1TYQB

Crystal structure of arp2/3 complex with bound atp and calcium
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
208
structure length
208
Chain Sequence
VLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
molecule tags Structural protein
total genus 57
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2004-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1tyqB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1tyqB02
5LJVA 5KPRA 3RSEA 3A5LC 3WXKA 4B1WB 2ASPA 3ULEB 4H5TA 3FLCO 4BRLA 5EY4A 4DCHA 1NGBA 5AQLA 1QZ6A 1JCFA 4B1VA 1NGFA 2P9LB 3ZX3A 2QWNA 4YDUA 5BR9A 2GTDA 4E1JA 1BWFO 2VWBA 1D4XA 1NGHA 4MO5A 4BRCA 2CH6A 1BDGA 4EHUA 1CZAN 5ADXH 1HUXA 1NLVA 5AQHA 1MDUB 3R9PA 3ENHA 4BROA 1NM1A 4YDUC 1XUPO 3ZEUA 1NGDA 2E2OA 3A5OC 2UYTA 5B8HA 5AQGA 1SQKA 4O8KA 4F9OA 1RFQA 3D2FB 3H45C 1IG8A 1HJOA 3HM8A 2QXLA 5FPNA 4H0XB 3MCPA 5EX5A 4KBOA 3DWLA 2P9IA 1BUPA 4FO0A 3MN9A 1ZXOA 2P9LA 2V52B 5AQMA 3VEWA 3SMSA 3HBTA 2A42A 4LC9B 4B1XB 2NLXA 2GELA 2F9TA 4BQZA 4FPBA 5E26A 4EFHA 4BR0A 4CZGA 3LM9A 4C23A 3GOIA 3UE5A 3D7EO 4EAHD 5KPTA 4WYBA 4BGAA 1TUUA 3VEZA 2YI1A 3CI5A 1ATRA 5BN9A 1QQOA 3QDKA 3CHWA 3CETA 2A41A 3A5MC 5AQTA 2E2PA 3WQUA 3CJ9A 4A2BA 5AQXA 4B1ZA 4BR2A 2FF6A 2P9SB 1KXPA 3HTVA 4JN4A 3O8MA 5KQ8A 1E4FT 1YAGA 3A0IX 3I33A 4JD2B 3ID8A 4CZHA 1GLCG 4XH1A 3VF2A 2ZGZA 1NGEA 5AR0A 4IO8A 1C0FA 3JXUA 1QQMA 3EKUA 4IWVA 1ATSA 2AA4A 3QBXA 3AARA 4BRDA 4BRKA 2YJFA 4CD3A 3ATUA 4HTLA 3RSEB 4H0OA 3R6MA 1KAYA 2A5XA 4QS7A 3OHRA 3QICA 4MLHA 2ASMA 2A6AA 3QFPA 3DXKA 5AQOA 4ISGA 5JLHA 5AQKA 2GUPA 1S22A 4FSVA 4IJAA 3BUZB 1GLAG 4K43A 2I7PA 3LM2A 2Q1NA 5AQUA 1TUYA 3IFRA 4JD2A 5AQNA 3CQXA 5AFUH 2ITMA 4DQ8A 3L6QA 5LY3A 2YHYA 2FSKA 1V4TA 1GLDG 3VEOA 1ZC6A 4GNIA 2D0PA 4AM6A 3VF4A 4QS8A 2Q36A 3ZX2A 4IZ9A 2E1ZA 3MMVA 3IDHA 3GL1A 2HF3A 2IVPA 4FWPA 4BRMA 2Q0RA 2E20A 1QQNA 3CJAA 3CJBA 1GLBG 5EOYA 4FWQA 2VYPA 1WOQA 1NGAA 4ISEA 4B1YB 2P9IB 4CBUA 2YHWA 1U6ZA 2IVNA 4H5WA 5ELZA 2QWMA 4BRFA 4FWOA 2P9PA 4K41A 4BR7A 2ZF5O 2A3ZA 4CZIA 1X9JA 3VETA 2H3GX 4FWKA 2E8AA 2V7YA 4BR5A 4CZMA 4AM7A 4H0PA 5AQRA 3O1BA 2QM1A 3QMLA 3G25A 2D4WA 1KAXA 4MO4A 2P9NA 3LDPA 2W41A 3ZX0A 5BRHA 2FXUA 3P4IA 3FZKA 4H03B 3A8YA 1HKBA 1H1VA 1KAZA 4BQLA 2CGKA 1BG3A 3CQYA 2QWRA 4BC2A 1HLUA 3ATVA 5AQZA 4JNEA 5AQWA 5BRFA 4BR4A 3DJCA 5FPDA 2PBDA 4FOEA 2D1KA 3AAPA 4BRQA 2ZWHA 4DHYA 2E2NA 4XH4A 5EVZA 4JHDB 2QWOA 1E4GT 4BRNA 5EXWA 3GE1A 4BRPA 4CZJA 1T6DA 5BN8A 3AAQA 3DXKB 4CI6A 3CERA 4IXCA 4FWNA 4IJNA 3R8EA 1WUAA 3QBWA 1G99A 3FR0A 3H1VX 2P9UB 2GWKA 2BUPA 3A5NC 4WQ4A 3HSCA 4BGBA 3LDLA 2HOEA 3LDNA 4B1UB 4BRHA 5I9EB 3SMPA 2E2QA 1ESVA 5AZJB 1LCUA 1GLLO 2WUSA 1TYQA 3QB0A 1R59O 5AZIB 3W3DA 4BREA 2NZTA 3H3NO 3TPQA 3EN9A 4K25A 5AQFA 4BC4A 4WQ4C 1SZ2A 3ZETA 4CZEA 4H5RA 4CZFA 3O80A 4JHDA 4FWMA 4H0YB 2V7ZA 3C0BA 3M6GA 3UKRB 1RDWX 3IUCA 4JAXA 3VERA 5FPEA 4EIAA 2DPNA 2Q97A 1GLEG 1NMDA 1K8KB 1Z05A 1P8ZA 3VESA 1RGIA 1HX1A 3LDQA 1SAZA 3L0QA 3U9DA 2EWSA 3WQTA 2HMPA 3M3ZA 3ENOA 2P9PB 2OANA 2QWPA 3SK3A 2P9UA 1JCGA 2Q31A 3WXIA 1QZ5A 3J8AA 3FGUA 5F0XA 2E88A 4H0TB 4A2AA 5JICA 2IVOA 3L4IA 1V4SA 3FE1A 3VGLA 1LOTB 2PAVA 3F9MA 5AZJA 5CE3A 5BPLA 3LDOA 4FWSA 5BPMA 3EO3A 5AQQA 5AZIA 3AY9A 2J4RA 2P9NB 3GDQA 5AQYA 3KZBA 3WXLA 2BTFA 2D0OA 4PKIA 1GLFO 1MWMA 3UKRA 3MK6A 2V51B 2F9WA 3GG4A 2YHXA 2ZGYA 3O6WA 5F2RA 3CJ7A 3DXMB 3CJCA 2YCHA 2W40A 3WUHA 4GY2B 1K8KA 1HKGA 1BOTO 3B8AX 3WT0A 3DAWA 4H5NA 3EKSA 5AQPA 4BG9A 3GBTA 4CZLA 3O08A 4FOIA 4FL9A 5KQDA 2QW9A 1C0GA 4PL8A 1NBWA 3BF3A 3BF1A 4BRIA 3EZWA 3D2EA 4RCHA 2CGLA 1YXQA 5KPZA 3M1FA 4BVOA 3WEEA 3C7NB 4PKHA 3VEVA 5ADXA 2HF4A 3FZHA 4I6MB 1GLJO 3LL3A 2FSJA 3H3OB 3JS6A 4CZKA 3MN5A 3FZMA 4O5FA 4WQ5A 4Z94A 1NGGA 3DXMA 3IMXA 5AQVA 1QHAA 4M63C 3S41A 5E84A 3MDQA 4A61A 4EHTA 1NWKA 1T44A 1Q18A 1TYQB 4BC5A 4B9QA 5F1XA 1T6CA 1EQYA 4FWRA 1U2VB 5TKYA 4WQ5C 1BO5O 3SLCA 4QS9A 4RTFD 3ZETB 2YJEA 1Z6RA 1J6ZA 3ULEA 1BA1A 3U4LA 1DGKN 3BEXA 5AQSA 3CIPA 1X3NA 3BP8A 2KHOA 2QWQA 4PKGA 1JCEA 2VCPA 3EL2A 4FPAA 4CBXA 3C7NA 4L3QA 4I6MA 3H6EA 1S3XA 3O5BA 1NGJA 3VEYA 1ZBSA 4Y0WA 2GWJA 3VGKA 4BG8A 3UKUB 2P9KB 2NRHA 1BU6O 2ASOA 1YUWA 3KHYA 1YVNA 1U2VA 1X3MA 4M7XA 3VOVA 3CJ1A 2FF3B 3VF6A 3VEXA 1HPMA 5FPMA 4NO7A 1BA0A 4BVPA 2I7NA 1IJJA 2E1YA 2IIRA 3D2FA 4PL7A 4H0VB 3HZ6A 4HWIA 4BRGA 3TU5A 1XQSC 2CGJA 3O4WA 5AQJA 4BRAA 2Q0UA 3MN6A 4XH5A 3HI0A 3VENA 1NGCA 1XC3A 1DEJA 4DB3A 1MWKA 4H5VA 4M7YA 1OKJA 5BREA 1DKGD 2Q2RA 1Y64A 5AQIA 3U9ZA 3VPZA 4BR9A 3UKUA 2P9KA 2FSNA 3VGMA 4CD1A 2CH5A 4XEIA 5AFUA 3WXJA 4CBWA 4J8FA 4RWTA 5JMVA 3H1QA 3W0LA 2A40A 3D2EB 3SJHA 2P9SA 3QFUA 3WEEB 2AP1A 5JLFA 2FLOA 3H46O 4FWLA 4MLEA 3U8XA 3O1WA 1MA9B 1HKCA 5BPNA 4ISFA 4BC3A 1NGIA 4NB4A 4K42A 3UB5A 4CJ7A 3FZLA 4A62A 2QWLA 3FZFA 3I8BA 1ATNA 2GEMA 3FFKB 5BRDA 3ZEUB 5LJWA 3KVGA 3MN7A
chains in the Genus database with same CATH superfamily
1JKHA 1W0HA 3A5LC 3IRXA 5IWAK 2ASPA 3FLCO 3L2UA 4CEEA 3VTIA 4B8CA 1N8RO 3LP0A 1QZ6A 1QE1A 3HVRA 1LW0A 3T1AA 4B1VA 2QWNA 3AA4A 4FK2A 1BWFO 1NGHA 3AVIA 3HT3A 1W9HA 4BRCA 3ZSQA 1I3AA 2G8HA 4EHUA 4MDAA 4JI0K 1CZAN 4X65K 1MDUB 3ENHA 4QCLA 3AA2A 4ELTA 5HRRA 4LH5A 4CJUA 3OYBA 4OLBA 3TAQA 1RFQA 4CF0A 1IG8A 4KO0A 4H0XB 3MCPA 5FLXO 1WBBA 3EE8A 3DWLA 3G4SN 1K9MO 4FW1A 4I7FA 4GW6A 1KLMA 4DS4A 5CYQA 1A5XA 2F9TA 1U48A 4RW7A 1A5WA 4DTXA 5E26A 1J9AA 3L3UA 3SAFA 1REVA 2RHKA 1B9DA 3AVLA 1NK9A 3VEZA 5KGXA 4KI4A 3NVMA 4XIUA 5BN9A 5AQTA 4CEFA 3A5MC 1YIJN 4X64K 2P9SB 3DLLL 3SQ4A 5KQ8A 1BIUA 2W6KA 4F8RA 3ID8A 2UXBK 1GLCG 4XH1A 1C1CA 3O9RA 2ZGZA 3HPGA 1RTDA 4NCAA 4JKGB 3K5MA 1QQMA 3DLGA 4GV6A 1ATSA 2FBVA 4BRDA 4BRKA 4ELVA 2XHBA 3NGYA 1L3TA 3ASMA 4C8OA 5TKWA 4LH4A 3G0ZA 1KFSA 2DTUA 5M1KA 3OVNA 3BUZB 4K43A 4CJVA 1EETA 4AHSA 5GIOA 3P31A 2VWJA 3SBTA 2ITMA 4I2PA 2FSKA 1BIZA 1V4TA 4FZXC 2YNIA 1RDBA 3C65A 3OTOK 2ATQA 4QS8A 2D0CA 3M8RA 2HHTA 3F2KA 1W97L 4KRFA 2E1ZA 2QK9A 3GL1A 3DMJA 4B3TK 4CJSA 2HB5A 2Q0RA 4TSXA 2E20A 1S1XA 1QQNA 1X9SA 3CJAA 3CF5L 1GLBG 5EOYA 2DFHA 1RTIA 3ZT1A 2VYPA 4FJ9A 1HPZA 2P9IB 1VHXA 3F9KA 4O0IA 4H5WA 3EY1A 4E7HA 3VA0A 4CJ3A 5ELZA 4CEOA 2GBZA 4FWOA 3TABA 2O8EB 3THYA 2ZF5O 1X9JA 1HQUA 3VETA 2KFNA 3V9SA 4NLCA 4YOUA 4AM7A 4H0PA 5AQRA 1WAFA 4JI2K 3PV8A 1Q8IA 1QTMA 3G25A 2HHHK 2I5JA 2D4WA 1QQCA 2P9NA 2PFUA 3LDPA 4ICLA 1N32K 3P4IA 1RT2A 3AVHA 5HOOA 4YOWA 2OZSA 1HKBA 4IKFA 4BDYA 5KI6A 3CC7N 5AQWA 4DTOA 4OKJA 4BR4A 3DJCA 4DTNA 1RBUA 4DHYA 3ZT2A 3K59A 4LFAK 4CFBA 5BN8A 4BE7B 3AAQA 3DXKB 4DFPA 3S5TA 4FWNA 2YHAA 4I9QA 2F8TA 3QBWA 3TTCA 4K8XA 3QEPA 5C0YA 1BHLA 3H1VX 2P9UB 2OPQA 1R0AA 4UY8O 2OPRA 4BGBA 2HOEA 3LDNA 1ZBFA 3SMPA 2E2QA 5BR8K 1LCUA 1VQ6N 4B9SA 1R59O 2HVIA 5AZIB 3M8QA 2O8CB 3TPQA 3ZETA 4FJ8A 1C1BA 4H0YB 3C0BA 3M6GA 3JSMA 3OW2M 2O8FA 3IUCA 5JS1A 2E4LA 3AA5X 4EIAA 2DPNA 3RMDA 1GLEG 3HJFA 3QESA 4KH4A 2YKNA 2D5RA 1NK8A 2KW4A 3L0QA 2O8BB 2HMPA 3K2PA 2P9PB 2QWPA 2Q31A 1QZ5A 4BDZA 3KIOA 1HRHA 4IEIA 4A2AA 1HYZA 2IVOA 5JICA 3F9MA 1QVFM 4WE1A 3BZCA 1VSFA 3AY9A 5C10A 4IDHA 5AQYA 1HNZK 4E7IA 4WFAL 3MX2A 1LW2A 1NK5A 4PKIA 1GLFO 1RDCA 3E1YA 1M1KO 3MK6A 2HHIA 3O6WA 1NOZA 3DXMB 3CJCA 2YCHA 3WUHA 3ZSZA 1NU0A 4WFNL 1RTHA 4ZTJA 4DU1A 4BG9A 3GBTA 4CZLA 3PX6A 3VQ6A 2QW9A 3C6UA 2KLAA 3VQ9A 5A2QO 2UU9K 1Q7YO 3CPEA 4DSFA 4Y1DA 2CGLA 3VTHA 3MXMA 5KPZA 4DF4A 3M1FA 4ZHRA 3QEVA 1RT6A 2HF4A 3SUOA 1W2BM 3H3OB 4CZKA 3CCMN 3TSQA 4N47A 4OLAA 5AQVA 1QHAA 4M63C 3KD5E 5E84A 1KQSM 5M1OA 1NWKA 4M3TA 1TYQB 1T6CA 4QAGA 3THVA 4IG0A 5JVGL 4RTFD 1JJ2M 5GIPA 4JYAK 3ULEA 4CJQA 2OCEA 2FBYA 3DLKA 1Q9YA 3CIPA 1Q81O 1F21A 1EKEA 2VWKA 2KHOA 1CXQA 5HL7L 2JGUA 5CZ2A 2DFFA 3C7NA 3LP2A 4L3QA 4JK9A 2VQFK 4FJGA 3H6EA 4B9TA 3HOSA 3G71N 2OTJN 1NGJA 4J2DA 4B8AB 3AO1A 2QXFA 1VSMA 3G10A 3UKUB 3HSTB 4Q5VA 4KHYA 2HHSA 3LANA 3ZLJA 1X3MA 3L4QA 4R79A 1NMNA 1S1UA 2YV0X 5FPMA 2C1IA 4CJ5A 4FJHA 4DV2K 5I3UA 4C8NA 4H0VB 2VGNA 4H4OA 