2P9SB

Structure of bovine arp2/3 complex co-crystallized with atp/mg2+
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
197
structure length
197
Chain Sequence
TGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
total genus 54
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9sB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9sB02
2WUSA 4XH1A 5EVZA 3VF4A 2CGLA 3LM9A 5FPDA 4EHTA 2A40A 5E26A 1NGDA 4BRAA 4A2BA 1BOTO 2HOEA 2VYPA 3DXKB 4B1VA 5KPZA 4PL8A 4MO4A 3UKRB 3LDPA 5EOYA 2QWMA 2Q97A 3GL1A 3ID8A 3EL2A 3FGUA 1BU6O 4FWRA 3ZEUB 3D2EA 3DXMA 4CZFA 3GG4A 4CD3A 2P9SB 1E4GT 4CI6A 4IZ9A 3BUZB 1SAZA 3BF1A 1BA0A 2BUPA 1BUPA 5AQQA 3CJBA 1DKGD 3CJCA 3H1VX 3VGLA 2ZF5O 2PAVA 4HWIA 3H46O 5AQTA 3LDQA 4BGAA 5BRHA 3HZ6A 5AFUH 4WQ5A 4JNEA 4BRDA 2AA4A 2D4WA 2QWLA 3H1QA 2J4RA 3VERA 2FF6A 2VCPA 3MN6A 4C23A 3IUCA 2E2QA 5AQMA 1HJOA 3HTVA 4M7XA 4H5RA 4FL9A 1NGIA 2CH5A 5JMVA 5KQ8A 3AAQA 3TPQA 5BPLA 3EKUA 3QB0A 4JHDB 4BR5A 2ZGYA 2KHOA 4IJNA 3QFPA 4O5FA 4CZHA 3ENOA 3U9ZA 5AQRA 2P9PA 4WQ4A 4H0PA 4FO0A 1TUUA 3O5BA 5AQXA 3UKUA 1NGJA 2D1KA 1CZAN 4M7YA 1SZ2A 3ULEA 4JAXA 2P9IB 2E20A 4DCHA 3WXJA 5AQNA 3VGMA 2YI1A 4BRKA 5AQSA 1MWMA 3IDHA 1TYQA 3IFRA 2YHWA 4BQLA 4B1ZA 4IJAA 2CGJA 2A5XA 3QICA 2VWBA 1Z05A 4BR9A 5LY3A 3HBTA 5AQIA 3U4LA 2QXLA 3S41A 3VEYA 2ASOA 5EY4A 3CJ7A 5JLHA 3WEEB 1XC3A 1RFQA 3LL3A 5AQPA 2V7ZA 3LDOA 3GBTA 3C0BA 3U9DA 4FOIA 4CZJA 3I33A 3ZX2A 1HKBA 5EXWA 5AQLA 5FPMA 3RSEB 3EKSA 3O6WA 4H5WA 4PL7A 4FWOA 2FSNA 1OKJA 3MK6A 4K43A 2F9TA 4B1WB 1U2VB 2I7NA 5F1XA 1YUWA 3O4WA 3R8EA 1IJJA 1QQOA 5KPRA 2CGKA 1Q18A 2ITMA 4BRHA 2V7YA 4H0XB 3R9PA 2GUPA 3CQYA 5CE3A 4BREA 3C7NB 5FPNA 5E84A 2Q0RA 3BEXA 2Q2RA 4WYBA 4XH5A 1H1VA 1NGEA 3LDNA 4H5NA 3DWLA 3WXLA 3VEWA 3R6MA 5KQDA 4FWNA 4H03B 1BG3A 1ATSA 2P9KB 2E2PA 2NZTA 4IWVA 4MLEA 5EX5A 4MLHA 2GWJA 2P9NA 4CZGA 4EHUA 3ATUA 2YHXA 3BF3A 2D0OA 2GWKA 5F2RA 3JS6A 3QFUA 4H0YB 3HI0A 4K42A 4PKIA 4CJ7A 3IMXA 1NGHA 4BROA 3DXKA 5BN8A 2EWSA 1C0FA 4JN4A 1LOTB 2P9UB 5AQHA 3UKRA 4I6MA 4CBWA 4BRCA 5ADXH 5I9EB 2P9LA 3O08A 3W3DA 4AM6A 4BC4A 3H45C 3CJ9A 4Z94A 2Q1NA 5AQUA 2DPNA 1U6ZA 2P9SA 4Y0WA 1YAGA 4FWKA 3CI5A 4CBUA 3KVGA 1TUYA 3SMSA 1P8ZA 3A5NC 5AQFA 3UB5A 3DAWA 3VETA 4AM7A 3AARA 4JD2B 5AQGA 2FLOA 4EFHA 2ZGZA 5LJVA 3D2EB 4BC2A 4B1UB 4BR0A 3QBWA 1BWFO 5BPMA 1IG8A 4WQ4C 1HLUA 4FSVA 4YDUA 1XQSC 3SJHA 5AQZA 3FR0A 5AZJB 2UYTA 4LC9B 1QQMA 1G99A 1ZXOA 5BRFA 2Q0UA 5LJWA 3ZX0A 3O8MA 1NGGA 1X9JA 4QS7A 4JHDA 3H3OB 3FZMA 4FPAA 5KPTA 2E88A 2I7PA 1WUAA 1JCGA 3L4IA 2V52B 3SLCA 4ISFA 3B8AX 5TKYA 1NMDA 3D7EO 3WQUA 3CJAA 1V4SA 1NBWA 5AQOA 1X3MA 3GDQA 4PKGA 2E1YA 3HM8A 4NB4A 5AZIA 4B1XB 3D2FA 4KBOA 4BR2A 4BVOA 3A5OC 4BQZA 3FE1A 1HUXA 3A8YA 4M63C 4MO5A 3UKUB 5F0XA 3GE1A 2A42A 3VOVA 3MMVA 1RDWX 2A6AA 3A5MC 4FOEA 4CZEA 3ULEB 5BR9A 5ADXA 3WUHA 2IIRA 2FSJA 4BRPA 2AP1A 2GEMA 4XH4A 3VGKA 1J6ZA 4GNIA 2PBDA 1MWKA 1NLVA 3VEXA 1HX1A 4BRMA 5BREA 1K8KB 4FWQA 4BR7A 3CQXA 3G25A 3ZETB 3AAPA 1NGBA 2BTFA 5AFUA 1QQNA 3SK3A 2A41A 3ATVA 4XEIA 4RWTA 3AY9A 2IVOA 2FXUA 4RTFD 4BG8A 3P4IA 2ASMA 1RGIA 2E2OA 2QM1A 1KAZA 1GLJO 3FZFA 4A62A 2NLXA 4L3QA 4DHYA 3WXKA 3M6GA 5AQYA 3QDKA 3VPZA 4CZIA 3I8BA 3GOIA 1GLAG 4H5TA 3OHRA 3EZWA 3MDQA 1GLFO 1KAXA 2YJEA 3F9MA 4IO8A 4O8KA 1DGKN 5B8HA 3VF2A 2A3ZA 4WQ5C 3KHYA 4HTLA 4RCHA 4CBXA 4BRIA 2GELA 3FZHA 4QS9A 3CETA 4YDUC 1NWKA 2P9NB 2QWRA 1HPMA 4PKHA 2NRHA 4BVPA 1C0GA 3JXUA 3ZEUA 3ZX3A 1QZ6A 4BG9A 4EIAA 4BC3A 2GTDA 2E8AA 4A61A 4EAHD 3QBXA 1KXPA 3DJCA 4H0VB 4J8FA 2FSKA 2FF3B 4NO7A 3WT0A 4I6MB 3DXMB 2P9LB 1GLBG 4ISEA 4JD2A 3O1WA 3M3ZA 3VEVA 4B9QA 3VF6A 2Q36A 2IVPA 3FFKB 3BP8A 5AR0A 4FWLA 4FWSA 4BRQA 5BPNA 2HF4A 1GLLO 1BA1A 1Y64A 3VENA 4BRFA 5AZJA 4IXCA 1MA9B 3J8AA 4FPBA 2V51B 3MN9A 5AQKA 3TU5A 4BRLA 1X3NA 2QW9A 3EN9A 4K41A 5FPEA 2ASPA 3CJ1A 2OANA 1ATNA 2E2NA 3CIPA 1Z6RA 3MN7A 1DEJA 1BO5O 3O80A 3VESA 4CZMA 4H5VA 4B1YB 2HF3A 3M1FA 3HSCA 1GLEG 2YHYA 4H0TB 1R59O 3U8XA 1MDUB 2QWNA 3LDLA 3FLCO 1T6CA 1ZC6A 1YVNA 2P9PB 1JCFA 3SMPA 2P9IA 1T44A 2W41A 5BRDA 4BRNA 1HKGA 2H3GX 1QHAA 3LM2A 5AQVA 2YCHA 2HMPA 1EQYA 1SQKA 4F9OA 2QWQA 1YXQA 1GLDG 3WQTA 1NM1A 5AZIB 3KZBA 3D2FB 3VEOA 4E1JA 3WEEA 1KAYA 4BC5A 4CD1A 4FWMA 4DB3A 1TYQB 3UE5A 1NGFA 3CHWA 4BGBA 5JICA 3RSEA 5AQWA 3L0QA 5ELZA 2W40A 1HKCA 3WXIA 1K8KA 1U2VA 2QWPA 2QWOA 3VEZA 4GY2B 3ZETA 1JCEA 2YJFA 2ZWHA 3L6QA 1V4TA 1ZBSA 4CZLA 2D0PA 4A2AA 3C7NA 4QS8A 1ATRA 3QMLA 4FWPA 3MCPA 2IVNA 1E4FT 3H3NO 1BDGA 4H0OA 5BN9A 1GLCG 3FZKA 2E1ZA 5AQJA 2P9KA 3FZLA 1NGAA 3W0LA 1XUPO 1T6DA 2CH6A 4K25A 4DQ8A 1QZ5A 3ENHA 4ISGA 4BRGA 1LCUA 1D4XA 3CERA 5JLFA 3H6EA 1S3XA 2F9WA 1ESVA 1S22A 3EO3A 2Q31A 3O1BA 3MN5A 1NGCA 4CZKA 3A0IX 4BR4A 3A5LC 2P9UA 1WOQA
chains in the Genus database with same CATH superfamily
3SCXA 4CCHA 3VF4A 1ZBIA 4XJXA 3LM9A 5FPDA 4DQIA 1NGDA 4BRAA 4A2BA 1BOTO 1NU0A 4DG1A 3VQQA 4B1VA 2O8FB 4ILHA 4O5BA 3O4NA 4LFAK 1FKPA 3G71N 2YNGA 4FWRA 4FJJA 4IFVA 5JVGL 4CD3A 4J2EA 4IZ9A 2JWLA 5FRMA 3LAKA 1SAZA 3BF1A 1IV0A 4DV4K 2BUPA 5MLCQ 2BH1A 1C6VA 2HNZA 1SS6A 4K0KK 4B08A 3T69A 5HRRA 3KKRA 1OVQA 4H4MA 1YJWN 1HNZK 3PV8A 2XY5A 3DLBA 1KVAA 1L3VA 3OYHA 1BIZA 2AA4A 4DV6K 2J4RA 4IG3A 2FF6A 5GAEP 4U7BA 3CXCM 3DI6A 3ALYA 3I0SA 3HTVA 4Z4HA 4FCYA 4H5RA 3IS9A 4DTRA 4GV3A 5BPLA 1A5VA 3QB0A 4IFYA 2HBJA 3NF9A 2W42A 4AILC 1VRTA 4HUFA 1XWLA 4CZHA 2QXFA 3OYNA 3ENOA 3OYAA 3WNHA 4E72A 1VHXA 2OYQA 4H0PA 2GBZA 4DU1A 1TUUA 1JKHA 3NE6A 1NGJA 1CZBA 4KB1A 1W2BM 3WXJA 3CMAN 2YI1A 2VG7A 3HPGA 2NRXA 2OZSA 3LANA 3CD6N 4CIEA 4DQRA 4B1ZA 3E1YA 4DSEA 2VWBA 4BR9A 5LY3A 2HHVA 2QXLA 5EY4A 5JLHA 1RFQA 2V7ZA 3LDOA 4CHNA 5I42A 2UU9K 3SUQA 4H4OA 4RW9A 3CC4N 2KLAA 4FOIA 4CZJA 1B9DA 1RT3A 3CCLN 1HKBA 4E7JA 3THXA 3O6WA 3L2WA 4V19S 5KRTA 2I7NA 5F1XA 3JAMO 3VQ7A 3PIPL 1VSEA 1QQOA 5KPRA 1IBLK 5M1QA 4WFAL 2OA8A 3AVJA 3ZSVA 1OH5A 4BREA 3BGRA 2WFBA 5CZ1A 4N41A 3O9QA 4E7IA 4JI0K 3MX2A 1XHXA 1WNSA 1ATSA 3L3VA 2HHWA 2E2PA 4MLHA 1HNIA 2P9NA 4CZGA 4EHUA 5JVHL 2G8HA 2ZM6K 3QFUA 3TAQA 2XY8A 4CESA 4EZ9A 3K58A 2ITGA 4JI2K 4BROA 3HYFA 3KWGA 1QS4A 5HBMA 2O8FA 5AQHA 4BWMA 4CBWA 5D3GA 5CZ2A 4BRCA 4JS4A 3MX5A 3EY1A 1XC9A 3CJ9A 3AO1A 4A59A 2NRWA 3LP3A 1TKZA 3OYCA 4DTMA 4Y0WA 3OS1A 1J9AA 1YAGA 4M3ZA 4W5OA 3CYGA 3CI5A 4X62K 3VETA 1WBBA 4JD2B 2DFHA 4EFHA 2C1GA 3D2EB 2Z1IA 4BC2A 4C1NI 3CMEN 3CC2N 4OGEA 1HLUA 3K9JA 2DFEA 3V9WA 3C6UA 5AZJB 1VQMN 4DV0K 2OPRA 3V1OA 4M45A 2G8WA 1G99A 4WFNL 4N5SA 3KLHA 2PYJA 4CGIA 3E66A 1DTQA 4YFUA 5GADP 1Y97A 1NGGA 3TR8A 2KFZA 4DFJA 5KPTA 1RBRA 3DM2A 4DTSA 3B8AX 5TKYA 4JI5K 1V4SA 1NBWA 3HRGA 3GDQA 1OVYA 3D0PA 4E7HA 4Z0UA 1RDBA 3HM8A 2YV0X 4KREA 5HL7L 2YX6A 1VK0A 4GVMA 3LALA 3S3OA 2UUBK 3T19A 4M63C 1YJ9N 4C1NK 2A42A 3VOVA 1FJGK 2A6AA 4YY3K 1LWCA 2IIRA 1BHLA 4DV2K 4DWIA 1RBUA 4C8KA 3VGKA 3K5OA 1C1BA 3S3MA 1RTHA 3LZJA 5BREA 1NK0A 1ILYA 3CPEA 2NRTA 1QVGM 2OPQA 3F2KA 2ZE2A 1WBDA 1KQSM 3LP1A 3AAPA 1QQNA 4OGCA 2OZMA 3V9ZA 3OYFA 1LAWA 3ATVA 1KLNA 2FBXA 1LWFA 1HYSA 4RW7A 2B4JA 1KAZA 3FZFA 4MQ3A 4HVJA 4DUZK 4Z4FA 3T1YK 4J2DA 3VPZA 1BQNA 1I39A 1VQLN 4CGJA 4LH4A 2ATQA 5CY4A 1GLAG 4H5TA 5C12A 1HJRA 5C25A 3KK1A 3NH2A 2YJEA 3JSMA 3OJUA 4IO8A 1CZ9A 3P1GA 4B3TK 3RMAA 3ZT4A 3FZHA 3S9HA 3TARA 4CJFA 4KI4A 2O8CA 2E6MA 4PKHA 2NRHA 4B9SA 4BVPA 1ZBUA 3C6TA 3ZYYX 2E8AA 1WN7A 3ZSYA 2HSTA 4H0VB 3ZSZA 2VGMA 4N76A 3WT0A 3OYGA 3E9OA 4GKKK 3DXMB 2P9LB 4CK2A 4JD2A 3O1WA 4KAZA 4FZZA 3I56N 1SUQA 4CGHA 4LF7K 3K5MA 3HVRA 4IBNA 1HRHA 4FWLA 4FWSA 3TSPA 4BRQA 5BPNA 4ELTA 5AZJA 4IXCA 4E0DA 2RPIA 2GV9A 4BE1A 1YF5L 1RDUA 4F2SA 2Z1GA 2XRIA 3CIPA 1ATNA 2E2NA 1N5YA 1Z6RA 3VESA 1BO5O 4KTWA 3M1FA 5FROA 4BECA 4DQQA 1R59O 4E89A 4NCBA 1MDUB 3QNNA 4F4KA 1S6PA 2QWNA 2Q3SA 3TWHA 2G8UA 3LPTA 3DLEA 4DMNA 5C15A 3TTDA 1JCFA 1KD1O 4YOVA 4MDAA 4BE7B 3IG1A 4DFKA 3CG7A 1NKBA 1IH7A 1F21A 2YCHA 2HMPA 4CFAA 4RW8A 3THYA 5AZIB 3KZBA 