3DXMA

Structure of bos taurus arp2/3 complex with bound inhibitor ck0993548
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
414
structure length
399
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-related protein 3
publication title Characterization of two classes of small molecule inhibitors of Arp2/3 complex
pubmed doi rcsb
total genus 130
structure length 399
sequence length 414
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3dxmA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxmA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxmA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3dxmA04
3VETA 2Q36A 2AP1A 4CZMA 2QWPA 4YDUC 3SJHA 4A2BA 4HTLA 3LDOA 2BUPA 4BGBA 3O4WA 5BPMA 3WXKA 5JICA 2GTDA 1RGIA 2GWKA 3WT0A 4FWQA 4BR0A 5AQQA 1QZ6A 3BEXA 5E26A 4FOIA 3ZX3A 1TYQB 5B8HA 3MMVA 2Q0UA 2YJEA 1JCFA 4QS9A 2PAVA 3M1FA 1E4FT 3QBWA 3WUHA 4BC5A 4XEIA 4H5WA 1HLUA 3VGLA 2IVOA 3CJAA 5AQXA 3WQUA 1YXQA 1QHAA 4FO0A 1DGKN 4AM7A 3L4IA 3M3ZA 3VEOA 3ZETB 3CJCA 4B1UB 4M7XA 4FL9A 4IZ9A 3H1VX 1BO5O 2ZGZA 3FR0A 2UYTA 4QS8A 4BQZA 2V7ZA 1NGBA 3QFPA 2KHOA 4O8KA 4BR9A 4BR5A 5EX5A 2OANA 4E1JA 4IJAA 5AQLA 4BG8A 2A3ZA 3SMSA 3FE1A 4H0YB 4BRGA 3TU5A 1TUUA 4O5FA 2HMPA 3L6QA 2GELA 4CD1A 3VEZA 3BF3A 4FPAA 3VESA 1D4XA 5AQTA 1YAGA 4FOEA 4BRHA 4CZLA 3IUCA 4YDUA 1ATSA 5AQGA 4ISGA 4H0PA 2Q97A 3HTVA 5AQWA 4BQLA 2YHYA 1NBWA 3MN7A 4JAXA 4MLHA 3H46O 4BVOA 1NGEA 4JHDA 1NM1A 2ASOA 4H0XB 4IJNA 1MA9B 3D2EA 2ZWHA 2CGJA 1JCEA 3VEWA 4BC3A 1J6ZA 1GLFO 5BN9A 1WOQA 2Q2RA 5AQOA 5AQSA 2CGKA 3R6MA 3CI5A 2HF4A 4GNIA 3EN9A 1MDUB 3ENHA 4BRDA 3U8XA 4EHUA 2PBDA 3LL3A 1YUWA 4FWPA 5AQJA 1C0FA 3EZWA 1BUPA 2D1KA 3IDHA 5JLFA 3A8YA 2W41A 5F2RA 5KPTA 3L0QA 2QWQA 2GEMA 4BR2A 4BROA 5JLHA 4JD2A 1U6ZA 2QWOA 1KAXA 4PKHA 4BC2A 2NRHA 4H0VB 2YCHA 3S41A 3EKSA 2J4RA 5KQ8A 1OKJA 3WXLA 2QWNA 2QWRA 4B1XB 1EQYA 4BR7A 4BRIA 3QFUA 4B1VA 4CZKA 3O1BA 1P8ZA 3VEVA 4JHDB 1NGIA 3I33A 3D2EB 2NLXA 3U4LA 3G25A 4H03B 3H1QA 4FWLA 5BN8A 5LJVA 1QQOA 3A5LC 2QM1A 2P9PA 5ADXH 2GWJA 1T6DA 2CH5A 2A42A 3KHYA 3FGUA 4MLEA 4B1ZA 3I8BA 4CBWA 3VGKA 3OHRA 5E84A 3D2FA 5FPMA 1C0GA 4H0OA 4BRLA 3GDQA 4BR4A 1WUAA 4FWMA 4BRKA 5AQYA 1HKCA 3A5OC 1LOTB 3DXKA 4ISEA 1BU6O 3UKUA 3VPZA 2E8AA 3H3NO 3H6EA 4JD2B 4M7YA 2D0OA 2Q1NA 4XH1A 1KXPA 1NGGA 1IJJA 1BG3A 4CZFA 5BPLA 3HZ6A 1HKBA 2IIRA 3LM9A 3B8AX 5ELZA 1GLAG 4H5RA 3WXJA 4EHTA 1MWMA 5AZJA 3GL1A 3SK3A 1T6CA 3GG4A 3JS6A 3O5BA 3QBXA 4MO5A 1NLVA 4DB3A 2FSNA 3EKUA 1GLLO 1S3XA 1T44A 2F9WA 3JXUA 4H5NA 2IVPA 5ADXA 3QMLA 2YHWA 3MN6A 3VF6A 4BRFA 2P9PB 4GY2B 2P9SA 1MWKA 1XUPO 2GUPA 3LDNA 3FZKA 4RTFD 4CBXA 4DHYA 3A0IX 2FF3B 1NGJA 2VYPA 4IWVA 1QQNA 3VENA 1BWFO 3D2FB 5KPRA 2E2QA 4CZJA 1IG8A 3WEEA 3EO3A 3IFRA 5AFUA 2E2NA 3J8AA 3DXKB 1NWKA 5EOYA 3UKUB 5AQKA 3O1WA 2EWSA 5AQZA 5AQRA 1HKGA 1Z6RA 3QICA 3O08A 2Q31A 1ATRA 4BRAA 2P9NA 2ZGYA 4PKGA 3R9PA 1V4TA 2P9KA 3W3DA 3ZEUA 3UKRA 3CQXA 3M6GA 4FPBA 1KAYA 2D4WA 3FZLA 5AZJB 1LCUA 4FWOA 1S22A 4CZGA 2YI1A 4K43A 4K42A 5AQMA 5F0XA 4NB4A 4J8FA 5CE3A 1SZ2A 2YHXA 4DQ8A 1ATNA 2P9SB 5KPZA 1BOTO 4JN4A 3KVGA 4PKIA 2VCPA 4XH5A 4WQ4C 4BGAA 5AQPA 1DKGD 4H0TB 3ATUA 2FSKA 4Y0WA 3WEEB 3VERA 1X9JA 3WQTA 2W40A 5EY4A 3LDPA 3CHWA 3FZHA 2P9NB 4BG9A 2Q0RA 2E2OA 4IXCA 5AQUA 2P9KB 3H45C 3ZEUB 2BTFA 3MN9A 3U9DA 3UKRB 4EAHD 5BREA 2CGLA 4KBOA 5BR9A 4K41A 3P4IA 1NGCA 3BUZB 3CJ9A 3O80A 5AQNA 1XC3A 3DAWA 4CJ7A 4ISFA 3VGMA 3IMXA 2H3GX 5I9EB 1ESVA 3CIPA 2ZF5O 4IO8A 3HBTA 4BC4A 4CD3A 3CQYA 1V4SA 2ASPA 1BDGA 4NO7A 3RSEA 3A5NC 4I6MA 4EIAA 2YJFA 1X3MA 2HOEA 1DEJA 3ENOA 3CETA 5JMVA 1GLJO 5AZIA 3VF4A 1Q18A 3FZMA 5AFUH 1NGAA 4WYBA 3O8MA 2FLOA 3VOVA 3GOIA 4FWRA 1NMDA 4CZHA 3CJ7A 3LDLA 4WQ4A 4BRQA 4B9QA 1RDWX 2QWLA 3UB5A 4CZIA 4XH4A 2P9LA 3ATVA 2ITMA 4QS7A 4FWNA 3KZBA 5BRFA 2CH6A 4BRMA 1NGFA 1HUXA 4M63C 3FLCO 4MO4A 3A5MC 3D7EO 3VEYA 1BA1A 2E1ZA 2ASMA 4JNEA 4FWKA 3GBTA 2FF6A 3CJ1A 4K25A 5KQDA 4RWTA 4B1WB 2P9IA 1G99A 1GLEG 2QWMA 3DWLA 3F9MA 1U2VA 3AARA 2DPNA 1GLBG 5FPEA 3DXMA 4AM6A 5AQIA 5F1XA 4F9OA 1R59O 2F9TA 4L3QA 3MN5A 3RSEB 4I6MB 4H5VA 2A41A 1TUYA 2V52B 4FWSA 2I7NA 5AR0A 1CZAN 3MDQA 5AZIB 3ZX2A 3AAQA 2V7YA 2E20A 1K8KA 3AY9A 1QZ5A 3BP8A 3UE5A 3SMPA 4BVPA 3C0BA 4BRCA 2V51B 4CBUA 3LDQA 3HI0A 1RFQA 3GE1A 4HWIA 3CERA 3ID8A 3BF1A 2P9LB 1GLCG 2IVNA 4RCHA 3FFKB 3W0LA 4WQ5C 5LJWA 1E4GT 1NGHA 1H1VA 2A40A 1BA0A 5LY3A 3CJBA 4PL8A 2QW9A 5BPNA 2FSJA 1HX1A 1X3NA 3MK6A 3LM2A 5AQFA 3U9ZA 3WXIA 1SQKA 4CZEA 4BREA 2P9IB 2WUSA 4A2AA 3O6WA 3VF2A 1YVNA 3AAPA 1U2VB 2A5XA 3ULEA 3C7NA 3DXMB 4CI6A 1HPMA 1KAZA 5BRDA 5FPNA 2P9UA 2NZTA 1ZXOA 2VWBA 2E2PA 5FPDA 2FXUA 3ZX0A 1QQMA 1XQSC 3TPQA 1GLDG 3DJCA 1Z05A 1K8KB 4A61A 4C23A 4EFHA 5BRHA 5TKYA 3HSCA 2E1YA 3MCPA 4B1YB 1ZC6A 2D0PA 2QXLA 2HF3A 4FSVA 1Y64A 1SAZA 1ZBSA 1JCGA 2AA4A 1HJOA 1TYQA 3R8EA 4Z94A 3FZFA 4PL7A 3VEXA 1NGDA 3QB0A 4A62A 3SLCA 3H3OB 4BRNA 2A6AA 3EL2A 4H5TA 2E88A 3ZETA 3C7NB 3ULEB 3QDKA 4WQ5A 3HM8A 4LC9B 5EXWA 4DCHA 2P9UB 5AQVA 5AQHA 5EVZA 4BRPA 2I7PA
chains in the Genus database with same CATH superfamily
2XO7A 3VETA 1N8RO 4CZMA 2QWPA 4H4MA 3P1GA 3LDOA 4DU3A 2C1GA 1S1XA 3O4WA 5JICA 3TAFA 4BR0A 4DQIA 4KHWA 3MMVA 1D9FA 1A5VA 1DTQA 1M1KO 2HHSA 3QBWA 4N56A 3DLLL 4DF8A 2ETJA 3WQUA 2HHQA 1DGKN 3PO4A 3M3ZA 1S9EA 1TL1A 3NMUA 4I7FA 2ZGZA 2P5GA 2GX9A 4BDPA 1YI2N 4DSLA 4BR5A 1WSFA 5KRSA 4DR5K 3G6EN 2IAJA 5AQLA 1RT2A 4BG8A 4MDAA 2HHUA 2X6NA 3MEGA 3QLHA 2BH1A 3CCMN 4J2AA 1I3AA 4FPAA 3CFPA 1D4XA 1WBBA 4DTJA 4U7BA 1ATSA 3K5LA 3TARA 4ISGA 4BQLA 2Q97A 4B3RK 4MLHA 4BVOA 2ASOA 4H0XB 1F21A 3SAGA 4DQQA 2CGJA 2HNZA 1ASUA 1WOQA 1WSJA 2ZD1A 3LDSA 1JLFA 1TKZA 5AQSA 2XY7A 1S5JA 3R6MA 1VSIA 2HF4A 1MDUB 3U8XA 3LL3A 5C2DA 4X64K 1Y97A 4B9UA 3O9QA 3IDHA 3KK1A 3KLEA 3A8YA 3O4QA 5KPTA 2NRXA 3CYGA 3S5TA 3I0SA 2B5JA 1KLMA 5KQ8A 1OKJA 3VA3A 1EQYA 4CJSA 4Z0UA 1VSJA 2VGNA 5HRNA 3QEIA 1P8ZA 1BISA 2YHBA 5DK5A 4FCYA 1VQ5N 4OGEA 4O55A 2NLXA 4OKJA 3LAMA 4M3TA 3J81O 3SPZA 3HO1A 1VSLA 1VQ4N 1G15A 4FZZA 2GWJA 4PA1A 4BE0A 1BI4A 2CH5A 2A42A 5FDLA 1RTHA 1TKTA 1UA0A 4L8RB 2W00A 4OJRA 1DLOA 1C0GA 3HPGA 3AGRA 4FWMA 4ILHA 4BRKA 5AQYA 1HKCA 1QE1A 1Q7YO 1FKPA 2OZMA 3VPZA 3UKUA 4HVJA 3TAPA 3E9OA 4J2DA 1NGGA 3TI0A 1IJJA 3BGRA 4AHSA 3L2UA 3SCXA 1I39A 2HBMA 3B8AX 5ELZA 2D0AA 4H5RA 4FXDA 1VK0A 1MWMA 2QEXN 3AA3A 3CCUN 3SK3A 4DR1K 3AVLA 3J80O 3VTIA 3JS6A 1VAZA 3P38A 5E41A 2FSNA 1S3XA 3JXUA 3DM2A 4H5NA 4CGIA 3QMLA 4M3WA 3VF6A 5CY4A 1MWKA 5I3UA 2GUPA 3LDNA 1BI4B 4CFDA 4J2EA 2GUIA 1IKXA 3VMFB 2FF3B 1RT3A 2VYPA 3SI6A 1QQNA 3VENA 3OYFA 3EO3A 2W6KA 3P83D 2UUCK 4OKEA 1NWKA 3UKUB 3C6HA 4DSFA 2EWSA 4YORA 2BGGA 1T8EA 3L3UA 3DLKA 3ULDA 2Q31A 3QNOA 1ATRA 1BIZA 4BRAA 1XWLA 2HB5A 1V4TA 4O8UA 2C1IA 4HCBA 3R1XA 3RMBA 3O9UA 1TAQA 2VQFK 1D8YA 1SL1A 2OPSA 2P5OA 2YI1A 4K43A 3I0RA 3OYGA 3F5TA 1D9DA 2KZZA 3DMJA 4J8FA 5CE3A 3SYZA 4KB0A 2E6MA 4YNQA 2YHXA 3O9RA 3M8RA 2QK9A 4CJUA 4BGAA 5HRPA 2BDPA 4O5BA 2FSKA 3AA2A 4B3TK 1E3MA 2ZE2A 3MAQA 4QOZB 1NG9A 1UOCA 4FJJA 2ATQA 4FLVA 3CCLN 3FZHA 3ZT4A 4CESA 3HPOA 5AQUA 4IXCA 4YOTA 3MN9A 3CFRA 3T19A 3PO5A 4Z4FA 5BREA 5BR9A 2Z1IA 5J2QA 1UAXA 4AHTA 1KFSA 1NGCA 3BUZB 3O80A 2X6SA 3HRGA 4CJ7A 3NE6A 4ISFA 3VGMA 3AVGA 5I9EB 2IOCA 1YHQN 2HHTA 4E7HA 3CQYA 3KLFA 3J7AP 2O8DA 2G8KA 4NO7A 4B08A 3ENOA 4CE9A 1GLJO 3VF4A 1Q9YA 1Q18A 3FZMA 3CMEN 3V81A 3O8MA 5C42A 1VRTA 1U49A 1KLNA 1RDBA 1IO2A 2FLOA 3VOVA 3QEVA 1VSHA 3LDLA 1C1AA 1B9FA 2OPRA 4B9QA 2FBXA 4KKOA 2QWLA 3UB5A 4DQPA 4XH4A 4IKFA 4JKAA 3ATVA 3K0SA 5BRFA 3K5OA 3KKSA 1HUXA 3FLCO 3L2QA 3ZT2A 1KSPA 5JS1A 3PSIA 3DRRA 3GBTA 2FF6A 4B1WB 4M41A 3G4SN 2QWMA 4JV5K 3F9MA 1GLBG 4F9OA 1R59O 2F9TA 4CJQA 1K73O 4FJNA 3MN5A 2O8DB 4Z4EA 4OLAA 4WFAL 1TUYA 1JLCA 4CEQA 3TWHA 1N36K 1EP4A 3AAQA 2V7YA 3G10A 3BP8A 3P39A 4FM2A 5IWAK 1RT1A 3U3GA 1HNXK 4O0JA 4FLXA 4JK9A 4YFUA 4FJGA 1RBVA 4B3OA 1C0UA 3IRXA 1TAUA 3FFKB 3W0LA 1BL3A 5LJWA 