2P9SA

Structure of bovine arp2/3 complex co-crystallized with atp/mg2+
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
414
structure length
397
Chain Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-like protein 3
total genus 127
structure length 397
sequence length 414
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 2p9sA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9sA04
2FLOA 4FPAA 4BR5A 3VESA 1X3NA 5AQTA 2Q0UA 4NO7A 1KAZA 4EHUA 4K41A 4XEIA 4BQZA 1KAYA 4H0VB 3UKRB 1QQOA 2E20A 2QWNA 4BVOA 4JD2B 4GY2B 4AM6A 4BRIA 3H46O 5AQVA 2A6AA 3VGMA 4MLEA 5AQKA 3TPQA 4BR9A 2A42A 5ADXH 4M7YA 3FGUA 3RSEA 2P9LB 5ELZA 3U4LA 5BR9A 1K8KB 2NLXA 3JXUA 1HKBA 1NGFA 3AY9A 4FL9A 4B9QA 5KPZA 5AQOA 4ISEA 1NGDA 2AP1A 5BPLA 3SMPA 2FF3B 2Q97A 4H0YB 1XC3A 5EOYA 4A2BA 3O08A 3QBXA 4CI6A 2E2PA 2Q31A 5BRFA 1QZ6A 3VPZA 1XUPO 3H1VX 4GNIA 2D4WA 1X9JA 3UKUB 2GWKA 2QWRA 2GTDA 5AQJA 2E2QA 2P9KA 1LCUA 1Z6RA 3MDQA 4WQ5A 3VETA 3ENOA 4FWSA 3O1BA 2YHWA 3KVGA 2QWLA 2I7PA 4NB4A 3AAQA 4BRDA 3BEXA 3M3ZA 2PBDA 5AQGA 4B1WB 3LDQA 2ITMA 4JN4A 1BDGA 3ZX2A 4Z94A 4IXCA 4FOEA 2VWBA 3MN6A 3L6QA 5AQYA 2A3ZA 4XH4A 2E2NA 2D0PA 3O1WA 3LDPA 4FWQA 1ATSA 1BOTO 2H3GX 4IWVA 4A61A 2PAVA 3CJ9A 1KAXA 1HPMA 1ZBSA 3CJCA 2YCHA 3VERA 1RFQA 2V7YA 3O6WA 3SJHA 2WUSA 3QICA 4HWIA 4CZFA 1E4GT 3S41A 2FSKA 3VOVA 1TYQA 4E1JA 1NGEA 3ULEB 4B1UB 4H0TB 4O5FA 3VEOA 4WQ4A 3ATUA 1BWFO 4DB3A 1NGAA 3QMLA 4JD2A 3ATVA 3MMVA 3QB0A 4B1XB 2E1ZA 1GLEG 5AQUA 3A5LC 3A8YA 1H1VA 2E88A 5KPTA 2KHOA 3CJ1A 3WXJA 4BR7A 4IJNA 2FSJA 4WYBA 2V51B 4BREA 4PKGA 3EZWA 5AZIA 3U9ZA 1NGHA 4RTFD 2CGKA 4BRLA 2ASPA 3CJ7A 3UB5A 1BO5O 4FWKA 2P9NA 3H3OB 1T6CA 1MWMA 2ASMA 4B1VA 2P9LA 3U9DA 5AQPA 2ZGYA 5TKYA 3WQTA 4BRPA 2NZTA 4BC5A 3GE1A 3WXLA 2P9PA 2P9UB 3ZX0A 2GEMA 4H0OA 2QWMA 5AQQA 1HKCA 2Q2RA 1NWKA 2FXUA 1DEJA 4H0PA 4IO8A 1KXPA 4H5TA 4O8KA 3SLCA 2E1YA 3DXKA 3CJAA 1ZC6A 4LC9B 4AM7A 3MCPA 5LJWA 2CGJA 2EWSA 4WQ5C 3VGLA 3MK6A 4CZKA 1QQNA 3R9PA 3VF6A 3CERA 4PL7A 2OANA 2D1KA 1TUYA 3FZHA 1OKJA 4FWMA 4KBOA 4IJAA 4FWLA 4FSVA 2NRHA 3C7NA 3D2FA 3DJCA 2HF4A 2W41A 4FWPA 4F9OA 4BRFA 1LOTB 1ATRA 4DCHA 4BROA 2V7ZA 1BA1A 2ASOA 1GLCG 3EKSA 5KQ8A 3TU5A 3AAPA 5ADXA 1IJJA 3A5OC 4BRGA 2CH5A 3BF3A 5AZJB 2IIRA 1TYQB 4K43A 2QM1A 1ZXOA 4CBXA 5BPNA 1ESVA 2YJEA 3L4IA 2QWOA 1S3XA 1WOQA 1BG3A 3CQXA 5EX5A 2AA4A 1U2VA 4EIAA 3IFRA 4BRQA 3O8MA 4MLHA 5AZJA 3O5BA 1SZ2A 3ULEA 2GUPA 3F9MA 3B8AX 5E84A 3CIPA 3CHWA 5JLFA 1DKGD 3AARA 1GLJO 1YAGA 5AQNA 5FPMA 4EAHD 3M6GA 5AQXA 4BRHA 2E2OA 3MN7A 3LM9A 1V4SA 3HZ6A 2HOEA 3D2EA 3WUHA 1NGIA 3FR0A 4H03B 2BTFA 5FPDA 5AZIB 1WUAA 3U8XA 1G99A 4FWRA 3GDQA 5AQFA 3GOIA 5LJVA 4BC4A 2Q1NA 3WXIA 1SQKA 3GBTA 2FF6A 5F2RA 3RSEB 4H5WA 1HKGA 1QQMA 1J6ZA 4A2AA 5AQRA 4DHYA 4MO5A 5BN8A 4QS8A 3VEVA 4DQ8A 1JCGA 4BGBA 1NM1A 3R8EA 3P4IA 4CZLA 3A5MC 5AQLA 2GELA 3WEEA 4MO4A 2BUPA 1HUXA 5KQDA 3G25A 3MN5A 3DAWA 1YVNA 4QS7A 2W40A 3WXKA 3J8AA 4H0XB 4C23A 3FLCO 5AQZA 4CJ7A 3LL3A 3KHYA 4BC2A 1QHAA 4JNEA 3QFPA 4IZ9A 3UKUA 4CZJA 4JAXA 1BU6O 4PL8A 4A62A 2A41A 3FZKA 3DXMB 1C0GA 5BRHA 2QW9A 2QWQA 3DXMA 1YUWA 2P9KB 2P9SA 3IUCA 1NGJA 3A0IX 5AFUH 2V52B 2ZF5O 5B8HA 4J8FA 5BPMA 4PKIA 4FO0A 5F0XA 3FZMA 4CBWA 3GG4A 3FFKB 3DXKB 3GL1A 1U6ZA 2QXLA 4FWOA 3A5NC 1C0FA 1NLVA 3VF2A 3BP8A 2UYTA 1HLUA 4EHTA 3O80A 3UE5A 3ZX3A 1XQSC 3VEYA 2FSNA 2D0OA 2YJFA 3HBTA 1NGCA 3EL2A 3KZBA 3EN9A 2CH6A 1IG8A 3BUZB 5AQSA 2F9TA 2IVNA 1JCFA 4ISFA 4ISGA 4CBUA 4H5NA 4CZIA 4CZGA 3LDNA 4FOIA 3I33A 1BA0A 4BRNA 5BREA 2QWPA 2DPNA 1DGKN 2J4RA 1HX1A 4HTLA 2YI1A 5AQHA 3D2EB 1ATNA 1K8KA 3CETA 4I6MA 1S22A 5AQIA 3VENA 3IMXA 4QS9A 3FZLA 2IVOA 4YDUA 4H5RA 4XH1A 2VYPA 2IVPA 3ID8A 3LM2A 1NGGA 3VEXA 1X3MA 3MN9A 3QDKA 3ENHA 2Q36A 1CZAN 3SMSA 3UKRA 2P9UA 1T44A 4M7XA 2HMPA 3VF4A 5EVZA 1NMDA 5AFUA 2P9NB 2ZGZA 3CI5A 1GLAG 1MA9B 1MWKA 3WEEB 4B1YB 2I7NA 1NGBA 5AQWA 1YXQA 4YDUC 4L3QA 5FPNA 3OHRA 3H45C 5CE3A 5I9EB 3CQYA 5EXWA 4BRKA 5FPEA 4XH5A 3VEWA 4BC3A 4CZEA 4BVPA 3EO3A 5JICA 4BR2A 2YHXA 2Q0RA 2A40A 4K25A 1SAZA 2ZWHA 2HF3A 3M1FA 3O4WA 3DWLA 4M63C 3SK3A 3C0BA 5EY4A 4BQLA 3WQUA 5AR0A 1EQYA 3IDHA 5KPRA 2P9SB 1GLLO 4BRMA 2P9PB 1T6DA 1Q18A 4BG8A 4H5VA 4BRAA 3VGKA 4CD3A 5BRDA 1GLDG 2VCPA 3C7NB 3D2FB 3HI0A 4Y0WA 3ZETB 1Z05A 3ZETA 3QFUA 3ZEUB 1NBWA 5JLHA 4CD1A 3ZEUA 4FWNA 1BUPA 4BRCA 3HM8A 5LY3A 1V4TA 1Y64A 2CGLA 4PKHA 5F1XA 4RWTA 1QZ5A 1RDWX 2E8AA 3R6MA 4BG9A 2YHYA 4B1ZA 3D7EO 3VEZA 3I8BA 3H3NO 4CZMA 3QBWA 1E4FT 2A5XA 1JCEA 4FPBA 1TUUA 3CJBA 3W3DA 4BGAA 4BR0A 5JMVA 1GLFO 4WQ4C 2P9IB 1D4XA 4JHDA 1P8ZA 2P9IA 4JHDB 4K42A 1U2VB 4BR4A 3L0QA 2F9WA 3HTVA 3WT0A 1HJOA 3FE1A 3HSCA 1MDUB 3LDLA 3H1QA 3H6EA 3JS6A 5BN9A 5E26A 3W0LA 2GWJA 4CZHA 4RCHA 4EFHA 3FZFA 1RGIA 4I6MB 3LDOA 1R59O 5AQMA 1GLBG 3BF1A 3EKUA
chains in the Genus database with same CATH superfamily
4C8KA 5J2NA 2NUBA 3HP9A 4DU3A 3BZKA 2Q0UA 3SUNA 2VG6A 4NO7A 4BEBA 4H0VB 4O44A 3HXMA 5FRMA 2E20A 1TL1A 2PYJA 2QWNA 4BVOA 3ZCMA 4CJQA 4BRIA 4CGJA 5AQVA 3LDSA 3O3FA 1ZBIA 3QNOA 4KHQA 3AA3A 4DR5K 3M8QA 1QSLA 3O4QA 1RT7A 3TANA 4U7BA 1VSEA 2NLXA 1NJXA 4JK9A 3O3GA 5KPZA 1HJRA 1LV5A 1NGDA 2KZZA 4BACA 2D0AA 1RBVA 2Q97A 1WBDA 3HOSA 1FK9A 2OCEA 2Q3SA 2KQ2A 1JLAA 3KK1A 5GAGP 5BRFA 2BANA 3VPZA 4O5BA 2D4WA 4WFBL 4HUFA 1NNEA 3HPOA 4JV5K 2GTDA 3JAMO 3HM9A 4JI3K 3MDQA 1JLEA 3ITHA 4ELTA 1RBRA 1TKZA 4C1NK 1ITGA 2O8CB 3L3VA 1I94K 4JEPA 2XY6A 1KFSA 3LPUA 3AAQA 4B1WB 1TV6A 3LDQA 4WE1A 2OPPA 4LSLA 4XH4A 4ILGB 4IWVA 4CHPA 3PSFA 1HPMA 4BE1A 3CJCA 3KD1E 1OH7A 3VERA 3A2FA 2ATQA 3DRRA 1OH5A 2Z1GA 5FROA 5GIPA 3LPTA 4DWIA 4WCEL 3NVMA 2WUSA 4DSEA 4CZFA 4BY9C 3MCAB 4J2EA 4CGIA 1TYQA 3BDPA 2O8DA 4B1UB 4I9LA 3OYDA 3ZT2A 4EP4A 4CF1A 1ASUA 3QB0A 3O9TA 4B1XB 2NNWA 3UIQA 2GUIA 3A8YA 2OPSA 4R79A 2E88A 3V1OA 1TKTA 5KGWA 4IJNA 4DQIA 3U9ZA 1NJZA 1CZ9A 2CGKA 1NMNA 4OGEA 4BRLA 4AHTA 2ASPA 4O4GA 2WFBA 3THXB 3AVFA 1JL1A 1GOCA 5C25A 4FJ5A 3U9DA 1B92A 5AQPA 5TKYA 4IBNA 1KCFA 2YKNA 2PZSA 2HHSA 3O9UA 4BRPA 4LF7K 3ZX0A 5KTQA 1LWFA 2Q2RA 3AVJA 1RTHA 1DEJA 3OYKA 4IO8A 3PX4A 2YHBA 2HHQA 1IO2A 4O8KA 3SLCA 3WNHA 3VN5A 4JS5A 2C1GA 4LC9B 4DQPA 4E7HA 2CGJA 4DR4K 3MK6A 4BWJA 4CZKA 2XO7A 4PL7A 3DLKA 1X9WA 1IKYA 4IJAA 4LSNA 3D2FA 4JI0K 4PWDA 1VQLN 1P90A 3PUFA 4J2DA 4OLAA 4FWPA 4F9OA 4DCHA 2ZQBA 4CVNE 4BROA 3OYLA 2V7ZA 1IJJA 1OH8A 3O9SA 2QM1A 4CEFA 2P5GA 5HRSA 4JKDA 4CJVA 1RTDA 2OA8A 1BG3A 3CQXA 4CJLA 1N33K 4BECA 3HSTB 3V81A 4YHHK 4B3OA 4DFPA 3VMFB 2FBTA 4DUYK 1B9DA 3M8PA 2OPQA 4B8CA 1L3TA 1DKGD 3AARA 1GLJO 4DV5K 5AQXA 3MAQA 3LM9A 3CC7N 3EY1A 4FLTA 3E9LA 4RW9A 5FPDA 5GADP 1HYZA 3U8XA 2P1JA 1C1BA 1GOBA 3GDQA 3VQ6A 4M3YA 4AHVA 3TARA 5CR4A 4JKHA 5LJVA 2Y1IA 4OKJA 4BC4A 2Q1NA 3NF6A 1EWRA 4B8AB 5GAEP 3L8BA 1DT9A 1UA0A 3SAHA 3HP6A 3QLHA 5AQRA 1KQSM 2XRIA 4JKBA 4DHYA 2PY5A 4CJEA 4KREA 2YNFA 3P39A 1HNZK 4X66K 3R8EA 3A5MC 5KI6A 4CJRA 3WEEA 1XNRK 4GMJB 2RHKA 3G25A 4LFCK 2VG7A 1S9GA 4MFBA 4QS7A 2W40A 1C0UA 3FLCO 3CXCM 4BC2A 1M1KO 3QFPA 1W9HA 4JAXA 4Q0BA 2DFHA 1S6PA 3C6HA 3FZKA 3DXMB 3EZ5A 3KD5E 2KTQA 1BISA 1NJWA 1NOYA 3QINA 4KRFA 1VQ5N 4LFBK 3A0IX 3O4NA 5AFUH 3S5TA 2V52B 4JKEA 1S6QA 4J8FA 1YITN 4PKIA 1RT4A 3FZMA 4CJTA 3QEXA 3G6EN 4OPKA 4FWOA 1ASVA 3VF2A 3BP8A 2UYTA 3ZSXA 1HLUA 4ID1A 3ZYYX 3KTQA 4DF8A 4K8ZA 4B9MA 1XQSC 2D0OA 4OX9K 2YJFA 3B6OA 3RVCA 2BH1A 4ICLA 4PA1A 4ISGA 2IVNA 4ISFA 4CBUA 4CZIA 4CZGA 3N4PA 4BE2A 5BREA 4JKGA 4KH4A 5LMNK 4KFBA 3S3NA 1TK5A 4IG3A 1ATNA 4I6MA 5AQIA 1KFDA 1NK8A 2B6AA 3VENA 3HRGA 1VQMN 1C1AA 4H5RA 4FZYA 3T1AA 1IBKK 3OYMA 4NYFA 3MN9A 4H4OA 3NMUA 3G0ZA 3VQ8A 1CZAN 3UKRA 2HSTA 3CM5A 4JS4A 2Z1HA 1W97L 4H8KA 5M1NA 1S9EA 4M7XA 4C8NA 1E3MA 1NMDA 2XY5A 3ULDA 2ZGZA 2VGMA 4NCAA 3RMCA 1VQPN 4Z4GA 3WNFA 4FVUA 5AQWA 4FZZA 1WSFA 2O8BA 4YDUC 4MDBA 1VSLA 5EXWA 4BRKA 1RT6A 2ITGA 3OYHA 3HVRA 5JICA 1VSFA 2X74A 3D45A 2NRRA 3TI0A 1XHZA 2Q0RA 4DFMA 2P5OA 3DWLA 