2P9UB

Crystal structure of bovine arp2/3 complex co-crystallized with amp-pnp and calcium
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
248
structure length
222
Chain Sequence
TEPPMIQAVLTLYQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
total genus 59
structure length 222
sequence length 248
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9uB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9uB02
3FGUA 3U4LA 3VETA 1Q18A 3QBWA 3FE1A 2F9WA 5ADXH 5BREA 3GOIA 5KPRA 5F2RA 3L4IA 2HF3A 5AZJA 1WOQA 1YXQA 3VEOA 4FWKA 4NB4A 3MN9A 3M3ZA 4CBWA 2FF3B 2IVNA 3AARA 4K43A 1GLLO 1HKGA 2P9PB 1JCGA 3EO3A 4H5VA 5E26A 2YHYA 4FWNA 3H46O 4A2BA 4L3QA 2I7PA 4PL8A 5B8HA 2D4WA 2QWPA 4K42A 3A5NC 5AQJA 2P9LB 3MDQA 4FOEA 3VF6A 3ZX3A 4CBUA 3CQXA 1K8KB 1GLEG 4CZLA 2QWRA 4BRHA 5AQHA 4BRQA 3UKRA 3ULEA 2ITMA 3LDNA 1MWMA 4BREA 3TPQA 4XEIA 4RWTA 3FZFA 5KQDA 4IJAA 4B9QA 2QWQA 3UE5A 5AQRA 2IVOA 2P9SB 1V4TA 1C0FA 1HX1A 4CD1A 1GLJO 3DJCA 5E84A 3VEXA 4A61A 4NO7A 4BR0A 2P9PA 2IIRA 3GDQA 3EZWA 5LJWA 4CZKA 2W40A 4H0VB 3M6GA 2PBDA 4FOIA 3MMVA 1BG3A 3ZETB 1U6ZA 2FXUA 3JS6A 5AFUH 1YVNA 4O5FA 4JD2B 3KHYA 2P9LA 1SQKA 2FSJA 3C7NB 3VOVA 1K8KA 1T6DA 2EWSA 1RFQA 3ZX0A 3LM2A 4WQ4C 3CIPA 5BRHA 5AQIA 3UKUB 3CI5A 1KAXA 5AZIB 2IVPA 5EVZA 4BG9A 1Y64A 1X3NA 2UYTA 3BP8A 3O80A 3O8MA 4B1ZA 5BN8A 5EXWA 3A0IX 2P9SA 3GE1A 4M7YA 1X3MA 1ATNA 4RTFD 2HOEA 4EIAA 1QQOA 3L6QA 1HPMA 1H1VA 2HMPA 4F9OA 4QS9A 2QWLA 1NM1A 2Q0UA 4XH4A 3C0BA 3ZETA 3FZMA 3FFKB 4JD2A 3CJ7A 3GBTA 3IDHA 3C7NA 3HM8A 4ISGA 4RCHA 1YAGA 4BVPA 2E2PA 4BR7A 3O6WA 3UKUA 4H0XB 2GEMA 5JMVA 1NWKA 3J8AA 5AZIA 1NMDA 3AY9A 5TKYA 4CZJA 3KZBA 3O1BA 1ESVA 2V51B 5JICA 3G25A 1XUPO 1MDUB 5FPMA 1V4SA 4H0TB 2D1KA 3WXIA 3QMLA 3B8AX 3MK6A 3DAWA 1C0GA 4BRPA 4BQZA 4DQ8A 3ATUA 4H5TA 4FSVA 3O5BA 4MO4A 5ADXA 3ZX2A 1BOTO 3LDQA 2QW9A 3H1QA 2ASOA 3L0QA 1NGJA 3GG4A 4DCHA 3SLCA 4BC4A 2VWBA 4QS7A 2KHOA 5AQQA 2YJFA 4PKHA 4BC5A 3VEWA 2A6AA 4ISFA 1SZ2A 1BDGA 1HLUA 2VYPA 1CZAN 3EKSA 3I8BA 4CI6A 1IG8A 3RSEB 3EN9A 5AQVA 4ISEA 5AQSA 4BVOA 3QB0A 4BRGA 2VCPA 4QS8A 1ATSA 2ASMA 3WUHA 3O4WA 4IO8A 5AQOA 3F9MA 1TUYA 3ENHA 4Y0WA 3H45C 4FWRA 3VEYA 4H5NA 5BR9A 2OANA 3FZKA 1R59O 4BRCA 3HBTA 2CH6A 4CZIA 2DPNA 3HSCA 2FSNA 3SMSA 4BRNA 5EOYA 4BRMA 1QQMA 3CERA 5AQGA 1LOTB 1NLVA 1S22A 3QFUA 4FWSA 1TYQB 1QZ6A 5JLFA 1NGAA 3LM9A 4IZ9A 3IMXA 3WQUA 3M1FA 4HTLA 1EQYA 4EHTA 1BUPA 2F9TA 3RSEA 5I9EB 4H0YB 3D7EO 2A41A 4IJNA 3SK3A 3VENA 2QXLA 3LL3A 5AFUA 4B1VA 3HZ6A 4FWOA 3WXJA 3D2EB 4BR9A 2J4RA 2V7ZA 3BEXA 5FPEA 1BA1A 4BRDA 3HTVA 3H3NO 5KQ8A 1RGIA 2YCHA 3IUCA 4FPAA 1S3XA 3VF4A 1NGBA 2FLOA 1BU6O 3U8XA 3A5OC 4I6MB 2E2NA 1T44A 5AQNA 4CZHA 5AQYA 3EL2A 4WYBA 1HKBA 1GLBG 4B1WB 1ZBSA 5FPNA 4BGAA 3FZHA 2A42A 4FWMA 3MN5A 1D4XA 1OKJA 5AQMA 3H1VX 2E2QA 4MO5A 4H0OA 3GL1A 1BWFO 4BROA 2P9NB 4BQLA 3CQYA 2E88A 1GLAG 1TYQA 2P9IB 3U9DA 4CZGA 2YHWA 2Q36A 4J8FA 1HJOA 5AQPA 5F1XA 4BRFA 5BPMA 3TU5A 4B1XB 3LDOA 5AQWA 5AQZA 2D0OA 1GLCG 4YDUC 4CZEA 5BRFA 4CBXA 3D2EA 1DGKN 2H3GX 5BN9A 3CHWA 4BG8A 4XH5A 5AQFA 3CJCA 3O1WA 1BA0A 2NLXA 3D2FB 3DXMA 4BRKA 4I6MA 3VEVA 1KXPA 1NBWA 1JCFA 4LC9B 2P9UB 3A8YA 1GLFO 5AQKA 1NGIA 3UB5A 4BC2A 2E8AA 4BR2A 1NGEA 3ID8A 4JAXA 3ATVA 5AQTA 5CE3A 3W0LA 3SMPA 1XQSC 4WQ5A 3MCPA 3FZLA 4JHDB 1KAYA 4CZFA 4HWIA 2P9NA 3VPZA 4AM7A 2AA4A 2P9IA 4H0PA 4H5WA 2NZTA 1XC3A 2YHXA 3BF3A 1U2VB 5AQUA 5BPNA 3ZEUB 3VERA 1KAZA 4Z94A 3S41A 4BR5A 4A2AA 2A3ZA 3H3OB 4EAHD 2YI1A 4FWQA 2Q31A 5BRDA 2BUPA 3MN6A 5AQLA 5ELZA 4BRLA 1P8ZA 2V52B 2GELA 2ZGZA 3D2FA 2CH5A 4PKIA 4BRIA 1YUWA 2E1YA 4YDUA 4DB3A 4O8KA 4MLHA 3W3DA 2P9UA 4IWVA 2Q0RA 2GWKA 2QWMA 1NGDA 3EKUA 4FWLA 1RDWX 2Q2RA 3ULEB 3A5MC 1IJJA 1QZ5A 4EFHA 4JHDA 2PAVA 5JLHA 5KPZA 3WEEB 1TUUA 2Q97A 4BR4A 1HUXA 4K25A 4B1UB 1U2VA 3P4IA 4JN4A 2ZGYA 3ZEUA 2QWOA 3QFPA 1WUAA 3CJ9A 3VGKA 3WQTA 1NGHA 4FL9A 2AP1A 3DXKB 3I33A 4DHYA 2GTDA 3BUZB 3CJBA 1Z05A 2E20A 1NGGA 1J6ZA 3FR0A 2GWJA 5FPDA 3U9ZA 4CD3A 4H03B 2Q1NA 2E1ZA 3QDKA 1G99A 4EHUA 3QICA 4BRAA 2CGLA 4XH1A 2CGJA 1HKCA 3A5LC 2W41A 3VGMA 1LCUA 1Z6RA 4BGBA 3R6MA 3DXMB 3WXKA 3MN7A 4GNIA 4WQ5C 4JNEA 5AQXA 1DKGD 2A5XA 2I7NA 2QM1A 3WEEA 5KPTA 1JCEA 1DEJA 2ZWHA 1T6CA 3ENOA 4A62A 2V7YA 3VF2A 1ATRA 1QHAA 4PKGA 3QBXA 2WUSA 4CJ7A 3LDLA 4CZMA 2GUPA 2A40A 3AAQA 3DXKA 3IFRA 1SAZA 1ZC6A 2QWNA 3WT0A 4KBOA 3R8EA 4E1JA 3FLCO 3JXUA 1E4FT 4FPBA 5EX5A 3O08A 1MWKA 2P9KB 4FO0A 2FSKA 4IXCA 1NGFA 2YJEA 1X9JA 4H5RA 5AZJB 2E2OA 3VGLA 5F0XA 2FF6A 2CGKA 4K41A 1GLDG 5BPLA 1ZXOA 3BF1A 3KVGA 3VEZA 5AR0A 5EY4A 3OHRA 2D0PA 3LDPA 4FWPA 3DWLA 3H6EA 3CETA 1NGCA 4B1YB 4GY2B 1MA9B 4PL7A 5LY3A 4MLEA 3WXLA 5LJVA 3VESA 3R9PA 2BTFA 2ZF5O 3SJHA 4C23A 3HI0A 1QQNA 1E4GT 1BO5O 4M63C 4WQ4A 2HF4A 3CJAA 4M7XA 3CJ1A 2ASPA 2NRHA 4BC3A 4AM6A 3AAPA 3UKRB 2P9KA
chains in the Genus database with same CATH superfamily
3VQ8A 4CEDA 3VETA 3QBWA 4IFVA 1JKHA 4DG1A 3KIOA 3LDSA 5GADP 5F2RA 5FRMA 1KLMA 1YXQA 2G8WA 4J2BA 1J53A 3ZCMA 3VEOA 4FWKA 4NB4A 2O8EB 4DFJA 1VQNN 3AV9A 4CJTA 3HPOA 1NU0A 4K43A 3SZ2A 3NHGA 1WAFA 3EO3A 5E26A 5GAEP 4BE0A 1QTMA 3MXIA 3RWUA 3E9PA 5CHIA 2ETJA 2AJQA 1O13A 4FLXA 1T03A 4CHQA 3A5NC 2P9LB 1NJIO 4DTRA 2F8TA 1G15A 4HCCA 4RW9A 4CZLA 1SS6A 5AQHA 3HK2A 1Z26A 4BRQA 3KD5E 3ULEA 3LDNA 3O3FA 4BREA 5IT9O 4JI5K 3FZFA 4YOVA 5KQDA 4I7FA 4E1NA 3LP2A 4KO0A 1JLGA 5AQRA 2IVOA 2P9SB 3AVJA 2OZSA 4UY8O 2HSTA 1C0FA 3AVFA 3NVMA 4CECA 3DJCA 5E41A 2FBXA 3TSQA 1QHTA 3DLEA 2IIRA 5LJWA 4BECA 4CE9A 4M41A 1BG3A 1RT4A 3ZETB 3JS6A 2R7YA 1VQ5N 3C65A 3MEDA 1U47A 3KHYA 2P9LA 2FSJA 4AILC 3VOVA 2HVIA 1T6DA 2EWSA 1RFQA 3ZX0A 3LM2A 4WQ4C 4CW7B 5C10A 2E6LA 5AZIB 1Y64A 2UYTA 3KKRA 3G71N 3OS0A 5KI6A 1TK8A 3LZJA 3KK2A 3CFOA 3FFIA 3QETA 2P9SA 4A59A 4MQ3A 2HOEA 4JKBA 4EIAA 1QQOA 4IKFA 4F9OA 1JXEA 2HBMA 4XH4A 3MXJA 1B9FA 4E0DA 3ZETA 1T7PA 2B6AA 2BANA 3FFKB 4F3TA 3TI0A 3C94A 3HM8A 5KRTA 4B9VA 4BR7A 3NH1A 5SZTA 4BY9C 4H0XB 3KLIA 5AZIA 3NGIA 1Q82O 4CZJA 3O1BA 1ESVA 1WB9A 3G25A 4O44A 4YOYA 5LMUK 3ZT1A 3MCAB 3F73A 1B9DA 3SQ0A 3HPGA 5HOOA 4CJVA 3BY5A 4FLZA 2ZQBA 3IKMA 4YOUA 4DSLA 1VSIA 5FLXO 2VGMA 2Z1GA 4MO4A 4DU1A 4DV4K 3LAKA 3DOKA 3LP3A 4Y1CA 5M1PA 3ZX2A 1SUQA 1BOTO 5CYQA 4DTXA 4LSNA 2QW9A 1Z25A 3WNFA 2ASOA 3QNOA 3T1YK 1SL2A 1BI4B 3V9XA 1BQNA 2HHWA 1ITGA 3I8BA 3RSEB 3V9UA 1VRTA 1HYSA 3VQEA 4BRGA 4JRQA 4OVLA 4QS8A 4C8MA 3QIPA 3ENHA 4OJRA 4Y0WA 4M3UA 1S1WA 4CJSA 4X65K 5JVHL 3SAGA 5JVGL 5C15A 3FZKA 3ZT3A 4NCGA 2HHHK 4DS4A 3OBWA 4PHTX 5HLFA 1J54A 2FSNA 3SMSA 4CJLA 5EOYA 2F8SA 4BRMA 1NLVA 1N36K 4OKKA 4FVMA 1BI4A 1TYQB 4FLTA 3IMXA 2KZMA 4CF1A 4HTLA 1EQYA 1LAWA 4EHTA 2F9TA 3RSEA 4CEAA 5I9EB 1LWCA 3TTCA 3D7EO 3D6RA 4IJNA 1JLQA 4FJGA 2VWJA 4B1VA 3HZ6A 2HHTA 1HQUA 2IAJA 2J4RA 3BEXA 2G8UA 1BA1A 3CPEA 1S1VA 1NKCA 4GV3A 3RR7A 4DV0K 1EWQA 4FPAA 4DU4A 2P5GA 1S3XA 2FLOA 3M8QA 3U8XA 4I6MB 2E2NA 3AGKA 1T44A 4CZHA 2WBNA 3EL2A 3LPUA 1HKBA 4TSXA 3R3LA 4CIFA 5KGWA 4BGAA 4C8NA 3NCIA 3FZHA 4FWMA 2JGUA 2E2QA 4MO5A 3OVNA 4IG0A 5BR8K 4WFBL 4B3TK 4BQLA 1TYQA 1XI1A 4JK9A 2VG5A 5F1XA 2OA8A 3ZT4A 3HRGA 3AVHA 3NMUA 4PQUA 5HROA 4CEEA 2XY6A 3O3HA 4N76A 1DGKN 2H3GX 3RRGA 4B3MK 3PX0A 3PUFA 1GOBA 3D45A 5GIPA 5DM6L 1DLOA 4I6MA 1NKEA 2A1SA 2DFHA 2G8IA 2O8FB 3A8YA 1IKWA 3ID8A 1JLAA 4GMJB 2QA4N 2RPIA 5AQTA 5CE3A 4FXDA 1Q9YA 4CK2A 3OYLA 4IOXA 4JHDB 4OX9K 4H0PA 4DR5K 4KHWA 1UA1A 3AO1A 4OLBA 4AHSA 3ZEUB 3VERA 1KAZA 2VG6A 1P90A 3V81A 1M90O 1L5UA 1RDUA 4EAHD 4KH6A 2ZE2A 5AQLA 4BRLA 1IH7A 2ZGZA 5CYMA 4BRIA 4DFPA 4M45A 4FJ5A 4YDUA 3V9WA 2O8FA 4O8KA 4MLHA 2VGNA 4CJKA 4IWVA 1RT7A 3C6HA 2Y1IA 2O8DB 2NRTA 3EKUA 4KH5A 2RKIA 5JENA 2D0BA 3JYTA 1NOYA 1D5AA 4JHDA 4ELTA 3TAEA 5JLHA 5KPZA 3DLBA 3WEEB 1HRHA 3O9TA 3AO5A 4OKEA 4BR4A 3ZEUA 2OPSA 2EX3A 4JKFA 1NGHA 1WBDA 2AP1A 1I39A 2GTDA 1GOAA 4OGCA 4DSEA 4U67L 3EYZA 4JS4A 1ZBLA 5DK5A 4DR1K 4ID1A 1XNRK 4DTSA 4Z4FA 1RT3A 4HHTA 