2P9SA

Structure of bovine arp2/3 complex co-crystallized with atp/mg2+
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
414
structure length
397
Chain Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
total genus 127
structure length 397
sequence length 414
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 2p9sA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9sA04
1BDGA 3KVGA 3ZETB 3SMPA 4WQ4A 1H1VA 1QZ6A 1GLCG 5FPEA 2V52B 3EO3A 4GNIA 4BR2A 1V4SA 3DXKA 1ATSA 2YHXA 3GOIA 4ISEA 4EIAA 1HUXA 1T6CA 3ZX0A 4DCHA 1SZ2A 3KZBA 4IJAA 3ID8A 1D4XA 3U4LA 5JLHA 2QWMA 4BC2A 4NB4A 5BN8A 5BRHA 2VCPA 3SLCA 1U2VA 1DEJA 4WYBA 2D0PA 5EY4A 3VEWA 3HZ6A 2GEMA 3H1VX 4IO8A 1K8KB 2VYPA 1NBWA 4J8FA 4BROA 1ZXOA 2FSNA 1TUUA 4IXCA 1C0FA 1YXQA 1MA9B 5B8HA 3MDQA 2EWSA 2ZGZA 2QM1A 3CIPA 3DJCA 2E2OA 1BA0A 2E1YA 1KAZA 2DPNA 2YHYA 3C7NA 2IVPA 2FXUA 2Q0UA 3F9MA 2E8AA 3O80A 4A61A 2IVNA 4B9QA 3EL2A 4CBWA 3AARA 4H0OA 2CGJA 3A8YA 1WUAA 1GLBG 2A5XA 4BR5A 3GL1A 3MK6A 2P9KA 2UYTA 1S22A 2FLOA 4FWQA 4BQLA 1X9JA 5AFUA 4BC5A 3CQXA 2GUPA 3MN7A 1NLVA 4KBOA 2ASMA 3O08A 2NZTA 4BRNA 4H0YB 4IZ9A 4RCHA 1R59O 3A0IX 1E4FT 2ZGYA 3VEXA 1BU6O 4K41A 4E1JA 4BRPA 5ADXA 1X3MA 2ASOA 3B8AX 1NGEA 4L3QA 4M7XA 5EX5A 5FPDA 5LY3A 4M7YA 4DQ8A 3QFPA 3LDOA 3U9ZA 4BR0A 4MLEA 3C7NB 3QMLA 2P9IA 3D2EA 3L0QA 5AZIA 1T44A 3RSEB 2Q97A 3JXUA 1S3XA 2J4RA 3CJ9A 2ZF5O 3FZFA 3WQUA 3O8MA 1BOTO 3CHWA 1BUPA 3W0LA 2P9KB 1WOQA 1XQSC 2V51B 5EXWA 1NM1A 1OKJA 4H5TA 4BR7A 1CZAN 1HKGA 2CGKA 2E2NA 1TYQA 3BF3A 4DHYA 4WQ5A 1HKBA 3J8AA 2HMPA 3KHYA 3ENOA 4H0TB 4CJ7A 4XH5A 2QXLA 1BA1A 3C0BA 3MN6A 4FWMA 1KAXA 3LDPA 2QWPA 5KPRA 1HPMA 3EZWA 4XH1A 4EAHD 5EOYA 3CERA 3M1FA 4BC4A 3HSCA 2F9TA 4FWKA 2YJFA 3WXJA 2E88A 2P9IB 3WQTA 5AZIB 1HX1A 4BRLA 2A6AA 4CZKA 2GWKA 3DXMA 4H0XB 2QWLA 1HKCA 3I33A 2P9LA 1GLLO 2FF3B 1EQYA 2GTDA 2PBDA 1RFQA 3MN9A 3H3NO 4CZJA 4QS7A 4BREA 5E26A 4BRGA 2QWQA 4YDUC 3H6EA 3CQYA 1SQKA 5BR9A 3WT0A 3H1QA 3ULEB 5BRDA 2HF4A 3ATVA 4FO0A 3H3OB 3FFKB 1TYQB 2WUSA 3LL3A 5EVZA 3WXLA 3VF2A 2QWNA 3ZEUA 4CBUA 1IG8A 2W41A 4B1VA 4BRHA 2D4WA 5AR0A 4JNEA 3SMSA 2ZWHA 1QHAA 4CZMA 1KXPA 2A40A 1NGFA 4EFHA 4IWVA 4LC9B 5KPTA 4JD2A 1BO5O 3BP8A 4I6MA 2P9UA 5TKYA 1GLDG 4BRMA 3ZX2A 5AQVA 1C0GA 2Q1NA 2VWBA 3BUZB 4FWSA 3BF1A 4BR4A 4CZFA 3UE5A 2A3ZA 1Z6RA 4JN4A 3O5BA 2E2QA 4EHTA 4RWTA 2P9LB 3FGUA 1MDUB 3CJBA 4FPAA 4H0PA 3UB5A 3EN9A 3UKUA 3VERA 2Q31A 2FSKA 2PAVA 3DXKB 3GDQA 5AQWA 2E1ZA 1NWKA 3AAPA 5JICA 2Q2RA 3IFRA 3FR0A 3ZEUB 4NO7A 5BRFA 2GELA 3VGLA 4RTFD 5F1XA 3IDHA 4WQ4C 1NGAA 5KPZA 3MN5A 3WXKA 1U2VB 3HTVA 4K43A 4PKGA 3VPZA 3AAQA 4JD2B 4B1YB 2P9UB 2BTFA 2IVOA 4BC3A 4H5RA 4Y0WA 3A5MC 1ATNA 3O6WA 4ISGA 4IJNA 3MCPA 3BEXA 3QFUA 3GG4A 4B1UB 4CI6A 2P9PA 1QQNA 2V7YA 1Y64A 1IJJA 1NGIA 5BN9A 3QBWA 4CD3A 5BREA 4BRKA 2A42A 4JAXA 3CJAA 3VENA 4H0VB 1DKGD 1RDWX 3S41A 3P4IA 4MO5A 4A62A 4C23A 3CJ7A 2YCHA 4FL9A 3QBXA 4FOIA 4AM7A 3DAWA 2QWRA 5AQIA 1TUYA 2E20A 3EKUA 3FZKA 2HOEA 2V7ZA 1ATRA 4BQZA 2CH6A 5F2RA 1JCGA 3LDQA 5BPLA 2Q36A 4MO4A 3LM2A 2OANA 5E84A 5BPMA 2P9PB 4FWLA 3U8XA 1QQMA 1YAGA 3UKRA 1QZ5A 3D2EB 4CZHA 1ESVA 2AA4A 3TPQA 1NGCA 2KHOA 4B1ZA 4Z94A 3W3DA 5AFUH 5AQMA 3R8EA 3VEOA 4FSVA 5AQYA 3M3ZA 4BG8A 1P8ZA 5JMVA 4QS9A 2YHWA 3FE1A 2F9WA 5AQZA 3CETA 1LCUA 4BR9A 5JLFA 4HWIA 2HF3A 5BPNA 4PL7A 5ADXH 3I8BA 3HI0A 1Q18A 4PKIA 4K42A 3SJHA 1YUWA 1NMDA 4H5VA 4HTLA 5I9EB 1E4GT 5KQDA 4H5NA 5FPMA 2QWOA 2A41A 3IUCA 3ATUA 4K25A 3FZHA 4EHUA 5AZJA 2ASPA 3OHRA 4WQ5C 3EKSA 2FSJA 3A5NC 5AQFA 3UKRB 1NGBA 3SK3A 3WEEA 3VOVA 2H3GX 3HM8A 1U6ZA 3DXMB 1ZBSA 4CD1A 4BRFA 1JCFA 1X3NA 5AQXA 4CZEA 3O4WA 1NGGA 1SAZA 1Z05A 3D7EO 1V4TA 5AQOA 4FPBA 2BUPA 3H45C 2Q0RA 3AY9A 5LJWA 3CJCA 3CI5A 4A2AA 4BRQA 4CZGA 3VF4A 4XEIA 4O5FA 3G25A 4XH4A 1MWKA 3VF6A 5AQPA 1GLJO 4BGAA 3A5OC 4BVPA 1NGJA 3M6GA 1KAYA 5AZJB 4I6MB 1NGHA 3RSEA 1YVNA 1GLEG 1NGDA 5AQLA 2CH5A 3IMXA 5AQQA 3WEEB 1XC3A 3D2FA 2D1KA 3LDLA 5AQSA 3H46O 4FWNA 3A5LC 4H03B 3VGKA 3VGMA 2I7PA 1GLFO 2FF6A 3UKUB 2GWJA 1DGKN 3QICA 2CGLA 3VESA 4F9OA 5AQJA 1LOTB 5AQTA 4BRAA 4BRCA 2IIRA 4H5WA 4DB3A 5AQNA 3QDKA 4JHDA 4CZIA 1RGIA 1ZC6A 2AP1A 3VETA 4M63C 5LJVA 3O1WA 2P9NA 4ISFA 4QS8A 2NRHA 3VEVA 3ZX3A 3CJ1A 3QB0A 2QW9A 3GBTA 4YDUA 4A2BA 4BGBA 4CZLA 2E2PA 4BRIA 3L4IA 1GLAG 1XUPO 2P9SA 2ITMA 1QQOA 3MMVA 4GY2B 4BG9A 2W40A 3D2FB 3VEYA 4PKHA 3ZETA 3WXIA 4AM6A 3DWLA 5AQUA 5CE3A 3L6QA 3O1BA 4FOEA 3ULEA 1G99A 4B1WB 5AQRA 2D0OA 5AQGA 3LDNA 3VEZA 2YJEA 5F0XA 1BWFO 1BG3A 1HLUA 1HJOA 4MLHA 4FWOA 4PL8A 3U9DA 4JHDB 1T6DA 4BRDA 3JS6A 3TU5A 3FLCO 3WUHA 4BVOA 4FWRA 1K8KA 3FZMA 4FWPA 2NLXA 2P9NB 3ENHA 1J6ZA 1MWMA 4B1XB 1JCEA 4CBXA 5AQKA 3R9PA 3FZLA 2YI1A 5KQ8A 2I7NA 3R6MA 3HBTA 4O8KA 3GE1A 5ELZA 5FPNA 3LM9A 2P9SB 5AQHA
chains in the Genus database with same CATH superfamily
1BDGA 4LF9K 4IFYA 4CIEA 4AHUA 2PYLA 1QZ6A 5FPEA 3RMDA 2V52B 3WNEA 3OYLA 1V4SA 3DXKA 1ATSA 1BHLA 4B8CA 2HHQA 4DCHA 1JLEA 2W42A 3HOSA 1BQMA 4KTWA 3AO1A 3S3NA 1XHZA 1U2VA 1DEJA 3P5JA 3CC7N 3H1VX 1S1TA 1OH6A 4IEIA 1QQCA 4OPJA 2GBZA 4BROA 3QETA 1NKCA 4E1NA 3OS0A 1TUUA 4IXCA 3SPZA 1C0FA 4M3XA 2PZSA 3BGRA 3OYDA 3DJCA 1NJXA 3TTDA 2RPIA 2E1YA 2DPNA 2Q0UA 5LMUK 4CE9A 4B9QA 3EL2A 3PIOL 4CEFA 1WSJA 4FK4A 1GOCA 5DK5A 3OA9A 3P1GA 3VA3A 2HNYA 1RT5A 4YNQA 3N4QA 1U47A 2IC3A 1X9JA 5GINA 1TGOA 1TKTA 4BC5A 3TSUA 4KBOA 3D0PA 2DFHA 3TAGA 3O08A 4TSXA 2NZTA 4B3TK 4FCYA 3IAYA 4ELVA 1BQNA 1ZBUA 2VG7A 4IZ9A 1R59O 4IFVA 2ZGYA 2O8FB 1S1VA 3VEXA 1CXQA 1BU6O 4BRPA 1JKHA 1X3MA 2ASOA 3B8AX 5J2PA 5FPDA 4FLYA 4JK9A 3LDOA 2FBYA 4G1QA 4MLEA 1WBDA 3C7NB 3VQ4A 1VSIA 3D2EA 1T44A 5GADP 4OGEA 2O8BA 4DSEA 1IBMK 1VSLA 4CHQA 1YJNN 3HP6A 1JLQA 4HVJA 3NMUA 3O8MA 2YHAA 1TV6A 1LW0A 2RN2A 4DLGA 1QTMA 2P9KB 3TSPA 4DTMA 3CM6A 5EXWA 4OLAA 2CGKA 3OYNA 4FJ5A 4DUYK 3ZSZA 1XMQK 1TYQA 3BF3A 3CD6N 3PSFA 4WQ5A 2G8KA 3F2KA 1X1PA 1J54A 2HMPA 4XH5A 1RT2A 2UXCK 1KAXA 4CJKA 3VQ8A 2QWPA 1HPMA 3CERA 4BC4A 5K14A 1U4BA 1VQ6N 3OJUA 2F9TA 4BDPA 3O9SA 4NLBA 2P9IB 3E9PA 3OY9A 1L3UA 4ELUA 4F3OA 1S6QA 3CF5L 2KZMA 1HX1A 5JS1A 2FC0A 3J7AP 3J80O 2GWKA 3SUNA 4AQYK 1LV5A 1NKBA 1WN7A 3ZSWA 1GLLO 4CEDA 4A59A 4KHWA 1C6VA 1K6YA 1VHXA 4IDKA 5E26A 1NOZA 3BY5A 4CF1A 3PX0A 4YDUC 5IWAK 3CCLN 1SQKA 3WT0A 3H1QA 3O4NA 3NF6A 4YOVA 1TAUA 4FO0A 3H3OB 3O9UA 3AO3A 5EVZA 2EHGA 3VF2A 3VA0A 4CBUA 1D8YA 4DFPA 4GKJK 1HNIA 3TAFA 4FJNA 3SMSA 1UA1A 3P31A 1NGFA 2A40A 3O9RA 4FJKA 4A5AA 2C1GA 1GLDG 3KJVA 2KQ2A 4JI5K 2XY6A 3BUZB 4CJUA 4DTXA 2FBTA 4BR4A 5DM7L 3KLEA 3S9HA 2D0AA 3O3HA 1CLQA 3KKRA 2NRZA 3O5BA 4JKHA 3AVGA 4LF7K 3EN9A 3VERA 1T8EA 2PAVA 4DSJA 2E1ZA 1NWKA 5JICA 2F8TA 4JKBA 2NRTA 1Q86O 1FW6A 4CERA 5BRFA 2GELA 2G8FA 4R79A 4MDAA 1NGAA 5KPZA 4GVMA 3WXKA 4EP5A 1HNXK 4PKGA 4BY9C 4B1YB 1RTJA 1I94K 4J2BA 3L2WA 4CJ4A 1JLCA 3HJFA 3J7ZO 1XMOK 1R0AA 4Z4IA 4IJNA 4B1UB 4MFBA 3RVCA 3ZSVA 4IOAL 1HMVA 1NGIA 4DR1K 1BI4B 3U6FA 1TKXA 5CY4A 3P4IA 5KI6A 3ZT3A 4DSLA 3O3FA 3AVJA 4X64K 5AQIA 3NHGA 2V7ZA 5C25A 4BQZA 1UWBA 2NRXA 4M3TA 2YNIA 4ICLA 4H8KA 2HHHK 1JCGA 2F4VK 3LDQA 1N32K 1SKSA 4MO4A 5HRPA 4M42A 4OPAA 3MEGA 4FWLA 3U8XA 1QZ5A 4ILJA 3SZ2A 1XI1A 3W3DA 4W5NA 1JLBA 1IH7A 3MXIA 3THYA 3CCSN 1VSDA 3TWHA 1BGXT 1P8ZA 1A5WA 5DMRA 3DRRA 3NGIA 4FM0A 3OYGA 4BR9A 1N5YA 5BPNA 3VQPA 3K5MA 1XC9A 3PY8A 3HI0A 1Q18A 3DM2A 4BE0A 3SJHA 3LAMA 1NMDA 4H5VA 4ZHRA 5I9EB 4LY7A 3HPHA 1LAWA 3SAFA 3DRSA 4YOWA 1WNSA 3ATUA 4K25A 3OTOK 5HROA 2FSJA 2W6KA 3A5NC 1KQSM 3SK3A 3CCMN 1KVBA 3O9QA 3HM8A 4LH5A 1S6PA 4CEOA 4JKCA 1SKRA 4Z4GA 1X3NA 5AQXA 4CZEA 1Z05A 3D7EO 2DTUA 3AA5X 1LWEA 1ITGA 4FPBA 3H45C 1YJWN 4E72A 2Z1GA 2O8EB 5T7BA 3AY9A 5LJWA 1RBVA 1Y97A 4A2AA 1VQNN 4QCLA 4BRQA 1RT7A 3TAEA 2IGIA 3THXB 4KHNA 4DG1A 4XEIA 3HO1A 1LW2A 5AQPA 3CFPA 2O4GA 4HCCA 1YT3A 1Z25A 4I6MB 3IRXA 2O4IA 4I2PA 1OH8A 3K0SA 5AQLA 3WEEB 3D2FA 3L3VA 4H03B 4JKDA 2I7PA 3JSMA 1P90A 4CEZA 