4HWIA 4IBNA 1HNWK 3TU5A 3TAFA 4E19A 3OS2A 2F8SA 2XRIA 2Q0UA 5DM6L 1X9WA 1NNEA 1XC3A 1SKSA 4H5VA 5M1NA 3ZT4A 2Q2RA 3VPZA 3HP9A 4FLVA 3SPZA 2CH5A 2UUAK 5JMVA 3H1QA 3W0LA 4CJ4A 1RNHA 2XY5A 1S5JA 1EX4A 2FLOA 3K9JA 1NJXA 1IKXA 4E72A 1HKCA 5GINA 3ALYA 4K42A 1D9DA 1VQ4N 1TKTA 4LSLA 4A62A 2PY5A 4DTUA 2WFBA 5C42A 3SQ1A 3QETA 4JKHA 5LJWA 2Q3SA 5F2RA 4CHZA 5FROA 5LJVA 3PX4A 5KPRA 3RSEA 3B6PA 1J5OA 3WXMB 4B1WB 2A1SA 2YNHA 3LDSA 1L3VA 4BRLA 5EY4A 4CHQA 4B3MK 4B3RK 5AQLA 3J7AP 1RBVA 1ASUA 1RT5A 1NGFA 1TV6A 4AF1A 3ZX3A 4B08A 1RT3A 3AVNA 5SWMA 1XHXA 1QSYA 1D4XA 4YFUA 4FLWA 4MO5A 1KC8O 4CGHA 3P38A 2KZZA 3K5OA 4B3OA 4KI6A 4Z4GA 4NLBA 1HUXA 1NLVA 3T7ZA 4BROA 1NM1A 1NJWA 3E9OA 4DLEA 3O3GA 2ZJRL 2RPIA 2DY4A 1NJZA 3V4IA 5B8HA 2O8DB 1U45A 1VSLA 2QKBA 4FLTA 3HM8A 1XMOK 3SUPA 1KLNA 3S3MA 3DI6A 4A59A 1ZXOA 2V52B 5AQMA 5LL6Z 4B1XB 3HPOA 1S6QA 4QOZB 2NLXA 3QEIA 4DG1A 1ZBIA 3S9HA 4EFHA 4F2RA 3CCVN 4KREA 3K5NA 2F4VK 3D7EO 4CGIA 5GADP 1T7PA 1JL2A 3EE9A 4DR1K 4GVEA 4CHNA 2HHVA 3R1XA 1I94K 2NRTA 2YNGA 1QQOA 4A2BA 2A41A 1S1VA 3CJ9A 4B1ZA 1XI1A 2FF6A 1WSHA 2D0BA 3HTVA 4JN4A 2XY7A 4MFBA 4DF8A 4JKCA 3E9PA 1TL1A 3MCAB 4WFBL 4IFVA 1EP4A 4B9UA 3V9XA 5KGWA 1NGEA 5AR0A 3KKSA 4IO8A 1C0FA 3K0SA 3TI0A 5D3GA 4N56A 2QA4N 3QBXA 3TARA 2PYJA 1SKWA 4HTLA 1Q86O 4CEQA 1KAYA 4QS7A 3OHRA 3QICA 3CXCM 4MLHA 5AQOA 3THWA 4DUZK 4BE0A 5JLHA 5AQKA 3FFIA 3TAMA 4B9MA 3NH0A 5E41A 2I7PA 1EXQA 2Q1NA 1TKZA 2G8KA 3OYHA 2XO7A 5AQNA 3THXB 4Z0UA 1BISA 3M8SA 3L6QA 3OJSA 4AM6A 4KV8A 4CF8A 4DTJA 1K73O 2PYLA 3MMVA 3V9WA 3IDHA 3T3FA 2B6AA 4FWPA 4BRMA 3O9QA 3DYAA 4NXMK 1VQKN 5DMRA 3LPTA 1WOQA 1WN7A 1NGAA 3ITHA 3HP6A 4EZ6A 4DR6K 4OPKA 4B1YB 3TAEA 3HOTA 2YHWA 1U6ZA 3KK1A 4FM2A 1IG9A 1XHZA 4BRFA 3F5TA 3T19A 4BR7A 2HVHA 3N4PA 4B9VA 2E8AA 5I42A 3K58A 3NGZA 4ID5A 1W7AA 3TR8A 4OO1J 5BRHA 4M3XA 2F96A 4FCYA 3VN5A 4H03B 3A8YA 3AO2A 2ZM6K 1N5YA 3DRPA 2CGKA 4CFAA 1VQLN 4WCEL 4KHUA 4NYFA 3ATVA 3VA3A 4JNEA 5BRFA 4FZZA 5HRPA 3NGIA 2D1KA 3DOLA 4BRQA 1NK4A 2ZWHA 2RE2A 4GMJB 4JK8A 1E4GT 5HBMA 3VQBA 5J2QA 5EXWA 3GE1A 3NH1A 4Q0BA 1NOYA 4CZJA 1X1PA 3V1RA 2HMIA 3RR8A 2G8UA 3CERA 1S72N 3HM9A 4DLGA 3FR0A 2GWKA 2D0AA 1VSEA 4YOXA 5C2DA 3LDLA 4B1UB 5I9EB 1UWBA 5GAGP 4DR2K 1XNQK 2WUSA 2ZJQL 2FC0A 4Y1CA 3OYAA 4DV7K 4NCGA 3H3NO 4IOXA 3EN9A 3ZSYA 5MLCQ 3VQ7A 2YKMA 4B9LA 4H5RA 3O80A 1CLQA 3L8BA 2C1GA 2V7ZA 1XMQK 1RDWX 4JAXA 3VERA 3ZSOA 4W5OA 1EO1A 1YJNN 2Q97A 3C6HA 4KHPK 1Z05A 4H8KA 1HX1A 2P5GA 2NRZA 4ELUA 3U9DA 3WQTA 3PSFA 3ENOA 1JCGA 3LWLA 3QINA 1RBSA 1NK6A 5F0XA 2E88A 1Z26A 3T69A 3I0RA 4HCCA 1NK0A 3AO3A 2UXCK 3KK2A 3VGLA 1LOTB 2PAVA 4RW8A 5CHIA 5BPLA 3LDOA 1JL1A 4FWSA 5BPMA 4DSKA 1JLCA 5AQQA 5CYMA 4IFEA 1Q9XA 3AGRA 1T05A 1DT9A 3OS0A 1MWMA 2OYQA 1RBRA 3UKRA 1VSDA 3MXIA 2F9WA 3GG4A 2YHXA 2W40A 1YTUA 4JI7K 1WSJA 1ITGA 4CK1A 5LMUK 3RR7A 1C1AA 1WBDA 3B8AX 2B4JA 3DAWA 2GV9A 4H5NA 3EKSA 2E5LK 4K8ZA 4IO9L 1C0MA 4FL9A 5KQDA 1C0GA 1M90O 4HCBA 4JRQA 1VAZA 1XWLA 3MWTA 4BRIA 3D2EA 4RCHA 3Q7BA 1J54A 4M3RA 3O9SA 4BVOA 3WEEA 3PX0A 3C7NB 5ADXA 3VEVA 3VQ4A 3FZHA 2FSJA 2F7TA 3JS6A 5KRTA 3AVMA 3MN5A 4M45A 4DV3K 5DM7L 3QNNA 3FZMA 4Z94A 1U47A 5K14A 4E1NA 4FK4A 4PHTX 4KH6A 3S41A 3VQEA 2IAJA 4A61A 4EHTA 4DR3K 1T44A 2Z1IA 4KHNA 1Q18A 1QVGM 4BC5A 4B9QA 5F1XA 1EQYA 5TKYA 4KB1A 4LF8K 4FM0A 3SLCA 3AVBA 3IG1A 4QS9A 1IBKK 3E01A 1BA1A 4K0KK 1MU2A 3SJJA 4RW6A 1J53A 2VG7A 3BP8A 5J1EA 1TVRA 2QWQA 2VCPA 3MEGA 4EP4A 2ZJPL 3IS9A 1IO2A 2UUBK 1S3XA 4O4GA 3O5BA 3P5JA 2GWJA 3VGKA 4B9NA 4GV9A 4AILC 4R5PA 4IOCL 5FRMA 2BGGA 2NRWA 3KHYA 4Z4IA 1YVNA 1U2VA 4M7XA 5J2PA 4J2AA 4BY9C 3O4QA 3VOVA 3SUQA 3SBGA 1FJGK 4OKEA 3SAGA 1KRPA 3NE6A 1HPMA 1K8AO 4NO7A 1BA0A 1IJJA 2IIRA 4FJ5A 3WNGA 1T03A 4ID1A 4KTQA 3I0SA 4BRAA 1FKPA 1HR0K 1SV5A 3MN6A 4XH5A 3HI0A 1GOCA 4M7YA 5GAEP 3IAYA 1NKBA 1KTQA 4DV6K 3U9ZA 4BR9A 4DQPA 2OPPA 3CMAN 3CQ8A 5AFUA 3WXJA 3SJHA 2BANA 1I39A 2P9SA 4JKBA 1Z25A 2AP1A 1RT1A 3H46O 4ILGB 1G15A 4MLEA 3NF6A 4ISFA 4KHSA 4E7JA 4AQYK 4NB4A 3UIQA 4CJ7A 4M41A 4CHYA 3FZLA 3L2QA 4HUGA 4DU4A 3I8BA 4JKGA 1ATNA 3FFKB 3RVCA 1UA1A 4CGFA 4F3OA 4JK7A 3KVGA 3MN7A 1YHQN 4FJLA 4N41A 2YHBA 3KLIA 2W00A 4H5TA 4OKKA 3AV9A 4DU3A 3KLEA 3CYGA 1ZBLA 1BI4A 2P5OA 3D45A 1NJIO 1WSEA 3SQ0A 4E1JA 4CK3A 1D5AA 1KFDA 5HLFA 3HXMA 3OYMA 1DTTA 2CH6A 3ULDA 1BDGA 4FK0A 4CVNE 1IBLK 4RW9A 5ADXH 3R9PA 3RRHA 4FYDA 4GV3A 3SAHA 3VQAA 4FVUA 4BE2A 2E2OA 4CF2A 1JLFA 1SQKA 4O8KA 2FBXA 4F9OA 1SL2A 3D2FB 3H45C 1HJOA 4FW2A 3OYFA 1IKVA 4OX9K 1JLAA 3OBWA 4KBOA 2P9IA 1HNXK 1BUPA 1WSFA 4FO0A 3NMUA 2P9LA 3SMSA 3CC4N 2FBTA 2A42A 2O8EA 4BQZA 4FPBA 2Z1GA 4NYNA 3TANA 4BR0A 4CZGA 2O4IA 4FJKA 3T1YK 4GKJK 3UE5A 3WNFA 5KPTA 3OS1A 1OVQA 1TUUA 3QEXA 2YI1A 4G1QA 4O5BA 3CHWA 4LF6K 3WQUA 2E2PA 3THWB 3ZSVA 4WF9L 1KXPA 4GVMA 1YAGA 3I33A 4CZHA 3SPYA 3SUNA 4YORA 1E3MA 4JS5A 4OPHA 3O3HA 3MEDA 3LP1A 1P90A 4MDBA 3OYNA 3JXUA 4W5TA 3EKUA 4IWVA 4M42A 4JLHA 2ZD1A 2AA4A 3AARA 4C8MA 4YHHK 4CD3A 3L2WA 2Z1JA 3TTDA 3C94A 5FRNA 1ZYQA 3K57A 1JLGA 4E7LA 2ASMA 5CR4A 2A6AA 2E6MA 4CJLA 3DXKA 5C12A 4YY3K 4J2EA 3NVKA 4ISGA 1S22A 4IJAA 1GLAG 1CXUA 3LM2A 4YOVA 4EP5A 2HBKA 3IFRA 3PUFA 4JD2A 3CQXA 5AFUH 4DQ8A 5LY3A 3SV4A 1GLDG 3VEOA 1ZC6A 3KLGA 3DRRA 3F73A 2D0PA 4IDKA 2Q36A 2W42A 4IZ9A 2ITGA 1HJRA 2O8CA 3ID6A 5FDLA 3RWUA 4CCHA 4DV4K 1L3UA 2HHWA 4FWQA 4CFCA 3A2FA 1DLOA 1L5UA 4ISEA 3I56N 1JXEA 2EHGA 5JENA 2O4GA 3RMAA 2IVNA 3QEWA 5EU7A 1YITN 5KRSA 2HNDA 2QWMA 2O8BA 2P9PA 1RDDA 1WSGA 4K41A 1Q82O 4PWDA 1TKXA 2V7YA 2YNFA 3KD1E 4CZMA 3LAKA 4AH9A 3NCIA 3O1BA 3VQCA 1KAXA 4MO4A 3NF8A 4KTWA 2FXUA 1S1TA 2ZE2A 3P83D 4CF1A 3RMCA 4DQSA 1BQNA 4OVLA 1NK7A 3DLRA 4BC2A 2JLEA 4DS5A 3DLHA 1RCHA 5AQZA 3KK3A 3E9LA 4JEPA 2PBDA 3AAPA 2BDPA 1BL3A 3MWPA 3CCJN 4XH4A 3G6EN 3NDKA 3QIPA 4CJWA 4LFBK 1VRTA 1O13A 4BRPA 4M3YA 1U04A 4DQQA 4IXCA 1TL3A 4IJNA 3R8EA 3PIOL 1WUAA 1G99A 3RRGA 1VQ9N 2BUPA 2KFZA 3HSCA 1WB9A 1VSHA 4IEEA 3DOKA 1B92A 2IS3A 1ESVA 1GLLO 1TYQA 3DLEA 4CECA 3W3DA 4BREA 4K25A 1WLJA 4JI6K 4BC4A 4IOAL 3TTFA 4CJPA 4HUEA 5J2MA 4CZEA 4FJ7A 4CE9A 4JHDA 4JKEA 2WTUA 3Q7CA 3MECA 4Z4CA 4FLZA 3UKRB 5FPEA 1DTQA 4DV5K 3HVTA 4FLXA 1O1WA 4M3WA 5LMNK 4JKFA 1P8ZA 1VQ8N 3CFRA 5GAHP 3OBYA 1RT4A 4CK2A 4EZ9A 5M1QA 3ZSRA 3M3ZA 1RT7A 3L2VA 4L8RB 3THYB 3WXIA 3J8AA 4JRPA 3FGUA 3VQDA 2NNWA 2W6LA 1CZ9A 3ZCMA 5C2FA 4W5QA 5AZJA 3WNHA 1RTJA 3EO3A 4KHQA 3TSPA 1LWFA 4MQ3A 3MAQA 4OJRA 1C0TA 1JLQA 2J4RA 2P9NB 3SV3A 3LZIA 4B3SK 3PLAA 2BTFA 3EEQA 4DSLA 2OZMA 3D6RA 5CY4A 2ZGYA 3CJ7A 4DSIA 1K8KA 2WONA 3VQPA 3TAGA 4ZTFA 2GUIA 1BOTO 3E66A 1N6QA 4ILHA 4DSJA 4E89A 4CEZA 3MXJA 5C24A 1OH8A 3RMBA 2HHQA 3O08A 4Z4HA 4PL8A 3QLHA 4O44A 4AHRA 1YJWN 1NBWA 3BF3A 1TAQA 3BF1A 3EZWA 1TK5A 1YXQA 4DTPA 2HHUA 2HNZA 3S3OA 3LL3A 3JYTA 3I55N 4O5FA 3AO4A 2R7YA 1NGGA 4U7BA 3IKMA 4AHVA 1VRUA 3OYDA 3S3NA 4A57A 4HTUA 5J2NA 3OY9A 2DFEA 1UOCA 1YJ9N 3LP3A 3OYGA 1U2VB 2WBNA 3VMFB 1BO5O 1ASWA 1VSIA 3HPHA 3ZETB 2YJEA 1Z6RA 3BY5A 3CFOA 4KB0A 3DLBA 4I2QA 1LWEA 1DGKN 3BEXA 3AO5A 3KTQA 2O8FB 1IV0A 1IH7A 1JCEA 3EL2A 1GOBA 4I6MA 5M1PA 4CGGA 2IOCA 3LZJA 3VEYA 2OA8A 3T1HK 4LF5K 3MEEA 3KWIA 3PY8A 2NRHA 1BU6O 1BGXT 1EWRA 4FLYA 1OVYA 3J7YP 4G9ZA 4H4MA 4CHPA 2O8DA 3VF6A 1YF5L 1HQEA 1NJYA 4CEAA 2I7NA 1UA0A 3CM5A 4C8LA 5SZTA 4FLUA 3HO1A 2XY8A 3HZ6A 4BRGA 2NUBA 4KTZA 5HP1A 1FK9A 3AVCA 3OYKA 2CGJA 3O4WA 4DFKA 4KFBA 4CJKA 4JI4K 3J80O 3VENA 1LAVA 4IG3A 1MWKA 1K6YA 4CJFA 3J81O 3VQ5A 1DKGD 4HVJA 3L2RA 4KHWA 5AQIA 2P9KA 2FSNA 2WC9A 4A5BA 2ETJA 1VQPN 4CBWA 3NBPA 3NAEA 3CC2N 2A40A 4CJTA 4CIEA 4JI8K 4FJIA 4XJXA 3QFUA 1BI4B 3O9UA 2A1RA 5JLFA 3QNOA 3U8XA 2IC3A 2Y1IA 1MA9B 3RTVA 3SI6A 5BPNA 4BC3A 4FXDA 1NGIA 2HBLA 3UB5A 4LD0A 3FZFA 2GEMA 4CGJA 4OGEA 2HHXA 4ILJA 3LAMA 3WXKA 2UUCK 4LF4K 3ULEB 2P1JA 3ZSXA 3M5RA 4DCHA 1NG9A 1NGBA 1SS6A 2G8VA 1XC9A 1JCFA 2WOMA 3DM2A 3KLHA 2P9LB 5H1SQ 3HYFA 4YDUA 4CGDA 5BR9A 2GTDA 3CYMA 