3CI5A

Complex of phosphorylated dictyostelium discoideum actin with gelsolin
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
372
structure length
366
Chain Sequence
DVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGMGQKDSVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Major actin
publication title Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 123
structure length 366
sequence length 372
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ci5A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ci5A02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3ci5A03
3FR0A 1ZC6A 2NRHA 4PL7A 2E2NA 3VF6A 1YXQA 3ENOA 4H5RA 4BRNA 4RTFD 1YUWA 3FLCO 3JS6A 5AQWA 5ADXA 3UKRA 3CJ1A 4GY2B 1RGIA 2CH5A 3FZHA 2GWJA 1ATSA 1WOQA 4CBXA 3M1FA 4Y0WA 2AP1A 4FPAA 4H0OA 4FWPA 2KHOA 3F9MA 5AQVA 3EKUA 4K25A 3L4IA 3H3NO 3VEXA 2HOEA 1HKCA 4FWMA 1SZ2A 2ZWHA 1ATRA 1JCGA 3VPZA 3BP8A 3CIPA 5LJVA 2P9NB 3SMPA 3RSEB 4E1JA 3BF1A 4AM7A 1XQSC 3C7NB 2Q2RA 1DEJA 3VEVA 4CZJA 3UKRB 3O08A 1NWKA 4CZIA 3C0BA 4B1ZA 3VOVA 1BA1A 4BRKA 5KPTA 4FPBA 3H3OB 2CGKA 3W3DA 1YVNA 4IJAA 1TUYA 5AQJA 1MWKA 5AFUH 3ZETA 4RWTA 3BUZB 3HTVA 4CZLA 1TYQA 3SLCA 1WUAA 3VGKA 3LM2A 1LOTB 1BA0A 2QWLA 4DQ8A 3D2EB 1NGBA 3QBWA 3UB5A 1S3XA 5AFUA 2A5XA 5AQLA 5LY3A 1NGIA 1GLAG 2BTFA 2QWMA 1HJOA 4O8KA 3CHWA 2E2OA 4FO0A 3QFPA 5AZJA 4B1YB 4CJ7A 3LDLA 1IG8A 4KBOA 4BC4A 1U2VA 4WYBA 2A6AA 3U4LA 4BC2A 2F9WA 2ASPA 2NLXA 1QQNA 3D2FB 4EAHD 4XH5A 1BWFO 3IFRA 2D4WA 3SMSA 2UYTA 4BR0A 3O1BA 5KQDA 4FWNA 4BGBA 3MMVA 1ESVA 4BRDA 2QWRA 3A5MC 3GBTA 1P8ZA 2A40A 3QDKA 1SQKA 4BRMA 3QBXA 5AQRA 4EFHA 1NGDA 4L3QA 5AZJB 3LDOA 1X9JA 2YJFA 2HMPA 3VEZA 1QHAA 3WUHA 4BR2A 4BG9A 4I6MA 4H03B 3L0QA 3SJHA 4FWRA 3GE1A 4IXCA 4HWIA 2A3ZA 4C23A 2FSNA 3L6QA 3U9DA 1NGGA 2AA4A 4FL9A 2ITMA 1NGFA 4NO7A 4CZEA 3I8BA 5BPLA 3MDQA 5EY4A 4Z94A 3ZEUA 1NGHA 2E1ZA 1KAZA 2E2QA 2FF3B 2P9IA 1BUPA 1NGEA 4JN4A 3WQTA 1RDWX 4BRPA 4I6MB 1K8KA 2PAVA 3GL1A 2CGJA 4FSVA 3ZX0A 4YDUA 5BREA 4IZ9A 5AQKA 1V4TA 4ISGA 3FZFA 2QWNA 4BC3A 2OANA 3H1QA 2FLOA 1KXPA 4BRCA 3ZEUB 3QB0A 3DXKA 4IWVA 2NZTA 4BRGA 5ADXH 1BOTO 1NBWA 3ENHA 1QQMA 4O5FA 4EHUA 3CJBA 3EN9A 1LCUA 4JNEA 1DKGD 1OKJA 3GOIA 2W41A 4JHDA 2CGLA 2Q97A 4GNIA 5AZIA 2J4RA 4B9QA 4CZMA 1YAGA 4PKIA 3DXKB 2HF4A 4WQ4C 3BEXA 3QICA 3KHYA 4IJNA 2IVOA 4XH1A 5AQSA 3J8AA 2QM1A 3H1VX 5BN8A 3O5BA 2ZGYA 3CJ9A 4BVOA 1ZBSA 1GLFO 4BGAA 1HKBA 3CJCA 3WXKA 4CZFA 5BRFA 4CBUA 1D4XA 1HPMA 3O6WA 1E4GT 1GLJO 3FGUA 3HBTA 5AZIB 5JLFA 1GLBG 2QW9A 1V4SA 4H5NA 3A5NC 3CJ7A 4NB4A 3VGLA 4IO8A 3I33A 4H0YB 4MLEA 5AQIA 3VERA 2ASOA 3M3ZA 5AQQA 4EHTA 5BN9A 3OHRA 4YDUC 2IVNA 1NGJA 2YI1A 4BG8A 3FFKB 4MO4A 1DGKN 3VETA 2DPNA 2E8AA 4PKHA 2A42A 4BR4A 3TU5A 4WQ5A 5KPRA 3ZETB 5FPMA 5BR9A 2ZGZA 3CI5A 3VGMA 5I9EB 1TYQB 3AAPA 2P9KA 4QS7A 4M7YA 4CD3A 4K42A 2E88A 3U8XA 3VEWA 3VESA 3O1WA 3EO3A 1JCFA 3UE5A 3IDHA 1R59O 2H3GX 1NGCA 2GTDA 3ATUA 4A2BA 4DB3A 4A61A 3B8AX 2D0OA 1NGAA 1U2VB 2P9UA 4H5WA 5F2RA 2HF3A 4XH4A 3H45C 4BQZA 1NMDA 3EZWA 4J8FA 2P9KB 5JMVA 2ASMA 5BPMA 2IIRA 2F9TA 5CE3A 1MDUB 4CZKA 3HZ6A 5EXWA 3UKUA 4HTLA 4FWLA 3MN9A 1H1VA 3W0LA 5FPNA 4K43A 3WT0A 2P9UB 1IJJA 2P9LA 2D1KA 3A8YA 3CERA 5AQGA 4ISFA 1X3MA 3EKSA 3HI0A 3FZKA 4PKGA 3MCPA 5BRHA 1ZXOA 3TPQA 3LM9A 1HX1A 5BPNA 1XUPO 1JCEA 3AAQA 3UKUB 1GLEG 4K41A 1TUUA 3G25A 2GELA 2I7PA 3D7EO 4BR5A 2GWKA 3AARA 3JXUA 4CD1A 3DXMA 2P9IB 4F9OA 4M63C 4A62A 1Z05A 2ZF5O 3O8MA 4WQ5C 1K8KB 1T6DA 3IMXA 4PL8A 1G99A 5AQOA 3HSCA 2WUSA 5BRDA 5LJWA 3HM8A 4FWQA 3A5OC 4BQLA 2YCHA 5AQZA 2D0PA 3S41A 4RCHA 4B1WB 4BRAA 1EQYA 2VWBA 2V52B 4H0PA 1QQOA 2YHWA 4BRFA 3MK6A 1GLLO 2VYPA 1Q18A 1BU6O 2P9NA 1Y64A 4BC5A 3CQYA 3FZLA 3RSEA 1S22A 4DHYA 1HUXA 1U6ZA 2FSJA 3C7NA 4H5VA 1E4FT 1KAXA 2BUPA 2EWSA 1QZ6A 3FZMA 3GDQA 1GLDG 4FWOA 4JHDB 2FXUA 1HKGA 4H5TA 2V7ZA 2YHXA 3DAWA 3BF3A 2E20A 4H0VB 2QXLA 3ATVA 4BRHA 1HLUA 4FWSA 2E1YA 4BRIA 3D2EA 4BREA 1Z6RA 3KVGA 3MN7A 4CBWA 3CJAA 4BR9A 2V7YA 2VCPA 5F1XA 2QWPA 4XEIA 5JLHA 3GG4A 3LDQA 2FF6A 3VEYA 4BR7A 3A0IX 2Q1NA 3WXLA 4FOEA 5AQTA 3LDNA 2YHYA 4BVPA 3H46O 4EIAA 3D2FA 2GUPA 5FPEA 3EL2A 4B1VA 5ELZA 5TKYA 1CZAN 1C0FA 3IUCA 3CQXA 1C0GA 3R9PA 1T6CA 3MN6A 3ZX2A 3R8EA 3WXJA 3H6EA 3SK3A 5E26A 3WEEA 5AQNA 3R6MA 3QFUA 3CETA 5EOYA 4QS8A 2Q36A 2PBDA 1ATNA 4MO5A 2E2PA 4BRQA 1KAYA 3FE1A 5FPDA 5AQPA 3O80A 1X3NA 4JAXA 1MA9B 4FWKA 5JICA 5AQHA 5AQFA 3ZX3A 2IVPA 1NLVA 3WEEB 1NM1A 3ULEA 4M7XA 4WQ4A 4CI6A 4JD2A 1BO5O 4QS9A 4BRLA 4H0XB 3VENA 2GEMA 5AQMA 5AQYA 4B1UB 1J6ZA 4H0TB 2A41A 4CZHA 3AY9A 1QZ5A 4MLHA 5E84A 5EX5A 2I7NA 5KPZA 2P9SA 1RFQA 2P9PA 2CH6A 5F0XA 3DJCA 3WXIA 1BG3A 4DCHA 4B1XB 2Q31A 3U9ZA 4A2AA 1XC3A 2YJEA 3P4IA 3ULEB 5EVZA 4LC9B 3LDPA 4JD2B 3VF4A 2QWOA 2Q0RA 2P9LB 1T44A 3VF2A 1MWMA 5B8HA 5AR0A 2W40A 3A5LC 3KZBA 5AQXA 4BROA 5AQUA 3WQUA 3O4WA 4CZGA 3M6GA 2P9SB 4AM6A 1SAZA 1GLCG 3MN5A 2P9PB 3DWLA 3LL3A 4FOIA 2QWQA 4ISEA 2V51B 3VEOA 2FSKA 2Q0UA 3QMLA 5KQ8A 3ID8A 1BDGA 3DXMB
chains in the Genus database with same CATH superfamily
3LANA 3FR0A 4E7KA 3VF6A 1YXQA 4H5RA 4BRNA 3TAPA 4RTFD 1YUWA 3G4SN 1XHXA 3V9SA 4GY2B 3FZHA 4FJNA 1WOQA 4CBXA 4DLEA 2AP1A 4FWPA 3F9MA 3EKUA 3NGYA 1ASUA 3L4IA 1SS6A 2HOEA 3ZLJA 4FWMA 2Z1IA 3BP8A 1KD1O 2HNDA 1SL1A 3QEPA 3AVLA 2FBTA 4CJ3A 4AM7A 3C6UA 3FFIA 1KQSM 1NWKA 3QO9A 4CZIA 3C0BA 4FJXA 4CF2A 2YHBA 4CF9A 3TARA 2O8FA 4FLVA 2P5OA 5T7BA 5AQJA 3NVKA 5AFUH 1MWKA 4CZLA 1TYQA 5CYQA 2GV9A 3LM2A 1HYSA 2QWLA 2JLEA 3QESA 3K9KA 3CD6N 5LY3A 3SQ4A 1I94K 1WSFA 1J5OA 4B3OA 1VSIA 4CJ7A 1VK0A 4E7IA 1IG8A 2FC0A 1M1KO 3T19A 3SV3A 2A6AA 4BC2A 4B9MA 2NLXA 5DMRA 1QQNA 3D2FB 2HHWA 2D4WA 2UYTA 3JAMO 4FJLA 4KREA 3RR8A 1WSHA 5FDLA 1NGDA 4L3QA 3VQQA 1TKZA 1X9JA 2YJFA 4FM1A 4HUFA 2VWJA 1VSDA 2B6AA 4H03B 1EETA 4JI3K 2IAJA 3LP1A 3E01A 3G6EN 4DR6K 3I8BA 5BPLA 4CHOA 1XC9A 3MDQA 5EY4A 3OYKA 4W5NA 1KAZA 1XHZA 3MXMA 2FF3B 3V1QA 3MEGA 1RDWX 1HPZA 1Y97A 3E66A 4FCYA 2PAVA 4DR1K 3OYJA 4BWJA 4CJVA 4YDUA 1V4TA 4ISGA 3V1OA 4JI5K 3FZFA 3J80O 5CR4A 4H4OA 4BC3A 4ILJA 2FLOA 3RWUA 1NG9A 3O4NA 4JI0K 1FXXA 3DXKA 5C2DA 2NZTA 1BOTO 3DM2A 4EHUA 1LCUA 1HQUA 4IFYA 4YY3K 4JNEA 4BY9C 2BE2A 2HNYA 5SWMA 1I39A 4OPJA 3GOIA 3O3GA 4JHDA 3OYBA 2J4RA 4JKBA 4MDAA 3SQ2A 5JVGL 3HVTA 1M90O 3DXKB 5AQSA 4NLBA 2P1JA 1OH8A 5H1SQ 4CJKA 4CJ5A 4MFBA 2YNFA 4AILC 1UA1A 1HKBA 4ILGB 3WXKA 4X62K 3OYGA 2UUBK 4CBUA 1D4XA 1E4GT 1U47A 3FGUA 1Q82O 2VG5A 4CK1A 2NRZA 3M8RA 3HRGA 2D5RA 3O9UA 4H5NA 4E7LA 3SPYA 3LAMA 4NB4A 1DLOA 4IO8A 3NH2A 2YNHA 4IBNA 5AQIA 4IFEA 3I55N 2G8VA 5AQQA 3EY1A 3D6RA 5CHIA 5FRNA 1VQKN 2IVNA 3OS0A 4BWMA 5LMNK 4LF4K 5KRTA 4RW7A 4YFUA 2WBNA 3ZETB 4MQ3A 3CI5A 3CCLN 3HJFA 2P9KA 3QIPA 1Z26A 1BI4B 2O4GA 1QTMA 1KVAA 1ASVA 3VESA 1WBBA 4IKFA 3IDHA 4I9QA 1RTDA 1IO2A 4FZZA 1C0MA 2GTDA 4A2BA 4DTXA 4QAGA 2D0OA 1N8RO 1U2VB 5F2RA 1FJGK 4J2AA 4JK7A 3THWA 1SKWA 4YHHK 2GX9A 4LH5A 4J8FA 2P9KB 5JMVA 3EYZA 2NNWA 2IIRA 2UXBK 4CF0A 1RDDA 2F9TA 5CYMA 5CE3A 1IBLK 4OPKA 3HZ6A 3A2FA 3V9WA 1RT5A 4W5RA 3HL8A 4HTLA 4FWLA 3K5OA 1H1VA 3AGRA 3H08A 4G1QA 4ZTFA 1QQCA 1EWRA 2P9LA 3EE8A 4HTUA 1C1AA 3CMAN 3FZKA 3K9JA 3TPQA 3V4IA 4DTOA 2UXDK 4K0KK 4RW9A 4CEBA 1GOAA 4YOUA 4AHRA 1GLEG 4H8KA 3CCSN 4CD1A 2P9IB 5E41A 3TTFA 2ZF5O 4E1MA 3HVRA 1K8KB 1T6DA 1IKXA 4F2SA 1O1WA 3HSCA 5LJWA 3DOLA 4BQLA 2D0PA 3P31A 1EQYA 2O8CA 1VSEA 3PX6A 1U45A 4H0PA 3QNNA 2O8EA 1QQOA 1VQNN 1GLLO 3IS9A 4M41A 5C12A 3NDKA 1BU6O 1WB9A 3LZIA 2P9NA 1B92A 1JXEA 4IG3A 4DLGA 1RDAA 4CEFA 4B9VA 1U6ZA 3C7NA 2P5GA 2DFHA 2PYJA 1C1BA 1GLDG 2XRIA 5HRNA 2NRXA 2OCEA 4FJIA 5C2FA 2FXUA 4H5TA 1YVUA 2YHXA 1VSHA 2G8KA 4DG1A 1I3AA 5JVHL 2E20A 5J2PA 3J81O 4H0VB 2QXLA 3HSTB 3P1GA 4FWSA 4RW4A 1Z6RA 3KLGA 3MN7A 3CJAA 1SL0A 4DV6K 4XEIA 3K5NA 4GKJK 2X78A 3RMAA 3KLFA 3LDQA 2FF6A 3VEYA 4BR7A 3L2UA 2Q1NA 4M45A 2YHYA 4LF7K 5HLFA 1Q86O 2QKKA 3TSUA 3L8BA 3CC4N 2GUPA 3CM5A 3MEDA 3MN6A 3BZCA 2IC3A 