3DXMA

Structure of bos taurus arp2/3 complex with bound inhibitor ck0993548
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
414
structure length
399
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Characterization of two classes of small molecule inhibitors of Arp2/3 complex
pubmed doi rcsb
molecule tags Structural protein
total genus 130
structure length 399
sequence length 414
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3dxmA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxmA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxmA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3dxmA04
5BRFA 3QBWA 3W3DA 4MLHA 3QICA 1C0GA 4BG9A 2P9KB 1ESVA 3A5OC 3TPQA 2E1ZA 3CQYA 3CETA 3EKUA 4O5FA 4M7XA 1IG8A 4MO4A 2BUPA 2YHYA 3DWLA 5JMVA 2ASMA 4M63C 3I33A 4WQ4C 5KPRA 5AQTA 3FFKB 1NM1A 4BR7A 3QFPA 2YHXA 4BRCA 2FSNA 1U6ZA 3AAQA 3DXMB 3FE1A 1T44A 5BN9A 1QZ5A 4BC4A 3WT0A 1DGKN 4FWMA 1NGBA 5B8HA 1X3NA 3QBXA 4BRLA 3VETA 3I8BA 3L6QA 2FXUA 3MN9A 4H03B 1BO5O 3CJBA 4BC2A 4BR0A 2QW9A 1BWFO 2AA4A 2F9TA 2CGJA 1CZAN 2P9SB 5BPMA 1NGFA 5AQNA 3CI5A 3VEXA 3DXKA 4CZKA 4B1YB 3A5NC 3FR0A 3MCPA 3EN9A 4XH4A 3CJAA 4CZFA 4DQ8A 5CE3A 2KHOA 1GLAG 2P9UA 2QWLA 3RSEA 3A0IX 3SMSA 3VENA 1KAZA 2W41A 4PKHA 3C7NA 4BC5A 1DEJA 4BVOA 5KPTA 4ISGA 1HPMA 3LM9A 3JS6A 2J4RA 4I6MB 3CJ9A 3D2EB 2HF4A 2YJFA 4FWQA 3ZEUA 2DPNA 3HI0A 5AQLA 1BA1A 2FF3B 1HLUA 2Q31A 1BUPA 3O80A 2P9KA 3HSCA 1Y64A 5LY3A 2CGKA 4RTFD 5FPMA 3O1WA 3UE5A 1YVNA 5BRDA 3WXLA 1QZ6A 5AQMA 3GG4A 5LJVA 1NWKA 4BR9A 2E88A 2Q0RA 4FL9A 5AQYA 3LDQA 4H5WA 4Y0WA 1V4SA 1QQNA 1NGIA 1U2VB 3VOVA 2GWJA 2Q36A 3H3OB 1G99A 3O5BA 1QQOA 3DXMA 3FGUA 1NGEA 3B8AX 3ULEB 4BREA 2Q1NA 3ZX3A 3MN6A 5BPLA 1H1VA 2OANA 1KXPA 5AQUA 3U9ZA 4B9QA 2HF3A 4O8KA 2E8AA 2HMPA 2UYTA 1NMDA 5EY4A 4BGBA 2P9IA 4IJNA 4PL8A 2P9SA 3BUZB 2NRHA 2V7ZA 3ATUA 4H5VA 4ISEA 3LDPA 5AQGA 3VEOA 1YXQA 4H0TB 4QS8A 4DCHA 1XQSC 2YHWA 4CI6A 2HOEA 3GOIA 4CJ7A 5AQXA 3VF6A 2Q2RA 3IMXA 5AQVA 4EFHA 4F9OA 4JD2B 4BROA 4IJAA 3QFUA 1ZBSA 5KQ8A 4I6MA 1YAGA 3AY9A 3U9DA 3VERA 2H3GX 3VEWA 2D4WA 3ZX0A 5BREA 3GDQA 2IVNA 4JN4A 4RCHA 4WQ5A 4A61A 2E2QA 1J6ZA 4XH1A 5F1XA 1GLBG 1V4TA 5EXWA 2I7PA 1LCUA 4CZLA 5JICA 2P9NA 5ADXH 2V51B 4A2BA 3VF4A 2BTFA 2IVOA 3H1QA 5AQFA 3L4IA 4KBOA 5TKYA 3JXUA 3M3ZA 4A2AA 1GLLO 2A40A 3EKSA 1X3MA 2NZTA 2ASPA 2CGLA 4CBUA 1RGIA 5AFUH 5AZIA 3CJCA 1RDWX 3QDKA 4B1ZA 1ATSA 2A42A 5AQSA 1QQMA 3C0BA 3O08A 5AQPA 3O1BA 2FSJA 3CJ1A 3MDQA 1U2VA 1DKGD 4BRFA 1YUWA 3VESA 1WUAA 3WXIA 4BR2A 5AFUA 1Z6RA 2YI1A 1Q18A 3FZHA 3F9MA 5FPNA 4JNEA 5I9EB 3KHYA 4BRPA 3U4LA 1IJJA 3MN7A 3WXJA 1X9JA 3VGLA 3KVGA 5AQZA 4WQ5C 3WEEB 1K8KB 1NLVA 3LDOA 4FSVA 4FWPA 3CQXA 4NB4A 3LL3A 4Z94A 5F0XA 4J8FA 1QHAA 3U8XA 3FZMA 3O4WA 3M6GA 4EHTA 4K41A 2GWKA 3A5LC 4JD2A 3D2FB 1SZ2A 5FPEA 4DHYA 4FPAA 5AQJA 3BF3A 1ATRA 1S3XA 2IVPA 3G25A 3WXKA 1P8ZA 2VWBA 3CERA 3SLCA 1NGDA 1HX1A 3SMPA 3QB0A 4B1WB 3IDHA 1BDGA 3M1FA 1KAYA 1JCFA 3DAWA 5AQRA 1XC3A 2W40A 1GLJO 4H5RA 4BC3A 5BRHA 3UKUB 4JHDB 4DB3A 5AQHA 3ENOA 4FWRA 4XH5A 3HBTA 3LM2A 5LJWA 1MWKA 1JCGA 2P9LB 5AR0A 4B1UB 4BR4A 1C0FA 2GTDA 3R6MA 2PBDA 2NLXA 4H0VB 4CBXA 1NBWA 4BRDA 4PKIA 3VGKA 1GLCG 1HKBA 4FO0A 4BVPA 3W0LA 1TUUA 3DJCA 3FZFA 1R59O 3FLCO 4WYBA 3CIPA 2P9PB 2PAVA 1MWMA 1TYQB 1NGGA 2GEMA 5EX5A 1RFQA 2FF6A 1SQKA 3HTVA 4FWSA 3WQTA 3WEEA 1K8KA 2E2OA 4M7YA 2E2NA 2EWSA 1BA0A 2A3ZA 3D7EO 5ELZA 1SAZA 3IUCA 3OHRA 4EIAA 3J8AA 5JLHA 5AQIA 3DXKB 4B1VA 3D2FA 3D2EA 3R8EA 4H5TA 4XEIA 2ZGYA 4H0XB 4CD3A 4IWVA 4BQLA 1BG3A 5BPNA 2FLOA 3VF2A 3C7NB 3EZWA 4BRKA 2YCHA 5EOYA 2A6AA 2I7NA 1XUPO 4FPBA 3HM8A 4QS9A 1T6CA 1Z05A 5EVZA 4CZGA 2E20A 1NGJA 3UKUA 2ZGZA 4JHDA 5ADXA 2ITMA 3H6EA 5F2RA 2D0OA 2AP1A 3UKRB 4BRIA 2QM1A 2P9LA 4BRNA 1E4GT 3HZ6A 3ID8A 4FWKA 4GY2B 2IIRA 4B1XB 5FPDA 2VCPA 1E4FT 3EL2A 3ULEA 4CD1A 4BRHA 4QS7A 1NGHA 5AQKA 3LDLA 3BF1A 1GLDG 3SJHA 1MDUB 2V7YA 2ZF5O 1HJOA 2P9PA 3AARA 3R9PA 1NGAA 1TYQA 4BGAA 3ENHA 4BRGA 4C23A 3VGMA 4IXCA 1LOTB 2ZWHA 3S41A 4YDUA 5JLFA 3QMLA 2GUPA 3ZETB 2QWMA 2P9IB 4IZ9A 2VYPA 2YJEA 2QWOA 4BRQA 4EHUA 3H46O 3H45C 3WUHA 2Q0UA 3LDNA 4CZHA 4CZMA 3ZX2A 2V52B 3VEVA 1ATNA 1ZXOA 2D0PA 3BEXA 3MMVA 4GNIA 4CZIA 1GLFO 4A62A 1S22A 4CZEA 2FSKA 4CZJA 3H1VX 1D4XA 5AZJB 3MK6A 3VEZA 3WQUA 1WOQA 3CJ7A 4CBWA 4EAHD 5KQDA 4MLEA 1ZC6A 4AM7A 4RWTA 4BRAA 5E26A 4K43A 2E1YA 3UB5A 4MO5A 3ATVA 3L0QA 3IFRA 3EO3A 3GL1A 2P9NB 3TU5A 1KAXA 3FZLA 4H0PA 3UKRA 4AM6A 2WUSA 5AQQA 4PKGA 1HUXA 1HKCA 4BR5A 1MA9B 2A5XA 4E1JA 4PL7A 4FWLA 4YDUC 2CH6A 3GBTA 4HWIA 5AZIB 4HTLA 3GE1A 3H3NO 3FZKA 4IO8A 3A8YA 3CHWA 2QWNA 4H0YB 2GELA 1T6DA 2D1KA 4BQZA 1BU6O 1NGCA 4K42A 5AQOA 2QWQA 3VEYA 5E84A 4BRMA 4WQ4A 3A5MC 1HKGA 1GLEG 3BP8A 3MN5A 3SK3A 4FWOA 3O8MA 4LC9B 3ZETA 4H0OA 4BG8A 2ASOA 4H5NA 4FOIA 2E2PA 4NO7A 3VPZA 2CH5A 1BOTO 2Q97A 2QWRA 5AQWA 3KZBA 3O6WA 4FOEA 5KPZA 1OKJA 2P9UB 3RSEB 4JAXA 4ISFA 1JCEA 1EQYA 2QWPA 2F9WA 5BR9A 2QXLA 3P4IA 4FWNA 4L3QA 1TUYA 2A41A 3AAPA 5AZJA 4K25A 5BN8A 3ZEUB
chains in the Genus database with same CATH superfamily
2PFUA 4GKKK 3QINA 5BRFA 1ZBLA 4DS5A 1W2BM 3EKUA 4WFBL 3PLAA 1WSJA 1RTDA 3I55N 1KLNA 2BUPA 3DWLA 4MQ3A 4UQGA 4M63C 4WQ4C 5AQTA 1Q9YA 1RT3A 4OJRA 2FSNA 3AAQA 4C8NA 5GINA 5BN9A 4GV9A 4RG8A 3DMJA 1FW6A 1NGBA 1X3NA 4ZHRA 3LANA 2YV0X 3SCXA 1K6YA 4GVEA 4IDHA 3SI6A 4FZZA 2X6NA 4RW7A 1B92A 3VQ7A 5FRMA 5BPMA 4N5SA 3WNEA 5AQNA 4Z4IA 2Z1GA 2FBTA 3Q7BA 4B1YB 1HQUA 3MCPA 5BR8K 3C6HA 3KLHA 2Z1HA 4I9QA 2ZQBA 1GLAG 4E7JA 3K2PA 2QWLA 3RSEA 2X78A 4ISGA 1HPMA 4DG1A 4B3RK 5CY4A 3KLIA 3P1GA 3D2EB 4CF2A 2OCEA 3ZEUA 2DPNA 3OVNA 4W5OA 5AQLA 3ZT1A 2EX3A 1BA1A 1T05A 1BUPA 3L2UA 2P9KA 3HSCA 1Y64A 5C12A 4CHNA 4FK4A 5AQMA 4CJEA 2UXCK 4E7LA 4M3ZA 4JK9A 4FL9A 3OYHA 2VG5A 4Y0WA 5MLCQ 4DV6K 1NGIA 3CCJN 1U2VB 1G99A 3DXMA 4LF4K 1NGEA 3B8AX 4NYFA 4R79A 3M5RA 3ZX3A 1BGXT 1H1VA 1TK5A 4LH5A 4AQYK 5AQUA 4B9QA 4DTOA 2HF3A 2HMPA 3VQ5A 3ZCMA 2P9IA 3EZ5A 4IG0A 3BZKA 2NRHA 2V7ZA 2WTUA 2W6KA 4ISEA 3B6PA 3AO1A 4DCHA 1C1CA 1WSIA 2ZJQL 2YHWA 3DRPA 4X62K 1Z26A 4EFHA 3THXA 4BROA 1KLMA 4IJAA 3S3NA 4I6MA 1TKXA 4WQ5A 4CECA 5C25A 4FJGA 1J6ZA 4XH1A 5GAGP 4Y1CA 3VQDA 3RRHA 1LCUA 3HK2A 5ADXH 4DR7K 2BTFA 2IVOA 2XY7A 4HHTA 4KBOA 3THWB 3JXUA 3M3ZA 2BDPA 2GV9A 3OYAA 4B3SK 1LWFA 1S1WA 5AFUH 3NE6A 3NCIA 3NF8A 3QDKA 1YIJN 3R1XA 2C1IA 4NLBA 2A42A 4KAZA 3NH2A 4M3TA 3C0BA 1YJ9N 5C2DA 1NJYA 1CZ9A 4BE1A 4FJ7A 4R5PA 4YNQA 3E66A 1WLJA 4JI7K 4BRFA 4E89A 1YUWA 3WXIA 1S1VA 4BR2A 5AFUA 1Z6RA 2YI1A 4ELUA 3JAMO 3FZHA 5GADP 4C8KA 3BGRA 1Z25A 4JNEA 4Y1DA 3HT3A 3KLEA 4BRPA 5GAEP 3MN7A 1KVBA 3KVGA 2E6LA 5F0XA 3BDPA 4DSLA 1VSJA 1QHAA 4JI1K 3V1QA 3PSIA 3FZMA 1RT6A 3O4WA 4DV5K 2QEXN 3S5TA 4J2BA 1LWCA 1SZ2A 3DI6A 4OX9K 3O3GA 3CM6A 4FPAA 2G8KA 5AQJA 4WCEL 3QEPA 3PO4A 4CGFA 3VQQA 3WXKA 4CJ5A 1FXXA 4DR1K 4JYAK 1JLGA 4B9SA 3BZCA 1HX1A 4B1WB 3DLHA 3M1FA 1JCFA 3DAWA 5AQRA 2W40A 4DMNA 4OPAA 4BC3A 3QETA 4DB3A 4BEBA 4XH5A 4JI0K 3TSQA 3WNFA 4LFCK 3TSUA 2P9LB 5AR0A 4B1UB 3VQ6A 3DLLL 2GTDA 4H0VB 1QE1A 4CBXA 2ZJPL 4BRDA 2NNWA 3VGKA 1QTMA 4DFJA 3WXMB 4OLAA 2NRRA 3L2VA 3DJCA 3OYJA 1YHQN 1R59O 3FLCO 1NOZA 3SUPA 2EHGA 3HPHA 4K8XA 1NGGA 4KHYA 3LALA 1T03A 3NH1A 1RNHA 1QQCA 2B5JA 4IOXA 4M7YA 2E2NA 1U4BA 2EWSA 3LP1A 3OHRA 3OYDA 3NMUA 2RN2A 1BQNA 4B1VA 5M1PA 3C6UA 3O3FA 4CJUA 4DR5K 3KD1E 2ZGYA 4CIEA 4CD3A 2QKBA 4FJXA 4MFBA 4LFAK 4DSKA 2A1RA 1TV6A 3MX5A 3OA9A 3DLBA 1VQON 3VF2A 4QAGA 4A59A 4KTZA 3M8QA 2G8FA 4QS9A 1T6CA 3KWGA 2ITMA 2D0OA 4TSXA 2E6MA 1N5YA 4CGIA 2JGUA 4BRNA 3OS0A 1E4GT 2IIRA 2VCPA 1XMQK 1A5XA 3ULEA 1OH7A 4CVNE 3SAFA 1A5VA 1GLDG 1SKWA 3QLHA 1D9FA 2KFNA 4CE9A 1T3VA 2VQFK 3DLEA 2Z1JA 1HJOA 2P9PA 1ASUA 3R9PA 4JEPA 3C94A 3CYMA 2KTQA 4BRGA 4C23A 2VQEK 2QK9A 2ZWHA 4CHPA 4DV0K 4CEEA 2RKIA 3ISNC 2P9IB 1NK6A 3IS9A 2YJEA 4HTUA 1SL2A 3V9UA 3AO4A 4LY7A 1U45A 5LL6Z 4KH6A 2Q0UA 1F21A 4O0JA 1NJZA 2V52B 4JKGA 