2P9SB

Structure of bovine arp2/3 complex co-crystallized with atp/mg2+
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
197
structure length
197
Chain Sequence
TGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-like protein 3
total genus 54
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9sB02
2P9PA 4PKIA 5ELZA 2BUPA 2CH5A 4ISEA 3DJCA 1K8KA 4CI6A 3CJBA 2QWNA 3CQXA 3I33A 2ZF5O 4O8KA 3CJAA 3D2EB 4EIAA 4FL9A 3DXMA 3AAQA 2QXLA 5ADXH 4B1YB 4H5TA 3LM2A 3LDNA 4MLHA 1LOTB 2CGKA 2VWBA 1T6DA 1ZBSA 5AQXA 3S41A 3CJ7A 1D4XA 4CZKA 4CD1A 4L3QA 1X3NA 1BOTO 4CZEA 3L4IA 3L6QA 4FWRA 4K41A 4H03B 3MCPA 4EHUA 5JLHA 2YJEA 4FOIA 3VGLA 4H5NA 5F0XA 1NGEA 3SLCA 3VERA 3AAPA 4BRFA 3VENA 5AZIB 1X3MA 4K25A 1GLDG 3HBTA 1S3XA 3CERA 4FPAA 4BC4A 5AQPA 4Z94A 1S22A 4WYBA 5AQLA 5KPRA 4XH1A 4CBXA 3O08A 1MDUB 4GY2B 4BRMA 3JS6A 1U6ZA 3ULEA 3RSEB 1BG3A 2A41A 3TU5A 2ZWHA 3ATVA 4C23A 4BR5A 1QZ5A 3IMXA 3SMPA 3L0QA 5EXWA 1IG8A 4FWOA 4H5VA 5AZJB 4ISFA 3EO3A 1WOQA 4PL8A 2P9UB 3EKSA 4BRIA 2D1KA 2W41A 3D2EA 4JD2B 1BA1A 2KHOA 1NMDA 3QFPA 1DGKN 1Z6RA 2D0OA 5BPNA 1TYQA 4CZLA 1HKCA 3EKUA 2V7ZA 2FSKA 2ASPA 5AQWA 2QWPA 4XH4A 4F9OA 3GOIA 2CGJA 1SQKA 2NLXA 2P9IB 3BP8A 2HOEA 2WUSA 3WUHA 3I8BA 5AQRA 4JHDA 4JD2A 3O1BA 3WQUA 4B9QA 3WXIA 3QICA 3BUZB 4CBWA 3QDKA 4A2BA 3D2FA 2BTFA 3FE1A 3G25A 5AQHA 3LL3A 3DXKA 5EX5A 3CJ9A 4WQ5C 4BRLA 3UKUB 3U8XA 2E2NA 3GL1A 2FF6A 4LC9B 4H5WA 1NWKA 5BRDA 3FLCO 4QS9A 3VETA 2E1ZA 1EQYA 4K43A 1Y64A 1KAZA 2CH6A 3IFRA 2Q97A 5CE3A 2CGLA 2IVNA 3O80A 3SJHA 1HKBA 3HSCA 2YHYA 3UE5A 1ATSA 3H6EA 3ID8A 1SZ2A 5AQNA 5EOYA 4B1VA 4CZJA 4RWTA 3FGUA 4IWVA 1JCFA 4BVOA 2E88A 4Y0WA 5EVZA 3LM9A 1BU6O 1Z05A 2HMPA 2YCHA 3O4WA 1TYQB 3C0BA 3UKRA 1NLVA 4HTLA 3CI5A 1KXPA 4CZIA 2FLOA 2QWRA 3GDQA 4B1WB 2V7YA 2P9KB 3FZMA 3VEWA 3GE1A 4GNIA 2A40A 1U2VA 1R59O 3HM8A 3ZETA 3ENOA 4YDUC 3RSEA 1ZXOA 1HLUA 3FZFA 3ZEUA 1CZAN 3H46O 4B1XB 2GELA 3CHWA 1NGDA 4YDUA 5AFUH 3J8AA 2VYPA 5AQUA 1GLAG 3H1VX 1NM1A 1HX1A 4BRAA 5AZJA 2I7PA 4CZGA 4EAHD 1HPMA 3HTVA 3LDOA 4KBOA 4HWIA 1ATRA 4FWSA 2QWQA 1GLFO 4M63C 3VGMA 2Q31A 2P9PB 2F9TA 4XH5A 2UYTA 2Q36A 4PKHA 3M3ZA 5AZIA 2FXUA 4IJAA 2E2QA 3BF1A 2P9SB 3WEEA 5AQMA 4BRPA 1MWMA 3LDLA 3U4LA 2P9IA 5BPMA 4B1UB 5KQDA 1JCGA 3O8MA 3VEZA 4JHDB 4WQ5A 4BREA 2EWSA 1RGIA 2OANA 3WXLA 4FOEA 4BRHA 2IVOA 3VPZA 4CZFA 1C0GA 1DEJA 4FWNA 5BN8A 3A5OC 3ATUA 3VEXA 3W0LA 4BRDA 2ASOA 3R6MA 4WQ4C 5BRHA 5BR9A 1T6CA 5AQQA 2YHWA 1QQNA 4BVPA 3GG4A 5KPTA 3CQYA 1MA9B 3CJ1A 4JN4A 3FZKA 3P4IA 2GWJA 1TUYA 3DWLA 4FO0A 3IUCA 5B8HA 5BN9A 2NZTA 5AQJA 4A61A 4BGAA 3EZWA 4BC2A 3QBXA 3WQTA 1MWKA 3CJCA 3H3OB 1GLJO 5JMVA 3DAWA 2V51B 3U9DA 5AFUA 5KPZA 3ZX0A 2F9WA 4DB3A 1E4FT 5E84A 3JXUA 4BR7A 1YVNA 3H45C 5AQTA 5F2RA 1ATNA 4BROA 3ULEB 3SK3A 4CD3A 3CIPA 3MMVA 3C7NB 4I6MA 2P9NB 3CETA 4NB4A 4BR0A 4PL7A 4XEIA 5FPEA 5ADXA 3LDPA 3M1FA 2AP1A 2E8AA 4QS8A 2P9LA 1RDWX 2Q0RA 2YJFA 1XQSC 1G99A 2NRHA 2V52B 5FPDA 4FPBA 2Q0UA 4BRKA 3GBTA 3FZHA 4K42A 1OKJA 1GLLO 4H0VB 4PKGA 3WXKA 1LCUA 4FWPA 4AM6A 3U9ZA 4BR9A 3ZX3A 4IJNA 4EHTA 5BPLA 1E4GT 2IIRA 1TUUA 2J4RA 4WQ4A 4AM7A 3MDQA 1QHAA 1BDGA 1T44A 3TPQA 3MN7A 5AQOA 4BRQA 3A5MC 3AARA 4DCHA 3HI0A 2P9KA 2A6AA 3A5LC 5F1XA 4MO4A 2E20A 4O5FA 3OHRA 1YAGA 3FZLA 3VEOA 5JLFA 3MN6A 3VF6A 3EL2A 2Q1NA 3O6WA 3VEYA 1YUWA 4FWLA 4BQLA 3M6GA 1KAYA 2P9UA 4BRGA 4BQZA 5AQVA 4FWQA 2QWOA 2GTDA 2YI1A 2IVPA 4QS7A 3VOVA 5AQGA 2ITMA 4BG9A 1BUPA 2D0PA 3VF4A 3QB0A 4E1JA 4CZHA 4BR2A 1WUAA 2P9NA 1Q18A 4BRNA 3MN5A 5AQZA 3MN9A 3WXJA 1J6ZA 1NGGA 3KHYA 1V4TA 1C0FA 2ZGZA 1NGCA 1HKGA 5KQ8A 3H1QA 3DXMB 2GEMA 2D4WA 1NGAA 1NGBA 4FSVA 4BGBA 3VEVA 2DPNA 2VCPA 4MLEA 4JAXA 4CBUA 1RFQA 4MO5A 2P9SA 3ZEUB 1X9JA 3SMSA 1HJOA 4FWKA 1NBWA 2HF3A 5E26A 1HUXA 1U2VB 1IJJA 3W3DA 1QQMA 4A62A 5AQFA 2Q2RA 4H5RA 3D7EO 3ENHA 5TKYA 3B8AX 4FWMA 4H0PA 3LDQA 3R8EA 2A3ZA 2QWMA 4RCHA 3IDHA 2ZGYA 4JNEA 4IXCA 4EFHA 1GLBG 3VGKA 1XUPO 4H0YB 4CJ7A 1BWFO 3UKUA 4BC3A 2W40A 1P8ZA 1V4SA 2AA4A 5EY4A 3VF2A 1NGIA 4H0OA 3D2FB 3O5BA 3BF3A 4BG8A 2E2OA 3QMLA 5JICA 2I7NA 2GWKA 2ASMA 4IZ9A 1QQOA 1JCEA 4M7YA 4A2AA 4DHYA 1DKGD 3AY9A 3C7NA 4I6MB 2QW9A 4ISGA 1K8KB 5AQKA 4CZMA 3F9MA 1H1VA 3KVGA 3A0IX 4RTFD 2P9LB 5FPMA 1GLCG 1SAZA 3KZBA 3ZX2A 3FFKB 4NO7A 1YXQA 4H0XB 4BR4A 2GUPA 5LY3A 5AQYA 3UKRB 3QFUA 1NGJA 3O1WA 2A42A 5BRFA 5BREA 4H0TB 5AQSA 2FF3B 3MK6A 3BEXA 3HZ6A 3VESA 5AQIA 2HF4A 3A8YA 2PBDA 1KAXA 1XC3A 3H3NO 3QBWA 4BRCA 1BO5O 1NGFA 3DXKB 5I9EB 3ZETB 3EN9A 2E2PA 2H3GX 3UB5A 1NGHA 3WEEB 1ZC6A 1QZ6A 4IO8A 4J8FA 2QWLA 4B1ZA 1ESVA 4M7XA 3WT0A 2PAVA 2FSNA 1BA0A 1GLEG 3R9PA 2YHXA 5AR0A 4DQ8A 5LJWA 4BC5A 5FPNA 2FSJA 3FR0A 3A5NC 2QM1A 2E1YA 2A5XA 5LJVA
chains in the Genus database with same CATH superfamily
4FK2A 2CH5A 4R5PA 3V6DA 1K8KA 4CGGA 5LMNK 4CK2A 3HO1A 4BE7B 4AHCA 2QXLA 2O8DB 4MLHA 2QA4N 4FZZA 1RT4A 4CD1A 3KK7A 1X3NA 3AO1A 4FWRA 3V9WA 3TR8A 3K59A 4HUEA 1BIUA 4FOIA 1NMNA 3HOSA 4H5NA 2VWJA 5F0XA 3SLCA 3AAPA 3R1XA 1L3SA 3AVIA 2ZJRL 4CEOA 2F8SA 1YJWN 4Z94A 5KPRA 4XH1A 4ILHA 4GV9A 1HNVA 4FK0A 3O08A 4BRMA 5MLCQ 4GKJK 2XY6A 4DTOA 2WOMA 4CHPA 1D9DA 4A5BA 1DLOA 4IG3A 2ZWHA 4O0JA 4C23A 4LD0A 3PIPL 3IMXA 5GAHP 1YJNN 3L0QA 3V1RA 2P9UB 4BRIA 1BIZA 4LF5K 2W41A 3D2EA 4M3XA 3M8SA 3C95A 3AA5X 1Z6RA 4C1NI 3PX4A 1P90A 4CEQA 1TYQA 4H4OA 3TTFA 2A1RA 4GMJB 3S3NA 4KKOA 2O8FA 3L8BA 2Z1JA 4F9OA 3QNOA 1SQKA 2O4IA 3VMFB 4JHDA 4W5OA 2C1IA 3RMAA 4DF8A 4B9QA 1U45A 4OKKA 4H4MA 1F21A 4A2BA 4N5SA 4HCBA 1QS4A 4E7HA 3OYNA 4WQ5C 3C6HA 4WFAL 1S1WA 4WCEL 4BRLA 4B3RK 3T1AA 1NK8A 3KJVA 5A2QO 5DMRA 3VETA 2E1ZA 1EQYA 5M1NA 3BZKA 1KAZA 1EWRA 2Q97A 5CE3A 2CGLA 2WONA 3O80A 3O3HA 2E5LK 1ATSA 2O4GA 1VRTA 1WN7A 4V19S 1XNRK 1U04A 3MXJA 5AQNA 4CIGA 1D9FA 1CLQA 3EZ5A 1JKHA 1SUQA 1JCFA 3D6RA 4JKHA 1IKYA 4OKJA 4Y0WA 1RTIA 3F5TA 4PUOA 1N33K 4RW4A 3N4QA 1NK6A 3UKRA 4FM2A 3DLRA 4ELVA 3VQ7A 1QSLA 3HM9A 5C2FA 1SV5A 3GDQA 4B1WB 3OS2A 5LMUK 2YX6A 2V7YA 2P9KB 4CJSA 2OPRA 3VEWA 1WAJA 1Q82O 3I0RA 4CJPA 2RPIA 2NRTA 4YOTA 3HRGA 4CHNA 1JXEA 4U67L 3FZFA 4CE9A 1CZAN 3VN5A 2GELA 3CHWA 1JXBA 1NGDA 3DLHA 4LSLA 3DYAA 3H1VX 3SUPA 4DV6K 4O4GA 4JV5K 1BCOA 4FW1A 4HWIA 5HRPA 2W6KA 1GLFO 4M63C 4EP4A 3VQEA 2P9PB 2F9TA 3MWTA 4JI5K 2Q36A 4PKHA 1I39A 3K9KA 2E2QA 2P9SB 1OH7A 4GV3A 4AILC 5BPMA 1HR0K 4HUFA 1RDBA 4CFDA 4RW6A 3AA4A 4WQ5A 4BREA 2EWSA 3WXLA 5GADP 1LWEA 2IGIA 3EE8A 4LF4K 4FOEA 2IVOA 4G1QA 3VPZA 1ZBUA 3HSTB 3IG1A 5BN8A 4CGHA 1HYZA 1KVAA 4CF0A 2JGUA 4IEEA 4BDZA 1NJIO 3P39A 2RKIA 5BR9A 3CQ8A 4DFKA 5C24A 4HUGA 3E9OA 3CJ1A 1VSDA 3E1YA 3LP2A 4JN4A 1QVFM 4DTNA 3IUCA 4UQGA 1RBSA 5AQJA 2G8HA 3G71N 1REVA 1GLJO 4DMNA 5JMVA 3DAWA 5AFUA 3HXMA 4UY8O 4LY7A 5JVHL 4KH4A 4DB3A 4FLXA 1E4FT 4BR7A 1YVNA 4DQSA 4DSFA 3LAKA 5F2RA 4OX9K 4CD3A 4OPHA 4BR0A 4N41A 4QS8A 2Q0RA 1XQSC 1G99A 2NRHA 4B08A 4AHRA 3R3LA 1MU2A 3CM6A 3WXMB 1Q86O 4KREA 1VK0A 4H0VB 3WXKA 3AVBA 1IKXA 3U9ZA 1W7AA 3VQ9A 5J2QA 1E4GT 3ZT3A 3PIOL 4OPJA 1TK0A 4KAZA 1VAZA 3THYA 1VQMN 3MN7A 2QK9A 3AARA 4E7LA 4PQUA 4CJTA 4MO4A 2HHSA 1YAGA 3CFOA 4DR6K 5GIOA 5M1OA 3G10A 1IKWA 3VEYA 4DTJA 4CEAA 4BQLA 1LWFA 3M6GA 2PZSA 2ATQA 3L3VA 1YI2N 1X9WA 4PY5A 2DTUA 3G4SN 2QWOA 2YKNA 3OYAA 3VOVA 5AQGA 3JYTA 3VQAA 2ITMA 4BG9A 1BUPA 1K6YA 1A5WA 2HBJA 1CZBA 4BR2A 3U3YA 4A57A 2P9NA 5AQZA 4Z0UA 3RRHA 4DTPA 3K0SA 4DV2K 3MN9A 3WXJA 3KHYA 1V4TA 1C0FA 2ZGZA 3E9LA 3HJFA 3MEGA 1FXXA 4YOVA 4IKFA 3O4QA 4CECA 4FSVA 1W0HA 4X66K 3Q7CA 4JKGA 2VCPA 3DMJA 1QVGM 2NRRA 1JLGA 1NKBA 2HHWA 4DTUA 1UOCA 2KZZA 3JAMO 3HP6A 2FC0A 5E26A 5KGXA 4E0DA 4DG1A 3QERA 3S3MA 2E6MA 3W3DA 1IJJA 4K8ZA 1YVUA 4ILGB 3JSMA 2Q2RA 3QIOA 3D7EO 3ZSRA 5TKYA 3R8EA 3LDQA 1FKPA 3PO4A 3IDHA 3TSQA 4W5TA 4BE2A 2QI2A 4KFBA 5CZ1A 3NHGA 2G8IA 3AVAA 4IXCA 4EFHA 5I42A 2AJQA 4H0YB 1C0TA 4CHQA 1FJGK 3SAFA 3UKUA 4BC3A 4FZYA 4NXNK 4JKFA 3DLLL 4KB0A 4CFAA 4JRPA 4O55A 3VF2A 4H0OA 2OCEA 