1NM1A

Crystal structure of d. dicsoideum actin complexed with gelsolin segment 1 and mg atp at 1.8 a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
372
structure length
364
Chain Sequence
DVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin
publication title The Structure of Non-Vertebrate Actin: Implications For The ATP Hydrolytic Mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 118
structure length 364
sequence length 372
ec nomenclature
pdb deposition date 2003-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nm1A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nm1A02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1nm1A03
1ATRA 5AQWA 1BU6O 2YJFA 2YHXA 1NGAA 4K25A 1SZ2A 3RSEA 4FSVA 1GLFO 1D4XA 3BEXA 2FLOA 3AARA 3SMSA 4IXCA 4FWNA 3GDQA 4XEIA 3MK6A 1X3MA 1BA1A 3DXMB 3M6GA 5BPLA 1LCUA 4XH5A 4A62A 1GLEG 2YHYA 3KHYA 2YCHA 4IO8A 4Y0WA 2QWMA 3U9DA 3FZLA 4O8KA 3HM8A 5AQSA 5AQHA 2QWRA 1P8ZA 3VEWA 3GG4A 2E20A 2QWPA 3RSEB 3C7NB 4HWIA 3H45C 4IWVA 3D2EA 3IFRA 4FWPA 5AQMA 2CGJA 2FSJA 4B1VA 1HKBA 1SAZA 2A3ZA 1QHAA 1RDWX 4WQ4A 4CBUA 5AQGA 4CI6A 3CETA 1QQMA 4DB3A 2AP1A 1YUWA 5EXWA 4PL7A 3M3ZA 1NGIA 5FPEA 4BRKA 2FSKA 3CJCA 3BP8A 3ULEA 1HKCA 3EN9A 4I6MA 3CERA 1BA0A 1BG3A 2NLXA 3C0BA 5BPNA 3CI5A 1ESVA 2I7NA 1JCFA 3SLCA 1T6CA 2QWNA 1NGEA 2GWJA 4BRMA 2E2PA 3CJ1A 1OKJA 3DJCA 3H46O 4A2AA 4NO7A 5JLHA 3H3NO 3ULEB 1V4TA 4IJAA 5EVZA 3AY9A 1TUYA 3GL1A 4K42A 2ASPA 3QDKA 1NGFA 2A5XA 3VGLA 3VOVA 5LJVA 4BR2A 3BF3A 4BG9A 2IVPA 1GLBG 4JHDA 4BRHA 1Y64A 4YDUC 5TKYA 1GLCG 5ADXA 1HPMA 3WXLA 5LJWA 3MCPA 4WYBA 4HTLA 1XUPO 4FO0A 3FZFA 2P9UA 1DGKN 4EHTA 3QB0A 4J8FA 4RWTA 4F9OA 1Z6RA 2CH5A 2D0OA 4MO5A 3DXKA 3FE1A 1JCEA 5AQJA 4B1UB 1HX1A 4B9QA 4MLEA 1ZBSA 2FSNA 3GE1A 3WEEB 3QBWA 4O5FA 3HI0A 4IZ9A 1E4FT 1C0FA 1NGHA 2ITMA 1U2VA 2HF3A 1MWMA 2ZGYA 3MN9A 2E88A 2V7YA 3HTVA 1KXPA 4JN4A 4EHUA 4FWLA 5AQOA 5AQUA 4DHYA 2E2OA 4Z94A 3G25A 1K8KA 1ATNA 1DEJA 2Q1NA 2E2QA 3VERA 4H0PA 1U6ZA 2V7ZA 1KAZA 2P9LA 2FF6A 3CJ9A 5AQIA 1XC3A 4A2BA 1MWKA 4BRAA 3ZX0A 2QW9A 3O08A 3MN6A 4FWOA 3D7EO 2OANA 2HMPA 4H03B 4B1XB 3EL2A 5E84A 3UE5A 3FZHA 4H0OA 5AQRA 1NLVA 4FPAA 3WQUA 2P9SB 2GEMA 5AQKA 2GELA 2WUSA 3O1WA 4LC9B 3VGMA 4BGAA 4BR5A 1GLAG 4CZLA 5B8HA 4QS7A 4KBOA 4CD3A 4H5VA 5CE3A 4AM7A 3VESA 3U4LA 5F1XA 3UKRA 1IG8A 4NB4A 3L0QA 3EO3A 3WUHA 4H5TA 2D1KA 2Q36A 1X9JA 4BRGA 2YJEA 5AFUA 2DPNA 2FF3B 1GLDG 1QQNA 4H0XB 3H1QA 2P9KA 3LM2A 3ID8A 1XQSC 4H5RA 3BUZB 1E4GT 2KHOA 4E1JA 2BUPA 3ZX2A 5AQZA 1HKGA 4BGBA 2Q97A 3MDQA 2E1YA 2J4RA 3UKRB 1ATSA 4BC3A 4WQ5A 2QWLA 3M1FA 3O4WA 5F2RA 2ZWHA 4FOEA 4H0VB 4BRCA 1BO5O 4PKGA 4BVPA 3H3OB 5BRDA 3D2EB 4AM6A 3U8XA 4C23A 2PBDA 2ZF5O 3EKUA 1JCGA 3AAPA 3CQYA 4BRPA 4CD1A 3L6QA 3ZEUA 1GLLO 3A5LC 3MN5A 3OHRA 3B8AX 1NGDA 3WXKA 3UKUA 4QS9A 4WQ4C 3ZETA 2P9IA 4BVOA 5BN9A 3SJHA 5AZJA 5BRFA 3WQTA 4CZEA 4CZGA 2Q0UA 4RCHA 3BF1A 1TYQA 1YXQA 3O80A 4I6MB 5AR0A 5KQDA 3DAWA 3HBTA 1R59O 3ZEUB 3IDHA 4H0TB 2AA4A 3VEYA 3CHWA 5BRHA 3LDPA 4BRIA 2ASOA 2V52B 2GTDA 4CBXA 2H3GX 2I7PA 5E26A 1GLJO 1QZ5A 5FPMA 3AAQA 3UB5A 5BN8A 4CZHA 2YHWA 4M7XA 3I8BA 3FZKA 5I9EB 1YAGA 5ELZA 4B1YB 4CZMA 5LY3A 1MDUB 1BUPA 1HJOA 1TUUA 2VCPA 5EY4A 3D2FA 3SK3A 2A40A 4JHDB 1NWKA 2ASMA 4EIAA 4ISGA 2Q31A 3QICA 3CJ7A 2Q2RA 4JD2A 1WOQA 2P9UB 3QMLA 4H0YB 3J8AA 1LOTB 1NGJA 2P9PA 4CBWA 4FWSA 3TU5A 2Q0RA 1CZAN 1HLUA 3LM9A 5JLFA 5KPTA 3O1BA 3DXKB 1NGBA 4CZIA 4XH4A 4PKHA 4EAHD 5AQXA 1NGGA 3A8YA 1S22A 5AQVA 2YI1A 2A42A 3QFPA 3FFKB 3ZX3A 1U2VB 1IJJA 4BG8A 3MN7A 3O8MA 4H5NA 2P9PB 3I33A 4JAXA 2VWBA 5JICA 1K8KB 4BRNA 2QM1A 3R9PA 4FWKA 2P9LB 5AQFA 4H5WA 3QBXA 5BR9A 5F0XA 4BC4A 5BPMA 3GOIA 3ATUA 1S3XA 3ENHA 3FZMA 2IVOA 4FWMA 3DWLA 2CGKA 3WXIA 1EQYA 2D0PA 4L3QA 3KZBA 3IMXA 1H1VA 1KAYA 2CGLA 5AQTA 4JNEA 3C7NA 4ISEA 3VF4A 2VYPA 4FWRA 4DQ8A 4CJ7A 2GUPA 3R8EA 3A5NC 2W40A 4M63C 3MMVA 3W0LA 3EZWA 1HUXA 1QQOA 2A41A 3A0IX 3A5OC 1BWFO 3VPZA 1BDGA 1NMDA 3ENOA 3VGKA 4RTFD 3CIPA 4BROA 2CH6A 2F9WA 5ADXH 3CQXA 2QWOA 1T6DA 5AQQA 3CJBA 2HF4A 2PAVA 2W41A 2P9KB 3LDLA 2A6AA 4BR9A 2D4WA 4BRQA 3VEXA 3FR0A 3S41A 1G99A 5FPNA 4FOIA 4BRFA 3LDQA 2E2NA 1YVNA 4ISFA 4CZJA 3F9MA 4WQ5C 5AQYA 3WXJA 4GNIA 1QZ6A 5KPRA 4QS8A 1J6ZA 4GY2B 4CZKA 2EWSA 3P4IA 5AZIA 1NGCA 2FXUA 3A5MC 5JMVA 5KPZA 4BQLA 4BR0A 1WUAA 3ATVA 3R6MA 4EFHA 4BC2A 3FLCO 3UKUB 1NM1A 1C0GA 3ZETB 2P9IB 2QXLA 3VEZA 5AZJB 4YDUA 3O6WA 3VENA 4BQZA 2P9NA 4MLHA 4FWQA 3FGUA 3JS6A 1TYQB 2NZTA 1X3NA 1KAXA 4CZFA 3LDOA 5AZIB 3SMPA 1ZXOA 3U9ZA 5FPDA 5AQLA 2GWKA 4BC5A 1RFQA 4B1WB 1SQKA 5EOYA 4BREA 1MA9B 2E8AA 3HZ6A 3WEEA 1Q18A 5AQPA 4A61A 3LDNA 1Z05A 3VEOA 1V4SA 2QWQA 4K43A 3WT0A 2P9NB 5BREA 4XH1A 3QFUA 5EX5A 3L4IA 1DKGD 3LL3A 3HSCA 2NRHA 1BOTO 5AFUH 3H6EA 3VEVA 2IVNA 3O5BA 2BTFA 4M7YA 3D2FB 3JXUA 4B1ZA 3VETA 2F9TA 3W3DA 4BR7A 4BRDA 2UYTA 4BR4A 4MO4A 3VF2A 2E1ZA 3KVGA 2V51B 4K41A 4BRLA 4JD2B 1RGIA 2IIRA 1NBWA 1T44A 4PL8A 3VF6A 3TPQA 4PKIA 3GBTA 4DCHA 4IJNA 2HOEA 2P9SA 3H1VX 3CJAA 5KQ8A 2ZGZA 1ZC6A 3IUCA 3DXMA 4FPBA 5AQNA 3EKSA 4FL9A
chains in the Genus database with same CATH superfamily
1EWRA 2UU9K 2YHXA 3L2QA 3CC7N 1NGAA 4F3TA 1SZ2A 3CM6A 3S5TA 4DF4A 2P1JA 1HYVA 1GLFO 1L3TA 3SCXA 3SMSA 3L8BA 4FWNA 5M1NA 3MK6A 4CJRA 5IWAK 1J53A 2GX9A 3ENBA 4XH5A 5KI6A 1JL2A 3KHYA 4CGDA 3U9DA 3HM8A 1WSFA 3V1QA 5AQHA 1P8ZA 2E20A 3EEQA 5KRTA 1ASVA 5HROA 1U49A 4IWVA 3WNGA 4LSNA 3IFRA 3P31A 4M3RA 4YFUA 1IV0A 3E01A 1SV5A 1KLMA 2A3ZA 1KFSA 2QXFA 1VQ9N 4CBUA 5AQGA 3VQPA 4CI6A 3ZCMA 4JKGA 5EXWA 5CR4A 4U7BA 3M3ZA 1VQPN 1DTTA 1EO1A 3F2KA 3BP8A 4NYFA 3T3FA 2NRZA 1VSHA 4FCYA 2NLXA 2B5JA 3CI5A 2PZSA 4DQRA 1N33K 3V9XA 1O1WA 2GWJA 2E2PA 3CJ1A 3I56N 3OJSA 4NO7A 1EKEA 3H3NO 4AF1A 3ULEB 1V4TA 3TTCA 4AQYK 5GINA 1SL0A 4DR5K 3NFAA 3GL1A 4K42A 4BECA 2A5XA 4CIEA 4W5OA 2PFUA 3O3FA 3BF3A 1W7AA 2HW3A 4DLGA 2IVPA 3M8RA 4DV3K 1Y64A 4YDUC 3LWMA 5ADXA 1BISA 3FZFA 1DGKN 2G8KA 2HBMA 5DM6L 1U45A 4B3RK 3P1GA 4DLEA 3ZLJA 1D5AA 2CH5A 4DV6K 5HRNA 2F8TA 4C8OA 3GE1A 4O5FA 4DUYK 1K9MO 2ZE2A 1QE1A 1JKHA 4KHPK 1NGHA 3QEWA 1XMQK 2ZGYA 3S3OA 4CEFA 3HTVA 3SPYA 4V19S 5AQOA 3TAPA 1ATNA 4IEIA 5JENA 3VERA 3NGIA 1VSFA 1KAZA 4YY3K 3QEIA 2IS3A 3VN5A 3CJ9A 1MWKA 4M42A 3K0SA 4W5TA 3O08A 2ETJA 4PQUA 4B1XB 2O8FB 2OTJN 5E84A 3CMAN 4DV7K 1ZBLA 2KLAA 4NLBA 5AQRA 3OYAA 3L2RA 2P9SB 3NAEA 1RDUA 4NXNK 2GEMA 5AQKA 4DU3A 4E0DA 4CFBA 1HNVA 4JI8K 4CJ3A 2RPIA 4CZLA 5B8HA 4QS7A 4C1NK 1JLQA 3D45A 3U4LA 5F1XA 1NOZA 4NB4A 2HHTA 4H5TA 2Q36A 4MFBA 1EETA 1GLDG 2XY7A 3VTHA 4M45A 3ID8A 4E1MA 1RDCA 3BUZB 4LD0A 4KI6A 1NKCA 2E1YA 4BC3A 4WQ5A 3ZSQA 1ITGA 3TAQA 4FOEA 4FYDA 2PBDA 2OPPA 4BRPA 3SI6A 4CD1A 3ZEUA 1GLLO 1RBVA 2NRXA 4IFVA 3A5LC 3EYZA 2VQFK 3UKUA 3ZETA 4JS5A 3RMBA 4JKGB 4M3TA 5BN9A 4RCHA 4ZTJA 3VQ6A 4BE1A 4J2DA 3DLKA 3HBTA 3CCEN 4WCEL 4DF8A 3QEVA 3IS9A 3NVKA 4H0TB 4DTUA 3V9UA 3L3UA 1REVA 4BRIA 3NDKA 2UXDK 1Z26A 3NF9A 3T19A 3C6AA 3UB5A 3VA0A 3BZCA 3I8BA 3V9SA 3C6TA 1N36K 4AHSA 1T3VA 3OYGA 3E66A 1YAGA 4JI2K 3VQCA 1TL1A 1BUPA 1XMOK 3O9RA 1Q8IA 2VCPA 3D2FA 4DWIA 1VQNN 1NNEA 3QMLA 3I0SA 3J8AA 3KWGA 4L8RB 3ZT1A 3VQ7A 1CZAN 3B6OA 5JVHL 5KPTA 3O1BA 3WNFA 1HYZA 4CZIA 4XH4A 5I42A 1S22A 2YI1A 3QFPA 5HP1A 4MDBA 1NK5A 4BG8A 1YIJN 1VAZA 4DTSA 3V9ZA 2P9PB 4JAXA 1RILA 3VQDA 4BRNA 2IOCA 4N56A 4IDKA 3OYHA 5BPMA 1X1PA 2GUIA 1Q9YA 4CIFA 1WAFA 1JXEA 5KGXA 1NJYA 2IVOA 4U67L 4KTWA 3DWLA 4J2BA 3WXIA 4B9VA 1EQYA 4FLZA 3THWA 1WAJA 3IMXA 4N5SA 1KAYA 1TAQA 2HHQA 3C7NA 4ISEA 4ZHRA 2YV0X 3AVKA 3T7ZA 5M1PA 4Z4HA 3ZSXA 3PIPL 4FJKA 4DUZK 3A5NC 3HK2A 3NBPA 1CXUA 3EZWA 1HUXA 3A5OC 3AGRA 3LAMA 1UWBA 4R79A 2YKMA 3P5JA 1NMDA 5M1KA 1FXXA 3VGKA 4O55A 4BY9C 3ITHA 4BROA 2ITGA 3QERA 3CQXA 2QWOA 1YJWN 3CJBA 1YITN 4Z4GA 2HF4A 2PAVA 3CM5A 2D0BA 2O8DA 3FR0A 4JKHA 4EP4A 4CEQA 3RTVA 5FPNA 4BRFA 2E2NA 1NJZA 1QS4A 3CCQN 1LAWA 4DTMA 3R1XA 2BDPA 5KPRA 1J6ZA 2UUAK 1NGCA 2FXUA 3A5MC 2KFNA 