2P9UB

Crystal structure of bovine arp2/3 complex co-crystallized with amp-pnp and calcium
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
248
structure length
222
Chain Sequence
TEPPMIQAVLTLYQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 59
structure length 222
sequence length 248
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9uB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9uB02
4H03B 4IZ9A 5AFUH 2GELA 4J8FA 4DQ8A 5BREA 2FSNA 4CZIA 5AQIA 2CGJA 4A2AA 4CD1A 2FSKA 3VEYA 5AQOA 1GLAG 1R59O 1HKGA 2P9PA 3KVGA 5AQVA 3MCPA 4H0VB 3JS6A 2HOEA 4BRIA 3UKRB 3WXJA 1NGGA 2Q97A 4BR2A 5ELZA 2AA4A 4JAXA 3M1FA 3ULEA 1GLCG 1MWMA 3I33A 3VOVA 5BRDA 1NGHA 2P9NA 4H0OA 4IJAA 1KAZA 3MDQA 4B1WB 5LY3A 3TPQA 3AAPA 1YUWA 3DAWA 2V51B 4H0TB 4EIAA 3DXKB 3C7NB 4BQZA 5AFUA 3LM2A 2DPNA 4EFHA 2QW9A 3VF2A 3ZX0A 3DWLA 3GE1A 3ZX2A 3CJ9A 4MO5A 5EXWA 1SQKA 4QS7A 4PL7A 2P9LA 1DKGD 4IJNA 3U9DA 1HUXA 2F9TA 5KQDA 2A3ZA 2GEMA 4BQLA 2BTFA 5FPMA 1U2VB 3VF6A 4JD2A 3LM9A 5KPTA 2Q0UA 4BRLA 3MK6A 2W41A 3D2FA 2IIRA 3QBXA 3O1WA 1MWKA 1XC3A 3M6GA 4L3QA 4BVPA 3HSCA 1GLFO 3A5NC 5AZIA 2GUPA 2P9PB 2Q31A 1BG3A 3WXLA 3A5OC 5LJWA 4NB4A 4B1UB 4B1ZA 1E4GT 2E2NA 3RSEA 5AQNA 5BPNA 3KHYA 4BRGA 1T6CA 5FPNA 1S3XA 3L4IA 3ULEB 1Z05A 5JICA 1ATRA 2D1KA 5EVZA 4O5FA 1NM1A 2P9NB 4CZJA 2W40A 1HKBA 3EL2A 4XEIA 5BR9A 2V52B 2NRHA 1H1VA 1IG8A 2VYPA 2QWQA 1KXPA 1HX1A 2AP1A 3EZWA 4CZKA 2CH5A 1GLJO 4A2BA 3MN5A 3SK3A 1QQMA 3LDQA 1BWFO 5CE3A 1IJJA 4EHTA 1RGIA 3LL3A 2UYTA 4FWMA 1DEJA 1X9JA 2Q2RA 5LJVA 2VWBA 3P4IA 3IMXA 2P9LB 2NZTA 1BDGA 5F0XA 1SAZA 5F1XA 2WUSA 2Q0RA 1KAYA 3CQYA 3GBTA 3FE1A 4FPAA 4JD2B 4BRFA 5BN8A 1TUYA 3BF3A 5AR0A 4PKGA 4CI6A 5E84A 4AM7A 3D2FB 3HI0A 4FOIA 4H5WA 4HWIA 3ATVA 5BRFA 5AZIB 3TU5A 5JLHA 3F9MA 1LCUA 1ATSA 4BR7A 3O8MA 3ATUA 2IVOA 1NGBA 5AQHA 2F9WA 1ZC6A 3M3ZA 4IXCA 1CZAN 3RSEB 4BRAA 1QQNA 3KZBA 3IFRA 3L6QA 1BA0A 2A40A 1U6ZA 4YDUA 4AM6A 3A5MC 1XUPO 3VGKA 4HTLA 1BOTO 2Q1NA 3CETA 3H1QA 1P8ZA 5AQMA 1EQYA 4B9QA 3VENA 4FWNA 4BG9A 3VEWA 1HKCA 5AQKA 3AARA 4H5NA 1BU6O 3FZMA 4JNEA 2A42A 3WQTA 1RDWX 3H46O 1ESVA 3I8BA 4FWRA 5BRHA 4BRKA 2ASOA 4BRPA 2HF4A 5AQYA 3BUZB 3R8EA 3ENOA 3ENHA 3QFPA 3D2EA 4PL8A 3UE5A 2FSJA 3H3OB 4MLHA 2E1ZA 4H5TA 3HZ6A 4EAHD 3VESA 2PBDA 1BO5O 2YHYA 2ASPA 2E2QA 4H5VA 3HBTA 3FZFA 3BP8A 3H1VX 4BRMA 3JXUA 1G99A 3EKSA 3QFUA 4BGAA 2IVPA 3LDNA 3WQUA 1ATNA 2QWRA 2ZWHA 3GG4A 4JN4A 4EHUA 4FPBA 4FWPA 4FWLA 3A0IX 4K42A 5I9EB 2CGKA 2NLXA 4FSVA 4WQ4A 4BRNA 1GLBG 2QWLA 3EN9A 4ISFA 1TUUA 1QHAA 1LOTB 1WUAA 1YXQA 5ADXH 3CHWA 2FLOA 1YAGA 3O4WA 2EWSA 2A41A 1SZ2A 3R9PA 4FO0A 2ASMA 3UKUA 5JMVA 4MLEA 5AQLA 3CJAA 1BA1A 2QWNA 5F2RA 4BREA 1NGIA 5KPRA 3HM8A 3VF4A 3FLCO 3EKUA 1JCGA 2OANA 4CZFA 3VERA 2ZGZA 3GDQA 4CD3A 3VEOA 5BPLA 3CI5A 3ID8A 3D2EB 3O6WA 1J6ZA 3WXIA 1C0GA 1MDUB 3O80A 5FPDA 4F9OA 4YDUC 2D4WA 1HJOA 1NMDA 1WOQA 4BC2A 3UB5A 5AQGA 2FXUA 4BRDA 3VEZA 3QICA 5JLFA 4O8KA 2YI1A 5AQXA 3QB0A 1NGDA 4GY2B 5ADXA 2QWOA 4CZGA 3VEVA 5BPMA 4ISEA 1Z6RA 3CJCA 1S22A 4BR0A 4BRCA 1NGAA 4BGBA 3C0BA 4FWSA 4K41A 3DJCA 2P9SA 3W3DA 4CBWA 3R6MA 4GNIA 4B1VA 2P9UA 4QS8A 5AQUA 2E1YA 4NO7A 3ZETA 1DGKN 4K25A 3GL1A 4CZLA 4BVOA 5EX5A 4CJ7A 5B8HA 4FL9A 2I7PA 2GWKA 3FGUA 1X3NA 1HLUA 2YHXA 1ZXOA 4PKIA 3U4LA 3UKUB 3L0QA 3W0LA 4B1XB 1MA9B 3O1BA 5KPZA 1V4SA 3SMSA 3H3NO 3WXKA 4BR9A 1C0FA 2QXLA 3CERA 3H45C 2I7NA 4BC3A 4WQ4C 3A8YA 3IUCA 4I6MA 3HTVA 3EO3A 4C23A 3WUHA 1QZ6A 1OKJA 2P9IA 3GOIA 4DHYA 4E1JA 2Q36A 3WEEA 1NGEA 5EY4A 4BR5A 4A62A 4CZEA 2YJEA 2E2OA 2P9KA 3BF1A 2FF3B 2GWJA 1HPMA 4H5RA 4ISGA 4M7YA 4WQ5C 3U9ZA 2CH6A 1V4TA 3ZEUA 5AQJA 5AQPA 2D0PA 4XH1A 2P9SB 3CJ7A 3SMPA 4K43A 3CJ1A 4M7XA 2E8AA 2FF6A 3O5BA 5AQZA 4RCHA 3VETA 3B8AX 5FPEA 5EOYA 2P9UB 4DB3A 3MMVA 3QBWA 3O08A 3S41A 1NBWA 3ZETB 2E88A 3QDKA 2GTDA 4CZMA 2BUPA 3D7EO 4JHDA 4DCHA 1BUPA 5AQQA 1RFQA 3LDOA 3FZKA 5AQSA 2QWMA 4FWOA 4QS9A 2ZGYA 3MN7A 5AZJA 2YJFA 4BRQA 1QZ5A 1K8KA 4I6MB 2A5XA 4KBOA 2HF3A 5KQ8A 1JCEA 3QMLA 2P9IB 4BROA 3VPZA 3LDLA 4FWKA 4WQ5A 1NGJA 3WEEB 2YCHA 2D0OA 3H6EA 4A61A 5TKYA 4PKHA 2P9KB 3AAQA 1GLDG 4H0PA 3FZLA 3ZEUB 1D4XA 1TYQA 2J4RA 2H3GX 2ITMA 3SLCA 4Y0WA 4RTFD 2YHWA 1XQSC 2V7ZA 3DXMA 4H0YB 3MN6A 3CIPA 1Y64A 4CBXA 5AQFA 3AY9A 3BEXA 4RWTA 3CJBA 4JHDB 3CQXA 2E20A 3MN9A 4B1YB 4BG8A 5E26A 4MO4A 5AZJB 4LC9B 1T6DA 4H0XB 3LDPA 1ZBSA 2PAVA 4XH5A 1K8KB 3ZX3A 3UKRA 3J8AA 2A6AA 4FOEA 3FZHA 5BN9A 3WT0A 1Q18A 4CBUA 2QWPA 3VGMA 4Z94A 1GLEG 3FFKB 4WYBA 4FWQA 2V7YA 5AQWA 3G25A 4BR4A 3OHRA 5AQRA 2E2PA 1E4FT 1QQOA 3DXKA 3IDHA 1NWKA 3C7NA 1KAXA 3SJHA 2IVNA 1TYQB 2QM1A 4BRHA 4BC4A 3VGLA 1JCFA 4CZHA 3FR0A 3A5LC 1X3MA 1T44A 4M63C 3U8XA 1GLLO 2ZF5O 1NGCA 4BC5A 2VCPA 1YVNA 3DXMB 4IO8A 4XH4A 5AQTA 2KHOA 2HMPA 3VEXA 2CGLA 1NGFA 4IWVA 1NLVA 1U2VA
chains in the Genus database with same CATH superfamily
4CFAA 4J8FA 2WFBA 1JLBA 2FSNA 2CGJA 4CD1A 4DTUA 3T7ZA 2ZJRL 3ZSVA 1F21A 3HT3A 1R59O 1WBDA 2IOCA 4CGDA 4H0VB 1NJIO 4BRIA 1NK0A 4C8LA 3VQ9A 2F7TA 2YNIA 5ELZA 3TI0A 4JAXA 3HM9A 2ZJPL 4FXDA 5HRNA 2KZZA 3TAQA 3MDQA 5LY3A 1NOYA 4GV9A 2HVIA 5JS1A 3TARA 2V51B 2NUBA 3LM2A 3CMEN 1KCFA 3ZX2A 3V9XA 3CCJN 4DSIA 5GADP 4IFVA 3TAFA 3OY9A 4PL7A 4JS4A 1SL1A 4CEFA 3EEQA 2GEMA 4CHPA 4BQLA 4CK1A 5LMNK 3LM9A 4B08A 1BQNA 3MK6A 2IIRA 1Q9XA 3QBXA 2ATQA 1MWKA 3G10A 3CM5A 1C1CA 1GLFO 5AZIA 1NKBA 3A5OC 5FRNA 1E4GT 4RW8A 3O9SA 3TANA 3R3LA 2WC9A 3WNGA 3PV8A 2W40A 1VQLN 3EL2A 5BR9A 1H1VA 5T7BA 3ASMA 4DV5K 2QWQA 2OTJN 1KXPA 5KRTA 3EZWA 4CZKA 4BACA 2FC0A 4DSEA 5C42A 4B9LA 1WNSA 4DQSA 3LDQA 3U6FA 5CE3A 3I55N 3QEVA 3LL3A 3KLHA 2P9LB 1HNIA 1N8RO 1I94K 3J7AP 3CCRN 1KLNA 3SQ2A 4Z4FA 3AGKA 1X9SA 4JD2B 1Q7YO 5BN8A 1VQ6N 1TKXA 4GVMA 3BY5A 4OPHA 5E84A 4FOIA 4H5WA 4HUFA 4HWIA 3ZCMA 2ITGA 1XMOK 1ZBFA 1ATSA 4BR7A 3ZSZA 3ATUA 1U48A 1N6QA 3S3MA 1NGBA 2F9WA 3MX2A 3RSEB 5GINA 4BRAA 4AHCA 4OGEA 3CFPA 3IFRA 1BA0A 4M3WA 2A40A 1U6ZA 3A5MC 3VGKA 4CGJA 1K9MO 4HTLA 3THVA 4XIUA 3H1QA 5AQMA 3NH0A 3QESA 4CFCA 4DR4K 3VENA 1JXBA 2HNYA 4BWJA 3LDSA 3SQ0A 4DFJA 3CC2N 4JRQA 2VG6A 3WQTA 1IKVA 1RDWX 3CCVN 3H46O 4O8UA 3O3HA 5BRHA 4F3OA 1VAZA 5AQYA 3BUZB 2RKIA 3P1GA 4O44A 4KH5A 5I42A 4NXNK 3D6RA 3D2EA 2FSJA 1HNZK 3LP2A 1Y97A 4EAHD 2GBZA 1TVRA 4FJJA 4N56A 2JWKA 4JRPA 3BP8A 3H1VX 3V1RA 2RPIA 1YJNN 4CJKA 1G99A 3TAMA 3HSTB 2NNWA 5J2QA 2IVPA 2ZWHA 2BGGA 4B3TK 4FWLA 2RF2A 4AH9A 4K42A 3SUNA 2NLXA 3RMCA 4DTJA 3QEPA 1GLBG 2QWLA 3THXB 1S72N 1TUUA 3SCXA 4B8AB 1WUAA 5ADXH 1CZ9A 3DLBA 1HNVA 4DQIA 1KVAA 4CE9A 4O0IA 4KB0A 5JMVA 1BA1A 1OH8A 1S6PA 3N4PA 4FJLA 4LF5K 5GIPA 4FLYA 4B9SA 3VF4A 4KH4A 5GAGP 3VERA 3HPHA 3CI5A 3O6WA 1X9MA 1T3VA 3O80A 3KK2A 2PZSA 1W97L 3LWMA 2D4WA 1WOQA 5CYMA 4FK2A 3UB5A 1XC9A 2YI1A 5MLCQ 1NG9A 1NGDA 2P5OA 1HNXK 3TAGA 1EWQA 4ZTJA 4BR0A 3C0BA 1LV5A 4FWSA 2W00A 1M1KO 3KLIA 3DJCA 2P9SA 2QEXN 3W3DA 2KFNA 4KTWA 4CW7B 3SPZA 4CIEA 2B6AA 3RRGA 1B92A 4NO7A 3KK1A 3ZETA 1DGKN 4CECA 4B9TA 3VMFB 4BVOA 2O8DA 5I3UA 3HPGA 4CJ4A 2GWKA 4OPAA 1HLUA 3UKUB 3L0QA 2VG7A 1D9FA 3H3NO 3KD5E 4RW7A 4BR9A 4E0DA 4Z4CA 4DMNA 4C8OA 4GV3A 3B6PA 1BCOA 4BDYA 2F96A 3NVMA 3A8YA 4LF6K 3HTVA 4C23A 5DM7L 3WUHA 1HPZA 4B9NA 2P9IA 1ASUA 4E1JA 4CHYA 4CEOA 1BGXT 4RW6A 2PFUA 4DV2K 5JVGL 4CZEA 4DLGA 4KHWA 2RHKA 4NLCA 1XNQK 3N4QA 4WFBL 3NGYA 4RW4A 3OW2M 3DLLL 1KFDA 2Z1HA 1BCMA 2D0PA 3ITHA 4DS5A 2FF6A 5AQZA 4RCHA 3B8AX 2HHHK 1TK0A 1SL0A 2F8TA 3SZ2A 1NU0A 3S41A 1DTTA 4CJQA 3E9LA 3D7EO 4DCHA 2O8BA 4ILJA 4PWDA 3LDOA 4KHSA 3FZKA 3CPEA 3LP1A 3OYGA 4CFBA 5AZJA 1VSHA 3OYFA 4G9ZA 2YJFA 1S1TA 2E6MA 1QSLA 4OKKA 3SPYA 4CGGA 4PA1A 1K8KA 4WE1A 4E7IA 3KWIA 2A5XA 4DU1A 3T1HK 2DFHA 5SZTA 5KQ8A 4DR6K 1JCEA 1NJXA 4ELTA 3VPZA 4FLZA 1EX4A 1LWCA 2E4LA 2UUCK 1WSIA 2D0OA 3CCMN 3HOTA 3CFRA 5TKYA 4PKHA 4BE1A 4H8KA 3AAQA 3KD1E 4H4MA 1XHXA 2C1GA 3OYEA 1JLCA 1UA0A 4YFUA 4JI7K 1A5VA 4LSLA 2VWKA 3CYMA 1LWFA 4OPKA 2V7ZA 