4FJKA 3O3HA 3G71N 1S22A 2FSKA 3NF6A 4CZJA 3H1VX 5K14A 1FKPA 4CEBA 3VEZA 2BGGA 4NCGA 1X9WA 1VQNN 4FXDA 4G9ZA 4MLEA 4DR2K 4B9UA 3SUNA 4BRAA 4IKFA 3UB5A 3V6DA 3ATVA 1HNWK 1QVGM 5JVHL 1I94K 2HHWA 2G8VA 4CESA 1WB9A 4JRPA 4GMJB 5CR4A 4YDUC 3GBTA 4HWIA 3I0RA 4CHQA 2HW3A 4HTLA 4DTMA 1RBRA 3A8YA 2O8CA 3DLGA 3CHWA 2O8FB 2NRTA 1CZBA 3SV4A 5E84A 4WQ4A 2FBVA 3A5MC 1HKGA 3BP8A 4KI6A 4I9LA 2WFBA 3KKRA 3O8MA 3ZETA 4CGGA 1VAZA 4H5NA 3TWHA 2ZE2A 4FOIA 2G8IA 4NO7A 2GX9A 1TK8A 4OVLA 2OTJN 4IFYA 4K0KK 3O6WA 5KPZA 2E5LK 1OKJA 2P9UB 4UY8O 3C6AA 4JAXA 4YOVA 2QWPA 5BR9A 4IOCL 1VSFA 2W00A 5C10A 4FJ5A 2A41A 4FJIA 5FLXO 1NOYA 3DLKA 3KLGA 1NU0A 1W0HA 4E1MA 3KJVA 4W5RA 3T1AA 4FM2A 3TPQA 3CQYA 2IS3A 3NF9A 2PYLA 2P5GA 2YHYA 3EE8A 3SPYA 3OJUA 2QTDA 3FFKB 2D0CA 3OYGA 3SBTA 4BR7A 4JKHA 3KIOA 4YFUA 4BRCA 3A2FA 3MEGA 1U6ZA 4DLGA 1VHXA 2HNZA 2Z1IA 4FW2A 4BC4A 3WT0A 4FWMA 4I2QA 3QBXA 4BRLA 2Q3SA 4H03B 1BO5O 3NHGA 4BC2A 3RMDA 1C6VA 1K73O 4E7HA 2AA4A 2RPIA 2CGJA 5IT9O 4JI5K 2P9SB 3PIPL 2F96A 1NGFA 3RTVA 3VEXA 3DXKA 1VSEA 1GOAA 5JS2A 2O8BA 4YOTA 3EN9A 4XH4A 3CJAA 4CJRA 5CE3A 2KHOA 4HUEA 2WOMA 4JLHA 3SAHA 1ILYA 3SMSA 3AO5A 4DTXA 2W41A 1DEJA 4BVOA 4A5BA 2BANA 3G4SN 2C1GA 2J4RA 1ASWA 2HVIA 5J2NA 2XY8A 2YJFA 1BI4A 3HI0A 3K5NA 4ZTJA 1X9SA 3AVAA 3O80A 2VGNA 4KH4A 5GIOA 2CGKA 4F8RA 5KGWA 3KK3A 5FRNA 1YVNA 4YORA 5BRDA 2HSTA 1QZ6A 4IEEA 1VQ8N 4Z4GA 4O4GA 4ELVA 1N8RO 1D9DA 1D5AA 1B9FA 3S9HA 1QQNA 4Q5VA 4ZTFA 1RBSA 3VOVA 4CK1A 3O5BA 4O44A 1HNZK 1XHXA 3ULEB 2Y1IA 2Q1NA 3MN6A 4KTQA 5J1EA 2E8AA 1NMDA 3QNNA 2O8DB 4XIUA 3BUZB 3PX4A 3SQ0A 3N4QA 3ENBA 4H5VA 3LDPA 3CCLN 5AQGA 1KFSA 1YXQA 1JXEA 4H0TB 1C1BA 4QS8A 3J7YP 4ID1A 3CC4N 4FJMA 5AQXA 2OPPA 1Q82O 2Q2RA 4PUOA 5AQVA 4F9OA 4JD2B 4JI8K 3U3YA 2KQ2A 4KKOA 4AF1A 5KQ8A 3AY9A 4H8KA 2DFEA 3GDQA 4B9LA 4JN4A 4RCHA 3AVKA 3TTCA 2E2QA 4JKGB 3VTIA 3TAGA 1TKDA 4WFAL 3M8PA 2V51B 4A2BA 1TGOA 3VF4A 1HYZA 3H1QA 3RVCA 3MEEA 4OPHA 2B6AA 1GLLO 1VQPN 2A40A 4CBUA 1X3MA 2ASPA 1U48A 1RGIA 3CJCA 5TKWA 4B1ZA 2WONA 3I56N 4DF8A 3O08A 2E4LA 1YVUA 3O1BA 3CJ1A 4CERA 3OYMA 3MWTA 5M1OA 4KH5A 3CCRN 1J9AA 1WUAA 1L3UA 1JLEA 4QCLA 3F9MA 5FPNA 3OBWA 3QEXA 5M1KA 2IGIA 5I9EB 1JJ2M 3U4LA 2O8CB 1X9JA 2VGMA 1NKBA 3VGLA 3C65A 1SL1A 1IBLK 1K8KB 3LDOA 3CQXA 4NB4A 3D45A 1WN7A 4J8FA 1XI1A 2D5RA 3CCQN 2GWKA 1TKTA 3D2FB 1BHLA 1KC8O 1RILA 5FPEA 1DTQA 3CPEA 3BF3A 1S3XA 2IVPA 4GW6A 4IO9L 1LW2A 1YITN 4B8CA 3SLCA 1O1WA 2G8UA 4E0DA 3QB0A 4CJVA 4PWDA 4ILHA 4LSNA 3IDHA 4JI4K 1KAYA 4NCAA 3UKUB 4JHDB 4CF1A 3ENOA 3NAEA 3HBTA 4CJFA 1MWKA 1JCGA 1HMVA 2HNYA 4KB0A 4O5BA 2XO7A 3TTFA 3HM9A 2NRVA 3V9ZA 3R3LA 4FO0A 4BVPA 5T7BA 1JLCA 2HHTA 1YTUA 4JV5K 5KI6A 3FZFA 2DFHA 4WYBA 4YOUA 4ILGB 3U6FA 2PAVA 4DV2K 3E9PA 3VN5A 4U67L 1TYQB 2GEMA 3KWIA 3RR8A 4CHZA 1SQKA 4FWSA 3HXMA 2UUAK 4CCHA 3WEEA 2E2OA 3OYEA 4DSFA 2QKKA 1BA0A 3D7EO 5ELZA 3HP6A 2XY6A 5HOOA 3CC7N 4EIAA 4CF8A 1WBDA 3DXKB 1N32K 3MXIA 5M1NA 4BQLA 1IKWA 3THYA 1OVQA 2FLOA 3QEIA 4BRKA 5EOYA 2NRWA 2KKZA 2A6AA 3WNGA 3U3GA 3HPOA 2HHSA 4CZGA 1BI4B 4FLXA 1RT5A 2E20A 5ADXA 3H6EA 3ZSVA 3OBYA 4DQRA 5SZTA 3UKRB 4BRIA 2QM1A 1U47A 4DQPA 3ID8A 2ITGA 2JWKA 3EL2A 1JLBA 1XNRK 1DT9A 3PUFA 1HRHA 1W9HA 2HHHK 2OTLN 3OS1A 3SJHA 1MDUB 3G10A 3LDSA 3ZSOA 3TAPA 3AARA 2IDOA 3DOKA 2Y1JA 3IRXA 4CGJA 3VQBA 3ENHA 2RHKA 3TAQA 2IC3A 3VGMA 3OS2A 4JKAA 4YDUA 5JLFA 2B4JA 3QMLA 2X74A 2QWMA 3JYTA 4O0IA 4FM1A 4IOAL 1OVYA 4BRQA 4F3OA 4I2PA 3H45C 2OZSA 4O55A 3WUHA 3VQPA 4FVUA 3LDNA 4CZMA 3KLFA 4FZXC 1XWLA 3AVCA 1ATNA 1ZXOA 2D0PA 3MMVA 4GNIA 1TAQA 1GLFO 2HBLA 4DV1K 5KRTA 4HVJA 5AZJB 4FW1A 1WOQA 4CBWA 2UUBK 1S6QA 4DLEA 1ZC6A 4RWTA 3CFRA 3HJFA 2HHUA 1VQ9N 3DOLA 4BDPA 3PIOL 3OW2M 4K43A 2E1YA 4BE0A 1FJGK 2KW4A 3GL1A 4LD0A 1NG9A 2WC9A 1KAXA 2OPQA 5I42A 4RW8A 4JRQA 4KHSA 5JENA 2WUSA 5HL7L 1SKRA 1RDBA 3RMAA 5AQQA 4PKGA 1X9MA 3RWUA 4DTJA 4AILC 4JKDA 1D8YA 2CH6A 4Q0BA 4CHYA 1KVCA 3G6EN 3OYNA 3K9JA 1RDCA 3HVTA 1TVRA 3MXMA 4CJLA 4BQZA 2D1KA 4K42A 3S3OA 3TAEA 1P90A 3DYAA 1VSMA 1NKCA 4JS4A 5KRSA 1VRUA 3SK3A 3CXCM 3ALYA 4B3MK 3CPWM 4IFVA 5JVGL 4BG8A 5J2MA 4AHCA 5HRSA 2CH5A 1BOTO 2F8TA 4M41A 2Q97A 2QWRA 3LPUA 4DUZK 1X1PA 1RDAA 4FOEA 5DM7L 1Q86O 3RSEB 2OPSA 3CMAN 4ISFA 4DSIA 3AO3A 1RBTA 3P4IA 4PA1A 4M3UA 1YT3A 2HHIA 3ZEUB 4BE2A 4MDAA 3AVNA 3L8BA 3L2QA 3UIQA 3QBWA 4MLHA 2O4GA 2P9KB 3QIOA 3VQEA 1ESVA 4KREA 1Q81O 1IG9A 2E1ZA 4X65K 3CETA 4C1NI 3LZJA 4DTRA 4O5FA 1R0AA 4MO4A 4WF9L 4OKKA 2ASMA 3DLRA 3I33A 4JI6K 5KPRA 1L3TA 1VQ6N 2UUCK 1NM1A 1HNIA 4CFAA 4DTNA 4E1NA 1NMNA 3DXMB 4ILJA 3NGZA 1DGKN 5CHIA 4CIGA 1WBBA 4N41A 3AGKA 2FXUA 4DR4K 3MN9A 1RDDA 3VTHA 4BR0A 2QW9A 1BWFO 4KI4A 3T1YK 1CZAN 3CI5A 1L3VA 3CFPA 1N34K 4MDBA 3A5NC 3FR0A 2XY5A 4DQ8A 1ZBUA 3CM5A 1YJWN 3HPGA 3A0IX 3VENA 3SBGA 1NK7A 4PKHA 3THXB 5KPTA 4DR6K 2VWKA 4I6MB 4KHQA 3E01A 3LP2A 3CJ9A 2HF4A 4FWQA 4FLTA 3ZT2A 4DUYK 1RT2A 3NH0A 1VSIA 3CQ8A 1J54A 2HHVA 1JL1A 1HLUA 4HUFA 4RTFD 3O1WA 3WXLA 1ASVA 1IBKK 1A5WA 3GG4A 4EP4A 4HUGA 4JKEA 2XRIA 4BR9A 1HR0K 4DKWA 1IBMK 3LDQA 4OKJA 1V4SA 2GWJA 3H3OB 1QQOA 4PY5A 3FGUA 4FLYA 1IV0A 3SYZA 1IKXA 2OANA 1KXPA 3U9ZA 4O8KA 1WSEA 4BGBA 4IJNA 5LMNK 1M90O 4DU1A 2AJQA 4PL8A 3VQAA 5H1SQ 3ATUA 3NGIA 1KVAA 1S1TA 1U04A 3VA0A 4CJWA 5HRPA 3SAGA 5HRNA 1WNSA 4L8RB 2QI2A 4CI6A 3GOIA 3TSPA 3VF6A 1S9GA 1LW0A 1ZBSA 1J5EK 3U9DA 3VERA 3V1RA 3E9OA 5BREA 3OY9A 3AVMA 2IVNA 4A61A 5F1XA 4AHVA 1V4TA 5EXWA 2I7PA 3L2WA 5C15A 4F2RA 3CFOA 3DM2A 3IG1A 2P9NA 3P83D 1J5OA 4F4KA 4F3TA 4JKCA 3NGYA 1VSKA 3L4IA 5AQFA 5TKYA 4A2AA 1HPZA 3LAMA 5CYMA 3OYCA 1RDWX 5AQSA 3AA4A 2KFZA 1BL3A 1QQMA 4FLWA 4DR3K 4KHPK 2D0BA 4OO1J 3MDQA 3P38A 4JK7A 1ZBIA 1U2VA 3QEWA 1DKGD 3EE9A 4DS4A 3VESA 1S72N 3ASMA 3V4IA 1DLOA 4NXMK 2YX6A 3SUQA 1Q18A 5SWMA 2VWJA 3KHYA 1IKVA 4JK8A 5AQZA 1G15A 1NLVA 4Z4EA 4FSVA 4M45A 1TK0A 3QNOA 4N47A 3VQ9A 3LL3A 3O4QA 3TR8A 4CF9A 1NK9A 1YTAA 3U8XA 1ZYQA 4EHTA 4K41A 3A5LC 3AA3A 1K9MO 1HQEA 5C42A 4DHYA 4AHRA 4A5AA 1LAWA 3PY8A 1JLFA 2FBYA 3G25A 3QO9A 1P8ZA 1SUQA 3CERA 4JI3K 3SQ2A 1NGDA 3QESA 3T69A 1BDGA 1S5JA 3M8SA 1XC3A 1GLJO 1I39A 3NF7A 4H5RA 5HP1A 1KFDA 2BH1A 3J81O 4I7FA 3LM2A 5LJWA 1NJXA 3RMCA 3R6MA 2PBDA 3KK2A 3T3FA 4FM0A 2NLXA 4FCYA 1HNXK 2HBKA 3AO2A 1NBWA 1Q8IA 4PKIA 2D0AA 1GLCG 3SZ2A 1HKBA 5HROA 3RRGA 2YNHA 3W0LA 3MECA 3K5OA 4J2DA 5FDLA 3FFIA 2KZMA 2DFFA 3CIPA 2P9PB 4DV4K 4EZ6A 5A2QO 2UXBK 4CEOA 3V9WA 1NJWA 3O9RA 5CZ1A 1MU2A 2F8SA 1VSLA 3IUCA 2OYQA 4BWJA 2IOCA 3J8AA 1FKOA 3K5LA 4M42A 5AQIA 4M3RA 4LF9K 3R8EA 3OTOK 4Z4FA 4DU4A 4H0XB 5KTQA 1HNVA 3IAYA 3ZSYA 1FK9A 1BG3A 4FVMA 3EZWA 2NUBA 2YCHA 1S9EA 3CG7A 4N56A 2I7NA 1XUPO 3DRRA 4DU3A 3HL8A 3HM8A 4KHUA 3LWMA 1VQLN 1NGJA 4OGEA 2ZGZA 1UA0A 3L2RA 2VG6A 2NRXA 1KRPA 2AP1A 1VK0A 2P9LA 4FWKA 5HRRA 4GY2B 1NK4A 1E4FT 4BRHA 4QS7A 3QERA 1NGHA 5AQKA 3BY5A 3LDLA 1L3SA 3TI0A 3BF1A 1LV5A 2PYJA 2V7YA 3PV8A 2ZF5O 4JKFA 4KHNA 3P39A 2G8WA 4B9NA 2O8EA 4W5QA 4F2SA 4WE1A 4M3XA 1BIUA 1Q7YO 1LOTB 3S41A 1YJNN 2P51A 2YKMA 3MX2A 4EZ9A 2GUPA 3ZETB 4CEQA 4E19A 2FC0A 3K5MA 2X6SA 3H46O 4FYDA 3HRGA 2HBMA 3KTQA 3K58A 4CZHA 3ZSRA 2NRZA 3SQ1A 3BEXA 4DV3K 4CZIA 3TABA 2F7TA 4CZEA 2F4VK 5J2QA 3H08A 2VG7A 3F5TA 1D4XA 2A1SA 1RBVA 3CJ7A 4AM7A 4KO0A 1EWQA 2G8HA 3V9XA 4MO5A 3IFRA 3EO3A 4DQIA 3SV3A 2P9NB 1EX4A 4NXNK 2KZZA 3I8DA 4FJJA 1RDUA 4BDYA 1CLQA 1OH5A 3LZIA 4KFBA 4C8MA 1RTHA 3NBPA 1KSPA 1MA9B 2A5XA 1JL2A 2HHXA 2OPRA 3T7ZA 5FROA 3GE1A 2JLEA 1LWEA 4KHWA 3E9LA 4IO8A 4LFBK 2HB5A 4H0YB 2GELA 1VQ5N 1T6DA 1BU6O 4YOYA 4YOWA 5C0YA 5AQOA 1M1KO 4CIFA 4IBNA 1GLEG 3SUOA 4CF0A 2QXFA 3ZSXA 2GBZA 5CYQA 3LAKA 3LWLA 3V81A 3S3MA 2ZJRL 2O8BB 2E2PA 3VPZA 1C1AA 5AQWA 3KZBA 2FBXA 1ZBFA 4CW7B 3MCAB 3AVFA 3KKSA 1J53A 5LMUK 1EQYA 1C0MA 2F9WA 3O4NA 5E41A 2QXLA 4CHOA 3OJSA 2HMIA 4L3QA 3AAPA 5BN8A 3CMEN 3Q7CA 3K59A 4Z4HA 3W3DA 1CXUA 3TAMA 3QICA 3HYFA 5M1FA 1C0GA 4BG9A 3A5OC 1C0UA 4IEIA 4M7XA 1W7AA 2P1JA 1IG8A 4OPKA 1EWRA 