3DXMA

Structure of bos taurus arp2/3 complex with bound inhibitor ck0993548
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
414
structure length
399
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Characterization of two classes of small molecule inhibitors of Arp2/3 complex
pubmed doi rcsb
molecule tags Structural protein
total genus 130
structure length 399
sequence length 414
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3dxmA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxmA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxmA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3dxmA04
1ZC6A 4H0XB 2HF3A 1T6DA 5BN8A 3W0LA 1BWFO 5AQJA 5KPRA 5EVZA 5BRHA 1SQKA 3D2EA 3QFPA 4BRGA 5BRFA 4FPAA 5I9EB 1BA0A 4B1UB 4PKHA 4B1VA 1TUYA 3U4LA 3ULEB 3VPZA 4CZGA 3ULEA 1ATSA 2E2PA 2V7ZA 4JD2B 3FZHA 2IVOA 3HI0A 1QZ5A 3VGLA 1SZ2A 3GG4A 1NBWA 2CH6A 1DGKN 3LDNA 2ITMA 3VF2A 2YCHA 3ZX2A 4BR4A 4BR7A 3S41A 4H5TA 3D7EO 5F1XA 1RGIA 2Q31A 3KHYA 1QQNA 3HTVA 2YHXA 4FWKA 1H1VA 1BOTO 2QXLA 3ZX3A 4CZHA 4ISEA 1NGJA 4MLHA 1BUPA 3VGMA 4IXCA 2QWLA 3WQUA 4BVOA 3I8BA 2D1KA 1QZ6A 1ESVA 1Q18A 1C0GA 2E2QA 3O4WA 1CZAN 2QWOA 1GLLO 2FSJA 3AAPA 2ZGZA 3FE1A 4YDUC 4KBOA 3CI5A 1JCEA 2VWBA 3SMPA 1T44A 3CJ7A 4DQ8A 2NZTA 5AQZA 5BN9A 4BQLA 1HUXA 1X9JA 3H1VX 4H5WA 3H1QA 3H3OB 2CGKA 3HZ6A 1KAXA 2QWMA 5FPMA 3QB0A 1NM1A 3SJHA 2AP1A 3QDKA 5AQIA 2P9SB 2V7YA 2P9SA 3CJCA 5AQYA 5AQFA 4J8FA 3HBTA 3AY9A 1K8KB 4CD1A 5AQUA 5LJWA 1K8KA 3BEXA 3EN9A 1KAYA 2GWKA 1NGDA 5KQDA 2GTDA 4BGAA 1NGHA 2P9LA 4F9OA 1QQOA 4XEIA 2ASOA 2NRHA 2P9KB 1ZXOA 2D0PA 4RCHA 2P9KA 2Q0RA 5KQ8A 1DKGD 3GL1A 3A8YA 4M63C 3KVGA 1GLEG 2Q1NA 2CH5A 3EKUA 1YXQA 5BREA 5BRDA 3H3NO 3D2FB 1ATRA 3D2FA 2QWNA 4H0OA 1GLAG 3VF6A 2HF4A 3O80A 2W41A 5AQXA 2FF3B 4CZFA 4CZIA 4Y0WA 3VF4A 1HKCA 2F9WA 2D0OA 4FL9A 4A2AA 1S3XA 3ENOA 3WT0A 4JHDB 1SAZA 5LY3A 5FPNA 4BREA 4JHDA 3FGUA 4ISFA 1BG3A 4B1WB 4IO8A 3F9MA 2A5XA 4K25A 3O08A 4M7YA 4EFHA 1DEJA 3C7NB 2EWSA 4Z94A 1Y64A 3WXLA 2FF6A 4CZKA 3C7NA 3O6WA 3VGKA 2HOEA 3VOVA 3LM2A 5FPEA 2VCPA 4LC9B 4A61A 5EXWA 4A62A 1NGBA 2E20A 3IDHA 3LDPA 4FWRA 4FPBA 4MLEA 2FXUA 2PBDA 4JD2A 3GDQA 2CGJA 3GE1A 1NGIA 3QBWA 3A5LC 1JCFA 1XUPO 2A6AA 3H46O 5AQQA 2GWJA 3UE5A 3MN7A 4CBWA 1MWKA 3A5OC 4JNEA 4BVPA 4EIAA 4FWMA 3VEVA 4IWVA 3DWLA 3VEOA 2HMPA 3VEZA 2VYPA 2A42A 2I7PA 1ATNA 1WUAA 3CJ9A 3WQTA 2ASPA 4DHYA 3R6MA 4YDUA 3A5NC 2E88A 5ADXH 3ZETB 4BRDA 3ZETA 3OHRA 2IVNA 2GUPA 3SLCA 5EY4A 4L3QA 3B8AX 5E26A 3BUZB 1V4SA 3VEWA 1GLDG 5BPLA 2ZWHA 1LOTB 2NLXA 3QICA 3FR0A 4QS9A 3FZKA 1S22A 3CJBA 3CQXA 2V52B 5KPZA 4BR0A 2UYTA 4IJAA 3W3DA 1KXPA 4CJ7A 4BRLA 4CBUA 3VERA 3UKUB 4FWSA 1MDUB 4K43A 4B1ZA 3BP8A 3LDQA 3UKUA 4AM6A 3GBTA 3JS6A 4QS7A 5AQGA 2YJEA 4FWLA 5FPDA 1NGAA 4M7XA 4NO7A 3QFUA 4BG8A 3WEEB 1R59O 2QWQA 4WYBA 3WEEA 1TUUA 1J6ZA 4BC3A 3MN9A 1U2VB 3ZEUB 2QW9A 5JLHA 3LDOA 1U2VA 3MN6A 4WQ4C 4BR9A 1BA1A 2I7NA 5ADXA 3P4IA 3EKSA 3SK3A 1BO5O 3LM9A 3O1BA 1YUWA 5AQMA 2Q36A 2ZGYA 3A5MC 1NLVA 4ISGA 3ATUA 4BRAA 4CZJA 3DXKB 4BC2A 1HLUA 4CBXA 2E1YA 1EQYA 1C0FA 5F0XA 5F2RA 1NGGA 3FZLA 1NGEA 3MN5A 1E4GT 3DJCA 1GLJO 1P8ZA 4WQ5C 3FZMA 2E2OA 3JXUA 2FLOA 4PL7A 4GY2B 2V51B 2IIRA 4FWNA 5B8HA 4DCHA 4BG9A 3DAWA 1T6CA 1NWKA 4E1JA 3EZWA 2AA4A 2FSNA 4H03B 4AM7A 5BPNA 2IVPA 5AFUA 4BC4A 3M1FA 5AQTA 3H45C 3RSEB 4XH4A 1Z6RA 2P9NB 3RSEA 3L0QA 4GNIA 3CQYA 2P9NA 2P9UB 2YHYA 3IFRA 5AQWA 2P9UA 1BU6O 1RDWX 1MA9B 1KAZA 1D4XA 4H0TB 1NGCA 4BROA 2J4RA 1HKBA 3O1WA 1ZBSA 4PL8A 4RTFD 4BRIA 3CERA 5EX5A 2P9IB 3TPQA 4FOIA 3L4IA 2F9TA 2P9IA 1E4FT 5AQSA 5AQLA 1G99A 3IUCA 2ZF5O 4BQZA 3D2EB 3FLCO 5ELZA 3VENA 2E8AA 5JICA 5AQRA 4H0VB 3ATVA 3VEXA 3IMXA 3WXJA 4CD3A 2A40A 4FSVA 5AQNA 2GEMA 3QMLA 4CI6A 3VETA 1NMDA 2Q2RA 4XH5A 5AQKA 1V4TA 1XQSC 4H5RA 4CZMA 2Q97A 3R9PA 2GELA 4BGBA 3LL3A 4DB3A 5CE3A 3UB5A 1X3MA 5AR0A 1HX1A 2QWPA 3QBXA 3FZFA 5KPTA 4BC5A 3C0BA 1RFQA 3UKRB 3ZX0A 1XC3A 3UKRA 1JCGA 4BRNA 4PKIA 3ID8A 3O8MA 2ASMA 4NB4A 1HKGA 4MO5A 1IG8A 3WUHA 5EOYA 1YVNA 3CIPA 4BRCA 3CJ1A 3VESA 3CHWA 2A41A 4FO0A 3M3ZA 4EHTA 1U6ZA 4EHUA 4O8KA 3BF3A 5TKYA 1LCUA 3AAQA 3A0IX 1HPMA 3WXKA 1GLBG 2H3GX 4FWPA 5AQHA 3AARA 2W40A 2KHOA 1OKJA 5LJVA 3R8EA 2BTFA 4H5NA 5JLFA 1WOQA 2YJFA 4H0YB 2D4WA 2BUPA 3J8AA 3MCPA 5AFUH 1NGFA 4WQ4A 5BPMA 3O5BA 4PKGA 4JAXA 4H5VA 5BR9A 3M6GA 4CZEA 4K42A 5AQPA 1QQMA 1GLCG 3EO3A 3H6EA 4FWOA 3ZEUA 1IJJA 4BRQA 4H0PA 4B1XB 2DPNA 3GOIA 4K41A 1TYQB 4O5FA 2YI1A 4BRKA 1TYQA 3U8XA 4XH1A 2WUSA 4I6MB 3G25A 4I6MA 4JN4A 2OANA 3DXKA 3HSCA 4WQ5A 1HJOA 2QM1A 1QHAA 3BF1A 4IZ9A 5AZJB 1BDGA 2PAVA 5AZJA 4EAHD 2P9LB 3DXMB 1MWMA 2FSKA 3I33A 3FFKB 3DXMA 4BRHA 2Q0UA 5E84A 1Z05A 4BRPA 3TU5A 3CJAA 3L6QA 1X3NA 4C23A 4IJNA 2A3ZA 2CGLA 3VEYA 3U9DA 4MO4A 4CZLA 4RWTA 5AQOA 4BRMA 4BR2A 3ENHA 2E2NA 4FOEA 4HTLA 4B1YB 5AZIB 5JMVA 3MK6A 3MMVA 5AZIA 4B9QA 3MDQA 4HWIA 3SMSA 1GLFO 3U9ZA 2QWRA 2P9PB 4A2BA 2YHWA 3CETA 3KZBA 3HM8A 2P9PA 3LDLA 4BR5A 2E1ZA 4QS8A 4FWQA 3WXIA 5AQVA 4BRFA 1YAGA 3EL2A
chains in the Genus database with same CATH superfamily
1T6DA 3W0LA 3R3LA 5AQJA 3D2EA 4B1UB 4PKHA 4DQRA 2G8IA 1SV5A 3ULEB 4B9MA 3NHGA 3E01A 4ZHRA 2E2PA 4FJLA 2GUIA 2V7ZA 3M8SA 3CMAN 3HI0A 4B9TA 4OLAA 1REVA 2WOMA 2PFUA 3CCJN 3V4IA 1NJWA 2G8VA 3K5LA 4OLBA 4E0DA 2ITMA 2YCHA 1I94K 1T3VA 1VSJA 1RGIA 4AQYK 4IFYA 4DTNA 2YHXA 3TABA 4CHPA 4CEFA 1HYZA 3ZT2A 3AGKA 4CZHA 1WSFA 2X78A 4JKDA 4DUYK 4CGGA 1D8YA 1EWRA 4DTOA 4KHWA 4JKGB 2JLEA 1NJXA 5KRTA 2D1KA 1VQMN 4Z0UA 1Q18A 1KFSA 4DV5K 3KLFA 4FJMA 1JLAA 4CIFA 1CZAN 3DLGA 3FE1A 2B4JA 1S72N 3LALA 4LF7K 2VWBA 3ZT3A 4DQ8A 4DV0K 3LAKA 1YT3A 1YIJN 3H1VX 2HBKA 1Q9XA 3PSFA 4DTUA 3HZ6A 4BDYA 4FVUA 1NM1A 1VSFA 4JI1K 3QDKA 5AQIA 1C1BA 5C15A 1VQKN 2ZJQL 3HBTA 3HSTB 3AY9A 3MCAB 4J2DA 5AQUA 2O8FA 1IBMK 3QETA 3F2KA 4M3RA 1KSPA 3MWTA 4F9OA 4DFMA 3G4SN 4DQPA 4ZTJA 1RTIA 3D6RA 2P9KB 1ZXOA 4TSXA 3ENBA 4B3MK 1NNEA 4M63C 2RHKA 2CH5A 1TL3A 3L2QA 3NVKA 2O8BA 1YXQA 3MX5A 1EX4A 3H3NO 3D2FB 3TTCA 3NAEA 1QVGM 4IFEA 1YF5L 1NG9A 5SZTA 3M8PA 1M1KO 3O80A 1IKXA 4BE1A 4Y0WA 1RTDA 4F3TA 4FL9A 4BWJA 1TK0A 3T19A 5LL6Z 4BREA 5CZ1A 4QCLA 3THYB 3P5JA 1C1CA 4K25A 1RBVA 3O08A 3PUFA 3ZT1A 4M7YA 3ZSYA 3WXLA 2FF6A 4K8XA 3C7NA 4Z4IA 3SV3A 4PY5A 2OA8A 1YVUA 3NF9A 2PY5A 5EXWA 4A62A 1NGBA 2YV0X 3DOLA 3LDPA 4FWRA 3THWB 1U48A 2FXUA 2PBDA 3GDQA 4H8KA 3AV9A 1TAQA 2OTLN 1VQ6N 3QBWA 1GOAA 2OPQA 2WFBA 2W42A 3S3OA 4KI4A 2GWJA 3AVKA 3M8RA 4CBWA 3OYHA 3VTHA 3OYKA 2W6LA 2A42A 5HRRA 4Z4CA 1XWLA 1IH7A 4JI7K 5DM7L 1WUAA 4B3SK 4WE1A 3OVNA 1RT1A 2E88A 4DLGA 3VN5A 1CLQA 1L3TA 2IVNA 3KKSA 4IKFA 4CJ5A 2XY7A 4WF9L 3B8AX 4FZYA 1RT2A 3OS1A 4YOUA 2UUBK 4PWDA 5BPLA 3I56N 1VSMA 3RR7A 3J81O 3T1AA 1S22A 4CEDA 5C25A 4CF0A 2V52B 3VQ8A 4BR0A 4OO1J 4IBNA 4N47A 1KFDA 3KK7A 4CHNA 3K9KA 5CHIA 1Y97A 4W5TA 3HK2A 3UKUA 4YOYA 3SPYA 2NRRA 4QS7A 2QA4N 2YJEA 4FWLA 3MXIA 4CE9A 2D0BA 1S1WA 2O8DA 4C8NA 1NOYA 1KLNA 2QWQA 3WEEA 1TUUA 4CHOA 3C65A 3SAGA 4CJKA 1U2VB 3K5MA 2A1RA 4NYFA 2I5JA 2O8CA 3NH0A 2I7NA 3C95A 3P4IA 3O9QA 4CJFA 4DS4A 1DTQA 1X9SA 5AQMA 3A5MC 4BECA 4J2AA 1HYSA 1P90A 3LANA 3DXKB 1RT7A 2JWLA 3DMJA 2YX6A 1S9EA 3NVMA 3MAQA 4RW6A 4JKBA 1TGOA 3FZLA 3TWHA 1NGEA 2BE2A 3MN5A 1E4GT 3VQEA 1KVBA 1P8ZA 3AVGA 4WQ5C 4OKEA 1JXEA 2NRTA 3AGRA 4M3XA 2DFFA 4PL7A 2IIRA 3DAWA 1NWKA 3EZWA 4AM7A 5J2PA 5BPNA 5AFUA 3VMFB 5AQTA 4XH4A 3K58A 4IDKA 3L0QA 3CQYA 4GW6A 3DI6A 2YHYA 2IS3A 4A5AA 3P1GA 1ZYQA 4DTXA 5M1PA 1RDWX 1MA9B 1RT3A 1NGCA 3KK1A 3CFOA 4DSKA 2YNIA 1ZBSA 3AVHA 4JI4K 4O0JA 4BRIA 5EX5A 4FOIA 2HVIA 2Z1GA 3RMBA 2HHVA 1G99A 3NF6A 5JS2A 4B9VA 4HCCA 3BZCA 3MWPA 5C2FA 3PSIA 4DTRA 4FYDA 1ZBUA 3VEXA 3IMXA 4CJQA 2AJQA 3KK2A 1CZ9A 4XH5A 5AQKA 1V4TA 1XQSC 3ZT0A 4CK1A 4CZMA 2Q97A 3B6PA 2GELA 4DG1A 3LP1A 2PYJA 4LFBK 2PZSA 4DB3A 3UB5A 4IOAL 1X3MA 2QEXN 4JK9A 3FZFA 1LW2A 2OPRA 3T1HK 1RFQA 3ZX0A 1J5OA 1XC3A 4DMNA 3UKRA 3RVCA 4LF9K 