2WOMA 1ZBIA 1VQNN 3OJSA 4KO0A 4GVEA 4F2RA 1OH7A 1BA0A 4BE2A 2F8TA 3MK6A 3LM2A 3RMDA 1SQKA 4CZEA 2WUSA 1ASVA 3VF2A 4XIUA 2A5XA 3ULEA 3C7NA 2XHBA 1RDDA 3ENBA 1HPMA 5BRDA 5FPNA 1JLBA 5HROA 2UUAK 4Y1CA 2E2PA 4AILC 3TPQA 2OPPA 4Z4HA 2OCEA 1VSMA 3HP6A 2I5JA 3PSFA 5TKYA 2E1YA 4DFKA 4B1YB 3VN5A 3TSPA 1ZC6A 2D0PA 2QXLA 2P1JA 1VSEA 1RDCA 1SAZA 5C10A 1DT9A 4E7KA 3L4QA 4HTUA 2HHXA 4PL7A 2HBKA 4QAGA 1YJNN 4Z4IA 4OX9K 4FJHA 1Q81O 1K6YA 3KD1E 4ELVA 2D0CA 3ZETA 4IOCL 3C7NB 3ULEB 3SUNA 2OYQA 1IG9A 5EXWA 3O9SA 3QEWA 4U67L 4A5BA 2Q36A 4YOXA 4CF0A 3HT3A 4HTLA 4DMNA 2G8FA 4BGBA 3LWMA 4C1NK 1RGIA 1YT3A 3WT0A 1RTIA 4WFNL 1QZ6A 3C65A 2KTQA 1J5OA 1QVGM 3CYMA 2Q0UA 2NUBA 2YJEA 4QS9A 3OYNA 4KI4A 4BC5A 1TKXA 4HUGA 3NVKA 4H5WA 5GADP 2IVOA 3CJAA 4JLHA 1NOZA 4FO0A 4CK1A 1ITGA 4AM7A 4M3YA 1NJWA 3NBPA 3ZETB 4B1UB 1JXEA 4CEDA 4DS4A 1X9WA 1BO5O 3FR0A 2QKBA 4JS4A 3SQ0A 1TGOA 4BQZA 2V7ZA 4BR9A 4NXMK 2OANA 4E1JA 1IBMK 4F3OA 4IJAA 4OKKA 4FJ7A 2F96A 5CYQA 2A3ZA 5J2PA 3FE1A 2HNDA 3TU5A 4CF1A 4CECA 2HMPA 4C1NI 4JI4K 4FLTA 1EWRA 3MWTA 5AQTA 5LMNK 4FOEA 3DOLA 3AVAA 4CF8A 1J53A 2O4IA 4FJMA 3AV9A 3HTVA 1OH8A 3CG7A 2OTJN 1WB9A 3H46O 4JHDA 3RR7A 4NCBA 3D2EA 1HYVA 3NGIA 4FK4A 4BC3A 2Q2RA 2GV9A 3TSQA 4CJEA 4FM0A 3CI5A 3F2KA 2PYJA 2DFHA 4R79A 3MXMA 2OPQA 3G71N 4DQSA 4EHUA 4E7JA 4JKBA 2HVHA 4FWPA 1HMVA 4FK0A 3EZWA 1VSDA 2D1KA 4FLWA 1ZBFA 4DR3K 2F8SA 3TSUA 4AHRA 4BR2A 1JL2A 4LSLA 4BROA 3PUFA 3OYKA 1L5UA 4YOWA 4DV1K 2NRHA 5J2NA 3ZCMA 4FJLA 3E01A 3WXLA 2XY8A 3CM6A 4CJRA 1QSLA 4BRIA 3ID6A 3QFUA 4CJTA 5JVGL 2Y1IA 3VEVA 4JHDB 1NGIA 4ILGB 3D2EB 1BIUA 3AO3A 4JEPA 4FM1A 1SKWA 3H1QA 4X65K 3MEDA 5C2FA 3WXMB 1QQOA 2OA8A 4NXNK 2YNHA 5ADXH 2D5RA 2DY4A 3KHYA 4MLEA 4IFVA 4DV7K 5SWMA 3QO9A 3VGKA 5M1PA 5E84A 5FPMA 4ZTFA 4DV6K 3SBGA 4BR4A 1WUAA 4CW7B 2IS3A 3A5OC 5KGWA 1LOTB 1GOAA 5GINA 4W5QA 2E8AA 4M7YA 2Q1NA 4XH1A 1IKYA 4I2QA 5T7BA 1KXPA 1NK9A 3HZ6A 1W2BM 2JWKA 4E7IA 3HPHA 4H8KA 4EHTA 4WCEL 3ALYA 3L2RA 3O5BA 2NRTA 5CR4A 1GLLO 2F9WA 2IVPA 4RW8A 4BRFA 3EE8A 1HQEA 1FK9A 2VQEK 2KFZA 3FZKA 5DM7L 4DHYA 2PYLA 1QVFM 4YOVA 1VQKN 4CJ3A 1J9AA 4IWVA 3CPWM 2E2QA 1IG8A 1JLAA 4JKCA 3RMCA 3SPYA 3UIQA 4CJ5A 3KWGA 5AFUA 1LWEA 1RILA 3LPUA 5AQKA 1HKGA 1Z6RA 5GAHP 3CXCM 3O08A 2DFEA 3NDKA 1WAJA 3I55N 1K9MO 4HHTA 3M6GA 4FPBA 1WSGA 1KAYA 1I94K 1FJGK 1XI1A 1HNWK 4ELTA 2ZJRL 1S22A 4CZGA 4KTWA 4LH4A 2KLAA 5MLCQ 4KPYA 4BE1A 1JLGA 1RT6A 1JKHA 1RDAA 4JI1K 3O9TA 1BOTO 3KVGA 3CFOA 2VCPA 1W7AA 2F7TA 4RG8A 1O1WA 4KV8A 3HVRA 4Y0WA 1VQMN 3WQTA 1NJZA 4DR7K 4JI8K 3LDPA 3WNHA 3CHWA 2DTUA 1X9MA 4M42A 2BTFA 3U9DA 4RW6A 4B9TA 4KBOA 1TV6A 5CZ1A 4K8XA 2X78A 3V1QA 4IEIA 3P4IA 4CHNA 4PY5A 2YNFA 4DV0K 3DRPA 3G0ZA 3MEEA 3PIPL 5AQNA 1XC3A 3OS2A 3DAWA 1VQ6N 4N41A 4FLUA 1EO1A 2H3GX 1U45A 2HHIA 1ESVA 4IO8A 3HBTA 4BC4A 2HHHK 3LANA 4FJKA 1SL2A 4TSXA 1OH6A 1BDGA 3CCVN 1WLJA 4EIAA 2YJFA 1EX4A 2HOEA 1DEJA 2VWKA 3E9PA 4DLEA 3J7ZO 4LFBK 5AFUH 4B9NA 3L3VA 3KK2A 2FC0A 3THXA 3V1OA 4FWRA 4CERA 3OY9A 4EZ9A 4NCGA 1N6QA 1LWCA 3ITHA 4CIFA 2EX3A 2ITMA 4O4GA 4PQUA 3DLBA 2CH6A 4CJLA 4M63C 1XHXA 4MO4A 3VEYA 1FXXA 4CJFA 4FWKA 3AVIA 4CF2A 4RWTA 4O0IA 5AJ3K 2P9IA 4AHCA 4GKKK 3AARA 4B9LA 2DPNA 3MWPA 5FPEA 5F1XA 4AM6A 4BE7B 3R3LA 3OYBA 1R0AA 2O8EA 5DM6L 4H5VA 2A41A 4FWSA 3LALA 3IAYA 3ZYYX 3CCEN 2UXBK 4CJKA 1CZAN 3CC2N 3AVKA 4FJ9A 1K8KA 3SMPA 3OBWA 4DR6K 3THXB 4BRCA 4ZHRA 4N47A 4Q5VA 4CBUA 2KW4A 4EZ6A 3RVCA 1RFQA 1YVUA 4B9MA 3C6TA 3CERA 3ID8A 2IVNA 2A1RA 1HPZA 4WQ5C 3AVNA 3ASMA 5D3GA 1OH5A 2YNIA 4CEZA 1U04A 3CJBA 4PL8A 2QW9A 5C25A 3KLGA 2FSJA 1X3NA 3NFAA 4CFAA 3NH1A 2P9IB 4AHUA 3QEXA 4FZXC 1HRHA 3O6WA 1VQ8N 1HNZK 4IDKA 4CI6A 2RE2A 3KTQA 3NF7A 1T03A 1KAZA 1KFDA 2P9UA 2O8EB 2NZTA 4KH5A 4E72A 4DSJA 1RT5A 5KI6A 4GKJK 2VWBA 3ZSOA 1ZBLA 4DTNA 3RRHA 1GLDG 4DV2K 3DJCA 3V9SA 4A61A 1K8KB 3VQ5A 1WSIA 1RCHA 1MU2A 1SKSA 1LW2A 4CJWA 4E89A 4KFBA 4DG1A 3TABA 4RW4A 2YNGA 2KZMA 4KH6A 4UY8O 1YTUA 1BQMA 1TYQA 3NHGA 3QIPA 3FZFA 1HJRA 1N5YA 1B92A 3KWIA 2HW3A 1NGDA 3E66A 4X62K 4PHTX 3Q7CA 3SLCA 3LAKA 4IBNA 5DMRA 3T1YK 1IKWA 3KD5E 3OYIA 2A6AA 3EL2A 4BWMA 3DRSA 2GBZA 3O3GA 3D0PA 1RTJA 3K5NA 3QDKA 5HP1A 3RR8A 3HM8A 2VG5A 3HL8A 2P9UB 4E1MA 2NNWA 4CK3A 3TAEA 4BRPA 4CGHA 2AP1A 1K8AO 3NH0A 4YDUC 3SJHA 4F3TA 1HNVA 3SUPA 4LFCK 1P90A 4A2BA 5HRSA 2HHWA 5M1QA 1A5WA 2O8FA 4RW9A 1ILYA 3WXKA 2GWKA 1S1VA 1D5AA 4FWQA 4M3ZA 3KLHA 3OTOK 3BEXA 5E26A 4FOIA 4A5AA 5FROA 1TYQB 5M1FA 4KAZA 4GVMA 4C8NA 1JCFA 2PAVA 3M1FA 4B9VA 2BANA 2Z1JA 3WUHA 3MXJA 1HLUA 4V19S 4BY9C 1YIJN 5AQXA 3OBYA 3AO1A 1YXQA 1QHAA 4W5NA 1L3SA 3L4IA 3VEOA 3CJCA 5JENA 4FL9A 4IZ9A 4C8MA 1NK4A 3TAQA 3VA0A 3WNFA 2UYTA 4QS8A 3SV3A 4O8KA 4OGCA 2RF2A 4DFJA 2X74A 2G8HA 3M8PA 1W0HA 3Q7BA 3V9UA 3IKMA 5GAEP 5CHIA 4BRGA 4H0YB 2O8FB 3PIOL 4PWDA 4CGFA 1WN7A 4O5FA 3VEZA 3AO2A 3BDPA 3RRGA 2QA4N 1KVAA 4LF8K 1YF5L 3MECA 4BRHA 3TTCA 5AQGA 4YY3K 2IGIA 4H0PA 5AQWA 4KHNA 2YHYA 1NBWA 2B4JA 3L8BA 1VHXA 4KI6A 2ZWHA 3KK7A 4B8AB 3VEWA 3VQDA 4JI6K 2HHVA 1GLFO 4E3SA 3N4PA 1TKDA 2KKZA 3EN9A 1NK8A 3T7ZA 3LWLA 3T69A 4KTQA 4GMJB 4FVUA 1C0FA 2E4LA 4W5RA 1TK0A 5JLFA 3C6AA 4GV3A 2B6AA 2PZSA 2W41A 3V9ZA 5C0YA 1NMNA 4ICLA 4H4OA 3OA9A 5JLHA 3DYAA 3LP3A 4F8RA 4JD2A 2QWOA 2W6LA 3ZT3A 4BC2A 4H0VB 2YCHA 2J4RA 2QWNA 1A5XA 2QWRA 4B1XB 2G8WA 4JI5K 1WAFA 4CFBA 2HMIA 1GOBA 4B1VA 4CZKA 3JSMA 2LSNA 3OS0A 4NYNA 2ITGA 3HSTB 4I9QA 5LJVA 3PLAA 4CHOA 1SV5A 3J7YP 2QM1A 4OVLA 2P9PA 1YITN 1BGXT 1T6DA 3LZJA 3OYJA 1JLEA 3FGUA 3I8BA 3KIOA 4NLBA 1JXBA 3AVCA 2YHAA 3D2FA 3QETA 4H0OA 3GDQA 2W42A 3SAFA 4DV3K 4ISEA 3DXKA 1LW0A 2WBNA 4FJXA 3H3NO 4JD2B 3H6EA 2D0OA 3QERA 4JI7K 3VQEA 3CMAN 3VQPA 4CZFA 5BPLA 4IOXA 3LM9A 1HKBA 2IIRA 4EP4A 3U3YA 1GLAG 4WFBL 4IFEA 3WXJA 5AZJA 4Z4GA 3GL1A 4DUYK 3QBXA 1NLVA 3EKUA 2XY6A 5ADXA 1RBUA 4WF9L 3SBTA 4DTOA 2YHWA 2P9PB 4GY2B 4JK8A 1XUPO 5HLFA 3N4QA 4DQRA 4DF4A 4M3XA 3A0IX 3HXMA 1T3VA 3OW2M 2NRWA 3HYFA 1BWFO 2DFFA 3D2FB 5LMUK 5KPRA 1NK5A 4CZJA 3WEEA 1C6VA 3IFRA 4BWJA 4AQYK 2E2NA 4B9SA 3DXKB 3VQCA 4DR2K 3O1WA 5AQZA 5AQRA 3TANA 3QICA 4HCCA 1OVYA 4KHSA 2P9NA 4IEEA 4IO9L 2ZGYA 4PKGA 3R9PA 4YOUA 2P9KA 1KRPA 4KHQA 3W3DA 3DLHA 3LPTA 3CQXA 1LV5A 2VWJA 5AZJB 2YKMA 1LCUA 4FWOA 5F0XA 5AQMA 4K42A 3KK3A 3B6PA 4WE1A 1NU0A 2WONA 4CEFA 3HP9A 3B6OA 4NB4A 1J54A 1S1UA 4ID1A 4DQ8A 1U48A 3OYLA 1YJWN 1ATNA 2HSTA 4WQ4C 2QI2A 2VG7A 4JKDA 1WSHA 4E0DA 1DKGD 3ZSVA 3ATUA 3SUOA 1QQCA 2F4VK 4BEBA 3WEEB 2HBLA 2ZJQL 1X9JA 4FLYA 2W40A 4LF9K 5EY4A 1CZ9A 4CF9A 4E1NA 4NCAA 4JS5A 3D45A 3MXIA 2P9NB 4BG9A 2Q0RA 2E2OA 3ISNC 2P9KB 2RHKA 1QSSA 1T7PA 2FBYA 1VSFA 2KFNA 4K41A 4B8CA 5A2QO 4M45A 4DKWA 2AJQA 5SZTA 3EYZA 3MX2A 3CIPA 2ZF5O 2XRIA 1L3VA 4FVMA 3HVTA 4CD3A 4OPJA 4GV9A 3F73A 2ASPA 3RSEA 4NLCA 2Q3SA 5JMVA 1U4BA 1Q9XA 3C6UA 4DTMA 1NGAA 3OS1A 4M3RA 4DU1A 2JGUA 2O4GA 3VQQA 1NMDA 4CZHA 3T3FA 3CJ7A 1HQUA 5LL6Z 1WBDA 4CZIA 4XJXA 3QESA 4DFMA 2UUBK 4JK7A 4QS7A 1RBRA 1GOCA 4BRMA 1NGFA 1RBTA 4HUEA 4K8ZA 3D7EO 3WNEA 4JNEA 2ASMA 4IG0A 3THYA 4LF5K 3SUQA 4F2SA 1G99A 1U2VA 4Z4CA 4JRPA 3DXMA 1S1WA 5AQIA 4X66K 1SUQA 5C24A 3LZIA 4L3QA 3RSEB 2V52B 3PX6A 4FLZA 3KLIA 3UE5A 1C1BA 1RBSA 3C0BA 2V51B 1C0MA 5CYMA 3CCRN 2FBVA 3HI0A 3GE1A 3P5JA 1RT7A 3SZ2A 2UU9K 1X1PA 1J5EK 1KVCA 3L2VA 4RCHA 3RWUA 3LP1A 2EHGA 1H1VA 2OTLN 1OVQA 3CC4N 1C1CA 3CCSN 5LY3A 3THYB 5BPNA 3NGZA 1IKVA 1HX1A 3U9ZA 3WXIA 1KTQA 4BREA 5HOOA 1RDUA 4GW6A 4BDZA 1YVNA 5H1SQ 3AAPA 1U2VB 1BCMA 3ZSYA 3DXMB 3U6FA 3M8QA 3DLRA 3JYTA 2HVIA 3AGKA 3AVJA 3NF6A 4BDYA 2FXUA 3ZX0A 4AH9A 1XQSC 3TTDA 4R5PA 1N33K 1Z05A 5JVHL 2Y1JA 3OVNA 1EXQA 4CHPA 4EFHA 3HSCA 3MCPA 5GAGP 1LAWA 3AVBA 3K9KA 2HF3A 1Y64A 2YX6A 2XY5A 2AA4A 3ZT1A 3KKRA 3E9LA 3RTVA 4DU4A 1ASWA 5CZ2A 2FBTA 1NNEA 1BHLA 4A62A 3AVMA 4IOAL 4DFPA 2NRZA 2WTUA 2E88A 4F4KA 3NCIA 4WQ5A 2UXCK 3S3NA 1QHTA 4LC9B 4AHVA 1VRUA 4DCHA 1T05A 3VQ6A 5AQVA 1CZBA 2I7PA 1ZBUA 3ZLJA 3I8DA 3VQBA 2KQ2A 4DSEA 