1C6VA 4M63C 3SK3A 3VTIA 3C0BA 4CJ4A 1TAUA 4B3TK 1Q7YO 2W6KA 3E9PA 2WTUA 2BE2A 4BRMA 3KLHA 4JRQA 4Y1DA 4BG8A 4AQYK 4BRAA 4CD3A 3C7NB 5IWAK 2I5JA 4AF1A 1WBBA 3ZETA 1BQMA 3ZEUB 1T7PA 5KRTA 3LAKA 5JLHA 4CD1A 4MQ3A 1C0MA 4JKGB 4BRCA 3HM8A 3I0RA 3C6TA 1Y64A 4Z4IA 3U6FA 3ZSOA 1HNWK 4WFAL 4RW6A 4CEBA 3VEZA 3H3NO 4F3TA 1JCEA 4CJWA 3HJFA 5CYMA 1TUUA 1RDBA 1GLFO 1D4XA 4NXNK 1P8ZA 3T69A 2P9IA 4JHDB 1U2VB 2G8UA 5C24A 3RRGA 4O0IA 2PFUA 1VSKA 4E7IA 5E26A 3VTHA 3OW2M 3FZFA 3HT3A 3LDOA 4CHNA 3AV9A 3VESA 3VQQA 3OYFA 3KWIA 5C10A 3AO3A 3SQ0A 1QS4A 3K2PA 2QA4N 4FXDA 3UKRB 1QQOA 3NCIA 4GY2B 3TTDA 2G8HA 2KW4A 1QVGM 1X1PA 4IFVA 1TKDA 1VSMA 3FGUA 4CERA 4DR2K 2P9LB 2DFEA 5CZ2A 1I3AA 1JLCA 4E1MA 4CGGA 1HKBA 4FJLA 4KB0A 4W5NA 2B4JA 2GV9A 4CEQA 4K0KK 3HPGA 1J5EK 2IC3A 4JI7K 3LP0A 5EOYA 4FK4A 3O08A 1Q8IA 2HVIA 3QBXA 4GV6A 3SBTA 1XMQK 3AO2A 2ZJRL 3AO1A 2HVHA 3C6UA 4FJKA 3K5LA 2QKBA 3AGKA 2F8SA 5JS1A 3OYAA 3DOLA 1JLGA 3KJVA 4B3SK 4DSIA 1IBLK 2RF2A 2P9KA 1LCUA 1Z6RA 4CEZA 2OZMA 4GVMA 3DYAA 4AH9A 4DU1A 5GAHP 2QWLA 3F2KA 3E9OA 3K9KA 1WB9A 4JKCA 4MDAA 4CHQA 2ITMA 3ZX2A 5J1EA 1KVAA 3G4SN 3CPWM 4FOEA 2VWBA 1JLQA 3LP3A 1C1CA 5J2MA 2E2NA 1NKBA 4CJFA 2D0PA 3O1WA 3JYTA 3V9WA 3P83D 1BOTO 4FLUA 2PAVA 3F5TA 3IRXA 3CFRA 2YCHA 1RFQA 5C0YA 3VQEA 3SPYA 4DKWA 3O6WA 2VGNA 4Y1CA 4HWIA 1E4GT 2HNZA 4FW1A 4DMNA 3SBGA 3HK2A 3TABA 1UA1A 4GV3A 4LF8K 4H0TB 2E4LA 4CGFA 1NG9A 4DB3A 4JD2A 1HQEA 4GVEA 3S3OA 1VQON 3NHGA 5M1KA 1NJIO 3NF9A 3KLIA 4KV8A 1RBUA 1H1VA 3PO5A 3TSQA 4F8RA 3WXJA 3DOKA 2UXCK 2FSJA 4WYBA 1RT2A 2V51B 4BREA 4PKGA 2ZE2A 4JI4K 1XHXA 3M5RA 1L3VA 3RTVA 1MWMA 2ASMA 4YOTA 2VQEK 3THWA 4FLWA 1TKXA 2O8FA 4IFEA 3T3FA 1DTTA 1HR0K 3J81O 4DTSA 3U3GA 4ZHRA 3GE1A 3WXLA 5E41A 3RRHA 3SV3A 2QI2A 3BZCA 5AQQA 1RT1A 1NWKA 3V4IA 5HL7L 1LW2A 1NOZA 4CHYA 4XJXA 1FW6A 4H5TA 4JLHA 1BI4A 2KFNA 2E1YA 3DXKA 5SZTA 3CJAA 1BI4B 3MCPA 3L3UA 2ETJA 1KLMA 1O13A 4DQRA 3CERA 4X65K 2D1KA 4B9TA 4CEEA 4DTOA 5LMUK 1RDAA 2PYLA 2HHHK 2HF4A 4CF0A 4BRFA 1LOTB 3FFIA 4J2AA 2ASOA 1GLCG 3EKSA 5KQ8A 3TU5A 2O8EA 3CCEN 3A5OC 3BF3A 1TYQB 2O8DB 1JXBA 1ZXOA 3J7AP 3AGRA 3HVTA 1BIUA 2QWOA 1QQCA 1VHXA 1SKWA 5EX5A 2AA4A 1FKPA 4B9UA 3VQ9A 3QERA 2FBXA 1U45A 5AJ3K 3G71N 1CXQA 5AZJA 1ASWA 1A5WA 4HTUA 2GUPA 3TSPA 4Z4CA 1C0TA 4YY3K 4E3SA 4YOVA 1YAGA 3SAFA 4BRHA 4NCBA 1VK0A 4YOUA 2XY8A 2WOMA 2QKKA 4RW8A 1FXXA 3THVA 1BCMA 4DR6K 1XNQK 4CJPA 1WSIA 4FWRA 5AQFA 4H4MA 1TK0A 2F7TA 4O8UA 4CJ5A 3GOIA 2HHVA 1Y97A 4DV7K 2C1IA 3MXIA 1QQMA 1JJ2M 4JI6K 3VQAA 2G8WA 2QXFA 2JGUA 4MO5A 1U47A 5DMRA 4LFAK 4E7KA 4BGBA 4CJSA 4E7JA 4CZLA 5AQLA 1YHQN 4F2SA 1S1WA 2GELA 2BUPA 1HUXA 5KQDA 4Z0UA 2YNIA 4FW2A 3D0PA 3MECA 1YVNA 1WSEA 3KKSA 4IFYA 4DTNA 3J7ZO 4CJ7A 2IGIA 3LL3A 4JNEA 4IZ9A 4M3RA 1K6YA 2BGGA 1BQNA 1BU6O 5JENA 4A62A 2O8FB 1RDCA 2A41A 1Z26A 5BRHA 2QW9A 4I7FA 2QWQA 4IDKA 4O0JA 5CZ1A 4FM0A 3CCLN 4FVMA 4EP5A 3CCSN 4FO0A 5F0XA 3LWLA 4FCYA 4JI1K 4DV4K 1U6ZA 2QXLA 2G8KA 1FJGK 4OJRA 3O80A 4YFUA 1NGCA 3EL2A 3BUZB 3DM2A 2F96A 1JLBA 2F9TA 3MWPA 4H5NA 4CK1A 1YJ9N 1QSSA 4FOIA 1RBSA 1F21A 4BRNA 2QWPA 2J4RA 3CCRN 1HX1A 5AQHA 3D2EB 3VA3A 4U67L 1ZBUA 3TAMA 1S22A 3LALA 1SUQA 3FZLA 2IVOA 4DV3K 2HBJA 5HP1A 4XH1A 5M1OA 3HYFA 2OTLN 3OA9A 3VEXA 3THYB 4A59A 1LAWA 1NK6A 3SMSA 4BDZA 1T44A 4E0DA 1SV5A 4C8MA 2ZJQL 5AFUA 3ZSYA 1KVCA 1MA9B 2HBMA 4B1YB 4CEOA 3KK7A 3QNNA 4YORA 3LZJA 4ILJA 5FPNA 5CE3A 3H45C 5FPEA 4A57A 3B6PA 4XH5A 4BC3A 1QTMA 2UU9K 4CZEA 4BVPA 2HHIA 1BCOA 2X6NA 4BR2A 4FJMA 4K25A 3O4WA 1VQ7N 5HOOA 4FJGA 3K5NA 5KPRA 2GX9A 4CJ3A 2P9SB 5JS2A 1Q18A 2D5RA 1J5OA 3VGKA 3KK2A 2VCPA 2OPRA 2VG5A 5J2QA 3ALYA 3ZETB 1XI1A 1ZBHA 4FWNA 3QESA 4LY7A 3AA4A 4ZTFA 2O8EB 1WSJA 2E8AA 3D6RA 4X64K 5HRPA 3D7EO 4CZMA 1RDUA 3I8BA 1E4FT 2A5XA 1T8EA 4V19S 2G8IA 3PLAA 1KC8O 3TAGA 4BR0A 1XC9A 4WQ4C 1NJYA 3L2QA 4BR4A 4DV0K 4FLXA 2XHBA 2NRVA 2F9WA 3THYA 3TTCA 4HVJA 3LDLA 1EWQA 3H1QA 3H6EA 3JS6A 3AVMA 4CZHA 4RCHA 4YOYA 4FJJA 4EZ9A 4I6MB 1R59O 3Q7BA 3ZT1A 5AQMA 3QIOA 5DM6L 3EKUA 3L2VA 2FLOA 1HPZA 1KD1O 1K9MO 3VQBA 1EKEA 4AHRA 3CQ8A 3OBWA 5LL6Z 1TAQA 4EHUA 3CFOA 4K41A 3QEIA 3CCUN 3IG1A 4BQZA 3RMDA 1T03A 4AM6A 1IKWA 2A6AA 5AQKA 4BR9A 3VGMA 4N47A 2A42A 5ADXH 5I42A 4CJKA 4M7YA 4DR3K 1YVUA 3CCJN 3E1YA 4RG8A 3JSMA 2Y1JA 1YJWN 3NFAA 4FJ7A 1K8KB 3JXUA 4OVLA 1J54A 3SI6A 1L5UA 1RTJA 3AVNA 4CCHA 4ISEA 2IS3A 1NK5A 4IDHA 3NGYA 4F4KA 2RPIA 4HCBA 5I3UA 2AP1A 4CK2A 2FF3B 4H0YB 2DTUA 1JLFA 4O55A 4FM1A 2KFZA 4WFNL 3T1YK 2E6MA 4CI6A 4OO1J 3P1GA 2E2PA 2Q31A 4F2RA 1QZ6A 5MLCQ 3SUQA 2UUAK 2FBVA 1EX4A 3H1VX 5CY4A 1O1WA 4KTQA 2P51A 1X9JA 3R1XA 4B08A 3RR8A 5HROA 3NDKA 4CESA 4WF9L 5AQJA 2E2QA 4E1NA 4A5BA 4WQ5A 3ENOA 4FWSA 4C8LA 3O1BA 2YHWA 4DSFA 3KVGA 2WBNA 5JVHL 4NXMK 4NB4A 2E5LK 4BRDA 2KKZA 3BEXA 4JN4A 4PQUA 4Z94A 4IXCA 3O3HA 3C65A 3L6QA 4W5QA 2A1SA 5AQYA 2W42A 1WSGA 4LF5K 3LDPA 1ATSA 2O8CA 4IKFA 4A61A 4JK8A 1KAXA 1ZBSA 3HPHA 1BIZA 2UUBK 2V7YA 4ID5A 4RW4A 3LZIA 3KIOA 3T1HK 1UAXA 3QICA 2Z1JA 3VOVA 2HHXA 4OGCA 4E1JA 1VSDA 1NGEA 4CW7B 4O5FA 3ZT3A 4WQ4A 4Q5VA 2VWKA 1BWFO 1NGAA 3SNNA 3ATVA 1SKRA 2E1ZA 1GLEG 5AQUA 4C1NI 3A5LC 2RE2A 2HNDA 3SQ1A 3WNEA 2KHOA 3CJ1A 2G8VA 4BR7A 3VQDA 3AA2A 2O8BB 3EZWA 5AZIA 1NK9A 1EO1A 4CIFA 3AVCA 1NGHA 3KK3A 3F73A 3UB5A 4FWKA 3H3OB 3CG7A 1T3VA 4CE9A 1G15A 2P9LA 4Z4HA 2ZGYA 4DTMA 4I9QA 4BC5A 3K9JA 4ZTJA 2GEMA 1N34K 2QWMA 1IV0A 4CGHA 3HO1A 1KXPA 4W5TA 3OTOK 3DMJA 3MX2A 3RMBA 2OTJN 1ZC6A 3IAYA 5LJWA 5M1FA 2EWSA 4CF8A 3SJJA 4WQ5C 1SL1A 1QQNA 1S72N 3DLRA 3R9PA 4DV2K 3NH0A 1TUYA 4KBOA 1OKJA 3EE8A 2NRHA 1VSHA 3DJCA 4R5PA 4KI6A 4DLGA 2W41A 3DLBA 1T05A 3ZSZA 5FRNA 1VRUA 3BGRA 3DLEA 3SV4A 3SPZA 4DSLA 1BA1A 3AO5A 4GW6A 4E89A 4DS4A 3AAPA 1HRHA 4KO0A 2EHGA 3DRSA 4FJXA 2IIRA 2OYQA 4KTZA 1ESVA 3EE9A 3L4IA 2HHWA 1WOQA 3I55N 3KWGA 1KTQA 1HNXK 4EIAA 4EZ6A 4UY8O 2RN2A 4DSKA 4BRQA 1QVFM 5H1SQ 2FC0A 3O8MA 4OPHA 3K57A 5T7BA 2W00A 3CC4N 1SZ2A 1S1TA 3F9KA 1BHLA 3B8AX 3CIPA 2WC9A 2O4IA 5D3GA 5FPMA 4EAHD 1LWEA 1D8YA 4DR7K 2E2OA 4JI2K 3AVAA 3D2EA 3WUHA 1NGIA 3FR0A 1TK8A 3QO9A 1MU2A 2XY7A 2LSNA 1OVYA 3OYBA 3WXIA 3GBTA 2FF6A 3BY5A 5F2RA 3RSEB 1TL3A 2UXBK 4DTPA 1QE1A 2RKIA 5HRNA 2YV0X 4CFBA 4DQ8A 4KHYA 5HBMA 1N6QA 1JCGA 4AHCA 4CHOA 3V9ZA 1S1XA 3P4IA 1D9DA 3V9UA 2HHTA 4FLZA 4FJIA 2E6LA 3K59A 3DAWA 3NAEA 1XWLA 3MX5A 3WXKA 3J8AA 4H0XB 3PX6A 4DR1K 4FJ9A 3I0SA 5AQZA 4OLBA 3KHYA 1QHAA 4CZJA 1ILYA 4PL8A 3CCQN 1C0GA 2QEXN 3AA5X 4FJHA 2YNGA 2P9SA 3IUCA 3ASMA 2ZF5O 5B8HA 4Z4FA 1DTQA 3GG4A 2JWLA 3LP2A 3OY9A 1C0FA 1NLVA 1J9AA 3MEGA 3UE5A 3VEYA 4KTWA 1A5VA 3KZBA 1GOAA 1HNVA 2CH6A 3EN9A 3TSUA 1IG8A 4IG0A 5AQSA 2KZMA 3MXMA 4E19A 2NRWA 3QIPA 5C2FA 1DGKN 4YOXA 3SUPA 1NU0A 1SKSA 4RW7A 5C2DA 3PO4A 1U04A 3AVBA 4OKKA 4CF2A 3IMXA 3C95A 4QS9A 2FBYA 4YDUA 3T19A 1KVBA 2VYPA 2IVPA 3LM2A 4OPAA 4N41A 2NRTA 1X3MA 3QDKA 3V6DA 3ENHA 3ZLJA 4JRPA 2Q36A 3E66A 3N4QA 1IKVA 1VQ4N 4DU4A 1K8AO 3QEWA 1N36K 5C42A 2HMPA 3VF4A 3THWB 3NH1A 1WSHA 3NF8A 4CK3A 3CM6A 4CFAA 1VQKN 1WN7A 1GLAG 3ZSQA 4KHPK 2I7NA 3Q7CA 1NGBA 1SL0A 1HMVA 4L3QA 5GINA 3OHRA 1M90O 3CQYA 1RT5A 3VEWA 5BR8K 3QEVA 2YHXA 5KRSA 2W6LA 2ZWHA 5EU7A 4M42A 3L4QA 3WQUA 1CXUA 4JYAK 2B5JA 1S1UA 1VSIA 1GLLO 1NK4A 2P9PB 3QEPA 1T6DA 2D0BA 1IH7A 3MEDA 3CMAN 1VRTA 1UWBA 4FLYA 2A1RA 1GLDG 3KKRA 3HI0A 4Y0WA 1YJNN 1Z05A 4LF4K 4B9SA 5SWMA 4E72A 4LH5A 1YTAA 5F1XA 4RWTA 4CJUA 1BGXT 3DLHA 3ZSWA 4LH4A 1N32K 3TAFA 2BDPA 3NE6A 3CJBA 3W3DA 3ZSRA 3OYIA 2P9IB 4JHDA 3NH2A 2HHUA 3L0QA 3PIPL 1NKCA 1HJOA 1YT3A 3FE1A 3HSCA 1MDUB 1WAFA 5BN9A 4XIUA 3W0LA 2YHAA 4EFHA 4KH5A 1GLBG 4HUGA 3BF1A 4FPAA 3K5OA 4BR5A 1X3NA 4KAZA 4K8XA 1HYSA 5AQTA 1KAZA 3VQCA 4XEIA 1IKXA 5A2QO 1KAYA 4N76A 2VWJA 3CPEA 2QTDA 4QAGA 5JVGL 4IO9L 4JD2B 3H46O 3OBYA 5TKWA 4MLEA 3TPQA 3OYCA 4X62K 1N5YA 1S1VA 3U3YA 1TVRA 3RWUA 3V9XA 4J2BA 4CECA 3RSEA 5ELZA 1RILA 3U4LA 5BR9A 1WAJA 1NGFA 1LWCA 3AY9A 4FL9A 