1JCGA 4BRNA 4CEEA 4FLWA 2KZMA 1NK4A 3O8MA 4N41A 1KC8O 5GAEP 2DFHA 4JLHA 1ILYA 4BRCA 4FO0A 5D3GA 1U6ZA 4O8KA 1FXXA 5HBMA 2C1IA 3SUQA 1GLBG 1G15A 5CR4A 1OKJA 1M90O 3PLAA 5JLFA 2RKIA 2YJFA 4M3ZA 4WQ4A 3O5BA 4H5VA 4W5RA 5FRNA 4CZEA 2HW3A 5KI6A 3BDPA 4B8AB 2D5RA 4A59A 4ELVA 1S6PA 5C42A 3TTDA 1IJJA 3B6OA 2DPNA 4K41A 3NFAA 4O5FA 1TYQA 2VQFK 3Q7BA 1WSJA 4I6MA 1LWFA 1IKYA 2OANA 3HSCA 4I9LA 1HJOA 2F96A 4OPAA 5AZJB 1C6VA 4Z4FA 4EAHD 1VAZA 4FW2A 5GIOA 2Q0UA 4JRQA 1Z05A 1N34K 5AJ3K 4C23A 2G8FA 3JSMA 3PX0A 2CGLA 3U9DA 2YNFA 4CZLA 1ZBFA 1ASVA 3C6UA 3VQ6A 4F2SA 1J54A 3E9PA 3MK6A 5AZIA 3QO9A 1D9DA 3VQ7A 2VG7A 3MDQA 1C1AA 1NMNA 3JYTA 2HBJA 3IRXA 2P9PB 4B8CA 4AHTA 4JKEA 2KFNA 2E1ZA 4F8RA 1L5UA 4QS8A 3WXIA 4BRFA 1IBKK 2KW4A 4O5BA 4M3TA 4FLUA 1BWFO 3SV4A 5KPRA 5EVZA 2KLAA 4E7IA 4FJGA 3QFPA 5BRFA 4FPAA 4DKWA 4B1VA 3VPZA 4CZGA 3ULEA 3L3UA 3DLKA 4JD2B 3FZHA 3MX2A 2KZZA 3ASMA 1QZ5A 3K5NA 1OVQA 2RE2A 3OY9A 5KGWA 4XIUA 4WFNL 1DGKN 3VF2A 3MEGA 3ZX2A 3OW2M 4BR7A 3S41A 3D7EO 2DTUA 3KHYA 3SZ2A 4AHVA 3HTVA 3NBPA 1RT4A 3V6DA 4KHQA 1BI4B 1FJGK 1H1VA 2QXLA 1TV6A 3KLIA 4NXNK 1NGJA 1BUPA 2G8HA 3VGMA 3MECA 5M1NA 4FK2A 4PHTX 4JKGA 3OYAA 4KB1A 3NH1A 4B3RK 1QZ6A 3CFPA 3K57A 4ICLA 2E2QA 1T05A 1VSHA 1J9AA 2FSJA 1VSKA 2ZGZA 2F8TA 1JCEA 2F4VK 1T44A 4FJHA 4GV9A 3CCUN 1Z26A 5BN9A 3WXMB 4ILHA 5HP1A 1JLBA 2ZM6K 4H5WA 3H1QA 1BQNA 2G8WA 1KAXA 1HQEA 2UXBK 5FPMA 4FM1A 3OYJA 4CJEA 4GVMA 1RDAA 5IWAK 2X6SA 1WSHA 1UA0A 1XMOK 3HP9A 2P9SB 2V7YA 4CF9A 4J8FA 3OTOK 5HLFA 4M42A 5LJWA 1D9FA 3EN9A 2GWKA 4BY9C 4JS5A 1NGDA 5C24A 4GV6A 5J2NA 2WBNA 4HTUA 2VGNA 1QQOA 4AHSA 2ASOA 4B9SA 1XNQK 4RCHA 2P9KA 1VQON 1SL0A 3GL1A 3A8YA 3EKUA 1TL1A 1XHXA 2P1JA 3CCLN 3AVBA 4CEAA 3D2FA 3LDSA 3K9JA 1WB9A 4CZFA 2HNDA 3VF4A 2D0OA 4OVLA 4A2AA 1S3XA 2GBZA 3ID6A 4CJVA 1SKWA 4JHDB 4JEPA 5LY3A 1W2BM 5FPNA 1R0AA 1WLJA 3THYA 4YOTA 4GKJK 3M5RA 1Y64A 4KI6A 4C8LA 3VGKA 3ITHA 1CXQA 3ZSZA 3SAHA 4OKJA 1NK9A 3J7ZO 3SUOA 2E20A 2X6NA 3MEEA 3QLHA 4G1QA 3THWA 2HHXA 1OH5A 2CGJA 4DSFA 3SI6A 4FVMA 1HMVA 4U67L 3A5LC 4CF1A 1XUPO 2A6AA 5AQQA 2OTJN 1T03A 1IO2A 3KD5E 1EXQA 3HPGA 3A5OC 4EIAA 4YNQA 3ZYYX 3P83D 3VEVA 1Q86O 3IKMA 4IWVA 4EP4A 3DWLA 4JV5K 2I7PA 1U47A 1ATNA 2IDOA 3CJ9A 1XI1A 2NRVA 3E66A 2P51A 2HVHA 4YDUA 1B9DA 5C2DA 3ZETB 4BRDA 4E3SA 4I2PA 3SLCA 5T7BA 3VA0A 1IG9A 1KVAA 3U3YA 1S1TA 3J80O 4L3QA 2OYQA 2F7TA 1O13A 2IOCA 1GLDG 3DOKA 3NGZA 4Z4HA 1SS6A 2D0CA 4CFAA 3SYZA 4BEBA 3CQXA 4DR3K 3OS0A 1QE1A 5DMRA 2HBLA 1B92A 2HHSA 3LAMA 2UYTA 4K8ZA 1KCFA 2G8KA 4IJAA 4CJ7A 1RBTA 1VQPN 4BRLA 2UUAK 1MDUB 4AM6A 3GBTA 4IEIA 3AO2A 4DR2K 4KPYA 1BHLA 3L4QA 2Y1IA 2QK9A 3QFUA 4DLEA 3AO5A 4BG8A 4J2EA 3J7AP 1RDUA 3V1OA 4DTMA 1WSIA 3CCQN 1A5VA 4IFVA 4BC3A 2IC3A 3ZEUB 2QW9A 1VQ5N 3LDOA 1U2VA 3PIPL 4WQ4C 4DTSA 1HJRA 5ADXA 3EKSA 3SK3A 1YHQN 1BO5O 3LM9A 2FBXA 3OBYA 2RPIA 1NLVA 2DFEA 2O8EA 1X1PA 2E6LA 1RTHA 4KH4A 4BDZA 4CZJA 3ZSVA 3VQPA 3CPWM 1RILA 4Z4GA 2E1YA 3ZSQA 5F2RA 4FM2A 3IAYA 1X9WA 1F21A 1GLJO 4M41A 3QEVA 3FZMA 2E2OA 4DTJA 3HOSA 3ALYA 1NK5A 4FWNA 4CESA 4Z4EA 1RT5A 3SQ1A 2BGGA 3P31A 4H03B 2AA4A 2FSNA 3T3FA 4YOVA 2VWJA 4FM0A 4C1NK 1LWEA 5EU7A 1Q9YA 1Z6RA 2P9NB 4KH5A 2P9UB 2X74A 1N6QA 3O9TA 1VSLA 3IG1A 1KAZA 2ETJA 1HKBA 1VSDA 3HO1A 3O1WA 4RTFD 2P9IB 4DFKA 2F9TA 4CJRA 1E4FT 3CXCM 1NKEA 3K59A 4DFJA 4NCAA 2ZF5O 4JS4A 4BQZA 3AA5X 3D2EB 3WNGA 5J1EA 4JI0K 5JICA 3CC7N 5AQRA 4DU4A 4CD3A 2VQEK 3G6EN 3QMLA 3OYNA 2Q2RA 4E1MA 4H5RA 2B6AA 3ZCMA 3AA4A 2NRWA 3S3MA 3WNFA 1QSSA 3QBXA 4ZTFA 1SKSA 3Q7CA 3S3NA 1JLEA 4A5BA 2Z1JA 3RMCA 1DLOA 3CYGA 3AVIA 3PIOL 4MO5A 3THXA 3PX6A 3OA9A 3CJ1A 3VESA 3CHWA 4B9LA 1FK9A 3AAQA 2RF2A 3A0IX 3O4QA 3CM6A 4CIEA 4JKAA 5AQHA 3RMAA 3T7ZA 3VQ4A 1VQ7N 3OBWA 1HYVA 5BPMA 4JAXA 3SNNA 3H6EA 4G9ZA 2PYLA 2FC0A 2WUSA 3VTIA 4GMJB 4CGIA 4ILJA 1LAWA 4FLXA 2VGMA 4PQUA 4OPKA 1QHAA 4IZ9A 3TARA 5SWMA 5AZJA 4DV6K 3K5OA 3DXMB 1MWMA 2FSKA 3DLRA 4CERA 4X64K 4BRPA 5HROA 4KFBA 3VEYA 1S1VA 4CHQA 2HHTA 4MO4A 2YKMA 4BRMA 4BR2A 4FLTA 1NKBA 3N4PA 1C0MA 1W0HA 3HYFA 4KTZA 1QTMA 1BIUA 4B9QA 4FZZA 1N8RO 4HWIA 3SMSA 3SQ2A 1GLFO 1UA1A 3LP3A 2HHUA 2YHWA 2P9PA 4BR5A 1VQ9N 5LMNK 1JLCA 2JGUA 4MQ3A 3EL2A 2DY4A 1ZC6A 2HF3A 2XY6A 1LW0A 3HPHA 1CZBA 4OX9K 2YNHA 5BRHA 1SQKA 5I9EB 1TUYA 3U4LA 4CEBA 3O9RA 1ATSA 2VG6A 1K73O 4YOXA 1IKVA 2IVOA 4L8RB 3VGLA 4OKKA 1WBDA 2XRIA 2CH6A 3TAPA 5FDLA 3CC2N 3EZ5A 3K2PA 2Q3SA 4DV2K 4H5TA 2ITGA 5F1XA 2Q31A 4CEQA 4MDAA 4C8MA 1BCMA 1QQNA 3EEQA 1BI4A 1DT9A 3TANA 1YJ9N 3CCEN 4MLHA 3MEDA 3MXJA 4KHUA 4IXCA 2HNZA 2QWLA 3OYMA 3WQUA 4FZXC 4BVOA 3I8BA 2R7YA 2WTUA 4IOXA 3AVAA 3P39A 1KTQA 3AAPA 4O8UA 4YDUC 3TSQA 4JK7A 4KBOA 1OH8A 3CI5A 1FKOA 3SMPA 2FBTA 3CJ7A 2NZTA 1XNRK 3TAGA 4JK8A 3PY8A 1HNWK 1UAXA 4HUFA 2E6MA 3DM2A 3JAMO 2QWMA 1VK0A 2A1SA 4NCGA 2NRZA 2AP1A 4CGDA 4DV1K 2GX9A 2W6KA 1W7AA 2P9SA 1EETA 2ZD1A 5AQFA 3I0RA 4V19S 1TAUA 4IOCL 4DV7K 1K8KB 4CD1A 4AHCA 3G0ZA 3OYFA 3KLEA 3BEXA 1MU2A 3NF8A 1KAYA 3RMDA 1U4BA 3SQ4A 4ELUA 5KQDA 2LSNA 2GTDA 4BGAA 2P9LA 4R5PA 3QIOA 2OZMA 4XEIA 2NRHA 3AA3A 5FROA 4LSNA 4B08A 3SUNA 2D0PA 1A5WA 2Q0RA 5KQ8A 4MFBA 3NF7A 2EX3A 1KVCA 1JL2A 1GLEG 3KD1E 3OYDA 1NOZA 3THVA 1HNIA 4PA1A 3I8DA 5C0YA 1ATRA 4BE7B 3L2UA 5FRMA 2QWNA 4CIGA 3VF6A 4FXDA 2P5OA 4E72A 2W41A 5AQXA 4CZIA 4FW1A 2JWKA 1SL1A 1HKCA 5CZ2A 2F9WA 3ENOA 1RDCA 4FK0A 4JHDA 1ZBIA 4FLYA 4B1WB 4IO8A 1I3AA 3SQ0A 3PX4A 4ID1A 2EWSA 4Z94A 3O6WA 3DLBA 3U6FA 3VOVA 4KHSA 1HRHA 1Z25A 3LM2A 4AHUA 3LZJA 4AH9A 5FPEA 3KIOA 4A61A 4FJNA 4K0KK 3OS2A 4FJKA 3KJVA 3CCMN 3QESA 3CQ8A 1NGIA 3AVCA 1SUQA 3H46O 2QKBA 4LH4A 3UE5A 1HNVA 1VQ8N 3N4QA 2QI2A 2W00A 1MWKA 1IV0A 3C6TA 1W9HA 1E3MA 4FJ7A 3KLGA 3VEOA 2HMPA 3VEZA 3S5TA 2VYPA 4LFCK 4QOZB 1XHZA 5HRPA 4IEEA 4E7KA 3WQTA 2ASPA 4DHYA 1W97L 3R6MA 1TK8A 1BCOA 4Y1CA 4EP5A 3A5NC 2EHGA 5ADXH 3ZETA 1N32K 4FJ5A 4FJ9A 2O4GA 2GUPA 4Q0BA 3V9WA 4KKOA 1Q81O 4C1NI 4F4KA 3DLEA 2NLXA 4KTQA 4QS9A 1RBUA 3DLHA 1BL3A 3LP0A 1S1UA 2HBMA 1Q8IA 3EE8A 4JYAK 3W3DA 3KTQA 4CBUA 1GOBA 4FWSA 4K43A 3DRPA 3LDQA 3PO4A 3HM9A 3JS6A 1TKTA 2ZJPL 4NXMK 5FPDA 1NGAA 1NK6A 1HPZA 4M7XA 4NO7A 5GADP 4DR6K 1JLQA 1T8EA 1R59O 4M3YA 5DK5A 4W5NA 4WYBA 3CPEA 4JRPA 2F8SA 3QNNA 4RW4A 2ZE2A 4UY8O 3G10A 4B9UA 3SBGA 4CJ4A 4CHYA 4AHRA 2OPSA 4FJ8A 3L3VA 3DYAA 4BR9A 3L2RA 1XMQK 2C1GA 1YUWA 4DR5K 4ISGA 4KV8A 4BRAA 4B3TK 1VSIA 1B9FA 4CBXA 3QIPA 4KO0A 3QERA 1LAVA 4GKKK 3NDKA 1EP4A 3JXUA 4GY2B 5M1QA 1NU0A 3V9ZA 4JI8K 1T6CA 4E1JA 3RWUA 1KRPA 1RBSA 2IVPA 2XY5A 4JI3K 2D0AA 4HHTA 4BC4A 1KQSM 3RSEB 2XO7A 1C0UA 4RW7A 4GNIA 2P9NA 4KAZA 1GOCA 3IFRA 3DLLL 5HL7L 2P9UA 2NUBA 3T69A 4KHYA 4CFBA 2HHHK 1LWCA 2VG5A 2J4RA 4JKFA 3EE9A 4LH5A 4RG8A 4PL8A 1IBLK 3CERA 3TPQA 1TK5A 1ZBHA 1WNSA 2P9IA 4R79A 4C8OA 5I3UA 4Y1DA 5AQLA 3HPOA 3O3HA 3FLCO 5ELZA 5HOOA 3NH2A 3EYZA 2E8AA 1YITN 4FK4A 4YORA 3WXJA 1L3SA 1YI2N 4FSVA 5A2QO 5E41A 5AQNA 4DV4K 2GEMA 3HVRA 1N5YA 1RDDA 4CI6A 3VETA 4X62K 4M3UA 4BGBA 3ULDA 3TAQA 3E9OA 5CE3A 5IT9O 1HX1A 2QWPA 1JLGA 4OJRA 5H1SQ 3CFRA 3TR8A 1L3VA 1TKDA 5KPTA 3AVLA 3C0BA 3OJUA 3LPTA 3H08A 3LWLA 4N5SA 3M8QA 4NB4A 4E1NA 1HKGA 1S5JA 3KWGA 3SUPA 4FJXA 4LF6K 3WUHA 4CJWA 3FFIA 3SCXA 2QKKA 1YVNA 2FBVA 4EHTA 4F2RA 4EHUA 3BF3A 1A5XA 3C6AA 4HUEA 4DWIA 3AARA 3ISNC 2W40A 3R8EA 4H5NA 4DR4K 4CEZA 4H0YB 3MCPA 5AFUH 1NGFA 4ID5A 4PKGA 3E1YA 4DR1K 3M6GA 4K42A 5AQPA 1JXBA 3OYLA 3OYCA 4FWOA 4BRQA 5GIPA 2E5LK 1OVYA 4RW9A 4DU3A 4GVEA 4BRKA 4UQGA 4XJXA 3LWMA 3HT3A 3G25A 3EY1A 1TVRA 2NNWA 2P5GA 3DXKA 1HNZK 4AILC 3BF1A 3NCIA 1BDGA 2PAVA 3CYMA 4EZ9A 3F73A 3I33A 3FFKB 3DXMA 3OYBA 3CF5L 1NJZA 5E84A 4CF8A 4NLBA 1X3NA 4BACA 4O0IA 2A3ZA 3HXMA 3CG7A 2Y1JA 1RDBA 4KHPK 2ZQBA 4JI5K 4CECA 4F3OA 5JS1A 3ENHA 2E2NA 4FOEA 5JMVA 4OGCA 1BIZA 1VQ4N 3RR8A 1ASUA 5JENA 2QWRA 3CETA 4CGFA 3KZBA 3LDLA 4DUZK 5AQVA 1YAGA 4A57A 4DS5A 4H0XB 3OJSA 5BN8A 4DQSA 4E7HA 4BRGA 4OGEA 5CY4A 3TTFA 1BA0A 1J53A 5CYQA 4CHZA 1N33K 1J5EK 