2BUPA 1TK5A 5BPMA 4DV4K 2GTDA 5AQQA 4CJ4A 4CJVA 4IDHA 5J2MA 3ZX3A 5B8HA 3DLEA 3EE9A 1E4FT 4XEIA 4A57A 3CPEA 3VGLA 1ZYQA 3BZKA 4NYFA 2ZM6K 4KTZA 1DTTA 4M7XA 3H1VX 4OPHA 4IFYA 2OZSA 3O4NA 1NGBA 3QFPA 2KHOA 5EX5A 1XNRK 4W5TA 3SMSA 4LH5A 1TUUA 4CCHA 3L6QA 4CGJA 2GELA 4CD1A 3BF3A 3PX0A 3ZSRA 1SL0A 3L2WA 4J2BA 3VESA 1NKEA 2ZJPL 1X9SA 1YAGA 2NRVA 3CM5A 4JI0K 4CZLA 3IUCA 3TTFA 4YDUA 1LWFA 3QNNA 4YHHK 1UA1A 4JI3K 3MN7A 4Y1DA 4DTPA 4JAXA 1NGEA 1NM1A 4IJNA 4E19A 2QXFA 1MA9B 1W97L 4OLBA 1JCEA 1ZBHA 1Z25A 1J6ZA 5BN9A 1JJ2M 5AQOA 3QIOA 2CGKA 1NOYA 4GNIA 4FW2A 3ENHA 3THWA 4BRDA 1HYSA 1JL1A 2PBDA 1YUWA 4DWIA 5AQJA 3M8SA 4M3UA 4DR4K 1BUPA 3SAHA 3VQAA 4G1QA 3THVA 5F2RA 2D0BA 3SNNA 4DSKA 3L0QA 2QWQA 2GEMA 2UXDK 3D6RA 1U6ZA 2WC9A 1KAXA 3NGYA 4PKHA 3S41A 3EKSA 4FK2A 2JLEA 1S1TA 4FJIA 4JYAK 5GIOA 4BR7A 4K0KK 5GIPA 4KHPK 3O1BA 1FW6A 1B9DA 3JAMO 1WNSA 3I33A 5TKWA 1EETA 4DTXA 1CXUA 3U4LA 5HL7L 3ZSXA 3G25A 1N34K 4AF1A 4H03B 1EWQA 4FWLA 5BN8A 4LF4K 1QSYA 3A5LC 1HNIA 4BACA 4JKEA 5HRRA 4N5SA 4YOYA 3TAGA 3THWB 4B1ZA 4MFBA 5I42A 1TVRA 1KQSM 4CBWA 4W5OA 3CC7N 3OHRA 1KCFA 4BECA 5J1EA 4BRLA 1QS4A 3CCQN 1IH7A 2RKIA 3NF9A 3CF5L 3TR8A 1BU6O 3WNGA 3DOKA 3AA5X 4DV5K 2WFBA 2O8CA 1VQLN 5K14A 1BG3A 1KC8O 4OPAA 4O44A 4E7LA 3C94A 3LP2A 4RW7A 1REVA 1W9HA 5C12A 1T6CA 3GG4A 1JLQA 4MO5A 3NVMA 3AO4A 3FFIA 4DB3A 4N76A 4MDBA 1T44A 3BZCA 1TL3A 4CVNE 4FZYA 3K9JA 4EP5A 3MN6A 3VQ7A 2P9SA 1VQ9N 3I56N 4I2PA 2YV0X 4RTFD 4CBXA 1NJXA 4DSIA 3P31A 1NGJA 1YJ9N 3SJJA 3AO5A 1VQON 3HM9A 2RN2A 4KREA 4FW1A 1NK6A 3OYHA 1SKRA 3J8AA 5EOYA 4CGDA 3K2PA 2O8CB 3S9HA 1XHZA 4DTUA 1TK8A 2PY5A 1RNHA 3IG1A 3ZEUA 3UKRA 1NK0A 4JI2K 2D4WA 3V4IA 1C0TA 3FZLA 1NKBA 4LD0A 1Q82O 4I9LA 1Q86O 3K59A 1Q8IA 3K5MA 1SZ2A 5C15A 2JWLA 2P9SB 4ILJA 5KPZA 4JN4A 4PKIA 4XH5A 3V9XA 4DTRA 5AQPA 4CIEA 4OO1J 4FJ8A 2IC3A 1LAVA 1FKOA 4H0TB 5HBMA 1KVBA 5FRMA 3BY5A 4CEEA 3VERA 2QKKA 2G8IA 4CHYA 3PV8A 3MCAB 1O13A 3OYEA 1XMOK 5IT9O 2P51A 4C8LA 4DUZK 3DI6A 1HR0K 2IDOA 4IG3A 3H45C 3ZEUB 1YTAA 4EAHD 4ZTJA 3UKRB 1S9GA 1S72N 1UWBA 1NJIO 1IV0A 2VG6A 2CGLA 4CHQA 3HOSA 4B3SK 1XMQK 1U47A 3O3HA 2YKNA 5FRNA 5KTQA 1CXQA 3A2FA 2PFUA 3CJ9A 3V1RA 5M1KA 4LSNA 3EZ5A 2Z1HA 4DS5A 4LF6K 3IMXA 1KD1O 4KB1A 1CLQA 1XNQK 3SQ1A 1Z26A 2BE2A 4HUFA 3QINA 1VQPN 4KHYA 3EEQA 5FLXO 1SS6A 3OYMA 1V4SA 2E5LK 3LP0A 2HBJA 3A5NC 4I6MA 3ZSQA 1X3MA 1XC9A 5JS2A 1L3UA 3CETA 5M1OA 5AZIA 4ELUA 2HNYA 4WYBA 1EKEA 3S3MA 4MQ3A 4LF7K 2QTDA 3GOIA 4CFCA 5BR8K 4OPKA 4WQ4A 4BRQA 2R7YA 1RDWX 2P9LA 1S6QA 3OJUA 4FWNA 3KZBA 4GV6A 1IBLK 2A1SA 3PY8A 3A5MC 2ZQBA 1BA1A 2E1ZA 3CJ1A 4K25A 5KQDA 3SV4A 3CD6N 1GLEG 3DWLA 1VSKA 3VTHA 4CEAA 1NKCA 3DLGA 3ZSZA 3OYCA 4QCLA 4CHZA 4Q0BA 1HYZA 1RT4A 4I6MB 4JKFA 4CK2A 2I7NA 5AR0A 3MDQA 3E1YA 5AZIB 3ZX2A 2E20A 3AY9A 1QZ5A 4JKHA 3QEPA 3NAEA 4BVPA 4C8OA 4C8KA 4DLGA 4G9ZA 5KRTA 3LDQA 4HWIA 4CGGA 3V6DA 3BF1A 4CJPA 5M1NA 2O8BA 1BCOA 2P9LB 4CEBA 5KGXA 3K57A 1GLCG 3IS9A 3C95A 1E4GT 1NGHA 3K58A 2A40A 1IBKK 3AVHA 4LY7A 4FYDA 3ZSWA 2VGMA 3S3OA 5AQFA 4KHUA 1VQ7N 4A2AA 1BQNA 2NRRA 3RMAA 4JKGA 1L3TA 3M5RA 3NF8A 1ZXOA 4ID5A 2Z1GA 3AA4A 5FPDA 3NH2A 3HJFA 1QQMA 4DTSA 3O3FA 3OYAA 3ZT0A 3T1HK 3HK2A 4UQGA 1S6PA 4C23A 3MX5A 1WSEA 5BRHA 3HOTA 4PUOA 3CCJN 3PX4A 3VQ9A 1RTDA 3TAMA 5EU7A 2O8BB 3H08A 3SQ2A 4KRFA 4FSVA 3VQ8A 3CQ8A 3R8EA 1JCGA 1ZBSA 1HJOA 2G8UA 4Z94A 3V9WA 4LFAK 1N32K 3VEXA 3QB0A 3AVFA 3VQ4A 2G8VA 4B3MK 3T1AA 3H3OB 4BRNA 3F9KA 3EY1A 3SQ4A 1QTMA 4JRQA 2E6LA 4CEOA 4H5TA 2RPIA 4FJ5A 1NK7A 3KJVA 3OYDA 1M90O 4JKGB 4CIGA 1NJYA 5AQHA 4A59A 5EVZA 4KH4A
chains in the Genus database with same CATH topology
3VETA 1N8RO 4A5BA 2Q36A 2AP1A 4YOXA 4CZMA 1K8AO 2QWPA 4YDUC 3SJHA 1P90A 4A2BA 4HTLA 3LDOA 2BUPA 5M1QA 2C1GA 4BGBA 3O4WA 5BPMA 1ILYA 3WXKA 4C1NK 5JICA 2GTDA 1RGIA 2GWKA 3WT0A 4FWQA 4BR0A 5AQQA 4WFNL 1QZ6A 3BEXA 5E26A 4FOIA 4IDHA 3C65A 3ZX3A 4A5AA 1TYQB 5B8HA 5M1FA 1QVGM 3MMVA 2Q0UA 2YJEA 1JCFA 4QS9A 3EE9A 2PAVA 3M1FA 1M1KO 1E4FT 3QBWA 3WUHA 4BC5A 4XEIA 4A57A 3NVKA 3CPEA 4H5WA 3DLLL 1HLUA 3VGLA 5GADP 2IVOA 3CJAA 5AQXA 1YIJN 3WQUA 3OBYA 4BY9C 1YXQA 1QHAA 4FO0A 1DGKN 4AM7A 3L4IA 3M3ZA 3VEOA 3ZETB 3CJCA 4B1UB 4M7XA 4FL9A 3NMUA 4IZ9A 3H1VX 1BO5O 2ZGZA 3FR0A 4OPHA 2GX9A 2UYTA 1YI2N 4QS8A 4BQZA 2V7ZA 1NGBA 3QFPA 2KHOA 4O8KA 4BR9A 4BR5A 5EX5A 2OANA 4E1JA 4IJAA 3G6EN 5AQLA 3Q7BA 4BG8A 4MDAA 3IKMA 5GAEP 5CHIA 2A3ZA 3SMSA 3FE1A 4H0YB 4BRGA 3PIOL 3TU5A 1TUUA 4O5FA 2BH1A 2HMPA 3L6QA 3CCMN 2GELA 4C1NI 4CD1A 3VEZA 3BF3A 4FPAA 3VESA 1D4XA 2QA4N 2ZJPL 3MWTA 1YF5L 5AQTA 1YAGA 2NRVA 4FOEA 4U7BA 4BRHA 3TTCA 4CZLA 3IUCA 3TTFA 4YDUA 1ATSA 5AQGA 4ISGA 4H0PA 2Q97A 3HTVA 5AQWA 4BQLA 2YHYA 1NBWA 3MN7A 2OTJN 4JAXA 4MLHA 3H46O 4BVOA 1NGEA 4JHDA 1NM1A 2ASOA 4H0XB 4IJNA 3SAGA 1MA9B 3D2EA 2ZWHA 1W97L 2CGJA 1JCEA 3KK7A 3VEWA 4BC3A 1J6ZA 1GLFO 5BN9A 1WOQA 2Q2RA 1JJ2M 5AQOA 3TSQA 5AQSA 3N4PA 2CGKA 3R6MA 3CI5A 2KKZA 2HF4A 3F2KA 4GNIA 3EN9A 1MDUB 3ENHA 3T7ZA 4R79A 3G71N 3T69A 4FVUA 4BRDA 3U8XA 4EHUA 4JKBA 2PBDA 3LL3A 1YUWA 4FWPA 5C2DA 5AQJA 1C0FA 3EZWA 1BUPA 2D1KA 3SAHA 3O9QA 3IDHA 5JLFA 3C6AA 4GV3A 3A8YA 2W41A 5F2RA 5KPTA 2NRXA 5C0YA 3TSUA 3L0QA 2QWQA 2GEMA 3OA9A 4BROA 4BR2A 5JLHA 3D6RA 4JD2A 1U6ZA 4YOWA 2QWOA 1KAXA 2WC9A 4PKHA 4BC2A 2NRHA 4H0VB 2YCHA 3S41A 3EKSA 2J4RA 5KQ8A 1OKJA 3WXLA 2QWNA 2QWRA 4B1XB 5GIOA 1EQYA 4BR7A 4BRIA 3ID6A 2VGNA 3QFUA 5GIPA 4B1VA 4CZKA 5JVGL 3O1BA 1P8ZA 3VEVA 4JHDB 1NGIA 4BRPA 3I33A 1VQ5N 4ILGB 3D2EB 5TKWA 2NLXA 3U4LA 5HL7L 4JEPA 3G25A 5GINA 4AF1A 4H03B 3H1QA 4FWLA 5BN8A 5LJVA 1VQ4N 5C2FA 3PLAA 3WXMB 1QQOA 3A5LC 2QM1A 2P9PA 1YITN 5ADXH 2GWJA 4JKEA 1T6DA 2CH5A 2A42A 3KHYA 4YOYA 3FGUA 4MLEA 4B1ZA 3I8BA 4NLBA 1KQSM 4CBWA 3CC7N 3VGKA 3OHRA 5E84A 5M1PA 2W00A 3D2FA 5FPMA 4BECA 1C0GA 4H0OA 4BRLA 3CCQN 3GDQA 3AGRA 3SAFA 3SBGA 4BR4A 1WUAA 4FWMA 4ILHA 4BRKA 3CF5L 5AQYA 1HKCA 3A5OC 1Q7YO 1LOTB 3DXKA 4ISEA 1BU6O 2WBNA 3UKUA 3VPZA 2E8AA 3H3NO 3H6EA 2WFBA 4JD2B 4M7YA 2D0OA 2Q1NA 4XH1A 3E9OA 1VQLN 3CMAN 1KXPA 1NGGA 1IJJA 1BG3A 4CZFA 5BPLA 4IOXA 3HZ6A 1HKBA 2IIRA 3LM9A 1KC8O 2HBMA 3B8AX 4OPAA 1W2BM 5ELZA 1GLAG 4WFBL 2JWKA 4H5RA 4IFEA 3WXJA 4EHTA 4WCEL 1MWMA 5AZJA 3GL1A 2QEXN 3CCUN 3SK3A 5C12A 1T6CA 3GG4A 3JS6A 3O5BA 3QBXA 3VTIA 2NRTA 1NLVA 1VAZA 3NVMA 3P38A 4MO5A 4DB3A 4MDBA 2FSNA 3EKUA 1GLLO 1S3XA 1T44A 2F9WA 5CR4A 3JXUA 4H5NA 2IVPA 5ADXA 5FPEA 3K9JA 3QMLA 4WF9L 3SBTA 2YHWA 3MN6A 3VF6A 4BRFA 2P9PB 3EE8A 2P9SA 1MWKA 4GY2B 1XUPO 4JK8A 3I56N 2GUPA 1VQ9N 3LDNA 3N4QA 3FZKA 5DM7L 3VMFB 4RTFD 4CBXA 4DHYA 3A0IX 1QVFM 2FF3B 4YOVA 1VQKN 3P31A 1NGJA 1T3VA 2VYPA 4IWVA 3OW2M 2NRWA 1QQNA 3VENA 3CPWM 1YJ9N 1BWFO 3D2FB 5KPRA 2E2QA 4CZJA 1IG8A 4JKCA 3WEEA 3EO3A 1VQON 3IFRA 3KWGA 5AFUA 2E2NA 3J8AA 3DXKB 1NWKA 5EOYA 3C6HA 3UKUB 5AQKA 3O1WA 2EWSA 4YORA 5AQZA 5AQRA 1HKGA 1Z6RA 3QICA 5GAHP 3CXCM 1OVYA 3O08A 2Q31A 1ATRA 4BRAA 2P9NA 4IEEA 4IO9L 2ZGYA 4PKGA 3R9PA 1V4TA 4YOUA 2P9KA 4O8UA 3W3DA 2C1IA 3ZEUA 3UKRA 3CQXA 3I55N 1K9MO 3R1XA 3M6GA 3O9UA 4FPBA 1KAYA 2D4WA 3FZLA 5AZJB 1Q82O 1LCUA 4FWOA 2ZJRL 1S22A 4CZGA 2YI1A 4K43A 4K42A 5AQMA 5F0XA 2KLAA 1Q86O 3F5TA 5MLCQ 4NB4A 4J8FA 5CE3A 1SZ2A 2YHXA 4DQ8A 5C15A 1YJWN 2JWLA 1ATNA 2P9SB 3O9TA 4ILJA 5KPZA 1BOTO 3O9RA 3KVGA 4JN4A 4PKIA 2VCPA 2HSTA 4XH5A 4WQ4C 4BGAA 2F7TA 5AQPA 4OO1J 2QI2A 4JKDA 1DKGD 4H0TB 3ATUA 2FSKA 4BEBA 4Y0WA 3WEEB 2HBLA 2ZJQL 3VERA 3MCAB 1X9JA 1O13A 1VQMN 3WQTA 2W40A 5EY4A 3LDPA 3CCLN 3CHWA 3FZHA 2P9NB 4BG9A 2Q0RA 2E2OA 4IXCA 5AQUA 2P9KB 4YOTA 2RHKA 3H45C 3ZEUB 2BTFA 3MN9A 3U9DA 3UKRB 4EAHD 1S72N 1NJIO 5BREA 2CGLA 4KBOA 3HOSA 5BR9A 4K41A 4IEIA 3P4IA 3PIPL 2PFUA 1NGCA 3BUZB 3CJ9A 3O80A 5AQNA 1XC3A 3HRGA 4DKWA 5M1KA 1VQ6N 3DAWA 4CJ7A 4ISFA 3MX2A 3VGMA 3IMXA 1KD1O 1EO1A 2H3GX 5I9EB 1ESVA 3CIPA 2ZF5O 4IO8A 1YHQN 3HBTA 4BC4A 1VQPN 4CD3A 3CQYA 4GV9A 1SS6A 1V4SA 2ASPA 1BDGA 3CCVN 4NO7A 3RSEA 2HBJA 3A5NC 4I6MA 4NLCA 4EIAA 