4B9QA 1ZYQA 4Z4EA 5AQOA 4DQSA 2F4VK 5BPLA 3SMPA 4AHUA 1BL3A 4M45A 2YX6A 1XC3A 4A2BA 2GBZA 2YKMA 4DSJA 3PX0A 1SL2A 2X6SA 2WONA 1XUPO 4GNIA 1EXQA 3K5MA 1U48A 3UKUB 3AVGA 2GWKA 2QWRA 1X9MA 3WXMB 5CHIA 3SQ2A 3VETA 3NF7A 3V9SA 2OZSA 4DG1A 2I7PA 3VQ7A 3RMAA 3VA0A 4DTRA 2IOCA 4IOXA 3VQ5A 1NKEA 3M3ZA 2PBDA 5AQGA 3AO4A 1BDGA 5C12A 3MN6A 2A3ZA 4LF6K 4FWQA 1W2BM 1U4BA 2H3GX 3CJ9A 3SZ2A 3K58A 2HW3A 2G8FA 2HB5A 3E01A 1W7AA 1RNHA 3SJHA 5FLXO 2ZJPL 4N56A 3S41A 3DLGA 2FSKA 3KLEA 3CCMN 4DTJA 3RR7A 4M3XA 3HL8A 4BE7B 5HRRA 5GIOA 3ULEB 3VEOA 1U49A 3ATUA 3HOTA 3CYMA 3QMLA 3MMVA 4ILHA 2X78A 3OS0A 2ZM6K 1CLQA 3TAPA 1W0HA 1OVQA 4JK7A 4QCLA 5KPTA 4PUOA 5K14A 4DV1K 3SCXA 1WLJA 2DY4A 3EYZA 4KB1A 1Q9XA 4LD0A 4RTFD 3PIOL 1UOCA 4CHZA 3OS2A 3ISNC 3CJ7A 1BO5O 2UXDK 2P9NA 1T6CA 4FZXC 4B1VA 1HYVA 3OYGA 4OPJA 4ELVA 3LP1A 3NVKA 3QETA 4DFKA 1KSPA 3WQTA 2NZTA 2P9PA 2P9UB 3ID6A 1VQ8N 4H0OA 3OS1A 1SS6A 5FDLA 1HKCA 4DS5A 1IBMK 3VQPA 3MEEA 2FXUA 5DK5A 4DLEA 4H0PA 1S5JA 3NGIA 3S9HA 1VSJA 3O9RA 4AM7A 1D5AA 1XMOK 3VGLA 1VAZA 4W5RA 2O4GA 3VF6A 4F3OA 4JI8K 2OANA 3TTFA 3FZHA 1QHTA 4FWMA 5M1QA 2R7YA 4FWLA 4DTXA 4FSVA 3C7NA 3P38A 4GV9A 3CMEN 1ATRA 4UQGA 1RDDA 1JKHA 5ADXA 4BRGA 2CH5A 5AZJB 1RBTA 4K43A 3CFPA 4HHTA 4CBXA 3C6AA 5BPNA 2YJEA 1EP4A 3L2UA 1S3XA 3ZT0A 4CEAA 4NLCA 1HQUA 1U2VA 3IFRA 4BDPA 1FKOA 5KGXA 3SQ4A 3P31A 4MLHA 4KHWA 3DI6A 3O5BA 3ULEA 3F9MA 5E84A 3CHWA 3P5JA 4IEEA 3V1QA 4PY5A 5JLFA 2KLAA 5AQNA 4KHSA 2NRZA 3AVKA 4NLBA 3M6GA 1NK0A 4CF9A 3MN7A 1ZBLA 1K73O 4GKKK 1V4SA 3HZ6A 2HOEA 2UUCK 4H03B 1OH6A 2BTFA 2HNYA 5AZIB 4B9NA 1WUAA 2D0CA 1G99A 3H08A 5DM7L 4GKJK 3LWMA 1Q9YA 4CGDA 1SQKA 2JLEA 3TR8A 1L3UA 3I56N 4H5WA 2HMIA 4BE0A 1N8RO 1HKGA 1J6ZA 4A2AA 4DQQA 1Q82O 3CCVN 2AJQA 5BN8A 4QS8A 3VEVA 1JL2A 1NM1A 3TAQA 4M41A 4DUZK 1Z25A 4JI5K 3LANA 4G1QA 4KI4A 4MO4A 3OJUA 2QK9A 3OYJA 1LAVA 3MN5A 1JXEA 4PHTX 4C23A 2YNHA 4C8OA 1YTUA 2Z1IA 1L3SA 3UKUA 4HUEA 4KHNA 4KH6A 3C94A 4IEIA 3R3LA 4TSXA 2EX3A 3J7YP 3DXMA 1YUWA 1KRPA 2P9KB 1KLNA 1NGJA 4B3RK 1Q81O 5BPMA 4B9VA 3CYGA 4G9ZA 1A5XA 4LF9K 2VQFK 4CBWA 3FFKB 4OKEA 3DXKB 3DLLL 3SYZA 4KKOA 3GL1A 1D9FA 3AVLA 3A5NC 4M3TA 3TWHA 1B9FA 1J53A 4EHTA 3ENBA 4JKAA 3KLGA 1NK7A 3ZX3A 2FSNA 3HBTA 3IKMA 1LW0A 3K0SA 1JCFA 1IG9A 2JWKA 3LDNA 1R0AA 3DRPA 3I33A 1BA0A 2DPNA 2ZD1A 4HTLA 4DF4A 2YI1A 4CEDA 4CFDA 4N5SA 1K8KA 3PSIA 3CETA 5CYQA 4BDYA 1Q86O 3G10A 3O9QA 1YIJN 4BWMA 3ID8A 4FYDA 1NGGA 5HLFA 1RT3A 1REVA 4CFCA 2DFFA 3LAMA 4HCCA 4I2QA 3CF5L 3J80O 4AILC 4KPYA 3NBPA 2P9UA 1WNSA 1EETA 1HNIA 3TAEA 3IS9A 3THXA 4FJNA 5EVZA 4FJ8A 4NYNA 2P9NB 1RTIA 3CI5A 4M3WA 1MWKA 3WEEB 3SAGA 4YOWA 1YXQA 4W5OA 5C15A 4A5AA 3I8DA 4ELUA 5I9EB 5M1PA 4DTUA 4L8RB 2HBLA 3EEQA 3AVIA 3EO3A 4FK2A 3VQ4A 4AHSA 2NRXA 4JKFA 1QSYA 2A40A 1SAZA 2HF3A 3M1FA 3PY8A 5EY4A 4BQLA 3L2WA 5AR0A 1VQ9N 1EQYA 4QOZB 4YNQA 3IDHA 3WNGA 3OYEA 1I39A 1ZBFA 4CIEA 3M8SA 4FM2A 3MWTA 1DLOA 4IOCL 3SUOA 1YI2N 4M3ZA 2F8TA 4H5VA 5BRDA 3OJSA 3D2FB 1RCHA 3NGZA 1TGOA 3AVHA 2IDOA 4CIGA 1VQNN 3M8RA 4M3UA 4E7LA 4DV6K 3ZSVA 3ZT4A 3QFUA 1NBWA 4IOAL 1VQ6N 3ZEUA 1BUPA 5LY3A 1YF5L 1V4TA 2CGLA 4PKHA 3PV8A 1QZ5A 1RDWX 4B3MK 4FK0A 3R6MA 4BG9A 2YHYA 2IAJA 5J2PA 4B1ZA 3QBWA 4B9LA 3KLFA 4FPBA 4BGAA 5JMVA 5IT9O 3S3MA 3V1RA 4K42A 1X9SA 3HTVA 3WT0A 3T7ZA 3L2RA 3OYNA 4I2PA 2HBKA 3MXJA 4FLVA 3CD6N 2GWJA 1CZBA 4KHUA 1RGIA 3OVNA 4NCGA 4DFJA 3CC2N
chains in the Genus database with same CATH topology
2FLOA 4FPAA 4BR5A 3VESA 1X3NA 1KD1O 1K9MO 3KWIA 5AQTA 5C10A 2Q0UA 3OBWA 4NO7A 1KAZA 4EHUA 4BEBA 4K41A 3CCUN 4XEIA 2QA4N 4BQZA 1KAYA 4H0VB 3CPEA 3UKRB 1QQOA 2E20A 2QTDA 2QWNA 4BVOA 5JVGL 4JD2B 4GY2B 4AM6A 4BRIA 3H46O 3OBYA 5AQVA 3TTDA 4IO9L 2A6AA 5TKWA 4MLEA 5AQKA 3TPQA 3VGMA 2A42A 4BR9A 5ADXH 1QVGM 4M7YA 3CCJN 3E1YA 3FGUA 4U7BA 3RSEA 2P9LB 5ELZA 3U4LA 5BR9A 1YJWN 1K8KB 2NLXA 3JXUA 4JK9A 1HKBA 1NGFA 3AY9A 4FL9A 4B9QA 5KPZA 5AQOA 4ISEA 4IDHA 1NGDA 2AP1A 5BPLA 3SMPA 2FF3B 2Q97A 4H0YB 2YX6A 1XC3A 3HOSA 5EOYA 4A2BA 3O08A 4WFNL 3QBXA 4GV6A 3SBTA 4CI6A 4OO1J 2ZJRL 2E2PA 5GAGP 2Q31A 5BRFA 1QZ6A 5MLCQ 3VPZA 1XUPO 3H1VX 4GNIA 3AGKA 2D4WA 1X9JA 3R1XA 4WFBL 3UKUB 2GWKA 2QWRA 2GTDA 4WF9L 5AQJA 2E2QA 3WXMB 5CHIA 4A5BA 2P9KA 1LCUA 1Z6RA 3MDQA 4WQ5A 3VETA 3ENOA 4FWSA 3O1BA 2YHWA 4CZIA 3KVGA 4C1NK 5GAHP 2WBNA 5JVHL 2QWLA 3F2KA 4JEPA 3E9OA 2I7PA 3K9KA 4NB4A 3AAQA 4IOXA 4BRDA 4JKCA 4MDAA 2KKZA 3BEXA 3M3ZA 5GINA 2PBDA 5AQGA 4B1WB 3LDQA 2ITMA 4JN4A 1BDGA 3ZX2A 4Z94A 3G4SN 5C12A 4IXCA 3CPWM 4FOEA 2VWBA 3C65A 3L6QA 3MN6A 5AQYA 2A3ZA 4XH4A 2E2NA 2D0PA 3O1WA 3LDPA 4ILGB 4FWQA 1ATSA 1BOTO 1W2BM 2H3GX 4IWVA 4A61A 2PAVA 3F5TA 4JK8A 3CJ9A 1KAXA 1HPMA 5I9EB 1ZBSA 3CJCA 2YCHA 3VERA 1RFQA 5C0YA 5GIPA 2V7YA 4DKWA 3O6WA 3SJHA 4WCEL 3NVMA 2VGNA 2WUSA 2ZJPL 3QICA 4HWIA 4CZFA 1E4GT 3S41A 4BY9C 2FSKA 3VOVA 3CCMN 3MCAB 3SBGA 4BE7B 1TYQA 4E1JA 5GIOA 4GV3A 1NGEA 3ULEB 4B1UB 4H0TB 4O5FA 3VEOA 4WQ4A 3ATUA 1BWFO 4DB3A 1NGAA 3QMLA 4GVEA 4JD2A 3ATVA 3MMVA 3HOTA 1VQON 3QB0A 3O9TA 4ILHA 4B1XB 2E1ZA 2NNWA 1GLEG 5AQUA 5M1KA 4C1NI 3A5LC 3A8YA 1NJIO 4R79A 2RE2A 1H1VA 4JK7A 2E88A 5KPTA 2KHOA 3CJ1A 3TSQA 3WXJA 4BR7A 4IJNA 2FSJA 4WYBA 2V51B 4BREA 4PKGA 3EZWA 5AZIA 3U9ZA 1EO1A 1NGHA 4RTFD 3PIOL 3M5RA 2CGKA 4BRLA 2ASPA 3CJ7A 3UB5A 1BO5O 4FWKA 2WFBA 2P9NA 3H3OB 1T6CA 1MWMA 1T3VA 2ASMA 4YOTA 4B1VA 2P9LA 4IFEA 3U9DA 5AQPA 3NVKA 2ZGYA 5TKYA 3WQTA 3O9UA 2NZTA 3K9JA 4BC5A 4BRPA 3GE1A 3WXLA 2P9PA 2P9UB 2QI2A 3ZX0A 3ID6A 2GEMA 1VQ8N 4H0OA 2QWMA 5AQQA 1SS6A 1HKCA 2Q2RA 1NWKA 2FXUA 1DEJA 4H0PA 4IO8A 5HL7L 1KXPA 4XJXA 4H5TA 4O8KA 3SLCA 2E1YA 3DXKA 3CJAA 3MX2A 2C1GA 2OTJN 1ZC6A 3O9RA 4LC9B 4AM7A 3MCPA 5LJWA 5M1FA 2CGJA 2EWSA 4WQ5C 3VGLA 1VAZA 3MK6A 4CZKA 1QQNA 1S72N 3R9PA 1O13A 3VF6A 3CERA 4PL7A 2OANA 2D1KA 1TUYA 3TTFA 3FZHA 1OKJA 4FWMA 4KBOA 5M1QA 4IJAA 4FWLA 3EE8A 4FSVA 2NRHA 3C7NA 3D2FA 3DJCA 2HF4A 3P38A 2W41A 1VQLN 1P90A 3CMEN 4GV9A 4FWPA 4F9OA 4BRFA 1LOTB 1ATRA 4DCHA 4BROA 2V7ZA 1BA1A 2ASOA 1GLCG 3EKSA 5KQ8A 3TU5A 3AAPA 5ADXA 1IJJA 3CCEN 3A5OC 4BRGA 2CH5A 3BF3A 5AZJB 2IIRA 1TYQB 3O9SA 4K43A 2QM1A 1ZXOA 3AGRA 4CBXA 3C6AA 5BPNA 1ESVA 4JKDA 3EE9A 2YJEA 3L4IA 2QWOA 1S3XA 1WOQA 3I55N 1BG3A 3CQXA 4NLCA 5EX5A 2AA4A 3KWGA 1U2VA 4EIAA 4UY8O 3IFRA 4BRQA 4BECA 1QVFM 5H1SQ 3O8MA 4OPHA 3G71N 3P31A 4MLHA 5AZJA 3VMFB 2W00A 3CC4N 3O5BA 1SZ2A 3ULEA 2GUPA 3TSPA 3F9MA 3B8AX 5E84A 3CIPA 3CHWA 2WC9A 4IEEA 5JLFA 2KLAA 1DKGD 4YOVA 3AARA 1GLJO 1YAGA 5AQNA 2NRZA 5FPMA 4EAHD 3SAFA 4NLBA 3M6GA 5AQXA 4BRHA 2E2OA 3MN7A 1K73O 3LM9A 1V4SA 3HZ6A 2HOEA 3D2EA 4YOUA 3CC7N 3WUHA 1NGIA 3FR0A 4H03B 3E9LA 2BTFA 5FPDA 5GADP 5AZIB 1WUAA 3U8XA 1G99A 4FWRA 5DM7L 3GDQA 5AQFA 2F7TA 4O8UA 5CR4A 3GOIA 4JKHA 5LJVA 1OVYA 4BC4A 2Q1NA 3WXIA 1SQKA 3GBTA 2FF6A 5F2RA 5GAEP 3RSEB 3I56N 1DT9A 2C1IA 4H5WA 3SAHA 1N8RO 1HKGA 1QQMA 1JJ2M 1J6ZA 4A2AA 1Q82O 3CCVN 5AQRA 1KQSM 4JKBA 4DHYA 4MO5A 5BN8A 4QS8A 3P39A 3VEVA 4DQ8A 1JCGA 4BGBA 1NM1A 3R8EA 3P4IA 4CZLA 3A5MC 5AQLA 1YHQN 2GELA 3WEEA 4MO4A 2BUPA 1HUXA 5KQDA 2RHKA 3G25A 3MN5A 3DAWA 1YVNA 4PHTX 3MX5A 4QS7A 2W40A 3WXKA 3J8AA 4H0XB 4C23A 3J7ZO 3FLCO 5AQZA 4CJ7A 3LL3A 3CXCM 3KHYA 4BC2A 1M1KO 1QHAA 4JNEA 3QFPA 4IZ9A 3UKUA 4CZJA 4KH6A 4JAXA 1BU6O 1ILYA 4PL8A 4IEIA 4A62A 3C6HA 2A41A 3FZKA 3DXMB 1C0GA 3R3LA 5BRHA 2QW9A 3CCQN 2QWQA 2QEXN 3DXMA 1YUWA 2P9KB 2P9SA 3CCLN 3IUCA 1NGJA 1VQ5N 3A0IX 3CD6N 5AFUH 2V52B 4JKEA 1Q81O 2ZF5O 5B8HA 4J8FA 3CCSN 5BPMA 1YITN 4FO0A 4PKIA 5F0XA 3FZMA 4G9ZA 3G6EN 4CBWA 3FFKB 3GG4A 2JWLA 3DXKB 3DLLL 3GL1A 1U6ZA 2QXLA 4FWOA 3A5NC 1C0FA 1NLVA 3VF2A 3BP8A 2UYTA 3ZYYX 1HLUA 4EHTA 3O80A 3ENBA 4JKAA 3UE5A 3ZX3A 1XQSC 3VEYA 2FSNA 2D0OA 2YJFA 1NGCA 3HBTA 3EL2A 3IKMA 3KZBA 3EN9A 2CH6A 3TSUA 1IG8A 3RVCA 3BUZB 5AQSA 2BH1A 2F9TA 2IVNA 1JCFA 2NRWA 3MWPA 4ISFA 4H5NA 3N4PA 2JWKA 3LDNA 4ISGA 4CBUA 4CZGA 5C2FA 1YJ9N 4FOIA 3I33A 1BA0A 4BRNA 