3JAMO 2VWBA 3THXA 3QERA 2VG5A 4JS4A 4PQUA 1EWQA 4CIGA 2XY6A 5AQHA 1LWCA 4YDUC 3LALA 1KSPA 3DRSA 1N36K 1XUPO 1YVUA 2HBMA 3HL8A 3ZEUA 4E3SA 1NGDA 1OH5A 3B6OA 3A5OC 2UYTA 3ZT3A 5AQGA 3D0PA 4OPAA 2X6SA 5JS2A 4LFCK 2QXLA 5FPNA 5EX5A 4DKWA 3OYJA 3LPUA 3MN9A 3VEWA 3KLFA 1A5VA 1ASVA 3HBTA 3ZT0A 4LC9B 2GELA 1QHTA 1RDAA 3ZYYX 4J2BA 3LM9A 4C23A 1NKCA 4O55A 3GOIA 3N4QA 4EAHD 4FJNA 3P39A 4WYBA 2NRVA 4BGAA 3PO5A 3CI5A 1ATRA 3QDKA 1C0UA 1Y97A 3CETA 3CCQN 5AQXA 4BR2A 1VSKA 4OPJA 3AVJA 3O8MA 1E4FT 4YOTA 4CJEA 2HSTA 2OPSA 3A0IX 2KZMA 2KKZA 4JD2B 4DWIA 3VF2A 4I9LA 4O0JA 1TK8A 4LF7K 4DV1K 3K5LA 2VG6A 2YJFA 3V6DA 3ATUA 3RSEB 4H0OA 4YNQA 1RDUA 3R6MA 3PSIA 1LAWA 2A5XA 4BEBA 4X62K 2JWLA 3U3GA 1KVCA 3OA9A 3QFPA 1LV5A 1HMVA 1VQON 4U67L 2GUPA 2IDOA 4KKOA 4FSVA 4CW7B 1VSJA 5AQUA 1GOAA 1WNSA 3EYZA 2KTQA 1TUYA 2RN2A 4CEBA 1CZBA 3TWHA 1QSSA 2YHYA 3CFPA 4GNIA 3VF4A 3V9UA 1QS4A 4PUOA 1TK0A 4DUYK 3ZX2A 4DSEA 2YX6A 1IKWA 2E6LA 2HF3A 2IVPA 1JLEA 3SQ2A 4CHOA 4FZYA 4BDPA 4DV0K 2HBJA 3CJBA 4FM1A 4DTSA 1XNRK 4AHCA 3J7ZO 3EZ5A 2ZQBA 3CCRN 1X9MA 4CBUA 1VQ7N 2X74A 3ISNC 4KPYA 4DFJA 3M8PA 4DMNA 4NCBA 1TGOA 3AVKA 2A3ZA 4CZIA 4JI3K 1U49A 3C95A 2H3GX 4FWKA 4LSNA 4BR5A 4FVMA 4DR7K 1VQMN 2QM1A 3NH2A 3NFAA 3QMLA 3KWGA 4CF9A 3VQQA 1YTAA 2W41A 3ZX0A 3OYIA 3OJUA 3CCSN 1VQNN 2KQ2A 3FZKA 3HRGA 3WNEA 1H1VA 1SKRA 3U6FA 1KAZA 3LWMA 4C1NK 3SCXA 4BQLA 4KH5A 4DR4K 2GX9A 1BG3A 3CQYA 2QWRA 1HLUA 4KAZA 1N33K 4PA1A 5FPDA 4FOEA 2X78A 4AHTA 4W5NA 4X66K 3AVFA 5HRSA 2E2NA 4AHUA 4DR5K 5EVZA 4JHDB 4M3UA 2QWOA 2VQEK 4BRNA 4V19S 3SNNA 3CCLN 2NRXA 3OYCA 1T6DA 1BCMA 4CI6A 5HROA 1SL0A 2QKKA 1ZBUA 1HNIA 3CPWM 2BH1A 2G8WA 2HW3A 2RKIA 3A5NC 4WQ4A 5M1FA 1S6PA 5C15A 3V1OA 4BRHA 3ZSWA 5AZJB 3CM6A 3QB0A 4JI5K 3U3YA 4F4KA 2NZTA 4Z4EA 5AQFA 2UXDK 3R3LA 1SZ2A 4WQ4C 1N34K 4DTMA 4CZFA 4FWMA 2BE2A 5JVHL 1NMDA 2G8FA 1K8KB 3VESA 4UQGA 1RGIA 1ILYA 2LSNA 1HYVA 4NXNK 3LDQA 1SAZA 4CEDA 2NRRA 3QO9A 3ENBA 1BCOA 2EWSA 1D9FA 2OANA 3SK3A 2P9UA 4F3TA 3QIOA 4H0TB 1TAUA 3L4IA 1V4SA 3FE1A 3CCUN 5CE3A 2B5JA 4DQIA 4CIFA 1J5EK 5AZIA 4E0DA 2Z1HA 5DK5A 2IGIA 4JKDA 2QEXN 2HNYA 3GDQA 3KZBA 3WXLA 4GKKK 4N76A 2D0OA 3PIPL 2V51B 1VQ5N 3KK7A 2OTLN 4HHTA 1S9EA 3CCEN 2JWKA 4GY2B 1YT3A 2PZSA 1HKGA 1U4BA 3OYLA 4CERA 3V81A 2X6NA 2QTDA 3WT0A 5KTQA 5AQPA 3VQ8A 4FOIA 1RILA 3AA3A 1TKDA 3C6TA 1D8YA 3KKRA 4E1MA 5AJ3K 3P1GA 1OH6A 1JLBA 1JXBA 4C1NI 3TAPA 3BZKA 4PKHA 3C6AA 1GLJO 4I6MB 4BE1A 3V9ZA 3L3VA 1FW6A 4WQ5A 4JI1K 1S9GA 3DXMA 3IMXA 5C25A 3CD6N 1FKOA 4DQRA 3MDQA 4FJJA 1BQMA 1WSIA 1YI2N 3O4NA 2QI2A 4FWRA 5CZ1A 1IBMK 4F2SA 4WQ5C 3H08A 3I8DA 1J6ZA 3U4LA 3O3FA 5AQSA 4CFDA 3K9KA 4HUFA 3AGKA 4BECA 1X3NA 4M3ZA 4PKGA 3NHGA 1WAJA 4CJRA 3V1QA 1T8EA 4YOYA 4FPAA 4CBXA 1HNVA 3MX5A 3CG7A 1ZBSA 4Y0WA 2EX3A 4BG8A 3TSUA 2P9KB 4CESA 2G8IA 3PO4A 2ASOA 1YUWA 4LY7A 4RW4A 3BDPA 1SUQA 1KCFA 4BWJA 3OYEA 4Z4FA 3CJ1A 4DFMA 2FF3B 1FXXA 3VEXA 4BVPA 3AVAA 3KJVA 4PL7A 2E1YA 3D2FA 4OGCA 3O9TA 2VGMA 1C6VA 1QSLA 1KVAA 2Y1JA 1XQSC 5AQJA 5T7BA 4IFYA 4PY5A 1NGCA 1DEJA 4DB3A 2P51A 1OKJA 1KVBA 4RG8A 5BREA 1T3VA 4E7KA 1NKEA 1B9FA 1S1WA 3HK2A 1Y64A 4DTRA 4A5AA 3UKUA 4N5SA 3VGMA 3SZ2A 4CD1A 4XEIA 2RF2A 3SYZA 1KD1O 1VK0A 4J8FA 4RWTA 4W5RA 5IT9O 3D2EB 3AVGA 1UAXA 1OH7A 4LF9K 3WEEB 4O8UA 3NF7A 4FWLA 4JKAA 3NF9A 3O1WA 4JV5K 5HRNA 1HYSA 1RBTA 4C8KA 4BACA 3BGRA 1L3SA 4FJMA 4FJXA 1ZBHA 2QWLA 4BWMA 2AJQA 1IKYA 1SL1A 5BRDA 3CMEN 3ZEUB
chains in the Genus database with same CATH topology
5LJVA 5KPRA 1YHQN 3RSEA 3A5LC 3WXKA 3WXMB 4B1WB 2ASPA 2W00A 3ULEB 4H5TA 3FLCO 4BRLA 3M5RA 5EY4A 3VTIA 4DCHA 1N8RO 1NGBA 5AQLA 1SS6A 1QZ6A 1JCFA 4B1VA 1NGFA 4AF1A 2P9LB 5H1SQ 1NJIO 3ZX3A 2QWNA 4YDUA 5BR9A 2GTDA 4E1JA 1BWFO 2VWBA 1D4XA 1NGHA 4MO5A 4BRCA 1KC8O 3P38A 2CH6A 1BDGA 4EHUA 4MDAA 4NLBA 1CZAN 5ADXH 1HUXA 1NLVA 5AQHA 1MDUB 3R9PA 3ENHA 3T7ZA 4BROA 1NM1A 4YDUC 4GV3A 3SAHA 1XUPO 3E9OA 3ZEUA 2HBMA 2ZJRL 4FVUA 1NGDA 2E2OA 3A5OC 2UYTA 5B8HA 5AQGA 4OPAA 1SQKA 4O8KA 4F9OA 1RFQA 3D2FB 3H45C 1IG8A 1HJOA 3HM8A 2QXLA 5FPNA 4H0XB 3MCPA 5EX5A 3OBWA 4DKWA 3EE8A 3DWLA 4KBOA 3G4SN 1K9MO 2P9IA 1BUPA 4A59A 4FO0A 3NMUA 3MN9A 1ZXOA 2P9LA 2V52B 5AQMA 3VEWA 3SMSA 3HBTA 3CC4N 2A42A 4LC9B 4B1XB 2NLXA 2GELA 2F9TA 4BQZA 4FPBA 5E26A 4EFHA 3ZYYX 4BR0A 3CCVN 4CZGA 3SAFA 3LM9A 4C23A 3GOIA 3N4QA 3D7EO 2RHKA 3UE5A 3P39A 4EAHD 5KPTA 5GADP 4WYBA 2NRVA 4BGAA 3EE9A 1TUUA 3VEZA 4GVEA 3R1XA 2YI1A 3CI5A 3NVMA 1ATRA 2NRTA 5BN9A 1QQOA 3QDKA 3CHWA 3CETA 2A41A 3A5MC 5AQTA 2E2PA 3WQUA 3CJ9A 4A2BA 5AQXA 3CCQN 4B1ZA 1YIJN 4BR2A 2FF6A 2P9SB 4WF9L 1KXPA 3DLLL 3HTVA 4JN4A 3O8MA 5KQ8A 1E4FT 4YOTA 1YAGA 4JKCA 3E9PA 2HSTA 3A0IX 3I33A 3MCAB 2KKZA 4JD2B 3ID8A 4WFBL 4CZHA 1GLCG 4YORA 4XH1A 3O9RA 4OPHA 3VF2A 2ZGZA 1NGEA 5AR0A 4IO8A 1C0FA 1P90A 4MDBA 4JKGB 3JXUA 1QQMA 3EKUA 4IWVA 4GV6A 1ATSA 2QA4N 2AA4A 3QBXA 3AARA 4BRDA 4BRKA 2YJFA 4CD3A 3ATUA 4HTLA 3TTDA 3RSEB 4H0OA 1Q86O 1RDUA 3R6MA 1KAYA 2A5XA 5TKWA 4BEBA 4QS7A 3OHRA 3QICA 3CXCM 4MLHA 2ASMA 2JWLA 5CR4A 2A6AA 3OA9A 3QFPA 3NVKA 5C12A 3DXKA 5AQOA 4ISGA 5M1KA 5JLHA 5AQKA 1VQON 4U67L 2GUPA 1S22A 4FSVA 4IJAA 3BUZB 1GLAG 4K43A 2I7PA 3LM2A 2Q1NA 5AQUA 5GIOA 4YOVA 3P31A 1TUYA 2HBKA 3IFRA 4JD2A 5AQNA 3CQXA 5AFUH 3SBTA 2ITMA 4DQ8A 3L6QA 5LY3A 2YHYA 2FSKA 1V4TA 1GLDG 3VEOA 1ZC6A 3C65A 4GNIA 2D0PA 4AM6A 3VF4A 4QS8A 2Q36A 3ZX2A 3F2KA 1W97L 4IZ9A 2YX6A 1K73O 2E1ZA 3MMVA 3IDHA 3GL1A 3ID6A 2HF3A 2IVPA 4FWPA 4BRMA 3O9QA 2Q0RA 2E20A 1QQNA 3CJAA 3CF5L 2HBJA 3CJBA 1GLBG 5EOYA 4FWQA 1VQKN 2VYPA 1WOQA 1NGAA 3J7ZO 4ISEA 3I56N 4B1YB 3CCRN 2P9IB 3HOTA 4CBUA 1VQ7N 2YHWA 1U6ZA 2IVNA 1YITN 4H5WA 5ELZA 2QWMA 4BRFA 4FWOA 2P9PA 3F5TA 4K41A 4BR7A 2ZF5O 2A3ZA 4CZIA 1X9JA 1Q82O 3VETA 3N4PA 2H3GX 4FWKA 2E8AA 2V7YA 4BR5A 4NLCA 4YOUA 4CZMA 4AM7A 1VQMN 4H0PA 5AQRA 3O1BA 2QM1A 3QMLA 3KWGA 3G25A 2D4WA 1KAXA 4MO4A 2P9NA 2PFUA 4OO1J 3LDPA 2W41A 3ZX0A 5BRHA 3CCSN 1VQNN 2FXUA 3P4IA 3FZKA 3HRGA 5HOOA 4H03B 3A8YA 4YOWA 1HKBA 1H1VA 1KAZA 4C1NK 4BQLA 2CGKA 4KH5A 1VQLN 4WCEL 2GX9A 1BG3A 3CQYA 2QWRA 4BC2A 1HLUA 3ATVA 3CC7N 5AQZA 4JNEA 5AQWA 5BRFA 3E9LA 3DJCA 4BR4A 4JEPA 2PBDA 4FOEA 5FPDA 2D1KA 3AAPA 4BRQA 2ZWHA 4DHYA 2E2NA 2RE2A 3MWPA 4JK8A 4XH4A 5EVZA 4JHDB 3G6EN 3CCJN 2QWOA 1E4GT 4BRNA 5EXWA 3GE1A 3CCLN 1O13A 4BRPA 2NRXA 4CZJA 1T6DA 5BN8A 4BE7B 3AAQA 3DXKB 4CI6A 3CERA 4IXCA 4FWNA 1S72N 4IJNA 3R8EA 3PIOL 1WUAA 3QBWA 3CPWM 1G99A 2BH1A 3TTCA 5C0YA 3FR0A 3H1VX 2P9UB 1VQ9N 2GWKA 2BUPA 3A5NC 4WQ4A 5M1FA 4UY8O 3HSCA 5C15A 4BGBA 4YOXA 5C2DA 3LDLA 2HOEA 3LDNA 4B1UB 4IEEA 4BRHA 5I9EB 3SMPA 2E2QA 1ESVA 5AZJB 5GAGP 1LCUA 1GLLO 2WUSA 1TYQA 3QB0A 2ZJQL 1VQ6N 1R59O 5AZIB 3W3DA 4BREA 2NZTA 3H3NO 4IOXA 3EN9A 4K25A 3TPQA 5AQFA 4BC4A 3R3LA 1SZ2A 4WQ4C 3TTFA 3ZETA 5MLCQ 4IOAL 4CZEA 4H5RA 4CZFA 3O80A 4JHDA 4FWMA 4JKEA 3Q7CA 4H0YB 2V7ZA 3C0BA 2C1GA 3M6GA 3OW2M 3UKRB 1RDWX 3IUCA 4JAXA 3VERA 5FPEA 5JVHL 4EIAA 1EO1A 2DPNA 1YJNN 2Q97A 1GLEG 1NMDA 3C6HA 1K8KB 1Z05A 4JKFA 1P8ZA 3VESA 1RGIA 1VQ8N 1HX1A 1ILYA 5GAHP 4KH4A 3LDQA 1SAZA 3OBYA 2NRZA 2NRRA 3ENBA 2EWSA 3L0QA 5M1QA 2HMPA 3M3ZA 3U9DA 3WQTA 3ENOA 2P9PB 2OANA 2QWPA 3SK3A 2P9UA 1JCGA 2Q31A 3WXIA 1QZ5A 3J8AA 3FGUA 5F0XA 2E88A 4H0TB 4IEIA 4A2AA 5JICA 2IVOA 2NNWA 3T69A 3L4IA 1V4SA 5C2FA 3FE1A 3VGLA 1LOTB 2PAVA 3F9MA 5AZJA 5CE3A 5CHIA 5BPLA 3LDOA 4FWSA 5BPMA 1QVFM 3EO3A 5AQQA 3TSPA 4IFEA 5AZIA 3AY9A 5C10A 4JKDA 2QEXN 2J4RA 2P9NB 3GDQA 4IDHA 3AGRA 5AQYA 3KZBA 4WFAL 3WXLA 2BTFA 3MX2A 3PLAA 1DT9A 2D0OA 3PIPL 4PKIA 1GLFO 1MWMA 3UKRA 1M1KO 3E1YA 3MK6A 2V51B 3D6RA 2F9WA 3GG4A 3KK7A 2YHXA 2ZGYA 3O6WA 1VQ5N 5F2RA 2OTLN 3CJ7A 3DXMB 3CJCA 2YCHA 2W40A 3WUHA 2JWKA 1K8KA 4GY2B 3CCEN 1HKGA 4WFNL 1BOTO 3E66A 4ILHA 3B8AX 2QTDA 3WT0A 3DAWA 4H5NA 3EKSA 5AQPA 4BG9A 4IO9L 3GBTA 4CZLA 3O08A 4FOIA 4FL9A 5KQDA 2QW9A 1C0GA 4PL8A 2KLAA 1YJWN 1M90O 1NBWA 3BF3A 1VAZA 3BF1A 1Q7YO 3MWTA 4BRIA 