2E1ZA 3ID6A 3QDKA 1RBSA 2O8DA 1DTQA 4EHUA 3F9KA 4FW2A 3QICA 3KK1A 4BRAA 4OPHA 2RE2A 1VSJA 2CGJA 3DI6A 4IBNA 1LCUA 3DXMB 3HVRA 3MN7A 4LSLA 4GNIA 4JEPA 2BE2A 1DKGD 3AO4A 3WEEA 4FJIA 1VSKA 2ZWHA 3L3UA 3IAYA 1OVYA 1Q8IA 3KLEA 4CJ4A 1HQEA 2GUPA 2LSNA 4EZ6A 2A40A 3AAQA 1SAZA 2QWNA 3WT0A 4KBOA 4YFUA 1OH8A 1KFDA 3FLCO 1E4FT 4CEOA 4FPBA 1RT6A 1EP4A 4LH5A 2F4VK 4B9UA 4DMNA 3CCQN 2Z1IA 1A5XA 3IG1A 3MX2A 1LWFA 3LAMA 4H5RA 1YVUA 4DR2K 4FJNA 3ZSOA 2KLAA 3Q7CA 4M3TA 3ULDA 2D0PA 4JRPA 3MEEA 4B1YB 1S9GA 3G0ZA 3ZSRA 4PL7A 4CF8A 1CXQA 3CCEN 2IC3A 1K8AO 3VESA 3R9PA 3C95A 4JI2K 3SJHA 3JSMA 2QKKA 1YF5L 5FRNA 4WQ4A 2HF4A 3CJAA 3J7AP 4M7XA 3CJ1A 3SI6A 3PY8A 4CGDA 4K8XA 5BREA 1XWLA 1RT1A 2HF3A 3QIOA 3HXMA 2UUBK 1TK0A 3HP9A 4FJHA 2FF3B 1NJXA 4E89A 1NJYA 3AARA 3L2QA 1GLLO 1HKGA 2P9PB 3HT3A 4H5VA 2HNZA 4M42A 4FWNA 3H46O 1KVBA 4A2BA 1RBVA 4PL8A 2QWPA 4N5SA 4I2QA 3SJJA 4LFAK 3VF6A 3QEVA 3ITHA 3ZYYX 3CQXA 1K8KB 4J2AA 3IS9A 4O55A 5K14A 4BRHA 1C1CA 3KD1E 2ITMA 1RBRA 3TPQA 4RWTA 2X74A 4R5PA 3NF8A 3OBYA 4XIUA 4K0KK 1B92A 4JI4K 3UE5A 1CLQA 3TAQA 4F2RA 4C8OA 1OH7A 1NK8A 2UXDK 3G6EN 1GLJO 5E84A 3TAFA 3L2UA 2P9PA 4CF2A 3GDQA 3EZWA 2W40A 4H0VB 2WONA 2KZZA 2Z1JA 3NBPA 1KQSM 1U6ZA 5AFUH 4O5FA 4W5NA 3TTFA 4DV7K 4DU3A 4NYNA 1SQKA 4OKJA 3WNEA 1HYZA 1S1UA 1K8KA 1RCHA 1SKWA 3K9JA 3CIPA 3DLHA 3CI5A 5M1QA 1IV0A 2IVPA 5EVZA 4BG9A 1IBLK 4FZXC 1X3NA 3VN5A 3BP8A 4LF9K 3O80A 2FBVA 4B1ZA 1Q7YO 5J1EA 2RHKA 1S6PA 3SNNA 4WF9L 4CJPA 3GE1A 2PYJA 3OYKA 2UXBK 1X3MA 1ATNA 3CQ8A 3L6QA 1HPMA 2OPPA 2QWLA 1OH5A 4KTQA 2I5JA 3MECA 1W0HA 3C0BA 3L8BA 4EZ9A 5C2FA 2O8CB 4CFCA 1NK9A 4RCHA 4OLAA 4BVPA 4NLBA 3O6WA 1XHXA 1WN7A 2GEMA 4B9SA 3F5TA 3OA9A 5TKYA 3OS1A 3RTVA 3ZT2A 4JKHA 2KFNA 4QOZB 4ZHRA 1T3VA 3B8AX 1KVCA 3THYB 3MK6A 3AVCA 2KFZA 1BCOA 4DQ8A 1WSHA 4FSVA 3T7ZA 3CMEN 2O8CA 1XHZA 3CCRN 3MEGA 4E19A 3I0RA 1HNWK 1YT3A 4BE7B 3H1QA 4DCHA 3GG4A 3TAGA 2VWBA 4QS7A 3OYCA 4BC5A 4DTPA 2A6AA 3WNGA 3O3GA 1X9WA 1WNSA 4J2EA 3EN9A 3SYZA 3B6PA 4IOCL 3K5MA 3QB0A 5GAGP 4O5BA 5KRSA 3EY1A 2HHIA 4YOTA 3DOLA 4EP5A 1ASWA 1ZYQA 1SL0A 3WUHA 4DSIA 5AQOA 3THYA 4Y1DA 3S5TA 3ENBA 2ZM6K 4KRFA 4H5NA 2E5LK 4EP4A 1LAVA 2OANA 3QO9A 2HMIA 5A2QO 3HBTA 1VQMN 4DTNA 2F7TA 3HSCA 1VRUA 4BRNA 5SWMA 4B3RK 1QQMA 3CERA 3LPTA 4Z4CA 3J80O 3S9HA 4FK0A 4WE1A 4FYDA 4CHZA 1QZ6A 2DFFA 1S1XA 2FBTA 3L2VA 3WQUA 4G1QA 3EEQA 2ZJPL 4CHPA 1MU2A 4RW7A 1VSFA 3VENA 2GBZA 1VSLA 2V7ZA 5GINA 1N33K 4DR7K 5FPEA 2ZJQL 4CCHA 4BRDA 3VQPA 1JLFA 3H3NO 5KQ8A 3KLHA 1REVA 3IUCA 1QSYA 3VF4A 1BU6O 3A5OC 3ZSQA 3HP6A 4W5TA 3K2PA 1UWBA 4B1WB 1QVGM 3T19A 3SUQA 3CFPA 4CESA 3RRHA 1NMNA 5D3GA 1ASUA 4ELVA 1HNIA 3MN5A 1OKJA 2W00A 1N32K 3VQ7A 3CC4N 3AVKA 3GL1A 1JLCA 4CZGA 3U9DA 2P9IB 2RN2A 2Q36A 4J8FA 1HJOA 4ILJA 4BRFA 3PV8A 4B1XB 4DUZK 1FXXA 1YTAA 4CGFA 5BRFA 1ZBIA 2ZD1A 4LF8K 2JWKA 1RDDA 1BA0A 1JL1A 3BZCA 5HRSA 4DR6K 4BRKA 1KXPA 1NBWA 1JCFA 3QINA 4CEZA 1TKTA 4HUEA 3EE8A 3WNHA 3QEXA 1L3TA 3AVIA 1SKRA 1VSHA 3CCSN 1L3UA 1SL1A 3SMPA 4BACA 3AVGA 1M1KO 3VPZA 4AM7A 2AA4A 1DT9A 2P9IA 4CJRA 4OPAA 3L2RA 5M1NA 2BH1A 3S41A 4BR5A 2A3ZA 3RMCA 2ITGA 5M1KA 3SV4A 2YI1A 2Q31A 2BUPA 3MAQA 5ELZA 1P8ZA 2V52B 1U49A 2GELA 4DV2K 2CH5A 4PKIA 1YUWA 3LWMA 5C12A 4GVMA 1VQPN 3BGRA 2GWKA 4IG3A 5I42A 4YOXA 1RDWX 4WFNL 1YJ9N 4CEQA 3O4NA 2WFBA 4G9ZA 3A5MC 1IJJA 2NNWA 5C42A 2XO7A 2HHQA 2Q97A 4K25A 4PUOA 3VTHA 1LW2A 1X1PA 3QFPA 2YNHA 3N4QA 1CZ9A 3MWTA 4OPJA 4DTUA 3C6TA 4KH4A 4NCBA 3SCXA 2Y1JA 4DWIA 4CD3A 1KRPA 4KI4A 3K59A 4XH1A 3A5LC 3O9SA 4KTZA 1N8RO 1Z6RA 1TL1A 4JNEA 4E7HA 5KPTA 3V1OA 1T6CA 3CC7N 3ENOA 3AA3A 4B9NA 2O4GA 4U7BA 3L3VA 4PKGA 4BE2A 4CGGA 1YI2N 4AH9A 3OTOK 3R8EA 4KFBA 3M8PA 1F21A 5CY4A 1BCMA 4IXCA 1RILA 4JI8K 5AZJB 3HL8A 3CM6A 4DQPA 2XY7A 5BPLA 1ZXOA 4NYFA 5EY4A 3QEPA 1TKDA 1RT5A 4CGHA 3DWLA 3H6EA 1NK7A 5I3UA 4GY2B 1VQKN 1Q81O 1KTQA 1WSEA 1HNZK 3R1XA 4MLEA 3WXLA 5LJVA 3QERA 4C23A 3HI0A 1I3AA 1QQNA 3J81O 1BO5O 4M63C 1U45A 1KFSA 3S3NA 3WXMB 3SQ1A 2NRHA 4BC3A 3VQDA 4C1NK 1TK5A 3UKRB 3OYNA 3U4LA 4H8KA 3K0SA 4GV6A 3FE1A 5ADXH 3GOIA 1NG9A 5KPRA 5AZJA 4DV5K 4CF9A 1Y97A 1WOQA 2NRVA 3ZSWA 3L4QA 3MN9A 5HRRA 4CBWA 3OYJA 5J2MA 2IVNA 1FKPA 4LF4K 1C6VA 1JCGA 3T69A 4CJ5A 5J2QA 3SQ4A 3I8DA 4JKEA 4KI6A 2I7PA 4CERA 4K42A 2HW3A 2KQ2A 4B9LA 3MDQA 4FOEA 2YHAA 2DFEA 2QWRA 4R79A 3UKRA 1MWMA 3V1RA 3QESA 4XEIA 1RBTA 4IJAA 3DRPA 1HMVA 2QWQA 4JI0K 1S1TA 1ZBHA 1TKXA 4Z4GA 1V4TA 1TGOA 3D0PA 4AHCA 4CD1A 4NO7A 1WSFA 4CHNA 4FJ8A 4M3YA 1RTDA 1XNQK 3J7YP 4DSFA 1EXQA 4KAZA 1YVNA 2P5OA 3PLAA 2NRXA 4N47A 2W6LA 3UIQA 4JI7K 3C7NB 3AA4A 4HUFA 3I55N 4NCAA 4JKAA 5AQIA 3UKUB 2O4IA 4FM2A 3O8MA 4E3SA 3CM5A 3OYEA 2NRZA 3DLKA 4RG8A 1UOCA 1IBMK 3SQ2A 4M7YA 3EE9A 3VA0A 2YNFA 4RTFD 3QNNA 3SPZA 1H1VA 2IOCA 1C0TA 2HMPA 4QS9A 2HHVA 4IDKA 3P1GA 5GIOA 2WC9A 2E4LA 2Z1HA 1NM1A 4ILGB 1OH6A 4B3SK 2GV9A 2ZJRL 4LF7K 1ASVA 3FZMA 2O8BB 2FC0A 4J2DA 3GBTA 2G8HA 3IDHA 4JKGB 3SAHA 4DSJA 3C7NA 1YAGA 4DQRA 1FW6A 3I0SA 1UA0A 5CZ2A 3UKUA 3V4IA 3OYGA 1RBUA 1HJRA 1NMDA 3O9UA 4GVEA 3AVLA 2HBKA 1W2BM 4CK3A 2V51B 1TAUA 5DM7L 4GKJK 4CF0A 1XUPO 1MDUB 3E1YA 3E9OA 5FPMA 4H0TB 4JKCA 1HNVA 1XC9A 2D1KA 5HP1A 3SUOA 4A5AA 3NDKA 4FLYA 1C0GA 4BRPA 2UUCK 4BE1A 4BQZA 4C8KA 3KJVA 3RVCA 2O8BA 5AJ3K 2HNDA 4ILHA 1BIZA 4JLHA 4JKGA 3PX6A 2X6NA 1RTJA 1NGJA 4BC4A 2KHOA 5AQQA 2A1RA 4FLWA 4FM1A 3VMFB 1BDGA 3EKSA 2VWKA 4ID5A 2HHSA 1IG8A 3AVNA 4M3XA 1VQ6N 5AQVA 4CJEA 4BVOA 3LWLA 1X9MA 2ASMA 3O4WA 4IO8A 4DLGA 4X62K 3HVTA 1VSDA 4BRCA 4DR3K 4O0JA 3RMBA 3HOSA 4E72A 2OTLN 2XRIA 1LOTB 1S22A 1WSJA 5GAHP 4B8AB 3TSUA 4FW1A 4FWSA 3ZSXA 3CYMA 5JLFA 1U4BA 3LM9A 4KHSA 4KHNA 2OZMA 3DRRA 4CGJA 3M1FA 1BUPA 1VSEA 5JS1A 4H0YB 3SK3A 3LL3A 5AFUA 1N6QA 4FWOA 3WXJA 4ZTFA 4FJ7A 3KTQA 3HTVA 1RGIA 2YCHA 3K5NA 1NGBA 3G10A 3DLGA 3TANA 3NF6A 5JS2A 4E1MA 5AQYA 4DTMA 1ZBSA 4DQIA 4JYAK 3KKSA 1RTHA 2A42A 5AQMA 1EWRA 3NFAA 4F4KA 4H0OA 1BWFO 1S9EA 4BROA 3CQYA 2E88A 1YJWN 1U48A 3OW2M 1T05A 5AQPA 2X78A 3T1AA 5BPMA 4E7JA 3G4SN 3LDOA 2VQFK 2BGGA 4JK8A 1VK0A 4YDUC 4CZEA 1J5EK 3C6AA 4CGIA 1K6YA 1QVFM 4E7IA 5BN9A 3CHWA 3T3FA 4XH5A 1N34K 4OGEA 3D2FB 4FVUA 1NKBA 3VEVA 4PY5A 5AQKA 3UB5A 3SBGA 4CJUA 1LV5A 3TR8A 2OPRA 2IS3A 4BR2A 1NGEA 4K8ZA 4ICLA 3OYIA 2X6SA 1XQSC 5CZ1A 3MCPA 4BWMA 4M3RA 3FZLA 1JJ2M 3SV3A 2PFUA 4CJQA 2YHXA 5C0YA 3PSIA 4PA1A 5AQUA 4LD0A 5BPNA 1EX4A 4DV1K 4DTOA 4Z94A 4A2AA 3BZKA 3H3OB 3RMAA 4FWQA 1BIUA 3B6OA 4LFCK 3K5OA 2QXFA 1KVAA 3D2FA 3LP1A 2E1YA 4X64K 3PO5A 3W3DA 2QK9A 4FJJA 2BDPA 4IEEA 2QWMA 3AVBA 3U6FA 4CHYA 2Q2RA 2P51A 4CK1A 4EFHA 3OY9A 3CXCM 3SUPA 1T8EA 4QAGA 4A5BA 4LFBK 1TUUA 2W6KA 4YNQA 4MDAA 5T7BA 3ZSVA 4JN4A 5KGXA 4IOAL 3KLGA 1WUAA 3KLFA 3CJ9A 4KKOA 3OYFA 3QLHA 2HBLA 1KLNA 4FL9A 4DKWA 3DXKB 2P1JA 2D5RA 3BUZB 3PO4A 4B9TA 4X66K 4FJ9A 1VQ9N 1NGGA 1LWEA 2O8EA 2GWJA 4FJMA 3U9ZA 4IEIA 1D9FA 3CCMN 4H03B 4BDZA 1HPZA 2OTJN 2YKNA 1G99A 5HRNA 1TAQA 3S3MA 2CGLA 3RMDA 2E6MA 4M3ZA 4HVJA 3VGMA 4BGBA 3K57A 3R6MA 4MFBA 4DR4K 4IFYA 3P5JA 4WQ5C 4CJ3A 4DS5A 3I56N 2UXCK 4YHHK 1DEJA 2PZSA 1CZBA 3VF2A 4DUYK 1QHAA 2OCEA 3E66A 1HNXK 3QBXA 3NGYA 4CJ7A 1D8YA 4CZMA 3LZIA 5EU7A 3DXKA 3IFRA 3ZLJA 5KTQA 1X9SA 4DTJA 3O08A 3BDPA 4FO0A 2FSKA 4M3WA 1DTTA 2E2OA 3VGLA 4CJWA 3QEIA 3P31A 1GLDG 3C6UA 3VEZA 5AR0A 2XHBA 4I2PA 2JLEA 3LDPA 4FWPA 3AO2A 3CETA 1NGCA 4O8UA 1QSLA 1HR0K 3OYHA 2YX6A 3CMAN 5H1SQ 4KPYA 2BTFA 2ZF5O 1I94K 1A5WA 1RDCA 1E4GT 4JV5K 2ASPA 3P38A 4CFBA 3AAPA 1GLEG 1W9HA 3FGUA 4A57A 1Q18A 4CIGA 4N56A 1J5OA 2F9WA 4YOWA 4FK2A 1YHQN 1IBKK 3TARA 1E3MA 3L4IA 1KCFA 3DMJA 1YJNN 3NVKA 4PWDA 2OYQA 2G8KA 4E7KA 3OYMA 3M3ZA 2HHUA 4KHUA 2QI2A 3CCJN 1GOCA 4B3OA 4FCYA 2YHYA 2B5JA 4L3QA 3AA2A 2F96A 3P83D 3VA3A 5B8HA 2D4WA 2EHGA 1EETA 3M5RA 5AQJA 4I9QA 1IG9A 2QKBA 3VQ5A 3ZX3A 4CBUA 3M8SA 4WCEL 3DYAA 2UU9K 3SPYA 4B8CA 3NH2A 5TKWA 3F2KA 4B9QA 4FK4A 3VTIA 3TAPA 1S6QA 3THVA 4OPKA 4HTUA 1VQ7N 