2P9UB

Crystal structure of bovine arp2/3 complex co-crystallized with amp-pnp and calcium
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
248
structure length
222
Chain Sequence
b'TEPPMIQAVLTLYQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 59
structure length 222
sequence length 248
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9uB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9uB02
4FWQA 2D0OA 4BG9A 2IVPA 3AAPA 2AA4A 3P4IA 2YJEA 3WQTA 4CZEA 1C0GA 3ZX0A 4O5FA 2KHOA 5TKYA 3U8XA 2WUSA 4MLHA 4RTFD 3SK3A 4B1VA 4ISFA 4BRFA 2P9LA 5KPRA 1IG8A 5BPNA 1HUXA 2A41A 4CJ7A 4JD2B 3A5OC 2BTFA 2QWNA 1SQKA 2E2QA 2V51B 4GY2B 5ELZA 4BC4A 5AQIA 3MK6A 4DQ8A 3UKRA 2IVNA 4YDUC 3I8BA 1TUYA 2A40A 5AFUA 5F2RA 5CE3A 2GELA 5AZIB 3BP8A 4IZ9A 4MLEA 4BR9A 1ZBSA 3D2FA 1TYQA 3EZWA 4CZMA 5FPDA 3GE1A 1RGIA 3GOIA 1GLCG 4XH1A 1GLJO 5LJVA 5B8HA 1QQNA 1HKBA 1ATRA 3DXMB 4IXCA 5E84A 2YHWA 4H5NA 3MN6A 2GUPA 5BRHA 5LJWA 1ZC6A 1NLVA 2Q31A 4PL8A 5EVZA 3ZX2A 3GBTA 2D4WA 2P9PA 2QW9A 5KQDA 1QZ5A 2QWMA 4FWSA 5AQPA 3VOVA 2ZGZA 4XH5A 1Q18A 1C0FA 1BUPA 2QXLA 1HJOA 2BUPA 5AQHA 5FPMA 3ZEUB 3FE1A 2PAVA 3H1QA 2GWJA 3TU5A 5EX5A 1U6ZA 2ASMA 5BRDA 3F9MA 4M63C 1QQMA 2VWBA 3LDOA 1T6CA 3WEEB 5AFUH 3SMSA 3O80A 4DHYA 1NGCA 3EO3A 2IIRA 3UKUB 3R9PA 3SMPA 3D2EB 4IJAA 3G25A 4HTLA 2QWRA 4A2BA 4FWOA 4RWTA 1BOTO 1MWMA 2V52B 1EQYA 1BWFO 1KAZA 3FZFA 2H3GX 4Z94A 2P9NA 4QS9A 4WQ5C 4LC9B 4M7XA 4M7YA 1SAZA 3LDPA 4H03B 3LM9A 3VPZA 4EFHA 5FPEA 3MN9A 4H5WA 4EIAA 3FGUA 1NGDA 3VEVA 3HSCA 4YDUA 1GLLO 3ULEA 1BA1A 4JHDB 5AQRA 1NM1A 2P9UA 3HTVA 3WQUA 4BREA 4BC5A 1NGHA 4JN4A 3CJ7A 3JS6A 5JMVA 3LDLA 3BEXA 1V4SA 1KAXA 1CZAN 3GDQA 4BRQA 4BR4A 4NO7A 1T6DA 3QFUA 3EN9A 5AQJA 3DXKA 4CD1A 3ID8A 2P9IB 4FPAA 4FWLA 3CJ1A 3C7NB 1QQOA 3MCPA 2FLOA 2YHXA 3FZLA 2CGJA 3LM2A 5FPNA 4CI6A 3HZ6A 2E1YA 3AAQA 2E1ZA 5BREA 3VENA 3QB0A 2VCPA 2ITMA 4MO4A 3CHWA 3ATVA 4H0VB 5JICA 3IUCA 5LY3A 2NLXA 2F9WA 4GNIA 3O1BA 5F1XA 1KXPA 2YCHA 3A8YA 3FZKA 3VGLA 1RDWX 1BU6O 1NGFA 4IO8A 3VETA 4BROA 3H6EA 2VYPA 4H0OA 3M1FA 3CJBA 3FFKB 3H45C 5BPLA 2E20A 1XC3A 1NWKA 5AQVA 3VESA 2ZF5O 5EXWA 3ZETA 4BR5A 5AZJA 2YHYA 2FF3B 3RSEA 4CZFA 4FSVA 1Z6RA 1U2VB 3HI0A 3MDQA 3KVGA 2HF3A 4AM7A 4H0XB 2Q0UA 4WQ4C 3TPQA 1X3MA 3J8AA 3ENOA 2QWLA 4FWKA 5ADXH 2QWOA 2UYTA 4WQ5A 4I6MB 2P9SB 1K8KB 3DWLA 4BRDA 1BO5O 4EHTA 1NBWA 4B1WB 4PKHA 1NGBA 3CI5A 3CERA 3A5MC 1H1VA 1P8ZA 4CBXA 3ATUA 3VEXA 4JAXA 4DB3A 4JNEA 3O5BA 4XH4A 5AQTA 4BQZA 3WXKA 2GWKA 5F0XA 2ZWHA 1GLDG 3CQXA 4CZGA 1QZ6A 1WOQA 5EOYA 4PKIA 3O08A 5AQNA 2AP1A 2P9KB 1ZXOA 4CBUA 4CZIA 4B1ZA 2A42A 4FWMA 3QBXA 2D0PA 5AQOA 1NGJA 4K25A 4BRLA 1KAYA 3BF3A 1SZ2A 4B1XB 4BRPA 1HKGA 2FSKA 3O4WA 4H0PA 4C23A 2Q2RA 5KPZA 2E2OA 3A0IX 2NRHA 5AQUA 1IJJA 5BRFA 3VF6A 3C0BA 4JD2A 3L4IA 4FPBA 2P9LB 2I7PA 4K41A 1Y64A 5AQZA 4BR0A 4FL9A 1NGIA 4CD3A 3I33A 3B8AX 4QS7A 1MWKA 2CH5A 5E26A 5AQSA 1NGGA 3UB5A 3D7EO 4FOEA 3R8EA 2Q1NA 3UKRB 3MN7A 4BRGA 5AZIA 3CJ9A 3VGKA 1E4FT 1YAGA 3BF1A 2IVOA 1BG3A 3A5NC 2YI1A 3FZMA 3D2FB 1RFQA 1TUUA 1TYQB 3AARA 1WUAA 3LDQA 4FOIA 3VF2A 2J4RA 1DEJA 1JCFA 2CGKA 2ZGYA 5BN9A 2FXUA 4H5RA 3VEYA 3WXLA 3EKSA 1HX1A 3CIPA 3O6WA 4KBOA 3CJCA 3MMVA 4H0YB 3U4LA 4DCHA 3DXMA 1GLBG 3U9DA 3L6QA 5ADXA 4CZJA 3VEWA 1E4GT 4F9OA 3L0QA 4BR2A 1S22A 3WT0A 1MDUB 4IWVA 4BRMA 3R6MA 3DAWA 5AQYA 4BVOA 1LCUA 2W41A 3OHRA 3EL2A 3VERA 4BGAA 2P9PB 1T44A 2HOEA 3FZHA 2OANA 2FSNA 4K42A 1YXQA 3GL1A 3ZEUA 4BRIA 1YUWA 2CH6A 4H0TB 4BQLA 4BRKA 2FF6A 3ENHA 1XQSC 1XUPO 3WEEA 1OKJA 3GG4A 4B1UB 4MO5A 1V4TA 2DPNA 3QMLA 4O8KA 3UKUA 4BRAA 5AQGA 3D2EA 1JCEA 3O8MA 3H3OB 4XEIA 4A2AA 4CZKA 3SJHA 5BR9A 4H5TA 1BDGA 1YVNA 1ATNA 3AY9A 3M3ZA 4BRNA 3O1WA 2NZTA 3BUZB 2CGLA 3JXUA 3CJAA 5AQQA 1ESVA 4FWRA 4FWPA 4A62A 4WYBA 1X3NA 2P9NB 4BVPA 2QM1A 1GLAG 5AQLA 3QICA 3KHYA 1Z05A 3CQYA 4JHDA 1DKGD 3H1VX 3U9ZA 1J6ZA 4CZHA 1HPMA 3ULEB 3DJCA 2P9UB 2PBDA 4BC2A 4PKGA 1BA0A 3QDKA 5EY4A 2QWPA 5JLFA 4BR7A 3LDNA 4BRCA 2P9IA 3QBWA 4BGBA 3DXKB 4QS8A 3C7NA 3H3NO 2GEMA 3HM8A 4A61A 1JCGA 3UE5A 2Q36A 2YJFA 3IMXA 1G99A 3WUHA 2Q0RA 5KPTA 1HKCA 4H5VA 3HBTA 3VGMA 4NB4A 1DGKN 3VEZA 4CZLA 3M6GA 3IDHA 4CBWA 5I9EB 5KQ8A 2V7ZA 4EAHD 1ATSA 3VEOA 4PL7A 2W40A 1S3XA 3S41A 2GTDA 4BC3A 4HWIA 2ASOA 3IFRA 3LL3A 2E2NA 3WXJA 2Q97A 4ISGA 2D1KA 2V7YA 3VF4A 4Y0WA 5AQKA 1U2VA 2HF4A 4RCHA 4AM6A 3ZETB 4BRHA 5AZJB 3CETA 3A5LC 4K43A 1GLFO 1X9JA 3RSEB 3SLCA 2A6AA 1QHAA 4J8FA 4FWNA 5AQMA 4EHUA 2E2PA 3KZBA 5BPMA 1MA9B 4WQ4A 4ISEA 4I6MA 2P9SA 1K8KA 2FSJA 4B1YB 4E1JA 2A3ZA 3H46O 5AR0A 2A5XA 2F9TA 4FO0A 3WXIA 1NMDA 2ASPA 5JLHA 4IJNA 3MN5A 1HLUA 2I7NA 1NGAA 3W3DA 2QWQA 2E8AA 3QFPA 5BN8A 1D4XA 1GLEG 1NGEA 3EKUA 5AQFA 4L3QA 1R59O 1LOTB 2E88A 3W0LA 2P9KA 4B9QA 4BG8A 2EWSA 2HMPA 5AQXA 3FR0A 3FLCO 3ZX3A 5AQWA
chains in the Genus database with same CATH superfamily
3HPOA 4BG9A 4CZEA 3WQTA 1Q86O 4HUEA 3CCQN 1C0GA 3RMBA 4DTMA 1C0TA 4DR3K 5TKYA 3AVFA 3CC2N 4X64K 4B1VA 4ISFA 4BRFA 1B9FA 2A41A 4FLZA 4E7HA 2FBTA 4MFBA 2BTFA 3PO5A 5IWAK 4KI6A 5T7BA 3OYHA 3MK6A 4DQRA 3VQQA 1BCMA 4CIFA 4OJRA 1RT3A 2O8EB 2YKMA 2PYLA 3V9WA 1IKVA 4IZ9A 3LANA 4E7KA 1ZBSA 3D2FA 4NXMK 1TYQA 4U7BA 4CK1A 5M1FA 4CZMA 4BECA 1EWRA 1RGIA 1EKEA 1MU2A 1GLJO 2IS3A 4TSXA 4M3XA 2C1GA 3C6TA 2FBYA 1VQPN 4CVNE 3SQ1A 4JI8K 5C2DA 2KQ2A 2VWKA 5LJWA 1YJWN 3QETA 2Q31A 1TK5A 3GBTA 4C8NA 2O8CA 4JKFA 5KQDA 3VQ4A 3ZSWA 1B9DA 1C0FA 1HJOA 4FXDA 4M45A 4FVMA 3PY8A 1JL2A 2PAVA 3H1QA 1S1TA 3TU5A 4R79A 5EX5A 1U6ZA 3CG7A 5BRDA 2O8BB 4M63C 3VA3A 1QQMA 2VWBA 3QESA 5AFUH 1SKWA 1WLJA 1NGCA 2IIRA 3VQ8A 1GOCA 3SMPA 1RCHA 4DQIA 1RILA 4FJJA 3G25A 4HTLA 4A2BA 2QI2A 3S5TA 4CEBA 4RWTA 3AVKA 2BH1A 3E1YA 1RNHA 3L2VA 4JV5K 3O9UA 4DUYK 2HHUA 3HO1A 2KFZA 1RT4A 4M7XA 1SAZA 3LM9A 3V6DA 4EFHA 5HRPA 4EIAA 4PHTX 3HSCA 4YDUA 4JLHA 3MXJA 4DLEA 1UOCA 4KI4A 1BA1A 4JHDB 3NF6A 4LFBK 5KTQA 4BY9C 3HTVA 4BC5A 4CJWA 4OPKA 5HROA 4JN4A 1VSEA 3JS6A 4DR2K 3LDLA 3MEGA 1V4SA 1KAXA 3QIOA 1KVBA 3THXA 1N5YA 4W5NA 4NO7A 1OH7A 3QFUA 5JVGL 3RMCA 3FFIA 3BGRA 4CGFA 1QQOA 3AVIA 1RT1A 5FRMA 3TAEA 3ZT0A 1RTJA 4CJLA 1QVGM 3FZLA 4LF6K 2GV9A 4IO9L 3AVLA 4CHPA 3LM2A 1QSSA 5FPNA 3J7ZO 1QTMA 3E9LA 5C24A 2BDPA 2VGNA 3ATVA 3NF7A 4H0VB 5JICA 1HYVA 4B8CA 3TAGA 2F9WA 1M90O 3PIOL 4YHHK 3M5RA 3VETA 2VYPA 2VWJA 4KKOA 3CJBA 3KK3A 1XC3A 1HPZA 1QHTA 5C42A 2JLEA 4BR5A 5AZJA 4C8OA 3HI0A 4DFPA 4H0XB 4CF1A 3ENOA 2QWLA 4JEPA 2QWOA 4WQ5A 3LP2A 4JKCA 4B9LA 3DRPA 3LZIA 3DLLL 3L8BA 3HP6A 1NGBA 3CERA 1IV0A 3A5MC 2W00A 4CBXA 4ELTA 2D0BA 3ATUA 4JAXA 4ELUA 4JNEA 3O5BA 4JKGB 4BQZA 5F0XA 5JS1A 2PY5A 1GLDG 4NYNA 1QZ6A 4PKIA 3O08A 4DTOA 1EXQA 4FJ7A 4DTUA 4DFMA 4FWMA 3QBXA 2D0PA 5AQOA 3WXMB 3TAMA 3NF8A 4DR6K 3BF3A 1SZ2A 4B1XB 3ZSXA 5AJ3K 3M8PA 1HKGA 4H0PA 4G9ZA 1L3SA 2E2OA 2EX3A 3OYKA 1RBSA 1IJJA 4WFNL 4O0JA 2QKKA 4FZYA 4JI4K 2P9LB 4IOCL 1Y64A 5AQZA 1NGIA 3B8AX 4QS7A 1EWQA 3AA2A 2WBNA 1NGGA 3PIPL 4FZXC 4H8KA 4Z0UA 2Q1NA 1J54A 3ALYA 3OVNA 3UKRB 1S6PA 2O8EA 1S1WA 3MXMA 3HVRA 5KI6A 1HNXK 1T3VA 1ITGA 3A5NC 1FKPA 4CFCA 3SJJA 3LDQA 2ITGA 1DEJA 4CF0A 1JCFA 3KKSA 5BN9A 3VQPA 2HHIA 2NRWA 1YITN 3EKSA 3CIPA 3O6WA 4KBOA 4K8XA 1WNSA 1KQSM 4DCHA 4CZJA 3C95A 3VEWA 3L0QA 1S22A 3WT0A 4IWVA 4QOZB 1X9MA 1GOBA 2P9PB 4JRQA 2ZJPL 2HHWA 3G4SN 4K42A 1RTDA 3GL1A 4MDAA 1Y97A 2HB5A 1Q82O 4YORA 3S3OA 1YUWA 2CH6A 4GVMA 4BRKA 1SS6A 4PUOA 2O8BA 4HTUA 1XQSC 1HNZK 2IGIA 3QMLA 4O8KA 1N36K 4GV6A 3QEIA 4JS5A 4JI1K 2ATQA 2YKNA 3C6AA 4U67L 3H3OB 4DR7K 3AVBA 1XHZA 4LSLA 3QEWA 1UWBA 4BACA 4CEDA 5BR9A 1BDGA 1YVNA 3M3ZA 5K14A 4BRNA 2HVHA 4B9MA 1RBTA 3AGKA 1ZBIA 5AQQA 2YHBA 1X3NA 3AVGA 2P9NB 4BE7B 3HJFA 2IOCA 1GLAG 1E3MA 1RDUA 2NRXA 3QICA 3CFRA 5CR4A 4JHDA 5FDLA 3U9ZA 4CFBA 5JS2A 4CZHA 2NRTA 5C2FA 3DJCA 3SQ2A 2P9UB 2PBDA 1NK7A 2VQFK 4FM1A 1KSPA 4PKGA 1BA0A 4KHQA 5EY4A 3KLIA 1KD1O 4KTZA 5E41A 3E9PA 3CCRN 2VG7A 4DQQA 1CXQA 1Q8IA 