4CIFA 2AJQA 2VGMA 3THYA 4DV3K 1FKPA 3NGZA 5SWMA 4JLHA 3VQEA 1P90A 3V9UA 4LC9B 3L3VA 4F4KA 4H0XB 1RTJA 4XH5A 4Y1DA 2P51A 5CY4A 4FOEA 1RDBA 3OTOK 4JI6K 2FBXA 3RVCA 2VGNA 4CHNA 1YIJN 3OYKA 2HHSA 4Z94A 3V4IA 1GLEG 3FFKB 1TAQA 4WYBA 4FWQA 5IWAK 3KK7A 1RBVA 1TKZA 4M3XA 4ELUA 2RE2A 3M8SA 5DM6L 1NWKA 3HK2A 4CJ3A 3SAGA 2YKNA 3SJHA 2IVNA 4BRHA 5HOOA 4FM2A 1JCFA 3ID6A 1Q81O 4CZHA 5HLFA 3AVFA 4Z4GA 1VQMN 2UUAK 1NGCA 4BC5A 4XH4A 3I56N 2HMPA 2HHXA 4K8XA 4DQ8A 3TSPA 5BREA 4CZIA 3VA3A 1O1WA 4IG3A 2NRVA 4FJIA 2BANA 3VEYA 1GLAG 2HHQA 1HKGA 1L5UA 4N5SA 3KVGA 3MXIA 5C2FA 3CYGA 4FLXA 3RR7A 3WXJA 5GAEP 4IDKA 4N76A 1SKSA 3NBPA 3M1FA 3OS1A 1VQNN 3HJFA 5BRDA 2P9NA 4H0OA 4IJAA 4B1WB 3HPOA 1KFSA 1RTIA 3SUOA 1NK6A 4O4GA 4LH5A 1W9HA 4BQZA 3NH2A 2DPNA 1NJYA 2QW9A 3VF2A 1S6QA 3DWLA 2O8FB 2WOMA 3LPTA 3CMAN 1TK8A 4AHVA 4MO5A 3C6UA 4B9UA 1IO2A 3FFIA 3Q7CA 4QS7A 4ZHRA 1DKGD 1KVCA 4V19S 3SUQA 2A3ZA 4CEZA 4DV4K 3K5NA 2BTFA 5FPMA 1U2VB 2O8CA 3CQ8A 3VQCA 5J2NA 4JK9A 1VQ9N 1IBKK 1XC3A 3WNHA 4K8ZA 1LW0A 3O4NA 4DTXA 4BVPA 2GUPA 4I9LA 4NB4A 1KTQA 4B1ZA 2VG5A 3AVJA 4FZXC 1C1BA 4BRGA 5FLXO 5FPNA 4IBNA 1S3XA 4MQ3A 3MWTA 5EVZA 1VSEA 4O5FA 5CR4A 3QLHA 1RDAA 3UIQA 2NRHA 2VYPA 2AP1A 5J2MA 2CH5A 4CCHA 4E72A 3HP9A 3SK3A 4OO1J 4N41A 4X65K 1IJJA 1RGIA 4FWMA 4W5TA 2QI2A 1X9JA 3QEIA 5LJVA 1U45A 2VWBA 2DTUA 3IMXA 4FLUA 4DTMA 1LW2A 3GBTA 1RDUA 1VQKN 1B9FA 2NRWA 1KRPA 4BRFA 4DTOA 1TUYA 1Q82O 4PKGA 1RDDA 4AF1A 5A2QO 2G8UA 3HI0A 1M90O 4CEEA 5BRFA 5AZIB 3C95A 5JLHA 1LCUA 3NCIA 3O8MA 4QOZB 1ZC6A 3M3ZA 1HRHA 1QQNA 2HBKA 4BWMA 3E1YA 1CZBA 1L3VA 4Q5VA 4YDUA 3QNOA 5K14A 1XUPO 2UXBK 4CF9A 1P8ZA 4DQRA 1EQYA 3I8DA 4YOVA 2IDOA 1WLJA 1JLGA 3TABA 3PUFA 3VEWA 1VRTA 1SKRA 1BL3A 4EZ9A 1BU6O 3FZMA 3U3GA 3MAQA 1G15A 4BDPA 4HCCA 5KGXA 1J9AA 3NF9A 2KZMA 4ICLA 4FWRA 3SV4A 4BRKA 1QSSA 1NK8A 4NYFA 4C1NI 4CHOA 3ENHA 1YI2N 5C10A 3UE5A 4MLHA 2QXFA 4H5TA 1YT3A 3VQDA 3HZ6A 4PQUA 1ILYA 2PBDA 3CXCM 2E2QA 3FZFA 4F2SA 4FLVA 1S1VA 3JXUA 3RMDA 2GUIA 3QFUA 3WQUA 3LDNA 3THWA 2JGUA 3AV9A 4EHUA 4JK7A 4FWPA 1BQMA 1EETA 5I9EB 1A5WA 1QHAA 3VQPA 1BIZA 1LAVA 1YXQA 1VQ7N 4BEBA 4ZTFA 4RW9A 4CF2A 4L8RB 4W5QA 2A41A 4DF8A 1VQON 2ASMA 1C0MA 4FM0A 3AA3A 4MLEA 3VN5A 5AQLA 1XNRK 3CJAA 2QWNA 3NF7A 4F3TA 1VK0A 3L2VA 3PIOL 3SYZA 4H4OA 3EKUA 2OANA 3P38A 4CD3A 1S5JA 3PX6A 3VEOA 3VQQA 5BPLA 3D2EB 1J6ZA 1C0GA 1MDUB 3AVNA 4F9OA 4YDUC 1DT9A 3OYAA 2NRZA 3TTCA 3DRPA 4DU4A 3T1AA 3O9UA 4YOUA 3QB0A 3NGIA 4GY2B 5ADXA 3SBGA 5BPMA 3EE8A 3AVGA 4ISEA 1IBMK 1NGAA 3OYBA 1ZBHA 4DR3K 5BR8K 2D0CA 4KV8A 3ZT3A 4CBWA 4KKOA 4JI8K 4OX9K 4GNIA 4MFBA 1JXEA 4N47A 1CLQA 3C65A 2HMIA 5EX5A 3J7YP 4CJ7A 2I7PA 1YTUA 1ZXOA 3W0LA 3OJSA 5HRSA 1V4SA 3SMSA 1OH7A 1XI1A 4BY9C 3WXKA 1WSEA 5HRRA 4GW6A 2HBJA 4FLWA 1TV6A 3IUCA 1T03A 3TAEA 1T05A 3AA4A 1T7PA 3L8BA 4OKEA 2Q36A 3NE6A 1JLQA 3IAYA 3L2QA 3B6OA 4I9QA 5EY4A 1GOCA 5C12A 3M8PA 1RBRA 3ZSXA 2P9KA 3U9ZA 4H5RA 4LF7K 4M7YA 2G8HA 4X62K 5AQJA 5AQPA 3ZYYX 5LMUK 4XH1A 2P9SB 3H08A 4IOAL 2UXCK 3QEWA 3CJ7A 5C2DA 4K43A 3TSUA 2HW3A 4JKGA 3G71N 4J2BA 3MMVA 3QBWA 1K8AO 4W5OA 3JYTA 4R5PA 1NBWA 3ZETB 3DOLA 1KSPA 2O8DB 4LH4A 4JI2K 3T19A 2BUPA 3L2WA 3LP3A 2NRXA 4YY3K 3NAEA 3A2FA 4CEDA 3S9HA 2OYQA 4BE0A 2ZGYA 4CERA 4DUYK 3K57A 2DFFA 3SAFA 3G4SN 3AO5A 5JENA 3KKRA 4UQGA 3D0PA 1RTHA 3CPWM 4LSNA 2P9IB 3SNNA 2P5GA 4M3ZA 4CJUA 2X6SA 1OVQA 2JLEA 1VSLA 3CFOA 3P83D 1JLFA 1GLDG 3FZLA 1TYQA 5KTQA 4E3SA 2J4RA 2H3GX 2WONA 4JKEA 2GX9A 1NOZA 4Y0WA 3ZSWA 1JKHA 3K9JA 2YHWA 3HO1A 1HMVA 2C1IA 4IOXA 4CBXA 3AY9A 4DV1K 3BEXA 1REVA 3TWHA 2O8BB 2E20A 3MN9A 4B1YB 5AZJB 2QK9A 3ZT0A 1KLMA 4DV7K 4DLEA 1B9DA 3LDPA 4X66K 2PAVA 1K8KB 1R0AA 2YNHA 3UKRA 2LSNA 1VQPN 1Q18A 1HNWK 4DU3A 1OH5A 3MEDA 1N32K 2V7YA 3R1XA 5AQWA 3DLEA 1QQOA 1NK5A 3DXKA 4HCBA 3C7NA 1TGOA 3VQBA 1X3MA 3AO3A 2G8KA 4JV5K 4I2QA 4IO8A 5AQTA 2KHOA 1X9WA 2KTQA 4H03B 3AVIA 5AFUH 3EY1A 5CHIA 4XJXA 4HUEA 1EWRA 4DTRA 1YITN 3THYB 1MU2A 5AQIA 5EU7A 4FCYA 2FSKA 5AQOA 3RMAA 3VQAA 1VSMA 2P9PA 5C24A 3JS6A 1QQCA 3LAMA 3SI6A 2Q97A 3E66A 1IKXA 4BR2A 3PO4A 2AA4A 4OJRA 3ULEA 3KTQA 3TTDA 3I33A 3LPUA 4EZ6A 2QA4N 3VOVA 4J2AA 3OS2A 1KAZA 3VQ6A 4CJPA 2D0AA 3TPQA 1SKWA 3VQ8A 1J53A 4EIAA 4A5BA 4MDAA 4EFHA 3ZX0A 4FLTA 5H1SQ 3LWLA 4JI5K 2KW4A 4I2PA 3ZSRA 4IJNA 3U9DA 3K2PA 1HUXA 3ZSYA 4HUGA 4FJGA 4FZYA 1EKEA 3DLKA 3T69A 4CEAA 2O4GA 4FW1A 2UUBK 4BECA 1BHLA 4KI4A 1NNEA 3E01A 4KTQA 4BRLA 4JKDA 2FBTA 3D2FA 4R79A 4LFCK 3LZIA 2YX6A 1XHZA 3VQ7A 3M6GA 4L3QA 1TK5A 3A5NC 2Q31A 4CF1A 1BG3A 3O9QA 2HHTA 3CCQN 2EX3A 2OCEA 2E2NA 4OPJA 4LFAK 5AQNA 3EYZA 1CXUA 4CK3A 1T6CA 1K6YA 4QAGA 3L4IA 3MXMA 1Z05A 1FKOA 4AHSA 1W2BM 2P9NB 4BE7B 2YNGA 4JKAA 5M1PA 2PY5A 1HKBA 4XEIA 4GV6A 4X64K 3V1QA 3K5LA 4NCBA 4WF9L 1GLJO 3O3GA 1BIUA 4EP4A 4DSKA 1FW6A 4E89A 4PHTX 4IDHA 1N33K 4EHTA 4FJ9A 4O0JA 1ZBLA 1NJZA 2Q2RA 3P4IA 5JVHL 1BDGA 5F0XA 1SAZA 5F1XA 2Q0RA 1KAYA 3CQYA 3FE1A 5CZ2A 1ITGA 4AHRA 3T3FA 1I3AA 2O8CB 2G8IA 5FRMA 1N5YA 3L3UA 3DLGA 3V9ZA 1J54A 3L2RA 2OTLN 3TU5A 1VRUA 2HNZA 4ID5A 1RDCA 2HBLA 3WXMB 3ZSQA 3K5OA 3KZBA 4A5AA 3L6QA 1C6VA 1VSFA 3BGRA 1Q86O 4JKFA 4AM6A 3VQ5A 1OVYA 4DV0K 1BOTO 2Q1NA 3CETA 2ETJA 4B9QA 1VSDA 3M8QA 1ZYQA 1IKYA 4OLBA 3L4QA 3AARA 1YTAA 3CCSN 4B3MK 3O9RA 4JNEA 3M8RA 1RTDA 1Z26A 4IEIA 3VTIA 3I8BA 3WNEA 2ASOA 4BRPA 4FJXA 1HYZA 3MEEA 3QFPA 2PYLA 4PUOA 3ZLJA 5DMRA 4JI3K 3NHGA 2E1ZA 1D9DA 1L3TA 3CCEN 5C0YA 1BO5O 2YHYA 3PX0A 1XWLA 4KHNA 4FZZA 1QVGM 3EKSA 3K58A 4BGAA 1D8YA 2YNFA 1RT5A 1ATNA 2B4JA 4JN4A 4GMJB 4FPBA 2W42A 4FJ8A 3A0IX 4FVUA 4FSVA 4BRNA 3TR8A 4ISFA 1LOTB 1WAFA 3CHWA 3AVLA 3JAMO 2EWSA 1K73O 2EHGA 1IKWA 1S9EA 1EO1A 1SZ2A 3BZKA 3R9PA 3CC7N 3QETA 4MDBA 3ZT1A 3MEGA 1HYVA 2ZM6K 1KQSM 3FLCO 3PSFA 4DFMA 4CZFA 4B3RK 2ZGZA 1T8EA 1DTQA 1RT3A 4JI0K 4FJ7A 4CK2A 3QIOA 4DQQA 1IG9A 4PY5A 1HJOA 1DLOA 5AQGA 4C8NA 4BRDA 3VEZA 5JLFA 4DKWA 2VWJA 2HSTA 2QWOA 3THWB 3F2KA 1Z6RA 3CJCA 3NFAA 4BRCA 1LWEA 4BGBA 4DR1K 3KIOA 2F8SA 4K41A 4AQYK 4YOYA 2X74A 4Z4EA 2HB5A 3R6MA 3AGRA 4B1VA 3DOKA 2P9UA 3DLHA 4NCAA 3OYIA 2E1YA 3OS0A 3HYFA 2UU9K 2B5JA 4K25A 4CZLA 4JI4K 5B8HA 1X3NA 2YHXA 4B1XB 4CIGA 1Q8IA 1MA9B 3O1BA 4LY7A 1S9GA 2O8EA 3V9WA 2ZD1A 4LF4K 2HHIA 4CJLA 4AILC 1C0FA 4DF4A 2G8VA 3H45C 5M1QA 2HBMA 4BC3A 4I6MA 4JKBA 3ZT4A 3CC4N 1NK4A 4RG8A 2Q3SA 1QZ6A 5M1OA 5CZ1A 1S1WA 1C1AA 4DWIA 3WEEA 3KWGA 1RILA 3AA5X 4NYNA 1NJWA 1NGEA 1O13A 3KLFA 3S5TA 2FF3B 1HPMA 5KRSA 2FBVA 4WQ5C 3CCUN 5JS2A 3TAPA 4CJEA 4B3OA 2XY7A 3ZEUA 3RRHA 3DRSA 1NK7A 1FJGK 4KTZA 4CGFA 3AVHA 3SMPA 3ZT2A 4M7XA 1U04A 3CJ1A 4CVNE 5FPEA 4WFNL 1RBTA 4J2EA 3ZSOA 4CFDA 4B8CA 3ULDA 4CJVA 1JJ2M 3CF5L 4E1NA 4JHDA 1BUPA 2OZMA 1RFQA 4IEEA 1YHQN 5AQSA 2QWMA 4FWOA 4QS9A 3DI6A 4DR2K 1Z25A 4BRQA 2GV9A 3AO4A 3AA2A 4M41A 3OVNA 4KBOA 2HF3A 3SBTA 2QKKA 3QMLA 3V6DA 4FWKA 1BI4A 3C6TA 3P31A 1WAJA 1C0UA 2D5RA 2P9KB 4KO0A 4H0PA 2Z1JA 4DR7K 2IC3A 3IS9A 2DFEA 2ITMA 1VHXA 2HNDA 2HHWA 1UAXA 4JKGB 3DXMA 2Y1IA 3CIPA 4IOCL 2KKZA 2BH1A 4Z4IA 3CM6A 4G1QA 4RWTA 5IT9O 4U67L 2IGIA 4B9MA 4F2RA 2HHUA 4E7KA 4AHUA 4MO4A 4KH6A 1T6DA 3OA9A 3S3OA 3ZX3A 4CJWA 4C1NK 2NRRA 4WCEL 2IAJA 3QINA 3FZHA 3QERA 5BN9A 2YV0X 3CG7A 3RR8A 3SAHA 4CBUA 2QWPA 4FJMA 1I39A 3O3FA 4Y1CA 3LANA 4CEQA 3C6AA 1ASVA 1U47A 1RT2A 5AQRA 3EZ5A 2Z1GA 5HP1A 3IDHA 4M3UA 1TYQB 2FBYA 1RT4A 2QM1A 3ALYA 4BC4A 3VGLA 3ISNC 3FR0A 1OH6A 4DTPA 3CD6N 4M63C 3U8XA 3VTHA 2XO7A 1RBSA 1GLLO 4KFBA 1QE1A 4CJSA 3VEXA 4NCGA 1GOAA 2ZE2A 2CGLA 1NGFA 4KHUA 4IZ9A 4FK0A 2GELA 1EXQA 3HVTA 1QTMA 3AVCA 1JL2A 4NLBA 3I0SA 3PO5A 4A2AA 4ILGB 1ASWA 2E6LA 2KQ2A 3TTFA 5AQVA 4KPYA 3MCPA 4E1MA 2HOEA 3OYCA 5J2PA 4BE2A 1KC8O 4M3RA 3UKRB 3OBWA 3DYAA 1NGGA 2OPPA 3WNFA 3P39A 1VSJA 1GLCG 1HQUA 1MWMA 3RWUA 1C0TA 1NGHA 5HL7L 3AAPA 5KGWA 3V81A 4CEBA 1YUWA 1IH7A 3DAWA 4H0TB 3JSMA 1X1PA 1QHTA 3DXKB 1VSKA 3C7NB 2YHAA 5AFUA 1JLEA 1QS4A 3GE1A 4FJNA 3L2UA 4M45A 3CJ9A 