1K8KA

Crystal structure of arp2/3 complex
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
416
structure length
401
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN-LIKE PROTEIN 3
publication title Crystal Structure of Arp2/3 Complex
pubmed doi rcsb
molecule tags Structural protein
total genus 130
structure length 401
sequence length 416
ec nomenclature
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1k8kA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1k8kA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1k8kA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1k8kA04
3I8BA 1RDWX 5LJVA 3VERA 2A40A 3SMSA 2GELA 1Z05A 4CBUA 3ATUA 5BRHA 2VYPA 5AQIA 5AQVA 4E1JA 3WT0A 4H0OA 2YCHA 1KAYA 2QWQA 4GNIA 4YDUA 5BN9A 4BGBA 2QWLA 2QM1A 3QFPA 1YXQA 4BRFA 3VENA 5AFUA 3HTVA 1CZAN 3GBTA 1ATNA 5AQHA 1Y64A 2CH6A 3MN6A 3A5MC 1MA9B 4BG9A 4JD2B 2ASOA 3DAWA 2W40A 5AQZA 5BRFA 3U4LA 3ZX2A 3A8YA 3ZETA 3O80A 3VF4A 1NLVA 4IJNA 3UE5A 5B8HA 2IIRA 3WUHA 4PL8A 4FWOA 3BF1A 2BUPA 2NRHA 1DKGD 4IJAA 2P9UA 2IVPA 3VOVA 2J4RA 1K8KA 3C7NB 4QS9A 4H0XB 5BN8A 4B1VA 4CZKA 3L4IA 4EHUA 4ISEA 2W41A 5EY4A 3LDQA 2F9WA 2GUPA 5BPLA 3GG4A 1HKGA 2P9SA 2FXUA 4RTFD 5AQRA 2V7YA 3GOIA 1P8ZA 3HI0A 4I6MB 4A2BA 2YJFA 1NGJA 3BP8A 2FSNA 4J8FA 4K43A 5ADXH 2YHWA 5AQMA 4BR0A 3TU5A 1RFQA 4BRKA 5FPDA 2CGLA 1S22A 4FOIA 2YJEA 4IZ9A 4FWRA 3H45C 3EKUA 4FPBA 5AR0A 1T44A 4JHDA 4ISFA 4F9OA 5LJWA 1TYQB 3BEXA 4H0TB 4EFHA 2PBDA 1X3MA 3FE1A 4MLHA 3RSEA 2P9KB 1SQKA 1U2VB 4FWNA 2WUSA 2AP1A 3O08A 1E4FT 5I9EB 2QWPA 4JAXA 1WOQA 3O6WA 4K41A 4MLEA 3WQUA 2CH5A 1TUYA 4HTLA 3SMPA 4B9QA 3D2FA 2Q97A 5BR9A 3FZLA 3LL3A 2V7ZA 3VEYA 3HZ6A 4BVOA 1BO5O 1BG3A 3ULEB 2IVNA 4BR7A 2A5XA 4CBXA 3LM2A 3ATVA 4BR2A 2P9LA 2E2OA 4CZLA 2DPNA 1YVNA 4Y0WA 4YDUC 1WUAA 3A0IX 5BPMA 3H1QA 3CI5A 1LCUA 3CETA 1HUXA 4FWLA 4LC9B 1H1VA 3FZFA 1OKJA 4A62A 1SZ2A 3O1BA 1HLUA 3WXJA 3DJCA 2D4WA 1V4SA 2OANA 4H5WA 3ZX3A 3ZEUA 3FLCO 2FLOA 3QBXA 1Z6RA 3DXMB 5FPEA 3VEWA 4CZHA 4WQ4A 5EVZA 4MO5A 3QBWA 2ZF5O 1EQYA 4H0PA 3C7NA 3VF6A 1X3NA 3VGLA 2BTFA 2E1YA 5AZIA 1BUPA 1QHAA 2V51B 3VEXA 3JXUA 1GLBG 2VCPA 3UKUB 2Q0RA 1SAZA 2QW9A 3MN7A 1HPMA 4BROA 4BRPA 2D1KA 1QQNA 2ASMA 3A5OC 5AQPA 5JLHA 4RWTA 1GLFO 2HF4A 5AQOA 5AQLA 4WYBA 3SK3A 1NMDA 2UYTA 3H3OB 4BQZA 5JLFA 3H1VX 3P4IA 4CJ7A 2Q1NA 3ENOA 1NGAA 2V52B 4CZEA 2NLXA 2P9PA 5F1XA 3DXKA 4EAHD 1MDUB 3BUZB 2P9NA 3I33A 1BWFO 2ZWHA 2P9IA 4FO0A 4B1XB 4CZFA 4HWIA 3WEEB 3M3ZA 1GLJO 3WXLA 4FWKA 4H0VB 3SJHA 3U8XA 5BPNA 4BRDA 2P9KA 1NBWA 1U2VA 2ASPA 3D7EO 3LDOA 4FWMA 3WXIA 1IJJA 4C23A 1DEJA 3GDQA 3AAPA 4M7XA 4O5FA 5ADXA 5EXWA 1QZ6A 1NGGA 3B8AX 1GLDG 5AQGA 4NB4A 4BC3A 3CJBA 5KPRA 2KHOA 4FOEA 3LDLA 4CZJA 4XEIA 3VF2A 1C0GA 3MN5A 5AZJA 3LDNA 4M63C 5AQUA 3A5NC 3UKRA 4B1YB 4BRHA 1XC3A 1YAGA 3QMLA 3D2EA 4Z94A 4FWSA 1T6CA 5KQDA 2ZGZA 4RCHA 3U9ZA 4BRGA 3CJCA 5AQQA 3WXKA 1KAXA 5FPMA 4WQ5C 4BRQA 2A6AA 2Q36A 4CBWA 4A61A 4EHTA 3JS6A 4CD3A 4H5VA 4JN4A 3C0BA 3H3NO 3ZETB 1XQSC 3CJ7A 3VPZA 5KPZA 1U6ZA 1ZXOA 2D0PA 1Q18A 2QWRA 1HX1A 4BREA 2I7NA 3CHWA 2Q0UA 3GL1A 3IMXA 2P9UB 3AARA 3LDPA 3O1WA 4JNEA 4WQ4C 3R6MA 5KQ8A 2E2PA 4CI6A 4BRCA 1BOTO 2FF3B 3R9PA 3UKUA 3EO3A 3IFRA 3O4WA 2A42A 1HJOA 4XH5A 4XH1A 3MN9A 1JCGA 3VEOA 1ATSA 3ID8A 3WQTA 2GTDA 4BR4A 4JD2A 3VESA 3QICA 3MK6A 1NGIA 3QFUA 2YHYA 3MCPA 2E20A 4JHDB 3MMVA 5EOYA 4BQLA 1BA1A 4BRAA 3CJ9A 4AM7A 4BRIA 1RGIA 1TUUA 2EWSA 3H6EA 3KZBA 1T6DA 3KVGA 5KPTA 3RSEB 4BC4A 5BREA 3FR0A 1BDGA 1S3XA 2Q31A 1QQMA 4PL7A 1ATRA 3L6QA 4PKIA 3HBTA 5E84A 5F0XA 5AQFA 2ZGYA 4QS8A 1X9JA 4MO4A 3O5BA 4BRLA 3D2FB 2A3ZA 4I6MA 5AQTA 1NM1A 3VGMA 2GEMA 1KAZA 3GE1A 2GWJA 4K25A 1ZBSA 2PAVA 2E2QA 5TKYA 1YUWA 2P9LB 1NGBA 4M7YA 2HOEA 1QZ5A 5FPNA 4DCHA 1TYQA 3CERA 3FGUA 4H0YB 2E88A 3H46O 3M6GA 4FWPA 4K42A 2YI1A 4PKHA 3F9MA 1LOTB 5ELZA 5AQYA 3BF3A 3HSCA 3O8MA 5AFUH 5AQXA 2GWKA 3DWLA 3ZEUB 1NGHA 3CQXA 1HKBA 4FPAA 4BRNA 3KHYA 3S41A 1V4TA 4BC5A 5AQSA 1G99A 4KBOA 5AQJA 3U9DA 2CGJA 5JICA 4BVPA 1NGFA 5AZIB 1NWKA 2QWMA 2QWNA 4IWVA 4QS7A 1HKCA 3ULEA 2QXLA 2E2NA 4DB3A 1DGKN 4PKGA 1E4GT 2VWBA 3AAQA 1R59O 1IG8A 3LM9A 3G25A 4CZMA 5LY3A 1ESVA 2NZTA 2ITMA 2YHXA 4IXCA 2F9TA 4IO8A 4ISGA 3SLCA 3W3DA 4L3QA 1GLAG 3R8EA 3A5LC 1D4XA 4CZGA 2AA4A 3FZHA 4EIAA 5AQNA 4BRMA 2P9PB 2FSJA 3DXKB 3CJ1A 1KXPA 2P9NB 4FSVA 4FL9A 2P9IB 4GY2B 5BRDA 3EL2A 4AM6A 3DXMA 3M1FA 1K8KB 3VETA 3IUCA 4B1WB 3MDQA 2HF3A 3J8AA 2H3GX 2IVOA 3CIPA 1GLLO 4NO7A 5E26A 3L0QA 1XUPO 2D0OA 3CQYA 2I7PA 4XH4A 4BC2A 3ZX0A 4H03B 1BA0A 2A41A 1NGEA 1NGCA 4H5NA 1NGDA 1C0FA 2E1ZA 3IDHA 2P9SB 1JCEA 5F2RA 4BG8A 4DHYA 1J6ZA 2E8AA 3EN9A 4DQ8A 3TPQA 5EX5A 3HM8A 3VEVA 3ENHA 2QWOA 5AQWA 1MWMA 5AQKA 1JCFA 3QDKA 5AZJB 2CGKA 3UKRB 3VEZA 3VGKA 4CD1A 1GLCG 3D2EB 3FZKA 4H5RA 3OHRA 4WQ5A 3CJAA 4BR9A 3FZMA 3W0LA 2FF6A 4BGAA 2HMPA 4FWQA 3QB0A 3WEEA 4H5TA 4B1ZA 3AY9A 2FSKA 2Q2RA 4O8KA 1MWKA 4CZIA 5CE3A 4BR5A 3UB5A 5JMVA 1QQOA 3FFKB 3EKSA 4A2AA 1BU6O 4B1UB 3EZWA 1ZC6A 1GLEG
chains in the Genus database with same CATH superfamily
3I8BA 1U48A 3ZLJA 1RDWX 4JLHA 3VERA 1ZYQA 2BGGA 4NYNA 3O3HA 3SMSA 3LAKA 1VQ8N 3VQ5A 2VYPA 4PY5A 2OTJN 1HPZA 3ID6A 1KVCA 4KHQA 4H0OA 2UXBK 3DRSA 4KHWA 4YOTA 3PIPL 4YDUA 5BN9A 4NYFA 4CJFA 1VK0A 3OS2A 4CCHA 3ZSZA 3K5LA 3VENA 3HTVA 1CZAN 3C65A 1TVRA 3P83D 1RDCA 1X9SA 1WBDA 4E7IA 1MA9B 3S9HA 1VSIA 3KWGA 4O55A 3T1AA 4CF8A 3DAWA 2HB5A 2F8TA 3ZX2A 3M8SA 1OH6A 3ZETA 1NLVA 2XO7A 3KJVA 3DOKA 4B9VA 4CF2A 4JI4K 2DTUA 4PL8A 2BUPA 2NRHA 4CIEA 2P9UA 2O8CB 4JKHA 2WONA 3C7NB 3OS0A 5LMUK 4B1VA 4OKKA 4N5SA 2ZM6K 1J5OA 1YJNN 1BL3A 1Q81O 3ISNC 5BPLA 3HM9A 4R5PA 2ATQA 5AQRA 3OBWA 3HI0A 3MCAB 4ZTJA 4K43A 4CJPA 2FSNA 1TKDA 4DTPA 5AQMA 2G8WA 1RFQA 4BRKA 2CGLA 4FJ7A 3RMAA 4IZ9A 4FWRA 2O4GA 3AVBA 3VA0A 4FPBA 3DLBA 4JHDA 3S3MA 4F9OA 2HHXA 5LJWA 4EFHA 3FE1A 4MLHA 1U2VB 4IG3A 4FWNA 2AP1A 2QWPA 3RMBA 3OYKA 1FK9A 3QLHA 4KTZA 3KIOA 2CH5A 1TUYA 2OPSA 3SMPA 1IBMK 3OYJA 4JS5A 2XRIA 4AHVA 5J1EA 3J7YP 3LL3A 3VEYA 3ZSRA 3D45A 1BO5O 1BG3A 3E66A 3V9XA 1RBSA 4CBXA 3LM2A 2P9LA 2PYJA 2W42A 2DPNA 1YVNA 4Y0WA 5MLCQ 4DF8A 4B3OA 1WUAA 2QI2A 2HHSA 2HHTA 3ZT1A 5KGXA 1H1VA 4DTOA 1OKJA 1OH8A 3VQQA 1SZ2A 4KHNA 4CJWA 3WXJA 4CK3A 3SPYA 4IOAL 1SS6A 2E4LA 2O8BB 2E6MA 1CZBA 5K14A 5GAGP 1TGOA 1KVAA 3CCEN 3V1RA 5FPEA 5HP1A 5CYMA 4DUZK 1HNVA 1BI4B 1X3NA 1RDAA 1UAXA 1BUPA 1HQUA 4X66K 4GV9A 1NK4A 1GLBG 4CEDA 2Q0RA 5JVHL 1L5UA 1S6QA 4QAGA 5FLXO 1QQNA 2ASMA 4B08A 4RWTA 5GADP 4DTUA 2HHQA 5CZ2A 2NRXA 4CEBA 1EWQA 3K9KA 4CJ7A 1VQLN 3ENOA 4CZEA 5F1XA 4ILGB 3HPGA 4I7FA 4EAHD 1S6PA 3BUZB 1N8RO 1KSPA 3I33A 4CZFA 1SKRA 4JEPA 3KKSA 3WEEB 4FJHA 1A5WA 3PX4A 1GLJO 3V1OA 2O8DA 2DFHA 4RG8A 4DR1K 1NBWA 3ZSWA 4FWMA 2RHKA 3HPOA 2RPIA 1DEJA 2YNHA 5GINA 2ZJRL 4O5FA 1VHXA 4MQ3A 1XNRK 3O9RA 3ZSOA 1HRHA 3LDNA 3SNNA 1QHTA 1X9MA 5C24A 4FJKA 2HHUA 1T3VA 1T6CA 4KH6A 1K9MO 1A5VA 2G8IA 3U9ZA 5D3GA 3CJCA 4BE2A 2A6AA 2Q36A 4A61A 2HW3A 1RT1A 3MX2A 2HHVA 3JS6A 3JAMO 1KQSM 2RF2A 4OKJA 1S9GA 3CJ7A 4CVNE 1U6ZA 4FK4A 1Q18A 4DF4A 1HX1A 1UOCA 2DY4A 5J2MA 4JRPA 1YTUA 4FK0A 4AHTA 3EY1A 2RN2A 3AARA 4JNEA 4WQ4C 4AHUA 2FF3B 2X74A 1O13A 1E3MA 4FLTA 2EHGA 3G71N 2FC0A 3PSFA 3ITHA 3NVKA 3VEOA 2IS3A 1KTQA 3ID8A 2GTDA 4G9ZA 4BR4A 1TK5A 3O9UA 1NJWA 1JL2A 1VSLA 3NFAA 2YHYA 3MCPA 3CC2N 2BH1A 1BCOA 4BRIA 3KK1A 2JWLA 1T6DA 4I2QA 2YNGA 4DTMA 3KVGA 5BREA 4E7JA 4BDPA 3FR0A 4E7HA 1S3XA 1ATRA 3L6QA 1QS4A 5F0XA 5HRNA 2G8FA 3O5BA 1O1WA 4LF4K 3K59A 4BRLA 4YORA 3NHGA 3TARA 3K2PA 2GBZA 1OVYA 2GV9A 3RR7A 3VGMA 2Z1JA 3AVNA 4CJ4A 4FLXA 3BGRA 2E2QA 4C8NA 4CK1A 2UXDK 2Z1HA 1YJWN 4LFAK 1NGBA 1RT4A 2HOEA 3PO5A 4B9TA 1QZ5A 2YNFA 5FPNA 4DCHA 3AO4A 4A5AA 1P90A 4LF7K 4JI7K 2WTUA 3LP2A 5KI6A 2O8EB 2GWKA 3DWLA 3C94A 4BRNA 2YX6A 5AJ3K 3S41A 4AF1A 3THVA 5AQSA 2ETJA 1RTIA 1BGXT 2F96A 2FBYA 4MDBA 4CEZA 1RBRA 2QKBA 1LAWA 2QWNA 4QS7A 4ZHRA 5T7BA 4GVEA 3OYNA 2XHBA 