3PLAA 4BR0A 1VRUA 3CXCM 3UKUB 4X64K 1NK9A 3ZETB 2QXLA 1JLGA 2WOMA 1VQLN 4RW4A 2W42A 1VSJA 3AVBA 2QK9A 1BIUA 4BQZA 4JI5K 2O8CA 4B3MK 4MLHA 4FLYA 2XY8A 4ID1A 1YTUA 2NZTA 3CPWM 4YOTA 3SMPA 4DV1K 1ZXOA 1JLBA 4FJJA 3NF7A 4BC5A 4FJHA 1SQKA 5EOYA 1BGXT 4BREA 2RE2A 1KQSM 3R3LA 3WEEA 1Q18A 5AQPA 1VQ7N 1ZBFA 1V4SA 3HO1A 4K43A 3WT0A 2HSTA 1N5YA 1DKGD 4BACA 4NCGA 2NRHA 5CZ1A 3SQ2A 1S1XA 1GOAA 3OYMA 5AFUH 3CCRN 2Z1IA 2DFFA 3K5LA 4JK9A 3P38A 3O5BA 2BTFA 1QTMA 3D2FB 3JXUA 4BR7A 3IKMA 2HNZA 3ASMA 4M3XA 1TV6A 1BIZA 5C2FA 4BRLA 3C95A 2IIRA 1EX4A 3V6DA 3QESA 3GBTA 4IJNA 2HHIA 3H1VX 3CJAA 3S9HA 4JKDA 1ZC6A 3SQ1A 3NVMA 3D0PA 3IRXA 5AQNA 4IEEA 3ZT2A 3EKSA 3E9LA 4CEZA 2ZJQL 2QKKA 4DR7K 1YJNN 1KTQA 3ZT4A 4PY5A 3OVNA 3AA4A 2DFEA 4E19A 1D4XA 3BEXA 4DV2K 2FLOA 1C0MA 4PWDA 4XEIA 1LV5A 4FLUA 4ZTFA 1M90O 3M6GA 4A62A 2KKZA 1GLEG 2YHYA 2YCHA 3THWB 2QWMA 3CG7A 3FZLA 4O8KA 3HOSA 4FJ8A 5AQSA 4CK1A 2X6NA 2QWRA 3VEWA 2BE2A 2QWPA 4CHYA 3RSEB 3C7NB 4HWIA 3H45C 3SBTA 4C8MA 4B1VA 2YKNA 1HKBA 5J1EA 3LP3A 1L5UA 4KPYA 3I0RA 4DTOA 1Y97A 5HRPA 4LF9K 2AP1A 3C94A 4PL7A 1D9DA 4GW6A 3K9KA 1YVUA 2EHGA 1NGIA 5FPEA 4KTQA 4CJUA 5CHIA 2FSKA 4B9SA 4DU1A 3AA5X 4C8NA 3ULEA 3AGKA 3CERA 5HLFA 2WONA 1NKBA 1BG3A 4CW7B 1LW0A 3F9KA 3RRHA 4DFJA 1KVBA 4O4GA 3QLHA 5M1OA 3I8DA 4LFBK 2A1RA 2OZMA 1C6VA 1WB9A 2QWNA 3F73A 4GV3A 4AHTA 3TAGA 4HCBA 5JLHA 2HHXA 3OYKA 3CCVN 3OYDA 1OH8A 2OYQA 1K8AO 5EVZA 4FJXA 4BE0A 4M41A 1M1KO 4FM1A 5MLCQ 3J7AP 4BR2A 1C1BA 1GLBG 3HP9A 4BRHA 2VWKA 2O8CB 3QO9A 1XUPO 3G4SN 3G10A 3MCAB 4QOZB 2P9UA 2VG5A 4J8FA 4F9OA 3PX4A 2XY5A 3TAEA 4LH5A 4BWJA 2D0OA 1T7PA 1N6QA 3DXKA 1JCEA 5AQJA 1HX1A 4B9QA 4C8LA 1JXBA 3WEEB 3O4QA 4BE2A 3MAQA 1YI2N 4DFKA 3E1YA 4RW8A 3JAMO 3CC2N 2ITMA 1U2VA 2HF3A 4Y1CA 1J9AA 1ZYQA 3J7YP 4ELUA 2O8FA 3AO1A 4EHUA 5SWMA 3DMJA 5AQUA 1O13A 1TAUA 1DEJA 1FK9A 1KSPA 3QEXA 2P9LA 1VQ5N 2FF6A 1WN7A 3CQ8A 4PHTX 2WFBA 2WTUA 2OANA 4FJMA 4H03B 1VSEA 4DTJA 1RBRA 4CECA 3UE5A 1OH6A 2VQEK 2G8VA 4LH4A 4H0OA 4E7KA 3WQUA 3OYCA 2F4VK 2GELA 4FJLA 3NF8A 3DLLL 1YF5L 3OTOK 4HTUA 1NJWA 3QIOA 2ZJRL 4ICLA 2XRIA 4NYNA 5CE3A 4NCAA 1IG8A 3DLHA 4YOWA 2D0CA 3L0QA 3WUHA 3T1AA 4KHQA 4FM2A 4JI3K 2JGUA 4B8CA 1QQNA 2B6AA 1RBSA 3DOLA 1CLQA 4H5RA 3RWUA 1E4GT 3G0ZA 4E1JA 2BUPA 4CF0A 5AQZA 3PSIA 3UKRB 4JYAK 5HRRA 3ZT3A 4YHHK 2QWLA 2VGMA 1VQMN 5F2RA 2UXBK 4H0VB 4CJWA 1BO5O 4LF7K 5BRDA 4FJ5A 4AM6A 2ZF5O 3AAPA 2W6LA 3F5TA 3KWIA 4CCHA 2Z1HA 1YT3A 3MN5A 2QI2A 3OHRA 4KV8A 4CERA 4WQ4C 1RBTA 4DS5A 2P9IA 4BVOA 5AZJA 5BRFA 3TAMA 1SS6A 1HR0K 3AA3A 2ZD1A 2Q0UA 3LP0A 3U3GA 4EP5A 4JI7K 3O80A 1N32K 1W2BM 1SL1A 3QEPA 2O8EA 5K14A 5EU7A 4YNQA 3LP1A 3HSTB 3ZSWA 3S3MA 4RW7A 1IO2A 4LSLA 3LDPA 2BANA 3RR7A 1GLJO 1WSGA 1ZBIA 2DFHA 5FPMA 1RTHA 3AAQA 4CZHA 2YHWA 4M7XA 1OH5A 4ID5A 5I9EB 3HP6A 4CF2A 3OYNA 5LY3A 1S1TA 3AVNA 3DRPA 4YORA 3LDSA 4E7JA 4B9UA 1NK4A 3CFPA 5C10A 3V4IA 3P83D 1NK7A 1TGOA 1YJ9N 3CFOA 2P9UB 4JKAA 1VQON 2P9PA 3V1OA 4E7LA 3AVLA 4CHOA 5H1SQ 1IKYA 1X9MA 2Q0RA 3KLGA 4DTRA 3DXKB 1NGBA 4OPAA 3KJVA 4PKHA 1HNZK 2KZZA 1U48A 1NGGA 1S1WA 4CJPA 4I9LA 3KK3A 5AQVA 2A42A 1U4BA 4JI4K 4Z4CA 3ZX3A 3CCUN 1U2VB 3MN7A 5CYQA 2YHAA 1I94K 1HRHA 1W0HA 3K59A 3MWPA 3VQBA 1KVCA 4CK2A 3MEDA 5JICA 1BQMA 2WC9A 4DSKA 1GOBA 5LL6Z 4DTPA 4FM0A 2P9LB 4H5WA 5F0XA 1Q86O 5JVGL 4JKEA 2NRWA 4LF8K 3C6HA 3BZKA 3KZBA 2OPQA 1SUQA 5AQTA 4JNEA 5FDLA 3O3GA 2VYPA 4FWRA 4CESA 2HHHK 2W40A 2Y1IA 1C0TA 3W0LA 1B92A 3SUQA 1SKWA 2A41A 4JK7A 5GIOA 4K0KK 3SNNA 1BWFO 3VPZA 4DR2K 4FZXC 3ENOA 1A5VA 4F3OA 1VSKA 4FK4A 4C1NI 4DSFA 2CH6A 1JJ2M 1TKZA 5ADXH 3OA9A 4N47A 1JL1A 2X74A 3L4QA 4LF4K 2BH1A 2A6AA 4BR9A 1VSDA 1WLJA 2OTLN 1S1UA 3S41A 4OVLA 4CGFA 1YVNA 1WBBA 4ISFA 3ZSZA 1TK8A 3MECA 4CFCA 4O0JA 2Z1GA 3SJJA 4QS8A 4A5AA 3NF6A 5A2QO 3P4IA 5CY4A 5KPZA 3R6MA 4DS4A 2G8UA 3FLCO 2GBZA 1NM1A 4CJKA 2P9IB 2P5GA 5AZJB 5JS2A 4YDUA 4QCLA 3JS6A 4GVMA 4IKFA 1MU2A 1KAXA 1UAXA 2O8EB 5AZIB 5DK5A 4IBNA 5AQLA 4B1WB 4AHVA 5GIPA 1MA9B 4J2EA 3KLFA 2E8AA 3HZ6A 4FW2A 4CHPA 3HVRA 4A61A 1BCOA 1CZBA 3VEOA 4A5BA 2QWQA 3QFUA 5EX5A 4KH4A 3H08A 3TSUA 3HSCA 1YTAA 3AO3A 2RKIA 1OVYA 3V81A 2NNWA 4AHUA 4ILHA 5AJ3K 3H6EA 4DV5K 1WNSA 2HB5A 1B9FA 4I2QA 2FC0A 1XHZA 4BDZA 3W3DA 4Z4EA 3VF2A 1CZ9A 2V51B 2I5JA 3NH2A 3TI0A 4PL8A 1ZBHA 3VF6A 5SZTA 2UXCK 3OS0A 4DCHA 2HOEA 2IC3A 4CJ5A 3NCIA 2OPRA 2ZGZA 1XI1A 2XO7A 3MXMA 2E6MA 3CCLN 1LWEA 3L2VA 1QHTA 1ATRA 3THXA 4JK8A 4ELVA 4K25A 3RSEA 3TANA 1JLAA 3AARA 5LMNK 4IXCA 3GDQA 3CCSN 1UA0A 1X3MA 1BA1A 3DXMB 5BPLA 1LCUA 4JI1K 4IO8A 4CEAA 1W9HA 4CF1A 1Z25A 4CHNA 2UUBK 3AVHA 1SL2A 4IOXA 4FLTA 4E1NA 4DFPA 3D2EA 3AVFA 1RT5A 2FBVA 5AQMA 2CGJA 2FSJA 1D8YA 2NRRA 3DLEA 1QQMA 3KIOA 4BDPA 1DLOA 1RBUA 4JS4A 4FJGA 1E3MA 4F2SA 3CJCA 4FLXA 4I6MA 2FBTA 1VQ6N 1VQKN 3C0BA 2VG7A 2R7YA 5BPNA 1LWFA 5GADP 4E72A 4IOCL 1J5OA 1BL3A 1ESVA 1S9EA 3AVGA 1JCFA 3SLCA 1T6CA 3JSMA 1OKJA 3DJCA 4AILC 4TSXA 4CEEA 4H4MA 3E9OA 4IJAA 4M3UA 1TKXA 3AY9A 3MWTA 5FROA 1Q81O 5HRSA 3NMUA 1RCHA 3NE6A 4OGEA 3ZSYA 3HM9A 2ASPA 3QDKA 2E5LK 1NGFA 3PO5A 3VOVA 4DSEA 5LJVA 3J7ZO 4BG9A 1RTJA 4JHDA 3WNEA 2D5RA 2HNDA 1HYSA 1GLCG 4QAGA 4FZZA 1HPMA 3WXLA 3MCPA 1IH7A 4A57A 3LP2A 4RWTA 2NRTA 1Z6RA 4LFAK 3KKRA 4CEOA 3HVTA 3FE1A 4B1UB 1S6QA 4JRQA 1QSYA 1C0FA 1KXPA 4CEDA 4FWLA 3RMDA 4DHYA 2E2OA 3KK7A 4Z94A 4AHCA 1VSMA 3UIQA 3Q7BA 1XWLA 1S9GA 5IT9O 1HQUA 1VK0A 3EY1A 4GKJK 1U6ZA 2O4IA 3MX2A 4E7IA 2FBYA 1XNQK 4JRPA 1RDBA 4BRAA 1TKDA 4O0IA 1TL3A 2QW9A 3AVAA 4B9LA 3D7EO 4HUFA 3SBGA 4B08A 2AJQA 4Z4FA 3EL2A 2HHWA 1BHLA 3FZHA 4IFEA 4MQ3A 3G71N 1NMNA 4G1QA 3SAHA 1S5JA 3O1WA 3VGMA 3RMCA 4BR5A 3QINA 3HXMA 3THXB 3KLHA 4KBOA 2HHVA 4Q5VA 1Q7YO 4AM7A 3K5NA 4YOVA 3VESA 4WFBL 3UKRA 4BWMA 1P90A 4KTZA 3DOKA 1C1CA 5GAEP 2D1KA 1X9JA 4BRGA 4X65K 3ZYYX 2YNHA 2DPNA 4IFYA 4IG0A 1LW2A 3CCMN 3H1QA 5M1FA 2P9KA 3LM2A 1L3VA 4RG8A 3N4QA 1HKGA 4DV0K 2Q97A 3HOTA 3NGYA 1ATSA 3G6EN 4DQQA 3M1FA 3O4WA 4R5PA 1UOCA 3THVA 2ZWHA 3RR8A 4BVPA 4BRCA 1XNRK 3D2EB 3PIOL 3EKUA 1RTDA 4DR6K 5DM7L 3AO2A 4JEPA 3L6QA 1X9WA 1T03A 3B8AX 3PO4A 4KREA 4NLCA 3DLBA 4A59A 3TTFA 2Z1JA 3WQTA 3T1YK 2YNGA 4CE9A 4WE1A 4CZEA 4CZGA 1JLFA 3OYFA 1Q9XA 1YXQA 4I6MB 1X9SA 3DAWA 3QIPA 1I39A 3SPZA 4E89A 2AA4A 3CHWA 2GTDA 4CHZA 2I7PA 4B9TA 5E26A 4ILJA 4Z0UA 3OBYA 3MEGA 5BN8A 1DTQA 4HUEA 1T05A 1G15A 3AVIA 3VQAA 4WF9L 3M5RA 3V1RA 1U04A 3D6RA 3OS2A 4FK0A 3B6PA 1B9DA 1HJOA 1TUUA 1IBKK 1NU0A 5EY4A 3LWLA 1RT4A 4X62K 4KB1A 1XHXA 2A40A 4JHDB 1NWKA 2ASMA 4EIAA 2VG6A 4ISGA 1BQNA 2RHKA 2HBJA 4JD2A 1WOQA 1NGJA 3TSQA 4LF6K 1NJXA 4G9ZA 5JLFA 4CJLA 3LALA 4CJ4A 4KKOA 3HYFA 2ZQBA 2F7TA 5AQXA 3FFIA 1KLNA 1HNIA 4RW9A 4H5NA 3LAKA 4CJSA 2B4JA 3HPHA 4CJVA 3HRGA 4CF9A 3PUFA 3O9QA 1TKTA 4OKEA 1QQCA 2QA4N 5AQFA 3SQ4A 4BC4A 4CFAA 4FWMA 2CGKA 4YOUA 4L3QA 2D0PA 3O9SA 2A1SA 3VQ5A 4FXDA 1J54A 2JLEA 1H1VA 3LZIA 4I2PA 1ASWA 4DQ8A 3SUPA 4CJ7A 1BCMA 1F21A 3N4PA 2JWKA 3C6UA 4M63C 3MMVA 1WBDA 4XJXA 3L2WA 1JLCA 1OVQA 4YOXA 4O5BA 3O3HA 4PUOA 1QQOA 3A0IX 1BDGA 3SUOA 3CIPA 1NK6A 3WXMB 2W00A 1W97L 1K73O 4KFBA 4OX9K 2PY5A 3CYGA 3O4NA 4CF8A 2RF2A 3K2PA 2P9KB 3LDLA 3KLEA 2OPSA 5J2PA 1YHQN 3ID6A 3VEXA 2IGIA 4IG3A 4FOIA 3LDQA 4I7FA 3ZSVA 2HBKA 4CZJA 4GVEA 5JS1A 2YNIA 4O44A 3F9MA 4FLVA 4WQ5C 2EX3A 5AQYA 3WXJA 2RN2A 4DMNA 4DV4K 4CZKA 4KH6A 2EWSA 5AZIA 2XY6A 4GMJB 4BQLA 2KQ2A 4KHUA 2P51A 4EFHA 5KTQA 4OKKA 3VEZA 5C25A 4JI6K 4F2RA 3VENA 2YNFA 4W5NA 3MEEA 4FWQA 2F8SA 1S6PA 3U9ZA 3WNHA 4CZFA 2GWKA 3QNNA 1NOYA 5BR8K 2C1IA 3SYZA 4UQGA 1HNWK 2GV9A 4OJRA 3M8SA 2NRVA 2C1GA 3LDNA 4BDYA 2HNYA 2P9NB 2LSNA 5BREA 4OGCA 4XH1A 1C0UA 2FBXA 2HHSA 3KK1A 3NH1A 4FJ9A 3LZJA 3MXJA 2HVIA 3VEVA 2IVNA 3SUNA 3THYA 3TR8A 4PA1A 4B1ZA 3S3NA 1T8EA 2UYTA 3OBWA 4BR4A 3KD5E 4OPJA 2VWJA 2G8HA 3ZT0A 2QKBA 5DMRA 4JD2B 1NKEA 1NBWA 1RT3A 4HVJA 1T44A 4IO9L 3VQ9A 4EZ9A 4FVUA 1FW6A 2O8BB 1XC9A 4FJIA 5GAGP 3ULDA 3PY8A 5KQ8A 1EWQA 3O9TA 3HT3A 1VQ4N 3DXMA 2ATQA 