4JEPA 5EXWA 1SQKA 3K9KA 2P9LA 2UXDK 5HROA 4YOWA 2E5LK 2BE2A 2F9TA 5KQDA 3VQ4A 4GKKK 1WBBA 4DS4A 3HRGA 4O55A 3VF6A 2R7YA 1W7AA 4KHPK 4JD2A 5TKWA 3NF8A 4JI1K 5KPTA 4HVJA 3SQ4A 2Q0UA 4CGHA 4DSFA 2W41A 3E9OA 4FW2A 1L3SA 4KHYA 3OJUA 1QSYA 3O1WA 3PSIA 3HSCA 4CGIA 2P9PB 3WXLA 5LJWA 4B1UB 4CJFA 1VQ4N 1HR0K 2WBNA 3RSEA 4IFEA 2VQEK 5BPNA 3KHYA 3OYMA 3ULEB 3AVMA 5JICA 4E7LA 1ATRA 2ZQBA 1N36K 2D1KA 4AHTA 1NM1A 4LD0A 2DY4A 4CZJA 3T1YK 1RT1A 3HVRA 3K5MA 2JWLA 2V52B 1A5XA 1IG8A 2W6LA 3K0SA 4YORA 4C8MA 1HX1A 4YOTA 2P1JA 1W0HA 4A2BA 2XY6A 3MN5A 4Z0UA 4FYDA 1QQMA 1BWFO 3I0RA 1KD1O 4KB1A 1WB9A 3LALA 2UYTA 1DEJA 2NZTA 1S1XA 1YJ9N 4DSJA 5D3GA 4M3YA 1YF5L 3KLEA 4JYAK 3NH1A 3KJVA 2WUSA 2YHBA 1JL1A 5GIOA 4FPAA 3C94A 4DTNA 3G0ZA 3BF3A 5AR0A 4Z4HA 1E3MA 4CI6A 4AM7A 3D2FB 3OYDA 3OYNA 2XY5A 3ATVA 1RBUA 2X6NA 3LAKA 3MX5A 3K59A 3F9MA 1S1UA 3OBYA 4HHTA 2IVOA 5AQHA 4IXCA 1CZAN 1JLAA 3THXA 2OA8A 3AVBA 1U49A 3HP6A 1XMQK 2KLAA 3ENBA 1GOBA 4M42A 1NMNA 3HL8A 4DTSA 2ZJQL 4FJHA 4FWNA 4BG9A 1UWBA 1HKCA 3QO9A 5AQKA 4H5NA 4EP5A 2A42A 3IG1A 4KREA 4C8KA 1CXQA 1ESVA 1HJRA 1WSFA 2OPSA 4B9VA 4JK8A 5E41A 4YNQA 2HF4A 3R8EA 3ENOA 3AO1A 4PL8A 3H3OB 4CF8A 1RT6A 4DFPA 4DQPA 3VESA 4YHHK 3KK3A 1HYSA 4YOXA 1SV5A 2XRIA 2ASPA 4H5VA 3HBTA 2PYJA 4OVLA 1WSGA 4BRMA 1WSJA 1ZBUA 3DLRA 1YVUA 3GG4A 2QWRA 3J7ZO 3PLAA 1RCHA 4JKHA 1IBLK 3HXMA 4FJKA 2CGKA 4HTUA 4WQ4A 2YKMA 3EN9A 1EP4A 3SJJA 4KAZA 2Y1JA 5KI6A 3NDKA 1NK9A 2FLOA 2OPQA 1YAGA 3O4WA 1WN7A 4E7JA 4FO0A 3UKUA 2A1SA 4FVMA 4K0KK 4JS5A 5F2RA 1QVFM 4BREA 4DR5K 3MXJA 1NGIA 5KPRA 3HM8A 4KRFA 3OYHA 3OYJA 1JCGA 3U3YA 3GDQA 1TL1A 3SUPA 3BDPA 4B3SK 3ID8A 3WXIA 4CJRA 3F73A 1NKCA 2G8FA 1LAWA 4Q0BA 5FPDA 1VQ5N 1SS6A 4JKCA 2A1RA 4LFBK 3NF6A 3PIPL 3V9SA 2O4IA 1NMDA 4BC2A 2FXUA 2IS3A 3QICA 4O8KA 4E7HA 3LP0A 5AQXA 2XHBA 4CZGA 4J2DA 3VEVA 3RMBA 3KKSA 1RT7A 1S22A 1TAUA 4GKJK 4KHQA 3J81O 5HRPA 1VSIA 3DRRA 4QS8A 5AQUA 4TSXA 5J1EA 2XY8A 4QCLA 5GAHP 3MCAB 3GL1A 4ILHA 4E19A 4FL9A 3VA0A 3FGUA 1Q9YA 2D0BA 4PKIA 1FK9A 3U4LA 5KPZA 3LZJA 3P5JA 3SV3A 3EE9A 4DSLA 1IV0A 2NRTA 3OYLA 4LF9K 3M5RA 2QXLA 3CERA 2I7NA 5M1KA 4WQ4C 3EO3A 3S3NA 1ZBIA 3DM2A 1OKJA 3GOIA 1RNHA 4DHYA 3PY8A 4ID1A 5CYQA 4BR5A 5HBMA 4A62A 2YJEA 2E2OA 3BF1A 2GWJA 4ISGA 3O9TA 3E9PA 5C25A 4DV6K 2CH6A 2W6KA 1V4TA 3MWPA 4IO9L 3AVAA 3HOSA 4FK4A 1J5OA 1TL3A 2E8AA 2Z1IA 3O5BA 3NMUA 3VETA 5EOYA 2P9UB 4DB3A 4FM1A 4CESA 3O08A 4KI6A 1HQEA 3C6HA 2E88A 3QDKA 2GTDA 1VQ8N 2F4VK 5C15A 5AQQA 5FROA 5DK5A 1TKTA 4W5RA 3MN7A 3G6EN 2O8EB 3QEXA 3AVKA 1QZ5A 3RTVA 3MECA 5FDLA 4IG0A 1SUQA 3D45A 4I6MB 4O5BA 2G8WA 1BISA 2HVHA 2QKBA 3J80O 4BROA 3LDLA 4WQ5A 4I7FA 1NGJA 3WEEB 2WTUA 2RN2A 2YCHA 3NVKA 3H6EA 1SL2A 4A61A 3O4QA 4CF0A 3AO2A 1TKDA 4WFAL 3ZEUB 1D4XA 3IKMA 4A59A 4CHZA 3SQ1A 3SLCA 3QIPA 2HHVA 1NKEA 4RTFD 4DUZK 1XQSC 3QNNA 1U4BA 1N34K 3Q7BA 2OPRA 4H0YB 4FJ5A 3MN6A 4NXMK 1Y64A 5AQFA 1KVBA 2QTDA 1L3UA 3F9KA 4GVEA 5LL6Z 4M3TA 1WSHA 3TSQA 3CJBA 4JHDB 2KFZA 3CQXA 4ELVA 5AJ3K 4BG8A 1UA1A 5E26A 2OZSA 3DMJA 1FXXA 4A57A 3CCLN 4W5NA 3F5TA 1J5EK 1ZBSA 4DFKA 3J8AA 2A6AA 4OKJA 5M1FA 4CHQA 3WT0A 1D5AA 3IRXA 3VGMA 4OGCA 4F8RA 1BI4B 1YJWN 4BR4A 3G25A 3OHRA 4UY8O 4BDZA 2E2PA 1E4FT 1UOCA 1KAXA 3V1OA 2O8FA 4IKFA 5M1NA 2BDPA 4DG1A 4CJTA 3A5LC 4OLAA 1T44A 2VQFK 3KLGA 2ZF5O 4IFYA 4U7BA 3PX4A 4LF8K 2I5JA 2VCPA 1YVNA 3DXMB 4CJ5A 2X78A 3BZCA 4CZMA 4IWVA 1NLVA 1U2VA
chains in the Genus database with same CATH topology
4H03B 4IZ9A 5AFUH 2GELA 5CHIA 4XJXA 1YITN 4J8FA 4DQ8A 3TSPA 4NLBA 2WFBA 5BREA 2FSNA 4CZIA 5AQIA 2CGJA 4ILGB 4A2AA 4CD1A 3T7ZA 2ZJRL 2FSKA 2NRVA 3VEYA 5AQOA 1GLAG 1R59O 1HKGA 3TTFA 2P9PA 3KVGA 5AQVA 3MCPA 4H0VB 5C2FA 3JS6A 1NJIO 2HOEA 4BRIA 1KC8O 3UKRB 3WXJA 3OBWA 5GAEP 1NGGA 2Q97A 3E66A 2F7TA 4BR2A 3P39A 5ELZA 2AA4A 4JAXA 3M1FA 3ULEA 1GLCG 1MWMA 3I33A 3TTDA 2ZJPL 1VQNN 2QA4N 3VOVA 5BRDA 1NGHA 2P9NA 4H0OA 4IJAA 1KAZA 5HL7L 3MDQA 4B1WB 5LY3A 4GV9A 3TPQA 3AAPA 1YUWA 3DAWA 2V51B 4H0TB 4EIAA 3DXKB 4A5BA 3C7NB 4BQZA 4MDAA 3LM2A 5AFUA 2DPNA 4EFHA 2QW9A 3VF2A 3ZX0A 3DWLA 3CMEN 3GE1A 3ZX2A 3CCJN 5H1SQ 5GADP 3CMAN 3CJ9A 4JEPA 4MO5A 5EXWA 1SQKA 3Q7CA 3K9KA 4QS7A 4PL7A 2P9LA 1DKGD 4IJNA 3U9DA 4YOWA 1HUXA 2F9TA 5KQDA 2A3ZA 2GEMA 3HRGA 4BQLA 2BTFA 5FPMA 1U2VB 3T69A 3VF6A 4JD2A 5TKWA 3LM9A 4BECA 5KPTA 2Q0UA 4BRLA 4JKDA 3MK6A 2W41A 3D2FA 3E9OA 2IIRA 4JK9A 3QBXA 2YX6A 4R79A 1VQ9N 3O1WA 1MWKA 1XC3A 3M6GA 4L3QA 4BVPA 3HSCA 1GLFO 3A5NC 5AZIA 2GUPA 2P9PB 2Q31A 1BG3A 3WXLA 3A5OC 3O9QA 5LJWA 4NB4A 4B1UB 3CCQN 4B1ZA 1VQ4N 1E4GT 2WBNA 2E2NA 3RSEA 4IFEA 3O9SA 5AQNA 5BPNA 3KHYA 4BRGA 1T6CA 3R3LA 2WC9A 5FPNA 1S3XA 3L4IA 3ULEB 1Z05A 5JICA 1ATRA 3MWTA 2D1KA 5EVZA 4O5FA 1NM1A 2P9NB 1W2BM 4CZJA 4BE7B 2W40A 1VQLN 4JKAA 5CR4A 5M1PA 1HKBA 3EL2A 2JWLA 4XEIA 3U9ZA 5BR9A 2V52B 2NRHA 1H1VA 1IG8A 2VYPA 4GV6A 2QWQA 4YORA 1KXPA 2OTJN 1HX1A 2AP1A 3EZWA 4CZKA 2CH5A 4YOTA 4WF9L 1GLJO 4A2BA 3MN5A 3SK3A 1QQMA 4OO1J 3LDQA 1BWFO 4PHTX 5CE3A 4IDHA 1KD1O 1IJJA 4EHTA 3I55N 1RGIA 3LL3A 2UYTA 4FWMA 1DEJA 2QI2A 1X9JA 2Q2RA 5LJVA 2VWBA 3P4IA 3IMXA 5JVHL 2P9LB 2NZTA 1BDGA 5F0XA 1YJ9N 1N8RO 1YF5L 1SAZA 5F1XA 2WUSA 2Q0RA 1KAYA 3CQYA 3GBTA 5GIOA 3CCRN 1RDUA 1VQKN 2NRWA 3AGKA 3FE1A 4FPAA 4JD2B 4BRFA 1Q7YO 5BN8A 1TUYA 3BF3A 5AR0A 4PKGA 1Q82O 1VQ6N 4CI6A 5E84A 4OPHA 4AF1A 4AM7A 3D2FB 3HI0A 4FOIA 4H5WA 4HWIA 1M90O 2OTLN 3ATVA 5BRFA 5AZIB 3TU5A 3MX5A 5JLHA 3F9MA 1LCUA 1ATSA 3OBYA 4BR7A 3O8MA 3ATUA 2IVOA 1NGBA 5AQHA 2HBLA 3WXMB 2F9WA 3MX2A 1ZC6A 3M3ZA 4IXCA 1CZAN 3RSEB 4BRAA 1QQNA 2HBKA 5GINA 3KZBA 4A5AA 3IFRA 3L6QA 3E1YA 1BA0A 1Q86O 2A40A 1U6ZA 4JKFA 4YDUA 3A5MC 2KLAA 4AM6A 1OVYA 1XUPO 3VGKA 1K9MO 4HTLA 3ENBA 1BOTO 2Q1NA 3CETA 3H1QA 1P8ZA 5AQMA 2ZJQL 1EQYA 4B9QA 4YOVA 3VENA 4FWNA 4BG9A 3VEWA 1HKCA 3L4QA 5AQKA 3AARA 4H5NA 3CCSN 3CC2N 1BU6O 3FZMA 3O9RA 2A42A 4JNEA 3WQTA 4IEIA 1RDWX 3VTIA 3H46O 3CCVN 1ESVA 3I8BA 4O8UA 4FWRA 4JK8A 4BRKA 2ASOA 4BRPA 5BRHA 1VAZA 2HF4A 5AQYA 3BUZB 3R8EA 4C1NI 3ENOA 4KH5A 3ENHA 3QFPA 1YI2N 3D6RA 3D2EA 5C10A 4PL8A 3UE5A 2FSJA 3H3OB 4MLHA 2E1ZA 4H5TA 1ILYA 3HZ6A 4EAHD 3VESA 3CCEN 2PBDA 5C0YA 4YOXA 1BO5O 2YHYA 3CXCM 2ASPA 2E2QA 2JWKA 3HBTA 4H5VA 3FZFA 3BP8A 3H1VX 4BRMA 1YJNN 3JXUA 1G99A 1QVGM 3EKSA 3QFUA 2NNWA 4BGAA 2IVPA 3LDNA 3WQUA 2ZWHA 1ATNA 2QWRA 3GG4A 4JN4A 4EHUA 3J7ZO 4JK7A 3PLAA 4FPBA 4FWPA 4FWLA 3A0IX 4JKHA 4FVUA 4K42A 5I9EB 2CGKA 2NLXA 4FSVA 4WQ4A 4BRNA 1GLBG 2QWLA 3EN9A 4ISFA 1S72N 1TUUA 1QHAA 1LOTB 1WUAA 1YXQA 5ADXH 1VQ7N 4BEBA 3CHWA 2FLOA 1YAGA 3O4WA 2EWSA 1K73O 2A41A 1VQON 1EO1A 1SZ2A 3R9PA 4FO0A 3CC7N 2ASMA 3UKUA 5JMVA 4MLEA 5AQLA 3CJAA 1BA1A 2QWNA 4MDBA 5F2RA 4BREA 1QVFM 1NGIA 3N4PA 5KPRA 3HM8A 5GIPA 1KQSM 3VF4A 3FLCO 4KH4A 3PIOL 5GAGP 3EKUA 1JCGA 2OANA 3P38A 4CZFA 3VERA 2ZGZA 3GDQA 4CD3A 3VEOA 5BPLA 3CI5A 3ID8A 3D2EB 3O6WA 1J6ZA 3WXIA 1C0GA 1MDUB 1T3VA 3O80A 5FPDA 1W97L 4F9OA 4YDUC 1SS6A 1DT9A 4JKCA 1VQ5N 3PIPL 2D4WA 2NRZA 1HJOA 1NMDA 1WOQA 4BC2A 3UB5A 5AQGA 2FXUA 3TTCA 4BRDA 3VEZA 3QICA 5JLFA 4O8KA 4DKWA 3O9UA 2YI1A 4YOUA 3QB0A 5AQXA 2HSTA 1NGDA 4GY2B 5MLCQ 5ADXA 2QWOA 4CZGA 3VEVA 3SBGA 5BPMA 3F2KA 3EE8A 1Z6RA 3CJCA 4ISEA 1S22A 4BR0A 4BRCA 1NGAA 4BGBA 3C0BA 2W00A 4FWSA 4K41A 1M1KO 4YOYA 3DJCA 2P9SA 2QEXN 3W3DA 4CBWA 3R6MA 3AGRA 4GNIA 4B1VA 2P9UA 4QS8A 5AQUA 2E1YA 4NO7A 3ZETA 1DGKN 5GAHP 3MCAB 3GL1A 4K25A 3C65A 3VMFB 4BVOA 4CZLA 5EX5A 4ILHA 4CJ7A 5B8HA 4FL9A 2I7PA 2GWKA 4OPAA 3FGUA 1X3NA 1HLUA 2YHXA 1ZXOA 4PKIA 3U4LA 3UKUB 3L0QA 3W0LA 4B1XB 1MA9B 3O1BA 5KPZA 1V4SA 3SMSA 3H3NO 4BY9C 3EE9A 3WXKA 4BR9A 2NRTA 1C0FA 4GV3A 3M5RA 2HBJA 2QXLA 3CERA 3H45C 5M1QA 3NVMA 2I7NA 2HBMA 4BC3A 5M1KA 4WQ4C 3A8YA 3IUCA 4I6MA 4JKBA 3CC4N 3HTVA 3EO3A 4C23A 5DM7L 3WUHA 1QZ6A 5M1OA 1OKJA 2P9IA 3GOIA 4DHYA 4E1JA 2Q36A 3WEEA 3KWGA 1NGEA 2PFUA 5EY4A 1O13A 4BR5A 5C12A 5JVGL 4A62A 4CZEA 2YJEA 2E2OA 2P9KA 2RHKA 2FF3B 