3D2FB 4BC5A 3OYIA 4FJ7A 4CJRA 1TYQB 4C8OA 1D9DA 3RR8A 3RSEA 1WSFA 3HPOA 1C0TA 1X1PA 5ELZA 2W40A 3MXMA 1U2VA 2QWOA 3VEZA 4GY2B 2JGUA 4H8KA 1EETA 3D45A 1JCEA 1TKTA 2YJFA 2ZWHA 5BR8K 1QSSA 2D0PA 1HYVA 3T1AA 1ATRA 2IOCA 4FWPA 3MCPA 3AVHA 5GAGP 1BDGA 3BZCA 5BN9A 4IEIA 4FLYA 3OS2A 3OYJA 3FZLA 4LD0A 2CH6A 4K25A 4CJPA 5M1NA 1MU2A 2EX3A 3D6RA 3H6EA 3B6PA 2VQEK 4YNQA 1ESVA 4ICLA 3O3HA 1HPZA 2P9UA 4W5NA 4KI6A 2CGLA 4JI1K 3OBWA 5GAHP 1S72N 1DLOA 2XHBA 1IKYA 2OCEA 4C8LA 4PL8A 4CK1A 3LDPA 5EOYA 5T7BA 3ID8A 1GOCA 3LAMA 4FYDA 3FGUA 3ZEUB 4FLXA 3DXMA 5LMNK 2Z1JA 3HO1A 4W5TA 2HBKA 3AA5X 5CR4A 4ILJA 3BUZB 3VQ9A 2W6KA 4CGGA 5AQQA 4FJNA 3CJCA 2PAVA 4HWIA 3H46O 1NK6A 5BRHA 3HZ6A 4WQ5A 3KKSA 4DV5K 2UXDK 4KHYA 3MWPA 5EU7A 4BRDA 2E5LK 4F2RA 3MN6A 1LWEA 3IUCA 3U3YA 3HP6A 1U04A 5AQMA 1HJOA 3RMBA 4M7XA 3ASMA 4FL9A 1NGIA 4F3OA 4JHDB 3DRRA 3J7YP 4BR5A 3M8QA 3QFPA 4K8ZA 1JJ2M 3SAHA 3AA4A 3IAYA 3ITHA 3PX4A 4KHUA 4WQ4A 3EE8A 4FO0A 4NXNK 3L2UA 3O5BA 3R3LA 3SV3A 4C8MA 4DF4A 1CZAN 2E20A 4CF2A 4DCHA 5M1KA 1BL3A 3VQAA 5AQNA 3PY8A 4BRKA 5AQSA 2F7TA 1TYQA 4CJTA 3QETA 4BQLA 3M8SA 1ASWA 3RMDA 4OLBA 1WAJA 4CJVA 4J2AA 1R0AA 3HBTA 4FJGA 3S41A 4LSNA 1VQ4N 1XC3A 5AQPA 3GBTA 4CJ5A 1A5WA 1TAUA 2R7YA 3KD1E 3I33A 4FJHA 1JXEA 1KFDA 1S5JA 1JL1A 4M3TA 2FSNA 1OKJA 3MK6A 4B1WB 1VSIA 3N4QA 3DLGA 1NJZA 3O4WA 3PO5A 1ASUA 2CGKA 1Q18A 3RWUA 2UXBK 1WLJA 1T3VA 5FRNA 3CQYA 4FK4A 4DR5K 3DLHA 5E84A 2Q0RA 2VG6A 1RT5A 2NRVA 2NRZA 4R79A 4XH5A 4CFDA 1NGEA 2X78A 4Q5VA 3JYTA 4FM0A 3WXLA 5KQDA 1IG9A 2P9KB 3F5TA 1TK0A 1JLGA 2VQFK 4IWVA 3SUNA 2UXCK 4NXMK 2QTDA 4CHZA 3NAEA 1GOBA 2VGNA 1J5EK 1NMNA 3BF3A 2GWKA 3VQCA 4FLTA 3HI0A 1IBMK 3C6AA 4M3UA 4YOXA 3IMXA 1NGHA 5HRPA 3P5JA 5BN8A 2OPPA 2EWSA 2YKMA 2NNWA 1LOTB 4YHHK 1VQ6N 4O4GA 1XHZA 3O08A 3W3DA 2FBVA 4AM6A 4DV3K 3H45C 4Z94A 2Q1NA 5AQUA 4N56A 4U67L 1U6ZA 3PIOL 3C95A 5I3UA 4O0IA 4YOWA 3SJJA 1RT2A 2ZGZA 4YOUA 5LJVA 4BR0A 3M5RA 5BPMA 1RCHA 3OYBA 3CCSN 4FSVA 3SJHA 5AQZA 1IKXA 1FXXA 4I7FA 4X65K 2UYTA 1N6QA 1XMOK 4LF8K 3CCRN 4DFPA 4RG8A 2DTUA 4CJUA 1OH8A 3RMCA 2ZQBA 1OH7A 4JHDA 2DFFA 3H3OB 3SAFA 1NK8A 4FPAA 4B3RK 1VSDA 1RBSA 1NKEA 5M1OA 3S5TA 4CE9A 1X9SA 4YOYA 2O8BA 1RBTA 1JCGA 3L4IA 2P5GA 1BIUA 1ITGA 4DTOA 4ISFA 1UA1A 1L3SA 3K5LA 1ZBLA 2F8TA 4KKOA 3FFIA 4IOAL 4B9MA 1HNXK 1JLQA 3VTIA 4PKGA 4B1XB 3SPZA 3P83D 4KBOA 4JEPA 4BVOA 4KFBA 4LFCK 3FE1A 2D0CA 2VG5A 3UKUB 3CM6A 3RTVA 1YITN 3MMVA 3OYDA 4FOEA 1I3AA 5C24A 3ULEB 4E1NA 1WSHA 2FSJA 4BRPA 1CXQA 3V81A 2AP1A 1RT7A 1ZBFA 3HOTA 3ZLJA 5JENA 2GEMA 4CGDA 4HUEA 3T7ZA 2PBDA 1MWKA 1VQON 1SV5A 4CK3A 1HX1A 4CEDA 3O4QA 3AV9A 1ZYQA 4Z4GA 3CQXA 3ZETB 4ZTFA 1NGBA 5M1PA 4EZ6A 1RNHA 4CEOA 4YOTA 4DR3K 1Q82O 3OVNA 1JL2A 4XEIA 4EP5A 4FJ5A 1CLQA 4LF6K 2FXUA 3VQ6A 3NGYA 4NCAA 1RGIA 4OPAA 4A62A 1D8YA 3OYLA 4F3TA 4CEFA 4DHYA 4FZXC 3M6GA 3V6DA 5KI6A 4CZIA 3HP9A 3I8BA 1JLAA 1WSGA 5AJ3K 3VA0A 3CC7N 4JS5A 3ISNC 1DGKN 1YTAA 1SKSA 3I55N 1SL0A 3KHYA 4RCHA 4YORA 4BRIA 4CJ4A 3L4QA 3CETA 1NK4A 2QWRA 1S1WA 1YVUA 4NYNA 1EWQA 3HT3A 3ZX3A 4JI6K 4BG9A 1IKWA 4EIAA 2HHXA 4BC3A 2GTDA 3TANA 1SKWA 1ZBHA 3DJCA 2YNFA 5DMRA 2FSKA 1Z26A 2PZSA 4I6MB 1EXQA 1RDCA 4HCCA 3OS0A 2QA4N 3SQ2A 4B9QA 2HHTA 3VF6A 5JS1A 3PSIA 4CJLA 1N8RO 2IVPA 3BP8A 4PWDA 1Q8IA 2HF4A 4AF1A 1HQEA 4BRFA 2KTQA 3J8AA 3Q7BA 4DR4K 3T1HK 1X3NA 3K9KA 4NLBA 4CJEA 3EN9A 3WXMB 2D0BA 1T8EA 3J7ZO 3V4IA 2PYLA 1EX4A 3AO2A 5FPEA 3PSFA 2UUAK 4PQUA 3SAGA 4O55A 4CFBA 1FK9A 4CEBA 1Z25A 2Y1JA 4JKAA 3VA3A 4F8RA 4HCBA 4H5VA 3OW2M 3AVLA 4JKGB 4BE0A 2RKIA 1GLEG 1REVA 1U49A 3K5NA 2JWKA 5A2QO 2HB5A 3U8XA 3TAMA 2RF2A 3EYZA 1ZC6A 4BDZA 1RT4A 2P9PB 3V9UA 2W41A 5BRDA 1HKGA 3AVMA 3DRSA 3VQ5A 3LM2A 1YIJN 1EQYA 1C0MA 2QWQA 4OJRA 1GLDG 1XNRK 3MCAB 2O8EB 4GKJK 3VEOA 4L8RB 3ZT3A 3AGRA 1VAZA 1NOYA 2IS3A 4HUGA 4JKFA 5JICA 1D9FA 1W9HA 3WXIA 3SPYA 5IWAK 3OYMA 4FLWA 3MECA 3ZETA 5GIOA 4IDKA 3L6QA 3TSQA 1HNWK 4DTJA 5LMUK 1E4FT 4H0OA 1GLCG 3SQ1A 1S1VA 1JLEA 3FZKA 3I8DA 2FBYA 3WNEA 1NGAA 4GV6A 5CYQA 4FLZA 1N36K 4FM1A 1QZ5A 3TAFA 4ISGA 1D4XA 1O1WA 3CCVN 4NYFA 4AQYK 3U6FA 1JLBA 2RN2A 1FW6A 1BISA 3QEWA 1S1UA 3EO3A 2Q31A 3O1BA 3MN5A 1NGCA 3A0IX 4BR4A 4DTNA 4PHTX 3TTCA 2WUSA 4XH1A 5EVZA 2QI2A 3QNOA 4G9ZA 2HHQA 2A40A 5E26A 3ZSXA 4DTPA 3PX0A 5IT9O 2BGGA 2HOEA 3LP2A 3DXKB 4X66K 1G15A 4ID5A 2B5JA 4FM2A 2A1SA 2Q97A 3E9LA 4I9QA 2KFNA 1BU6O 4DU3A 3D2EA 3G10A 4KH5A 3ID6A 3G4SN 3THWB 4DQSA 4FJLA 4CI6A 2HVHA 4W5QA 3BY5A 3KK3A 3UIQA 3SZ2A 2KZZA 5HP1A 4JYAK 3LWMA 1WAFA 1J53A 2KW4A 3H1VX 1QSLA 5AQTA 3KK2A 4NCGA 1L5UA 4BGAA 1N34K 5AFUH 1T7PA 3LZIA 4DF8A 4KRFA 2D4WA 3H1QA 1IKVA 4HHTA 4X64K 4DKWA 2IAJA 4B9LA 2O8DB 2A1RA 1U48A 2E2QA 1LW0A 4IG0A 3NMUA 2CH5A 5JMVA 3AAQA 3TPQA 4CF1A 4JK9A 5J2NA 2ZGYA 2KHOA 2HNYA 4O5FA 3OA9A 3U9ZA 3O3FA 5AQRA 2P9PA 1NK5A 1VQKN 2YNHA 2X6NA 3KLEA 2XY7A 3LWLA 4DUYK 4M7YA 1SZ2A 4JAXA 2P9IB 3ZT2A 4DS5A 3PO4A 3VGMA 4FXDA 2NUBA 4B3SK 1MWMA 3H08A 2KQ2A 3IDHA 3TTFA 2YNIA 3IFRA 4IJAA 4DV7K 3QERA 4KO0A 3QICA 3QLHA 1Z05A 5AQIA 3EEQA 3U4LA 3VEYA 2ASOA 5TKWA 3CJ7A 1TL1A 3WEEB 4LFBK 3HK2A 4GMJB 4CEAA 3U9DA 5CHIA 1VQ8N 2G8KA 1LW2A 5EXWA 3DLRA 3EKSA 4H5WA 4K43A 2F9TA 2YKNA 4NLCA 3SBGA 3HPHA 4JLHA 3QIOA 3O9SA 1IJJA 4BRHA 3T3FA 4H0XB 3R9PA 2GUPA 1S6QA 3C7NB 5FPNA 3VTHA 2Q2RA 4I2PA 1HMVA 3U3GA 3WNFA 3CPWM 4DLGA 1FKOA 3J80O 4KB0A 4JKDA 3WNGA 3LDNA 4H5NA 3DWLA 3VEWA 1XI1A 4FWNA 1C1CA 1L3TA 1BG3A 2NZTA 1VQ7N 2GWJA 1RTIA 4IOXA 1TK8A 4KHNA 2P51A 1N32K 3ATUA 1TL3A 2JLEA 4I2QA 4DV1K 4K42A 4PKIA 4CJ7A 4FLUA 3DXKA 1C0FA 4JN4A 4CFCA 1TVRA 4A57A 1K9MO 1LV5A 1VSKA 2GUIA 3CCMN 5ADXH 3NH1A 4JV5K 3VMFB 4KHPK 2P9LA 3NHGA 2OTLN 2IGIA 2Y1IA 3THWA 4FJ9A 3NGZA 4CF8A 3PUFA 4CBUA 3KVGA 1TUYA 3SMSA 1P8ZA 3A5NC 3DAWA 4AM7A 2PFUA 5AQGA 3IRXA 2XY6A 2FC0A 3LDSA 4B1UB 3QBWA 1EWRA 1BWFO 3HM9A 1T05A 1IG8A 4WQ4C 3ZSRA 3RVCA 4YDUA 4R5PA 3OTOK 4ZHRA 4QOZB 4KPYA 1KLMA 3FR0A 4CECA 4JKCA 4LC9B 3MEGA 3C94A 2Q0UA 4IO9L 4CF9A 3TI0A 5LJWA 3ZX0A 3O8MA 4WF9L 3ENBA 4CEZA 1X9JA 3S3NA 4OPJA 3FZMA 3ULDA 2I7PA 1WUAA 3OYEA 2QK9A 4JKEA 1HR0K 2BDPA 5C10A 4DTUA 4XIUA 4AHSA 4QAGA 4B9NA 3D7EO 1KRPA 1X9WA 4WFBL 5AQOA 1X3MA 4RW4A 3OY9A 5LL6Z 4AHUA 2E1YA 3HXMA 5AZIA 3D2FA 1KVCA 4BR2A 3AVKA 3A5OC 4BQZA 3A8YA 5GINA 2WONA 5F0XA 4QCLA 1VSJA 4BACA 3A5MC 4CZEA 5BR9A 5ADXA 3WUHA 1RBVA 4B9VA 3MEDA 3KLFA 3AA2A 1NNEA 1TK5A 4XH4A 1NLVA 4TSXA 4MFBA 3VEXA 4Q0BA 2D0AA 4BRMA 1NK9A 1GOAA 3MEEA 4BR7A 3G25A 3P39A 3L2RA 2BANA 4FVMA 4CHPA 4JK7A 3SBTA 4FJMA 1RT1A 1SKRA 1VRUA 3L3UA 4RWTA 4PA1A 4RTFD 4IFEA 3P4IA 2E2OA 3CF5L 1GLJO 3AVGA 1KFSA 3WXKA 4E7LA 1BCMA 4CIGA 1VQNN 3K59A 3MXJA 3QO9A 4FZYA 4J2BA 2KZMA 4BE2A 3GOIA 4AH9A 5KGWA 3OHRA 4GW6A 2I5JA 4JKHA 4KH4A 4KV8A 5C2FA 3MDQA 1QTMA 1KAXA 4O8KA 4CGFA 3VF2A 2WTUA 1BI4B 3VQEA 4CF0A 2GELA 4QS9A 1NWKA 2P9NB 2ZD1A 1HPMA 1P90A 3CFRA 3NBPA 1C0GA 3JXUA 3ZEUA 4B9TA 4EAHD 4A61A 1C1AA 4I9LA 3QEXA 3QBXA 1RILA 1KXPA 2OPSA 2ZJPL 1JLFA 4J8FA 4Z4IA 3J81O 3AO5A 2F96A 2FF3B 1U47A 3G0ZA 3O9TA 3M3ZA 3VEVA 4E7KA 3FFKB 4CIFA 4JK8A 1BA1A 4JI8K 1VQ9N 4B8CA 4DSFA 1MA9B 4JI3K 4KTQA 3KK7A 3TU5A 4BRLA 5C42A 5KTQA 4OLAA 4DSKA 3CJ1A 2W00A 2HBMA 2OANA 3O80A 3HOSA 4CZMA 1NJIO 4B1YB 3HSCA 4CEQA 1T03A 3NVKA 5J2QA 2ETJA 4O44A 2P5OA 3LDLA 4FK2A 2KKZA 5HLFA 3FLCO 4FJIA 3SQ0A 1JXBA 1YVNA 3SMPA 1T44A 3ZT1A 4FJXA 3ZT0A 4BRNA 2XO7A 3DLKA 2F4VK 2H3GX 5AQVA 1BCOA 1SQKA 1J5OA 1YXQA 3EE9A 2LSNA 1NM1A 2OTJN 4DU4A 1SL2A 4PUOA 3VN5A 4E1JA 4BWJA 4DSJA 1KAYA 4CD1A 4FWMA 3O3GA 3G6EN 3CHWA 4B3OA 3NGIA 1K8AO 3AVIA 3L0QA 1EP4A 3RRGA 1HKCA 1VSLA 1QE1A 4EP4A 3KLGA 3TAPA 3K0SA 1NJWA 1V4TA 1ZBSA 4CZLA 1NG9A 2HHIA 4A2AA 4QS8A 3QEVA 3QMLA 3NDKA 3AVAA 2IVNA 1Q9YA 3DOLA 3H3NO 3VQPA 4AHRA 3QEPA 4O0JA 3MAQA 1VSHA 1D5AA 3AGKA 2P9KA 3O9RA 5J2MA 3NVMA 3CCUN 3L8BA 4DR2K 4KTZA 1XNQK 5JLFA 1S3XA 4M3XA 2F9WA 1S22A 4JKBA 1BI4A 3A5LC 2O4IA 2UUCK 2AJQA 4EHTA 