1K8KA

Crystal structure of arp2/3 complex
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
416
structure length
401
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords ACTIN-LIKE PROTEIN 3
publication title Crystal Structure of Arp2/3 Complex
pubmed doi rcsb
total genus 130
structure length 401
sequence length 416
ec nomenclature
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1k8kA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1k8kA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1k8kA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1k8kA04
4Y0WA 4CD3A 2A3ZA 3D2EB 4FO0A 5TKYA 3ATVA 4B1YB 5AQLA 1TUYA 2D0OA 3CJAA 1GLDG 2E20A 2ASOA 4DHYA 4ISFA 3KZBA 4JD2A 2P9LB 4CBWA 3I8BA 1MA9B 3BUZB 5BRDA 2D1KA 4JHDB 2E2OA 4BG9A 3FZFA 3FZMA 2BUPA 5JICA 1CZAN 4A61A 3RSEA 1WUAA 2V51B 3A8YA 4BGBA 4BRAA 1TYQA 4ISEA 1V4TA 2P9SB 2E1ZA 4DCHA 2ZF5O 2NRHA 3VEOA 1NGJA 1XQSC 2W41A 3GL1A 3ZEUA 2ITMA 1HKBA 4K43A 3CJ1A 3L4IA 4BREA 5BRHA 3VGKA 3CHWA 1NGGA 3VENA 1JCGA 3QICA 2PBDA 4AM7A 1OKJA 5B8HA 1TUUA 4BR0A 2Q36A 3A5MC 3M1FA 5JLHA 4MLEA 2GWKA 3WEEB 5FPDA 1D4XA 3UKRB 3SK3A 5AZJA 5BPNA 1X3NA 5AQRA 4A62A 3CQYA 4BG8A 3LL3A 3M3ZA 2A42A 4JNEA 1NGBA 2OANA 2F9TA 1HX1A 1E4FT 1T6DA 2Q97A 5EXWA 4H0PA 4CZMA 2E2QA 2QM1A 3O4WA 3G25A 3UB5A 4GY2B 1MWKA 2QWRA 3MN6A 5LJVA 2P9NA 3IFRA 3BF3A 3ZX0A 1J6ZA 2V52B 4WYBA 2YJEA 2YHXA 4WQ4A 1RDWX 1BUPA 2IVPA 5AQIA 3A5NC 4BRLA 5EVZA 5FPNA 3O6WA 4K42A 1G99A 1ZBSA 2P9PB 1BG3A 3VGMA 3CI5A 5AQMA 2GEMA 4CZKA 3EKUA 4QS7A 5ELZA 4BC2A 3O80A 2P9KA 3O8MA 2CH5A 1HLUA 3MK6A 4FWNA 5JLFA 4FPAA 1NWKA 1WOQA 4QS9A 4B1ZA 4BC4A 1V4SA 1DGKN 1HJOA 3SJHA 4BC3A 3VERA 1QQMA 3H1QA 3QFUA 3JXUA 3WQUA 4CBXA 2QWQA 2QWMA 2YCHA 4B1XB 5BRFA 1C0GA 5EY4A 1XC3A 1ZXOA 3F9MA 3GBTA 4Z94A 4KBOA 2QXLA 4CZJA 3M6GA 2YHWA 3FZLA 5E84A 4BRGA 3D2FA 4F9OA 1KAXA 4FL9A 3QFPA 2HOEA 4H0XB 5KPTA 4EHUA 1GLFO 4BRIA 3A0IX 1LCUA 3AAQA 3B8AX 3EO3A 5AQWA 5AFUH 4BRPA 5BR9A 2HF3A 5AR0A 3VEZA 1DKGD 2I7PA 1LOTB 4C23A 3D2EA 1JCFA 2A6AA 2F9WA 3DXMB 3QBXA 4H0YB 4K25A 4NO7A 4BVOA 3LM2A 4BC5A 2P9LA 2Q1NA 4RWTA 5AQVA 2GUPA 4IZ9A 3ULEB 3UKUA 3CJ7A 4IO8A 4PL7A 3W0LA 1U2VA 3L6QA 3C7NB 4JHDA 2GTDA 3VEXA 4BRDA 4PKGA 3VF6A 1U6ZA 3H1VX 3UKUB 5FPEA 4PKHA 1U2VB 2P9SA 1GLBG 4CZFA 4FSVA 3U9DA 4A2BA 5KQ8A 1T6CA 3IMXA 1GLAG 4EAHD 5ADXA 3ENHA 3DAWA 3GDQA 3HSCA 4J8FA 2CH6A 2Q0RA 3LDPA 3HBTA 2ZGZA 3AAPA 1DEJA 1KAZA 2FSKA 1BU6O 1NBWA 2VWBA 1ATSA 3BF1A 5AQOA 3VETA 4XH4A 3WEEA 4DB3A 3ZETB 2YI1A 3UKRA 3H46O 4B1VA 4B1WB 4HWIA 4I6MB 4L3QA 4H0VB 4FPBA 4MO4A 2EWSA 1XUPO 3O1BA 2E8AA 1BA0A 3DXKA 4HTLA 1BA1A 3WXIA 2ASPA 3VESA 1NGHA 4YDUC 1RFQA 2GELA 4BROA 4XEIA 3WT0A 4CZLA 2GWJA 1X9JA 3AY9A 3LDQA 3DXKB 4YDUA 1YUWA 1YAGA 1BWFO 2NLXA 3OHRA 4IXCA 5I9EB 5KQDA 3LDOA 1SQKA 3FR0A 4O8KA 1ATNA 3WXLA 2P9IB 2PAVA 5AQKA 4BR2A 3H3NO 4WQ4C 1HPMA 5AQSA 2FLOA 5AQQA 1R59O 2P9PA 1SAZA 5AFUA 5EX5A 3VGLA 2I7NA 5AZIA 2E2PA 3A5LC 3LDLA 3QDKA 3WUHA 4QS8A 3A5OC 4BRKA 1ATRA 4FWMA 1K8KB 4BQLA 1Y64A 4FWKA 4A2AA 3WXKA 5AZIB 1IJJA 1BO5O 1MWMA 5AQYA 3QMLA 5AQUA 3CJCA 5BPMA 5AQHA 1T44A 4ISGA 5BN8A 2QWOA 4H5RA 5KPZA 3TPQA 2A5XA 4M7XA 4LC9B 4GNIA 2E88A 2UYTA 1ZC6A 4BR4A 3MN5A 3FGUA 3TU5A 3CETA 3CJ9A 3VF2A 2FSJA 1QZ5A 3UE5A 1RGIA 1EQYA 3HM8A 3DXMA 3HTVA 1Z05A 1NGDA 4EFHA 1QHAA 4CD1A 5AQFA 4EHTA 2IVNA 3FZHA 4WQ5C 5BREA 2YHYA 4CBUA 4CJ7A 2HMPA 3MMVA 4CZEA 3ULEA 4H5WA 4B9QA 5CE3A 4FWLA 3C7NA 4WQ5A 5AQPA 1JCEA 2J4RA 3H3OB 3H6EA 5F1XA 5JMVA 3MN7A 4BRNA 2QWPA 1E4GT 5KPRA 4CZGA 1HKGA 1NGCA 4H5TA 3O5BA 2E1YA 3U8XA 4O5FA 2V7YA 4PL8A 3EN9A 2WUSA 3LDNA 1NMDA 4DQ8A 4M63C 4BRFA 4H5NA 2AP1A 4B1UB 1X3MA 2A41A 2DPNA 3IDHA 4FWPA 1NLVA 3LM9A 2CGLA 3L0QA 4BQZA 1BOTO 4H0TB 3D7EO 4XH5A 5F0XA 4H03B 5AQTA 1QZ6A 4BRHA 4FWQA 3WQTA 3GG4A 4CZHA 4IJNA 5LY3A 3R9PA 1MDUB 1IG8A 5AQXA 3VF4A 3ZETA 5AQZA 3VEVA 2H3GX 3KHYA 4I6MA 2HF4A 4BR9A 4FWRA 3HI0A 4JD2B 4EIAA 1KAYA 2FF6A 3FLCO 1S3XA 1ESVA 1NGEA 4M7YA 5AQNA 3SMPA 3MDQA 3U4LA 4E1JA 2D4WA 3WXJA 2E2NA 3FZKA 3RSEB 3VEWA 4BR5A 1TYQB 3BP8A 1HUXA 1Q18A 1GLCG 4CZIA 4BRQA 2FF3B 3P4IA 2P9IA 2VCPA 4MLHA 3CJBA 3ZEUB 1H1VA 1HKCA 4XH1A 1GLJO 3ZX2A 4AM6A 1NGFA 5BN9A 2FXUA 3CERA 3FE1A 2P9UA 1NGIA 3KVGA 3O08A 3GOIA 4BRMA 2Q2RA 3JS6A 3MCPA 3BEXA 4BRCA 5BPLA 1S22A 2Q0UA 3DJCA 5E26A 4FOIA 2QW9A 1GLLO 2P9UB 2KHOA 1K8KA 1C0FA 2YJFA 3DWLA 3H45C 3QB0A 5AZJB 3FFKB 5AQGA 3O1WA 4IWVA 4BVPA 5ADXH 1Z6RA 4H0OA 2A40A 1NGAA 1YXQA 2D0PA 3QBWA 2FSNA 5EOYA 5AQJA 4FWOA 3I33A 3EL2A 4K41A 1SZ2A 3EKSA 2P9NB 5LJWA 3HZ6A 2Q31A 2V7ZA 1QQNA 2BTFA 1BDGA 4RTFD 1P8ZA 3VOVA 3C0BA 3ID8A 3ENOA 4IJAA 3VEYA 2IVOA 4NB4A 1QQOA 3CQXA 4BGAA 3ATUA 2P9KB 1YVNA 3ZX3A 1GLEG 3MN9A 2ZWHA 3S41A 3CIPA 4H5VA 5FPMA 2ZGYA 3R8EA 3J8AA 4FOEA 2CGJA 4JN4A 3GE1A 1KXPA 3U9ZA 2NZTA 3W3DA 4BR7A 3AARA 2QWLA 3VPZA 2AA4A 3D2FB 3IUCA 3EZWA 4CI6A 5F2RA 4JAXA 2ASMA 2W40A 4MO5A 2IIRA 3SLCA 4PKIA 3SMSA 2VYPA 4FWSA 2QWNA 4RCHA 2CGKA 1NM1A 3R6MA
chains in the Genus database with same CATH superfamily
2NRXA 1YTAA 5M1QA 1RBRA 3D2EB 4JI8K 2KTQA 1L3UA 1TUYA 1GLDG 2E20A 2ASOA 1RT2A 4IDKA 4YHHK 3O3GA 1YF5L 1VQNN 1B9DA 2BDPA 3M8RA 4ID1A 1RTHA 4F3OA 1MA9B 2DFFA 5BRDA 3OYKA 4KTQA 1IV0A 4JHDB 1C1BA 3LAMA 3CFRA 1JLEA 2OA8A 4I2QA 4ISEA 4DCHA 2ZF5O 3C95A 3J80O 4BDZA 3OYIA 4Z4IA 1NGJA 2W41A 3GL1A 2ITMA 3AVNA 1HKBA 3D45A 4MQ3A 3HO1A 3L4IA 3M8PA 4DTMA 3S5TA 2OTJN 4O4GA 4DV2K 4FLVA 3VENA 4A57A 3QICA 1OKJA 4OKJA 3TAEA 4BR0A 1NK9A 2Q36A 3AGRA 1HYZA 3A5MC 1D4XA 5HRRA 4KHUA 1X3NA 4HUEA 4I7FA 3M3ZA 1TVRA 4JNEA 1TK5A 1NGBA 1RTIA 1Q8IA 2OANA 2F9TA 1O13A 4DTJA 1RBSA 1YJWN 1BQMA 3Q7BA 3KLGA 3SV4A 3OS1A 3O4WA 3VQAA 1CXQA 2QWRA 3TAFA 3L8BA 1LWFA 2P9NA 5LJVA 3MXMA 3KWGA 4CHNA 2JWLA 2QKKA 1J6ZA 1G15A 3J81O 1A5XA 3CXCM 4MFBA 4WQ4A 5J2QA 1RDWX 3T19A 1RTDA 3A5NC 1EETA 4K42A 1HQEA 2QXFA 2ZQBA 3HOTA 1J5OA 2W42A 3VGMA 1BG3A 4FJ8A 4KHPK 1QSSA 4DV5K 3CG7A 2CH5A 3MK6A 1W9HA 2P5OA 1WOQA 4K8ZA 3ZSYA 1HJOA 4H4OA 3H1QA 4CBXA 4KO0A 4O0IA 1HNWK 2QWQA 2QWMA 4DMNA 5BRFA 4GV6A 4DSKA 2O8BB 2UUCK 2QXLA 4CZJA 5D3GA 3NAEA 2C1GA 3NBPA 4BRGA 4OX9K 2OZMA 2FBVA 2YX6A 2UXDK 1Q9XA 1T7PA 1CLQA 3S3NA 1UAXA 2HOEA 3NF9A 4EHUA 4BRIA 3EO3A 4KAZA 1JLBA 3VEZA 4CESA 3D2EA 3LWMA 3SBGA 4E7LA 3F9KA 2A6AA 2F9WA 3QBXA 1K6YA 3K5LA 3VQ5A 4CEOA 4J2AA 4GKKK 1M1KO 4RWTA 5T7BA 3P31A 3CJ7A 1NJXA 4JHDA 4CJLA 4PUOA 4KI6A 1E3MA 4FJ9A 4PKGA 3UKUB 5FPEA 1U2VB 4JKHA 1GLBG 3WNEA 4CZFA 5M1KA 4FCYA 4A2BA 1T6CA 3NF6A 2G8VA 1KFDA 3HSCA 4B3SK 4E7KA 3HBTA 2ZGZA 3RMBA 4DQSA 3OYLA 4DQRA 2VWBA 2HNZA 1ATSA 5AQOA 1KQSM 4Z4GA 4XH4A 3K5NA 4C8KA 3NH1A 3H46O 4B1VA 4B1WB 1B9FA 4I6MB 4BE0A 2NRVA 1S1XA 3OYEA 2EWSA 3CC7N 4FLTA 2IDOA 4HTLA 1BA1A 4IFEA 4YDUC 2GELA 3PX0A 4C8LA 2E4LA 4XEIA 4IOXA 4KKOA 4WFNL 4BDPA 4DU4A 3AY9A 4FK2A 2FC0A 3K9JA 4PWDA 1YUWA 1RT5A 1S5JA 5A2QO 5M1PA 3QINA 3PIOL 2P9IB 3K5OA 3H3NO 1HPMA 3EZ5A 1WSIA 3MEGA 4UY8O 4HVJA 1JXEA 2BH1A 4OLAA 1OH8A 2OPPA 4DU1A 3VGLA 2I7NA 3V81A 5C42A 2E2PA 2OPQA 3LDLA 3QDKA 1ASWA 4QS8A 2G8FA 3A5OC 4BRKA 3M8SA 1QHTA 1ATRA 4MDBA 5AZIB 1MWMA 2O8BA 1D9DA 4CHYA 4ISGA 5BN8A 1W0HA 4H5RA 5KPZA 4JKGB 3NH0A 3THYA 3VA0A 3SQ1A 2A5XA 4M7XA 1KC8O 3IS9A 4NCAA 3VQCA 3I8DA 1BQNA 2W6KA 5AJ3K 3TABA 4BR4A 1WN7A 1D5AA 5TKWA 1SUQA 3CETA 1XMOK 4KB0A 3QLHA 3CJ9A 1Q82O 4AHTA 1Z26A 2PY5A 1RGIA 3PX6A 4Z4FA 2KFZA 5DM7L 1N8RO 3PIPL 5HRSA 4DFMA 1KCFA 1XNQK 4FJ5A 3FZHA 1RDAA 1FW6A 4G1QA 1BCOA 4CBUA 4JKCA 2UUBK 4CZEA 3PX4A 3DLHA 2BANA 1U47A 1P90A 3H6EA 5GAHP 1E4GT 5KPRA 1NGCA 4O5FA 4PL8A 1NMNA 3LDSA 3NGYA 3R3LA 3WNGA 1TKZA 3NDKA 1NMDA 4DQ8A 3OYGA 4M3UA 2QA4N 4H5NA 2PZSA 3SUNA 4E7JA 4FWPA 1NLVA 2HNDA 3L0QA 1BOTO 4H0TB 4CJWA 4XH5A 5F0XA 3KK2A 3SZ2A 3GG4A 4CZHA 3MX5A 1MDUB 1HR0K 1IG8A 5FLXO 1T3VA 5AQZA 3OBWA 4JRQA 4IDHA 2H3GX 3ULDA 3KHYA 4I6MA 1IKYA 4FWRA 4YFUA 1Q9YA 4CJRA 1KAYA 1NG9A 1ESVA 1NGEA 1WSGA 4M7YA 2F8TA 1RBUA 4FM2A 