2YJFA 1X3MA 2HOEA 1DEJA 3ENOA 3CETA 5JMVA 3E9PA 5M1OA 1GLJO 3J7ZO 5AZIA 3VF4A 1Q18A 3FZMA 5AFUH 1NGAA 4WYBA 3CMEN 3O8MA 2FLOA 3VOVA 2QTDA 3GOIA 4FWRA 1NMDA 4CZHA 3CJ7A 3LDLA 4WQ4A 4BRQA 4B9QA 1RDWX 2QWLA 3UB5A 4CZIA 4XH4A 4XJXA 2P9LA 4JKAA 3ATVA 2ITMA 4JK7A 4QS7A 4FWNA 3KZBA 5BRFA 4GV6A 2CH6A 4BRMA 1NGFA 1HUXA 4M63C 3FLCO 4MO4A 3A5MC 3D7EO 3VEYA 1BA1A 2E1ZA 2ASMA 4JNEA 4FWKA 3GBTA 2FF6A 3CJ1A 4K25A 5KQDA 4RWTA 4B1WB 2P9IA 3CD6N 3G4SN 1G99A 1GLEG 2QWMA 3DWLA 3VTHA 3F9MA 1U2VA 3AARA 2DPNA 1GLBG 3MWPA 3DXMA 4AM6A 5AQIA 5F1XA 3R3LA 4F9OA 1R59O 2F9TA 4BE7B 1K73O 4L3QA 3MN5A 3RSEB 5DM6L 4I6MB 4H5VA 4WFAL 2A41A 1TUYA 2V52B 4FWSA 4JKFA 3ZYYX 3CCEN 2I7NA 5AR0A 1CZAN 3CC2N 3MDQA 3E1YA 5AZIB 3AAQA 2V7YA 2E20A 3ZX2A 1K8KA 3AY9A 1QZ5A 3BP8A 3P39A 4JKHA 3SMPA 3OBWA 3UE5A 4BVPA 3C0BA 4BRCA 2V51B 4G9ZA 4CBUA 3LDQA 3HI0A 3RVCA 1RFQA 3GE1A 4HWIA 3CCRN 4JK9A 3CERA 3ID8A 3BF1A 5M1NA 2P9LB 1GLCG 2IVNA 4RCHA 3FFKB 3W0LA 4WQ5C 5LJWA 1E4GT 1NGHA 1VQNN 1H1VA 2A40A 2OTLN 4GVEA 3CC4N 3CCSN 1BA0A 5LY3A 3CJBA 2VGMA 4PL8A 2QW9A 5BPNA 2FSJA 1HX1A 1X3NA 3MK6A 3LM2A 5AQFA 3U9ZA 3WXIA 1SQKA 4CZEA 4BREA 2P9IB 2WUSA 1VQ7N 5HOOA 1RDUA 4A2AA 3O6WA 3VF2A 1YVNA 1VQ8N 5H1SQ 3AAPA 1U2VB 2A5XA 3ULEA 3C7NA 3DXMB 4CI6A 2NRRA 2RE2A 3ENBA 1HPMA 3AGKA 1KAZA 5BRDA 4JKGA 5FPNA 2P9UA 3M5RA 2NZTA 4KH5A 1ZXOA 2VWBA 2E2PA 5FPDA 2FXUA 3ZX0A 1QQMA 1XQSC 3TPQA 3TTDA 1GLDG 3DJCA 1Z05A 1K8KB 4A61A 5JVHL 4C23A 4EFHA 3MX5A 5BRHA 3HOTA 5TKYA 3HSCA 2E1YA 3CCJN 3MCPA 5GAGP 4B1YB 3TSPA 1ZC6A 2D0PA 2QXLA 3K9KA 2HF3A 4FSVA 1Y64A 2YX6A 4KH6A 4UY8O 2AA4A 1SAZA 1JCGA 1ZBSA 1HJOA 1TYQA 1DT9A 3E9LA 4Z94A 3R8EA 3FZFA 5C10A 3L4QA 3KWIA 4PL7A 2HBKA 3VEXA 1NGDA 1YJNN 3E66A 3QB0A 4PHTX 4A62A 3Q7CA 3SLCA 4IOAL 2NRZA 3H3OB 4BRNA 1Q81O 2A6AA 3EL2A 4H5TA 2E88A 3ZETA 4IOCL 3C7NB 3ULEB 3QDKA 4WQ5A 3HM8A 4LC9B 5EXWA 4JKGB 4DCHA 1M90O 2P9UB 5AQVA 3O9SA 2NNWA 5AQHA 5EVZA 4KH4A 4A59A 2I7PA 4U67L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VET A;  2Q36 A;  2AP1 A;  4CZM A;  2QWP A;  4YDU C;  3SJH A;  4A2B A;  4HTL A;  3LDO A;  2BUP A;  4BGB A;  3O4W A;  5BPM A;  3WXK A;  5JIC A;  2GTD A;  1RGI A;  2GWK A;  3WT0 A;  4FWQ A;  4BR0 A;  5AQQ A;  1QZ6 A;  3BEX A;  5E26 A;  4FOI A;  3ZX3 A;  1TYQ B;  5B8H A;  3MMV A;  2Q0U A;  2YJE A;  1JCF A;  4QS9 A;  2PAV A;  3M1F A;  1E4F T;  3QBW A;  3WUH A;  4BC5 A;  4XEI A;  4H5W A;  1HLU A;  3VGL A;  2IVO A;  3CJA A;  5AQX A;  3WQU A;  1YXQ A;  1QHA A;  4FO0 A;  1DGK N;  4AM7 A;  3L4I A;  3M3Z A;  3VEO A;  3ZET B;  3CJC A;  4B1U B;  4M7X A;  4FL9 A;  4IZ9 A;  3H1V X;  1BO5 O;  2ZGZ A;  3FR0 A;  2UYT A;  4QS8 A;  4BQZ A;  2V7Z A;  1NGB A;  3QFP A;  2KHO A;  4O8K A;  4BR9 A;  4BR5 A;  5EX5 A;  2OAN A;  4E1J A;  4IJA A;  5AQL A;  4BG8 A;  2A3Z A;  3SMS A;  3FE1 A;  4H0Y B;  4BRG A;  3TU5 A;  1TUU A;  4O5F A;  2HMP A;  3L6Q A;  2GEL A;  4CD1 A;  3VEZ A;  3BF3 A;  4FPA A;  3VES A;  1D4X A;  5AQT A;  1YAG A;  4FOE A;  4BRH A;  4CZL A;  3IUC A;  4YDU A;  1ATS A;  5AQG A;  4ISG A;  4H0P A;  2Q97 A;  3HTV A;  5AQW A;  4BQL A;  2YHY A;  1NBW A;  3MN7 A;  4JAX A;  4MLH A;  3H46 O;  4BVO A;  1NGE A;  4JHD A;  1NM1 A;  2ASO A;  4H0X B;  4IJN A;  1MA9 B;  3D2E A;  2ZWH A;  2CGJ A;  1JCE A;  3VEW A;  4BC3 A;  1J6Z A;  1GLF O;  5BN9 A;  1WOQ A;  2Q2R A;  5AQO A;  5AQS A;  2CGK A;  3R6M A;  3CI5 A;  2HF4 A;  4GNI A;  3EN9 A;  1MDU B;  3ENH A;  4BRD A;  3U8X A;  4EHU A;  2PBD A;  3LL3 A;  1YUW A;  4FWP A;  5AQJ A;  1C0F A;  3EZW A;  1BUP A;  2D1K A;  3IDH A;  5JLF A;  3A8Y A;  2W41 A;  5F2R A;  5KPT A;  3L0Q A;  2QWQ A;  2GEM A;  4BR2 A;  4BRO A;  5JLH A;  4JD2 A;  1U6Z A;  2QWO A;  1KAX A;  4PKH A;  4BC2 A;  2NRH A;  4H0V B;  2YCH A;  3S41 A;  3EKS A;  2J4R A;  5KQ8 A;  1OKJ A;  3WXL A;  2QWN A;  2QWR A;  4B1X B;  1EQY A;  4BR7 A;  4BRI A;  3QFU A;  4B1V A;  4CZK A;  3O1B A;  1P8Z A;  3VEV A;  4JHD B;  1NGI A;  3I33 A;  3D2E B;  2NLX A;  3U4L A;  3G25 A;  4H03 B;  3H1Q A;  4FWL A;  5BN8 A;  5LJV A;  1QQO A;  3A5L C;  2QM1 A;  2P9P A;  5ADX H;  2GWJ A;  1T6D A;  2CH5 A;  2A42 A;  3KHY A;  3FGU A;  4MLE A;  4B1Z A;  3I8B A;  4CBW A;  3VGK A;  3OHR A;  5E84 A;  3D2F A;  5FPM A;  1C0G A;  4H0O A;  4BRL A;  3GDQ A;  4BR4 A;  1WUA A;  4FWM A;  4BRK A;  5AQY A;  1HKC A;  3A5O C;  1LOT B;  3DXK A;  4ISE A;  1BU6 O;  3UKU A;  3VPZ A;  2E8A A;  3H3N O;  3H6E A;  4JD2 B;  4M7Y A;  2D0O A;  2Q1N A;  4XH1 A;  1KXP A;  1NGG A;  1IJJ A;  1BG3 A;  4CZF A;  5BPL A;  3HZ6 A;  1HKB A;  2IIR A;  3LM9 A;  3B8A X;  5ELZ A;  1GLA G;  4H5R A;  3WXJ A;  4EHT A;  1MWM A;  5AZJ A;  3GL1 A;  3SK3 A;  1T6C A;  3GG4 A;  3JS6 A;  3O5B A;  3QBX A;  4MO5 A;  1NLV A;  4DB3 A;  2FSN A;  3EKU A;  1GLL O;  1S3X A;  1T44 A;  2F9W A;  3JXU A;  4H5N A;  2IVP A;  5ADX A;  3QML A;  2YHW A;  3MN6 A;  3VF6 A;  4BRF A;  2P9P B;  4GY2 B;  2P9S A;  1MWK A;  1XUP O;  2GUP A;  3LDN A;  3FZK A;  4RTF D;  4CBX A;  4DHY A;  3A0I X;  2FF3 B;  1NGJ A;  2VYP A;  4IWV A;  1QQN A;  3VEN A;  1BWF O;  3D2F B;  5KPR A;  2E2Q A;  4CZJ A;  1IG8 A;  3WEE A;  3EO3 A;  3IFR A;  5AFU A;  2E2N A;  3J8A A;  3DXK B;  1NWK A;  5EOY A;  3UKU B;  5AQK A;  3O1W A;  2EWS A;  5AQZ A;  5AQR A;  1HKG A;  1Z6R A;  3QIC A;  3O08 A;  2Q31 A;  1ATR A;  4BRA A;  2P9N A;  2ZGY A;  4PKG A;  3R9P A;  1V4T A;  2P9K A;  3W3D A;  3ZEU A;  3UKR A;  3CQX A;  3M6G A;  4FPB A;  1KAY A;  2D4W A;  3FZL A;  5AZJ B;  1LCU A;  4FWO A;  1S22 A;  4CZG A;  2YI1 A;  4K43 A;  4K42 A;  5AQM A;  5F0X A;  4NB4 A;  4J8F A;  5CE3 A;  1SZ2 A;  2YHX A;  4DQ8 A;  1ATN A;  2P9S B;  5KPZ A;  1BOT O;  4JN4 A;  3KVG A;  4PKI A;  2VCP A;  4XH5 A;  4WQ4 C;  4BGA A;  5AQP A;  1DKG D;  4H0T B;  3ATU A;  2FSK A;  4Y0W A;  3WEE B;  3VER A;  1X9J A;  3WQT A;  2W40 A;  5EY4 A;  3LDP A;  3CHW A;  3FZH A;  2P9N B;  4BG9 A;  2Q0R A;  2E2O A;  4IXC A;  5AQU A;  2P9K B;  3H45 C;  3ZEU B;  2BTF A;  3MN9 A;  3U9D A;  3UKR B;  4EAH D;  5BRE A;  2CGL A;  4KBO A;  5BR9 A;  4K41 A;  3P4I A;  1NGC A;  3BUZ B;  3CJ9 A;  3O80 A;  5AQN A;  1XC3 A;  3DAW A;  4CJ7 A;  4ISF A;  3VGM A;  3IMX A;  2H3G X;  5I9E B;  1ESV A;  3CIP A;  2ZF5 O;  4IO8 A;  3HBT A;  4BC4 A;  4CD3 A;  3CQY A;  1V4S A;  2ASP A;  1BDG A;  4NO7 A;  3RSE A;  3A5N C;  4I6M A;  4EIA A;  2YJF A;  1X3M A;  2HOE A;  1DEJ A;  3ENO A;  3CET A;  5JMV A;  1GLJ O;  5AZI A;  3VF4 A;  1Q18 A;  3FZM A;  5AFU H;  1NGA A;  4WYB A;  3O8M A;  2FLO A;  3VOV A;  3GOI A;  4FWR A;  1NMD A;  4CZH A;  3CJ7 A;  3LDL A;  4WQ4 A;  4BRQ A;  4B9Q A;  1RDW X;  2QWL A;  3UB5 A;  4CZI A;  4XH4 A;  2P9L A;  3ATV A;  2ITM A;  4QS7 A;  4FWN A;  3KZB A;  5BRF A;  2CH6 A;  4BRM A;  1NGF A;  1HUX A;  4M63 C;  3FLC O;  4MO4 A;  3A5M C;  3D7E O;  3VEY A;  1BA1 A;  2E1Z A;  2ASM A;  4JNE A;  4FWK A;  3GBT A;  2FF6 A;  3CJ1 A;  4K25 A;  5KQD A;  4RWT A;  4B1W B;  2P9I A;  1G99 A;  1GLE G;  2QWM A;  3DWL A;  3F9M A;  1U2V A;  3AAR A;  2DPN A;  1GLB G;  5FPE A;  3DXM A;  4AM6 A;  5AQI A;  5F1X A;  4F9O A;  1R59 O;  2F9T A;  4L3Q A;  3MN5 A;  3RSE B;  4I6M B;  4H5V A;  2A41 A;  1TUY A;  2V52 B;  4FWS A;  2I7N A;  5AR0 A;  1CZA N;  3MDQ A;  5AZI B;  3ZX2 A;  3AAQ A;  2V7Y A;  2E20 A;  1K8K A;  3AY9 A;  1QZ5 A;  3BP8 A;  3UE5 A;  3SMP A;  4BVP A;  3C0B A;  4BRC A;  2V51 B;  4CBU A;  3LDQ A;  3HI0 A;  1RFQ A;  3GE1 A;  4HWI A;  3CER A;  3ID8 A;  3BF1 A;  2P9L B;  1GLC G;  2IVN A;  4RCH A;  3FFK B;  3W0L A;  4WQ5 C;  5LJW A;  1E4G T;  1NGH A;  1H1V A;  2A40 A;  1BA0 A;  5LY3 A;  3CJB A;  4PL8 A;  2QW9 A;  5BPN A;  2FSJ A;  1HX1 A;  1X3N A;  3MK6 A;  3LM2 A;  5AQF A;  3U9Z A;  3WXI A;  1SQK A;  4CZE A;  4BRE A;  2P9I B;  2WUS A;  4A2A A;  3O6W A;  3VF2 A;  1YVN A;  3AAP A;  1U2V B;  2A5X A;  3ULE A;  3C7N A;  3DXM B;  4CI6 A;  1HPM A;  1KAZ A;  5BRD A;  5FPN A;  2P9U A;  2NZT A;  1ZXO A;  2VWB A;  2E2P A;  5FPD A;  2FXU A;  3ZX0 A;  1QQM A;  1XQS C;  3TPQ A;  1GLD G;  3DJC A;  1Z05 A;  1K8K B;  4A61 A;  4C23 A;  4EFH A;  5BRH A;  5TKY A;  3HSC A;  2E1Y A;  3MCP A;  4B1Y B;  1ZC6 A;  2D0P A;  2QXL A;  2HF3 A;  4FSV A;  1Y64 A;  1SAZ A;  1ZBS A;  1JCG A;  2AA4 A;  1HJO A;  1TYQ A;  3R8E A;  4Z94 A;  3FZF A;  4PL7 A;  3VEX A;  1NGD A;  3QB0 A;  4A62 A;  3SLC A;  3H3O B;  4BRN A;  2A6A A;  3EL2 A;  4H5T A;  2E88 A;  3ZET A;  3C7N B;  3ULE B;  3QDK A;  4WQ5 A;  3HM8 A;  4LC9 B;  5EXW A;  4DCH A;  2P9U B;  5AQV A;  5AQH A;  5EVZ A;  4BRP A;  2I7P A; 