5JMVA 4B9TA 1ZBHA 1KCFA 1HJRA 1U49A 3J80O 2YNFA 3QFPA 2YHXA 1JLAA 3CD6N 3FE1A 1T44A 1QZ5A 5B8HA 3OYKA 2O8FA 3VETA 3I8BA 2OA8A 4OGCA 3L6QA 3IKMA 3G0ZA 4CEZA 1C0TA 3CJBA 3RMBA 3K57A 2F9TA 4DFKA 4W5TA 3TAFA 4CJ4A 3AVJA 1SV5A 1REVA 2HBJA 4CZKA 4CK3A 4RW4A 4LF8K 4CZFA 2I5JA 2YHAA 2P9UA 1EXQA 4WFNL 1KAZA 3C7NA 5DMRA 4BC5A 1VQ4N 4NCBA 1S1XA 1BQMA 1WAFA 3LM9A 3JS6A 1BCMA 2KLAA 1BISA 1VQMN 4CK2A 3OYBA 4CEFA 3SPZA 2FF3B 1GOBA 2Q31A 1EKEA 4O8UA 1WSGA 1W97L 1WSFA 4DFMA 1KTQA 5LY3A 3C95A 1TL3A 5FPMA 3AVHA 2R7YA 3UE5A 4FLZA 3EYZA 1KD1O 2PY5A 5LJVA 1NWKA 2E88A 2Q0RA 5AQYA 3L4QA 4DTUA 4H5WA 4CFBA 1Y97A 1S1UA 2Q36A 1JXBA 3ZYYX 2RF2A 3ZSQA 4B9MA 4BREA 3CCUN 4DSEA 3VMFB 1HYVA 3K0SA 5BPLA 1WSHA 3VQCA 3P31A 2UYTA 5EY4A 3RR7A 4QOZB 1EO1A 4BE7B 4RW9A 4OKEA 2P9SA 1DTTA 2O8EB 1K8AO 2WBNA 3VEOA 1RT7A 4CEAA 2DTUA 1NKEA 4FJNA 3PO5A 2GUIA 3CF5L 3OYLA 2YKNA 1XQSC 1T8EA 2HOEA 4CJ7A 2LSNA 2ZM6K 3IMXA 1XC9A 4DTPA 5J2PA 3QFUA 1RBUA 4B3OA 1YAGA 3DRSA 3MAQA 4DQQA 2H3GX 3VEWA 2D4WA 3ZX0A 3CYGA 3AGRA 4BY9C 3SNNA 1XHZA 2OZMA 3T19A 1GLBG 4NYNA 1RCHA 4CZLA 5JICA 1RTJA 4X64K 3THVA 4FLUA 4B08A 1NK5A 3EKSA 2NZTA 2CGLA 3AV9A 3D0PA 5AZIA 5C2FA 2UU9K 4J2EA 1ATSA 5KGXA 5AQPA 3C6TA 4JKBA 2FSJA 4B9VA 4V19S 4JI2K 5HBMA 1NK0A 4KPYA 4CFCA 1WAJA 3HP9A 2PZSA 3SJJA 3F9KA 1ITGA 3CCVN 2O8DA 3CC2N 1IJJA 1VQ7N 3WXJA 4IFEA 5GAHP 4K8ZA 4RW6A 1B9DA 4WQ5C 3WEEB 3HOSA 3OYIA 4FWPA 3HSTB 1RT4A 5M1QA 4E3SA 4Z94A 5DK5A 4FJHA 4U7BA 4H4OA 3M6GA 3K9KA 2ETJA 1IH7A 3PX6A 2ATQA 4JD2A 1UOCA 3O9SA 3VQ4A 4ID5A 4CJ3A 4AHUA 1ATRA 3HO1A 1BIZA 3ZSWA 1SKSA 3THYB 2VWBA 4LF5K 4C1NK 3SMPA 4BECA 4LF7K 3CCEN 3E1YA 4LF6K 2P5OA 4DF4A 1VQKN 2QA4N 1EETA 5BRHA 3J7ZO 1QSYA 5AQHA 3NFAA 4FWRA 4FJLA 4YY3K 3KD5E 4OLBA 4BR4A 5IWAK 1C0FA 1NJIO 3I0SA 1EP4A 1CXQA 4CJPA 4BWMA 1QVFM 4XJXA 3V9SA 1TL1A 1TUUA 3AVBA 3LP3A 4FJ8A 4ELTA 1MWMA 3JSMA 4IG3A 4DFPA 5GIPA 3M8RA 4LH4A 4W5NA 1NK8A 5EX5A 1RFQA 2FF6A 1OH8A 3HTVA 4CJTA 5DM6L 3WQTA 4C8OA 1K8KA 3ZSZA 4CFDA 3QIPA 2A3ZA 1SAZA 3LP0A 3AVIA 1XMOK 5JLHA 1VSHA 3KK1A 3L3UA 1N36K 4GVMA 3ZT3A 4CJQA 1RTIA 3D2FA 1YI2N 4X66K 3D2EA 1TKZA 4G1QA 4H5TA 4XEIA 3NVKA 4IWVA 4GV6A 4Z4CA 3P5JA 5BPNA 3CCSN 1OH6A 3C7NB 4KTWA 4IDKA 3B6OA 1IO2A 2HNDA 4NLCA 4FJ9A 4AHTA 1I3AA 3MEDA 4FPBA 1QHTA 1Z05A 5EVZA 4YOXA 4DWIA 1JKHA 4FLVA 4AH9A 1XNQK 3AVLA 4KRFA 3UKUA 4JHDA 4BDZA 5F2RA 2UXDK 4PHTX 1UA1A 3J7AP 2XHBA 1L5UA 1RT1A 3HZ6A 3TTDA 4N76A 3HOTA 3F2KA 4B1XB 5FPDA 4EP5A 2RE2A 5EU7A 5C24A 4H4MA 4CEDA 3VA3A 4CD1A 3NVMA 3ZT0A 3O9UA 3MXJA 5AJ3K 1N6QA 1E3MA 4B3TK 1SS6A 3MWPA 3HVRA 4YHHK 4CJSA 1TAUA 3ULDA 1S6PA 1NGAA 4E72A 1TYQA 4BGAA 3EY1A 1UAXA 4KB1A 2IAJA 4J2AA 3ZLJA 2W6LA 4IXCA 2HHQA 3ZT4A 4CGHA 2JWLA 4ICLA 2BE2A 4FZYA 4IZ9A 5JS1A 2VYPA 2YNIA 2QWOA 3ID6A 4FK2A 3F73A 4DQSA 3AA2A 4EHUA 1KQSM 1VSDA 1LAVA 3TANA 3AVGA 4C8LA 2YHBA 2HVHA 3ZX2A 4HCCA 3WNHA 4A57A 3VEVA 1QSLA 4E7KA 4M3WA 1IKYA 3SQ4A 4A62A 4JS5A 4HCBA 3AA5X 4DTSA 3VQ8A 3THWA 1Q9XA 3MK6A 3PSFA 3WQUA 5I3UA 1HYSA 4EAHD 5KQDA 4PQUA 1YF5L 3EEQA 5E26A 1N33K 3PX0A 3OYFA 3L0QA 5CZ2A 4GKJK 3TARA 3ITHA 3TU5A 3FZLA 3QEVA 1JLQA 4H0PA 3UKRA 4AM6A 4DSJA 1BCOA 3LPTA 1HUXA 4GV3A 1HKCA 4LSLA 4BR5A 4E1JA 4PL7A 4FWLA 4BACA 3CCMN 5HLFA 3O9TA 5AZIB 4FK0A 3H3NO 1T7PA 1O13A 3N4PA 3FZKA 4E7IA 2DY4A 2QWNA 1VRTA 4AHSA 1NGCA 4OPJA 2W42A 2QWQA 4B8AB 3VEYA 3T1HK 4BRMA 1UWBA 4Z0UA 3MN5A 3V1OA 4FWOA 4LC9B 2YNGA 1QS4A 4H0OA 2ASOA 3KK7A 3L3VA 4CGDA 4M3YA 4DV7K 4CJKA 1NNEA 5D3GA 2ZD1A 1SL0A 1QSSA 1GOCA 1JCEA 3O9QA 4FWNA 3D6RA 1TUYA 4KV8A 2O4IA 3NDKA 5AZJA 4K25A
chains in the Genus database with same CATH topology
2PFUA 3Q7CA 5BRFA 3QBWA 3W3DA 4MLHA 3QICA 5M1FA 1C0GA 4BG9A 2P9KB 1ESVA 3A5OC 1Q81O 3TPQA 4IEIA 2E1ZA 1W2BM 3CQYA 3CETA 3EKUA 4WFBL 4C1NI 3PLAA 4O5FA 4M7XA 3I55N 1IG8A 4MO4A 2BUPA 2YHYA 3DWLA 5JMVA 4WF9L 2ASMA 4M63C 3EE8A 3I33A 4WQ4C 5KPRA 1VQ6N 5AQTA 2QTDA 3FFKB 1NM1A 3SBTA 4BR7A 3QFPA 2YHXA 4JKHA 4BRCA 3CD6N 2FSNA 1U6ZA 3AAQA 3DXMB 3FE1A 5GINA 1T44A 4ILJA 5BN9A 1QZ5A 4GV9A 4BC4A 3WT0A 1DGKN 4FWMA 1NGBA 5B8HA 1X3NA 5CHIA 3QBXA 4BRLA 3VETA 3I8BA 3AGKA 4GVEA 3L6QA 4IDHA 2FXUA 3IKMA 3MN9A 4H03B 1BO5O 3CJBA 3VTHA 4BC2A 4BR0A 1K73O 2QW9A 1BWFO 2AA4A 2F9TA 2CGJA 1CZAN 2P9SB 5BPMA 3PIPL 1NGFA 5AQNA 3CI5A 2HBJA 3DXKA 3Q7BA 4MDBA 3VEXA 4B1YB 3A5NC 4YOTA 3FR0A 4CZKA 3MCPA 3EN9A 4XH4A 3C6HA 3CJAA 4CZFA 4DQ8A 5CE3A 2KHOA 1GLAG 1YJWN 1ILYA 2P9UA 3SAHA 2QWLA 3RSEA 3A0IX 4WFNL 3SMSA 3VENA 3SBGA 1KAZA 2W41A 4PKHA 3C7NA 4BC5A 1DEJA 4BVOA 5KPTA 4ISGA 4A5BA 1HPMA 3LM9A 1VQ4N 3G4SN 3JS6A 2J4RA 4I6MB 2C1GA 2KLAA 3CJ9A 3D2EB 2HF4A 2YJFA 4FWQA 1VQMN 3ZEUA 2DPNA 3HI0A 5AQLA 1BA1A 2FF3B 1HLUA 2Q31A 4O8UA 1BUPA 1W97L 3O80A 2P9KA 3HSCA 1Y64A 2VGNA 4KH4A 5LY3A 2CGKA 5GIOA 4RTFD 5FPMA 3O1WA 3UE5A 1YVNA 4YORA 5BRDA 5C12A 2HSTA 3WXLA 1QZ6A 5AQMA 4IEEA 1VQ8N 1KD1O 3GG4A 5LJVA 1NWKA 4JKEA 4BR9A 2E88A 4JK9A 2Q0RA 4FL9A 5AQYA 4DKWA 3L4QA 1N8RO 3LDQA 4H5WA 4Y0WA 1V4SA 1QQNA 5MLCQ 1NGIA 3CCJN 1U2VB 3VOVA 2GWJA 2Q36A 3H3OB 1G99A 3O5BA 3ZYYX 1QQOA 3DXMA 3FGUA 1NGEA 3B8AX 3ULEB 4BREA 4R79A 3CCUN 3VMFB 3M5RA 2Q1NA 3ZX3A 3MN6A 5BPLA 1H1VA 2OANA 1KXPA 5AQUA 3U9ZA 4B9QA 3P31A 2HF3A 4O8KA 2E8AA 2HMPA 2UYTA 1NMDA 5EY4A 4BGBA 1EO1A 2P9IA 4IJNA 4BE7B 1M90O 4PL8A 2P9SA 3BUZB 3N4QA 5H1SQ 3ENBA 2NRHA 2V7ZA 3ATUA 4H5VA 4ISEA 1K8AO 3LDPA 2WBNA 5AQGA 3VEOA 3CCLN 1YXQA 4H0TB 4QS8A 4DCHA 3CC4N 3CF5L 3SAGA 2ZJQL 1XQSC 2QI2A 2YHWA 4CI6A 2HOEA 3GOIA 3TSPA 4CJ7A 5AQXA 1Q82O 3VF6A 2Q2RA 3IMXA 5AQVA 4EFHA 4F9OA 4JD2B 4BROA 4IJAA 3QFUA 1ZBSA 4AF1A 5KQ8A 4I6MA 1YAGA 3AY9A 3U9DA 3VERA 2H3GX 3E9OA 2D4WA 3VEWA 3ZX0A 3GDQA 5BREA 3AGRA 4BY9C 2IVNA 4JN4A 4RCHA 4WQ5A 3TTCA 2E2QA 4JKGB 3VTIA 4A61A 1J6ZA 4XH1A 5GAGP 5F1XA 1GLBG 1V4TA 5EXWA 2I7PA 4WFAL 1LCUA 5C15A 4CZLA 5JICA 2P9NA 5ADXH 2V51B 4JKCA 4A2BA 3VF4A 2BTFA 2IVOA 3H1QA 5AQFA 3L4IA 4KBOA 4OPHA 3RVCA 5TKYA 3JXUA 3M3ZA 4A2AA 1GLLO 1VQPN 2A40A 3EKSA 1X3MA 2NZTA 2ASPA 2CGLA 4CBUA 1RGIA 5AFUH 5AZIA 5C2FA 3CJCA 1RDWX 3QDKA 5TKWA 4B1ZA 1YIJN 3R1XA 1ATSA 3I56N 2C1IA 4NLBA 2A42A 5AQSA 1QQMA 3C0BA 3O08A 5AQPA 3O1BA 1YJ9N 4JKBA 5C2DA 2FSJA 3CJ1A 3MDQA 3P38A 4JK7A 4OO1J 1U2VA 3MWTA 1DKGD 3EE9A 5M1OA 3E66A 4KH5A 3CCRN 4BRFA 1YUWA 3VESA 1WUAA 3WXIA 4BR2A 5AFUA 1Z6RA 2YI1A 1S72N 2YX6A 1Q18A 3FZHA 5GADP 3F9MA 5FPNA 3OBWA 4JNEA 5M1KA 3CCVN 5I9EB 3KHYA 4BRPA 3CC2N 1JJ2M 3U4LA 4JK8A 5GAEP 1IJJA 1VQ7N 3MN7A 3WXJA 1X9JA 4IFEA 2VGMA 5GAHP 3VGLA 3KVGA 5AQZA 3C65A 4WQ5C 3WEEB 1K8KB 1NLVA 3HOSA 3LDOA 4FSVA 4FWPA 3CQXA 5M1QA 4NB4A 3LL3A 4Z94A 5F0XA 4J8FA 1QHAA 4U7BA 3U8XA 3FZMA 3O4WA 3M6GA 3K9KA 4EHTA 2QEXN 3CCQN 4K41A 2GWKA 3A5LC 4JD2A 3D2FB 1K9MO 1KC8O 1SZ2A 5FPEA 3O9SA 4DHYA 4A5AA 3CPEA 4FPAA 5AQJA 3BF3A 1ATRA 1S3XA 4WCEL 2IVPA 3G25A 3WXKA 1P8ZA 2VWBA 3CERA 4IO9L 1YITN 3SLCA 4C1NK 1NGDA 1HX1A 3SMPA 4BECA 3QB0A 4B1WB 3CCEN 4ILHA 3IDHA 3T69A 3E1YA 1BDGA 3M1FA 1KAYA 1JCFA 3DAWA 5AQRA 1XC3A 2QA4N 2W40A 1VQKN 1GLJO 4OPAA 4H5RA 4BC3A 5BRHA 3UKUB 4JHDB 4DB3A 5AQHA 3ENOA 2BH1A 4FWRA 4XH5A 3J7ZO 4BEBA 3HBTA 3LM2A 3TSQA 5LJWA 1MWKA 3TSUA 1JCGA 2P9LB 5AR0A 4B1UB 4BR4A 3DLLL 1C0FA 2GTDA 3R6MA 2PBDA 1NJIO 2NLXA 4H0VB 4CBXA 3TTFA 2ZJPL 2HBKA 2NRVA 1NBWA 4BRDA 4PKIA 2NNWA 1GLCG 3R3LA 4FO0A 1HKBA 3VGKA 4BVPA 3WXMB 1QVFM 4XJXA 3W0LA 1TUUA 2NRRA 3DJCA 1YHQN 3FZFA 1R59O 3FLCO 4WYBA 3CIPA 4YOUA 2P9PB 4ILGB 2PAVA 3E9PA 1MWMA 4U67L 1TYQB 5GIPA 1NGGA 2GEMA 3KWIA 5EX5A 1RFQA 2FF6A 1SQKA 3HTVA 4FWSA 5DM6L 3WQTA 3WEEA 1K8KA 2E2OA 4IOXA 3O9RA 4M7YA 2E2NA 2EWSA 1BA0A 2A3ZA 3D7EO 5ELZA 1SAZA 3IUCA 3OHRA 5HOOA 3CC7N 4EIAA 3J8AA 5JLHA 3NMUA 5AQIA 3DXKB 5M1PA 4B1VA 3D2FA 1YI2N 3D2EA 3R8EA 4H5TA 4XEIA 2ZGYA 4H0XB 4CD3A 4IWVA 3NVKA 4GV6A 5M1NA 4BQLA 3MX5A 1BG3A 3OA9A 5BPNA 1VQON 3CCSN 2FLOA 3VF2A 3C7NB 3EZWA 4BRKA 4A59A 2YCHA 5EOYA 2NRWA 2KKZA 2A6AA 4NLCA 2I7NA 1XUPO 4FPBA 3HM8A 4QS9A 1T6CA 1Z05A 