4JD2A

Crystal structure of bos taurus arp2/3 complex binding with mus musculus gmf
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
414
structure length
398
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-related protein 3
publication title Structural basis for regulation of Arp2/3 complex by GMF.
pubmed doi rcsb
total genus 124
structure length 398
sequence length 414
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jd2A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jd2A02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4jd2A03
3R6MA 3DXKA 5FPEA 3QFUA 4B1ZA 1BA0A 1Z05A 1Y64A 3L4IA 3GOIA 2FF6A 2FSJA 2YJFA 5EVZA 3D2EB 3ZETA 3VESA 3MN6A 4H0VB 4J8FA 2E2OA 1GLLO 4C23A 5TKYA 1KAZA 5JLHA 3CJAA 1X3NA 1XUPO 4M7XA 5AR0A 3H3NO 5JMVA 4BVOA 1HJOA 3BF3A 5BRDA 1T44A 2V51B 3IFRA 1D4XA 2CH5A 4MLEA 5ELZA 4CZFA 1V4SA 2YI1A 4MLHA 3ATVA 2WUSA 4NO7A 3CQXA 4XEIA 3BUZB 1K8KB 1S3XA 3VETA 4JD2B 3S41A 3FZLA 3WQTA 4CZEA 1X3MA 4BGAA 2F9WA 4PKHA 2P9PA 3MCPA 3A5OC 5EOYA 1ATSA 3HI0A 2P9KB 4JAXA 5EY4A 1GLBG 1YXQA 2QWQA 1JCGA 2P9UA 1NGJA 1E4FT 2I7NA 3ENOA 3EKSA 2CGJA 1U2VB 5AQNA 1Q18A 3IDHA 4B1UB 4CBXA 4ISGA 4K42A 3ZETB 3CJ7A 1ESVA 4YDUA 4CBUA 1QQMA 5BPNA 3A5LC 1ATNA 1SAZA 5AZIA 4B1WB 1BUPA 2E2QA 1S22A 4JHDB 5EXWA 3H45C 4AM7A 4BRHA 4GY2B 4H5RA 1DEJA 3DXMB 1BO5O 2VWBA 4QS7A 2HF4A 2Q1NA 3DAWA 3KHYA 4CD3A 5AQHA 2E8AA 3MMVA 3ULEB 1P8ZA 5F1XA 3QBWA 4EHUA 3LL3A 1J6ZA 2E88A 3CJBA 1LOTB 3DJCA 1C0GA 3A5NC 5AQWA 4BR4A 4BRGA 3ATUA 3GE1A 3KZBA 2P9UB 2QWRA 3VEVA 1CZAN 3WQUA 2Q31A 4EFHA 1ZBSA 4BRCA 5AQRA 2NLXA 3IUCA 1QZ5A 1MDUB 5JLFA 5AZIB 4FWQA 5FPMA 3OHRA 4IJNA 3UKUA 4WQ4C 4H5WA 3U9ZA 4MO4A 3SJHA 1YUWA 4CZHA 4BRLA 4IJAA 4Z94A 4QS8A 3CJ1A 2GELA 1XQSC 2HF3A 1HKCA 5FPNA 2Q36A 5KPZA 3LDOA 1GLCG 4AM6A 3EZWA 4LC9B 2IIRA 1XC3A 4FPAA 3WXIA 4PL8A 3W0LA 3C7NA 3UKRB 3QDKA 4CZIA 2A41A 3WT0A 3H3OB 5AQXA 1QHAA 3HM8A 4IO8A 3LDLA 5AQIA 1IJJA 4CZGA 1ATRA 3ID8A 2FXUA 3G25A 3UB5A 1LCUA 2YHYA 2D1KA 3CHWA 3RSEB 3LDPA 4H5NA 2IVPA 5AQKA 1T6DA 3ZEUB 4H0TB 4H5VA 5JICA 2Q0RA 3AAPA 2P9IA 3EN9A 5LJWA 3TPQA 3L0QA 3CERA 2GUPA 4BRAA 5FPDA 5LY3A 3P4IA 4BRMA 1HKGA 1QQNA 1YAGA 3CJ9A 1SQKA 5AQTA 3B8AX 5BR9A 1NGIA 4DB3A 3WEEB 1MWMA 5AQGA 3WUHA 2E1ZA 2QXLA 2ITMA 3D7EO 2P9SB 3AAQA 4H0XB 2Q97A 5AQLA 2F9TA 4BGBA 3DXKB 1C0FA 3I33A 5AQJA 3CI5A 3D2FA 4FSVA 3LDNA 4XH5A 3GBTA 3EKUA 3SMPA 1SZ2A 4HWIA 4B9QA 3O8MA 1GLAG 3H1QA 2FLOA 5AQFA 1HPMA 3VF6A 3WXKA 2FSKA 4BQZA 2E2NA 4BRKA 3FZHA 4BR9A 3VOVA 4A61A 4H0YB 1EQYA 4K41A 4E1JA 1BDGA 2BTFA 2QWNA 4M7YA 4I6MA 3VEZA 4XH4A 4PKIA 5BRFA 4FL9A 2UYTA 3O1WA 5BPLA 3BEXA 4H0OA 4DQ8A 3AARA 5E84A 3SLCA 2ZWHA 2D4WA 3CIPA 2A40A 2IVNA 3O6WA 4A2BA 2QW9A 4CI6A 4FWMA 5BN9A 2KHOA 1HKBA 1TYQA 1JCFA 1KAXA 1RDWX 2BUPA 4KBOA 3FZFA 4A62A 5AQSA 3H6EA 2A6AA 3LM2A 4FWNA 2P9PB 3HBTA 4BR7A 3U4LA 1NGCA 3FGUA 4BRDA 3L6QA 3R9PA 1NGGA 1NGEA 2NRHA 5LJVA 3M1FA 4K25A 1GLEG 3O80A 3O4WA 3QB0A 4JN4A 4BRPA 4EIAA 3A8YA 2GWJA 1HUXA 1NGFA 3QBXA 3WXLA 4H03B 4BR2A 1QQOA 4BVPA 3QMLA 1KAYA 4IXCA 3MDQA 3R8EA 5BN8A 2A42A 2A3ZA 3VF2A 2ASMA 2QWMA 4FWRA 4FOEA 4FWKA 2A5XA 2E20A 5AQVA 1WOQA 2PAVA 1NWKA 4FWOA 2Q0UA 3H46O 5AQOA 3O5BA 3VENA 5BREA 1G99A 1NMDA 3O1BA 5F0XA 3IMXA 4NB4A 5B8HA 4WYBA 3A5MC 5KPTA 3A0IX 2E2PA 4B1YB 2VYPA 5EX5A 3I8BA 1ZXOA 3HSCA 1TYQB 3VF4A 4CZKA 2GTDA 4DHYA 4A2AA 3ZX2A 2ZGYA 3LM9A 5CE3A 1K8KA 3SK3A 4ISFA 2OANA 4O5FA 3CETA 5AFUH 5AQYA 3HZ6A 5I9EB 3JXUA 2P9NA 3EL2A 4O8KA 3KVGA 3MN9A 2AP1A 4IZ9A 4RCHA 5BRHA 1BA1A 3VERA 2P9KA 2FF3B 1H1VA 3AY9A 4XH1A 1GLDG 3H1VX 2J4RA 3M6GA 3UE5A 3VEOA 4B1VA 3FFKB 3GDQA 1X9JA 1T6CA 2QWOA 4CZLA 3FLCO 2EWSA 4BRQA 1U2VA 5AFUA 4PKGA 2VCPA 2NZTA 4F9OA 3W3DA 3BP8A 4WQ5C 1V4TA 2QM1A 1MWKA 3FZMA 3UKUB 4BQLA 2CGLA 4CJ7A 1RFQA 3U8XA 1Z6RA 2E1YA 2QWPA 5AQZA 4FWLA 2W41A 2FSNA 4JHDA 3SMSA 3CJCA 4BREA 1BOTO 2H3GX 3DXMA 4CBWA 2I7PA 4M63C 3ULEA 3VPZA 1BU6O 4BRFA 4FWSA 2DPNA 2Q2RA 4WQ4A 3GL1A 3C7NB 2P9NB 5KQDA 2ZGZA 1YVNA 1BWFO 1HX1A 4BROA 1NGHA 2YCHA 1NGAA 2D0PA 4GNIA 3VEWA 4BRNA 4FWPA 1GLJO 4H5TA 2HOEA 4EAHD 3QICA 3GG4A 1TUYA 2P9IB 2V7YA 1OKJA 3VEXA 3ZX3A 3FR0A 1DKGD 4JNEA 5AZJA 5AQQA 4BG9A 1QZ6A 1E4GT 3FZKA 4FPBA 4B1XB 4ISEA 2QWLA 3MN7A 1RGIA 4PL7A 3DWLA 4BC4A 4QS9A 3J8AA 3VGKA 2GEMA 2P9LA 2V52B 4EHTA 2W40A 1NLVA 1ZC6A 2CH6A 2HMPA 4K43A 2YHXA 1KXPA 3D2FB 5KQ8A 2CGKA 4WQ5A 1R59O 5BPMA 2ZF5O 3VGLA 3ENHA 3ZX0A 2YHWA 3HTVA 4MO5A 4BR0A 3QFPA 2ASOA 1MA9B 2ASPA 3JS6A 4FO0A 4BR5A 3WXJA 5KPRA 3D2EA 3EO3A 4CZMA 4Y0WA 2V7ZA 3UKRA 4I6MB 5AQPA 4BC3A 1IG8A 2GWKA 3O08A 3U9DA 5ADXH 4BC2A 1U6ZA 2AA4A 3RSEA 5AZJB 5AQMA 2IVOA 4IWVA 3ZEUA 3M3ZA 4DCHA 3F9MA 1GLFO 1JCEA 4CD1A 3BF1A 4RTFD 1HLUA 3C0BA 1NGDA 2P9LB 4BRIA 2PBDA 1WUAA 3FE1A 4BG8A 1DGKN 3VGMA 4JD2A 4RWTA 4BC5A 5E26A 3MN5A 4YDUC 3TU5A 3WEEA 5ADXA 1NGBA 5F2RA 1BG3A 4H0PA 5AQUA 1NM1A 4HTLA 2D0OA 3CQYA 2YJEA 3LDQA 3VEYA 2P9SA 3MK6A 4CZJA 4L3QA 4FOIA 1NBWA 1TUUA
chains in the Genus database with same CATH superfamily
4MQ3A 5FPEA 3QFUA 3H08A 4I2QA 1BA0A 3ENBA 3L4IA 4K0KK 2YJFA 1N34K 3D2EB 4N41A 1NOZA 4J8FA 1X3NA 1XUPO 1LWCA 1QHTA 3H3NO 4TSXA 4KHWA 1EWRA 4CERA 4CJRA 1BCOA 3IFRA 4AF1A 1D4XA 5ELZA 3ATVA 1KD1O 3OTOK 3BUZB 4NXMK 1NMNA 4JD2B 1VQ8N 4CZEA 3OYGA 1X3MA 4B8AB 2QA4N 3RRGA 2P9PA 2UXBK 3MCPA 3ZSXA 4LY7A 2P9KB 1GLBG 3VA3A 2DY4A 3J7ZO 1I39A 4FJNA 5HRNA 1E4FT 2XY6A 3EKSA 4CEDA 4B9TA 2CGJA 1U2VB 4B1UB 4FJXA 4ISGA 3OBYA 3ZETB 1DT9A 1HQEA 3D0PA 3P38A 3KK2A 4F3OA 1JLAA 4CBUA 4CGJA 3OS0A 4ID5A 2D0BA 3O9UA 1SAZA 1YTAA 1BUPA 3MXIA 3LZJA 4FK2A 3A2FA 3K5NA 2G8HA 4JHDB 3PX0A 3LDSA 3H45C 3NH1A 4DTPA 4KHNA 4GY2B 4OLBA 4DR3K 1Y97A 1GOAA 3C95A 4AHVA 2Q1NA 2F7TA 5AQHA 3NH0A 3LWLA 2XHBA 5F1XA 4LD0A 1LAWA 4EHUA 2O8FB 4GV6A 4OGEA 1J6ZA 2VQFK 2HNDA 1BL3A 3CJBA 3KD1E 4YORA 4FJKA 4JLHA 4GKJK 4QCLA 4IFEA 4FW1A 5AQWA 4BR4A 1R0AA 4FLWA 3R3LA 1HNIA 3VEVA 3WQUA 3DLGA 3F73A 1NK4A 5DM7L 1NKBA 2RPIA 4BRCA 3O3GA 4CIFA 4B9NA 4B9LA 1VSKA 4CHPA 4CGFA 1IKVA 4KFBA 1E3MA 4F2SA 2GX9A 5FPMA 5GAEP 3P1GA 4DV7K 4FJMA 1JLQA 3M8PA 1M1KO 3DLKA 4I2PA 3J81O 4Z0UA 3SJHA 4CZHA 4IJAA 4JK9A 1HYSA 4Z94A 2YHBA 4WFNL 4QS8A 3LAKA 4Q5VA 3DLLL 1L3UA 3TABA 4FJJA 5T7BA 4Z4HA 5FPNA 2Q36A 1RT5A 2NRVA 4LC9B 3QEVA 1RTHA 5J2NA 4FPAA 4CJSA 3CCEN 4E3SA 3C7NA 3UKRB 1QVGM 4MDAA 4CZIA 3H3OB 3MX5A 4IO8A 4AHTA 1IJJA 4N5SA 2HHWA 3QINA 4LF6K 3RSEB 3CHWA 4IEEA 3L2WA 2C1IA 4DUYK 3OY9A 1T6DA 1WSIA 2FBTA 2RKIA 4H0TB 3AA2A 2P9IA 3LP3A 1RCHA 3TPQA 4QAGA 3SJJA 4BRAA 5FPDA 4HUFA 5LY3A 2QKBA 4BRMA 4AHCA 3CMEN 3G6EN 4C8MA 1CXQA 1KVCA 3IRXA 4OKKA 1TL1A 1NOYA 4JS4A 4A57A 4H0XB 4LF4K 1S1WA 1UA1A 2VQEK 2FC0A 3CI5A 3CQ8A 3LDNA 3GBTA 1SZ2A 1L5UA 3OYCA 3C6TA 1IBMK 5CY4A 3V9ZA 2F8SA 2P5GA 4BQZA 1A5VA 2E2NA 1TV6A 1JJ2M 4YFUA 3SUPA 5GADP 4PKIA 5BRFA 2UYTA 3DLRA 3ZLJA 3TR8A 3QEIA 2YNGA 5BPLA 3BEXA 4H0OA 4KV8A 3SLCA 4A2BA 4IDHA 2A40A 4CGIA 5I3UA 3C94A 3S5TA 3OYIA 1VSLA 3TSQA 