3SUPA 1DLOA 2VG6A 3V1RA 3VESA 1WSGA 4F9OA 4BRAA 5KTQA 3CCJN 2IIRA 3MEEA 3AA4A 4DB3A 5JVHL 2HVHA 2ZD1A 3V6DA 4IEEA 2BDPA 3THVA 3VEVA 3CJ1A 1CZ9A 3GBTA 4DTNA 4NYNA 3RWUA 4CFCA 1GLAG 2P9SA 4GY2B 2O8DA 1N6QA 3OYEA 3VQCA 3LP3A 4M3UA 2Y1JA 2P51A 3L6QA 4OPKA 1TL3A 2Z1IA 2UXDK 1HYSA 5AJ3K 4B1WB 5AQGA 3ULDA 2KTQA 4FM1A 1ZBIA 1BISA 1B92A 3K57A 4PL8A 4BWMA 5CYQA 4JHDB 4BRDA 5BR8K 1NJWA 3WUHA 1FKOA 2A1RA 1K8KA 3HP9A 4FWPA 5M1OA 3TR8A 2G8VA 4CHYA 4FLTA 3DLGA 5IT9O 4F4KA 4QAGA 4CHOA 3R6MA 3HBTA 3H08A 3LM9A 3BZKA 3ZT1A 2NRVA 4CJEA 3K5OA 4E89A 1O13A 3EO3A 1B9DA 4I7FA 4DSIA 3J7YP 1KFDA 3GOIA 4ISEA 3VQ7A 4J2EA 5EU7A 4H4OA 3U4LA 5JLHA 3OS2A 4J2AA 4BC2A 5BRHA 5GIOA 3AO4A 2VCPA 3SLCA 3E9OA 5JVGL 2D0PA 3HZ6A 4R5PA 3LPTA 5C24A 4NCGA 1SUQA 1ZXOA 5I42A 4B3MK 2FSNA 3O3GA 4Q5VA 5B8HA 2YNHA 4YORA 1S5JA 2ZGZA 3VQ9A 4E7JA 5M1FA 4HTUA 3F9MA 5M1KA 1GLBG 2A5XA 4I9LA 4E7KA 1VQ7N 3GL1A 1SL0A 2UYTA 1S22A 4N56A 4BQLA 4FLUA 4OVLA 3AVCA 3L3UA 1NLVA 3CMAN 4B9NA 2KLAA 4KHUA 5GIPA 1BIZA 3LZIA 4DR3K 4FVUA 4FJXA 3QINA 4E1JA 3SQ0A 1Q7YO 3QNNA 4FK2A 4M7XA 5FRNA 4M7YA 4DQ8A 3SQ1A 4C8OA 3IS9A 3KTQA 3HK2A 2F96A 4O0JA 3RSEB 1VRUA 2ZF5O 3FZFA 2OTLN 1ZBLA 4AHVA 1BOTO 5CZ2A 1XQSC 1NK0A 2V51B 1OKJA 4H5TA 1ZYQA 5KRTA 5HOOA 1QSYA 2JWKA 4CJTA 4DR7K 3J8AA 3KHYA 4UY8O 4FYDA 5DM6L 3V9SA 1VQ8N 4FWMA 3MN6A 1KFSA 3LDPA 4DF8A 4CIFA 1VSHA 4EAHD 5EOYA 4PQUA 1TAQA 1KLMA 3M1FA 2OPQA 4YFUA 5CHIA 1L3TA 5JS2A 4XIUA 3KIOA 4FWKA 4B9MA 3CYGA 3WXJA 4C8KA 4KB0A 1YITN 4BRLA 4CZKA 5M1QA 3DXMA 1YIJN 4BDZA 1HKCA 3I33A 4DFJA 3QEVA 2P9LA 2GTDA 3LZJA 1RFQA 3H3NO 1HJRA 4CZJA 4QS7A 2RE2A 4BREA 5J2MA 4BRGA 2OYQA 4U67L 3EY1A 1X9SA 3E9LA 2HF4A 4HHTA 3ATVA 5FRMA 3A2FA 3FFKB 1TYQB 4CESA 1X9MA 3U3GA 2QXFA 1RBTA 1TL1A 1W97L 2W41A 3G6EN 4B1VA 2D4WA 5AR0A 3SBTA 1REVA 2ZWHA 1QHAA 4CZMA 1KXPA 3V9XA 4KRFA 4YOTA 4JD2A 5GAEP 3LAKA 5TKYA 4JI6K 4BRMA 2B5JA 5AQVA 4CGGA 2Q1NA 3LALA 1VSFA 1YTUA 5HRNA 1KTQA 1C0TA 1RT4A 3G10A 3R1XA 3HXMA 1MDUB 4Z4EA 2HBKA 3DOLA 3UKUA 2D5RA 4NXMK 3MEDA 3K5LA 3ALYA 4GV3A 5AQWA 5HBMA 4C1NI 1RTHA 2Q2RA 3K5NA 4DV7K 3IFRA 4X62K 2HMIA 5F1XA 3VGLA 3IDHA 2OZMA 4CFDA 1N36K 3NE6A 4K43A 4CGHA 1DTQA 4IG0A 3AAQA 4CIGA 3PIPL 4DTRA 4V19S 4JS4A 2D0CA 2IVOA 3ITHA 3O6WA 3EZ5A 4JS5A 4CI6A 4DKWA 1HYZA 2P9PA 5C2FA 1QQNA 3SPYA 5J2NA 5C12A 2V7YA 1Y64A 3T7ZA 2KW4A 1IJJA 4LF8K 4DS4A 1RBRA 3QBWA 5BREA 3OS1A 2X78A 2A42A 3KWIA 1FXXA 3S41A 1WSFA 3TAMA 4EZ9A 2B6AA 4AF1A 4MO5A 4CJ5A 2C1IA 4DQIA 3QBXA 3V9UA 3KKSA 2OZSA 1HR0K 3T1AA 3ZT0A 4Z4FA 4E1MA 3KLHA 4KB1A 1TUYA 3ZT4A 5C0YA 3T19A 3FZKA 2HOEA 4BECA 1NJIO 3G4SN 2OTJN 1VQON 3PO4A 1J9AA 3OYJA 2IAJA 1O1WA 5BPMA 1TK8A 3VQQA 2P5GA 1QQMA 4YHHK 3NGZA 1K73O 2HB5A 2WONA 1RDUA 3T69A 3QNOA 2KHOA 4Z94A 1RDAA 1IKWA 3V1QA 2QA4N 1QS4A 4BG8A 4KAZA 2YHWA 2F9WA 4DTPA 4Z0UA 5JLFA 4B9UA 2HF3A 4LFBK 4IFEA 3K9JA 1KVCA 4RG8A 4PKIA 4K42A 1G15A 2QEXN 4HTLA 4PY5A 4CJ3A 4H5NA 1KCFA 5FPMA 3I56N 3IUCA 2OA8A 5AZJA 1HQUA 3NFAA 2VWJA 3OHRA 4WQ5C 3NF9A 4OKJA 4DFKA 4F8RA 3KD1E 1EWQA 4BE7B 2XHBA 3DLHA 1L3VA 4YY3K 1ZBSA 3THYB 1FK9A 4BRFA 4FZYA 4A5BA 2YKMA 1V4TA 3OW2M 3DMJA 3T1HK 1SL2A 3HPGA 1X9WA 3CJCA 3CI5A 1IBLK 4DTUA 3SYZA 2O8FA 1QVFM 4CZGA 2P5OA 4ID5A 1RBUA 5KRSA 3S5TA 4K0KK 4BGAA 2IOCA 4I9QA 3M6GA 3DRPA 1KAYA 1VSKA 1NGHA 4FZZA 1YVNA 5KGWA 1NGDA 1UAXA 4LFCK 3F73A 2ZQBA 1YJ9N 3H46O 4FWNA 4W5RA 3WXMB 3AA2A 1HRHA 3VGMA 1NK4A 4B9SA 3CPEA 2A1SA 2GWJA 3QICA 2CGLA 1IO2A 2ZE2A 1XWLA 3AGRA 3T3FA 2WFBA 2I5JA 1UOCA 3Q7BA 5AQNA 3QDKA 2G8UA 2E5LK 3NCIA 1ZC6A 2AP1A 3RR8A 1VQMN 3BZCA 4ILHA 4JKGB 4KH5A 4KTZA 4DV0K 3ZX3A 4KKOA 5SZTA 3C6UA 4DS5A 4DV4K 4Q0BA 3DLEA 3L4IA 1XUPO 4G9ZA 1A5VA 1QQOA 3MMVA 1S72N 4CGFA 5SWMA 3D2FB 3SJJA 4PKHA 3LP2A 3ZETA 2R7YA 4RW7A 3TANA 3DWLA 4CVNE 5CE3A 4WCEL 1JLAA 2HHXA 4PWDA 4DMNA 3RMAA 2YJEA 1VK0A 5F0XA 3NAEA 2VQFK 1HJOA 3V81A 4Z4CA 4GVEA 3PV8A 1VRTA 2O8CA 1T6DA 1EO1A 3FLCO 3C6TA 4BVOA 4O5BA 3OYHA 3K59A 1MU2A 3ENHA 1J6ZA 4B1XB 2HHTA 4CBXA 3R9PA 3FZLA 4L8RB 2XO7A 4O44A 3G71N 4AILC 3GE1A 2UUAK 4B3OA 2P9SB 5AQHA 3I0SA 3ZYYX 2O8DB 2IS3A 3P83D 3AO2A 3S3OA 4WQ4A 1H1VA 1LAVA 3SUOA 4GNIA 1XNRK 2WC9A 3M8PA 3CFOA 4BR2A 3M8SA 1IG9A 1QSLA 3WNFA 1HUXA 3ZX0A 3KK7A 1U48A 1Q9XA 4JYAK 4A57A 3THWA 4IJAA 3VQAA 1D4XA 3RRGA 2VGMA 4YOYA 4JI8K 3S3MA 4EZ6A 4GV6A 2GEMA 4IO8A 1K8KB 2JLEA 2VYPA 1TKZA 4J8FA 3VQDA 3CC4N 4M3ZA 4FM2A 1YXQA 3OYIA 3MDQA 3TARA 4DSKA 4NYFA 2HBLA 5C10A 3CIPA 1Q82O 1BA0A 1U04A 3CMEN 1LWCA 3PO5A 2E8AA 3O80A 1IBKK 1BI4A 3CXCM 3C6AA 3I0RA 3AARA 4H0OA 4DU3A 4KH6A 3A8YA 1RDCA 4HUEA 4BR5A 4ILGB 1CXUA 4J2DA 1TVRA 3OYBA 1OH7A 4FWQA 2VGNA 4CJFA 5AFUA 3CQXA 5H1SQ 2GUPA 4O55A 3MN7A 4JRPA 1L5UA 1KSPA 2ASMA 4RW9A 1RILA 4E7HA 5FROA 3A0IX 2W00A 4PHTX 4K41A 3NVMA 4L3QA 2KFZA 3SQ2A 3QFPA 3U9ZA 4BR0A 3ZSRA 4DV2K 3CG7A 3L0QA 4WE1A 5AZIA 2Q97A 4CEAA 1S3XA 4I2QA 1NK8A 4FZXC 2J4RA 4FJJA 3SI6A 3DYAA 1LWFA 4DV3K 4DV6K 3QESA 4DU4A 4WFBL 3RMBA 1BUPA 4DV1K 4AH9A 3MWTA 4KI4A 1NM1A 4MQ3A 4BR7A 2HNZA 3HPOA 2HHIA 1CZAN 2AJQA 4JKEA 4DQSA 4JK7A 4CJ7A 3ENOA 1W2BM 2QXLA 1BA1A 2DFEA 1KRPA 3C0BA 1ASVA 5KPRA 3LDSA 4XH1A 2KFNA 3CCUN 4OPHA 3SAGA 2E88A 1QE1A 3WQTA 1U45A 4CK2A 2A6AA 1ILYA 2HW3A 3SV3A 1C1BA 3RMCA 2P1JA 4H0XB 4IKFA 3KK3A 1YVUA 3VQEA 4CF9A 4F2SA 2YX6A 2PBDA 3TI0A 3AVFA 2BGGA 1XNQK 4KHYA 3H6EA 3CQYA 1QVGM 1FJGK 3ULEB 3KK2A 4DR6K 1D5AA 4Z4HA 2HVIA 4KPYA 4KHSA 3ZEUA 4ID1A 3THXA 1S9EA 4NCBA 2RHKA 3C95A 3ISNC 4EFHA 3PUFA 3AVNA 3VMFB 1BO5O 2QI2A 4I6MA 2P9UA 4IG3A 1M90O 3ZX2A 1JL2A 4FWSA 1WBBA 4CZFA 2Y1IA 3UE5A 5HRRA 1Z6RA 4CJQA 3VQBA 1TK0A 4RWTA 2P9LB 3KLGA 4FPAA 4YOUA 3K2PA 2OCEA 4DLEA 2UU9K 1RDBA 4X65K 1A5XA 1NOYA 4GMJB 2FBXA 2FSKA 3GDQA 3DXKB 3OBYA 4CEEA 1OH5A 4AHRA 1JLGA 4DQPA 3ID6A 3HM9A 4NO7A 4RTFD 3MX5A 4K8XA 4WFAL 5HLFA 1U2VB 3HTVA 2GUIA 4FJIA 3SQ4A 4AHSA 4KHPK 4NCAA 4OGCA 4JD2B 3TABA 3FFIA 2DFFA 4LSLA 4BC3A 3B6PA 4IO9L 3OYKA 4H5RA 2VG5A 4Y0WA 3A5MC 4CJLA 5JENA 3LP1A 3CC2N 4M45A 4X66K 4B9TA 1N33K 1DT9A 5BN9A 3SBGA 1WSIA 4K8ZA 4DFMA 4A62A 3SUQA 3CJ7A 2YCHA 4FL9A 3MXMA 3TTFA 3DAWA 1DTTA 3QO9A 1NKEA 4PA1A 2E20A 3EKUA 4FK0A 3QEPA 1W0HA 2YHBA 1ATRA 5KGXA 1IV0A 4LF6K 2DY4A 2QKKA 3M8QA 4QOZB 1KLNA 1ZBHA 2OPSA 3LANA 2BE2A 5F2RA 4N47A 4CHPA 3E01A 3RRHA 3QIPA 2Q36A 1WAFA 1HYVA 3LM2A 2P9PB 3ZLJA 1YAGA 4OJRA 3HRGA 2XY5A 3UKRA 3D2EB 4CZHA 2AA4A 3P38A 1U49A 1NGCA 3LPUA 4KHQA 2O8BB 1VSJA 3CYMA 5AFUH 5AQMA 4WFNL 3R8EA 3VEOA 4FSVA 4U7BA 3L2UA 4QS9A 4BDYA 3CETA 3NH0A 3ZSOA 2PYJA 3AA3A 4FW2A 4HWIA 3BDPA 4LF5K 1E3MA 3I8BA 5LL6Z 4GKKK 4FLWA 1YUWA 3NH2A 2QWOA 3CPWM 4KTQA 4H4MA 4N41A 1WLJA 2HHSA 3EKSA 2H3GX 1U6ZA 3ENBA 3I55N 2WTUA 4BEBA 4CD1A 2JWLA 3QLHA 3O4WA 1NGGA 1SAZA 2OPPA 4FJLA 5AQOA 1C1CA 2BUPA 3ZCMA 4DUZK 1NG9A 3AVBA 3NGYA 5HL7L 4KFBA 2LSNA 3WNHA 4O5FA 4XH4A 1MWKA 1GLJO 2HBMA 1HNWK 1NGJA 5AZJB 4JI4K 3L2QA 4B3SK 3RSEA 4E0DA 3AV9A 1GLEG 4CF8A 3SV4A 2CH5A 5GAHP 5AQQA 4CJVA 1XC3A 5AQSA 5C15A 1YHQN 4LSNA 4CEQA 1GLFO 3KWGA 1DGKN 5J1EA 4DF4A 4C8NA 5AQTA 3C6HA 4BRCA 1K9MO 3ZSQA 5HP1A 3IKMA 4CZIA 1B9FA 4M41A 1RGIA 4DTSA 3QEXA 3VETA 3O1WA 2P9NA 1Q8IA 2RKIA 4JRQA 1NK7A 2NRHA 4NLCA 4IOXA 5FDLA 2UUBK 4HCBA 2QW9A 3EE9A 4YDUA 4B8AB 1NJZA 2Z1HA 3E66A 4CZLA 4JI0K 2E2PA 3D6RA 4BRIA 4XJXA 1VQPN 5TKWA 4O8UA 3NVKA 1EXQA 2W40A 1I3AA 3VEYA 3WXIA 5AQUA 4FOEA 1G99A 4Y1CA 1OVQA 4O4GA 5AQRA 3LDNA 4DQQA 1IKYA 1S1WA 1BWFO 1HLUA 4CECA 2BANA 2E4LA 3U9DA 4M3WA 4B08A 4ELTA 1S1XA 2NRRA 4W5QA 1UA0A 2OPRA 3JS6A 1JLFA 4FWRA 3FZMA 3KD5E 1D9FA 1SS6A 3DLBA 1JCEA 5FLXO 1YF5L 4FLZA 2YI1A 3C94A 5FPNA 4AHCA 1NK5A 3HVTA 1T05A 2G8HA 3KVGA 3TTCA 3LP0A 3ZETB 1S1UA 3SMPA 1N8RO 3CCEN 1GLCG 1J5OA 2YHXA 1XHXA 4EIAA 1T6CA 3UIQA 1SZ2A 2HBJA 3KZBA 1VSEA 3ID8A 2QWMA 4KREA 4NB4A 5BN8A 4CF0A 4O0IA 2NRWA 4CGDA 2O8CB 4WYBA 5EY4A 1ASWA 3VEWA 3Q7CA 4DU1A 1NBWA 4OX9K 3VN5A 3HT3A 4DR2K 1VQ4N 1OVYA 1MA9B 2EWSA 3SNNA 3QEWA 