1HX1A 3CYGA 3HOTA 3VEXA 1UAXA 4A61A 4BR0A 1CXUA 4CZKA 1QQCA 4NLCA 3M6GA 4KTWA 2PBDA 4C1NI 4FOIA 3MMVA 1C1AA 1N5YA 2FXUA 3SBTA 4W5OA 2C1IA 1HYVA 1RTIA 3V1QA 4JD2B 4DV3K 2HVHA 1TV6A 2QEXN 5BRHA 3H08A 3CPWM 3TABA 2OPQA 1KAXA 1EKEA 3QEWA 2QTDA 1WLJA 5BN8A 2YHBA 5EXWA 3A0IX 4BWJA 4CFDA 4LF5K 5LMNK 3J7ZO 4FJKA 1C0UA 5FDLA 3TAMA 1S72N 2HNYA 2Q0UA 3VQ9A 3OYAA 3O4QA 3TWHA 4HCBA 4DF8A 4JD2A 1TKZA 3CJ7A 2IDOA 2IGIA 1KD1O 5CR4A 2PY5A 4ISGA 3MX5A 2YKMA 1NK5A 2E2PA 3CCUN 5IWAK 4CHOA 5HBMA 3AVMA 5JMVA 1NWKA 3J8AA 4JK7A 2FBYA 4NXNK 3AO3A 3AY9A 4IDHA 3KZBA 4AHUA 3NAEA 5JICA 1TL3A 1VSMA 1WSIA 1V4SA 4AHVA 5DMRA 1LW0A 3WXIA 4CEFA 3QMLA 1VAZA 4W5QA 3VQAA 3AA5X 3DAWA 1RDBA 2XY8A 4LF6K 3SUNA 5J2NA 2G8FA 1TVRA 1VQLN 3ATUA 4H5TA 3O5BA 5ADXA 3OYBA 4IO9L 2W42A 3LDQA 1QE1A 3E9LA 3L0QA 3CCLN 1VHXA 3SLCA 3P39A 5FROA 4Q0BA 2YJFA 4PKHA 3VEWA 3U3YA 2HB5A 4AHRA 5C25A 4ISFA 4UQGA 1VQON 1SZ2A 1HLUA 4CI6A 2VYPA 1CZAN 4KB0A 1FKOA 3ZT0A 4ISEA 5AQSA 3CCVN 4FLUA 2VCPA 1ATSA 4N41A 3F9MA 4O0IA 1TUYA 3H45C 4FWRA 3VEYA 3DM2A 1WBBA 4W5RA 4Z4EA 5BR9A 1NK4A 3MXMA 2B4JA 1R59O 4B9MA 4ZTJA 2CH6A 4CZIA 2DPNA 4LH4A 1FK9A 2VQEK 3Q7BA 5AQGA 1QS4A 1K73O 3HSTB 3QFUA 3VQBA 4DFMA 1BISA 3PSFA 1K9MO 1NNEA 1ILYA 1NGAA 4IZ9A 4Z0UA 4DQQA 2KKZA 2GUIA 4F8RA 4CVNE 4ELUA 4KREA 1NJWA 3VQCA 2A41A 4KV8A 5C2DA 2QXLA 1RT2A 4AF1A 3D2EB 4F2SA 4BR9A 2RF2A 1BHLA 3N4PA 4H4OA 2D0AA 4KB1A 4MDBA 1C1BA 2C1GA 1EO1A 1NJZA 5AQNA 2GX9A 1NK6A 4WYBA 1GLBG 4CEBA 3V9SA 4DFKA 1W7AA 5FPNA 1IKXA 3DRSA 3CFRA 4LY7A 3OJUA 1D4XA 1RDAA 3H1VX 4GKKK 1JL2A 3ZSZA 4DSKA 5MLCQ 2P9NB 1GLAG 1ZBUA 2YHWA 1Q9XA 4DF4A 1JLBA 3K9KA 3TU5A 3RR8A 1OVQA 4DQSA 4L8RB 3OS2A 5AQWA 5AQZA 2D0OA 3S3OA 3T1HK 1GLCG 5C24A 4CBXA 3D2EA 1IKVA 4F3OA 3L2WA 4BG8A 5AQFA 3CJCA 3O1WA 1QSSA 4XJXA 2NLXA 3DXMA 3CD6N 1SKSA 3KK7A 5M1FA 1VQ4N 4LC9B 3E01A 2P9UB 4OO1J 1GLFO 1NGIA 2WOMA 4JI3K 4BC2A 4BEBA 2E8AA 1Q86O 2HBJA 4JAXA 2HHXA 3ATVA 3TTDA 3W0LA 1BL3A 4WQ5A 2JWLA 1J9AA 4QCLA 1KAYA 4CZFA 4HWIA 5HRPA 2P9NA 3KWIA 1JLEA 4YORA 4H5WA 3THWB 2NZTA 1XC3A 2XY5A 3BF3A 4JI6K 4AHTA 4Z4IA 4RW6A 1U2VB 1FJGK 3PX4A 4GW6A 1R0AA 3NE6A 3AVAA 5BRDA 3MN6A 3K58A 3EZ5A 3PIOL 1YIJN 4E7LA 4DB3A 1D9DA 2P9UA 4CIEA 3HO1A 4B08A 2Q0RA 1IO2A 1NGDA 4CFAA 1ZBFA 2VG7A 2Q3SA 4FWLA 3OYDA 4H4MA 3HM9A 4DV6K 3DLLL 1XMQK 1QZ5A 3O9RA 1KC8O 4BDPA 4FZYA 1YTUA 3KK3A 2PAVA 3THWA 3AGRA 3VQQA 1RNHA 4I9LA 3M8RA 4YY3K 1SV5A 4Q5VA 1HUXA 4B1UB 1VQ8N 1U2VA 3P4IA 2WTUA 2ZGYA 3V9ZA 4C8LA 2QWOA 3WQTA 3O9QA 3VGKA 3ZSYA 4FJLA 1BQMA 4FZZA 3I33A 4DHYA 3CJBA 3THXB 1Z05A 4FM0A 3A2FA 2E20A 4FJXA 3CG7A 4FLVA 3LANA 1J6ZA 3FR0A 4JKDA 4KHYA 3DLRA 1W97L 4RW8A 5FPDA 2G8VA 3OJSA 3CF5L 3V6DA 4V19S 3NGZA 2Q1NA 4RW4A 1S5JA 3CC2N 2ATQA 3KWGA 2NRRA 3VQ4A 1HKCA 4JS5A 2W41A 4KHQA 3WXKA 3NF7A 1BGXT 5AQXA 4CJFA 5M1OA 2A5XA 2I7NA 2QM1A 3U3GA 3ASMA 1JCEA 3NH0A 1IKYA 4NXMK 2NUBA 4A62A 2V7YA 3MWPA 1ATRA 1WAJA 1XMOK 2WUSA 4WFAL 3LDLA 1ZC6A 4BDYA 3THXA 4JI1K 4E1JA 3JXUA 2YV0X 3HJFA 2YNGA 5EX5A 4Z4HA 3IRXA 1L3VA 2DTUA 1JXBA 3LALA 1MWKA 3HYFA 2KW4A 4O4GA 2P9KB 1L3SA 1C0MA 1NGFA 2YJEA 3SAFA 1X9JA 2KTQA 2DY4A 1YITN 3HPHA 5F0XA 2PYLA 2FF6A 2CGKA 2NRWA 3LP0A 4HUGA 4K41A 2YNIA 3PIPL 3TSPA 3BF1A 3KVGA 1A5VA 2UUAK 5LL6Z 3JAMO 3OHRA 1U04A 1WSGA 4DLEA 4GV9A 1MA9B 4AQYK 5LY3A 1KSPA 1O1WA 4KHPK 4IFEA 3NF9A 1NOZA 5J2PA 3ISNC 1NK0A 3VQ6A 2D0CA 3ALYA 4AM6A 5HL7L 3ULEB 3K5LA 2P9KA
chains in the Genus database with same CATH topology
3FGUA 3U4LA 4A57A 3VETA 1Q18A 4GV6A 3QBWA 3FE1A 2F9WA 5ADXH 5BREA 4YOWA 1YHQN 3GOIA 5KPRA 5F2RA 3L4IA 2HF3A 5AZJA 5GADP 1WOQA 1YXQA 2NRVA 1YJNN 3VEOA 4FWKA 3NVKA 4NB4A 3L4QA 3MN9A 3M3ZA 4CBWA 2FF3B 1VQNN 2IVNA 2QI2A 3CCJN 3AARA 4K43A 1GLLO 1HKGA 2P9PB 1JCGA 3EO3A 4H5VA 5E26A 3T69A 2YHYA 5GAEP 4FWNA 3H46O 4A2BA 4JKEA 3E9PA 4L3QA 5CHIA 2I7PA 4PL8A 5B8HA 2D4WA 1O13A 2QWPA 3M5RA 4K42A 3A5NC 5AQJA 2P9LB 1NJIO 3MDQA 4FOEA 3VF6A 3ZX3A 4CBUA 3ZYYX 4WCEL 3CQXA 1K8KB 1GLEG 4CZLA 2QWRA 1SS6A 4BRHA 5AQHA 4BRQA 4R79A 3UKRA 3ULEA 2ITMA 3LDNA 1MWMA 4BREA 3TPQA 4XEIA 4RWTA 3FZFA 5TKWA 4YOVA 3OBYA 3F2KA 4IJAA 4B9QA 5KQDA 2QWQA 3UE5A 3VTIA 5AQRA 2IVOA 2P9SB 1VQ7N 1V4TA 4UY8O 2HSTA 1C0FA 1HX1A 3NVMA 4CD1A 3G6EN 1GLJO 3DJCA 5E84A 3VEXA 4A61A 4NO7A 3HOTA 3TSQA 4BR0A 2P9PA 2IIRA 3GDQA 3EZWA 5LJWA 4CZKA 2W40A 4H0VB 4BECA 4NLCA 3M6GA 2PBDA 4C1NI 4FOIA 3MMVA 1BG3A 3ZETB 1KQSM 1U6ZA 2FXUA 3JS6A 3SBTA 1VQ5N 5AFUH 1YVNA 3C65A 2C1IA 4O5FA 3PLAA 4JD2B 2NRXA 3KHYA 3TTFA 2P9LA 1SQKA 2FSJA 3C7NB 3VOVA 1K8KA 1T6DA 2EWSA 1RFQA 3ZX0A 3I55N 3LM2A 4WQ4C 2QEXN 3K9JA 3CIPA 4JKAA 5AQIA 5BRHA 3UKUB 3CI5A 3CPWM 5C10A 5M1QA 1KAXA 5AZIB 2IVPA 5EVZA 4BG9A 1Y64A 1X3NA 2UYTA 3BP8A 3O80A 2QTDA 3G71N 3O8MA 4B1ZA 1Q7YO 2RHKA 2NRZA 5BN8A 5EXWA 4WF9L 3A0IX 2P9SA 4A59A 3GE1A 3J7ZO 4M7YA 3EE9A 1X3MA 1ATNA 4RTFD 2HOEA 4JKBA 4EIAA 1QQOA 3L6QA 1HPMA 1H1VA 2HMPA 4F9OA 4QS9A 1S72N 2QWLA 5GIOA 2WC9A 1NM1A 2Q0UA 4ILGB 2ZJRL 2HBMA 4XH4A 3C0BA 3ZETA 5C2FA 3FZMA 3FFKB 4JD2A 3CJ7A 1KD1O 3GBTA 5CR4A 3IDHA 4JKGB 3SAHA 3C7NA 3HM8A 4ISGA 4RCHA 1YAGA 4BVPA 3MX5A 2E2PA 4BR7A 4NLBA 3CCUN 3O6WA 3UKUA 4BY9C 4H0XB 2GEMA 5JMVA 1NWKA 3J8AA 4JK7A 5AZIA 1NMDA 3O9UA 3F5TA 4GVEA 3AY9A 3OA9A 4IDHA 3KZBA 5TKYA 4CZJA 2HBKA 1W2BM 1Q82O 3O1BA 1ESVA 2V51B 5JICA 3G25A 5DM7L 4YOYA 1XUPO 3MCAB 1MDUB 3E1YA 3E9OA 5FPMA 1V4SA 4H0TB 4JKCA 4JKHA 5HOOA 2D1KA 3WXIA 3QMLA 1T3VA 3B8AX 1VAZA 3IKMA 4YOUA 4A5AA 3MK6A 3DAWA 1C0GA 4BRPA 2VGMA 4BQZA 4DQ8A 3RVCA 1VQLN 3ATUA 4H5TA 4FSVA 3O5BA 4MO4A 3T7ZA 5ADXA 3CMEN 4IO9L 5M1PA 3CCRN 4ILHA 3ZX2A 1BOTO 4JKGA 3LDQA 4BE7B 2QW9A 3E9LA 3H1QA 2ASOA 3L0QA 1NGJA 3GG4A 4DCHA 3SLCA 3P39A 2VWBA 4BC4A 4QS7A 2KHOA 5AQQA 2YJFA 4PKHA 4BC5A 3VEWA 2A6AA 1VQON 4ISFA 3VMFB 1SZ2A 1BDGA 1HLUA 2VYPA 1CZAN 3EKSA 3I8BA 4CI6A 1IG8A 3RSEB 3EN9A 1VQ6N 5AQVA 4ISEA 5AQSA 4IOCL 3CCVN 4BVOA 3QB0A 5GAGP 4BRGA 2VCPA 4QS8A 1ATSA 4YOTA 2ASMA 3WUHA 3O4WA 4IO8A 5AQOA 3F9MA 1TUYA 3ENHA 4Y0WA 3H45C 4FWRA 3VEYA 3ENBA 4H5NA 5BR9A 5JVHL 3SAGA 2OANA 5JVGL 5C15A 3FZKA 1R59O 4BRCA 3HBTA 1VQMN 3OBWA 2CH6A 4CZIA 2DPNA 2F7TA 4PHTX 3HOSA 3HSCA 2FSNA 3SMSA 4BRNA 2OTLN 5EOYA 3Q7BA 4BRMA 1QQMA 3CERA 5AQGA 1LOTB 1NLVA 1S22A 1K73O 5GAHP 3QFUA 3TSUA 4FWSA 1TYQB 1QZ6A 1K9MO 5JLFA 1ILYA 1NGAA 3LM9A 4IZ9A 5HL7L 3IMXA 3WQUA 2KKZA 3M1FA 1EQYA 4HTLA 4EHTA 2ZJPL 1BUPA 2F9TA 3RSEA 5I9EB 4H0YB 3TTCA 3D7EO 2A41A 5C2DA 3D6RA 4IJNA 3SK3A 3VENA 2QXLA 3LL3A 4AF1A 5AFUA 4B1VA 3HZ6A 4FWOA 3WXJA 3D2EB 4BR9A 3N4PA 2J4RA 2V7ZA 5GINA 3BEXA 5FPEA 2ZJQL 1BA1A 3CPEA 4GV3A 4BRDA 3HTVA 3H3NO 5KQ8A 1RGIA 2YCHA 3IUCA 4FPAA 1S3XA 4MDBA 3VF4A 1NGBA 2FLOA 1BU6O 3U8XA 3A5OC 4I6MB 2C1GA 2E2NA 1EO1A 3AGKA 1T44A 5AQNA 4CZHA 5AQYA 2WBNA 3EL2A 2GX9A 4WYBA 1HKBA 1GLBG 4B1WB 1QVGM 1ZBSA 3R3LA 5FPNA 4BGAA 3FZHA 2A42A 4FWMA 3MN5A 1D4XA 1OKJA 5AQMA 2W00A 3H1VX 2E2QA 3CCLN 4MO5A 3CC4N 4H0OA 3GL1A 1BWFO 4BROA 4WFBL 5MLCQ 2P9NB 4BQLA 3CQYA 2E88A 1GLAG 1TYQA 2P9IB 3U9DA 4CZGA 2YHWA 4JK9A 2Q36A 3OW2M 4J8FA 1HJOA 5AQPA 4ILJA 5F1XA 4BRFA 5BPMA 3K9KA 3TU5A 4B1XB 3G4SN 3LDOA 3HRGA 5AQWA 5AQZA 3NMUA 2D0OA 4JK8A 1GLCG 4YDUC 4CZEA 3C6AA 5BRFA 4CBXA 3D2EA 1DGKN 2H3GX 1QVFM 5BN9A 3CHWA 4BG8A 2JWKA 4XH5A 5AQFA 5GIPA 3CJCA 3O1WA 4XJXA 5DM6L 1BA0A 2NLXA 3D2FB 3DXMA 3CD6N 4BRKA 4FVUA 4I6MA 3VEVA 3KK7A 5M1FA 1VQ4N 1KXPA 1NBWA 1JCFA 4LC9B 2P9UB 3A8YA 4OO1J 1GLFO 5AQKA 1NGIA 3SBGA 3UB5A 3EE8A 4BC2A 2E8AA 4BR2A 1Q86O 4BEBA 1NGEA 2HBJA 3ID8A 4JAXA 3ATVA 3TTDA 3CCSN 5AQTA 2QA4N 5CE3A 3W0LA 3SMPA 1XQSC 4WQ5A 4IOXA 2JWLA 3MCPA 3FZLA 4JHDB 1JJ2M 1KAYA 4CZFA 4HWIA 1YJWN 1M1KO 2P9NA 3VPZA 3KWIA 4AM7A 2AA4A 1DT9A 2P9IA 4H0PA 2PFUA 4H5WA 4YORA 2NZTA 1XC3A 2YHXA 3BF3A 5C0YA 4OPAA 5M1NA 1U2VB 5AQUA 2BH1A 5BPNA 3ZEUB 3VERA 1KAZA 1P90A 4Z94A 3S41A 4BR5A 4A2AA 1M90O 2A3ZA 3H3OB 5M1KA 1RDUA 4EAHD 2YI1A 4FWQA 2Q31A 5BRDA 2BUPA 4KH6A 3MN6A 