2P9SB

Structure of bovine arp2/3 complex co-crystallized with atp/mg2+
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
197
structure length
197
Chain Sequence
TGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-like protein 3
total genus 54
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9sB02
4HWIA 3GOIA 4I6MB 2P9LA 4MO5A 3LL3A 4LC9B 2V7YA 3VGLA 3FR0A 3ZEUA 1X3NA 3BP8A 3DWLA 2QWLA 5AQGA 3CHWA 4AM7A 4PKHA 3GE1A 4QS8A 1XQSC 2A6AA 2A40A 5BRHA 3W3DA 2GUPA 3FFKB 5JLHA 2PBDA 4EAHD 1EQYA 5AQIA 2GWJA 4BROA 2A41A 4IXCA 2P9SB 2QWQA 5AQYA 4FPAA 5AQLA 3VF6A 2IVOA 4CZLA 2ITMA 3CETA 2F9TA 3OHRA 4B1ZA 3BF3A 3M1FA 3R8EA 4GY2B 4Z94A 1P8ZA 4YDUC 3VEZA 5BPMA 3H46O 5ADXA 1NMDA 3H1QA 5FPEA 3DXKB 1BG3A 4BQZA 3GL1A 3U9DA 3VERA 1TUYA 1GLBG 1QQOA 2IVPA 3ATUA 3FZLA 5FPNA 4K42A 4CJ7A 3HI0A 2P9PA 3QBXA 1R59O 4BC4A 4BG8A 3ENHA 2P9UA 5AZIB 3AARA 2P9NA 4BC5A 4FWRA 4BC2A 2D0PA 2P9KA 3VENA 3J8AA 1NGBA 4ISFA 4CI6A 5KQ8A 3AAQA 2CGLA 5AQWA 1KAZA 2E2NA 4C23A 4FPBA 4BRDA 3O4WA 3HZ6A 4BC3A 4B1UB 4WQ4A 4CBUA 2OANA 1NGJA 2YJFA 2CH6A 4BRFA 1HKCA 1V4TA 5BPNA 1MWMA 3D2FB 5F1XA 1X3MA 2P9UB 4JAXA 4HTLA 4BVPA 2Q2RA 1HX1A 2YI1A 5AR0A 5ADXH 2YHXA 4CZGA 3MN9A 3HBTA 1IG8A 1XUPO 3QFUA 5ELZA 5I9EB 3O08A 4H5WA 2ASMA 4CZFA 2D4WA 4CZMA 2CGJA 3MN5A 3ULEB 4H0PA 5EOYA 3LM2A 1HKGA 4JHDA 4FWMA 2GWKA 5F0XA 3VF4A 2FF3B 5AQMA 4BRIA 1RFQA 4NB4A 3RSEB 4PL7A 1NGDA 4NO7A 3KHYA 1HKBA 4H03B 3ZX3A 5KQDA 2E88A 3CQXA 4JD2B 3HTVA 3AY9A 3IUCA 4IZ9A 4YDUA 2IIRA 3DXMB 4BR9A 1QZ6A 4H5RA 3CIPA 3LM9A 3HM8A 3KZBA 3M3ZA 2F9WA 4FL9A 4XEIA 3VEXA 3SMSA 4BRLA 2BTFA 1BU6O 3WUHA 1GLCG 4BG9A 2ASOA 3EKUA 3A5MC 2CGKA 1SQKA 3D7EO 4E1JA 3AAPA 3LDLA 3A8YA 3W0LA 4BVOA 3BF1A 1BA0A 1ATSA 3R9PA 4ISGA 3FLCO 3SK3A 3MDQA 5AQXA 1QQNA 4CBXA 1X9JA 3CJ7A 1TUUA 3IMXA 1SAZA 3O1WA 1NGGA 1JCFA 4H0VB 2P9IB 4M7YA 2BUPA 1Y64A 2FXUA 2P9PB 1MA9B 3D2FA 3TU5A 4L3QA 3ZX0A 4A2AA 4MO4A 4XH1A 4M7XA 3S41A 2ZGYA 1NGHA 4BRNA 3CJ1A 2W40A 5BN9A 4JD2A 5EVZA 3FGUA 4BR4A 2FSNA 3C7NB 1NGIA 5BRDA 2PAVA 3WT0A 5LJVA 4M63C 4PKGA 2VYPA 3CJCA 2E2OA 4WQ4C 3FZHA 2GEMA 5EY4A 1C0FA 2QWNA 3LDNA 4FWNA 4H5NA 1QZ5A 1T44A 2A3ZA 4FWKA 2Q31A 3U4LA 2HOEA 3VOVA 4JN4A 4BRCA 2QM1A 4PL8A 4FWOA 4BRGA 4MLEA 4CZIA 5EXWA 5CE3A 3KVGA 1E4FT 5AFUA 3U8XA 4ISEA 2FSJA 2EWSA 4A62A 4BRPA 5KPZA 1CZAN 4AM6A 3QB0A 1RDWX 4RWTA 1J6ZA 5BN8A 1ZBSA 3QICA 4FO0A 1U6ZA 4FWPA 4BR2A 3O80A 3VGKA 4BR5A 2P9IA 3G25A 2P9LB 3JXUA 1QHAA 4CD3A 1BOTO 4IO8A 3CQYA 2I7PA 5AQPA 2NRHA 2E1ZA 3SLCA 5LJWA 3VEWA 5BREA 3ZX2A 1K8KA 2VWBA 4H0TB 4O8KA 3ZETB 3QBWA 4B1WB 2P9SA 3L6QA 1KAXA 2FLOA 2Q36A 4BGAA 3VESA 1NWKA 4CZEA 3FZKA 1NBWA 1T6CA 4DQ8A 1Z6RA 3A5OC 2I7NA 3DJCA 3VPZA 1LOTB 3SMPA 2NZTA 3MN7A 3WQTA 4B1VA 3EKSA 3EN9A 4JHDB 3WXLA 3L0QA 1YXQA 3WXKA 4BGBA 3QMLA 3VEVA 3RSEA 5AQRA 4RCHA 4BRMA 2QWPA 3ZETA 4CD1A 3B8AX 3EL2A 5AQVA 3VETA 4B9QA 2FF6A 2ASPA 1NGCA 4B1XB 1KXPA 2QW9A 2P9NB 3H3NO 1KAYA 2HMPA 1GLDG 5AQUA 4J8FA 2HF3A 4H5TA 3L4IA 4FWSA 4H5VA 1TYQB 5JICA 1Q18A 4GNIA 2AA4A 1G99A 1ATNA 3UE5A 3VEYA 3CJBA 1MWKA 3A5NC 5AQQA 2YCHA 3D2EB 1IJJA 1Z05A 3MN6A 3WQUA 4KBOA 2QXLA 3I33A 1JCEA 3GG4A 1H1VA 4BRKA 1ATRA 5TKYA 3ATVA 4K43A 2QWMA 3BUZB 4H0YB 2E8AA 2P9KB 1BUPA 4CZKA 2J4RA 2D1KA 4K41A 5AQSA 3DXKA 3IFRA 3WXJA 5E26A 5KPTA 3P4IA 5AQHA 3QFPA 1HLUA 2V52B 1BO5O 2HF4A 3MMVA 4B1YB 2KHOA 3WEEB 1ESVA 1HJOA 2Q1NA 3R6MA 4WQ5A 1BDGA 3UKUB 3LDPA 4PKIA 1YUWA 2YJEA 3ZEUB 1S22A 2Q0UA 5BRFA 3O8MA 3MK6A 3ENOA 3M6GA 4MLHA 1WUAA 3C0BA 1SZ2A 2ZWHA 3H3OB 1GLFO 3LDQA 5BPLA 4A2BA 2YHWA 2WUSA 1NLVA 5AQNA 2Q97A 2CH5A 4QS7A 1BA1A 1GLJO 2Q0RA 4FOEA 1NGFA 3A5LC 3A0IX 5AQOA 3DAWA 3CJAA 5AQZA 2D0OA 3FE1A 2W41A 2FSKA 1C0GA 2ZF5O 5AQFA 2V51B 3JS6A 4FSVA 2DPNA 2AP1A 1OKJA 3IDHA 4A61A 1YVNA 5E84A 4FWQA 3SJHA 1T6DA 2A42A 3CI5A 3HSCA 4CBWA 3CJ9A 4F9OA 1NM1A 1WOQA 4QS9A 1GLAG 1NGAA 3QDKA 1ZXOA 5AFUH 1K8KB 4I6MA 1LCUA 4O5FA 5F2RA 2GELA 4BR0A 5AZJA 2UYTA 2E2PA 5KPRA 1QQMA 4IJAA 3CERA 4IJNA 5AQKA 3UKRA 3VGMA 4BRAA 1MDUB 4BR7A 3H6EA 5FPMA 4EHTA 5AZJB 3D2EA 1V4SA 5LY3A 5AQTA 3FZMA 3BEXA 4BRHA 2QWRA 1U2VA 5JMVA 3ULEA 4WYBA 3O5BA 2NLXA 3O1BA 2IVNA 4WQ5C 1DKGD 4IWVA 4DB3A 3UB5A 2ZGZA 3U9ZA 3WEEA 1XC3A 2E20A 4DCHA 2GTDA 2H3GX 2V7ZA 1ZC6A 4K25A 1DGKN 3ID8A 3UKRB 4BQLA 2YHYA 3F9MA 4FOIA 1RGIA 4BRQA 3LDOA 3H45C 1GLEG 3EZWA 3WXIA 3GBTA 1DEJA 3I8BA 5EX5A 5B8HA 3VEOA 4RTFD 4BREA 3UKUA 1YAGA 3VF2A 1HPMA 5AZIA 4JNEA 3O6WA 3H1VX 1TYQA 5JLFA 2E1YA 3C7NA 4H0OA 4EFHA 2E2QA 3MCPA 4CZJA 3TPQA 4CZHA 1BWFO 1D4XA 4FWLA 4DHYA 1U2VB 4XH5A 1S3XA 4EHUA 4H0XB 1NGEA 1E4GT 3FZFA 1JCGA 1HUXA 5FPDA 2VCPA 5BR9A 2A5XA 4Y0WA 1GLLO 3DXMA 3GDQA 3EO3A 4XH4A 2QWOA 5AQJA 4EIAA
chains in the Genus database with same CATH superfamily
4HWIA 4I6MB 4DKWA 2P9LA 3LL3A 4LC9B 5IWAK 2V7YA 3VGLA 3FR0A 3HM9A 3E1YA 1X3NA 1FKOA 4LD0A 5HRNA 3DWLA 1IKXA 1KTQA 1O13A 1VQON 3J7ZO 4PKHA 3BDPA 4ILHA 2DTUA 4DV1K 2O8EA 1K8AO 3CC4N 1XNRK 3VTIA 2A6AA 2A40A 3OBWA 4Y1CA 4E7HA 2PBDA 2G8UA 4J2DA 1TK0A 4CFAA 3OY9A 5J1EA 5HBMA 3KLFA 4DR6K 1RDDA 3Q7BA 2P9SB 2NRVA 3BY5A 5AQYA 1KQSM 5AQLA 3CM5A 4FJXA 5JS1A 3OJSA 3L2QA 2F9TA 4KTWA 3BF3A 5LMUK 1JL1A 3OYFA 1WSGA 3O3FA 3MXMA 4CJLA 4E7KA 2VGMA 3G10A 4JK7A 3I0SA 4CJFA 3GL1A 1RT2A 3Q7CA 4FLZA 3VQ8A 4IFYA 2Q3SA 1TK5A 3HI0A 2QXFA 2X78A 4BC4A 5DM6L 1S6PA 3DLKA 2YNHA 1Q7YO 4BC5A 4DV2K 2D0PA 2P9KA 4YOXA 5KQ8A 2HBKA 1VAZA 3SBTA 4CHNA 3TR8A 4BRDA 2B6AA 1EWQA 4B1UB 2OANA 1NGJA 3E01A 4M3TA 4BRFA 1V4TA 1X9SA 2DFHA 3OYAA 3D2FB 2FBXA 2P9UB 5F1XA 4KB1A 1U4BA 5ADXH 4E1MA 3HBTA 2XO7A 4OGEA 2ASMA 4FJGA 3DLGA 1KD1O 4RW9A 3ULEB 3LM2A 4MQ3A 4NXNK 3NMUA 5D3GA 3NFAA 2KTQA 5HLFA 1L3VA 3VF4A 4CF2A 1KRPA 3C6AA 3SAHA 1VQ6N 4CEZA 1WAFA 2DFFA 4CK2A 1VSDA 3KK3A 4H03B 2YHAA 3CYMA 3ZSRA 4ZTFA 1IBMK 3ZX3A 5KQDA 2E88A 3J80O 3CQXA 4IZ9A 1IBLK 3M8QA 3SUOA 4H5RA 3LM9A 3A2FA 3NF8A 1K73O 4KKOA 3WNHA 2BTFA 4CGHA 3NVKA 4CJVA 3EKUA 1QSSA 3D7EO 2WBNA 1KC8O 3L3VA 4E1JA 2F8SA 1C1AA 3LDLA 4K0KK 3BF1A 3P83D 4I2QA 3ZLJA 5FROA 4CJSA 3VTHA 5AQXA 1NJWA 3SPYA 2I5JA 4EZ9A 1SAZA 1NK6A 2OPQA 3AA3A 4H0VB 1N33K 3LPTA 4Z4EA 3PX4A 3NH1A 4A2AA 3RMAA 2NRRA 4M7XA 4BRNA 1VSFA 4BR4A 1NOYA 2FSNA 4QOZB 4DTJA 4ICLA 4WQ4C 4LF5K 3WXMB 2VG6A 1NK7A 4IKFA 1B9FA 5EY4A 3LP3A 1EETA 3KD1E 1QZ5A 4KHSA 3U4LA 3VOVA 4BRCA 4BWJA 3V9SA 1K6YA 4JKAA 3AVGA 1JKHA 3MWTA 4MLEA 1RT4A 4CJUA 5EXWA 5CE3A 1NKBA 1E4FT 3PO4A 3L3UA 2FSJA 4ISEA 4LF9K 1CZAN 1SS6A 3THVA 4M42A 5BN8A 2R7YA 4C8MA 2YKMA 4M3UA 1U48A 3O80A 2P9IA 4XIUA 4FJMA 4M3YA 4PY5A 5KRTA 2YNFA 1JLFA 4Z4IA 3DOLA 3RRGA 1BIZA 2NRHA 5IT9O 3SLCA 3ZX2A 1K8KA 2O8CA 4H4OA 1L3UA 2Q36A 1I39A 3VESA 1NWKA 4CZEA 3K2PA 4CFCA 4NYFA 3SQ4A 1ZBHA 3PIOL 1BISA 1JJ2M 4CERA 1TAQA 1LOTB 3SMPA 4ID5A 3WQTA 3LP1A 3TSUA 3WXLA 3EN9A 4JHDB 3LWMA 1XNQK 4IFEA 4B9SA 4DTUA 3RSEA 2Y1JA 1KCFA 4RCHA 4BRMA 1WSHA 2FBVA 1WB9A 3KKSA 3LZJA 4FZZA 2FF6A 1S5JA 1GLDG 4ELUA 3MCAB 3ZSXA 1Z25A 3KJVA 3THYA 4H5VA 1S9EA 1FK9A 4GKJK 4AHRA 5JICA 1Q18A 1IO2A 4U67L 2RHKA 4FLUA 1LWEA 4ILJA 2KFZA 3CG7A 1ATNA 4DU3A 4HVJA 3THWB 4DR5K 3CJBA 2G8VA 3EE8A 3VQ7A 3A5NC 4DR2K 5AQQA 3D2EB 1IJJA 3MN6A 4DTOA 1KVCA 2QXLA 4H8KA 3SZ2A 1L3TA 4BRKA 1UOCA 2HHHK 5C2DA 2QWMA 4IEEA 3ZT4A 3CQ8A 1BL3A 3IFRA 3WXJA 1M1KO 2DY4A 2YHBA 1O1WA 4KI4A 1BO5O 2HF4A 2JGUA 3MMVA 3WEEB 3SUPA 3VMFB 1T8EA 2HB5A 5J2NA 1WLJA 3NGZA 1BDGA 5GADP 4FLXA 3UKUB 3MWPA 3LDPA 4CJQA 3L2VA 4YORA 1YUWA 3IS9A 4CHYA 3O8MA 3MK6A 4JYAK 1LWFA 3ISNC 3V1RA 3H3OB 4E19A 4KHWA 1IKVA 3DOKA 4C8KA 4IOXA 3WNGA 2OZMA 1A5WA 5FRNA 3IKMA 3QIPA 3VQ9A 4DV5K 5E41A 3VQPA 1XHZA 4FOEA 1F21A 1XWLA 3CJAA 2D0OA 3FE1A 4WFBL 3F5TA 2FSKA 5H1SQ 4M3WA 2BANA 4GV9A 1ZBFA 5AQFA 3JS6A 2DPNA 3CMEN 3V9ZA 3TARA 3KLHA 4OO1J 4C1NK 4A61A 5KGXA 5C25A 3SJHA 2NNWA 1M90O 3M5RA 3CI5A 3PSIA 1WOQA 3QDKA 5AFUH 4DS5A 1ZXOA 1K8KB 3F2KA 1D8YA 2E2PA 4LFAK 5C0YA 4YOYA 3I0RA 4BR7A 