3C65A 1KD1O 2QM1A 2E2OA 1KAZA 2YHYA 2IVPA 3C7NA 1JXBA 2FXUA 4LH4A 2HSTA 4A61A 2IVNA 4CBWA 1SV5A 1K8AO 1C0MA 2CGJA 1WUAA 4CK1A 4KI6A 1S9GA 3O4QA 3O9TA 3V1OA 3HYFA 3THWB 3MK6A 2P9KA 4FJHA 2FLOA 4BE1A 4FJGA 4CEBA 2ZJPL 4CJSA 4FLXA 5C42A 2PFUA 3KK1A 4WF9L 4E7IA 3AVIA 2YNFA 4BRNA 4H0YB 4RCHA 4E3SA 2VWKA 1E4FT 5ADXA 3OYCA 3OYFA 1NGEA 5EX5A 5LY3A 2NNWA 4BACA 1T03A 3OBWA 3QMLA 2P9IA 4C8MA 1IKXA 3JXUA 4CFBA 4GW6A 3TSQA 3CJ9A 4HUFA 3WQUA 3VTIA 3MCAB 3CHWA 5I3UA 3W0LA 3G0ZA 1WOQA 3HL8A 4DQRA 2ETJA 3D45A 1RDDA 1HKGA 4LF4K 2YNGA 1WSEA 2E2NA 4DHYA 1NMNA 1RBSA 1HKBA 1EETA 4H0TB 3DLRA 4EP4A 3MWPA 3CCRN 2XY8A 4LD0A 3EZWA 4IDHA 3L2RA 5CYMA 3HSCA 5LMNK 3ZSXA 5M1NA 3L4QA 2YJFA 1L3SA 5AZIB 5D3GA 3V4IA 3K58A 3OYMA 3QERA 4RW6A 2QWLA 3ASMA 2FF3B 1EQYA 1RNHA 3MN9A 2XY7A 3U3YA 2G8IA 1NJYA 1W7AA 5J2QA 2QK9A 2QWQA 2D0BA 1KC8O 1RT3A 2E6LA 5BR9A 5BRDA 1C1AA 1HNZK 3VQ6A 2WUSA 3LL3A 3WXLA 2QWNA 1IG8A 4N5SA 1Q9YA 1BIUA 4BRHA 1HNVA 3J81O 4JNEA 4IWVA 4LC9B 4HUGA 4DTJA 3DI6A 5KPTA 4CFAA 1WB9A 3BP8A 1C0GA 2VWBA 1T7PA 4JI7K 1BL3A 3B6OA 3BF1A 3VTHA 4PUOA 5M1PA 4CHZA 4FJ8A 2KZZA 3WNGA 4ZTFA 2WOMA 1VQKN 3N4PA 2A3ZA 4JN4A 2E2QA 4EHTA 3FGUA 3CJBA 4H0PA 3KLFA 3KLIA 3UB5A 1J5EK 4GV9A 4Y1DA 3EE8A 4DSFA 2Q31A 3AVLA 3MECA 4JI1K 2WBNA 4CK3A 3DLLL 3AAPA 1BCMA 3I8DA 4B9LA 3FR0A 3PX4A 1VQ5N 2X6NA 3ZEUB 1TK5A 3QIOA 4WQ4C 1M1KO 3MN5A 4M3YA 4JKGA 2KKZA 2FBVA 3VPZA 5GAGP 3CCQN 5HRSA 3VQ5A 2P9UB 2BTFA 1NK9A 3EEQA 3T1YK 2X6SA 1ATNA 1GOAA 5CZ1A 4ISGA 3AGKA 3MCPA 3BEXA 2XRIA 3AVMA 3GG4A 3QFUA 1VQLN 1BCOA 2JGUA 3OJSA 4KV8A 2QTDA 4AHTA 1EWRA 4CD3A 4BRKA 4JAXA 3CJAA 3VENA 4B9VA 3OYAA 1RCHA 4OKEA 4H0VB 1VSMA 1DKGD 1RDWX 4E19A 3L2VA 4NXNK 4IBNA 3ZT2A 2F8SA 4C23A 3F9KA 2ATQA 3NH1A 4FOIA 4LFAK 4AM7A 2QWRA 3PSIA 4FJ7A 3K9KA 1I39A 2HHUA 4DV5K 3SAHA 2CH6A 2Q3SA 3M5RA 1Z26A 5E41A 1ASUA 1QSSA 5BPLA 2OANA 5E84A 4FJMA 2ZJQL 1RTIA 4IOCL 1ESVA 3TPQA 4B1ZA 3LWLA 1EX4A 4CJRA 3TAQA 3P39A 1N34K 2BH1A 4B3RK 5AQYA 3M3ZA 4CHNA 5JMVA 1QHTA 2YV0X 3FE1A 4CCHA 5AQZA 1LCUA 2O8EA 5CR4A 2HNDA 1YI2N 4W5TA 1HPZA 4PL7A 4C1NK 5ADXH 3MX2A 1SL1A 3LWMA 4OLBA 2QKBA 1W9HA 4RW8A 5KQDA 1E4GT 1IKVA 2IDOA 2W6LA 1RT1A 2A41A 1KVAA 4DTOA 1EKEA 3M8RA 1WSHA 3FZHA 4EHUA 1VQ9N 4JI3K 2F7TA 2ASPA 3NF8A 3F5TA 5AQFA 4DR5K 3UKRB 4JKFA 1NGBA 3WEEA 3VOVA 3TAPA 3DXMB 1JCFA 5MLCQ 5A2QO 4CGJA 1VAZA 3NF7A 2G8WA 1C0UA 2Q0RA 3V9WA 2YKNA 3DOKA 2RF2A 4DWIA 4CJPA 4F2RA 4E7LA 3NDKA 4FW1A 3VF4A 4FVMA 3RTVA 2HHVA 1RTDA 3AVKA 4JI2K 3G25A 1RT6A 3VF6A 1NK6A 3A5OC 4BVPA 4UQGA 4BWJA 4OKKA 1YTAA 3IMXA 2ITGA 3HOTA 2NUBA 3NBPA 2D1KA 3LDLA 3ZSYA 4DR4K 3A5LC 3VGKA 3PLAA 4CW7B 4M3RA 2FF6A 3UKUB 4C8LA 3AVAA 1GOBA 2B4JA 2E6MA 3MAQA 5AQJA 1LOTB 2HHWA 4W5OA 3R3LA 4H5WA 4JHDA 2GX9A 4JLHA 1CZBA 3SCXA 1TKDA 4F3TA 1HQEA 3DLKA 3JAMO 4M63C 5LJVA 4FLVA 3L8BA 4ISFA 4QS8A 4FXDA 3JYTA 3HSTB 3QB0A 1Q81O 3HVRA 4JK8A 4A2BA 4BGBA 3IG1A 3QEIA 1T3VA 4JV5K 4MDBA 2ITMA 5C2DA 4CGIA 1NU0A 4BG9A 2Z1JA 3MXJA 3CQ8A 4YOXA 3CM5A 4FJ9A 1JJ2M 3EYZA 3CFRA 1D9DA 4JKAA 4AM6A 4BE2A 3O1BA 1J53A 3ULEA 4RW4A 3RR7A 2D0OA 4OO1J 3VEZA 4JEPA 1BG3A 4MLHA 4FWOA 3OVNA 2UUCK 1F21A 3PX6A 2EX3A 3V9ZA 1FKPA 3E1YA 1SKWA 3TU5A 3AVHA 3AO5A 2ZM6K 2PY5A 2NLXA 2P9NB 4CJWA 2VQEK 1ZBFA 1MWMA 3CCVN 4KH4A 4CF2A 5AQKA 2ZJRL 2UXBK 4KO0A 2X74A 5KQ8A 1NNEA 4ZTJA 2GV9A 1JL1A 2I7NA 4O8KA 5ELZA 4N76A 1JXEA 1WAJA 1EP4A
chains in the Genus database with same CATH topology
1BDGA 3ZYYX 3KVGA 3TTCA 2NRVA 3ZETB 3SMPA 1O13A 4WQ4A 1H1VA 1QZ6A 1GLCG 5FPEA 2V52B 1N8RO 3CCEN 3EO3A 4GNIA 2WC9A 4BR2A 1V4SA 3DXKA 1ATSA 2YHXA 3GOIA 4ISEA 4EIAA 1HUXA 1T6CA 3ZX0A 4DCHA 1SZ2A 2HBJA 3KK7A 3KZBA 4A57A 4IJAA 3ID8A 1D4XA 3U4LA 5JLHA 3HOSA 2QWMA 4BC2A 2VGMA 4NB4A 5BN8A 5BRHA 5GIOA 2VCPA 3SLCA 4YOYA 1U2VA 1DEJA 2NRWA 3E9OA 5JVGL 4GV6A 4WYBA 2D0PA 5EY4A 3VEWA 3HZ6A 2GEMA 3Q7CA 3H1VX 3CC7N 4IO8A 1K8KB 4IEIA 2VYPA 1NBWA 4J8FA 4BROA 1VQ4N 1OVYA 1ZXOA 3CC4N 2FSNA 1TUUA 4IXCA 1C0FA 1YXQA 1MA9B 5B8HA 3MDQA 2EWSA 4YORA 3C65A 2HBLA 5C10A 2ZGZA 2QM1A 3CIPA 3DJCA 2E2OA 1Q82O 1KD1O 3TTDA 1BA0A 2E1YA 3CMEN 1KAZA 2DPNA 2YHYA 2IVPA 3C7NA 2FXUA 2Q0UA 5M1FA 3F9MA 2HSTA 2E8AA 3O80A 4A61A 2IVNA 4B9QA 3EL2A 3C6AA 3CXCM 4CBWA 1K8AO 3AARA 4H0OA 5M1KA 3PIOL 2CGJA 4KH6A 3A8YA 1WUAA 1GLBG 2A5XA 4BR5A 3OA9A 4ILGB 1VQ7N 3GL1A 3O9TA 3MK6A 2P9KA 2UYTA 1S22A 2FLOA 3N4QA 4FWQA 2ZJPL 4BQLA 1X9JA 2VGNA 4CZHA 5GINA 5AFUA 2PFUA 3CQXA 4BC5A 2GUPA 5H1SQ 3MN7A 3TSUA 1NLVA 4KBOA 4WF9L 2KLAA 3CMAN 2ASMA 5GIPA 3O08A 2NZTA 4BRNA 4FVUA 4H0YB 4IZ9A 4RCHA 1R59O 3A0IX 2W00A 1E4FT 2ZGYA 4PHTX 3VEXA 1BU6O 4K41A 4E1JA 4BRPA 5ADXA 1Q7YO 1X3MA 2ASOA 3B8AX 1NGEA 3NVMA 4L3QA 4M7XA 5EX5A 5FPDA 5LY3A 4M7YA 2NNWA 4JK9A 3QFPA 4DQ8A 3LDOA 3U9ZA 4BR0A 4MLEA 3C7NB 3OBWA 3QMLA 2P9IA 3D2EA 3L0QA 5AZIA 1T44A 3RSEB 5GADP 2Q97A 3JXUA 1S3XA 2J4RA 3TSQA 3CJ9A 2ZF5O 3FZFA 1YJNN 2OTLN 3WQUA 3NMUA 3O8MA 3MCAB 3VTIA 1BOTO 4WFBL 3CHWA 1BUPA 3W0LA 2P9KB 3MWTA 3TSPA 1WOQA 1XQSC 2V51B 5EXWA 1NM1A 1OKJA 4H5TA 4BR7A 1CZAN 5HOOA 1HKGA 2CGKA 2JWKA 2E2NA 1TYQA 3BF3A 4DHYA 4JKEA 3CD6N 4WQ5A 3F2KA 4JK7A 1HKBA 3J8AA 2HMPA 3KHYA 3ENOA 4H0TB 4CJ7A 5DM6L 4XH5A 1W2BM 2QXLA 1BA1A 1VQ8N 3C0BA 3MN6A 4FWMA 1KAXA 3LDPA 2QWPA 3MWPA 5KPRA 1HPMA 3CCRN 3EZWA 4XH1A 4EAHD 4IDHA 3CERA 5EOYA 3M1FA 4BC4A 1VQ6N 5CHIA 3HSCA 2F9TA 5M1NA 3L4QA 4FWKA 4OPHA 2YJFA 3SAGA 3WXJA 2E88A 3CCUN 3O9SA 4NLBA 2P9IB 3E9PA 1YITN 3WQTA 3CF5L 5AZIB 1HX1A 4BRLA 2A6AA 4CZKA 2GWKA 1ILYA 5M1QA 3DXMA 1YIJN 4H0XB 2QWLA 1HKCA 3I33A 2P9LA 1GLLO 2FF3B 1EQYA 2GTDA 2PBDA 1RFQA 2YX6A 3H3NO 3MN9A 4A59A 4CZJA 4QS7A 2RE2A 4BREA 5E26A 4BRGA 2QWQA 4U67L 4YDUC 3H6EA 3CQYA 1KC8O 1QVGM 1SQKA 3CCLN 5BR9A 3WT0A 3H1QA 3ULEB 3E9LA 2HF4A 5BRDA 3ATVA 4YOVA 4FO0A 3H3OB 3FFKB 1TYQB 2WUSA 3LL3A 3O9UA 5EVZA 3WXLA 3VF2A 2QWNA 3ZEUA 1W97L 4CBUA 1IG8A 2W41A 3G6EN 4B1VA 4BRHA 2RHKA 2D4WA 5AR0A 4JNEA 3SBTA 3SMSA 2ZWHA 1QHAA 4CZMA 3P31A 1KXPA 2A40A 1NGFA 4EFHA 4IWVA 4LC9B 5KPTA 3O9RA 4YOTA 4JD2A 4A5AA 2C1GA 3VMFB 1BO5O 2QI2A 3BP8A 2P9UA 4I6MA 1GLDG 5TKYA 3ZX2A 5AQVA 4BRMA 5GAEP 1C0GA 2Q1NA 2VWBA 3BUZB 4FWSA 3VTHA 3BF1A 5M1PA 4BR4A 4CZFA 3UE5A 5DM7L 1VQKN 3N4PA 2A3ZA 1Z6RA 2NRZA 4JN4A 3O5BA 2E2QA 3R1XA 4JKHA 4EHTA 4RWTA 2P9LB 3FGUA 1MDUB 3CJBA 4FPAA 4YOUA 4H0PA 2HBKA 3UB5A 3EN9A 3UKUA 3VERA 4GV9A 3EE8A 2Q31A 2FSKA 2PAVA 3DXKB 3GDQA 3OBYA 4GV3A 5AQWA 2WBNA 4C1NI 3DLLL 2E1ZA 1NWKA 3AAPA 5JICA 2Q2RA 3IFRA 3ID6A 3FR0A 4JKBA 2NRTA 1Q86O 1VQ5N 3ZEUB 4NO7A 5BRFA 2GELA 3VGLA 4RTFD 5F1XA 3MX5A 4MDAA 3IDHA 4WQ4C 4R79A 1NGAA 5KPZA 1M1KO 4UY8O 3MN5A 3WXKA 4WFAL 1U2VB 3HTVA 4K43A 4JKGA 4PKGA 2KKZA 3VPZA 5GAGP 3AAQA 3CCQN 3PIPL 4JD2B 4BY9C 4B1YB 2P9UB 2BTFA 2IVOA 4BC3A 4IO9L 4H5RA 4Y0WA 3A5MC 3J7ZO 1ATNA 3O6WA 4ISGA 4IJNA 3AGKA 3MCPA 3BEXA 3QFUA 3GG4A 4B1UB 4CI6A 4DKWA 3CC2N 1VQLN 2P9PA 3RVCA 5C2FA 1QQNA 4IOAL 5C12A 2QTDA 2V7YA 1Y64A 3T7ZA 1IJJA 1DT9A 1NGIA 5BN9A 3QBWA 4CD3A 5BREA 4BRKA 2A42A 4JAXA 3CJAA 3VENA 3SBGA 4H0VB 3KWIA 1DKGD 1RDWX 3S41A 3P4IA 4AF1A 4MO5A 4A62A 4C23A 3CJ7A 2YCHA 4FL9A 2C1IA 3QBXA 4FOIA 4AM7A 3TTFA 3DAWA 2QWRA 5AQIA 1TUYA 3K9KA 2E20A 3EKUA 5C0YA 3FZKA 2HOEA 2V7ZA 1ATRA 3SAHA 4BQZA 2NRXA 4BECA 2CH6A 1NJIO 3M5RA 5F2RA 3G4SN 2OTJN 1VQON 1JCGA 3LDQA 5BPLA 2Q36A 4MO4A 3LM2A 2OANA 5E84A 5BPMA 2P9PB 4OPAA 1M90O 4FWLA 3U8XA 1QQMA 1YAGA 2ZJQL 3HRGA 1K73O 3UKRA 1QZ5A 1RDUA 3T69A 3D2EB 4ILJA 1ESVA 2AA4A 3P38A 1NGCA 2KHOA 3TPQA 4Z94A 3W3DA 4B1ZA 3P39A 5AFUH 5AQMA 2QA4N 4WFNL 2BH1A 3R8EA 3VEOA 3CCSN 4FSVA 5AQYA 3M3ZA 4BG8A 1P8ZA 5JMVA 4U7BA 4QS9A 2YHWA 3FE1A 2F9WA 5AQZA 3CETA 1LCUA 4BR9A 5JLFA 5CR4A 4HWIA 1YI2N 2HF3A 5BPNA 4PL7A 4C1NK 5ADXH 3MX2A 3I8BA 3HI0A 1Q18A 4IFEA 3K9JA 4PKIA 4K42A 3SJHA 1YUWA 2QEXN 1NMDA 4H5VA 4HTLA 5I9EB 1E4GT 5KQDA 4H5NA 5FPMA 2QWOA 3CPWM 3I56N 2A41A 3IUCA 3SAFA 4YOWA 3ATUA 4K25A 3FZHA 4EHUA 5AZJA 