4CJEA 2UXCK 3BZKA 5LY3A 3OJUA 1G15A 1XC9A 4IXCA 2F9TA 1GLAG 1FXXA 2HSTA 3CCJN 4CZGA 2OYQA 1RDUA 4BRMA 2P9PB 3V1QA 2FSJA 1BQMA 2O8BA 3MAQA 3L3VA 4DV0K 4JKDA 2P9IB 4RW6A 5BRDA 5DK5A 1TKZA 3DM2A 3VETA 2KZZA 3J8AA 2H3GX 5H1SQ 4CJRA 4ILJA 3DLGA 1BI4A 3MWPA 4CJQA 4RW9A 1Q9XA 1ZBUA 2A41A 1I39A 1NGEA 1NK8A 1N36K 4FJJA 1NGDA 3SUNA 3O9QA 1Q9YA 1N33K 3QEWA 4FM0A 1Q7YO 4QOZB 4AHSA 4BG8A 4FYDA 4FM2A 4HUGA 2QWOA 3ZSXA 3NGYA 3PLAA 4C1NI 1ZBIA 3QDKA 3DLEA 1NK5A 3AO3A 5GAEP 2D0AA 4WCEL 5GIPA 4CD1A 3D2EB 3FZKA 3OHRA 3LP1A 3W0LA 2FF6A 1D8YA 4FWQA 3QB0A 3NDKA 3WEEA 4H5TA 4B1ZA 2Y1IA 1HNZK 3AY9A 2FSKA 4IOXA 3OYAA 4CEQA 1J53A 1F21A 1FW6A 3SQ1A 5CE3A 3IS9A 4RW7A 4PHTX 3S3OA 3EKSA 3TTFA 4KREA 4DSEA 4GKKK 4LY7A 1HNWK 4LFCK 3U6FA 3OYMA 1WNSA 3KTQA 3AA4A 3OYHA 4JKCA 2E6LA 5KGWA 2QWQA 1KRPA 1C6VA 3L4QA 2WOMA 4CHQA 2E5LK 2QM1A 3QFPA 4MDAA 4BRFA 4OJRA 5A2QO 4DR5K 5AQHA 3MN6A 4OLAA 2ASOA 2G8VA 2W40A 5AQZA 4IBNA 4ELVA 3LP0A 4AQYK 3NF9A 4E72A 3VF4A 1L3TA 4FWOA 3IRXA 4UY8O 2XY8A 2NRTA 4JI1K 3BF1A 4IJAA 2IVPA 1QQCA 4W5QA 4QS9A 4DKWA 3CM6A 3F2KA 3K58A 3L4IA 2W6LA 2W41A 4DTXA 5EY4A 4JKGB 4KTWA 3HO1A 2GUPA 4CGIA 4CFBA 3GG4A 1HKGA 2P9SA 3KKRA 4RTFD 2V7YA 3BP8A 4J8FA 5FROA 4E7LA 1S1UA 1WSEA 2BANA 3NF7A 1S22A 4FOIA 3ZCMA 3LPTA 2NUBA 4BWJA 4F4KA 3EKUA 4CJTA 3PO4A 4HCCA 4ISFA 3HP6A 1TYQB 3SAGA 3S3NA 5JS1A 3O4NA 3BEXA 1GOCA 2PBDA 4L8RB 3PX6A 1VQON 1SQKA 1C0TA 2KZMA 4K8ZA 5HRSA 1JLGA 2ZJPL 1WOQA 1DTQA 4NCAA 4G1QA 4K41A 4OX9K 3I0SA 2X78A 4JRQA 4B9QA 4DS5A 2JLEA 2Q97A 4CJKA 3NH2A 2O8FB 2YHBA 1WSHA 4BVOA 4DMNA 2HBMA 2IVNA 1DT9A 3VN5A 3KLEA 3AVCA 4HTUA 4FVUA 1RDDA 3H1QA 2B4JA 1T05A 3CETA 3OA9A 4FLWA 1UA1A 4LC9B 1IG9A 4NLBA 1EO1A 4ID1A 1VQNN 4DV4K 1YJ9N 1HLUA 3DJCA 1WLJA 2D4WA 2OANA 4DFKA 3Q7CA 2FLOA 4BDZA 4E19A 3DXMB 3RRHA 1GOAA 2IGIA 5EVZA 2ZF5O 1ZBFA 1EQYA 2IDOA 2NNWA 1KC8O 4FCYA 1IBKK 2XY6A 1HPMA 5AQPA 5JLHA 3QEPA 1NJIO 5AQLA 2I5JA 4HHTA 4CHZA 4OGEA 5J2PA 1J5EK 4ELTA 1XNQK 3PSIA 3CYGA 1NMDA 1OH5A 2DFFA 4BQZA 3H1VX 4FK2A 2P9PA 3A2FA 1FKPA 1W0HA 1LWFA 4DSLA 2P9IA 4FO0A 3TAPA 2QA4N 1TKXA 4KHYA 1HMVA 2R7YA 1R0AA 1NJZA 4H0VB 3KK3A 1RBUA 3SJHA 4DV1K 4M3ZA 4K8XA 4FZZA 4BRDA 2P9KA 2ASPA 3LDOA 1T8EA 4C23A 3AAPA 5EXWA 3RMDA 4FW1A 4KI6A 1C0UA 4GVMA 4BDYA 1D9FA 3VTHA 2KHOA 3AO2A 4Z4IA 1C0GA 1TK8A 3OYEA 4CGDA 4IG0A 4M63C 5AQUA 3CFPA 1EKEA 4Z4GA 1XC3A 4X62K 1YAGA 3D2EA 4Z94A 2OA8A 1RTHA 4FLYA 2ZGZA 4RCHA 3WXKA 1KAXA 5FPMA 4WQ5C 2DFEA 1W9HA 4CBWA 1TKTA 3WNGA 3UIQA 4CD3A 4H5VA 3C0BA 1TL3A 4DS4A 2YNIA 3CCVN 3CPWM 1N32K 3EYZA 1M90O 3J80O 3VPZA 1NOYA 3NH0A 2I7NA 3O3FA 1RT5A 3GL1A 3VQCA 1QSSA 2FBVA 4IO9L 3OTOK 5KQ8A 4ZTFA 4BRCA 2LSNA 3KLIA 2W00A 1HNIA 2A1SA 3T3FA 4LD0A 1LWCA 3SV4A 1TK0A 1K6YA 4XH1A 4DLEA 3NGIA 3C6TA 5JVGL 4Z4HA 4C8MA 5E41A 4CJ5A 2F8SA 4WFBL 2E20A 2ZJQL 3TABA 4AM7A 1UA0A 1N34K 1TUUA 2EWSA 3H6EA 3KZBA 3EEQA 1EXQA 5KPTA 2WBNA 2Q31A 1YVUA 2JWKA 5FRMA 4JKGA 4CGFA 4F3TA 3THWB 4FJMA 3EE9A 3CC7N 2ZGYA 4QS8A 3I8DA 4V19S 4MO4A 3SUOA 1TL1A 1KCFA 4DSFA 4RW8A 1IKVA 3MECA 1XHXA 2VG5A 1KAZA 2D5RA 2GWJA 2PAVA 4YOWA 2QTDA 2HMIA 4M7YA 3L3UA 3OYLA 5SWMA 4JI3K 1TYQA 3CERA 3FGUA 4H0YB 3BZCA 4HVJA 4O8UA 3M6GA 3SAHA 1QSLA 1VQPN 1VQ7N 3CMAN 1LOTB 5TKWA 3KK2A 3O8MA 3HSCA 4JKAA 5AFUH 5AQXA 4CIFA 1C1BA 2KW4A 4IDKA 1NGHA 3CQXA 3T7ZA 3KHYA 1N5YA 4WE1A 4JKFA 1V4TA 1C0MA 3C95A 4FVMA 3C6AA 3OS1A 3KD1E 4Z0UA 3DLRA 3QEXA 3AVAA 3CXCM 4FLUA 4FJ8A 1QE1A 5JICA 3SQ2A 3IAYA 1M1KO 3OW2M 2O8FA 1CZ9A 4GW6A 4DTSA 4J2BA 1DGKN 1WSIA 3P31A 1FJGK 2OZMA 3LM9A 4NCGA 4W5NA 1ESVA 3HVTA 3MWTA 4M3WA 3SUPA 2YHXA 3VQAA 4IO8A 3W3DA 1HJRA 4RW4A 5HBMA 3QNNA 4DWIA 5AQNA 4OO1J 3TAFA 4B3TK 3DXKB 4DSIA 5C2DA 2WFBA 3SYZA 4B9SA 4DR2K 2ITGA 4FL9A 4CHPA 5C12A 3JYTA 4Y1DA 3EL2A 3DXMA 5HL7L 3QEVA 1WN7A 5C10A 4JI0K 3K5NA 2D0OA 3DOLA 4XH4A 3N4PA 1REVA 1CLQA 1WSGA 4H5NA 2P9SB 4AHCA 4F2RA 1JCEA 5FRNA 4DHYA 3EN9A 4K0KK 3QIPA 3TPQA 4ID5A 5EX5A 3HM8A 3LWMA 4DFMA 4CF0A 4YOYA 3HJFA 4FJLA 5GAHP 4B8CA 1EP4A 2CGKA 4DQPA 4OLBA 1VSHA 3TWHA 1KFSA 3OBYA 2OZSA 2KFZA 4WQ5A 3CJAA 4CW7B 4NXNK 4FW2A 4DV6K 4FZYA 4DU1A 3V9SA 2Q2RA 1MWKA 4LF8K 3UB5A 3ZSQA 4M3UA 1GOBA 5CYQA 1S72N 5C15A 1BU6O 3EZWA 3NBPA 3OY9A 2NRZA 4C1NK 5LJVA 4CESA 1T03A 1Z05A 5BRHA 5AQVA 4E1JA 2ZQBA 2YCHA 4DV7K 1KAYA 1LW2A 4A5BA 3I55N 4YY3K 4GNIA 4BGBA 1YXQA 4YHHK 1HNXK 3CG7A 1U45A 4FJGA 5AFUA 1Q8IA 4N41A 4FJXA 1YTAA 4AILC 1RTJA 4BG9A 4JD2B 4GV6A 4JK8A 1J9AA 4B9LA 5J2QA 3TAEA 4FJ5A 4FXDA 3RTVA 3J7ZO 3O80A 5IWAK 2HBLA 3UE5A 5B8HA 3DLLL 1RT7A 3SBTA 3SZ2A 4ICLA 4N47A 4OPHA 4YNQA 2PYLA 2KFNA 1K8KA 5M1QA 3WNEA 1XWLA 3C6UA 4H0XB 4CF9A 4EHUA 4CZKA 3M8QA 2OPPA 1VRTA 3B6PA 4IOCL 4Z4CA 3V4IA 1W7AA 2P5GA 4KHPK 1IKWA 1S1TA 4DG1A 3TSPA 4LF6K 1P8ZA 4I6MB 3VMFB 2YJFA 1NGJA 2VQFK 5ADXH 2VG7A 2YHWA 1KVBA 4BR0A 3OYFA 5C2FA 4KI4A 3QESA 3K57A 3NF6A 3V9ZA 1T44A 3MXIA 1X3MA 1EX4A 3MEGA 2P5OA 4N56A 2P9KB 4C8KA 3O08A 5I9EB 3THWA 3V9UA 3O6WA 1CXUA 4MLEA 3WQUA 1FKOA 3AA3A 3HSTB 3AVMA 5DM6L 3QIOA 4E0DA 3FZLA 2V7ZA 2KQ2A 2VGNA 3HZ6A 3D0PA 4H4OA 2XY5A 4DLGA 3ZSYA 1JXEA 1SUQA 4Z4EA 2E2OA 4CZLA 3O3GA 1VSKA 4PUOA 4YDUC 1BIUA 2IAJA 4M3RA 5BPMA 4CJLA 1JLBA 1JLQA 1HUXA 4FWLA 3TAQA 3NAEA 1TAUA 3FZFA 1S5JA 1QSYA 3SUQA 1RILA 4A62A 3RVCA 1JJ2M 4DU4A 3O1BA 4KAZA 3QEIA 3I56N 1V4SA 3TSQA 3CCRN 4LH5A 3QBXA 1TV6A 2X6SA 4YOVA 4E1NA 2D0CA 4WQ4A 3V9WA 4QCLA 5DM7L 4KHSA 4H0PA 3TSUA 3VF6A 1Q86O 2HHIA 1JLEA 3VEXA 2VCPA 4I9LA 2QW9A 5SZTA 4DV5K 1OH7A 4BROA 4BRPA 2D1KA 4WFNL 4F2SA 3OYBA 1GLFO 3L2WA 5AQOA 1DLOA 4WYBA 1K8AO 3ULDA 3SK3A 5BR8K 3VQ9A 2NRWA 3CPEA 2UYTA 5JLFA 2F7TA 2OPQA 3P4IA 2AJQA 3SQ4A 2P51A 1KLMA 2NLXA 3K9JA 3DXKA 1VSDA 1MU2A 3OYIA 4B1XB 2G8HA 1U4BA 4YOUA 3M3ZA 3AVJA 2XY7A 3WXLA 4FWKA 4O4GA 3CM5A 5BPNA 1D9DA 3PIOL 3SCXA 3CFRA 3WXIA 3PY8A 3PV8A 1IJJA 5ADXA 3O4QA 1GLDG 4YOXA 4DQRA 4BC3A 4O0IA 1RT3A 1RNHA 4CHNA 5KRTA 5J2NA 4FOEA 3LDLA 4X64K 2G8UA 4XEIA 3E01A 2B5JA 4OPAA 1IV0A 3MN5A 4R79A 3VA3A 4B1YB 3VQ6A 3L2UA 3TAGA 3L2VA 3QMLA 4GV3A 3OYGA 3CCQN 1RTDA 4FWSA 3AO1A 5KQDA 4BRGA 4BRQA 1NK7A 4EHTA 1XMQK 3TTCA 1JXBA 4JN4A 1YF5L 3VQ8A 3H3NO 4LSLA 2WC9A 1XQSC 2UUBK 3AO5A 1Q82O 1EETA 2YKNA 2Q0UA 1RBVA 3IMXA 4JI6K 3NF8A 3NCIA 3AA2A 4DQIA 3O1WA 2E2PA 5HROA 3T1HK 2GX9A 3UKUA 4LFBK 4B8AB 4B3RK 3IFRA 5FDLA 2C1IA 2A42A 1HJOA 3G6EN 2RKIA 3MN9A 1ATSA 5C42A 1S1WA 4JD2A 1JLAA 3VESA 1BISA 1JLCA 2Q3SA 3R1XA 2B6AA 4LF5K 3ZT2A 3I0RA 4M45A 3MMVA 4BRAA 4BQLA 1BA1A 5M1FA 1VQMN 1WSFA 3DMJA 3M8RA 4JV5K 1NMNA 4M3YA 1IO2A 1QTMA 4CERA 3RSEB 3B6OA 1JL1A 1QQMA 4PL7A 4CECA 3ZSVA 4PKIA 3DI6A 5E84A 3U3YA 1X9JA 1QVFM 2QK9A 4CFCA 1VQ4N 3D2FB 4HUEA 2A3ZA 4I6MA 5AQTA 4HUFA 1VAZA 1IBLK 3GE1A 4BACA 1ZBSA 1KFDA 2VQEK 4DFJA 4MFBA 4DR3K 1YUWA 2YKMA 1A5XA 4KKOA 4UQGA 1WB9A 1B9FA 2E88A 3H46O 3SAFA 3F73A 5M1OA 4NLCA 4PKHA 3F9MA 3C6HA 4AH9A 3ZEUB 4FPAA 1HKBA 4I2PA 3CF5L 3LZJA 4BC5A 1Y97A 4TSXA 1NKCA 3SBGA 3ZYYX 3OYCA 3BY5A 3QINA 4DFPA 5AZIB 3E1YA 2QWMA 1OVQA 2RE2A 3MXMA 4IWVA 3EZ5A 2E2NA 3KLHA 4DTRA 3QETA 2VWBA 3THXA 1R59O 4W5OA 3M5RA 4CZMA 3CCSN 4Q0BA 2NZTA 4CJUA 3SLCA 3ASMA 3ALYA 3R8EA 3A5LC 1D4XA 3P38A 4OPJA 2AA4A 3WXMB 3J81O 1CXQA 3THYB 4FJ9A 5KTQA 3CJ1A 4OKEA 2P9NB 4FSVA 3P1GA 4FLZA 4GY2B 5DMRA 1YI2N 3Q7BA 4E7KA 1K8KB 3AVLA 3TTDA 4B1WB 3MDQA 2HF3A 2IVOA 3CIPA 1SL0A 1GLLO 4NO7A 5E26A 4KHUA 2I7PA 4BC2A 3LZIA 2D0BA 3TI0A 3ZX0A 2JGUA 4H03B 2VWJA 1ILYA 1Z26A 4XJXA 3IG1A 4DTJA 4CJVA 3IDHA 1X9WA 1S1XA 3AVKA 4Y1CA 1BQNA 1J6ZA 2VG6A 3AGKA 2BDPA 1NK0A 3ENHA 1JCFA 5M1KA 4U7BA 5AZJB 3LDSA 3F5TA 3UKRB 3DLKA 3QO9A 5HRRA 3VGKA 4O0JA 1GLCG 3VQEA 3CC4N 3P5JA 4DQSA 4BR9A 4CGHA 1LW0A 4JKEA 2HMPA 1I94K 1X1PA 4JK7A 3SQ0A 3E9OA 3T19A 4JI2K 4BR5A 2PFUA 1QQOA 3S5TA 4A2AA 4DUYK 4B1UB 3HRGA 4DR7K 1C1CA 1GLEG 1ZBLA 2KKZA 4JYAK 2GUIA 2A40A 1WSJA 2GELA 3RRGA 4CBUA 2YHAA 3P39A 3ATUA 4J2EA 5AQIA 3T1YK 1VSMA 3WT0A 1C1AA 3G4SN 2QWLA 3HL8A 4X65K 3GBTA 2PY5A 