3BDPA 3THWB 1JCFA 1KAXA 1EKEA 1SKRA 3LM2A 1OH6A 3THXB 2ZQBA 1JL2A 3SPZA 4BR7A 4CE9A 4KAZA 4KI4A 4E7KA 4BRDA 3R9PA 4CF2A 4DSEA 1ASVA 1NGGA 2NRHA 4K25A 3O4WA 1BIZA 2ATQA 4HCBA 3A8YA 2GWJA 3CCQN 4BR2A 5TKWA 3QMLA 3MDQA 3R8EA 4ELVA 4H4MA 4MFBA 2QWMA 5H1SQ 4FWRA 1NJZA 1RILA 1VQNN 3CCLN 1HNWK 2E20A 1ZYQA 1NWKA 3AO3A 2OPPA 2HMIA 1RDBA 1C6VA 1NMDA 4WYBA 1SS6A 1G15A 4KTZA 4B1YB 2HHUA 2VYPA 1LW2A 4ZHRA 4CZKA 1ZXOA 1TYQB 2GTDA 4DHYA 2Y1JA 4A2AA 2WFBA 1FW6A 1S6PA 2ZGYA 1EO1A 1VSJA 4O5FA 2OANA 5AFUH 3TAQA 3N4PA 4C8OA 5DMRA 3JXUA 4YOYA 1IV0A 4DV4K 2O8BB 4JKHA 3LAMA 4DR1K 3V4IA 2P9KA 2FF3B 3AY9A 2HBJA 4AQYK 2GV9A 2J4RA 3UE5A 3VEOA 4K8XA 3FFKB 4KB0A 3KK1A 3AA3A 3LP2A 4FJLA 1X9JA 3HRGA 5IWAK 1U2VA 5AFUA 2VCPA 5JS2A 4N47A 5C15A 1QSSA 1V4TA 1MWKA 3FZMA 1RT1A 1LW0A 2FBYA 4I7FA 3VQAA 1S6QA 4CJ7A 1X1PA 5AQZA 4FWLA 4JI0K 4JHDA 1BOTO 3CG7A 1JL1A 2H3GX 3I0RA 2I7PA 2Z1GA 3DMJA 3VPZA 4FWSA 2Q2RA 4DU3A 2ZJRL 4WQ4A 3E9OA 2O8FA 3SQ1A 4DSJA 2P9NB 2ZGZA 5J1EA 1YVNA 1HX1A 2HNYA 1U47A 1NGHA 4CHQA 1VQMN 1D8YA 1NGAA 5CR4A 4GNIA 3MX2A 4OGCA 2IGIA 4H5TA 4EAHD 4BWMA 1QE1A 1QS4A 1NJIO 4HVJA 4R79A 3VEXA 3ZX3A 3FR0A 5C12A 4BG9A 3FZKA 1T8EA 3VQ6A 3Q7BA 3VTIA 3RMAA 2QWLA 2QXFA 1IKYA 3AVMA 5MLCQ 3ZSWA 1W2BM 4FJ9A 2QI2A 3CYGA 3WXMB 1TKTA 4XIUA 2P9LA 3CC4N 1HMVA 4EHTA 4DS5A 2D0CA 1N5YA 3ZSRA 4U7BA 3KJVA 3D2FB 5KQ8A 4WQ5A 2HVHA 3NF8A 3VGLA 3ENHA 4B9UA 2OPRA 3AA4A 1VQ4N 1B92A 4BR0A 1D9DA 4DQIA 4JI4K 3WXJA 4CZMA 1T7PA 1VQPN 3UKRA 4I6MB 2DTUA 5AQPA 2GWKA 3I55N 3OJUA 3O08A 4WFBL 4MDBA 3S3OA 3RSEA 5AZJB 2GBZA 1W0HA 4IWVA 3LPUA 3M3ZA 4DV1K 3PSIA 4RW9A 1WNSA 4LSNA 3L2QA 3HOTA 2YKMA 1FKOA 2E6MA 1YVUA 4E7JA 3FE1A 4YOWA 4CJVA 2O8EA 1KLNA 4H0PA 5AQUA 4HTLA 4CZJA 3SQ4A 1WBBA 3SNNA 1O13A 1TUUA 2P5OA 5FDLA 3G71N 3TAEA 2FF6A 5EVZA 2HB5A 2OYQA 3HPGA 4EP4A 1ITGA 1YT3A 2ITGA 2VGNA 3SUOA 4C23A 4DWIA 1KAZA 5JLHA 1N32K 4M7XA 4ILGB 5AR0A 3HP6A 4BY9C 3P39A 3BF3A 3LP1A 3TSPA 4FJIA 5FRNA 4MLEA 4NYFA 4MLHA 2WUSA 3CQXA 4XEIA 1I3AA 1K8KB 1C0UA 1QQCA 3TARA 3KIOA 3VETA 3WQTA 3FZLA 3NGZA 3U6FA 4BGAA 3U3YA 1RBUA 1UWBA 3A5OC 5EOYA 1T03A 5HL7L 2D5RA 1LWFA 3VQ5A 3O9TA 5LL6Z 3AGRA 5AQNA 3IDHA 3CJ7A 4KHQA 4KHYA 4KH4A 3NAEA 1KVBA 2HW3A 1VRTA 5AZIA 2E2QA 3LPTA 1IH7A 3VN5A 2B5JA 4AM7A 4BRHA 3V9XA 2NUBA 4B3TK 4H5RA 4CIGA 4JS5A 3DXMB 1BO5O 4QS7A 4JEPA 4CD3A 3KHYA 4O0JA 3HVTA 3MMVA 3ULEB 4FK0A 4GVMA 1S1VA 3SAFA 1RTJA 3DLEA 3V9WA 3NFAA 1XWLA 2E88A 4KO0A 3QEXA 4M3TA 4LF5K 4DTJA 3GE1A 3KZBA 2P9UB 3T69A 1HNXK 2O8BA 4EFHA 4YOVA 3K2PA 2O8CB 1VSFA 1YJNN 5C2FA 5AQRA 3V1OA 1BCMA 4CGDA 1NK5A 4CEZA 1MDUB 1S1XA 4GVEA 2KZZA 1RBVA 3SZ2A 3T1HK 3MWTA 1HNVA 4X66K 4H5WA 4CESA 1S9EA 5IT9O 1U4BA 4MO4A 1UOCA 3VQPA 3KTQA 2HHIA 1ASWA 3CJ1A 2GELA 2HF3A 1HKCA 1JXBA 4BDZA 1L3TA 1XC3A 3WXIA 3W0LA 5A2QO 1TK8A 3QDKA 5M1OA 2A41A 3WT0A 5AQXA 3MXMA 1QHAA 3HM8A 4C1NK 4RW8A 4B3MK 3ID8A 2FXUA 1LCUA 2D1KA 3LDPA 4YOXA 3IKMA 4H5NA 4H5VA 1EX4A 1VHXA 3CERA 3PY8A 3PUFA 4NCGA 3NVKA 2KW4A 4ZTJA 2X6NA 1OH5A 3CJ9A 1JLCA 1SQKA 3B8AX 5BR9A 3DRPA 4FM0A 5M1NA 4B9SA 3BGRA 4Z4EA 4X65K 3PIOL 2E1ZA 2QXLA 3S9HA 2ETJA 1FJGK 4BE0A 2Q97A 5AQLA 3DXKB 3I33A 3M5RA 4E72A 1RTIA 4IOXA 4BEBA 3D2FA 4FSVA 4HWIA 3CXCM 1LV5A 4B9QA 1GLAG 2DFHA 3OYHA 3H1QA 4DR2K 5AQFA 1J5OA 1HPMA 1NK9A 3WXKA 4RW6A 4YHHK 4CVNE 4DR7K 3K0SA 3AVGA 3KLGA 3VOVA 3TAPA 4A61A 4LF8K 2OA8A 1EQYA 2QWNA 4I6MA 1EETA 1TGOA 1N6QA 5GAHP 4M42A 3DRSA 5E84A 3CIPA 4PA1A 2QW9A 1RT3A 5BN9A 1X9MA 3EY1A 4WE1A 2IAJA 1HKBA 3NHGA 4JI3K 1RDWX 4KBOA 2YV0X 5AQSA 4CJWA 1TKZA 1Q82O 4N56A 4DQSA 2BDPA 2OZSA 3SBGA 3B6OA 3LP0A 1NGCA 1A5WA 3L6QA 3OA9A 3KLEA 1VSHA 1NGEA 4CK3A 1GLEG 3T1YK 3O80A 3QB0A 4BRPA 4EIAA 3P83D 3QBXA 4O44A 3K9KA 1C1CA 4F8RA 4H03B 5FRMA 1K73O 5HRSA 2WTUA 1QQOA 4B8CA 4BVPA 3NGIA 1KAYA 3S3MA 4EZ6A 1YJWN 1KQSM 3TAMA 4R5PA 4JKFA 4FJGA 2ASMA 4FOEA 3T3FA 4FWKA 5AQVA 2PY5A 2PAVA 5FROA 4RW7A 4CJ5A 1YHQN 5AQOA 4KTWA 3G0ZA 4CECA 5JVHL 4LF9K 1XC9A 1NG9A 1TKDA 4CK1A 3IMXA 3PSFA 5B8HA 2G8UA 4ILHA 3A5MC 3C6UA 5KPTA 2E2PA 3NCIA 3CFPA 3HSCA 3M8RA 2G8VA 3HSTB 1Q9YA 3ZX2A 3CCMN 4FVMA 1Q8IA 2O4GA 1QTMA 4X64K 1K8KA 4OX9K 3SK3A 3CETA 4NYNA 4J2DA 4BACA 4B08A 3O4NA 3MAQA 3EL2A 4M3XA 1LAVA 4O8KA 3MN9A 3QIPA 2AP1A 4IZ9A 4RCHA 4A59A 1BA1A 5BRHA 3VERA 4OJRA 1H1VA 3CPEA 1W97L 3M6GA 4DTSA 3BY5A 3GDQA 5C10A 3AVAA 3OYKA 1T6CA 2QWOA 2RN2A 4JI8K 2EWSA 3MECA 2NRZA 3ISNC 4KHSA 3BP8A 3UKUB 3L2VA 3RMCA 1FK9A 4BWJA 4ELTA 1ILYA 1IBLK 3LWMA 3QESA 1RDAA 1C1AA 2QWPA 1KFDA 2FSNA 4DTMA 3CJCA 4JKGB 4OPHA 3V81A 3CM6A 3NMUA 1DLOA 3CCUN 3B6PA 3DXMA 3O3FA 4M63C 3AVHA 4KRFA 3ULEA 1YJ9N 3K5OA 3GL1A 1OH8A 3BZCA 4QOZB 4BROA 3L8BA 2D0PA 3AVLA 4H8KA 1CLQA 1VSMA 1SL1A 2HOEA 5SWMA 3CCSN 3C6HA 3GG4A 1OKJA 1VSEA 4B3OA 3L3UA 3SV3A 4W5TA 1DKGD 1HYVA 1VQ7N 1E4GT 4DFKA 4K8ZA 3M8SA 3WNFA 3I56N 4ISEA 4M3RA 3MN7A 2PYJA 1RBRA 3DWLA 4CEEA 3ZSQA 3J8AA 1NNEA 2V52B 1RT6A 1ZC6A 2OPQA 1KXPA 4HCCA 2CGKA 2E5LK 3PO5A 3LZIA 3V1RA 3FFIA 1BI4B 1S9GA 4LSLA 4MO5A 4CK2A 1Q86O 1JLBA 1MA9B 2ASPA 4FO0A 5M1FA 5KPRA 2F4VK 3D2EA 3HT3A 2YNIA 2V7ZA 2WONA 3OS1A 4BC3A 5SZTA 4C8KA 5ADXH 4BC2A 3P5JA 1U6ZA 4FYDA 4CHOA 5CYMA 2IVOA 1XHXA 4DU4A 1JCEA 4CD1A 2Q3SA 1HLUA 4KH6A 4CGGA 1BHLA 2G8FA 2VG5A 3C0BA 2WOMA 1WUAA 4DSFA 2QKKA 4BG8A 3VGMA 4JD2A 1FKPA 4Z4CA 3SQ0A 4BC5A 4YDUC 4DV2K 4A5BA 2GUIA 5ADXA 2OCEA 4DFJA 3SAGA 1BG3A 3SUQA 2ZM6K 2D0OA 4JKAA 3ZSYA 4FOIA 1NBWA 4HUGA 4JYAK 1HRHA 2KZMA 5C2DA 3DXKA 4JK8A 4HHTA 1HQUA 3VTHA 3NGYA 5KRSA 4DTUA 3Q7CA 5GIOA 3ZETA 3VESA 4H0VB 5HRPA 2XO7A 4M41A 2E2OA 1QSYA 1GLLO 3HJFA 1NU0A 4JI5K 4W5RA 4DLEA 5JMVA 4FM1A 3KKRA 3OJSA 5BRDA 1T44A 2VG7A 3TTDA 3HO1A 2CH5A 2KTQA 1V4SA 1KRPA 4NO7A 3VQ4A 3AO2A 4DR4K 1S3XA 4DUZK 3HXMA 3T7ZA 3S41A 1NK0A 3NF6A 1WSFA 2F9WA 3MEGA 1YTUA 3AO1A 4O5BA 4PY5A 4JAXA 1JXEA 4CF1A 3CPWM 4V19S 1OH7A 1YXQA 2QWQA 3HPHA 1JCGA 1Z25A 2JGUA 4E89A 3ENOA 4GMJB 4KKOA 4CJTA 4WF9L 3QO9A 1Q18A 4CBXA 1ZBFA 1ESVA 1RDDA 4DTOA 1BQMA 3TTFA 5GAGP 3A5LC 5J2PA 2QTDA 1ATNA 2F8TA 1RDCA 4E0DA 4L8RB 3RRHA 1K6YA 4KHPK 1KLMA 4HUEA 1J53A 2HF4A 3AVJA 3DAWA 5AJ3K 3G10A 3RTVA 3TANA 2OZMA 3OVNA 4E1NA 4NCBA 3DJCA 1RT2A 2KLAA 3A5NC 1WB9A 3ATUA 2RHKA 3RMBA 1IO2A 1A5XA 1CZAN 2Q31A 4CEOA 4JKBA 5HP1A 1ZBSA 3ALYA 1TK5A 2YKNA 4OKEA 4CF9A 4ID1A 1HR0K 2P51A 2VWKA 3OBWA 3OHRA 3D45A 3UKUA 3ZT2A 4J2BA 3QEPA 4G9ZA 3JSMA 4WQ4C 3AVKA 1BIUA 3U9ZA 5JVGL 3N4QA 4LFCK 3V9SA 3DLHA 1GOBA 4JKGA 1KC8O 1XQSC 2Z1IA 3QERA 1EXQA 3KWIA 1IBKK 4ICLA 2W6LA 4AM6A 4IOAL 4KTQA 5K14A 4N76A 4C1NI 1S5JA 1RTDA 3G25A 3ZSVA 2YHYA 2Y1IA 3DOKA 1TAQA 2IVPA 5AQKA 2QK9A 2DFFA 4F4KA 1CXUA 1KTQA 3EN9A 5LJWA 3L0QA 2RE2A 2GUPA 4E7IA 2HHTA 2HBLA 3E9LA 3HK2A 4Z4IA 2UUBK 4FZYA 3P4IA 1QQNA 1YAGA 5AQTA 3THWA 1HNZK 2UXCK 4DB3A 3WEEB 3E1YA 3THXA 3CCJN 1TVRA 5LMNK 3D7EO 2HHVA 2E4LA 1WLJA 4E7LA 4WCEL 2F9TA 2A1SA 3CC2N 4J2EA 1C0FA 5JS1A 3RVCA 3DI6A 1B9FA 3OYEA 3AVFA 4CW7B 3KLIA 3AGKA 1BI4A 3ITHA 1WSGA 3O8MA 