2C1IA 4E1JA 4B9VA 3ZSZA 3L3UA 3K57A 3L2WA 3RSEB 5IWAK 3CCSN 3OYMA 3K9KA 1TYQB 5J2PA 1KD1O 3G0ZA 1Q18A 3VQ4A 3HPOA 4GKJK 4CZIA 4BRQA 4M3RA 1IH7A 2E5LK 1LW2A 2P9IA 1MU2A 1K8AO 2VCPA 4MLHA 5KRSA 2QEXN 4XH1A 2ZE2A 2FXUA 1XWLA 1IBKK 2P9UA 4OPAA 4QCLA 3KVGA 3O08A 3QEVA 3SPYA 3GOIA 4CEFA 1Q7YO 3JS6A 1VSHA 4BRCA 4CJ5A 4DS4A 3G71N 4CJ4A 2IOCA 1HYVA 3ASMA 2WONA 3AA2A 4A5BA 3VQBA 4RW4A 4ZTFA 2HBJA 4CGFA 3H45C 5AZJB 4PQUA 2IS3A 2FBXA 1HNXK 4IWVA 3THXB 4CCHA 1BGXT 2DFEA 2HB5A 4ELVA 1NGAA 4B9TA 4KREA 3KD1E 4JKGA 3KKSA 3QBWA 2FSNA 4O55A 4DSFA 3KD5E 3VQEA 5EOYA 1LAVA 3AO5A 3I33A 3EL2A 1SZ2A 3VN5A 4N56A 3QERA 3TI0A 3ALYA 2G8UA 4CEDA 3KJVA 1QS4A 1WBBA 4L8RB 1P8ZA 3EY1A 3C0BA 4C8NA 3ID8A 4JLHA 3VQ7A 4Y1DA 3VQPA 1U04A 3CQXA 3V4IA 1C6VA 5GADP 2HSTA 1IO2A 3K2PA 1A5WA 1NNEA 4JN4A 3ZT0A 3KLFA 1SS6A 4KHYA 4NCBA 1OVQA 3T1YK 3CPEA 4FLUA 3IAYA 3S3MA 4CHQA 3OS2A 2AA4A 3AVAA 3G6EN 2FBTA 2XHBA 4M45A 3EZWA 2D0BA 4E1NA 4DR1K 1RT3A 4LF4K 2NRRA 3OYFA 4C1NK 4ILHA 1VQ9N 3DLLL 4PKIA 3SMSA 1QSLA 4E19A 3BGRA 4O8UA 2CGKA 1OVYA 1VK0A 3AA3A 4FJIA 4CD3A 5TKYA 3ZT4A 4JV5K 2D0OA 4DR3K 4ISFA 1NOYA 2BGGA 1QSYA 4HTUA 4WFBL 3OS0A 3NE6A 3P38A 4LSNA 3AA5X 3BUZB 1NK7A 4BACA 2VGMA 3CFOA 3FZFA 2BUPA 3RSEA 4U7BA 3OYJA 4F2SA 4BRAA 1TYQA 1I39A 4E72A 4DR6K 2P9SB 2E1ZA 1R0AA 4AILC 1VRUA 3VEOA 1VQPN 4DR4K 1WSEA 3SUOA 3J7AP 1C0UA 1UWBA 4DUYK 4M3XA 1N32K 3PO5A 1S9GA 2Z1GA 5SWMA 4E89A 1L5UA 2PBDA 4ILGB 5B8HA 1TUUA 1SKRA 4CGHA 4MDAA 5FPDA 3CC2N 4W5QA 3SK3A 5AZJA 4ZTJA 1W7AA 3THXA 4W5NA 1J9AA 2A42A 5CYMA 1HX1A 3HRGA 1E4FT 1T6DA 3DRRA 4CF8A 4EZ6A 4H0PA 2QM1A 2X6NA 3UB5A 2AJQA 1MWKA 3C6UA 1TK8A 1YHQN 1W2BM 1RDCA 3EE9A 2JGUA 1IG9A 4B9SA 4WYBA 2YHXA 4BRLA 1ZBLA 1EKEA 4FVMA 1JKHA 5CY4A 3O6WA 5FPNA 4CFCA 4JKAA 3TAMA 4J2DA 4QS7A 4BC2A 3O80A 1NJZA 3O8MA 4RW8A 4YNQA 3SAFA 1JLGA 1DGKN 3EYZA 1QQMA 3QFUA 3WQUA 4OPKA 1RT6A 3ZSXA 2YCHA 4B1XB 3D0PA 1C0GA 4DF4A 2KKZA 1XC3A 2NUBA 4BECA 1C1AA 4CK3A 4Z94A 4KBOA 3HK2A 1D9FA 5E84A 3CPWM 2W6LA 4YORA 3THVA 1BIUA 4AQYK 1JL2A 4H0XB 3O9QA 1GLFO 3K58A 3A0IX 1Q81O 4BRPA 5BR9A 4DLGA 1DKGD 2YNGA 5LMUK 2OYQA 4C8OA 4OPJA 1JCFA 4CFBA 1J53A 4E0DA 3D6RA 4F3TA 2Q1NA 4FJXA 2GUPA 1ITGA 5M1OA 1WNSA 3OYBA 1HNIA 3C7NB 3NGIA 3VEXA 4BRDA 2QI2A 5CR4A 4DTXA 1T03A 3TAQA 3KWIA 3H1VX 4PKHA 4N5SA 3MAQA 2P9SA 4B9LA 3U9DA 3O9SA 4OGEA 4DG1A 3LP1A 4B08A 4EAHD 4YOXA 3O4NA 2DY4A 3DAWA 4JS5A 3CFPA 4BEBA 4B9NA 4IKFA 1ZBFA 2CH6A 3CF5L 1N36K 3V9SA 3AAPA 3AVMA 2YKNA 3AO4A 1N5YA 1NBWA 4DR7K 1T8EA 4FJMA 3O4QA 3VETA 2G8WA 4JK8A 1U48A 4HWIA 4DUZK 4CEAA 4IBNA 4MO4A 2B4JA 1XUPO 4M41A 3DXKA 3WXIA 1KFSA 3VESA 4Y1CA 4IFYA 4OPHA 3CCMN 1ASUA 4BE2A 3WT0A 1JLFA 2GWJA 4CGDA 3KLEA 3VQ6A 4CHOA 1S6PA 2HHTA 4IXCA 5KI6A 3KK7A 4LSLA 4JK7A 4DFKA 3I0SA 1SQKA 1YJ9N 1TAUA 4E3SA 4O8KA 5I3UA 2PAVA 3HOSA 4KH4A 5M1NA 4NYFA 1ZBIA 5HRPA 1SAZA 5AFUA 1S1VA 3DMJA 3SUQA 1VAZA 3A5LC 2G8HA 1YIJN 4AHVA 1EWRA 4QOZB 4DS5A 1KLMA 4DQQA 1OH7A 4LFBK 4M42A 3T7ZA 4DV4K 3OY9A 4W5TA 4CIFA 5FDLA 5KGWA 3L2UA 3AVKA 1LW0A 4UQGA 1JLCA 5KTQA 3LZIA 3AVBA 3SJJA 1FKPA 4WCEL 3THYB 1FK9A 3VF2A 2FSJA 3TSUA 1QZ5A 4AHUA 3UE5A 3HM8A 4CK1A 1NKCA 3ZSVA 2F8SA 3P39A 2IVNA 2O4IA 5BREA 2YHYA 4GMJB 4CJ7A 2HMPA 3MMVA 4FWLA 3C7NA 1QTMA 4WQ5A 4KFBA 1LAWA 2J4RA 5CHIA 4BRNA 4CZGA 3QNNA 3AVFA 3JSMA 1VQ5N 2E1YA 3U8XA 1W97L 1EP4A 3CQ8A 2V7YA 4DTRA 4JK9A 3EN9A 4JI7K 2E6MA 1I3AA 2RE2A 3LZJA 3RR8A 3OBYA 1YJNN 1N6QA 4BRFA 1VQ7N 4ICLA 1DTTA 4LFCK 2A41A 3I55N 3CYMA 3SQ4A 4W5RA 3SI6A 4DV6K 3QNOA 1JJ2M 3KTQA 1YITN 3BY5A 3D7EO 1QE1A 5AQTA 4CJTA 4CJPA 1VQLN 3U3YA 4KI4A 3V9ZA 4IJNA 2RKIA 2VG7A 3PSIA 4WFAL 3OVNA 1WLJA 4BR9A 4IFVA 4N47A 4EIAA 2XY7A 3SQ2A 2ZJRL 1S3XA 3J7YP 4J2EA 3Q7CA 4LH5A 3NH2A 3ZSRA 4FXDA 1BL3A 3U4LA 2XO7A 2E2NA 3FZKA 3VEWA 3TANA 1NK4A 3BP8A 2UXBK 1RCHA 2ZJQL 4CEBA 1GLCG 4KTZA 2FF3B 4KRFA 3QO9A 1RDBA 3CJBA 3RR7A 3ZEUB 1XMQK 4AM6A 1JXBA 5BN9A 2IGIA 3FE1A 1VQMN 4BE1A 1VQKN 4BRMA 4CEEA 3C6AA 1RILA 4M3ZA 3CCUN 2XY5A 5JENA 3TARA 1J5EK 4FOIA 1GLLO 2R7YA 2P9UB 1C0FA 3HL8A 3S9HA 3OW2M 3S3OA 4LY7A 4YOTA 4BVPA 5ADXH 2B5JA 1Z6RA 2G8KA 4B3OA 1KVBA 1ZBHA 4R5PA 5C10A 4JI5K 2ZM6K 4G9ZA 3A2FA 2D0PA 3O3HA 2KLAA 2D5RA 5HP1A 2DTUA 5CZ2A 2KFNA 3E9OA 5BR8K 4OKEA 4FJHA 1YI2N 2Q31A 4F2RA 1QQNA 2BTFA 4RTFD 4DV7K 2QK9A 2NRWA 2GBZA 1HMVA 3LPUA 4R79A 3HJFA 3S41A 2KW4A 3CIPA 1B92A 3N4QA 3R8EA 4EP4A 2XY6A 4DSJA 1EO1A 3B6PA 4IO9L 3CCEN 3U9ZA 2NZTA 1X1PA 4BR7A 1BIZA 1U4BA 1LV5A 3AVLA 4KV8A 2QWLA 2BE2A 1TL3A 3VPZA 1VQON 1VSFA 3D2FB 3V1RA 4CI6A 1JL1A 5DK5A 3AVGA 4JI2K 2W40A 2IIRA 4DQPA 1NU0A 2VYPA 2OCEA 4FWSA 2QWNA 3WNFA 3VQ9A 3E9PA 1RT7A 4Y0WA 2A3ZA 3DLKA 2VWKA 4B1YB 5AQLA 1BI4B 4LF5K 4DHYA 3KZBA 4RG8A 4CJVA 5LMNK 3QEIA 2P9LB 1WSHA 1J54A 4CBWA 4AHRA 2VG5A 3I8BA 1VSJA 2HW3A 2E2OA 1WBDA 4BG9A 3ITHA 5JICA 1CZAN 3IKMA 4A61A 1WUAA 3NCIA 4DTNA 2V51B 4V19S 4BGBA 1ASVA 1TKDA 3QESA 1V4TA 4OKKA 2HHXA 2RHKA 1Z25A 1XQSC 3AVCA 4E7IA 1S1TA 3ZEUA 3OTOK 1IKXA 4B3MK 4BREA 5BRHA 3RTVA 3V9XA 1YTUA 3TR8A 1NGGA 3CC4N 1JCGA 3L4QA 2E6LA 4AM7A 2KZZA 3SPZA 3QEWA 1ILYA 3WEEB 1VQ6N 1RNHA 2ATQA 4GVMA 5BPNA 3VA3A 3PSFA 1KVCA 4A62A 3CQYA 5JS1A 1XHZA 4CFAA 2WOMA 3DLGA 3HPHA 5HRNA 4F4KA 5FRMA 1EXQA 3BZKA 5EXWA 3SV3A 4CZMA 2E2QA 1NK6A 1N33K 1VSLA 3F5TA 3ID6A 3LPTA 2ZJPL 3IFRA 4O5BA 1RDDA 4DTOA 4B3TK 3SCXA 2YJEA 5AQIA 5C12A 5EVZA 1QVGM 1G99A 1S6QA 3AVIA 1ZBSA 2P9PB 5AQMA 4CZKA 5C15A 3EKUA 3ZYYX 5ELZA 4CJQA 1F21A 4B9UA 2HNYA 2O4GA 4FWNA 4BC4A 4FK4A 1DT9A 4GV9A 1NKEA 3DRPA 4BC3A 3VERA 3AO3A 3DYAA 3DLEA 3NF8A 3KIOA 2PYJA 3F9MA 3M6GA 1X9WA 3FZLA 3OA9A 2YHBA 2XY8A 4BE7B 3D2FA 4F9OA 1VQ4N 4X66K 3OYHA 4CF0A 3T3FA 4FL9A 2Z1HA 3R1XA 2X78A 3MX2A 4HHTA 2JLEA 3AVHA 3AAQA 3B8AX 5AQWA 5AFUH 3SAHA 2WFBA 3RVCA 3VTHA 5AR0A 3WNHA 2I7PA 1LOTB 4C23A 4GV3A 3P83D 1BI4A 4H0YB 4K25A 2P9LA 1L3TA 1C0MA 3DLBA 1UOCA 1JLQA 3J7ZO 3I0RA 4DV0K 4KHSA 3W0LA 3AO2A 3L6QA 4IOCL 3G10A 2GTDA 1WSJA 2NRTA 3SQ0A 3VF6A 1HYSA 4FLWA 3SAGA 4OJRA 2O8CA 5KQ8A 4RW7A 5HROA 4KHQA 5ADXA 4I9LA 3ZT2A 4CEQA 1VRTA 3C6TA 3GDQA 4J8FA 1RT1A 5LL6Z 2Q0RA 3LDPA 4BY9C 1DEJA 1YVUA 1BU6O 3CCJN 3OYDA 4LF6K 3KLIA 3WEEA 4DB3A 3ZETB 1IKVA 4M3TA 4DTUA 1NK5A 1TAQA 4H0VB 4FPBA 1TGOA 2E8AA 3HSTB 2ASPA 1RFQA 4BROA 4CZLA 3U6FA 1X9JA 5EU7A 3LDQA 1L3SA 3DXKB 4FVUA 5C24A 1VQ8N 4FLZA 3OHRA 4FZXC 5KQDA 5I9EB 4U67L 5C25A 4CGJA 3LAKA 3LDOA 3CCLN 3FR0A 3KKRA 3WXLA 2GX9A 4H4MA 4AHSA 4WQ4C 2FLOA 4YOUA 1R59O 2P9PA 4A5AA 4LH4A 4CIEA 4DSLA 3MECA 3LP3A 4F8RA 3IG1A 1Y64A 4A2AA 3VTIA 2YKMA 5H1SQ 3HP6A 1BO5O 5AQYA 3CJCA 5AQHA 3F2KA 2QWOA 2B6AA 3AA4A 2JWKA 3TPQA 5GIOA 4JI4K 4QAGA 4GNIA 4CJFA 3M5RA 3MN5A 3T1AA 4LF7K 2HHSA 4DR5K 1GOAA 2GUIA 4W5OA 5DMRA 3HTVA 2EX3A 4AF1A 4DQIA 1BCMA 1NGDA 1Z05A 5C0YA 1QHAA 4CD1A 3RWUA 4EHTA 3EE8A 3OYAA 3PY8A 4WQ5C 3HM9A 2F96A 1WAJA 3P5JA 4PY5A 4LF9K 4H5WA 4B9QA 3OYNA 5AQPA 1SKSA 5JMVA 5F1XA 3MN7A 4NXNK 4EZ9A 4CECA 2QWPA 1HNZK 3OJUA 3RMDA 3E66A 2A1SA 3O5BA 2VWJA 3KK3A 2OPRA 1DTQA 3LDNA 3B6OA 2Z1JA 4M63C 2UUAK 4M3YA 5KGXA 4B1UB 4Q5VA 4ILJA 3V1OA 3ZLJA 3FFIA 2DPNA 3IDHA 2HHHK 1WB9A 5CZ1A 4BQZA 4H03B 1QZ6A 2DFHA 4FWQA 3WQTA 4B8CA 5LY3A 4K0KK 3R9PA 1VSMA 5AQXA 3ZETA 3BDPA 3VEVA 4BWJA 2P5GA 4JD2B 3CMAN 3I56N 2YNHA 2NRZA 3TSPA 4ELTA 2HHWA 5AQNA 3PLAA 3SUPA 1M90O 5CYQA 4DTPA 5HL7L 2D4WA 3WXJA 1RBVA 2RF2A 2YV0X 4CJEA 4FLXA 4X65K 4XIUA 1HUXA 4RW6A 4JRPA 3P4IA 5C2DA 1JLAA 4NLBA 3ZX2A 1GLJO 1NGFA 3CERA 2Z1IA 3NF7A 5FROA 5J2NA 1RT4A 3HXMA 3DOLA 2O8EB 3RMAA 1S22A 4FJKA 3DJCA 5E26A 3AO1A 2KHOA 2HBKA 3HP9A 4FM1A 3DWLA 4FLYA 3QB0A 4C8MA 5JS2A 4KH5A 3O1WA 4X64K 2A40A 1QVFM 1HNVA 1RDUA 2HHQA 4DWIA 4FWOA 3E1YA 3HVRA 2HBLA 4DLEA 1NKBA 3MXIA 4FJLA 2V7ZA 2HVIA 4AHCA 4DV1K 4IG3A 1BDGA 3VEYA 5JVHL 4CIGA 4NB4A 2X6SA 4FJGA 2A1RA 4WF9L 4BGAA 2P9KB 2ZWHA 4ELUA 3J8AA 4KHWA 2CGJA 3PV8A 2QKBA 3GE1A 4LD0A 5HLFA 1XNRK 3RMCA 3MEEA 3IUCA 1SV5A 3P1GA 1RBTA 3K5MA 5F2RA 