4O44A 1ATNA 4Z4FA 1Y64A 2CH6A 3A5MC 3IKMA 1RDBA 2C1GA 5BRFA 3QNOA 3U4LA 3A8YA 3VQ7A 1ASVA 3DYAA 3O9TA 1L3SA 1B92A 4CGJA 3V81A 4IJNA 1TAQA 4BY9C 4C8LA 2BE2A 3N4QA 2IIRA 3M8PA 3WNFA 3WUHA 3QERA 3DLHA 4KH5A 1DKGD 3VOVA 2J4RA 5BN8A 1VQ9N 4CEEA 4ISEA 4KH4A 4BECA 3LDQA 1U47A 1VQ6N 2UUCK 1LV5A 2F9WA 3O9SA 4GKJK 4AHRA 2FXUA 3FFIA 3GOIA 5JENA 4CK2A 1SKSA 4A2BA 1HYVA 3ZT4A 3TU5A 4KPYA 5FPDA 3HYFA 1LWEA 2W6KA 2YJEA 3SV3A 4CF1A 3NGZA 3H45C 1W97L 5AR0A 4YFUA 2HBKA 1NOZA 4H0TB 3L2RA 4NCBA 4ILHA 1RT2A 3RSEA 3SI6A 5LMNK 1YITN 4CJ3A 3R3LA 1HYZA 3HP9A 2WUSA 1E4FT 4KO0A 1VSJA 4HCBA 3CCLN 3CFOA 4JAXA 3CCMN 4DSJA 4HTLA 5GIOA 5M1PA 3WNHA 3D2FA 3K0SA 3HOTA 5BR9A 5CHIA 5CR4A 4DV2K 3ULEB 3NE6A 2Z1IA 4BR7A 2A5XA 1WAJA 1I3AA 3ATVA 4BR2A 3G0ZA 5M1NA 4DR6K 3MX5A 4OVLA 4W5RA 3A0IX 3MEEA 3CI5A 1LCUA 2FBTA 3L8BA 1U04A 1SKWA 2KTQA 1HQEA 4CGGA 4B9MA 5KRSA 3OYDA 4H5WA 3ZX3A 1KLNA 3ZEUA 4KV8A 1NJXA 1S1VA 3FLCO 4E89A 2QKKA 5LL6Z 5HOOA 3K5OA 4LSNA 4M3XA 1Z6RA 3VQBA 3VEWA 4CZHA 2IC3A 4MO5A 3QBWA 3BDPA 3MEDA 4H8KA 2O8CA 3C7NA 4DV3K 3VGLA 2BTFA 2E1YA 2HNYA 1QHAA 2V51B 3CYMA 5AZIA 3JXUA 4EP5A 4N76A 3ENBA 3UKUB 1SAZA 3MN7A 4JK9A 3KD5E 3A5OC 2HF4A 4OGCA 4W5TA 3CQ8A 2QEXN 4B3MK 3RMCA 4IDHA 3TR8A 3RWUA 2Z1GA 4IFYA 5CZ1A 3H3OB 3T69A 4OPKA 4F8RA 2Q1NA 1NGAA 1UWBA 2V52B 3L2QA 1EWRA 3CMEN 1IKXA 3PUFA 4FJNA 3THYA 1MDUB 3LALA 3AVGA 2P9NA 1L3VA 1BWFO 3LP3A 2ZWHA 4IEEA 2A1RA 4HWIA 1J54A 1HYSA 1NKEA 1W2BM 4O5BA 4JKBA 1ZBHA 3U8XA 2F4VK 3OVNA 1U2VA 2ZE2A 3D7EO 4DSKA 3GDQA 3KWIA 4M7XA 1ASUA 1LAVA 1QZ6A 1NGGA 3B8AX 2HHWA 3VTIA 1U49A 5AQGA 4NB4A 1NU0A 3CJBA 3DRRA 2NRRA 5I3UA 1D5AA 4F3OA 5KPRA 4CZJA 4PQUA 4CE9A 3VF2A 4NXMK 3HT3A 5AZJA 4J2AA 4IKFA 1N6QA 3A5NC 3UKRA 4BRHA 3NVMA 1RT6A 4EZ9A 2HNZA 4E3SA 1IH7A 1VSFA 4BWMA 5AQQA 3AV9A 2VGMA 3ZT3A 3HK2A 2G8KA 4BEBA 1S9EA 4CEOA 3ZETB 2Y1JA 5KPZA 3HOSA 1ZXOA 2D0PA 3EE8A 2QWRA 4BREA 3E9PA 4Q5VA 3CHWA 2P9UB 1BHLA 5C25A 2PZSA 1YHQN 5I42A 5HLFA 3LDPA 2UUAK 1RCHA 3R6MA 4CI6A 1BOTO 3H08A 4WF9L 3R9PA 3EO3A 2FBXA 4KB0A 1SL2A 3O4WA 4BE1A 3THXB 4EZ6A 3LANA 1NJYA 4XH5A 3KK7A 1JCGA 5C0YA 4B9UA 4B9NA 3WQTA 1NG9A 3U3GA 4H4MA 2OCEA 3QICA 4CJSA 1XMOK 3MK6A 5JS2A 3HXMA 1NGIA 4U67L 3QFUA 3NMUA 4FJIA 3KLFA 1WAFA 4JHDB 5EU7A 2X6NA 5EOYA 1JKHA 2VWKA 3CJ9A 1KD1O 1RGIA 4FLVA 4BC4A 4EP4A 4DQQA 1K73O 2UU9K 3CD6N 1BDGA 4C8OA 3LPUA 3HBTA 3RR8A 5AQFA 2NRVA 5HRPA 4M3TA 1VQ5N 4LF9K 1ITGA 1JLFA 3TANA 3V6DA 1BIZA 4WFAL 4LH4A 1NM1A 4BE0A 1QVGM 3F9KA 4CFAA 1VQKN 2GEMA 3AVHA 3VQ4A 1XI1A 1DTTA 4KRFA 4K25A 4CEAA 1SV5A 5TKYA 3SJJA 3AVFA 1IKYA 1L3UA 2O4IA 4XIUA 2P9LB 3HPHA 4IFVA 4IEIA 3MXJA 1T7PA 4FZXC 3J7AP 4A57A 1YIJN 4FWPA 4K42A 4DU3A 1NNEA 2HNDA 2YI1A 3G10A 5ELZA 1YT3A 2P1JA 5AQYA 3BF3A 3OJSA 3AVIA 1B9DA 4J2DA 1VRUA 3NH1A 4IFEA 4CHYA 1RBTA 4M41A 3VQDA 4CFDA 3TAMA 1G99A 4KBOA 2OPRA 5AQJA 4DTNA 3U9DA 2CGJA 4BVPA 1NGFA 1NWKA 3SPZA 4KB1A 2HBJA 3CCUN 4ELUA 4M42A 1HKCA 3ULEA 2QXLA 5IT9O 4DB3A 4PKGA 4I9QA 1E4GT 1WBBA 3AAQA 1NK9A 1VSEA 1IG8A 3PX0A 4JI5K 3G25A 2ITMA 3HVRA 4ISGA 4L3QA 3FZHA 4EIAA 2YV0X 4JI8K 2QXFA 4KFBA 1ASWA 4B3SK 2ZD1A 1KXPA 1Z25A 3KLGA 3E9LA 4GMJB 4FM1A 3K5MA 4AM6A 3M1FA 3AA5X 3IUCA 4DR4K 4A59A 2O8DB 4PA1A 4PWDA 3L0QA 1XUPO 3CQYA 1BA0A 3VQPA 1NGCA 1BCMA 1C0FA 2E1ZA 5CY4A 2EX3A 5F2RA 4BE7B 2HVIA 2E8AA 4DQ8A 3VEVA 1HR0K 5AQWA 1MWMA 3DRPA 5AQKA 4CIGA 3LWLA 3AGRA 3VEZA 4JS4A 1SL1A 1NK6A 2KLAA 4H5RA 1NKBA 3FZMA 4BGAA 3ZT0A 2OTLN 2HHHK 3D6RA 4O8KA 3JSMA 4CZIA 4KTQA 1XHZA 5JMVA 4CHOA 2IOCA 2O8EA 3LAMA 4CEFA 3FFKB 2HVHA 1ZC6A 4E1MA
chains in the Genus database with same CATH topology
2NRZA 3I8BA 4C1NK 1RDWX 5LJVA 3VERA 2A40A 3SMSA 2GELA 1VQ8N 1Z05A 3P39A 4CBUA 3ATUA 5BRHA 2VYPA 5AQIA 5AQVA 2OTJN 4JKCA 4E1JA 3WT0A 3ID6A 4H0OA 2YCHA 1KAYA 2QWQA 4A5BA 3L4QA 4YOTA 3I55N 4GNIA 4YDUA 3PIPL 5BN9A 3G4SN 4BGBA 2QWLA 2QM1A 3QFPA 1YXQA 4MDAA 4BRFA 3VENA 5AFUA 3HTVA 1CZAN 3C65A 3GBTA 1ATNA 5AQHA 1Y64A 2CH6A 3MN6A 3A5MC 1MA9B 3IKMA 4BG9A 4JD2B 3KWGA 4GV6A 4JK8A 2ASOA 2C1GA 3DAWA 2W40A 5AQZA 5BRFA 3U4LA 3ZX2A 3A8YA 3O9TA 3ZETA 3J7ZO 3O80A 3VF4A 1NLVA 4IJNA 4BY9C 2HBLA 3UE5A 3N4QA 5B8HA 2IIRA 3WUHA 4PL8A 4FWOA 3DLLL 4UY8O 4KH5A 2NRTA 3SBTA 2BUPA 2NRHA 3BF1A 1DKGD 4IJAA 4OPHA 2P9UA 2IVPA 3VOVA 2J4RA 4JKHA 1K8KA 3C7NB 5M1QA 4QS9A 4DKWA 4H0XB 5BN8A 1VQ9N 3F2KA 4B1VA 4CZKA 3L4IA 4EHUA 4ISEA 2W41A 4KH4A 4BECA 5EY4A 3LDQA 4IOCL 4JKGB 1VQ6N 1YJNN 2F9WA 1Q81O 2GUPA 5BPLA 3O9SA 3GG4A 1HKGA 2P9SA 2FXUA 3TSPA 4RTFD 5AQRA 2V7YA 3GOIA 1P8ZA 3HI0A 3MCAB 3OBWA 4I6MB 3VMFB 2YJFA 1NGJA 3BP8A 2FSNA 4J8FA 4K43A 4A2BA 5ADXH 2YHWA 5AQMA 4BR0A 3TU5A 5C2FA 1RFQA 4BRKA 5FPDA 2CGLA 1S22A 4FOIA 2YJEA 4IZ9A 4FWRA 3H45C 3EKUA 1W97L 4FPBA 5AR0A 1T44A 4JHDA 4ISFA 4F9OA 5LJWA 1TYQB 3SAGA 2HBKA 3BEXA 4H0TB 4EFHA 2PBDA 1X3MA 4ILHA 3FE1A 1VQON 4MLHA 3RSEA 2P9KB 1SQKA 1U2VB 1YITN 4FWNA 3R3LA 2WUSA 2AP1A 3O08A 1E4FT 5I9EB 2QWPA 3CCLN 4JAXA 1WOQA 3O6WA 2ZJPL 3CCMN 4K41A 4MLEA 3WQUA 2CH5A 1TUYA 4HTLA 3SMPA 5GIOA 5M1PA 4B9QA 5DM6L 3D2FA 2Q97A 3HOTA 5BR9A 3FZLA 5CHIA 5CR4A 3LL3A 2V7ZA 3VEYA 2VGNA 3HZ6A 4BVOA 1BO5O 1BG3A 2HBMA 3E66A 2IVNA 3ULEB 4BR7A 2A5XA 1DT9A 4CBXA 3LM2A 3ATVA 4BR2A 2P9LA 2E2OA 4CZLA 5M1NA 2DPNA 1YVNA 3MX5A 4Y0WA 4YDUC 5MLCQ 1WUAA 2QI2A 4FVUA 3A0IX 5BPMA 3H1QA 3CI5A 1LCUA 3CETA 3OA9A 1HUXA 4FWLA 4LC9B 4NLBA 1H1VA 3FZFA 1EO1A 1VQNN 1OKJA 4A62A 3RVCA 1JJ2M 1YJ9N 1SZ2A 3O1BA 1HLUA 3WXJA 3DJCA 2D4WA 1V4SA 2OANA 4H5WA 3TSQA 3ZEUA 3ZX3A 3I56N 4IOAL 1SS6A 3CCRN 3FLCO 5GAGP 3Q7CA 2FLOA 5HOOA 3CCEN 3QBXA 1Z6RA 4YOVA 3DXMB 5FPEA 3VEWA 4CZHA 4WQ4A 5EVZA 4MO5A 3QBWA 2ZF5O 5DM7L 1EQYA 4H0PA 3TSUA 3C7NA 3VF6A 1X3NA 3VGLA 1Q86O 2BTFA 2E1YA 5AZIA 1BUPA 1QHAA 2V51B 2NNWA 3JXUA 3VEXA 1KC8O 1GLBG 3ENBA 2VCPA 4GV9A 3UKUB 2Q0RA 1SAZA 2QW9A 3MN7A 4JK9A 5JVHL 1HPMA 4BROA 4BRPA 2D1KA 4WFNL 1QQNA 2ASMA 3A5OC 5AQPA 5JLHA 4RWTA 1NJIO 1GLFO 2HF4A 5AQOA 5AQLA 5GADP 2QEXN 4WYBA 1K8AO 4IDHA 2NRXA 3SK3A 2NRWA 3CPEA 1NMDA 2UYTA 3H3OB 3T69A 4BQZA 5JLFA 2F7TA 3H1VX 3K9KA 3P4IA 2Q1NA 4CJ7A 1VQLN 3ENOA 1NGAA 2V52B 3CMEN 4CZEA 2NLXA 2P9PA 3K9JA 5F1XA 3DXKA 4ILGB 4EAHD 1MDUB 3BUZB 1N8RO 2P9NA 3I33A 1BWFO 2ZWHA 2P9IA 4FO0A 4IEEA 4B1XB 4CZFA 2QA4N 4HWIA 4JEPA 3WEEB 4YOUA 3M3ZA 1GLJO 3WXLA 1W2BM 4FWKA 4H0VB 4JKBA 3SJHA 3U8XA 5BPNA 4BRDA 3PIOL 2P9KA 1NBWA 1U2VA 2ASPA 3D7EO 3LDOA 4FWMA 2RHKA 3WXIA 1IJJA 4C23A 1DEJA 3GDQA 5GINA 2ZJRL 3AAPA 3KWIA 4M7XA 4O5FA 5ADXA 5EXWA 1QZ6A 1NGGA 3B8AX 3VTIA 1GLDG 4YOXA 5AQGA 4NB4A 4BC3A 3CJBA 2NRRA 5KPRA 3VTHA 2KHOA 4FOEA 3LDLA 4CZJA 4XEIA 3VF2A 3O9RA 4OPAA 1C0GA 3MN5A 5AZJA 3LDNA 4R79A 4M63C 5AQUA 3A5NC 3UKRA 4B1YB 4BRHA 1XC3A 1YAGA 3QMLA 4GV3A 3D2EA 1T3VA 4Z94A 3NVMA 3CCQN 4FWSA 1T6CA 5KQDA 4KH6A 1K9MO 2ZGZA 4RCHA 3U9ZA 4BRGA 3CJCA 5AQQA 3WXKA 1KAXA 5FPMA 4WQ5C 4BRQA 2A6AA 2Q36A 4CBWA 4A61A 2VGMA 4EHTA 3MX2A 3TTCA 3JS6A 4BEBA 4CD3A 4H5VA 4JN4A 3C0BA 1KQSM 1YF5L 3H3NO 3ZETB 3CCVN 2WC9A 3CPWM 1XQSC 3CJ7A 1M90O 3VPZA 5KPZA 3HOSA 1U6ZA 1ZXOA 2D0PA 3EE8A 1Q18A 2QWRA 1HX1A 4BREA 3E9PA 2I7NA 1Q82O 3CHWA 2Q0UA 3GL1A 3IMXA 2P9UB 1YHQN 3AARA 3LDPA 3O1WA 4JNEA 4WQ4C 3R6MA 4IO9L 5KQ8A 2E2PA 4CI6A 4BRCA 1BOTO 2FF3B 2GX9A 3R9PA 1O13A 3UKUA 4WF9L 3EO3A 2W00A 3IFRA 3O4WA 2C1IA 2A42A 1HJOA 3G71N 4XH5A 3KK7A 4XH1A 3G6EN 3MN9A 1JCGA 3VEOA 3NVKA 5C0YA 1ATSA 3ID8A 3WQTA 2GTDA 4G9ZA 4BR4A 4JD2A 3VESA 5JVGL 3O9UA 3QICA 3MK6A 1NGIA 3R1XA 4U67L 3QFUA 2YHYA 3MCPA 3NMUA 3CC2N 2BH1A 4WFBL 2E20A 4JHDB 2ZJQL 3MMVA 5EOYA 4BQLA 1BA1A 4BRAA 3CJ9A 4AM7A 4BRIA 5M1FA 1KD1O 1RGIA 1VQMN 1TUUA 2EWSA 3H6EA 3KZBA 2JWLA 1T6DA 3KVGA 5KPTA 3RSEB 4BC4A 5BREA 1K73O 2WBNA 3FR0A 3CD6N 1BDGA 1S3XA 2Q31A 1QQMA 4PL7A 1ATRA 2JWKA 3L6QA 4PKIA 3HBTA 4JKGA 5E84A 5F0XA 3EE9A 5AQFA 3CC7N 2ZGYA 4QS8A 2NRVA 1X9JA 1QVFM 1VQ4N 1VQ5N 4MO4A 3O5BA 4BRLA 3D2FB 4YORA 2A3ZA 4I6MA 5AQTA 4WFAL 1QVGM 1NM1A 1OVYA 3VGMA 1VQKN 2GEMA 1VAZA 