4EHTA 3ENBA 4JKFA 3C6TA 3SCXA 2HNZA 1V4SA 3LAKA 4JRQA 2WOMA 3FZMA 4KH4A 4MFBA 5JMVA 2BE2A 3HJFA 3ULEA 3HPHA 1KVBA 1DKGD 3C95A 3UB5A 4FYDA 4JI0K 2B5JA 4W5NA 1XC3A 4O8UA 4DCHA 4LH5A 2H3GX 4F3TA 4BQLA 1RGIA 4FK0A 4FK4A 3WXIA 4DSFA 4DSIA 4YOUA 5EX5A 5B8HA 3OYNA 4RTFD 4O0JA 3VF2A 3MXJA 1HPMA 4GV3A 4JNEA 4A5AA 1QQCA 4CJWA 4FM2A 3H1VX 1EX4A 4Z0UA 1TYQA 1YI2N 5JLFA 4KTQA 5KRSA 3SI6A 5LL6Z 3TPQA 2A1SA 4CZHA 4FWLA 1D4XA 2GV9A 1S3XA 1E4GT 3ULDA 3ZSWA 3OS0A 5M1QA 2RF2A 5M1FA 1GOBA 2EHGA 1RT6A 3AA5X 4F2RA 4EIAA 5DM7L 3GOIA 3O4QA 1LV5A 4JI7K 5I3UA 4ID1A 4DR7K 3ZEUA 2G8HA 5HP1A 2QWLA 5AQGA 4JKCA 1CZ9A 3CHWA 2Z1GA 3ZCMA 4A59A 4AM7A 4FCYA 4YNQA 3V1OA 3EY1A 4QS8A 2O8BB 1TKXA 1SV5A 2O8FB 3DI6A 4DFKA 1EQYA 1NK9A 4BROA 4CESA 4FM0A 3B6PA 1RILA 3VF6A 2W6LA 4CZLA 4B3MK 4OKEA 2X6SA 1X1PA 4DV0K 3CETA 5J2MA 4B1ZA 3R8EA 3WNFA 4Z94A 1P8ZA 3H46O 1NMDA 1WBDA 4B3SK 1HMVA 3DXKB 1L5UA 4BQZA 1VQ8N 4I2PA 2QKBA 1RT1A 3PUFA 4PHTX 3VERA 1TUYA 3ATUA 1QQOA 1RDUA 2IVPA 3TAQA 1VSEA 1W2BM 3CC7N 1HNXK 2P9UA 4YOWA 2E6LA 4BC2A 1VSKA 3VENA 4CEEA 3T69A 2D0CA 3NBPA 2E2NA 3O4WA 1DT9A 3KK7A 3RR8A 4B3OA 2CH6A 1D5AA 4JS5A 1X3MA 3HPOA 4HTLA 1HX1A 3THYB 2YHXA 3THWA 3MN9A 3F73A 1XUPO 1FKPA 5I9EB 4DUZK 3P31A 1N5YA 4GMJB 2D4WA 4ILGB 3MN5A 3NH0A 4H0PA 1CXUA 1OH7A 4FWMA 2GWKA 1D9DA 5AQMA 4MDAA 2KKZA 3ZSYA 4PL7A 3NGIA 1NGDA 2A1RA 3KHYA 4A5BA 1W9HA 1YITN 4GKKK 3O9TA 3AO5A 4PWDA 3HTVA 3AY9A 3IUCA 4CIEA 3DXMB 4NYNA 4AHCA 2F8TA 3HM8A 3DLBA 1Q81O 4X66K 2F9WA 1YVUA 2FBYA 4FL9A 1NOZA 4XEIA 4AHTA 4BRLA 1BI4B 2WFBA 4RG8A 3WUHA 4DU4A 5JENA 4KRFA 1ITGA 3A5MC 4KHNA 1JLEA 1BI4A 3ZT0A 4C8LA 4BVOA 3A8YA 4BDYA 1SUQA 4ISGA 1IBKK 4FJJA 1RBUA 3MDQA 1C1CA 4C1NI 1QQNA 4CBXA 3MAQA 4DR1K 2VGNA 3CF5L 1BCOA 3CJ7A 3AVFA 3OYBA 1NGGA 2OTJN 2IOCA 2P9IB 3PIPL 4JRPA 2P9PB 1VQPN 1WSEA 1CZBA 4BE1A 2IC3A 3L4QA 3OBYA 4L3QA 3T7ZA 1CLQA 3HSTB 4XH1A 3QETA 2HBMA 1NGHA 1J9AA 2HBLA 1WSJA 3C7NB 3D0PA 2QA4N 2RN2A 1UA0A 5LJVA 3U3YA 2RE2A 4CHPA 4CJ4A 3O9QA 1VSLA 4M63C 4B9VA 3CJCA 2E2OA 3FZHA 1RNHA 1C0FA 2QWNA 4FWNA 1ZBUA 3TWHA 4NLBA 1HNZK 1JLCA 4DV6K 4AQYK 1B92A 2HOEA 4F3OA 4PL8A 4L8RB 4DV7K 4BRGA 1S1WA 4QAGA 4EP4A 4FJLA 3G0ZA 2EWSA 4BRPA 2YKNA 5KI6A 4A62A 1T3VA 1RDWX 3QB0A 4RWTA 1ZBSA 3QICA 4FWPA 3EEQA 4BR2A 4JK9A 5C15A 4BR5A 4AF1A 3U6FA 2P9LB 3JXUA 4Z4GA 4CEOA 3M8PA 4FJ7A 2UXDK 2ZJPL 3AVJA 3CQYA 1HQEA 3SV4A 4DTSA 5LJWA 3VEWA 5BREA 2VWBA 3ZETB 3OYHA 2UUAK 4G9ZA 2Z1JA 5GINA 3L6QA 3DLHA 1KAXA 4CJEA 1Y97A 1HQUA 3FZKA 3T3FA 2EX3A 4CHZA 1NBWA 4DQ8A 1Z6RA 2I7NA 2XRIA 3K57A 3DJCA 1JLBA 2KQ2A 4B9UA 1NJIO 2P51A 4ELVA 2QTDA 4AH9A 1UA1A 1YXQA 3HPGA 2UU9K 4FZYA 3CCEN 3LPUA 2QWPA 3JAMO 5C10A 2P5OA 3EL2A 3SQ2A 3AVKA 3CPEA 1S9GA 2QW9A 3AO4A 4LFCK 2P9NB 4DFJA 2GX9A 3ZSQA 4CHQA 1Q82O 4HTUA 4DQRA 3TTFA 4J8FA 4BDZA 2OPPA 4C8OA 3RRHA 1NU0A 4FWSA 1TYQB 4I9QA 1FJGK 3VQAA 5AJ3K 4Y1DA 1VSHA 3AVMA 3CCUN 2W6KA 5HL7L 1BQNA 1Z05A 4JLHA 3DRPA 4BEBA 4AILC 3GG4A 4LFBK 2UUBK 1XMOK 1VQKN 3KTQA 2E4LA 5TKYA 3ATVA 4CEFA 3BUZB 3C65A 1WSFA 4H0YB 2P9KB 1BUPA 2KZMA 2J4RA 3VA0A 5AQSA 2HHSA 1SKWA 4Z4HA 3L8BA 3AA2A 5C2FA 3P4IA 3QFPA 2AJQA 1BGXT 2OZSA 2GBZA 2KHOA 4BDPA 1REVA 3OYEA 2Q1NA 1HJOA 3R6MA 3M8SA 5EU7A 5FLXO 5JVHL 2F4VK 4FVMA 4JI4K 4OPKA 3KIOA 4DTXA 1D9FA 1XMQK 2YJEA 2Q0UA 4CIGA 1NJYA 4DFPA 4LF8K 4CF0A 4KTZA 1GLFO 4DQQA 4BY9C 5BPLA 1RDCA 2YHWA 4KHQA 3ZSOA 1TL1A 2NUBA 4QS7A 2XY7A 4DF8A 3ZSZA 5FRMA 3AVIA 2Q0RA 3SNNA 1NGFA 3A5LC 5LMNK 3A0IX 5AQOA 4BE2A 4M3RA 5AQZA 5SWMA 3SUNA 1XC9A 2HHIA 3E9PA 1HPZA 3SUQA 2HNYA 1X9WA 2UXBK 1C0GA 5K14A 1VHXA 4CGIA 2AP1A 3IDHA 2HHVA 4GW6A 4FWQA 3HYFA 2HMIA 4JI2K 3SV3A 1HYSA 4CEQA 4F9OA 4B1XB 4PA1A 5F2RA 5AZJA 2GELA 1LAVA 5M1KA 5AQKA 3WNEA 3AO3A 3QEPA 1VQ9N 4GVEA 5FPMA 3KWGA 5AZJB 3VQCA 1QSLA 2JWKA 2WONA 3TSPA 4BRHA 4DQIA 3BZCA 1OH8A 4FVUA 4WYBA 3O5BA 1WAJA 4Z4FA 3O1BA 4IWVA 4DB3A 3WEEA 3K9JA 5C24A 1NK4A 1T7PA 3CFRA 3HP9A 2GTDA 4X65K 1RT5A 3CM6A 4Q5VA 3UKRB 4IFVA 4FOIA 4OJRA 3H45C 3EZWA 1ZBIA 4FJNA 4FZXC 1ASUA 1JXBA 4FJHA 4LF7K 3TABA 2KFNA 4CIFA 5CYQA 1S1VA 3O6WA 2UUCK 4N76A 3TAGA 2E1YA 4H0OA 1N8RO 3T1HK 1BQMA 2JLEA 2Z1IA 1B9DA 4DHYA 1U2VB 4XH5A 1NK5A 1C0MA 4H0XB 3OW2M 1KFDA 3CPWM 1JCGA 1HUXA 5FPDA 2VCPA 2A5XA 3GDQA 4IDKA 3DMJA 4KO0A 3SAGA 1U45A 4DR4K 2QI2A 1QE1A 3OYMA 4CJPA 1ZBLA 1KFSA 1HJRA 1IV0A 4CF1A 4W5RA 3FFIA 3DLRA 3U3GA 3AVCA 3MXIA 1YHQN 4FLTA 2Z1HA 2FC0A 3OA9A 4FJ9A 4CGGA 1TL3A 3GE1A 4HUGA 2NRZA 3OYKA 3KKRA 3PSFA 5DK5A 1J5OA 5BRHA 4CK1A 4HCBA 2GUPA 5JLHA 3BGRA 1TKZA 5GAGP 3I55N 4EAHD 3SPZA 4DV4K 1HNWK 2PY5A 5M1OA 4FPAA 4M3ZA 4KI6A 4B3RK 2ITMA 1LAWA 3VQEA 3THXB 4JKGA 3F9KA 2O8DB 1BHLA 2QKKA 4BECA 1HRHA 3S3OA 2LSNA 4GY2B 1VRUA 4ZTJA 4YDUC 4B9LA 1TKTA 4W5TA 4O4GA 5FPEA 3U9DA 4CJ7A 5FPNA 3FZLA 3ZYYX 4DSEA 2P9PA 3QBXA 2HW3A 1KLNA 4CECA 4DQSA 4DMNA 3V81A 4FWRA 4CF8A 3HVRA 2RKIA 3N4QA 4KV8A 3CCVN 4ELTA 4CJTA 3AAQA 5AQWA 5T7BA 4DTNA 1KAZA 4EZ6A 3HZ6A 5HROA 2HHXA 4WQ4A 1OVQA 3AVAA 5BPNA 1HKCA 1MWMA 1RT3A 4BVPA 4X62K 2Q2RA 2G8FA 2HVHA 1FXXA 1IG8A 1RBSA 5ELZA 3K5MA 4H5WA 3O9UA 4CZFA 4CZMA 2CGJA 5EOYA 1UAXA 1HKGA 3PX6A 4B8CA 2KLAA 4JHDA 1ZYQA 3P38A 4UQGA 4BRIA 1RFQA 5HRPA 3CMAN 4HCCA 1ASVA 1N34K 4NO7A 3QNNA 4Q0BA 1HKBA 2G8KA 3QNOA 1G15A 4CGJA 4YDUA 1S1TA 3VQBA 2IIRA 1KVAA 4BR9A 3CIPA 1I3AA 3KZBA 3M3ZA 4J2BA 3VEXA 3SMSA 4CEBA 3ZSVA 4BG9A 3TTDA 4DF4A 2ASOA 5KGWA 4ZHRA 3JSMA 3OYDA 1SQKA 4O0IA 4OPHA 3TAFA 3PO5A 3AAPA 4FLVA 3W0LA 3B6OA 3O3GA 1ATSA 1EXQA 1GOAA 3E9OA 2C1GA 3IMXA 2D0BA 3O1WA 1QTMA 3OYLA 4M7YA 2BUPA 4OPAA 1Y64A 2FXUA 1NKCA 3ITHA 1HNVA 3D2FA 3TU5A 3DLEA 4FJIA 3KD5E 1CXQA 1NJXA 3S41A 2ZGYA 3KLIA 4E7IA 3CJ1A 3OYJA 3SYZA 1RBVA 1JLQA 1DTTA 4JD2A 5EVZA 4DV3K 5BRDA 2PAVA 4WFAL 4E0DA 4K8ZA 2ZM6K 3ZT1A 1A5VA 2GEMA 4KHUA 3QIOA 3CC2N 1T44A 4KH6A 4CJKA 4FWKA 2Q31A 2KW4A 2VG5A 3OVNA 4FWOA 4O5BA 3V4IA 3KVGA 5AFUA 3SAFA 4AM6A 1J6ZA 1EWRA 4OPJA 3LANA 2Y1IA 1NKEA 3G25A 1HNIA 4CFDA 3LALA 2F7TA 4R5PA 3CYGA 4CJ3A 4K8XA 4RW4A 3HT3A 2I7PA 4JI6K 5AQPA 3CFPA 5GAEP 2E1ZA 3ASMA 4YY3K 3AO1A 4O8KA 5GAHP 1EO1A 2P9SA 4NXMK 4DTPA 4DSLA 2XY5A 1GOCA 1T6CA 2VG7A 4KREA 2NZTA 2O8EB 4B1VA 1LW0A 3L0QA 4AHSA 1NNEA 3OJUA 3HO1A 1SL0A 1FW6A 3VEVA 4DSKA 5AQRA 1YF5L 2O8CB 4CD1A 3B8AX 1NGCA 1KXPA 4UY8O 3OTOK 4IEIA 4CK3A 1KLMA 4J2EA 4G1QA 2HSTA 2O8BA 1OVYA 3P1GA 2HF3A 4H5TA 3L4IA 3SQ0A 4AHUA 2OTLN 1LWCA 2XHBA 2D0AA 1NG9A 1RTHA 3L2UA 1G99A 5MLCQ 3VQ5A 4FM1A 3VEYA 1MWKA 2P5GA 2YCHA 3J7YP 4F2SA 4KPYA 3NF6A 4JKGB 1TK8A 1W7AA 4FJ8A 1N32K 5HOOA 5M1NA 4K43A 2HBJA 3QEVA 1SKSA 4IG0A 1OH6A 2E8AA 3BZKA 4K41A 3DXKA 5BR8K 4MDBA 3THXA 5AQHA 1BCMA 5GIPA 1HLUA 4OKJA 2V52B 4HHTA 1JLAA 2C1IA 4LF4K 1ESVA 1RBRA 1VQMN 2ITGA 3AVNA 1IKWA 5BRFA 4DS4A 3RVCA 3M6GA 4MLHA 3C0BA 2ZWHA 1VQNN 3KK1A 4A2BA 3K9KA 2WUSA 2G8IA 5AQNA 4B3TK 2Q97A 1EP4A 3DM2A 5SZTA 2D5RA 2HHUA 1J53A 4LH4A 2IS3A 1VSJA 2W41A 3VQ6A 3V1QA 2WC9A 4CFBA 4BACA 4FSVA 2IAJA 3RR7A 1KSPA 3QEXA 4GV6A 1OKJA 2O8DA 3G6EN 2ZJRL 1T6DA 4Z4CA 4W5QA 3CJ9A 2NRTA 1NM1A 1NJZA 1NGAA 1J54A 4O5FA 4BR0A 1QQMA 4IJAA 4BRAA 3UKRA 4YFUA 1SKRA 2ZD1A 3EE9A 3RWUA 2IGIA 1MDUB 3VQQA 3D2EA 3QLHA 1YJ9N 1RT7A 3UIQA 3R1XA 5AQTA 3QINA 5KTQA 4N56A 3BEXA 2QWRA 1HR0K 4DFMA 3O9RA 4N41A 2NLXA 3DRRA 1QS4A 3TAPA 3QEIA 2OPRA 1RTIA 3AGRA 1VQLN 4K25A 3MX5A 1ZC6A 2P1JA 1DGKN 3ID8A 3L2RA 5I42A 4U7BA 1C6VA 2PZSA 4B08A 4E1NA 3LDOA 5HRRA 1GLEG 3CXCM 4RW6A 1IH7A 2HHWA 3GBTA 3I56N 4M45A 3UKUA 1YAGA 4BREA 2PFUA 1SL1A 4IG3A 1YIJN 4N5SA 4EFHA 3LDSA 2E2QA 3RTVA 2OCEA 2G8WA 3TI0A 4YHHK 4DSJA 4KHPK 1VK0A 3FZFA 4N47A 2VQEK 1C0TA 5BR9A 4Y0WA 1GLLO 3DXMA 4DLGA 2GUIA 4RW8A 4XH4A 3EO3A 4OKKA 3NVMA 5AQJA 2PYLA 4HUFA 1IG9A 4JV5K 4MO5A 3NDKA 5FDLA 5C42A 1HYVA 4DG1A 3BP8A 4GVMA 2NRXA 3OYCA 1L3SA 4BE0A 2HHQA 4JK8A 4EP5A 2HVIA 1XQSC 3AGKA 2FBTA 5CZ1A 4E89A 2O4GA 3W3DA 3FFKB 3AV9A 4FLWA 5AQIA 2GWJA 2OYQA 2E6MA 1Q8IA 