4LF4K 3DOKA 2VYPA 4B9UA 5KPZA 4MO4A 3UKRB 1S1TA 2QWMA 1W0HA 3GL1A 1RTJA 3AVBA 3EL2A 3PX6A 2O8CB 4CHOA 1RTDA 3VQ4A 4DS4A 3CCQN 4CZFA 3GG4A 3R1XA 2P9SB 1E4GT 1VQ5N 4C8NA 1WSJA 1UA0A 1BA0A 4UQGA 4DR1K 1BUPA 3CJBA 3KTQA 1YJNN 1DKGD 3QESA 1UAXA 2E4LA 2ZF5O 3VGLA 1J54A 3LDQA 2GX9A 1RDAA 2VWJA 4JNEA 4G1QA 3VERA 1VSFA 2QWLA 2VCPA 4C23A 1KTQA 4K8XA 2D5RA 4DFMA 1S1XA 1IBKK 1XMQK 5KQ8A 3EKUA 1WSEA 4HTUA 4IJNA 3VQBA 4AHCA 1M90O 3HVTA 1EKEA 4DSLA 2WC9A 5AQXA 3UKUA 5HROA 5SWMA 4LY7A 2D1KA 2HHHK 3ULEA 1B92A 3TSUA 3E9PA 2PY5A 4IEEA 3QEIA 3TAEA 2G8IA 3KD5E 2YHWA 5K14A 4N47A 2CGJA 2A5XA 3C65A 3A2FA 3CFPA 3KLIA 4KHWA 3THYB 3LL3A 2IDOA 4PY5A 2HVIA 3DMJA 3C0BA 1RDDA 4ZTJA 3ZX2A 5FPMA 5AQLA 3E01A 3RSEB 2EHGA 4PL7A 4FWOA 4Z4EA 3THVA 1U2VB 1M1KO 1NK7A 1YUWA 1B9FA 4DR6K 3R8EA 2W6LA 3M8PA 1C0UA 2ITMA 4JRPA 4WE1A 1YT3A 2V7YA 5CE3A 1Q9XA 2C1IA 4M3WA 4LF5K 3C6HA 3BEXA 4WYBA 4KH6A 3ZSOA 3QINA 3K57A 1H1VA 3R6MA 4OPKA 4H03B 4MLEA 5EX5A 2QKKA 3NF7A 1VSMA 4FJKA 2YHXA 3TABA 2D0OA 2RE2A 5F2RA 3JS6A 4H0YB 4IDHA 3LPUA 3L2QA 1TKXA 4Y1DA 1DTTA 3NCIA 4BDYA 5DK5A 2P9UB 3UKRA 3CCJN 4I6MA 5I9EB 5HRSA 4Z4CA 4BC4A 5C0YA 2X74A 4FW1A 3MXIA 2DPNA 2ZJQL 2P9SA 3SV4A 4CHQA 4FWKA 3EZ5A 5AQFA 3UB5A 5DM6L 3AARA 3NF6A 1TAQA 2FLOA 5E41A 1N33K 3AO3A 4CJKA 1TV6A 1YTUA 1XQSC 2ZJRL 1UWBA 1NKCA 1L3UA 2QEXN 1LAVA 1TGOA 1QQMA 4GVEA 1ZXOA 5BRFA 4JKGA 2WBNA 1K6YA 4ILGB 2HMIA 1TKDA 3OYKA 1U45A 1YHQN 4QS7A 1QSYA 1NOZA 1QQCA 5DM7L 2E88A 2V52B 1VQPN 4Y1CA 3SLCA 2YHAA 4CJWA 5SZTA 1WSIA 1NMDA 5HRNA 3WQUA 3CJAA 4BY9C 3AA3A 4DSIA 4CJ3A 3F73A 4LF9K 1RT6A 2HNDA 2O8EA 5C2DA 4NB4A 4FVUA 4CJQA 1HUXA 3VQ8A 4MO5A 3OJSA 4M42A 3GE1A 4DLEA 2YHBA 3V9SA 3V1QA 1KVBA 2DY4A 1RDWX 3AVNA 1QHTA 1W97L 4CEEA 5HOOA 1HNVA 4IOCL 4B8AB 3AVCA 5FLXO 4CHYA 1J6ZA 4GNIA 4LH5A 1X9MA 3J7AP 2NRRA 1K8KB 2G8VA 4FWQA 3SI6A 3P38A 1OH6A 1I94K 2RHKA 4OKEA 2Z1HA 2BTFA 5AFUA 4JRQA 3CYMA 1KCFA 4ID1A 3SK3A 1BQMA 2A41A 3AY9A 1KC8O 2IVOA 1QVFM 4RW6A 4BG8A 2O4GA 2ASMA 2QM1A 4UY8O 1Q86O 1SL1A 3SUPA 1Q7YO 2NLXA 4L3QA 2G8FA 5AQYA 1O13A 3QDKA 1Q81O 2WOMA 5JS2A 2F8SA 4DQPA 4M3RA 3N4PA 1HQUA 3AVFA 3K2PA 1YI2N 4OO1J 3LP0A 2E6LA 3EZWA 4CW7B 1GLFO 3F9MA 2QKBA 5B8HA 2A3ZA 5GIPA 4WQ5C 4HTLA 4O8UA 4CBXA 3DYAA 4YDUC 4W5RA 1IO2A 4CERA 4AHVA 5H1SQ 1S9EA 2FBTA 1QZ6A 3ZSWA 4DR7K 4FJ8A 3CM5A 5CYMA 4JI7K 4NO7A 3NF8A 4B3MK 3P31A 1GLBG 3AO4A 4ISEA 1NJXA 3IKMA 2Q36A 4BDPA 3V9XA 1DT9A 4A5BA 5AR0A 4JI4K 3SNNA 1GLLO 4FLVA 3B6OA 3KJVA 3RRHA 1Y64A 3VENA 2O8DA 3DLLL 4FPBA 2HBLA 2V51B 3MN9A 1EO1A 4M41A 5AQKA 3HL8A 3CFOA 4E1MA 2QW9A 4K41A 4OPHA 3QIPA 1BGXT 5J2PA 3HSTB 2ASPA 3MN7A 1DEJA 5KRSA 4LSLA 3F9KA 2IC3A 2HF3A 2HHSA 5M1FA 2YHYA 2VWKA 4H0TB 2HW3A 1U4BA 4A5AA 4BEBA 1T6CA 4OVLA 4AHTA 3CCEN 2P9IA 3I0RA 2O8BB 2BE2A 3SYZA 4OX9K 2X6SA 1K73O 1QHAA 5J1EA 3OBYA 1UOCA 3CQ8A 4F9OA 4FK0A 3WQTA 4E3SA 3V1RA 3BDPA 3KIOA 3DRPA 3RR7A 3WEEA 4E19A 4DB3A 3UE5A 1NGFA 4OKJA 4BGBA 4KHQA 5AQWA 1KSPA 3Q7CA 4WCEL 3ZCMA 3M8RA 1K8KA 1NJYA 2QWPA 1S9GA 3PLAA 1JLCA 1W7AA 3BZKA 4M3YA 2B6AA 3SQ4A 1WB9A 3THXB 4DTXA 3C7NA 3ZSQA 4ELVA 3VQDA 1CXUA 3O9UA 5FDLA 3HJFA 1HYZA 4CVNE 4KHSA 3KWIA 2P1JA 2E1ZA 2HHUA 5AQJA 5KGXA 4CJSA 4MDBA 1E3MA 3W0LA 1XUPO 1T6DA 4DQ8A 3ENHA 3L2VA 3TAGA 4BRGA 1LCUA 4ELUA 3CERA 3NH0A 4OKKA 1A5XA 4GV9A 3NFAA 4FW2A 1ASVA 3MWTA 3SUOA 4CZKA 4IKFA 1WOQA
chains in the Genus database with same CATH topology
2WUSA 4XH1A 5EVZA 3VF4A 2QI2A 4G9ZA 4XJXA 2CGLA 3LM9A 3OBWA 5FPDA 4EHTA 5GAHP 1S72N 2A40A 5E26A 1NGDA 4BRAA 4A2BA 1BOTO 2HOEA 2VYPA 3DXKB 4B1VA 5KPZA 4PL8A 4MO4A 3UKRB 3LDPA 4ILHA 5EOYA 2QWMA 2Q97A 3GL1A 3ID8A 3EL2A 3E9LA 3G71N 3FGUA 1BU6O 4FWRA 3ZEUB 3D2EA 4KH5A 3ID6A 3DXMA 3G4SN 3CCQN 4CZFA 5JVGL 3GG4A 4CD3A 3R1XA 2HBKA 2P9SB 1E4GT 4CI6A 4IZ9A 2JWLA 1VQ5N 5CR4A 4ILJA 3BUZB 1SAZA 3BF1A 1BA0A 2BUPA 5MLCQ 2BH1A 1SS6A 1BUPA 5AQQA 3CJBA 1YJNN 1DKGD 3T69A 3CJCA 3H1VX 3VGLA 2ZF5O 2PAVA 4HWIA 1YJWN 3H46O 5AQTA 3LDQA 4BGAA 5BRHA 3HZ6A 5AFUH 4WQ5A 2GX9A 3MWPA 4JNEA 4BRDA 2AA4A 2D4WA 2QWLA 3H1QA 2J4RA 3VERA 2FF6A 2VCPA 3MN6A 4DKWA 4C23A 3IUCA 5GAEP 4U7BA 3CXCM 2E2QA 5AQMA 1HJOA 3HTVA 4M7XA 4H5RA 4FL9A 1NGIA 3NMUA 2CH5A 5JMVA 5KQ8A 3AAQA 3TPQA 4GV3A 5BPLA 3EKUA 3QB0A 4JHDB 2HBJA 4JK9A 4BR5A 2ZGYA 2KHOA 4IJNA 3QFPA 4O5FA 4CZHA 3OA9A 1JJ2M 3ENOA 3U9ZA 3SAHA 5AQRA 1M90O 2P9PA 4WQ4A 1VQKN 4H0PA 3EE8A 4FO0A 1TUUA 3O5BA 2WC9A 5AQXA 3UKUA 3R3LA 1NGJA 2D1KA 4PHTX 1CZAN 4M7YA 1SZ2A 3ULEA 1W2BM 4JAXA 2P9IB 2E20A 4DCHA 5M1KA 3TSUA 3WXJA 3CMAN 3E9PA 5AQNA 4IEEA 2YI1A 3VGMA 4BRKA 5AQSA 2NRXA 2F7TA 1MWMA 3IDHA 3TTFA 1TYQA 3CD6N 3IFRA 2YHWA 4BQLA 4B1ZA 4IJAA 2CGJA 3E1YA 2A5XA 3C65A 3QICA 2VWBA 1Z05A 4BR9A 5LY3A 3HBTA 5AQIA 3U4LA 2QXLA 3S41A 3VEYA 2ASOA 5EY4A 3CJ7A 5TKWA 1VQ4N 5JLHA 3WEEB 1XC3A 1RFQA 3LL3A 5AQPA 2V7ZA 3LDOA 3GBTA 3C0BA 3U9DA 2KLAA 4FOIA 4CZJA 3I33A 5CHIA 3CC4N 1VQ8N 3CCLN 3ZX2A 1HKBA 5EXWA 5AQLA 5FPMA 3RSEB 3EKSA 3O6WA 4H5WA 4PL7A 4FWOA 2FSNA 1OKJA 3MK6A 4K43A 2F9TA 4B1WB 1U2VB 1M1KO 2I7NA 4NLCA 1YUWA 3SBGA 5F1XA 3PIPL 3N4QA 3O9SA 3O4WA 3R8EA 1IJJA 1QQOA 5KPRA 2CGKA 1Q18A 5M1QA 2ITMA 4WFAL 4BRHA 1T3VA 2V7YA 4H0XB 2GUPA 3CQYA 3R9PA 5CE3A 2C1IA 4BREA 3C7NB 5FPNA 3VTHA 5E84A 2WFBA 3C6HA 3BEXA 2Q0RA 2Q2RA 4KH6A 4WYBA 3CPWM 2NRVA 2NRZA 3O9QA 4R79A 4XH5A 1H1VA 1NGEA 4JKDA 3MX2A 3LDNA 4H5NA 3DWLA 3WXLA 3VEWA 3R6MA 5KQDA 4FWNA 4H03B 3TTCA 1BG3A 1ATSA 2P9KB 3F5TA 2E2PA 2NZTA 4IWVA 4MLEA 5EX5A 1VQ7N 4MLHA 2GWJA 2QTDA 2P9NA 4IOXA 2VGNA 4CZGA 4EHUA 3ATUA 2YHXA 5JVHL 3BF3A 2D0OA 2GWKA 2RE2A 5F2RA 3JS6A 3QFUA 4H0YB 4IDHA 3HI0A 4K42A 4PKIA 3C6AA 4YOXA 4CJ7A 3IMXA 1NGHA 4BROA 3DXKA 5BN8A 2EWSA 1C0FA 3KWGA 2NNWA 4JN4A 1LOTB 2P9UB 5AQHA 3UKRA 4A57A 1K9MO 3CCMN 1VQ6N 3CCJN 4I6MA 4CBWA 4BRCA 5ADXH 5I9EB 3MX5A 3VMFB 2P9LA 3O08A 3W3DA 4AM6A 4BC4A 5C0YA 2OTLN 3H45C 3CJ9A 4Z94A 2Q1NA 5AQUA 2DPNA 4U67L 1U6ZA 2NRWA 4A59A 2ZJQL 2P9SA 4Y0WA 3PIOL 1YAGA 4FWKA 3CI5A 4CBUA 3KVGA 1TUYA 3SMSA 1P8ZA 3A5NC 5AQFA 3UB5A 5DM6L 4YOWA 3DAWA 3VETA 4AM7A 2PFUA 3AARA 4JD2B 5AQGA 2FLOA 4EFHA 2C1GA 2ZGZA 4YOUA 5LJVA 3D2EB 4BC2A 4B1UB 4BR0A 3QBWA 3M5RA 4C1NI 3CMEN 1BWFO 5BPMA 3CC2N 1IG8A 4WQ4C 3CCSN 1HLUA 3K9JA 3RVCA 4FSVA 4YDUA 1XQSC 3SJHA 5AQZA 2ZJRL 2QEXN 3FR0A 5AZJB 1VQMN 2UYTA 4JKCA 4LC9B 1QQMA 4GVEA 1G99A 1ZXOA 4WFNL 5BRFA 4JKGA 3CCRN 2Q0UA 2WBNA 4IO9L 3E66A 5LJWA 5GADP 3ZX0A 4ILGB 3O8MA 4WF9L 3ENBA 1NGGA 1X9JA 1YHQN 4QS7A 4JHDA 3H3OB 3SAFA 3FZMA 4FPAA 5KPTA 5DM7L 5M1OA 2E88A 2I7PA 4YOYA 1WUAA 1JCGA 3L4IA 2V52B 4JKEA 5C10A 1VQPN 3SLCA 4ISFA 3B8AX 5TKYA 1NMDA 3D7EO 3WQUA 3CJAA 4BY9C 1V4SA 1NBWA 3HRGA 5AQOA 4WFBL 4IOAL 1X3MA 1OVYA 3GDQA 3VTIA 4PKGA 5C2DA 2E1YA 3HM8A 4NB4A 5AZIA 4B1XB 3D2FA 5HL7L 2YX6A 4KBOA 4JEPA 4FVUA 4BR2A 4BVOA 3A5OC 4BQZA 3FE1A 1HUXA 3A8YA 5GINA 4M63C 4MO5A 3UKUB 5F0XA 1YJ9N 4C1NK 3GE1A 2A42A 3VOVA 1YITN 3MMVA 1RDWX 2A6AA 3A5MC 4FOEA 4CZEA 3ULEB 5BR9A 5ADXA 3WUHA 2IIRA 1W97L 2FSJA 4BRPA 2AP1A 5HOOA 4IOCL 3HOTA 2GEMA 4XH4A 3VGKA 1J6ZA 4GNIA 3T7ZA 2PBDA 1MWKA 1NLVA 1VQON 3VEXA 2NRRA 1HX1A 4BRMA 5BREA 1K8KB 1ILYA 3CPEA 2NRTA 4FWQA 3F2KA 1QVGM 3P38A 4BR7A 3CQXA 3G25A 3P39A 3ZETB 1KQSM 3AAPA 1NGBA 2RHKA 5M1PA 2BTFA 4JK7A 5AFUA 1QQNA 3SBTA 4YOTA 1Q82O 3SK3A 2A41A 3ATVA 4XEIA 4RWTA 3AY9A 1KC8O 2IVOA 2FXUA 1QVFM 4RTFD 4BG8A 4IFEA 3P4IA 2ASMA 1RGIA 2E2OA 2QM1A 1KAZA 4OPAA 3CF5L 4UY8O 1GLJO 3FZFA 1Q86O 4A62A 1Q7YO 2NLXA 4L3QA 4DHYA 3WXKA 3M6GA 5AQYA 1O13A 3QDKA 1Q81O 3VPZA 4CZIA 1VQNN 1VQLN 3I8BA 3N4PA 3GOIA 1GLAG 4H5TA 5C12A 3OHRA 3CC7N 4JKHA 4KH4A 5C2FA 1YI2N 3EZWA 3MDQA 1GLFO 1KAXA 2YJEA 3F9MA 4IO8A 4O8KA 1DGKN 5B8HA 3I55N 3VF2A 2A3ZA 5GIPA 4WQ5C 3KHYA 4HTLA 4O8UA 4RCHA 4CBXA 4YORA 2GELA 3FZHA 3L4QA 3CETA 4QS9A 1NWKA 2P9NB 4YDUC 4BRIA 2QWRA 1HPMA 1P90A 4PKHA 2NRHA 5H1SQ 4BVPA 1C0GA 3JXUA 3ZEUA 3ZX3A 1QZ6A 4BG9A 4EIAA 3ZYYX 4BC3A 2GTDA 