5BREA 2QWPA 2DPNA 1DGKN 2J4RA 4JKGA 4KH4A 1HX1A 4YOXA 4HTLA 3CCRN 2YI1A 5AQHA 3D2EB 4U67L 5C2DA 1ATNA 1K8KA 3CETA 4I6MA 1S22A 5AQIA 3VENA 3IMXA 4QS9A 1Q86O 3FZLA 3HRGA 2IVOA 4YDUA 2HBJA 1VQMN 3O9QA 4H5RA 1YIJN 4XH1A 5M1OA 2VYPA 2IVPA 3ID8A 3LM2A 4OPAA 2OTLN 1NGGA 3OA9A 2NRTA 3VEXA 1X3MA 3MN9A 3QDKA 3NMUA 4A59A 3ENHA 2Q36A 3E66A 1CZAN 3N4QA 5DM6L 3CF5L 3SMSA 3UKRA 2HSTA 2P9UA 1T44A 1VQ4N 1W97L 1K8AO 5M1NA 4M7XA 2HMPA 3VF4A 2ZJQL 5EVZA 1NMDA 5AFUA 1VQKN 2P9NB 2ZGZA 3CI5A 1GLAG 1MA9B 2HBMA 1MWKA 2VGMA 3WEEB 1VQPN 4B1YB 3SAGA 2I7NA 4FVUA 3Q7CA 1NGBA 5AQWA 3KK7A 1YXQA 4YOWA 4YORA 4YDUC 4A5AA 4ILJA 5C15A 4L3QA 4MDBA 5FPNA 3OHRA 3H45C 5M1PA 5CE3A 3CQYA 5EXWA 4BRKA 4A57A 5FPEA 1M90O 4XH5A 3VEWA 4BC3A 2HBLA 4BVPA 4CZEA 3EO3A 5JICA 4BR2A 2NRRA 2NRXA 4JKFA 2YHXA 2Q0RA 2A40A 4K25A 1SAZA 2ZWHA 2HF3A 3M1FA 3O4WA 1VQ7N 3DWLA 4M63C 3SK3A 3VTIA 3C0BA 3L4QA 5EY4A 4BQLA 5HOOA 3WQUA 1Q7YO 5AR0A 1VQ9N 1EQYA 3E9PA 3IDHA 5KPRA 2GX9A 2P9SB 1GLLO 4BRMA 2P9PB 1YI2N 1T6DA 3MWTA 4IOCL 1Q18A 4BG8A 3CMAN 4H5VA 4BRAA 3VGKA 4CD3A 5BRDA 1GLDG 2VCPA 3C7NB 3D2FB 3HI0A 4AF1A 1VQNN 4Y0WA 3ZETB 1YJNN 1Z05A 3ZETA 3QFUA 3ZEUB 1NBWA 5JLHA 4CD1A 3ZEUA 1VQ6N 4IOAL 4FWNA 1BUPA 4JKGB 4BRCA 3HM8A 5LY3A 1YF5L 1V4TA 1Y64A 2CGLA 4PKHA 5F1XA 4RWTA 1QZ5A 1RDWX 2E8AA 3D6RA 3R6MA 4BG9A 4WFAL 2YHYA 4B1ZA 3D7EO 3VEZA 1RDUA 3H3NO 3I8BA 4CZMA 3QBWA 1E4FT 2A5XA 1JCEA 3PLAA 1KC8O 4FPBA 1TUUA 3CJBA 3W3DA 4BGAA 4BR0A 5JMVA 1GLFO 4WQ4C 2P9IB 1D4XA 4JHDA 1P8ZA 3T69A 2P9IA 4JHDB 4K42A 1U2VB 4BR4A 3L0QA 2NRVA 3PIPL 2PFUA 2F9WA 3HTVA 3WT0A 3T7ZA 1HJOA 3TTCA 3FE1A 3HSCA 1MDUB 3LDLA 2HBKA 3H1QA 3H6EA 3JS6A 5BN9A 5E26A 3W0LA 2GWJA 4CZHA 3VTHA 4RCHA 4YOYA 4EFHA 1RGIA 3FZFA 4I6MB 3LDOA 1R59O 3OW2M 3Q7BA 4KH5A 5AQMA 1GLBG 3BF1A 3CC2N 3EKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FLO A;  4FPA A;  4BR5 A;  3VES A;  1X3N A;  5AQT A;  2Q0U A;  4NO7 A;  1KAZ A;  4EHU A;  4K41 A;  4XEI A;  4BQZ A;  1KAY A;  4H0V B;  3UKR B;  1QQO A;  2E20 A;  2QWN A;  4BVO A;  4JD2 B;  4GY2 B;  4AM6 A;  4BRI A;  3H46 O;  5AQV A;  2A6A A;  3VGM A;  4MLE A;  5AQK A;  3TPQ A;  4BR9 A;  2A42 A;  5ADX H;  4M7Y A;  3FGU A;  3RSE A;  2P9L B;  5ELZ A;  3U4L A;  5BR9 A;  1K8K B;  2NLX A;  3JXU A;  1HKB A;  1NGF A;  3AY9 A;  4FL9 A;  4B9Q A;  5KPZ A;  5AQO A;  4ISE A;  1NGD A;  2AP1 A;  5BPL A;  3SMP A;  2FF3 B;  2Q97 A;  4H0Y B;  1XC3 A;  5EOY A;  4A2B A;  3O08 A;  3QBX A;  4CI6 A;  2E2P A;  2Q31 A;  5BRF A;  1QZ6 A;  3VPZ A;  1XUP O;  3H1V X;  4GNI A;  2D4W A;  1X9J A;  3UKU B;  2GWK A;  2QWR A;  2GTD A;  5AQJ A;  2E2Q A;  2P9K A;  1LCU A;  1Z6R A;  3MDQ A;  4WQ5 A;  3VET A;  3ENO A;  4FWS A;  3O1B A;  2YHW A;  3KVG A;  2QWL A;  2I7P A;  4NB4 A;  3AAQ A;  4BRD A;  3BEX A;  3M3Z A;  2PBD A;  5AQG A;  4B1W B;  3LDQ A;  2ITM A;  4JN4 A;  1BDG A;  3ZX2 A;  4Z94 A;  4IXC A;  4FOE A;  2VWB A;  3MN6 A;  3L6Q A;  5AQY A;  2A3Z A;  4XH4 A;  2E2N A;  2D0P A;  3O1W A;  3LDP A;  4FWQ A;  1ATS A;  1BOT O;  2H3G X;  4IWV A;  4A61 A;  2PAV A;  3CJ9 A;  1KAX A;  1HPM A;  1ZBS A;  3CJC A;  2YCH A;  3VER A;  1RFQ A;  2V7Y A;  3O6W A;  3SJH A;  2WUS A;  3QIC A;  4HWI A;  4CZF A;  1E4G T;  3S41 A;  2FSK A;  3VOV A;  1TYQ A;  4E1J A;  1NGE A;  3ULE B;  4B1U B;  4H0T B;  4O5F A;  3VEO A;  4WQ4 A;  3ATU A;  1BWF O;  4DB3 A;  1NGA A;  3QML A;  4JD2 A;  3ATV A;  3MMV A;  3QB0 A;  4B1X B;  2E1Z A;  1GLE G;  5AQU A;  3A5L C;  3A8Y A;  1H1V A;  2E88 A;  5KPT A;  2KHO A;  3CJ1 A;  3WXJ A;  4BR7 A;  4IJN A;  2FSJ A;  4WYB A;  2V51 B;  4BRE A;  4PKG A;  3EZW A;  5AZI A;  3U9Z A;  1NGH A;  4RTF D;  2CGK A;  4BRL A;  2ASP A;  3CJ7 A;  3UB5 A;  1BO5 O;  4FWK A;  2P9N A;  3H3O B;  1T6C A;  1MWM A;  2ASM A;  4B1V A;  2P9L A;  3U9D A;  5AQP A;  2ZGY A;  5TKY A;  3WQT A;  4BRP A;  2NZT A;  4BC5 A;  3GE1 A;  3WXL A;  2P9P A;  2P9U B;  3ZX0 A;  2GEM A;  4H0O A;  2QWM A;  5AQQ A;  1HKC A;  2Q2R A;  1NWK A;  2FXU A;  1DEJ A;  4H0P A;  4IO8 A;  1KXP A;  4H5T A;  4O8K A;  3SLC A;  2E1Y A;  3DXK A;  3CJA A;  1ZC6 A;  4LC9 B;  4AM7 A;  3MCP A;  5LJW A;  2CGJ A;  2EWS A;  4WQ5 C;  3VGL A;  3MK6 A;  4CZK A;  1QQN A;  3R9P A;  3VF6 A;  3CER A;  4PL7 A;  2OAN A;  2D1K A;  1TUY A;  3FZH A;  1OKJ A;  4FWM A;  4KBO A;  4IJA A;  4FWL A;  4FSV A;  2NRH A;  3C7N A;  3D2F A;  3DJC A;  2HF4 A;  2W41 A;  4FWP A;  4F9O A;  4BRF A;  1LOT B;  1ATR A;  4DCH A;  4BRO A;  2V7Z A;  1BA1 A;  2ASO A;  1GLC G;  3EKS A;  5KQ8 A;  3TU5 A;  3AAP A;  5ADX A;  1IJJ A;  3A5O C;  4BRG A;  2CH5 A;  3BF3 A;  5AZJ B;  2IIR A;  1TYQ B;  4K43 A;  2QM1 A;  1ZXO A;  4CBX A;  5BPN A;  1ESV A;  2YJE A;  3L4I A;  2QWO A;  1S3X A;  1WOQ A;  1BG3 A;  3CQX A;  5EX5 A;  2AA4 A;  1U2V A;  4EIA A;  3IFR A;  4BRQ A;  3O8M A;  4MLH A;  5AZJ A;  3O5B A;  1SZ2 A;  3ULE A;  2GUP A;  3F9M A;  3B8A X;  5E84 A;  3CIP A;  3CHW A;  5JLF A;  1DKG D;  3AAR A;  1GLJ O;  1YAG A;  5AQN A;  5FPM A;  4EAH D;  3M6G A;  5AQX A;  4BRH A;  2E2O A;  3MN7 A;  3LM9 A;  1V4S A;  3HZ6 A;  2HOE A;  3D2E A;  3WUH A;  1NGI A;  3FR0 A;  4H03 B;  2BTF A;  5FPD A;  5AZI B;  1WUA A;  3U8X A;  1G99 A;  4FWR A;  3GDQ A;  5AQF A;  3GOI A;  5LJV A;  4BC4 A;  2Q1N A;  3WXI A;  1SQK A;  3GBT A;  2FF6 A;  5F2R A;  3RSE B;  4H5W A;  1HKG A;  1QQM A;  1J6Z A;  4A2A A;  5AQR A;  4DHY A;  4MO5 A;  5BN8 A;  4QS8 A;  3VEV A;  4DQ8 A;  1JCG A;  4BGB A;  1NM1 A;  3R8E A;  3P4I A;  4CZL A;  3A5M C;  5AQL A;  2GEL A;  3WEE A;  4MO4 A;  2BUP A;  1HUX A;  5KQD A;  3G25 A;  3MN5 A;  3DAW A;  1YVN A;  4QS7 A;  2W40 A;  3WXK A;  3J8A A;  4H0X B;  4C23 A;  3FLC O;  5AQZ A;  4CJ7 A;  3LL3 A;  3KHY A;  4BC2 A;  1QHA A;  4JNE A;  3QFP A;  4IZ9 A;  3UKU A;  4CZJ A;  4JAX A;  1BU6 O;  4PL8 A;  4A62 A;  2A41 A;  3FZK A;  3DXM B;  1C0G A;  5BRH A;  2QW9 A;  2QWQ A;  3DXM A;  1YUW A;  2P9K B;  2P9S A;  3IUC A;  1NGJ A;  3A0I X;  5AFU H;  2V52 B;  2ZF5 O;  5B8H A;  4J8F A;  5BPM A;  4PKI A;  4FO0 A;  5F0X A;  3FZM A;  4CBW A;  3GG4 A;  3FFK B;  3DXK B;  3GL1 A;  1U6Z A;  2QXL A;  4FWO A;  3A5N C;  1C0F A;  1NLV A;  3VF2 A;  3BP8 A;  2UYT A;  1HLU A;  4EHT A;  3O80 A;  3UE5 A;  3ZX3 A;  1XQS C;  3VEY A;  2FSN A;  2D0O A;  2YJF A;  3HBT A;  1NGC A;  3EL2 A;  3KZB A;  3EN9 A;  2CH6 A;  1IG8 A;  3BUZ B;  5AQS A;  2F9T A;  2IVN A;  1JCF A;  4ISF A;  4ISG A;  4CBU A;  4H5N A;  4CZI A;  4CZG A;  3LDN A;  4FOI A;  3I33 A;  1BA0 A;  4BRN A;  5BRE A;  2QWP A;  2DPN A;  1DGK N;  2J4R A;  1HX1 A;  4HTL A;  2YI1 A;  5AQH A;  3D2E B;  1ATN A;  1K8K A;  3CET A;  4I6M A;  1S22 A;  5AQI A;  3VEN A;  3IMX A;  4QS9 A;  3FZL A;  2IVO A;  4YDU A;  4H5R A;  4XH1 A;  2VYP A;  2IVP A;  3ID8 A;  3LM2 A;  1NGG A;  3VEX A;  1X3M A;  3MN9 A;  3QDK A;  3ENH A;  2Q36 A;  1CZA N;  3SMS A;  3UKR A;  2P9U A;  1T44 A;  4M7X A;  2HMP A;  3VF4 A;  5EVZ A;  1NMD A;  5AFU A;  2P9N B;  2ZGZ A;  3CI5 A;  1GLA G;  1MA9 B;  1MWK A;  3WEE B;  4B1Y B;  2I7N A;  1NGB A;  5AQW A;  1YXQ A;  4YDU C;  4L3Q A;  5FPN A;  3OHR A;  3H45 C;  5CE3 A;  5I9E B;  3CQY A;  5EXW A;  4BRK A;  5FPE A;  4XH5 A;  3VEW A;  4BC3 A;  4CZE A;  4BVP A;  3EO3 A;  5JIC A;  4BR2 A;  2YHX A;  2Q0R A;  2A40 A;  4K25 A;  1SAZ A;  2ZWH A;  2HF3 A;  3M1F A;  3O4W A;  3DWL A;  4M63 C;  3SK3 A;  3C0B A;  5EY4 A;  4BQL A;  3WQU A;  5AR0 A;  1EQY A;  3IDH A;  5KPR A;  2P9S B;  1GLL O;  4BRM A;  2P9P B;  1T6D A;  1Q18 A;  4BG8 A;  4H5V A;  4BRA A;  3VGK A;  4CD3 A;  5BRD A;  1GLD G;  2VCP A;  3C7N B;  3D2F B;  3HI0 A;  4Y0W A;  3ZET B;  1Z05 A;  3ZET A;  3QFU A;  3ZEU B;  1NBW A;  5JLH A;  4CD1 A;  3ZEU A;  4FWN A;  1BUP A;  4BRC A;  3HM8 A;  5LY3 A;  1V4T A;  1Y64 A;  2CGL A;  4PKH A;  5F1X A;  4RWT A;  1QZ5 A;  1RDW X;  2E8A A;  3R6M A;  4BG9 A;  2YHY A;  4B1Z A;  3D7E O;  3VEZ A;  3I8B A;  3H3N O;  4CZM A;  3QBW A;  1E4F T;  2A5X A;  1JCE A;  4FPB A;  1TUU A;  3CJB A;  3W3D A;  4BGA A;  4BR0 A;  5JMV A;  1GLF O;  4WQ4 C;  2P9I B;  1D4X A;  4JHD A;  1P8Z A;  2P9I A;  4JHD B;  4K42 A;  1U2V B;  4BR4 A;  3L0Q A;  2F9W A;  3HTV A;  3WT0 A;  1HJO A;  3FE1 A;  3HSC A;  1MDU B;  3LDL A;  3H1Q A;  3H6E A;  3JS6 A;  5BN9 A;  5E26 A;  3W0L A;  2GWJ A;  4CZH A;  4RCH A;  4EFH A;  3FZF A;  1RGI A;  4I6M B;  3LDO A;  1R59 O;  5AQM A;  1GLB G;  3BF1 A;  3EKU A; 
