3CI5A

Complex of phosphorylated dictyostelium discoideum actin with gelsolin
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
372
structure length
366
Chain Sequence
DVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGMGQKDSVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major actin
publication title Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 123
structure length 366
sequence length 372
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ci5A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ci5A02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3ci5A03
3VEOA 5KPZA 5BN9A 3O4WA 2CGJA 3LM9A 3VEXA 1R59O 2QWMA 3AAPA 4CD1A 5EVZA 4DCHA 2ZF5O 2P9KA 3FLCO 5KQ8A 4IJNA 4BRPA 3WT0A 1TUYA 4I6MA 3WXJA 4A62A 4BVOA 3MMVA 3ULEB 5FPMA 2D0PA 4BR0A 3GG4A 4H03B 3VF4A 4BRMA 4Z94A 4CZLA 4DB3A 3QMLA 3FR0A 5AZJA 3H46O 1WUAA 4H0YB 4BR2A 2W41A 4FPBA 5LY3A 3EKUA 3R6MA 3EZWA 1SQKA 4BRHA 2FSNA 1GLAG 2BUPA 1X3NA 4MO4A 4K42A 4B9QA 5JICA 4XH4A 3I8BA 3SK3A 2E2PA 2VYPA 4AM6A 1ATRA 1NGGA 3ENOA 2QWNA 3D2EA 3MCPA 3ZEUB 1ATSA 2P9LB 3C7NA 4CZEA 4EHTA 3L6QA 2P9IA 3MN6A 5JLHA 1K8KB 3CJ9A 5BRFA 1MWMA 3GDQA 4BR5A 4EHUA 3VPZA 1H1VA 3MN7A 4O8KA 4CJ7A 3HSCA 2A5XA 3LL3A 3KZBA 1OKJA 4BGBA 1IG8A 4BR4A 5BPMA 2Q36A 4E1JA 5CE3A 3VESA 3QB0A 3BEXA 1U2VA 5BN8A 2D4WA 3ATUA 2A40A 4H5NA 4PKGA 4QS9A 3GOIA 3LDOA 4MO5A 1ZBSA 3I33A 2NLXA 3QBWA 3UKUA 4FWOA 4F9OA 1NGJA 3IUCA 2YHXA 1NGHA 2P9SA 3FGUA 1G99A 1RGIA 2IVNA 1ATNA 3DXMB 2FF3B 2V7YA 4CZFA 2VWBA 4L3QA 4CZMA 4JD2A 4K25A 4A61A 1T6CA 2V7ZA 1NGFA 1MWKA 1T44A 2ASPA 3D7EO 3HBTA 3FZMA 1GLJO 3MK6A 4CBXA 3MN9A 2P9NA 2V52B 1NGCA 5AQQA 4BC4A 4DHYA 4WYBA 1QZ5A 5AQXA 2E2QA 5ADXA 1BUPA 5AQKA 3EKSA 4CZGA 3ZETA 3H3NO 5AFUH 3VENA 3UKRA 3VERA 1GLLO 5AQTA 4AM7A 2QWPA 4DQ8A 2P9UB 5F2RA 3UB5A 3GBTA 2P9PB 4Y0WA 4H5RA 3CI5A 4JAXA 4BC3A 4JN4A 3QDKA 4XH1A 4GNIA 5TKYA 1KAXA 3MDQA 1YUWA 1XQSC 3O5BA 4H0OA 2YI1A 2E1ZA 3W0LA 4MLHA 5AQNA 5BRDA 1HUXA 2Q97A 2CGKA 3DJCA 3WXLA 1E4FT 5AQLA 2HF4A 5KPTA 5LJWA 3FFKB 1NBWA 1HKBA 3HZ6A 5FPNA 1HJOA 2HMPA 2A42A 2J4RA 2GEMA 4XH5A 3RSEB 1NLVA 4CBUA 4CZJA 3BUZB 3ZX0A 3FE1A 3CJ1A 4BG9A 3U9DA 2HF3A 4FOIA 4ISFA 4IZ9A 4FWQA 3D2FA 3VGMA 1NGAA 1SZ2A 4M7XA 1QHAA 5AQHA 3CQYA 4RTFD 1DEJA 4BRGA 4CBWA 3CJAA 3MN5A 3H6EA 3CIPA 3IFRA 4FWRA 1XUPO 4FOEA 1BOTO 3ULEA 3WXKA 3AAQA 1QZ6A 1T6DA 4PKHA 3VOVA 3QBXA 2PAVA 1J6ZA 4RWTA 1YAGA 3U9ZA 2H3GX 2CGLA 2F9TA 4YDUC 3F9MA 3SMSA 1Y64A 2QM1A 3UE5A 3WUHA 4WQ4C 2ZGZA 3QFPA 4FPAA 1ZXOA 5LJVA 1IJJA 3CHWA 3QFUA 3ZEUA 3LM2A 3FZFA 3S41A 3JXUA 2P9LA 2QWRA 5AQUA 4BRDA 1HPMA 1BDGA 4FWMA 1HX1A 3AARA 1K8KA 4B1XB 5AQIA 3L4IA 1MA9B 4IO8A 5JLFA 3ID8A 3WQUA 4FWKA 1U6ZA 1BWFO 3LDNA 4PL8A 5AQSA 3GL1A 3HM8A 3LDQA 1BA1A 3WXIA 4H0PA 3JS6A 4JHDB 2E8AA 3CJCA 3EN9A 5AQOA 3DXKB 1GLDG 4LC9B 4B1YB 3WEEB 4BROA 5AQWA 2WUSA 4B1UB 3SLCA 4H0XB 2GTDA 2E1YA 3FZHA 4PL7A 2Q0RA 2GWJA 4FWSA 2ASMA 4FL9A 3BF3A 1GLCG 3IDHA 4BRIA 2I7NA 2QWQA 3AY9A 2CH6A 2D1KA 4YDUA 2KHOA 4BGAA 3DXMA 4GY2B 3QICA 3ENHA 1V4TA 1SAZA 2V51B 4NO7A 4WQ4A 4BVPA 5AQMA 3KVGA 1Z05A 3VEZA 1YXQA 2ASOA 3VF2A 5AQJA 3W3DA 4BREA 1XC3A 3OHRA 4J8FA 1TYQB 3GE1A 4M63C 1ESVA 3FZLA 4BR9A 3TU5A 5BREA 3A5NC 5AZIA 1C0FA 3U8XA 2FSKA 1KAZA 3BF1A 4H0TB 3VEVA 5AFUA 3VF6A 1DKGD 2DPNA 3M6GA 4QS7A 1CZAN 4FSVA 4KBOA 2IVOA 2YJEA 4CZKA 4BG8A 5ELZA 1E4GT 2P9UA 2AA4A 1YVNA 3A8YA 2P9PA 3C0BA 4H0VB 4HWIA 2Q1NA 2QXLA 5BR9A 1QQOA 2QW9A 3O1WA 3O6WA 2E88A 4M7YA 2Q0UA 4PKIA 3EO3A 3H1QA 4A2AA 3ZX3A 4CD3A 3J8AA 3RSEA 2W40A 3VEYA 2P9KB 2AP1A 5BPNA 3HTVA 2A6AA 5AQPA 5AQYA 2FLOA 4BRLA 1NGEA 1RDWX 2Q31A 4I6MB 2A3ZA 4XEIA 3DWLA 2GUPA 5EX5A 1Q18A 1BU6O 3A0IX 3CETA 3VGLA 1HKCA 4BC5A 1Z6RA 4BQLA 5AZJB 3BP8A 2I7PA 2CH5A 3U4LA 4JNEA 5AQVA 2YHYA 1S22A 2F9WA 3SJHA 5F0XA 3O80A 3D2EB 2UYTA 3C7NB 4B1WB 2QWOA 5JMVA 2BTFA 1JCGA 2E2NA 2P9IB 1KAYA 3R8EA 4BRQA 3ATVA 2GWKA 3VEWA 1WOQA 3H3OB 1BG3A 1NGDA 3CJ7A 1MDUB 3IMXA 4BRFA 2YHWA 5F1XA 4BR7A 5AQFA 1GLEG 4BRAA 5AR0A 4WQ5C 1V4SA 1U2VB 4H5VA 5EXWA 2EWSA 3O1BA 1JCEA 5AQZA 2IIRA 5BRHA 3B8AX 3A5OC 2ZGYA 1QQMA 3UKUB 4EAHD 1DGKN 4BRCA 2P9SB 3SMPA 5EOYA 1JCFA 3DAWA 2YJFA 2FXUA 3A5LC 4JHDA 3R9PA 4O5FA 5E26A 3DXKA 3FZKA 2E2OA 2OANA 3HI0A 2A41A 3WEEA 4JD2B 1P8ZA 1NGIA 4B1ZA 5KPRA 3TPQA 1NWKA 4K43A 4IWVA 5B8HA 1NMDA 4IJAA 4RCHA 2P9NB 2NRHA 1X9JA 1LOTB 5KQDA 3H1VX 4EFHA 1RFQA 4BQZA 2YCHA 1KXPA 5AQRA 2VCPA 4B1VA 3VETA 2QWLA 3P4IA 2E20A 4FWNA 5ADXH 3WQTA 2GELA 4H5TA 3ZETB 5FPDA 1ZC6A 5E84A 4CZIA 5I9EB 4H5WA 2Q2RA 4WQ5A 3UKRB 5EY4A 1X3MA 2D0OA 3LDLA 4QS8A 4BC2A 3VGKA 3A5MC 1C0GA 1TYQA 3G25A 1GLFO 4FWPA 4HTLA 1HKGA 5AZIB 2NZTA 5BPLA 3M3ZA 4BRNA 4A2BA 4CZHA 4K41A 1HLUA 3LDPA 3CQXA 1NM1A 3O8MA 4MLEA 1D4XA 2FSJA 4ISGA 5AQGA 3CERA 3EL2A 1QQNA 1LCUA 4ISEA 1BA0A 3CJBA 4BRKA 1BO5O 3H45C 1EQYA 3M1FA 4IXCA 2ITMA 2PBDA 2ZWHA 3O08A 3L0QA 4EIAA 4FO0A 3ZX2A 4FWLA 2IVPA 4CI6A 2FF6A 2HOEA 5FPEA 4NB4A 1S3XA 1NGBA 4C23A 3KHYA 1GLBG 1TUUA 3D2FB
chains in the Genus database with same CATH superfamily
3VEOA 1ITGA 5BN9A 3O4WA 3VEXA 2XRIA 2Y1JA 1VQ5N 4DR5K 3FLCO 3WNEA 1YJNN 4FYDA 3WXJA 1L3UA 4BVOA 3HO1A 3ULEB 3OYEA 3SPYA 3MECA 4GV6A 2D0PA 4XJXA 5M1QA 5A2QO 4Q5VA 5J2NA 4BRMA 4CZLA 4IOCL 1OVYA 4I2QA 4H0YB 3AO2A 1IKYA 3CQ8A 3EKUA 2OZSA 4BRHA 3J7AP 2ZJRL 4DFMA 1GLAG 2G8FA 2BUPA 1X3NA 2WOMA 1KVAA 2VYPA 1NGGA 2QWNA 2WTUA 4JKEA 4XIUA 3ZSZA 3HP6A 2F8SA 3AVKA 3IAYA 4E72A 4CJWA 3GDQA 2DFFA 3HP9A 4AQYK 4KB0A 4FJNA 1SUQA 2FC0A 4DS4A 5KRSA 4FW2A 1CLQA 5BPMA 4PUOA 3KLIA 3QB0A 1U2VA 2A40A 4MO5A 5JVHL 4B9LA 1FKOA 3QBWA 3JAMO 4F9OA 3IUCA 1HMVA 2P9SA 4W5OA 1U04A 3DLLL 4FW1A 1ATNA 3DXMB 3DLKA 3OYNA 4KI6A 4FJMA 4L3QA 1M90O 3F9KA 4JD2A 3LWLA 4IFVA 1KVCA 4NXNK 1GLJO 3MK6A 3AVJA 3MN9A 3M8QA 1WSGA 3LPUA 3HRGA 5AQQA 1X9MA 1ILYA 4JS5A 3H08A 1LW2A 1WAJA 1GOAA 3AVLA 1VQ9N 5HL7L 4Z4EA 2IC3A 3OS0A 1T05A 5JS1A 4AHVA 1XMQK 4DLGA 4CJ3A 1N36K 3LP2A 4M3ZA 4GKJK 2P9UB 3P5JA 3SUPA 3UB5A 1WBDA 3S5TA 3E1YA 3CI5A 4JAXA 4JN4A 3QDKA 4XH1A 3MDQA 2WBNA 4H0OA 2YI1A 3HOSA 3AA2A 4AHTA 5CZ2A 1XWLA 5LJWA 3ZSOA 5AQLA 4A57A 5KPTA 3V9ZA 4FLWA 3FFKB 1M1KO 4YOTA 1HJOA 5SZTA 1NJZA 4XH5A 1RDUA 4DQSA 2HHIA 1BIUA 3AA4A 4B3OA 4LF8K 4BG9A 1TKZA 3KJVA 3RR7A 3AO5A 4FK4A 1NOZA 5FRNA 2JGUA 4IZ9A 2OCEA 3LP0A 3ZSVA 3HVRA 1KRPA 3ZT4A 3Q7CA 4BY9C 4CBWA 4GVEA 3CFOA 2G8WA 1L3VA 2OTJN 3ENBA 3MN5A 3CIPA 3HL8A 3S9HA 4FWRA 4FXDA 1WSFA 1BIZA 3WXKA 2JWKA 1TL3A 2B4JA 3VQPA 5FDLA 3P38A 3V9SA 3QBXA 2PAVA 4IOAL 4RWTA 3PX4A 3TAPA 2KLAA 4O55A 3SMSA 4DFPA 2X6NA 4I7FA 1RDDA 2ZGZA 4FPAA 3C94A 1ZXOA 3NHGA 1IJJA 4B9NA 4N76A 5DK5A 1QSLA 3JXUA 1VQ8N 3K9JA 3HYFA 3AARA 1K73O 1K8KA 4B1XB 1WAFA 1MA9B 4IO8A 2OZMA 3ZSQA 2JLEA 1RBTA 3LDNA 2F4VK 1YF5L 1BA1A 4H0PA 2IOCA 3TR8A 3EN9A 5AQOA 1GLDG 5CY4A 1N8RO 4GV3A 4IDHA 4H0XB 4W5TA 4M3UA 3FZHA 2GWJA 4FWSA 1NKBA 3G6EN 2VQEK 1S5JA 1YJ9N 4BRIA 1CXUA 3ZSXA 4KH4A 5GAGP 4YNQA 2CH6A 4M42A 3PO4A 3LAMA 3QEVA 5M1NA 4JRQA 1YTUA 4BEBA 3QICA 3ENHA 3D0PA 3SPZA 1RBVA 3TAGA 4BECA 2ASOA 3VF2A 5AQJA 4DUYK 2O8EB 3THYA 1XC3A 4J8FA 3SCXA 2KKZA 3VTHA 3TABA 2HHSA 3TU5A 4LD0A 3CPWM 2RN2A 4PA1A 2OTLN 3HPGA 3TTDA 1UWBA 3ULDA 2VG6A 4DSLA 5AFUA 1DKGD 2YNHA 3QEWA 3RR8A 4FSVA 4DV5K 3CF5L 4CZKA 2YJEA 3O4NA 4BG8A 5ELZA 1E4GT 4RW4A 3AVCA 2AA4A 3T69A 1YVNA 3O9UA 3HXMA 4HWIA 4CFCA 4U67L 4LSLA 2BE2A 3TTCA 2E88A 3M5RA 4M7YA 2W6KA 2HNDA 4JKGA 4PKIA 3KWGA 1IBMK 2I5JA 4A2AA 4FLUA 4FM2A 4DTOA 3J8AA 4NCBA 3CCSN 2W40A 3ZYYX 4CIGA 4KHSA 4JI8K 3RMAA 1SV5A 3DLEA 5BPNA 1KFSA 2A6AA 5AQPA 4Q0BA 1NGEA 1RDWX 2ATQA 4I6MB 3DWLA 2P5OA 2GUPA 3HK2A 5EX5A 3RTVA 4ZTFA 1VQ4N 4Z4IA 3A0IX 4BE1A 3ASMA 4BC5A 1Z6RA 1C1CA 5AZJB 3BP8A 4DTMA 4JI5K 4KHYA 3RRGA 3JYTA 1XNRK 3OS1A 4OKEA 1WBBA 3WXMB 5HP1A 3P39A 2ZJQL 2YHYA 2HBLA 4U7BA 3QEPA 1S22A 2F9WA 4MQ3A 2O8CB 5F0XA 4B9MA 2UYTA 3B6OA 3DLGA 4YOWA 3NDKA 2P9IB 4CEAA 4DSFA 4JKDA 4FK0A 3H3OB 4IG3A 