2E8AA 4A61A 4EAHD 3QBXA 1KXPA 2ZJPL 2HSTA 3DJCA 4H0VB 4J8FA 2FSKA 2VGMA 2FF3B 4NO7A 3WT0A 3P31A 4I6MB 3E9OA 3DXMB 2P9LB 1GLBG 4ISEA 4JD2A 2QA4N 3O9TA 3O1WA 3M3ZA 3VEVA 3I56N 4B9QA 3IKMA 2Q36A 3VF6A 1N8RO 2IVPA 3FFKB 3BP8A 1DT9A 4A5BA 5AR0A 4FWLA 4FWSA 3TSPA 4BRQA 5BPNA 2HF4A 4JK8A 1GLLO 1BA1A 4AF1A 1VQ9N 1Y64A 3VENA 4BRFA 5AZJA 4IXCA 3DLLL 1MA9B 3J8AA 4FPBA 2HBLA 2V51B 3KK7A 3MN9A 3Q7BA 1EO1A 5AQKA 3TU5A 1YF5L 1RDUA 1X3NA 4BRLA 3K9KA 4NLBA 2QW9A 3EN9A 3WXMB 4K41A 4OPHA 3J7ZO 5FPEA 2ASPA 3CJ1A 2W00A 2HBMA 2OANA 1ATNA 2E2NA 3CIPA 3SAGA 1Z6RA 3MN7A 1DEJA 1BO5O 3O80A 3VESA 4CZMA 3HOSA 4JKAA 1NJIO 4OO1J 4H5VA 4B1YB 3OW2M 2HF3A 3M1FA 3HSCA 4JKGB 5M1FA 4BECA 1GLEG 2YHYA 4H0TB 3NVKA 2JWKA 1R59O 3U8XA 1MDUB 2QWNA 4A5AA 3LDLA 4BEBA 2KKZA 3FLCO 1T6CA 1ZC6A 5C15A 1YVNA 2P9PB 1JCFA 3SMPA 2P9IA 1T44A 3TTDA 4YOVA 4MDAA 1KD1O 3CCEN 4BE7B 2W41A 5BRDA 4BRNA 1HKGA 2H3GX 1K73O 1QHAA 3LM2A 5AQVA 2YCHA 1YIJN 2HMPA 1EQYA 3OBYA 1SQKA 4F9OA 2QWQA 1YXQA 3EE9A 1GLDG 3WQTA 3MCAB 1NM1A 2OTJN 5AZIB 3KZBA 3D2FB 3VEOA 4E1JA 3WEEA 1KAYA 4BC5A 3AGRA 1VAZA 4CD1A 4FWMA 4DB3A 1TYQB 3UE5A 3G6EN 1NGFA 3CHWA 4BGBA 1K8AO 4JKFA 5JICA 3RSEA 5AQWA 3L0QA 5ELZA 2W40A 1HKCA 3Q7CA 3WXIA 4WCEL 1K8KA 1U2VA 2QWPA 2QWOA 3PLAA 3VEZA 4GY2B 3ZETA 5GIOA 1JCEA 2YJFA 2ZWHA 3L6QA 1V4TA 1ZBSA 4CZLA 2D0PA 4A2AA 3C7NA 4QS8A 3TSQA 1ATRA 3QMLA 4FWPA 3MCPA 5GAGP 2IVNA 1E4FT 3H3NO 1BDGA 3O9UA 4H0OA 5BN9A 1GLCG 4IEIA 3FZKA 3KWIA 3AGKA 2E1ZA 5AQJA 2P9KA 3FZLA 1NGAA 4MDBA 3O9RA 4GV6A 3W0LA 1XUPO 1T6DA 2CH6A 3NVMA 3CCUN 4K25A 4DQ8A 1QZ5A 5M1NA 3ENHA 4ISGA 4BRGA 1LCUA 1D4XA 3CCVN 3CERA 3D6RA 5JLFA 3H6EA 1S3XA 4GV9A 2F9WA 1ESVA 1S22A 3EO3A 2Q31A 3MWTA 3O1BA 3MN5A 1NGCA 4JKBA 3A0IX 4BR4A 3A5LC 4CZKA 2P9UA 1WOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WUS A;  4XH1 A;  5EVZ A;  3VF4 A;  2CGL A;  3LM9 A;  5FPD A;  4EHT A;  2A40 A;  5E26 A;  1NGD A;  4BRA A;  4A2B A;  1BOT O;  2HOE A;  2VYP A;  3DXK B;  4B1V A;  5KPZ A;  4PL8 A;  4MO4 A;  3UKR B;  3LDP A;  5EOY A;  2QWM A;  2Q97 A;  3GL1 A;  3ID8 A;  3EL2 A;  3FGU A;  1BU6 O;  4FWR A;  3ZEU B;  3D2E A;  3DXM A;  4CZF A;  3GG4 A;  4CD3 A;  2P9S B;  1E4G T;  4CI6 A;  4IZ9 A;  3BUZ B;  1SAZ A;  3BF1 A;  1BA0 A;  2BUP A;  1BUP A;  5AQQ A;  3CJB A;  1DKG D;  3CJC A;  3H1V X;  3VGL A;  2ZF5 O;  2PAV A;  4HWI A;  3H46 O;  5AQT A;  3LDQ A;  4BGA A;  5BRH A;  3HZ6 A;  5AFU H;  4WQ5 A;  4JNE A;  4BRD A;  2AA4 A;  2D4W A;  2QWL A;  3H1Q A;  2J4R A;  3VER A;  2FF6 A;  2VCP A;  3MN6 A;  4C23 A;  3IUC A;  2E2Q A;  5AQM A;  1HJO A;  3HTV A;  4M7X A;  4H5R A;  4FL9 A;  1NGI A;  2CH5 A;  5JMV A;  5KQ8 A;  3AAQ A;  3TPQ A;  5BPL A;  3EKU A;  3QB0 A;  4JHD B;  4BR5 A;  2ZGY A;  2KHO A;  4IJN A;  3QFP A;  4O5F A;  4CZH A;  3ENO A;  3U9Z A;  5AQR A;  2P9P A;  4WQ4 A;  4H0P A;  4FO0 A;  1TUU A;  3O5B A;  5AQX A;  3UKU A;  1NGJ A;  2D1K A;  1CZA N;  4M7Y A;  1SZ2 A;  3ULE A;  4JAX A;  2P9I B;  2E20 A;  4DCH A;  3WXJ A;  5AQN A;  3VGM A;  2YI1 A;  4BRK A;  5AQS A;  1MWM A;  3IDH A;  1TYQ A;  3IFR A;  2YHW A;  4BQL A;  4B1Z A;  4IJA A;  2CGJ A;  2A5X A;  3QIC A;  2VWB A;  1Z05 A;  4BR9 A;  5LY3 A;  3HBT A;  5AQI A;  3U4L A;  2QXL A;  3S41 A;  3VEY A;  2ASO A;  5EY4 A;  3CJ7 A;  5JLH A;  3WEE B;  1XC3 A;  1RFQ A;  3LL3 A;  5AQP A;  2V7Z A;  3LDO A;  3GBT A;  3C0B A;  3U9D A;  4FOI A;  4CZJ A;  3I33 A;  3ZX2 A;  1HKB A;  5EXW A;  5AQL A;  5FPM A;  3RSE B;  3EKS A;  3O6W A;  4H5W A;  4PL7 A;  4FWO A;  2FSN A;  1OKJ A;  3MK6 A;  4K43 A;  2F9T A;  4B1W B;  1U2V B;  2I7N A;  5F1X A;  1YUW A;  3O4W A;  3R8E A;  1IJJ A;  1QQO A;  5KPR A;  2CGK A;  1Q18 A;  2ITM A;  4BRH A;  2V7Y A;  4H0X B;  3R9P A;  2GUP A;  3CQY A;  5CE3 A;  4BRE A;  3C7N B;  5FPN A;  5E84 A;  2Q0R A;  3BEX A;  2Q2R A;  4WYB A;  4XH5 A;  1H1V A;  1NGE A;  3LDN A;  4H5N A;  3DWL A;  3WXL A;  3VEW A;  3R6M A;  5KQD A;  4FWN A;  4H03 B;  1BG3 A;  1ATS A;  2P9K B;  2E2P A;  2NZT A;  4IWV A;  4MLE A;  5EX5 A;  4MLH A;  2GWJ A;  2P9N A;  4CZG A;  4EHU A;  3ATU A;  2YHX A;  3BF3 A;  2D0O A;  2GWK A;  5F2R A;  3JS6 A;  3QFU A;  4H0Y B;  3HI0 A;  4K42 A;  4PKI A;  4CJ7 A;  3IMX A;  1NGH A;  4BRO A;  3DXK A;  5BN8 A;  2EWS A;  1C0F A;  4JN4 A;  1LOT B;  2P9U B;  5AQH A;  3UKR A;  4I6M A;  4CBW A;  4BRC A;  5ADX H;  5I9E B;  2P9L A;  3O08 A;  3W3D A;  4AM6 A;  4BC4 A;  3H45 C;  3CJ9 A;  4Z94 A;  2Q1N A;  5AQU A;  2DPN A;  1U6Z A;  2P9S A;  4Y0W A;  1YAG A;  4FWK A;  3CI5 A;  4CBU A;  3KVG A;  1TUY A;  3SMS A;  1P8Z A;  3A5N C;  5AQF A;  3UB5 A;  3DAW A;  3VET A;  4AM7 A;  3AAR A;  4JD2 B;  5AQG A;  2FLO A;  4EFH A;  2ZGZ A;  5LJV A;  3D2E B;  4BC2 A;  4B1U B;  4BR0 A;  3QBW A;  1BWF O;  5BPM A;  1IG8 A;  4WQ4 C;  1HLU A;  4FSV A;  4YDU A;  1XQS C;  3SJH A;  5AQZ A;  3FR0 A;  5AZJ B;  2UYT A;  4LC9 B;  1QQM A;  1G99 A;  1ZXO A;  5BRF A;  2Q0U A;  5LJW A;  3ZX0 A;  3O8M A;  1NGG A;  1X9J A;  4QS7 A;  4JHD A;  3H3O B;  3FZM A;  4FPA A;  5KPT A;  2E88 A;  2I7P A;  1WUA A;  1JCG A;  3L4I A;  2V52 B;  3SLC A;  4ISF A;  3B8A X;  5TKY A;  1NMD A;  3D7E O;  3WQU A;  3CJA A;  1V4S A;  1NBW A;  5AQO A;  1X3M A;  3GDQ A;  4PKG A;  2E1Y A;  3HM8 A;  4NB4 A;  5AZI A;  4B1X B;  3D2F A;  4KBO A;  4BR2 A;  4BVO A;  3A5O C;  4BQZ A;  3FE1 A;  1HUX A;  3A8Y A;  4M63 C;  4MO5 A;  3UKU B;  5F0X A;  3GE1 A;  2A42 A;  3VOV A;  3MMV A;  1RDW X;  2A6A A;  3A5M C;  4FOE A;  4CZE A;  3ULE B;  5BR9 A;  5ADX A;  3WUH A;  2IIR A;  2FSJ A;  4BRP A;  2AP1 A;  2GEM A;  4XH4 A;  3VGK A;  1J6Z A;  4GNI A;  2PBD A;  1MWK A;  1NLV A;  3VEX A;  1HX1 A;  4BRM A;  5BRE A;  1K8K B;  4FWQ A;  4BR7 A;  3CQX A;  3G25 A;  3ZET B;  3AAP A;  1NGB A;  2BTF A;  5AFU A;  1QQN A;  3SK3 A;  2A41 A;  3ATV A;  4XEI A;  4RWT A;  3AY9 A;  2IVO A;  2FXU A;  4RTF D;  4BG8 A;  3P4I A;  2ASM A;  1RGI A;  2E2O A;  2QM1 A;  1KAZ A;  1GLJ O;  3FZF A;  4A62 A;  2NLX A;  4L3Q A;  4DHY A;  3WXK A;  3M6G A;  5AQY A;  3QDK A;  3VPZ A;  4CZI A;  3I8B A;  3GOI A;  1GLA G;  4H5T A;  3OHR A;  3EZW A;  3MDQ A;  1GLF O;  1KAX A;  2YJE A;  3F9M A;  4IO8 A;  4O8K A;  1DGK N;  5B8H A;  3VF2 A;  2A3Z A;  4WQ5 C;  3KHY A;  4HTL A;  4RCH A;  4CBX A;  4BRI A;  2GEL A;  3FZH A;  4QS9 A;  3CET A;  4YDU C;  1NWK A;  2P9N B;  2QWR A;  1HPM A;  4PKH A;  2NRH A;  4BVP A;  1C0G A;  3JXU A;  3ZEU A;  3ZX3 A;  1QZ6 A;  4BG9 A;  4EIA A;  4BC3 A;  2GTD A;  2E8A A;  4A61 A;  4EAH D;  3QBX A;  1KXP A;  3DJC A;  4H0V B;  4J8F A;  2FSK A;  2FF3 B;  4NO7 A;  3WT0 A;  4I6M B;  3DXM B;  2P9L B;  1GLB G;  4ISE A;  4JD2 A;  3O1W A;  3M3Z A;  3VEV A;  4B9Q A;  3VF6 A;  2Q36 A;  2IVP A;  3FFK B;  3BP8 A;  5AR0 A;  4FWL A;  4FWS A;  4BRQ A;  5BPN A;  2HF4 A;  1GLL O;  1BA1 A;  1Y64 A;  3VEN A;  4BRF A;  5AZJ A;  4IXC A;  1MA9 B;  3J8A A;  4FPB A;  2V51 B;  3MN9 A;  5AQK A;  3TU5 A;  4BRL A;  1X3N A;  2QW9 A;  3EN9 A;  4K41 A;  5FPE A;  2ASP A;  3CJ1 A;  2OAN A;  1ATN A;  2E2N A;  3CIP A;  1Z6R A;  3MN7 A;  1DEJ A;  1BO5 O;  3O80 A;  3VES A;  4CZM A;  4H5V A;  4B1Y B;  2HF3 A;  3M1F A;  3HSC A;  1GLE G;  2YHY A;  4H0T B;  1R59 O;  3U8X A;  1MDU B;  2QWN A;  3LDL A;  3FLC O;  1T6C A;  1ZC6 A;  1YVN A;  2P9P B;  1JCF A;  3SMP A;  2P9I A;  1T44 A;  2W41 A;  5BRD A;  4BRN A;  1HKG A;  2H3G X;  1QHA A;  3LM2 A;  5AQV A;  2YCH A;  2HMP A;  1EQY A;  1SQK A;  4F9O A;  2QWQ A;  1YXQ A;  1GLD G;  3WQT A;  1NM1 A;  5AZI B;  3KZB A;  3D2F B;  3VEO A;  4E1J A;  3WEE A;  1KAY A;  4BC5 A;  4CD1 A;  4FWM A;  4DB3 A;  1TYQ B;  3UE5 A;  1NGF A;  3CHW A;  4BGB A;  5JIC A;  3RSE A;  5AQW A;  3L0Q A;  5ELZ A;  2W40 A;  1HKC A;  3WXI A;  1K8K A;  1U2V A;  2QWP A;  2QWO A;  3VEZ A;  4GY2 B;  3ZET A;  1JCE A;  2YJF A;  2ZWH A;  3L6Q A;  1V4T A;  1ZBS A;  4CZL A;  2D0P A;  4A2A A;  3C7N A;  4QS8 A;  1ATR A;  3QML A;  4FWP A;  3MCP A;  2IVN A;  1E4F T;  3H3N O;  1BDG A;  4H0O A;  5BN9 A;  1GLC G;  3FZK A;  2E1Z A;  5AQJ A;  2P9K A;  3FZL A;  1NGA A;  3W0L A;  1XUP O;  1T6D A;  2CH6 A;  4K25 A;  4DQ8 A;  1QZ5 A;  3ENH A;  4ISG A;  4BRG A;  1LCU A;  1D4X A;  3CER A;  5JLF A;  3H6E A;  1S3X A;  2F9W A;  1ESV A;  1S22 A;  3EO3 A;  2Q31 A;  3O1B A;  3MN5 A;  1NGC A;  4CZK A;  3A0I X;  4BR4 A;  3A5L C;  2P9U A;  1WOQ A; 
