2P9SB

Structure of bovine arp2/3 complex co-crystallized with atp/mg2+
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
197
structure length
197
Chain Sequence
b'TGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 54
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9sB02
2P9NB 4H0YB 1HKBA 3LDPA 2V51B 3FE1A 4H5TA 3DXMB 4ISEA 2GUPA 3L4IA 1NGIA 3MK6A 2ASOA 4K41A 5EOYA 4H5WA 4FWRA 1SQKA 3EO3A 4CZIA 3CQYA 5AQOA 4AM6A 3I33A 3D2EA 4BROA 4WQ4C 4A61A 4AM7A 4BR7A 2GELA 2A5XA 3U9ZA 5AQNA 3ZEUB 4KBOA 2Q2RA 3MN6A 3EZWA 1HLUA 3ID8A 1GLJO 4CZKA 1TUYA 2E1YA 2NRHA 4H0VB 3D2FB 2D0OA 2HOEA 2FSKA 2P9LB 4XH4A 1BUPA 4JD2B 5AZIB 4JAXA 2HF4A 2P9IA 5BPNA 3ZETB 4FWQA 2CH5A 3QBXA 5B8HA 3FFKB 3HZ6A 4IZ9A 3DXKA 2QWOA 4ISFA 5AQLA 4K43A 2BUPA 3RSEA 3VF4A 3CERA 4BRGA 1Y64A 1HKGA 1IG8A 1TUUA 4IXCA 5AQQA 2D0PA 4BRDA 2UYTA 2F9WA 3EN9A 1P8ZA 4BVPA 5AQTA 3C0BA 4IJAA 2AP1A 2EWSA 4CZEA 5E84A 2ZGYA 4CZFA 5EXWA 3D2EB 3QMLA 1LCUA 4FWPA 3IFRA 4BG9A 3VPZA 3O08A 1V4TA 3ENOA 4XH1A 3VENA 2IVPA 4EHUA 3H1QA 1MWKA 3CHWA 3OHRA 2GEMA 3FZFA 3HM8A 1X3NA 4K25A 3LDQA 3KHYA 3AAPA 5FPMA 5AQMA 3AY9A 3VEXA 4BR0A 5KPRA 4B1VA 1GLCG 2E2QA 3ZX2A 3ZX3A 2QW9A 3A5OC 2PBDA 4CJ7A 2P9IB 3CJCA 1ESVA 3KZBA 4CD1A 2P9KA 4CI6A 3DXKB 3O1BA 3SK3A 4FWOA 5EVZA 2P9SA 2QWLA 2H3GX 3FZHA 3BF1A 4H5VA 2FXUA 4H5NA 4CZJA 2CH6A 2GWKA 3QFPA 1ZXOA 3FZKA 3SMPA 3S41A 3VEYA 1K8KA 1ATRA 4QS9A 1HJOA 2A40A 1NLVA 2QWQA 3LDNA 4CBXA 3U8XA 5I9EB 2J4RA 4IWVA 5AQWA 3VEOA 3M1FA 4B9QA 4BQLA 2Q97A 1NGGA 4H5RA 4BRKA 2I7NA 1NGAA 4B1YB 1YUWA 5LJVA 2Q0RA 1NGCA 3UB5A 4RTFD 4A2BA 4IO8A 1U6ZA 2ZF5O 4EAHD 2FF6A 2V52B 3WT0A 5F0XA 3BF3A 2Q36A 1ATNA 5AQVA 4BGAA 1SAZA 1DKGD 3MCPA 3TU5A 4CZLA 1QQNA 3CJBA 1U2VA 1WUAA 3CIPA 1S22A 3H3NO 4FOEA 4BQZA 5F2RA 2P9KB 3BUZB 1E4FT 4JN4A 5BR9A 1RGIA 5KPTA 5BPLA 2P9SB 3W0LA 3IUCA 1GLBG 1NGFA 4B1WB 4MO4A 1ZBSA 4M7YA 5TKYA 3C7NB 1T44A 4MLHA 1CZAN 5BN9A 5FPDA 2FF3B 3VEZA 4FWNA 2V7ZA 1K8KB 5LY3A 2YJEA 2E2PA 2ASMA 1ZC6A 4M7XA 4DHYA 2A42A 4BRHA 3A0IX 2HMPA 2Q31A 4WQ4A 3WQTA 5BRHA 4EFHA 4QS8A 4B1XB 1MDUB 3ENHA 2YHYA 1XC3A 1GLAG 3WQUA 1ATSA 2KHOA 3ULEA 2GTDA 2CGLA 3BP8A 3J8AA 1U2VB 3KVGA 3GL1A 5BRDA 1BWFO 1NMDA 1YAGA 2A3ZA 4YDUA 3JXUA 1KAXA 4M63C 4WYBA 4FWLA 1GLDG 3HI0A 3LL3A 4HWIA 3CQXA 4FPBA 1BOTO 3IDHA 3L6QA 2IVOA 1KAZA 3VGLA 2ZWHA 5AQSA 2CGKA 4J8FA 4JHDA 4GNIA 1QQOA 1JCEA 1BU6O 3MMVA 2YCHA 5EY4A 4F9OA 4IJNA 3QBWA 2OANA 1RDWX 3JS6A 3CJ7A 4CZGA 3QDKA 4GY2B 4WQ5C 2QXLA 1BA1A 1QHAA 2E2NA 3A5MC 3H45C 2WUSA 4H03B 4ISGA 3B8AX 2P9UB 2Q1NA 4I6MA 1NGDA 1H1VA 1BG3A 4H0TB 4FO0A 2QWNA 4Z94A 3GE1A 1Q18A 1MA9B 4FL9A 4K42A 3O5BA 2YHWA 5AQPA 3FZMA 3ULEB 3A5LC 3C7NA 4BR2A 3H1VX 2ASPA 4BC5A 4BRLA 1V4SA 3QFUA 4B1UB 1WOQA 5AQUA 4B1ZA 4DB3A 1NGHA 4BC3A 1HX1A 3H3OB 5ELZA 2E2OA 4NB4A 4O5FA 2F9TA 4PL7A 4BR5A 4XH5A 4H0XB 3WXKA 2IVNA 1T6DA 1KAYA 5AQFA 3R9PA 3VGMA 4CBWA 4FSVA 1D4XA 4BRNA 4O8KA 4JHDB 1YVNA 4BREA 3WXJA 3CI5A 2VWBA 5KQ8A 3FZLA 1LOTB 3EKSA 5AZJA 3GG4A 3HBTA 3D7EO 3A5NC 3U4LA 4HTLA 1QZ6A 1X9JA 1HUXA 1HPMA 3GBTA 2NZTA 2W41A 2QM1A 3LDLA 4I6MB 5AQGA 4BR9A 5BRFA 3O8MA 4FPAA 1NGEA 1JCGA 3TPQA 1GLFO 3U9DA 4RCHA 1Z05A 4BRCA 4CD3A 5F1XA 3VOVA 4PKIA 3VESA 1HKCA 3FGUA 2V7YA 3VEVA 2W40A 3MN9A 4EIAA 2E1ZA 3VF6A 3VF2A 3VETA 3W3DA 5EX5A 4LC9B 4BR4A 2DPNA 1T6CA 3DWLA 4MLEA 3MN5A 1XQSC 4FWMA 1Z6RA 2IIRA 4RWTA 5E26A 3O6WA 3FLCO 1X3MA 2P9UA 1BDGA 3CJ9A 5AQKA 2VCPA 1E4GT 1KXPA 4DCHA 5JMVA 4BRPA 1MWMA 4CBUA 2FLOA 3WEEA 4MO5A 4NO7A 3QICA 3DAWA 5CE3A 2P9PA 1GLEG 5AQJA 5AZJB 3EL2A 3GDQA 5AR0A 1BO5O 1TYQA 3ZX0A 2VYPA 1NWKA 4BRMA 3ATUA 3LM9A 4BRFA 4YDUC 4BRIA 4H0OA 3DJCA 5KPZA 2GWJA 4PKGA 3HTVA 4H0PA 4A2AA 4PKHA 3L0QA 3QB0A 2PAVA 2ITMA 3UE5A 3CJ1A 1NBWA 2QWMA 4CZMA 3MDQA 4L3QA 2A41A 1JCFA 1NGBA 1XUPO 3AAQA 2AA4A 3O4WA 4PL8A 5KQDA 3A8YA 3P4IA 4EHTA 1NM1A 2FSJA 2BTFA 2QWPA 3UKRA 1OKJA 1IJJA 3VGKA 4BRAA 3SLCA 3M3ZA 3VEWA 2YI1A 5FPNA 3SJHA 3WXLA 4DQ8A 5AQIA 3HSCA 3UKUA 3LM2A 3EKUA 1NGJA 4BGBA 2ZGZA 3I8BA 1QQMA 5BREA 2QWRA 3IMXA 3O1WA 4FOIA 4QS7A 4Y0WA 4A62A 3WEEB 5JLFA 3AARA 2Q0UA 2P9NA 5BPMA 3VERA 4E1JA 1C0GA 3WUHA 3R6MA 2P9PB 4FWSA 5AQYA 1QZ5A 3DXMA 1R59O 1TYQB 1SZ2A 3LDOA 3M6GA 5JLHA 2HF3A 5AQRA 3H46O 3CJAA 4CZHA 2D1KA 4BRQA 5LJWA 1DEJA 5AQZA 2CGJA 3O80A 2NLXA 4WQ5A 4BC4A 5BN8A 2E88A 2E8AA 3MN7A 2YHXA 3WXIA 5ADXA 4BVOA 3RSEB 2FSNA 1EQYA 5AFUA 5ADXH 2YJFA 3ZEUA 1J6ZA 3H6EA 5AQHA 4JNEA 3FR0A 5AFUH 4C23A 2I7PA 3UKRB 5FPEA 1DGKN 3D2FA 1GLLO 5JICA 3BEXA 1S3XA 2P9LA 4BC2A 4BG8A 3CETA 4JD2A 3R8EA 3F9MA 3GOIA 4FWKA 5AQXA 1BA0A 5AZIA 1G99A 1YXQA 2D4WA 2E20A 1RFQA 3ATVA 4XEIA 3UKUB 2A6AA 3ZETA 3G25A 3SMSA 1C0FA
chains in the Genus database with same CATH superfamily
4IEEA 2XHBA 2VGMA 3DXMB 4ISEA 4Y1DA 2RN2A 1NGIA 2ASOA 4H5WA 2OZMA 3C95A 4JI0K 3CQYA 5AQOA 4I7FA 3I33A 3G0ZA 4A61A 1EETA 4AM7A 4CEDA 2GELA 2A5XA 3U9ZA 4PWDA 4KHWA 4KPYA 4PUOA 5SZTA 2G8VA 3SAFA 1C0UA 1REVA 3EZWA 2HHXA 1ASVA 1GLJO 3JYTA 2X6NA 2NRHA 2OTLN 1QVFM 3AO2A 2YNHA 3TAGA 2B6AA 3T1AA 4B8AB 3LWLA 3U6FA 4JD2B 5AZIB 4JAXA 5AJ3K 2XY7A 1N6QA 4FCYA 2P9IA 5BPNA 3ZETB 2ZE2A 1RNHA 3HZ6A 3MEGA 1NJZA 1ASWA 4BRGA 5M1KA 1EO1A 2W6KA 1IG8A 1TUUA 5I42A 4DR3K 3OJUA 2D0PA 4H4MA 3EN9A 1NOZA 3CCVN 1QTMA 3C0BA 4A5AA 4IJAA 3NGIA 3ID6A 2AP1A 2EWSA 5E84A 4DTNA 5EXWA 3D2EB 4DQQA 1XMOK 1QSSA 4YNQA 3EE8A 2Y1IA 4QOZB 4KO0A 3VPZA 1V4TA 4E1MA 4C8LA 4FVUA 3VQAA 4KH4A 2IVPA 4EHUA 3AA4A 3CHWA 4BDYA 2GEMA 3HM8A 4CHQA 4CJPA 4Z4CA 3ZX3A 2F4VK 3MAQA 3A5OC 3CJCA 4FJNA 4CD1A 2P9KA 5LL6Z 2F7TA 3SK3A 3MECA 4FWOA 4CE9A 4O4GA 3BF1A 3VA3A 4LH5A 4YOYA 3AVJA 2ZM6K 1NMNA 4Z4GA 4E1NA 3V9SA 3BZCA 3SMPA 4BWJA 4DSFA 3P83D 1VSDA 4ICLA 3KD5E 1HJOA 4DV3K 5CYMA 4GVEA 2UXBK 1WLJA 4GVMA 3U8XA 3VEOA 3M1FA 1Z25A 2Q97A 3AVFA 4H5RA 4BRKA 5M1FA 4KHSA 5A2QO 2I7NA 1NU0A 4B1YB 3OJSA 1YUWA 1NJYA 1RTJA 4DMNA 3OYKA 4JI8K 1U6ZA 4EAHD 1MU2A 3AVLA 4QCLA 4KH5A 3BF3A 4E7JA 3TU5A 1QQNA 1WUAA 3AVHA 1S22A 1KLMA 3C6TA 1JLFA 4HCBA 2VQEK 4DV1K 4F4KA 4R79A 3P1GA 1EKEA 1D9DA 2GUIA 4FK0A 1O1WA 3QEWA 2BGGA 3IUCA 4DS5A 1RBTA 1ZBLA 4B1WB 3BDPA 4M45A 4M7YA 3TAEA 2G8HA 5BN9A 3VEZA 3RMDA 4F3TA 5LY3A 3D0PA 1ZYQA 4KKOA 4JKHA 1YT3A 2E2PA 1ZC6A 4E7LA 1IO2A 2Q31A 2NUBA 3WQTA 4QS8A 3ENHA 2VWJA 3AA3A 2QA4N 2KZMA 2OTJN 3WNEA 3ZSVA 2OZSA 4DR1K 3ZSXA 3WQUA 4W5TA 1ATSA 5J2QA 1JKHA 2GTDA 1GOAA 3E9OA 4C1NI 2HHSA 3AVNA 4OJRA 4BACA 2RF2A 4IDKA 2RKIA 3J8AA 1U2VB 3RR8A 2KZZA 4YDUA 3WXMB 1L3SA 4M63C 1JL1A 1GLDG 3C6AA 5CHIA 5GAEP 3LL3A 1CXUA 3S5TA 4FM2A 3CQXA 4FPBA 2IVOA 4CECA 3LAMA 4KH6A 1NK6A 4GNIA 1S6PA 4M42A 4B9VA 5IT9O 3LZIA 2YCHA 1TKTA 3LANA 1RTHA 2OANA 3IKMA 4IDHA 3THYB 1L3VA 4DR7K 3CJ7A 2HVIA 4ISGA 2WUSA 2KFZA 3SJJA 3HSTB 1BI4A 1YF5L 3K9KA 4A59A 3M8RA 1BG3A 3ZSYA 1VQ6N 3GE1A 5EU7A 2QI2A 2RHKA 4K42A 2YHWA 4EP4A 4FXDA 2JWKA 3A5LC 4BR2A 4BC5A 4BRLA 1V4SA 4HUGA 5M1OA 3ITHA 1NGHA 3MX2A 1S9GA 1B9DA 4O5FA 2F9TA 4BR5A 1IG9A 3EE9A 1T6DA 4IG0A 3R9PA 3WNFA 1I39A 4U67L 4CBWA 1IBLK 4K8XA 4LH4A 3CD6N 3OYAA 1VQKN 4Y1CA 4FJLA 5J2PA 2UU9K 2VWBA 3HRGA 5KQ8A 3OYFA 4DFMA 4DTPA 4IFYA 2QXFA 3EKSA 4QAGA 4CGIA 1KLNA 3KLIA 3OYIA 1HUXA 3OYBA 2HBJA 4I6MB 3E01A 1VSEA 5AQGA 1YJWN 5BRFA 4KHQA 1SL2A 4PA1A 1GLFO 1XI1A 4CD3A 5F1XA 1OVYA 1VK0A 3OW2M 3JAMO 1HKCA 3FGUA 3AO3A 3ZT3A 3VEVA 1B9FA 3MN9A 3PSFA 2IC3A 5EX5A 1LWEA 4LC9B 3W3DA 5C24A 2YHBA 1RT3A 4MQ3A 1HNVA 1XQSC 4FWMA 1Z6RA 4CESA 3RR7A 1BDGA 3KK3A 4ZTFA 3CJ9A 2A1SA 2VCPA 1E4GT 4KHPK 4B3TK 4GV3A 1MWMA 1W97L 4BECA 3LDSA 2YNGA 4LSNA 1JXEA 3PX4A 3ZX0A 4CHYA 4YY3K 1TL1A 3LM9A 4KREA 1T3VA 1TAQA 1RDAA 4PKGA 3VQCA 4PKHA 2VQFK 3M8PA 3L4QA 4DLEA 2UUAK 3UE5A 3V9ZA 2O8BB 2QWMA 4EP5A 4DFJA 3CCMN 2A41A 4M3TA 3A8YA 3K9JA 1NM1A 2FSJA 4DR6K 1OKJA 3G10A 5KGXA 2HVHA 4CJVA 4JI6K 4BRAA 3CYMA 4A57A 1WAFA 1K9MO 3SPZA 5K14A 3VQ8A 3CPWM 2D0AA 3SJHA 4DQ8A 1TAUA 1B92A 4M3ZA 3EKUA 1NGJA 