3OA9A 3ZX2A 2YV0X 3HOTA 3H6EA 3O9QA 4EP5A 4JS4A 3CETA 4F4KA 4CK3A 2PBDA 2F8TA 2UUAK 1T05A 4CEQA 5HROA 5FPDA 3SAGA 3DMJA 1YJ9N 3QEXA 3V9UA 2O8BA 5JICA 3TI0A 5AQHA 4DQQA 5AQFA 1NLVA 4JYAK 4NYFA 2FBVA 2C1GA 4GMJB 2I5JA 4JKEA 1NJXA 4LFBK 4IG0A 3IAYA 4ILHA 1BO5O 1GOBA 4B08A 3L2VA 4LFCK 4BRLA 1Q9YA 4H0XB 4CJFA 3KK2A 3MWPA 4DMNA 2A41A 4AHVA 4GV3A 1OH6A 2I7NA 4DV2K 2UUCK 2O8BB 3G71N 3NH0A 1NKEA 1WN7A 4A2AA 3TSPA 3WNEA 1TVRA 5EVZA 3LWMA 4I2QA 3O3FA 5HRSA 2QWOA 3OBYA 1GOCA 3VF2A 3NF9A 1C6VA 4OGCA 1MWMA 5B8HA 5AR0A 1Q9XA 1T7PA 4CJQA 5KRSA 5AQUA 3VQ4A 2D0AA 4AM6A 2D0CA 3LL3A 3ASMA 5EU7A 3VA3A 4DR2K 1LWEA 1E3MA 2HBKA 3PIPL 1VQ8N 3ID8A 5JENA 2VGMA 5CZ2A 4FLTA 3IRXA 3D0PA 1WSIA 4Y1CA 3QINA 1RT2A 2NRHA 1UA0A 1RTIA 1C1CA 4Z4GA 1ATSA 1Z25A 4KHSA 1ITGA 1FW6A 4Y0WA 3ZSXA 4DTSA 2KHOA 1RBTA 4K25A 1NJIO 3ZCMA 3H3NO 1NKBA 3KWGA 1G15A 1HKCA 4C8NA 1KLNA 4M3WA 1SZ2A 3VQPA 1ATRA 2B5JA 3HPHA 4DR5K 4KH4A 5LJVA 4DTPA 3SMPA 3K5MA 2RN2A 3ID6A 4CZJA 1IKWA 1DTQA 4AHCA 4JI4K 4FJ7A 4CGFA 5KPTA 4FPBA 3W3DA 4CGIA 3VQ7A 3L3UA 1KVCA 4JKAA 5M1FA 3SLCA 1WUAA 4GV6A 1BA0A 3D2EB 2EHGA 1NGBA 4FW2A 1S3XA 4WE1A 5AFUA 2DTUA 3L2WA 5AQLA 3SUPA 1NGIA 2DFEA 3Q7CA 4DFPA 3KWIA 2WC9A 2QWMA 1HJOA 3CHWA 2E2OA 4IDHA 1X9SA 4FO0A 5C42A 3QFPA 5AZJA 4B1YB 3LDLA 4KBOA 3AVMA 4WYBA 4CGGA 4CFBA 1K6YA 4FW1A 2ZJRL 2F9WA 4EAHD 1WAJA 4BR0A 1SUQA 4OLBA 3TR8A 3O4QA 2Y1JA 4BGBA 2ZE2A 2GUIA 4EFHA 2HHSA 3EEQA 5AZJB 4CECA 4Z0UA 3WUHA 1QSYA 4BG9A 4I6MA 3SQ0A 3MCAB 4FWRA 3GE1A 4FJ9A 4C23A 2O4IA 3L6QA 3L2QA 1S72N 1BL3A 3OVNA 3WXMB 2EX3A 4NO7A 3ULDA 4KV8A 4DQSA 2YX6A 1BHLA 4Z94A 3N4QA 3ZEUA 4DTMA 1NGHA 1HNZK 3QEWA 2W00A 4JN4A 3VN5A 4DU1A 4I6MB 3G10A 4BECA 4PA1A 3HK2A 3IG1A 4O8UA 1NMNA 3NF6A 1S1UA 1RDBA 3PO5A 1HQEA 3V6DA 1VQ9N 5M1NA 3DRPA 5MLCQ 3CCQN 3ZEUB 3TTCA 4IWVA 1TK0A 4BRGA 3KTQA 3P38A 1QQMA 4O5FA 1WAFA 1FKOA 3K57A 3S5TA 4DFKA 4CGHA 4CZMA 3I56N 3OYFA 4LF6K 4KB0A 2HB5A 2ETJA 4PKIA 3HP6A 4WQ4C 3QICA 3KHYA 4IJNA 2IVOA 4O55A 1D5AA 3J8AA 4R79A 1OH5A 2GBZA 3H1VX 5IWAK 1T8EA 5C24A 2ZGYA 3CJ9A 1ZBSA 2BANA 4BGAA 1QSSA 3QERA 5D3GA 2VQEK 4X64K 4DSEA 4A5AA 4DSFA 3C6TA 4B3TK 2VGNA 3ZT4A 4CCHA 3CCMN 2HHXA 2OZMA 2IOCA 3MX5A 4NLCA 3A5NC 3CJ7A 3LZJA 3I33A 5A2QO 4MLEA 4KI6A 2ASOA 3DLHA 4NCBA 3OYDA 4M3XA 3MXJA 5BN9A 4JK9A 4WFBL 3OHRA 1NGJA 4CESA 4DQRA 4MO4A 5GADP 1DGKN 2E6MA 2DPNA 1NJWA 2O8FB 2RF2A 2A42A 4IOXA 3TU5A 1YIJN 4WQ5A 2KTQA 1ZBLA 2YKNA 3VGMA 4EZ6A 1TYQB 2WFBA 3AVJA 3C6AA 3PX0A 1VRTA 4CJUA 1FKPA 4KKOA 3K59A 4RG8A 2VG7A 3OYCA 3EO3A 1JCFA 1D8YA 1HNWK 2H3GX 3OYMA 4KH5A 3SBGA 1NGCA 3WNHA 4A61A 1OVYA 1NK9A 3NE6A 3LDSA 2P9UA 3NBPA 4H5WA 2HF3A 4XH4A 3AO4A 4OVLA 1W97L 5TKWA 4H4MA 3NH1A 5BPMA 4GKKK 4BE1A 3VQCA 4PQUA 3DRRA 1U48A 1Q7YO 3P39A 3CCEN 4E19A 1EX4A 1VSMA 3MN9A 3ZT1A 3W0LA 2OYQA 3O9RA 2F96A 3ZT3A 1WSEA 3ZT2A 4DTRA 1N5YA 2P9UB 3HPOA 1HYZA 2D1KA 3A8YA 3AO3A 3CERA 2G8FA 4ISFA 1X3MA 3OS1A 1L3TA 4Z4CA 2P51A 4PKGA 4N47A 3S3NA 3M8SA 1BQMA 1LV5A 4I9LA 5BPNA 3IKMA 1XUPO 2HHVA 4YOWA 2FBYA 4FK4A 3AA4A 4CIEA 1IKYA 3D7EO 2I7PA 4BR5A 4CGJA 4X65K 2GWKA 2HBLA 3JXUA 5M1QA 3T1AA 3DXMA 4DR3K 1BQNA 4IEEA 1CZ9A 3IMXA 4PL8A 4ID1A 4FK0A 5HOOA 5I3UA 2G8HA 4HUEA 5AQZA 4B1WB 3MX2A 3AVNA 2VWBA 3WNFA 3PIOL 4DV1K 1QVFM 2R7YA 4KAZA 1Q18A 3SNNA 4BC5A 2O8DA 4DHYA 3RSEA 1RNHA 2ZQBA 1S22A 5AJ3K 2FSJA 1E4FT 3SZ2A 4JV5K 4C8MA 3SPZA 1KRPA 4JHDB 1HKGA 4DQPA 1XI1A 4IO9L 4DTJA 2V7ZA 3BF3A 1JLCA 4W5OA 2G8IA 2E1YA 1EP4A 4BREA 4CEEA 3CFPA 4HVJA 4FLUA 5J2MA 3U3YA 1SV5A 3NF7A 4DSJA 5JLHA 5CY4A 4OGEA 3DLBA 4FJ5A 1JLEA 3UIQA 3BZKA 5AQTA 4OKEA 1EWQA 2C1IA 3H46O 1EO1A 1VSLA 3HOSA 4OKJA 1IBMK 3RR7A 3E1YA 5ELZA 1CZAN 4JEPA 3R9PA 1T6CA 4DU3A 3R8EA 3SK3A 3WEEA 4OPHA 4FLWA 2RKIA 1NK6A 3QFUA 2YNIA 2Q36A 1NOZA 1ATNA 3VQBA 1KSPA 5I42A 1KAYA 1SKRA 1NK0A 4ICLA 4FWKA 3LP2A 1SL2A 1W0HA 1RBSA 2HHTA 3ZX3A 3WEEB 2PFUA 4BDYA 4WQ4A 4FLYA 3TAGA 2F7TA 1A5VA 5IT9O 1S5JA 5AQMA 1S9GA 1JKHA 4Z4IA 4DR4K 3THWB 4CZHA 4M3TA 3S3MA 1B9FA 1RFQA 2X6NA 1KVBA 3WXIA 1KCFA 1WNSA 1XC3A 3P4IA 4XIUA 2F4VK 4CF1A 4DS5A 4FJKA 2Q0RA 3VQAA 2P9LB 3NCIA 2IDOA 2W40A 5AQXA 4YOTA 3CMEN 3AVIA 3O4WA 2XY8A 1SAZA 1BGXT 4CHPA 3F9KA 3SUNA 5HRRA 3ZSWA 3QMLA 4AHTA 2OZSA 1VRUA 5KQ8A 4CERA 4YOXA 1EXQA 2OPQA 2Z1HA 4PL7A 3OBWA 4DSIA 3CJ1A 3ZYYX 2GWJA 4FPAA 3OJSA 2O8CB 5AQVA 3HM9A 3OYHA 5LMUK 2O8EB 2WONA 4FYDA 1JCGA 3VPZA 1OH7A 4B9TA 3L4QA 2P9NB 2RE2A 4E1JA 3BF1A 1MU2A 4Q5VA 1XQSC 3C7NB 2Q2RA 3SBTA 3AA3A 1HR0K 1N33K 1RT7A 3O08A 4B1ZA 3VOVA 1BA1A 1SKSA 2CGKA 1UWBA 4IJAA 1TUYA 1RDUA 4U7BA 3BUZB 5DM7L 2ZJPL 4DUZK 4QOZB 4DU4A 1RTHA 4DQ8A 1HJRA 3UB5A 1C0TA 4PUOA 2A5XA 1WLJA 1HNVA 1K8AO 1GLAG 1BIUA 4O8KA 1VSJA 3PLAA 4L8RB 3JSMA 1JLGA 1U4BA 3DLKA 1W9HA 2ASPA 2YHAA 4XH5A 1BWFO 3E9PA 3SMSA 4FWNA 3QNOA 3LAKA 4OJRA 4BRDA 2QWRA 3GBTA 3OYIA 1SQKA 3QBXA 2HHQA 4KTZA 1N36K 4DQIA 1WSGA 1NK4A 1X9WA 4CHYA 4N56A 2HMPA 1QHAA 4G9ZA 4JKGA 2YKMA 2OPSA 4J2BA 4IXCA 2BH1A 4HWIA 2A3ZA 3SQ1A 1T3VA 3U9DA 3VQEA 4FJHA 4FL9A 1NGFA 4YNQA 2PY5A 5GAEP 1WBDA 3LALA 4DFMA 1BUPA 3WQTA 4BRPA 3VQDA 2XY7A 2CGJA 4E89A 3KK1A 4IZ9A 5AQKA 3S9HA 2KQ2A 3JYTA 5KGWA 4CVNE 4JI1K 1A5WA 2W42A 5JS2A 3H1QA 3RMBA 3KIOA 4BRCA 1TK8A 2UXCK 3I0RA 3J7YP 2KLAA 1S1TA 2DY4A 3ENHA 3CJBA 3EN9A 4AH9A 1DKGD 4PHTX 1OKJA 4W5QA 3V9XA 3SYZA 2Q97A 4GNIA 1HMVA 2A1RA 4B9UA 4B9QA 4JI6K 4TSXA 4J2DA 4B3SK 1BISA 2HF4A 3BEXA 4W5TA 4XH1A 3KK3A 2QM1A 3HYFA 4NXMK 1VSKA 4KFBA 3CJCA 4CZFA 4B9SA 3B6PA 4C1NI 1ZBIA 1HPMA 1YHQN 1GLJO 3HBTA 3M5RA 5JLFA 1GLBG 3T69A 3NVMA 1V4SA 3NAEA 4M3UA 1QHTA 2LSNA 3VGLA 4H0YB 4HUGA 3T1HK 3VERA 1UAXA 1VQ6N 5JS1A 4YOYA 2HHUA 1YTUA 1NJYA 2PYLA 4A5BA 2ITGA 4JKFA 4YDUC 4JI7K 5BR8K 2YI1A 4KI4A 4BG8A 3VETA 2D0BA 2E8AA 4PKHA 3OTOK 3OYNA 1QE1A 5KPRA 2Z1GA 5BR9A 4JK8A 1JLQA 3AAPA 4QS7A 3CYMA 4CD3A 4DTUA 4K42A 4CF8A 3LWLA 2E88A 3U8XA 1JLBA 1XWLA 1DT9A 3VEWA 2QEXN 1J9AA 2UU9K 1ZBUA 4CFCA 1B9DA 1TGOA 4ELVA 1X1PA 2W6KA 3H45C 4BQZA 2AJQA 4LSLA 4Z4HA 4LF5K 4JI8K 4B8AB 2WOMA 4NCGA 4CJPA 4LFAK 1ZBFA 2W6LA 3ZSYA 1A5XA 1KLMA 1MDUB 5EXWA 3UKUA 2QI2A 1YT3A 1TAUA 4I7FA 5CZ1A 4B8CA 3AV9A 3M8QA 4F3OA 5AQGA 4GW6A 3EKSA 3O9TA 4GV9A 3MCPA 5BRHA 2PZSA 3LM9A 3K0SA 1HX1A 1T03A 2ZJQL 1F21A 4JKHA 3AAQA 4HCCA 3UKUB 3TWHA 3DOKA 4AQYK 4CHNA 1C0UA 4AF1A 3VTHA 4F9OA 4CFAA 4M63C 1YTAA 3CCUN 1KC8O 4A62A 1Z05A 3DLRA 5LL6Z 2E6LA 1CXUA 5HL7L 3Q7BA 1X9MA 1G99A 5AQOA 1S1WA 1J5EK 2KFNA 5BRDA 4C8KA 3HM8A 4FWQA 3QIOA 3S41A 4KB1A 1NOYA 2V52B 1YJNN 5GAGP 3DYAA 3MXIA 2YHWA 2VYPA 5J2NA 2WTUA 1Y64A 3AVKA 3FZLA 1Q8IA 3J7ZO 3AVAA 3TANA 2BUPA 3CFRA 4ZHRA 1HNIA 3GDQA 3QETA 2KFZA 5J1EA 2ZM6K 3AO1A 1REVA 3VQ8A 3SV4A 1JL2A 3ATVA 4BRHA 1HLUA 3P83D 4BRIA 1RILA 3KVGA 4CBWA 3ZSRA 3TAMA 4CJRA 4BR9A 2VCPA 2X74A 4KHWA 1U49A 5KTQA 3AA2A 2BDPA 2KZMA 4O5BA 3K5LA 1K9MO 3U6FA 4BACA 1NJZA 3A0IX 3NGZA 4FOEA 3VMFB 3CC7N 3D2FA 3KLIA 3HT3A 4J2EA 3EL2A 4KTQA 4CJWA 4FZXC 3TTDA 1HRHA 4CJLA 5HRPA 3WXJA 4KHUA 5E26A 3C65A 2FBXA 1RBUA 4Z4EA 3R6MA 1NNEA 4N41A 2HHIA 4MO5A 4A57A 4O44A 2E2PA 3AVBA 1U04A 4UQGA 3O3HA 5AQPA 4BEBA 3VTIA 3NFAA 3O80A 3OJUA 2HBMA 4JAXA 3THXA 1IH7A 3RRHA 4KPYA 4FM2A 3AVHA 1MA9B 1IKVA 3V81A 2IVPA 1TAQA 1NM1A 1ZBHA 4ZTJA 4CI6A 2JWKA 4JD2A 4ELTA 4KHYA 3N4PA 4B9NA 4B1UB 2RPIA 4H0TB 2OTJN 1VAZA 3AY9A 1K73O 1QZ5A 5E84A 4XJXA 3THXB 4WFAL 2P9PA 5F0XA 1Q81O 3DJCA 3MWTA 4CK2A 4DUYK 4DWIA 1XNRK 4DFJA 2KZZA 4LC9B 4QCLA 4JD2B 1L3VA 3VF4A 1CLQA 4X66K 1TV6A 3A5LC 3C95A 3KZBA 3EE9A 4M3RA 3TAFA 3SI6A 3C6HA 4E3SA 4CZGA 3NF8A 3MN5A 1GLCG 2NRRA 2P9PB 3CYGA 4WCEL 2Y1IA 2NRVA 3KKSA 4FOIA 4ISEA 3T3FA 1JXBA 2V51B 1IG9A 2HW3A 3ZSVA 3L3VA 2NUBA 1XNQK 3KKRA 1FK9A 4F8RA 1BDGA 3DXMB 1LWCA 1ZC6A 1RT6A 2E2NA 3CG7A 3ENOA 1BCOA 1JLFA 3BY5A 1RDCA 1S1XA 3FLCO 3JS6A 5AQWA 3UKRA 5ADXA 1RGIA 1W2BM 2CH5A 2RHKA 1J53A 1RBVA 3M1FA 2HMIA 4H0OA 3OYEA 3I8DA 3QEIA 5DK5A 3VEXA 4IOAL 3NMUA 3KJVA 2ZWHA 2XY5A 3CIPA 3CCVN 4NYNA 