3DXMA

Structure of bos taurus arp2/3 complex with bound inhibitor ck0993548
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
414
structure length
399
Chain Sequence
b'GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Characterization of two classes of small molecule inhibitors of Arp2/3 complex
pubmed doi rcsb
molecule tags Structural protein
total genus 130
structure length 399
sequence length 414
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3dxmA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxmA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxmA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3dxmA04
2E1ZA 3ULEB 5BPLA 3VEZA 2ZGZA 3A8YA 3VPZA 1NWKA 3O8MA 3M1FA 1WUAA 1JCFA 5EY4A 1U2VA 2ZGYA 3J8AA 3WEEA 4GY2B 4H5VA 4MLHA 4MLEA 4PKHA 5E26A 3FR0A 5AQKA 4CBXA 2E2QA 3EKUA 3LDLA 3O4WA 4HTLA 2Q97A 3CERA 1NGHA 4CBUA 4BQLA 3VESA 4BQZA 1DGKN 1GLFO 2FSKA 3VGLA 5KPRA 3H3OB 4CJ7A 5KQDA 4ISGA 4M63C 4MO4A 5JMVA 2QM1A 5LY3A 1S3XA 4JNEA 5BRFA 5AZIA 4IJAA 1J6ZA 2P9KB 3D2EA 1XUPO 4H0VB 3C7NA 3U4LA 3ZX3A 5ADXA 4ISEA 4K41A 3GL1A 1H1VA 3R9PA 5BN8A 1T44A 1HPMA 4YDUC 1HKBA 3L4IA 3LL3A 3VOVA 4B1VA 1OKJA 4BR7A 4PL7A 2A5XA 2BTFA 3IMXA 2P9SB 1QHAA 1T6DA 4JD2A 1IJJA 2CGKA 3ID8A 2P9LA 3CHWA 4O5FA 5FPMA 1E4GT 1X9JA 2WUSA 3SJHA 3DXKB 1KAYA 3H1QA 5AQJA 4FPAA 4B1YB 3SLCA 1BG3A 2CGJA 3CJ7A 1T6CA 3IFRA 1NGCA 1ZXOA 3FFKB 3W0LA 3P4IA 4FWOA 5AQFA 1X3NA 4IJNA 3RSEB 4BRPA 1QZ6A 2ASPA 4BRHA 3CETA 1BO5O 3H46O 2A6AA 2QXLA 4MO5A 5AQSA 3UKRA 1V4SA 2HF3A 2F9WA 3VENA 2FSNA 4CZLA 1HKGA 4K42A 3BF1A 2J4RA 4L3QA 3ENOA 5F0XA 3B8AX 1Z6RA 2E2PA 3A5MC 4IZ9A 4BR0A 1QQOA 1S22A 1HLUA 2E8AA 4CZJA 4EHUA 3W3DA 4BRKA 3H3NO 5AQUA 3WXLA 1KAZA 2P9IB 4EFHA 1DKGD 3LDNA 3GE1A 3CQYA 1TUUA 4BRAA 3EKSA 3O5BA 2FLOA 2A40A 2DPNA 3GBTA 4RTFD 1ATRA 4BRMA 3VF2A 1YVNA 3QB0A 3O80A 5ELZA 3HBTA 1X3MA 1MWKA 4WQ4C 3UB5A 3VEOA 2FF6A 5FPNA 5EXWA 5AZJB 5AQQA 1HX1A 2Q0UA 3D2FA 3HSCA 2FXUA 2GWJA 1NGGA 4BRQA 1P8ZA 1WOQA 3VEWA 4BRGA 5LJVA 3LDQA 4DHYA 3O08A 4BRDA 3FE1A 1RDWX 4FPBA 4QS8A 3ULEA 3AAPA 4XH1A 3D2FB 3LDOA 1EQYA 2FF3B 1BWFO 4PKIA 4DQ8A 5AQMA 1SQKA 3ZX2A 5AQXA 1HKCA 3EN9A 5LJWA 1XQSC 4B1ZA 4XEIA 4HWIA 3ATUA 1IG8A 4H5NA 4IWVA 4FL9A 1NGJA 3VETA 2IIRA 3WXKA 2P9PB 3GDQA 3F9MA 4BG9A 3WQUA 5AR0A 5BR9A 3AAQA 5AFUA 4CD1A 4BROA 4FWQA 4AM6A 5AQGA 5JICA 4BRLA 2E2OA 5KPZA 2P9KA 2QWMA 2GELA 1MDUB 1CZAN 3R6MA 3U8XA 2D1KA 4WQ4A 4BR4A 4CBWA 5AQOA 1D4XA 4BC4A 2P9NB 1GLDG 5AQLA 4BGBA 2AA4A 2NZTA 5E84A 4DCHA 5BRDA 4A61A 4NO7A 2KHOA 4BGAA 3ZEUB 2P9SA 1GLEG 1GLAG 4H0PA 3VEVA 2YHXA 4CZEA 2GEMA 1Q18A 3L0QA 5F1XA 3CQXA 3ZX0A 2OANA 4XH5A 1NBWA 1XC3A 1NGFA 3C0BA 3QICA 1V4TA 3DXKA 3FZHA 3QMLA 4IO8A 1ZBSA 4M7YA 3DAWA 4BC2A 2D0OA 1NGIA 2V7YA 4FWNA 1U6ZA 5AQHA 4JAXA 5KQ8A 3BP8A 3RSEA 2V7ZA 4FO0A 5F2RA 1MA9B 2AP1A 2HOEA 3DWLA 1TUYA 3R8EA 1NGAA 4B1XB 5EVZA 3VERA 2YHYA 2A41A 4Y0WA 3HM8A 1NGBA 3L6QA 4FWKA 4NB4A 3I8BA 2P9UA 3HI0A 2ZF5O 2GTDA 2H3GX 2E20A 1BA1A 1ZC6A 4RCHA 2IVPA 4BRFA 5ADXH 3DXMB 2P9UB 2QWPA 4YDUA 1QQNA 2HMPA 2P9IA 3CJ9A 3QDKA 1C0GA 2V51B 4IXCA 1YAGA 4QS7A 1NMDA 3IUCA 2YJFA 2NRHA 2D4WA 2V52B 2Q31A 4O8KA 4BG8A 2IVOA 4K43A 3MN7A 2A42A 3GG4A 3JS6A 3CJCA 2PAVA 4JHDB 1BU6O 3MDQA 3ATVA 4H5WA 2FSJA 2QWNA 3FLCO 5AZJA 1MWMA 3H1VX 4H5RA 5KPTA 1TYQB 1RGIA 4I6MA 4CI6A 4LC9B 2E2NA 4EHTA 1Z05A 3H45C 4H03B 3KVGA 5AQRA 3EZWA 1NLVA 4I6MB 4QS9A 3GOIA 3VGKA 1KXPA 4FWMA 4FWSA 4C23A 1JCEA 2VCPA 2QWLA 5AQIA 1ESVA 3MK6A 3I33A 2ITMA 5AQPA 1R59O 4EAHD 1HJOA 4E1JA 3QFUA 2F9TA 4CZGA 5I9EB 4M7XA 5AQWA 2EWSA 2A3ZA 2VYPA 2P9PA 5FPEA 4FWRA 3SK3A 4H0TB 3AY9A 3U9ZA 3WQTA 2YI1A 3UKUB 2QWQA 2I7NA 3HZ6A 3WUHA 1GLCG 1SAZA 1C0FA 2Q2RA 2P9NA 4BC3A 4BRIA 2BUPA 4XH4A 2CH6A 3MMVA 4BC5A 5BPMA 2YCHA 3ZEUA 3WT0A 3QFPA 2YJEA 1NGEA 3BEXA 3FZMA 3CJAA 4RWTA 4WQ5C 1JCGA 1GLLO 1U2VB 1BDGA 3WEEB 2ASOA 3EL2A 4GNIA 3WXJA 4DB3A 2E1YA 3TPQA 1GLBG 3CJBA 1Y64A 4B1WB 3LDPA 3SMPA 2CH5A 2GUPA 3WXIA 4J8FA 4KBOA 3UE5A 4F9OA 4A62A 5FPDA 3A0IX 1LCUA 1DEJA 4FOEA 4BR2A 1K8KA 1ATNA 2Q1NA 3FZFA 5AZIB 1RFQA 2YHWA 3CI5A 3D2EB 1K8KB 3C7NB 3VEXA 3EO3A 3U9DA 5AFUH 1QZ5A 4BR9A 3QBXA 3LM2A 4Z94A 4JN4A 2NLXA 3G25A 4BRNA 4JD2B 3A5OC 3CIPA 2E88A 3O1WA 5BRHA 4PKGA 3DJCA 2ASMA 3TU5A 2P9LB 2QWRA 4PL8A 3CJ1A 3VF4A 4H0YB 4A2BA 3A5LC 3DXMA 2D0PA 1KAXA 2VWBA 5CE3A 3JXUA 4WQ5A 2W41A 2ZWHA 4BR5A 1NM1A 4BREA 4B1UB 3O1BA 5AQVA 2Q36A 5BPNA 2Q0RA 4FWLA 5AQYA 3MN6A 4JHDA 1G99A 4BVOA 3LM9A 5AQNA 4CZKA 4AM7A 5BREA 3H6EA 1TYQA 1BA0A 4CZMA 2GWKA 2QWOA 3HTVA 3MCPA 3UKRB 1QQMA 3FGUA 4B9QA 3BF3A 1NGDA 3O6WA 4FOIA 3OHRA 3MN5A 5BN9A 2HF4A 3KZBA 4H0XB 5EOYA 3SMSA 4BRCA 4ISFA 1GLJO 1ATSA 3ZETA 4EIAA 5JLHA 3AARA 3VEYA 4K25A 4CZIA 5B8HA 5AQTA 3ZETB 1SZ2A 3VF6A 1BOTO 4FWPA 3BUZB 5AQZA 4BVPA 2UYTA 3A5NC 1BUPA 3IDHA 2W40A 2IVNA 3VGMA 3KHYA 1YUWA 3M3ZA 3ENHA 4FSVA 4CD3A 4CZHA 3UKUA 5JLFA 1HUXA 3MN9A 4CZFA 5EX5A 2PBDA 1YXQA 4H0OA 3QBWA 4H5TA 1E4FT 5TKYA 4A2AA 4WYBA 3FZLA 2CGLA 3D7EO 3M6GA 3FZKA 3S41A 1LOTB 2I7PA 2QW9A
chains in the Genus database with same CATH superfamily
3VPZA 4W5OA 1VAZA 1WUAA 1YHQN 4M3UA 3CFOA 4MLEA 4DTSA 4CBXA 3ZSZA 2D5RA 4CJKA 3SI6A 3LP3A 4OVLA 4RW4A 1L3UA 1O1WA 4CJUA 1GLFO 2VWKA 3H3OB 4CJ7A 1B9DA 3N4PA 3BZCA 4M63C 1SKSA 4BACA 2F7TA 1RNHA 5LY3A 3SJJA 1NK8A 5BRFA 4CVNE 4CFDA 3ZSQA 3V1OA 2QXFA 3C7NA 4WFNL 3O4QA 4CESA 4K41A 3GL1A 1H1VA 3R9PA 4FLTA 1VRUA 3LALA 4B1VA 1HKBA 4QAGA 4CEOA 4FK4A 5D3GA 3L2QA 2Z1JA 2A5XA 2BTFA 4FK2A 5CZ1A 1IJJA 2CGKA 3CQ8A 4O5FA 4DSEA 5M1OA 2A1RA 3KKRA 2UXCK 4CJLA 4DUZK 4RG8A 2WUSA 1R0AA 1NK9A 4DU1A 4CF0A 2CGJA 3CJ7A 3IFRA 1IBMK 3K5LA 3NVMA 2YNGA 3K9KA 3MAQA 4CF2A 2Z1IA 4IG0A 2OTJN 2O8DB 1BO5O 3H46O 1XMQK 4JV5K 2HF3A 4HCCA 4CZLA 4Q5VA 1HKGA 4K42A 1N5YA 2WTUA 3BF1A 3ENOA 4UQGA 1BQMA 2X6SA 3ITHA 3U3GA 3A5MC 4IZ9A 1RBRA 1WSJA 4GKJK 3CYMA 5BR8K 1VQMN 4HUEA 1RT1A 3QEVA 1LV5A 3H3NO 5AQUA 3WXLA 1KAZA 1DKGD 3LDNA 4JI4K 4I9LA 1SKWA 3O3GA 1JL1A 4CW7B 5SWMA 4BRAA 3EKSA 3OJSA 4DV0K 4LF7K 2DPNA 3TSUA 3CC4N 2D0BA 1S6PA 1O13A 3LWLA 4DR7K 3CCLN 3O80A 1WBBA 1MWKA 4DQIA 4JI3K 2FF6A 5EXWA 5AZJB 1HX1A 2NRWA 3VEWA 5LJVA 1BQNA 1RT5A 2F4VK 5HL7L 4QS8A 3ULEA 4NYFA 3WXMB 4U7BA 1VK0A 4CF9A 3OYFA 2FF3B 1BWFO 4M3XA 1HYZA 3LZIA 1KRPA 3MCAB 5I3UA 4IEIA 2O8BB 1HKCA 3KJVA 1XQSC 3MWTA 3SUOA 2VG7A 4AHVA 3ATUA 3L8BA 4H5NA 2HVIA 3IRXA 3NF7A 4JKFA 3VETA 3WXKA 3O3HA 3OYDA 3GDQA 3F9MA 5AR0A 2RHKA 4FWQA 3HPHA 4Q0BA 3SAGA 3P83D 4I2QA 2OCEA 4BDPA 1HPZA 2P9KA 2QWMA 4WF9L 2GELA 3R6MA 4KHSA 1BL3A 4O8UA 4E3SA 4XIUA 4JRPA 3HPGA 2P9NB 1GLDG 5AQLA 2AA4A 5BRDA 5E84A 2UUAK 4DTNA 1LW2A 5CZ2A 5C24A 5FRMA 1GLEG 4CHPA 4E7JA 4YNQA 3NGIA 4KTQA 2OANA 5C12A 5GINA 1XC3A 2W6KA 1TK8A 2G8UA 3AVFA 3K5OA 3LPTA 3LAKA 1VQKN 3FZHA 1L3SA 1TKTA 3KD5E 3TAFA 1WSGA 2KQ2A 3G0ZA 4CJ4A 3L2UA 2D0OA 1QVFM 3G10A 4CF8A 5AJ3K 3O4NA 1I3AA 3QEPA 2HOEA 2YNIA 1VQ5N 1ZBHA 3R8EA 4CK1A 3OA9A 5EVZA 3TAGA 1U45A 2YHYA 3THWB 1QE1A 1TKXA 4CHYA 4ZTFA 4KB1A 4IBNA 3OYMA 3JYTA 3CCJN 4NB4A 3LWMA 3I8BA 4M3YA 1ZYQA 3TANA 1IBLK 2H3GX 1ZC6A 2WONA 4HCBA 3WNGA 2IVPA 3DMJA 3R3LA 2QWPA 4YDUA 2P9IA 4YOWA 4LFBK 4DSIA 1C0GA 3MEGA 4IXCA 2VWJA 4DV2K 4QS7A 1NMDA 4E0DA 3IUCA 1HYSA 2Q31A 3OYBA 1EX4A 1SKRA 3HPOA 4K43A 1UWBA 3MN7A 3GG4A 3JS6A 2HNYA 2LSNA 2PAVA 1BU6O 3ATVA 4Y1CA 4N5SA 2FSJA 4YHHK 1VQLN 2BANA 5KPTA 2DFHA 4I6MA 2PYJA 1RT7A 4LC9B 4E19A 4EHTA 3KK2A 2X6NA 2HBJA 4LSLA 4I6MB 3T7ZA 3VGKA 1J5EK 5AQIA 3V1QA 5C2FA 4FJXA 1HJOA 3TAMA 3QFUA 1HMVA 2XY7A 3CCMN 4CZGA 1UOCA 4M7XA 5AQWA 2A3ZA 3KLFA 4WFBL 2HSTA 5FPEA 3SK3A 4H0TB 4KH4A 3AY9A 4G1QA 3RWUA 4E1NA 4DF4A 4FJ8A 3CXCM 2D0AA 1VQON 3WQTA 4Z4IA 3UKUB 2QWQA 3HZ6A 3OBYA 4CERA 4KPYA 3J80O 4DTRA 4JKAA 1C0FA 4FYDA 4FJIA 4BC3A 3I8DA 3ISNC 4BC5A 4E7HA 2YCHA 3ZEUA 3WT0A 4JKCA 3CJAA 1JXEA 4WQ5C 1JCGA 1U2VB 3QIPA 4DB3A 3TPQA 1Y64A 3PX4A 1QSYA 3K58A 5FPDA 4JK8A 3CPWM 4C8MA 4DKWA 