4KFBA 3I8BA 1QQMA 1RTIA 4CJRA 4Y0WA 3WEEB 4HCCA 1TK0A 4CFBA 3VERA 4E3SA 3IG1A 3WUHA 4FWSA 3O4NA 2YNFA 3DXMA 4CGJA 2Z1JA 1NNEA 4W5NA 1L3TA 4JI5K 3PX6A 2HF3A 5I3UA 3H46O 3U3GA 5C0YA 3TAQA 3SQ1A 2JGUA 4NCAA 2D1KA 4OKEA 4RW7A 3V1QA 4GKKK 3U3YA 2CGJA 4FJ9A 3OS0A 2E88A 4CHPA 1C1AA 2P5GA 4B3OA 2BANA 1DT9A 4U7BA 4OLAA 2P1JA 5ADXH 1VAZA 4IFVA 4JNEA 5AFUH 4C23A 3AVAA 5TKWA 3UKRB 1EWRA 1GLLO 1VQ8N 3VQQA 5JICA 3BEXA 4BC2A 4C8KA 1RT6A 4FK2A 4JD2A 3F9MA 3GOIA 5AQXA 5AZIA 3OA9A 1YXQA 2E20A 3ATVA 1QSLA 4CGHA 3UKUB 4O55A 3ZETA 5JVGL 4AHTA 4CK3A 5HLFA 2P9NB 4H0YB 3LDPA 1KVCA 1VSFA 2V51B 4JKGB 4DR5K 4GW6A 4X62K 1NJIO 3SNNA 3PY8A 3L4IA 2HHHK 1NK4A 4CEOA 5D3GA 1NG9A 3NMUA 3NVKA 4DV6K 2HHVA 3L3VA 1FXXA 4AM6A 3D2EA 3IRXA 4J2EA 3HPHA 3HO1A 2YKMA 4EZ9A 3CCRN 4KI6A 2Q2RA 4CGDA 2D5RA 3O4QA 4FJGA 1YTAA 3D2FB 1YJ9N 4WFNL 1KFDA 2FSKA 1NK9A 4XH4A 4DTJA 1BUPA 1N36K 2G8UA 4IOXA 4FLUA 2HF4A 1JLBA 2XY5A 4M3UA 4FWQA 1NKEA 3QBXA 4CJFA 3CPEA 4IZ9A 1HNXK 3NVMA 4K43A 4CIFA 2BUPA 3VF4A 3CERA 1RILA 1TK8A 1HKGA 4B9MA 2UXDK 1WBBA 3KKSA 3TSQA 3L8BA 2UYTA 4AHSA 1YHQN 3AVKA 1QQCA 3KK1A 3JSMA 3DLRA 4CERA 4DTSA 4CZEA 4CZFA 1LCUA 4FWPA 4PHTX 3IFRA 3ZSRA 4CVNE 1D5AA 3VENA 4O0JA 1DLOA 1NKCA 2VG6A 1U48A 1VSHA 1I3AA 3H1QA 4CJ5A 3OHRA 4N47A 3FZFA 4OPJA 4K25A 3AAPA 2BH1A 3VEXA 4BR0A 2WOMA 5KPRA 4JK7A 2QKBA 2PBDA 4C1NK 1ESVA 4DV5K 4CEFA 3DXKB 1NJWA 3AV9A 3C94A 3PX0A 2H3GX 4CEZA 3I0SA 2FXUA 2GWKA 4CJ3A 3NAEA 2AJQA 1WSEA 3Q7BA 3T19A 1KVAA 1XC9A 5HRNA 3OYDA 2A40A 3CG7A 3LDNA 4CBXA 3A2FA 2C1GA 2J4RA 3E66A 3KLGA 5AQWA 5CY4A 1SKWA 5FDLA 3SAHA 3I56N 1VHXA 1YVUA 3K5OA 4C8NA 3F9KA 2ZF5O 3EYZA 3TAFA 2JLEA 4E72A 1RT5A 4F3OA 3QNNA 4BGAA 2YV0X 3MX5A 4LF6K 1U2VA 3CIPA 1HMVA 3QLHA 3I55N 1F21A 1E4FT 1IH7A 3N4PA 2P9SB 3W0LA 4Q0BA 1GLBG 4MO4A 1ZBSA 5GADP 1U49A 5TKYA 2IGIA 4H8KA 3KTQA 1UWBA 4W5RA 3KWGA 2V7ZA 3RVCA 3PIOL 4CK1A 3K5MA 2FC0A 2YJEA 3THYA 4Z4HA 4M7XA 3A0IX 1IBKK 1WSJA 2HMPA 1Y97A 4BE2A 4DSIA 4YORA 4B1XB 3VMFB 2HNZA 4ID5A 3NH1A 3HYFA 3CC2N 2VGNA 1VSIA 1T03A 1XC3A 3L2QA 3LWMA 1LWFA 4G9ZA 2KHOA 4AHCA 4NCGA 2CGLA 3KVGA 3O3HA 1D9FA 4OGEA 2FBTA 4BDZA 4FWLA 2F8TA 3MXJA 3L2WA 2B4JA 3HPOA 4CHZA 1ZBFA 3VA0A 4NYFA 2HMIA 1KAZA 5AQSA 1HRHA 5HRSA 3DMJA 5FRNA 1JCEA 1BU6O 2HW3A 3MMVA 4B9NA 1VSLA 3QBWA 4KV8A 1RDWX 2NRZA 3QDKA 4GY2B 2QXLA 2E2NA 1QHAA 3H45C 5LMNK 2P9UB 2Q1NA 4I6MA 1A5XA 4KHYA 4FO0A 2HB5A 1U47A 2QWNA 2O8CB 4Z94A 1NOYA 1UA1A 1Q18A 3AO1A 3OS1A 2FBYA 2UUCK 3HL8A 3O5BA 4C8MA 5AQPA 1S1WA 3C7NA 2GBZA 3H1VX 3KIOA 3OYNA 2VG5A 1WOQA 4B1UB 3DRRA 5AQUA 2Z1IA 3Q7CA 4Z4IA 1VQ5N 2W6LA 4BC3A 1HX1A 4NB4A 4V19S 4H0XB 3WXKA 2IVNA 2JWLA 1WSGA 4JEPA 3VGMA 4CJEA 1FJGK 4W5QA 4FSVA 1D4XA 3HP9A 2NRWA 4BRNA 4E89A 2O8DB 3SYZA 4BREA 1NK8A 1OVQA 5HL7L 2PYLA 1LOTB 3SI6A 3C6UA 4B9LA 3V1RA 2DFEA 3D7EO 3A5NC 2ETJA 2DTUA 3FFIA 3T7ZA 1HPMA 2F96A 3RRHA 1CLQA 4FPAA 1NGEA 1JCGA 1HNZK 4BRCA 4DTOA 1VQ9N 3K5LA 2O8BA 3MEDA 4PKIA 3RWUA 2KTQA 2V7YA 2O8FA 2E1ZA 3VF6A 3OYMA 3QO9A 4FW2A 1QHTA 1SV5A 3DWLA 3V6DA 2YX6A 4RWTA 4DU3A 3FLCO 1Q82O 3OS2A 1S1TA 4MDAA 4DF4A 4BRPA 3DRPA 2FLOA 3WEEA 1S5JA 4OO1J 4ELTA 4NO7A 1QE1A 3QICA 5CE3A 1GLEG 4ILGB 5AQJA 3GDQA 2LSNA 3PUFA 4ELVA 1BQMA 1N32K 4BRMA 3ATUA 4KAZA 1WAJA 4H0OA 3K2PA 3DJCA 3IS9A 4EZ6A 1VQNN 5KPZA 2GWJA 3HTVA 3SBTA 4CJQA 3CC7N 4JI3K 2HHWA 3QB0A 2PAVA 2ITMA 1U45A 3CJ1A 4CZMA 2NRTA 4FLWA 1XUPO 3AAQA 3TAPA 4DV4K 3SZ2A 3T3FA 5HRRA 3PLAA 3UKRA 5J2MA 1NK5A 4FJ7A 3J7YP 1M90O 3VGKA 3SLCA 3VQDA 3V9UA 3VEWA 4CW7B 3EZ5A 4CFDA 1BISA 3NBPA 3TARA 3H08A 4HUFA 5AQIA 3UKUA 3LM2A 1Q86O 2FBXA 1GOBA 4FLZA 3O1WA 3SV3A 3I0RA 1TVRA 3AARA 3VQ5A 2P9NA 5BPMA 3M5RA 4B9TA 2OPPA 2P9PB 4JKGA 4AHRA 3SQ4A 3K59A 3J7ZO 3M6GA 5JLHA 4CFCA 3G6EN 4DTUA 4CGGA 1C0TA 5AQZA 2NLXA 1LWCA 4OKJA 2E8AA 3AGRA 3MN7A 3KD1E 3F73A 1EWQA 4JLHA 4LY7A 3WXIA 4BVOA 2FSNA 5C42A 3QEVA 3QETA 4N5SA 3SUNA 2YKNA 3OYHA 1UOCA 4LFBK 2I7PA 4WE1A 3K58A 4OGCA 3D2FA 1JLAA 5M1PA 5GIPA 3CETA 3WNGA 1UA0A 1BA0A 4PY5A 1RBVA 1LAWA 4M3YA 4AILC 4B08A 5KTQA 4DQSA 3OBWA 4UY8O 4FLXA 3NFAA 5JS2A 4DTMA 3HOTA 1XNRK 1HKBA 1WN7A 3ZYYX 3FE1A 3AGKA 2ZJPL 2GUPA 5EOYA 1U04A 3ZSOA 1SQKA 4HTUA 4IOAL 2YHAA 4B3MK 4CZIA 3OYGA 5JVHL 4JKCA 4CJWA 3M8SA 4BROA 3TI0A 5SWMA 3C65A 4JRQA 1OH5A 3HXMA 3BY5A 3ZT2A 4BR7A 3O3FA 3ISNC 1YIJN 5AQNA 3TAMA 3ZEUB 4KBOA 1KRPA 4WFAL 4FVMA 1HLUA 1TUYA 1WB9A 2E1YA 1X1PA 4H0VB 2HOEA 1BQNA 2P9LB 3L2VA 3NF7A 3EEQA 3DM2A 1RT1A 3MWTA 3NGZA 3CMAN 1NJXA 4FM1A 2YNIA 3ULDA 1J9AA 3QIPA 1JLQA 3DXKA 4ISFA 5AQLA 3VTIA 3WNHA 3RSEA 2X6SA 1Y64A 4IXCA 3L2UA 2HBLA 3CMEN 1NKBA 1A5VA 4YOWA 1UAXA 1P8ZA 4NLBA 3VQ6A 2IAJA 2R7YA 3S9HA 2ZGYA 3QMLA 1KTQA 5C10A 2QKKA 4BG9A 3ENOA 4GMJB 1NK7A 4AQYK 4DTRA 3C6HA 3J7AP 1GOCA 4FJHA 4CEEA 3KHYA 3HOSA 5FPMA 2X74A 2HBMA 4YOUA 3CYGA 1GLCG 2E2QA 3ZX2A 4JV5K 2QW9A 4MDBA 3TTFA 4DSLA 2HHIA 1Q7YO 2P9SA 3S3NA 4RW9A 4H5NA 4CZJA 2D0BA 4JRPA 2CH6A 2W42A 5CZ2A 4HHTA 1RDDA 4BDPA 1ZXOA 4J2AA 1N5YA 4GV6A 2RPIA 4X66K 3FZKA 1W9HA 3S41A 3VEYA 4JKFA 1ZBIA 1ATRA 1FKOA 1D8YA 3O9UA 4B9SA 3DLGA 4LFAK 2W00A 4B9QA 1NGGA 4LF8K 4M3RA 1NGAA 1I94K 3ZSWA 4CJKA 3OBYA 5LJVA 4CF8A 4WF9L 2Y1JA 1L3UA 1NGCA 3UB5A 2PZSA 5E41A 4A2BA 1W2BM 1XHXA 2V52B 3HM9A 2ZJQL 4ILHA 3P5JA 3WT0A 4B3RK 2Q36A 1HPZA 5BR8K 5AQVA 1SAZA 2RE2A 1LV5A 3CJBA 4C8OA 4DWIA 3NE6A 2VWKA 3RTVA 4NCBA 3H3NO 4FOEA 3QEPA 3BUZB 5BR9A 1W0HA 3AVIA 2NRXA 4JN4A 2OCEA 1S1VA 5BPLA 3G4SN 2QK9A 3LPUA 5GIOA 3BZKA 2G8WA 4JK9A 1EP4A 3THWB 3CCSN 4DU4A 3SQ0A 4E7KA 3VQ7A 2FF3B 4JS5A 4FWNA 1FK9A 1K8KB 3RRGA 3TSUA 3DOLA 4B3SK 3R3LA 4FLVA 1P90A 1QVGM 2E6MA 3DLKA 4DG1A 2HNDA 4JS4A 1OH7A 2O8CA 2QTDA 3S3MA 3SCXA 1XNQK 4BEBA 3PIPL 4FLYA 1DTQA 2Z1GA 1TKZA 1BIZA 4CF9A 5BRDA 3GL1A 3VQPA 1BWFO 1NMDA 1S1XA 2ZQBA 3E9PA 1ZBHA 2A3ZA 1KVBA 1ILYA 3JXUA 4WYBA 4J2BA 3PSIA 3TABA 4HWIA 1RBRA 2EX3A 4CK2A 2G8FA 2ZWHA 2CGKA 3NHGA 4J8FA 3CCEN 2O8DA 2F8SA 1QQOA 4ZHRA 1HNIA 3VN5A 1JLGA 2XY8A 4IJNA 3QIOA 5C12A 1C0MA 3JS6A 4CZGA 4WQ5C 4F8RA 4DV0K 3LALA 4I9QA 3B8AX 4BE7B 1H1VA 3D45A 1IKVA 2PFUA 2XRIA 4KI4A 4DTXA 1MA9B 4FL9A 5DM7L 3ULEB 1TGOA 1S9EA 2ASPA 3QFUA 4KHNA 3VQEA 4JKDA 5ELZA 2E2OA 4PL7A 4CF0A 1EX4A 5AQFA 3SBGA 2KQ2A 4DV7K 3VQBA 4JHDB 1RBSA 3J81O 3WXJA 4JKBA 5GINA 2ZD1A 4AH9A 2OPSA 1JLEA 4LSLA 4KTZA 3HBTA 4FZZA 3S3OA 1CZBA 1QZ6A 1X9JA 3DI6A 4O44A 3ASMA 3K5NA 3GBTA 2NZTA 1Z26A 4FYDA 3NF9A 1C6VA 3VQ9A 3ZT4A 2E5LK 4FJJA 4FJKA 1VRTA 4RCHA 1Z05A 4M3XA 4OX9K 4DU1A 4JKEA 3VOVA 3VESA 1RT2A 3KK2A 5M1QA 4I2PA 1OH8A 1KFSA 4MFBA 2BDPA 2W40A 2G8KA 4EIAA 2NRRA 3VF2A 3VETA 1HQUA 3G71N 4CJSA 1IKYA 3OYLA 2GV9A 1T6CA 1HNWK 4AHUA 4MLEA 5C2FA 5E26A 3O6WA 4N76A 3QERA 3SUQA 4DCHA 5JMVA 4CBUA 4MO5A 1FW6A 1WSIA 2P9PA 2O8EB 5JS1A 3ZSQA 5AZJB 3EL2A 5AR0A 4OVLA 5T7BA 3MEEA 4FJ8A 1NWKA 4YDUC 4BRIA 3HT3A 3ZT0A 4H0PA 2WTUA 4JK8A 4DKWA 4I2QA 4LF4K 1NBWA 3MDQA 2PYJA 1J5OA 3THVA 4GV9A 2AA4A 4PL8A 5KQDA 1KSPA 3P4IA 2BTFA 1DTTA 1IJJA 1NK0A 3K57A 3M3ZA 3ZCMA 1RT7A 5CZ1A 3AO5A 1G15A 2YI1A 3HP6A 4KB1A 5FPNA 1RCHA 4OKKA 3WXLA 3KLFA 3HSCA 4BGBA 4DFPA 2ZGZA 4FOIA 1HYZA 2HSTA 1EXQA 3IMXA 5HROA 2DY4A 2VG7A 4B9UA 1HJRA 1Q9XA 1SL0A 4YHHK 1QZ5A 1HR0K 2I5JA 1R59O 1RT4A 1TYQB 3O3GA 1LAVA 3CM6A 2C1IA 4CZHA 4BRQA 4LF9K 3QNOA 1K8AO 1LW2A 1DEJA 3O80A 3BGRA 4WQ5A 4BWMA 2HBKA 1N33K 2OYQA 3OTOK 1X9SA 4HUEA 4AHVA 4DLGA 3SQ2A 1VQON 3UIQA 4LF7K 3D6RA 3LAKA 3QESA 3O9QA 1JL2A 1WBDA 3ZEUA 1J6ZA 3H6EA 5AQHA 2KLAA 1BGXT 1BCMA 3DYAA 2UXCK 1DGKN 3CCJN 2HHTA 1N34K 1S3XA 1VSKA 3CFRA 2P9LA 4CGFA 3SV4A 1IBMK 1G99A 3DOKA 3AA5X 4ELUA 4XEIA 1Q8IA 2A6AA 4CEAA 2B5JA 4CJ4A 3SMSA 3VQ4A 1SKSA 4JI4K 3E1YA 2NNWA 3OVNA 4H5TA 4OPAA 4CHOA 5C25A 4I9LA 5HRPA 3MK6A 4K41A 1JLCA 1K73O 4FWRA 3HVRA 3EO3A 3E9LA 3TWHA 4FZXC 5H1SQ 4JI7K 1T05A 1RDUA 3TANA 5KRSA 2DFHA 4RW8A 4WQ4C 5LMUK 2WBNA 4NXNK 4CIEA 4PQUA 1CZ9A 4DV2K 4IO9L 3MN6A 1BIUA 3ID8A 4YOTA 