1VQ9N 2F7TA 2ASPA 3OHRA 4WQ5C 3EKSA 2FSJA 3A5NC 3F5TA 5AQFA 1KQSM 3UKRB 4BE7B 4JKFA 1NGBA 3SK3A 3WEEA 3CCMN 3VOVA 3O9QA 1VQPN 2H3GX 3HM8A 1U6ZA 3DXMB 3ENBA 3I55N 1ZBSA 4BEBA 4CD1A 2JWLA 4BRFA 1JCFA 4JKCA 4A5BA 1X3NA 5AQXA 4CZEA 3O4WA 1NGGA 1SAZA 1Z05A 3D7EO 5MLCQ 1V4TA 5AQOA 3OW2M 4FPBA 1VAZA 2BUPA 3H45C 1YJWN 2Q0RA 3AY9A 5LJWA 3CJCA 3CI5A 5HL7L 4A2AA 1VQNN 1QVFM 4BRQA 4CZGA 3VF4A 4XEIA 4O5FA 3G25A 4XH4A 1MWKA 3VF6A 5AQPA 1GLJO 2HBMA 4BGAA 3A5OC 4BVPA 1NGJA 3M6GA 1KAYA 5AZJB 4I6MB 1NGHA 3RSEA 1YVNA 1GLEG 1NGDA 5AQLA 2CH5A 5GAHP 3IMXA 5AQQA 3WEEB 1XC3A 3D2FA 3HOTA 2D1KA 3LDLA 5AQSA 1YJ9N 3H46O 4FWNA 3A5LC 4H03B 3WXMB 5C15A 1YHQN 4JKDA 3VGKA 3PLAA 3VGMA 2I7PA 3CPEA 1GLFO 3KWGA 1P90A 2FF6A 2GWJA 3UKUB 1DGKN 3QICA 2CGLA 3VESA 3AGRA 4F9OA 2WFBA 5AQJA 1LOTB 3C6HA 5AQTA 4BRAA 4BRCA 3CCJN 3R3LA 2IIRA 1K9MO 3Q7BA 4H5WA 4DB3A 5AQNA 5JVHL 3QDKA 4JHDA 2GX9A 3IKMA 4CZIA 4IEEA 1RGIA 1ZC6A 2AP1A 3VETA 4M63C 5LJVA 1VQMN 3O1WA 2P9NA 4ISFA 4ILHA 4QS8A 4JKGB 4KH5A 2NRHA 4NLCA 3VEVA 3ZX3A 3CJ1A 4IOXA 3QB0A 1Q81O 2QW9A 3EE9A 3GBTA 4YDUA 4JK8A 4A2BA 4BGBA 3E66A 4CZLA 1T3VA 2E2PA 3D6RA 4BRIA 3L4IA 4XJXA 1GLAG 1XUPO 2P9SA 4MDBA 1QQOA 3MMVA 4O8UA 5TKWA 2ITMA 5C2DA 4GY2B 4BG9A 1S72N 2W40A 3NVKA 3D2FB 3VEYA 4YOXA 4PKHA 3ZETA 1JJ2M 3WXIA 4JKAA 3DWLA 4AM6A 5AQUA 5CE3A 4WCEL 3L6QA 4IOCL 3O1BA 4FOEA 3ULEA 1G99A 4B1WB 5AQRA 2D0OA 5AQGA 3LDNA 4OO1J 4G9ZA 3VEZA 2YJEA 5F0XA 1BWFO 4JEPA 1BG3A 1HLUA 1HJOA 4MLHA 4FWOA 4PL8A 3U9DA 4GVEA 2NRRA 4JHDB 1T6DA 4BRDA 3JS6A 3E1YA 1EO1A 3TU5A 3FLCO 3WUHA 4BVOA 4FWRA 1K8KA 3FZMA 4FWPA 1SS6A 2NLXA 2P9NB 5M1OA 3ENHA 1J6ZA 1MWMA 4B1XB 3CCVN 1JCEA 4KH4A 4CBXA 1YF5L 5AQKA 3R9PA 2ZJRL 3FZLA 2YI1A 5KQ8A 2I7NA 3R6MA 3HBTA 4O8KA 3GE1A 5ELZA 5FPNA 3LM9A 3G71N 2P9SB 5AQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDG A;  3KVG A;  3ZET B;  3SMP A;  4WQ4 A;  1H1V A;  1QZ6 A;  1GLC G;  5FPE A;  2V52 B;  3EO3 A;  4GNI A;  4BR2 A;  1V4S A;  3DXK A;  1ATS A;  2YHX A;  3GOI A;  4ISE A;  4EIA A;  1HUX A;  1T6C A;  3ZX0 A;  4DCH A;  1SZ2 A;  3KZB A;  4IJA A;  3ID8 A;  1D4X A;  3U4L A;  5JLH A;  2QWM A;  4BC2 A;  4NB4 A;  5BN8 A;  5BRH A;  2VCP A;  3SLC A;  1U2V A;  1DEJ A;  4WYB A;  2D0P A;  5EY4 A;  3VEW A;  3HZ6 A;  2GEM A;  3H1V X;  4IO8 A;  1K8K B;  2VYP A;  1NBW A;  4J8F A;  4BRO A;  1ZXO A;  2FSN A;  1TUU A;  4IXC A;  1C0F A;  1YXQ A;  1MA9 B;  5B8H A;  3MDQ A;  2EWS A;  2ZGZ A;  2QM1 A;  3CIP A;  3DJC A;  2E2O A;  1BA0 A;  2E1Y A;  1KAZ A;  2DPN A;  2YHY A;  3C7N A;  2IVP A;  2FXU A;  2Q0U A;  3F9M A;  2E8A A;  3O80 A;  4A61 A;  2IVN A;  4B9Q A;  3EL2 A;  4CBW A;  3AAR A;  4H0O A;  2CGJ A;  3A8Y A;  1WUA A;  1GLB G;  2A5X A;  4BR5 A;  3GL1 A;  3MK6 A;  2P9K A;  2UYT A;  1S22 A;  2FLO A;  4FWQ A;  4BQL A;  1X9J A;  5AFU A;  4BC5 A;  3CQX A;  2GUP A;  3MN7 A;  1NLV A;  4KBO A;  2ASM A;  3O08 A;  2NZT A;  4BRN A;  4H0Y B;  4IZ9 A;  4RCH A;  1R59 O;  3A0I X;  1E4F T;  2ZGY A;  3VEX A;  1BU6 O;  4K41 A;  4E1J A;  4BRP A;  5ADX A;  1X3M A;  2ASO A;  3B8A X;  1NGE A;  4L3Q A;  4M7X A;  5EX5 A;  5FPD A;  5LY3 A;  4M7Y A;  4DQ8 A;  3QFP A;  3LDO A;  3U9Z A;  4BR0 A;  4MLE A;  3C7N B;  3QML A;  2P9I A;  3D2E A;  3L0Q A;  5AZI A;  1T44 A;  3RSE B;  2Q97 A;  3JXU A;  1S3X A;  2J4R A;  3CJ9 A;  2ZF5 O;  3FZF A;  3WQU A;  3O8M A;  1BOT O;  3CHW A;  1BUP A;  3W0L A;  2P9K B;  1WOQ A;  1XQS C;  2V51 B;  5EXW A;  1NM1 A;  1OKJ A;  4H5T A;  4BR7 A;  1CZA N;  1HKG A;  2CGK A;  2E2N A;  1TYQ A;  3BF3 A;  4DHY A;  4WQ5 A;  1HKB A;  3J8A A;  2HMP A;  3KHY A;  3ENO A;  4H0T B;  4CJ7 A;  4XH5 A;  2QXL A;  1BA1 A;  3C0B A;  3MN6 A;  4FWM A;  1KAX A;  3LDP A;  2QWP A;  5KPR A;  1HPM A;  3EZW A;  4XH1 A;  4EAH D;  5EOY A;  3CER A;  3M1F A;  4BC4 A;  3HSC A;  2F9T A;  4FWK A;  2YJF A;  3WXJ A;  2E88 A;  2P9I B;  3WQT A;  5AZI B;  1HX1 A;  4BRL A;  2A6A A;  4CZK A;  2GWK A;  3DXM A;  4H0X B;  2QWL A;  1HKC A;  3I33 A;  2P9L A;  1GLL O;  2FF3 B;  1EQY A;  2GTD A;  2PBD A;  1RFQ A;  3MN9 A;  3H3N O;  4CZJ A;  4QS7 A;  4BRE A;  5E26 A;  4BRG A;  2QWQ A;  4YDU C;  3H6E A;  3CQY A;  1SQK A;  5BR9 A;  3WT0 A;  3H1Q A;  3ULE B;  5BRD A;  2HF4 A;  3ATV A;  4FO0 A;  3H3O B;  3FFK B;  1TYQ B;  2WUS A;  3LL3 A;  5EVZ A;  3WXL A;  3VF2 A;  2QWN A;  3ZEU A;  4CBU A;  1IG8 A;  2W41 A;  4B1V A;  4BRH A;  2D4W A;  5AR0 A;  4JNE A;  3SMS A;  2ZWH A;  1QHA A;  4CZM A;  1KXP A;  2A40 A;  1NGF A;  4EFH A;  4IWV A;  4LC9 B;  5KPT A;  4JD2 A;  1BO5 O;  3BP8 A;  4I6M A;  2P9U A;  5TKY A;  1GLD G;  4BRM A;  3ZX2 A;  5AQV A;  1C0G A;  2Q1N A;  2VWB A;  3BUZ B;  4FWS A;  3BF1 A;  4BR4 A;  4CZF A;  3UE5 A;  2A3Z A;  1Z6R A;  4JN4 A;  3O5B A;  2E2Q A;  4EHT A;  4RWT A;  2P9L B;  3FGU A;  1MDU B;  3CJB A;  4FPA A;  4H0P A;  3UB5 A;  3EN9 A;  3UKU A;  3VER A;  2Q31 A;  2FSK A;  2PAV A;  3DXK B;  3GDQ A;  5AQW A;  2E1Z A;  1NWK A;  3AAP A;  5JIC A;  2Q2R A;  3IFR A;  3FR0 A;  3ZEU B;  4NO7 A;  5BRF A;  2GEL A;  3VGL A;  4RTF D;  5F1X A;  3IDH A;  4WQ4 C;  1NGA A;  5KPZ A;  3MN5 A;  3WXK A;  1U2V B;  3HTV A;  4K43 A;  4PKG A;  3VPZ A;  3AAQ A;  4JD2 B;  4B1Y B;  2P9U B;  2BTF A;  2IVO A;  4BC3 A;  4H5R A;  4Y0W A;  3A5M C;  1ATN A;  3O6W A;  4ISG A;  4IJN A;  3MCP A;  3BEX A;  3QFU A;  3GG4 A;  4B1U B;  4CI6 A;  2P9P A;  1QQN A;  2V7Y A;  1Y64 A;  1IJJ A;  1NGI A;  5BN9 A;  3QBW A;  4CD3 A;  5BRE A;  4BRK A;  2A42 A;  4JAX A;  3CJA A;  3VEN A;  4H0V B;  1DKG D;  1RDW X;  3S41 A;  3P4I A;  4MO5 A;  4A62 A;  4C23 A;  3CJ7 A;  2YCH A;  4FL9 A;  3QBX A;  4FOI A;  4AM7 A;  3DAW A;  2QWR A;  5AQI A;  1TUY A;  2E20 A;  3EKU A;  3FZK A;  2HOE A;  2V7Z A;  1ATR A;  4BQZ A;  2CH6 A;  5F2R A;  1JCG A;  3LDQ A;  5BPL A;  2Q36 A;  4MO4 A;  3LM2 A;  2OAN A;  5E84 A;  5BPM A;  2P9P B;  4FWL A;  3U8X A;  1QQM A;  1YAG A;  3UKR A;  1QZ5 A;  3D2E B;  4CZH A;  1ESV A;  2AA4 A;  3TPQ A;  1NGC A;  2KHO A;  4B1Z A;  4Z94 A;  3W3D A;  5AFU H;  5AQM A;  3R8E A;  3VEO A;  4FSV A;  5AQY A;  3M3Z A;  4BG8 A;  1P8Z A;  5JMV A;  4QS9 A;  2YHW A;  3FE1 A;  2F9W A;  5AQZ A;  3CET A;  1LCU A;  4BR9 A;  5JLF A;  4HWI A;  2HF3 A;  5BPN A;  4PL7 A;  5ADX H;  3I8B A;  3HI0 A;  1Q18 A;  4PKI A;  4K42 A;  3SJH A;  1YUW A;  1NMD A;  4H5V A;  4HTL A;  5I9E B;  1E4G T;  5KQD A;  4H5N A;  5FPM A;  2QWO A;  2A41 A;  3IUC A;  3ATU A;  4K25 A;  3FZH A;  4EHU A;  5AZJ A;  2ASP A;  3OHR A;  4WQ5 C;  3EKS A;  2FSJ A;  3A5N C;  5AQF A;  3UKR B;  1NGB A;  3SK3 A;  3WEE A;  3VOV A;  2H3G X;  3HM8 A;  1U6Z A;  3DXM B;  1ZBS A;  4CD1 A;  4BRF A;  1JCF A;  1X3N A;  5AQX A;  4CZE A;  3O4W A;  1NGG A;  1SAZ A;  1Z05 A;  3D7E O;  1V4T A;  5AQO A;  4FPB A;  2BUP A;  3H45 C;  2Q0R A;  3AY9 A;  5LJW A;  3CJC A;  3CI5 A;  4A2A A;  4BRQ A;  4CZG A;  3VF4 A;  4XEI A;  4O5F A;  3G25 A;  4XH4 A;  1MWK A;  3VF6 A;  5AQP A;  1GLJ O;  4BGA A;  3A5O C;  4BVP A;  1NGJ A;  3M6G A;  1KAY A;  5AZJ B;  4I6M B;  1NGH A;  3RSE A;  1YVN A;  1GLE G;  1NGD A;  5AQL A;  2CH5 A;  3IMX A;  5AQQ A;  3WEE B;  1XC3 A;  3D2F A;  2D1K A;  3LDL A;  5AQS A;  3H46 O;  4FWN A;  3A5L C;  4H03 B;  3VGK A;  3VGM A;  2I7P A;  1GLF O;  2FF6 A;  3UKU B;  2GWJ A;  1DGK N;  3QIC A;  2CGL A;  3VES A;  4F9O A;  5AQJ A;  1LOT B;  5AQT A;  4BRA A;  4BRC A;  2IIR A;  4H5W A;  4DB3 A;  5AQN A;  3QDK A;  4JHD A;  4CZI A;  1RGI A;  1ZC6 A;  2AP1 A;  3VET A;  4M63 C;  5LJV A;  3O1W A;  2P9N A;  4ISF A;  4QS8 A;  2NRH A;  3VEV A;  3ZX3 A;  3CJ1 A;  3QB0 A;  2QW9 A;  3GBT A;  4YDU A;  4A2B A;  4BGB A;  4CZL A;  2E2P A;  4BRI A;  3L4I A;  1GLA G;  1XUP O;  2P9S A;  2ITM A;  1QQO A;  3MMV A;  4GY2 B;  4BG9 A;  2W40 A;  3D2F B;  3VEY A;  4PKH A;  3ZET A;  3WXI A;  4AM6 A;  3DWL A;  5AQU A;  5CE3 A;  3L6Q A;  3O1B A;  4FOE A;  3ULE A;  1G99 A;  4B1W B;  5AQR A;  2D0O A;  5AQG A;  3LDN A;  3VEZ A;  2YJE A;  5F0X A;  1BWF O;  1BG3 A;  1HLU A;  1HJO A;  4MLH A;  4FWO A;  4PL8 A;  3U9D A;  4JHD B;  1T6D A;  4BRD A;  3JS6 A;  3TU5 A;  3FLC O;  3WUH A;  4BVO A;  4FWR A;  1K8K A;  3FZM A;  4FWP A;  2NLX A;  2P9N B;  3ENH A;  1J6Z A;  1MWM A;  4B1X B;  1JCE A;  4CBX A;  5AQK A;  3R9P A;  3FZL A;  2YI1 A;  5KQ8 A;  2I7N A;  3R6M A;  3HBT A;  4O8K A;  3GE1 A;  5ELZ A;  5FPN A;  3LM9 A;  2P9S B;  5AQH A; 
