2P9SB

Structure of bovine arp2/3 complex co-crystallized with atp/mg2+
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
197
structure length
197
Chain Sequence
TGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 54
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9sB02
3IUCA 2QW9A 4O5FA 3QBXA 2QWRA 5BPLA 1NGGA 3EKSA 2HF3A 4H5NA 3I33A 4MO4A 4CZHA 4BRGA 3FGUA 1DKGD 4BR7A 4BRQA 1OKJA 1X9JA 3VEVA 5KQDA 3FZKA 3LDPA 3MCPA 2Q1NA 2YI1A 4BQLA 1U6ZA 4BRIA 3VPZA 3ENOA 1KXPA 5AQXA 3IFRA 3DJCA 4JD2B 3SK3A 2E2OA 3QICA 4A61A 5F1XA 1ESVA 1YXQA 4CBXA 2QWLA 2QWMA 4RTFD 2P9IB 3DXMA 4FWKA 4CD1A 2P9SB 3KHYA 3CIPA 3LDLA 4I6MA 2GWJA 2F9TA 3HSCA 4YDUA 2FSNA 3CERA 5KQ8A 5AQZA 1S22A 5AZIB 4NO7A 4K43A 3UKRB 3C0BA 3EN9A 5FPDA 4H5RA 2IIRA 3QDKA 3H1VX 4JNEA 4XEIA 3R6MA 3D2FA 1DEJA 3P4IA 3J8AA 4WYBA 1U2VB 2E88A 3F9MA 1ZBSA 4BC5A 2P9LA 4PL8A 3B8AX 4K42A 3SMSA 4EIAA 4FWLA 2CGLA 3VOVA 5AQSA 1TUUA 2V52B 3VEWA 1J6ZA 1RGIA 2YHXA 2Q0UA 1R59O 2ASOA 2ZWHA 2GUPA 5AQHA 3ULEB 5LJVA 1BOTO 2P9KB 4KBOA 1TYQB 2NLXA 3U9ZA 4C23A 3HI0A 1TUYA 3VF6A 3ID8A 3RSEB 3FFKB 4H0YB 2ASPA 3GG4A 1BUPA 2A40A 4YDUC 4FWRA 1WUAA 2Q2RA 1IJJA 3AY9A 4H5VA 1K8KB 4JAXA 2P9PB 2VCPA 5BN8A 3L0QA 4CD3A 2FF6A 4BVOA 3A5OC 3QBWA 5AQOA 3TPQA 1QZ5A 1WOQA 3UKUB 2H3GX 3UKRA 1NGDA 2E2NA 3O4WA 5AQNA 4BC4A 4BRFA 3QMLA 5AQIA 5AQRA 3O6WA 1BU6O 3DWLA 1ATSA 2KHOA 3HZ6A 4H0TB 4CZLA 4BG8A 4BQZA 3A5MC 3WEEB 3H45C 4RCHA 1V4SA 1GLJO 4JHDB 4IJNA 4BR0A 3DXKB 3HM8A 2J4RA 1NM1A 3FZHA 3O1WA 3ULEA 3VERA 2GEMA 2V7ZA 3GE1A 3SMPA 5EXWA 5AQTA 2OANA 3WXKA 3RSEA 2PBDA 2D1KA 5EY4A 3WXLA 1EQYA 3EZWA 1V4TA 3ZETA 4FOEA 4BRHA 2A5XA 4BRMA 2WUSA 3DAWA 1LOTB 1E4FT 4PL7A 5BRFA 1Z6RA 4EFHA 3H3OB 4DCHA 4M7YA 4F9OA 4IJAA 5BPMA 5BRDA 2AA4A 4AM7A 3CHWA 1QZ6A 4AM6A 3ZX2A 4A2AA 5CE3A 1RFQA 1JCFA 1XC3A 4BGAA 1D4XA 4BR2A 3QB0A 1GLBG 4B1ZA 1NLVA 3FZLA 5FPEA 2NZTA 5AQUA 3S41A 1NBWA 4BRKA 3CQXA 2QWOA 3L4IA 3EL2A 3ATUA 1HUXA 1MWKA 2CGKA 3GL1A 3VEZA 4B1VA 2GTDA 1YVNA 3LDNA 3VGMA 3G25A 3ENHA 1MDUB 1SAZA 3O1BA 4MO5A 4O8KA 3MDQA 3UB5A 3MK6A 4M7XA 1X3MA 3M3ZA 2V51B 1JCEA 1KAYA 1S3XA 2D0OA 5FPMA 3JS6A 4EHUA 1HJOA 3AARA 2CGJA 5E26A 1KAXA 2W41A 3JXUA 4PKIA 2IVPA 4CBUA 5AQQA 3MN5A 4BROA 4K41A 3VGKA 5E84A 4J8FA 5AQYA 1Y64A 1NGFA 1KAZA 4CI6A 4IWVA 4PKHA 3WQUA 4DB3A 3H1QA 4ISFA 2ZF5O 4A62A 4EAHD 3VEYA 1MWMA 4PKGA 5AQKA 1QHAA 5BR9A 4HWIA 4CZGA 5KPRA 2A3ZA 4JD2A 3D2EB 3L6QA 2FSKA 2NRHA 2HMPA 4H03B 5AZJB 1RDWX 2BUPA 4HTLA 4BRPA 2CH6A 4FO0A 5EX5A 3MMVA 4DHYA 2P9IA 5EOYA 5LJWA 1GLFO 2P9SA 4BRCA 4GNIA 3M6GA 4IO8A 3VF4A 3WQTA 4H0OA 2ITMA 5JLHA 5FPNA 5AZIA 3VEXA 2E2QA 4DQ8A 4E1JA 1CZAN 4FOIA 2PAVA 4BC2A 3WXJA 1HKCA 4B9QA 2ZGYA 5ADXH 4CZJA 1U2VA 2Q36A 4FSVA 2A41A 3FZFA 3CETA 4BRNA 3KZBA 1HPMA 1ZXOA 4FWMA 2UYTA 3LDQA 4IXCA 5ELZA 4CZEA 5JLFA 3U4LA 1LCUA 1NGJA 3BUZB 4BRDA 3CJBA 3QFUA 2ZGZA 3U9DA 1NGCA 3BF3A 4B1YB 3GDQA 4QS9A 2YHYA 1BG3A 2V7YA 2EWSA 3FZMA 2P9KA 1TYQA 3TU5A 4FPBA 3A5NC 2HF4A 3D2EA 2E20A 4CZMA 3FE1A 4L3QA 2IVNA 2YHWA 4CJ7A 4H0VB 3IMXA 5AZJA 4K25A 1NWKA 1K8KA 1NGIA 5AR0A 2P9PA 2P9NB 3BF1A 4XH5A 4BR9A 5BREA 2BTFA 5JMVA 4Z94A 3OHRA 5ADXA 3UKUA 3SJHA 2QWQA 1GLLO 3I8BA 1C0FA 3MN9A 2GWKA 5AFUH 4FWNA 5BPNA 3VESA 2F9WA 4NB4A 1T44A 2QM1A 3VETA 2DPNA 2QXLA 3WT0A 5B8HA 1G99A 3MN7A 2YCHA 3CJ7A 3VEOA 1QQNA 3WEEA 4GY2B 2P9UB 3D2FB 4QS7A 4H0XB 3R8EA 1SQKA 4JHDA 1QQMA 3DXKA 2I7NA 2FLOA 2P9LB 1BA1A 3CJCA 4WQ5A 3SLCA 4MLEA 5F2RA 1NGBA 3BEXA 2VWBA 3LDOA 4FWSA 3WXIA 3EO3A 3BP8A 4BRLA 2IVOA 1GLDG 2Q31A 5AQJA 3IDHA 5AQWA 3O8MA 5KPTA 1HKGA 4BREA 2P9NA 5AQVA 4H5TA 1P8ZA 5AFUA 3LL3A 5I9EB 1E4GT 4XH4A 3C7NB 4BG9A 3O5BA 1ATNA 4RWTA 2HOEA 5AQMA 1SZ2A 2A42A 4BRAA 1BA0A 1NGHA 1Q18A 4CZKA 3H3NO 1ATRA 4CZIA 1BDGA 1GLCG 2FSJA 2Q0RA 4WQ5C 5AQGA 4BVPA 2E2PA 3ZEUB 3VENA 1BO5O 3AAPA 3U8XA 1GLEG 5AQLA 1T6CA 3H6EA 2YJFA 2P9UA 2AP1A 3ZX3A 4BC3A 3H46O 1HX1A 2E8AA 3CQYA 2CH5A 1C0GA 3LM2A 3A0IX 2YJEA 1NGEA 1X3NA 2GELA 4H0PA 3VGLA 1BWFO 1T6DA 2A6AA 5BN9A 3CI5A 1DGKN 5AQFA 4FPAA 3ZX0A 3AAQA 3O08A 4WQ4A 5LY3A 3R9PA 5EVZA 1YUWA 3O80A 5TKYA 3UE5A 3ZETB 3W0LA 3A5LC 5AQPA 4A2BA 2QWPA 3C7NA 1NMDA 5F0XA 4CZFA 2E1ZA 2I7PA 4LC9B 1Z05A 1HKBA 2ASMA 1ZC6A 3WUHA 1QQOA 4CBWA 2W40A 4EHTA 4FWQA 3GBTA 1JCGA 3ZEUA 1XQSC 5KPZA 3W3DA 3MN6A 4M63C 2QWNA 3ATVA 5JICA 3CJ1A 2VYPA 3D7EO 3A8YA 2FXUA 4B1UB 2D0PA 3EKUA 1XUPO 4Y0WA 4WQ4C 4ISEA 3GOIA 2FF3B 4JN4A 4H5WA 5BRHA 3QFPA 3HTVA 1GLAG 2Q97A 4B1XB 4FWPA 3DXMB 3CJAA 3VF2A 4QS8A 4MLHA 3FR0A 4IZ9A 4B1WB 1HLUA 4I6MB 4BGBA 4BR5A 1H1VA 3M1FA 4BR4A 1MA9B 3HBTA 4FL9A 3FLCO 4ISGA 1NGAA 1IG8A 4XH1A 3CJ9A 3KVGA 1YAGA 3LM9A 2E1YA 2D4WA 4FWOA
chains in the Genus database with same CATH superfamily
3IUCA 4O5FA 2HHVA 5M1OA 4DMNA 2QWRA 3EKSA 4OKEA 4H5NA 4CZHA 4BRGA 1YJ9N 1M1KO 4OX9K 1X9JA 5KQDA 3FZKA 3LDPA 2Q1NA 4I2PA 4HUFA 1BISA 1U6ZA 4BRIA 2ATQA 3IFRA 3DJCA 1NKBA 4B8CA 4CF9A 4B9MA 5SZTA 4Z4FA 3LZIA 3THWB 1BQNA 3SQ1A 3DLEA 5F1XA 3PO5A 1ESVA 3NGZA 2ZJPL 2HBKA 4JKFA 5C2DA 3DXMA 3ZSWA 5MLCQ 2GBZA 1VQ6N 2GWJA 4CJLA 1WSGA 1C1CA 3M8PA 5AZIB 4NO7A 4K43A 3EN9A 4RW4A 1BI4B 3H1VX 3KLGA 4KFBA 3NH1A 1XMOK 1ZBUA 1ZBSA 4BC5A 4YNQA 3IG1A 4PL8A 3B8AX 4K42A 3H08A 3BGRA 3ZT0A 2HHXA 4I9LA 3THVA 1Q82O 4JKGA 5AQSA 2O8EB 1RGIA 2YHXA 5C2FA 4BE7B 4K0KK 3B6OA 2NLXA 2HHTA 3PV8A 1RTDA 5D3GA 4YDUC 2Q2RA 4DS4A 1ASUA 1S9EA 4B9VA 1WOQA 2D0CA 2HNYA 3DLGA 1IO2A 4RW6A 1XMQK 2JWLA 4DSEA 3T69A 1NJWA 3PO4A 3SCXA 1TV6A 3O4WA 4JI2K 1I94K 5AQNA 4BC4A 1BU6O 4JKBA 3OW2M 1YJNN 2YX6A 4CZLA 3TI0A 2HHQA 4BQZA 3ALYA 5LMUK 1KFDA 2WFBA 4CJVA 4IJNA 1XNQK 3HM8A 3FZHA 4LH4A 3ULEA 4KAZA 3CPEA 4HTUA 5AQTA 4A5AA 3RSEA 2G8VA 1EQYA 3VQ9A 1X1PA 4FOEA 3ZSRA 2FC0A 3IRXA 3CPWM 1RT4A 4FLVA 5SWMA 3E9LA 1LW0A 3NF8A 1LOTB 2O8BA 1E4FT 5LMNK 4FK4A 1QTMA 4KI4A 3QETA 2R7YA 5DK5A 5BPMA 4R79A 2W6KA 1ASVA 4JK7A 4C8KA 4DTRA 4FW2A 3WNHA 4AM6A 3CCJN 5GAHP 4CJSA 3KJVA 3VQDA 1SUQA 1G15A 4V19S 3CFOA 4ILGB 4BRKA 3DMJA 2QWOA 1VRUA 1MWKA 5H1SQ 3PUFA 3QEWA 3CCRN 1N34K 1QSLA 1SAZA 1HNWK 4O8KA 3MDQA 3P39A 4JKCA 3UB5A 1SKRA 5GAEP 4CEEA 1XHXA 4M7XA 2P5OA 4KREA 1X3MA 2YKMA 3M3ZA 4CFCA 2V51B 4U67L 2P5GA 3JS6A 3THYB 3PSFA 4EHUA 5JVHL 1KAXA 4CHQA 2W41A 3JXUA 4PKIA 3I8DA 2C1IA 4BEBA 3MN5A 2HVHA 4K41A 3VGKA 3VQ5A 4J8FA 2UUAK 2X74A 1FJGK 1RCHA 3WQUA 4YOVA 4DB3A 1VQ7N 4CJWA 4F3OA 1MWMA 2P1JA 2RKIA 2HHWA 3MEEA 4AQYK 3OYIA 4DU3A 3DLBA 3JAMO 1N6QA 4BACA 2NRHA 3NE6A 2Z1IA 2FBVA 4KH5A 1RNHA 1VSEA 4BDZA 2CH6A 4G1QA 4FO0A 2PYLA 5J2MA 2P9IA 3AO2A 2P9SA 4BRCA 4GNIA 4IO8A 4CHNA 3VF4A 3WQTA 3SZ2A 3NVMA 5FPNA 3VEXA 4E1JA 2OYQA 4E7IA 2QKBA 4PY5A 3MXMA 1L3SA 4M3WA 1HKCA 2XRIA 3OYMA 1JLQA 3QEPA 1BCOA 5HP1A 2Q36A 4FSVA 4ZTJA 1QSYA 1TGOA 1VSLA 2A41A 4JS4A 4LF4K 1ZBLA 1HMVA 4DTOA 3U4LA 2HNDA 3TARA 1S1WA 1NGJA 3SQ4A 1WBBA 3BUZB 3DLKA 3CJBA 2ZGZA 3L3UA 3BF3A 4B1YB 1A5XA 3GDQA 3AGKA 3KLIA 2A1RA 2V7YA 2G8UA 1OVQA 2P9KA 1TYQA 2GUIA 3TU5A 2YNFA 1FKOA 2HF4A 3V9ZA 3QNOA 3V81A 4L3QA 4CJ7A 2OPPA 3VN5A 4K25A 1VRTA 1K8KA 4LSNA 4WF9L 1NK0A 3D6RA 4DTSA 2RHKA 4MQ3A 2A1SA 5JMVA 4WFAL 2EHGA 3AVNA 5ADXA 5M1FA 1WAFA 5C12A 1HNIA 4IOAL 2WONA 3I8BA 4DS5A 1VSKA 2GWKA 4FWNA 3VESA 2F9WA 4M3XA 2QTDA 3ZT2A 2UXCK 3VETA 2QXLA 3M5RA 4FLTA 1NK7A 3EEQA 5JVGL 3MAQA 3CJ7A 3WEEA 2P9UB 4H0XB 3R8EA 3DXKA 5HOOA 4F3TA 3U3YA 1HR0K 4OPHA 3SLCA 3QNNA 3ZT3A 3AVAA 1RT3A 5F2RA 3K58A 4JKGB 3PX4A 3WXIA 4FWSA 2Q31A 1K9MO 4DV5K 4LFAK 4B3SK 1S72N 5AQVA 1JLFA 4H5TA 1IKXA 3CQ8A 1L3TA 1VK0A 1E4GT 4IDKA 3C7NB 4CK2A 3J7YP 4CJKA 1J9AA 4DTUA 3Q7BA 4BRAA 1BA0A 4CZKA 4E7JA 4FJHA 4CJEA 1HYZA 3ITHA 2Q0RA 4W5QA 1K73O 4H4MA 1BO5O 4OLAA 1T6CA 3PIOL 3P31A 3ZX3A 4BC3A 2DY4A 2F4VK 1VQ8N 3CQYA 4DSIA 3O3FA 1HQUA 1C0GA 3RRGA 2C1GA 3AVJA 4M3YA 1TL1A 4B08A 2NRTA 2YNIA 2GELA 4H0PA 4KV8A 4NCGA 1GOCA 4I7FA 1EWRA 3CCMN 4JK9A 2W6LA 3SAHA 4FPAA 1VQNN 3AAQA 1WLJA 2O8CB 4Y1DA 