4BDPA 4KREA 5FLXO 4CFCA 1NJIO 3TSUA 4CK3A 1SZ2A 3GG4A 1NBWA 1BISA 3LDNA 4ILGB 4BR4A 1UWBA 4LF5K 1BGXT 5HRSA 1QHTA 3LP2A 3CD6N 4FCYA 2ZJRL 5JVGL 4FLVA 4FWKA 5KGXA 1BOTO 3ZX3A 5GINA 3V9SA 1QQCA 1NKCA 4CEOA 4ISEA 1N36K 1WAJA 3TAMA 3V1QA 1U45A 2O4IA 4LSLA 4X65K 1RT6A 5TKWA 3VQBA 4LF8K 1ESVA 1C0GA 3PO5A 3NMUA 3O4WA 4DQQA 4FJIA 2QWOA 1GLLO 4W5QA 4CW7B 4CJ3A 3S9HA 1CXUA 3BZKA 4CJTA 1FW6A 4B9NA 4IG3A 1WSEA 5AQZA 3SJJA 4BQLA 1HUXA 1X9JA 4NLCA 1NJYA 2IAJA 3H3OB 3ZSRA 2CGKA 4IDHA 1RTJA 3KKRA 3CCRN 4KHNA 3KK3A 3QB0A 3SJHA 3VQ5A 5KRSA 1VSEA 3VQDA 3WNEA 4LFAK 3HOTA 3BGRA 1VRUA 1C0TA 3CJCA 2BANA 2KTQA 2GV9A 5AQYA 2HHWA 4AF1A 2O8FB 1K8KA 5C10A 2Z1HA 1RBRA 4DTPA 3OYGA 1SL2A 4N76A 1X9MA 2UU9K 3AVFA 1TKXA 1NGHA 4E19A 4WCEL 4N56A 1NK0A 1ASWA 4WFAL 3AA2A 3BY5A 3VQAA 3CCSN 2O8EB 3O3FA 1DKGD 3NGYA 5CYMA 4RW8A 2HB5A 4JI2K 4BE2A 3KVGA 2O8BB 2Q1NA 3QEIA 5BREA 5BRDA 4CFDA 3HP6A 1OH6A 4H0OA 1GLAG 3DRRA 2HF4A 3E9LA 3ZSWA 4CF2A 2FF3B 2WC9A 4DV3K 4CJUA 5M1KA 3O4NA 1YJWN 3WT0A 1SAZA 3D0PA 3TI0A 4DSLA 3FGUA 2YHAA 1DTTA 1BG3A 4ISFA 2VWKA 1QSYA 4JI6K 3AO1A 1LV5A 3VA3A 3F9MA 2A5XA 4B3OA 5C12A 4O55A 3C6HA 2OCEA 4EFHA 1DEJA 2XY8A 3C7NB 4CZKA 3RTVA 5J2MA 2UXDK 3WNHA 4CJPA 2HOEA 3ZSXA 3ZT4A 3RRGA 3NE6A 4KB0A 1YJNN 4HUGA 2VCPA 4LC9B 5GAHP 3IDHA 4FPBA 4MLEA 3HJFA 1HQUA 4JD2A 5HRNA 3GE1A 2QTDA 2QXFA 1QS4A 3VQ9A 2UUCK 1JCFA 1T7PA 1VHXA 3KLHA 3AO4A 3MN7A 4LY7A 3NGIA 3OYIA 3PV8A 4JNEA 4BVPA 1KLMA 4FWMA 4O44A 3MXMA 1JL1A 3I55N 4M3WA 1FKPA 1EWQA 4IO9L 3ZLJA 4W5OA 1K6YA 1QSLA 2ATQA 4YHHK 4FLZA 1L3UA 3CM5A 3O9SA 3OHRA 3R1XA 4CJSA 3V9UA 3L2VA 5EY4A 5M1FA 5E26A 3BUZB 1V4SA 3VEWA 3HL8A 4BE0A 3THXB 1EO1A 4X66K 2ZWHA 1LOTB 3QICA 3FR0A 3FZKA 3CJBA 4KRFA 2BH1A 1WAFA 4KTWA 5KPZA 5I42A 1KXPA 4LF4K 3VERA 3UKUB 4B1ZA 3BP8A 1I39A 5AQGA 4YY3K 1JLFA 2O8DB 1JKHA 1UOCA 3K0SA 3WEEB 1OH7A 2RN2A 5K14A 2FBYA 2OZSA 1Q7YO 1RCHA 1J6ZA 3MN9A 5JLHA 4LD0A 2O8CB 4EZ6A 3MN6A 1BA1A 4E7JA 3F5TA 3O1BA 2Q36A 2ZGYA 1S9GA 3ATUA 5KTQA 4DR7K 4BC2A 1HLUA 4H4MA 1NK8A 1EQYA 1C0FA 5F0XA 1NGGA 1RNHA 3DJCA 3AVJA 4DFPA 2NRXA 3I0SA 2YHBA 2FLOA 2V51B 5B8HA 4DCHA 4BG9A 3QINA 1ZBLA 4BWMA 3M1FA 3H45C 3KWIA 5J2QA 3RSEA 1HR0K 2KKZA 3L2WA 1WSGA 2UXCK 4JKCA 5AQWA 1Q82O 1BU6O 1EKEA 4JKHA 3VQQA 3SBTA 1VQLN 4FJJA 4J2BA 1ITGA 1D4XA 4H0TB 2YKNA 4BROA 4DQIA 2KFZA 4C8KA 4QAGA 3CC4N 4OPHA 4I7FA 1BQMA 2BDPA 4E7LA 3L4IA 4O4GA 5AQSA 3P38A 5DM6L 3IUCA 5GAGP 3VENA 1U49A 3LPUA 3HVTA 1HNXK 4MDBA 2KQ2A 4H0VB 4OPJA 3ATVA 3L8BA 3F9KA 2A40A 2WONA 1S1XA 3HRGA 1NMDA 4CK2A 3SAFA 3AVMA 3D45A 4CGHA 3R9PA 4HCBA 3LL3A 3IS9A 2E4LA 5AR0A 4DF8A 4NCBA 1IKWA 4ELTA 2HHIA 1YTAA 1SKRA 2IGIA 4I9QA 4BC5A 1XC9A 3UKRB 1VQNN 4PKIA 3TAEA 4WFBL 3ID8A 5BR8K 2ASMA 3QNOA 1IG8A 5EOYA 3CIPA 3C94A 3RRHA 2A41A 3TSPA 3M3ZA 3A2FA 2HNYA 3SPZA 5TKYA 3CCVN 1LCUA 4DSEA 1TKZA 5JVHL 3WXKA 1HPMA 2G8UA 2H3GX 3V9XA 4FWPA 5M1OA 2XHBA 5LJVA 2KHOA 3V1RA 3T1YK 3TAFA 2BTFA 4E89A 5MLCQ 1WOQA 1O1WA 2D4WA 2BUPA 3J8AA 4H4OA 3J7YP 4KH6A 4HVJA 3G71N 2B5JA 1JJ2M 1VRTA 3U3GA 3UIQA 4DU1A 1WBBA 4CGJA 5BR9A 3AVNA 2HHQA 3O9UA 1QQMA 3QEPA 1GLCG 3EO3A 3ZEUA 4Q5VA 3AO3A 3QEWA 4DSIA 4H0PA 4B1XB 1KD1O 1QVFM 3GOIA 3ZSOA 4CCHA 1TYQB 2YI1A 4I2QA 3U8XA 4XH1A 4I6MB 4U7BA 2HSTA 4JN4A 1K9MO 2YNGA 4PUOA 4WQ5A 2QM1A 2P9LB 3VQCA 4BRHA 3LZIA 1NK7A 3O3GA 4CVNE 3OYEA 3TU5A 3CJAA 3L6QA 4M45A 2OPPA 4IJNA 1YTUA 4IG0A 3CMEN 4RWTA 3QEXA 3V81A 5AQOA 2HMIA 4B1YB 4HTLA 4DF4A 1K8AO 5AZIB 1D5AA 1WN7A 1U04A 3MMVA 4DSJA 1S6QA 3DRSA 4CJLA 2Z1IA 5LMUK 3U9ZA 4A2BA 4YOWA 4GV3A 3HM8A 4FWQA 4YFUA 4NYNA
chains in the Genus database with same CATH topology
1ZC6A 4A57A 4H0XB 2HF3A 1T6DA 5BN8A 3W0LA 3R3LA 1BWFO 5AQJA 5KPRA 5EVZA 2KLAA 5BRHA 1SQKA 3D2EA 3QFPA 4BRGA 5BRFA 4FPAA 5I9EB 3TTFA 1BA0A 4B1UB 4DKWA 4PKHA 4B1VA 1TUYA 3U4LA 3ULEB 3VPZA 4CZGA 3O9RA 3ULEA 1ATSA 1K73O 4YOXA 2E2PA 1NJIO 2V7ZA 4JD2B 3CMAN 3FZHA 3MX2A 3TSUA 2IVOA 3HI0A 1QZ5A 3VGLA 1SZ2A 2RE2A 2PFUA 3GG4A 3CCJN 1NBWA 2CH6A 4WFNL 3CC2N 1DGKN 3LDNA 4ILGB 2ITMA 3VF2A 2YCHA 3ZX2A 4BR4A 3OW2M 4BR7A 3S41A 4H5TA 1T3VA 3D7EO 3CD6N 5F1XA 1RGIA 2Q31A 3KHYA 4MDAA 1QQNA 3HTVA 2YHXA 2ZJRL 5JVGL 4FWKA 1H1VA 1BOTO 2QXLA 3ZX3A 1DT9A 5GINA 3AGKA 4CZHA 4ISEA 1YJ9N 4JKDA 3CCEN 1NGJA 4MLHA 1BUPA 3VGMA 4JKGB 4IXCA 5M1NA 2QWLA 4JKGA 5TKWA 3WQUA 4PHTX 4BVOA 3I8BA 2D1KA 1QZ6A 1VQMN 1ESVA 1Q18A 1C0GA 4IOXA 3NMUA 2E2QA 3O4WA 3P39A 1CZAN 2QWOA 1GLLO 2FSJA 3AAPA 2ZGZA 3FE1A 4O8UA 4YDUC 1S72N 3TSQA 4JK7A 4KBOA 3CI5A 1JCEA 2VWBA 3SMPA 1T44A 3CJ7A 4DQ8A 4GV9A 2NZTA 5AQZA 3CCUN 5BN9A 4BQLA 1HUXA 4JK8A 4ILHA 3WXMB 1YIJN 1X9JA 4NLCA 3H1VX 4H5WA 2HBKA 3H1QA 3H3OB 2CGKA 3HZ6A 1KAXA 4IDHA 2QWMA 3CCRN 5FPMA 4FVUA 3QB0A 1NM1A 3SJHA 2NRZA 2AP1A 3QDKA 5AQIA 2GX9A 2P9SB 3HOTA 2V7YA 5C15A 2P9SA 3CJCA 1VQKN 2ZJQL 5AQYA 4AF1A 5AQFA 4J8FA 3HBTA 4IOCL 3AY9A 1K8KB 3MCAB 4CD1A 5AQUA 5LJWA 1K8KA 5C10A 3BEXA 3EN9A 1KAYA 2GWKA 4BY9C 1NGDA 4GV6A 2WBNA 5KQDA 3F2KA 2GTDA 4BGAA 1NGHA 4WCEL 2VGNA 2P9LA 3MWTA 4F9OA 1QQOA 3G4SN 4XEIA 2ASOA 2NRHA 3D6RA 2P9KB 4WFAL 1ZXOA 2D0PA 4RCHA 3CCSN 2P9KA 2Q0RA 3ENBA 5KQ8A 1DKGD 1VQON 3GL1A 3A8YA 4M63C 2RHKA 3KVGA 1GLEG 2Q1NA 2CH5A 3EKUA 3NVKA 1YXQA 3MX5A 5BREA 5BRDA 3H3NO 3D2FB 3TTCA 1QVGM 3CCLN 4IFEA 1ATRA 1YF5L 5C0YA 4BE7B 3D2FA 2QWNA 3K9JA 4H0OA 1GLAG 3VF6A 2HF4A 3E9LA 1M1KO 3O80A 2W41A 5AQXA 2FF3B 2WC9A 4CZFA 4CZIA 4Y0WA 2JWKA 3VF4A 1HKCA 2F9WA 2D0OA 4FL9A 5M1KA 4A2AA 1S3XA 3ENOA 1YJWN 3ID6A 3WT0A 4JHDB 1SAZA 4JEPA 5LY3A 1W2BM 5FPNA 4BREA 4JHDA 3FGUA 4ISFA 1BG3A 4B1WB 4IO8A 3F9MA 2A5XA 4K25A 4YOTA 3O08A 5C12A 4M7YA 3C6HA 4EFHA 1DEJA 3C7NB 3M5RA 2EWSA 4Z94A 1Y64A 3WXLA 2FF6A 4CZKA 3C7NA 3O6WA 3VGKA 2HOEA 3VOVA 3SAHA 3LM2A 5FPEA 1YJNN 2VCPA 4LC9B 4A61A 5GAHP 3J7ZO 5EXWA 4A62A 1NGBA 2E20A 3IDHA 3LDPA 4FWRA 4FPBA 4MLEA 2FXUA 2PBDA 4JD2A 3GDQA 2CGJA 3GE1A 3CCMN 2QTDA 2OTLN 1VQ6N 1NGIA 3QBWA 4U67L 2WFBA 3A5LC 1JCFA 1XUPO 2A6AA 3H46O 5AQQA 2GWJA 3UE5A 2OTJN 3MN7A 1VQ8N 3N4QA 4CBWA 2QI2A 3VTHA 2W00A 1MWKA 3A5OC 4JNEA 4BVPA 4EIAA 3ZYYX 4FWMA 3VEVA 1Q86O 3IKMA 4IWVA 3I55N 3DWLA 3VEOA 2HMPA 3VEZA 2VYPA 4IO9L 2A42A 2I7PA 1ATNA 4IEEA 5DM7L 1WUAA 3CJ9A 3WQTA 2ASPA 4DHYA 1W97L 2NRVA 3E66A 3R6MA 4YDUA 3A5NC 5C2DA 2E88A 5ADXH 3ZETB 3O9SA 3ZETA 3OHRA 2IVNA 3R1XA 4BRDA 2GUPA 3SLCA 5EY4A 5M1FA 4WF9L 4L3QA 3B8AX 5E26A 2F7TA 1O13A 3BUZB 1Q81O 1V4SA 3VEWA 1GLDG 4YOUA 4C1NI 5BPLA 3I56N 1EO1A 2ZWHA 1LOTB 2NLXA 3QICA 3FR0A 4QS9A 3FZKA 1S22A 3CJBA 1SS6A 2BH1A 4BEBA 3CQXA 2V52B 5KPZA 2HBMA 2HBLA 4BR0A 3EE8A 4OO1J 2UYTA 3KK7A 3K9KA 4IJAA 3W3DA 1KXPA 4CJ7A 5CHIA 1VQPN 4BRLA 4CBUA 3VERA 3UKUB 4FWSA 1MDUB 4K43A 4B1ZA 3BP8A 3LDQA 3UKUA 4AM6A 3GBTA 4IEIA 4YOYA 3JS6A 2NRRA 4QS7A 5AQGA 2YJEA 4FWLA 2ZJPL 5FPDA 1NGAA 2QA4N 3L4QA 4M7XA 4NO7A 3QFUA 5GADP 4BG8A 3WEEB 1R59O 1RDUA 2QWQA 4WYBA 3CPEA 3WEEA 1TUUA 3CCQN 1Q7YO 1J6ZA 3C65A 4BC3A 3SAGA 3MN9A 4UY8O 1U2VB 3ZEUB 2QW9A 3SBGA 5JLHA 1VQ5N 3LDOA 1U2VA 3PIPL 3MN6A 4WQ4C 4BR9A 1BA1A 2I7NA 5ADXA 3P4IA 3EKSA 3O9QA 3SK3A 1YHQN 2C1GA 1BO5O 3LM9A 3F5TA 1YUWA 3O1BA 2Q36A 2ZGYA 3OBYA 5AQMA 3A5MC 1NLVA 4ISGA 3ATUA 4BECA 4KH4A 4BRAA 1P90A 4CZJA 3DXKB 4BC2A 3CPWM 1HLUA 2JWLA 4CBXA 2E1YA 2YX6A 1EQYA 1C0FA 3NVMA 5F0XA 5F2RA 1NGGA 4JKBA 3FZLA 1NGEA 3MN5A 1E4GT 3DJCA 1GLJO 1P8ZA 2NRXA 4WQ5C 3FZMA 2E2OA 2NRTA 3AGRA 3HOSA 3JXUA 2FLOA 4PL7A 4GY2B 2V51B 2IIRA 4FWNA 5M1QA 5B8HA 4DCHA 4BG9A 3DAWA 1T6CA 1NWKA 4E1JA 3P31A 3EZWA 2AA4A 2FSNA 4H03B 4AM7A 5BPNA 4YOVA 2IVPA 5AFUA 3VMFB 4C1NK 4BC4A 1KQSM 3M1FA 5AQTA 3H45C 3RSEB 3KWIA 4XH4A 1Z6RA 2P9NB 3RSEA 3L0QA 4GNIA 3CQYA 2KKZA 2P9NA 2P9UB 4KH5A 2YHYA 3IFRA 4JKCA 5AQWA 5HL7L 2P9UA 4A5AA 3DLLL 1BU6O 3O9TA 4JKHA 1Q82O 3SBTA 5M1PA 1RDWX 1MA9B 1KAZA 3T69A 1VQLN 1D4XA 4H0TB 1NGCA 4BROA 2J4RA 4JKFA 3EE9A 1HKBA 3O1WA 1ZBSA 4PL8A 4RTFD 3CC4N 4OPHA 4BRIA 3CERA 5EX5A 2P9IB 3TPQA 4FOIA 3L4IA 2F9TA 2P9IA 1E4FT 