5EVZA 3KWGA 4YOXA 4CZGA 1VQLN 2E20A 1NGJA 3UKUA 2ZGZA 4JHDA 5ADXA 2ITMA 3H6EA 5F2RA 2D0OA 2NRXA 3OBYA 2AP1A 4PHTX 3UKRB 4BRIA 2QM1A 2P9LA 4BRNA 1E4GT 3HZ6A 3ID8A 4FWKA 4GY2B 3F2KA 2IIRA 3TTDA 4B1XB 5FPDA 3HOTA 2RE2A 2VCPA 1E4FT 2JWKA 3EL2A 3CMEN 3ULEA 4CD1A 4BRHA 4QS7A 1DT9A 1NGHA 3NVMA 5AQKA 3LDLA 3O9UA 3SAFA 3BF1A 1GLDG 2OTLN 3SJHA 1MDUB 2V7YA 2ZF5O 4JKFA 1SS6A 3MWPA 1T3VA 1HJOA 2P9PA 3AARA 3R9PA 4JEPA 1NGAA 3P39A 1TYQA 4BGAA 3ENHA 4BRGA 2RHKA 4C23A 3VGMA 4IXCA 1Q7YO 1LOTB 2ZWHA 4JKAA 3S41A 2JWLA 1YJNN 4YDUA 5JLFA 3MX2A 3QMLA 2GUPA 3ZETB 2QWMA 2P9IB 4IOAL 4IZ9A 1OVYA 2VYPA 2YJEA 2QWOA 3ID6A 4BRQA 4EHUA 3H46O 3H45C 1KQSM 3WUHA 3HRGA 4KH6A 2HBMA 2Q0UA 4FVUA 3LDNA 4CZHA 4CZMA 3ZX2A 2V52B 4JKGA 4A57A 2NRZA 3VEVA 1ATNA 1ZXOA 2D0PA 3BEXA 3MMVA 4GNIA 3G71N 4CZIA 1GLFO 2HBLA 4A62A 1S22A 2F7TA 4CZEA 2FSKA 4CZJA 3H1VX 3F5TA 1D4XA 5AZJB 3MK6A 3VEZA 3WQUA 1VQNN 1WOQA 3CJ7A 4CBWA 4G9ZA 4EAHD 5KQDA 4MLEA 1ZC6A 4AM7A 4RWTA 4BRAA 1VQ9N 1YF5L 5E26A 3PIOL 3OW2M 4K43A 2E1YA 3UB5A 4MO5A 3ATVA 3L0QA 1QVGM 3IFRA 3EO3A 3GL1A 5JVHL 2WC9A 2P9NB 3TU5A 1KAXA 3FZLA 4H0PA 3UKRA 4AM6A 2WUSA 5HL7L 1RDUA 5AQQA 4PKGA 1HUXA 4GV3A 1HKCA 4BR5A 1MA9B 4JKDA 2A5XA 4E1JA 5CR4A 4PL7A 4FWLA 4YDUC 3CCMN 2CH6A 3GBTA 3O9TA 4HWIA 5AZIB 4HTLA 3T7ZA 3GE1A 3H3NO 3G6EN 1O13A 3N4PA 3FZKA 3K9JA 3E9LA 4IO8A 3A8YA 3CHWA 2QWNA 4H0YB 2GELA 1VQ5N 1T6DA 2D1KA 4BQZA 1BU6O 1NGCA 4YOYA 4YOWA 5C0YA 4K42A 2NRTA 5AQOA 2QWQA 1M1KO 3VEYA 1P90A 5E84A 4BRMA 4WQ4A 3A5MC 1HKGA 1GLEG 3BP8A 3MN5A 2WFBA 3SK3A 3CXCM 4FWOA 3O8MA 4LC9B 3ZETA 3CPWM 1VAZA 4H0OA 5JVGL 4BG8A 2ASOA 3KK7A 4H5NA 2ZJRL 4FOIA 2E2PA 4NO7A 3VPZA 2GX9A 2CH5A 1BOTO 2OTJN 2Q97A 2QWRA 5AQWA 3KZBA 3O6WA 4FOEA 5DM7L 5KPZA 3MCAB 1OKJA 2P9UB 1Q86O 4UY8O 3RSEB 3C6AA 4JAXA 3CMAN 4YOVA 4ISFA 1JCEA 1EQYA 2QWPA 2F9WA 5BR9A 3O9QA 2QXLA 4IOCL 3P4IA 4FWNA 3D6RA 2W00A 4L3QA 5C10A 1TUYA 2A41A 3AAPA 5AZJA 4K25A 5BN8A 3ZEUB 4MDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BRF A;  3QBW A;  3W3D A;  4MLH A;  3QIC A;  1C0G A;  4BG9 A;  2P9K B;  1ESV A;  3A5O C;  3TPQ A;  2E1Z A;  3CQY A;  3CET A;  3EKU A;  4O5F A;  4M7X A;  1IG8 A;  4MO4 A;  2BUP A;  2YHY A;  3DWL A;  5JMV A;  2ASM A;  4M63 C;  3I33 A;  4WQ4 C;  5KPR A;  5AQT A;  3FFK B;  1NM1 A;  4BR7 A;  3QFP A;  2YHX A;  4BRC A;  2FSN A;  1U6Z A;  3AAQ A;  3DXM B;  3FE1 A;  1T44 A;  5BN9 A;  1QZ5 A;  4BC4 A;  3WT0 A;  1DGK N;  4FWM A;  1NGB A;  5B8H A;  1X3N A;  3QBX A;  4BRL A;  3VET A;  3I8B A;  3L6Q A;  2FXU A;  3MN9 A;  4H03 B;  1BO5 O;  3CJB A;  4BC2 A;  4BR0 A;  2QW9 A;  1BWF O;  2AA4 A;  2F9T A;  2CGJ A;  1CZA N;  2P9S B;  5BPM A;  1NGF A;  5AQN A;  3CI5 A;  3VEX A;  3DXK A;  4CZK A;  4B1Y B;  3A5N C;  3FR0 A;  3MCP A;  3EN9 A;  4XH4 A;  3CJA A;  4CZF A;  4DQ8 A;  5CE3 A;  2KHO A;  1GLA G;  2P9U A;  2QWL A;  3RSE A;  3A0I X;  3SMS A;  3VEN A;  1KAZ A;  2W41 A;  4PKH A;  3C7N A;  4BC5 A;  1DEJ A;  4BVO A;  5KPT A;  4ISG A;  1HPM A;  3LM9 A;  3JS6 A;  2J4R A;  4I6M B;  3CJ9 A;  3D2E B;  2HF4 A;  2YJF A;  4FWQ A;  3ZEU A;  2DPN A;  3HI0 A;  5AQL A;  1BA1 A;  2FF3 B;  1HLU A;  2Q31 A;  1BUP A;  3O80 A;  2P9K A;  3HSC A;  1Y64 A;  5LY3 A;  2CGK A;  4RTF D;  5FPM A;  3O1W A;  3UE5 A;  1YVN A;  5BRD A;  3WXL A;  1QZ6 A;  5AQM A;  3GG4 A;  5LJV A;  1NWK A;  4BR9 A;  2E88 A;  2Q0R A;  4FL9 A;  5AQY A;  3LDQ A;  4H5W A;  4Y0W A;  1V4S A;  1QQN A;  1NGI A;  1U2V B;  3VOV A;  2GWJ A;  2Q36 A;  3H3O B;  1G99 A;  3O5B A;  1QQO A;  3DXM A;  3FGU A;  1NGE A;  3B8A X;  3ULE B;  4BRE A;  2Q1N A;  3ZX3 A;  3MN6 A;  5BPL A;  1H1V A;  2OAN A;  1KXP A;  5AQU A;  3U9Z A;  4B9Q A;  2HF3 A;  4O8K A;  2E8A A;  2HMP A;  2UYT A;  1NMD A;  5EY4 A;  4BGB A;  2P9I A;  4IJN A;  4PL8 A;  2P9S A;  3BUZ B;  2NRH A;  2V7Z A;  3ATU A;  4H5V A;  4ISE A;  3LDP A;  5AQG A;  3VEO A;  1YXQ A;  4H0T B;  4QS8 A;  4DCH A;  1XQS C;  2YHW A;  4CI6 A;  2HOE A;  3GOI A;  4CJ7 A;  5AQX A;  3VF6 A;  2Q2R A;  3IMX A;  5AQV A;  4EFH A;  4F9O A;  4JD2 B;  4BRO A;  4IJA A;  3QFU A;  1ZBS A;  5KQ8 A;  4I6M A;  1YAG A;  3AY9 A;  3U9D A;  3VER A;  2H3G X;  3VEW A;  2D4W A;  3ZX0 A;  5BRE A;  3GDQ A;  2IVN A;  4JN4 A;  4RCH A;  4WQ5 A;  4A61 A;  2E2Q A;  1J6Z A;  4XH1 A;  5F1X A;  1GLB G;  1V4T A;  5EXW A;  2I7P A;  1LCU A;  4CZL A;  5JIC A;  2P9N A;  5ADX H;  2V51 B;  4A2B A;  3VF4 A;  2BTF A;  2IVO A;  3H1Q A;  5AQF A;  3L4I A;  4KBO A;  5TKY A;  3JXU A;  3M3Z A;  4A2A A;  1GLL O;  2A40 A;  3EKS A;  1X3M A;  2NZT A;  2ASP A;  2CGL A;  4CBU A;  1RGI A;  5AFU H;  5AZI A;  3CJC A;  1RDW X;  3QDK A;  4B1Z A;  1ATS A;  2A42 A;  5AQS A;  1QQM A;  3C0B A;  3O08 A;  5AQP A;  3O1B A;  2FSJ A;  3CJ1 A;  3MDQ A;  1U2V A;  1DKG D;  4BRF A;  1YUW A;  3VES A;  1WUA A;  3WXI A;  4BR2 A;  5AFU A;  1Z6R A;  2YI1 A;  1Q18 A;  3FZH A;  3F9M A;  5FPN A;  4JNE A;  5I9E B;  3KHY A;  4BRP A;  3U4L A;  1IJJ A;  3MN7 A;  3WXJ A;  1X9J A;  3VGL A;  3KVG A;  5AQZ A;  4WQ5 C;  3WEE B;  1K8K B;  1NLV A;  3LDO A;  4FSV A;  4FWP A;  3CQX A;  4NB4 A;  3LL3 A;  4Z94 A;  5F0X A;  4J8F A;  1QHA A;  3U8X A;  3FZM A;  3O4W A;  3M6G A;  4EHT A;  4K41 A;  2GWK A;  3A5L C;  4JD2 A;  3D2F B;  1SZ2 A;  5FPE A;  4DHY A;  4FPA A;  5AQJ A;  3BF3 A;  1ATR A;  1S3X A;  2IVP A;  3G25 A;  3WXK A;  1P8Z A;  2VWB A;  3CER A;  3SLC A;  1NGD A;  1HX1 A;  3SMP A;  3QB0 A;  4B1W B;  3IDH A;  1BDG A;  3M1F A;  1KAY A;  1JCF A;  3DAW A;  5AQR A;  1XC3 A;  2W40 A;  1GLJ O;  4H5R A;  4BC3 A;  5BRH A;  3UKU B;  4JHD B;  4DB3 A;  5AQH A;  3ENO A;  4FWR A;  4XH5 A;  3HBT A;  3LM2 A;  5LJW A;  1MWK A;  1JCG A;  2P9L B;  5AR0 A;  4B1U B;  4BR4 A;  1C0F A;  2GTD A;  3R6M A;  2PBD A;  2NLX A;  4H0V B;  4CBX A;  1NBW A;  4BRD A;  4PKI A;  3VGK A;  1GLC G;  1HKB A;  4FO0 A;  4BVP A;  3W0L A;  1TUU A;  3DJC A;  3FZF A;  1R59 O;  3FLC O;  4WYB A;  3CIP A;  2P9P B;  2PAV A;  1MWM A;  1TYQ B;  1NGG A;  2GEM A;  5EX5 A;  1RFQ A;  2FF6 A;  1SQK A;  3HTV A;  4FWS A;  3WQT A;  3WEE A;  1K8K A;  2E2O A;  4M7Y A;  2E2N A;  2EWS A;  1BA0 A;  2A3Z A;  3D7E O;  5ELZ A;  1SAZ A;  3IUC A;  3OHR A;  4EIA A;  3J8A A;  5JLH A;  5AQI A;  3DXK B;  4B1V A;  3D2F A;  3D2E A;  3R8E A;  4H5T A;  4XEI A;  2ZGY A;  4H0X B;  4CD3 A;  4IWV A;  4BQL A;  1BG3 A;  5BPN A;  2FLO A;  3VF2 A;  3C7N B;  3EZW A;  4BRK A;  2YCH A;  5EOY A;  2A6A A;  2I7N A;  1XUP O;  4FPB A;  3HM8 A;  4QS9 A;  1T6C A;  1Z05 A;  5EVZ A;  4CZG A;  2E20 A;  1NGJ A;  3UKU A;  2ZGZ A;  4JHD A;  5ADX A;  2ITM A;  3H6E A;  5F2R A;  2D0O A;  2AP1 A;  3UKR B;  4BRI A;  2QM1 A;  2P9L A;  4BRN A;  1E4G T;  3HZ6 A;  3ID8 A;  4FWK A;  4GY2 B;  2IIR A;  4B1X B;  5FPD A;  2VCP A;  1E4F T;  3EL2 A;  3ULE A;  4CD1 A;  4BRH A;  4QS7 A;  1NGH A;  5AQK A;  3LDL A;  3BF1 A;  1GLD G;  3SJH A;  1MDU B;  2V7Y A;  2ZF5 O;  1HJO A;  2P9P A;  3AAR A;  3R9P A;  1NGA A;  1TYQ A;  4BGA A;  3ENH A;  4BRG A;  4C23 A;  3VGM A;  4IXC A;  1LOT B;  2ZWH A;  3S41 A;  4YDU A;  5JLF A;  3QML A;  2GUP A;  3ZET B;  2QWM A;  2P9I B;  4IZ9 A;  2VYP A;  2YJE A;  2QWO A;  4BRQ A;  4EHU A;  3H46 O;  3H45 C;  3WUH A;  2Q0U A;  3LDN A;  4CZH A;  4CZM A;  3ZX2 A;  2V52 B;  3VEV A;  1ATN A;  1ZXO A;  2D0P A;  3BEX A;  3MMV A;  4GNI A;  4CZI A;  1GLF O;  4A62 A;  1S22 A;  4CZE A;  2FSK A;  4CZJ A;  3H1V X;  1D4X A;  5AZJ B;  3MK6 A;  3VEZ A;  3WQU A;  1WOQ A;  3CJ7 A;  4CBW A;  4EAH D;  5KQD A;  4MLE A;  1ZC6 A;  4AM7 A;  4RWT A;  4BRA A;  5E26 A;  4K43 A;  2E1Y A;  3UB5 A;  4MO5 A;  3ATV A;  3L0Q A;  3IFR A;  3EO3 A;  3GL1 A;  2P9N B;  3TU5 A;  1KAX A;  3FZL A;  4H0P A;  3UKR A;  4AM6 A;  2WUS A;  5AQQ A;  4PKG A;  1HUX A;  1HKC A;  4BR5 A;  1MA9 B;  2A5X A;  4E1J A;  4PL7 A;  4FWL A;  4YDU C;  2CH6 A;  3GBT A;  4HWI A;  5AZI B;  4HTL A;  3GE1 A;  3H3N O;  3FZK A;  4IO8 A;  3A8Y A;  3CHW A;  2QWN A;  4H0Y B;  2GEL A;  1T6D A;  2D1K A;  4BQZ A;  1BU6 O;  1NGC A;  4K42 A;  5AQO A;  2QWQ A;  3VEY A;  5E84 A;  4BRM A;  4WQ4 A;  3A5M C;  1HKG A;  1GLE G;  3BP8 A;  3MN5 A;  3SK3 A;  4FWO A;  3O8M A;  4LC9 B;  3ZET A;  4H0O A;  4BG8 A;  2ASO A;  4H5N A;  4FOI A;  2E2P A;  4NO7 A;  3VPZ A;  2CH5 A;  1BOT O;  2Q97 A;  2QWR A;  5AQW A;  3KZB A;  3O6W A;  4FOE A;  5KPZ A;  1OKJ A;  2P9U B;  3RSE B;  4JAX A;  4ISF A;  1JCE A;  1EQY A;  2QWP A;  2F9W A;  5BR9 A;  2QXL A;  3P4I A;  4FWN A;  4L3Q A;  1TUY A;  2A41 A;  3AAP A;  5AZJ A;  4K25 A;  5BN8 A;  3ZEU B; 