#chains in the Genus database with same CATH topology
 4C8K A;  5J2N A;  2NUB A;  3HP9 A;  4DU3 A;  3BZK A;  2Q0U A;  3SUN A;  2VG6 A;  4NO7 A;  4BEB A;  4H0V B;  4O44 A;  3HXM A;  5FRM A;  2E20 A;  1TL1 A;  2PYJ A;  2QWN A;  4BVO A;  3ZCM A;  4CJQ A;  4BRI A;  4CGJ A;  5AQV A;  3LDS A;  3O3F A;  1ZBI A;  3QNO A;  4KHQ A;  3AA3 A;  4DR5 K;  3M8Q A;  1QSL A;  3O4Q A;  1RT7 A;  3TAN A;  4U7B A;  1VSE A;  2NLX A;  1NJX A;  4JK9 A;  3O3G A;  5KPZ A;  1HJR A;  1LV5 A;  1NGD A;  2KZZ A;  4BAC A;  2D0A A;  1RBV A;  2Q97 A;  1WBD A;  3HOS A;  1FK9 A;  2OCE A;  2Q3S A;  2KQ2 A;  1JLA A;  3KK1 A;  5GAG P;  5BRF A;  2BAN A;  3VPZ A;  4O5B A;  2D4W A;  4WFB L;  4HUF A;  1NNE A;  3HPO A;  4JV5 K;  2GTD A;  3JAM O;  3HM9 A;  4JI3 K;  3MDQ A;  1JLE A;  3ITH A;  4ELT A;  1RBR A;  1TKZ A;  4C1N K;  1ITG A;  2O8C B;  3L3V A;  1I94 K;  4JEP A;  2XY6 A;  1KFS A;  3LPU A;  3AAQ A;  4B1W B;  1TV6 A;  3LDQ A;  4WE1 A;  2OPP A;  4LSL A;  4XH4 A;  4ILG B;  4IWV A;  4CHP A;  3PSF A;  1HPM A;  4BE1 A;  3CJC A;  3KD1 E;  1OH7 A;  3VER A;  3A2F A;  2ATQ A;  3DRR A;  1OH5 A;  2Z1G A;  5FRO A;  5GIP A;  3LPT A;  4DWI A;  4WCE L;  3NVM A;  2WUS A;  4DSE A;  4CZF A;  4BY9 C;  3MCA B;  4J2E A;  4CGI A;  1TYQ A;  3BDP A;  2O8D A;  4B1U B;  4I9L A;  3OYD A;  3ZT2 A;  4EP4 A;  4CF1 A;  1ASU A;  3QB0 A;  3O9T A;  4B1X B;  2NNW A;  3UIQ A;  2GUI A;  3A8Y A;  2OPS A;  4R79 A;  2E88 A;  3V1O A;  1TKT A;  5KGW A;  4IJN A;  4DQI A;  3U9Z A;  1NJZ A;  1CZ9 A;  2CGK A;  1NMN A;  4OGE A;  4BRL A;  4AHT A;  2ASP A;  4O4G A;  2WFB A;  3THX B;  3AVF A;  1JL1 A;  1GOC A;  5C25 A;  4FJ5 A;  3U9D A;  1B92 A;  5AQP A;  5TKY A;  4IBN A;  1KCF A;  2YKN A;  2PZS A;  2HHS A;  3O9U A;  4BRP A;  4LF7 K;  3ZX0 A;  5KTQ A;  1LWF A;  2Q2R A;  3AVJ A;  1RTH A;  1DEJ A;  3OYK A;  4IO8 A;  3PX4 A;  2YHB A;  2HHQ A;  1IO2 A;  4O8K A;  3SLC A;  3WNH A;  3VN5 A;  4JS5 A;  2C1G A;  4LC9 B;  4DQP A;  4E7H A;  2CGJ A;  4DR4 K;  3MK6 A;  4BWJ A;  4CZK A;  2XO7 A;  4PL7 A;  3DLK A;  1X9W A;  1IKY A;  4IJA A;  4LSN A;  3D2F A;  4JI0 K;  4PWD A;  1VQL N;  1P90 A;  3PUF A;  4J2D A;  4OLA A;  4FWP A;  4F9O A;  4DCH A;  2ZQB A;  4CVN E;  4BRO A;  3OYL A;  2V7Z A;  1IJJ A;  1OH8 A;  3O9S A;  2QM1 A;  4CEF A;  2P5G A;  5HRS A;  4JKD A;  4CJV A;  1RTD A;  2OA8 A;  1BG3 A;  3CQX A;  4CJL A;  1N33 K;  4BEC A;  3HST B;  3V81 A;  4YHH K;  4B3O A;  4DFP A;  3VMF B;  2FBT A;  4DUY K;  1B9D A;  3M8P A;  2OPQ A;  4B8C A;  1L3T A;  1DKG D;  3AAR A;  1GLJ O;  4DV5 K;  5AQX A;  3MAQ A;  3LM9 A;  3CC7 N;  3EY1 A;  4FLT A;  3E9L A;  4RW9 A;  5FPD A;  5GAD P;  1HYZ A;  3U8X A;  2P1J A;  1C1B A;  1GOB A;  3GDQ A;  3VQ6 A;  4M3Y A;  4AHV A;  3TAR A;  5CR4 A;  4JKH A;  5LJV A;  2Y1I A;  4OKJ A;  4BC4 A;  2Q1N A;  3NF6 A;  1EWR A;  4B8A B;  5GAE P;  3L8B A;  1DT9 A;  1UA0 A;  3SAH A;  3HP6 A;  3QLH A;  5AQR A;  1KQS M;  2XRI A;  4JKB A;  4DHY A;  2PY5 A;  4CJE A;  4KRE A;  2YNF A;  3P39 A;  1HNZ K;  4X66 K;  3R8E A;  3A5M C;  5KI6 A;  4CJR A;  3WEE A;  1XNR K;  4GMJ B;  2RHK A;  3G25 A;  4LFC K;  2VG7 A;  1S9G A;  4MFB A;  4QS7 A;  2W40 A;  1C0U A;  3FLC O;  3CXC M;  4BC2 A;  1M1K O;  3QFP A;  1W9H A;  4JAX A;  4Q0B A;  2DFH A;  1S6P A;  3C6H A;  3FZK A;  3DXM B;  3EZ5 A;  3KD5 E;  2KTQ A;  1BIS A;  1NJW A;  1NOY A;  3QIN A;  4KRF A;  1VQ5 N;  4LFB K;  3A0I X;  3O4N A;  5AFU H;  3S5T A;  2V52 B;  4JKE A;  1S6Q A;  4J8F A;  1YIT N;  4PKI A;  1RT4 A;  3FZM A;  4CJT A;  3QEX A;  3G6E N;  4OPK A;  4FWO A;  1ASV A;  3VF2 A;  3BP8 A;  2UYT A;  3ZSX A;  1HLU A;  4ID1 A;  3ZYY X;  3KTQ A;  4DF8 A;  4K8Z A;  4B9M A;  1XQS C;  2D0O A;  4OX9 K;  2YJF A;  3B6O A;  3RVC A;  2BH1 A;  4ICL A;  4PA1 A;  4ISG A;  2IVN A;  4ISF A;  4CBU A;  4CZI A;  4CZG A;  3N4P A;  4BE2 A;  5BRE A;  4JKG A;  4KH4 A;  5LMN K;  4KFB A;  3S3N A;  1TK5 A;  4IG3 A;  1ATN A;  4I6M A;  5AQI A;  1KFD A;  1NK8 A;  2B6A A;  3VEN A;  3HRG A;  1VQM N;  1C1A A;  4H5R A;  4FZY A;  3T1A A;  1IBK K;  3OYM A;  4NYF A;  3MN9 A;  4H4O A;  3NMU A;  3G0Z A;  3VQ8 A;  1CZA N;  3UKR A;  2HST A;  3CM5 A;  4JS4 A;  2Z1H A;  1W97 L;  4H8K A;  5M1N A;  1S9E A;  4M7X A;  4C8N A;  1E3M A;  1NMD A;  2XY5 A;  3ULD A;  2ZGZ A;  2VGM A;  4NCA A;  3RMC A;  1VQP N;  4Z4G A;  3WNF A;  4FVU A;  5AQW A;  4FZZ A;  1WSF A;  2O8B A;  4YDU C;  4MDB A;  1VSL A;  5EXW A;  4BRK A;  1RT6 A;  2ITG A;  3OYH A;  3HVR A;  5JIC A;  1VSF A;  2X74 A;  3D45 A;  2NRR A;  3TI0 A;  1XHZ A;  2Q0R A;  4DFM A;  2P5O A;  3DWL A;  1C6V A;  4M63 C;  3SK3 A;  3VTI A;  3C0B A;  4CJ4 A;  1TAU A;  4B3T K;  1Q7Y O;  2W6K A;  3E9P A;  2WTU A;  2BE2 A;  4BRM A;  3KLH A;  4JRQ A;  4Y1D A;  4BG8 A;  4AQY K;  4BRA A;  4CD3 A;  3C7N B;  5IWA K;  2I5J A;  4AF1 A;  1WBB A;  3ZET A;  1BQM A;  3ZEU B;  1T7P A;  5KRT A;  3LAK A;  5JLH A;  4CD1 A;  4MQ3 A;  1C0M A;  4JKG B;  4BRC A;  3HM8 A;  3I0R A;  3C6T A;  1Y64 A;  4Z4I A;  3U6F A;  3ZSO A;  1HNW K;  4WFA L;  4RW6 A;  4CEB A;  3VEZ A;  3H3N O;  4F3T A;  1JCE A;  4CJW A;  3HJF A;  5CYM A;  1TUU A;  1RDB A;  1GLF O;  1D4X A;  4NXN K;  1P8Z A;  3T69 A;  2P9I A;  4JHD B;  1U2V B;  2G8U A;  5C24 A;  3RRG A;  4O0I A;  2PFU A;  1VSK A;  4E7I A;  5E26 A;  3VTH A;  3OW2 M;  3FZF A;  3HT3 A;  3LDO A;  4CHN A;  3AV9 A;  3VES A;  3VQQ A;  3OYF A;  3KWI A;  5C10 A;  3AO3 A;  3SQ0 A;  1QS4 A;  3K2P A;  2QA4 N;  4FXD A;  3UKR B;  1QQO A;  3NCI A;  4GY2 B;  3TTD A;  2G8H A;  2KW4 A;  1QVG M;  1X1P A;  4IFV A;  1TKD A;  1VSM A;  3FGU A;  4CER A;  4DR2 K;  2P9L B;  2DFE A;  5CZ2 A;  1I3A A;  1JLC A;  4E1M A;  4CGG A;  1HKB A;  4FJL A;  4KB0 A;  4W5N A;  2B4J A;  2GV9 A;  4CEQ A;  4K0K K;  3HPG A;  1J5E K;  2IC3 A;  4JI7 K;  3LP0 A;  5EOY A;  4FK4 A;  3O08 A;  1Q8I A;  2HVI A;  3QBX A;  4GV6 A;  3SBT A;  1XMQ K;  3AO2 A;  2ZJR L;  3AO1 A;  2HVH A;  3C6U A;  4FJK A;  3K5L A;  2QKB A;  3AGK A;  2F8S A;  5JS1 A;  3OYA A;  3DOL A;  1JLG A;  3KJV A;  4B3S K;  4DSI A;  1IBL K;  2RF2 A;  2P9K A;  1LCU A;  1Z6R A;  4CEZ A;  2OZM A;  4GVM A;  3DYA A;  4AH9 A;  4DU1 A;  5GAH P;  2QWL A;  3F2K A;  3E9O A;  3K9K A;  1WB9 A;  4JKC A;  4MDA A;  4CHQ A;  2ITM A;  3ZX2 A;  5J1E A;  1KVA A;  3G4S N;  3CPW M;  4FOE A;  2VWB A;  1JLQ A;  3LP3 A;  1C1C A;  5J2M A;  2E2N A;  1NKB A;  4CJF A;  2D0P A;  3O1W A;  3JYT A;  3V9W A;  3P83 D;  1BOT O;  4FLU A;  2PAV A;  3F5T A;  3IRX A;  3CFR A;  2YCH A;  1RFQ A;  5C0Y A;  3VQE A;  3SPY A;  4DKW A;  3O6W A;  2VGN A;  4Y1C A;  4HWI A;  1E4G T;  2HNZ A;  4FW1 A;  4DMN A;  3SBG A;  3HK2 A;  3TAB A;  1UA1 A;  4GV3 A;  4LF8 K;  4H0T B;  2E4L A;  4CGF A;  1NG9 A;  4DB3 A;  4JD2 A;  1HQE A;  4GVE A;  3S3O A;  1VQO N;  3NHG A;  5M1K A;  1NJI O;  3NF9 A;  3KLI A;  4KV8 A;  1RBU A;  1H1V A;  3PO5 A;  3TSQ A;  4F8R A;  3WXJ A;  3DOK A;  2UXC K;  2FSJ A;  4WYB A;  1RT2 A;  2V51 B;  4BRE A;  4PKG A;  2ZE2 A;  4JI4 K;  1XHX A;  3M5R A;  1L3V A;  3RTV A;  1MWM A;  2ASM A;  4YOT A;  2VQE K;  3THW A;  4FLW A;  1TKX A;  2O8F A;  4IFE A;  3T3F A;  1DTT A;  1HR0 K;  3J81 O;  4DTS A;  3U3G A;  4ZHR A;  3GE1 A;  3WXL A;  5E41 A;  3RRH A;  3SV3 A;  2QI2 A;  3BZC A;  5AQQ A;  1RT1 A;  1NWK A;  3V4I A;  5HL7 L;  1LW2 A;  1NOZ A;  4CHY A;  