1KAZA 3GE1A 2GWJA 4K25A 1ZBSA 2PAVA 2E2QA 5TKYA 4YOWA 1YUWA 1YJWN 2QTDA 2P9LB 1NGBA 4M7YA 2HOEA 4IEIA 1QZ5A 5FPNA 4DCHA 4A57A 1YIJN 1TYQA 3CERA 3FGUA 4H0YB 2E88A 4O8UA 3H46O 3SAFA 3M6GA 4FWPA 4K42A 3SAHA 4A5AA 1P90A 5M1OA 4NLCA 2YI1A 1VQPN 1VQ7N 4PKHA 3F9MA 1LOTB 5ELZA 5TKWA 3CMAN 5AQYA 3BF3A 3C6HA 3HSCA 3O8MA 4JKAA 5AQXA 5AFUH 2GWKA 3DWLA 3ZEUB 1NGHA 3CQXA 1HKBA 4FPAA 3T7ZA 4BRNA 3KHYA 2YX6A 4JKFA 3CF5L 4IFEA 1V4TA 3S41A 4BC5A 4AF1A 5AQSA 3C6AA 1G99A 3SBGA 4KBOA 3ZYYX 4MDBA 5AQJA 3U9DA 3CXCM 2CGJA 5JICA 4BVPA 1NGFA 5AZIB 1NWKA 2QWMA 3E1YA 3OW2M 2HBJA 1M1KO 3CCUN 2RE2A 2QWNA 4IWVA 4QS7A 1HKCA 3ULEA 2QXLA 2E2NA 4GVEA 4DB3A 1DGKN 4PKGA 1E4GT 2VWBA 3AAQA 3P31A 1R59O 1IG8A 3LM9A 3G25A 3M5RA 4CZMA 5LY3A 1ESVA 3MWTA 2NZTA 3CCSN 2ITMA 2YHXA 4IXCA 2F9TA 4IO8A 4ISGA 3SLCA 3W3DA 4L3QA 1GLAG 3R8EA 2HSTA 3A5LC 1D4XA 3CCJN 3P38A 4CZGA 2AA4A 3FZHA 4EIAA 3WXMB 5AQNA 4OO1J 1RDUA 4BRMA 2P9PB 2FSJA 3DXKB 3CJ1A 5C2DA 2WFBA 1KXPA 2P9NB 4FSVA 4JKDA 4FL9A 2P9IB 5C12A 4GY2B 3E9LA 5BRDA 1YI2N 3Q7BA 3EL2A 4AM6A 3DXMA 3M1FA 1K8KB 3VETA 3IUCA 3TTDA 3MDQA 4B1WB 2HF3A 4A59A 5HL7L 3J8AA 2H3GX 5H1SQ 2IVOA 3CIPA 1GLLO 4ILJA 4NO7A 5E26A 5C10A 3L0QA 3MWPA 1XUPO 2D0OA 3CQYA 2I7PA 4XH4A 3N4PA 4BC2A 3ZX0A 4H03B 1ILYA 1BA0A 2A41A 1NGEA 1NGCA 4H5NA 1NGDA 4XJXA 1C0FA 3O9QA 2E1ZA 3IDHA 2P9SB 1Q7YO 1JCEA 5F2RA 4BG8A 4BE7B 4DHYA 1J6ZA 2E8AA 3EN9A 4DQ8A 3AGKA 3TPQA 5EX5A 3HM8A 3VEVA 3ENHA 2QWOA 4YOYA 3PLAA 5AQWA 4C1NI 1MWMA 5AQKA 1JCFA 3QDKA 5M1KA 5AZJB 5GAHP 4U7BA 5GAEP 3F5TA 2CGKA 4WCEL 3AGRA 3UKRB 3VEZA 5GIPA 3VGKA 4CD1A 1GLCG 3CC4N 3D2EB 3FZKA 3OBYA 2KLAA 4H5RA 3OHRA 4WQ5A 3CJAA 4BR9A 3FZMA 3W0LA 2FF6A 4JKEA 4BGAA 2HMPA 4FWQA 3QB0A 3WEEA 4H5TA 4B1ZA 4JK7A 3AY9A 2FSKA 4IOXA 2OTLN 2Q2RA 3D6RA 3E9OA 4O8KA 1MWKA 4CZIA 5CE3A 4BR5A 2PFUA 3UB5A 5JMVA 1QQOA 4PHTX 3FFKB 3EKSA 3TTFA 4A2AA 5C15A 1BU6O 4B1UB 3EZWA 3HRGA 1S72N 1ZC6A 1GLEG 2KKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I8B A;  1RDW X;  5LJV A;  3VER A;  2A40 A;  3SMS A;  2GEL A;  1Z05 A;  4CBU A;  3ATU A;  5BRH A;  2VYP A;  5AQI A;  5AQV A;  4E1J A;  3WT0 A;  4H0O A;  2YCH A;  1KAY A;  2QWQ A;  4GNI A;  4YDU A;  5BN9 A;  4BGB A;  2QWL A;  2QM1 A;  3QFP A;  1YXQ A;  4BRF A;  3VEN A;  5AFU A;  3HTV A;  1CZA N;  3GBT A;  1ATN A;  5AQH A;  1Y64 A;  2CH6 A;  3MN6 A;  3A5M C;  1MA9 B;  4BG9 A;  4JD2 B;  2ASO A;  3DAW A;  2W40 A;  5AQZ A;  5BRF A;  3U4L A;  3ZX2 A;  3A8Y A;  3ZET A;  3O80 A;  3VF4 A;  1NLV A;  4IJN A;  3UE5 A;  5B8H A;  2IIR A;  3WUH A;  4PL8 A;  4FWO A;  3BF1 A;  2BUP A;  2NRH A;  1DKG D;  4IJA A;  2P9U A;  2IVP A;  3VOV A;  2J4R A;  1K8K A;  3C7N B;  4QS9 A;  4H0X B;  5BN8 A;  4B1V A;  4CZK A;  3L4I A;  4EHU A;  4ISE A;  2W41 A;  5EY4 A;  3LDQ A;  2F9W A;  2GUP A;  5BPL A;  3GG4 A;  1HKG A;  2P9S A;  2FXU A;  4RTF D;  5AQR A;  2V7Y A;  3GOI A;  1P8Z A;  3HI0 A;  4I6M B;  4A2B A;  2YJF A;  1NGJ A;  3BP8 A;  2FSN A;  4J8F A;  4K43 A;  5ADX H;  2YHW A;  5AQM A;  4BR0 A;  3TU5 A;  1RFQ A;  4BRK A;  5FPD A;  2CGL A;  1S22 A;  4FOI A;  2YJE A;  4IZ9 A;  4FWR A;  3H45 C;  3EKU A;  4FPB A;  5AR0 A;  1T44 A;  4JHD A;  4ISF A;  4F9O A;  5LJW A;  1TYQ B;  3BEX A;  4H0T B;  4EFH A;  2PBD A;  1X3M A;  3FE1 A;  4MLH A;  3RSE A;  2P9K B;  1SQK A;  1U2V B;  4FWN A;  2WUS A;  2AP1 A;  3O08 A;  1E4F T;  5I9E B;  2QWP A;  4JAX A;  1WOQ A;  3O6W A;  4K41 A;  4MLE A;  3WQU A;  2CH5 A;  1TUY A;  4HTL A;  3SMP A;  4B9Q A;  3D2F A;  2Q97 A;  5BR9 A;  3FZL A;  3LL3 A;  2V7Z A;  3VEY A;  3HZ6 A;  4BVO A;  1BO5 O;  1BG3 A;  3ULE B;  2IVN A;  4BR7 A;  2A5X A;  4CBX A;  3LM2 A;  3ATV A;  4BR2 A;  2P9L A;  2E2O A;  4CZL A;  2DPN A;  1YVN A;  4Y0W A;  4YDU C;  1WUA A;  3A0I X;  5BPM A;  3H1Q A;  3CI5 A;  1LCU A;  3CET A;  1HUX A;  4FWL A;  4LC9 B;  1H1V A;  3FZF A;  1OKJ A;  4A62 A;  1SZ2 A;  3O1B A;  1HLU A;  3WXJ A;  3DJC A;  2D4W A;  1V4S A;  2OAN A;  4H5W A;  3ZX3 A;  3ZEU A;  3FLC O;  2FLO A;  3QBX A;  1Z6R A;  3DXM B;  5FPE A;  3VEW A;  4CZH A;  4WQ4 A;  5EVZ A;  4MO5 A;  3QBW A;  2ZF5 O;  1EQY A;  4H0P A;  3C7N A;  3VF6 A;  1X3N A;  3VGL A;  2BTF A;  2E1Y A;  5AZI A;  1BUP A;  1QHA A;  2V51 B;  3VEX A;  3JXU A;  1GLB G;  2VCP A;  3UKU B;  2Q0R A;  1SAZ A;  2QW9 A;  3MN7 A;  1HPM A;  4BRO A;  4BRP A;  2D1K A;  1QQN A;  2ASM A;  3A5O C;  5AQP A;  5JLH A;  4RWT A;  1GLF O;  2HF4 A;  5AQO A;  5AQL A;  4WYB A;  3SK3 A;  1NMD A;  2UYT A;  3H3O B;  4BQZ A;  5JLF A;  3H1V X;  3P4I A;  4CJ7 A;  2Q1N A;  3ENO A;  1NGA A;  2V52 B;  4CZE A;  2NLX A;  2P9P A;  5F1X A;  3DXK A;  4EAH D;  1MDU B;  3BUZ B;  2P9N A;  3I33 A;  1BWF O;  2ZWH A;  2P9I A;  4FO0 A;  4B1X B;  4CZF A;  4HWI A;  3WEE B;  3M3Z A;  1GLJ O;  3WXL A;  4FWK A;  4H0V B;  3SJH A;  3U8X A;  5BPN A;  4BRD A;  2P9K A;  1NBW A;  1U2V A;  2ASP A;  3D7E O;  3LDO A;  4FWM A;  3WXI A;  1IJJ A;  4C23 A;  1DEJ A;  3GDQ A;  3AAP A;  4M7X A;  4O5F A;  5ADX A;  5EXW A;  1QZ6 A;  1NGG A;  3B8A X;  1GLD G;  5AQG A;  4NB4 A;  4BC3 A;  3CJB A;  5KPR A;  2KHO A;  4FOE A;  3LDL A;  4CZJ A;  4XEI A;  3VF2 A;  1C0G A;  3MN5 A;  5AZJ A;  3LDN A;  4M63 C;  5AQU A;  3A5N C;  3UKR A;  4B1Y B;  4BRH A;  1XC3 A;  1YAG A;  3QML A;  3D2E A;  4Z94 A;  4FWS A;  1T6C A;  5KQD A;  2ZGZ A;  4RCH A;  3U9Z A;  4BRG A;  3CJC A;  5AQQ A;  3WXK A;  1KAX A;  5FPM A;  4WQ5 C;  4BRQ A;  2A6A A;  2Q36 A;  4CBW A;  4A61 A;  4EHT A;  3JS6 A;  4CD3 A;  4H5V A;  4JN4 A;  3C0B A;  3H3N O;  3ZET B;  1XQS C;  3CJ7 A;  3VPZ A;  5KPZ A;  1U6Z A;  1ZXO A;  2D0P A;  1Q18 A;  2QWR A;  1HX1 A;  4BRE A;  2I7N A;  3CHW A;  2Q0U A;  3GL1 A;  3IMX A;  2P9U B;  3AAR A;  3LDP A;  3O1W A;  4JNE A;  4WQ4 C;  3R6M A;  5KQ8 A;  2E2P A;  4CI6 A;  4BRC A;  1BOT O;  2FF3 B;  3R9P A;  3UKU A;  3EO3 A;  3IFR A;  3O4W A;  2A42 A;  1HJO A;  4XH5 A;  4XH1 A;  3MN9 A;  1JCG A;  3VEO A;  1ATS A;  3ID8 A;  3WQT A;  2GTD A;  4BR4 A;  4JD2 A;  3VES A;  3QIC A;  3MK6 A;  1NGI A;  3QFU A;  2YHY A;  3MCP A;  2E20 A;  4JHD B;  3MMV A;  5EOY A;  4BQL A;  1BA1 A;  4BRA A;  3CJ9 A;  4AM7 A;  4BRI A;  1RGI A;  1TUU A;  2EWS A;  3H6E A;  3KZB A;  1T6D A;  3KVG A;  5KPT A;  3RSE B;  4BC4 A;  5BRE A;  3FR0 A;  1BDG A;  1S3X A;  2Q31 A;  1QQM A;  4PL7 A;  1ATR A;  3L6Q A;  4PKI A;  3HBT A;  5E84 A;  5F0X A;  5AQF A;  2ZGY A;  4QS8 A;  1X9J A;  4MO4 A;  3O5B A;  4BRL A;  3D2F B;  2A3Z A;  4I6M A;  5AQT A;  1NM1 A;  3VGM A;  2GEM A;  1KAZ A;  3GE1 A;  2GWJ A;  4K25 A;  1ZBS A;  2PAV A;  2E2Q A;  5TKY A;  1YUW A;  2P9L B;  1NGB A;  4M7Y A;  2HOE A;  1QZ5 A;  5FPN A;  4DCH A;  1TYQ A;  3CER A;  3FGU A;  4H0Y B;  2E88 A;  3H46 O;  3M6G A;  4FWP A;  4K42 A;  2YI1 A;  4PKH A;  3F9M A;  1LOT B;  5ELZ A;  5AQY A;  3BF3 A;  3HSC A;  3O8M A;  5AFU H;  5AQX A;  2GWK A;  3DWL A;  3ZEU B;  1NGH A;  3CQX A;  1HKB A;  4FPA A;  4BRN A;  3KHY A;  3S41 A;  1V4T A;  4BC5 A;  5AQS A;  1G99 A;  4KBO A;  5AQJ A;  3U9D A;  2CGJ A;  5JIC A;  4BVP A;  1NGF A;  5AZI B;  1NWK A;  2QWM A;  2QWN A;  4IWV A;  4QS7 A;  1HKC A;  3ULE A;  2QXL A;  2E2N A;  4DB3 A;  1DGK N;  4PKG A;  1E4G T;  2VWB A;  3AAQ A;  1R59 O;  1IG8 A;  3LM9 A;  3G25 A;  4CZM A;  5LY3 A;  1ESV A;  2NZT A;  2ITM A;  2YHX A;  4IXC A;  2F9T A;  4IO8 A;  4ISG A;  3SLC A;  3W3D A;  4L3Q A;  1GLA G;  3R8E A;  3A5L C;  1D4X A;  4CZG A;  2AA4 A;  3FZH A;  4EIA A;  5AQN A;  4BRM A;  2P9P B;  2FSJ A;  3DXK B;  3CJ1 A;  1KXP A;  2P9N B;  4FSV A;  4FL9 A;  2P9I B;  4GY2 B;  5BRD A;  3EL2 A;  4AM6 A;  3DXM A;  3M1F A;  1K8K B;  3VET A;  3IUC A;  4B1W B;  3MDQ A;  2HF3 A;  3J8A A;  2H3G X;  2IVO A;  3CIP A;  1GLL O;  4NO7 A;  5E26 A;  3L0Q A;  1XUP O;  2D0O A;  3CQY A;  2I7P A;  4XH4 A;  4BC2 A;  3ZX0 A;  4H03 B;  1BA0 A;  2A41 A;  1NGE A;  1NGC A;  4H5N A;  1NGD A;  1C0F A;  2E1Z A;  3IDH A;  2P9S B;  1JCE A;  5F2R A;  4BG8 A;  4DHY A;  1J6Z A;  2E8A A;  3EN9 A;  4DQ8 A;  3TPQ A;  5EX5 A;  3HM8 A;  3VEV A;  3ENH A;  2QWO A;  5AQW A;  1MWM A;  5AQK A;  1JCF A;  3QDK A;  5AZJ B;  2CGK A;  3UKR B;  3VEZ A;  3VGK A;  4CD1 A;  1GLC G;  3D2E B;  3FZK A;  4H5R A;  3OHR A;  4WQ5 A;  3CJA A;  4BR9 A;  3FZM A;  3W0L A;  2FF6 A;  4BGA A;  2HMP A;  4FWQ A;  3QB0 A;  3WEE A;  4H5T A;  4B1Z A;  3AY9 A;  2FSK A;  2Q2R A;  4O8K A;  1MWK A;  4CZI A;  5CE3 A;  4BR5 A;  3UB5 A;  5JMV A;  1QQO A;  3FFK B;  3EKS A;  4A2A A;  1BU6 O;  4B1U B;  3EZW A;  1ZC6 A;  1GLE G; 