#chains in the Genus database with same CATH topology
 2PFU A;  4GKK K;  3QIN A;  5BRF A;  1ZBL A;  4DS5 A;  1W2B M;  3EKU A;  4WFB L;  3PLA A;  1WSJ A;  1RTD A;  3I55 N;  1KLN A;  2BUP A;  3DWL A;  4MQ3 A;  4UQG A;  4M63 C;  4WQ4 C;  5AQT A;  1Q9Y A;  1RT3 A;  4OJR A;  2FSN A;  3AAQ A;  4C8N A;  5GIN A;  5BN9 A;  4GV9 A;  4RG8 A;  3DMJ A;  1FW6 A;  1NGB A;  1X3N A;  4ZHR A;  3LAN A;  2YV0 X;  3SCX A;  1K6Y A;  4GVE A;  4IDH A;  3SI6 A;  4FZZ A;  2X6N A;  4RW7 A;  1B92 A;  3VQ7 A;  5FRM A;  5BPM A;  4N5S A;  3WNE A;  5AQN A;  4Z4I A;  2Z1G A;  2FBT A;  3Q7B A;  4B1Y B;  1HQU A;  3MCP A;  5BR8 K;  3C6H A;  3KLH A;  2Z1H A;  4I9Q A;  2ZQB A;  1GLA G;  4E7J A;  3K2P A;  2QWL A;  3RSE A;  2X78 A;  4ISG A;  1HPM A;  4DG1 A;  4B3R K;  5CY4 A;  3KLI A;  3P1G A;  3D2E B;  4CF2 A;  2OCE A;  3ZEU A;  2DPN A;  3OVN A;  4W5O A;  5AQL A;  3ZT1 A;  2EX3 A;  1BA1 A;  1T05 A;  1BUP A;  3L2U A;  2P9K A;  3HSC A;  1Y64 A;  5C12 A;  4CHN A;  4FK4 A;  5AQM A;  4CJE A;  2UXC K;  4E7L A;  4M3Z A;  4JK9 A;  4FL9 A;  3OYH A;  2VG5 A;  4Y0W A;  5MLC Q;  4DV6 K;  1NGI A;  3CCJ N;  1U2V B;  1G99 A;  3DXM A;  4LF4 K;  1NGE A;  3B8A X;  4NYF A;  4R79 A;  3M5R A;  3ZX3 A;  1BGX T;  1H1V A;  1TK5 A;  4LH5 A;  4AQY K;  5AQU A;  4B9Q A;  4DTO A;  2HF3 A;  2HMP A;  3VQ5 A;  3ZCM A;  2P9I A;  3EZ5 A;  4IG0 A;  3BZK A;  2NRH A;  2V7Z A;  2WTU A;  2W6K A;  4ISE A;  3B6P A;  3AO1 A;  4DCH A;  1C1C A;  1WSI A;  2ZJQ L;  2YHW A;  3DRP A;  4X62 K;  1Z26 A;  4EFH A;  3THX A;  4BRO A;  1KLM A;  4IJA A;  3S3N A;  4I6M A;  1TKX A;  4WQ5 A;  4CEC A;  5C25 A;  4FJG A;  1J6Z A;  4XH1 A;  5GAG P;  4Y1C A;  3VQD A;  3RRH A;  1LCU A;  3HK2 A;  5ADX H;  4DR7 K;  2BTF A;  2IVO A;  2XY7 A;  4HHT A;  4KBO A;  3THW B;  3JXU A;  3M3Z A;  2BDP A;  2GV9 A;  3OYA A;  4B3S K;  1LWF A;  1S1W A;  5AFU H;  3NE6 A;  3NCI A;  3NF8 A;  3QDK A;  1YIJ N;  3R1X A;  2C1I A;  4NLB A;  2A42 A;  4KAZ A;  3NH2 A;  4M3T A;  3C0B A;  1YJ9 N;  5C2D A;  1NJY A;  1CZ9 A;  4BE1 A;  4FJ7 A;  4R5P A;  4YNQ A;  3E66 A;  1WLJ A;  4JI7 K;  4BRF A;  4E89 A;  1YUW A;  3WXI A;  1S1V A;  4BR2 A;  5AFU A;  1Z6R A;  2YI1 A;  4ELU A;  3JAM O;  3FZH A;  5GAD P;  4C8K A;  3BGR A;  1Z25 A;  4JNE A;  4Y1D A;  3HT3 A;  3KLE A;  4BRP A;  5GAE P;  3MN7 A;  1KVB A;  3KVG A;  2E6L A;  5F0X A;  3BDP A;  4DSL A;  1VSJ A;  1QHA A;  4JI1 K;  3V1Q A;  3PSI A;  3FZM A;  1RT6 A;  3O4W A;  4DV5 K;  2QEX N;  3S5T A;  4J2B A;  1LWC A;  1SZ2 A;  3DI6 A;  4OX9 K;  3O3G A;  3CM6 A;  4FPA A;  2G8K A;  5AQJ A;  4WCE L;  3QEP A;  3PO4 A;  4CGF A;  3VQQ A;  3WXK A;  4CJ5 A;  1FXX A;  4DR1 K;  4JYA K;  1JLG A;  4B9S A;  3BZC A;  1HX1 A;  4B1W B;  3DLH A;  3M1F A;  1JCF A;  3DAW A;  5AQR A;  2W40 A;  4DMN A;  4OPA A;  4BC3 A;  3QET A;  4DB3 A;  4BEB A;  4XH5 A;  4JI0 K;  3TSQ A;  3WNF A;  4LFC K;  3TSU A;  2P9L B;  5AR0 A;  4B1U B;  3VQ6 A;  3DLL L;  2GTD A;  4H0V B;  1QE1 A;  4CBX A;  2ZJP L;  4BRD A;  2NNW A;  3VGK A;  1QTM A;  4DFJ A;  3WXM B;  4OLA A;  2NRR A;  3L2V A;  3DJC A;  3OYJ A;  1YHQ N;  1R59 O;  3FLC O;  1NOZ A;  3SUP A;  2EHG A;  3HPH A;  4K8X A;  1NGG A;  4KHY A;  3LAL A;  1T03 A;  3NH1 A;  1RNH A;  1QQC A;  2B5J A;  4IOX A;  4M7Y A;  2E2N A;  1U4B A;  2EWS A;  3LP1 A;  3OHR A;  3OYD A;  3NMU A;  2RN2 A;  1BQN A;  4B1V A;  5M1P A;  3C6U A;  3O3F A;  4CJU A;  4DR5 K;  3KD1 E;  2ZGY A;  4CIE A;  4CD3 A;  2QKB A;  4FJX A;  4MFB A;  4LFA K;  4DSK A;  2A1R A;  1TV6 A;  3MX5 A;  3OA9 A;  3DLB A;  1VQO N;  3VF2 A;  4QAG A;  4A59 A;  4KTZ A;  3M8Q A;  2G8F A;  4QS9 A;  1T6C A;  3KWG A;  2ITM A;  2D0O A;  4TSX A;  2E6M A;  1N5Y A;  4CGI A;  2JGU A;  4BRN A;  3OS0 A;  1E4G T;  2IIR A;  2VCP A;  1XMQ K;  1A5X A;  3ULE A;  1OH7 A;  4CVN E;  3SAF A;  1A5V A;  1GLD G;  1SKW A;  3QLH A;  1D9F A;  2KFN A;  4CE9 A;  1T3V A;  2VQF K;  3DLE A;  2Z1J A;  1HJO A;  2P9P A;  1ASU A;  3R9P A;  4JEP A;  3C94 A;  3CYM A;  2KTQ A;  4BRG A;  4C23 A;  2VQE K;  2QK9 A;  2ZWH A;  4CHP A;  4DV0 K;  4CEE A;  2RKI A;  3ISN C;  2P9I B;  1NK6 A;  3IS9 A;  2YJE A;  4HTU A;  1SL2 A;  3V9U A;  3AO4 A;  4LY7 A;  1U45 A;  5LL6 Z;  4KH6 A;  2Q0U A;  1F21 A;  4O0J A;  1NJZ A;  2V52 B;  4JKG A;  4FJK A;  3O3H A;  3G71 N;  1S22 A;  2FSK A;  3NF6 A;  4CZJ A;  3H1V X;  5K14 A;  1FKP A;  4CEB A;  3VEZ A;  2BGG A;  4NCG A;  1X9W A;  1VQN N;  4FXD A;  4G9Z A;  4MLE A;  4DR2 K;  4B9U A;  3SUN A;  4BRA A;  4IKF A;  3UB5 A;  3V6D A;  3ATV A;  1HNW K;  1QVG M;  5JVH L;  1I94 K;  2HHW A;  2G8V A;  4CES A;  1WB9 A;  4JRP A;  4GMJ B;  5CR4 A;  4YDU C;  3GBT A;  4HWI A;  3I0R A;  4CHQ A;  2HW3 A;  4HTL A;  4DTM A;  1RBR A;  3A8Y A;  2O8C A;  3DLG A;  3CHW A;  2O8F B;  2NRT A;  1CZB A;  3SV4 A;  5E84 A;  4WQ4 A;  2FBV A;  3A5M C;  1HKG A;  3BP8 A;  4KI6 A;  4I9L A;  2WFB A;  3KKR A;  3O8M A;  3ZET A;  4CGG A;  1VAZ A;  4H5N A;  3TWH A;  2ZE2 A;  4FOI A;  2G8I A;  4NO7 A;  2GX9 A;  1TK8 A;  4OVL A;  2OTJ N;  4IFY A;  4K0K K;  3O6W A;  5KPZ A;  2E5L K;  1OKJ A;  2P9U B;  4UY8 O;  3C6A A;  4JAX A;  4YOV A;  2QWP A;  5BR9 A;  4IOC L;  1VSF A;  2W00 A;  5C10 A;  4FJ5 A;  2A41 A;  4FJI A;  5FLX O;  1NOY A;  3DLK A;  3KLG A;  1NU0 A;  1W0H A;  4E1M A;  3KJV A;  4W5R A;  3T1A A;  4FM2 A;  3TPQ A;  3CQY A;  2IS3 A;  3NF9 A;  2PYL A;  2P5G A;  2YHY A;  3EE8 A;  3SPY A;  3OJU A;  2QTD A;  3FFK B;  2D0C A;  3OYG A;  3SBT A;  4BR7 A;  4JKH A;  3KIO A;  4YFU A;  4BRC A;  3A2F A;  3MEG A;  1U6Z A;  4DLG A;  1VHX A;  2HNZ A;  2Z1I A;  4FW2 A;  4BC4 A;  3WT0 A;  4FWM A;  4I2Q A;  3QBX A;  4BRL A;  2Q3S A;  4H03 B;  1BO5 O;  3NHG A;  4BC2 A;  3RMD A;  1C6V A;  1K73 O;  4E7H A;  2AA4 A;  2RPI A;  2CGJ A;  5IT9 O;  4JI5 K;  2P9S B;  3PIP L;  2F96 A;  1NGF A;  3RTV A;  3VEX A;  3DXK A;  1VSE A;  1GOA A;  5JS2 A;  2O8B A;  4YOT A;  3EN9 A;  4XH4 A;  3CJA A;  4CJR A;  5CE3 A;  2KHO A;  4HUE A;  2WOM A;  4JLH A;  3SAH A;  1ILY A;  3SMS A;  3AO5 A;  4DTX A;  2W41 A;  1DEJ A;  4BVO A;  4A5B A;  2BAN A;  3G4S N;  2C1G A;  2J4R A;  1ASW A;  2HVI A;  5J2N A;  2XY8 A;  2YJF A;  1BI4 A;  3HI0 A;  3K5N A;  4ZTJ A;  1X9S A;  3AVA A;  3O80 A;  2VGN A;  4KH4 A;  5GIO A;  2CGK A;  4F8R A;  5KGW A;  3KK3 A;  5FRN A;  1YVN A;  4YOR A;  5BRD A;  2HST A;  1QZ6 A;  4IEE A;  1VQ8 N;  4Z4G A;  4O4G A;  4ELV A;  1N8R O;  1D9D A;  1D5A A;  1B9F A;  3S9H A;  1QQN A;  4Q5V A;  4ZTF A;  1RBS A;  3VOV A;  4CK1 A;  3O5B A;  4O44 A;  1HNZ K;  1XHX A;  3ULE B;  2Y1I A;  2Q1N A;  3MN6 A;  4KTQ A;  5J1E A;  2E8A A;  1NMD A;  3QNN A;  2O8D B;  4XIU A;  3BUZ B;  3PX4 A;  3SQ0 A;  3N4Q A;  3ENB A;  4H5V A;  3LDP A;  3CCL N;  5AQG A;  1KFS A;  1YXQ A;  1JXE A;  4H0T B;  1C1B A;  4QS8 A;  3J7Y P;  4ID1 A;  3CC4 N;  4FJM A;  5AQX A;  2OPP A;  1Q82 O;  2Q2R A;  4PUO A;  5AQV A;  4F9O A;  4JD2 B;  4JI8 K;  3U3Y A;  2KQ2 A;  4KKO A;  4AF1 A;  5KQ8 A;  3AY9 A;  4H8K A;  2DFE A;  3GDQ A;  4B9L A;  4JN4 A;  4RCH A;  3AVK A;  3TTC A;  2E2Q A;  4JKG B;  3VTI A;  3TAG A;  1TKD A;  4WFA L;  3M8P A;  2V51 B;  4A2B A;  1TGO A;  3VF4 A;  1HYZ A;  3H1Q A;  3RVC A;  3MEE A;  4OPH A;  2B6A A;  1GLL O;  1VQP N;  2A40 