5AQSA 4R79A 3CXCM 5AQLA 1G99A 3P38A 5DM6L 3IUCA 2ZF5O 5GAGP 4BQZA 3D2EB 3FLCO 5ELZA 3VENA 5HOOA 2E8AA 5JICA 4MDBA 1YITN 3MWPA 3CC7N 5C2FA 5AQRA 4H0VB 4YORA 3ATVA 3VEXA 3IMXA 3WXJA 4CD3A 2A40A 1YI2N 4FSVA 3G6EN 5AQNA 2GEMA 3QMLA 4CI6A 3HRGA 1NMDA 2Q2RA 3VETA 4XH5A 3SAFA 5AQKA 1V4TA 1XQSC 4H5RA 4CZMA 2Q97A 3R9PA 2GELA 4BGBA 3E9OA 3LL3A 4DB3A 5CE3A 3UB5A 4IOAL 2NRWA 1X3MA 5AR0A 2QEXN 1HX1A 4JK9A 2QWPA 5H1SQ 3QBXA 3FZFA 3Q7CA 5KPTA 4BC5A 3C0BA 1RFQA 3UKRB 3ZX0A 1XC3A 4A5BA 1VQNN 3UKRA 3RVCA 1JCGA 4BRNA 4PKIA 4WFBL 3PIOL 3ID8A 3O8MA 1KC8O 5GAEP 2ASMA 4NB4A 1HKGA 4MO5A 1IG8A 3KWGA 3WUHA 5EOYA 1YVNA 3CIPA 3OA9A 4BRCA 3CJ1A 1ILYA 3VESA 3CHWA 2A41A 4FO0A 3M3ZA 3TSPA 4EHTA 1U6ZA 4EHUA 4O8KA 3BF3A 5TKYA 3CCVN 1LCUA 3AAQA 5JVHL 3A0IX 1HPMA 3C6AA 3WXKA 2C1IA 1GLBG 2H3GX 4JKAA 4FWPA 5CR4A 5AQHA 3AARA 5M1OA 2W40A 2KHOA 1OKJA 5LJVA 1M90O 3R8EA 3T7ZA 2BTFA 4H5NA 3PLAA 5JLFA 5MLCQ 1VQ7N 3OBWA 1WOQA 2YJFA 4H0YB 2D4WA 2BUPA 3J8AA 3MCPA 5AFUH 4KH6A 1NGFA 3G71N 4WQ4A 5BPMA 1JJ2M 3O5BA 4PKGA 4JAXA 3E1YA 4H5VA 5BR9A 3M6GA 4CZEA 3O9UA 4K42A 5AQPA 1QQMA 4A59A 1GLCG 3EO3A 3H6EA 4FWOA 3TTDA 1IJJA 3ZEUA 4BRQA 5GIPA 4H0PA 4B1XB 1KD1O 1QVFM 1OVYA 2DPNA 3GOIA 4K41A 4G9ZA 1TYQB 4O5FA 2YI1A 4GVEA 4BRKA 1TYQA 3Q7BA 3U8XA 4XH1A 2WUSA 3VTIA 4XJXA 4ILJA 4I6MB 4U7BA 3G25A 4I6MA 2HSTA 2NNWA 4JN4A 2OANA 1K9MO 3DXKA 2VGMA 3HSCA 4WQ5A 1HJOA 2QM1A 1QHAA 3BF1A 4IZ9A 4OPAA 5AZJB 1BDGA 2PAVA 5AZJA 4EAHD 2P9LB 1VAZA 1MWMA 2FSKA 3DXMB 3I33A 3FFKB 3DXMA 4BRHA 3CF5L 5GIOA 2Q0UA 5E84A 4NLBA 1Z05A 4BRPA 3TU5A 3CJAA 3L6QA 1X3NA 4C23A 4IJNA 2A3ZA 2CGLA 3VEYA 3U9DA 3CMEN 4MO4A 4CZLA 4RWTA 5AQOA 4BRMA 4BR2A 3ENHA 2E2NA 4FOEA 4HTLA 4B1YB 3N4PA 1K8AO 5AZIB 3E9PA 5JMVA 3MK6A 3MMVA 5AZIA 4B9QA 3MDQA 1VQ4N 1N8RO 4HWIA 3SMSA 1GLFO 3U9ZA 2HBJA 2QWRA 2P9PB 4A2BA 2YHWA 4YOWA 3CETA 4GV3A 3KZBA 3HM8A 2P9PA 3LDLA 4JKEA 4BR5A 2E1ZA 1VQ9N 4QS8A 4FWQA 3WXIA 5AQVA 4BRFA 1YAGA 3EL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZC6 A;  4H0X B;  2HF3 A;  1T6D A;  5BN8 A;  3W0L A;  1BWF O;  5AQJ A;  5KPR A;  5EVZ A;  5BRH A;  1SQK A;  3D2E A;  3QFP A;  4BRG A;  5BRF A;  4FPA A;  5I9E B;  1BA0 A;  4B1U B;  4PKH A;  4B1V A;  1TUY A;  3U4L A;  3ULE B;  3VPZ A;  4CZG A;  3ULE A;  1ATS A;  2E2P A;  2V7Z A;  4JD2 B;  3FZH A;  2IVO A;  3HI0 A;  1QZ5 A;  3VGL A;  1SZ2 A;  3GG4 A;  1NBW A;  2CH6 A;  1DGK N;  3LDN A;  2ITM A;  3VF2 A;  2YCH A;  3ZX2 A;  4BR4 A;  4BR7 A;  3S41 A;  4H5T A;  3D7E O;  5F1X A;  1RGI A;  2Q31 A;  3KHY A;  1QQN A;  3HTV A;  2YHX A;  4FWK A;  1H1V A;  1BOT O;  2QXL A;  3ZX3 A;  4CZH A;  4ISE A;  1NGJ A;  4MLH A;  1BUP A;  3VGM A;  4IXC A;  2QWL A;  3WQU A;  4BVO A;  3I8B A;  2D1K A;  1QZ6 A;  1ESV A;  1Q18 A;  1C0G A;  2E2Q A;  3O4W A;  1CZA N;  2QWO A;  1GLL O;  2FSJ A;  3AAP A;  2ZGZ A;  3FE1 A;  4YDU C;  4KBO A;  3CI5 A;  1JCE A;  2VWB A;  3SMP A;  1T44 A;  3CJ7 A;  4DQ8 A;  2NZT A;  5AQZ A;  5BN9 A;  4BQL A;  1HUX A;  1X9J A;  3H1V X;  4H5W A;  3H1Q A;  3H3O B;  2CGK A;  3HZ6 A;  1KAX A;  2QWM A;  5FPM A;  3QB0 A;  1NM1 A;  3SJH A;  2AP1 A;  3QDK A;  5AQI A;  2P9S B;  2V7Y A;  2P9S A;  3CJC A;  5AQY A;  5AQF A;  4J8F A;  3HBT A;  3AY9 A;  1K8K B;  4CD1 A;  5AQU A;  5LJW A;  1K8K A;  3BEX A;  3EN9 A;  1KAY A;  2GWK A;  1NGD A;  5KQD A;  2GTD A;  4BGA A;  1NGH A;  2P9L A;  4F9O A;  1QQO A;  4XEI A;  2ASO A;  2NRH A;  2P9K B;  1ZXO A;  2D0P A;  4RCH A;  2P9K A;  2Q0R A;  5KQ8 A;  1DKG D;  3GL1 A;  3A8Y A;  4M63 C;  3KVG A;  1GLE G;  2Q1N A;  2CH5 A;  3EKU A;  1YXQ A;  5BRE A;  5BRD A;  3H3N O;  3D2F B;  1ATR A;  3D2F A;  2QWN A;  4H0O A;  1GLA G;  3VF6 A;  2HF4 A;  3O80 A;  2W41 A;  5AQX A;  2FF3 B;  4CZF A;  4CZI A;  4Y0W A;  3VF4 A;  1HKC A;  2F9W A;  2D0O A;  4FL9 A;  4A2A A;  1S3X A;  3ENO A;  3WT0 A;  4JHD B;  1SAZ A;  5LY3 A;  5FPN A;  4BRE A;  4JHD A;  3FGU A;  4ISF A;  1BG3 A;  4B1W B;  4IO8 A;  3F9M A;  2A5X A;  4K25 A;  3O08 A;  4M7Y A;  4EFH A;  1DEJ A;  3C7N B;  2EWS A;  4Z94 A;  1Y64 A;  3WXL A;  2FF6 A;  4CZK A;  3C7N A;  3O6W A;  3VGK A;  2HOE A;  3VOV A;  3LM2 A;  5FPE A;  2VCP A;  4LC9 B;  4A61 A;  5EXW A;  4A62 A;  1NGB A;  2E20 A;  3IDH A;  3LDP A;  4FWR A;  4FPB A;  4MLE A;  2FXU A;  2PBD A;  4JD2 A;  3GDQ A;  2CGJ A;  3GE1 A;  1NGI A;  3QBW A;  3A5L C;  1JCF A;  1XUP O;  2A6A A;  3H46 O;  5AQQ A;  2GWJ A;  3UE5 A;  3MN7 A;  4CBW A;  1MWK A;  3A5O C;  4JNE A;  4BVP A;  4EIA A;  4FWM A;  3VEV A;  4IWV A;  3DWL A;  3VEO A;  2HMP A;  3VEZ A;  2VYP A;  2A42 A;  2I7P A;  1ATN A;  1WUA A;  3CJ9 A;  3WQT A;  2ASP A;  4DHY A;  3R6M A;  4YDU A;  3A5N C;  2E88 A;  5ADX H;  3ZET B;  4BRD A;  3ZET A;  3OHR A;  2IVN A;  2GUP A;  3SLC A;  5EY4 A;  4L3Q A;  3B8A X;  5E26 A;  3BUZ B;  1V4S A;  3VEW A;  1GLD G;  5BPL A;  2ZWH A;  1LOT B;  2NLX A;  3QIC A;  3FR0 A;  4QS9 A;  3FZK A;  1S22 A;  3CJB A;  3CQX A;  2V52 B;  5KPZ A;  4BR0 A;  2UYT A;  4IJA A;  3W3D A;  1KXP A;  4CJ7 A;  4BRL A;  4CBU A;  3VER A;  3UKU B;  4FWS A;  1MDU B;  4K43 A;  4B1Z A;  3BP8 A;  3LDQ A;  3UKU A;  4AM6 A;  3GBT A;  3JS6 A;  4QS7 A;  5AQG A;  2YJE A;  4FWL A;  5FPD A;  1NGA A;  4M7X A;  4NO7 A;  3QFU A;  4BG8 A;  3WEE B;  1R59 O;  2QWQ A;  4WYB A;  3WEE A;  1TUU A;  1J6Z A;  4BC3 A;  3MN9 A;  1U2V B;  3ZEU B;  2QW9 A;  5JLH A;  3LDO A;  1U2V A;  3MN6 A;  4WQ4 C;  4BR9 A;  1BA1 A;  2I7N A;  5ADX A;  3P4I A;  3EKS A;  3SK3 A;  1BO5 O;  3LM9 A;  3O1B A;  1YUW A;  5AQM A;  2Q36 A;  2ZGY A;  3A5M C;  1NLV A;  4ISG A;  3ATU A;  4BRA A;  4CZJ A;  3DXK B;  4BC2 A;  1HLU A;  4CBX A;  2E1Y A;  1EQY A;  1C0F A;  5F0X A;  5F2R A;  1NGG A;  3FZL A;  1NGE A;  3MN5 A;  1E4G T;  3DJC A;  1GLJ O;  1P8Z A;  4WQ5 C;  3FZM A;  2E2O A;  3JXU A;  2FLO A;  4PL7 A;  4GY2 B;  2V51 B;  2IIR A;  4FWN A;  5B8H A;  4DCH A;  4BG9 A;  3DAW A;  1T6C A;  1NWK A;  4E1J A;  3EZW A;  2AA4 A;  2FSN A;  4H03 B;  4AM7 A;  5BPN A;  2IVP A;  5AFU A;  4BC4 A;  3M1F A;  5AQT A;  3H45 C;  3RSE B;  4XH4 A;  1Z6R A;  2P9N B;  3RSE A;  3L0Q A;  4GNI A;  3CQY A;  2P9N A;  2P9U B;  2YHY A;  3IFR A;  5AQW A;  2P9U A;  1BU6 O;  1RDW X;  1MA9 B;  1KAZ A;  1D4X A;  4H0T B;  1NGC A;  4BRO A;  2J4R A;  1HKB A;  3O1W A;  1ZBS A;  4PL8 A;  4RTF D;  4BRI A;  3CER A;  5EX5 A;  2P9I B;  3TPQ A;  4FOI A;  3L4I A;  2F9T A;  2P9I A;  1E4F T;  5AQS A;  5AQL A;  1G99 A;  3IUC A;  2ZF5 O;  4BQZ A;  3D2E B;  3FLC O;  5ELZ A;  3VEN A;  2E8A A;  5JIC A;  5AQR A;  4H0V B;  3ATV A;  3VEX A;  3IMX A;  3WXJ A;  4CD3 A;  2A40 A;  4FSV A;  5AQN A;  2GEM A;  3QML A;  4CI6 A;  3VET A;  1NMD A;  2Q2R A;  4XH5 A;  5AQK A;  1V4T A;  1XQS C;  4H5R A;  4CZM A;  2Q97 A;  3R9P A;  2GEL A;  4BGB A;  3LL3 A;  4DB3 A;  5CE3 A;  3UB5 A;  1X3M A;  5AR0 A;  1HX1 A;  2QWP A;  3QBX A;  3FZF A;  5KPT A;  4BC5 A;  3C0B A;  1RFQ A;  3UKR B;  3ZX0 A;  1XC3 A;  3UKR A;  1JCG A;  4BRN A;  4PKI A;  3ID8 A;  3O8M A;  2ASM A;  4NB4 A;  1HKG A;  4MO5 A;  1IG8 A;  3WUH A;  5EOY A;  1YVN A;  3CIP A;  4BRC A;  3CJ1 A;  3VES A;  3CHW A;  2A41 A;  4FO0 A;  3M3Z A;  4EHT A;  1U6Z A;  4EHU A;  4O8K A;  3BF3 A;  5TKY A;  1LCU A;  3AAQ A;  3A0I X;  1HPM A;  3WXK A;  1GLB G;  2H3G X;  4FWP A;  5AQH A;  3AAR A;  2W40 A;  2KHO A;  1OKJ A;  5LJV A;  3R8E A;  2BTF A;  4H5N A;  5JLF A;  1WOQ A;  2YJF A;  4H0Y B;  2D4W A;  2BUP A;  3J8A A;  3MCP A;  5AFU H;  1NGF A;  4WQ4 A;  5BPM A;  3O5B A;  4PKG A;  4JAX A;  4H5V A;  5BR9 A;  3M6G A;  4CZE A;  4K42 A;  5AQP A;  1QQM A;  1GLC G;  3EO3 A;  3H6E A;  4FWO A;  3ZEU A;  1IJJ A;  4BRQ A;  4H0P A;  4B1X B;  2DPN A;  3GOI A;  4K41 A;  1TYQ B;  4O5F A;  2YI1 A;  4BRK A;  1TYQ A;  3U8X A;  4XH1 A;  2WUS A;  4I6M B;  3G25 A;  4I6M A;  4JN4 A;  2OAN A;  3DXK A;  3HSC A;  4WQ5 A;  1HJO A;  2QM1 A;  1QHA A;  3BF1 A;  4IZ9 A;  5AZJ B;  1BDG A;  2PAV A;  5AZJ A;  4EAH D;  2P9L B;  3DXM B;  1MWM A;  2FSK A;  3I33 A;  3FFK B;  3DXM A;  4BRH A;  2Q0U A;  5E84 A;  1Z05 A;  4BRP A;  3TU5 A;  3CJA A;  3L6Q A;  1X3N A;  4C23 A;  4IJN A;  2A3Z A;  2CGL A;  3VEY A;  3U9D A;  4MO4 A;  4CZL A;  4RWT A;  5AQO A;  4BRM A;  4BR2 A;  3ENH A;  2E2N A;  4FOE A;  4HTL A;  4B1Y B;  5AZI B;  5JMV A;  3MK6 A;  3MMV A;  5AZI A;  4B9Q A;  3MDQ A;  4HWI A;  3SMS A;  1GLF O;  3U9Z A;  2QWR A;  2P9P B;  4A2B A;  2YHW A;  3CET A;  3KZB A;  3HM8 A;  2P9P A;  3LDL A;  4BR5 A;  2E1Z A;  4QS8 A;  4FWQ A;  3WXI A;  5AQV A;  4BRF A;  1YAG A;  3EL2 A; 
