1TYQB

Crystal structure of arp2/3 complex with bound atp and calcium
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
208
structure length
208
Chain Sequence
VLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-related protein 3
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
total genus 57
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2004-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1tyqB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1tyqB02
4M7XA 3U9ZA 1NM1A 3ULEA 4ISGA 4AM6A 1EQYA 1HKCA 4A61A 1E4GT 2ZWHA 4QS8A 4WYBA 4BC2A 3SMPA 5AQKA 4QS9A 4CBXA 2GWJA 3FZHA 3FZMA 3IFRA 4B1UB 4FWLA 1QHAA 1DGKN 4FWNA 4H0TB 2AA4A 3ZX3A 5EXWA 3ZEUA 3A5OC 1V4TA 2GTDA 2W41A 3BF3A 3EN9A 4BRDA 3VENA 3W0LA 3AARA 3KVGA 3L6QA 2E2OA 2EWSA 5AQXA 2A6AA 5EOYA 3EKUA 1HJOA 2E20A 2YHYA 2V52B 2IVPA 4MLHA 4KBOA 4IXCA 1KXPA 3J8AA 5AQUA 4O8KA 4BC5A 2GEMA 3ZX2A 1X3NA 3WEEB 3MCPA 3DXMA 5AFUH 5KQDA 1NMDA 3BF1A 4BRCA 1NGEA 1T6CA 2QM1A 5BPMA 3EL2A 2GWKA 2P9LA 1U6ZA 2ASPA 5KPTA 4BG8A 1BUPA 2ZF5O 1XQSC 4BC3A 3GOIA 3WQTA 1LCUA 3VF2A 3I8BA 1NGHA 3ATUA 2P9PA 2HF4A 2CGKA 1NBWA 3DXMB 1GLLO 3CJBA 1IG8A 5BRFA 5E26A 5BRDA 5AQIA 1Q18A 3A0IX 2FXUA 1H1VA 2D0OA 2YI1A 4H0XB 4BRFA 4FOEA 4BVPA 3MN6A 3H45C 4IZ9A 3LDNA 3LDOA 5AQQA 4K43A 5JLFA 5LY3A 4H5NA 3FE1A 4GY2B 5BN8A 3CJ1A 3VOVA 3BUZB 3D7EO 4FO0A 3SK3A 3D2FB 1NGGA 4K41A 5ADXH 2P9UA 3WXKA 3WQUA 2BUPA 3EKSA 1YAGA 2YJFA 3O1BA 4JHDA 4BVOA 2P9IA 2ZGYA 4EAHD 5AZJB 4BRLA 1G99A 4BQZA 2Q97A 4BRMA 2NRHA 4DB3A 4BR9A 4ISFA 2CH5A 4EIAA 4XH4A 2IVNA 2WUSA 3O4WA 3CI5A 4BR2A 3MN7A 4NO7A 5AR0A 4H0PA 3FZLA 4WQ5C 2P9KA 5I9EB 2P9UB 1P8ZA 3UKRA 5KPZA 3QFPA 4LC9B 3LM9A 3EZWA 1SAZA 2OANA 5JLHA 2E2PA 2IIRA 4A2BA 3H1VX 1K8KB 4YDUA 2Q2RA 4BG9A 2QWPA 3O1WA 3MMVA 4JN4A 4B1XB 2P9KB 4PL8A 3UKRB 2P9NB 2D1KA 1DKGD 3MK6A 1NWKA 2FSNA 3U9DA 5AQNA 4H0YB 4BGBA 2YHWA 3WEEA 1QZ5A 2QXLA 1GLCG 1HKGA 3CQYA 3CERA 2AP1A 1HKBA 1MWMA 1GLJO 2FSKA 4GNIA 1HLUA 1BA0A 3FLCO 4A62A 2YCHA 4DCHA 2CGJA 3VEWA 5BRHA 2QW9A 1R59O 3A5MC 3LDLA 5F2RA 3BEXA 2FSJA 3ZETB 3WXIA 3VEZA 3VPZA 1NGAA 5AQOA 2GELA 3VGLA 5AQFA 5FPDA 1QQMA 2ZGZA 2QWRA 1WUAA 3GL1A 1S22A 3C7NB 4E1JA 1E4FT 1KAZA 3QBWA 1JCGA 3HBTA 4Z94A 5AQSA 4H0VB 3CHWA 1TUYA 5AQPA 3FZFA 3TU5A 3IMXA 4XEIA 2A3ZA 2F9WA 1ATRA 3CETA 4B1ZA 3O08A 4BGAA 4BRKA 1V4SA 4RCHA 2H3GX 4FSVA 1ESVA 5BR9A 1BWFO 3QBXA 4FWMA 1X3MA 4FL9A 1SQKA 3VEYA 3VESA 3QMLA 4H5VA 5ADXA 1IJJA 1MWKA 1SZ2A 2NZTA 4H0OA 5FPMA 2E2NA 3LM2A 1Y64A 5AQLA 5EY4A 3TPQA 1C0FA 3D2FA 3B8AX 5KPRA 5AZIB 2ASOA 1ATSA 3ATVA 2FF3B 5AQRA 4BRAA 3CJ7A 1BDGA 1BO5O 2VCPA 3R6MA 5BPLA 4JD2B 1RFQA 4BR4A 5AZJA 1KAXA 4M63C 1Z6RA 5AQVA 2W40A 1NGJA 3UE5A 1C0GA 3M3ZA 2PAVA 2A5XA 4RWTA 4K42A 4CZEA 1ZC6A 5AQYA 4CZHA 3AAPA 4BC4A 2Q0UA 3FFKB 1QZ6A 4EFHA 4FWRA 3WXJA 3OHRA 2E8AA 3EO3A 4MO5A 5JICA 5AQGA 2QWOA 3FR0A 3H6EA 4MO4A 4NB4A 4CZIA 5E84A 3L0QA 3BP8A 2E88A 2IVOA 2Q36A 3LDQA 4BREA 2I7PA 4DQ8A 2V7ZA 1ATNA 3DJCA 4EHUA 1GLAG 3FGUA 1K8KA 5BPNA 2J4RA 4BRHA 4CZJA 3CJCA 2V7YA 3ENOA 2P9NA 3VF6A 3RSEB 4I6MB 5FPEA 5ELZA 5AQJA 3QDKA 1TYQB 3C0BA 3O80A 4FOIA 4F9OA 1GLFO 4MLEA 3DXKB 3G25A 1GLEG 2D4WA 2KHOA 2F9TA 1CZAN 4FPBA 4XH1A 4PKHA 4H5RA 2P9SB 3AY9A 5AQWA 3UKUB 3F9MA 3LDPA 2D0PA 5AQZA 5FPNA 4EHTA 3IUCA 3VEXA 3ID8A 1JCFA 1U2VB 4IJAA 3VEOA 1BOTO 3ZETA 5AFUA 1T44A 4BRIA 4A2AA 2A41A 4L3QA 5AQMA 4BQLA 3H3NO 3O6WA 3W3DA 4BR5A 4QS7A 4WQ4C 1OKJA 1GLBG 1NGIA 4CJ7A 3C7NA 4CD1A 3U4LA 4C23A 2ASMA 3H1QA 4CZMA 4IJNA 1BA1A 2VYPA 3SMSA 2QWMA 3CJ9A 2FLOA 1QQNA 2V51B 3WT0A 3FZKA 4FWKA 1J6ZA 2BTFA 2NLXA 3CQXA 4AM7A 4PKGA 1RGIA 2E1YA 2DPNA 1HPMA 3D2EA 1HUXA 3ULEB 1XC3A 4FWOA 4IWVA 3JS6A 3KZBA 5AQTA 4H5TA 1JCEA 1RDWX 4BR7A 5AZIA 3R8EA 2GUPA 4K25A 4M7YA 4B1VA 1NGBA 2VWBA 5TKYA 2Q31A 3WXLA 2HMPA 4JD2A 3GE1A 3ENHA 2FF6A 3QFUA 3M6GA 4HTLA 4J8FA 3ZEUB 3CJAA 1S3XA 3D2EB 4FWPA 2I7NA 1TUUA 4YDUC 3QB0A 3ZX0A 1BU6O 3MDQA 2HOEA 4HWIA 3H46O 4BRNA 1MA9B 2E1ZA 2HF3A 1DEJA 2UYTA 3U8XA 4WQ5A 3QICA 4CD3A 3WUHA 5LJWA 3L4IA 3VEVA 4CBUA 4CZKA 1KAYA 5F1XA 2A40A 3R9PA 5AQHA 3VERA 1GLDG 1NLVA 2QWLA 5JMVA 5CE3A 4BRPA 4B9QA 4BRQA 1Z05A 4CZFA 3SLCA 3VGKA 4PL7A 2YHXA 2P9LB 2PBDA 4JNEA 1ZXOA 4PKIA 4FWSA 5F0XA 4ISEA 1X9JA 4Y0WA 3RSEA 4I6MA 3VF4A 5LJVA 5KQ8A 1TYQA 1WOQA 2E2QA 1XUPO 4FWQA 1HX1A 3DXKA 2A42A 3A5NC 3AAQA 4H5WA 4CZLA 3MN5A 5B8HA 2P9PB 3DWLA 1NGFA 2YJEA 2P9SA 4WQ4A 3UKUA 2QWNA 3VGMA 4H03B 1MDUB 4BRGA 3HSCA 3VETA 3HM8A 1NGCA 5BREA 3HZ6A 3CIPA 3KHYA 1U2VA 3JXUA 4IO8A 5EVZA 3O5BA 5BN9A 3A8YA 1LOTB 3GDQA 3I33A 4B1WB 4CBWA 2ITMA 1YUWA 1NGDA 3HTVA 2CH6A 4BROA 2CGLA 4JAXA 1BG3A 3M1FA 3P4IA 1QQOA 4O5FA 4RTFD 5EX5A 3LL3A 4FPAA 3GBTA 3SJHA 3DAWA 2Q0RA 3UB5A 3S41A 1T6DA 3HI0A 4BR0A 3MN9A 4CI6A 2QWQA 1ZBSA 4B1YB 1D4XA 1YVNA 4XH5A 1YXQA 3O8MA 4JHDB 4DHYA 2P9IB 3IDHA 3H3OB 3A5LC 4CZGA 2Q1NA 3GG4A
chains in the Genus database with same CATH superfamily
4GVEA 4AILC 1YJWN 2NUBA 4CCHA 1JLBA 2ZQBA 2GBZA 3THXB 4NCGA 4IO9L 4CBXA 5C15A 4JS4A 2P5GA 4N41A 1IKYA 4B1UB 3RMDA 1DGKN 4B08A 4DFKA 2GV9A 4DR3K 2HB5A 3ZEUA 3A5OC 3OW2M 4E7LA 1YJ9N 1JLEA 2VQEK 4KHSA 3AARA 3L6QA 3O9SA 3R1XA 4DLEA 3SPYA 5SZTA 3IRXA 5AQXA 2EWSA 3G6EN 3EKUA 2V52B 1BGXT 2IVPA 5DK5A 1ASVA 2IAJA 1WBBA 2UUCK 4PHTX 1NK9A 2E5LK 4LY7A 1RDCA 2QA4N 3K5LA 1T6CA 1NK8A 2QM1A 5BPMA 4N5SA 3EL2A 2GWKA 4DTNA 1U6ZA 1HNZK 3RRGA 5KPTA 4BG8A 3QNNA 1RT6A 3D45A 3V9UA 2HBJA 4E1NA 4CF0A 3I8BA 4ELTA 3AVGA 4DSLA 5BRFA 4RW7A 5E26A 5BRDA 3S5TA 4JI0K 4C8LA 4ILHA 1YTUA 1H1VA 3ZSWA 3CPWM 3MXIA 1N6QA 1VQLN 3LDNA 3DRPA 3UIQA 4B8AB 4AHUA 2BH1A 4DFMA 5AQQA 3LP3A 3FE1A 5BN8A 2C1GA 3VOVA 3HJFA 3TSUA 1TKTA 1VQ7N 3QO9A 4NYFA 5ADXH 4HUEA 3WQUA 3MEEA 1K6YA 1KLNA 4CFCA 3ZCMA 1ASWA 1G99A 4IKFA 4BQZA 1C1AA 1TK5A 2NRHA 5AJ3K 2ZD1A 3AVBA 2WUSA 3O4WA 3CI5A 4BDYA 3J80O 3NGYA 4FLVA 3A2FA 4Z4HA 1KFDA 3QFPA 4LC9B 4FLZA 4B9TA 3EZWA 1SAZA 4DV7K 3KWGA 4DQQA 2JGUA 5JLHA 4KHWA 3ZYYX 3VQEA 4I9QA 3H1VX 1K8KB 4BG9A 4IDHA 1SL0A 1NJYA 1HR0K 4G9ZA 3MMVA 3VQ5A 3ZSXA 3ULDA 4JKHA 2P9KB 4IEEA 1WSHA 3UKRB 4CJLA 2Y1JA 1LAVA 4DTOA 3AO4A 5AQNA 5IWAK 3LALA 3NAEA 3D0PA 4JI5K 2QXLA 4DS4A 3BZCA 4PA1A 1TV6A 1MWMA 1MU2A 3SBGA 3U6FA 1GLJO 1BA0A 4CGJA 1IBLK 3TAFA 3LDLA 3A5MC 1L3UA 4IOXA 5C2FA 3HVRA 3PO4A 4KRFA 1VQNN 1NGAA 2R7YA 4X64K 5AQFA 5FPDA 1QQMA 3Q7CA 4JK9A 2FBTA 3C7NB 4QAGA 4E1JA 4N56A 2HHXA 1KAZA 2QXFA 3HBTA 1SKWA 4R5PA 4Z94A 1XNRK 2FC0A 1TUYA 3EZ5A 3FZFA 1WLJA 2A3ZA 3U3GA 2F9WA 4B1ZA 1HYZA 2UXBK 1M90O 2H3GX 4FWMA 3CM5A 3C95A 3KLEA 1Q86O 3IS9A 4H5VA 2YKMA 3PIPL 1MWKA 1L3VA 3F73A 4J2AA 5FPMA 5EY4A 3QINA 2OPPA 2HHQA 5C12A 4F3TA 3D2FA 4DUZK 3ZSQA 1ATSA 2P51A 4BRAA 1XC9A 1I94K 3L2RA 3N4PA 2ZE2A 3MXJA 3MXMA 3HRGA 3OBWA 4BR4A 5AZJA 1OVYA 4HHTA 4M63C 1Z6RA 5AQVA 4CHZA 4CF9A 4CK1A 4M3WA 2PAVA 2A5XA 4RWTA 3KK1A 4K42A 1NU0A 3P39A 4FZXC 5KRSA 3ZSOA 1JJ2M 1D8YA 1LW2A 3CCEN 3AVAA 1RDAA 1QZ6A 4DTUA 3VQ9A 2NRTA 5CYQA 1U45A 3BGRA 1KVCA 2E8AA 3EO3A 3QESA 1K73O 3NCIA 2Q36A 2O4IA 4FJ7A 4IOAL 2V7ZA 2PZSA 1KVBA 3VQ7A 2O8FB 3V1QA 4LD0A 4IFVA 2J4RA 3CJCA 3ENOA 4ID1A 4I6MB 5FPEA 2KTQA 3QDKA 2OPSA 3O80A 3CFRA 1VSHA 4F9OA 3K9KA 1NKBA 1QVFM 3M8RA 3G25A 1GLEG 1W0HA 2F9TA 4XIUA 4JI6K 2G8WA 1FKPA 4XH1A 4H5RA 3SQ1A 2F8SA 2P9SB 5AQWA 2PY5A 3B6PA 4AHVA 2Q3SA 2YX6A 2QKBA 3IG1A 3SUNA 4NYNA 1JCFA 2FBYA 3I0RA 5LMNK 1L3TA 1T44A 2O8DA 4BQLA 2PYJA 1YT3A 4BWMA 4HTUA 1NJWA 3AVKA 3T3FA 4CIEA 3CC7N 4C8NA 3LPUA 3VQ8A 3CQXA 4PKGA 3OYLA 1RGIA 4JRPA 2DPNA 3NH0A 2BE2A 3KZBA 2XHBA 2ZJRL 1JCEA 1C1CA 5AZIA 2G8HA 5HROA 2GUPA 3G4SN 1NGBA 5TKYA 1JL1A 3WXLA 3CC4N 4JD2A 4W5RA 4CJ5A 5KTQA 5JS1A 3ZEUB 4FWPA 3D2EB 3SNNA 4OPKA 3NE6A 3ZX0A 4KTZA 3MX2A 2Z1GA 4GW6A 1Z25A 1DEJA 4CJUA 2UYTA 3CCVN 3SJJA 3WUHA 4AHSA 5LJWA 3G10A 3L4IA 4CBUA 4KKOA 1REVA 1VAZA 4DWIA 3R9PA 5AQHA 1NLVA 5CE3A 3P83D 4B9QA 3PO5A 1Z05A 3SLCA 2G8UA 5FDLA 1DLOA 1Q7YO 2D0BA 