3LALA 4ZHRA 4JAXA 4MO5A 4CEZA 4JYAK 4CFDA 4H8KA 2XRIA 2D0CA 4RCHA 1SKWA 4FZZA 3R6MA 2LSNA 3CM5A 4FO0A 3ATVA 3RRGA 3CJAA 1UA0A 4TSXA 3OYCA 2YNIA 4JD2A 3TTFA 4YY3K 4FYDA 2F7TA 3LP0A 3V1QA 3ZSQA 3MCAB 1D8YA 2D1KA 2F4VK 3FZMA 3KLHA 4CJUA 2NNWA 3A8YA 3M8QA 3PUFA 2O8FB 3THWB 2PYLA 1S9EA 2VGNA 2IAJA 2NRHA 4FJ7A 4Z4EA 4DTSA 4DSIA 4FJNA 4CJ3A 5K14A 4YOWA 1ZYQA 5M1FA 4K43A 3CJ1A 3VGKA 3ZSWA 3CHWA 1XI1A 5HOOA 3PO4A 5GINA 1FJGK 2O8EA 2YHAA 2HHUA 3CCVN 4CE9A 4CVNE 5HBMA 4B3RK 3M1FA 5JLHA 1Q86O 4MLEA 2GWKA 4NYNA 4JI3K 1CZBA 3IRXA 4O0JA 3UKRB 4O44A 2UU9K 4PA1A 4X62K 4NLCA 2FBYA 1KRPA 5AQRA 1GOBA 4BG8A 3LL3A 3TAGA 3K59A 4IEIA 5JVGL 4A59A 2Q97A 4OVLA 1TL1A 4GVEA 1C0TA 1RTJA 3G25A 4GY2B 3CD6N 3WXMB 1NOZA 3MN6A 3NVKA 3CYGA 4I2PA 5I42A 3BF3A 3ZX0A 1WSFA 2V52B 3QEXA 3ZT1A 1KSPA 1BUPA 2IVPA 1S1WA 1CXUA 3T1HK 4KTWA 3CI5A 2GEMA 2OTLN 1OH6A 5IT9O 2P9KA 4BWMA 2KQ2A 1HLUA 5JLFA 4FPAA 1NWKA 4QS9A 4B1ZA 2HHVA 3L3VA 1V4SA 4CF1A 3DOKA 3SJHA 3L2VA 4J2BA 1GOCA 3JXUA 3MEDA 3DLRA 3G4SN 5EY4A 3UIQA 3ZCMA 3CCRN 1ZXOA 3GBTA 2UXCK 2YHWA 1VSKA 5MLCQ 2Q3SA 1KAXA 4NXMK 1NJYA 3QFPA 4FJJA 3QIPA 3DRSA 5KPTA 1NK8A 1I94K 1LCUA 4BDYA 2HF3A 3MWPA 3DXMB 3V9UA 4NO7A 4BVOA 3L2QA 1HPZA 3LM2A 4BC5A 4KB1A 5AQVA 4YOYA 4IZ9A 1XC9A 2RN2A 3ULEB 3UKUA 1X9SA 4IO8A 4PL7A 1U2VA 1HJRA 3C65A 4JKEA 1TK0A 1U6ZA 2O8FA 2HMIA 3THWA 4FSVA 5GAGP 1REVA 3N4PA 2QTDA 3ENBA 3IMXA 5J1EA 1GLAG 2RPIA 2HBMA 3ENHA 3OJSA 4E7HA 2O8CB 4GW6A 4JI6K 4B8AB 4B9MA 3E01A 1KLNA 3SBTA 2Y1JA 1KAZA 2FSKA 4Z4HA 3BF1A 4JS4A 4PHTX 3HPGA 4Z0UA 1NJIO 2YI1A 3UKRA 4HCCA 4EP5A 4L3QA 1CZ9A 3O1BA 1BA0A 3NFAA 5GAEP 1NGHA 2GV9A 5SZTA 4CF9A 3O9TA 4YDUA 4LFAK 2W00A 4NCGA 1YAGA 1BWFO 2NLXA 4DFJA 1FKOA 1TV6A 1ATNA 3TSQA 5AQKA 4JI0K 5AQSA 5AQQA 4KPYA 5EX5A 4DKWA 1O1WA 4FW1A 1NJWA 4CF2A 5AZIA 1WAFA 1UA1A 3NGZA 4DFPA 3WUHA 3NMUA 4IG0A 4K8XA 3MWTA 2X74A 3CCQN 2PFUA 4BQLA 4FWMA 1K8KB 3DM2A 4FWKA 3WXKA 1IJJA 1C1CA 3QMLA 1U45A 2G8IA 4WE1A 5AQUA 4DF8A 5BPMA 1T44A 3O9UA 4CERA 4LC9B 4CGGA 1QQCA 2E88A 2UYTA 3ISNC 1T05A 1K9MO 1ZC6A 2I5JA 3FGUA 3TU5A 1X9MA 1N34K 4Q0BA 2KZMA 3HT3A 5GIPA 2IC3A 1EQYA 3BZCA 3U3GA 1Y97A 3EEQA 3DXMA 2EHGA 1EX4A 2WTUA 1IBLK 4EFHA 4DV3K 5AQFA 4FZYA 3VMFB 1K73O 2O8DB 1KTQA 3ULEA 5CE3A 4CW7B 1HQUA 1JCEA 2P51A 3H3OB 1YT3A 1VSEA 2ZD1A 3TWHA 3C94A 3LANA 4IOAL 4CHPA 1HKGA 4H5TA 1VHXA 4ID5A 3ZT3A 4FW2A 1LWCA 4JKDA 3LWLA 2WUSA 3O9RA 3H08A 2AP1A 1X3MA 4OO1J 4IEEA 2D0AA 4LF8K 3LM9A 2CGLA 4RW9A 1VSIA 3SYZA 4BRHA 4KHNA 4JEPA 1LWEA 1S1UA 4HUFA 3VF4A 3JYTA 1BISA 5C2FA 2HF4A 2VQFK 3HI0A 1FXXA 1SL2A 2WBNA 3CM6A 2FF6A 3FLCO 4Z4CA 3QEPA 1U49A 2WC9A 4CJKA 3SMPA 3MDQA 1DLOA 4KH6A 5FRNA 3K0SA 3NVMA 4BR5A 1BHLA 1ZBUA 3AVJA 1OH5A 3HYFA 3TTCA 3O3FA 4N41A 4I9QA 3VQ8A 1H1VA 1HKCA 4DSEA 1A5VA 4DU3A 3V6DA 4JI1K 2OZSA 2P1JA 2YNFA 1NGIA 3VQQA 2Q2RA 1IKWA 3MCPA 3BEXA 4M3WA 4CJSA 3C6HA 5BPLA 2Q0UA 5KRTA 2QW9A 1K8KA 3ZSOA 3TAPA 2YJFA 3HVTA 2HHIA 3JAMO 3FFKB 5AQGA 3VQDA 4H0OA 2ITGA 1YXQA 2Y1IA 5DM6L 5AQJA 4FM0A 4JKBA 3SNNA 4K41A 3EKSA 2P9NB 3QETA 1HRHA 1SL0A 5LJWA 3HZ6A 1EWQA 2OPSA 4HUGA 4N76A 1TKTA 1VSDA 5E41A 1IBMK 4YOVA 3VOVA 3ENOA 4IJAA 2IVOA 4HCBA 4C1NI 2O8DA 1XHXA 1S72N 1QQOA 2HVHA 3ATUA 3V9WA 1YVNA 3ZX3A 1GLEG 3MN9A 2VG6A 4H5VA 5FPMA 3CMEN 3AGKA 2ZGYA 3MXJA 4AH9A 4FOEA 1NK0A 3RRHA 3L2RA 3AV9A 2ETJA 1KXPA 3E9LA 4CGIA 1SL1A 3W3DA 4XJXA 4CHZA 3TTDA 4JKFA 3AARA 1KVAA 4E1MA 3NHGA 3LP2A 3F73A 3KK1A 4OLBA 1L3VA 3DI6A 2VQEK 4FK0A 4OGCA 3T69A 2ASMA 4CK2A 3SLCA 4DR2K 5J2MA 3QIOA 1TKXA 4BR2A 1NM1A
chains in the Genus database with same CATH topology
2NRXA 5M1QA 4Y0WA 4CD3A 2A3ZA 4FO0A 3D2EB 5TKYA 3ATVA 4B1YB 5AQLA 1TUYA 2D0OA 3CJAA 1GLDG 2E20A 2ASOA 4DHYA 4ISFA 3KZBA 4JD2A 1YF5L 2P9LB 1VQNN 3TTFA 4WFBL 4CBWA 3HOSA 2F7TA 3I8BA 1MA9B 3P38A 3BUZB 5BRDA 3MCAB 2D1KA 4JHDB 2E2OA 4BG9A 2VGMA 3FZFA 3FZMA 2BUPA 5JICA 1CZAN 3IKMA 3RSEA 1WUAA 4A61A 2NNWA 2V51B 3A8YA 4U7BA 4BGBA 4BRAA 1TYQA 4ISEA 1V4TA 2P9SB 2E1ZA 4DCHA 2ZF5O 2VGNA 2NRHA 3VEOA 2RHKA 1VQPN 1NGJA 1XQSC 2W41A 3GL1A 3ZEUA 2ITMA 4YOWA 1HKBA 4K43A 5M1FA 3CJ1A 4BR2A 3L4IA 4BREA 5BRHA 3VGKA 3CHWA 1NGGA 5HOOA 2OTJN 5GINA 3CC4N 3VENA 1JCGA 3L4QA 3QICA 4A57A 2PBDA 4AM7A 1OKJA 4ILGB 5B8HA 3CCVN 1TUUA 4BR0A 2Q36A 3AGRA 3A5MC 1ILYA 3M1FA 5JLHA 1Q86O 4MLEA 2GWKA 4MDAA 3WEEB 1D4XA 5FPDA 3CC2N 1VQ6N 3UKRB 3SK3A 5AZJA 5BPNA 4NLCA 1X3NA 5AQRA 4A62A 3CQYA 4BG8A 3LL3A 3M3ZA 2A42A 4JNEA 1NGBA 4IEIA 2OANA 2F9TA 1HX1A 1O13A 5JVGL 3HRGA 1E4FT 1T6DA 1YJWN 3Q7BA 4A59A 2Q97A 5EXWA 4H0PA 4CZMA 2E2QA 2QM1A 3O4WA 4GVEA 3G25A 3UB5A 4GY2B 3CD6N 1MWKA 2QWRA 3WXMB 3F5TA 3ID6A 3MN6A 1YHQN 3NVKA 2ZJPL 5LJVA 2P9NA 3IFRA 1W2BM 3KWGA 2JWLA 3BF3A 3ZX0A 1J6ZA 3EE9A 2V52B 3CXCM 4WYBA 2YJEA 2YHXA 4WQ4A 1RDWX 1BUPA 2IVPA 5AQIA 3A5NC 4BRLA 5C12A 5EVZA 5FPNA 1QVGM 3O6WA 4K42A 1G99A 4JKAA 1ZBSA 3HOTA 2P9PB 1BG3A 3VGMA 3CI5A 5AQMA 2GEMA 4CZKA 5C15A 3EKUA 4QS7A 2OTLN 3ZYYX 5ELZA 4BC2A 3O80A 2P9KA 3O8MA 2CH5A 1HLUA 3MK6A 4FWNA 5JLFA 4FPAA 1NWKA 1DT9A 1WOQA 4QS9A 4B1ZA 4BC4A 3SAFA 4GV9A 1V4SA 1DGKN 1HJOA 3SJHA 4BC3A 3VERA 1QQMA 3H1QA 3QFUA 3JXUA 3WQUA 4CBXA 2QWQA 2QWMA 2YCHA 4B1XB 3G4SN 5BRFA 1C0GA 5EY4A 4GV6A 2KKZA 1XC3A 4BECA 3CCRN 1ZXOA 3F9MA 3GBTA 4Z94A 4KBOA 2QXLA 4CZJA 3M6GA 2YHWA 3FZLA 3OA9A 2C1GA 5E84A 3CPWM 4BRGA 4BE7B 3D2FA 5MLCQ 4F9OA 4YORA 1VQ4N 2YX6A 1KAXA 4FL9A 3R1XA 3QFPA 2HOEA 3MX2A 4H0XB 3O9QA 5KPTA 4EHUA 1GLFO 4BRIA 3A0IX 1LCUA 3AAQA 3B8AX 3EO3A 5AQWA 5AFUH 4BRPA 3SAHA 1Q81O 2WFBA 5BR9A 2HF3A 3RVCA 3VTHA 5AR0A 3VEZA 1DKGD 2I7PA 1LOTB 4C23A 3D2EA 4GV3A 3SBGA 3MWPA 1JCFA 2A6AA 2F9WA 3DXMB 3QBXA 4H0YB 4K25A 4NO7A 4BVOA 3D6RA 1M1KO 3LM2A 4BC5A 2P9LA 2Q1NA 4RWTA 5AQVA 4YOYA 2GUPA 4IZ9A 3J7ZO 5M1OA 3P31A 3ULEB 3UKUA 3CJ7A 4IO8A 4PL7A 3W0LA 1U2VA 3L6QA 3C7NB 4IOCL 4JHDA 2GTDA 3VEXA 2NRTA 4BRDA 2QI2A 5CR4A 3C65A 4PKGA 4JKEA 3VF6A 1U6ZA 3KWIA 3H1VX 3UKUB 5FPEA 4PKHA 1U2VB 2P9SA 4JKHA 3SAGA 1GLBG 4CZFA 5M1KA 4FSVA 3U9DA 5GAGP 3O9SA 4A2BA 5KQ8A 1T6CA 3N4PA 2QTDA 3ENBA 3IMXA 1GLAG 4EAHD 2HBMA 5ADXA 4YOXA 3ENHA 3DAWA 4BEBA 3GDQA 3HSCA 4J8FA 2CH6A 2Q0RA 3LDPA 3CF5L 3HBTA 2ZGZA 3AAPA 4BY9C 1DEJA 3SBTA 1KAZA 2FSKA 1BU6O 1NBWA 2VWBA 1ATSA 3BF1A 3CCJN 5AQOA 4PHTX 1KQSM 3VETA 4XH4A 3WEEA 4DB3A 1NJIO 3ZETB 2YI1A 3UKRA 3H46O 4JK8A 4B1VA 4B1WB 4HWIA 4I6MB 4L3QA 2NRVA 4H0VB 4FPBA 4MO4A 2EWSA 1XUPO 3O1BA 3CC7N 2E8AA 1BA0A 3DXKA 4HTLA 1BA1A 4IFEA 3WXIA 2ASPA 5GAEP 3VESA 4OPHA 1NGHA 3CCMN 4YDUC 1RFQA 2GELA 4BROA 4XEIA 4IOXA 3WT0A 2GWJA 1X9JA 4CZLA 4WFNL 3O9TA 3AY9A 3LDQA 3DXKB 3K9JA 4FVUA 4YDUA 1VQ8N 2W00A 1YUWA 1YAGA 1BWFO 2NLXA 3OHRA 4IXCA 5I9EB 5KQDA 4U67L 5M1PA 1YJ9N 3KK7A 4JK7A 3LDOA 1SQKA 3CCLN 3FR0A 3PIOL 4O8KA 1ATNA 3WXLA 2GX9A 2P9IB 2PAVA 4KH4A 5AQKA 3TSQA 3H3NO 4WQ4C 1HPMA 5AQSA 2FLOA 5AQQA 5M1NA 4YOUA 4UY8O 1R59O 2BH1A 2P9PA 1SAZA 5AFUA 4A5AA 5EX5A 4DKWA 3VGLA 2I7NA 5AZIA 1VAZA 2E2PA 3A5LC 3LDLA 3QDKA 3WUHA 1YIJN 3NMUA 3MWTA 4QS8A 3A5OC 4BRKA 3CCQN 2PFUA 1ATRA 4FWMA 1K8KB 4MDBA 4BQLA 1Y64A 4FWKA 4A2AA 3VTIA 3WXKA 5AZIB 5H1SQ 1IJJA 1BO5O 1MWMA 5AQYA 3QMLA 5AQUA 3T7ZA 3CJCA 5BPMA 5AQHA 1T44A 4ISGA 5BN8A 3F2KA 2QWOA 3O9UA 4H5RA 5KPZA 4JKGB 2JWKA 3TPQA 5GIOA 2A5XA 4M7XA 1KC8O 4LC9B 4GNIA 2E88A 2UYTA 1K9MO 1ZC6A 4BR4A 3M5RA 3MN5A 3FGUA 5TKWA 3TU5A 4WCEL 3CETA 3CJ9A 3VF2A 2FSJA 1Q82O 3TSUA 1QZ5A 5GIPA 3UE5A 1RGIA 1EQYA 3HM8A 3DXMA 3HTVA 5DM7L 1N8RO 4AF1A 3PIPL 1Z05A 1NGDA 5C0YA 4EFHA 1QHAA 4CD1A 5AQFA 4EHTA 3EE8A 2IVNA 3FZHA 3P39A 4WQ5C 3VMFB 5BREA 1K73O 2YHYA 4JKCA 4CBUA 4CJ7A 2HMPA 3MMVA 4CZEA 3ULEA 4H5WA 4B9QA 5CE3A 4FWLA 3C7NA 4WQ5A 5AQPA 1JCEA 1P90A 2J4RA 3H3OB 3H6EA 5F1XA 5JMVA 3MN7A 5CHIA 4BRNA 5GAHP 2QWPA 4IOAL 1E4GT 5KPRA 4CZGA 1HKGA 1NGCA 4H5TA 3E66A 1VQ5N 3O5BA 2E1YA 3U8XA 1W97L 4O5FA 2V7YA 4PL8A 4JK9A 3EN9A 4JKDA 3R3LA 2WUSA 2RE2A 3LDNA 1NMDA 4DQ8A 3OBYA 1YJNN 3O9RA 4M63C 4BRFA 3E9PA 4H5NA 