#chains in the Genus database with same CATH topology
 1T6D A;  3W0L A;  3R3L A;  5AQJ A;  3D2E A;  4B1U B;  4PKH A;  4DQR A;  2G8I A;  1SV5 A;  3ULE B;  4B9M A;  3NHG A;  3E01 A;  4ZHR A;  2E2P A;  4FJL A;  2GUI A;  2V7Z A;  3M8S A;  3CMA N;  3HI0 A;  4B9T A;  4OLA A;  1REV A;  2WOM A;  2PFU A;  3CCJ N;  3V4I A;  1NJW A;  2G8V A;  3K5L A;  4OLB A;  4E0D A;  2ITM A;  2YCH A;  1I94 K;  1T3V A;  1VSJ A;  1RGI A;  4AQY K;  4IFY A;  4DTN A;  2YHX A;  3TAB A;  4CHP A;  4CEF A;  1HYZ A;  3ZT2 A;  3AGK A;  4CZH A;  1WSF A;  2X78 A;  4JKD A;  4DUY K;  4CGG A;  1D8Y A;  1EWR A;  4DTO A;  4KHW A;  4JKG B;  2JLE A;  1NJX A;  5KRT A;  2D1K A;  1VQM N;  4Z0U A;  1Q18 A;  1KFS A;  4DV5 K;  3KLF A;  4FJM A;  1JLA A;  4CIF A;  1CZA N;  3DLG A;  3FE1 A;  2B4J A;  1S72 N;  3LAL A;  4LF7 K;  2VWB A;  3ZT3 A;  4DQ8 A;  4DV0 K;  3LAK A;  1YT3 A;  1YIJ N;  3H1V X;  2HBK A;  1Q9X A;  3PSF A;  4DTU A;  3HZ6 A;  4BDY A;  4FVU A;  1NM1 A;  1VSF A;  4JI1 K;  3QDK A;  5AQI A;  1C1B A;  5C15 A;  1VQK N;  2ZJQ L;  3HBT A;  3HST B;  3AY9 A;  3MCA B;  4J2D A;  5AQU A;  2O8F A;  1IBM K;  3QET A;  3F2K A;  4M3R A;  1KSP A;  3MWT A;  4F9O A;  4DFM A;  3G4S N;  4DQP A;  4ZTJ A;  1RTI A;  3D6R A;  2P9K B;  1ZXO A;  4TSX A;  3ENB A;  4B3M K;  1NNE A;  4M63 C;  2RHK A;  2CH5 A;  1TL3 A;  3L2Q A;  3NVK A;  2O8B A;  1YXQ A;  3MX5 A;  1EX4 A;  3H3N O;  3D2F B;  3TTC A;  3NAE A;  1QVG M;  4IFE A;  1YF5 L;  1NG9 A;  5SZT A;  3M8P A;  1M1K O;  3O80 A;  1IKX A;  4BE1 A;  4Y0W A;  1RTD A;  4F3T A;  4FL9 A;  4BWJ A;  1TK0 A;  3T19 A;  5LL6 Z;  4BRE A;  5CZ1 A;  4QCL A;  3THY B;  3P5J A;  1C1C A;  4K25 A;  1RBV A;  3O08 A;  3PUF A;  3ZT1 A;  4M7Y A;  3ZSY A;  3WXL A;  2FF6 A;  4K8X A;  3C7N A;  4Z4I A;  3SV3 A;  4PY5 A;  2OA8 A;  1YVU A;  3NF9 A;  2PY5 A;  5EXW A;  4A62 A;  1NGB A;  2YV0 X;  3DOL A;  3LDP A;  4FWR A;  3THW B;  1U48 A;  2FXU A;  2PBD A;  3GDQ A;  4H8K A;  3AV9 A;  1TAQ A;  2OTL N;  1VQ6 N;  3QBW A;  1GOA A;  2OPQ A;  2WFB A;  2W42 A;  3S3O A;  4KI4 A;  2GWJ A;  3AVK A;  3M8R A;  4CBW A;  3OYH A;  3VTH A;  3OYK A;  2W6L A;  2A42 A;  5HRR A;  4Z4C A;  1XWL A;  1IH7 A;  4JI7 K;  5DM7 L;  1WUA A;  4B3S K;  4WE1 A;  3OVN A;  1RT1 A;  2E88 A;  4DLG A;  3VN5 A;  1CLQ A;  1L3T A;  2IVN A;  3KKS A;  4IKF A;  4CJ5 A;  2XY7 A;  4WF9 L;  3B8A X;  4FZY A;  1RT2 A;  3OS1 A;  4YOU A;  2UUB K;  4PWD A;  5BPL A;  3I56 N;  1VSM A;  3RR7 A;  3J81 O;  3T1A A;  1S22 A;  4CED A;  5C25 A;  4CF0 A;  2V52 B;  3VQ8 A;  4BR0 A;  4OO1 J;  4IBN A;  4N47 A;  1KFD A;  3KK7 A;  4CHN A;  3K9K A;  5CHI A;  1Y97 A;  4W5T A;  3HK2 A;  3UKU A;  4YOY A;  3SPY A;  2NRR A;  4QS7 A;  2QA4 N;  2YJE A;  4FWL A;  3MXI A;  4CE9 A;  2D0B A;  1S1W A;  2O8D A;  4C8N A;  1NOY A;  1KLN A;  2QWQ A;  3WEE A;  1TUU A;  4CHO A;  3C65 A;  3SAG A;  4CJK A;  1U2V B;  3K5M A;  2A1R A;  4NYF A;  2I5J A;  2O8C A;  3NH0 A;  2I7N A;  3C95 A;  3P4I A;  3O9Q A;  4CJF A;  4DS4 A;  1DTQ A;  1X9S A;  5AQM A;  3A5M C;  4BEC A;  4J2A A;  1HYS A;  1P90 A;  3LAN A;  3DXK B;  1RT7 A;  2JWL A;  3DMJ A;  2YX6 A;  1S9E A;  3NVM A;  3MAQ A;  4RW6 A;  4JKB A;  1TGO A;  3FZL A;  3TWH A;  1NGE A;  2BE2 A;  3MN5 A;  1E4G T;  3VQE A;  1KVB A;  1P8Z A;  3AVG A;  4WQ5 C;  4OKE A;  1JXE A;  2NRT A;  3AGR A;  4M3X A;  2DFF A;  4PL7 A;  2IIR A;  3DAW A;  1NWK A;  3EZW A;  4AM7 A;  5J2P A;  5BPN A;  5AFU A;  3VMF B;  5AQT A;  4XH4 A;  3K58 A;  4IDK A;  3L0Q A;  3CQY A;  4GW6 A;  3DI6 A;  2YHY A;  2IS3 A;  4A5A A;  3P1G A;  1ZYQ A;  4DTX A;  5M1P A;  1RDW X;  1MA9 B;  1RT3 A;  1NGC A;  3KK1 A;  3CFO A;  4DSK A;  2YNI A;  1ZBS A;  3AVH A;  4JI4 K;  4O0J A;  4BRI A;  5EX5 A;  4FOI A;  2HVI A;  2Z1G A;  3RMB A;  2HHV A;  1G99 A;  3NF6 A;  5JS2 A;  4B9V A;  4HCC A;  3BZC A;  3MWP A;  5C2F A;  3PSI A;  4DTR A;  4FYD A;  1ZBU A;  3VEX A;  3IMX A;  4CJQ A;  2AJQ A;  3KK2 A;  1CZ9 A;  4XH5 A;  5AQK A;  1V4T A;  1XQS C;  3ZT0 A;  4CK1 A;  4CZM A;  2Q97 A;  3B6P A;  2GEL A;  4DG1 A;  3LP1 A;  2PYJ A;  4LFB K;  2PZS A;  4DB3 A;  3UB5 A;  4IOA L;  1X3M A;  2QEX N;  4JK9 A;  3FZF A;  1LW2 A;  2OPR A;  3T1H K;  1RFQ A;  3ZX0 A;  1J5O A;  1XC3 A;  4DMN A;  3UKR A;  3RVC A;  4LF9 K;  1JCG A;  4BRN A;  4CEE A;  4FLW A;  2KZM A;  1NK4 A;  3O8M A;  4N41 A;  1KC8 O;  5GAE P;  2DFH A;  4JLH A;  1ILY A;  4BRC A;  4FO0 A;  5D3G A;  1U6Z A;  4O8K A;  1FXX A;  5HBM A;  2C1I A;  3SUQ A;  1GLB G;  1G15 A;  5CR4 A;  1OKJ A;  1M90 O;  3PLA A;  5JLF A;  2RKI A;  2YJF A;  4M3Z A;  4WQ4 A;  3O5B A;  4H5V A;  4W5R A;  5FRN A;  4CZE A;  2HW3 A;  5KI6 A;  3BDP A;  4B8A B;  2D5R A;  4A59 A;  4ELV A;  1S6P A;  5C42 A;  3TTD A;  1IJJ A;  3B6O A;  2DPN A;  4K41 A;  3NFA A;  4O5F A;  1TYQ A;  2VQF K;  3Q7B A;  1WSJ A;  4I6M A;  1LWF A;  1IKY A;  2OAN A;  3HSC A;  4I9L A;  1HJO A;  2F96 A;  4OPA A;  5AZJ B;  1C6V A;  4Z4F A;  4EAH D;  1VAZ A;  4FW2 A;  5GIO A;  2Q0U A;  4JRQ A;  1Z05 A;  1N34 K;  5AJ3 K;  4C23 A;  2G8F A;  3JSM A;  3PX0 A;  2CGL A;  3U9D A;  2YNF A;  4CZL A;  1ZBF A;  1ASV A;  3C6U A;  3VQ6 A;  4F2S A;  1J54 A;  3E9P A;  3MK6 A;  5AZI A;  3QO9 A;  1D9D A;  3VQ7 A;  2VG7 A;  3MDQ A;  1C1A A;  1NMN A;  3JYT A;  2HBJ A;  3IRX A;  2P9P B;  4B8C A;  4AHT A;  4JKE A;  2KFN A;  2E1Z A;  4F8R A;  1L5U A;  4QS8 A;  3WXI A;  4BRF A;  1IBK K;  2KW4 A;  4O5B A;  4M3T A;  4FLU A;  1BWF O;  3SV4 A;  5KPR A;  5EVZ A;  2KLA A;  4E7I A;  4FJG A;  3QFP A;  5BRF A;  4FPA A;  4DKW A;  4B1V A;  3VPZ A;  4CZG A;  3ULE A;  3L3U A;  3DLK A;  4JD2 B;  3FZH A;  3MX2 A;  2KZZ A;  3ASM A;  1QZ5 A;  3K5N A;  1OVQ A;  2RE2 A;  3OY9 A;  5KGW A;  4XIU A;  4WFN L;  1DGK N;  3VF2 A;  3MEG A;  3ZX2 A;  3OW2 M;  4BR7 A;  3S41 A;  3D7E O;  2DTU A;  3KHY A;  3SZ2 A;  4AHV A;  3HTV A;  3NBP A;  1RT4 A;  3V6D A;  4KHQ A;  1BI4 B;  1FJG K;  1H1V A;  2QXL A;  1TV6 A;  3KLI A;  4NXN K;  1NGJ A;  1BUP A;  2G8H A;  3VGM A;  3MEC A;  5M1N A;  4FK2 A;  4PHT X;  4JKG A;  3OYA A;  4KB1 A;  3NH1 A;  4B3R K;  1QZ6 A;  3CFP A;  3K57 A;  4ICL A;  2E2Q A;  1T05 A;  1VSH A;  1J9A A;  2FSJ A;  1VSK A;  2ZGZ A;  2F8T A;  1JCE A;  2F4V K;  1T44 A;  4FJH A;  4GV9 A;  3CCU N;  1Z26 A;  5BN9 A;  3WXM B;  4ILH A;  5HP1 A;  1JLB A;  2ZM6 K;  4H5W A;  3H1Q A;  1BQN A;  2G8W A;  1KAX A;  1HQE A;  2UXB K;  5FPM A;  4FM1 A;  3OYJ A;  4CJE A;  4GVM A;  1RDA A;  5IWA K;  2X6S A;  1WSH A;  1UA0 A;  1XMO K;  3HP9 A;  2P9S B;  2V7Y A;  4CF9 A;  4J8F A;  3OTO K;  5HLF A;  4M42 A;  5LJW A;  1D9F A;  3EN9 A;  2GWK A;  4BY9 C;  4JS5 A;  1NGD A;  5C24 A;  4GV6 A;  5J2N A;  2WBN A;  4HTU A;  2VGN A;  1QQO A;  4AHS A;  2ASO A;  4B9S A;  1XNQ K;  4RCH A;  2P9K A;  1VQO N;  1SL0 A;  3GL1 A;  3A8Y A;  3EKU A;  1TL1 A;  1XHX A;  2P1J A;  3CCL N;  3AVB A;  4CEA A;  3D2F A;  3LDS A;  3K9J A;  1WB9 A;  4CZF A;  2HND A;  3VF4 A;  2D0O A;  4OVL A;  4A2A A;  1S3X A;  2GBZ A;  3ID6 A;  4CJV A;  1SKW A;  4JHD B;  4JEP A;  5LY3 A;  1W2B M;  5FPN A;  1R0A A;  1WLJ A;  3THY A;  4YOT A;  4GKJ K;  3M5R A;  1Y64 A;  4KI6 A;  4C8L A;  3VGK A;  3ITH A;  1CXQ A;  3ZSZ A;  3SAH A;  4OKJ A;  1NK9 A;  3J7Z O;  3SUO A;  2E20 