3CPEA 3EZWA 3D2EA 4C1NI 4RCHA 2CGLA 1YXQA 3Q7BA 3VTHA 3O9SA 5KPZA 3M1FA 4BVOA 3WEEA 3C7NB 4PKHA 3VEVA 5ADXA 2HF4A 3FZHA 3C6AA 1GLJO 4I6MB 1W2BM 3LL3A 2FSJA 3H3OB 2F7TA 3JS6A 4CZKA 3MN5A 3CCMN 5DM7L 3I55N 3FZMA 4O5FA 4WQ5A 3TSQA 4Z94A 1NGGA 3DXMA 3IMXA 5AQVA 4U7BA 1QHAA 4PHTX 4KH6A 4M63C 3S41A 3IKMA 3CD6N 5E84A 1KQSM 5M1OA 4A57A 3MDQA 4A61A 4EHTA 1NWKA 1YJ9N 1T44A 1Q18A 1QVGM 1TYQB 1YI2N 4BC5A 4B9QA 5F1XA 1T6CA 1EQYA 2QI2A 4FWRA 1U2VB 5TKYA 2WBNA 4WQ5C 3VMFB 1BO5O 5JVGL 3SLCA 4QS9A 4RTFD 3ZETB 2YJEA 5GIPA 1JJ2M 1Z6RA 1J6ZA 3ULEA 1BA1A 3U4LA 1DGKN 3BEXA 3K9KA 5AQSA 3AGKA 3CIPA 3CCUN 4BECA 1Q81O 1X3NA 3BP8A 2KHOA 2QWQA 4PKGA 5HL7L 1JCEA 2VCPA 3EL2A 4YOYA 4FPAA 4CBXA 3C7NA 4L3QA 3MX5A 2ZJPL 4JK9A 4I6MA 3H6EA 5M1PA 3HOSA 3G71N 2OTJN 1S3XA 3O5BA 1NGJA 3VEYA 1ZBSA 4Y0WA 2GWJA 3VGKA 4BG8A 4GV9A 3TSUA 3UKUB 3KWIA 2P9KB 2NRHA 1BU6O 2ASOA 4IOCL 1YUWA 2NRWA 3KHYA 1OVYA 1U2VA 1X3MA 1YVNA 3L4QA 4M7XA 4BY9C 4G9ZA 4R79A 3VOVA 3CJ1A 3SBGA 2FF3B 3VF6A 1YF5L 3SAGA 3VEXA 1HPMA 5FPMA 4NO7A 1BA0A 4BVPA 1K8AO 2I7NA 2C1IA 1IJJA 2E1YA 2IIRA 3D2FA 4PL7A 3O9TA 2VGMA 4H0VB 2VGNA 3HZ6A 4HWIA 4BRGA 3TU5A 1XQSC 2CGJA 3O4WA 5AQJA 4BRAA 2Q0UA 3MN6A 4XH5A 5DM6L 3HI0A 3VENA 1NGCA 1XC3A 1DEJA 4DB3A 1MWKA 4H5VA 4M7YA 1OKJA 5BREA 1DKGD 1T3VA 5GAEP 5M1NA 2Q2RA 1Y64A 5AQIA 3U9ZA 3VPZA 4BR9A 4A5AA 3UKUA 2P9KA 3CMAN 2FSNA 3VGMA 4CD1A 2CH5A 4XEIA 2WC9A 1KD1O 4A5BA 5AFUA 3WXJA 4CBWA 4J8FA 4RWTA 1VQPN 5JMVA 3H1QA 3W0LA 2A40A 3CC2N 3D2EB 3SJHA 2P9SA 4JKBA 4XJXA 3QFUA 3WEEB 2AP1A 3O9UA 4O8UA 5JLFA 2FLOA 3H46O 3K9JA 4FWLA 4ILGB 4JKAA 4MLEA 3U8XA 3O1WA 1MA9B 1HKCA 5BPNA 5GINA 4ISFA 4BC3A 1NGIA 4NB4A 4K42A 2HBLA 3UB5A 4CJ7A 1VQ4N 3FZLA 4A62A 2QWLA 3FZFA 3I8BA 2WFBA 4JKGA 1ATNA 2GEMA 3FFKB 3RVCA 5BRDA 4JKHA 3ZEUB 3CMEN 4JK7A 5LJWA 3KVGA 3MN7A 4ILJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJV A;  5KPR A;  3RSE A;  3A5L C;  3WXK A;  4B1W B;  2ASP A;  3ULE B;  4H5T A;  3FLC O;  4BRL A;  5EY4 A;  4DCH A;  1NGB A;  5AQL A;  1QZ6 A;  1JCF A;  4B1V A;  1NGF A;  2P9L B;  3ZX3 A;  2QWN A;  4YDU A;  5BR9 A;  2GTD A;  4E1J A;  1BWF O;  2VWB A;  1D4X A;  1NGH A;  4MO5 A;  4BRC A;  2CH6 A;  1BDG A;  4EHU A;  1CZA N;  5ADX H;  1HUX A;  1NLV A;  5AQH A;  1MDU B;  3R9P A;  3ENH A;  4BRO A;  1NM1 A;  4YDU C;  1XUP O;  3ZEU A;  1NGD A;  2E2O A;  3A5O C;  2UYT A;  5B8H A;  5AQG A;  1SQK A;  4O8K A;  4F9O A;  1RFQ A;  3D2F B;  3H45 C;  1IG8 A;  1HJO A;  3HM8 A;  2QXL A;  5FPN A;  4H0X B;  3MCP A;  5EX5 A;  4KBO A;  3DWL A;  2P9I A;  1BUP A;  4FO0 A;  3MN9 A;  1ZXO A;  2P9L A;  2V52 B;  5AQM A;  3VEW A;  3SMS A;  3HBT A;  2A42 A;  4LC9 B;  4B1X B;  2NLX A;  2GEL A;  2F9T A;  4BQZ A;  4FPB A;  5E26 A;  4EFH A;  4BR0 A;  4CZG A;  3LM9 A;  4C23 A;  3GOI A;  3UE5 A;  3D7E O;  4EAH D;  5KPT A;  4WYB A;  4BGA A;  1TUU A;  3VEZ A;  2YI1 A;  3CI5 A;  1ATR A;  5BN9 A;  1QQO A;  3QDK A;  3CHW A;  3CET A;  2A41 A;  3A5M C;  5AQT A;  2E2P A;  3WQU A;  3CJ9 A;  4A2B A;  5AQX A;  4B1Z A;  4BR2 A;  2FF6 A;  2P9S B;  1KXP A;  3HTV A;  4JN4 A;  3O8M A;  5KQ8 A;  1E4F T;  1YAG A;  3A0I X;  3I33 A;  4JD2 B;  3ID8 A;  4CZH A;  1GLC G;  4XH1 A;  3VF2 A;  2ZGZ A;  1NGE A;  5AR0 A;  4IO8 A;  1C0F A;  3JXU A;  1QQM A;  3EKU A;  4IWV A;  1ATS A;  2AA4 A;  3QBX A;  3AAR A;  4BRD A;  4BRK A;  2YJF A;  4CD3 A;  3ATU A;  4HTL A;  3RSE B;  4H0O A;  3R6M A;  1KAY A;  2A5X A;  4QS7 A;  3OHR A;  3QIC A;  4MLH A;  2ASM A;  2A6A A;  3QFP A;  3DXK A;  5AQO A;  4ISG A;  5JLH A;  5AQK A;  2GUP A;  1S22 A;  4FSV A;  4IJA A;  3BUZ B;  1GLA G;  4K43 A;  2I7P A;  3LM2 A;  2Q1N A;  5AQU A;  1TUY A;  3IFR A;  4JD2 A;  5AQN A;  3CQX A;  5AFU H;  2ITM A;  4DQ8 A;  3L6Q A;  5LY3 A;  2YHY A;  2FSK A;  1V4T A;  1GLD G;  3VEO A;  1ZC6 A;  4GNI A;  2D0P A;  4AM6 A;  3VF4 A;  4QS8 A;  2Q36 A;  3ZX2 A;  4IZ9 A;  2E1Z A;  3MMV A;  3IDH A;  3GL1 A;  2HF3 A;  2IVP A;  4FWP A;  4BRM A;  2Q0R A;  2E20 A;  1QQN A;  3CJA A;  3CJB A;  1GLB G;  5EOY A;  4FWQ A;  2VYP A;  1WOQ A;  1NGA A;  4ISE A;  4B1Y B;  2P9I B;  4CBU A;  2YHW A;  1U6Z A;  2IVN A;  4H5W A;  5ELZ A;  2QWM A;  4BRF A;  4FWO A;  2P9P A;  4K41 A;  4BR7 A;  2ZF5 O;  2A3Z A;  4CZI A;  1X9J A;  3VET A;  2H3G X;  4FWK A;  2E8A A;  2V7Y A;  4BR5 A;  4CZM A;  4AM7 A;  4H0P A;  5AQR A;  3O1B A;  2QM1 A;  3QML A;  3G25 A;  2D4W A;  1KAX A;  4MO4 A;  2P9N A;  3LDP A;  2W41 A;  3ZX0 A;  5BRH A;  2FXU A;  3P4I A;  3FZK A;  4H03 B;  3A8Y A;  1HKB A;  1H1V A;  1KAZ A;  4BQL A;  2CGK A;  1BG3 A;  3CQY A;  2QWR A;  4BC2 A;  1HLU A;  3ATV A;  5AQZ A;  4JNE A;  5AQW A;  5BRF A;  4BR4 A;  3DJC A;  5FPD A;  2PBD A;  4FOE A;  2D1K A;  3AAP A;  4BRQ A;  2ZWH A;  4DHY A;  2E2N A;  4XH4 A;  5EVZ A;  4JHD B;  2QWO A;  1E4G T;  4BRN A;  5EXW A;  3GE1 A;  4BRP A;  4CZJ A;  1T6D A;  5BN8 A;  3AAQ A;  3DXK B;  4CI6 A;  3CER A;  4IXC A;  4FWN A;  4IJN A;  3R8E A;  1WUA A;  3QBW A;  1G99 A;  3FR0 A;  3H1V X;  2P9U B;  2GWK A;  2BUP A;  3A5N C;  4WQ4 A;  3HSC A;  4BGB A;  3LDL A;  2HOE A;  3LDN A;  4B1U B;  4BRH A;  5I9E B;  3SMP A;  2E2Q A;  1ESV A;  5AZJ B;  1LCU A;  1GLL O;  2WUS A;  1TYQ A;  3QB0 A;  1R59 O;  5AZI B;  3W3D A;  4BRE A;  2NZT A;  3H3N O;  3TPQ A;  3EN9 A;  4K25 A;  5AQF A;  4BC4 A;  4WQ4 C;  1SZ2 A;  3ZET A;  4CZE A;  4H5R A;  4CZF A;  3O80 A;  4JHD A;  4FWM A;  4H0Y B;  2V7Z A;  3C0B A;  3M6G A;  3UKR B;  1RDW X;  3IUC A;  4JAX A;  3VER A;  5FPE A;  4EIA A;  2DPN A;  2Q97 A;  1GLE G;  1NMD A;  1K8K B;  1Z05 A;  1P8Z A;  3VES A;  1RGI A;  1HX1 A;  3LDQ A;  1SAZ A;  3L0Q A;  3U9D A;  2EWS A;  3WQT A;  2HMP A;  3M3Z A;  3ENO A;  2P9P B;  2OAN A;  2QWP A;  3SK3 A;  2P9U A;  1JCG A;  2Q31 A;  3WXI A;  1QZ5 A;  3J8A A;  3FGU A;  5F0X A;  2E88 A;  4H0T B;  4A2A A;  5JIC A;  2IVO A;  3L4I A;  1V4S A;  3FE1 A;  3VGL A;  1LOT B;  2PAV A;  3F9M A;  5AZJ A;  5CE3 A;  5BPL A;  3LDO A;  4FWS A;  5BPM A;  3EO3 A;  5AQQ A;  5AZI A;  3AY9 A;  2J4R A;  2P9N B;  3GDQ A;  5AQY A;  3KZB A;  3WXL A;  2BTF A;  2D0O A;  4PKI A;  1GLF O;  1MWM A;  3UKR A;  3MK6 A;  2V51 B;  2F9W A;  3GG4 A;  2YHX A;  2ZGY A;  3O6W A;  5F2R A;  3CJ7 A;  3DXM B;  3CJC A;  2YCH A;  2W40 A;  3WUH A;  4GY2 B;  1K8K A;  1HKG A;  1BOT O;  3B8A X;  3WT0 A;  3DAW A;  4H5N A;  3EKS A;  5AQP A;  4BG9 A;  3GBT A;  4CZL A;  3O08 A;  4FOI A;  4FL9 A;  5KQD A;  2QW9 A;  1C0G A;  4PL8 A;  1NBW A;  3BF3 A;  3BF1 A;  4BRI A;  3EZW A;  3D2E A;  4RCH A;  2CGL A;  1YXQ A;  5KPZ A;  3M1F A;  4BVO A;  3WEE A;  3C7N B;  4PKH A;  3VEV A;  5ADX A;  2HF4 A;  3FZH A;  4I6M B;  1GLJ O;  3LL3 A;  2FSJ A;  3H3O B;  3JS6 A;  4CZK A;  3MN5 A;  3FZM A;  4O5F A;  4WQ5 A;  4Z94 A;  1NGG A;  3DXM A;  3IMX A;  5AQV A;  1QHA A;  4M63 C;  3S41 A;  5E84 A;  3MDQ A;  4A61 A;  4EHT A;  1NWK A;  1T44 A;  1Q18 A;  1TYQ B;  4BC5 A;  4B9Q A;  5F1X A;  1T6C A;  1EQY A;  4FWR A;  1U2V B;  5TKY A;  4WQ5 C;  1BO5 O;  3SLC A;  4QS9 A;  4RTF D;  3ZET B;  2YJE A;  1Z6R A;  1J6Z A;  3ULE A;  1BA1 A;  3U4L A;  1DGK N;  3BEX A;  5AQS A;  3CIP A;  1X3N A;  3BP8 A;  2KHO A;  2QWQ A;  4PKG A;  1JCE A;  2VCP A;  3EL2 A;  4FPA A;  4CBX A;  3C7N A;  4L3Q A;  4I6M A;  3H6E A;  1S3X A;  3O5B A;  1NGJ A;  3VEY A;  1ZBS A;  4Y0W A;  2GWJ A;  3VGK A;  4BG8 A;  3UKU B;  2P9K B;  2NRH A;  1BU6 O;  2ASO A;  1YUW A;  3KHY A;  1YVN A;  1U2V A;  1X3M A;  4M7X A;  3VOV A;  3CJ1 A;  2FF3 B;  3VF6 A;  3VEX A;  1HPM A;  5FPM A;  4NO7 A;  1BA0 A;  4BVP A;  2I7N A;  1IJJ A;  2E1Y A;  2IIR A;  3D2F A;  4PL7 A;  4H0V B;  3HZ6 A;  4HWI A;  4BRG A;  3TU5 A;  1XQS C;  2CGJ A;  3O4W A;  5AQJ A;  4BRA A;  2Q0U A;  3MN6 A;  4XH5 A;  3HI0 A;  3VEN A;  1NGC A;  1XC3 A;  1DEJ A;  4DB3 A;  1MWK A;  4H5V A;  4M7Y A;  1OKJ A;  5BRE A;  1DKG D;  2Q2R A;  1Y64 A;  5AQI A;  3U9Z A;  3VPZ A;  4BR9 A;  3UKU A;  2P9K A;  2FSN A;  3VGM A;  4CD1 A;  2CH5 A;  4XEI A;  5AFU A;  3WXJ A;  4CBW A;  4J8F A;  4RWT A;  5JMV A;  3H1Q A;  3W0L A;  2A40 A;  3D2E B;  3SJH A;  2P9S A;  3QFU A;  3WEE B;  2AP1 A;  5JLF A;  2FLO A;  3H46 O;  4FWL A;  4MLE A;  3U8X A;  3O1W A;  1MA9 B;  1HKC A;  5BPN A;  4ISF A;  4BC3 A;  1NGI A;  4NB4 A;  4K42 A;  3UB5 A;  4CJ7 A;  3FZL A;  4A62 A;  2QWL A;  3FZF A;  3I8B A;  1ATN A;  2GEM A;  3FFK B;  5BRD A;  3ZEU B;  5LJW A;  3KVG A;  3MN7 A; 