4XJX A;  1FW6 A;  4H5T A;  4JLH A;  1BI4 A;  2KFN A;  2E1Y A;  3DXK A;  5SZT A;  3CJA A;  1BI4 B;  3MCP A;  3L3U A;  2ETJ A;  1KLM A;  1O13 A;  4DQR A;  3CER A;  4X65 K;  2D1K A;  4B9T A;  4CEE A;  4DTO A;  5LMU K;  1RDA A;  2PYL A;  2HHH K;  2HF4 A;  4CF0 A;  4BRF A;  1LOT B;  3FFI A;  4J2A A;  2ASO A;  1GLC G;  3EKS A;  5KQ8 A;  3TU5 A;  2O8E A;  3CCE N;  3A5O C;  3BF3 A;  1TYQ B;  2O8D B;  1JXB A;  1ZXO A;  3J7A P;  3AGR A;  3HVT A;  1BIU A;  2QWO A;  1QQC A;  1VHX A;  1SKW A;  5EX5 A;  2AA4 A;  1FKP A;  4B9U A;  3VQ9 A;  3QER A;  2FBX A;  1U45 A;  5AJ3 K;  3G71 N;  1CXQ A;  5AZJ A;  1ASW A;  1A5W A;  4HTU A;  2GUP A;  3TSP A;  4Z4C A;  1C0T A;  4YY3 K;  4E3S A;  4YOV A;  1YAG A;  3SAF A;  4BRH A;  4NCB A;  1VK0 A;  4YOU A;  2XY8 A;  2WOM A;  2QKK A;  4RW8 A;  1FXX A;  3THV A;  1BCM A;  4DR6 K;  1XNQ K;  4CJP A;  1WSI A;  4FWR A;  5AQF A;  4H4M A;  1TK0 A;  2F7T A;  4O8U A;  4CJ5 A;  3GOI A;  2HHV A;  1Y97 A;  4DV7 K;  2C1I A;  3MXI A;  1QQM A;  1JJ2 M;  4JI6 K;  3VQA A;  2G8W A;  2QXF A;  2JGU A;  4MO5 A;  1U47 A;  5DMR A;  4LFA K;  4E7K A;  4BGB A;  4CJS A;  4E7J A;  4CZL A;  5AQL A;  1YHQ N;  4F2S A;  1S1W A;  2GEL A;  2BUP A;  1HUX A;  5KQD A;  4Z0U A;  2YNI A;  4FW2 A;  3D0P A;  3MEC A;  1YVN A;  1WSE A;  3KKS A;  4IFY A;  4DTN A;  3J7Z O;  4CJ7 A;  2IGI A;  3LL3 A;  4JNE A;  4IZ9 A;  4M3R A;  1K6Y A;  2BGG A;  1BQN A;  1BU6 O;  5JEN A;  4A62 A;  2O8F B;  1RDC A;  2A41 A;  1Z26 A;  5BRH A;  2QW9 A;  4I7F A;  2QWQ A;  4IDK A;  4O0J A;  5CZ1 A;  4FM0 A;  3CCL N;  4FVM A;  4EP5 A;  3CCS N;  4FO0 A;  5F0X A;  3LWL A;  4FCY A;  4JI1 K;  4DV4 K;  1U6Z A;  2QXL A;  2G8K A;  1FJG K;  4OJR A;  3O80 A;  4YFU A;  1NGC A;  3EL2 A;  3BUZ B;  3DM2 A;  2F96 A;  1JLB A;  2F9T A;  3MWP A;  4H5N A;  4CK1 A;  1YJ9 N;  1QSS A;  4FOI A;  1RBS A;  1F21 A;  4BRN A;  2QWP A;  2J4R A;  3CCR N;  1HX1 A;  5AQH A;  3D2E B;  3VA3 A;  4U67 L;  1ZBU A;  3TAM A;  1S22 A;  3LAL A;  1SUQ A;  3FZL A;  2IVO A;  4DV3 K;  2HBJ A;  5HP1 A;  4XH1 A;  5M1O A;  3HYF A;  2OTL N;  3OA9 A;  3VEX A;  3THY B;  4A59 A;  1LAW A;  1NK6 A;  3SMS A;  4BDZ A;  1T44 A;  4E0D A;  1SV5 A;  4C8M A;  2ZJQ L;  5AFU A;  3ZSY A;  1KVC A;  1MA9 B;  2HBM A;  4B1Y B;  4CEO A;  3KK7 A;  3QNN A;  4YOR A;  3LZJ A;  4ILJ A;  5FPN A;  5CE3 A;  3H45 C;  5FPE A;  4A57 A;  3B6P A;  4XH5 A;  4BC3 A;  1QTM A;  2UU9 K;  4CZE A;  4BVP A;  2HHI A;  1BCO A;  2X6N A;  4BR2 A;  4FJM A;  4K25 A;  3O4W A;  1VQ7 N;  5HOO A;  4FJG A;  3K5N A;  5KPR A;  2GX9 A;  4CJ3 A;  2P9S B;  5JS2 A;  1Q18 A;  2D5R A;  1J5O A;  3VGK A;  3KK2 A;  2VCP A;  2OPR A;  2VG5 A;  5J2Q A;  3ALY A;  3ZET B;  1XI1 A;  1ZBH A;  4FWN A;  3QES A;  4LY7 A;  3AA4 A;  4ZTF A;  2O8E B;  1WSJ A;  2E8A A;  3D6R A;  4X64 K;  5HRP A;  3D7E O;  4CZM A;  1RDU A;  3I8B A;  1E4F T;  2A5X A;  1T8E A;  4V19 S;  2G8I A;  3PLA A;  1KC8 O;  3TAG A;  4BR0 A;  1XC9 A;  4WQ4 C;  1NJY A;  3L2Q A;  4BR4 A;  4DV0 K;  4FLX A;  2XHB A;  2NRV A;  2F9W A;  3THY A;  3TTC A;  4HVJ A;  3LDL A;  1EWQ A;  3H1Q A;  3H6E A;  3JS6 A;  3AVM A;  4CZH A;  4RCH A;  4YOY A;  4FJJ A;  4EZ9 A;  4I6M B;  1R59 O;  3Q7B A;  3ZT1 A;  5AQM A;  3QIO A;  5DM6 L;  3EKU A;  3L2V A;  2FLO A;  1HPZ A;  1KD1 O;  1K9M O;  3VQB A;  1EKE A;  4AHR A;  3CQ8 A;  3OBW A;  5LL6 Z;  1TAQ A;  4EHU A;  3CFO A;  4K41 A;  3QEI A;  3CCU N;  3IG1 A;  4BQZ A;  3RMD A;  1T03 A;  4AM6 A;  1IKW A;  2A6A A;  5AQK A;  4BR9 A;  3VGM A;  4N47 A;  2A42 A;  5ADX H;  5I42 A;  4CJK A;  4M7Y A;  4DR3 K;  1YVU A;  3CCJ N;  3E1Y A;  4RG8 A;  3JSM A;  2Y1J A;  1YJW N;  3NFA A;  4FJ7 A;  1K8K B;  3JXU A;  4OVL A;  1J54 A;  3SI6 A;  1L5U A;  1RTJ A;  3AVN A;  4CCH A;  4ISE A;  2IS3 A;  1NK5 A;  4IDH A;  3NGY A;  4F4K A;  2RPI A;  4HCB A;  5I3U A;  2AP1 A;  4CK2 A;  2FF3 B;  4H0Y B;  2DTU A;  1JLF A;  4O55 A;  4FM1 A;  2KFZ A;  4WFN L;  3T1Y K;  2E6M A;  4CI6 A;  4OO1 J;  3P1G A;  2E2P A;  2Q31 A;  4F2R A;  1QZ6 A;  5MLC Q;  3SUQ A;  2UUA K;  2FBV A;  1EX4 A;  3H1V X;  5CY4 A;  1O1W A;  4KTQ A;  2P51 A;  1X9J A;  3R1X A;  4B08 A;  3RR8 A;  5HRO A;  3NDK A;  4CES A;  4WF9 L;  5AQJ A;  2E2Q A;  4E1N A;  4A5B A;  4WQ5 A;  3ENO A;  4FWS A;  4C8L A;  3O1B A;  2YHW A;  4DSF A;  3KVG A;  2WBN A;  5JVH L;  4NXM K;  4NB4 A;  2E5L K;  4BRD A;  2KKZ A;  3BEX A;  4JN4 A;  4PQU A;  4Z94 A;  4IXC A;  3O3H A;  3C65 A;  3L6Q A;  4W5Q A;  2A1S A;  5AQY A;  2W42 A;  1WSG A;  4LF5 K;  3LDP A;  1ATS A;  2O8C A;  4IKF A;  4A61 A;  4JK8 A;  1KAX A;  1ZBS A;  3HPH A;  1BIZ A;  2UUB K;  2V7Y A;  4ID5 A;  4RW4 A;  3LZI A;  3KIO A;  3T1H K;  1UAX A;  3QIC A;  2Z1J A;  3VOV A;  2HHX A;  4OGC A;  4E1J A;  1VSD A;  1NGE A;  4CW7 B;  4O5F A;  3ZT3 A;  4WQ4 A;  4Q5V A;  2VWK A;  1BWF O;  1NGA A;  3SNN A;  3ATV A;  1SKR A;  2E1Z A;  1GLE G;  5AQU A;  4C1N I;  3A5L C;  2RE2 A;  2HND A;  3SQ1 A;  3WNE A;  2KHO A;  3CJ1 A;  2G8V A;  4BR7 A;  3VQD A;  3AA2 A;  2O8B B;  3EZW A;  5AZI A;  1NK9 A;  1EO1 A;  4CIF A;  3AVC A;  1NGH A;  3KK3 A;  3F73 A;  3UB5 A;  4FWK A;  3H3O B;  3CG7 A;  1T3V A;  4CE9 A;  1G15 A;  2P9L A;  4Z4H A;  2ZGY A;  4DTM A;  4I9Q A;  4BC5 A;  3K9J A;  4ZTJ A;  2GEM A;  1N34 K;  2QWM A;  1IV0 A;  4CGH A;  3HO1 A;  1KXP A;  4W5T A;  3OTO K;  3DMJ A;  3MX2 A;  3RMB A;  2OTJ N;  1ZC6 A;  3IAY A;  5LJW A;  5M1F A;  2EWS A;  4CF8 A;  3SJJ A;  4WQ5 C;  1SL1 A;  1QQN A;  1S72 N;  3DLR A;  3R9P A;  4DV2 K;  3NH0 A;  1TUY A;  4KBO A;  1OKJ A;  3EE8 A;  2NRH A;  1VSH A;  3DJC A;  4R5P A;  4KI6 A;  4DLG A;  2W41 A;  3DLB A;  1T05 A;  3ZSZ A;  5FRN A;  1VRU A;  3BGR A;  3DLE A;  3SV4 A;  3SPZ A;  4DSL A;  1BA1 A;  3AO5 A;  4GW6 A;  4E89 A;  4DS4 A;  3AAP A;  1HRH A;  4KO0 A;  2EHG A;  3DRS A;  4FJX A;  2IIR A;  2OYQ A;  4KTZ A;  1ESV A;  3EE9 A;  3L4I A;  2HHW A;  1WOQ A;  3I55 N;  3KWG A;  1KTQ A;  1HNX K;  4EIA A;  4EZ6 A;  4UY8 O;  2RN2 A;  4DSK A;  4BRQ A;  1QVF M;  5H1S Q;  2FC0 A;  3O8M A;  4OPH A;  3K57 A;  5T7B A;  2W00 A;  3CC4 N;  1SZ2 A;  1S1T A;  3F9K A;  1BHL A;  3B8A X;  3CIP A;  2WC9 A;  2O4I A;  5D3G A;  5FPM A;  4EAH D;  1LWE A;  1D8Y A;  4DR7 K;  2E2O A;  4JI2 K;  3AVA A;  3D2E A;  3WUH A;  1NGI A;  3FR0 A;  1TK8 A;  3QO9 A;  1MU2 A;  2XY7 A;  2LSN A;  1OVY A;  3OYB A;  3WXI A;  3GBT A;  2FF6 A;  3BY5 A;  5F2R A;  3RSE B;  1TL3 A;  2UXB K;  4DTP A;  1QE1 A;  2RKI A;  5HRN A;  2YV0 X;  4CFB A;  4DQ8 A;  4KHY A;  5HBM A;  1N6Q A;  1JCG A;  4AHC A;  4CHO A;  3V9Z A;  1S1X A;  3P4I A;  1D9D A;  3V9U A;  2HHT A;  4FLZ A;  4FJI A;  2E6L A;  3K59 A;  3DAW A;  3NAE A;  1XWL A;  3MX5 A;  3WXK A;  3J8A A;  4H0X B;  3PX6 A;  4DR1 K;  4FJ9 A;  3I0S A;  5AQZ A;  4OLB A;  3KHY A;  1QHA A;  4CZJ A;  1ILY A;  4PL8 A;  3CCQ N;  1C0G A;  2QEX N;  3AA5 X;  4FJH A;  2YNG A;  2P9S A;  3IUC A;  3ASM A;  2ZF5 O;  5B8H A;  4Z4F A;  1DTQ A;  3GG4 A;  2JWL A;  3LP2 A;  3OY9 A;  1C0F A;  1NLV A;  1J9A A;  3MEG A;  3UE5 A;  3VEY A;  4KTW A;  1A5V A;  3KZB A;  1GOA A;  1HNV A;  2CH6 A;  3EN9 A;  3TSU A;  1IG8 A;  4IG0 A;  5AQS A;  2KZM A;  3MXM A;  4E19 A;  2NRW A;  3QIP A;  5C2F A;  1DGK N;  4YOX A;  3SUP A;  1NU0 A;  1SKS A;  4RW7 A;  5C2D A;  3PO4 A;  1U04 A;  3AVB A;  4OKK A;  4CF2 A;  3IMX A;  3C95 A;  4QS9 A;  2FBY A;  4YDU A;  3T19 A;  1KVB A;  2VYP A;  2IVP A;  3LM2 A;  4OPA A;  4N41 A;  2NRT A;  1X3M A;  3QDK A;  3V6D A;  3ENH A;  3ZLJ A;  4JRP A;  2Q36 A;  3E66 A;  3N4Q A;  1IKV A;  1VQ4 N;  4DU4 A;  1K8A O;  3QEW A;  1N36 K;  5C42 A;  2HMP A;  3VF4 A;  3THW B;  3NH1 A;  1WSH A;  3NF8 A;  4CK3 A;  3CM6 A;  4CFA A;  1VQK N;  1WN7 A;  1GLA G;  3ZSQ A;  4KHP K;  2I7N A;  3Q7C A;  1NGB A;  1SL0 A;  1HMV A;  4L3Q A;  5GIN A;  3OHR A;  1M90 O;  3CQY A;  1RT5 A;  3VEW