3M8PA 3THWA 4I9LA 3VQCA 2PBDA 3DLHA 4JNEA 3F5TA 3VF4A 1X9JA 1NMNA 4Y0WA 5LJVA 4YOWA 4JKFA 1XUPO 3P31A 1NKCA 4FWQA 3EYZA 4PY5A 2A42A 3JAMO 3V6DA 4NCBA 3AAQA 5CR4A 3MN5A 1NJXA 3PV8A 2RHKA 3PX4A 4GV9A 4MDAA 4H03B 1MDUB 3VETA 1CLQA 3TR8A 4F2RA 3JXUA 4FZYA 3O5BA 1S1WA 3GDQA 1QHTA 2YV0X 4DU4A 4ID5A 3CQ8A 1RCHA 2ITMA 3HTVA 3RVCA 1UA0A 4FJ5A 4BROA 4JAXA 1M1KO 1QQOA 3ENBA 2HHTA 4DV4K 4U67L 4H4MA 1FXXA 1T6DA 4BR0A 3MN9A 4CEEA 2DFEA 4FLUA 3ITHA 4DHYA 3HPHA 3H3OB 3IDHA 3A5LC 3SAGA 2Q1NA 5FPNA 3JSMA 4CJEA 4ISGA 3MEDA 1EQYA 3K5MA 1HJRA 3L2WA 4A61A 1E4GT 4BC2A 3SMPA 1ZBIA 4CERA 5KRTA 1IKWA 1B9DA 3PLAA 4CK3A 1X9SA 3E1YA 4OVLA 3DMJA 4LSLA 4B9UA 3DOLA 3OYAA 4FWLA 4FWNA 4H0TB 3AA5X 1WSFA 2W41A 3BF3A 4CJPA 3AO3A 4HVJA 3W0LA 4Z4CA 3SCXA 3K0SA 2E2OA 3HPGA 1TK8A 2O8EA 2A6AA 1BL3A 5EOYA 4DSEA 4MLHA 4QCLA 4KBOA 1KXPA 4X65K 5HOOA 4BC5A 2GEMA 3TABA 3V81A 4DR2K 4F4KA 3ZX2A 3LWMA 3DLGA 1X3NA 3S9HA 4JI8K 4CK2A 4CESA 2ZM6K 5AFUH 1VRUA 3S3NA 4A5BA 4CF1A 3BF1A 3TAMA 1ZBUA 4FM2A 1EETA 3HYFA 1HQEA 2OZMA 1LWFA 4B3OA 3OJSA 1N32K 3EY1A 2KLAA 4I2PA 3WQTA 1LCUA 3CFOA 4MQ3A 3O9QA 2BANA 5TKWA 4FLXA 3ATUA 1JLGA 3KD1E 4X62K 4OPJA 2CGKA 1NBWA 3DXMB 4RW8A 4E7KA 1GLLO 3AVCA 4KHYA 3TTDA 3MECA 1S1TA 3VQBA 5GAGP 4CGHA 1VQ8N 4J2EA 3HP6A 2O8BA 2FXUA 4Z4IA 5FROA 4BRFA 4FOEA 4BVPA 4DTPA 4ILJA 4FJ8A 3LDSA 4LSNA 4BE0A 3KLGA 4H5NA 3WNGA 3BUZB 1D5AA 1VSJA 3SK3A 2E6LA 3D2FB 3NVMA 3DLKA 4K41A 1BCOA 2P9UA 5LL6Z 4DUYK 4LF6K 4JHDA 3HOSA 5AZJB 1IG9A 1S1UA 4BRLA 4DTSA 3DM2A 4CFDA 5HRSA 5M1PA 4W5TA 4LF5K 1WB9A 4DB3A 4BR9A 2CH5A 4EIAA 1F21A 4CEOA 4EZ9A 3CC2N 3OTOK 1HPZA 2Z1IA 3P38A 3V9WA 2XY5A 3I56N 1IBKK 1C1BA 3LM9A 2NRRA 5HRPA 1L5UA 5J2NA 4JKDA 3CCQN 1S1XA 2IIRA 1U04A 4Y1CA 2Q2RA 1UOCA 2QWPA 3O1WA 1ZBHA 1BI4A 3PSIA 1DKGD 4OO1J 3OYFA 3DRRA 3TANA 2WBNA 4LH4A 3TAQA 1XI1A 3AGKA 1OH8A 4H0YB 1Q9YA 5C0YA 2YHWA 2OA8A 3NGZA 4FK2A 4C8KA 2NNWA 3WEEA 3HP9A 2KFZA 5HLFA 3CQYA 4OGCA 1XHXA 2FSKA 4ZTJA 1EWQA 4JI3K 1YITN 3FLCO 1VK0A 1ZBFA 4K8ZA 4PQUA 4DCHA 2CGJA 2QW9A 1R59O 4FM0A 4DFPA 3SPZA 1NK4A 3RR7A 1VSIA 2FSJA 2O8DB 2RKIA 4CFBA 1VSEA 2WC9A 2XRIA 3T1AA 5AQOA 2GELA 4DR5K 3RWUA 5JENA 4BACA 2LSNA 1WUAA 4JK8A 3WNEA 1E4FT 3V4IA 4K0KK 1CXUA 4A59A 1HRHA 3TU5A 4KHPK 4BGAA 1ATRA 3CETA 4V19S 4BRKA 3CPEA 4RCHA 1UWBA 3M5RA 5BR9A 3AVMA 5EU7A 3VESA 2YHBA 3QMLA 1IJJA 3D6RA 4DU3A 1HNIA 3CYGA 1TK0A 2E2NA 1Y64A 5AQLA 1HNVA 3J7ZO 1C0FA 3OS2A 4KPYA 5AZIB 4FJJA 2ASOA 3ATVA 2FF3B 5AQRA 3CJ7A 4GV6A 2VGNA 3R6MA 1SKRA 4HCBA 4JD2B 2W42A 3B6OA 1CZBA 4I7FA 1KAXA 1NGJA 3UE5A 2KQ2A 1C0GA 4M45A 3SBTA 4E3SA 1ZC6A 1D9FA 1NK0A 1NKEA 3NDKA 3V1RA 3AAPA 4BC4A 4KB1A 4AH9A 1U48A 2XY8A 4M41A 3AO5A 4EFHA 1S72N 3E66A 3OHRA 4JK7A 4L8RB 1K9MO 4MO5A 5JICA 5AQGA 3FR0A 4NB4A 4H8KA 3BP8A 3MAQA 4ICLA 2I5JA 1IH7A 4MFBA 1ATNA 4FXDA 4FJKA 4CZJA 1BISA 3LZJA 3THWB 1N34K 2P9NA 4E0DA 1TKZA 4CIGA 4M3TA 5AQJA 1UAXA 3C65A 3SV4A 3F2KA 3P5JA 1BHLA 1WSIA 3QERA 2D4WA 2WFBA 3VQPA 3SI6A 3BZKA 4B9LA 4FPBA 4ZHRA 4GVMA 4PKHA 4FLWA 4E19A 3WXMB 4DV1K 2X74A 3ZT1A 4WE1A 3VTHA 4IJAA 1IV0A 1BIUA 5AFUA 3ZETA 3K5OA 4A2AA 4L3QA 5AQMA 3K2PA 3W3DA 4BR5A 2O8CA 3KKSA 5I3UA 1TVRA 2B6AA 1OKJA 1NGIA 1LAWA 4DTMA 3QEPA 3U4LA 2ASMA 3H1QA 2HW3A 1BA1A 3SMSA 2BGGA 4CJ3A 2FLOA 1QQNA 3DLLL 4CHQA 3VA0A 2G8VA 4O44A 3THVA 2OYQA 1J6ZA 4DTJA 2BTFA 5DM7L 4KAZA 1RDUA 4IG0A 1OH6A 1HUXA 3L3VA 1XC3A 4IWVA 3MWTA 4CEZA 3JS6A 1KC8O 5AQTA 4H5TA 3E9LA 1OH7A 3AVFA 3NF6A 4FJMA 1X1PA 1ASUA 3AGRA 2X78A 4B1VA 2Q31A 1J53A 2HMPA 4DSIA 1C0TA 1JLFA 3EE8A 4HTLA 4YY3K 2WTUA 3CD6N 3SAHA 1RTHA 3NFAA 4CHNA 3SQ2A 4M3XA 3CJAA 1S3XA 4M3RA 1TUUA 4YDUC 4PUOA 1VQ5N 4PWDA 3QB0A 4FZZA 4LF4K 4C1NI 1K8AO 1BU6O 3OYGA 3K59A 2O8EB 4HWIA 3NHGA 1BQMA 4BRNA 4K8XA 4EP5A 4FW1A 4B9VA 3O9UA 3QICA 4CEAA 2ATQA 3VEVA 3O4QA 5F1XA 2JWKA 3L4QA 3VERA 2QWLA 5JMVA 1SUQA 3DOKA 1RBTA 4JEPA 4DSFA 3VGKA 3QLHA 1T03A 1RTJA 4Z4FA 1C6VA 4PKIA 3O3FA 3P1GA 5KQ8A 5E41A 4BDZA 1P90A 1HX1A 3DXKA 2RPIA 4CECA 4H5WA 3RTVA 1YJNN 3KLHA 3ZSRA 3DWLA 2YNFA 4RG8A 1FKOA 4WQ4A 3T19A 1VSFA 3UKUA 2QWNA 4DSKA 1JLAA 4BRGA 3ALYA 3HSCA 5BREA 1X9MA 3AA3A 2O8BB 3CIPA 3KHYA 1U2VA 4FK0A 5EVZA 3G71N 3NGIA 4AQYK 4B9MA 4I2QA 1S9EA 2W6LA 5BN9A 1LOTB 3CCMN 1B9FA 4NCAA 3EE9A 2OPRA 1YIJN 2CGLA 3L2QA 1BG3A 1QE1A 3P4IA 3SV3A 4O5FA 3ZLJA 4N76A 2ZJQL 2IC3A 3DAWA 3WNHA 2PYLA 1NK6A 1ZBSA 1HNWK 1RDBA 4XH5A 4J2DA 4W5NA 3CCUN 4AHRA 4JHDB 3VQ4A 4CZGA 1EWRA 4FLTA 3QNOA 3GG4A 4M7XA 3U9ZA 1NM1A 3C6HA 4HUFA 5I42A 4JKGA 2ZWHA 5HL7L 5M1QA 2G8IA 2O4GA 5AQKA 4QS9A 5LMUK 4CJQA 5KGXA 3FZMA 3IFRA 3LP2A 4NLCA 1S5JA 1N5YA 2RF2A 1QHAA 3AA4A 3SUOA 2AA4A 3ZX3A 5EXWA 2HBKA 1J5EK 4OPAA 3EN9A 4CE9A 3SQ0A 3VQQA 2HSTA 1YVUA 3KVGA 4Q5VA 3HOTA 1TKDA 4FLYA 1CZ9A 1HJOA 2E20A 2YHYA 1BI4B 4IXCA 3J8AA 4FW2A 4O8KA 3T7ZA 4CHPA 3QIOA 5SWMA 3WEEB 5KQDA 1NMDA 1IO2A 4DR4K 3OYKA 4YOYA 3T1HK 3QETA 4ELVA 3E01A 4KFBA 4YOUA 1BUPA 2ZF5O 4BC3A 3GOIA 2WOMA 5CY4A 1XHZA 3PUFA 3QEIA 2HHVA 5KGWA 4DV0K 2UXDK 3VF2A 1NGHA 5J2MA 2OPQA 4DV3K 2QEXN 2P9PA 3L3UA 4JRQA 1IG8A 4IFEA 3TI0A 4F8RA 3K57A 5AQIA 4CEQA 3O3GA 2B4JA 2E4LA 5FRMA 3OS1A 2YI1A 4NLBA 2FBVA 3SAFA 4IZ9A 3RMBA 3OY9A 3TAEA 4K43A 5LY3A 4W5QA 3S3MA 1NJIO 3IKMA 5C25A 3I8DA 3VMFB 1C0MA 4CJKA 5MLCQ 4FJ9A 1DT9A 4LH5A 5M1KA 4WF9L 1NJZA 2OZSA 3M8SA 5C24A 4DF4A 4JI7K 3O1BA 3AVHA 5M1OA 2QK9A 2HHWA 4BVOA 1ITGA 2P9IA 4KHUA 4KHQA 1CXQA 2Q97A 4BRMA 4OKJA 4DTXA 4XH4A 2HNZA 1VSKA 4BR2A 3ZSVA 3T1YK 4H0PA 4WQ5C 2P9KA 5I9EB 3UKRA 1LWEA 1QSYA 4QOZB 2IS3A 1OH5A 2OANA 4GV3A 1U47A 1ZYQA 1VSDA 3NBPA 4YDUA 5GINA 2VQFK 4RW4A 3KLFA 4B1XB 3CM6A 2P9NB 3MK6A 1NWKA 2FSNA 3LP0A 3MWPA 4JI1K 4BGBA 4CJ4A 4CJVA 4X66K 2IDOA 1WSGA 3HPOA 4BE2A 1QZ5A 3OYMA 4OGEA 4CFAA 1Q82O 2AP1A 4M3YA 3DRSA 3KLIA 1HKBA 3QIPA 3L2UA 1EKEA 1HLUA 4KH6A 2YCHA 3VEWA 5KI6A 4OKEA 3C6UA 4CIFA 4FJGA 3QEXA 2OTJN 3ZETB 3ISNC 3K58A 3VGLA 3T69A 1RNHA 3LWLA 3AVNA 1NK7A 1RT4A 5H1SQ 3G0ZA 5HBMA 1JCGA 1RT1A 1SS6A 3QEVA 4B8CA 5AQSA 1KFSA 4EP4A 2GX9A 4XEIA 4IBNA 4DS5A 2HNDA 3I0SA 1V4SA 3V9XA 1HQUA 4FSVA 3CCLN 4FM1A 4JI4K 3CXCM 1SZ2A 2NZTA 3LM2A 1TGOA 2NRWA 3TPQA 3B8AX 3U3YA 4IOCL 2JLEA 2VCPA 4LF8K 3KD5E 1QS4A 3PX0A 4AHCA 4CGIA 2KFNA 3VTIA 3M3ZA 3NH1A 1VSLA 1Y97A 4W5OA 4CZEA 1QSSA 4Q0BA 1VRTA 4CZHA 5JS2A 2X6SA 4UY8O 1JLCA 3FFKB 4B3RK 2YNGA 3THYA 2VWKA 4KV8A 5A2QO 3RRHA 2UUBK 4FWRA 1KCFA 3V9ZA 2QWOA 3H6EA 3O9RA 4MO4A 4CZIA 5E84A 4GKJK 2E88A 1TL3A 2IVOA 2DFFA 3ZT2A 4BREA 4DQ8A 3E9OA 4GKKK 4E7IA 4FJLA 5BPNA 4B3TK 4BRHA 4OPHA 3VF6A 4AF1A 4CHOA 4IDKA 3PSFA 1T7PA 5HP1A 3OYEA 3DXKB 4M3ZA 1W9HA 1A5XA 2HHHK 3UKUB 1QSLA 3F9MA 1RBUA 3LDPA 2ITGA 1L3SA 4NXNK 1TL1A 3IUCA 3DI6A 1U2VB 2PFUA 4DTRA 1KD1O 3VEOA 1U4BA 4BRIA 2A41A 2YKNA 3HL8A 4CJWA 4FJXA 3O6WA 4WQ4C 1GOCA 2EHGA 1WSJA 3N4QA 2EX3A 4CJ7A 1IKXA 4CD1A 3S3OA 4C23A 1KRPA 1JLQA 4CZMA 4IJNA 2QI2A 4KI6A 2QWMA 2V51B 3OYDA 4BEBA 2XY6A 2ZJPL 4B3SK 3FZKA 4FWKA 2NLXA 4AM7A 1HPMA 3NF8A 3D2EA 5J1EA 4FWOA 4JKGB 1RT2A 1C0UA 1T05A 5FRNA 4FK4A 3LAMA 1YHQN 1HYVA 4K25A 1DTTA 1TAQA 1RILA 5GAEP 2WONA 1Q8IA 4YORA 4TSXA 3OA9A 1VQMN 2QTDA 2FF6A 3QFUA 3M6GA 3DYAA 1LV5A 3AO1A 1N36K 2NRXA 3MDQA 2HOEA 5JVHL 4A5AA 3C6AA 3VQ6A 1YTAA 1MA9B 2E1ZA 2HF3A 3NF9A 4KHNA 1KTQA 4OLAA 4KH4A 4WQ5A 4LFBK 4HCCA 4FJIA 1WNSA 5BR8K 2HHIA 1KAYA 2A40A 3LPTA 1S6QA 4R79A 1KSPA 1U49A 4BRPA 4BRQA 3KTQA 1YF5L 4G1QA 1VQ4N 3SZ2A 2YHXA 4Z0UA 5T7BA 5F0XA 4FWSA 2VG6A 3RSEA 3AVJA 1HMVA 3VQDA 3BDPA 3CCJN 1TYQA 4M3UA 1WOQA 2E2QA 5FLXO 4OLBA 1FK9A 4CZLA 4O55A 4E7JA 3TAPA 2P9PB 4CW7B 1ILYA 2W00A 1NGFA 2YJEA 3CCSN 4DQPA 1OVQA 3MX5A 4YOTA 3HZ6A 3HO1A 4JI2K 1X9WA 3OYCA 2VGMA 4J2BA 4YHHK 3RMCA 1R0AA 1HYSA 1YUWA 1NGDA 2CH6A 3M1FA 1S9GA 2HHSA 1Q9XA 4YFUA 4FPAA 2NRVA 3H08A 3HI0A 4JKAA 3KK7A 2OTLN 1W97L 2Y1IA 4RW9A 4BY9C 1D4XA 3O8MA 4N47A 2P9IB 4FJNA 3SUPA 4CGGA 1XNQK 1WAJA 3J7AP 3ULEA 4AM6A 4OKKA 1HKCA 2Z1JA 3J81O 4O4GA 