A;  4CBU A;  1X3M A;  2ASP A;  1U48 A;  1RGI A;  3CJC A;  5TKW A;  4B1Z A;  2WON A;  3I56 N;  4DF8 A;  3O08 A;  2E4L A;  1YVU A;  3O1B A;  3CJ1 A;  4CER A;  3OYM A;  3MWT A;  5M1O A;  4KH5 A;  3CCR N;  1J9A A;  1WUA A;  1L3U A;  1JLE A;  4QCL A;  3F9M A;  5FPN A;  3OBW A;  3QEX A;  5M1K A;  2IGI A;  5I9E B;  1JJ2 M;  3U4L A;  2O8C B;  1X9J A;  2VGM A;  1NKB A;  3VGL A;  3C65 A;  1SL1 A;  1IBL K;  1K8K B;  3LDO A;  3CQX A;  4NB4 A;  3D45 A;  1WN7 A;  4J8F A;  1XI1 A;  2D5R A;  3CCQ N;  2GWK A;  1TKT A;  3D2F B;  1BHL A;  1KC8 O;  1RIL A;  5FPE A;  1DTQ A;  3CPE A;  3BF3 A;  1S3X A;  2IVP A;  4GW6 A;  4IO9 L;  1LW2 A;  1YIT N;  4B8C A;  3SLC A;  1O1W A;  2G8U A;  4E0D A;  3QB0 A;  4CJV A;  4PWD A;  4ILH A;  4LSN A;  3IDH A;  4JI4 K;  1KAY A;  4NCA A;  3UKU B;  4JHD B;  4CF1 A;  3ENO A;  3NAE A;  3HBT A;  4CJF A;  1MWK A;  1JCG A;  1HMV A;  2HNY A;  4KB0 A;  4O5B A;  2XO7 A;  3TTF A;  3HM9 A;  2NRV A;  3V9Z A;  3R3L A;  4FO0 A;  4BVP A;  5T7B A;  1JLC A;  2HHT A;  1YTU A;  4JV5 K;  5KI6 A;  3FZF A;  2DFH A;  4WYB A;  4YOU A;  4ILG B;  3U6F A;  2PAV A;  4DV2 K;  3E9P A;  3VN5 A;  4U67 L;  1TYQ B;  2GEM A;  3KWI A;  3RR8 A;  4CHZ A;  1SQK A;  4FWS A;  3HXM A;  2UUA K;  4CCH A;  3WEE A;  2E2O A;  3OYE A;  4DSF A;  2QKK A;  1BA0 A;  3D7E O;  5ELZ A;  3HP6 A;  2XY6 A;  5HOO A;  3CC7 N;  4EIA A;  4CF8 A;  1WBD A;  3DXK B;  1N32 K;  3MXI A;  5M1N A;  4BQL A;  1IKW A;  3THY A;  1OVQ A;  2FLO A;  3QEI A;  4BRK A;  5EOY A;  2NRW A;  2KKZ A;  2A6A A;  3WNG A;  3U3G A;  3HPO A;  2HHS A;  4CZG A;  1BI4 B;  4FLX A;  1RT5 A;  2E20 A;  5ADX A;  3H6E A;  3ZSV A;  3OBY A;  4DQR A;  5SZT A;  3UKR B;  4BRI A;  2QM1 A;  1U47 A;  4DQP A;  3ID8 A;  2ITG A;  2JWK A;  3EL2 A;  1JLB A;  1XNR K;  1DT9 A;  3PUF A;  1HRH A;  1W9H A;  2HHH K;  2OTL N;  3OS1 A;  3SJH A;  1MDU B;  3G10 A;  3LDS A;  3ZSO A;  3TAP A;  3AAR A;  2IDO A;  3DOK A;  2Y1J A;  3IRX A;  4CGJ A;  3VQB A;  3ENH A;  2RHK A;  3TAQ A;  2IC3 A;  3VGM A;  3OS2 A;  4JKA A;  4YDU A;  5JLF A;  2B4J A;  3QML A;  2X74 A;  2QWM A;  3JYT A;  4O0I A;  4FM1 A;  4IOA L;  1OVY A;  4BRQ A;  4F3O A;  4I2P A;  3H45 C;  2OZS A;  4O55 A;  3WUH A;  3VQP A;  4FVU A;  3LDN A;  4CZM A;  3KLF A;  4FZX C;  1XWL A;  3AVC A;  1ATN A;  1ZXO A;  2D0P A;  3MMV A;  4GNI A;  1TAQ A;  1GLF O;  2HBL A;  4DV1 K;  5KRT A;  4HVJ A;  5AZJ B;  4FW1 A;  1WOQ A;  4CBW A;  2UUB K;  1S6Q A;  4DLE A;  1ZC6 A;  4RWT A;  3CFR A;  3HJF A;  2HHU A;  1VQ9 N;  3DOL A;  4BDP A;  3PIO L;  3OW2 M;  4K43 A;  2E1Y A;  4BE0 A;  1FJG K;  2KW4 A;  3GL1 A;  4LD0 A;  1NG9 A;  2WC9 A;  1KAX A;  2OPQ A;  5I42 A;  4RW8 A;  4JRQ A;  4KHS A;  5JEN A;  2WUS A;  5HL7 L;  1SKR A;  1RDB A;  3RMA A;  5AQQ A;  4PKG A;  1X9M A;  3RWU A;  4DTJ A;  4AIL C;  4JKD A;  1D8Y A;  2CH6 A;  4Q0B A;  4CHY A;  1KVC A;  3G6E N;  3OYN A;  3K9J A;  1RDC A;  3HVT A;  1TVR A;  3MXM A;  4CJL A;  4BQZ A;  2D1K A;  4K42 A;  3S3O A;  3TAE A;  1P90 A;  3DYA A;  1VSM A;  1NKC A;  4JS4 A;  5KRS A;  1VRU A;  3SK3 A;  3CXC M;  3ALY A;  4B3M K;  3CPW M;  4IFV A;  5JVG L;  4BG8 A;  5J2M A;  4AHC A;  5HRS A;  2CH5 A;  1BOT O;  2F8T A;  4M41 A;  2Q97 A;  2QWR A;  3LPU A;  4DUZ K;  1X1P A;  1RDA A;  4FOE A;  5DM7 L;  1Q86 O;  3RSE B;  2OPS A;  3CMA N;  4ISF A;  4DSI A;  3AO3 A;  1RBT A;  3P4I A;  4PA1 A;  4M3U A;  1YT3 A;  2HHI A;  3ZEU B;  4BE2 A;  4MDA A;  3AVN A;  3L8B A;  3L2Q A;  3UIQ A;  3QBW A;  4MLH A;  2O4G A;  2P9K B;  3QIO A;  3VQE A;  1ESV A;  4KRE A;  1Q81 O;  1IG9 A;  2E1Z A;  4X65 K;  3CET A;  4C1N I;  3LZJ A;  4DTR A;  4O5F A;  1R0A A;  4MO4 A;  4WF9 L;  4OKK A;  2ASM A;  3DLR A;  3I33 A;  4JI6 K;  5KPR A;  1L3T A;  1VQ6 N;  2UUC K;  1NM1 A;  1HNI A;  4CFA A;  4DTN A;  4E1N A;  1NMN A;  3DXM B;  4ILJ A;  3NGZ A;  1DGK N;  5CHI A;  4CIG A;  1WBB A;  4N41 A;  3AGK A;  2FXU A;  4DR4 K;  3MN9 A;  1RDD A;  3VTH A;  4BR0 A;  2QW9 A;  1BWF O;  4KI4 A;  3T1Y K;  1CZA N;  3CI5 A;  1L3V A;  3CFP A;  1N34 K;  4MDB A;  3A5N C;  3FR0 A;  2XY5 A;  4DQ8 A;  1ZBU A;  3CM5 A;  1YJW N;  3HPG A;  3A0I X;  3VEN A;  3SBG A;  1NK7 A;  4PKH A;  3THX B;  5KPT A;  4DR6 K;  2VWK A;  4I6M B;  4KHQ A;  3E01 A;  3LP2 A;  3CJ9 A;  2HF4 A;  4FWQ A;  4FLT A;  3ZT2 A;  4DUY K;  1RT2 A;  3NH0 A;  1VSI A;  3CQ8 A;  1J54 A;  2HHV A;  1JL1 A;  1HLU A;  4HUF A;  4RTF D;  3O1W A;  3WXL A;  1ASV A;  1IBK K;  1A5W A;  3GG4 A;  4EP4 A;  4HUG A;  4JKE A;  2XRI A;  4BR9 A;  1HR0 K;  4DKW A;  1IBM K;  3LDQ A;  4OKJ A;  1V4S A;  2GWJ A;  3H3O B;  1QQO A;  4PY5 A;  3FGU A;  4FLY A;  1IV0 A;  3SYZ A;  1IKX A;  2OAN A;  1KXP A;  3U9Z A;  4O8K A;  1WSE A;  4BGB A;  4IJN A;  5LMN K;  1M90 O;  4DU1 A;  2AJQ A;  4PL8 A;  3VQA A;  5H1S Q;  3ATU A;  3NGI A;  1KVA A;  1S1T A;  1U04 A;  3VA0 A;  4CJW A;  5HRP A;  3SAG A;  5HRN A;  1WNS A;  4L8R B;  2QI2 A;  4CI6 A;  3GOI A;  3TSP A;  3VF6 A;  1S9G A;  1LW0 A;  1ZBS A;  1J5E K;  3U9D A;  3VER A;  3V1R A;  3E9O A;  5BRE A;  3OY9 A;  3AVM A;  2IVN A;  4A61 A;  5F1X A;  4AHV A;  1V4T A;  5EXW A;  2I7P A;  3L2W A;  5C15 A;  4F2R A;  3CFO A;  3DM2 A;  3IG1 A;  2P9N A;  3P83 D;  1J5O A;  4F4K A;  4F3T A;  4JKC A;  3NGY A;  1VSK A;  3L4I A;  5AQF A;  5TKY A;  4A2A A;  1HPZ A;  3LAM A;  5CYM A;  3OYC A;  1RDW X;  5AQS A;  3AA4 A;  2KFZ A;  1BL3 A;  1QQM A;  4FLW A;  4DR3 K;  4KHP K;  2D0B A;  4OO1 J;  3MDQ A;  3P38 A;  4JK7 A;  1ZBI A;  1U2V A;  3QEW A;  1DKG D;  3EE9 A;  4DS4 A;  3VES A;  1S72 N;  3ASM A;  3V4I A;  1DLO A;  4NXM K;  2YX6 A;  3SUQ A;  1Q18 A;  5SWM A;  2VWJ A;  3KHY A;  1IKV A;  4JK8 A;  5AQZ A;  1G15 A;  1NLV A;  4Z4E A;  4FSV A;  4M45 A;  1TK0 A;  3QNO A;  4N47 A;  3VQ9 A;  3LL3 A;  3O4Q A;  3TR8 A;  4CF9 A;  1NK9 A;  1YTA A;  3U8X A;  1ZYQ A;  4EHT A;  4K41 A;  3A5L C;  3AA3 A;  1K9M O;  1HQE A;  5C42 A;  4DHY A;  4AHR A;  4A5A A;  1LAW A;  3PY8 A;  1JLF A;  2FBY A;  3G25 A;  3QO9 A;  1P8Z A;  1SUQ A;  3CER A;  4JI3 K;  3SQ2 A;  1NGD A;  3QES A;  3T69 A;  1BDG A;  1S5J A;  3M8S A;  1XC3 A;  1GLJ O;  1I39 A;  3NF7 A;  4H5R A;  5HP1 A;  1KFD A;  2BH1 A;  3J81 O;  4I7F A;  3LM2 A;  5LJW A;  1NJX A;  3RMC A;  3R6M A;  2PBD A;  3KK2 A;  3T3F A;  4FM0 A;  2NLX A;  4FCY A;  1HNX K;  2HBK A;  3AO2 A;  1NBW A;  1Q8I A;  4PKI A;  2D0A A;  1GLC G;  3SZ2 A;  1HKB A;  5HRO A;  3RRG A;  2YNH A;  3W0L A;  3MEC A;  3K5O A;  4J2D A;  5FDL A;  3FFI A;  2KZM A;  2DFF A;  3CIP A;  2P9P B;  4DV4 K;  4EZ6 A;  5A2Q O;  2UXB K;  4CEO A;  3V9W A;  1NJW A;  3O9R A;  5CZ1 A;  1MU2 A;  2F8S A;  1VSL A;  3IUC A;  2OYQ A;  4BWJ A;  2IOC A;  3J8A A;  1FKO A;  3K5L A;  4M42 A;  5AQI A;  4M3R A;  4LF9 K;  3R8E A;  3OTO K;  4Z4F A;  4DU4 A;  4H0X B;  5KTQ A;  1HNV A;  3IAY A;  3ZSY A;  1FK9 A;  1BG3 A;  4FVM A;  3EZW A;  2NUB A;  2YCH A;  1S9E A;  3CG7 A;  4N56 A;  2I7N A;  1XUP O;  3DRR A;  4DU3 A;  3HL8 A;  3HM8 A;  4KHU A;  3LWM A;  1VQL N;  1NGJ A;  4OGE A;  2ZGZ A;  1UA0 A;  3L2R A;  2VG6 A;  2NRX A;  1KRP A;  2AP1 A;  1VK0 A;  2P9L A;  4FWK A;  5HRR A;  4GY2 B;  1NK4 A;  1E4F T;  4BRH A;  4QS7 A;  3QER A;  1NGH A;  5AQK A;  3BY5 A;  3LDL A;  1L3S A;  3TI0 A;  3BF1 A;  1LV5 A;  2PYJ A;  2V7Y A;  3PV8 A;  2ZF5 O;  4JKF A;  4KHN A;  3P39 A;  2G8W A;  4B9N A;  2O8E A;  4W5Q A;  4F2S A;  4WE1 A;  4M3X A;  1BIU A;  1Q7Y O;  1LOT B;  3S41 A;  1YJN N;  2P51 A;  2YKM A;  3MX2 A;  4EZ9 A;  2GUP A;  3ZET B;  4CEQ A;  4E19 A;  2FC0 A;  3K5M A;  2X6S A;  3H46 O;  4FYD A;  3HRG A;  2HBM A;  3KTQ A;  3K58 A;  4CZH A;  3ZSR A;  2NRZ A;  3SQ1 A;  3BEX A;  4DV3 K;  4CZI A;  3TAB A;  2F7T A;  4CZE A;  2F4V K;  5J2Q A;  3H08 A;  2VG7 A;  3F5T A;  1D4X A;  2A1S A;  1RBV A;  3CJ7 A;  4AM7 A;  4KO0 A;  1EWQ A;  2G8H A;  3V9X A;  4MO5 A;  3IFR A;  3EO3 A;  4DQI A;  