3CFPA 3O5BA 3BF3A 3BZCA 1GOCA 4Y1CA 2O8BB 4I2QA 2E2OA 3QMLA 3OBWA 2QEXN 2PFUA 4Z4EA 2I7NA 2HSTA 1VRUA 3KKRA 1QSYA 3THWB 1QQOA 1JCEA 4M7YA 2IDOA 1DKGD 1Z25A 2BDPA 3CCLN 4B3OA 3TSPA 2IS3A 4B3MK 4RTFD 2HBMA 4IBNA 1QHTA 4OPKA 3OJSA 2PYJA 1RT5A 4DSJA 3FFKB 4KO0A 2O8BA 5HBMA 4H0XB 4BR4A 4NCAA 1VQ6N 4AHTA 4DQIA 3OJUA 3A2FA 4DUYK 3V9SA 5FLXO 1TVRA 5JVGL 1K8AO 3BY5A 5AQSA 4DV7K 3MK6A 3B6PA 2VG5A 5M1KA 3NH2A 5FRNA 3O9TA 1VQ8N 4DQPA 1NGFA 3TAQA 3ZETB 2E2PA 2H3GX 4KPYA 1ZC6A 3OW2M 1YT3A 3LP1A 4GW6A 4IDKA 4M7XA 2PAVA 1UWBA 1S9GA 3AO4A 3OYKA 4O44A 4BE1A 3S9HA 5AR0A 2B5JA 3OYGA 4BC5A 5FPNA 2KFNA 4DKWA 3NMUA 4E7KA 3FR0A 3CC7N 3L2VA 4AQYK 1EX4A 2P9PA 4PKIA 2BUPA 4ISEA 4DR1K 3DJCA 4O5BA 1WB9A 2PY5A 3CQXA 2I5JA 3LP0A 3J80O 5BR8K 1S1UA 4EP5A 3SUOA 3TARA 2ZE2A 3CJAA 3D2EB 3QNNA 4FL9A 3U3GA 5JS2A 3AAQA 4IG0A 4CJ4A 1B92A 1QTMA 1LOTB 2CGKA 3VQ8A 1ZBSA 3S41A 1M1KO 3MXMA 5K14A 3CJ7A 1NJYA 1JLCA 2YHAA 2OPSA 5CZ2A 3OYBA 3L6QA 1VSKA 4H03B 4H8KA 1RDDA 3VGLA 1NGEA 3VERA 4M3TA 1LW0A 4AHUA 4FJMA 2P5GA 2O8CB 1TKDA 4JI0K 3HBTA 4FPAA 1ASWA 1S22A 1KLMA 4JI2K 3NGZA 3VTHA 3ZSWA 4CBXA 1MDUB 4GY2B 3JS6A 4AH9A 1FKOA 3LPUA 4CJKA 1BG3A 3VQ4A 4LH4A 3TU5A 2HHUA 3ATVA 4BR5A 3NF7A 3SMPA 4CJQA 2QKBA 1WOQA 2D1KA 2PYLA 1BA1A 4YOWA 4YFUA 2KHOA 3CPEA 3O3GA 4JKGB 1DGKN 2G8UA 1RT2A 1BCMA 3EKUA 2V7ZA 3CD6N 2YNFA 2QWPA 3DM2A 3OYIA 3TAGA 3GOIA 2CGJA 4OLBA 2HOEA 2WUSA 3WUHA 4JI7K 4Q0BA 3WQUA 4ID5A 1NNEA 2Z1IA 3QDKA 3K2PA 4JEPA 3L2RA 1WSHA 5EX5A 3UKUB 4KHYA 3U8XA 3OYLA 1UA1A 3ZT4A 1VSFA 4W5NA 2X78A 2FF6A 4LC9B 4H5WA 1NWKA 2KW4A 3FLCO 4K43A 2YHBA 2IVNA 4FM0A 4TSXA 3HSCA 1HNWK 4DFJA 1YIJN 3UE5A 3NDKA 4OO1J 1TL3A 4OVLA 1YTUA 3SUQA 1SZ2A 3ISNC 3KLEA 4DR4K 4FXDA 5EOYA 4B1VA 4CF1A 3RWUA 5J2MA 4BVOA 2A1SA 2KTQA 2E88A 5EVZA 5FROA 1Z05A 2HMPA 2YCHA 3O4WA 3C0BA 4CJLA 3LZJA 1KLNA 4LSNA 3RRGA 1NK0A 2D0AA 4CEBA 1S5JA 4ZHRA 3T3FA 3KK2A 1WBDA 2ZJQL 4CEEA 4GNIA 1HQUA 2A40A 1R59O 3HM8A 2HHQA 1KFSA 3ZETA 2JWKA 4YDUC 3AVNA 3RSEA 1ZXOA 1FW6A 2RF2A 3ZEUA 1EKEA 3H46O 1IBKK 4C1NK 5AFUH 3J8AA 5AQUA 1U48A 1GLAG 4BRAA 4JKEA 4MDAA 5AZJA 2UUCK 3SI6A 4FJ5A 3DLGA 1WSJA 3C6AA 4CZGA 5DK5A 1HPMA 3DLKA 3HTVA 1RTDA 3LDOA 4KBOA 4FWSA 2Q3SA 3VGMA 2Q31A 1W97L 3DRPA 4M3RA 2UYTA 2FXUA 5C12A 3AVJA 3S3OA 4Z4CA 3LDLA 5KQDA 5C10A 4B1UB 3TANA 4Y1DA 4KI4A 1JCGA 4JHDB 2DFFA 1EETA 4E89A 1NKEA 2KQ2A 4DWIA 3SBTA 2IC3A 4WFBL 4J2DA 3UIQA 3NFAA 3RVCA 3W0LA 3HL8A 3R6MA 2GV9A 4CJWA 1QQNA 4BDYA 4BVPA 3GG4A 5HL7L 3CQYA 1EO1A 2HBKA 2HHVA 3TAEA 3FZKA 4J2EA 5DM6L 5B8HA 1S1TA 1A5VA 3KIOA 3PSIA 5BN9A 4KHWA 4A61A 5TKWA 4DSIA 3QBXA 2W42A 4KH6A 3H3OB 5KPZA 4GVMA 3NGYA 1OVYA 5E84A 3KLIA 3H45C 4BROA 4Q5VA 1N32K 3V9UA 4NYNA 3SK3A 3THWA 3CIPA 3C7NB 2P9NB 5FPEA 3IKMA 4CHYA 2HNDA 3LPTA 4QCLA 4YY3K 1X1PA 3E66A 3ALYA 3NE6A 2YJFA 2V52B 5SZTA 3VTIA 1D8YA 4E7JA 4BRKA 2EX3A 4KTWA 4MQ3A 4NYFA 4K42A 3C6UA 1LCUA 3H08A 4BR9A 4CGIA 4IJNA 4EHTA 2IIRA 2B4JA 3G0ZA 3SUNA 3SAHA 3MDQA 3MEEA 5EU7A 3QIPA 1CZ9A 5AQOA 1BI4A 5C2DA 3HI0A 3A5LC 5F1XA 4F4KA 3E01A 2D0CA 3HPOA 3VEOA 2FBYA 5JLFA 3MN6A 3VF6A 3EL2A 3O6WA 1YUWA 2UXDK 2EHGA 1C1CA 1KAYA 1RTJA 1NG9A 2GTDA 4IOAL 4YORA 4CIEA 5CYQA 1TKZA 5HRSA 3QB0A 4CZHA 4W5QA 4DF4A 3HVRA 5H1SQ 1Q18A 2RHKA 4AF1A 4C8OA 3KD5E 1WBBA 1NGGA 5D3GA 4CW7B 3F9KA 1HKGA 2NRVA 1ITGA 4OGEA 1J9AA 4B9SA 4F2RA 4BGBA 3HT3A 4FLTA 4FJJA 3ZSQA 3CMEN 4CJ5A 2P9SA 2WTUA 4WF9L 4DR2K 2VG7A 4O8UA 4FWKA 5C15A 1NBWA 3J7YP 2HF3A 3MXIA 3SCXA 1HUXA 4A62A 3AV9A 1JLQA 1VQNN 4FLYA 4H5RA 3QESA 1HNIA 3ENHA 3S5TA 3B8AX 4H0PA 4FJNA 2F7TA 2WFBA 3QO9A 1RBUA 4DTSA 1DTQA 1XUPO 3ASMA 3HPHA 4FZXC 2W40A 4ICLA 2IAJA 4I9LA 4Z4HA 5EY4A 3D2FB 2Z1HA 3CYGA 1VQON 4CGFA 3N4PA 2BE2A 4KHPK 3C65A 4I6MB 4FM1A 3CYMA 4B9LA 4ISGA 1K8KB 5AQKA 4KH5A 2OYQA 3F9MA 4O0IA 1U4BA 1H1VA 3A0IX 5M1PA 2P9LB 5FPMA 4NXMK 1NJZA 3D0PA 4M42A 1WSFA 3ZX2A 3MWPA 1JL1A 3FFIA 4BWMA 2OPPA 2IOCA 4FJ8A 4CEDA 1Q81O 5AQYA 1VQ7N 1VQPN 4B9UA 1Q8IA 4N47A 1TK8A 5J2PA 3K5OA 3B6OA 3NF9A 2A42A 1VQ5N 2HBLA 4FK4A 2HVIA 5BREA 4QAGA 2UUBK 4DTRA 4BACA 1DT9A 1J54A 4IFEA 3OYEA 3O9QA 1KAXA 4J2AA 4X64K 4J2BA 3WNEA 5I9EB 1BHLA 1NK7A 3WEEB 4IO8A 4CK1A 4J8FA 2QWLA 4K0KK 4DQQA 4W5RA 3U6FA 1C0MA 5C42A 1I94K 1JLAA 1TGOA 2VGNA 1BA0A 4OPAA 2YHXA 1NKCA 3NF8A 4KTZA 1L3TA 4CJRA 3MAQA 3SQ1A 2BGGA 2X6NA 2A5XA 4RW9A 5ELZA 2FBXA 1VQ4N 3OYHA 3CJBA 2QWNA 1UA0A 3PX6A 4O8KA 4LFBK 4CCHA 4EIAA 4JI3K 5CHIA 3RR7A 3AVMA 4B1YB 4H5TA 4JS5A 3LDNA 1IKVA 2VWBA 2NRWA 3PO5A 2QTDA 5AQXA 5J1EA 1SL0A 3V9ZA 1M90O 3KLHA 3WNGA 4CZKA 1IH7A 2GUIA 4IOXA 4L3QA 4BE0A 1BOTO 1HYSA 4FJIA 3L4IA 2QXFA 4K41A 4DFMA 5HRNA 3I0SA 3MCPA 3HPGA 4EHUA 5JLHA 2P5OA 1WSGA 3DLEA 4KHNA 1YHQN 4XJXA 3VENA 4JKDA 1RTHA 4DU3A 3SNNA 2GX9A 4L8RB 2YNIA 1S3XA 3CERA 1Q7YO 5AQPA 4WYBA 1N8RO 4N76A 4FJ7A 1X9SA 1K9MO 1U6ZA 3P83D 1HJRA 3ULEA 2JWLA 5GAEP 4Z4FA 3AVKA 4I2PA 1QZ5A 3TTDA 4DFPA 3SZ2A 4FWOA 4LF7K 1NK4A 2X74A 3EKSA 1NMDA 3QFPA 1VSMA 3K5NA 2D0OA 1SKSA 2VQFK 4C8KA 5J2NA 4CZLA 1U49A 4KHQA 3OYMA 2FSKA 3NH1A 4DR3K 5I3UA 4CJVA 2DY4A 4B3SK 3O3FA 3BP8A 2P9IB 1S9EA 3I8BA 3SJJA 5AQRA 4JD2A 4JYAK 1XNQK 3BUZB 4CBWA 3CCSN 1W2BM 1S1XA 2RN2A 3FE1A 3OA9A 3MECA 3G25A 5AQHA 3AO3A 3DXKA 3LL3A 4CESA 1YTAA 3SV4A 1GOBA 3CPWM 3ZCMA 4CHZA 5JENA 2JLEA 3L2QA 3GL1A 4JLHA 5BRDA 1KSPA 1J5OA 2CH6A 3IS9A 4B8CA 2HW3A 4A59A 1QE1A 1HKBA 2YHYA 2ZJPL 4B3TK 3KLFA 3H6EA 1XHZA 5GIPA 1RDUA 2G8WA 1WAFA 1LW2A 1B9FA 1G15A 4CZJA 4IWVA 1JLBA 3NCIA 5DM7L 1TKTA 2P1JA 1TYQB 1N34K 5JS1A 1NLVA 3CI5A 3SPYA 2QWRA 3SQ0A 4KI6A 3LP3A 1C0UA 5CR4A 3K5LA 4NLCA 4ZTJA 1J5EK 1HQEA 1WSIA 4MFBA 3ENOA 1WNSA 1XI1A 1EXQA 1HLUA 4CJUA 4X62K 2VWKA 1HX1A 3WNHA 4F3TA 1EWQA 2I7PA 3RMBA 4NCBA 1IV0A 4U7BA 1I3AA 2XO7A 3THVA 3QEPA 2RE2A 2VGMA 3M3ZA 1JL2A 4IJAA 3BF1A 3WEEA 5AQMA 4CFCA 1ZYQA 4M3WA 3VEZA 1RGIA 2OANA 4FLVA 4EZ9A 4LH5A 1UAXA 3LAMA 4CZFA 1C0GA 2FBVA 1DEJA 4FWNA 2NNWA 1S72N 2G8FA 3ATUA 1NOZA 1Y97A 2ASOA 3K9JA 4WQ4C 5E41A 5BRHA 1T6CA 2YHWA 2Y1IA 4JK9A 1KVBA 2OZMA 3RMCA 3P4IA 1TUYA 4FO0A 3V9XA 3KD1E 2VG6A 4BGAA 1FK9A 3AA3A 3EZWA 3T1YK 1LWCA 1RDAA 3WQTA 1MWKA 4JI8K 4OLAA 3K5MA 5HP1A 4DU1A 2V51B 2NRZA 4FJKA 1SL1A 3CM5A 3I8DA 4N56A 3SYZA 3M8PA 1VSLA 1TL1A 1KD1O 1HNZK 5AQTA 4PHTX 3DRRA 3ULEB 1IG9A 5HROA 1XMQK 3SBGA 3DRSA 4CJEA 4FLWA 1NJXA 3O9SA 4PL7A 4XEIA 1C1AA 3LDPA 3M1FA 3EYZA 5KGWA 1WLJA 2AP1A 2E8AA 2P9LA 1RDWX 3V1OA 5FPDA 4I7FA 3ZT0A 4FPBA 3NGIA 4FLUA 1OVQA 2Q0UA 3GBTA 1GLLO 4JRQA 4PKGA 3ZX3A 2OZSA 1S6QA 1TUUA 2J4RA 4B9VA 4WQ4A 4AM7A 3LDSA 4CJFA 3K58A 4AHSA 3AGKA 3J81O 3TPQA 2WBNA 4LF6K 1T3VA 4DCHA 2A6AA 5M1FA 2UUAK 2E20A 4O5FA 1NU0A 1N36K 2BH1A 2Q1NA 4DS5A 3CMAN 3I56N 4BRGA 2P9UA 4BQZA 4FWQA 2IVPA 3EY1A 3T7ZA 2KKZA 5KI6A 4DLGA 2D0PA 2NRXA 4CEZA 3THXB 4E1JA 3V1QA 3MN5A 2HNYA 3ID6A 1J6ZA 4FYDA 3KLGA 4F8RA 3CCQN 3H1QA 3O4NA 4DSLA 3L2UA 3NVKA 2D4WA 4QOZB 3PV8A 5T7BA 3C94A 2DPNA 1HNXK 4MLEA 1C6VA 4DR7K 2D0BA 4CBUA 3OY9A 1RFQA 5LL6Z 4FLZA 4MO5A 4LFAK 4KV8A 3SMSA 3HK2A 1T8EA 3L2WA 3DOKA 4IOCL 3SV3A 1D5AA 4DV0K 4G9ZA 2UXBK 3WNFA 2XY8A 3MEDA 1RT3A 3AVLA 3DI6A 2WC9A 4FWMA 2QKKA 3LZIA 4NLBA 3V81A 4RCHA 2QWMA 2ZGYA 4JNEA 1YF5L 1A5XA 5GINA 2G8VA 1E3MA 1OH5A 1Q9XA 1NK5A 3Q7BA 1NGIA 2R7YA 1KRPA 3OBYA 3AVGA 1VSEA 2ASMA 3OYCA 3O9RA 4DHYA 3AY9A 3DOLA 2QW9A 1IO2A 2KLAA 1XMOK 4CZMA 4IDHA 3HOTA 4M3UA 4Z4GA 3VQCA 4IFVA 3SQ4A 2FBTA 3E9PA 1SAZA 3KZBA 3T1HK 2GBZA 1KQSM 4NO7A 4Z4IA 3L3UA 2OPQA 4JI1K 4DLEA 1KTQA 1TAQA 4YHHK 3QFUA 1NGJA 4ID1A 3O1WA 1U47A 3O9UA 4H0TB 3BEXA 2NUBA 1ASVA 3HZ6A 3VESA 4BDPA 3RMDA 2HF4A 2DFEA 3VQDA 4EZ6A 4F2SA 1BO5O 3VQQA 3CCEN 4E3SA 3EN9A 4JKBA 3UB5A 1NGHA 2O8FB 3F2KA 4FCYA 4M3ZA 4JS4A 2UXCK 4B1ZA 1ESVA 4FVMA 4JI6K 3ZSYA 1SKRA 3WT0A 1ZBIA 1C1BA 3HP9A 2FSNA 4GV6A 1GLEG 4DQ8A 5LJWA 2ZM6K 1T03A 4M3YA 3QLHA 5KRSA 3A5NC 1S1VA 2QM1A 4GVEA 5LJVA 3LWLA 4M41A 4CI6A 3OTOK 4FJXA 3CCRN 3NF6A 