3S9HA 5AZIB 1OH6A 3LP2A 1VSMA 1RFQA 2YHWA 3H08A 1NK4A 3O3FA 1GOCA 4GMJB 4E7IA 4BDZA 3AO1A 5HRNA 3ZSOA 1SL1A 5AFUH 4JI7K 4LF9K 4OLBA 1N33K 4NLBA 1BIZA 4BRNA 1HNZK 4CHZA 4A2BA 4DFKA 4PL8A 1NK0A 3K57A 3DXMA 4M3WA 4DV1K 4WQ5A 4ICLA 1K8AO 2W41A 3TSPA 4CE9A 5IWAK 3T19A 4Z4FA 4B1UB 5J2QA 5TKWA 5AQYA 3AA5X 1NMNA 4CJ5A 2HHWA 5J2MA 4M3RA 4YOYA 3MXIA 1L3TA 1Q8IA 3S3MA 3AO2A 3I55N 2QI2A 4GV3A 4B08A 4IDKA 1KVBA 1TYQA 3E01A 3G6EN 1RDDA 3Q7BA 3O6WA 3VQ6A 1NJZA 3LAMA 3KZBA 4H0XB 5EOYA 4ISFA 1GLJO 3NH1A 5KGWA 1RT2A 3I56N 1IH7A 3D6RA 3VEYA 4M42A 4CZIA 3P5JA 3CCVN 2EX3A 4B9TA 2B5JA 3BUZB 3QNNA 1BUPA 3VGMA 1NK6A 3M3ZA 3ENHA 2RE2A 4DTXA 3HM9A 2IDOA 3MN9A 3F2KA 2Y1JA 3THXA 5EX5A 1RT3A 4KH5A 1E4FT 5TKYA 3S5TA 4WYBA 1KLNA 2PZSA 3D7EO 1NK7A 3THXB 4JI6K 2E1ZA 3CC7N 5BPLA 1ASVA 3A8YA 1NWKA 4LY7A 1N34K 1HNIA 3M1FA 3O9UA 3OYEA 2P51A 4C1NI 4GY2B 2G8KA 4PKHA 3SUNA 5AQKA 1D9FA 2QEXN 2Q97A 3RMBA 3CERA 3SAFA 4BQLA 2HMIA 4JKGA 1DGKN 3VGLA 5KPRA 2KTQA 5KQDA 3F5TA 4MO4A 4FCYA 3K2PA 4JKGB 4AHUA 2QM1A 1BGXT 1S3XA 4FW2A 4IJAA 3D2EA 1WB9A 4PY5A 4I7FA 4CFCA 3U4LA 3ZX3A 5ADXA 4FLYA 3OYKA 4Z4CA 4KFBA 1T44A 1HPMA 4CJPA 3L4IA 3LL3A 3VQ5A 1OKJA 1VSDA 1XC9A 1SS6A 1JLEA 1QHAA 2P9SB 4RW8A 3ID8A 2E6MA 5C2DA 4DMNA 3S3OA 3CMEN 1U04A 3RTVA 3DXKB 3THYB 2ZJQL 5AQJA 4FPAA 3TI0A 1JLFA 1BG3A 3SLCA 1T6CA 1NGCA 3ZSYA 3FFKB 3W0LA 5AQFA 1CLQA 4IJNA 4IEEA 4B3MK 3RSEB 2ZQBA 4BRHA 1KFSA 2QXLA 4MO5A 4IO9L 3UKRA 1V4SA 2F9WA 1ITGA 5M1QA 4DF8A 4FXDA 3ZT0A 3DYAA 5M1KA 4X64K 3SQ4A 2B6AA 2J4RA 2XY8A 3CC2N 4EZ9A 2HBLA 5DK5A 4B9UA 2E2PA 4FLXA 4LF6K 1JLBA 4CJSA 3N4QA 1KVAA 3ZT2A 3ZLJA 1KLMA 4BE2A 3HVRA 4DLGA 1NOYA 4GV9A 1EWQA 3GE1A 2KW4A 5LMNK 2UU9K 4KHYA 4CJTA 4DTPA 1GOAA 2O8EB 1VQ4N 2FLOA 3IKMA 2VGMA 1XI1A 2FBYA 1ATRA 5KTQA 3L4QA 4MDAA 3DLRA 1BCMA 1VQNN 1N8RO 1W97L 5ELZA 2GV9A 3HBTA 1S5JA 1RBSA 3VEOA 4FM0A 4FLUA 5AQQA 5CHIA 1DLOA 2Q0UA 3D2FA 4H4MA 4BE1A 4AHCA 1NGGA 4BRQA 1WOQA 5MLCQ 4DFMA 1HR0K 4DHYA 1FXXA 3FE1A 4XH1A 3D2FB 1VSHA 4B3OA 4PKIA 5AQMA 2HHUA 1SQKA 3ZX2A 4DSFA 5E41A 4KH6A 3QESA 3O9TA 4FJ9A 4CEEA 1YTAA 2XRIA 5K14A 4G9ZA 3WQUA 3S3NA 3AAQA 1RBUA 4BROA 5M1FA 3CM5A 3L3VA 4AH9A 3SYZA 5JICA 2PFUA 3RMDA 5FDLA 1CZAN 1S1WA 1QSLA 4BR4A 4CBWA 4DS4A 4NCGA 5JVHL 4BGBA 2IGIA 2B4JA 4H8KA 4QCLA 4CGGA 4NO7A 4F4KA 2BH1A 1GLAG 4CZEA 2HHTA 2GEMA 1Q18A 3CQXA 1S1XA 3ZX0A 1TK0A 4A57A 4XH5A 3QICA 1XHZA 5HRRA 3OYIA 1V4TA 3NAEA 1VHXA 3OS0A 3VQDA 4DV7K 1NU0A 2VQFK 1NGIA 2V7YA 1U6ZA 1CZBA 3VTHA 3AVCA 3BP8A 4FO0A 4W5NA 2AP1A 2O8DA 1TKZA 1C6VA 4B1XB 3DM2A 2A41A 3C6TA 4Y0WA 1JLQA 4CEFA 3HOTA 4FWKA 4KTWA 4M3TA 4FJ5A 2F96A 4OO1J 2E20A 1OH5A 3NCIA 4YOVA 2ZJPL 2NRTA 1QQNA 2HMPA 2YX6A 3CJ9A 3CFPA 1YAGA 1NJWA 2YJFA 2NRHA 2D4WA 2V52B 3SBTA 4FJKA 4BEBA 3LP0A 4O55A 4AHTA 3HYFA 2GX9A 4H5WA 1KVCA 3AGKA 5AZJA 3LDSA 4PWDA 4H5RA 3O9SA 4OJRA 4TSXA 3SAHA 3QLHA 4DSLA 4H03B 3KVGA 4K8XA 3EZWA 1NLVA 4CJQA 4I2PA 3PIOL 3F73A 1KXPA 1WN7A 3DRSA 4B9VA 1JCEA 3AVGA 2QWLA 3MK6A 3NBPA 2ITMA 4BDYA 2O8BA 3T1HK 4EAHD 1R59O 1ASUA 2NRXA 1KFDA 2F9TA 1JLCA 1WLJA 4DV6K 3DOKA 5I9EB 3HP6A 1JKHA 5CYQA 2OA8A 4ELUA 3E66A 1LW0A 1XMOK 1YITN 4RW6A 1T05A 3DI6A 3U9ZA 3HSTB 3T3FA 2YI1A 3AA3A 5GIOA 1B92A 2OTLN 1GLCG 4LF8K 4DR2K 2O8FA 3QEXA 1Z26A 2Q2RA 3UIQA 2P9NA 3M8QA 2BUPA 4E89A 2CH6A 2O8FB 3MMVA 1W7AA 1UA1A 1DTTA 3RR8A 2YJEA 1D5AA 3FZMA 4F3TA 4LFAK 4DG1A 1GLLO 3WEEB 4ID5A 2KFNA 2E1YA 3PO4A 2KLAA 4DQRA 1GLBG 4B1WB 4ID1A 3T1YK 3SMPA 3SPZA 4UY8O 2X74A 2UXBK 3P38A 4ZHRA 3IAYA 4J8FA 3UE5A 1EP4A 4WFAL 4FOEA 1K8KA 2Q1NA 4FK0A 4JI2K 1IKXA 2HNZA 3VQEA 3CI5A 1K8KB 4F8RA 3THWA 2R7YA 5CY4A 1WSEA 4CJEA 4BR9A 3LM2A 4JN4A 3B6OA 4E7KA 3QNOA 2HHVA 4JD2B 3A5OC 2OPRA 4PKGA 1ZBFA 2P9LB 3CJ1A 3NVKA 2D0PA 3P1GA 2VWBA 4KV8A 2ZWHA 3OYHA 5HROA 3JSMA 4DR4K 1GOBA 1J54A 1S9GA 4BREA 4FW1A 2Q36A 5EU7A 2YHAA 1W0HA 3LM9A 5AQNA 4CZKA 1YF5L 3D45A 5JS2A 3H6EA 2KZZA 4NCBA 1YVUA 1Z25A 2HHIA 3NF9A 3ID6A 1BA0A 3MEEA 4EZ6A 1JXBA 4JI8K 3MCPA 3OBWA 3F9KA 3QIOA 3BF3A 1VSFA 2DFEA 5C15A 5M1NA 2HF4A 4BRCA 1Q81O 3ZETA 5JLHA 3AARA 4CECA 3K5NA 2HHQA 3MXMA 4DUYK 2NRZA 2E4LA 3ZETB 4JKBA 1WBDA 4J2AA 3MWPA 4FWPA 4Y1DA 1IKVA 3CYGA 1RDBA 4FSVA 4CD3A 1NJYA 4CZHA 3UKUA 4FLWA 3KD1E 3PSFA 3AO4A 2PBDA 4AHRA 3Q7CA 1HRHA 3P39A 2CGLA 1EXQA 3FZKA 4ELVA 2QW9A 3PUFA 3VEZA 3EYZA 3L2WA 1WAFA 2ZGZA 3KWIA 4B9NA 3MECA 3O8MA 5EY4A 1U2VA 3AVBA 1HJRA 4GVMA 3AA2A 4H5VA 5GAEP 2QKBA 4JYAK 5E26A 1J53A 2E2QA 4DTUA 3EKUA 3D0PA 1HNXK 4HTLA 4NXNK 3O9QA 4CBUA 2FBVA 4W5QA 1CXQA 4ILGB 1C1CA 3G4SN 4BQZA 3PY8A 3CMAN 5JMVA 4DQPA 1HYVA 3E9LA 3L3UA 3DLKA 4JNEA 3WNFA 3CCRN 3RRGA 5AZIA 2AJQA 1J6ZA 4DWIA 1LWFA 1XUPO 4H0VB 1J5OA 4N47A 4MFBA 3ZT4A 4BR7A 4FJMA 1W9HA 4OPAA 4CCHA 4OX9K 3PV8A 5FPMA 4OLAA 1E4GT 3PLAA 4M41A 2PYLA 4JI1K 1KAYA 3EE9A 1RDCA 4OKEA 1ZXOA 1D9DA 4K8ZA 4FWOA 1X3NA 3O9RA 4AF1A 1QQCA 4BRPA 1CZ9A 3CETA 5A2QO 1TAUA 2WFBA 2A6AA 3VQQA 2FBXA 2FSNA 4IFVA 2QTDA 1L5UA 5F0XA 2UUCK 1T7PA 1Z6RA 5HRPA 1QQOA 4CEBA 2Z1HA 1BI4A 1Q9YA 2RPIA 2E8AA 3W3DA 4ZTJA 1EWRA 3AO5A 4EFHA 1BI4B 5KGXA 3CQYA 3O5BA 4CJRA 4DU3A 3TR8A 4BRMA 3VF2A 1YVNA 3OYLA 1U4BA 3QB0A 1EO1A 3C6UA 3K9JA 1X3MA 4WQ4C 1WSIA 3TSQA 1UAXA 1BCOA 1RTDA 1VSEA 4GW6A 1RCHA 4IOXA 5FPNA 3THVA 2FXUA 1RTIA 4LH4A 4M3ZA 3QEWA 3O08A 1RDWX 4FPBA 3AAPA 3HK2A 3AVAA 3LDOA 4DTJA 5J2PA 1EQYA 4C8LA 3ZSRA 1T8EA 2ZM6K 2GBZA 2OPPA 2HBMA 3SCXA 5AQXA 1VQ6N 4IDHA 3HL8A 2HHXA 3EN9A 5LL6Z 1XWLA 1OVQA 1JLAA 4B1ZA 3M5RA 1L3VA 4DFJA 1NNEA 3MXJA 2UUBK 3CD6N 2ZD1A 2HHHK 1YI2N 1K73O 3QINA 3BY5A 4AILC 4LF5K 2IIRA 1HNVA 4Z4HA 2P9PB 2UXDK 3C94A 3ZSWA 5BR9A 5AFUA 2OPQA 2E5LK 4AM6A 3NH2A 1KTQA 2W6LA 3C6HA 5KPZA 1C0TA 4MDBA 1MDUB 4NXMK 4WQ4A 3EZ5A 5C0YA 3HO1A 4JEPA 4DCHA 3OTOK 4BGAA 2P9SA 3VEVA 1FKOA 4C8KA 1IBKK 1XNQK 4KHPK 5F1XA 3L0QA 3KLIA 1NJXA 1NGFA 3C0BA 3CCUN 4WE1A 4YORA 3DXKA 1LWEA 3THYA 1TVRA 3QMLA 2G8FA 4B3RK 4O5BA 4Z4GA 2NRRA 5J1EA 4DV5K 1ZBSA 3SV4A 4M7YA 3DAWA 4BC2A 4DSKA 3V9SA 3V6DA 3LPUA 4CIFA 4KTZA 3OYGA 3HOSA 2HNDA 3HRGA 4LF4K 4JAXA 5KQ8A 3AO3A 3V9ZA 3BZKA 1S1UA 1IO2A 3RSEA 4KI4A 1TV6A 3OYJA 4DR6K 1HQUA 4FJGA 1DTQA 1NGAA 1RDUA 3TAQA 4YOXA 2XY6A 5KI6A 4EP5A 3J81O 1NGBA 3L6QA 3TARA 4O44A 3HI0A 4CEQA 4FJ7A 3LP1A 2ZF5O 2Q3SA 1BA1A 1RTHA 5CR4A 4O0JA 3VQ4A 3RVCA 4N41A 4W5RA 1N32K 3QETA 3C65A 3QERA 3MEDA 3ENBA 2IOCA 3U3YA 2HHSA 1KQSM 3RRHA 4O8KA 5GADP 2O8EA 3VA0A 2A42A 3CJCA 3KK1A 3AVJA 3RMCA 1ILYA 2P1JA 4JHDB 3WNEA 3M8RA 1Q9XA 2NUBA 1ZBUA 1YT3A 3SBGA 1W2BM 2QWNA 4V19S 4Z0UA 4KHQA 4DTOA 3DLLL 3K0SA 1RGIA 2WC9A 4RW9A 2E2NA 3PO5A 3H45C 1JLGA 3CPEA 4A5BA 1LAVA 5AQRA 4IKFA 3U6FA 4QS9A 3ZT3A 3GOIA 2IC3A 4X66K 4FWMA 3BGRA 4NLCA 4WCEL 4C23A 2VCPA 2ATQA 1QHTA 3I33A 1LAWA 5AQPA 4DR5K 3TWHA 5FROA 2EWSA 1IG9A 3AVHA 2JWLA 2VYPA 3EEQA 1CXUA 2Y1IA 1EKEA 1ZBIA 5GAGP 2I7NA 2C1GA 3WUHA 2XY5A 1U49A 2BGGA 4IFYA 4XH4A 4X62K 4F3OA 1MU2A 3QFPA 3AVLA 1NGEA 4FVUA 4C8NA 3IS9A 4IFEA 1BDGA 4YFUA 2ASOA 3EL2A 4GNIA 4BECA 3M8PA 3WXJA 3CJBA 4YY3K 3LDPA 4YOUA 1EETA 2DTUA 2CH5A 3I0SA 4N76A 3V1RA 2GUPA 3WXIA 4KBOA 1YTUA 1WSHA 4F9OA 1N6QA 2O8CA 3A0IX 1RT6A 4J2BA 3I0RA 4OKJA 4BR2A 3CFRA 5JS1A 2O8CB 3OJUA 1SUQA 3ZCMA 3KLHA 3C7NB 1HNWK 4FZZA 3M8SA 4DU4A 3U9DA 1KCFA 1C1BA 3QBXA 1WNSA 4Z94A 1VSJA 3ASMA 3NFAA 3VQPA 4CJWA 1REVA 2NNWA 2NLXA 1QTMA 4KAZA 3O1WA 3DJCA 3OYNA 3TU5A 4KHWA 3AVKA 3A5LC 3KWGA 4FM2A 3JXUA 3PX6A 2ETJA 4PA1A 4CGFA 1BISA 3CF5L 1C0UA 5AQVA 1NKCA 3SQ0A 5BPNA 2GUIA 2Q0RA 4CGJA 3MN6A 4CJVA 4BVOA 5T7BA 1QVGM 4AM7A 2XHBA 2OPSA 5KRTA 3AVMA 1D8YA 1SV5A 4LH5A 3VN5A 3VQ7A 2GWKA 2QWOA 3HTVA 4HUGA 3SQ2A 1QQMA 3VQCA 1NGDA 4B8AB 4KKOA 3OHRA 1NK5A 3EE8A 3AVIA 1M90O 4X65K 3KLEA 3MN5A 3CCEN 4A59A 3SMSA 1K9MO 1S9EA 2OZSA 3CM6A 1FK9A 3VA3A 5B8HA 5HLFA 1YJWN 4B3SK 5AQTA 5CYMA 4KHUA 3VF6A 4AQYK 3SNNA 4J2EA 1BOTO 5AQZA 4IG3A 3TAEA 1XHXA 2D0CA 2FBTA 3A5NC 2IVNA 3KHYA 1YUWA 3DOLA 4CJ3A 3SZ2A 4DLEA 4OPJA 4CEDA 3KLGA 1VSKA 