4B8CA 4FK4A 4CZKA 1C1BA 5M1NA 1Q81O 3THXB 2O4IA 2D0OA 4DUZK 4FZYA 1YI2N 4CF2A 1KCFA 3HPGA 1ITGA 2E4LA 2CH5A 4TSXA 5DMRA 5B8HA 3FFKB 4ID1A 3N4QA 4DQRA 2QWOA 1S6QA 4JI1K 2EHGA 3MXIA 4BY9C 2WFBA 4OPKA 5AQQA 3LZJA 3TTCA 3ALYA 4NYNA 1XHZA 4BRDA 1WSFA 3CFOA 4FLTA 4KB0A 2F9WA 4BVPA 5AQTA 3OYEA 3V9WA 3O9RA 3NH2A 3PV8A 1T8EA 2UUBK 3M8QA 2P51A 1VQPN 1RDCA 1VRUA 3AVCA 4O8UA 4E0DA 3P31A 3O08A 1SKRA 4XH1A 4G1QA 2XO7A 2IDOA 4Q5VA 2HHUA 2KW4A 1QSYA 1X9MA 1MWKA 3V1OA 3QEIA 1IV0A 3I8DA 1X3NA 2HHQA 3LDQA 3ZSZA 5AQMA 3AY9A 2WC9A 4B1VA 3ZLJA 4CJ7A 2P9IB 3KZBA 4CI6A 3O1BA 3T1YK 5EVZA 2QWLA 3FZHA 4H5VA 3THWA 3QFPA 3SPYA 3HJFA 2DFFA 1VSMA 1BHLA 4OLBA 1K8KA 4CJTA 3MWPA 4QS9A 1NLVA 2QWQA 2IOCA 2ZJRL 5I9EB 2A1RA 1SS6A 4IWVA 3KKRA 4BQLA 5DK5A 2Q0RA 3RMBA 3ZT1A 4AF1A 3LP3A 4RTFD 4IO8A 1RTDA 5KGWA 2FF6A 3SUOA 1O13A 3HVTA 5F0XA 2D0CA 1VSJA 4RW4A 1ATNA 1DKGD 3MCPA 3QINA 4CEBA 4CZLA 4UQGA 4K0KK 4O5BA 4CIGA 2E6LA 4BQZA 5F2RA 1LW0A 2P9KB 5KPTA 1RGIA 3LP1A 3MCAB 1NGFA 1HYVA 3QEXA 2Z1HA 3CFPA 3CCUN 3PO4A 3DLLL 3C7NB 1T44A 4NLCA 4MLHA 1CZAN 3RMAA 5FPDA 4YFUA 5KI6A 4CJUA 1S1UA 2OPRA 3IAYA 2ASMA 4DHYA 2A42A 4BRHA 1M1KO 1TK5A 4WQ4A 3DRSA 3KJVA 5BRHA 4EFHA 2Q3SA 1MDUB 1JJ2M 3LPTA 4DSKA 2YHYA 1FKPA 4W5OA 1TV6A 3NF8A 1HYSA 5CYQA 3K0SA 2HNYA 3KWIA 3KLEA 1GLAG 3SUPA 3TTDA 3NH0A 4CCHA 4FJIA 3ULEA 3AVGA 3BP8A 4DSEA 1HQEA 1YAGA 5FROA 4E19A 1KAXA 5C15A 3L2RA 1YITN 1ZBUA 3HI0A 5C2DA 4X65K 1BOTO 3IDHA 3NF6A 5J2NA 1BL3A 3L6QA 5JENA 3VGLA 3O9TA 4JHDA 5IWAK 4KTQA 2O8FB 4JI2K 2OA8A 3TR8A 2PY5A 1QS4A 4N41A 5EY4A 1KQSM 4F9OA 1YTUA 2IS3A 1TL3A 4DS4A 4R5PA 3CC4N 1Q9YA 4IFEA 5FLXO 1BA1A 3A5MC 4H03B 4OPHA 3CCQN 4FW1A 3LP2A 2GX9A 1KC8O 4JYAK 1NGDA 4H0TB 5KRTA 3NCIA 4NXMK 1OH6A 2KFNA 3SAGA 2O4GA 3FZMA 3PO5A 4B1ZA 3DLEA 2FBVA 4DB3A 4BE1A 3V81A 3F5TA 4GKJK 3CXCM 3H3OB 5CR4A 3V9XA 3CF5L 4XH5A 3KK7A 1XMQK 1S72N 3NGYA 4M3WA 1KAYA 1R0AA 4X64K 2XY6A 4KRFA 3TSPA 1VQ7N 4O8KA 1YVNA 3NDKA 3CI5A 3FZLA 3KLHA 2O8EA 3AVMA 5AZJA 1TKDA 3GG4A 3U4LA 4CF1A 4HTLA 4DFKA 3F2KA 4H4OA 1VQLN 4DF8A 3B6PA 2W41A 2QM1A 3LDLA 3V4IA 3EY1A 3DLHA 4WCEL 1L5UA 1BI4B 4BR9A 4IBNA 3LP0A 4YOXA 3O8MA 4J2DA 3TPQA 3VTHA 4IEIA 3L3UA 4LFCK 3U9DA 1KD1O 1XWLA 1CXQA 4IOCL 1WNSA 5HOOA 4FJXA 4ILJA 4LF5K 4KTWA 4BR4A 4KHUA 2DPNA 5GAHP 5HBMA 3MN5A 1WSHA 2IIRA 1C1CA 1X3MA 2P9UA 3HK2A 1A5WA 5AQKA 4XIUA 1KXPA 3AO4A 1BCOA 4JKAA 4A5BA 3OY9A 3OYJA 3T1HK 4FJMA 4Z4FA 4Z4EA 4RG8A 3CCLN 2ATQA 3DAWA 4IKFA 4K8ZA 5MLCQ 1BO5O 1TYQA 2X78A 4M41A 2VYPA 4Z0UA 1JXBA 4BRFA 1W7AA 4RW6A 5DM6L 4A2AA 2QEXN 3L0QA 4ZTJA 3AA2A 3OYCA 1TKXA 4F2SA 1YJNN 4BE0A 4L3QA 2BE2A 1JCFA 1NGBA 2OPQA 3O4WA 4CHNA 4EHTA 2QWPA 4XJXA 1RDBA 4FM0A 4WFBL 3RMCA 4YOVA 1E3MA 1RBUA 3R1XA 1X9WA 3P39A 3ENBA 3T69A 3MXMA 1N8RO 2WONA 5BREA 2QWRA 1IKWA 4QS7A 4A62A 1J5EK 5JLFA 3P38A 1IKXA 2Q0UA 4DR2K 4E1JA 5J1EA 1U4BA 1C0GA 4N56A 3R6MA 4E7IA 5AQYA 4CFAA 1J53A 3CQ8A 1SZ2A 2NRVA 3LDOA 3B6OA 4DUYK 5AQRA 3CJAA 5LJWA 1T7PA 2G8IA 4BC4A 4HVJA 5BN8A 5GAGP 2YHXA 1J54A 4L8RB 2KKZA 4DSJA 5ADXA 3RSEB 1VQ4N 5HP1A 3J80O 4E7HA 1EQYA 4LD0A 5AFUA 3DLBA 2YJFA 4F2RA 4CEQA 1SL1A 4O0IA 2P5OA 3FR0A 5FPEA 3THXA 1ASUA 3CM5A 3AVBA 4DQPA 1K6YA 4BG8A 1SUQA 5FRMA 3R8EA 3O9SA 4FWKA 4FJ5A 4IG3A 2D4WA 1VQMN 1RFQA 4DQIA 4DR4K 3G25A 4CJLA 2ITGA 1C0FA
chains in the Genus database with same CATH topology
2P9NB 3HOTA 3E1YA 4H0YB 4IEEA 1HKBA 3LDPA 2NNWA 2V51B 4JKGB 3ZYYX 3FE1A 3AGKA 2VGMA 2ZJPL 4H5TA 1NJIO 3DXMB 4ISEA 2GUPA 3L4IA 4OPAA 1NGIA 3NMUA 3MK6A 2ASOA 4K41A 5EOYA 3NVKA 4H5WA 1K73O 4FWRA 1SQKA 3EO3A 4IOAL 3E9LA 4CZIA 5JVHL 3CQYA 5AQOA 5H1SQ 4AM6A 4JKCA 3I33A 1RDUA 3D2EA 4BROA 4WQ4C 3C65A 2WBNA 4A61A 4AM7A 4BR7A 2GELA 2A5XA 3U9ZA 3CCRN 1YIJN 5AQNA 3ZEUB 4KBOA 2Q2RA 3SAFA 4IO9L 3MN6A 4WFAL 3EZWA 1HLUA 3ID8A 4YOTA 1GLJO 4CZKA 5M1NA 1TUYA 1Q81O 2E1YA 2OTLN 2NRHA 4H0VB 1QVFM 3D2FB 1YJ9N 4WFNL 2D0OA 2HOEA 2FSKA 2P9LB 4XH4A 1BUPA 4JD2B 5AZIB 3MWTA 4IOXA 4JAXA 3CMAN 1YI2N 2HF4A 2P9IA 5BPNA 3ZETB 4FWQA 2CH5A 3QBXA 5B8HA 3CPEA 3FFKB 3HZ6A 3N4QA 4IZ9A 3DXKA 3NVMA 2QWOA 4ISFA 5AQLA 4K43A 3VTIA 2BUPA 3RSEA 3VF4A 3CERA 4BRGA 5M1KA 4BY9C 2WFBA 1EO1A 1Y64A 1HKGA 1IG8A 1TUUA 4IXCA 5AQQA 3TTCA 2HBLA 2D0PA 3CMEN 4BRDA 3TSQA 2UYTA 2F9WA 3EN9A 4YOWA 1YHQN 1P8ZA 3CCVN 4NLBA 4BVPA 5AQTA 3C0BA 3O9RA 4A5AA 4IJAA 3ID6A 2AP1A 2EWSA 4CZEA 5E84A 1VQPN 2ZGYA 4CZFA 5EXWA 3D2EB 3QMLA 5C10A 3EE8A 1LCUA 4O8UA 4FWPA 4PHTX 3IFRA 3P31A 3VPZA 4BG9A 3O08A 1V4TA 3ENOA 4FVUA 4KH4A 4XH1A 3VENA 2IVPA 4EHUA 3C6HA 3H1QA 1MWKA 3CHWA 3OHRA 2GEMA 3FZFA 3HM8A 1X3NA 4K25A 3LDQA 3KHYA 3AAPA 2BH1A 5FPMA 3HOSA 5AQMA 3AY9A 3VEXA 4BR0A 2HBMA 2WC9A 4YOUA 5KPRA 4B1VA 1GLCG 2E2QA 3ZX2A 3ZX3A 2QW9A 4JK7A 4MDBA 3TTFA 3A5OC 2PBDA 4CJ7A 2P9IB 3CJCA 4C1NK 1ESVA 3KZBA 4CD1A 2P9KA 4CI6A 2F7TA 3DXKB 3O1BA 3SK3A 4FWOA 5EVZA 1Q7YO 2P9SA 2QWLA 2H3GX 3FZHA 3BF1A 4H5VA 2FXUA 4H5NA 4CZJA 2CH6A 2GWKA 4YOYA 3QFPA 1ZXOA 3Q7BA 4GV6A 3FZKA 3SMPA 3S41A 3VEYA 1K8KA 4JKFA 1ATRA 3MWPA 3O9UA 1HJOA 2A40A 1NLVA 2QWQA 4QS9A 3LDNA 4GVEA 4CBXA 2ZJRL 3U8XA 2W00A 5I9EB 2C1GA 2J4RA 3E66A 1SS6A 4IWVA 5AQWA 3M1FA 3VEOA 4B9QA 4BQLA 2Q97A 1NGGA 4H5RA 4BRKA 5M1FA 2I7NA 1NGAA 4B1YB 1YUWA 5LJVA 4WF9L 3OBYA 2Q0RA 1NGCA 3UB5A 4AF1A 3SAHA 3I56N 4RTFD 4A2BA 4IO8A 1W2BM 2ZF5O 1U6ZA 4EAHD 2FF6A 2V52B 1O13A 2ZJQL 4ILHA 3WT0A 4KH5A 5F0XA 3BF3A 2Q36A 1ATNA 5AQVA 4BGAA 1SAZA 1DKGD 2RE2A 3MCPA 3TU5A 4CZLA 3MX5A 1QQNA 3CJBA 1U2VA 1WUAA 3CIPA 1S22A 3H3NO 4FOEA 4R79A 4BQZA 5F2RA 2P9KB 3BUZB 1E4FT 4JN4A 5BR9A 1RGIA 2NRXA 5KPTA 3I55N 3N4PA 5BPLA 2P9SB 3W0LA 3G4SN 3IUCA 3MCAB 1GLBG 1NGFA 4B1WB 5GIOA 3CCUN 4JK9A 3CCSN 4MO4A 1ZBSA 4M7YA 5GADP 3DLLL 5TKYA 3C7NB 1T44A 4NLCA 4MLHA 1CZAN 5BN9A 5FPDA 2FF3B 3VEZA 3KWGA 4FWNA 2V7ZA 3RVCA 1K8KB 3PIOL 3TSUA 5LY3A 4JKHA 2YJEA 2E2PA 2ASMA 1ZC6A 3R3LA 1P90A 4M7XA 4DHYA 2A42A 4BRHA 3A0IX 1M1KO 1QVGM 2HMPA 2Q31A 4WQ4A 4YORA 3WQTA 5BRHA 4EFHA 4QS8A 4B1XB 1MDUB 1JJ2M 3VMFB 3ENHA 3CC2N 2VGNA 2QA4N 2YHYA 1XC3A 2QTDA 2OTJN 4G9ZA 4BEBA 3KWIA 1GLAG 3WQUA 3TTDA 1ATSA 3PIPL 2KHOA 3ULEA 2GTDA 3E9OA 4C1NI 2CGLA 3BP8A 3J8AA 1U2VB 3KVGA 3GL1A 5BRDA 1BWFO 1NMDA 3E9PA 1YAGA 2A3ZA 4YDUA 1ILYA 3WXMB 3JXUA 1KAXA 4M63C 4WYBA 4FWLA 5C15A 1YITN 3C6AA 1GLDG 5CHIA 3HI0A 5GAEP 3LL3A 5C2DA 4HWIA 3CQXA 4FPBA 1BOTO 3IDHA 3L6QA 2IVOA 1KAZA 3VGLA 2ZWHA 5AQSA 2CGKA 4J8FA 3CCEN 4KH6A 3O9TA 4JHDA 4GNIA 1QQOA 1JCEA 1BU6O 3MMVA 2YCHA 5EY4A 1KQSM 4F9OA 4IJNA 5C12A 3QBWA 2OANA 1RDWX 3IKMA 3JS6A 4IDHA 3CC4N 3CJ7A 2NRZA 4CZGA 3QDKA 4GY2B 4IFEA 4WQ5C 2QXLA 1BA1A 1QHAA 2E2NA 3A5MC 3H45C 2WUSA 4H03B 4ISGA 4OPHA 3B8AX 2P9UB 3CCQN 4BE7B 2Q1NA 4I6MA 2GX9A 1KC8O 1YF5L 1NGDA 1H1VA 3K9KA 4A59A 1BG3A 4H0TB 4FO0A 2PFUA 2QWNA 1VQ6N 4Z94A 3GE1A 1Q18A 1MA9B 4FL9A 2QI2A 5DM7L 2RHKA 4K42A 3SAGA 3O5BA 2YHWA 5AQPA 3FZMA 2JWKA 3A5LC 3C7NA 3ULEB 3H1VX 4BR2A 2ASPA 4BC5A 4BRLA 1V4SA 3QFUA 4B1UB 1WOQA 5AQUA 5M1OA 4JKDA 4B1ZA 4DB3A 1NGHA 3Q7CA 3MX2A 3F5TA 1VQ5N 3CXCM 4BC3A 1HX1A 3H3OB 5ELZA 2E2OA 4NB4A 4O5FA 2F9TA 5CR4A 4PL7A 3CF5L 4BR5A 4XH5A 3KK7A 4H0XB 3WXKA 2IVNA 2JWLA 1T6DA 3EE9A 1S72N 1KAYA 4JEPA 5AQFA 3R9PA 3SBGA 4U67L 3VGMA 4CBWA 4FSVA 1D4XA 2NRWA 3TSPA 3CD6N 4BRNA 1VQ7N 4O8KA 4JHDB 1VQKN 1YVNA 4BREA 3WXJA 3CI5A 2VWBA 3HRGA 4JKBA 3FZLA 5KQ8A 5HL7L 1LOTB 5GINA 3EKSA 5AZJA 3GG4A 3HBTA 3D7EO 3A5NC 3U4LA 4HTLA 1QZ6A 1X9JA 3F2KA 1HUXA 1VQLN 3T7ZA 1HPMA 3GBTA 2HBJA 2NZTA 2W41A 2QM1A 3LDLA 4I6MB 4WCEL 5AQGA 4BR9A 1YJWN 5BRFA 4YOXA 3O8MA 4FPAA 1NGEA 1JCGA 3TPQA 3VTHA 4IEIA 1GLFO 3U9DA 4RCHA 1Z05A 4BRCA 1KD1O 1VQ9N 4CD3A 5F1XA 1OVYA 4JKEA 4IOCL 3VOVA 3OW2M 5HOOA 4PKIA 3VESA 1HKCA 3FGUA 2V7YA 5M1QA 3VEVA 2W40A 3MN9A 4ILJA 4EIAA 2E1ZA 3VF6A 2NRRA 3VF2A 3VETA 3W3DA 5EX5A 4LC9B 4BR4A 3G71N 2DPNA 1T6CA 5GAHP 3DWLA 4MLEA 3MN5A 2YX6A 5C2FA 1XQSC 4FWMA 1Z6RA 2IIRA 4RWTA 5E26A 3O6WA 