4KI4A 2W6KA 4DR1K 3TSPA 4BC2A 2G8WA 2DTUA 5J2MA 2HBLA 5AQWA 1BU6O 2YJFA 4DQIA 4M3YA 4KAZA 2VGNA 4FSVA 4Z4IA 1KVAA 5TKWA 4DQPA 4J2AA 3SAFA 2ZM6K 4OO1J 4Y0WA 5C0YA 1Q82O 3GG4A 4KB0A 1RT7A 1RT2A 4FZYA 5LMUK 1KD1O 3TWHA 4FWPA 2D0AA 3RMAA 1SAZA 2Y1JA 1C1AA 1QHAA 1RDWX 3PX6A 4LFCK 1D9FA 4WQ4A 3CETA 4DB3A 3DLRA 4CJQA 4GV9A 1YUWA 4DKWA 4OKJA 4CIGA 3OYEA 3BDPA 1KCFA 1S1VA 4N76A 4CJEA 4BRKA 3JYTA 3VQEA 4NXMK 1IBMK 4E7HA 1BI4A 3NHGA 1HKCA 3EN9A 4WFAL 3SAGA 3TARA 1BA0A 3C65A 1VRTA 4BE7B 3U6FA 1CXQA 3ZSOA 2KZMA 4ELTA 4FW1A 2I7NA 3NH0A 4CVNE 1NGEA 5C12A 4BRMA 4K8ZA 3H46O 3K5MA 4A2AA 2G8FA 4BEBA 3KK2A 4KHWA 3OW2M 3AVMA 1L3UA 2Q3SA 1TUYA 4X66K 1GOCA 3EZ5A 1RNHA 4AH9A 3AVJA 3VGLA 4CGGA 2DY4A 5TKYA 1UA1A 3TABA 2IAJA 5LJWA 5I3UA 4OPKA 4WYBA 4HTLA 4FO0A 1LAVA 4EHTA 2HVHA 3QB0A 5KRSA 4ILGB 3ALYA 3PSFA 4CJTA 3SV3A 4GKKK 3SQ0A 4K8XA 4MO5A 3RRGA 3LANA 4MLEA 1ZBSA 2FSNA 2OCEA 3MX5A 5C42A 2X6SA 3QBWA 3HI0A 4IZ9A 1E4FT 2XHBA 1NG9A 1K6YA 1NK8A 1EXQA 1MWMA 1A5WA 3MN9A 4XIUA 2E4LA 2E88A 2V7YA 4JN4A 5FRMA 3QETA 3VA3A 3G25A 4DSJA 1K8KA 2KFZA 3CC4N 3EE8A 2Q1NA 2E2QA 5HOOA 4H0PA 2V7ZA 3THYB 2ZJPL 5AQIA 4A2BA 1XC3A 3ZX0A 3RVCA 3MN6A 4FWOA 2HMIA 2PYLA 2HMPA 1KFDA 4CFDA 3E9PA 1NLVA 1N8RO 4FPAA 2YX6A 2WUSA 4HHTA 3TTDA 4LC9B 4BGAA 2F96A 1GLAG 4JLHA 2G8IA 1HNXK 4CD3A 4H5VA 3NGZA 3EO3A 5KGWA 5J2QA 3BGRA 3KD1E 2YJEA 1VQ8N 5AFUA 1ZBUA 2FF3B 1JLEA 4I9QA 4H0XB 3PX0A 1XQSC 2KHOA 4FLWA 3ZX2A 4BGBA 3MDQA 2O4GA 4KHSA 2J4RA 4C8KA 1TVRA 3KTQA 2QTDA 4M3WA 4PKGA 3H3OB 3U8XA 4C23A 1EP4A 1JCGA 3CQYA 2BGGA 5D3GA 1WSHA 3T69A 3HJFA 1QSSA 1NGDA 3WXKA 4QS9A 5C15A 2QEXN 4FJ7A 4CJFA 3SJHA 3OYJA 4F8RA 3IG1A 1KC8O 3K5OA 3IAYA 4JV5K 3BF1A 1ILYA 1TYQA 1TK0A 1BI4B 5HL7L 3L2UA 4WFNL 5AR0A 5KQDA 3DM2A 1R59O 3ZEUB 4M3ZA 4CGJA 3IDHA 3P39A 3VEYA 5BRHA 3CD6N 2ASOA 2V52B 4CBXA 2H3GX 1QZ5A 4DU4A 1VSLA 3K9JA 1HQEA 3K58A 3FZKA 3CCJN 5CZ2A 5ELZA 4B3TK 4B1YB 1IKVA 4CZMA 1WSIA 1MDUB 2WBNA 3ISNC 3I55N 4DR3K 1QVGM 4DTXA 3SK3A 1HPZA 1LWCA 2Q31A 3QICA 5HBMA 3CJ7A 2E6LA 3OJUA 4B9MA 4DQSA 2Q2RA 3OY9A 4DTNA 4H0YB 3DRSA 1LOTB 4CBWA 4AHRA 2YHBA 4FWSA 3TU5A 1N34K 3CF5L 3LM9A 1HLUA 4CGIA 1TK5A 1RT1A 4EAHD 4O8UA 4B8AB 2X78A 4KRFA 2NUBA 3A8YA 4B9NA 3FFKB 1WSJA 3M8PA 4OLBA 2HHUA 1S72N 1IJJA 1QVFM 1R0AA 3O8MA 3V9WA 3PV8A 4CGHA 3HL8A 3I33A 4OLAA 2VWBA 3OYBA 3AV9A 1K8KB 2QM1A 4FK2A 3DRRA 3R9PA 4UY8O 3AO4A 4JKBA 3TAFA 4FWKA 5C2DA 3QBXA 5BR9A 4CHQA 2JWLA 3GOIA 1FKPA 3ATUA 3VMFB 1S3XA 3ENHA 3FZMA 5GAHP 3CYMA 1DT9A 1A5XA 1U47A 4FVMA 1RDDA 3SZ2A 4JKCA 5C24A 2CGLA 3VF4A 3QNOA 3DLGA 2PYJA 2GUPA 4Y1DA 3AVCA 3R8EA 3OYLA 3O9UA 1SKRA 4MDAA 4OPHA 4HCCA 3SV4A 1NJIO 4DSIA 4RTFD 3DI6A 3J81O 4GV6A 1L3SA 2F9WA 3KKSA 3KLIA 2IDOA 3MXIA 2OZSA 2KW4A 3EE9A 1T6DA 5AQQA 3OS1A 4LF5K 2W41A 4Q0BA 2D4WA 4BRQA 3AA2A 4CEBA 4H8KA 4KO0A 1G99A 3K57A 5E41A 4KH5A 4W5QA 3ZSRA 1IKWA 4DG1A 1VHXA 4GNIA 1QZ6A 3CFRA 4GY2B 4LY7A 1RT6A 5M1QA 1FKOA 5CYMA 4HUGA 4N41A 5JMVA 2O8DB 3CPEA 1WUAA 3ATVA 3HPOA 5FLXO 3LPUA 4DSLA 1C0GA 4IOAL 5FRNA 1IG9A 1SKSA 3J80O 1WSEA 3O6WA 1ASUA 3OYIA 2P9NA 3U3YA 3AO5A 3FGUA 1TYQB 1X3NA 3A2FA 4CK3A 1FJGK 4DFMA 3LDOA 4JKFA 1OH7A 1I3AA 3VQ4A 1NK0A 1HJRA 5FPDA 2KTQA 1RFQA 4KHYA 1IKXA 5T7BA 2OA8A 4B3OA 3Q7CA 3VQQA 3T1HK 4YOYA 4E3SA 5J2NA 1Z05A 3VTIA 3BY5A 4DR4K 3L4IA 3LL3A 1RTIA 1BOTO 2O8BA 4B3SK 4W5RA 4IDHA 1HMVA 3HPGA 3M8QA 2UUCK 4M7YA 3CMEN 1KRPA 3DYAA 3VETA 1IBLK 2F9TA 4KHNA 4BRDA 4MO4A 2E1ZA 3LPTA 1QSLA 2P5OA 3KVGA 4K41A 1RGIA 4RW6A 4NCBA 3VQ8A 3TPQA 4PKIA 4JI0K 1RDAA 1J5EK 2P9SA 4H4OA 1VSIA 4EZ6A 3IUCA 4FPBA 4FJNA 4F4KA 4FL9A 3L3VA
chains in the Genus database with same CATH topology
1ATRA 2HBLA 5AQWA 1BU6O 2YJFA 4JK8A 1YJNN 2YHXA 3CC7N 1NGAA 4K25A 1SZ2A 2VGNA 3RSEA 4FSVA 1GLFO 1D4XA 3BEXA 2FLOA 3AARA 5TKWA 3SMSA 4IXCA 4FWNA 3GDQA 4XEIA 5M1NA 3CCSN 3MK6A 3SAFA 1M90O 1X3MA 1BA1A 3DXMB 3M6GA 5BPLA 1LCUA 2GX9A 3ENBA 4XH5A 4A62A 2KKZA 1GLEG 2YHYA 3KHYA 4OO1J 2YCHA 4IO8A 4Y0WA 2QWMA 3U9DA 3FZLA 4O8KA 3HOSA 5C0YA 3HM8A 5AQSA 1Q82O 5AQHA 2QWRA 1P8ZA 3VEWA 3GG4A 2E20A 2QWPA 3RSEB 4IOXA 3C7NB 4HWIA 3H45C 4IWVA 3D2EA 3IFRA 3P31A 1KD1O 4FWPA 3SBTA 5AQMA 2CGJA 2FSJA 4B1VA 1HKBA 1SAZA 2A3ZA 2NRRA 1QHAA 1RDWX 4WQ4A 4CBUA 5AQGA 4CI6A 1VQ9N 3CETA 1QQMA 4DB3A 4JKGA 2AP1A 4GV9A 1YUWA 4DKWA 5EXWA 4PL7A 5CR4A 4U7BA 3K9KA 3M3ZA 1NGIA 5FPEA 5CHIA 4BRKA 2FSKA 1VQPN 3CJCA 3F2KA 1EO1A 3BP8A 3ULEA 3AGKA 1HKCA 3EN9A 4WFAL 4I6MA 3CERA 3SAGA 1BA0A 3C65A 1VQ6N 2NRZA 1VQKN 4BE7B 1BG3A 2NLXA 3C0BA 5BPNA 3CI5A 5M1OA 5GADP 4IOCL 1ESVA 2I7NA 1JCFA 3SLCA 1T6CA 2QWNA 1NGEA 4GV3A 5C12A 2GWJA 4BRMA 2E2PA 3CJ1A 1OKJA 3DJCA 3H46O 4A2AA 3I56N 4BEBA 4NO7A 5JLHA 3H3NO 4AF1A 3ULEB 1V4TA 3CCVN 3E9OA 3TTCA 4IJAA 3OW2M 5GINA 1K8AO 5EVZA 3AY9A 3MWTA 1Q81O 1TUYA 3NMUA 3GL1A 1M1KO 4K42A 5MLCQ 2ASPA 4BECA 3QDKA 1NGFA 2A5XA 3VGLA 3VOVA 2PFUA 5LJVA 4BR2A 3BF3A 4BG9A 3J7ZO 2IVPA 1GLBG 4JHDA 4BRHA 1Y64A 4YDUC 5TKYA 1GLCG 5ADXA 1HPMA 3WXLA 5LJWA 3MCPA 4WYBA 4HTLA 1XUPO 4FO0A 3G4SN 3FZFA 3MCAB 2P9UA 4A57A 1DGKN 4EHTA 3QB0A 4J8FA 2HBMA 4RWTA 5DM6L 4ILGB 2NRTA 4F9OA 1Z6RA 2CH5A 2D0OA 4MO5A 3DXKA 1JCEA 3FE1A 5AQJA 4B1UB 1HX1A 4B9QA 4MLEA 1ZBSA 2FSNA 3GE1A 3MX5A 3WEEB 1YI2N 3E1YA 3QBWA 4O5FA 3HI0A 4IZ9A 1E4FT 1C0FA 1K9MO 1NGHA 3CC2N 2ITMA 1U2VA 2HF3A 1MWMA 2ZGYA 3MN9A 2E88A 2V7YA 3HTVA 1KXPA 4JN4A 4EHUA 4FWLA 5AQOA 5AQUA 1O13A 2E2OA 3KK7A 3G25A 4DHYA 4Z94A 1K8KA 1ATNA 4IEIA 3Q7BA 3CC4N 1DEJA 3EE8A 2Q1NA 2E2QA 3VERA 5HOOA 4H0PA 1U6ZA 2V7ZA 1KAZA 3MX2A 2P9LA 1VQ5N 2ZJPL 2FF6A 3CJ9A 5AQIA 1XC3A 4A2BA 1MWKA 4BRAA 3ZX0A 4PHTX 2QW9A 2WFBA 3O08A 3RVCA 3MN6A 4FWOA 3D7EO 2OANA 2HMPA 3SBGA 4H03B 4B1XB 3EL2A 2OTJN 5E84A 3UE5A 3CMAN 3FZHA 2KLAA 3E9PA 4H0OA 4NLBA 5AQRA 1NLVA 4IFEA 1N8RO 4FPAA 3WQUA 2P9SB 1RDUA 3G71N 2GEMA 5AQKA 2GELA 2YX6A 3SAHA 2WUSA 3O1WA 3DLLL 3TTDA 4LC9B 1YF5L 3VGMA 4BGAA 4BR5A 1GLAG 4CZLA 5B8HA 2ZJRL 4QS7A 4KBOA 4C1NK 4CD3A 4H5VA 5CE3A 1Q7YO 4AM7A 4YOVA 3VESA 3U4LA 5F1XA 3UKRA 4WFBL 1IG8A 1P90A 4NB4A 4YOWA 3L0QA 3EO3A 5GAEP 3WUHA 4H5TA 2D1KA 2Q36A 1X9JA 4BRGA 2YJEA 1VQ8N 5AFUA 3ZYYX 2DPNA 2FF3B 1GLDG 1QQNA 4H0XB 3CCMN 3H1QA 5M1FA 3VTHA 2P9KA 3LM2A 3ID8A 1XQSC 4H5RA 3BUZB 1E4GT 2KHOA 4E1JA 2BUPA 3ZX2A 3N4QA 1HKGA 5AQZA 2Q97A 3MDQA 4BGBA 3HOTA 2E1YA 2J4RA 3UKRB 1ATSA 3G6EN 4BC3A 4WQ5A 2QWLA 2VGMA 3M1FA 3O4WA 5F2RA 1VQMN 2ZWHA 2QTDA 4FOEA 4H0VB 1BO5O 4PKGA 4BRCA 4BVPA 3H3OB 5BRDA 3D2EB 4AM6A 3PIOL 3U8XA 4C23A 2PBDA 2ZF5O 3EKUA 1JCGA 3AAPA 3CQYA 3F5TA 3KWIA 4BRPA 5DM7L 4CD1A 4JEPA 3L6QA 3ZEUA 1GLLO 2NRXA 3A5LC 2QI2A 3MN5A 3OHRA 3T69A 3B8AX 1NGDA 3WXKA 5GIOA 3UKUA 4QS9A 4WQ4C 3ZETA 4JKGB 2P9IA 4NLCA 5C15A 2QEXN 4BVOA 5BN9A 3SJHA 5AZJA 4A59A 5BRFA 1KC8O 3TTFA 3WQTA 1SS6A 4CZEA 4CZGA 2Q0UA 4RCHA 3BF1A 1ILYA 1TYQA 1YXQA 3O80A 5HL7L 1W2BM 4I6MB 5AR0A 5KQDA 3DAWA 3HBTA 4WFNL 4WCEL 3CCEN 1R59O 3ZEUB 3NVKA 3IDHA 3P39A 4H0TB 2AA4A 3VEYA 3CHWA 5BRHA 3CD6N 3LDPA 4BRIA 2ASOA 2V52B 2GTDA 4CBXA 2H3GX 2I7PA 3C6AA 5E26A 1GLJO 1QZ5A 4ILJA 5FPMA 3AAQA 3OBYA 3UB5A 5BN8A 4CZHA 3K9JA 2YHWA 4M7XA 3I8BA 3FZKA 3CCJN 1T3VA 5I9EB 3E66A 1YAGA 5ELZA 4WF9L 4B1YB 3M5RA 3D6RA 4CZMA 5LY3A 1MDUB 4YORA 1BUPA 1HJOA 1TUUA 2WBNA 3I55N 1QVGM 3O9RA 2VCPA 5EY4A 3D2FA 3SK3A 2A40A 4JHDB 1NWKA 2ASMA 4EIAA 5C10A 1VQNN 4ISGA 2Q31A 3QICA 1YJ9N 3CJ7A 2RHKA 2HBJA 2Q2RA 4JD2A 1WOQA 2P9UB 3QMLA 4JKAA 4H0YB 3J8AA 3KWGA 1VQON 1LOTB 1NGJA 2P9PA 3TSQA 4CBWA 5H1SQ 4G9ZA 4FWSA 3TU5A 2Q0RA 1CZAN 1HLUA 3LM9A 3CF5L 5JLFA 5KPTA 3O1BA 3DXKB 5JVHL 1NGBA 4OPAA 4CZIA 4XH4A 4PKHA 4EAHD 4O8UA 5AQXA 2F7TA 1NGGA 3A8YA 1S22A 5AQVA 2YI1A 2A42A 3QFPA 3FFKB 3CCUN 3ZX3A 4MDBA 1U2VB 1IJJA 1S72N 4BG8A 1QVFM 3MN7A 1YIJN 3O8MA 4H5NA 1VAZA 3MWPA 2P9PB 3I33A 4JAXA 2VWBA 5JICA 1K8KB 2WC9A 3HRGA 4BRNA 2QM1A 3O9QA 4UY8O 3R9PA 4JKBA 4FWKA 5C2DA 2P9LB 2QA4N 5AQFA 4H5WA 3QBXA 5BR9A 5F0XA 1Q86O 4BC4A 5BPMA 5JVGL 4JKEA 2JWLA 3GOIA 