4QS8A 1BQNA 4WYBA 2HMIA 2F96A 3EEQA 3LZIA 5GADP 5CZ1A 2GWJA 2E6MA 3FZHA 4DLGA 3HM9A 1JKHA 1EO1A 3OYHA 5J2PA 4Z4EA 1V4TA 2GTDA 3TSQA 4BRDA 3VA3A 3VENA 2F8TA 3TWHA 4DR6K 4BECA 3LAKA 4IFYA 2A1RA 2X6NA 4DR7K 1EP4A 4JKBA 3NH2A 5AQUA 2DTUA 3KJVA 4NXMK 3HVTA 3DLBA 4FVUA 1O13A 5HRNA 3MCPA 3DXMA 4U7BA 4BRCA 3ZSZA 1RBSA 1NGEA 2P9LA 1RBRA 3PX6A 2ASPA 4YOVA 3KK3A 3OJUA 1VHXA 1XQSC 1DTQA 4E7HA 4LF7K 3RR8A 4KTWA 4CF2A 5M1NA 1VQ9N 3OYBA 5JVGL 4FCYA 2HF4A 4CEDA 3E9PA 2F7TA 3CJBA 2RN2A 3DLEA 4C1NK 2JWLA 2C1IA 1Q18A 3OYIA 3A0IX 3M8QA 2D0OA 4H0XB 1J54A 3K9JA 3MN6A 3H45C 3HXMA 3HSTB 3LDOA 1J9AA 2NRZA 1N8RO 3V1OA 5JLFA 2GUIA 1W7AA 4GY2B 4DF8A 3CJ1A 3TSPA 2AJQA 3D7EO 4FO0A 4CGFA 4DMNA 1NGGA 2KW4A 5K14A 3WXKA 3R3LA 2BUPA 3EKSA 1YAGA 2YJFA 4Y1DA 4EAHD 1SL1A 2ZGYA 3CG7A 4ISFA 1RBVA 2IVNA 2UU9K 3OVNA 3THXA 1EXQA 4JV5K 3MN7A 2B5JA 4DG1A 4NO7A 5AR0A 3FZLA 1Q81O 4DR1K 2P9UB 1P8ZA 3J7YP 3CFPA 5KPZA 3THYB 3AVLA 3QEWA 1KLMA 3TTFA 4BDPA 3CMAN 4JKCA 4DSJA 4CEFA 3AV9A 3CMEN 2E2PA 4A2BA 1G15A 1VSMA 4YNQA 3PIOL 1NG9A 4H4OA 5DM6L 1XMQK 4Z4GA 3ZSYA 4MDBA 4JN4A 1SKSA 4GMJB 4PL8A 5J2QA 2D1KA 2KZZA 2XY7A 1VQPN 3U9DA 2UXCK 3FFIA 5C10A 3NMUA 4UQGA 1Z26A 1GLCG 1RT5A 1HKGA 3CERA 5CYMA 2RE2A 3OYJA 1J5OA 4WFBL 1IBMK 4GNIA 2YNHA 4A62A 4O0JA 3TAGA 1T3VA 3CYMA 4LF9K 5BRHA 2BDPA 2D5RA 4CJTA 1RDDA 2D0CA 2G8KA 5F2RA 3BEXA 2HVHA 3WXIA 2XO7A 1BIZA 3VEZA 4WCEL 5HRRA 3VPZA 4CF8A 2ZGZA 2ETJA 1B92A 2QWRA 3GL1A 1S22A 4IEIA 5C42A 4CVNE 1VQKN 3QBWA 1JL2A 4LFAK 4H0VB 4JS5A 3CHWA 5AQPA 5GAHP 3IMXA 5CHIA 3O08A 1GOBA 4CJFA 1ESVA 1BWFO 2HNYA 3QBXA 1X3MA 3OS0A 4FL9A 3OYNA 1SQKA 3TTCA 3VEYA 3CF5L 5ADXA 3TARA 4H0OA 1NK5A 4E89A 4FVMA 5KPRA 3HK2A 4ELUA 4BE1A 1BDGA 1BO5O 1NOYA 5BPLA 2HVIA 1RFQA 3MCAB 4BE7B 2OCEA 3AA2A 3SUQA 1VQ6N 4B3MK 1S6PA 2W40A 4DU1A 1N33K 1RT3A 1FJGK 3K5NA 1RT7A 2HHUA 1TAUA 4JLHA 3I55N 5AQYA 4IG3A 5DMRA 1LW0A 2Q0UA 4KREA 4A57A 1E3MA 4DV6K 4JKEA 4LFCK 3O3HA 3WXJA 3ID6A 1TKXA 3L0QA 1QQCA 3LDQA 4DKWA 2I7PA 1O1WA 3DJCA 1GLAG 3FGUA 1K8KA 4O5BA 4EHUA 1WAFA 4DV5K 2KZMA 1JXBA 4KTQA 1GOAA 2V7YA 4C8MA 3RSEB 3HT3A 5ELZA 1NOZA 1TYQB 3C0BA 4CHYA 4O0IA 4FOIA 2P5OA 4DQIA 1GLFO 4MLEA 4WFNL 2KHOA 3SQ4A 1CZAN 4OJRA 4ILGB 1KVAA 2F4VK 3AY9A 2W6KA 3F9KA 5GIOA 2D0PA 5AQZA 4EHTA 3VEXA 4YOXA 3ID8A 5M1FA 1ZBLA 1VQON 4E72A 1BOTO 2P1JA 3VN5A 3H3NO 4QS7A 1RTIA 3AVIA 4CEBA 1GLBG 3C7NA 4F2SA 2FBXA 3WNFA 3LP1A 4OX9K 3KWIA 3NF7A 4KI4A 1A5VA 1HNXK 3OBYA 1W2BM 2VYPA 5D3GA 3KK2A 4DV2K 3CJ9A 4CJSA 1WSEA 1KQSM 2YNIA 3WT0A 3ZT3A 3JYTA 1D9DA 4F3OA 1XMOK 2E1YA 2DFHA 3KKRA 2O8CB 1SL2A 3ULEB 2HBMA 3C94A 2G8FA 3O4NA 4CJRA 1BCMA 1RDWX 4BR7A 3R8EA 3SYZA 1YI2N 3PY8A 2UUAK 4M7YA 3DLRA 2IGIA 2VWBA 4AHTA 3GE1A 3ENHA 1LWCA 1I39A 4J8FA 1FW6A 4EZ6A 4XJXA 1QVGM 2I7NA 4B9SA 2Z1HA 4FJHA 3CCRN 1RTDA 5C2DA 4O8UA 3H46O 2QKKA 4JYAK 4BWJA 3L2VA 1IKVA 3AO2A 1JXEA 2KKZA 3U8XA 3VQAA 4ZTFA 4CD3A 5IT9O 3O9TA 4CZKA 2YHAA 4DQRA 3IAYA 1GLDG 4KB0A 2VWJA 4KH5A 4CZFA 2O8FA 1XWLA 2VG7A 3ZT4A 2DY4A 1WN7A 4PL7A 5GIPA 2P9LB 4RW6A 1ZXOA 4ISEA 4I6MA 3NVKA 4DQSA 2HBLA 5CZ2A 1NNEA 4CGDA 3A5NC 4DFJA 5B8HA 1WBDA 1T8EA 2D0AA 2P9SA 3ZT0A 2A1SA 3VGMA 2VG5A 4HUGA 3HM8A 1NGCA 3RMAA 3LANA 4FYDA 4E1MA 4IO8A 3C6TA 3A8YA 1UA1A 3I33A 4B1WB 4M42A 3BY5A 1QTMA 4CBWA 3L8BA 1SV5A 2IOCA 3V9SA 4KO0A 4RTFD 5EX5A 4B9NA 3LL3A 3MEGA 1EX4A 3GBTA 3SJHA 1A5WA 2Q0RA 4C8OA 3UB5A 3S41A 3ASMA 4CI6A 2QWQA 1S1VA 4B1YB 1YVNA 3KIOA 1YXQA 4WFAL 3Q7BA 1I3AA
chains in the Genus database with same CATH topology
4M7XA 3U9ZA 4GVEA 1NM1A 3ULEA 4ISGA 1YJWN 3C6HA 4AM6A 1EQYA 1HKCA 4JKGA 4A61A 1E4GT 2ZWHA 4QS8A 4WYBA 4BC2A 5HL7L 3SMPA 5M1QA 3PLAA 5AQKA 5GADP 4QS9A 4CBXA 5C15A 4IO9L 3E1YA 2GWJA 3FZHA 3FZMA 3IFRA 4NLCA 4B1UB 1EO1A 4FWLA 1QHAA 1DGKN 4FWNA 4H0TB 2AA4A 3ZX3A 5EXWA 2HBKA 3ZEUA 3A5OC 1V4TA 4OPAA 3OW2M 2GTDA 2W41A 3BF3A 1YJ9N 3EN9A 3TSQA 4BRDA 3VENA 4BECA 3W0LA 2HSTA 3AARA 3KVGA 3L6QA 3O9SA 3R1XA 3HOTA 2E2OA 2EWSA 5AQXA 3G6EN 2A6AA 5EOYA 3EKUA 1HJOA 2E20A 2YHYA 2V52B 2IVPA 4MLHA 4KBOA 4IXCA 1KXPA 3J8AA 4JKBA 5AQUA 4O8KA 3T7ZA 4PHTX 5HOOA 4BC5A 2GEMA 4FVUA 3ZX2A 1O13A 1X3NA 3WEEB 3MCPA 3DXMA 5AFUH 5KQDA 1NMDA 4A5BA 4U7BA 2QA4N 3BF1A 4BRCA 1NGEA 1T6CA 2QM1A 5BPMA 4YOYA 3EL2A 2GWKA 2P9LA 1U6ZA 2ASPA 5KPTA 4YOVA 4BG8A 4YOUA 1BUPA 2KLAA 2ZF5O 1XQSC 4BC3A 3GOIA 2HBJA 3WQTA 1LCUA 5M1NA 3O9QA 3VF2A 1VQ9N 3I8BA 5TKWA 1NGHA 5JVGL 3ATUA 2QEXN 2P9PA 2HF4A 2CGKA 1NBWA 3DXMB 3E9PA 1GLLO 2F7TA 3CJBA 1IG8A 4IFEA 3TTDA 2JWLA 4C1NK 5BRFA 5E26A 5BRDA 2C1IA 5AQIA 5GAGP 1VQ8N 1Q18A 3A0IX 2FXUA 4ILHA 1H1VA 2D0OA 2YI1A 4H0XB 4NLBA 4BRFA 4FOEA 3CPWM 4BVPA 3K9JA 3MN6A 3H45C 3SAFA 1VQLN 4IZ9A 3LDNA 4ILJA 3LDOA 2BH1A 2NRZA 5AQQA 4K43A 1N8RO 5JLFA 5LY3A 4H5NA 1NJIO 3FE1A 3IKMA 4GY2B 5BN8A 2C1GA 3CJ1A 3VOVA 3VMFB 3TSPA 3BUZB 3D7EO 4FO0A 5MLCQ 3TSUA 1DT9A 3SK3A 3D2FB 5M1KA 1NGGA 4WF9L 3NVMA 4K41A 1VQ7N 5ADXH 2P9UA 3WXKA 3R3LA 3WQUA 2BUPA 3EKSA 1YAGA 2YJFA 3O1BA 4JHDA 5M1OA 2P9IA 2ZGYA 4BVOA 4EAHD 3HOSA 5AZJB 4BRLA 1G99A 4BQZA 2Q97A 4BRMA 2NRHA 5M1PA 4DB3A 4BR9A 4ISFA 2CH5A 4EIAA 4XH4A 2IVNA 3CC2N 2WUSA 3O4WA 3CI5A 3P38A 4BR2A 3MN7A 4NO7A 5AR0A 4H0PA 3FZLA 4WQ5C 1Q81O 2P9KA 5I9EB 2P9UB 1P8ZA 3UKRA 3I56N 5KPZA 3QFPA 4LC9B 3LM9A 2NRRA 1SAZA 3EZWA 3KWGA 2OANA 3TTFA 3CMAN 4GV3A 4JKCA 4JKDA 5JLHA 3ZYYX 3CCQN 3CMEN 2E2PA 2IIRA 4A2BA 3H1VX 1K8KB 4YDUA 2Q2RA 3PIOL 4BG9A 5GINA 4IDHA 2QWPA 3O1WA 5DM6L 4G9ZA 3MMVA 4MDBA 4JN4A 4JKHA 4B1XB 2P9KB 4IEEA 4PL8A 3UKRB 2P9NB 2D1KA 1DKGD 3MK6A 4OO1J 1NWKA 2FSNA 2WBNA 1VQPN 3AGKA 3U9DA 5AQNA 3MWPA 4H0YB 4BGBA 5C0YA 2YHWA 5C10A 3NMUA 2NNWA 3WEEA 1QZ5A 2QXLA 1GLCG 1HKGA 3CQYA 3CERA 1Q82O 2RE2A 2AP1A 4WFBL 1HKBA 1MWMA 3SBGA 1GLJO 2FSKA 4GNIA 1HLUA 4KH6A 1BA0A 1YITN 3FLCO 4A62A 2YCHA 4DCHA 1T3VA 2CGJA 3VEWA 5BRHA 2QW9A 1R59O 3A5MC 3LDLA 4IOXA 5C2FA 2OTJN 5F2RA 3BEXA 2FSJA 3ZETB 3WXIA 3VEZA 4WCEL 2WC9A 1VQNN 3VPZA 1NGAA 5AQOA 2GELA 3T69A 3VGLA 5AQFA 5FPDA 1QQMA 2ZGZA 3Q7CA 1YHQN 2QWRA 1WUAA 3GL1A 4JK9A 4JK8A 1S22A 3C7NB 4IEIA 4E1JA 5H1SQ 1VQKN 1E4FT 1KAZA 3QBWA 1JCGA 1SS6A 3HBTA 4Z94A 5AQSA 4H0VB 3CHWA 4A59A 1TUYA 5AQPA 3FZFA 3TU5A 5GAHP 2GX9A 3IMXA 2A3ZA 4XEIA 2F9WA 1ATRA 3CETA 4B1ZA 3O08A 4BGAA 4BRKA 5CHIA 1V4SA 3CPEA 4RCHA 1M90O 2H3GX 4FSVA 1ESVA 3M5RA 5BR9A 1BWFO 3QBXA 4FWMA 1X3MA 4FL9A 1SQKA 3TTCA 3VEYA 3VESA 3CCLN 1Q86O 3QMLA 4H5VA 3CF5L 3PIPL 5ADXA 1IJJA 3D6RA 3CXCM 1MWKA 1SZ2A 2NZTA 4H0OA 5FPMA 2E2NA 3LM2A 1Y64A 2NRWA 5AQLA 5EY4A 3J7ZO 3TPQA 5C12A 1C0FA 3D2FA 3B8AX 5KPRA 5AZIB 2ASOA 1ATSA 3ATVA 2FF3B 5AQRA 4BRAA 4IOCL 3CJ7A 1BDGA 3N4PA 1BO5O 2VCPA 2VGNA 3R6MA 4GV6A 5BPLA 4JD2B 1RFQA 3MCAB 3HRGA 3OBWA 4BR4A 5AZJA 1OVYA 1KAXA 4M63C 4BE7B 1Z6RA 5AQVA 1VQ6N 2W40A 1NGJA 3UE5A 3VTIA 1C0GA 3M3ZA 2PAVA 2A5XA 4RWTA 3SBTA 4K42A 4CZEA 1ZC6A 3P39A 1JJ2M 3I55N 5AQYA 4CZHA 3AAPA 3CCEN 4BC4A 2Q0UA 4UY8O 3FFKB 4A57A 1QZ6A 4EFHA 4JKEA 1S72N 4FWRA 2NRTA 3E66A 3WXJA 3OHRA 4JK7A 2E8AA 3ID6A 1K9MO 3EO3A 4MO5A 5JICA 5AQGA 2QWOA 3FR0A 3H6EA 3O9RA 4MO4A 4NB4A 5E84A 4CZIA 3L0QA 3BP8A 1K73O 2E88A 2IVOA 2Q36A 3LDQA 4BREA 4DKWA 2I7PA 4DQ8A 4IOAL 2V7ZA 1ATNA 3E9OA 3DJCA 4EHUA 1GLAG 3FGUA 1K8KA 5BPNA 2J4RA 4OPHA 4BRHA 4CZJA 3CJCA 2V7YA 3ENOA 2P9NA 3VF6A 4AF1A 3RSEB 4I6MB 5FPEA 5ELZA 5AQJA 3C65A 3QDKA 1TYQB 3C0BA 3F2KA 3O80A 4FOIA 4F9OA 3K9KA 1QVFM 1GLFO 4MLEA 3DXKB 4WFNL 3G25A 1GLEG 2WFBA 2D4WA 2KHOA 2F9TA 1CZAN 4FPBA 4XH1A 4ILGB 4PKHA 4H5RA 2P9SB 3AY9A 5AQWA 3UKUB 3F9MA 3LDPA 5GIOA 2D0PA 5AQZA 5FPNA 4EHTA 2YX6A 3WXMB 3IUCA 3VEXA 4YOXA 3ID8A 5M1FA 1JCFA 3VTHA 1U2VB 2PFUA 4IJAA 1VQON 1KD1O 3VEOA 1BOTO 3ZETA 5AFUA 1T44A 4BRIA 4A2AA 2A41A 4L3QA 5AQMA 4BQLA 3H3NO 3O6WA 3W3DA 4BR5A 4QS7A 4WQ4C 1OKJA 3N4QA 1GLBG 1NGIA 4CJ7A 3C7NA 3KWIA 3U4LA 4CD1A 4C23A 2ASMA 3H1QA 4CZMA 3OBYA 4IJNA 1BA1A 2QI2A 2VYPA 3SMSA 1W2BM 2QWMA 3CJ9A 2FLOA 1QQNA 2V51B 3DLLL 1KQSM 