4CCHA 2A41A 4AHVA 4IXCA 2QWQA 1VSIA 3RMBA 2IVOA 5HRSA 3PX0A 1E3MA 4CJ5A 3IAYA 3NH2A 3QERA 3OHRA 3J81O 3HRGA 3M1FA 3H08A 2XY8A 3VEZA 3G71N 4B9MA 1WNSA 5BPMA 5ADXA 3H1QA 4OLAA 4M3XA 3LP2A 4CJRA 3CCLN 1BG3A 3ID6A 4R79A 2NRWA 1GLBG 2X6NA 4K42A 2YNGA 3MEDA 4YOTA 1R59O 4BG8A 4KB0A 3ENHA 1W97L 3QESA 5AZIB 1VQ5N 3AARA 2P9NA 4LSNA 2UXCK 3TAEA 3P5JA 2OPSA 3PV8A 2KZZA 3J8AA 3NAEA 1NGBA 4ISFA 4CI6A 3OS2A 2QEXN 3ZT2A 2ATQA 2CGLA 3SJJA 4V19S 2BH1A 4C23A 2JWLA 4FPBA 4BC3A 5A2QO 4CBUA 4KAZA 3S3MA 2YJFA 3J7AP 2ETJA 3C94A 2XY6A 3DRSA 4NCAA 3E9LA 4J2AA 1S1XA 4JAXA 2YI1A 5AR0A 3V9WA 4CZGA 1TAUA 3QFUA 2RPIA 4E72A 2W00A 3O08A 4YOVA 4IOCL 1RCHA 1YTAA 5F0XA 4CF9A 2HNDA 2FF3B 3NF7A 4NB4A 3RSEB 4BE7B 1QVGM 2OA8A 3DLLL 3OS1A 4JKDA 4WE1A 1XI1A 4JD2B 1TV6A 3MX2A 1QZ6A 1U04A 3O3HA 3LZIA 1XHXA 4I9LA 3V9XA 3CCMN 3NF9A 1BU6O 1GLCG 2CGKA 1S6QA 4F8RA 4B8AB 3D6RA 4E7LA 4JI8K 5DMRA 3N4PA 3S5TA 1BA0A 3K58A 2B4JA 4E7JA 1SL2A 1YTUA 3R9PA 3FLCO 3SK3A 2YNIA 4OGCA 4JEPA 4CEAA 3RMCA 3AVBA 1X9JA 1TUUA 2O4IA 3CCQN 1JCFA 1MU2A 3HOTA 1K9MO 2VWJA 4DUYK 1MA9B 4FJKA 3ZX0A 1RTDA 1JL2A 4X64K 4MO4A 2QK9A 4WF9L 3T1YK 5CYMA 5BN9A 2W40A 4B9NA 4LF6K 3FGUA 3HXMA 1NGIA 3JYTA 1EKEA 3V9UA 3WT0A 2PYJA 4NLCA 4PKGA 2VYPA 3OYIA 4CVNE 3NE6A 1LW2A 1Q9XA 4IO9L 3AVHA 4CGFA 3LDNA 3LWLA 4H5NA 2A3ZA 3HOSA 4DTRA 5J2PA 1UWBA 4JN4A 2QM1A 3SBGA 3KLEA 4CEDA 1YT3A 4CZIA 3U8XA 3K0SA 5KPZA 1QHTA 5GIOA 4FO0A 1U6ZA 1T03A 4C8NA 1ASWA 4DR3K 4DTMA 3VGKA 2ZQBA 4QCLA 4FW1A 3TANA 1QHAA 4CGDA 4CD3A 5JS2A 1BOTO 4IO8A 3VQDA 3PLAA 1VSMA 1TKDA 3T1AA 3NCIA 4H0TB 3SQ1A 3QBWA 4B1WB 2FLOA 4BGAA 4JI1K 5CHIA 3ZT3A 2O8FA 3A5OC 3AO2A 3O9SA 3VPZA 1W0HA 4JKBA 3MN7A 1C0UA 5TKWA 3EKSA 4FLYA 1RBTA 5M1PA 2YV0X 3IG1A 4F4KA 3R3LA 2W42A 1U47A 3WXKA 4A57A 4BGBA 3QMLA 3L2WA 4HUEA 3K5NA 4CHOA 3ZETA 4PUOA 1R0AA 1U49A 5AQVA 4O44A 4M41A 3VETA 3MECA 4B9QA 3CCJN 1S1UA 2ASPA 4FW2A 2F96A 3H3NO 4H4MA 1KAYA 2HMPA 1RDAA 5AQUA 1Q9YA 3ALYA 4XJXA 4GNIA 3CFOA 4OVLA 2AA4A 1P90A 1N36K 3UE5A 3HK2A 3IRXA 4PQUA 1BIUA 2YX6A 1JLGA 3P39A 1YJWN 3WQUA 4KBOA 3I33A 4LY7A 1JCEA 4JKHA 1H1VA 1ATRA 3CCRN 4O55A 3G4SN 1QSYA 3D45A 4BWMA 3RMDA 4DQPA 2ZE2A 4CZKA 2D1KA 4IOAL 4OLBA 4RW7A 1WN7A 3KWIA 1Z26A 5E26A 5KPTA 3KLGA 4B1YB 1T05A 4CE9A 3TAMA 4DWIA 4WQ5A 4LSLA 4NCGA 3KK2A 4PKIA 3QEWA 3ZEUB 4TSXA 1S22A 1DTQA 2E5LK 4KFBA 3ENOA 2DFEA 4JI5K 1WUAA 1SZ2A 3LDQA 1JXEA 3NHGA 4E3SA 1NLVA 3HL8A 3LP0A 1NK8A 4NCBA 2CH5A 3EZ5A 1QVFM 1BA1A 1VRTA 1GLJO 2BGGA 1TVRA 4I7FA 3HP6A 3DAWA 4WCEL 5C12A 3CCSN 3I8DA 1HYZA 2ZF5O 1WBBA 3MEGA 2V51B 5JVGL 3V6DA 4JI3K 5CY4A 1VQ7N 1YVNA 5E84A 4FJ5A 2A42A 4FK2A 1VQ4N 4CBWA 3HSCA 3E66A 1X9MA 4B9TA 3AVLA 4QS9A 1GLAG 4I6MA 1LCUA 5KPRA 4DLEA 2UYTA 4IJNA 3VGMA 3CERA 4JS4A 1I94K 3K5LA 1S72N 1WSIA 3H6EA 5LY3A 2VWKA 5CR4A 3TTCA 4W5OA 1U2VA 2ZJQL 2VQFK 3K5OA 1N6QA 1C1BA 2IVNA 3DYAA 1IKYA 4IBNA 4WQ5C 2HHTA 3PY8A 2ZGZA 3LAMA 3U9ZA 4FXDA 1RDBA 1NMNA 2E20A 1NK0A 3S9HA 2V7ZA 1RTJA 3QO9A 1DLOA 3S3NA 3O4NA 2YHYA 3F9MA 4BRQA 3OYGA 3C6UA 4DU1A 3C6HA 4CW7B 3AA4A 2WTUA 1DEJA 3I8BA 3NGYA 3VEOA 3T19A 3EYZA 5AZIA 3K59A 1A5XA 3TSQA 3VN5A 2IDOA 3HVTA 3C7NA 1Q86O 3MCPA 4CZJA 1ILYA 1BWFO 4KHYA 3VA3A 5J2QA 5CZ2A 3CD6N 4EHUA 4OX9K 1NGEA 1YJNN 4WFNL 3MEEA 1TGOA 1J5EK 2BDPA 4KH5A 2QWOA 2X74A 3VQ4A 1OH5A 4JKEA 4IDHA 3M8RA
chains in the Genus database with same CATH topology
4HWIA 3GOIA 3SAGA 4I6MB 4DKWA 2P9LA 4MO5A 2QI2A 3LL3A 4LC9B 2V7YA 3VGLA 3FR0A 3ZEUA 3E1YA 1X3NA 3BP8A 3DWLA 2QWLA 5AQGA 4JKCA 2NRXA 3CHWA 1YHQN 1O13A 4JK8A 5KPRA 1VQON 4A59A 4AM7A 3J7ZO 3OA9A 4PKHA 4ILHA 1K8AO 3CC4N 3GE1A 4QS8A 1XQSC 2NRZA 3AGKA 3VTIA 2A6AA 2A40A 3OBWA 5BRHA 3W3DA 2GUPA 3FFKB 5JLHA 2PBDA 5GAGP 3I55N 4EAHD 1EQYA 5AQIA 2GWJA 4BROA 2A41A 3Q7BA 4IXCA 2P9SB 2NRVA 5M1OA 2QWQA 5AQYA 4FPAA 5AQLA 3VF6A 2IVOA 1KQSM 4CZLA 2ITMA 4JKGA 3CETA 2F9TA 3OHRA 4B1ZA 3BF3A 3HRGA 4BECA 3M1FA 3R8EA 4GY2B 4Z94A 1P8ZA 4YDUC 3VEZA 3G71N 5BPMA 3H46O 5ADXA 1NMDA 3H1QA 2VGMA 5FPEA 4JK7A 3DXKB 3CCLN 1BG3A 3ID6A 3GL1A 3U9DA 4BQZA 1VQ8N 4PHTX 3Q7CA 4R79A 3VERA 1TUYA 2NRWA 1GLBG 1QQOA 1RDUA 2IVPA 3ATUA 3FZLA 4K42A 5FPNA 4CJ7A 3ZYYX 4YOTA 3HI0A 1W2BM 2P9PA 3QBXA 3CC7N 1R59O 4BC4A 4BG8A 3ENHA 5DM6L 2P9UA 1W97L 4YOWA 5AZIB 1VQ5N 1Q7YO 3AARA 2P9NA 4BC5A 4FWRA 4BC2A 2D0PA 2P9KA 4YOXA 3VENA 3J8AA 3N4QA 1NGBA 4ISFA 3T69A 2HBKA 1VAZA 3SBTA 4CI6A 5KQ8A 2QEXN 3CCVN 3AAQA 2CGLA 5AQWA 1KAZA 2E2NA 2BH1A 4C23A 2JWLA 4FPBA 3O4WA 4BRDA 1DT9A 3HZ6A 3KK7A 4B1UB 4WQ4A 4BC3A 4CBUA 2OANA 1NGJA 2YJFA 2CH6A 4BRFA 1HKCA 1V4TA 5BPNA 1MWMA 3D2FB 3E9LA 1X3MA 2P9UB 4JAXA 5F1XA 4HTLA 4BVPA 2Q2RA 1HX1A 2YI1A 5AR0A 5ADXH 2YHXA 4CZGA 3MN9A 3HBTA 1IG8A 1XUPO 3QFUA 5ELZA 5I9EB 3O08A 4H5WA 2W00A 2ASMA 3P31A 4YOVA 3O9UA 2D4WA 4CZMA 4CZFA 4IOCL 2CGJA 4ILGB 3MN5A 3ULEB 4H0PA 5EOYA 1KD1O 3LM2A 3NMUA 1HKGA 2KLAA 4JHDA 4FWMA 3P38A 2GWKA 5F0XA 3VF4A 2FF3B 5AQMA 4MDAA 4BRIA 1RFQA 2KKZA 3C6AA 3SAHA 4NB4A 3CMAN 1VQ6N 3RSEB 5M1KA 4PL7A 1NGDA 4NO7A 4BE7B 3KHYA 4A5BA 1HKBA 4H03B 1YITN 1QVGM 3DLLL 3O9TA 3ZX3A 4JKDA 5KQDA 2E88A 3CQXA 4JD2B 3HTVA 3AY9A 3IUCA 4IZ9A 4YDUA 2IIRA 3DXMB 3MX2A 4BR9A 1QZ6A 4H5RA 3CIPA 3LM9A 3HM8A 3KZBA 3M3ZA 1Q81O 2F9WA 1K73O 4FL9A 4XEIA 3VEXA 3SMSA 4BRLA 3CCMN 2BTFA 2WFBA 1BU6O 3WUHA 3NVKA 1GLCG 4BG9A 3TTDA 2ASOA 3EKUA 3A5MC 2CGKA 3D6RA 1SQKA 3D7EO 4OPHA 2WBNA 1KC8O 4E1JA 3AAPA 3LDLA 3A8YA 3W0LA 4BVOA 3BF1A 3N4PA 1BA0A 1ATSA 3VTHA 3R9PA 4ISGA 3FLCO 3SK3A 3MDQA 5AQXA 4C1NI 1QQNA 4CBXA 3E9OA 4JEPA 2VGNA 1X9JA 3CF5L 3CJ7A 2C1GA 1TUUA 3IMXA 1SAZA 3O1WA 1NGGA 3CCQN 1JCFA 4H0VB 2OTJN 2P9IB 4M7YA 3HOTA 2BUPA 4OPAA 1Y64A 3PIPL 2FXUA 2P9PB 1VQPN 1K9MO 1MA9B 3D2FA 3L4QA 3OBYA 3TU5A 4L3QA 3T7ZA 3ZX0A 4A2AA 4MO4A 2NRRA 4M7XA 4XH1A 3S41A 2ZGYA 2HBMA 4WF9L 1NGHA 4BRNA 3CJ1A 2W40A 2HBLA 5BN9A 4JD2A 5EVZA 3FGUA 4BR4A 2FSNA 3C7NB 2QA4N 1NGIA 5BRDA 2PAVA 4WFAL 3WT0A 5LJVA 2RE2A 3O9QA 4M63C 4NLCA 4PKGA 2VYPA 3CJCA 2E2OA 4WQ4C 3WXMB 3FZHA 4IO9L 2GEMA 5EY4A 1C0FA 2QWNA 3LDNA 4FWNA 4NLBA 4H5NA 3CC2N 1QZ5A 1T44A 4KH6A 2A3ZA 4FWKA 2Q31A 3U4LA 2HOEA 3VOVA 3HOSA 4JN4A 4BRCA 2QM1A 3SBGA 4PL8A 4JKAA 4FWOA 4BRGA 3MWTA 4MLEA 4CZIA 5EXWA 5CE3A 3KVGA 1E4FT 5AFUA 3U8XA 4ISEA 2FSJA 2EWSA 4A62A 4BRPA 5KPZA 1CZAN 1SS6A 1T3VA 1RDWX 3QB0A 4AM6A 3SAFA 1J6ZA 5BN8A 1ZBSA 3QICA 4RWTA 5GIOA 4FO0A 1U6ZA 4FWPA 4BR2A 4JK9A 5C15A 3O80A 3VGKA 4BR5A 2P9IA 4AF1A 3G25A 2P9LB 3JXUA 2F7TA 1QHAA 4CD3A 1BOTO 4IO8A 3CQYA 2ZJPL 2I7PA 3PLAA 5AQPA 2NRHA 5GAEP 2E1ZA 3SLCA 5LJWA 3VEWA 5BREA 3ZX2A 1K8KA 2VWBA 4H0TB 4O8KA 3ZETB 3QBWA 5GAHP 4B1WB 4G9ZA 1EO1A 5GINA 2P9SA 3L6QA 1KAXA 2FLOA 2Q36A 4BGAA 3VESA 1NWKA 4CZEA 3FZKA 5CHIA 1NBWA 1T6CA 4DQ8A 1Z6RA 3A5OC 2I7NA 3PIOL 3DJCA 3O9SA 3VPZA 1JJ2M 1LOTB 4JKBA 3SMPA 1NJIO 2NZTA 3MN7A 5TKWA 2QTDA 3WQTA 4B1VA 3TSUA 3EKSA 3EN9A 4JHDB 5M1PA 3L0QA 3WXLA 3R3LA 4IFEA 1YXQA 3WXKA 4A57A 4BGBA 3QMLA 3CCEN 3VEVA 3RSEA 5AQRA 4RCHA 4BRMA 2QWPA 5C10A 1YF5L 3ZETA 4CD1A 3B8AX 3EL2A 5AQVA 3VETA 4B9QA 3CCJN 2FF6A 2ASPA 1NGCA 3CPEA 4B1XB 1KXPA 4UY8O 2QW9A 4IEIA 2P9NB 3H3NO 2GX9A 1KAYA 2HMPA 1GLDG 1Q82O 2HSTA 3MCAB 5AQUA 4J8FA 3TTFA 1OVYA 2HF3A 4H5TA 3L4IA 4FWSA 4H5VA 1TYQB 5JICA 4XJXA 1Q18A 4U67L 2RHKA 4GNIA 2OTLN 4ILJA 2AA4A 1P90A 1G99A 1ATNA 5MLCQ 3CCUN 3UE5A 3VEYA 3CJBA 1MWKA 5HL7L 3EE8A 3A5NC 2YX6A 2YCHA 5AQQA 3D2EB 1IJJA 3P39A 1Z05A 1YJWN 3MN6A 3WQUA 4KBOA 2QXLA 3I33A 4BEBA 4JKGB 1JCEA 3GG4A 4JKHA 1H1VA 1VQKN 4BRKA 1ATRA 3CCRN 5TKYA 3ATVA 5HOOA 5M1NA 4K43A 2HBJA 3G4SN 5C2DA 2QWMA 3C65A 3BUZB 4H0YB 4IEEA 2E8AA 2P9KB 1BUPA 4CZKA 2J4RA 2D1KA 4IOAL 4K41A 5AQSA 3DXKA 3IFRA 3WXJA 1M1KO 3KWIA 5E26A 4MDBA 5KPTA 5C2FA 3P4IA 5AQHA 3QFPA 5GIPA 1HLUA 2V52B 1BO5O 2HF4A 3MMVA 4B1YB 2C1IA 2KHOA 3WEEB 3VMFB 1ESVA 1HJOA 2Q1NA 3R6MA 5JVHL 4WQ5A 1VQMN 1BDGA 5GADP 3UKUB 3MWPA 3LDPA 4PKIA 4YORA 1YUWA 2YJEA 3ZEUB 