5CHIA 3CPEA 3VQQA 1WSEA 4BRFA 3OJUA 5AQFA 1GLEG 1ZBFA 1CZ9A 4WQ5C 2KW4A 4OGCA 3V81A 4PWDA 2LSNA 4HHTA 3THVA 5C42A 1HNIA 1LAWA 2IIRA 3B8AX 1QQMA 3DLHA 5KTQA 4CJTA 2FXUA 2O8FA 3AVMA 3HOTA 4JI1K 1RILA 4JKCA 3KLHA 4OPJA 1UA0A 1OH8A 2E2OA 3WEEA 3KKSA 2QEXN 1SL2A 4NYFA 4B1ZA 2UUAK 1FXXA 2HVIA 1N6QA 4YORA 3OJSA 4CW7B 4RCHA 3SYZA 1JLQA 2QK9A 1CZBA 3L2WA 3OW2M 1C0UA 1L3SA 3VETA 3PUFA 4UY8O 4FWNA 5ADXH 4DQIA 1ZC6A 4CZIA 3OYHA 4JLHA 2A1RA 4H5WA 2Q2RA 4BE2A 3UKRB 4E7HA 4K8XA 3O9SA 4CFAA 4N47A 1TYQA 3G25A 3CYMA 3KTQA 3T7ZA 2NZTA 3V1QA 2OPPA 3NAEA 3SBTA 1HLUA 4JI7K 4Y1CA 1NM1A 1D4XA 1S72N 4QCLA 4KAZA 4WE1A 1WB9A 1BA0A 3AVFA 1BO5O 1EQYA 3LZJA 1GOCA 5K14A 2BANA 2ZQBA 3KK7A 4IXCA 4RW9A 3RWUA 3PIOL 4EIAA 3L0QA 5J2QA 4R5PA 4AHCA 3QEXA 1N33K 4O8UA 1S3XA 4H4MA 4F3OA 3KHYA 4CJQA 2RF2A 4FLTA 4CJ5A 3OS2A 1KVBA 1IH7A 2QWMA 3CMEN 5JVGL 4CD1A 2B6AA 3OTOK 2HMIA 1IKXA 2C1IA 3OA9A 1C1BA 2OA8A 2P9KA 4CHNA 2UXBK 4N5SA 3I8DA 4BRPA 4CEOA 3G71N 1NKCA 3MMVA 3AV9A 3SI6A 3GG4A 1T7PA 3MWPA 3HVTA 1VSLA 3VTIA 3QMLA 1JLEA 3CCUN 2QXFA 3QNNA 2W41A 1HNWK 3R6MA 3V9WA 1LWCA 2FSNA 4IKFA 4DQQA 4MO4A 1U47A 4AH9A 4CJVA 4CF1A 3I8BA 4J2EA 3D2EA 3OYIA 3U6FA 1ATSA 2P9LB 3OYBA 2EX3A 4NLBA 2ZJPL 1IO2A 3THXB 2Z1GA 3DM2A 1WSJA 5BRFA 1MWMA 1JJ2M 4JK9A 3VPZA 4DTUA 3MN7A 1LW0A 4O8KA 4X65K 1C6VA 3HSCA 3BGRA 1VSJA 4BGBA 2Q36A 3OYLA 5KI6A 4OLBA 2P1JA 5BN8A 4PKGA 1N5YA 2E6LA 3AGKA 5H1SQ 3ZSYA 4DU3A 4JK8A 2YHXA 1NGHA 4DF4A 3FGUA 4FJIA 1DT9A 1A5XA 2V7YA 4F4KA 3K2PA 4CZMA 4K25A 4DLEA 4C1NI 1ASWA 3CCQN 1L3TA 1MWKA 1T44A 2ASPA 5J2MA 1R0AA 4CBXA 4OX9K 3CMAN 2A1SA 3WNHA 2QKKA 4DHYA 5AQXA 5GINA 3V9XA 1BUPA 3THWB 3ZCMA 4CZGA 3K58A 3VENA 3VERA 5AQTA 4AM7A 5F2RA 4I2PA 4CHZA 3GBTA 4LSNA 5FRMA 2P9PB 4Y0WA 4H5RA 4BC3A 3E66A 5TKYA 1EWRA 3O5BA 4QOZB 3W0LA 3K9KA 4DTRA 4O0JA 4IFEA 5BRDA 1HUXA 3SAFA 3DJCA 2HNYA 2JWLA 3HZ6A 5FPNA 1I94K 2A42A 2J4RA 3RSEB 4OPAA 1NLVA 1VSIA 3NF7A 1W97L 3HPHA 1YVUA 3ZX0A 4FCYA 4B3SK 2OPRA 4ISFA 4IOXA 4FWQA 4PHTX 4B9UA 3D2FA 4MDAA 3VGMA 4DTNA 3SV4A 2GBZA 3VMFB 4ILHA 1RT2A 3CQYA 4RTFD 4BRGA 4PQUA 2F96A 4CGHA 4DFKA 3H6EA 4B08A 1IV0A 3VA0A 3IFRA 4KO0A 1XUPO 1BOTO 3IG1A 3ULEA 1B92A 3AAQA 3CYGA 2VGNA 4PKHA 2NUBA 1RT4A 4B8CA 2F9TA 3A2FA 3QEIA 1EWQA 4DR6K 3ZT2A 4IEIA 1D8YA 2F7TA 4DSIA 4M3YA 4WQ4C 4DR2K 4I9QA 3NE6A 3CXCM 1EP4A 4F2RA 3QFUA 3AA3A 3LM2A 3S41A 4DV0K 4BRDA 1HPMA 3G4SN 3ID8A 3WQUA 3K5LA 3QIOA 5C25A 4E7LA 3AVHA 3HM8A 4B8AB 3LDQA 4JHDB 5C12A 4DV6K 1TKXA 3DXKB 4W5QA 4GVMA 1BQMA 4DQRA 2WUSA 4B1UB 4WFNL 2XY7A 3EE8A 4BWMA 2E1YA 2ASMA 2G8KA 4F8RA 4FL9A 3BF3A 4EZ6A 1B9DA 2I7NA 2QWQA 4CJRA 1JLAA 4BE7B 2KHOA 4BGAA 1S9EA 5DM6L 2QA4N 4CEBA 3DXMA 4GY2B 4KH6A 1SAZA 2V51B 4BVPA 4DKWA 4JS4A 4FLXA 3W3DA 3NCIA 3G0ZA 2BH1A 4J2DA 3GE1A 3FZLA 3LDSA 4H8KA 2Z1IA 5BREA 3TAFA 1JLGA 1KCFA 2YV0X 3A5NC 1NJWA 3NMUA 2YNFA 5AZIA 3BF1A 2X78A 3TSUA 3VEVA 2DPNA 2HB5A 4I9LA 4DU4A 1CZAN 4V19S 3CG7A 2NNWA 2YKMA 4EZ9A 2F8TA 2AJQA 2P9UA 1RBSA 1IKVA 4H0VB 1JLBA 3LANA 4NYNA 1KTQA 3CCJN 1HQUA 4CHPA 3O1WA 3NGIA 4TSXA 4H4OA 3I55N 3EO3A 1RTIA 3CCVN 5I42A 1QVGM 4FJJA 3D45A 4CD3A 4HCBA 3MWTA 3SJJA 3J7ZO 3HTVA 4B9VA 1YTAA 4BRLA 3V6DA 2A3ZA 4XEIA 4DR4K 1A5VA 4E89A 3DOKA 3HT3A 1EXQA 4W5RA 1KC8O 5HROA 2X74A 2I7PA 1VRTA 2CH5A 2P51A 3EY1A 4FZYA 1TK8A 2UXDK 4BDZA 2RKIA 4JNEA 1RDBA 1NK5A 3UIQA 1RDCA 4C1NK 1YITN 3LP1A 3C7NB 4FJ5A 5JMVA 3OYFA 4F2SA 1BG3A 3CJ7A 3V1RA 2DFEA 1ASVA 2YHWA 5F1XA 3LZIA 4CJUA 3EZ5A 1QQCA 1WSIA 3VQAA 2EWSA 2O8DB 1JCEA 3SAGA 5AQZA 4E1NA 1S9GA 2ZGYA 3UKUB 1EX4A 3V4IA 1DGKN 1J9AA 5EOYA 1JCFA 3C65A 4DTXA 5GIPA 1S1TA 3NF9A 3CC2N 3MXJA 1RT3A 4O5FA 4CESA 4JKAA 3MEGA 4AHSA 1TKTA 1FK9A 4DUZK 3TI0A 3I0SA 5B8HA 1W7AA 1X1PA 4IJAA 2EHGA 2W00A 2P9NB 1BL3A 3TAEA 4W5NA 4FJ7A 4EFHA 3I56N 2NRZA 4YOXA 2NRRA 3P4IA 2E20A 4O4GA 3WQTA 4H5TA 3ZETB 4GMJB 5I9EB 5KRTA 4FM1A 4WQ5A 2D0OA 2O8EA 4QS8A 3NVKA 1C0GA 1GLFO 4FWPA 4HTLA 1EKEA 1HKGA 1ZYQA 1HNVA 5BPLA 1U49A 3K5OA 4CJLA 1NK6A 4CEQA 2VWKA 4A2BA 3L2QA 1J53A 4MLEA 5C10A 1QVFM 4FJXA 3RVCA 3R1XA 5AQGA 1TKDA 1NU0A 4DR7K 1LCUA 4KI4A 3CJBA 2Y1IA 4BRKA 1UA1A 5M1OA 4CERA 3CFRA 3OBYA 1VQLN 4JKBA 2PBDA 4HUEA 2ZWHA 3KK2A 3ITHA 3KK3A 5CR4A 4CI6A 2FF6A 5FPEA 4C23A 5BR8K 1GLBG 2GUIA 3F2KA 1L5UA 4FJKA 5KPZA 2CGJA 2OPQA 3ISNC 3OYDA 5EVZA 2Z1JA 1X9WA 2WONA 4LF6K 1VQPN 3OYCA 5KQ8A 4IJNA 1A5WA 1F21A 3WT0A 4I6MA 1HR0K 3K0SA 3RMBA 5FPMA 4BR0A 2WC9A 2O4IA 3T19A 4H03B 3VF4A 4DR1K 4Z94A 4E7JA 4ELTA 4E1MA 4DB3A 3TARA 3FR0A 5AZJA 3H46O 1VQKN 1WUAA 3K57A 1T03A 3QIPA 1NJYA 3CCMN 1W9HA 1W2BM 1N32K 3T1YK 4O5BA 4JI0K 4B9QA 5JICA 4XH4A 4KTWA 2O8CA 4DG1A 4L8RB 4AM6A 1ATRA 3MCPA 3ZEUB 3L3VA 4CHYA 3BY5A 2VQFK 4EHTA 3EE9A 2RHKA 3SBGA 3L6QA 1U45A 2P9IA 5JLHA 1Q9XA 3CJ9A 4CEFA 1VHXA 4KHNA 1VQNN 1W0HA 1WLJA 1BI4B 1H1VA 1I3AA 1FJGK 1SL1A 4YOYA 5GAEP 3LL3A 4BR4A 2HW3A 4E1JA 5CE3A 5E41A 5GAHP 1RTJA 2D4WA 3QERA 4QS9A 3GOIA 3I33A 3AA5X 4DFJA 4F3TA 4LFAK 3C6HA 3CM5A 3ZLJA 3S3NA 3SUQA 4WFAL 1RTDA 4J2BA 1G99A 1RTHA 4JKHA 4AILC 3VQ5A 1BCMA 1P90A 4DSEA 4CZFA 4OPHA 4KH5A 2HHHK 1JXBA 2B5JA 3SQ4A 1T6CA 1XHXA 1B9FA 1NGFA 1VSFA 2V7ZA 3D7EO 1J5EK 3FZMA 1TVRA 2UXCK 5DMRA 4LF5K 3OYKA 1NGCA 1VSDA 3V1OA 4BC4A 4WYBA 1QZ5A 4JI2K 2E2QA 1RCHA 3AVIA 5AQKA 1IG9A 3ID6A 3EKSA 3QLHA 4CEZA 5J1EA 3KLGA 3H3NO 4HCCA 1TL1A 5AFUH 3UKRA 3TANA 1Q7YO 2HHQA 5AJ3K 1N34K 4GNIA 4YOVA 2YHBA 2W42A 1Y97A 4MLHA 2CGKA 4IG0A 2HF4A 1NBWA 4FK2A 4YOUA 5JENA 4NLCA 4YFUA 5HRPA 2GEMA 3SQ2A 1LV5A 4B3MK 3BUZB 3CJ1A 2O8BB 2ZE2A 1VRUA 1S1XA 3U9DA 2HF3A 3CCRN 1RBRA 5MLCQ 1QSYA 1QHAA 5AQHA 1VSHA 2R7YA 5LMUK 1DEJA 4KREA 4DU1A 5HRRA 1WN7A 5JS2A 3N4PA 5FLXO 3PSIA 4KTQA 1K9MO 3L4QA 4FOEA 4DV4K 5KGWA 4CCHA 1ZBIA 4GV9A 2FBXA 1QZ6A 1QHTA 4BDYA 3C6AA 3EEQA 4E7IA 3VOVA 2X6SA 4DF8A 1J6ZA 1D9DA 1YAGA 2CGLA 5M1PA 4JRPA 4YDUC 1KLMA 3F9MA 2HSTA 2GV9A 2HHXA 4CGIA 3OYMA 3U3YA 3UE5A 1C1AA 1HNXK 3Q7BA 3QFPA 3AO4A 3NGZA 3CC7N 3DRPA 1VQ6N 4KFBA 3MEDA 1KSPA 2P9LA 5HRSA 4X62K 2Z1HA 4R79A 3ZT1A 3THXA 1UOCA 4KTZA 3L4IA 1XI1A 5JLFA 3O3FA 3RMCA 4FWKA 1U6ZA 4PL8A 5AQSA 4M3XA 4UQGA 5HBMA 2UU9K 4KHWA 3PY8A 3KK1A 4BROA 5AQWA 3L2RA 2XY6A 4FLYA 1VSMA 1YT3A 3SUNA 2GTDA 3QO9A 3PIPL 5SWMA 4PL7A 3ZSRA 3DYAA 4LF7K 1RBUA 1Q8IA 3IDHA 3AY9A 4K0KK 2D0BA 1NK8A 2D1KA 4MDBA 4Z4CA 3ZT3A 1V4TA 2PY5A 5I3UA 4WQ4A 4OLAA 3KVGA 1Z05A 1YXQA 4MFBA 4Z0UA 1HRHA 4CIEA 2P5GA 4M63C 3VA3A 1OVQA 3THWA 4ZHRA 2FSKA 1TAUA 1U4BA 4H0TB 1LWFA 4NCGA 3M6GA 4RW7A 5DM7L 4G9ZA 4KBOA 4AHRA 4X66K 4GW6A 4FJLA 3MXIA 1VQMN 2HBMA 4AHUA 2KZMA 1KLNA 1MU2A 3A8YA 2P9PA 3QINA 3TSQA 3AO3A 1NMNA 4CEEA 5BR9A 1DTTA 4JYAK 3KD5E 4C8LA 1Z26A 1XHZA 4CF0A 3KLEA 3HM9A 3MXMA 3TAMA 5IT9O 1BCOA 2OPSA 4KV8A 1JL2A 4LFBK 4CGDA 3F73A 2D5RA 4DV2K 3RSEA 2DFHA 2O4GA 2AP1A 5AQYA 2Q31A 2Q3SA 4CFBA 1Q18A 2VG7A 3OBWA 5C2DA 3K59A 2KFZA 1UAXA 3CETA 1SKSA 3VGLA 3DMJA 4NXMK 4JKFA 3WNGA 2W6LA 4CHOA 2OYQA 3DLRA 1K6YA 4DMNA 3U4LA 1JKHA 3OY9A 1BHLA 5AQVA 3U3GA 3P1GA 1WNSA 2IDOA 3TAQA 2VWJA 3QESA 1VQON 1TK5A 4RG8A 1RT1A 4FLVA 2QWOA 1VQ7N 4GKKK 3T1HK 1KAYA 3R8EA 4BRQA 3ATVA 2GWKA 3R3LA 2YHAA 1Z25A 1MDUB 5C0YA 4DV1K 2HBKA 3NGYA 4BR7A 5AR0A 4DSJA 3NH2A 1V4SA 1U2VB 4CECA 5EXWA 3RRHA 5BRHA 3SAHA 1QE1A 3A5OC 3IKMA 1ASUA 4EAHD 4BRCA 2P9SB 3SMPA 3NBPA 2KTQA 3VQBA 1NK9A 2G8HA 4JHDA 2FBVA 1REVA 4B3RK 3DXKA 1ZBHA 2OANA 3HI0A 4E7KA 2A41A 4JD2B 1P8ZA 3TPQA 2IGIA 4IWVA 4ILGB 2UUCK 2NRXA 3RMDA 2NRHA 1OH7A 4M45A 4JI4K 4A5AA 2KZZA 1X9JA 3KWIA 1LOTB 1RFQA 4BQZA 4KHUA 4B1VA 1J5OA 3O9TA 1O13A 5FPDA 3AVGA 3DLBA 5E84A 1OH5A 2NRWA 2PYLA 3V9UA 1X3MA 3MAQA 3LDLA 4LH4A 3LPTA 4LH5A 3C6TA 4BC2A 1NJXA 3KD1E 2E4LA 4ICLA 5AZIB 1KQSM 3M3ZA 3PX0A 1TGOA 4BRNA 5FROA 3G10A 4CZHA 4K41A 3LDPA 1TAQA 3WNFA 5J2PA 3O8MA 1YJWN 4E3SA 2FSJA 3BZKA 1HQEA 2QI2A 4CGFA 5GADP 3CM6A 3CERA 1QQNA 4ISEA 3SUOA 4N41A 3PV8A 5LL6Z 3H45C 4CJSA 1GOBA 3TWHA 4BWJA 3M1FA 5C2FA 4CHQA 4DR3K 1D9FA 1SKRA 