3FLCO 1X3MA 2P9UA 1BDGA 1Q82O 3CJ9A 5AQKA 2VCPA 1E4GT 1KXPA 4MDAA 4DCHA 4JKAA 4A5BA 4BRPA 5JMVA 1MWMA 4CBUA 1W97L 4GV3A 2FLOA 3WEEA 4BECA 4OO1J 4MO5A 3CCLN 4NO7A 3QICA 3DAWA 5CE3A 2P9PA 1GLEG 4ILGB 5AQJA 3EL2A 3GDQA 5AR0A 5AZJB 5MLCQ 1BO5O 1TYQA 3ZX0A 2VYPA 1NWKA 4BRMA 3ATUA 3LM9A 4BRFA 4YDUC 1T3VA 4BRIA 4H0OA 3DJCA 5DM6L 1VQNN 5KPZA 2GWJA 4PKGA 3HTVA 4H0PA 3SBTA 4PKHA 4A2AA 3CC7N 2QEXN 3L0QA 4JK8A 3QB0A 2PAVA 4DKWA 3L4QA 2ITMA 3UE5A 3CJ1A 1NBWA 2QWMA 4CZMA 1YJNN 3MDQA 3CCMN 2NRTA 4L3QA 2A41A 1JCFA 1NGBA 4GV9A 1XUPO 3AAQA 2AA4A 3O4WA 4PL8A 5KQDA 3A8YA 3K9JA 3P4IA 4EHTA 1NM1A 2FSJA 2BTFA 3PLAA 2QWPA 3UKRA 1OKJA 1IJJA 4XJXA 1M90O 3VGKA 4BRAA 3SLCA 4WFBL 4A57A 3M3ZA 4YOVA 1K9MO 3VEWA 2YI1A 3R1XA 5FPNA 3P39A 3CPWM 3SJHA 3WXLA 4DQ8A 5AQIA 3ENBA 3T69A 3HSCA 3UKUA 3LM2A 3EKUA 1NGJA 4BGBA 1Q86O 2ZGZA 3I8BA 1QQMA 5BREA 2QWRA 3IMXA 2HSTA 3O1WA 4FOIA 4QS7A 4Y0WA 4A62A 3WEEB 5JLFA 3P38A 3AARA 2Q0UA 2P9NA 5BPMA 3M5RA 3VERA 4E1JA 1C0GA 3WUHA 3R6MA 2P9PB 4FWSA 4JKGA 5AQYA 1QZ5A 3DXMA 1R59O 1TYQB 1SZ2A 2NRVA 3J7ZO 3LDOA 3M6GA 5JLHA 2HF3A 5AQRA 3H46O 3CJAA 5C0YA 3G6EN 2C1IA 4CZHA 2D1KA 4BRQA 5LJWA 1K8AO 1DEJA 5AQZA 2CGJA 3O80A 2NLXA 4WQ5A 2HBKA 4BC4A 5BN8A 2E88A 2E8AA 3AGRA 3MN7A 2YHXA 5GAGP 1VQON 2KKZA 3D6RA 3WXIA 5ADXA 4BVOA 3RSEB 2FSNA 1VQ4N 3O9QA 1DT9A 4U7BA 1EQYA 5AFUA 5ADXH 2YJFA 1N8RO 1VAZA 3ZEUA 1J6ZA 3H6EA 5AQHA 2KLAA 4JNEA 3FR0A 5AFUH 4C23A 5TKWA 2I7PA 3UKRB 5FPEA 1DGKN 3CCJN 3D2FA 1GLLO 1VQ8N 5JICA 3BEXA 1S3XA 5M1PA 2P9LA 4BC2A 4BG8A 5GIPA 3CETA 4JD2A 3R8EA 3F9MA 3GOIA 3O9SA 4FWKA 1BA0A 3OA9A 5AQXA 1G99A 5AZIA 1YXQA 2D4WA 2E20A 1RFQA 3ATVA 4XEIA 1VQMN 3UKUB 2A6AA 3ZETA 5JVGL 3OBWA 3G25A 3SMSA 4UY8O 1C0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9N B;  4H0Y B;  1HKB A;  3LDP A;  2V51 B;  3FE1 A;  4H5T A;  3DXM B;  4ISE A;  2GUP A;  3L4I A;  1NGI A;  3MK6 A;  2ASO A;  4K41 A;  5EOY A;  4H5W A;  4FWR A;  1SQK A;  3EO3 A;  4CZI A;  3CQY A;  5AQO A;  4AM6 A;  3I33 A;  3D2E A;  4BRO A;  4WQ4 C;  4A61 A;  4AM7 A;  4BR7 A;  2GEL A;  2A5X A;  3U9Z A;  5AQN A;  3ZEU B;  4KBO A;  2Q2R A;  3MN6 A;  3EZW A;  1HLU A;  3ID8 A;  1GLJ O;  4CZK A;  1TUY A;  2E1Y A;  2NRH A;  4H0V B;  3D2F B;  2D0O A;  2HOE A;  2FSK A;  2P9L B;  4XH4 A;  1BUP A;  4JD2 B;  5AZI B;  4JAX A;  2HF4 A;  2P9I A;  5BPN A;  3ZET B;  4FWQ A;  2CH5 A;  3QBX A;  5B8H A;  3FFK B;  3HZ6 A;  4IZ9 A;  3DXK A;  2QWO A;  4ISF A;  5AQL A;  4K43 A;  2BUP A;  3RSE A;  3VF4 A;  3CER A;  4BRG A;  1Y64 A;  1HKG A;  1IG8 A;  1TUU A;  4IXC A;  5AQQ A;  2D0P A;  4BRD A;  2UYT A;  2F9W A;  3EN9 A;  1P8Z A;  4BVP A;  5AQT A;  3C0B A;  4IJA A;  2AP1 A;  2EWS A;  4CZE A;  5E84 A;  2ZGY A;  4CZF A;  5EXW A;  3D2E B;  3QML A;  1LCU A;  4FWP A;  3IFR A;  4BG9 A;  3VPZ A;  3O08 A;  1V4T A;  3ENO A;  4XH1 A;  3VEN A;  2IVP A;  4EHU A;  3H1Q A;  1MWK A;  3CHW A;  3OHR A;  2GEM A;  3FZF A;  3HM8 A;  1X3N A;  4K25 A;  3LDQ A;  3KHY A;  3AAP A;  5FPM A;  5AQM A;  3AY9 A;  3VEX A;  4BR0 A;  5KPR A;  4B1V A;  1GLC G;  2E2Q A;  3ZX2 A;  3ZX3 A;  2QW9 A;  3A5O C;  2PBD A;  4CJ7 A;  2P9I B;  3CJC A;  1ESV A;  3KZB A;  4CD1 A;  2P9K A;  4CI6 A;  3DXK B;  3O1B A;  3SK3 A;  4FWO A;  5EVZ A;  2P9S A;  2QWL A;  2H3G X;  3FZH A;  3BF1 A;  4H5V A;  2FXU A;  4H5N A;  4CZJ A;  2CH6 A;  2GWK A;  3QFP A;  1ZXO A;  3FZK A;  3SMP A;  3S41 A;  3VEY A;  1K8K A;  1ATR A;  4QS9 A;  1HJO A;  2A40 A;  1NLV A;  2QWQ A;  3LDN A;  4CBX A;  3U8X A;  5I9E B;  2J4R A;  4IWV A;  5AQW A;  3VEO A;  3M1F A;  4B9Q A;  4BQL A;  2Q97 A;  1NGG A;  4H5R A;  4BRK A;  2I7N A;  1NGA A;  4B1Y B;  1YUW A;  5LJV A;  2Q0R A;  1NGC A;  3UB5 A;  4RTF D;  4A2B A;  4IO8 A;  1U6Z A;  2ZF5 O;  4EAH D;  2FF6 A;  2V52 B;  3WT0 A;  5F0X A;  3BF3 A;  2Q36 A;  1ATN A;  5AQV A;  4BGA A;  1SAZ A;  1DKG D;  3MCP A;  3TU5 A;  4CZL A;  1QQN A;  3CJB A;  1U2V A;  1WUA A;  3CIP A;  1S22 A;  3H3N O;  4FOE A;  4BQZ A;  5F2R A;  2P9K B;  3BUZ B;  1E4F T;  4JN4 A;  5BR9 A;  1RGI A;  5KPT A;  5BPL A;  2P9S B;  3W0L A;  3IUC A;  1GLB G;  1NGF A;  4B1W B;  4MO4 A;  1ZBS A;  4M7Y A;  5TKY A;  3C7N B;  1T44 A;  4MLH A;  1CZA N;  5BN9 A;  5FPD A;  2FF3 B;  3VEZ A;  4FWN A;  2V7Z A;  1K8K B;  5LY3 A;  2YJE A;  2E2P A;  2ASM A;  1ZC6 A;  4M7X A;  4DHY A;  2A42 A;  4BRH A;  3A0I X;  2HMP A;  2Q31 A;  4WQ4 A;  3WQT A;  5BRH A;  4EFH A;  4QS8 A;  4B1X B;  1MDU B;  3ENH A;  2YHY A;  1XC3 A;  1GLA G;  3WQU A;  1ATS A;  2KHO A;  3ULE A;  2GTD A;  2CGL A;  3BP8 A;  3J8A A;  1U2V B;  3KVG A;  3GL1 A;  5BRD A;  1BWF O;  1NMD A;  1YAG A;  2A3Z A;  4YDU A;  3JXU A;  1KAX A;  4M63 C;  4WYB A;  4FWL A;  1GLD G;  3HI0 A;  3LL3 A;  4HWI A;  3CQX A;  4FPB A;  1BOT O;  3IDH A;  3L6Q A;  2IVO A;  1KAZ A;  3VGL A;  2ZWH A;  5AQS A;  2CGK A;  4J8F A;  4JHD A;  4GNI A;  1QQO A;  1JCE A;  1BU6 O;  3MMV A;  2YCH A;  5EY4 A;  4F9O A;  4IJN A;  3QBW A;  2OAN A;  1RDW X;  3JS6 A;  3CJ7 A;  4CZG A;  3QDK A;  4GY2 B;  4WQ5 C;  2QXL A;  1BA1 A;  1QHA A;  2E2N A;  3A5M C;  3H45 C;  2WUS A;  4H03 B;  4ISG A;  3B8A X;  2P9U B;  2Q1N A;  4I6M A;  1NGD A;  1H1V A;  1BG3 A;  4H0T B;  4FO0 A;  2QWN A;  4Z94 A;  3GE1 A;  1Q18 A;  1MA9 B;  4FL9 A;  4K42 A;  3O5B A;  2YHW A;  5AQP A;  3FZM A;  3ULE B;  3A5L C;  3C7N A;  4BR2 A;  3H1V X;  2ASP A;  4BC5 A;  4BRL A;  1V4S A;  3QFU A;  4B1U B;  1WOQ A;  5AQU A;  4B1Z A;  4DB3 A;  1NGH A;  4BC3 A;  1HX1 A;  3H3O B;  5ELZ A;  2E2O A;  4NB4 A;  4O5F A;  2F9T A;  4PL7 A;  4BR5 A;  4XH5 A;  4H0X B;  3WXK A;  2IVN A;  1T6D A;  1KAY A;  5AQF A;  3R9P A;  3VGM A;  4CBW A;  4FSV A;  1D4X A;  4BRN A;  4O8K A;  4JHD B;  1YVN A;  4BRE A;  3WXJ A;  3CI5 A;  2VWB A;  5KQ8 A;  3FZL A;  1LOT B;  3EKS A;  5AZJ A;  3GG4 A;  3HBT A;  3D7E O;  3A5N C;  3U4L A;  4HTL A;  1QZ6 A;  1X9J A;  1HUX A;  1HPM A;  3GBT A;  2NZT A;  2W41 A;  2QM1 A;  3LDL A;  4I6M B;  5AQG A;  4BR9 A;  5BRF A;  3O8M A;  4FPA A;  1NGE A;  1JCG A;  3TPQ A;  1GLF O;  3U9D A;  4RCH A;  1Z05 A;  4BRC A;  4CD3 A;  5F1X A;  3VOV A;  4PKI A;  3VES A;  1HKC A;  3FGU A;  2V7Y A;  3VEV A;  2W40 A;  3MN9 A;  4EIA A;  2E1Z A;  3VF6 A;  3VF2 A;  3VET A;  3W3D A;  5EX5 A;  4LC9 B;  4BR4 A;  2DPN A;  1T6C A;  3DWL A;  4MLE A;  3MN5 A;  1XQS C;  4FWM A;  1Z6R A;  2IIR A;  4RWT A;  5E26 A;  3O6W A;  3FLC O;  1X3M A;  2P9U A;  1BDG A;  3CJ9 A;  5AQK A;  2VCP A;  1E4G T;  1KXP A;  4DCH A;  5JMV A;  4BRP A;  1MWM A;  4CBU A;  2FLO A;  3WEE A;  4MO5 A;  4NO7 A;  3QIC A;  3DAW A;  5CE3 A;  2P9P A;  1GLE G;  5AQJ A;  5AZJ B;  3EL2 A;  3GDQ A;  5AR0 A;  1BO5 O;  1TYQ A;  3ZX0 A;  2VYP A;  1NWK A;  4BRM A;  3ATU A;  3LM9 A;  4BRF A;  4YDU C;  4BRI A;  4H0O A;  3DJC A;  5KPZ A;  2GWJ A;  4PKG A;  3HTV A;  4H0P A;  4A2A A;  4PKH A;  3L0Q A;  3QB0 A;  2PAV A;  2ITM A;  3UE5 A;  3CJ1 A;  1NBW A;  2QWM A;  4CZM A;  3MDQ A;  4L3Q A;  2A41 A;  1JCF A;  1NGB A;  1XUP O;  3AAQ A;  2AA4 A;  3O4W A;  4PL8 A;  5KQD A;  3A8Y A;  3P4I A;  4EHT A;  1NM1 A;  2FSJ A;  2BTF A;  2QWP A;  3UKR A;  1OKJ A;  1IJJ A;  3VGK A;  4BRA A;  3SLC A;  3M3Z A;  3VEW A;  2YI1 A;  5FPN A;  3SJH A;  3WXL A;  4DQ8 A;  5AQI A;  3HSC A;  3UKU A;  3LM2 A;  3EKU A;  1NGJ A;  4BGB A;  2ZGZ A;  3I8B A;  1QQM A;  5BRE A;  2QWR A;  3IMX A;  3O1W A;  4FOI A;  4QS7 A;  4Y0W A;  4A62 A;  3WEE B;  5JLF A;  3AAR A;  2Q0U A;  2P9N A;  5BPM A;  3VER A;  4E1J A;  1C0G A;  3WUH A;  3R6M A;  2P9P B;  4FWS A;  5AQY A;  1QZ5 A;  3DXM A;  1R59 O;  1TYQ B;  1SZ2 A;  3LDO A;  3M6G A;  5JLH A;  2HF3 A;  5AQR A;  3H46 O;  3CJA A;  4CZH A;  2D1K A;  4BRQ A;  5LJW A;  1DEJ A;  5AQZ A;  2CGJ A;  3O80 A;  2NLX A;  4WQ5 A;  4BC4 A;  5BN8 A;  2E88 A;  2E8A A;  3MN7 A;  2YHX A;  3WXI A;  5ADX A;  4BVO A;  3RSE B;  2FSN A;  1EQY A;  5AFU A;  5ADX H;  2YJF A;  3ZEU A;  1J6Z A;  3H6E A;  5AQH A;  4JNE A;  3FR0 A;  5AFU H;  4C23 A;  2I7P A;  3UKR B;  5FPE A;  1DGK N;  3D2F A;  1GLL O;  5JIC A;  3BEX A;  1S3X A;  2P9L A;  4BC2 A;  4BG8 A;  3CET A;  4JD2 A;  3R8E A;  3F9M A;  3GOI A;  4FWK A;  5AQX A;  1BA0 A;  5AZI A;  1G99 A;  1YXQ A;  2D4W A;  2E20 A;  1RFQ A;  3ATV A;  4XEI A;  3UKU B;  2A6A A;  3ZET A;  3G25 A;  3SMS A;  1C0F A; 