#chains in the Genus database with same CATH topology
 3SCX A;  4CCH A;  3VF4 A;  1ZBI A;  4XJX A;  3LM9 A;  5FPD A;  4DQI A;  1NGD A;  4BRA A;  4A2B A;  1BOT O;  1NU0 A;  4DG1 A;  3VQQ A;  4B1V A;  2O8F B;  4ILH A;  4O5B A;  3O4N A;  4LFA K;  1FKP A;  3G71 N;  2YNG A;  4FWR A;  4FJJ A;  4IFV A;  5JVG L;  4CD3 A;  4J2E A;  4IZ9 A;  2JWL A;  5FRM A;  3LAK A;  1SAZ A;  3BF1 A;  1IV0 A;  4DV4 K;  2BUP A;  5MLC Q;  2BH1 A;  1C6V A;  2HNZ A;  1SS6 A;  4K0K K;  4B08 A;  3T69 A;  5HRR A;  3KKR A;  1OVQ A;  4H4M A;  1YJW N;  1HNZ K;  3PV8 A;  2XY5 A;  3DLB A;  1KVA A;  1L3V A;  3OYH A;  1BIZ A;  2AA4 A;  4DV6 K;  2J4R A;  4IG3 A;  2FF6 A;  5GAE P;  4U7B A;  3CXC M;  3DI6 A;  3ALY A;  3I0S A;  3HTV A;  4Z4H A;  4FCY A;  4H5R A;  3IS9 A;  4DTR A;  4GV3 A;  5BPL A;  1A5V A;  3QB0 A;  4IFY A;  2HBJ A;  3NF9 A;  2W42 A;  4AIL C;  1VRT A;  4HUF A;  1XWL A;  4CZH A;  2QXF A;  3OYN A;  3ENO A;  3OYA A;  3WNH A;  4E72 A;  1VHX A;  2OYQ A;  4H0P A;  2GBZ A;  4DU1 A;  1TUU A;  1JKH A;  3NE6 A;  1NGJ A;  1CZB A;  4KB1 A;  1W2B M;  3WXJ A;  3CMA N;  2YI1 A;  2VG7 A;  3HPG A;  2NRX A;  2OZS A;  3LAN A;  3CD6 N;  4CIE A;  4DQR A;  4B1Z A;  3E1Y A;  4DSE A;  2VWB A;  4BR9 A;  5LY3 A;  2HHV A;  2QXL A;  5EY4 A;  5JLH A;  1RFQ A;  2V7Z A;  3LDO A;  4CHN A;  5I42 A;  2UU9 K;  3SUQ A;  4H4O A;  4RW9 A;  3CC4 N;  2KLA A;  4FOI A;  4CZJ A;  1B9D A;  1RT3 A;  3CCL N;  1HKB A;  4E7J A;  3THX A;  3O6W A;  3L2W A;  4V19 S;  5KRT A;  2I7N A;  5F1X A;  3JAM O;  3VQ7 A;  3PIP L;  1VSE A;  1QQO A;  5KPR A;  1IBL K;  5M1Q A;  4WFA L;  2OA8 A;  3AVJ A;  3ZSV A;  1OH5 A;  4BRE A;  3BGR A;  2WFB A;  5CZ1 A;  4N41 A;  3O9Q A;  4E7I A;  4JI0 K;  3MX2 A;  1XHX A;  1WNS A;  1ATS A;  3L3V A;  2HHW A;  2E2P A;  4MLH A;  1HNI A;  2P9N A;  4CZG A;  4EHU A;  5JVH L;  2G8H A;  2ZM6 K;  3QFU A;  3TAQ A;  2XY8 A;  4CES A;  4EZ9 A;  3K58 A;  2ITG A;  4JI2 K;  4BRO A;  3HYF A;  3KWG A;  1QS4 A;  5HBM A;  2O8F A;  5AQH A;  4BWM A;  4CBW A;  5D3G A;  5CZ2 A;  4BRC A;  4JS4 A;  3MX5 A;  3EY1 A;  1XC9 A;  3CJ9 A;  3AO1 A;  4A59 A;  2NRW A;  3LP3 A;  1TKZ A;  3OYC A;  4DTM A;  4Y0W A;  3OS1 A;  1J9A A;  1YAG A;  4M3Z A;  4W5O A;  3CYG A;  3CI5 A;  4X62 K;  3VET A;  1WBB A;  4JD2 B;  2DFH A;  4EFH A;  2C1G A;  3D2E B;  2Z1I A;  4BC2 A;  4C1N I;  3CME N;  3CC2 N;  4OGE A;  1HLU A;  3K9J A;  2DFE A;  3V9W A;  3C6U A;  5AZJ B;  1VQM N;  4DV0 K;  2OPR A;  3V1O A;  4M45 A;  2G8W A;  1G99 A;  4WFN L;  4N5S A;  3KLH A;  2PYJ A;  4CGI A;  3E66 A;  1DTQ A;  4YFU A;  5GAD P;  1Y97 A;  1NGG A;  3TR8 A;  2KFZ A;  4DFJ A;  5KPT A;  1RBR A;  3DM2 A;  4DTS A;  3B8A X;  5TKY A;  4JI5 K;  1V4S A;  1NBW A;  3HRG A;  3GDQ A;  1OVY A;  3D0P A;  4E7H A;  4Z0U A;  1RDB A;  3HM8 A;  2YV0 X;  4KRE A;  5HL7 L;  2YX6 A;  1VK0 A;  4GVM A;  3LAL A;  3S3O A;  2UUB K;  3T19 A;  4M63 C;  1YJ9 N;  4C1N K;  2A42 A;  3VOV A;  1FJG K;  2A6A A;  4YY3 K;  1LWC A;  2IIR A;  1BHL A;  4DV2 K;  4DWI A;  1RBU A;  4C8K A;  3VGK A;  3K5O A;  1C1B A;  3S3M A;  1RTH A;  3LZJ A;  5BRE A;  1NK0 A;  1ILY A;  3CPE A;  2NRT A;  1QVG M;  2OPQ A;  3F2K A;  2ZE2 A;  1WBD A;  1KQS M;  3LP1 A;  3AAP A;  1QQN A;  4OGC A;  2OZM A;  3V9Z A;  3OYF A;  1LAW A;  3ATV A;  1KLN A;  2FBX A;  1LWF A;  1HYS A;  4RW7 A;  2B4J A;  1KAZ A;  3FZF A;  4MQ3 A;  4HVJ A;  4DUZ K;  4Z4F A;  3T1Y K;  4J2D A;  3VPZ A;  1BQN A;  1I39 A;  1VQL N;  4CGJ A;  4LH4 A;  2ATQ A;  5CY4 A;  1GLA G;  4H5T A;  5C12 A;  1HJR A;  5C25 A;  3KK1 A;  3NH2 A;  2YJE A;  3JSM A;  3OJU A;  4IO8 A;  1CZ9 A;  3P1G A;  4B3T K;  3RMA A;  3ZT4 A;  3FZH A;  3S9H A;  3TAR A;  4CJF A;  4KI4 A;  2O8C A;  2E6M A;  4PKH A;  2NRH A;  4B9S A;  4BVP A;  1ZBU A;  3C6T A;  3ZYY X;  2E8A A;  1WN7 A;  3ZSY A;  2HST A;  4H0V B;  3ZSZ A;  2VGM A;  4N76 A;  3WT0 A;  3OYG A;  3E9O A;  4GKK K;  3DXM B;  2P9L B;  4CK2 A;  4JD2 A;  3O1W A;  4KAZ A;  4FZZ A;  3I56 N;  1SUQ A;  4CGH A;  4LF7 K;  3K5M A;  3HVR A;  4IBN A;  1HRH A;  4FWL A;  4FWS A;  3TSP A;  4BRQ A;  5BPN A;  4ELT A;  5AZJ A;  4IXC A;  4E0D A;  2RPI A;  2GV9 A;  4BE1 A;  1YF5 L;  1RDU A;  4F2S A;  2Z1G A;  2XRI A;  3CIP A;  1ATN A;  2E2N A;  1N5Y A;  1Z6R A;  3VES A;  1BO5 O;  4KTW A;  3M1F A;  5FRO A;  4BEC A;  4DQQ A;  1R59 O;  4E89 A;  4NCB A;  1MDU B;  3QNN A;  4F4K A;  1S6P A;  2QWN A;  2Q3S A;  3TWH A;  2G8U A;  3LPT A;  3DLE A;  4DMN A;  5C15 A;  3TTD A;  1JCF A;  1KD1 O;  4YOV A;  4MDA A;  4BE7 B;  3IG1 A;  4DFK A;  3CG7 A;  1NKB A;  1IH7 A;  1F21 A;  2YCH A;  2HMP A;  4CFA A;  4RW8 A;  3THY A;  5AZI B;  3KZB A;  3D2F B;  4BC5 A;  3OYI A;  4FJ7 A;  4CJR A;  1TYQ B;  4C8O A;  1D9D A;  3RR8 A;  3RSE A;  1WSF A;  3HPO A;  1C0T A;  1X1P A;  5ELZ A;  2W40 A;  3MXM A;  1U2V A;  2QWO A;  3VEZ A;  4GY2 B;  2JGU A;  4H8K A;  1EET A;  3D45 A;  1JCE A;  1TKT A;  2YJF A;  2ZWH A;  5BR8 K;  1QSS A;  2D0P A;  1HYV A;  3T1A A;  1ATR A;  2IOC A;  4FWP A;  3MCP A;  3AVH A;  5GAG P;  1BDG A;  3BZC A;  5BN9 A;  4IEI A;  4FLY A;  3OS2 A;  3OYJ A;  3FZL A;  4LD0 A;  2CH6 A;  4K25 A;  4CJP A;  5M1N A;  1MU2 A;  2EX3 A;  3D6R A;  3H6E A;  3B6P A;  2VQE K;  4YNQ A;  1ESV A;  4ICL A;  3O3H A;  1HPZ A;  2P9U A;  4W5N A;  4KI6 A;  2CGL A;  4JI1 K;  3OBW A;  5GAH P;  1S72 N;  1DLO A;  2XHB A;  1IKY A;  2OCE A;  4C8L A;  4PL8 A;  4CK1 A;  3LDP A;  5EOY A;  5T7B A;  3ID8 A;  1GOC A;  3LAM A;  4FYD A;  3FGU A;  3ZEU B;  4FLX A;  3DXM A;  5LMN K;  2Z1J A;  3HO1 A;  4W5T A;  2HBK A;  3AA5 X;  5CR4 A;  4ILJ A;  3BUZ B;  3VQ9 A;  2W6K A;  4CGG A;  5AQQ A;  4FJN A;  3CJC A;  2PAV A;  4HWI A;  3H46 O;  1NK6 A;  5BRH A;  3HZ6 A;  4WQ5 A;  3KKS A;  4DV5 K;  2UXD K;  4KHY A;  3MWP A;  5EU7 A;  4BRD A;  2E5L K;  4F2R A;  3MN6 A;  1LWE A;  3IUC A;  3U3Y A;  3HP6 A;  1U04 A;  5AQM A;  1HJO A;  3RMB A;  4M7X A;  3ASM A;  4FL9 A;  1NGI A;  4F3O A;  4JHD B;  3DRR A;  3J7Y P;  4BR5 A;  3M8Q A;  3QFP A;  4K8Z A;  1JJ2 M;  3SAH A;  3AA4 A;  3IAY A;  3ITH A;  3PX4 A;  4KHU A;  4WQ4 A;  3EE8 A;  4FO0 A;  4NXN K;  3L2U A;  3O5B A;  3R3L A;  3SV3 A;  4C8M A;  4DF4 A;  1CZA N;  2E20 A;  4CF2 A;  4DCH A;  5M1K A;  1BL3 A;  3VQA A;  5AQN A;  3PY8 A;  4BRK A;  5AQS A;  2F7T A;  1TYQ A;  4CJT A;  3QET A;  4BQL A;  3M8S A;  1ASW A;  3RMD A;  4OLB A;  1WAJ A;  4CJV A;  4J2A A;  1R0A A;  3HBT A;  4FJG A;  3S41 A;  4LSN A;  1VQ4 N;  1XC3 A;  5AQP A;  3GBT A;  4CJ5 A;  1A5W A;  1TAU A;  2R7Y A;  3KD1 E;  3I33 A;  4FJH A;  1JXE A;  1KFD A;  1S5J A;  1JL1 A;  4M3T A;  2FSN A;  1OKJ A;  3MK6 A;  4B1W B;  1VSI A;  3N4Q A;  3DLG A;  1NJZ A;  3O4W A;  3PO5 A;  1ASU A;  2CGK A;  1Q18 A;  3RWU A;  2UXB K;  1WLJ A;  1T3V A;  5FRN A;  3CQY A;  4FK4 A;  4DR5 K;  3DLH A;  5E84 A;  2Q0R A;  2VG6 A;  1RT5 A;  2NRV A;  2NRZ A;  4R79 A;  4XH5 A;  4CFD A;  1NGE A;  2X78 A;  4Q5V A;  3JYT A;  4FM0 A;  3WXL A;  5KQD A;  1IG9 A;  2P9K B;  3F5T A;  1TK0 A;  1JLG A;  2VQF K;  4IWV A;  3SUN A;  2UXC K;  4NXM K;  2QTD A;  4CHZ A;  3NAE A;  1GOB A;  2VGN A;  1J5E K;  1NMN A;  3BF3 A;  2GWK A;  3VQC A;  4FLT A;  3HI0 A;  1IBM K;  3C6A A;  4M3U A;  4YOX A;  3IMX A;  1NGH A;  5HRP A;  3P5J A;  5BN8 A;  2OPP A;  2EWS A;  2YKM A;  2NNW A;  1LOT B;  4YHH K;  1VQ6 N;  4O4G A;  1XHZ A;  