5J1EA 2Y1IA 5EVZA 3M8QA 3J80O 3O4QA 5C15A 4CZFA 4NCAA 2O8BB 2UXBK 2D0AA 3PX6A 4LC9B 1RTHA 4EHTA 3ZEUA 3ASMA 3MN6A 3AVKA 2EX3A 1QSSA 3KWGA 4IFEA 2D0PA 4KHSA 4Y0WA 5JS2A 5JS1A 4ISEA 4DSKA 4O8UA 4JN4A 4AF1A 4H5WA 3QEVA 2UUBK 1BCMA 1C6VA 1HYSA 3V9SA 2O8FB 1L3UA 3J7ZO 3RR7A 3SV4A 1HLUA 3C95A 1L3VA 2YKNA 4CFBA 3M1FA 1Q86O 4F2RA 3C6UA 1WSIA 3AVFA 1DTQA 4OKKA 4PHTX 1NGAA 3P38A 1JLBA 3KD5E 4FVUA 2D4WA 1VQKN 1NK6A 2F8SA 4OPKA 1DKGD 1JLGA 2ITGA 4WFNL 2HHIA 3VEVA 4M42A 4BQLA 3OY9A 3SUOA 4DTPA 4NXNK 4Z4IA 1NJIO 5AQXA 1WNSA 3V1OA 3G10A 3IAYA 1Q9YA 1J53A 4OGCA 4CBXA 2QWLA 4RTFD 2P9IB 3CYMA 1RDDA 2P9SB 1YITN 1DTTA 3ZSVA 3S3NA 3HSCA 2VG7A 3V1QA 3G0ZA 3DM2A 1NU0A 5AQZA 1S22A 5HBMA 5KQ8A 5TKWA 4JEPA 3UKRB 4AILC 3SV3A 1OVYA 3TAPA 1IBKK 2IIRA 1NOYA 3QDKA 4AHSA 3D2FA 1DEJA 4WYBA 3J8AA 1EP4A 1KFSA 3F9MA 1YTAA 1HPZA 5J2QA 4KHNA 3ZLJA 1YJWN 4FWLA 1SS6A 4DFJA 1J6ZA 3OS0A 1J5EK 5AQHA 4NXMK 2P9KB 4KBOA 1TYQB 4WE1A 4C23A 3KIOA 1TUYA 3ID8A 1FW6A 4G9ZA 3L2VA 2ASPA 3GG4A 1IJJA 1K8KB 2KFZA 2X6SA 4KH6A 4CESA 3L0QA 1RDAA 3A5OC 4YOUA 5DM7L 4DTNA 2O4GA 3C94A 1NGDA 2I5JA 1J54A 1IKYA 1WSEA 2E6LA 4JKHA 3O6WA 4AHTA 1ATSA 4KTZA 1Q9XA 2KHOA 3NVKA 2LSNA 3R1XA 1S1VA 3A5MC 3WEEB 3EE9A 4RCHA 1GLJO 4OPAA 2IC3A 4BR0A 3DXKB 1RBTA 1HNVA 1D5AA 1HYVA 1UAXA 4EZ6A 3VERA 3LPUA 3DLRA 4J2AA 3SMPA 3OYKA 3SBGA 2RF2A 2OANA 4DV1K 3WXKA 3AVHA 4YY3K 2PBDA 2D1KA 4NYFA 4RW7A 5EY4A 4CGIA 4CIFA 5I3UA 3ZETA 1A5WA 4BE1A 4BRMA 2XHBA 2WUSA 3DAWA 1QVFM 1R0AA 5BRFA 4EFHA 3ENBA 4M7YA 4F9OA 2ZM6K 4IJAA 4JRPA 4HCCA 5BRDA 2AA4A 4AM7A 3ZT4A 4F4KA 4UY8O 3THXA 4DQPA 3OJSA 1JCFA 4Z4HA 3ZSXA 3UIQA 2NZTA 3D0PA 3S41A 1SKWA 3VQBA 3CQXA 3L4IA 1RT2A 4CJPA 2VG6A 1HUXA 2CGKA 3VQQA 3C6TA 2GTDA 1YVNA 1MDUB 4FZZA 3O1BA 4MO5A 4DV2K 2WTUA 2PY5A 1BIZA 4YFUA 3E66A 1KD1O 3CMEN 1JCEA 3E01A 1S3XA 1HJOA 3P1GA 2OPSA 2IDOA 1HNZK 5AQQA 3SYZA 4JKAA 5FDLA 5E84A 4IWVA 3HO1A 4TSXA 1RILA 3EY1A 4A62A 3DRPA 4EAHD 3VEYA 2HHHK 1LV5A 1NOZA 1YIJN 1VQ9N 1QHAA 4HWIA 1C0MA 3WNGA 4A57A 5KPRA 4E7KA 2FSKA 4KB1A 3VQ7A 1VQON 4H03B 3OS2A 5AZJB 4LH5A 5EX5A 1EXQA 4RG8A 3TSUA 2GV9A 4N56A 2OZMA 1GLFO 3DLHA 3S9HA 4FW1A 2XY6A 4FJ8A 3ISNC 2ITMA 3VQAA 4AHRA 2OPQA 3O9UA 4YOTA 2E2QA 4JI1K 3F2KA 4FOIA 3OJUA 1B9DA 2PAVA 4BC2A 1HJRA 3WXJA 3MECA 4DR3K 3CCQN 2ZGYA 1LAWA 4FLUA 4IO9L 3VQ4A 3CETA 4BRNA 5JENA 1ZXOA 3U3GA 4PWDA 3VQEA 5JLFA 5ELZA 1NNEA 1Z25A 4LFBK 3CCVN 1E3MA 1VSJA 4IOXA 2KQ2A 4Y1CA 3QFUA 1OH5A 4QS9A 2EWSA 1FK9A 3E9OA 3FZMA 4CJRA 4LF7K 3A5NC 3HP6A 3D2EA 2HB5A 4CK1A 3NH0A 3AVBA 3OS1A 3FE1A 4H0VB 4L8RB 3MXJA 1WSFA 5AR0A 3M8RA 2P9PA 5HROA 2P9NB 1RBVA 4FCYA 4CEZA 2WC9A 2BTFA 3F5TA 3OHRA 4FJ9A 3ZSYA 1XWLA 3TAGA 3C6HA 2ZJRL 3TTFA 3SJHA 1LWFA 3CC7N 1C0FA 5AFUH 3MWPA 5BPNA 1I39A 3ID6A 3TANA 2RE2A 4QCLA 4FJKA 3I0SA 1S6PA 4ICLA 1T44A 1BHLA 4EZ9A 2DPNA 1FKPA 2P51A 1CXUA 2GX9A 4CF2A 4GY2B 4RW9A 3D2FB 4JHDA 1KVAA 1NKEA 3QIOA 4WQ5A 4B9LA 1U04A 4KHPK 1NMNA 2VWBA 3K5LA 1JJ2M 3EO3A 1UA0A 4CHYA 2BDPA 3O8MA 4GV6A 4BREA 2BANA 4CEQA 1IH7A 3MEGA 3K2PA 3LL3A 1RT1A 2Z1HA 5I9EB 4DFMA 4XH4A 3CYGA 3SUNA 1ZBFA 4RWTA 4BE2A 3KK1A 4DR7K 5AQMA 1SV5A 1NGHA 1Q18A 3EE8A 1ATRA 2G8FA 4FK0A 1BDGA 2RN2A 2FSJA 2QKKA 1S1TA 3VENA 3AAPA 4JI6K 3U8XA 4F2SA 5AQLA 4DR1K 1TKXA 2AP1A 3HK2A 1JLCA 5KI6A 3TSQA 1HX1A 4MFBA 2E8AA 3HP9A 4YHHK 4FK2A 3AVGA 2CH5A 3LM2A 3DRSA 3OTOK 1BQMA 4FM1A 1NGEA 4CEOA 3AVCA 1YT3A 1DGKN 3HOTA 1T05A 2WOMA 3ZX0A 4DV0K 4WQ4A 4DFKA 4FYDA 1YUWA 3O80A 5TKYA 3ZETB 1WB9A 3W0LA 3A5LC 3LAMA 3Q7CA 5F0XA 3K59A 1KSPA 2ASMA 4CBWA 1MU2A 1VQPN 1T7PA 1XQSC 5CYMA 3HYFA 5GIPA 1JKHA 1VQLN 4M63C 4KHYA 3AA3A 4JK8A 2QWNA 3BZKA 4LSLA 3THXB 1CXQA 5JICA 1ASWA 3LDSA 4PQUA 1A5VA 3NDKA 4JI5K 2FF3B 5M1QA 3VMFB 3CXCM 1VSDA 1D8YA 4B1XB 3DXMB 4DR2K 3RTVA 2KTQA 4QS8A 4JRQA 4M3TA 4DQRA 1H1VA 4BR4A 1MA9B 1RBUA 3HBTA 1HQEA 3RMCA 4ISGA 2X78A 3SNNA 3K57A 1IG8A 3CJ9A 2NRRA 1SKSA 3OYCA 3NF9A 3N4PA 2UUCK 1RT7A 2HVIA 2QW9A 5BPLA 1U47A 4DLEA 2HF3A 3ZYYX 3T1AA 3ULDA 3AVMA 3FGUA 2NRWA 1VSMA 4IFVA 3HL8A 3ZSZA 3SQ2A 4BR7A 4BRQA 3CMAN 3MCPA 3K5OA 3E9PA 2HHSA 2RPIA 3ENOA 1U4BA 3KK7A 4DTMA 3SK3A 2E2OA 4ID1A 5IWAK 5HRSA 1XC9A 3QICA 4A61A 1ZYQA 1YXQA 4IG0A 1WN7A 4KTWA 3L2QA 3L8BA 4K8ZA 1NG9A 3CIPA 1C0TA 1S9GA 4I6MA 1UA1A 4YDUA 3CERA 2DFHA 3SBTA 4H5RA 3LANA 3HPOA 3L2UA 1S5JA 3R6MA 3OYGA 1W9HA 3AA4A 3K5MA 3HVRA 4CIEA 3HPHA 4EIAA 3VOVA 3VQ6A 1TUUA 3HRGA 4CJ5A 1RBRA 2Q0UA 3ULEB 2ZWHA 2GUPA 1ILYA 3I55N 3L4QA 4RW8A 5EU7A 1RBSA 4E1MA 3PLAA 3U9ZA 2YNGA 3HPGA 3RSEB 3FFKB 1EKEA 3THWA 1NK8A 3AO3A 4H0YB 5HL7L 1BUPA 2OZSA 4A5BA 2VWJA 4H5VA 1WUAA 4AHCA 2P9PB 4DQSA 5BN8A 3T19A 4DV6K 4CD3A 2FF6A 4BVOA 3K9JA 3QBWA 5AQOA 4GMJB 3TPQA 3HOSA 2H3GX 2QXFA 4DV3K 1IKWA 2OA8A 1BI4A 4FLYA 2ETJA 4J2BA 4BRFA 3QMLA 3V9XA 5AQRA 4FJLA 4H0TB 1TAUA 2HSTA 1TKDA 2Q3SA 4BG8A 3WNEA 4X64K 3LP2A 2PFUA 4E7HA 1XHZA 1LAVA 4JHDB 1KQSM 2VQFK 4ID5A 2VGMA 1YHQN 3T3FA 2GEMA 4M3RA 3GE1A 2XY8A 4DF8A 2HBMA 3WXLA 3CCSN 1LW2A 3EZWA 4JI7K 3VQCA 5J2PA 1IG9A 3KD1E 1UOCA 4BRHA 2A5XA 4PL7A 3KTQA 1Z6RA 1IV0A 4DCHA 4B9UA 4CGDA 3F9KA 4Q5VA 5FRNA 3CHWA 1LWCA 4DTJA 4NCBA 4B3TK 2O4IA 3S5TA 2IOCA 5CE3A 1RFQA 5KRSA 2G8WA 1XC3A 4BGAA 1D4XA 4GKKK 3QB0A 1BL3A 3MWTA 4B1ZA 1NLVA 3FZLA 5FPEA 5AQUA 4CJ4A 4DU1A 2XY7A 4C8MA 5CHIA 4I9QA 4UQGA 2KKZA 3VA0A 4O0IA 3GL1A 1N33K 2B5JA 3G25A 4IKFA 3OVNA 1HNXK 3FFIA 4HVJA 3EYZA 5DMRA 3MXIA 3CM5A 1NK4A 4LY7A 4HUEA 1VSIA 4JV5K 3SAGA 3OYEA 4DSLA 2D0OA 4E0DA 2PZSA 4GW6A 3EZ5A 4LF6K 4EP4A 3AARA 5GIOA 2CGJA 5E26A 4E19A 4FVMA 3OYJA 3SUQA 4H4OA 1TVRA 3CFRA 3D45A 1NJXA 4BROA 3K5NA 3RMDA 1TK5A 1Y64A 3M8SA 1NGFA 1KAZA 4CI6A 4CK3A 3PY8A 4PKHA 2O8DA 2XO7A 4ISFA 4FXDA 4CE9A 3TWHA 4WCEL 4PKGA 4OVLA 4CZGA 2BH1A 4OLBA 3U6FA 4OKJA 4JD2A 1ITGA 1EO1A 1NK9A 3T1HK 3IS9A 4Z4EA 1RDWX 2WBNA 3V1RA 3DOKA 2BUPA 4BDPA 4FWOA 3MMVA 5EOYA 5FRMA 1I3AA 4M45A 1WSJA 1BGXT 3V9UA 3OYFA 4DU4A 3T1YK 4B3OA 5JLHA 5HLFA 4KH4A 4DQ8A 2YNHA 3QLHA 1CZAN 4BWMA 1JL1A 4B9QA 3CF5L 1J5OA 3K9KA 1N8RO 1U2VA 3G71N 3KZBA 2UYTA 2F7TA 3LDQA 1OH7A 1YVUA 1EX4A 5M1PA 5DM6L 3CCUN 1C0UA 1YF5L 3LP3A 4BRDA 3U9DA 2KFNA 1NGCA 2W00A 2YHYA 1BG3A 4FPBA 1QS4A 4YORA 2BE2A 2IVNA 2YHWA 1N32K 4BE0A 1NWKA 4E72A 1NGIA 3NF7A 4Z4GA 4XH5A 5BREA 4KHUA 2QEXN 1QE1A 3RWUA 4Z94A 3V6DA 4NLBA 4OGEA 3UKUA 4QOZB 1W7AA 3NGIA 4FLXA 3QO9A 2G8HA 2QWQA 2E4LA 3KK2A 5CR4A 3QESA 1HRHA 4W5TA 4H8KA 4X62K 1DT9A 2QM1A 1G99A 3MN7A 2YCHA 3VEOA 2F96A 4ZTFA 4IOCL 4CCHA 3RRHA 1T03A 1SQKA 3HM9A 1QQMA 3JYTA 4FJ5A 2I7NA 2FLOA 1BA1A 3NF6A 3C65A 4MLEA 3NH2A 3OBYA 4E1NA 3VTIA 1U45A 4FJNA 3BEXA 1RTJA 4DQIA 5FLXO 1JXEA 3O3GA 3IDHA 1NJYA 3SQ0A 5AQWA 3L2WA 1HKGA 1VQMN 2ZE2A 3BZCA 2FBYA 5AFUA 1UWBA 3S3OA 1NJZA 1XNRK 4BG9A 2BGGA 4CF8A 2DFEA 1ATNA 2IAJA 3NMUA 2IGIA 3KKSA 3KLHA 1TKTA 1RT6A 1WBDA 3DRRA 1SZ2A 1O13A 4N76A 4PA1A 5AQGA 4BVPA 3ZEUB 1GLEG 4NYNA 4E89A 1ZBHA 4JI4K 3H6EA 2YJFA 2P9UA 1OH6A 2HNZA 3H46O 3AO5A 4IDHA 2Z1GA 4ILHA 4FJIA 3NFAA 1KCFA 3VGLA 3RMBA 3C6AA 1BWFO 1T6DA 2A6AA 4NLCA 5BN9A 3CCEN 4DSFA 3CI5A 1W0HA 3VQPA 4X65K 3O08A 5LY3A 5C0YA 3R9PA 4CEDA 5AQPA 4A2BA 1S6QA 3C7NA 4CHOA 5CYQA 4YOYA 1KC8O 3E1YA 2NRZA 1ZC6A 3WUHA 1QQOA 2JLEA 1N5YA 4DKWA 4FWQA 3MCAB 1KLMA 5KPZA 3AVIA 3W3DA 4CJTA 3ATVA 4CVNE 1Z26A 3D7EO 3A8YA 3O9TA 4B1UB 3EKUA 1XUPO 1Q7YO 1NKCA 2F8TA 4OPJA 3HXMA 5BRHA 1GLAG 4FWPA 3KLFA 1B9FA 3CJAA 3N4QA 3VF2A 2O8CA 3FR0A 2OTJN 4IZ9A 4B1WB 4BGBA 4BECA 4BR5A 5HRRA 3TSPA 1SL2A 3QEIA 4DG1A 3DLLL 4B9SA 3KVGA 2YHBA 4FLWA 4JI8K 3QBXA 1NGGA 5KGXA 3I33A 4MO4A 2B4JA 2O8DB 3ZSOA 3OYNA 1QHTA 4DLGA 1OKJA 5BR8K 4HCBA 3PIPL 2Z1JA 3O9QA 1X9MA 2YI1A 1U48A 4GV9A 3VPZA 3F73A 1RDUA 1KXPA 1RDBA 2VGNA 4E3SA 1JL2A 4JD2B 4CJ3A 3OYBA 4DWIA 4CJUA 1F21A 4JKDA 4KB0A 1KTQA 4JYAK 4C8NA 4CF1A 2QWMA 3CD6N 3MX2A 3RR8A 1S1XA 4FWKA 4JI0K 4CD1A 2O8FA 1S1UA 3KHYA 3LWLA 3VA3A 4DR6K 3LDLA 2F9TA 1QVGM 