2GWJA 1HPMA 3BF1A 3O9TA 4H5RA 3E9PA 4ISGA 4M7YA 4NLCA 4WQ5C 3CCUN 3N4QA 2CH6A 4WFBL 1V4TA 3ZEUA 3OW2M 3MWPA 5AQJA 4IO9L 3DLLL 5AQPA 3ZYYX 2D0PA 3HOSA 4XH1A 2P9SB 4IOAL 3CJ7A 3SMPA 5C2DA 4K43A 3CJ1A 4M7XA 2E8AA 2FF6A 3O5BA 3TSUA 5AQZA 3NMUA 4RCHA 3VETA 3B8AX 4JKGA 5FPEA 5EOYA 4WFNL 2P9UB 4DB3A 3G71N 3MMVA 3QBWA 1K8AO 3O08A 3S41A 1JJ2M 1NBWA 3C6HA 2E88A 3ZETB 3QDKA 3CF5L 3E9LA 2GTDA 4CZMA 2BUPA 3D7EO 4JHDA 4DCHA 1VQ8N 5C15A 1BUPA 5AQQA 4ILJA 2NRXA 1RFQA 3LDOA 4IEEA 3FZKA 5AQSA 2QWMA 3CPEA 4FWOA 1YHQN 4QS9A 2ZGYA 3MN7A 5AZJA 3G6EN 4G9ZA 2YJFA 4BRQA 3SAFA 1QZ5A 3G4SN 1K8KA 3KWIA 4I6MB 2A5XA 4KBOA 2HF3A 3CPWM 5KQ8A 1JCEA 3SBTA 3QMLA 2P9IB 4BROA 3VPZA 3LDLA 4FWKA 4WQ5A 1NGJA 3WEEB 3P31A 2YCHA 3NVKA 2D0OA 3H6EA 3CCMN 3HOTA 4A61A 5TKYA 4PKHA 2P9KB 3AAQA 1GLDG 4H0PA 3FZLA 4WFAL 2C1GA 3ZEUB 1D4XA 1TYQA 3IKMA 2J4RA 4A59A 2H3GX 4JKEA 2ITMA 2GX9A 3SLCA 4Y0WA 4RTFD 3K9JA 2YHWA 1XQSC 4JKGB 2C1IA 2V7ZA 3Q7BA 3DXMA 4IOXA 4H0YB 3MN6A 3CIPA 1Y64A 4CBXA 2KKZA 2BH1A 2VGMA 5AQFA 4IOCL 2QTDA 3AY9A 4GVEA 3BEXA 4RWTA 3TSQA 3CJBA 4JHDB 4U67L 3CQXA 2E20A 3MN9A 4B1YB 4BG8A 5E26A 1P90A 4MO4A 5AZJB 4A57A 4KH6A 4LC9B 3CCLN 1T6DA 3OA9A 4H0XB 3F5TA 3LDPA 1ZBSA 2PAVA 4XH5A 1K8KB 3ZX3A 3UKRA 4C1NK 3J8AA 2A6AA 4FOEA 2NRRA 4WCEL 5M1FA 3FZHA 5BN9A 3WT0A 1VQPN 3RVCA 1YIJN 2VGNA 3SAHA 1Q18A 4CBUA 2QWPA 3VGMA 4Z94A 1GLEG 3C6AA 3FFKB 4WYBA 4FWQA 2V7YA 3R1XA 5AQWA 3G25A 4BR4A 3OHRA 1YJWN 3KK7A 5AQRA 4UY8O 2RE2A 2E2PA 1E4FT 1QQOA 3DXKA 3IDHA 5DM6L 1NWKA 3C7NA 1KAXA 3SAGA 3SJHA 2IVNA 1TYQB 2QM1A 4BRHA 5M1NA 4BC4A 3VGLA 5HOOA 1JCFA 3ID6A 1Q81O 4CZHA 3FR0A 3A5LC 3CD6N 1X3MA 1T44A 4M63C 3U8XA 3VTHA 1VQMN 1GLLO 2ZF5O 4U7BA 1NGCA 4BC5A 2VCPA 1YVNA 3DXMB 4IO8A 4XH4A 5AQTA 3I56N 2KHOA 2HMPA 3VEXA 2CGLA 1NGFA 4IWVA 1NLVA 1U2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H03 B;  4IZ9 A;  5AFU H;  2GEL A;  4J8F A;  4DQ8 A;  5BRE A;  2FSN A;  4CZI A;  5AQI A;  2CGJ A;  4A2A A;  4CD1 A;  2FSK A;  3VEY A;  5AQO A;  1GLA G;  1R59 O;  1HKG A;  2P9P A;  3KVG A;  5AQV A;  3MCP A;  4H0V B;  3JS6 A;  2HOE A;  4BRI A;  3UKR B;  3WXJ A;  1NGG A;  2Q97 A;  4BR2 A;  5ELZ A;  2AA4 A;  4JAX A;  3M1F A;  3ULE A;  1GLC G;  1MWM A;  3I33 A;  3VOV A;  5BRD A;  1NGH A;  2P9N A;  4H0O A;  4IJA A;  1KAZ A;  3MDQ A;  4B1W B;  5LY3 A;  3TPQ A;  3AAP A;  1YUW A;  3DAW A;  2V51 B;  4H0T B;  4EIA A;  3DXK B;  3C7N B;  4BQZ A;  5AFU A;  3LM2 A;  2DPN A;  4EFH A;  2QW9 A;  3VF2 A;  3ZX0 A;  3DWL A;  3GE1 A;  3ZX2 A;  3CJ9 A;  4MO5 A;  5EXW A;  1SQK A;  4QS7 A;  4PL7 A;  2P9L A;  1DKG D;  4IJN A;  3U9D A;  1HUX A;  2F9T A;  5KQD A;  2A3Z A;  2GEM A;  4BQL A;  2BTF A;  5FPM A;  1U2V B;  3VF6 A;  4JD2 A;  3LM9 A;  5KPT A;  2Q0U A;  4BRL A;  3MK6 A;  2W41 A;  3D2F A;  2IIR A;  3QBX A;  3O1W A;  1MWK A;  1XC3 A;  3M6G A;  4L3Q A;  4BVP A;  3HSC A;  1GLF O;  3A5N C;  5AZI A;  2GUP A;  2P9P B;  2Q31 A;  1BG3 A;  3WXL A;  3A5O C;  5LJW A;  4NB4 A;  4B1U B;  4B1Z A;  1E4G T;  2E2N A;  3RSE A;  5AQN A;  5BPN A;  3KHY A;  4BRG A;  1T6C A;  5FPN A;  1S3X A;  3L4I A;  3ULE B;  1Z05 A;  5JIC A;  1ATR A;  2D1K A;  5EVZ A;  4O5F A;  1NM1 A;  2P9N B;  4CZJ A;  2W40 A;  1HKB A;  3EL2 A;  4XEI A;  5BR9 A;  2V52 B;  2NRH A;  1H1V A;  1IG8 A;  2VYP A;  2QWQ A;  1KXP A;  1HX1 A;  2AP1 A;  3EZW A;  4CZK A;  2CH5 A;  1GLJ O;  4A2B A;  3MN5 A;  3SK3 A;  1QQM A;  3LDQ A;  1BWF O;  5CE3 A;  1IJJ A;  4EHT A;  1RGI A;  3LL3 A;  2UYT A;  4FWM A;  1DEJ A;  1X9J A;  2Q2R A;  5LJV A;  2VWB A;  3P4I A;  3IMX A;  2P9L B;  2NZT A;  1BDG A;  5F0X A;  1SAZ A;  5F1X A;  2WUS A;  2Q0R A;  1KAY A;  3CQY A;  3GBT A;  3FE1 A;  4FPA A;  4JD2 B;  4BRF A;  5BN8 A;  1TUY A;  3BF3 A;  5AR0 A;  4PKG A;  4CI6 A;  5E84 A;  4AM7 A;  3D2F B;  3HI0 A;  4FOI A;  4H5W A;  4HWI A;  3ATV A;  5BRF A;  5AZI B;  3TU5 A;  5JLH A;  3F9M A;  1LCU A;  1ATS A;  4BR7 A;  3O8M A;  3ATU A;  2IVO A;  1NGB A;  5AQH A;  2F9W A;  1ZC6 A;  3M3Z A;  4IXC A;  1CZA N;  3RSE B;  4BRA A;  1QQN A;  3KZB A;  3IFR A;  3L6Q A;  1BA0 A;  2A40 A;  1U6Z A;  4YDU A;  4AM6 A;  3A5M C;  1XUP O;  3VGK A;  4HTL A;  1BOT O;  2Q1N A;  3CET A;  3H1Q A;  1P8Z A;  5AQM A;  1EQY A;  4B9Q A;  3VEN A;  4FWN A;  4BG9 A;  3VEW A;  1HKC A;  5AQK A;  3AAR A;  4H5N A;  1BU6 O;  3FZM A;  4JNE A;  2A42 A;  3WQT A;  1RDW X;  3H46 O;  1ESV A;  3I8B A;  4FWR A;  5BRH A;  4BRK A;  2ASO A;  4BRP A;  2HF4 A;  5AQY A;  3BUZ B;  3R8E A;  3ENO A;  3ENH A;  3QFP A;  3D2E A;  4PL8 A;  3UE5 A;  2FSJ A;  3H3O B;  4MLH A;  2E1Z A;  4H5T A;  3HZ6 A;  4EAH D;  3VES A;  2PBD A;  1BO5 O;  2YHY A;  2ASP A;  2E2Q A;  4H5V A;  3HBT A;  3FZF A;  3BP8 A;  3H1V X;  4BRM A;  3JXU A;  1G99 A;  3EKS A;  3QFU A;  4BGA A;  2IVP A;  3LDN A;  3WQU A;  1ATN A;  2QWR A;  2ZWH A;  3GG4 A;  4JN4 A;  4EHU A;  4FPB A;  4FWP A;  4FWL A;  3A0I X;  4K42 A;  5I9E B;  2CGK A;  2NLX A;  4FSV A;  4WQ4 A;  4BRN A;  1GLB G;  2QWL A;  3EN9 A;  4ISF A;  1TUU A;  1QHA A;  1LOT B;  1WUA A;  1YXQ A;  5ADX H;  3CHW A;  2FLO A;  1YAG A;  3O4W A;  2EWS A;  2A41 A;  1SZ2 A;  3R9P A;  4FO0 A;  2ASM A;  3UKU A;  5JMV A;  4MLE A;  5AQL A;  3CJA A;  1BA1 A;  2QWN A;  5F2R A;  4BRE A;  1NGI A;  5KPR A;  3HM8 A;  3VF4 A;  3FLC O;  3EKU A;  1JCG A;  2OAN A;  4CZF A;  3VER A;  2ZGZ A;  3GDQ A;  4CD3 A;  3VEO A;  5BPL A;  3CI5 A;  3ID8 A;  3D2E B;  3O6W A;  1J6Z A;  3WXI A;  1C0G A;  1MDU B;  3O80 A;  5FPD A;  4F9O A;  4YDU C;  2D4W A;  1HJO A;  1NMD A;  1WOQ A;  4BC2 A;  3UB5 A;  5AQG A;  2FXU A;  4BRD A;  3VEZ A;  3QIC A;  5JLF A;  4O8K A;  2YI1 A;  5AQX A;  3QB0 A;  1NGD A;  4GY2 B;  5ADX A;  2QWO A;  4CZG A;  3VEV A;  5BPM A;  4ISE A;  1Z6R A;  3CJC A;  1S22 A;  4BR0 A;  4BRC A;  1NGA A;  4BGB A;  3C0B A;  4FWS A;  4K41 A;  3DJC A;  2P9S A;  3W3D A;  4CBW A;  3R6M A;  4GNI A;  4B1V A;  2P9U A;  4QS8 A;  5AQU A;  2E1Y A;  4NO7 A;  3ZET A;  1DGK N;  4K25 A;  3GL1 A;  4CZL A;  4BVO A;  5EX5 A;  4CJ7 A;  5B8H A;  4FL9 A;  2I7P A;  2GWK A;  3FGU A;  1X3N A;  1HLU A;  2YHX A;  1ZXO A;  4PKI A;  3U4L A;  3UKU B;  3L0Q A;  3W0L A;  4B1X B;  1MA9 B;  3O1B A;  5KPZ A;  1V4S A;  3SMS A;  3H3N O;  3WXK A;  4BR9 A;  1C0F A;  2QXL A;  3CER A;  3H45 C;  2I7N A;  4BC3 A;  4WQ4 C;  3A8Y A;  3IUC A;  4I6M A;  3HTV A;  3EO3 A;  4C23 A;  3WUH A;  1QZ6 A;  1OKJ A;  2P9I A;  3GOI A;  4DHY A;  4E1J A;  2Q36 A;  3WEE A;  1NGE A;  5EY4 A;  4BR5 A;  4A62 A;  4CZE A;  2YJE A;  2E2O A;  2P9K A;  3BF1 A;  2FF3 B;  2GWJ A;  1HPM A;  4H5R A;  4ISG A;  4M7Y A;  4WQ5 C;  3U9Z A;  2CH6 A;  1V4T A;  3ZEU A;  5AQJ A;  5AQP A;  2D0P A;  4XH1 A;  2P9S B;  3CJ7 A;  3SMP A;  4K43 A;  3CJ1 A;  4M7X A;  2E8A A;  2FF6 A;  3O5B A;  5AQZ A;  4RCH A;  3VET A;  3B8A X;  5FPE A;  5EOY A;  2P9U B;  4DB3 A;  3MMV A;  3QBW A;  3O08 A;  3S41 A;  1NBW A;  3ZET B;  2E88 A;  3QDK A;  2GTD A;  4CZM A;  2BUP A;  3D7E O;  4JHD A;  4DCH A;  1BUP A;  5AQQ A;  1RFQ A;  3LDO A;  3FZK A;  5AQS A;  2QWM A;  4FWO A;  4QS9 A;  2ZGY A;  3MN7 A;  5AZJ A;  2YJF A;  4BRQ A;  1QZ5 A;  1K8K A;  4I6M B;  2A5X A;  4KBO A;  2HF3 A;  5KQ8 A;  1JCE A;  3QML A;  2P9I B;  4BRO A;  3VPZ A;  3LDL A;  4FWK A;  4WQ5 A;  1NGJ A;  3WEE B;  2YCH A;  2D0O A;  3H6E A;  4A61 A;  5TKY A;  4PKH A;  2P9K B;  3AAQ A;  1GLD G;  4H0P A;  3FZL A;  3ZEU B;  1D4X A;  1TYQ A;  2J4R A;  2H3G X;  2ITM A;  3SLC A;  4Y0W A;  4RTF D;  2YHW A;  1XQS C;  2V7Z A;  3DXM A;  4H0Y B;  3MN6 A;  3CIP A;  1Y64 A;  4CBX A;  5AQF A;  3AY9 A;  3BEX A;  4RWT A;  3CJB A;  4JHD B;  3CQX A;  2E20 A;  3MN9 A;  4B1Y B;  4BG8 A;  5E26 A;  4MO4 A;  5AZJ B;  4LC9 B;  1T6D A;  4H0X B;  3LDP A;  1ZBS A;  2PAV A;  4XH5 A;  1K8K B;  3ZX3 A;  3UKR A;  3J8A A;  2A6A A;  4FOE A;  3FZH A;  5BN9 A;  3WT0 A;  1Q18 A;  4CBU A;  2QWP A;  3VGM A;  4Z94 A;  1GLE G;  3FFK B;  4WYB A;  4FWQ A;  2V7Y A;  5AQW A;  3G25 A;  4BR4 A;  3OHR A;  5AQR A;  2E2P A;  1E4F T;  1QQO A;  3DXK A;  3IDH A;  1NWK A;  3C7N A;  1KAX A;  3SJH A;  2IVN A;  1TYQ B;  2QM1 A;  4BRH A;  4BC4 A;  3VGL A;  1JCF A;  4CZH A;  3FR0 A;  3A5L C;  1X3M A;  1T44 A;  4M63 C;  3U8X A;  1GLL O;  2ZF5 O;  1NGC A;  4BC5 A;  2VCP A;  1YVN A;  3DXM B;  4IO8 A;  4XH4 A;  5AQT A;  2KHO A;  2HMP A;  3VEX A;  2CGL A;  1NGF A;  4IWV A;  1NLV A;  1U2V A; 