3CC7N 4BEBA 3WT0A 2ZJPL 3FZKA 4FWKA 1J6ZA 2BTFA 2NLXA 5DM7L 1RDUA 3CQXA 4AM7A 4PKGA 1RGIA 2E1YA 2DPNA 1HPMA 3D2EA 1HUXA 3ULEB 2HBMA 1XC3A 4FWOA 4IWVA 3MWTA 4JKGB 3JS6A 3KZBA 1KC8O 5AQTA 2ZJRL 4H5TA 1JCEA 1RDWX 3E9LA 4BR7A 3AGRA 5AZIA 3R8EA 1YI2N 2GUPA 4K25A 4M7YA 4B1VA 1NGBA 2VWBA 5TKYA 2Q31A 3G4SN 3WXLA 5GAEP 2HMPA 3CC4N 4JD2A 4YORA 3GE1A 3EE8A 3OA9A 2QTDA 3ENHA 1VQMN 2FF6A 3QFUA 3M6GA 4HTLA 4J8FA 3CD6N 3SAHA 3ZEUB 3CJAA 4XJXA 1S3XA 3D2EB 4FWPA 2I7NA 1TUUA 4YDUC 1QVGM 1VQ5N 3QB0A 4CZGA 4C1NI 1K8AO 2NRXA 3ZX0A 1BU6O 3MDQA 2HOEA 5JVHL 4A5AA 3CCRN 3MX2A 3C6AA 5C2DA 4O8UA 4HWIA 3H46O 4BRNA 1MA9B 2E1ZA 2HF3A 1DEJA 2UYTA 3O9UA 2KKZA 3U8XA 4KH4A 3CCVN 4WQ5A 3QICA 4CD3A 3WUHA 5LJWA 3L4IA 3O9TA 3VEVA 4CBUA 4CZKA 1VAZA 1KAYA 5F1XA 2A40A 3R9PA 5AQHA 2JWKA 1GLDG 1NLVA 3L4QA 2QWLA 3VERA 4R79A 5CE3A 5JMVA 4BRPA 4B9QA 4KH5A 4BRQA 1Z05A 4CZFA 3SLCA 1YF5L 1VQ4N 4JEPA 3VGKA 1Q7YO 4PL7A 5GIPA 2YHXA 2P9LB 2PBDA 4JNEA 1ZXOA 4PKIA 4FWSA 5F0XA 3F5TA 1X9JA 4ISEA 4Y0WA 4I6MA 3RSEA 3VF4A 5LJVA 5KQ8A 3NVKA 2HBLA 3CCJN 4YOWA 1TYQA 4JKFA 1WOQA 2E2QA 1P90A 1XUPO 3P31A 4FWQA 1HX1A 3DXKA 2A42A 3A5NC 3AAQA 4H5WA 5CR4A 3MN5A 4CZLA 2P9PB 5B8HA 1YJNN 1ILYA 2W00A 2RHKA 1NGFA 3DWLA 4GV9A 4MDAA 2YJEA 3CCSN 2P9SA 4WQ4A 3UKUA 2QWNA 3VGMA 4H03B 1MDUB 4BRGA 3HSCA 3VETA 3HM8A 1NGCA 3MX5A 5BREA 4YOTA 3HZ6A 3CIPA 3KHYA 1U2VA 3JXUA 4IO8A 5EVZA 3G71N 3O5BA 5BN9A 3A8YA 1LOTB 3GDQA 2VGMA 3I33A 4B1WB 3CCMN 4CBWA 2ITMA 1YUWA 3EE9A 1NGDA 3HTVA 3RVCA 1YIJN 2CH6A 4BROA 2CGLA 4JAXA 1BG3A 3M1FA 3P4IA 1M1KO 1QQOA 3ENBA 4O5FA 4RTFD 5EX5A 2ZJQL 3LL3A 4FPAA 3GBTA 3SJHA 3DAWA 2NRVA 2Q0RA 3UB5A 3S41A 4U67L 1T6DA 3HI0A 4JKAA 3MN9A 4BR0A 2QWQA 4CI6A 1ZBSA 3KK7A 2OTLN 1W97L 4B1YB 4BY9C 1D4XA 1YVNA 4XH5A 4WFAL 1YXQA 3O8MA 3CCUN 4JHDB 4DHYA 2P9IB 3IDHA 3H3OB 3SAGA 3A5LC 3Q7BA 2Q1NA 3GG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7X A;  3U9Z A;  1NM1 A;  3ULE A;  4ISG A;  4AM6 A;  1EQY A;  1HKC A;  4A61 A;  1E4G T;  2ZWH A;  4QS8 A;  4WYB A;  4BC2 A;  3SMP A;  5AQK A;  4QS9 A;  4CBX A;  2GWJ A;  3FZH A;  3FZM A;  3IFR A;  4B1U B;  4FWL A;  1QHA A;  1DGK N;  4FWN A;  4H0T B;  2AA4 A;  3ZX3 A;  5EXW A;  3ZEU A;  3A5O C;  1V4T A;  2GTD A;  2W41 A;  3BF3 A;  3EN9 A;  4BRD A;  3VEN A;  3W0L A;  3AAR A;  3KVG A;  3L6Q A;  2E2O A;  2EWS A;  5AQX A;  2A6A A;  5EOY A;  3EKU A;  1HJO A;  2E20 A;  2YHY A;  2V52 B;  2IVP A;  4MLH A;  4KBO A;  4IXC A;  1KXP A;  3J8A A;  5AQU A;  4O8K A;  4BC5 A;  2GEM A;  3ZX2 A;  1X3N A;  3WEE B;  3MCP A;  3DXM A;  5AFU H;  5KQD A;  1NMD A;  3BF1 A;  4BRC A;  1NGE A;  1T6C A;  2QM1 A;  5BPM A;  3EL2 A;  2GWK A;  2P9L A;  1U6Z A;  2ASP A;  5KPT A;  4BG8 A;  1BUP A;  2ZF5 O;  1XQS C;  4BC3 A;  3GOI A;  3WQT A;  1LCU A;  3VF2 A;  3I8B A;  1NGH A;  3ATU A;  2P9P A;  2HF4 A;  2CGK A;  1NBW A;  3DXM B;  1GLL O;  3CJB A;  1IG8 A;  5BRF A;  5E26 A;  5BRD A;  5AQI A;  1Q18 A;  3A0I X;  2FXU A;  1H1V A;  2D0O A;  2YI1 A;  4H0X B;  4BRF A;  4FOE A;  4BVP A;  3MN6 A;  3H45 C;  4IZ9 A;  3LDN A;  3LDO A;  5AQQ A;  4K43 A;  5JLF A;  5LY3 A;  4H5N A;  3FE1 A;  4GY2 B;  5BN8 A;  3CJ1 A;  3VOV A;  3BUZ B;  3D7E O;  4FO0 A;  3SK3 A;  3D2F B;  1NGG A;  4K41 A;  5ADX H;  2P9U A;  3WXK A;  3WQU A;  2BUP A;  3EKS A;  1YAG A;  2YJF A;  3O1B A;  4JHD A;  4BVO A;  2P9I A;  2ZGY A;  4EAH D;  5AZJ B;  4BRL A;  1G99 A;  4BQZ A;  2Q97 A;  4BRM A;  2NRH A;  4DB3 A;  4BR9 A;  4ISF A;  2CH5 A;  4EIA A;  4XH4 A;  2IVN A;  2WUS A;  3O4W A;  3CI5 A;  4BR2 A;  3MN7 A;  4NO7 A;  5AR0 A;  4H0P A;  3FZL A;  4WQ5 C;  2P9K A;  5I9E B;  2P9U B;  1P8Z A;  3UKR A;  5KPZ A;  3QFP A;  4LC9 B;  3LM9 A;  3EZW A;  1SAZ A;  2OAN A;  5JLH A;  2E2P A;  2IIR A;  4A2B A;  3H1V X;  1K8K B;  4YDU A;  2Q2R A;  4BG9 A;  2QWP A;  3O1W A;  3MMV A;  4JN4 A;  4B1X B;  2P9K B;  4PL8 A;  3UKR B;  2P9N B;  2D1K A;  1DKG D;  3MK6 A;  1NWK A;  2FSN A;  3U9D A;  5AQN A;  4H0Y B;  4BGB A;  2YHW A;  3WEE A;  1QZ5 A;  2QXL A;  1GLC G;  1HKG A;  3CQY A;  3CER A;  2AP1 A;  1HKB A;  1MWM A;  1GLJ O;  2FSK A;  4GNI A;  1HLU A;  1BA0 A;  3FLC O;  4A62 A;  2YCH A;  4DCH A;  2CGJ A;  3VEW A;  5BRH A;  2QW9 A;  1R59 O;  3A5M C;  3LDL A;  5F2R A;  3BEX A;  2FSJ A;  3ZET B;  3WXI A;  3VEZ A;  3VPZ A;  1NGA A;  5AQO A;  2GEL A;  3VGL A;  5AQF A;  5FPD A;  1QQM A;  2ZGZ A;  2QWR A;  1WUA A;  3GL1 A;  1S22 A;  3C7N B;  4E1J A;  1E4F T;  1KAZ A;  3QBW A;  1JCG A;  3HBT A;  4Z94 A;  5AQS A;  4H0V B;  3CHW A;  1TUY A;  5AQP A;  3FZF A;  3TU5 A;  3IMX A;  4XEI A;  2A3Z A;  2F9W A;  1ATR A;  3CET A;  4B1Z A;  3O08 A;  4BGA A;  4BRK A;  1V4S A;  4RCH A;  2H3G X;  4FSV A;  1ESV A;  5BR9 A;  1BWF O;  3QBX A;  4FWM A;  1X3M A;  4FL9 A;  1SQK A;  3VEY A;  3VES A;  3QML A;  4H5V A;  5ADX A;  1IJJ A;  1MWK A;  1SZ2 A;  2NZT A;  4H0O A;  5FPM A;  2E2N A;  3LM2 A;  1Y64 A;  5AQL A;  5EY4 A;  3TPQ A;  1C0F A;  3D2F A;  3B8A X;  5KPR A;  5AZI B;  2ASO A;  1ATS A;  3ATV A;  2FF3 B;  5AQR A;  4BRA A;  3CJ7 A;  1BDG A;  1BO5 O;  2VCP A;  3R6M A;  5BPL A;  4JD2 B;  1RFQ A;  4BR4 A;  5AZJ A;  1KAX A;  4M63 C;  1Z6R A;  5AQV A;  2W40 A;  1NGJ A;  3UE5 A;  1C0G A;  3M3Z A;  2PAV A;  2A5X A;  4RWT A;  4K42 A;  4CZE A;  1ZC6 A;  5AQY A;  4CZH A;  3AAP A;  4BC4 A;  2Q0U A;  3FFK B;  1QZ6 A;  4EFH A;  4FWR A;  3WXJ A;  3OHR A;  2E8A A;  3EO3 A;  4MO5 A;  5JIC A;  5AQG A;  2QWO A;  3FR0 A;  3H6E A;  4MO4 A;  4NB4 A;  4CZI A;  5E84 A;  3L0Q A;  3BP8 A;  2E88 A;  2IVO A;  2Q36 A;  3LDQ A;  4BRE A;  2I7P A;  4DQ8 A;  2V7Z A;  1ATN A;  3DJC A;  4EHU A;  1GLA G;  3FGU A;  1K8K A;  5BPN A;  2J4R A;  4BRH A;  4CZJ A;  3CJC A;  2V7Y A;  3ENO A;  2P9N A;  3VF6 A;  3RSE B;  4I6M B;  5FPE A;  5ELZ A;  5AQJ A;  3QDK A;  1TYQ B;  3C0B A;  3O80 A;  4FOI A;  4F9O A;  1GLF O;  4MLE A;  3DXK B;  3G25 A;  1GLE G;  2D4W A;  2KHO A;  2F9T A;  1CZA N;  4FPB A;  4XH1 A;  4PKH A;  4H5R A;  2P9S B;  3AY9 A;  5AQW A;  3UKU B;  3F9M A;  3LDP A;  2D0P A;  5AQZ A;  5FPN A;  4EHT A;  3IUC A;  3VEX A;  3ID8 A;  1JCF A;  1U2V B;  4IJA A;  3VEO A;  1BOT O;  3ZET A;  5AFU A;  1T44 A;  4BRI A;  4A2A A;  2A41 A;  4L3Q A;  5AQM A;  4BQL A;  3H3N O;  3O6W A;  3W3D A;  4BR5 A;  4QS7 A;  4WQ4 C;  1OKJ A;  1GLB G;  1NGI A;  4CJ7 A;  3C7N A;  4CD1 A;  3U4L A;  4C23 A;  2ASM A;  3H1Q A;  4CZM A;  4IJN A;  1BA1 A;  2VYP A;  3SMS A;  2QWM A;  3CJ9 A;  2FLO A;  1QQN A;  2V51 B;  3WT0 A;  3FZK A;  4FWK A;  1J6Z A;  2BTF A;  2NLX A;  3CQX A;  4AM7 A;  4PKG A;  1RGI A;  2E1Y A;  2DPN A;  1HPM A;  3D2E A;  1HUX A;  3ULE B;  1XC3 A;  4FWO A;  4IWV A;  3JS6 A;  3KZB A;  5AQT A;  4H5T A;  1JCE A;  1RDW X;  4BR7 A;  5AZI A;  3R8E A;  2GUP A;  4K25 A;  4M7Y A;  4B1V A;  1NGB A;  2VWB A;  5TKY A;  2Q31 A;  3WXL A;  2HMP A;  4JD2 A;  3GE1 A;  3ENH A;  2FF6 A;  3QFU A;  3M6G A;  4HTL A;  4J8F A;  3ZEU B;  3CJA A;  1S3X A;  3D2E B;  4FWP A;  2I7N A;  1TUU A;  4YDU C;  3QB0 A;  3ZX0 A;  1BU6 O;  3MDQ A;  2HOE A;  4HWI A;  3H46 O;  4BRN A;  1MA9 B;  2E1Z A;  2HF3 A;  1DEJ A;  2UYT A;  3U8X A;  4WQ5 A;  3QIC A;  4CD3 A;  3WUH A;  5LJW A;  3L4I A;  3VEV A;  4CBU A;  4CZK A;  1KAY A;  5F1X A;  2A40 A;  3R9P A;  5AQH A;  3VER A;  1GLD G;  1NLV A;  2QWL A;  5JMV A;  5CE3 A;  4BRP A;  4B9Q A;  4BRQ A;  1Z05 A;  4CZF A;  3SLC A;  3VGK A;  4PL7 A;  2YHX A;  2P9L B;  2PBD A;  4JNE A;  1ZXO A;  4PKI A;  4FWS A;  5F0X A;  4ISE A;  1X9J A;  4Y0W A;  3RSE A;  4I6M A;  3VF4 A;  5LJV A;  5KQ8 A;  1TYQ A;  1WOQ A;  2E2Q A;  1XUP O;  4FWQ A;  1HX1 A;  3DXK A;  2A42 A;  3A5N C;  3AAQ A;  4H5W A;  4CZL A;  3MN5 A;  5B8H A;  2P9P B;  3DWL A;  1NGF A;  2YJE A;  2P9S A;  4WQ4 A;  3UKU A;  2QWN A;  3VGM A;  4H03 B;  1MDU B;  4BRG A;  3HSC A;  3VET A;  3HM8 A;  1NGC A;  5BRE A;  3HZ6 A;  3CIP A;  3KHY A;  1U2V A;  3JXU A;  4IO8 A;  5EVZ A;  3O5B A;  5BN9 A;  3A8Y A;  1LOT B;  3GDQ A;  3I33 A;  4B1W B;  4CBW A;  2ITM A;  1YUW A;  1NGD A;  3HTV A;  2CH6 A;  4BRO A;  2CGL A;  4JAX A;  1BG3 A;  3M1F A;  3P4I A;  1QQO A;  4O5F A;  4RTF D;  5EX5 A;  3LL3 A;  4FPA A;  3GBT A;  3SJH A;  3DAW A;  2Q0R A;  3UB5 A;  3S41 A;  1T6D A;  3HI0 A;  4BR0 A;  3MN9 A;  4CI6 A;  2QWQ A;  1ZBS A;  4B1Y B;  1D4X A;  1YVN A;  4XH5 A;  1YXQ A;  3O8M A;  4JHD B;  4DHY A;  2P9I B;  3IDH A;  3H3O B;  3A5L C;  4CZG A;  2Q1N A;  3GG4 A; 