2F8TA 3TAPA 3NAEA 3I33A 2ZF5O 3LALA 1RT1A 3AVCA 3DXMA 5HOOA 4DV4K 4CFBA 1HMVA 3HVTA 5ADXH 1GOAA 5C0YA 3LM2A 4CHOA 3VQBA 1T6DA 4PWDA 4CJ3A 3PLAA 3OYDA 1DTTA 4LF9K 1D4XA 1HRHA 1L3VA 3BDPA 4DUZK 3ZSOA 4CZEA 1VQLN 3EE9A 3AVHA 3F73A 4CEFA 2OTLN 2YJEA 4BRFA 1VQ9N 3TABA 5AZIB 1L3UA 1X3MA 4K25A 1GLDG 3P1GA 4BC4A 1SKWA 4DV1K 4DTXA 5AQLA 3OS1A 4YOUA 3SAGA 2HHTA 3PUFA 3OS0A 3RSEB 4FJ9A 2A41A 4I9QA 2Y1JA 3KK3A 5EXWA 2HMIA 1IG8A 4H5VA 5AZJB 4ISFA 3EO3A 3TSUA 4PL8A 2E6LA 4JD2B 1ASUA 1Z26A 2KFZA 1LAVA 4FJHA 3THXA 1RNHA 5BPNA 1IBLK 1HKCA 3M8RA 4C8MA 3HYFA 3T19A 4ZTFA 3P38A 2ASPA 3VA0A 4BECA 2HVHA 5AQWA 3MCAB 4XH4A 1IBMK 2ETJA 2NLXA 2XY7A 4KRFA 1XC9A 4ELTA 3MX2A 4CGDA 1W9HA 3O1BA 2YV0X 4B9MA 1NK9A 4GKKK 3WXIA 2DFHA 3D45A 3QICA 3D2FA 2BTFA 2F96A 3CJ9A 3THYB 3EEQA 4KB1A 1JLFA 4WFNL 1TKXA 1YJ9N 1LV5A 2E2NA 3DLBA 2F4VK 2HHXA 4XIUA 3M5RA 2E4LA 4QS9A 1Y64A 3IFRA 3QEXA 3SJHA 3KWGA 3OVNA 3C6TA 3ID8A 3QINA 4DR5K 5KRTA 1SL2A 2UU9K 4RWTA 1XWLA 3FGUA 3M8QA 2X6SA 3LM9A 1BU6O 4E1MA 3RR8A 4C8LA 2XHBA 4F3OA 4CERA 4E7IA 4HTLA 1KXPA 1VHXA 4CZIA 2FLOA 5SWMA 2B6AA 4HTUA 4CGJA 3SQ2A 3FZMA 3CC4N 2YNHA 3GE1A 3NH0A 1U2VA 3SPZA 3VA3A 4FW2A 4X65K 1RBTA 4B1XB 4YDUA 2VYPA 1NM1A 2W6LA 5FDLA 4EAHD 2XY5A 1KC8O 3MX5A 3PY8A 4PA1A 1BI4B 5KTQA 4DU4A 2HHHK 5AJ3K 4B9NA 1RT7A 1ATRA 2QWQA 3IAYA 1ZBFA 1BL3A 4XH5A 2Z1GA 3G6EN 4C8NA 5CY4A 5AZIA 1BQNA 4MDBA 2D5RA 3QEIA 4BRPA 4JI4K 1B9DA 1MWMA 3U4LA 2P9IA 3O8MA 4BRHA 4FJLA 2XRIA 3LWMA 2O8DA 1KFDA 2P51A 3A5OC 3VEXA 2LSNA 4BRDA 2ZD1A 1RBRA 1X9MA 3ZSVA 1CXUA 5AQQA 1RILA 3CCUN 4JK7A 3I55N 5KPTA 2ZQBA 1MA9B 4KHSA 4WE1A 4CIFA 3CFRA 3ZT2A 3QETA 2GWJA 3DWLA 1TK5A 3P31A 2NZTA 4BC2A 4IEIA 3CJCA 1RDCA 3U9DA 3TTCA 3ZX0A 2F9WA 1O1WA 1NOYA 3JXUA 4NCGA 5HLFA 4OJRA 1ATNA 4RG8A 1JLEA 3MMVA 4I6MA 3VQPA 3CETA 4NB4A 5M1QA 5ADXA 1CXQA 4CVNE 2YKMA 5FRMA 2C1GA 4DQRA 4LF8K 3CF5L 3TI0A 2OA8A 3AA2A 2KZMA 4DS4A 1ZBHA 4YNQA 4YOXA 3ITHA 3FZHA 3NVMA 1OKJA 4FWPA 4AM6A 3T69A 5BPLA 2O8CA 4OKEA 2HB5A 2YNGA 1QHAA 4CF8A 3ULDA 1OH6A 1BDGA 3BGRA 1KVCA 1T44A 4BRQA 3A5MC 4R79A 2P9KA 3PSFA 1HPZA 1O13A 3OHRA 3K57A 3KWIA 2OTJN 1BQMA 3FZLA 3RTVA 3J7AP 1J53A 4FWLA 4KHUA 1RCHA 4B8AB 5AQVA 1BGXT 4HHTA 1HYVA 2YI1A 4QS7A 3PX0A 5IT9O 1SS6A 3CCJN 2ITGA 3ENBA 3CCVN 3VF4A 4M45A 4DV3K 3QEWA 4B9TA 3VQ5A 1WUAA 5GAGP 3V4IA 3ZLJA 1TV6A 3AVFA 4BRNA 2O8EB 4BY9C 5CYMA 3ZSZA 2HHIA 3KKSA 1NGCA 4AHVA 5KQ8A 1EP4A 3DXMB 2G8KA 2W00A 2GEMA 3J7ZO 4FJGA 1NGAA 1NGBA 3VEVA 4HVJA 1RT6A 4ILJA 1Q9YA 3IRXA 4DSEA 4JAXA 2O8EA 1VQKN 3CCMN 3L4QA 4ELUA 4YOYA 3CG7A 3ZEUB 1X9JA 1HJOA 3NBPA 1ZBLA 1U2VB 1TAUA 1QQMA 5AQFA 1JJ2M 5IWAK 3KK1A 2A3ZA 4CF9A 4E72A 4RW8A 1ILYA 3ZSXA 3CXCM 1KCFA 1GLBG 3VGKA 1OH8A 4CJ7A 1BWFO 3TAFA 4FVUA 1P8ZA 3VQ6A 3AO2A 1V4SA 2AA4A 4BWJA 4DTMA 3AO5A 4BG8A 4E1NA 5JICA 1BISA 1RBVA 4E19A 1QSSA 2GWKA 4A2AA 4IZ9A 1NJWA 3ZT1A 3C7NA 4KTQA 3AGRA 3CC2N 5C25A 3P5JA 3KVGA 3KTQA 2BANA 4RW7A 1GLCG 4BEBA 3LANA 3TAMA 1YXQA 4DV5K 4LFCK 4OGCA 4DSKA 2GUPA 5LY3A 3UKRB 1QQCA 1VSIA 3OYJA 1R0AA 4CF2A 1S6PA 1VSHA 4HCCA 5BRFA 4JKCA 1VSJA 2FF3B 1T05A 4JKAA 5AQIA 3A8YA 2PBDA 4JK8A 4CK3A 3OYFA 1XC3A 3H3NO 3QBWA 4BRCA 1XHXA 3ZYYX 4K8XA 3DXKB 1LAWA 1K73O 1QZ6A 5HRRA 1T7PA 2HNZA 4A5AA 2VQEK 1N6QA 3TWHA 3R9PA 1YITN 2FSJA 4IFYA 1L5UA 1N5YA 3QEVA 4IO9L 1WSEA 2E1YA
chains in the Genus database with same CATH topology
2P9PA 4PKIA 5ELZA 2BUPA 1VQ4N 2CH5A 4ISEA 3DJCA 1K8KA 4CI6A 3CJBA 2QWNA 3CQXA 3CCRN 3I33A 2ZF5O 4O8KA 3CJAA 3D2EB 4EIAA 4BE7B 4FL9A 5CHIA 3DXMA 5HOOA 3AAQA 2QXLA 5ADXH 5C0YA 4B1YB 4H5TA 3LM2A 3LDNA 4MLHA 1LOTB 2CGKA 2QA4N 2VWBA 1T6DA 1ZBSA 2NRWA 2QTDA 5AQXA 3PLAA 3S41A 1M90O 1M1KO 3CJ7A 1D4XA 4CZKA 4CD1A 4IOXA 3KK7A 4L3QA 1X3NA 1BOTO 4CZEA 1VQLN 3EE9A 3L4IA 3L6QA 4FWRA 4K41A 4H03B 3MCPA 2OTLN 4EHUA 5JLHA 2YJEA 4FOIA 3VGLA 3HOSA 4H5NA 5F0XA 1NGEA 3SLCA 3VERA 3AAPA 4BRFA 1VQ9N 3R1XA 4XJXA 1YHQN 3VENA 5AZIB 2ZJRL 1X3MA 4K25A 4JKDA 1GLDG 1YJWN 2GX9A 3HBTA 1S3XA 3CERA 4FPAA 4BC4A 1Q7YO 5AQPA 4Z94A 1S22A 4WYBA 5AQLA 5KPRA 4XH1A 1N8RO 4ILHA 3VTHA 4CBXA 4GV9A 3O08A 1MDUB 4GY2B 4YOUA 4BRMA 3JS6A 3SAGA 5MLCQ 1K9MO 1U6ZA 3ULEA 3RSEB 1BG3A 2JWLA 5GAEP 2A41A 4A5BA 3TU5A 2ZWHA 3ATVA 4C23A 4BR5A 3PIPL 1QZ5A 3IMXA 3TTDA 5GAHP 3SMPA 3L0QA 1YJNN 5EXWA 1IG8A 4FWOA 4H5VA 5AZJB 4ISFA 3EO3A 1WOQA 3TSUA 4PL8A 2P9UB 3EKSA 4BRIA 2D1KA 2W41A 3D2EA 4JD2B 1BA1A 4YOWA 2KHOA 3CPEA 4JKGB 1NMDA 3QFPA 1DGKN 1Z6RA 4C1NI 2D0OA 1P90A 5BPNA 1TYQA 3TTFA 4CZLA 1HKCA 3EKUA 2V7ZA 2FSKA 4BECA 3P38A 2ASPA 3CD6N 5AQWA 2QWPA 3MCAB 4XH4A 4F9OA 3GOIA 2CGJA 1SQKA 2NLXA 2P9IB 3BP8A 2HOEA 2WUSA 3VMFB 3WUHA 3MX2A 3I8BA 5AQRA 4JHDA 4JD2A 4GVEA 3O1BA 2C1IA 3WQUA 4B9QA 3WXIA 3QICA 3BUZB 4CBWA 3CCSN 3QDKA 4A2BA 1W2BM 3D2FA 4JEPA 2BTFA 3FE1A 3OA9A 3G25A 5AQHA 3LL3A 3DXKA 5EX5A 3CJ9A 4WQ5C 3C6HA 4WFAL 3CPWM 4WCEL 4BRLA 3UKUB 4WFNL 1YJ9N 3U8XA 2E2NA 3GL1A 2FF6A 3M5RA 4H5WA 4LC9B 1NWKA 5BRDA 3FLCO 4QS9A 3VETA 2E1ZA 1EQYA 4K43A 5M1NA 1Y64A 1KAZA 2CH6A 3IFRA 2Q97A 5CE3A 4A59A 2CGLA 2IVNA 3O80A 3SJHA 1HKBA 3HSCA 2YHYA 3KWGA 2ZJPL 1YIJN 3UE5A 1ATSA 4OO1J 3H6EA 5GIPA 3ID8A 1RDUA 1SZ2A 5AQNA 5EOYA 4B1VA 4CZJA 4RWTA 3FGUA 4IWVA 1JCFA 3D6RA 4BVOA 4JKHA 2E88A 4Y0WA 5DM7L 3F5TA 5EVZA 3LM9A 1BU6O 1Z05A 3N4QA 2HMPA 2YCHA 3O4WA 1TYQB 3C0BA 3UKRA 1NLVA 4HTLA 3CI5A 1KXPA 4CZIA 5C2FA 2FLOA 2QWRA 3GDQA 4B1WB 2YX6A 2V7YA 2P9KB 3FZMA 3CC4N 2ZJQL 3VEWA 3GE1A 1Q82O 4GNIA 5CR4A 2A40A 4NLCA 1U2VA 1R59O 3HM8A 2NRTA 4YOTA 3HRGA 3ENOA 2JWKA 3ZETA 4YDUC 3RSEA 1ZXOA 4U67L 1HLUA 3FZFA 3ZEUA 1CZAN 3H46O 4B1XB 2GELA 3CHWA 4C1NK 1NGDA 4YDUA 5AFUH 3J8AA 2VYPA 5AQUA 1GLAG 3H1VX 1NM1A 1HX1A 4JKEA 4MDAA 4BRAA 5AZJA 3C6AA 2I7PA 4CZGA 4EAHD 1KC8O 3MX5A 1HPMA 3HTVA 4U7BA 3LDOA 4KBOA 4HWIA 1ATRA 4FWSA 2RE2A 2QWQA 1GLFO 4M63C 2VGMA 2Q31A 1W97L 3VGMA 2P9PB 2F9TA 3MWTA 2UYTA 4XH5A 2Q36A 4PKHA 3G6EN 3K9KA 3M3ZA 5AZIA 2FXUA 4IJAA 4MDBA 2E2QA 5C12A 3BF1A 2P9SB 3WEEA 5AQMA 4BRPA 4GV3A 1MWMA 3LDLA 3U4LA 2P9IA 5BPMA 4B1UB 5C10A 5KQDA 1JCGA 3O8MA 3VEZA 4JHDB 4WQ5A 4BREA 2EWSA 1RGIA 2OANA 3WXLA 5GADP 3EE8A 4FOEA 3SBTA 4BRHA 2IVOA 3VPZA 4CZFA 4WFBL 1C0GA 1DEJA 4FWNA 2NNWA 5BN8A 1S72N 3A5OC 3ATUA 3VEXA 3RVCA 3W0LA 4BRDA 2ASOA 3K9JA 3R6MA 4WQ4C 4IEEA 1NJIO 3P39A 5BRHA 5BR9A 1T6CA 5AQQA 2YHWA 1QQNA 4JK9A 4JK7A 4BVPA 3CCUN 3I55N 3GG4A 5KPTA 5HL7L 3CQYA 1EO1A 1MA9B 3E9OA 2HBKA 3CJ1A 3E1YA 4JN4A 1QVFM 3FZKA 3P4IA 2GWJA 1TUYA 3DWLA 4FO0A 5DM6L 3IUCA 5B8HA 3P31A 5BN9A 2NZTA 5AQJA 4A61A 4BGAA 3EZWA 5TKWA 4BC2A 3QBXA 3WQTA 1MWKA 4IEIA 3G71N 3CJCA 4KH6A 3H3OB 1GLJO 5JMVA 3DAWA 2V51B 3U9DA 3TTCA 5AFUA 5KPZA 2NRZA 3ZX0A 4UY8O 2F9WA 5JVHL 4KH4A 4DB3A 1OVYA 1E4FT 5E84A 3JXUA 4BR7A 1YVNA 1KD1O 3H45C 5AQTA 5F2RA 1ATNA 4PHTX 4BROA 3ULEB 3SK3A 4CD3A 4OPHA 3CIPA 3SBGA 3MMVA 3C7NB 4I6MA 2P9NB 3CETA 3O9SA 4NB4A 5M1QA 4XEIA 3IKMA 4BR0A 4PL7A 5ADXA 5FPEA 3LDPA 3M1FA 2AP1A 2E8AA 3E66A 4QS8A 2C1GA 2P9LA 1RDWX 2Q0RA 2YJFA 3CF5L 1XQSC 1G99A 2NRHA 2V52B 5FPDA 4FPBA 3VTIA 2Q0UA 3R3LA 4BRKA 4YOXA 3GBTA 3WXMB 1Q86O 3FZHA 4K42A 3NVMA 1OKJA 1GLLO 4H0VB 4PKGA 3WXKA 1LCUA 4FWPA 4AM6A 3U9ZA 4BR9A 3ZX3A 3T69A 4IJNA 4EHTA 5BPLA 1E4GT 2IIRA 1TUUA 2J4RA 4WQ4A 4AM7A 3SAHA 3MDQA 3PIOL 1QHAA 1BDGA 1T44A 1VAZA 3AGKA 3TPQA 1VQMN 3MN7A 5AQOA 4BRQA 2WBNA 3A5MC 1T3VA 3AARA 4DCHA 4R79A 3HI0A 5C2DA 2P9KA 2A6AA 3A5LC 5M1FA 5F1XA 4MO4A 2E20A 4O5FA 1O13A 3OHRA 1YAGA 3KWIA 2OTJN 3FZLA 5GIOA 2BH1A 5M1OA 3VEOA 5JLFA 3MN6A 3VF6A 3EL2A 2Q1NA 3O6WA 3VEYA 1YUWA 4FWLA 4BQLA 3M6GA 3CMAN 3I56N 1KAYA 2P9UA 4BRGA 1YI2N 4BQZA 5AQVA 4FWQA 3G4SN 2QWOA 2GTDA 2YI1A 2IVPA 4IOAL 4QS7A 3T7ZA 5AQGA 3VOVA 2KKZA 4YORA 1SS6A 3CCJN 2ITMA 4BG9A 1BUPA 2D0PA 2NRXA 3ENBA 3CCVN 3VF4A 3QB0A 4E1JA 4CZHA 2HBJA 4BR2A 4A57A 1WUAA 5GAGP 5H1SQ 2P9NA 1Q18A 2RHKA 4BRNA 3MN5A 5AQZA 4AF1A 3ID6A 3MN9A 4BY9C 3WXJA 1J6ZA 1NGGA 