3O08 A;  3W3D A;  2FBV A;  4AM6 A;  4DV3 K;  3H45 C;  4Z94 A;  2Q1N A;  5AQU A;  4N56 A;  4U67 L;  1U6Z A;  3PIO L;  3C95 A;  5I3U A;  4O0I A;  4YOW A;  3SJJ A;  1RT2 A;  2ZGZ A;  4YOU A;  5LJV A;  4BR0 A;  3M5R A;  5BPM A;  1RCH A;  3OYB A;  3CCS N;  4FSV A;  3SJH A;  5AQZ A;  1IKX A;  1FXX A;  4I7F A;  4X65 K;  2UYT A;  1N6Q A;  1XMO K;  4LF8 K;  3CCR N;  4DFP A;  4RG8 A;  2DTU A;  4CJU A;  1OH8 A;  3RMC A;  2ZQB A;  1OH7 A;  4JHD A;  2DFF A;  3H3O B;  3SAF A;  1NK8 A;  4FPA A;  4B3R K;  1VSD A;  1RBS A;  1NKE A;  5M1O A;  3S5T A;  4CE9 A;  1X9S A;  4YOY A;  2O8B A;  1RBT A;  1JCG A;  3L4I A;  2P5G A;  1BIU A;  1ITG A;  4DTO A;  4ISF A;  1UA1 A;  1L3S A;  3K5L A;  1ZBL A;  2F8T A;  4KKO A;  3FFI A;  4IOA L;  4B9M A;  1HNX K;  1JLQ A;  3VTI A;  4PKG A;  4B1X B;  3SPZ A;  3P83 D;  4KBO A;  4JEP A;  4BVO A;  4KFB A;  4LFC K;  3FE1 A;  2D0C A;  2VG5 A;  3UKU B;  3CM6 A;  3RTV A;  1YIT N;  3MMV A;  3OYD A;  4FOE A;  1I3A A;  5C24 A;  3ULE B;  4E1N A;  1WSH A;  2FSJ A;  4BRP A;  1CXQ A;  3V81 A;  2AP1 A;  1RT7 A;  1ZBF A;  3HOT A;  3ZLJ A;  5JEN A;  2GEM A;  4CGD A;  4HUE A;  3T7Z A;  2PBD A;  1MWK A;  1VQO N;  1SV5 A;  4CK3 A;  1HX1 A;  4CED A;  3O4Q A;  3AV9 A;  1ZYQ A;  4Z4G A;  3CQX A;  3ZET B;  4ZTF A;  1NGB A;  5M1P A;  4EZ6 A;  1RNH A;  4CEO A;  4YOT A;  4DR3 K;  1Q82 O;  3OVN A;  1JL2 A;  4XEI A;  4EP5 A;  4FJ5 A;  1CLQ A;  4LF6 K;  2FXU A;  3VQ6 A;  3NGY A;  4NCA A;  1RGI A;  4OPA A;  4A62 A;  1D8Y A;  3OYL A;  4F3T A;  4CEF A;  4DHY A;  4FZX C;  3M6G A;  3V6D A;  5KI6 A;  4CZI A;  3HP9 A;  3I8B A;  1JLA A;  1WSG A;  5AJ3 K;  3VA0 A;  3CC7 N;  4JS5 A;  3ISN C;  1DGK N;  1YTA A;  1SKS A;  3I55 N;  1SL0 A;  3KHY A;  4RCH A;  4YOR A;  4BRI A;  4CJ4 A;  3L4Q A;  3CET A;  1NK4 A;  2QWR A;  1S1W A;  1YVU A;  4NYN A;  1EWQ A;  3HT3 A;  3ZX3 A;  4JI6 K;  4BG9 A;  1IKW A;  4EIA A;  2HHX A;  4BC3 A;  2GTD A;  3TAN A;  1SKW A;  1ZBH A;  3DJC A;  2YNF A;  5DMR A;  2FSK A;  1Z26 A;  2PZS A;  4I6M B;  1EXQ A;  1RDC A;  4HCC A;  3OS0 A;  2QA4 N;  3SQ2 A;  4B9Q A;  2HHT A;  3VF6 A;  5JS1 A;  3PSI A;  4CJL A;  1N8R O;  2IVP A;  3BP8 A;  4PWD A;  1Q8I A;  2HF4 A;  4AF1 A;  1HQE A;  4BRF A;  2KTQ A;  3J8A A;  3Q7B A;  4DR4 K;  3T1H K;  1X3N A;  3K9K A;  4NLB A;  4CJE A;  3EN9 A;  3WXM B;  2D0B A;  1T8E A;  3J7Z O;  3V4I A;  2PYL A;  1EX4 A;  3AO2 A;  5FPE A;  3PSF A;  2UUA K;  4PQU A;  3SAG A;  4O55 A;  4CFB A;  1FK9 A;  4CEB A;  1Z25 A;  2Y1J A;  4JKA A;  3VA3 A;  4F8R A;  4HCB A;  4H5V A;  3OW2 M;  3AVL A;  4JKG B;  4BE0 A;  2RKI A;  1GLE G;  1REV A;  1U49 A;  3K5N A;  2JWK A;  5A2Q O;  2HB5 A;  3U8X A;  3TAM A;  2RF2 A;  3EYZ A;  1ZC6 A;  4BDZ A;  1RT4 A;  2P9P B;  3V9U A;  2W41 A;  5BRD A;  1HKG A;  3AVM A;  3DRS A;  3VQ5 A;  3LM2 A;  1YIJ N;  1EQY A;  1C0M A;  2QWQ A;  4OJR A;  1GLD G;  1XNR K;  3MCA B;  2O8E B;  4GKJ K;  3VEO A;  4L8R B;  3ZT3 A;  3AGR A;  1VAZ A;  1NOY A;  2IS3 A;  4HUG A;  4JKF A;  5JIC A;  1D9F A;  1W9H A;  3WXI A;  3SPY A;  5IWA K;  3OYM A;  4FLW A;  3MEC A;  3ZET A;  5GIO A;  4IDK A;  3L6Q A;  3TSQ A;  1HNW K;  4DTJ A;  5LMU K;  1E4F T;  4H0O A;  1GLC G;  3SQ1 A;  1S1V A;  1JLE A;  3FZK A;  3I8D A;  2FBY A;  3WNE A;  1NGA A;  4GV6 A;  5CYQ A;  4FLZ A;  1N36 K;  4FM1 A;  1QZ5 A;  3TAF A;  4ISG A;  1D4X A;  1O1W A;  3CCV N;  4NYF A;  4AQY K;  3U6F A;  1JLB A;  2RN2 A;  1FW6 A;  1BIS A;  3QEW A;  1S1U A;  3EO3 A;  2Q31 A;  3O1B A;  3MN5 A;  1NGC A;  3A0I X;  4BR4 A;  4DTN A;  4PHT X;  3TTC A;  2WUS A;  4XH1 A;  5EVZ A;  2QI2 A;  3QNO A;  4G9Z A;  2HHQ A;  2A40 A;  5E26 A;  3ZSX A;  4DTP A;  3PX0 A;  5IT9 O;  2BGG A;  2HOE A;  3LP2 A;  3DXK B;  4X66 K;  1G15 A;  4ID5 A;  2B5J A;  4FM2 A;  2A1S A;  2Q97 A;  3E9L A;  4I9Q A;  2KFN A;  1BU6 O;  4DU3 A;  3D2E A;  3G10 A;  4KH5 A;  3ID6 A;  3G4S N;  3THW B;  4DQS A;  4FJL A;  4CI6 A;  2HVH A;  4W5Q A;  3BY5 A;  3KK3 A;  3UIQ A;  3SZ2 A;  2KZZ A;  5HP1 A;  4JYA K;  3LWM A;  1WAF A;  1J53 A;  2KW4 A;  3H1V X;  1QSL A;  5AQT A;  3KK2 A;  4NCG A;  1L5U A;  4BGA A;  1N34 K;  5AFU H;  1T7P A;  3LZI A;  4DF8 A;  4KRF A;  2D4W A;  3H1Q A;  1IKV A;  4HHT A;  4X64 K;  4DKW A;  2IAJ A;  4B9L A;  2O8D B;  2A1R A;  1U48 A;  2E2Q A;  1LW0 A;  4IG0 A;  3NMU A;  2CH5 A;  5JMV A;  3AAQ A;  3TPQ A;  4CF1 A;  4JK9 A;  5J2N A;  2ZGY A;  2KHO A;  2HNY A;  4O5F A;  3OA9 A;  3U9Z A;  3O3F A;  5AQR A;  2P9P A;  1NK5 A;  1VQK N;  2YNH A;  2X6N A;  3KLE A;  2XY7 A;  3LWL A;  4DUY K;  4M7Y A;  1SZ2 A;  4JAX A;  2P9I B;  3ZT2 A;  4DS5 A;  3PO4 A;  3VGM A;  4FXD A;  2NUB A;  4B3S K;  1MWM A;  3H08 A;  2KQ2 A;  3IDH A;  3TTF A;  2YNI A;  3IFR A;  4IJA A;  4DV7 K;  3QER A;  4KO0 A;  3QIC A;  3QLH A;  1Z05 A;  5AQI A;  3EEQ A;  3U4L A;  3VEY A;  2ASO A;  5TKW A;  3CJ7 A;  1TL1 A;  3WEE B;  4LFB K;  3HK2 A;  4GMJ B;  4CEA A;  3U9D A;  5CHI A;  1VQ8 N;  2G8K A;  1LW2 A;  5EXW A;  3DLR A;  3EKS A;  4H5W A;  4K43 A;  2F9T A;  2YKN A;  4NLC A;  3SBG A;  3HPH A;  4JLH A;  3QIO A;  3O9S A;  1IJJ A;  4BRH A;  3T3F A;  4H0X B;  3R9P A;  2GUP A;  1S6Q A;  3C7N B;  5FPN A;  3VTH A;  2Q2R A;  4I2P A;  1HMV A;  3U3G A;  3WNF A;  3CPW M;  4DLG A;  1FKO A;  3J80 O;  4KB0 A;  4JKD A;  3WNG A;  3LDN A;  4H5N A;  3DWL A;  3VEW A;  1XI1 A;  4FWN A;  1C1C A;  1L3T A;  1BG3 A;  2NZT A;  1VQ7 N;  2GWJ A;  1RTI A;  4IOX A;  1TK8 A;  4KHN A;  2P51 A;  1N32 K;  3ATU A;  1TL3 A;  2JLE A;  4I2Q A;  4DV1 K;  4K42 A;  4PKI A;  4CJ7 A;  4FLU A;  3DXK A;  1C0F A;  4JN4 A;  4CFC A;  1TVR A;  4A57 A;  1K9M O;  1LV5 A;  1VSK A;  2GUI A;  3CCM N;  5ADX H;  3NH1 A;  4JV5 K;  3VMF B;  4KHP K;  2P9L A;  3NHG A;  2OTL N;  2IGI A;  2Y1I A;  3THW A;  4FJ9 A;  3NGZ A;  4CF8 A;  3PUF A;  4CBU A;  3KVG A;  1TUY A;  3SMS A;  1P8Z A;  3A5N C;  3DAW A;  4AM7 A;  2PFU A;  5AQG A;  3IRX A;  2XY6 A;  2FC0 A;  3LDS A;  4B1U B;  3QBW A;  1EWR A;  1BWF O;  3HM9 A;  1T05 A;  1IG8 A;  4WQ4 C;  3ZSR A;  3RVC A;  4YDU A;  4R5P A;  3OTO K;  4ZHR A;  4QOZ B;  4KPY A;  1KLM A;  3FR0 A;  4CEC A;  4JKC A;  4LC9 B;  3MEG A;  3C94 A;  2Q0U A;  4IO9 L;  4CF9 A;  3TI0 A;  5LJW A;  3ZX0 A;  3O8M A;  4WF9 L;  3ENB A;  4CEZ A;  1X9J A;  3S3N A;  4OPJ A;  3FZM A;  3ULD A;  2I7P A;  1WUA A;  3OYE A;  2QK9 A;  4JKE A;  1HR0 K;  2BDP A;  5C10 A;  4DTU A;  4XIU A;  4AHS A;  4QAG A;  4B9N A;  3D7E O;  1KRP A;  1X9W A;  4WFB L;  5AQO A;  1X3M A;  4RW4 A;  3OY9 A;  5LL6 Z;  4AHU A;  2E1Y A;  3HXM A;  5AZI A;  3D2F A;  1KVC A;  4BR2 A;  3AVK A;  3A5O C;  4BQZ A;  3A8Y A;  5GIN A;  2WON A;  5F0X A;  4QCL A;  1VSJ A;  4BAC A;  3A5M C;  4CZE A;  5BR9 A;  5ADX A;  3WUH A;  1RBV A;  4B9V A;  3MED A;  3KLF A;  3AA2 A;  1NNE A;  1TK5 A;  4XH4 A;  1NLV A;  4TSX A;  4MFB A;  3VEX A;  4Q0B A;  2D0A A;  4BRM A;  1NK9 A;  1GOA A;  3MEE A;  4BR7 A;  3G25 A;  3P39 A;  3L2R A;  2BAN A;  4FVM A;  4CHP A;  4JK7 A;  3SBT A;  4FJM A;  1RT1 A;  1SKR A;  1VRU A;  3L3U A;  4RWT A;  4PA1 A;  4RTF D;  4IFE A;  3P4I A;  2E2O A;  3CF5 L;  1GLJ O;  3AVG A;  1KFS A;  3WXK A;  4E7L A;  1BCM A;  4CIG A;  1VQN N;  3K59 A;  3MXJ A;  3QO9 A;  4FZY A;  4J2B A;  2KZM A;  4BE2 A;  3GOI A;  4AH9 A;  5KGW A;  3OHR A;  4GW6 A;  2I5J A;  4JKH A;  4KH4 A;  4KV8 A;  5C2F A;  3MDQ A;  1QTM A;  1KAX A;  4O8K A;  4CGF A;  3VF2 A;  2WTU A;  1BI4 B;  3VQE A;  4CF0 A;  2GEL A;  4QS9 A;  1NWK A;  2P9N B;  2ZD1 A;  1HPM A;  1P90 A;  3CFR A;  3NBP A;  1C0G A;  3JXU A;  3ZEU A;  4B9T A;  4EAH D;  4A61 A;  1C1A A;  4I9L A;  3QEX A;  3QBX A;  1RIL A;  1KXP A;  2OPS A;  2ZJP L;  1JLF A;  4J8F A;  4Z4I A;  3J81 O;  3AO5 A;  2F96 A;  2FF3 B;  1U47 A;  3G0Z A;  3O9T A;  3M3Z A;  3VEV A;  4E7K A;  3FFK B;  4CIF A;  4JK8 A;  1BA1 A;  4JI8 K;  1VQ9 N;  