#chains in the Genus database with same CATH topology
 1BDG A;  4LF9 K;  4IFY A;  4CIE A;  4AHU A;  2PYL A;  1QZ6 A;  5FPE A;  3RMD A;  2V52 B;  3WNE A;  3OYL A;  1V4S A;  3DXK A;  1ATS A;  1BHL A;  4B8C A;  2HHQ A;  4DCH A;  1JLE A;  2W42 A;  3HOS A;  1BQM A;  4KTW A;  3AO1 A;  3S3N A;  1XHZ A;  1U2V A;  1DEJ A;  3P5J A;  3CC7 N;  3H1V X;  1S1T A;  1OH6 A;  4IEI A;  1QQC A;  4OPJ A;  2GBZ A;  4BRO A;  3QET A;  1NKC A;  4E1N A;  3OS0 A;  1TUU A;  4IXC A;  3SPZ A;  1C0F A;  4M3X A;  2PZS A;  3BGR A;  3OYD A;  3DJC A;  1NJX A;  3TTD A;  2RPI A;  2E1Y A;  2DPN A;  2Q0U A;  5LMU K;  4CE9 A;  4B9Q A;  3EL2 A;  3PIO L;  4CEF A;  1WSJ A;  4FK4 A;  1GOC A;  5DK5 A;  3OA9 A;  3P1G A;  3VA3 A;  2HNY A;  1RT5 A;  4YNQ A;  3N4Q A;  1U47 A;  2IC3 A;  1X9J A;  5GIN A;  1TGO A;  1TKT A;  4BC5 A;  3TSU A;  4KBO A;  3D0P A;  2DFH A;  3TAG A;  3O08 A;  4TSX A;  2NZT A;  4B3T K;  4FCY A;  3IAY A;  4ELV A;  1BQN A;  1ZBU A;  2VG7 A;  4IZ9 A;  1R59 O;  4IFV A;  2ZGY A;  2O8F B;  1S1V A;  3VEX A;  1CXQ A;  1BU6 O;  4BRP A;  1JKH A;  1X3M A;  2ASO A;  3B8A X;  5J2P A;  5FPD A;  4FLY A;  4JK9 A;  3LDO A;  2FBY A;  4G1Q A;  4MLE A;  1WBD A;  3C7N B;  3VQ4 A;  1VSI A;  3D2E A;  1T44 A;  5GAD P;  4OGE A;  2O8B A;  4DSE A;  1IBM K;  1VSL A;  4CHQ A;  1YJN N;  3HP6 A;  1JLQ A;  4HVJ A;  3NMU A;  3O8M A;  2YHA A;  1TV6 A;  1LW0 A;  2RN2 A;  4DLG A;  1QTM A;  2P9K B;  3TSP A;  4DTM A;  3CM6 A;  5EXW A;  4OLA A;  2CGK A;  3OYN A;  4FJ5 A;  4DUY K;  3ZSZ A;  1XMQ K;  1TYQ A;  3BF3 A;  3CD6 N;  3PSF A;  4WQ5 A;  2G8K A;  3F2K A;  1X1P A;  1J54 A;  2HMP A;  4XH5 A;  1RT2 A;  2UXC K;  1KAX A;  4CJK A;  3VQ8 A;  2QWP A;  1HPM A;  3CER A;  4BC4 A;  5K14 A;  1U4B A;  1VQ6 N;  3OJU A;  2F9T A;  4BDP A;  3O9S A;  4NLB A;  2P9I B;  3E9P A;  3OY9 A;  1L3U A;  4ELU A;  4F3O A;  1S6Q A;  3CF5 L;  2KZM A;  1HX1 A;  5JS1 A;  2FC0 A;  3J7A P;  3J80 O;  2GWK A;  3SUN A;  4AQY K;  1LV5 A;  1NKB A;  1WN7 A;  3ZSW A;  1GLL O;  4CED A;  4A59 A;  4KHW A;  1C6V A;  1K6Y A;  1VHX A;  4IDK A;  5E26 A;  1NOZ A;  3BY5 A;  4CF1 A;  3PX0 A;  4YDU C;  5IWA K;  3CCL N;  1SQK A;  3WT0 A;  3H1Q A;  3O4N A;  3NF6 A;  4YOV A;  1TAU A;  4FO0 A;  3H3O B;  3O9U A;  3AO3 A;  5EVZ A;  2EHG A;  3VF2 A;  3VA0 A;  4CBU A;  1D8Y A;  4DFP A;  4GKJ K;  1HNI A;  3TAF A;  4FJN A;  3SMS A;  1UA1 A;  3P31 A;  1NGF A;  2A40 A;  3O9R A;  4FJK A;  4A5A A;  2C1G A;  1GLD G;  3KJV A;  2KQ2 A;  4JI5 K;  2XY6 A;  3BUZ B;  4CJU A;  4DTX A;  2FBT A;  4BR4 A;  5DM7 L;  3KLE A;  3S9H A;  2D0A A;  3O3H A;  1CLQ A;  3KKR A;  2NRZ A;  3O5B A;  4JKH A;  3AVG A;  4LF7 K;  3EN9 A;  3VER A;  1T8E A;  2PAV A;  4DSJ A;  2E1Z A;  1NWK A;  5JIC A;  2F8T A;  4JKB A;  2NRT A;  1Q86 O;  1FW6 A;  4CER A;  5BRF A;  2GEL A;  2G8F A;  4R79 A;  4MDA A;  1NGA A;  5KPZ A;  4GVM A;  3WXK A;  4EP5 A;  1HNX K;  4PKG A;  4BY9 C;  4B1Y B;  1RTJ A;  1I94 K;  4J2B A;  3L2W A;  4CJ4 A;  1JLC A;  3HJF A;  3J7Z O;  1XMO K;  1R0A A;  4Z4I A;  4IJN A;  4B1U B;  4MFB A;  3RVC A;  3ZSV A;  4IOA L;  1HMV A;  1NGI A;  4DR1 K;  1BI4 B;  3U6F A;  1TKX A;  5CY4 A;  3P4I A;  5KI6 A;  3ZT3 A;  4DSL A;  3O3F A;  3AVJ A;  4X64 K;  5AQI A;  3NHG A;  2V7Z A;  5C25 A;  4BQZ A;  1UWB A;  2NRX A;  4M3T A;  2YNI A;  4ICL A;  4H8K A;  2HHH K;  1JCG A;  2F4V K;  3LDQ A;  1N32 K;  1SKS A;  4MO4 A;  5HRP A;  4M42 A;  4OPA A;  3MEG A;  4FWL A;  3U8X A;  1QZ5 A;  4ILJ A;  3SZ2 A;  1XI1 A;  3W3D A;  4W5N A;  1JLB A;  1IH7 A;  3MXI A;  3THY A;  3CCS N;  1VSD A;  3TWH A;  1BGX T;  1P8Z A;  1A5W A;  5DMR A;  3DRR A;  3NGI A;  4FM0 A;  3OYG A;  4BR9 A;  1N5Y A;  5BPN A;  3VQP A;  3K5M A;  1XC9 A;  3PY8 A;  3HI0 A;  1Q18 A;  3DM2 A;  4BE0 A;  3SJH A;  3LAM A;  1NMD A;  4H5V A;  4ZHR A;  5I9E B;  4LY7 A;  3HPH A;  1LAW A;  3SAF A;  3DRS A;  4YOW A;  1WNS A;  3ATU A;  4K25 A;  3OTO K;  5HRO A;  2FSJ A;  2W6K A;  3A5N C;  1KQS M;  3SK3 A;  3CCM N;  1KVB A;  3O9Q A;  3HM8 A;  4LH5 A;  1S6P A;  4CEO A;  4JKC A;  1SKR A;  4Z4G A;  1X3N A;  5AQX A;  4CZE A;  1Z05 A;  3D7E O;  2DTU A;  3AA5 X;  1LWE A;  1ITG A;  4FPB A;  3H45 C;  1YJW N;  4E72 A;  2Z1G A;  2O8E B;  5T7B A;  3AY9 A;  5LJW A;  1RBV A;  1Y97 A;  4A2A A;  1VQN N;  4QCL A;  4BRQ A;  1RT7 A;  3TAE A;  2IGI A;  3THX B;  4KHN A;  4DG1 A;  4XEI A;  3HO1 A;  1LW2 A;  5AQP A;  3CFP A;  2O4G A;  4HCC A;  1YT3 A;  1Z25 A;  4I6M B;  3IRX A;  2O4I A;  4I2P A;  1OH8 A;  3K0S A;  5AQL A;  3WEE B;  3D2F A;  3L3V A;  4H03 B;  4JKD A;  2I7P A;  3JSM A;  1P90 A;  4CEZ A;  3SUP A;  1DLO A;  2VG6 A;  3V1R A;  3VES A;  1WSG A;  4F9O A;  4BRA A;  5KTQ A;  3CCJ N;  2IIR A;  3MEE A;  3AA4 A;  4DB3 A;  5JVH L;  2HVH A;  2ZD1 A;  3V6D A;  4IEE A;  2BDP A;  3THV A;  3VEV A;  3CJ1 A;  1CZ9 A;  3GBT A;  4DTN A;  4NYN A;  3RWU A;  4CFC A;  1GLA G;  2P9S A;  4GY2 B;  2O8D A;  1N6Q A;  3OYE A;  3VQC A;  3LP3 A;  4M3U A;  2Y1J A;  2P51 A;  3L6Q A;  4OPK A;  1TL3 A;  2Z1I A;  2UXD K;  1HYS A;  5AJ3 K;  4B1W B;  5AQG A;  3ULD A;  2KTQ A;  4FM1 A;  1ZBI A;  1BIS A;  1B92 A;  3K57 A;  4PL8 A;  4BWM A;  5CYQ A;  4JHD B;  4BRD A;  5BR8 K;  1NJW A;  3WUH A;  1FKO A;  2A1R A;  1K8K A;  3HP9 A;  4FWP A;  5M1O A;  3TR8 A;  2G8V A;  4CHY A;  4FLT A;  3DLG A;  5IT9 O;  4F4K A;  4QAG A;  4CHO A;  3R6M A;  3HBT A;  3H08 A;  3LM9 A;  3BZK A;  3ZT1 A;  2NRV A;  4CJE A;  3K5O A;  4E89 A;  1O13 A;  3EO3 A;  1B9D A;  4I7F A;  4DSI A;  3J7Y P;  1KFD A;  3GOI A;  4ISE A;  3VQ7 A;  4J2E A;  5EU7 A;  4H4O A;  3U4L A;  5JLH A;  3OS2 A;  4J2A A;  4BC2 A;  5BRH A;  5GIO A;  3AO4 A;  2VCP A;  3SLC A;  3E9O A;  5JVG L;  2D0P A;  3HZ6 A;  4R5P A;  3LPT A;  5C24 A;  4NCG A;  1SUQ A;  1ZXO A;  5I42 A;  4B3M K;  2FSN A;  3O3G A;  4Q5V A;  5B8H A;  2YNH A;  4YOR A;  1S5J A;  2ZGZ A;  3VQ9 A;  4E7J A;  5M1F A;  4HTU A;  3F9M A;  5M1K A;  1GLB G;  2A5X A;  4I9L A;  4E7K A;  1VQ7 N;  3GL1 A;  1SL0 A;  2UYT A;  1S22 A;  4N56 A;  4BQL A;  4FLU A;  4OVL A;  3AVC A;  3L3U A;  1NLV A;  3CMA N;  4B9N A;  2KLA A;  4KHU A;  5GIP A;  1BIZ A;  3LZI A;  4DR3 K;  4FVU A;  4FJX A;  3QIN A;  4E1J A;  3SQ0 A;  1Q7Y O;  3QNN A;  4FK2 A;  4M7X A;  5FRN A;  4M7Y A;  4DQ8 A;  3SQ1 A;  4C8O A;  3IS9 A;  3KTQ A;  3HK2 A;  2F96 A;  4O0J A;  3RSE B;  1VRU A;  2ZF5 O;  3FZF A;  2OTL N;  1ZBL A;  4AHV A;  1BOT O;  5CZ2 A;  1XQS C;  1NK0 A;  2V51 B;  1OKJ A;  4H5T A;  1ZYQ A;  5KRT A;  5HOO A;  1QSY A;  2JWK A;  4CJT A;  4DR7 K;  3J8A A;  3KHY A;  4UY8 O;  4FYD A;  5DM6 L;  3V9S A;  1VQ8 N;  4FWM A;  3MN6 A;  1KFS A;  3LDP A;  4DF8 A;  4CIF A;  1VSH A;  4EAH D;  5EOY A;  4PQU A;  1TAQ A;  1KLM A;  3M1F A;  2OPQ A;  4YFU A;  5CHI A;  1L3T A;  5JS2 A;  4XIU A;  3KIO A;  4FWK A;  4B9M A;  3CYG A;  3WXJ A;  4C8K A;  4KB0 A;  1YIT N;  4BRL A;  4CZK A;  5M1Q A;  3DXM A;  1YIJ N;  4BDZ A;  1HKC A;  3I33 A;  4DFJ A;  3QEV A;  2P9L A;  2GTD A;  3LZJ A;  1RFQ A;  3H3N O;  1HJR A;  4CZJ A;  4QS7 A;  2RE2 A;  4BRE A;  5J2M A;  4BRG A;  2OYQ A;  4U67 L;  3EY1 A;  1X9S A;  3E9L A;  2HF4 A;  4HHT A;  3ATV A;  5FRM A;  3A2F A;  3FFK B;  1TYQ B;  4CES A;  1X9M A;  3U3G A;  2QXF A;  1RBT A;  1TL1 A;  1W97 L;  2W41 A;  3G6E N;  4B1V A;  2D4W A;  5AR0 A;  3SBT A;  1REV A;  2ZWH