#chains in the Genus database with same CATH topology
 4GVE A;  4AIL C;  1YJW N;  2NUB A;  4CCH A;  1JLB A;  2ZQB A;  2GBZ A;  3THX B;  4NCG A;  4IO9 L;  4CBX A;  5C15 A;  4JS4 A;  2P5G A;  4N41 A;  1IKY A;  4B1U B;  3RMD A;  1DGK N;  4B08 A;  4DFK A;  2GV9 A;  4DR3 K;  2HB5 A;  3ZEU A;  3A5O C;  3OW2 M;  4E7L A;  1YJ9 N;  1JLE A;  2VQE K;  4KHS A;  3AAR A;  3L6Q A;  3O9S A;  3R1X A;  4DLE A;  3SPY A;  5SZT A;  3IRX A;  5AQX A;  2EWS A;  3G6E N;  3EKU A;  2V52 B;  1BGX T;  2IVP A;  5DK5 A;  1ASV A;  2IAJ A;  1WBB A;  2UUC K;  4PHT X;  1NK9 A;  2E5L K;  4LY7 A;  1RDC A;  2QA4 N;  3K5L A;  1T6C A;  1NK8 A;  2QM1 A;  5BPM A;  4N5S A;  3EL2 A;  2GWK A;  4DTN A;  1U6Z A;  1HNZ K;  3RRG A;  5KPT A;  4BG8 A;  3QNN A;  1RT6 A;  3D45 A;  3V9U A;  2HBJ A;  4E1N A;  4CF0 A;  3I8B A;  4ELT A;  3AVG A;  4DSL A;  5BRF A;  4RW7 A;  5E26 A;  5BRD A;  3S5T A;  4JI0 K;  4C8L A;  4ILH A;  1YTU A;  1H1V A;  3ZSW A;  3CPW M;  3MXI A;  1N6Q A;  1VQL N;  3LDN A;  3DRP A;  3UIQ A;  4B8A B;  4AHU A;  2BH1 A;  4DFM A;  5AQQ A;  3LP3 A;  3FE1 A;  5BN8 A;  2C1G A;  3VOV A;  3HJF A;  3TSU A;  1TKT A;  1VQ7 N;  3QO9 A;  4NYF A;  5ADX H;  4HUE A;  3WQU A;  3MEE A;  1K6Y A;  1KLN A;  4CFC A;  3ZCM A;  1ASW A;  1G99 A;  4IKF A;  4BQZ A;  1C1A A;  1TK5 A;  2NRH A;  5AJ3 K;  2ZD1 A;  3AVB A;  2WUS A;  3O4W A;  3CI5 A;  4BDY A;  3J80 O;  3NGY A;  4FLV A;  3A2F A;  4Z4H A;  1KFD A;  3QFP A;  4LC9 B;  4FLZ A;  4B9T A;  3EZW A;  1SAZ A;  4DV7 K;  3KWG A;  4DQQ A;  2JGU A;  5JLH A;  4KHW A;  3ZYY X;  3VQE A;  4I9Q A;  3H1V X;  1K8K B;  4BG9 A;  4IDH A;  1SL0 A;  1NJY A;  1HR0 K;  4G9Z A;  3MMV A;  3VQ5 A;  3ZSX A;  3ULD A;  4JKH A;  2P9K B;  4IEE A;  1WSH A;  3UKR B;  4CJL A;  2Y1J A;  1LAV A;  4DTO A;  3AO4 A;  5AQN A;  5IWA K;  3LAL A;  3NAE A;  3D0P A;  4JI5 K;  2QXL A;  4DS4 A;  3BZC A;  4PA1 A;  1TV6 A;  1MWM A;  1MU2 A;  3SBG A;  3U6F A;  1GLJ O;  1BA0 A;  4CGJ A;  1IBL K;  3TAF A;  3LDL A;  3A5M C;  1L3U A;  4IOX A;  5C2F A;  3HVR A;  3PO4 A;  4KRF A;  1VQN N;  1NGA A;  2R7Y A;  4X64 K;  5AQF A;  5FPD A;  1QQM A;  3Q7C A;  4JK9 A;  2FBT A;  3C7N B;  4QAG A;  4E1J A;  4N56 A;  2HHX A;  1KAZ A;  2QXF A;  3HBT A;  1SKW A;  4R5P A;  4Z94 A;  1XNR K;  2FC0 A;  1TUY A;  3EZ5 A;  3FZF A;  1WLJ A;  2A3Z A;  3U3G A;  2F9W A;  4B1Z A;  1HYZ A;  2UXB K;  1M90 O;  2H3G X;  4FWM A;  3CM5 A;  3C95 A;  3KLE A;  1Q86 O;  3IS9 A;  4H5V A;  2YKM A;  3PIP L;  1MWK A;  1L3V A;  3F73 A;  4J2A A;  5FPM A;  5EY4 A;  3QIN A;  2OPP A;  2HHQ A;  5C12 A;  4F3T A;  3D2F A;  4DUZ K;  3ZSQ A;  1ATS A;  2P51 A;  4BRA A;  1XC9 A;  1I94 K;  3L2R A;  3N4P A;  2ZE2 A;  3MXJ A;  3MXM A;  3HRG A;  3OBW A;  4BR4 A;  5AZJ A;  1OVY A;  4HHT A;  4M63 C;  1Z6R A;  5AQV A;  4CHZ A;  4CF9 A;  4CK1 A;  4M3W A;  2PAV A;  2A5X A;  4RWT A;  3KK1 A;  4K42 A;  1NU0 A;  3P39 A;  4FZX C;  5KRS A;  3ZSO A;  1JJ2 M;  1D8Y A;  1LW2 A;  3CCE N;  3AVA A;  1RDA A;  1QZ6 A;  4DTU A;  3VQ9 A;  2NRT A;  5CYQ A;  1U45 A;  3BGR A;  1KVC A;  2E8A A;  3EO3 A;  3QES A;  1K73 O;  3NCI A;  2Q36 A;  2O4I A;  4FJ7 A;  4IOA L;  2V7Z A;  2PZS A;  1KVB A;  3VQ7 A;  2O8F B;  3V1Q A;  4LD0 A;  4IFV A;  2J4R A;  3CJC A;  3ENO A;  4ID1 A;  4I6M B;  5FPE A;  2KTQ A;  3QDK A;  2OPS A;  3O80 A;  3CFR A;  1VSH A;  4F9O A;  3K9K A;  1NKB A;  1QVF M;  3M8R A;  3G25 A;  1GLE G;  1W0H A;  2F9T A;  4XIU A;  4JI6 K;  2G8W A;  1FKP A;  4XH1 A;  4H5R A;  3SQ1 A;  2F8S A;  2P9S B;  5AQW A;  2PY5 A;  3B6P A;  4AHV A;  2Q3S A;  2YX6 A;  2QKB A;  3IG1 A;  3SUN A;  4NYN A;  1JCF A;  2FBY A;  3I0R A;  5LMN K;  1L3T A;  1T44 A;  2O8D A;  4BQL A;  2PYJ A;  1YT3 A;  4BWM A;  4HTU A;  1NJW A;  3AVK A;  3T3F A;  4CIE A;  3CC7 N;  4C8N A;  3LPU A;  3VQ8 A;  3CQX A;  4PKG A;  3OYL A;  1RGI A;  4JRP A;  2DPN A;  3NH0 A;  2BE2 A;  3KZB A;  2XHB A;  2ZJR L;  1JCE A;  1C1C A;  5AZI A;  2G8H A;  5HRO A;  2GUP A;  3G4S N;  1NGB A;  5TKY A;  1JL1 A;  3WXL A;  3CC4 N;  4JD2 A;  4W5R A;  4CJ5 A;  5KTQ A;  5JS1 A;  3ZEU B;  4FWP A;  3D2E B;  3SNN A;  4OPK A;  3NE6 A;  3ZX0 A;  4KTZ A;  3MX2 A;  2Z1G A;  4GW6 A;  1Z25 A;  1DEJ A;  4CJU A;  2UYT A;  3CCV N;  3SJJ A;  3WUH A;  4AHS A;  5LJW A;  3G10 A;  3L4I A;  4CBU A;  4KKO A;  1REV A;  1VAZ A;  4DWI A;  3R9P A;  5AQH A;  1NLV A;  5CE3 A;  3P83 D;  4B9Q A;  3PO5 A;  1Z05 A;  3SLC A;  2G8U A;  5FDL A;  1DLO A;  1Q7Y O;  2D0B A;  3M8P A;  3THW A;  4I9L A;  3VQC A;  2PBD A;  3DLH A;  4JNE A;  3F5T A;  3VF4 A;  1X9J A;  1NMN A;  4Y0W A;  5LJV A;  4YOW A;  4JKF A;  1XUP O;  3P31 A;  1NKC A;  4FWQ A;  3EYZ A;  4PY5 A;  2A42 A;  3JAM O;  3V6D A;  4NCB A;  3AAQ A;  5CR4 A;  3MN5 A;  1NJX A;  3PV8 A;  2RHK A;  3PX4 A;  4GV9 A;  4MDA A;  4H03 B;  1MDU B;  3VET A;  1CLQ A;  3TR8 A;  4F2R A;  3JXU A;  4FZY A;  3O5B A;  1S1W A;  3GDQ A;  1QHT A;  2YV0 X;  4DU4 A;  4ID5 A;  3CQ8 A;  1RCH A;  2ITM A;  3HTV A;  3RVC A;  1UA0 A;  4FJ5 A;  4BRO A;  4JAX A;  1M1K O;  1QQO A;  3ENB A;  2HHT A;  4DV4 K;  4U67 L;  4H4M A;  1FXX A;  1T6D A;  4BR0 A;  3MN9 A;  4CEE A;  2DFE A;  4FLU A;  3ITH A;  4DHY A;  3HPH A;  3H3O B;  3IDH A;  3A5L C;  3SAG A;  2Q1N A;  5FPN A;  3JSM A;  4CJE A;  4ISG A;  3MED A;  1EQY A;  3K5M A;  1HJR A;  3L2W A;  4A61 A;  1E4G T;  4BC2 A;  3SMP A;  1ZBI A;  4CER A;  5KRT A;  1IKW A;  1B9D A;  3PLA A;  4CK3 A;  1X9S A;  3E1Y A;  4OVL A;  3DMJ A;  4LSL A;  4B9U A;  3DOL A;  3OYA A;  4FWL A;  4FWN A;  4H0T B;  3AA5 X;  1WSF A;  2W41 A;  3BF3 A;  4CJP A;  3AO3 A;  4HVJ A;  3W0L A;  4Z4C A;  3SCX A;  3K0S A;  2E2O A;  3HPG A;  1TK8 A;  2O8E A;  2A6A A;  1BL3 A;  5EOY A;  4DSE A;  4MLH A;  4QCL A;  4KBO A;  1KXP A;  4X65 K;  5HOO A;  4BC5 A;  2GEM A;  3TAB A;  3V81 A;  4DR2 K;  4F4K A;  3ZX2 A;  3LWM A;  3DLG A;  1X3N A;  3S9H A;  4JI8 K;  4CK2 A;  4CES A;  2ZM6 K;  5AFU H;  1VRU A;  3S3N A;  4A5B A;  4CF1 A;  3BF1 A;  3TAM A;  1ZBU A;  4FM2 A;  1EET A;  3HYF A;  1HQE A;  2OZM A;  1LWF A;  4B3O A;  3OJS A;  1N32 K;  3EY1 A;  2KLA A;  4I2P A;  3WQT A;  1LCU A;  3CFO A;  4MQ3 A;  3O9Q A;  2BAN A;  5TKW A;  4FLX A;  3ATU A;  1JLG A;  3KD1 E;  4X62 K;  4OPJ A;  2CGK A;  1NBW A;  3DXM B;  4RW8 A;  4E7K A;  1GLL O;  3AVC A;  4KHY A;  3TTD A;  3MEC A;  1S1T A;  3VQB A;  5GAG P;  4CGH A;  1VQ8 N;  4J2E A;  3HP6 A;  2O8B A;  2FXU A;  4Z4I A;  5FRO A;  4BRF A;  4FOE A;  4BVP A;  4DTP A;  4ILJ A;  4FJ8 A;  3LDS A;  4LSN A;  4BE0 A;  3KLG A;  4H5N A;  3WNG A;  3BUZ B;  1D5A A;  1VSJ A;  3SK3 A;  2E6L A;  3D2F B;  3NVM A;  3DLK A;  4K41 A;  1BCO A;  2P9U A;  5LL6 Z;  4DUY K;  4LF6 K;  4JHD A;  3HOS A;  5AZJ B;  1IG9 A;  1S1U A;  4BRL A;  4DTS A;  3DM2 A;  4CFD A;  5HRS A;  5M1P A;  4W5T A;  4LF5 K;  1WB9 A;  4DB3 A;  4BR9 A;  2CH5 A;  4EIA A;  1F21 A;  4CEO A;  4EZ9 A;  3CC2 N;  3OTO K;  1HPZ A;  2Z1I A;  3P38 A;  3V9W A;  2XY5 A;  3I56 N;  1IBK K;  1C1B A;  3LM9 A;  2NRR A;  5HRP A;  1L5U A;  5J2N A;  4JKD A;  3CCQ N;  1S1X A;  2IIR A;  1U04 A;  4Y1C A;  2Q2R A;  1UOC A;  2QWP A;  3O1W A;  1ZBH A;  1BI4 A;  3PSI A;  1DKG D;  4OO1 J;  3OYF A;  3DRR A;  3TAN A;  2WBN A;  4LH4 A;  3TAQ A;  1XI1 A;  3AGK A;  1OH8 A;  4H0Y B;  1Q9Y A;  5C0Y A;  2YHW