2QA4N 1VQ7N 2AP1A 4B1UB 1X3MA 2A41A 4ILJA 3I55N 4OO1J 2DPNA 3IDHA 4IEEA 4FWPA 1NLVA 3LM9A 2CGLA 3L0QA 1JJ2M 4BQZA 1BOTO 4H0TB 3D7EO 4XH5A 5F0XA 1YITN 4H03B 5AQTA 1VQLN 1QZ6A 4BRHA 4FWQA 3WQTA 3GG4A 4CZHA 4IJNA 5LY3A 4JEPA 3R9PA 3MX5A 1MDUB 1IG8A 5AQXA 1T3VA 3VF4A 3ZETA 4WFAL 5AQZA 3OBWA 4IDHA 3VEVA 2H3GX 5C2FA 3KHYA 4I6MA 2HF4A 4BR9A 4FWRA 3HI0A 4JD2B 3CMAN 3I56N 2NRZA 3TSPA 4EIAA 2WBNA 1KAYA 2FF6A 3FLCO 2ZJRL 1S3XA 1ESVA 1NGEA 3Q7CA 4M7YA 5AQNA 3PLAA 2WC9A 1M90O 2C1IA 3SMPA 3MDQA 3U4LA 4E1JA 5HL7L 2D4WA 3WXJA 4KH6A 2E2NA 3FZKA 3NVMA 3RSEB 3VEWA 3CCSN 3K9KA 1TYQB 4BR5A 1KD1O 3BP8A 1HUXA 1Q18A 2ZJQL 1GLCG 4CZIA 4BRQA 2FF3B 3P4IA 5C2DA 2P9IA 3TTCA 1K8AO 2VCPA 4MLHA 3CJBA 2QEXN 4NLBA 3ZEUB 1H1VA 1HKCA 4XH1A 1GLJO 3ZX2A 4AM6A 1NGFA 5BN9A 2FXUA 3CERA 3FE1A 2P9UA 4OPAA 1NGIA 1VQMN 1VQKN 3KVGA 3O08A 3GOIA 4BRMA 1Q7YO 2Q2RA 3C6AA 3JS6A 3BEXA 3MCPA 4BRCA 3C6HA 3G71N 5BPLA 1S22A 3CCUN 4A5BA 2Q0UA 3DJCA 5E26A 4FOIA 2QW9A 1GLLO 2P9UB 2KHOA 1K8KA 1C0FA 2HBKA 2YJFA 3OW2M 2HBJA 3DWLA 3H45C 3QB0A 5AZJB 4KH5A 4YOTA 3FFKB 5AQGA 3O1WA 4IWVA 4BVPA 5ADXH 1Z6RA 4H0OA 2A40A 1NGAA 5C10A 1YXQA 4JKGA 4G9ZA 2D0PA 5DM6L 1QVFM 3QBWA 2KLAA 1RDUA 2FSNA 5EOYA 5AQJA 4FWOA 3E1YA 4JKBA 3I33A 3EL2A 4K41A 1SZ2A 2HBLA 3EKSA 2P9NB 3E9OA 5LJWA 3HZ6A 1YI2N 2Q31A 2V7ZA 1QQNA 2BTFA 1BDGA 4RTFD 4YOVA 1P8ZA 3VOVA 3C0BA 3ID8A 3ENOA 4IJAA 3VEYA 2NRWA 5JVHL 2IVOA 4NB4A 4C1NI 4WF9L 1QQOA 3CQXA 4BGAA 3ATUA 4R79A 1S72N 2P9KB 1YVNA 5GADP 2HSTA 3ZX3A 1GLEG 3MN9A 2ZWHA 3S41A 3CIPA 4H5VA 5FPMA 3CMEN 3AGKA 3N4QA 2ZGYA 3R8EA 3J8AA 4FOEA 2CGJA 1EO1A 4JN4A 3GE1A 1KXPA 1SS6A 3E9LA 4IO9L 3CCEN 3U9ZA 2NZTA 3W3DA 4BR7A 4XJXA 3TTDA 4JKFA 3AARA 3CPEA 2QWLA 3VPZA 1VQON 2AA4A 3D2FB 3IUCA 3G6EN 3EZWA 4CI6A 3T69A 5F2RA 2NRRA 4JAXA 2ASMA 4C1NK 4ILHA 2W40A 1VQ9N 4MO5A 2IIRA 3SLCA 3DLLL 4PKIA 3SMSA 2VYPA 4FWSA 4O8UA 2QWNA 4RCHA 2CGKA 1NM1A 3R6MA 1OVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y0W A;  4CD3 A;  2A3Z A;  3D2E B;  4FO0 A;  5TKY A;  3ATV A;  4B1Y B;  5AQL A;  1TUY A;  2D0O A;  3CJA A;  1GLD G;  2E20 A;  2ASO A;  4DHY A;  4ISF A;  3KZB A;  4JD2 A;  2P9L B;  4CBW A;  3I8B A;  1MA9 B;  3BUZ B;  5BRD A;  2D1K A;  4JHD B;  2E2O A;  4BG9 A;  3FZF A;  3FZM A;  2BUP A;  5JIC A;  1CZA N;  4A61 A;  3RSE A;  1WUA A;  2V51 B;  3A8Y A;  4BGB A;  4BRA A;  1TYQ A;  4ISE A;  1V4T A;  2P9S B;  2E1Z A;  4DCH A;  2ZF5 O;  2NRH A;  3VEO A;  1NGJ A;  1XQS C;  2W41 A;  3GL1 A;  3ZEU A;  2ITM A;  1HKB A;  4K43 A;  3CJ1 A;  3L4I A;  4BRE A;  5BRH A;  3VGK A;  3CHW A;  1NGG A;  3VEN A;  1JCG A;  3QIC A;  2PBD A;  4AM7 A;  1OKJ A;  5B8H A;  1TUU A;  4BR0 A;  2Q36 A;  3A5M C;  3M1F A;  5JLH A;  4MLE A;  2GWK A;  3WEE B;  5FPD A;  1D4X A;  3UKR B;  3SK3 A;  5AZJ A;  5BPN A;  1X3N A;  5AQR A;  4A62 A;  3CQY A;  4BG8 A;  3LL3 A;  3M3Z A;  2A42 A;  4JNE A;  1NGB A;  2OAN A;  2F9T A;  1HX1 A;  1E4F T;  1T6D A;  2Q97 A;  5EXW A;  4H0P A;  4CZM A;  2E2Q A;  2QM1 A;  3O4W A;  3G25 A;  3UB5 A;  4GY2 B;  1MWK A;  2QWR A;  3MN6 A;  5LJV A;  2P9N A;  3IFR A;  3BF3 A;  3ZX0 A;  1J6Z A;  2V52 B;  4WYB A;  2YJE A;  2YHX A;  4WQ4 A;  1RDW X;  1BUP A;  2IVP A;  5AQI A;  3A5N C;  4BRL A;  5EVZ A;  5FPN A;  3O6W A;  4K42 A;  1G99 A;  1ZBS A;  2P9P B;  1BG3 A;  3VGM A;  3CI5 A;  5AQM A;  2GEM A;  4CZK A;  3EKU A;  4QS7 A;  5ELZ A;  4BC2 A;  3O80 A;  2P9K A;  3O8M A;  2CH5 A;  1HLU A;  3MK6 A;  4FWN A;  5JLF A;  4FPA A;  1NWK A;  1WOQ A;  4QS9 A;  4B1Z A;  4BC4 A;  1V4S A;  1DGK N;  1HJO A;  3SJH A;  4BC3 A;  3VER A;  1QQM A;  3H1Q A;  3QFU A;  3JXU A;  3WQU A;  4CBX A;  2QWQ A;  2QWM A;  2YCH A;  4B1X B;  5BRF A;  1C0G A;  5EY4 A;  1XC3 A;  1ZXO A;  3F9M A;  3GBT A;  4Z94 A;  4KBO A;  2QXL A;  4CZJ A;  3M6G A;  2YHW A;  3FZL A;  5E84 A;  4BRG A;  3D2F A;  4F9O A;  1KAX A;  4FL9 A;  3QFP A;  2HOE A;  4H0X B;  5KPT A;  4EHU A;  1GLF O;  4BRI A;  3A0I X;  1LCU A;  3AAQ A;  3B8A X;  3EO3 A;  5AQW A;  5AFU H;  4BRP A;  5BR9 A;  2HF3 A;  5AR0 A;  3VEZ A;  1DKG D;  2I7P A;  1LOT B;  4C23 A;  3D2E A;  1JCF A;  2A6A A;  2F9W A;  3DXM B;  3QBX A;  4H0Y B;  4K25 A;  4NO7 A;  4BVO A;  3LM2 A;  4BC5 A;  2P9L A;  2Q1N A;  4RWT A;  5AQV A;  2GUP A;  4IZ9 A;  3ULE B;  3UKU A;  3CJ7 A;  4IO8 A;  4PL7 A;  3W0L A;  1U2V A;  3L6Q A;  3C7N B;  4JHD A;  2GTD A;  3VEX A;  4BRD A;  4PKG A;  3VF6 A;  1U6Z A;  3H1V X;  3UKU B;  5FPE A;  4PKH A;  1U2V B;  2P9S A;  1GLB G;  4CZF A;  4FSV A;  3U9D A;  4A2B A;  5KQ8 A;  1T6C A;  3IMX A;  1GLA G;  4EAH D;  5ADX A;  3ENH A;  3DAW A;  3GDQ A;  3HSC A;  4J8F A;  2CH6 A;  2Q0R A;  3LDP A;  3HBT A;  2ZGZ A;  3AAP A;  1DEJ A;  1KAZ A;  2FSK A;  1BU6 O;  1NBW A;  2VWB A;  1ATS A;  3BF1 A;  5AQO A;  3VET A;  4XH4 A;  3WEE A;  4DB3 A;  3ZET B;  2YI1 A;  3UKR A;  3H46 O;  4B1V A;  4B1W B;  4HWI A;  4I6M B;  4L3Q A;  4H0V B;  4FPB A;  4MO4 A;  2EWS A;  1XUP O;  3O1B A;  2E8A A;  1BA0 A;  3DXK A;  4HTL A;  1BA1 A;  3WXI A;  2ASP A;  3VES A;  1NGH A;  4YDU C;  1RFQ A;  2GEL A;  4BRO A;  4XEI A;  3WT0 A;  4CZL A;  2GWJ A;  1X9J A;  3AY9 A;  3LDQ A;  3DXK B;  4YDU A;  1YUW A;  1YAG A;  1BWF O;  2NLX A;  3OHR A;  4IXC A;  5I9E B;  5KQD A;  3LDO A;  1SQK A;  3FR0 A;  4O8K A;  1ATN A;  3WXL A;  2P9I B;  2PAV A;  5AQK A;  4BR2 A;  3H3N O;  4WQ4 C;  1HPM A;  5AQS A;  2FLO A;  5AQQ A;  1R59 O;  2P9P A;  1SAZ A;  5AFU A;  5EX5 A;  3VGL A;  2I7N A;  5AZI A;  2E2P A;  3A5L C;  3LDL A;  3QDK A;  3WUH A;  4QS8 A;  3A5O C;  4BRK A;  1ATR A;  4FWM A;  1K8K B;  4BQL A;  1Y64 A;  4FWK A;  4A2A A;  3WXK A;  5AZI B;  1IJJ A;  1BO5 O;  1MWM A;  5AQY A;  3QML A;  5AQU A;  3CJC A;  5BPM A;  5AQH A;  1T44 A;  4ISG A;  5BN8 A;  2QWO A;  4H5R A;  5KPZ A;  3TPQ A;  2A5X A;  4M7X A;  4LC9 B;  4GNI A;  2E88 A;  2UYT A;  1ZC6 A;  4BR4 A;  3MN5 A;  3FGU A;  3TU5 A;  3CET A;  3CJ9 A;  3VF2 A;  2FSJ A;  1QZ5 A;  3UE5 A;  1RGI A;  1EQY A;  3HM8 A;  3DXM A;  3HTV A;  1Z05 A;  1NGD A;  4EFH A;  1QHA A;  4CD1 A;  5AQF A;  4EHT A;  2IVN A;  3FZH A;  4WQ5 C;  5BRE A;  2YHY A;  4CBU A;  4CJ7 A;  2HMP A;  3MMV A;  4CZE A;  3ULE A;  4H5W A;  4B9Q A;  5CE3 A;  4FWL A;  3C7N A;  4WQ5 A;  5AQP A;  1JCE A;  2J4R A;  3H3O B;  3H6E A;  5F1X A;  5JMV A;  3MN7 A;  4BRN A;  2QWP A;  1E4G T;  5KPR A;  4CZG A;  1HKG A;  1NGC A;  4H5T A;  3O5B A;  2E1Y A;  3U8X A;  4O5F A;  2V7Y A;  4PL8 A;  3EN9 A;  2WUS A;  3LDN A;  1NMD A;  4DQ8 A;  4M63 C;  4BRF A;  4H5N A;  2AP1 A;  4B1U B;  1X3M A;  2A41 A;  2DPN A;  3IDH A;  4FWP A;  1NLV A;  3LM9 A;  2CGL A;  3L0Q A;  4BQZ A;  1BOT O;  4H0T B;  3D7E O;  4XH5 A;  5F0X A;  4H03 B;  5AQT A;  1QZ6 A;  4BRH A;  4FWQ A;  3WQT A;  3GG4 A;  4CZH A;  4IJN A;  5LY3 A;  3R9P A;  1MDU B;  1IG8 A;  5AQX A;  3VF4 A;  3ZET A;  5AQZ A;  3VEV A;  2H3G X;  3KHY A;  4I6M A;  2HF4 A;  4BR9 A;  4FWR A;  3HI0 A;  4JD2 B;  4EIA A;  1KAY A;  2FF6 A;  3FLC O;  1S3X A;  1ESV A;  1NGE A;  4M7Y A;  5AQN A;  3SMP A;  3MDQ A;  3U4L A;  4E1J A;  2D4W A;  3WXJ A;  2E2N A;  3FZK A;  3RSE B;  3VEW A;  4BR5 A;  1TYQ B;  3BP8 A;  1HUX A;  1Q18 A;  1GLC G;  4CZI A;  4BRQ A;  2FF3 B;  3P4I A;  2P9I A;  2VCP A;  4MLH A;  3CJB A;  3ZEU B;  1H1V A;  1HKC A;  4XH1 A;  1GLJ O;  3ZX2 A;  4AM6 A;  1NGF A;  5BN9 A;  2FXU A;  3CER A;  3FE1 A;  2P9U A;  1NGI A;  3KVG A;  3O08 A;  3GOI A;  4BRM A;  2Q2R A;  3JS6 A;  3MCP A;  3BEX A;  4BRC A;  5BPL A;  1S22 A;  2Q0U A;  3DJC A;  5E26 A;  4FOI A;  2QW9 A;  1GLL O;  2P9U B;  2KHO A;  1K8K A;  1C0F A;  2YJF A;  3DWL A;  3H45 C;  3QB0 A;  5AZJ B;  3FFK B;  5AQG A;  3O1W A;  4IWV A;  4BVP A;  5ADX H;  1Z6R A;  4H0O A;  2A40 A;  1NGA A;  1YXQ A;  2D0P A;  3QBW A;  2FSN A;  5EOY A;  5AQJ A;  4FWO A;  3I33 A;  3EL2 A;  4K41 A;  1SZ2 A;  3EKS A;  2P9N B;  5LJW A;  3HZ6 A;  2Q31 A;  2V7Z A;  1QQN A;  2BTF A;  1BDG A;  4RTF D;  1P8Z A;  3VOV A;  3C0B A;  3ID8 A;  3ENO A;  4IJA A;  3VEY A;  2IVO A;  4NB4 A;  1QQO A;  3CQX A;  4BGA A;  3ATU A;  2P9K B;  1YVN A;  3ZX3 A;  1GLE G;  3MN9 A;  2ZWH A;  3S41 A;  3CIP A;  4H5V A;  5FPM A;  2ZGY A;  3R8E A;  3J8A A;  4FOE A;  2CGJ A;  4JN4 A;  3GE1 A;  1KXP A;  3U9Z A;  2NZT A;  3W3D A;  4BR7 A;  3AAR A;  2QWL A;  3VPZ A;  2AA4 A;  3D2F B;  3IUC A;  3EZW A;  4CI6 A;  5F2R A;  4JAX A;  2ASM A;  2W40 A;  4MO5 A;  2IIR A;  3SLC A;  4PKI A;  3SMS A;  2VYP A;  4FWS A;  2QWN A;  4RCH A;  2CGK A;  1NM1 A;  3R6M A; 