A;  1QHA A;  4CZM A;  1KXP A;  3V9X A;  4KRF A;  4YOT A;  4JD2 A;  5GAE P;  3LAK A;  5TKY A;  4JI6 K;  4BRM A;  2B5J A;  5AQV A;  4CGG A;  2Q1N A;  3LAL A;  1VSF A;  1YTU A;  5HRN A;  1KTQ A;  1C0T A;  1RT4 A;  3G10 A;  3R1X A;  3HXM A;  1MDU B;  4Z4E A;  2HBK A;  3DOL A;  3UKU A;  2D5R A;  4NXM K;  3MED A;  3K5L A;  3ALY A;  4GV3 A;  5AQW A;  5HBM A;  4C1N I;  1RTH A;  2Q2R A;  3K5N A;  4DV7 K;  3IFR A;  4X62 K;  2HMI A;  5F1X A;  3VGL A;  3IDH A;  2OZM A;  4CFD A;  1N36 K;  3NE6 A;  4K43 A;  4CGH A;  1DTQ A;  4IG0 A;  3AAQ A;  4CIG A;  3PIP L;  4DTR A;  4V19 S;  4JS4 A;  2D0C A;  2IVO A;  3ITH A;  3O6W A;  3EZ5 A;  4JS5 A;  4CI6 A;  4DKW A;  1HYZ A;  2P9P A;  5C2F A;  1QQN A;  3SPY A;  5J2N A;  5C12 A;  2V7Y A;  1Y64 A;  3T7Z A;  2KW4 A;  1IJJ A;  4LF8 K;  4DS4 A;  1RBR A;  3QBW A;  5BRE A;  3OS1 A;  2X78 A;  2A42 A;  3KWI A;  1FXX A;  3S41 A;  1WSF A;  3TAM A;  4EZ9 A;  2B6A A;  4AF1 A;  4MO5 A;  4CJ5 A;  2C1I A;  4DQI A;  3QBX A;  3V9U A;  3KKS A;  2OZS A;  1HR0 K;  3T1A A;  3ZT0 A;  4Z4F A;  4E1M A;  3KLH A;  4KB1 A;  1TUY A;  3ZT4 A;  5C0Y A;  3T19 A;  3FZK A;  2HOE A;  4BEC A;  1NJI O;  3G4S N;  2OTJ N;  1VQO N;  3PO4 A;  1J9A A;  3OYJ A;  2IAJ A;  1O1W A;  5BPM A;  1TK8 A;  3VQQ A;  2P5G A;  1QQM A;  4YHH K;  3NGZ A;  1K73 O;  2HB5 A;  2WON A;  1RDU A;  3T69 A;  3QNO A;  2KHO A;  4Z94 A;  1RDA A;  1IKW A;  3V1Q A;  2QA4 N;  1QS4 A;  4BG8 A;  4KAZ A;  2YHW A;  2F9W A;  4DTP A;  4Z0U A;  5JLF A;  4B9U A;  2HF3 A;  4LFB K;  4IFE A;  3K9J A;  1KVC A;  4RG8 A;  4PKI A;  4K42 A;  1G15 A;  2QEX N;  4HTL A;  4PY5 A;  4CJ3 A;  4H5N A;  1KCF A;  5FPM A;  3I56 N;  3IUC A;  2OA8 A;  5AZJ A;  1HQU A;  3NFA A;  2VWJ A;  3OHR A;  4WQ5 C;  3NF9 A;  4OKJ A;  4DFK A;  4F8R A;  3KD1 E;  1EWQ A;  4BE7 B;  2XHB A;  3DLH A;  1L3V A;  4YY3 K;  1ZBS A;  3THY B;  1FK9 A;  4BRF A;  4FZY A;  4A5B A;  2YKM A;  1V4T A;  3OW2 M;  3DMJ A;  3T1H K;  1SL2 A;  3HPG A;  1X9W A;  3CJC A;  3CI5 A;  1IBL K;  4DTU A;  3SYZ A;  2O8F A;  1QVF M;  4CZG A;  2P5O A;  4ID5 A;  1RBU A;  5KRS A;  3S5T A;  4K0K K;  4BGA A;  2IOC A;  4I9Q A;  3M6G A;  3DRP A;  1KAY A;  1VSK A;  1NGH A;  4FZZ A;  1YVN A;  5KGW A;  1NGD A;  1UAX A;  4LFC K;  3F73 A;  2ZQB A;  1YJ9 N;  3H46 O;  4FWN A;  4W5R A;  3WXM B;  3AA2 A;  1HRH A;  3VGM A;  1NK4 A;  4B9S A;  3CPE A;  2A1S A;  2GWJ A;  3QIC A;  2CGL A;  1IO2 A;  2ZE2 A;  1XWL A;  3AGR A;  3T3F A;  2WFB A;  2I5J A;  1UOC A;  3Q7B A;  5AQN A;  3QDK A;  2G8U A;  2E5L K;  3NCI A;  1ZC6 A;  2AP1 A;  3RR8 A;  1VQM N;  3BZC A;  4ILH A;  4JKG B;  4KH5 A;  4KTZ A;  4DV0 K;  3ZX3 A;  4KKO A;  5SZT A;  3C6U A;  4DS5 A;  4DV4 K;  4Q0B A;  3DLE A;  3L4I A;  1XUP O;  4G9Z A;  1A5V A;  1QQO A;  3MMV A;  1S72 N;  4CGF A;  5SWM A;  3D2F B;  3SJJ A;  4PKH A;  3LP2 A;  3ZET A;  2R7Y A;  4RW7 A;  3TAN A;  3DWL A;  4CVN E;  5CE3 A;  4WCE L;  1JLA A;  2HHX A;  4PWD A;  4DMN A;  3RMA A;  2YJE A;  1VK0 A;  5F0X A;  3NAE A;  2VQF K;  1HJO A;  3V81 A;  4Z4C A;  4GVE A;  3PV8 A;  1VRT A;  2O8C A;  1T6D A;  1EO1 A;  3FLC O;  3C6T A;  4BVO A;  4O5B A;  3OYH A;  3K59 A;  1MU2 A;  3ENH A;  1J6Z A;  4B1X B;  2HHT A;  4CBX A;  3R9P A;  3FZL A;  4L8R B;  2XO7 A;  4O44 A;  3G71 N;  4AIL C;  3GE1 A;  2UUA K;  4B3O A;  2P9S B;  5AQH A;  3I0S A;  3ZYY X;  2O8D B;  2IS3 A;  3P83 D;  3AO2 A;  3S3O A;  4WQ4 A;  1H1V A;  1LAV A;  3SUO A;  4GNI A;  1XNR K;  2WC9 A;  3M8P A;  3CFO A;  4BR2 A;  3M8S A;  1IG9 A;  1QSL A;  3WNF A;  1HUX A;  3ZX0 A;  3KK7 A;  1U48 A;  1Q9X A;  4JYA K;  4A57 A;  3THW A;  4IJA A;  3VQA A;  1D4X A;  3RRG A;  2VGM A;  4YOY A;  4JI8 K;  3S3M A;  4EZ6 A;  4GV6 A;  2GEM A;  4IO8 A;  1K8K B;  2JLE A;  2VYP A;  1TKZ A;  4J8F A;  3VQD A;  3CC4 N;  4M3Z A;  4FM2 A;  1YXQ A;  3OYI A;  3MDQ A;  3TAR A;  4DSK A;  4NYF A;  2HBL A;  5C10 A;  3CIP A;  1Q82 O;  1BA0 A;  1U04 A;  3CME N;  1LWC A;  3PO5 A;  2E8A A;  3O80 A;  1IBK K;  1BI4 A;  3CXC M;  3C6A A;  3I0R A;  3AAR A;  4H0O A;  4DU3 A;  4KH6 A;  3A8Y A;  1RDC A;  4HUE A;  4BR5 A;  4ILG B;  1CXU A;  4J2D A;  1TVR A;  3OYB A;  1OH7 A;  4FWQ A;  2VGN A;  4CJF A;  5AFU A;  3CQX A;  5H1S Q;  2GUP A;  4O55 A;  3MN7 A;  4JRP A;  1L5U A;  1KSP A;  2ASM A;  4RW9 A;  1RIL A;  4E7H A;  5FRO A;  3A0I X;  2W00 A;  4PHT X;  4K41 A;  3NVM A;  4L3Q A;  2KFZ A;  3SQ2 A;  3QFP A;  3U9Z A;  4BR0 A;  3ZSR A;  4DV2 K;  3CG7 A;  3L0Q A;  4WE1 A;  5AZI A;  2Q97 A;  4CEA A;  1S3X A;  4I2Q A;  1NK8 A;  4FZX C;  2J4R A;  4FJJ A;  3SI6 A;  3DYA A;  1LWF A;  4DV3 K;  4DV6 K;  3QES A;  4DU4 A;  4WFB L;  3RMB A;  1BUP A;  4DV1 K;  4AH9 A;  3MWT A;  4KI4 A;  1NM1 A;  4MQ3 A;  4BR7 A;  2HNZ A;  3HPO A;  2HHI A;  1CZA N;  2AJQ A;  4JKE A;  4DQS A;  4JK7 A;  4CJ7 A;  3ENO A;  1W2B M;  2QXL A;  1BA1 A;  2DFE A;  1KRP A;  3C0B A;  1ASV A;  5KPR A;  3LDS A;  4XH1 A;  2KFN A;  3CCU N;  4OPH A;  3SAG A;  2E88 A;  1QE1 A;  3WQT A;  1U45 A;  4CK2 A;  2A6A A;  1ILY A;  2HW3 A;  3SV3 A;  1C1B A;  3RMC A;  2P1J A;  4H0X B;  4IKF A;  3KK3 A;  1YVU A;  3VQE A;  4CF9 A;  4F2S A;  2YX6 A;  2PBD A;  3TI0 A;  3AVF A;  2BGG A;  1XNQ K;  4KHY A;  3H6E A;  3CQY A;  1QVG M;  1FJG K;  3ULE B;  3KK2 A;  4DR6 K;  1D5A A;  4Z4H A;  2HVI A;  4KPY A;  4KHS A;  3ZEU A;  4ID1 A;  3THX A;  1S9E A;  4NCB A;  2RHK A;  3C95 A;  3ISN C;  4EFH A;  3PUF A;  3AVN A;  3VMF B;  1BO5 O;  2QI2 A;  4I6M A;  2P9U A;  4IG3 A;  1M90 O;  3ZX2 A;  1JL2 A;  4FWS A;  1WBB A;  4CZF A;  2Y1I A;  3UE5 A;  5HRR A;  1Z6R A;  4CJQ A;  3VQB A;  1TK0 A;  4RWT A;  2P9L B;  3KLG A;  4FPA A;  4YOU A;  3K2P A;  2OCE A;  4DLE A;  2UU9 K;  1RDB A;  4X65 K;  1A5X A;  1NOY A;  4GMJ B;  2FBX A;  2FSK A;  3GDQ A;  3DXK B;  3OBY A;  4CEE A;  1OH5 A;  4AHR A;  1JLG A;  4DQP A;  3ID6 A;  3HM9 A;  4NO7 A;  4RTF D;  3MX5 A;  4K8X A;  4WFA L;  5HLF A;  1U2V B;  3HTV A;  2GUI A;  4FJI A;  3SQ4 A;  4AHS A;  4KHP K;  4NCA A;  4OGC A;  4JD2 B;  3TAB A;  3FFI A;  2DFF A;  4LSL A;  4BC3 A;  3B6P A;  4IO9 L;  3OYK A;  4H5R A;  2VG5 A;  4Y0W A;  3A5M C;  4CJL A;  5JEN A;  3LP1 A;  3CC2 N;  4M45 A;  4X66 K;  4B9T A;  1N33 K;  1DT9 A;  5BN9 A;  3SBG A;  1WSI A;  4K8Z A;  4DFM A;  4A62 A;  3SUQ A;  3CJ7 A;  2YCH A;  4FL9 A;  3MXM A;  3TTF A;  3DAW A;  1DTT A;  3QO9 A;  1NKE A;  4PA1 A;  2E20 A;  3EKU A;  4FK0 A;  3QEP A;  1W0H A;  2YHB A;  1ATR A;  5KGX A;  1IV0 A;  4LF6 K;  2DY4 A;  2QKK A;  3M8Q A;  4QOZ B;  1KLN A;  1ZBH A;  2OPS A;  3LAN A;  2BE2 A;  5F2R A;  4N47 A;  4CHP A;  3E01 A;  3RRH A;  3QIP A;  2Q36 A;  1WAF A;  1HYV A;  3LM2 A;  2P9P B;  3ZLJ A;  1YAG A;  4OJR A;  3HRG A;  2XY5 A;  3UKR A;  3D2E B;  4CZH A;  2AA4 A;  3P38 A;  1U49 A;  1NGC A;  3LPU A;  4KHQ A;  2O8B B;  1VSJ A;  3CYM A;  5AFU H;  5AQM A;  4WFN L;  3R8E A;  3VEO A;  4FSV A;  4U7B A;  3L2U A;  4QS9 A;  4BDY A;  3CET A;  3NH0 A;  3ZSO A;  2PYJ A;  3AA3 A;  4FW2 A;  4HWI A;  3BDP A;  4LF5 K;  1E3M A;  3I8B A;  5LL6 Z;  4GKK K;  4FLW A;  1YUW A;  3NH2 A;  2QWO A;  3CPW M;  4KTQ A;  4H4M A;  4N41 A;  1WLJ A;  2HHS A;  3EKS A;  2H3G X;  1U6Z A;  3ENB A;  3I55 N;  2WTU A;  4BEB A;  4CD1 A;  2JWL A;  3QLH A;  3O4W A;  1NGG A;  1SAZ A;  2OPP A;  4FJL A;  5AQO A;  1C1C A;  2BUP A;  3ZCM A;  4DUZ K;  1NG9 A;  3AVB A;  3NGY A;  5HL7 L;  4KFB A;  2LSN A;  3WNH A;  4O5F A;  4XH4 A;  1MWK A;  1GLJ O;  2HBM A;  1HNW K;  1NGJ A;  5AZJ B;  4JI4 K;  3L2Q A;  4B3S K;  3RSE A;  4E0D A;  3AV9 A;  1GLE G;  4CF8 A;  3SV4 A;  2CH5 A;  5GAH P;  5AQQ A;  4CJV A;  1XC3 A;  5AQS A;  5C15 A;  1YHQ N;  4LSN A;  4CEQ A;  1GLF O;  3KWG A;  1DGK N;  5J1E A;  4DF4 A;  4C8N A;  5AQT A;  3C6H A;  4BRC A;  1K9M O;  3ZSQ A;  5HP1 A;  3IKM A;  4CZI A;  1B9F A;  4M41 A;  1RGI A;  4DTS A;  3QEX A;  