#chains in the Genus database with same CATH topology
 1JKH A;  1W0H A;  3A5L C;  3IRX A;  5IWA K;  2ASP A;  3FLC O;  3L2U A;  4CEE A;  3VTI A;  4B8C A;  1N8R O;  3LP0 A;  1QZ6 A;  1QE1 A;  3HVR A;  1LW0 A;  3T1A A;  4B1V A;  2QWN A;  3AA4 A;  4FK2 A;  1BWF O;  1NGH A;  3AVI A;  3HT3 A;  1W9H A;  4BRC A;  3ZSQ A;  1I3A A;  2G8H A;  4EHU A;  4MDA A;  4JI0 K;  1CZA N;  4X65 K;  1MDU B;  3ENH A;  4QCL A;  3AA2 A;  4ELT A;  5HRR A;  4LH5 A;  4CJU A;  3OYB A;  4OLB A;  3TAQ A;  1RFQ A;  4CF0 A;  1IG8 A;  4KO0 A;  4H0X B;  3MCP A;  5FLX O;  1WBB A;  3EE8 A;  3DWL A;  3G4S N;  1K9M O;  4FW1 A;  4I7F A;  4GW6 A;  1KLM A;  4DS4 A;  5CYQ A;  1A5X A;  2F9T A;  1U48 A;  4RW7 A;  1A5W A;  4DTX A;  5E26 A;  1J9A A;  3L3U A;  3SAF A;  1REV A;  2RHK A;  1B9D A;  3AVL A;  1NK9 A;  3VEZ A;  5KGX A;  4KI4 A;  3NVM A;  4XIU A;  5BN9 A;  5AQT A;  4CEF A;  3A5M C;  1YIJ N;  4X64 K;  2P9S B;  3DLL L;  3SQ4 A;  5KQ8 A;  1BIU A;  2W6K A;  4F8R A;  3ID8 A;  2UXB K;  1GLC G;  4XH1 A;  1C1C A;  3O9R A;  2ZGZ A;  3HPG A;  1RTD A;  4NCA A;  4JKG B;  3K5M A;  1QQM A;  3DLG A;  4GV6 A;  1ATS A;  2FBV A;  4BRD A;  4BRK A;  4ELV A;  2XHB A;  3NGY A;  1L3T A;  3ASM A;  4C8O A;  5TKW A;  4LH4 A;  3G0Z A;  1KFS A;  2DTU A;  5M1K A;  3OVN A;  3BUZ B;  4K43 A;  4CJV A;  1EET A;  4AHS A;  5GIO A;  3P31 A;  2VWJ A;  3SBT A;  2ITM A;  4I2P A;  2FSK A;  1BIZ A;  1V4T A;  4FZX C;  2YNI A;  1RDB A;  3C65 A;  3OTO K;  2ATQ A;  4QS8 A;  2D0C A;  3M8R A;  2HHT A;  3F2K A;  1W97 L;  4KRF A;  2E1Z A;  2QK9 A;  3GL1 A;  3DMJ A;  4B3T K;  4CJS A;  2HB5 A;  2Q0R A;  4TSX A;  2E20 A;  1S1X A;  1QQN A;  1X9S A;  3CJA A;  3CF5 L;  1GLB G;  5EOY A;  2DFH A;  1RTI A;  3ZT1 A;  2VYP A;  4FJ9 A;  1HPZ A;  2P9I B;  1VHX A;  3F9K A;  4O0I A;  4H5W A;  3EY1 A;  4E7H A;  3VA0 A;  4CJ3 A;  5ELZ A;  4CEO A;  2GBZ A;  4FWO A;  3TAB A;  2O8E B;  3THY A;  2ZF5 O;  1X9J A;  1HQU A;  3VET A;  2KFN A;  3V9S A;  4NLC A;  4YOU A;  4AM7 A;  4H0P A;  5AQR A;  1WAF A;  4JI2 K;  3PV8 A;  1Q8I A;  1QTM A;  3G25 A;  2HHH K;  2I5J A;  2D4W A;  1QQC A;  2P9N A;  2PFU A;  3LDP A;  4ICL A;  1N32 K;  3P4I A;  1RT2 A;  3AVH A;  5HOO A;  4YOW A;  2OZS A;  1HKB A;  4IKF A;  4BDY A;  5KI6 A;  3CC7 N;  5AQW A;  4DTO A;  4OKJ A;  4BR4 A;  3DJC A;  4DTN A;  1RBU A;  4DHY A;  3ZT2 A;  3K59 A;  4LFA K;  4CFB A;  5BN8 A;  4BE7 B;  3AAQ A;  3DXK B;  4DFP A;  3S5T A;  4FWN A;  2YHA A;  4I9Q A;  2F8T A;  3QBW A;  3TTC A;  4K8X A;  3QEP A;  5C0Y A;  1BHL A;  3H1V X;  2P9U B;  2OPQ A;  1R0A A;  4UY8 O;  2OPR A;  4BGB A;  2HOE A;  3LDN A;  1ZBF A;  3SMP A;  2E2Q A;  5BR8 K;  1LCU A;  1VQ6 N;  4B9S A;  1R59 O;  2HVI A;  5AZI B;  3M8Q A;  2O8C B;  3TPQ A;  3ZET A;  4FJ8 A;  1C1B A;  4H0Y B;  3C0B A;  3M6G A;  3JSM A;  3OW2 M;  2O8F A;  3IUC A;  5JS1 A;  2E4L A;  3AA5 X;  4EIA A;  2DPN A;  3RMD A;  1GLE G;  3HJF A;  3QES A;  4KH4 A;  2YKN A;  2D5R A;  1NK8 A;  2KW4 A;  3L0Q A;  2O8B B;  2HMP A;  3K2P A;  2P9P B;  2QWP A;  2Q31 A;  1QZ5 A;  4BDZ A;  3KIO A;  1HRH A;  4IEI A;  4A2A A;  1HYZ A;  2IVO A;  5JIC A;  3F9M A;  1QVF M;  4WE1 A;  3BZC A;  1VSF A;  3AY9 A;  5C10 A;  4IDH A;  5AQY A;  1HNZ K;  4E7I A;  4WFA L;  3MX2 A;  1LW2 A;  1NK5 A;  4PKI A;  1GLF O;  1RDC A;  3E1Y A;  1M1K O;  3MK6 A;  2HHI A;  3O6W A;  1NOZ A;  3DXM B;  3CJC A;  2YCH A;  3WUH A;  3ZSZ A;  1NU0 A;  4WFN L;  1RTH A;  4ZTJ A;  4DU1 A;  4BG9 A;  3GBT A;  4CZL A;  3PX6 A;  3VQ6 A;  2QW9 A;  3C6U A;  2KLA A;  3VQ9 A;  5A2Q O;  2UU9 K;  1Q7Y O;  3CPE A;  4DSF A;  4Y1D A;  2CGL A;  3VTH A;  3MXM A;  5KPZ A;  4DF4 A;  3M1F A;  4ZHR A;  3QEV A;  1RT6 A;  2HF4 A;  3SUO A;  1W2B M;  3H3O B;  4CZK A;  3CCM N;  3TSQ A;  4N47 A;  4OLA A;  5AQV A;  1QHA A;  4M63 C;  3KD5 E;  5E84 A;  1KQS M;  5M1O A;  1NWK A;  4M3T A;  1TYQ B;  1T6C A;  4QAG A;  3THV A;  4IG0 A;  5JVG L;  4RTF D;  1JJ2 M;  5GIP A;  4JYA K;  3ULE A;  4CJQ A;  2OCE A;  2FBY A;  3DLK A;  1Q9Y A;  3CIP A;  1Q81 O;  1F21 A;  1EKE A;  2VWK A;  2KHO A;  1CXQ A;  5HL7 L;  2JGU A;  5CZ2 A;  2DFF A;  3C7N A;  3LP2 A;  4L3Q A;  4JK9 A;  2VQF K;  4FJG A;  3H6E A;  4B9T A;  3HOS A;  3G71 N;  2OTJ N;  1NGJ A;  4J2D A;  4B8A B;  3AO1 A;  2QXF A;  1VSM A;  3G10 A;  3UKU B;  3HST B;  4Q5V A;  4KHY A;  2HHS A;  3LAN A;  3ZLJ A;  1X3M A;  3L4Q A;  4R79 A;  1NMN A;  1S1U A;  2YV0 X;  5FPM A;  2C1I A;  4CJ5 A;  4FJH A;  4DV2 K;  5I3U A;  4C8N A;  4H0V B;  2VGN A;  4H4O A;  4HWI A;  4IBN A;  1HNW K;  3TU5 A;  3TAF A;  4E19 A;  3OS2 A;  2F8S A;  2XRI A;  2Q0U A;  5DM6 L;  1X9W A;  1NNE A;  1XC3 A;  1SKS A;  4H5V A;  5M1N A;  3ZT4 A;  2Q2R A;  3VPZ A;  3HP9 A;  4FLV A;  3SPZ A;  2CH5 A;  2UUA K;  5JMV A;  3H1Q A;  3W0L A;  4CJ4 A;  1RNH A;  2XY5 A;  1S5J A;  1EX4 A;  2FLO A;  3K9J A;  1NJX A;  1IKX A;  4E72 A;  1HKC A;  5GIN A;  3ALY A;  4K42 A;  1D9D A;  1VQ4 N;  1TKT A;  4LSL A;  4A62 A;  2PY5 A;  4DTU A;  2WFB A;  5C42 A;  3SQ1 A;  3QET A;  4JKH A;  5LJW A;  2Q3S A;  5F2R A;  4CHZ A;  5FRO A;  5LJV A;  3PX4 A;  5KPR A;  3RSE A;  3B6P A;  1J5O A;  3WXM B;  4B1W B;  2A1S A;  2YNH A;  3LDS A;  1L3V A;  4BRL A;  5EY4 A;  4CHQ A;  4B3M K;  4B3R K;  5AQL A;  3J7A P;  1RBV A;  1ASU A;  1RT5 A;  1NGF A;  1TV6 A;  4AF1 A;  3ZX3 A;  4B08 A;  1RT3 A;  3AVN A;  5SWM A;  1XHX A;  1QSY A;  1D4X A;  4YFU A;  4FLW A;  4MO5 A;  1KC8 O;  4CGH A;  3P38 A;  2KZZ A;  3K5O A;  4B3O A;  4KI6 A;  4Z4G A;  4NLB A;  1HUX A;  1NLV A;  3T7Z A;  4BRO A;  1NM1 A;  1NJW A;  3E9O A;  4DLE A;  3O3G A;  2ZJR L;  2RPI A;  2DY4 A;  1NJZ A;  3V4I A;  5B8H A;  2O8D B;  1U45 A;  1VSL A;  2QKB A;  4FLT A;  3HM8 A;  1XMO K;  3SUP A;  1KLN A;  3S3M A;  3DI6 A;  4A59 A;  1ZXO A;  2V52 B;  5AQM A;  5LL6 Z;  4B1X B;  3HPO A;  1S6Q A;  4QOZ B;  2NLX A;  3QEI A;  4DG1 A;  1ZBI A;  3S9H A;  4EFH A;  4F2R A;  3CCV N;  4KRE A;  3K5N A;  2F4V K;  3D7E O;  4CGI A;  5GAD P;  1T7P A;  1JL2 A;  3EE9 A;  4DR1 K;  4GVE A;  4CHN A;  2HHV A;  3R1X A;  1I94 K;  2NRT A;  2YNG A;  1QQO A;  4A2B A;  2A41 A;  1S1V A;  3CJ9 A;  4B1Z A;  1XI1 A;  2FF6 A;  1WSH A;  2D0B A;  3HTV A;  4JN4 A;  2XY7 A;  4MFB A;  4DF8 A;  4JKC A;  3E9P A;  1TL1 A;  3MCA B;  4WFB L;  4IFV A;  1EP4 A;  4B9U A;  3V9X A;  5KGW A;  1NGE A;  5AR0 A;  3KKS A;  4IO8 A;  1C0F A;  3K0S A;  3TI0 A;  5D3G A;  4N56 A;  2QA4 N;  3QBX A;  3TAR A;  2PYJ A;  1SKW A;  4HTL A;  1Q86 O;  4CEQ A;  1KAY A;  4QS7 A;  3OHR A;  3QIC A;  3CXC M;  4MLH A;  5AQO A;  3THW A;  4DUZ K;  4BE0 A;  5JLH A;  5AQK A;  3FFI A;  3TAM A;  4B9M A;  3NH0 A;  5E41 A;  2I7P A;  1EXQ A;  2Q1N A;  1TKZ A;  2G8K A;  3OYH A;  2XO7 A;  5AQN A;  3THX B;  4Z0U A;  1BIS A;  3M8S A;  3L6Q A;  3OJS A;  4AM6 A;  4KV8 A;  4CF8 A;  4DTJ A;  1K73 O;  2PYL A;  3MMV A;  3V9W A;  3IDH A;  3T3F A;  2B6A A;  4FWP A;  4BRM A;  3O9Q A;  3DYA A;  4NXM K;  1VQK N;  5DMR A;  3LPT A;  1WOQ A;  1WN7 A;  1NGA A;  3ITH A;  3HP6 A;  4EZ6 A;  4DR6 K;  4OPK A;  4B1Y B;  3TAE A;  3HOT A;  2YHW A;  1U6Z A;  3KK1 A;  4FM2 A;  1IG9 A;  1XHZ A;  4BRF A;  3F5T A;  3T19 A;  4BR7 A;  2HVH A;  3N4P A;  4B9V A;  2E8A A;  5I42 A;  3K58 A;  3NGZ A;  4ID5 A;  1W7A A;  3TR8 A;  4OO1 J;  5BRH A;  4M3X A;  2F96 A;  