3AVCA 2O8DB 3RSEB 3RTVA 3AVGA 3WNGA 1YITN 4C8OA 3HO1A 3TSQA 1DEJA 3VEVA 1CXQA 4I2PA 3UKRB 4B3MK 3HPGA 4BE2A 2YNGA 4BRKA 3F73A 4HCBA 3DLEA 3H3OB 2E5LK 1YVNA 3TABA 3THVA 1HYVA 4E0DA 3ZETA 4RWTA 3KD1E 3HTVA 3VGKA 1D9FA 1BI4A 1LOTB 2HBJA 3SJJA 1NK5A 4B9LA 2KW4A 3QBWA 3ZT0A 3OYAA 3RMCA 2BTFA 3PY8A 3U3GA 2QXFA 4JRPA 1LAWA 1VQPN 1S9EA 5GINA 4BC4A 1IV0A 1U2VA 3SCXA 4CJSA 2QA4N 2OPPA 4LY7A 3U4LA 5K14A 1P90A 3HXMA 3KD5E 4FJJA 4E1NA 3IFRA 4FK2A 1LW0A 3O1BA 5KQDA 5KI6A 4WFNL 3LP3A 4DV5K 4O0IA 3MMVA 4YOVA 1YI2N 1ESVA 3P5JA 3A5MC 1P8ZA 2A40A 3QDKA 4BRMA 5AQRA 1XMQK 1VQ5N 5C10A 3LDOA 3ZSZA 2Z1JA 4HHTA 3SUOA 3VEZA 4FJMA 4BR2A 1D9DA 4KHQA 2OA8A 3L0QA 3SJHA 1QSLA 1YJWN 2F8SA 1ASWA 5KGXA 4FJGA 2FSNA 4DV0K 3E9LA 1N6QA 1NGGA 2HHHK 2AA4A 2ITMA 4IOCL 4CEOA 4M42A 3F2KA 4KH6A 4N5SA 3R3LA 4CZEA 3CCRN 3HP9A 1HNXK 4FM0A 4KHNA 2QK9A 3ENBA 2E1ZA 3ZSOA 3QEVA 2E2QA 2P9IA 4CW7B 2G8WA 4LD0A 1NK7A 1NGEA 2VG6A 4WF9L 3CXCM 4EP4A 4DF8A 1K8KA 1BIZA 2HVIA 3GL1A 3L2RA 4FSVA 3ZX0A 3MAQA 4E7JA 5BREA 4DV3K 5FROA 3EZ5A 2OTLN 1QS4A 2IGIA 2QWNA 2OANA 4NCAA 1KXPA 1RBRA 3QB0A 3MECA 4AHUA 4RW6A 1VHXA 5ADXH 5M1PA 1NBWA 4R5PA 3CQ8A 3PX4A 4AHSA 3CM6A 2QKBA 2W41A 5C15A 2CGLA 5AZIA 5SZTA 1UOCA 3DLGA 1EKEA 4GVEA 1YAGA 3KLEA 4BDZA 3AA5X 4M3ZA 4FVMA 2OPRA 1TL3A 5FLXO 5BN8A 3O5BA 2DFFA 1OVQA 4BVOA 4CJEA 1ZYQA 1GLFO 1L3UA 4FLXA 5BRFA 3BGRA 4DF4A 3O6WA 3PO4A 2QTDA 2X6SA 4CIGA 2JWLA 5AZIB 4FVUA 4JRQA 4DS4A 3LPUA 4C1NK 4YORA 2QW9A 4CE9A 1NK8A 3SAFA 4FZYA 4A59A 4Y1DA 1KFDA 3M3ZA 3O9SA 4C8LA 4OX9K 4EHTA 4UY8O 4DR7K 3J7AP 4KTWA 4E7HA 3FFKB 4Z4FA 1VQMN 3DLLL 4JS5A 4BR4A 1RT3A 3OYLA 3ZSQA 4BE0A 5FPMA 2ZGZA 5I9EB 3PUFA 4M7YA 1W7AA 3K58A 3T7ZA 3D45A 3O1WA 1YF5L 3UE5A 3VA0A 1R59O 1TL1A 4DSLA 2Q3SA 3ATUA 4OO1J 4DB3A 1VSFA 3B8AX 5HBMA 1NGAA 4FJ8A 3AO2A 3CFOA 1NMDA 3B6OA 3EZWA 3ISNC 2ASMA 4BE7B 4JKCA 4FLZA 3G0ZA 4FXDA 4O4GA 1NU0A 4ID5A 4LF8K 4CZKA 1BCMA 2ZD1A 1VQLN 5FPNA 4K43A 2A1SA 3WT0A 1IJJA 3KK7A 3NHGA 4JKGB 3NGIA 3MEEA 1IBKK 4U67L 1O13A 3HI0A 2KKZA 1ZXOA 4IEIA 3RVCA 3VQ6A 1JCEA 4ELUA 3ITHA 4JI2K 4K41A 5GAHP 1TUUA 3CC2N 3G25A 2GELA 3AARA 3LP0A 2XHBA 4V19S 3S3OA 3F5TA 4IDKA 2HSTA 3T1YK 3O8MA 4WQ5C 1CZBA 2JGUA 3RMDA 2WUSA 1TKXA 3A5OC 2YCHA 3DI6A 1N34K 4BRAA 4RCHA 4CEDA 4DSKA 4CHZA 3OY9A 1RCHA 4BRFA 3MK6A 1J54A 2BGGA 3M8PA 3CF5L 1L3SA 2VQFK 2HNZA 3AVFA 3CQYA 4RW8A 1HUXA 4JLHA 4H5VA 4CJ4A 3C94A 1KAXA 1LWFA 4LSNA 3PSFA 2EWSA 1S6QA 4PWDA 3OS2A 1QZ6A 3FZMA 1QVGM 1LAVA 3CPWM 4FWOA 2G8UA 2NRWA 2VWKA 3DAWA 4LF9K 4F3TA 1KTQA 3D2EA 5GIPA 1TK5A 1R0AA 4O0JA 4K8ZA 1TKDA 2V7YA 5F1XA 5GIOA 2QWPA 4PY5A 2XO7A 3CCJN 1VQON 5HP1A 3GG4A 3CPEA 4OLAA 1XMOK 3E9OA 2E4LA 1S6PA 3WXLA 3LDNA 4BVPA 3I0SA 4NXNK 4DV7K 4F2RA 4EIAA 3PV8A 5FPEA 3V1RA 4B1VA 1RT1A 5TKYA 5J2QA 1C0FA 3IUCA 3CQXA 4K8XA 2HVHA 1C0GA 1N32K 1ILYA 4CEAA 3K2PA 5M1KA 3VQ9A 5DM6L 5AQNA 1KFSA 4MDBA 2ATQA 3OW2M 3PSIA 5EOYA 3V9ZA 4QS8A 3LPTA 1WSJA 4N76A 4M3YA 3ALYA 1JLAA 3SUQA 3AO5A 4BRQA 3FE1A 4DV4K 4BDPA 3TAEA 1X3NA 1RT4A 3SAHA 1TKTA 4CJTA 2XY6A 4KHPK 2B4JA 3ULEA 4M7XA 5M1OA 1S1VA 4DTNA 4GVMA 4QS9A 1JJ2M 3QLHA 3VENA 2GEMA 5AQYA 4CEZA 1J6ZA 1LW2A 3VQ5A 1DTTA 4MLHA 5EX5A 3TAQA 5C25A 3THYA 4CIFA 3DRSA 1VQ4N 5KPZA 2P9SA 2CH6A 4DKWA 4OPAA 1BG3A 4DCHA 4JKDA 4B1XB 2Q31A 3U9ZA 4CHQA 3R1XA 2YJEA 4OKKA 1NKCA 3ULEB 3LDPA 3AGKA 3KLHA 4EZ9A 1RTJA 1L5UA 1T44A 5C0YA 4E72A 4BROA 1JL1A 3WQUA 4Q0BA 4CGDA 4LH4A 3BDPA 3THYB 3M6GA 2P9SB 4CFDA 5FRMA 3DWLA 2NRTA 1VQ7N 2IS3A 2QWQA 3VEOA 2FSKA 2Q0UA 4B3RK 4KRFA 3RRGA 4IFVA 4KO0A
chains in the Genus database with same CATH topology
3FR0A 1ZC6A 2NRHA 4PL7A 2E2NA 3VF6A 1YXQA 3ENOA 3OBWA 4H5RA 4RTFD 1YUWA 3FLCO 3JS6A 5AQWA 4BRNA 5ADXA 3UKRA 3CJ1A 3G4SN 4GY2B 1RGIA 1W2BM 2CH5A 3FZHA 3ZYYX 2GWJA 2RHKA 1ATSA 1WOQA 4CBXA 3M1FA 4Y0WA 2AP1A 4FPAA 4H0OA 4FWPA 2KHOA 3F9MA 5AQVA 3EKUA 4K25A 3L4IA 1SS6A 1NJIO 3H3NO 3VEXA 2HOEA 4IOAL 3KWGA 1HKCA 4FWMA 3NMUA 1SZ2A 2ZWHA 1ATRA 1JCGA 3VPZA 3BP8A 3CIPA 1KD1O 3CCVN 3L4QA 4KH4A 5LJVA 2P9NB 2RE2A 3SMPA 3RSEB 4E1JA 3BF1A 4AM7A 1XQSC 3C7NB 3ID6A 1YITN 2Q2RA 3SBTA 1DEJA 3TSQA 3VEVA 4CZJA 3UKRB 1KQSM 3O08A 1NWKA 4CZIA 3C0BA 4B1ZA 3VOVA 1BA1A 4BRKA 5KPTA 4FPBA 3H3OB 2CGKA 3W3DA 1YVNA 4IJAA 1TUYA 5AQJA 1MWKA 4JKAA 1RDUA 5AFUH 3ZETA 4RWTA 4U7BA 5M1FA 3NVKA 3BUZB 3HTVA 5DM7L 4CZLA 2ZJPL 1TYQA 3SLCA 1WUAA 3VGKA 4GV6A 2HBJA 1LOTB 3LM2A 1BA0A 2QWLA 4DQ8A 3D2EB 1NGBA 3QBWA 3UB5A 1S3XA 3K9KA 5AFUA 3CD6N 2A5XA 5AQLA 5LY3A 1NGIA 3Q7CA 1K8AO 1GLAG 3KWIA 2WC9A 2BTFA 2QWMA 1HJOA 4O8KA 3CHWA 2E2OA 4IDHA 1VQPN 4FO0A 5GINA 3PLAA 3QFPA 5AZJA 4B1YB 4CJ7A 3LDLA 1M1KO 1IG8A 4KBOA 4BC4A 1U2VA 4WYBA 2QA4N 2A6AA 3U4LA 4BC2A 2ZJRL 2F9WA 2ASPA 2NLXA 1P90A 1QQNA 3D2FB 4XH5A 4EAHD 1BWFO 3E9PA 3IFRA 2D4WA 3SMSA 2UYTA 4BR0A 3O1BA 5KQDA 4WFNL 4FWNA 4BGBA 3MMVA 4YOVA 1YI2N 1ESVA 4BRDA 2QWRA 3A5MC 3GBTA 1P8ZA 2A40A 3QDKA 1SQKA 4BRMA 3QBXA 5AQRA 4EFHA 1VQ5N 1NGDA 4L3QA 5AZJB 5C10A 3LDOA 1X9JA 2YJFA 2HMPA 3VEZA 1QHAA 3WUHA 4BR2A 4G9ZA 4JKGA 4BG9A 4I6MA 4H03B 3MCAB 3L0QA 3SJHA 4FWRA 3GE1A 1YJWN 4IXCA 2BH1A 4HWIA 2A3ZA 1T3VA 4C23A 2FSNA 3L6QA 3U9DA 3E9LA 1NGGA 1S72N 2AA4A 4FL9A 2ITMA 4IOCL 3WXMB 1NGFA 3F2KA 4KH6A 4NO7A 3R3LA 4CZEA 5GAEP 3G6EN 3I8BA 3CCRN 5BPLA 3MDQA 5EY4A 2YX6A 4Z94A 3N4QA 3ZEUA 3ENBA 1NGHA 2E1ZA 1KAZA 2E2QA 2FF3B 2P9IA 2W00A 1BUPA 1NGEA 4JN4A 3WQTA 4WF9L 3CXCM 1RDWX 4BRPA 4I6MB 4BECA 1K8KA 3E66A 2PAVA 3GL1A 4O8UA 2CGJA 4FSVA 3ZX0A 4YDUA 5BREA 4IZ9A 5AQKA 1V4TA 4ISGA 3FZFA 1VQ9N 2OTLN 5CR4A 2QWNA 4BC3A 5M1NA 4ILJA 2OANA 3H1QA 2FLOA 1KXPA 5MLCQ 3CCQN 4BRCA 3ZEUB 3QB0A 3TTCA 3DXKA 5C2DA 4IWVA 2KLAA 2NZTA 4BRGA 5ADXH 1BOTO 5M1PA 1NBWA 3P38A 3ENHA 1QQMA 4O5FA 4EHUA 3CJBA 3EN9A 1LCUA 4JNEA 4BY9C 1DKGD 4PHTX 1OKJA 3GOIA 2W41A 5C15A 4JHDA 2CGLA 2Q97A 4GNIA 5AZIA 2J4RA 4JKBA 4B9QA 4MDAA 4CZMA 3I56N 5JVGL 4GVEA 1YAGA 4PKIA 1M90O 3DXKB 2HF4A 4WQ4C 3BEXA 3QICA 3KHYA 4IJNA 2IVOA 4NLBA 4XH1A 5AQSA 3J8AA 4R79A 2QM1A 5H1SQ 3H1VX 5BN8A 3O5BA 2ZGYA 3CJ9A 4BVOA 1ZBSA 1GLFO 4BGAA 1HKBA 3CJCA 4ILGB 3WXKA 4CZFA 5BRFA 4C1NI 4CBUA 1D4XA 1HPMA 3O6WA 2QTDA 1YHQN 1E4GT 1GLJO 3FGUA 3HBTA 2JWLA 3M5RA 5AZIB 4A5AA 1GLBG 5JLFA 3T69A 1Q82O 2NRZA 4FVUA 4C1NK 4YORA 2QW9A 3NVMA 2VGNA 1V4SA 3CCMN 3HRGA 4H5NA 3O9UA 3MX5A 4NLCA 3A5NC 3CJ7A 4NB4A 3VGLA 3SAFA 4IO8A 3I33A 4H0YB 4MLEA 5AQIA 3VERA 4A59A 1VQ6N 4IFEA 3I55N 4YOYA 2ASOA 4A5BA 3M3ZA 5AQQA 3O9SA 4EHTA 4UY8O 3D6RA 4JKFA 5BN9A 5CHIA 4JK9A 1VQKN 4WFBL 3OHRA 4YDUC 2IVNA 1NGJA 2YI1A 4BG8A 3FFKB 4MO4A 5GADP 3DLLL 1DGKN 3VETA 2DPNA 2E8AA 1VQMN 4PKHA 2A42A 4IOXA 4BR4A 3TU5A 1YIJN 2WBNA 4WQ5A 3ZETB 5KPRA 5FPMA 5BR9A 2ZGZA 3CI5A 3VGMA 5I9EB 4JK8A 3CCLN 1TYQB 3AAPA 2P9KA 4QS7A 2WFBA 4M7YA 3T7ZA 3C6AA 4CD3A 4K42A 2E88A 3U8XA 3VEWA 1DT9A 3VESA 3O1WA 1YF5L 3EO3A 1JCFA 2QEXN 3UE5A 3IDHA 1R59O 2H3GX 4KH5A 3SBGA 1NGCA 2GTDA 3ATUA 4A2BA 4DB3A 4OO1J 4A61A 1OVYA 3B8AX 2D0OA 1N8RO 1NGAA 1U2VB 2P9UA 4H5WA 5F2RA 2HF3A 4XH4A 4JK7A 3H45C 4BQZA 1NMDA 3EZWA 2GX9A 1W97L 4J8FA 5TKWA 2P9KB 5JMVA 2ASMA 4BE7B 5BPMA 2NNWA 4JKCA 2IIRA 2F9TA 5CE3A 1MDUB 4CZKA 3HZ6A 5EXWA 3UKUA 1Q7YO 4HTLA 3P39A 3CCEN 4FWLA 3MN9A 1H1VA 3AGRA 3W0LA 5FPNA 1VQLN 4K43A 2QI2A 3O9RA 3WT0A 2P9UB 1IJJA 2P9LA 3KK7A 2D1KA 3A8YA 3EE8A 4JKGB 3CERA 5AQGA 4ISFA 3CMAN 1X3MA 3EKSA 1O13A 4U67L 3HI0A 3O9TA 4GV9A 2KKZA 3FZKA 4PKGA 3MCPA 3K9JA 1ZXOA 5BRHA 3TPQA 3LM9A 4IEIA 3RVCA 1HX1A 2ZJQL 5BPNA 3IKMA 1XUPO 1JCEA 3AAQA 4JKHA 4YOWA 3UKUB 4YOUA 1GLEG 4K41A 5GAHP 1TUUA 3CC2N 3G25A 2GELA 2I7PA 3D7EO 4BR5A 3CCSN 2GWKA 2HBLA 3AARA 3JXUA 5M1QA 4CD1A 4AF1A 3VTHA 3DXMA 2P9IB 3F5TA 4F9OA 3TTFA 2HSTA 4M63C 3CCUN 1KC8O 4IEEA 4A62A 1Z05A 2ZF5O 3O8MA 4WQ5C 1K8KB 1T6DA 3IMXA 5HL7L 3Q7BA 4PL8A 1G99A 5AQOA 5HOOA 3HSCA 2WUSA 5BRDA 5LJWA 3HM8A 4FWQA 3A5OC 4BQLA 2YCHA 5AQZA 2D0PA 3S41A 4RCHA 4B1WB 4BRAA 3P31A 1EQYA 3MX2A 3PIOL 2VWBA 2V52B 1YJNN 