3VET A;  3O1W A;  2P9N A;  1Q8I A;  2RKI A;  4JRQ A;  1NK7 A;  2NRH A;  4NLC A;  4IOX A;  5FDL A;  2UUB K;  4HCB A;  2QW9 A;  3EE9 A;  4YDU A;  4B8A B;  1NJZ A;  2Z1H A;  3E66 A;  4CZL A;  4JI0 K;  2E2P A;  3D6R A;  4BRI A;  4XJX A;  1VQP N;  5TKW A;  4O8U A;  3NVK A;  1EXQ A;  2W40 A;  1I3A A;  3VEY A;  3WXI A;  5AQU A;  4FOE A;  1G99 A;  4Y1C A;  1OVQ A;  4O4G A;  5AQR A;  3LDN A;  4DQQ A;  1IKY A;  1S1W A;  1BWF O;  1HLU A;  4CEC A;  2BAN A;  2E4L A;  3U9D A;  4M3W A;  4B08 A;  4ELT A;  1S1X A;  2NRR A;  4W5Q A;  1UA0 A;  2OPR A;  3JS6 A;  1JLF A;  4FWR A;  3FZM A;  3KD5 E;  1D9F A;  1SS6 A;  3DLB A;  1JCE A;  5FLX O;  1YF5 L;  4FLZ A;  2YI1 A;  3C94 A;  5FPN A;  4AHC A;  1NK5 A;  3HVT A;  1T05 A;  2G8H A;  3KVG A;  3TTC A;  3LP0 A;  3ZET B;  1S1U A;  3SMP A;  1N8R O;  3CCE N;  1GLC G;  1J5O A;  2YHX A;  1XHX A;  4EIA A;  1T6C A;  3UIQ A;  1SZ2 A;  2HBJ A;  3KZB A;  1VSE A;  3ID8 A;  2QWM A;  4KRE A;  4NB4 A;  5BN8 A;  4CF0 A;  4O0I A;  2NRW A;  4CGD A;  2O8C B;  4WYB A;  5EY4 A;  1ASW A;  3VEW A;  3Q7C A;  4DU1 A;  1NBW A;  4OX9 K;  3VN5 A;  3HT3 A;  4DR2 K;  1VQ4 N;  1OVY A;  1MA9 B;  2EWS A;  3SNN A;  3QEW A;  3C65 A;  1KD1 O;  2QM1 A;  2E2O A;  1KAZ A;  2YHY A;  2IVP A;  3C7N A;  1JXB A;  2FXU A;  4LH4 A;  2HST A;  4A61 A;  2IVN A;  4CBW A;  1SV5 A;  1K8A O;  1C0M A;  2CGJ A;  1WUA A;  4CK1 A;  4KI6 A;  1S9G A;  3O4Q A;  3O9T A;  3V1O A;  3HYF A;  3THW B;  3MK6 A;  2P9K A;  4FJH A;  2FLO A;  4BE1 A;  4FJG A;  4CEB A;  2ZJP L;  4CJS A;  4FLX A;  5C42 A;  2PFU A;  3KK1 A;  4WF9 L;  4E7I A;  3AVI A;  2YNF A;  4BRN A;  4H0Y B;  4RCH A;  4E3S A;  2VWK A;  1E4F T;  5ADX A;  3OYC A;  3OYF A;  1NGE A;  5EX5 A;  5LY3 A;  2NNW A;  4BAC A;  1T03 A;  3OBW A;  3QML A;  2P9I A;  4C8M A;  1IKX A;  3JXU A;  4CFB A;  4GW6 A;  3TSQ A;  3CJ9 A;  4HUF A;  3WQU A;  3VTI A;  3MCA B;  3CHW A;  5I3U A;  3W0L A;  3G0Z A;  1WOQ A;  3HL8 A;  4DQR A;  2ETJ A;  3D45 A;  1RDD A;  1HKG A;  4LF4 K;  2YNG A;  1WSE A;  2E2N A;  4DHY A;  1NMN A;  1RBS A;  1HKB A;  1EET A;  4H0T B;  3DLR A;  4EP4 A;  3MWP A;  3CCR N;  2XY8 A;  4LD0 A;  3EZW A;  4IDH A;  3L2R A;  5CYM A;  3HSC A;  5LMN K;  3ZSX A;  5M1N A;  3L4Q A;  2YJF A;  1L3S A;  5AZI B;  5D3G A;  3V4I A;  3K58 A;  3OYM A;  3QER A;  4RW6 A;  2QWL A;  3ASM A;  2FF3 B;  1EQY A;  1RNH A;  3MN9 A;  2XY7 A;  3U3Y A;  2G8I A;  1NJY A;  1W7A A;  5J2Q A;  2QK9 A;  2QWQ A;  2D0B A;  1KC8 O;  1RT3 A;  2E6L A;  5BR9 A;  5BRD A;  1C1A A;  1HNZ K;  3VQ6 A;  2WUS A;  3LL3 A;  3WXL A;  2QWN A;  1IG8 A;  4N5S A;  1Q9Y A;  1BIU A;  4BRH A;  1HNV A;  3J81 O;  4JNE A;  4IWV A;  4LC9 B;  4HUG A;  4DTJ A;  3DI6 A;  5KPT A;  4CFA A;  1WB9 A;  3BP8 A;  1C0G A;  2VWB A;  1T7P A;  4JI7 K;  1BL3 A;  3B6O A;  3BF1 A;  3VTH A;  4PUO A;  5M1P A;  4CHZ A;  4FJ8 A;  2KZZ A;  3WNG A;  4ZTF A;  2WOM A;  1VQK N;  3N4P A;  2A3Z A;  4JN4 A;  2E2Q A;  4EHT A;  3FGU A;  3CJB A;  4H0P A;  3KLF A;  3KLI A;  3UB5 A;  1J5E K;  4GV9 A;  4Y1D A;  3EE8 A;  4DSF A;  2Q31 A;  3AVL A;  3MEC A;  4JI1 K;  2WBN A;  4CK3 A;  3DLL L;  3AAP A;  1BCM A;  3I8D A;  4B9L A;  3FR0 A;  3PX4 A;  1VQ5 N;  2X6N A;  3ZEU B;  1TK5 A;  3QIO A;  4WQ4 C;  1M1K O;  3MN5 A;  4M3Y A;  4JKG A;  2KKZ A;  2FBV A;  3VPZ A;  5GAG P;  3CCQ N;  5HRS A;  3VQ5 A;  2P9U B;  2BTF A;  1NK9 A;  3EEQ A;  3T1Y K;  2X6S A;  1ATN A;  1GOA A;  5CZ1 A;  4ISG A;  3AGK A;  3MCP A;  3BEX A;  2XRI A;  3AVM A;  3GG4 A;  3QFU A;  1VQL N;  1BCO A;  2JGU A;  3OJS A;  4KV8 A;  2QTD A;  4AHT A;  1EWR A;  4CD3 A;  4BRK A;  4JAX A;  3CJA A;  3VEN A;  4B9V A;  3OYA A;  1RCH A;  4OKE A;  4H0V B;  1VSM A;  1DKG D;  1RDW X;  4E19 A;  3L2V A;  4NXN K;  4IBN A;  3ZT2 A;  2F8S A;  4C23 A;  3F9K A;  2ATQ A;  3NH1 A;  4FOI A;  4LFA K;  4AM7 A;  2QWR A;  3PSI A;  4FJ7 A;  3K9K A;  1I39 A;  2HHU A;  4DV5 K;  3SAH A;  2CH6 A;  2Q3S A;  3M5R A;  1Z26 A;  5E41 A;  1ASU A;  1QSS A;  5BPL A;  2OAN A;  5E84 A;  4FJM A;  2ZJQ L;  1RTI A;  4IOC L;  1ESV A;  3TPQ A;  4B1Z A;  3LWL A;  1EX4 A;  4CJR A;  3TAQ A;  3P39 A;  1N34 K;  2BH1 A;  4B3R K;  5AQY A;  3M3Z A;  4CHN A;  5JMV A;  1QHT A;  2YV0 X;  3FE1 A;  4CCH A;  5AQZ A;  1LCU A;  2O8E A;  5CR4 A;  2HND A;  1YI2 N;  4W5T A;  1HPZ A;  4PL7 A;  4C1N K;  5ADX H;  3MX2 A;  1SL1 A;  3LWM A;  4OLB A;  2QKB A;  1W9H A;  4RW8 A;  5KQD A;  1E4G T;  1IKV A;  2IDO A;  2W6L A;  1RT1 A;  2A41 A;  1KVA A;  4DTO A;  1EKE A;  3M8R A;  1WSH A;  3FZH A;  4EHU A;  1VQ9 N;  4JI3 K;  2F7T A;  2ASP A;  3NF8 A;  3F5T A;  5AQF A;  4DR5 K;  3UKR B;  4JKF A;  1NGB A;  3WEE A;  3VOV A;  3TAP A;  3DXM B;  1JCF A;  5MLC Q;  5A2Q O;  4CGJ A;  1VAZ A;  3NF7 A;  2G8W A;  1C0U A;  2Q0R A;  3V9W A;  2YKN A;  3DOK A;  2RF2 A;  4DWI A;  4CJP A;  4F2R A;  4E7L A;  3NDK A;  4FW1 A;  3VF4 A;  4FVM A;  3RTV A;  2HHV A;  1RTD A;  3AVK A;  4JI2 K;  3G25 A;  1RT6 A;  3VF6 A;  1NK6 A;  3A5O C;  4BVP A;  4UQG A;  4BWJ A;  4OKK A;  1YTA A;  3IMX A;  2ITG A;  3HOT A;  2NUB A;  3NBP A;  2D1K A;  3LDL A;  3ZSY A;  4DR4 K;  3A5L C;  3VGK A;  3PLA A;  4CW7 B;  4M3R A;  2FF6 A;  3UKU B;  4C8L A;  3AVA A;  1GOB A;  2B4J A;  2E6M A;  3MAQ A;  5AQJ A;  1LOT B;  2HHW A;  4W5O A;  3R3L A;  4H5W A;  4JHD A;  2GX9 A;  4JLH A;  1CZB A;  3SCX A;  1TKD A;  4F3T A;  1HQE A;  3DLK A;  3JAM O;  4M63 C;  5LJV A;  4FLV A;  3L8B A;  4ISF A;  4QS8 A;  4FXD A;  3JYT A;  3HST B;  3QB0 A;  1Q81 O;  3HVR A;  4JK8 A;  4A2B A;  4BGB A;  3IG1 A;  3QEI A;  1T3V A;  4JV5 K;  4MDB A;  2ITM A;  5C2D A;  4CGI A;  1NU0 A;  4BG9 A;  2Z1J A;  3MXJ A;  3CQ8 A;  4YOX A;  3CM5 A;  4FJ9 A;  1JJ2 M;  3EYZ A;  3CFR A;  1D9D A;  4JKA A;  4AM6 A;  4BE2 A;  3O1B A;  1J53 A;  3ULE A;  4RW4 A;  3RR7 A;  2D0O A;  4OO1 J;  3VEZ A;  4JEP A;  1BG3 A;  4MLH A;  4FWO A;  3OVN A;  2UUC K;  1F21 A;  3PX6 A;  2EX3 A;  3V9Z A;  1FKP A;  3E1Y A;  1SKW A;  3TU5 A;  3AVH A;  3AO5 A;  2ZM6 K;  2PY5 A;  2NLX A;  2P9N B;  4CJW A;  2VQE K;  1ZBF A;  1MWM A;  3CCV N;  4KH4 A;  4CF2 A;  5AQK A;  2ZJR L;  2UXB K;  4KO0 A;  2X74 A;  5KQ8 A;  1NNE A;  4ZTJ A;  2GV9 A;  1JL1 A;  2I7N A;  4O8K A;  5ELZ A;  4N76 A;  1JXE A;  1WAJ A;  1EP4 A; 
#chains in the Genus database with same CATH homology
 1BDG A;  3ZYY X;  3KVG A;  3TTC A;  2NRV A;  3ZET B;  3SMP A;  1O13 A;  4WQ4 A;  1H1V A;  1QZ6 A;  1GLC G;  5FPE A;  2V52 B;  1N8R O;  3CCE N;  3EO3 A;  4GNI A;  2WC9 A;  4BR2 A;  1V4S A;  3DXK A;  1ATS A;  2YHX A;  3GOI A;  4ISE A;  4EIA A;  1HUX A;  1T6C A;  3ZX0 A;  4DCH A;  1SZ2 A;  2HBJ A;  3KK7 A;  3KZB A;  4A57 A;  4IJA A;  3ID8 A;  1D4X A;  3U4L A;  5JLH A;  3HOS A;  2QWM A;  4BC2 A;  2VGM A;  4NB4 A;  5BN8 A;  5BRH A;  5GIO A;  2VCP A;  3SLC A;  4YOY A;  1U2V A;  1DEJ A;  2NRW A;  3E9O A;  5JVG L;  4GV6 A;  4WYB A;  2D0P A;  5EY4 A;  3VEW A;  3HZ6 A;  2GEM A;  3Q7C A;  3H1V X;  3CC7 N;  4IO8 A;  1K8K B;  4IEI A;  2VYP A;  1NBW A;  4J8F A;  4BRO A;  1VQ4 N;  1OVY A;  1ZXO A;  3CC4 N;  2FSN A;  1TUU A;  4IXC A;  1C0F A;  1YXQ A;  1MA9 B;  5B8H A;  3MDQ A;  2EWS A;  4YOR A;  3C65 A;  2HBL A;  5C10 A;  2ZGZ A;  2QM1 A;  3CIP A;  3DJC A;  2E2O A;  1Q82 O;  1KD1 O;  3TTD A;  1BA0 A;  2E1Y A;  3CME N;  1KAZ A;  2DPN A;  2YHY A;  2IVP A;  3C7N A;  2FXU A;  2Q0U A;  5M1F A;  3F9M A;  2HST A;  2E8A A;  3O80 A;  4A61 A;  2IVN A;  4B9Q A;  3EL2 A;  3C6A A;  3CXC M;  4CBW A;  1K8A O;  3AAR A;  4H0O A;  5M1K A;  3PIO L;  2CGJ A;  4KH6 A;  3A8Y A;  1WUA A;  1GLB G;  2A5X A;  4BR5 A;  3OA9 A;  4ILG B;  1VQ7 N;  3GL1 A;  3O9T A;  3MK6 A;  2P9K A;  2UYT A;  1S22 A;  2FLO A;  3N4Q A;  4FWQ A;  2ZJP L;  4BQL A;  1X9J A;  2VGN A;  4CZH A;  5GIN A;  5AFU A;  2PFU A;  3CQX A;  4BC5 A;  2GUP A;  5H1S Q;  3MN7 A;  3TSU A;  