4M45A 2FLOA 2UUAK 3VF6A 3NE6A 4W5QA 3DRRA 3FZHA 4BR9A 5BR8K 1WN7A 4CF0A 3EEQA 4K41A 5J2MA 4M7YA 3DM2A 3PX6A 4XH4A 1NK7A 3O1WA 5M1KA 1S1TA 1WSJA 2ZWHA 1K8AO 1VK0A 2IVNA 4DKWA 2UXDK 2KKZA 1TYQA 5DM6L 2BGGA 1VQLN 4G1QA 4A62A 4CJPA 3H6EA 3SYZA 2A6AA 3HBTA 3KKSA 3U4LA 5C42A 1N33K 4FJ7A 3DLBA 2PYLA 3M1FA 4JK7A 4KB1A 1C0MA 4CFBA 4IXCA 2X78A 3P31A 3F2KA 2A42A 1JLEA 2BH1A 1NJXA 1REVA 2A5XA 4OPAA 4IFVA 1RT7A 4FW2A 1J54A 4FXDA 5KGXA 4GV9A 3SQ2A 1XMQK 1YI2N 2HHHK 3O9SA 3O5BA 3TAGA 4W5OA 2XRIA 1G99A 4NB4A 3E66A 2NRXA 3A0IX 3VQ7A 3VF4A 4IFYA 2WC9A 4DG1A 1CZBA 4JI2K 3RR7A 5CE3A 4ISFA 4O4GA 3F9KA 4CGHA 4UQGA 3PLAA 2OTLN 4CJEA 4PQUA 3J7YP 5I9EB 5KGWA 3SPYA 2P9NA 2P1JA 1T05A 1EP4A 2JLEA 5M1PA 1Q9XA 4IKFA 3BZKA 4DTRA 1VQ6N 4CZLA 3AO4A 3FLCO 4C8LA 3K59A 4BRQA 4M3WA 3E9PA 4PKGA 3ZSOA 4BDPA 1HYZA 2NZTA 4F9OA 1QSLA 2QM1A 4BQLA 1S1UA 1SL0A 1D5AA 2HHXA 3QEWA 2HHSA 3HM9A 3QNNA 3U8XA 3M8QA 4FLVA 3CFRA 4E19A 2QEXN 1Z6RA 4IBNA 4BREA 2W41A 5J2QA 1NKEA 3J80O 1OVYA 4CBWA 4LFAK 4BRFA 3VQBA 3WNHA 1XMOK 4CJ4A 3DYAA 4DFMA 2O8DB 1U49A 3R1XA 1VAZA 3NH2A 2FBXA 3L3VA 4NLBA 4M3UA 1WSEA 3VEWA 4BRNA 4FWPA 1GLJO 4KI6A 4DQQA 1TUYA 3T1AA 2V7YA 5GINA 4ILJA 4JNEA 5AZJA 1VSDA 2YHAA 4FJHA 2KFNA 1MU2A 1RGIA 4OPJA 3HVRA 4QS9A 4DF4A 3UIQA 3VGKA 2GEMA 3OYJA 3TSUA 2W40A 2HBKA 3AVBA 2HMPA 3T19A 2B6AA 2YHXA 3VQEA 2W00A 3MEEA 5BPMA 2A1RA 5KTQA 3HL8A 3ZX0A 4U67L 4CFDA 3QFPA 1C0TA 4IG0A 5DK5A 3QLHA 3NVMA 3VQ9A 3EO3A 4JI6K 3RR8A 4Y0WA 4O0IA 3KLFA 4Q0BA 1EWQA 4B9MA 4LH4A 3U9DA 4DV0K 2AA4A 2LSNA 4DV3K 2PFUA 4XJXA 4DSLA 4B3RK 1XNRK 4CFCA 1ZBIA 1P90A 3SUNA 4NLCA 3VQQA 4ZTFA 1KCFA 1TAUA 2P9LB 2ZJPL 2PBDA 3ZSZA 1DGKN 5C24A 4RWTA 3L2UA 3QETA 3WEEA 1SUQA 3TU5A 2BE2A 4CJ3A 4RW4A 1NGBA 5F2RA 1KVAA 4JV5K 2YX6A 1NM1A 3V6DA 3LDQA 4BE2A 4L3QA 1XI1A 3CF5L 2NRRA 3R6MA 4B1ZA 1X9WA 4Z4FA 4FVUA 1Z05A 1Y64A 3GOIA 2FSJA 3MEDA 3JAMO 1X9SA 3KK7A 3MN6A 3KD5E 3VQDA 4FLYA 2IC3A 3SBTA 4JRPA 3IS9A 5TKYA 5GIPA 3CJAA 5C0YA 4W5NA 4BVOA 5CHIA 1HJOA 3KWGA 3HYFA 5HBMA 2PZSA 2V51B 3OYDA 2JWLA 4CEQA 2YI1A 4CZFA 2W6KA 3OYLA 4CEAA 3WNEA 1VRUA 3SV4A 4IO9L 1TKXA 2ZE2A 3PIPL 3OYFA 4CEFA 4JKDA 4OLAA 2O8EB 4GV3A 4PKHA 2HSTA 1ATSA 3U3GA 3HI0A 3THYB 1XNQK 5EY4A 1WAJA 3TTCA 5HOOA 1IG9A 1BQNA 2P9UA 4OO1J 4FLTA 1NGJA 2I7NA 2O8CA 4DSKA 3K57A 4K42A 3OYBA 4FZXC 4YDUA 3IG1A 3DOLA 1UA0A 2E6LA 1QQMA 5BPNA 3RMDA 3C6AA 1SKWA 3TAFA 4B1WB 1ZBHA 1S22A 2OTJN 5EXWA 2YNHA 1DEJA 3ID6A 4LH5A 4YOTA 4Y1DA 2VWBA 2E8AA 1VQ5N 4F2RA 1P8ZA 3QBWA 4CHZA 2HHQA 2VGMA 1RBTA 2HNZA 3AV9A 4KREA 3LL3A 1WAFA 3EYZA 1QVFM 2WBNA 4OKJA 1LOTB 3ASMA 3SI6A 3L2RA 3ZT1A 1C0GA 3KK3A 4OPKA 4AHSA 4BRGA 1JKHA 1GOCA 2QWRA 4DLGA 3CYMA 4AH9A 5E41A 5HLFA 3MXJA 3AVIA 1SKSA 4JI1K 3K9JA 2XY5A 2NLXA 3IUCA 1VQON 1M90O 4HTUA 1QZ5A 5JLFA 3CCVN 2VWJA 5AZIB 4FWQA 1WSHA 4IJNA 1J9AA 4AHUA 2OPSA 1T3VA 3EE8A 2R7YA 5FLXO 3THVA 4KHUA 3LALA 2UU9K 1YUWA 4BRLA 3CC7N 3RWUA 5CZ1A 5KPZA 3LDOA 4CJFA 1GLCG 3SCXA 3EZWA 1LWEA 2IIRA 1N36K 4YOUA 1Q7YO 4PL8A 3NBPA 3ULDA 1Z26A 2O8DA 4A5AA 5AQIA 3LDLA 4BDYA 4CZGA 1ATRA 3UB5A 4J2AA 4JKCA 5M1QA 4CJQA 5LMUK 4M3YA 4B3SK 4FCYA 4EZ9A 1NJYA 3ZEUB 1W7AA 1U04A 2I5JA 3I0SA 5JICA 1L3SA 2Q0RA 3OYMA 3AAPA 5KRTA 5JENA 3CFOA 2ZD1A 3CM5A 4E7HA 1VQKN 1HKGA 3O3HA 1NGIA 3ZCMA 1MWMA 3OS2A 4JI7K 1S72N 4GW6A 4DTNA 5AQGA 3WUHA 2F96A 2ITMA 4I9QA 2P9SB 3ZT3A 3AAQA 4C8NA 3ZT0A 4BGBA 5AQJA 3NF9A 4BE1A 1BISA 1WBDA 3JYTA 4DS4A 4XH5A 3SMPA 3EKUA 4IG3A 3CD6N 1UAXA 4EP5A 3TWHA 4UY8O 2FSKA 1SL2A 2B4JA 4RG8A 4BRKA 4OVLA 2D0AA 2UUCK 4H0YB 4JRQA 4BE7B 4E1JA 1BDGA 2BTFA 3VEZA 2IDOA 4FL9A 4PUOA 4DTXA 2XY8A 1SV5A 1NKCA 3VMFB 3AARA 4DQ8A 2NRTA 1DTTA 1C1BA 2D4WA 3O6WA 4CI6A 4FWMA 1JLGA 2KHOA 2VG6A 5I42A 2IS3A 2BUPA 3FZFA 1RT4A 4CHYA 1NK8A 4FWNA 2P9PB 1N8RO 2KQ2A 2YNFA 3FGUA 4DU1A 3HPOA 5LJVA 1HPZA 1FXXA 4JN4A 4DF8A 1HUXA 1NGFA 3WXLA 3TI0A 4NXNK 4KH5A 3E01A 5D3GA 2KFZA 5BN8A 2A3ZA 3VF2A 1NJWA 4DSIA 2G8KA 4YNQA 1YF5L 1WOQA 2NNWA 3IAYA 3WNGA 4FWOA 2Q0UA 3H46O 1Q81O 3VENA 1ASUA 4FLUA 5BREA 4H4OA 3L4QA 3SAHA 3O1BA 5F0XA 3I8DA 3PX4A 4AHRA 3OYAA 1W9HA 5EX5A 3I8BA 2ZJQL 4F3TA 5EU7A 4GKKK 4O8UA 4DV5K 3O9QA 4WFAL 2DFEA 4CJKA 3V9UA 4LF7K 2EHGA 4BECA 3LM9A 4X62K 1IKXA 3K5LA 3F5TA 5AQYA 3HZ6A 4DQPA 5HRRA 3EZ5A 3KVGA 3VQ8A 4CJLA 4DFPA 1RBSA 4Z4GA 3THYA 1VSIA 4XH1A 1GLDG 3H1VX 3HOSA 4B1VA 4YY3K 1YITN 3CCRN 2Z1JA 1CZ9A 1RDUA 1TL3A 3HP9A 4CF8A 1KFSA 2X74A 3W3DA 4WQ5C 2W42A 2HBMA 3K5MA 2CGLA 3KLHA 4CHNA 3NF7A 4CCHA 4FM2A 1RFQA 2E1YA 3SMSA 2IOCA 1RNHA 1TK0A 2FBVA 3ZT4A 1XHZA 3CMAN 1BU6O 2BANA 4ELUA 2DPNA 3OYNA 3C7NB 3PO4A 4Y1CA 3LANA 5C25A 4CJUA 1VQ9N 5KQDA 1BWFO 3S3NA 1U48A 4FJ8A 2NRWA 2YCHA 3MWPA 1DTQA 2Z1HA 4FK4A 1F21A 1KSPA 4PWDA 3QICA 2P9IB 3V1QA 4FLZA 3MCAB 3VQCA 4DMNA 5AQQA 1QZ6A 3ZYYX 3QNOA 4FPBA 4B1XB 4FJ5A 4KPYA 4IEIA 1NK6A 3J7AP 3AO5A 3C65A 1K9MO 4B9VA 1D9FA 4PL7A 4CIEA 4BC4A 4JKEA 1IKWA 4O55A 4CEBA 1JLFA 1NLVA 2CH6A 2G8WA 4K43A 4DR6K 2O4IA 2C1GA 1ZBUA 4IDKA 1B9DA 1R59O 2ZF5O 5CZ2A 2HVIA 1BGXT 4DR5K 2YHWA 3HTVA 1U45A 2ASOA 3JS6A 4BR5A 3EE9A 4I9LA 2X6SA 5KI6A 3PV8A 4DQRA 1ZBLA 4E1MA 1IG8A 3O9RA 4LFBK 3G4SN 5AQMA 4DV6K 3OW2M 3ZEUA 4DCHA 3AVCA 3F9MA 4AILC 1GLFO 3AVNA 4M3ZA 1L3VA 5CYQA 3BF1A 4NCAA 2JWKA 1HJRA 4RTFD 4PHTX 3K58A 4FLXA 2RF2A 3AA5X 3NDKA 3QIOA 1I94K 1NGDA 3D6RA 4BRIA 2XY7A 2AJQA 5E26A 1OVQA 3MN5A 4FZZA 2G8IA 1O1WA 4CFAA 1J5EK 1YIJN 5HROA 3CQYA 2YJEA 3VEYA 3VA0A 2P9SA 3MK6A 3O4QA 4IOCL 2EX3A
chains in the Genus database with same CATH topology
3CF5L 2NRRA 3R6MA 3DXKA 4JK8A 3QFUA 5C2DA 4B1ZA 5FPEA 1BA0A 4FVUA 3ENBA 1Z05A 3G71N 1Y64A 3L4IA 3VTHA 3GOIA 2FF6A 2FSJA 2YJFA 5EVZA 3Q7CA 3D2EB 5GIOA 3ZETA 3VESA 3KK7A 3MN6A 4H0VB 4J8FA 2VGNA 3SBTA 2E2OA 1GLLO 4C23A 5TKYA 1KAZA 5JLHA 5GIPA 3CJAA 1X3NA 1XUPO 4ILGB 4M7XA 5AR0A 5C0YA 3H3NO 5JMVA 4BY9C 3P39A 4BVOA 5CHIA 1HJOA 3BF3A 3KWGA 5BRDA 1T44A 3TSPA 3TTDA 2V51B 3IFRA 4AF1A 1D4XA 2CH5A 4MLEA 5ELZA 2JWLA 4CZFA 1V4SA 2YI1A 4MLHA 3ATVA 1KD1O 2WUSA 4NO7A 3CQXA 4XEIA 3BUZB 1K8KB 1S3XA 4IO9L 5C15A 3VETA 4JD2B 3S41A 3FZLA 3T7ZA 3WQTA 3PIPL 4CZEA 1VQ8N 1X3MA 4BGAA 2F9WA 4JKDA 2QA4N 4GV3A 4PKHA 2P9PA 3MCPA 3A5OC 5EOYA 2HSTA 1ATSA 3HI0A 2P9KB 4JAXA 5EY4A 1GLBG 3CPWM 5HL7L 1YXQA 2QWQA 3J7ZO 3TTCA 5HOOA 4OO1J 1JCGA 2P9UA 3O9TA 1NGJA 1E4FT 2I7NA 3ENOA 3EKSA 2CGJA 4WF9L 1U2VB 3AGRA 5AQNA 1Q18A 3IDHA 4B1UB 4CBXA 4ISGA 3OBYA 4K42A 3ZETB 3CJ7A 1ESVA 1DT9A 4YDUA 3P38A 4KH4A 4CBUA 3TTFA 1QQMA 5GAGP 5BPNA 3A5LC 3O9UA 2QTDA 1ATNA 1SAZA 3C6AA 5AZIA 4B1WB 1BUPA 2E2QA 1S22A 2OTJN 4JHDB 5EXWA 3H45C 4AM7A 4BRHA 4GY2B 4H5RA 1DEJA 3ID6A 4YOTA 3DXMB 1BO5O 2VWBA 4JEPA 2HF4A 2Q1NA 3DAWA 2F7TA 3KHYA 4QS7A 5AQHA 2E8AA 4CD3A 1VQ5N 3MMVA 3ULEB 1P8ZA 5F1XA 3QBWA 2VGMA 4EHUA 3SAFA 4GV6A 3LL3A 1J6ZA 1QVFM 2E88A 2WBNA 3CJBA 1LOTB 3DJCA 4YORA 1C0GA 4IFEA 2KLAA 3A5NC 5AQWA 4BR4A 4BRGA 3R3LA 3ATUA 2RHKA 3GE1A 3KZBA 2P9UB 2QWRA 3T69A 1CZAN 3VEVA 2Q31A 3WQUA 