3ZSQA 1KLMA 4BGBA 1EO1A 2GEMA 3NE6A 3HVTA 3L2QA 3THYB 1LWFA 3C6HA 2W42A 4NCAA 3CXCM 4JI6K 5KPTA 1XWLA 4E89A 4FJIA 1O13A 3TAQA 3QNNA 1DGKN 3VEZA 2WC9A 3MEDA 3LWMA 3IDHA 4CBWA 3L2UA 5KQ8A 4EAHD 4AHCA 3S41A 3SUQA 4FYDA 3CCSN 1U48A 3T1YK 3RTVA 3WNHA 3OYIA 2NRZA 2E2NA 4BDZA 3QLHA 4Y0WA 5AQKA 3ZT1A 3TWHA 2JGUA 4PA1A 2RHKA 3A5LC 4RW6A 3U6FA 2A6AA 4FJXA 4EHUA 3D0PA 2WTUA 1TK8A 1VSJA 4WQ4A 3HOSA 3HRGA 4BDYA 1HMVA 4DU1A 4E1JA 4KREA 4F2RA 1U04A 4LY7A 5AR0A 4FO0A 3CYGA 3MN5A 1HLUA 4IFEA 3E66A 2I7NA 4Y1DA 4I7FA 4JKGA 3NH0A 1NGEA 4B3TK 1XNQK 1NK8A 4L3QA 3OY9A 1R59O 2FC0A 3CCJN 4OKKA 4CCHA 3W0LA 4A5BA 4FJNA 4J2AA 4FW1A 3SZ2A 4W5RA 3FR0A 1W7AA 2OYQA 3ZX3A 2Y1IA 4KB1A 4FCYA 1FK9A 1CZBA 4FWQA 2D0OA 3AAPA 5SWMA 4FJHA 1ZBHA 1WSIA 4FLWA 3U8XA 2P1JA 4JKDA 4RTFD 2P9LA 5BPNA 4JD2B 1IKYA 5M1NA 4B9SA 2V51B 1HNVA 5ELZA 4RG8A 3TTDA 3PO4A 3UKRA 5CYQA 3G6EN 4E7LA 3DMJA 2E5LK 1RTHA 3K57A 2RPIA 4FJGA 4B3OA 5FPDA 5FRNA 4ID5A 1RT6A 2UUCK 1GLCG 5BR8K 4XH1A 4RW9A 4CF2A 1UAXA 5LJVA 1XHXA 3CCEN 4IG3A 1ATRA 3DXMB 4DG1A 4H4MA 2GUPA 4DTNA 2G8FA 1ZC6A 4LF5K 3IKMA 1NLVA 3CPWM 4PL8A 3ITHA 5EVZA 3ZX2A 4W5TA 2P9PA 1QZ5A 2DFHA 1VSIA 2QWMA 4B9NA 5AQPA 4ILJA 1QVFM 3ZSYA 2QXLA 3PX4A 2B6AA 3DLKA 5FPMA 2HBJA 1C6VA 3KD1E 3LDOA 1T6CA 3NF9A 3SMSA 2BE2A 5SZTA 2HBLA 4DHYA 3AVCA 3SBTA 1WN7A 1WSFA 4YOUA 1D9DA 1LAWA 2YNGA 4IJAA 3SQ0A 3PSFA 1TK0A 1D8YA 4OKEA 3ZSVA 4LF7K 4DU4A 3IG1A 3F73A 1C0MA 4CK3A 4LF8K 5C25A 2H3GX 4DSFA 2P9NA 4JI3K 3BZCA 4KPYA 3QERA 3MCAB 2P5OA 4DLGA 2O4GA 4H5WA 1GLLO 3OW2M 4AHTA 4DTPA 2P9UA 1L3VA 3WQUA 3OYEA 2QXFA 3TARA 5CZ1A 3CJ7A 5JMVA 2QTDA 1CZAN 4Z4FA 3GDQA 4IBNA 3WNEA 3KWGA 3DM2A 3ASMA 3AO5A 1ZYQA 3SI6A 2F8TA 4Z4CA 5M1OA 2P9IB 3THYA 3VQ5A 2HVIA 3TANA 1RDBA 2YHXA 2HW3A 4NYFA 1S6QA 3TI0A 3NAEA 3TABA 5BREA 3VENA 1NG9A 1LWEA 2HHHK 3OTOK 1C1CA 1X9SA 3IUCA 3LAKA 4JKEA 4GNIA 5F1XA 3DLHA 2YCHA 3E01A 1LW2A 4YOYA 1RDWX 1W97L 3AV9A 1XMOK 4DQPA 3FFKB 3H45C 4RW8A 2HHTA 2KLAA 4CEQA 1NWKA 1IBMK 3IS9A 4YNQA 4DV5K 3VQDA 3PX6A 1Z6RA 1U2VB 3KVGA 5GAEP 2HF3A 1KTQA 4WQ4C 4DQSA 2XRIA 3J8AA 3SNNA 4YOVA 3K5NA 2UYTA 3AVAA 3WNFA 4I6MB 4PWDA 3DWLA 4QAGA 3K59A 3LP1A 2A1RA 4PKHA 3VQ6A 4IEIA 4M41A 1H1VA 1P8ZA 2UXBK 1WAFA 1K8AO 1NOZA 3WXKA 3VQEA 1J5OA 3O9RA 3MWTA 2VQEK 2YNIA 5JENA 3CQXA 1WOQA 5EOYA 4CZIA 4B1ZA 1LWCA 3U3GA 1RDDA 1NGJA 2ZE2A 4BRLA 1KAYA 4E72A 4W5QA 4BRPA 1TL1A 1WSEA 3O4WA 2P5GA 4UQGA 4OVLA 2NRHA 5AQUA 1NK0A 2G8WA 4UY8O 2X6SA 1NMNA 3C0BA 4Z4EA 4JD2A 4FPBA 5M1PA 4K41A 2Y1JA 4BR0A 2BANA 4CD3A 3EZ5A 4B9UA 3I33A 1MWKA 2CH5A 3LZJA 4M3YA 3V1QA 2KZMA 3S9HA 1TKDA 1Q81O 3D7EO 4FOEA 4CGJA 3MN7A 4BRGA 3DLRA 3S3NA 3VGKA 3OYAA 1L5UA 3BF1A 2YI1A 3C94A 4IFYA 1RFQA 1IO2A 4NLBA 2OA8A 1BL3A 2RE2A 3KK2A 4B3MK 1K6YA 1BI4A 2ZGYA 4AF1A 3ZT3A 3AVNA 5C12A 3PX0A 1VSMA 3THVA 1HX1A 1Z26A 3T69A 1IH7A 4FVUA 3DXMA 1GLBG 5C0YA 3NDKA 3I8DA 4BDPA 2DY4A 4FW2A 2X78A 3L6QA 3RMAA 3JAMO 4KAZA 4F9OA 1RBUA 4O55A 5HBMA 3R6MA 3DAWA 2GX9A 5GINA 1DTQA 2W41A 3OHRA 3EL2A 4JK7A 1JLEA 4BGAA 2D0AA 1T44A 2HOEA 3FZHA 2OANA 4CIEA 4I2PA 2FSNA 4FLVA 3IRXA 2G8UA 4NLCA 1S9GA 3CD6N 1QE1A 4H0TB 1C1AA 2XY7A 3SCXA 3BZKA 4NCBA 1REVA 1WSGA 4E7JA 3LPTA 3VQ9A 2HHSA 4LFAK 4XEIA 3CF5L 3U3YA 2OCEA 3SJHA 4KHPK 1VQNN 4CGHA 2NRRA 4H5TA 3AY9A 1ATNA 4KRFA 4F4KA 3P31A 2NZTA 3OYCA 3BUZB 2CGLA 1Q9XA 4FWRA 3HSTB 4RW4A 4BWMA 1NKCA 1KFDA 3KHYA 4FLXA 3CQYA 1IBKK 1DKGD 3H1VX 4CK2A 1J6ZA 3J81O 1HPMA 2FBXA 4GV3A 2O8DB 3G71N 4OO1J 3F5TA 1NK5A 1SV5A 1J5EK 1NKEA 2G8VA 3HL8A 3QDKA 4F3TA 3SPZA 3HYFA 4CEZA 1VQ8N 3K2PA 4BR7A 4AHVA 1YT3A 4GW6A 3SUPA 5CZ2A 4OX9K 4BE0A 2P9IA 3NH2A 3CMAN 4QS8A 5J2QA 4ILGB 4CHNA 1WB9A 3A2FA 1JLCA 4A61A 2W6LA 3UE5A 3OYBA 2Q36A 5HRRA 3IMXA 1VQ6N 2Q0RA 5LMNK 1RT5A 3VGMA 4DFJA 3N4QA 2G8KA 3AVJA 4DTXA 2V7ZA 1CXUA 4JK9A 2WONA 3VEOA 4CHZA 2W40A 3TSPA 3ULDA 5M1KA 3ZT4A 3ZT2A 2GTDA 3PV8A 1UA0A 3KK7A 1WBDA 3ENBA 3LL3A 1B92A 3DI6A 3K5MA 3NCIA 2V7YA 1SL0A 1U2VA 2R7YA 3RSEB 1W9HA 1GLFO 3SLCA 3OYGA 2D0CA 2FBVA 1G15A 4DV4K 3OS2A 4FWNA 5AQMA 1EX4A 3KJVA 3T3FA 1NJZA 1NJXA 4JI2K 4I6MA 1HQUA 3M8SA 3E9OA 2FSJA 1SL1A 3RRHA 4Q0BA 4I9QA 3V4IA 3QEPA 2ASPA 3WNGA 4OGEA 4CFDA 3QFPA 2E8AA 4BEBA 4O5BA 3AO3A 3CMEN 1J53A 5AQFA 4Z4HA 3NMUA 3MAQA 1TAUA 4FZZA 1FKOA 4BG8A 4JKBA 4M3TA 1VSHA 3TPQA 4F3OA 2Z1GA 2AA4A 3P4IA 2ZJQL 3RR7A 4MQ3A 3ZX0A 1VQ4N 2KHOA 2WUSA 3SK3A 3ZSZA 4LFCK 4FM2A 5KPRA 2UU9K 4CJ7A 4DV0K 1NJIO 3AA4A 3K58A 3A5OC 2QWNA 4DWIA 4LSNA 4F8RA 1QS4A 4GY2B 3OYFA 1O1WA 4BC4A 4DQ8A 4YDUC 3I8BA 2HMIA 1TUYA 2A40A 5AFUA 5JVHL 4GKJK 1I39A 5IT9O 3TAPA 4XIUA 2GELA 5AZIB 1N6QA 4DF8A 3HPGA 3OYDA 4MLEA 4BR9A 3HK2A 4KH4A 3L2WA 4O8UA 3OYNA 3EZWA 4HVJA 1WAJA 3HP9A 3K5LA 2WFBA 4DSIA 3OS1A 4CGGA 4DS4A 1VQ7N 1HYZA 4JI7K 2A1SA 2YNHA 1QQNA 1HKBA 2O8FB 3NVMA 4IOAL 2YHWA 5BRHA 3MN6A 4XJXA 3AVMA 2QW9A 4FJMA 1IKXA 3VOVA 2ZGZA 1N32K 1Q18A 3TAFA 1BUPA 1JXEA 4OKJA 3CCUN 2BUPA 1WSHA 1ASWA 5AQHA 3ZEUB 1J9AA 3PSIA 3THWB 2GWJA 3T19A 4E1MA 2ASMA 3ZSOA 3F9MA 5GIOA 5I3UA 1JJ2M 4DUZK 3O9QA 4CJSA 3O3GA 3DYAA 1U4BA 2E6MA 3D2EB 3OYJA 1BCOA 3RRGA 4DMNA 4Z4IA 3K9KA 4FWOA 2NUBA 3J7AP 4OLAA 2ZJRL 1MWMA 1JLBA 2V52B 2HHXA 1BWFO 1NJWA 3H08A 1KAZA 3FZFA 4Z94A 4N56A 4WQ5C 4KHSA 4G1QA 4N5SA 1DT9A 3LDPA 4H03B 2UUAK 5FPEA 1X9WA 3MN9A 2Z1HA 3FGUA 4YOXA 4KB0A 3O4NA 2O8DA 1NM1A 1T03A 4BREA 3T1HK 3C65A 3VQAA 3BEXA 1NNEA 1VSFA 4BRQA 4BR4A 1KFSA 4EZ9A 5AQJA 3EN9A 4OGCA 2IC3A 3ID8A 3D6RA 3KK1A 3EY1A 4O0IA 3C7NB 4PQUA 1XC9A 2KFNA 3P1GA 3MCPA 1VSLA 3Q7CA 1OVYA 1RT2A 5KRSA 2CGJA 1S1XA 4CI6A 4M3WA 4J2EA 3QB0A 2VCPA 3CHWA 1VQON 1OH5A 5LY3A 2NLXA 2GUIA 1KXPA 3VGLA 1BU6O 1NGFA 3H6EA 4H0OA 1QQCA 4F2SA 5BPLA 2E20A 5C10A 3V9ZA 5I42A 5EXWA 3I0RA 3HM9A 2PFUA 4B9TA 3RSEA 4FK0A 4FSVA 3MDQA 2HSTA 4FLUA 4C8LA 4AM7A 2NRVA 1BI4B 5J2PA 3BDPA 3SAGA 2BGGA 5FLXO 4FWKA 5TKWA 3ZCMA 2KKZA 4BRDA 1BO5O 4YOTA 4AILC 1NBWA 4B1WB 1BQMA 4DFKA 3O9SA 3TTFA 3CI5A 2KTQA 3P83D 4DB3A 2F7TA 5AQTA 1S5JA 2GWKA 1JLGA 1JXBA 2ZWHA 4DV6K 1YIJN 4JKHA 4CZGA 5AQNA 2X74A 2KW4A 2P9KB 1ZXOA 4IDKA 3JSMA 2A42A 4WFAL 4GVEA 4X62K 3VTIA 3SV4A 4C1NI 5J1EA 3OJUA 4DV3K 1KVCA 4CJKA 3R3LA 5KPZA 3TSQA 2IAJA 1FXXA 3NBPA 4M3ZA 4CHOA 1JL1A 4DU3A 3EE8A 3L4IA 4DTRA 1YF5L 2I7PA 1TV6A 3RMDA 3F2KA 4FL9A 3ZSRA 3DLEA 1L3TA 3MEEA 1HRHA 4CEEA 1WSJA 1W0HA 4NXNK 1HR0K 4JS4A 1OH8A 2PYJA 3CYMA 5AZIA 1VQLN 3CJ9A 4B3RK 3HOTA 1DLOA 1YAGA 1BIZA 2IVOA 2OTJN 3VF2A 3AARA 2OPSA 2I5JA 2FXUA 5GADP 3OA9A 4FJ5A 3KTQA 3WXLA 3U4LA 3CJCA 3MMVA 2O8FA 5ADXA 2ETJA 3AA3A 3PUFA 5AQYA 4BVOA 4BE1A 1LCUA 3VERA 3V1OA 4DTSA 5DM7L 1YXQA 4OPJA 3I0SA 1LW0A 1YTAA 3MX2A 3ZEUA 3THWA 4BQLA 3DRSA 2FF6A 3ENHA 4ILHA 1IKWA 4ICLA 4CFAA 4EP4A 4CE9A 2E6LA 4CJ3A 4BRAA 1TKTA 5AQGA 3CM6A 2VG5A 3D2EA 4DV2K 1NOYA 5J2MA 4DR5K 3J7YP 3O1WA 4DSKA 4A5AA 3JXUA 3CJAA 4CERA 4FWPA 3QEVA 4WYBA 1VK0A 3MWPA 2XY5A 4BVPA 2QM1A 1VHXA 5AQLA 1EETA 3NHGA 1S1VA 4K0KK 1KRPA 1SUQA 3DOKA 3EEQA 1D9FA 1BIUA 1Z05A 4CJ5A 4J2BA 2QK9A 1XMQK 2WOMA 4N47A 5FROA 3ULEB 5D3GA 5HOOA 2LSNA 2E4LA 4DR1K 1HYSA 3CFOA 4FLTA 3CCLN 3RR8A 4IFVA 4R5PA 2QWPA 4KH5A 4AH9A 4EZ6A 3G0ZA 5JLFA 1KVAA 2F4VK 4CESA 1OVQA 3LAMA 3LDNA 4BRCA 2OTLN 4V19S 2XY6A 2P51A 3DXKB 3C7NA 4FLYA 3VN5A 1JCGA 5GAHP 5LL6Z 1TKXA 1YVUA 2VGMA 4FM0A 3DLGA 4H5VA 1FJGK 1W2BM 3C6UA 3L2RA 4K8ZA 1TAQA 3KLGA 3D45A 3EE9A 3CFPA 4Y1CA 1NJYA 5I9EB 3PLAA 3V9XA 4RW7A 2YHAA 1SKSA 4BC3A 3K0SA 4HUGA 1KCFA 4YOWA 2KZZA 4E0DA 3WXJA 4X66K 4ISGA 2D1KA 3L4QA 3VA0A 1RBVA 5KGWA 3ZETB 4BRHA 3CETA 1HNIA 2HBKA 3MX5A 3R1XA 3V1RA 4DV7K 1QHAA 2E2PA 3KZBA 3LP3A 3K9JA 1RTIA 1VQMN 1HJRA 1MA9B 5CHIA 4B1YB 3EYZA 3SPYA 2O4IA 2A3ZA 1NK9A 3H46O 2A5XA 2F9TA 2RF2A 4DSEA 1A5VA 3DRRA 3OYMA 3AGRA 3B6PA 3OBWA 4CJTA 3W3DA 1I94K 2QWQA 2G8HA 1K73O 1GLEG 3SUOA 3EKUA 1YI2N 1U45A 2RKIA 4H4OA 2E88A 2P9KA 4B9QA 2YX6A 4CJ4A 2EWSA 2HMPA 5AQXA 2OZMA 3FLCO 2RN2A 3G10A 1NKBA 2HNDA 2W6KA 