3SV3 A;  2P9N B;  1EX4 A;  4NXN K;  2KZZ A;  3I8D A;  4FJJ A;  1RDU A;  4BDY A;  1CLQ A;  1OH5 A;  3LZI A;  4KFB A;  4C8M A;  1RTH A;  3NBP A;  1KSP A;  1MA9 B;  2A5X A;  1JL2 A;  2HHX A;  2OPR A;  3T7Z A;  5FRO A;  3GE1 A;  2JLE A;  1LWE A;  4KHW A;  3E9L A;  4IO8 A;  4LFB K;  2HB5 A;  4H0Y B;  2GEL A;  1VQ5 N;  1T6D A;  1BU6 O;  4YOY A;  4YOW A;  5C0Y A;  5AQO A;  1M1K O;  4CIF A;  4IBN A;  1GLE G;  3SUO A;  4CF0 A;  2QXF A;  3ZSX A;  2GBZ A;  5CYQ A;  3LAK A;  3LWL A;  3V81 A;  3S3M A;  2ZJR L;  2O8B B;  2E2P A;  3VPZ A;  1C1A A;  5AQW A;  3KZB A;  2FBX A;  1ZBF A;  4CW7 B;  3MCA B;  3AVF A;  3KKS A;  1J53 A;  5LMU K;  1EQY A;  1C0M A;  2F9W A;  3O4N A;  5E41 A;  2QXL A;  4CHO A;  3OJS A;  2HMI A;  4L3Q A;  3AAP A;  5BN8 A;  3CME N;  3Q7C A;  3K59 A;  4Z4H A;  3W3D A;  1CXU A;  3TAM A;  3QIC A;  3HYF A;  5M1F A;  1C0G A;  4BG9 A;  3A5O C;  1C0U A;  4IEI A;  4M7X A;  1W7A A;  2P1J A;  1IG8 A;  4OPK A;  1EWR A;  5JMV A;  4B9T A;  1ZBH A;  1KCF A;  1HJR A;  1U49 A;  3J80 O;  2YNF A;  3QFP A;  2YHX A;  1JLA A;  3CD6 N;  3FE1 A;  1T44 A;  1QZ5 A;  5B8H A;  3OYK A;  2O8F A;  3VET A;  3I8B A;  2OA8 A;  4OGC A;  3L6Q A;  3IKM A;  3G0Z A;  4CEZ A;  1C0T A;  3CJB A;  3RMB A;  3K57 A;  2F9T A;  4DFK A;  4W5T A;  3TAF A;  4CJ4 A;  3AVJ A;  1SV5 A;  1REV A;  2HBJ A;  4CZK A;  4CK3 A;  4RW4 A;  4LF8 K;  4CZF A;  2I5J A;  2YHA A;  2P9U A;  1EXQ A;  4WFN L;  1KAZ A;  3C7N A;  5DMR A;  4BC5 A;  1VQ4 N;  4NCB A;  1S1X A;  1BQM A;  1WAF A;  3LM9 A;  3JS6 A;  1BCM A;  2KLA A;  1BIS A;  1VQM N;  4CK2 A;  3OYB A;  4CEF A;  3SPZ A;  2FF3 B;  1GOB A;  2Q31 A;  1EKE A;  4O8U A;  1WSG A;  1W97 L;  1WSF A;  4DFM A;  1KTQ A;  5LY3 A;  3C95 A;  1TL3 A;  5FPM A;  3AVH A;  2R7Y A;  3UE5 A;  4FLZ A;  3EYZ A;  1KD1 O;  2PY5 A;  5LJV A;  1NWK A;  2E88 A;  2Q0R A;  5AQY A;  3L4Q A;  4DTU A;  4H5W A;  4CFB A;  1Y97 A;  1S1U A;  2Q36 A;  1JXB A;  3ZYY X;  2RF2 A;  3ZSQ A;  4B9M A;  4BRE A;  3CCU N;  4DSE A;  3VMF B;  1HYV A;  3K0S A;  5BPL A;  1WSH A;  3VQC A;  3P31 A;  2UYT A;  5EY4 A;  3RR7 A;  4QOZ B;  1EO1 A;  4BE7 B;  4RW9 A;  4OKE A;  2P9S A;  1DTT A;  2O8E B;  1K8A O;  2WBN A;  3VEO A;  1RT7 A;  4CEA A;  2DTU A;  1NKE A;  4FJN A;  3PO5 A;  2GUI A;  3CF5 L;  3OYL A;  2YKN A;  1XQS C;  1T8E A;  2HOE A;  4CJ7 A;  2LSN A;  2ZM6 K;  3IMX A;  1XC9 A;  4DTP A;  5J2P A;  3QFU A;  1RBU A;  4B3O A;  1YAG A;  3DRS A;  3MAQ A;  4DQQ A;  2H3G X;  3VEW A;  2D4W A;  3ZX0 A;  3CYG A;  3AGR A;  4BY9 C;  3SNN A;  1XHZ A;  2OZM A;  3T19 A;  1GLB G;  4NYN A;  1RCH A;  4CZL A;  5JIC A;  1RTJ A;  4X64 K;  3THV A;  4FLU A;  4B08 A;  1NK5 A;  3EKS A;  2NZT A;  2CGL A;  3AV9 A;  3D0P A;  5AZI A;  5C2F A;  2UU9 K;  4J2E A;  1ATS A;  5KGX A;  5AQP A;  3C6T A;  4JKB A;  2FSJ A;  4B9V A;  4V19 S;  4JI2 K;  5HBM A;  1NK0 A;  4KPY A;  4CFC A;  1WAJ A;  3HP9 A;  2PZS A;  3SJJ A;  3F9K A;  1ITG A;  3CCV N;  2O8D A;  3CC2 N;  1IJJ A;  1VQ7 N;  3WXJ A;  4IFE A;  5GAH P;  4K8Z A;  4RW6 A;  1B9D A;  4WQ5 C;  3WEE B;  3HOS A;  3OYI A;  4FWP A;  3HST B;  1RT4 A;  5M1Q A;  4E3S A;  4Z94 A;  5DK5 A;  4FJH A;  4U7B A;  4H4O A;  3M6G A;  3K9K A;  2ETJ A;  1IH7 A;  3PX6 A;  2ATQ A;  4JD2 A;  1UOC A;  3O9S A;  3VQ4 A;  4ID5 A;  4CJ3 A;  4AHU A;  1ATR A;  3HO1 A;  1BIZ A;  3ZSW A;  1SKS A;  3THY B;  2VWB A;  4LF5 K;  4C1N K;  3SMP A;  4BEC A;  4LF7 K;  3CCE N;  3E1Y A;  4LF6 K;  2P5O A;  4DF4 A;  1VQK N;  2QA4 N;  1EET A;  5BRH A;  3J7Z O;  1QSY A;  5AQH A;  3NFA A;  4FWR A;  4FJL A;  4YY3 K;  3KD5 E;  4OLB A;  4BR4 A;  5IWA K;  1C0F A;  1NJI O;  3I0S A;  1EP4 A;  1CXQ A;  4CJP A;  4BWM A;  1QVF M;  4XJX A;  3V9S A;  1TL1 A;  1TUU A;  3AVB A;  3LP3 A;  4FJ8 A;  4ELT A;  1MWM A;  3JSM A;  4IG3 A;  4DFP A;  5GIP A;  3M8R A;  4LH4 A;  4W5N A;  1NK8 A;  5EX5 A;  1RFQ A;  2FF6 A;  1OH8 A;  3HTV A;  4CJT A;  5DM6 L;  3WQT A;  4C8O A;  1K8K A;  3ZSZ A;  4CFD A;  3QIP A;  2A3Z A;  1SAZ A;  3LP0 A;  3AVI A;  1XMO K;  5JLH A;  1VSH A;  3KK1 A;  3L3U A;  1N36 K;  4GVM A;  3ZT3 A;  4CJQ A;  1RTI A;  3D2F A;  1YI2 N;  4X66 K;  3D2E A;  1TKZ A;  4G1Q A;  4H5T A;  4XEI A;  3NVK A;  4IWV A;  4GV6 A;  4Z4C A;  3P5J A;  5BPN A;  3CCS N;  1OH6 A;  3C7N B;  4KTW A;  4IDK A;  3B6O A;  1IO2 A;  2HND A;  4NLC A;  4FJ9 A;  4AHT A;  1I3A A;  3MED A;  4FPB A;  1QHT A;  1Z05 A;  5EVZ A;  4YOX A;  4DWI A;  1JKH A;  4FLV A;  4AH9 A;  1XNQ K;  3AVL A;  4KRF A;  3UKU A;  4JHD A;  4BDZ A;  5F2R A;  2UXD K;  4PHT X;  1UA1 A;  3J7A P;  2XHB A;  1L5U A;  1RT1 A;  3HZ6 A;  3TTD A;  4N76 A;  3HOT A;  3F2K A;  4B1X B;  5FPD A;  4EP5 A;  2RE2 A;  5EU7 A;  5C24 A;  4H4M A;  4CED A;  3VA3 A;  4CD1 A;  3NVM A;  3ZT0 A;  3O9U A;  3MXJ A;  5AJ3 K;  1N6Q A;  1E3M A;  4B3T K;  1SS6 A;  3MWP A;  3HVR A;  4YHH K;  4CJS A;  1TAU A;  3ULD A;  1S6P A;  1NGA A;  4E72 A;  1TYQ A;  4BGA A;  3EY1 A;  1UAX A;  4KB1 A;  2IAJ A;  4J2A A;  3ZLJ A;  2W6L A;  4IXC A;  2HHQ A;  3ZT4 A;  4CGH A;  2JWL A;  4ICL A;  2BE2 A;  4FZY A;  4IZ9 A;  5JS1 A;  2VYP A;  2YNI A;  2QWO A;  3ID6 A;  4FK2 A;  3F73 A;  4DQS A;  3AA2 A;  4EHU A;  1KQS M;  1VSD A;  1LAV A;  3TAN A;  3AVG A;  4C8L A;  2YHB A;  2HVH A;  3ZX2 A;  4HCC A;  3WNH A;  4A57 A;  3VEV A;  1QSL A;  4E7K A;  4M3W A;  1IKY A;  3SQ4 A;  4A62 A;  4JS5 A;  4HCB A;  3AA5 X;  4DTS A;  3VQ8 A;  3THW A;  1Q9X A;  3MK6 A;  3PSF A;  3WQU A;  5I3U A;  1HYS A;  4EAH D;  5KQD A;  4PQU A;  1YF5 L;  3EEQ A;  5E26 A;  1N33 K;  3PX0 A;  3OYF A;  3L0Q A;  5CZ2 A;  4GKJ K;  3TAR A;  3ITH A;  3TU5 A;  3FZL A;  3QEV A;  1JLQ A;  4H0P A;  3UKR A;  4AM6 A;  4DSJ A;  1BCO A;  3LPT A;  1HUX A;  4GV3 A;  1HKC A;  4LSL A;  4BR5 A;  4E1J A;  4PL7 A;  4FWL A;  4BAC A;  3CCM N;  5HLF A;  3O9T A;  5AZI B;  4FK0 A;  3H3N O;  1T7P A;  1O13 A;  3N4P A;  3FZK A;  4E7I A;  2DY4 A;  2QWN A;  1VRT A;  4AHS A;  1NGC A;  4OPJ A;  2W42 A;  2QWQ A;  4B8A B;  3VEY A;  3T1H K;  4BRM A;  1UWB A;  4Z0U A;  3MN5 A;  3V1O A;  4FWO A;  4LC9 B;  2YNG A;  1QS4 A;  4H0O A;  2ASO A;  3KK7 A;  3L3V A;  4CGD A;  4M3Y A;  4DV7 K;  4CJK A;  1NNE A;  5D3G A;  2ZD1 A;  1SL0 A;  1QSS A;  1GOC A;  1JCE A;  3O9Q A;  4FWN A;  3D6R A;  1TUY A;  4KV8 A;  2O4I A;  3NDK A;  5AZJ A;  4K25 A; 
#chains in the Genus database with same CATH homology
 2PFU A;  3Q7C A;  5BRF A;  3QBW A;  3W3D A;  4MLH A;  3QIC A;  5M1F A;  1C0G A;  4BG9 A;  2P9K B;  1ESV A;  3A5O C;  1Q81 O;  3TPQ A;  4IEI A;  2E1Z A;  1W2B M;  3CQY A;  3CET A;  3EKU A;  4WFB L;  4C1N I;  3PLA A;  4O5F A;  4M7X A;  3I55 N;  1IG8 A;  4MO4 A;  2BUP A;  2YHY A;  3DWL A;  5JMV A;  4WF9 L;  2ASM A;  4M63 C;  3EE8 A;  3I33 A;  4WQ4 C;  5KPR A;  1VQ6 N;  5AQT A;  2QTD A;  3FFK B;  1NM1 A;  3SBT A;  4BR7 A;  3QFP A;  2YHX A;  4JKH A;  4BRC A;  3CD6 N;  2FSN A;  1U6Z A;  3AAQ A;  3DXM B;  3FE1 A;  5GIN A;  1T44 A;  4ILJ A;  5BN9 A;  1QZ5 A;  4GV9 A;  4BC4 A;  3WT0 A;  1DGK N;  4FWM A;  1NGB A;  5B8H A;  1X3N A;  5CHI A;  3QBX A;  4BRL A;  3VET A;  3I8B A;  3AGK A;  4GVE A;  3L6Q A;  4IDH A;  2FXU A;  3IKM A;  3MN9 A;  4H03 B;  1BO5 O;  3CJB A;  3VTH A;  4BC2 A;  4BR0 A;  1K73 O;  2QW9 A;  1BWF O;  2AA4 A;  2F9T A;  2CGJ A;  1CZA N;  2P9S B;  5BPM A;  3PIP L;  1NGF A;  5AQN A;  3CI5 A;  2HBJ A;  3DXK A;  3Q7B A;  4MDB A;  3VEX A;  4B1Y B;  3A5N C;  4YOT A;  3FR0 A;  4CZK A;  3MCP A;  3EN9 A;  4XH4 A;  3C6H A;  3CJA A;  4CZF A;  4DQ8 A;  5CE3 A;  2KHO A;  1GLA G;  1YJW N;  1ILY A;  2P9U A;  3SAH A;  2QWL A;  3RSE A;  3A0I X;  4WFN L;  3SMS A;  3VEN A;  3SBG A;  1KAZ A;  2W41 A;  4PKH A;  3C7N A;  4BC5 A;  1DEJ A;  4BVO A;  5KPT A;  4ISG A;  4A5B A;  1HPM A;  3LM9 A;  1VQ4 N;  3G4S N;  3JS6 A;  2J4R A;  4I6M B;  2C1G A;  2KLA A;  3CJ9 A;  3D2E B;  2HF4 A;  2YJF A;  4FWQ A;  