4JKBA 4EFHA 1ZBSA 5DM7L 4YOVA 1YJNN 5C2FA 4BRCA 3K9JA 5AQRA 2NLXA 3IUCA 1VQON 1M90O 1QZ5A 1MDUB 4GVEA 5JLFA 3CCVN 2GX9A 5AZIB 4FWQA 3OBWA 5FPMA 3MWTA 5GAEP 3OHRA 4IJNA 3UKUA 4G9ZA 4WQ4C 1M1KO 4H5WA 1T3VA 3EE8A 3U9ZA 5JVGL 3N4QA 4MO4A 3SJHA 1YUWA 4CZHA 4BRLA 4IJAA 4JK9A 4Z94A 4WFNL 3DLLL 4QS8A 3CJ1A 4JKGA 2GELA 3CC7N 1KC8O 1XQSC 2HF3A 1HKCA 5FPNA 2Q36A 5KPZA 3LDOA 3KWIA 1GLCG 2NRVA 4AM6A 3EZWA 4LC9B 2IIRA 1XC3A 4IOAL 4YOUA 4FPAA 1Q7YO 3WXIA 3CCEN 4PL8A 3W0LA 3C7NA 3UKRB 1QVGM 4MDAA 3QDKA 5M1OA 2A41A 3WT0A 3H3OB 5AQXA 3MX5A 1QHAA 3HM8A 4IO8A 3LDLA 5AQIA 1IJJA 4A5AA 4C1NK 4CZGA 1ATRA 3ID8A 4C1NI 2FXUA 3G25A 3UB5A 1LCUA 2YHYA 4JKCA 5M1QA 2D1KA 3CHWA 4IEEA 3RSEB 3LDPA 4YOXA 2C1IA 3IKMA 2IVPA 4H5NA 1T6DA 5AQKA 3ZEUB 4H0TB 4H5VA 5JICA 2Q0RA 3AAPA 2P9IA 3EN9A 5LJWA 3TPQA 3L0QA 2RE2A 2GUPA 3CERA 4BRAA 5FPDA 2HBLA 3E9LA 3NVKA 5LY3A 1VQKN 3P4IA 4BRMA 1HKGA 1QQNA 1YAGA 3CJ9A 1SQKA 5AQTA 3B8AX 5BR9A 1NGIA 4DB3A 5M1NA 3WEEB 3G6EN 3CMEN 3E1YA 1MWMA 1S72N 3CCJN 5AQGA 3WUHA 2E1ZA 2QXLA 2ITMA 3PIOL 3D7EO 2P9SB 4A57A 3AAQA 4H0XB 2Q97A 5AQLA 2F9TA 4WCEL 3CC2N 4BGBA 3DXKB 1C0FA 3I33A 3M5RA 5AQJA 3CI5A 3RVCA 4IOXA 4BEBA 3D2FA 4FSVA 3LDNA 4XH5A 3GBTA 3EKUA 3SMPA 1SZ2A 4HWIA 3CXCM 4B9QA 3AGKA 3O8MA 3CD6N 1GLAG 3H1QA 2FLOA 5AQFA 4UY8O 1HPMA 3VF6A 3WXKA 2FSKA 4BQZA 2E2NA 4BRKA 3FZHA 4BR9A 3VOVA 1JJ2M 4A61A 4H0YB 1EQYA 4K41A 4E1JA 1BDGA 2BTFA 2QWNA 4M7YA 4I6MA 3VEZA 4BE7B 4XH4A 5GADP 4PKIA 4CZJA 5BRFA 4FL9A 2UYTA 4IOCL 5GAHP 3O1WA 5BPLA 3BEXA 4H0OA 5M1KA 3VMFB 3AARA 5E84A 4DQ8A 2NRTA 3SLCA 2ZWHA 2D4WA 3CIPA 2A40A 2IVNA 3O6WA 4IDHA 2QW9A 4A2BA 2KKZA 4FWMA 5BN9A 4CI6A 2KHOA 1HKBA 3TSQA 1TYQA 5DM6L 1VQLN 1JCFA 1KAXA 1RDWX 2BUPA 4KBOA 3FZFA 4A62A 5AQSA 3H6EA 2A6AA 3LM2A 4FWNA 2P9PB 1Q82O 1N8RO 3HBTA 4BR7A 3SBGA 3U4LA 1NGCA 3FGUA 4BRDA 3L6QA 3OA9A 3R9PA 1NGGA 1NGEA 2NRHA 5LJVA 3M1FA 4JK7A 4K25A 1GLEG 3O80A 3O4WA 3QB0A 4JN4A 4BRPA 4EIAA 3A8YA 2GWJA 1HUXA 3CCQN 1NGFA 3QBXA 3K9KA 3WXLA 4H03B 4KH5A 4BR2A 1K73O 5TKWA 1QQOA 4BVPA 3QMLA 1KAYA 4IXCA 3MDQA 3R8EA 3P31A 1YJWN 1KQSM 3F2KA 5BN8A 2A42A 2A3ZA 3VF2A 2BH1A 4JKFA 2ASMA 2QWMA 5H1SQ 4FWRA 4FOEA 4FWKA 1VQNN 3CCLN 2A5XA 2E20A 5AQVA 1YF5L 4OPAA 1WOQA 2NNWA 2PAVA 1NWKA 1K8AO 4FWOA 2Q0UA 3H46O 1YHQN 1Q81O 5AQOA 4GV9A 1YI2N 3O9SA 3O5BA 3VENA 5JVHL 5BREA 1G99A 3L4QA 1NMDA 3O1BA 5F0XA 3IMXA 4NB4A 5B8HA 4WYBA 1SS6A 3E66A 3A5MC 4ILHA 2NRXA 5KPTA 3A0IX 2E2PA 4B1YB 2VYPA 5EX5A 3I8BA 1ZXOA 3HSCA 1TYQB 3VF4A 4CZKA 2ZJQL 2GTDA 2WC9A 4DHYA 4O8UA 4A2AA 2WFBA 3O9QA 4WFAL 3ZX2A 3CCMN 4BECA 2ZGYA 3LM9A 5CE3A 1EO1A 1K8KA 3SK3A 4ISFA 2OANA 4O5FA 3CETA 5AFUH 3N4PA 3PLAA 3F5TA 2OTLN 5AQYA 3HZ6A 5I9EB 3JXUA 4YOYA 2P9NA 3EL2A 4O8KA 3KVGA 3MN9A 5M1PA 4JKHA 2AP1A 4IZ9A 4RCHA 4A59A 1BA1A 5BRHA 3VERA 2P9KA 2FF3B 1H1VA 3AY9A 3CPEA 4XH1A 1GLDG 2HBJA 3H1VX 1W97L 3HOSA 2J4RA 3M6GA 3UE5A 3VEOA 4B1VA 1YITN 3FFKB 1VQ6N 3GDQA 1X9JA 3HRGA 5C10A 3CCRN 1T6CA 2QWOA 4CZLA 3FLCO 2EWSA 1RDUA 4BRQA 1U2VA 2NRZA 3E9PA 4PKGA 5AFUA 2VCPA 2NZTA 4F9OA 3W3DA 3BP8A 4WQ5C 1V4TA 2HBMA 1MWKA 2QM1A 3FZMA 3UKUB 4BQLA 2CGLA 1ILYA 4CJ7A 1RFQA 3U8XA 2QEXN 1Z6RA 2E1YA 2QWPA 5AQZA 4FWLA 2W41A 2FSNA 4JHDA 3SMSA 3CJCA 4JKGB 4BREA 1BOTO 4OPHA 3NMUA 3CCUN 2H3GX 1OVYA 3DXMA 4CBWA 2I7PA 4M63C 3ULEA 3VPZA 1BU6O 4BRFA 3CMAN 1YJ9N 4FWSA 2DPNA 2Q2RA 2ZJRL 4WQ4A 3E9OA 3GL1A 3C7NB 1VQ9N 2P9NB 5KQDA 2ZGZA 1YVNA 1BWFO 1HX1A 4BROA 3R1XA 1VAZA 1NGHA 1VQMN 4NLBA 2NRWA 2YCHA 1NGAA 3MWPA 2D0PA 5CR4A 4GNIA 3MX2A 3VEWA 4BRNA 4FWPA 1GLJO 4H5TA 3SAHA 2HOEA 4EAHD 3CCSN 3C6HA 3QICA 3GG4A 1TUYA 2P9IB 1NJIO 2V7YA 1OKJA 4R79A 3VEXA 3ZX3A 3FR0A 3MCAB 1DKGD 5C12A 4ILJA 4JNEA 5AZJA 5GINA 5AQQA 4BG9A 1QZ6A 1VQ7N 1E4GT 3FZKA 3ZYYX 4FPBA 4B1XB 3I56N 4ISEA 4IEIA 3Q7BA 3VTIA 3C65A 2QWLA 1K9MO 3MN7A 1RGIA 4PL7A 5MLCQ 3DWLA 4BC4A 1W2BM 4QS9A 2QI2A 3J8AA 4JKEA 3WXMB 3VGKA 2GEMA 2P9LA 3CC4N 2V52B 3TSUA 4DKWA 4EHTA 2W40A 2HBKA 1NLVA 1ZC6A 2CH6A 2HMPA 4K43A 2YHXA 4U7BA 1KXPA 3D2FB 5KQ8A 2C1GA 2CGKA 2W00A 4WQ5A 1R59O 5BPMA 2ZF5O 3VGLA 3ENHA 3ZX0A 2YHWA 3HTVA 4U67L 1Q86O 4MO5A 1VQ4N 4BR0A 3QFPA 2ASOA 1MA9B 2ASPA 3JS6A 4FO0A 4BR5A 3EE9A 5M1FA 3NVMA 3WXJA 5KPRA 3D2EA 3EO3A 4CZMA 4Y0WA 1VQPN 2V7ZA 3UKRA 4I6MB 5AQPA 4BC3A 1IG8A 2GWKA 3I55N 3O9RA 3O08A 3U9DA 4WFBL 5ADXH 4MDBA 4BC2A 1U6ZA 3G4SN 2AA4A 3RSEA 5AZJB 2PFUA 5AQMA 4XJXA 3OW2M 2IVOA 4IWVA 3ZEUA 3M3ZA 4DCHA 3F9MA 1GLFO 1JCEA 4CD1A 3BF1A 2JWKA 1P90A 3HOTA 4RTFD 4NLCA 4PHTX 1HLUA 4KH6A 3C0BA 1NGDA 2P9LB 3D6RA 4BRIA 2PBDA 1WUAA 3FE1A 2ZJPL 4BG8A 1DGKN 3VGMA 4JD2A 4RWTA 4YOWA 4BC5A 5E26A 3MN5A 4YDUC 3TU5A 3WEEA 4A5BA 5ADXA 1NGBA 5F2RA 3SAGA 1BG3A 4H0PA 1YIJN 5AQUA 2YX6A 1NM1A 4HTLA 2D0OA 3CQYA 2YJEA 3LDQA 4JKAA 2P9SA 3MK6A 3VEYA 4CZIA 4L3QA 4FOIA 1NBWA 1O13A 1TUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6M A;  3DXK A;  5FPE A;  3QFU A;  4B1Z A;  1BA0 A;  1Z05 A;  1Y64 A;  3L4I A;  3GOI A;  2FF6 A;  2FSJ A;  2YJF A;  5EVZ A;  3D2E B;  3ZET A;  3VES A;  3MN6 A;  4H0V B;  4J8F A;  2E2O A;  1GLL O;  4C23 A;  5TKY A;  1KAZ A;  5JLH A;  3CJA A;  1X3N A;  1XUP O;  4M7X A;  5AR0 A;  3H3N O;  5JMV A;  4BVO A;  1HJO A;  3BF3 A;  5BRD A;  1T44 A;  2V51 B;  3IFR A;  1D4X A;  2CH5 A;  4MLE A;  5ELZ A;  4CZF A;  1V4S A;  2YI1 A;  4MLH A;  3ATV A;  2WUS A;  4NO7 A;  3CQX A;  4XEI A;  3BUZ B;  1K8K B;  1S3X A;  3VET A;  4JD2 B;  3S41 A;  3FZL A;  3WQT A;  4CZE A;  1X3M A;  4BGA A;  2F9W A;  4PKH A;  2P9P A;  3MCP A;  3A5O C;  5EOY A;  1ATS A;  3HI0 A;  2P9K B;  4JAX A;  5EY4 A;  1GLB G;  1YXQ A;  2QWQ A;  1JCG A;  2P9U A;  1NGJ A;  1E4F T;  2I7N A;  3ENO A;  3EKS A;  2CGJ A;  1U2V B;  5AQN A;  1Q18 A;  3IDH A;  4B1U B;  4CBX A;  4ISG A;  4K42 A;  3ZET B;  3CJ7 A;  1ESV A;  4YDU A;  4CBU A;  1QQM A;  5BPN A;  3A5L C;  1ATN A;  1SAZ A;  5AZI A;  4B1W B;  1BUP A;  2E2Q A;  1S22 A;  4JHD B;  5EXW A;  3H45 C;  4AM7 A;  4BRH A;  4GY2 B;  4H5R A;  1DEJ A;  3DXM B;  1BO5 O;  2VWB A;  4QS7 A;  2HF4 A;  2Q1N A;  3DAW A;  3KHY A;  4CD3 A;  5AQH A;  2E8A A;  3MMV A;  3ULE B;  1P8Z A;  5F1X A;  3QBW A;  4EHU A;  3LL3 A;  1J6Z A;  2E88 A;  3CJB A;  1LOT B;  3DJC A;  1C0G A;  3A5N C;  5AQW A;  4BR4 A;  4BRG A;  3ATU A;  3GE1 A;  3KZB A;  2P9U B;  2QWR A;  3VEV A;  1CZA N;  3WQU A;  2Q31 A;  4EFH A;  1ZBS A;  4BRC A;  5AQR A;  2NLX A;  3IUC A;  1QZ5 A;  1MDU B;  5JLF A;  5AZI B;  4FWQ A;  5FPM A;  3OHR A;  4IJN A;  3UKU A;  4WQ4 C;  4H5W A;  3U9Z A;  4MO4 A;  3SJH A;  1YUW A;  4CZH A;  4BRL A;  4IJA A;  4Z94 A;  4QS8 A;  3CJ1 A;  2GEL A;  1XQS C;  2HF3 A;  1HKC A;  5FPN A;  2Q36 A;  5KPZ A;  3LDO A;  1GLC G;  4AM6 A;  3EZW A;  4LC9 B;  2IIR A;  1XC3 A;  4FPA A;  3WXI A;  4PL8 A;  3W0L A;  3C7N A;  3UKR B;  3QDK A;  4CZI A;  2A41 A;  3WT0 A;  3H3O B;  5AQX A;  1QHA A;  3HM8 A;  4IO8 A;  3LDL A;  5AQI A;  1IJJ A;  4CZG A;  1ATR A;  3ID8 A;  2FXU A;  