#chains in the Genus database with same CATH topology
 2NRX A;  1YTA A;  5M1Q A;  1RBR A;  3D2E B;  4JI8 K;  2KTQ A;  1L3U A;  1TUY A;  1GLD G;  2E20 A;  2ASO A;  1RT2 A;  4IDK A;  4YHH K;  3O3G A;  1YF5 L;  1VQN N;  1B9D A;  2BDP A;  3M8R A;  4ID1 A;  1RTH A;  4F3O A;  1MA9 B;  2DFF A;  5BRD A;  3OYK A;  4KTQ A;  1IV0 A;  4JHD B;  1C1B A;  3LAM A;  3CFR A;  1JLE A;  2OA8 A;  4I2Q A;  4ISE A;  4DCH A;  2ZF5 O;  3C95 A;  3J80 O;  4BDZ A;  3OYI A;  4Z4I A;  1NGJ A;  2W41 A;  3GL1 A;  2ITM A;  3AVN A;  1HKB A;  3D45 A;  4MQ3 A;  3HO1 A;  3L4I A;  3M8P A;  4DTM A;  3S5T A;  2OTJ N;  4O4G A;  4DV2 K;  4FLV A;  3VEN A;  4A57 A;  3QIC A;  1OKJ A;  4OKJ A;  3TAE A;  4BR0 A;  1NK9 A;  2Q36 A;  3AGR A;  1HYZ A;  3A5M C;  1D4X A;  5HRR A;  4KHU A;  1X3N A;  4HUE A;  4I7F A;  3M3Z A;  1TVR A;  4JNE A;  1TK5 A;  1NGB A;  1RTI A;  1Q8I A;  2OAN A;  2F9T A;  1O13 A;  4DTJ A;  1RBS A;  1YJW N;  1BQM A;  3Q7B A;  3KLG A;  3SV4 A;  3OS1 A;  3O4W A;  3VQA A;  1CXQ A;  2QWR A;  3TAF A;  3L8B A;  1LWF A;  2P9N A;  5LJV A;  3MXM A;  3KWG A;  4CHN A;  2JWL A;  2QKK A;  1J6Z A;  1G15 A;  3J81 O;  1A5X A;  3CXC M;  4MFB A;  4WQ4 A;  5J2Q A;  1RDW X;  3T19 A;  1RTD A;  3A5N C;  1EET A;  4K42 A;  1HQE A;  2QXF A;  2ZQB A;  3HOT A;  1J5O A;  2W42 A;  3VGM A;  1BG3 A;  4FJ8 A;  4KHP K;  1QSS A;  4DV5 K;  3CG7 A;  2CH5 A;  3MK6 A;  1W9H A;  2P5O A;  1WOQ A;  4K8Z A;  3ZSY A;  1HJO A;  4H4O A;  3H1Q A;  4CBX A;  4KO0 A;  4O0I A;  1HNW K;  2QWQ A;  2QWM A;  4DMN A;  5BRF A;  4GV6 A;  4DSK A;  2O8B B;  2UUC K;  2QXL A;  4CZJ A;  5D3G A;  3NAE A;  2C1G A;  3NBP A;  4BRG A;  4OX9 K;  2OZM A;  2FBV A;  2YX6 A;  2UXD K;  1Q9X A;  1T7P A;  1CLQ A;  3S3N A;  1UAX A;  2HOE A;  3NF9 A;  4EHU A;  4BRI A;  3EO3 A;  4KAZ A;  1JLB A;  3VEZ A;  4CES A;  3D2E A;  3LWM A;  3SBG A;  4E7L A;  3F9K A;  2A6A A;  2F9W A;  3QBX A;  1K6Y A;  3K5L A;  3VQ5 A;  4CEO A;  4J2A A;  4GKK K;  1M1K O;  4RWT A;  5T7B A;  3P31 A;  3CJ7 A;  1NJX A;  4JHD A;  4CJL A;  4PUO A;  4KI6 A;  1E3M A;  4FJ9 A;  4PKG A;  3UKU B;  5FPE A;  1U2V B;  4JKH A;  1GLB G;  3WNE A;  4CZF A;  5M1K A;  4FCY A;  4A2B A;  1T6C A;  3NF6 A;  2G8V A;  1KFD A;  3HSC A;  4B3S K;  4E7K A;  3HBT A;  2ZGZ A;  3RMB A;  4DQS A;  3OYL A;  4DQR A;  2VWB A;  2HNZ A;  1ATS A;  5AQO A;  1KQS M;  4Z4G A;  4XH4 A;  3K5N A;  4C8K A;  3NH1 A;  3H46 O;  4B1V A;  4B1W B;  1B9F A;  4I6M B;  4BE0 A;  2NRV A;  1S1X A;  3OYE A;  2EWS A;  3CC7 N;  4FLT A;  2IDO A;  4HTL A;  1BA1 A;  4IFE A;  4YDU C;  2GEL A;  3PX0 A;  4C8L A;  2E4L A;  4XEI A;  4IOX A;  4KKO A;  4WFN L;  4BDP A;  4DU4 A;  3AY9 A;  4FK2 A;  2FC0 A;  3K9J A;  4PWD A;  1YUW A;  1RT5 A;  1S5J A;  5A2Q O;  5M1P A;  3QIN A;  3PIO L;  2P9I B;  3K5O A;  3H3N O;  1HPM A;  3EZ5 A;  1WSI A;  3MEG A;  4UY8 O;  4HVJ A;  1JXE A;  2BH1 A;  4OLA A;  1OH8 A;  2OPP A;  4DU1 A;  3VGL A;  2I7N A;  3V81 A;  5C42 A;  2E2P A;  2OPQ A;  3LDL A;  3QDK A;  1ASW A;  4QS8 A;  2G8F A;  3A5O C;  4BRK A;  3M8S A;  1QHT A;  1ATR A;  4MDB A;  5AZI B;  1MWM A;  2O8B A;  1D9D A;  4CHY A;  4ISG A;  5BN8 A;  1W0H A;  4H5R A;  5KPZ A;  4JKG B;  3NH0 A;  3THY A;  3VA0 A;  3SQ1 A;  2A5X A;  4M7X A;  1KC8 O;  3IS9 A;  4NCA A;  3VQC A;  3I8D A;  1BQN A;  2W6K A;  5AJ3 K;  3TAB A;  4BR4 A;  1WN7 A;  1D5A A;  5TKW A;  1SUQ A;  3CET A;  1XMO K;  4KB0 A;  3QLH A;  3CJ9 A;  1Q82 O;  4AHT A;  1Z26 A;  2PY5 A;  1RGI A;  3PX6 A;  4Z4F A;  2KFZ A;  5DM7 L;  1N8R O;  3PIP L;  5HRS A;  4DFM A;  1KCF A;  1XNQ K;  4FJ5 A;  3FZH A;  1RDA A;  1FW6 A;  4G1Q A;  1BCO A;  4CBU A;  4JKC A;  2UUB K;  4CZE A;  3PX4 A;  3DLH A;  2BAN A;  1U47 A;  1P90 A;  3H6E A;  5GAH P;  1E4G T;  5KPR A;  1NGC A;  4O5F A;  4PL8 A;  1NMN A;  3LDS A;  3NGY A;  3R3L A;  3WNG A;  1TKZ A;  3NDK A;  1NMD A;  4DQ8 A;  3OYG A;  4M3U A;  2QA4 N;  4H5N A;  2PZS A;  3SUN A;  4E7J A;  4FWP A;  1NLV A;  2HND A;  3L0Q A;  1BOT O;  4H0T B;  4CJW A;  4XH5 A;  5F0X A;  3KK2 A;  3SZ2 A;  3GG4 A;  4CZH A;  3MX5 A;  1MDU B;  1HR0 K;  1IG8 A;  5FLX O;  1T3V A;  5AQZ A;  3OBW A;  4JRQ A;  4IDH A;  2H3G X;  3ULD A;  3KHY A;  4I6M A;  1IKY A;  4FWR A;  4YFU A;  1Q9Y A;  4CJR A;  1KAY A;  1NG9 A;  1ESV A;  1NGE A;  1WSG A;  4M7Y A;  2F8T A;  1RBU A;  4FM2 A;  2C1I A;  4E1J A;  4B9V A;  3ZSZ A;  3L3U A;  3K57 A;  3L2W A;  3RSE B;  5IWA K;  3CCS N;  3OYM A;  3K9K A;  1TYQ B;  5J2P A;  1KD1 O;  3G0Z A;  1Q18 A;  3VQ4 A;  3HPO A;  4GKJ K;  4CZI A;  4BRQ A;  4M3R A;  1IH7 A;  2E5L K;  1LW2 A;  2P9I A;  1MU2 A;  1K8A O;  2VCP A;  4MLH A;  5KRS A;  2QEX N;  4XH1 A;  2ZE2 A;  2FXU A;  1XWL A;  1IBK K;  2P9U A;  4OPA A;  4QCL A;  3KVG A;  3O08 A;  3QEV A;  3SPY A;  3GOI A;  4CEF A;  1Q7Y O;  3JS6 A;  1VSH A;  4BRC A;  4CJ5 A;  4DS4 A;  3G71 N;  4CJ4 A;  2IOC A;  1HYV A;  3ASM A;  2WON A;  3AA2 A;  4A5B A;  3VQB A;  4RW4 A;  4ZTF A;  2HBJ A;  4CGF A;  3H45 C;  5AZJ B;  4PQU A;  2IS3 A;  2FBX A;  1HNX K;  4IWV A;  3THX B;  4CCH A;  1BGX T;  2DFE A;  2HB5 A;  4ELV A;  1NGA A;  4B9T A;  4KRE A;  3KD1 E;  4JKG A;  3KKS A;  3QBW A;  2FSN A;  4O55 A;  4DSF A;  3KD5 E;  3VQE A;  5EOY A;  1LAV A;  3AO5 A;  3I33 A;  3EL2 A;  1SZ2 A;  3VN5 A;  4N56 A;  3QER A;  3TI0 A;  3ALY A;  2G8U A;  4CED A;  3KJV A;  1QS4 A;  1WBB A;  4L8R B;  1P8Z A;  3EY1 A;  3C0B A;  4C8N A;  3ID8 A;  4JLH A;  3VQ7 A;  4Y1D A;  3VQP A;  1U04 A;  3CQX A;  3V4I A;  1C6V A;  5GAD P;  2HST A;  1IO2 A;  3K2P A;  1A5W A;  1NNE A;  4JN4 A;  3ZT0 A;  3KLF A;  1SS6 A;  4KHY A;  4NCB A;  1OVQ A;  3T1Y K;  3CPE A;  4FLU A;  3IAY A;  3S3M A;  4CHQ A;  3OS2 A;  2AA4 A;  3AVA A;  3G6E N;  2FBT A;  2XHB A;  4M45 A;  3EZW A;  2D0B A;  4E1N A;  4DR1 K;  1RT3 A;  4LF4 K;  2NRR A;  3OYF A;  4C1N K;  4ILH A;  1VQ9 N;  3DLL L;  4PKI A;  3SMS A;  1QSL A;  4E19 A;  3BGR A;  4O8U A;  2CGK A;  1OVY A;  1VK0 A;  3AA3 A;  4FJI A;  4CD3 A;  5TKY A;  3ZT4 A;  4JV5 K;  2D0O A;  4DR3 K;  4ISF A;  1NOY A;  2BGG A;  1QSY A;  4HTU A;  4WFB L;  3OS0 A;  3NE6 A;  3P38 A;  4LSN A;  3AA5 X;  3BUZ B;  1NK7 A;  4BAC A;  2VGM A;  3CFO A;  3FZF A;  2BUP A;  3RSE A;  4U7B A;  3OYJ A;  4F2S A;  4BRA A;  1TYQ A;  1I39 A;  4E72 A;  4DR6 K;  2P9S B;  2E1Z A;  1R0A A;  4AIL C;  1VRU A;  3VEO A;  1VQP N;  4DR4 K;  1WSE A;  3SUO A;  3J7A P;  1C0U A;  1UWB A;  4DUY K;  4M3X A;  1N32 K;  3PO5 A;  1S9G A;  2Z1G A;  5SWM A;  4E89 A;  1L5U A;  2PBD A;  4ILG B;  5B8H A;  1TUU A;  1SKR A;  4CGH A;  4MDA A;  5FPD A;  3CC2 N;  4W5Q A;  3SK3 A;  5AZJ A;  4ZTJ A;  1W7A A;  3THX A;  4W5N A;  1J9A A;  2A42 A;  5CYM A;  1HX1 A;  3HRG A;  1E4F T;  1T6D A;  3DRR A;  4CF8 A;  4EZ6 A;  4H0P A;  2QM1 A;  2X6N A;  3UB5 A;  2AJQ A;  1MWK A;  3C6U A;  1TK8 A;  1YHQ N;  1W2B M;  1RDC A;  3EE9 A;  2JGU A;  1IG9 A;  4B9S A;  4WYB A;  2YHX A;  4BRL A;  1ZBL A;  1EKE A;  4FVM A;  1JKH A;  5CY4 A;  3O6W A;  5FPN A;  4CFC A;  4JKA A;  3TAM A;  4J2D A;  4QS7 A;  4BC2 A;  3O80 A;  1NJZ A;  3O8M A;  4RW8 A;  4YNQ A;  3SAF A;  1JLG A;  1DGK N;  3EYZ A;  1QQM A;  3QFU A;  3WQU A;  4OPK A;  1RT6 A;  3ZSX A;  2YCH A;  4B1X B;  3D0P A;  1C0G A;  4DF4 A;  2KKZ A;  1XC3 A;  2NUB