A;  2X6N A;  3MEE A;  3QLH A;  4G1Q A;  3THW A;  2HHX A;  1OH5 A;  2CGJ A;  4DSF A;  3SI6 A;  4FVM A;  1HMV A;  4U67 L;  3A5L C;  4CF1 A;  1XUP O;  2A6A A;  5AQQ A;  2OTJ N;  1T03 A;  1IO2 A;  3KD5 E;  1EXQ A;  3HPG A;  3A5O C;  4EIA A;  4YNQ A;  3ZYY X;  3P83 D;  3VEV A;  1Q86 O;  3IKM A;  4IWV A;  4EP4 A;  3DWL A;  4JV5 K;  2I7P A;  1U47 A;  1ATN A;  2IDO A;  3CJ9 A;  1XI1 A;  2NRV A;  3E66 A;  2P51 A;  2HVH A;  4YDU A;  1B9D A;  5C2D A;  3ZET B;  4BRD A;  4E3S A;  4I2P A;  3SLC A;  5T7B A;  3VA0 A;  1IG9 A;  1KVA A;  3U3Y A;  1S1T A;  3J80 O;  4L3Q A;  2OYQ A;  2F7T A;  1O13 A;  2IOC A;  1GLD G;  3DOK A;  3NGZ A;  4Z4H A;  1SS6 A;  2D0C A;  4CFA A;  3SYZ A;  4BEB A;  3CQX A;  4DR3 K;  3OS0 A;  1QE1 A;  5DMR A;  2HBL A;  1B92 A;  2HHS A;  3LAM A;  2UYT A;  4K8Z A;  1KCF A;  2G8K A;  4IJA A;  4CJ7 A;  1RBT A;  1VQP N;  4BRL A;  2UUA K;  1MDU B;  4AM6 A;  3GBT A;  4IEI A;  3AO2 A;  4DR2 K;  4KPY A;  1BHL A;  3L4Q A;  2Y1I A;  2QK9 A;  3QFU A;  4DLE A;  3AO5 A;  4BG8 A;  4J2E A;  3J7A P;  1RDU A;  3V1O A;  4DTM A;  1WSI A;  3CCQ N;  1A5V A;  4IFV A;  4BC3 A;  2IC3 A;  3ZEU B;  2QW9 A;  1VQ5 N;  3LDO A;  1U2V A;  3PIP L;  4WQ4 C;  4DTS A;  1HJR A;  5ADX A;  3EKS A;  3SK3 A;  1YHQ N;  1BO5 O;  3LM9 A;  2FBX A;  3OBY A;  2RPI A;  1NLV A;  2DFE A;  2O8E A;  1X1P A;  2E6L A;  1RTH A;  4KH4 A;  4BDZ A;  4CZJ A;  3ZSV A;  3VQP A;  3CPW M;  1RIL A;  4Z4G A;  2E1Y A;  3ZSQ A;  5F2R A;  4FM2 A;  3IAY A;  1X9W A;  1F21 A;  1GLJ O;  4M41 A;  3QEV A;  3FZM A;  2E2O A;  4DTJ A;  3HOS A;  3ALY A;  1NK5 A;  4FWN A;  4CES A;  4Z4E A;  1RT5 A;  3SQ1 A;  2BGG A;  3P31 A;  4H03 B;  2AA4 A;  2FSN A;  3T3F A;  4YOV A;  2VWJ A;  4FM0 A;  4C1N K;  1LWE A;  5EU7 A;  1Q9Y A;  1Z6R A;  2P9N B;  4KH5 A;  2P9U B;  2X74 A;  1N6Q A;  3O9T A;  1VSL A;  3IG1 A;  1KAZ A;  2ETJ A;  1HKB A;  1VSD A;  3HO1 A;  3O1W A;  4RTF D;  2P9I B;  4DFK A;  2F9T A;  4CJR A;  1E4F T;  3CXC M;  1NKE A;  3K59 A;  4DFJ A;  4NCA A;  2ZF5 O;  4JS4 A;  4BQZ A;  3AA5 X;  3D2E B;  3WNG A;  5J1E A;  4JI0 K;  5JIC A;  3CC7 N;  5AQR A;  4DU4 A;  4CD3 A;  2VQE K;  3G6E N;  3QML A;  3OYN A;  2Q2R A;  4E1M A;  4H5R A;  2B6A A;  3ZCM A;  3AA4 A;  2NRW A;  3S3M A;  3WNF A;  1QSS A;  3QBX A;  4ZTF A;  1SKS A;  3Q7C A;  3S3N A;  1JLE A;  4A5B A;  2Z1J A;  3RMC A;  1DLO A;  3CYG A;  3AVI A;  3PIO L;  4MO5 A;  3THX A;  3PX6 A;  3OA9 A;  3CJ1 A;  3VES A;  3CHW A;  4B9L A;  1FK9 A;  3AAQ A;  2RF2 A;  3A0I X;  3O4Q A;  3CM6 A;  4CIE A;  4JKA A;  5AQH A;  3RMA A;  3T7Z A;  3VQ4 A;  1VQ7 N;  3OBW A;  1HYV A;  5BPM A;  4JAX A;  3SNN A;  3H6E A;  4G9Z A;  2PYL A;  2FC0 A;  2WUS A;  3VTI A;  4GMJ B;  4CGI A;  4ILJ A;  1LAW A;  4FLX A;  2VGM A;  4PQU A;  4OPK A;  1QHA A;  4IZ9 A;  3TAR A;  5SWM A;  5AZJ A;  4DV6 K;  3K5O A;  3DXM B;  1MWM A;  2FSK A;  3DLR A;  4CER A;  4X64 K;  4BRP A;  5HRO A;  4KFB A;  3VEY A;  1S1V A;  4CHQ A;  2HHT A;  4MO4 A;  2YKM A;  4BRM A;  4BR2 A;  4FLT A;  1NKB A;  3N4P A;  1C0M A;  1W0H A;  3HYF A;  4KTZ A;  1QTM A;  1BIU A;  4B9Q A;  4FZZ A;  1N8R O;  4HWI A;  3SMS A;  3SQ2 A;  1GLF O;  1UA1 A;  3LP3 A;  2HHU A;  2YHW A;  2P9P A;  4BR5 A;  1VQ9 N;  5LMN K;  1JLC A;  2JGU A;  4MQ3 A;  3EL2 A;  2DY4 A;  1ZC6 A;  2HF3 A;  2XY6 A;  1LW0 A;  3HPH A;  1CZB A;  4OX9 K;  2YNH A;  5BRH A;  1SQK A;  5I9E B;  1TUY A;  3U4L A;  4CEB A;  3O9R A;  1ATS A;  2VG6 A;  1K73 O;  4YOX A;  1IKV A;  2IVO A;  4L8R B;  3VGL A;  4OKK A;  1WBD A;  2XRI A;  2CH6 A;  3TAP A;  5FDL A;  3CC2 N;  3EZ5 A;  3K2P A;  2Q3S A;  4DV2 K;  4H5T A;  2ITG A;  5F1X A;  2Q31 A;  4CEQ A;  4MDA A;  4C8M A;  1BCM A;  1QQN A;  3EEQ A;  1BI4 A;  1DT9 A;  3TAN A;  1YJ9 N;  3CCE N;  4MLH A;  3MED A;  3MXJ A;  4KHU A;  4IXC A;  2HNZ A;  2QWL A;  3OYM A;  3WQU A;  4FZX C;  4BVO A;  3I8B A;  2R7Y A;  2WTU A;  4IOX A;  3AVA A;  3P39 A;  1KTQ A;  3AAP A;  4O8U A;  4YDU C;  3TSQ A;  4JK7 A;  4KBO A;  1OH8 A;  3CI5 A;  1FKO A;  3SMP A;  2FBT A;  3CJ7 A;  2NZT A;  1XNR K;  3TAG A;  4JK8 A;  3PY8 A;  1HNW K;  1UAX A;  4HUF A;  2E6M A;  3DM2 A;  3JAM O;  2QWM A;  1VK0 A;  2A1S A;  4NCG A;  2NRZ A;  2AP1 A;  4CGD A;  4DV1 K;  2GX9 A;  2W6K A;  1W7A A;  2P9S A;  1EET A;  2ZD1 A;  5AQF A;  3I0R A;  4V19 S;  1TAU A;  4IOC L;  4DV7 K;  1K8K B;  4CD1 A;  4AHC A;  3G0Z A;  3OYF A;  3KLE A;  3BEX A;  1MU2 A;  3NF8 A;  1KAY A;  3RMD A;  1U4B A;  3SQ4 A;  4ELU A;  5KQD A;  2LSN A;  2GTD A;  4BGA A;  2P9L A;  4R5P A;  3QIO A;  2OZM A;  4XEI A;  2NRH A;  3AA3 A;  5FRO A;  4LSN A;  4B08 A;  3SUN A;  2D0P A;  1A5W A;  2Q0R A;  5KQ8 A;  4MFB A;  3NF7 A;  2EX3 A;  1KVC A;  1JL2 A;  1GLE G;  3KD1 E;  3OYD A;  1NOZ A;  3THV A;  1HNI A;  4PA1 A;  3I8D A;  5C0Y A;  1ATR A;  4BE7 B;  3L2U A;  5FRM A;  2QWN A;  4CIG A;  3VF6 A;  4FXD A;  2P5O A;  4E72 A;  2W41 A;  5AQX A;  4CZI A;  4FW1 A;  2JWK A;  1SL1 A;  1HKC A;  5CZ2 A;  2F9W A;  3ENO A;  1RDC A;  4FK0 A;  4JHD A;  1ZBI A;  4FLY A;  4B1W B;  4IO8 A;  1I3A A;  3SQ0 A;  3PX4 A;  4ID1 A;  2EWS A;  4Z94 A;  3O6W A;  3DLB A;  3U6F A;  3VOV A;  4KHS A;  1HRH A;  1Z25 A;  3LM2 A;  4AHU A;  3LZJ A;  4AH9 A;  5FPE A;  3KIO A;  4A61 A;  4FJN A;  4K0K K;  3OS2 A;  4FJK A;  3KJV A;  3CCM N;  3QES A;  3CQ8 A;  1NGI A;  3AVC A;  1SUQ A;  3H46 O;  2QKB A;  4LH4 A;  3UE5 A;  1HNV A;  1VQ8 N;  3N4Q A;  2QI2 A;  2W00 A;  1MWK A;  1IV0 A;  3C6T A;  1W9H A;  1E3M A;  4FJ7 A;  3KLG A;  3VEO A;  2HMP A;  3VEZ A;  3S5T A;  2VYP A;  4LFC K;  4QOZ B;  1XHZ A;  5HRP A;  4IEE A;  4E7K A;  3WQT A;  2ASP A;  4DHY A;  1W97 L;  3R6M A;  1TK8 A;  1BCO A;  4Y1C A;  4EP5 A;  3A5N C;  2EHG A;  5ADX H;  3ZET A;  1N32 K;  4FJ5 A;  4FJ9 A;  2O4G A;  2GUP A;  4Q0B A;  3V9W A;  4KKO A;  1Q81 O;  4C1N I;  4F4K A;  3DLE A;  2NLX A;  4KTQ A;  4QS9 A;  1RBU A;  3DLH A;  1BL3 A;  3LP0 A;  1S1U A;  2HBM A;  1Q8I A;  3EE8 A;  4JYA K;  3W3D A;  3KTQ A;  4CBU A;  1GOB A;  4FWS A;  4K43 A;  3DRP A;  3LDQ A;  3PO4 A;  3HM9 A;  3JS6 A;  1TKT A;  2ZJP L;  4NXM K;  5FPD A;  1NGA A;  1NK6 A;  1HPZ A;  4M7X A;  4NO7 A;  5GAD P;  4DR6 K;  1JLQ A;  1T8E A;  1R59 O;  4M3Y A;  5DK5 A;  4W5N A;  4WYB A;  3CPE A;  4JRP A;  2F8S A;  3QNN A;  4RW4 A;  2ZE2 A;  4UY8 O;  3G10 A;  4B9U A;  3SBG A;  4CJ4 A;  4CHY A;  4AHR A;  2OPS A;  4FJ8 A;  3L3V A;  3DYA A;  4BR9 A;  3L2R A;  1XMQ K;  2C1G A;  1YUW A;  4DR5 K;  4ISG A;  4KV8 A;  4BRA A;  4B3T K;  1VSI A;  1B9F A;  4CBX A;  3QIP A;  4KO0 A;  3QER A;  1LAV A;  4GKK K;  3NDK A;  1EP4 A;  3JXU A;  4GY2 B;  5M1Q A;  1NU0 A;  3V9Z A;  4JI8 K;  1T6C A;  4E1J A;  3RWU A;  1KRP A;  1RBS A;  2IVP A;  2XY5 A;  4JI3 K;  2D0A A;  4HHT A;  4BC4 A;  1KQS M;  3RSE B;  2XO7 A;  1C0U A;  4RW7 A;  4GNI A;  2P9N A;  4KAZ A;  1GOC A;  3IFR A;  3DLL L;  5HL7 L;  2P9U A;  2NUB A;  3T69 A;  4KHY A;  4CFB A;  2HHH K;  1LWC A;  2VG5 A;  2J4R A;  4JKF A;  3EE9 A;  4LH5 A;  4RG8 A;  4PL8 A;  1IBL K;  3CER A;  3TPQ A;  1TK5 A;  1ZBH A;  1WNS A;  2P9I A;  4R79 A;  4C8O A;  5I3U A;  4Y1D A;  5AQL A;  3HPO A;  3O3H A;  3FLC O;  5ELZ A;  5HOO A;  3NH2 A;  3EYZ A;  2E8A A;  1YIT N;  4FK4 A;  4YOR A;  3WXJ A;  1L3S A;  1YI2 N;  4FSV A;  5A2Q O;  5E41 A;  5AQN A;  4DV4 K;  2GEM A;  3HVR A;  1N5Y A;  1RDD A;  4CI6 A;  3VET A;  4X62 K;  4M3U A;  4BGB A;  3ULD A;  3TAQ A;  3E9O A;  5CE3 A;  5IT9 O;  1HX1 A;  2QWP A;  1JLG A;  4OJR A;  5H1S Q;  3CFR A;  3TR8 A;  1L3V A;  1TKD A;  5KPT A;  3AVL A;  3C0B A;  3OJU A;  3LPT A;  3H08 A;  3LWL A;  4N5S A;  3M8Q A;  4NB4 A;  4E1N A;  1HKG A;  1S5J A;  3KWG A;  3SUP A;  4FJX A;  4LF6 K;  3WUH A;  4CJW A;  3FFI A;  3SCX A;  2QKK A;  1YVN A;  2FBV A;  4EHT A;  4F2R A;  4EHU A;  3BF3 A;  1A5X A;  3C6A A;  4HUE A;  4DWI A;  3AAR A;  3ISN C;  2W40 A;  3R8E A;  