3G25 A;  3UB5 A;  1LCU A;  2YHY A;  2D1K A;  3CHW A;  3RSE B;  3LDP A;  4H5N A;  2IVP A;  5AQK A;  1T6D A;  3ZEU B;  4H0T B;  4H5V A;  5JIC A;  2Q0R A;  3AAP A;  2P9I A;  3EN9 A;  5LJW A;  3TPQ A;  3L0Q A;  3CER A;  2GUP A;  4BRA A;  5FPD A;  5LY3 A;  3P4I A;  4BRM A;  1HKG A;  1QQN A;  1YAG A;  3CJ9 A;  1SQK A;  5AQT A;  3B8A X;  5BR9 A;  1NGI A;  4DB3 A;  3WEE B;  1MWM A;  5AQG A;  3WUH A;  2E1Z A;  2QXL A;  2ITM A;  3D7E O;  2P9S B;  3AAQ A;  4H0X B;  2Q97 A;  5AQL A;  2F9T A;  4BGB A;  3DXK B;  1C0F A;  3I33 A;  5AQJ A;  3CI5 A;  3D2F A;  4FSV A;  3LDN A;  4XH5 A;  3GBT A;  3EKU A;  3SMP A;  1SZ2 A;  4HWI A;  4B9Q A;  3O8M A;  1GLA G;  3H1Q A;  2FLO A;  5AQF A;  1HPM A;  3VF6 A;  3WXK A;  2FSK A;  4BQZ A;  2E2N A;  4BRK A;  3FZH A;  4BR9 A;  3VOV A;  4A61 A;  4H0Y B;  1EQY A;  4K41 A;  4E1J A;  1BDG A;  2BTF A;  2QWN A;  4M7Y A;  4I6M A;  3VEZ A;  4XH4 A;  4PKI A;  5BRF A;  4FL9 A;  2UYT A;  3O1W A;  5BPL A;  3BEX A;  4H0O A;  4DQ8 A;  3AAR A;  5E84 A;  3SLC A;  2ZWH A;  2D4W A;  3CIP A;  2A40 A;  2IVN A;  3O6W A;  4A2B A;  2QW9 A;  4CI6 A;  4FWM A;  5BN9 A;  2KHO A;  1HKB A;  1TYQ A;  1JCF A;  1KAX A;  1RDW X;  2BUP A;  4KBO A;  3FZF A;  4A62 A;  5AQS A;  3H6E A;  2A6A A;  3LM2 A;  4FWN A;  2P9P B;  3HBT A;  4BR7 A;  3U4L A;  1NGC A;  3FGU A;  4BRD A;  3L6Q A;  3R9P A;  1NGG A;  1NGE A;  2NRH A;  5LJV A;  3M1F A;  4K25 A;  1GLE G;  3O80 A;  3O4W A;  3QB0 A;  4JN4 A;  4BRP A;  4EIA A;  3A8Y A;  2GWJ A;  1HUX A;  1NGF A;  3QBX A;  3WXL A;  4H03 B;  4BR2 A;  1QQO A;  4BVP A;  3QML A;  1KAY A;  4IXC A;  3MDQ A;  3R8E A;  5BN8 A;  2A42 A;  2A3Z A;  3VF2 A;  2ASM A;  2QWM A;  4FWR A;  4FOE A;  4FWK A;  2A5X A;  2E20 A;  5AQV A;  1WOQ A;  2PAV A;  1NWK A;  4FWO A;  2Q0U A;  3H46 O;  5AQO A;  3O5B A;  3VEN A;  5BRE A;  1G99 A;  1NMD A;  3O1B A;  5F0X A;  3IMX A;  4NB4 A;  5B8H A;  4WYB A;  3A5M C;  5KPT A;  3A0I X;  2E2P A;  4B1Y B;  2VYP A;  5EX5 A;  3I8B A;  1ZXO A;  3HSC A;  1TYQ B;  3VF4 A;  4CZK A;  2GTD A;  4DHY A;  4A2A A;  3ZX2 A;  2ZGY A;  3LM9 A;  5CE3 A;  1K8K A;  3SK3 A;  4ISF A;  2OAN A;  4O5F A;  3CET A;  5AFU H;  5AQY A;  3HZ6 A;  5I9E B;  3JXU A;  2P9N A;  3EL2 A;  4O8K A;  3KVG A;  3MN9 A;  2AP1 A;  4IZ9 A;  4RCH A;  5BRH A;  1BA1 A;  3VER A;  2P9K A;  2FF3 B;  1H1V A;  3AY9 A;  4XH1 A;  1GLD G;  3H1V X;  2J4R A;  3M6G A;  3UE5 A;  3VEO A;  4B1V A;  3FFK B;  3GDQ A;  1X9J A;  1T6C A;  2QWO A;  4CZL A;  3FLC O;  2EWS A;  4BRQ A;  1U2V A;  5AFU A;  4PKG A;  2VCP A;  2NZT A;  4F9O A;  3W3D A;  3BP8 A;  4WQ5 C;  1V4T A;  2QM1 A;  1MWK A;  3FZM A;  3UKU B;  4BQL A;  2CGL A;  4CJ7 A;  1RFQ A;  3U8X A;  1Z6R A;  2E1Y A;  2QWP A;  5AQZ A;  4FWL A;  2W41 A;  2FSN A;  4JHD A;  3SMS A;  3CJC A;  4BRE A;  1BOT O;  2H3G X;  3DXM A;  4CBW A;  2I7P A;  4M63 C;  3ULE A;  3VPZ A;  1BU6 O;  4BRF A;  4FWS A;  2DPN A;  2Q2R A;  4WQ4 A;  3GL1 A;  3C7N B;  2P9N B;  5KQD A;  2ZGZ A;  1YVN A;  1BWF O;  1HX1 A;  4BRO A;  1NGH A;  2YCH A;  1NGA A;  2D0P A;  4GNI A;  3VEW A;  4BRN A;  4FWP A;  1GLJ O;  4H5T A;  2HOE A;  4EAH D;  3QIC A;  3GG4 A;  1TUY A;  2P9I B;  2V7Y A;  1OKJ A;  3VEX A;  3ZX3 A;  3FR0 A;  1DKG D;  4JNE A;  5AZJ A;  5AQQ A;  4BG9 A;  1QZ6 A;  1E4G T;  3FZK A;  4FPB A;  4B1X B;  4ISE A;  2QWL A;  3MN7 A;  1RGI A;  4PL7 A;  3DWL A;  4BC4 A;  4QS9 A;  3J8A A;  3VGK A;  2GEM A;  2P9L A;  2V52 B;  4EHT A;  2W40 A;  1NLV A;  1ZC6 A;  2CH6 A;  2HMP A;  4K43 A;  2YHX A;  1KXP A;  3D2F B;  5KQ8 A;  2CGK A;  4WQ5 A;  1R59 O;  5BPM A;  2ZF5 O;  3VGL A;  3ENH A;  3ZX0 A;  2YHW A;  3HTV A;  4MO5 A;  4BR0 A;  3QFP A;  2ASO A;  1MA9 B;  2ASP A;  3JS6 A;  4FO0 A;  4BR5 A;  3WXJ A;  5KPR A;  3D2E A;  3EO3 A;  4CZM A;  4Y0W A;  2V7Z A;  3UKR A;  4I6M B;  5AQP A;  4BC3 A;  1IG8 A;  2GWK A;  3O08 A;  3U9D A;  5ADX H;  4BC2 A;  1U6Z A;  2AA4 A;  3RSE A;  5AZJ B;  5AQM A;  2IVO A;  4IWV A;  3ZEU A;  3M3Z A;  4DCH A;  3F9M A;  1GLF O;  1JCE A;  4CD1 A;  3BF1 A;  4RTF D;  1HLU A;  3C0B A;  1NGD A;  2P9L B;  4BRI A;  2PBD A;  1WUA A;  3FE1 A;  4BG8 A;  1DGK N;  3VGM A;  4JD2 A;  4RWT A;  4BC5 A;  5E26 A;  3MN5 A;  4YDU C;  3TU5 A;  3WEE A;  5ADX A;  1NGB A;  5F2R A;  1BG3 A;  4H0P A;  5AQU A;  1NM1 A;  4HTL A;  2D0O A;  3CQY A;  2YJE A;  3LDQ A;  3VEY A;  2P9S A;  3MK6 A;  4CZJ A;  4L3Q A;  4FOI A;  1NBW A;  1TUU A; 
#chains in the Genus database with same CATH topology
 4MQ3 A;  5FPE A;  3QFU A;  3H08 A;  4I2Q A;  1BA0 A;  3ENB A;  3L4I A;  4K0K K;  2YJF A;  1N34 K;  3D2E B;  4N41 A;  1NOZ A;  4J8F A;  1X3N A;  1XUP O;  1LWC A;  1QHT A;  3H3N O;  4TSX A;  4KHW A;  1EWR A;  4CER A;  4CJR A;  1BCO A;  3IFR A;  4AF1 A;  1D4X A;  5ELZ A;  3ATV A;  1KD1 O;  3OTO K;  3BUZ B;  4NXM K;  1NMN A;  4JD2 B;  1VQ8 N;  4CZE A;  3OYG A;  1X3M A;  4B8A B;  2QA4 N;  3RRG A;  2P9P A;  2UXB K;  3MCP A;  3ZSX A;  4LY7 A;  2P9K B;  1GLB G;  3VA3 A;  2DY4 A;  3J7Z O;  1I39 A;  4FJN A;  5HRN A;  1E4F T;  2XY6 A;  3EKS A;  4CED A;  4B9T A;  2CGJ A;  1U2V B;  4B1U B;  4FJX A;  4ISG A;  3OBY A;  3ZET B;  1DT9 A;  1HQE A;  3D0P A;  3P38 A;  3KK2 A;  4F3O A;  1JLA A;  4CBU A;  4CGJ A;  3OS0 A;  4ID5 A;  2D0B A;  3O9U A;  1SAZ A;  1YTA A;  1BUP A;  3MXI A;  3LZJ A;  4FK2 A;  3A2F A;  3K5N A;  2G8H A;  4JHD B;  3PX0 A;  3LDS A;  3H45 C;  3NH1 A;  4DTP A;  4KHN A;  4GY2 B;  4OLB A;  4DR3 K;  1Y97 A;  1GOA A;  3C95 A;  4AHV A;  2Q1N A;  2F7T A;  5AQH A;  3NH0 A;  3LWL A;  2XHB A;  5F1X A;  4LD0 A;  1LAW A;  4EHU A;  2O8F B;  4GV6 A;  4OGE A;  1J6Z A;  2VQF K;  2HND A;  1BL3 A;  3CJB A;  3KD1 E;  4YOR A;  4FJK A;  4JLH A;  4GKJ K;  4QCL A;  4IFE A;  4FW1 A;  5AQW A;  4BR4 A;  1R0A A;  4FLW A;  3R3L A;  1HNI A;  3VEV A;  3WQU A;  3DLG A;  3F73 A;  1NK4 A;  5DM7 L;  1NKB A;  2RPI A;  4BRC A;  3O3G A;  4CIF A;  4B9N A;  4B9L A;  1VSK A;  4CHP A;  4CGF A;  1IKV A;  4KFB A;  1E3M A;  4F2S A;  2GX9 A;  5FPM A;  5GAE P;  3P1G A;  4DV7 K;  4FJM A;  1JLQ A;  3M8P A;  1M1K O;  3DLK A;  4I2P A;  3J81 O;  4Z0U A;  3SJH A;  4CZH A;  4IJA A;  4JK9 A;  1HYS A;  4Z94 A;  2YHB A;  4WFN L;  4QS8 A;  3LAK A;  4Q5V A;  3DLL L;  1L3U A;  3TAB A;  4FJJ A;  5T7B A;  4Z4H A;  5FPN A;  2Q36 A;  1RT5 A;  2NRV A;  4LC9 B;  3QEV A;  1RTH A;  5J2N A;  4FPA A;  4CJS A;  3CCE N;  4E3S A;  3C7N A;  3UKR B;  1QVG M;  4MDA A;  4CZI A;  3H3O B;  3MX5 A;  4IO8 A;  4AHT A;  1IJJ A;  4N5S A;  2HHW A;  3QIN A;  4LF6 K;  3RSE B;  3CHW A;  4IEE A;  3L2W A;  2C1I A;  4DUY K;  3OY9 A;  1T6D A;  1WSI A;  2FBT A;  2RKI A;  4H0T B;  3AA2 A;  2P9I A;  3LP3 A;  1RCH A;  3TPQ A;  4QAG A;  3SJJ A;  4BRA A;  5FPD A;  4HUF A;  5LY3 A;  2QKB A;  4BRM A;  4AHC A;  3CME N;  3G6E N;  4C8M A;  1CXQ A;  1KVC A;  3IRX A;  4OKK A;  1TL1 A;  1NOY A;  4JS4 A;  4A57 A;  4H0X B;  4LF4 K;  1S1W