3KK3A 2FSNA 5A2QO 2E5LK 2NUBA 2YV0X 3C0BA 5FPDA 1IKVA 2D0BA 4JNEA 4XEIA 1TK0A 3P4IA 1U2VB 2E88A 3ZCMA 1VAZA 4C1NI 5HRNA 4CERA 3O4NA 1X9SA 2P9LA 4KO0A 1IBLK 3AV9A 3SMSA 3LPTA 4DQQA 2CGLA 5KGWA 3ZSQA 2V52B 2YHAA 3VEWA 1XI1A 1IBMK 3OYHA 1R59O 2ASOA 5LJVA 4YOXA 1BOTO 4N47A 4DSJA 4DR5K 4J2EA 5C25A 3HI0A 4O5BA 4CEBA 3VF6A 4MDBA 2OCEA 4OJRA 4N5SA 1ZBIA 4AH9A 2A40A 2VG5A 4FWRA 3AY9A 1CLQA 3QINA 3AA2A 4JAXA 2VCPA 4DV7K 4KTQA 4CJQA 2JWKA 1EETA 4BWJA 2NRVA 2DTUA 1TAQA 1QZ5A 3UKUB 3B6PA 4FJXA 2X6NA 3UKRA 4OO1J 3I0RA 2E2NA 4GV3A 3BDPA 4LF8K 4BY9C 4O55A 4CJFA 5AQIA 2ZJQL 4ILJA 1TK8A 3DWLA 1JXBA 4FZYA 1EWQA 1K6YA 1TKZA 3HZ6A 3O9RA 4R5PA 3H45C 2HMIA 4LD0A 1V4SA 1JLEA 4CW7B 1FXXA 2J4RA 1NM1A 3O1WA 4DF4A 2VWKA 2ZQBA 3QERA 2V7ZA 1RDCA 3LAKA 5EXWA 2AJQA 3OYAA 5KRTA 1V4TA 4B8AB 1T8EA 2QK9A 3AGRA 3HVTA 4CECA 3CG7A 3H3OB 5M1NA 4Z4CA 4W5RA 3TAQA 3OA9A 4GVEA 3LZJA 2UU9K 3AO1A 1QZ6A 2PYJA 1D9FA 3ZX2A 4IEIA 4A2AA 1GOBA 4FZXC 2E6MA 4FM0A 4BR2A 1NK5A 1X9WA 1GLBG 3PSIA 2HW3A 1LWEA 2NRXA 1NBWA 1OH8A 4C8OA 5LL6Z 3G4SN 3EL2A 5CZ2A 3ATUA 4FJ7A 3VEZA 4W5NA 4B1VA 4LFCK 3LDNA 3VGMA 3ENHA 3J81O 3SPYA 3MK6A 3BY5A 4I2QA 2VQEK 5GINA 2UXDK 5I42A 1KAYA 5FPMA 4C8LA 3I56N 3CC4N 2KW4A 4ELVA 4J2DA 1Y97A 5CZ1A 4PUOA 1YTUA 4BDYA 4ZHRA 2IVPA 4CBUA 4HUGA 4CF0A 2HBJA 5GADP 1CZ9A 5AQYA 3G6EN 1KLNA 3P5JA 3V4IA 3H1QA 2FBTA 2ZF5O 1YI2N 4B9TA 3CC2N 2W42A 1KRPA 5AQKA 3HJFA 1RT5A 2OTLN 5BR9A 1U49A 4GKJK 2A3ZA 2JGUA 3CFPA 1W2BM 3D2EB 3L6QA 4WFBL 3IKMA 4A59A 2HMPA 3O9SA 3TTCA 4FJGA 3DYAA 1JLAA 1VSFA 4HTLA 4JLHA 1C1AA 4BRPA 3SAFA 4DHYA 4ELTA 5LJWA 1P90A 3M6GA 3NGYA 3LP0A 4AHUA 4H0OA 4DFPA 3CM6A 5AZIA 3WXMB 3OBWA 1VQ4N 3V9WA 2G8KA 5HRPA 5ADXH 5AJ3K 4CZJA 3VTHA 3KLEA 3FZFA 3K0SA 1W97L 1HPMA 4FWMA 4M41A 4IXCA 4CZEA 3SJJA 4K8XA 1LCUA 5K14A 2HBLA 3AA5X 5GAGP 4KHQA 4IFYA 2O8EA 3NAEA 5FROA 3HSTB 3TAEA 3QEXA 3O3HA 4O4GA 1VSHA 2E20A 4CZMA 4CGGA 3MEDA 3DI6A 2ZD1A 3IMXA 5AZJA 3RMAA 2QA4N 1SL0A 3NHGA 3BF1A 3DOLA 3AO4A 3OYDA 4BR9A 4B9NA 3MX5A 4LF9K 3P83D 3NCIA 1SL1A 4FM2A 4CGJA 4XIUA 4B3MK 1GLLO 4M3UA 3NBPA 3TAFA 3MN9A 1RTIA 2KZMA 4NB4A 3VQ8A 3WT0A 3TAMA 4CGFA 1BIUA 5B8HA 3HT3A 5C42A 3OYLA 4YOWA 1QQNA 4FJJA 4C1NK 3TABA 4QS7A 1KVBA 4FJMA 3LALA 4KRFA 2P9LB 3CJCA 4EP5A 1NGBA 4BRLA 3LDOA 3BP8A 2IVOA 1GLDG 4CIGA 5AQJA 4JS5A 4IBNA 4O0JA 4QAGA 5KPTA 3SI6A 2P9NA 1P8ZA 3CCLN 1O1WA 1N36K 4CGHA 4IG3A 5E41A 4U7BA 3ZT1A 4DTXA 3TR8A 4DR4K 3O5BA 3PX0A 1T3VA 4F8RA 2HOEA 1TL3A 2DFFA 4DUYK 2A42A 3H3NO 2B6AA 4X66K 1VQ5N 3L2RA 4CZIA 4DV4K 3WNFA 1GLCG 1Q81O 4WQ5C 4CHZA 1VHXA 2E2PA 1D9DA 1REVA 4KI6A 2Y1JA 3L3VA 2G8IA 3SPZA 3KKRA 4O44A 4CEAA 3A2FA 5M1KA 2KZZA 3LWMA 2D5RA 4CFAA 5IT9O 3A0IX 1Q8IA 5CY4A 2YJEA 3AVLA 5KTQA 1M90O 4CEFA 1X3NA 1WAJA 1KVCA 5T7BA 4DUZK 4W5OA 3THYA 5AQFA 3KWIA 5J2NA 4JKEA 4B3RK 1CZBA 2QI2A 3UE5A 1B92A 2QWPA 1WSHA 1NMDA 3TTDA 4CFDA 3SUPA 2E1ZA 2I7PA 4KHWA 1Z05A 4Q0BA 2XY5A 1HKBA 3QIPA 4IEEA 1K8AO 2W40A 4LF5K 3JSMA 3GBTA 1JCGA 2IS3A 4Z0UA 1DLOA 2FBXA 1QQCA 2NNWA 3J7AP 4KKOA 3CJ1A 2VYPA 4MDAA 5C10A 4N41A 3LP1A 2FXUA 4CHPA 4JI3K 4WQ4C 1C1BA 4M3ZA 3RVCA 3GOIA 2HHUA 3QFPA 3HTVA 1GOAA 2Q97A 4HHTA 4XJXA 3S3MA 1L5UA 4MLHA 4I6MB 2KLAA 3T7ZA 4ELUA 4FLZA 4GVMA 4FL9A 3FLCO 3R3LA 4KPYA 4AHVA 4E7LA 4XH1A 1YAGA 3LM9A 2E1YA 5C24A 2OPRA
chains in the Genus database with same CATH topology
3IUCA 2QW9A 4O5FA 5M1OA 1VQKN 3QBXA 2QWRA 5BPLA 1NGGA 3EKSA 2HF3A 3ZYYX 4H5NA 3I33A 4MO4A 4CZHA 4BRGA 1YJ9N 1M1KO 3FGUA 2NRWA 1DKGD 4BR7A 4WFNL 4BRQA 1OKJA 1X9JA 3VEVA 5KQDA 3FZKA 3LDPA 3MCPA 3O9QA 2Q1NA 3PIPL 2YI1A 3E9PA 4GV9A 4BQLA 1U6ZA 4BRIA 3VPZA 3ENOA 1RDUA 3KK7A 1NJIO 1KXPA 2VGNA 5AQXA 3IFRA 3DJCA 4JD2B 3SK3A 2E2OA 4JKDA 3QICA 4A61A 5F1XA 1ESVA 1YXQA 4CBXA 2QWLA 2QWMA 2ZJPL 3CD6N 3MX2A 4RTFD 2HBKA 4JKFA 2P9IB 5C2DA 3DXMA 4FWKA 4CD1A 2P9SB 1YITN 5MLCQ 3KHYA 1VQ6N 3CIPA 3LDLA 4I6MA 2GWJA 2F9TA 3HSCA 3CMAN 4YDUA 1QVGM 2FSNA 3CERA 5KQ8A 5AQZA 1S22A 5AZIB 5TKWA 4JEPA 4K43A 4NO7A 3UKRB 3C0BA 1OVYA 3EN9A 4H5RA 2IIRA 3SBTA 5FPDA 3QDKA 3H1VX 4JNEA 4XEIA 3R6MA 3D2FA 1DEJA 3P4IA 3J8AA 4WYBA 1U2VB 2E88A 3F9MA 1VAZA 4C1NI 1ZBSA 4BC5A 2P9LA 4PL8A 3B8AX 4K42A 3SMSA 1YJWN 4EIAA 1Q82O 4FWLA 4JKGA 2CGLA 1SS6A 3VOVA 5AQSA 1TUUA 3HRGA 2V52B 3VEWA 1J6ZA 1RGIA 2YHXA 2Q0UA 1R59O 2ASOA 2ZWHA 2GUPA 5AQHA 3ULEB 5C2FA 1BOTO 5LJVA 4YOXA 3L4QA 3I55N 1ILYA 3PLAA 2P9KB 4KBOA 1TYQB 2NLXA 3U9ZA 4C23A 3HI0A 1TUYA 3VF6A 3ID8A 4MDBA 3RSEB 3FFKB 4G9ZA 4H0YB 2ASPA 3GG4A 1BUPA 2A40A 4YDUC 4A5BA 5HL7L 4FWRA 1WUAA 2Q2RA 1IJJA 3AY9A 4H5VA 1K8KB 4JAXA 2P9PB 2VCPA 4KH6A 5BN8A 2JWKA 3L0QA 2FF6A 4CD3A 4BVOA 2NRVA 3A5OC 3K9JA 3QBWA 5AQOA 4YOUA 5DM7L 3TPQA 1QZ5A 1WOQA 3HOSA 3UKUB 2H3GX 2JWLA 3T69A 3UKRA 4OO1J 1NGDA 2E2NA 3O4WA 4GV3A 5AQNA 4BC4A 4BRFA 4BY9C 3QMLA 4JKHA 5AQIA 5AQRA 3O6WA 2ZJQL 4ILJA 1BU6O 3DWLA 1ATSA 4JKBA 2KHOA 3NVKA 3OW2M 3HZ6A 3R1XA 1YJNN 4H0TB 2HSTA 2YX6A 3O9RA 4CZLA 4BG8A 4BQZA 3A5MC 3WEEB 3H45C 2PFUA 3EE9A 2WFBA 4RCHA 1V4SA 1GLJO 4JHDB 4OPAA 4IJNA 4BR0A 1KQSM 3DXKB 3HM8A 2VGMA 2J4RA 1NM1A 3FZHA 3O1WA 1YHQN 3ULEA 3VERA 2GEMA 3CPEA 2V7ZA 3GE1A 3SMPA 5EXWA 3SBGA 2HBMA 5AQTA 2OANA 3WXKA 4A5AA 3RSEA 2PBDA 2D1KA 5EY4A 3WXLA 3CCSN 1EQYA 3EZWA 1V4TA 3ZETA 4FOEA 4BRHA 3CPWM 2A5XA 4BRMA 3AGRA 2WUSA 3E9LA 3DAWA 1QVFM 1LOTB 1E4FT 4PL7A 5BRFA 1Z6RA 4EFHA 3H3OB 5M1NA 4DCHA 3ENBA 4M7YA 4F9OA 4R79A 4IJAA 3OA9A 5BPMA 5BRDA 4JK7A 4GVEA 2AA4A 4AM7A 3CHWA 1QZ6A 4AM6A 3ZX2A 4IEIA 4A2AA 3CCJN 5CE3A 4UY8O 5GAHP 1RFQA 1JCFA 1XC3A 4BGAA 1D4XA 4BR2A 3QB0A 1GLBG 3MWTA 4B1ZA 1NLVA 3FZLA 5FPEA 2NZTA 5AQUA 2NRXA 3S41A 5CHIA 1NBWA 4ILGB 4BRKA 3CQXA 2QWOA 3L4IA 2KKZA 3EL2A 3G4SN 3ATUA 1HUXA 1MWKA 2CGKA 3GL1A 3VEZA 5H1SQ 4B1VA 2GTDA 3CCRN 1YVNA 3LDNA 3VGMA 3G25A 3ENHA 1MDUB 1SAZA 3O1BA 4MO5A 4O8KA 3MDQA 3P39A 4JKCA 3UB5A 3MK6A 5GAEP 3E66A 4M7XA 1X3MA 3M3ZA 1KD1O 3SAGA 5GINA 2V51B 1JCEA 3CMEN 1KAYA 1S3XA 2D0OA 4U67L 5FPMA 3JS6A 4EHUA 3I56N 1HJOA 3AARA 5JVHL 5GIOA 2CGJA 3CC4N 5E26A 1KAXA 2W41A 3JXUA 4PKIA 2IVPA 4CBUA 5AQQA 2C1IA 4BEBA 3MN5A 4BROA 2HBJA 5GADP 4JKAA 4K41A 3VGKA 5E84A 4J8FA 5AQYA 3G6EN 1Y64A 1NGFA 1KAZA 4CI6A 4IWVA 4PKHA 3WQUA 4DB3A 4YOVA 3H1QA 4ISFA 2ZF5O 4A62A 1VQ7N 1YI2N 4EAHD 3VEYA 1MWMA 3CC2N 4WCEL 1YIJN 1VQ9N 4PKGA 5AQKA 1QHAA 2OTLN 5BR9A 4HWIA 2BH1A 4CZGA 4A57A 5KPRA 2A3ZA 4JD2A 1W2BM 3D2EB 3L6QA 4WFBL 2FSKA 2NRHA 3IKMA 4A59A 2HMPA 3O9SA 3TTCA 1EO1A 1VQON 4H03B 4KH5A 5AZJB 1RDWX 2WBNA 2BUPA 4HTLA 4BRPA 2CH6A 4FO0A 5EX5A 3SAFA 3MMVA 4DHYA 2P9IA 5EOYA 3TSUA 5LJWA 1GLFO 1P90A 2P9SA 4BRCA 4GNIA 3M6GA 4IO8A 3VF4A 3WQTA 4H0OA 2ITMA 3NVMA 5JLHA 5FPNA 3O9UA 4KH4A 5AZIA 4YOTA 3OBWA 3VEXA 2E2QA 3WXMB 3F2KA 4DQ8A 4E1JA 1VQ4N 1CZAN 4FOIA 2PAVA 4BC2A 3WXJA 1HKCA 4B9QA 3CF5L 3CCQN 2ZGYA 3K9KA 5ADXH 1N8RO 4CZJA 1U2VA 2Q36A 4FSVA 3VTHA 4IO9L 2A41A 3FZFA 3G71N 3CETA 4BRNA 1W97L 1HPMA 1ZXOA 3KZBA 2UYTA 4FWMA 2F7TA 3LDQA 4IXCA 5ELZA 4CZEA 5JLFA 3U4LA 5M1PA 5DM6L 1LCUA 2HBLA 3CCUN 3CCVN 1NGJA 5GAGP 4IOXA 1YF5L 3BUZB 4BRDA 3CJBA 3QFUA 2ZGZA 3U9DA 1NGCA 3BF3A 4B1YB 2W00A 3GDQA 4QS9A 3AGKA 2YHYA 1BG3A 2V7YA 2EWSA 3E9OA 3FZMA 2P9KA 1TYQA 3TU5A 4FPBA 3A5NC 2HF4A 3D2EA 2E20A 4CZMA 3FE1A 4L3QA 2IVNA 2YHWA 4YORA 4H0VB 3IMXA 4CJ7A 5AZJA 4K25A 1NWKA 1K8KA 1NGIA 2QA4N 4WF9L 5AR0A 2P9PA 2P9NB 3BF1A 3D6RA 2RHKA 4XH5A 4BR9A 3MX5A 5BREA 2WC9A 2QEXN 2BTFA 5JMVA 4WFAL 3F5TA 4Z94A 3OHRA 5ADXA 4NLBA 3UKUA 5M1FA 5C12A 3C6HA 2ZJRL 3SJHA 2QWQA 3TTFA 4IOAL 1GLLO 3I8BA 1C0FA 5CR4A 3CC7N 3MN9A 2GWKA 5AFUH 3MWPA 4FWNA 5BPNA 3ID6A 2RE2A 1DT9A 3VESA 2F9WA 4NB4A 2QTDA 1T44A 2QM1A 3VETA 2DPNA 2QXLA 3M5RA 3WT0A 5B8HA 1G99A 2GX9A 5JVGL 3MN7A 2YCHA 3CJ7A 3VEOA 1QQNA 4YOWA 4IOCL 3WEEA 4GY2B 4C1NK 2P9UB 3D2FB 4QS7A 4H0XB 3R8EA 1SQKA 4JHDA 1QQMA 3DXKA 5HOOA 2I7NA 2FLOA 2P9LB 1BA1A 3CJCA 4WQ5A 4OPHA 3SLCA 3C65A 4MLEA 3OBYA 5F2RA 