4H5N A;  4DR4 K;  4CEZ A;  4H0Y B;  3MCP A;  5AFU H;  1NGF A;  4ID5 A;  4PKG A;  3E1Y A;  4DR1 K;  3M6G A;  4K42 A;  5AQP A;  1JXB A;  3OYL A;  3OYC A;  4FWO A;  4BRQ A;  5GIP A;  2E5L K;  1OVY A;  4RW9 A;  4DU3 A;  4GVE A;  4BRK A;  4UQG A;  4XJX A;  3LWM A;  3HT3 A;  3G25 A;  3EY1 A;  1TVR A;  2NNW A;  2P5G A;  3DXK A;  1HNZ K;  4AIL C;  3BF1 A;  3NCI A;  1BDG A;  2PAV A;  3CYM A;  4EZ9 A;  3F73 A;  3I33 A;  3FFK B;  3DXM A;  3OYB A;  3CF5 L;  1NJZ A;  5E84 A;  4CF8 A;  4NLB A;  1X3N A;  4BAC A;  4O0I A;  2A3Z A;  3HXM A;  3CG7 A;  2Y1J A;  1RDB A;  4KHP K;  2ZQB A;  4JI5 K;  4CEC A;  4F3O A;  5JS1 A;  3ENH A;  2E2N A;  4FOE A;  5JMV A;  4OGC A;  1BIZ A;  1VQ4 N;  3RR8 A;  1ASU A;  5JEN A;  2QWR A;  3CET A;  4CGF A;  3KZB A;  3LDL A;  4DUZ K;  5AQV A;  1YAG A;  4A57 A;  4DS5 A;  4H0X B;  3OJS A;  5BN8 A;  4DQS A;  4E7H A;  4BRG A;  4OGE A;  5CY4 A;  3TTF A;  1BA0 A;  1J53 A;  5CYQ A;  4CHZ A;  1N33 K;  1J5E K;  4BDP A;  4KRE A;  5FLX O;  4CFC A;  1NJI O;  3TSU A;  4CK3 A;  1SZ2 A;  3GG4 A;  1NBW A;  1BIS A;  3LDN A;  4ILG B;  4BR4 A;  1UWB A;  4LF5 K;  1BGX T;  5HRS A;  1QHT A;  3LP2 A;  3CD6 N;  4FCY A;  2ZJR L;  5JVG L;  4FLV A;  4FWK A;  5KGX A;  1BOT O;  3ZX3 A;  5GIN A;  3V9S A;  1QQC A;  1NKC A;  4CEO A;  4ISE A;  1N36 K;  1WAJ A;  3TAM A;  3V1Q A;  1U45 A;  2O4I A;  4LSL A;  4X65 K;  1RT6 A;  5TKW A;  3VQB A;  4LF8 K;  1ESV A;  1C0G A;  3PO5 A;  3NMU A;  3O4W A;  4DQQ A;  4FJI A;  2QWO A;  1GLL O;  4W5Q A;  4CW7 B;  4CJ3 A;  3S9H A;  1CXU A;  3BZK A;  4CJT A;  1FW6 A;  4B9N A;  4IG3 A;  1WSE A;  5AQZ A;  3SJJ A;  4BQL A;  1HUX A;  1X9J A;  4NLC A;  1NJY A;  2IAJ A;  3H3O B;  3ZSR A;  2CGK A;  4IDH A;  1RTJ A;  3KKR A;  3CCR N;  4KHN A;  3KK3 A;  3QB0 A;  3SJH A;  3VQ5 A;  5KRS A;  1VSE A;  3VQD A;  3WNE A;  4LFA K;  3HOT A;  3BGR A;  1VRU A;  1C0T A;  3CJC A;  2BAN A;  2KTQ A;  2GV9 A;  5AQY A;  2HHW A;  4AF1 A;  2O8F B;  1K8K A;  5C10 A;  2Z1H A;  1RBR A;  4DTP A;  3OYG A;  1SL2 A;  4N76 A;  1X9M A;  2UU9 K;  3AVF A;  1TKX A;  1NGH A;  4E19 A;  4WCE L;  4N56 A;  1NK0 A;  1ASW A;  4WFA L;  3AA2 A;  3BY5 A;  3VQA A;  3CCS N;  2O8E B;  3O3F A;  1DKG D;  3NGY A;  5CYM A;  4RW8 A;  2HB5 A;  4JI2 K;  4BE2 A;  3KVG A;  2O8B B;  2Q1N A;  3QEI A;  5BRE A;  5BRD A;  4CFD A;  3HP6 A;  1OH6 A;  4H0O A;  1GLA G;  3DRR A;  2HF4 A;  3E9L A;  3ZSW A;  4CF2 A;  2FF3 B;  2WC9 A;  4DV3 K;  4CJU A;  5M1K A;  3O4N A;  1YJW N;  3WT0 A;  1SAZ A;  3D0P A;  3TI0 A;  4DSL A;  3FGU A;  2YHA A;  1DTT A;  1BG3 A;  4ISF A;  2VWK A;  1QSY A;  4JI6 K;  3AO1 A;  1LV5 A;  3VA3 A;  3F9M A;  2A5X A;  4B3O A;  5C12 A;  4O55 A;  3C6H A;  2OCE A;  4EFH A;  1DEJ A;  2XY8 A;  3C7N B;  4CZK A;  3RTV A;  5J2M A;  2UXD K;  3WNH A;  4CJP A;  2HOE A;  3ZSX A;  3ZT4 A;  3RRG A;  3NE6 A;  4KB0 A;  1YJN N;  4HUG A;  2VCP A;  4LC9 B;  5GAH P;  3IDH A;  4FPB A;  4MLE A;  3HJF A;  1HQU A;  4JD2 A;  5HRN A;  3GE1 A;  2QTD A;  2QXF A;  1QS4 A;  3VQ9 A;  2UUC K;  1JCF A;  1T7P A;  1VHX A;  3KLH A;  3AO4 A;  3MN7 A;  4LY7 A;  3NGI A;  3OYI A;  3PV8 A;  4JNE A;  4BVP A;  1KLM A;  4FWM A;  4O44 A;  3MXM A;  1JL1 A;  3I55 N;  4M3W A;  1FKP A;  1EWQ A;  4IO9 L;  3ZLJ A;  4W5O A;  1K6Y A;  1QSL A;  2ATQ A;  4YHH K;  4FLZ A;  1L3U A;  3CM5 A;  3O9S A;  3OHR A;  3R1X A;  4CJS A;  3V9U A;  3L2V A;  5EY4 A;  5M1F A;  5E26 A;  3BUZ B;  1V4S A;  3VEW A;  3HL8 A;  4BE0 A;  3THX B;  1EO1 A;  4X66 K;  2ZWH A;  1LOT B;  3QIC A;  3FR0 A;  3FZK A;  3CJB A;  4KRF A;  2BH1 A;  1WAF A;  4KTW A;  5KPZ A;  5I42 A;  1KXP A;  4LF4 K;  3VER A;  3UKU B;  4B1Z A;  3BP8 A;  1I39 A;  5AQG A;  4YY3 K;  1JLF A;  2O8D B;  1JKH A;  1UOC A;  3K0S A;  3WEE B;  1OH7 A;  2RN2 A;  5K14 A;  2FBY A;  2OZS A;  1Q7Y O;  1RCH A;  1J6Z A;  3MN9 A;  5JLH A;  4LD0 A;  2O8C B;  4EZ6 A;  3MN6 A;  1BA1 A;  4E7J A;  3F5T A;  3O1B A;  2Q36 A;  2ZGY A;  1S9G A;  3ATU A;  5KTQ A;  4DR7 K;  4BC2 A;  1HLU A;  4H4M A;  1NK8 A;  1EQY A;  1C0F A;  5F0X A;  1NGG A;  1RNH A;  3DJC A;  3AVJ A;  4DFP A;  2NRX A;  3I0S A;  2YHB A;  2FLO A;  2V51 B;  5B8H A;  4DCH A;  4BG9 A;  3QIN A;  1ZBL A;  4BWM A;  3M1F A;  3H45 C;  3KWI A;  5J2Q A;  3RSE A;  1HR0 K;  2KKZ A;  3L2W A;  1WSG A;  2UXC K;  4JKC A;  5AQW A;  1Q82 O;  1BU6 O;  1EKE A;  4JKH A;  3VQQ A;  3SBT A;  1VQL N;  4FJJ A;  4J2B A;  1ITG A;  1D4X A;  4H0T B;  2YKN A;  4BRO A;  4DQI A;  2KFZ A;  4C8K A;  4QAG A;  3CC4 N;  4OPH A;  4I7F A;  1BQM A;  2BDP A;  4E7L A;  3L4I A;  4O4G A;  5AQS A;  3P38 A;  5DM6 L;  3IUC A;  5GAG P;  3VEN A;  1U49 A;  3LPU A;  3HVT A;  1HNX K;  4MDB A;  2KQ2 A;  4H0V B;  4OPJ A;  3ATV A;  3L8B A;  3F9K A;  2A40 A;  2WON A;  1S1X A;  3HRG A;  1NMD A;  4CK2 A;  3SAF A;  3AVM A;  3D45 A;  4CGH A;  3R9P A;  4HCB A;  3LL3 A;  3IS9 A;  2E4L A;  5AR0 A;  4DF8 A;  4NCB A;  1IKW A;  4ELT A;  2HHI A;  1YTA A;  1SKR A;  2IGI A;  4I9Q A;  4BC5 A;  1XC9 A;  3UKR B;  1VQN N;  4PKI A;  3TAE A;  4WFB L;  3ID8 A;  5BR8 K;  2ASM A;  3QNO A;  1IG8 A;  5EOY A;  3CIP A;  3C94 A;  3RRH A;  2A41 A;  3TSP A;  3M3Z A;  3A2F A;  2HNY A;  3SPZ A;  5TKY A;  3CCV N;  1LCU A;  4DSE A;  1TKZ A;  5JVH L;  3WXK A;  1HPM A;  2G8U A;  2H3G X;  3V9X A;  4FWP A;  5M1O A;  2XHB A;  5LJV A;  2KHO A;  3V1R A;  3T1Y K;  3TAF A;  2BTF A;  4E89 A;  5MLC Q;  1WOQ A;  1O1W A;  2D4W A;  2BUP A;  3J8A A;  4H4O A;  3J7Y P;  4KH6 A;  4HVJ A;  3G71 N;  2B5J A;  1JJ2 M;  1VRT A;  3U3G A;  3UIQ A;  4DU1 A;  1WBB A;  4CGJ A;  5BR9 A;  3AVN A;  2HHQ A;  3O9U A;  1QQM A;  3QEP A;  1GLC G;  3EO3 A;  3ZEU A;  4Q5V A;  3AO3 A;  3QEW A;  4DSI A;  4H0P A;  4B1X B;  1KD1 O;  1QVF M;  3GOI A;  3ZSO A;  4CCH A;  1TYQ B;  2YI1 A;  4I2Q A;  3U8X A;  4XH1 A;  4I6M B;  4U7B A;  2HST A;  4JN4 A;  1K9M O;  2YNG A;  4PUO A;  4WQ5 A;  2QM1 A;  2P9L B;  3VQC A;  4BRH A;  3LZI A;  1NK7 A;  3O3G A;  4CVN E;  3OYE A;  3TU5 A;  3CJA A;  3L6Q A;  4M45 A;  2OPP A;  4IJN A;  1YTU A;  4IG0 A;  3CME N;  4RWT A;  3QEX A;  3V81 A;  5AQO A;  2HMI A;  4B1Y B;  4HTL A;  4DF4 A;  1K8A O;  5AZI B;  1D5A A;  1WN7 A;  1U04 A;  3MMV A;  4DSJ A;  1S6Q A;  3DRS A;  4CJL A;  2Z1I A;  5LMU K;  3U9Z A;  4A2B A;  4YOW A;  4GV3 A;  3HM8 A;  4FWQ A;  4YFU A;  4NYN A; 
#chains in the Genus database with same CATH homology
 1ZC6 A;  4A57 A;  4H0X B;  2HF3 A;  1T6D A;  5BN8 A;  3W0L A;  3R3L A;  1BWF O;  5AQJ A;  5KPR A;  5EVZ A;  2KLA A;  5BRH A;  1SQK A;  3D2E A;  3QFP A;  4BRG A;  5BRF A;  4FPA A;  5I9E B;  3TTF A;  1BA0 A;  4B1U B;  4DKW A;  4PKH A;  4B1V A;  1TUY A;  3U4L A;  3ULE B;  3VPZ A;  4CZG A;  3O9R A;  3ULE A;  1ATS A;  1K73 O;  4YOX A;  2E2P A;  1NJI O;  2V7Z A;  4JD2 B;  3CMA N;  3FZH A;  3MX2 A;  3TSU A;  2IVO A;  3HI0 A;  1QZ5 A;  3VGL A;  1SZ2 A;  2RE2 A;  2PFU A;  3GG4 A;  3CCJ N;  1NBW A;  2CH6 A;  4WFN L;  3CC2 N;  1DGK N;  3LDN A;  4ILG B;  2ITM A;  3VF2 A;  2YCH A;  3ZX2 A;  4BR4 A;  3OW2 M;  4BR7 A;  3S41 A;  4H5T A;  1T3V A;  3D7E O;  3CD6 N;  5F1X A;  1RGI A;  2Q31 A;  3KHY A;  4MDA A;  1QQN A;  3HTV A;  2YHX A;  2ZJR L;  5JVG L;  4FWK A;  1H1V A;  1BOT O;  2QXL A;  3ZX3 A;  1DT9 A;  5GIN A;  3AGK A;  4CZH A;  4ISE A;  1YJ9 N;  4JKD A;  3CCE N;  1NGJ A;  4MLH A;  1BUP A;  3VGM A;  4JKG B;  4IXC A;  5M1N A;  2QWL A;  4JKG A;  5TKW A;  3WQU A;  4PHT X;  4BVO A;  3I8B A;  2D1K A;  1QZ6 A;  1VQM N;  1ESV A;  1Q18 A;  1C0G A;  4IOX A;  3NMU A;  2E2Q A;  3O4W A;  3P39 A;  1CZA N;  2QWO A;  1GLL O;  2FSJ A;  3AAP A;  2ZGZ A;  3FE1 A;  4O8U A;  4YDU C;  1S72 N;  3TSQ A;  4JK7 A;  4KBO A;  3CI5 A;  1JCE A;  2VWB A;  3SMP A;  1T44 A;  3CJ7 A;  4DQ8 A;  4GV9 A;  2NZT A;  5AQZ A;  3CCU N;  5BN9 A;  4BQL A;  1HUX A;  4JK8 A;  4ILH A;  3WXM B;  1YIJ N;  1X9J A;  4NLC A;  3H1V X;  4H5W A;  