#chains in the Genus database with same CATH topology
 4IEE A;  2XHB A;  2VGM A;  3DXM B;  4ISE A;  4Y1D A;  2RN2 A;  1NGI A;  2ASO A;  4H5W A;  2OZM A;  3C95 A;  4JI0 K;  3CQY A;  5AQO A;  4I7F A;  3I33 A;  3G0Z A;  4A61 A;  1EET A;  4AM7 A;  4CED A;  2GEL A;  2A5X A;  3U9Z A;  4PWD A;  4KHW A;  4KPY A;  4PUO A;  5SZT A;  2G8V A;  3SAF A;  1C0U A;  1REV A;  3EZW A;  2HHX A;  1ASV A;  1GLJ O;  3JYT A;  2X6N A;  2NRH A;  2OTL N;  1QVF M;  3AO2 A;  2YNH A;  3TAG A;  2B6A A;  3T1A A;  4B8A B;  3LWL A;  3U6F A;  4JD2 B;  5AZI B;  4JAX A;  5AJ3 K;  2XY7 A;  1N6Q A;  4FCY A;  2P9I A;  5BPN A;  3ZET B;  2ZE2 A;  1RNH A;  3HZ6 A;  3MEG A;  1NJZ A;  1ASW A;  4BRG A;  5M1K A;  1EO1 A;  2W6K A;  1IG8 A;  1TUU A;  5I42 A;  4DR3 K;  3OJU A;  2D0P A;  4H4M A;  3EN9 A;  1NOZ A;  3CCV N;  1QTM A;  3C0B A;  4A5A A;  4IJA A;  3NGI A;  3ID6 A;  2AP1 A;  2EWS A;  5E84 A;  4DTN A;  5EXW A;  3D2E B;  4DQQ A;  1XMO K;  1QSS A;  4YNQ A;  3EE8 A;  2Y1I A;  4QOZ B;  4KO0 A;  3VPZ A;  1V4T A;  4E1M A;  4C8L A;  4FVU A;  3VQA A;  4KH4 A;  2IVP A;  4EHU A;  3AA4 A;  3CHW A;  4BDY A;  2GEM A;  3HM8 A;  4CHQ A;  4CJP A;  4Z4C A;  3ZX3 A;  2F4V K;  3MAQ A;  3A5O C;  3CJC A;  4FJN A;  4CD1 A;  2P9K A;  5LL6 Z;  2F7T A;  3SK3 A;  3MEC A;  4FWO A;  4CE9 A;  4O4G A;  3BF1 A;  3VA3 A;  4LH5 A;  4YOY A;  3AVJ A;  2ZM6 K;  1NMN A;  4Z4G A;  4E1N A;  3V9S A;  3BZC A;  3SMP A;  4BWJ A;  4DSF A;  3P83 D;  1VSD A;  4ICL A;  3KD5 E;  1HJO A;  4DV3 K;  5CYM A;  4GVE A;  2UXB K;  1WLJ A;  4GVM A;  3U8X A;  3VEO A;  3M1F A;  1Z25 A;  2Q97 A;  3AVF A;  4H5R A;  4BRK A;  5M1F A;  4KHS A;  5A2Q O;  2I7N A;  1NU0 A;  4B1Y B;  3OJS A;  1YUW A;  1NJY A;  1RTJ A;  4DMN A;  3OYK A;  4JI8 K;  1U6Z A;  4EAH D;  1MU2 A;  3AVL A;  4QCL A;  4KH5 A;  3BF3 A;  4E7J A;  3TU5 A;  1QQN A;  1WUA A;  3AVH A;  1S22 A;  1KLM A;  3C6T A;  1JLF A;  4HCB A;  2VQE K;  4DV1 K;  4F4K A;  4R79 A;  3P1G A;  1EKE A;  1D9D A;  2GUI A;  4FK0 A;  1O1W A;  3QEW A;  2BGG A;  3IUC A;  4DS5 A;  1RBT A;  1ZBL A;  4B1W B;  3BDP A;  4M45 A;  4M7Y A;  3TAE A;  2G8H A;  5BN9 A;  3VEZ A;  3RMD A;  4F3T A;  5LY3 A;  3D0P A;  1ZYQ A;  4KKO A;  4JKH A;  1YT3 A;  2E2P A;  1ZC6 A;  4E7L A;  1IO2 A;  2Q31 A;  2NUB A;  3WQT A;  4QS8 A;  3ENH A;  2VWJ A;  3AA3 A;  2QA4 N;  2KZM A;  2OTJ N;  3WNE A;  3ZSV A;  2OZS A;  4DR1 K;  3ZSX A;  3WQU A;  4W5T A;  1ATS A;  5J2Q A;  1JKH A;  2GTD A;  1GOA A;  3E9O A;  4C1N I;  2HHS A;  3AVN A;  4OJR A;  4BAC A;  2RF2 A;  4IDK A;  2RKI A;  3J8A A;  1U2V B;  3RR8 A;  2KZZ A;  4YDU A;  3WXM B;  1L3S A;  4M63 C;  1JL1 A;  1GLD G;  3C6A A;  5CHI A;  5GAE P;  3LL3 A;  1CXU A;  3S5T A;  4FM2 A;  3CQX A;  4FPB A;  2IVO A;  4CEC A;  3LAM A;  4KH6 A;  1NK6 A;  4GNI A;  1S6P A;  4M42 A;  4B9V A;  5IT9 O;  3LZI A;  2YCH A;  1TKT A;  3LAN A;  1RTH A;  2OAN A;  3IKM A;  4IDH A;  3THY B;  1L3V A;  4DR7 K;  3CJ7 A;  2HVI A;  4ISG A;  2WUS A;  2KFZ A;  3SJJ A;  3HST B;  1BI4 A;  1YF5 L;  3K9K A;  4A59 A;  3M8R A;  1BG3 A;  3ZSY A;  1VQ6 N;  3GE1 A;  5EU7 A;  2QI2 A;  2RHK A;  4K42 A;  2YHW A;  4EP4 A;  4FXD A;  2JWK A;  3A5L C;  4BR2 A;  4BC5 A;  4BRL A;  1V4S A;  4HUG A;  5M1O A;  3ITH A;  1NGH A;  3MX2 A;  1S9G A;  1B9D A;  4O5F A;  2F9T A;  4BR5 A;  1IG9 A;  3EE9 A;  1T6D A;  4IG0 A;  3R9P A;  3WNF A;  1I39 A;  4U67 L;  4CBW A;  1IBL K;  4K8X A;  4LH4 A;  3CD6 N;  3OYA A;  1VQK N;  4Y1C A;  4FJL A;  5J2P A;  2UU9 K;  2VWB A;  3HRG A;  5KQ8 A;  3OYF A;  4DFM A;  4DTP A;  4IFY A;  2QXF A;  3EKS A;  4QAG A;  4CGI A;  1KLN A;  3KLI A;  3OYI A;  1HUX A;  3OYB A;  2HBJ A;  4I6M B;  3E01 A;  1VSE A;  5AQG A;  1YJW N;  5BRF A;  4KHQ A;  1SL2 A;  4PA1 A;  1GLF O;  1XI1 A;  4CD3 A;  5F1X A;  1OVY A;  1VK0 A;  3OW2 M;  3JAM O;  1HKC A;  3FGU A;  3AO3 A;  3ZT3 A;  3VEV A;  1B9F A;  3MN9 A;  3PSF A;  2IC3 A;  5EX5 A;  1LWE A;  4LC9 B;  3W3D A;  5C24 A;  2YHB A;  1RT3 A;  4MQ3 A;  1HNV A;  1XQS C;  4FWM A;  1Z6R A;  4CES A;  3RR7 A;  1BDG A;  3KK3 A;  4ZTF A;  3CJ9 A;  2A1S A;  2VCP A;  1E4G T;  4KHP K;  4B3T K;  4GV3 A;  1MWM A;  1W97 L;  4BEC A;  3LDS A;  2YNG A;  4LSN A;  1JXE A;  3PX4 A;  3ZX0 A;  4CHY A;  4YY3 K;  1TL1 A;  3LM9 A;  4KRE A;  1T3V A;  1TAQ A;  1RDA A;  4PKG A;  3VQC A;  4PKH A;  2VQF K;  3M8P A;  3L4Q A;  4DLE A;  2UUA K;  3UE5 A;  3V9Z A;  2O8B B;  2QWM A;  4EP5 A;  4DFJ A;  3CCM N;  2A41 A;  4M3T A;  3A8Y A;  3K9J A;  1NM1 A;  2FSJ A;  4DR6 K;  1OKJ A;  3G10 A;  5KGX A;  2HVH A;  4CJV A;  4JI6 K;  4BRA A;  3CYM A;  4A57 A;  1WAF A;  1K9M O;  3SPZ A;  5K14 A;  3VQ8 A;  3CPW M;  2D0A A;  3SJH A;  4DQ8 A;  1TAU A;  1B92 A;  4M3Z A;  3EKU A;  1NGJ A;  4KFB A;  3I8B A;  1QQM A;  1RTI A;  4CJR A;  4Y0W A;  3WEE B;  4HCC A;  1TK0 A;  4CFB A;  3VER A;  4E3S A;  3IG1 A;  3WUH A;  4FWS A;  3O4N A;  2YNF A;  3DXM A;  4CGJ A;  2Z1J A;  1NNE A;  4W5N A;  1L3T A;  4JI5 K;  3PX6 A;  2HF3 A;  5I3U A;  3H46 O;  3U3G A;  5C0Y A;  3TAQ A;  3SQ1 A;  2JGU A;  4NCA A;  2D1K A;  4OKE A;  4RW7 A;  3V1Q A;  4GKK K;  3U3Y A;  2CGJ A;  4FJ9 A;  3OS0 A;  2E88 A;  4CHP A;  1C1A A;  2P5G A;  4B3O A;  2BAN A;  1DT9 A;  4U7B A;  4OLA A;  2P1J A;  5ADX H;  1VAZ A;  4IFV A;  4JNE A;  5AFU H;  4C23 A;  3AVA A;  5TKW A;  3UKR B;  1EWR A;  1GLL O;  1VQ8 N;  3VQQ A;  5JIC A;  3BEX A;  4BC2 A;  4C8K A;  1RT6 A;  4FK2 A;  4JD2 A;  3F9M A;  3GOI A;  5AQX A;  5AZI A;  3OA9 A;  1YXQ A;  2E20 A;  3ATV A;  1QSL A;  4CGH A;  3UKU B;  4O55 A;  3ZET A;  5JVG L;  4AHT A;  4CK3 A;  5HLF A;  2P9N B;  4H0Y B;  3LDP A;  1KVC A;  1VSF A;  2V51 B;  4JKG B;  4DR5 K;  4GW6 A;  4X62 K;  1NJI O;  3SNN A;  3PY8 A;  3L4I A;  2HHH K;  1NK4 A;  4CEO A;  5D3G A;  1NG9 A;  3NMU A;  3NVK A;  4DV6 K;  2HHV A;  3L3V A;  1FXX A;  4AM6 A;  3D2E A;  3IRX A;  4J2E A;  3HPH A;  3HO1 A;  2YKM A;  4EZ9 A;  3CCR N;  4KI6 A;  2Q2R A;  4CGD A;  2D5R A;  3O4Q A;  4FJG A;  1YTA A;  3D2F B;  1YJ9 N;  4WFN L;  1KFD A;  2FSK A;  1NK9 A;  4XH4 A;  4DTJ A;  1BUP A;  1N36 K;  2G8U A;  4IOX A;  4FLU A;  2HF4 A;  1JLB A;  2XY5 A;  4M3U A;  4FWQ A;  1NKE A;  3QBX A;  4CJF A;  3CPE A;  4IZ9 A;  1HNX K;  3NVM A;  4K43 A;  4CIF A;  2BUP A;  3VF4 A;  3CER A;  1RIL A;  1TK8 A;  1HKG A;  4B9M A;  2UXD K;  1WBB A;  3KKS A;  3TSQ A;  3L8B A;  2UYT A;  4AHS A;  1YHQ N;  3AVK A;  1QQC A;  3KK1 A;  3JSM A;  3DLR A;  4CER A;  4DTS A;  4CZE A;  4CZF A;  1LCU A;  4FWP A;  4PHT X;  3IFR A;  3ZSR A;  4CVN E;  1D5A A;  3VEN A;  4O0J A;  1DLO A;  1NKC A;  2VG6 A;  1U48 A;  1VSH A;  1I3A A;  3H1Q A;  4CJ5 A;  3OHR A;  4N47 A;  3FZF A;  4OPJ A;  4K25 A;  3AAP A;  2BH1 A;  3VEX A;  4BR0 A;  2WOM A;  5KPR A;  4JK7 A;  2QKB A;  2PBD A;  4C1N K;  1ESV A;  4DV5 K;  4CEF A;  3DXK B;  1NJW A;  3AV9 A;  3C94 A;  3PX0 A;  2H3G X;  4CEZ A;  3I0S A;  2FXU A;  2GWK A;  4CJ3 A;  3NAE A;  2AJQ A;  1WSE A;  3Q7B A;  3T19 A;  1KVA A;  1XC9 A;  5HRN A;  3OYD A;  2A40 A;  3CG7 A;  3LDN A;  4CBX A;  3A2F A;  2C1G A;  2J4R A;  3E66 A;  3KLG A;  5AQW A;  5CY4 A;  1SKW A;  5FDL A;  3SAH A;  3I56 N;  1VHX A;  1YVU A;  3K5O A;  4C8N A;  3F9K A;  2ZF5 O;  3EYZ A;  3TAF A;  2JLE A;  4E72 A;  1RT5 A;  4F3O A;  3QNN A;  4BGA A;  2YV0 X;  3MX5 A;  4LF6 K;  1U2V A;  3CIP A;  1HMV A;  3QLH A;  3I55 N;  1F21 