A;  2OA8 A;  3NGZ A;  4FK2 A;  4C8K A;  2NNW A;  3WEE A;  3HP9 A;  2KFZ A;  5HLF A;  3CQY A;  4OGC A;  1XHX A;  2FSK A;  4ZTJ A;  1EWQ A;  4JI3 K;  1YIT N;  3FLC O;  1VK0 A;  1ZBF A;  4K8Z A;  4PQU A;  4DCH A;  2CGJ A;  2QW9 A;  1R59 O;  4FM0 A;  4DFP A;  3SPZ A;  1NK4 A;  3RR7 A;  1VSI A;  2FSJ A;  2O8D B;  2RKI A;  4CFB A;  1VSE A;  2WC9 A;  2XRI A;  3T1A A;  5AQO A;  2GEL A;  4DR5 K;  3RWU A;  5JEN A;  4BAC A;  2LSN A;  1WUA A;  4JK8 A;  3WNE A;  1E4F T;  3V4I A;  4K0K K;  1CXU A;  4A59 A;  1HRH A;  3TU5 A;  4KHP K;  4BGA A;  1ATR A;  3CET A;  4V19 S;  4BRK A;  3CPE A;  4RCH A;  1UWB A;  3M5R A;  5BR9 A;  3AVM A;  5EU7 A;  3VES A;  2YHB A;  3QML A;  1IJJ A;  3D6R A;  4DU3 A;  1HNI A;  3CYG A;  1TK0 A;  2E2N A;  1Y64 A;  5AQL A;  1HNV A;  3J7Z O;  1C0F A;  3OS2 A;  4KPY A;  5AZI B;  4FJJ A;  2ASO A;  3ATV A;  2FF3 B;  5AQR A;  3CJ7 A;  4GV6 A;  2VGN A;  3R6M A;  1SKR A;  4HCB A;  4JD2 B;  2W42 A;  3B6O A;  1CZB A;  4I7F A;  1KAX A;  1NGJ A;  3UE5 A;  2KQ2 A;  1C0G A;  4M45 A;  3SBT A;  4E3S A;  1ZC6 A;  1D9F A;  1NK0 A;  1NKE A;  3NDK A;  3V1R A;  3AAP A;  4BC4 A;  4KB1 A;  4AH9 A;  1U48 A;  2XY8 A;  4M41 A;  3AO5 A;  4EFH A;  1S72 N;  3E66 A;  3OHR A;  4JK7 A;  4L8R B;  1K9M O;  4MO5 A;  5JIC A;  5AQG A;  3FR0 A;  4NB4 A;  4H8K A;  3BP8 A;  3MAQ A;  4ICL A;  2I5J A;  1IH7 A;  4MFB A;  1ATN A;  4FXD A;  4FJK A;  4CZJ A;  1BIS A;  3LZJ A;  3THW B;  1N34 K;  2P9N A;  4E0D A;  1TKZ A;  4CIG A;  4M3T A;  5AQJ A;  1UAX A;  3C65 A;  3SV4 A;  3F2K A;  3P5J A;  1BHL A;  1WSI A;  3QER A;  2D4W A;  2WFB A;  3VQP A;  3SI6 A;  3BZK A;  4B9L A;  4FPB A;  4ZHR A;  4GVM A;  4PKH A;  4FLW A;  4E19 A;  3WXM B;  4DV1 K;  2X74 A;  3ZT1 A;  4WE1 A;  3VTH A;  4IJA A;  1IV0 A;  1BIU A;  5AFU A;  3ZET A;  3K5O A;  4A2A A;  4L3Q A;  5AQM A;  3K2P A;  3W3D A;  4BR5 A;  2O8C A;  3KKS A;  5I3U A;  1TVR A;  2B6A A;  1OKJ A;  1NGI A;  1LAW A;  4DTM A;  3QEP A;  3U4L A;  2ASM A;  3H1Q A;  2HW3 A;  1BA1 A;  3SMS A;  2BGG A;  4CJ3 A;  2FLO A;  1QQN A;  3DLL L;  4CHQ A;  3VA0 A;  2G8V A;  4O44 A;  3THV A;  2OYQ A;  1J6Z A;  4DTJ A;  2BTF A;  5DM7 L;  4KAZ A;  1RDU A;  4IG0 A;  1OH6 A;  1HUX A;  3L3V A;  1XC3 A;  4IWV A;  3MWT A;  4CEZ A;  3JS6 A;  1KC8 O;  5AQT A;  4H5T A;  3E9L A;  1OH7 A;  3AVF A;  3NF6 A;  4FJM A;  1X1P A;  1ASU A;  3AGR A;  2X78 A;  4B1V A;  2Q31 A;  1J53 A;  2HMP A;  4DSI A;  1C0T A;  1JLF A;  3EE8 A;  4HTL A;  4YY3 K;  2WTU A;  3CD6 N;  3SAH A;  1RTH A;  3NFA A;  4CHN A;  3SQ2 A;  4M3X A;  3CJA A;  1S3X A;  4M3R A;  1TUU A;  4YDU C;  4PUO A;  1VQ5 N;  4PWD A;  3QB0 A;  4FZZ A;  4LF4 K;  4C1N I;  1K8A O;  1BU6 O;  3OYG A;  3K59 A;  2O8E B;  4HWI A;  3NHG A;  1BQM A;  4BRN A;  4K8X A;  4EP5 A;  4FW1 A;  4B9V A;  3O9U A;  3QIC A;  4CEA A;  2ATQ A;  3VEV A;  3O4Q A;  5F1X A;  2JWK A;  3L4Q A;  3VER A;  2QWL A;  5JMV A;  1SUQ A;  3DOK A;  1RBT A;  4JEP A;  4DSF A;  3VGK A;  3QLH A;  1T03 A;  1RTJ A;  4Z4F A;  1C6V A;  4PKI A;  3O3F A;  3P1G A;  5KQ8 A;  5E41 A;  4BDZ A;  1P90 A;  1HX1 A;  3DXK A;  2RPI A;  4CEC A;  4H5W A;  3RTV A;  1YJN N;  3KLH A;  3ZSR A;  3DWL A;  2YNF A;  4RG8 A;  1FKO A;  4WQ4 A;  3T19 A;  1VSF A;  3UKU A;  2QWN A;  4DSK A;  1JLA A;  4BRG A;  3ALY A;  3HSC A;  5BRE A;  1X9M A;  3AA3 A;  2O8B B;  3CIP A;  3KHY A;  1U2V A;  4FK0 A;  5EVZ A;  3G71 N;  3NGI A;  4AQY K;  4B9M A;  4I2Q A;  1S9E A;  2W6L A;  5BN9 A;  1LOT B;  3CCM N;  1B9F A;  4NCA A;  3EE9 A;  2OPR A;  1YIJ N;  2CGL A;  3L2Q A;  1BG3 A;  1QE1 A;  3P4I A;  3SV3 A;  4O5F A;  3ZLJ A;  4N76 A;  2ZJQ L;  2IC3 A;  3DAW A;  3WNH A;  2PYL A;  1NK6 A;  1ZBS A;  1HNW K;  1RDB A;  4XH5 A;  4J2D A;  4W5N A;  3CCU N;  4AHR A;  4JHD B;  3VQ4 A;  4CZG A;  1EWR A;  4FLT A;  3QNO A;  3GG4 A;  4M7X A;  3U9Z A;  1NM1 A;  3C6H A;  4HUF A;  5I42 A;  4JKG A;  2ZWH A;  5HL7 L;  5M1Q A;  2G8I A;  2O4G A;  5AQK A;  4QS9 A;  5LMU K;  4CJQ A;  5KGX A;  3FZM A;  3IFR A;  3LP2 A;  4NLC A;  1S5J A;  1N5Y A;  2RF2 A;  1QHA A;  3AA4 A;  3SUO A;  2AA4 A;  3ZX3 A;  5EXW A;  2HBK A;  1J5E K;  4OPA A;  3EN9 A;  4CE9 A;  3SQ0 A;  3VQQ A;  2HST A;  1YVU A;  3KVG A;  4Q5V A;  3HOT A;  1TKD A;  4FLY A;  1CZ9 A;  1HJO A;  2E20 A;  2YHY A;  1BI4 B;  4IXC A;  3J8A A;  4FW2 A;  4O8K A;  3T7Z A;  4CHP A;  3QIO A;  5SWM A;  3WEE B;  5KQD A;  1NMD A;  1IO2 A;  4DR4 K;  3OYK A;  4YOY A;  3T1H K;  3QET A;  4ELV A;  3E01 A;  4KFB A;  4YOU A;  1BUP A;  2ZF5 O;  4BC3 A;  3GOI A;  2WOM A;  5CY4 A;  1XHZ A;  3PUF A;  3QEI A;  2HHV A;  5KGW A;  4DV0 K;  2UXD K;  3VF2 A;  1NGH A;  5J2M A;  2OPQ A;  4DV3 K;  2QEX N;  2P9P A;  3L3U A;  4JRQ A;  1IG8 A;  4IFE A;  3TI0 A;  4F8R A;  3K57 A;  5AQI A;  4CEQ A;  3O3G A;  2B4J A;  2E4L A;  5FRM A;  3OS1 A;  2YI1 A;  4NLB A;  2FBV A;  3SAF A;  4IZ9 A;  3RMB A;  3OY9 A;  3TAE A;  4K43 A;  5LY3 A;  4W5Q A;  3S3M A;  1NJI O;  3IKM A;  5C25 A;  3I8D A;  3VMF B;  1C0M A;  4CJK A;  5MLC Q;  4FJ9 A;  1DT9 A;  4LH5 A;  5M1K A;  4WF9 L;  1NJZ A;  2OZS A;  3M8S A;  5C24 A;  4DF4 A;  4JI7 K;  3O1B A;  3AVH A;  5M1O A;  2QK9 A;  2HHW A;  4BVO A;  1ITG A;  2P9I A;  4KHU A;  4KHQ A;  1CXQ A;  2Q97 A;  4BRM A;  4OKJ A;  4DTX A;  4XH4 A;  2HNZ A;  1VSK A;  4BR2 A;  3ZSV A;  3T1Y K;  4H0P A;  4WQ5 C;  2P9K A;  5I9E B;  3UKR A;  1LWE A;  1QSY A;  4QOZ B;  2IS3 A;  1OH5 A;  2OAN A;  4GV3 A;  1U47 A;  1ZYQ A;  1VSD A;  3NBP A;  4YDU A;  5GIN A;  2VQF K;  4RW4 A;  3KLF A;  4B1X B;  3CM6 A;  2P9N B;  3MK6 A;  1NWK A;  2FSN A;  3LP0 A;  3MWP A;  4JI1 K;  4BGB A;  4CJ4 A;  4CJV A;  4X66 K;  2IDO A;  1WSG A;  3HPO A;  4BE2 A;  1QZ5 A;  3OYM A;  4OGE A;  4CFA A;  1Q82 O;  2AP1 A;  4M3Y A;  3DRS A;  3KLI A;  1HKB A;  3QIP A;  3L2U A;  1EKE A;  1HLU A;  4KH6 A;  2YCH A;  3VEW A;  5KI6 A;  4OKE A;  3C6U A;  4CIF A;  4FJG A;  3QEX A;  2OTJ N;  3ZET B;  3ISN C;  3K58 A;  3VGL A;  3T69 A;  1RNH A;  3LWL A;  3AVN A;  1NK7 A;  1RT4 A;  5H1S Q;  3G0Z A;  5HBM A;  1JCG A;  1RT1 A;  1SS6 A;  3QEV A;  4B8C A;  5AQS A;  1KFS A;  4EP4 A;  2GX9 A;  4XEI A;  4IBN A;  4DS5 A;  2HND A;  3I0S A;  1V4S A;  3V9X A;  1HQU A;  4FSV A;  3CCL N;  4FM1 A;  4JI4 K;  3CXC M;  1SZ2 A;  2NZT A;  3LM2 A;  1TGO A;  2NRW A;  3TPQ A;  3B8A X;  3U3Y A;  4IOC L;  2JLE A;  2VCP A;  4LF8 K;  3KD5 E;  1QS4 A;  3PX0 A;  4AHC A;  4CGI A;  2KFN A;  3VTI A;  3M3Z A;  3NH1 A;  1VSL A;  1Y97 A;  4W5O A;  4CZE A;  1QSS A;  4Q0B A;  1VRT A;  4CZH A;  5JS2 A;  2X6S A;  4UY8 O;  1JLC A;  3FFK B;  4B3R K;  2YNG A;  3THY A;  2VWK A;  4KV8 A;  5A2Q O;  3RRH A;  2UUB K;  4FWR A;  1KCF A;  3V9Z A;  2QWO A;  3H6E A;  3O9R A;  4MO4 A;  4CZI A;  5E84 A;  4GKJ K;  2E88 A;  1TL3 A;  2IVO A;  2DFF A;  3ZT2 A;  4BRE A;  4DQ8 A;  3E9O A;  4GKK K;  4E7I A;  4FJL A;  5BPN A;  4B3T K;  4BRH A;  4OPH A;  3VF6 A;  4AF1 A;  4CHO A;  4IDK A;  3PSF A;  1T7P A;  5HP1 A;  3OYE A;  3DXK B;  4M3Z A;  1W9H A;  1A5X A;  2HHH K;  3UKU B;  1QSL A;  3F9M A;  1RBU A;  3LDP A;  2ITG A;  1L3S A;  4NXN K;  1TL1 A;  3IUC A;  3DI6 A;  1U2V B;  2PFU A;  4DTR A;  1KD1 O;  3VEO A;  1U4B A;  4BRI A;  2A41 A;  2YKN A;  3HL8 A;  4CJW A;  4FJX A;  3O6W A;  4WQ4 C;  1GOC A;  2EHG A;  1WSJ A;  3N4Q A;  2EX3 A;  4CJ7 A;  1IKX A;  4CD1 A;  3S3O A;  4C23 A;  1KRP A;  1JLQ A;  4CZM A;  4IJN A;  2QI2 A;  4KI6 A;  2QWM A;  2V51 B;  3OYD A;  4BEB A;  2XY6 A;  2ZJP L;  4B3S K;  3FZK A;  4FWK A;  2NLX A;  4AM7 A;  1HPM A;  3NF8 A;  3D2E A;  5J1E A;  4FWO A;  4JKG B;  1RT2 A;  1C0U A;  1T05 A;  5FRN A;  4FK4 A;  3LAM A;  1YHQ N;  1HYV A;  4K25 A;  1DTT A;  1TAQ A;  1RIL A;  5GAE P;  2WON A;  1Q8I A;  4YOR A;  4TSX A;  3OA9 A;  1VQM N;  2QTD A;  2FF6 A;  3QFU A;  3M6G A;  3DYA A;  1LV5 A;  3AO1 A;  1N36 K;  2NRX A;  3MDQ A;  