2IVPA 4CHQA 1QSLA 2YJEA 4DR4K 3AA5X 3UIQA 4M3RA 2NNWA 4FJ8A 1T8EA 4O5FA 1WBBA 4B8AB 4MLHA 1IG8A 1HUXA 3SUNA 1VQKN 3ZLJA 1SQKA 1N8RO 3P39A 2E2QA 3RVCA 5AQIA 4DSLA 2IVNA 1ASUA 4HUFA 3HT3A 2ZQBA 4AHUA 5F2RA 5CE3A 4WCEL 3BP8A 1JLQA 1IG9A 4CJPA 1BHLA 4KTQA 4JKAA 3GE1A 5HP1A 4MDBA 4C8MA 3GOIA 4C8KA 3DLBA 4DV1K 1JLAA 4JYAK 2DFEA 4OPAA 5B8HA 4NCGA 3M8RA 4IXCA 3CCMN 5E84A 4O4GA 4FJKA 3T7ZA 4H5NA 5EU7A 1P90A 2D4WA 4LH4A 3QIPA 4KV8A 4X65K 5KRTA 4FWSA 4XH5A 4EP5A 2Z1JA 4LD0A 3VMFB 1C0UA 3FE1A 1NU0A 4WE1A 3KKRA 3WEEB 4BE2A 3O80A 4CJEA 3V9SA 3EO3A 1NK4A 4M42A 3UKUB 3R9PA 3MECA 2HHQA 3O9TA 3O4QA 4GMJB 1CZ9A 4FK2A 3I55N 1YHQN 2QWRA 1BOTO 1EQYA 2QKBA 1YJNN 1U49A 2DTUA 2OZSA 2X6NA 3LALA 4CEOA 4QS9A 1VRUA 4LC9B 4IEEA 3KIOA 4M7YA 5A2QO 3VPZA 3KLEA 1K9MO 3IAYA 4CIGA 1NGDA 3VEVA 3ULEA 4IOXA 4IDHA 5AQRA 3MXIA 4E19A 5HLFA 4QCLA 3I56N 1NGHA 1TKZA 3NFAA 4CECA 3QINA 4FJ9A 4DS5A 1FW6A 4CJQA 4HCCA 4OLBA 1N33K 4IKFA 1HQEA 2PZSA 1L3UA 3SAFA 4CGDA 3HPHA 4CJFA 1T6DA 3DXKA 4JRPA 3NGYA 4CD1A 4FPAA 4FWLA 1T7PA 3CJ1A 2HNZA 2UXCK 1VQ5N 5CYMA 2D5RA 3JYTA 3SYZA 2FLOA 3ISNC 1RDCA 4L8RB 1XI1A 3NGIA 4KHYA 2EHGA 3AO2A 3HZ6A 2E1YA 3AAQA 2E1ZA 3O3HA 2ITMA 1VRTA 4MO4A 4FK4A 4KO0A 1I3AA 3O1BA 4CF9A 5M1QA 3A8YA 1S9EA 3FZKA 4IO8A 3LP0A 4BROA 1TGOA 3M1FA 5HRNA 5AQVA 3TSUA 4JK8A 3VESA 2ZF5O 3VQ7A 3ZETA 2YHYA 2FF3B 2QA4N 4CZFA 3NH1A 4ELVA 4I9LA 2HNYA 2Q0UA 3TTCA 3J80O 4HCBA 1X3MA 3SV3A 4E3SA 2B4JA 5ADXH 2B5JA 5DK5A 4LH5A 2P9SB 1K8KB 1A5XA 4CW7B 3OJSA 4EHTA 4IG0A 2VG6A 1GOAA 4FJLA 2Z1IA 3CC7N 3QNOA 4DSJA 3VEXA 5MLCQ 1U47A 5J2NA 4XH4A 4CJRA 4CEFA 4E7IA 1KC8O 3VQCA 2AP1A 4CBUA 3CQ8A 1M1KO 4YY3K 4K25A 4LF4K 4B08A 1DTTA 1Q9YA 2IDOA 2FSKA 4C23A 4W5OA 2Q2RA 3LPUA 4DF4A 1XNRK 3A0IX 4GV9A 5BRFA 3VF6A 4O44A 1HNWK 3L3UA 2HBMA 4ZTFA 3BY5A 3SBGA 3V81A 1ZBLA 1T05A 3K5OA 5KGXA 5E26A 5AQSA 3UB5A 2ZM6K 3R8EA 3AO4A 5DM6L 3O3FA 3AVHA 4Q5VA 1E4FT 3F9KA 3CM5A 1BG3A 3FZMA 1ZBUA 3D2FB 1TUUA 1TYQB 5H1SQ 1WUAA 4CF8A 4FOIA 2J4RA 2CGKA 3ID6A 3SAHA 3DOLA 4H5RA 4JI0K 2UUBK 4GKKK 1BISA 3VEYA 4KH6A 1SL2A 4H0YB 5HL7L 4AQYK 3U9DA 2OPQA 1VSKA 2JWLA 1OH6A 1RT7A 1E4GT 3T1AA 4BR2A 1MDUB 4BRMA 1C1BA 1QSYA 2QEXN 2O8CB 4WF9L 1BQNA 1SKRA 3L3VA 5LMUK 1TVRA 4WFBL 4C1NK 3NVKA 4BRIA 1TL3A 4ID1A 1XUPO 3WEEA 1Q7YO 1OKJA 3GG4A 4B1UB 4MO5A 1V4TA 2DPNA 3UKUA 4CEAA 4BWJA 2GBZA 1JCEA 3O8MA 4YFUA 4A2AA 3TR8A 2F96A 4KHNA 3CC4N 1ZBFA 5HRSA 4CZKA 3QO9A 3QEXA 3KLFA 5GIPA 1JLFA 3OS0A 4ZHRA 2UXDK 1YJ9N 4AHRA 1ESVA 4A62A 3S3MA 4KHWA 4CGIA 1RBRA 1LV5A 4E1NA 3KWIA 2XO7A 1JKHA 1VSDA 4A59A 1NK6A 4AHSA 3ZYYX 3Q7BA 4B9VA 4BC2A 4A57A 2AJQA 1KLNA 2C1IA 2F8SA 4CHYA 3THXB 3VQBA 2JWKA 4KFBA 1S72N 2YV0X 2G8IA 3QBWA 3SQ4A 3H3NO 3HM8A 4KTWA 1A5WA 2Q3SA 4N76A 2YJFA 1G99A 1YTUA 1S1UA 3M8QA 3WUHA 1HKCA 4JI5K 2OPRA 4HHTA 2XHBA 1X1PA 3HBTA 3CPEA 4NB4A 1UA1A 4J2DA 3OBYA 1F21A 4CZLA 3P5JA 3KD5E 3M6GA 1EP4A 2DFFA 3LDSA 1ATSA 4PL7A 5CY4A 3VTHA 1S3XA 1ILYA 5C15A 4I2QA 4HWIA 2ASOA 3RWUA 3IFRA 4N41A 4LF9K 3AO1A 3KLHA 4Z4GA 2Q97A 4ZTJA 1IBLK 1CLQA 3VF4A 3CCVN 2HHVA 2HF4A 1VQ9N 4RCHA 4AM6A 3NGZA 5AZJB 3LWLA 4K43A 1N34K 1BGXT 1X9JA 4CJUA 4J8FA 5BPMA 2OPPA 5GAGP 4M3UA 4ISEA 2P9SA 1K8KA 1D5AA 4KHUA 3OYLA 1ASVA 4OPHA 4B3SK 4PY5A 3WXIA 4DTJA 1NMDA 2YNFA 5JLHA 4IJNA 2XY8A 1NGAA 5BN8A 1D4XA 3P38A 1LAVA 3V9UA 4DKWA 3B6OA 1LOTB 1RDAA 4CJVA 1VAZA 2ZD1A 3N4PA 3HXMA 1R0AA 5AQWA 1Z25A 5DMRA
chains in the Genus database with same CATH topology
4FWQA 2D0OA 4BG9A 2IVPA 3AAPA 2AA4A 3P4IA 2YJEA 3WQTA 4CZEA 1Q86O 2ZJQL 2NNWA 3CCQN 1C0GA 3ZX0A 1VQ4N 4O5FA 2KHOA 5TKYA 3U8XA 2WUSA 3CC2N 4MLHA 4JKDA 4RTFD 3SK3A 4B1VA 4ISFA 4BRFA 2P9LA 5KPRA 1IG8A 5BPNA 1HUXA 2A41A 4CJ7A 4JD2B 1NJIO 1VQKN 3A5OC 2BTFA 2QWNA 1SQKA 5M1NA 1N8RO 3P39A 2E2QA 2V51B 4GY2B 5ELZA 3RVCA 3TTDA 5AQIA 4BC4A 3MK6A 4DQ8A 3UKRA 2IVNA 4YDUC 3I8BA 1TUYA 2A40A 5AFUA 3G6EN 5JVHL 5F2RA 5CE3A 2GELA 5AZIB 4WCEL 3BP8A 4IZ9A 4MLEA 4BR9A 4KH4A 4O8UA 1ZBSA 3D2FA 4U7BA 1TYQA 5M1FA 3EZWA 4CZMA 5FPDA 4JKAA 4BECA 3GE1A 4MDBA 1RGIA 3GOIA 2WFBA 1GLCG 4XH1A 1GLJO 1VQ7N 4OPAA 5LJVA 5B8HA 3CCEN 1QQNA 1HKBA 2C1GA 1ATRA 3CCMN 3DXMB 4IXCA 5E84A 3NVMA 1VQPN 5C2DA 4IOAL 3T7ZA 2YHWA 4H5NA 3MN6A 2GUPA 5BRHA 5LJWA 1YJWN 4XJXA 1ZC6A 3IKMA 1NLVA 3CPWM 2Q31A 4PL8A 5EVZA 3ZX2A 3GBTA 2P9PA 1P90A 2D4WA 2QW9A 4JKFA 5KQDA 1QZ5A 2QWMA 4FWSA 5AQPA 4ILJA 3VOVA 2ZGZA 4XH5A 1Q18A 1C0FA 1QVFM 1BUPA 2QXLA 1HJOA 3CCUN 2BUPA 5AQHA 3VMFB 5FPMA 3ZEUB 3FE1A 2PAVA 2HBJA 2GWJA 3H1QA 3TU5A 4R79A 5EX5A 1U6ZA 2ASMA 5BRDA 3F9MA 4M63C 5GIOA 1QQMA 2VWBA 3LDOA 1T6CA 3WEEB 5AFUH 1JJ2M 3SMSA 2HBLA 3O9QA 3O80A 4DHYA 1NGCA 3EO3A 2IIRA 3UKUB 3SBTA 3R9PA 3SMPA 4YOUA 3D2EB 3O9TA 4IJAA 3I55N 3G25A 4HTLA 1YHQN 2QWRA 3K9KA 4FWOA 4A2BA 2QI2A 4RWTA 1BOTO 2BH1A 3E1YA 2ZJRL 1MWMA 2V52B 3O9UA 1EQYA 1BWFO 1YJNN 1KAZA 3FZFA 2H3GX 4Z94A 2P9NA 4QS9A 4WQ5C 1DT9A 4LC9B 4IEEA 4M7XA 4M7YA 1SAZA 3LDPA 4H03B 3LM9A 3MCAB 3VPZA 4EFHA 5FPEA 1K9MO 3MN9A 4H5WA 4EIAA 3FGUA 1NGDA 4PHTX 3VEVA 4YOXA 3HSCA 4YDUA 1GLLO 3ULEA 3OW2M 1BA1A 4JHDB 4IOXA 4IDHA 5AQRA 1NM1A 4BY9C 2P9UA 3HTVA 3WQUA 4BREA 4BC5A 3C65A 3I56N 1NGHA 4JN4A 3CJ7A 3JS6A 5JMVA 3LDLA 3BEXA 2QTDA 1V4SA 1KAXA 1CZAN 3GDQA 4BRQA 3KWGA 4BR4A 3SAFA 5MLCQ 4NO7A 1T6DA 3QFUA 3EN9A 5AQJA 3DXKA 5JVGL 4CD1A 3ID8A 3D6RA 5M1OA 2P9IB 4FPAA 4FWLA 3CJ1A 3C7NB 1QQOA 3MCPA 1VQ5N 3Q7CA 1OVYA 1QVGM 2FLOA 2YHXA 3FZLA 4IO9L 2CGJA 3LM2A 5FPNA 4CI6A 3J7ZO 3HZ6A 2E1YA 3AAQA 2E1ZA 3E9LA 3VENA 5BREA 3QB0A 2VCPA 2ITMA 4MO4A 3CHWA 2VGNA 3ATVA 4H0VB 1VQON 5JICA 3IUCA 5LY3A 2NLXA 2F9WA 4JKEA 4GNIA 3O1BA 1M90O 3PIOL 5M1QA 5F1XA 1KXPA 2YCHA 3A8YA 3FZKA 3M5RA 3VGLA 1RDWX 4YOYA 1BU6O 1NGFA 4IO8A 3VETA 4BROA 3H6EA 2VYPA 1W97L 4H0OA 3M1FA 3CJBA 3FFKB 3H45C 5BPLA 2E20A 2KLAA 1XC3A 5C10A 1NWKA 5AQVA 3TSUA 4JK8A 3VESA 2ZF5O 5EXWA 2PFUA 3ZETA 4BR5A 5AZJA 2YHYA 2FF3B 3RSEA 2QA4N 4CZFA 4FSVA 1Z6RA 1U2VB 3HI0A 3MDQA 2HSTA 3KVGA 2HF3A 5GAEP 4AM7A 2NRVA 4H0XB 2Q0UA 4WQ4C 3TTCA 3TPQA 1X3MA 3SAGA 3J8AA 3ENOA 2QWLA 4JEPA 4FWKA 5ADXH 4YOVA 5TKWA 2QWOA 2UYTA 4WQ5A 4JKCA 4I6MB 2KKZA 1K8KB 2P9SB 3DWLA 4BRDA 1BO5O 4YOTA 4EHTA 1NBWA 3DLLL 4B1WB 3O9SA 3TTFA 3CC7N 4PKHA 1NGBA 3CI5A 3CERA 4IEIA 3A5MC 2W00A 1H1VA 1P8ZA 4CBXA 3ATUA 3VEXA 4JAXA 4DB3A 2F7TA 3O5BA 4JKGB 4JNEA 4XH4A 5AQTA 4BQZA 3WXKA 1K8AO 2GWKA 5F0XA 3O9RA 2ZWHA 3MWTA 1YIJN 1GLDG 3CQXA 4JKHA 4CZGA 1QZ6A 1WOQA 5EOYA 4PKIA 3O08A 5AQNA 1KC8O 2AP1A 2P9KB 1ZXOA 4CBUA 4CZIA 4B1ZA 2A42A 4FWMA 3QBXA 4WFAL 2D0PA 4GVEA 5AQOA 1NGJA 3WXMB 1M1KO 3VTIA 4K25A 4BRLA 1KAYA 3BF3A 1SZ2A 4B1XB 4C1NI 4BRPA 1HKGA 2FSKA 3O4WA 4H0PA 4C23A 2Q2RA 3R3LA 4G9ZA 5KPZA 3TSQA 2E2OA 3A0IX 2NRHA 5AQUA 4GV9A 1IJJA 5BRFA 3VF6A 4UY8O 4WFNL 3C0BA 4JD2A 3EE8A 3L4IA 2HBMA 2P9LB 4FPBA 5M1PA 3VF2A 3SBGA 4IOCL 1YF5L 2I7PA 4K41A 3F2KA 1Y64A 5AQZA 4BR0A 4FL9A 1NGIA 4CD3A 3I33A 3B8AX 4QS7A 1MWKA 2CH5A 5E26A 2WBNA 5AQSA 1NGGA 3PIPL 3UB5A 1Q81O 3D7EO 4FOEA 3R8EA 2Q1NA 3UKRB 3MN7A 4BRGA 5DM6L 5AZIA 1VQLN 3CJ9A 3VGKA 3HOTA 1E4FT 1YAGA 3BF1A 1T3VA 2IVOA 1BG3A 2OTJN 3A5NC 2YI1A 3FZMA 3D2FB 1RFQA 1TUUA 1TYQB 3AARA 1WUAA 3LDQA 4FOIA 2RE2A 2J4RA 4NLBA 1DEJA 5H1SQ 1JCFA 2CGKA 2ZGYA 3ID6A 4AF1A 5BN9A 3SAHA 2FXUA 4H5RA 3OA9A 5C12A 5GADP 2NRWA 1YITN 3VEYA 4KH6A 3EKSA 3WXLA 1HX1A 3CIPA 3O6WA 4KBOA 3CJCA 3MMVA 4H0YB 3T69A 3U4LA 1KQSM 4DCHA 4FVUA 5HL7L 3DXMA 1GLBG 5C0YA 3U9DA 3L6QA 2JWLA 5ADXA 4CZJA 3VEWA 1E4GT 4F9OA 3L0QA 4BR2A 1S22A 3WT0A 1MDUB 4IWVA 4BRMA 3R6MA 3DAWA 2GX9A 5AQYA 4BVOA 5GINA 1LCUA 2W41A 3OHRA 3EL2A 4JK7A 3VERA 2QEXN 4BGAA 2P9PB 1T44A 2HOEA 3FZHA 4WF9L 2OANA 2ZJPL 3G4SN 2FSNA 4K42A 1YXQA 3GL1A 5DM7L 4MDAA 4NLCA 3MX2A 4WFBL 3ZEUA 4YORA 1Q82O 3CD6N 4C1NK 3NVKA 4BRIA 1YUWA 2CH6A 4H0TB 4BQLA 4BRKA 4ILHA 1SS6A 2FF6A 3ENHA 1XQSC 1XUPO 3WEEA 1Q7YO 1OKJA 3GG4A 4B1UB 4MO5A 1V4TA 2DPNA 3QMLA 4O8KA 3UKUA 4BRAA 4GV6A 