1S22A 2Q0UA 5BRFA 3O8MA 3MK6A 3ENOA 3RVCA 3M6GA 4MLHA 1WUAA 3C0BA 1SZ2A 2ZWHA 3H3OB 1GLFO 1VQNN 3LDQA 4BY9C 5BPLA 4A2BA 3K9KA 4IOXA 2YHWA 2WUSA 1NLVA 5AQNA 2Q97A 2CH5A 3IKMA 4QS7A 1QVFM 1BA1A 1GLJO 2Q0RA 4FOEA 1NGFA 3A5LC 3A0IX 5AQOA 3DAWA 3CJAA 5AQZA 4WCEL 2D0OA 5C12A 3CCSN 3E9PA 3FE1A 2W41A 4WFBL 3F5TA 2FSKA 5H1SQ 1C0GA 2ZF5O 2WC9A 4GV9A 5AQFA 2V51B 5JVGL 3JS6A 4FSVA 2DPNA 3CMEN 2AP1A 4GV6A 4C1NK 1OKJA 4OO1J 3IDHA 4A61A 1VQ7N 1YVNA 5E84A 3G6EN 2ZJRL 4FWQA 3SJHA 2NNWA 1T6DA 2A42A 1M90O 3M5RA 1VQ4N 3CI5A 3HSCA 3E66A 4CBWA 3CJ9A 4F9OA 2NRTA 1NM1A 1WOQA 4QS9A 1GLAG 1NGAA 3QDKA 1ZXOA 5AFUH 1K8KB 4I6MA 1LCUA 3F2KA 4O5FA 2GELA 5F2RA 4BR0A 2UYTA 2E2PA 5AZJA 1QQMA 4IJAA 3CERA 4IJNA 5AQKA 3UKRA 3VGMA 3EE9A 4BRAA 5C0YA 1VQ9N 4YOYA 1MDUB 1S72N 4GVEA 4BR7A 3H6EA 5FPMA 3KWGA 4EHTA 5AZJB 3D2EA 3ENBA 4JKFA 1YJ9N 1V4SA 5LY3A 3R1XA 5AQTA 2JWKA 3FZMA 4KH4A 5CR4A 3BEXA 3TSPA 2QWRA 3TTCA 4BRHA 1U2VA 5JMVA 2ZJQL 4FVUA 3O9RA 3ULEA 4WYBA 3O5BA 2NLXA 3O1BA 2IVNA 4WQ5C 1DKGD 4IWVA 4DB3A 3UB5A 2ZGZA 3U9ZA 3WEEA 1XC3A 3K9JA 4O8UA 2E20A 4DCHA 2GTDA 3AGRA 1VQLN 2H3GX 2V7ZA 1ZC6A 3MX5A 4K25A 1DGKN 3ID8A 4U7BA 3UKRB 4BQLA 2YHYA 3F9MA 4FOIA 1RGIA 4BRQA 3LDOA 3H45C 1GLEG 3EZWA 3CXCM 3C6HA 3WXIA 3GBTA 1DEJA 3I8BA 4YOUA 5EX5A 5B8HA 3VEOA 4RTFD 3I56N 4BREA 3UKUA 1YAGA 3VF2A 1HPMA 4GV3A 2PFUA 4JNEA 5AZIA 4A5AA 3O6WA 3H1VX 3TSQA 1TYQA 1YI2N 5JLFA 2E1YA 1YIJN 3C7NA 4H0OA 1Q86O 4EFHA 2E2QA 3MCPA 1N8RO 4CZJA 1ILYA 3TPQA 4CZHA 1BWFO 1D4XA 4FWLA 4DHYA 1U2VB 4XH5A 1S3XA 3CD6N 4EHUA 4H0XB 3OW2M 1NGEA 1E4GT 3FZFA 3CPWM 1JCGA 1HUXA 5FPDA 1YJNN 2VCPA 5BR9A 2A5XA 4WFNL 5M1QA 4Y0WA 1GLLO 3DXMA 3GDQA 3EO3A 4XH4A 4KH5A 2QWOA 5M1FA 4JKEA 3NVMA 5AQJA 4IDHA 4EIAA 5DM7L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWI A;  3GOI A;  4I6M B;  2P9L A;  4MO5 A;  3LL3 A;  4LC9 B;  2V7Y A;  3VGL A;  3FR0 A;  3ZEU A;  1X3N A;  3BP8 A;  3DWL A;  2QWL A;  5AQG A;  3CHW A;  4AM7 A;  4PKH A;  3GE1 A;  4QS8 A;  1XQS C;  2A6A A;  2A40 A;  5BRH A;  3W3D A;  2GUP A;  3FFK B;  5JLH A;  2PBD A;  4EAH D;  1EQY A;  5AQI A;  2GWJ A;  4BRO A;  2A41 A;  4IXC A;  2P9S B;  2QWQ A;  5AQY A;  4FPA A;  5AQL A;  3VF6 A;  2IVO A;  4CZL A;  2ITM A;  3CET A;  2F9T A;  3OHR A;  4B1Z A;  3BF3 A;  3M1F A;  3R8E A;  4GY2 B;  4Z94 A;  1P8Z A;  4YDU C;  3VEZ A;  5BPM A;  3H46 O;  5ADX A;  1NMD A;  3H1Q A;  5FPE A;  3DXK B;  1BG3 A;  4BQZ A;  3GL1 A;  3U9D A;  3VER A;  1TUY A;  1GLB G;  1QQO A;  2IVP A;  3ATU A;  3FZL A;  5FPN A;  4K42 A;  4CJ7 A;  3HI0 A;  2P9P A;  3QBX A;  1R59 O;  4BC4 A;  4BG8 A;  3ENH A;  2P9U A;  5AZI B;  3AAR A;  2P9N A;  4BC5 A;  4FWR A;  4BC2 A;  2D0P A;  2P9K A;  3VEN A;  3J8A A;  1NGB A;  4ISF A;  4CI6 A;  5KQ8 A;  3AAQ A;  2CGL A;  5AQW A;  1KAZ A;  2E2N A;  4C23 A;  4FPB A;  4BRD A;  3O4W A;  3HZ6 A;  4BC3 A;  4B1U B;  4WQ4 A;  4CBU A;  2OAN A;  1NGJ A;  2YJF A;  2CH6 A;  4BRF A;  1HKC A;  1V4T A;  5BPN A;  1MWM A;  3D2F B;  5F1X A;  1X3M A;  2P9U B;  4JAX A;  4HTL A;  4BVP A;  2Q2R A;  1HX1 A;  2YI1 A;  5AR0 A;  5ADX H;  2YHX A;  4CZG A;  3MN9 A;  3HBT A;  1IG8 A;  1XUP O;  3QFU A;  5ELZ A;  5I9E B;  3O08 A;  4H5W A;  2ASM A;  4CZF A;  2D4W A;  4CZM A;  2CGJ A;  3MN5 A;  3ULE B;  4H0P A;  5EOY A;  3LM2 A;  1HKG A;  4JHD A;  4FWM A;  2GWK A;  5F0X A;  3VF4 A;  2FF3 B;  5AQM A;  4BRI A;  1RFQ A;  4NB4 A;  3RSE B;  4PL7 A;  1NGD A;  4NO7 A;  3KHY A;  1HKB A;  4H03 B;  3ZX3 A;  5KQD A;  2E88 A;  3CQX A;  4JD2 B;  3HTV A;  3AY9 A;  3IUC A;  4IZ9 A;  4YDU A;  2IIR A;  3DXM B;  4BR9 A;  1QZ6 A;  4H5R A;  3CIP A;  3LM9 A;  3HM8 A;  3KZB A;  3M3Z A;  2F9W A;  4FL9 A;  4XEI A;  3VEX A;  3SMS A;  4BRL A;  2BTF A;  1BU6 O;  3WUH A;  1GLC G;  4BG9 A;  2ASO A;  3EKU A;  3A5M C;  2CGK A;  1SQK A;  3D7E O;  4E1J A;  3AAP A;  3LDL A;  3A8Y A;  3W0L A;  4BVO A;  3BF1 A;  1BA0 A;  1ATS A;  3R9P A;  4ISG A;  3FLC O;  3SK3 A;  3MDQ A;  5AQX A;  1QQN A;  4CBX A;  1X9J A;  3CJ7 A;  1TUU A;  3IMX A;  1SAZ A;  3O1W A;  1NGG A;  1JCF A;  4H0V B;  2P9I B;  4M7Y A;  2BUP A;  1Y64 A;  2FXU A;  2P9P B;  1MA9 B;  3D2F A;  3TU5 A;  4L3Q A;  3ZX0 A;  4A2A A;  4MO4 A;  4XH1 A;  4M7X A;  3S41 A;  2ZGY A;  1NGH A;  4BRN A;  3CJ1 A;  2W40 A;  5BN9 A;  4JD2 A;  5EVZ A;  3FGU A;  4BR4 A;  2FSN A;  3C7N B;  1NGI A;  5BRD A;  2PAV A;  3WT0 A;  5LJV A;  4M63 C;  4PKG A;  2VYP A;  3CJC A;  2E2O A;  4WQ4 C;  3FZH A;  2GEM A;  5EY4 A;  1C0F A;  2QWN A;  3LDN A;  4FWN A;  4H5N A;  1QZ5 A;  1T44 A;  2A3Z A;  4FWK A;  2Q31 A;  3U4L A;  2HOE A;  3VOV A;  4JN4 A;  4BRC A;  2QM1 A;  4PL8 A;  4FWO A;  4BRG A;  4MLE A;  4CZI A;  5EXW A;  5CE3 A;  3KVG A;  1E4F T;  5AFU A;  3U8X A;  4ISE A;  2FSJ A;  2EWS A;  4A62 A;  4BRP A;  5KPZ A;  1CZA N;  4AM6 A;  3QB0 A;  1RDW X;  4RWT A;  1J6Z A;  5BN8 A;  1ZBS A;  3QIC A;  4FO0 A;  1U6Z A;  4FWP A;  4BR2 A;  3O80 A;  3VGK A;  4BR5 A;  2P9I A;  3G25 A;  2P9L B;  3JXU A;  1QHA A;  4CD3 A;  1BOT O;  4IO8 A;  3CQY A;  2I7P A;  5AQP A;  2NRH A;  2E1Z A;  3SLC A;  5LJW A;  3VEW A;  5BRE A;  3ZX2 A;  1K8K A;  2VWB A;  4H0T B;  4O8K A;  3ZET B;  3QBW A;  4B1W B;  2P9S A;  3L6Q A;  1KAX A;  2FLO A;  2Q36 A;  4BGA A;  3VES A;  1NWK A;  4CZE A;  3FZK A;  1NBW A;  1T6C A;  4DQ8 A;  1Z6R A;  3A5O C;  2I7N A;  3DJC A;  3VPZ A;  1LOT B;  3SMP A;  2NZT A;  3MN7 A;  3WQT A;  4B1V A;  3EKS A;  3EN9 A;  4JHD B;  3WXL A;  3L0Q A;  1YXQ A;  3WXK A;  4BGB A;  3QML A;  3VEV A;  3RSE A;  5AQR A;  4RCH A;  4BRM A;  2QWP A;  3ZET A;  4CD1 A;  3B8A X;  3EL2 A;  5AQV A;  3VET A;  4B9Q A;  2FF6 A;  2ASP A;  1NGC A;  4B1X B;  1KXP A;  2QW9 A;  2P9N B;  3H3N O;  1KAY A;  2HMP A;  1GLD G;  5AQU A;  4J8F A;  2HF3 A;  4H5T A;  3L4I A;  4FWS A;  4H5V A;  1TYQ B;  5JIC A;  1Q18 A;  4GNI A;  2AA4 A;  1G99 A;  1ATN A;  3UE5 A;  3VEY A;  3CJB A;  1MWK A;  3A5N C;  5AQQ A;  2YCH A;  3D2E B;  1IJJ A;  1Z05 A;  3MN6 A;  3WQU A;  4KBO A;  2QXL A;  3I33 A;  1JCE A;  3GG4 A;  1H1V A;  4BRK A;  1ATR A;  5TKY A;  3ATV A;  4K43 A;  2QWM A;  3BUZ B;  4H0Y B;  2E8A A;  2P9K B;  1BUP A;  4CZK A;  2J4R A;  2D1K A;  4K41 A;  5AQS A;  3DXK A;  3IFR A;  3WXJ A;  5E26 A;  5KPT A;  3P4I A;  5AQH A;  3QFP A;  1HLU A;  2V52 B;  1BO5 O;  2HF4 A;  3MMV A;  4B1Y B;  2KHO A;  3WEE B;  1ESV A;  1HJO A;  2Q1N A;  3R6M A;  4WQ5 A;  1BDG A;  3UKU B;  3LDP A;  4PKI A;  1YUW A;  2YJE A;  3ZEU B;  1S22 A;  2Q0U A;  5BRF A;  3O8M A;  3MK6 A;  3ENO A;  3M6G A;  4MLH A;  1WUA A;  3C0B A;  1SZ2 A;  2ZWH A;  3H3O B;  1GLF O;  3LDQ A;  5BPL A;  4A2B A;  2YHW A;  2WUS A;  1NLV A;  5AQN A;  2Q97 A;  2CH5 A;  4QS7 A;  1BA1 A;  1GLJ O;  2Q0R A;  4FOE A;  1NGF A;  3A5L C;  3A0I X;  5AQO A;  3DAW A;  3CJA A;  5AQZ A;  2D0O A;  3FE1 A;  2W41 A;  2FSK A;  1C0G A;  2ZF5 O;  5AQF A;  2V51 B;  3JS6 A;  4FSV A;  2DPN A;  2AP1 A;  1OKJ A;  3IDH A;  4A61 A;  1YVN A;  5E84 A;  4FWQ A;  3SJH A;  1T6D A;  2A42 A;  3CI5 A;  3HSC A;  4CBW A;  3CJ9 A;  4F9O A;  1NM1 A;  1WOQ A;  4QS9 A;  1GLA G;  1NGA A;  3QDK A;  1ZXO A;  5AFU H;  1K8K B;  4I6M A;  1LCU A;  4O5F A;  5F2R A;  2GEL A;  4BR0 A;  5AZJ A;  2UYT A;  2E2P A;  5KPR A;  1QQM A;  4IJA A;  3CER A;  4IJN A;  5AQK A;  3UKR A;  3VGM A;  4BRA A;  1MDU B;  4BR7 A;  3H6E A;  5FPM A;  4EHT A;  5AZJ B;  3D2E A;  1V4S A;  5LY3 A;  5AQT A;  3FZM A;  3BEX A;  4BRH A;  2QWR A;  1U2V A;  5JMV A;  3ULE A;  4WYB A;  3O5B A;  2NLX A;  3O1B A;  2IVN A;  4WQ5 C;  1DKG D;  4IWV A;  4DB3 A;  3UB5 A;  2ZGZ A;  3U9Z A;  3WEE A;  1XC3 A;  2E20 A;  4DCH A;  2GTD A;  2H3G X;  2V7Z A;  1ZC6 A;  4K25 A;  1DGK N;  3ID8 A;  3UKR B;  4BQL A;  2YHY A;  3F9M A;  4FOI A;  1RGI A;  4BRQ A;  3LDO A;  3H45 C;  1GLE G;  3EZW A;  3WXI A;  3GBT A;  1DEJ A;  3I8B A;  5EX5 A;  5B8H A;  3VEO A;  4RTF D;  4BRE A;  3UKU A;  1YAG A;  3VF2 A;  1HPM A;  5AZI A;  4JNE A;  3O6W A;  3H1V X;  1TYQ A;  5JLF A;  2E1Y A;  3C7N A;  4H0O A;  4EFH A;  2E2Q A;  3MCP A;  4CZJ A;  3TPQ A;  4CZH A;  1BWF O;  1D4X A;  4FWL A;  4DHY A;  1U2V B;  4XH5 A;  1S3X A;  4EHU A;  4H0X B;  1NGE A;  1E4G T;  3FZF A;  1JCG A;  1HUX A;  5FPD A;  2VCP A;  5BR9 A;  2A5X A;  4Y0W A;  1GLL O;  3DXM A;  3GDQ A;  3EO3 A;  4XH4 A;  2QWO A;  5AQJ A;  4EIA A; 