#chains in the Genus database with same CATH topology
 2XO7 A;  3VET A;  1N8R O;  4CZM A;  2QWP A;  4H4M A;  3P1G A;  3LDO A;  4DU3 A;  2C1G A;  1S1X A;  3O4W A;  5JIC A;  3TAF A;  4BR0 A;  4DQI A;  4KHW A;  3MMV A;  1D9F A;  1A5V A;  1DTQ A;  1M1K O;  2HHS A;  3QBW A;  4N56 A;  3DLL L;  4DF8 A;  2ETJ A;  3WQU A;  2HHQ A;  1DGK N;  3PO4 A;  3M3Z A;  1S9E A;  1TL1 A;  3NMU A;  4I7F A;  2ZGZ A;  2P5G A;  2GX9 A;  4BDP A;  1YI2 N;  4DSL A;  4BR5 A;  1WSF A;  5KRS A;  4DR5 K;  3G6E N;  2IAJ A;  5AQL A;  1RT2 A;  4BG8 A;  4MDA A;  2HHU A;  2X6N A;  3MEG A;  3QLH A;  2BH1 A;  3CCM N;  4J2A A;  1I3A A;  4FPA A;  3CFP A;  1D4X A;  1WBB A;  4DTJ A;  4U7B A;  1ATS A;  3K5L A;  3TAR A;  4ISG A;  4BQL A;  2Q97 A;  4B3R K;  4MLH A;  4BVO A;  2ASO A;  4H0X B;  1F21 A;  3SAG A;  4DQQ A;  2CGJ A;  2HNZ A;  1ASU A;  1WOQ A;  1WSJ A;  2ZD1 A;  3LDS A;  1JLF A;  1TKZ A;  5AQS A;  2XY7 A;  1S5J A;  3R6M A;  1VSI A;  2HF4 A;  1MDU B;  3U8X A;  3LL3 A;  5C2D A;  4X64 K;  1Y97 A;  4B9U A;  3O9Q A;  3IDH A;  3KK1 A;  3KLE A;  3A8Y A;  3O4Q A;  5KPT A;  2NRX A;  3CYG A;  3S5T A;  3I0S A;  2B5J A;  1KLM A;  5KQ8 A;  1OKJ A;  3VA3 A;  1EQY A;  4CJS A;  4Z0U A;  1VSJ A;  2VGN A;  5HRN A;  3QEI A;  1P8Z A;  1BIS A;  2YHB A;  5DK5 A;  4FCY A;  1VQ5 N;  4OGE A;  4O55 A;  2NLX A;  4OKJ A;  3LAM A;  4M3T A;  3J81 O;  3SPZ A;  3HO1 A;  1VSL A;  1VQ4 N;  1G15 A;  4FZZ A;  2GWJ A;  4PA1 A;  4BE0 A;  1BI4 A;  2CH5 A;  2A42 A;  5FDL A;  1RTH A;  1TKT A;  1UA0 A;  4L8R B;  2W00 A;  4OJR A;  1DLO A;  1C0G A;  3HPG A;  3AGR A;  4FWM A;  4ILH A;  4BRK A;  5AQY A;  1HKC A;  1QE1 A;  1Q7Y O;  1FKP A;  2OZM A;  3VPZ A;  3UKU A;  4HVJ A;  3TAP A;  3E9O A;  4J2D A;  1NGG A;  3TI0 A;  1IJJ A;  3BGR A;  4AHS A;  3L2U A;  3SCX A;  1I39 A;  2HBM A;  3B8A X;  5ELZ A;  2D0A A;  4H5R A;  4FXD A;  1VK0 A;  1MWM A;  2QEX N;  3AA3 A;  3CCU N;  3SK3 A;  4DR1 K;  3AVL A;  3J80 O;  3VTI A;  3JS6 A;  1VAZ A;  3P38 A;  5E41 A;  2FSN A;  1S3X A;  3JXU A;  3DM2 A;  4H5N A;  4CGI A;  3QML A;  4M3W A;  3VF6 A;  5CY4 A;  1MWK A;  5I3U A;  2GUP A;  3LDN A;  1BI4 B;  4CFD A;  4J2E A;  2GUI A;  1IKX A;  3VMF B;  2FF3 B;  1RT3 A;  2VYP A;  3SI6 A;  1QQN A;  3VEN A;  3OYF A;  3EO3 A;  2W6K A;  3P83 D;  2UUC K;  4OKE A;  1NWK A;  3UKU B;  3C6H A;  4DSF A;  2EWS A;  4YOR A;  2BGG A;  1T8E A;  3L3U A;  3DLK A;  3ULD A;  2Q31 A;  3QNO A;  1ATR A;  1BIZ A;  4BRA A;  1XWL A;  2HB5 A;  1V4T A;  4O8U A;  2C1I A;  4HCB A;  3R1X A;  3RMB A;  3O9U A;  1TAQ A;  2VQF K;  1D8Y A;  1SL1 A;  2OPS A;  2P5O A;  2YI1 A;  4K43 A;  3I0R A;  3OYG A;  3F5T A;  1D9D A;  2KZZ A;  3DMJ A;  4J8F A;  5CE3 A;  3SYZ A;  4KB0 A;  2E6M A;  4YNQ A;  2YHX A;  3O9R A;  3M8R A;  2QK9 A;  4CJU A;  4BGA A;  5HRP A;  2BDP A;  4O5B A;  2FSK A;  3AA2 A;  4B3T K;  1E3M A;  2ZE2 A;  3MAQ A;  4QOZ B;  1NG9 A;  1UOC A;  4FJJ A;  2ATQ A;  4FLV A;  3CCL N;  3FZH A;  3ZT4 A;  4CES A;  3HPO A;  5AQU A;  4IXC A;  4YOT A;  3MN9 A;  3CFR A;  3T19 A;  3PO5 A;  4Z4F A;  5BRE A;  5BR9 A;  2Z1I A;  5J2Q A;  1UAX A;  4AHT A;  1KFS A;  1NGC A;  3BUZ B;  3O80 A;  2X6S A;  3HRG A;  4CJ7 A;  3NE6 A;  4ISF A;  3VGM A;  3AVG A;  5I9E B;  2IOC A;  1YHQ N;  2HHT A;  4E7H A;  3CQY A;  3KLF A;  3J7A P;  2O8D A;  2G8K A;  4NO7 A;  4B08 A;  3ENO A;  4CE9 A;  1GLJ O;  3VF4 A;  1Q9Y A;  1Q18 A;  3FZM A;  3CME N;  3V81 A;  3O8M A;  5C42 A;  1VRT A;  1U49 A;  1KLN A;  1RDB A;  1IO2 A;  2FLO A;  3VOV A;  3QEV A;  1VSH A;  3LDL A;  1C1A A;  1B9F A;  2OPR A;  4B9Q A;  2FBX A;  4KKO A;  2QWL A;  3UB5 A;  4DQP A;  4XH4 A;  4IKF A;  4JKA A;  3ATV A;  3K0S A;  5BRF A;  3K5O A;  3KKS A;  1HUX A;  3FLC O;  3L2Q A;  3ZT2 A;  1KSP A;  5JS1 A;  3PSI A;  3DRR A;  3GBT A;  2FF6 A;  4B1W B;  4M41 A;  3G4S N;  2QWM A;  4JV5 K;  3F9M A;  1GLB G;  4F9O A;  1R59 O;  2F9T A;  4CJQ A;  1K73 O;  4FJN A;  3MN5 A;  2O8D B;  4Z4E A;  4OLA A;  4WFA L;  1TUY A;  1JLC A;  4CEQ A;  3TWH A;  1N36 K;  1EP4 A;  3AAQ A;  2V7Y A;  3G10 A;  3BP8 A;  3P39 A;  4FM2 A;  5IWA K;  1RT1 A;  3U3G A;  1HNX K;  4O0J A;  4FLX A;  4JK9 A;  4YFU A;  4FJG A;  1RBV A;  4B3O A;  1C0U A;  3IRX A;  1TAU A;  3FFK B;  3W0L A;  1BL3 A;  5LJW A;  2WOM A;  1ZBI A;  1VQN N;  3OJS A;  4KO0 A;  4GVE A;  4F2R A;  1OH7 A;  1BA0 A;  4BE2 A;  2F8T A;  3MK6 A;  3LM2 A;  3RMD A;  1SQK A;  4CZE A;  2WUS A;  1ASV A;  3VF2 A;  4XIU A;  2A5X A;  3ULE A;  3C7N A;  2XHB A;  1RDD A;  3ENB A;  1HPM A;  5BRD A;  5FPN A;  1JLB A;  5HRO A;  2UUA K;  4Y1C A;  2E2P A;  4AIL C;  3TPQ A;  2OPP A;  4Z4H A;  2OCE A;  1VSM A;  3HP6 A;  2I5J A;  3PSF A;  5TKY A;  2E1Y A;  4DFK A;  4B1Y B;  3VN5 A;  3TSP A;  1ZC6 A;  2D0P A;  2QXL A;  2P1J A;  1VSE A;  1RDC A;  1SAZ A;  5C10 A;  1DT9 A;  4E7K A;  3L4Q A;  4HTU A;  2HHX A;  4PL7 A;  2HBK A;  4QAG A;  1YJN N;  4Z4I A;  4OX9 K;  4FJH A;  1Q81 O;  1K6Y A;  3KD1 E;  4ELV A;  2D0C A;  3ZET A;  4IOC L;  3C7N B;  3ULE B;  3SUN A;  2OYQ A;  1IG9 A;  5EXW A;  3O9S A;  3QEW A;  4U67 L;  4A5B A;  2Q36 A;  4YOX A;  4CF0 A;  3HT3 A;  4HTL A;  4DMN A;  2G8F A;  4BGB A;  3LWM A;  4C1N K;  1RGI A;  1YT3 A;  3WT0 A;  1RTI A;  4WFN L;  1QZ6 A;  3C65 A;  2KTQ A;  1J5O A;  1QVG M;  3CYM A;  2Q0U A;  2NUB A;  2YJE A;  4QS9 A;  3OYN A;  4KI4 A;  4BC5 A;  1TKX A;  4HUG A;  3NVK A;  4H5W A;  5GAD P;  2IVO A;  3CJA A;  4JLH A;  1NOZ A;  4FO0 A;  4CK1 A;  1ITG A;  4AM7 A;  4M3Y A;  1NJW A;  3NBP A;  3ZET B;  4B1U B;  1JXE A;  4CED A;  4DS4 A;  1X9W A;  1BO5 O;  3FR0 A;  2QKB A;  4JS4 A;  3SQ0 A;  1TGO A;  4BQZ A;  2V7Z A;  4BR9 A;  4NXM K;  2OAN A;  4E1J A;  1IBM K;  4F3O A;  4IJA A;  4OKK A;  4FJ7 A;  2F96 A;  5CYQ A;  2A3Z A;  5J2P A;  3FE1 A;  2HND A;  3TU5 A;  4CF1 A;  4CEC A;  2HMP A;  4C1N I;  4JI4 K;  4FLT A;  1EWR A;  3MWT A;  5AQT A;  5LMN K;  4FOE A;  3DOL A;  3AVA A;  4CF8 A;  1J53 A;  2O4I A;  4FJM A;  3AV9 A;  3HTV A;  1OH8 A;  3CG7 A;  2OTJ N;  1WB9 A;  3H46 O;  4JHD A;  3RR7 A;  4NCB A;  3D2E A;  1HYV A;  3NGI A;  4FK4 A;  4BC3 A;  2Q2R A;  2GV9 A;  3TSQ A;  4CJE A;  4FM0 A;  3CI5 A;  3F2K A;  2PYJ A;  2DFH A;  4R79 A;  3MXM A;  2OPQ A;  3G71 N;  4DQS A;  4EHU A;  4E7J A;  4JKB A;  2HVH A;  4FWP A;  1HMV A;  4FK0 A;  3EZW A;  1VSD A;  2D1K A;  4FLW A;  1ZBF A;  4DR3 K;  2F8S A;  3TSU A;  4AHR A;  4BR2 A;  1JL2 A;  4LSL A;  4BRO A;  3PUF A;  3OYK A;  1L5U A;  4YOW A;  4DV1 K;  2NRH A;  5J2N A;  3ZCM A;  4FJL A;  3E01 A;  3WXL A;  2XY8 A;  3CM6 A;  4CJR A;  1QSL A;  4BRI A;  3ID6 A;  3QFU A;  4CJT A;  5JVG L;  2Y1I A;  3VEV A;  4JHD B;  1NGI A;  4ILG B;  3D2E B;  1BIU A;  3AO3 A;  4JEP A;  4FM1 A;  1SKW A;  3H1Q A;  4X65 K;  3MED A;  5C2F A;  3WXM B;  1QQO A;  2OA8 A;  4NXN K;  2YNH A;  5ADX H;  2D5R A;  2DY4 A;  3KHY A;  4MLE A;  4IFV A;  4DV7 K;  5SWM A;  3QO9 A;  3VGK A;  5M1P A;  5E84 A;  5FPM A;  4ZTF A;  4DV6 K;  3SBG A;  4BR4 A;  1WUA A;  4CW7 B;  2IS3 A;  3A5O C;  5KGW A;  1LOT B;  1GOA A;  5GIN A;  4W5Q A;  2E8A A;  4M7Y A;  2Q1N A;  4XH1 A;  1IKY A;  4I2Q A;  5T7B A;  1KXP A;  1NK9 A;  3HZ6 A;  1W2B M;  2JWK A;  4E7I A;  3HPH A;  4H8K A;  4EHT A;  4WCE L;  3ALY