5AQGA 3D2EA 1JCEA 3O8MA 3C6AA 4U67L 3H3OB 4XEIA 3CF5L 4A2AA 3CC4N 4CZKA 3SJHA 5BR9A 5GIPA 1VQNN 2NRRA 4H5TA 1BDGA 1YVNA 1ATNA 3AY9A 3M3ZA 4BRNA 3O1WA 3P31A 2NZTA 4A5AA 3BUZB 2CGLA 3AGKA 3JXUA 3CJAA 1YJ9N 5AQQA 1ESVA 4FWRA 4FWPA 4A62A 4WYBA 1X3NA 2P9NB 4BE7B 3MWPA 4BVPA 2QM1A 1GLAG 5AQLA 2NRXA 1RDUA 3QICA 3KHYA 5CR4A 1Z05A 3CQYA 3KWIA 4JHDA 1DKGD 3H1VX 3U9ZA 1J6ZA 4CZHA 4A59A 1HPMA 3ULEB 2NRTA 5HOOA 4GV3A 5C2FA 3DJCA 3G71N 2P9UB 2PBDA 3ZYYX 4OO1J 3Q7BA 4BC2A 3F5TA 4A57A 3CCLN 2C1IA 4PKGA 1BA0A 3QDKA 5EY4A 2QWPA 4KH5A 5JLFA 1KD1O 1VQ8N 3E9PA 2JWKA 4BR7A 3LDNA 4BRCA 3CCRN 2OTLN 1S72N 2P9IA 3QBWA 4BGBA 3CMAN 3DXKB 4QS8A 3C7NA 1EO1A 3H3NO 2GEMA 3HM8A 4ILGB 4A61A 1JCGA 5GAHP 3UE5A 2Q36A 3C6HA 3CXCM 2YJFA 3IMXA 1G99A 2VGMA 1VQ6N 3WUHA 2Q0RA 5KPTA 1HKCA 1O13A 4H5VA 3HBTA 3CPEA 4NB4A 3VGMA 1W2BM 3N4QA 1DGKN 3OBYA 3VEZA 2WC9A 4CZLA 3EE9A 3M6GA 3IDHA 4CBWA 5I9EB 5KQ8A 3PLAA 2V7ZA 4EAHD 4JK9A 1ATSA 3VEOA 3VTHA 2W40A 4PL7A 1S3XA 3TSPA 3S41A 5M1KA 1ILYA 2GTDA 4BC3A 5C15A 4YOWA 4HWIA 3CCSN 2ASOA 3IFRA 3KK7A 3ENBA 3LL3A 2NRZA 2E2NA 3WXJA 2Q97A 4ISGA 2D1KA 3L4QA 2V7YA 3VF4A 3CCVN 4Y0WA 5AQKA 1U2VA 2HF4A 1VQ9N 4RCHA 4AM6A 3ZETB 4BRHA 5AZJB 3CETA 2RHKA 3A5LC 4K43A 1GLFO 1X9JA 2HBKA 3MX5A 3R1XA 3RSEB 3SLCA 2A6AA 1QHAA 4J8FA 4FWNA 5AQMA 4EHUA 2E2PA 3KZBA 5BPMA 5GAGP 3K9JA 1VQMN 1MA9B 5CHIA 4WQ4A 4ISEA 4I6MA 3HRGA 3HOSA 2P9SA 1K8KA 3E9OA 2FSJA 4B1YB 4E1JA 2A3ZA 3H46O 5AR0A 2A5XA 4OPHA 2F9TA 4FO0A 3WXIA 1NMDA 2ASPA 5JLHA 4IJNA 3MN5A 1HLUA 4IFEA 3E66A 2I7NA 3AGRA 3OBWA 1NGAA 4JKGA 3W3DA 2QWQA 2E8AA 3QFPA 5BN8A 1K73O 4BEBA 1D4XA 1GLEG 1NGEA 3EKUA 3P38A 1YI2N 3CMEN 5AQFA 4L3QA 4DKWA 3NMUA 1R59O 1LOTB 3CCJN 2E88A 3W0LA 1VAZA 4A5BA 2P9KA 4B9QA 3N4PA 2YX6A 4BG8A 2EWSA 2HMPA 4JKBA 5AQXA 3FR0A 3FLCO 3ZX3A 5AQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FWQ A;  2D0O A;  4BG9 A;  2IVP A;  3AAP A;  2AA4 A;  3P4I A;  2YJE A;  3WQT A;  4CZE A;  1C0G A;  3ZX0 A;  4O5F A;  2KHO A;  5TKY A;  3U8X A;  2WUS A;  4MLH A;  4RTF D;  3SK3 A;  4B1V A;  4ISF A;  4BRF A;  2P9L A;  5KPR A;  1IG8 A;  5BPN A;  1HUX A;  2A41 A;  4CJ7 A;  4JD2 B;  3A5O C;  2BTF A;  2QWN A;  1SQK A;  2E2Q A;  2V51 B;  4GY2 B;  5ELZ A;  4BC4 A;  5AQI A;  3MK6 A;  4DQ8 A;  3UKR A;  2IVN A;  4YDU C;  3I8B A;  1TUY A;  2A40 A;  5AFU A;  5F2R A;  5CE3 A;  2GEL A;  5AZI B;  3BP8 A;  4IZ9 A;  4MLE A;  4BR9 A;  1ZBS A;  3D2F A;  1TYQ A;  3EZW A;  4CZM A;  5FPD A;  3GE1 A;  1RGI A;  3GOI A;  1GLC G;  4XH1 A;  1GLJ O;  5LJV A;  5B8H A;  1QQN A;  1HKB A;  1ATR A;  3DXM B;  4IXC A;  5E84 A;  2YHW A;  4H5N A;  3MN6 A;  2GUP A;  5BRH A;  5LJW A;  1ZC6 A;  1NLV A;  2Q31 A;  4PL8 A;  5EVZ A;  3ZX2 A;  3GBT A;  2D4W A;  2P9P A;  2QW9 A;  5KQD A;  1QZ5 A;  2QWM A;  4FWS A;  5AQP A;  3VOV A;  2ZGZ A;  4XH5 A;  1Q18 A;  1C0F A;  1BUP A;  2QXL A;  1HJO A;  2BUP A;  5AQH A;  5FPM A;  3ZEU B;  3FE1 A;  2PAV A;  3H1Q A;  2GWJ A;  3TU5 A;  5EX5 A;  1U6Z A;  2ASM A;  5BRD A;  3F9M A;  4M63 C;  1QQM A;  2VWB A;  3LDO A;  1T6C A;  3WEE B;  5AFU H;  3SMS A;  3O80 A;  4DHY A;  1NGC A;  3EO3 A;  2IIR A;  3UKU B;  3R9P A;  3SMP A;  3D2E B;  4IJA A;  3G25 A;  4HTL A;  2QWR A;  4A2B A;  4FWO A;  4RWT A;  1BOT O;  1MWM A;  2V52 B;  1EQY A;  1BWF O;  1KAZ A;  3FZF A;  2H3G X;  4Z94 A;  2P9N A;  4QS9 A;  4WQ5 C;  4LC9 B;  4M7X A;  4M7Y A;  1SAZ A;  3LDP A;  4H03 B;  3LM9 A;  3VPZ A;  4EFH A;  5FPE A;  3MN9 A;  4H5W A;  4EIA A;  3FGU A;  1NGD A;  3VEV A;  3HSC A;  4YDU A;  1GLL O;  3ULE A;  1BA1 A;  4JHD B;  5AQR A;  1NM1 A;  2P9U A;  3HTV A;  3WQU A;  4BRE A;  4BC5 A;  1NGH A;  4JN4 A;  3CJ7 A;  3JS6 A;  5JMV A;  3LDL A;  3BEX A;  1V4S A;  1KAX A;  1CZA N;  3GDQ A;  4BRQ A;  4BR4 A;  4NO7 A;  1T6D A;  3QFU A;  3EN9 A;  5AQJ A;  3DXK A;  4CD1 A;  3ID8 A;  2P9I B;  4FPA A;  4FWL A;  3CJ1 A;  3C7N B;  1QQO A;  3MCP A;  2FLO A;  2YHX A;  3FZL A;  2CGJ A;  3LM2 A;  5FPN A;  4CI6 A;  3HZ6 A;  2E1Y A;  3AAQ A;  2E1Z A;  5BRE A;  3VEN A;  3QB0 A;  2VCP A;  2ITM A;  4MO4 A;  3CHW A;  3ATV A;  4H0V B;  5JIC A;  3IUC A;  5LY3 A;  2NLX A;  2F9W A;  4GNI A;  3O1B A;  5F1X A;  1KXP A;  2YCH A;  3A8Y A;  3FZK A;  3VGL A;  1RDW X;  1BU6 O;  1NGF A;  4IO8 A;  3VET A;  4BRO A;  3H6E A;  2VYP A;  4H0O A;  3M1F A;  3CJB A;  3FFK B;  3H45 C;  5BPL A;  2E20 A;  1XC3 A;  1NWK A;  5AQV A;  3VES A;  2ZF5 O;  5EXW A;  3ZET A;  4BR5 A;  5AZJ A;  2YHY A;  2FF3 B;  3RSE A;  4CZF A;  4FSV A;  1Z6R A;  1U2V B;  3HI0 A;  3MDQ A;  3KVG A;  2HF3 A;  4AM7 A;  4H0X B;  2Q0U A;  4WQ4 C;  3TPQ A;  1X3M A;  3J8A A;  3ENO A;  2QWL A;  4FWK A;  5ADX H;  2QWO A;  2UYT A;  4WQ5 A;  4I6M B;  2P9S B;  1K8K B;  3DWL A;  4BRD A;  1BO5 O;  4EHT A;  1NBW A;  4B1W B;  4PKH A;  1NGB A;  3CI5 A;  3CER A;  3A5M C;  1H1V A;  1P8Z A;  4CBX A;  3ATU A;  3VEX A;  4JAX A;  4DB3 A;  4JNE A;  3O5B A;  4XH4 A;  5AQT A;  4BQZ A;  3WXK A;  2GWK A;  5F0X A;  2ZWH A;  1GLD G;  3CQX A;  4CZG A;  1QZ6 A;  1WOQ A;  5EOY A;  4PKI A;  3O08 A;  5AQN A;  2AP1 A;  2P9K B;  1ZXO A;  4CBU A;  4CZI A;  4B1Z A;  2A42 A;  4FWM A;  3QBX A;  2D0P A;  5AQO A;  1NGJ A;  4K25 A;  4BRL A;  1KAY A;  3BF3 A;  1SZ2 A;  4B1X B;  4BRP A;  1HKG A;  2FSK A;  3O4W A;  4H0P A;  4C23 A;  2Q2R A;  5KPZ A;  2E2O A;  3A0I X;  2NRH A;  5AQU A;  1IJJ A;  5BRF A;  3VF6 A;  3C0B A;  4JD2 A;  3L4I A;  4FPB A;  2P9L B;  2I7P A;  4K41 A;  1Y64 A;  5AQZ A;  4BR0 A;  4FL9 A;  1NGI A;  4CD3 A;  3I33 A;  3B8A X;  4QS7 A;  1MWK A;  2CH5 A;  5E26 A;  5AQS A;  1NGG A;  3UB5 A;  3D7E O;  4FOE A;  3R8E A;  2Q1N A;  3UKR B;  3MN7 A;  4BRG A;  5AZI A;  3CJ9 A;  3VGK A;  1E4F T;  1YAG A;  3BF1 A;  2IVO A;  1BG3 A;  3A5N C;  2YI1 A;  3FZM A;  3D2F B;  1RFQ A;  1TUU A;  1TYQ B;  3AAR A;  1WUA A;  3LDQ A;  4FOI A;  3VF2 A;  2J4R A;  1DEJ A;  1JCF A;  2CGK A;  2ZGY A;  5BN9 A;  2FXU A;  4H5R A;  3VEY A;  3WXL A;  3EKS A;  1HX1 A;  3CIP A;  3O6W A;  4KBO A;  3CJC A;  3MMV A;  4H0Y B;  3U4L A;  4DCH A;  3DXM A;  1GLB G;  3U9D A;  3L6Q A;  5ADX A;  4CZJ A;  3VEW A;  1E4G T;  4F9O A;  3L0Q A;  4BR2 A;  1S22 A;  3WT0 A;  1MDU B;  4IWV A;  4BRM A;  3R6M A;  3DAW A;  5AQY A;  4BVO A;  1LCU A;  2W41 A;  3OHR A;  3EL2 A;  3VER A;  4BGA A;  2P9P B;  1T44 A;  2HOE A;  3FZH A;  2OAN A;  2FSN A;  4K42 A;  1YXQ A;  3GL1 A;  3ZEU A;  4BRI A;  1YUW A;  2CH6 A;  4H0T B;  4BQL A;  4BRK A;  2FF6 A;  3ENH A;  1XQS C;  1XUP O;  3WEE A;  1OKJ A;  3GG4 A;  4B1U B;  4MO5 A;  1V4T A;  2DPN A;  3QML A;  4O8K A;  3UKU A;  4BRA A;  5AQG A;  3D2E A;  1JCE A;  3O8M A;  3H3O B;  4XEI A;  4A2A A;  4CZK A;  3SJH A;  5BR9 A;  4H5T A;  1BDG A;  1YVN A;  1ATN A;  3AY9 A;  3M3Z A;  4BRN A;  3O1W A;  2NZT A;  3BUZ B;  2CGL A;  3JXU A;  3CJA A;  5AQQ A;  1ESV A;  4FWR A;  4FWP A;  4A62 A;  4WYB A;  1X3N A;  2P9N B;  4BVP A;  2QM1 A;  1GLA G;  5AQL A;  3QIC A;  3KHY A;  1Z05 A;  3CQY A;  4JHD A;  1DKG D;  3H1V X;  3U9Z A;  1J6Z A;  4CZH A;  1HPM A;  3ULE B;  3DJC A;  2P9U B;  2PBD A;  4BC2 A;  4PKG A;  1BA0 A;  3QDK A;  5EY4 A;  2QWP A;  5JLF A;  4BR7 A;  3LDN A;  4BRC A;  2P9I A;  3QBW A;  4BGB A;  3DXK B;  4QS8 A;  3C7N A;  3H3N O;  2GEM A;  3HM8 A;  4A61 A;  1JCG A;  3UE5 A;  2Q36 A;  2YJF A;  3IMX A;  1G99 A;  3WUH A;  2Q0R A;  5KPT A;  1HKC A;  4H5V A;  3HBT A;  3VGM A;  4NB4 A;  1DGK N;  3VEZ A;  4CZL A;  3M6G A;  3IDH A;  4CBW A;  5I9E B;  5KQ8 A;  2V7Z A;  4EAH D;  1ATS A;  3VEO A;  4PL7 A;  2W40 A;  1S3X A;  3S41 A;  2GTD A;  4BC3 A;  4HWI A;  2ASO A;  3IFR A;  3LL3 A;  2E2N A;  3WXJ A;  2Q97 A;  4ISG A;  2D1K A;  2V7Y A;  3VF4 A;  4Y0W A;  5AQK A;  1U2V A;  2HF4 A;  4RCH A;  4AM6 A;  3ZET B;  4BRH A;  5AZJ B;  3CET A;  3A5L C;  4K43 A;  1GLF O;  1X9J A;  3RSE B;  3SLC A;  2A6A A;  1QHA A;  4J8F A;  4FWN A;  5AQM A;  4EHU A;  2E2P A;  3KZB A;  5BPM A;  1MA9 B;  4WQ4 A;  4ISE A;  4I6M A;  2P9S A;  1K8K A;  2FSJ A;  4B1Y B;  4E1J A;  2A3Z A;  3H46 O;  5AR0 A;  2A5X A;  2F9T A;  4FO0 A;  3WXI A;  1NMD A;  2ASP A;  5JLH A;  4IJN A;  3MN5 A;  1HLU A;  2I7N A;  1NGA A;  3W3D A;  2QWQ A;  2E8A A;  3QFP A;  5BN8 A;  1D4X A;  1GLE G;  1NGE A;  3EKU A;  5AQF A;  4L3Q A;  1R59 O;  1LOT B;  2E88 A;  3W0L A;  2P9K A;  4B9Q A;  4BG8 A;  2EWS A;  2HMP A;  5AQX A;  3FR0 A;  3FLC O;  3ZX3 A;  5AQW A; 