2HBK A;  3H1Q A;  3H3O B;  2CGK A;  3HZ6 A;  1KAX A;  4IDH A;  2QWM A;  3CCR N;  5FPM A;  4FVU A;  3QB0 A;  1NM1 A;  3SJH A;  2NRZ A;  2AP1 A;  3QDK A;  5AQI A;  2GX9 A;  2P9S B;  3HOT A;  2V7Y A;  5C15 A;  2P9S A;  3CJC A;  1VQK N;  2ZJQ L;  5AQY A;  4AF1 A;  5AQF A;  4J8F A;  3HBT A;  4IOC L;  3AY9 A;  1K8K B;  3MCA B;  4CD1 A;  5AQU A;  5LJW A;  1K8K A;  5C10 A;  3BEX A;  3EN9 A;  1KAY A;  2GWK A;  4BY9 C;  1NGD A;  4GV6 A;  2WBN A;  5KQD A;  3F2K A;  2GTD A;  4BGA A;  1NGH A;  4WCE L;  2VGN A;  2P9L A;  3MWT A;  4F9O A;  1QQO A;  3G4S N;  4XEI A;  2ASO A;  2NRH A;  3D6R A;  2P9K B;  4WFA L;  1ZXO A;  2D0P A;  4RCH A;  3CCS N;  2P9K A;  2Q0R A;  3ENB A;  5KQ8 A;  1DKG D;  1VQO N;  3GL1 A;  3A8Y A;  4M63 C;  2RHK A;  3KVG A;  1GLE G;  2Q1N A;  2CH5 A;  3EKU A;  3NVK A;  1YXQ A;  3MX5 A;  5BRE A;  5BRD A;  3H3N O;  3D2F B;  3TTC A;  1QVG M;  3CCL N;  4IFE A;  1ATR A;  1YF5 L;  5C0Y A;  4BE7 B;  3D2F A;  2QWN A;  3K9J A;  4H0O A;  1GLA G;  3VF6 A;  2HF4 A;  3E9L A;  1M1K O;  3O80 A;  2W41 A;  5AQX A;  2FF3 B;  2WC9 A;  4CZF A;  4CZI A;  4Y0W A;  2JWK A;  3VF4 A;  1HKC A;  2F9W A;  2D0O A;  4FL9 A;  5M1K A;  4A2A A;  1S3X A;  3ENO A;  1YJW N;  3ID6 A;  3WT0 A;  4JHD B;  1SAZ A;  4JEP A;  5LY3 A;  1W2B M;  5FPN A;  4BRE A;  4JHD A;  3FGU A;  4ISF A;  1BG3 A;  4B1W B;  4IO8 A;  3F9M A;  2A5X A;  4K25 A;  4YOT A;  3O08 A;  5C12 A;  4M7Y A;  3C6H A;  4EFH A;  1DEJ A;  3C7N B;  3M5R A;  2EWS A;  4Z94 A;  1Y64 A;  3WXL A;  2FF6 A;  4CZK A;  3C7N A;  3O6W A;  3VGK A;  2HOE A;  3VOV A;  3SAH A;  3LM2 A;  5FPE A;  1YJN N;  2VCP A;  4LC9 B;  4A61 A;  5GAH P;  3J7Z O;  5EXW A;  4A62 A;  1NGB A;  2E20 A;  3IDH A;  3LDP A;  4FWR A;  4FPB A;  4MLE A;  2FXU A;  2PBD A;  4JD2 A;  3GDQ A;  2CGJ A;  3GE1 A;  3CCM N;  2QTD A;  2OTL N;  1VQ6 N;  1NGI A;  3QBW A;  4U67 L;  2WFB A;  3A5L C;  1JCF A;  1XUP O;  2A6A A;  3H46 O;  5AQQ A;  2GWJ A;  3UE5 A;  2OTJ N;  3MN7 A;  1VQ8 N;  3N4Q A;  4CBW A;  2QI2 A;  3VTH A;  2W00 A;  1MWK A;  3A5O C;  4JNE A;  4BVP A;  4EIA A;  3ZYY X;  4FWM A;  3VEV A;  1Q86 O;  3IKM A;  4IWV A;  3I55 N;  3DWL A;  3VEO A;  2HMP A;  3VEZ A;  2VYP A;  4IO9 L;  2A42 A;  2I7P A;  1ATN A;  4IEE A;  5DM7 L;  1WUA A;  3CJ9 A;  3WQT A;  2ASP A;  4DHY A;  1W97 L;  2NRV A;  3E66 A;  3R6M A;  4YDU A;  3A5N C;  5C2D A;  2E88 A;  5ADX H;  3ZET B;  3O9S A;  3ZET A;  3OHR A;  2IVN A;  3R1X A;  4BRD A;  2GUP A;  3SLC A;  5EY4 A;  5M1F A;  4WF9 L;  4L3Q A;  3B8A X;  5E26 A;  2F7T A;  1O13 A;  3BUZ B;  1Q81 O;  1V4S A;  3VEW A;  1GLD G;  4YOU A;  4C1N I;  5BPL A;  3I56 N;  1EO1 A;  2ZWH A;  1LOT B;  2NLX A;  3QIC A;  3FR0 A;  4QS9 A;  3FZK A;  1S22 A;  3CJB A;  1SS6 A;  2BH1 A;  4BEB A;  3CQX A;  2V52 B;  5KPZ A;  2HBM A;  2HBL A;  4BR0 A;  3EE8 A;  4OO1 J;  2UYT A;  3KK7 A;  3K9K A;  4IJA A;  3W3D A;  1KXP A;  4CJ7 A;  5CHI A;  1VQP N;  4BRL A;  4CBU A;  3VER A;  3UKU B;  4FWS A;  1MDU B;  4K43 A;  4B1Z A;  3BP8 A;  3LDQ A;  3UKU A;  4AM6 A;  3GBT A;  4IEI A;  4YOY A;  3JS6 A;  2NRR A;  4QS7 A;  5AQG A;  2YJE A;  4FWL A;  2ZJP L;  5FPD A;  1NGA A;  2QA4 N;  3L4Q A;  4M7X A;  4NO7 A;  3QFU A;  5GAD P;  4BG8 A;  3WEE B;  1R59 O;  1RDU A;  2QWQ A;  4WYB A;  3CPE A;  3WEE A;  1TUU A;  3CCQ N;  1Q7Y O;  1J6Z A;  3C65 A;  4BC3 A;  3SAG A;  3MN9 A;  4UY8 O;  1U2V B;  3ZEU B;  2QW9 A;  3SBG A;  5JLH A;  1VQ5 N;  3LDO A;  1U2V A;  3PIP L;  3MN6 A;  4WQ4 C;  4BR9 A;  1BA1 A;  2I7N A;  5ADX A;  3P4I A;  3EKS A;  3O9Q A;  3SK3 A;  1YHQ N;  2C1G A;  1BO5 O;  3LM9 A;  3F5T A;  1YUW A;  3O1B A;  2Q36 A;  2ZGY A;  3OBY A;  5AQM A;  3A5M C;  1NLV A;  4ISG A;  3ATU A;  4BEC A;  4KH4 A;  4BRA A;  1P90 A;  4CZJ A;  3DXK B;  4BC2 A;  3CPW M;  1HLU A;  2JWL A;  4CBX A;  2E1Y A;  2YX6 A;  1EQY A;  1C0F A;  3NVM A;  5F0X A;  5F2R A;  1NGG A;  4JKB A;  3FZL A;  1NGE A;  3MN5 A;  1E4G T;  3DJC A;  1GLJ O;  1P8Z A;  2NRX A;  4WQ5 C;  3FZM A;  2E2O A;  2NRT A;  3AGR A;  3HOS A;  3JXU A;  2FLO A;  4PL7 A;  4GY2 B;  2V51 B;  2IIR A;  4FWN A;  5M1Q A;  5B8H A;  4DCH A;  4BG9 A;  3DAW A;  1T6C A;  1NWK A;  4E1J A;  3P31 A;  3EZW A;  2AA4 A;  2FSN A;  4H03 B;  4AM7 A;  5BPN A;  4YOV A;  2IVP A;  5AFU A;  3VMF B;  4C1N K;  4BC4 A;  1KQS M;  3M1F A;  5AQT A;  3H45 C;  3RSE B;  3KWI A;  4XH4 A;  1Z6R A;  2P9N B;  3RSE A;  3L0Q A;  4GNI A;  3CQY A;  2KKZ A;  2P9N A;  2P9U B;  4KH5 A;  2YHY A;  3IFR A;  4JKC A;  5AQW A;  5HL7 L;  2P9U A;  4A5A A;  3DLL L;  1BU6 O;  3O9T A;  4JKH A;  1Q82 O;  3SBT A;  5M1P A;  1RDW X;  1MA9 B;  1KAZ A;  3T69 A;  1VQL N;  1D4X A;  4H0T B;  1NGC A;  4BRO A;  2J4R A;  4JKF A;  3EE9 A;  1HKB A;  3O1W A;  1ZBS A;  4PL8 A;  4RTF D;  3CC4 N;  4OPH A;  4BRI A;  3CER A;  5EX5 A;  2P9I B;  3TPQ A;  4FOI A;  3L4I A;  2F9T A;  2P9I A;  1E4F T;  5AQS A;  4R79 A;  3CXC M;  5AQL A;  1G99 A;  3P38 A;  5DM6 L;  3IUC A;  2ZF5 O;  5GAG P;  4BQZ A;  3D2E B;  3FLC O;  5ELZ A;  3VEN A;  5HOO A;  2E8A A;  5JIC A;  4MDB A;  1YIT N;  3MWP A;  3CC7 N;  5C2F A;  5AQR A;  4H0V B;  4YOR A;  3ATV A;  3VEX A;  3IMX A;  3WXJ A;  4CD3 A;  2A40 A;  1YI2 N;  4FSV A;  3G6E N;  5AQN A;  2GEM A;  3QML A;  4CI6 A;  3HRG A;  1NMD A;  2Q2R A;  3VET A;  4XH5 A;  3SAF A;  5AQK A;  1V4T A;  1XQS C;  4H5R A;  4CZM A;  2Q97 A;  3R9P A;  2GEL A;  4BGB A;  3E9O A;  3LL3 A;  4DB3 A;  5CE3 A;  3UB5 A;  4IOA L;  2NRW A;  1X3M A;  5AR0 A;  2QEX N;  1HX1 A;  4JK9 A;  2QWP A;  5H1S Q;  3QBX A;  3FZF A;  3Q7C A;  5KPT A;  4BC5 A;  3C0B A;  1RFQ A;  3UKR B;  3ZX0 A;  1XC3 A;  4A5B A;  1VQN N;  3UKR A;  3RVC A;  1JCG A;  4BRN A;  4PKI A;  4WFB L;  3PIO L;  3ID8 A;  3O8M A;  1KC8 O;  5GAE P;  2ASM A;  4NB4 A;  1HKG A;  4MO5 A;  1IG8 A;  3KWG A;  3WUH A;  5EOY A;  1YVN A;  3CIP A;  3OA9 A;  4BRC A;  3CJ1 A;  1ILY A;  3VES A;  3CHW A;  2A41 A;  4FO0 A;  3M3Z A;  3TSP A;  4EHT A;  1U6Z A;  4EHU A;  4O8K A;  3BF3 A;  5TKY A;  3CCV N;  1LCU A;  3AAQ A;  5JVH L;  3A0I X;  1HPM A;  3C6A A;  3WXK A;  2C1I A;  1GLB G;  2H3G X;  4JKA A;  4FWP A;  5CR4 A;  5AQH A;  3AAR A;  5M1O A;  2W40 A;  2KHO A;  1OKJ A;  5LJV A;  1M90 O;  3R8E A;  3T7Z A;  2BTF A;  4H5N A;  3PLA A;  5JLF A;  5MLC Q;  1VQ7 N;  3OBW A;  1WOQ A;  2YJF A;  4H0Y B;  2D4W A;  2BUP A;  3J8A A;  3MCP A;  5AFU H;  4KH6 A;  1NGF A;  3G71 N;  4WQ4 A;  5BPM A;  1JJ2 M;  3O5B A;  4PKG A;  4JAX A;  3E1Y A;  4H5V A;  5BR9 A;  3M6G A;  4CZE A;  3O9U A;  4K42 A;  5AQP A;  1QQM A;  4A59 A;  1GLC G;  3EO3 A;  3H6E A;  4FWO A;  3TTD A;  1IJJ A;  3ZEU A;  4BRQ A;  5GIP A;  4H0P A;  4B1X B;  1KD1 O;  1QVF M;  1OVY A;  2DPN A;  3GOI A;  4K41 A;  4G9Z A;  1TYQ B;  4O5F A;  2YI1 A;  4GVE A;  4BRK A;  1TYQ A;  3Q7B A;  3U8X A;  4XH1 A;  2WUS A;  3VTI A;  4XJX A;  4ILJ A;  4I6M B;  4U7B A;  3G25 A;  4I6M A;  2HST A;  2NNW A;  4JN4 A;  2OAN A;  1K9M O;  3DXK A;  2VGM A;  3HSC A;  4WQ5 A;  1HJO A;  2QM1 A;  1QHA A;  3BF1 A;  4IZ9 A;  4OPA A;  5AZJ B;  1BDG A;  2PAV A;  5AZJ A;  4EAH D;  2P9L B;  1VAZ A;  1MWM A;  2FSK A;  3DXM B;  3I33 A;  3FFK B;  3DXM A;  4BRH A;  3CF5 L;  5GIO A;  2Q0U A;  5E84 A;  4NLB A;  1Z05 A;  4BRP A;  3TU5 A;  3CJA A;  3L6Q A;  1X3N A;  4C23 A;  4IJN A;  2A3Z A;  2CGL A;  3VEY A;  3U9D A;  3CME N;  4MO4 A;  4CZL A;  4RWT A;  5AQO A;  4BRM A;  4BR2 A;  3ENH A;  2E2N A;  4FOE A;  4HTL A;  4B1Y B;  3N4P A;  1K8A O;  5AZI B;  3E9P A;  5JMV A;  3MK6 A;  3MMV A;  5AZI A;  4B9Q A;  3MDQ A;  1VQ4 N;  1N8R O;  4HWI A;  3SMS A;  1GLF O;  3U9Z A;  2HBJ A;  2QWR A;  2P9P B;  4A2B A;  2YHW A;  4YOW A;  3CET A;  4GV3 A;  3KZB A;  3HM8 A;  2P9P A;  3LDL A;  4JKE A;  4BR5 A;  2E1Z A;  1VQ9 N;  4QS8 A;  4FWQ A;  3WXI A;  5AQV A;  4BRF A;  1YAG A;  3EL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...