A;  3L2R A;  3O5B A;  2NRT A;  5CR4 A;  1GLL O;  2F9W A;  2IVP A;  4RW8 A;  4BRF A;  3EE8 A;  1HQE A;  1FK9 A;  2VQE K;  2KFZ A;  3FZK A;  5DM7 L;  4DHY A;  2PYL A;  1QVF M;  4YOV A;  1VQK N;  4CJ3 A;  1J9A A;  4IWV A;  3CPW M;  2E2Q A;  1IG8 A;  1JLA A;  4JKC A;  3RMC A;  3SPY A;  3UIQ A;  4CJ5 A;  3KWG A;  5AFU A;  1LWE A;  1RIL A;  3LPU A;  5AQK A;  1HKG A;  1Z6R A;  5GAH P;  3CXC M;  3O08 A;  2DFE A;  3NDK A;  1WAJ A;  3I55 N;  1K9M O;  4HHT A;  3M6G A;  4FPB A;  1WSG A;  1KAY A;  1I94 K;  1FJG K;  1XI1 A;  1HNW K;  4ELT A;  2ZJR L;  1S22 A;  4CZG A;  4KTW A;  4LH4 A;  2KLA A;  5MLC Q;  4KPY A;  4BE1 A;  1JLG A;  1RT6 A;  1JKH A;  1RDA A;  4JI1 K;  3O9T A;  1BOT O;  3KVG A;  3CFO A;  2VCP A;  1W7A A;  2F7T A;  4RG8 A;  1O1W A;  4KV8 A;  3HVR A;  4Y0W A;  1VQM N;  3WQT A;  1NJZ A;  4DR7 K;  4JI8 K;  3LDP A;  3WNH A;  3CHW A;  2DTU A;  1X9M A;  4M42 A;  2BTF A;  3U9D A;  4RW6 A;  4B9T A;  4KBO A;  1TV6 A;  5CZ1 A;  4K8X A;  2X78 A;  3V1Q A;  4IEI A;  3P4I A;  4CHN A;  4PY5 A;  2YNF A;  4DV0 K;  3DRP A;  3G0Z A;  3MEE A;  3PIP L;  5AQN A;  1XC3 A;  3OS2 A;  3DAW A;  1VQ6 N;  4N41 A;  4FLU A;  1EO1 A;  2H3G X;  1U45 A;  2HHI A;  1ESV A;  4IO8 A;  3HBT A;  4BC4 A;  2HHH K;  3LAN A;  4FJK A;  1SL2 A;  4TSX A;  1OH6 A;  1BDG A;  3CCV N;  1WLJ A;  4EIA A;  2YJF A;  1EX4 A;  2HOE A;  1DEJ A;  2VWK A;  3E9P A;  4DLE A;  3J7Z O;  4LFB K;  5AFU H;  4B9N A;  3L3V A;  3KK2 A;  2FC0 A;  3THX A;  3V1O A;  4FWR A;  4CER A;  3OY9 A;  4EZ9 A;  4NCG A;  1N6Q A;  1LWC A;  3ITH A;  4CIF A;  2EX3 A;  2ITM A;  4O4G A;  4PQU A;  3DLB A;  2CH6 A;  4CJL A;  4M63 C;  1XHX A;  4MO4 A;  3VEY A;  1FXX A;  4CJF A;  4FWK A;  3AVI A;  4CF2 A;  4RWT A;  4O0I A;  5AJ3 K;  2P9I A;  4AHC A;  4GKK K;  3AAR A;  4B9L A;  2DPN A;  3MWP A;  5FPE A;  5F1X A;  4AM6 A;  4BE7 B;  3R3L A;  3OYB A;  1R0A A;  2O8E A;  5DM6 L;  4H5V A;  2A41 A;  4FWS A;  3LAL A;  3IAY A;  3ZYY X;  3CCE N;  2UXB K;  4CJK A;  1CZA N;  3CC2 N;  3AVK A;  4FJ9 A;  1K8K A;  3SMP A;  3OBW A;  4DR6 K;  3THX B;  4BRC A;  4ZHR A;  4N47 A;  4Q5V A;  4CBU A;  2KW4 A;  4EZ6 A;  3RVC A;  1RFQ A;  1YVU A;  4B9M A;  3C6T A;  3CER A;  3ID8 A;  2IVN A;  2A1R A;  1HPZ A;  4WQ5 C;  3AVN A;  3ASM A;  5D3G A;  1OH5 A;  2YNI A;  4CEZ A;  1U04 A;  3CJB A;  4PL8 A;  2QW9 A;  5C25 A;  3KLG A;  2FSJ A;  1X3N A;  3NFA A;  4CFA A;  3NH1 A;  2P9I B;  4AHU A;  3QEX A;  4FZX C;  1HRH A;  3O6W A;  1VQ8 N;  1HNZ K;  4IDK A;  4CI6 A;  2RE2 A;  3KTQ A;  3NF7 A;  1T03 A;  1KAZ A;  1KFD A;  2P9U A;  2O8E B;  2NZT A;  4KH5 A;  4E72 A;  4DSJ A;  1RT5 A;  5KI6 A;  4GKJ K;  2VWB A;  3ZSO A;  1ZBL A;  4DTN A;  3RRH A;  1GLD G;  4DV2 K;  3DJC A;  3V9S A;  4A61 A;  1K8K B;  3VQ5 A;  1WSI A;  1RCH A;  1MU2 A;  1SKS A;  1LW2 A;  4CJW A;  4E89 A;  4KFB A;  4DG1 A;  3TAB A;  4RW4 A;  2YNG A;  2KZM A;  4KH6 A;  4UY8 O;  1YTU A;  1BQM A;  1TYQ A;  3NHG A;  3QIP A;  3FZF A;  1HJR A;  1N5Y A;  1B92 A;  3KWI A;  2HW3 A;  1NGD A;  3E66 A;  4X62 K;  4PHT X;  3Q7C A;  3SLC A;  3LAK A;  4IBN A;  5DMR A;  3T1Y K;  1IKW A;  3KD5 E;  3OYI A;  2A6A A;  3EL2 A;  4BWM A;  3DRS A;  2GBZ A;  3O3G A;  3D0P A;  1RTJ A;  3K5N A;  3QDK A;  5HP1 A;  3RR8 A;  3HM8 A;  2VG5 A;  3HL8 A;  2P9U B;  4E1M A;  2NNW A;  4CK3 A;  3TAE A;  4BRP A;  4CGH A;  2AP1 A;  1K8A O;  3NH0 A;  4YDU C;  3SJH A;  4F3T A;  1HNV A;  3SUP A;  4LFC K;  1P90 A;  4A2B A;  5HRS A;  2HHW A;  5M1Q A;  1A5W A;  2O8F A;  4RW9 A;  1ILY A;  3WXK A;  2GWK A;  1S1V A;  1D5A A;  4FWQ A;  4M3Z A;  3KLH A;  3OTO K;  3BEX A;  5E26 A;  4FOI A;  4A5A A;  5FRO A;  1TYQ B;  5M1F A;  4KAZ A;  4GVM A;  4C8N A;  1JCF A;  2PAV A;  3M1F A;  4B9V A;  2BAN A;  2Z1J A;  3WUH A;  3MXJ A;  1HLU A;  4V19 S;  4BY9 C;  1YIJ N;  5AQX A;  3OBY A;  3AO1 A;  1YXQ A;  1QHA A;  4W5N A;  1L3S A;  3L4I A;  3VEO A;  3CJC A;  5JEN A;  4FL9 A;  4IZ9 A;  4C8M A;  1NK4 A;  3TAQ A;  3VA0 A;  3WNF A;  2UYT A;  4QS8 A;  3SV3 A;  4O8K A;  4OGC A;  2RF2 A;  4DFJ A;  2X74 A;  2G8H A;  3M8P A;  1W0H A;  3Q7B A;  3V9U A;  3IKM A;  5GAE P;  5CHI A;  4BRG A;  4H0Y B;  2O8F B;  3PIO L;  4PWD A;  4CGF A;  1WN7 A;  4O5F A;  3VEZ A;  3AO2 A;  3BDP A;  3RRG A;  2QA4 N;  1KVA A;  4LF8 K;  1YF5 L;  3MEC A;  4BRH A;  3TTC A;  5AQG A;  4YY3 K;  2IGI A;  4H0P A;  5AQW A;  4KHN A;  2YHY A;  1NBW A;  2B4J A;  3L8B A;  1VHX A;  4KI6 A;  2ZWH A;  3KK7 A;  4B8A B;  3VEW A;  3VQD A;  4JI6 K;  2HHV A;  1GLF O;  4E3S A;  3N4P A;  1TKD A;  2KKZ A;  3EN9 A;  1NK8 A;  3T7Z A;  3LWL A;  3T69 A;  4KTQ A;  4GMJ B;  4FVU A;  1C0F A;  2E4L A;  4W5R A;  1TK0 A;  5JLF A;  3C6A A;  4GV3 A;  2B6A A;  2PZS A;  2W41 A;  3V9Z A;  5C0Y A;  1NMN A;  4ICL A;  4H4O A;  3OA9 A;  5JLH A;  3DYA A;  3LP3 A;  4F8R A;  4JD2 A;  2QWO A;  2W6L A;  3ZT3 A;  4BC2 A;  4H0V B;  2YCH A;  2J4R A;  2QWN A;  1A5X A;  2QWR A;  4B1X B;  2G8W A;  4JI5 K;  1WAF A;  4CFB A;  2HMI A;  1GOB A;  4B1V A;  4CZK A;  3JSM A;  2LSN A;  3OS0 A;  4NYN A;  2ITG A;  3HST B;  4I9Q A;  5LJV A;  3PLA A;  4CHO A;  1SV5 A;  3J7Y P;  2QM1 A;  4OVL A;  2P9P A;  1YIT N;  1BGX T;  1T6D A;  3LZJ A;  3OYJ A;  1JLE A;  3FGU A;  3I8B A;  3KIO A;  4NLB A;  1JXB A;  3AVC A;  2YHA A;  3D2F A;  3QET A;  4H0O A;  3GDQ A;  2W42 A;  3SAF A;  4DV3 K;  4ISE A;  3DXK A;  1LW0 A;  2WBN A;  4FJX A;  3H3N O;  4JD2 B;  3H6E A;  2D0O A;  3QER A;  4JI7 K;  3VQE A;  3CMA N;  3VQP A;  4CZF A;  5BPL A;  4IOX A;  3LM9 A;  1HKB A;  2IIR A;  4EP4 A;  3U3Y A;  1GLA G;  4WFB L;  4IFE A;  3WXJ A;  5AZJ A;  4Z4G A;  3GL1 A;  4DUY K;  3QBX A;  1NLV A;  3EKU A;  2XY6 A;  5ADX A;  1RBU A;  4WF9 L;  3SBT A;  4DTO A;  2YHW A;  2P9P B;  4GY2 B;  4JK8 A;  1XUP O;  5HLF A;  3N4Q A;  4DQR A;  4DF4 A;  4M3X A;  3A0I X;  3HXM A;  1T3V A;  3OW2 M;  2NRW A;  3HYF A;  1BWF O;  2DFF A;  3D2F B;  5LMU K;  5KPR A;  1NK5 A;  4CZJ A;  3WEE A;  1C6V A;  3IFR A;  4BWJ A;  4AQY K;  2E2N A;  4B9S A;  3DXK B;  3VQC A;  4DR2 K;  3O1W A;  5AQZ A;  5AQR A;  3TAN A;  3QIC A;  4HCC A;  1OVY A;  4KHS A;  2P9N A;  4IEE A;  4IO9 L;  2ZGY A;  4PKG A;  3R9P A;  4YOU A;  2P9K A;  1KRP A;  4KHQ A;  3W3D A;  3DLH A;  3LPT A;  3CQX A;  1LV5 A;  2VWJ A;  5AZJ B;  2YKM A;  1LCU A;  4FWO A;  5F0X A;  5AQM A;  4K42 A;  3KK3 A;  3B6P A;  4WE1 A;  1NU0 A;  2WON A;  4CEF A;  3HP9 A;  3B6O A;  4NB4 A;  1J54 A;  1S1U A;  4ID1 A;  4DQ8 A;  1U48 A;  3OYL A;  1YJW N;  1ATN A;  2HST A;  4WQ4 C;  2QI2 A;  2VG7 A;  4JKD A;  1WSH A;  4E0D A;  1DKG D;  3ZSV A;  3ATU A;  3SUO A;  1QQC A;  2F4V K;  4BEB A;  3WEE B;  2HBL A;  2ZJQ L;  1X9J A;  4FLY A;  2W40 A;  4LF9 K;  5EY4 A;  1CZ9 A;  4CF9 A;  4E1N A;  4NCA A;  4JS5 A;  3D45 A;  3MXI A;  2P9N B;  4BG9 A;  2Q0R A;  2E2O A;  3ISN C;  2P9K B;  2RHK A;  1QSS A;  1T7P A;  2FBY A;  1VSF A;  2KFN A;  4K41 A;  4B8C A;  5A2Q O;  4M45 A;  4DKW A;  2AJQ A;  5SZT A;  3EYZ A;  3MX2 A;  3CIP A;  2ZF5 O;  2XRI A;  1L3V A;  4FVM A;  3HVT A;  4CD3 A;  4OPJ A;  4GV9 A;  3F73 A;  2ASP A;  3RSE A;  4NLC A;  2Q3S A;  5JMV A;  1U4B A;  1Q9X A;  3C6U A;  4DTM A;  1NGA A;  3OS1 A;  4M3R A;  4DU1 A;  2JGU A;  2O4G A;  3VQQ A;  1NMD A;  4CZH A;  3T3F A;  3CJ7 A;  1HQU A;  5LL6 Z;  1WBD A;  4CZI A;  4XJX A;  3QES A;  4DFM A;  2UUB K;  4JK7 A;  4QS7 A;  1RBR A;  1GOC A;  4BRM A;  1NGF A;  1RBT A;  4HUE A;  4K8Z A;  3D7E O;  3WNE A;  4JNE A;  2ASM A;  4IG0 A;  3THY A;  4LF5 K;  3SUQ A;  4F2S A;  1G99 A;  1U2V A;  4Z4C A;  4JRP A;  3DXM A;  1S1W A;  5AQI A;  4X66 K;  1SUQ A;  5C24 A;  3LZI A;  4L3Q A;  3RSE B;  2V52 B;  3PX6 A;  4FLZ A;  3KLI A;  3UE5 A;  1C1B A;  1RBS A;  3C0B A;  2V51 B;  1C0M A;  5CYM A;  3CCR N;  2FBV A;  3HI0 A;  3GE1 A;  3P5J A;  1RT7 A;  3SZ2 A;  2UU9 K;  1X1P A;  1J5E K;  1KVC A;  3L2V A;  4RCH A;  