#chains in the Genus database with same CATH topology
 4HWI A;  4I6M B;  4DKW A;  2P9L A;  3LL3 A;  4LC9 B;  5IWA K;  2V7Y A;  3VGL A;  3FR0 A;  3HM9 A;  3E1Y A;  1X3N A;  1FKO A;  4LD0 A;  5HRN A;  3DWL A;  1IKX A;  1KTQ A;  1O13 A;  1VQO N;  3J7Z O;  4PKH A;  3BDP A;  4ILH A;  2DTU A;  4DV1 K;  2O8E A;  1K8A O;  3CC4 N;  1XNR K;  3VTI A;  2A6A A;  2A40 A;  3OBW A;  4Y1C A;  4E7H A;  2PBD A;  2G8U A;  4J2D A;  1TK0 A;  4CFA A;  3OY9 A;  5J1E A;  5HBM A;  3KLF A;  4DR6 K;  1RDD A;  3Q7B A;  2P9S B;  2NRV A;  3BY5 A;  5AQY A;  1KQS M;  5AQL A;  3CM5 A;  4FJX A;  5JS1 A;  3OJS A;  3L2Q A;  2F9T A;  4KTW A;  3BF3 A;  5LMU K;  1JL1 A;  3OYF A;  1WSG A;  3O3F A;  3MXM A;  4CJL A;  4E7K A;  2VGM A;  3G10 A;  4JK7 A;  3I0S A;  4CJF A;  3GL1 A;  1RT2 A;  3Q7C A;  4FLZ A;  3VQ8 A;  4IFY A;  2Q3S A;  1TK5 A;  3HI0 A;  2QXF A;  2X78 A;  4BC4 A;  5DM6 L;  1S6P A;  3DLK A;  2YNH A;  1Q7Y O;  4BC5 A;  4DV2 K;  2D0P A;  2P9K A;  4YOX A;  5KQ8 A;  2HBK A;  1VAZ A;  3SBT A;  4CHN A;  3TR8 A;  4BRD A;  2B6A A;  1EWQ A;  4B1U B;  2OAN A;  1NGJ A;  3E01 A;  4M3T A;  4BRF A;  1V4T A;  1X9S A;  2DFH A;  3OYA A;  3D2F B;  2FBX A;  2P9U B;  5F1X A;  4KB1 A;  1U4B A;  5ADX H;  4E1M A;  3HBT A;  2XO7 A;  4OGE A;  2ASM A;  4FJG A;  3DLG A;  1KD1 O;  4RW9 A;  3ULE B;  3LM2 A;  4MQ3 A;  4NXN K;  3NMU A;  5D3G A;  3NFA A;  2KTQ A;  5HLF A;  1L3V A;  3VF4 A;  4CF2 A;  1KRP A;  3C6A A;  3SAH A;  1VQ6 N;  4CEZ A;  1WAF A;  2DFF A;  4CK2 A;  1VSD A;  3KK3 A;  4H03 B;  2YHA A;  3CYM A;  3ZSR A;  4ZTF A;  1IBM K;  3ZX3 A;  5KQD A;  2E88 A;  3J80 O;  3CQX A;  4IZ9 A;  1IBL K;  3M8Q A;  3SUO A;  4H5R A;  3LM9 A;  3A2F A;  3NF8 A;  1K73 O;  4KKO A;  3WNH A;  2BTF A;  4CGH A;  3NVK A;  4CJV A;  3EKU A;  1QSS A;  3D7E O;  2WBN A;  1KC8 O;  3L3V A;  4E1J A;  2F8S A;  1C1A A;  3LDL A;  4K0K K;  3BF1 A;  3P83 D;  4I2Q A;  3ZLJ A;  5FRO A;  4CJS A;  3VTH A;  5AQX A;  1NJW A;  3SPY A;  2I5J A;  4EZ9 A;  1SAZ A;  1NK6 A;  2OPQ A;  3AA3 A;  4H0V B;  1N33 K;  3LPT A;  4Z4E A;  3PX4 A;  3NH1 A;  4A2A A;  3RMA A;  2NRR A;  4M7X A;  4BRN A;  1VSF A;  4BR4 A;  1NOY A;  2FSN A;  4QOZ B;  4DTJ A;  4ICL A;  4WQ4 C;  4LF5 K;  3WXM B;  2VG6 A;  1NK7 A;  4IKF A;  1B9F A;  5EY4 A;  3LP3 A;  1EET A;  3KD1 E;  1QZ5 A;  4KHS A;  3U4L A;  3VOV A;  4BRC A;  4BWJ A;  3V9S A;  1K6Y A;  4JKA A;  3AVG A;  1JKH A;  3MWT A;  4MLE A;  1RT4 A;  4CJU A;  5EXW A;  5CE3 A;  1NKB A;  1E4F T;  3PO4 A;  3L3U A;  2FSJ A;  4ISE A;  4LF9 K;  1CZA N;  1SS6 A;  3THV A;  4M42 A;  5BN8 A;  2R7Y A;  4C8M A;  2YKM A;  4M3U A;  1U48 A;  3O80 A;  2P9I A;  4XIU A;  4FJM A;  4M3Y A;  4PY5 A;  5KRT A;  2YNF A;  1JLF A;  4Z4I A;  3DOL A;  3RRG A;  1BIZ A;  2NRH A;  5IT9 O;  3SLC A;  3ZX2 A;  1K8K A;  2O8C A;  4H4O A;  1L3U A;  2Q36 A;  1I39 A;  3VES A;  1NWK A;  4CZE A;  3K2P A;  4CFC A;  4NYF A;  3SQ4 A;  1ZBH A;  3PIO L;  1BIS A;  1JJ2 M;  4CER A;  1TAQ A;  1LOT B;  3SMP A;  4ID5 A;  3WQT A;  3LP1 A;  3TSU A;  3WXL A;  3EN9 A;  4JHD B;  3LWM A;  1XNQ K;  4IFE A;  4B9S A;  4DTU A;  3RSE A;  2Y1J A;  1KCF A;  4RCH A;  4BRM A;  1WSH A;  2FBV A;  1WB9 A;  3KKS A;  3LZJ A;  4FZZ A;  2FF6 A;  1S5J A;  1GLD G;  4ELU A;  3MCA B;  3ZSX A;  1Z25 A;  3KJV A;  3THY A;  4H5V A;  1S9E A;  1FK9 A;  4GKJ K;  4AHR A;  5JIC A;  1Q18 A;  1IO2 A;  4U67 L;  2RHK A;  4FLU A;  1LWE A;  4ILJ A;  2KFZ A;  3CG7 A;  1ATN A;  4DU3 A;  4HVJ A;  3THW B;  4DR5 K;  3CJB A;  2G8V A;  3EE8 A;  3VQ7 A;  3A5N C;  4DR2 K;  5AQQ A;  3D2E B;  1IJJ A;  3MN6 A;  4DTO A;  1KVC A;  2QXL A;  4H8K A;  3SZ2 A;  1L3T A;  4BRK A;  1UOC A;  2HHH K;  5C2D A;  2QWM A;  4IEE A;  3ZT4 A;  3CQ8 A;  1BL3 A;  3IFR A;  3WXJ A;  1M1K O;  2DY4 A;  2YHB A;  1O1W A;  4KI4 A;  1BO5 O;  2HF4 A;  2JGU A;  3MMV A;  3WEE B;  3SUP A;  3VMF B;  1T8E A;  2HB5 A;  5J2N A;  1WLJ A;  3NGZ A;  1BDG A;  5GAD P;  4FLX A;  3UKU B;  3MWP A;  3LDP A;  4CJQ A;  3L2V A;  4YOR A;  1YUW A;  3IS9 A;  4CHY A;  3O8M A;  3MK6 A;  4JYA K;  1LWF A;  3ISN C;  3V1R A;  3H3O B;  4E19 A;  4KHW A;  1IKV A;  3DOK A;  4C8K A;  4IOX A;  3WNG A;  2OZM A;  1A5W A;  5FRN A;  3IKM A;  3QIP A;  3VQ9 A;  4DV5 K;  5E41 A;  3VQP A;  1XHZ A;  4FOE A;  1F21 A;  1XWL A;  3CJA A;  2D0O A;  3FE1 A;  4WFB L;  3F5T A;  2FSK A;  5H1S Q;  4M3W A;  2BAN A;  4GV9 A;  1ZBF A;  5AQF A;  3JS6 A;  2DPN A;  3CME N;  3V9Z A;  3TAR A;  3KLH A;  4OO1 J;  4C1N K;  4A61 A;  5KGX A;  5C25 A;  3SJH A;  2NNW A;  1M90 O;  3M5R A;  3CI5 A;  3PSI A;  1WOQ A;  3QDK A;  5AFU H;  4DS5 A;  1ZXO A;  1K8K B;  3F2K A;  1D8Y A;  2E2P A;  4LFA K;  5C0Y A;  4YOY A;  3I0R A;  4BR7 A;  4EHT A;  3ENB A;  4JKF A;  3C6T A;  3SCX A;  2HNZ A;  1V4S A;  3LAK A;  4JRQ A;  2WOM A;  3FZM A;  4KH4 A;  4MFB A;  5JMV A;  2BE2 A;  3HJF A;  3ULE A;  3HPH A;  1KVB A;  1DKG D;  3C95 A;  3UB5 A;  4FYD A;  4JI0 K;  2B5J A;  4W5N A;  1XC3 A;  4O8U A;  4DCH A;  4LH5 A;  2H3G X;  4F3T A;  4BQL A;  1RGI A;  4FK0 A;  4FK4 A;  3WXI A;  4DSF A;  4DSI A;  4YOU A;  5EX5 A;  5B8H A;  3OYN A;  4RTF D;  4O0J A;  3VF2 A;  3MXJ A;  1HPM A;  4GV3 A;  4JNE A;  4A5A A;  1QQC A;  4CJW A;  4FM2 A;  3H1V X;  1EX4 A;  4Z0U A;  1TYQ A;  1YI2 N;  5JLF A;  4KTQ A;  5KRS A;  3SI6 A;  5LL6 Z;  3TPQ A;  2A1S A;  4CZH A;  4FWL A;  1D4X A;  2GV9 A;  1S3X A;  1E4G T;  3ULD A;  3ZSW A;  3OS0 A;  5M1Q A;  2RF2 A;  5M1F A;  1GOB A;  2EHG A;  1RT6 A;  3AA5 X;  4F2R A;  4EIA A;  5DM7 L;  3GOI A;  3O4Q A;  1LV5 A;  4JI7 K;  5I3U A;  4ID1 A;  4DR7 K;  3ZEU A;  2G8H A;  5HP1 A;  2QWL A;  5AQG A;  4JKC A;  1CZ9 A;  3CHW A;  2Z1G A;  3ZCM A;  4A59 A;  4AM7 A;  4FCY A;  4YNQ A;  3V1O A;  3EY1 A;  4QS8 A;  2O8B B;  1TKX A;  1SV5 A;  2O8F B;  3DI6 A;  4DFK A;  1EQY A;  1NK9 A;  4BRO A;  4CES A;  4FM0 A;  3B6P A;  1RIL A;  3VF6 A;  2W6L A;  4CZL A;  4B3M K;  4OKE A;  2X6S A;  1X1P A;  4DV0 K;  3CET A;  5J2M A;  4B1Z A;  3R8E A;  3WNF A;  4Z94 A;  1P8Z A;  3H46 O;  1NMD A;  1WBD A;  4B3S K;  1HMV A;  3DXK B;  1L5U A;  4BQZ A;  1VQ8 N;  4I2P A;  2QKB A;  1RT1 A;  3PUF A;  4PHT X;  3VER A;  1TUY A;  3ATU A;  1QQO A;  1RDU A;  2IVP A;  3TAQ A;  1VSE A;  1W2B M;  3CC7 N;  1HNX K;  2P9U A;  4YOW A;  2E6L A;  4BC2 A;  1VSK A;  3VEN A;  4CEE A;  3T69 A;  2D0C A;  3NBP A;  2E2N A;  3O4W A;  1DT9 A;  3KK7 A;  3RR8 A;  4B3O A;  2CH6 A;  1D5A A;  4JS5 A;  1X3M A;  3HPO A;  4HTL A;  1HX1 A;  3THY B;  2YHX A;  3THW A;  3MN9 A;  3F73 A;  1XUP O;  1FKP A;  5I9E B;  4DUZ K;  3P31 A;  1N5Y A;  4GMJ B;  2D4W A;  4ILG B;  3MN5 A;  3NH0 A;  4H0P A;  1CXU A;  1OH7 A;  4FWM A;  2GWK A;  1D9D A;  5AQM A;  4MDA A;  2KKZ A;  3ZSY A;  4PL7 A;  3NGI A;  1NGD A;  2A1R A;  3KHY A;  4A5B A;  1W9H A;  1YIT N;  4GKK K;  3O9T A;  3AO5 A;  4PWD A;  3HTV A;  3AY9 A;  3IUC A;  4CIE A;  3DXM B;  4NYN A;  4AHC A;  2F8T A;  3HM8 A;  3DLB A;  1Q81 O;  4X66 K;  2F9W A;  1YVU A;  2FBY A;  4FL9 A;  1NOZ A;  4XEI A;  4AHT A;  4BRL A;  1BI4 B;  2WFB A;  4RG8 A;  3WUH A;  4DU4 A;  5JEN A;  4KRF A;  1ITG A;  3A5M C;  4KHN A;  1JLE A;  1BI4 A;  3ZT0 A;  4C8L A;  4BVO A;  3A8Y A;  4BDY A;  1SUQ A;  4ISG A;  1IBK K;  4FJJ A;  1RBU A;  3MDQ A;  1C1C A;  4C1N I;  1QQN A;  4CBX A;  3MAQ A;  4DR1 K;  2VGN A;  3CF5 L;  1BCO A;  3CJ7 A;  3AVF