#chains in the Genus database with same CATH topology
 4CFA A;  4J8F A;  2WFB A;  1JLB A;  2FSN A;  2CGJ A;  4CD1 A;  4DTU A;  3T7Z A;  2ZJR L;  3ZSV A;  1F21 A;  3HT3 A;  1R59 O;  1WBD A;  2IOC A;  4CGD A;  4H0V B;  1NJI O;  4BRI A;  1NK0 A;  4C8L A;  3VQ9 A;  2F7T A;  2YNI A;  5ELZ A;  3TI0 A;  4JAX A;  3HM9 A;  2ZJP L;  4FXD A;  5HRN A;  2KZZ A;  3TAQ A;  3MDQ A;  5LY3 A;  1NOY A;  4GV9 A;  2HVI A;  5JS1 A;  3TAR A;  2V51 B;  2NUB A;  3LM2 A;  3CME N;  1KCF A;  3ZX2 A;  3V9X A;  3CCJ N;  4DSI A;  5GAD P;  4IFV A;  3TAF A;  3OY9 A;  4PL7 A;  4JS4 A;  1SL1 A;  4CEF A;  3EEQ A;  2GEM A;  4CHP A;  4BQL A;  4CK1 A;  5LMN K;  3LM9 A;  4B08 A;  1BQN A;  3MK6 A;  2IIR A;  1Q9X A;  3QBX A;  2ATQ A;  1MWK A;  3G10 A;  3CM5 A;  1C1C A;  1GLF O;  5AZI A;  1NKB A;  3A5O C;  5FRN A;  1E4G T;  4RW8 A;  3O9S A;  3TAN A;  3R3L A;  2WC9 A;  3WNG A;  3PV8 A;  2W40 A;  1VQL N;  3EL2 A;  5BR9 A;  1H1V A;  5T7B A;  3ASM A;  4DV5 K;  2QWQ A;  2OTJ N;  1KXP A;  5KRT A;  3EZW A;  4CZK A;  4BAC A;  2FC0 A;  4DSE A;  5C42 A;  4B9L A;  1WNS A;  4DQS A;  3LDQ A;  3U6F A;  5CE3 A;  3I55 N;  3QEV A;  3LL3 A;  3KLH A;  2P9L B;  1HNI A;  1N8R O;  1I94 K;  3J7A P;  3CCR N;  1KLN A;  3SQ2 A;  4Z4F A;  3AGK A;  1X9S A;  4JD2 B;  1Q7Y O;  5BN8 A;  1VQ6 N;  1TKX A;  4GVM A;  3BY5 A;  4OPH A;  5E84 A;  4FOI A;  4H5W A;  4HUF A;  4HWI A;  3ZCM A;  2ITG A;  1XMO K;  1ZBF A;  1ATS A;  4BR7 A;  3ZSZ A;  3ATU A;  1U48 A;  1N6Q A;  3S3M A;  1NGB A;  2F9W A;  3MX2 A;  3RSE B;  5GIN A;  4BRA A;  4AHC A;  4OGE A;  3CFP A;  3IFR A;  1BA0 A;  4M3W A;  2A40 A;  1U6Z A;  3A5M C;  3VGK A;  4CGJ A;  1K9M O;  4HTL A;  3THV A;  4XIU A;  3H1Q A;  5AQM A;  3NH0 A;  3QES A;  4CFC A;  4DR4 K;  3VEN A;  1JXB A;  2HNY A;  4BWJ A;  3LDS A;  3SQ0 A;  4DFJ A;  3CC2 N;  4JRQ A;  2VG6 A;  3WQT A;  1IKV A;  1RDW X;  3CCV N;  3H46 O;  4O8U A;  3O3H A;  5BRH A;  4F3O A;  1VAZ A;  5AQY A;  3BUZ B;  2RKI A;  3P1G A;  4O44 A;  4KH5 A;  5I42 A;  4NXN K;  3D6R A;  3D2E A;  2FSJ A;  1HNZ K;  3LP2 A;  1Y97 A;  4EAH D;  2GBZ A;  1TVR A;  4FJJ A;  4N56 A;  2JWK A;  4JRP A;  3BP8 A;  3H1V X;  3V1R A;  2RPI A;  1YJN N;  4CJK A;  1G99 A;  3TAM A;  3HST B;  2NNW A;  5J2Q A;  2IVP A;  2ZWH A;  2BGG A;  4B3T K;  4FWL A;  2RF2 A;  4AH9 A;  4K42 A;  3SUN A;  2NLX A;  3RMC A;  4DTJ A;  3QEP A;  1GLB G;  2QWL A;  3THX B;  1S72 N;  1TUU A;  3SCX A;  4B8A B;  1WUA A;  5ADX H;  1CZ9 A;  3DLB A;  1HNV A;  4DQI A;  1KVA A;  4CE9 A;  4O0I A;  4KB0 A;  5JMV A;  1BA1 A;  1OH8 A;  1S6P A;  3N4P A;  4FJL A;  4LF5 K;  5GIP A;  4FLY A;  4B9S A;  3VF4 A;  4KH4 A;  5GAG P;  3VER A;  3HPH A;  3CI5 A;  3O6W A;  1X9M A;  1T3V A;  3O80 A;  3KK2 A;  2PZS A;  1W97 L;  3LWM A;  2D4W A;  1WOQ A;  5CYM A;  4FK2 A;  3UB5 A;  1XC9 A;  2YI1 A;  5MLC Q;  1NG9 A;  1NGD A;  2P5O A;  1HNX K;  3TAG A;  1EWQ A;  4ZTJ A;  4BR0 A;  3C0B A;  1LV5 A;  4FWS A;  2W00 A;  1M1K O;  3KLI A;  3DJC A;  2P9S A;  2QEX N;  3W3D A;  2KFN A;  4KTW A;  4CW7 B;  3SPZ A;  4CIE A;  2B6A A;  3RRG A;  1B92 A;  4NO7 A;  3KK1 A;  3ZET A;  1DGK N;  4CEC A;  4B9T A;  3VMF B;  4BVO A;  2O8D A;  5I3U A;  3HPG A;  4CJ4 A;  2GWK A;  4OPA A;  1HLU A;  3UKU B;  3L0Q A;  2VG7 A;  1D9F A;  3H3N O;  3KD5 E;  4RW7 A;  4BR9 A;  4E0D A;  4Z4C A;  4DMN A;  4C8O A;  4GV3 A;  3B6P A;  1BCO A;  4BDY A;  2F96 A;  3NVM A;  3A8Y A;  4LF6 K;  3HTV A;  4C23 A;  5DM7 L;  3WUH A;  1HPZ A;  4B9N A;  2P9I A;  1ASU A;  4E1J A;  4CHY A;  4CEO A;  1BGX T;  4RW6 A;  2PFU A;  4DV2 K;  5JVG L;  4CZE A;  4DLG A;  4KHW A;  2RHK A;  4NLC A;  1XNQ K;  3N4Q A;  4WFB L;  3NGY A;  4RW4 A;  3OW2 M;  3DLL L;  1KFD A;  2Z1H A;  1BCM A;  2D0P A;  3ITH A;  4DS5 A;  2FF6 A;  5AQZ A;  4RCH A;  3B8A X;  2HHH K;  1TK0 A;  1SL0 A;  2F8T A;  3SZ2 A;  1NU0 A;  3S41 A;  1DTT A;  4CJQ A;  3E9L A;  3D7E O;  4DCH A;  2O8B A;  4ILJ A;  4PWD A;  3LDO A;  4KHS A;  3FZK A;  3CPE A;  3LP1 A;  3OYG A;  4CFB A;  5AZJ A;  1VSH A;  3OYF A;  4G9Z A;  2YJF A;  1S1T A;  2E6M A;  1QSL A;  4OKK A;  3SPY A;  4CGG A;  4PA1 A;  1K8K A;  4WE1 A;  4E7I A;  3KWI A;  2A5X A;  4DU1 A;  3T1H K;  2DFH A;  5SZT A;  5KQ8 A;  4DR6 K;  1JCE A;  1NJX A;  4ELT A;  3VPZ A;  4FLZ A;  1EX4 A;  1LWC A;  2E4L A;  2UUC K;  1WSI A;  2D0O A;  3CCM N;  3HOT A;  3CFR A;  5TKY A;  4PKH A;  4BE1 A;  4H8K A;  3AAQ A;  3KD1 E;  4H4M A;  1XHX A;  2C1G A;  3OYE A;  1JLC A;  1UA0 A;  4YFU A;  4JI7 K;  1A5V A;  4LSL A;  2VWK A;  3CYM A;  1LWF A;  4OPK A;  2V7Z A;  4CIF A;  2AJQ A;  2VGM A;  3THY A;  4DV3 K;  1FKP A;  3NGZ A;  5SWM A;  4JLH A;  3VQE A;  1P90 A;  3V9U A;  4LC9 B;  3L3V A;  4F4K A;  4H0X B;  1RTJ A;  4XH5 A;  4Y1D A;  2P51 A;  5CY4 A;  4FOE A;  1RDB A;  3OTO K;  4JI6 K;  2FBX A;  3RVC A;  2VGN A;  4CHN A;  1YIJ N;  3OYK A;  2HHS A;  4Z94 A;  3V4I A;  1GLE G;  3FFK B;  1TAQ A;  4WYB A;  4FWQ A;  5IWA K;  3KK7 A;  1RBV A;  1TKZ A;  4M3X A;  4ELU A;  2RE2 A;  3M8S A;  5DM6 L;  1NWK A;  3HK2 A;  4CJ3 A;  3SAG A;  2YKN A;  3SJH A;  2IVN A;  4BRH A;  5HOO A;  4FM2 A;  1JCF A;  3ID6 A;  1Q81 O;  4CZH A;  5HLF A;  3AVF A;  4Z4G A;  1VQM N;  2UUA K;  1NGC A;  4BC5 A;  4XH4 A;  3I56 N;  2HMP A;  2HHX A;  4K8X A;  4DQ8 A;  3TSP A;  5BRE A;  4CZI A;  3VA3 A;  1O1W A;  4IG3 A;  2NRV A;  4FJI A;  2BAN A;  3VEY A;  1GLA G;  2HHQ A;  1HKG A;  1L5U A;  4N5S A;  3KVG A;  3MXI A;  5C2F A;  3CYG A;  4FLX A;  3RR7 A;  3WXJ A;  5GAE P;  4IDK A;  4N76 A;  1SKS A;  3NBP A;  3M1F A;  3OS1 A;  1VQN N;  3HJF A;  5BRD A;  2P9N A;  4H0O A;  4IJA A;  4B1W B;  3HPO A;  1KFS A;  1RTI A;  3SUO A;  1NK6 A;  4O4G A;  4LH5 A;  1W9H A;  4BQZ A;  3NH2 A;  2DPN A;  1NJY A;  2QW9 A;  3VF2 A;  1S6Q A;  3DWL A;  2O8F B;  2WOM A;  3LPT A;  3CMA N;  1TK8 A;  4AHV A;  4MO5 A;  3C6U A;  4B9U A;  1IO2 A;  3FFI A;  3Q7C A;  4QS7 A;  4ZHR A;  1DKG D;  1KVC A;  4V19 S;  3SUQ A;  2A3Z A;  4CEZ A;  4DV4 K;  3K5N A;  2BTF A;  5FPM A;  1U2V B;  2O8C A;  3CQ8 A;  3VQC A;  5J2N A;  4JK9 A;  1VQ9 N;  1IBK K;  1XC3 A;  3WNH A;  4K8Z A;  1LW0 A;  3O4N A;  4DTX A;  4BVP A;  2GUP A;  4I9L A;  4NB4 A;  1KTQ A;  4B1Z A;  2VG5 A;  3AVJ A;  4FZX C;  1C1B A;  4BRG A;  5FLX O;  5FPN A;  4IBN A;  1S3X A;  4MQ3 A;  3MWT A;  5EVZ A;  1VSE A;  4O5F A;  5CR4 A;  3QLH A;  1RDA A;  3UIQ A;  2NRH A;  2VYP A;  2AP1 A;  5J2M A;  2CH5 A;  4CCH A;  4E72 A;  3HP9 A;  3SK3 A;  4OO1 J;  4N41 A;  4X65 K;  1IJJ A;  1RGI A;  4FWM A;  4W5T A;  2QI2 A;  1X9J A;  3QEI A;  5LJV A;  1U45 A;  2VWB A;  2DTU A;  3IMX A;  4FLU A;  4DTM A;  1LW2 A;  3GBT A;  1RDU A;  1VQK N;  1B9F A;  2NRW A;  1KRP A;  4BRF A;  4DTO A;  1TUY A;  1Q82 O;  4PKG A;  1RDD A;  4AF1 A;  5A2Q O;  2G8U A;  3HI0 A;  1M90 O;  4CEE A;  5BRF A;  5AZI B;  3C95 A;  5JLH A;  1LCU A;  3NCI A;  3O8M A;  4QOZ B;  1ZC6 A;  3M3Z A;  1HRH A;  1QQN A;  2HBK A;  4BWM A;  3E1Y A;  1CZB A;  1L3V A;  4Q5V A;  4YDU A;  3QNO A;  5K14 A;  1XUP O;  2UXB K;  4CF9 A;  1P8Z A;  4DQR A;  1EQY A;  3I8D A;  4YOV A;  2IDO A;  1WLJ A;  1JLG A;  3TAB A;  3PUF A;  3VEW A;  1VRT A;  1SKR A;  1BL3 A;  4EZ9 A;  1BU6 O;  3FZM A;  3U3G A;  3MAQ A;  1G15 A;  4BDP A;  4HCC A;  5KGX A;  1J9A A;  3NF9 A;  2KZM A;  4ICL A;  4FWR A;  3SV4 A;  4BRK