A;  1E4F T;  1IH7 A;  3N4P A;  2P9S B;  3W0L A;  4Q0B A;  1GLB G;  4MO4 A;  1ZBS A;  5GAD P;  1U49 A;  5TKY A;  2IGI A;  4H8K A;  3KTQ A;  1UWB A;  4W5R A;  3KWG A;  2V7Z A;  3RVC A;  3PIO L;  4CK1 A;  3K5M A;  2FC0 A;  2YJE A;  3THY A;  4Z4H A;  4M7X A;  3A0I X;  1IBK K;  1WSJ A;  2HMP A;  1Y97 A;  4BE2 A;  4DSI A;  4YOR A;  4B1X B;  3VMF B;  2HNZ A;  4ID5 A;  3NH1 A;  3HYF A;  3CC2 N;  2VGN A;  1VSI A;  1T03 A;  1XC3 A;  3L2Q A;  3LWM A;  1LWF A;  4G9Z A;  2KHO A;  4AHC A;  4NCG A;  2CGL A;  3KVG A;  3O3H A;  1D9F A;  4OGE A;  2FBT A;  4BDZ A;  4FWL A;  2F8T A;  3MXJ A;  3L2W A;  2B4J A;  3HPO A;  4CHZ A;  1ZBF A;  3VA0 A;  4NYF A;  2HMI A;  1KAZ A;  5AQS A;  1HRH A;  5HRS A;  3DMJ A;  5FRN A;  1JCE A;  1BU6 O;  2HW3 A;  3MMV A;  4B9N A;  1VSL A;  3QBW A;  4KV8 A;  1RDW X;  2NRZ A;  3QDK A;  4GY2 B;  2QXL A;  2E2N A;  1QHA A;  3H45 C;  5LMN K;  2P9U B;  2Q1N A;  4I6M A;  1A5X A;  4KHY A;  4FO0 A;  2HB5 A;  1U47 A;  2QWN A;  2O8C B;  4Z94 A;  1NOY A;  1UA1 A;  1Q18 A;  3AO1 A;  3OS1 A;  2FBY A;  2UUC K;  3HL8 A;  3O5B A;  4C8M A;  5AQP A;  1S1W A;  3C7N A;  2GBZ A;  3H1V X;  3KIO A;  3OYN A;  2VG5 A;  1WOQ A;  4B1U B;  3DRR A;  5AQU A;  2Z1I A;  3Q7C A;  4Z4I A;  1VQ5 N;  2W6L A;  4BC3 A;  1HX1 A;  4NB4 A;  4V19 S;  4H0X B;  3WXK A;  2IVN A;  2JWL A;  1WSG A;  4JEP A;  3VGM A;  4CJE A;  1FJG K;  4W5Q A;  4FSV A;  1D4X A;  3HP9 A;  2NRW A;  4BRN A;  4E89 A;  2O8D B;  3SYZ A;  4BRE A;  1NK8 A;  1OVQ A;  5HL7 L;  2PYL A;  1LOT B;  3SI6 A;  3C6U A;  4B9L A;  3V1R A;  2DFE A;  3D7E O;  3A5N C;  2ETJ A;  2DTU A;  3FFI A;  3T7Z A;  1HPM A;  2F96 A;  3RRH A;  1CLQ A;  4FPA A;  1NGE A;  1JCG A;  1HNZ K;  4BRC A;  4DTO A;  1VQ9 N;  3K5L A;  2O8B A;  3MED A;  4PKI A;  3RWU A;  2KTQ A;  2V7Y A;  2O8F A;  2E1Z A;  3VF6 A;  3OYM A;  3QO9 A;  4FW2 A;  1QHT A;  1SV5 A;  3DWL A;  3V6D A;  2YX6 A;  4RWT A;  4DU3 A;  3FLC O;  1Q82 O;  3OS2 A;  1S1T A;  4MDA A;  4DF4 A;  4BRP A;  3DRP A;  2FLO A;  3WEE A;  1S5J A;  4OO1 J;  4ELT A;  4NO7 A;  1QE1 A;  3QIC A;  5CE3 A;  1GLE G;  4ILG B;  5AQJ A;  3GDQ A;  2LSN A;  3PUF A;  4ELV A;  1BQM A;  1N32 K;  4BRM A;  3ATU A;  4KAZ A;  1WAJ A;  4H0O A;  3K2P A;  3DJC A;  3IS9 A;  4EZ6 A;  1VQN N;  5KPZ A;  2GWJ A;  3HTV A;  3SBT A;  4CJQ A;  3CC7 N;  4JI3 K;  2HHW A;  3QB0 A;  2PAV A;  2ITM A;  1U45 A;  3CJ1 A;  4CZM A;  2NRT A;  4FLW A;  1XUP O;  3AAQ A;  3TAP A;  4DV4 K;  3SZ2 A;  3T3F A;  5HRR A;  3PLA A;  3UKR A;  5J2M A;  1NK5 A;  4FJ7 A;  3J7Y P;  1M90 O;  3VGK A;  3SLC A;  3VQD A;  3V9U A;  3VEW A;  4CW7 B;  3EZ5 A;  4CFD A;  1BIS A;  3NBP A;  3TAR A;  3H08 A;  4HUF A;  5AQI A;  3UKU A;  3LM2 A;  1Q86 O;  2FBX A;  1GOB A;  4FLZ A;  3O1W A;  3SV3 A;  3I0R A;  1TVR A;  3AAR A;  3VQ5 A;  2P9N A;  5BPM A;  3M5R A;  4B9T A;  2OPP A;  2P9P B;  4JKG A;  4AHR A;  3SQ4 A;  3K59 A;  3J7Z O;  3M6G A;  5JLH A;  4CFC A;  3G6E N;  4DTU A;  4CGG A;  1C0T A;  5AQZ A;  2NLX A;  1LWC A;  4OKJ A;  2E8A A;  3AGR A;  3MN7 A;  3KD1 E;  3F73 A;  1EWQ A;  4JLH A;  4LY7 A;  3WXI A;  4BVO A;  2FSN A;  5C42 A;  3QEV A;  3QET A;  4N5S A;  3SUN A;  2YKN A;  3OYH A;  1UOC A;  4LFB K;  2I7P A;  4WE1 A;  3K58 A;  4OGC A;  3D2F A;  1JLA A;  5M1P A;  5GIP A;  3CET A;  3WNG A;  1UA0 A;  1BA0 A;  4PY5 A;  1RBV A;  1LAW A;  4M3Y A;  4AIL C;  4B08 A;  5KTQ A;  4DQS A;  3OBW A;  4UY8 O;  4FLX A;  3NFA A;  5JS2 A;  4DTM A;  3HOT A;  1XNR K;  1HKB A;  1WN7 A;  3ZYY X;  3FE1 A;  3AGK A;  2ZJP L;  2GUP A;  5EOY A;  1U04 A;  3ZSO A;  1SQK A;  4HTU A;  4IOA L;  2YHA A;  4B3M K;  4CZI A;  3OYG A;  5JVH L;  4JKC A;  4CJW A;  3M8S A;  4BRO A;  3TI0 A;  5SWM A;  3C65 A;  4JRQ A;  1OH5 A;  3HXM A;  3BY5 A;  3ZT2 A;  4BR7 A;  3O3F A;  3ISN C;  1YIJ N;  5AQN A;  3TAM A;  3ZEU B;  4KBO A;  1KRP A;  4WFA L;  4FVM A;  1HLU A;  1TUY A;  1WB9 A;  2E1Y A;  1X1P A;  4H0V B;  2HOE A;  1BQN A;  2P9L B;  3L2V A;  3NF7 A;  3EEQ A;  3DM2 A;  1RT1 A;  3MWT A;  3NGZ A;  3CMA N;  1NJX A;  4FM1 A;  2YNI A;  3ULD A;  1J9A A;  3QIP A;  1JLQ A;  3DXK A;  4ISF A;  5AQL A;  3VTI A;  3WNH A;  3RSE A;  2X6S A;  1Y64 A;  4IXC A;  3L2U A;  2HBL A;  3CME N;  1NKB A;  1A5V A;  4YOW A;  1UAX A;  1P8Z A;  4NLB A;  3VQ6 A;  2IAJ A;  2R7Y A;  3S9H A;  2ZGY A;  3QML A;  1KTQ A;  5C10 A;  2QKK A;  4BG9 A;  3ENO A;  4GMJ B;  1NK7 A;  4AQY K;  4DTR A;  3C6H A;  3J7A P;  1GOC A;  4FJH A;  4CEE A;  3KHY A;  3HOS A;  5FPM A;  2X74 A;  2HBM A;  4YOU A;  3CYG A;  1GLC G;  2E2Q A;  3ZX2 A;  4JV5 K;  2QW9 A;  4MDB A;  3TTF A;  4DSL A;  2HHI A;  1Q7Y O;  2P9S A;  3S3N A;  4RW9 A;  4H5N A;  4CZJ A;  2D0B A;  4JRP A;  2CH6 A;  2W42 A;  5CZ2 A;  4HHT A;  1RDD A;  4BDP A;  1ZXO A;  4J2A A;  1N5Y A;  4GV6 A;  2RPI A;  4X66 K;  3FZK A;  1W9H A;  3S41 A;  3VEY A;  4JKF A;  1ZBI A;  1ATR A;  1FKO A;  1D8Y A;  3O9U A;  4B9S A;  3DLG A;  4LFA K;  2W00 A;  4B9Q A;  1NGG A;  4LF8 K;  4M3R A;  1NGA A;  1I94 K;  3ZSW A;  4CJK A;  3OBY A;  5LJV A;  4CF8 A;  4WF9 L;  2Y1J A;  1L3U A;  1NGC A;  3UB5 A;  2PZS A;  5E41 A;  4A2B A;  1W2B M;  1XHX A;  2V52 B;  3HM9 A;  2ZJQ L;  4ILH A;  3P5J A;  3WT0 A;  4B3R K;  2Q36 A;  1HPZ A;  5BR8 K;  5AQV A;  1SAZ A;  2RE2 A;  1LV5 A;  3CJB A;  4C8O A;  4DWI A;  3NE6 A;  2VWK A;  3RTV A;  4NCB A;  3H3N O;  4FOE A;  3QEP A;  3BUZ B;  5BR9 A;  1W0H A;  3AVI A;  2NRX A;  4JN4 A;  2OCE A;  1S1V A;  5BPL A;  3G4S N;  2QK9 A;  3LPU A;  5GIO A;  3BZK A;  2G8W A;  4JK9 A;  1EP4 A;  3THW B;  3CCS N;  4DU4 A;  3SQ0 A;  4E7K A;  3VQ7 A;  2FF3 B;  4JS5 A;  4FWN A;  1FK9 A;  1K8K B;  3RRG A;  3TSU A;  3DOL A;  4B3S K;  3R3L A;  4FLV A;  1P90 A;  1QVG M;  2E6M A;  3DLK A;  4DG1 A;  2HND A;  4JS4 A;  1OH7 A;  2O8C A;  2QTD A;  3S3M A;  3SCX A;  1XNQ K;  4BEB A;  3PIP L;  4FLY A;  1DTQ A;  2Z1G A;  1TKZ A;  1BIZ A;  4CF9 A;  5BRD A;  3GL1 A;  3VQP A;  1BWF O;  1NMD A;  1S1X A;  2ZQB A;  3E9P A;  1ZBH A;  2A3Z A;  1KVB A;  1ILY A;  3JXU A;  4WYB A;  4J2B A;  3PSI A;  3TAB A;  4HWI A;  1RBR A;  2EX3 A;  4CK2 A;  2G8F A;  2ZWH A;  2CGK A;  3NHG A;  4J8F A;  3CCE N;  2O8D A;  2F8S A;  1QQO A;  4ZHR A;  1HNI A;  3VN5 A;  1JLG A;  2XY8 A;  4IJN A;  3QIO A;  5C12 A;  1C0M A;  3JS6 A;  4CZG A;  4WQ5 C;  4F8R A;  4DV0 K;  3LAL A;  4I9Q A;  3B8A X;  4BE7 B;  1H1V A;  3D45 A;  1IKV A;  2PFU A;  2XRI A;  4KI4 A;  4DTX A;  1MA9 B;  4FL9 A;  5DM7 L;  3ULE B;  1TGO A;  1S9E A;  2ASP A;  3QFU A;  4KHN A;  3VQE A;  4JKD A;  5ELZ A;  2E2O A;  4PL7 A;  4CF0 A;  1EX4 A;  5AQF A;  3SBG A;  2KQ2 A;  4DV7 K;  3VQB A;  4JHD B;  1RBS A;  3J81 O;  3WXJ A;  4JKB A;  5GIN A;  2ZD1 A;  4AH9 A;  2OPS A;  1JLE A;  4LSL A;  4KTZ A;  3HBT A;  4FZZ A;  3S3O A;  1CZB A;  1QZ6 A;  1X9J A;  3DI6 A;  4O44 A;  3ASM A;  3K5N A;  3GBT A;  2NZT A;  1Z26 A;  4FYD A;  3NF9 A;  1C6V A;  3VQ9 A;  3ZT4 A;  2E5L K;  4FJJ A;  4FJK A;  1VRT A;  4RCH A;  1Z05 A;  4M3X A;  4OX9 K;  4DU1 A;  4JKE A;  3VOV A;  3VES A;  1RT2 A;  3KK2 A;  5M1Q A;  4I2P A;  1OH8 A;  1KFS A;  4MFB A;  2BDP A;  2W40 A;  2G8K A;  4EIA A;  2NRR A;  3VF2 A;  3VET A;  1HQU A;  3G71 N;  4CJS A;  1IKY A;  3OYL A;  2GV9 A;  1T6C A;  1HNW K;  4AHU A;  4MLE A;  5C2F A;  5E26 A;  3O6W A;  4N76 A;  3QER A;  3SUQ A;  4DCH A;  5JMV A;  4CBU A;  4MO5 A;  1FW6 A;  1WSI A;  2P9P A;  2O8E B;  5JS1 A;  3ZSQ A;  5AZJ B;  3EL2 A;  5AR0 A;  4OVL A;  5T7B A;  3MEE A;  4FJ8 A;  1NWK A;  4YDU C;  4BRI A;  3HT3 A;  3ZT0 A;  4H0P A;  2WTU A;  4JK8 A;  4DKW A;  4I2Q A;  4LF4 K;  1NBW A;  3MDQ A;  2PYJ A;  1J5O A;  3THV A;  4GV9 A;  2AA4 A;  4PL8 A;  5KQD A;  1KSP A;  3P4I A;  2BTF A;  1DTT A;  1IJJ A;  1NK0 A;  3K57 A;  3M3Z A;  3ZCM A;  1RT7 A;  5CZ1 A;  3AO5 A;  1G15 A;  2YI1 A;  3HP6 A;  4KB1 