A;  5BR8 K;  3QEV A;  2YHX A;  5KRS A;  2W6L A;  2ZWH A;  5EU7 A;  4M42 A;  3L4Q A;  3WQU A;  1CXU A;  4JYA K;  2B5J A;  1S1U A;  1VSI A;  1GLL O;  1NK4 A;  2P9P B;  3QEP A;  1T6D A;  2D0B A;  1IH7 A;  3MED A;  3CMA N;  1VRT A;  1UWB A;  4FLY A;  2A1R A;  1GLD G;  3KKR A;  3HI0 A;  4Y0W A;  1YJN N;  1Z05 A;  4LF4 K;  4B9S A;  5SWM A;  4E72 A;  4LH5 A;  1YTA A;  5F1X A;  4RWT A;  4CJU A;  1BGX T;  3DLH A;  3ZSW A;  4LH4 A;  1N32 K;  3TAF A;  2BDP A;  3NE6 A;  3CJB A;  3W3D A;  3ZSR A;  3OYI A;  2P9I B;  4JHD A;  3NH2 A;  2HHU A;  3L0Q A;  3PIP L;  1NKC A;  1HJO A;  1YT3 A;  3FE1 A;  3HSC A;  1MDU B;  1WAF A;  5BN9 A;  4XIU A;  3W0L A;  2YHA A;  4EFH A;  4KH5 A;  1GLB G;  4HUG A;  3BF1 A;  4FPA A;  3K5O A;  4BR5 A;  1X3N A;  4KAZ A;  4K8X A;  1HYS A;  5AQT A;  1KAZ A;  3VQC A;  4XEI A;  1IKX A;  5A2Q O;  1KAY A;  4N76 A;  2VWJ A;  3CPE A;  2QTD A;  4QAG A;  5JVG L;  4IO9 L;  4JD2 B;  3H46 O;  3OBY A;  5TKW A;  4MLE A;  3TPQ A;  3OYC A;  4X62 K;  1N5Y A;  1S1V A;  3U3Y A;  1TVR A;  3RWU A;  3V9X A;  4J2B A;  4CEC A;  3RSE A;  5ELZ A;  1RIL A;  3U4L A;  5BR9 A;  1WAJ A;  1NGF A;  1LWC A;  3AY9 A;  4FL9 A;  4B9Q A;  1ZYQ A;  4Z4E A;  5AQO A;  4DQS A;  2F4V K;  5BPL A;  3SMP A;  4AHU A;  1BL3 A;  4M45 A;  2YX6 A;  1XC3 A;  4A2B A;  2GBZ A;  2YKM A;  4DSJ A;  3PX0 A;  1SL2 A;  2X6S A;  2WON A;  1XUP O;  4GNI A;  1EXQ A;  3K5M A;  1U48 A;  3UKU B;  3AVG A;  2GWK A;  2QWR A;  1X9M A;  3WXM B;  5CHI A;  3SQ2 A;  3VET A;  3NF7 A;  3V9S A;  2OZS A;  4DG1 A;  2I7P A;  3VQ7 A;  3RMA A;  3VA0 A;  4DTR A;  2IOC A;  4IOX A;  3VQ5 A;  1NKE A;  3M3Z A;  2PBD A;  5AQG A;  3AO4 A;  1BDG A;  5C12 A;  3MN6 A;  2A3Z A;  4LF6 K;  4FWQ A;  1W2B M;  1U4B A;  2H3G X;  3CJ9 A;  3SZ2 A;  3K58 A;  2HW3 A;  2G8F A;  2HB5 A;  3E01 A;  1W7A A;  1RNH A;  3SJH A;  5FLX O;  2ZJP L;  4N56 A;  3S41 A;  3DLG A;  2FSK A;  3KLE A;  3CCM N;  4DTJ A;  3RR7 A;  4M3X A;  3HL8 A;  4BE7 B;  5HRR A;  5GIO A;  3ULE B;  3VEO A;  1U49 A;  3ATU A;  3HOT A;  3CYM A;  3QML A;  3MMV A;  4ILH A;  2X78 A;  3OS0 A;  2ZM6 K;  1CLQ A;  3TAP A;  1W0H A;  1OVQ A;  4JK7 A;  4QCL A;  5KPT A;  4PUO A;  5K14 A;  4DV1 K;  3SCX A;  1WLJ A;  2DY4 A;  3EYZ A;  4KB1 A;  1Q9X A;  4LD0 A;  4RTF D;  3PIO L;  1UOC A;  4CHZ A;  3OS2 A;  3ISN C;  3CJ7 A;  1BO5 O;  2UXD K;  2P9N A;  1T6C A;  4FZX C;  4B1V A;  1HYV A;  3OYG A;  4OPJ A;  4ELV A;  3LP1 A;  3NVK A;  3QET A;  4DFK A;  1KSP A;  3WQT A;  2NZT A;  2P9P A;  2P9U B;  3ID6 A;  1VQ8 N;  4H0O A;  3OS1 A;  1SS6 A;  5FDL A;  1HKC A;  4DS5 A;  1IBM K;  3VQP A;  3MEE A;  2FXU A;  5DK5 A;  4DLE A;  4H0P A;  1S5J A;  3NGI A;  3S9H A;  1VSJ A;  3O9R A;  4AM7 A;  1D5A A;  1XMO K;  3VGL A;  1VAZ A;  4W5R A;  2O4G A;  3VF6 A;  4F3O A;  4JI8 K;  2OAN A;  3TTF A;  3FZH A;  1QHT A;  4FWM A;  5M1Q A;  2R7Y A;  4FWL A;  4DTX A;  4FSV A;  3C7N A;  3P38 A;  4GV9 A;  3CME N;  1ATR A;  4UQG A;  1RDD A;  1JKH A;  5ADX A;  4BRG A;  2CH5 A;  5AZJ B;  1RBT A;  4K43 A;  3CFP A;  4HHT A;  4CBX A;  3C6A A;  5BPN A;  2YJE A;  1EP4 A;  3L2U A;  1S3X A;  3ZT0 A;  4CEA A;  4NLC A;  1HQU A;  1U2V A;  3IFR A;  4BDP A;  1FKO A;  5KGX A;  3SQ4 A;  3P31 A;  4MLH A;  4KHW A;  3DI6 A;  3O5B A;  3ULE A;  3F9M A;  5E84 A;  3CHW A;  3P5J A;  4IEE A;  3V1Q A;  4PY5 A;  5JLF A;  2KLA A;  5AQN A;  4KHS A;  2NRZ A;  3AVK A;  4NLB A;  3M6G A;  1NK0 A;  4CF9 A;  3MN7 A;  1ZBL A;  1K73 O;  4GKK K;  1V4S A;  3HZ6 A;  2HOE A;  2UUC K;  4H03 B;  1OH6 A;  2BTF A;  2HNY A;  5AZI B;  4B9N A;  1WUA A;  2D0C A;  1G99 A;  3H08 A;  5DM7 L;  4GKJ K;  3LWM A;  1Q9Y A;  4CGD A;  1SQK A;  2JLE A;  3TR8 A;  1L3U A;  3I56 N;  4H5W A;  2HMI A;  4BE0 A;  1N8R O;  1HKG A;  1J6Z A;  4A2A A;  4DQQ A;  1Q82 O;  3CCV N;  2AJQ A;  5BN8 A;  4QS8 A;  3VEV A;  1JL2 A;  1NM1 A;  3TAQ A;  4M41 A;  4DUZ K;  1Z25 A;  4JI5 K;  3LAN A;  4G1Q A;  4KI4 A;  4MO4 A;  3OJU A;  2QK9 A;  3OYJ A;  1LAV A;  3MN5 A;  1JXE A;  4PHT X;  4C23 A;  2YNH A;  4C8O A;  1YTU A;  2Z1I A;  1L3S A;  3UKU A;  4HUE A;  4KHN A;  4KH6 A;  3C94 A;  4IEI A;  3R3L A;  4TSX A;  2EX3 A;  3J7Y P;  3DXM A;  1YUW A;  1KRP A;  2P9K B;  1KLN A;  1NGJ A;  4B3R K;  1Q81 O;  5BPM A;  4B9V A;  3CYG A;  4G9Z A;  1A5X A;  4LF9 K;  2VQF K;  4CBW A;  3FFK B;  4OKE A;  3DXK B;  3DLL L;  3SYZ A;  4KKO A;  3GL1 A;  1D9F A;  3AVL A;  3A5N C;  4M3T A;  3TWH A;  1B9F A;  1J53 A;  4EHT A;  3ENB A;  4JKA A;  3KLG A;  1NK7 A;  3ZX3 A;  2FSN A;  3HBT A;  3IKM A;  1LW0 A;  3K0S A;  1JCF A;  1IG9 A;  2JWK A;  3LDN A;  1R0A A;  3DRP A;  3I33 A;  1BA0 A;  2DPN A;  2ZD1 A;  4HTL A;  4DF4 A;  2YI1 A;  4CED A;  4CFD A;  4N5S A;  1K8K A;  3PSI A;  3CET A;  5CYQ A;  4BDY A;  1Q86 O;  3G10 A;  3O9Q A;  1YIJ N;  4BWM A;  3ID8 A;  4FYD A;  1NGG A;  5HLF A;  1RT3 A;  1REV A;  4CFC A;  2DFF A;  3LAM A;  4HCC A;  4I2Q A;  3CF5 L;  3J80 O;  4AIL C;  4KPY A;  3NBP A;  2P9U A;  1WNS A;  1EET A;  1HNI A;  3TAE A;  3IS9 A;  3THX A;  4FJN A;  5EVZ A;  4FJ8 A;  4NYN A;  2P9N B;  1RTI A;  3CI5 A;  4M3W A;  1MWK A;  3WEE B;  3SAG A;  4YOW A;  1YXQ A;  4W5O A;  5C15 A;  4A5A A;  3I8D A;  4ELU A;  5I9E B;  5M1P A;  4DTU A;  4L8R B;  2HBL A;  3EEQ A;  3AVI A;  3EO3 A;  4FK2 A;  3VQ4 A;  4AHS A;  2NRX A;  4JKF A;  1QSY A;  2A40 A;  1SAZ A;  2HF3 A;  3M1F A;  3PY8 A;  5EY4 A;  4BQL A;  3L2W A;  5AR0 A;  1VQ9 N;  1EQY A;  4QOZ B;  4YNQ A;  3IDH A;  3WNG A;  3OYE A;  1I39 A;  1ZBF A;  4CIE A;  3M8S A;  4FM2 A;  3MWT A;  1DLO A;  4IOC L;  3SUO A;  1YI2 N;  4M3Z A;  2F8T A;  4H5V A;  5BRD A;  3OJS A;  3D2F B;  1RCH A;  3NGZ A;  1TGO A;  3AVH A;  2IDO A;  4CIG A;  1VQN N;  3M8R A;  4M3U A;  4E7L A;  4DV6 K;  3ZSV A;  3ZT4 A;  3QFU A;  1NBW A;  4IOA L;  1VQ6 N;  3ZEU A;  1BUP A;  5LY3 A;  1YF5 L;  1V4T A;  2CGL A;  4PKH A;  3PV8 A;  1QZ5 A;  1RDW X;  4B3M K;  4FK0 A;  3R6M A;  4BG9 A;  2YHY A;  2IAJ A;  5J2P A;  4B1Z A;  3QBW A;  4B9L A;  3KLF A;  4FPB A;  4BGA A;  5JMV A;  5IT9 O;  3S3M A;  3V1R A;  4K42 A;  1X9S A;  3HTV A;  3WT0 A;  3T7Z A;  3L2R A;  3OYN A;  4I2P A;  2HBK A;  3MXJ A;  4FLV A;  3CD6 N;  2GWJ A;  1CZB A;  4KHU A;  1RGI A;  3OVN A;  4NCG A;  4DFJ A;  3CC2 N; 
#chains in the Genus database with same CATH homology
 2FLO A;  4FPA A;  4BR5 A;  3VES A;  1X3N A;  1KD1 O;  1K9M O;  3KWI A;  5AQT A;  5C10 A;  2Q0U A;  3OBW A;  4NO7 A;  1KAZ A;  4EHU A;  4BEB A;  4K41 A;  3CCU N;  4XEI A;  2QA4 N;  4BQZ A;  1KAY A;  4H0V B;  3CPE A;  3UKR B;  1QQO A;  2E20 A;  2QTD A;  2QWN A;  4BVO A;  5JVG L;  4JD2 B;  4GY2 B;  4AM6 A;  4BRI A;  3H46 O;  3OBY A;  5AQV A;  3TTD A;  4IO9 L;  2A6A A;  5TKW A;  4MLE A;  5AQK A;  3TPQ A;  3VGM A;  2A42 A;  4BR9 A;  5ADX H;  1QVG M;  4M7Y A;  3CCJ N;  3E1Y A;  3FGU A;  4U7B A;  3RSE A;  2P9L B;  5ELZ A;  3U4L A;  5BR9 A;  1YJW N;  1K8K B;  2NLX A;  3JXU A;  4JK9 A;  1HKB A;  1NGF A;  3AY9 A;  4FL9 A;  4B9Q A;  5KPZ A;  5AQO A;  4ISE A;  4IDH A;  1NGD A;  2AP1 A;  5BPL A;  3SMP A;  2FF3 B;  2Q97 A;  4H0Y B;  2YX6 A;  1XC3 A;  3HOS A;  5EOY A;  4A2B A;  3O08 A;  4WFN L;  3QBX A;  4GV6 A;  3SBT A;  4CI6 A;  4OO1 J;  2ZJR L;  2E2P A;  5GAG P;  2Q31 A;  5BRF A;  1QZ6 A;  5MLC Q;  3VPZ A;  1XUP O;  3H1V X;  4GNI A;  3AGK A;  2D4W A;  1X9J A;  3R1X A;  4WFB L;  3UKU B;  2GWK A;  2QWR A;  2GTD A;  4WF9 L;  5AQJ A;  2E2Q A;  3WXM B;  5CHI A;  4A5B A;  2P9K A;  1LCU A;  1Z6R A;  3MDQ A;  4WQ5 A;  3VET A;  3ENO A;  4FWS A;  3O1B A;  2YHW A;  4CZI A;  3KVG A;  4C1N K;  5GAH P;  2WBN A;  5JVH L;  2QWL A;  3F2K A;  4JEP A;  3E9O A;  2I7P A;  3K9K A;  4NB4 A;  3AAQ A;  4IOX A;  4BRD A;  4JKC A;  4MDA A;  2KKZ A;  3BEX A;  3M3Z A;  5GIN A;  2PBD A;  5AQG A;  4B1W B;  3LDQ A;  2ITM A;  4JN4 A;  1BDG A;  3ZX2 A;  