2HOE A;  5JVH L;  4A5A A;  3C6A A;  3VQ6 A;  1YTA A;  1MA9 B;  2E1Z A;  2HF3 A;  3NF9 A;  4KHN A;  1KTQ A;  4OLA A;  4KH4 A;  4WQ5 A;  4LFB K;  4HCC A;  4FJI A;  1WNS A;  5BR8 K;  2HHI A;  1KAY A;  2A40 A;  3LPT A;  1S6Q A;  4R79 A;  1KSP A;  1U49 A;  4BRP A;  4BRQ A;  3KTQ A;  1YF5 L;  4G1Q A;  1VQ4 N;  3SZ2 A;  2YHX A;  4Z0U A;  5T7B A;  5F0X A;  4FWS A;  2VG6 A;  3RSE A;  3AVJ A;  1HMV A;  3VQD A;  3BDP A;  3CCJ N;  1TYQ A;  4M3U A;  1WOQ A;  2E2Q A;  5FLX O;  4OLB A;  1FK9 A;  4CZL A;  4O55 A;  4E7J A;  3TAP A;  2P9P B;  4CW7 B;  1ILY A;  2W00 A;  1NGF A;  2YJE A;  3CCS N;  4DQP A;  1OVQ A;  3MX5 A;  4YOT A;  3HZ6 A;  3HO1 A;  4JI2 K;  1X9W A;  3OYC A;  2VGM A;  4J2B A;  4YHH K;  3RMC A;  1R0A A;  1HYS A;  1YUW A;  1NGD A;  2CH6 A;  3M1F A;  1S9G A;  2HHS A;  1Q9X A;  4YFU A;  4FPA A;  2NRV A;  3H08 A;  3HI0 A;  4JKA A;  3KK7 A;  2OTL N;  1W97 L;  2Y1I A;  4RW9 A;  4BY9 C;  1D4X A;  3O8M A;  4N47 A;  2P9I B;  4FJN A;  3SUP A;  4CGG A;  1XNQ K;  1WAJ A;  3J7A P;  3ULE A;  4AM6 A;  4OKK A;  1HKC A;  2Z1J A;  3J81 O;  4O4G A;  4QS8 A;  1BQN A;  4WYB A;  2HMI A;  2F96 A;  3EEQ A;  3LZI A;  5GAD P;  5CZ1 A;  2GWJ A;  2E6M A;  3FZH A;  4DLG A;  3HM9 A;  1JKH A;  1EO1 A;  3OYH A;  5J2P A;  4Z4E A;  1V4T A;  2GTD A;  3TSQ A;  4BRD A;  3VA3 A;  3VEN A;  2F8T A;  3TWH A;  4DR6 K;  4BEC A;  3LAK A;  4IFY A;  2A1R A;  2X6N A;  4DR7 K;  1EP4 A;  4JKB A;  3NH2 A;  5AQU A;  2DTU A;  3KJV A;  4NXM K;  3HVT A;  3DLB A;  4FVU A;  1O13 A;  5HRN A;  3MCP A;  3DXM A;  4U7B A;  4BRC A;  3ZSZ A;  1RBS A;  1NGE A;  2P9L A;  1RBR A;  3PX6 A;  2ASP A;  4YOV A;  3KK3 A;  3OJU A;  1VHX A;  1XQS C;  1DTQ A;  4E7H A;  4LF7 K;  3RR8 A;  4KTW A;  4CF2 A;  5M1N A;  1VQ9 N;  3OYB A;  5JVG L;  4FCY A;  2HF4 A;  4CED A;  3E9P A;  2F7T A;  3CJB A;  2RN2 A;  3DLE A;  4C1N K;  2JWL A;  2C1I A;  1Q18 A;  3OYI A;  3A0I X;  3M8Q A;  2D0O A;  4H0X B;  1J54 A;  3K9J A;  3MN6 A;  3H45 C;  3HXM A;  3HST B;  3LDO A;  1J9A A;  2NRZ A;  1N8R O;  3V1O A;  5JLF A;  2GUI A;  1W7A A;  4GY2 B;  4DF8 A;  3CJ1 A;  3TSP A;  2AJQ A;  3D7E O;  4FO0 A;  4CGF A;  4DMN A;  1NGG A;  2KW4 A;  5K14 A;  3WXK A;  3R3L A;  2BUP A;  3EKS A;  1YAG A;  2YJF A;  4Y1D A;  4EAH D;  1SL1 A;  2ZGY A;  3CG7 A;  4ISF A;  1RBV A;  2IVN A;  2UU9 K;  3OVN A;  3THX A;  1EXQ A;  4JV5 K;  3MN7 A;  2B5J A;  4DG1 A;  4NO7 A;  5AR0 A;  3FZL A;  1Q81 O;  4DR1 K;  2P9U B;  1P8Z A;  3J7Y P;  3CFP A;  5KPZ A;  3THY B;  3AVL A;  3QEW A;  1KLM A;  3TTF A;  4BDP A;  3CMA N;  4JKC A;  4DSJ A;  4CEF A;  3AV9 A;  3CME N;  2E2P A;  4A2B A;  1G15 A;  1VSM A;  4YNQ A;  3PIO L;  1NG9 A;  4H4O A;  5DM6 L;  1XMQ K;  4Z4G A;  3ZSY A;  4MDB A;  4JN4 A;  1SKS A;  4GMJ B;  4PL8 A;  5J2Q A;  2D1K A;  2KZZ A;  2XY7 A;  1VQP N;  3U9D A;  2UXC K;  3FFI A;  5C10 A;  3NMU A;  4UQG A;  1Z26 A;  1GLC G;  1RT5 A;  1HKG A;  3CER A;  5CYM A;  2RE2 A;  3OYJ A;  1J5O A;  4WFB L;  1IBM K;  4GNI A;  2YNH A;  4A62 A;  4O0J A;  3TAG A;  1T3V A;  3CYM A;  4LF9 K;  5BRH A;  2BDP A;  2D5R A;  4CJT A;  1RDD A;  2D0C A;  2G8K A;  5F2R A;  3BEX A;  2HVH A;  3WXI A;  2XO7 A;  1BIZ A;  3VEZ A;  4WCE L;  5HRR A;  3VPZ A;  4CF8 A;  2ZGZ A;  2ETJ A;  1B92 A;  2QWR A;  3GL1 A;  1S22 A;  4IEI A;  5C42 A;  4CVN E;  1VQK N;  3QBW A;  1JL2 A;  4LFA K;  4H0V B;  4JS5 A;  3CHW A;  5AQP A;  5GAH P;  3IMX A;  5CHI A;  3O08 A;  1GOB A;  4CJF A;  1ESV A;  1BWF O;  2HNY A;  3QBX A;  1X3M A;  3OS0 A;  4FL9 A;  3OYN A;  1SQK A;  3TTC A;  3VEY A;  3CF5 L;  5ADX A;  3TAR A;  4H0O A;  1NK5 A;  4E89 A;  4FVM A;  5KPR A;  3HK2 A;  4ELU A;  4BE1 A;  1BDG A;  1BO5 O;  1NOY A;  5BPL A;  2HVI A;  1RFQ A;  3MCA B;  4BE7 B;  2OCE A;  3AA2 A;  3SUQ A;  1VQ6 N;  4B3M K;  1S6P A;  2W40 A;  4DU1 A;  1N33 K;  1RT3 A;  1FJG K;  3K5N A;  1RT7 A;  2HHU A;  1TAU A;  4JLH A;  3I55 N;  5AQY A;  4IG3 A;  5DMR A;  1LW0 A;  2Q0U A;  4KRE A;  4A57 A;  1E3M A;  4DV6 K;  4JKE A;  4LFC K;  3O3H A;  3WXJ A;  3ID6 A;  1TKX A;  3L0Q A;  1QQC A;  3LDQ A;  4DKW A;  2I7P A;  1O1W A;  3DJC A;  1GLA G;  3FGU A;  1K8K A;  4O5B A;  4EHU A;  1WAF A;  4DV5 K;  2KZM A;  1JXB A;  4KTQ A;  1GOA A;  2V7Y A;  4C8M A;  3RSE B;  3HT3 A;  5ELZ A;  1NOZ A;  1TYQ B;  3C0B A;  4CHY A;  4O0I A;  4FOI A;  2P5O A;  4DQI A;  1GLF O;  4MLE A;  4WFN L;  2KHO A;  3SQ4 A;  1CZA N;  4OJR A;  4ILG B;  1KVA A;  2F4V K;  3AY9 A;  2W6K A;  3F9K A;  5GIO A;  2D0P A;  5AQZ A;  4EHT A;  3VEX A;  4YOX A;  3ID8 A;  5M1F A;  1ZBL A;  1VQO N;  4E72 A;  1BOT O;  2P1J A;  3VN5 A;  3H3N O;  4QS7 A;  1RTI A;  3AVI A;  4CEB A;  1GLB G;  3C7N A;  4F2S A;  2FBX A;  3WNF A;  3LP1 A;  4OX9 K;  3KWI A;  3NF7 A;  4KI4 A;  1A5V A;  1HNX K;  3OBY A;  1W2B M;  2VYP A;  5D3G A;  3KK2 A;  4DV2 K;  3CJ9 A;  4CJS A;  1WSE A;  1KQS M;  2YNI A;  3WT0 A;  3ZT3 A;  3JYT A;  1D9D A;  4F3O A;  1XMO K;  2E1Y A;  2DFH A;  3KKR A;  2O8C B;  1SL2 A;  3ULE B;  2HBM A;  3C94 A;  2G8F A;  3O4N A;  4CJR A;  1BCM A;  1RDW X;  4BR7 A;  3R8E A;  3SYZ A;  1YI2 N;  3PY8 A;  2UUA K;  4M7Y A;  3DLR A;  2IGI A;  2VWB A;  4AHT A;  3GE1 A;  3ENH A;  1LWC A;  1I39 A;  4J8F A;  1FW6 A;  4EZ6 A;  4XJX A;  1QVG M;  2I7N A;  4B9S A;  2Z1H A;  4FJH A;  3CCR N;  1RTD A;  5C2D A;  4O8U A;  3H46 O;  2QKK A;  4JYA K;  4BWJ A;  3L2V A;  1IKV A;  3AO2 A;  1JXE A;  2KKZ A;  3U8X A;  3VQA A;  4ZTF A;  4CD3 A;  5IT9 O;  3O9T A;  4CZK A;  2YHA A;  4DQR A;  3IAY A;  1GLD G;  4KB0 A;  2VWJ A;  4KH5 A;  4CZF A;  2O8F A;  1XWL A;  2VG7 A;  3ZT4 A;  2DY4 A;  1WN7 A;  4PL7 A;  5GIP A;  2P9L B;  4RW6 A;  1ZXO A;  4ISE A;  4I6M A;  3NVK A;  4DQS A;  2HBL A;  5CZ2 A;  1NNE A;  4CGD A;  3A5N C;  4DFJ A;  5B8H A;  1WBD A;  1T8E A;  2D0A A;  2P9S A;  3ZT0 A;  2A1S A;  3VGM A;  2VG5 A;  4HUG A;  3HM8 A;  1NGC A;  3RMA A;  3LAN A;  4FYD A;  4E1M A;  4IO8 A;  3C6T A;  3A8Y A;  1UA1 A;  3I33 A;  4B1W B;  4M42 A;  3BY5 A;  1QTM A;  4CBW A;  3L8B A;  1SV5 A;  2IOC A;  3V9S A;  4KO0 A;  4RTF D;  5EX5 A;  4B9N A;  3LL3 A;  3MEG A;  1EX4 A;  3GBT A;  3SJH A;  1A5W A;  2Q0R A;  4C8O A;  3UB5 A;  3S41 A;  3ASM A;  4CI6 A;  2QWQ A;  1S1V A;  4B1Y B;  1YVN A;  3KIO A;  1YXQ A;  4WFA L;  3Q7B A;  1I3A A; 
#chains in the Genus database with same CATH homology
 4M7X A;  3U9Z A;  4GVE A;  1NM1 A;  3ULE A;  4ISG A;  1YJW N;  3C6H A;  4AM6 A;  1EQY A;  1HKC A;  4JKG A;  4A61 A;  1E4G T;  2ZWH A;  4QS8 A;  4WYB A;  4BC2 A;  5HL7 L;  3SMP A;  5M1Q A;  3PLA A;  5AQK A;  5GAD P;  4QS9 A;  4CBX A;  5C15 A;  4IO9 L;  3E1Y A;  2GWJ A;  3FZH A;  3FZM A;  3IFR A;  4NLC A;  4B1U B;  1EO1 A;  4FWL A;  1QHA A;  1DGK N;  4FWN A;  4H0T B;  2AA4 A;  3ZX3 A;  5EXW A;  2HBK A;  3ZEU A;  3A5O C;  1V4T A;  4OPA A;  3OW2 M;  2GTD A;  2W41 A;  3BF3 A;  1YJ9 N;  3EN9 A;  3TSQ A;  4BRD A;  3VEN A;  4BEC A;  3W0L A;  2HST A;  3AAR A;  3KVG A;  3L6Q A;  3O9S A;  3R1X A;  3HOT A;  2E2O A;  2EWS A;  5AQX A;  3G6E N;  2A6A A;  5EOY A;  3EKU A;  1HJO A;  2E20 A;  2YHY A;  2V52 B;  2IVP A;  4MLH A;  4KBO A;  4IXC A;  1KXP A;  3J8A A;  4JKB A;  5AQU A;  4O8K A;  3T7Z A;  4PHT X;  5HOO A;  4BC5 A;  2GEM A;  4FVU A;  3ZX2 A;  1O13 A;  1X3N A;  3WEE B;  3MCP A;  3DXM A;  5AFU H;  5KQD A;  1NMD A;  4A5B A;  4U7B A;  2QA4 N;  3BF1 A;  4BRC A;  1NGE A;  1T6C A;  2QM1 A;  5BPM A;  4YOY A;  3EL2 A;  2GWK A;  2P9L A;  1U6Z A;  2ASP A;  5KPT A;  4YOV A;  4BG8 A;  4YOU A;  1BUP A;  2KLA A;  2ZF5 O;  1XQS C;  4BC3 A;  3GOI A;  2HBJ A;  3WQT A;  1LCU A;  5M1N A;  3O9Q A;  3VF2 A;  1VQ9 N;  3I8B A;  5TKW A;  1NGH A;  5JVG L;  3ATU A;  2QEX N;  2P9P A;  2HF4 A;  2CGK A;  1NBW A;  3DXM B;  3E9P A;  1GLL O;  2F7T A;  3CJB A;  1IG8 A;  4IFE A;  3TTD A;  2JWL A;  4C1N K;  5BRF A;  5E26 A;  5BRD A;  2C1I A;  