3KHYA 1V4TA 1C0FA 2ZGZA 3E9LA 1NGCA 4YOVA 3CCQN 1HKGA 5KQ8A 2NRVA 3H1QA 3DXMB 2W00A 2GEMA 3J7ZO 2D4WA 3NVKA 1NGAA 1NGBA 4FSVA 4BGBA 3VEVA 4ILJA 2DPNA 3Q7CA 4JKGA 2VCPA 4MLEA 3CMEN 4JAXA 4CBUA 1QVGM 1VQKN 1RFQA 2NRRA 3CCMN 4MO5A 3L4QA 2P9SA 4YOYA 3ZEUB 1X9JA 3SMSA 4WF9L 4O8UA 1HJOA 4IOCL 4FWKA 5C15A 1NBWA 2HF3A 5E26A 4G9ZA 1HUXA 1U2VB 1IJJA 3W3DA 1QQMA 4ILGB 4A62A 5AQFA 2Q2RA 1JJ2M 1VQNN 4H5RA 3D7EO 3ENHA 5TKYA 2WC9A 3B8AX 4FWMA 4H0PA 3LDQA 3R8EA 4NLBA 2A3ZA 2QWMA 2F7TA 2WFBA 4RCHA 3IDHA 3TSQA 2ZGYA 2QI2A 4JNEA 4IXCA 4EFHA 1YF5L 1ILYA 3CXCM 1GLBG 3VGKA 1XUPO 5GINA 4H0YB 4CJ7A 1BWFO 3SAFA 3UKUA 4BC3A 4FVUA 2W40A 4JKFA 3DLLL 1P8ZA 1V4SA 2AA4A 3Q7BA 5EY4A 1NGIA 4H0OA 3VF2A 3D2FB 3O5BA 3BF3A 3OBYA 4BG8A 1VQON 2E2OA 3QMLA 5JICA 3OBWA 2QEXN 2PFUA 3N4PA 2I7NA 2HSTA 2GWKA 2ASMA 4IZ9A 1QQOA 1JCEA 4M7YA 3O9RA 4A2AA 3C65A 1DKGD 3AY9A 3C7NA 4I6MB 4DHYA 3CCLN 3AGRA 2QW9A 3TSPA 3CC2N 4ISGA 2KLAA 1K8KB 5AQKA 4CZMA 4KH5A 3F9MA 4IDHA 3HOTA 1H1VA 3KVGA 3A0IX 4RTFD 5M1PA 2HBMA 2P9LB 5FPMA 1GLCG 1SAZA 3E9PA 3KZBA 3ZX2A 4BEBA 3MWPA 3FFKB 1KQSM 4NO7A 1YXQA 4H0XB 1Q81O 4BR4A 2GUPA 5LY3A 5AQYA 3UKRB 1VQ7N 1VQPN 1VQ6N 3QFUA 1NGJA 3O1WA 1VQ5N 2A42A 5JVGL 2HBLA 3O9UA 5BRFA 1K8AO 4JKCA 4H0TB 5BREA 5AQSA 2FF3B 3MK6A 3BEXA 4JKAA 3HZ6A 1DT9A 3VESA 5AQIA 2HF4A 4IFEA 3O9QA 3A8YA 2PBDA 4JK8A 5M1KA 1KAXA 1XC3A 3H3NO 3O9TA 3QBWA 1VQ8N 4BRCA 1BO5O 3ZYYX 1NGFA 3CCEN 3DXKB 5I9EB 3ZETB 3EN9A 2E2PA 2H3GX 4JKBA 3UB5A 1NGHA 3WEEB 1ZC6A 3OW2M 1QZ6A 1K73O 4IO8A 3F2KA 4J8FA 2QWLA 4B1ZA 1ESVA 4M7XA 3WT0A 2PAVA 4A5AA 2FSNA 4GV6A 2VGNA 1BA0A 4OPAA 1GLEG 3R9PA 2YHXA 5AR0A 4DQ8A 1YITN 5LJWA 4BC5A 5FPNA 2FSJA 4DKWA 3NMUA 3FR0A 3CC7N 4IO9L 3A5NC 2QM1A 2E1YA 2A5XA 5LJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9P A;  4PKI A;  5ELZ A;  2BUP A;  2CH5 A;  4ISE A;  3DJC A;  1K8K A;  4CI6 A;  3CJB A;  2QWN A;  3CQX A;  3I33 A;  2ZF5 O;  4O8K A;  3CJA A;  3D2E B;  4EIA A;  4FL9 A;  3DXM A;  3AAQ A;  2QXL A;  5ADX H;  4B1Y B;  4H5T A;  3LM2 A;  3LDN A;  4MLH A;  1LOT B;  2CGK A;  2VWB A;  1T6D A;  1ZBS A;  5AQX A;  3S41 A;  3CJ7 A;  1D4X A;  4CZK A;  4CD1 A;  4L3Q A;  1X3N A;  1BOT O;  4CZE A;  3L4I A;  3L6Q A;  4FWR A;  4K41 A;  4H03 B;  3MCP A;  4EHU A;  5JLH A;  2YJE A;  4FOI A;  3VGL A;  4H5N A;  5F0X A;  1NGE A;  3SLC A;  3VER A;  3AAP A;  4BRF A;  3VEN A;  5AZI B;  1X3M A;  4K25 A;  1GLD G;  3HBT A;  1S3X A;  3CER A;  4FPA A;  4BC4 A;  5AQP A;  4Z94 A;  1S22 A;  4WYB A;  5AQL A;  5KPR A;  4XH1 A;  4CBX A;  3O08 A;  1MDU B;  4GY2 B;  4BRM A;  3JS6 A;  1U6Z A;  3ULE A;  3RSE B;  1BG3 A;  2A41 A;  3TU5 A;  2ZWH A;  3ATV A;  4C23 A;  4BR5 A;  1QZ5 A;  3IMX A;  3SMP A;  3L0Q A;  5EXW A;  1IG8 A;  4FWO A;  4H5V A;  5AZJ B;  4ISF A;  3EO3 A;  1WOQ A;  4PL8 A;  2P9U B;  3EKS A;  4BRI A;  2D1K A;  2W41 A;  3D2E A;  4JD2 B;  1BA1 A;  2KHO A;  1NMD A;  3QFP A;  1DGK N;  1Z6R A;  2D0O A;  5BPN A;  1TYQ A;  4CZL A;  1HKC A;  3EKU A;  2V7Z A;  2FSK A;  2ASP A;  5AQW A;  2QWP A;  4XH4 A;  4F9O A;  3GOI A;  2CGJ A;  1SQK A;  2NLX A;  2P9I B;  3BP8 A;  2HOE A;  2WUS A;  3WUH A;  3I8B A;  5AQR A;  4JHD A;  4JD2 A;  3O1B A;  3WQU A;  4B9Q A;  3WXI A;  3QIC A;  3BUZ B;  4CBW A;  3QDK A;  4A2B A;  3D2F A;  2BTF A;  3FE1 A;  3G25 A;  5AQH A;  3LL3 A;  3DXK A;  5EX5 A;  3CJ9 A;  4WQ5 C;  4BRL A;  3UKU B;  3U8X A;  2E2N A;  3GL1 A;  2FF6 A;  4LC9 B;  4H5W A;  1NWK A;  5BRD A;  3FLC O;  4QS9 A;  3VET A;  2E1Z A;  1EQY A;  4K43 A;  1Y64 A;  1KAZ A;  2CH6 A;  3IFR A;  2Q97 A;  5CE3 A;  2CGL A;  2IVN A;  3O80 A;  3SJH A;  1HKB A;  3HSC A;  2YHY A;  3UE5 A;  1ATS A;  3H6E A;  3ID8 A;  1SZ2 A;  5AQN A;  5EOY A;  4B1V A;  4CZJ A;  4RWT A;  3FGU A;  4IWV A;  1JCF A;  4BVO A;  2E88 A;  4Y0W A;  5EVZ A;  3LM9 A;  1BU6 O;  1Z05 A;  2HMP A;  2YCH A;  3O4W A;  1TYQ B;  3C0B A;  3UKR A;  1NLV A;  4HTL A;  3CI5 A;  1KXP A;  4CZI A;  2FLO A;  2QWR A;  3GDQ A;  4B1W B;  2V7Y A;  2P9K B;  3FZM A;  3VEW A;  3GE1 A;  4GNI A;  2A40 A;  1U2V A;  1R59 O;  3HM8 A;  3ZET A;  3ENO A;  4YDU C;  3RSE A;  1ZXO A;  1HLU A;  3FZF A;  3ZEU A;  1CZA N;  3H46 O;  4B1X B;  2GEL A;  3CHW A;  1NGD A;  4YDU A;  5AFU H;  3J8A A;  2VYP A;  5AQU A;  1GLA G;  3H1V X;  1NM1 A;  1HX1 A;  4BRA A;  5AZJ A;  2I7P A;  4CZG A;  4EAH D;  1HPM A;  3HTV A;  3LDO A;  4KBO A;  4HWI A;  1ATR A;  4FWS A;  2QWQ A;  1GLF O;  4M63 C;  3VGM A;  2Q31 A;  2P9P B;  2F9T A;  4XH5 A;  2UYT A;  2Q36 A;  4PKH A;  3M3Z A;  5AZI A;  2FXU A;  4IJA A;  2E2Q A;  3BF1 A;  2P9S B;  3WEE A;  5AQM A;  4BRP A;  1MWM A;  3LDL A;  3U4L A;  2P9I A;  5BPM A;  4B1U B;  5KQD A;  1JCG A;  3O8M A;  3VEZ A;  4JHD B;  4WQ5 A;  4BRE A;  2EWS A;  1RGI A;  2OAN A;  3WXL A;  4FOE A;  4BRH A;  2IVO A;  3VPZ A;  4CZF A;  1C0G A;  1DEJ A;  4FWN A;  5BN8 A;  3A5O C;  3ATU A;  3VEX A;  3W0L A;  4BRD A;  2ASO A;  3R6M A;  4WQ4 C;  5BRH A;  5BR9 A;  1T6C A;  5AQQ A;  2YHW A;  1QQN A;  4BVP A;  3GG4 A;  5KPT A;  3CQY A;  1MA9 B;  3CJ1 A;  4JN4 A;  3FZK A;  3P4I A;  2GWJ A;  1TUY A;  3DWL A;  4FO0 A;  3IUC A;  5B8H A;  5BN9 A;  2NZT A;  5AQJ A;  4A61 A;  4BGA A;  3EZW A;  4BC2 A;  3QBX A;  3WQT A;  1MWK A;  3CJC A;  3H3O B;  1GLJ O;  5JMV A;  3DAW A;  2V51 B;  3U9D A;  5AFU A;  5KPZ A;  3ZX0 A;  2F9W A;  4DB3 A;  1E4F T;  5E84 A;  3JXU A;  4BR7 A;  1YVN A;  3H45 C;  5AQT A;  5F2R A;  1ATN A;  4BRO A;  3ULE B;  3SK3 A;  4CD3 A;  3CIP A;  3MMV A;  3C7N B;  4I6M A;  2P9N B;  3CET A;  4NB4 A;  4BR0 A;  4PL7 A;  4XEI A;  5FPE A;  5ADX A;  3LDP A;  3M1F A;  2AP1 A;  2E8A A;  4QS8 A;  2P9L A;  1RDW X;  2Q0R A;  2YJF A;  1XQS C;  1G99 A;  2NRH A;  2V52 B;  5FPD A;  4FPB A;  2Q0U A;  4BRK A;  3GBT A;  3FZH A;  4K42 A;  1OKJ A;  1GLL O;  4H0V B;  4PKG A;  3WXK A;  1LCU A;  4FWP A;  4AM6 A;  3U9Z A;  4BR9 A;  3ZX3 A;  4IJN A;  4EHT A;  5BPL A;  1E4G T;  2IIR A;  1TUU A;  2J4R A;  4WQ4 A;  4AM7 A;  3MDQ A;  1QHA A;  1BDG A;  1T44 A;  3TPQ A;  3MN7 A;  5AQO A;  4BRQ A;  3A5M C;  3AAR A;  4DCH A;  3HI0 A;  2P9K A;  2A6A A;  3A5L C;  5F1X A;  4MO4 A;  2E20 A;  4O5F A;  3OHR A;  1YAG A;  3FZL A;  3VEO A;  5JLF A;  3MN6 A;  3VF6 A;  3EL2 A;  2Q1N A;  3O6W A;  3VEY A;  1YUW A;  4FWL A;  4BQL A;  3M6G A;  1KAY A;  2P9U A;  4BRG A;  4BQZ A;  5AQV A;  4FWQ A;  2QWO A;  2GTD A;  2YI1 A;  2IVP A;  4QS7 A;  3VOV A;  5AQG A;  2ITM A;  4BG9 A;  1BUP A;  2D0P A;  3VF4 A;  3QB0 A;  4E1J A;  4CZH A;  4BR2 A;  1WUA A;  2P9N A;  1Q18 A;  4BRN A;  3MN5 A;  5AQZ A;  3MN9 A;  3WXJ A;  1J6Z A;  1NGG A;  3KHY A;  1V4T A;  1C0F A;  2ZGZ A;  1NGC A;  1HKG A;  5KQ8 A;  3H1Q A;  3DXM B;  2GEM A;  2D4W A;  1NGA A;  1NGB A;  4FSV A;  4BGB A;  3VEV A;  2DPN A;  2VCP A;  4MLE A;  4JAX A;  4CBU A;  1RFQ A;  4MO5 A;  2P9S A;  3ZEU B;  1X9J A;  3SMS A;  1HJO A;  4FWK A;  1NBW A;  2HF3 A;  5E26 A;  1HUX A;  1U2V B;  1IJJ A;  3W3D A;  1QQM A;  4A62 A;  5AQF A;  2Q2R A;  4H5R A;  3D7E O;  3ENH A;  5TKY A;  3B8A X;  4FWM A;  4H0P A;  3LDQ A;  3R8E A;  2A3Z A;  2QWM A;  4RCH A;  3IDH A;  2ZGY A;  4JNE A;  4IXC A;  4EFH A;  1GLB G;  3VGK A;  1XUP O;  4H0Y B;  4CJ7 A;  1BWF O;  3UKU A;  4BC3 A;  2W40 A;  1P8Z A;  1V4S A;  2AA4 A;  5EY4 A;  3VF2 A;  1NGI A;  4H0O A;  3D2F B;  3O5B A;  3BF3 A;  4BG8 A;  2E2O A;  3QML A;  5JIC A;  2I7N A;  2GWK A;  2ASM A;  4IZ9 A;  1QQO A;  1JCE A;  4M7Y A;  4A2A A;  4DHY A;  1DKG D;  3AY9 A;  3C7N A;  4I6M B;  2QW9 A;  4ISG A;  1K8K B;  5AQK A;  4CZM A;  3F9M A;  1H1V A;  3KVG A;  3A0I X;  4RTF D;  2P9L B;  5FPM A;  1GLC G;  1SAZ A;  3KZB A;  3ZX2 A;  3FFK B;  4NO7 A;  1YXQ A;  4H0X B;  4BR4 A;  2GUP A;  5LY3 A;  5AQY A;  3UKR B;  3QFU A;  1NGJ A;  3O1W A;  2A42 A;  5BRF A;  5BRE A;  4H0T B;  5AQS A;  2FF3 B;  3MK6 A;  3BEX A;  3HZ6 A;  3VES A;  5AQI A;  2HF4 A;  3A8Y A;  2PBD A;  1KAX A;  1XC3 A;  3H3N O;  3QBW A;  4BRC A;  1BO5 O;  1NGF A;  3DXK B;  5I9E B;  3ZET B;  3EN9 A;  2E2P A;  2H3G X;  3UB5 A;  1NGH A;  3WEE B;  1ZC6 A;  1QZ6 A;  4IO8 A;  4J8F A;  2QWL A;  4B1Z A;  1ESV A;  4M7X A;  3WT0 A;  2PAV A;  2FSN A;  1BA0 A;  1GLE G;  3R9P A;  2YHX A;  5AR0 A;  4DQ8 A;  5LJW A;  4BC5 A;  5FPN A;  2FSJ A;  3FR0 A;  3A5N C;  2QM1 A;  2E1Y A;  2A5X A;  5LJV A; 