5AQLA 5ELZA 4BRLA 1P8ZA 2V52B 2GELA 2ZGZA 3D2FA 2CH5A 4PKIA 4BRIA 3PIOL 1YIJN 1YUWA 2E1YA 4YDUA 4DB3A 4O8KA 4MLHA 3W3DA 5C12A 2P9UA 2VGNA 4IWVA 1VQPN 3C6HA 2Q0RA 4IEEA 2GWKA 2QWMA 1NGDA 2NRTA 4YOXA 3EKUA 4FWLA 1RDWX 4WFNL 4KH5A 1YJ9N 2Q2RA 3ULEB 2WFBA 4G9ZA 3A5MC 3DLLL 1IJJA 1QZ5A 3O9RA 2NNWA 4JHDA 4EFHA 3CXCM 1KC8O 2PAVA 4A5BA 5JLHA 5KPZA 3WEEB 3O9TA 1TUUA 3AGRA 2Q97A 4MDAA 4BR4A 1HUXA 4K25A 4B1UB 1U2VA 3P4IA 4JN4A 1VQ8N 2ZGYA 3ZEUA 3VTHA 2QWOA 4IOAL 3QFPA 1WUAA 4JKFA 3CJ9A 3O9QA 3VGKA 3WQTA 1NGHA 2HBLA 3N4QA 4FL9A 2AP1A 4DKWA 3DXKB 3MWTA 3I33A 4DHYA 2GTDA 3BUZB 3CJBA 1Z05A 2E20A 4KH4A 1VQ9N 4U67L 1NGGA 1J6ZA 3FR0A 4JKDA 2GWJA 1W97L 3U9ZA 4IEIA 5FPDA 3CCMN 4CD3A 4H03B 3CF5L 2OTJN 2Q1NA 2E1ZA 3CC2N 3ID6A 1G99A 3QDKA 4EHUA 3QICA 3KWGA 4BRAA 2CGLA 2NRRA 4OPHA 2RE2A 4XH1A 2CGJA 1HKCA 3A5LC 3O9SA 2W41A 3VGMA 1N8RO 1LCUA 1Z6RA 4BGBA 3R6MA 3DXMB 3WXKA 3MN7A 4GNIA 4JEPA 4WQ5C 4JNEA 5AQXA 1DKGD 5M1OA 2A5XA 2I7NA 2QM1A 3WEEA 3I56N 5KPTA 1JCEA 1DEJA 2ZWHA 1T6CA 3CC7N 3ENOA 4A62A 2V7YA 3MWPA 3VF2A 1OVYA 1ATRA 1QHAA 4U7BA 3E66A 4PKGA 3QBXA 2WUSA 4WFAL 4CJ7A 1YI2N 3LDLA 4CZMA 2GUPA 2A40A 3AAQA 3DXKA 3IFRA 1SAZA 1ZC6A 2QWNA 3WT0A 4KBOA 3R8EA 4E1JA 3FLCO 3JXUA 1E4FT 4FPBA 5EX5A 3O08A 1MWKA 2P9KB 4FO0A 2FSKA 3CCQN 4IXCA 3MX2A 1NGFA 2YJEA 3SAFA 1X9JA 4H5RA 5AZJB 1YITN 2E2OA 3VGLA 5F0XA 2FF6A 2CGKA 2NRWA 4K41A 3P31A 1GLDG 3PIPL 5BPLA 3TSPA 1ZXOA 3BF1A 3KVGA 3VEZA 5AR0A 5EY4A 2KLAA 3Q7CA 3OHRA 2D0PA 3LDPA 4FWPA 3DWLA 3H6EA 4GV9A 3CETA 1NGCA 4O8UA 4B1YB 4GY2B 1VQKN 1MA9B 1Q81O 2YX6A 4PL7A 3CMAN 5LY3A 5H1SQ 3CCEN 3R1XA 4MLEA 1K8AO 3WXLA 4IFEA 5LJVA 3VESA 3R9PA 2BTFA 2ZF5O 3SJHA 4C23A 3HI0A 1QQNA 1E4GT 1BO5O 4M63C 1YF5L 4WQ4A 2HF4A 3CJAA 3WXMB 4M7XA 3CJ1A 2ASPA 2NRHA 4BC3A 4AM6A 3P38A 4C1NK 3AAPA 3UKRB 2P9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGU A;  3U4L A;  3VET A;  1Q18 A;  3QBW A;  3FE1 A;  2F9W A;  5ADX H;  5BRE A;  3GOI A;  5KPR A;  5F2R A;  3L4I A;  2HF3 A;  5AZJ A;  1WOQ A;  1YXQ A;  3VEO A;  4FWK A;  4NB4 A;  3MN9 A;  3M3Z A;  4CBW A;  2FF3 B;  2IVN A;  3AAR A;  4K43 A;  1GLL O;  1HKG A;  2P9P B;  1JCG A;  3EO3 A;  4H5V A;  5E26 A;  2YHY A;  4FWN A;  3H46 O;  4A2B A;  4L3Q A;  2I7P A;  4PL8 A;  5B8H A;  2D4W A;  2QWP A;  4K42 A;  3A5N C;  5AQJ A;  2P9L B;  3MDQ A;  4FOE A;  3VF6 A;  3ZX3 A;  4CBU A;  3CQX A;  1K8K B;  1GLE G;  4CZL A;  2QWR A;  4BRH A;  5AQH A;  4BRQ A;  3UKR A;  3ULE A;  2ITM A;  3LDN A;  1MWM A;  4BRE A;  3TPQ A;  4XEI A;  4RWT A;  3FZF A;  5KQD A;  4IJA A;  4B9Q A;  2QWQ A;  3UE5 A;  5AQR A;  2IVO A;  2P9S B;  1V4T A;  1C0F A;  1HX1 A;  4CD1 A;  1GLJ O;  3DJC A;  5E84 A;  3VEX A;  4A61 A;  4NO7 A;  4BR0 A;  2P9P A;  2IIR A;  3GDQ A;  3EZW A;  5LJW A;  4CZK A;  2W40 A;  4H0V B;  3M6G A;  2PBD A;  4FOI A;  3MMV A;  1BG3 A;  3ZET B;  1U6Z A;  2FXU A;  3JS6 A;  5AFU H;  1YVN A;  4O5F A;  4JD2 B;  3KHY A;  2P9L A;  1SQK A;  2FSJ A;  3C7N B;  3VOV A;  1K8K A;  1T6D A;  2EWS A;  1RFQ A;  3ZX0 A;  3LM2 A;  4WQ4 C;  3CIP A;  5BRH A;  5AQI A;  3UKU B;  3CI5 A;  1KAX A;  5AZI B;  2IVP A;  5EVZ A;  4BG9 A;  1Y64 A;  1X3N A;  2UYT A;  3BP8 A;  3O80 A;  3O8M A;  4B1Z A;  5BN8 A;  5EXW A;  3A0I X;  2P9S A;  3GE1 A;  4M7Y A;  1X3M A;  1ATN A;  4RTF D;  2HOE A;  4EIA A;  1QQO A;  3L6Q A;  1HPM A;  1H1V A;  2HMP A;  4F9O A;  4QS9 A;  2QWL A;  1NM1 A;  2Q0U A;  4XH4 A;  3C0B A;  3ZET A;  3FZM A;  3FFK B;  4JD2 A;  3CJ7 A;  3GBT A;  3IDH A;  3C7N A;  3HM8 A;  4ISG A;  4RCH A;  1YAG A;  4BVP A;  2E2P A;  4BR7 A;  3O6W A;  3UKU A;  4H0X B;  2GEM A;  5JMV A;  1NWK A;  3J8A A;  5AZI A;  1NMD A;  3AY9 A;  5TKY A;  4CZJ A;  3KZB A;  3O1B A;  1ESV A;  2V51 B;  5JIC A;  3G25 A;  1XUP O;  1MDU B;  5FPM A;  1V4S A;  4H0T B;  2D1K A;  3WXI A;  3QML A;  3B8A X;  3MK6 A;  3DAW A;  1C0G A;  4BRP A;  4BQZ A;  4DQ8 A;  3ATU A;  4H5T A;  4FSV A;  3O5B A;  4MO4 A;  5ADX A;  3ZX2 A;  1BOT O;  3LDQ A;  2QW9 A;  3H1Q A;  2ASO A;  3L0Q A;  1NGJ A;  3GG4 A;  4DCH A;  3SLC A;  4BC4 A;  2VWB A;  4QS7 A;  2KHO A;  5AQQ A;  2YJF A;  4PKH A;  4BC5 A;  3VEW A;  2A6A A;  4ISF A;  1SZ2 A;  1BDG A;  1HLU A;  2VYP A;  1CZA N;  3EKS A;  3I8B A;  4CI6 A;  1IG8 A;  3RSE B;  3EN9 A;  5AQV A;  4ISE A;  5AQS A;  4BVO A;  3QB0 A;  4BRG A;  2VCP A;  4QS8 A;  1ATS A;  2ASM A;  3WUH A;  3O4W A;  4IO8 A;  5AQO A;  3F9M A;  1TUY A;  3ENH A;  4Y0W A;  3H45 C;  4FWR A;  3VEY A;  4H5N A;  5BR9 A;  2OAN A;  3FZK A;  1R59 O;  4BRC A;  3HBT A;  2CH6 A;  4CZI A;  2DPN A;  3HSC A;  2FSN A;  3SMS A;  4BRN A;  5EOY A;  4BRM A;  1QQM A;  3CER A;  5AQG A;  1LOT B;  1NLV A;  1S22 A;  3QFU A;  4FWS A;  1TYQ B;  1QZ6 A;  5JLF A;  1NGA A;  3LM9 A;  4IZ9 A;  3IMX A;  3WQU A;  3M1F A;  4HTL A;  1EQY A;  4EHT A;  1BUP A;  2F9T A;  3RSE A;  5I9E B;  4H0Y B;  3D7E O;  2A41 A;  4IJN A;  3SK3 A;  3VEN A;  2QXL A;  3LL3 A;  5AFU A;  4B1V A;  3HZ6 A;  4FWO A;  3WXJ A;  3D2E B;  4BR9 A;  2J4R A;  2V7Z A;  3BEX A;  5FPE A;  1BA1 A;  4BRD A;  3HTV A;  3H3N O;  5KQ8 A;  1RGI A;  2YCH A;  3IUC A;  4FPA A;  1S3X A;  3VF4 A;  1NGB A;  2FLO A;  1BU6 O;  3U8X A;  3A5O C;  4I6M B;  2E2N A;  1T44 A;  5AQN A;  4CZH A;  5AQY A;  3EL2 A;  4WYB A;  1HKB A;  1GLB G;  4B1W B;  1ZBS A;  5FPN A;  4BGA A;  3FZH A;  2A42 A;  4FWM A;  3MN5 A;  1D4X A;  1OKJ A;  5AQM A;  3H1V X;  2E2Q A;  4MO5 A;  4H0O A;  3GL1 A;  1BWF O;  4BRO A;  2P9N B;  4BQL A;  3CQY A;  2E88 A;  1GLA G;  1TYQ A;  2P9I B;  3U9D A;  4CZG A;  2YHW A;  2Q36 A;  4J8F A;  1HJO A;  5AQP A;  5F1X A;  4BRF A;  5BPM A;  3TU5 A;  4B1X B;  3LDO A;  5AQW A;  5AQZ A;  2D0O A;  1GLC G;  4YDU C;  4CZE A;  5BRF A;  4CBX A;  3D2E A;  1DGK N;  2H3G X;  5BN9 A;  3CHW A;  4BG8 A;  4XH5 A;  5AQF A;  3CJC A;  3O1W A;  1BA0 A;  2NLX A;  3D2F B;  3DXM A;  4BRK A;  4I6M A;  3VEV A;  1KXP A;  1NBW A;  1JCF A;  4LC9 B;  2P9U B;  3A8Y A;  1GLF O;  5AQK A;  1NGI A;  3UB5 A;  4BC2 A;  2E8A A;  4BR2 A;  1NGE A;  3ID8 A;  4JAX A;  3ATV A;  5AQT A;  5CE3 A;  3W0L A;  3SMP A;  1XQS C;  4WQ5 A;  3MCP A;  3FZL A;  4JHD B;  1KAY A;  4CZF A;  4HWI A;  2P9N A;  3VPZ A;  4AM7 A;  2AA4 A;  2P9I A;  4H0P A;  4H5W A;  2NZT A;  1XC3 A;  2YHX A;  3BF3 A;  1U2V B;  5AQU A;  5BPN A;  3ZEU B;  3VER A;  1KAZ A;  4Z94 A;  3S41 A;  4BR5 A;  4A2A A;  2A3Z A;  3H3O B;  4EAH D;  2YI1 A;  4FWQ A;  2Q31 A;  5BRD A;  2BUP A;  3MN6 A;  5AQL A;  5ELZ A;  4BRL A;  1P8Z A;  2V52 B;  2GEL A;  2ZGZ A;  3D2F A;  2CH5 A;  4PKI A;  4BRI A;  1YUW A;  2E1Y A;  4YDU A;  4DB3 A;  4O8K A;  4MLH A;  3W3D A;  2P9U A;  4IWV A;  2Q0R A;  2GWK A;  2QWM A;  1NGD A;  3EKU A;  4FWL A;  1RDW X;  2Q2R A;  3ULE B;  3A5M C;  1IJJ A;  1QZ5 A;  4EFH A;  4JHD A;  2PAV A;  5JLH A;  5KPZ A;  3WEE B;  1TUU A;  2Q97 A;  4BR4 A;  1HUX A;  4K25 A;  4B1U B;  1U2V A;  3P4I A;  4JN4 A;  2ZGY A;  3ZEU A;  2QWO A;  3QFP A;  1WUA A;  3CJ9 A;  3VGK A;  3WQT A;  1NGH A;  4FL9 A;  2AP1 A;  3DXK B;  3I33 A;  4DHY A;  2GTD A;  3BUZ B;  3CJB A;  1Z05 A;  2E20 A;  1NGG A;  1J6Z A;  3FR0 A;  2GWJ A;  5FPD A;  3U9Z A;  4CD3 A;  4H03 B;  2Q1N A;  2E1Z A;  3QDK A;  1G99 A;  4EHU A;  3QIC A;  4BRA A;  2CGL A;  4XH1 A;  2CGJ A;  1HKC A;  3A5L C;  2W41 A;  3VGM A;  1LCU A;  1Z6R A;  4BGB A;  3R6M A;  3DXM B;  3WXK A;  3MN7 A;  4GNI A;  4WQ5 C;  4JNE A;  5AQX A;  1DKG D;  2A5X A;  2I7N A;  2QM1 A;  3WEE A;  5KPT A;  1JCE A;  1DEJ A;  2ZWH A;  1T6C A;  3ENO A;  4A62 A;  2V7Y A;  3VF2 A;  1ATR A;  1QHA A;  4PKG A;  3QBX A;  2WUS A;  4CJ7 A;  3LDL A;  4CZM A;  2GUP A;  2A40 A;  3AAQ A;  3DXK A;  3IFR A;  1SAZ A;  1ZC6 A;  2QWN A;  3WT0 A;  4KBO A;  3R8E A;  4E1J A;  3FLC O;  3JXU A;  1E4F T;  4FPB A;  5EX5 A;  3O08 A;  1MWK A;  2P9K B;  4FO0 A;  2FSK A;  4IXC A;  1NGF A;  2YJE A;  1X9J A;  4H5R A;  5AZJ B;  2E2O A;  3VGL A;  5F0X A;  2FF6 A;  2CGK A;  4K41 A;  1GLD G;  5BPL A;  1ZXO A;  3BF1 A;  3KVG A;  3VEZ A;  5AR0 A;  5EY4 A;  3OHR A;  2D0P A;  3LDP A;  4FWP A;  3DWL A;  3H6E A;  3CET A;  1NGC A;  4B1Y B;  4GY2 B;  1MA9 B;  4PL7 A;  5LY3 A;  4MLE A;  3WXL A;  5LJV A;  3VES A;  3R9P A;  2BTF A;  2ZF5 O;  3SJH A;  4C23 A;  3HI0 A;  1QQN A;  1E4G T;  1BO5 O;  4M63 C;  4WQ4 A;  2HF4 A;  3CJA A;  4M7X A;  3CJ1 A;  2ASP A;  2NRH A;  4BC3 A;  4AM6 A;  3AAP A;  3UKR B;  2P9K A; 