A;  1QSS A;  1NK8 A;  4NYF A;  4C1N I;  4CHO A;  3ENH A;  1YI2 N;  5C10 A;  3UE5 A;  4MLH A;  2QXF A;  4H5T A;  1YT3 A;  3VQD A;  3HZ6 A;  4PQU A;  1ILY A;  2PBD A;  3CXC M;  2E2Q A;  3FZF A;  4F2S A;  4FLV A;  1S1V A;  3JXU A;  3RMD A;  2GUI A;  3QFU A;  3WQU A;  3LDN A;  3THW A;  2JGU A;  3AV9 A;  4EHU A;  4JK7 A;  4FWP A;  1BQM A;  1EET A;  5I9E B;  1A5W A;  1QHA A;  3VQP A;  1BIZ A;  1LAV A;  1YXQ A;  1VQ7 N;  4BEB A;  4ZTF A;  4RW9 A;  4CF2 A;  4L8R B;  4W5Q A;  2A41 A;  4DF8 A;  1VQO N;  2ASM A;  1C0M A;  4FM0 A;  3AA3 A;  4MLE A;  3VN5 A;  5AQL A;  1XNR K;  3CJA A;  2QWN A;  3NF7 A;  4F3T A;  1VK0 A;  3L2V A;  3PIO L;  3SYZ A;  4H4O A;  3EKU A;  2OAN A;  3P38 A;  4CD3 A;  1S5J A;  3PX6 A;  3VEO A;  3VQQ A;  5BPL A;  3D2E B;  1J6Z A;  1C0G A;  1MDU B;  3AVN A;  4F9O A;  4YDU C;  1DT9 A;  3OYA A;  2NRZ A;  3TTC A;  3DRP A;  4DU4 A;  3T1A A;  3O9U A;  4YOU A;  3QB0 A;  3NGI A;  4GY2 B;  5ADX A;  3SBG A;  5BPM A;  3EE8 A;  3AVG A;  4ISE A;  1IBM K;  1NGA A;  3OYB A;  1ZBH A;  4DR3 K;  5BR8 K;  2D0C A;  4KV8 A;  3ZT3 A;  4CBW A;  4KKO A;  4JI8 K;  4OX9 K;  4GNI A;  4MFB A;  1JXE A;  4N47 A;  1CLQ A;  3C65 A;  2HMI A;  5EX5 A;  3J7Y P;  4CJ7 A;  2I7P A;  1YTU A;  1ZXO A;  3W0L A;  3OJS A;  5HRS A;  1V4S A;  3SMS A;  1OH7 A;  1XI1 A;  4BY9 C;  3WXK A;  1WSE A;  5HRR A;  4GW6 A;  2HBJ A;  4FLW A;  1TV6 A;  3IUC A;  1T03 A;  3TAE A;  1T05 A;  3AA4 A;  1T7P A;  3L8B A;  4OKE A;  2Q36 A;  3NE6 A;  1JLQ A;  3IAY A;  3L2Q A;  3B6O A;  4I9Q A;  5EY4 A;  1GOC A;  5C12 A;  3M8P A;  1RBR A;  3ZSX A;  2P9K A;  3U9Z A;  4H5R A;  4LF7 K;  4M7Y A;  2G8H A;  4X62 K;  5AQJ A;  5AQP A;  3ZYY X;  5LMU K;  4XH1 A;  2P9S B;  3H08 A;  4IOA L;  2UXC K;  3QEW A;  3CJ7 A;  5C2D A;  4K43 A;  3TSU A;  2HW3 A;  4JKG A;  3G71 N;  4J2B A;  3MMV A;  3QBW A;  1K8A O;  4W5O A;  3JYT A;  4R5P A;  1NBW A;  3ZET B;  3DOL A;  1KSP A;  2O8D B;  4LH4 A;  4JI2 K;  3T19 A;  2BUP A;  3L2W A;  3LP3 A;  2NRX A;  4YY3 K;  3NAE A;  3A2F A;  4CED A;  3S9H A;  2OYQ A;  4BE0 A;  2ZGY A;  4CER A;  4DUY K;  3K57 A;  2DFF A;  3SAF A;  3G4S N;  3AO5 A;  5JEN A;  3KKR A;  4UQG A;  3D0P A;  1RTH A;  3CPW M;  4LSN A;  2P9I B;  3SNN A;  2P5G A;  4M3Z A;  4CJU A;  2X6S A;  1OVQ A;  2JLE A;  1VSL A;  3CFO A;  3P83 D;  1JLF A;  1GLD G;  3FZL A;  1TYQ A;  5KTQ A;  4E3S A;  2J4R A;  2H3G X;  2WON A;  4JKE A;  2GX9 A;  1NOZ A;  4Y0W A;  3ZSW A;  1JKH A;  3K9J A;  2YHW A;  3HO1 A;  1HMV A;  2C1I A;  4IOX A;  4CBX A;  3AY9 A;  4DV1 K;  3BEX A;  1REV A;  3TWH A;  2O8B B;  2E20 A;  3MN9 A;  4B1Y B;  5AZJ B;  2QK9 A;  3ZT0 A;  1KLM A;  4DV7 K;  4DLE A;  1B9D A;  3LDP A;  4X66 K;  2PAV A;  1K8K B;  1R0A A;  2YNH A;  3UKR A;  2LSN A;  1VQP N;  1Q18 A;  1HNW K;  4DU3 A;  1OH5 A;  3MED A;  1N32 K;  2V7Y A;  3R1X A;  5AQW A;  3DLE A;  1QQO A;  1NK5 A;  3DXK A;  4HCB A;  3C7N A;  1TGO A;  3VQB A;  1X3M A;  3AO3 A;  2G8K A;  4JV5 K;  4I2Q A;  4IO8 A;  5AQT A;  2KHO A;  1X9W A;  2KTQ A;  4H03 B;  3AVI A;  5AFU H;  3EY1 A;  5CHI A;  4XJX A;  4HUE A;  1EWR A;  4DTR A;  1YIT N;  3THY B;  1MU2 A;  5AQI A;  5EU7 A;  4FCY A;  2FSK A;  5AQO A;  3RMA A;  3VQA A;  1VSM A;  2P9P A;  5C24 A;  3JS6 A;  1QQC A;  3LAM A;  3SI6 A;  2Q97 A;  3E66 A;  1IKX A;  4BR2 A;  3PO4 A;  2AA4 A;  4OJR A;  3ULE A;  3KTQ A;  3TTD A;  3I33 A;  3LPU A;  4EZ6 A;  2QA4 N;  3VOV A;  4J2A A;  3OS2 A;  1KAZ A;  3VQ6 A;  4CJP A;  2D0A A;  3TPQ A;  1SKW A;  3VQ8 A;  1J53 A;  4EIA A;  4A5B A;  4MDA A;  4EFH A;  3ZX0 A;  4FLT A;  5H1S Q;  3LWL A;  4JI5 K;  2KW4 A;  4I2P A;  3ZSR A;  4IJN A;  3U9D A;  3K2P A;  1HUX A;  3ZSY A;  4HUG A;  4FJG A;  4FZY A;  1EKE A;  3DLK A;  3T69 A;  4CEA A;  2O4G A;  4FW1 A;  2UUB K;  4BEC A;  1BHL A;  4KI4 A;  1NNE A;  3E01 A;  4KTQ A;  4BRL A;  4JKD A;  2FBT A;  3D2F A;  4R79 A;  4LFC K;  3LZI A;  2YX6 A;  1XHZ A;  3VQ7 A;  3M6G A;  4L3Q A;  1TK5 A;  3A5N C;  2Q31 A;  4CF1 A;  1BG3 A;  3O9Q A;  2HHT A;  3CCQ N;  2EX3 A;  2OCE A;  2E2N A;  4OPJ A;  4LFA K;  5AQN A;  3EYZ A;  1CXU A;  4CK3 A;  1T6C A;  1K6Y A;  4QAG A;  3L4I A;  3MXM A;  1Z05 A;  1FKO A;  4AHS A;  1W2B M;  2P9N B;  4BE7 B;  2YNG A;  4JKA A;  5M1P A;  2PY5 A;  1HKB A;  4XEI A;  4GV6 A;  4X64 K;  3V1Q A;  3K5L A;  4NCB A;  4WF9 L;  1GLJ O;  3O3G A;  1BIU A;  4EP4 A;  4DSK A;  1FW6 A;  4E89 A;  4PHT X;  4IDH A;  1N33 K;  4EHT A;  4FJ9 A;  4O0J A;  1ZBL A;  1NJZ A;  2Q2R A;  3P4I A;  5JVH L;  1BDG A;  5F0X A;  1SAZ A;  5F1X A;  2Q0R A;  1KAY A;  3CQY A;  3FE1 A;  5CZ2 A;  1ITG A;  4AHR A;  3T3F A;  1I3A A;  2O8C B;  2G8I A;  5FRM A;  1N5Y A;  3L3U A;  3DLG A;  3V9Z A;  1J54 A;  3L2R A;  2OTL N;  3TU5 A;  1VRU A;  2HNZ A;  4ID5 A;  1RDC A;  2HBL A;  3WXM B;  3ZSQ A;  3K5O A;  3KZB A;  4A5A A;  3L6Q A;  1C6V A;  1VSF A;  3BGR A;  1Q86 O;  4JKF A;  4AM6 A;  3VQ5 A;  1OVY A;  4DV0 K;  1BOT O;  2Q1N A;  3CET A;  2ETJ A;  4B9Q A;  1VSD A;  3M8Q A;  1ZYQ A;  1IKY A;  4OLB A;  3L4Q A;  3AAR A;  1YTA A;  3CCS N;  4B3M K;  3O9R A;  4JNE A;  3M8R A;  1RTD A;  1Z26 A;  4IEI A;  3VTI A;  3I8B A;  3WNE A;  2ASO A;  4BRP A;  4FJX A;  1HYZ A;  3MEE A;  3QFP A;  2PYL A;  4PUO A;  3ZLJ A;  5DMR A;  4JI3 K;  3NHG A;  2E1Z A;  1D9D A;  1L3T A;  3CCE N;  5C0Y A;  1BO5 O;  2YHY A;  3PX0 A;  1XWL A;  4KHN A;  4FZZ A;  1QVG M;  3EKS A;  3K58 A;  4BGA A;  1D8Y A;  2YNF A;  1RT5 A;  1ATN A;  2B4J A;  4JN4 A;  4GMJ B;  4FPB A;  2W42 A;  4FJ8 A;  3A0I X;  4FVU A;  4FSV A;  4BRN A;  3TR8 A;  4ISF A;  1LOT B;  1WAF A;  3CHW A;  3AVL A;  3JAM O;  2EWS A;  1K73 O;  2EHG A;  1IKW A;  1S9E A;  1EO1 A;  1SZ2 A;  3BZK A;  3R9P A;  3CC7 N;  3QET A;  4MDB A;  3ZT1 A;  3MEG A;  1HYV A;  2ZM6 K;  1KQS M;  3FLC O;  3PSF A;  4DFM A;  4CZF A;  4B3R K;  2ZGZ A;  1T8E A;  1DTQ A;  1RT3 A;  4JI0 K;  4FJ7 A;  4CK2 A;  3QIO A;  4DQQ A;  1IG9 A;  4PY5 A;  1HJO A;  1DLO A;  5AQG A;  4C8N A;  4BRD A;  3VEZ A;  5JLF A;  4DKW A;  2VWJ A;  2HST A;  2QWO A;  3THW B;  3F2K A;  1Z6R A;  3CJC A;  3NFA A;  4BRC A;  1LWE A;  4BGB A;  4DR1 K;  3KIO A;  2F8S A;  4K41 A;  4AQY K;  4YOY A;  2X74 A;  4Z4E A;  2HB5 A;  3R6M A;  3AGR A;  4B1V A;  3DOK A;  2P9U A;  3DLH A;  4NCA A;  3OYI A;  2E1Y A;  3OS0 A;  3HYF A;  2UU9 K;  2B5J A;  4K25 A;  4CZL A;  4JI4 K;  5B8H A;  1X3N A;  2YHX A;  4B1X B;  4CIG A;  1Q8I A;  1MA9 B;  3O1B A;  4LY7 A;  1S9G A;  2O8E A;  3V9W A;  2ZD1 A;  4LF4 K;  2HHI A;  4CJL A;  4AIL C;  1C0F A;  4DF4 A;  2G8V A;  3H45 C;  5M1Q A;  2HBM A;  4BC3 A;  4I6M A;  4JKB A;  3ZT4 A;  3CC4 N;  1NK4 A;  4RG8 A;  2Q3S A;  1QZ6 A;  5M1O A;  5CZ1 A;  1S1W A;  1C1A A;  4DWI A;  3WEE A;  3KWG A;  1RIL A;  3AA5 X;  4NYN A;  1NJW A;  1NGE A;  1O13 A;  3KLF A;  3S5T A;  2FF3 B;  1HPM A;  5KRS A;  2FBV A;  4WQ5 C;  3CCU N;  5JS2 A;  3TAP A;  4CJE A;  4B3O A;  2XY7 A;  3ZEU A;  3RRH A;  3DRS A;  1NK7 A;  1FJG K;  4KTZ A;  4CGF A;  3AVH A;  3SMP A;  3ZT2 A;  4M7X A;  1U04 A;  3CJ1 A;  4CVN E;  5FPE A;  4WFN L;  1RBT A;  4J2E A;  3ZSO A;  4CFD A;  4B8C A;  3ULD A;  4CJV A;  1JJ2 M;  3CF5 L;  4E1N A;  4JHD A;  1BUP A;  2OZM A;  1RFQ A;  4IEE A;  1YHQ N;  5AQS A;  2QWM A;  4FWO A;  4QS9 A;  3DI6 A;  4DR2 K;  1Z25 A;  4BRQ A;  2GV9 A;  3AO4 A;  3AA2 A;  4M41 A;  3OVN A;  4KBO A;  2HF3 A;  3SBT A;  2QKK A;  3QML A;  3V6D A;  4FWK A;  1BI4 A;  3C6T A;  3P31 A;  1WAJ A;  1C0U A;  2D5R A;  2P9K B;  4KO0 A;  4H0P A;  2Z1J A;  4DR7 K;  2IC3 A;  3IS9 A;  2DFE A;  2ITM A;  1VHX A;  2HND A;  2HHW A;  1UAX A;  4JKG B;  3DXM A;  2Y1I A;  3CIP A;  4IOC L;  2KKZ A;  2BH1 A;  4Z4I A;  3CM6 A;  4G1Q A;  4RWT A;  5IT9 O;  4U67 L;  2IGI A;  4B9M A;  4F2R A;  2HHU A;  4E7K A;  4AHU A;  4MO4 A;  4KH6 A;  1T6D A;  3OA9 A;  3S3O A;  3ZX3 A;  4CJW A;  