A;  1UA1 A;  2VQE K;  2FC0 A;  3CI5 A;  3CQ8 A;  3LDN A;  3GBT A;  1SZ2 A;  1L5U A;  3OYC A;  3C6T A;  1IBM K;  5CY4 A;  3V9Z A;  2F8S A;  2P5G A;  4BQZ A;  1A5V A;  2E2N A;  1TV6 A;  1JJ2 M;  4YFU A;  3SUP A;  5GAD P;  4PKI A;  5BRF A;  2UYT A;  3DLR A;  3ZLJ A;  3TR8 A;  3QEI A;  2YNG A;  5BPL A;  3BEX A;  4H0O A;  4KV8 A;  3SLC A;  4A2B A;  4IDH A;  2A40 A;  4CGI A;  5I3U A;  3C94 A;  3S5T A;  3OYI A;  1VSL A;  3TSQ A;  3BDP A;  3THW B;  1JCF A;  1KAX A;  1EKE A;  1SKR A;  3LM2 A;  1OH6 A;  3THX B;  2ZQB A;  1JL2 A;  3SPZ A;  4BR7 A;  4CE9 A;  4KAZ A;  4KI4 A;  4E7K A;  4BRD A;  3R9P A;  4CF2 A;  4DSE A;  1ASV A;  1NGG A;  2NRH A;  4K25 A;  3O4W A;  1BIZ A;  2ATQ A;  4HCB A;  3A8Y A;  2GWJ A;  3CCQ N;  4BR2 A;  5TKW A;  3QML A;  3MDQ A;  3R8E A;  4ELV A;  4H4M A;  4MFB A;  2QWM A;  5H1S Q;  4FWR A;  1NJZ A;  1RIL A;  1VQN N;  3CCL N;  1HNW K;  2E20 A;  1ZYQ A;  1NWK A;  3AO3 A;  2OPP A;  2HMI A;  1RDB A;  1C6V A;  1NMD A;  4WYB A;  1SS6 A;  1G15 A;  4KTZ A;  4B1Y B;  2HHU A;  2VYP A;  1LW2 A;  4ZHR A;  4CZK A;  1ZXO A;  1TYQ B;  2GTD A;  4DHY A;  2Y1J A;  4A2A A;  2WFB A;  1FW6 A;  1S6P A;  2ZGY A;  1EO1 A;  1VSJ A;  4O5F A;  2OAN A;  5AFU H;  3TAQ A;  3N4P A;  4C8O A;  5DMR A;  3JXU A;  4YOY A;  1IV0 A;  4DV4 K;  2O8B B;  4JKH A;  3LAM A;  4DR1 K;  3V4I A;  2P9K A;  2FF3 B;  3AY9 A;  2HBJ A;  4AQY K;  2GV9 A;  2J4R A;  3UE5 A;  3VEO A;  4K8X A;  3FFK B;  4KB0 A;  3KK1 A;  3AA3 A;  3LP2 A;  4FJL A;  1X9J A;  3HRG A;  5IWA K;  1U2V A;  5AFU A;  2VCP A;  5JS2 A;  4N47 A;  5C15 A;  1QSS A;  1V4T A;  1MWK A;  3FZM A;  1RT1 A;  1LW0 A;  2FBY A;  4I7F A;  3VQA A;  1S6Q A;  4CJ7 A;  1X1P A;  5AQZ A;  4FWL A;  4JI0 K;  4JHD A;  1BOT O;  3CG7 A;  1JL1 A;  2H3G X;  3I0R A;  2I7P A;  2Z1G A;  3DMJ A;  3VPZ A;  4FWS A;  2Q2R A;  4DU3 A;  2ZJR L;  4WQ4 A;  3E9O A;  2O8F A;  3SQ1 A;  4DSJ A;  2P9N B;  2ZGZ A;  5J1E A;  1YVN A;  1HX1 A;  2HNY A;  1U47 A;  1NGH A;  4CHQ A;  1VQM N;  1D8Y A;  1NGA A;  5CR4 A;  4GNI A;  3MX2 A;  4OGC A;  2IGI A;  4H5T A;  4EAH D;  4BWM A;  1QE1 A;  1QS4 A;  1NJI O;  4HVJ A;  4R79 A;  3VEX A;  3ZX3 A;  3FR0 A;  5C12 A;  4BG9 A;  3FZK A;  1T8E A;  3VQ6 A;  3Q7B A;  3VTI A;  3RMA A;  2QWL A;  2QXF A;  1IKY A;  3AVM A;  5MLC Q;  3ZSW A;  1W2B M;  4FJ9 A;  2QI2 A;  3CYG A;  3WXM B;  1TKT A;  4XIU A;  2P9L A;  3CC4 N;  1HMV A;  4EHT A;  4DS5 A;  2D0C A;  1N5Y A;  3ZSR A;  4U7B A;  3KJV A;  3D2F B;  5KQ8 A;  4WQ5 A;  2HVH A;  3NF8 A;  3VGL A;  3ENH A;  4B9U A;  2OPR A;  3AA4 A;  1VQ4 N;  1B92 A;  4BR0 A;  1D9D A;  4DQI A;  4JI4 K;  3WXJ A;  4CZM A;  1T7P A;  1VQP N;  3UKR A;  4I6M B;  2DTU A;  5AQP A;  2GWK A;  3I55 N;  3OJU A;  3O08 A;  4WFB L;  4MDB A;  3S3O A;  3RSE A;  5AZJ B;  2GBZ A;  1W0H A;  4IWV A;  3LPU A;  3M3Z A;  4DV1 K;  3PSI A;  4RW9 A;  1WNS A;  4LSN A;  3L2Q A;  3HOT A;  2YKM A;  1FKO A;  2E6M A;  1YVU A;  4E7J A;  3FE1 A;  4YOW A;  4CJV A;  2O8E A;  1KLN A;  4H0P A;  5AQU A;  4HTL A;  4CZJ A;  3SQ4 A;  1WBB A;  3SNN A;  1O13 A;  1TUU A;  2P5O A;  5FDL A;  3G71 N;  3TAE A;  2FF6 A;  5EVZ A;  2HB5 A;  2OYQ A;  3HPG A;  4EP4 A;  1ITG A;  1YT3 A;  2ITG A;  2VGN A;  3SUO A;  4C23 A;  4DWI A;  1KAZ A;  5JLH A;  1N32 K;  4M7X A;  4ILG B;  5AR0 A;  3HP6 A;  4BY9 C;  3P39 A;  3BF3 A;  3LP1 A;  3TSP A;  4FJI A;  5FRN A;  4MLE A;  4NYF A;  4MLH A;  2WUS A;  3CQX A;  4XEI A;  1I3A A;  1K8K B;  1C0U A;  1QQC A;  3TAR A;  3KIO A;  3VET A;  3WQT A;  3FZL A;  3NGZ A;  3U6F A;  4BGA A;  3U3Y A;  1RBU A;  1UWB A;  3A5O C;  5EOY A;  1T03 A;  5HL7 L;  2D5R A;  1LWF A;  3VQ5 A;  3O9T A;  5LL6 Z;  3AGR A;  5AQN A;  3IDH A;  3CJ7 A;  4KHQ A;  4KHY A;  4KH4 A;  3NAE A;  1KVB A;  2HW3 A;  1VRT A;  5AZI A;  2E2Q A;  3LPT A;  1IH7 A;  3VN5 A;  2B5J A;  4AM7 A;  4BRH A;  3V9X A;  2NUB A;  4B3T K;  4H5R A;  4CIG A;  4JS5 A;  3DXM B;  1BO5 O;  4QS7 A;  4JEP A;  4CD3 A;  3KHY A;  4O0J A;  3HVT A;  3MMV A;  3ULE B;  4FK0 A;  4GVM A;  1S1V A;  3SAF A;  1RTJ A;  3DLE A;  3V9W A;  3NFA A;  1XWL A;  2E88 A;  4KO0 A;  3QEX A;  4M3T A;  4LF5 K;  4DTJ A;  3GE1 A;  3KZB A;  2P9U B;  3T69 A;  1HNX K;  2O8B A;  4EFH A;  4YOV A;  3K2P A;  2O8C B;  1VSF A;  1YJN N;  5C2F A;  5AQR A;  3V1O A;  1BCM A;  4CGD A;  1NK5 A;  4CEZ A;  1MDU B;  1S1X A;  4GVE A;  2KZZ A;  1RBV A;  3SZ2 A;  3T1H K;  3MWT A;  1HNV A;  4X66 K;  4H5W A;  4CES A;  1S9E A;  5IT9 O;  1U4B A;  4MO4 A;  1UOC A;  3VQP A;  3KTQ A;  2HHI A;  1ASW A;  3CJ1 A;  2GEL A;  2HF3 A;  1HKC A;  1JXB A;  4BDZ A;  1L3T A;  1XC3 A;  3WXI A;  3W0L A;  5A2Q O;  1TK8 A;  3QDK A;  5M1O A;  2A41 A;  3WT0 A;  5AQX A;  3MXM A;  1QHA A;  3HM8 A;  4C1N K;  4RW8 A;  4B3M K;  3ID8 A;  2FXU A;  1LCU A;  2D1K A;  3LDP A;  4YOX A;  3IKM A;  4H5N A;  4H5V A;  1EX4 A;  1VHX A;  3CER A;  3PY8 A;  3PUF A;  4NCG A;  3NVK A;  2KW4 A;  4ZTJ A;  2X6N A;  1OH5 A;  3CJ9 A;  1JLC A;  1SQK A;  3B8A X;  5BR9 A;  3DRP A;  4FM0 A;  5M1N A;  4B9S A;  3BGR A;  4Z4E A;  4X65 K;  3PIO L;  2E1Z A;  2QXL A;  3S9H A;  2ETJ A;  1FJG K;  4BE0 A;  2Q97 A;  5AQL A;  3DXK B;  3I33 A;  3M5R A;  4E72 A;  1RTI A;  4IOX A;  4BEB A;  3D2F A;  4FSV A;  4HWI A;  3CXC M;  1LV5 A;  4B9Q A;  1GLA G;  2DFH A;  3OYH A;  3H1Q A;  4DR2 K;  5AQF A;  1J5O A;  1HPM A;  1NK9 A;  3WXK A;  4RW6 A;  4YHH K;  4CVN E;  4DR7 K;  3K0S A;  3AVG A;  3KLG A;  3VOV A;  3TAP A;  4A61 A;  4LF8 K;  2OA8 A;  1EQY A;  2QWN A;  4I6M A;  1EET A;  1TGO A;  1N6Q A;  5GAH P;  4M42 A;  3DRS A;  5E84 A;  3CIP A;  4PA1 A;  2QW9 A;  1RT3 A;  5BN9 A;  1X9M A;  3EY1 A;  4WE1 A;  2IAJ A;  1HKB A;  3NHG A;  4JI3 K;  1RDW X;  4KBO A;  2YV0 X;  5AQS A;  4CJW A;  1TKZ A;  1Q82 O;  4N56 A;  4DQS A;  2BDP A;  2OZS A;  3SBG A;  3B6O A;  3LP0 A;  1NGC A;  1A5W A;  3L6Q A;  3OA9 A;  3KLE A;  1VSH A;  1NGE A;  4CK3 A;  1GLE G;  3T1Y K;  3O80 A;  3QB0 A;  4BRP A;  4EIA A;  3P83 D;  3QBX A;  4O44 A;  3K9K A;  1C1C A;  4F8R A;  4H03 B;  5FRM A;  1K73 O;  5HRS A;  2WTU A;  1QQO A;  4B8C A;  4BVP A;  3NGI A;  1KAY A;  3S3M A;  4EZ6 A;  1YJW N;  1KQS M;  3TAM A;  4R5P A;  4JKF A;  4FJG A;  2ASM A;  4FOE A;  3T3F A;  4FWK A;  5AQV A;  2PY5 A;  2PAV A;  5FRO A;  4RW7 A;  4CJ5 A;  1YHQ N;  5AQO A;  4KTW A;  3G0Z A;  4CEC A;  5JVH L;  4LF9 K;  1XC9 A;  1NG9 A;  1TKD A;  4CK1 A;  3IMX A;  3PSF A;  5B8H A;  2G8U A;  4ILH A;  3A5M C;  3C6U A;  5KPT A;  2E2P A;  3NCI A;  3CFP A;  3HSC A;  3M8R A;  2G8V A;  3HST B;  1Q9Y A;  3ZX2 A;  3CCM N;  4FVM A;  1Q8I A;  2O4G A;  1QTM A;  4X64 K;  1K8K A;  4OX9 K;  3SK3 A;  3CET A;  4NYN A;  4J2D A;  4BAC A;  4B08 A;  3O4N A;  3MAQ A;  3EL2 A;  4M3X A;  1LAV A;  4O8K A;  3MN9 A;  3QIP A;  2AP1 A;  4IZ9 A;  4RCH A;  4A59 A;  1BA1 A;  5BRH A;  3VER A;  4OJR A;  1H1V A;  3CPE A;  1W97 L;  3M6G A;  4DTS A;  3BY5 A;  