3ATUA 3VMFB 1S3XA 2NRWA 3ENHA 3FZMA 2IVOA 5GAHP 3C6HA 4FWMA 3DWLA 2CGKA 4U67L 4YOUA 3WXIA 1EQYA 2D0PA 4L3QA 3O9SA 1DT9A 3KZBA 3IMXA 1H1VA 4JKCA 1KAYA 2CGLA 5AQTA 4JNEA 3C7NA 4ISEA 3VF4A 2VYPA 4FWRA 4DQ8A 3T7ZA 5M1PA 4CJ7A 2GUPA 3R8EA 3PIPL 3N4PA 3A5NC 2W40A 2JWKA 4M63C 4XJXA 3MMVA 3O9UA 3W0LA 4YOXA 4MDAA 3EZWA 1HUXA 1QQOA 2A41A 3A0IX 3A5OC 3AGRA 4JK7A 1BWFO 4OPHA 3VPZA 4R79A 1BDGA 1NJIO 1NMDA 3ENOA 3VGKA 5M1KA 4BY9C 4RTFD 4C1NI 3CIPA 4GV6A 4BROA 2CH6A 3WXMB 2W00A 1W97L 2F9WA 1JJ2M 1K73O 5ADXH 3EE9A 3CQXA 2QWOA 1T6DA 3OA9A 5AQQA 1YJWN 3L4QA 3CJBA 1YITN 2HF4A 2PAVA 2W41A 2BH1A 2P9KB 2A6AA 3LDLA 4BR9A 1YHQN 2D4WA 3ID6A 4BRQA 3VEXA 3FR0A 4JKHA 2OTLN 3S41A 1G99A 5FPNA 4FOIA 4BRFA 3LDQA 2E2NA 1YVNA 4ISFA 4KH5A 2HBKA 4CZJA 4GVEA 3CCQN 3F9MA 4WQ5C 3R1XA 5AQYA 3WXJA 4GNIA 1QZ6A 5KPRA 4QS8A 1J6ZA 4GY2B 4CZKA 4KH6A 4A5AA 2EWSA 5M1QA 3P4IA 5AZIA 1NGCA 2FXUA 3A5MC 5JMVA 5KPZA 3PLAA 4BQLA 4BR0A 3CPEA 1WUAA 3ATVA 3R6MA 4EFHA 3CXCM 4BC2A 3FLCO 3UKUB 1NM1A 1C0GA 3ZETB 2P9IB 2QXLA 3VEZA 4IOAL 5AZJB 1VQLN 4YDUA 3O6WA 3VENA 4BQZA 2P9NA 4MLHA 4FWQA 3FGUA 3JS6A 1TYQB 2NZTA 1X3NA 3CPWM 1KAXA 4CZFA 3LDOA 4JKFA 4YOTA 1ZXOA 5AZIB 3SMPA 3U9ZA 5FPDA 5AQLA 2GWKA 4BC5A 1RFQA 4B1WB 1SQKA 5EOYA 2C1IA 4BREA 5GIPA 1MA9B 2RE2A 1KQSM 3Q7CA 2E8AA 3HZ6A 3R3LA 3WEEA 4YOYA 1Q18A 5AQPA 2NRVA 4A61A 3LDNA 1VQ7N 2C1GA 1Z05A 3VEOA 1V4SA 3VTIA 4A5BA 2QWQA 4K43A 3WT0A 2P9NB 5BREA 2HSTA 3QFUA 4XH1A 5EX5A 3L4IA 4KH4A 1DKGD 3LL3A 3HSCA 3TSUA 2NRHA 1OVYA 1BOTO 2NNWA 4ILHA 5AFUH 4IDHA 3H6EA 3CCRN 3VEVA 2IVNA 4JK9A 3P38A 3O5BA 2BTFA 4M7YA 3D2FB 3JXUA 3CMEN 4B1ZA 3VETA 2F9TA 3W3DA 4BR7A 3IKMA 4BRDA 2UYTA 3OBWA 4MO4A 3VF2A 4BR4A 2E1ZA 3KVGA 2V51B 5C2FA 4K41A 4BRLA 4JD2B 1RGIA 2IIRA 1NBWA 1T44A 4IO9L 4PL8A 3VF6A 3TPQA 4PKIA 4FVUA 3GBTA 4DCHA 4IJNA 2HOEA 5GAGP 2P9SA 3H1VX 3CJAA 5KQ8A 2ZGZA 3O9TA 4JKDA 3CCLN 1ZC6A 3IUCA 3NVMA 1VQ4N 3DXMA 4FPBA 5AQNA 4IEEA 3EKSA 3TSPA 4FL9A 3E9LA 2ZJQL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ATR A;  5AQW A;  1BU6 O;  2YJF A;  2YHX A;  1NGA A;  4K25 A;  1SZ2 A;  3RSE A;  4FSV A;  1GLF O;  1D4X A;  3BEX A;  2FLO A;  3AAR A;  3SMS A;  4IXC A;  4FWN A;  3GDQ A;  4XEI A;  3MK6 A;  1X3M A;  1BA1 A;  3DXM B;  3M6G A;  5BPL A;  1LCU A;  4XH5 A;  4A62 A;  1GLE G;  2YHY A;  3KHY A;  2YCH A;  4IO8 A;  4Y0W A;  2QWM A;  3U9D A;  3FZL A;  4O8K A;  3HM8 A;  5AQS A;  5AQH A;  2QWR A;  1P8Z A;  3VEW A;  3GG4 A;  2E20 A;  2QWP A;  3RSE B;  3C7N B;  4HWI A;  3H45 C;  4IWV A;  3D2E A;  3IFR A;  4FWP A;  5AQM A;  2CGJ A;  2FSJ A;  4B1V A;  1HKB A;  1SAZ A;  2A3Z A;  1QHA A;  1RDW X;  4WQ4 A;  4CBU A;  5AQG A;  4CI6 A;  3CET A;  1QQM A;  4DB3 A;  2AP1 A;  1YUW A;  5EXW A;  4PL7 A;  3M3Z A;  1NGI A;  5FPE A;  4BRK A;  2FSK A;  3CJC A;  3BP8 A;  3ULE A;  1HKC A;  3EN9 A;  4I6M A;  3CER A;  1BA0 A;  1BG3 A;  2NLX A;  3C0B A;  5BPN A;  3CI5 A;  1ESV A;  2I7N A;  1JCF A;  3SLC A;  1T6C A;  2QWN A;  1NGE A;  2GWJ A;  4BRM A;  2E2P A;  3CJ1 A;  1OKJ A;  3DJC A;  3H46 O;  4A2A A;  4NO7 A;  5JLH A;  3H3N O;  3ULE B;  1V4T A;  4IJA A;  5EVZ A;  3AY9 A;  1TUY A;  3GL1 A;  4K42 A;  2ASP A;  3QDK A;  1NGF A;  2A5X A;  3VGL A;  3VOV A;  5LJV A;  4BR2 A;  3BF3 A;  4BG9 A;  2IVP A;  1GLB G;  4JHD A;  4BRH A;  1Y64 A;  4YDU C;  5TKY A;  1GLC G;  5ADX A;  1HPM A;  3WXL A;  5LJW A;  3MCP A;  4WYB A;  4HTL A;  1XUP O;  4FO0 A;  3FZF A;  2P9U A;  1DGK N;  4EHT A;  3QB0 A;  4J8F A;  4RWT A;  4F9O A;  1Z6R A;  2CH5 A;  2D0O A;  4MO5 A;  3DXK A;  3FE1 A;  1JCE A;  5AQJ A;  4B1U B;  1HX1 A;  4B9Q A;  4MLE A;  1ZBS A;  2FSN A;  3GE1 A;  3WEE B;  3QBW A;  4O5F A;  3HI0 A;  4IZ9 A;  1E4F T;  1C0F A;  1NGH A;  2ITM A;  1U2V A;  2HF3 A;  1MWM A;  2ZGY A;  3MN9 A;  2E88 A;  2V7Y A;  3HTV A;  1KXP A;  4JN4 A;  4EHU A;  4FWL A;  5AQO A;  5AQU A;  4DHY A;  2E2O A;  4Z94 A;  3G25 A;  1K8K A;  1ATN A;  1DEJ A;  2Q1N A;  2E2Q A;  3VER A;  4H0P A;  1U6Z A;  2V7Z A;  1KAZ A;  2P9L A;  2FF6 A;  3CJ9 A;  5AQI A;  1XC3 A;  4A2B A;  1MWK A;  4BRA A;  3ZX0 A;  2QW9 A;  3O08 A;  3MN6 A;  4FWO A;  3D7E O;  2OAN A;  2HMP A;  4H03 B;  4B1X B;  3EL2 A;  5E84 A;  3UE5 A;  3FZH A;  4H0O A;  5AQR A;  1NLV A;  4FPA A;  3WQU A;  2P9S B;  2GEM A;  5AQK A;  2GEL A;  2WUS A;  3O1W A;  4LC9 B;  3VGM A;  4BGA A;  4BR5 A;  1GLA G;  4CZL A;  5B8H A;  4QS7 A;  4KBO A;  4CD3 A;  4H5V A;  5CE3 A;  4AM7 A;  3VES A;  3U4L A;  5F1X A;  3UKR A;  1IG8 A;  4NB4 A;  3L0Q A;  3EO3 A;  3WUH A;  4H5T A;  2D1K A;  2Q36 A;  1X9J A;  4BRG A;  2YJE A;  5AFU A;  2DPN A;  2FF3 B;  1GLD G;  1QQN A;  4H0X B;  3H1Q A;  2P9K A;  3LM2 A;  3ID8 A;  1XQS C;  4H5R A;  3BUZ B;  1E4G T;  2KHO A;  4E1J A;  2BUP A;  3ZX2 A;  5AQZ A;  1HKG A;  4BGB A;  2Q97 A;  3MDQ A;  2E1Y A;  2J4R A;  3UKR B;  1ATS A;  4BC3 A;  4WQ5 A;  2QWL A;  3M1F A;  3O4W A;  5F2R A;  2ZWH A;  4FOE A;  4H0V B;  4BRC A;  1BO5 O;  4PKG A;  4BVP A;  3H3O B;  5BRD A;  3D2E B;  4AM6 A;  3U8X A;  4C23 A;  2PBD A;  2ZF5 O;  3EKU A;  1JCG A;  3AAP A;  3CQY A;  4BRP A;  4CD1 A;  3L6Q A;  3ZEU A;  1GLL O;  3A5L C;  3MN5 A;  3OHR A;  3B8A X;  1NGD A;  3WXK A;  3UKU A;  4QS9 A;  4WQ4 C;  3ZET A;  2P9I A;  4BVO A;  5BN9 A;  3SJH A;  5AZJ A;  5BRF A;  3WQT A;  4CZE A;  4CZG A;  2Q0U A;  4RCH A;  3BF1 A;  1TYQ A;  1YXQ A;  3O80 A;  4I6M B;  5AR0 A;  5KQD A;  3DAW A;  3HBT A;  1R59 O;  3ZEU B;  3IDH A;  4H0T B;  2AA4 A;  3VEY A;  3CHW A;  5BRH A;  3LDP A;  4BRI A;  2ASO A;  2V52 B;  2GTD A;  4CBX A;  2H3G X;  2I7P A;  5E26 A;  1GLJ O;  1QZ5 A;  5FPM A;  3AAQ A;  3UB5 A;  5BN8 A;  4CZH A;  2YHW A;  4M7X A;  3I8B A;  3FZK A;  5I9E B;  1YAG A;  5ELZ A;  4B1Y B;  4CZM A;  5LY3 A;  1MDU B;  1BUP A;  1HJO A;  1TUU A;  2VCP A;  5EY4 A;  3D2F A;  3SK3 A;  2A40 A;  4JHD B;  1NWK A;  2ASM A;  4EIA A;  4ISG A;  2Q31 A;  3QIC A;  3CJ7 A;  2Q2R A;  4JD2 A;  1WOQ A;  2P9U B;  3QML A;  4H0Y B;  3J8A A;  1LOT B;  1NGJ A;  2P9P A;  4CBW A;  4FWS A;  3TU5 A;  2Q0R A;  1CZA N;  1HLU A;  3LM9 A;  5JLF A;  5KPT A;  3O1B A;  3DXK B;  1NGB A;  4CZI A;  4XH4 A;  4PKH A;  4EAH D;  5AQX A;  1NGG A;  3A8Y A;  1S22 A;  5AQV A;  2YI1 A;  2A42 A;  3QFP A;  3FFK B;  3ZX3 A;  1U2V B;  1IJJ A;  4BG8 A;  3MN7 A;  3O8M A;  4H5N A;  2P9P B;  3I33 A;  4JAX A;  2VWB A;  5JIC A;  1K8K B;  4BRN A;  2QM1 A;  3R9P A;  4FWK A;  2P9L B;  5AQF A;  4H5W A;  3QBX A;  5BR9 A;  5F0X A;  4BC4 A;  5BPM A;  3GOI A;  3ATU A;  1S3X A;  3ENH A;  3FZM A;  2IVO A;  4FWM A;  3DWL A;  2CGK A;  3WXI A;  1EQY A;  2D0P A;  4L3Q A;  3KZB A;  3IMX A;  1H1V A;  1KAY A;  2CGL A;  5AQT A;  4JNE A;  3C7N A;  4ISE A;  3VF4 A;  2VYP A;  4FWR A;  4DQ8 A;  4CJ7 A;  2GUP A;  3R8E A;  3A5N C;  2W40 A;  4M63 C;  3MMV A;  3W0L A;  3EZW A;  1HUX A;  1QQO A;  2A41 A;  3A0I X;  3A5O C;  1BWF O;  3VPZ A;  1BDG A;  1NMD A;  3ENO A;  3VGK A;  4RTF D;  3CIP A;  4BRO A;  2CH6 A;  2F9W A;  5ADX H;  3CQX A;  2QWO A;  1T6D A;  5AQQ A;  3CJB A;  2HF4 A;  2PAV A;  2W41 A;  2P9K B;  3LDL A;  2A6A A;  4BR9 A;  2D4W A;  4BRQ A;  3VEX A;  3FR0 A;  3S41 A;  1G99 A;  5FPN A;  4FOI A;  4BRF A;  3LDQ A;  2E2N A;  1YVN A;  4ISF A;  4CZJ A;  3F9M A;  4WQ5 C;  5AQY A;  3WXJ A;  4GNI A;  1QZ6 A;  5KPR A;  4QS8 A;  1J6Z A;  4GY2 B;  4CZK A;  2EWS A;  3P4I A;  5AZI A;  1NGC A;  2FXU A;  3A5M C;  5JMV A;  5KPZ A;  4BQL A;  4BR0 A;  1WUA A;  3ATV A;  3R6M A;  4EFH A;  4BC2 A;  3FLC O;  3UKU B;  1NM1 A;  1C0G A;  3ZET B;  2P9I B;  2QXL A;  3VEZ A;  5AZJ B;  4YDU A;  3O6W A;  3VEN A;  4BQZ A;  2P9N A;  4MLH A;  4FWQ A;  3FGU A;  3JS6 A;  1TYQ B;  2NZT A;  1X3N A;  1KAX A;  4CZF A;  3LDO A;  5AZI B;  3SMP A;  1ZXO A;  3U9Z A;  5FPD A;  5AQL A;  2GWK A;  4BC5 A;  1RFQ A;  4B1W B;  1SQK A;  5EOY A;  4BRE A;  1MA9 B;  2E8A A;  3HZ6 A;  3WEE A;  1Q18 A;  5AQP A;  4A61 A;  3LDN A;  1Z05 A;  3VEO A;  1V4S A;  2QWQ A;  4K43 A;  3WT0 A;  2P9N B;  5BRE A;  4XH1 A;  3QFU A;  5EX5 A;  3L4I A;  1DKG D;  3LL3 A;  3HSC A;  2NRH A;  1BOT O;  5AFU H;  3H6E A;  3VEV A;  2IVN A;  3O5B A;  2BTF A;  4M7Y A;  3D2F B;  3JXU A;  4B1Z A;  3VET A;  2F9T A;  3W3D A;  4BR7 A;  4BRD A;  2UYT A;  4BR4 A;  4MO4 A;  3VF2 A;  2E1Z A;  3KVG A;  2V51 B;  4K41 A;  4BRL A;  4JD2 B;  1RGI A;  2IIR A;  1NBW A;  1T44 A;  4PL8 A;  3VF6 A;  3TPQ A;  4PKI A;  3GBT A;  4DCH A;  4IJN A;  2HOE A;  2P9S A;  3H1V X;  3CJA A;  5KQ8 A;  2ZGZ A;  1ZC6 A;  3IUC A;  3DXM A;  4FPB A;  5AQN A;  3EKS A;  4FL9 A; 