5GAGP 4H0PA 1QQOA 2YHWA 4BRFA 3MK6A 1GLLO 1QVFM 1VQNN 5C12A 2VYPA 1Q18A 1BU6O 3CF5L 2P9NA 1Y64A 4BC5A 3CQYA 3FZLA 3RSEA 1S22A 4DHYA 1HUXA 1U6ZA 2FSJA 3C7NA 4H5VA 1E4FT 1KAXA 3J7ZO 2BUPA 2EWSA 1QVGM 1QZ6A 3FZMA 3GDQA 1GLDG 3CPWM 2NRXA 4FWOA 4JHDB 2FXUA 1HKGA 5C2FA 2NRWA 4H5TA 4IO9L 2V7ZA 2YHXA 3DAWA 5JVHL 3BF3A 2E20A 4H0VB 2QXLA 3ATVA 4BRHA 1HLUA 4FWSA 2E1YA 4BRIA 3D2EA 4BREA 1Z6RA 3KVGA 3MN7A 4CBWA 5GIPA 3CJAA 4BR9A 2V7YA 2VCPA 5F1XA 5GIOA 2QWPA 4XEIA 5JLHA 3CCJN 1VQON 3GG4A 3CPEA 1K9MO 3LDQA 2FF6A 3VEYA 4BR7A 3A0IX 3E9OA 2Q1NA 3WXLA 4FOEA 3VMFB 5AQTA 3LDNA 2YHYA 4BVPA 2C1IA 3H46O 4EIAA 1Q86O 3CC7N 3D2FA 3HOSA 1EO1A 3TSUA 3CC4N 2GUPA 5FPEA 3E1YA 3EL2A 4B1VA 5ELZA 5TKYA 1CZAN 1C0FA 3IUCA 3CQXA 4JEPA 1C0GA 3R9PA 1T6CA 3MN6A 3TTDA 1ILYA 5M1KA 3OA9A 3R8EA 3ZX2A 3HOTA 3WXJA 5DM6L 3H6EA 3SK3A 3O9QA 4OPHA 3C65A 5E26A 3WEEA 5AQNA 3R6MA 4MDBA 3OW2M 3QFUA 3CETA 5EOYA 4QS8A 2Q36A 2PBDA 1ATNA 4MO5A 4A57A 2E2PA 4BRQA 1KAYA 3FE1A 5FPDA 5AQPA 4BEBA 3SAGA 3VTIA 3O80A 1YJ9N 1X3NA 2HBMA 4JAXA 1MA9B 4FWKA 5JICA 3SAHA 5AQHA 5AQFA 3ZX3A 2IVPA 1NLVA 3WEEB 2PFUA 1NM1A 3ULEA 4M7XA 2C1GA 4JKEA 4WQ4A 5M1OA 4CI6A 2JWKA 4JD2A 4ILHA 1BO5O 4QS9A 4BRLA 1JJ2M 2F7TA 4H0XB 3VENA 2GEMA 5AQMA 3MWPA 5AQYA 3N4PA 4B1UB 1J6ZA 4H0TB 2A41A 1VAZA 4CZHA 4GV3A 2OTJN 3AY9A 1K73O 1QZ5A 4MLHA 5E84A 5EX5A 4XJXA 2I7NA 1VQ4N 5KPZA 4WFAL 2P9SA 1RFQA 2P9PA 2CH6A 5F0XA 4DKWA 1Q81O 3DJCA 4OPAA 3WXIA 3G71N 1BG3A 4DCHA 4JKDA 4B1XB 3MWTA 2Q31A 3U9ZA 3TSPA 1XC3A 3R1XA 4A2AA 2YJEA 3P4IA 3ULEB 5EVZA 4LC9B 3LDPA 4JD2B 3VF4A 3AGKA 2QWOA 3OBYA 2Q0RA 2P9LB 1T44A 3VF2A 5C0YA 1MWMA 5B8HA 5AR0A 2W40A 3A5LC 3KZBA 3EE9A 5AQXA 4BROA 5AQUA 3WQUA 4YOTA 3CMEN 3C6HA 3O4WA 4CZGA 3M6GA 2P9SB 4AM6A 1SAZA 1GLCG 2NRRA 2P9PB 3DWLA 2NRTA 3MN5A 4WCEL 1VQ7N 3LL3A 2NRVA 4FOIA 2QWQA 4ISEA 2V51B 3VEOA 2FSKA 2Q0UA 3QMLA 2HBKA 5KQ8A 3PIPL 1VQ8N 3ID8A 1BDGA 4YOXA 3DXMB 2VGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FR0 A;  1ZC6 A;  2NRH A;  4PL7 A;  2E2N A;  3VF6 A;  1YXQ A;  3ENO A;  4H5R A;  4BRN A;  4RTF D;  1YUW A;  3FLC O;  3JS6 A;  5AQW A;  5ADX A;  3UKR A;  3CJ1 A;  4GY2 B;  1RGI A;  2CH5 A;  3FZH A;  2GWJ A;  1ATS A;  1WOQ A;  4CBX A;  3M1F A;  4Y0W A;  2AP1 A;  4FPA A;  4H0O A;  4FWP A;  2KHO A;  3F9M A;  5AQV A;  3EKU A;  4K25 A;  3L4I A;  3H3N O;  3VEX A;  2HOE A;  1HKC A;  4FWM A;  1SZ2 A;  2ZWH A;  1ATR A;  1JCG A;  3VPZ A;  3BP8 A;  3CIP A;  5LJV A;  2P9N B;  3SMP A;  3RSE B;  4E1J A;  3BF1 A;  4AM7 A;  1XQS C;  3C7N B;  2Q2R A;  1DEJ A;  3VEV A;  4CZJ A;  3UKR B;  3O08 A;  1NWK A;  4CZI A;  3C0B A;  4B1Z A;  3VOV A;  1BA1 A;  4BRK A;  5KPT A;  4FPB A;  3H3O B;  2CGK A;  3W3D A;  1YVN A;  4IJA A;  1TUY A;  5AQJ A;  1MWK A;  5AFU H;  3ZET A;  4RWT A;  3BUZ B;  3HTV A;  4CZL A;  1TYQ A;  3SLC A;  1WUA A;  3VGK A;  3LM2 A;  1LOT B;  1BA0 A;  2QWL A;  4DQ8 A;  3D2E B;  1NGB A;  3QBW A;  3UB5 A;  1S3X A;  5AFU A;  2A5X A;  5AQL A;  5LY3 A;  1NGI A;  1GLA G;  2BTF A;  2QWM A;  1HJO A;  4O8K A;  3CHW A;  2E2O A;  4FO0 A;  3QFP A;  5AZJ A;  4B1Y B;  4CJ7 A;  3LDL A;  1IG8 A;  4KBO A;  4BC4 A;  1U2V A;  4WYB A;  2A6A A;  3U4L A;  4BC2 A;  2F9W A;  2ASP A;  2NLX A;  1QQN A;  3D2F B;  4EAH D;  4XH5 A;  1BWF O;  3IFR A;  2D4W A;  3SMS A;  2UYT A;  4BR0 A;  3O1B A;  5KQD A;  4FWN A;  4BGB A;  3MMV A;  1ESV A;  4BRD A;  2QWR A;  3A5M C;  3GBT A;  1P8Z A;  2A40 A;  3QDK A;  1SQK A;  4BRM A;  3QBX A;  5AQR A;  4EFH A;  1NGD A;  4L3Q A;  5AZJ B;  3LDO A;  1X9J A;  2YJF A;  2HMP A;  3VEZ A;  1QHA A;  3WUH A;  4BR2 A;  4BG9 A;  4I6M A;  4H03 B;  3L0Q A;  3SJH A;  4FWR A;  3GE1 A;  4IXC A;  4HWI A;  2A3Z A;  4C23 A;  2FSN A;  3L6Q A;  3U9D A;  1NGG A;  2AA4 A;  4FL9 A;  2ITM A;  1NGF A;  4NO7 A;  4CZE A;  3I8B A;  5BPL A;  3MDQ A;  5EY4 A;  4Z94 A;  3ZEU A;  1NGH A;  2E1Z A;  1KAZ A;  2E2Q A;  2FF3 B;  2P9I A;  1BUP A;  1NGE A;  4JN4 A;  3WQT A;  1RDW X;  4BRP A;  4I6M B;  1K8K A;  2PAV A;  3GL1 A;  2CGJ A;  4FSV A;  3ZX0 A;  4YDU A;  5BRE A;  4IZ9 A;  5AQK A;  1V4T A;  4ISG A;  3FZF A;  2QWN A;  4BC3 A;  2OAN A;  3H1Q A;  2FLO A;  1KXP A;  4BRC A;  3ZEU B;  3QB0 A;  3DXK A;  4IWV A;  2NZT A;  4BRG A;  5ADX H;  1BOT O;  1NBW A;  3ENH A;  1QQM A;  4O5F A;  4EHU A;  3CJB A;  3EN9 A;  1LCU A;  4JNE A;  1DKG D;  1OKJ A;  3GOI A;  2W41 A;  4JHD A;  2CGL A;  2Q97 A;  4GNI A;  5AZI A;  2J4R A;  4B9Q A;  4CZM A;  1YAG A;  4PKI A;  3DXK B;  2HF4 A;  4WQ4 C;  3BEX A;  3QIC A;  3KHY A;  4IJN A;  2IVO A;  4XH1 A;  5AQS A;  3J8A A;  2QM1 A;  3H1V X;  5BN8 A;  3O5B A;  2ZGY A;  3CJ9 A;  4BVO A;  1ZBS A;  1GLF O;  4BGA A;  1HKB A;  3CJC A;  3WXK A;  4CZF A;  5BRF A;  4CBU A;  1D4X A;  1HPM A;  3O6W A;  1E4G T;  1GLJ O;  3FGU A;  3HBT A;  5AZI B;  5JLF A;  1GLB G;  2QW9 A;  1V4S A;  4H5N A;  3A5N C;  3CJ7 A;  4NB4 A;  3VGL A;  4IO8 A;  3I33 A;  4H0Y B;  4MLE A;  5AQI A;  3VER A;  2ASO A;  3M3Z A;  5AQQ A;  4EHT A;  5BN9 A;  3OHR A;  4YDU C;  2IVN A;  1NGJ A;  2YI1 A;  4BG8 A;  3FFK B;  4MO4 A;  1DGK N;  3VET A;  2DPN A;  2E8A A;  4PKH A;  2A42 A;  4BR4 A;  3TU5 A;  4WQ5 A;  5KPR A;  3ZET B;  5FPM A;  5BR9 A;  2ZGZ A;  3CI5 A;  3VGM A;  5I9E B;  1TYQ B;  3AAP A;  2P9K A;  4QS7 A;  4M7Y A;  4CD3 A;  4K42 A;  2E88 A;  3U8X A;  3VEW A;  3VES A;  3O1W A;  3EO3 A;  1JCF A;  3UE5 A;  3IDH A;  1R59 O;  2H3G X;  1NGC A;  2GTD A;  3ATU A;  4A2B A;  4DB3 A;  4A61 A;  3B8A X;  2D0O A;  1NGA A;  1U2V B;  2P9U A;  4H5W A;  5F2R A;  2HF3 A;  4XH4 A;  3H45 C;  4BQZ A;  1NMD A;  3EZW A;  4J8F A;  2P9K B;  5JMV A;  2ASM A;  5BPM A;  2IIR A;  2F9T A;  5CE3 A;  1MDU B;  4CZK A;  3HZ6 A;  5EXW A;  3UKU A;  4HTL A;  4FWL A;  3MN9 A;  1H1V A;  3W0L A;  5FPN A;  4K43 A;  3WT0 A;  2P9U B;  1IJJ A;  2P9L A;  2D1K A;  3A8Y A;  3CER A;  5AQG A;  4ISF A;  1X3M A;  3EKS A;  3HI0 A;  3FZK A;  4PKG A;  3MCP A;  5BRH A;  1ZXO A;  3TPQ A;  3LM9 A;  1HX1 A;  5BPN A;  1XUP O;  1JCE A;  3AAQ A;  3UKU B;  1GLE G;  4K41 A;  1TUU A;  3G25 A;  2GEL A;  2I7P A;  3D7E O;  4BR5 A;  2GWK A;  3AAR A;  3JXU A;  4CD1 A;  3DXM A;  2P9I B;  4F9O A;  4M63 C;  4A62 A;  1Z05 A;  2ZF5 O;  3O8M A;  4WQ5 C;  1K8K B;  1T6D A;  3IMX A;  4PL8 A;  1G99 A;  5AQO A;  3HSC A;  2WUS A;  5BRD A;  5LJW A;  3HM8 A;  4FWQ A;  3A5O C;  4BQL A;  2YCH A;  5AQZ A;  2D0P A;  3S41 A;  4RCH A;  4B1W B;  4BRA A;  1EQY A;  2VWB A;  2V52 B;  4H0P A;  1QQO A;  2YHW A;  4BRF A;  3MK6 A;  1GLL O;  2VYP A;  1Q18 A;  1BU6 O;  2P9N A;  1Y64 A;  4BC5 A;  3CQY A;  3FZL A;  3RSE A;  1S22 A;  4DHY A;  1HUX A;  1U6Z A;  2FSJ A;  3C7N A;  4H5V A;  1E4F T;  1KAX A;  2BUP A;  2EWS A;  1QZ6 A;  3FZM A;  3GDQ A;  1GLD G;  4FWO A;  4JHD B;  2FXU A;  1HKG A;  4H5T A;  2V7Z A;  2YHX A;  3DAW A;  3BF3 A;  2E20 A;  4H0V B;  2QXL A;  3ATV A;  4BRH A;  1HLU A;  4FWS A;  2E1Y A;  4BRI A;  3D2E A;  4BRE A;  1Z6R A;  3KVG A;  3MN7 A;  4CBW A;  3CJA A;  4BR9 A;  2V7Y A;  2VCP A;  5F1X A;  2QWP A;  4XEI A;  5JLH A;  3GG4 A;  3LDQ A;  2FF6 A;  3VEY A;  4BR7 A;  3A0I X;  2Q1N A;  3WXL A;  4FOE A;  5AQT A;  3LDN A;  2YHY A;  4BVP A;  3H46 O;  4EIA A;  3D2F A;  2GUP A;  5FPE A;  3EL2 A;  4B1V A;  5ELZ A;  5TKY A;  1CZA N;  1C0F A;  3IUC A;  3CQX A;  1C0G A;  3R9P A;  1T6C A;  3MN6 A;  3ZX2 A;  3R8E A;  3WXJ A;  3H6E A;  3SK3 A;  5E26 A;  3WEE A;  5AQN A;  3R6M A;  3QFU A;  3CET A;  5EOY A;  4QS8 A;  2Q36 A;  2PBD A;  1ATN A;  4MO5 A;  2E2P A;  4BRQ A;  1KAY A;  3FE1 A;  5FPD A;  5AQP A;  3O80 A;  1X3N A;  4JAX A;  1MA9 B;  4FWK A;  5JIC A;  5AQH A;  5AQF A;  3ZX3 A;  2IVP A;  1NLV A;  3WEE B;  1NM1 A;  3ULE A;  4M7X A;  4WQ4 A;  4CI6 A;  4JD2 A;  1BO5 O;  4QS9 A;  4BRL A;  4H0X B;  3VEN A;  2GEM A;  5AQM A;  5AQY A;  4B1U B;  1J6Z A;  4H0T B;  2A41 A;  4CZH A;  3AY9 A;  1QZ5 A;  4MLH A;  5E84 A;  5EX5 A;  2I7N A;  5KPZ A;  2P9S A;  1RFQ A;  2P9P A;  2CH6 A;  5F0X A;  3DJC A;  3WXI A;  1BG3 A;  4DCH A;  4B1X B;  2Q31 A;  3U9Z A;  4A2A A;  1XC3 A;  2YJE A;  3P4I A;  3ULE B;  5EVZ A;  4LC9 B;  3LDP A;  4JD2 B;  3VF4 A;  2QWO A;  2Q0R A;  2P9L B;  1T44 A;  3VF2 A;  1MWM A;  5B8H A;  5AR0 A;  2W40 A;  3A5L C;  3KZB A;  5AQX A;  4BRO A;  5AQU A;  3WQU A;  3O4W A;  4CZG A;  3M6G A;  2P9S B;  4AM6 A;  1SAZ A;  1GLC G;  3MN5 A;  2P9P B;  3DWL A;  3LL3 A;  4FOI A;  2QWQ A;  4ISE A;  2V51 B;  3VEO A;  2FSK A;  2Q0U A;  3QML A;  5KQ8 A;  3ID8 A;  1BDG A;  3DXM B; 