4HVJA 1SL0A 1RDAA 4CZFA 3NHGA 3E1YA 4H0OA 4H5TA 4I9QA 1LWCA 2C1IA 3FZLA 3M6GA 3S41A 1LOTB 3JAMO 2I7PA 3SQ1A 3ULEB 1UA0A 4BE0A 4HHTA 5DMRA 1JCFA 4B9SA 2ZGYA 3J8AA 3WEEA 2HW3A 1E3MA 1S1VA 4MLHA 3FR0A 4IOAL 1I39A 3LDLA 3O4WA 4CIEA 1NGHA 1ASWA 3VESA 5HP1A 2P5GA 1IV0A 2FSKA 2G8WA 1VQ9N 1YJNN 2YNFA 4ISGA 1OH8A 4PUOA 1K6YA 4CGIA 2W42A 3KK3A 1X1PA 2I5JA 1BIUA 2P9KB 5KRSA 3RMAA 4JS5A 3MX2A 4ISEA 5BN8A 4YDUC 2NRVA 3VOVA 4PL7A 3IMXA 4JI0K 1T6DA 4JD2A 3VQ9A 3LANA 2P9LA 3J7ZO 3CHWA 3VTIA 4AHSA 4JLHA 2RKIA 4JKEA 4LSNA 3DLEA 1X9JA 3E9PA 1TAQA 3SJHA 4R79A 2G8HA 3H1QA 4B1YB 4IOCL 1YIJN 1TK5A 3K59A 4CGHA 4O0IA 3P4IA 4JRQA 3T1AA 4DR3K 3V81A 4CFAA 1QZ6A 2ASPA 5DM6L 1DT9A 1X9SA 2YHBA 2QA4N 5AQSA 3OS2A 1U47A 1VSLA 4OGEA 1P90A 3VENA 3J7AP 3R1XA 4L3QA 2YNHA 4FLVA 4K0KK 1KSPA 3B8AX 3KK7A 4BR0A 4HUFA 1S22A 3PIPL 4U67L 1HLUA 4CZJA 4EHUA 1NKBA 3VQBA 3DLBA 4BRKA 2P9IB 3CCQN 3PSIA 4DS5A 1C0MA 4F2SA 3DRPA 2KKZA 1TUUA 4CK2A 4KHNA 4DV4K 4KI6A 1JL2A 3A2FA 2A40A 3GBTA 4H4OA 4RTFD 4FZYA 1A5VA 5C42A 4E1MA 1FW6A 4CHQA 2HBKA 3WNHA 3UB5A 1IKYA 3TTDA 3HSCA 1TL1A 3NDKA 4JKDA 2GWJA 1P8ZA 2A1SA 4BRGA 4N56A 1Q82O 3LDQA 4BRDA 5JENA 5JVGL 5J2NA 1RBTA 5HRSA 4DQ8A 4R5PA 3ZSXA 2ZJRL 4M45A 1S6QA 5LJWA 1NJIO 4XEIA 4HWIA 4OKKA 3BDPA 2VG5A 1IG8A 4IWVA 4FL9A 1NGJA 3TABA 2KZMA 2WOMA 2YV0X 3OYCA 4JS4A 4BG9A 4FJNA 2VG6A 4CD1A 4OPKA 1A5WA 1T03A 5AQGA 4RW7A 4CJFA 2G8IA 4BRLA 2E2OA 2VQEK 2JWKA 5C10A 4FLZA 4GVEA 4LD0A 1VQ7N 1Q86O 4L8RB 3U8XA 2D1KA 4EP4A 5AQOA 2O4IA 4PQUA 1D4XA 4BC4A 2NZTA 2HVHA 4A61A 4JI5K 2OZMA 2KHOA 3V9UA 3ZEUB 4H0PA 1T3VA 2YHXA 4CK3A 2ZE2A 3MX5A 4CF1A 1NBWA 1G15A 3J7YP 4GKKK 4KB0A 4F2RA 3CG7A 4ILHA 3TAPA 4IO8A 1OH7A 4NCAA 4JKHA 3AVNA 1QSSA 4FWNA 2IS3A 3E9OA 5AQHA 3CCSN 5IT9O 1YJ9N 2V7ZA 5F2RA 1MA9B 1F21A 1C1AA 3DWLA 1TUYA 5M1PA 3OS1A 4BE7B 3VERA 4KREA 3AGRA 4NYNA 5SZTA 3HM8A 3DRRA 3SUQA 3QEIA 1SL2A 3HP9A 3OY9A 2P9UA 4DTMA 4E7LA 4QOZB 4XJXA 2W00A 2GTDA 4RCHA 4BRFA 5ADXH 3DXMB 2P9UB 2ITGA 1RBVA 3HT3A 1FKPA 4ILJA 3QDKA 2G8VA 3KTQA 2V51B 3DLGA 1ZBLA 3NGYA 3ZT1A 5HOOA 4DQSA 3AA4A 3ZSVA 2HB5A 5LMUK 1B9FA 4BG8A 1QS4A 2IVOA 4FJLA 1VSIA 4OPHA 4BY9C 4DR1K 3MDQA 4FJHA 1Y97A 3TTCA 1S1TA 3L2VA 3FLCO 4HTUA 2IAJA 1MWMA 3H1VX 1TYQB 2E6LA 4CI6A 4B8CA 1Z05A 1RT4A 3IG1A 3QO9A 2O4GA 1VQPN 3P31A 3HXMA 4FWSA 3T69A 4DSJA 2RN2A 4OGCA 1ESVA 4JK7A 5GAHP 4FJJA 3C6AA 5FRNA 4E1JA 1XNRK 2DFFA 3V9WA 1NG9A 1KC8O 1NOZA 4PHTX 2P9PA 4FWRA 4YOTA 1TKDA 4FZXC 2DY4A 3VQAA 3SUPA 4E72A 3L2RA 4DFPA 4O4GA 4ELTA 4FM1A 3NF6A 1SAZA 4LFCK 3HVTA 2F8TA 3B6PA 1N36K 5I42A 4CIGA 4BRIA 5BPMA 4DQQA 3BEXA 2XO7A 3ZYYX 3OVNA 4C8OA 3VMFB 4RWTA 4DV3K 1KD1O 1TGOA 3FFIA 3K5MA 2JGUA 4CGDA 1HQEA 3DLHA 2X78A 5HBMA 2JLEA 1FJGK 3TTFA 3C95A 4MQ3A 3PX0A 1I94K 1WAJA 4B3TK 4A62A 1LCUA 1DEJA 3KIOA 1ATNA 3FZFA 3LZJA 2FC0A 3ALYA 3D2EB 1BHLA 3VEXA 3EO3A 1QZ5A 3AV9A 5GIPA 3V9XA 1M1KO 3EY1A 1J9AA 3SPYA 2F8SA 3OW2M 3G25A 3CIPA 5FLXO 2E88A 5BRHA 3VF4A 2ASMA 2QWRA 4KO0A 4H0YB 3OYAA 3KKSA 1KAXA 5CE3A 4BWJA 1S72N 4BR5A 2KFZA 3ULDA 1NM1A 1TL3A 3RR7A 3NMUA 3O1BA 4W5TA 4BWMA 4FWLA 2WBNA 4JHDA 1G99A 4KRFA 1JJ2M 3HJFA 1VQ8N 5BREA 2YKNA 4CHNA 1Q7YO 5C25A 4CZMA 1OVYA 3UKRB 3FGUA 4CFBA 4B9QA 1IKWA 1VRTA 3V4IA 3NGZA 4FOIA 3NE6A 1U48A 5BN9A 2YKMA 2OYQA 4CEAA 1RTJA 1ATSA 4EIAA 4CEZA 4K25A 2QKKA 4JK9A 4CHOA 2PY5A 4B9LA 2EHGA 5H1SQ 3SV3A 1X9MA 1SZ2A 3NH0A 4BVPA 4J2DA 1X9WA 2UYTA 2BE2A 2RF2A 3IDHA 2W40A 1WSFA 3G71N 2VGNA 5DM7L 4B9MA 4Z4EA 4FVMA 5JLFA 2Z1GA 1A5XA 1HUXA 4C1NK 2BDPA 2QK9A 1RILA 3VQ8A 1YXQA 3QBWA 3NF8A 2P5OA 4A2AA 1NKEA 4GV6A 4A5AA
chains in the Genus database with same CATH topology
2E1ZA 3ULEB 5BPLA 3CC7N 3VEZA 2ZGZA 3A8YA 3VPZA 1NWKA 3KWIA 3O8MA 1VAZA 1WUAA 1JCFA 3M1FA 3O9UA 5EY4A 1YHQN 1U2VA 2ZGYA 3J8AA 3WEEA 4C1NI 4GY2B 5GAEP 4H5VA 4MLHA 4MLEA 4PKHA 5E26A 3FR0A 5AQKA 4CBXA 4IOAL 2E2QA 3EKUA 3LDLA 3O4WA 2QEXN 4HTLA 2Q97A 3CERA 3SAFA 1NGHA 3O9QA 4CBUA 4BQLA 4ILGB 3G4SN 4JKGA 3VESA 4BQZA 1DGKN 1GLFO 2FSKA 3VGLA 5KPRA 3H3OB 4CJ7A 1VQ9N 5KQDA 1YJNN 4ISGA 3CMAN 3N4PA 3F5TA 4M63C 4MO4A 5JMVA 4JKGB 2F7TA 2QM1A 3E9LA 5LY3A 1S3XA 4JNEA 3CCRN 5BRFA 5AZIA 4IJAA 1J6ZA 2P9KB 3D2EA 1XUPO 4H0VB 3C7NA 4WFNL 3U4LA 3MX2A 3ZX3A 5ADXA 4ISEA 4K41A 3GL1A 1H1VA 3R9PA 5BN8A 1T44A 1HPMA 2NRVA 1HKBA 3L4IA 3LL3A 4YDUC 3VOVA 4B1VA 1OKJA 4BR7A 4PL7A 2A5XA 2BTFA 3IMXA 1SS6A 4OPAA 2P9SB 1QHAA 1T6DA 4JD2A 1IJJA 2CGKA 3ID8A 2P9LA 3J7ZO 3CHWA 4O5FA 5FPMA 5C2DA 3VTIA 5M1OA 1E4GT 3PLAA 4JKEA 3E9PA 1X9JA 3CMEN 2WUSA 3SJHA 3DXKB 1KAYA 3EE9A 4R79A 2ZJQL 3H1QA 5AQJA 4FPAA 4B1YB 4IOCL 3SLCA 1BG3A 2CGJA 3CJ7A 1T6CA 1YIJN 3IFRA 1NGCA 1ZXOA 3NVMA 3FFKB 3W0LA 3K9KA 3P4IA 4FWOA 5AQFA 1X3NA 3O9RA 4IJNA 4AF1A 4IEEA 3RSEB 4BRPA 1QZ6A 2OTJN 2ASPA 5DM6L 4BRHA 1DT9A 3CETA 1BO5O 2WFBA 2A6AA 2QXLA 3H46O 4MO5A 5AQSA 2QA4N 4IO9L 3UKRA 1V4SA 2HF3A 2F9WA 1P90A 5M1QA 3VENA 2FSNA 4CZLA 5M1KA 3R1XA 1HKGA 4K42A 2QTDA 3BF1A 2J4RA 4L3QA 3ENOA 5F0XA 3CC2N 2HBLA 3B8AX 1Z6RA 2E2PA 3A5MC 4IZ9A 3KK7A 4BR0A 1QQOA 1S22A 3PIPL 4U67L 1HLUA 2E8AA 3N4QA 4CZJA 4EHUA 1VQMN 3W3DA 4BRKA 3H3NO 5AQUA 3WXLA 1KAZA 2P9IB 3CCQN 4GV9A 4EFHA 1DKGD 3LDNA 3GE1A 2KKZA 3CQYA 1TUUA 4BRAA 3EKSA 3O5BA 2FLOA 1VQ4N 2A40A 2DPNA 3GBTA 3TSUA 3IKMA 2VGMA 3CC4N 4RTFD 1ATRA 4BRMA 3L4QA 3VF2A 1YVNA 4MDAA 1O13A 3QB0A 1EO1A 1VQNN 3CCLN 3O80A 1N8RO 1W97L 3K9JA 5ELZA 3HBTA 1X3MA 1MWKA 4WQ4C 3TSQA 2HBKA 3UB5A 3VEOA 4IOXA 2FF6A 5FPNA 5EXWA 5AZJB 5AQQA 1HX1A 5CHIA 3TTDA 2Q0UA 3D2FA 3HSCA 2FXUA 2NRWA 4JKDA 2GWJA 1NGGA 4BRQA 1P8ZA 1WOQA 3VEWA 4BRGA 5LJVA 5MLCQ 1Q82O 3LDQA 5HL7L 4DHYA 3O08A 4BRDA 3FE1A 1RDWX 4FPBA 4QS8A 3ULEA 3AAPA 4XH1A 3D2FB 3LDOA 3WXMB 4U7BA 5JVGL 1EQYA 2FF3B 1BWFO 4PKIA 4DQ8A 5AQMA 2HBMA 3MCAB 1SQKA 3ZX2A 5AQXA 2ZJRL 1VQ6N 4IEIA 4IDHA 1HKCA 3EN9A 5LJWA 1XQSC 3MWTA 1NJIO 4B1ZA 4KH6A 4XEIA 4HWIA 3M5RA 3O9TA 3ATUA 1IG8A 3CD6N 4H5NA 4IWVA 4FL9A 1NGJA 1YI2N 1K73O 4JKFA 3VETA 2IIRA 3WXKA 2P9PB 3GDQA 3F9MA 4BG9A 3WQUA 5AR0A 5BR9A 3AAQA 5AFUA 4G9ZA 4CD1A 4BROA 2RHKA 4FWQA 5M1FA 4AM6A 3SAGA 5AQGA 5JICA 2PFUA 3C6HA 2E2OA 4BRLA 2JWKA 2P9KA 5KPZA 5C10A 2QWMA 4MDBA 2GELA 1MDUB 4WF9L 4GVEA 1CZAN 3R6MA 1Q86O 1VQ7N 3U8XA 2D1KA 4WQ4A 5C0YA 4BR4A 4CBWA 5AQOA 4O8UA 1D4XA 4BC4A 5JVHL 2P9NB 1GLDG 5AQLA 4JEPA 2AA4A 2NZTA 5E84A 4BGBA 4DCHA 5BRDA 4A61A 4NO7A 2KHOA 4BGAA 3ZEUB 2P9SA 1GLEG 1GLAG 2BH1A 4H0PA 1T3VA 3VEVA 2YHXA 4CZEA 2GEMA 1Q18A 3L0QA 3MX5A 3CQXA 5F1XA 3ZX0A 2OANA 4A57A 4XH5A 1NBWA 1XC3A 1NGFA 5C12A 5GINA 3C0BA 3CCUN 3QICA 1VQKN 4YORA 1V4TA 3DXKA 3FZHA 3QMLA 4ILHA 2NRRA 4IO8A 1ZBSA 4M7YA 3DAWA 4BC2A 4JKHA 2D0OA 1NGIA 2V7YA 4FWNA 1U6ZA 3CCSN 3E9OA 5AQHA 3VTHA 3HOSA 1QVFM 3HRGA 4JAXA 5KQ8A 3BP8A 1YJ9N 3RSEA 2V7ZA 4FO0A 5F2RA 1MA9B 2AP1A 2HOEA 3DWLA 1VQ5N 1TUYA 5M1PA 3OA9A 1NGAA 3R8EA 4B1XB 5EVZA 4BE7B 1RDUA 2YHYA 3VERA 2A41A 3AGRA 4Y0WA 3HM8A 4YOXA 1NGBA 3L6QA 3HOTA 4FWKA 3CCJN 4NB4A 3I8BA 2P9UA 3HI0A 2ZF5O 4XJXA 2W00A 2GTDA 2H3GX 2E20A 4OO1J 1BA1A 1ZC6A 4RCHA 2IVPA 3R3LA 4BRFA 5ADXH 3DXMB 2P9UB 2QWPA 4YOVA 2NRTA 2ZJPL 5CR4A 4YDUA 1QQNA 2HMPA 2YX6A 2P9IA 3RVCA 4YOWA 4ILJA 3CJ9A 3C65A 3QDKA 1C0GA 2V51B 4IXCA 1YAGA 4QS7A 1NMDA 3IUCA 3ENBA 2YJFA 2NRHA 5HOOA 2D4WA 2V52B 3SBTA 1KQSM 2Q31A 4O8KA 4BG8A 5GADP 2IVOA 4K43A 4BEBA 3MN7A 2A42A 3GG4A 3JS6A 3CJCA 2PAVA 1ILYA 4OPHA 4BY9C 4JHDB 1BU6O 3MDQA 3ATVA 2GX9A 4H5WA 3TTCA 1W2BM 2FSJA 3AGKA 2QWNA 3SBGA 3FLCO 5AZJA 1VQLN 1MWMA 3H1VX 4H5RA 5KPTA 3DLLL 1TYQB 1RGIA 2WC9A 4I6MA 4CI6A 4LC9B 2E2NA 4EHTA 1Z05A 3O9SA 3H45C 3SAHA 3CPEA 4A5BA 2HBJA 4H03B 1VQPN 3KVGA 5AQRA 3EZWA 1NLVA 3P31A 4I6MB 4QS9A 3T7ZA 3PIOL 3GOIA 3VGKA 1KXPA 4FWMA 4NLCA 4WCEL 4FWSA 3T69A 4C23A 1JCEA 2VCPA 2QWLA 5AQIA 1ESVA 4JK7A 3MK6A 5GAHP 3I33A 5C2FA 3C6AA 2ITMA 5AQPA 1R59O 4EAHD 2NRXA 1HJOA 4E1JA 3QFUA 2F9TA 3CCMN 4CZGA 5I9EB 4M7XA 5AQWA 2EWSA 2A3ZA 1KC8O 4PHTX 2JWLA 4WFBL 2VYPA 2HSTA 2P9PA 