4C1N K;  2NRR A;  4WCE L;  2IAJ A;  3QIN A;  3FZH A;  3QER A;  5BN9 A;  2YV0 X;  3CG7 A;  3RR8 A;  3SAH A;  4CBU A;  2QWP A;  4FJM A;  1I39 A;  3O3F A;  4Y1C A;  3LAN A;  4CEQ A;  3C6A A;  1ASV A;  1U47 A;  1RT2 A;  5AQR A;  3EZ5 A;  2Z1G A;  5HP1 A;  3IDH A;  4M3U A;  1TYQ B;  2FBY A;  1RT4 A;  2QM1 A;  3ALY A;  4BC4 A;  3VGL A;  3ISN C;  3FR0 A;  1OH6 A;  4DTP A;  3CD6 N;  4M63 C;  3U8X A;  3VTH A;  2XO7 A;  1RBS A;  1GLL O;  4KFB A;  1QE1 A;  4CJS A;  3VEX A;  4NCG A;  1GOA A;  2ZE2 A;  2CGL A;  1NGF A;  4KHU A;  4IZ9 A;  4FK0 A;  2GEL A;  1EXQ A;  3HVT A;  1QTM A;  3AVC A;  1JL2 A;  4NLB A;  3I0S A;  3PO5 A;  4A2A A;  4ILG B;  1ASW A;  2E6L A;  2KQ2 A;  3TTF A;  5AQV A;  4KPY A;  3MCP A;  4E1M A;  2HOE A;  3OYC A;  5J2P A;  4BE2 A;  1KC8 O;  4M3R A;  3UKR B;  3OBW A;  3DYA A;  1NGG A;  2OPP A;  3WNF A;  3P39 A;  1VSJ A;  1GLC G;  1HQU A;  1MWM A;  3RWU A;  1C0T A;  1NGH A;  5HL7 L;  3AAP A;  5KGW A;  3V81 A;  4CEB A;  1YUW A;  1IH7 A;  3DAW A;  4H0T B;  3JSM A;  1X1P A;  1QHT A;  3DXK B;  1VSK A;  3C7N B;  2YHA A;  5AFU A;  1JLE A;  1QS4 A;  3GE1 A;  4FJN A;  3L2U A;  4M45 A;  3CJ9 A;  4JEP A;  5EXW A;  1SQK A;  3K9K A;  2P9L A;  2UXD K;  5HRO A;  4YOW A;  2E5L K;  2BE2 A;  2F9T A;  5KQD A;  3VQ4 A;  4GKK K;  1WBB A;  4DS4 A;  3HRG A;  4O55 A;  3VF6 A;  2R7Y A;  1W7A A;  4KHP K;  4JD2 A;  5TKW A;  3NF8 A;  4JI1 K;  5KPT A;  4HVJ A;  3SQ4 A;  2Q0U A;  4CGH A;  4DSF A;  2W41 A;  3E9O A;  4FW2 A;  1L3S A;  4KHY A;  3OJU A;  1QSY A;  3O1W A;  3PSI A;  3HSC A;  4CGI A;  2P9P B;  3WXL A;  5LJW A;  4B1U B;  4CJF A;  1VQ4 N;  1HR0 K;  2WBN A;  3RSE A;  4IFE A;  2VQE K;  5BPN A;  3KHY A;  3OYM A;  3ULE B;  3AVM A;  5JIC A;  4E7L A;  1ATR A;  2ZQB A;  1N36 K;  2D1K A;  4AHT A;  1NM1 A;  4LD0 A;  2DY4 A;  4CZJ A;  3T1Y K;  1RT1 A;  3HVR A;  3K5M A;  2JWL A;  2V52 B;  1A5X A;  1IG8 A;  2W6L A;  3K0S A;  4YOR A;  4C8M A;  1HX1 A;  4YOT A;  2P1J A;  1W0H A;  4A2B A;  2XY6 A;  3MN5 A;  4Z0U A;  4FYD A;  1QQM A;  1BWF O;  3I0R A;  1KD1 O;  4KB1 A;  1WB9 A;  3LAL A;  2UYT A;  1DEJ A;  2NZT A;  1S1X A;  1YJ9 N;  4DSJ A;  5D3G A;  4M3Y A;  1YF5 L;  3KLE A;  4JYA K;  3NH1 A;  3KJV A;  2WUS A;  2YHB A;  1JL1 A;  5GIO A;  4FPA A;  3C94 A;  4DTN A;  3G0Z A;  3BF3 A;  5AR0 A;  4Z4H A;  1E3M A;  4CI6 A;  4AM7 A;  3D2F B;  3OYD A;  3OYN A;  2XY5 A;  3ATV A;  1RBU A;  2X6N A;  3LAK A;  3MX5 A;  3K59 A;  3F9M A;  1S1U A;  3OBY A;  4HHT A;  2IVO A;  5AQH A;  4IXC A;  1CZA N;  1JLA A;  3THX A;  2OA8 A;  3AVB A;  1U49 A;  3HP6 A;  1XMQ K;  2KLA A;  3ENB A;  1GOB A;  4M42 A;  1NMN A;  3HL8 A;  4DTS A;  2ZJQ L;  4FJH A;  4FWN A;  4BG9 A;  1UWB A;  1HKC A;  3QO9 A;  5AQK A;  4H5N A;  4EP5 A;  2A42 A;  3IG1 A;  4KRE A;  4C8K A;  1CXQ A;  1ESV A;  1HJR A;  1WSF A;  2OPS A;  4B9V A;  4JK8 A;  5E41 A;  4YNQ A;  2HF4 A;  3R8E A;  3ENO A;  3AO1 A;  4PL8 A;  3H3O B;  4CF8 A;  1RT6 A;  4DFP A;  4DQP A;  3VES A;  4YHH K;  3KK3 A;  1HYS A;  4YOX A;  1SV5 A;  2XRI A;  2ASP A;  4H5V A;  3HBT A;  2PYJ A;  4OVL A;  1WSG A;  4BRM A;  1WSJ A;  1ZBU A;  3DLR A;  1YVU A;  3GG4 A;  2QWR A;  3J7Z O;  3PLA A;  1RCH A;  4JKH A;  1IBL K;  3HXM A;  4FJK A;  2CGK A;  4HTU A;  4WQ4 A;  2YKM A;  3EN9 A;  1EP4 A;  3SJJ A;  4KAZ A;  2Y1J A;  5KI6 A;  3NDK A;  1NK9 A;  2FLO A;  2OPQ A;  1YAG A;  3O4W A;  1WN7 A;  4E7J A;  4FO0 A;  3UKU A;  2A1S A;  4FVM A;  4K0K K;  4JS5 A;  5F2R A;  1QVF M;  4BRE A;  4DR5 K;  3MXJ A;  1NGI A;  5KPR A;  3HM8 A;  4KRF A;  3OYH A;  3OYJ A;  1JCG A;  3U3Y A;  3GDQ A;  1TL1 A;  3SUP A;  3BDP A;  4B3S K;  3ID8 A;  3WXI A;  4CJR A;  3F73 A;  1NKC A;  2G8F A;  1LAW A;  4Q0B A;  5FPD A;  1VQ5 N;  1SS6 A;  4JKC A;  2A1R A;  4LFB K;  3NF6 A;  3PIP L;  3V9S A;  2O4I A;  1NMD A;  4BC2 A;  2FXU A;  2IS3 A;  3QIC A;  4O8K A;  4E7H A;  3LP0 A;  5AQX A;  2XHB A;  4CZG A;  4J2D A;  3VEV A;  3RMB A;  3KKS A;  1RT7 A;  1S22 A;  1TAU A;  4GKJ K;  4KHQ A;  3J81 O;  5HRP A;  1VSI A;  3DRR A;  4QS8 A;  5AQU A;  4TSX A;  5J1E A;  2XY8 A;  4QCL A;  5GAH P;  3MCA B;  3GL1 A;  4ILH A;  4E19 A;  4FL9 A;  3VA0 A;  3FGU A;  1Q9Y A;  2D0B A;  4PKI A;  1FK9 A;  3U4L A;  5KPZ A;  3LZJ A;  3P5J A;  3SV3 A;  3EE9 A;  4DSL A;  1IV0 A;  2NRT A;  3OYL A;  4LF9 K;  3M5R A;  2QXL A;  3CER A;  2I7N A;  5M1K A;  4WQ4 C;  3EO3 A;  3S3N A;  1ZBI A;  3DM2 A;  1OKJ A;  3GOI A;  1RNH A;  4DHY A;  3PY8 A;  4ID1 A;  5CYQ A;  4BR5 A;  5HBM A;  4A62 A;  2YJE A;  2E2O A;  3BF1 A;  2GWJ A;  4ISG A;  3O9T A;  3E9P A;  5C25 A;  4DV6 K;  2CH6 A;  2W6K A;  1V4T A;  3MWP A;  4IO9 L;  3AVA A;  3HOS A;  4FK4 A;  1J5O A;  1TL3 A;  2E8A A;  2Z1I A;  3O5B A;  3NMU A;  3VET A;  5EOY A;  2P9U B;  4DB3 A;  4FM1 A;  4CES A;  3O08 A;  4KI6 A;  1HQE A;  3C6H A;  2E88 A;  3QDK A;  2GTD A;  1VQ8 N;  2F4V K;  5C15 A;  5AQQ A;  5FRO A;  5DK5 A;  1TKT A;  4W5R A;  3MN7 A;  3G6E N;  2O8E B;  3QEX A;  3AVK A;  1QZ5 A;  3RTV A;  3MEC A;  5FDL A;  4IG0 A;  1SUQ A;  3D45 A;  4I6M B;  4O5B A;  2G8W A;  1BIS A;  2HVH A;  2QKB A;  3J80 O;  4BRO A;  3LDL A;  4WQ5 A;  4I7F A;  1NGJ A;  3WEE B;  2WTU A;  2RN2 A;  2YCH A;  3NVK A;  3H6E A;  1SL2 A;  4A61 A;  3O4Q A;  4CF0 A;  3AO2 A;  1TKD A;  4WFA L;  3ZEU B;  1D4X A;  3IKM A;  4A59 A;  4CHZ A;  3SQ1 A;  3SLC A;  3QIP A;  2HHV A;  1NKE A;  4RTF D;  4DUZ K;  1XQS C;  3QNN A;  1U4B A;  1N34 K;  3Q7B A;  2OPR A;  4H0Y B;  4FJ5 A;  3MN6 A;  4NXM K;  1Y64 A;  5AQF A;  1KVB A;  2QTD A;  1L3U A;  3F9K A;  4GVE A;  5LL6 Z;  4M3T A;  1WSH A;  3TSQ A;  3CJB A;  4JHD B;  2KFZ A;  3CQX A;  4ELV A;  5AJ3 K;  4BG8 A;  1UA1 A;  5E26 A;  2OZS A;  3DMJ A;  1FXX A;  4A57 A;  3CCL N;  4W5N A;  3F5T A;  1J5E K;  1ZBS A;  4DFK A;  3J8A A;  2A6A A;  4OKJ A;  5M1F A;  4CHQ A;  3WT0 A;  1D5A A;  3IRX A;  3VGM A;  4OGC A;  4F8R A;  1BI4 B;  1YJW N;  4BR4 A;  3G25 A;  3OHR A;  4UY8 O;  4BDZ A;  2E2P A;  1E4F T;  1UOC A;  1KAX A;  3V1O A;  2O8F A;  4IKF A;  5M1N A;  2BDP A;  4DG1 A;  4CJT A;  3A5L C;  4OLA A;  1T44 A;  2VQF K;  3KLG A;  2ZF5 O;  4IFY A;  4U7B A;  3PX4 A;  4LF8 K;  2I5J A;  2VCP A;  1YVN A;  3DXM B;  4CJ5 A;  2X78 A;  3BZC A;  4CZM A;  4IWV A;  1NLV A;  1U2V A; 
#chains in the Genus database with same CATH homology
 4H03 B;  4IZ9 A;  5AFU H;  2GEL A;  5CHI A;  4XJX A;  1YIT N;  4J8F A;  4DQ8 A;  3TSP A;  4NLB A;  2WFB A;  5BRE A;  2FSN A;  4CZI A;  5AQI A;  2CGJ A;  4ILG B;  4A2A A;  4CD1 A;  3T7Z A;  2ZJR L;  2FSK A;  2NRV A;  3VEY A;  5AQO A;  1GLA G;  1R59 O;  1HKG A;  3TTF A;  2P9P A;  3KVG A;  5AQV A;  3MCP A;  4H0V B;  5C2F A;  3JS6 A;  1NJI O;  2HOE A;  4BRI A;  1KC8 O;  3UKR B;  3WXJ A;  3OBW A;  5GAE P;  1NGG A;  2Q97 A;  3E66 A;  2F7T A;  4BR2 A;  3P39 A;  5ELZ A;  2AA4 A;  4JAX A;  3M1F A;  3ULE A;  1GLC G;  1MWM A;  3I33 A;  3TTD A;  2ZJP L;  1VQN N;  2QA4 N;  3VOV A;  5BRD A;  1NGH A;  2P9N A;  4H0O A;  4IJA A;  1KAZ A;  5HL7 L;  3MDQ A;  4B1W B;  5LY3 A;  4GV9 A;  3TPQ A;  3AAP A;  1YUW A;  3DAW A;  2V51 B;  4H0T B;  4EIA A;  3DXK B;  4A5B A;  3C7N B;  4BQZ A;  4MDA A;  3LM2 A;  5AFU A;  2DPN A;  4EFH A;  2QW9 A;  3VF2 A;  3ZX0 A;  3DWL A;  3CME N;  3GE1 A;  3ZX2 A;  3CCJ N;  5H1S Q;  5GAD P;  3CMA N;  3CJ9 A;  4JEP A;  4MO5 A;  5EXW A;  1SQK A;  3Q7C A;  3K9K A;  4QS7 A;  4PL7 A;  2P9L A;  1DKG D;  4IJN A;  3U9D A;  4YOW A;  1HUX A;  2F9T A;  5KQD A;  2A3Z A;  2GEM A;  3HRG A;  4BQL A;  2BTF A;  5FPM A;  1U2V B;  3T69 A;  3VF6 A;  4JD2 A;  5TKW A;  3LM9 A;  4BEC A;  5KPT A;  2Q0U A;  4BRL A;  4JKD A;  3MK6 A;  2W41 A;  3D2F A;  3E9O A;  2IIR A;  4JK9 A;  3QBX A;  2YX6 A;  4R79 A;  1VQ9 N;  3O1W A;  1MWK A;  1XC3 A;  3M6G A;  4L3Q A;  4BVP A;  3HSC A;  1GLF O;  3A5N C;  5AZI A;  2GUP A;  2P9P B;  2Q31 A;  