A;  3OYB A;  1NGG A;  2OTJ N;  2IOC A;  2P9I B;  3PIP L;  4JRP A;  2P9P B;  1VQP N;  1WSE A;  1CZB A;  4BE1 A;  2IC3 A;  3L4Q A;  3OBY A;  4L3Q A;  3T7Z A;  1CLQ A;  3HST B;  4XH1 A;  3QET A;  2HBM A;  1NGH A;  1J9A A;  2HBL A;  1WSJ A;  3C7N B;  3D0P A;  2QA4 N;  2RN2 A;  1UA0 A;  5LJV A;  3U3Y A;  2RE2 A;  4CHP A;  4CJ4 A;  3O9Q A;  1VSL A;  4M63 C;  4B9V A;  3CJC A;  2E2O A;  3FZH A;  1RNH A;  1C0F A;  2QWN A;  4FWN A;  1ZBU A;  3TWH A;  4NLB A;  1HNZ K;  1JLC A;  4DV6 K;  4AQY K;  1B92 A;  2HOE A;  4F3O A;  4PL8 A;  4L8R B;  4DV7 K;  4BRG A;  1S1W A;  4QAG A;  4EP4 A;  4FJL A;  3G0Z A;  2EWS A;  4BRP A;  2YKN A;  5KI6 A;  4A62 A;  1T3V A;  1RDW X;  3QB0 A;  4RWT A;  1ZBS A;  3QIC A;  4FWP A;  3EEQ A;  4BR2 A;  4JK9 A;  5C15 A;  4BR5 A;  4AF1 A;  3U6F A;  2P9L B;  3JXU A;  4Z4G A;  4CEO A;  3M8P A;  4FJ7 A;  2UXD K;  2ZJP L;  3AVJ A;  3CQY A;  1HQE A;  3SV4 A;  4DTS A;  5LJW A;  3VEW A;  5BRE A;  2VWB A;  3ZET B;  3OYH A;  2UUA K;  4G9Z A;  2Z1J A;  5GIN A;  3L6Q A;  3DLH A;  1KAX A;  4CJE A;  1Y97 A;  1HQU A;  3FZK A;  3T3F A;  2EX3 A;  4CHZ A;  1NBW A;  4DQ8 A;  1Z6R A;  2I7N A;  2XRI A;  3K57 A;  3DJC A;  1JLB A;  2KQ2 A;  4B9U A;  1NJI O;  2P51 A;  4ELV A;  2QTD A;  4AH9 A;  1UA1 A;  1YXQ A;  3HPG A;  2UU9 K;  4FZY A;  3CCE N;  3LPU A;  2QWP A;  3JAM O;  5C10 A;  2P5O A;  3EL2 A;  3SQ2 A;  3AVK A;  3CPE A;  1S9G A;  2QW9 A;  3AO4 A;  4LFC K;  2P9N B;  4DFJ A;  2GX9 A;  3ZSQ A;  4CHQ A;  1Q82 O;  4HTU A;  4DQR A;  3TTF A;  4J8F A;  4BDZ A;  2OPP A;  4C8O A;  3RRH A;  1NU0 A;  4FWS A;  1TYQ B;  4I9Q A;  1FJG K;  3VQA A;  5AJ3 K;  4Y1D A;  1VSH A;  3AVM A;  3CCU N;  2W6K A;  5HL7 L;  1BQN A;  1Z05 A;  4JLH A;  3DRP A;  4BEB A;  4AIL C;  3GG4 A;  4LFB K;  2UUB K;  1XMO K;  1VQK N;  3KTQ A;  2E4L A;  5TKY A;  3ATV A;  4CEF A;  3BUZ B;  3C65 A;  1WSF A;  4H0Y B;  2P9K B;  1BUP A;  2KZM A;  2J4R A;  3VA0 A;  5AQS A;  2HHS A;  1SKW A;  4Z4H A;  3L8B A;  3AA2 A;  5C2F A;  3P4I A;  3QFP A;  2AJQ A;  1BGX T;  2OZS A;  2GBZ A;  2KHO A;  4BDP A;  1REV A;  3OYE A;  2Q1N A;  1HJO A;  3R6M A;  3M8S A;  5EU7 A;  5FLX O;  5JVH L;  2F4V K;  4FVM A;  4JI4 K;  4OPK A;  3KIO A;  4DTX A;  1D9F A;  1XMQ K;  2YJE A;  2Q0U A;  4CIG A;  1NJY A;  4DFP A;  4LF8 K;  4CF0 A;  4KTZ A;  1GLF O;  4DQQ A;  4BY9 C;  5BPL A;  1RDC A;  2YHW A;  4KHQ A;  3ZSO A;  1TL1 A;  2NUB A;  4QS7 A;  2XY7 A;  4DF8 A;  3ZSZ A;  5FRM A;  3AVI A;  2Q0R A;  3SNN A;  1NGF A;  3A5L C;  5LMN K;  3A0I X;  5AQO A;  4BE2 A;  4M3R A;  5AQZ A;  5SWM A;  3SUN A;  1XC9 A;  2HHI A;  3E9P A;  1HPZ A;  3SUQ A;  2HNY A;  1X9W A;  2UXB K;  1C0G A;  5K14 A;  1VHX A;  4CGI A;  2AP1 A;  3IDH A;  2HHV A;  4GW6 A;  4FWQ A;  3HYF A;  2HMI A;  4JI2 K;  3SV3 A;  1HYS A;  4CEQ A;  4F9O A;  4B1X B;  4PA1 A;  5F2R A;  5AZJ A;  2GEL A;  1LAV A;  5M1K A;  5AQK A;  3WNE A;  3AO3 A;  3QEP A;  1VQ9 N;  4GVE A;  5FPM A;  3KWG A;  5AZJ B;  3VQC A;  1QSL A;  2JWK A;  2WON A;  3TSP A;  4BRH A;  4DQI A;  3BZC A;  1OH8 A;  4FVU A;  4WYB A;  3O5B A;  1WAJ A;  4Z4F A;  3O1B A;  4IWV A;  4DB3 A;  3WEE A;  3K9J A;  5C24 A;  1NK4 A;  1T7P A;  3CFR A;  3HP9 A;  2GTD A;  4X65 K;  1RT5 A;  3CM6 A;  4Q5V A;  3UKR B;  4IFV A;  4FOI A;  4OJR A;  3H45 C;  3EZW A;  1ZBI A;  4FJN A;  4FZX C;  1ASU A;  1JXB A;  4FJH A;  4LF7 K;  3TAB A;  2KFN A;  4CIF A;  5CYQ A;  1S1V A;  3O6W A;  2UUC K;  4N76 A;  3TAG A;  2E1Y A;  4H0O A;  1N8R O;  3T1H K;  1BQM A;  2JLE A;  2Z1I A;  1B9D A;  4DHY A;  1U2V B;  4XH5 A;  1NK5 A;  1C0M A;  4H0X B;  3OW2 M;  1KFD A;  3CPW M;  1JCG A;  1HUX A;  5FPD A;  2VCP A;  2A5X A;  3GDQ A;  4IDK A;  3DMJ A;  4KO0 A;  3SAG A;  1U45 A;  4DR4 K;  2QI2 A;  1QE1 A;  3OYM A;  4CJP A;  1ZBL A;  1KFS A;  1HJR A;  1IV0 A;  4CF1 A;  4W5R A;  3FFI A;  3DLR A;  3U3G A;  3AVC A;  3MXI A;  1YHQ N;  4FLT A;  2Z1H A;  2FC0 A;  3OA9 A;  4FJ9 A;  4CGG A;  1TL3 A;  3GE1 A;  4HUG A;  2NRZ A;  3OYK A;  3KKR A;  3PSF A;  5DK5 A;  1J5O A;  5BRH A;  4CK1 A;  4HCB A;  2GUP A;  5JLH A;  3BGR A;  1TKZ A;  5GAG P;  3I55 N;  4EAH D;  3SPZ A;  4DV4 K;  1HNW K;  2PY5 A;  5M1O A;  4FPA A;  4M3Z A;  4KI6 A;  4B3R K;  2ITM A;  1LAW A;  3VQE A;  3THX B;  4JKG A;  3F9K A;  2O8D B;  1BHL A;  2QKK A;  4BEC A;  1HRH A;  3S3O A;  2LSN A;  4GY2 B;  1VRU A;  4ZTJ A;  4YDU C;  4B9L A;  1TKT A;  4W5T A;  4O4G A;  5FPE A;  3U9D A;  4CJ7 A;  5FPN A;  3FZL A;  3ZYY X;  4DSE A;  2P9P A;  3QBX A;  2HW3 A;  1KLN A;  4CEC A;  4DQS A;  4DMN A;  3V81 A;  4FWR A;  4CF8 A;  3HVR A;  2RKI A;  3N4Q A;  4KV8 A;  3CCV N;  4ELT A;  4CJT A;  3AAQ A;  5AQW A;  5T7B A;  4DTN A;  1KAZ A;  4EZ6 A;  3HZ6 A;  5HRO A;  2HHX A;  4WQ4 A;  1OVQ A;  3AVA A;  5BPN A;  1HKC A;  1MWM A;  1RT3 A;  4BVP A;  4X62 K;  2Q2R A;  2G8F A;  2HVH A;  1FXX A;  1IG8 A;  1RBS A;  5ELZ A;  3K5M A;  4H5W A;  3O9U A;  4CZF A;  4CZM A;  2CGJ A;  5EOY A;  1UAX A;  1HKG A;  3PX6 A;  4B8C A;  2KLA A;  4JHD A;  1ZYQ A;  3P38 A;  4UQG A;  4BRI A;  1RFQ A;  5HRP A;  3CMA N;  4HCC A;  1ASV A;  1N34 K;  4NO7 A;  3QNN A;  4Q0B A;  1HKB A;  2G8K A;  3QNO A;  1G15 A;  4CGJ A;  4YDU A;  1S1T A;  3VQB A;  2IIR A;  1KVA A;  4BR9 A;  3CIP A;  1I3A A;  3KZB A;  3M3Z A;  4J2B A;  3VEX A;  3SMS A;  4CEB A;  3ZSV A;  4BG9 A;  3TTD A;  4DF4 A;  2ASO A;  5KGW A;  4ZHR A;  3JSM A;  3OYD A;  1SQK A;  4O0I A;  4OPH A;  3TAF A;  3PO5 A;  3AAP A;  4FLV A;  3W0L A;  3B6O A;  3O3G A;  1ATS A;  1EXQ A;  1GOA A;  3E9O A;  2C1G A;  3IMX A;  2D0B A;  3O1W A;  1QTM A;  3OYL A;  4M7Y A;  2BUP A;  4OPA A;  1Y64 A;  2FXU A;  1NKC A;  3ITH A;  1HNV A;  3D2F A;  3TU5 A;  3DLE A;  4FJI A;  3KD5 E;  1CXQ A;  1NJX A;  3S41 A;  2ZGY A;  3KLI A;  4E7I A;  3CJ1 A;  3OYJ A;  3SYZ A;  1RBV A;  1JLQ A;  1DTT A;  4JD2 A;  5EVZ A;  4DV3 K;  5BRD A;  2PAV A;  4WFA L;  4E0D A;  4K8Z A;  2ZM6 K;  3ZT1 A;  1A5V A;  2GEM A;  4KHU A;  3QIO A;  3CC2 N;  1T44 A;  4KH6 A;  4CJK A;  4FWK A;  2Q31 A;  2KW4 A;  2VG5 A;  3OVN A;  4FWO A;  4O5B A;  3V4I A;  3KVG A;  5AFU A;  3SAF A;  4AM6 A;  1J6Z A;  1EWR A;  4OPJ A;  3LAN A;  2Y1I A;  1NKE A;  3G25 A;  1HNI A;  4CFD A;  3LAL A;  2F7T A;  4R5P A;  3CYG A;  4CJ3 A;  4K8X A;  4RW4 A;  3HT3 A;  2I7P A;  4JI6 K;  5AQP A;  3CFP A;  5GAE P;  2E1Z A;  3ASM A;  4YY3 K;  3AO1 A;  4O8K A;  5GAH P;  1EO1 A;  2P9S A;  4NXM K;  4DTP A;  4DSL A;  2XY5 A;  1GOC A;  1T6C A;  2VG7 A;  4KRE A;  2NZT A;  2O8E B;  4B1V A;  1LW0 A;  3L0Q A;  4AHS A;  1NNE A;  3OJU A;  3HO1 A;  1SL0 A;  1FW6 A;  3VEV A;  4DSK A;  5AQR A;  1YF5 L;  2O8C B;  4CD1 A;  3B8A X;  1NGC A;  1KXP A;  4UY8 O;  3OTO K;  4IEI A;  4CK3 A;  1KLM A;  4J2E A;  4G1Q A;  2HST A;  2O8B A;  1OVY A;  3P1G A;  2HF3 A;  4H5T A;  3L4I A;  3SQ0 A;  4AHU A;  2OTL N;  1LWC A;  2XHB A;  2D0A A;  1NG9 A;  1RTH A;  3L2U A;  1G99 A;  5MLC Q;  3VQ5 A;  4FM1 A;  3VEY A;  1MWK A;  2P5G A;  2YCH A;  3J7Y P;  4F2S A;  4KPY A;  3NF6 A;  4JKG B;  1TK8 A;  1W7A A;  4FJ8 A;  1N32 K;  5HOO A;  5M1N A;  4K43 A;  2HBJ A;  3QEV A;  1SKS A;  4IG0 A;  1OH6 A;  2E8A A;  3BZK A;  4K41 A;  3DXK A;  5BR8 K;  4MDB A;  3THX A;  5AQH A;  1BCM A;  5GIP A;  1HLU A;  4OKJ A;  2V52 B;  4HHT A;  1JLA A;  2C1I A;  4LF4 K;  1ESV A;  1RBR A;  1VQM N;  2ITG A;  3AVN A;  1IKW A;  5BRF A;  4DS4 A;  3RVC A;  3M6G A;  4MLH A;  3C0B A;  2ZWH A;  1VQN N;  3KK1 A;  4A2B A;  3K9K A;  2WUS A;  2G8I A;  5AQN A;  4B3T K;  2Q97 A;  1EP4 A;  3DM2 A;  5SZT A;  2D5R A;  2HHU A;  1J53 A;  4LH4 A;  2IS3 A;  1VSJ A;  2W41 A;  3VQ6 A;  3V1Q A;  2WC9 A;  4CFB A;  4BAC A;  4FSV A;  2IAJ A;  3RR7 A;  1KSP A;  3QEX A;  4GV6 A;  1OKJ A;  2O8D A;  3G6E N;  2ZJR L;  1T6D A;  4Z4C A;  4W5Q A;  3CJ9 A;  2NRT A;  1NM1 A;  1NJZ A;  1NGA A;  