#chains in the Genus database with same CATH topology
 4FK2 A;  2CH5 A;  4R5P A;  3V6D A;  1K8K A;  4CGG A;  5LMN K;  4CK2 A;  3HO1 A;  4BE7 B;  4AHC A;  2QXL A;  2O8D B;  4MLH A;  2QA4 N;  4FZZ A;  1RT4 A;  4CD1 A;  3KK7 A;  1X3N A;  3AO1 A;  4FWR A;  3V9W A;  3TR8 A;  3K59 A;  4HUE A;  1BIU A;  4FOI A;  1NMN A;  3HOS A;  4H5N A;  2VWJ A;  5F0X A;  3SLC A;  3AAP A;  3R1X A;  1L3S A;  3AVI A;  2ZJR L;  4CEO A;  2F8S A;  1YJW N;  4Z94 A;  5KPR A;  4XH1 A;  4ILH A;  4GV9 A;  1HNV A;  4FK0 A;  3O08 A;  4BRM A;  5MLC Q;  4GKJ K;  2XY6 A;  4DTO A;  2WOM A;  4CHP A;  1D9D A;  4A5B A;  1DLO A;  4IG3 A;  2ZWH A;  4O0J A;  4C23 A;  4LD0 A;  3PIP L;  3IMX A;  5GAH P;  1YJN N;  3L0Q A;  3V1R A;  2P9U B;  4BRI A;  1BIZ A;  4LF5 K;  2W41 A;  3D2E A;  4M3X A;  3M8S A;  3C95 A;  3AA5 X;  1Z6R A;  4C1N I;  3PX4 A;  1P90 A;  4CEQ A;  1TYQ A;  4H4O A;  3TTF A;  2A1R A;  4GMJ B;  3S3N A;  4KKO A;  2O8F A;  3L8B A;  2Z1J A;  4F9O A;  3QNO A;  1SQK A;  2O4I A;  3VMF B;  4JHD A;  4W5O A;  2C1I A;  3RMA A;  4DF8 A;  4B9Q A;  1U45 A;  4OKK A;  4H4M A;  1F21 A;  4A2B A;  4N5S A;  4HCB A;  1QS4 A;  4E7H A;  3OYN A;  4WQ5 C;  3C6H A;  4WFA L;  1S1W A;  4WCE L;  4BRL A;  4B3R K;  3T1A A;  1NK8 A;  3KJV A;  5A2Q O;  5DMR A;  3VET A;  2E1Z A;  1EQY A;  5M1N A;  3BZK A;  1KAZ A;  1EWR A;  2Q97 A;  5CE3 A;  2CGL A;  2WON A;  3O80 A;  3O3H A;  2E5L K;  1ATS A;  2O4G A;  1VRT A;  1WN7 A;  4V19 S;  1XNR K;  1U04 A;  3MXJ A;  5AQN A;  4CIG A;  1D9F A;  1CLQ A;  3EZ5 A;  1JKH A;  1SUQ A;  1JCF A;  3D6R A;  4JKH A;  1IKY A;  4OKJ A;  4Y0W A;  1RTI A;  3F5T A;  4PUO A;  1N33 K;  4RW4 A;  3N4Q A;  1NK6 A;  3UKR A;  4FM2 A;  3DLR A;  4ELV A;  3VQ7 A;  1QSL A;  3HM9 A;  5C2F A;  1SV5 A;  3GDQ A;  4B1W B;  3OS2 A;  5LMU K;  2YX6 A;  2V7Y A;  2P9K B;  4CJS A;  2OPR A;  3VEW A;  1WAJ A;  1Q82 O;  3I0R A;  4CJP A;  2RPI A;  2NRT A;  4YOT A;  3HRG A;  4CHN A;  1JXE A;  4U67 L;  3FZF A;  4CE9 A;  1CZA N;  3VN5 A;  2GEL A;  3CHW A;  1JXB A;  1NGD A;  3DLH A;  4LSL A;  3DYA A;  3H1V X;  3SUP A;  4DV6 K;  4O4G A;  4JV5 K;  1BCO A;  4FW1 A;  4HWI A;  5HRP A;  2W6K A;  1GLF O;  4M63 C;  4EP4 A;  3VQE A;  2P9P B;  2F9T A;  3MWT A;  4JI5 K;  2Q36 A;  4PKH A;  1I39 A;  3K9K A;  2E2Q A;  2P9S B;  1OH7 A;  4GV3 A;  4AIL C;  5BPM A;  1HR0 K;  4HUF A;  1RDB A;  4CFD A;  4RW6 A;  3AA4 A;  4WQ5 A;  4BRE A;  2EWS A;  3WXL A;  5GAD P;  1LWE A;  2IGI A;  3EE8 A;  4LF4 K;  4FOE A;  2IVO A;  4G1Q A;  3VPZ A;  1ZBU A;  3HST B;  3IG1 A;  5BN8 A;  4CGH A;  1HYZ A;  1KVA A;  4CF0 A;  2JGU A;  4IEE A;  4BDZ A;  1NJI O;  3P39 A;  2RKI A;  5BR9 A;  3CQ8 A;  4DFK A;  5C24 A;  4HUG A;  3E9O A;  3CJ1 A;  1VSD A;  3E1Y A;  3LP2 A;  4JN4 A;  1QVF M;  4DTN A;  3IUC A;  4UQG A;  1RBS A;  5AQJ A;  2G8H A;  3G71 N;  1REV A;  1GLJ O;  4DMN A;  5JMV A;  3DAW A;  5AFU A;  3HXM A;  4UY8 O;  4LY7 A;  5JVH L;  4KH4 A;  4DB3 A;  4FLX A;  1E4F T;  4BR7 A;  1YVN A;  4DQS A;  4DSF A;  3LAK A;  5F2R A;  4OX9 K;  4CD3 A;  4OPH A;  4BR0 A;  4N41 A;  4QS8 A;  2Q0R A;  1XQS C;  1G99 A;  2NRH A;  4B08 A;  4AHR A;  3R3L A;  1MU2 A;  3CM6 A;  3WXM B;  1Q86 O;  4KRE A;  1VK0 A;  4H0V B;  3WXK A;  3AVB A;  1IKX A;  3U9Z A;  1W7A A;  3VQ9 A;  5J2Q A;  1E4G T;  3ZT3 A;  3PIO L;  4OPJ A;  1TK0 A;  4KAZ A;  1VAZ A;  3THY A;  1VQM N;  3MN7 A;  2QK9 A;  3AAR A;  4E7L A;  4PQU A;  4CJT A;  4MO4 A;  2HHS A;  1YAG A;  3CFO A;  4DR6 K;  5GIO A;  5M1O A;  3G10 A;  1IKW A;  3VEY A;  4DTJ A;  4CEA A;  4BQL A;  1LWF A;  3M6G A;  2PZS A;  2ATQ A;  3L3V A;  1YI2 N;  1X9W A;  4PY5 A;  2DTU A;  3G4S N;  2QWO A;  2YKN A;  3OYA A;  3VOV A;  5AQG A;  3JYT A;  3VQA A;  2ITM A;  4BG9 A;  1BUP A;  1K6Y A;  1A5W A;  2HBJ A;  1CZB A;  4BR2 A;  3U3Y A;  4A57 A;  2P9N A;  5AQZ A;  4Z0U A;  3RRH A;  4DTP A;  3K0S A;  4DV2 K;  3MN9 A;  3WXJ A;  3KHY A;  1V4T A;  1C0F A;  2ZGZ A;  3E9L A;  3HJF A;  3MEG A;  1FXX A;  4YOV A;  4IKF A;  3O4Q A;  4CEC A;  4FSV A;  1W0H A;  4X66 K;  3Q7C A;  4JKG A;  2VCP A;  3DMJ A;  1QVG M;  2NRR A;  1JLG A;  1NKB A;  2HHW A;  4DTU A;  1UOC A;  2KZZ A;  3JAM O;  3HP6 A;  2FC0 A;  5E26 A;  5KGX A;  4E0D A;  4DG1 A;  3QER A;  3S3M A;  2E6M A;  3W3D A;  1IJJ A;  4K8Z A;  1YVU A;  4ILG B;  3JSM A;  2Q2R A;  3QIO A;  3D7E O;  3ZSR A;  5TKY A;  3R8E A;  3LDQ A;  1FKP A;  3PO4 A;  3IDH A;  3TSQ A;  4W5T A;  4BE2 A;  2QI2 A;  4KFB A;  5CZ1 A;  3NHG A;  2G8I A;  3AVA A;  4IXC A;  4EFH A;  5I42 A;  2AJQ A;  4H0Y B;  1C0T A;  4CHQ A;  1FJG K;  3SAF A;  3UKU A;  4BC3 A;  4FZY A;  4NXN K;  4JKF A;  3DLL L;  4KB0 A;  4CFA A;  4JRP A;  4O55 A;  3VF2 A;  4H0O A;  2OCE A;  3CFP A;  3O5B A;  3BF3 A;  3BZC A;  1GOC A;  4Y1C A;  2O8B B;  4I2Q A;  2E2O A;  3QML A;  3OBW A;  2QEX N;  2PFU A;  4Z4E A;  2I7N A;  2HST A;  1VRU A;  3KKR A;  1QSY A;  3THW B;  1QQO A;  1JCE A;  4M7Y A;  2IDO A;  1DKG D;  1Z25 A;  2BDP A;  3CCL N;  4B3O A;  3TSP A;  2IS3 A;  4B3M K;  4RTF D;  2HBM A;  4IBN A;  1QHT A;  4OPK A;  3OJS A;  2PYJ A;  1RT5 A;  4DSJ A;  3FFK B;  4KO0 A;  2O8B A;  5HBM A;  4H0X B;  4BR4 A;  4NCA A;  1VQ6 N;  4AHT A;  4DQI A;  3OJU A;  3A2F A;  4DUY K;  3V9S A;  5FLX O;  1TVR A;  5JVG L;  1K8A O;  3BY5 A;  5AQS A;  4DV7 K;  3MK6 A;  3B6P A;  2VG5 A;  5M1K A;  3NH2 A;  5FRN A;  3O9T A;  1VQ8 N;  4DQP A;  1NGF A;  3TAQ A;  3ZET B;  2E2P A;  2H3G X;  4KPY A;  1ZC6 A;  3OW2 M;  1YT3 A;  3LP1 A;  4GW6 A;  4IDK A;  4M7X A;  2PAV A;  1UWB A;  1S9G A;  3AO4 A;  3OYK A;  4O44 A;  4BE1 A;  3S9H A;  5AR0 A;  2B5J A;  3OYG A;  4BC5 A;  5FPN A;  2KFN A;  4DKW A;  3NMU A;  4E7K A;  3FR0 A;  3CC7 N;  3L2V A;  4AQY K;  1EX4 A;  2P9P A;  4PKI A;  2BUP A;  4ISE A;  4DR1 K;  3DJC A;  4O5B A;  1WB9 A;  2PY5 A;  3CQX A;  2I5J A;  3LP0 A;  3J80 O;  5BR8 K;  1S1U A;  4EP5 A;  3SUO A;  3TAR A;  2ZE2 A;  3CJA A;  3D2E B;  3QNN A;  4FL9 A;  3U3G A;  5JS2 A;  3AAQ A;  4IG0 A;  4CJ4 A;  1B92 A;  1QTM A;  1LOT B;  2CGK A;  3VQ8 A;  1ZBS A;  3S41 A;  1M1K O;  3MXM A;  5K14 A;  3CJ7 A;  1NJY A;  1JLC A;  2YHA A;  2OPS A;  5CZ2 A;  3OYB A;  3L6Q A;  1VSK A;  4H03 B;  4H8K A;  1RDD A;  3VGL A;  1NGE A;  3VER A;  4M3T A;  1LW0 A;  4AHU A;  4FJM A;  2P5G A;  2O8C B;  1TKD A;  4JI0 K;  3HBT A;  4FPA A;  1ASW A;  1S22 A;  1KLM A;  4JI2 K;  3NGZ A;  3VTH A;  3ZSW A;  4CBX A;  1MDU B;  4GY2 B;  3JS6 A;  4AH9 A;  1FKO A;  3LPU A;  4CJK A;  1BG3 A;  3VQ4 A;  4LH4 A;  3TU5 A;  2HHU A;  3ATV A;  4BR5 A;  3NF7 A;  3SMP A;  4CJQ A;  2QKB A;  1WOQ A;  2D1K A;  2PYL A;  1BA1 A;  4YOW A;  4YFU A;  2KHO A;  3CPE A;  3O3G A;  4JKG B;  1DGK N;  2G8U A;  1RT2 A;  1BCM A;  3EKU A;  2V7Z A;  3CD6 N;  2YNF A;  2QWP A;  3DM2 A;  3OYI A;  3TAG A;  3GOI A;  2CGJ A;  4OLB A;  2HOE A;  2WUS A;  3WUH A;  4JI7 K;  4Q0B A;  3WQU A;  4ID5 A;  1NNE A;  2Z1I A;  3QDK A;  3K2P A;  4JEP A;  3L2R A;  1WSH A;  5EX5 A;  3UKU B;  4KHY A;  3U8X A;  3OYL A;  1UA1 A;  3ZT4 A;  1VSF A;  4W5N A;  2X78 A;  2FF6 A;  4LC9 B;  4H5W A;  1NWK A;  2KW4 A;  3FLC O;  4K43 A;  2YHB A;  2IVN A;  4FM0 A;  4TSX A;  3HSC A;  1HNW K;  4DFJ A;  1YIJ N;  3UE5 A;  3NDK A;  4OO1 J;  1TL3 A;  4OVL A;  1YTU A;  3SUQ A;  1SZ2 A;  3ISN C;  3KLE A;  4DR4 K;  4FXD A;  5EOY A;  4B1V A;  4CF1 A;  3RWU A;  5J2M A;  4BVO