1BG3 A;  3WXL A;  3A5O C;  3O9Q A;  5LJW A;  4NB4 A;  4B1U B;  3CCQ N;  4B1Z A;  1VQ4 N;  1E4G T;  2WBN A;  2E2N A;  3RSE A;  4IFE A;  3O9S A;  5AQN A;  5BPN A;  3KHY A;  4BRG A;  1T6C A;  3R3L A;  2WC9 A;  5FPN A;  1S3X A;  3L4I A;  3ULE B;  1Z05 A;  5JIC A;  1ATR A;  3MWT A;  2D1K A;  5EVZ A;  4O5F A;  1NM1 A;  2P9N B;  1W2B M;  4CZJ A;  4BE7 B;  2W40 A;  1VQL N;  4JKA A;  5CR4 A;  5M1P A;  1HKB A;  3EL2 A;  2JWL A;  4XEI A;  3U9Z A;  5BR9 A;  2V52 B;  2NRH A;  1H1V A;  1IG8 A;  2VYP A;  4GV6 A;  2QWQ A;  4YOR A;  1KXP A;  2OTJ N;  1HX1 A;  2AP1 A;  3EZW A;  4CZK A;  2CH5 A;  4YOT A;  4WF9 L;  1GLJ O;  4A2B A;  3MN5 A;  3SK3 A;  1QQM A;  4OO1 J;  3LDQ A;  1BWF O;  4PHT X;  5CE3 A;  4IDH A;  1KD1 O;  1IJJ A;  4EHT A;  3I55 N;  1RGI A;  3LL3 A;  2UYT A;  4FWM A;  1DEJ A;  2QI2 A;  1X9J A;  2Q2R A;  5LJV A;  2VWB A;  3P4I A;  3IMX A;  5JVH L;  2P9L B;  2NZT A;  1BDG A;  5F0X A;  1YJ9 N;  1N8R O;  1YF5 L;  1SAZ A;  5F1X A;  2WUS A;  2Q0R A;  1KAY A;  3CQY A;  3GBT A;  5GIO A;  3CCR N;  1RDU A;  1VQK N;  2NRW A;  3AGK A;  3FE1 A;  4FPA A;  4JD2 B;  4BRF A;  1Q7Y O;  5BN8 A;  1TUY A;  3BF3 A;  5AR0 A;  4PKG A;  1Q82 O;  1VQ6 N;  4CI6 A;  5E84 A;  4OPH A;  4AF1 A;  4AM7 A;  3D2F B;  3HI0 A;  4FOI A;  4H5W A;  4HWI A;  1M90 O;  2OTL N;  3ATV A;  5BRF A;  5AZI B;  3TU5 A;  3MX5 A;  5JLH A;  3F9M A;  1LCU A;  1ATS A;  3OBY A;  4BR7 A;  3O8M A;  3ATU A;  2IVO A;  1NGB A;  5AQH A;  2HBL A;  3WXM B;  2F9W A;  3MX2 A;  1ZC6 A;  3M3Z A;  4IXC A;  1CZA N;  3RSE B;  4BRA A;  1QQN A;  2HBK A;  5GIN A;  3KZB A;  4A5A A;  3IFR A;  3L6Q A;  3E1Y A;  1BA0 A;  1Q86 O;  2A40 A;  1U6Z A;  4JKF A;  4YDU A;  3A5M C;  2KLA A;  4AM6 A;  1OVY A;  1XUP O;  3VGK A;  1K9M O;  4HTL A;  3ENB A;  1BOT O;  2Q1N A;  3CET A;  3H1Q A;  1P8Z A;  5AQM A;  2ZJQ L;  1EQY A;  4B9Q A;  4YOV A;  3VEN A;  4FWN A;  4BG9 A;  3VEW A;  1HKC A;  3L4Q A;  5AQK A;  3AAR A;  4H5N A;  3CCS N;  3CC2 N;  1BU6 O;  3FZM A;  3O9R A;  2A42 A;  4JNE A;  3WQT A;  4IEI A;  1RDW X;  3VTI A;  3H46 O;  3CCV N;  1ESV A;  3I8B A;  4O8U A;  4FWR A;  4JK8 A;  4BRK A;  2ASO A;  4BRP A;  5BRH A;  1VAZ A;  2HF4 A;  5AQY A;  3BUZ B;  3R8E A;  4C1N I;  3ENO A;  4KH5 A;  3ENH A;  3QFP A;  1YI2 N;  3D6R A;  3D2E A;  5C10 A;  4PL8 A;  3UE5 A;  2FSJ A;  3H3O B;  4MLH A;  2E1Z A;  4H5T A;  1ILY A;  3HZ6 A;  4EAH D;  3VES A;  3CCE N;  2PBD A;  5C0Y A;  4YOX A;  1BO5 O;  2YHY A;  3CXC M;  2ASP A;  2E2Q A;  2JWK A;  3HBT A;  4H5V A;  3FZF A;  3BP8 A;  3H1V X;  4BRM A;  1YJN N;  3JXU A;  1G99 A;  1QVG M;  3EKS A;  3QFU A;  2NNW A;  4BGA A;  2IVP A;  3LDN A;  3WQU A;  2ZWH A;  1ATN A;  2QWR A;  3GG4 A;  4JN4 A;  4EHU A;  3J7Z O;  4JK7 A;  3PLA A;  4FPB A;  4FWP A;  4FWL A;  3A0I X;  4JKH A;  4FVU A;  4K42 A;  5I9E B;  2CGK A;  2NLX A;  4FSV A;  4WQ4 A;  4BRN A;  1GLB G;  2QWL A;  3EN9 A;  4ISF A;  1S72 N;  1TUU A;  1QHA A;  1LOT B;  1WUA A;  1YXQ A;  5ADX H;  1VQ7 N;  4BEB A;  3CHW A;  2FLO A;  1YAG A;  3O4W A;  2EWS A;  1K73 O;  2A41 A;  1VQO N;  1EO1 A;  1SZ2 A;  3R9P A;  4FO0 A;  3CC7 N;  2ASM A;  3UKU A;  5JMV A;  4MLE A;  5AQL A;  3CJA A;  1BA1 A;  2QWN A;  4MDB A;  5F2R A;  4BRE A;  1QVF M;  1NGI A;  3N4P A;  5KPR A;  3HM8 A;  5GIP A;  1KQS M;  3VF4 A;  3FLC O;  4KH4 A;  3PIO L;  5GAG P;  3EKU A;  1JCG A;  2OAN A;  3P38 A;  4CZF A;  3VER A;  2ZGZ A;  3GDQ A;  4CD3 A;  3VEO A;  5BPL A;  3CI5 A;  3ID8 A;  3D2E B;  3O6W A;  1J6Z A;  3WXI A;  1C0G A;  1MDU B;  1T3V A;  3O80 A;  5FPD A;  1W97 L;  4F9O A;  4YDU C;  1SS6 A;  1DT9 A;  4JKC A;  1VQ5 N;  3PIP L;  2D4W A;  2NRZ A;  1HJO A;  1NMD A;  1WOQ A;  4BC2 A;  3UB5 A;  5AQG A;  2FXU A;  3TTC A;  4BRD A;  3VEZ A;  3QIC A;  5JLF A;  4O8K A;  4DKW A;  3O9U A;  2YI1 A;  4YOU A;  3QB0 A;  5AQX A;  2HST A;  1NGD A;  4GY2 B;  5MLC Q;  5ADX A;  2QWO A;  4CZG A;  3VEV A;  3SBG A;  5BPM A;  3F2K A;  3EE8 A;  1Z6R A;  3CJC A;  4ISE A;  1S22 A;  4BR0 A;  4BRC A;  1NGA A;  4BGB A;  3C0B A;  2W00 A;  4FWS A;  4K41 A;  1M1K O;  4YOY A;  3DJC A;  2P9S A;  2QEX N;  3W3D A;  4CBW A;  3R6M A;  3AGR A;  4GNI A;  4B1V A;  2P9U A;  4QS8 A;  5AQU A;  2E1Y A;  4NO7 A;  3ZET A;  1DGK N;  5GAH P;  3MCA B;  3GL1 A;  4K25 A;  3C65 A;  3VMF B;  4BVO A;  4CZL A;  5EX5 A;  4ILH A;  4CJ7 A;  5B8H A;  4FL9 A;  2I7P A;  2GWK A;  4OPA A;  3FGU A;  1X3N A;  1HLU A;  2YHX A;  1ZXO A;  4PKI A;  3U4L A;  3UKU B;  3L0Q A;  3W0L A;  4B1X B;  1MA9 B;  3O1B A;  5KPZ A;  1V4S A;  3SMS A;  3H3N O;  4BY9 C;  3EE9 A;  3WXK A;  4BR9 A;  2NRT A;  1C0F A;  4GV3 A;  3M5R A;  2HBJ A;  2QXL A;  3CER A;  3H45 C;  5M1Q A;  3NVM A;  2I7N A;  2HBM A;  4BC3 A;  5M1K A;  4WQ4 C;  3A8Y A;  3IUC A;  4I6M A;  4JKB A;  3CC4 N;  3HTV A;  3EO3 A;  4C23 A;  5DM7 L;  3WUH A;  1QZ6 A;  5M1O A;  1OKJ A;  2P9I A;  3GOI A;  4DHY A;  4E1J A;  2Q36 A;  3WEE A;  3KWG A;  1NGE A;  2PFU A;  5EY4 A;  1O13 A;  4BR5 A;  5C12 A;  5JVG L;  4A62 A;  4CZE A;  2YJE A;  2E2O A;  2P9K A;  2RHK A;  2FF3 B;  2GWJ A;  1HPM A;  3BF1 A;  3O9T A;  4H5R A;  3E9P A;  4ISG A;  4M7Y A;  4NLC A;  4WQ5 C;  3CCU N;  3N4Q A;  2CH6 A;  4WFB L;  1V4T A;  3ZEU A;  3OW2 M;  3MWP A;  5AQJ A;  4IO9 L;  3DLL L;  5AQP A;  3ZYY X;  2D0P A;  3HOS A;  4XH1 A;  2P9S B;  4IOA L;  3CJ7 A;  3SMP A;  5C2D A;  4K43 A;  3CJ1 A;  4M7X A;  2E8A A;  2FF6 A;  3O5B A;  3TSU A;  5AQZ A;  3NMU A;  4RCH A;  3VET A;  3B8A X;  4JKG A;  5FPE A;  5EOY A;  4WFN L;  2P9U B;  4DB3 A;  3G71 N;  3MMV A;  3QBW A;  1K8A O;  3O08 A;  3S41 A;  1JJ2 M;  1NBW A;  3C6H A;  2E88 A;  3ZET B;  3QDK A;  3CF5 L;  3E9L A;  2GTD A;  4CZM A;  2BUP A;  3D7E O;  4JHD A;  4DCH A;  1VQ8 N;  5C15 A;  1BUP A;  5AQQ A;  4ILJ A;  2NRX A;  1RFQ A;  3LDO A;  4IEE A;  3FZK A;  5AQS A;  2QWM A;  3CPE A;  4FWO A;  1YHQ N;  4QS9 A;  2ZGY A;  3MN7 A;  5AZJ A;  3G6E N;  4G9Z A;  2YJF A;  4BRQ A;  3SAF A;  1QZ5 A;  3G4S N;  1K8K A;  3KWI A;  4I6M B;  2A5X A;  4KBO A;  2HF3 A;  3CPW M;  5KQ8 A;  1JCE A;  3SBT A;  3QML A;  2P9I B;  4BRO A;  3VPZ A;  3LDL A;  4FWK A;  4WQ5 A;  1NGJ A;  3WEE B;  3P31 A;  2YCH A;  3NVK A;  2D0O A;  3H6E A;  3CCM N;  3HOT A;  4A61 A;  5TKY A;  4PKH A;  2P9K B;  3AAQ A;  1GLD G;  4H0P A;  3FZL A;  4WFA L;  2C1G A;  3ZEU B;  1D4X A;  1TYQ A;  3IKM A;  2J4R A;  4A59 A;  2H3G X;  4JKE A;  2ITM A;  2GX9 A;  3SLC A;  4Y0W A;  4RTF D;  3K9J A;  2YHW A;  1XQS C;  4JKG B;  2C1I A;  2V7Z A;  3Q7B A;  3DXM A;  4IOX A;  4H0Y B;  3MN6 A;  3CIP A;  1Y64 A;  4CBX A;  2KKZ A;  2BH1 A;  2VGM A;  5AQF A;  4IOC L;  2QTD A;  3AY9 A;  4GVE A;  3BEX A;  4RWT A;  3TSQ A;  3CJB A;  4JHD B;  4U67 L;  3CQX A;  2E20 A;  3MN9 A;  4B1Y B;  4BG8 A;  5E26 A;  1P90 A;  4MO4 A;  5AZJ B;  4A57 A;  4KH6 A;  4LC9 B;  3CCL N;  1T6D A;  3OA9 A;  4H0X B;  3F5T A;  3LDP A;  1ZBS A;  2PAV A;  4XH5 A;  1K8K B;  3ZX3 A;  3UKR A;  4C1N K;  3J8A A;  2A6A A;  4FOE A;  2NRR A;  4WCE L;  5M1F A;  3FZH A;  5BN9 A;  3WT0 A;  1VQP N;  3RVC A;  1YIJ N;  2VGN A;  3SAH A;  1Q18 A;  4CBU A;  2QWP A;  3VGM A;  4Z94 A;  1GLE G;  3C6A A;  3FFK B;  4WYB A;  4FWQ A;  2V7Y A;  3R1X A;  5AQW A;  3G25 A;  4BR4 A;  3OHR A;  1YJW N;  3KK7 A;  5AQR A;  4UY8 O;  2RE2 A;  2E2P A;  1E4F T;  1QQO A;  3DXK A;  3IDH A;  5DM6 L;  1NWK A;  3C7N A;  1KAX A;  3SAG A;  3SJH A;  2IVN A;  1TYQ B;  2QM1 A;  4BRH A;  5M1N A;  4BC4 A;  3VGL A;  5HOO A;  1JCF A;  3ID6 A;  1Q81 O;  4CZH A;  3FR0 A;  3A5L C;  3CD6 N;  1X3M A;  1T44 A;  4M63 C;  3U8X A;  3VTH A;  1VQM N;  1GLL O;  2ZF5 O;  4U7B A;  1NGC A;  4BC5 A;  2VCP A;  1YVN A;  3DXM B;  4IO8 A;  4XH4 A;  5AQT A;  3I56 N;  2KHO A;  2HMP A;  3VEX A;  2CGL A;  1NGF A;  4IWV A;  1NLV A;  1U2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...