#chains in the Genus database with same CATH topology
 3HPO A;  4BG9 A;  4CZE A;  3WQT A;  1Q86 O;  4HUE A;  3CCQ N;  1C0G A;  3RMB A;  4DTM A;  1C0T A;  4DR3 K;  5TKY A;  3AVF A;  3CC2 N;  4X64 K;  4B1V A;  4ISF A;  4BRF A;  1B9F A;  2A41 A;  4FLZ A;  4E7H A;  2FBT A;  4MFB A;  2BTF A;  3PO5 A;  5IWA K;  4KI6 A;  5T7B A;  3OYH A;  3MK6 A;  4DQR A;  3VQQ A;  1BCM A;  4CIF A;  4OJR A;  1RT3 A;  2O8E B;  2YKM A;  2PYL A;  3V9W A;  1IKV A;  4IZ9 A;  3LAN A;  4E7K A;  1ZBS A;  3D2F A;  4NXM K;  1TYQ A;  4U7B A;  4CK1 A;  5M1F A;  4CZM A;  4BEC A;  1EWR A;  1RGI A;  1EKE A;  1MU2 A;  1GLJ O;  2IS3 A;  4TSX A;  4M3X A;  2C1G A;  3C6T A;  2FBY A;  1VQP N;  4CVN E;  3SQ1 A;  4JI8 K;  5C2D A;  2KQ2 A;  2VWK A;  5LJW A;  1YJW N;  3QET A;  2Q31 A;  1TK5 A;  3GBT A;  4C8N A;  2O8C A;  4JKF A;  5KQD A;  3VQ4 A;  3ZSW A;  1B9D A;  1C0F A;  1HJO A;  4FXD A;  4M45 A;  4FVM A;  3PY8 A;  1JL2 A;  2PAV A;  3H1Q A;  1S1T A;  3TU5 A;  4R79 A;  5EX5 A;  1U6Z A;  3CG7 A;  5BRD A;  2O8B B;  4M63 C;  3VA3 A;  1QQM A;  2VWB A;  3QES A;  5AFU H;  1SKW A;  1WLJ A;  1NGC A;  2IIR A;  3VQ8 A;  1GOC A;  3SMP A;  1RCH A;  4DQI A;  1RIL A;  4FJJ A;  3G25 A;  4HTL A;  4A2B A;  2QI2 A;  3S5T A;  4CEB A;  4RWT A;  3AVK A;  2BH1 A;  3E1Y A;  1RNH A;  3L2V A;  4JV5 K;  3O9U A;  4DUY K;  2HHU A;  3HO1 A;  2KFZ A;  1RT4 A;  4M7X A;  1SAZ A;  3LM9 A;  3V6D A;  4EFH A;  5HRP A;  4EIA A;  4PHT X;  3HSC A;  4YDU A;  4JLH A;  3MXJ A;  4DLE A;  1UOC A;  4KI4 A;  1BA1 A;  4JHD B;  3NF6 A;  4LFB K;  5KTQ A;  4BY9 C;  3HTV A;  4BC5 A;  4CJW A;  4OPK A;  5HRO A;  4JN4 A;  1VSE A;  3JS6 A;  4DR2 K;  3LDL A;  3MEG A;  1V4S A;  1KAX A;  3QIO A;  1KVB A;  3THX A;  1N5Y A;  4W5N A;  4NO7 A;  1OH7 A;  3QFU A;  5JVG L;  3RMC A;  3FFI A;  3BGR A;  4CGF A;  1QQO A;  3AVI A;  1RT1 A;  5FRM A;  3TAE A;  3ZT0 A;  1RTJ A;  4CJL A;  1QVG M;  3FZL A;  4LF6 K;  2GV9 A;  4IO9 L;  3AVL A;  4CHP A;  3LM2 A;  1QSS A;  5FPN A;  3J7Z O;  1QTM A;  3E9L A;  5C24 A;  2BDP A;  2VGN A;  3ATV A;  3NF7 A;  4H0V B;  5JIC A;  1HYV A;  4B8C A;  3TAG A;  2F9W A;  1M90 O;  3PIO L;  4YHH K;  3M5R A;  3VET A;  2VYP A;  2VWJ A;  4KKO A;  3CJB A;  3KK3 A;  1XC3 A;  1HPZ A;  1QHT A;  5C42 A;  2JLE A;  4BR5 A;  5AZJ A;  4C8O A;  3HI0 A;  4DFP A;  4H0X B;  4CF1 A;  3ENO A;  2QWL A;  4JEP A;  2QWO A;  4WQ5 A;  3LP2 A;  4JKC A;  4B9L A;  3DRP A;  3LZI A;  3DLL L;  3L8B A;  3HP6 A;  1NGB A;  3CER A;  1IV0 A;  3A5M C;  2W00 A;  4CBX A;  4ELT A;  2D0B A;  3ATU A;  4JAX A;  4ELU A;  4JNE A;  3O5B A;  4JKG B;  4BQZ A;  5F0X A;  5JS1 A;  2PY5 A;  1GLD G;  4NYN A;  1QZ6 A;  4PKI A;  3O08 A;  4DTO A;  1EXQ A;  4FJ7 A;  4DTU A;  4DFM A;  4FWM A;  3QBX A;  2D0P A;  5AQO A;  3WXM B;  3TAM A;  3NF8 A;  4DR6 K;  3BF3 A;  1SZ2 A;  4B1X B;  3ZSX A;  5AJ3 K;  3M8P A;  1HKG A;  4H0P A;  4G9Z A;  1L3S A;  2E2O A;  2EX3 A;  3OYK A;  1RBS A;  1IJJ A;  4WFN L;  4O0J A;  2QKK A;  4FZY A;  4JI4 K;  2P9L B;  4IOC L;  1Y64 A;  5AQZ A;  1NGI A;  3B8A X;  4QS7 A;  1EWQ A;  3AA2 A;  2WBN A;  1NGG A;  3PIP L;  4FZX C;  4H8K A;  4Z0U A;  2Q1N A;  1J54 A;  3ALY A;  3OVN A;  3UKR B;  1S6P A;  2O8E A;  1S1W A;  3MXM A;  3HVR A;  5KI6 A;  1HNX K;  1T3V A;  1ITG A;  3A5N C;  1FKP A;  4CFC A;  3SJJ A;  3LDQ A;  2ITG A;  1DEJ A;  4CF0 A;  1JCF A;  3KKS A;  5BN9 A;  3VQP A;  2HHI A;  2NRW A;  1YIT N;  3EKS A;  3CIP A;  3O6W A;  4KBO A;  4K8X A;  1WNS A;  1KQS M;  4DCH A;  4CZJ A;  3C95 A;  3VEW A;  3L0Q A;  1S22 A;  3WT0 A;  4IWV A;  4QOZ B;  1X9M A;  1GOB A;  2P9P B;  4JRQ A;  2ZJP L;  2HHW A;  3G4S N;  4K42 A;  1RTD A;  3GL1 A;  4MDA A;  1Y97 A;  2HB5 A;  1Q82 O;  4YOR A;  3S3O A;  1YUW A;  2CH6 A;  4GVM A;  4BRK A;  1SS6 A;  4PUO A;  2O8B A;  4HTU A;  1XQS C;  1HNZ K;  2IGI A;  3QML A;  4O8K A;  1N36 K;  4GV6 A;  3QEI A;  4JS5 A;  4JI1 K;  2ATQ A;  2YKN A;  3C6A A;  4U67 L;  3H3O B;  4DR7 K;  3AVB A;  1XHZ A;  4LSL A;  3QEW A;  1UWB A;  4BAC A;  4CED A;  5BR9 A;  1BDG A;  1YVN A;  3M3Z A;  5K14 A;  4BRN A;  2HVH A;  4B9M A;  1RBT A;  3AGK A;  1ZBI A;  5AQQ A;  2YHB A;  1X3N A;  3AVG A;  2P9N B;  4BE7 B;  3HJF A;  2IOC A;  1GLA G;  1E3M A;  1RDU A;  2NRX A;  3QIC A;  3CFR A;  5CR4 A;  4JHD A;  5FDL A;  3U9Z A;  4CFB A;  5JS2 A;  4CZH A;  2NRT A;  5C2F A;  3DJC A;  3SQ2 A;  2P9U B;  2PBD A;  1NK7 A;  2VQF K;  4FM1 A;  1KSP A;  4PKG A;  1BA0 A;  4KHQ A;  5EY4 A;  3KLI A;  1KD1 O;  4KTZ A;  5E41 A;  3E9P A;  3CCR N;  2VG7 A;  4DQQ A;  1CXQ A;  1Q8I A;  3ZSQ A;  1KLM A;  4BGB A;  1EO1 A;  2GEM A;  3NE6 A;  3HVT A;  3L2Q A;  3THY B;  1LWF A;  3C6H A;  2W42 A;  4NCA A;  3CXC M;  4JI6 K;  5KPT A;  1XWL A;  4E89 A;  4FJI A;  1O13 A;  3TAQ A;  3QNN A;  1DGK N;  3VEZ A;  2WC9 A;  3MED A;  3LWM A;  3IDH A;  4CBW A;  3L2U A;  5KQ8 A;  4EAH D;  4AHC A;  3S41 A;  3SUQ A;  4FYD A;  3CCS N;  1U48 A;  3T1Y K;  3RTV A;  3WNH A;  3OYI A;  2NRZ A;  2E2N A;  4BDZ A;  3QLH A;  4Y0W A;  5AQK A;  3ZT1 A;  3TWH A;  2JGU A;  4PA1 A;  2RHK A;  3A5L C;  4RW6 A;  3U6F A;  2A6A A;  4FJX A;  4EHU A;  3D0P A;  2WTU A;  1TK8 A;  1VSJ A;  4WQ4 A;  3HOS A;  3HRG A;  4BDY A;  1HMV A;  4DU1 A;  4E1J A;  4KRE A;  4F2R A;  1U04 A;  4LY7 A;  5AR0 A;  4FO0 A;  3CYG A;  3MN5 A;  1HLU A;  4IFE A;  3E66 A;  2I7N A;  4Y1D A;  4I7F A;  4JKG A;  3NH0 A;  1NGE A;  4B3T K;  1XNQ K;  1NK8 A;  4L3Q A;  3OY9 A;  1R59 O;  2FC0 A;  3CCJ N;  4OKK A;  4CCH A;  3W0L A;  4A5B A;  4FJN A;  4J2A A;  4FW1 A;  3SZ2 A;  4W5R A;  3FR0 A;  1W7A A;  2OYQ A;  3ZX3 A;  2Y1I A;  4KB1 A;  4FCY A;  1FK9 A;  1CZB A;  4FWQ A;  2D0O A;  3AAP A;  5SWM A;  4FJH A;  1ZBH A;  1WSI A;  4FLW A;  3U8X A;  2P1J A;  4JKD A;  4RTF D;  2P9L A;  5BPN A;  4JD2 B;  1IKY A;  5M1N A;  4B9S A;  2V51 B;  1HNV A;  5ELZ A;  4RG8 A;  3TTD A;  3PO4 A;  3UKR A;  5CYQ A;  3G6E N;  4E7L A;  3DMJ A;  2E5L K;  1RTH A;  3K57 A;  2RPI A;  4FJG A;  4B3O A;  5FPD A;  5FRN A;  4ID5 A;  1RT6 A;  2UUC K;  1GLC G;  5BR8 K;  4XH1 A;  4RW9 A;  4CF2 A;  1UAX A;  5LJV A;  1XHX A;  3CCE N;  4IG3 A;  1ATR A;  3DXM B;  4DG1 A;  4H4M A;  2GUP A;  4DTN A;  2G8F A;  1ZC6 A;  4LF5 K;  3IKM A;  1NLV A;  3CPW M;  4PL8 A;  3ITH A;  5EVZ A;  3ZX2 A;  4W5T A;  2P9P A;  1QZ5 A;  2DFH A;  1VSI A;  2QWM A;  4B9N A;  5AQP A;  4ILJ A;  1QVF M;  3ZSY A;  2QXL A;  3PX4 A;  2B6A A;  3DLK A;  5FPM A;  2HBJ A;  1C6V A;  3KD1 E;  3LDO A;  1T6C A;  3NF9 A;  3SMS A;  2BE2 A;  5SZT A;  2HBL A;  4DHY A;  3AVC A;  3SBT A;  1WN7 A;  1WSF A;  4YOU A;  1D9D A;  1LAW A;  2YNG A;  4IJA A;  3SQ0 A;  3PSF A;  1TK0 A;  1D8Y A;  4OKE A;  3ZSV A;  4LF7 K;  4DU4 A;  3IG1 A;  3F73 A;  1C0M A;  4CK3 A;  4LF8 K;  5C25 A;  2H3G X;  4DSF A;  2P9N A;  4JI3 K;  3BZC A;  4KPY A;  3QER A;  3MCA B;  2P5O A;  4DLG A;  2O4G A;  4H5W A;  1GLL O;  3OW2 M;  4AHT A;  4DTP A;  2P9U A;  1L3V A;  3WQU A;  3OYE A;  2QXF A;  3TAR A;  5CZ1 A;  3CJ7 A;  5JMV A;  2QTD A;  1CZA N;  4Z4F A;  3GDQ A;  4IBN A;  3WNE A;  3KWG A;  3DM2 A;  3ASM A;  3AO5 A;  1ZYQ A;  3SI6 A;  2F8T A;  4Z4C A;  5M1O A;  2P9I B;  3THY A;  3VQ5 A;  2HVI A;  3TAN A;  1RDB A;  2YHX A;  2HW3 A;  4NYF A;  1S6Q A;  3TI0 A;  3NAE A;  3TAB A;  5BRE A;  3VEN A;  1NG9 A;  1LWE A;  2HHH K;  3OTO