#chains in the Genus database with same CATH topology
 3LAN A;  3FR0 A;  4E7K A;  3VF6 A;  1YXQ A;  4H5R A;  4BRN A;  3TAP A;  4RTF D;  1YUW A;  3G4S N;  1XHX A;  3V9S A;  4GY2 B;  3FZH A;  4FJN A;  1WOQ A;  4CBX A;  4DLE A;  2AP1 A;  4FWP A;  3F9M A;  3EKU A;  3NGY A;  1ASU A;  3L4I A;  1SS6 A;  2HOE A;  3ZLJ A;  4FWM A;  2Z1I A;  3BP8 A;  1KD1 O;  2HND A;  1SL1 A;  3QEP A;  3AVL A;  2FBT A;  4CJ3 A;  4AM7 A;  3C6U A;  3FFI A;  1KQS M;  1NWK A;  3QO9 A;  4CZI A;  3C0B A;  4FJX A;  4CF2 A;  2YHB A;  4CF9 A;  3TAR A;  2O8F A;  4FLV A;  2P5O A;  5T7B A;  5AQJ A;  3NVK A;  5AFU H;  1MWK A;  4CZL A;  1TYQ A;  5CYQ A;  2GV9 A;  3LM2 A;  1HYS A;  2QWL A;  2JLE A;  3QES A;  3K9K A;  3CD6 N;  5LY3 A;  3SQ4 A;  1I94 K;  1WSF A;  1J5O A;  4B3O A;  1VSI A;  4CJ7 A;  1VK0 A;  4E7I A;  1IG8 A;  2FC0 A;  1M1K O;  3T19 A;  3SV3 A;  2A6A A;  4BC2 A;  4B9M A;  2NLX A;  5DMR A;  1QQN A;  3D2F B;  2HHW A;  2D4W A;  2UYT A;  3JAM O;  4FJL A;  4KRE A;  3RR8 A;  1WSH A;  5FDL A;  1NGD A;  4L3Q A;  3VQQ A;  1TKZ A;  1X9J A;  2YJF A;  4FM1 A;  4HUF A;  2VWJ A;  1VSD A;  2B6A A;  4H03 B;  1EET A;  4JI3 K;  2IAJ A;  3LP1 A;  3E01 A;  3G6E N;  4DR6 K;  3I8B A;  5BPL A;  4CHO A;  1XC9 A;  3MDQ A;  5EY4 A;  3OYK A;  4W5N A;  1KAZ A;  1XHZ A;  3MXM A;  2FF3 B;  3V1Q A;  3MEG A;  1RDW X;  1HPZ A;  1Y97 A;  3E66 A;  4FCY A;  2PAV A;  4DR1 K;  3OYJ A;  4BWJ A;  4CJV A;  4YDU A;  1V4T A;  4ISG A;  3V1O A;  4JI5 K;  3FZF A;  3J80 O;  5CR4 A;  4H4O A;  4BC3 A;  4ILJ A;  2FLO A;  3RWU A;  1NG9 A;  3O4N A;  4JI0 K;  1FXX A;  3DXK A;  5C2D A;  2NZT A;  1BOT O;  3DM2 A;  4EHU A;  1LCU A;  1HQU A;  4IFY A;  4YY3 K;  4JNE A;  4BY9 C;  2BE2 A;  2HNY A;  5SWM A;  1I39 A;  4OPJ A;  3GOI A;  3O3G A;  4JHD A;  3OYB A;  2J4R A;  4JKB A;  4MDA A;  3SQ2 A;  5JVG L;  3HVT A;  1M90 O;  3DXK B;  5AQS A;  4NLB A;  2P1J A;  1OH8 A;  5H1S Q;  4CJK A;  4CJ5 A;  4MFB A;  2YNF A;  4AIL C;  1UA1 A;  1HKB A;  4ILG B;  3WXK A;  4X62 K;  3OYG A;  2UUB K;  4CBU A;  1D4X A;  1E4G T;  1U47 A;  3FGU A;  1Q82 O;  2VG5 A;  4CK1 A;  2NRZ A;  3M8R A;  3HRG A;  2D5R A;  3O9U A;  4H5N A;  4E7L A;  3SPY A;  3LAM A;  4NB4 A;  1DLO A;  4IO8 A;  3NH2 A;  2YNH A;  4IBN A;  5AQI A;  4IFE A;  3I55 N;  2G8V A;  5AQQ A;  3EY1 A;  3D6R A;  5CHI A;  5FRN A;  1VQK N;  2IVN A;  3OS0 A;  4BWM A;  5LMN K;  4LF4 K;  5KRT A;  4RW7 A;  4YFU A;  2WBN A;  3ZET B;  4MQ3 A;  3CI5 A;  3CCL N;  3HJF A;  2P9K A;  3QIP A;  1Z26 A;  1BI4 B;  2O4G A;  1QTM A;  1KVA A;  1ASV A;  3VES A;  1WBB A;  4IKF A;  3IDH A;  4I9Q A;  1RTD A;  1IO2 A;  4FZZ A;  1C0M A;  2GTD A;  4A2B A;  4DTX A;  4QAG A;  2D0O A;  1N8R O;  1U2V B;  5F2R A;  1FJG K;  4J2A A;  4JK7 A;  3THW A;  1SKW A;  4YHH K;  2GX9 A;  4LH5 A;  4J8F A;  2P9K B;  5JMV A;  3EYZ A;  2NNW A;  2IIR A;  2UXB K;  4CF0 A;  1RDD A;  2F9T A;  5CYM A;  5CE3 A;  1IBL K;  4OPK A;  3HZ6 A;  3A2F A;  3V9W A;  1RT5 A;  4W5R A;  3HL8 A;  4HTL A;  4FWL A;  3K5O A;  1H1V A;  3AGR A;  3H08 A;  4G1Q A;  4ZTF A;  1QQC A;  1EWR A;  2P9L A;  3EE8 A;  4HTU A;  1C1A A;  3CMA N;  3FZK A;  3K9J A;  3TPQ A;  3V4I A;  4DTO A;  2UXD K;  4K0K K;  4RW9 A;  4CEB A;  1GOA A;  4YOU A;  4AHR A;  1GLE G;  4H8K A;  3CCS N;  4CD1 A;  2P9I B;  5E41 A;  3TTF A;  2ZF5 O;  4E1M A;  3HVR A;  1K8K B;  1T6D A;  1IKX A;  4F2S A;  1O1W A;  3HSC A;  5LJW A;  3DOL A;  4BQL A;  2D0P A;  3P31 A;  1EQY A;  2O8C A;  1VSE A;  3PX6 A;  1U45 A;  4H0P A;  3QNN A;  2O8E A;  1QQO A;  1VQN N;  1GLL O;  3IS9 A;  4M41 A;  5C12 A;  3NDK A;  1BU6 O;  1WB9 A;  3LZI A;  2P9N A;  1B92 A;  1JXE A;  4IG3 A;  4DLG A;  1RDA A;  4CEF A;  4B9V A;  1U6Z A;  3C7N A;  2P5G A;  2DFH A;  2PYJ A;  1C1B A;  1GLD G;  2XRI A;  5HRN A;  2NRX A;  2OCE A;  4FJI A;  5C2F A;  2FXU A;  4H5T A;  1YVU A;  2YHX A;  1VSH A;  2G8K A;  4DG1 A;  1I3A A;  5JVH L;  2E20 A;  5J2P A;  3J81 O;  4H0V B;  2QXL A;  3HST B;  3P1G A;  4FWS A;  4RW4 A;  1Z6R A;  3KLG A;  3MN7 A;  3CJA A;  1SL0 A;  4DV6 K;  4XEI A;  3K5N A;  4GKJ K;  2X78 A;  3RMA A;  3KLF A;  3LDQ A;  2FF6 A;  3VEY A;  4BR7 A;  3L2U A;  2Q1N A;  4M45 A;  2YHY A;  4LF7 K;  5HLF A;  1Q86 O;  2QKK A;  3TSU A;  3L8B A;  3CC4 N;  2GUP A;  3CM5 A;  3MED A;  3MN6 A;  3BZC A;  2IC3 A;  3OA9 A;  3ZX2 A;  2YV0 X;  3HOT A;  3H6E A;  3O9Q A;  4EP5 A;  4JS4 A;  3CET A;  4F4K A;  4CK3 A;  2PBD A;  2F8T A;  2UUA K;  1T05 A;  4CEQ A;  5HRO A;  5FPD A;  3SAG A;  3DMJ A;  1YJ9 N;  3QEX A;  3V9U A;  2O8B A;  5JIC A;  3TI0 A;  5AQH A;  4DQQ A;  5AQF A;  1NLV A;  4JYA K;  4NYF A;  2FBV A;  2C1G A;  4GMJ B;  2I5J A;  4JKE A;  1NJX A;  4LFB K;  4IG0 A;  3IAY A;  4ILH A;  1BO5 O;  1GOB A;  4B08 A;  3L2V A;  4LFC K;  4BRL A;  1Q9Y A;  4H0X B;  4CJF A;  3KK2 A;  3MWP A;  4DMN A;  2A41 A;  4AHV A;  4GV3 A;  1OH6 A;  2I7N A;  4DV2 K;  2UUC K;  2O8B B;  3G71 N;  3NH0 A;  1NKE A;  1WN7 A;  4A2A A;  3TSP A;  3WNE A;  1TVR A;  5EVZ A;  3LWM A;  4I2Q A;  3O3F A;  5HRS A;  2QWO A;  3OBY A;  1GOC A;  3VF2 A;  3NF9 A;  1C6V A;  4OGC A;  1MWM A;  5B8H A;  5AR0 A;  1Q9X A;  1T7P A;  4CJQ A;  5KRS A;  5AQU A;  3VQ4 A;  2D0A A;  4AM6 A;  2D0C A;  3LL3 A;  3ASM A;  5EU7 A;  3VA3 A;  4DR2 K;  1LWE A;  1E3M A;  2HBK A;  3PIP L;  1VQ8 N;  3ID8 A;  5JEN A;  2VGM A;  5CZ2 A;  4FLT A;  3IRX A;  3D0P A;  1WSI A;  4Y1C A;  3QIN A;  1RT2 A;  2NRH A;  1UA0 A;  1RTI A;  1C1C A;  4Z4G A;  1ATS A;  1Z25 A;  4KHS A;  1ITG A;  1FW6 A;  4Y0W A;  3ZSX A;  4DTS A;  2KHO A;  1RBT A;  4K25 A;  1NJI O;  3ZCM A;  3H3N O;  1NKB A;  3KWG A;  1G15 A;  1HKC A;  4C8N A;  1KLN A;  4M3W A;  1SZ2 A;  3VQP A;  1ATR A;  2B5J A;  3HPH A;  4DR5 K;  4KH4 A;  5LJV A;  4DTP A;  3SMP A;  3K5M A;  2RN2 A;  3ID6 A;  4CZJ A;  1IKW A;  1DTQ A;  4AHC A;  4JI4 K;  4FJ7 A;  4CGF A;  5KPT A;  4FPB A;  3W3D A;  4CGI A;  3VQ7 A;  3L3U A;  1KVC A;  4JKA A;  5M1F A;  3SLC A;  1WUA A;  4GV6 A;  1BA0 A;  3D2E B;  2EHG A;  1NGB A;  4FW2 A;  1S3X A;  4WE1 A;  5AFU A;  2DTU A;  3L2W A;  5AQL A;  3SUP A;  1NGI A;  2DFE A;  3Q7C A;  4DFP A;  3KWI A;  2WC9 A;  2QWM A;  1HJO A;  3CHW A;  2E2O A;  4IDH A;  1X9S A;  4FO0 A;  5C42 A;  3QFP A;  5AZJ A;  4B1Y B;  3LDL A;  4KBO A;  3AVM A;  4WYB A;  4CGG A;  4CFB A;  1K6Y A;  4FW1 A;  2ZJR L;  2F9W A;  4EAH D;  1WAJ A;  4BR0 A;  1SUQ A;  4OLB A;  3TR8 A;  3O4Q A;  2Y1J A;  4BGB A;  2ZE2 A;  2GUI A;  4EFH A;  2HHS A;  3EEQ A;  5AZJ B;  4CEC A;  4Z0U A;  3WUH A;  1QSY A;  4BG9 A;  4I6M A;  3SQ0 A;  3MCA B;  4FWR A;  3GE1 A;  4FJ9 A;  4C23 A;  2O4I A;  3L6Q A;  3L2Q A;  1S72 N;  1BL3 A;  3OVN A;  3WXM B;  2EX3 A;  4NO7 A;  3ULD A;  4KV8 A;  4DQS A;  2YX6 A;  1BHL A;  4Z94 A;  3N4Q A;  3ZEU A;  4DTM A;  1NGH A;  1HNZ K;  3QEW A;  2W00 A;  4JN4 A;  3VN5 A;  4DU1 A;  4I6M B;  3G10 A;  4BEC A;  4PA1 A;  3HK2 A;  3IG1 A;  4O8U A;  1NMN A;  3NF6 A;  1S1U A;  1RDB A;  3PO5 A;  1HQE A;  3V6D A;  1VQ9 N;  5M1N A;  3DRP A;  5MLC Q;  3CCQ N;  3ZEU B;  3TTC A;  4IWV A;  1TK0 A;  4BRG A;  3KTQ A;  3P38 A;  1QQM A;  4O5F A;  1WAF A;  1FKO A;  3K57 A;  3S5T A;  4DFK A;  4CGH A;  4CZM A;  3I56 N;  3OYF A;  4LF6 K;  4KB0 A;  2HB5 A;  2ETJ A;  4PKI A;  