4FWRA 5FPEA 3SK3A 3E66A 4H0TB 4KH4A 3AY9A 4YOTA 1YITN 3CXCM 1VQON 3U9ZA 3WQTA 5GAGP 2YI1A 3UKUB 2QWQA 5GIOA 2I7NA 3HZ6A 3OBYA 2C1GA 3WUHA 2OTLN 1GLCG 4JKAA 1SAZA 1C0FA 2Q2RA 2P9NA 4BC3A 4BRIA 2BUPA 4XH4A 2CH6A 3MMVA 4BC5A 5BPMA 2YCHA 3ZEUA 3WT0A 3QFPA 2YJEA 1NGEA 4JKCA 3BEXA 3FZMA 3ZYYX 4FVUA 3CJAA 3VMFB 4RWTA 1KD1O 4WQ5C 1JCGA 4IFEA 1GLLO 1U2VB 1BDGA 3WEEB 2ASOA 3EL2A 4GNIA 4BECA 3WXJA 4DB3A 2E1YA 3TPQA 2KLAA 1GLBG 3CJBA 1Y64A 4B1WB 3LDPA 4YOUA 3SMPA 2CH5A 3TTFA 4UY8O 3P38A 2GUPA 3WXIA 4J8FA 4KBOA 3UE5A 4F9OA 4A62A 5FPDA 4JK8A 3A0IX 1LCUA 1DEJA 4WFAL 4FOEA 4BR2A 1K8KA 1ATNA 2Q1NA 3CPWM 3FZFA 4DKWA 5AZIB 1RFQA 2YHWA 3CI5A 3D2EB 1K8KB 3C7NB 3VEXA 3EO3A 3U9DA 5AFUH 1QZ5A 4BR9A 3QBXA 3LM2A 5GIPA 1M1KO 4Z94A 4NLBA 4JN4A 2NNWA 2NLXA 3OW2M 3G25A 4BRNA 4JD2B 3A5OC 3CIPA 2E88A 3O1WA 5BRHA 4PKGA 3DJCA 2ASMA 3TU5A 2P9LB 2QWRA 4PL8A 3CJ1A 3VF4A 4H0YB 4A2BA 3A5LC 3KWGA 3DXMA 3NVKA 2D0PA 1KAXA 2VWBA 5CE3A 1S72N 3JXUA 4WQ5A 1K8AO 2W41A 3TSPA 2ZWHA 4BR5A 1NM1A 3CF5L 4BREA 3NMUA 4B1UB 3O1BA 5AQVA 5TKWA 2Q36A 5BPNA 2Q0RA 4FWLA 5AQYA 3MN6A 2WBNA 4JHDA 1G99A 4YOYA 4BVOA 1JJ2M 3LM9A 5AQNA 1QVGM 4CZKA 3I55N 1YF5L 2QI2A 4AM7A 1VQ8N 5BREA 3H6EA 4GV3A 1Q7YO 3ID6A 1TYQA 1BA0A 4CZMA 2GWKA 2QWOA 3HTVA 3MCPA 3OBWA 1OVYA 3UKRB 1QQMA 3FGUA 3G6EN 4B9QA 3BF3A 1NGDA 3Q7BA 3O6WA 4FOIA 3OHRA 3EE8A 5C15A 1M90O 3MN5A 5BN9A 5M1NA 2HF4A 3CCEN 3KZBA 4H0XB 5EOYA 3SMSA 4A59A 4ISFA 1GLJO 4BRCA 1Q81O 1ATSA 3ZETA 4EIAA 5JLHA 3I56N 3AARA 1K9MO 3D6RA 4K25A 3VEYA 4JK9A 4CZIA 1YJWN 5B8HA 5AQTA 2NRZA 5H1SQ 3ZETB 3CCVN 4JKBA 1SZ2A 3VF6A 1BOTO 3MWPA 3BUZB 4FWPA 5AQZA 4BVPA 2UYTA 3A5NC 1BUPA 3IDHA 2W40A 2IVNA 3VGMA 3KHYA 1YUWA 3M3ZA 3G71N 2VGNA 3ENHA 4FSVA 2RE2A 4CD3A 5DM7L 4CZHA 3UKUA 5JLFA 1HUXA 4C1NK 3MN9A 3F2KA 4CZFA 5EX5A 2PBDA 1YXQA 3E1YA 4H0OA 3QBWA 4H5TA 4KH5A 3Q7CA 1E4FT 5TKYA 4A2AA 2C1IA 4GV6A 3P39A 4WYBA 4A5AA 3FZLA 2CGLA 3D7EO 3M6GA 3FZKA 3S41A 1LOTB 2I7PA 2QW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1Z A;  3ULE B;  5BPL A;  3VEZ A;  2ZGZ A;  3A8Y A;  3VPZ A;  1NWK A;  3O8M A;  3M1F A;  1WUA A;  1JCF A;  5EY4 A;  1U2V A;  2ZGY A;  3J8A A;  3WEE A;  4GY2 B;  4H5V A;  4MLH A;  4MLE A;  4PKH A;  5E26 A;  3FR0 A;  5AQK A;  4CBX A;  2E2Q A;  3EKU A;  3LDL A;  3O4W A;  4HTL A;  2Q97 A;  3CER A;  1NGH A;  4CBU A;  4BQL A;  3VES A;  4BQZ A;  1DGK N;  1GLF O;  2FSK A;  3VGL A;  5KPR A;  3H3O B;  4CJ7 A;  5KQD A;  4ISG A;  4M63 C;  4MO4 A;  5JMV A;  2QM1 A;  5LY3 A;  1S3X A;  4JNE A;  5BRF A;  5AZI A;  4IJA A;  1J6Z A;  2P9K B;  3D2E A;  1XUP O;  4H0V B;  3C7N A;  3U4L A;  3ZX3 A;  5ADX A;  4ISE A;  4K41 A;  3GL1 A;  1H1V A;  3R9P A;  5BN8 A;  1T44 A;  1HPM A;  4YDU C;  1HKB A;  3L4I A;  3LL3 A;  3VOV A;  4B1V A;  1OKJ A;  4BR7 A;  4PL7 A;  2A5X A;  2BTF A;  3IMX A;  2P9S B;  1QHA A;  1T6D A;  4JD2 A;  1IJJ A;  2CGK A;  3ID8 A;  2P9L A;  3CHW A;  4O5F A;  5FPM A;  1E4G T;  1X9J A;  2WUS A;  3SJH A;  3DXK B;  1KAY A;  3H1Q A;  5AQJ A;  4FPA A;  4B1Y B;  3SLC A;  1BG3 A;  2CGJ A;  3CJ7 A;  1T6C A;  3IFR A;  1NGC A;  1ZXO A;  3FFK B;  3W0L A;  3P4I A;  4FWO A;  5AQF A;  1X3N A;  4IJN A;  3RSE B;  4BRP A;  1QZ6 A;  2ASP A;  4BRH A;  3CET A;  1BO5 O;  3H46 O;  2A6A A;  2QXL A;  4MO5 A;  5AQS A;  3UKR A;  1V4S A;  2HF3 A;  2F9W A;  3VEN A;  2FSN A;  4CZL A;  1HKG A;  4K42 A;  3BF1 A;  2J4R A;  4L3Q A;  3ENO A;  5F0X A;  3B8A X;  1Z6R A;  2E2P A;  3A5M C;  4IZ9 A;  4BR0 A;  1QQO A;  1S22 A;  1HLU A;  2E8A A;  4CZJ A;  4EHU A;  3W3D A;  4BRK A;  3H3N O;  5AQU A;  3WXL A;  1KAZ A;  2P9I B;  4EFH A;  1DKG D;  3LDN A;  3GE1 A;  3CQY A;  1TUU A;  4BRA A;  3EKS A;  3O5B A;  2FLO A;  2A40 A;  2DPN A;  3GBT A;  4RTF D;  1ATR A;  4BRM A;  3VF2 A;  1YVN A;  3QB0 A;  3O80 A;  5ELZ A;  3HBT A;  1X3M A;  1MWK A;  4WQ4 C;  3UB5 A;  3VEO A;  2FF6 A;  5FPN A;  5EXW A;  5AZJ B;  5AQQ A;  1HX1 A;  2Q0U A;  3D2F A;  3HSC A;  2FXU A;  2GWJ A;  1NGG A;  4BRQ A;  1P8Z A;  1WOQ A;  3VEW A;  4BRG A;  5LJV A;  3LDQ A;  4DHY A;  3O08 A;  4BRD A;  3FE1 A;  1RDW X;  4FPB A;  4QS8 A;  3ULE A;  3AAP A;  4XH1 A;  3D2F B;  3LDO A;  1EQY A;  2FF3 B;  1BWF O;  4PKI A;  4DQ8 A;  5AQM A;  1SQK A;  3ZX2 A;  5AQX A;  1HKC A;  3EN9 A;  5LJW A;  1XQS C;  4B1Z A;  4XEI A;  4HWI A;  3ATU A;  1IG8 A;  4H5N A;  4IWV A;  4FL9 A;  1NGJ A;  3VET A;  2IIR A;  3WXK A;  2P9P B;  3GDQ A;  3F9M A;  4BG9 A;  3WQU A;  5AR0 A;  5BR9 A;  3AAQ A;  5AFU A;  4CD1 A;  4BRO A;  4FWQ A;  4AM6 A;  5AQG A;  5JIC A;  4BRL A;  2E2O A;  5KPZ A;  2P9K A;  2QWM A;  2GEL A;  1MDU B;  1CZA N;  3R6M A;  3U8X A;  2D1K A;  4WQ4 A;  4BR4 A;  4CBW A;  5AQO A;  1D4X A;  4BC4 A;  2P9N B;  1GLD G;  5AQL A;  4BGB A;  2AA4 A;  2NZT A;  5E84 A;  4DCH A;  5BRD A;  4A61 A;  4NO7 A;  2KHO A;  4BGA A;  3ZEU B;  2P9S A;  1GLE G;  1GLA G;  4H0P A;  3VEV A;  2YHX A;  4CZE A;  2GEM A;  1Q18 A;  3L0Q A;  5F1X A;  3CQX A;  3ZX0 A;  2OAN A;  4XH5 A;  1NBW A;  1XC3 A;  1NGF A;  3C0B A;  3QIC A;  1V4T A;  3DXK A;  3FZH A;  3QML A;  4IO8 A;  1ZBS A;  4M7Y A;  3DAW A;  4BC2 A;  2D0O A;  1NGI A;  2V7Y A;  4FWN A;  1U6Z A;  5AQH A;  4JAX A;  5KQ8 A;  3BP8 A;  3RSE A;  2V7Z A;  4FO0 A;  5F2R A;  1MA9 B;  2AP1 A;  2HOE A;  3DWL A;  1TUY A;  3R8E A;  1NGA A;  4B1X B;  5EVZ A;  3VER A;  2YHY A;  2A41 A;  4Y0W A;  3HM8 A;  1NGB A;  3L6Q A;  4FWK A;  4NB4 A;  3I8B A;  2P9U A;  3HI0 A;  2ZF5 O;  2GTD A;  2H3G X;  2E20 A;  1BA1 A;  1ZC6 A;  4RCH A;  2IVP A;  4BRF A;  5ADX H;  3DXM B;  2P9U B;  2QWP A;  4YDU A;  1QQN A;  2HMP A;  2P9I A;  3CJ9 A;  3QDK A;  1C0G A;  2V51 B;  4IXC A;  1YAG A;  4QS7 A;  1NMD A;  3IUC A;  2YJF A;  2NRH A;  2D4W A;  2V52 B;  2Q31 A;  4O8K A;  4BG8 A;  2IVO A;  4K43 A;  3MN7 A;  2A42 A;  3GG4 A;  3JS6 A;  3CJC A;  2PAV A;  4JHD B;  1BU6 O;  3MDQ A;  3ATV A;  4H5W A;  2FSJ A;  2QWN A;  3FLC O;  5AZJ A;  1MWM A;  3H1V X;  4H5R A;  5KPT A;  1TYQ B;  1RGI A;  4I6M A;  4CI6 A;  4LC9 B;  2E2N A;  4EHT A;  1Z05 A;  3H45 C;  4H03 B;  3KVG A;  5AQR A;  3EZW A;  1NLV A;  4I6M B;  4QS9 A;  3GOI A;  3VGK A;  1KXP A;  4FWM A;  4FWS A;  4C23 A;  1JCE A;  2VCP A;  2QWL A;  5AQI A;  1ESV A;  3MK6 A;  3I33 A;  2ITM A;  5AQP A;  1R59 O;  4EAH D;  1HJO A;  4E1J A;  3QFU A;  2F9T A;  4CZG A;  5I9E B;  4M7X A;  5AQW A;  2EWS A;  2A3Z A;  2VYP A;  2P9P A;  5FPE A;  4FWR A;  3SK3 A;  4H0T B;  3AY9 A;  3U9Z A;  3WQT A;  2YI1 A;  3UKU B;  2QWQ A;  2I7N A;  3HZ6 A;  3WUH A;  1GLC G;  1SAZ A;  1C0F A;  2Q2R A;  2P9N A;  4BC3 A;  4BRI A;  2BUP A;  4XH4 A;  2CH6 A;  3MMV A;  4BC5 A;  5BPM A;  2YCH A;  3ZEU A;  3WT0 A;  3QFP A;  2YJE A;  1NGE A;  3BEX A;  3FZM A;  3CJA A;  4RWT A;  4WQ5 C;  1JCG A;  1GLL O;  1U2V B;  1BDG A;  3WEE B;  2ASO A;  3EL2 A;  4GNI A;  3WXJ A;  4DB3 A;  2E1Y A;  3TPQ A;  1GLB G;  3CJB A;  1Y64 A;  4B1W B;  3LDP A;  3SMP A;  2CH5 A;  2GUP A;  3WXI A;  4J8F A;  4KBO A;  3UE5 A;  4F9O A;  4A62 A;  5FPD A;  3A0I X;  1LCU A;  1DEJ A;  4FOE A;  4BR2 A;  1K8K A;  1ATN A;  2Q1N A;  3FZF A;  5AZI B;  1RFQ A;  2YHW A;  3CI5 A;  3D2E B;  1K8K B;  3C7N B;  3VEX A;  3EO3 A;  3U9D A;  5AFU H;  1QZ5 A;  4BR9 A;  3QBX A;  3LM2 A;  4Z94 A;  4JN4 A;  2NLX A;  3G25 A;  4BRN A;  4JD2 B;  3A5O C;  3CIP A;  2E88 A;  3O1W A;  5BRH A;  4PKG A;  3DJC A;  2ASM A;  3TU5 A;  2P9L B;  2QWR A;  4PL8 A;  3CJ1 A;  3VF4 A;  4H0Y B;  4A2B A;  3A5L C;  3DXM A;  2D0P A;  1KAX A;  2VWB A;  5CE3 A;  3JXU A;  4WQ5 A;  2W41 A;  2ZWH A;  4BR5 A;  1NM1 A;  4BRE A;  4B1U B;  3O1B A;  5AQV A;  2Q36 A;  5BPN A;  2Q0R A;  4FWL A;  5AQY A;  3MN6 A;  4JHD A;  1G99 A;  4BVO A;  3LM9 A;  5AQN A;  4CZK A;  4AM7 A;  5BRE A;  3H6E A;  1TYQ A;  1BA0 A;  4CZM A;  2GWK A;  2QWO A;  3HTV A;  3MCP A;  3UKR B;  1QQM A;  3FGU A;  4B9Q A;  3BF3 A;  1NGD A;  3O6W A;  4FOI A;  3OHR A;  3MN5 A;  5BN9 A;  2HF4 A;  3KZB A;  4H0X B;  5EOY A;  3SMS A;  4BRC A;  4ISF A;  1GLJ O;  1ATS A;  3ZET A;  4EIA A;  5JLH A;  3AAR A;  3VEY A;  4K25 A;  4CZI A;  5B8H A;  5AQT A;  3ZET B;  1SZ2 A;  3VF6 A;  1BOT O;  4FWP A;  3BUZ B;  5AQZ A;  4BVP A;  2UYT A;  3A5N C;  1BUP A;  3IDH A;  2W40 A;  2IVN A;  3VGM A;  3KHY A;  1YUW A;  3M3Z A;  3ENH A;  4FSV A;  4CD3 A;  4CZH A;  3UKU A;  5JLF A;  1HUX A;  3MN9 A;  4CZF A;  5EX5 A;  2PBD A;  1YXQ A;  4H0O A;  3QBW A;  4H5T A;  1E4F T;  5TKY A;  4A2A A;  4WYB A;  3FZL A;  2CGL A;  3D7E O;  3M6G A;  3FZK A;  3S41 A;  1LOT B;  2I7P A;  2QW9 A; 