A;  2A1S A;  2KTQ A;  2E88 A;  5EVZ A;  5FRO A;  1Z05 A;  2HMP A;  2YCH A;  3O4W A;  3C0B A;  4CJL A;  3LZJ A;  1KLN A;  4LSN A;  3RRG A;  1NK0 A;  2D0A A;  4CEB A;  1S5J A;  4ZHR A;  3T3F A;  3KK2 A;  1WBD A;  2ZJQ L;  4CEE A;  4GNI A;  1HQU A;  2A40 A;  1R59 O;  3HM8 A;  2HHQ A;  1KFS A;  3ZET A;  2JWK A;  4YDU C;  3AVN A;  3RSE A;  1ZXO A;  1FW6 A;  2RF2 A;  3ZEU A;  1EKE A;  3H46 O;  1IBK K;  4C1N K;  5AFU H;  3J8A A;  5AQU A;  1U48 A;  1GLA G;  4BRA A;  4JKE A;  4MDA A;  5AZJ A;  2UUC K;  3SI6 A;  4FJ5 A;  3DLG A;  1WSJ A;  3C6A A;  4CZG A;  5DK5 A;  1HPM A;  3DLK A;  3HTV A;  1RTD A;  3LDO A;  4KBO A;  4FWS A;  2Q3S A;  3VGM A;  2Q31 A;  1W97 L;  3DRP A;  4M3R A;  2UYT A;  2FXU A;  5C12 A;  3AVJ A;  3S3O A;  4Z4C A;  3LDL A;  5KQD A;  5C10 A;  4B1U B;  3TAN A;  4Y1D A;  4KI4 A;  1JCG A;  4JHD B;  2DFF A;  1EET A;  4E89 A;  1NKE A;  2KQ2 A;  4DWI A;  3SBT A;  2IC3 A;  4WFB L;  4J2D A;  3UIQ A;  3NFA A;  3RVC A;  3W0L A;  3HL8 A;  3R6M A;  2GV9 A;  4CJW A;  1QQN A;  4BDY A;  4BVP A;  3GG4 A;  5HL7 L;  3CQY A;  1EO1 A;  2HBK A;  2HHV A;  3TAE A;  3FZK A;  4J2E A;  5DM6 L;  5B8H A;  1S1T A;  1A5V A;  3KIO A;  3PSI A;  5BN9 A;  4KHW A;  4A61 A;  5TKW A;  4DSI A;  3QBX A;  2W42 A;  4KH6 A;  3H3O B;  5KPZ A;  4GVM A;  3NGY A;  1OVY A;  5E84 A;  3KLI A;  3H45 C;  4BRO A;  4Q5V A;  1N32 K;  3V9U A;  4NYN A;  3SK3 A;  3THW A;  3CIP A;  3C7N B;  2P9N B;  5FPE A;  3IKM A;  4CHY A;  2HND A;  3LPT A;  4QCL A;  4YY3 K;  1X1P A;  3E66 A;  3ALY A;  3NE6 A;  2YJF A;  2V52 B;  5SZT A;  3VTI A;  1D8Y A;  4E7J A;  4BRK A;  2EX3 A;  4KTW A;  4MQ3 A;  4NYF A;  4K42 A;  3C6U A;  1LCU A;  3H08 A;  4BR9 A;  4CGI A;  4IJN A;  4EHT A;  2IIR A;  2B4J A;  3G0Z A;  3SUN A;  3SAH A;  3MDQ A;  3MEE A;  5EU7 A;  3QIP A;  1CZ9 A;  5AQO A;  1BI4 A;  5C2D A;  3HI0 A;  3A5L C;  5F1X A;  4F4K A;  3E01 A;  2D0C A;  3HPO A;  3VEO A;  2FBY A;  5JLF A;  3MN6 A;  3VF6 A;  3EL2 A;  3O6W A;  1YUW A;  2UXD K;  2EHG A;  1C1C A;  1KAY A;  1RTJ A;  1NG9 A;  2GTD A;  4IOA L;  4YOR A;  4CIE A;  5CYQ A;  1TKZ A;  5HRS A;  3QB0 A;  4CZH A;  4W5Q A;  4DF4 A;  3HVR A;  5H1S Q;  1Q18 A;  2RHK A;  4AF1 A;  4C8O A;  3KD5 E;  1WBB A;  1NGG A;  5D3G A;  4CW7 B;  3F9K A;  1HKG A;  2NRV A;  1ITG A;  4OGE A;  1J9A A;  4B9S A;  4F2R A;  4BGB A;  3HT3 A;  4FLT A;  4FJJ A;  3ZSQ A;  3CME N;  4CJ5 A;  2P9S A;  2WTU A;  4WF9 L;  4DR2 K;  2VG7 A;  4O8U A;  4FWK A;  5C15 A;  1NBW A;  3J7Y P;  2HF3 A;  3MXI A;  3SCX A;  1HUX A;  4A62 A;  3AV9 A;  1JLQ A;  1VQN N;  4FLY A;  4H5R A;  3QES A;  1HNI A;  3ENH A;  3S5T A;  3B8A X;  4H0P A;  4FJN A;  2F7T A;  2WFB A;  3QO9 A;  1RBU A;  4DTS A;  1DTQ A;  1XUP O;  3ASM A;  3HPH A;  4FZX C;  2W40 A;  4ICL A;  2IAJ A;  4I9L A;  4Z4H A;  5EY4 A;  3D2F B;  2Z1H A;  3CYG A;  1VQO N;  4CGF A;  3N4P A;  2BE2 A;  4KHP K;  3C65 A;  4I6M B;  4FM1 A;  3CYM A;  4B9L A;  4ISG A;  1K8K B;  5AQK A;  4KH5 A;  2OYQ A;  3F9M A;  4O0I A;  1U4B A;  1H1V A;  3A0I X;  5M1P A;  2P9L B;  5FPM A;  4NXM K;  1NJZ A;  3D0P A;  4M42 A;  1WSF A;  3ZX2 A;  3MWP A;  1JL1 A;  3FFI A;  4BWM A;  2OPP A;  2IOC A;  4FJ8 A;  4CED A;  1Q81 O;  5AQY A;  1VQ7 N;  1VQP N;  4B9U A;  1Q8I A;  4N47 A;  1TK8 A;  5J2P A;  3K5O A;  3B6O A;  3NF9 A;  2A42 A;  1VQ5 N;  2HBL A;  4FK4 A;  2HVI A;  5BRE A;  4QAG A;  2UUB K;  4DTR A;  4BAC A;  1DT9 A;  1J54 A;  4IFE A;  3OYE A;  3O9Q A;  1KAX A;  4J2A A;  4X64 K;  4J2B A;  3WNE A;  5I9E B;  1BHL A;  1NK7 A;  3WEE B;  4IO8 A;  4CK1 A;  4J8F A;  2QWL A;  4K0K K;  4DQQ A;  4W5R A;  3U6F A;  1C0M A;  5C42 A;  1I94 K;  1JLA A;  1TGO A;  2VGN A;  1BA0 A;  4OPA A;  2YHX A;  1NKC A;  3NF8 A;  4KTZ A;  1L3T A;  4CJR A;  3MAQ A;  3SQ1 A;  2BGG A;  2X6N A;  2A5X A;  4RW9 A;  5ELZ A;  2FBX A;  1VQ4 N;  3OYH A;  3CJB A;  2QWN A;  1UA0 A;  3PX6 A;  4O8K A;  4LFB K;  4CCH A;  4EIA A;  4JI3 K;  5CHI A;  3RR7 A;  3AVM A;  4B1Y B;  4H5T A;  4JS5 A;  3LDN A;  1IKV A;  2VWB A;  2NRW A;  3PO5 A;  2QTD A;  5AQX A;  5J1E A;  1SL0 A;  3V9Z A;  1M90 O;  3KLH A;  3WNG A;  4CZK A;  1IH7 A;  2GUI A;  4IOX A;  4L3Q A;  4BE0 A;  1BOT O;  1HYS A;  4FJI A;  3L4I A;  2QXF A;  4K41 A;  4DFM A;  5HRN A;  3I0S A;  3MCP A;  3HPG A;  4EHU A;  5JLH A;  2P5O A;  1WSG A;  3DLE A;  4KHN A;  1YHQ N;  4XJX A;  3VEN A;  4JKD A;  1RTH A;  4DU3 A;  3SNN A;  2GX9 A;  4L8R B;  2YNI A;  1S3X A;  3CER A;  1Q7Y O;  5AQP A;  4WYB A;  1N8R O;  4N76 A;  4FJ7 A;  1X9S A;  1K9M O;  1U6Z A;  3P83 D;  1HJR A;  3ULE A;  2JWL A;  5GAE P;  4Z4F A;  3AVK A;  4I2P A;  1QZ5 A;  3TTD A;  4DFP A;  3SZ2 A;  4FWO A;  4LF7 K;  1NK4 A;  2X74 A;  3EKS A;  1NMD A;  3QFP A;  1VSM A;  3K5N A;  2D0O A;  1SKS A;  2VQF K;  4C8K A;  5J2N A;  4CZL A;  1U49 A;  4KHQ A;  3OYM A;  2FSK A;  3NH1 A;  4DR3 K;  5I3U A;  4CJV A;  2DY4 A;  4B3S K;  3O3F A;  3BP8 A;  2P9I B;  1S9E A;  3I8B A;  3SJJ A;  5AQR A;  4JD2 A;  4JYA K;  1XNQ K;  3BUZ B;  4CBW A;  3CCS N;  1W2B M;  1S1X A;  2RN2 A;  3FE1 A;  3OA9 A;  3MEC A;  3G25 A;  5AQH A;  3AO3 A;  3DXK A;  3LL3 A;  4CES A;  1YTA A;  3SV4 A;  1GOB A;  3CPW M;  3ZCM A;  4CHZ A;  5JEN A;  2JLE A;  3L2Q A;  3GL1 A;  4JLH A;  5BRD A;  1KSP A;  1J5O A;  2CH6 A;  3IS9 A;  4B8C A;  2HW3 A;  4A59 A;  1QE1 A;  1HKB A;  2YHY A;  2ZJP L;  4B3T K;  3KLF A;  3H6E A;  1XHZ A;  5GIP A;  1RDU A;  2G8W A;  1WAF A;  1LW2 A;  1B9F A;  1G15 A;  4CZJ A;  4IWV A;  1JLB A;  3NCI A;  5DM7 L;  1TKT A;  2P1J A;  1TYQ B;  1N34 K;  5JS1 A;  1NLV A;  3CI5 A;  3SPY A;  2QWR A;  3SQ0 A;  4KI6 A;  3LP3 A;  1C0U A;  5CR4 A;  3K5L A;  4NLC A;  4ZTJ A;  1J5E K;  1HQE A;  1WSI A;  4MFB A;  3ENO A;  1WNS A;  1XI1 A;  1EXQ A;  1HLU A;  4CJU A;  4X62 K;  2VWK A;  1HX1 A;  3WNH A;  4F3T A;  1EWQ A;  2I7P A;  3RMB A;  4NCB A;  1IV0 A;  4U7B A;  1I3A A;  2XO7 A;  3THV A;  3QEP A;  2RE2 A;  2VGM A;  3M3Z A;  1JL2 A;  4IJA A;  3BF1 A;  3WEE A;  5AQM A;  4CFC A;  1ZYQ A;  4M3W A;  3VEZ A;  1RGI A;  2OAN A;  4FLV A;  4EZ9 A;  4LH5 A;  1UAX A;  3LAM A;  4CZF A;  1C0G A;  2FBV A;  1DEJ A;  4FWN A;  2NNW A;  1S72 N;  2G8F A;  3ATU A;  1NOZ A;  1Y97 A;  2ASO A;  3K9J A;  4WQ4 C;  5E41 A;  5BRH A;  1T6C A;  2YHW A;  2Y1I A;  4JK9 A;  1KVB A;  2OZM A;  3RMC A;  3P4I A;  1TUY A;  4FO0 A;  3V9X A;  3KD1 E;  2VG6 A;  4BGA A;  1FK9 A;  3AA3 A;  3EZW A;  3T1Y K;  1LWC A;  1RDA A;  3WQT A;  1MWK A;  4JI8 K;  4OLA A;  3K5M A;  5HP1 A;  4DU1 A;  2V51 B;  2NRZ A;  4FJK A;  1SL1 A;  3CM5 A;  3I8D A;  4N56 A;  3SYZ A;  3M8P A;  1VSL A;  1TL1 A;  1KD1 O;  1HNZ K;  5AQT A;  4PHT X;  3DRR A;  3ULE B;  1IG9 A;  5HRO A;  1XMQ K;  3SBG A;  3DRS A;  4CJE A;  4FLW A;  1NJX A;  3O9S A;  4PL7 A;  4XEI A;  1C1A A;  3LDP A;  3M1F A;  3EYZ A;  5KGW A;  1WLJ A;  2AP1 A;  2E8A A;  2P9L A;  1RDW X;  3V1O A;  5FPD A;  4I7F A;  3ZT0 A;  4FPB A;  3NGI A;  4FLU A;  1OVQ A;  2Q0U A;  3GBT A;  1GLL O;  4JRQ A;  4PKG A;  3ZX3 A;  2OZS A;  1S6Q A;  1TUU A;  2J4R A;  4B9V A;  4WQ4 A;  4AM7 A;  3LDS A;  4CJF A;  3K58 A;  4AHS A;  3AGK A;  3J81 O;  3TPQ A;  2WBN A;  4LF6 K;  1T3V A;  4DCH A;  2A6A A;  5M1F A;  2UUA K;  2E20 A;  4O5F A;  1NU0 A;  1N36 K;  2BH1 A;  2Q1N A;  4DS5 A;  3CMA N;  3I56 N;  4BRG A;  2P9U A;  4BQZ A;  4FWQ A;  2IVP A;  3EY1 A;  3T7Z A;  2KKZ A;  5KI6 A;  4DLG A;  2D0P A;  2NRX A;  4CEZ A;  3THX B;  4E1J A;  3V1Q A;  3MN5 A;  2HNY A;  3ID6 A;  1J6Z A;  4FYD A;  3KLG A;  4F8R A;  3CCQ N;  3H1Q A;  3O4N A;  4DSL A;  3L2U A;  3NVK A;  2D4W A;  4QOZ B;  3PV8 A;  5T7B A;  3C94 A;  2DPN A;  1HNX K;  4MLE A;  1C6V A;  4DR7 K;  2D0B A;  4CBU A;  3OY9 A;  1RFQ A;  5LL6 Z;  4FLZ A;  4MO5 A;  4LFA K;  4KV8 A;  3SMS A;  3HK2 A;  1T8E A;  3L2W A;  3DOK A;  4IOC L;  3SV3 A;  1D5A A;  