3HP6 A;  4WQ4 C;  3QIC A;  3KHY A;  4IJN A;  2IVO A;  4O55 A;  1D5A A;  3J8A A;  4R79 A;  1OH5 A;  2GBZ A;  3H1V X;  5IWA K;  1T8E A;  5C24 A;  2ZGY A;  3CJ9 A;  1ZBS A;  2BAN A;  4BGA A;  1QSS A;  3QER A;  5D3G A;  2VQE K;  4X64 K;  4DSE A;  4A5A A;  4DSF A;  3C6T A;  4B3T K;  2VGN A;  3ZT4 A;  4CCH A;  3CCM N;  2HHX A;  2OZM A;  2IOC A;  3MX5 A;  4NLC A;  3A5N C;  3CJ7 A;  3LZJ A;  3I33 A;  5A2Q O;  4MLE A;  4KI6 A;  2ASO A;  3DLH A;  4NCB A;  3OYD A;  4M3X A;  3MXJ A;  5BN9 A;  4JK9 A;  4WFB L;  3OHR A;  1NGJ A;  4CES A;  4DQR A;  4MO4 A;  5GAD P;  1DGK N;  2E6M A;  2DPN A;  1NJW A;  2O8F B;  2RF2 A;  2A42 A;  4IOX A;  3TU5 A;  1YIJ N;  4WQ5 A;  2KTQ A;  1ZBL A;  2YKN A;  3VGM A;  4EZ6 A;  1TYQ B;  2WFB A;  3AVJ A;  3C6A A;  3PX0 A;  1VRT A;  4CJU A;  1FKP A;  4KKO A;  3K59 A;  4RG8 A;  2VG7 A;  3OYC A;  3EO3 A;  1JCF A;  1D8Y A;  1HNW K;  2H3G X;  3OYM A;  4KH5 A;  3SBG A;  1NGC A;  3WNH A;  4A61 A;  1OVY A;  1NK9 A;  3NE6 A;  3LDS A;  2P9U A;  3NBP A;  4H5W A;  2HF3 A;  4XH4 A;  3AO4 A;  4OVL A;  1W97 L;  5TKW A;  4H4M A;  3NH1 A;  5BPM A;  4GKK K;  4BE1 A;  3VQC A;  4PQU A;  3DRR A;  1U48 A;  1Q7Y O;  3P39 A;  3CCE N;  4E19 A;  1EX4 A;  1VSM A;  3MN9 A;  3ZT1 A;  3W0L A;  2OYQ A;  3O9R A;  2F96 A;  3ZT3 A;  1WSE A;  3ZT2 A;  4DTR A;  1N5Y A;  2P9U B;  3HPO A;  1HYZ A;  2D1K A;  3A8Y A;  3AO3 A;  3CER A;  2G8F A;  4ISF A;  1X3M A;  3OS1 A;  1L3T A;  4Z4C A;  2P51 A;  4PKG A;  4N47 A;  3S3N A;  3M8S A;  1BQM A;  1LV5 A;  4I9L A;  5BPN A;  3IKM A;  1XUP O;  2HHV A;  4YOW A;  2FBY A;  4FK4 A;  3AA4 A;  4CIE A;  1IKY A;  3D7E O;  2I7P A;  4BR5 A;  4CGJ A;  4X65 K;  2GWK A;  2HBL A;  3JXU A;  5M1Q A;  3T1A A;  3DXM A;  4DR3 K;  1BQN A;  4IEE A;  1CZ9 A;  3IMX A;  4PL8 A;  4ID1 A;  4FK0 A;  5HOO A;  5I3U A;  2G8H A;  4HUE A;  5AQZ A;  4B1W B;  3MX2 A;  3AVN A;  2VWB A;  3WNF A;  3PIO L;  4DV1 K;  1QVF M;  2R7Y A;  4KAZ A;  1Q18 A;  3SNN A;  4BC5 A;  2O8D A;  4DHY A;  3RSE A;  1RNH A;  2ZQB A;  1S22 A;  5AJ3 K;  2FSJ A;  1E4F T;  3SZ2 A;  4JV5 K;  4C8M A;  3SPZ A;  1KRP A;  4JHD B;  1HKG A;  4DQP A;  1XI1 A;  4IO9 L;  4DTJ A;  2V7Z A;  3BF3 A;  1JLC A;  4W5O A;  2G8I A;  2E1Y A;  1EP4 A;  4BRE A;  4CEE A;  3CFP A;  4HVJ A;  4FLU A;  5J2M A;  3U3Y A;  1SV5 A;  3NF7 A;  4DSJ A;  5JLH A;  5CY4 A;  4OGE A;  3DLB A;  4FJ5 A;  1JLE A;  3UIQ A;  3BZK A;  5AQT A;  4OKE A;  1EWQ A;  2C1I A;  3H46 O;  1EO1 A;  1VSL A;  3HOS A;  4OKJ A;  1IBM K;  3RR7 A;  3E1Y A;  5ELZ A;  1CZA N;  4JEP A;  3R9P A;  1T6C A;  4DU3 A;  3R8E A;  3SK3 A;  3WEE A;  4OPH A;  4FLW A;  2RKI A;  1NK6 A;  3QFU A;  2YNI A;  2Q36 A;  1NOZ A;  1ATN A;  3VQB A;  1KSP A;  5I42 A;  1KAY A;  1SKR A;  1NK0 A;  4ICL A;  4FWK A;  3LP2 A;  1SL2 A;  1W0H A;  1RBS A;  2HHT A;  3ZX3 A;  3WEE B;  2PFU A;  4BDY A;  4WQ4 A;  4FLY A;  3TAG A;  2F7T A;  1A5V A;  5IT9 O;  1S5J A;  5AQM A;  1S9G A;  1JKH A;  4Z4I A;  4DR4 K;  3THW B;  4CZH A;  4M3T A;  3S3M A;  1B9F A;  1RFQ A;  2X6N A;  1KVB A;  3WXI A;  1KCF A;  1WNS A;  1XC3 A;  3P4I A;  4XIU A;  2F4V K;  4CF1 A;  4DS5 A;  4FJK A;  2Q0R A;  3VQA A;  2P9L B;  3NCI A;  2IDO A;  2W40 A;  5AQX A;  4YOT A;  3CME N;  3AVI A;  3O4W A;  2XY8 A;  1SAZ A;  1BGX T;  4CHP A;  3F9K A;  3SUN A;  5HRR A;  3ZSW A;  3QML A;  4AHT A;  2OZS A;  1VRU A;  5KQ8 A;  4CER A;  4YOX A;  1EXQ A;  2OPQ A;  2Z1H A;  4PL7 A;  3OBW A;  4DSI A;  3CJ1 A;  3ZYY X;  2GWJ A;  4FPA A;  3OJS A;  2O8C B;  5AQV A;  3HM9 A;  3OYH A;  5LMU K;  2O8E B;  2WON A;  4FYD A;  1JCG A;  3VPZ A;  1OH7 A;  4B9T A;  3L4Q A;  2P9N B;  2RE2 A;  4E1J A;  3BF1 A;  1MU2 A;  4Q5V A;  1XQS C;  3C7N B;  2Q2R A;  3SBT A;  3AA3 A;  1HR0 K;  1N33 K;  1RT7 A;  3O08 A;  4B1Z A;  3VOV A;  1BA1 A;  1SKS A;  2CGK A;  1UWB A;  4IJA A;  1TUY A;  1RDU A;  4U7B A;  3BUZ B;  5DM7 L;  2ZJP L;  4DUZ K;  4QOZ B;  4DU4 A;  1RTH A;  4DQ8 A;  1HJR A;  3UB5 A;  1C0T A;  4PUO A;  2A5X A;  1WLJ A;  1HNV A;  1K8A O;  1GLA G;  1BIU A;  4O8K A;  1VSJ A;  3PLA A;  4L8R B;  3JSM A;  1JLG A;  1U4B A;  3DLK A;  1W9H A;  2ASP A;  2YHA A;  4XH5 A;  1BWF O;  3E9P A;  3SMS A;  4FWN A;  3QNO A;  3LAK A;  4OJR A;  4BRD A;  2QWR A;  3GBT A;  3OYI A;  1SQK A;  3QBX A;  2HHQ A;  4KTZ A;  1N36 K;  4DQI A;  1WSG A;  1NK4 A;  1X9W A;  4CHY A;  4N56 A;  2HMP A;  1QHA A;  4G9Z A;  4JKG A;  2YKM A;  2OPS A;  4J2B A;  4IXC A;  2BH1 A;  4HWI A;  2A3Z A;  3SQ1 A;  1T3V A;  3U9D A;  3VQE A;  4FJH A;  4FL9 A;  1NGF A;  4YNQ A;  2PY5 A;  5GAE P;  1WBD A;  3LAL A;  4DFM A;  1BUP A;  3WQT A;  4BRP A;  3VQD A;  2XY7 A;  2CGJ A;  4E89 A;  3KK1 A;  4IZ9 A;  5AQK A;  3S9H A;  2KQ2 A;  3JYT A;  5KGW A;  4CVN E;  4JI1 K;  1A5W A;  2W42 A;  5JS2 A;  3H1Q A;  3RMB A;  3KIO A;  4BRC A;  1TK8 A;  2UXC K;  3I0R A;  3J7Y P;  2KLA A;  1S1T A;  2DY4 A;  3ENH A;  3CJB A;  3EN9 A;  4AH9 A;  1DKG D;  4PHT X;  1OKJ A;  4W5Q A;  3V9X A;  3SYZ A;  2Q97 A;  4GNI A;  1HMV A;  2A1R A;  4B9U A;  4B9Q A;  4JI6 K;  4TSX A;  4J2D A;  4B3S K;  1BIS A;  2HF4 A;  3BEX A;  4W5T A;  4XH1 A;  3KK3 A;  2QM1 A;  3HYF A;  4NXM K;  1VSK A;  4KFB A;  3CJC A;  4CZF A;  4B9S A;  3B6P A;  4C1N I;  1ZBI A;  1HPM A;  1YHQ N;  1GLJ O;  3HBT A;  3M5R A;  5JLF A;  1GLB G;  3T69 A;  3NVM A;  1V4S A;  3NAE A;  4M3U A;  1QHT A;  2LSN A;  3VGL A;  4H0Y B;  4HUG A;  3T1H K;  3VER A;  1UAX A;  1VQ6 N;  5JS1 A;  4YOY A;  2HHU A;  1YTU A;  1NJY A;  2PYL A;  4A5B A;  2ITG A;  4JKF A;  4YDU C;  4JI7 K;  5BR8 K;  2YI1 A;  4KI4 A;  4BG8 A;  3VET A;  2D0B A;  2E8A A;  4PKH A;  3OTO K;  3OYN A;  1QE1 A;  5KPR A;  2Z1G A;  5BR9 A;  4JK8 A;  1JLQ A;  3AAP A;  4QS7 A;  3CYM A;  4CD3 A;  4DTU A;  4K42 A;  4CF8 A;  3LWL A;  2E88 A;  3U8X A;  1JLB A;  1XWL A;  1DT9 A;  3VEW A;  2QEX N;  1J9A A;  2UU9 K;  1ZBU A;  4CFC A;  1B9D A;  1TGO A;  4ELV A;  1X1P A;  2W6K A;  3H45 C;  4BQZ A;  2AJQ A;  4LSL A;  4Z4H A;  4LF5 K;  4JI8 K;  4B8A B;  2WOM A;  4NCG A;  4CJP A;  4LFA K;  1ZBF A;  2W6L A;  3ZSY A;  1A5X A;  1KLM A;  1MDU B;  5EXW A;  3UKU A;  2QI2 A;  1YT3 A;  1TAU A;  4I7F A;  5CZ1 A;  4B8C A;  3AV9 A;  3M8Q A;  4F3O A;  5AQG A;  4GW6 A;  3EKS A;  3O9T A;  4GV9 A;  3MCP A;  5BRH A;  2PZS A;  3LM9 A;  3K0S A;  1HX1 A;  1T03 A;  2ZJQ L;  1F21 A;  4JKH A;  3AAQ A;  4HCC A;  3UKU B;  3TWH A;  3DOK A;  4AQY K;  4CHN A;  1C0U A;  4AF1 A;  3VTH A;  4F9O A;  4CFA A;  4M63 C;  1YTA A;  3CCU N;  1KC8 O;  4A62 A;  1Z05 A;  3DLR A;  5LL6 Z;  2E6L A;  1CXU A;  5HL7 L;  3Q7B A;  1X9M A;  1G99 A;  5AQO A;  1S1W A;  1J5E K;  2KFN A;  5BRD A;  4C8K A;  3HM8 A;  4FWQ A;  3QIO A;  3S41 A;  4KB1 A;  1NOY A;  2V52 B;  1YJN N;  5GAG P;  3DYA A;  3MXI A;  2YHW A;  2VYP A;  5J2N A;  2WTU A;  1Y64 A;  3AVK A;  3FZL A;  1Q8I A;  3J7Z O;  3AVA A;  3TAN A;  2BUP A;  3CFR A;  4ZHR A;  1HNI A;  3GDQ A;  3QET A;  2KFZ A;  5J1E A;  2ZM6 K;  3AO1 A;  1REV A;  3VQ8 A;  3SV4 A;  1JL2 A;  3ATV A;  4BRH A;  1HLU A;  3P83 D;  4BRI A;  1RIL A;  3KVG A;  4CBW A;  3ZSR A;  3TAM A;  4CJR A;  4BR9 A;  2VCP A;  2X74 A;  4KHW A;  1U49 A;  5KTQ A;  3AA2 A;  2BDP A;  2KZM A;  4O5B A;  3K5L A;  1K9M O;  3U6F A;  4BAC A;  1NJZ A;  3A0I X;  3NGZ A;  4FOE A;  3VMF B;  3CC7 N;  3D2F A;  3KLI A;  3HT3 A;  4J2E A;  3EL2 A;  4KTQ A;  4CJW A;  4FZX C;  3TTD A;  1HRH A;  4CJL A;  5HRP A;  3WXJ A;  4KHU A;  5E26 A;  3C65 A;  2FBX A;  1RBU A;  4Z4E A;  3R6M A;  1NNE A;  4N41 A;  2HHI A;  4MO5 A;  4A57 A;  4O44 A;  2E2P A;  3AVB A;  1U04 A;  4UQG A;  3O3H A;  5AQP A;  4BEB A;  3VTI A;  3NFA A;  3O80 A;  3OJU A;  2HBM A;  4JAX A;  3THX A;  1IH7 A;  3RRH A;  4KPY A;  4FM2 A;  3AVH A;  1MA9 B;  1IKV A;  3V81 A;  2IVP A;  1TAQ A;  1NM1 A;  1ZBH A;  4ZTJ A;  4CI6 A;  2JWK A;  4JD2 A;  4ELT A;  4KHY A;  3N4P A;  