#chains in the Genus database with same CATH topology
 1EWR A;  2UU9 K;  2YHX A;  3L2Q A;  3CC7 N;  1NGA A;  4F3T A;  1SZ2 A;  3CM6 A;  3S5T A;  4DF4 A;  2P1J A;  1HYV A;  1GLF O;  1L3T A;  3SCX A;  3SMS A;  3L8B A;  4FWN A;  5M1N A;  3MK6 A;  4CJR A;  5IWA K;  1J53 A;  2GX9 A;  3ENB A;  4XH5 A;  5KI6 A;  1JL2 A;  3KHY A;  4CGD A;  3U9D A;  3HM8 A;  1WSF A;  3V1Q A;  5AQH A;  1P8Z A;  2E20 A;  3EEQ A;  5KRT A;  1ASV A;  5HRO A;  1U49 A;  4IWV A;  3WNG A;  4LSN A;  3IFR A;  3P31 A;  4M3R A;  4YFU A;  1IV0 A;  3E01 A;  1SV5 A;  1KLM A;  2A3Z A;  1KFS A;  2QXF A;  1VQ9 N;  4CBU A;  5AQG A;  3VQP A;  4CI6 A;  3ZCM A;  4JKG A;  5EXW A;  5CR4 A;  4U7B A;  3M3Z A;  1VQP N;  1DTT A;  1EO1 A;  3F2K A;  3BP8 A;  4NYF A;  3T3F A;  2NRZ A;  1VSH A;  4FCY A;  2NLX A;  2B5J A;  3CI5 A;  2PZS A;  4DQR A;  1N33 K;  3V9X A;  1O1W A;  2GWJ A;  2E2P A;  3CJ1 A;  3I56 N;  3OJS A;  4NO7 A;  1EKE A;  3H3N O;  4AF1 A;  3ULE B;  1V4T A;  3TTC A;  4AQY K;  5GIN A;  1SL0 A;  4DR5 K;  3NFA A;  3GL1 A;  4K42 A;  4BEC A;  2A5X A;  4CIE A;  4W5O A;  2PFU A;  3O3F A;  3BF3 A;  1W7A A;  2HW3 A;  4DLG A;  2IVP A;  3M8R A;  4DV3 K;  1Y64 A;  4YDU C;  3LWM A;  5ADX A;  1BIS A;  3FZF A;  1DGK N;  2G8K A;  2HBM A;  5DM6 L;  1U45 A;  4B3R K;  3P1G A;  4DLE A;  3ZLJ A;  1D5A A;  2CH5 A;  4DV6 K;  5HRN A;  2F8T A;  4C8O A;  3GE1 A;  4O5F A;  4DUY K;  1K9M O;  2ZE2 A;  1QE1 A;  1JKH A;  4KHP K;  1NGH A;  3QEW A;  1XMQ K;  2ZGY A;  3S3O A;  4CEF A;  3HTV A;  3SPY A;  4V19 S;  5AQO A;  3TAP A;  1ATN A;  4IEI A;  5JEN A;  3VER A;  3NGI A;  1VSF A;  1KAZ A;  4YY3 K;  3QEI A;  2IS3 A;  3VN5 A;  3CJ9 A;  1MWK A;  4M42 A;  3K0S A;  4W5T A;  3O08 A;  2ETJ A;  4PQU A;  4B1X B;  2O8F B;  2OTJ N;  5E84 A;  3CMA N;  4DV7 K;  1ZBL A;  2KLA A;  4NLB A;  5AQR A;  3OYA A;  3L2R A;  2P9S B;  3NAE A;  1RDU A;  4NXN K;  2GEM A;  5AQK A;  4DU3 A;  4E0D A;  4CFB A;  1HNV A;  4JI8 K;  4CJ3 A;  2RPI A;  4CZL A;  5B8H A;  4QS7 A;  4C1N K;  1JLQ A;  3D45 A;  3U4L A;  5F1X A;  1NOZ A;  4NB4 A;  2HHT A;  4H5T A;  2Q36 A;  4MFB A;  1EET A;  1GLD G;  2XY7 A;  3VTH A;  4M45 A;  3ID8 A;  4E1M A;  1RDC A;  3BUZ B;  4LD0 A;  4KI6 A;  1NKC A;  2E1Y A;  4BC3 A;  4WQ5 A;  3ZSQ A;  1ITG A;  3TAQ A;  4FOE A;  4FYD A;  2PBD A;  2OPP A;  4BRP A;  3SI6 A;  4CD1 A;  3ZEU A;  1GLL O;  1RBV A;  2NRX A;  4IFV A;  3A5L C;  3EYZ A;  2VQF K;  3UKU A;  3ZET A;  4JS5 A;  3RMB A;  4JKG B;  4M3T A;  5BN9 A;  4RCH A;  4ZTJ A;  3VQ6 A;  4BE1 A;  4J2D A;  3DLK A;  3HBT A;  3CCE N;  4WCE L;  4DF8 A;  3QEV A;  3IS9 A;  3NVK A;  4H0T B;  4DTU A;  3V9U A;  3L3U A;  1REV A;  4BRI A;  3NDK A;  2UXD K;  1Z26 A;  3NF9 A;  3T19 A;  3C6A A;  3UB5 A;  3VA0 A;  3BZC A;  3I8B A;  3V9S A;  3C6T A;  1N36 K;  4AHS A;  1T3V A;  3OYG A;  3E66 A;  1YAG A;  4JI2 K;  3VQC A;  1TL1 A;  1BUP A;  1XMO K;  3O9R A;  1Q8I A;  2VCP A;  3D2F A;  4DWI A;  1VQN N;  1NNE A;  3QML A;  3I0S A;  3J8A A;  3KWG A;  4L8R B;  3ZT1 A;  3VQ7 A;  1CZA N;  3B6O A;  5JVH L;  5KPT A;  3O1B A;  3WNF A;  1HYZ A;  4CZI A;  4XH4 A;  5I42 A;  1S22 A;  2YI1 A;  3QFP A;  5HP1 A;  4MDB A;  1NK5 A;  4BG8 A;  1YIJ N;  1VAZ A;  4DTS A;  3V9Z A;  2P9P B;  4JAX A;  1RIL A;  3VQD A;  4BRN A;  2IOC A;  4N56 A;  4IDK A;  3OYH A;  5BPM A;  1X1P A;  2GUI A;  1Q9Y A;  4CIF A;  1WAF A;  1JXE A;  5KGX A;  1NJY A;  2IVO A;  4U67 L;  4KTW A;  3DWL A;  4J2B A;  3WXI A;  4B9V A;  1EQY A;  4FLZ A;  3THW A;  1WAJ A;  3IMX A;  4N5S A;  1KAY A;  1TAQ A;  2HHQ A;  3C7N A;  4ISE A;  4ZHR A;  2YV0 X;  3AVK A;  3T7Z A;  5M1P A;  4Z4H A;  3ZSX A;  3PIP L;  4FJK A;  4DUZ K;  3A5N C;  3HK2 A;  3NBP A;  1CXU A;  3EZW A;  1HUX A;  3A5O C;  3AGR A;  3LAM A;  1UWB A;  4R79 A;  2YKM A;  3P5J A;  1NMD A;  5M1K A;  1FXX A;  3VGK A;  4O55 A;  4BY9 C;  3ITH A;  4BRO A;  2ITG A;  3QER A;  3CQX A;  2QWO A;  1YJW N;  3CJB A;  1YIT N;  4Z4G A;  2HF4 A;  2PAV A;  3CM5 A;  2D0B A;  2O8D A;  3FR0 A;  4JKH A;  4EP4 A;  4CEQ A;  3RTV A;  5FPN A;  4BRF A;  2E2N A;  1NJZ A;  1QS4 A;  3CCQ N;  1LAW A;  4DTM A;  3R1X A;  2BDP A;  5KPR A;  1J6Z A;  2UUA K;  1NGC A;  2FXU A;  3A5M C;  2KFN A;  3PLA A;  4BR0 A;  1VRU A;  3CXC M;  3UKU B;  4X64 K;  1NK9 A;  3ZET B;  2QXL A;  1JLG A;  2WOM A;  1VQL N;  4RW4 A;  2W42 A;  1VSJ A;  3AVB A;  2QK9 A;  1BIU A;  4BQZ A;  4JI5 K;  2O8C A;  4B3M K;  4MLH A;  4FLY A;  2XY8 A;  4ID1 A;  1YTU A;  2NZT A;  3CPW M;  4YOT A;  3SMP A;  4DV1 K;  1ZXO A;  1JLB A;  4FJJ A;  3NF7 A;  4BC5 A;  4FJH A;  1SQK A;  5EOY A;  1BGX T;  4BRE A;  2RE2 A;  1KQS M;  3R3L A;  3WEE A;  1Q18 A;  5AQP A;  1VQ7 N;  1ZBF A;  1V4S A;  3HO1 A;  4K43 A;  3WT0 A;  2HST A;  1N5Y A;  1DKG D;  4BAC A;  4NCG A;  2NRH A;  5CZ1 A;  3SQ2 A;  1S1X A;  1GOA A;  3OYM A;  5AFU H;  3CCR N;  2Z1I A;  2DFF A;  3K5L A;  4JK9 A;  3P38 A;  3O5B A;  2BTF A;  1QTM A;  3D2F B;  3JXU A;  4BR7 A;  3IKM A;  2HNZ A;  3ASM A;  4M3X A;  1TV6 A;  1BIZ A;  5C2F A;  4BRL A;  3C95 A;  2IIR A;  1EX4 A;  3V6D A;  3QES A;  3GBT A;  4IJN A;  2HHI A;  3H1V X;  3CJA A;  3S9H A;  4JKD A;  1ZC6 A;  3SQ1 A;  3NVM A;  3D0P A;  3IRX A;  5AQN A;  4IEE A;  3ZT2 A;  3EKS A;  3E9L A;  4CEZ A;  2ZJQ L;  2QKK A;  4DR7 K;  1YJN N;  1KTQ A;  3ZT4 A;  4PY5 A;  3OVN A;  3AA4 A;  2DFE A;  4E19 A;  1D4X A;  3BEX A;  4DV2 K;  2FLO A;  1C0M A;  4PWD A;  4XEI A;  1LV5 A;  4FLU A;  4ZTF A;  1M90 O;  3M6G A;  4A62 A;  2KKZ A;  1GLE G;  2YHY A;  2YCH A;  3THW B;  2QWM A;  3CG7 A;  3FZL A;  4O8K A;  3HOS A;  4FJ8 A;  5AQS A;  4CK1 A;  2X6N A;  2QWR A;  3VEW A;  2BE2 A;  2QWP A;  4CHY A;  3RSE B;  3C7N B;  4HWI A;  3H45 C;  3SBT A;  4C8M A;  4B1V A;  2YKN A;  1HKB A;  5J1E A;  3LP3 A;  1L5U A;  4KPY A;  3I0R A;  4DTO A;  1Y97 A;  5HRP A;  4LF9 K;  2AP1 A;  3C94 A;  4PL7 A;  1D9D A;  4GW6 A;  3K9K A;  1YVU A;  2EHG A;  1NGI A;  5FPE A;  4KTQ A;  4CJU A;  5CHI A;  2FSK A;  4B9S A;  4DU1 A;  3AA5 X;  4C8N A;  3ULE A;  3AGK A;  3CER A;  5HLF A;  2WON A;  1NKB A;  1BG3 A;  4CW7 B;  1LW0 A;  3F9K A;  3RRH A;  4DFJ A;  1KVB A;  4O4G A;  3QLH A;  5M1O A;  3I8D A;  4LFB K;  2A1R A;  2OZM A;  1C6V A;  1WB9 A;  2QWN A;  3F73 A;  4GV3 A;  4AHT A;  3TAG A;  4HCB A;  5JLH A;  2HHX A;  3OYK A;  3CCV N;  3OYD A;  1OH8 A;  2OYQ A;  1K8A O;  5EVZ A;  4FJX A;  4BE0 A;  4M41 A;  1M1K O;  4FM1 A;  5MLC Q;  3J7A P;  4BR2 A;  1C1B A;  1GLB G;  3HP9 A;  4BRH A;  2VWK A;  2O8C B;  3QO9 A;  1XUP O;  3G4S N;  3G10 A;  3MCA B;  4QOZ B;  2P9U A;  2VG5 A;  4J8F A;  4F9O A;  3PX4 A;  2XY5 A;  3TAE A;  4LH5 A;  4BWJ A;  2D0O A;  1T7P A;  1N6Q A;  3DXK A;  1JCE A;  5AQJ A;  1HX1 A;  4B9Q A;  4C8L A;  1JXB A;  3WEE B;  3O4Q A;  4BE2 A;  3MAQ A;  1YI2 N;  4DFK A;  3E1Y A;  4RW8 A;  3JAM O;  3CC2 N;  2ITM A;  1U2V A;  2HF3 A;  4Y1C A;  1J9A A;  1ZYQ A;  3J7Y P;  4ELU A;  2O8F A;  3AO1 A;  4EHU A;  5SWM A;  3DMJ A;  5AQU A;  1O13 A;  1TAU A;  1DEJ A;  1FK9 A;  1KSP A;  3QEX A;  2P9L A;  1VQ5 N;  2FF6 A;  1WN7 A;  3CQ8 A;  4PHT X;  2WFB A;  2WTU A;  2OAN A;  4FJM A;  4H03 B;  1VSE A;  4DTJ A;  1RBR A;  4CEC A;  3UE5 A;  1OH6 A;  2VQE K;  2G8V A;  4LH4 A;  