3VTIA 4JKGB 1NGBA 3BEXA 2VWBA 3LDOA 4FWSA 3WXIA 3EO3A 3BP8A 4BRLA 2IVOA 1GLDG 1JJ2M 2Q31A 5AQJA 3IDHA 5AQWA 3O8MA 1K9MO 5KPTA 4GV6A 1HKGA 1VQMN 4BREA 1S72N 2P9NA 5AQVA 4H5TA 1P8ZA 5AFUA 3CCLN 3LL3A 5I9EB 1E4GT 4XH4A 4U7BA 3C7NB 4BG9A 3O5BA 1ATNA 1T3VA 4RWTA 3NMUA 2HOEA 5AQMA 3Q7BA 1SZ2A 2A42A 4BRAA 1BA0A 1NGHA 1Q18A 3EE8A 3H3NO 4CZKA 1O13A 1VQ5N 1ATRA 4CZIA 1BDGA 1GLCG 2FSJA 2Q0RA 4WQ5C 5AQGA 4BVPA 1Q81O 2E2PA 1K73O 3ZEUB 3VENA 1BO5O 3AAPA 3U8XA 1GLEG 5AQLA 1T6CA 3H6EA 2YJFA 3PIOL 2P9UA 3P31A 2AP1A 3ZX3A 4BC3A 3H46O 1HX1A 3TSQA 2E8AA 5M1KA 1VQ8N 4IDHA 3CQYA 2CH5A 1C0GA 3LM2A 4ILHA 2C1GA 3A0IX 2YJEA 1NGEA 1M90O 2NRTA 1X3NA 2GELA 4H0PA 3VGLA 3CCMN 3C6AA 1BWFO 1T6DA 2A6AA 4NLCA 5BN9A 3CCEN 4JK9A 3CI5A 1DGKN 5AQFA 3SAHA 3KWIA 3HOTA 4FPAA 1VQNN 3ZX0A 4JKEA 3AAQA 3O08A 4WQ4A 5LY3A 5C0YA 2QI2A 3R9PA 5EVZA 1YUWA 3O80A 5TKYA 3UE5A 3ZETB 3W0LA 3A5LC 5AQPA 4A2BA 2QWPA 3Q7CA 3C7NA 1NMDA 3TTDA 5C15A 4YOYA 5F0XA 4CZFA 1KC8O 2E1ZA 2I7PA 3E1YA 4LC9B 1Z05A 4BE7B 2NRZA 1HKBA 2ASMA 4IEEA 1ZC6A 1K8AO 3WUHA 1QQOA 4CBWA 2W40A 4EHTA 4DKWA 4FWQA 3GBTA 1JCGA 3MCAB 3ZEUA 1VQPN 1XQSC 5KPZA 5GIPA 3W3DA 3MN6A 4M63C 1VQLN 4JK8A 2QWNA 2NNWA 3ATVA 3KWGA 5JICA 3CJ1A 2VYPA 4MDAA 5C10A 4IFEA 3D7EO 3A8YA 2FXUA 3O9TA 4B1UB 2D0PA 3EKUA 1XUPO 4Y0WA 1Q7YO 4WQ4C 4ISEA 3RVCA 3GOIA 2FF3B 4JN4A 4H5WA 4O8UA 4AF1A 5M1QA 3VMFB 3CXCM 5BRHA 3QFPA 3HTVA 1GLAG 2Q97A 4B1XB 4XJXA 4FWPA 3DXMB 3CJAA 3J7ZO 3N4QA 3VF2A 4QS8A 4MLHA 3FR0A 2OTJN 4IZ9A 4B1WB 1HLUA 4I6MB 2KLAA 3T7ZA 4BGBA 4BECA 4BR5A 1H1VA 3M1FA 3TSPA 4BR4A 1MA9B 1Q86O 3HBTA 4FL9A 3FLCO 3R3LA 4ISGA 3DLLL 4PHTX 1NGAA 3P38A 1IG8A 4XH1A 3CJ9A 2NRRA 3KVGA 1YAGA 3LM9A 4FVUA 2E1YA 2D4WA 4FWOA 3N4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IUC A;  2QW9 A;  4O5F A;  3QBX A;  2QWR A;  5BPL A;  1NGG A;  3EKS A;  2HF3 A;  4H5N A;  3I33 A;  4MO4 A;  4CZH A;  4BRG A;  3FGU A;  1DKG D;  4BR7 A;  4BRQ A;  1OKJ A;  1X9J A;  3VEV A;  5KQD A;  3FZK A;  3LDP A;  3MCP A;  2Q1N A;  2YI1 A;  4BQL A;  1U6Z A;  4BRI A;  3VPZ A;  3ENO A;  1KXP A;  5AQX A;  3IFR A;  3DJC A;  4JD2 B;  3SK3 A;  2E2O A;  3QIC A;  4A61 A;  5F1X A;  1ESV A;  1YXQ A;  4CBX A;  2QWL A;  2QWM A;  4RTF D;  2P9I B;  3DXM A;  4FWK A;  4CD1 A;  2P9S B;  3KHY A;  3CIP A;  3LDL A;  4I6M A;  2GWJ A;  2F9T A;  3HSC A;  4YDU A;  2FSN A;  3CER A;  5KQ8 A;  5AQZ A;  1S22 A;  5AZI B;  4NO7 A;  4K43 A;  3UKR B;  3C0B A;  3EN9 A;  5FPD A;  4H5R A;  2IIR A;  3QDK A;  3H1V X;  4JNE A;  4XEI A;  3R6M A;  3D2F A;  1DEJ A;  3P4I A;  3J8A A;  4WYB A;  1U2V B;  2E88 A;  3F9M A;  1ZBS A;  4BC5 A;  2P9L A;  4PL8 A;  3B8A X;  4K42 A;  3SMS A;  4EIA A;  4FWL A;  2CGL A;  3VOV A;  5AQS A;  1TUU A;  2V52 B;  3VEW A;  1J6Z A;  1RGI A;  2YHX A;  2Q0U A;  1R59 O;  2ASO A;  2ZWH A;  2GUP A;  5AQH A;  3ULE B;  5LJV A;  1BOT O;  2P9K B;  4KBO A;  1TYQ B;  2NLX A;  3U9Z A;  4C23 A;  3HI0 A;  1TUY A;  3VF6 A;  3ID8 A;  3RSE B;  3FFK B;  4H0Y B;  2ASP A;  3GG4 A;  1BUP A;  2A40 A;  4YDU C;  4FWR A;  1WUA A;  2Q2R A;  1IJJ A;  3AY9 A;  4H5V A;  1K8K B;  4JAX A;  2P9P B;  2VCP A;  5BN8 A;  3L0Q A;  4CD3 A;  2FF6 A;  4BVO A;  3A5O C;  3QBW A;  5AQO A;  3TPQ A;  1QZ5 A;  1WOQ A;  3UKU B;  2H3G X;  3UKR A;  1NGD A;  2E2N A;  3O4W A;  5AQN A;  4BC4 A;  4BRF A;  3QML A;  5AQI A;  5AQR A;  3O6W A;  1BU6 O;  3DWL A;  1ATS A;  2KHO A;  3HZ6 A;  4H0T B;  4CZL A;  4BG8 A;  4BQZ A;  3A5M C;  3WEE B;  3H45 C;  4RCH A;  1V4S A;  1GLJ O;  4JHD B;  4IJN A;  4BR0 A;  3DXK B;  3HM8 A;  2J4R A;  1NM1 A;  3FZH A;  3O1W A;  3ULE A;  3VER A;  2GEM A;  2V7Z A;  3GE1 A;  3SMP A;  5EXW A;  5AQT A;  2OAN A;  3WXK A;  3RSE A;  2PBD A;  2D1K A;  5EY4 A;  3WXL A;  1EQY A;  3EZW A;  1V4T A;  3ZET A;  4FOE A;  4BRH A;  2A5X A;  4BRM A;  2WUS A;  3DAW A;  1LOT B;  1E4F T;  4PL7 A;  5BRF A;  1Z6R A;  4EFH A;  3H3O B;  4DCH A;  4M7Y A;  4F9O A;  4IJA A;  5BPM A;  5BRD A;  2AA4 A;  4AM7 A;  3CHW A;  1QZ6 A;  4AM6 A;  3ZX2 A;  4A2A A;  5CE3 A;  1RFQ A;  1JCF A;  1XC3 A;  4BGA A;  1D4X A;  4BR2 A;  3QB0 A;  1GLB G;  4B1Z A;  1NLV A;  3FZL A;  5FPE A;  2NZT A;  5AQU A;  3S41 A;  1NBW A;  4BRK A;  3CQX A;  2QWO A;  3L4I A;  3EL2 A;  3ATU A;  1HUX A;  1MWK A;  2CGK A;  3GL1 A;  3VEZ A;  4B1V A;  2GTD A;  1YVN A;  3LDN A;  3VGM A;  3G25 A;  3ENH A;  1MDU B;  1SAZ A;  3O1B A;  4MO5 A;  4O8K A;  3MDQ A;  3UB5 A;  3MK6 A;  4M7X A;  1X3M A;  3M3Z A;  2V51 B;  1JCE A;  1KAY A;  1S3X A;  2D0O A;  5FPM A;  3JS6 A;  4EHU A;  1HJO A;  3AAR A;  2CGJ A;  5E26 A;  1KAX A;  2W41 A;  3JXU A;  4PKI A;  2IVP A;  4CBU A;  5AQQ A;  3MN5 A;  4BRO A;  4K41 A;  3VGK A;  5E84 A;  4J8F A;  5AQY A;  1Y64 A;  1NGF A;  1KAZ A;  4CI6 A;  4IWV A;  4PKH A;  3WQU A;  4DB3 A;  3H1Q A;  4ISF A;  2ZF5 O;  4A62 A;  4EAH D;  3VEY A;  1MWM A;  4PKG A;  5AQK A;  1QHA A;  5BR9 A;  4HWI A;  4CZG A;  5KPR A;  2A3Z A;  4JD2 A;  3D2E B;  3L6Q A;  2FSK A;  2NRH A;  2HMP A;  4H03 B;  5AZJ B;  1RDW X;  2BUP A;  4HTL A;  4BRP A;  2CH6 A;  4FO0 A;  5EX5 A;  3MMV A;  4DHY A;  2P9I A;  5EOY A;  5LJW A;  1GLF O;  2P9S A;  4BRC A;  4GNI A;  3M6G A;  4IO8 A;  3VF4 A;  3WQT A;  4H0O A;  2ITM A;  5JLH A;  5FPN A;  5AZI A;  3VEX A;  2E2Q A;  4DQ8 A;  4E1J A;  1CZA N;  4FOI A;  2PAV A;  4BC2 A;  3WXJ A;  1HKC A;  4B9Q A;  2ZGY A;  5ADX H;  4CZJ A;  1U2V A;  2Q36 A;  4FSV A;  2A41 A;  3FZF A;  3CET A;  4BRN A;  3KZB A;  1HPM A;  1ZXO A;  4FWM A;  2UYT A;  3LDQ A;  4IXC A;  5ELZ A;  4CZE A;  5JLF A;  3U4L A;  1LCU A;  1NGJ A;  3BUZ B;  4BRD A;  3CJB A;  3QFU A;  2ZGZ A;  3U9D A;  1NGC A;  3BF3 A;  4B1Y B;  3GDQ A;  4QS9 A;  2YHY A;  1BG3 A;  2V7Y A;  2EWS A;  3FZM A;  2P9K A;  1TYQ A;  3TU5 A;  4FPB A;  3A5N C;  2HF4 A;  3D2E A;  2E20 A;  4CZM A;  3FE1 A;  4L3Q A;  2IVN A;  2YHW A;  4CJ7 A;  4H0V B;  3IMX A;  5AZJ A;  4K25 A;  1NWK A;  1K8K A;  1NGI A;  5AR0 A;  2P9P A;  2P9N B;  3BF1 A;  4XH5 A;  4BR9 A;  5BRE A;  2BTF A;  5JMV A;  4Z94 A;  3OHR A;  5ADX A;  3UKU A;  3SJH A;  2QWQ A;  1GLL O;  3I8B A;  1C0F A;  3MN9 A;  2GWK A;  5AFU H;  4FWN A;  5BPN A;  3VES A;  2F9W A;  4NB4 A;  1T44 A;  2QM1 A;  3VET A;  2DPN A;  2QXL A;  3WT0 A;  5B8H A;  1G99 A;  3MN7 A;  2YCH A;  3CJ7 A;  3VEO A;  1QQN A;  3WEE A;  4GY2 B;  2P9U B;  3D2F B;  4QS7 A;  4H0X B;  3R8E A;  1SQK A;  4JHD A;  1QQM A;  3DXK A;  2I7N A;  2FLO A;  2P9L B;  1BA1 A;  3CJC A;  4WQ5 A;  3SLC A;  4MLE A;  5F2R A;  1NGB A;  3BEX A;  2VWB A;  3LDO A;  4FWS A;  3WXI A;  3EO3 A;  3BP8 A;  4BRL A;  2IVO A;  1GLD G;  2Q31 A;  5AQJ A;  3IDH A;  5AQW A;  3O8M A;  5KPT A;  1HKG A;  4BRE A;  2P9N A;  5AQV A;  4H5T A;  1P8Z A;  5AFU A;  3LL3 A;  5I9E B;  1E4G T;  4XH4 A;  3C7N B;  4BG9 A;  3O5B A;  1ATN A;  4RWT A;  2HOE A;  5AQM A;  1SZ2 A;  2A42 A;  4BRA A;  1BA0 A;  1NGH A;  1Q18 A;  4CZK A;  3H3N O;  1ATR A;  4CZI A;  1BDG A;  1GLC G;  2FSJ A;  2Q0R A;  4WQ5 C;  5AQG A;  4BVP A;  2E2P A;  3ZEU B;  3VEN A;  1BO5 O;  3AAP A;  3U8X A;  1GLE G;  5AQL A;  1T6C A;  3H6E A;  2YJF A;  2P9U A;  2AP1 A;  3ZX3 A;  4BC3 A;  3H46 O;  1HX1 A;  2E8A A;  3CQY A;  2CH5 A;  1C0G A;  3LM2 A;  3A0I X;  2YJE A;  1NGE A;  1X3N A;  2GEL A;  4H0P A;  3VGL A;  1BWF O;  1T6D A;  2A6A A;  5BN9 A;  3CI5 A;  1DGK N;  5AQF A;  4FPA A;  3ZX0 A;  3AAQ A;  3O08 A;  4WQ4 A;  5LY3 A;  3R9P A;  5EVZ A;  1YUW A;  3O80 A;  5TKY A;  3UE5 A;  3ZET B;  3W0L A;  3A5L C;  5AQP A;  4A2B A;  2QWP A;  3C7N A;  1NMD A;  5F0X A;  4CZF A;  2E1Z A;  2I7P A;  4LC9 B;  1Z05 A;  1HKB A;  2ASM A;  1ZC6 A;  3WUH A;  1QQO A;  4CBW A;  2W40 A;  4EHT A;  4FWQ A;  3GBT A;  1JCG A;  3ZEU A;  1XQS C;  5KPZ A;  3W3D A;  3MN6 A;  4M63 C;  2QWN A;  3ATV A;  5JIC A;  3CJ1 A;  2VYP A;  3D7E O;  3A8Y A;  2FXU A;  4B1U B;  2D0P A;  3EKU A;  1XUP O;  4Y0W A;  4WQ4 C;  4ISE A;  3GOI A;  2FF3 B;  4JN4 A;  4H5W A;  5BRH A;  3QFP A;  3HTV A;  1GLA G;  2Q97 A;  4B1X B;  4FWP A;  3DXM B;  3CJA A;  3VF2 A;  4QS8 A;  4MLH A;  3FR0 A;  4IZ9 A;  4B1W B;  1HLU A;  4I6M B;  4BGB A;  4BR5 A;  1H1V A;  3M1F A;  4BR4 A;  1MA9 B;  3HBT A;  4FL9 A;  3FLC O;  4ISG A;  1NGA A;  1IG8 A;  4XH1 A;  3CJ9 A;  3KVG A;  1YAG A;  3LM9 A;  2E1Y A;  2D4W A;  4FWO A; 