4FCY A;  3VN5 A;  4H03 B;  3A8Y A;  3AO2 A;  2ZM6 K;  1N5Y A;  3DRP A;  2CGK A;  4CFA A;  1VQL N;  4WCE L;  4KHU A;  4NYF A;  3ATV A;  3VA3 A;  4JNE A;  5BRF A;  4FZZ A;  5HRP A;  3NGI A;  2D1K A;  3DOL A;  4BRQ A;  1NK4 A;  2ZWH A;  2RE2 A;  4GMJ B;  4JK8 A;  1E4G T;  5HBM A;  3VQB A;  5J2Q A;  5EXW A;  3GE1 A;  3NH1 A;  4Q0B A;  1NOY A;  4CZJ A;  1X1P A;  3V1R A;  2HMI A;  3RR8 A;  2G8U A;  3CER A;  1S72 N;  3HM9 A;  4DLG A;  3FR0 A;  2GWK A;  2D0A A;  1VSE A;  4YOX A;  5C2D A;  3LDL A;  4B1U B;  5I9E B;  1UWB A;  5GAG P;  4DR2 K;  1XNQ K;  2WUS A;  2ZJQ L;  2FC0 A;  4Y1C A;  3OYA A;  4DV7 K;  4NCG A;  3H3N O;  4IOX A;  3EN9 A;  3ZSY A;  5MLC Q;  3VQ7 A;  2YKM A;  4B9L A;  4H5R A;  3O80 A;  1CLQ A;  3L8B A;  2C1G A;  2V7Z A;  1XMQ K;  1RDW X;  4JAX A;  3VER A;  3ZSO A;  4W5O A;  1EO1 A;  1YJN N;  2Q97 A;  3C6H A;  4KHP K;  1Z05 A;  4H8K A;  1HX1 A;  2P5G A;  2NRZ A;  4ELU A;  3U9D A;  3WQT A;  3PSF A;  3ENO A;  1JCG A;  3LWL A;  3QIN A;  1RBS A;  1NK6 A;  5F0X A;  2E88 A;  1Z26 A;  3T69 A;  3I0R A;  4HCC A;  1NK0 A;  3AO3 A;  2UXC K;  3KK2 A;  3VGL A;  1LOT B;  2PAV A;  4RW8 A;  5CHI A;  5BPL A;  3LDO A;  1JL1 A;  4FWS A;  5BPM A;  4DSK A;  1JLC A;  5AQQ A;  5CYM A;  4IFE A;  1Q9X A;  3AGR A;  1T05 A;  1DT9 A;  3OS0 A;  1MWM A;  2OYQ A;  1RBR A;  3UKR A;  1VSD A;  3MXI A;  2F9W A;  3GG4 A;  2YHX A;  2W40 A;  1YTU A;  4JI7 K;  1WSJ A;  1ITG A;  4CK1 A;  5LMU K;  3RR7 A;  1C1A A;  1WBD A;  3B8A X;  2B4J A;  3DAW A;  2GV9 A;  4H5N A;  3EKS A;  2E5L K;  4K8Z A;  4IO9 L;  1C0M A;  4FL9 A;  5KQD A;  1C0G A;  1M90 O;  4HCB A;  4JRQ A;  1VAZ A;  1XWL A;  3MWT A;  4BRI A;  3D2E A;  4RCH A;  3Q7B A;  1J54 A;  4M3R A;  3O9S A;  4BVO A;  3WEE A;  3PX0 A;  3C7N B;  5ADX A;  3VEV A;  3VQ4 A;  3FZH A;  2FSJ A;  2F7T A;  3JS6 A;  5KRT A;  3AVM A;  3MN5 A;  4M45 A;  4DV3 K;  5DM7 L;  3QNN A;  3FZM A;  4Z94 A;  1U47 A;  5K14 A;  4E1N A;  4FK4 A;  4PHT X;  4KH6 A;  3S41 A;  3VQE A;  2IAJ A;  4A61 A;  4EHT A;  4DR3 K;  1T44 A;  2Z1I A;  4KHN A;  1Q18 A;  1QVG M;  4BC5 A;  4B9Q A;  5F1X A;  1EQY A;  5TKY A;  4KB1 A;  4LF8 K;  4FM0 A;  3SLC A;  3AVB A;  3IG1 A;  4QS9 A;  1IBK K;  3E01 A;  1BA1 A;  4K0K K;  1MU2 A;  3SJJ A;  4RW6 A;  1J53 A;  2VG7 A;  3BP8 A;  5J1E A;  1TVR A;  2QWQ A;  2VCP A;  3MEG A;  4EP4 A;  2ZJP L;  3IS9 A;  1IO2 A;  2UUB K;  1S3X A;  4O4G A;  3O5B A;  3P5J A;  2GWJ A;  3VGK A;  4B9N A;  4GV9 A;  4AIL C;  4R5P A;  4IOC L;  5FRM A;  2BGG A;  2NRW A;  3KHY A;  4Z4I A;  1YVN A;  1U2V A;  4M7X A;  5J2P A;  4J2A A;  4BY9 C;  3O4Q A;  3VOV A;  3SUQ A;  3SBG A;  1FJG K;  4OKE A;  3SAG A;  1KRP A;  3NE6 A;  1HPM A;  1K8A O;  4NO7 A;  1BA0 A;  1IJJ A;  2IIR A;  4FJ5 A;  3WNG A;  1T03 A;  4ID1 A;  4KTQ A;  3I0S A;  4BRA A;  1FKP A;  1HR0 K;  1SV5 A;  3MN6 A;  4XH5 A;  3HI0 A;  1GOC A;  4M7Y A;  5GAE P;  3IAY A;  1NKB A;  1KTQ A;  4DV6 K;  3U9Z A;  4BR9 A;  4DQP A;  2OPP A;  3CMA N;  3CQ8 A;  5AFU A;  3WXJ A;  3SJH A;  2BAN A;  1I39 A;  2P9S A;  4JKB A;  1Z25 A;  2AP1 A;  1RT1 A;  3H46 O;  4ILG B;  1G15 A;  4MLE A;  3NF6 A;  4ISF A;  4KHS A;  4E7J A;  4AQY K;  4NB4 A;  3UIQ A;  4CJ7 A;  4M41 A;  4CHY A;  3FZL A;  3L2Q A;  4HUG A;  4DU4 A;  3I8B A;  4JKG A;  1ATN A;  3FFK B;  3RVC A;  1UA1 A;  4CGF A;  4F3O A;  4JK7 A;  3KVG A;  3MN7 A;  1YHQ N;  4FJL A;  4N41 A;  2YHB A;  3KLI A;  2W00 A;  4H5T A;  4OKK A;  3AV9 A;  4DU3 A;  3KLE A;  3CYG A;  1ZBL A;  1BI4 A;  2P5O A;  3D45 A;  1NJI O;  1WSE A;  3SQ0 A;  4E1J A;  4CK3 A;  1D5A A;  1KFD A;  5HLF A;  3HXM A;  3OYM A;  1DTT A;  2CH6 A;  3ULD A;  1BDG A;  4FK0 A;  4CVN E;  1IBL K;  4RW9 A;  5ADX H;  3R9P A;  3RRH A;  4FYD A;  4GV3 A;  3SAH A;  3VQA A;  4FVU A;  4BE2 A;  2E2O A;  4CF2 A;  1JLF A;  1SQK A;  4O8K A;  2FBX A;  4F9O A;  1SL2 A;  3D2F B;  3H45 C;  1HJO A;  4FW2 A;  3OYF A;  1IKV A;  4OX9 K;  1JLA A;  3OBW A;  4KBO A;  2P9I A;  1HNX K;  1BUP A;  1WSF A;  4FO0 A;  3NMU A;  2P9L A;  3SMS A;  3CC4 N;  2FBT A;  2A42 A;  2O8E A;  4BQZ A;  4FPB A;  2Z1G A;  4NYN A;  3TAN A;  4BR0 A;  4CZG A;  2O4I A;  4FJK A;  3T1Y K;  4GKJ K;  3UE5 A;  3WNF A;  5KPT A;  3OS1 A;  1OVQ A;  1TUU A;  3QEX A;  2YI1 A;  4G1Q A;  4O5B A;  3CHW A;  4LF6 K;  3WQU A;  2E2P A;  3THW B;  3ZSV A;  4WF9 L;  1KXP A;  4GVM A;  1YAG A;  3I33 A;  4CZH A;  3SPY A;  3SUN A;  4YOR A;  1E3M A;  4JS5 A;  4OPH A;  3O3H A;  3MED A;  3LP1 A;  1P90 A;  4MDB A;  3OYN A;  3JXU A;  4W5T A;  3EKU A;  4IWV A;  4M42 A;  4JLH A;  2ZD1 A;  2AA4 A;  3AAR A;  4C8M A;  4YHH K;  4CD3 A;  3L2W A;  2Z1J A;  3TTD A;  3C94 A;  5FRN A;  1ZYQ A;  3K57 A;  1JLG A;  4E7L A;  2ASM A;  5CR4 A;  2A6A A;  2E6M A;  4CJL A;  3DXK A;  5C12 A;  4YY3 K;  4J2E A;  3NVK A;  4ISG A;  1S22 A;  4IJA A;  1GLA G;  1CXU A;  3LM2 A;  4YOV A;  4EP5 A;  2HBK A;  3IFR A;  3PUF A;  4JD2 A;  3CQX A;  5AFU H;  4DQ8 A;  5LY3 A;  3SV4 A;  1GLD G;  3VEO A;  1ZC6 A;  3KLG A;  3DRR A;  3F73 A;  2D0P A;  4IDK A;  2Q36 A;  2W42 A;  4IZ9 A;  2ITG A;  1HJR A;  2O8C A;  3ID6 A;  5FDL A;  3RWU A;  4CCH A;  4DV4 K;  1L3U A;  2HHW A;  4FWQ A;  4CFC A;  3A2F A;  1DLO A;  1L5U A;  4ISE A;  3I56 N;  1JXE A;  2EHG A;  5JEN A;  2O4G A;  3RMA A;  2IVN A;  3QEW A;  5EU7 A;  1YIT N;  5KRS A;  2HND A;  2QWM A;  2O8B A;  2P9P A;  1RDD A;  1WSG A;  4K41 A;  1Q82 O;  4PWD A;  1TKX A;  2V7Y A;  2YNF A;  3KD1 E;  4CZM A;  3LAK A;  4AH9 A;  3NCI A;  3O1B A;  3VQC A;  1KAX A;  4MO4 A;  3NF8 A;  4KTW A;  2FXU A;  1S1T A;  2ZE2 A;  3P83 D;  4CF1 A;  3RMC A;  4DQS A;  1BQN A;  4OVL A;  1NK7 A;  3DLR A;  4BC2 A;  2JLE A;  4DS5 A;  3DLH A;  1RCH A;  5AQZ A;  3KK3 A;  3E9L A;  4JEP A;  2PBD A;  3AAP A;  2BDP A;  1BL3 A;  3MWP A;  3CCJ N;  4XH4 A;  3G6E N;  3NDK A;  3QIP A;  4CJW A;  4LFB K;  1VRT A;  1O13 A;  4BRP A;  4M3Y A;  1U04 A;  4DQQ A;  4IXC A;  1TL3 A;  4IJN A;  3R8E A;  3PIO L;  1WUA A;  1G99 A;  3RRG A;  1VQ9 N;  2BUP A;  2KFZ A;  3HSC A;  1WB9 A;  1VSH A;  4IEE A;  3DOK A;  1B92 A;  2IS3 A;  1ESV A;  1GLL O;  1TYQ A;  3DLE A;  4CEC A;  3W3D A;  4BRE A;  4K25 A;  1WLJ A;  4JI6 K;  4BC4 A;  4IOA L;  3TTF A;  4CJP A;  4HUE A;  5J2M A;  4CZE A;  4FJ7 A;  4CE9 A;  4JHD A;  4JKE A;  2WTU A;  3Q7C A;  3MEC A;  4Z4C A;  4FLZ A;  3UKR B;  5FPE A;  1DTQ A;  4DV5 K;  3HVT A;  4FLX A;  1O1W A;  4M3W A;  5LMN K;  4JKF A;  1P8Z A;  1VQ8 N;  3CFR A;  5GAH P;  3OBY A;  1RT4 A;  4CK2 A;  4EZ9 A;  5M1Q A;  3ZSR A;  3M3Z A;  1RT7 A;  3L2V A;  4L8R B;  3THY B;  3WXI A;  3J8A A;  4JRP A;  3FGU A;  3VQD A;  2NNW A;  2W6L A;  1CZ9 A;  3ZCM A;  5C2F A;  4W5Q A;  5AZJ A;  3WNH A;  1RTJ A;  3EO3 A;  4KHQ A;  3TSP A;  1LWF A;  4MQ3 A;  3MAQ A;  4OJR A;  1C0T A;  1JLQ A;  2J4R A;  2P9N B;  3SV3 A;  3LZI A;  4B3S K;  3PLA A;  2BTF A;  3EEQ A;  4DSL A;  2OZM A;  3D6R A;  5CY4 A;  2ZGY A;  3CJ7 A;  4DSI A;  1K8K A;  2WON A;  3VQP A;  3TAG A;  4ZTF A;  2GUI A;  1BOT O;  3E66 A;  1N6Q A;  4ILH A;  4DSJ A;  4E89 A;  4CEZ A;  3MXJ A;  5C24 A;  1OH8 A;  3RMB A;  2HHQ A;  3O08 A;  4Z4H A;  4PL8 A;  3QLH A;  4O44 A;  4AHR A;  1YJW N;  1NBW A;  3BF3 A;  1TAQ A;  3BF1 A;  3EZW A;  1TK5 A;  1YXQ A;  4DTP A;  2HHU A;  2HNZ A;  3S3O A;  3LL3 A;  3JYT A;  3I55 N;  4O5F A;  3AO4 A;  2R7Y A;  1NGG A;  4U7B A;  3IKM A;  4AHV A;  1VRU A;  3OYD A;  3S3N A;  4A57 A;  4HTU A;  5J2N A;  3OY9 A;  2DFE A;  1UOC A;  1YJ9 N;  3LP3 A;  3OYG A;  1U2V B;  2WBN A;  3VMF B;  1BO5 O;  1ASW A;  1VSI A;  3HPH A;  3ZET B;  2YJE A;  1Z6R A;  3BY5 A;  3CFO A;  4KB0 A;  3DLB A;  4I2Q A;  1LWE A;  1DGK N;  3BEX A;  3AO5 A;  3KTQ A;  2O8F B;  1IV0 A;  1IH7 A;  1JCE A;  3EL2 A;  1GOB A;  4I6M A;  5M1P A;  4CGG A;  2IOC A;  3LZJ A;  3VEY A;  2OA8 A;  3T1H K;  4LF5 K;  3MEE A;  3KWI A;  3PY8 