4H0O A;  4E7K A;  3WQU A;  3OYC A;  2F4V K;  2GEL A;  4FJL A;  3NF8 A;  3DLL L;  1YF5 L;  3OTO K;  4HTU A;  1NJW A;  3QIO A;  2ZJR L;  4ICL A;  2XRI A;  4NYN A;  5CE3 A;  4NCA A;  1IG8 A;  3DLH A;  4YOW A;  2D0C A;  3L0Q A;  3WUH A;  3T1A A;  4KHQ A;  4FM2 A;  4JI3 K;  2JGU A;  4B8C A;  1QQN A;  2B6A A;  1RBS A;  3DOL A;  1CLQ A;  4H5R A;  3RWU A;  1E4G T;  3G0Z A;  4E1J A;  2BUP A;  4CF0 A;  5AQZ A;  3PSI A;  3UKR B;  4JYA K;  5HRR A;  3ZT3 A;  4YHH K;  2QWL A;  2VGM A;  1VQM N;  5F2R A;  2UXB K;  4H0V B;  4CJW A;  1BO5 O;  4LF7 K;  5BRD A;  4FJ5 A;  4AM6 A;  2ZF5 O;  3AAP A;  2W6L A;  3F5T A;  3KWI A;  4CCH A;  2Z1H A;  1YT3 A;  3MN5 A;  2QI2 A;  3OHR A;  4KV8 A;  4CER A;  4WQ4 C;  1RBT A;  4DS5 A;  2P9I A;  4BVO A;  5AZJ A;  5BRF A;  3TAM A;  1SS6 A;  1HR0 K;  3AA3 A;  2ZD1 A;  2Q0U A;  3LP0 A;  3U3G A;  4EP5 A;  4JI7 K;  3O80 A;  1N32 K;  1W2B M;  1SL1 A;  3QEP A;  2O8E A;  5K14 A;  5EU7 A;  4YNQ A;  3LP1 A;  3HST B;  3ZSW A;  3S3M A;  4RW7 A;  1IO2 A;  4LSL A;  3LDP A;  2BAN A;  3RR7 A;  1GLJ O;  1WSG A;  1ZBI A;  2DFH A;  5FPM A;  1RTH A;  3AAQ A;  4CZH A;  2YHW A;  4M7X A;  1OH5 A;  4ID5 A;  5I9E B;  3HP6 A;  4CF2 A;  3OYN A;  5LY3 A;  1S1T A;  3AVN A;  3DRP A;  4YOR A;  3LDS A;  4E7J A;  4B9U A;  1NK4 A;  3CFP A;  5C10 A;  3V4I A;  3P83 D;  1NK7 A;  1TGO A;  1YJ9 N;  3CFO A;  2P9U B;  4JKA A;  1VQO N;  2P9P A;  3V1O A;  4E7L A;  3AVL A;  4CHO A;  5H1S Q;  1IKY A;  1X9M A;  2Q0R A;  3KLG A;  4DTR A;  3DXK B;  1NGB A;  4OPA A;  3KJV A;  4PKH A;  1HNZ K;  2KZZ A;  1U48 A;  1NGG A;  1S1W A;  4CJP A;  4I9L A;  3KK3 A;  5AQV A;  2A42 A;  1U4B A;  4JI4 K;  4Z4C A;  3ZX3 A;  3CCU N;  1U2V B;  3MN7 A;  5CYQ A;  2YHA A;  1I94 K;  1HRH A;  1W0H A;  3K59 A;  3MWP A;  3VQB A;  1KVC A;  4CK2 A;  3MED A;  5JIC A;  1BQM A;  2WC9 A;  4DSK A;  1GOB A;  5LL6 Z;  4DTP A;  4FM0 A;  2P9L B;  4H5W A;  5F0X A;  1Q86 O;  5JVG L;  4JKE A;  2NRW A;  4LF8 K;  3C6H A;  3BZK A;  3KZB A;  2OPQ A;  1SUQ A;  5AQT A;  4JNE A;  5FDL A;  3O3G A;  2VYP A;  4FWR A;  4CES A;  2HHH K;  2W40 A;  2Y1I A;  1C0T A;  3W0L A;  1B92 A;  3SUQ A;  1SKW A;  2A41 A;  4JK7 A;  5GIO A;  4K0K K;  3SNN A;  1BWF O;  3VPZ A;  4DR2 K;  4FZX C;  3ENO A;  1A5V A;  4F3O A;  1VSK A;  4FK4 A;  4C1N I;  4DSF A;  2CH6 A;  1JJ2 M;  1TKZ A;  5ADX H;  3OA9 A;  4N47 A;  1JL1 A;  2X74 A;  3L4Q A;  4LF4 K;  2BH1 A;  2A6A A;  4BR9 A;  1VSD A;  1WLJ A;  2OTL N;  1S1U A;  3S41 A;  4OVL A;  4CGF A;  1YVN A;  1WBB A;  4ISF A;  3ZSZ A;  1TK8 A;  3MEC A;  4CFC A;  4O0J A;  2Z1G A;  3SJJ A;  4QS8 A;  4A5A A;  3NF6 A;  5A2Q O;  3P4I A;  5CY4 A;  5KPZ A;  3R6M A;  4DS4 A;  2G8U A;  3FLC O;  2GBZ A;  1NM1 A;  4CJK A;  2P9I B;  2P5G A;  5AZJ B;  5JS2 A;  4YDU A;  4QCL A;  3JS6 A;  4GVM A;  4IKF A;  1MU2 A;  1KAX A;  1UAX A;  2O8E B;  5AZI B;  5DK5 A;  4IBN A;  5AQL A;  4B1W B;  4AHV A;  5GIP A;  1MA9 B;  4J2E A;  3KLF A;  2E8A A;  3HZ6 A;  4FW2 A;  4CHP A;  3HVR A;  4A61 A;  1BCO A;  1CZB A;  3VEO A;  4A5B A;  2QWQ A;  3QFU A;  5EX5 A;  4KH4 A;  3H08 A;  3TSU A;  3HSC A;  1YTA A;  3AO3 A;  2RKI A;  1OVY A;  3V81 A;  2NNW A;  4AHU A;  4ILH A;  5AJ3 K;  3H6E A;  4DV5 K;  1WNS A;  2HB5 A;  1B9F A;  4I2Q A;  2FC0 A;  1XHZ A;  4BDZ A;  3W3D A;  4Z4E A;  3VF2 A;  1CZ9 A;  2V51 B;  2I5J A;  3NH2 A;  3TI0 A;  4PL8 A;  1ZBH A;  3VF6 A;  5SZT A;  2UXC K;  3OS0 A;  4DCH A;  2HOE A;  2IC3 A;  4CJ5 A;  3NCI A;  2OPR A;  2ZGZ A;  1XI1 A;  2XO7 A;  3MXM A;  2E6M A;  3CCL N;  1LWE A;  3L2V A;  1QHT A;  1ATR A;  3THX A;  4JK8 A;  4ELV A;  4K25 A;  3RSE A;  3TAN A;  1JLA A;  3AAR A;  5LMN K;  4IXC A;  3GDQ A;  3CCS N;  1UA0 A;  1X3M A;  1BA1 A;  3DXM B;  5BPL A;  1LCU A;  4JI1 K;  4IO8 A;  4CEA A;  1W9H A;  4CF1 A;  1Z25 A;  4CHN A;  2UUB K;  3AVH A;  1SL2 A;  4IOX A;  4FLT A;  4E1N A;  4DFP A;  3D2E A;  3AVF A;  1RT5 A;  2FBV A;  5AQM A;  2CGJ A;  2FSJ A;  1D8Y A;  2NRR A;  3DLE A;  1QQM A;  3KIO A;  4BDP A;  1DLO A;  1RBU A;  4JS4 A;  4FJG A;  1E3M A;  4F2S A;  3CJC A;  4FLX A;  4I6M A;  2FBT A;  1VQ6 N;  1VQK N;  3C0B A;  2VG7 A;  2R7Y A;  5BPN A;  1LWF A;  5GAD P;  4E72 A;  4IOC L;  1J5O A;  1BL3 A;  1ESV A;  1S9E A;  3AVG A;  1JCF A;  3SLC A;  1T6C A;  3JSM A;  1OKJ A;  3DJC A;  4AIL C;  4TSX A;  4CEE A;  4H4M A;  3E9O A;  4IJA A;  4M3U A;  1TKX A;  3AY9 A;  3MWT A;  5FRO A;  1Q81 O;  5HRS A;  3NMU A;  1RCH A;  3NE6 A;  4OGE A;  3ZSY A;  3HM9 A;  2ASP A;  3QDK A;  2E5L K;  1NGF A;  3PO5 A;  3VOV A;  4DSE A;  5LJV A;  3J7Z O;  4BG9 A;  1RTJ A;  4JHD A;  3WNE A;  2D5R A;  2HND A;  1HYS A;  1GLC G;  4QAG A;  4FZZ A;  1HPM A;  3WXL A;  3MCP A;  1IH7 A;  4A57 A;  3LP2 A;  4RWT A;  2NRT A;  1Z6R A;  4LFA K;  3KKR A;  4CEO A;  3HVT A;  3FE1 A;  4B1U B;  1S6Q A;  4JRQ A;  1QSY A;  1C0F A;  1KXP A;  4CED A;  4FWL A;  3RMD A;  4DHY A;  2E2O A;  3KK7 A;  4Z94 A;  4AHC A;  1VSM A;  3UIQ A;  3Q7B A;  1XWL A;  1S9G A;  5IT9 O;  1HQU A;  1VK0 A;  3EY1 A;  4GKJ K;  1U6Z A;  2O4I A;  3MX2 A;  4E7I A;  2FBY A;  1XNQ K;  4JRP A;  1RDB A;  4BRA A;  1TKD A;  4O0I A;  1TL3 A;  2QW9 A;  3AVA A;  4B9L A;  3D7E O;  4HUF A;  3SBG A;  4B08 A;  2AJQ A;  4Z4F A;  3EL2 A;  2HHW A;  1BHL A;  3FZH A;  4IFE A;  4MQ3 A;  3G71 N;  1NMN A;  4G1Q A;  3SAH A;  1S5J A;  3O1W A;  3VGM A;  3RMC A;  4BR5 A;  3QIN A;  3HXM A;  3THX B;  3KLH A;  4KBO A;  2HHV A;  4Q5V A;  1Q7Y O;  4AM7 A;  3K5N A;  4YOV A;  3VES A;  4WFB L;  3UKR A;  4BWM A;  1P90 A;  4KTZ A;  3DOK A;  1C1C A;  5GAE P;  2D1K A;  1X9J A;  4BRG A;  4X65 K;  3ZYY X;  2YNH A;  2DPN A;  4IFY A;  4IG0 A;  1LW2 A;  3CCM N;  3H1Q A;  5M1F A;  2P9K A;  3LM2 A;  1L3V A;  4RG8 A;  3N4Q A;  1HKG A;  4DV0 K;  2Q97 A;  3HOT A;  3NGY A;  1ATS A;  3G6E N;  4DQQ A;  3M1F A;  3O4W A;  4R5P A;  1UOC A;  3THV A;  2ZWH A;  3RR8 A;  4BVP A;  4BRC A;  1XNR K;  3D2E B;  3PIO L;  3EKU A;  1RTD A;  4DR6 K;  5DM7 L;  3AO2 A;  4JEP A;  3L6Q A;  1X9W A;  1T03 A;  3B8A X;  3PO4 A;  4KRE A;  4NLC A;  3DLB A;  4A59 A;  3TTF A;  2Z1J A;  3WQT A;  3T1Y K;  2YNG A;  4CE9 A;  4WE1 A;  4CZE A;  4CZG A;  1JLF A;  3OYF A;  1Q9X A;  1YXQ A;  4I6M B;  1X9S A;  3DAW A;  3QIP A;  1I39 A;  3SPZ A;  4E89 A;  2AA4 A;  3CHW A;  2GTD A;  4CHZ A;  2I7P A;  4B9T A;  5E26 A;  4ILJ A;  4Z0U A;  3OBY A;  3MEG A;  5BN8 A;  1DTQ A;  4HUE A;  1T05 A;  1G15 A;  3AVI A;  3VQA A;  4WF9 L;  3M5R A;  3V1R A;  1U04 A;  3D6R A;  3OS2 A;  4FK0 A;  3B6P A;  1B9D A;  1HJO A;  1TUU A;  1IBK K;  1NU0 A;  5EY4 A;  3LWL A;  1RT4 A;  4X62 K;  4KB1 A;  1XHX A;  2A40 A;  4JHD B;  1NWK A;  2ASM A;  4EIA A;  2VG6 A;  4ISG A;  1BQN A;  2RHK A;  2HBJ A;  4JD2 A;  1WOQ A;  1NGJ A;  3TSQ A;  4LF6 K;  1NJX A;  4G9Z A;  5JLF A;  4CJL A;  3LAL A;  4CJ4 A;  4KKO A;  3HYF A;  2ZQB A;  2F7T A;  5AQX A;  3FFI A;  1KLN A;  1HNI A;  4RW9 A;  4H5N A;  3LAK A;  4CJS A;  2B4J A;  3HPH A;  4CJV A;  3HRG A;  4CF9 A;  3PUF A;  3O9Q A;  1TKT A;  4OKE A;  1QQC A;  2QA4 N;  5AQF A;  3SQ4 A;  4BC4 A;  4CFA A;  4FWM A;  2CGK A;  4YOU A;  4L3Q A;  2D0P A;  3O9S A;  2A1S A;  3VQ5 A;  4FXD A;  1J54 A;  2JLE A;  1H1V A;  3LZI A;  4I2P A;  1ASW A;  4DQ8 A;  3SUP A;  4CJ7 A;  1BCM A;  1F21 A;  3N4P A;  2JWK A;  3C6U A;  4M63 C;  3MMV A;  1WBD A;  4XJX A;  3L2W A;  1JLC A;  1OVQ A;  4YOX A;  4O5B A;  3O3H A;  4PUO A;  1QQO A;  3A0I X;  1BDG A;  3SUO A;  3CIP A;  1NK6 A;  3WXM B;  2W00 A;  1W97 L;  1K73 O;  4KFB A;  4OX9 K;  2PY5 A;  3CYG A;  3O4N A;  4CF8 A;  2RF2 A;  3K2P A;  2P9K B;  3LDL A;  3KLE A;  2OPS A;  5J2P A;  1YHQ N;  3ID6 A;  3VEX A;  2IGI A;  4IG3 A;  4FOI A;  3LDQ A;  4I7F A;  3ZSV A;  2HBK A;  4CZJ A;  4GVE A;  5JS1 A;  2YNI A;  4O44 A;  3F9M A;  4FLV A;  4WQ5 C;  2EX3 A;  5AQY A;  3WXJ A;  2RN2 A;  4DMN A;  4DV4 K;  4CZK A;  