K;  1C1C A;  1X9S A;  3IUC A;  3LAK A;  4JKE A;  4GNI A;  5F1X A;  3DLH A;  2YCH A;  3E01 A;  1LW2 A;  4YOY A;  1RDW X;  1W97 L;  3AV9 A;  1XMO K;  4DQP A;  3FFK B;  3H45 C;  4RW8 A;  2HHT A;  2KLA A;  4CEQ A;  1NWK A;  1IBM K;  3IS9 A;  4YNQ A;  4DV5 K;  3VQD A;  3PX6 A;  1Z6R A;  1U2V B;  3KVG A;  5GAE P;  2HF3 A;  1KTQ A;  4WQ4 C;  4DQS A;  2XRI A;  3J8A A;  3SNN A;  4YOV A;  3K5N A;  2UYT A;  3AVA A;  3WNF A;  4I6M B;  4PWD A;  3DWL A;  4QAG A;  3K59 A;  3LP1 A;  2A1R A;  4PKH A;  3VQ6 A;  4IEI A;  4M41 A;  1H1V A;  1P8Z A;  2UXB K;  1WAF A;  1K8A O;  1NOZ A;  3WXK A;  3VQE A;  1J5O A;  3O9R A;  3MWT A;  2VQE K;  2YNI A;  5JEN A;  3CQX A;  1WOQ A;  5EOY A;  4CZI A;  4B1Z A;  1LWC A;  3U3G A;  1RDD A;  1NGJ A;  2ZE2 A;  4BRL A;  1KAY A;  4E72 A;  4W5Q A;  4BRP A;  1TL1 A;  1WSE A;  3O4W A;  2P5G A;  4UQG A;  4OVL A;  2NRH A;  5AQU A;  1NK0 A;  2G8W A;  4UY8 O;  2X6S A;  1NMN A;  3C0B A;  4Z4E A;  4JD2 A;  4FPB A;  5M1P A;  4K41 A;  2Y1J A;  4BR0 A;  2BAN A;  4CD3 A;  3EZ5 A;  4B9U A;  3I33 A;  1MWK A;  2CH5 A;  3LZJ A;  4M3Y A;  3V1Q A;  2KZM A;  3S9H A;  1TKD A;  1Q81 O;  3D7E O;  4FOE A;  4CGJ A;  3MN7 A;  4BRG A;  3DLR A;  3S3N A;  3VGK A;  3OYA A;  1L5U A;  3BF1 A;  2YI1 A;  3C94 A;  4IFY A;  1RFQ A;  1IO2 A;  4NLB A;  2OA8 A;  1BL3 A;  2RE2 A;  3KK2 A;  4B3M K;  1K6Y A;  1BI4 A;  2ZGY A;  4AF1 A;  3ZT3 A;  3AVN A;  5C12 A;  3PX0 A;  1VSM A;  3THV A;  1HX1 A;  1Z26 A;  3T69 A;  1IH7 A;  4FVU A;  3DXM A;  1GLB G;  5C0Y A;  3NDK A;  3I8D A;  4BDP A;  2DY4 A;  4FW2 A;  2X78 A;  3L6Q A;  3RMA A;  3JAM O;  4KAZ A;  4F9O A;  1RBU A;  4O55 A;  5HBM A;  3R6M A;  3DAW A;  2GX9 A;  5GIN A;  1DTQ A;  2W41 A;  3OHR A;  3EL2 A;  4JK7 A;  1JLE A;  4BGA A;  2D0A A;  1T44 A;  2HOE A;  3FZH A;  2OAN A;  4CIE A;  4I2P A;  2FSN A;  4FLV A;  3IRX A;  2G8U A;  4NLC A;  1S9G A;  3CD6 N;  1QE1 A;  4H0T B;  1C1A A;  2XY7 A;  3SCX A;  3BZK A;  4NCB A;  1REV A;  1WSG A;  4E7J A;  3LPT A;  3VQ9 A;  2HHS A;  4LFA K;  4XEI A;  3CF5 L;  3U3Y A;  2OCE A;  3SJH A;  4KHP K;  1VQN N;  4CGH A;  2NRR A;  4H5T A;  3AY9 A;  1ATN A;  4KRF A;  4F4K A;  3P31 A;  2NZT A;  3OYC A;  3BUZ B;  2CGL A;  1Q9X A;  4FWR A;  3HST B;  4RW4 A;  4BWM A;  1NKC A;  1KFD A;  3KHY A;  4FLX A;  3CQY A;  1IBK K;  1DKG D;  3H1V X;  4CK2 A;  1J6Z A;  3J81 O;  1HPM A;  2FBX A;  4GV3 A;  2O8D B;  3G71 N;  4OO1 J;  3F5T A;  1NK5 A;  1SV5 A;  1J5E K;  1NKE A;  2G8V A;  3HL8 A;  3QDK A;  4F3T A;  3SPZ A;  3HYF A;  4CEZ A;  1VQ8 N;  3K2P A;  4BR7 A;  4AHV A;  1YT3 A;  4GW6 A;  3SUP A;  5CZ2 A;  4OX9 K;  4BE0 A;  2P9I A;  3NH2 A;  3CMA N;  4QS8 A;  5J2Q A;  4ILG B;  4CHN A;  1WB9 A;  3A2F A;  1JLC A;  4A61 A;  2W6L A;  3UE5 A;  3OYB A;  2Q36 A;  5HRR A;  3IMX A;  1VQ6 N;  2Q0R A;  5LMN K;  1RT5 A;  3VGM A;  4DFJ A;  3N4Q A;  2G8K A;  3AVJ A;  4DTX A;  2V7Z A;  1CXU A;  4JK9 A;  2WON A;  3VEO A;  4CHZ A;  2W40 A;  3TSP A;  3ULD A;  5M1K A;  3ZT4 A;  3ZT2 A;  2GTD A;  3PV8 A;  1UA0 A;  3KK7 A;  1WBD A;  3ENB A;  3LL3 A;  1B92 A;  3DI6 A;  3K5M A;  3NCI A;  2V7Y A;  1SL0 A;  1U2V A;  2R7Y A;  3RSE B;  1W9H A;  1GLF O;  3SLC A;  3OYG A;  2D0C A;  2FBV A;  1G15 A;  4DV4 K;  3OS2 A;  4FWN A;  5AQM A;  1EX4 A;  3KJV A;  3T3F A;  1NJZ A;  1NJX A;  4JI2 K;  4I6M A;  1HQU A;  3M8S A;  3E9O A;  2FSJ A;  1SL1 A;  3RRH A;  4Q0B A;  4I9Q A;  3V4I A;  3QEP A;  2ASP A;  3WNG A;  4OGE A;  4CFD A;  3QFP A;  2E8A A;  4BEB A;  4O5B A;  3AO3 A;  3CME N;  1J53 A;  5AQF A;  4Z4H A;  3NMU A;  3MAQ A;  1TAU A;  4FZZ A;  1FKO A;  4BG8 A;  4JKB A;  4M3T A;  1VSH A;  3TPQ A;  4F3O A;  2Z1G A;  2AA4 A;  3P4I A;  2ZJQ L;  3RR7 A;  4MQ3 A;  3ZX0 A;  1VQ4 N;  2KHO A;  2WUS A;  3SK3 A;  3ZSZ A;  4LFC K;  4FM2 A;  5KPR A;  2UU9 K;  4CJ7 A;  4DV0 K;  1NJI O;  3AA4 A;  3K58 A;  3A5O C;  2QWN A;  4DWI A;  4LSN A;  4F8R A;  1QS4 A;  4GY2 B;  3OYF A;  1O1W A;  4BC4 A;  4DQ8 A;  4YDU C;  3I8B A;  2HMI A;  1TUY A;  2A40 A;  5AFU A;  5JVH L;  4GKJ K;  1I39 A;  5IT9 O;  3TAP A;  4XIU A;  2GEL A;  5AZI B;  1N6Q A;  4DF8 A;  3HPG A;  3OYD A;  4MLE A;  4BR9 A;  3HK2 A;  4KH4 A;  3L2W A;  4O8U A;  3OYN A;  3EZW A;  4HVJ A;  1WAJ A;  3HP9 A;  3K5L A;  2WFB A;  4DSI A;  3OS1 A;  4CGG A;  4DS4 A;  1VQ7 N;  1HYZ A;  4JI7 K;  2A1S A;  2YNH A;  1QQN A;  1HKB A;  2O8F B;  3NVM A;  4IOA L;  2YHW A;  5BRH A;  3MN6 A;  4XJX A;  3AVM A;  2QW9 A;  4FJM A;  1IKX A;  3VOV A;  2ZGZ A;  1N32 K;  1Q18 A;  3TAF A;  1BUP A;  1JXE A;  4OKJ A;  3CCU N;  2BUP A;  1WSH A;  1ASW A;  5AQH A;  3ZEU B;  1J9A A;  3PSI A;  3THW B;  2GWJ A;  3T19 A;  4E1M A;  2ASM A;  3ZSO A;  3F9M A;  5GIO A;  5I3U A;  1JJ2 M;  4DUZ K;  3O9Q A;  4CJS A;  3O3G A;  3DYA A;  1U4B A;  2E6M A;  3D2E B;  3OYJ A;  1BCO A;  3RRG A;  4DMN A;  4Z4I A;  3K9K A;  4FWO A;  2NUB A;  3J7A P;  4OLA A;  2ZJR L;  1MWM A;  1JLB A;  2V52 B;  2HHX A;  1BWF O;  1NJW A;  3H08 A;  1KAZ A;  3FZF A;  4Z94 A;  4N56 A;  4WQ5 C;  4KHS A;  4G1Q A;  4N5S A;  1DT9 A;  3LDP A;  4H03 B;  2UUA K;  5FPE A;  1X9W A;  3MN9 A;  2Z1H A;  3FGU A;  4YOX A;  4KB0 A;  3O4N A;  2O8D A;  1NM1 A;  1T03 A;  4BRE A;  3T1H K;  3C65 A;  3VQA A;  3BEX A;  1NNE A;  1VSF A;  4BRQ A;  4BR4 A;  1KFS A;  4EZ9 A;  5AQJ A;  3EN9 A;  4OGC A;  2IC3 A;  3ID8 A;  3D6R A;  3KK1 A;  3EY1 A;  4O0I A;  3C7N B;  4PQU A;  1XC9 A;  2KFN A;  3P1G A;  3MCP A;  1VSL A;  3Q7C A;  1OVY A;  1RT2 A;  5KRS A;  2CGJ A;  1S1X A;  4CI6 A;  4M3W A;  4J2E A;  3QB0 A;  2VCP A;  3CHW A;  1VQO N;  1OH5 A;  5LY3 A;  2NLX A;  2GUI A;  1KXP A;  3VGL A;  1BU6 O;  1NGF A;  3H6E A;  4H0O A;  1QQC A;  4F2S A;  5BPL A;  2E20 A;  5C10 A;  3V9Z A;  5I42 A;  5EXW A;  3I0R A;  3HM9 A;  2PFU A;  4B9T A;  3RSE A;  4FK0 A;  4FSV A;  3MDQ A;  2HST A;  4FLU A;  4C8L A;  4AM7 A;  2NRV A;  1BI4 B;  5J2P A;  3BDP A;  3SAG A;  2BGG A;  5FLX O;  4FWK A;  5TKW A;  3ZCM A;  2KKZ A;  4BRD A;  1BO5 O;  4YOT A;  4AIL C;  1NBW A;  4B1W B;  1BQM A;  4DFK A;  3O9S A;  3TTF A;  3CI5 A;  2KTQ A;  3P83 D;  4DB3 A;  2F7T A;  5AQT A;  1S5J A;  2GWK A;  1JLG A;  1JXB A;  2ZWH A;  4DV6 K;  1YIJ N;  4JKH A;  4CZG A;  5AQN A;  2X74 A;  2KW4 A;  2P9K B;  1ZXO A;  4IDK A;  3JSM A;  2A42 A;  4WFA L;  4GVE A;  4X62 K;  3VTI A;  3SV4 A;  4C1N I;  5J1E A;  3OJU A;  4DV3 K;  1KVC A;  4CJK A;  3R3L A;  5KPZ A;  3TSQ A;  2IAJ A;  1FXX A;  3NBP A;  4M3Z A;  4CHO A;  1JL1 A;  4DU3 A;  3EE8 A;  3L4I A;  4DTR A;  1YF5 L;  2I7P A;  1TV6 A;  3RMD A;  3F2K A;  4FL9 A;  3ZSR A;  3DLE A;  1L3T A;  3MEE A;  1HRH A;  4CEE A;  1WSJ A;  1W0H A;  4NXN K;  1HR0 K;  4JS4 A;  1OH8 A;  2PYJ A;  3CYM A;  5AZI A;  1VQL N;  3CJ9 A;  4B3R K;  3HOT A;  1DLO A;  1YAG A;  1BIZ A;  2IVO A;  2OTJ N;  3VF2 A;  3AAR A;  2OPS A;  2I5J A;  2FXU A;  5GAD P;  3OA9 A;  4FJ5 A;  3KTQ A;  3WXL A;  3U4L A;  3CJC A;  3MMV A;  2O8F A;  5ADX A;  2ETJ A;  3AA3 A;  3PUF A;  5AQY A;  4BVO A;  4BE1 A;  1LCU A;  3VER A;  3V1O A;  4DTS A;  5DM7 L;  1YXQ A;  4OPJ A;  3I0S A;  1LW0 A;  1YTA A;  3MX2 A;  3ZEU A;  3THW A;  4BQL A;  3DRS A;  2FF6 A;  3ENH A;  4ILH A;  1IKW A;  4ICL A;  4CFA A;  4EP4 A;  4CE9 A;  2E6L A;  4CJ3 A;  4BRA A;  1TKT A;  5AQG A;  3CM6 A;  2VG5 A;  3D2E A;  4DV2 K;  1NOY A;  5J2M A;  4DR5 K;  3J7Y P;  3O1W A;  4DSK A;  4A5A A;  3JXU A;  3CJA A;  4CER A;  4FWP A;  3QEV A;  4WYB A;  1VK0 A;  3MWP A;  2XY5 A;  4BVP A;  2QM1 A;  1VHX A;  5AQL A;  1EET A;  3NHG A;  1S1V A;  4K0K K;  1KRP A;  1SUQ A;  3DOK A;  3EEQ A;  1D9F A;  1BIU A;  1Z05 A;  4CJ5 A;  4J2B A;  2QK9 A;  1XMQ K;  2WOM A;  4N47 A;  5FRO A;  3ULE B;  5D3G A;  5HOO A;  2LSN A;  2E4L A;  4DR1 K;  1HYS A;  3CFO A;  4FLT A;  3CCL N;  3RR8 A;  4IFV A;  4R5P A;  2QWP A;  4KH5 A;  4AH9 A;  4EZ6 A;  