4DV0 K;  4G9Z A;  2UXB K;  3WNF A;  2XY8 A;  3MED A;  1RT3 A;  3AVL A;  3DI6 A;  2WC9 A;  4FWM A;  2QKK A;  3LZI A;  4NLB A;  3V81 A;  4RCH A;  2QWM A;  2ZGY A;  4JNE A;  1YF5 L;  1A5X A;  5GIN A;  2G8V A;  1E3M A;  1OH5 A;  1Q9X A;  1NK5 A;  3Q7B A;  1NGI A;  2R7Y A;  1KRP A;  3OBY A;  3AVG A;  1VSE A;  2ASM A;  3OYC A;  3O9R A;  4DHY A;  3AY9 A;  3DOL A;  2QW9 A;  1IO2 A;  2KLA A;  1XMO K;  4CZM A;  4IDH A;  3HOT A;  4M3U A;  4Z4G A;  3VQC A;  4IFV A;  3SQ4 A;  2FBT A;  3E9P A;  1SAZ A;  3KZB A;  3T1H K;  2GBZ A;  1KQS M;  4NO7 A;  4Z4I A;  3L3U A;  2OPQ A;  4JI1 K;  4DLE A;  1KTQ A;  1TAQ A;  4YHH K;  3QFU A;  1NGJ A;  4ID1 A;  3O1W A;  1U47 A;  3O9U A;  4H0T B;  3BEX A;  2NUB A;  1ASV A;  3HZ6 A;  3VES A;  4BDP A;  3RMD A;  2HF4 A;  2DFE A;  3VQD A;  4EZ6 A;  4F2S A;  1BO5 O;  3VQQ A;  3CCE N;  4E3S A;  3EN9 A;  4JKB A;  3UB5 A;  1NGH A;  2O8F B;  3F2K A;  4FCY A;  4M3Z A;  4JS4 A;  2UXC K;  4B1Z A;  1ESV A;  4FVM A;  4JI6 K;  3ZSY A;  1SKR A;  3WT0 A;  1ZBI A;  1C1B A;  3HP9 A;  2FSN A;  4GV6 A;  1GLE G;  4DQ8 A;  5LJW A;  2ZM6 K;  1T03 A;  4M3Y A;  3QLH A;  5KRS A;  3A5N C;  1S1V A;  2QM1 A;  4GVE A;  5LJV A;  3LWL A;  4M41 A;  4CI6 A;  3OTO K;  4FJX A;  3CCR N;  3NF6 A;  2F8T A;  3TAP A;  3NAE A;  3I33 A;  2ZF5 O;  3LAL A;  1RT1 A;  3AVC A;  3DXM A;  5HOO A;  4DV4 K;  4CFB A;  1HMV A;  3HVT A;  5ADX H;  1GOA A;  5C0Y A;  3LM2 A;  4CHO A;  3VQB A;  1T6D A;  4PWD A;  4CJ3 A;  3PLA A;  3OYD A;  1DTT A;  4LF9 K;  1D4X A;  1HRH A;  1L3V A;  3BDP A;  4DUZ K;  3ZSO A;  4CZE A;  1VQL N;  3EE9 A;  3AVH A;  3F73 A;  4CEF A;  2OTL N;  2YJE A;  4BRF A;  1VQ9 N;  3TAB A;  5AZI B;  1L3U A;  1X3M A;  4K25 A;  1GLD G;  3P1G A;  4BC4 A;  1SKW A;  4DV1 K;  4DTX A;  5AQL A;  3OS1 A;  4YOU A;  3SAG A;  2HHT A;  3PUF A;  3OS0 A;  3RSE B;  4FJ9 A;  2A41 A;  4I9Q A;  2Y1J A;  3KK3 A;  5EXW A;  2HMI A;  1IG8 A;  4H5V A;  5AZJ B;  4ISF A;  3EO3 A;  3TSU A;  4PL8 A;  2E6L A;  4JD2 B;  1ASU A;  1Z26 A;  2KFZ A;  1LAV A;  4FJH A;  3THX A;  1RNH A;  5BPN A;  1IBL K;  1HKC A;  3M8R A;  4C8M A;  3HYF A;  3T19 A;  4ZTF A;  3P38 A;  2ASP A;  3VA0 A;  4BEC A;  2HVH A;  5AQW A;  3MCA B;  4XH4 A;  1IBM K;  2ETJ A;  2NLX A;  2XY7 A;  4KRF A;  1XC9 A;  4ELT A;  3MX2 A;  4CGD A;  1W9H A;  3O1B A;  2YV0 X;  4B9M A;  1NK9 A;  4GKK K;  3WXI A;  2DFH A;  3D45 A;  3QIC A;  3D2F A;  2BTF A;  2F96 A;  3CJ9 A;  3THY B;  3EEQ A;  4KB1 A;  1JLF A;  4WFN L;  1TKX A;  1YJ9 N;  1LV5 A;  2E2N A;  3DLB A;  2F4V K;  2HHX A;  4XIU A;  3M5R A;  2E4L A;  4QS9 A;  1Y64 A;  3IFR A;  3QEX A;  3SJH A;  3KWG A;  3OVN A;  3C6T A;  3ID8 A;  3QIN A;  4DR5 K;  5KRT A;  1SL2 A;  2UU9 K;  4RWT A;  1XWL A;  3FGU A;  3M8Q A;  2X6S A;  3LM9 A;  1BU6 O;  4E1M A;  3RR8 A;  4C8L A;  2XHB A;  4F3O A;  4CER A;  4E7I A;  4HTL A;  1KXP A;  1VHX A;  4CZI A;  2FLO A;  5SWM A;  2B6A A;  4HTU A;  4CGJ A;  3SQ2 A;  3FZM A;  3CC4 N;  2YNH A;  3GE1 A;  3NH0 A;  1U2V A;  3SPZ A;  3VA3 A;  4FW2 A;  4X65 K;  1RBT A;  4B1X B;  4YDU A;  2VYP A;  1NM1 A;  2W6L A;  5FDL A;  4EAH D;  2XY5 A;  1KC8 O;  3MX5 A;  3PY8 A;  4PA1 A;  1BI4 B;  5KTQ A;  4DU4 A;  2HHH K;  5AJ3 K;  4B9N A;  1RT7 A;  1ATR A;  2QWQ A;  3IAY A;  1ZBF A;  1BL3 A;  4XH5 A;  2Z1G A;  3G6E N;  4C8N A;  5CY4 A;  5AZI A;  1BQN A;  4MDB A;  2D5R A;  3QEI A;  4BRP A;  4JI4 K;  1B9D A;  1MWM A;  3U4L A;  2P9I A;  3O8M A;  4BRH A;  4FJL A;  2XRI A;  3LWM A;  2O8D A;  1KFD A;  2P51 A;  3A5O C;  3VEX A;  2LSN A;  4BRD A;  2ZD1 A;  1RBR A;  1X9M A;  3ZSV A;  1CXU A;  5AQQ A;  1RIL A;  3CCU N;  4JK7 A;  3I55 N;  5KPT A;  2ZQB A;  1MA9 B;  4KHS A;  4WE1 A;  4CIF A;  3CFR A;  3ZT2 A;  3QET A;  2GWJ A;  3DWL A;  1TK5 A;  3P31 A;  2NZT A;  4BC2 A;  4IEI A;  3CJC A;  1RDC A;  3U9D A;  3TTC A;  3ZX0 A;  2F9W A;  1O1W A;  1NOY A;  3JXU A;  4NCG A;  5HLF A;  4OJR A;  1ATN A;  4RG8 A;  1JLE A;  3MMV A;  4I6M A;  3VQP A;  3CET A;  4NB4 A;  5M1Q A;  5ADX A;  1CXQ A;  4CVN E;  2YKM A;  5FRM A;  2C1G A;  4DQR A;  4LF8 K;  3CF5 L;  3TI0 A;  2OA8 A;  3AA2 A;  2KZM A;  4DS4 A;  1ZBH A;  4YNQ A;  4YOX A;  3ITH A;  3FZH A;  3NVM A;  1OKJ A;  4FWP A;  4AM6 A;  3T69 A;  5BPL A;  2O8C A;  4OKE A;  2HB5 A;  2YNG A;  1QHA A;  4CF8 A;  3ULD A;  1OH6 A;  1BDG A;  3BGR A;  1KVC A;  1T44 A;  4BRQ A;  3A5M C;  4R79 A;  2P9K A;  3PSF A;  1HPZ A;  1O13 A;  3OHR A;  3K57 A;  3KWI A;  2OTJ N;  1BQM A;  3FZL A;  3RTV A;  3J7A P;  1J53 A;  4FWL A;  4KHU A;  1RCH A;  4B8A B;  5AQV A;  1BGX T;  4HHT A;  1HYV A;  2YI1 A;  4QS7 A;  3PX0 A;  5IT9 O;  1SS6 A;  3CCJ N;  2ITG A;  3ENB A;  3CCV N;  3VF4 A;  4M45 A;  4DV3 K;  3QEW A;  4B9T A;  3VQ5 A;  1WUA A;  5GAG P;  3V4I A;  3ZLJ A;  1TV6 A;  3AVF A;  4BRN A;  2O8E B;  4BY9 C;  5CYM A;  3ZSZ A;  2HHI A;  3KKS A;  1NGC A;  4AHV A;  5KQ8 A;  1EP4 A;  3DXM B;  2G8K A;  2W00 A;  2GEM A;  3J7Z O;  4FJG A;  1NGA A;  1NGB A;  3VEV A;  4HVJ A;  1RT6 A;  4ILJ A;  1Q9Y A;  3IRX A;  4DSE A;  4JAX A;  2O8E A;  1VQK N;  3CCM N;  3L4Q A;  4ELU A;  4YOY A;  3CG7 A;  3ZEU B;  1X9J A;  1HJO A;  3NBP A;  1ZBL A;  1U2V B;  1TAU A;  1QQM A;  5AQF A;  1JJ2 M;  5IWA K;  3KK1 A;  2A3Z A;  4CF9 A;  4E72 A;  4RW8 A;  1ILY A;  3ZSX A;  3CXC M;  1KCF A;  1GLB G;  3VGK A;  1OH8 A;  4CJ7 A;  1BWF O;  3TAF A;  4FVU A;  1P8Z A;  3VQ6 A;  3AO2 A;  1V4S A;  2AA4 A;  4BWJ A;  4DTM A;  3AO5 A;  4BG8 A;  4E1N A;  5JIC A;  1BIS A;  1RBV A;  4E19 A;  1QSS A;  2GWK A;  4A2A A;  4IZ9 A;  1NJW A;  3ZT1 A;  3C7N A;  4KTQ A;  3AGR A;  3CC2 N;  5C25 A;  3P5J A;  3KVG A;  3KTQ A;  2BAN A;  4RW7 A;  1GLC G;  4BEB A;  3LAN A;  3TAM A;  1YXQ A;  4DV5 K;  4LFC K;  4OGC A;  4DSK A;  2GUP A;  5LY3 A;  3UKR B;  1QQC A;  1VSI A;  3OYJ A;  1R0A A;  4CF2 A;  1S6P A;  1VSH A;  4HCC A;  5BRF A;  4JKC A;  1VSJ A;  2FF3 B;  1T05 A;  4JKA A;  5AQI A;  3A8Y A;  2PBD A;  4JK8 A;  4CK3 A;  3OYF A;  1XC3 A;  3H3N O;  3QBW A;  4BRC A;  1XHX A;  3ZYY X;  4K8X A;  3DXK B;  1LAW A;  1K73 O;  1QZ6 A;  5HRR A;  1T7P A;  2HNZ A;  4A5A A;  2VQE K;  1N6Q A;  3TWH A;  3R9P A;  1YIT N;  2FSJ A;  4IFY A;  1L5U A;  1N5Y A;  3QEV A;  4IO9 L;  1WSE A;  2E1Y A; 
#chains in the Genus database with same CATH homology
 2P9P A;  4PKI A;  5ELZ A;  2BUP A;  1VQ4 N;  2CH5 A;  4ISE A;  3DJC A;  1K8K A;  4CI6 A;  3CJB A;  2QWN A;  3CQX A;  3CCR N;  3I33 A;  2ZF5 O;  4O8K A;  3CJA A;  3D2E B;  4EIA A;  4BE7 B;  4FL9 A;  5CHI A;  3DXM A;  5HOO A;  3AAQ A;  2QXL A;  5ADX H;  5C0Y A;  4B1Y B;  4H5T A;  3LM2 A;  3LDN A;  4MLH A;  1LOT B;  2CGK A;  2QA4 N;  2VWB A;  1T6D A;  1ZBS A;  2NRW A;  2QTD A;  5AQX A;  3PLA A;  3S41 A;  1M90 O;  1M1K O;  3CJ7 A;  1D4X A;  4CZK A;  4CD1 A;  4IOX A;  3KK7 A;  4L3Q A;  1X3N A;  1BOT O;  4CZE A;  1VQL N;  3EE9 A;  3L4I A;  3L6Q A;  4FWR A;  4K41 A;  4H03 B;  3MCP A;  2OTL N;  4EHU A;  5JLH A;  2YJE A;  4FOI A;  3VGL A;  3HOS A;  4H5N A;  5F0X A;  1NGE A;  3SLC A;  3VER A;  3AAP A;  4BRF A;  1VQ9 N;  3R1X A;  4XJX A;  1YHQ N;  3VEN A;  5AZI B;  2ZJR L;  1X3M A;  4K25 A;  4JKD A;  1GLD G;  1YJW N;  2GX9 A;  3HBT A;  1S3X A;  3CER A;  4FPA A;  4BC4 A;  1Q7Y O;  5AQP A;  4Z94 A;  1S22 A;  4WYB A;  5AQL A;  5KPR A;  4XH1 A;  1N8R O;  4ILH A;  3VTH A;  4CBX A;  4GV9 A;  3O08 A;  1MDU B;  4GY2 B;  4YOU A;  4BRM A;  3JS6 A;  3SAG A;  5MLC Q;  1K9M O;  1U6Z A;  3ULE A;  3RSE B;  1BG3 A;  2JWL A;  5GAE P;  2A41 A;  4A5B A;  3TU5 A;  2ZWH A;  3ATV A;  4C23 A;  4BR5 A;  3PIP L;  1QZ5 A;  3IMX A;  3TTD A;  5GAH P;  3SMP A;  3L0Q A;  1YJN N;  5EXW A;  1IG8 A;  4FWO A;  4H5V A;  5AZJ B;  4ISF A;  3EO3 A;  1WOQ A;  3TSU A;  4PL8 A;  2P9U B;  3EKS A;  4BRI A;  2D1K A;  2W41 A;  3D2E A;  4JD2 B;  1BA1 A;  4YOW A;  2KHO A;  