#chains in the Genus database with same CATH topology
 3VPZ A;  4W5O A;  1VAZ A;  1WUA A;  1YHQ N;  4M3U A;  3CFO A;  4MLE A;  4DTS A;  4CBX A;  3ZSZ A;  2D5R A;  4CJK A;  3SI6 A;  3LP3 A;  4OVL A;  4RW4 A;  1L3U A;  1O1W A;  4CJU A;  1GLF O;  2VWK A;  3H3O B;  4CJ7 A;  1B9D A;  3N4P A;  3BZC A;  4M63 C;  1SKS A;  4BAC A;  2F7T A;  1RNH A;  5LY3 A;  3SJJ A;  1NK8 A;  5BRF A;  4CVN E;  4CFD A;  3ZSQ A;  3V1O A;  2QXF A;  3C7N A;  4WFN L;  3O4Q A;  4CES A;  4K41 A;  3GL1 A;  1H1V A;  3R9P A;  4FLT A;  1VRU A;  3LAL A;  4B1V A;  1HKB A;  4QAG A;  4CEO A;  4FK4 A;  5D3G A;  3L2Q A;  2Z1J A;  2A5X A;  2BTF A;  4FK2 A;  5CZ1 A;  1IJJ A;  2CGK A;  3CQ8 A;  4O5F A;  4DSE A;  5M1O A;  2A1R A;  3KKR A;  2UXC K;  4CJL A;  4DUZ K;  4RG8 A;  2WUS A;  1R0A A;  1NK9 A;  4DU1 A;  4CF0 A;  2CGJ A;  3CJ7 A;  3IFR A;  1IBM K;  3K5L A;  3NVM A;  2YNG A;  3K9K A;  3MAQ A;  4CF2 A;  2Z1I A;  4IG0 A;  2OTJ N;  2O8D B;  1BO5 O;  3H46 O;  1XMQ K;  4JV5 K;  2HF3 A;  4HCC A;  4CZL A;  4Q5V A;  1HKG A;  4K42 A;  1N5Y A;  2WTU A;  3BF1 A;  3ENO A;  4UQG A;  1BQM A;  2X6S A;  3ITH A;  3U3G A;  3A5M C;  4IZ9 A;  1RBR A;  1WSJ A;  4GKJ K;  3CYM A;  5BR8 K;  1VQM N;  4HUE A;  1RT1 A;  3QEV A;  1LV5 A;  3H3N O;  5AQU A;  3WXL A;  1KAZ A;  1DKG D;  3LDN A;  4JI4 K;  4I9L A;  1SKW A;  3O3G A;  1JL1 A;  4CW7 B;  5SWM A;  4BRA A;  3EKS A;  3OJS A;  4DV0 K;  4LF7 K;  2DPN A;  3TSU A;  3CC4 N;  2D0B A;  1S6P A;  1O13 A;  3LWL A;  4DR7 K;  3CCL N;  3O80 A;  1WBB A;  1MWK A;  4DQI A;  4JI3 K;  2FF6 A;  5EXW A;  5AZJ B;  1HX1 A;  2NRW A;  3VEW A;  5LJV A;  1BQN A;  1RT5 A;  2F4V K;  5HL7 L;  4QS8 A;  3ULE A;  4NYF A;  3WXM B;  4U7B A;  1VK0 A;  4CF9 A;  3OYF A;  2FF3 B;  1BWF O;  4M3X A;  1HYZ A;  3LZI A;  1KRP A;  3MCA B;  5I3U A;  4IEI A;  2O8B B;  1HKC A;  3KJV A;  1XQS C;  3MWT A;  3SUO A;  2VG7 A;  4AHV A;  3ATU A;  3L8B A;  4H5N A;  2HVI A;  3IRX A;  3NF7 A;  4JKF A;  3VET A;  3WXK A;  3O3H A;  3OYD A;  3GDQ A;  3F9M A;  5AR0 A;  2RHK A;  4FWQ A;  3HPH A;  4Q0B A;  3SAG A;  3P83 D;  4I2Q A;  2OCE A;  4BDP A;  1HPZ A;  2P9K A;  2QWM A;  4WF9 L;  2GEL A;  3R6M A;  4KHS A;  1BL3 A;  4O8U A;  4E3S A;  4XIU A;  4JRP A;  3HPG A;  2P9N B;  1GLD G;  5AQL A;  2AA4 A;  5BRD A;  5E84 A;  2UUA K;  4DTN A;  1LW2 A;  5CZ2 A;  5C24 A;  5FRM A;  1GLE G;  4CHP A;  4E7J A;  4YNQ A;  3NGI A;  4KTQ A;  2OAN A;  5C12 A;  5GIN A;  1XC3 A;  2W6K A;  1TK8 A;  2G8U A;  3AVF A;  3K5O A;  3LPT A;  3LAK A;  1VQK N;  3FZH A;  1L3S A;  1TKT A;  3KD5 E;  3TAF A;  1WSG A;  2KQ2 A;  3G0Z A;  4CJ4 A;  3L2U A;  2D0O A;  1QVF M;  3G10 A;  4CF8 A;  5AJ3 K;  3O4N A;  1I3A A;  3QEP A;  2HOE A;  2YNI A;  1VQ5 N;  1ZBH A;  3R8E A;  4CK1 A;  3OA9 A;  5EVZ A;  3TAG A;  1U45 A;  2YHY A;  3THW B;  1QE1 A;  1TKX A;  4CHY A;  4ZTF A;  4KB1 A;  4IBN A;  3OYM A;  3JYT A;  3CCJ N;  4NB4 A;  3LWM A;  3I8B A;  4M3Y A;  1ZYQ A;  3TAN A;  1IBL K;  2H3G X;  1ZC6 A;  2WON A;  4HCB A;  3WNG A;  2IVP A;  3DMJ A;  3R3L A;  2QWP A;  4YDU A;  2P9I A;  4YOW A;  4LFB K;  4DSI A;  1C0G A;  3MEG A;  4IXC A;  2VWJ A;  4DV2 K;  4QS7 A;  1NMD A;  4E0D A;  3IUC A;  1HYS A;  2Q31 A;  3OYB A;  1EX4 A;  1SKR A;  3HPO A;  4K43 A;  1UWB A;  3MN7 A;  3GG4 A;  3JS6 A;  2HNY A;  2LSN A;  2PAV A;  1BU6 O;  3ATV A;  4Y1C A;  4N5S A;  2FSJ A;  4YHH K;  1VQL N;  2BAN A;  5KPT A;  2DFH A;  4I6M A;  2PYJ A;  1RT7 A;  4LC9 B;  4E19 A;  4EHT A;  3KK2 A;  2X6N A;  2HBJ A;  4LSL A;  4I6M B;  3T7Z A;  3VGK A;  1J5E K;  5AQI A;  3V1Q A;  5C2F A;  4FJX A;  1HJO A;  3TAM A;  3QFU A;  1HMV A;  2XY7 A;  3CCM N;  4CZG A;  1UOC A;  4M7X A;  5AQW A;  2A3Z A;  3KLF A;  4WFB L;  2HST A;  5FPE A;  3SK3 A;  4H0T B;  4KH4 A;  3AY9 A;  4G1Q A;  3RWU A;  4E1N A;  4DF4 A;  4FJ8 A;  3CXC M;  2D0A A;  1VQO N;  3WQT A;  4Z4I A;  3UKU B;  2QWQ A;  3HZ6 A;  3OBY A;  4CER A;  4KPY A;  3J80 O;  4DTR A;  4JKA A;  1C0F A;  4FYD A;  4FJI A;  4BC3 A;  3I8D A;  3ISN C;  4BC5 A;  4E7H A;  2YCH A;  3ZEU A;  3WT0 A;  4JKC A;  3CJA A;  1JXE A;  4WQ5 C;  1JCG A;  1U2V B;  3QIP A;  4DB3 A;  3TPQ A;  1Y64 A;  3PX4 A;  1QSY A;  3K58 A;  5FPD A;  4JK8 A;  3CPW M;  4C8M A;  4DKW A;  3S9H A;  5AZI B;  1OH6 A;  3LP2 A;  1VSM A;  1RFQ A;  2YHW A;  3H08 A;  1NK4 A;  3O3F A;  1GOC A;  4GMJ B;  4E7I A;  4BDZ A;  3AO1 A;  5HRN A;  3ZSO A;  1SL1 A;  5AFU H;  4JI7 K;  4LF9 K;  4OLB A;  1N33 K;  4NLB A;  1BIZ A;  4BRN A;  1HNZ K;  4CHZ A;  4A2B A;  4DFK A;  4PL8 A;  1NK0 A;  3K57 A;  3DXM A;  4M3W A;  4DV1 K;  4WQ5 A;  4ICL A;  1K8A O;  2W41 A;  3TSP A;  4CE9 A;  5IWA K;  3T19 A;  4Z4F A;  4B1U B;  5J2Q A;  5TKW A;  5AQY A;  3AA5 X;  1NMN A;  4CJ5 A;  2HHW A;  5J2M A;  4M3R A;  4YOY A;  3MXI A;  1L3T A;  1Q8I A;  3S3M A;  3AO2 A;  3I55 N;  2QI2 A;  4GV3 A;  4B08 A;  4IDK A;  1KVB A;  1TYQ A;  3E01 A;  3G6E N;  1RDD A;  3Q7B A;  3O6W A;  3VQ6 A;  1NJZ A;  3LAM A;  3KZB A;  4H0X B;  5EOY A;  4ISF A;  1GLJ O;  3NH1 A;  5KGW A;  1RT2 A;  3I56 N;  1IH7 A;  3D6R A;  3VEY A;  4M42 A;  4CZI A;  3P5J A;  3CCV N;  2EX3 A;  4B9T A;  2B5J A;  3BUZ B;  3QNN A;  1BUP A;  3VGM A;  1NK6 A;  3M3Z A;  3ENH A;  2RE2 A;  4DTX A;  3HM9 A;  2IDO A;  3MN9 A;  3F2K A;  2Y1J A;  3THX A;  5EX5 A;  1RT3 A;  4KH5 A;  1E4F T;  5TKY A;  3S5T A;  4WYB A;  1KLN A;  2PZS A;  3D7E O;  1NK7 A;  3THX B;  4JI6 K;  2E1Z A;  3CC7 N;  5BPL A;  1ASV A;  3A8Y A;  1NWK A;  4LY7 A;  1N34 K;  1HNI A;  3M1F A;  3O9U A;  3OYE A;  2P51 A;  4C1N I;  4GY2 B;  2G8K A;  4PKH A;  3SUN A;  5AQK A;  1D9F A;  2QEX N;  2Q97 A;  3RMB A;  3CER A;  3SAF A;  4BQL A;  2HMI A;  4JKG A;  1DGK N;  3VGL A;  5KPR A;  2KTQ A;  5KQD A;  3F5T A;  4MO4 A;  4FCY A;  3K2P A;  4JKG B;  4AHU A;  2QM1 A;  1BGX T;  1S3X A;  4FW2 A;  4IJA A;  3D2E A;  1WB9 A;  4PY5 A;  4I7F A;  4CFC A;  3U4L A;  3ZX3 A;  5ADX A;  4FLY A;  3OYK A;  4Z4C A;  4KFB A;  1T44 A;  1HPM A;  4CJP A;  3L4I A;  3LL3 A;  3VQ5 A;  1OKJ A;  1VSD A;  1XC9 A;  1SS6 A;  1JLE A;  1QHA A;  2P9S B;  4RW8 A;  3ID8 A;  2E6M A;  5C2D A;  4DMN A;  3S3O A;  3CME N;  1U04 A;  3RTV A;  3DXK B;  3THY B;  2ZJQ L;  5AQJ A;  4FPA A;  3TI0 A;  1JLF A;  1BG3 A;  3SLC A;  1T6C A;  1NGC A;  3ZSY A;  3FFK B;  3W0L A;  5AQF A;  1CLQ A;  4IJN A;  4IEE A;  4B3M K;  3RSE B;  2ZQB A;  4BRH A;  1KFS A;  2QXL A;  4MO5 A;  4IO9 L;  3UKR A;  1V4S A;  2F9W A;  1ITG A;  5M1Q A;  4DF8 A;  4FXD A;  3ZT0 A;  3DYA A;  5M1K A;  4X64 K;  3SQ4 A;  2B6A A;  2J4R A;  2XY8 A;  3CC2 N;  4EZ9 A;  2HBL A;  5DK5 A;  4B9U A;  2E2P A;  4FLX A;  4LF6 K;  1JLB A;  4CJS A;  3N4Q A;  1KVA A;  3ZT2 A;  3ZLJ A;  1KLM A;  4BE2 A;  3HVR A;  4DLG A;  1NOY A;  4GV9 A;  1EWQ A;  3GE1 A;  2KW4 A;  5LMN K;  2UU9 K;  4KHY A;  4CJT A;  4DTP A;  1GOA A;  2O8E B;  1VQ4 N;  2FLO A;  3IKM A;  2VGM A;  1XI1 A;  2FBY A;  1ATR A;  5KTQ A;  3L4Q A;  4MDA A;  3DLR A;  1BCM A;  1VQN N;  1N8R O;  1W97 L;  5ELZ A;  2GV9 A;  3HBT A;  1S5J A;  1RBS A;  3VEO A;  4FM0 A;  4FLU A;  5AQQ A;  5CHI A;  1DLO A;  2Q0U A;  3D2F A;  4H4M A;  4BE1 A;  4AHC A;  1NGG A;  4BRQ A;  1WOQ A;  5MLC Q;  4DFM A;  1HR0 K;  4DHY A;  1FXX A;  3FE1 A;  