#chains in the Genus database with same CATH topology
 3VQ8 A;  4CED A;  3VET A;  3QBW A;  4IFV A;  1JKH A;  4DG1 A;  3KIO A;  3LDS A;  5GAD P;  5F2R A;  5FRM A;  1KLM A;  1YXQ A;  2G8W A;  4J2B A;  1J53 A;  3ZCM A;  3VEO A;  4FWK A;  4NB4 A;  2O8E B;  4DFJ A;  1VQN N;  3AV9 A;  4CJT A;  3HPO A;  1NU0 A;  4K43 A;  3SZ2 A;  3NHG A;  1WAF A;  3EO3 A;  5E26 A;  5GAE P;  4BE0 A;  1QTM A;  3MXI A;  3RWU A;  3E9P A;  5CHI A;  2ETJ A;  2AJQ A;  1O13 A;  4FLX A;  1T03 A;  4CHQ A;  3A5N C;  2P9L B;  1NJI O;  4DTR A;  2F8T A;  1G15 A;  4HCC A;  4RW9 A;  4CZL A;  1SS6 A;  5AQH A;  3HK2 A;  1Z26 A;  4BRQ A;  3KD5 E;  3ULE A;  3LDN A;  3O3F A;  4BRE A;  5IT9 O;  4JI5 K;  3FZF A;  4YOV A;  5KQD A;  4I7F A;  4E1N A;  3LP2 A;  4KO0 A;  1JLG A;  5AQR A;  2IVO A;  2P9S B;  3AVJ A;  2OZS A;  4UY8 O;  2HST A;  1C0F A;  3AVF A;  3NVM A;  4CEC A;  3DJC A;  5E41 A;  2FBX A;  3TSQ A;  1QHT A;  3DLE A;  2IIR A;  5LJW A;  4BEC A;  4CE9 A;  4M41 A;  1BG3 A;  1RT4 A;  3ZET B;  3JS6 A;  2R7Y A;  1VQ5 N;  3C65 A;  3MED A;  1U47 A;  3KHY A;  2P9L A;  2FSJ A;  4AIL C;  3VOV A;  2HVI A;  1T6D A;  2EWS A;  1RFQ A;  3ZX0 A;  3LM2 A;  4WQ4 C;  4CW7 B;  5C10 A;  2E6L A;  5AZI B;  1Y64 A;  2UYT A;  3KKR A;  3G71 N;  3OS0 A;  5KI6 A;  1TK8 A;  3LZJ A;  3KK2 A;  3CFO A;  3FFI A;  3QET A;  2P9S A;  4A59 A;  4MQ3 A;  2HOE A;  4JKB A;  4EIA A;  1QQO A;  4IKF A;  4F9O A;  1JXE A;  2HBM A;  4XH4 A;  3MXJ A;  1B9F A;  4E0D A;  3ZET A;  1T7P A;  2B6A A;  2BAN A;  3FFK B;  4F3T A;  3TI0 A;  3C94 A;  3HM8 A;  5KRT A;  4B9V A;  4BR7 A;  3NH1 A;  5SZT A;  4BY9 C;  4H0X B;  3KLI A;  5AZI A;  3NGI A;  1Q82 O;  4CZJ A;  3O1B A;  1ESV A;  1WB9 A;  3G25 A;  4O44 A;  4YOY A;  5LMU K;  3ZT1 A;  3MCA B;  3F73 A;  1B9D A;  3SQ0 A;  3HPG A;  5HOO A;  4CJV A;  3BY5 A;  4FLZ A;  2ZQB A;  3IKM A;  4YOU A;  4DSL A;  1VSI A;  5FLX O;  2VGM A;  2Z1G A;  4MO4 A;  4DU1 A;  4DV4 K;  3LAK A;  3DOK A;  3LP3 A;  4Y1C A;  5M1P A;  3ZX2 A;  1SUQ A;  1BOT O;  5CYQ A;  4DTX A;  4LSN A;  2QW9 A;  1Z25 A;  3WNF A;  2ASO A;  3QNO A;  3T1Y K;  1SL2 A;  1BI4 B;  3V9X A;  1BQN A;  2HHW A;  1ITG A;  3I8B A;  3RSE B;  3V9U A;  1VRT A;  1HYS A;  3VQE A;  4BRG A;  4JRQ A;  4OVL A;  4QS8 A;  4C8M A;  3QIP A;  3ENH A;  4OJR A;  4Y0W A;  4M3U A;  1S1W A;  4CJS A;  4X65 K;  5JVH L;  3SAG A;  5JVG L;  5C15 A;  3FZK A;  3ZT3 A;  4NCG A;  2HHH K;  4DS4 A;  3OBW A;  4PHT X;  5HLF A;  1J54 A;  2FSN A;  3SMS A;  4CJL A;  5EOY A;  2F8S A;  4BRM A;  1NLV A;  1N36 K;  4OKK A;  4FVM A;  1BI4 A;  1TYQ B;  4FLT A;  3IMX A;  2KZM A;  4CF1 A;  4HTL A;  1EQY A;  1LAW A;  4EHT A;  2F9T A;  3RSE A;  4CEA A;  5I9E B;  1LWC A;  3TTC A;  3D7E O;  3D6R A;  4IJN A;  1JLQ A;  4FJG A;  2VWJ A;  4B1V A;  3HZ6 A;  2HHT A;  1HQU A;  2IAJ A;  2J4R A;  3BEX A;  2G8U A;  1BA1 A;  3CPE A;  1S1V A;  1NKC A;  4GV3 A;  3RR7 A;  4DV0 K;  1EWQ A;  4FPA A;  4DU4 A;  2P5G A;  1S3X A;  2FLO A;  3M8Q A;  3U8X A;  4I6M B;  2E2N A;  3AGK A;  1T44 A;  4CZH A;  2WBN A;  3EL2 A;  3LPU A;  1HKB A;  4TSX A;  3R3L A;  4CIF A;  5KGW A;  4BGA A;  4C8N A;  3NCI A;  3FZH A;  4FWM A;  2JGU A;  2E2Q A;  4MO5 A;  3OVN A;  4IG0 A;  5BR8 K;  4WFB L;  4B3T K;  4BQL A;  1TYQ A;  1XI1 A;  4JK9 A;  2VG5 A;  5F1X A;  2OA8 A;  3ZT4 A;  3HRG A;  3AVH A;  3NMU A;  4PQU A;  5HRO A;  4CEE A;  2XY6 A;  3O3H A;  4N76 A;  1DGK N;  2H3G X;  3RRG A;  4B3M K;  3PX0 A;  3PUF A;  1GOB A;  3D45 A;  5GIP A;  5DM6 L;  1DLO A;  4I6M A;  1NKE A;  2A1S A;  2DFH A;  2G8I A;  2O8F B;  3A8Y A;  1IKW A;  3ID8 A;  1JLA A;  4GMJ B;  2QA4 N;  2RPI A;  5AQT A;  5CE3 A;  4FXD A;  1Q9Y A;  4CK2 A;  3OYL A;  4IOX A;  4JHD B;  4OX9 K;  4H0P A;  4DR5 K;  4KHW A;  1UA1 A;  3AO1 A;  4OLB A;  4AHS A;  3ZEU B;  3VER A;  1KAZ A;  2VG6 A;  1P90 A;  3V81 A;  1M90 O;  1L5U A;  1RDU A;  4EAH D;  4KH6 A;  2ZE2 A;  5AQL A;  4BRL A;  1IH7 A;  2ZGZ A;  5CYM A;  4BRI A;  4DFP A;  4M45 A;  4FJ5 A;  4YDU A;  3V9W A;  2O8F A;  4O8K A;  4MLH A;  2VGN A;  4CJK A;  4IWV A;  1RT7 A;  3C6H A;  2Y1I A;  2O8D B;  2NRT A;  3EKU A;  4KH5 A;  2RKI A;  5JEN A;  2D0B A;  3JYT A;  1NOY A;  1D5A A;  4JHD A;  4ELT A;  3TAE A;  5JLH A;  5KPZ A;  3DLB A;  3WEE B;  1HRH A;  3O9T A;  3AO5 A;  4OKE A;  4BR4 A;  3ZEU A;  2OPS A;  2EX3 A;  4JKF A;  1NGH A;  1WBD A;  2AP1 A;  1I39 A;  2GTD A;  1GOA A;  4OGC A;  4DSE A;  4U67 L;  3EYZ A;  4JS4 A;  1ZBL A;  5DK5 A;  4DR1 K;  4ID1 A;  1XNR K;  4DTS A;  4Z4F A;  1RT3 A;  4HHT A;  2E1Z A;  3ID6 A;  3QDK A;  1RBS A;  2O8D A;  1DTQ A;  4EHU A;  3F9K A;  4FW2 A;  3QIC A;  3KK1 A;  4BRA A;  4OPH A;  2RE2 A;  1VSJ A;  2CGJ A;  3DI6 A;  4IBN A;  1LCU A;  3DXM B;  3HVR A;  3MN7 A;  4LSL A;  4GNI A;  4JEP A;  2BE2 A;  1DKG D;  3AO4 A;  3WEE A;  4FJI A;  1VSK A;  2ZWH A;  3L3U A;  3IAY A;  1OVY A;  1Q8I A;  3KLE A;  4CJ4 A;  1HQE A;  2GUP A;  2LSN A;  4EZ6 A;  2A40 A;  3AAQ A;  1SAZ A;  2QWN A;  3WT0 A;  4KBO A;  4YFU A;  1OH8 A;  1KFD A;  3FLC O;  1E4F T;  4CEO A;  4FPB A;  1RT6 A;  1EP4 A;  4LH5 A;  2F4V K;  4B9U A;  4DMN A;  3CCQ N;  2Z1I A;  1A5X A;  3IG1 A;  3MX2 A;  1LWF A;  3LAM A;  4H5R A;  1YVU A;  4DR2 K;  4FJN A;  3ZSO A;  2KLA A;  3Q7C A;  4M3T A;  3ULD A;  2D0P A;  4JRP A;  3MEE A;  4B1Y B;  1S9G A;  3G0Z A;  3ZSR A;  4PL7 A;  4CF8 A;  1CXQ A;  3CCE N;  2IC3 A;  1K8A O;  3VES A;  3R9P A;  3C95 A;  4JI2 K;  3SJH A;  3JSM A;  2QKK A;  1YF5 L;  5FRN A;  4WQ4 A;  2HF4 A;  3CJA A;  3J7A P;  4M7X A;  3CJ1 A;  3SI6 A;  3PY8 A;  4CGD A;  4K8X A;  5BRE A;  1XWL A;  1RT1 A;  2HF3 A;  3QIO A;  3HXM A;  2UUB K;  1TK0 A;  3HP9 A;  4FJH A;  2FF3 B;  1NJX A;  4E89 A;  1NJY A;  3AAR A;  3L2Q A;  1GLL O;  1HKG A;  2P9P B;  3HT3 A;  4H5V A;  2HNZ A;  4M42 A;  4FWN A;  3H46 O;  1KVB A;  4A2B A;  1RBV A;  4PL8 A;  2QWP A;  4N5S A;  4I2Q A;  3SJJ A;  4LFA K;  3VF6 A;  3QEV A;  3ITH A;  3ZYY X;  3CQX A;  1K8K B;  4J2A A;  3IS9 A;  4O55 A;  5K14 A;  4BRH A;  1C1C A;  3KD1 E;  2ITM A;  1RBR A;  3TPQ A;  4RWT A;  2X74 A;  4R5P A;  3NF8 A;  3OBY A;  4XIU A;  4K0K K;  1B92 A;  4JI4 K;  3UE5 A;  1CLQ A;  3TAQ A;  4F2R A;  4C8O A;  1OH7 A;  1NK8 A;  2UXD K;  3G6E N;  1GLJ O;  5E84 A;  3TAF A;  3L2U A;  2P9P A;  4CF2 A;  3GDQ A;  3EZW A;  2W40 A;  4H0V B;  2WON A;  2KZZ A;  2Z1J A;  3NBP A;  1KQS M;  1U6Z A;  5AFU H;  4O5F A;  4W5N A;  3TTF A;  4DV7 K;  4DU3 A;  4NYN A;  1SQK A;  4OKJ A;  3WNE A;  1HYZ A;  1S1U A;  1K8K A;  1RCH A;  1SKW A;  3K9J A;  3CIP A;  3DLH A;  3CI5 A;  5M1Q A;  1IV0 A;  2IVP A;  5EVZ A;  4BG9 A;  1IBL K;  4FZX C;  1X3N A;  3VN5 A;  3BP8 A;  4LF9 K;  3O80 A;  2FBV A;  4B1Z A;  1Q7Y O;  5J1E A;  2RHK A;  1S6P A;  3SNN A;  4WF9 L;  4CJP A;  3GE1 A;  2PYJ A;  3OYK A;  2UXB K;  1X3M A;  1ATN A;  3CQ8 A;  3L6Q A;  1HPM A;  2OPP A;  2QWL A;  1OH5 A;  4KTQ A;  2I5J A;  3MEC A;  1W0H A;  3C0B A;  3L8B A;  4EZ9 A;  5C2F A;  2O8C B;  4CFC A;  1NK9 A;  4RCH A;  4OLA A;  4BVP A;  4NLB A;  3O6W A;  1XHX A;  1WN7 A;  2GEM A;  4B9S A;  3F5T A;  3OA9 A;  5TKY A;  3OS1 A;  3RTV A;  3ZT2 A;  4JKH A;  2KFN A;  4QOZ B;  4ZHR A;  1T3V A;  3B8A X;  1KVC A;  3THY B;  3MK6 A;  3AVC A;  2KFZ A;  1BCO A;  4DQ8 A;  1WSH A;  4FSV A;  3T7Z A;  3CME N;  2O8C A;  