#chains in the Genus database with same CATH topology
 3I8B A;  1U48 A;  3ZLJ A;  1RDW X;  4JLH A;  3VER A;  1ZYQ A;  2BGG A;  4NYN A;  3O3H A;  3SMS A;  3LAK A;  1VQ8 N;  3VQ5 A;  2VYP A;  4PY5 A;  2OTJ N;  1HPZ A;  3ID6 A;  1KVC A;  4KHQ A;  4H0O A;  2UXB K;  3DRS A;  4KHW A;  4YOT A;  3PIP L;  4YDU A;  5BN9 A;  4NYF A;  4CJF A;  1VK0 A;  3OS2 A;  4CCH A;  3ZSZ A;  3K5L A;  3VEN A;  3HTV A;  1CZA N;  3C65 A;  1TVR A;  3P83 D;  1RDC A;  1X9S A;  1WBD A;  4E7I A;  1MA9 B;  3S9H A;  1VSI A;  3KWG A;  4O55 A;  3T1A A;  4CF8 A;  3DAW A;  2HB5 A;  2F8T A;  3ZX2 A;  3M8S A;  1OH6 A;  3ZET A;  1NLV A;  2XO7 A;  3KJV A;  3DOK A;  4B9V A;  4CF2 A;  4JI4 K;  2DTU A;  4PL8 A;  2BUP A;  2NRH A;  4CIE A;  2P9U A;  2O8C B;  4JKH A;  2WON A;  3C7N B;  3OS0 A;  5LMU K;  4B1V A;  4OKK A;  4N5S A;  2ZM6 K;  1J5O A;  1YJN N;  1BL3 A;  1Q81 O;  3ISN C;  5BPL A;  3HM9 A;  4R5P A;  2ATQ A;  5AQR A;  3OBW A;  3HI0 A;  3MCA B;  4ZTJ A;  4K43 A;  4CJP A;  2FSN A;  1TKD A;  4DTP A;  5AQM A;  2G8W A;  1RFQ A;  4BRK A;  2CGL A;  4FJ7 A;  3RMA A;  4IZ9 A;  4FWR A;  2O4G A;  3AVB A;  3VA0 A;  4FPB A;  3DLB A;  4JHD A;  3S3M A;  4F9O A;  2HHX A;  5LJW A;  4EFH A;  3FE1 A;  4MLH A;  1U2V B;  4IG3 A;  4FWN A;  2AP1 A;  2QWP A;  3RMB A;  3OYK A;  1FK9 A;  3QLH A;  4KTZ A;  3KIO A;  2CH5 A;  1TUY A;  2OPS A;  3SMP A;  1IBM K;  3OYJ A;  4JS5 A;  2XRI A;  4AHV A;  5J1E A;  3J7Y P;  3LL3 A;  3VEY A;  3ZSR A;  3D45 A;  1BO5 O;  1BG3 A;  3E66 A;  3V9X A;  1RBS A;  4CBX A;  3LM2 A;  2P9L A;  2PYJ A;  2W42 A;  2DPN A;  1YVN A;  4Y0W A;  5MLC Q;  4DF8 A;  4B3O A;  1WUA A;  2QI2 A;  2HHS A;  2HHT A;  3ZT1 A;  5KGX A;  1H1V A;  4DTO A;  1OKJ A;  1OH8 A;  3VQQ A;  1SZ2 A;  4KHN A;  4CJW A;  3WXJ A;  4CK3 A;  3SPY A;  4IOA L;  1SS6 A;  2E4L A;  2O8B B;  2E6M A;  1CZB A;  5K14 A;  5GAG P;  1TGO A;  1KVA A;  3CCE N;  3V1R A;  5FPE A;  5HP1 A;  5CYM A;  4DUZ K;  1HNV A;  1BI4 B;  1X3N A;  1RDA A;  1UAX A;  1BUP A;  1HQU A;  4X66 K;  4GV9 A;  1NK4 A;  1GLB G;  4CED A;  2Q0R A;  5JVH L;  1L5U A;  1S6Q A;  4QAG A;  5FLX O;  1QQN A;  2ASM A;  4B08 A;  4RWT A;  5GAD P;  4DTU A;  2HHQ A;  5CZ2 A;  2NRX A;  4CEB A;  1EWQ A;  3K9K A;  4CJ7 A;  1VQL N;  3ENO A;  4CZE A;  5F1X A;  4ILG B;  3HPG A;  4I7F A;  4EAH D;  1S6P A;  3BUZ B;  1N8R O;  1KSP A;  3I33 A;  4CZF A;  1SKR A;  4JEP A;  3KKS A;  3WEE B;  4FJH A;  1A5W A;  3PX4 A;  1GLJ O;  3V1O A;  2O8D A;  2DFH A;  4RG8 A;  4DR1 K;  1NBW A;  3ZSW A;  4FWM A;  2RHK A;  3HPO A;  2RPI A;  1DEJ A;  2YNH A;  5GIN A;  2ZJR L;  4O5F A;  1VHX A;  4MQ3 A;  1XNR K;  3O9R A;  3ZSO A;  1HRH A;  3LDN A;  3SNN A;  1QHT A;  1X9M A;  5C24 A;  4FJK A;  2HHU A;  1T3V A;  1T6C A;  4KH6 A;  1K9M O;  1A5V A;  2G8I A;  3U9Z A;  5D3G A;  3CJC A;  4BE2 A;  2A6A A;  2Q36 A;  4A61 A;  2HW3 A;  1RT1 A;  3MX2 A;  2HHV A;  3JS6 A;  3JAM O;  1KQS M;  2RF2 A;  4OKJ A;  1S9G A;  3CJ7 A;  4CVN E;  1U6Z A;  4FK4 A;  1Q18 A;  4DF4 A;  1HX1 A;  1UOC A;  2DY4 A;  5J2M A;  4JRP A;  1YTU A;  4FK0 A;  4AHT A;  3EY1 A;  2RN2 A;  3AAR A;  4JNE A;  4WQ4 C;  4AHU A;  2FF3 B;  2X74 A;  1O13 A;  1E3M A;  4FLT A;  2EHG A;  3G71 N;  2FC0 A;  3PSF A;  3ITH A;  3NVK A;  3VEO A;  2IS3 A;  1KTQ A;  3ID8 A;  2GTD A;  4G9Z A;  4BR4 A;  1TK5 A;  3O9U A;  1NJW A;  1JL2 A;  1VSL A;  3NFA A;  2YHY A;  3MCP A;  3CC2 N;  2BH1 A;  1BCO A;  4BRI A;  3KK1 A;  2JWL A;  1T6D A;  4I2Q A;  2YNG A;  4DTM A;  3KVG A;  5BRE A;  4E7J A;  4BDP A;  3FR0 A;  4E7H A;  1S3X A;  1ATR A;  3L6Q A;  1QS4 A;  5F0X A;  5HRN A;  2G8F A;  3O5B A;  1O1W A;  4LF4 K;  3K59 A;  4BRL A;  4YOR A;  3NHG A;  3TAR A;  3K2P A;  2GBZ A;  1OVY A;  2GV9 A;  3RR7 A;  3VGM A;  2Z1J A;  3AVN A;  4CJ4 A;  4FLX A;  3BGR A;  2E2Q A;  4C8N A;  4CK1 A;  2UXD K;  2Z1H A;  1YJW N;  4LFA K;  1NGB A;  1RT4 A;  2HOE A;  3PO5 A;  4B9T A;  1QZ5 A;  2YNF A;  5FPN A;  4DCH A;  3AO4 A;  4A5A A;  1P90 A;  4LF7 K;  4JI7 K;  2WTU A;  3LP2 A;  5KI6 A;  2O8E B;  2GWK A;  3DWL A;  3C94 A;  4BRN A;  2YX6 A;  5AJ3 K;  3S41 A;  4AF1 A;  3THV A;  5AQS A;  2ETJ A;  1RTI A;  1BGX T;  2F96 A;  2FBY A;  4MDB A;  4CEZ A;  1RBR A;  2QKB A;  1LAW A;  2QWN A;  4QS7 A;  4ZHR A;  5T7B A;  4GVE A;  3OYN A;  2XHB A;  4CJE A;  2UXC K;  3BZK A;  5LY3 A;  3OJU A;  1G15 A;  1XC9 A;  4IXC A;  2F9T A;  1GLA G;  1FXX A;  2HST A;  3CCJ N;  4CZG A;  2OYQ A;  1RDU A;  4BRM A;  2P9P B;  3V1Q A;  2FSJ A;  1BQM A;  2O8B A;  3MAQ A;  3L3V A;  4DV0 K;  4JKD A;  2P9I B;  4RW6 A;  5BRD A;  5DK5 A;  1TKZ A;  3DM2 A;  3VET A;  2KZZ A;  3J8A A;  2H3G X;  5H1S Q;  4CJR A;  4ILJ A;  3DLG A;  1BI4 A;  3MWP A;  4CJQ A;  4RW9 A;  1Q9X A;  1ZBU A;  2A41 A;  1I39 A;  1NGE A;  1NK8 A;  1N36 K;  4FJJ A;  1NGD A;  3SUN A;  3O9Q A;  1Q9Y A;  1N33 K;  3QEW A;  4FM0 A;  1Q7Y O;  4QOZ B;  4AHS A;  4BG8 A;  4FYD A;  4FM2 A;  4HUG A;  2QWO A;  3ZSX A;  3NGY A;  3PLA A;  4C1N I;  1ZBI A;  3QDK A;  3DLE A;  1NK5 A;  3AO3 A;  5GAE P;  2D0A A;  4WCE L;  5GIP A;  4CD1 A;  3D2E B;  3FZK A;  3OHR A;  3LP1 A;  3W0L A;  2FF6 A;  1D8Y A;  4FWQ A;  3QB0 A;  3NDK A;  3WEE A;  4H5T A;  4B1Z A;  2Y1I A;  1HNZ K;  3AY9 A;  2FSK A;  4IOX A;  3OYA A;  4CEQ A;  1J53 A;  1F21 A;  1FW6 A;  3SQ1 A;  5CE3 A;  3IS9 A;  4RW7 A;  4PHT X;  3S3O A;  3EKS A;  3TTF A;  4KRE A;  4DSE A;  4GKK K;  4LY7 A;  1HNW K;  4LFC K;  3U6F A;  3OYM A;  1WNS A;  3KTQ A;  3AA4 A;  3OYH A;  4JKC A;  2E6L A;  5KGW A;  2QWQ A;  1KRP A;  1C6V A;  3L4Q A;  2WOM A;  4CHQ A;  2E5L K;  2QM1 A;  3QFP A;  4MDA A;  4BRF A;  4OJR A;  5A2Q O;  4DR5 K;  5AQH A;  3MN6 A;  4OLA A;  2ASO A;  2G8V A;  2W40 A;  5AQZ A;  4IBN A;  4ELV A;  3LP0 A;  4AQY K;  3NF9 A;  4E72 A;  3VF4 A;  1L3T A;  4FWO A;  3IRX A;  4UY8 O;  2XY8 A;  2NRT A;  4JI1 K;  3BF1 A;  4IJA A;  2IVP A;  1QQC A;  4W5Q A;  4QS9 A;  4DKW A;  3CM6 A;  3F2K A;  3K58 A;  3L4I A;  2W6L A;  2W41 A;  4DTX A;  5EY4 A;  4JKG B;  4KTW A;  3HO1 A;  2GUP A;  4CGI A;  4CFB A;  3GG4 A;  1HKG A;  2P9S A;  3KKR A;  4RTF D;  2V7Y A;  3BP8 A;  4J8F A;  5FRO A;  4E7L A;  1S1U A;  1WSE A;  2BAN A;  3NF7 A;  1S22 A;  4FOI A;  3ZCM A;  3LPT A;  2NUB A;  4BWJ A;  4F4K A;  3EKU A;  4CJT A;  3PO4 A;  4HCC A;  4ISF A;  3HP6 A;  1TYQ B;  3SAG A;  3S3N A;  5JS1 A;  3O4N A;  3BEX A;  1GOC A;  2PBD A;  4L8R B;  3PX6 A;  1VQO N;  1SQK A;  1C0T A;  2KZM A;  4K8Z A;  5HRS A;  1JLG A;  2ZJP L;  1WOQ A;  1DTQ A;  4NCA A;  4G1Q A;  4K41 A;  4OX9 K;  3I0S A;  2X78 A;  4JRQ A;  4B9Q A;  4DS5 A;  2JLE A;  2Q97 A;  4CJK A;  3NH2 A;  2O8F B;  2YHB A;  1WSH A;  4BVO A;  4DMN A;  2HBM A;  2IVN A;  1DT9 A;  3VN5 A;  3KLE A;  3AVC A;  4HTU A;  4FVU A;  1RDD A;  3H1Q A;  2B4J A;  1T05 A;  3CET A;  3OA9 A;  4FLW A;  1UA1 A;  4LC9 B;  1IG9 A;  4NLB A;  1EO1 A;  4ID1 A;  1VQN N;  4DV4 K;  1YJ9 N;  1HLU A;  3DJC A;  1WLJ A;  2D4W A;  2OAN A;  4DFK A;  3Q7C A;  2FLO A;  4BDZ A;  4E19 A;  3DXM B;  3RRH A;  1GOA A;  2IGI A;  5EVZ A;  2ZF5 O;  1ZBF A;  1EQY A;  2IDO A;  2NNW A;  1KC8 O;  4FCY A;  1IBK K;  2XY6 A;  1HPM A;  5AQP A;  5JLH A;  3QEP A;  1NJI O;  5AQL A;  2I5J A;  4HHT A;  4CHZ A;  4OGE A;  5J2P A;  1J5E