4B9N A;  4B1U B;  2RPI A;  4H0T B;  2OTJ N;  1VAZ A;  3AY9 A;  1K73 O;  1QZ5 A;  5E84 A;  4XJX A;  3THX B;  4WFA L;  2P9P A;  5F0X A;  1Q81 O;  3DJC A;  3MWT A;  4CK2 A;  4DUY K;  4DWI A;  1XNR K;  4DFJ A;  2KZZ A;  4LC9 B;  4QCL A;  4JD2 B;  1L3V A;  3VF4 A;  1CLQ A;  4X66 K;  1TV6 A;  3A5L C;  3C95 A;  3KZB A;  3EE9 A;  4M3R A;  3TAF A;  3SI6 A;  3C6H A;  4E3S A;  4CZG A;  3NF8 A;  3MN5 A;  1GLC G;  2NRR A;  2P9P B;  3CYG A;  4WCE L;  2Y1I A;  2NRV A;  3KKS A;  4FOI A;  4ISE A;  3T3F A;  1JXB A;  2V51 B;  1IG9 A;  2HW3 A;  3ZSV A;  3L3V A;  2NUB A;  1XNQ K;  3KKR A;  1FK9 A;  4F8R A;  1BDG A;  3DXM B;  1LWC A;  1ZC6 A;  1RT6 A;  2E2N A;  3CG7 A;  3ENO A;  1BCO A;  1JLF A;  3BY5 A;  1RDC A;  1S1X A;  3FLC O;  3JS6 A;  5AQW A;  3UKR A;  5ADX A;  1RGI A;  1W2B M;  2CH5 A;  2RHK A;  1J53 A;  1RBV A;  3M1F A;  2HMI A;  4H0O A;  3OYE A;  3I8D A;  3QEI A;  5DK5 A;  3VEX A;  4IOA L;  3NMU A;  3KJV A;  2ZWH A;  2XY5 A;  3CIP A;  3CCV N;  4NYN A;  3AVC A;  2O8D B;  3RSE B;  3RTV A;  3AVG A;  3WNG A;  1YIT N;  4C8O A;  3HO1 A;  3TSQ A;  1DEJ A;  3VEV A;  1CXQ A;  4I2P A;  3UKR B;  4B3M K;  3HPG A;  4BE2 A;  2YNG A;  4BRK A;  3F73 A;  4HCB A;  3DLE A;  3H3O B;  2E5L K;  1YVN A;  3TAB A;  3THV A;  1HYV A;  4E0D A;  3ZET A;  4RWT A;  3KD1 E;  3HTV A;  3VGK A;  1D9F A;  1BI4 A;  1LOT B;  2HBJ A;  3SJJ A;  1NK5 A;  4B9L A;  2KW4 A;  3QBW A;  3ZT0 A;  3OYA A;  3RMC A;  2BTF A;  3PY8 A;  3U3G A;  2QXF A;  4JRP A;  1LAW A;  1VQP N;  1S9E A;  5GIN A;  4BC4 A;  1IV0 A;  1U2V A;  3SCX A;  4CJS A;  2QA4 N;  2OPP A;  4LY7 A;  3U4L A;  5K14 A;  1P90 A;  3HXM A;  3KD5 E;  4FJJ A;  4E1N A;  3IFR A;  4FK2 A;  1LW0 A;  3O1B A;  5KQD A;  5KI6 A;  4WFN L;  3LP3 A;  4DV5 K;  4O0I A;  3MMV A;  4YOV A;  1YI2 N;  1ESV A;  3P5J A;  3A5M C;  1P8Z A;  2A40 A;  3QDK A;  4BRM A;  5AQR A;  1XMQ K;  1VQ5 N;  5C10 A;  3LDO A;  3ZSZ A;  2Z1J A;  4HHT A;  3SUO A;  3VEZ A;  4FJM A;  4BR2 A;  1D9D A;  4KHQ A;  2OA8 A;  3L0Q A;  3SJH A;  1QSL A;  1YJW N;  2F8S A;  1ASW A;  5KGX A;  4FJG A;  2FSN A;  4DV0 K;  3E9L A;  1N6Q A;  1NGG A;  2HHH K;  2AA4 A;  2ITM A;  4IOC L;  4CEO A;  4M42 A;  3F2K A;  4KH6 A;  4N5S A;  3R3L A;  4CZE A;  3CCR N;  3HP9 A;  1HNX K;  4FM0 A;  4KHN A;  2QK9 A;  3ENB A;  2E1Z A;  3ZSO A;  3QEV A;  2E2Q A;  2P9I A;  4CW7 B;  2G8W A;  4LD0 A;  1NK7 A;  1NGE A;  2VG6 A;  4WF9 L;  3CXC M;  4EP4 A;  4DF8 A;  1K8K A;  1BIZ A;  2HVI A;  3GL1 A;  3L2R A;  4FSV A;  3ZX0 A;  3MAQ A;  4E7J A;  5BRE A;  4DV3 K;  5FRO A;  3EZ5 A;  2OTL N;  1QS4 A;  2IGI A;  2QWN A;  2OAN A;  4NCA A;  1KXP A;  1RBR A;  3QB0 A;  3MEC A;  4AHU A;  4RW6 A;  1VHX A;  5ADX H;  5M1P A;  1NBW A;  4R5P A;  3CQ8 A;  3PX4 A;  4AHS A;  3CM6 A;  2QKB A;  2W41 A;  5C15 A;  2CGL A;  5AZI A;  5SZT A;  1UOC A;  3DLG A;  1EKE A;  4GVE A;  1YAG A;  3KLE A;  4BDZ A;  3AA5 X;  4M3Z A;  4FVM A;  2OPR A;  1TL3 A;  5FLX O;  5BN8 A;  3O5B A;  2DFF A;  1OVQ A;  4BVO A;  4CJE A;  1ZYQ A;  1GLF O;  1L3U A;  4FLX A;  5BRF A;  3BGR A;  4DF4 A;  3O6W A;  3PO4 A;  2QTD A;  2X6S A;  4CIG A;  2JWL A;  5AZI B;  4FVU A;  4JRQ A;  4DS4 A;  3LPU A;  4C1N K;  4YOR A;  2QW9 A;  4CE9 A;  1NK8 A;  3SAF A;  4FZY A;  4A59 A;  4Y1D A;  1KFD A;  3M3Z A;  3O9S A;  4C8L A;  4OX9 K;  4EHT A;  4UY8 O;  4DR7 K;  3J7A P;  4KTW A;  4E7H A;  3FFK B;  4Z4F A;  1VQM N;  3DLL L;  4JS5 A;  4BR4 A;  1RT3 A;  3OYL A;  3ZSQ A;  4BE0 A;  5FPM A;  2ZGZ A;  5I9E B;  3PUF A;  4M7Y A;  1W7A A;  3K58 A;  3T7Z A;  3D45 A;  3O1W A;  1YF5 L;  3UE5 A;  3VA0 A;  1R59 O;  1TL1 A;  4DSL A;  2Q3S A;  3ATU A;  4OO1 J;  4DB3 A;  1VSF A;  3B8A X;  5HBM A;  1NGA A;  4FJ8 A;  3AO2 A;  3CFO A;  1NMD A;  3B6O A;  3EZW A;  3ISN C;  2ASM A;  4BE7 B;  4JKC A;  4FLZ A;  3G0Z A;  4FXD A;  4O4G A;  1NU0 A;  4ID5 A;  4LF8 K;  4CZK A;  1BCM A;  2ZD1 A;  1VQL N;  5FPN A;  4K43 A;  2A1S A;  3WT0 A;  1IJJ A;  3KK7 A;  3NHG A;  4JKG B;  3NGI A;  3MEE A;  1IBK K;  4U67 L;  1O13 A;  3HI0 A;  2KKZ A;  1ZXO A;  4IEI A;  3RVC A;  3VQ6 A;  1JCE A;  4ELU A;  3ITH A;  4JI2 K;  4K41 A;  5GAH P;  1TUU A;  3CC2 N;  3G25 A;  2GEL A;  3AAR A;  3LP0 A;  2XHB A;  4V19 S;  3S3O A;  3F5T A;  4IDK A;  2HST A;  3T1Y K;  3O8M A;  4WQ5 C;  1CZB A;  2JGU A;  3RMD A;  2WUS A;  1TKX A;  3A5O C;  2YCH A;  3DI6 A;  1N34 K;  4BRA A;  4RCH A;  4CED A;  4DSK A;  4CHZ A;  3OY9 A;  1RCH A;  4BRF A;  3MK6 A;  1J54 A;  2BGG A;  3M8P A;  3CF5 L;  1L3S A;  2VQF K;  2HNZ A;  3AVF A;  3CQY A;  4RW8 A;  1HUX A;  4JLH A;  4H5V A;  4CJ4 A;  3C94 A;  1KAX A;  1LWF A;  4LSN A;  3PSF A;  2EWS A;  1S6Q A;  4PWD A;  3OS2 A;  1QZ6 A;  3FZM A;  1QVG M;  1LAV A;  3CPW M;  4FWO A;  2G8U A;  2NRW A;  2VWK A;  3DAW A;  4LF9 K;  4F3T A;  1KTQ A;  3D2E A;  5GIP A;  1TK5 A;  1R0A A;  4O0J A;  4K8Z A;  1TKD A;  2V7Y A;  5F1X A;  5GIO A;  2QWP A;  4PY5 A;  2XO7 A;  3CCJ N;  1VQO N;  5HP1 A;  3GG4 A;  3CPE A;  4OLA A;  1XMO K;  3E9O A;  2E4L A;  1S6P A;  3WXL A;  3LDN A;  4BVP A;  3I0S A;  4NXN K;  4DV7 K;  4F2R A;  4EIA A;  3PV8 A;  5FPE A;  3V1R A;  4B1V A;  1RT1 A;  5TKY A;  5J2Q A;  1C0F A;  3IUC A;  3CQX A;  4K8X A;  2HVH A;  1C0G A;  1N32 K;  1ILY A;  4CEA A;  3K2P A;  5M1K A;  3VQ9 A;  5DM6 L;  5AQN A;  1KFS A;  4MDB A;  2ATQ A;  3OW2 M;  3PSI A;  5EOY A;  3V9Z A;  4QS8 A;  3LPT A;  1WSJ A;  4N76 A;  4M3Y A;  3ALY A;  1JLA A;  3SUQ A;  3AO5 A;  4BRQ A;  3FE1 A;  4DV4 K;  4BDP A;  3TAE A;  1X3N A;  1RT4 A;  3SAH A;  1TKT A;  4CJT A;  2XY6 A;  4KHP K;  2B4J A;  3ULE A;  4M7X A;  5M1O A;  1S1V A;  4DTN A;  4GVM A;  4QS9 A;  1JJ2 M;  3QLH A;  3VEN A;  2GEM A;  5AQY A;  4CEZ A;  1J6Z A;  1LW2 A;  3VQ5 A;  1DTT A;  4MLH A;  5EX5 A;  3TAQ A;  5C25 A;  3THY A;  4CIF A;  3DRS A;  1VQ4 N;  5KPZ A;  2P9S A;  2CH6 A;  4DKW A;  4OPA A;  1BG3 A;  4DCH A;  4JKD A;  4B1X B;  2Q31 A;  3U9Z A;  4CHQ A;  3R1X A;  2YJE A;  4OKK A;  1NKC A;  3ULE B;  3LDP A;  3AGK A;  3KLH A;  4EZ9 A;  1RTJ A;  1L5U A;  1T44 A;  5C0Y A;  4E72 A;  4BRO A;  1JL1 A;  3WQU A;  4Q0B A;  4CGD A;  4LH4 A;  3BDP A;  3THY B;  3M6G A;  2P9S B;  4CFD A;  5FRM A;  3DWL A;  2NRT A;  1VQ7 N;  2IS3 A;  2QWQ A;  3VEO A;  2FSK A;  2Q0U A;  4B3R K;  4KRF A;  3RRG A;  4IFV A;  4KO0 A; 
#chains in the Genus database with same CATH homology
 3FR0 A;  1ZC6 A;  2NRH A;  4PL7 A;  2E2N A;  3VF6 A;  1YXQ A;  3ENO A;  3OBW A;  4H5R A;  4RTF D;  1YUW A;  3FLC O;  3JS6 A;  5AQW A;  4BRN A;  5ADX A;  3UKR A;  3CJ1 A;  3G4S N;  4GY2 B;  1RGI A;  1W2B M;  2CH5 A;  3FZH A;  3ZYY X;  2GWJ A;  2RHK A;  1ATS A;  1WOQ A;  4CBX A;  3M1F A;  4Y0W A;  2AP1 A;  4FPA A;  4H0O A;  4FWP A;  2KHO A;  3F9M A;  5AQV A;  3EKU A;  4K25 A;  3L4I A;  1SS6 A;  1NJI O;  3H3N O;  3VEX A;  2HOE A;  4IOA L;  3KWG A;  1HKC A;  4FWM A;  3NMU A;  1SZ2 A;  2ZWH A;  1ATR A;  1JCG A;  3VPZ A;  3BP8 A;  3CIP A;  1KD1 O;  3CCV N;  3L4Q A;  4KH4 A;  5LJV A;  2P9N B;  2RE2 A;  3SMP A;  3RSE B;  4E1J A;  3BF1 A;  4AM7 A;  1XQS C;  3C7N B;  3ID6 A;  1YIT N;  2Q2R A;  3SBT A;  1DEJ A;  3TSQ A;  3VEV A;  4CZJ A;  3UKR B;  1KQS M;  3O08 A;  1NWK A;  4CZI A;  3C0B A;  4B1Z A;  3VOV A;  1BA1 A;  4BRK A;  5KPT A;  4FPB A;  3H3O B;  2CGK A;  3W3D A;  1YVN A;  4IJA A;  1TUY A;  5AQJ A;  1MWK A;  4JKA A;  1RDU A;  5AFU H;  3ZET A;  4RWT A;  4U7B A;  5M1F A;  3NVK A;  3BUZ B;  3HTV A;  5DM7 L;  4CZL A;  2ZJP L;  1TYQ A;  3SLC A;  1WUA A;  3VGK A;  4GV6 A;  2HBJ A;  1LOT B;  3LM2 A;  1BA0 A;  2QWL A;  4DQ8 A;  3D2E B;  1NGB A;  3QBW A;  3UB5 A;  1S3X A;  3K9K A;  5AFU A;  3CD6 N;  2A5X A;  5AQL A;  5LY3 A;  1NGI A;  3Q7C A;  1K8A O;  1GLA G;  3KWI A;  2WC9 A;  2BTF A;  2QWM A;  1HJO A;  4O8K A;  3CHW A;  2E2O A;  4IDH A;  1VQP N;  4FO0 A;  5GIN A;  3PLA A;  3QFP A;  5AZJ A;  