A;  4BEC A;  1C1A A;  4CK3 A;  4Z94 A;  4KBO A;  3HK2 A;  1D9F A;  5E84 A;  3CPW M;  2W6L A;  4YOR A;  3THV A;  1BIU A;  4AQY K;  1JL2 A;  4H0X B;  3O9Q A;  1GLF O;  3K58 A;  3A0I X;  1Q81 O;  4BRP A;  5BR9 A;  4DLG A;  1DKG D;  2YNG A;  5LMU K;  2OYQ A;  4C8O A;  4OPJ A;  1JCF A;  4CFB A;  1J53 A;  4E0D A;  3D6R A;  4F3T A;  2Q1N A;  4FJX A;  2GUP A;  1ITG A;  5M1O A;  1WNS A;  3OYB A;  1HNI A;  3C7N B;  3NGI A;  3VEX A;  4BRD A;  2QI2 A;  5CR4 A;  4DTX A;  1T03 A;  3TAQ A;  3KWI A;  3H1V X;  4PKH A;  4N5S A;  3MAQ A;  2P9S A;  4B9L A;  3U9D A;  3O9S A;  4OGE A;  4DG1 A;  3LP1 A;  4B08 A;  4EAH D;  4YOX A;  3O4N A;  2DY4 A;  3DAW A;  4JS5 A;  3CFP A;  4BEB A;  4B9N A;  4IKF A;  1ZBF A;  2CH6 A;  3CF5 L;  1N36 K;  3V9S A;  3AAP A;  3AVM A;  2YKN A;  3AO4 A;  1N5Y A;  1NBW A;  4DR7 K;  1T8E A;  4FJM A;  3O4Q A;  3VET A;  2G8W A;  4JK8 A;  1U48 A;  4HWI A;  4DUZ K;  4CEA A;  4IBN A;  4MO4 A;  2B4J A;  1XUP O;  4M41 A;  3DXK A;  3WXI A;  1KFS A;  3VES A;  4Y1C A;  4IFY A;  4OPH A;  3CCM N;  1ASU A;  4BE2 A;  3WT0 A;  1JLF A;  2GWJ A;  4CGD A;  3KLE A;  3VQ6 A;  4CHO A;  1S6P A;  2HHT A;  4IXC A;  5KI6 A;  3KK7 A;  4LSL A;  4JK7 A;  4DFK A;  3I0S A;  1SQK A;  1YJ9 N;  1TAU A;  4E3S A;  4O8K A;  5I3U A;  2PAV A;  3HOS A;  4KH4 A;  5M1N A;  4NYF A;  1ZBI A;  5HRP A;  1SAZ A;  5AFU A;  1S1V A;  3DMJ A;  3SUQ A;  1VAZ A;  3A5L C;  2G8H A;  1YIJ N;  4AHV A;  1EWR A;  4QOZ B;  4DS5 A;  1KLM A;  4DQQ A;  1OH7 A;  4LFB K;  4M42 A;  3T7Z A;  4DV4 K;  3OY9 A;  4W5T A;  4CIF A;  5FDL A;  5KGW A;  3L2U A;  3AVK A;  1LW0 A;  4UQG A;  1JLC A;  5KTQ A;  3LZI A;  3AVB A;  3SJJ A;  1FKP A;  4WCE L;  3THY B;  1FK9 A;  3VF2 A;  2FSJ A;  3TSU A;  1QZ5 A;  4AHU A;  3UE5 A;  3HM8 A;  4CK1 A;  1NKC A;  3ZSV A;  2F8S A;  3P39 A;  2IVN A;  2O4I A;  5BRE A;  2YHY A;  4GMJ B;  4CJ7 A;  2HMP A;  3MMV A;  4FWL A;  3C7N A;  1QTM A;  4WQ5 A;  4KFB A;  1LAW A;  2J4R A;  5CHI A;  4BRN A;  4CZG A;  3QNN A;  3AVF A;  3JSM A;  1VQ5 N;  2E1Y A;  3U8X A;  1W97 L;  1EP4 A;  3CQ8 A;  2V7Y A;  4DTR A;  4JK9 A;  3EN9 A;  4JI7 K;  2E6M A;  1I3A A;  2RE2 A;  3LZJ A;  3RR8 A;  3OBY A;  1YJN N;  1N6Q A;  4BRF A;  1VQ7 N;  4ICL A;  1DTT A;  4LFC K;  2A41 A;  3I55 N;  3CYM A;  3SQ4 A;  4W5R A;  3SI6 A;  4DV6 K;  3QNO A;  1JJ2 M;  3KTQ A;  1YIT N;  3BY5 A;  3D7E O;  1QE1 A;  5AQT A;  4CJT A;  4CJP A;  1VQL N;  3U3Y A;  4KI4 A;  3V9Z A;  4IJN A;  2RKI A;  2VG7 A;  3PSI A;  4WFA L;  3OVN A;  1WLJ A;  4BR9 A;  4IFV A;  4N47 A;  4EIA A;  2XY7 A;  3SQ2 A;  2ZJR L;  1S3X A;  3J7Y P;  4J2E A;  3Q7C A;  4LH5 A;  3NH2 A;  3ZSR A;  4FXD A;  1BL3 A;  3U4L A;  2XO7 A;  2E2N A;  3FZK A;  3VEW A;  3TAN A;  1NK4 A;  3BP8 A;  2UXB K;  1RCH A;  2ZJQ L;  4CEB A;  1GLC G;  4KTZ A;  2FF3 B;  4KRF A;  3QO9 A;  1RDB A;  3CJB A;  3RR7 A;  3ZEU B;  1XMQ K;  4AM6 A;  1JXB A;  5BN9 A;  2IGI A;  3FE1 A;  1VQM N;  4BE1 A;  1VQK N;  4BRM A;  4CEE A;  3C6A A;  1RIL A;  4M3Z A;  3CCU N;  2XY5 A;  5JEN A;  3TAR A;  1J5E K;  4FOI A;  1GLL O;  2R7Y A;  2P9U B;  1C0F A;  3HL8 A;  3S9H A;  3OW2 M;  3S3O A;  4LY7 A;  4YOT A;  4BVP A;  5ADX H;  2B5J A;  1Z6R A;  2G8K A;  4B3O A;  1KVB A;  1ZBH A;  4R5P A;  5C10 A;  4JI5 K;  2ZM6 K;  4G9Z A;  3A2F A;  2D0P A;  3O3H A;  2KLA A;  2D5R A;  5HP1 A;  2DTU A;  5CZ2 A;  2KFN A;  3E9O A;  5BR8 K;  4OKE A;  4FJH A;  1YI2 N;  2Q31 A;  4F2R A;  1QQN A;  2BTF A;  4RTF D;  4DV7 K;  2QK9 A;  2NRW A;  2GBZ A;  1HMV A;  3LPU A;  4R79 A;  3HJF A;  3S41 A;  2KW4 A;  3CIP A;  1B92 A;  3N4Q A;  3R8E A;  4EP4 A;  2XY6 A;  4DSJ A;  1EO1 A;  3B6P A;  4IO9 L;  3CCE N;  3U9Z A;  2NZT A;  1X1P A;  4BR7 A;  1BIZ A;  1U4B A;  1LV5 A;  3AVL A;  4KV8 A;  2QWL A;  2BE2 A;  1TL3 A;  3VPZ A;  1VQO N;  1VSF A;  3D2F B;  3V1R A;  4CI6 A;  1JL1 A;  5DK5 A;  3AVG A;  4JI2 K;  2W40 A;  2IIR A;  4DQP A;  1NU0 A;  2VYP A;  2OCE A;  4FWS A;  2QWN A;  3WNF A;  3VQ9 A;  3E9P A;  1RT7 A;  4Y0W A;  2A3Z A;  3DLK A;  2VWK A;  4B1Y B;  5AQL A;  1BI4 B;  4LF5 K;  4DHY A;  3KZB A;  4RG8 A;  4CJV A;  5LMN K;  3QEI A;  2P9L B;  1WSH A;  1J54 A;  4CBW A;  4AHR A;  2VG5 A;  3I8B A;  1VSJ A;  2HW3 A;  2E2O A;  1WBD A;  4BG9 A;  3ITH A;  5JIC A;  1CZA N;  3IKM A;  4A61 A;  1WUA A;  3NCI A;  4DTN A;  2V51 B;  4V19 S;  4BGB A;  1ASV A;  1TKD A;  3QES A;  1V4T A;  4OKK A;  2HHX A;  2RHK A;  1Z25 A;  1XQS C;  3AVC A;  4E7I A;  1S1T A;  3ZEU A;  3OTO K;  1IKX A;  4B3M K;  4BRE A;  5BRH A;  3RTV A;  3V9X A;  1YTU A;  3TR8 A;  1NGG A;  3CC4 N;  1JCG A;  3L4Q A;  2E6L A;  4AM7 A;  2KZZ A;  3SPZ A;  3QEW A;  1ILY A;  3WEE B;  1VQ6 N;  1RNH A;  2ATQ A;  4GVM A;  5BPN A;  3VA3 A;  3PSF A;  1KVC A;  4A62 A;  3CQY A;  5JS1 A;  1XHZ A;  4CFA A;  2WOM A;  3DLG A;  3HPH A;  5HRN A;  4F4K A;  5FRM A;  1EXQ A;  3BZK A;  5EXW A;  3SV3 A;  4CZM A;  2E2Q A;  1NK6 A;  1N33 K;  1VSL A;  3F5T A;  3ID6 A;  3LPT A;  2ZJP L;  3IFR A;  4O5B A;  1RDD A;  4DTO A;  4B3T K;  3SCX A;  2YJE A;  5AQI A;  5C12 A;  5EVZ A;  1QVG M;  1G99 A;  1S6Q A;  3AVI A;  1ZBS A;  2P9P B;  5AQM A;  4CZK A;  5C15 A;  3EKU A;  3ZYY X;  5ELZ A;  4CJQ A;  1F21 A;  4B9U A;  2HNY A;  2O4G A;  4FWN A;  4BC4 A;  4FK4 A;  1DT9 A;  4GV9 A;  1NKE A;  3DRP A;  4BC3 A;  3VER A;  3AO3 A;  3DYA A;  3DLE A;  3NF8 A;  3KIO A;  2PYJ A;  3F9M A;  3M6G A;  1X9W A;  3FZL A;  3OA9 A;  2YHB A;  2XY8 A;  4BE7 B;  3D2F A;  4F9O A;  1VQ4 N;  4X66 K;  3OYH A;  4CF0 A;  3T3F A;  4FL9 A;  2Z1H A;  3R1X A;  2X78 A;  3MX2 A;  4HHT A;  2JLE A;  3AVH A;  3AAQ A;  3B8A X;  5AQW A;  5AFU H;  3SAH A;  2WFB A;  3RVC A;  3VTH A;  5AR0 A;  3WNH A;  2I7P A;  1LOT B;  4C23 A;  4GV3 A;  3P83 D;  1BI4 A;  4H0Y B;  4K25 A;  2P9L A;  1L3T A;  1C0M A;  3DLB A;  1UOC A;  1JLQ A;  3J7Z O;  3I0R A;  4DV0 K;  4KHS A;  3W0L A;  3AO2 A;  3L6Q A;  4IOC L;  3G10 A;  2GTD A;  1WSJ A;  2NRT A;  3SQ0 A;  3VF6 A;  1HYS A;  4FLW A;  3SAG A;  4OJR A;  2O8C A;  5KQ8 A;  4RW7 A;  5HRO A;  4KHQ A;  5ADX A;  4I9L A;  3ZT2 A;  4CEQ A;  1VRT A;  3C6T A;  3GDQ A;  4J8F A;  1RT1 A;  5LL6 Z;  2Q0R A;  3LDP A;  4BY9 C;  1DEJ A;  1YVU A;  1BU6 O;  3CCJ N;  3OYD A;  4LF6 K;  3KLI A;  3WEE A;  4DB3 A;  3ZET B;  1IKV A;  4M3T A;  4DTU A;  1NK5 A;  1TAQ A;  4H0V B;  4FPB A;  1TGO A;  2E8A A;  3HST B;  2ASP A;  1RFQ A;  4BRO A;  4CZL A;  3U6F A;  1X9J A;  5EU7 A;  3LDQ A;  1L3S A;  3DXK B;  4FVU A;  5C24 A;  1VQ8 N;  4FLZ A;  3OHR A;  4FZX C;  5KQD A;  5I9E B;  4U67 L;  5C25 A;  4CGJ A;  3LAK A;  3LDO A;  3CCL N;  3FR0 A;  3KKR A;  3WXL A;  2GX9 A;  4H4M A;  4AHS A;  4WQ4 C;  2FLO A;  4YOU A;  1R59 O;  2P9P A;  4A5A A;  4LH4 A;  4CIE A;  4DSL A;  3MEC A;  3LP3 A;  4F8R A;  3IG1 A;  1Y64 A;  4A2A A;  3VTI A;  2YKM A;  5H1S Q;  3HP6 A;  1BO5 O;  5AQY A;  3CJC A;  5AQH A;  3F2K A;  2QWO A;  2B6A A;  3AA4 A;  2JWK A;  3TPQ A;  5GIO A;  4JI4 K;  4QAG A;  4GNI A;  4CJF A;  3M5R A;  3MN5 A;  3T1A A;  4LF7 K;  2HHS A;  4DR5 K;  1GOA A;  2GUI A;  4W5O A;  5DMR A;  3HTV A;  2EX3 A;  4AF1 A;  4DQI A;  1BCM A;  1NGD A;  1Z05 A;  5C0Y A;  1QHA A;  4CD1 A;  3RWU A;  4EHT A;  3EE8 A;  3OYA A;  3PY8 A;  4WQ5 C;  3HM9 A;  2F96 A;  1WAJ A;  3P5J A;  4PY5 A;  4LF9 K;  4H5W A;  4B9Q A;  3OYN A;  5AQP A;  1SKS A;  5JMV A;  5F1X A;  3MN7 A;  4NXN K;  4EZ9 A;  4CEC A;  2QWP A;  1HNZ K;  3OJU A;  3RMD A;  3E66 A;  2A1S A;  3O5B A;  2VWJ A;  3KK3 A;  2OPR A;  1DTQ A;  3LDN A;  3B6O A;  2Z1J A;  4M63 C;  2UUA K;  4M3Y A;  5KGX A;  4B1U B;  4Q5V A;  4ILJ A;  3V1O A;  3ZLJ A;  3FFI A;  2DPN A;  3IDH A;  2HHH K;  1WB9 A;  5CZ1 A;  4BQZ A;  4H03 B;  1QZ6 A;  2DFH A;  4FWQ A;  3WQT A;  4B8C A;  5LY3 A;  4K0K K;  3R9P A;  1VSM A;  5AQX A;  3ZET A;  3BDP A;  3VEV A;  4BWJ A;  2P5G A;  4JD2 B;  3CMA N;  3I56 N;  2YNH