K;  4ELT A;  1XNQ K;  3PSI A;  3CYG A;  1NMD A;  1OH5 A;  2DFF A;  4BQZ A;  3H1V X;  4FK2 A;  2P9P A;  3A2F A;  1FKP A;  1W0H A;  1LWF A;  4DSL A;  2P9I A;  4FO0 A;  3TAP A;  2QA4 N;  1TKX A;  4KHY A;  1HMV A;  2R7Y A;  1R0A A;  1NJZ A;  4H0V B;  3KK3 A;  1RBU A;  3SJH A;  4DV1 K;  4M3Z A;  4K8X A;  4FZZ A;  4BRD A;  2P9K A;  2ASP A;  3LDO A;  1T8E A;  4C23 A;  3AAP A;  5EXW A;  3RMD A;  4FW1 A;  4KI6 A;  1C0U A;  4GVM A;  4BDY A;  1D9F A;  3VTH A;  2KHO A;  3AO2 A;  4Z4I A;  1C0G A;  1TK8 A;  3OYE A;  4CGD A;  4IG0 A;  4M63 C;  5AQU A;  3CFP A;  1EKE A;  4Z4G A;  1XC3 A;  4X62 K;  1YAG A;  3D2E A;  4Z94 A;  2OA8 A;  1RTH A;  4FLY A;  2ZGZ A;  4RCH A;  3WXK A;  1KAX A;  5FPM A;  4WQ5 C;  2DFE A;  1W9H A;  4CBW A;  1TKT A;  3WNG A;  3UIQ A;  4CD3 A;  4H5V A;  3C0B A;  1TL3 A;  4DS4 A;  2YNI A;  3CCV N;  3CPW M;  1N32 K;  3EYZ A;  1M90 O;  3J80 O;  3VPZ A;  1NOY A;  3NH0 A;  2I7N A;  3O3F A;  1RT5 A;  3GL1 A;  3VQC A;  1QSS A;  2FBV A;  4IO9 L;  3OTO K;  5KQ8 A;  4ZTF A;  4BRC A;  2LSN A;  3KLI A;  2W00 A;  1HNI A;  2A1S A;  3T3F A;  4LD0 A;  1LWC A;  3SV4 A;  1TK0 A;  1K6Y A;  4XH1 A;  4DLE A;  3NGI A;  3C6T A;  5JVG L;  4Z4H A;  4C8M A;  5E41 A;  4CJ5 A;  2F8S A;  4WFB L;  2E20 A;  2ZJQ L;  3TAB A;  4AM7 A;  1UA0 A;  1N34 K;  1TUU A;  2EWS A;  3H6E A;  3KZB A;  3EEQ A;  1EXQ A;  5KPT A;  2WBN A;  2Q31 A;  1YVU A;  2JWK A;  5FRM A;  4JKG A;  4CGF A;  4F3T A;  3THW B;  4FJM A;  3EE9 A;  3CC7 N;  2ZGY A;  4QS8 A;  3I8D A;  4V19 S;  4MO4 A;  3SUO A;  1TL1 A;  1KCF A;  4DSF A;  4RW8 A;  1IKV A;  3MEC A;  1XHX A;  2VG5 A;  1KAZ A;  2D5R A;  2GWJ A;  2PAV A;  4YOW A;  2QTD A;  2HMI A;  4M7Y A;  3L3U A;  3OYL A;  5SWM A;  4JI3 K;  1TYQ A;  3CER A;  3FGU A;  4H0Y B;  3BZC A;  4HVJ A;  4O8U A;  3M6G A;  3SAH A;  1QSL A;  1VQP N;  1VQ7 N;  3CMA N;  1LOT B;  5TKW A;  3KK2 A;  3O8M A;  3HSC A;  4JKA A;  5AFU H;  5AQX A;  4CIF A;  1C1B A;  2KW4 A;  4IDK A;  1NGH A;  3CQX A;  3T7Z A;  3KHY A;  1N5Y A;  4WE1 A;  4JKF A;  1V4T A;  1C0M A;  3C95 A;  4FVM A;  3C6A A;  3OS1 A;  3KD1 E;  4Z0U A;  3DLR A;  3QEX A;  3AVA A;  3CXC M;  4FLU A;  4FJ8 A;  1QE1 A;  5JIC A;  3SQ2 A;  3IAY A;  1M1K O;  3OW2 M;  2O8F A;  1CZ9 A;  4GW6 A;  4DTS A;  4J2B A;  1DGK N;  1WSI A;  3P31 A;  1FJG K;  2OZM A;  3LM9 A;  4NCG A;  4W5N A;  1ESV A;  3HVT A;  3MWT A;  4M3W A;  3SUP A;  2YHX A;  3VQA A;  4IO8 A;  3W3D A;  1HJR A;  4RW4 A;  5HBM A;  3QNN A;  4DWI A;  5AQN A;  4OO1 J;  3TAF A;  4B3T K;  3DXK B;  4DSI A;  5C2D A;  2WFB A;  3SYZ A;  4B9S A;  4DR2 K;  2ITG A;  4FL9 A;  4CHP A;  5C12 A;  3JYT A;  4Y1D A;  3EL2 A;  3DXM A;  5HL7 L;  3QEV A;  1WN7 A;  5C10 A;  4JI0 K;  3K5N A;  2D0O A;  3DOL A;  4XH4 A;  3N4P A;  1REV A;  1CLQ A;  1WSG A;  4H5N A;  2P9S B;  4AHC A;  4F2R A;  1JCE A;  5FRN A;  4DHY A;  3EN9 A;  4K0K K;  3QIP A;  3TPQ A;  4ID5 A;  5EX5 A;  3HM8 A;  3LWM A;  4DFM A;  4CF0 A;  4YOY A;  3HJF A;  4FJL A;  5GAH P;  4B8C A;  1EP4 A;  2CGK A;  4DQP A;  4OLB A;  1VSH A;  3TWH A;  1KFS A;  3OBY A;  2OZS A;  2KFZ A;  4WQ5 A;  3CJA A;  4CW7 B;  4NXN K;  4FW2 A;  4DV6 K;  4FZY A;  4DU1 A;  3V9S A;  2Q2R A;  1MWK A;  4LF8 K;  3UB5 A;  3ZSQ A;  4M3U A;  1GOB A;  5CYQ A;  1S72 N;  5C15 A;  1BU6 O;  3EZW A;  3NBP A;  3OY9 A;  2NRZ A;  4C1N K;  5LJV A;  4CES A;  1T03 A;  1Z05 A;  5BRH A;  5AQV A;  4E1J A;  2ZQB A;  2YCH A;  4DV7 K;  1KAY A;  1LW2 A;  4A5B A;  3I55 N;  4YY3 K;  4GNI A;  4BGB A;  1YXQ A;  4YHH K;  1HNX K;  3CG7 A;  1U45 A;  4FJG A;  5AFU A;  1Q8I A;  4N41 A;  4FJX A;  1YTA A;  4AIL C;  1RTJ A;  4BG9 A;  4JD2 B;  4GV6 A;  4JK8 A;  1J9A A;  4B9L A;  5J2Q A;  3TAE A;  4FJ5 A;  4FXD A;  3RTV A;  3J7Z O;  3O80 A;  5IWA K;  2HBL A;  3UE5 A;  5B8H A;  3DLL L;  1RT7 A;  3SBT A;  3SZ2 A;  4ICL A;  4N47 A;  4OPH A;  4YNQ A;  2PYL A;  2KFN A;  1K8K A;  5M1Q A;  3WNE A;  1XWL A;  3C6U A;  4H0X B;  4CF9 A;  4EHU A;  4CZK A;  3M8Q A;  2OPP A;  1VRT A;  3B6P A;  4IOC L;  4Z4C A;  3V4I A;  1W7A A;  2P5G A;  4KHP K;  1IKW A;  1S1T A;  4DG1 A;  3TSP A;  4LF6 K;  1P8Z A;  4I6M B;  3VMF B;  2YJF A;  1NGJ A;  2VQF K;  5ADX H;  2VG7 A;  2YHW A;  1KVB A;  4BR0 A;  3OYF A;  5C2F A;  4KI4 A;  3QES A;  3K57 A;  3NF6 A;  3V9Z A;  1T44 A;  3MXI A;  1X3M A;  1EX4 A;  3MEG A;  2P5O A;  4N56 A;  2P9K B;  4C8K A;  3O08 A;  5I9E B;  3THW A;  3V9U A;  3O6W A;  1CXU A;  4MLE A;  3WQU A;  1FKO A;  3AA3 A;  3HST B;  3AVM A;  5DM6 L;  3QIO A;  4E0D A;  3FZL A;  2V7Z A;  2KQ2 A;  2VGN A;  3HZ6 A;  3D0P A;  4H4O A;  2XY5 A;  4DLG A;  3ZSY A;  1JXE A;  1SUQ A;  4Z4E A;  2E2O A;  4CZL A;  3O3G A;  1VSK A;  4PUO A;  4YDU C;  1BIU A;  2IAJ A;  4M3R A;  5BPM A;  4CJL A;  1JLB A;  1JLQ A;  1HUX A;  4FWL A;  3TAQ A;  3NAE A;  1TAU A;  3FZF A;  1S5J A;  1QSY A;  3SUQ A;  1RIL A;  4A62 A;  3RVC A;  1JJ2 M;  4DU4 A;  3O1B A;  4KAZ A;  3QEI A;  3I56 N;  1V4S A;  3TSQ A;  3CCR N;  4LH5 A;  3QBX A;  1TV6 A;  2X6S A;  4YOV A;  4E1N A;  2D0C A;  4WQ4 A;  3V9W A;  4QCL A;  5DM7 L;  4KHS A;  4H0P A;  3TSU A;  3VF6 A;  1Q86 O;  2HHI A;  1JLE A;  3VEX A;  2VCP A;  4I9L A;  2QW9 A;  5SZT A;  4DV5 K;  1OH7 A;  4BRO A;  4BRP A;  2D1K A;  4WFN L;  4F2S A;  3OYB A;  1GLF O;  3L2W A;  5AQO A;  1DLO A;  4WYB A;  1K8A O;  3ULD A;  3SK3 A;  5BR8 K;  3VQ9 A;  2NRW A;  3CPE A;  2UYT A;  5JLF A;  2F7T A;  2OPQ A;  3P4I A;  2AJQ A;  3SQ4 A;  2P51 A;  1KLM A;  2NLX A;  3K9J A;  3DXK A;  1VSD A;  1MU2 A;  3OYI A;  4B1X B;  2G8H A;  1U4B A;  4YOU A;  3M3Z A;  3AVJ A;  2XY7 A;  3WXL A;  4FWK A;  4O4G A;  3CM5 A;  5BPN A;  1D9D A;  3PIO L;  3SCX A;  3CFR A;  3WXI A;  3PY8 A;  3PV8 A;  1IJJ A;  5ADX A;  3O4Q A;  1GLD G;  4YOX A;  4DQR A;  4BC3 A;  4O0I A;  1RT3 A;  1RNH A;  4CHN A;  5KRT A;  5J2N A;  4FOE A;  3LDL A;  4X64 K;  2G8U A;  4XEI A;  3E01 A;  2B5J A;  4OPA A;  1IV0 A;  3MN5 A;  4R79 A;  3VA3 A;  4B1Y B;  3VQ6 A;  3L2U A;  3TAG A;  3L2V A;  3QML A;  4GV3 A;  3OYG A;  3CCQ N;  1RTD A;  4FWS A;  3AO1 A;  5KQD A;  4BRG A;  4BRQ A;  1NK7 A;  4EHT A;  1XMQ K;  3TTC A;  1JXB A;  4JN4 A;  1YF5 L;  3VQ8 A;  3H3N O;  4LSL A;  2WC9 A;  1XQS C;  2UUB K;  3AO5 A;  1Q82 O;  1EET A;  2YKN A;  2Q0U A;  1RBV A;  3IMX A;  4JI6 K;  3NF8 A;  3NCI A;  3AA2 A;  4DQI A;  3O1W A;  2E2P A;  5HRO A;  3T1H K;  2GX9 A;  3UKU A;  4LFB K;  4B8A B;  4B3R K;  3IFR A;  5FDL A;  2C1I A;  2A42 A;  1HJO A;  3G6E N;  2RKI A;  3MN9 A;  1ATS A;  5C42 A;  1S1W A;  4JD2 A;  1JLA A;  3VES A;  1BIS A;  1JLC A;  2Q3S A;  3R1X A;  2B6A A;  4LF5 K;  3ZT2 A;  3I0R A;  4M45 A;  3MMV A;  4BRA A;  4BQL A;  1BA1 A;  5M1F A;  1VQM N;  1WSF A;  3DMJ A;  3M8R A;  4JV5 K;  1NMN A;  4M3Y A;  1IO2 A;  1QTM A;  4CER A;  3RSE B;  3B6O A;  1JL1 A;  1QQM A;  4PL7 A;  4CEC A;  3ZSV A;  4PKI A;  3DI6 A;  5E84 A;  3U3Y A;  1X9J A;  1QVF M;  2QK9 A;  4CFC A;  1VQ4 N;  3D2F B;  4HUE A;  2A3Z A;  4I6M A;  5AQT A;  4HUF A;  1VAZ A;  1IBL K;  3GE1 A;  4BAC A;  1ZBS A;  1KFD A;  2VQE K;  4DFJ A;  4MFB A;  4DR3 K;  1YUW A;  2YKM A;  1A5X A;  4KKO A;  4UQG A;  1WB9 A;  1B9F A;  2E88 A;  3H46 O;  3SAF A;  3F73 A;  5M1O A;  4NLC A;  4PKH A;  3F9M A;  3C6H A;  4AH9 A;  3ZEU B;  4FPA A;  1HKB A;  4I2P A;  3CF5 L;  3LZJ A;  4BC5 A;  1Y97 A;  4TSX A;  1NKC A;  3SBG A;  3ZYY X;  3OYC A;  3BY5 A;  3QIN A;  4DFP A;  5AZI B;  3E1Y A;  2QWM A;  1OVQ A;  2RE2 A;  3MXM A;  4IWV A;  3EZ5 A;  2E2N A;  3KLH A;  4DTR A;  3QET A;  2VWB A;  3THX A;  1R59 O;  4W5O A;  3M5R A;  4CZM A;  3CCS N;  4Q0B A;  2NZT A;  4CJU A;  3SLC A;  3ASM A;  3ALY A;  3R8E A;  3A5L C;  1D4X A;  3P38 A;  4OPJ A;  2AA4 A;  3WXM B;  3J81 O;  1CXQ A;  3THY B;  4FJ9 A;  5KTQ A;  3CJ1 A;  4OKE A;  2P9N B;  4FSV A;  3P1G A;  4FLZ A;  4GY2 B;  5DMR A;  1YI2 N;  3Q7B A;  4E7K A;  