#chains in the Genus database with same CATH topology
 3IUC A;  4O5F A;  2HHV A;  5M1O A;  4DMN A;  2QWR A;  3EKS A;  4OKE A;  4H5N A;  4CZH A;  4BRG A;  1YJ9 N;  1M1K O;  4OX9 K;  1X9J A;  5KQD A;  3FZK A;  3LDP A;  2Q1N A;  4I2P A;  4HUF A;  1BIS A;  1U6Z A;  4BRI A;  2ATQ A;  3IFR A;  3DJC A;  1NKB A;  4B8C A;  4CF9 A;  4B9M A;  5SZT A;  4Z4F A;  3LZI A;  3THW B;  1BQN A;  3SQ1 A;  3DLE A;  5F1X A;  3PO5 A;  1ESV A;  3NGZ A;  2ZJP L;  2HBK A;  4JKF A;  5C2D A;  3DXM A;  3ZSW A;  5MLC Q;  2GBZ A;  1VQ6 N;  2GWJ A;  4CJL A;  1WSG A;  1C1C A;  3M8P A;  5AZI B;  4NO7 A;  4K43 A;  3EN9 A;  4RW4 A;  1BI4 B;  3H1V X;  3KLG A;  4KFB A;  3NH1 A;  1XMO K;  1ZBU A;  1ZBS A;  4BC5 A;  4YNQ A;  3IG1 A;  4PL8 A;  3B8A X;  4K42 A;  3H08 A;  3BGR A;  3ZT0 A;  2HHX A;  4I9L A;  3THV A;  1Q82 O;  4JKG A;  5AQS A;  2O8E B;  1RGI A;  2YHX A;  5C2F A;  4BE7 B;  4K0K K;  3B6O A;  2NLX A;  2HHT A;  3PV8 A;  1RTD A;  5D3G A;  4YDU C;  2Q2R A;  4DS4 A;  1ASU A;  1S9E A;  4B9V A;  1WOQ A;  2D0C A;  2HNY A;  3DLG A;  1IO2 A;  4RW6 A;  1XMQ K;  2JWL A;  4DSE A;  3T69 A;  1NJW A;  3PO4 A;  3SCX A;  1TV6 A;  3O4W A;  4JI2 K;  1I94 K;  5AQN A;  4BC4 A;  1BU6 O;  4JKB A;  3OW2 M;  1YJN N;  2YX6 A;  4CZL A;  3TI0 A;  2HHQ A;  4BQZ A;  3ALY A;  5LMU K;  1KFD A;  2WFB A;  4CJV A;  4IJN A;  1XNQ K;  3HM8 A;  3FZH A;  4LH4 A;  3ULE A;  4KAZ A;  3CPE A;  4HTU A;  5AQT A;  4A5A A;  3RSE A;  2G8V A;  1EQY A;  3VQ9 A;  1X1P A;  4FOE A;  3ZSR A;  2FC0 A;  3IRX A;  3CPW M;  1RT4 A;  4FLV A;  5SWM A;  3E9L A;  1LW0 A;  3NF8 A;  1LOT B;  2O8B A;  1E4F T;  5LMN K;  4FK4 A;  1QTM A;  4KI4 A;  3QET A;  2R7Y A;  5DK5 A;  5BPM A;  4R79 A;  2W6K A;  1ASV A;  4JK7 A;  4C8K A;  4DTR A;  4FW2 A;  3WNH A;  4AM6 A;  3CCJ N;  5GAH P;  4CJS A;  3KJV A;  3VQD A;  1SUQ A;  1G15 A;  4V19 S;  3CFO A;  4ILG B;  4BRK A;  3DMJ A;  2QWO A;  1VRU A;  1MWK A;  5H1S Q;  3PUF A;  3QEW A;  3CCR N;  1N34 K;  1QSL A;  1SAZ A;  1HNW K;  4O8K A;  3MDQ A;  3P39 A;  4JKC A;  3UB5 A;  1SKR A;  5GAE P;  4CEE A;  1XHX A;  4M7X A;  2P5O A;  4KRE A;  1X3M A;  2YKM A;  3M3Z A;  4CFC A;  2V51 B;  4U67 L;  2P5G A;  3JS6 A;  3THY B;  3PSF A;  4EHU A;  5JVH L;  1KAX A;  4CHQ A;  2W41 A;  3JXU A;  4PKI A;  3I8D A;  2C1I A;  4BEB A;  3MN5 A;  2HVH A;  4K41 A;  3VGK A;  3VQ5 A;  4J8F A;  2UUA K;  2X74 A;  1FJG K;  1RCH A;  3WQU A;  4YOV A;  4DB3 A;  1VQ7 N;  4CJW A;  4F3O A;  1MWM A;  2P1J A;  2RKI A;  2HHW A;  3MEE A;  4AQY K;  3OYI A;  4DU3 A;  3DLB A;  3JAM O;  1N6Q A;  4BAC A;  2NRH A;  3NE6 A;  2Z1I A;  2FBV A;  4KH5 A;  1RNH A;  1VSE A;  4BDZ A;  2CH6 A;  4G1Q A;  4FO0 A;  2PYL A;  5J2M A;  2P9I A;  3AO2 A;  2P9S A;  4BRC A;  4GNI A;  4IO8 A;  4CHN A;  3VF4 A;  3WQT A;  3SZ2 A;  3NVM A;  5FPN A;  3VEX A;  4E1J A;  2OYQ A;  4E7I A;  2QKB A;  4PY5 A;  3MXM A;  1L3S A;  4M3W A;  1HKC A;  2XRI A;  3OYM A;  1JLQ A;  3QEP A;  1BCO A;  5HP1 A;  2Q36 A;  4FSV A;  4ZTJ A;  1QSY A;  1TGO A;  1VSL A;  2A41 A;  4JS4 A;  4LF4 K;  1ZBL A;  1HMV A;  4DTO A;  3U4L A;  2HND A;  3TAR A;  1S1W A;  1NGJ A;  3SQ4 A;  1WBB A;  3BUZ B;  3DLK A;  3CJB A;  2ZGZ A;  3L3U A;  3BF3 A;  4B1Y B;  1A5X A;  3GDQ A;  3AGK A;  3KLI A;  2A1R A;  2V7Y A;  2G8U A;  1OVQ A;  2P9K A;  1TYQ A;  2GUI A;  3TU5 A;  2YNF A;  1FKO A;  2HF4 A;  3V9Z A;  3QNO A;  3V81 A;  4L3Q A;  4CJ7 A;  2OPP A;  3VN5 A;  4K25 A;  1VRT A;  1K8K A;  4LSN A;  4WF9 L;  1NK0 A;  3D6R A;  4DTS A;  2RHK A;  4MQ3 A;  2A1S A;  5JMV A;  4WFA L;  2EHG A;  3AVN A;  5ADX A;  5M1F A;  1WAF A;  5C12 A;  1HNI A;  4IOA L;  2WON A;  3I8B A;  4DS5 A;  1VSK A;  2GWK A;  4FWN A;  3VES A;  2F9W A;  4M3X A;  2QTD A;  3ZT2 A;  2UXC K;  3VET A;  2QXL A;  3M5R A;  4FLT A;  1NK7 A;  3EEQ A;  5JVG L;  3MAQ A;  3CJ7 A;  3WEE A;  2P9U B;  4H0X B;  3R8E A;  3DXK A;  5HOO A;  4F3T A;  3U3Y A;  1HR0 K;  4OPH A;  3SLC A;  3QNN A;  3ZT3 A;  3AVA A;  1RT3 A;  5F2R A;  3K58 A;  4JKG B;  3PX4 A;  3WXI A;  4FWS A;  2Q31 A;  1K9M O;  4DV5 K;  4LFA K;  4B3S K;  1S72 N;  5AQV A;  1JLF A;  4H5T A;  1IKX A;  3CQ8 A;  1L3T A;  1VK0 A;  1E4G T;  4IDK A;  3C7N B;  4CK2 A;  3J7Y P;  4CJK A;  1J9A A;  4DTU A;  3Q7B A;  4BRA A;  1BA0 A;  4CZK A;  4E7J A;  4FJH A;  4CJE A;  1HYZ A;  3ITH A;  2Q0R A;  4W5Q A;  1K73 O;  4H4M A;  1BO5 O;  4OLA A;  1T6C A;  3PIO L;  3P31 A;  3ZX3 A;  4BC3 A;  2DY4 A;  2F4V K;  1VQ8 N;  3CQY A;  4DSI A;  3O3F A;  1HQU A;  1C0G A;  3RRG A;  2C1G A;  3AVJ A;  4M3Y A;  1TL1 A;  4B08 A;  2NRT A;  2YNI A;  2GEL A;  4H0P A;  4KV8 A;  4NCG A;  1GOC A;  4I7F A;  1EWR A;  3CCM N;  4JK9 A;  2W6L A;  3SAH A;  4FPA A;  1VQN N;  3AAQ A;  1WLJ A;  2O8C B;  4Y1D A;  5J1E A;  2Y1I A;  5EVZ A;  3M8Q A;  3J80 O;  3O4Q A;  5C15 A;  4CZF A;  4NCA A;  2O8B B;  2UXB K;  2D0A A;  3PX6 A;  4LC9 B;  1RTH A;  4EHT A;  3ZEU A;  3ASM A;  3MN6 A;  3AVK A;  2EX3 A;  1QSS A;  3KWG A;  4IFE A;  2D0P A;  4KHS A;  4Y0W A;  5JS2 A;  5JS1 A;  4ISE A;  4DSK A;  4O8U A;  4JN4 A;  4AF1 A;  4H5W A;  3QEV A;  2UUB K;  1BCM A;  1C6V A;  1HYS A;  3V9S A;  2O8F B;  1L3U A;  3J7Z O;  3RR7 A;  3SV4 A;  1HLU A;  3C95 A;  1L3V A;  2YKN A;  4CFB A;  3M1F A;  1Q86 O;  4F2R A;  3C6U A;  1WSI A;  3AVF A;  1DTQ A;  4OKK A;  4PHT X;  1NGA A;  3P38 A;  1JLB A;  3KD5 E;  4FVU A;  2D4W A;  1VQK N;  1NK6 A;  2F8S A;  4OPK A;  1DKG D;  1JLG A;  2ITG A;  4WFN L;  2HHI A;  3VEV A;  4M42 A;  4BQL A;  3OY9 A;  3SUO A;  4DTP A;  4NXN K;  4Z4I A;  1NJI O;  5AQX A;  1WNS A;  3V1O A;  3G10 A;  3IAY A;  1Q9Y A;  1J53 A;  4OGC A;  4CBX A;  2QWL A;  4RTF D;  2P9I B;  3CYM A;  1RDD A;  2P9S B;  1YIT N;  1DTT A;  3ZSV A;  3S3N A;  3HSC A;  2VG7 A;  3V1Q A;  3G0Z A;  3DM2 A;  1NU0 A;  5AQZ A;  1S22 A;  5HBM A;  5KQ8 A;  5TKW A;  4JEP A;  3UKR B;  4AIL C;  3SV3 A;  1OVY A;  3TAP A;  1IBK K;  2IIR A;  1NOY A;  3QDK A;  4AHS A;  3D2F A;  1DEJ A;  4WYB A;  3J8A A;  1EP4 A;  1KFS A;  3F9M A;  1YTA A;  1HPZ A;  5J2Q A;  4KHN A;  3ZLJ A;  1YJW N;  4FWL A;  1SS6 A;  4DFJ A;  1J6Z A;  3OS0 A;  1J5E K;  5AQH A;  4NXM K;  2P9K B;  4KBO A;  1TYQ B;  4WE1 A;  4C23 A;  3KIO A;  1TUY A;  3ID8 A;  1FW6 A;  4G9Z A;  3L2V A;  2ASP A;  3GG4 A;  1IJJ A;  1K8K B;  2KFZ A;  2X6S A;  4KH6 A;  4CES A;  3L0Q A;  1RDA A;  3A5O C;  4YOU A;  5DM7 L;  4DTN A;  2O4G A;  3C94 A;  1NGD A;  2I5J A;  1J54 A;  1IKY A;  1WSE A;  2E6L A;  4JKH A;  3O6W A;  4AHT A;  1ATS A;  4KTZ A;  1Q9X A;  2KHO A;  3NVK A;  2LSN A;  3R1X A;  1S1V A;  3A5M C;  3WEE B;  3EE9 A;  4RCH A;  1GLJ O;  4OPA A;  2IC3 A;  4BR0 A;  3DXK B;  1RBT A;  1HNV A;  1D5A A;  1HYV A;  1UAX A;  4EZ6 A;  3VER A;  3LPU A;  3DLR A;  4J2A A;  3SMP A;  3OYK A;  3SBG A;  2RF2 A;  2OAN A;  4DV1 K;  3WXK A;  3AVH A;  4YY3 K;  2PBD A;  2D1K A;  4NYF A;  4RW7 A;  5EY4 A;  4CGI A;  4CIF A;  5I3U A;  3ZET A;  1A5W A;  4BE1 A;  4BRM A;  2XHB A;  2WUS A;  3DAW A;  1QVF M;  1R0A A;  5BRF A;  4EFH A;  3ENB A;  4M7Y A;  4F9O A;  2ZM6 K;  4IJA A;  4JRP A;  4HCC A;  5BRD A;  2AA4 A;  4AM7 A;  3ZT4 A;  4F4K A;  4UY8 O;  3THX A;  4DQP A;  3OJS A;  1JCF A;  4Z4H A;  3ZSX A;  3UIQ A;  2NZT A;  3D0P A;  3S41 A;  1SKW A;  3VQB A;  3CQX A;  3L4I A;  1RT2 A;  4CJP A;  2VG6 A;  1HUX A;  2CGK A;  3VQQ A;  3C6T A;  2GTD A;  1YVN A;  1MDU