A;  2NRZ A;  3TSP A;  4ELT A;  2HHW A;  5AQN A;  3PLA A;  3SUP A;  1M90 O;  5CYQ A;  4DTP A;  5HL7 L;  2D4W A;  3WXJ A;  1RBV A;  2RF2 A;  2YV0 X;  4CJE A;  4FLX A;  4X65 K;  4XIU A;  1HUX A;  4RW6 A;  4JRP A;  3P4I A;  5C2D A;  1JLA A;  4NLB A;  3ZX2 A;  1GLJ O;  1NGF A;  3CER A;  2Z1I A;  3NF7 A;  5FRO A;  5J2N A;  1RT4 A;  3HXM A;  3DOL A;  2O8E B;  3RMA A;  1S22 A;  4FJK A;  3DJC A;  5E26 A;  3AO1 A;  2KHO A;  2HBK A;  3HP9 A;  4FM1 A;  3DWL A;  4FLY A;  3QB0 A;  4C8M A;  5JS2 A;  4KH5 A;  3O1W A;  4X64 K;  2A40 A;  1QVF M;  1HNV A;  1RDU A;  2HHQ A;  4DWI A;  4FWO A;  3E1Y A;  3HVR A;  2HBL A;  4DLE A;  1NKB A;  3MXI A;  4FJL A;  2V7Z A;  2HVI A;  4AHC A;  4DV1 K;  4IG3 A;  1BDG A;  3VEY A;  5JVH L;  4CIG A;  4NB4 A;  2X6S A;  4FJG A;  2A1R A;  4WF9 L;  4BGA A;  2P9K B;  2ZWH A;  4ELU A;  3J8A A;  4KHW A;  2CGJ A;  3PV8 A;  2QKB A;  3GE1 A;  4LD0 A;  5HLF A;  1XNR K;  3RMC A;  3MEE A;  3IUC A;  1SV5 A;  3P1G A;  1RBT A;  3K5M A;  5F2R A;  3LAL A;  4ZHR A;  4JAX A;  4MO5 A;  4CEZ A;  4JYA K;  4CFD A;  4H8K A;  2XRI A;  2D0C A;  4RCH A;  1SKW A;  4FZZ A;  3R6M A;  2LSN A;  3CM5 A;  4FO0 A;  3ATV A;  3RRG A;  3CJA A;  1UA0 A;  4TSX A;  3OYC A;  2YNI A;  4JD2 A;  3TTF A;  4YY3 K;  4FYD A;  2F7T A;  3LP0 A;  3V1Q A;  3ZSQ A;  3MCA B;  1D8Y A;  2D1K A;  2F4V K;  3FZM A;  3KLH A;  4CJU A;  2NNW A;  3A8Y A;  3M8Q A;  3PUF A;  2O8F B;  3THW B;  2PYL A;  1S9E A;  2VGN A;  2IAJ A;  2NRH A;  4FJ7 A;  4Z4E A;  4DTS A;  4DSI A;  4FJN A;  4CJ3 A;  5K14 A;  4YOW A;  1ZYQ A;  5M1F A;  4K43 A;  3CJ1 A;  3VGK A;  3ZSW A;  3CHW A;  1XI1 A;  5HOO A;  3PO4 A;  5GIN A;  1FJG K;  2O8E A;  2YHA A;  2HHU A;  3CCV N;  4CE9 A;  4CVN E;  5HBM A;  4B3R K;  3M1F A;  5JLH A;  1Q86 O;  4MLE A;  2GWK A;  4NYN A;  4JI3 K;  1CZB A;  3IRX A;  4O0J A;  3UKR B;  4O44 A;  2UU9 K;  4PA1 A;  4X62 K;  4NLC A;  2FBY A;  1KRP A;  5AQR A;  1GOB A;  4BG8 A;  3LL3 A;  3TAG A;  3K59 A;  4IEI A;  5JVG L;  4A59 A;  2Q97 A;  4OVL A;  1TL1 A;  4GVE A;  1C0T A;  1RTJ A;  3G25 A;  4GY2 B;  3CD6 N;  3WXM B;  1NOZ A;  3MN6 A;  3NVK A;  3CYG A;  4I2P A;  5I42 A;  3BF3 A;  3ZX0 A;  1WSF A;  2V52 B;  3QEX A;  3ZT1 A;  1KSP A;  1BUP A;  2IVP A;  1S1W A;  1CXU A;  3T1H K;  4KTW A;  3CI5 A;  2GEM A;  2OTL N;  1OH6 A;  5IT9 O;  2P9K A;  4BWM A;  2KQ2 A;  1HLU A;  5JLF A;  4FPA A;  1NWK A;  4QS9 A;  4B1Z A;  2HHV A;  3L3V A;  1V4S A;  4CF1 A;  3DOK A;  3SJH A;  3L2V A;  4J2B A;  1GOC A;  3JXU A;  3MED A;  3DLR A;  3G4S N;  5EY4 A;  3UIQ A;  3ZCM A;  3CCR N;  1ZXO A;  3GBT A;  2UXC K;  2YHW A;  1VSK A;  5MLC Q;  2Q3S A;  1KAX A;  4NXM K;  1NJY A;  3QFP A;  4FJJ A;  3QIP A;  3DRS A;  5KPT A;  1NK8 A;  1I94 K;  1LCU A;  4BDY A;  2HF3 A;  3MWP A;  3DXM B;  3V9U A;  4NO7 A;  4BVO A;  3L2Q A;  1HPZ A;  3LM2 A;  4BC5 A;  4KB1 A;  5AQV A;  4YOY A;  4IZ9 A;  1XC9 A;  2RN2 A;  3ULE B;  3UKU A;  1X9S A;  4IO8 A;  4PL7 A;  1U2V A;  1HJR A;  3C65 A;  4JKE A;  1TK0 A;  1U6Z A;  2O8F A;  2HMI A;  3THW A;  4FSV A;  5GAG P;  1REV A;  3N4P A;  2QTD A;  3ENB A;  3IMX A;  5J1E A;  1GLA G;  2RPI A;  2HBM A;  3ENH A;  3OJS A;  4E7H A;  2O8C B;  4GW6 A;  4JI6 K;  4B8A B;  4B9M A;  3E01 A;  1KLN A;  3SBT A;  2Y1J A;  1KAZ A;  2FSK A;  4Z4H A;  3BF1 A;  4JS4 A;  4PHT X;  3HPG A;  4Z0U A;  1NJI O;  2YI1 A;  3UKR A;  4HCC A;  4EP5 A;  4L3Q A;  1CZ9 A;  3O1B A;  1BA0 A;  3NFA A;  5GAE P;  1NGH A;  2GV9 A;  5SZT A;  4CF9 A;  3O9T A;  4YDU A;  4LFA K;  2W00 A;  4NCG A;  1YAG A;  1BWF O;  2NLX A;  4DFJ A;  1FKO A;  1TV6 A;  1ATN A;  3TSQ A;  5AQK A;  4JI0 K;  5AQS A;  5AQQ A;  4KPY A;  5EX5 A;  4DKW A;  1O1W A;  4FW1 A;  1NJW A;  4CF2 A;  5AZI A;  1WAF A;  1UA1 A;  3NGZ A;  4DFP A;  3WUH A;  3NMU A;  4IG0 A;  4K8X A;  3MWT A;  2X74 A;  3CCQ N;  2PFU A;  4BQL A;  4FWM A;  1K8K B;  3DM2 A;  4FWK A;  3WXK A;  1IJJ A;  1C1C A;  3QML A;  1U45 A;  2G8I A;  4WE1 A;  5AQU A;  4DF8 A;  5BPM A;  1T44 A;  3O9U A;  4CER A;  4LC9 B;  4CGG A;  1QQC A;  2E88 A;  2UYT A;  3ISN C;  1T05 A;  1K9M O;  1ZC6 A;  2I5J A;  3FGU A;  3TU5 A;  1X9M A;  1N34 K;  4Q0B A;  2KZM A;  3HT3 A;  5GIP A;  2IC3 A;  1EQY A;  3BZC A;  3U3G A;  1Y97 A;  3EEQ A;  3DXM A;  2EHG A;  1EX4 A;  2WTU A;  1IBL K;  4EFH A;  4DV3 K;  5AQF A;  4FZY A;  3VMF B;  1K73 O;  2O8D B;  1KTQ A;  3ULE A;  5CE3 A;  4CW7 B;  1HQU A;  1JCE A;  2P51 A;  3H3O B;  1YT3 A;  1VSE A;  2ZD1 A;  3TWH A;  3C94 A;  3LAN A;  4IOA L;  4CHP A;  1HKG A;  4H5T A;  1VHX A;  4ID5 A;  3ZT3 A;  4FW2 A;  1LWC A;  4JKD A;  3LWL A;  2WUS A;  3O9R A;  3H08 A;  2AP1 A;  1X3M A;  4OO1 J;  4IEE A;  2D0A A;  4LF8 K;  3LM9 A;  2CGL A;  4RW9 A;  1VSI A;  3SYZ A;  4BRH A;  4KHN A;  4JEP A;  1LWE A;  1S1U A;  4HUF A;  3VF4 A;  3JYT A;  1BIS A;  5C2F A;  2HF4 A;  2VQF K;  3HI0 A;  1FXX A;  1SL2 A;  2WBN A;  3CM6 A;  2FF6 A;  3FLC O;  4Z4C A;  3QEP A;  1U49 A;  2WC9 A;  4CJK A;  3SMP A;  3MDQ A;  1DLO A;  4KH6 A;  5FRN A;  3K0S A;  3NVM A;  4BR5 A;  1BHL A;  1ZBU A;  3AVJ A;  1OH5 A;  3HYF A;  3TTC A;  3O3F A;  4N41 A;  4I9Q A;  3VQ8 A;  1H1V A;  1HKC A;  4DSE A;  1A5V A;  4DU3 A;  3V6D A;  4JI1 K;  2OZS A;  2P1J A;  2YNF A;  1NGI A;  3VQQ A;  2Q2R A;  1IKW A;  3MCP A;  3BEX A;  4M3W A;  4CJS A;  3C6H A;  5BPL A;  2Q0U A;  5KRT A;  2QW9 A;  1K8K A;  3ZSO A;  3TAP A;  2YJF A;  3HVT A;  2HHI A;  3JAM O;  3FFK B;  5AQG A;  3VQD A;  4H0O A;  2ITG A;  1YXQ A;  2Y1I A;  5DM6 L;  5AQJ A;  4FM0 A;  4JKB A;  3SNN A;  4K41 A;  3EKS A;  2P9N B;  3QET A;  1HRH A;  1SL0 A;  5LJW A;  3HZ6 A;  1EWQ A;  2OPS A;  4HUG A;  4N76 A;  1TKT A;  1VSD A;  5E41 A;  1IBM K;  4YOV A;  3VOV A;  3ENO A;  4IJA A;  2IVO A;  4HCB A;  4C1N I;  2O8D A;  1XHX A;  1S72 N;  1QQO A;  2HVH A;  3ATU A;  3V9W A;  1YVN A;  3ZX3 A;  1GLE G;  3MN9 A;  2VG6 A;  4H5V A;  5FPM A;  3CME N;  3AGK A;  2ZGY A;  3MXJ A;  4AH9 A;  4FOE A;  1NK0 A;  3RRH A;  3L2R A;  3AV9 A;  2ETJ A;  1KXP A;  3E9L A;  4CGI A;  1SL1 A;  3W3D A;  4XJX A;  4CHZ A;  3TTD A;  4JKF A;  3AAR A;  1KVA A;  4E1M A;  3NHG A;  3LP2 A;  3F73 A;  3KK1 A;  4OLB A;  1L3V A;  3DI6 A;  2VQE K;  4FK0 A;  4OGC A;  3T69 A;  2ASM A;  4CK2 A;  3SLC A;  4DR2 K;  5J2M A;  3QIO A;  1TKX A;  4BR2 A;  1NM1 A; 
#chains in the Genus database with same CATH homology
 2NRX A;  5M1Q A;  4Y0W A;  4CD3 A;  2A3Z A;  4FO0 A;  3D2E B;  5TKY A;  3ATV A;  4B1Y B;  5AQL A;  1TUY A;  2D0O A;  3CJA A;  1GLD G;  2E20 A;  2ASO A;  4DHY A;  4ISF A;  3KZB A;  4JD2 A;  1YF5 L;  2P9L B;  1VQN N;  3TTF A;  4WFB L;  4CBW A;  3HOS A;  2F7T A;  3I8B A;  1MA9 B;  3P38 A;  3BUZ B;  5BRD A;  3MCA B;  2D1K A;  4JHD B;  2E2O A;  4BG9 A;  2VGM A;  3FZF A;  3FZM A;  2BUP A;  5JIC A;  1CZA N;  3IKM A;  3RSE A;  1WUA A;  4A61 A;  2NNW A;  2V51 B;  3A8Y A;  4U7B A;  4BGB A;  4BRA A;  1TYQ A;  4ISE A;  1V4T A;  2P9S B;  2E1Z A;  4DCH A;  2ZF5 O;  2VGN A;  2NRH A;  3VEO A;  2RHK A;  1VQP N;  1NGJ A;  1XQS C;  2W41 A;  3GL1 A;  3ZEU A;  2ITM A;  4YOW A;  1HKB A;  4K43 A;  5M1F A;  3CJ1 A;  4BR2 A;  3L4I A;  4BRE A;  5BRH A;  3VGK A;  3CHW A;  1NGG A;  5HOO A;  2OTJ N;  5GIN A;  3CC4 N;  3VEN A;  1JCG A;  3L4Q A;  3QIC A;  4A57 A;  2PBD A;  4AM7 A;  1OKJ A;  4ILG B;  5B8H A;  3CCV N;  1TUU A;  4BR0 A;  2Q36 A;  3AGR A;  3A5M C;  1ILY A;  3M1F A;  5JLH A;  1Q86 O;  4MLE A;  2GWK A;  4MDA A;  3WEE B;  1D4X A;  5FPD A;  3CC2 N;  1VQ6 N;  3UKR B;  3SK3 A;  5AZJ A;  5BPN A;  4NLC A;  1X3N A;  5AQR A;  4A62 A;  3CQY A;  4BG8 A;  3LL3 A;  3M3Z A;  2A42 A;  4JNE A;  1NGB A;  4IEI A;  2OAN A;  2F9T A;  1HX1 A;  1O13 A;  5JVG L;  3HRG A;  1E4F T;  1T6D A;  1YJW N;  3Q7B A;  4A59 A;  2Q97 A;  5EXW A;  4H0P A;  4CZM A;  2E2Q A;  2QM1 A;  3O4W A;  4GVE A;  3G25 A;  3UB5 A;  4GY2 B;  3CD6 N;  1MWK