3G0Z A;  5JLF A;  1KVA A;  2F4V K;  4CES A;  1OVQ A;  3LAM A;  3LDN A;  4BRC A;  2OTL N;  4V19 S;  2XY6 A;  2P51 A;  3DXK B;  3C7N A;  4FLY A;  3VN5 A;  1JCG A;  5GAH P;  5LL6 Z;  1TKX A;  1YVU A;  2VGM A;  4FM0 A;  3DLG A;  4H5V A;  1FJG K;  1W2B M;  3C6U A;  3L2R A;  4K8Z A;  1TAQ A;  3KLG A;  3D45 A;  3EE9 A;  3CFP A;  4Y1C A;  1NJY A;  5I9E B;  3PLA A;  3V9X A;  4RW7 A;  2YHA A;  1SKS A;  4BC3 A;  3K0S A;  4HUG A;  1KCF A;  4YOW A;  2KZZ A;  4E0D A;  3WXJ A;  4X66 K;  4ISG A;  2D1K A;  3L4Q A;  3VA0 A;  1RBV A;  5KGW A;  3ZET B;  4BRH A;  3CET A;  1HNI A;  2HBK A;  3MX5 A;  3R1X A;  3V1R A;  4DV7 K;  1QHA A;  2E2P A;  3KZB A;  3LP3 A;  3K9J A;  1RTI A;  1VQM N;  1HJR A;  1MA9 B;  5CHI A;  4B1Y B;  3EYZ A;  3SPY A;  2O4I A;  2A3Z A;  1NK9 A;  3H46 O;  2A5X A;  2F9T A;  2RF2 A;  4DSE A;  1A5V A;  3DRR A;  3OYM A;  3AGR A;  3B6P A;  3OBW A;  4CJT A;  3W3D A;  1I94 K;  2QWQ A;  2G8H A;  1K73 O;  1GLE G;  3SUO A;  3EKU A;  1YI2 N;  1U45 A;  2RKI A;  4H4O A;  2E88 A;  2P9K A;  4B9Q A;  2YX6 A;  4CJ4 A;  2EWS A;  2HMP A;  5AQX A;  2OZM A;  3FLC O;  2RN2 A;  3G10 A;  1NKB A;  2HND A;  2W6K A;  2IVP A;  4CHQ A;  1QSL A;  2YJE A;  4DR4 K;  3AA5 X;  3UIQ A;  4M3R A;  2NNW A;  4FJ8 A;  1T8E A;  4O5F A;  1WBB A;  4B8A B;  4MLH A;  1IG8 A;  1HUX A;  3SUN A;  1VQK N;  3ZLJ A;  1SQK A;  1N8R O;  3P39 A;  2E2Q A;  3RVC A;  5AQI A;  4DSL A;  2IVN A;  1ASU A;  4HUF A;  3HT3 A;  2ZQB A;  4AHU A;  5F2R A;  5CE3 A;  4WCE L;  3BP8 A;  1JLQ A;  1IG9 A;  4CJP A;  1BHL A;  4KTQ A;  4JKA A;  3GE1 A;  5HP1 A;  4MDB A;  4C8M A;  3GOI A;  4C8K A;  3DLB A;  4DV1 K;  1JLA A;  4JYA K;  2DFE A;  4OPA A;  5B8H A;  4NCG A;  3M8R A;  4IXC A;  3CCM N;  5E84 A;  4O4G A;  4FJK A;  3T7Z A;  4H5N A;  5EU7 A;  1P90 A;  2D4W A;  4LH4 A;  3QIP A;  4KV8 A;  4X65 K;  5KRT A;  4FWS A;  4XH5 A;  4EP5 A;  2Z1J A;  4LD0 A;  3VMF B;  1C0U A;  3FE1 A;  1NU0 A;  4WE1 A;  3KKR A;  3WEE B;  4BE2 A;  3O80 A;  4CJE A;  3V9S A;  3EO3 A;  1NK4 A;  4M42 A;  3UKU B;  3R9P A;  3MEC A;  2HHQ A;  3O9T A;  3O4Q A;  4GMJ B;  1CZ9 A;  4FK2 A;  3I55 N;  1YHQ N;  2QWR A;  1BOT O;  1EQY A;  2QKB A;  1YJN N;  1U49 A;  2DTU A;  2OZS A;  2X6N A;  3LAL A;  4CEO A;  4QS9 A;  1VRU A;  4LC9 B;  4IEE A;  3KIO A;  4M7Y A;  5A2Q O;  3VPZ A;  3KLE A;  1K9M O;  3IAY A;  4CIG A;  1NGD A;  3VEV A;  3ULE A;  4IOX A;  4IDH A;  5AQR A;  3MXI A;  4E19 A;  5HLF A;  4QCL A;  3I56 N;  1NGH A;  1TKZ A;  3NFA A;  4CEC A;  3QIN A;  4FJ9 A;  4DS5 A;  1FW6 A;  4CJQ A;  4HCC A;  4OLB A;  1N33 K;  4IKF A;  1HQE A;  2PZS A;  1L3U A;  3SAF A;  4CGD A;  3HPH A;  4CJF A;  1T6D A;  3DXK A;  4JRP A;  3NGY A;  4CD1 A;  4FPA A;  4FWL A;  1T7P A;  3CJ1 A;  2HNZ A;  2UXC K;  1VQ5 N;  5CYM A;  2D5R A;  3JYT A;  3SYZ A;  2FLO A;  3ISN C;  1RDC A;  4L8R B;  1XI1 A;  3NGI A;  4KHY A;  2EHG A;  3AO2 A;  3HZ6 A;  2E1Y A;  3AAQ A;  2E1Z A;  3O3H A;  2ITM A;  1VRT A;  4MO4 A;  4FK4 A;  4KO0 A;  1I3A A;  3O1B A;  4CF9 A;  5M1Q A;  3A8Y A;  1S9E A;  3FZK A;  4IO8 A;  3LP0 A;  4BRO A;  1TGO A;  3M1F A;  5HRN A;  5AQV A;  3TSU A;  4JK8 A;  3VES A;  2ZF5 O;  3VQ7 A;  3ZET A;  2YHY A;  2FF3 B;  2QA4 N;  4CZF A;  3NH1 A;  4ELV A;  4I9L A;  2HNY A;  2Q0U A;  3TTC A;  3J80 O;  4HCB A;  1X3M A;  3SV3 A;  4E3S A;  2B4J A;  5ADX H;  2B5J A;  5DK5 A;  4LH5 A;  2P9S B;  1K8K B;  1A5X A;  4CW7 B;  3OJS A;  4EHT A;  4IG0 A;  2VG6 A;  1GOA A;  4FJL A;  2Z1I A;  3CC7 N;  3QNO A;  4DSJ A;  3VEX A;  5MLC Q;  1U47 A;  5J2N A;  4XH4 A;  4CJR A;  4CEF A;  4E7I A;  1KC8 O;  3VQC A;  2AP1 A;  4CBU A;  3CQ8 A;  1M1K O;  4YY3 K;  4K25 A;  4LF4 K;  4B08 A;  1DTT A;  1Q9Y A;  2IDO A;  2FSK A;  4C23 A;  4W5O A;  2Q2R A;  3LPU A;  4DF4 A;  1XNR K;  3A0I X;  4GV9 A;  5BRF A;  3VF6 A;  4O44 A;  1HNW K;  3L3U A;  2HBM A;  4ZTF A;  3BY5 A;  3SBG A;  3V81 A;  1ZBL A;  1T05 A;  3K5O A;  5KGX A;  5E26 A;  5AQS A;  3UB5 A;  2ZM6 K;  3R8E A;  3AO4 A;  5DM6 L;  3O3F A;  3AVH A;  4Q5V A;  1E4F T;  3F9K A;  3CM5 A;  1BG3 A;  3FZM A;  1ZBU A;  3D2F B;  1TUU A;  1TYQ B;  5H1S Q;  1WUA A;  4CF8 A;  4FOI A;  2J4R A;  2CGK A;  3ID6 A;  3SAH A;  3DOL A;  4H5R A;  4JI0 K;  2UUB K;  4GKK K;  1BIS A;  3VEY A;  4KH6 A;  1SL2 A;  4H0Y B;  5HL7 L;  4AQY K;  3U9D A;  2OPQ A;  1VSK A;  2JWL A;  1OH6 A;  1RT7 A;  1E4G T;  3T1A A;  4BR2 A;  1MDU B;  4BRM A;  1C1B A;  1QSY A;  2QEX N;  2O8C B;  4WF9 L;  1BQN A;  1SKR A;  3L3V A;  5LMU K;  1TVR A;  4WFB L;  4C1N K;  3NVK A;  4BRI A;  1TL3 A;  4ID1 A;  1XUP O;  3WEE A;  1Q7Y O;  1OKJ A;  3GG4 A;  4B1U B;  4MO5 A;  1V4T A;  2DPN A;  3UKU A;  4CEA A;  4BWJ A;  2GBZ A;  1JCE A;  3O8M A;  4YFU A;  4A2A A;  3TR8 A;  2F96 A;  4KHN A;  3CC4 N;  1ZBF A;  5HRS A;  4CZK A;  3QO9 A;  3QEX A;  3KLF A;  5GIP A;  1JLF A;  3OS0 A;  4ZHR A;  2UXD K;  1YJ9 N;  4AHR A;  1ESV A;  4A62 A;  3S3M A;  4KHW A;  4CGI A;  1RBR A;  1LV5 A;  4E1N A;  3KWI A;  2XO7 A;  1JKH A;  1VSD A;  4A59 A;  1NK6 A;  4AHS A;  3ZYY X;  3Q7B A;  4B9V A;  4BC2 A;  4A57 A;  2AJQ A;  1KLN A;  2C1I A;  2F8S A;  4CHY A;  3THX B;  3VQB A;  2JWK A;  4KFB A;  1S72 N;  2YV0 X;  2G8I A;  3QBW A;  3SQ4 A;  3H3N O;  3HM8 A;  4KTW A;  1A5W A;  2Q3S A;  4N76 A;  2YJF A;  1G99 A;  1YTU A;  1S1U A;  3M8Q A;  3WUH A;  1HKC A;  4JI5 K;  2OPR A;  4HHT A;  2XHB A;  1X1P A;  3HBT A;  3CPE A;  4NB4 A;  1UA1 A;  4J2D A;  3OBY A;  1F21 A;  4CZL A;  3P5J A;  3KD5 E;  3M6G A;  1EP4 A;  2DFF A;  3LDS A;  1ATS A;  4PL7 A;  5CY4 A;  3VTH A;  1S3X A;  1ILY A;  5C15 A;  4I2Q A;  4HWI A;  2ASO A;  3RWU A;  3IFR A;  4N41 A;  4LF9 K;  3AO1 A;  3KLH A;  4Z4G A;  2Q97 A;  4ZTJ A;  1IBL K;  1CLQ A;  3VF4 A;  3CCV N;  2HHV A;  2HF4 A;  1VQ9 N;  4RCH A;  4AM6 A;  3NGZ A;  5AZJ B;  3LWL A;  4K43 A;  1N34 K;  1BGX T;  1X9J A;  4CJU A;  4J8F A;  5BPM A;  2OPP A;  5GAG P;  4M3U A;  4ISE A;  2P9S A;  1K8K A;  1D5A A;  4KHU A;  3OYL A;  1ASV A;  4OPH A;  4B3S K;  4PY5 A;  3WXI A;  4DTJ A;  1NMD A;  2YNF A;  5JLH A;  4IJN A;  2XY8 A;  1NGA A;  5BN8 A;  1D4X A;  3P38 A;  1LAV A;  3V9U A;  4DKW A;  3B6O A;  1LOT B;  1RDA A;  4CJV A;  1VAZ A;  2ZD1 A;  3N4P A;  3HXM A;  1R0A A;  5AQW A;  1Z25 A;  5DMR A; 
#chains in the Genus database with same CATH homology
 4FWQ A;  2D0O A;  4BG9 A;  2IVP A;  3AAP A;  2AA4 A;  3P4I A;  2YJE A;  3WQT A;  4CZE A;  1Q86 O;  2ZJQ L;  2NNW A;  3CCQ N;  1C0G A;  3ZX0 A;  1VQ4 N;  4O5F A;  2KHO A;  5TKY A;  3U8X A;  2WUS A;  3CC2 N;  4MLH A;  4JKD A;  4RTF D;  3SK3 A;  4B1V A;  4ISF A;  4BRF A;  2P9L A;  5KPR A;  1IG8 A;  5BPN A;  1HUX A;  2A41 A;  4CJ7 A;  4JD2 B;  1NJI O;  1VQK N;  3A5O C;  2BTF A;  2QWN A;  1SQK A;  5M1N A;  1N8R O;  3P39 A;  2E2Q A;  2V51 B;  4GY2 B;  5ELZ A;  3RVC A;  3TTD A;  5AQI A;  4BC4 A;  3MK6 A;  4DQ8 A;  3UKR A;  2IVN A;  4YDU C;  3I8B A;  1TUY A;  2A40 A;  5AFU A;  3G6E N;  5JVH L;  5F2R A;  5CE3 A;  2GEL A;  5AZI B;  4WCE L;  3BP8 A;  4IZ9 A;  4MLE A;  4BR9 A;  4KH4 A;  4O8U A;  1ZBS A;  3D2F A;  4U7B A;  1TYQ A;  5M1F A;  3EZW A;  4CZM A;  5FPD A;  4JKA A;  4BEC A;  3GE1 A;  4MDB A;  1RGI A;  3GOI A;  2WFB A;  1GLC G;  4XH1 A;  1GLJ O;  1VQ7 N;  4OPA A;  5LJV A;  5B8H A;  3CCE N;  1QQN A;  1HKB A;  2C1G A;  1ATR A;  3CCM N;  3DXM B;  4IXC A;  5E84 A;  3NVM A;  1VQP N;  5C2D A;  4IOA L;  3T7Z A;  2YHW A;  4H5N A;  3MN6 A;  2GUP A;  5BRH A;  5LJW A;  1YJW N;  4XJX A;  1ZC6 A;  3IKM A;  1NLV A;  3CPW M;  2Q31 A;  4PL8 A;  5EVZ A;  3ZX2 A;  3GBT A;  2P9P A;  1P90 A;  2D4W A;  2QW9 A;  4JKF A;  5KQD A;  1QZ5 A;  2QWM A;  4FWS A;  5AQP A;  4ILJ A;  3VOV A;  2ZGZ A;  4XH5 A;  1Q18 A;  1C0F A;  1QVF M;  1BUP A;  2QXL A;  1HJO A;  3CCU N;  2BUP A;  5AQH A;  3VMF B;  5FPM A;  3ZEU B;  3FE1 A;  2PAV A;  2HBJ A;  2GWJ A;  3H1Q A;  3TU5 A;  4R79 A;  5EX5 A;  1U6Z A;  2ASM A;  5BRD A;  3F9M A;  4M63 C;  5GIO A;  1QQM A;  2VWB A;  3LDO A;  1T6C A;  3WEE B;  5AFU H;  1JJ2 M;  3SMS A;  2HBL A;  3O9Q A;  3O80 A;  4DHY A;  1NGC A;  3EO3 A;  2IIR A;  3UKU B;  3SBT A;  3R9P A;  3SMP A;  4YOU A;  3D2E B;  3O9T A;  4IJA A;  3I55 N;  3G25 A;  4HTL A;  1YHQ N;  2QWR A;  3K9K A;  4FWO A;  4A2B A;  2QI2 A;  4RWT A;  1BOT O;  2BH1 A;  3E1Y A;  2ZJR L;  1MWM A;  2V52 B;  3O9U A;  1EQY A;  1BWF O;  1YJN N;  1KAZ A;  3FZF A;  2H3G X;  4Z94 A;  2P9N A;  4QS9 A;  4WQ5 C;  1DT9 A;  4LC9 B;  4IEE A;  4M7X A;  4M7Y A;  1SAZ A;  3LDP A;  4H03 B;  3LM9 A;  3MCA B;  3VPZ A;  4EFH A;  5FPE A;  1K9M O;  3MN9 A;  4H5W A;  4EIA A;  3FGU A;  1NGD A;  4PHT X;  3VEV A;  4YOX A;  3HSC A;  4YDU A;  1GLL O;  3ULE A;  3OW2 M;  1BA1 A;  4JHD B;  4IOX A;  4IDH A;  5AQR A;  1NM1 A;  4BY9 C;  2P9U A;  3HTV A;  3WQU A;  4BRE A;  4BC5 A;  3C65 A;  3I56 N;  1NGH A;  4JN4 A;  3CJ7 A;  3JS6 A;  5JMV A;  3LDL A;  3BEX A;  2QTD A;  1V4S A;  1KAX A;  1CZA N;  3GDQ A;  4BRQ A;  3KWG A;  4BR4 A;  3SAF A;  5MLC Q;  4NO7 A;  1T6D A;  3QFU A;  3EN9 A;  5AQJ A;  3DXK A;  5JVG L;  4CD1 A;  3ID8 A;  3D6R A;  5M1O A;  2P9I B;  4FPA A;  4FWL A;  3CJ1 A;  3C7N B;  1QQO A;  3MCP A;  1VQ5 N;  3Q7C A;  1OVY A;  1QVG M;  2FLO A;  2YHX A;  3FZL A;  4IO9 L;  2CGJ A;  3LM2 A;  5FPN A;  4CI6 A;  3J7Z O;  3HZ6 A;  2E1Y A;  3AAQ A;  2E1Z A;  3E9L A;  3VEN A;  5BRE A;  3QB0 A;  2VCP A;  2ITM A;  4MO4 A;  3CHW A;  2VGN A;  3ATV A;  4H0V B;  1VQO N;  5JIC A;  3IUC A;  5LY3 A;  2NLX A;  2F9W A;  4JKE A;  4GNI A;  3O1B A;  1M90 O;  3PIO L;  5M1Q A;  5F1X A;  1KXP A;  2YCH A;  3A8Y A;  3FZK A;  3M5R A;  3VGL A;  1RDW X;  4YOY A;  1BU6 O;  1NGF A;  4IO8 A;  3VET A;  4BRO A;  3H6E A;  2VYP A;  1W97 L;  4H0O A;  3M1F A;  3CJB A;  3FFK B;  3H45 C;  5BPL A;  2E20 A;  2KLA A;  1XC3 A;  5C10 A;  1NWK A;  5AQV A;  3TSU A;  4JK8 A;  3VES A;  2ZF5 O;  5EXW A;  2PFU A;  3ZET A;  4BR5 A;  5AZJ A;  2YHY A;  2FF3 B;  3RSE A;  2QA4 N;  4CZF A;  4FSV A;  1Z6R A;  1U2V B;  3HI0 A;  3MDQ A;  2HST A;  3KVG A;  2HF3 A;  5GAE P;  4AM7 A;  2NRV A;  4H0X B;  2Q0U A;  4WQ4 C;  3TTC A;  3TPQ A;  1X3M A;  3SAG A;  3J8A A;  3ENO A;  2QWL A;  4JEP A;  4FWK A;  5ADX H;  4YOV A;  5TKW A;  2QWO A;  2UYT A;  4WQ5 A;  4JKC A;  4I6M B;  2KKZ A;  1K8K B;  2P9S B;  3DWL A;  4BRD A;  1BO5 O;  4YOT A;  4EHT A;  1NBW A;  3DLL L;  4B1W B;  3O9S A;  3TTF A;  3CC7 N;  4PKH A;  1NGB A;  3CI5 A;  3CER A;  4IEI A;  3A5M C;  2W00 A;  1H1V A;  1P8Z A;  4CBX A;  3ATU A;  3VEX A;  4JAX A;  4DB3 A;  2F7T A;  3O5B A;  4JKG B;  4JNE A;  4XH4 A;  5AQT A;  4BQZ A;  3WXK A;  1K8A O;  2GWK A;  5F0X A;  3O9R A;  2ZWH A;  3MWT A;  1YIJ N;  1GLD G;  3CQX A;  4JKH A;  4CZG A;  1QZ6 A;  1WOQ A;  5EOY A;  4PKI A;  3O08 A;  5AQN A;  1KC8 O;  2AP1 A;  2P9K B;  1ZXO A;  4CBU A;  4CZI A;  4B1Z A;  2A42 A;  4FWM A;  3QBX A;  4WFA L;  2D0P A;  4GVE A;  5AQO A;  1NGJ A;  3WXM B;  1M1K O;  3VTI A;  4K25 A;  4BRL A;  1KAY A;  3BF3 A;  1SZ2 A;  4B1X B;  4C1N I;  4BRP A;  1HKG A;  2FSK A;  3O4W A;  4H0P A;  4C23 A;  2Q2R A;  3R3L A;  4G9Z A;  5KPZ A;  3TSQ A;  2E2O A;  3A0I X;  2NRH A;  5AQU A;  4GV9 A;  1IJJ A;  5BRF A;  3VF6 A;  4UY8 O;  4WFN L;  3C0B A;  4JD2 A;  3EE8 A;  3L4I A;  2HBM A;  2P9L B;  4FPB A;  5M1P A;  3VF2 A;  3SBG A;  4IOC L;  1YF5 L;  2I7P A;  4K41 A;  3F2K A;  1Y64 A;  5AQZ A;  4BR0 A;  4FL9 A;  1NGI A;  4CD3 A;  3I33 A;  3B8A X;  4QS7 A;  1MWK A;  2CH5 A;  5E26 A;  2WBN A;  5AQS A;  1NGG A;  3PIP L;  3UB5 A;  1Q81 O;  3D7E O;  4FOE A;  3R8E A;  2Q1N A;  3UKR B;  3MN7 A;  4BRG A;  5DM6 L;  5AZI A;  1VQL N;  3CJ9 A;  3VGK A;  3HOT A;  1E4F T;  1YAG A;  3BF1 A;  1T3V A;  2IVO A;  1BG3 A;  2OTJ N;  3A5N C;  2YI1 A;  3FZM A;  3D2F B;  1RFQ A;  1TUU A;  1TYQ B;  3AAR A;  1WUA A;  3LDQ A;  4FOI A;  2RE2 A;  2J4R A;  4NLB A;  1DEJ A;  5H1S Q;  1JCF A;  2CGK A;  2ZGY A;  3ID6 A;  4AF1 A;  5BN9 A;  3SAH A;  2FXU A;  4H5R A;  3OA9 A;  5C12 A;  5GAD P;  2NRW A;  1YIT N;  3VEY A;  4KH6 A;  3EKS A;  3WXL A;  1HX1 A;  3CIP A;  3O6W A;  4KBO A;  3CJC A;  3MMV A;  4H0Y B;  3T69 A;  3U4L A;  1KQS M;  4DCH A;  4FVU A;  5HL7 L;  3DXM A;  1GLB G;  5C0Y A;  3U9D A;  3L6Q A;  2JWL A;  5ADX A;  4CZJ A;  3VEW A;  1E4G T;  4F9O A;  3L0Q A;  4BR2 A;  1S22 A;  3WT0 A;  1MDU B;  4IWV A;  4BRM A;  3R6M A;  3DAW A;  2GX9 A;  5AQY A;  4BVO A;  5GIN A;  1LCU A;  2W41 A;  3OHR A;  3EL2 A;  4JK7 A;  3VER A;  2QEX N;  4BGA A;  2P9P B;  1T44 A;  2HOE A;  3FZH A;  4WF9 L;  2OAN A;  2ZJP L;  3G4S N;  2FSN A;  4K42 A;  1YXQ A;  3GL1 A;  5DM7 L;  4MDA A;  4NLC A;  3MX2 A;  4WFB L;  3ZEU A;  4YOR A;  1Q82 O;  3CD6 N;  4C1N K;  3NVK A;  4BRI A;  1YUW A;  2CH6 A;  4H0T B;  4BQL A;  4BRK A;  4ILH A;  1SS6 A;  2FF6 A;  3ENH A;  1XQS C;  1XUP O;  3WEE A;  1Q7Y O;  1OKJ A;  3GG4 A;  4B1U B;  4MO5 A;  1V4T A;  2DPN A;  3QML A;  4O8K A;  3UKU A;  4BRA A;  4GV6 A;  5AQG A;  3D2E A;  1JCE A;  3O8M A;  3C6A A;  4U67 L;  3H3O B;  4XEI A;  3CF5 L;  4A2A A;  3CC4 N;  4CZK A;  3SJH A;  5BR9 A;  5GIP A;  1VQN N;  2NRR A;  4H5T A;  1BDG A;  1YVN A;  1ATN A;  3AY9 A;  3M3Z A;  4BRN A;  3O1W A;  3P31 A;  2NZT A;  4A5A A;  3BUZ B;  2CGL A;  3AGK A;  3JXU A;  3CJA A;  1YJ9 N;  5AQQ A;  1ESV A;  4FWR A;  4FWP A;  4A62 A;  4WYB A;  1X3N A;  2P9N B;  4BE7 B;  3MWP A;  4BVP A;  2QM1 A;  1GLA G;  5AQL A;  2NRX A;  1RDU A;  3QIC A;  3KHY A;  5CR4 A;  1Z05 A;  3CQY A;  3KWI A;  4JHD A;  1DKG D;  3H1V X;  3U9Z A;  1J6Z A;  4CZH A;  4A59 A;  1HPM A;  3ULE B;  2NRT A;  5HOO A;  4GV3 A;  5C2F A;  3DJC A;  3G71 N;  2P9U B;  2PBD A;  3ZYY X;  4OO1 J;  3Q7B A;  4BC2 A;  3F5T A;  4A57 A;  3CCL N;  2C1I A;  4PKG A;  1BA0 A;  3QDK A;  5EY4 A;  2QWP A;  4KH5 A;  5JLF A;  1KD1 O;  1VQ8 N;  3E9P A;  2JWK A;  4BR7 A;  3LDN A;  4BRC A;  3CCR N;  2OTL N;  1S72 N;  2P9I A;  3QBW A;  4BGB A;  3CMA N;  3DXK B;  4QS8 A;  3C7N A;  1EO1 A;  3H3N O;  2GEM A;  3HM8 A;  4ILG B;  4A61 A;  1JCG A;  5GAH P;  3UE5 A;  2Q36 A;  3C6H A;  3CXC M;  2YJF A;  3IMX A;  1G99 A;  2VGM A;  1VQ6 N;  3WUH A;  2Q0R A;  5KPT A;  1HKC A;  1O13 A;  4H5V A;  3HBT A;  3CPE A;  4NB4 A;  3VGM A;  1W2B M;  3N4Q A;  1DGK N;  3OBY A;  3VEZ A;  2WC9 A;  4CZL A;  3EE9 A;  3M6G A;  3IDH A;  4CBW A;  5I9E B;  5KQ8 A;  3PLA A;  2V7Z A;  4EAH D;  4JK9 A;  1ATS A;  3VEO A;  3VTH A;  2W40 A;  4PL7 A;  1S3X A;  3TSP A;  3S41 A;  5M1K A;  1ILY A;  2GTD A;  4BC3 A;  5C15 A;  4YOW A;  4HWI A;  3CCS N;  2ASO A;  3IFR A;  3KK7 A;  3ENB A;  3LL3 A;  2NRZ A;  2E2N A;  3WXJ A;  2Q97 A;  4ISG A;  2D1K A;  3L4Q A;  2V7Y A;  3VF4 A;  3CCV N;  4Y0W A;  5AQK A;  1U2V A;  2HF4 A;  1VQ9 N;  4RCH A;  4AM6 A;  3ZET B;  4BRH A;  5AZJ B;  3CET A;  2RHK A;  3A5L C;  4K43 A;  1GLF O;  1X9J A;  2HBK A;  3MX5 A;  3R1X A;  3RSE B;  3SLC A;  2A6A A;  1QHA A;  4J8F A;  4FWN A;  5AQM A;  4EHU A;  2E2P A;  3KZB A;  5BPM A;  5GAG P;  3K9J A;  1VQM N;  1MA9 B;  5CHI A;  4WQ4 A;  4ISE A;  4I6M A;  3HRG A;  3HOS A;  2P9S A;  1K8K A;  3E9O A;  2FSJ A;  4B1Y B;  4E1J A;  2A3Z A;  3H46 O;  5AR0 A;  2A5X A;  4OPH A;  2F9T A;  4FO0 A;  3WXI A;  1NMD A;  2ASP A;  5JLH A;  4IJN A;  3MN5 A;  1HLU A;  4IFE A;  3E66 A;  2I7N A;  3AGR A;  3OBW A;  1NGA A;  4JKG A;  3W3D A;  2QWQ A;  2E8A A;  3QFP A;  5BN8 A;  1K73 O;  4BEB A;  1D4X A;  1GLE G;  1NGE A;  3EKU A;  3P38 A;  1YI2 N;  3CME N;  5AQF A;  4L3Q A;  4DKW A;  3NMU A;  1R59 O;  1LOT B;  3CCJ N;  2E88 A;  3W0L A;  1VAZ A;  4A5B A;  2P9K A;  4B9Q A;  3N4P A;  2YX6 A;  4BG8 A;  2EWS A;  2HMP A;  4JKB A;  5AQX A;  3FR0 A;  3FLC O;  3ZX3 A;  5AQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...