B;  4FZZ A;  3O1B A;  4MO5 A;  4DV2 K;  2WTU A;  2PY5 A;  1BIZ A;  4YFU A;  3E66 A;  1KD1 O;  3CME N;  1JCE A;  3E01 A;  1S3X A;  1HJO A;  3P1G A;  2OPS A;  2IDO A;  1HNZ K;  5AQQ A;  3SYZ A;  4JKA A;  5FDL A;  5E84 A;  4IWV A;  3HO1 A;  4TSX A;  1RIL A;  3EY1 A;  4A62 A;  3DRP A;  4EAH D;  3VEY A;  2HHH K;  1LV5 A;  1NOZ A;  1YIJ N;  1VQ9 N;  1QHA A;  4HWI A;  1C0M A;  3WNG A;  4A57 A;  5KPR A;  4E7K A;  2FSK A;  4KB1 A;  3VQ7 A;  1VQO N;  4H03 B;  3OS2 A;  5AZJ B;  4LH5 A;  5EX5 A;  1EXQ A;  4RG8 A;  3TSU A;  2GV9 A;  4N56 A;  2OZM A;  1GLF O;  3DLH A;  3S9H A;  4FW1 A;  2XY6 A;  4FJ8 A;  3ISN C;  2ITM A;  3VQA A;  4AHR A;  2OPQ A;  3O9U A;  4YOT A;  2E2Q A;  4JI1 K;  3F2K A;  4FOI A;  3OJU A;  1B9D A;  2PAV A;  4BC2 A;  1HJR A;  3WXJ A;  3MEC A;  4DR3 K;  3CCQ N;  2ZGY A;  1LAW A;  4FLU A;  4IO9 L;  3VQ4 A;  3CET A;  4BRN A;  5JEN A;  1ZXO A;  3U3G A;  4PWD A;  3VQE A;  5JLF A;  5ELZ A;  1NNE A;  1Z25 A;  4LFB K;  3CCV N;  1E3M A;  1VSJ A;  4IOX A;  2KQ2 A;  4Y1C A;  3QFU A;  1OH5 A;  4QS9 A;  2EWS A;  1FK9 A;  3E9O A;  3FZM A;  4CJR A;  4LF7 K;  3A5N C;  3HP6 A;  3D2E A;  2HB5 A;  4CK1 A;  3NH0 A;  3AVB A;  3OS1 A;  3FE1 A;  4H0V B;  4L8R B;  3MXJ A;  1WSF A;  5AR0 A;  3M8R A;  2P9P A;  5HRO A;  2P9N B;  1RBV A;  4FCY A;  4CEZ A;  2WC9 A;  2BTF A;  3F5T A;  3OHR A;  4FJ9 A;  3ZSY A;  1XWL A;  3TAG A;  3C6H A;  2ZJR L;  3TTF A;  3SJH A;  1LWF A;  3CC7 N;  1C0F A;  5AFU H;  3MWP A;  5BPN A;  1I39 A;  3ID6 A;  3TAN A;  2RE2 A;  4QCL A;  4FJK A;  3I0S A;  1S6P A;  4ICL A;  1T44 A;  1BHL A;  4EZ9 A;  2DPN A;  1FKP A;  2P51 A;  1CXU A;  2GX9 A;  4CF2 A;  4GY2 B;  4RW9 A;  3D2F B;  4JHD A;  1KVA A;  1NKE A;  3QIO A;  4WQ5 A;  4B9L A;  1U04 A;  4KHP K;  1NMN A;  2VWB A;  3K5L A;  1JJ2 M;  3EO3 A;  1UA0 A;  4CHY A;  2BDP A;  3O8M A;  4GV6 A;  4BRE A;  2BAN A;  4CEQ A;  1IH7 A;  3MEG A;  3K2P A;  3LL3 A;  1RT1 A;  2Z1H A;  5I9E B;  4DFM A;  4XH4 A;  3CYG A;  3SUN A;  1ZBF A;  4RWT A;  4BE2 A;  3KK1 A;  4DR7 K;  5AQM A;  1SV5 A;  1NGH A;  1Q18 A;  3EE8 A;  1ATR A;  2G8F A;  4FK0 A;  1BDG A;  2RN2 A;  2FSJ A;  2QKK A;  1S1T A;  3VEN A;  3AAP A;  4JI6 K;  3U8X A;  4F2S A;  5AQL A;  4DR1 K;  1TKX A;  2AP1 A;  3HK2 A;  1JLC A;  5KI6 A;  3TSQ A;  1HX1 A;  4MFB A;  2E8A A;  3HP9 A;  4YHH K;  4FK2 A;  3AVG A;  2CH5 A;  3LM2 A;  3DRS A;  3OTO K;  1BQM A;  4FM1 A;  1NGE A;  4CEO A;  3AVC A;  1YT3 A;  1DGK N;  3HOT A;  1T05 A;  2WOM A;  3ZX0 A;  4DV0 K;  4WQ4 A;  4DFK A;  4FYD A;  1YUW A;  3O80 A;  5TKY A;  3ZET B;  1WB9 A;  3W0L A;  3A5L C;  3LAM A;  3Q7C A;  5F0X A;  3K59 A;  1KSP A;  2ASM A;  4CBW A;  1MU2 A;  1VQP N;  1T7P A;  1XQS C;  5CYM A;  3HYF A;  5GIP A;  1JKH A;  1VQL N;  4M63 C;  4KHY A;  3AA3 A;  4JK8 A;  2QWN A;  3BZK A;  4LSL A;  3THX B;  1CXQ A;  5JIC A;  1ASW A;  3LDS A;  4PQU A;  1A5V A;  3NDK A;  4JI5 K;  2FF3 B;  5M1Q A;  3VMF B;  3CXC M;  1VSD A;  1D8Y A;  4B1X B;  3DXM B;  4DR2 K;  3RTV A;  2KTQ A;  4QS8 A;  4JRQ A;  4M3T A;  4DQR A;  1H1V A;  4BR4 A;  1MA9 B;  1RBU A;  3HBT A;  1HQE A;  3RMC A;  4ISG A;  2X78 A;  3SNN A;  3K57 A;  1IG8 A;  3CJ9 A;  2NRR A;  1SKS A;  3OYC A;  3NF9 A;  3N4P A;  2UUC K;  1RT7 A;  2HVI A;  2QW9 A;  5BPL A;  1U47 A;  4DLE A;  2HF3 A;  3ZYY X;  3T1A A;  3ULD A;  3AVM A;  3FGU A;  2NRW A;  1VSM A;  4IFV A;  3HL8 A;  3ZSZ A;  3SQ2 A;  4BR7 A;  4BRQ A;  3CMA N;  3MCP A;  3K5O A;  3E9P A;  2HHS A;  2RPI A;  3ENO A;  1U4B A;  3KK7 A;  4DTM A;  3SK3 A;  2E2O A;  4ID1 A;  5IWA K;  5HRS A;  1XC9 A;  3QIC A;  4A61 A;  1ZYQ A;  1YXQ A;  4IG0 A;  1WN7 A;  4KTW A;  3L2Q A;  3L8B A;  4K8Z A;  1NG9 A;  3CIP A;  1C0T A;  1S9G A;  4I6M A;  1UA1 A;  4YDU A;  3CER A;  2DFH A;  3SBT A;  4H5R A;  3LAN A;  3HPO A;  3L2U A;  1S5J A;  3R6M A;  3OYG A;  1W9H A;  3AA4 A;  3K5M A;  3HVR A;  4CIE A;  3HPH A;  4EIA A;  3VOV A;  3VQ6 A;  1TUU A;  3HRG A;  4CJ5 A;  1RBR A;  2Q0U A;  3ULE B;  2ZWH A;  2GUP A;  1ILY A;  3I55 N;  3L4Q A;  4RW8 A;  5EU7 A;  1RBS A;  4E1M A;  3PLA A;  3U9Z A;  2YNG A;  3HPG A;  3RSE B;  3FFK B;  1EKE A;  3THW A;  1NK8 A;  3AO3 A;  4H0Y B;  5HL7 L;  1BUP A;  2OZS A;  4A5B A;  2VWJ A;  4H5V A;  1WUA A;  4AHC A;  2P9P B;  4DQS A;  5BN8 A;  3T19 A;  4DV6 K;  4CD3 A;  2FF6 A;  4BVO A;  3K9J A;  3QBW A;  5AQO A;  4GMJ B;  3TPQ A;  3HOS A;  2H3G X;  2QXF A;  4DV3 K;  1IKW A;  2OA8 A;  1BI4 A;  4FLY A;  2ETJ A;  4J2B A;  4BRF A;  3QML A;  3V9X A;  5AQR A;  4FJL A;  4H0T B;  1TAU A;  2HST A;  1TKD A;  2Q3S A;  4BG8 A;  3WNE A;  4X64 K;  3LP2 A;  2PFU A;  4E7H A;  1XHZ A;  1LAV A;  4JHD B;  1KQS M;  2VQF K;  4ID5 A;  2VGM A;  1YHQ N;  3T3F A;  2GEM A;  4M3R A;  3GE1 A;  2XY8 A;  4DF8 A;  2HBM A;  3WXL A;  3CCS N;  1LW2 A;  3EZW A;  4JI7 K;  3VQC A;  5J2P A;  1IG9 A;  3KD1 E;  1UOC A;  4BRH A;  2A5X A;  4PL7 A;  3KTQ A;  1Z6R A;  1IV0 A;  4DCH A;  4B9U A;  4CGD A;  3F9K A;  4Q5V A;  5FRN A;  3CHW A;  1LWC A;  4DTJ A;  4NCB A;  4B3T K;  2O4I A;  3S5T A;  2IOC A;  5CE3 A;  1RFQ A;  5KRS A;  2G8W A;  1XC3 A;  4BGA A;  1D4X A;  4GKK K;  3QB0 A;  1BL3 A;  3MWT A;  4B1Z A;  1NLV A;  3FZL A;  5FPE A;  5AQU A;  4CJ4 A;  4DU1 A;  2XY7 A;  4C8M A;  5CHI A;  4I9Q A;  4UQG A;  2KKZ A;  3VA0 A;  4O0I A;  3GL1 A;  1N33 K;  2B5J A;  3G25 A;  4IKF A;  3OVN A;  1HNX K;  3FFI A;  4HVJ A;  3EYZ A;  5DMR A;  3MXI A;  3CM5 A;  1NK4 A;  4LY7 A;  4HUE A;  1VSI A;  4JV5 K;  3SAG A;  3OYE A;  4DSL A;  2D0O A;  4E0D A;  2PZS A;  4GW6 A;  3EZ5 A;  4LF6 K;  4EP4 A;  3AAR A;  5GIO A;  2CGJ A;  5E26 A;  4E19 A;  4FVM A;  3OYJ A;  3SUQ A;  4H4O A;  1TVR A;  3CFR A;  3D45 A;  1NJX A;  4BRO A;  3K5N A;  3RMD A;  1TK5 A;  1Y64 A;  3M8S A;  1NGF A;  1KAZ A;  4CI6 A;  4CK3 A;  3PY8 A;  4PKH A;  2O8D A;  2XO7 A;  4ISF A;  4FXD A;  4CE9 A;  3TWH A;  4WCE L;  4PKG A;  4OVL A;  4CZG A;  2BH1 A;  4OLB A;  3U6F A;  4OKJ A;  4JD2 A;  1ITG A;  1EO1 A;  1NK9 A;  3T1H K;  3IS9 A;  4Z4E A;  1RDW X;  2WBN A;  3V1R A;  3DOK A;  2BUP A;  4BDP A;  4FWO A;  3MMV A;  5EOY A;  5FRM A;  1I3A A;  4M45 A;  1WSJ A;  1BGX T;  3V9U A;  3OYF A;  4DU4 A;  3T1Y K;  4B3O A;  5JLH A;  5HLF A;  4KH4 A;  4DQ8 A;  2YNH A;  3QLH A;  1CZA N;  4BWM A;  1JL1 A;  4B9Q A;  3CF5 L;  1J5O A;  3K9K A;  1N8R O;  1U2V A;  3G71 N;  3KZB A;  2UYT A;  2F7T A;  3LDQ A;  1OH7 A;  1YVU A;  1EX4 A;  5M1P A;  5DM6 L;  3CCU N;  1C0U A;  1YF5 L;  3LP3 A;  4BRD A;  3U9D A;  2KFN A;  1NGC A;  2W00 A;  2YHY A;  1BG3 A;  4FPB A;  1QS4 A;  4YOR A;  2BE2 A;  2IVN A;  2YHW A;  1N32 K;  4BE0 A;  1NWK A;  4E72 A;  1NGI A;  3NF7 A;  4Z4G A;  4XH5 A;  5BRE A;  4KHU A;  2QEX N;  1QE1 A;  3RWU A;  4Z94 A;  3V6D A;  4NLB A;  4OGE A;  3UKU A;  4QOZ B;  1W7A A;  3NGI A;  4FLX A;  3QO9 A;  2G8H A;  2QWQ A;  2E4L A;  3KK2 A;  5CR4 A;  3QES A;  1HRH A;  4W5T A;  4H8K A;  4X62 K;  1DT9 A;  2QM1 A;  1G99 A;  3MN7 A;  2YCH A;  3VEO A;  2F96 A;  4ZTF A;  4IOC L;  4CCH A;  3RRH A;  1T03 A;  1SQK A;  3HM9 A;  1QQM A;  3JYT A;  4FJ5 A;  2I7N A;  2FLO A;  1BA1 A;  3NF6 A;  3C65 A;  4MLE A;  3NH2 A;  3OBY A;  4E1N A;  3VTI A;  1U45 A;  4FJN A;  3BEX A;  1RTJ A;  4DQI A;  5FLX O;  1JXE A;  3O3G A;  3IDH A;  1NJY A;  3SQ0 A;  5AQW A;  3L2W A;  1HKG A;  1VQM N;  2ZE2 A;  3BZC A;  2FBY A;  5AFU A;  1UWB A;  3S3O A;  1NJZ A;  1XNR K;  4BG9 A;  2BGG A;  4CF8 A;  2DFE A;  1ATN A;  2IAJ A;  3NMU A;  2IGI A;  3KKS A;  3KLH A;  1TKT A;  1RT6 A;  1WBD A;  3DRR A;  1SZ2 A;  1O13 A;  4N76 A;  4PA1 A;  5AQG A;  4BVP A;  3ZEU B;  1GLE G;  4NYN A;  4E89 A;  1ZBH A;  4JI4 K;  3H6E A;  2YJF A;  2P9U A;  1OH6 A;  2HNZ A;  3H46 O;  3AO5 A;  4IDH A;  2Z1G A;  4ILH A;  4FJI A;  3NFA A;  1KCF A;  3VGL A;  3RMB A;  3C6A A;  1BWF O;  1T6D A;  2A6A