1J54 A;  4O5F A;  4BR0 A;  1QQM A;  4IJA A;  4BRA A;  3UKR A;  4YFU A;  1SKR A;  2ZD1 A;  3EE9 A;  3RWU A;  2IGI A;  1MDU B;  3VQQ A;  3D2E A;  3QLH A;  1YJ9 N;  1RT7 A;  3UIQ A;  3R1X A;  5AQT A;  3QIN A;  5KTQ A;  4N56 A;  3BEX A;  2QWR A;  1HR0 K;  4DFM A;  3O9R A;  4N41 A;  2NLX A;  3DRR A;  1QS4 A;  3TAP A;  3QEI A;  2OPR A;  1RTI A;  3AGR A;  1VQL N;  4K25 A;  3MX5 A;  1ZC6 A;  2P1J A;  1DGK N;  3ID8 A;  3L2R A;  5I42 A;  4U7B A;  1C6V A;  2PZS A;  4B08 A;  4E1N A;  3LDO A;  5HRR A;  1GLE G;  3CXC M;  4RW6 A;  1IH7 A;  2HHW A;  3GBT A;  3I56 N;  4M45 A;  3UKU A;  1YAG A;  4BRE A;  2PFU A;  1SL1 A;  4IG3 A;  1YIJ N;  4N5S A;  4EFH A;  3LDS A;  2E2Q A;  3RTV A;  2OCE A;  2G8W A;  3TI0 A;  4YHH K;  4DSJ A;  4KHP K;  1VK0 A;  3FZF A;  4N47 A;  2VQE K;  1C0T A;  5BR9 A;  4Y0W A;  1GLL O;  3DXM A;  4DLG A;  2GUI A;  4RW8 A;  4XH4 A;  3EO3 A;  4OKK A;  3NVM A;  5AQJ A;  2PYL A;  4HUF A;  1IG9 A;  4JV5 K;  4MO5 A;  3NDK A;  5FDL A;  5C42 A;  1HYV A;  4DG1 A;  3BP8 A;  4GVM A;  2NRX A;  3OYC A;  1L3S A;  4BE0 A;  2HHQ A;  4JK8 A;  4EP5 A;  2HVI A;  1XQS C;  3AGK A;  2FBT A;  5CZ1 A;  4E89 A;  2O4G A;  3W3D A;  3FFK B;  3AV9 A;  4FLW A;  5AQI A;  2GWJ A;  2OYQ A;  2E6M A;  1Q8I A;  4CCH A;  2A41 A;  4AHV A;  4IXC A;  2QWQ A;  1VSI A;  3RMB A;  2IVO A;  5HRS A;  3PX0 A;  1E3M A;  4CJ5 A;  3IAY A;  3NH2 A;  3QER A;  3OHR A;  3J81 O;  3HRG A;  3M1F A;  3H08 A;  2XY8 A;  3VEZ A;  3G71 N;  4B9M A;  1WNS A;  5BPM A;  5ADX A;  3H1Q A;  4OLA A;  4M3X A;  3LP2 A;  4CJR A;  3CCL N;  1BG3 A;  3ID6 A;  4R79 A;  2NRW A;  1GLB G;  2X6N A;  4K42 A;  2YNG A;  3MED A;  4YOT A;  1R59 O;  4BG8 A;  4KB0 A;  3ENH A;  1W97 L;  3QES A;  5AZI B;  1VQ5 N;  3AAR A;  2P9N A;  4LSN A;  2UXC K;  3TAE A;  3P5J A;  2OPS A;  3PV8 A;  2KZZ A;  3J8A A;  3NAE A;  1NGB A;  4ISF A;  4CI6 A;  3OS2 A;  2QEX N;  3ZT2 A;  2ATQ A;  2CGL A;  3SJJ A;  4V19 S;  2BH1 A;  4C23 A;  2JWL A;  4FPB A;  4BC3 A;  5A2Q O;  4CBU A;  4KAZ A;  3S3M A;  2YJF A;  3J7A P;  2ETJ A;  3C94 A;  2XY6 A;  3DRS A;  4NCA A;  3E9L A;  4J2A A;  1S1X A;  4JAX A;  2YI1 A;  5AR0 A;  3V9W A;  4CZG A;  1TAU A;  3QFU A;  2RPI A;  4E72 A;  2W00 A;  3O08 A;  4YOV A;  4IOC L;  1RCH A;  1YTA A;  5F0X A;  4CF9 A;  2HND A;  2FF3 B;  3NF7 A;  4NB4 A;  3RSE B;  4BE7 B;  1QVG M;  2OA8 A;  3DLL L;  3OS1 A;  4JKD A;  4WE1 A;  1XI1 A;  4JD2 B;  1TV6 A;  3MX2 A;  1QZ6 A;  1U04 A;  3O3H A;  3LZI A;  1XHX A;  4I9L A;  3V9X A;  3CCM N;  3NF9 A;  1BU6 O;  1GLC G;  2CGK A;  1S6Q A;  4F8R A;  4B8A B;  3D6R A;  4E7L A;  4JI8 K;  5DMR A;  3N4P A;  3S5T A;  1BA0 A;  3K58 A;  2B4J A;  4E7J A;  1SL2 A;  1YTU A;  3R9P A;  3FLC O;  3SK3 A;  2YNI A;  4OGC A;  4JEP A;  4CEA A;  3RMC A;  3AVB A;  1X9J A;  1TUU A;  2O4I A;  3CCQ N;  1JCF A;  1MU2 A;  3HOT A;  1K9M O;  2VWJ A;  4DUY K;  1MA9 B;  4FJK A;  3ZX0 A;  1RTD A;  1JL2 A;  4X64 K;  4MO4 A;  2QK9 A;  4WF9 L;  3T1Y K;  5CYM A;  5BN9 A;  2W40 A;  4B9N A;  4LF6 K;  3FGU A;  3HXM A;  1NGI A;  3JYT A;  1EKE A;  3V9U A;  3WT0 A;  2PYJ A;  4NLC A;  4PKG A;  2VYP A;  3OYI A;  4CVN E;  3NE6 A;  1LW2 A;  1Q9X A;  4IO9 L;  3AVH A;  4CGF A;  3LDN A;  3LWL A;  4H5N A;  2A3Z A;  3HOS A;  4DTR A;  5J2P A;  1UWB A;  4JN4 A;  2QM1 A;  3SBG A;  3KLE A;  4CED A;  1YT3 A;  4CZI A;  3U8X A;  3K0S A;  5KPZ A;  1QHT A;  5GIO A;  4FO0 A;  1U6Z A;  1T03 A;  4C8N A;  1ASW A;  4DR3 K;  4DTM A;  3VGK A;  2ZQB A;  4QCL A;  4FW1 A;  3TAN A;  1QHA A;  4CGD A;  4CD3 A;  5JS2 A;  1BOT O;  4IO8 A;  3VQD A;  3PLA A;  1VSM A;  1TKD A;  3T1A A;  3NCI A;  4H0T B;  3SQ1 A;  3QBW A;  4B1W B;  2FLO A;  4BGA A;  4JI1 K;  5CHI A;  3ZT3 A;  2O8F A;  3A5O C;  3AO2 A;  3O9S A;  3VPZ A;  1W0H A;  4JKB A;  3MN7 A;  1C0U A;  5TKW A;  3EKS A;  4FLY A;  1RBT A;  5M1P A;  2YV0 X;  3IG1 A;  4F4K A;  3R3L A;  2W42 A;  1U47 A;  3WXK A;  4A57 A;  4BGB A;  3QML A;  3L2W A;  4HUE A;  3K5N A;  4CHO A;  3ZET A;  4PUO A;  1R0A A;  1U49 A;  5AQV A;  4O44 A;  4M41 A;  3VET A;  3MEC A;  4B9Q A;  3CCJ N;  1S1U A;  2ASP A;  4FW2 A;  2F96 A;  3H3N O;  4H4M A;  1KAY A;  2HMP A;  1RDA A;  5AQU A;  1Q9Y A;  3ALY A;  4XJX A;  4GNI A;  3CFO A;  4OVL A;  2AA4 A;  1P90 A;  1N36 K;  3UE5 A;  3HK2 A;  3IRX A;  4PQU A;  1BIU A;  2YX6 A;  1JLG A;  3P39 A;  1YJW N;  3WQU A;  4KBO A;  3I33 A;  4LY7 A;  1JCE A;  4JKH A;  1H1V A;  1ATR A;  3CCR N;  4O55 A;  3G4S N;  1QSY A;  3D45 A;  4BWM A;  3RMD A;  4DQP A;  2ZE2 A;  4CZK A;  2D1K A;  4IOA L;  4OLB A;  4RW7 A;  1WN7 A;  3KWI A;  1Z26 A;  5E26 A;  5KPT A;  3KLG A;  4B1Y B;  1T05 A;  4CE9 A;  3TAM A;  4DWI A;  4WQ5 A;  4LSL A;  4NCG A;  3KK2 A;  4PKI A;  3QEW A;  3ZEU B;  4TSX A;  1S22 A;  1DTQ A;  2E5L K;  4KFB A;  3ENO A;  2DFE A;  4JI5 K;  1WUA A;  1SZ2 A;  3LDQ A;  1JXE A;  3NHG A;  4E3S A;  1NLV A;  3HL8 A;  3LP0 A;  1NK8 A;  4NCB A;  2CH5 A;  3EZ5 A;  1QVF M;  1BA1 A;  1VRT A;  1GLJ O;  2BGG A;  1TVR A;  4I7F A;  3HP6 A;  3DAW A;  4WCE L;  5C12 A;  3CCS N;  3I8D A;  1HYZ A;  2ZF5 O;  1WBB A;  3MEG A;  2V51 B;  5JVG L;  3V6D A;  4JI3 K;  5CY4 A;  1VQ7 N;  1YVN A;  5E84 A;  4FJ5 A;  2A42 A;  4FK2 A;  1VQ4 N;  4CBW A;  3HSC A;  3E66 A;  1X9M A;  4B9T A;  3AVL A;  4QS9 A;  1GLA G;  4I6M A;  1LCU A;  5KPR A;  4DLE A;  2UYT A;  4IJN A;  3VGM A;  3CER A;  4JS4 A;  1I94 K;  3K5L A;  1S72 N;  1WSI A;  3H6E A;  5LY3 A;  2VWK A;  5CR4 A;  3TTC A;  4W5O A;  1U2V A;  2ZJQ L;  2VQF K;  3K5O A;  1N6Q A;  1C1B A;  2IVN A;  3DYA A;  1IKY A;  4IBN A;  4WQ5 C;  2HHT A;  3PY8 A;  2ZGZ A;  3LAM A;  3U9Z A;  4FXD A;  1RDB A;  1NMN A;  2E20 A;  1NK0 A;  3S9H A;  2V7Z A;  1RTJ A;  3QO9 A;  1DLO A;  3S3N A;  3O4N A;  2YHY A;  3F9M A;  4BRQ A;  3OYG A;  3C6U A;  4DU1 A;  3C6H A;  4CW7 B;  3AA4 A;  2WTU A;  1DEJ A;  3I8B A;  3NGY A;  3VEO A;  3T19 A;  3EYZ A;  5AZI A;  3K59 A;  1A5X A;  3TSQ A;  3VN5 A;  2IDO A;  3HVT A;  3C7N A;  1Q86 O;  3MCP A;  4CZJ A;  1ILY A;  1BWF O;  4KHY A;  3VA3 A;  5J2Q A;  5CZ2 A;  3CD6 N;  4EHU A;  4OX9 K;  1NGE A;  1YJN N;  4WFN L;  3MEE A;  1TGO A;  1J5E K;  2BDP A;  4KH5 A;  2QWO A;  2X74 A;  3VQ4 A;  1OH5 A;  4JKE A;  4IDH A;  3M8R A; 
#chains in the Genus database with same CATH homology
 4HWI A;  3GOI A;  3SAG A;  4I6M B;  4DKW A;  2P9L A;  4MO5 A;  2QI2 A;  3LL3 A;  4LC9 B;  2V7Y A;  3VGL A;  3FR0 A;  3ZEU A;  3E1Y A;  1X3N A;  3BP8 A;  3DWL A;  2QWL A;  5AQG A;  4JKC A;  2NRX A;  3CHW A;  1YHQ N;  1O13 A;  4JK8 A;  5KPR A;  1VQO N;  4A59 A;  4AM7 A;  3J7Z O;  3OA9 A;  4PKH A;  4ILH A;  1K8A O;  3CC4 N;  3GE1 A;  4QS8 A;  1XQS C;  2NRZ A;  3AGK A;  3VTI A;  2A6A A;  2A40 A;  3OBW A;  5BRH A;  3W3D A;  2GUP A;  3FFK B;  5JLH A;  2PBD A;  5GAG P;  3I55 N;  4EAH D;  1EQY A;  5AQI A;  2GWJ A;  4BRO A;  2A41 A;  3Q7B A;  4IXC A;  2P9S B;  2NRV A;  5M1O A;  2QWQ A;  5AQY A;  4FPA A;  5AQL A;  3VF6 A;  2IVO A;  1KQS M;  4CZL A;  2ITM A;  4JKG A;  3CET A;  2F9T A;  3OHR A;  4B1Z A;  3BF3 A;  3HRG A;  4BEC A;  3M1F A;  3R8E A;  4GY2 B;  4Z94 A;  1P8Z A;  4YDU C;  3VEZ A;  3G71 N;  5BPM A;  3H46 O;  5ADX A;  1NMD A;  3H1Q A;  2VGM A;  5FPE A;  4JK7 A;  3DXK B;  3CCL N;  1BG3 A;  3ID6 A;  3GL1 A;  3U9D A;  4BQZ A;  1VQ8 N;  4PHT X;  3Q7C A;  4R79 A;  3VER A;  1TUY A;  2NRW A;  1GLB G;  1QQO A;  1RDU A;  2IVP A;  3ATU A;  3FZL A;  4K42 A;  5FPN A;  4CJ7 A;  3ZYY X;  4YOT A;  3HI0 A;  1W2B M;  2P9P A;  3QBX A;  3CC7 N;  1R59 O;  4BC4 A;  4BG8 A;  3ENH A;  5DM6 L;  2P9U A;  1W97 L;  4YOW A;  5AZI B;  1VQ5 N;  1Q7Y O;  3AAR A;  2P9N A;  4BC5 A;  4FWR A;  4BC2 A;  2D0P A;  2P9K A;  4YOX A;  3VEN A;  3J8A A;  3N4Q A;  1NGB A;  4ISF A;  3T69 A;  2HBK A;  1VAZ A;  3SBT A;  4CI6 A;  5KQ8 A;  2QEX N;  3CCV N;  3AAQ A;  2CGL A;  5AQW A;  1KAZ A;  2E2N A;  2BH1 A;  4C23 A;  2JWL A;  4FPB A;  3O4W A;  4BRD A;  1DT9 A;  3HZ6 A;  3KK7 A;  4B1U B;  4WQ4 A;  4BC3 A;  4CBU A;  2OAN A;  1NGJ A;  2YJF A;  2CH6 A;  4BRF A;  1HKC A;  1V4T A;  5BPN A;  1MWM A;  3D2F B;  3E9L A;  1X3M A;  2P9U B;  4JAX A;  5F1X A;  4HTL A;  4BVP A;  2Q2R A;  1HX1 A;  2YI1 A;  5AR0 A;  5ADX H;  2YHX A;  4CZG A;  3MN9 A;  3HBT A;  1IG8 A;  1XUP O;  3QFU A;  5ELZ A;  5I9E B;  3O08 A;  4H5W A;  2W00 A;  2ASM A;  3P31 A;  4YOV A;  3O9U A;  2D4W A;  4CZM A;  4CZF A;  4IOC L;  2CGJ A;  4ILG B;  3MN5 A;  3ULE B;  4H0P A;  5EOY A;  1KD1 O;  3LM2 A;  3NMU A;  1HKG A;  2KLA A;  4JHD A;  4FWM A;  3P38 A;  2GWK A;  5F0X A;  3VF4 A;  2FF3 B;  5AQM A;  4MDA A;  4BRI A;  1RFQ A;  2KKZ A;  3C6A A;  3SAH A;  4NB4 A;  3CMA N;  1VQ6 N;  3RSE B;  5M1K A;  4PL7 A;  1NGD A;  4NO7 A;  4BE7 B;  3KHY A;  4A5B A;  1HKB A;  4H03 B;  1YIT N;  1QVG M;  3DLL L;  3O9T A;  3ZX3 A;  4JKD A;  5KQD A;  2E88 A;  3CQX A;  4JD2 B;  3HTV A;  3AY9 A;  3IUC A;  4IZ9 A;  4YDU A;  2IIR A;  3DXM B;  3MX2 A;  4BR9 A;  1QZ6 A;  4H5R A;  3CIP A;  3LM9 A;  3HM8 A;  3KZB A;  3M3Z A;  1Q81 O;  2F9W A;  1K73 O;  4FL9 A;  4XEI A;  3VEX A;  3SMS A;  4BRL A;  3CCM N;  2BTF A;  2WFB A;  1BU6 O;  3WUH A;  3NVK A;  1GLC G;  4BG9 A;  3TTD A;  2ASO A;  3EKU A;  3A5M C;  2CGK A;  3D6R A;  1SQK A;  3D7E O;  4OPH A;  2WBN A;  1KC8 O;  4E1J A;  3AAP A;  3LDL A;  3A8Y A;  3W0L A;  4BVO A;  3BF1 A;  3N4P A;  1BA0 A;  1ATS A;  3VTH A;  3R9P A;  4ISG A;  3FLC O;  3SK3 A;  3MDQ A;  5AQX A;  4C1N I;  1QQN A;  4CBX A;  3E9O A;  4JEP A;  2VGN A;  1X9J A;  3CF5 L;  3CJ7 A;  2C1G A;  1TUU A;  3IMX A;  1SAZ A;  3O1W A;  1NGG A;  3CCQ N;  1JCF A;  4H0V B;  2OTJ N;  2P9I B;  4M7Y A;  3HOT A;  2BUP A;  4OPA A;  1Y64 A;  3PIP L;  2FXU A;  2P9P B;  1VQP N;  1K9M O;  1MA9 B;  3D2F A;  3L4Q A;  3OBY A;  3TU5 A;  4L3Q A;  3T7Z A;  3ZX0 A;  4A2A A;  4MO4 A;  2NRR A;  4M7X A;  4XH1 A;  3S41 A;  2ZGY A;  2HBM A;  4WF9 L;  1NGH A;  4BRN A;  3CJ1 A;  2W40 A;  2HBL A;  5BN9 A;  4JD2 A;  5EVZ A;  3FGU A;  4BR4 A;  2FSN A;  3C7N B;  2QA4 N;  1NGI A;  5BRD A;  2PAV A;  4WFA L;  3WT0 A;  5LJV A;  2RE2 A;  3O9Q A;  4M63 C;  4NLC A;  4PKG A;  2VYP A;  3CJC A;  2E2O A;  4WQ4 C;  3WXM B;  3FZH A;  4IO9 L;  2GEM A;  5EY4 A;  1C0F A;  2QWN A;  3LDN A;  4FWN A;  4NLB A;  4H5N A;  3CC2 N;  1QZ5 A;  1T44 A;  4KH6 A;  2A3Z A;  4FWK A;  2Q31 A;  3U4L A;  2HOE A;  3VOV A;  3HOS A;  4JN4 A;  4BRC A;  2QM1 A;  3SBG A;  4PL8 A;  4JKA A;  4FWO A;  4BRG A;  3MWT A;  4MLE A;  4CZI A;  5EXW A;  5CE3 A;  3KVG A;  1E4F T;  5AFU A;  3U8X A;  4ISE A;  2FSJ A;  2EWS A;  4A62 A;  4BRP A;  5KPZ A;  1CZA N;  1SS6 A;  1T3V A;  1RDW X;  3QB0 A;  4AM6 A;  3SAF A;  1J6Z A;  5BN8 A;  1ZBS A;  3QIC A;  4RWT A;  5GIO A;  4FO0 A;  1U6Z A;  4FWP A;  4BR2 A;  4JK9 A;  5C15 A;  3O80 A;  3VGK A;  4BR5 A;  2P9I A;  4AF1 A;  3G25 A;  2P9L B;  3JXU A;  2F7T A;  1QHA A;  4CD3 A;  1BOT O;  4IO8 A;  3CQY A;  2ZJP L;  2I7P A;  3PLA A;  5AQP A;  2NRH A;  5GAE P;  2E1Z A;  3SLC A;  5LJW A;  3VEW A;  5BRE A;  3ZX2 A;  1K8K A;  2VWB A;  4H0T B;  4O8K A;  3ZET B;  3QBW A;  5GAH P;  4B1W B;  4G9Z A;  1EO1 A;  5GIN A;  2P9S A;  3L6Q A;  1KAX A;  2FLO A;  2Q36 A;  4BGA A;  3VES A;  1NWK A;  4CZE A;  3FZK A;  5CHI A;  1NBW A;  1T6C A;  4DQ8 A;  1Z6R A;  3A5O C;  2I7N A;  3PIO L;  3DJC A;  3O9S A;  3VPZ A;  1JJ2 M;  1LOT B;  4JKB A;  3SMP A;  1NJI O;  2NZT A;  3MN7 A;  5TKW A;  2QTD A;  3WQT A;  4B1V A;  3TSU A;  3EKS A;  3EN9 A;  4JHD B;  5M1P A;  3L0Q A;  3WXL A;  3R3L A;  4IFE A;  1YXQ A;  3WXK A;  4A57 A;  4BGB A;  3QML A;  3CCE N;  3VEV A;  3RSE A;  5AQR A;  4RCH A;  4BRM A;  2QWP A;  5C10 A;  1YF5 L;  3ZET A;  4CD1 A;  3B8A X;  3EL2 A;  5AQV A;  3VET A;  4B9Q A;  3CCJ N;  2FF6 A;  2ASP A;  1NGC A;  3CPE A;  4B1X B;  1KXP A;  4UY8 O;  2QW9 A;  4IEI A;  2P9N B;  3H3N O;  2GX9 A;  1KAY A;  2HMP A;  1GLD G;  1Q82 O;  2HST A;  3MCA B;  5AQU A;  4J8F A;  3TTF A;  1OVY A;  2HF3 A;  4H5T A;  3L4I A;  4FWS A;  4H5V A;  1TYQ B;  5JIC A;  4XJX A;  1Q18 A;  4U67 L;  2RHK A;  4GNI A;  2OTL N;  4ILJ A;  2AA4 A;  1P90 A;  1G99 A;  1ATN A;  5MLC Q;  3CCU N;  3UE5 A;  3VEY A;  3CJB A;  1MWK A;  5HL7 L;  3EE8 A;  3A5N C;  2YX6 A;  2YCH A;  5AQQ A;  3D2E B;  1IJJ A;  3P39 A;  1Z05 A;  1YJW N;  3MN6 A;  3WQU A;  4KBO A;  2QXL A;  3I33 A;  4BEB A;  4JKG B;  1JCE A;  3GG4 A;  4JKH A;  1H1V A;  1VQK N;  4BRK A;  1ATR A;  3CCR N;  5TKY A;  3ATV A;  5HOO A;  5M1N A;  4K43 A;  2HBJ A;  3G4S N;  5C2D A;  2QWM A;  3C65 A;  3BUZ B;  4H0Y B;  4IEE A;  2E8A A;  2P9K B;  1BUP A;  4CZK A;  2J4R A;  2D1K A;  4IOA L;  4K41 A;  5AQS A;  3DXK A;  3IFR A;  3WXJ A;  1M1K O;  3KWI A;  5E26 A;  4MDB A;  5KPT A;  5C2F A;  3P4I A;  5AQH A;  3QFP A;  5GIP A;  1HLU A;  2V52 B;  1BO5 O;  2HF4 A;  3MMV A;  4B1Y B;  2C1I A;  2KHO A;  3WEE B;  3VMF B;  1ESV A;  1HJO A;  2Q1N A;  3R6M A;  5JVH L;  4WQ5 A;  1VQM N;  1BDG A;  5GAD P;  3UKU B;  3MWP A;  3LDP A;  4PKI A;  4YOR A;  1YUW A;  2YJE A;  3ZEU B;  1S22 A;  2Q0U A;  5BRF A;  3O8M A;  3MK6 A;  3ENO A;  3RVC A;  3M6G A;  4MLH A;  1WUA A;  3C0B A;  1SZ2 A;  2ZWH A;  3H3O B;  1GLF O;  1VQN N;  3LDQ A;  4BY9 C;  5BPL A;  4A2B A;  3K9K A;  4IOX A;  2YHW A;  2WUS A;  1NLV A;  5AQN A;  2Q97 A;  2CH5 A;  3IKM A;  4QS7 A;  1QVF M;  1BA1 A;  1GLJ O;  2Q0R A;  4FOE A;  1NGF A;  3A5L C;  3A0I X;  5AQO A;  3DAW A;  3CJA A;  5AQZ A;  4WCE L;  2D0O A;  5C12 A;  3CCS N;  3E9P A;  3FE1 A;  2W41 A;  4WFB L;  3F5T A;  2FSK A;  5H1S Q;  1C0G A;  2ZF5 O;  2WC9 A;  4GV9 A;  5AQF A;  2V51 B;  5JVG L;  3JS6 A;  4FSV A;  2DPN A;  3CME N;  2AP1 A;  4GV6 A;  4C1N K;  1OKJ A;  4OO1 J;  3IDH A;  4A61 A;  1VQ7 N;  1YVN A;  5E84 A;  3G6E N;  2ZJR L;  4FWQ A;  3SJH A;  2NNW A;  1T6D A;  2A42 A;  1M90 O;  3M5R A;  1VQ4 N;  3CI5 A;  3HSC A;  3E66 A;  4CBW A;  3CJ9 A;  4F9O A;  2NRT A;  1NM1 A;  1WOQ A;  4QS9 A;  1GLA G;  1NGA A;  3QDK A;  1ZXO A;  5AFU H;  1K8K B;  4I6M A;  1LCU A;  3F2K A;  4O5F A;  2GEL A;  5F2R A;  4BR0 A;  2UYT A;  2E2P A;  5AZJ A;  1QQM A;  4IJA A;  3CER A;  4IJN A;  5AQK A;  3UKR A;  3VGM A;  3EE9 A;  4BRA A;  5C0Y A;  1VQ9 N;  4YOY A;  1MDU B;  1S72 N;  4GVE A;  4BR7 A;  3H6E A;  5FPM A;  3KWG A;  4EHT A;  5AZJ B;  3D2E A;  3ENB A;  4JKF A;  1YJ9 N;  1V4S A;  5LY3 A;  3R1X A;  5AQT A;  2JWK A;  3FZM A;  4KH4 A;  5CR4 A;  3BEX A;  3TSP A;  2QWR A;  3TTC A;  4BRH A;  1U2V A;  5JMV A;  2ZJQ L;  4FVU A;  3O9R A;  3ULE A;  4WYB A;  3O5B A;  2NLX A;  3O1B A;  2IVN A;  4WQ5 C;  1DKG D;  4IWV A;  4DB3 A;  3UB5 A;  2ZGZ A;  3U9Z A;  3WEE A;  1XC3 A;  3K9J A;  4O8U A;  2E20 A;  4DCH A;  2GTD A;  3AGR A;  1VQL N;  2H3G X;  2V7Z A;  1ZC6 A;  3MX5 A;  4K25 A;  1DGK N;  3ID8 A;  4U7B A;  3UKR B;  4BQL A;  2YHY A;  3F9M A;  4FOI A;  1RGI A;  4BRQ A;  3LDO A;  3H45 C;  1GLE G;  3EZW A;  3CXC M;  3C6H A;  3WXI A;  3GBT A;  1DEJ A;  3I8B A;  4YOU A;  5EX5 A;  5B8H A;  3VEO A;  4RTF D;  3I56 N;  4BRE A;  3UKU A;  1YAG A;  3VF2 A;  1HPM A;  4GV3 A;  2PFU A;  4JNE A;  5AZI A;  4A5A A;  3O6W A;  3H1V X;  3TSQ A;  1TYQ A;  1YI2 N;  5JLF A;  2E1Y A;  1YIJ N;  3C7N A;  4H0O A;  1Q86 O;  4EFH A;  2E2Q A;  3MCP A;  1N8R O;  4CZJ A;  1ILY A;  3TPQ A;  4CZH A;  1BWF O;  1D4X A;  4FWL A;  4DHY A;  1U2V B;  4XH5 A;  1S3X A;  3CD6 N;  4EHU A;  4H0X B;  3OW2 M;  1NGE A;  1E4G T;  3FZF A;  3CPW M;  1JCG A;  1HUX A;  5FPD A;  1YJN N;  2VCP A;  5BR9 A;  2A5X A;  4WFN L;  5M1Q A;  4Y0W A;  1GLL O;  3DXM A;  3GDQ A;  3EO3 A;  4XH4 A;  4KH5 A;  2QWO A;  5M1F A;  4JKE A;  3NVM A;  5AQJ A;  4IDH A;  4EIA A;  5DM7 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...