A;  2NRH A;  1BU6 O;  1BGX T;  1EWR A;  4FLY A;  1OVY A;  3J7Y P;  4G9Z A;  4H4M A;  4CHP A;  2O8D A;  3VF6 A;  1YF5 L;  1HQE A;  1NJY A;  4CEA A;  2I7N A;  1UA0 A;  3CM5 A;  4C8L A;  5SZT A;  4FLU A;  3HO1 A;  2XY8 A;  3HZ6 A;  4BRG A;  2NUB A;  4KTZ A;  5HP1 A;  1FK9 A;  3AVC A;  3OYK A;  2CGJ A;  3O4W A;  4DFK A;  4KFB A;  4CJK A;  4JI4 K;  3J80 O;  3VEN A;  1LAV A;  4IG3 A;  1MWK A;  1K6Y A;  4CJF A;  3J81 O;  3VQ5 A;  1DKG D;  4HVJ A;  3L2R A;  4KHW A;  5AQI A;  2P9K A;  2FSN A;  2WC9 A;  4A5B A;  2ETJ A;  1VQP N;  4CBW A;  3NBP A;  3NAE A;  3CC2 N;  2A40 A;  4CJT A;  4CIE A;  4JI8 K;  4FJI A;  4XJX A;  3QFU A;  1BI4 B;  3O9U A;  2A1R A;  5JLF A;  3QNO A;  3U8X A;  2IC3 A;  2Y1I A;  1MA9 B;  3RTV A;  3SI6 A;  5BPN A;  4BC3 A;  4FXD A;  1NGI A;  2HBL A;  3UB5 A;  4LD0 A;  3FZF A;  2GEM A;  4CGJ A;  4OGE A;  2HHX A;  4ILJ A;  3LAM A;  3WXK A;  2UUC K;  4LF4 K;  3ULE B;  2P1J A;  3ZSX A;  3M5R A;  4DCH A;  1NG9 A;  1NGB A;  1SS6 A;  2G8V A;  1XC9 A;  1JCF A;  2WOM A;  3DM2 A;  3KLH A;  2P9L B;  5H1S Q;  3HYF A;  4YDU A;  4CGD A;  5BR9 A;  2GTD A;  3CYM A;  3JAM O;  2VWB A;  3THX A;  3QER A;  2VG5 A;  4JS4 A;  4PQU A;  1EWQ A;  4CIG A;  2XY6 A;  5AQH A;  1LWC A;  4YDU C;  3LAL A;  1KSP A;  3DRS A;  1N36 K;  1XUP O;  1YVU A;  2HBM A;  3HL8 A;  3ZEU A;  4E3S A;  1NGD A;  1OH5 A;  3B6O A;  3A5O C;  2UYT A;  3ZT3 A;  5AQG A;  3D0P A;  4OPA A;  2X6S A;  5JS2 A;  4LFC K;  2QXL A;  5FPN A;  5EX5 A;  4DKW A;  3OYJ A;  3LPU A;  3MN9 A;  3VEW A;  3KLF A;  1A5V A;  1ASV A;  3HBT A;  3ZT0 A;  4LC9 B;  2GEL A;  1QHT A;  1RDA A;  3ZYY X;  4J2B A;  3LM9 A;  4C23 A;  1NKC A;  4O55 A;  3GOI A;  3N4Q A;  4EAH D;  4FJN A;  3P39 A;  4WYB A;  2NRV A;  4BGA A;  3PO5 A;  3CI5 A;  1ATR A;  3QDK A;  1C0U A;  1Y97 A;  3CET A;  3CCQ N;  5AQX A;  4BR2 A;  1VSK A;  4OPJ A;  3AVJ A;  3O8M A;  1E4F T;  4YOT A;  4CJE A;  2HST A;  2OPS A;  3A0I X;  2KZM A;  2KKZ A;  4JD2 B;  4DWI A;  3VF2 A;  4I9L A;  4O0J A;  1TK8 A;  4LF7 K;  4DV1 K;  3K5L A;  2VG6 A;  2YJF A;  3V6D A;  3ATU A;  3RSE B;  4H0O A;  4YNQ A;  1RDU A;  3R6M A;  3PSI A;  1LAW A;  2A5X A;  4BEB A;  4X62 K;  2JWL A;  3U3G A;  1KVC A;  3OA9 A;  3QFP A;  1LV5 A;  1HMV A;  1VQO N;  4U67 L;  2GUP A;  2IDO A;  4KKO A;  4FSV A;  4CW7 B;  1VSJ A;  5AQU A;  1GOA A;  1WNS A;  3EYZ A;  2KTQ A;  1TUY A;  2RN2 A;  4CEB A;  1CZB A;  3TWH A;  1QSS A;  2YHY A;  3CFP A;  4GNI A;  3VF4 A;  3V9U A;  1QS4 A;  4PUO A;  1TK0 A;  4DUY K;  3ZX2 A;  4DSE A;  2YX6 A;  1IKW A;  2E6L A;  2HF3 A;  2IVP A;  1JLE A;  3SQ2 A;  4CHO A;  4FZY A;  4BDP A;  4DV0 K;  2HBJ A;  3CJB A;  4FM1 A;  4DTS A;  1XNR K;  4AHC A;  3J7Z O;  3EZ5 A;  2ZQB A;  3CCR N;  1X9M A;  4CBU A;  1VQ7 N;  2X74 A;  3ISN C;  4KPY A;  4DFJ A;  3M8P A;  4DMN A;  4NCB A;  1TGO A;  3AVK A;  2A3Z A;  4CZI A;  4JI3 K;  1U49 A;  3C95 A;  2H3G X;  4FWK A;  4LSN A;  4BR5 A;  4FVM A;  4DR7 K;  1VQM N;  2QM1 A;  3NH2 A;  3NFA A;  3QML A;  3KWG A;  4CF9 A;  3VQQ A;  1YTA A;  2W41 A;  3ZX0 A;  3OYI A;  3OJU A;  3CCS N;  1VQN N;  2KQ2 A;  3FZK A;  3HRG A;  3WNE A;  1H1V A;  1SKR A;  3U6F A;  1KAZ A;  3LWM A;  4C1N K;  3SCX A;  4BQL A;  4KH5 A;  4DR4 K;  2GX9 A;  1BG3 A;  3CQY A;  2QWR A;  1HLU A;  4KAZ A;  1N33 K;  4PA1 A;  5FPD A;  4FOE A;  2X78 A;  4AHT A;  4W5N A;  4X66 K;  3AVF A;  5HRS A;  2E2N A;  4AHU A;  4DR5 K;  5EVZ A;  4JHD B;  4M3U A;  2QWO A;  2VQE K;  4BRN A;  4V19 S;  3SNN A;  3CCL N;  2NRX A;  3OYC A;  1T6D A;  1BCM A;  4CI6 A;  5HRO A;  1SL0 A;  2QKK A;  1ZBU A;  1HNI A;  3CPW M;  2BH1 A;  2G8W A;  2HW3 A;  2RKI A;  3A5N C;  4WQ4 A;  5M1F A;  1S6P A;  5C15 A;  3V1O A;  4BRH A;  3ZSW A;  5AZJ B;  3CM6 A;  3QB0 A;  4JI5 K;  3U3Y A;  4F4K A;  2NZT A;  4Z4E A;  5AQF A;  2UXD K;  3R3L A;  1SZ2 A;  4WQ4 C;  1N34 K;  4DTM A;  4CZF A;  4FWM A;  2BE2 A;  5JVH L;  1NMD A;  2G8F A;  1K8K B;  3VES A;  4UQG A;  1RGI A;  1ILY A;  2LSN A;  1HYV A;  4NXN K;  3LDQ A;  1SAZ A;  4CED A;  2NRR A;  3QO9 A;  3ENB A;  1BCO A;  2EWS A;  1D9F A;  2OAN A;  3SK3 A;  2P9U A;  4F3T A;  3QIO A;  4H0T B;  1TAU A;  3L4I A;  1V4S A;  3FE1 A;  3CCU N;  5CE3 A;  2B5J A;  4DQI A;  4CIF A;  1J5E K;  5AZI A;  4E0D A;  2Z1H A;  5DK5 A;  2IGI A;  4JKD A;  2QEX N;  2HNY A;  3GDQ A;  3KZB A;  3WXL A;  4GKK K;  4N76 A;  2D0O A;  3PIP L;  2V51 B;  1VQ5 N;  3KK7 A;  2OTL N;  4HHT A;  1S9E A;  3CCE N;  2JWK A;  4GY2 B;  1YT3 A;  2PZS A;  1HKG A;  1U4B A;  3OYL A;  4CER A;  3V81 A;  2X6N A;  2QTD A;  3WT0 A;  5KTQ A;  5AQP A;  3VQ8 A;  4FOI A;  1RIL A;  3AA3 A;  1TKD A;  3C6T A;  1D8Y A;  3KKR A;  4E1M A;  5AJ3 K;  3P1G A;  1OH6 A;  1JLB A;  1JXB A;  4C1N I;  3TAP A;  3BZK A;  4PKH A;  3C6A A;  1GLJ O;  4I6M B;  4BE1 A;  3V9Z A;  3L3V A;  1FW6 A;  4WQ5 A;  4JI1 K;  1S9G A;  3DXM A;  3IMX A;  5C25 A;  3CD6 N;  1FKO A;  4DQR A;  3MDQ A;  4FJJ A;  1BQM A;  1WSI A;  1YI2 N;  3O4N A;  2QI2 A;  4FWR A;  5CZ1 A;  1IBM K;  4F2S A;  4WQ5 C;  3H08 A;  3I8D A;  1J6Z A;  3U4L A;  3O3F A;  5AQS A;  4CFD A;  3K9K A;  4HUF A;  3AGK A;  4BEC A;  1X3N A;  4M3Z A;  4PKG A;  3NHG A;  1WAJ A;  4CJR A;  3V1Q A;  1T8E A;  4YOY A;  4FPA A;  4CBX A;  1HNV A;  3MX5 A;  3CG7 A;  1ZBS A;  4Y0W A;  2EX3 A;  4BG8 A;  3TSU A;  2P9K B;  4CES A;  2G8I A;  3PO4 A;  2ASO A;  1YUW A;  4LY7 A;  4RW4 A;  3BDP A;  1SUQ A;  1KCF A;  4BWJ A;  3OYE A;  4Z4F A;  3CJ1 A;  4DFM A;  2FF3 B;  1FXX A;  3VEX A;  4BVP A;  3AVA A;  3KJV A;  4PL7 A;  2E1Y A;  3D2F A;  4OGC A;  3O9T A;  2VGM A;  1C6V A;  1QSL A;  1KVA A;  2Y1J A;  1XQS C;  5AQJ A;  5T7B A;  4IFY A;  4PY5 A;  1NGC A;  1DEJ A;  4DB3 A;  2P51 A;  1OKJ A;  1KVB A;  4RG8 A;  5BRE A;  1T3V A;  4E7K A;  1NKE A;  1B9F A;  1S1W A;  3HK2 A;  1Y64 A;  4DTR A;  4A5A A;  3UKU A;  4N5S A;  3VGM A;  3SZ2 A;  4CD1 A;  4XEI A;  2RF2 A;  3SYZ A;  1KD1 O;  1VK0 A;  4J8F A;  4RWT A;  4W5R A;  5IT9 O;  3D2E B;  3AVG A;  1UAX A;  1OH7 A;  4LF9 K;  3WEE B;  4O8U A;  3NF7 A;  4FWL A;  4JKA A;  3NF9 A;  3O1W A;  4JV5 K;  5HRN A;  1HYS A;  1RBT A;  4C8K A;  4BAC A;  3BGR A;  1L3S A;  4FJM A;  4FJX A;  1ZBH A;  2QWL A;  4BWM A;  2AJQ A;  1IKY A;  1SL1 A;  5BRD A;  3CME N;  3ZEU B; 
#chains in the Genus database with same CATH homology
 5LJV A;  5KPR A;  1YHQ N;  3RSE A;  3A5L C;  3WXK A;  3WXM B;  4B1W B;  2ASP A;  2W00 A;  3ULE B;  4H5T A;  3FLC O;  4BRL A;  3M5R A;  5EY4 A;  3VTI A;  4DCH A;  1N8R O;  1NGB A;  5AQL A;  1SS6 A;  1QZ6 A;  1JCF A;  4B1V A;  1NGF A;  4AF1 A;  2P9L B;  5H1S Q;  1NJI O;  3ZX3 A;  2QWN A;  4YDU A;  5BR9 A;  2GTD A;  4E1J A;  1BWF O;  2VWB A;  1D4X A;  1NGH A;  4MO5 A;  4BRC A;  1KC8 O;  3P38 A;  2CH6 A;  1BDG A;  4EHU A;  4MDA A;  4NLB A;  1CZA N;  5ADX H;  1HUX A;  1NLV A;  5AQH A;  1MDU B;  3R9P A;  3ENH A;  3T7Z A;  4BRO A;  1NM1 A;  4YDU C;  4GV3 A;  3SAH A;  1XUP O;  3E9O A;  3ZEU A;  2HBM A;  2ZJR L;  4FVU A;  1NGD A;  2E2O A;  3A5O C;  2UYT A;  5B8H A;  5AQG A;  4OPA A;  1SQK A;  4O8K A;  4F9O A;  1RFQ A;  3D2F B;  3H45 C;  1IG8 A;  1HJO A;  3HM8 A;  2QXL A;  5FPN A;  4H0X B;  3MCP A;  5EX5 A;  3OBW A;  4DKW A;  3EE8 A;  3DWL A;  4KBO A;  3G4S N;  1K9M O;  2P9I A;  1BUP A;  4A59 A;  4FO0 A;  3NMU A;  3MN9 A;  1ZXO A;  2P9L A;  2V52 B;  5AQM A;  3VEW A;  3SMS A;  3HBT A;  3CC4 N;  2A42 A;  4LC9 B;  4B1X B;  2NLX A;  2GEL A;  2F9T A;  4BQZ A;  4FPB A;  5E26 A;  4EFH A;  3ZYY X;  4BR0 A;  3CCV N;  4CZG A;  3SAF A;  3LM9 A;  4C23 A;  3GOI A;  3N4Q A;  3D7E O;  2RHK A;  3UE5 A;  3P39 A;  4EAH D;  5KPT A;  5GAD P;  4WYB A;  2NRV A;  4BGA A;  3EE9 A;  1TUU A;  3VEZ A;  4GVE A;  3R1X A;  2YI1 A;  3CI5 A;  3NVM A;  1ATR A;  2NRT A;  5BN9 A;  1QQO A;  3QDK A;  3CHW A;  3CET A;  2A41 A;  3A5M C;  5AQT A;  2E2P