A;  4NLC A;  5BN9 A;  3CCE N;  4DSF A;  3CI5 A;  1W0H A;  3VQP A;  4X65 K;  3O08 A;  5LY3 A;  5C0Y A;  3R9P A;  4CED A;  5AQP A;  4A2B A;  1S6Q A;  3C7N A;  4CHO A;  5CYQ A;  4YOY A;  1KC8 O;  3E1Y A;  2NRZ A;  1ZC6 A;  3WUH A;  1QQO A;  2JLE A;  1N5Y A;  4DKW A;  4FWQ A;  3MCA B;  1KLM A;  5KPZ A;  3AVI A;  3W3D A;  4CJT A;  3ATV A;  4CVN E;  1Z26 A;  3D7E O;  3A8Y A;  3O9T A;  4B1U B;  3EKU A;  1XUP O;  1Q7Y O;  1NKC A;  2F8T A;  4OPJ A;  3HXM A;  5BRH A;  1GLA G;  4FWP A;  3KLF A;  1B9F A;  3CJA A;  3N4Q A;  3VF2 A;  2O8C A;  3FR0 A;  2OTJ N;  4IZ9 A;  4B1W B;  4BGB A;  4BEC A;  4BR5 A;  5HRR A;  3TSP A;  1SL2 A;  3QEI A;  4DG1 A;  3DLL L;  4B9S A;  3KVG A;  2YHB A;  4FLW A;  4JI8 K;  3QBX A;  1NGG A;  5KGX A;  3I33 A;  4MO4 A;  2B4J A;  2O8D B;  3ZSO A;  3OYN A;  1QHT A;  4DLG A;  1OKJ A;  5BR8 K;  4HCB A;  3PIP L;  2Z1J A;  3O9Q A;  1X9M A;  2YI1 A;  1U48 A;  4GV9 A;  3VPZ A;  3F73 A;  1RDU A;  1KXP A;  1RDB A;  2VGN A;  4E3S A;  1JL2 A;  4JD2 B;  4CJ3 A;  3OYB A;  4DWI A;  4CJU A;  1F21 A;  4JKD A;  4KB0 A;  1KTQ A;  4JYA K;  4C8N A;  4CF1 A;  2QWM A;  3CD6 N;  3MX2 A;  3RR8 A;  1S1X A;  4FWK A;  4JI0 K;  4CD1 A;  2O8F A;  1S1U A;  3KHY A;  3LWL A;  3VA3 A;  4DR6 K;  3LDL A;  2F9T A;  1QVG M;  3KK3 A;  2FSN A;  5A2Q O;  2E5L K;  2NUB A;  2YV0 X;  3C0B A;  5FPD A;  1IKV A;  2D0B A;  4JNE A;  4XEI A;  1TK0 A;  3P4I A;  1U2V B;  2E88 A;  3ZCM A;  1VAZ A;  4C1N I;  5HRN A;  4CER A;  3O4N A;  1X9S A;  2P9L A;  4KO0 A;  1IBL K;  3AV9 A;  3SMS A;  3LPT A;  4DQQ A;  2CGL A;  5KGW A;  3ZSQ A;  2V52 B;  2YHA A;  3VEW A;  1XI1 A;  1IBM K;  3OYH A;  1R59 O;  2ASO A;  5LJV A;  4YOX A;  1BOT O;  4N47 A;  4DSJ A;  4DR5 K;  4J2E A;  5C25 A;  3HI0 A;  4O5B A;  4CEB A;  3VF6 A;  4MDB A;  2OCE A;  4OJR A;  4N5S A;  1ZBI A;  4AH9 A;  2A40 A;  2VG5 A;  4FWR A;  3AY9 A;  1CLQ A;  3QIN A;  3AA2 A;  4JAX A;  2VCP A;  4DV7 K;  4KTQ A;  4CJQ A;  2JWK A;  1EET A;  4BWJ A;  2NRV A;  2DTU A;  1TAQ A;  1QZ5 A;  3UKU B;  3B6P A;  4FJX A;  2X6N A;  3UKR A;  4OO1 J;  3I0R A;  2E2N A;  4GV3 A;  3BDP A;  4LF8 K;  4BY9 C;  4O55 A;  4CJF A;  5AQI A;  2ZJQ L;  4ILJ A;  1TK8 A;  3DWL A;  1JXB A;  4FZY A;  1EWQ A;  1K6Y A;  1TKZ A;  3HZ6 A;  3O9R A;  4R5P A;  3H45 C;  2HMI A;  4LD0 A;  1V4S A;  1JLE A;  4CW7 B;  1FXX A;  2J4R A;  1NM1 A;  3O1W A;  4DF4 A;  2VWK A;  2ZQB A;  3QER A;  2V7Z A;  1RDC A;  3LAK A;  5EXW A;  2AJQ A;  3OYA A;  5KRT A;  1V4T A;  4B8A B;  1T8E A;  2QK9 A;  3AGR A;  3HVT A;  4CEC A;  3CG7 A;  3H3O B;  5M1N A;  4Z4C A;  4W5R A;  3TAQ A;  3OA9 A;  4GVE A;  3LZJ A;  2UU9 K;  3AO1 A;  1QZ6 A;  2PYJ A;  1D9F A;  3ZX2 A;  4IEI A;  4A2A A;  1GOB A;  4FZX C;  2E6M A;  4FM0 A;  4BR2 A;  1NK5 A;  1X9W A;  1GLB G;  3PSI A;  2HW3 A;  1LWE A;  2NRX A;  1NBW A;  1OH8 A;  4C8O A;  5LL6 Z;  3G4S N;  3EL2 A;  5CZ2 A;  3ATU A;  4FJ7 A;  3VEZ A;  4W5N A;  4B1V A;  4LFC K;  3LDN A;  3VGM A;  3ENH A;  3J81 O;  3SPY A;  3MK6 A;  3BY5 A;  4I2Q A;  2VQE K;  5GIN A;  2UXD K;  5I42 A;  1KAY A;  5FPM A;  4C8L A;  3I56 N;  3CC4 N;  2KW4 A;  4ELV A;  4J2D A;  1Y97 A;  5CZ1 A;  4PUO A;  1YTU A;  4BDY A;  4ZHR A;  2IVP A;  4CBU A;  4HUG A;  4CF0 A;  2HBJ A;  5GAD P;  1CZ9 A;  5AQY A;  3G6E N;  1KLN A;  3P5J A;  3V4I A;  3H1Q A;  2FBT A;  2ZF5 O;  1YI2 N;  4B9T A;  3CC2 N;  2W42 A;  1KRP A;  5AQK A;  3HJF A;  1RT5 A;  2OTL N;  5BR9 A;  1U49 A;  4GKJ K;  2A3Z A;  2JGU A;  3CFP A;  1W2B M;  3D2E B;  3L6Q A;  4WFB L;  3IKM A;  4A59 A;  2HMP A;  3O9S A;  3TTC A;  4FJG A;  3DYA A;  1JLA A;  1VSF A;  4HTL A;  4JLH A;  1C1A A;  4BRP A;  3SAF A;  4DHY A;  4ELT A;  5LJW A;  1P90 A;  3M6G A;  3NGY A;  3LP0 A;  4AHU A;  4H0O A;  4DFP A;  3CM6 A;  5AZI A;  3WXM B;  3OBW A;  1VQ4 N;  3V9W A;  2G8K A;  5HRP A;  5ADX H;  5AJ3 K;  4CZJ A;  3VTH A;  3KLE A;  3FZF A;  3K0S A;  1W97 L;  1HPM A;  4FWM A;  4M41 A;  4IXC A;  4CZE A;  3SJJ A;  4K8X A;  1LCU A;  5K14 A;  2HBL A;  3AA5 X;  5GAG P;  4KHQ A;  4IFY A;  2O8E A;  3NAE A;  5FRO A;  3HST B;  3TAE A;  3QEX A;  3O3H A;  4O4G A;  1VSH A;  2E20 A;  4CZM A;  4CGG A;  3MED A;  3DI6 A;  2ZD1 A;  3IMX A;  5AZJ A;  3RMA A;  2QA4 N;  1SL0 A;  3NHG A;  3BF1 A;  3DOL A;  3AO4 A;  3OYD A;  4BR9 A;  4B9N A;  3MX5 A;  4LF9 K;  3P83 D;  3NCI A;  1SL1 A;  4FM2 A;  4CGJ A;  4XIU A;  4B3M K;  1GLL O;  4M3U A;  3NBP A;  3TAF A;  3MN9 A;  1RTI A;  2KZM A;  4NB4 A;  3VQ8 A;  3WT0 A;  3TAM A;  4CGF A;  1BIU A;  5B8H A;  3HT3 A;  5C42 A;  3OYL A;  4YOW A;  1QQN A;  4FJJ A;  4C1N K;  3TAB A;  4QS7 A;  1KVB A;  4FJM A;  3LAL A;  4KRF A;  2P9L B;  3CJC A;  4EP5 A;  1NGB A;  4BRL A;  3LDO A;  3BP8 A;  2IVO A;  1GLD G;  4CIG A;  5AQJ A;  4JS5 A;  4IBN A;  4O0J A;  4QAG A;  5KPT A;  3SI6 A;  2P9N A;  1P8Z A;  3CCL N;  1O1W A;  1N36 K;  4CGH A;  4IG3 A;  5E41 A;  4U7B A;  3ZT1 A;  4DTX A;  3TR8 A;  4DR4 K;  3O5B A;  3PX0 A;  1T3V A;  4F8R A;  2HOE A;  1TL3 A;  2DFF A;  4DUY K;  2A42 A;  3H3N O;  2B6A A;  4X66 K;  1VQ5 N;  3L2R A;  4CZI A;  4DV4 K;  3WNF A;  1GLC G;  1Q81 O;  4WQ5 C;  4CHZ A;  1VHX A;  2E2P A;  1D9D A;  1REV A;  4KI6 A;  2Y1J A;  3L3V A;  2G8I A;  3SPZ A;  3KKR A;  4O44 A;  4CEA A;  3A2F A;  5M1K A;  2KZZ A;  3LWM A;  2D5R A;  4CFA A;  5IT9 O;  3A0I X;  1Q8I A;  5CY4 A;  2YJE A;  3AVL A;  5KTQ A;  1M90 O;  4CEF A;  1X3N A;  1WAJ A;  1KVC A;  5T7B A;  4DUZ K;  4W5O A;  3THY A;  5AQF A;  3KWI A;  5J2N A;  4JKE A;  4B3R K;  1CZB A;  2QI2 A;  3UE5 A;  1B92 A;  2QWP A;  1WSH A;  1NMD A;  3TTD A;  4CFD A;  3SUP A;  2E1Z A;  2I7P A;  4KHW A;  1Z05 A;  4Q0B A;  2XY5 A;  1HKB A;  3QIP A;  4IEE A;  1K8A O;  2W40 A;  4LF5 K;  3JSM A;  3GBT A;  1JCG A;  2IS3 A;  4Z0U A;  1DLO A;  2FBX A;  1QQC A;  2NNW A;  3J7A P;  4KKO A;  3CJ1 A;  2VYP A;  4MDA A;  5C10 A;  4N41 A;  3LP1 A;  2FXU A;  4CHP A;  4JI3 K;  4WQ4 C;  1C1B A;  4M3Z A;  3RVC A;  3GOI A;  2HHU A;  3QFP A;  3HTV A;  1GOA A;  2Q97 A;  4HHT A;  4XJX A;  3S3M A;  1L5U A;  4MLH A;  4I6M B;  2KLA A;  3T7Z A;  4ELU A;  4FLZ A;  4GVM A;  4FL9 A;  3FLC O;  3R3L A;  4KPY A;  4AHV A;  4E7L A;  4XH1 A;  1YAG A;  3LM9 A;  2E1Y A;  5C24 A;  2OPR A; 
#chains in the Genus database with same CATH homology
 3IUC A;  2QW9 A;  4O5F A;  5M1O A;  1VQK N;  3QBX A;  2QWR A;  5BPL A;  1NGG A;  3EKS A;  2HF3 A;  3ZYY X;  4H5N A;  3I33 A;  4MO4 A;  4CZH A;  4BRG A;  1YJ9 N;  1M1K O;  3FGU A;  2NRW A;  1DKG D;  4BR7 A;  4WFN L;  4BRQ A;  1OKJ A;  1X9J A;  3VEV A;  5KQD A;  3FZK A;  3LDP A;  3MCP A;  3O9Q A;  2Q1N A;  3PIP L;  2YI1 A;  3E9P A;  4GV9 A;  4BQL A;  1U6Z A;  4BRI A;  3VPZ A;  3ENO A;  1RDU A;  3KK7 A;  1NJI O;  1KXP A;  2VGN A;  5AQX A;  3IFR A;  3DJC A;  4JD2 B;  3SK3 A;  2E2O A;  4JKD A;  3QIC A;  4A61 A;  5F1X A;  1ESV A;  1YXQ A;  4CBX A;  2QWL A;  2QWM A;  2ZJP L;  3CD6 N;  3MX2 A;  4RTF D;  2HBK A;  4JKF A;  2P9I B;  5C2D A;  3DXM A;  4FWK A;  4CD1 A;  2P9S B;  1YIT N;  5MLC Q;  3KHY A;  1VQ6 N;  3CIP A;  3LDL A;  4I6M A;  2GWJ A;  2F9T A;  3HSC A;  3CMA N;  4YDU A;  1QVG M;  2FSN A;  3CER A;  5KQ8 A;  5AQZ A;  1S22 A;  5AZI B;  5TKW A;  4JEP A;  4K43 A;  4NO7 A;  3UKR B;  3C0B A;  1OVY A;  3EN9 A;  4H5R A;  2IIR A;  3SBT A;  5FPD A;  3QDK A;  3H1V X;  4JNE A;  4XEI A;  3R6M A;  3D2F A;  1DEJ A;  3P4I A;  3J8A A;  4WYB A;  1U2V B;  2E88 A;  3F9M A;  1VAZ A;  4C1N I;  1ZBS A;  4BC5 A;  2P9L A;  4PL8 A;  3B8A X;  4K42 A;  3SMS A;  1YJW N;  4EIA A;  1Q82 O;  4FWL A;  4JKG A;  2CGL A;  1SS6 A;  3VOV A;  5AQS A;  1TUU A;  3HRG A;  2V52 B;  3VEW A;  1J6Z A;  1RGI A;  2YHX A;  2Q0U A;  1R59 O;  2ASO A;  2ZWH A;  2GUP A;  5AQH A;  3ULE B;  5C2F A;  1BOT O;  5LJV A;  4YOX A;  3L4Q A;  3I55 N;  1ILY A;  3PLA A;  2P9K B;  4KBO