4XH1 A;  3D2F B;  1VSH A;  4B3O A;  4PKI A;  5AQM A;  2HHU A;  1SQK A;  3ZX2 A;  4DSF A;  5E41 A;  4KH6 A;  3QES A;  3O9T A;  4FJ9 A;  4CEE A;  1YTA A;  2XRI A;  5K14 A;  4G9Z A;  3WQU A;  3S3N A;  3AAQ A;  1RBU A;  4BRO A;  5M1F A;  3CM5 A;  3L3V A;  4AH9 A;  3SYZ A;  5JIC A;  2PFU A;  3RMD A;  5FDL A;  1CZA N;  1S1W A;  1QSL A;  4BR4 A;  4CBW A;  4DS4 A;  4NCG A;  5JVH L;  4BGB A;  2IGI A;  2B4J A;  4H8K A;  4QCL A;  4CGG A;  4NO7 A;  4F4K A;  2BH1 A;  1GLA G;  4CZE A;  2HHT A;  2GEM A;  1Q18 A;  3CQX A;  1S1X A;  3ZX0 A;  1TK0 A;  4A57 A;  4XH5 A;  3QIC A;  1XHZ A;  5HRR A;  3OYI A;  1V4T A;  3NAE A;  1VHX A;  3OS0 A;  3VQD A;  4DV7 K;  1NU0 A;  2VQF K;  1NGI A;  2V7Y A;  1U6Z A;  1CZB A;  3VTH A;  3AVC A;  3BP8 A;  4FO0 A;  4W5N A;  2AP1 A;  2O8D A;  1TKZ A;  1C6V A;  4B1X B;  3DM2 A;  2A41 A;  3C6T A;  4Y0W A;  1JLQ A;  4CEF A;  3HOT A;  4FWK A;  4KTW A;  4M3T A;  4FJ5 A;  2F96 A;  4OO1 J;  2E20 A;  1OH5 A;  3NCI A;  4YOV A;  2ZJP L;  2NRT A;  1QQN A;  2HMP A;  2YX6 A;  3CJ9 A;  3CFP A;  1YAG A;  1NJW A;  2YJF A;  2NRH A;  2D4W A;  2V52 B;  3SBT A;  4FJK A;  4BEB A;  3LP0 A;  4O55 A;  4AHT A;  3HYF A;  2GX9 A;  4H5W A;  1KVC A;  3AGK A;  5AZJ A;  3LDS A;  4PWD A;  4H5R A;  3O9S A;  4OJR A;  4TSX A;  3SAH A;  3QLH A;  4DSL A;  4H03 B;  3KVG A;  4K8X A;  3EZW A;  1NLV A;  4CJQ A;  4I2P A;  3PIO L;  3F73 A;  1KXP A;  1WN7 A;  3DRS A;  4B9V A;  1JCE A;  3AVG A;  2QWL A;  3MK6 A;  3NBP A;  2ITM A;  4BDY A;  2O8B A;  3T1H K;  4EAH D;  1R59 O;  1ASU A;  2NRX A;  1KFD A;  2F9T A;  1JLC A;  1WLJ A;  4DV6 K;  3DOK A;  5I9E B;  3HP6 A;  1JKH A;  5CYQ A;  2OA8 A;  4ELU A;  3E66 A;  1LW0 A;  1XMO K;  1YIT N;  4RW6 A;  1T05 A;  3DI6 A;  3U9Z A;  3HST B;  3T3F A;  2YI1 A;  3AA3 A;  5GIO A;  1B92 A;  2OTL N;  1GLC G;  4LF8 K;  4DR2 K;  2O8F A;  3QEX A;  1Z26 A;  2Q2R A;  3UIQ A;  2P9N A;  3M8Q A;  2BUP A;  4E89 A;  2CH6 A;  2O8F B;  3MMV A;  1W7A A;  1UA1 A;  1DTT A;  3RR8 A;  2YJE A;  1D5A A;  3FZM A;  4F3T A;  4LFA K;  4DG1 A;  1GLL O;  3WEE B;  4ID5 A;  2KFN A;  2E1Y A;  3PO4 A;  2KLA A;  4DQR A;  1GLB G;  4B1W B;  4ID1 A;  3T1Y K;  3SMP A;  3SPZ A;  4UY8 O;  2X74 A;  2UXB K;  3P38 A;  4ZHR A;  3IAY A;  4J8F A;  3UE5 A;  1EP4 A;  4WFA L;  4FOE A;  1K8K A;  2Q1N A;  4FK0 A;  4JI2 K;  1IKX A;  2HNZ A;  3VQE A;  3CI5 A;  1K8K B;  4F8R A;  3THW A;  2R7Y A;  5CY4 A;  1WSE A;  4CJE A;  4BR9 A;  3LM2 A;  4JN4 A;  3B6O A;  4E7K A;  3QNO A;  2HHV A;  4JD2 B;  3A5O C;  2OPR A;  4PKG A;  1ZBF A;  2P9L B;  3CJ1 A;  3NVK A;  2D0P A;  3P1G A;  2VWB A;  4KV8 A;  2ZWH A;  3OYH A;  5HRO A;  3JSM A;  4DR4 K;  1GOB A;  1J54 A;  1S9G A;  4BRE A;  4FW1 A;  2Q36 A;  5EU7 A;  2YHA A;  1W0H A;  3LM9 A;  5AQN A;  4CZK A;  1YF5 L;  3D45 A;  5JS2 A;  3H6E A;  2KZZ A;  4NCB A;  1YVU A;  1Z25 A;  2HHI A;  3NF9 A;  3ID6 A;  1BA0 A;  3MEE A;  4EZ6 A;  1JXB A;  4JI8 K;  3MCP A;  3OBW A;  3F9K A;  3QIO A;  3BF3 A;  1VSF A;  2DFE A;  5C15 A;  5M1N A;  2HF4 A;  4BRC A;  1Q81 O;  3ZET A;  5JLH A;  3AAR A;  4CEC A;  3K5N A;  2HHQ A;  3MXM A;  4DUY K;  2NRZ A;  2E4L A;  3ZET B;  4JKB A;  1WBD A;  4J2A A;  3MWP A;  4FWP A;  4Y1D A;  1IKV A;  3CYG A;  1RDB A;  4FSV A;  4CD3 A;  1NJY A;  4CZH A;  3UKU A;  4FLW A;  3KD1 E;  3PSF A;  3AO4 A;  2PBD A;  4AHR A;  3Q7C A;  1HRH A;  3P39 A;  2CGL A;  1EXQ A;  3FZK A;  4ELV A;  2QW9 A;  3PUF A;  3VEZ A;  3EYZ A;  3L2W A;  1WAF A;  2ZGZ A;  3KWI A;  4B9N A;  3MEC A;  3O8M A;  5EY4 A;  1U2V A;  3AVB A;  1HJR A;  4GVM A;  3AA2 A;  4H5V A;  5GAE P;  2QKB A;  4JYA K;  5E26 A;  1J53 A;  2E2Q A;  4DTU A;  3EKU A;  3D0P A;  1HNX K;  4HTL A;  4NXN K;  3O9Q A;  4CBU A;  2FBV A;  4W5Q A;  1CXQ A;  4ILG B;  1C1C A;  3G4S N;  4BQZ A;  3PY8 A;  3CMA N;  5JMV A;  4DQP A;  1HYV A;  3E9L A;  3L3U A;  3DLK A;  4JNE A;  3WNF A;  3CCR N;  3RRG A;  5AZI A;  2AJQ A;  1J6Z A;  4DWI A;  1LWF A;  1XUP O;  4H0V B;  1J5O A;  4N47 A;  4MFB A;  3ZT4 A;  4BR7 A;  4FJM A;  1W9H A;  4OPA A;  4CCH A;  4OX9 K;  3PV8 A;  5FPM A;  4OLA A;  1E4G T;  3PLA A;  4M41 A;  2PYL A;  4JI1 K;  1KAY A;  3EE9 A;  1RDC A;  4OKE A;  1ZXO A;  1D9D A;  4K8Z A;  4FWO A;  1X3N A;  3O9R A;  4AF1 A;  1QQC A;  4BRP A;  1CZ9 A;  3CET A;  5A2Q O;  1TAU A;  2WFB A;  2A6A A;  3VQQ A;  2FBX A;  2FSN A;  4IFV A;  2QTD A;  1L5U A;  5F0X A;  2UUC K;  1T7P A;  1Z6R A;  5HRP A;  1QQO A;  4CEB A;  2Z1H A;  1BI4 A;  1Q9Y A;  2RPI A;  2E8A A;  3W3D A;  4ZTJ A;  1EWR A;  3AO5 A;  4EFH A;  1BI4 B;  5KGX A;  3CQY A;  3O5B A;  4CJR A;  4DU3 A;  3TR8 A;  4BRM A;  3VF2 A;  1YVN A;  3OYL A;  1U4B A;  3QB0 A;  1EO1 A;  3C6U A;  3K9J A;  1X3M A;  4WQ4 C;  1WSI A;  3TSQ A;  1UAX A;  1BCO A;  1RTD A;  1VSE A;  4GW6 A;  1RCH A;  4IOX A;  5FPN A;  3THV A;  2FXU A;  1RTI A;  4LH4 A;  4M3Z A;  3QEW A;  3O08 A;  1RDW X;  4FPB A;  3AAP A;  3HK2 A;  3AVA A;  3LDO A;  4DTJ A;  5J2P A;  1EQY A;  4C8L A;  3ZSR A;  1T8E A;  2ZM6 K;  2GBZ A;  2OPP A;  2HBM A;  3SCX A;  5AQX A;  1VQ6 N;  4IDH A;  3HL8 A;  2HHX A;  3EN9 A;  5LL6 Z;  1XWL A;  1OVQ A;  1JLA A;  4B1Z A;  3M5R A;  1L3V A;  4DFJ A;  1NNE A;  3MXJ A;  2UUB K;  3CD6 N;  2ZD1 A;  2HHH K;  1YI2 N;  1K73 O;  3QIN A;  3BY5 A;  4AIL C;  4LF5 K;  2IIR A;  1HNV A;  4Z4H A;  2P9P B;  2UXD K;  3C94 A;  3ZSW A;  5BR9 A;  5AFU A;  2OPQ A;  2E5L K;  4AM6 A;  3NH2 A;  1KTQ A;  2W6L A;  3C6H A;  5KPZ A;  1C0T A;  4MDB A;  1MDU B;  4NXM K;  4WQ4 A;  3EZ5 A;  5C0Y A;  3HO1 A;  4JEP A;  4DCH A;  3OTO K;  4BGA A;  2P9S A;  3VEV A;  1FKO A;  4C8K A;  1IBK K;  1XNQ K;  4KHP K;  5F1X A;  3L0Q A;  3KLI A;  1NJX A;  1NGF A;  3C0B A;  3CCU N;  4WE1 A;  4YOR A;  3DXK A;  1LWE A;  3THY A;  1TVR A;  3QML A;  2G8F A;  4B3R K;  4O5B A;  4Z4G A;  2NRR A;  5J1E A;  4DV5 K;  1ZBS A;  3SV4 A;  4M7Y A;  3DAW A;  4BC2 A;  4DSK A;  3V9S A;  3V6D A;  3LPU A;  4CIF A;  4KTZ A;  3OYG A;  3HOS A;  2HND A;  3HRG A;  4LF4 K;  4JAX A;  5KQ8 A;  3AO3 A;  3V9Z A;  3BZK A;  1S1U A;  1IO2 A;  3RSE A;  4KI4 A;  1TV6 A;  3OYJ A;  4DR6 K;  1HQU A;  4FJG A;  1DTQ A;  1NGA A;  1RDU A;  3TAQ A;  4YOX A;  2XY6 A;  5KI6 A;  4EP5 A;  3J81 O;  1NGB A;  3L6Q A;  3TAR A;  4O44 A;  3HI0 A;  4CEQ A;  4FJ7 A;  3LP1 A;  2ZF5 O;  2Q3S A;  1BA1 A;  1RTH A;  5CR4 A;  4O0J A;  3VQ4 A;  3RVC A;  4N41 A;  4W5R A;  1N32 K;  3QET A;  3C65 A;  3QER A;  3MED A;  3ENB A;  2IOC A;  3U3Y A;  2HHS A;  1KQS M;  3RRH A;  4O8K A;  5GAD P;  2O8E A;  3VA0 A;  2A42 A;  3CJC A;  3KK1 A;  3AVJ A;  3RMC A;  1ILY A;  2P1J A;  4JHD B;  3WNE A;  3M8R A;  1Q9X A;  2NUB A;  1ZBU A;  1YT3 A;  3SBG A;  1W2B M;  2QWN A;  4V19 S;  4Z0U A;  4KHQ A;  4DTO A;  3DLL L;  3K0S A;  1RGI A;  2WC9 A;  4RW9 A;  2E2N A;  3PO5 A;  3H45 C;  1JLG A;  3CPE A;  4A5B A;  1LAV A;  5AQR A;  4IKF A;  3U6F A;  4QS9 A;  3ZT3 A;  3GOI A;  2IC3 A;  4X66 K;  4FWM A;  3BGR A;  4NLC A;  4WCE L;  4C23 A;  2VCP A;  2ATQ A;  1QHT A;  3I33 A;  1LAW A;  5AQP A;  4DR5 K;  3TWH A;  5FRO A;  2EWS A;  1IG9 A;  3AVH A;  2JWL A;  2VYP A;  3EEQ A;  1CXU A;  2Y1I A;  1EKE A;  1ZBI A;  5GAG P;  2I7N A;  2C1G A;  3WUH A;  2XY5 A;  1U49 A;  2BGG A;  4IFY A;  4XH4 A;  4X62 K;  4F3O A;  1MU2 A;  3QFP A;  3AVL A;  1NGE A;  4FVU A;  4C8N A;  3IS9 A;  4IFE A;  1BDG A;  4YFU A;  2ASO A;  3EL2 A;  4GNI A;  4BEC A;  3M8P A;  3WXJ A;  3CJB A;  4YY3 K;  3LDP A;  4YOU A;  1EET A;  2DTU A;  2CH5 A;  3I0S A;  4N76 A;  3V1R A;  2GUP A;  3WXI A;  4KBO A;  1YTU A;  1WSH A;  4F9O A;  1N6Q A;  2O8C A;  3A0I X;  1RT6 A;  4J2B A;  3I0R A;  4OKJ A;  4BR2 A;  3CFR A;  5JS1 A;  2O8C B;  3OJU A;  1SUQ A;  3ZCM A;  3KLH A;  3C7N B;  1HNW K;  4FZZ A;  3M8S A;  4DU4 A;  3U9D A;  1KCF A;  1C1B A;  3QBX A;  1WNS A;  4Z94 A;  1VSJ A;  3ASM A;  3NFA A;  3VQP A;  4CJW A;  1REV