3CPE A;  4JKG B;  1NMD A;  3QFP A;  1DGK N;  1Z6R A;  4C1N I;  2D0O A;  1P90 A;  5BPN A;  1TYQ A;  3TTF A;  4CZL A;  1HKC A;  3EKU A;  2V7Z A;  2FSK A;  4BEC A;  3P38 A;  2ASP A;  3CD6 N;  5AQW A;  2QWP A;  3MCA B;  4XH4 A;  4F9O A;  3GOI A;  2CGJ A;  1SQK A;  2NLX A;  2P9I B;  3BP8 A;  2HOE A;  2WUS A;  3VMF B;  3WUH A;  3MX2 A;  3I8B A;  5AQR A;  4JHD A;  4JD2 A;  4GVE A;  3O1B A;  2C1I A;  3WQU A;  4B9Q A;  3WXI A;  3QIC A;  3BUZ B;  4CBW A;  3CCS N;  3QDK A;  4A2B A;  1W2B M;  3D2F A;  4JEP A;  2BTF A;  3FE1 A;  3OA9 A;  3G25 A;  5AQH A;  3LL3 A;  3DXK A;  5EX5 A;  3CJ9 A;  4WQ5 C;  3C6H A;  4WFA L;  3CPW M;  4WCE L;  4BRL A;  3UKU B;  4WFN L;  1YJ9 N;  3U8X A;  2E2N A;  3GL1 A;  2FF6 A;  3M5R A;  4H5W A;  4LC9 B;  1NWK A;  5BRD A;  3FLC O;  4QS9 A;  3VET A;  2E1Z A;  1EQY A;  4K43 A;  5M1N A;  1Y64 A;  1KAZ A;  2CH6 A;  3IFR A;  2Q97 A;  5CE3 A;  4A59 A;  2CGL A;  2IVN A;  3O80 A;  3SJH A;  1HKB A;  3HSC A;  2YHY A;  3KWG A;  2ZJP L;  1YIJ N;  3UE5 A;  1ATS A;  4OO1 J;  3H6E A;  5GIP A;  3ID8 A;  1RDU A;  1SZ2 A;  5AQN A;  5EOY A;  4B1V A;  4CZJ A;  4RWT A;  3FGU A;  4IWV A;  1JCF A;  3D6R A;  4BVO A;  4JKH A;  2E88 A;  4Y0W A;  5DM7 L;  3F5T A;  5EVZ A;  3LM9 A;  1BU6 O;  1Z05 A;  3N4Q A;  2HMP A;  2YCH A;  3O4W A;  1TYQ B;  3C0B A;  3UKR A;  1NLV A;  4HTL A;  3CI5 A;  1KXP A;  4CZI A;  5C2F A;  2FLO A;  2QWR A;  3GDQ A;  4B1W B;  2YX6 A;  2V7Y A;  2P9K B;  3FZM A;  3CC4 N;  2ZJQ L;  3VEW A;  3GE1 A;  1Q82 O;  4GNI A;  5CR4 A;  2A40 A;  4NLC A;  1U2V A;  1R59 O;  3HM8 A;  2NRT A;  4YOT A;  3HRG A;  3ENO A;  2JWK A;  3ZET A;  4YDU C;  3RSE A;  1ZXO A;  4U67 L;  1HLU A;  3FZF A;  3ZEU A;  1CZA N;  3H46 O;  4B1X B;  2GEL A;  3CHW A;  4C1N K;  1NGD A;  4YDU A;  5AFU H;  3J8A A;  2VYP A;  5AQU A;  1GLA G;  3H1V X;  1NM1 A;  1HX1 A;  4JKE A;  4MDA A;  4BRA A;  5AZJ A;  3C6A A;  2I7P A;  4CZG A;  4EAH D;  1KC8 O;  3MX5 A;  1HPM A;  3HTV A;  4U7B A;  3LDO A;  4KBO A;  4HWI A;  1ATR A;  4FWS A;  2RE2 A;  2QWQ A;  1GLF O;  4M63 C;  2VGM A;  2Q31 A;  1W97 L;  3VGM A;  2P9P B;  2F9T A;  3MWT A;  2UYT A;  4XH5 A;  2Q36 A;  4PKH A;  3G6E N;  3K9K A;  3M3Z A;  5AZI A;  2FXU A;  4IJA A;  4MDB A;  2E2Q A;  5C12 A;  3BF1 A;  2P9S B;  3WEE A;  5AQM A;  4BRP A;  4GV3 A;  1MWM A;  3LDL A;  3U4L A;  2P9I A;  5BPM A;  4B1U B;  5C10 A;  5KQD A;  1JCG A;  3O8M A;  3VEZ A;  4JHD B;  4WQ5 A;  4BRE A;  2EWS A;  1RGI A;  2OAN A;  3WXL A;  5GAD P;  3EE8 A;  4FOE A;  3SBT A;  4BRH A;  2IVO A;  3VPZ A;  4CZF A;  4WFB L;  1C0G A;  1DEJ A;  4FWN A;  2NNW A;  5BN8 A;  1S72 N;  3A5O C;  3ATU A;  3VEX A;  3RVC A;  3W0L A;  4BRD A;  2ASO A;  3K9J A;  3R6M A;  4WQ4 C;  4IEE A;  1NJI O;  3P39 A;  5BRH A;  5BR9 A;  1T6C A;  5AQQ A;  2YHW A;  1QQN A;  4JK9 A;  4JK7 A;  4BVP A;  3CCU N;  3I55 N;  3GG4 A;  5KPT A;  5HL7 L;  3CQY A;  1EO1 A;  1MA9 B;  3E9O A;  2HBK A;  3CJ1 A;  3E1Y A;  4JN4 A;  1QVF M;  3FZK A;  3P4I A;  2GWJ A;  1TUY A;  3DWL A;  4FO0 A;  5DM6 L;  3IUC A;  5B8H A;  3P31 A;  5BN9 A;  2NZT A;  5AQJ A;  4A61 A;  4BGA A;  3EZW A;  5TKW A;  4BC2 A;  3QBX A;  3WQT A;  1MWK A;  4IEI A;  3G71 N;  3CJC A;  4KH6 A;  3H3O B;  1GLJ O;  5JMV A;  3DAW A;  2V51 B;  3U9D A;  3TTC A;  5AFU A;  5KPZ A;  2NRZ A;  3ZX0 A;  4UY8 O;  2F9W A;  5JVH L;  4KH4 A;  4DB3 A;  1OVY A;  1E4F T;  5E84 A;  3JXU A;  4BR7 A;  1YVN A;  1KD1 O;  3H45 C;  5AQT A;  5F2R A;  1ATN A;  4PHT X;  4BRO A;  3ULE B;  3SK3 A;  4CD3 A;  4OPH A;  3CIP A;  3SBG A;  3MMV A;  3C7N B;  4I6M A;  2P9N B;  3CET A;  3O9S A;  4NB4 A;  5M1Q A;  4XEI A;  3IKM A;  4BR0 A;  4PL7 A;  5ADX A;  5FPE A;  3LDP A;  3M1F A;  2AP1 A;  2E8A A;  3E66 A;  4QS8 A;  2C1G A;  2P9L A;  1RDW X;  2Q0R A;  2YJF A;  3CF5 L;  1XQS C;  1G99 A;  2NRH A;  2V52 B;  5FPD A;  4FPB A;  3VTI A;  2Q0U A;  3R3L A;  4BRK A;  4YOX A;  3GBT A;  3WXM B;  1Q86 O;  3FZH A;  4K42 A;  3NVM A;  1OKJ A;  1GLL O;  4H0V B;  4PKG A;  3WXK A;  1LCU A;  4FWP A;  4AM6 A;  3U9Z A;  4BR9 A;  3ZX3 A;  3T69 A;  4IJN A;  4EHT A;  5BPL A;  1E4G T;  2IIR A;  1TUU A;  2J4R A;  4WQ4 A;  4AM7 A;  3SAH A;  3MDQ A;  3PIO L;  1QHA A;  1BDG A;  1T44 A;  1VAZ A;  3AGK A;  3TPQ A;  1VQM N;  3MN7 A;  5AQO A;  4BRQ A;  2WBN A;  3A5M C;  1T3V A;  3AAR A;  4DCH A;  4R79 A;  3HI0 A;  5C2D A;  2P9K A;  2A6A A;  3A5L C;  5M1F A;  5F1X A;  4MO4 A;  2E20 A;  4O5F A;  1O13 A;  3OHR A;  1YAG A;  3KWI A;  2OTJ N;  3FZL A;  5GIO A;  2BH1 A;  5M1O A;  3VEO A;  5JLF A;  3MN6 A;  3VF6 A;  3EL2 A;  2Q1N A;  3O6W A;  3VEY A;  1YUW A;  4FWL A;  4BQL A;  3M6G A;  3CMA N;  3I56 N;  1KAY A;  2P9U A;  4BRG A;  1YI2 N;  4BQZ A;  5AQV A;  4FWQ A;  3G4S N;  2QWO A;  2GTD A;  2YI1 A;  2IVP A;  4IOA L;  4QS7 A;  3T7Z A;  5AQG A;  3VOV A;  2KKZ A;  4YOR A;  1SS6 A;  3CCJ N;  2ITM A;  4BG9 A;  1BUP A;  2D0P A;  2NRX A;  3ENB A;  3CCV N;  3VF4 A;  3QB0 A;  4E1J A;  4CZH A;  2HBJ A;  4BR2 A;  4A57 A;  1WUA A;  5GAG P;  5H1S Q;  2P9N A;  1Q18 A;  2RHK A;  4BRN A;  3MN5 A;  5AQZ A;  4AF1 A;  3ID6 A;  3MN9 A;  4BY9 C;  3WXJ A;  1J6Z A;  1NGG A;  3KHY A;  1V4T A;  1C0F A;  2ZGZ A;  3E9L A;  1NGC A;  4YOV A;  3CCQ N;  1HKG A;  5KQ8 A;  2NRV A;  3H1Q A;  3DXM B;  2W00 A;  2GEM A;  3J7Z O;  2D4W A;  3NVK A;  1NGA A;  1NGB A;  4FSV A;  4BGB A;  3VEV A;  4ILJ A;  2DPN A;  3Q7C A;  4JKG A;  2VCP A;  4MLE A;  3CME N;  4JAX A;  4CBU A;  1QVG M;  1VQK N;  1RFQ A;  2NRR A;  3CCM N;  4MO5 A;  3L4Q A;  2P9S A;  4YOY A;  3ZEU B;  1X9J A;  3SMS A;  4WF9 L;  4O8U A;  1HJO A;  4IOC L;  4FWK A;  5C15 A;  1NBW A;  2HF3 A;  5E26 A;  4G9Z A;  1HUX A;  1U2V B;  1IJJ A;  3W3D A;  1QQM A;  4ILG B;  4A62 A;  5AQF A;  2Q2R A;  1JJ2 M;  1VQN N;  4H5R A;  3D7E O;  3ENH A;  5TKY A;  2WC9 A;  3B8A X;  4FWM A;  4H0P A;  3LDQ A;  3R8E A;  4NLB A;  2A3Z A;  2QWM A;  2F7T A;  2WFB A;  4RCH A;  3IDH A;  3TSQ A;  2ZGY A;  2QI2 A;  4JNE A;  4IXC A;  4EFH A;  1YF5 L;  1ILY A;  3CXC M;  1GLB G;  3VGK A;  1XUP O;  5GIN A;  4H0Y B;  4CJ7 A;  1BWF O;  3SAF A;  3UKU A;  4BC3 A;  4FVU A;  2W40 A;  4JKF A;  3DLL L;  1P8Z A;  1V4S A;  2AA4 A;  3Q7B A;  5EY4 A;  1NGI A;  4H0O A;  3VF2 A;  3D2F B;  3O5B A;  3BF3 A;  3OBY A;  4BG8 A;  1VQO N;  2E2O A;  3QML A;  5JIC A;  3OBW A;  2QEX N;  2PFU A;  3N4P A;  2I7N A;  2HST A;  2GWK A;  2ASM A;  4IZ9 A;  1QQO A;  1JCE A;  4M7Y A;  3O9R A;  4A2A A;  3C65 A;  1DKG D;  3AY9 A;  3C7N A;  4I6M B;  4DHY A;  3CCL N;  3AGR A;  2QW9 A;  3TSP A;  3CC2 N;  4ISG A;  2KLA A;  1K8K B;  5AQK A;  4CZM A;  4KH5 A;  3F9M A;  4IDH A;  3HOT A;  1H1V A;  3KVG A;  3A0I X;  4RTF D;  5M1P A;  2HBM A;  2P9L B;  5FPM A;  1GLC G;  1SAZ A;  3E9P A;  3KZB A;  3ZX2 A;  4BEB A;  3MWP A;  3FFK B;  1KQS M;  4NO7 A;  1YXQ A;  4H0X B;  1Q81 O;  4BR4 A;  2GUP A;  5LY3 A;  5AQY A;  3UKR B;  1VQ7 N;  1VQP N;  1VQ6 N;  3QFU A;  1NGJ A;  3O1W A;  1VQ5 N;  2A42 A;  5JVG L;  2HBL A;  3O9U A;  5BRF A;  1K8A O;  4JKC A;  4H0T B;  5BRE A;  5AQS A;  2FF3 B;  3MK6 A;  3BEX A;  4JKA A;  3HZ6 A;  1DT9 A;  3VES A;  5AQI A;  2HF4 A;  4IFE A;  3O9Q A;  3A8Y A;  2PBD A;  4JK8 A;  5M1K A;  1KAX A;  1XC3 A;  3H3N O;  3O9T A;  3QBW A;  1VQ8 N;  4BRC A;  1BO5 O;  3ZYY X;  1NGF A;  3CCE N;  3DXK B;  5I9E B;  3ZET B;  3EN9 A;  2E2P A;  2H3G X;  4JKB A;  3UB5 A;  1NGH A;  3WEE B;  1ZC6 A;  3OW2 M;  1QZ6 A;  1K73 O;  4IO8 A;  3F2K A;  4J8F A;  2QWL A;  4B1Z A;  1ESV A;  4M7X A;  3WT0 A;  2PAV A;  4A5A A;  2FSN A;  4GV6 A;  2VGN A;  1BA0 A;  4OPA A;  1GLE G;  3R9P A;  2YHX A;  5AR0 A;  4DQ8 A;  1YIT N;  5LJW A;  4BC5 A;  5FPN A;  2FSJ A;  4DKW A;  3NMU A;  3FR0 A;  3CC7 N;  4IO9 L;  3A5N C;  2QM1 A;  2E1Y A;  2A5X A;  5LJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...