4B8C A;  4DSF A;  1MA9 B;  4JI3 K;  4KTQ A;  3KK7 A;  3TU5 A;  4BRL A;  5C42 A;  5KTQ A;  4OLA A;  4DSK A;  3CJ1 A;  2W00 A;  2HBM A;  2OAN A;  3O80 A;  3HOS A;  4CZM A;  1NJI O;  4B1Y B;  3HSC A;  4CEQ A;  1T03 A;  3NVK A;  5J2Q A;  2ETJ A;  4O44 A;  2P5O A;  3LDL A;  4FK2 A;  2KKZ A;  5HLF A;  3FLC O;  4FJI A;  3SQ0 A;  1JXB A;  1YVN A;  3SMP A;  1T44 A;  3ZT1 A;  4FJX A;  3ZT0 A;  4BRN A;  2XO7 A;  3DLK A;  2F4V K;  2H3G X;  5AQV A;  1BCO A;  1SQK A;  1J5O A;  1YXQ A;  3EE9 A;  2LSN A;  1NM1 A;  2OTJ N;  4DU4 A;  1SL2 A;  4PUO A;  3VN5 A;  4E1J A;  4BWJ A;  4DSJ A;  1KAY A;  4CD1 A;  4FWM A;  3O3G A;  3G6E N;  3CHW A;  4B3O A;  3NGI A;  1K8A O;  3AVI A;  3L0Q A;  1EP4 A;  3RRG A;  1HKC A;  1VSL A;  1QE1 A;  4EP4 A;  3KLG A;  3TAP A;  3K0S A;  1NJW A;  1V4T A;  1ZBS A;  4CZL A;  1NG9 A;  2HHI A;  4A2A A;  4QS8 A;  3QEV A;  3QML A;  3NDK A;  3AVA A;  2IVN A;  1Q9Y A;  3DOL A;  3H3N O;  3VQP A;  4AHR A;  3QEP A;  4O0J A;  3MAQ A;  1VSH A;  1D5A A;  3AGK A;  2P9K A;  3O9R A;  5J2M A;  3NVM A;  3CCU N;  3L8B A;  4DR2 K;  4KTZ A;  1XNQ K;  5JLF A;  1S3X A;  4M3X A;  2F9W A;  1S22 A;  4JKB A;  1BI4 A;  3A5L C;  2O4I A;  2UUC K;  2AJQ A;  4EHT A;  4LF4 K;  3DOK A;  2VYP A;  4B9U A;  5KPZ A;  4MO4 A;  3UKR B;  1S1T A;  2QWM A;  1W0H A;  3GL1 A;  1RTJ A;  3AVB A;  3EL2 A;  3PX6 A;  2O8C B;  4CHO A;  1RTD A;  3VQ4 A;  4DS4 A;  3CCQ N;  4CZF A;  3GG4 A;  3R1X A;  2P9S B;  1E4G T;  1VQ5 N;  4C8N A;  1WSJ A;  1UA0 A;  1BA0 A;  4UQG A;  4DR1 K;  1BUP A;  3CJB A;  3KTQ A;  1YJN N;  1DKG D;  3QES A;  1UAX A;  2E4L A;  2ZF5 O;  3VGL A;  1J54 A;  3LDQ A;  2GX9 A;  1RDA A;  2VWJ A;  4JNE A;  4G1Q A;  3VER A;  1VSF A;  2QWL A;  2VCP A;  4C23 A;  1KTQ A;  4K8X A;  2D5R A;  4DFM A;  1S1X A;  1IBK K;  1XMQ K;  5KQ8 A;  3EKU A;  1WSE A;  4HTU A;  4IJN A;  3VQB A;  4AHC A;  1M90 O;  3HVT A;  1EKE A;  4DSL A;  2WC9 A;  5AQX A;  3UKU A;  5HRO A;  5SWM A;  4LY7 A;  2D1K A;  2HHH K;  3ULE A;  1B92 A;  3TSU A;  3E9P A;  2PY5 A;  4IEE A;  3QEI A;  3TAE A;  2G8I A;  3KD5 E;  2YHW A;  5K14 A;  4N47 A;  2CGJ A;  2A5X A;  3C65 A;  3A2F A;  3CFP A;  3KLI A;  4KHW A;  3THY B;  3LL3 A;  2IDO A;  4PY5 A;  2HVI A;  3DMJ A;  3C0B A;  1RDD A;  4ZTJ A;  3ZX2 A;  5FPM A;  5AQL A;  3E01 A;  3RSE B;  2EHG A;  4PL7 A;  4FWO A;  4Z4E A;  3THV A;  1U2V B;  1M1K O;  1NK7 A;  1YUW A;  1B9F A;  4DR6 K;  3R8E A;  2W6L A;  3M8P A;  1C0U A;  2ITM A;  4JRP A;  4WE1 A;  1YT3 A;  2V7Y A;  5CE3 A;  1Q9X A;  2C1I A;  4M3W A;  4LF5 K;  3C6H A;  3BEX A;  4WYB A;  4KH6 A;  3ZSO A;  3QIN A;  3K57 A;  1H1V A;  3R6M A;  4OPK A;  4H03 B;  4MLE A;  5EX5 A;  2QKK A;  3NF7 A;  1VSM A;  4FJK A;  2YHX A;  3TAB A;  2D0O A;  2RE2 A;  5F2R A;  3JS6 A;  4H0Y B;  4IDH A;  3LPU A;  3L2Q A;  1TKX A;  4Y1D A;  1DTT A;  3NCI A;  4BDY A;  5DK5 A;  2P9U B;  3UKR A;  3CCJ N;  4I6M A;  5I9E B;  5HRS A;  4Z4C A;  4BC4 A;  5C0Y A;  2X74 A;  4FW1 A;  3MXI A;  2DPN A;  2ZJQ L;  2P9S A;  3SV4 A;  4CHQ A;  4FWK A;  3EZ5 A;  5AQF A;  3UB5 A;  5DM6 L;  3AAR A;  3NF6 A;  1TAQ A;  2FLO A;  5E41 A;  1N33 K;  3AO3 A;  4CJK A;  1TV6 A;  1YTU A;  1XQS C;  2ZJR L;  1UWB A;  1NKC A;  1L3U A;  2QEX N;  1LAV A;  1TGO A;  1QQM A;  4GVE A;  1ZXO A;  5BRF A;  4JKG A;  2WBN A;  1K6Y A;  4ILG B;  2HMI A;  1TKD A;  3OYK A;  1U45 A;  1YHQ N;  4QS7 A;  1QSY A;  1NOZ A;  1QQC A;  5DM7 L;  2E88 A;  2V52 B;  1VQP N;  4Y1C A;  3SLC A;  2YHA A;  4CJW A;  5SZT A;  1WSI A;  1NMD A;  5HRN A;  3WQU A;  3CJA A;  4BY9 C;  3AA3 A;  4DSI A;  4CJ3 A;  3F73 A;  4LF9 K;  1RT6 A;  2HND A;  2O8E A;  5C2D A;  4NB4 A;  4FVU A;  4CJQ A;  1HUX A;  3VQ8 A;  4MO5 A;  3OJS A;  4M42 A;  3GE1 A;  4DLE A;  2YHB A;  3V9S A;  3V1Q A;  1KVB A;  2DY4 A;  1RDW X;  3AVN A;  1QHT A;  1W97 L;  4CEE A;  5HOO A;  1HNV A;  4IOC L;  4B8A B;  3AVC A;  5FLX O;  4CHY A;  1J6Z A;  4GNI A;  4LH5 A;  1X9M A;  3J7A P;  2NRR A;  1K8K B;  2G8V A;  4FWQ A;  3SI6 A;  3P38 A;  1OH6 A;  1I94 K;  2RHK A;  4OKE A;  2Z1H A;  2BTF A;  5AFU A;  4JRQ A;  3CYM A;  1KCF A;  4ID1 A;  3SK3 A;  1BQM A;  2A41 A;  3AY9 A;  1KC8 O;  2IVO A;  1QVF M;  4RW6 A;  4BG8 A;  2O4G A;  2ASM A;  2QM1 A;  4UY8 O;  1Q86 O;  1SL1 A;  3SUP A;  1Q7Y O;  2NLX A;  4L3Q A;  2G8F A;  5AQY A;  1O13 A;  3QDK A;  1Q81 O;  2WOM A;  5JS2 A;  2F8S A;  4DQP A;  4M3R A;  3N4P A;  1HQU A;  3AVF A;  3K2P A;  1YI2 N;  4OO1 J;  3LP0 A;  2E6L A;  3EZW A;  4CW7 B;  1GLF O;  3F9M A;  2QKB A;  5B8H A;  2A3Z A;  5GIP A;  4WQ5 C;  4HTL A;  4O8U A;  4CBX A;  3DYA A;  4YDU C;  4W5R A;  1IO2 A;  4CER A;  4AHV A;  5H1S Q;  1S9E A;  2FBT A;  1QZ6 A;  3ZSW A;  4DR7 K;  4FJ8 A;  3CM5 A;  5CYM A;  4JI7 K;  4NO7 A;  3NF8 A;  4B3M K;  3P31 A;  1GLB G;  3AO4 A;  4ISE A;  1NJX A;  3IKM A;  2Q36 A;  4BDP A;  3V9X A;  1DT9 A;  4A5B A;  5AR0 A;  4JI4 K;  3SNN A;  1GLL O;  4FLV A;  3B6O A;  3KJV A;  3RRH A;  1Y64 A;  3VEN A;  2O8D A;  3DLL L;  4FPB A;  2HBL A;  2V51 B;  3MN9 A;  1EO1 A;  4M41 A;  5AQK A;  3HL8 A;  3CFO A;  4E1M A;  2QW9 A;  4K41 A;  4OPH A;  3QIP A;  1BGX T;  5J2P A;  3HST B;  2ASP A;  3MN7 A;  1DEJ A;  5KRS A;  4LSL A;  3F9K A;  2IC3 A;  2HF3 A;  2HHS A;  5M1F A;  2YHY A;  2VWK A;  4H0T B;  2HW3 A;  1U4B A;  4A5A A;  4BEB A;  1T6C A;  4OVL A;  4AHT A;  3CCE N;  2P9I A;  3I0R A;  2O8B B;  2BE2 A;  3SYZ A;  4OX9 K;  2X6S A;  1K73 O;  1QHA A;  5J1E A;  3OBY A;  1UOC A;  3CQ8 A;  4F9O A;  4FK0 A;  3WQT A;  4E3S A;  3V1R A;  3BDP A;  3KIO A;  3DRP A;  3RR7 A;  3WEE A;  4E19 A;  4DB3 A;  3UE5 A;  1NGF A;  4OKJ A;  4BGB A;  4KHQ A;  5AQW A;  1KSP A;  3Q7C A;  4WCE L;  3ZCM A;  3M8R A;  1K8K A;  1NJY A;  2QWP A;  1S9G A;  3PLA A;  1JLC A;  1W7A A;  3BZK A;  4M3Y A;  2B6A A;  3SQ4 A;  1WB9 A;  3THX B;  4DTX A;  3C7N A;  3ZSQ A;  4ELV A;  3VQD A;  1CXU A;  3O9U A;  5FDL A;  3HJF A;  1HYZ A;  4CVN E;  4KHS A;  3KWI A;  2P1J A;  2E1Z A;  2HHU A;  5AQJ A;  5KGX A;  4CJS A;  4MDB A;  1E3M A;  3W0L A;  1XUP O;  1T6D A;  4DQ8 A;  3ENH A;  3L2V A;  3TAG A;  4BRG A;  1LCU A;  4ELU A;  3CER A;  3NH0 A;  4OKK A;  1A5X A;  4GV9 A;  3NFA A;  4FW2 A;  1ASV A;  3MWT A;  3SUO A;  4CZK A;  4IKF A;  1WOQ A; 
#chains in the Genus database with same CATH homology
 2WUS A;  4XH1 A;  5EVZ A;  3VF4 A;  2QI2 A;  4G9Z A;  4XJX A;  2CGL A;  3LM9 A;  3OBW A;  5FPD A;  4EHT A;  5GAH P;  1S72 N;  2A40 A;  5E26 A;  1NGD A;  4BRA A;  4A2B A;  1BOT O;  2HOE A;  2VYP A;  3DXK B;  4B1V A;  5KPZ A;  4PL8 A;  4MO4 A;  3UKR B;  3LDP A;  4ILH A;  5EOY A;  2QWM A;  2Q97 A;  3GL1 A;  3ID8 A;  3EL2 A;  3E9L A;  3G71 N;  3FGU A;  1BU6 O;  4FWR A;  3ZEU B;  3D2E A;  4KH5 A;  3ID6 A;  3DXM A;  3G4S N;  3CCQ N;  4CZF A;  5JVG L;  3GG4 A;  4CD3 A;  3R1X A;  2HBK A;  2P9S B;  1E4G T;  4CI6 A;  4IZ9 A;  2JWL A;  1VQ5 N;  5CR4 A;  4ILJ A;  3BUZ B;  1SAZ A;  3BF1 A;  1BA0 A;  2BUP A;  5MLC Q;  2BH1 A;  1SS6 A;  1BUP A;  5AQQ A;  3CJB A;  1YJN N;  1DKG D;  3T69 A;  3CJC A;  3H1V X;  3VGL A;  2ZF5 O;  2PAV A;  4HWI A;  1YJW N;  3H46 O;  5AQT A;  3LDQ A;  4BGA A;  5BRH A;  3HZ6 A;  5AFU H;  4WQ5 A;  2GX9 A;  3MWP A;  4JNE A;  4BRD A;  2AA4 A;  2D4W A;  2QWL A;  3H1Q A;  2J4R A;  3VER A;  2FF6 A;  2VCP A;  3MN6 A;  4DKW A;  4C23 A;  3IUC A;  5GAE P;  4U7B A;  3CXC M;  2E2Q A;  5AQM A;  1HJO A;  3HTV A;  4M7X A;  4H5R A;  4FL9 A;  1NGI A;  3NMU A;  2CH5 A;  5JMV A;  5KQ8 A;  3AAQ A;  3TPQ A;  4GV3 A;  5BPL A;  3EKU A;  3QB0 A;  4JHD B;  2HBJ A;  4JK9 A;  4BR5 A;  2ZGY A;  2KHO A;  4IJN A;  3QFP A;  4O5F A;  4CZH A;  3OA9 A;  1JJ2 M;  3ENO A;  3U9Z A;  3SAH A;  5AQR A;  1M90 O;  2P9P A;  4WQ4 A;  1VQK N;  4H0P A;  3EE8 A;  4FO0 A;  1TUU A;  3O5B A;  2WC9 A;  5AQX A;  3UKU A;  3R3L A;  1NGJ A;  2D1K A;  4PHT