A;  2QWR A;  3WXM B;  3F5T A;  3ID6 A;  3MN6 A;  1YHQ N;  3NVK A;  2ZJP L;  5LJV A;  2P9N A;  3IFR A;  1W2B M;  3KWG A;  2JWL A;  3BF3 A;  3ZX0 A;  1J6Z A;  3EE9 A;  2V52 B;  3CXC M;  4WYB A;  2YJE A;  2YHX A;  4WQ4 A;  1RDW X;  1BUP A;  2IVP A;  5AQI A;  3A5N C;  4BRL A;  5C12 A;  5EVZ A;  5FPN A;  1QVG M;  3O6W A;  4K42 A;  1G99 A;  4JKA A;  1ZBS A;  3HOT A;  2P9P B;  1BG3 A;  3VGM A;  3CI5 A;  5AQM A;  2GEM A;  4CZK A;  5C15 A;  3EKU A;  4QS7 A;  2OTL N;  3ZYY X;  5ELZ A;  4BC2 A;  3O80 A;  2P9K A;  3O8M A;  2CH5 A;  1HLU A;  3MK6 A;  4FWN A;  5JLF A;  4FPA A;  1NWK A;  1DT9 A;  1WOQ A;  4QS9 A;  4B1Z A;  4BC4 A;  3SAF A;  4GV9 A;  1V4S A;  1DGK N;  1HJO A;  3SJH A;  4BC3 A;  3VER A;  1QQM A;  3H1Q A;  3QFU A;  3JXU A;  3WQU A;  4CBX A;  2QWQ A;  2QWM A;  2YCH A;  4B1X B;  3G4S N;  5BRF A;  1C0G A;  5EY4 A;  4GV6 A;  2KKZ A;  1XC3 A;  4BEC A;  3CCR N;  1ZXO A;  3F9M A;  3GBT A;  4Z94 A;  4KBO A;  2QXL A;  4CZJ A;  3M6G A;  2YHW A;  3FZL A;  3OA9 A;  2C1G A;  5E84 A;  3CPW M;  4BRG A;  4BE7 B;  3D2F A;  5MLC Q;  4F9O A;  4YOR A;  1VQ4 N;  2YX6 A;  1KAX A;  4FL9 A;  3R1X A;  3QFP A;  2HOE A;  3MX2 A;  4H0X B;  3O9Q A;  5KPT A;  4EHU A;  1GLF O;  4BRI A;  3A0I X;  1LCU A;  3AAQ A;  3B8A X;  3EO3 A;  5AQW A;  5AFU H;  4BRP A;  3SAH A;  1Q81 O;  2WFB A;  5BR9 A;  2HF3 A;  3RVC A;  3VTH A;  5AR0 A;  3VEZ A;  1DKG D;  2I7P A;  1LOT B;  4C23 A;  3D2E A;  4GV3 A;  3SBG A;  3MWP A;  1JCF A;  2A6A A;  2F9W A;  3DXM B;  3QBX A;  4H0Y B;  4K25 A;  4NO7 A;  4BVO A;  3D6R A;  1M1K O;  3LM2 A;  4BC5 A;  2P9L A;  2Q1N A;  4RWT A;  5AQV A;  4YOY A;  2GUP A;  4IZ9 A;  3J7Z O;  5M1O A;  3P31 A;  3ULE B;  3UKU A;  3CJ7 A;  4IO8 A;  4PL7 A;  3W0L A;  1U2V A;  3L6Q A;  3C7N B;  4IOC L;  4JHD A;  2GTD A;  3VEX A;  2NRT A;  4BRD A;  2QI2 A;  5CR4 A;  3C65 A;  4PKG A;  4JKE A;  3VF6 A;  1U6Z A;  3KWI A;  3H1V X;  3UKU B;  5FPE A;  4PKH A;  1U2V B;  2P9S A;  4JKH A;  3SAG A;  1GLB G;  4CZF A;  5M1K A;  4FSV A;  3U9D A;  5GAG P;  3O9S A;  4A2B A;  5KQ8 A;  1T6C A;  3N4P A;  2QTD A;  3ENB A;  3IMX A;  1GLA G;  4EAH D;  2HBM A;  5ADX A;  4YOX A;  3ENH A;  3DAW A;  4BEB A;  3GDQ A;  3HSC A;  4J8F A;  2CH6 A;  2Q0R A;  3LDP A;  3CF5 L;  3HBT A;  2ZGZ A;  3AAP A;  4BY9 C;  1DEJ A;  3SBT A;  1KAZ A;  2FSK A;  1BU6 O;  1NBW A;  2VWB A;  1ATS A;  3BF1 A;  3CCJ N;  5AQO A;  4PHT X;  1KQS M;  3VET A;  4XH4 A;  3WEE A;  4DB3 A;  1NJI O;  3ZET B;  2YI1 A;  3UKR A;  3H46 O;  4JK8 A;  4B1V A;  4B1W B;  4HWI A;  4I6M B;  4L3Q A;  2NRV A;  4H0V B;  4FPB A;  4MO4 A;  2EWS A;  1XUP O;  3O1B A;  3CC7 N;  2E8A A;  1BA0 A;  3DXK A;  4HTL A;  1BA1 A;  4IFE A;  3WXI A;  2ASP A;  5GAE P;  3VES A;  4OPH A;  1NGH A;  3CCM N;  4YDU C;  1RFQ A;  2GEL A;  4BRO A;  4XEI A;  4IOX A;  3WT0 A;  2GWJ A;  1X9J A;  4CZL A;  4WFN L;  3O9T A;  3AY9 A;  3LDQ A;  3DXK B;  3K9J A;  4FVU A;  4YDU A;  1VQ8 N;  2W00 A;  1YUW A;  1YAG A;  1BWF O;  2NLX A;  3OHR A;  4IXC A;  5I9E B;  5KQD A;  4U67 L;  5M1P A;  1YJ9 N;  3KK7 A;  4JK7 A;  3LDO A;  1SQK A;  3CCL N;  3FR0 A;  3PIO L;  4O8K A;  1ATN A;  3WXL A;  2GX9 A;  2P9I B;  2PAV A;  4KH4 A;  5AQK A;  3TSQ A;  3H3N O;  4WQ4 C;  1HPM A;  5AQS A;  2FLO A;  5AQQ A;  5M1N A;  4YOU A;  4UY8 O;  1R59 O;  2BH1 A;  2P9P A;  1SAZ A;  5AFU A;  4A5A A;  5EX5 A;  4DKW A;  3VGL A;  2I7N A;  5AZI A;  1VAZ A;  2E2P A;  3A5L C;  3LDL A;  3QDK A;  3WUH A;  1YIJ N;  3NMU A;  3MWT A;  4QS8 A;  3A5O C;  4BRK A;  3CCQ N;  2PFU A;  1ATR A;  4FWM A;  1K8K B;  4MDB A;  4BQL A;  1Y64 A;  4FWK A;  4A2A A;  3VTI A;  3WXK A;  5AZI B;  5H1S Q;  1IJJ A;  1BO5 O;  1MWM A;  5AQY A;  3QML A;  5AQU A;  3T7Z A;  3CJC A;  5BPM A;  5AQH A;  1T44 A;  4ISG A;  5BN8 A;  3F2K A;  2QWO A;  3O9U A;  4H5R A;  5KPZ A;  4JKG B;  2JWK A;  3TPQ A;  5GIO A;  2A5X A;  4M7X A;  1KC8 O;  4LC9 B;  4GNI A;  2E88 A;  2UYT A;  1K9M O;  1ZC6 A;  4BR4 A;  3M5R A;  3MN5 A;  3FGU A;  5TKW A;  3TU5 A;  4WCE L;  3CET A;  3CJ9 A;  3VF2 A;  2FSJ A;  1Q82 O;  3TSU A;  1QZ5 A;  5GIP A;  3UE5 A;  1RGI A;  1EQY A;  3HM8 A;  3DXM A;  3HTV A;  5DM7 L;  1N8R O;  4AF1 A;  3PIP L;  1Z05 A;  1NGD A;  5C0Y A;  4EFH A;  1QHA A;  4CD1 A;  5AQF A;  4EHT A;  3EE8 A;  2IVN A;  3FZH A;  3P39 A;  4WQ5 C;  3VMF B;  5BRE A;  1K73 O;  2YHY A;  4JKC A;  4CBU A;  4CJ7 A;  2HMP A;  3MMV A;  4CZE A;  3ULE A;  4H5W A;  4B9Q A;  5CE3 A;  4FWL A;  3C7N A;  4WQ5 A;  5AQP A;  1JCE A;  1P90 A;  2J4R A;  3H3O B;  3H6E A;  5F1X A;  5JMV A;  3MN7 A;  5CHI A;  4BRN A;  5GAH P;  2QWP A;  4IOA L;  1E4G T;  5KPR A;  4CZG A;  1HKG A;  1NGC A;  4H5T A;  3E66 A;  1VQ5 N;  3O5B A;  2E1Y A;  3U8X A;  1W97 L;  4O5F A;  2V7Y A;  4PL8 A;  4JK9 A;  3EN9 A;  4JKD A;  3R3L A;  2WUS A;  2RE2 A;  3LDN A;  1NMD A;  4DQ8 A;  3OBY A;  1YJN N;  3O9R A;  4M63 C;  4BRF A;  3E9P A;  4H5N A;  2QA4 N;  1VQ7 N;  2AP1 A;  4B1U B;  1X3M A;  2A41 A;  4ILJ A;  3I55 N;  4OO1 J;  2DPN A;  3IDH A;  4IEE A;  4FWP A;  1NLV A;  3LM9 A;  2CGL A;  3L0Q A;  1JJ2 M;  4BQZ A;  1BOT O;  4H0T B;  3D7E O;  4XH5 A;  5F0X A;  1YIT N;  4H03 B;  5AQT A;  1VQL N;  1QZ6 A;  4BRH A;  4FWQ A;  3WQT A;  3GG4 A;  4CZH A;  4IJN A;  5LY3 A;  4JEP A;  3R9P A;  3MX5 A;  1MDU B;  1IG8 A;  5AQX A;  1T3V A;  3VF4 A;  3ZET A;  4WFA L;  5AQZ A;  3OBW A;  4IDH A;  3VEV A;  2H3G X;  5C2F A;  3KHY A;  4I6M A;  2HF4 A;  4BR9 A;  4FWR A;  3HI0 A;  4JD2 B;  3CMA N;  3I56 N;  2NRZ A;  3TSP A;  4EIA A;  2WBN A;  1KAY A;  2FF6 A;  3FLC O;  2ZJR L;  1S3X A;  1ESV A;  1NGE A;  3Q7C A;  4M7Y A;  5AQN A;  3PLA A;  2WC9 A;  1M90 O;  2C1I A;  3SMP A;  3MDQ A;  3U4L A;  4E1J A;  5HL7 L;  2D4W A;  3WXJ A;  4KH6 A;  2E2N A;  3FZK A;  3NVM A;  3RSE B;  3VEW A;  3CCS N;  3K9K A;  1TYQ B;  4BR5 A;  1KD1 O;  3BP8 A;  1HUX A;  1Q18 A;  2ZJQ L;  1GLC G;  4CZI A;  4BRQ A;  2FF3 B;  3P4I A;  5C2D A;  2P9I A;  3TTC A;  1K8A O;  2VCP A;  4MLH A;  3CJB A;  2QEX N;  4NLB A;  3ZEU B;  1H1V A;  1HKC A;  4XH1 A;  1GLJ O;  3ZX2 A;  4AM6 A;  1NGF A;  5BN9 A;  2FXU A;  3CER A;  3FE1 A;  2P9U A;  4OPA A;  1NGI A;  1VQM N;  1VQK N;  3KVG A;  3O08 A;  3GOI A;  4BRM A;  1Q7Y O;  2Q2R A;  3C6A A;  3JS6 A;  3BEX A;  3MCP A;  4BRC A;  3C6H A;  3G71 N;  5BPL A;  1S22 A;  3CCU N;  4A5B A;  2Q0U A;  3DJC A;  5E26 A;  4FOI A;  2QW9 A;  1GLL O;  2P9U B;  2KHO A;  1K8K A;  1C0F A;  2HBK A;  2YJF A;  3OW2 M;  2HBJ A;  3DWL A;  3H45 C;  3QB0 A;  5AZJ B;  4KH5 A;  4YOT A;  3FFK B;  5AQG A;  3O1W A;  4IWV A;  4BVP A;  5ADX H;  1Z6R A;  4H0O A;  2A40 A;  1NGA A;  5C10 A;  1YXQ A;  4JKG A;  4G9Z A;  2D0P A;  5DM6 L;  1QVF M;  3QBW A;  2KLA A;  1RDU A;  2FSN A;  5EOY A;  5AQJ A;  4FWO A;  3E1Y A;  4JKB A;  3I33 A;  3EL2 A;  4K41 A;  1SZ2 A;  2HBL A;  3EKS A;  2P9N B;  3E9O A;  5LJW A;  3HZ6 A;  1YI2 N;  2Q31 A;  2V7Z A;  1QQN A;  2BTF A;  1BDG A;  4RTF D;  4YOV A;  1P8Z A;  3VOV A;  3C0B A;  3ID8 A;  3ENO A;  4IJA A;  3VEY A;  2NRW A;  5JVH L;  2IVO A;  4NB4 A;  4C1N I;  4WF9 L;  1QQO A;  3CQX A;  4BGA A;  3ATU A;  4R79 A;  1S72 N;  2P9K B;  1YVN A;  5GAD P;  2HST A;  3ZX3 A;  1GLE G;  3MN9 A;  2ZWH A;  3S41 A;  3CIP A;  4H5V A;  5FPM A;  3CME N;  3AGK A;  3N4Q A;  2ZGY A;  3R8E A;  3J8A A;  4FOE A;  2CGJ A;  1EO1 A;  4JN4 A;  3GE1 A;  1KXP A;  1SS6 A;  3E9L A;  4IO9 L;  3CCE N;  3U9Z A;  2NZT A;  3W3D A;  4BR7 A;  4XJX A;  3TTD A;  4JKF A;  3AAR A;  3CPE A;  2QWL A;  3VPZ A;  1VQO N;  2AA4 A;  3D2F B;  3IUC A;  3G6E N;  3EZW A;  4CI6 A;  3T69 A;  5F2R A;  2NRR A;  4JAX A;  2ASM A;  4C1N K;  4ILH A;  2W40 A;  1VQ9 N;  4MO5 A;  2IIR A;  3SLC A;  3DLL L;  4PKI A;  3SMS A;  2VYP A;  4FWS A;  4O8U A;  2QWN A;  4RCH A;  2CGK A;  1NM1 A;  3R6M A;  1OVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...