3GDQ A;  5C10 A;  3AVA A;  3OYK A;  1T6C A;  2QWO A;  2RN2 A;  4JI8 K;  2EWS A;  3MEC A;  2NRZ A;  3ISN C;  4KHS A;  3BP8 A;  3UKU B;  3L2V A;  3RMC A;  1FK9 A;  4BWJ A;  4ELT A;  1ILY A;  1IBL K;  3LWM A;  3QES A;  1RDA A;  1C1A A;  2QWP A;  1KFD A;  2FSN A;  4DTM A;  3CJC A;  4JKG B;  4OPH A;  3V81 A;  3CM6 A;  3NMU A;  1DLO A;  3CCU N;  3B6P A;  3DXM A;  3O3F A;  4M63 C;  3AVH A;  4KRF A;  3ULE A;  1YJ9 N;  3K5O A;  3GL1 A;  1OH8 A;  3BZC A;  4QOZ B;  4BRO A;  3L8B A;  2D0P A;  3AVL A;  4H8K A;  1CLQ A;  1VSM A;  1SL1 A;  2HOE A;  5SWM A;  3CCS N;  3C6H A;  3GG4 A;  1OKJ A;  1VSE A;  4B3O A;  3L3U A;  3SV3 A;  4W5T A;  1DKG D;  1HYV A;  1VQ7 N;  1E4G T;  4DFK A;  4K8Z A;  3M8S A;  3WNF A;  3I56 N;  4ISE A;  4M3R A;  3MN7 A;  2PYJ A;  1RBR A;  3DWL A;  4CEE A;  3ZSQ A;  3J8A A;  1NNE A;  2V52 B;  1RT6 A;  1ZC6 A;  2OPQ A;  1KXP A;  4HCC A;  2CGK A;  2E5L K;  3PO5 A;  3LZI A;  3V1R A;  3FFI A;  1BI4 B;  1S9G A;  4LSL A;  4MO5 A;  4CK2 A;  1Q86 O;  1JLB A;  1MA9 B;  2ASP A;  4FO0 A;  5M1F A;  5KPR A;  2F4V K;  3D2E A;  3HT3 A;  2YNI A;  2V7Z A;  2WON A;  3OS1 A;  4BC3 A;  5SZT A;  4C8K A;  5ADX H;  4BC2 A;  3P5J A;  1U6Z A;  4FYD A;  4CHO A;  5CYM A;  2IVO A;  1XHX A;  4DU4 A;  1JCE A;  4CD1 A;  2Q3S A;  1HLU A;  4KH6 A;  4CGG A;  1BHL A;  2G8F A;  2VG5 A;  3C0B A;  2WOM A;  1WUA A;  4DSF A;  2QKK A;  4BG8 A;  3VGM A;  4JD2 A;  1FKP A;  4Z4C A;  3SQ0 A;  4BC5 A;  4YDU C;  4DV2 K;  4A5B A;  2GUI A;  5ADX A;  2OCE A;  4DFJ A;  3SAG A;  1BG3 A;  3SUQ A;  2ZM6 K;  2D0O A;  4JKA A;  3ZSY A;  4FOI A;  1NBW A;  4HUG A;  4JYA K;  1HRH A;  2KZM A;  5C2D A;  3DXK A;  4JK8 A;  4HHT A;  1HQU A;  3VTH A;  3NGY A;  5KRS A;  4DTU A;  3Q7C A;  5GIO A;  3ZET A;  3VES A;  4H0V B;  5HRP A;  2XO7 A;  4M41 A;  2E2O A;  1QSY A;  1GLL O;  3HJF A;  1NU0 A;  4JI5 K;  4W5R A;  4DLE A;  5JMV A;  4FM1 A;  3KKR A;  3OJS A;  5BRD A;  1T44 A;  2VG7 A;  3TTD A;  3HO1 A;  2CH5 A;  2KTQ A;  1V4S A;  1KRP A;  4NO7 A;  3VQ4 A;  3AO2 A;  4DR4 K;  1S3X A;  4DUZ K;  3HXM A;  3T7Z A;  3S41 A;  1NK0 A;  3NF6 A;  1WSF A;  2F9W A;  3MEG A;  1YTU A;  3AO1 A;  4O5B A;  4PY5 A;  4JAX A;  1JXE A;  4CF1 A;  3CPW M;  4V19 S;  1OH7 A;  1YXQ A;  2QWQ A;  3HPH A;  1JCG A;  1Z25 A;  2JGU A;  4E89 A;  3ENO A;  4GMJ B;  4KKO A;  4CJT A;  4WF9 L;  3QO9 A;  1Q18 A;  4CBX A;  1ZBF A;  1ESV A;  1RDD A;  4DTO A;  1BQM A;  3TTF A;  5GAG P;  3A5L C;  5J2P A;  2QTD A;  1ATN A;  2F8T A;  1RDC A;  4E0D A;  4L8R B;  3RRH A;  1K6Y A;  4KHP K;  1KLM A;  4HUE A;  1J53 A;  2HF4 A;  3AVJ A;  3DAW A;  5AJ3 K;  3G10 A;  3RTV A;  3TAN A;  2OZM A;  3OVN A;  4E1N A;  4NCB A;  3DJC A;  1RT2 A;  2KLA A;  3A5N C;  1WB9 A;  3ATU A;  2RHK A;  3RMB A;  1IO2 A;  1A5X A;  1CZA N;  2Q31 A;  4CEO A;  4JKB A;  5HP1 A;  1ZBS A;  3ALY A;  1TK5 A;  2YKN A;  4OKE A;  4CF9 A;  4ID1 A;  1HR0 K;  2P51 A;  2VWK A;  3OBW A;  3OHR A;  3D45 A;  3UKU A;  3ZT2 A;  4J2B A;  3QEP A;  4G9Z A;  3JSM A;  4WQ4 C;  3AVK A;  1BIU A;  3U9Z A;  5JVG L;  3N4Q A;  4LFC K;  3V9S A;  3DLH A;  1GOB A;  4JKG A;  1KC8 O;  1XQS C;  2Z1I A;  3QER A;  1EXQ A;  3KWI A;  1IBK K;  4ICL A;  2W6L A;  4AM6 A;  4IOA L;  4KTQ A;  5K14 A;  4N76 A;  4C1N I;  1S5J A;  1RTD A;  3G25 A;  3ZSV A;  2YHY A;  2Y1I A;  3DOK A;  1TAQ A;  2IVP A;  5AQK A;  2QK9 A;  2DFF A;  4F4K A;  1CXU A;  1KTQ A;  3EN9 A;  5LJW A;  3L0Q A;  2RE2 A;  2GUP A;  4E7I A;  2HHT A;  2HBL A;  3E9L A;  3HK2 A;  4Z4I A;  2UUB K;  4FZY A;  3P4I A;  1QQN A;  1YAG A;  5AQT A;  3THW A;  1HNZ K;  2UXC K;  4DB3 A;  3WEE B;  3E1Y A;  3THX A;  3CCJ N;  1TVR A;  5LMN K;  3D7E O;  2HHV A;  2E4L A;  1WLJ A;  4E7L A;  4WCE L;  2F9T A;  2A1S A;  3CC2 N;  4J2E A;  1C0F A;  5JS1 A;  3RVC A;  3DI6 A;  1B9F A;  3OYE A;  3AVF A;  4CW7 B;  3KLI A;  3AGK A;  1BI4 A;  3ITH A;  1WSG A;  3O8M A;  4M45 A;  2FLO A;  2UUA K;  3VF6 A;  3NE6 A;  4W5Q A;  3DRR A;  3FZH A;  4BR9 A;  5BR8 K;  1WN7 A;  4CF0 A;  3EEQ A;  4K41 A;  5J2M A;  4M7Y A;  3DM2 A;  3PX6 A;  4XH4 A;  1NK7 A;  3O1W A;  5M1K A;  1S1T A;  1WSJ A;  2ZWH A;  1K8A O;  1VK0 A;  2IVN A;  4DKW A;  2UXD K;  2KKZ A;  1TYQ A;  5DM6 L;  2BGG A;  1VQL N;  4G1Q A;  4A62 A;  4CJP A;  3H6E A;  3SYZ A;  2A6A A;  3HBT A;  3KKS A;  3U4L A;  5C42 A;  1N33 K;  4FJ7 A;  3DLB A;  2PYL A;  3M1F A;  4JK7 A;  4KB1 A;  1C0M A;  4CFB A;  4IXC A;  2X78 A;  3P31 A;  3F2K A;  2A42 A;  1JLE A;  2BH1 A;  1NJX A;  1REV A;  2A5X A;  4OPA A;  4IFV A;  1RT7 A;  4FW2 A;  1J54 A;  4FXD A;  5KGX A;  4GV9 A;  3SQ2 A;  1XMQ K;  1YI2 N;  2HHH K;  3O9S A;  3O5B A;  3TAG A;  4W5O A;  2XRI A;  1G99 A;  4NB4 A;  3E66 A;  2NRX A;  3A0I X;  3VQ7 A;  3VF4 A;  4IFY A;  2WC9 A;  4DG1 A;  1CZB A;  4JI2 K;  3RR7 A;  5CE3 A;  4ISF A;  4O4G A;  3F9K A;  4CGH A;  4UQG A;  3PLA A;  2OTL N;  4CJE A;  4PQU A;  3J7Y P;  5I9E B;  5KGW A;  3SPY A;  2P9N A;  2P1J A;  1T05 A;  1EP4 A;  2JLE A;  5M1P A;  1Q9X A;  4IKF A;  3BZK A;  4DTR A;  1VQ6 N;  4CZL A;  3AO4 A;  3FLC O;  4C8L A;  3K59 A;  4BRQ A;  4M3W A;  3E9P A;  4PKG A;  3ZSO A;  4BDP A;  1HYZ A;  2NZT A;  4F9O A;  1QSL A;  2QM1 A;  4BQL A;  1S1U A;  1SL0 A;  1D5A A;  2HHX A;  3QEW A;  2HHS A;  3HM9 A;  3QNN A;  3U8X A;  3M8Q A;  4FLV A;  3CFR A;  4E19 A;  2QEX N;  1Z6R A;  4IBN A;  4BRE A;  2W41 A;  5J2Q A;  1NKE A;  3J80 O;  1OVY A;  4CBW A;  4LFA K;  4BRF A;  3VQB A;  3WNH A;  1XMO K;  4CJ4 A;  3DYA A;  4DFM A;  2O8D B;  1U49 A;  3R1X A;  1VAZ A;  3NH2 A;  2FBX A;  3L3V A;  4NLB A;  4M3U A;  1WSE A;  3VEW A;  4BRN A;  4FWP A;  1GLJ O;  4KI6 A;  4DQQ A;  1TUY A;  3T1A A;  2V7Y A;  5GIN A;  4ILJ A;  4JNE A;  5AZJ A;  1VSD A;  2YHA A;  4FJH A;  2KFN A;  1MU2 A;  1RGI A;  4OPJ A;  3HVR A;  4QS9 A;  4DF4 A;  3UIQ A;  3VGK A;  2GEM A;  3OYJ A;  3TSU A;  2W40 A;  2HBK A;  3AVB A;  2HMP A;  3T19 A;  2B6A A;  2YHX A;  3VQE A;  2W00 A;  3MEE A;  5BPM A;  2A1R A;  5KTQ A;  3HL8 A;  3ZX0 A;  4U67 L;  4CFD A;  3QFP A;  1C0T A;  4IG0 A;  5DK5 A;  3QLH A;  3NVM A;  3VQ9 A;  3EO3 A;  4JI6 K;  3RR8 A;  4Y0W A;  4O0I A;  3KLF A;  4Q0B A;  1EWQ A;  4B9M A;  4LH4 A;  3U9D A;  4DV0 K;  2AA4 A;  2LSN A;  4DV3 K;  2PFU A;  4XJX A;  4DSL A;  4B3R K;  1XNR K;  4CFC A;  1ZBI A;  1P90 A;  3SUN A;  4NLC A;  3VQQ A;  4ZTF A;  1KCF A;  1TAU A;  2P9L B;  2ZJP L;  2PBD A;  3ZSZ A;  1DGK N;  5C24 A;  4RWT A;  3L2U A;  3QET A;  3WEE A;  1SUQ A;  3TU5 A;  2BE2 A;  4CJ3 A;  4RW4 A;  1NGB A;  5F2R A;  1KVA A;  4JV5 K;  2YX6 A;  1NM1 A;  3V6D A;  3LDQ A;  4BE2 A;  4L3Q A;  1XI1 A;  3CF5 L;  2NRR A;  3R6M A;  4B1Z A;  1X9W A;  4Z4F A;  4FVU A;  1Z05 A;  1Y64 A;  3GOI A;  2FSJ A;  3MED A;  3JAM O;  1X9S A;  3KK7 A;  3MN6 A;  3KD5 E;  3VQD A;  4FLY A;  2IC3 A;  3SBT A;  4JRP A;  3IS9 A;  5TKY A;  5GIP A;  3CJA A;  5C0Y A;  4W5N A;  4BVO A;  5CHI A;  