A;  5FPN A;  1RCH A;  4OKK A;  3WXL A;  3KLF A;  3HSC A;  4BGB A;  4DFP A;  2ZGZ A;  4FOI A;  1HYZ A;  2HST A;  1EXQ A;  3IMX A;  5HRO A;  2DY4 A;  2VG7 A;  4B9U A;  1HJR A;  1Q9X A;  1SL0 A;  4YHH K;  1QZ5 A;  1HR0 K;  2I5J A;  1R59 O;  1RT4 A;  1TYQ B;  3O3G A;  1LAV A;  3CM6 A;  2C1I A;  4CZH A;  4BRQ A;  4LF9 K;  3QNO A;  1K8A O;  1LW2 A;  1DEJ A;  3O80 A;  3BGR A;  4WQ5 A;  4BWM A;  2HBK A;  1N33 K;  2OYQ A;  3OTO K;  1X9S A;  4HUE A;  4AHV A;  4DLG A;  3SQ2 A;  1VQO N;  3UIQ A;  4LF7 K;  3D6R A;  3LAK A;  3QES A;  3O9Q A;  1JL2 A;  1WBD A;  3ZEU A;  1J6Z A;  3H6E A;  5AQH A;  2KLA A;  1BGX T;  1BCM A;  3DYA A;  2UXC K;  1DGK N;  3CCJ N;  2HHT A;  1N34 K;  1S3X A;  1VSK A;  3CFR A;  2P9L A;  4CGF A;  3SV4 A;  1IBM K;  1G99 A;  3DOK A;  3AA5 X;  4ELU A;  4XEI A;  1Q8I A;  2A6A A;  4CEA A;  2B5J A;  4CJ4 A;  3SMS A;  3VQ4 A;  1SKS A;  4JI4 K;  3E1Y A;  2NNW A;  3OVN A;  4H5T A;  4OPA A;  4CHO A;  5C25 A;  4I9L A;  5HRP A;  3MK6 A;  4K41 A;  1JLC A;  1K73 O;  4FWR A;  3HVR A;  3EO3 A;  3E9L A;  3TWH A;  4FZX C;  5H1S Q;  4JI7 K;  1T05 A;  1RDU A;  3TAN A;  5KRS A;  2DFH A;  4RW8 A;  4WQ4 C;  5LMU K;  2WBN A;  4NXN K;  4CIE A;  4PQU A;  1CZ9 A;  4DV2 K;  4IO9 L;  3MN6 A;  1BIU A;  3ID8 A;  4YOT A;  4B8C A;  4FK4 A;  4CZK A;  1C1B A;  5M1N A;  1Q81 O;  3THX B;  2O4I A;  2D0O A;  4DUZ K;  4FZY A;  1YI2 N;  4CF2 A;  1KCF A;  3HPG A;  1ITG A;  2E4L A;  2CH5 A;  4TSX A;  5DMR A;  5B8H A;  3FFK B;  4ID1 A;  3N4Q A;  4DQR A;  2QWO A;  1S6Q A;  4JI1 K;  2EHG A;  3MXI A;  4BY9 C;  2WFB A;  4OPK A;  5AQQ A;  3LZJ A;  3TTC A;  3ALY A;  4NYN A;  1XHZ A;  4BRD A;  1WSF A;  3CFO A;  4FLT A;  4KB0 A;  2F9W A;  4BVP A;  5AQT A;  3OYE A;  3V9W A;  3O9R A;  3NH2 A;  3PV8 A;  1T8E A;  2UUB K;  3M8Q A;  2P51 A;  1VQP N;  1RDC A;  1VRU A;  3AVC A;  4O8U A;  4E0D A;  3P31 A;  3O08 A;  1SKR A;  4XH1 A;  4G1Q A;  2XO7 A;  2IDO A;  4Q5V A;  2HHU A;  2KW4 A;  1QSY A;  1X9M A;  1MWK A;  3V1O A;  3QEI A;  1IV0 A;  3I8D A;  1X3N A;  2HHQ A;  3LDQ A;  3ZSZ A;  5AQM A;  3AY9 A;  2WC9 A;  4B1V A;  3ZLJ A;  4CJ7 A;  2P9I B;  3KZB A;  4CI6 A;  3O1B A;  3T1Y K;  5EVZ A;  2QWL A;  3FZH A;  4H5V A;  3THW A;  3QFP A;  3SPY A;  3HJF A;  2DFF A;  1VSM A;  1BHL A;  4OLB A;  1K8K A;  4CJT A;  3MWP A;  4QS9 A;  1NLV A;  2QWQ A;  2IOC A;  2ZJR L;  5I9E B;  2A1R A;  1SS6 A;  4IWV A;  3KKR A;  4BQL A;  5DK5 A;  2Q0R A;  3RMB A;  3ZT1 A;  4AF1 A;  3LP3 A;  4RTF D;  4IO8 A;  1RTD A;  5KGW A;  2FF6 A;  3SUO A;  1O13 A;  3HVT A;  5F0X A;  2D0C A;  1VSJ A;  4RW4 A;  1ATN A;  1DKG D;  3MCP A;  3QIN A;  4CEB A;  4CZL A;  4UQG A;  4K0K K;  4O5B A;  4CIG A;  2E6L A;  4BQZ A;  5F2R A;  1LW0 A;  2P9K B;  5KPT A;  1RGI A;  3LP1 A;  3MCA B;  1NGF A;  1HYV A;  3QEX A;  2Z1H A;  3CFP A;  3CCU N;  3PO4 A;  3DLL L;  3C7N B;  1T44 A;  4NLC A;  4MLH A;  1CZA N;  3RMA A;  5FPD A;  4YFU A;  5KI6 A;  4CJU A;  1S1U A;  2OPR A;  3IAY A;  2ASM A;  4DHY A;  2A42 A;  4BRH A;  1M1K O;  1TK5 A;  4WQ4 A;  3DRS A;  3KJV A;  5BRH A;  4EFH A;  2Q3S A;  1MDU B;  1JJ2 M;  3LPT A;  4DSK A;  2YHY A;  1FKP A;  4W5O A;  1TV6 A;  3NF8 A;  1HYS A;  5CYQ A;  3K0S A;  2HNY A;  3KWI A;  3KLE A;  1GLA G;  3SUP A;  3TTD A;  3NH0 A;  4CCH A;  4FJI A;  3ULE A;  3AVG A;  3BP8 A;  4DSE A;  1HQE A;  1YAG A;  5FRO A;  4E19 A;  1KAX A;  5C15 A;  3L2R A;  1YIT N;  1ZBU A;  3HI0 A;  5C2D A;  4X65 K;  1BOT O;  3IDH A;  3NF6 A;  5J2N A;  1BL3 A;  3L6Q A;  5JEN A;  3VGL A;  3O9T A;  4JHD A;  5IWA K;  4KTQ A;  2O8F B;  4JI2 K;  2OA8 A;  3TR8 A;  2PY5 A;  1QS4 A;  4N41 A;  5EY4 A;  1KQS M;  4F9O A;  1YTU A;  2IS3 A;  1TL3 A;  4DS4 A;  4R5P A;  3CC4 N;  1Q9Y A;  4IFE A;  5FLX O;  1BA1 A;  3A5M C;  4H03 B;  4OPH A;  3CCQ N;  4FW1 A;  3LP2 A;  2GX9 A;  1KC8 O;  4JYA K;  1NGD A;  4H0T B;  5KRT A;  3NCI A;  4NXM K;  1OH6 A;  2KFN A;  3SAG A;  2O4G A;  3FZM A;  3PO5 A;  4B1Z A;  3DLE A;  2FBV A;  4DB3 A;  4BE1 A;  3V81 A;  3F5T A;  4GKJ K;  3CXC M;  3H3O B;  5CR4 A;  3V9X A;  3CF5 L;  4XH5 A;  3KK7 A;  1XMQ K;  1S72 N;  3NGY A;  4M3W A;  1KAY A;  1R0A A;  4X64 K;  2XY6 A;  4KRF A;  3TSP A;  1VQ7 N;  4O8K A;  1YVN A;  3NDK A;  3CI5 A;  3FZL A;  3KLH A;  2O8E A;  3AVM A;  5AZJ A;  1TKD A;  3GG4 A;  3U4L A;  4CF1 A;  4HTL A;  4DFK A;  3F2K A;  4H4O A;  1VQL N;  4DF8 A;  3B6P A;  2W41 A;  2QM1 A;  3LDL A;  3V4I A;  3EY1 A;  3DLH A;  4WCE L;  1L5U A;  1BI4 B;  4BR9 A;  4IBN A;  3LP0 A;  4YOX A;  3O8M A;  4J2D A;  3TPQ A;  3VTH A;  4IEI A;  3L3U A;  4LFC K;  3U9D A;  1KD1 O;  1XWL A;  1CXQ A;  4IOC L;  1WNS A;  5HOO A;  4FJX A;  4ILJ A;  4LF5 K;  4KTW A;  4BR4 A;  4KHU A;  2DPN A;  5GAH P;  5HBM A;  3MN5 A;  1WSH A;  2IIR A;  1C1C A;  1X3M A;  2P9U A;  3HK2 A;  1A5W A;  5AQK A;  4XIU A;  1KXP A;  3AO4 A;  1BCO A;  4JKA A;  4A5B A;  3OY9 A;  3OYJ A;  3T1H K;  4FJM A;  4Z4F A;  4Z4E A;  4RG8 A;  3CCL N;  2ATQ A;  3DAW A;  4IKF A;  4K8Z A;  5MLC Q;  1BO5 O;  1TYQ A;  2X78 A;  4M41 A;  2VYP A;  4Z0U A;  1JXB A;  4BRF A;  1W7A A;  4RW6 A;  5DM6 L;  4A2A A;  2QEX N;  3L0Q A;  4ZTJ A;  3AA2 A;  3OYC A;  1TKX A;  4F2S A;  1YJN N;  4BE0 A;  4L3Q A;  2BE2 A;  1JCF A;  1NGB A;  2OPQ A;  3O4W A;  4CHN A;  4EHT A;  2QWP A;  4XJX A;  1RDB A;  4FM0 A;  4WFB L;  3RMC A;  4YOV A;  1E3M A;  1RBU A;  3R1X A;  1X9W A;  3P39 A;  3ENB A;  3T69 A;  3MXM A;  1N8R O;  2WON A;  5BRE A;  2QWR A;  1IKW A;  4QS7 A;  4A62 A;  1J5E K;  5JLF A;  3P38 A;  1IKX A;  2Q0U A;  4DR2 K;  4E1J A;  5J1E A;  1U4B A;  1C0G A;  4N56 A;  3R6M A;  4E7I A;  5AQY A;  4CFA A;  1J53 A;  3CQ8 A;  1SZ2 A;  2NRV A;  3LDO A;  3B6O A;  4DUY K;  5AQR A;  3CJA A;  5LJW A;  1T7P A;  2G8I A;  4BC4 A;  4HVJ A;  5BN8 A;  5GAG P;  2YHX A;  1J54 A;  4L8R B;  2KKZ A;  4DSJ A;  5ADX A;  3RSE B;  1VQ4 N;  5HP1 A;  3J80 O;  4E7H A;  1EQY A;  4LD0 A;  5AFU A;  3DLB A;  2YJF A;  4F2R A;  4CEQ A;  1SL1 A;  4O0I A;  2P5O A;  3FR0 A;  5FPE A;  3THX A;  1ASU A;  3CM5 A;  3AVB A;  4DQP A;  1K6Y A;  4BG8 A;  1SUQ A;  5FRM A;  3R8E A;  3O9S A;  4FWK A;  4FJ5 A;  4IG3 A;  2D4W A;  1VQM N;  1RFQ A;  4DQI A;  4DR4 K;  3G25 A;  4CJL A;  2ITG A;  1C0F A; 
#chains in the Genus database with same CATH homology
 2P9N B;  3HOT A;  3E1Y A;  4H0Y B;  4IEE A;  1HKB A;  3LDP A;  2NNW A;  2V51 B;  4JKG B;  3ZYY X;  3FE1 A;  3AGK A;  2VGM A;  2ZJP L;  4H5T A;  1NJI O;  3DXM B;  4ISE A;  2GUP A;  3L4I A;  4OPA A;  1NGI A;  3NMU A;  3MK6 A;  2ASO A;  4K41 A;  5EOY A;  3NVK A;  4H5W A;  1K73 O;  4FWR A;  1SQK A;  3EO3 A;  4IOA L;  3E9L A;  4CZI A;  5JVH L;  3CQY A;  5AQO A;  5H1S Q;  4AM6 A;  4JKC A;  3I33 A;  1RDU A;  3D2E A;  4BRO A;  4WQ4 C;  3C65 A;  2WBN A;  4A61 A;  4AM7 A;  4BR7 A;  2GEL A;  2A5X A;  3U9Z A;  3CCR N;  1YIJ N;  5AQN A;  3ZEU B;  4KBO A;  2Q2R A;  3SAF A;  4IO9 L;  3MN6 A;  4WFA L;  3EZW A;  1HLU A;  3ID8 A;  4YOT A;  1GLJ O;  4CZK A;  5M1N A;  1TUY A;  1Q81 O;  2E1Y A;  2OTL N;  2NRH A;  4H0V B;  1QVF M;  3D2F B;  1YJ9 N;  4WFN L;  2D0O A;  2HOE A;  2FSK A;  2P9L B;  4XH4 A;  1BUP A;  4JD2 B;  5AZI B;  3MWT A;  4IOX A;  4JAX A;  3CMA N;  1YI2 N;  2HF4 A;  2P9I A;  5BPN A;  3ZET B;  4FWQ A;  2CH5 A;  3QBX A;  5B8H A;  3CPE A;  3FFK B;  3HZ6 A;  3N4Q A;  4IZ9 A;  3DXK A;  3NVM A;  2QWO A;  4ISF A;  5AQL A;  4K43 A;  3VTI A;  2BUP A;  3RSE A;  3VF4 A;  3CER A;  4BRG A;  5M1K A;  4BY9 C;  2WFB A;  1EO1 A;  1Y64 A;  1HKG A;  1IG8 A;  1TUU A;  4IXC A;  5AQQ A;  3TTC A;  2HBL A;  2D0P A;  3CME N;  4BRD A;  3TSQ A;  2UYT A;  2F9W A;  3EN9 A;  4YOW A;  1YHQ N;  1P8Z A;  3CCV N;  4NLB A;  4BVP A;  5AQT A;  3C0B A;  3O9R A;  4A5A A;  4IJA A;  3ID6 A;  2AP1 A;  2EWS A;  4CZE A;  5E84 A;  1VQP N;  2ZGY A;  4CZF A;  5EXW A;  3D2E