4KH6 A;  2EWS A;  5AZI A;  2XY6 A;  4GMJ B;  4BQL A;  2KQ2 A;  4KHU A;  2P51 A;  4EFH A;  5KTQ A;  4OKK A;  3VEZ A;  5C25 A;  4JI6 K;  4F2R A;  3VEN A;  2YNF A;  4W5N A;  3MEE A;  4FWQ A;  2F8S A;  1S6P A;  3U9Z A;  3WNH A;  4CZF A;  2GWK A;  3QNN A;  1NOY A;  5BR8 K;  2C1I A;  3SYZ A;  4UQG A;  1HNW K;  2GV9 A;  4OJR A;  3M8S A;  2NRV A;  2C1G A;  3LDN A;  4BDY A;  2HNY A;  2P9N B;  2LSN A;  5BRE A;  4OGC A;  4XH1 A;  1C0U A;  2FBX A;  2HHS A;  3KK1 A;  3NH1 A;  4FJ9 A;  3LZJ A;  3MXJ A;  2HVI A;  3VEV A;  2IVN A;  3SUN A;  3THY A;  3TR8 A;  4PA1 A;  4B1Z A;  3S3N A;  1T8E A;  2UYT A;  3OBW A;  4BR4 A;  3KD5 E;  4OPJ A;  2VWJ A;  2G8H A;  3ZT0 A;  2QKB A;  5DMR A;  4JD2 B;  1NKE A;  1NBW A;  1RT3 A;  4HVJ A;  1T44 A;  4IO9 L;  3VQ9 A;  4EZ9 A;  4FVU A;  1FW6 A;  2O8B B;  1XC9 A;  4FJI A;  5GAG P;  3ULD A;  3PY8 A;  5KQ8 A;  1EWQ A;  3O9T A;  3HT3 A;  1VQ4 N;  3DXM A;  2ATQ A;  4KI4 A;  2W6K A;  4DR1 K;  3TSP A;  4BC2 A;  2G8W A;  2DTU A;  5J2M A;  2HBL A;  5AQW A;  1BU6 O;  2YJF A;  4DQI A;  4M3Y A;  4KAZ A;  2VGN A;  4FSV A;  4Z4I A;  1KVA A;  5TKW A;  4DQP A;  4J2A A;  3SAF A;  2ZM6 K;  4OO1 J;  4Y0W A;  5C0Y A;  1Q82 O;  3GG4 A;  4KB0 A;  1RT7 A;  1RT2 A;  4FZY A;  5LMU K;  1KD1 O;  3TWH A;  4FWP A;  2D0A A;  3RMA A;  1SAZ A;  2Y1J A;  1C1A A;  1QHA A;  1RDW X;  3PX6 A;  4LFC K;  1D9F A;  4WQ4 A;  3CET A;  4DB3 A;  3DLR A;  4CJQ A;  4GV9 A;  1YUW A;  4DKW A;  4OKJ A;  4CIG A;  3OYE A;  3BDP A;  1KCF A;  1S1V A;  4N76 A;  4CJE A;  4BRK A;  3JYT A;  3VQE A;  4NXM K;  1IBM K;  4E7H A;  1BI4 A;  3NHG A;  1HKC A;  3EN9 A;  4WFA L;  3SAG A;  3TAR A;  1BA0 A;  3C65 A;  1VRT A;  4BE7 B;  3U6F A;  1CXQ A;  3ZSO A;  2KZM A;  4ELT A;  4FW1 A;  2I7N A;  3NH0 A;  4CVN E;  1NGE A;  5C12 A;  4BRM A;  4K8Z A;  3H46 O;  3K5M A;  4A2A A;  2G8F A;  4BEB A;  3KK2 A;  4KHW A;  3OW2 M;  3AVM A;  1L3U A;  2Q3S A;  1TUY A;  4X66 K;  1GOC A;  3EZ5 A;  1RNH A;  4AH9 A;  3AVJ A;  3VGL A;  4CGG A;  2DY4 A;  5TKY A;  1UA1 A;  3TAB A;  2IAJ A;  5LJW A;  5I3U A;  4OPK A;  4WYB A;  4HTL A;  4FO0 A;  1LAV A;  4EHT A;  2HVH A;  3QB0 A;  5KRS A;  4ILG B;  3ALY A;  3PSF A;  4CJT A;  3SV3 A;  4GKK K;  3SQ0 A;  4K8X A;  4MO5 A;  3RRG A;  3LAN A;  4MLE A;  1ZBS A;  2FSN A;  2OCE A;  3MX5 A;  5C42 A;  2X6S A;  3QBW A;  3HI0 A;  4IZ9 A;  1E4F T;  2XHB A;  1NG9 A;  1K6Y A;  1NK8 A;  1EXQ A;  1MWM A;  1A5W A;  3MN9 A;  4XIU A;  2E4L A;  2E88 A;  2V7Y A;  4JN4 A;  5FRM A;  3QET A;  3VA3 A;  3G25 A;  4DSJ A;  1K8K A;  2KFZ A;  3CC4 N;  3EE8 A;  2Q1N A;  2E2Q A;  5HOO A;  4H0P A;  2V7Z A;  3THY B;  2ZJP L;  5AQI A;  4A2B A;  1XC3 A;  3ZX0 A;  3RVC A;  3MN6 A;  4FWO A;  2HMI A;  2PYL A;  2HMP A;  1KFD A;  4CFD A;  3E9P A;  1NLV A;  1N8R O;  4FPA A;  2YX6 A;  2WUS A;  4HHT A;  3TTD A;  4LC9 B;  4BGA A;  2F96 A;  1GLA G;  4JLH A;  2G8I A;  1HNX K;  4CD3 A;  4H5V A;  3NGZ A;  3EO3 A;  5KGW A;  5J2Q A;  3BGR A;  3KD1 E;  2YJE A;  1VQ8 N;  5AFU A;  1ZBU A;  2FF3 B;  1JLE A;  4I9Q A;  4H0X B;  3PX0 A;  1XQS C;  2KHO A;  4FLW A;  3ZX2 A;  4BGB A;  3MDQ A;  2O4G A;  4KHS A;  2J4R A;  4C8K A;  1TVR A;  3KTQ A;  2QTD A;  4M3W A;  4PKG A;  3H3O B;  3U8X A;  4C23 A;  1EP4 A;  1JCG A;  3CQY A;  2BGG A;  5D3G A;  1WSH A;  3T69 A;  3HJF A;  1QSS A;  1NGD A;  3WXK A;  4QS9 A;  5C15 A;  2QEX N;  4FJ7 A;  4CJF A;  3SJH A;  3OYJ A;  4F8R A;  3IG1 A;  1KC8 O;  3K5O A;  3IAY A;  4JV5 K;  3BF1 A;  1ILY A;  1TYQ A;  1TK0 A;  1BI4 B;  5HL7 L;  3L2U A;  4WFN L;  5AR0 A;  5KQD A;  3DM2 A;  1R59 O;  3ZEU B;  4M3Z A;  4CGJ A;  3IDH A;  3P39 A;  3VEY A;  5BRH A;  3CD6 N;  2ASO A;  2V52 B;  4CBX A;  2H3G X;  1QZ5 A;  4DU4 A;  1VSL A;  3K9J A;  1HQE A;  3K58 A;  3FZK A;  3CCJ N;  5CZ2 A;  5ELZ A;  4B3T K;  4B1Y B;  1IKV A;  4CZM A;  1WSI A;  1MDU B;  2WBN A;  3ISN C;  3I55 N;  4DR3 K;  1QVG M;  4DTX A;  3SK3 A;  1HPZ A;  1LWC A;  2Q31 A;  3QIC A;  5HBM A;  3CJ7 A;  2E6L A;  3OJU A;  4B9M A;  4DQS A;  2Q2R A;  3OY9 A;  4DTN A;  4H0Y B;  3DRS A;  1LOT B;  4CBW A;  4AHR A;  2YHB A;  4FWS A;  3TU5 A;  1N34 K;  3CF5 L;  3LM9 A;  1HLU A;  4CGI A;  1TK5 A;  1RT1 A;  4EAH D;  4O8U A;  4B8A B;  2X78 A;  4KRF A;  2NUB A;  3A8Y A;  4B9N A;  3FFK B;  1WSJ A;  3M8P A;  4OLB A;  2HHU A;  1S72 N;  1IJJ A;  1QVF M;  1R0A A;  3O8M A;  3V9W A;  3PV8 A;  4CGH A;  3HL8 A;  3I33 A;  4OLA A;  2VWB A;  3OYB A;  3AV9 A;  1K8K B;  2QM1 A;  4FK2 A;  3DRR A;  3R9P A;  4UY8 O;  3AO4 A;  4JKB A;  3TAF A;  4FWK A;  5C2D A;  3QBX A;  5BR9 A;  4CHQ A;  2JWL A;  3GOI A;  1FKP A;  3ATU A;  3VMF B;  1S3X A;  3ENH A;  3FZM A;  5GAH P;  3CYM A;  1DT9 A;  1A5X A;  1U47 A;  4FVM A;  1RDD A;  3SZ2 A;  4JKC A;  5C24 A;  2CGL A;  3VF4 A;  3QNO A;  3DLG A;  2PYJ A;  2GUP A;  4Y1D A;  3AVC A;  3R8E A;  3OYL A;  3O9U A;  1SKR A;  4MDA A;  4OPH A;  4HCC A;  3SV4 A;  1NJI O;  4DSI A;  4RTF D;  3DI6 A;  3J81 O;  4GV6 A;  1L3S A;  2F9W A;  3KKS A;  3KLI A;  2IDO A;  3MXI A;  2OZS A;  2KW4 A;  3EE9 A;  1T6D A;  5AQQ A;  3OS1 A;  4LF5 K;  2W41 A;  4Q0B A;  2D4W A;  4BRQ A;  3AA2 A;  4CEB A;  4H8K A;  4KO0 A;  1G99 A;  3K57 A;  5E41 A;  4KH5 A;  4W5Q A;  3ZSR A;  1IKW A;  4DG1 A;  1VHX A;  4GNI A;  1QZ6 A;  3CFR A;  4GY2 B;  4LY7 A;  1RT6 A;  5M1Q A;  1FKO A;  5CYM A;  4HUG A;  4N41 A;  5JMV A;  2O8D B;  3CPE A;  1WUA A;  3ATV A;  3HPO A;  5FLX O;  3LPU A;  4DSL A;  1C0G A;  4IOA L;  5FRN A;  1IG9 A;  1SKS A;  3J80 O;  1WSE A;  3O6W A;  1ASU A;  3OYI A;  2P9N A;  3U3Y A;  3AO5 A;  3FGU A;  1TYQ B;  1X3N A;  3A2F A;  4CK3 A;  1FJG K;  4DFM A;  3LDO A;  4JKF A;  1OH7 A;  1I3A A;  3VQ4 A;  1NK0 A;  1HJR A;  5FPD A;  2KTQ A;  1RFQ A;  4KHY A;  1IKX A;  5T7B A;  2OA8 A;  4B3O A;  3Q7C A;  3VQQ A;  3T1H K;  4YOY A;  4E3S A;  5J2N A;  1Z05 A;  3VTI A;  3BY5 A;  4DR4 K;  3L4I A;  3LL3 A;  1RTI A;  1BOT O;  2O8B A;  4B3S K;  4W5R A;  4IDH A;  1HMV A;  3HPG A;  3M8Q A;  2UUC K;  4M7Y A;  3CME N;  1KRP A;  3DYA A;  3VET A;  1IBL K;  2F9T A;  4KHN A;  4BRD A;  4MO4 A;  2E1Z A;  3LPT A;  1QSL A;  2P5O A;  3KVG A;  4K41 A;  1RGI A;  4RW6 A;  4NCB A;  3VQ8 A;  3TPQ A;  4PKI A;  4JI0 K;  1RDA A;  1J5E K;  2P9S A;  4H4O A;  1VSI A;  4EZ6 A;  3IUC A;  4FPB A;  4FJN A;  4F4K A;  4FL9 A;  3L3V A; 
#chains in the Genus database with same CATH homology
 1ATR A;  2HBL A;  5AQW A;  1BU6 O;  2YJF A;  4JK8 A;  1YJN N;  2YHX A;  3CC7 N;  1NGA A;  4K25 A;  1SZ2 A;  2VGN A;  3RSE A;  4FSV A;  1GLF O;  1D4X A;  3BEX A;  2FLO A;  3AAR A;  5TKW A;  3SMS A;  4IXC A;  4FWN A;  3GDQ A;  4XEI A;  5M1N A;  3CCS N;  3MK6 A;  3SAF A;  1M90 O;  1X3M A;  1BA1 A;  3DXM B;  3M6G A;  5BPL A;  1LCU A;  2GX9 A;  3ENB A;  4XH5 A;  4A62 A;  2KKZ A;  1GLE G;  2YHY A;  3KHY A;  4OO1 J;  2YCH A;  4IO8 A;  4Y0W A;  2QWM A;  3U9D A;  3FZL A;  4O8K A;  3HOS A;  5C0Y A;  3HM8 A;  5AQS A;  1Q82 O;  5AQH A;  2QWR A;  1P8Z A;  3VEW A;  3GG4 A;  2E20 A;  2QWP A;  3RSE B;  4IOX A;  3C7N B;  4HWI A;  3H45 C;  4IWV A;  3D2E A;  3IFR A;  3P31 A;  1KD1 O;  4FWP A;  3SBT A;  5AQM A;  2CGJ A;  2FSJ A;  4B1V A;  1HKB A;  1SAZ A;  2A3Z A;  2NRR A;  1QHA A;  1RDW X;  4WQ4 A;  4CBU A;  5AQG A;  4CI6 A;  1VQ9 N;  3CET A;  1QQM A;  4DB3 A;  4JKG A;  2AP1 A;  4GV9 A;  1YUW A;  4DKW A;  5EXW A;  4PL7 A;  5CR4 A;  4U7B A;  3K9K A;  3M3Z A;  1NGI A;  5FPE A;  5CHI A;  4BRK A;  2FSK A;  1VQP N;  3CJC A;  3F2K A;  1EO1 A;  3BP8 A;  3ULE A;  3AGK A;  1HKC A;  3EN9 A;  4WFA L;  4I6M A;  3CER A;  3SAG A;  1BA0 A;  3C65 A;  1VQ6 N;  2NRZ A;  1VQK N;  4BE7 B;  1BG3 A;  2NLX A;  3C0B A;  5BPN A;  3CI5 A;  5M1O A;  5GAD P;  4IOC L;  1ESV A;  2I7N A;  1JCF A;  3SLC A;  1T6C A;  2QWN A;  1NGE A;  4GV3 A;  5C12 A;  2GWJ A;  4BRM A;  2E2P A;  3CJ1 A;  1OKJ A;  3DJC A;  3H46 O;  4A2A A;  3I56 