1XHZ A;  3CCR N;  3MEG A;  4E19 A;  3I0R A;  1HNW K;  1YT3 A;  4BE7 B;  3H1Q A;  4DCH A;  3GG4 A;  3TAG A;  2VWB A;  4QS7 A;  3OYC A;  4BC5 A;  4DTP A;  2A6A A;  3WNG A;  3O3G A;  1X9W A;  1WNS A;  4J2E A;  3EN9 A;  3SYZ A;  3B6P A;  4IOC L;  3K5M A;  3QB0 A;  5GAG P;  4O5B A;  5KRS A;  3EY1 A;  2HHI A;  4YOT A;  3DOL A;  4EP5 A;  1ASW A;  1ZYQ A;  1SL0 A;  3WUH A;  4DSI A;  5AQO A;  3THY A;  4Y1D A;  3S5T A;  3ENB A;  2ZM6 K;  4KRF A;  4H5N A;  2E5L K;  4EP4 A;  1LAV A;  2OAN A;  3QO9 A;  2HMI A;  5A2Q O;  3HBT A;  1VQM N;  4DTN A;  2F7T A;  3HSC A;  1VRU A;  4BRN A;  5SWM A;  4B3R K;  1QQM A;  3CER A;  3LPT A;  4Z4C A;  3J80 O;  3S9H A;  4FK0 A;  4WE1 A;  4FYD A;  4CHZ A;  1QZ6 A;  2DFF A;  1S1X A;  2FBT A;  3L2V A;  3WQU A;  4G1Q A;  3EEQ A;  2ZJP L;  4CHP A;  1MU2 A;  4RW7 A;  1VSF A;  3VEN A;  2GBZ A;  1VSL A;  2V7Z A;  5GIN A;  1N33 K;  4DR7 K;  5FPE A;  2ZJQ L;  4CCH A;  4BRD A;  3VQP A;  1JLF A;  3H3N O;  5KQ8 A;  3KLH A;  1REV A;  3IUC A;  1QSY A;  3VF4 A;  1BU6 O;  3A5O C;  3ZSQ A;  3HP6 A;  4W5T A;  3K2P A;  1UWB A;  4B1W B;  1QVG M;  3T19 A;  3SUQ A;  3CFP A;  4CES A;  3RRH A;  1NMN A;  5D3G A;  1ASU A;  4ELV A;  1HNI A;  3MN5 A;  1OKJ A;  2W00 A;  1N32 K;  3VQ7 A;  3CC4 N;  3AVK A;  3GL1 A;  1JLC A;  4CZG A;  3U9D A;  2P9I B;  2RN2 A;  2Q36 A;  4J8F A;  1HJO A;  4ILJ A;  4BRF A;  3PV8 A;  4B1X B;  4DUZ K;  1FXX A;  1YTA A;  4CGF A;  5BRF A;  1ZBI A;  2ZD1 A;  4LF8 K;  2JWK A;  1RDD A;  1BA0 A;  1JL1 A;  3BZC A;  5HRS A;  4DR6 K;  4BRK A;  1KXP A;  1NBW A;  1JCF A;  3QIN A;  4CEZ A;  1TKT A;  4HUE A;  3EE8 A;  3WNH A;  3QEX A;  1L3T A;  3AVI A;  1SKR A;  1VSH A;  3CCS N;  1L3U A;  1SL1 A;  3SMP A;  4BAC A;  3AVG A;  1M1K O;  3VPZ A;  4AM7 A;  2AA4 A;  1DT9 A;  2P9I A;  4CJR A;  4OPA A;  3L2R A;  5M1N A;  2BH1 A;  3S41 A;  4BR5 A;  2A3Z A;  3RMC A;  2ITG A;  5M1K A;  3SV4 A;  2YI1 A;  2Q31 A;  2BUP A;  3MAQ A;  5ELZ A;  1P8Z A;  2V52 B;  1U49 A;  2GEL A;  4DV2 K;  2CH5 A;  4PKI A;  1YUW A;  3LWM A;  5C12 A;  4GVM A;  1VQP N;  3BGR A;  2GWK A;  4IG3 A;  5I42 A;  4YOX A;  1RDW X;  4WFN L;  1YJ9 N;  4CEQ A;  3O4N A;  2WFB A;  4G9Z A;  3A5M C;  1IJJ A;  2NNW A;  5C42 A;  2XO7 A;  2HHQ A;  2Q97 A;  4K25 A;  4PUO A;  3VTH A;  1LW2 A;  1X1P A;  3QFP A;  2YNH A;  3N4Q A;  1CZ9 A;  3MWT A;  4OPJ A;  4DTU A;  3C6T A;  4KH4 A;  4NCB A;  3SCX A;  2Y1J A;  4DWI A;  4CD3 A;  1KRP A;  4KI4 A;  3K59 A;  4XH1 A;  3A5L C;  3O9S A;  4KTZ A;  1N8R O;  1Z6R A;  1TL1 A;  4JNE A;  4E7H A;  5KPT A;  3V1O A;  1T6C A;  3CC7 N;  3ENO A;  3AA3 A;  4B9N A;  2O4G A;  4U7B A;  3L3V A;  4PKG A;  4BE2 A;  4CGG A;  1YI2 N;  4AH9 A;  3OTO K;  3R8E A;  4KFB A;  3M8P A;  1F21 A;  5CY4 A;  1BCM A;  4IXC A;  1RIL A;  4JI8 K;  5AZJ B;  3HL8 A;  3CM6 A;  4DQP A;  2XY7 A;  5BPL A;  1ZXO A;  4NYF A;  5EY4 A;  3QEP A;  1TKD A;  1RT5 A;  4CGH A;  3DWL A;  3H6E A;  1NK7 A;  5I3U A;  4GY2 B;  1VQK N;  1Q81 O;  1KTQ A;  1WSE A;  1HNZ K;  3R1X A;  4MLE A;  3WXL A;  5LJV A;  3QER A;  4C23 A;  3HI0 A;  1I3A A;  1QQN A;  3J81 O;  1BO5 O;  4M63 C;  1U45 A;  1KFS A;  3S3N A;  3WXM B;  3SQ1 A;  2NRH A;  4BC3 A;  3VQD A;  4C1N K;  1TK5 A;  3UKR B;  3OYN A;  3U4L A;  4H8K A;  3K0S A;  4GV6 A;  3FE1 A;  5ADX H;  3GOI A;  1NG9 A;  5KPR A;  5AZJ A;  4DV5 K;  4CF9 A;  1Y97 A;  1WOQ A;  2NRV A;  3ZSW A;  3L4Q A;  3MN9 A;  5HRR A;  4CBW A;  3OYJ A;  5J2M A;  2IVN A;  1FKP A;  4LF4 K;  1C6V A;  1JCG A;  3T69 A;  4CJ5 A;  5J2Q A;  3SQ4 A;  3I8D A;  4JKE A;  4KI6 A;  2I7P A;  4CER A;  4K42 A;  2HW3 A;  2KQ2 A;  4B9L A;  3MDQ A;  4FOE A;  2YHA A;  2DFE A;  2QWR A;  4R79 A;  3UKR A;  1MWM A;  3V1R A;  3QES A;  4XEI A;  1RBT A;  4IJA A;  3DRP A;  1HMV A;  2QWQ A;  4JI0 K;  1S1T A;  1ZBH A;  1TKX A;  4Z4G A;  1V4T A;  1TGO A;  3D0P A;  4AHC A;  4CD1 A;  4NO7 A;  1WSF A;  4CHN A;  4FJ8 A;  4M3Y A;  1RTD A;  1XNQ K;  3J7Y P;  4DSF A;  1EXQ A;  4KAZ A;  1YVN A;  2P5O A;  3PLA A;  2NRX A;  4N47 A;  2W6L A;  3UIQ A;  4JI7 K;  3C7N B;  3AA4 A;  4HUF A;  3I55 N;  4NCA A;  4JKA A;  5AQI A;  3UKU B;  2O4I A;  4FM2 A;  3O8M A;  4E3S A;  3CM5 A;  3OYE A;  2NRZ A;  3DLK A;  4RG8 A;  1UOC A;  1IBM K;  3SQ2 A;  4M7Y A;  3EE9 A;  3VA0 A;  2YNF A;  4RTF D;  3QNN A;  3SPZ A;  1H1V A;  2IOC A;  1C0T A;  2HMP A;  4QS9 A;  2HHV A;  4IDK A;  3P1G A;  5GIO A;  2WC9 A;  2E4L A;  2Z1H A;  1NM1 A;  4ILG B;  1OH6 A;  4B3S K;  2GV9 A;  2ZJR L;  4LF7 K;  1ASV A;  3FZM A;  2O8B B;  2FC0 A;  4J2D A;  3GBT A;  2G8H A;  3IDH A;  4JKG B;  3SAH A;  4DSJ A;  3C7N A;  1YAG A;  4DQR A;  1FW6 A;  3I0S A;  1UA0 A;  5CZ2 A;  3UKU A;  3V4I A;  3OYG A;  1RBU A;  1HJR A;  1NMD A;  3O9U A;  4GVE A;  3AVL A;  2HBK A;  1W2B M;  4CK3 A;  2V51 B;  1TAU A;  5DM7 L;  4GKJ K;  4CF0 A;  1XUP O;  1MDU B;  3E1Y A;  3E9O A;  5FPM A;  4H0T B;  4JKC A;  1HNV A;  1XC9 A;  2D1K A;  5HP1 A;  3SUO A;  4A5A A;  3NDK A;  4FLY A;  1C0G A;  4BRP A;  2UUC K;  4BE1 A;  4BQZ A;  4C8K A;  3KJV A;  3RVC A;  2O8B A;  5AJ3 K;  2HND A;  4ILH A;  1BIZ A;  4JLH A;  4JKG A;  3PX6 A;  2X6N A;  1RTJ A;  1NGJ A;  4BC4 A;  2KHO A;  5AQQ A;  2A1R A;  4FLW A;  4FM1 A;  3VMF B;  1BDG A;  3EKS A;  2VWK A;  4ID5 A;  2HHS A;  1IG8 A;  3AVN A;  4M3X A;  1VQ6 N;  5AQV A;  4CJE A;  4BVO A;  3LWL A;  1X9M A;  2ASM A;  3O4W A;  4IO8 A;  4DLG A;  4X62 K;  3HVT A;  1VSD A;  4BRC A;  4DR3 K;  4O0J A;  3RMB A;  3HOS A;  4E72 A;  2OTL N;  2XRI A;  1LOT B;  1S22 A;  1WSJ A;  5GAH P;  4B8A B;  3TSU A;  4FW1 A;  4FWS A;  3ZSX A;  3CYM A;  5JLF A;  1U4B A;  3LM9 A;  4KHS A;  4KHN A;  2OZM A;  3DRR A;  4CGJ A;  3M1F A;  1BUP A;  1VSE A;  5JS1 A;  4H0Y B;  3SK3 A;  3LL3 A;  5AFU A;  1N6Q A;  4FWO A;  3WXJ A;  4ZTF A;  4FJ7 A;  3KTQ A;  3HTV A;  1RGI A;  2YCH A;  3K5N A;  1NGB A;  3G10 A;  3DLG A;  3TAN A;  3NF6 A;  5JS2 A;  4E1M A;  5AQY A;  4DTM A;  1ZBS A;  4DQI A;  4JYA K;  3KKS A;  1RTH A;  2A42 A;  5AQM A;  1EWR A;  3NFA A;  4F4K A;  4H0O A;  1BWF O;  1S9E A;  4BRO A;  3CQY A;  2E88 A;  1YJW N;  1U48 A;  3OW2 M;  1T05 A;  5AQP A;  2X78 A;  3T1A A;  5BPM A;  4E7J A;  3G4S N;  3LDO A;  2VQF K;  2BGG A;  4JK8 A;  1VK0 A;  4YDU C;  4CZE A;  1J5E K;  3C6A A;  4CGI A;  1K6Y A;  1QVF M;  4E7I A;  5BN9 A;  3CHW A;  3T3F A;  4XH5 A;  1N34 K;  4OGE A;  3D2F B;  4FVU A;  1NKB A;  3VEV A;  4PY5 A;  5AQK A;  3UB5 A;  3SBG A;  4CJU A;  1LV5 A;  3TR8 A;  2OPR A;  2IS3 A;  4BR2 A;  1NGE A;  4K8Z A;  4ICL A;  3OYI A;  2X6S A;  1XQS C;  5CZ1 A;  3MCP A;  4BWM A;  4M3R A;  3FZL A;  1JJ2 M;  3SV3 A;  2PFU A;  4CJQ A;  2YHX A;  5C0Y A;  3PSI A;  4PA1 A;  5AQU A;  4LD0 A;  5BPN A;  1EX4 A;  4DV1 K;  4DTO A;  4Z94 A;  4A2A A;  3BZK A;  3H3O B;  3RMA A;  4FWQ A;  1BIU A;  3B6O A;  4LFC K;  3K5O A;  2QXF A;  1KVA A;  3D2F A;  3LP1 A;  2E1Y A;  4X64 K;  3PO5 A;  3W3D A;  2QK9 A;  4FJJ A;  2BDP A;  4IEE A;  2QWM A;  3AVB A;  3U6F A;  4CHY A;  2Q2R A;  2P51 A;  4CK1 A;  4EFH A;  3OY9 A;  3CXC M;  3SUP A;  1T8E A;  4QAG A;  4A5B A;  4LFB K;  1TUU A;  2W6K A;  4YNQ A;  4MDA A;  5T7B A;  3ZSV A;  4JN4 A;  5KGX A;  4IOA L;  3KLG A;  1WUA A;  3KLF A;  3CJ9 A;  4KKO A;  3OYF A;  3QLH A;  2HBL A;  1KLN A;  4FL9 A;  4DKW A;  3DXK B;  2P1J A;  2D5R A;  3BUZ B;  3PO4 A;  4B9T A;  4X66 K;  4FJ9 A;  1VQ9 N;  1NGG A;  1LWE A;  2O8E A;  2GWJ A;  4FJM A;  3U9Z A;  4IEI A;  1D9F A;  3CCM N;  4H03 B;  4BDZ A;  1HPZ A;  2OTJ N;  2YKN A;  1G99 A;  5HRN A;  1TAQ A;  3S3M A;  2CGL A;  3RMD A;  2E6M A;  4M3Z A;  4HVJ A;  3VGM A;  4BGB A;  3K57 A;  3R6M A;  4MFB A;  4DR4 K;  4IFY A;  3P5J A;  4WQ5 C;  4CJ3 A;  4DS5 A;  3I56 N;  2UXC K;  4YHH K;  1DEJ A;  2PZS A;  1CZB A;  3VF2 A;  4DUY K;  1QHA A;  2OCE A;  3E66 A;  1HNX K;  3QBX A;  3NGY A;  4CJ7 A;  