5AQI A;  5GAG P;  1VQ8 N;  1Q18 A;  3A0I X;  2FXU A;  4ILH A;  1H1V A;  2D0O A;  2YI1 A;  4H0X B;  4NLB A;  4BRF A;  4FOE A;  3CPW M;  4BVP A;  3K9J A;  3MN6 A;  3H45 C;  3SAF A;  1VQL N;  4IZ9 A;  3LDN A;  4ILJ A;  3LDO A;  2BH1 A;  2NRZ A;  5AQQ A;  4K43 A;  1N8R O;  5JLF A;  5LY3 A;  4H5N A;  1NJI O;  3FE1 A;  3IKM A;  4GY2 B;  5BN8 A;  2C1G A;  3CJ1 A;  3VOV A;  3VMF B;  3TSP A;  3BUZ B;  3D7E O;  4FO0 A;  5MLC Q;  3TSU A;  1DT9 A;  3SK3 A;  3D2F B;  5M1K A;  1NGG A;  4WF9 L;  3NVM A;  4K41 A;  1VQ7 N;  5ADX H;  2P9U A;  3WXK A;  3R3L A;  3WQU A;  2BUP A;  3EKS A;  1YAG A;  2YJF A;  3O1B A;  4JHD A;  5M1O A;  2P9I A;  2ZGY A;  4BVO A;  4EAH D;  3HOS A;  5AZJ B;  4BRL A;  1G99 A;  4BQZ A;  2Q97 A;  4BRM A;  2NRH A;  5M1P A;  4DB3 A;  4BR9 A;  4ISF A;  2CH5 A;  4EIA A;  4XH4 A;  2IVN A;  3CC2 N;  2WUS A;  3O4W A;  3CI5 A;  3P38 A;  4BR2 A;  3MN7 A;  4NO7 A;  5AR0 A;  4H0P A;  3FZL A;  4WQ5 C;  1Q81 O;  2P9K A;  5I9E B;  2P9U B;  1P8Z A;  3UKR A;  3I56 N;  5KPZ A;  3QFP A;  4LC9 B;  3LM9 A;  2NRR A;  1SAZ A;  3EZW A;  3KWG A;  2OAN A;  3TTF A;  3CMA N;  4GV3 A;  4JKC A;  4JKD A;  5JLH A;  3ZYY X;  3CCQ N;  3CME N;  2E2P A;  2IIR A;  4A2B A;  3H1V X;  1K8K B;  4YDU A;  2Q2R A;  3PIO L;  4BG9 A;  5GIN A;  4IDH A;  2QWP A;  3O1W A;  5DM6 L;  4G9Z A;  3MMV A;  4MDB A;  4JN4 A;  4JKH A;  4B1X B;  2P9K B;  4IEE A;  4PL8 A;  3UKR B;  2P9N B;  2D1K A;  1DKG D;  3MK6 A;  4OO1 J;  1NWK A;  2FSN A;  2WBN A;  1VQP N;  3AGK A;  3U9D A;  5AQN A;  3MWP A;  4H0Y B;  4BGB A;  5C0Y A;  2YHW A;  5C10 A;  3NMU A;  2NNW A;  3WEE A;  1QZ5 A;  2QXL A;  1GLC G;  1HKG A;  3CQY A;  3CER A;  1Q82 O;  2RE2 A;  2AP1 A;  4WFB L;  1HKB A;  1MWM A;  3SBG A;  1GLJ O;  2FSK A;  4GNI A;  1HLU A;  4KH6 A;  1BA0 A;  1YIT N;  3FLC O;  4A62 A;  2YCH A;  4DCH A;  1T3V A;  2CGJ A;  3VEW A;  5BRH A;  2QW9 A;  1R59 O;  3A5M C;  3LDL A;  4IOX A;  5C2F A;  2OTJ N;  5F2R A;  3BEX A;  2FSJ A;  3ZET B;  3WXI A;  3VEZ A;  4WCE L;  2WC9 A;  1VQN N;  3VPZ A;  1NGA A;  5AQO A;  2GEL A;  3T69 A;  3VGL A;  5AQF A;  5FPD A;  1QQM A;  2ZGZ A;  3Q7C A;  1YHQ N;  2QWR A;  1WUA A;  3GL1 A;  4JK9 A;  4JK8 A;  1S22 A;  3C7N B;  4IEI A;  4E1J A;  5H1S Q;  1VQK N;  1E4F T;  1KAZ A;  3QBW A;  1JCG A;  1SS6 A;  3HBT A;  4Z94 A;  5AQS A;  4H0V B;  3CHW A;  4A59 A;  1TUY A;  5AQP A;  3FZF A;  3TU5 A;  5GAH P;  2GX9 A;  3IMX A;  2A3Z A;  4XEI A;  2F9W A;  1ATR A;  3CET A;  4B1Z A;  3O08 A;  4BGA A;  4BRK A;  5CHI A;  1V4S A;  3CPE A;  4RCH A;  1M90 O;  2H3G X;  4FSV A;  1ESV A;  3M5R A;  5BR9 A;  1BWF O;  3QBX A;  4FWM A;  1X3M A;  4FL9 A;  1SQK A;  3TTC A;  3VEY A;  3VES A;  3CCL N;  1Q86 O;  3QML A;  4H5V A;  3CF5 L;  3PIP L;  5ADX A;  1IJJ A;  3D6R A;  3CXC M;  1MWK A;  1SZ2 A;  2NZT A;  4H0O A;  5FPM A;  2E2N A;  3LM2 A;  1Y64 A;  2NRW A;  5AQL A;  5EY4 A;  3J7Z O;  3TPQ A;  5C12 A;  1C0F A;  3D2F A;  3B8A X;  5KPR A;  5AZI B;  2ASO A;  1ATS A;  3ATV A;  2FF3 B;  5AQR A;  4BRA A;  4IOC L;  3CJ7 A;  1BDG A;  3N4P A;  1BO5 O;  2VCP A;  2VGN A;  3R6M A;  4GV6 A;  5BPL A;  4JD2 B;  1RFQ A;  3MCA B;  3HRG A;  3OBW A;  4BR4 A;  5AZJ A;  1OVY A;  1KAX A;  4M63 C;  4BE7 B;  1Z6R A;  5AQV A;  1VQ6 N;  2W40 A;  1NGJ A;  3UE5 A;  3VTI A;  1C0G A;  3M3Z A;  2PAV A;  2A5X A;  4RWT A;  3SBT A;  4K42 A;  4CZE A;  1ZC6 A;  3P39 A;  1JJ2 M;  3I55 N;  5AQY A;  4CZH A;  3AAP A;  3CCE N;  4BC4 A;  2Q0U A;  4UY8 O;  3FFK B;  4A57 A;  1QZ6 A;  4EFH A;  4JKE A;  1S72 N;  4FWR A;  2NRT A;  3E66 A;  3WXJ A;  3OHR A;  4JK7 A;  2E8A A;  3ID6 A;  1K9M O;  3EO3 A;  4MO5 A;  5JIC A;  5AQG A;  2QWO A;  3FR0 A;  3H6E A;  3O9R A;  4MO4 A;  4NB4 A;  5E84 A;  4CZI A;  3L0Q A;  3BP8 A;  1K73 O;  2E88 A;  2IVO A;  2Q36 A;  3LDQ A;  4BRE A;  4DKW A;  2I7P A;  4DQ8 A;  4IOA L;  2V7Z A;  1ATN A;  3E9O A;  3DJC A;  4EHU A;  1GLA G;  3FGU A;  1K8K A;  5BPN A;  2J4R A;  4OPH A;  4BRH A;  4CZJ A;  3CJC A;  2V7Y A;  3ENO A;  2P9N A;  3VF6 A;  4AF1 A;  3RSE B;  4I6M B;  5FPE A;  5ELZ A;  5AQJ A;  3C65 A;  3QDK A;  1TYQ B;  3C0B A;  3F2K A;  3O80 A;  4FOI A;  4F9O A;  3K9K A;  1QVF M;  1GLF O;  4MLE A;  3DXK B;  4WFN L;  3G25 A;  1GLE G;  2WFB A;  2D4W A;  2KHO A;  2F9T A;  1CZA N;  4FPB A;  4XH1 A;  4ILG B;  4PKH A;  4H5R A;  2P9S B;  3AY9 A;  5AQW A;  3UKU B;  3F9M A;  3LDP A;  5GIO A;  2D0P A;  5AQZ A;  5FPN A;  4EHT A;  2YX6 A;  3WXM B;  3IUC A;  3VEX A;  4YOX A;  3ID8 A;  5M1F A;  1JCF A;  3VTH A;  1U2V B;  2PFU A;  4IJA A;  1VQO N;  1KD1 O;  3VEO A;  1BOT O;  3ZET A;  5AFU A;  1T44 A;  4BRI A;  4A2A A;  2A41 A;  4L3Q A;  5AQM A;  4BQL A;  3H3N O;  3O6W A;  3W3D A;  4BR5 A;  4QS7 A;  4WQ4 C;  1OKJ A;  3N4Q A;  1GLB G;  1NGI A;  4CJ7 A;  3C7N A;  3KWI A;  3U4L A;  4CD1 A;  4C23 A;  2ASM A;  3H1Q A;  4CZM A;  3OBY A;  4IJN A;  1BA1 A;  2QI2 A;  2VYP A;  3SMS A;  1W2B M;  2QWM A;  3CJ9 A;  2FLO A;  1QQN A;  2V51 B;  3DLL L;  1KQS M;  3CC7 N;  4BEB A;  3WT0 A;  2ZJP L;  3FZK A;  4FWK A;  1J6Z A;  2BTF A;  2NLX A;  5DM7 L;  1RDU A;  3CQX A;  4AM7 A;  4PKG A;  1RGI A;  2E1Y A;  2DPN A;  1HPM A;  3D2E A;  1HUX A;  3ULE B;  2HBM A;  1XC3 A;  4FWO A;  4IWV A;  3MWT A;  4JKG B;  3JS6 A;  3KZB A;  1KC8 O;  5AQT A;  2ZJR L;  4H5T A;  1JCE A;  1RDW X;  3E9L A;  4BR7 A;  3AGR A;  5AZI A;  3R8E A;  1YI2 N;  2GUP A;  4K25 A;  4M7Y A;  4B1V A;  1NGB A;  2VWB A;  5TKY A;  2Q31 A;  3G4S N;  3WXL A;  5GAE P;  2HMP A;  3CC4 N;  4JD2 A;  4YOR A;  3GE1 A;  3EE8 A;  3OA9 A;  2QTD A;  3ENH A;  1VQM N;  2FF6 A;  3QFU A;  3M6G A;  4HTL A;  4J8F A;  3CD6 N;  3SAH A;  3ZEU B;  3CJA A;  4XJX A;  1S3X A;  3D2E B;  4FWP A;  2I7N A;  1TUU A;  4YDU C;  1QVG M;  1VQ5 N;  3QB0 A;  4CZG A;  4C1N I;  1K8A O;  2NRX A;  3ZX0 A;  1BU6 O;  3MDQ A;  2HOE A;  5JVH L;  4A5A A;  3CCR N;  3MX2 A;  3C6A A;  5C2D A;  4O8U A;  4HWI A;  3H46 O;  4BRN A;  1MA9 B;  2E1Z A;  2HF3 A;  1DEJ A;  2UYT A;  3O9U A;  2KKZ A;  3U8X A;  4KH4 A;  3CCV N;  4WQ5 A;  3QIC A;  4CD3 A;  3WUH A;  5LJW A;  3L4I A;  3O9T A;  3VEV A;  4CBU A;  4CZK A;  1VAZ A;  1KAY A;  5F1X A;  2A40 A;  3R9P A;  5AQH A;  2JWK A;  1GLD G;  1NLV A;  3L4Q A;  2QWL A;  3VER A;  4R79 A;  5CE3 A;  5JMV A;  4BRP A;  4B9Q A;  4KH5 A;  4BRQ A;  1Z05 A;  4CZF A;  3SLC A;  1YF5 L;  1VQ4 N;  4JEP A;  3VGK A;  1Q7Y O;  4PL7 A;  5GIP A;  2YHX A;  2P9L B;  2PBD A;  4JNE A;  1ZXO A;  4PKI A;  4FWS A;  5F0X A;  3F5T A;  1X9J A;  4ISE A;  4Y0W A;  4I6M A;  3RSE A;  3VF4 A;  5LJV A;  5KQ8 A;  3NVK A;  2HBL A;  3CCJ N;  4YOW A;  1TYQ A;  4JKF A;  1WOQ A;  2E2Q A;  1P90 A;  1XUP O;  3P31 A;  4FWQ A;  1HX1 A;  3DXK A;  2A42 A;  3A5N C;  3AAQ A;  4H5W A;  5CR4 A;  3MN5 A;  4CZL A;  2P9P B;  5B8H A;  1YJN N;  1ILY A;  2W00 A;  2RHK A;  1NGF A;  3DWL A;  4GV9 A;  4MDA A;  2YJE A;  3CCS N;  2P9S A;  4WQ4 A;  3UKU A;  2QWN A;  3VGM A;  4H03 B;  1MDU B;  4BRG A;  3HSC A;  3VET A;  3HM8 A;  1NGC A;  3MX5 A;  5BRE A;  4YOT A;  3HZ6 A;  3CIP A;  3KHY A;  1U2V A;  3JXU A;  4IO8 A;  5EVZ A;  3G71 N;  3O5B A;  5BN9 A;  3A8Y A;  1LOT B;  3GDQ A;  2VGM A;  3I33 A;  4B1W B;  3CCM N;  4CBW A;  2ITM A;  1YUW A;  3EE9 A;  1NGD A;  3HTV A;  3RVC A;  1YIJ N;  2CH6 A;  4BRO A;  2CGL A;  4JAX A;  1BG3 A;  3M1F A;  3P4I A;  1M1K O;  1QQO A;  3ENB A;  4O5F A;  4RTF D;  5EX5 A;  2ZJQ L;  3LL3 A;  4FPA A;  3GBT A;  3SJH A;  3DAW A;  2NRV A;  2Q0R A;  3UB5 A;  3S41 A;  4U67 L;  1T6D A;  3HI0 A;  4JKA A;  3MN9 A;  4BR0 A;  2QWQ A;  4CI6 A;  1ZBS A;  3KK7 A;  2OTL N;  1W97 L;  4B1Y B;  4BY9 C;  1D4X A;  1YVN A;  4XH5 A;  4WFA L;  1YXQ A;  3O8M A;  3CCU N;  4JHD B;  4DHY A;  2P9I B;  3IDH A;  3H3O B;  3SAG A;  3A5L C;  3Q7B A;  2Q1N A;  3GG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...