A;  3WQU A;  3CJ9 A;  4A2B A;  5AQX A;  3CCQ N;  4B1Z A;  1YIJ N;  4BR2 A;  2FF6 A;  2P9S B;  4WF9 L;  1KXP A;  3DLL L;  3HTV A;  4JN4 A;  3O8M A;  5KQ8 A;  1E4F T;  4YOT A;  1YAG A;  4JKC A;  3E9P A;  2HST A;  3A0I X;  3I33 A;  3MCA B;  2KKZ A;  4JD2 B;  3ID8 A;  4WFB L;  4CZH A;  1GLC G;  4YOR A;  4XH1 A;  3O9R A;  4OPH A;  3VF2 A;  2ZGZ A;  1NGE A;  5AR0 A;  4IO8 A;  1C0F A;  1P90 A;  4MDB A;  4JKG B;  3JXU A;  1QQM A;  3EKU A;  4IWV A;  4GV6 A;  1ATS A;  2QA4 N;  2AA4 A;  3QBX A;  3AAR A;  4BRD A;  4BRK A;  2YJF A;  4CD3 A;  3ATU A;  4HTL A;  3TTD A;  3RSE B;  4H0O A;  1Q86 O;  1RDU A;  3R6M A;  1KAY A;  2A5X A;  5TKW A;  4BEB A;  4QS7 A;  3OHR A;  3QIC A;  3CXC M;  4MLH A;  2ASM A;  2JWL A;  5CR4 A;  2A6A A;  3OA9 A;  3QFP A;  3NVK A;  5C12 A;  3DXK A;  5AQO A;  4ISG A;  5M1K A;  5JLH A;  5AQK A;  1VQO N;  4U67 L;  2GUP A;  1S22 A;  4FSV A;  4IJA A;  3BUZ B;  1GLA G;  4K43 A;  2I7P A;  3LM2 A;  2Q1N A;  5AQU A;  5GIO A;  4YOV A;  3P31 A;  1TUY A;  2HBK A;  3IFR A;  4JD2 A;  5AQN A;  3CQX A;  5AFU H;  3SBT A;  2ITM A;  4DQ8 A;  3L6Q A;  5LY3 A;  2YHY A;  2FSK A;  1V4T A;  1GLD G;  3VEO A;  1ZC6 A;  3C65 A;  4GNI A;  2D0P A;  4AM6 A;  3VF4 A;  4QS8 A;  2Q36 A;  3ZX2 A;  3F2K A;  1W97 L;  4IZ9 A;  2YX6 A;  1K73 O;  2E1Z A;  3MMV A;  3IDH A;  3GL1 A;  3ID6 A;  2HF3 A;  2IVP A;  4FWP A;  4BRM A;  3O9Q A;  2Q0R A;  2E20 A;  1QQN A;  3CJA A;  3CF5 L;  2HBJ A;  3CJB A;  1GLB G;  5EOY A;  4FWQ A;  1VQK N;  2VYP A;  1WOQ A;  1NGA A;  3J7Z O;  4ISE A;  3I56 N;  4B1Y B;  3CCR N;  2P9I B;  3HOT A;  4CBU A;  1VQ7 N;  2YHW A;  1U6Z A;  2IVN A;  1YIT N;  4H5W A;  5ELZ A;  2QWM A;  4BRF A;  4FWO A;  2P9P A;  3F5T A;  4K41 A;  4BR7 A;  2ZF5 O;  2A3Z A;  4CZI A;  1X9J A;  1Q82 O;  3VET A;  3N4P A;  2H3G X;  4FWK A;  2E8A A;  2V7Y A;  4BR5 A;  4NLC A;  4YOU A;  4CZM A;  4AM7 A;  1VQM N;  4H0P A;  5AQR A;  3O1B A;  2QM1 A;  3QML A;  3KWG A;  3G25 A;  2D4W A;  1KAX A;  4MO4 A;  2P9N A;  2PFU A;  4OO1 J;  3LDP A;  2W41 A;  3ZX0 A;  5BRH A;  3CCS N;  1VQN N;  2FXU A;  3P4I A;  3FZK A;  3HRG A;  5HOO A;  4H03 B;  3A8Y A;  4YOW A;  1HKB A;  1H1V A;  1KAZ A;  4C1N K;  4BQL A;  2CGK A;  4KH5 A;  1VQL N;  4WCE L;  2GX9 A;  1BG3 A;  3CQY A;  2QWR A;  4BC2 A;  1HLU A;  3ATV A;  3CC7 N;  5AQZ A;  4JNE A;  5AQW A;  5BRF A;  3E9L A;  3DJC A;  4BR4 A;  4JEP A;  2PBD A;  4FOE A;  5FPD A;  2D1K A;  3AAP A;  4BRQ A;  2ZWH A;  4DHY A;  2E2N A;  2RE2 A;  3MWP A;  4JK8 A;  4XH4 A;  5EVZ A;  4JHD B;  3G6E N;  3CCJ N;  2QWO A;  1E4G T;  4BRN A;  5EXW A;  3GE1 A;  3CCL N;  1O13 A;  4BRP A;  2NRX A;  4CZJ A;  1T6D A;  5BN8 A;  4BE7 B;  3AAQ A;  3DXK B;  4CI6 A;  3CER A;  4IXC A;  4FWN A;  1S72 N;  4IJN A;  3R8E A;  3PIO L;  1WUA A;  3QBW A;  3CPW M;  1G99 A;  2BH1 A;  3TTC A;  5C0Y A;  3FR0 A;  3H1V X;  2P9U B;  1VQ9 N;  2GWK A;  2BUP A;  3A5N C;  4WQ4 A;  5M1F A;  4UY8 O;  3HSC A;  5C15 A;  4BGB A;  4YOX A;  5C2D A;  3LDL A;  2HOE A;  3LDN A;  4B1U B;  4IEE A;  4BRH A;  5I9E B;  3SMP A;  2E2Q A;  1ESV A;  5AZJ B;  5GAG P;  1LCU A;  1GLL O;  2WUS A;  1TYQ A;  3QB0 A;  2ZJQ L;  1VQ6 N;  1R59 O;  5AZI B;  3W3D A;  4BRE A;  2NZT A;  3H3N O;  4IOX A;  3EN9 A;  4K25 A;  3TPQ A;  5AQF A;  4BC4 A;  3R3L A;  1SZ2 A;  4WQ4 C;  3TTF A;  3ZET A;  5MLC Q;  4IOA L;  4CZE A;  4H5R A;  4CZF A;  3O80 A;  4JHD A;  4FWM A;  4JKE A;  3Q7C A;  4H0Y B;  2V7Z A;  3C0B A;  2C1G A;  3M6G A;  3OW2 M;  3UKR B;  1RDW X;  3IUC A;  4JAX A;  3VER A;  5FPE A;  5JVH L;  4EIA A;  1EO1 A;  2DPN A;  1YJN N;  2Q97 A;  1GLE G;  1NMD A;  3C6H A;  1K8K B;  1Z05 A;  4JKF A;  1P8Z A;  3VES A;  1RGI A;  1VQ8 N;  1HX1 A;  1ILY A;  5GAH P;  4KH4 A;  3LDQ A;  1SAZ A;  3OBY A;  2NRZ A;  2NRR A;  3ENB A;  2EWS A;  3L0Q A;  5M1Q A;  2HMP A;  3M3Z A;  3U9D A;  3WQT A;  3ENO A;  2P9P B;  2OAN A;  2QWP A;  3SK3 A;  2P9U A;  1JCG A;  2Q31 A;  3WXI A;  1QZ5 A;  3J8A A;  3FGU A;  5F0X A;  2E88 A;  4H0T B;  4IEI A;  4A2A A;  5JIC A;  2IVO A;  2NNW A;  3T69 A;  3L4I A;  1V4S A;  5C2F A;  3FE1 A;  3VGL A;  1LOT B;  2PAV A;  3F9M A;  5AZJ A;  5CE3 A;  5CHI A;  5BPL A;  3LDO A;  4FWS A;  5BPM A;  1QVF M;  3EO3 A;  5AQQ A;  3TSP A;  4IFE A;  5AZI A;  3AY9 A;  5C10 A;  4JKD A;  2QEX N;  2J4R A;  2P9N B;  3GDQ A;  4IDH A;  3AGR A;  5AQY A;  3KZB A;  4WFA L;  3WXL A;  2BTF A;  3MX2 A;  3PLA A;  1DT9 A;  2D0O A;  3PIP L;  4PKI A;  1GLF O;  1MWM A;  3UKR A;  1M1K O;  3E1Y A;  3MK6 A;  2V51 B;  3D6R A;  2F9W A;  3GG4 A;  3KK7 A;  2YHX A;  2ZGY A;  3O6W A;  1VQ5 N;  5F2R A;  2OTL N;  3CJ7 A;  3DXM B;  3CJC A;  2YCH A;  2W40 A;  3WUH A;  2JWK A;  1K8K A;  4GY2 B;  3CCE N;  1HKG A;  4WFN L;  1BOT O;  3E66 A;  4ILH A;  3B8A X;  2QTD A;  3WT0 A;  3DAW A;  4H5N A;  3EKS A;  5AQP A;  4BG9 A;  4IO9 L;  3GBT A;  4CZL A;  3O08 A;  4FOI A;  4FL9 A;  5KQD A;  2QW9 A;  1C0G A;  4PL8 A;  2KLA A;  1YJW N;  1M90 O;  1NBW A;  3BF3 A;  1VAZ A;  3BF1 A;  1Q7Y O;  3MWT A;  4BRI A;  3CPE A;  3EZW A;  3D2E A;  4C1N I;  4RCH A;  2CGL A;  1YXQ A;  3Q7B A;  3VTH A;  3O9S A;  5KPZ A;  3M1F A;  4BVO A;  3WEE A;  3C7N B;  4PKH A;  3VEV A;  5ADX A;  2HF4 A;  3FZH A;  3C6A A;  1GLJ O;  4I6M B;  1W2B M;  3LL3 A;  2FSJ A;  3H3O B;  2F7T A;  3JS6 A;  4CZK A;  3MN5 A;  3CCM N;  5DM7 L;  3I55 N;  3FZM A;  4O5F A;  4WQ5 A;  3TSQ A;  4Z94 A;  1NGG A;  3DXM A;  3IMX A;  5AQV A;  4U7B A;  1QHA A;  4PHT X;  4KH6 A;  4M63 C;  3S41 A;  3IKM A;  3CD6 N;  5E84 A;  1KQS M;  5M1O A;  4A57 A;  3MDQ A;  4A61 A;  4EHT A;  1NWK A;  1YJ9 N;  1T44 A;  1Q18 A;  1QVG M;  1TYQ B;  1YI2 N;  4BC5 A;  4B9Q A;  5F1X A;  1T6C A;  1EQY A;  2QI2 A;  4FWR A;  1U2V B;  5TKY A;  2WBN A;  4WQ5 C;  3VMF B;  1BO5 O;  5JVG L;  3SLC A;  4QS9 A;  4RTF D;  3ZET B;  2YJE A;  5GIP A;  1JJ2 M;  1Z6R A;  1J6Z A;  3ULE A;  1BA1 A;  3U4L A;  1DGK N;  3BEX A;  3K9K A;  5AQS A;  3AGK A;  3CIP A;  3CCU N;  4BEC A;  1Q81 O;  1X3N A;  3BP8 A;  2KHO A;  2QWQ A;  4PKG A;  5HL7 L;  1JCE A;  2VCP A;  3EL2 A;  4YOY A;  4FPA A;  4CBX A;  3C7N A;  4L3Q A;  3MX5 A;  2ZJP L;  4JK9 A;  4I6M A;  3H6E A;  5M1P A;  3HOS A;  3G71 N;  2OTJ N;  1S3X A;  3O5B A;  1NGJ A;  3VEY A;  1ZBS A;  4Y0W A;  2GWJ A;  3VGK A;  4BG8 A;  4GV9 A;  3TSU A;  3UKU B;  3KWI A;  2P9K B;  2NRH A;  1BU6 O;  2ASO A;  4IOC L;  1YUW A;  2NRW A;  3KHY A;  1OVY A;  1U2V A;  1X3M A;  1YVN A;  3L4Q A;  4M7X A;  4BY9 C;  4G9Z A;  4R79 A;  3VOV A;  3CJ1 A;  3SBG A;  2FF3 B;  3VF6 A;  1YF5 L;  3SAG A;  3VEX A;  1HPM A;  5FPM A;  4NO7 A;  1BA0 A;  4BVP A;  1K8A O;  2I7N A;  2C1I A;  1IJJ A;  2E1Y A;  2IIR A;  3D2F A;  4PL7 A;  3O9T A;  2VGM A;  4H0V B;  2VGN A;  3HZ6 A;  4HWI A;  4BRG A;  3TU5 A;  1XQS C;  2CGJ A;  3O4W A;  5AQJ A;  4BRA A;  2Q0U A;  3MN6 A;  4XH5 A;  5DM6 L;  3HI0 A;  3VEN A;  1NGC A;  1XC3 A;  1DEJ A;  4DB3 A;  1MWK A;  4H5V A;  4M7Y A;  1OKJ A;  5BRE A;  1DKG D;  1T3V A;  5GAE P;  5M1N A;  2Q2R A;  1Y64 A;  5AQI A;  3U9Z A;  3VPZ A;  4BR9 A;  4A5A A;  3UKU A;  2P9K A;  3CMA N;  2FSN A;  3VGM A;  4CD1 A;  2CH5 A;  4XEI A;  2WC9 A;  1KD1 O;  4A5B A;  5AFU A;  3WXJ A;  4CBW A;  4J8F A;  4RWT A;  1VQP N;  5JMV A;  3H1Q A;  3W0L A;  2A40 A;  3CC2 N;  3D2E B;  3SJH A;  2P9S A;  4JKB A;  4XJX A;  3QFU A;  3WEE B;  2AP1 A;  3O9U A;  4O8U A;  5JLF A;  2FLO A;  3H46 O;  3K9J A;  4FWL A;  4ILG B;  4JKA A;  4MLE A;  3U8X A;  3O1W A;  1MA9 B;  1HKC A;  5BPN A;  5GIN A;  4ISF A;  4BC3 A;  1NGI A;  4NB4 A;  4K42 A;  2HBL A;  3UB5 A;  4CJ7 A;  1VQ4 N;  3FZL A;  4A62 A;  2QWL A;  3FZF A;  3I8B A;  2WFB A;  4JKG A;  1ATN A;  2GEM A;  3FFK B;  3RVC A;  5BRD A;  4JKH A;  3ZEU B;  3CME N;  4JK7 A;  5LJW A;  3KVG A;  3MN7 A;  4ILJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...