0O A;  4JN4 A;  4DCH A;  3EL2 A;  4YDU A;  4HTL A;  4R79 A;  3CQY A;  1K8K A;  3EE8 A;  2IVN A;  3EKS A;  2QWP A;  4A2A A;  2GX9 A;  3R9P A;  3VET A;  3BUZ B;  3I33 A;  4FWQ A;  1T44 A;  2YJE A;  2JWK A;  4IOA L;  4FWR A;  1TUY A;  3N4Q A;  1IJJ A;  4YOX A;  5H1S Q;  3IUC A;  3N4P A;  4LC9 B;  3VEN A;  4NO7 A;  4BRI A;  2QI2 A;  5AQQ A;  1QZ6 A;  2A6A A;  4GV6 A;  3SAF A;  3H46 O;  4CI6 A;  4A62 A;  2IIR A;  4ILG B;  2CGJ A;  3E1Y A;  3LDO A;  4WQ5 C;  3QFU A;  4B1V A;  2QXL A;  3M6G A;  3UB5 A;  3TSP A;  1ATR A;  3FZM A;  3VPZ A;  2P9N B;  5EVZ A;  3CF5 L;  2NNW A;  3FZL A;  4MO4 A;  3A8Y A;  3LDL A;  4CZL A;  3ZET B;  4B1W B;  3PIO L;  2FSK A;  2Q0R A;  2HBL A;  4BRH A;  1T3V A;  1R59 O;  1HPM A;  1NBW A;  2QW9 A;  3R8E A;  1M90 O;  1EO1 A;  3P39 A;  3VEV A;  2GTD A;  3C6A A;  2NRT A;  3MN7 A;  4DKW A;  2HOE A;  3EN9 A;  4O5F A;  2Q97 A;  3CCM N;  1E4F T;  4K43 A;  2F9T A;  3AAP A;  3VEX A;  1NM1 A;  2VYP A;  5KPR A;  4IO9 L;  4BY9 C;  4AM7 A;  2OTJ N;  3CCE N;  3O9T A;  3JS6 A;  1YAG A;  2FSJ A;  2HMP A;  3HOS A;  3ENH A;  3VOV A;  4BR2 A;  4KH5 A;  1GLJ O;  4JEP A;  4UY8 O;  4BQZ A;  1LOT B;  1BOT O;  3VES A;  2DPN A;  2NRW A;  5KPT A;  5M1K A;  3BF3 A;  4CD1 A;  3SBT A;  3R3L A;  4JD2 B;  4AM6 A;  2FLO A;  2OTL N;  5GAH P;  2QM1 A;  3CPE A;  2WFB A;  4M7Y A;  1N8R O;  1VQ4 N;  4BRL A;  2ZWH A;  1GLB G;  2WUS A;  3MMV A;  3E66 A;  2ZJQ L;  2OAN A;  4JKH A;  2E2Q A;  1YJ9 N;  4K42 A;  4MO5 A;  4PL8 A;  1DKG D;  3SBG A;  5E84 A;  1ZBS A;  1VQL N;  3HSC A;  4H5T A;  1YXQ A;  4IOX A;  2QEX N;  4ISG A;  1HLU A;  3CI5 A;  3CQX A;  3GBT A;  4O8K A;  5BR9 A;  5C2D A;  1MWK A;  5C2F A;  3RSE B;  3U9D A;  4CBW A;  2JWL A;  3CCJ N;  4JKC A;  2QTD A;  5ADX H;  2GUP A;  2NLX A;  2HF4 A;  4YOU A;  3ATV A;  3U4L A;  3DWL A;  1NGB A;  3D7E O;  4JKD A;  5JMV A;  4BRE A;  1KXP A;  3VGK A;  3FR0 A;  1NGJ A;  5ADX A;  3O1W A;  3TTD A;  2CGL A;  5KQD A;  3O9U A;  1SAZ A;  3O6W A;  3A5M C;  4MLE A;  1GLF O;  4GVE A;  2NZT A;  2GWK A;  5LY3 A;  3ULE A;  3DLL L;  5JVG L;  2QWN A;  2A3Z A;  3KHY A;  1RGI A;  3MN9 A;  1QQN A;  3G71 N;  3GOI A;  4FSV A;  