N;  4BEB A;  4NO7 A;  5JLH A;  3H3N O;  4AF1 A;  3ULE B;  1V4T A;  3CCV N;  3E9O A;  3TTC A;  4IJA A;  3OW2 M;  5GIN A;  1K8A O;  5EVZ A;  3AY9 A;  3MWT A;  1Q81 O;  1TUY A;  3NMU A;  3GL1 A;  1M1K O;  4K42 A;  5MLC Q;  2ASP A;  4BEC A;  3QDK A;  1NGF A;  2A5X A;  3VGL A;  3VOV A;  2PFU A;  5LJV A;  4BR2 A;  3BF3 A;  4BG9 A;  3J7Z O;  2IVP A;  1GLB G;  4JHD A;  4BRH A;  1Y64 A;  4YDU C;  5TKY A;  1GLC G;  5ADX A;  1HPM A;  3WXL A;  5LJW A;  3MCP A;  4WYB A;  4HTL A;  1XUP O;  4FO0 A;  3G4S N;  3FZF A;  3MCA B;  2P9U A;  4A57 A;  1DGK N;  4EHT A;  3QB0 A;  4J8F A;  2HBM A;  4RWT A;  5DM6 L;  4ILG B;  2NRT A;  4F9O A;  1Z6R A;  2CH5 A;  2D0O A;  4MO5 A;  3DXK A;  1JCE A;  3FE1 A;  5AQJ A;  4B1U B;  1HX1 A;  4B9Q A;  4MLE A;  1ZBS A;  2FSN A;  3GE1 A;  3MX5 A;  3WEE B;  1YI2 N;  3E1Y A;  3QBW A;  4O5F A;  3HI0 A;  4IZ9 A;  1E4F T;  1C0F A;  1K9M O;  1NGH A;  3CC2 N;  2ITM A;  1U2V A;  2HF3 A;  1MWM A;  2ZGY A;  3MN9 A;  2E88 A;  2V7Y A;  3HTV A;  1KXP A;  4JN4 A;  4EHU A;  4FWL A;  5AQO A;  5AQU A;  1O13 A;  2E2O A;  3KK7 A;  3G25 A;  4DHY A;  4Z94 A;  1K8K A;  1ATN A;  4IEI A;  3Q7B A;  3CC4 N;  1DEJ A;  3EE8 A;  2Q1N A;  2E2Q A;  3VER A;  5HOO A;  4H0P A;  1U6Z A;  2V7Z A;  1KAZ A;  3MX2 A;  2P9L A;  1VQ5 N;  2ZJP L;  2FF6 A;  3CJ9 A;  5AQI A;  1XC3 A;  4A2B A;  1MWK A;  4BRA A;  3ZX0 A;  4PHT X;  2QW9 A;  2WFB A;  3O08 A;  3RVC A;  3MN6 A;  4FWO A;  3D7E O;  2OAN A;  2HMP A;  3SBG A;  4H03 B;  4B1X B;  3EL2 A;  2OTJ N;  5E84 A;  3UE5 A;  3CMA N;  3FZH A;  2KLA A;  3E9P A;  4H0O A;  4NLB A;  5AQR A;  1NLV A;  4IFE A;  1N8R O;  4FPA A;  3WQU A;  2P9S B;  1RDU A;  3G71 N;  2GEM A;  5AQK A;  2GEL A;  2YX6 A;  3SAH A;  2WUS A;  3O1W A;  3DLL L;  3TTD A;  4LC9 B;  1YF5 L;  3VGM A;  4BGA A;  4BR5 A;  1GLA G;  4CZL A;  5B8H A;  2ZJR L;  4QS7 A;  4KBO A;  4C1N K;  4CD3 A;  4H5V A;  5CE3 A;  1Q7Y O;  4AM7 A;  4YOV A;  3VES A;  3U4L A;  5F1X A;  3UKR A;  4WFB L;  1IG8 A;  1P90 A;  4NB4 A;  4YOW A;  3L0Q A;  3EO3 A;  5GAE P;  3WUH A;  4H5T A;  2D1K A;  2Q36 A;  1X9J A;  4BRG A;  2YJE A;  1VQ8 N;  5AFU A;  3ZYY X;  2DPN A;  2FF3 B;  1GLD G;  1QQN A;  4H0X B;  3CCM N;  3H1Q A;  5M1F A;  3VTH A;  2P9K A;  3LM2 A;  3ID8 A;  1XQS C;  4H5R A;  3BUZ B;  1E4G T;  2KHO A;  4E1J A;  2BUP A;  3ZX2 A;  3N4Q A;  1HKG A;  5AQZ A;  2Q97 A;  3MDQ A;  4BGB A;  3HOT A;  2E1Y A;  2J4R A;  3UKR B;  1ATS A;  3G6E N;  4BC3 A;  4WQ5 A;  2QWL A;  2VGM A;  3M1F A;  3O4W A;  5F2R A;  1VQM N;  2ZWH A;  2QTD A;  4FOE A;  4H0V B;  1BO5 O;  4PKG A;  4BRC A;  4BVP A;  3H3O B;  5BRD A;  3D2E B;  4AM6 A;  3PIO L;  3U8X A;  4C23 A;  2PBD A;  2ZF5 O;  3EKU A;  1JCG A;  3AAP A;  3CQY A;  3F5T A;  3KWI A;  4BRP A;  5DM7 L;  4CD1 A;  4JEP A;  3L6Q A;  3ZEU A;  1GLL O;  2NRX A;  3A5L C;  2QI2 A;  3MN5 A;  3OHR A;  3T69 A;  3B8A X;  1NGD A;  3WXK A;  5GIO A;  3UKU A;  4QS9 A;  4WQ4 C;  3ZET A;  4JKG B;  2P9I A;  4NLC A;  5C15 A;  2QEX N;  4BVO A;  5BN9 A;  3SJH A;  5AZJ A;  4A59 A;  5BRF A;  1KC8 O;  3TTF A;  3WQT A;  1SS6 A;  4CZE A;  4CZG A;  2Q0U A;  4RCH A;  3BF1 A;  1ILY A;  1TYQ A;  1YXQ A;  3O80 A;  5HL7 L;  1W2B M;  4I6M B;  5AR0 A;  5KQD A;  3DAW A;  3HBT A;  4WFN L;  4WCE L;  3CCE N;  1R59 O;  3ZEU B;  3NVK A;  3IDH A;  3P39 A;  4H0T B;  2AA4 A;  3VEY A;  3CHW A;  5BRH A;  3CD6 N;  3LDP A;  4BRI A;  2ASO A;  2V52 B;  2GTD A;  4CBX A;  2H3G X;  2I7P A;  3C6A A;  5E26 A;  1GLJ O;  1QZ5 A;  4ILJ A;  5FPM A;  3AAQ A;  3OBY A;  3UB5 A;  5BN8 A;  4CZH A;  3K9J A;  2YHW A;  4M7X A;  3I8B A;  3FZK A;  3CCJ N;  1T3V A;  5I9E B;  3E66 A;  1YAG A;  5ELZ A;  4WF9 L;  4B1Y B;  3M5R A;  3D6R A;  4CZM A;  5LY3 A;  1MDU B;  4YOR A;  1BUP A;  1HJO A;  1TUU A;  2WBN A;  3I55 N;  1QVG M;  3O9R A;  2VCP A;  5EY4 A;  3D2F A;  3SK3 A;  2A40 A;  4JHD B;  1NWK A;  2ASM A;  4EIA A;  5C10 A;  1VQN N;  4ISG A;  2Q31 A;  3QIC A;  1YJ9 N;  3CJ7 A;  2RHK A;  2HBJ A;  2Q2R A;  4JD2 A;  1WOQ A;  2P9U B;  3QML A;  4JKA A;  4H0Y B;  3J8A A;  3KWG A;  1VQO N;  1LOT B;  1NGJ A;  2P9P A;  3TSQ A;  4CBW A;  5H1S Q;  4G9Z A;  4FWS A;  3TU5 A;  2Q0R A;  1CZA N;  1HLU A;  3LM9 A;  3CF5 L;  5JLF A;  5KPT A;  3O1B A;  3DXK B;  5JVH L;  1NGB A;  4OPA A;  4CZI A;  4XH4 A;  4PKH A;  4EAH D;  4O8U A;  5AQX A;  2F7T A;  1NGG A;  3A8Y A;  1S22 A;  5AQV A;  2YI1 A;  2A42 A;  3QFP A;  3FFK B;  3CCU N;  3ZX3 A;  4MDB A;  1U2V B;  1IJJ A;  1S72 N;  4BG8 A;  1QVF M;  3MN7 A;  1YIJ N;  3O8M A;  4H5N A;  1VAZ A;  3MWP A;  2P9P B;  3I33 A;  4JAX A;  2VWB A;  5JIC A;  1K8K B;  2WC9 A;  3HRG A;  4BRN A;  2QM1 A;  3O9Q A;  4UY8 O;  3R9P A;  4JKB A;  4FWK A;  5C2D A;  2P9L B;  2QA4 N;  5AQF A;  4H5W A;  3QBX A;  5BR9 A;  5F0X A;  1Q86 O;  4BC4 A;  5BPM A;  5JVG L;  4JKE A;  2JWL A;  3GOI A;  3ATU A;  3VMF B;  1S3X A;  2NRW A;  3ENH A;  3FZM A;  2IVO A;  5GAH P;  3C6H A;  4FWM A;  3DWL A;  2CGK A;  4U67 L;  4YOU A;  3WXI A;  1EQY A;  2D0P A;  4L3Q A;  3O9S A;  1DT9 A;  3KZB A;  3IMX A;  1H1V A;  4JKC A;  1KAY A;  2CGL A;  5AQT A;  4JNE A;  3C7N A;  4ISE A;  3VF4 A;  2VYP A;  4FWR A;  4DQ8 A;  3T7Z A;  5M1P A;  4CJ7 A;  2GUP A;  3R8E A;  3PIP L;  3N4P A;  3A5N C;  2W40 A;  2JWK A;  4M63 C;  4XJX A;  3MMV A;  3O9U A;  3W0L A;  4YOX A;  4MDA A;  3EZW A;  1HUX A;  1QQO A;  2A41 A;  3A0I X;  3A5O C;  3AGR A;  4JK7 A;  1BWF O;  4OPH A;  3VPZ A;  4R79 A;  1BDG A;  1NJI O;  1NMD A;  3ENO A;  3VGK A;  5M1K A;  4BY9 C;  4RTF D;  4C1N I;  3CIP A;  4GV6 A;  4BRO A;  2CH6 A;  3WXM B;  2W00 A;  1W97 L;  2F9W A;  1JJ2 M;  1K73 O;  5ADX H;  3EE9 A;  3CQX A;  2QWO A;  1T6D A;  3OA9 A;  5AQQ A;  1YJW N;  3L4Q A;  3CJB A;  1YIT N;  2HF4 A;  2PAV A;  2W41 A;  2BH1 A;  2P9K B;  2A6A A;  3LDL A;  4BR9 A;  1YHQ N;  2D4W A;  3ID6 A;  4BRQ A;  3VEX A;  3FR0 A;  4JKH A;  2OTL N;  3S41 A;  1G99 A;  5FPN A;  4FOI A;  4BRF A;  3LDQ A;  2E2N A;  1YVN A;  4ISF A;  4KH5 A;  2HBK A;  4CZJ A;  4GVE A;  3CCQ N;  3F9M A;  4WQ5 C;  3R1X A;  5AQY A;  3WXJ A;  4GNI A;  1QZ6 A;  5KPR A;  4QS8 A;  1J6Z A;  4GY2 B;  4CZK A;  4KH6 A;  4A5A A;  2EWS A;  5M1Q A;  3P4I A;  5AZI A;  1NGC A;  2FXU A;  3A5M C;  5JMV A;  5KPZ A;  3PLA A;  4BQL A;  4BR0 A;  3CPE A;  1WUA A;  3ATV A;  3R6M A;  4EFH A;  3CXC M;  4BC2 A;  3FLC O;  3UKU B;  1NM1 A;  1C0G A;  3ZET B;  2P9I B;  2QXL A;  3VEZ A;  4IOA L;  5AZJ B;  1VQL N;  4YDU A;  3O6W A;  3VEN A;  4BQZ A;  2P9N A;  4MLH A;  4FWQ A;  3FGU A;  3JS6 A;  1TYQ B;  2NZT A;  1X3N A;  3CPW M;  1KAX A;  4CZF A;  3LDO A;  4JKF A;  4YOT A;  1ZXO A;  5AZI B;  3SMP A;  3U9Z A;  5FPD A;  5AQL A;  2GWK A;  4BC5 A;  1RFQ A;  4B1W B;  1SQK A;  5EOY A;  2C1I A;  4BRE A;  5GIP A;  1MA9 B;  2RE2 A;  1KQS M;  3Q7C A;  2E8A A;  3HZ6 A;  3R3L A;  3WEE A;  4YOY A;  1Q18 A;  5AQP A;  2NRV A;  4A61 A;  3LDN A;  1VQ7 N;  2C1G A;  1Z05 A;  3VEO A;  1V4S A;  3VTI A;  4A5B A;  2QWQ A;  4K43 A;  3WT0 A;  2P9N B;  5BRE A;  2HST A;  3QFU A;  4XH1 A;  5EX5 A;  3L4I A;  4KH4 A;  1DKG D;  3LL3 A;  3HSC A;  3TSU A;  2NRH A;  1OVY A;  1BOT O;  2NNW A;  4ILH A;  5AFU H;  4IDH A;  3H6E A;  3CCR N;  3VEV A;  2IVN A;  4JK9 A;  3P38 A;  3O5B A;  2BTF A;  4M7Y A;  3D2F B;  3JXU A;  3CME N;  4B1Z A;  3VET A;  2F9T A;  3W3D A;  4BR7 A;  3IKM A;  4BRD A;  2UYT A;  3OBW A;  4MO4 A;  3VF2 A;  4BR4 A;  2E1Z A;  3KVG A;  2V51 B;  5C2F A;  4K41 A;  4BRL A;  4JD2 B;  1RGI A;  2IIR A;  1NBW A;  1T44 A;  4IO9 L;  4PL8 A;  3VF6 A;  3TPQ A;  4PKI A;  4FVU A;  3GBT A;  4DCH A;  4IJN A;  2HOE A;  5GAG P;  2P9S A;  3H1V X;  3CJA A;  5KQ8 A;  2ZGZ A;  3O9T A;  4JKD A;  3CCL N;  1ZC6 A;  3IUC A;  3NVM A;  1VQ4 N;  3DXM A;  4FPB A;  5AQN A;  4IEE A;  3EKS A;  3TSP A;  4FL9 A;  3E9L A;  2ZJQ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...