B;  3QML A;  5C10 A;  3EE8 A;  1LCU A;  4O8U A;  4FWP A;  4PHT X;  3IFR A;  3P31 A;  3VPZ A;  4BG9 A;  3O08 A;  1V4T A;  3ENO A;  4FVU A;  4KH4 A;  4XH1 A;  3VEN A;  2IVP A;  4EHU A;  3C6H A;  3H1Q A;  1MWK A;  3CHW A;  3OHR A;  2GEM A;  3FZF A;  3HM8 A;  1X3N A;  4K25 A;  3LDQ A;  3KHY A;  3AAP A;  2BH1 A;  5FPM A;  3HOS A;  5AQM A;  3AY9 A;  3VEX A;  4BR0 A;  2HBM A;  2WC9 A;  4YOU A;  5KPR A;  4B1V A;  1GLC G;  2E2Q A;  3ZX2 A;  3ZX3 A;  2QW9 A;  4JK7 A;  4MDB A;  3TTF A;  3A5O C;  2PBD A;  4CJ7 A;  2P9I B;  3CJC A;  4C1N K;  1ESV A;  3KZB A;  4CD1 A;  2P9K A;  4CI6 A;  2F7T A;  3DXK B;  3O1B A;  3SK3 A;  4FWO A;  5EVZ A;  1Q7Y O;  2P9S A;  2QWL A;  2H3G X;  3FZH A;  3BF1 A;  4H5V A;  2FXU A;  4H5N A;  4CZJ A;  2CH6 A;  2GWK A;  4YOY A;  3QFP A;  1ZXO A;  3Q7B A;  4GV6 A;  3FZK A;  3SMP A;  3S41 A;  3VEY A;  1K8K A;  4JKF A;  1ATR A;  3MWP A;  3O9U A;  1HJO A;  2A40 A;  1NLV A;  2QWQ A;  4QS9 A;  3LDN A;  4GVE A;  4CBX A;  2ZJR L;  3U8X A;  2W00 A;  5I9E B;  2C1G A;  2J4R A;  3E66 A;  1SS6 A;  4IWV A;  5AQW A;  3M1F A;  3VEO A;  4B9Q A;  4BQL A;  2Q97 A;  1NGG A;  4H5R A;  4BRK A;  5M1F A;  2I7N A;  1NGA A;  4B1Y B;  1YUW A;  5LJV A;  4WF9 L;  3OBY A;  2Q0R A;  1NGC A;  3UB5 A;  4AF1 A;  3SAH A;  3I56 N;  4RTF D;  4A2B A;  4IO8 A;  1W2B M;  2ZF5 O;  1U6Z A;  4EAH D;  2FF6 A;  2V52 B;  1O13 A;  2ZJQ L;  4ILH A;  3WT0 A;  4KH5 A;  5F0X A;  3BF3 A;  2Q36 A;  1ATN A;  5AQV A;  4BGA A;  1SAZ A;  1DKG D;  2RE2 A;  3MCP A;  3TU5 A;  4CZL A;  3MX5 A;  1QQN A;  3CJB A;  1U2V A;  1WUA A;  3CIP A;  1S22 A;  3H3N O;  4FOE A;  4R79 A;  4BQZ A;  5F2R A;  2P9K B;  3BUZ B;  1E4F T;  4JN4 A;  5BR9 A;  1RGI A;  2NRX A;  5KPT A;  3I55 N;  3N4P A;  5BPL A;  2P9S B;  3W0L A;  3G4S N;  3IUC A;  3MCA B;  1GLB G;  1NGF A;  4B1W B;  5GIO A;  3CCU N;  4JK9 A;  3CCS N;  4MO4 A;  1ZBS A;  4M7Y A;  5GAD P;  3DLL L;  5TKY A;  3C7N B;  1T44 A;  4NLC A;  4MLH A;  1CZA N;  5BN9 A;  5FPD A;  2FF3 B;  3VEZ A;  3KWG A;  4FWN A;  2V7Z A;  3RVC A;  1K8K B;  3PIO L;  3TSU A;  5LY3 A;  4JKH A;  2YJE A;  2E2P A;  2ASM A;  1ZC6 A;  3R3L A;  1P90 A;  4M7X A;  4DHY A;  2A42 A;  4BRH A;  3A0I X;  1M1K O;  1QVG M;  2HMP A;  2Q31 A;  4WQ4 A;  4YOR A;  3WQT A;  5BRH A;  4EFH A;  4QS8 A;  4B1X B;  1MDU B;  1JJ2 M;  3VMF B;  3ENH A;  3CC2 N;  2VGN A;  2QA4 N;  2YHY A;  1XC3 A;  2QTD A;  2OTJ N;  4G9Z A;  4BEB A;  3KWI A;  1GLA G;  3WQU A;  3TTD A;  1ATS A;  3PIP L;  2KHO A;  3ULE A;  2GTD A;  3E9O A;  4C1N I;  2CGL A;  3BP8 A;  3J8A A;  1U2V B;  3KVG A;  3GL1 A;  5BRD A;  1BWF O;  1NMD A;  3E9P A;  1YAG A;  2A3Z A;  4YDU A;  1ILY A;  3WXM B;  3JXU A;  1KAX A;  4M63 C;  4WYB A;  4FWL A;  5C15 A;  1YIT N;  3C6A A;  1GLD G;  5CHI A;  3HI0 A;  5GAE P;  3LL3 A;  5C2D A;  4HWI A;  3CQX A;  4FPB A;  1BOT O;  3IDH A;  3L6Q A;  2IVO A;  1KAZ A;  3VGL A;  2ZWH A;  5AQS A;  2CGK A;  4J8F A;  3CCE N;  4KH6 A;  3O9T A;  4JHD A;  4GNI A;  1QQO A;  1JCE A;  1BU6 O;  3MMV A;  2YCH A;  5EY4 A;  1KQS M;  4F9O A;  4IJN A;  5C12 A;  3QBW A;  2OAN A;  1RDW X;  3IKM A;  3JS6 A;  4IDH A;  3CC4 N;  3CJ7 A;  2NRZ A;  4CZG A;  3QDK A;  4GY2 B;  4IFE A;  4WQ5 C;  2QXL A;  1BA1 A;  1QHA A;  2E2N A;  3A5M C;  3H45 C;  2WUS A;  4H03 B;  4ISG A;  4OPH A;  3B8A X;  2P9U B;  3CCQ N;  4BE7 B;  2Q1N A;  4I6M A;  2GX9 A;  1KC8 O;  1YF5 L;  1NGD A;  1H1V A;  3K9K A;  4A59 A;  1BG3 A;  4H0T B;  4FO0 A;  2PFU A;  2QWN A;  1VQ6 N;  4Z94 A;  3GE1 A;  1Q18 A;  1MA9 B;  4FL9 A;  2QI2 A;  5DM7 L;  2RHK A;  4K42 A;  3SAG A;  3O5B A;  2YHW A;  5AQP A;  3FZM A;  2JWK A;  3A5L C;  3C7N A;  3ULE B;  3H1V X;  4BR2 A;  2ASP A;  4BC5 A;  4BRL A;  1V4S A;  3QFU A;  4B1U B;  1WOQ A;  5AQU A;  5M1O A;  4JKD A;  4B1Z A;  4DB3 A;  1NGH A;  3Q7C A;  3MX2 A;  3F5T A;  1VQ5 N;  3CXC M;  4BC3 A;  1HX1 A;  3H3O B;  5ELZ A;  2E2O A;  4NB4 A;  4O5F A;  2F9T A;  5CR4 A;  4PL7 A;  3CF5 L;  4BR5 A;  4XH5 A;  3KK7 A;  4H0X B;  3WXK A;  2IVN A;  2JWL A;  1T6D A;  3EE9 A;  1S72 N;  1KAY A;  4JEP A;  5AQF A;  3R9P A;  3SBG A;  4U67 L;  3VGM A;  4CBW A;  4FSV A;  1D4X A;  2NRW A;  3TSP A;  3CD6 N;  4BRN A;  1VQ7 N;  4O8K A;  4JHD B;  1VQK N;  1YVN A;  4BRE A;  3WXJ A;  3CI5 A;  2VWB A;  3HRG A;  4JKB A;  3FZL A;  5KQ8 A;  5HL7 L;  1LOT B;  5GIN A;  3EKS A;  5AZJ A;  3GG4 A;  3HBT A;  3D7E O;  3A5N C;  3U4L A;  4HTL A;  1QZ6 A;  1X9J A;  3F2K A;  1HUX A;  1VQL N;  3T7Z A;  1HPM A;  3GBT A;  2HBJ A;  2NZT A;  2W41 A;  2QM1 A;  3LDL A;  4I6M B;  4WCE L;  5AQG A;  4BR9 A;  1YJW N;  5BRF A;  4YOX A;  3O8M A;  4FPA A;  1NGE A;  1JCG A;  3TPQ A;  3VTH A;  4IEI A;  1GLF O;  3U9D A;  4RCH A;  1Z05 A;  4BRC A;  1KD1 O;  1VQ9 N;  4CD3 A;  5F1X A;  1OVY A;  4JKE A;  4IOC L;  3VOV A;  3OW2 M;  5HOO A;  4PKI A;  3VES A;  1HKC A;  3FGU A;  2V7Y A;  5M1Q A;  3VEV A;  2W40 A;  3MN9 A;  4ILJ A;  4EIA A;  2E1Z A;  3VF6 A;  2NRR A;  3VF2 A;  3VET A;  3W3D A;  5EX5 A;  4LC9 B;  4BR4 A;  3G71 N;  2DPN A;  1T6C A;  5GAH P;  3DWL A;  4MLE A;  3MN5 A;  2YX6 A;  5C2F A;  1XQS C;  4FWM A;  1Z6R A;  2IIR A;  4RWT A;  5E26 A;  3O6W A;  3FLC O;  1X3M A;  2P9U A;  1BDG A;  1Q82 O;  3CJ9 A;  5AQK A;  2VCP A;  1E4G T;  1KXP A;  4MDA A;  4DCH A;  4JKA A;  4A5B A;  4BRP A;  5JMV A;  1MWM A;  4CBU A;  1W97 L;  4GV3 A;  2FLO A;  3WEE A;  4BEC A;  4OO1 J;  4MO5 A;  3CCL N;  4NO7 A;  3QIC A;  3DAW A;  5CE3 A;  2P9P A;  1GLE G;  4ILG B;  5AQJ A;  3EL2 A;  3GDQ A;  5AR0 A;  5AZJ B;  5MLC Q;  1BO5 O;  1TYQ A;  3ZX0 A;  2VYP A;  1NWK A;  4BRM A;  3ATU A;  3LM9 A;  4BRF A;  4YDU C;  1T3V A;  4BRI A;  4H0O A;  3DJC A;  5DM6 L;  1VQN N;  5KPZ A;  2GWJ A;  4PKG A;  3HTV A;  4H0P A;  3SBT A;  4PKH A;  4A2A A;  3CC7 N;  2QEX N;  3L0Q A;  4JK8 A;  3QB0 A;  2PAV A;  4DKW A;  3L4Q A;  2ITM A;  3UE5 A;  3CJ1 A;  1NBW A;  2QWM A;  4CZM A;  1YJN N;  3MDQ A;  3CCM N;  2NRT A;  4L3Q A;  2A41 A;  1JCF A;  1NGB A;  4GV9 A;  1XUP O;  3AAQ A;  2AA4 A;  3O4W A;  4PL8 A;  5KQD A;  3A8Y A;  3K9J A;  3P4I A;  4EHT A;  1NM1 A;  2FSJ A;  2BTF A;  3PLA A;  2QWP A;  3UKR A;  1OKJ A;  1IJJ A;  4XJX A;  1M90 O;  3VGK A;  4BRA A;  3SLC A;  4WFB L;  4A57 A;  3M3Z A;  4YOV A;  1K9M O;  3VEW A;  2YI1 A;  3R1X A;  5FPN A;  3P39 A;  3CPW M;  3SJH A;  3WXL A;  4DQ8 A;  5AQI A;  3ENB A;  3T69 A;  3HSC A;  3UKU A;  3LM2 A;  3EKU A;  1NGJ A;  4BGB A;  1Q86 O;  2ZGZ A;  3I8B A;  1QQM A;  5BRE A;  2QWR A;  3IMX A;  2HST A;  3O1W A;  4FOI A;  4QS7 A;  4Y0W A;  4A62 A;  3WEE B;  5JLF A;  3P38 A;  3AAR A;  2Q0U A;  2P9N A;  5BPM A;  3M5R A;  3VER A;  4E1J A;  1C0G A;  3WUH A;  3R6M A;  2P9P B;  4FWS A;  4JKG A;  5AQY A;  1QZ5 A;  3DXM A;  1R59 O;  1TYQ B;  1SZ2 A;  2NRV A;  3J7Z O;  3LDO A;  3M6G A;  5JLH A;  2HF3 A;  5AQR A;  3H46 O;  3CJA A;  5C0Y A;  3G6E N;  2C1I A;  4CZH A;  2D1K A;  4BRQ A;  5LJW A;  1K8A O;  1DEJ A;  5AQZ A;  2CGJ A;  3O80 A;  2NLX A;  4WQ5 A;  2HBK A;  4BC4 A;  5BN8 A;  2E88 A;  2E8A A;  3AGR A;  3MN7 A;  2YHX A;  5GAG P;  1VQO N;  2KKZ A;  3D6R A;  3WXI A;  5ADX A;  4BVO A;  3RSE B;  2FSN A;  1VQ4 N;  3O9Q A;  1DT9 A;  4U7B A;  1EQY A;  5AFU A;  5ADX H;  2YJF A;  1N8R O;  1VAZ A;  3ZEU A;  1J6Z A;  3H6E A;  5AQH A;  2KLA A;  4JNE A;  3FR0 A;  5AFU H;  4C23 A;  5TKW A;  2I7P A;  3UKR B;  5FPE A;  1DGK N;  3CCJ N;  3D2F A;  1GLL O;  1VQ8 N;  5JIC A;  3BEX A;  1S3X A;  5M1P A;  2P9L A;  4BC2 A;  4BG8 A;  5GIP A;  3CET A;  4JD2 A;  3R8E A;  3F9M A;  3GOI A;  3O9S A;  4FWK A;  1BA0 A;  3OA9 A;  5AQX A;  1G99 A;  5AZI A;  1YXQ A;  2D4W A;  2E20 A;  1RFQ A;  3ATV A;  4XEI A;  1VQM N;  3UKU B;  2A6A A;  3ZET A;  5JVG L;  3OBW A;  3G25 A;  3SMS A;  4UY8 O;  1C0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...