2NRR A;  4MDA A;  3RVC A;  1YI2 N;  2QWO A;  5AZJ B;  3MCP A;  3CCV N;  3ZEU B;  2YX6 A;  1QQO A;  4GV9 A;  5C0Y A;  4BE7 B;  4WF9 L;  1GLD G;  3J7Z O;  3ENO A;  4YOR A;  1Q81 O;  4BGA A;  1BA1 A;  1VQM N;  4L3Q A;  3UKR A;  2P9S A;  2Q2R A;  4HWI A;  3CJ9 A;  5F1X A;  4CBU A;  4F9O A;  5AQS A;  5FPD A;  3CCU N;  4O8U A;  3GG4 A;  3CCQ N;  4WQ4 A;  3WXJ A;  3LDN A;  4H0V B;  3UKU B;  3OBW A;  5BPM A;  3WQT A;  3F9M A;  4I6M B;  3E9L A;  5CE3 A;  3ZEU A;  1BO5 O;  5GIN A;  4BR7 A;  1OVY A;  3G6E N;  2C1I A;  4JKA A;  4BRC A;  5JLF A;  2ZGZ A;  4CZK A;  4JNE A;  4IOC L;  4Z94 A;  2ASP A;  2P9P A;  2FF3 B;  4ILH A;  4BGB A;  1M1K O;  3AAQ A;  4FWK A;  1QVG M;  4WFB L;  4J8F A;  4BG9 A;  2YI1 A;  3BEX A;  1SQK A;  2GEM A;  2F9W A;  3KWI A;  3EE9 A;  5AQO A;  5AQN A;  2AA4 A;  3TTF A;  4CZJ A;  4XH4 A;  1S3X A;  2IVP A;  1HUX A;  2VGN A;  3WXM B;  4CBX A;  1DEJ A;  3TTC A;  3MCA B;  4EAH D;  5I9E B;  5AQR A;  1HJO A;  4AF1 A;  2QA4 N;  4IEI A;  1BDG A;  4FWN A;  5F2R A;  3CC4 N;  4IZ9 A;  3E9O A;  3QIC A;  1SS6 A;  4BRO A;  3VEY A;  4FWM A;  1SZ2 A;  2C1G A;  1XUP O;  2CH5 A;  5AQF A;  3WT0 A;  4C23 A;  4FWL A;  3NMU A;  3FGU A;  3OHR A;  3QML A;  4B1Y B;  3MN5 A;  3LDQ A;  2KKZ A;  4MLH A;  5TKW A;  1BWF O;  2E20 A;  3C0B A;  4FOI A;  5BRD A;  4OO1 J;  4JAX A;  2CGK A;  2W00 A;  3W3D A;  4FO0 A;  3P31 A;  5E26 A;  4KH4 A;  3G4S N;  2E2O A;  2P9L A;  4JKG A;  3UKU A;  4CZH A;  1YIT N;  4OPA A;  2V7Y A;  4GY2 B;  5AQT A;  4A5B A;  1KAY A;  3IDH A;  1KC8 O;  4XJX A;  2YHY A;  5AQH A;  3EO3 A;  4DB3 A;  3EKU A;  1YJN N;  2ASM A;  3GE1 A;  1ATN A;  1BA0 A;  3U9Z A;  3NVK A;  4YDU C;  1NMD A;  3MN6 A;  4JD2 A;  4BC3 A;  5DM6 L;  2EWS A;  5AZI A;  3I56 N;  2V51 B;  3FE1 A;  4K25 A;  1VQ9 N;  4FWP A;  2ZGY A;  3H1V X;  2I7N A;  3O9S A;  5EX5 A;  3BF1 A;  3GDQ A;  3ZET A;  1V4T A;  3H3O B;  4FVU A;  2A42 A;  3C6H A;  3U8X A;  3CJC A;  2GWJ A;  5AQI A;  4BR0 A;  3WXI A;  3VGM A;  3CJA A;  5FPM A;  3OW2 M;  4H0X B;  5BPL A;  1ZC6 A;  1HX1 A;  4JK9 A;  3C65 A;  2UYT A;  3L6Q A;  3A5O C;  3MK6 A;  3VMF B;  5GIP A;  3CD6 N;  2FXU A;  4IJN A;  3D2E B;  