4DV7K 4CF8A 3N4QA 4RW8A 3E9PA 5M1KA 3ZX2A 3OYJA 2IVPA 5D3GA 2GX9A 4NB4A 1QSSA 2IS3A 4CF9A 1TUUA 4CZJA 4CJ4A 2DY4A 3LM9A 1R59O 3AAPA 3BZCA 1LWEA 1HPZA 4DCHA 4LFCK 2ZF5O 2HHVA 4ID1A 1D5AA 1TUYA 3C6UA 5HRNA 5CYMA 4A62A 2ITGA 4A59A 3S3OA 4N56A 4B9SA 2E6MA 4BR2A 4CJKA 4FPBA 1XNQK 5LY3A 1SL0A 3VQ4A 3OYAA 4BDPA 3EZWA 1SQKA 3NF8A 4G1QA 2XO7A 3EYZA 4K42A 2XY5A 3PSFA 3SQ0A 1NNEA 3SZ2A 3SK3A 2E2PA 3ENOA 3HJFA 3C7NA 4M3RA 1EETA 4CZEA 1FW6A 3T1AA 3VQ7A 2PYJA 1YI2N 5C24A 1HYSA 3MN6A 1K8KB 1O1WA 4BR5A 4FVUA 4EHUA 3O3HA 3MCAB 4OJRA 3MEEA 4CGGA 4CJ7A 2FBTA 2A5XA 3KZBA 1OKJA 1IG8A 1OH6A 3VESA 3BEXA 2XY8A 3OVNA 3ATUA 1RT7A 4H5NA 3L2VA 2O8DA 3LDOA 1HJRA 1YIJN 1ZBSA 4WCEL 4Z4FA 2NLXA 1U48A 3UKUA 4FWOA 1RT5A 1NGJA 4RW6A 3ZSWA 3SQ1A 4FZXC 1RGIA 2IVNA 4OVLA 2FF3B 1JXEA 1EO1A 3NH0A 4K8ZA 2VWBA 4OKKA 5KGXA 4A61A 2G8UA 3KLFA 3HBTA 3THYB 4ELUA 2QKBA 3M8RA 4LY7A 1ZBLA 2P9NA 2V52B 4FVMA 4PY5A 4M41A 5ADXA 4ILJA 1NJIO 3ZETA 4DTSA 1IKWA 3JSMA 4EP5A 1RDAA 2ZD1A 1GLLO 1C0MA 3SNNA 2QWPA 4DQ8A 2G8VA 1NG9A 3VQ8A 3NFAA 1KAXA 1YUWA 1XQSC 1C0TA 2E1ZA 4OGEA 4JKGB 5AQNA 3ALYA 2Q97A 3WXLA 3L2UA 1E4FT 3LALA 3D6RA 4OO1J 3PLAA 1HKBA 3IS9A 4FJHA 2DTUA 3M8SA 2HMPA 3KIOA 3J7YP 3FFIA 5EU7A 3J80O 4C8KA 1JLFA 2C1GA 4M3TA 4CBUA 2HHWA 1LAVA 3FE1A 3LP3A 3P83D 3L8BA 3CCEN 4FOIA 4DTJA 1S6QA 2RPIA 1NGAA 2HNZA 1SZ2A 2YNGA 4M7XA 4C8NA 4C8MA 2NRTA 4ZTJA 3ZT0A 3QNOA 1VSEA 4E19A 3DOLA 4FM0A 3CJAA 4DWIA 3E9OA 3AGRA 4WF9L 2VGMA 3DI6A 3C95A 1T6DA 4QAGA 4DS5A 3O3GA 3U9ZA 2H3GX 3J81O 3SV3A 5IWAK 4JV5K 1Y64A 4Z4HA 4ELVA 2QM1A 3WUHA 1VK0A 1I39A 1JLCA 5LJVA 3CHWA 3ZEUA 4KPYA 3FZFA 4E0DA 2QWRA 5AQUA 4KHPK 1QS4A 1BDGA 4FWMA 4M3WA 1HX1A 2KQ2A 3O4QA 5HOOA 5AQIA 4Z4GA 5C15A 3QETA 2WFBA 1BI4A 5TKWA 1BWFO 1NOYA 3GL1A 4CJEA 3WXIA 2O8FB 3JS6A 4CE9A 5GIOA 2E8AA 3CJCA 4B1YB 4LC9B 1NKEA 3WEEB 3T3FA 3DRSA 4JEPA 3SLCA 3MX2A 3K5NA 2Q0RA 4HUFA 5CZ1A 1GLCG 3VQ6A 4FLZA 4YY3K 3L3UA 3AVNA 4YDUA 4FZZA 3CD6N 1CXQA 4IBNA 4NO7A 2QTDA 2BDPA 5AQMA 1X9SA 3VEZA 4AF1A 1HYVA 1K8AO 3VQEA 3VQCA 4BREA 1NK7A 1VSKA 3OHRA 3VN5A 1TYQB 4FJ9A 5LMNK 1QTMA 1ESVA 4BR9A 1IBLK 4CF2A 4O44A 1HYZA 1C0FA 3U8XA 2IAJA 4Y1DA 1KAZA 3M8PA 2HHTA 3VF6A 2RE2A 2BGGA 4QS7A 2D0CA 3NF6A 2IVOA 3IRXA 1KD1O 3HSTB 1J54A 1Q81O 1T3VA 1XC9A 3C0BA 3VQDA 2Q1NA 2QXLA 4KKOA 4CEDA 1DTQA 1QQOA 5HLFA 4CJPA 2QW9A 3O6WA 3NVMA 2Q0UA 1VAZA 3H1QA 4A5BA 3CCLN 4B3TK 1JL1A 1KFDA 3ZX3A 4CVNE 3S3MA 3F5TA 3VEYA 2P9KB 1SS6A 4CJFA 2FLOA 3K5MA 2E5LK 3BDPA 3MX5A 2O8BA 1BU6O 2YNIA 4WFBL 4HUGA 1HKCA 3CFPA 4BQLA 1SKWA 2ETJA 2XHBA 1E3MA 2D0AA 3LWMA 4BACA 4IFYA 1IBKK 1NK0A 4LF9K 4DSKA 1TK0A 2PZSA 3VQ9A 3SJHA 3AVBA 3O80A 3D2EB 4O0IA 4B1WB 1Q9YA 4C8OA 2BTFA 2UUBK 1JCGA 2E2NA 4HTUA 4BE0A 3VEWA 1WOQA 2G8IA 5CYQA 1NGDA 5T7BA 4JK7A 4KB1A 4LF4K 4CIFA 3IMXA 1TV6A 3O9RA 1RT6A 4BRAA 4CK1A 4X64K 1XMOK 4CGJA 4H5VA 4YHHK 2ZM6K 3O1BA 3HPOA 1BISA 4KRFA 3PO5A 4DV3K 3P31A 4DTPA 2HBJA 4JI3K 3DAWA 1WSHA 2YJFA 3A5LC 4CFDA 1S1VA 3R9PA 5E26A 4ID5A 1S6PA 4IDKA 1FKPA 3FZKA 3O9QA 2HVHA 1NGIA 5KPRA 1NWKA 3I0RA 4K43A 3NH1A 1NMDA 1RNHA 3E01A 4IO9L 4OKJA 5KQDA 3H1VX 4KHQA 2YCHA 1KXPA 5AQRA 4JI6K 2PFUA 2VCPA 3AO1A 3LAKA 2QWLA 4EP4A 1T8EA 2GELA 1S1WA 1BGXT 1DLOA 2HHUA 5EY4A 1G15A 2VG5A 1Q82O 4FJGA 3VGKA 3A5MC 2YKNA 3AVAA 2YX6A 4J2AA 3TTFA 4FJ8A 5M1FA 1BQNA 3CC4N 3E9LA 4NCAA 1Q86O 3CQXA 3KKRA 1ZBUA 3TSPA 1S1UA 1HNZK 4ISGA 3EL2A 2KFNA 4IEEA 2FBYA 2NRVA 4OPKA 2ITMA 1NK4A 3O08A 4FO0A 3PX6A 4B9TA 4CK2A 4CK3A 4FWLA 2HOEA 4HVJA 3B6PA 4DQPA 3DRRA 1NGBA 1YHQN 3D2FB 3OYGA
chains in the Genus database with same CATH topology
3VEOA 5KPZA 5BN9A 3O4WA 2CGJA 3LM9A 3VEXA 1R59O 2QWMA 3AAPA 3CMEN 5JVGL 4CD1A 2C1IA 5EVZA 4DCHA 2ZF5O 3OA9A 1VQ5N 2P9KA 1VQPN 3FLCO 5KQ8A 4IJNA 4BRPA 3WT0A 1TUYA 3G71N 4I6MA 1YJNN 3WXJA 4A62A 4BVOA 3MMVA 3ULEB 4A59A 4GV6A 5FPMA 4XJXA 2D0PA 4BR0A 5M1QA 2WC9A 3GG4A 4H03B 3VF4A 4BRMA 4Z94A 4CZLA 3MWPA 4IOCL 4DB3A 3VTIA 3QMLA 3FR0A 5AZJA 3H46O 1VQKN 1OVYA 3CCUN 1WUAA 4H0YB 4BR2A 2W41A 4FPBA 5LY3A 3CCMN 3EKUA 3R6MA 3EZWA 1SQKA 4BRHA 1W2BM 2ZJRL 2FSNA 1GLAG 2BUPA 1X3NA 4MO4A 4K42A 4B9QA 5JICA 4XH4A 3I8BA 3SK3A 2E2PA 2VYPA 4AM6A 1ATRA 1NGGA 2QWNA 3D2EA 3ENOA 3MCPA 3ZEUB 1ATSA 2P9LB 3C7NA 4JKEA 4CZEA 4EHTA 3EE9A 2RHKA 4NLBA 3L6QA 3SBGA 2ZJPL 1YI2N 2P9IA 3MN6A 5JLHA 1K8KB 3CJ9A 5BRFA 1MWMA 3GDQA 4BR5A 4EHUA 1VQNN 4FVUA 1JJ2M 3MCAB 4JK9A 3VPZA 1H1VA 3MN7A 4O8KA 4YOYA 4CJ7A 3SAFA 3HSCA 2A5XA 3LL3A 5GAEP 3KZBA 1OKJA 4BGBA 1IG8A 4BR4A 5BPMA 2Q36A 4E1JA 5CE3A 5GAHP 3VESA 3QB0A 3BEXA 1U2VA 5BN8A 2D4WA 3ATUA 2A40A 4H5NA 4PKGA 4QS9A 3GOIA 3LDOA 4MO5A 1YIJN 1ZBSA 3I33A 4WCEL 5JVHL 2NLXA 3C6HA 3AGKA 5H1SQ 3QBWA 3UKUA 4FWOA 4F9OA 4JK8A 1NGJA 3IUCA 2YHXA 1NGHA 2P9SA 4WFAL 3FGUA 1G99A 4JKHA 3DLLL 1DT9A 1P90A 1RGIA 2IVNA 1ATNA 3DXMB 2FF3B 2V7YA 4CZFA 1EO1A 4OPHA 2VWBA 4L3QA 4KH5A 4CZMA 4JD2A 4K25A 4A61A 1M90O 4C1NI 1T6CA 3CCQN 2V7ZA 1NGFA 1MWKA 1T44A 2ASPA 3D7EO 3HBTA 3FZMA 1GLJO 3MK6A 4CBXA 3MN9A 2P9NA 3CMAN 2V52B 1NGCA 3HRGA 5AQQA 5LJWA 4BC4A 4DHYA 4WYBA 1QZ5A 5AQXA 2E2QA 5GINA 5ADXA 1ILYA 1BUPA 5AQKA 3ID6A 4ILJA 1VQ9N 3EKSA 4CZGA 5HL7L 1NJIO 3ZETA 3H3NO 5AFUH 3VENA 3UKRA 3VERA 1GLLO 5AQTA 4AM7A 1Q7YO 2QWPA 4DQ8A 2P9UB 5F2RA 3UB5A 3GBTA 3E1YA 2P9PB 4Y0WA 4H5RA 3CI5A 4JAXA 4BC3A 4JN4A 3QDKA 4XH1A 4GNIA 3E66A 1KAXA 3MDQA 5TKYA 1YUWA 2WBNA 1XQSC 3O5BA 4YOVA 4H0OA 2YI1A 2E1ZA 3K9KA 3W0LA 4JKGB 3HOSA 4MLHA 5AQNA 4IFEA 5BRDA 1HUXA 2Q97A 2CGKA 3DJCA 3WXLA 1E4FT 5AQLA 2HF4A 2JWLA 3D6RA 4A57A 5KPTA 4OO1J 3PLAA 3FFKB 1NBWA 4YOUA 1HKBA 3HZ6A 1M1KO 4NLCA 4YOTA 5FPNA 1HJOA 2HMPA 2A42A 2J4RA 2GEMA 4XH5A 1RDUA 3RSEB 4OPAA 1NLVA 2C1GA 1W97L 4CBUA 4CZJA 3BUZB 3ZX0A 3FE1A 3CJ1A 4BG9A 3CCEN 3U9DA 2HF3A 4FOIA 4ISFA 3CCRN 4IZ9A 5MLCQ 4IOXA 4FWQA 4PHTX 3D2FA 4MDAA 3VGMA 1NGAA 1SZ2A 4M7XA 3VMFB 2NRTA 1QHAA 5AQHA 4ILHA 3CQYA 4RTFD 3Q7CA 1DEJA 4BRGA 4BY9C 4CBWA 4GVEA 2OTJN 3CJAA 3N4PA 3ENBA 3MN5A 3H6EA 3CIPA 3E9OA 3IFRA 3AGRA 3L4QA 1K9MO 4FWRA 1XUPO 4FOEA 4WF9L 1BOTO 2VGMA 3ULEA 3WXKA 4GV9A 2JWKA 1QZ6A 3AAQA 1T6DA 2VGNA 3C6AA 4PKHA 3P38A 3VOVA 3QBXA 2PAVA 1J6ZA 4IOAL 4RWTA 1YAGA 3U9ZA 2H3GX 2CGLA 5M1PA 2F9TA 4YDUC 2KLAA 3F9MA 2HSTA 4IEIA 3SMSA 1Y64A 2F7TA 2QM1A 3UE5A 3WUHA 4WQ4C 2ZGZA 3Q7BA 3QFPA 4FPAA 3CC7N 3CXCM 1ZXOA 5LJVA 1IJJA 3CHWA 3QFUA 1VQ6N 3ZEUA 3LM2A 3FZFA 3S41A 3JXUA 2P9LA 1VQ8N 2QWRA 3K9JA 5AQUA 4BRDA 1HPMA 1BDGA 4FWMA 4R79A 1HX1A 3G4SN 3AARA 1K73O 1K8KA 4B1XB 5HOOA 5AQIA 3L4IA 1MA9B 4IO8A 5JLFA 5C15A 3ID8A 2WFBA 3WQUA 4FWKA 5TKWA 1U6ZA 1BWFO 3LDNA 4PL8A 5AQSA 3GL1A 3HM8A 1YF5L 3LDQA 1BA1A 3WXIA 4H0PA 3JS6A 4JHDB 5GIOA 5C12A 2E8AA 3CJCA 3EN9A 5AQOA 3DXKB 1GLDG 4LC9B 4B1YB 3WEEB 4BROA 5AQWA 2WUSA 4JEPA 4B1UB 1N8RO 3SLCA 4IDHA 4H0XB 4GV3A 4WFNL 3EE8A 2GTDA 3MX2A 2E1YA 3PIPL 3FZHA 4PL7A 2Q0RA 2GWJA 4FWSA 2ASMA 3G6EN 4FL9A 3BF3A 1GLCG 1YJ9N 3IDHA 4BRIA 5GAGP 2I7NA 2QWQA 3AY9A 2CH6A 4KH4A 2D1KA 4YDUA 4MDBA 4BE7B 2KHOA 4BGAA 5M1NA 5DM6L 2QA4N 3DXMA 4GY2B 4KH6A 4BEBA 3QICA 3ENHA 3CD6N 1V4TA 1SAZA 2V51B 4NO7A 4WQ4A 2QTDA 4BVPA 5AQMA 3KVGA 1Z05A 4DKWA 3VEZA 1YXQA 4AF1A 1K8AO 2ASOA 4BECA 3VF2A 5AQJA 3W3DA 4BREA 2BH1A 1XC3A 3OHRA 4J8FA 1TYQB 2KKZA 3GE1A 4M63C 3VTHA 1ESVA 3FZLA 4BR9A 3TU5A 5BREA 3CPWM 3A5NC 2OTLN 3NMUA 5AZIA 1C0FA 3TTDA 3U8XA 2FSKA 1KAZA 3BF1A 4H0TB 3TSUA 3VEVA 3VF6A 1DKGD 2DPNA 2RE2A 5AFUA 3M6GA 5DM7L 4QS7A 1CZAN 4G9ZA 4FSVA 4KBOA 2NNWA 3CF5L 2IVOA 2YJEA 4CZKA 4BG8A 5ELZA 1E4GT 1VQMN 1KD1O 2P9UA 2AA4A 3T69A 1YVNA 2HBMA 3O9UA 1Q81O 1T3VA 3A8YA 2P9PA 3C0BA 4H0VB 4HWIA 2Q1NA 3TSQA 2QXLA 4U67L 5BR9A 3TTCA 3CCJN 1QQOA 2QW9A 3O1WA 3O6WA 3NVMA 2E88A 3M5RA 4M7YA 2Q0UA 1VAZA 3I55N 4JKGA 4PKIA 3EO3A 3H1QA 3KWGA 4A5BA 3CCVN 3CCLN 4A2AA 1QVGM 3ZX3A 4CD3A 3J8AA 3CCSN 3RSEA 2W40A 3ZYYX 3F5TA 3VEYA 2P9KB 3MWTA 1SS6A 2AP1A 3J7ZO 5BPNA 3HTVA 2A6AA 5AQPA 5AQYA 2FLOA 4BRLA 1NGEA 1RDWX 2Q31A 4I6MB 