X;  1CZA N;  4M7Y A;  1SZ2 A;  3ULE A;  1W2B M;  4JAX A;  2P9I B;  2E20 A;  4DCH A;  5M1K A;  3TSU A;  3WXJ A;  3CMA N;  3E9P A;  5AQN A;  4IEE A;  2YI1 A;  3VGM A;  4BRK A;  5AQS A;  2NRX A;  2F7T A;  1MWM A;  3IDH A;  3TTF A;  1TYQ A;  3CD6 N;  3IFR A;  2YHW A;  4BQL A;  4B1Z A;  4IJA A;  2CGJ A;  3E1Y A;  2A5X A;  3C65 A;  3QIC A;  2VWB A;  1Z05 A;  4BR9 A;  5LY3 A;  3HBT A;  5AQI A;  3U4L A;  2QXL A;  3S41 A;  3VEY A;  2ASO A;  5EY4 A;  3CJ7 A;  5TKW A;  1VQ4 N;  5JLH A;  3WEE B;  1XC3 A;  1RFQ A;  3LL3 A;  5AQP A;  2V7Z A;  3LDO A;  3GBT A;  3C0B A;  3U9D A;  2KLA A;  4FOI A;  4CZJ A;  3I33 A;  5CHI A;  3CC4 N;  1VQ8 N;  3CCL N;  3ZX2 A;  1HKB A;  5EXW A;  5AQL A;  5FPM A;  3RSE B;  3EKS A;  3O6W A;  4H5W A;  4PL7 A;  4FWO A;  2FSN A;  1OKJ A;  3MK6 A;  4K43 A;  2F9T A;  4B1W B;  1U2V B;  1M1K O;  2I7N A;  4NLC A;  1YUW A;  3SBG A;  5F1X A;  3PIP L;  3N4Q A;  3O9S A;  3O4W A;  3R8E A;  1IJJ A;  1QQO A;  5KPR A;  2CGK A;  1Q18 A;  5M1Q A;  2ITM A;  4WFA L;  4BRH A;  1T3V A;  2V7Y A;  4H0X B;  2GUP A;  3CQY A;  3R9P A;  5CE3 A;  2C1I A;  4BRE A;  3C7N B;  5FPN A;  3VTH A;  5E84 A;  2WFB A;  3C6H A;  3BEX A;  2Q0R A;  2Q2R A;  4KH6 A;  4WYB A;  3CPW M;  2NRV A;  2NRZ A;  3O9Q A;  4R79 A;  4XH5 A;  1H1V A;  1NGE A;  4JKD A;  3MX2 A;  3LDN A;  4H5N A;  3DWL A;  3WXL A;  3VEW A;  3R6M A;  5KQD A;  4FWN A;  4H03 B;  3TTC A;  1BG3 A;  1ATS A;  2P9K B;  3F5T A;  2E2P A;  2NZT A;  4IWV A;  4MLE A;  5EX5 A;  1VQ7 N;  4MLH A;  2GWJ A;  2QTD A;  2P9N A;  4IOX A;  2VGN A;  4CZG A;  4EHU A;  3ATU A;  2YHX A;  5JVH L;  3BF3 A;  2D0O A;  2GWK A;  2RE2 A;  5F2R A;  3JS6 A;  3QFU A;  4H0Y B;  4IDH A;  3HI0 A;  4K42 A;  4PKI A;  3C6A A;  4YOX A;  4CJ7 A;  3IMX A;  1NGH A;  4BRO A;  3DXK A;  5BN8 A;  2EWS A;  1C0F A;  3KWG A;  2NNW A;  4JN4 A;  1LOT B;  2P9U B;  5AQH A;  3UKR A;  4A57 A;  1K9M O;  3CCM N;  1VQ6 N;  3CCJ N;  4I6M A;  4CBW A;  4BRC A;  5ADX H;  5I9E B;  3MX5 A;  3VMF B;  2P9L A;  3O08 A;  3W3D A;  4AM6 A;  4BC4 A;  5C0Y A;  2OTL N;  3H45 C;  3CJ9 A;  4Z94 A;  2Q1N A;  5AQU A;  2DPN A;  4U67 L;  1U6Z A;  2NRW A;  4A59 A;  2ZJQ L;  2P9S A;  4Y0W A;  3PIO L;  1YAG A;  4FWK A;  3CI5 A;  4CBU A;  3KVG A;  1TUY A;  3SMS A;  1P8Z A;  3A5N C;  5AQF A;  3UB5 A;  5DM6 L;  4YOW A;  3DAW A;  3VET A;  4AM7 A;  2PFU A;  3AAR A;  4JD2 B;  5AQG A;  2FLO A;  4EFH A;  2C1G A;  2ZGZ A;  4YOU A;  5LJV A;  3D2E B;  4BC2 A;  4B1U B;  4BR0 A;  3QBW A;  3M5R A;  4C1N I;  3CME N;  1BWF O;  5BPM A;  3CC2 N;  1IG8 A;  4WQ4 C;  3CCS N;  1HLU A;  3K9J A;  3RVC A;  4FSV A;  4YDU A;  1XQS C;  3SJH A;  5AQZ A;  2ZJR L;  2QEX N;  3FR0 A;  5AZJ B;  1VQM N;  2UYT A;  4JKC A;  4LC9 B;  1QQM A;  4GVE A;  1G99 A;  1ZXO A;  4WFN L;  5BRF A;  4JKG A;  3CCR N;  2Q0U A;  2WBN A;  4IO9 L;  3E66 A;  5LJW A;  5GAD P;  3ZX0 A;  4ILG B;  3O8M A;  4WF9 L;  3ENB A;  1NGG A;  1X9J A;  1YHQ N;  4QS7 A;  4JHD A;  3H3O B;  3SAF A;  3FZM A;  4FPA A;  5KPT A;  5DM7 L;  5M1O A;  2E88 A;  2I7P A;  4YOY A;  1WUA A;  1JCG A;  3L4I A;  2V52 B;  4JKE A;  5C10 A;  1VQP N;  3SLC A;  4ISF A;  3B8A X;  5TKY A;  1NMD A;  3D7E O;  3WQU A;  3CJA A;  4BY9 C;  1V4S A;  1NBW A;  3HRG A;  5AQO A;  4WFB L;  4IOA L;  1X3M A;  1OVY A;  3GDQ A;  3VTI A;  4PKG A;  5C2D A;  2E1Y A;  3HM8 A;  4NB4 A;  5AZI A;  4B1X B;  3D2F A;  5HL7 L;  2YX6 A;  4KBO A;  4JEP A;  4FVU A;  4BR2 A;  4BVO A;  3A5O C;  4BQZ A;  3FE1 A;  1HUX A;  3A8Y A;  5GIN A;  4M63 C;  4MO5 A;  3UKU B;  5F0X A;  1YJ9 N;  4C1N K;  3GE1 A;  2A42 A;  3VOV A;  1YIT N;  3MMV A;  1RDW X;  2A6A A;  3A5M C;  4FOE A;  4CZE A;  3ULE B;  5BR9 A;  5ADX A;  3WUH A;  2IIR A;  1W97 L;  2FSJ A;  4BRP A;  2AP1 A;  5HOO A;  4IOC L;  3HOT A;  2GEM A;  4XH4 A;  3VGK A;  1J6Z A;  4GNI A;  3T7Z A;  2PBD A;  1MWK A;  1NLV A;  1VQO N;  3VEX A;  2NRR A;  1HX1 A;  4BRM A;  5BRE A;  1K8K B;  1ILY A;  3CPE A;  2NRT A;  4FWQ A;  3F2K A;  1QVG M;  3P38 A;  4BR7 A;  3CQX A;  3G25 A;  3P39 A;  3ZET B;  1KQS M;  3AAP A;  1NGB A;  2RHK A;  5M1P A;  2BTF A;  4JK7 A;  5AFU A;  1QQN A;  3SBT A;  4YOT A;  1Q82 O;  3SK3 A;  2A41 A;  3ATV A;  4XEI A;  4RWT A;  3AY9 A;  1KC8 O;  2IVO A;  2FXU A;  1QVF M;  4RTF D;  4BG8 A;  4IFE A;  3P4I A;  2ASM A;  1RGI A;  2E2O A;  2QM1 A;  1KAZ A;  4OPA A;  3CF5 L;  4UY8 O;  1GLJ O;  3FZF A;  1Q86 O;  4A62 A;  1Q7Y O;  2NLX A;  4L3Q A;  4DHY A;  3WXK A;  3M6G A;  5AQY A;  1O13 A;  3QDK A;  1Q81 O;  3VPZ A;  4CZI A;  1VQN N;  1VQL N;  3I8B A;  3N4P A;  3GOI A;  1GLA G;  4H5T A;  5C12 A;  3OHR A;  3CC7 N;  4JKH A;  4KH4 A;  5C2F A;  1YI2 N;  3EZW A;  3MDQ A;  1GLF O;  1KAX A;  2YJE A;  3F9M A;  4IO8 A;  4O8K A;  1DGK N;  5B8H A;  3I55 N;  3VF2 A;  2A3Z A;  5GIP A;  4WQ5 C;  3KHY A;  4HTL A;  4O8U A;  4RCH A;  4CBX A;  4YOR A;  2GEL A;  3FZH A;  3L4Q A;  3CET A;  4QS9 A;  1NWK A;  2P9N B;  4YDU C;  4BRI A;  2QWR A;  1HPM A;  1P90 A;  4PKH A;  2NRH A;  5H1S Q;  4BVP A;  1C0G A;  3JXU A;  3ZEU A;  3ZX3 A;  1QZ6 A;  4BG9 A;  4EIA A;  3ZYY X;  4BC3 A;  2GTD A;  2E8A A;  4A61 A;  4EAH D;  3QBX A;  1KXP A;  2ZJP L;  2HST A;  3DJC A;  4H0V B;  4J8F A;  2FSK A;  2VGM A;  2FF3 B;  4NO7 A;  3WT0 A;  3P31 A;  4I6M B;  3E9O A;  3DXM B;  2P9L B;  1GLB G;  4ISE A;  4JD2 A;  2QA4 N;  3O9T A;  3O1W A;  3M3Z A;  3VEV A;  3I56 N;  4B9Q A;  3IKM A;  2Q36 A;  3VF6 A;  1N8R O;  2IVP A;  3FFK B;  3BP8 A;  1DT9 A;  4A5B A;  5AR0 A;  4FWL A;  4FWS A;  3TSP A;  4BRQ A;  5BPN A;  2HF4 A;  4JK8 A;  1GLL O;  1BA1 A;  4AF1 A;  1VQ9 N;  1Y64 A;  3VEN A;  4BRF A;  5AZJ A;  4IXC A;  3DLL L;  1MA9 B;  3J8A A;  4FPB A;  2HBL A;  2V51 B;  3KK7 A;  3MN9 A;  3Q7B A;  1EO1 A;  5AQK A;  3TU5 A;  1YF5 L;  1RDU A;  1X3N A;  4BRL A;  3K9K A;  4NLB A;  2QW9 A;  3EN9 A;  3WXM B;  4K41 A;  4OPH A;  3J7Z O;  5FPE A;  2ASP A;  3CJ1 A;  2W00 A;  2HBM A;  2OAN A;  1ATN A;  2E2N A;  3CIP A;  3SAG A;  1Z6R A;  3MN7 A;  1DEJ A;  1BO5 O;  3O80 A;  3VES A;  4CZM A;  3HOS A;  4JKA A;  1NJI O;  4OO1 J;  4H5V A;  4B1Y B;  3OW2 M;  2HF3 A;  3M1F A;  3HSC A;  4JKG B;  5M1F A;  4BEC A;  1GLE G;  2YHY A;  4H0T B;  3NVK A;  2JWK A;  1R59 O;  3U8X A;  1MDU B;  2QWN A;  4A5A A;  3LDL A;  4BEB A;  2KKZ A;  3FLC O;  1T6C A;  1ZC6 A;  5C15 A;  1YVN A;  2P9P B;  1JCF A;  3SMP A;  2P9I A;  1T44 A;  3TTD A;  4YOV A;  4MDA A;  1KD1 O;  3CCE N;  4BE7 B;  2W41 A;  5BRD A;  4BRN A;  1HKG A;  2H3G X;  1K73 O;  1QHA A;  3LM2 A;  5AQV A;  2YCH A;  1YIJ N;  2HMP A;  1EQY A;  3OBY A;  1SQK A;  4F9O A;  2QWQ A;  1YXQ A;  3EE9 A;  1GLD G;  3WQT A;  3MCA B;  1NM1 A;  2OTJ N;  5AZI B;  3KZB A;  3D2F B;  3VEO A;  4E1J A;  3WEE A;  1KAY A;  4BC5 A;  3AGR A;  1VAZ A;  4CD1 A;  4FWM A;  4DB3 A;  1TYQ B;  3UE5 A;  3G6E N;  1NGF A;  3CHW A;  4BGB A;  1K8A O;  4JKF A;  5JIC A;  3RSE A;  5AQW A;  3L0Q A;  5ELZ A;  2W40 A;  1HKC A;  3Q7C A;  3WXI A;  4WCE L;  1K8K A;  1U2V A;  2QWP A;  2QWO A;  3PLA A;  3VEZ A;  4GY2 B;  3ZET A;  5GIO A;  1JCE A;  2YJF A;  2ZWH A;  3L6Q A;  1V4T A;  1ZBS A;  4CZL A;  2D0P A;  4A2A A;  3C7N A;  4QS8 A;  3TSQ A;  1ATR A;  3QML A;  4FWP A;  3MCP A;  5GAG P;  2IVN A;  1E4F T;  3H3N O;  1BDG A;  3O9U A;  4H0O A;  5BN9 A;  1GLC G;  4IEI A;  3FZK A;  3KWI A;  3AGK A;  2E1Z A;  5AQJ A;  2P9K A;  3FZL A;  1NGA A;  4MDB A;  3O9R A;  4GV6 A;  3W0L A;  1XUP O;  1T6D A;  2CH6 A;  3NVM A;  3CCU N;  4K25 A;  4DQ8 A;  1QZ5 A;  5M1N A;  3ENH A;  4ISG A;  4BRG A;  1LCU A;  1D4X A;  3CCV N;  3CER A;  3D6R A;  5JLF A;  3H6E A;  1S3X A;  4GV9 A;  2F9W A;  1ESV A;  1S22 A;  3EO3 A;  2Q31 A;  3MWT A;  3O1B A;  3MN5 A;  1NGC A;  4JKB A;  3A0I X;  4BR4 A;  3A5L C;  4CZK A;  2P9U A;  1WOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...