1VQM N;  3ZEU A;  2DPN A;  3HI0 A;  5AQL A;  1BA1 A;  2FF3 B;  1HLU A;  2Q31 A;  4O8U A;  1BUP A;  1W97 L;  3O80 A;  2P9K A;  3HSC A;  1Y64 A;  2VGN A;  4KH4 A;  5LY3 A;  2CGK A;  5GIO A;  4RTF D;  5FPM A;  3O1W A;  3UE5 A;  1YVN A;  4YOR A;  5BRD A;  5C12 A;  2HST A;  3WXL A;  1QZ6 A;  5AQM A;  4IEE A;  1VQ8 N;  1KD1 O;  3GG4 A;  5LJV A;  1NWK A;  4JKE A;  4BR9 A;  2E88 A;  4JK9 A;  2Q0R A;  4FL9 A;  5AQY A;  4DKW A;  3L4Q A;  1N8R O;  3LDQ A;  4H5W A;  4Y0W A;  1V4S A;  1QQN A;  5MLC Q;  1NGI A;  3CCJ N;  1U2V B;  3VOV A;  2GWJ A;  2Q36 A;  3H3O B;  1G99 A;  3O5B A;  3ZYY X;  1QQO A;  3DXM A;  3FGU A;  1NGE A;  3B8A X;  3ULE B;  4BRE A;  4R79 A;  3CCU N;  3VMF B;  3M5R A;  2Q1N A;  3ZX3 A;  3MN6 A;  5BPL A;  1H1V A;  2OAN A;  1KXP A;  5AQU A;  3U9Z A;  4B9Q A;  3P31 A;  2HF3 A;  4O8K A;  2E8A A;  2HMP A;  2UYT A;  1NMD A;  5EY4 A;  4BGB A;  1EO1 A;  2P9I A;  4IJN A;  4BE7 B;  1M90 O;  4PL8 A;  2P9S A;  3BUZ B;  3N4Q A;  5H1S Q;  3ENB A;  2NRH A;  2V7Z A;  3ATU A;  4H5V A;  4ISE A;  1K8A O;  3LDP A;  2WBN A;  5AQG A;  3VEO A;  3CCL N;  1YXQ A;  4H0T B;  4QS8 A;  4DCH A;  3CC4 N;  3CF5 L;  3SAG A;  2ZJQ L;  1XQS C;  2QI2 A;  2YHW A;  4CI6 A;  2HOE A;  3GOI A;  3TSP A;  4CJ7 A;  5AQX A;  1Q82 O;  3VF6 A;  2Q2R A;  3IMX A;  5AQV A;  4EFH A;  4F9O A;  4JD2 B;  4BRO A;  4IJA A;  3QFU A;  1ZBS A;  4AF1 A;  5KQ8 A;  4I6M A;  1YAG A;  3AY9 A;  3U9D A;  3VER A;  2H3G X;  3E9O A;  2D4W A;  3VEW A;  3ZX0 A;  3GDQ A;  5BRE A;  3AGR A;  4BY9 C;  2IVN A;  4JN4 A;  4RCH A;  4WQ5 A;  3TTC A;  2E2Q A;  4JKG B;  3VTI A;  4A61 A;  1J6Z A;  4XH1 A;  5GAG P;  5F1X A;  1GLB G;  1V4T A;  5EXW A;  2I7P A;  4WFA L;  1LCU A;  5C15 A;  4CZL A;  5JIC A;  2P9N A;  5ADX H;  2V51 B;  4JKC A;  4A2B A;  3VF4 A;  2BTF A;  2IVO A;  3H1Q A;  5AQF A;  3L4I A;  4KBO A;  4OPH A;  3RVC A;  5TKY A;  3JXU A;  3M3Z A;  4A2A A;  1GLL O;  1VQP N;  2A40 A;  3EKS A;  1X3M A;  2NZT A;  2ASP A;  2CGL A;  4CBU A;  1RGI A;  5AFU H;  5AZI A;  5C2F A;  3CJC A;  1RDW X;  3QDK A;  5TKW A;  4B1Z A;  1YIJ N;  3R1X A;  1ATS A;  3I56 N;  2C1I A;  4NLB A;  2A42 A;  5AQS A;  1QQM A;  3C0B A;  3O08 A;  5AQP A;  3O1B A;  1YJ9 N;  4JKB A;  5C2D A;  2FSJ A;  3CJ1 A;  3MDQ A;  3P38 A;  4JK7 A;  4OO1 J;  1U2V A;  3MWT A;  1DKG D;  3EE9 A;  5M1O A;  3E66 A;  4KH5 A;  3CCR N;  4BRF A;  1YUW A;  3VES A;  1WUA A;  3WXI A;  4BR2 A;  5AFU A;  1Z6R A;  2YI1 A;  1S72 N;  2YX6 A;  1Q18 A;  3FZH A;  5GAD P;  3F9M A;  5FPN A;  3OBW A;  4JNE A;  5M1K A;  3CCV N;  5I9E B;  3KHY A;  4BRP A;  3CC2 N;  1JJ2 M;  3U4L A;  4JK8 A;  5GAE P;  1IJJ A;  1VQ7 N;  3MN7 A;  3WXJ A;  1X9J A;  4IFE A;  2VGM A;  5GAH P;  3VGL A;  3KVG A;  5AQZ A;  3C65 A;  4WQ5 C;  3WEE B;  1K8K B;  1NLV A;  3HOS A;  3LDO A;  4FSV A;  4FWP A;  3CQX A;  5M1Q A;  4NB4 A;  3LL3 A;  4Z94 A;  5F0X A;  4J8F A;  1QHA A;  4U7B A;  3U8X A;  3FZM A;  3O4W A;  3M6G A;  3K9K A;  4EHT A;  2QEX N;  3CCQ N;  4K41 A;  2GWK A;  3A5L C;  4JD2 A;  3D2F B;  1K9M O;  1KC8 O;  1SZ2 A;  5FPE A;  3O9S A;  4DHY A;  4A5A A;  3CPE A;  4FPA A;  5AQJ A;  3BF3 A;  1ATR A;  1S3X A;  4WCE L;  2IVP A;  3G25 A;  3WXK A;  1P8Z A;  2VWB A;  3CER A;  4IO9 L;  1YIT N;  3SLC A;  4C1N K;  1NGD A;  1HX1 A;  3SMP A;  4BEC A;  3QB0 A;  4B1W B;  3CCE N;  4ILH A;  3IDH A;  3T69 A;  3E1Y A;  1BDG A;  3M1F A;  1KAY A;  1JCF A;  3DAW A;  5AQR A;  1XC3 A;  2QA4 N;  2W40 A;  1VQK N;  1GLJ O;  4OPA A;  4H5R A;  4BC3 A;  5BRH A;  3UKU B;  4JHD B;  4DB3 A;  5AQH A;  3ENO A;  2BH1 A;  4FWR A;  4XH5 A;  3J7Z O;  4BEB A;  3HBT A;  3LM2 A;  3TSQ A;  5LJW A;  1MWK A;  3TSU A;  1JCG A;  2P9L B;  5AR0 A;  4B1U B;  4BR4 A;  3DLL L;  1C0F A;  2GTD A;  3R6M A;  2PBD A;  1NJI O;  2NLX A;  4H0V B;  4CBX A;  3TTF A;  2ZJP L;  2HBK A;  2NRV A;  1NBW A;  4BRD A;  4PKI A;  2NNW A;  1GLC G;  3R3L A;  4FO0 A;  1HKB A;  3VGK A;  4BVP A;  3WXM B;  1QVF M;  4XJX A;  3W0L A;  1TUU A;  2NRR A;  3DJC A;  1YHQ N;  3FZF A;  1R59 O;  3FLC O;  4WYB A;  3CIP A;  4YOU A;  2P9P B;  4ILG B;  2PAV A;  3E9P A;  1MWM A;  4U67 L;  1TYQ B;  5GIP A;  1NGG A;  2GEM A;  3KWI A;  5EX5 A;  1RFQ A;  2FF6 A;  1SQK A;  3HTV A;  4FWS A;  5DM6 L;  3WQT A;  3WEE A;  1K8K A;  2E2O A;  4IOX A;  3O9R A;  4M7Y A;  2E2N A;  2EWS A;  1BA0 A;  2A3Z A;  3D7E O;  5ELZ A;  1SAZ A;  3IUC A;  3OHR A;  5HOO A;  3CC7 N;  4EIA A;  3J8A A;  5JLH A;  3NMU A;  5AQI A;  3DXK B;  5M1P A;  4B1V A;  3D2F A;  1YI2 N;  3D2E A;  3R8E A;  4H5T A;  4XEI A;  2ZGY A;  4H0X B;  4CD3 A;  4IWV A;  3NVK A;  4GV6 A;  5M1N A;  4BQL A;  3MX5 A;  1BG3 A;  3OA9 A;  5BPN A;  1VQO N;  3CCS N;  2FLO A;  3VF2 A;  3C7N B;  3EZW A;  4BRK A;  4A59 A;  2YCH A;  5EOY A;  2NRW A;  2KKZ A;  2A6A A;  4NLC A;  2I7N A;  1XUP O;  4FPB A;  3HM8 A;  4QS9 A;  1T6C A;  1Z05 A;  5EVZ A;  3KWG A;  4YOX A;  4CZG A;  1VQL N;  2E20 A;  1NGJ A;  3UKU A;  2ZGZ A;  4JHD A;  5ADX A;  2ITM A;  3H6E A;  5F2R A;  2D0O A;  2NRX A;  3OBY A;  2AP1 A;  4PHT X;  3UKR B;  4BRI A;  2QM1 A;  2P9L A;  4BRN A;  1E4G T;  3HZ6 A;  3ID8 A;  4FWK A;  4GY2 B;  3F2K A;  2IIR A;  3TTD A;  4B1X B;  5FPD A;  3HOT A;  2RE2 A;  2VCP A;  1E4F T;  2JWK A;  3EL2 A;  3CME N;  3ULE A;  4CD1 A;  4BRH A;  4QS7 A;  1DT9 A;  1NGH A;  3NVM A;  5AQK A;  3LDL A;  3O9U A;  3SAF A;  3BF1 A;  1GLD G;  2OTL N;  3SJH A;  1MDU B;  2V7Y A;  2ZF5 O;  4JKF A;  1SS6 A;  3MWP A;  1T3V A;  1HJO A;  2P9P A;  3AAR A;  3R9P A;  4JEP A;  1NGA A;  3P39 A;  1TYQ A;  4BGA A;  3ENH A;  4BRG A;  2RHK A;  4C23 A;  3VGM A;  4IXC A;  1Q7Y O;  1LOT B;  2ZWH A;  4JKA A;  3S41 A;  2JWL A;  1YJN N;  4YDU A;  5JLF A;  3MX2 A;  3QML A;  2GUP A;  3ZET B;  2QWM A;  2P9I B;  4IOA L;  4IZ9 A;  1OVY A;  2VYP A;  2YJE A;  2QWO A;  3ID6 A;  4BRQ A;  4EHU A;  3H46 O;  3H45 C;  1KQS M;  3WUH A;  3HRG A;  4KH6 A;  2HBM A;  2Q0U A;  4FVU A;  3LDN A;  4CZH A;  4CZM A;  3ZX2 A;  2V52 B;  4JKG A;  4A57 A;  2NRZ A;  3VEV A;  1ATN A;  1ZXO A;  2D0P A;  3BEX A;  3MMV A;  4GNI A;  3G71 N;  4CZI A;  1GLF O;  2HBL A;  4A62 A;  1S22 A;  2F7T A;  4CZE A;  2FSK A;  4CZJ A;  3H1V X;  3F5T A;  1D4X A;  5AZJ B;  3MK6 A;  3VEZ A;  3WQU A;  1VQN N;  1WOQ A;  3CJ7 A;  4CBW A;  4G9Z A;  4EAH D;  5KQD A;  4MLE A;  1ZC6 A;  4AM7 A;  4RWT A;  4BRA A;  1VQ9 N;  1YF5 L;  5E26 A;  3PIO L;  3OW2 M;  4K43 A;  2E1Y A;  3UB5 A;  4MO5 A;  3ATV A;  3L0Q A;  1QVG M;  3IFR A;  3EO3 A;  3GL1 A;  5JVH L;  2WC9 A;  2P9N B;  3TU5 A;  1KAX A;  3FZL A;  4H0P A;  3UKR A;  4AM6 A;  2WUS A;  5HL7 L;  1RDU A;  5AQQ A;  4PKG A;  1HUX A;  4GV3 A;  1HKC A;  4BR5 A;  1MA9 B;  4JKD A;  2A5X A;  4E1J A;  5CR4 A;  4PL7 A;  4FWL A;  4YDU C;  3CCM N;  2CH6 A;  3GBT A;  3O9T A;  4HWI A;  5AZI B;  4HTL A;  3T7Z A;  3GE1 A;  3H3N O;  3G6E N;  1O13 A;  3N4P A;  3FZK A;  3K9J A;  3E9L A;  4IO8 A;  3A8Y A;  3CHW A;  2QWN A;  4H0Y B;  2GEL A;  1VQ5 N;  1T6D A;  2D1K A;  4BQZ A;  1BU6 O;  1NGC A;  4YOY A;  4YOW A;  5C0Y A;  4K42 A;  2NRT A;  5AQO A;  2QWQ A;  1M1K O;  3VEY A;  1P90 A;  5E84 A;  4BRM A;  4WQ4 A;  3A5M C;  1HKG A;  1GLE G;  3BP8 A;  3MN5 A;  2WFB A;  3SK3 A;  3CXC M;  4FWO A;  3O8M A;  4LC9 B;  3ZET A;  3CPW M;  1VAZ A;  4H0O A;  5JVG L;  4BG8 A;  2ASO A;  3KK7 A;  4H5N A;  2ZJR L;  4FOI A;  2E2P A;  4NO7 A;  3VPZ A;  2GX9 A;  2CH5 A;  1BOT O;  2OTJ N;  2Q97 A;  2QWR A;  5AQW A;  3KZB A;  3O6W A;  4FOE A;  5DM7 L;  5KPZ A;  3MCA B;  1OKJ A;  2P9U B;  1Q86 O;  4UY8 O;  3RSE B;  3C6A A;  4JAX A;  3CMA N;  4YOV A;  4ISF A;  1JCE A;  1EQY A;  2QWP A;  2F9W A;  5BR9 A;  3O9Q A;  2QXL A;  4IOC L;  3P4I A;  4FWN A;  3D6R A;  2W00 A;  4L3Q A;  5C10 A;  1TUY A;  2A41 A;  3AAP A;  5AZJ A;  4K25 A;  5BN8 A;  3ZEU B;  4MDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...