2A3ZA 3MX5A 4XEIA 3DWLA 2GUPA 5EX5A 1Q18A 1BU6O 3OBWA 5C2DA 1VQ4N 3A0IX 4WFBL 3CETA 3VGLA 1HKCA 4BC5A 1KC8O 4JKFA 1Z6RA 4BQLA 5AZJB 3BP8A 2I7PA 2CH5A 3U4LA 3WXMB 3P39A 4JNEA 2ZJQL 5AQVA 2YHYA 2HBLA 4U7BA 1S22A 2F9WA 4C1NK 3SJHA 5F0XA 3O80A 1VQON 1YITN 3D2EB 2UYTA 3C7NB 4B1WB 2QWOA 5JMVA 1VQ7N 2BTFA 4YOWA 1JCGA 2E2NA 2P9IB 1KAYA 3R8EA 4BRQA 3ATVA 4JKDA 2GWKA 3VEWA 1WOQA 3H3OB 3R3LA 1BG3A 1NGDA 3CJ7A 5CHIA 4JK7A 1MDUB 3CPEA 3IMXA 5C0YA 4BRFA 2HBKA 2YHWA 5F1XA 3O9RA 4BR7A 5AQFA 1GLEG 4BRAA 5AR0A 4WQ5C 1V4SA 1U2VB 4H5VA 5EXWA 2EWSA 3O1BA 1JCEA 3SAGA 5AQZA 2IIRA 5BRHA 3SAHA 3B8AX 3A5OC 2ZGYA 1QQMA 3UKUB 3IKMA 4EAHD 1DGKN 3P31A 2P9SB 4BRCA 2HBJA 3SMPA 5EOYA 1JCFA 3C65A 3DAWA 2YJFA 2FXUA 5GIPA 3A5LC 4JHDA 3HOTA 3CC2N 4JKCA 3R9PA 4O5FA 5E26A 3DXKA 3FZKA 4JKAA 2E2OA 2OANA 3HI0A 2A41A 3O9QA 3WEEA 2QEXN 4JD2B 1P8ZA 1NGIA 4B1ZA 5KPRA 3TPQA 1NWKA 4K43A 4IWVA 4ILGB 2NRXA 4YORA 5B8HA 1NMDA 4IJAA 4RCHA 4IO9L 2W00A 2P9NB 2NRHA 4A5AA 1X9JA 3KWIA 1LOTB 5KQDA 3H1VX 4EFHA 3I56N 1RFQA 4BQZA 2YCHA 3OW2M 1KXPA 5AQRA 2NRZA 2PFUA 2VCPA 4YOXA 4B1VA 2NRRA 3VETA 2QWLA 3P4IA 2E20A 4UY8O 3O9TA 4FWNA 5ADXH 3WQTA 2GELA 1O13A 4H5TA 3ZETB 5FPDA 1ZC6A 5E84A 4CZIA 5I9EB 2NRWA 4H5WA 2Q2RA 4WQ5A 3UKRB 5EY4A 1X3MA 2D0OA 3LDLA 3O9SA 4QS8A 3VGKA 4BC2A 1Q82O 3A5MC 1C0GA 1TYQA 3G25A 1GLFO 4FWPA 3NVKA 4HTLA 1HKGA 2YX6A 2NZTA 5AZIB 3T7ZA 5BPLA 1KQSM 3M3ZA 3SBTA 3TTFA 4BRNA 5M1FA 4A2BA 4CZHA 3CC4N 4K41A 1HLUA 3LDPA 3E9LA 1Q86O 3CQXA 1NM1A 3O8MA 4MLEA 5C10A 1D4XA 1YJWN 3TSPA 1QVFM 2FSJA 3RVCA 4ISGA 2QI2A 3R1XA 5AQGA 1S72N 5GADP 3CERA 3EL2A 1QQNA 1LCUA 4ISEA 1BA0A 3CJBA 4BRKA 1BO5O 4IEEA 5M1OA 3H45C 1EQYA 2NRVA 3M1FA 5C2FA 3KK7A 3OBYA 1VQLN 4IXCA 2ITMA 4JKBA 2PBDA 3PIOL 2ZWHA 3O08A 3L0QA 4EIAA 4FO0A 3N4QA 3E9PA 5M1KA 5CR4A 4FWLA 2IVPA 3ZX2A 2FF6A 2HOEA 2GX9A 4CI6A 4O8UA 4NB4A 5FPEA 1S3XA 1NGBA 4C23A 3KHYA 1GLBG 3F2KA 1YHQN 1TUUA 3D2FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VEO A;  5KPZ A;  5BN9 A;  3O4W A;  2CGJ A;  3LM9 A;  3VEX A;  1R59 O;  2QWM A;  3AAP A;  4CD1 A;  5EVZ A;  4DCH A;  2ZF5 O;  2P9K A;  3FLC O;  5KQ8 A;  4IJN A;  4BRP A;  3WT0 A;  1TUY A;  4I6M A;  3WXJ A;  4A62 A;  4BVO A;  3MMV A;  3ULE B;  5FPM A;  2D0P A;  4BR0 A;  3GG4 A;  4H03 B;  3VF4 A;  4BRM A;  4Z94 A;  4CZL A;  4DB3 A;  3QML A;  3FR0 A;  5AZJ A;  3H46 O;  1WUA A;  4H0Y B;  4BR2 A;  2W41 A;  4FPB A;  5LY3 A;  3EKU A;  3R6M A;  3EZW A;  1SQK A;  4BRH A;  2FSN A;  1GLA G;  2BUP A;  1X3N A;  4MO4 A;  4K42 A;  4B9Q A;  5JIC A;  4XH4 A;  3I8B A;  3SK3 A;  2E2P A;  2VYP A;  4AM6 A;  1ATR A;  1NGG A;  3ENO A;  2QWN A;  3D2E A;  3MCP A;  3ZEU B;  1ATS A;  2P9L B;  3C7N A;  4CZE A;  4EHT A;  3L6Q A;  2P9I A;  3MN6 A;  5JLH A;  1K8K B;  3CJ9 A;  5BRF A;  1MWM A;  3GDQ A;  4BR5 A;  4EHU A;  3VPZ A;  1H1V A;  3MN7 A;  4O8K A;  4CJ7 A;  3HSC A;  2A5X A;  3LL3 A;  3KZB A;  1OKJ A;  4BGB A;  1IG8 A;  4BR4 A;  5BPM A;  2Q36 A;  4E1J A;  5CE3 A;  3VES A;  3QB0 A;  3BEX A;  1U2V A;  5BN8 A;  2D4W A;  3ATU A;  2A40 A;  4H5N A;  4PKG A;  4QS9 A;  3GOI A;  3LDO A;  4MO5 A;  1ZBS A;  3I33 A;  2NLX A;  3QBW A;  3UKU A;  4FWO A;  4F9O A;  1NGJ A;  3IUC A;  2YHX A;  1NGH A;  2P9S A;  3FGU A;  1G99 A;  1RGI A;  2IVN A;  1ATN A;  3DXM B;  2FF3 B;  2V7Y A;  4CZF A;  2VWB A;  4L3Q A;  4CZM A;  4JD2 A;  4K25 A;  4A61 A;  1T6C A;  2V7Z A;  1NGF A;  1MWK A;  1T44 A;  2ASP A;  3D7E O;  3HBT A;  3FZM A;  1GLJ O;  3MK6 A;  4CBX A;  3MN9 A;  2P9N A;  2V52 B;  1NGC A;  5AQQ A;  4BC4 A;  4DHY A;  4WYB A;  1QZ5 A;  5AQX A;  2E2Q A;  5ADX A;  1BUP A;  5AQK A;  3EKS A;  4CZG A;  3ZET A;  3H3N O;  5AFU H;  3VEN A;  3UKR A;  3VER A;  1GLL O;  5AQT A;  4AM7 A;  2QWP A;  4DQ8 A;  2P9U B;  5F2R A;  3UB5 A;  3GBT A;  2P9P B;  4Y0W A;  4H5R A;  3CI5 A;  4JAX A;  4BC3 A;  4JN4 A;  3QDK A;  4XH1 A;  4GNI A;  5TKY A;  1KAX A;  3MDQ A;  1YUW A;  1XQS C;  3O5B A;  4H0O A;  2YI1 A;  2E1Z A;  3W0L A;  4MLH A;  5AQN A;  5BRD A;  1HUX A;  2Q97 A;  2CGK A;  3DJC A;  3WXL A;  1E4F T;  5AQL A;  2HF4 A;  5KPT A;  5LJW A;  3FFK B;  1NBW A;  1HKB A;  3HZ6 A;  5FPN A;  1HJO A;  2HMP A;  2A42 A;  2J4R A;  2GEM A;  4XH5 A;  3RSE B;  1NLV A;  4CBU A;  4CZJ A;  3BUZ B;  3ZX0 A;  3FE1 A;  3CJ1 A;  4BG9 A;  3U9D A;  2HF3 A;  4FOI A;  4ISF A;  4IZ9 A;  4FWQ A;  3D2F A;  3VGM A;  1NGA A;  1SZ2 A;  4M7X A;  1QHA A;  5AQH A;  3CQY A;  4RTF D;  1DEJ A;  4BRG A;  4CBW A;  3CJA A;  3MN5 A;  3H6E A;  3CIP A;  3IFR A;  4FWR A;  1XUP O;  4FOE A;  1BOT O;  3ULE A;  3WXK A;  3AAQ A;  1QZ6 A;  1T6D A;  4PKH A;  3VOV A;  3QBX A;  2PAV A;  1J6Z A;  4RWT A;  1YAG A;  3U9Z A;  2H3G X;  2CGL A;  2F9T A;  4YDU C;  3F9M A;  3SMS A;  1Y64 A;  2QM1 A;  3UE5 A;  3WUH A;  4WQ4 C;  2ZGZ A;  3QFP A;  4FPA A;  1ZXO A;  5LJV A;  1IJJ A;  3CHW A;  3QFU A;  3ZEU A;  3LM2 A;  3FZF A;  3S41 A;  3JXU A;  2P9L A;  2QWR A;  5AQU A;  4BRD A;  1HPM A;  1BDG A;  4FWM A;  1HX1 A;  3AAR A;  1K8K A;  4B1X B;  5AQI A;  3L4I A;  1MA9 B;  4IO8 A;  5JLF A;  3ID8 A;  3WQU A;  4FWK A;  1U6Z A;  1BWF O;  3LDN A;  4PL8 A;  5AQS A;  3GL1 A;  3HM8 A;  3LDQ A;  1BA1 A;  3WXI A;  4H0P A;  3JS6 A;  4JHD B;  2E8A A;  3CJC A;  3EN9 A;  5AQO A;  3DXK B;  1GLD G;  4LC9 B;  4B1Y B;  3WEE B;  4BRO A;  5AQW A;  2WUS A;  4B1U B;  3SLC A;  4H0X B;  2GTD A;  2E1Y A;  3FZH A;  4PL7 A;  2Q0R A;  2GWJ A;  4FWS A;  2ASM A;  4FL9 A;  3BF3 A;  1GLC G;  3IDH A;  4BRI A;  2I7N A;  2QWQ A;  3AY9 A;  2CH6 A;  2D1K A;  4YDU A;  2KHO A;  4BGA A;  3DXM A;  4GY2 B;  3QIC A;  3ENH A;  1V4T A;  1SAZ A;  2V51 B;  4NO7 A;  4WQ4 A;  4BVP A;  5AQM A;  3KVG A;  1Z05 A;  3VEZ A;  1YXQ A;  2ASO A;  3VF2 A;  5AQJ A;  3W3D A;  4BRE A;  1XC3 A;  3OHR A;  4J8F A;  1TYQ B;  3GE1 A;  4M63 C;  1ESV A;  3FZL A;  4BR9 A;  3TU5 A;  5BRE A;  3A5N C;  5AZI A;  1C0F A;  3U8X A;  2FSK A;  1KAZ A;  3BF1 A;  4H0T B;  3VEV A;  5AFU A;  3VF6 A;  1DKG D;  2DPN A;  3M6G A;  4QS7 A;  1CZA N;  4FSV A;  4KBO A;  2IVO A;  2YJE A;  4CZK A;  4BG8 A;  5ELZ A;  1E4G T;  2P9U A;  2AA4 A;  1YVN A;  3A8Y A;  2P9P A;  3C0B A;  4H0V B;  4HWI A;  2Q1N A;  2QXL A;  5BR9 A;  1QQO A;  2QW9 A;  3O1W A;  3O6W A;  2E88 A;  4M7Y A;  2Q0U A;  4PKI A;  3EO3 A;  3H1Q A;  4A2A A;  3ZX3 A;  4CD3 A;  3J8A A;  3RSE A;  2W40 A;  3VEY A;  2P9K B;  2AP1 A;  5BPN A;  3HTV A;  2A6A A;  5AQP A;  5AQY A;  2FLO A;  4BRL A;  1NGE A;  1RDW X;  2Q31 A;  4I6M B;  2A3Z A;  4XEI A;  3DWL A;  2GUP A;  5EX5 A;  1Q18 A;  1BU6 O;  3A0I X;  3CET A;  3VGL A;  1HKC A;  4BC5 A;  1Z6R A;  4BQL A;  5AZJ B;  3BP8 A;  2I7P A;  2CH5 A;  3U4L A;  4JNE A;  5AQV A;  2YHY A;  1S22 A;  2F9W A;  3SJH A;  5F0X A;  3O80 A;  3D2E B;  2UYT A;  3C7N B;  4B1W B;  2QWO A;  5JMV A;  2BTF A;  1JCG A;  2E2N A;  2P9I B;  1KAY A;  3R8E A;  4BRQ A;  3ATV A;  2GWK A;  3VEW A;  1WOQ A;  3H3O B;  1BG3 A;  1NGD A;  3CJ7 A;  1MDU B;  3IMX A;  4BRF A;  2YHW A;  5F1X A;  4BR7 A;  5AQF A;  1GLE G;  4BRA A;  5AR0 A;  4WQ5 C;  1V4S A;  1U2V B;  4H5V A;  5EXW A;  2EWS A;  3O1B A;  1JCE A;  5AQZ A;  2IIR A;  5BRH A;  3B8A X;  3A5O C;  2ZGY A;  1QQM A;  3UKU B;  4EAH D;  1DGK N;  4BRC A;  2P9S B;  3SMP A;  5EOY A;  1JCF A;  3DAW A;  2YJF A;  2FXU A;  3A5L C;  4JHD A;  3R9P A;  4O5F A;  5E26 A;  3DXK A;  3FZK A;  2E2O A;  2OAN A;  3HI0 A;  2A41 A;  3WEE A;  4JD2 B;  1P8Z A;  1NGI A;  4B1Z A;  5KPR A;  3TPQ A;  1NWK A;  4K43 A;  4IWV A;  5B8H A;  1NMD A;  4IJA A;  4RCH A;  2P9N B;  2NRH A;  1X9J A;  1LOT B;  5KQD A;  3H1V X;  4EFH A;  1RFQ A;  4BQZ A;  2YCH A;  1KXP A;  5AQR A;  2VCP A;  4B1V A;  3VET A;  2QWL A;  3P4I A;  2E20 A;  4FWN A;  5ADX H;  3WQT A;  2GEL A;  4H5T A;  3ZET B;  5FPD A;  1ZC6 A;  5E84 A;  4CZI A;  5I9E B;  4H5W A;  2Q2R A;  4WQ5 A;  3UKR B;  5EY4 A;  1X3M A;  2D0O A;  3LDL A;  4QS8 A;  4BC2 A;  3VGK A;  3A5M C;  1C0G A;  1TYQ A;  3G25 A;  1GLF O;  4FWP A;  4HTL A;  1HKG A;  5AZI B;  2NZT A;  5BPL A;  3M3Z A;  4BRN A;  4A2B A;  4CZH A;  4K41 A;  1HLU A;  3LDP A;  3CQX A;  1NM1 A;  3O8M A;  4MLE A;  1D4X A;  2FSJ A;  4ISG A;  5AQG A;  3CER A;  3EL2 A;  1QQN A;  1LCU A;  4ISE A;  1BA0 A;  3CJB A;  4BRK A;  1BO5 O;  3H45 C;  1EQY A;  3M1F A;  4IXC A;  2ITM A;  2PBD A;  2ZWH A;  3O08 A;  3L0Q A;  4EIA A;  4FO0 A;  3ZX2 A;  4FWL A;  2IVP A;  4CI6 A;  2FF6 A;  2HOE A;  5FPE A;  4NB4 A;  1S3X A;  1NGB A;  4C23 A;  3KHY A;  1GLB G;  1TUU A;  3D2F B; 