1D8Y A;  4CZM A;  3LZI A;  5EU7 A;  3DXK A;  3IFR A;  3ZLJ A;  5KTQ A;  1X9S A;  4DTJ A;  3O08 A;  3BDP A;  4FO0 A;  2FSK A;  4M3W A;  1DTT A;  2E2O A;  3VGL A;  4CJW A;  3QEI A;  3P31 A;  1GLD G;  3C6U A;  3VEZ A;  5AR0 A;  2XHB A;  4I2P A;  2JLE A;  3LDP A;  4FWP A;  3AO2 A;  3CET A;  1NGC A;  4O8U A;  1QSL A;  1HR0 K;  3OYH A;  2YX6 A;  3CMA N;  5H1S Q;  4KPY A;  2BTF A;  2ZF5 O;  1I94 K;  1A5W A;  1RDC A;  1E4G T;  4JV5 K;  2ASP A;  3P38 A;  4CFB A;  3AAP A;  1GLE G;  1W9H A;  3FGU A;  4A57 A;  1Q18 A;  4CIG A;  4N56 A;  1J5O A;  2F9W A;  4YOW A;  4FK2 A;  1YHQ N;  1IBK K;  3TAR A;  1E3M A;  3L4I A;  1KCF A;  3DMJ A;  1YJN N;  3NVK A;  4PWD A;  2OYQ A;  2G8K A;  4E7K A;  3OYM A;  3M3Z A;  2HHU A;  4KHU A;  2QI2 A;  3CCJ N;  1GOC A;  4B3O A;  4FCY A;  2YHY A;  2B5J A;  4L3Q A;  3AA2 A;  2F96 A;  3P83 D;  3VA3 A;  5B8H A;  2D4W A;  2EHG A;  1EET A;  3M5R A;  5AQJ A;  4I9Q A;  1IG9 A;  2QKB A;  3VQ5 A;  3ZX3 A;  4CBU A;  3M8S A;  4WCE L;  3DYA A;  2UU9 K;  3SPY A;  4B8C A;  3NH2 A;  5TKW A;  3F2K A;  4B9Q A;  4FK4 A;  3VTI A;  3TAP A;  1S6Q A;  3THV A;  4OPK A;  4HTU A;  1VQ7 N;  1HX1 A;  3CYG A;  3HOT A;  3VEX A;  1UAX A;  4A61 A;  4BR0 A;  1CXU A;  4CZK A;  1QQC A;  4NLC A;  3M6G A;  4KTW A;  2PBD A;  4C1N I;  4FOI A;  3MMV A;  1C1A A;  1N5Y A;  2FXU A;  3SBT A;  4W5O A;  2C1I A;  1HYV A;  1RTI A;  3V1Q A;  4JD2 B;  4DV3 K;  2HVH A;  1TV6 A;  2QEX N;  5BRH A;  3H08 A;  3CPW M;  3TAB A;  2OPQ A;  1KAX A;  1EKE A;  3QEW A;  2QTD A;  1WLJ A;  5BN8 A;  2YHB A;  5EXW A;  3A0I X;  4BWJ A;  4CFD A;  4LF5 K;  5LMN K;  3J7Z O;  4FJK A;  1C0U A;  5FDL A;  3TAM A;  1S72 N;  2HNY A;  2Q0U A;  3VQ9 A;  3OYA A;  3O4Q A;  3TWH A;  4HCB A;  4DF8 A;  4JD2 A;  1TKZ A;  3CJ7 A;  2IDO A;  2IGI A;  1KD1 O;  5CR4 A;  2PY5 A;  4ISG A;  3MX5 A;  2YKM A;  1NK5 A;  2E2P A;  3CCU N;  5IWA K;  4CHO A;  5HBM A;  3AVM A;  5JMV A;  1NWK A;  3J8A A;  4JK7 A;  2FBY A;  4NXN K;  3AO3 A;  3AY9 A;  4IDH A;  3KZB A;  4AHU A;  3NAE A;  5JIC A;  1TL3 A;  1VSM A;  1WSI A;  1V4S A;  4AHV A;  5DMR A;  1LW0 A;  3WXI A;  4CEF A;  3QML A;  1VAZ A;  4W5Q A;  3VQA A;  3AA5 X;  3DAW A;  1RDB A;  2XY8 A;  4LF6 K;  3SUN A;  5J2N A;  2G8F A;  1TVR A;  1VQL N;  3ATU A;  4H5T A;  3O5B A;  5ADX A;  3OYB A;  4IO9 L;  2W42 A;  3LDQ A;  1QE1 A;  3E9L A;  3L0Q A;  3CCL N;  1VHX A;  3SLC A;  3P39 A;  5FRO A;  4Q0B A;  2YJF A;  4PKH A;  3VEW A;  3U3Y A;  2HB5 A;  4AHR A;  5C25 A;  4ISF A;  4UQG A;  1VQO N;  1SZ2 A;  1HLU A;  4CI6 A;  2VYP A;  1CZA N;  4KB0 A;  1FKO A;  3ZT0 A;  4ISE A;  5AQS A;  3CCV N;  4FLU A;  2VCP A;  1ATS A;  4N41 A;  3F9M A;  4O0I A;  1TUY A;  3H45 C;  4FWR A;  3VEY A;  3DM2 A;  1WBB A;  4W5R A;  4Z4E A;  5BR9 A;  1NK4 A;  3MXM A;  2B4J A;  1R59 O;  4B9M A;  4ZTJ A;  2CH6 A;  4CZI A;  2DPN A;  4LH4 A;  1FK9 A;  2VQE K;  3Q7B A;  5AQG A;  1QS4 A;  1K73 O;  3HST B;  3QFU A;  3VQB A;  4DFM A;  1BIS A;  3PSF A;  1K9M O;  1NNE A;  1ILY A;  1NGA A;  4IZ9 A;  4Z0U A;  4DQQ A;  2KKZ A;  2GUI A;  4F8R A;  4CVN E;  4ELU A;  4KRE A;  1NJW A;  3VQC A;  2A41 A;  4KV8 A;  5C2D A;  2QXL A;  1RT2 A;  4AF1 A;  3D2E B;  4F2S A;  4BR9 A;  2RF2 A;  1BHL A;  3N4P A;  4H4O A;  2D0A A;  4KB1 A;  4MDB A;  1C1B A;  2C1G A;  1EO1 A;  1NJZ A;  5AQN A;  2GX9 A;  1NK6 A;  4WYB A;  1GLB G;  4CEB A;  3V9S A;  4DFK A;  1W7A A;  5FPN A;  1IKX A;  3DRS A;  3CFR A;  4LY7 A;  3OJU A;  1D4X A;  1RDA A;  3H1V X;  4GKK K;  1JL2 A;  3ZSZ A;  4DSK A;  5MLC Q;  2P9N B;  1GLA G;  1ZBU A;  2YHW A;  1Q9X A;  4DF4 A;  1JLB A;  3K9K A;  3TU5 A;  3RR8 A;  1OVQ A;  4DQS A;  4L8R B;  3OS2 A;  5AQW A;  5AQZ A;  2D0O A;  3S3O A;  3T1H K;  1GLC G;  5C24 A;  4CBX A;  3D2E A;  1IKV A;  4F3O A;  3L2W A;  4BG8 A;  5AQF A;  3CJC A;  3O1W A;  1QSS A;  4XJX A;  2NLX A;  3DXM A;  3CD6 N;  1SKS A;  3KK7 A;  5M1F A;  1VQ4 N;  4LC9 B;  3E01 A;  2P9U B;  4OO1 J;  1GLF O;  1NGI A;  2WOM A;  4JI3 K;  4BC2 A;  4BEB A;  2E8A A;  1Q86 O;  2HBJ A;  4JAX A;  2HHX A;  3ATV A;  3TTD A;  3W0L A;  1BL3 A;  4WQ5 A;  2JWL A;  1J9A A;  4QCL A;  1KAY A;  4CZF A;  4HWI A;  5HRP A;  2P9N A;  3KWI A;  1JLE A;  4YOR A;  4H5W A;  3THW B;  2NZT A;  1XC3 A;  2XY5 A;  3BF3 A;  4JI6 K;  4AHT A;  4Z4I A;  4RW6 A;  1U2V B;  1FJG K;  3PX4 A;  4GW6 A;  1R0A A;  3NE6 A;  3AVA A;  5BRD A;  3MN6 A;  3K58 A;  3EZ5 A;  3PIO L;  1YIJ N;  4E7L A;  4DB3 A;  1D9D A;  2P9U A;  4CIE A;  3HO1 A;  4B08 A;  2Q0R A;  1IO2 A;  1NGD A;  4CFA A;  1ZBF A;  2VG7 A;  2Q3S A;  4FWL A;  3OYD A;  4H4M A;  3HM9 A;  4DV6 K;  3DLL L;  1XMQ K;  1QZ5 A;  3O9R A;  1KC8 O;  4BDP A;  4FZY A;  1YTU A;  3KK3 A;  2PAV A;  3THW A;  3AGR A;  3VQQ A;  1RNH A;  4I9L A;  3M8R A;  4YY3 K;  1SV5 A;  4Q5V A;  1HUX A;  4B1U B;  1VQ8 N;  1U2V A;  3P4I A;  2WTU A;  2ZGY A;  3V9Z A;  4C8L A;  2QWO A;  3WQT A;  3O9Q A;  3VGK A;  3ZSY A;  4FJL A;  1BQM A;  4FZZ A;  3I33 A;  4DHY A;  3CJB A;  3THX B;  1Z05 A;  4FM0 A;  3A2F A;  2E20 A;  4FJX A;  3CG7 A;  4FLV A;  3LAN A;  1J6Z A;  3FR0 A;  4JKD A;  4KHY A;  3DLR A;  1W97 L;  4RW8 A;  5FPD A;  2G8V A;  3OJS A;  3CF5 L;  3V6D A;  4V19 S;  3NGZ A;  2Q1N A;  4RW4 A;  1S5J A;  3CC2 N;  2ATQ A;  3KWG A;  2NRR A;  3VQ4 A;  1HKC A;  4JS5 A;  2W41 A;  4KHQ A;  3WXK A;  3NF7 A;  1BGX T;  5AQX A;  4CJF A;  5M1O A;  2A5X A;  2I7N A;  2QM1 A;  3U3G A;  3ASM A;  1JCE A;  3NH0 A;  1IKY A;  4NXM K;  2NUB A;  4A62 A;  2V7Y A;  3MWP A;  1ATR A;  1WAJ A;  1XMO K;  2WUS A;  4WFA L;  3LDL A;  1ZC6 A;  4BDY A;  3THX A;  4JI1 K;  4E1J A;  3JXU A;  2YV0 X;  3HJF A;  2YNG A;  5EX5 A;  4Z4H A;  3IRX A;  1L3V A;  2DTU A;  1JXB A;  3LAL A;  1MWK A;  3HYF A;  2KW4 A;  4O4G A;  2P9K B;  1L3S A;  1C0M A;  1NGF A;  2YJE A;  3SAF A;  1X9J A;  2KTQ A;  2DY4 A;  1YIT N;  3HPH A;  5F0X A;  2PYL A;  2FF6 A;  2CGK A;  2NRW A;  3LP0 A;  4HUG A;  4K41 A;  2YNI A;  3PIP L;  3TSP A;  3BF1 A;  3KVG A;  1A5V A;  2UUA K;  5LL6 Z;  3JAM O;  3OHR A;  1U04 A;  1WSG A;  4DLE A;  4GV9 A;  1MA9 B;  4AQY K;  5LY3 A;  1KSP A;  1O1W A;  4KHP K;  4IFE A;  3NF9 A;  1NOZ A;  5J2P A;  3ISN C;  1NK0 A;  3VQ6 A;  2D0C A;  3ALY A;  4AM6 A;  5HL7 L;  3ULE B;  3K5L A;  2P9K A; 
#chains in the Genus database with same CATH homology
 3FGU A;  3U4L A;  4A57 A;  3VET A;  1Q18 A;  4GV6 A;  3QBW A;  3FE1 A;  2F9W A;  5ADX H;  5BRE A;  4YOW A;  1YHQ N;  3GOI A;  5KPR A;  5F2R A;  3L4I A;  2HF3 A;  5AZJ A;  5GAD P;  1WOQ A;  1YXQ A;  2NRV A;  1YJN N;  3VEO A;  4FWK A;  3NVK A;  4NB4 A;  3L4Q A;  3MN9 A;  3M3Z A;  4CBW A;  2FF3 B;  1VQN N;  2IVN A;  2QI2 A;  3CCJ N;  3AAR A;  4K43 A;  1GLL O;  1HKG A;  2P9P B;  1JCG A;  3EO3 A;  4H5V A;  5E26 A;  3T69 A;  2YHY A;  5GAE P;  4FWN A;  3H46 O;  4A2B A;  4JKE A;  3E9P A;  4L3Q A;  5CHI A;  2I7P A;  4PL8 A;  5B8H A;  2D4W A;  1O13 A;  2QWP A;  3M5R A;  4K42 A;  3A5N C;  5AQJ A;  2P9L B;  1NJI O;  3MDQ A;  4FOE A;  3VF6 A;  3ZX3 A;  4CBU A;  3ZYY X;  4WCE L;  3CQX A;  1K8K B;  1GLE G;  4CZL A;  2QWR A;  1SS6 A;  4BRH A;  5AQH A;  4BRQ A;  4R79 A;  3UKR A;  3ULE A;  2ITM A;  3LDN A;  1MWM A;  4BRE A;  3TPQ A;  4XEI A;  4RWT A;  3FZF A;  5TKW A;  4YOV A;  3OBY A;  3F2K A;  4IJA A;  4B9Q A;  5KQD A;  2QWQ A;  3UE5 A;  3VTI A;  5AQR A;  2IVO A;  2P9S B;  1VQ7 N;  1V4T A;  4UY8 O;  2HST A;  1C0F A;  1HX1 A;  3NVM A;  4CD1 A;  3G6E N;  1GLJ O;  3DJC A;  5E84 A;  3VEX A;  4A61 A;  4NO7 A;  3HOT A;  3TSQ A;  4BR0 A;  2P9P A;  2IIR A;  3GDQ A;  3EZW A;  5LJW A;  4CZK A;  2W40 A;  4H0V B;  4BEC A;  4NLC A;  3M6G A;  2PBD A;  4C1N I;  4FOI A;  3MMV A;  1BG3 A;  3ZET B;  1KQS M;  1U6Z A;  2FXU A;  3JS6 A;  3SBT A;  1VQ5 N;  5AFU H;  1YVN A;  3C65 A;  2C1I A;  4O5F A;  3PLA A;  4JD2 B;  2NRX A;  3KHY A;  3TTF