1NLV A;  4KBO A;  4WF9 L;  2KLA A;  3CMA N;  2ASM A;  5GIP A;  3O08 A;  2NZT A;  4BRN A;  4FVU A;  4H0Y B;  4IZ9 A;  4RCH A;  1R59 O;  3A0I X;  2W00 A;  1E4F T;  2ZGY A;  4PHT X;  3VEX A;  1BU6 O;  4K41 A;  4E1J A;  4BRP A;  5ADX A;  1Q7Y O;  1X3M A;  2ASO A;  3B8A X;  1NGE A;  3NVM A;  4L3Q A;  4M7X A;  5EX5 A;  5FPD A;  5LY3 A;  4M7Y A;  2NNW A;  4JK9 A;  3QFP A;  4DQ8 A;  3LDO A;  3U9Z A;  4BR0 A;  4MLE A;  3C7N B;  3OBW A;  3QML A;  2P9I A;  3D2E A;  3L0Q A;  5AZI A;  1T44 A;  3RSE B;  5GAD P;  2Q97 A;  3JXU A;  1S3X A;  2J4R A;  3TSQ A;  3CJ9 A;  2ZF5 O;  3FZF A;  1YJN N;  2OTL N;  3WQU A;  3NMU A;  3O8M A;  3MCA B;  3VTI A;  1BOT O;  4WFB L;  3CHW A;  1BUP A;  3W0L A;  2P9K B;  3MWT A;  3TSP A;  1WOQ A;  1XQS C;  2V51 B;  5EXW A;  1NM1 A;  1OKJ A;  4H5T A;  4BR7 A;  1CZA N;  5HOO A;  1HKG A;  2CGK A;  2JWK A;  2E2N A;  1TYQ A;  3BF3 A;  4DHY A;  4JKE A;  3CD6 N;  4WQ5 A;  3F2K A;  4JK7 A;  1HKB A;  3J8A A;  2HMP A;  3KHY A;  3ENO A;  4H0T B;  4CJ7 A;  5DM6 L;  4XH5 A;  1W2B M;  2QXL A;  1BA1 A;  1VQ8 N;  3C0B A;  3MN6 A;  4FWM A;  1KAX A;  3LDP A;  2QWP A;  3MWP A;  5KPR A;  1HPM A;  3CCR N;  3EZW A;  4XH1 A;  4EAH D;  4IDH A;  3CER A;  5EOY A;  3M1F A;  4BC4 A;  1VQ6 N;  5CHI A;  3HSC A;  2F9T A;  5M1N A;  3L4Q A;  4FWK A;  4OPH A;  2YJF A;  3SAG A;  3WXJ A;  2E88 A;  3CCU N;  3O9S A;  4NLB A;  2P9I B;  3E9P A;  1YIT N;  3WQT A;  3CF5 L;  5AZI B;  1HX1 A;  4BRL A;  2A6A A;  4CZK A;  2GWK A;  1ILY A;  5M1Q A;  3DXM A;  1YIJ N;  4H0X B;  2QWL A;  1HKC A;  3I33 A;  2P9L A;  1GLL O;  2FF3 B;  1EQY A;  2GTD A;  2PBD A;  1RFQ A;  2YX6 A;  3H3N O;  3MN9 A;  4A59 A;  4CZJ A;  4QS7 A;  2RE2 A;  4BRE A;  5E26 A;  4BRG A;  2QWQ A;  4U67 L;  4YDU C;  3H6E A;  3CQY A;  1KC8 O;  1QVG M;  1SQK A;  3CCL N;  5BR9 A;  3WT0 A;  3H1Q A;  3ULE B;  3E9L A;  2HF4 A;  5BRD A;  3ATV A;  4YOV A;  4FO0 A;  3H3O B;  3FFK B;  1TYQ B;  2WUS A;  3LL3 A;  3O9U A;  5EVZ A;  3WXL A;  3VF2 A;  2QWN A;  3ZEU A;  1W97 L;  4CBU A;  1IG8 A;  2W41 A;  3G6E N;  4B1V A;  4BRH A;  2RHK A;  2D4W A;  5AR0 A;  4JNE A;  3SBT A;  3SMS A;  2ZWH A;  1QHA A;  4CZM A;  3P31 A;  1KXP A;  2A40 A;  1NGF A;  4EFH A;  4IWV A;  4LC9 B;  5KPT A;  3O9R A;  4YOT A;  4JD2 A;  4A5A A;  2C1G A;  3VMF B;  1BO5 O;  2QI2 A;  3BP8 A;  2P9U A;  4I6M A;  1GLD G;  5TKY A;  3ZX2 A;  5AQV A;  4BRM A;  5GAE P;  1C0G A;  2Q1N A;  2VWB A;  3BUZ B;  4FWS A;  3VTH A;  3BF1 A;  5M1P A;  4BR4 A;  4CZF A;  3UE5 A;  5DM7 L;  1VQK N;  3N4P A;  2A3Z A;  1Z6R A;  2NRZ A;  4JN4 A;  3O5B A;  2E2Q A;  3R1X A;  4JKH A;  4EHT A;  4RWT A;  2P9L B;  3FGU A;  1MDU B;  3CJB A;  4FPA A;  4YOU A;  4H0P A;  2HBK A;  3UB5 A;  3EN9 A;  3UKU A;  3VER A;  4GV9 A;  3EE8 A;  2Q31 A;  2FSK A;  2PAV A;  3DXK B;  3GDQ A;  3OBY A;  4GV3 A;  5AQW A;  2WBN A;  4C1N I;  3DLL L;  2E1Z A;  1NWK A;  3AAP A;  5JIC A;  2Q2R A;  3IFR A;  3ID6 A;  3FR0 A;  4JKB A;  2NRT A;  1Q86 O;  1VQ5 N;  3ZEU B;  4NO7 A;  5BRF A;  2GEL A;  3VGL A;  4RTF D;  5F1X A;  3MX5 A;  4MDA A;  3IDH A;  4WQ4 C;  4R79 A;  1NGA A;  5KPZ A;  1M1K O;  4UY8 O;  3MN5 A;  3WXK A;  4WFA L;  1U2V B;  3HTV A;  4K43 A;  4JKG A;  4PKG A;  2KKZ A;  3VPZ A;  5GAG P;  3AAQ A;  3CCQ N;  3PIP L;  4JD2 B;  4BY9 C;  4B1Y B;  2P9U B;  2BTF A;  2IVO A;  4BC3 A;  4IO9 L;  4H5R A;  4Y0W A;  3A5M C;  3J7Z O;  1ATN A;  3O6W A;  4ISG A;  4IJN A;  3AGK A;  3MCP A;  3BEX A;  3QFU A;  3GG4 A;  4B1U B;  4CI6 A;  4DKW A;  3CC2 N;  1VQL N;  2P9P A;  3RVC A;  5C2F A;  1QQN A;  4IOA L;  5C12 A;  2QTD A;  2V7Y A;  1Y64 A;  3T7Z A;  1IJJ A;  1DT9 A;  1NGI A;  5BN9 A;  3QBW A;  4CD3 A;  5BRE A;  4BRK A;  2A42 A;  4JAX A;  3CJA A;  3VEN A;  3SBG A;  4H0V B;  3KWI A;  1DKG D;  1RDW X;  3S41 A;  3P4I A;  4AF1 A;  4MO5 A;  4A62 A;  4C23 A;  3CJ7 A;  2YCH A;  4FL9 A;  2C1I A;  3QBX A;  4FOI A;  4AM7 A;  3TTF A;  3DAW A;  2QWR A;  5AQI A;  1TUY A;  3K9K A;  2E20 A;  3EKU A;  5C0Y A;  3FZK A;  2HOE A;  2V7Z A;  1ATR A;  3SAH A;  4BQZ A;  2NRX A;  4BEC A;  2CH6 A;  1NJI O;  3M5R A;  5F2R A;  3G4S N;  2OTJ N;  1VQO N;  1JCG A;  3LDQ A;  5BPL A;  2Q36 A;  4MO4 A;  3LM2 A;  2OAN A;  5E84 A;  5BPM A;  2P9P B;  4OPA A;  1M90 O;  4FWL A;  3U8X A;  1QQM A;  1YAG A;  2ZJQ L;  3HRG A;  1K73 O;  3UKR A;  1QZ5 A;  1RDU A;  3T69 A;  3D2E B;  4ILJ A;  1ESV A;  2AA4 A;  3P38 A;  1NGC A;  2KHO A;  3TPQ A;  4Z94 A;  3W3D A;  4B1Z A;  3P39 A;  5AFU H;  5AQM A;  2QA4 N;  4WFN L;  2BH1 A;  3R8E A;  3VEO A;  3CCS N;  4FSV A;  5AQY A;  3M3Z A;  4BG8 A;  1P8Z A;  5JMV A;  4U7B A;  4QS9 A;  2YHW A;  3FE1 A;  2F9W A;  5AQZ A;  3CET A;  1LCU A;  4BR9 A;  5JLF A;  5CR4 A;  4HWI A;  1YI2 N;  2HF3 A;  5BPN A;  4PL7 A;  4C1N K;  5ADX H;  3MX2 A;  3I8B A;  3HI0 A;  1Q18 A;  4IFE A;  3K9J A;  4PKI A;  4K42 A;  3SJH A;  1YUW A;  2QEX N;  1NMD A;  4H5V A;  4HTL A;  5I9E B;  1E4G T;  5KQD A;  4H5N A;  5FPM A;  2QWO A;  3CPW M;  3I56 N;  2A41 A;  3IUC A;  3SAF A;  4YOW A;  3ATU A;  4K25 A;  3FZH A;  4EHU A;  5AZJ A;  1VQ9 N;  2F7T A;  2ASP A;  3OHR A;  4WQ5 C;  3EKS A;  2FSJ A;  3A5N C;  3F5T A;  5AQF A;  1KQS M;  3UKR B;  4BE7 B;  4JKF A;  1NGB A;  3SK3 A;  3WEE A;  3CCM N;  3VOV A;  3O9Q A;  1VQP N;  2H3G X;  3HM8 A;  1U6Z A;  3DXM B;  3ENB A;  3I55 N;  1ZBS A;  4BEB A;  4CD1 A;  2JWL A;  4BRF A;  1JCF A;  4JKC A;  4A5B A;  1X3N A;  5AQX A;  4CZE A;  3O4W A;  1NGG A;  1SAZ A;  1Z05 A;  3D7E O;  5MLC Q;  1V4T A;  5AQO A;  3OW2 M;  4FPB A;  1VAZ A;  2BUP A;  3H45 C;  1YJW N;  2Q0R A;  3AY9 A;  5LJW A;  3CJC A;  3CI5 A;  5HL7 L;  4A2A A;  1VQN N;  1QVF M;  4BRQ A;  4CZG A;  3VF4 A;  4XEI A;  4O5F A;  3G25 A;  4XH4 A;  1MWK A;  3VF6 A;  5AQP A;  1GLJ O;  2HBM A;  4BGA A;  3A5O C;  4BVP A;  1NGJ A;  3M6G A;  1KAY A;  5AZJ B;  4I6M B;  1NGH A;  3RSE A;  1YVN A;  1GLE G;  1NGD A;  5AQL A;  2CH5 A;  5GAH P;  3IMX A;  5AQQ A;  3WEE B;  1XC3 A;  3D2F A;  3HOT A;  2D1K A;  3LDL A;  5AQS A;  1YJ9 N;  3H46 O;  4FWN A;  3A5L C;  4H03 B;  3WXM B;  5C15 A;  1YHQ N;  4JKD A;  3VGK A;  3PLA A;  3VGM A;  2I7P A;  3CPE A;  1GLF O;  3KWG A;  1P90 A;  2FF6 A;  2GWJ A;  3UKU B;  1DGK N;  3QIC A;  2CGL A;  3VES A;  3AGR A;  4F9O A;  2WFB A;  5AQJ A;  1LOT B;  3C6H A;  5AQT A;  4BRA A;  4BRC A;  3CCJ N;  3R3L A;  2IIR A;  1K9M O;  3Q7B A;  4H5W A;  4DB3 A;  5AQN A;  5JVH L;  3QDK A;  4JHD A;  2GX9 A;  3IKM A;  4CZI A;  4IEE A;  1RGI A;  1ZC6 A;  2AP1 A;  3VET A;  4M63 C;  5LJV A;  1VQM N;  3O1W A;  2P9N A;  4ISF A;  4ILH A;  4QS8 A;  4JKG B;  4KH5 A;  2NRH A;  4NLC A;  3VEV A;  3ZX3 A;  3CJ1 A;  4IOX A;  3QB0 A;  1Q81 O;  2QW9 A;  3EE9 A;  3GBT A;  4YDU A;  4JK8 A;  4A2B A;  4BGB A;  3E66 A;  4CZL A;  1T3V A;  2E2P A;  3D6R A;  4BRI A;  3L4I A;  4XJX A;  1GLA G;  1XUP O;  2P9S A;  4MDB A;  1QQO A;  3MMV A;  4O8U A;  5TKW A;  2ITM A;  5C2D A;  4GY2 B;  4BG9 A;  1S72 N;  2W40 A;  3NVK A;  3D2F B;  3VEY A;  4YOX A;  4PKH A;  3ZET A;  1JJ2 M;  3WXI A;  4JKA A;  3DWL A;  4AM6 A;  5AQU A;  5CE3 A;  4WCE L;  3L6Q A;  4IOC L;  3O1B A;  4FOE A;  3ULE A;  1G99 A;  4B1W B;  5AQR A;  2D0O A;  5AQG A;  3LDN A;  4OO1 J;  4G9Z A;  3VEZ A;  2YJE A;  5F0X A;  1BWF O;  4JEP A;  1BG3 A;  1HLU A;  1HJO A;  4MLH A;  4FWO A;  4PL8 A;  3U9D A;  4GVE A;  2NRR A;  4JHD B;  1T6D A;  4BRD A;  3JS6 A;  3E1Y A;  1EO1 A;  3TU5 A;  3FLC O;  3WUH A;  4BVO A;  4FWR A;  1K8K A;  3FZM A;  4FWP A;  1SS6 A;  2NLX A;  2P9N B;  5M1O A;  3ENH A;  1J6Z A;  1MWM A;  4B1X B;  3CCV N;  1JCE A;  4KH4 A;  4CBX A;  1YF5 L;  5AQK A;  3R9P A;  2ZJR L;  3FZL A;  2YI1 A;  5KQ8 A;  2I7N A;  3R6M A;  3HBT A;  4O8K A;  3GE1 A;  5ELZ A;  5FPN A;  3LM9 A;  3G71 N;  2P9S B;  5AQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...