#chains in the Genus database with same CATH topology
 3VEO A;  1ITG A;  5BN9 A;  3O4W A;  3VEX A;  2XRI A;  2Y1J A;  1VQ5 N;  4DR5 K;  3FLC O;  3WNE A;  1YJN N;  4FYD A;  3WXJ A;  1L3U A;  4BVO A;  3HO1 A;  3ULE B;  3OYE A;  3SPY A;  3MEC A;  4GV6 A;  2D0P A;  4XJX A;  5M1Q A;  5A2Q O;  4Q5V A;  5J2N A;  4BRM A;  4CZL A;  4IOC L;  1OVY A;  4I2Q A;  4H0Y B;  3AO2 A;  1IKY A;  3CQ8 A;  3EKU A;  2OZS A;  4BRH A;  3J7A P;  2ZJR L;  4DFM A;  1GLA G;  2G8F A;  2BUP A;  1X3N A;  2WOM A;  1KVA A;  2VYP A;  1NGG A;  2QWN A;  2WTU A;  4JKE A;  4XIU A;  3ZSZ A;  3HP6 A;  2F8S A;  3AVK A;  3IAY A;  4E72 A;  4CJW A;  3GDQ A;  2DFF A;  3HP9 A;  4AQY K;  4KB0 A;  4FJN A;  1SUQ A;  2FC0 A;  4DS4 A;  5KRS A;  4FW2 A;  1CLQ A;  5BPM A;  4PUO A;  3KLI A;  3QB0 A;  1U2V A;  2A40 A;  4MO5 A;  5JVH L;  4B9L A;  1FKO A;  3QBW A;  3JAM O;  4F9O A;  3IUC A;  1HMV A;  2P9S A;  4W5O A;  1U04 A;  3DLL L;  4FW1 A;  1ATN A;  3DXM B;  3DLK A;  3OYN A;  4KI6 A;  4FJM A;  4L3Q A;  1M90 O;  3F9K A;  4JD2 A;  3LWL A;  4IFV A;  1KVC A;  4NXN K;  1GLJ O;  3MK6 A;  3AVJ A;  3MN9 A;  3M8Q A;  1WSG A;  3LPU A;  3HRG A;  5AQQ A;  1X9M A;  1ILY A;  4JS5 A;  3H08 A;  1LW2 A;  1WAJ A;  1GOA A;  3AVL A;  1VQ9 N;  5HL7 L;  4Z4E A;  2IC3 A;  3OS0 A;  1T05 A;  5JS1 A;  4AHV A;  1XMQ K;  4DLG A;  4CJ3 A;  1N36 K;  3LP2 A;  4M3Z A;  4GKJ K;  2P9U B;  3P5J A;  3SUP A;  3UB5 A;  1WBD A;  3S5T A;  3E1Y A;  3CI5 A;  4JAX A;  4JN4 A;  3QDK A;  4XH1 A;  3MDQ A;  2WBN A;  4H0O A;  2YI1 A;  3HOS A;  3AA2 A;  4AHT A;  5CZ2 A;  1XWL A;  5LJW A;  3ZSO A;  5AQL A;  4A57 A;  5KPT A;  3V9Z A;  4FLW A;  3FFK B;  1M1K O;  4YOT A;  1HJO A;  5SZT A;  1NJZ A;  4XH5 A;  1RDU A;  4DQS A;  2HHI A;  1BIU A;  3AA4 A;  4B3O A;  4LF8 K;  4BG9 A;  1TKZ A;  3KJV A;  3RR7 A;  3AO5 A;  4FK4 A;  1NOZ A;  5FRN A;  2JGU A;  4IZ9 A;  2OCE A;  3LP0 A;  3ZSV A;  3HVR A;  1KRP A;  3ZT4 A;  3Q7C A;  4BY9 C;  4CBW A;  4GVE A;  3CFO A;  2G8W A;  1L3V A;  2OTJ N;  3ENB A;  3MN5 A;  3CIP A;  3HL8 A;  3S9H A;  4FWR A;  4FXD A;  1WSF A;  1BIZ A;  3WXK A;  2JWK A;  1TL3 A;  2B4J A;  3VQP A;  5FDL A;  3P38 A;  3V9S A;  3QBX A;  2PAV A;  4IOA L;  4RWT A;  3PX4 A;  3TAP A;  2KLA A;  4O55 A;  3SMS A;  4DFP A;  2X6N A;  4I7F A;  1RDD A;  2ZGZ A;  4FPA A;  3C94 A;  1ZXO A;  3NHG A;  1IJJ A;  4B9N A;  4N76 A;  5DK5 A;  1QSL A;  3JXU A;  1VQ8 N;  3K9J A;  3HYF A;  3AAR A;  1K73 O;  1K8K A;  4B1X B;  1WAF A;  1MA9 B;  4IO8 A;  2OZM A;  3ZSQ A;  2JLE A;  1RBT A;  3LDN A;  2F4V K;  1YF5 L;  1BA1 A;  4H0P A;  2IOC A;  3TR8 A;  3EN9 A;  5AQO A;  1GLD G;  5CY4 A;  1N8R O;  4GV3 A;  4IDH A;  4H0X B;  4W5T A;  4M3U A;  3FZH A;  2GWJ A;  4FWS A;  1NKB A;  3G6E N;  2VQE K;  1S5J A;  1YJ9 N;  4BRI A;  1CXU A;  3ZSX A;  4KH4 A;  5GAG P;  4YNQ A;  2CH6 A;  4M42 A;  3PO4 A;  3LAM A;  3QEV A;  5M1N A;  4JRQ A;  1YTU A;  4BEB A;  3QIC A;  3ENH A;  3D0P A;  3SPZ A;  1RBV A;  3TAG A;  4BEC A;  2ASO A;  3VF2 A;  5AQJ A;  4DUY K;  2O8E B;  3THY A;  1XC3 A;  4J8F A;  3SCX A;  2KKZ A;  3VTH A;  3TAB A;  2HHS A;  3TU5 A;  4LD0 A;  3CPW M;  2RN2 A;  4PA1 A;  2OTL N;  3HPG A;  3TTD A;  1UWB A;  3ULD A;  2VG6 A;  4DSL A;  5AFU A;  1DKG D;  2YNH A;  3QEW A;  3RR8 A;  4FSV A;  4DV5 K;  3CF5 L;  4CZK A;  2YJE A;  3O4N A;  4BG8 A;  5ELZ A;  1E4G T;  4RW4 A;  3AVC A;  2AA4 A;  3T69 A;  1YVN A;  3O9U A;  3HXM A;  4HWI A;  4CFC A;  4U67 L;  4LSL A;  2BE2 A;  3TTC A;  2E88 A;  3M5R A;  4M7Y A;  2W6K A;  2HND A;  4JKG A;  4PKI A;  3KWG A;  1IBM K;  2I5J A;  4A2A A;  4FLU A;  4FM2 A;  4DTO A;  3J8A A;  4NCB A;  3CCS N;  2W40 A;  3ZYY X;  4CIG A;  4KHS A;  4JI8 K;  3RMA A;  1SV5 A;  3DLE A;  5BPN A;  1KFS A;  2A6A A;  5AQP A;  4Q0B A;  1NGE A;  1RDW X;  2ATQ A;  4I6M B;  3DWL A;  2P5O A;  2GUP A;  3HK2 A;  5EX5 A;  3RTV A;  4ZTF A;  1VQ4 N;  4Z4I A;  3A0I X;  4BE1 A;  3ASM A;  4BC5 A;  1Z6R A;  1C1C A;  5AZJ B;  3BP8 A;  4DTM A;  4JI5 K;  4KHY A;  3RRG A;  3JYT A;  1XNR K;  3OS1 A;  4OKE A;  1WBB A;  3WXM B;  5HP1 A;  3P39 A;  2ZJQ L;  2YHY A;  2HBL A;  4U7B A;  3QEP A;  1S22 A;  2F9W A;  4MQ3 A;  2O8C B;  5F0X A;  4B9M A;  2UYT A;  3B6O A;  3DLG A;  4YOW A;  3NDK A;  2P9I B;  4CEA A;  4DSF A;  4JKD A;  4FK0 A;  3H3O B;  4IG3 A;  5CHI A;  3CPE A;  3VQQ A;  1WSE A;  4BRF A;  3OJU A;  5AQF A;  1GLE G;  1ZBF A;  1CZ9 A;  4WQ5 C;  2KW4 A;  4OGC A;  3V81 A;  4PWD A;  2LSN A;  4HHT A;  3THV A;  5C42 A;  1HNI A;  1LAW A;  2IIR A;  3B8A X;  1QQM A;  3DLH A;  5KTQ A;  4CJT A;  2FXU A;  2O8F A;  3AVM A;  3HOT A;  4JI1 K;  1RIL A;  4JKC A;  3KLH A;  4OPJ A;  1UA0 A;  1OH8 A;  2E2O A;  3WEE A;  3KKS A;  2QEX N;  1SL2 A;  4NYF A;  4B1Z A;  2UUA K;  1FXX A;  2HVI A;  1N6Q A;  4YOR A;  3OJS A;  4CW7 B;  4RCH A;  3SYZ A;  1JLQ A;  2QK9 A;  1CZB A;  3L2W A;  3OW2 M;  1C0U A;  1L3S A;  3VET A;  3PUF A;  4UY8 O;  4FWN A;  5ADX H;  4DQI A;  1ZC6 A;  4CZI A;  3OYH A;  4JLH A;  2A1R A;  4H5W A;  2Q2R A;  4BE2 A;  3UKR B;  4E7H A;  4K8X A;  3O9S A;  4CFA A;  4N47 A;  1TYQ A;  3G25 A;  3CYM A;  3KTQ A;  3T7Z A;  2NZT A;  3V1Q A;  2OPP A;  3NAE A;  3SBT A;  1HLU A;  4JI7 K;  4Y1C A;  1NM1 A;  1D4X A;  1S72 N;  4QCL A;  4KAZ A;  4WE1 A;  1WB9 A;  1BA0 A;  3AVF A;  1BO5 O;  1EQY A;  3LZJ A;  1GOC A;  5K14 A;  2BAN A;  2ZQB A;  3KK7 A;  4IXC A;  4RW9 A;  3RWU A;  3PIO L;  4EIA A;  3L0Q A;  5J2Q A;  4R5P A;  4AHC A;  3QEX A;  1N33 K;  4O8U A;  1S3X A;  4H4M A;  4F3O A;  3KHY A;  4CJQ A;  2RF2 A;  4FLT A;  4CJ5 A;  3OS2 A;  1KVB A;  1IH7 A;  2QWM A;  3CME N;  5JVG L;  4CD1 A;  2B6A A;  3OTO K;  2HMI A;  1IKX A;  2C1I A;  3OA9 A;  1C1B A;  2OA8 A;  2P9K A;  4CHN A;  2UXB K;  4N5S A;  3I8D A;  4BRP A;  4CEO A;  3G71 N;  1NKC A;  3MMV A;  3AV9 A;  3SI6 A;  3GG4 A;  1T7P A;  3MWP A;  3HVT A;  1VSL A;  3VTI A;  3QML A;  1JLE A;  3CCU N;  2QXF A;  3QNN A;  2W41 A;  1HNW K;  3R6M A;  3V9W A;  1LWC A;  2FSN A;  4IKF A;  4DQQ A;  4MO4 A;  1U47 A;  4AH9 A;  4CJV A;  4CF1 A;  3I8B A;  4J2E A;  3D2E A;  3OYI A;  3U6F A;  1ATS A;  2P9L B;  3OYB A;  2EX3 A;  4NLB A;  2ZJP L;  1IO2 A;  3THX B;  2Z1G A;  3DM2 A;  1WSJ A;  5BRF A;  1MWM A;  1JJ2 M;  4JK9 A;  3VPZ A;  4DTU A;  3MN7 A;  1LW0 A;  4O8K A;  4X65 K;  1C6V A;  3HSC A;  3BGR A;  1VSJ A;  4BGB A;  2Q36 A;  3OYL A;  5KI6 A;  4OLB A;  2P1J A;  5BN8 A;  4PKG A;  1N5Y A;  2E6L A;  3AGK A;  5H1S Q;  3ZSY A;  4DU3 A;  4JK8 A;  2YHX A;  1NGH A;  4DF4 A;  3FGU A;  4FJI A;  1DT9 A;  1A5X A;  2V7Y A;  4F4K A;  3K2P A;  4CZM A;  4K25 A;  4DLE A;  4C1N I;  1ASW A;  3CCQ N;  1L3T A;  1MWK A;  1T44 A;  2ASP A;  5J2M A;  1R0A A;  4CBX A;  4OX9 K;  3CMA N;  2A1S A;  3WNH A;  2QKK A;  4DHY A;  5AQX A;  5GIN A;  3V9X A;  1BUP A;  3THW B;  3ZCM A;  4CZG A;  3K58 A;  3VEN A;  3VER A;  5AQT A;  4AM7 A;  5F2R A;  4I2P A;  4CHZ A;  3GBT A;  4LSN A;  5FRM A;  2P9P B;  4Y0W A;  4H5R A;  4BC3 A;  3E66 A;  5TKY A;  1EWR A;  3O5B A;  4QOZ B;  3W0L A;  3K9K A;  4DTR A;  4O0J A;  4IFE A;  5BRD A;  1HUX A;  3SAF A;  3DJC A;  2HNY A;  2JWL A;  3HZ6 A;  5FPN A;  1I94 K;  2A42 A;  2J4R A;  3RSE B;  4OPA A;  1NLV A;  1VSI A;  3NF7 A;  1W97 L;  3HPH A;  