A;  1TYQ B;  2NLX A;  3U9Z A;  4C23 A;  3HI0 A;  1TUY A;  3VF6 A;  3ID8 A;  4MDB A;  3RSE B;  3FFK B;  4G9Z A;  4H0Y B;  2ASP A;  3GG4 A;  1BUP A;  2A40 A;  4YDU C;  4A5B A;  5HL7 L;  4FWR A;  1WUA A;  2Q2R A;  1IJJ A;  3AY9 A;  4H5V A;  1K8K B;  4JAX A;  2P9P B;  2VCP A;  4KH6 A;  5BN8 A;  2JWK A;  3L0Q A;  2FF6 A;  4CD3 A;  4BVO A;  2NRV A;  3A5O C;  3K9J A;  3QBW A;  5AQO A;  4YOU A;  5DM7 L;  3TPQ A;  1QZ5 A;  1WOQ A;  3HOS A;  3UKU B;  2H3G X;  2JWL A;  3T69 A;  3UKR A;  4OO1 J;  1NGD A;  2E2N A;  3O4W A;  4GV3 A;  5AQN A;  4BC4 A;  4BRF A;  4BY9 C;  3QML A;  4JKH A;  5AQI A;  5AQR A;  3O6W A;  2ZJQ L;  4ILJ A;  1BU6 O;  3DWL A;  1ATS A;  4JKB A;  2KHO A;  3NVK A;  3OW2 M;  3HZ6 A;  3R1X A;  1YJN N;  4H0T B;  2HST A;  2YX6 A;  3O9R A;  4CZL A;  4BG8 A;  4BQZ A;  3A5M C;  3WEE B;  3H45 C;  2PFU A;  3EE9 A;  2WFB A;  4RCH A;  1V4S A;  1GLJ O;  4JHD B;  4OPA A;  4IJN A;  4BR0 A;  1KQS M;  3DXK B;  3HM8 A;  2VGM A;  2J4R A;  1NM1 A;  3FZH A;  3O1W A;  1YHQ N;  3ULE A;  3VER A;  2GEM A;  3CPE A;  2V7Z A;  3GE1 A;  3SMP A;  5EXW A;  3SBG A;  2HBM A;  5AQT A;  2OAN A;  3WXK A;  4A5A A;  3RSE A;  2PBD A;  2D1K A;  5EY4 A;  3WXL A;  3CCS N;  1EQY A;  3EZW A;  1V4T A;  3ZET A;  4FOE A;  4BRH A;  3CPW M;  2A5X A;  4BRM A;  3AGR A;  2WUS A;  3E9L A;  3DAW A;  1QVF M;  1LOT B;  1E4F T;  4PL7 A;  5BRF A;  1Z6R A;  4EFH A;  3H3O B;  5M1N A;  4DCH A;  3ENB A;  4M7Y A;  4F9O A;  4R79 A;  4IJA A;  3OA9 A;  5BPM A;  5BRD A;  4JK7 A;  4GVE A;  2AA4 A;  4AM7 A;  3CHW A;  1QZ6 A;  4AM6 A;  3ZX2 A;  4IEI A;  4A2A A;  3CCJ N;  5CE3 A;  4UY8 O;  5GAH P;  1RFQ A;  1JCF A;  1XC3 A;  4BGA A;  1D4X A;  4BR2 A;  3QB0 A;  1GLB G;  3MWT A;  4B1Z A;  1NLV A;  3FZL A;  5FPE A;  2NZT A;  5AQU A;  2NRX A;  3S41 A;  5CHI A;  1NBW A;  4ILG B;  4BRK A;  3CQX A;  2QWO A;  3L4I A;  2KKZ A;  3EL2 A;  3G4S N;  3ATU A;  1HUX A;  1MWK A;  2CGK A;  3GL1 A;  3VEZ A;  5H1S Q;  4B1V A;  2GTD A;  3CCR N;  1YVN A;  3LDN A;  3VGM A;  3G25 A;  3ENH A;  1MDU B;  1SAZ A;  3O1B A;  4MO5 A;  4O8K A;  3MDQ A;  3P39 A;  4JKC A;  3UB5 A;  3MK6 A;  5GAE P;  3E66 A;  4M7X A;  1X3M A;  3M3Z A;  1KD1 O;  3SAG A;  5GIN A;  2V51 B;  1JCE A;  3CME N;  1KAY A;  1S3X A;  2D0O A;  4U67 L;  5FPM A;  3JS6 A;  4EHU A;  3I56 N;  1HJO A;  3AAR A;  5JVH L;  5GIO A;  2CGJ A;  3CC4 N;  5E26 A;  1KAX A;  2W41 A;  3JXU A;  4PKI A;  2IVP A;  4CBU A;  5AQQ A;  2C1I A;  4BEB A;  3MN5 A;  4BRO A;  2HBJ A;  5GAD P;  4JKA A;  4K41 A;  3VGK A;  5E84 A;  4J8F A;  5AQY A;  3G6E N;  1Y64 A;  1NGF A;  1KAZ A;  4CI6 A;  4IWV A;  4PKH A;  3WQU A;  4DB3 A;  4YOV A;  3H1Q A;  4ISF A;  2ZF5 O;  4A62 A;  1VQ7 N;  1YI2 N;  4EAH D;  3VEY A;  1MWM A;  3CC2 N;  4WCE L;  1YIJ N;  1VQ9 N;  4PKG A;  5AQK A;  1QHA A;  2OTL N;  5BR9 A;  4HWI A;  2BH1 A;  4CZG A;  4A57 A;  5KPR A;  2A3Z A;  4JD2 A;  1W2B M;  3D2E B;  3L6Q A;  4WFB L;  2FSK A;  2NRH A;  3IKM A;  4A59 A;  2HMP A;  3O9S A;  3TTC A;  1EO1 A;  1VQO N;  4H03 B;  4KH5 A;  5AZJ B;  1RDW X;  2WBN A;  2BUP A;  4HTL A;  4BRP A;  2CH6 A;  4FO0 A;  5EX5 A;  3SAF A;  3MMV A;  4DHY A;  2P9I A;  5EOY A;  3TSU A;  5LJW A;  1GLF O;  1P90 A;  2P9S A;  4BRC A;  4GNI A;  3M6G A;  4IO8 A;  3VF4 A;  3WQT A;  4H0O A;  2ITM A;  3NVM A;  5JLH A;  5FPN A;  3O9U A;  4KH4 A;  5AZI A;  4YOT A;  3OBW A;  3VEX A;  2E2Q A;  3WXM B;  3F2K A;  4DQ8 A;  4E1J A;  1VQ4 N;  1CZA N;  4FOI A;  2PAV A;  4BC2 A;  3WXJ A;  1HKC A;  4B9Q A;  3CF5 L;  3CCQ N;  2ZGY A;  3K9K A;  5ADX H;  1N8R O;  4CZJ A;  1U2V A;  2Q36 A;  4FSV A;  3VTH A;  4IO9 L;  2A41 A;  3FZF A;  3G71 N;  3CET A;  4BRN A;  1W97 L;  1HPM A;  1ZXO A;  3KZB A;  2UYT A;  4FWM A;  2F7T A;  3LDQ A;  4IXC A;  5ELZ A;  4CZE A;  5JLF A;  3U4L A;  5M1P A;  5DM6 L;  1LCU A;  2HBL A;  3CCU N;  3CCV N;  1NGJ A;  5GAG P;  4IOX A;  1YF5 L;  3BUZ B;  4BRD A;  3CJB A;  3QFU A;  2ZGZ A;  3U9D A;  1NGC A;  3BF3 A;  4B1Y B;  2W00 A;  3GDQ A;  4QS9 A;  3AGK A;  2YHY A;  1BG3 A;  2V7Y A;  2EWS A;  3E9O A;  3FZM A;  2P9K A;  1TYQ A;  3TU5 A;  4FPB A;  3A5N C;  2HF4 A;  3D2E A;  2E20 A;  4CZM A;  3FE1 A;  4L3Q A;  2IVN A;  2YHW A;  4YOR A;  4H0V B;  3IMX A;  4CJ7 A;  5AZJ A;  4K25 A;  1NWK A;  1K8K A;  1NGI A;  2QA4 N;  4WF9 L;  5AR0 A;  2P9P A;  2P9N B;  3BF1 A;  3D6R A;  2RHK A;  4XH5 A;  4BR9 A;  3MX5 A;  5BRE A;  2WC9 A;  2QEX N;  2BTF A;  5JMV A;  4WFA L;  3F5T A;  4Z94 A;  3OHR A;  5ADX A;  4NLB A;  3UKU A;  5M1F A;  5C12 A;  3C6H A;  2ZJR L;  3SJH A;  2QWQ A;  3TTF A;  4IOA L;  1GLL O;  3I8B A;  1C0F A;  5CR4 A;  3CC7 N;  3MN9 A;  2GWK A;  5AFU H;  3MWP A;  4FWN A;  5BPN A;  3ID6 A;  2RE2 A;  1DT9 A;  3VES A;  2F9W A;  4NB4 A;  2QTD A;  1T44 A;  2QM1 A;  3VET A;  2DPN A;  2QXL A;  3M5R A;  3WT0 A;  5B8H A;  1G99 A;  2GX9 A;  5JVG L;  3MN7 A;  2YCH A;  3CJ7 A;  3VEO A;  1QQN A;  4YOW A;  4IOC L;  3WEE A;  4GY2 B;  4C1N K;  2P9U B;  3D2F B;  4QS7 A;  4H0X B;  3R8E A;  1SQK A;  4JHD A;  1QQM A;  3DXK A;  5HOO A;  2I7N A;  2FLO A;  2P9L B;  1BA1 A;  3CJC A;  4WQ5 A;  4OPH A;  3SLC A;  3C65 A;  4MLE A;  3OBY A;  5F2R A;  3VTI A;  4JKG B;  1NGB A;  3BEX A;  2VWB A;  3LDO A;  4FWS A;  3WXI A;  3EO3 A;  3BP8 A;  4BRL A;  2IVO A;  1GLD G;  1JJ2 M;  2Q31 A;  5AQJ A;  3IDH A;  5AQW A;  3O8M A;  1K9M O;  5KPT A;  4GV6 A;  1HKG A;  1VQM N;  4BRE A;  1S72 N;  2P9N A;  5AQV A;  4H5T A;  1P8Z A;  5AFU A;  3CCL N;  3LL3 A;  5I9E B;  1E4G T;  4XH4 A;  4U7B A;  3C7N B;  4BG9 A;  3O5B A;  1ATN A;  1T3V A;  4RWT A;  3NMU A;  2HOE A;  5AQM A;  3Q7B A;  1SZ2 A;  2A42 A;  4BRA A;  1BA0 A;  1NGH A;  1Q18 A;  3EE8 A;  3H3N O;  4CZK A;  1O13 A;  1VQ5 N;  1ATR A;  4CZI A;  1BDG A;  1GLC G;  2FSJ A;  2Q0R A;  4WQ5 C;  5AQG A;  4BVP A;  1Q81 O;  2E2P A;  1K73 O;  3ZEU B;  3VEN A;  1BO5 O;  3AAP A;  3U8X A;  1GLE G;  5AQL A;  1T6C A;  3H6E A;  2YJF A;  3PIO L;  2P9U A;  3P31 A;  2AP1 A;  3ZX3 A;  4BC3 A;  3H46 O;  1HX1 A;  3TSQ A;  2E8A A;  5M1K A;  1VQ8 N;  4IDH A;  3CQY A;  2CH5 A;  1C0G A;  3LM2 A;  4ILH A;  2C1G A;  3A0I X;  2YJE A;  1NGE A;  1M90 O;  2NRT A;  1X3N A;  2GEL A;  4H0P A;  3VGL A;  3CCM N;  3C6A A;  1BWF O;  1T6D A;  2A6A A;  4NLC A;  5BN9 A;  3CCE N;  4JK9 A;  3CI5 A;  1DGK N;  5AQF A;  3SAH A;  3KWI A;  3HOT A;  4FPA A;  1VQN N;  3ZX0 A;  4JKE A;  3AAQ A;  3O08 A;  4WQ4 A;  5LY3 A;  5C0Y A;  2QI2 A;  3R9P A;  5EVZ A;  1YUW A;  3O80 A;  5TKY A;  3UE5 A;  3ZET B;  3W0L A;  3A5L C;  5AQP A;  4A2B A;  2QWP A;  3Q7C A;  3C7N A;  1NMD A;  3TTD A;  5C15 A;  4YOY A;  5F0X A;  4CZF A;  1KC8 O;  2E1Z A;  2I7P A;  3E1Y A;  4LC9 B;  1Z05 A;  4BE7 B;  2NRZ A;  1HKB A;  2ASM A;  4IEE A;  1ZC6 A;  1K8A O;  3WUH A;  1QQO A;  4CBW A;  2W40 A;  4EHT A;  4DKW A;  4FWQ A;  3GBT A;  1JCG A;  3MCA B;  3ZEU A;  1VQP N;  1XQS C;  5KPZ A;  5GIP A;  3W3D A;  3MN6 A;  4M63 C;  1VQL N;  4JK8 A;  2QWN A;  2NNW A;  3ATV A;  3KWG A;  5JIC A;  3CJ1 A;  2VYP A;  4MDA A;  5C10 A;  4IFE A;  3D7E O;  3A8Y A;  2FXU A;  3O9T A;  4B1U B;  2D0P A;  3EKU A;  1XUP O;  4Y0W A;  1Q7Y O;  4WQ4 C;  4ISE A;  3RVC A;  3GOI A;  2FF3 B;  4JN4 A;  4H5W A;  4O8U A;  4AF1 A;  5M1Q A;  3VMF B;  3CXC M;  5BRH A;  3QFP A;  3HTV A;  1GLA G;  2Q97 A;  4B1X B;  4XJX A;  4FWP A;  3DXM B;  3CJA A;  3J7Z O;  3N4Q A;  3VF2 A;  4QS8 A;  4MLH A;  3FR0 A;  2OTJ N;  4IZ9 A;  4B1W B;  1HLU A;  4I6M B;  2KLA A;  3T7Z A;  4BGB A;  4BEC A;  4BR5 A;  1H1V A;  3M1F A;  3TSP A;  4BR4 A;  1MA9 B;  1Q86 O;  3HBT A;  4FL9 A;  3FLC O;  3R3L A;  4ISG A;  3DLL L;  4PHT X;  1NGA A;  3P38 A;  1IG8 A;  4XH1 A;  3CJ9 A;  2NRR A;  3KVG A;  1YAG A;  3LM9 A;  4FVU A;  2E1Y A;  2D4W A;  4FWO A;  3N4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...