1E4G T;  4B1X B;  3D2F B;  3T7Z A;  3M1F A;  4IWV A;  3SLC A;  1JCE A;  1JCF A;  2P9P B;  3MWT A;  5AFU A;  3HBT A;  1ATS A;  3SMP A;  1XQS C;  2RE2 A;  1X3M A;  3MX5 A;  4BRG A;  3J8A A;  2HBM A;  2QWR A;  4FPA A;  4NLB A;  2KLA A;  5AQK A;  1BG3 A;  4BRA A;  1NGH A;  4E1J A;  4WFA L;  1IG8 A;  5AQZ A;  5BRH A;  2A5X A;  4WQ4 C;  3LL3 A;  2P9U A;  1NGF A;  2BUP A;  3CXC M;  1GLL O;  4GV3 A;  4M7X A;  3O4W A;  2E1Z A;  3O8M A;  4EHU A;  1HKB A;  3NVM A;  4ILJ A;  5M1Q A;  5AQP A;  2V52 B;  4CZG A;  2Q31 A;  4IXC A;  3BP8 A;  3O08 A;  3MWP A;  5AZI B;  1S72 N;  4B9Q A;  2QWL A;  1QHA A;  3KVG A;  3ID8 A;  3GL1 A;  3K9K A;  4K41 A;  1P8Z A;  3P38 A;  4BC5 A;  3JXU A;  3VEW A;  5JLH A;  4PKH A;  1KAZ A;  2FF6 A;  3H6E A;  1VQN N;  3HI0 A;  3S41 A;  4WFN L;  2J4R A;  3VER A;  2PAV A;  4H0P A;  2AP1 A;  3R1X A;  3SMS A;  3WEE B;  2P9K B;  4H5N A;  2A40 A;  2BTF A;  5EY4 A;  4IDH A;  4A59 A;  4A5A A;  5MLC Q;  3ZYY X;  3FFK B;  2YHX A;  4H0T B;  5C15 A;  5BRE A;  3H1Q A;  4QS9 A;  3CCS N;  3CC7 N;  4BC2 A;  1NGC A;  4H03 B;  1Q82 O;  3AY9 A;  3O9R A;  5GAG P;  4PKG A;  4BRM A;  1ZXO A;  4H5V A;  3F5T A;  2RHK A;  1NLV A;  5F0X A;  1K73 O;  1YVN A;  3QBX A;  3FZF A;  2D0O A;  4EFH A;  1RDU A;  1U2V B;  3ID6 A;  3DAW A;  1Q18 A;  1NWK A;  3A0I X;  4DQ8 A;  5KPZ A;  4A2B A;  3K9J A;  4Y0W A;  5CR4 A;  4I6M A;  4H5W A;  4A61 A;  4EHT A;  4PKI A;  5AFU H;  2E1Y A;  3VF2 A;  2YCH A;  3VTH A;  1X9J A;  5BN9 A;  4BRK A;  1VQK N;  1MWM A;  2E2N A;  4BR5 A;  2P9I B;  3AAR A;  4ISE A;  2E88 A;  3CJ1 A;  4KBO A;  4BEC A;  1Z05 A;  3QB0 A;  3L4I A;  1YHQ N;  1GLC G;  2NRX A;  3C7N B;  3DXM B;  4U7B A;  2ZJP L;  2ITM A;  3HM8 A;  4G9Z A;  4MDB A;  5LJW A;  4JK7 A;  5CHI A;  1GLE G;  3IKM A;  3VEZ A;  3QBW A;  4H5R A;  1W97 L;  5B8H A;  5EOY A;  3VEO A;  5GIO A;  4BR4 A;  4JKE A;  1Q86 O;  1K8K B;  5M1O A;  5TKY A;  1YIJ N;  1J6Z A;  1K8A O;  2ASO A;  1VQ8 N;  3CHW A;  3ZX3 A;  1YF5 L;  4BQL A;  2VCP A;  5KQ8 A;  4FPB A;  3T69 A;  3WQU A;  2HBK A;  4YOY A;  3KZB A;  3E9P A;  2W40 A;  4IFE A;  3H3N O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...