1YVU A;  3ZX0 A;  4FCY A;  4B3S K;  2OPR A;  4ISF A;  4IOX A;  4FWQ A;  4PHT X;  4B9U A;  3D2F A;  4MDA A;  3VGM A;  4DTN A;  3SV4 A;  2GBZ A;  3VMF B;  4ILH A;  1RT2 A;  3CQY A;  4RTF D;  4BRG A;  4PQU A;  2F96 A;  4CGH A;  4DFK A;  3H6E A;  4B08 A;  1IV0 A;  3VA0 A;  3IFR A;  4KO0 A;  1XUP O;  1BOT O;  3IG1 A;  3ULE A;  1B92 A;  3AAQ A;  3CYG A;  2VGN A;  4PKH A;  2NUB A;  1RT4 A;  4B8C A;  2F9T A;  3A2F A;  3QEI A;  1EWQ A;  4DR6 K;  3ZT2 A;  4IEI A;  1D8Y A;  2F7T A;  4DSI A;  4M3Y A;  4WQ4 C;  4DR2 K;  4I9Q A;  3NE6 A;  3CXC M;  1EP4 A;  4F2R A;  3QFU A;  3AA3 A;  3LM2 A;  3S41 A;  4DV0 K;  4BRD A;  1HPM A;  3G4S N;  3ID8 A;  3WQU A;  3K5L A;  3QIO A;  5C25 A;  4E7L A;  3AVH A;  3HM8 A;  4B8A B;  3LDQ A;  4JHD B;  5C12 A;  4DV6 K;  1TKX A;  3DXK B;  4W5Q A;  4GVM A;  1BQM A;  4DQR A;  2WUS A;  4B1U B;  4WFN L;  2XY7 A;  3EE8 A;  4BWM A;  2E1Y A;  2ASM A;  2G8K A;  4F8R A;  4FL9 A;  3BF3 A;  4EZ6 A;  1B9D A;  2I7N A;  2QWQ A;  4CJR A;  1JLA A;  4BE7 B;  2KHO A;  4BGA A;  1S9E A;  5DM6 L;  2QA4 N;  4CEB A;  3DXM A;  4GY2 B;  4KH6 A;  1SAZ A;  2V51 B;  4BVP A;  4DKW A;  4JS4 A;  4FLX A;  3W3D A;  3NCI A;  3G0Z A;  2BH1 A;  4J2D A;  3GE1 A;  3FZL A;  3LDS A;  4H8K A;  2Z1I A;  5BRE A;  3TAF A;  1JLG A;  1KCF A;  2YV0 X;  3A5N C;  1NJW A;  3NMU A;  2YNF A;  5AZI A;  3BF1 A;  2X78 A;  3TSU A;  3VEV A;  2DPN A;  2HB5 A;  4I9L A;  4DU4 A;  1CZA N;  4V19 S;  3CG7 A;  2NNW A;  2YKM A;  4EZ9 A;  2F8T A;  2AJQ A;  2P9U A;  1RBS A;  1IKV A;  4H0V B;  1JLB A;  3LAN A;  4NYN A;  1KTQ A;  3CCJ N;  1HQU A;  4CHP A;  3O1W A;  3NGI A;  4TSX A;  4H4O A;  3I55 N;  3EO3 A;  1RTI A;  3CCV N;  5I42 A;  1QVG M;  4FJJ A;  3D45 A;  4CD3 A;  4HCB A;  3MWT A;  3SJJ A;  3J7Z O;  3HTV A;  4B9V A;  1YTA A;  4BRL A;  3V6D A;  2A3Z A;  4XEI A;  4DR4 K;  1A5V A;  4E89 A;  3DOK A;  3HT3 A;  1EXQ A;  4W5R A;  1KC8 O;  5HRO A;  2X74 A;  2I7P A;  1VRT A;  2CH5 A;  2P51 A;  3EY1 A;  4FZY A;  1TK8 A;  2UXD K;  4BDZ A;  2RKI A;  4JNE A;  1RDB A;  1NK5 A;  3UIQ A;  1RDC A;  4C1N K;  1YIT N;  3LP1 A;  3C7N B;  4FJ5 A;  5JMV A;  3OYF A;  4F2S A;  1BG3 A;  3CJ7 A;  3V1R A;  2DFE A;  1ASV A;  2YHW A;  5F1X A;  3LZI A;  4CJU A;  3EZ5 A;  1QQC A;  1WSI A;  3VQA A;  2EWS A;  2O8D B;  1JCE A;  3SAG A;  5AQZ A;  4E1N A;  1S9G A;  2ZGY A;  3UKU B;  1EX4 A;  3V4I A;  1DGK N;  1J9A A;  5EOY A;  1JCF A;  3C65 A;  4DTX A;  5GIP A;  1S1T A;  3NF9 A;  3CC2 N;  3MXJ A;  1RT3 A;  4O5F A;  4CES A;  4JKA A;  3MEG A;  4AHS A;  1TKT A;  1FK9 A;  4DUZ K;  3TI0 A;  3I0S A;  5B8H A;  1W7A A;  1X1P A;  4IJA A;  2EHG A;  2W00 A;  2P9N B;  1BL3 A;  3TAE A;  4W5N A;  4FJ7 A;  4EFH A;  3I56 N;  2NRZ A;  4YOX A;  2NRR A;  3P4I A;  2E20 A;  4O4G A;  3WQT A;  4H5T A;  3ZET B;  4GMJ B;  5I9E B;  5KRT A;  4FM1 A;  4WQ5 A;  2D0O A;  2O8E A;  4QS8 A;  3NVK A;  1C0G A;  1GLF O;  4FWP A;  4HTL A;  1EKE A;  1HKG A;  1ZYQ A;  1HNV A;  5BPL A;  1U49 A;  3K5O A;  4CJL A;  1NK6 A;  4CEQ A;  2VWK A;  4A2B A;  3L2Q A;  1J53 A;  4MLE A;  5C10 A;  1QVF M;  4FJX A;  3RVC A;  3R1X A;  5AQG A;  1TKD A;  1NU0 A;  4DR7 K;  1LCU A;  4KI4 A;  3CJB A;  2Y1I A;  4BRK A;  1UA1 A;  5M1O A;  4CER A;  3CFR A;  3OBY A;  1VQL N;  4JKB A;  2PBD A;  4HUE A;  2ZWH A;  3KK2 A;  3ITH A;  3KK3 A;  5CR4 A;  4CI6 A;  2FF6 A;  5FPE A;  4C23 A;  5BR8 K;  1GLB G;  2GUI A;  3F2K A;  1L5U A;  4FJK A;  5KPZ A;  2CGJ A;  2OPQ A;  3ISN C;  3OYD A;  5EVZ A;  2Z1J A;  1X9W A;  2WON A;  4LF6 K;  1VQP N;  3OYC A;  5KQ8 A;  4IJN A;  1A5W A;  1F21 A;  3WT0 A;  4I6M A;  1HR0 K;  3K0S A;  3RMB A;  5FPM A;  4BR0 A;  2WC9 A;  2O4I A;  3T19 A;  4H03 B;  3VF4 A;  4DR1 K;  4Z94 A;  4E7J A;  4ELT A;  4E1M A;  4DB3 A;  3TAR A;  3FR0 A;  5AZJ A;  3H46 O;  1VQK N;  1WUA A;  3K57 A;  1T03 A;  3QIP A;  1NJY A;  3CCM N;  1W9H A;  1W2B M;  1N32 K;  3T1Y K;  4O5B A;  4JI0 K;  4B9Q A;  5JIC A;  4XH4 A;  4KTW A;  2O8C A;  4DG1 A;  4L8R B;  4AM6 A;  1ATR A;  3MCP A;  3ZEU B;  3L3V A;  4CHY A;  3BY5 A;  2VQF K;  4EHT A;  3EE9 A;  2RHK A;  3SBG A;  3L6Q A;  1U45 A;  2P9I A;  5JLH A;  1Q9X A;  3CJ9 A;  4CEF A;  1VHX A;  4KHN A;  1VQN N;  1W0H A;  1WLJ A;  1BI4 B;  1H1V A;  1I3A A;  1FJG K;  1SL1 A;  4YOY A;  5GAE P;  3LL3 A;  4BR4 A;  2HW3 A;  4E1J A;  5CE3 A;  5E41 A;  5GAH P;  1RTJ A;  2D4W A;  3QER A;  4QS9 A;  3GOI A;  3I33 A;  3AA5 X;  4DFJ A;  4F3T A;  4LFA K;  3C6H A;  3CM5 A;  3ZLJ A;  3S3N A;  3SUQ A;  4WFA L;  1RTD A;  4J2B A;  1G99 A;  1RTH A;  4JKH A;  4AIL C;  3VQ5 A;  1BCM A;  1P90 A;  4DSE A;  4CZF A;  4OPH A;  4KH5 A;  2HHH K;  1JXB A;  2B5J A;  3SQ4 A;  1T6C A;  1XHX A;  1B9F A;  1NGF A;  1VSF A;  2V7Z A;  3D7E O;  1J5E K;  3FZM A;  1TVR A;  2UXC K;  5DMR A;  4LF5 K;  3OYK A;  1NGC A;  1VSD A;  3V1O A;  4BC4 A;  4WYB A;  1QZ5 A;  4JI2 K;  2E2Q A;  1RCH A;  3AVI A;  5AQK A;  1IG9 A;  3ID6 A;  3EKS A;  3QLH A;  4CEZ A;  5J1E A;  3KLG A;  3H3N O;  4HCC A;  1TL1 A;  5AFU H;  3UKR A;  3TAN A;  1Q7Y O;  2HHQ A;  5AJ3 K;  1N34 K;  4GNI A;  4YOV A;  2YHB A;  2W42 A;  1Y97 A;  4MLH A;  2CGK A;  4IG0 A;  2HF4 A;  1NBW A;  4FK2 A;  4YOU A;  5JEN A;  4NLC A;  4YFU A;  5HRP A;  2GEM A;  3SQ2 A;  1LV5 A;  4B3M K;  3BUZ B;  3CJ1 A;  2O8B B;  2ZE2 A;  1VRU A;  1S1X A;  3U9D A;  2HF3 A;  3CCR N;  1RBR A;  5MLC Q;  1QSY A;  1QHA A;  5AQH A;  1VSH A;  2R7Y A;  5LMU K;  1DEJ A;  4KRE A;  4DU1 A;  5HRR A;  1WN7 A;  5JS2 A;  3N4P A;  5FLX O;  3PSI A;  4KTQ A;  1K9M O;  3L4Q A;  4FOE A;  4DV4 K;  5KGW A;  4CCH A;  1ZBI A;  4GV9 A;  2FBX A;  1QZ6 A;  1QHT A;  4BDY A;  3C6A A;  3EEQ A;  4E7I A;  3VOV A;  2X6S A;  4DF8 A;  1J6Z A;  1D9D A;  1YAG A;  2CGL A;  5M1P A;  4JRP A;  4YDU C;  1KLM A;  3F9M A;  2HST A;  2GV9 A;  2HHX A;  4CGI A;  3OYM A;  3U3Y A;  3UE5 A;  1C1A A;  1HNX K;  3Q7B A;  3QFP A;  3AO4 A;  3NGZ A;  3CC7 N;  3DRP A;  1VQ6 N;  4KFB A;  3MED A;  1KSP A;  2P9L A;  5HRS A;  4X62 K;  2Z1H A;  4R79 A;  3ZT1 A;  3THX A;  1UOC A;  4KTZ A;  3L4I A;  1XI1 A;  5JLF A;  3O3F A;  3RMC A;  4FWK A;  1U6Z A;  4PL8 A;  5AQS A;  4M3X A;  4UQG A;  5HBM A;  2UU9 K;  4KHW A;  3PY8 A;  3KK1 A;  4BRO A;  5AQW A;  3L2R A;  2XY6 A;  4FLY A;  1VSM A;  1YT3 A;  3SUN A;  2GTD A;  3QO9 A;  3PIP L;  5SWM A;  4PL7 A;  3ZSR A;  3DYA A;  4LF7 K;  1RBU A;  1Q8I A;  3IDH A;  3AY9 A;  4K0K K;  2D0B A;  1NK8 A;  2D1K A;  4MDB A;  4Z4C A;  3ZT3 A;  1V4T A;  2PY5 A;  5I3U A;  4WQ4 A;  4OLA A;  3KVG A;  1Z05 A;  1YXQ A;  4MFB A;  4Z0U A;  1HRH A;  4CIE A;  2P5G A;  4M63 C;  3VA3 A;  1OVQ A;  3THW A;  4ZHR A;  2FSK A;  1TAU A;  1U4B A;  4H0T B;  1LWF A;  4NCG A;  3M6G A;  4RW7 A;  5DM7 L;  4G9Z A;  4KBO A;  4AHR A;  4X66 K;  4GW6 A;  4FJL A;  3MXI A;  1VQM N;  2HBM A;  4AHU A;  2KZM A;  1KLN A;  1MU2 A;  3A8Y A;  2P9P A;  3QIN A;  3TSQ A;  3AO3 A;  1NMN A;  4CEE A;  5BR9 A;  1DTT A;  4JYA K;  3KD5 E;  4C8L A;  1Z26 A;  1XHZ A;  4CF0 A;  3KLE A;  3HM9 A;  3MXM A;  3TAM A;  5IT9 O;  1BCO A;  2OPS A;  4KV8 A;  1JL2 A;  4LFB K;  4CGD A;  3F73 A;  2D5R A;  4DV2 K;  3RSE A;  2DFH A;  2O4G A;  2AP1 A;  5AQY A;  2Q31 A;  2Q3S A;  4CFB A;  1Q18 A;  2VG7 A;  3OBW A;  5C2D A;  3K59 A;  2KFZ A;  1UAX A;  3CET A;  1SKS A;  3VGL A;  3DMJ A;  4NXM K;  4JKF A;  3WNG A;  2W6L A;  4CHO A;  2OYQ A;  3DLR A;  1K6Y A;  4DMN A;  3U4L A;  1JKH A;  3OY9 A;  1BHL A;  5AQV A;  3U3G A;  3P1G A;  1WNS A;  2IDO A;  3TAQ A;  2VWJ A;  3QES A;  1VQO N;  1TK5 A;  4RG8 A;  1RT1 A;  4FLV A;  2QWO A;  1VQ7 N;  4GKK K;  3T1H K;  1KAY A;  3R8E A;  4BRQ A;  3ATV A;  2GWK A;  3R3L A;  2YHA A;  1Z25 A;  1MDU B;  5C0Y A;  4DV1 K;  2HBK A;  3NGY A;  4BR7 A;  5AR0 A;  4DSJ A;  3NH2 A;  1V4S A;  1U2V B;  4CEC A;  5EXW A;  3RRH A;  5BRH A;  3SAH A;  1QE1 A;  3A5O C;  3IKM A;  1ASU A;  