3RWU A;  3LP1 A;  2EHG A;  1H1V A;  2OTL N;  1OVQ A;  3CC4 N;  1C1C A;  3CCS N;  5LY3 A;  3THY B;  5BPN A;  3NGZ A;  1IKV A;  1HX1 A;  3U9Z A;  3WXI A;  1KTQ A;  4BRE A;  5HOO A;  1RDU A;  4GW6 A;  4BDZ A;  1YVN A;  5H1S Q;  3AAP A;  1U2V B;  1BCM A;  3ZSY A;  3DXM B;  3U6F A;  3M8Q A;  3DLR A;  3JYT A;  2HVI A;  3AGK A;  3AVJ A;  3NF6 A;  4BDY A;  2FXU A;  3ZX0 A;  4AH9 A;  1XQS C;  3TTD A;  4R5P A;  1N33 K;  1Z05 A;  5JVH L;  2Y1J A;  3OVN A;  1EXQ A;  4CHP A;  4EFH A;  3HSC A;  3MCP A;  5GAG P;  1LAW A;  3AVB A;  3K9K A;  2HF3 A;  1Y64 A;  2YX6 A;  2XY5 A;  2AA4 A;  3ZT1 A;  3KKR A;  3E9L A;  3RTV A;  4DU4 A;  1ASW A;  5CZ2 A;  2FBT A;  1NNE A;  1BHL A;  4A62 A;  3AVM A;  4IOA L;  4DFP A;  2NRZ A;  2WTU A;  2E88 A;  4F4K A;  3NCI A;  4WQ5 A;  2UXC K;  3S3N A;  1QHT A;  4LC9 B;  4AHV A;  1VRU A;  4DCH A;  1T05 A;  3VQ6 A;  5AQV A;  1CZB A;  2I7P A;  1ZBU A;  3ZLJ A;  3I8D A;  3VQB A;  2KQ2 A;  4DSE A;  2BUP A;  1TK5 A;  5BPM A;  4DV4 K;  2GTD A;  5AQQ A;  4CJ4 A;  4CJV A;  4IDH A;  5J2M A;  3ZX3 A;  5B8H A;  3DLE A;  3EE9 A;  1E4F T;  4XEI A;  4A57 A;  3CPE A;  3VGL A;  1ZYQ A;  3BZK A;  4NYF A;  2ZM6 K;  4KTZ A;  1DTT A;  4M7X A;  3H1V X;  4OPH A;  4IFY A;  2OZS A;  3O4N A;  1NGB A;  3QFP A;  2KHO A;  5EX5 A;  1XNR K;  4W5T A;  3SMS A;  4LH5 A;  1TUU A;  4CCH A;  3L6Q A;  4CGJ A;  2GEL A;  4CD1 A;  3BF3 A;  3PX0 A;  3ZSR A;  1SL0 A;  3L2W A;  4J2B A;  3VES A;  1NKE A;  2ZJP L;  1X9S A;  1YAG A;  2NRV A;  3CM5 A;  4JI0 K;  4CZL A;  3IUC A;  3TTF A;  4YDU A;  1LWF A;  3QNN A;  4YHH K;  1UA1 A;  4JI3 K;  3MN7 A;  4Y1D A;  4DTP A;  4JAX A;  1NGE A;  1NM1 A;  4IJN A;  4E19 A;  2QXF A;  1MA9 B;  1W97 L;  4OLB A;  1JCE A;  1ZBH A;  1Z25 A;  1J6Z A;  5BN9 A;  1JJ2 M;  5AQO A;  3QIO A;  2CGK A;  1NOY A;  4GNI A;  4FW2 A;  3ENH A;  3THW A;  4BRD A;  1HYS A;  1JL1 A;  2PBD A;  1YUW A;  4DWI A;  5AQJ A;  3M8S A;  4M3U A;  4DR4 K;  1BUP A;  3SAH A;  3VQA A;  4G1Q A;  3THV A;  5F2R A;  2D0B A;  3SNN A;  4DSK A;  3L0Q A;  2QWQ A;  2GEM A;  2UXD K;  3D6R A;  1U6Z A;  2WC9 A;  1KAX A;  3NGY A;  4PKH A;  3S41 A;  3EKS A;  4FK2 A;  2JLE A;  1S1T A;  4FJI A;  4JYA K;  5GIO A;  4BR7 A;  4K0K K;  5GIP A;  4KHP K;  3O1B A;  1FW6 A;  1B9D A;  3JAM O;  1WNS A;  3I33 A;  5TKW A;  1EET A;  4DTX A;  1CXU A;  3U4L A;  5HL7 L;  3ZSX A;  3G25 A;  1N34 K;  4AF1 A;  4H03 B;  1EWQ A;  4FWL A;  5BN8 A;  4LF4 K;  1QSY A;  3A5L C;  1HNI A;  4BAC A;  4JKE A;  5HRR A;  4N5S A;  4YOY A;  3TAG A;  3THW B;  4B1Z A;  4MFB A;  5I42 A;  1TVR A;  1KQS M;  4CBW A;  4W5O A;  3CC7 N;  3OHR A;  1KCF A;  4BEC A;  5J1E A;  4BRL A;  1QS4 A;  3CCQ N;  1IH7 A;  2RKI A;  3NF9 A;  3CF5 L;  3TR8 A;  1BU6 O;  3WNG A;  3DOK A;  3AA5 X;  4DV5 K;  2WFB A;  2O8C A;  1VQL N;  5K14 A;  1BG3 A;  1KC8 O;  4OPA A;  4O44 A;  4E7L A;  3C94 A;  3LP2 A;  4RW7 A;  1REV A;  1W9H A;  5C12 A;  1T6C A;  3GG4 A;  1JLQ A;  4MO5 A;  3NVM A;  3AO4 A;  3FFI A;  4DB3 A;  4N76 A;  4MDB A;  1T44 A;  3BZC A;  1TL3 A;  4CVN E;  4FZY A;  3K9J A;  4EP5 A;  3MN6 A;  3VQ7 A;  2P9S A;  1VQ9 N;  3I56 N;  4I2P A;  2YV0 X;  4RTF D;  4CBX A;  1NJX A;  4DSI A;  3P31 A;  1NGJ A;  1YJ9 N;  3SJJ A;  3AO5 A;  1VQO N;  3HM9 A;  2RN2 A;  4KRE A;  4FW1 A;  1NK6 A;  3OYH A;  1SKR A;  3J8A A;  5EOY A;  4CGD A;  3K2P A;  2O8C B;  3S9H A;  1XHZ A;  4DTU A;  1TK8 A;  2PY5 A;  1RNH A;  3IG1 A;  3ZEU A;  3UKR A;  1NK0 A;  4JI2 K;  2D4W A;  3V4I A;  1C0T A;  3FZL A;  1NKB A;  4LD0 A;  1Q82 O;  4I9L A;  1Q86 O;  3K59 A;  1Q8I A;  3K5M A;  1SZ2 A;  5C15 A;  2JWL A;  2P9S B;  4ILJ A;  5KPZ A;  4JN4 A;  4PKI A;  4XH5 A;  3V9X A;  4DTR A;  5AQP A;  4CIE A;  4OO1 J;  4FJ8 A;  2IC3 A;  1LAV A;  1FKO A;  4H0T B;  5HBM A;  1KVB A;  5FRM A;  3BY5 A;  4CEE A;  3VER A;  2QKK A;  2G8I A;  4CHY A;  3PV8 A;  3MCA B;  1O13 A;  3OYE A;  1XMO K;  5IT9 O;  2P51 A;  4C8L A;  4DUZ K;  3DI6 A;  1HR0 K;  2IDO A;  4IG3 A;  3H45 C;  3ZEU B;  1YTA A;  4EAH D;  4ZTJ A;  3UKR B;  1S9G A;  1S72 N;  1UWB A;  1NJI O;  1IV0 A;  2VG6 A;  2CGL A;  4CHQ A;  3HOS A;  4B3S K;  1XMQ K;  1U47 A;  3O3H A;  2YKN A;  5FRN A;  5KTQ A;  1CXQ A;  3A2F A;  2PFU A;  3CJ9 A;  3V1R A;  5M1K A;  4LSN A;  3EZ5 A;  2Z1H A;  4DS5 A;  4LF6 K;  3IMX A;  1KD1 O;  4KB1 A;  1CLQ A;  1XNQ K;  3SQ1 A;  1Z26 A;  2BE2 A;  4HUF A;  3QIN A;  1VQP N;  4KHY A;  3EEQ A;  5FLX O;  1SS6 A;  3OYM A;  1V4S A;  2E5L K;  3LP0 A;  2HBJ A;  3A5N C;  4I6M A;  3ZSQ A;  1X3M A;  1XC9 A;  5JS2 A;  1L3U A;  3CET A;  5M1O A;  5AZI A;  4ELU A;  2HNY A;  4WYB A;  1EKE A;  3S3M A;  4MQ3 A;  4LF7 K;  2QTD A;  3GOI A;  4CFC A;  5BR8 K;  4OPK A;  4WQ4 A;  4BRQ A;  2R7Y A;  1RDW X;  2P9L A;  1S6Q A;  3OJU A;  4FWN A;  3KZB A;  4GV6 A;  1IBL K;  2A1S A;  3PY8 A;  3A5M C;  2ZQB A;  1BA1 A;  2E1Z A;  3CJ1 A;  4K25 A;  5KQD A;  3SV4 A;  3CD6 N;  1GLE G;  3DWL A;  1VSK A;  3VTH A;  4CEA A;  1NKC A;  3DLG A;  3ZSZ A;  3OYC A;  4QCL A;  4CHZ A;  4Q0B A;  1HYZ A;  1RT4 A;  4I6M B;  4JKF A;  4CK2 A;  2I7N A;  5AR0 A;  3MDQ A;  3E1Y A;  5AZI B;  3ZX2 A;  2E20 A;  3AY9 A;  1QZ5 A;  4JKH A;  3QEP A;  3NAE A;  4BVP A;  4C8O A;  4C8K A;  4DLG A;  4G9Z A;  5KRT A;  3LDQ A;  4HWI A;  4CGG A;  3V6D A;  3BF1 A;  4CJP A;  5M1N A;  2O8B A;  1BCO A;  2P9L B;  4CEB A;  5KGX A;  3K57 A;  1GLC G;  3IS9 A;  3C95 A;  1E4G T;  1NGH A;  3K58 A;  2A40 A;  1IBK K;  3AVH A;  4LY7 A;  4FYD A;  3ZSW A;  2VGM A;  3S3O A;  5AQF A;  4KHU A;  1VQ7 N;  4A2A A;  1BQN A;  2NRR A;  3RMA A;  4JKG A;  1L3T A;  3M5R A;  3NF8 A;  1ZXO A;  4ID5 A;  2Z1G A;  3AA4 A;  5FPD A;  3NH2 A;  3HJF A;  1QQM A;  4DTS A;  3O3F A;  3OYA A;  3ZT0 A;  3T1H K;  3HK2 A;  4UQG A;  1S6P A;  4C23 A;  3MX5 A;  1WSE A;  5BRH A;  3HOT A;  4PUO A;  3CCJ N;  3PX4 A;  3VQ9 A;  1RTD A;  3TAM A;  5EU7 A;  2O8B B;  3H08 A;  3SQ2 A;  4KRF A;  4FSV A;  3VQ8 A;  3CQ8 A;  3R8E A;  1JCG A;  1ZBS A;  1HJO A;  2G8U A;  4Z94 A;  3V9W A;  4LFA K;  1N32 K;  3VEX A;  3QB0 A;  3AVF A;  3VQ4 A;  2G8V A;  4B3M K;  3T1A A;  3H3O B;  4BRN A;  3F9K A;  3EY1 A;  3SQ4 A;  1QTM A;  4JRQ A;  2E6L A;  4CEO A;  4H5T A;  2RPI A;  4FJ5 A;  1NK7 A;  3KJV A;  3OYD A;  1M90 O;  4JKG B;  4CIG A;  1NJY A;  5AQH A;  4A59 A;  5EVZ A;  4KH4 A; 
#chains in the Genus database with same CATH homology
 3VET A;  1N8R O;  4A5B A;  2Q36 A;  2AP1 A;  4YOX A;  4CZM A;  1K8A O;  2QWP A;  4YDU C;  3SJH A;  1P90 A;  4A2B A;  4HTL A;  3LDO A;  2BUP A;  5M1Q A;  2C1G A;  4BGB A;  3O4W A;  5BPM A;  1ILY A;  3WXK A;  4C1N K;  5JIC A;  2GTD A;  1RGI A;  2GWK A;  3WT0 A;  4FWQ A;  4BR0 A;  5AQQ A;  4WFN L;  1QZ6 A;  3BEX A;  5E26 A;  4FOI A;  4IDH A;  3C65 A;  3ZX3 A;  4A5A A;  1TYQ B;  5B8H A;  5M1F A;  1QVG M;  3MMV A;  2Q0U A;  2YJE A;  1JCF A;  4QS9 A;  3EE9 A;  2PAV A;  3M1F A;  1M1K O;  1E4F T;  3QBW A;  3WUH A;  4BC5 A;  4XEI A;  4A57 A;  3NVK A;  3CPE A;  4H5W A;  3DLL L;  1HLU A;  3VGL A;  5GAD P;  2IVO A;  3CJA A;  5AQX A;  1YIJ N;  3WQU A;  3OBY A;  4BY9 C;  1YXQ A;  1QHA A;  4FO0 A;  1DGK N;  4AM7 A;  3L4I A;  3M3Z A;  3VEO A;  3ZET B;  3CJC A;  4B1U B;  4M7X A;  4FL9 A;  3NMU A;  4IZ9 A;  3H1V X;  1BO5 O;  2ZGZ A;  3FR0 A;  4OPH A;  2GX9 A;  2UYT A;  1YI2 N;  4QS8 A;  4BQZ A;  2V7Z A;  1NGB A;  3QFP A;  2KHO A;  4O8K A;  4BR9 A;  4BR5 A;  5EX5 A;  2OAN A;  4E1J A;  4IJA A;  3G6E N;  5AQL A;  3Q7B A;  4BG8 A;  4MDA A;  3IKM A;  5GAE P;  5CHI A;  2A3Z A;  3SMS A;  3FE1 A;  4H0Y B;  4BRG A;  3PIO L;  3TU5 A;  1TUU A;  4O5F A;  2BH1 A;  2HMP A;  3L6Q A;  3CCM N;  2GEL A;  4C1N I;  4CD1 A;  3VEZ A;  3BF3 A;  4FPA A;  3VES A;  1D4X A;  2QA4 N;  2ZJP L;  3MWT A;  1YF5 L;  5AQT A;  1YAG A;  2NRV A;  4FOE A;  4U7B A;  4BRH A;  3TTC A;  4CZL A;  3IUC A;  3TTF A;  4YDU A;  1ATS A;  5AQG A;  