1K8K B;  3AVL A;  3TTD A;  4B1W B;  3MDQ A;  2HF3 A;  2IVO A;  3CIP A;  1SL0 A;  1GLL O;  4NO7 A;  5E26 A;  4KHU A;  2I7P A;  4BC2 A;  3LZI A;  2D0B A;  3TI0 A;  3ZX0 A;  2JGU A;  4H03 B;  2VWJ A;  1ILY A;  1Z26 A;  4XJX A;  3IG1 A;  4DTJ A;  4CJV A;  3IDH A;  1X9W A;  1S1X A;  3AVK A;  4Y1C A;  1BQN A;  1J6Z A;  2VG6 A;  3AGK A;  2BDP A;  1NK0 A;  3ENH A;  1JCF A;  5M1K A;  4U7B A;  5AZJ B;  3LDS A;  3F5T A;  3UKR B;  3DLK A;  3QO9 A;  5HRR A;  3VGK A;  4O0J A;  1GLC G;  3VQE A;  3CC4 N;  3P5J A;  4DQS A;  4BR9 A;  4CGH A;  1LW0 A;  4JKE A;  2HMP A;  1I94 K;  1X1P A;  4JK7 A;  3SQ0 A;  3E9O A;  3T19 A;  4JI2 K;  4BR5 A;  2PFU A;  1QQO A;  3S5T A;  4A2A A;  4DUY K;  4B1U B;  3HRG A;  4DR7 K;  1C1C A;  1GLE G;  1ZBL A;  2KKZ A;  4JYA K;  2GUI A;  2A40 A;  1WSJ A;  2GEL A;  3RRG A;  4CBU A;  2YHA A;  3P39 A;  3ATU A;  4J2E A;  5AQI A;  3T1Y K;  1VSM A;  3WT0 A;  1C1A A;  3G4S N;  2QWL A;  3HL8 A;  4X65 K;  3GBT A;  2PY5 A;  4O44 A;  1ATN A;  4Z4F A;  1Y64 A;  2CH6 A;  3A5M C;  3IKM A;  1RDB A;  2C1G A;  5BRF A;  3QNO A;  3U4L A;  3A8Y A;  3VQ7 A;  1ASV A;  3DYA A;  3O9T A;  1L3S A;  1B92 A;  4CGJ A;  3V81 A;  4IJN A;  1TAQ A;  4BY9 C;  4C8L A;  2BE2 A;  3N4Q A;  2IIR A;  3M8P A;  3WNF A;  3WUH A;  3QER A;  3DLH A;  4KH5 A;  1DKG D;  3VOV A;  2J4R A;  5BN8 A;  1VQ9 N;  4CEE A;  4ISE A;  4KH4 A;  4BEC A;  3LDQ A;  1U47 A;  1VQ6 N;  2UUC K;  1LV5 A;  2F9W A;  3O9S A;  4GKJ K;  4AHR A;  2FXU A;  3FFI A;  3GOI A;  5JEN A;  4CK2 A;  1SKS A;  4A2B A;  1HYV A;  3ZT4 A;  3TU5 A;  4KPY A;  5FPD A;  3HYF A;  1LWE A;  2W6K A;  2YJE A;  3SV3 A;  4CF1 A;  3NGZ A;  3H45 C;  1W97 L;  5AR0 A;  4YFU A;  2HBK A;  1NOZ A;  4H0T B;  3L2R A;  4NCB A;  4ILH A;  1RT2 A;  3RSE A;  3SI6 A;  5LMN K;  1YIT N;  4CJ3 A;  3R3L A;  1HYZ A;  3HP9 A;  2WUS A;  1E4F T;  4KO0 A;  1VSJ A;  4HCB A;  3CCL N;  3CFO A;  4JAX A;  3CCM N;  4DSJ A;  4HTL A;  5GIO A;  5M1P A;  3WNH A;  3D2F A;  3K0S A;  3HOT A;  5BR9 A;  5CHI A;  5CR4 A;  4DV2 K;  3ULE B;  3NE6 A;  2Z1I A;  4BR7 A;  2A5X A;  1WAJ A;  1I3A A;  3ATV A;  4BR2 A;  3G0Z A;  5M1N A;  4DR6 K;  3MX5 A;  4OVL A;  4W5R A;  3A0I X;  3MEE A;  3CI5 A;  1LCU A;  2FBT A;  3L8B A;  1U04 A;  1SKW A;  2KTQ A;  1HQE A;  4CGG A;  4B9M A;  5KRS A;  3OYD A;  4H5W A;  3ZX3 A;  1KLN A;  3ZEU A;  4KV8 A;  1NJX A;  1S1V A;  3FLC O;  4E89 A;  2QKK A;  5LL6 Z;  5HOO A;  3K5O A;  4LSN A;  4M3X A;  1Z6R A;  3VQB A;  3VEW A;  4CZH A;  2IC3 A;  4MO5 A;  3QBW A;  3BDP A;  3MED A;  4H8K A;  2O8C A;  3C7N A;  4DV3 K;  3VGL A;  2BTF A;  2E1Y A;  2HNY A;  1QHA A;  2V51 B;  3CYM A;  5AZI A;  3JXU A;  4EP5 A;  4N76 A;  3ENB A;  3UKU B;  1SAZ A;  3MN7 A;  4JK9 A;  3KD5 E;  3A5O C;  2HF4 A;  4OGC A;  4W5T A;  3CQ8 A;  2QEX N;  4B3M K;  3RMC A;  4IDH A;  3TR8 A;  3RWU A;  2Z1G A;  4IFY A;  5CZ1 A;  3H3O B;  3T69 A;  4OPK A;  4F8R A;  2Q1N A;  1NGA A;  1UWB A;  2V52 B;  3L2Q A;  1EWR A;  3CME N;  1IKX A;  3PUF A;  4FJN A;  3THY A;  1MDU B;  3LAL A;  3AVG A;  2P9N A;  1L3V A;  1BWF O;  3LP3 A;  2ZWH A;  4IEE A;  2A1R A;  4HWI A;  1J54 A;  1HYS A;  1NKE A;  1W2B M;  4O5B A;  4JKB A;  1ZBH A;  3U8X A;  2F4V K;  3OVN A;  1U2V A;  2ZE2 A;  3D7E O;  4DSK A;  3GDQ A;  3KWI A;  4M7X A;  1ASU A;  1LAV A;  1QZ6 A;  1NGG A;  3B8A X;  2HHW A;  3VTI A;  1U49 A;  5AQG A;  4NB4 A;  1NU0 A;  3CJB A;  3DRR A;  2NRR A;  5I3U A;  1D5A A;  4F3O A;  5KPR A;  4CZJ A;  4PQU A;  4CE9 A;  3VF2 A;  4NXM K;  3HT3 A;  5AZJ A;  4J2A A;  4IKF A;  1N6Q A;  3A5N C;  3UKR A;  4BRH A;  3NVM A;  1RT6 A;  4EZ9 A;  2HNZ A;  4E3S A;  1IH7 A;  1VSF A;  4BWM A;  5AQQ A;  3AV9 A;  2VGM A;  3ZT3 A;  3HK2 A;  2G8K A;  4BEB A;  1S9E A;  4CEO A;  3ZET B;  2Y1J A;  5KPZ A;  3HOS A;  1ZXO A;  2D0P A;  3EE8 A;  2QWR A;  4BRE A;  3E9P A;  4Q5V A;  3CHW A;  2P9U B;  1BHL A;  5C25 A;  2PZS A;  1YHQ N;  5I42 A;  5HLF A;  3LDP A;  2UUA K;  1RCH A;  3R6M A;  4CI6 A;  1BOT O;  3H08 A;  4WF9 L;  3R9P A;  3EO3 A;  2FBX A;  4KB0 A;  1SL2 A;  3O4W A;  4BE1 A;  3THX B;  4EZ6 A;  3LAN A;  1NJY A;  4XH5 A;  3KK7 A;  1JCG A;  5C0Y A;  4B9U A;  4B9N A;  3WQT A;  1NG9 A;  3U3G A;  4H4M A;  2OCE A;  3QIC A;  4CJS A;  1XMO K;  3MK6 A;  5JS2 A;  3HXM A;  1NGI A;  4U67 L;  3QFU A;  3NMU A;  4FJI A;  3KLF A;  1WAF A;  4JHD B;  5EU7 A;  2X6N A;  5EOY A;  1JKH A;  2VWK A;  3CJ9 A;  1KD1 O;  1RGI A;  4FLV A;  4BC4 A;  4EP4 A;  4DQQ A;  1K73 O;  2UU9 K;  3CD6 N;  1BDG A;  4C8O A;  3LPU A;  3HBT A;  3RR8 A;  5AQF A;  2NRV A;  5HRP A;  4M3T A;  1VQ5 N;  4LF9 K;  1ITG A;  1JLF A;  3TAN A;  3V6D A;  1BIZ A;  4WFA L;  4LH4 A;  1NM1 A;  4BE0 A;  1QVG M;  3F9K A;  4CFA A;  1VQK N;  2GEM A;  3AVH A;  3VQ4 A;  1XI1 A;  1DTT A;  4KRF A;  4K25 A;  4CEA A;  1SV5 A;  5TKY A;  3SJJ A;  3AVF A;  1IKY A;  1L3U A;  2O4I A;  4XIU A;  2P9L B;  3HPH A;  4IFV A;  4IEI A;  3MXJ A;  1T7P A;  4FZX C;  3J7A P;  4A57 A;  1YIJ N;  4FWP A;  4K42 A;  4DU3 A;  1NNE A;  2HND A;  2YI1 A;  3G10 A;  5ELZ A;  1YT3 A;  2P1J A;  5AQY A;  3BF3 A;  3OJS A;  3AVI A;  1B9D A;  4J2D A;  1VRU A;  3NH1 A;  4IFE A;  4CHY A;  1RBT A;  4M41 A;  3VQD A;  4CFD A;  3TAM A;  1G99 A;  4KBO A;  2OPR A;  5AQJ A;  4DTN A;  3U9D A;  2CGJ A;  4BVP A;  1NGF A;  1NWK A;  3SPZ A;  4KB1 A;  2HBJ A;  3CCU N;  4ELU A;  4M42 A;  1HKC A;  3ULE A;  2QXL A;  5IT9 O;  4DB3 A;  4PKG A;  4I9Q A;  1E4G T;  1WBB A;  3AAQ A;  1NK9 A;  1VSE A;  1IG8 A;  3PX0 A;  4JI5 K;  3G25 A;  2ITM A;  3HVR A;  4ISG A;  4L3Q A;  3FZH A;  4EIA A;  2YV0 X;  4JI8 K;  2QXF A;  4KFB A;  1ASW A;  4B3S K;  2ZD1 A;  1KXP A;  1Z25 A;  3KLG A;  3E9L A;  4GMJ B;  4FM1 A;  3K5M A;  4AM6 A;  3M1F A;  3AA5 X;  3IUC A;  4DR4 K;  4A59 A;  2O8D B;  4PA1 A;  4PWD A;  3L0Q A;  1XUP O;  3CQY A;  1BA0 A;  3VQP A;  1NGC A;  1BCM A;  1C0F A;  2E1Z A;  5CY4 A;  2EX3 A;  5F2R A;  4BE7 B;  2HVI A;  2E8A A;  4DQ8 A;  3VEV A;  1HR0 K;  5AQW A;  1MWM A;  3DRP A;  5AQK A;  4CIG A;  3LWL A;  3AGR A;  3VEZ A;  4JS4 A;  1SL1 A;  1NK6 A;  2KLA A;  4H5R A;  1NKB A;  3FZM A;  4BGA A;  3ZT0 A;  2OTL N;  2HHH K;  3D6R A;  4O8K A;  3JSM A;  4CZI A;  4KTQ A;  1XHZ A;  5JMV A;  4CHO A;  2IOC A;  2O8E A;  3LAM A;  4CEF A;  3FFK B;  2HVH A;  1ZC6 A;  4E1M A; 
#chains in the Genus database with same CATH homology
 2NRZ A;  3I8B A;  4C1N K;  1RDW X;  5LJV A;  3VER A;  2A40 A;  3SMS A;  2GEL A;  1VQ8 N;  1Z05 A;  3P39 A;  4CBU A;  3ATU A;  5BRH A;  2VYP A;  5AQI A;  5AQV A;  2OTJ N;  4JKC A;  4E1J A;  3WT0 A;  3ID6 A;  4H0O A;  2YCH A;  1KAY A;  2QWQ A;  4A5B A;  3L4Q A;  4YOT A;  3I55 N;  4GNI A;  4YDU A;  3PIP L;  5BN9 A;  3G4S N;  4BGB A;  2QWL A;  2QM1 A;  3QFP A;  1YXQ A;  4MDA A;  4BRF A;  3VEN A;  5AFU A;  3HTV A;  1CZA N;  3C65 A;  3GBT A;  1ATN A;  5AQH A;  1Y64 A;  2CH6 A;  3MN6 A;  3A5M C;  1MA9 B;  3IKM A;  4BG9 A;  4JD2 B;  3KWG A;  4GV6 A;  4JK8 A;  2ASO A;  2C1G A;  3DAW A;  2W40 A;  5AQZ A;  5BRF A;  3U4L A;  3ZX2 A;  3A8Y A;  3O9T A;  3ZET A;  3J7Z O;  3O80 A;  3VF4 A;  1NLV A;  4IJN A;  4BY9 C;  2HBL A;  3UE5 A;  3N4Q A;  5B8H A;  2IIR A;  3WUH A;  4PL8 A;  4FWO A;  3DLL L;  4UY8 O;  4KH5 A;  2NRT A;  3SBT A;  2BUP A;  2NRH A;  3BF1 A;  1DKG D;  4IJA A;  4OPH A;  2P9U A;  2IVP A;  3VOV A;  2J4R A;  4JKH A;  1K8K A;  3C7N B;  5M1Q A;  4QS9 A;  4DKW A;  4H0X B;  5BN8 A;  1VQ9 N;  3F2K A;  4B1V A;  4CZK A;  3L4I A;  4EHU A;  4ISE A;  2W41 A;  4KH4 A;  4BEC A;  5EY4 A;  3LDQ A;  4IOC L;  4JKG B;  1VQ6 N;  1YJN N;  2F9W A;  1Q81 O;  2GUP A;  5BPL A;  3O9S A;  3GG4 A;  1HKG A;  2P9S A;  2FXU A;  3TSP A;  4RTF D;  5AQR A;  2V7Y A;  3GOI A;  1P8Z A;  3HI0 A;  3MCA B;  3OBW A;  4I6M B;  3VMF B;  2YJF A;  1NGJ A;  3BP8 A;  2FSN A;  4J8F A;  4K43 A;  4A2B A;  5ADX H;  2YHW A;  5AQM A;  