4EAH D;  4BRC A;  2P9S B;  3SMP A;  3NBP A;  2KTQ A;  3VQB A;  1NK9 A;  2G8H A;  4JHD A;  2FBV A;  1REV A;  4B3R K;  3DXK A;  1ZBH A;  2OAN A;  3HI0 A;  4E7K A;  2A41 A;  4JD2 B;  1P8Z A;  3TPQ A;  2IGI A;  4IWV A;  4ILG B;  2UUC K;  2NRX A;  3RMD A;  2NRH A;  1OH7 A;  4M45 A;  4JI4 K;  4A5A A;  2KZZ A;  1X9J A;  3KWI A;  1LOT B;  1RFQ A;  4BQZ A;  4KHU A;  4B1V A;  1J5O A;  3O9T A;  1O13 A;  5FPD A;  3AVG A;  3DLB A;  5E84 A;  1OH5 A;  2NRW A;  2PYL A;  3V9U A;  1X3M A;  3MAQ A;  3LDL A;  4LH4 A;  3LPT A;  4LH5 A;  3C6T A;  4BC2 A;  1NJX A;  3KD1 E;  2E4L A;  4ICL A;  5AZI B;  1KQS M;  3M3Z A;  3PX0 A;  1TGO A;  4BRN A;  5FRO A;  3G10 A;  4CZH A;  4K41 A;  3LDP A;  1TAQ A;  3WNF A;  5J2P A;  3O8M A;  1YJW N;  4E3S A;  2FSJ A;  3BZK A;  1HQE A;  2QI2 A;  4CGF A;  5GAD P;  3CM6 A;  3CER A;  1QQN A;  4ISE A;  3SUO A;  4N41 A;  3PV8 A;  5LL6 Z;  3H45 C;  4CJS A;  1GOB A;  3TWH A;  4BWJ A;  3M1F A;  5C2F A;  4CHQ A;  4DR3 K;  1D9F A;  1SKR A;  4DV7 K;  4CF8 A;  3N4Q A;  4RW8 A;  3E9P A;  5M1K A;  3ZX2 A;  3OYJ A;  2IVP A;  5D3G A;  2GX9 A;  4NB4 A;  1QSS A;  2IS3 A;  4CF9 A;  1TUU A;  4CZJ A;  4CJ4 A;  2DY4 A;  3LM9 A;  1R59 O;  3AAP A;  3BZC A;  1LWE A;  1HPZ A;  4DCH A;  4LFC K;  2ZF5 O;  2HHV A;  4ID1 A;  1D5A A;  1TUY A;  3C6U A;  5HRN A;  5CYM A;  4A62 A;  2ITG A;  4A59 A;  3S3O A;  4N56 A;  4B9S A;  2E6M A;  4BR2 A;  4CJK A;  4FPB A;  1XNQ K;  5LY3 A;  1SL0 A;  3VQ4 A;  3OYA A;  4BDP A;  3EZW A;  1SQK A;  3NF8 A;  4G1Q A;  2XO7 A;  3EYZ A;  4K42 A;  2XY5 A;  3PSF A;  3SQ0 A;  1NNE A;  3SZ2 A;  3SK3 A;  2E2P A;  3ENO A;  3HJF A;  3C7N A;  4M3R A;  1EET A;  4CZE A;  1FW6 A;  3T1A A;  3VQ7 A;  2PYJ A;  1YI2 N;  5C24 A;  1HYS A;  3MN6 A;  1K8K B;  1O1W A;  4BR5 A;  4FVU A;  4EHU A;  3O3H A;  3MCA B;  4OJR A;  3MEE A;  4CGG A;  4CJ7 A;  2FBT A;  2A5X A;  3KZB A;  1OKJ A;  1IG8 A;  1OH6 A;  3VES A;  3BEX A;  2XY8 A;  3OVN A;  3ATU A;  1RT7 A;  4H5N A;  3L2V A;  2O8D A;  3LDO A;  1HJR A;  1YIJ N;  1ZBS A;  4WCE L;  4Z4F A;  2NLX A;  1U48 A;  3UKU A;  4FWO A;  1RT5 A;  1NGJ A;  4RW6 A;  3ZSW A;  3SQ1 A;  4FZX C;  1RGI A;  2IVN A;  4OVL A;  2FF3 B;  1JXE A;  1EO1 A;  3NH0 A;  4K8Z A;  2VWB A;  4OKK A;  5KGX A;  4A61 A;  2G8U A;  3KLF A;  3HBT A;  3THY B;  4ELU A;  2QKB A;  3M8R A;  4LY7 A;  1ZBL A;  2P9N A;  2V52 B;  4FVM A;  4PY5 A;  4M41 A;  5ADX A;  4ILJ A;  1NJI O;  3ZET A;  4DTS A;  1IKW A;  3JSM A;  4EP5 A;  1RDA A;  2ZD1 A;  1GLL O;  1C0M A;  3SNN A;  2QWP A;  4DQ8 A;  2G8V A;  1NG9 A;  3VQ8 A;  3NFA A;  1KAX A;  1YUW A;  1XQS C;  1C0T A;  2E1Z A;  4OGE A;  4JKG B;  5AQN A;  3ALY A;  2Q97 A;  3WXL A;  3L2U A;  1E4F T;  3LAL A;  3D6R A;  4OO1 J;  3PLA A;  1HKB A;  3IS9 A;  4FJH A;  2DTU A;  3M8S A;  2HMP A;  3KIO A;  3J7Y P;  3FFI A;  5EU7 A;  3J80 O;  4C8K A;  1JLF A;  2C1G A;  4M3T A;  4CBU A;  2HHW A;  1LAV A;  3FE1 A;  3LP3 A;  3P83 D;  3L8B A;  3CCE N;  4FOI A;  4DTJ A;  1S6Q A;  2RPI A;  1NGA A;  2HNZ A;  1SZ2 A;  2YNG A;  4M7X A;  4C8N A;  4C8M A;  2NRT A;  4ZTJ A;  3ZT0 A;  3QNO A;  1VSE A;  4E19 A;  3DOL A;  4FM0 A;  3CJA A;  4DWI A;  3E9O A;  3AGR A;  4WF9 L;  2VGM A;  3DI6 A;  3C95 A;  1T6D A;  4QAG A;  4DS5 A;  3O3G A;  3U9Z A;  2H3G X;  3J81 O;  3SV3 A;  5IWA K;  4JV5 K;  1Y64 A;  4Z4H A;  4ELV A;  2QM1 A;  3WUH A;  1VK0 A;  1I39 A;  1JLC A;  5LJV A;  3CHW A;  3ZEU A;  4KPY A;  3FZF A;  4E0D A;  2QWR A;  5AQU A;  4KHP K;  1QS4 A;  1BDG A;  4FWM A;  4M3W A;  1HX1 A;  2KQ2 A;  3O4Q A;  5HOO A;  5AQI A;  4Z4G A;  5C15 A;  3QET A;  2WFB A;  1BI4 A;  5TKW A;  1BWF O;  1NOY A;  3GL1 A;  4CJE A;  3WXI A;  2O8F B;  3JS6 A;  4CE9 A;  5GIO A;  2E8A A;  3CJC A;  4B1Y B;  4LC9 B;  1NKE A;  3WEE B;  3T3F A;  3DRS A;  4JEP A;  3SLC A;  3MX2 A;  3K5N A;  2Q0R A;  4HUF A;  5CZ1 A;  1GLC G;  3VQ6 A;  4FLZ A;  4YY3 K;  3L3U A;  3AVN A;  4YDU A;  4FZZ A;  3CD6 N;  1CXQ A;  4IBN A;  4NO7 A;  2QTD A;  2BDP A;  5AQM A;  1X9S A;  3VEZ A;  4AF1 A;  1HYV A;  1K8A O;  3VQE A;  3VQC A;  4BRE A;  1NK7 A;  1VSK A;  3OHR A;  3VN5 A;  1TYQ B;  4FJ9 A;  5LMN K;  1QTM A;  1ESV A;  4BR9 A;  1IBL K;  4CF2 A;  4O44 A;  1HYZ A;  1C0F A;  3U8X A;  2IAJ A;  4Y1D A;  1KAZ A;  3M8P A;  2HHT A;  3VF6 A;  2RE2 A;  2BGG A;  4QS7 A;  2D0C A;  3NF6 A;  2IVO A;  3IRX A;  1KD1 O;  3HST B;  1J54 A;  1Q81 O;  1T3V A;  1XC9 A;  3C0B A;  3VQD A;  2Q1N A;  2QXL A;  4KKO A;  4CED A;  1DTQ A;  1QQO A;  5HLF A;  4CJP A;  2QW9 A;  3O6W A;  3NVM A;  2Q0U A;  1VAZ A;  3H1Q A;  4A5B A;  3CCL N;  4B3T K;  1JL1 A;  1KFD A;  3ZX3 A;  4CVN E;  3S3M A;  3F5T A;  3VEY A;  2P9K B;  1SS6 A;  4CJF A;  2FLO A;  3K5M A;  2E5L K;  3BDP A;  3MX5 A;  2O8B A;  1BU6 O;  2YNI A;  4WFB L;  4HUG A;  1HKC A;  3CFP A;  4BQL A;  1SKW A;  2ETJ A;  2XHB A;  1E3M A;  2D0A A;  3LWM A;  4BAC A;  4IFY A;  1IBK K;  1NK0 A;  4LF9 K;  4DSK A;  1TK0 A;  2PZS A;  3VQ9 A;  3SJH A;  3AVB A;  3O80 A;  3D2E B;  4O0I A;  4B1W B;  1Q9Y A;  4C8O A;  2BTF A;  2UUB K;  1JCG A;  2E2N A;  4HTU A;  4BE0 A;  3VEW A;  1WOQ A;  2G8I A;  5CYQ A;  1NGD A;  5T7B A;  4JK7 A;  4KB1 A;  4LF4 K;  4CIF A;  3IMX A;  1TV6 A;  3O9R A;  1RT6 A;  4BRA A;  4CK1 A;  4X64 K;  1XMO K;  4CGJ A;  4H5V A;  4YHH K;  2ZM6 K;  3O1B A;  3HPO A;  1BIS A;  4KRF A;  3PO5 A;  4DV3 K;  3P31 A;  4DTP A;  2HBJ A;  4JI3 K;  3DAW A;  1WSH A;  2YJF A;  3A5L C;  4CFD A;  1S1V A;  3R9P A;  5E26 A;  4ID5 A;  1S6P A;  4IDK A;  1FKP A;  3FZK A;  3O9Q A;  2HVH A;  1NGI A;  5KPR A;  1NWK A;  3I0R A;  4K43 A;  3NH1 A;  1NMD A;  1RNH A;  3E01 A;  4IO9 L;  4OKJ A;  5KQD A;  3H1V X;  4KHQ A;  2YCH A;  1KXP A;  5AQR A;  4JI6 K;  2PFU A;  2VCP A;  3AO1 A;  3LAK A;  2QWL A;  4EP4 A;  1T8E A;  2GEL A;  1S1W A;  1BGX T;  1DLO A;  2HHU A;  5EY4 A;  1G15 A;  2VG5 A;  1Q82 O;  4FJG A;  3VGK A;  3A5M C;  2YKN A;  3AVA A;  2YX6 A;  4J2A A;  3TTF A;  4FJ8 A;  5M1F A;  1BQN A;  3CC4 N;  3E9L A;  4NCA A;  1Q86 O;  3CQX A;  3KKR A;  1ZBU A;  3TSP A;  1S1U A;  1HNZ K;  4ISG A;  3EL2 A;  2KFN A;  4IEE A;  2FBY A;  2NRV A;  4OPK A;  2ITM A;  1NK4 A;  3O08 A;  4FO0 A;  3PX6 A;  4B9T A;  4CK2 A;  4CK3 A;  4FWL A;  2HOE A;  4HVJ A;  3B6P A;  4DQP A;  3DRR A;  1NGB A;  1YHQ N;  3D2F B;  3OYG A; 
#chains in the Genus database with same CATH homology
 3VEO A;  5KPZ A;  5BN9 A;  3O4W A;  2CGJ A;  3LM9 A;  3VEX A;  1R59 O;  2QWM A;  3AAP A;  3CME N;  5JVG L;  4CD1 A;  2C1I A;  5EVZ A;  4DCH A;  2ZF5 O;  3OA9 A;  1VQ5 N;  2P9K A;  1VQP N;  3FLC O;  5KQ8 A;  4IJN A;  4BRP A;  3WT0 A;  1TUY A;  3G71 N;  4I6M A;  1YJN N;  3WXJ A;  4A62 A;  4BVO A;  3MMV A;  3ULE B;  4A59 A;  4GV6 A;  5FPM A;  4XJX A;  2D0P A;  4BR0 A;  5M1Q A;  2WC9 A;  3GG4 A;  4H03 B;  3VF4 A;  4BRM A;  4Z94 A;  4CZL A;  3MWP A;  4IOC L;  4DB3 A;  3VTI A;  3QML A;  3FR0 A;  5AZJ A;  3H46 O;  1VQK N;  1OVY A;  3CCU N;  1WUA A;  4H0Y B;  4BR2 A;  2W41 A;  4FPB A;  5LY3 A;  3CCM N;  3EKU A;  3R6M A;  3EZW A;  1SQK A;  4BRH A;  1W2B M;  2ZJR L;  2FSN A;  1GLA G;  2BUP A;  1X3N A;  4MO4 A;  4K42 A;  4B9Q A;  5JIC A;  4XH4 A;  3I8B A;  3SK3 A;  2E2P A;  2VYP A;  4AM6 A;  1ATR A;  1NGG A;  2QWN A;  3D2E A;  3ENO A;  3MCP A;  3ZEU B;  1ATS A;  2P9L B;  3C7N A;  4JKE A;  4CZE A;  4EHT A;  3EE9 A;  2RHK A;  4NLB A;  3L6Q A;  3SBG A;  2ZJP L;  1YI2 N;  2P9I A;  3MN6 A;  5JLH A;  1K8K B;  3CJ9 A;  5BRF A;  1MWM A;  3GDQ A;  4BR5 A;  4EHU A;  1VQN N;  4FVU A;  1JJ2 M;  3MCA B;  4JK9 A;  3VPZ A;  1H1V A;  3MN7 A;  4O8K A;  4YOY A;  4CJ7 A;  3SAF A;  3HSC A;  2A5X A;  3LL3 A;  5GAE P;  3KZB A;  1OKJ A;  4BGB A;  1IG8 A;  4BR4 A;  5BPM A;  2Q36 A;  4E1J A;  5CE3 A;  5GAH P;  3VES A;  3QB0 A;  3BEX A;  1U2V A;  5BN8 A;  2D4W A;  3ATU A;  2A40 A;  4H5N A;  4PKG A;  4QS9 A;  3GOI A;  3LDO