A;  2NNW A;  2NLX A;  1QTM A;  4KAZ A;  3O1W A;  3DJC A;  3OYN A;  3TU5 A;  4KHW A;  3AVK A;  3A5L C;  3KWG A;  4FM2 A;  3JXU A;  3PX6 A;  2ETJ A;  4PA1 A;  4CGF A;  1BIS A;  3CF5 L;  1C0U A;  5AQV A;  1NKC A;  3SQ0 A;  5BPN A;  2GUI A;  2Q0R A;  4CGJ A;  3MN6 A;  4CJV A;  4BVO A;  5T7B A;  1QVG M;  4AM7 A;  2XHB A;  2OPS A;  5KRT A;  3AVM A;  1D8Y A;  1SV5 A;  4LH5 A;  3VN5 A;  3VQ7 A;  2GWK A;  2QWO A;  3HTV A;  4HUG A;  3SQ2 A;  1QQM A;  3VQC A;  1NGD A;  4B8A B;  4KKO A;  3OHR A;  1NK5 A;  3EE8 A;  3AVI A;  1M90 O;  4X65 K;  3KLE A;  3MN5 A;  3CCE N;  4A59 A;  3SMS A;  1K9M O;  1S9E A;  2OZS A;  3CM6 A;  1FK9 A;  3VA3 A;  5B8H A;  5HLF A;  1YJW N;  4B3S K;  5AQT A;  5CYM A;  4KHU A;  3VF6 A;  4AQY K;  3SNN A;  4J2E A;  1BOT O;  5AQZ A;  4IG3 A;  3TAE A;  1XHX A;  2D0C A;  2FBT A;  3A5N C;  2IVN A;  3KHY A;  1YUW A;  3DOL A;  4CJ3 A;  3SZ2 A;  4DLE A;  4OPJ A;  4CED A;  3KLG A;  1VSK A;  4HVJ A;  1SL0 A;  1RDA A;  4CZF A;  3NHG A;  3E1Y A;  4H0O A;  4H5T A;  4I9Q A;  1LWC A;  2C1I A;  3FZL A;  3M6G A;  3S41 A;  1LOT B;  3JAM O;  2I7P A;  3SQ1 A;  3ULE B;  1UA0 A;  4BE0 A;  4HHT A;  5DMR A;  1JCF A;  4B9S A;  2ZGY A;  3J8A A;  3WEE A;  2HW3 A;  1E3M A;  1S1V A;  4MLH A;  3FR0 A;  4IOA L;  1I39 A;  3LDL A;  3O4W A;  4CIE A;  1NGH A;  1ASW A;  3VES A;  5HP1 A;  2P5G A;  1IV0 A;  2FSK A;  2G8W A;  1VQ9 N;  1YJN N;  2YNF A;  4ISG A;  1OH8 A;  4PUO A;  1K6Y A;  4CGI A;  2W42 A;  3KK3 A;  1X1P A;  2I5J A;  1BIU A;  2P9K B;  5KRS A;  3RMA A;  4JS5 A;  3MX2 A;  4ISE A;  5BN8 A;  4YDU C;  2NRV A;  3VOV A;  4PL7 A;  3IMX A;  4JI0 K;  1T6D A;  4JD2 A;  3VQ9 A;  3LAN A;  2P9L A;  3J7Z O;  3CHW A;  3VTI A;  4AHS A;  4JLH A;  2RKI A;  4JKE A;  4LSN A;  3DLE A;  1X9J A;  3E9P A;  1TAQ A;  3SJH A;  4R79 A;  2G8H A;  3H1Q A;  4B1Y B;  4IOC L;  1YIJ N;  1TK5 A;  3K59 A;  4CGH A;  4O0I A;  3P4I A;  4JRQ A;  3T1A A;  4DR3 K;  3V81 A;  4CFA A;  1QZ6 A;  2ASP A;  5DM6 L;  1DT9 A;  1X9S A;  2YHB A;  2QA4 N;  5AQS A;  3OS2 A;  1U47 A;  1VSL A;  4OGE A;  1P90 A;  3VEN A;  3J7A P;  3R1X A;  4L3Q A;  2YNH A;  4FLV A;  4K0K K;  1KSP A;  3B8A X;  3KK7 A;  4BR0 A;  4HUF A;  1S22 A;  3PIP L;  4U67 L;  1HLU A;  4CZJ A;  4EHU A;  1NKB A;  3VQB A;  3DLB A;  4BRK A;  2P9I B;  3CCQ N;  3PSI A;  4DS5 A;  1C0M A;  4F2S A;  3DRP A;  2KKZ A;  1TUU A;  4CK2 A;  4KHN A;  4DV4 K;  4KI6 A;  1JL2 A;  3A2F A;  2A40 A;  3GBT A;  4H4O A;  4RTF D;  4FZY A;  1A5V A;  5C42 A;  4E1M A;  1FW6 A;  4CHQ A;  2HBK A;  3WNH A;  3UB5 A;  1IKY A;  3TTD A;  3HSC A;  1TL1 A;  3NDK A;  4JKD A;  2GWJ A;  1P8Z A;  2A1S A;  4BRG A;  4N56 A;  1Q82 O;  3LDQ A;  4BRD A;  5JEN A;  5JVG L;  5J2N A;  1RBT A;  5HRS A;  4DQ8 A;  4R5P A;  3ZSX A;  2ZJR L;  4M45 A;  1S6Q A;  5LJW A;  1NJI O;  4XEI A;  4HWI A;  4OKK A;  3BDP A;  2VG5 A;  1IG8 A;  4IWV A;  4FL9 A;  1NGJ A;  3TAB A;  2KZM A;  2WOM A;  2YV0 X;  3OYC A;  4JS4 A;  4BG9 A;  4FJN A;  2VG6 A;  4CD1 A;  4OPK A;  1A5W A;  1T03 A;  5AQG A;  4RW7 A;  4CJF A;  2G8I A;  4BRL A;  2E2O A;  2VQE K;  2JWK A;  5C10 A;  4FLZ A;  4GVE A;  4LD0 A;  1VQ7 N;  1Q86 O;  4L8R B;  3U8X A;  2D1K A;  4EP4 A;  5AQO A;  2O4I A;  4PQU A;  1D4X A;  4BC4 A;  2NZT A;  2HVH A;  4A61 A;  4JI5 K;  2OZM A;  2KHO A;  3V9U A;  3ZEU B;  4H0P A;  1T3V A;  2YHX A;  4CK3 A;  2ZE2 A;  3MX5 A;  4CF1 A;  1NBW A;  1G15 A;  3J7Y P;  4GKK K;  4KB0 A;  4F2R A;  3CG7 A;  4ILH A;  3TAP A;  4IO8 A;  1OH7 A;  4NCA A;  4JKH A;  3AVN A;  1QSS A;  4FWN A;  2IS3 A;  3E9O A;  5AQH A;  3CCS N;  5IT9 O;  1YJ9 N;  2V7Z A;  5F2R A;  1MA9 B;  1F21 A;  1C1A A;  3DWL A;  1TUY A;  5M1P A;  3OS1 A;  4BE7 B;  3VER A;  4KRE A;  3AGR A;  4NYN A;  5SZT A;  3HM8 A;  3DRR A;  3SUQ A;  3QEI A;  1SL2 A;  3HP9 A;  3OY9 A;  2P9U A;  4DTM A;  4E7L A;  4QOZ B;  4XJX A;  2W00 A;  2GTD A;  4RCH A;  4BRF A;  5ADX H;  3DXM B;  2P9U B;  2ITG A;  1RBV A;  3HT3 A;  1FKP A;  4ILJ A;  3QDK A;  2G8V A;  3KTQ A;  2V51 B;  3DLG A;  1ZBL A;  3NGY A;  3ZT1 A;  5HOO A;  4DQS A;  3AA4 A;  3ZSV A;  2HB5 A;  5LMU K;  1B9F A;  4BG8 A;  1QS4 A;  2IVO A;  4FJL A;  1VSI A;  4OPH A;  4BY9 C;  4DR1 K;  3MDQ A;  4FJH A;  1Y97 A;  3TTC A;  1S1T A;  3L2V A;  3FLC O;  4HTU A;  2IAJ A;  1MWM A;  3H1V X;  1TYQ B;  2E6L A;  4CI6 A;  4B8C A;  1Z05 A;  1RT4 A;  3IG1 A;  3QO9 A;  2O4G A;  1VQP N;  3P31 A;  3HXM A;  4FWS A;  3T69 A;  4DSJ A;  2RN2 A;  4OGC A;  1ESV A;  4JK7 A;  5GAH P;  4FJJ A;  3C6A A;  5FRN A;  4E1J A;  1XNR K;  2DFF A;  3V9W A;  1NG9 A;  1KC8 O;  1NOZ A;  4PHT X;  2P9P A;  4FWR A;  4YOT A;  1TKD A;  4FZX C;  2DY4 A;  3VQA A;  3SUP A;  4E72 A;  3L2R A;  4DFP A;  4O4G A;  4ELT A;  4FM1 A;  3NF6 A;  1SAZ A;  4LFC K;  3HVT A;  2F8T A;  3B6P A;  1N36 K;  5I42 A;  4CIG A;  4BRI A;  5BPM A;  4DQQ A;  3BEX A;  2XO7 A;  3ZYY X;  3OVN A;  4C8O A;  3VMF B;  4RWT A;  4DV3 K;  1KD1 O;  1TGO A;  3FFI A;  3K5M A;  2JGU A;  4CGD A;  1HQE A;  3DLH A;  2X78 A;  5HBM A;  2JLE A;  1FJG K;  3TTF A;  3C95 A;  4MQ3 A;  3PX0 A;  1I94 K;  1WAJ A;  4B3T K;  4A62 A;  1LCU A;  1DEJ A;  3KIO A;  1ATN A;  3FZF A;  3LZJ A;  2FC0 A;  3ALY A;  3D2E B;  1BHL A;  3VEX A;  3EO3 A;  1QZ5 A;  3AV9 A;  5GIP A;  3V9X A;  1M1K O;  3EY1 A;  1J9A A;  3SPY A;  2F8S A;  3OW2 M;  3G25 A;  3CIP A;  5FLX O;  2E88 A;  5BRH A;  3VF4 A;  2ASM A;  2QWR A;  4KO0 A;  4H0Y B;  3OYA A;  3KKS A;  1KAX A;  5CE3 A;  4BWJ A;  1S72 N;  4BR5 A;  2KFZ A;  3ULD A;  1NM1 A;  1TL3 A;  3RR7 A;  3NMU A;  3O1B A;  4W5T A;  4BWM A;  4FWL A;  2WBN A;  4JHD A;  1G99 A;  4KRF A;  1JJ2 M;  3HJF A;  1VQ8 N;  5BRE A;  2YKN A;  4CHN A;  1Q7Y O;  5C25 A;  4CZM A;  1OVY A;  3UKR B;  3FGU A;  4CFB A;  4B9Q A;  1IKW A;  1VRT A;  3V4I A;  3NGZ A;  4FOI A;  3NE6 A;  1U48 A;  5BN9 A;  2YKM A;  2OYQ A;  4CEA A;  1RTJ A;  1ATS A;  4EIA A;  4CEZ A;  4K25 A;  2QKK A;  4JK9 A;  4CHO A;  2PY5 A;  4B9L A;  2EHG A;  5H1S Q;  3SV3 A;  1X9M A;  1SZ2 A;  3NH0 A;  4BVP A;  4J2D A;  1X9W A;  2UYT A;  2BE2 A;  2RF2 A;  3IDH A;  2W40 A;  1WSF A;  3G71 N;  2VGN A;  5DM7 L;  4B9M A;  4Z4E A;  4FVM A;  5JLF A;  2Z1G A;  1A5X A;  1HUX A;  4C1N K;  2BDP A;  2QK9 A;  1RIL A;  3VQ8 A;  1YXQ A;  3QBW A;  3NF8 A;  2P5O A;  4A2A A;  1NKE A;  4GV6 A;  4A5A A; 
#chains in the Genus database with same CATH homology
 2E1Z A;  3ULE B;  5BPL A;  3CC7 N;  3VEZ A;  2ZGZ A;  3A8Y A;  3VPZ A;  1NWK A;  3KWI A;  3O8M A;  1VAZ A;  1WUA A;  1JCF A;  3M1F A;  3O9U A;  5EY4 A;  1YHQ N;  1U2V A;  2ZGY A;  3J8A A;  3WEE A;  4C1N I;  4GY2 B;  5GAE P;  4H5V A;  4MLH A;  4MLE A;  4PKH A;  5E26 A;  3FR0 A;  5AQK A;  4CBX A;  4IOA L;  2E2Q A;  3EKU A;  3LDL A;  3O4W A;  2QEX N;  4HTL A;  2Q97 A;  3CER A;  3SAF A;  1NGH A;  3O9Q A;  4CBU A;  4BQL A;  4ILG B;  3G4S N;  4JKG A;  3VES A;  4BQZ A;  1DGK N;  1GLF O;  2FSK A;  3VGL A;  5KPR A;  3H3O B;  4CJ7 A;  1VQ9 N;  5KQD A;  1YJN N;  4ISG A;  3CMA N;  3N4P A;  3F5T A;  4M63 C;  4MO4 A;  5JMV A;  4JKG B;  2F7T A;  2QM1 A;  3E9L A;  5LY3 A;  1S3X A;  4JNE A;  3CCR N;  5BRF A;  5AZI A;  4IJA A;  1J6Z A;  2P9K B;  3D2E A;  1XUP O;  4H0V B;  3C7N A;  4WFN L;  3U4L A;  3MX2 A;  3ZX3 A;  5ADX A;  4ISE A;  4K41 A;  3GL1 A;  1H1V A;  3R9P A;  5BN8 A;  1T44 A;  1HPM A;  2NRV A;  1HKB A;  3L4I A;  3LL3 A;  4YDU C;  3VOV A;  4B1V A;  1OKJ A;  4BR7 A;  4PL7 A;  2A5X A;  2BTF A;  3IMX A;  1SS6 A;  4OPA A;  2P9S B;  1QHA A;  1T6D A;  4JD2 A;  1IJJ A;  2CGK A;  3ID8 A;  2P9L A;  3J7Z O;  3CHW A;  4O5F A;  5FPM A;  5C2D A;  3VTI A;  5M1O A;  1E4G T;  3PLA A;  4JKE A;  3E9P A;  1X9J A;  3CME N;  2WUS A;  3SJH A;  3DXK B;  1KAY A;  3EE9 A;  4R79 A;  2ZJQ L;  3H1Q A;  5AQJ A;  4FPA A;  4B1Y B;  4IOC L;  3SLC A;  1BG3 A;  2CGJ A;  3CJ7 A;  1T6C A;  1YIJ N;  3IFR A;  1NGC A;  1ZXO