4BR0 A;  3TU5 A;  5C2F A;  1RFQ A;  4BRK A;  5FPD A;  2CGL A;  1S22 A;  4FOI A;  2YJE A;  4IZ9 A;  4FWR A;  3H45 C;  3EKU A;  1W97 L;  4FPB A;  5AR0 A;  1T44 A;  4JHD A;  4ISF A;  4F9O A;  5LJW A;  1TYQ B;  3SAG A;  2HBK A;  3BEX A;  4H0T B;  4EFH A;  2PBD A;  1X3M A;  4ILH A;  3FE1 A;  1VQO N;  4MLH A;  3RSE A;  2P9K B;  1SQK A;  1U2V B;  1YIT N;  4FWN A;  3R3L A;  2WUS A;  2AP1 A;  3O08 A;  1E4F T;  5I9E B;  2QWP A;  3CCL N;  4JAX A;  1WOQ A;  3O6W A;  2ZJP L;  3CCM N;  4K41 A;  4MLE A;  3WQU A;  2CH5 A;  1TUY A;  4HTL A;  3SMP A;  5GIO A;  5M1P A;  4B9Q A;  5DM6 L;  3D2F A;  2Q97 A;  3HOT A;  5BR9 A;  3FZL A;  5CHI A;  5CR4 A;  3LL3 A;  2V7Z A;  3VEY A;  2VGN A;  3HZ6 A;  4BVO A;  1BO5 O;  1BG3 A;  2HBM A;  3E66 A;  2IVN A;  3ULE B;  4BR7 A;  2A5X A;  1DT9 A;  4CBX A;  3LM2 A;  3ATV A;  4BR2 A;  2P9L A;  2E2O A;  4CZL A;  5M1N A;  2DPN A;  1YVN A;  3MX5 A;  4Y0W A;  4YDU C;  5MLC Q;  1WUA A;  2QI2 A;  4FVU A;  3A0I X;  5BPM A;  3H1Q A;  3CI5 A;  1LCU A;  3CET A;  3OA9 A;  1HUX A;  4FWL A;  4LC9 B;  4NLB A;  1H1V A;  3FZF A;  1EO1 A;  1VQN N;  1OKJ A;  4A62 A;  3RVC A;  1JJ2 M;  1YJ9 N;  1SZ2 A;  3O1B A;  1HLU A;  3WXJ A;  3DJC A;  2D4W A;  1V4S A;  2OAN A;  4H5W A;  3TSQ A;  3ZEU A;  3ZX3 A;  3I56 N;  4IOA L;  1SS6 A;  3CCR N;  3FLC O;  5GAG P;  3Q7C A;  2FLO A;  5HOO A;  3CCE N;  3QBX A;  1Z6R A;  4YOV A;  3DXM B;  5FPE A;  3VEW A;  4CZH A;  4WQ4 A;  5EVZ A;  4MO5 A;  3QBW A;  2ZF5 O;  5DM7 L;  1EQY A;  4H0P A;  3TSU A;  3C7N A;  3VF6 A;  1X3N A;  3VGL A;  1Q86 O;  2BTF A;  2E1Y A;  5AZI A;  1BUP A;  1QHA A;  2V51 B;  2NNW A;  3JXU A;  3VEX A;  1KC8 O;  1GLB G;  3ENB A;  2VCP A;  4GV9 A;  3UKU B;  2Q0R A;  1SAZ A;  2QW9 A;  3MN7 A;  4JK9 A;  5JVH L;  1HPM A;  4BRO A;  4BRP A;  2D1K A;  4WFN L;  1QQN A;  2ASM A;  3A5O C;  5AQP A;  5JLH A;  4RWT A;  1NJI O;  1GLF O;  2HF4 A;  5AQO A;  5AQL A;  5GAD P;  2QEX N;  4WYB A;  1K8A O;  4IDH A;  2NRX A;  3SK3 A;  2NRW A;  3CPE A;  1NMD A;  2UYT A;  3H3O B;  3T69 A;  4BQZ A;  5JLF A;  2F7T A;  3H1V X;  3K9K A;  3P4I A;  2Q1N A;  4CJ7 A;  1VQL N;  3ENO A;  1NGA A;  2V52 B;  3CME N;  4CZE A;  2NLX A;  2P9P A;  3K9J A;  5F1X A;  3DXK A;  4ILG B;  4EAH D;  1MDU B;  3BUZ B;  1N8R O;  2P9N A;  3I33 A;  1BWF O;  2ZWH A;  2P9I A;  4FO0 A;  4IEE A;  4B1X B;  4CZF A;  2QA4 N;  4HWI A;  4JEP A;  3WEE B;  4YOU A;  3M3Z A;  1GLJ O;  3WXL A;  1W2B M;  4FWK A;  4H0V B;  4JKB A;  3SJH A;  3U8X A;  5BPN A;  4BRD A;  3PIO L;  2P9K A;  1NBW A;  1U2V A;  2ASP A;  3D7E O;  3LDO A;  4FWM A;  2RHK A;  3WXI A;  1IJJ A;  4C23 A;  1DEJ A;  3GDQ A;  5GIN A;  2ZJR L;  3AAP A;  3KWI A;  4M7X A;  4O5F A;  5ADX A;  5EXW A;  1QZ6 A;  1NGG A;  3B8A X;  3VTI A;  1GLD G;  4YOX A;  5AQG A;  4NB4 A;  4BC3 A;  3CJB A;  2NRR A;  5KPR A;  3VTH A;  2KHO A;  4FOE A;  3LDL A;  4CZJ A;  4XEI A;  3VF2 A;  3O9R A;  4OPA A;  1C0G A;  3MN5 A;  5AZJ A;  3LDN A;  4R79 A;  4M63 C;  5AQU A;  3A5N C;  3UKR A;  4B1Y B;  4BRH A;  1XC3 A;  1YAG A;  3QML A;  4GV3 A;  3D2E A;  1T3V A;  4Z94 A;  3NVM A;  3CCQ N;  4FWS A;  1T6C A;  5KQD A;  4KH6 A;  1K9M O;  2ZGZ A;  4RCH A;  3U9Z A;  4BRG A;  3CJC A;  5AQQ A;  3WXK A;  1KAX A;  5FPM A;  4WQ5 C;  4BRQ A;  2A6A A;  2Q36 A;  4CBW A;  4A61 A;  2VGM A;  4EHT A;  3MX2 A;  3TTC A;  3JS6 A;  4BEB A;  4CD3 A;  4H5V A;  4JN4 A;  3C0B A;  1KQS M;  1YF5 L;  3H3N O;  3ZET B;  3CCV N;  2WC9 A;  3CPW M;  1XQS C;  3CJ7 A;  1M90 O;  3VPZ A;  5KPZ A;  3HOS A;  1U6Z A;  1ZXO A;  2D0P A;  3EE8 A;  1Q18 A;  2QWR A;  1HX1 A;  4BRE A;  3E9P A;  2I7N A;  1Q82 O;  3CHW A;  2Q0U A;  3GL1 A;  3IMX A;  2P9U B;  1YHQ N;  3AAR A;  3LDP A;  3O1W A;  4JNE A;  4WQ4 C;  3R6M A;  4IO9 L;  5KQ8 A;  2E2P A;  4CI6 A;  4BRC A;  1BOT O;  2FF3 B;  2GX9 A;  3R9P A;  1O13 A;  3UKU A;  4WF9 L;  3EO3 A;  2W00 A;  3IFR A;  3O4W A;  2C1I A;  2A42 A;  1HJO A;  3G71 N;  4XH5 A;  3KK7 A;  4XH1 A;  3G6E N;  3MN9 A;  1JCG A;  3VEO A;  3NVK A;  5C0Y A;  1ATS A;  3ID8 A;  3WQT A;  2GTD A;  4G9Z A;  4BR4 A;  4JD2 A;  3VES A;  5JVG L;  3O9U A;  3QIC A;  3MK6 A;  1NGI A;  3R1X A;  4U67 L;  3QFU A;  2YHY A;  3MCP A;  3NMU A;  3CC2 N;  2BH1 A;  4WFB L;  2E20 A;  4JHD B;  2ZJQ L;  3MMV A;  5EOY A;  4BQL A;  1BA1 A;  4BRA A;  3CJ9 A;  4AM7 A;  4BRI A;  5M1F A;  1KD1 O;  1RGI A;  1VQM N;  1TUU A;  2EWS A;  3H6E A;  3KZB A;  2JWL A;  1T6D A;  3KVG A;  5KPT A;  3RSE B;  4BC4 A;  5BRE A;  1K73 O;  2WBN A;  3FR0 A;  3CD6 N;  1BDG A;  1S3X A;  2Q31 A;  1QQM A;  4PL7 A;  1ATR A;  2JWK A;  3L6Q A;  4PKI A;  3HBT A;  4JKG A;  5E84 A;  5F0X A;  3EE9 A;  5AQF A;  3CC7 N;  2ZGY A;  4QS8 A;  2NRV A;  1X9J A;  1QVF M;  1VQ4 N;  1VQ5 N;  4MO4 A;  3O5B A;  4BRL A;  3D2F B;  4YOR A;  2A3Z A;  4I6M A;  5AQT A;  4WFA L;  1QVG M;  1NM1 A;  1OVY A;  3VGM A;  1VQK N;  2GEM A;  1VAZ A;  1KAZ A;  3GE1 A;  2GWJ A;  4K25 A;  1ZBS A;  2PAV A;  2E2Q A;  5TKY A;  4YOW A;  1YUW A;  1YJW N;  2QTD A;  2P9L B;  1NGB A;  4M7Y A;  2HOE A;  4IEI A;  1QZ5 A;  5FPN A;  4DCH A;  4A57 A;  1YIJ N;  1TYQ A;  3CER A;  3FGU A;  4H0Y B;  2E88 A;  4O8U A;  3H46 O;  3SAF A;  3M6G A;  4FWP A;  4K42 A;  3SAH A;  4A5A A;  1P90 A;  5M1O A;  4NLC A;  2YI1 A;  1VQP N;  1VQ7 N;  4PKH A;  3F9M A;  1LOT B;  5ELZ A;  5TKW A;  3CMA N;  5AQY A;  3BF3 A;  3C6H A;  3HSC A;  3O8M A;  4JKA A;  5AQX A;  5AFU H;  2GWK A;  3DWL A;  3ZEU B;  1NGH A;  3CQX A;  1HKB A;  4FPA A;  3T7Z A;  4BRN A;  3KHY A;  2YX6 A;  4JKF A;  3CF5 L;  4IFE A;  1V4T A;  3S41 A;  4BC5 A;  4AF1 A;  5AQS A;  3C6A A;  1G99 A;  3SBG A;  4KBO A;  3ZYY X;  4MDB A;  5AQJ A;  3U9D A;  3CXC M;  2CGJ A;  5JIC A;  4BVP A;  1NGF A;  5AZI B;  1NWK A;  2QWM A;  3E1Y A;  3OW2 M;  2HBJ A;  1M1K O;  3CCU N;  2RE2 A;  2QWN A;  4IWV A;  4QS7 A;  1HKC A;  3ULE A;  2QXL A;  2E2N A;  4GVE A;  4DB3 A;  1DGK N;  4PKG A;  1E4G T;  2VWB A;  3AAQ A;  3P31 A;  1R59 O;  1IG8 A;  3LM9 A;  3G25 A;  3M5R A;  4CZM A;  5LY3 A;  1ESV A;  3MWT A;  2NZT A;  3CCS N;  2ITM A;  2YHX A;  4IXC A;  2F9T A;  4IO8 A;  4ISG A;  3SLC A;  3W3D A;  4L3Q A;  1GLA G;  3R8E A;  2HST A;  3A5L C;  1D4X A;  3CCJ N;  3P38 A;  4CZG A;  2AA4 A;  3FZH A;  4EIA A;  3WXM B;  5AQN A;  4OO1 J;  1RDU A;  4BRM A;  2P9P B;  2FSJ A;  3DXK B;  3CJ1 A;  5C2D A;  2WFB A;  1KXP A;  2P9N B;  4FSV A;  4JKD A;  4FL9 A;  2P9I B;  5C12 A;  4GY2 B;  3E9L A;  5BRD A;  1YI2 N;  3Q7B A;  3EL2 A;  4AM6 A;  3DXM A;  3M1F A;  1K8K B;  3VET A;  3IUC A;  3TTD A;  3MDQ A;  4B1W B;  2HF3 A;  4A59 A;  5HL7 L;  3J8A A;  2H3G X;  5H1S Q;  2IVO A;  3CIP A;  1GLL O;  4ILJ A;  4NO7 A;  5E26 A;  5C10 A;  3L0Q A;  3MWP A;  1XUP O;  2D0O A;  3CQY A;  2I7P A;  4XH4 A;  3N4P A;  4BC2 A;  3ZX0 A;  4H03 B;  1ILY A;  1BA0 A;  2A41 A;  1NGE A;  1NGC A;  4H5N A;  1NGD A;  4XJX A;  1C0F A;  3O9Q A;  2E1Z A;  3IDH A;  2P9S B;  1Q7Y O;  1JCE A;  5F2R A;  4BG8 A;  4BE7 B;  4DHY A;  1J6Z A;  2E8A A;  3EN9 A;  4DQ8 A;  3AGK A;  3TPQ A;  5EX5 A;  3HM8 A;  3VEV A;  3ENH A;  2QWO A;  4YOY A;  3PLA A;  5AQW A;  4C1N I;  1MWM A;  5AQK A;  1JCF A;  3QDK A;  5M1K A;  5AZJ B;  5GAH P;  4U7B A;  5GAE P;  3F5T A;  2CGK A;  4WCE L;  3AGR A;  3UKR B;  3VEZ A;  5GIP A;  3VGK A;  4CD1 A;  1GLC G;  3CC4 N;  3D2E B;  3FZK A;  3OBY A;  2KLA A;  4H5R A;  3OHR A;  4WQ5 A;  3CJA A;  4BR9 A;  3FZM A;  3W0L A;  2FF6 A;  4JKE A;  4BGA A;  2HMP A;  4FWQ A;  3QB0 A;  3WEE A;  4H5T A;  4B1Z A;  4JK7 A;  3AY9 A;  2FSK A;  4IOX A;  2OTL N;  2Q2R A;  3D6R A;  3E9O A;  4O8K A;  1MWK A;  4CZI A;  5CE3 A;  4BR5 A;  2PFU A;  3UB5 A;  5JMV A;  1QQO A;  4PHT X;  3FFK B;  3EKS A;  3TTF A;  4A2A A;  5C15 A;  1BU6 O;  4B1U B;  3EZW A;  3HRG A;  1S72 N;  1ZC6 A;  1GLE G;  2KKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...