A;  4MO5 A;  1YIJ N;  1ZBS A;  3I33 A;  4WCE L;  5JVH L;  2NLX A;  3C6H A;  3AGK A;  5H1S Q;  3QBW A;  3UKU A;  4FWO A;  4F9O A;  4JK8 A;  1NGJ A;  3IUC A;  2YHX A;  1NGH A;  2P9S A;  4WFA L;  3FGU A;  1G99 A;  4JKH A;  3DLL L;  1DT9 A;  1P90 A;  1RGI A;  2IVN A;  1ATN A;  3DXM B;  2FF3 B;  2V7Y A;  4CZF A;  1EO1 A;  4OPH A;  2VWB A;  4L3Q A;  4KH5 A;  4CZM A;  4JD2 A;  4K25 A;  4A61 A;  1M90 O;  4C1N I;  1T6C A;  3CCQ N;  2V7Z A;  1NGF A;  1MWK A;  1T44 A;  2ASP A;  3D7E O;  3HBT A;  3FZM A;  1GLJ O;  3MK6 A;  4CBX A;  3MN9 A;  2P9N A;  3CMA N;  2V52 B;  1NGC A;  3HRG A;  5AQQ A;  5LJW A;  4BC4 A;  4DHY A;  4WYB A;  1QZ5 A;  5AQX A;  2E2Q A;  5GIN A;  5ADX A;  1ILY A;  1BUP A;  5AQK A;  3ID6 A;  4ILJ A;  1VQ9 N;  3EKS A;  4CZG A;  5HL7 L;  1NJI O;  3ZET A;  3H3N O;  5AFU H;  3VEN A;  3UKR A;  3VER A;  1GLL O;  5AQT A;  4AM7 A;  1Q7Y O;  2QWP A;  4DQ8 A;  2P9U B;  5F2R A;  3UB5 A;  3GBT A;  3E1Y A;  2P9P B;  4Y0W A;  4H5R A;  3CI5 A;  4JAX A;  4BC3 A;  4JN4 A;  3QDK A;  4XH1 A;  4GNI A;  3E66 A;  1KAX A;  3MDQ A;  5TKY A;  1YUW A;  2WBN A;  1XQS C;  3O5B A;  4YOV A;  4H0O A;  2YI1 A;  2E1Z A;  3K9K A;  3W0L A;  4JKG B;  3HOS A;  4MLH A;  5AQN A;  4IFE A;  5BRD A;  1HUX A;  2Q97 A;  2CGK A;  3DJC A;  3WXL A;  1E4F T;  5AQL A;  2HF4 A;  2JWL A;  3D6R A;  4A57 A;  5KPT A;  4OO1 J;  3PLA A;  3FFK B;  1NBW A;  4YOU A;  1HKB A;  3HZ6 A;  1M1K O;  4NLC A;  4YOT A;  5FPN A;  1HJO A;  2HMP A;  2A42 A;  2J4R A;  2GEM A;  4XH5 A;  1RDU A;  3RSE B;  4OPA A;  1NLV A;  2C1G A;  1W97 L;  4CBU A;  4CZJ A;  3BUZ B;  3ZX0 A;  3FE1 A;  3CJ1 A;  4BG9 A;  3CCE N;  3U9D A;  2HF3 A;  4FOI A;  4ISF A;  3CCR N;  4IZ9 A;  5MLC Q;  4IOX A;  4FWQ A;  4PHT X;  3D2F A;  4MDA A;  3VGM A;  1NGA A;  1SZ2 A;  4M7X A;  3VMF B;  2NRT A;  1QHA A;  5AQH A;  4ILH A;  3CQY A;  4RTF D;  3Q7C A;  1DEJ A;  4BRG A;  4BY9 C;  4CBW A;  4GVE A;  2OTJ N;  3CJA A;  3N4P A;  3ENB A;  3MN5 A;  3H6E A;  3CIP A;  3E9O A;  3IFR A;  3AGR A;  3L4Q A;  1K9M O;  4FWR A;  1XUP O;  4FOE A;  4WF9 L;  1BOT O;  2VGM A;  3ULE A;  3WXK A;  4GV9 A;  2JWK A;  1QZ6 A;  3AAQ A;  1T6D A;  2VGN A;  3C6A A;  4PKH A;  3P38 A;  3VOV A;  3QBX A;  2PAV A;  1J6Z A;  4IOA L;  4RWT A;  1YAG A;  3U9Z A;  2H3G X;  2CGL A;  5M1P A;  2F9T A;  4YDU C;  2KLA A;  3F9M A;  2HST A;  4IEI A;  3SMS A;  1Y64 A;  2F7T A;  2QM1 A;  3UE5 A;  3WUH A;  4WQ4 C;  2ZGZ A;  3Q7B A;  3QFP A;  4FPA A;  3CC7 N;  3CXC M;  1ZXO A;  5LJV A;  1IJJ A;  3CHW A;  3QFU A;  1VQ6 N;  3ZEU A;  3LM2 A;  3FZF A;  3S41 A;  3JXU A;  2P9L A;  1VQ8 N;  2QWR A;  3K9J A;  5AQU A;  4BRD A;  1HPM A;  1BDG A;  4FWM A;  4R79 A;  1HX1 A;  3G4S N;  3AAR A;  1K73 O;  1K8K A;  4B1X B;  5HOO A;  5AQI A;  3L4I A;  1MA9 B;  4IO8 A;  5JLF A;  5C15 A;  3ID8 A;  2WFB A;  3WQU A;  4FWK A;  5TKW A;  1U6Z A;  1BWF O;  3LDN A;  4PL8 A;  5AQS A;  3GL1 A;  3HM8 A;  1YF5 L;  3LDQ A;  1BA1 A;  3WXI A;  4H0P A;  3JS6 A;  4JHD B;  5GIO A;  5C12 A;  2E8A A;  3CJC A;  3EN9 A;  5AQO A;  3DXK B;  1GLD G;  4LC9 B;  4B1Y B;  3WEE B;  4BRO A;  5AQW A;  2WUS A;  4JEP A;  4B1U B;  1N8R O;  3SLC A;  4IDH A;  4H0X B;  4GV3 A;  4WFN L;  3EE8 A;  2GTD A;  3MX2 A;  2E1Y A;  3PIP L;  3FZH A;  4PL7 A;  2Q0R A;  2GWJ A;  4FWS A;  2ASM A;  3G6E N;  4FL9 A;  3BF3 A;  1GLC G;  1YJ9 N;  3IDH A;  4BRI A;  5GAG P;  2I7N A;  2QWQ A;  3AY9 A;  2CH6 A;  4KH4 A;  2D1K A;  4YDU A;  4MDB A;  4BE7 B;  2KHO A;  4BGA A;  5M1N A;  5DM6 L;  2QA4 N;  3DXM A;  4GY2 B;  4KH6 A;  4BEB A;  3QIC A;  3ENH A;  3CD6 N;  1V4T A;  1SAZ A;  2V51 B;  4NO7 A;  4WQ4 A;  2QTD A;  4BVP A;  5AQM A;  3KVG A;  1Z05 A;  4DKW A;  3VEZ A;  1YXQ A;  4AF1 A;  1K8A O;  2ASO A;  4BEC A;  3VF2 A;  5AQJ A;  3W3D A;  4BRE A;  2BH1 A;  1XC3 A;  3OHR A;  4J8F A;  1TYQ B;  2KKZ A;  3GE1 A;  4M63 C;  3VTH A;  1ESV A;  3FZL A;  4BR9 A;  3TU5 A;  5BRE A;  3CPW M;  3A5N C;  2OTL N;  3NMU A;  5AZI A;  1C0F A;  3TTD A;  3U8X A;  2FSK A;  1KAZ A;  3BF1 A;  4H0T B;  3TSU A;  3VEV A;  3VF6 A;  1DKG D;  2DPN A;  2RE2 A;  5AFU A;  3M6G A;  5DM7 L;  4QS7 A;  1CZA N;  4G9Z A;  4FSV A;  4KBO A;  2NNW A;  3CF5 L;  2IVO A;  2YJE A;  4CZK A;  4BG8 A;  5ELZ A;  1E4G T;  1VQM N;  1KD1 O;  2P9U A;  2AA4 A;  3T69 A;  1YVN A;  2HBM A;  3O9U A;  1Q81 O;  1T3V A;  3A8Y A;  2P9P A;  3C0B A;  4H0V B;  4HWI A;  2Q1N A;  3TSQ A;  2QXL A;  4U67 L;  5BR9 A;  3TTC A;  3CCJ N;  1QQO A;  2QW9 A;  3O1W A;  3O6W A;  3NVM A;  2E88 A;  3M5R A;  4M7Y A;  2Q0U A;  1VAZ A;  3I55 N;  4JKG A;  4PKI A;  3EO3 A;  3H1Q A;  3KWG A;  4A5B A;  3CCV N;  3CCL N;  4A2A A;  1QVG M;  3ZX3 A;  4CD3 A;  3J8A A;  3CCS N;  3RSE A;  2W40 A;  3ZYY X;  3F5T A;  3VEY A;  2P9K B;  3MWT A;  1SS6 A;  2AP1 A;  3J7Z O;  5BPN A;  3HTV A;  2A6A A;  5AQP A;  5AQY A;  2FLO A;  4BRL A;  1NGE A;  1RDW X;  2Q31 A;  4I6M B;  2A3Z A;  3MX5 A;  4XEI A;  3DWL A;  2GUP A;  5EX5 A;  1Q18 A;  1BU6 O;  3OBW A;  5C2D A;  1VQ4 N;  3A0I X;  4WFB L;  3CET A;  3VGL A;  1HKC A;  4BC5 A;  1KC8 O;  4JKF A;  1Z6R A;  4BQL A;  5AZJ B;  3BP8 A;  2I7P A;  2CH5 A;  3U4L A;  3WXM B;  3P39 A;  4JNE A;  2ZJQ L;  5AQV A;  2YHY A;  2HBL A;  4U7B A;  1S22 A;  2F9W A;  4C1N K;  3SJH A;  5F0X A;  3O80 A;  1VQO N;  1YIT N;  3D2E B;  2UYT A;  3C7N B;  4B1W B;  2QWO A;  5JMV A;  1VQ7 N;  2BTF A;  4YOW A;  1JCG A;  2E2N A;  2P9I B;  1KAY A;  3R8E A;  4BRQ A;  3ATV A;  4JKD A;  2GWK A;  3VEW A;  1WOQ A;  3H3O B;  3R3L A;  1BG3 A;  1NGD A;  3CJ7 A;  5CHI A;  4JK7 A;  1MDU B;  3CPE A;  3IMX A;  5C0Y A;  4BRF A;  2HBK A;  2YHW A;  5F1X A;  3O9R A;  4BR7 A;  5AQF A;  1GLE G;  4BRA A;  5AR0 A;  4WQ5 C;  1V4S A;  1U2V B;  4H5V A;  5EXW A;  2EWS A;  3O1B A;  1JCE A;  3SAG A;  5AQZ A;  2IIR A;  5BRH A;  3SAH A;  3B8A X;  3A5O C;  2ZGY A;  1QQM A;  3UKU B;  3IKM A;  4EAH D;  1DGK N;  3P31 A;  2P9S B;  4BRC A;  2HBJ A;  3SMP A;  5EOY A;  1JCF A;  3C65 A;  3DAW A;  2YJF A;  2FXU A;  5GIP A;  3A5L C;  4JHD A;  3HOT A;  3CC2 N;  4JKC A;  3R9P A;  4O5F A;  5E26 A;  3DXK A;  3FZK A;  4JKA A;  2E2O A;  2OAN A;  3HI0 A;  2A41 A;  3O9Q A;  3WEE A;  2QEX N;  4JD2 B;  1P8Z A;  1NGI A;  4B1Z A;  5KPR A;  3TPQ A;  1NWK A;  4K43 A;  4IWV A;  4ILG B;  2NRX A;  4YOR A;  5B8H A;  1NMD A;  4IJA A;  4RCH A;  4IO9 L;  2W00 A;  2P9N B;  2NRH A;  4A5A A;  1X9J A;  3KWI A;  1LOT B;  5KQD A;  3H1V X;  4EFH A;  3I56 N;  1RFQ A;  4BQZ A;  2YCH A;  3OW2 M;  1KXP A;  5AQR A;  2NRZ A;  2PFU A;  2VCP A;  4YOX A;  4B1V A;  2NRR A;  3VET A;  2QWL A;  3P4I A;  2E20 A;  4UY8 O;  3O9T A;  4FWN A;  5ADX H;  3WQT A;  2GEL A;  1O13 A;  4H5T A;  3ZET B;  5FPD A;  1ZC6 A;  5E84 A;  4CZI A;  5I9E B;  2NRW A;  4H5W A;  2Q2R A;  4WQ5 A;  3UKR B;  5EY4 A;  1X3M A;  2D0O A;  3LDL A;  3O9S A;  4QS8 A;  3VGK A;  4BC2 A;  1Q82 O;  3A5M C;  1C0G A;  1TYQ A;  3G25 A;  1GLF O;  4FWP A;  3NVK A;  4HTL A;  1HKG A;  2YX6 A;  2NZT A;  5AZI B;  3T7Z A;  5BPL A;  1KQS M;  3M3Z A;  3SBT A;  3TTF A;  4BRN A;  5M1F A;  4A2B A;  4CZH A;  3CC4 N;  4K41 A;  1HLU A;  3LDP A;  3E9L A;  1Q86 O;  3CQX A;  1NM1 A;  3O8M A;  4MLE A;  5C10 A;  1D4X A;  1YJW N;  3TSP A;  1QVF M;  2FSJ A;  3RVC A;  4ISG A;  2QI2 A;  3R1X A;  5AQG A;  1S72 N;  5GAD P;  3CER A;  3EL2 A;  1QQN A;  1LCU A;  4ISE A;  1BA0 A;  3CJB A;  4BRK A;  1BO5 O;  4IEE A;  5M1O A;  3H45 C;  1EQY A;  2NRV A;  3M1F A;  5C2F A;  3KK7 A;  3OBY A;  1VQL N;  4IXC A;  2ITM A;  4JKB A;  2PBD A;  3PIO L;  2ZWH A;  3O08 A;  3L0Q A;  4EIA A;  4FO0 A;  3N4Q A;  3E9P A;  5M1K A;  5CR4 A;  4FWL A;  2IVP A;  3ZX2 A;  2FF6 A;  2HOE A;  2GX9 A;  4CI6 A;  4O8U A;  4NB4 A;  5FPE A;  1S3X A;  1NGB A;  4C23 A;  3KHY A;  1GLB G;  3F2K A;  1YHQ N;  1TUU A;  3D2F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...