A;  3NVM A;  3FFK B;  3W0L A;  3K9K A;  3P4I A;  4FWO A;  5AQF A;  1X3N A;  3O9R A;  4IJN A;  4AF1 A;  4IEE A;  3RSE B;  4BRP A;  1QZ6 A;  2OTJ N;  2ASP A;  5DM6 L;  4BRH A;  1DT9 A;  3CET A;  1BO5 O;  2WFB A;  2A6A A;  2QXL A;  3H46 O;  4MO5 A;  5AQS A;  2QA4 N;  4IO9 L;  3UKR A;  1V4S A;  2HF3 A;  2F9W A;  1P90 A;  5M1Q A;  3VEN A;  2FSN A;  4CZL A;  5M1K A;  3R1X A;  1HKG A;  4K42 A;  2QTD A;  3BF1 A;  2J4R A;  4L3Q A;  3ENO A;  5F0X A;  3CC2 N;  2HBL A;  3B8A X;  1Z6R A;  2E2P A;  3A5M C;  4IZ9 A;  3KK7 A;  4BR0 A;  1QQO A;  1S22 A;  3PIP L;  4U67 L;  1HLU A;  2E8A A;  3N4Q A;  4CZJ A;  4EHU A;  1VQM N;  3W3D A;  4BRK A;  3H3N O;  5AQU A;  3WXL A;  1KAZ A;  2P9I B;  3CCQ N;  4GV9 A;  4EFH A;  1DKG D;  3LDN A;  3GE1 A;  2KKZ A;  3CQY A;  1TUU A;  4BRA A;  3EKS A;  3O5B A;  2FLO A;  1VQ4 N;  2A40 A;  2DPN A;  3GBT A;  3TSU A;  3IKM A;  2VGM A;  3CC4 N;  4RTF D;  1ATR A;  4BRM A;  3L4Q A;  3VF2 A;  1YVN A;  4MDA A;  1O13 A;  3QB0 A;  1EO1 A;  1VQN N;  3CCL N;  3O80 A;  1N8R O;  1W97 L;  3K9J A;  5ELZ A;  3HBT A;  1X3M A;  1MWK A;  4WQ4 C;  3TSQ A;  2HBK A;  3UB5 A;  3VEO A;  4IOX A;  2FF6 A;  5FPN A;  5EXW A;  5AZJ B;  5AQQ A;  1HX1 A;  5CHI A;  3TTD A;  2Q0U A;  3D2F A;  3HSC A;  2FXU A;  2NRW A;  4JKD A;  2GWJ A;  1NGG A;  4BRQ A;  1P8Z A;  1WOQ A;  3VEW A;  4BRG A;  5LJV A;  5MLC Q;  1Q82 O;  3LDQ A;  5HL7 L;  4DHY A;  3O08 A;  4BRD A;  3FE1 A;  1RDW X;  4FPB A;  4QS8 A;  3ULE A;  3AAP A;  4XH1 A;  3D2F B;  3LDO A;  3WXM B;  4U7B A;  5JVG L;  1EQY A;  2FF3 B;  1BWF O;  4PKI A;  4DQ8 A;  5AQM A;  2HBM A;  3MCA B;  1SQK A;  3ZX2 A;  5AQX A;  2ZJR L;  1VQ6 N;  4IEI A;  4IDH A;  1HKC A;  3EN9 A;  5LJW A;  1XQS C;  3MWT A;  1NJI O;  4B1Z A;  4KH6 A;  4XEI A;  4HWI A;  3M5R A;  3O9T A;  3ATU A;  1IG8 A;  3CD6 N;  4H5N A;  4IWV A;  4FL9 A;  1NGJ A;  1YI2 N;  1K73 O;  4JKF A;  3VET A;  2IIR A;  3WXK A;  2P9P B;  3GDQ A;  3F9M A;  4BG9 A;  3WQU A;  5AR0 A;  5BR9 A;  3AAQ A;  5AFU A;  4G9Z A;  4CD1 A;  4BRO A;  2RHK A;  4FWQ A;  5M1F A;  4AM6 A;  3SAG A;  5AQG A;  5JIC A;  2PFU A;  3C6H A;  2E2O A;  4BRL A;  2JWK A;  2P9K A;  5KPZ A;  5C10 A;  2QWM A;  4MDB A;  2GEL A;  1MDU B;  4WF9 L;  4GVE A;  1CZA N;  3R6M A;  1Q86 O;  1VQ7 N;  3U8X A;  2D1K A;  4WQ4 A;  5C0Y A;  4BR4 A;  4CBW A;  5AQO A;  4O8U A;  1D4X A;  4BC4 A;  5JVH L;  2P9N B;  1GLD G;  5AQL A;  4JEP A;  2AA4 A;  2NZT A;  5E84 A;  4BGB A;  4DCH A;  5BRD A;  4A61 A;  4NO7 A;  2KHO A;  4BGA A;  3ZEU B;  2P9S A;  1GLE G;  1GLA G;  2BH1 A;  4H0P A;  1T3V A;  3VEV A;  2YHX A;  4CZE A;  2GEM A;  1Q18 A;  3L0Q A;  3MX5 A;  3CQX A;  5F1X A;  3ZX0 A;  2OAN A;  4A57 A;  4XH5 A;  1NBW A;  1XC3 A;  1NGF A;  5C12 A;  5GIN A;  3C0B A;  3CCU N;  3QIC A;  1VQK N;  4YOR A;  1V4T A;  3DXK A;  3FZH A;  3QML A;  4ILH A;  2NRR A;  4IO8 A;  1ZBS A;  4M7Y A;  3DAW A;  4BC2 A;  4JKH A;  2D0O A;  1NGI A;  2V7Y A;  4FWN A;  1U6Z A;  3CCS N;  3E9O A;  5AQH A;  3VTH A;  3HOS A;  1QVF M;  3HRG A;  4JAX A;  5KQ8 A;  3BP8 A;  1YJ9 N;  3RSE A;  2V7Z A;  4FO0 A;  5F2R A;  1MA9 B;  2AP1 A;  2HOE A;  3DWL A;  1VQ5 N;  1TUY A;  5M1P A;  3OA9 A;  1NGA A;  3R8E A;  4B1X B;  5EVZ A;  4BE7 B;  1RDU A;  2YHY A;  3VER A;  2A41 A;  3AGR A;  4Y0W A;  3HM8 A;  4YOX A;  1NGB A;  3L6Q A;  3HOT A;  4FWK A;  3CCJ N;  4NB4 A;  3I8B A;  2P9U A;  3HI0 A;  2ZF5 O;  4XJX A;  2W00 A;  2GTD A;  2H3G X;  2E20 A;  4OO1 J;  1BA1 A;  1ZC6 A;  4RCH A;  2IVP A;  3R3L A;  4BRF A;  5ADX H;  3DXM B;  2P9U B;  2QWP A;  4YOV A;  2NRT A;  2ZJP L;  5CR4 A;  4YDU A;  1QQN A;  2HMP A;  2YX6 A;  2P9I A;  3RVC A;  4YOW A;  4ILJ A;  3CJ9 A;  3C65 A;  3QDK A;  1C0G A;  2V51 B;  4IXC A;  1YAG A;  4QS7 A;  1NMD A;  3IUC A;  3ENB A;  2YJF A;  2NRH A;  5HOO A;  2D4W A;  2V52 B;  3SBT A;  1KQS M;  2Q31 A;  4O8K A;  4BG8 A;  5GAD P;  2IVO A;  4K43 A;  4BEB A;  3MN7 A;  2A42 A;  3GG4 A;  3JS6 A;  3CJC A;  2PAV A;  1ILY A;  4OPH A;  4BY9 C;  4JHD B;  1BU6 O;  3MDQ A;  3ATV A;  2GX9 A;  4H5W A;  3TTC A;  1W2B M;  2FSJ A;  3AGK A;  2QWN A;  3SBG A;  3FLC O;  5AZJ A;  1VQL N;  1MWM A;  3H1V X;  4H5R A;  5KPT A;  3DLL L;  1TYQ B;  1RGI A;  2WC9 A;  4I6M A;  4CI6 A;  4LC9 B;  2E2N A;  4EHT A;  1Z05 A;  3O9S A;  3H45 C;  3SAH A;  3CPE A;  4A5B A;  2HBJ A;  4H03 B;  1VQP N;  3KVG A;  5AQR A;  3EZW A;  1NLV A;  3P31 A;  4I6M B;  4QS9 A;  3T7Z A;  3PIO L;  3GOI A;  3VGK A;  1KXP A;  4FWM A;  4NLC A;  4WCE L;  4FWS A;  3T69 A;  4C23 A;  1JCE A;  2VCP A;  2QWL A;  5AQI A;  1ESV A;  4JK7 A;  3MK6 A;  5GAH P;  3I33 A;  5C2F A;  3C6A A;  2ITM A;  5AQP A;  1R59 O;  4EAH D;  2NRX A;  1HJO A;  4E1J A;  3QFU A;  2F9T A;  3CCM N;  4CZG A;  5I9E B;  4M7X A;  5AQW A;  2EWS A;  2A3Z A;  1KC8 O;  4PHT X;  2JWL A;  4WFB L;  2VYP A;  2HST A;  2P9P A;  4FWR A;  5FPE A;  3SK3 A;  3E66 A;  4H0T B;  4KH4 A;  3AY9 A;  4YOT A;  1YIT N;  3CXC M;  1VQO N;  3U9Z A;  3WQT A;  5GAG P;  2YI1 A;  3UKU B;  2QWQ A;  5GIO A;  2I7N A;  3HZ6 A;  3OBY A;  2C1G A;  3WUH A;  2OTL N;  1GLC G;  4JKA A;  1SAZ A;  1C0F A;  2Q2R A;  2P9N A;  4BC3 A;  4BRI A;  2BUP A;  4XH4 A;  2CH6 A;  3MMV A;  4BC5 A;  5BPM A;  2YCH A;  3ZEU A;  3WT0 A;  3QFP A;  2YJE A;  1NGE A;  4JKC A;  3BEX A;  3FZM A;  3ZYY X;  4FVU A;  3CJA A;  3VMF B;  4RWT A;  1KD1 O;  4WQ5 C;  1JCG A;  4IFE A;  1GLL O;  1U2V B;  1BDG A;  3WEE B;  2ASO A;  3EL2 A;  4GNI A;  4BEC A;  3WXJ A;  4DB3 A;  2E1Y A;  3TPQ A;  2KLA A;  1GLB G;  3CJB A;  1Y64 A;  4B1W B;  3LDP A;  4YOU A;  3SMP A;  2CH5 A;  3TTF A;  4UY8 O;  3P38 A;  2GUP A;  3WXI A;  4J8F A;  4KBO A;  3UE5 A;  4F9O A;  4A62 A;  5FPD A;  4JK8 A;  3A0I X;  1LCU A;  1DEJ A;  4WFA L;  4FOE A;  4BR2 A;  1K8K A;  1ATN A;  2Q1N A;  3CPW M;  3FZF A;  4DKW A;  5AZI B;  1RFQ A;  2YHW A;  3CI5 A;  3D2E B;  1K8K B;  3C7N B;  3VEX A;  3EO3 A;  3U9D A;  5AFU H;  1QZ5 A;  4BR9 A;  3QBX A;  3LM2 A;  5GIP A;  1M1K O;  4Z94 A;  4NLB A;  4JN4 A;  2NNW A;  2NLX A;  3OW2 M;  3G25 A;  4BRN A;  4JD2 B;  3A5O C;  3CIP A;  2E88 A;  3O1W A;  5BRH A;  4PKG A;  3DJC A;  2ASM A;  3TU5 A;  2P9L B;  2QWR A;  4PL8 A;  3CJ1 A;  3VF4 A;  4H0Y B;  4A2B A;  3A5L C;  3KWG A;  3DXM A;  3NVK A;  2D0P A;  1KAX A;  2VWB A;  5CE3 A;  1S72 N;  3JXU A;  4WQ5 A;  1K8A O;  2W41 A;  3TSP A;  2ZWH A;  4BR5 A;  1NM1 A;  3CF5 L;  4BRE A;  3NMU A;  4B1U B;  3O1B A;  5AQV A;  5TKW A;  2Q36 A;  5BPN A;  2Q0R A;  4FWL A;  5AQY A;  3MN6 A;  2WBN A;  4JHD A;  1G99 A;  4YOY A;  4BVO A;  1JJ2 M;  3LM9 A;  5AQN A;  1QVG M;  4CZK A;  3I55 N;  1YF5 L;  2QI2 A;  4AM7 A;  1VQ8 N;  5BRE A;  3H6E A;  4GV3 A;  1Q7Y O;  3ID6 A;  1TYQ A;  1BA0 A;  4CZM A;  2GWK A;  2QWO A;  3HTV A;  3MCP A;  3OBW A;  1OVY A;  3UKR B;  1QQM A;  3FGU A;  3G6E N;  4B9Q A;  3BF3 A;  1NGD A;  3Q7B A;  3O6W A;  4FOI A;  3OHR A;  3EE8 A;  5C15 A;  1M90 O;  3MN5 A;  5BN9 A;  5M1N A;  2HF4 A;  3CCE N;  3KZB A;  4H0X B;  5EOY A;  3SMS A;  4A59 A;  4ISF A;  1GLJ O;  4BRC A;  1Q81 O;  1ATS A;  3ZET A;  4EIA A;  5JLH A;  3I56 N;  3AAR A;  1K9M O;  3D6R A;  4K25 A;  3VEY A;  4JK9 A;  4CZI A;  1YJW N;  5B8H A;  5AQT A;  2NRZ A;  5H1S Q;  3ZET B;  3CCV N;  4JKB A;  1SZ2 A;  3VF6 A;  1BOT O;  3MWP A;  3BUZ B;  4FWP A;  5AQZ A;  4BVP A;  2UYT A;  3A5N C;  1BUP A;  3IDH A;  2W40 A;  2IVN A;  3VGM A;  3KHY A;  1YUW A;  3M3Z A;  3G71 N;  2VGN A;  3ENH A;  4FSV A;  2RE2 A;  4CD3 A;  5DM7 L;  4CZH A;  3UKU A;  5JLF A;  1HUX A;  4C1N K;  3MN9 A;  3F2K A;  4CZF A;  5EX5 A;  2PBD A;  1YXQ A;  3E1Y A;  4H0O A;  3QBW A;  4H5T A;  4KH5 A;  3Q7C A;  1E4F T;  5TKY A;  4A2A A;  2C1I A;  4GV6 A;  3P39 A;  4WYB A;  4A5A A;  3FZL A;  2CGL A;  3D7E O;  3M6G A;  3FZK A;  3S41 A;  1LOT B;  2I7P A;  2QW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...