4ISG A;  4H0P A;  2Q97 A;  3HTV A;  5AQW A;  4BQL A;  2YHY A;  1NBW A;  3MN7 A;  2OTJ N;  4JAX A;  4MLH A;  3H46 O;  4BVO A;  1NGE A;  4JHD A;  1NM1 A;  2ASO A;  4H0X B;  4IJN A;  3SAG A;  1MA9 B;  3D2E A;  2ZWH A;  1W97 L;  2CGJ A;  1JCE A;  3KK7 A;  3VEW A;  4BC3 A;  1J6Z A;  1GLF O;  5BN9 A;  1WOQ A;  2Q2R A;  1JJ2 M;  5AQO A;  3TSQ A;  5AQS A;  3N4P A;  2CGK A;  3R6M A;  3CI5 A;  2KKZ A;  2HF4 A;  3F2K A;  4GNI A;  3EN9 A;  1MDU B;  3ENH A;  3T7Z A;  4R79 A;  3G71 N;  3T69 A;  4FVU A;  4BRD A;  3U8X A;  4EHU A;  4JKB A;  2PBD A;  3LL3 A;  1YUW A;  4FWP A;  5C2D A;  5AQJ A;  1C0F A;  3EZW A;  1BUP A;  2D1K A;  3SAH A;  3O9Q A;  3IDH A;  5JLF A;  3C6A A;  4GV3 A;  3A8Y A;  2W41 A;  5F2R A;  5KPT A;  2NRX A;  5C0Y A;  3TSU A;  3L0Q A;  2QWQ A;  2GEM A;  3OA9 A;  4BRO A;  4BR2 A;  5JLH A;  3D6R A;  4JD2 A;  1U6Z A;  4YOW A;  2QWO A;  1KAX A;  2WC9 A;  4PKH A;  4BC2 A;  2NRH A;  4H0V B;  2YCH A;  3S41 A;  3EKS A;  2J4R A;  5KQ8 A;  1OKJ A;  3WXL A;  2QWN A;  2QWR A;  4B1X B;  5GIO A;  1EQY A;  4BR7 A;  4BRI A;  3ID6 A;  2VGN A;  3QFU A;  5GIP A;  4B1V A;  4CZK A;  5JVG L;  3O1B A;  1P8Z A;  3VEV A;  4JHD B;  1NGI A;  4BRP A;  3I33 A;  1VQ5 N;  4ILG B;  3D2E B;  5TKW A;  2NLX A;  3U4L A;  5HL7 L;  4JEP A;  3G25 A;  5GIN A;  4AF1 A;  4H03 B;  3H1Q A;  4FWL A;  5BN8 A;  5LJV A;  1VQ4 N;  5C2F A;  3PLA A;  3WXM B;  1QQO A;  3A5L C;  2QM1 A;  2P9P A;  1YIT N;  5ADX H;  2GWJ A;  4JKE A;  1T6D A;  2CH5 A;  2A42 A;  3KHY A;  4YOY A;  3FGU A;  4MLE A;  4B1Z A;  3I8B A;  4NLB A;  1KQS M;  4CBW A;  3CC7 N;  3VGK A;  3OHR A;  5E84 A;  5M1P A;  2W00 A;  3D2F A;  5FPM A;  4BEC A;  1C0G A;  4H0O A;  4BRL A;  3CCQ N;  3GDQ A;  3AGR A;  3SAF A;  3SBG A;  4BR4 A;  1WUA A;  4FWM A;  4ILH A;  4BRK A;  3CF5 L;  5AQY A;  1HKC A;  3A5O C;  1Q7Y O;  1LOT B;  3DXK A;  4ISE A;  1BU6 O;  2WBN A;  3UKU A;  3VPZ A;  2E8A A;  3H3N O;  3H6E A;  2WFB A;  4JD2 B;  4M7Y A;  2D0O A;  2Q1N A;  4XH1 A;  3E9O A;  1VQL N;  3CMA N;  1KXP A;  1NGG A;  1IJJ A;  1BG3 A;  4CZF A;  5BPL A;  4IOX A;  3HZ6 A;  1HKB A;  2IIR A;  3LM9 A;  1KC8 O;  2HBM A;  3B8A X;  4OPA A;  1W2B M;  5ELZ A;  1GLA G;  4WFB L;  2JWK A;  4H5R A;  4IFE A;  3WXJ A;  4EHT A;  4WCE L;  1MWM A;  5AZJ A;  3GL1 A;  2QEX N;  3CCU N;  3SK3 A;  5C12 A;  1T6C A;  3GG4 A;  3JS6 A;  3O5B A;  3QBX A;  3VTI A;  2NRT A;  1NLV A;  1VAZ A;  3NVM A;  3P38 A;  4MO5 A;  4DB3 A;  4MDB A;  2FSN A;  3EKU A;  1GLL O;  1S3X A;  1T44 A;  2F9W A;  5CR4 A;  3JXU A;  4H5N A;  2IVP A;  5ADX A;  5FPE A;  3K9J A;  3QML A;  4WF9 L;  3SBT A;  2YHW A;  3MN6 A;  3VF6 A;  4BRF A;  2P9P B;  3EE8 A;  2P9S A;  1MWK A;  4GY2 B;  1XUP O;  4JK8 A;  3I56 N;  2GUP A;  1VQ9 N;  3LDN A;  3N4Q A;  3FZK A;  5DM7 L;  3VMF B;  4RTF D;  4CBX A;  4DHY A;  3A0I X;  1QVF M;  2FF3 B;  4YOV A;  1VQK N;  3P31 A;  1NGJ A;  1T3V A;  2VYP A;  4IWV A;  3OW2 M;  2NRW A;  1QQN A;  3VEN A;  3CPW M;  1YJ9 N;  1BWF O;  3D2F B;  5KPR A;  2E2Q A;  4CZJ A;  1IG8 A;  4JKC A;  3WEE A;  3EO3 A;  1VQO N;  3IFR A;  3KWG A;  5AFU A;  2E2N A;  3J8A A;  3DXK B;  1NWK A;  5EOY A;  3C6H A;  3UKU B;  5AQK A;  3O1W A;  2EWS A;  4YOR A;  5AQZ A;  5AQR A;  1HKG A;  1Z6R A;  3QIC A;  5GAH P;  3CXC M;  1OVY A;  3O08 A;  2Q31 A;  1ATR A;  4BRA A;  2P9N A;  4IEE A;  4IO9 L;  2ZGY A;  4PKG A;  3R9P A;  1V4T A;  4YOU A;  2P9K A;  4O8U A;  3W3D A;  2C1I A;  3ZEU A;  3UKR A;  3CQX A;  3I55 N;  1K9M O;  3R1X A;  3M6G A;  3O9U A;  4FPB A;  1KAY A;  2D4W A;  3FZL A;  5AZJ B;  1Q82 O;  1LCU A;  4FWO A;  2ZJR L;  1S22 A;  4CZG A;  2YI1 A;  4K43 A;  4K42 A;  5AQM A;  5F0X A;  2KLA A;  1Q86 O;  3F5T A;  5MLC Q;  4NB4 A;  4J8F A;  5CE3 A;  1SZ2 A;  2YHX A;  4DQ8 A;  5C15 A;  1YJW N;  2JWL A;  1ATN A;  2P9S B;  3O9T A;  4ILJ A;  5KPZ A;  1BOT O;  3O9R A;  3KVG A;  4JN4 A;  4PKI A;  2VCP A;  2HST A;  4XH5 A;  4WQ4 C;  4BGA A;  2F7T A;  5AQP A;  4OO1 J;  2QI2 A;  4JKD A;  1DKG D;  4H0T B;  3ATU A;  2FSK A;  4BEB A;  4Y0W A;  3WEE B;  2HBL A;  2ZJQ L;  3VER A;  3MCA B;  1X9J A;  1O13 A;  1VQM N;  3WQT A;  2W40 A;  5EY4 A;  3LDP A;  3CCL N;  3CHW A;  3FZH A;  2P9N B;  4BG9 A;  2Q0R A;  2E2O A;  4IXC A;  5AQU A;  2P9K B;  4YOT A;  2RHK A;  3H45 C;  3ZEU B;  2BTF A;  3MN9 A;  3U9D A;  3UKR B;  4EAH D;  1S72 N;  1NJI O;  5BRE A;  2CGL A;  4KBO A;  3HOS A;  5BR9 A;  4K41 A;  4IEI A;  3P4I A;  3PIP L;  2PFU A;  1NGC A;  3BUZ B;  3CJ9 A;  3O80 A;  5AQN A;  1XC3 A;  3HRG A;  4DKW A;  5M1K A;  1VQ6 N;  3DAW A;  4CJ7 A;  4ISF A;  3MX2 A;  3VGM A;  3IMX A;  1KD1 O;  1EO1 A;  2H3G X;  5I9E B;  1ESV A;  3CIP A;  2ZF5 O;  4IO8 A;  1YHQ N;  3HBT A;  4BC4 A;  1VQP N;  4CD3 A;  3CQY A;  4GV9 A;  1SS6 A;  1V4S A;  2ASP A;  1BDG A;  3CCV N;  4NO7 A;  3RSE A;  2HBJ A;  3A5N C;  4I6M A;  4NLC A;  4EIA A;  2YJF A;  1X3M A;  2HOE A;  1DEJ A;  3ENO A;  3CET A;  5JMV A;  3E9P A;  5M1O A;  1GLJ O;  3J7Z O;  5AZI A;  3VF4 A;  1Q18 A;  3FZM A;  5AFU H;  1NGA A;  4WYB A;  3CME N;  3O8M A;  2FLO A;  3VOV A;  2QTD A;  3GOI A;  4FWR A;  1NMD A;  4CZH A;  3CJ7 A;  3LDL A;  4WQ4 A;  4BRQ A;  4B9Q A;  1RDW X;  2QWL A;  3UB5 A;  4CZI A;  4XH4 A;  4XJX A;  2P9L A;  4JKA A;  3ATV A;  2ITM A;  4JK7 A;  4QS7 A;  4FWN A;  3KZB A;  5BRF A;  4GV6 A;  2CH6 A;  4BRM A;  1NGF A;  1HUX A;  4M63 C;  3FLC O;  4MO4 A;  3A5M C;  3D7E O;  3VEY A;  1BA1 A;  2E1Z A;  2ASM A;  4JNE A;  4FWK A;  3GBT A;  2FF6 A;  3CJ1 A;  4K25 A;  5KQD A;  4RWT A;  4B1W B;  2P9I A;  3CD6 N;  3G4S N;  1G99 A;  1GLE G;  2QWM A;  3DWL A;  3VTH A;  3F9M A;  1U2V A;  3AAR A;  2DPN A;  1GLB G;  3MWP A;  3DXM A;  4AM6 A;  5AQI A;  5F1X A;  3R3L A;  4F9O A;  1R59 O;  2F9T A;  4BE7 B;  1K73 O;  4L3Q A;  3MN5 A;  3RSE B;  5DM6 L;  4I6M B;  4H5V A;  4WFA L;  2A41 A;  1TUY A;  2V52 B;  4FWS A;  4JKF A;  3ZYY X;  3CCE N;  2I7N A;  5AR0 A;  1CZA N;  3CC2 N;  3MDQ A;  3E1Y A;  5AZI B;  3AAQ A;  2V7Y A;  2E20 A;  3ZX2 A;  1K8K A;  3AY9 A;  1QZ5 A;  3BP8 A;  3P39 A;  4JKH A;  3SMP A;  3OBW A;  3UE5 A;  4BVP A;  3C0B A;  4BRC A;  2V51 B;  4G9Z A;  4CBU A;  3LDQ A;  3HI0 A;  3RVC A;  1RFQ A;  3GE1 A;  4HWI A;  3CCR N;  4JK9 A;  3CER A;  3ID8 A;  3BF1 A;  5M1N A;  2P9L B;  1GLC G;  2IVN A;  4RCH A;  3FFK B;  3W0L A;  4WQ5 C;  5LJW A;  1E4G T;  1NGH A;  1VQN N;  1H1V A;  2A40 A;  2OTL N;  4GVE A;  3CC4 N;  3CCS N;  1BA0 A;  5LY3 A;  3CJB A;  2VGM A;  4PL8 A;  2QW9 A;  5BPN A;  2FSJ A;  1HX1 A;  1X3N A;  3MK6 A;  3LM2 A;  5AQF A;  3U9Z A;  3WXI A;  1SQK A;  4CZE A;  4BRE A;  2P9I B;  2WUS A;  1VQ7 N;  5HOO A;  1RDU A;  4A2A A;  3O6W A;  3VF2 A;  1YVN A;  1VQ8 N;  5H1S Q;  3AAP A;  1U2V B;  2A5X A;  3ULE A;  3C7N A;  3DXM B;  4CI6 A;  2NRR A;  2RE2 A;  3ENB A;  1HPM A;  3AGK A;  1KAZ A;  5BRD A;  4JKG A;  5FPN A;  2P9U A;  3M5R A;  2NZT A;  4KH5 A;  1ZXO A;  2VWB A;  2E2P A;  5FPD A;  2FXU A;  3ZX0 A;  1QQM A;  1XQS C;  3TPQ A;  3TTD A;  1GLD G;  3DJC A;  1Z05 A;  1K8K B;  4A61 A;  5JVH L;  4C23 A;  4EFH A;  3MX5 A;  5BRH A;  3HOT A;  5TKY A;  3HSC A;  2E1Y A;  3CCJ N;  3MCP A;  5GAG P;  4B1Y B;  3TSP A;  1ZC6 A;  2D0P A;  2QXL A;  3K9K A;  2HF3 A;  4FSV A;  1Y64 A;  2YX6 A;  4KH6 A;  4UY8 O;  2AA4 A;  1SAZ A;  1JCG A;  1ZBS A;  1HJO A;  1TYQ A;  1DT9 A;  3E9L A;  4Z94 A;  3R8E A;  3FZF A;  5C10 A;  3L4Q A;  3KWI A;  4PL7 A;  2HBK A;  3VEX A;  1NGD A;  1YJN N;  3E66 A;  3QB0 A;  4PHT X;  4A62 A;  3Q7C A;  3SLC A;  4IOA L;  2NRZ A;  3H3O B;  4BRN A;  1Q81 O;  2A6A A;  3EL2 A;  4H5T A;  2E88 A;  3ZET A;  4IOC L;  3C7N B;  3ULE B;  3QDK A;  4WQ5 A;  3HM8 A;  4LC9 B;  5EXW A;  4JKG B;  4DCH A;  1M90 O;  2P9U B;  5AQV A;  3O9S A;  2NNW A;  5AQH A;  5EVZ A;  4KH4 A;  4A59 A;  2I7P A;  4U67 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...