A;  2P9L A;  1SQK A;  2FSJ A;  3C7N B;  3VOV A;  1K8K A;  1T6D A;  2EWS A;  1RFQ A;  3ZX0 A;  3I55 N;  3LM2 A;  4WQ4 C;  2QEX N;  3K9J A;  3CIP A;  4JKA A;  5AQI A;  5BRH A;  3UKU B;  3CI5 A;  3CPW M;  5C10 A;  5M1Q A;  1KAX A;  5AZI B;  2IVP A;  5EVZ A;  4BG9 A;  1Y64 A;  1X3N A;  2UYT A;  3BP8 A;  3O80 A;  2QTD A;  3G71 N;  3O8M A;  4B1Z A;  1Q7Y O;  2RHK A;  2NRZ A;  5BN8 A;  5EXW A;  4WF9 L;  3A0I X;  2P9S A;  4A59 A;  3GE1 A;  3J7Z O;  4M7Y A;  3EE9 A;  1X3M A;  1ATN A;  4RTF D;  2HOE A;  4JKB A;  4EIA A;  1QQO A;  3L6Q A;  1HPM A;  1H1V A;  2HMP A;  4F9O A;  4QS9 A;  1S72 N;  2QWL A;  5GIO A;  2WC9 A;  1NM1 A;  2Q0U A;  4ILG B;  2ZJR L;  2HBM A;  4XH4 A;  3C0B A;  3ZET A;  5C2F A;  3FZM A;  3FFK B;  4JD2 A;  3CJ7 A;  1KD1 O;  3GBT A;  5CR4 A;  3IDH A;  4JKG B;  3SAH A;  3C7N A;  3HM8 A;  4ISG A;  4RCH A;  1YAG A;  4BVP A;  3MX5 A;  2E2P A;  4BR7 A;  4NLB A;  3CCU N;  3O6W A;  3UKU A;  4BY9 C;  4H0X B;  2GEM A;  5JMV A;  1NWK A;  3J8A A;  4JK7 A;  5AZI A;  1NMD A;  3O9U A;  3F5T A;  4GVE A;  3AY9 A;  3OA9 A;  4IDH A;  3KZB A;  5TKY A;  4CZJ A;  2HBK A;  1W2B M;  1Q82 O;  3O1B A;  1ESV A;  2V51 B;  5JIC A;  3G25 A;  5DM7 L;  4YOY A;  1XUP O;  3MCA B;  1MDU B;  3E1Y A;  3E9O A;  5FPM A;  1V4S A;  4H0T B;  4JKC A;  4JKH A;  5HOO A;  2D1K A;  3WXI A;  3QML A;  1T3V A;  3B8A X;  1VAZ A;  3IKM A;  4YOU A;  4A5A A;  3MK6 A;  3DAW A;  1C0G A;  4BRP A;  2VGM A;  4BQZ A;  4DQ8 A;  3RVC A;  1VQL N;  3ATU A;  4H5T A;  4FSV A;  3O5B A;  4MO4 A;  3T7Z A;  5ADX A;  3CME N;  4IO9 L;  5M1P A;  3CCR N;  4ILH A;  3ZX2 A;  1BOT O;  4JKG A;  3LDQ A;  4BE7 B;  2QW9 A;  3E9L A;  3H1Q A;  2ASO A;  3L0Q A;  1NGJ A;  3GG4 A;  4DCH A;  3SLC A;  3P39 A;  2VWB A;  4BC4 A;  4QS7 A;  2KHO A;  5AQQ A;  2YJF A;  4PKH A;  4BC5 A;  3VEW A;  2A6A A;  1VQO N;  4ISF A;  3VMF B;  1SZ2 A;  1BDG A;  1HLU A;  2VYP A;  1CZA N;  3EKS A;  3I8B A;  4CI6 A;  1IG8 A;  3RSE B;  3EN9 A;  1VQ6 N;  5AQV A;  4ISE A;  5AQS A;  4IOC L;  3CCV N;  4BVO A;  3QB0 A;  5GAG P;  4BRG A;  2VCP A;  4QS8 A;  1ATS A;  4YOT A;  2ASM A;  3WUH A;  3O4W A;  4IO8 A;  5AQO A;  3F9M A;  1TUY A;  3ENH A;  4Y0W A;  3H45 C;  4FWR A;  3VEY A;  3ENB A;  4H5N A;  5BR9 A;  5JVH L;  3SAG A;  2OAN A;  5JVG L;  5C15 A;  3FZK A;  1R59 O;  4BRC A;  3HBT A;  1VQM N;  3OBW A;  2CH6 A;  4CZI A;  2DPN A;  2F7T A;  4PHT X;  3HOS A;  3HSC A;  2FSN A;  3SMS A;  4BRN A;  2OTL N;  5EOY A;  3Q7B A;  4BRM A;  1QQM A;  3CER A;  5AQG A;  1LOT B;  1NLV A;  1S22 A;  1K73 O;  5GAH P;  3QFU A;  3TSU A;  4FWS A;  1TYQ B;  1QZ6 A;  1K9M O;  5JLF A;  1ILY A;  1NGA A;  3LM9 A;  4IZ9 A;  5HL7 L;  3IMX A;  3WQU A;  2KKZ A;  3M1F A;  1EQY A;  4HTL A;  4EHT A;  2ZJP L;  1BUP A;  2F9T A;  3RSE A;  5I9E B;  4H0Y B;  3TTC A;  3D7E O;  2A41 A;  5C2D A;  3D6R A;  4IJN A;  3SK3 A;  3VEN A;  2QXL A;  3LL3 A;  4AF1 A;  5AFU A;  4B1V A;  3HZ6 A;  4FWO A;  3WXJ A;  3D2E B;  4BR9 A;  3N4P A;  2J4R A;  2V7Z A;  5GIN A;  3BEX A;  5FPE A;  2ZJQ L;  1BA1 A;  3CPE A;  4GV3 A;  4BRD A;  3HTV A;  3H3N O;  5KQ8 A;  1RGI A;  2YCH A;  3IUC A;  4FPA A;  1S3X A;  4MDB A;  3VF4 A;  1NGB A;  2FLO A;  1BU6 O;  3U8X A;  3A5O C;  4I6M B;  2C1G A;  2E2N A;  1EO1 A;  3AGK A;  1T44 A;  5AQN A;  4CZH A;  5AQY A;  2WBN A;  3EL2 A;  2GX9 A;  4WYB A;  1HKB A;  1GLB G;  4B1W B;  1QVG M;  1ZBS A;  3R3L A;  5FPN A;  4BGA A;  3FZH A;  2A42 A;  4FWM A;  3MN5 A;  1D4X A;  1OKJ A;  5AQM A;  2W00 A;  3H1V X;  2E2Q A;  3CCL N;  4MO5 A;  3CC4 N;  4H0O A;  3GL1 A;  1BWF O;  4BRO A;  4WFB L;  5MLC Q;  2P9N B;  4BQL A;  3CQY A;  2E88 A;  1GLA G;  1TYQ A;  2P9I B;  3U9D A;  4CZG A;  2YHW A;  4JK9 A;  2Q36 A;  3OW2 M;  4J8F A;  1HJO A;  5AQP A;  4ILJ A;  5F1X A;  4BRF A;  5BPM A;  3K9K A;  3TU5 A;  4B1X B;  3G4S N;  3LDO A;  3HRG A;  5AQW A;  5AQZ A;  3NMU A;  2D0O A;  4JK8 A;  1GLC G;  4YDU C;  4CZE A;  3C6A A;  5BRF A;  4CBX A;  3D2E A;  1DGK N;  2H3G X;  1QVF M;  5BN9 A;  3CHW A;  4BG8 A;  2JWK A;  4XH5 A;  5AQF A;  5GIP A;  3CJC A;  3O1W A;  4XJX A;  5DM6 L;  1BA0 A;  2NLX A;  3D2F B;  3DXM A;  3CD6 N;  4BRK A;  4FVU A;  4I6M A;  3VEV A;  3KK7 A;  5M1F A;  1VQ4 N;  1KXP A;  1NBW A;  1JCF A;  4LC9 B;  2P9U B;  3A8Y A;  4OO1 J;  1GLF O;  5AQK A;  1NGI A;  3SBG A;  3UB5 A;  3EE8 A;  4BC2 A;  2E8A A;  4BR2 A;  1Q86 O;  4BEB A;  1NGE A;  2HBJ A;  3ID8 A;  4JAX A;  3ATV A;  3TTD A;  3CCS N;  5AQT A;  2QA4 N;  5CE3 A;  3W0L A;  3SMP A;  1XQS C;  4WQ5 A;  4IOX A;  2JWL A;  3MCP A;  3FZL A;  4JHD B;  1JJ2 M;  1KAY A;  4CZF A;  4HWI A;  1YJW N;  1M1K O;  2P9N A;  3VPZ A;  3KWI A;  4AM7 A;  2AA4 A;  1DT9 A;  2P9I A;  4H0P A;  2PFU A;  4H5W A;  4YOR A;  2NZT A;  1XC3 A;  2YHX A;  3BF3 A;  5C0Y A;  4OPA A;  5M1N A;  1U2V B;  5AQU A;  2BH1 A;  5BPN A;  3ZEU B;  3VER A;  1KAZ A;  1P90 A;  4Z94 A;  3S41 A;  4BR5 A;  4A2A A;  1M90 O;  2A3Z A;  3H3O B;  5M1K A;  1RDU A;  4EAH D;  2YI1 A;  4FWQ A;  2Q31 A;  5BRD A;  2BUP A;  4KH6 A;  3MN6 A;  5AQL A;  5ELZ A;  4BRL A;  1P8Z A;  2V52 B;  2GEL A;  2ZGZ A;  3D2F A;  2CH5 A;  4PKI A;  4BRI A;  3PIO L;  1YIJ N;  1YUW A;  2E1Y A;  4YDU A;  4DB3 A;  4O8K A;  4MLH A;  3W3D A;  5C12 A;  2P9U A;  2VGN A;  4IWV A;  1VQP N;  3C6H A;  2Q0R A;  4IEE A;  2GWK A;  2QWM A;  1NGD A;  2NRT A;  4YOX A;  3EKU A;  4FWL A;  1RDW X;  4WFN L;  4KH5 A;  1YJ9 N;  2Q2R A;  3ULE B;  2WFB A;  4G9Z A;  3A5M C;  3DLL L;  1IJJ A;  1QZ5 A;  3O9R A;  2NNW A;  4JHD A;  4EFH A;  3CXC M;  1KC8 O;  2PAV A;  4A5B A;  5JLH A;  5KPZ A;  3WEE B;  3O9T A;  1TUU A;  3AGR A;  2Q97 A;  4MDA A;  4BR4 A;  1HUX A;  4K25 A;  4B1U B;  1U2V A;  3P4I A;  4JN4 A;  1VQ8 N;  2ZGY A;  3ZEU A;  3VTH A;  2QWO A;  4IOA L;  3QFP A;  1WUA A;  4JKF A;  3CJ9 A;  3O9Q A;  3VGK A;  3WQT A;  1NGH A;  2HBL A;  3N4Q A;  4FL9 A;  2AP1 A;  4DKW A;  3DXK B;  3MWT A;  3I33 A;  4DHY A;  2GTD A;  3BUZ B;  3CJB A;  1Z05 A;  2E20 A;  4KH4 A;  1VQ9 N;  4U67 L;  1NGG A;  1J6Z A;  3FR0 A;  4JKD A;  2GWJ A;  1W97 L;  3U9Z A;  4IEI A;  5FPD A;  3CCM N;  4CD3 A;  4H03 B;  3CF5 L;  2OTJ N;  2Q1N A;  2E1Z A;  3CC2 N;  3ID6 A;  1G99 A;  3QDK A;  4EHU A;  3QIC A;  3KWG A;  4BRA A;  2CGL A;  2NRR A;  4OPH A;  2RE2 A;  4XH1 A;  2CGJ A;  1HKC A;  3A5L C;  3O9S A;  2W41 A;  3VGM A;  1N8R O;  1LCU A;  1Z6R A;  4BGB A;  3R6M A;  3DXM B;  3WXK A;  3MN7 A;  4GNI A;  4JEP A;  4WQ5 C;  4JNE A;  5AQX A;  1DKG D;  5M1O A;  2A5X A;  2I7N A;  2QM1 A;  3WEE A;  3I56 N;  5KPT A;  1JCE A;  1DEJ A;  2ZWH A;  1T6C A;  3CC7 N;  3ENO A;  4A62 A;  2V7Y A;  3MWP A;  3VF2 A;  1OVY A;  1ATR A;  1QHA A;  4U7B A;  3E66 A;  4PKG A;  3QBX A;  2WUS A;  4WFA L;  4CJ7 A;  1YI2 N;  3LDL A;  4CZM A;  2GUP A;  2A40 A;  3AAQ A;  3DXK A;  3IFR A;  1SAZ A;  1ZC6 A;  2QWN A;  3WT0 A;  4KBO A;  3R8E A;  4E1J A;  3FLC O;  3JXU A;  1E4F T;  4FPB A;  5EX5 A;  3O08 A;  1MWK A;  2P9K B;  4FO0 A;  2FSK A;  3CCQ N;  4IXC A;  3MX2 A;  1NGF A;  2YJE A;  3SAF A;  1X9J A;  4H5R A;  5AZJ B;  1YIT N;  2E2O A;  3VGL A;  5F0X A;  2FF6 A;  2CGK A;  2NRW A;  4K41 A;  3P31 A;  1GLD G;  3PIP L;  5BPL A;  3TSP A;  1ZXO A;  3BF1 A;  3KVG A;  3VEZ A;  5AR0 A;  5EY4 A;  2KLA A;  3Q7C A;  3OHR A;  2D0P A;  3LDP A;  4FWP A;  3DWL A;  3H6E A;  4GV9 A;  3CET A;  1NGC A;  4O8U A;  4B1Y B;  4GY2 B;  1VQK N;  1MA9 B;  1Q81 O;  2YX6 A;  4PL7 A;  3CMA N;  5LY3 A;  5H1S Q;  3CCE N;  3R1X A;  4MLE A;  1K8A O;  3WXL A;  4IFE A;  5LJV A;  3VES A;  3R9P A;  2BTF A;  2ZF5 O;  3SJH A;  4C23 A;  3HI0 A;  1QQN A;  1E4G T;  1BO5 O;  4M63 C;  1YF5 L;  4WQ4 A;  2HF4 A;  3CJA A;  3WXM B;  4M7X A;  3CJ1 A;  2ASP A;  2NRH A;  4BC3 A;  4AM6 A;  3P38 A;  4C1N K;  3AAP A;  3UKR B;  2P9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...