4B1Y B;  4CJ7 A;  3LDL A;  1M1K O;  1IG8 A;  4KBO A;  4BC4 A;  1U2V A;  4WYB A;  2QA4 N;  2A6A A;  3U4L A;  4BC2 A;  2ZJR L;  2F9W A;  2ASP A;  2NLX A;  1P90 A;  1QQN A;  3D2F B;  4XH5 A;  4EAH D;  1BWF O;  3E9P A;  3IFR A;  2D4W A;  3SMS A;  2UYT A;  4BR0 A;  3O1B A;  5KQD A;  4WFN L;  4FWN A;  4BGB A;  3MMV A;  4YOV A;  1YI2 N;  1ESV A;  4BRD A;  2QWR A;  3A5M C;  3GBT A;  1P8Z A;  2A40 A;  3QDK A;  1SQK A;  4BRM A;  3QBX A;  5AQR A;  4EFH A;  1VQ5 N;  1NGD A;  4L3Q A;  5AZJ B;  5C10 A;  3LDO A;  1X9J A;  2YJF A;  2HMP A;  3VEZ A;  1QHA A;  3WUH A;  4BR2 A;  4G9Z A;  4JKG A;  4BG9 A;  4I6M A;  4H03 B;  3MCA B;  3L0Q A;  3SJH A;  4FWR A;  3GE1 A;  1YJW N;  4IXC A;  2BH1 A;  4HWI A;  2A3Z A;  1T3V A;  4C23 A;  2FSN A;  3L6Q A;  3U9D A;  3E9L A;  1NGG A;  1S72 N;  2AA4 A;  4FL9 A;  2ITM A;  4IOC L;  3WXM B;  1NGF A;  3F2K A;  4KH6 A;  4NO7 A;  3R3L A;  4CZE A;  5GAE P;  3G6E N;  3I8B A;  3CCR N;  5BPL A;  3MDQ A;  5EY4 A;  2YX6 A;  4Z94 A;  3N4Q A;  3ZEU A;  3ENB A;  1NGH A;  2E1Z A;  1KAZ A;  2E2Q A;  2FF3 B;  2P9I A;  2W00 A;  1BUP A;  1NGE A;  4JN4 A;  3WQT A;  4WF9 L;  3CXC M;  1RDW X;  4BRP A;  4I6M B;  4BEC A;  1K8K A;  3E66 A;  2PAV A;  3GL1 A;  4O8U A;  2CGJ A;  4FSV A;  3ZX0 A;  4YDU A;  5BRE A;  4IZ9 A;  5AQK A;  1V4T A;  4ISG A;  3FZF A;  1VQ9 N;  2OTL N;  5CR4 A;  2QWN A;  4BC3 A;  5M1N A;  4ILJ A;  2OAN A;  3H1Q A;  2FLO A;  1KXP A;  5MLC Q;  3CCQ N;  4BRC A;  3ZEU B;  3QB0 A;  3TTC A;  3DXK A;  5C2D A;  4IWV A;  2KLA A;  2NZT A;  4BRG A;  5ADX H;  1BOT O;  5M1P A;  1NBW A;  3P38 A;  3ENH A;  1QQM A;  4O5F A;  4EHU A;  3CJB A;  3EN9 A;  1LCU A;  4JNE A;  4BY9 C;  1DKG D;  4PHT X;  1OKJ A;  3GOI A;  2W41 A;  5C15 A;  4JHD A;  2CGL A;  2Q97 A;  4GNI A;  5AZI A;  2J4R A;  4JKB A;  4B9Q A;  4MDA A;  4CZM A;  3I56 N;  5JVG L;  4GVE A;  1YAG A;  4PKI A;  1M90 O;  3DXK B;  2HF4 A;  4WQ4 C;  3BEX A;  3QIC A;  3KHY A;  4IJN A;  2IVO A;  4NLB A;  4XH1 A;  5AQS A;  3J8A A;  4R79 A;  2QM1 A;  5H1S Q;  3H1V X;  5BN8 A;  3O5B A;  2ZGY A;  3CJ9 A;  4BVO A;  1ZBS A;  1GLF O;  4BGA A;  1HKB A;  3CJC A;  4ILG B;  3WXK A;  4CZF A;  5BRF A;  4C1N I;  4CBU A;  1D4X A;  1HPM A;  3O6W A;  2QTD A;  1YHQ N;  1E4G T;  1GLJ O;  3FGU A;  3HBT A;  2JWL A;  3M5R A;  5AZI B;  4A5A A;  1GLB G;  5JLF A;  3T69 A;  1Q82 O;  2NRZ A;  4FVU A;  4C1N K;  4YOR A;  2QW9 A;  3NVM A;  2VGN A;  1V4S A;  3CCM N;  3HRG A;  4H5N A;  3O9U A;  3MX5 A;  4NLC A;  3A5N C;  3CJ7 A;  4NB4 A;  3VGL A;  3SAF A;  4IO8 A;  3I33 A;  4H0Y B;  4MLE A;  5AQI A;  3VER A;  4A59 A;  1VQ6 N;  4IFE A;  3I55 N;  4YOY A;  2ASO A;  4A5B A;  3M3Z A;  5AQQ A;  3O9S A;  4EHT A;  4UY8 O;  3D6R A;  4JKF A;  5BN9 A;  5CHI A;  4JK9 A;  1VQK N;  4WFB L;  3OHR A;  4YDU C;  2IVN A;  1NGJ A;  2YI1 A;  4BG8 A;  3FFK B;  4MO4 A;  5GAD P;  3DLL L;  1DGK N;  3VET A;  2DPN A;  2E8A A;  1VQM N;  4PKH A;  2A42 A;  4IOX A;  4BR4 A;  3TU5 A;  1YIJ N;  2WBN A;  4WQ5 A;  3ZET B;  5KPR A;  5FPM A;  5BR9 A;  2ZGZ A;  3CI5 A;  3VGM A;  5I9E B;  4JK8 A;  3CCL N;  1TYQ B;  3AAP A;  2P9K A;  4QS7 A;  2WFB A;  4M7Y A;  3T7Z A;  3C6A A;  4CD3 A;  4K42 A;  2E88 A;  3U8X A;  3VEW A;  1DT9 A;  3VES A;  3O1W A;  1YF5 L;  3EO3 A;  1JCF A;  2QEX N;  3UE5 A;  3IDH A;  1R59 O;  2H3G X;  4KH5 A;  3SBG A;  1NGC A;  2GTD A;  3ATU A;  4A2B A;  4DB3 A;  4OO1 J;  4A61 A;  1OVY A;  3B8A X;  2D0O A;  1N8R O;  1NGA A;  1U2V B;  2P9U A;  4H5W A;  5F2R A;  2HF3 A;  4XH4 A;  4JK7 A;  3H45 C;  4BQZ A;  1NMD A;  3EZW A;  2GX9 A;  1W97 L;  4J8F A;  5TKW A;  2P9K B;  5JMV A;  2ASM A;  4BE7 B;  5BPM A;  2NNW A;  4JKC A;  2IIR A;  2F9T A;  5CE3 A;  1MDU B;  4CZK A;  3HZ6 A;  5EXW A;  3UKU A;  1Q7Y O;  4HTL A;  3P39 A;  3CCE N;  4FWL A;  3MN9 A;  1H1V A;  3AGR A;  3W0L A;  5FPN A;  1VQL N;  4K43 A;  2QI2 A;  3O9R A;  3WT0 A;  2P9U B;  1IJJ A;  2P9L A;  3KK7 A;  2D1K A;  3A8Y A;  3EE8 A;  4JKG B;  3CER A;  5AQG A;  4ISF A;  3CMA N;  1X3M A;  3EKS A;  1O13 A;  4U67 L;  3HI0 A;  3O9T A;  4GV9 A;  2KKZ A;  3FZK A;  4PKG A;  3MCP A;  3K9J A;  1ZXO A;  5BRH A;  3TPQ A;  3LM9 A;  4IEI A;  3RVC A;  1HX1 A;  2ZJQ L;  5BPN A;  3IKM A;  1XUP O;  1JCE A;  3AAQ A;  4JKH A;  4YOW A;  3UKU B;  4YOU A;  1GLE G;  4K41 A;  5GAH P;  1TUU A;  3CC2 N;  3G25 A;  2GEL A;  2I7P A;  3D7E O;  4BR5 A;  3CCS N;  2GWK A;  2HBL A;  3AAR A;  3JXU A;  5M1Q A;  4CD1 A;  4AF1 A;  3VTH A;  3DXM A;  2P9I B;  3F5T A;  4F9O A;  3TTF A;  2HST A;  4M63 C;  3CCU N;  1KC8 O;  4IEE A;  4A62 A;  1Z05 A;  2ZF5 O;  3O8M A;  4WQ5 C;  1K8K B;  1T6D A;  3IMX A;  5HL7 L;  3Q7B A;  4PL8 A;  1G99 A;  5AQO A;  5HOO A;  3HSC A;  2WUS A;  5BRD A;  5LJW A;  3HM8 A;  4FWQ A;  3A5O C;  4BQL A;  2YCH A;  5AQZ A;  2D0P A;  3S41 A;  4RCH A;  4B1W B;  4BRA A;  3P31 A;  1EQY A;  3MX2 A;  3PIO L;  2VWB A;  2V52 B;  1YJN N;  5GAG P;  4H0P A;  1QQO A;  2YHW A;  4BRF A;  3MK6 A;  1GLL O;  1QVF M;  1VQN N;  5C12 A;  2VYP A;  1Q18 A;  1BU6 O;  3CF5 L;  2P9N A;  1Y64 A;  4BC5 A;  3CQY A;  3FZL A;  3RSE A;  1S22 A;  4DHY A;  1HUX A;  1U6Z A;  2FSJ A;  3C7N A;  4H5V A;  1E4F T;  1KAX A;  3J7Z O;  2BUP A;  2EWS A;  1QVG M;  1QZ6 A;  3FZM A;  3GDQ A;  1GLD G;  3CPW M;  2NRX A;  4FWO A;  4JHD B;  2FXU A;  1HKG A;  5C2F A;  2NRW A;  4H5T A;  4IO9 L;  2V7Z A;  2YHX A;  3DAW A;  5JVH L;  3BF3 A;  2E20 A;  4H0V B;  2QXL A;  3ATV A;  4BRH A;  1HLU A;  4FWS A;  2E1Y A;  4BRI A;  3D2E A;  4BRE A;  1Z6R A;  3KVG A;  3MN7 A;  4CBW A;  5GIP A;  3CJA A;  4BR9 A;  2V7Y A;  2VCP A;  5F1X A;  5GIO A;  2QWP A;  4XEI A;  5JLH A;  3CCJ N;  1VQO N;  3GG4 A;  3CPE A;  1K9M O;  3LDQ A;  2FF6 A;  3VEY A;  4BR7 A;  3A0I X;  3E9O A;  2Q1N A;  3WXL A;  4FOE A;  3VMF B;  5AQT A;  3LDN A;  2YHY A;  4BVP A;  2C1I A;  3H46 O;  4EIA A;  1Q86 O;  3CC7 N;  3D2F A;  3HOS A;  1EO1 A;  3TSU A;  3CC4 N;  2GUP A;  5FPE A;  3E1Y A;  3EL2 A;  4B1V A;  5ELZ A;  5TKY A;  1CZA N;  1C0F A;  3IUC A;  3CQX A;  4JEP A;  1C0G A;  3R9P A;  1T6C A;  3MN6 A;  3TTD A;  1ILY A;  5M1K A;  3OA9 A;  3R8E A;  3ZX2 A;  3HOT A;  3WXJ A;  5DM6 L;  3H6E A;  3SK3 A;  3O9Q A;  4OPH A;  3C65 A;  5E26 A;  3WEE A;  5AQN A;  3R6M A;  4MDB A;  3OW2 M;  3QFU A;  3CET A;  5EOY A;  4QS8 A;  2Q36 A;  2PBD A;  1ATN A;  4MO5 A;  4A57 A;  2E2P A;  4BRQ A;  1KAY A;  3FE1 A;  5FPD A;  5AQP A;  4BEB A;  3SAG A;  3VTI A;  3O80 A;  1YJ9 N;  1X3N A;  2HBM A;  4JAX A;  1MA9 B;  4FWK A;  5JIC A;  3SAH A;  5AQH A;  5AQF A;  3ZX3 A;  2IVP A;  1NLV A;  3WEE B;  2PFU A;  1NM1 A;  3ULE A;  4M7X A;  2C1G A;  4JKE A;  4WQ4 A;  5M1O A;  4CI6 A;  2JWK A;  4JD2 A;  4ILH A;  1BO5 O;  4QS9 A;  4BRL A;  1JJ2 M;  2F7T A;  4H0X B;  3VEN A;  2GEM A;  5AQM A;  3MWP A;  5AQY A;  3N4P A;  4B1U B;  1J6Z A;  4H0T B;  2A41 A;  1VAZ A;  4CZH A;  4GV3 A;  2OTJ N;  3AY9 A;  1K73 O;  1QZ5 A;  4MLH A;  5E84 A;  5EX5 A;  4XJX A;  2I7N A;  1VQ4 N;  5KPZ A;  4WFA L;  2P9S A;  1RFQ A;  2P9P A;  2CH6 A;  5F0X A;  4DKW A;  1Q81 O;  3DJC A;  4OPA A;  3WXI A;  3G71 N;  1BG3 A;  4DCH A;  4JKD A;  4B1X B;  3MWT A;  2Q31 A;  3U9Z A;  3TSP A;  1XC3 A;  3R1X A;  4A2A A;  2YJE A;  3P4I A;  3ULE B;  5EVZ A;  4LC9 B;  3LDP A;  4JD2 B;  3VF4 A;  3AGK A;  2QWO A;  3OBY A;  2Q0R A;  2P9L B;  1T44 A;  3VF2 A;  5C0Y A;  1MWM A;  5B8H A;  5AR0 A;  2W40 A;  3A5L C;  3KZB A;  3EE9 A;  5AQX A;  4BRO A;  5AQU A;  3WQU A;  4YOT A;  3CME N;  3C6H A;  3O4W A;  4CZG A;  3M6G A;  2P9S B;  4AM6 A;  1SAZ A;  1GLC G;  2NRR A;  2P9P B;  3DWL A;  2NRT A;  3MN5 A;  4WCE L;  1VQ7 N;  3LL3 A;  2NRV A;  4FOI A;  2QWQ A;  4ISE A;  2V51 B;  3VEO A;  2FSK A;  2Q0U A;  3QML A;  2HBK A;  5KQ8 A;  3PIP L;  1VQ8 N;  3ID8 A;  1BDG A;  4YOX A;  3DXM B;  2VGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...