4Z94 A;  3G4S N;  5C12 A;  4IXC A;  3CPW M;  4FOE A;  2VWB A;  3C65 A;  3L6Q A;  3MN6 A;  5AQY A;  2A3Z A;  4XH4 A;  2E2N A;  2D0P A;  3O1W A;  3LDP A;  4ILG B;  4FWQ A;  1ATS A;  1BOT O;  1W2B M;  2H3G X;  4IWV A;  4A61 A;  2PAV A;  3F5T A;  4JK8 A;  3CJ9 A;  1KAX A;  1HPM A;  5I9E B;  1ZBS A;  3CJC A;  2YCH A;  3VER A;  1RFQ A;  5C0Y A;  5GIP A;  2V7Y A;  4DKW A;  3O6W A;  3SJH A;  4WCE L;  3NVM A;  2VGN A;  2WUS A;  2ZJP L;  3QIC A;  4HWI A;  4CZF A;  1E4G T;  3S41 A;  4BY9 C;  2FSK A;  3VOV A;  3CCM N;  3MCA B;  3SBG A;  4BE7 B;  1TYQ A;  4E1J A;  5GIO A;  4GV3 A;  1NGE A;  3ULE B;  4B1U B;  4H0T B;  4O5F A;  3VEO A;  4WQ4 A;  3ATU A;  1BWF O;  4DB3 A;  1NGA A;  3QML A;  4GVE A;  4JD2 A;  3ATV A;  3MMV A;  3HOT A;  1VQO N;  3QB0 A;  3O9T A;  4ILH A;  4B1X B;  2E1Z A;  2NNW A;  1GLE G;  5AQU A;  5M1K A;  4C1N I;  3A5L C;  3A8Y A;  1NJI O;  4R79 A;  2RE2 A;  1H1V A;  4JK7 A;  2E88 A;  5KPT A;  2KHO A;  3CJ1 A;  3TSQ A;  3WXJ A;  4BR7 A;  4IJN A;  2FSJ A;  4WYB A;  2V51 B;  4BRE A;  4PKG A;  3EZW A;  5AZI A;  3U9Z A;  1EO1 A;  1NGH A;  4RTF D;  3PIO L;  3M5R A;  2CGK A;  4BRL A;  2ASP A;  3CJ7 A;  3UB5 A;  1BO5 O;  4FWK A;  2WFB A;  2P9N A;  3H3O B;  1T6C A;  1MWM A;  1T3V A;  2ASM A;  4YOT A;  4B1V A;  2P9L A;  4IFE A;  3U9D A;  5AQP A;  3NVK A;  2ZGY A;  5TKY A;  3WQT A;  3O9U A;  2NZT A;  3K9J A;  4BC5 A;  4BRP A;  3GE1 A;  3WXL A;  2P9P A;  2P9U B;  2QI2 A;  3ZX0 A;  3ID6 A;  2GEM A;  1VQ8 N;  4H0O A;  2QWM A;  5AQQ A;  1SS6 A;  1HKC A;  2Q2R A;  1NWK A;  2FXU A;  1DEJ A;  4H0P A;  4IO8 A;  5HL7 L;  1KXP A;  4XJX A;  4H5T A;  4O8K A;  3SLC A;  2E1Y A;  3DXK A;  3CJA A;  3MX2 A;  2C1G A;  2OTJ N;  1ZC6 A;  3O9R A;  4LC9 B;  4AM7 A;  3MCP A;  5LJW A;  5M1F A;  2CGJ A;  2EWS A;  4WQ5 C;  3VGL A;  1VAZ A;  3MK6 A;  4CZK A;  1QQN A;  1S72 N;  3R9P A;  1O13 A;  3VF6 A;  3CER A;  4PL7 A;  2OAN A;  2D1K A;  1TUY A;  3TTF A;  3FZH A;  1OKJ A;  4FWM A;  4KBO A;  5M1Q A;  4IJA A;  4FWL A;  3EE8 A;  4FSV A;  2NRH A;  3C7N A;  3D2F A;  3DJC A;  2HF4 A;  3P38 A;  2W41 A;  1VQL N;  1P90 A;  3CME N;  4GV9 A;  4FWP A;  4F9O A;  4BRF A;  1LOT B;  1ATR A;  4DCH A;  4BRO A;  2V7Z A;  1BA1 A;  2ASO A;  1GLC G;  3EKS A;  5KQ8 A;  3TU5 A;  3AAP A;  5ADX A;  1IJJ A;  3CCE N;  3A5O C;  4BRG A;  2CH5 A;  3BF3 A;  5AZJ B;  2IIR A;  1TYQ B;  3O9S A;  4K43 A;  2QM1 A;  1ZXO A;  3AGR A;  4CBX A;  3C6A A;  5BPN A;  1ESV A;  4JKD A;  3EE9 A;  2YJE A;  3L4I A;  2QWO A;  1S3X A;  1WOQ A;  3I55 N;  1BG3 A;  3CQX A;  4NLC A;  5EX5 A;  2AA4 A;  3KWG A;  1U2V A;  4EIA A;  4UY8 O;  3IFR A;  4BRQ A;  4BEC A;  1QVF M;  5H1S Q;  3O8M A;  4OPH A;  3G71 N;  3P31 A;  4MLH A;  5AZJ A;  3VMF B;  2W00 A;  3CC4 N;  3O5B A;  1SZ2 A;  3ULE A;  2GUP A;  3TSP A;  3F9M A;  3B8A X;  5E84 A;  3CIP A;  3CHW A;  2WC9 A;  4IEE A;  5JLF A;  2KLA A;  1DKG D;  4YOV A;  3AAR A;  1GLJ O;  1YAG A;  5AQN A;  2NRZ A;  5FPM A;  4EAH D;  3SAF A;  4NLB A;  3M6G A;  5AQX A;  4BRH A;  2E2O A;  3MN7 A;  1K73 O;  3LM9 A;  1V4S A;  3HZ6 A;  2HOE A;  3D2E A;  4YOU A;  3CC7 N;  3WUH A;  1NGI A;  3FR0 A;  4H03 B;  3E9L A;  2BTF A;  5FPD A;  5GAD P;  5AZI B;  1WUA A;  3U8X A;  1G99 A;  4FWR A;  5DM7 L;  3GDQ A;  5AQF A;  2F7T A;  4O8U A;  5CR4 A;  3GOI A;  4JKH A;  5LJV A;  1OVY A;  4BC4 A;  2Q1N A;  3WXI A;  1SQK A;  3GBT A;  2FF6 A;  5F2R A;  5GAE P;  3RSE B;  3I56 N;  1DT9 A;  2C1I A;  4H5W A;  3SAH A;  1N8R O;  1HKG A;  1QQM A;  1JJ2 M;  1J6Z A;  4A2A A;  1Q82 O;  3CCV N;  5AQR A;  1KQS M;  4JKB A;  4DHY A;  4MO5 A;  5BN8 A;  4QS8 A;  3P39 A;  3VEV A;  4DQ8 A;  1JCG A;  4BGB A;  1NM1 A;  3R8E A;  3P4I A;  4CZL A;  3A5M C;  5AQL A;  1YHQ N;  2GEL A;  3WEE A;  4MO4 A;  2BUP A;  1HUX A;  5KQD A;  2RHK A;  3G25 A;  3MN5 A;  3DAW A;  1YVN A;  4PHT X;  3MX5 A;  4QS7 A;  2W40 A;  3WXK A;  3J8A A;  4H0X B;  4C23 A;  3J7Z O;  3FLC O;  5AQZ A;  4CJ7 A;  3LL3 A;  3CXC M;  3KHY A;  4BC2 A;  1M1K O;  1QHA A;  4JNE A;  3QFP A;  4IZ9 A;  3UKU A;  4CZJ A;  4KH6 A;  4JAX A;  1BU6 O;  1ILY A;  4PL8 A;  4IEI A;  4A62 A;  3C6H A;  2A41 A;  3FZK A;  3DXM B;  1C0G A;  3R3L A;  5BRH A;  2QW9 A;  3CCQ N;  2QWQ A;  2QEX N;  3DXM A;  1YUW A;  2P9K B;  2P9S A;  3CCL N;  3IUC A;  1NGJ A;  1VQ5 N;  3A0I X;  3CD6 N;  5AFU H;  2V52 B;  4JKE A;  1Q81 O;  2ZF5 O;  5B8H A;  4J8F A;  3CCS N;  5BPM A;  1YIT N;  4FO0 A;  4PKI A;  5F0X A;  3FZM A;  4G9Z A;  3G6E N;  4CBW A;  3FFK B;  3GG4 A;  2JWL A;  3DXK B;  3DLL L;  3GL1 A;  1U6Z A;  2QXL A;  4FWO A;  3A5N C;  1C0F A;  1NLV A;  3VF2 A;  3BP8 A;  2UYT A;  3ZYY X;  1HLU A;  4EHT A;  3O80 A;  3ENB A;  4JKA A;  3UE5 A;  3ZX3 A;  1XQS C;  3VEY A;  2FSN A;  2D0O A;  2YJF A;  1NGC A;  3HBT A;  3EL2 A;  3IKM A;  3KZB A;  3EN9 A;  2CH6 A;  3TSU A;  1IG8 A;  3RVC A;  3BUZ B;  5AQS A;  2BH1 A;  2F9T A;  2IVN A;  1JCF A;  2NRW A;  3MWP A;  4ISF A;  4H5N A;  3N4P A;  2JWK A;  3LDN A;  4ISG A;  4CBU A;  4CZG A;  5C2F A;  1YJ9 N;  4FOI A;  3I33 A;  1BA0 A;  4BRN A;  5BRE A;  2QWP A;  2DPN A;  1DGK N;  2J4R A;  4JKG A;  4KH4 A;  1HX1 A;  4YOX A;  4HTL A;  3CCR N;  2YI1 A;  5AQH A;  3D2E B;  4U67 L;  5C2D A;  1ATN A;  1K8K A;  3CET A;  4I6M A;  1S22 A;  5AQI A;  3VEN A;  3IMX A;  4QS9 A;  1Q86 O;  3FZL A;  3HRG A;  2IVO A;  4YDU A;  2HBJ A;  1VQM N;  3O9Q A;  4H5R A;  1YIJ N;  4XH1 A;  5M1O A;  2VYP A;  2IVP A;  3ID8 A;  3LM2 A;  4OPA A;  2OTL N;  1NGG A;  3OA9 A;  2NRT A;  3VEX A;  1X3M A;  3MN9 A;  3QDK A;  3NMU A;  4A59 A;  3ENH A;  2Q36 A;  3E66 A;  1CZA N;  3N4Q A;  5DM6 L;  3CF5 L;  3SMS A;  3UKR A;  2HST A;  2P9U A;  1T44 A;  1VQ4 N;  1W97 L;  1K8A O;  5M1N A;  4M7X A;  2HMP A;  3VF4 A;  2ZJQ L;  5EVZ A;  1NMD A;  5AFU A;  1VQK N;  2P9N B;  2ZGZ A;  3CI5 A;  1GLA G;  1MA9 B;  2HBM A;  1MWK A;  2VGM A;  3WEE B;  1VQP N;  4B1Y B;  3SAG A;  2I7N A;  4FVU A;  3Q7C A;  1NGB A;  5AQW A;  3KK7 A;  1YXQ A;  4YOW A;  4YOR A;  4YDU C;  4A5A A;  4ILJ A;  5C15 A;  4L3Q A;  4MDB A;  5FPN A;  3OHR A;  3H45 C;  5M1P A;  5CE3 A;  3CQY A;  5EXW A;  4BRK A;  4A57 A;  5FPE A;  1M90 O;  4XH5 A;  3VEW A;  4BC3 A;  2HBL A;  4BVP A;  4CZE A;  3EO3 A;  5JIC A;  4BR2 A;  2NRR A;  2NRX A;  4JKF A;  2YHX A;  2Q0R A;  2A40 A;  4K25 A;  1SAZ A;  2ZWH A;  2HF3 A;  3M1F A;  3O4W A;  1VQ7 N;  3DWL A;  4M63 C;  3SK3 A;  3VTI A;  3C0B A;  3L4Q A;  5EY4 A;  4BQL A;  5HOO A;  3WQU A;  1Q7Y O;  5AR0 A;  1VQ9 N;  1EQY A;  3E9P A;  3IDH A;  5KPR A;  2GX9 A;  2P9S B;  1GLL O;  4BRM A;  2P9P B;  1YI2 N;  1T6D A;  3MWT A;  4IOC L;  1Q18 A;  4BG8 A;  3CMA N;  4H5V A;  4BRA A;  3VGK A;  4CD3 A;  5BRD A;  1GLD G;  2VCP A;  3C7N B;  3D2F B;  3HI0 A;  4AF1 A;  1VQN N;  4Y0W A;  3ZET B;  1YJN N;  1Z05 A;  3ZET A;  3QFU A;  3ZEU B;  1NBW A;  5JLH A;  4CD1 A;  3ZEU A;  1VQ6 N;  4IOA L;  4FWN A;  1BUP A;  4JKG B;  4BRC A;  3HM8 A;  5LY3 A;  1YF5 L;  1V4T A;  1Y64 A;  2CGL A;  4PKH A;  5F1X A;  4RWT A;  1QZ5 A;  1RDW X;  2E8A A;  3D6R A;  3R6M A;  4BG9 A;  4WFA L;  2YHY A;  4B1Z A;  3D7E O;  3VEZ A;  1RDU A;  3H3N O;  3I8B A;  4CZM A;  3QBW A;  1E4F T;  2A5X A;  1JCE A;  3PLA A;  1KC8 O;  4FPB A;  1TUU A;  3CJB A;  3W3D A;  4BGA A;  4BR0 A;  5JMV A;  1GLF O;  4WQ4 C;  2P9I B;  1D4X A;  4JHD A;  1P8Z A;  3T69 A;  2P9I A;  4JHD B;  4K42 A;  1U2V B;  4BR4 A;  3L0Q A;  2NRV A;  3PIP L;  2PFU A;  2F9W A;  3HTV A;  3WT0 A;  3T7Z A;  1HJO A;  3TTC A;  3FE1 A;  3HSC A;  1MDU B;  3LDL A;  2HBK A;  3H1Q A;  3H6E A;  3JS6 A;  5BN9 A;  5E26 A;  3W0L A;  2GWJ A;  4CZH A;  3VTH A;  4RCH A;  4YOY A;  4EFH A;  1RGI A;  3FZF A;  4I6M B;  3LDO A;  1R59 O;  3OW2 M;  3Q7B A;  4KH5 A;  5AQM A;  1GLB G;  3BF1 A;  3CC2 N;  3EKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...