1HJO A;  3KWG A;  3HYF A;  5HBM A;  2PZS A;  2V51 B;  3OYD A;  2JWL A;  4CEQ A;  2YI1 A;  4CZF A;  2W6K A;  3OYL A;  4CEA A;  3WNE A;  1VRU A;  3SV4 A;  4IO9 L;  1TKX A;  2ZE2 A;  3PIP L;  3OYF A;  4CEF A;  4JKD A;  4OLA A;  2O8E B;  4GV3 A;  4PKH A;  2HST A;  1ATS A;  3U3G A;  3HI0 A;  3THY B;  1XNQ K;  5EY4 A;  1WAJ A;  3TTC A;  5HOO A;  1IG9 A;  1BQN A;  2P9U A;  4OO1 J;  4FLT A;  1NGJ A;  2I7N A;  2O8C A;  4DSK A;  3K57 A;  4K42 A;  3OYB A;  4FZX C;  4YDU A;  3IG1 A;  3DOL A;  1UA0 A;  2E6L A;  1QQM A;  5BPN A;  3RMD A;  3C6A A;  1SKW A;  3TAF A;  4B1W B;  1ZBH A;  1S22 A;  2OTJ N;  5EXW A;  2YNH A;  1DEJ A;  3ID6 A;  4LH5 A;  4YOT A;  4Y1D A;  2VWB A;  2E8A A;  1VQ5 N;  4F2R A;  1P8Z A;  3QBW A;  4CHZ A;  2HHQ A;  2VGM A;  1RBT A;  2HNZ A;  3AV9 A;  4KRE A;  3LL3 A;  1WAF A;  3EYZ A;  1QVF M;  2WBN A;  4OKJ A;  1LOT B;  3ASM A;  3SI6 A;  3L2R A;  3ZT1 A;  1C0G A;  3KK3 A;  4OPK A;  4AHS A;  4BRG A;  1JKH A;  1GOC A;  2QWR A;  4DLG A;  3CYM A;  4AH9 A;  5E41 A;  5HLF A;  3MXJ A;  3AVI A;  1SKS A;  4JI1 K;  3K9J A;  2XY5 A;  2NLX A;  3IUC A;  1VQO N;  1M90 O;  4HTU A;  1QZ5 A;  5JLF A;  3CCV N;  2VWJ A;  5AZI B;  4FWQ A;  1WSH A;  4IJN A;  1J9A A;  4AHU A;  2OPS A;  1T3V A;  3EE8 A;  2R7Y A;  5FLX O;  3THV A;  4KHU A;  3LAL A;  2UU9 K;  1YUW A;  4BRL A;  3CC7 N;  3RWU A;  5CZ1 A;  5KPZ A;  3LDO A;  4CJF A;  1GLC G;  3SCX A;  3EZW A;  1LWE A;  2IIR A;  1N36 K;  4YOU A;  1Q7Y O;  4PL8 A;  3NBP A;  3ULD A;  1Z26 A;  2O8D A;  4A5A A;  5AQI A;  3LDL A;  4BDY A;  4CZG A;  1ATR A;  3UB5 A;  4J2A A;  4JKC A;  5M1Q A;  4CJQ A;  5LMU K;  4M3Y A;  4B3S K;  4FCY A;  4EZ9 A;  1NJY A;  3ZEU B;  1W7A A;  1U04 A;  2I5J A;  3I0S A;  5JIC A;  1L3S A;  2Q0R A;  3OYM A;  3AAP A;  5KRT A;  5JEN A;  3CFO A;  2ZD1 A;  3CM5 A;  4E7H A;  1VQK N;  1HKG A;  3O3H A;  1NGI A;  3ZCM A;  1MWM A;  3OS2 A;  4JI7 K;  1S72 N;  4GW6 A;  4DTN A;  5AQG A;  3WUH A;  2F96 A;  2ITM A;  4I9Q A;  2P9S B;  3ZT3 A;  3AAQ A;  4C8N A;  3ZT0 A;  4BGB A;  5AQJ A;  3NF9 A;  4BE1 A;  1BIS A;  1WBD A;  3JYT A;  4DS4 A;  4XH5 A;  3SMP A;  3EKU A;  4IG3 A;  3CD6 N;  1UAX A;  4EP5 A;  3TWH A;  4UY8 O;  2FSK A;  1SL2 A;  2B4J A;  4RG8 A;  4BRK A;  4OVL A;  2D0A A;  2UUC K;  4H0Y B;  4JRQ A;  4BE7 B;  4E1J A;  1BDG A;  2BTF A;  3VEZ A;  2IDO A;  4FL9 A;  4PUO A;  4DTX A;  2XY8 A;  1SV5 A;  1NKC A;  3VMF B;  3AAR A;  4DQ8 A;  2NRT A;  1DTT A;  1C1B A;  2D4W A;  3O6W A;  4CI6 A;  4FWM A;  1JLG A;  2KHO A;  2VG6 A;  5I42 A;  2IS3 A;  2BUP A;  3FZF A;  1RT4 A;  4CHY A;  1NK8 A;  4FWN A;  2P9P B;  1N8R O;  2KQ2 A;  2YNF A;  3FGU A;  4DU1 A;  3HPO A;  5LJV A;  1HPZ A;  1FXX A;  4JN4 A;  4DF8 A;  1HUX A;  1NGF A;  3WXL A;  3TI0 A;  4NXN K;  4KH5 A;  3E01 A;  5D3G A;  2KFZ A;  5BN8 A;  2A3Z A;  3VF2 A;  1NJW A;  4DSI A;  2G8K A;  4YNQ A;  1YF5 L;  1WOQ A;  2NNW A;  3IAY A;  3WNG A;  4FWO A;  2Q0U A;  3H46 O;  1Q81 O;  3VEN A;  1ASU A;  4FLU A;  5BRE A;  4H4O A;  3L4Q A;  3SAH A;  3O1B A;  5F0X A;  3I8D A;  3PX4 A;  4AHR A;  3OYA A;  1W9H A;  5EX5 A;  3I8B A;  2ZJQ L;  4F3T A;  5EU7 A;  4GKK K;  4O8U A;  4DV5 K;  3O9Q A;  4WFA L;  2DFE A;  4CJK A;  3V9U A;  4LF7 K;  2EHG A;  4BEC A;  3LM9 A;  4X62 K;  1IKX A;  3K5L A;  3F5T A;  5AQY A;  3HZ6 A;  4DQP A;  5HRR A;  3EZ5 A;  3KVG A;  3VQ8 A;  4CJL A;  4DFP A;  1RBS A;  4Z4G A;  3THY A;  1VSI A;  4XH1 A;  1GLD G;  3H1V X;  3HOS A;  4B1V A;  4YY3 K;  1YIT N;  3CCR N;  2Z1J A;  1CZ9 A;  1RDU A;  1TL3 A;  3HP9 A;  4CF8 A;  1KFS A;  2X74 A;  3W3D A;  4WQ5 C;  2W42 A;  2HBM A;  3K5M A;  2CGL A;  3KLH A;  4CHN A;  3NF7 A;  4CCH A;  4FM2 A;  1RFQ A;  2E1Y A;  3SMS A;  2IOC A;  1RNH A;  1TK0 A;  2FBV A;  3ZT4 A;  1XHZ A;  3CMA N;  1BU6 O;  2BAN A;  4ELU A;  2DPN A;  3OYN A;  3C7N B;  3PO4 A;  4Y1C A;  3LAN A;  5C25 A;  4CJU A;  1VQ9 N;  5KQD A;  1BWF O;  3S3N A;  1U48 A;  4FJ8 A;  2NRW A;  2YCH A;  3MWP A;  1DTQ A;  2Z1H A;  4FK4 A;  1F21 A;  1KSP A;  4PWD A;  3QIC A;  2P9I B;  3V1Q A;  4FLZ A;  3MCA B;  3VQC A;  4DMN A;  5AQQ A;  1QZ6 A;  3ZYY X;  3QNO A;  4FPB A;  4B1X B;  4FJ5 A;  4KPY A;  4IEI A;  1NK6 A;  3J7A P;  3AO5 A;  3C65 A;  1K9M O;  4B9V A;  1D9F A;  4PL7 A;  4CIE A;  4BC4 A;  4JKE A;  1IKW A;  4O55 A;  4CEB A;  1JLF A;  1NLV A;  2CH6 A;  2G8W A;  4K43 A;  4DR6 K;  2O4I A;  2C1G A;  1ZBU A;  4IDK A;  1B9D A;  1R59 O;  2ZF5 O;  5CZ2 A;  2HVI A;  1BGX T;  4DR5 K;  2YHW A;  3HTV A;  1U45 A;  2ASO A;  3JS6 A;  4BR5 A;  3EE9 A;  4I9L A;  2X6S A;  5KI6 A;  3PV8 A;  4DQR A;  1ZBL A;  4E1M A;  1IG8 A;  3O9R A;  4LFB K;  3G4S N;  5AQM A;  4DV6 K;  3OW2 M;  3ZEU A;  4DCH A;  3AVC A;  3F9M A;  4AIL C;  1GLF O;  3AVN A;  4M3Z A;  1L3V A;  5CYQ A;  3BF1 A;  4NCA A;  2JWK A;  1HJR A;  4RTF D;  4PHT X;  3K58 A;  4FLX A;  2RF2 A;  3AA5 X;  3NDK A;  3QIO A;  1I94 K;  1NGD A;  3D6R A;  4BRI A;  2XY7 A;  2AJQ A;  5E26 A;  1OVQ A;  3MN5 A;  4FZZ A;  2G8I A;  1O1W A;  4CFA A;  1J5E K;  1YIJ N;  5HRO A;  3CQY A;  2YJE A;  3VEY A;  3VA0 A;  2P9S A;  3MK6 A;  3O4Q A;  4IOC L;  2EX3 A; 
#chains in the Genus database with same CATH homology
 3CF5 L;  2NRR A;  3R6M A;  3DXK A;  4JK8 A;  3QFU A;  5C2D A;  4B1Z A;  5FPE A;  1BA0 A;  4FVU A;  3ENB A;  1Z05 A;  3G71 N;  1Y64 A;  3L4I A;  3VTH A;  3GOI A;  2FF6 A;  2FSJ A;  2YJF A;  5EVZ A;  3Q7C A;  3D2E B;  5GIO A;  3ZET A;  3VES A;  3KK7 A;  3MN6 A;  4H0V B;  4J8F A;  2VGN A;  3SBT A;  2E2O A;  1GLL O;  4C23 A;  5TKY A;  1KAZ A;  5JLH A;  5GIP A;  3CJA A;  1X3N A;  1XUP O;  4ILG B;  4M7X A;  5AR0 A;  5C0Y A;  3H3N O;  5JMV A;  4BY9 C;  3P39 A;  4BVO A;  5CHI A;  1HJO A;  3BF3 A;  3KWG A;  5BRD A;  1T44 A;  3TSP A;  3TTD A;  2V51 B;  3IFR A;  4AF1 A;  1D4X A;  2CH5 A;  4MLE A;  5ELZ A;  2JWL A;  4CZF A;  1V4S A;  2YI1 A;  4MLH A;  3ATV A;  1KD1 O;  2WUS A;  4NO7 A;  3CQX A;  4XEI A;  3BUZ B;  1K8K B;  1S3X A;  4IO9 L;  5C15 A;  3VET A;  4JD2 B;  3S41 A;  3FZL A;  3T7Z A;  3WQT A;  3PIP L;  4CZE A;  1VQ8 N;  1X3M A;  4BGA A;  2F9W A;  4JKD A;  2QA4 N;  4GV3 A;  4PKH A;  2P9P A;  3MCP A;  3A5O C;  5EOY A;  2HST A;  1ATS A;  3HI0 A;  2P9K B;  4JAX A;  5EY4 A;  1GLB G;  3CPW M;  5HL7 L;  1YXQ A;  2QWQ A;  3J7Z O;  3TTC A;  5HOO A;  4OO1 J;  1JCG A;  2P9U A;  3O9T A;  1NGJ A;  1E4F T;  2I7N A;  3ENO A;  3EKS A;  2CGJ A;  4WF9 L;  1U2V B;  3AGR A;  5AQN A;  1Q18 A;  3IDH A;  4B1U B;  4CBX A;  4ISG A;  3OBY A;  4K42 A;  3ZET B;  3CJ7 A;  1ESV A;  1DT9 A;  4YDU A;  3P38 A;  4KH4 A;  4CBU A;  3TTF A;  1QQM A;  5GAG P;  5BPN A;  3A5L C;  3O9U A;  2QTD A;  1ATN A;  1SAZ A;  3C6A A;  5AZI A;  4B1W B;  1BUP A;  2E2Q A;  1S22 A;  2OTJ N;  4JHD B;  5EXW A;  3H45 C;  4AM7 A;  4BRH A;  4GY2 B;  4H5R A;  1DEJ A;  3ID6 A;  4YOT A;  3DXM B;  1BO5 O;  2VWB A;  4JEP A;  2HF4 A;  2Q1N A;  3DAW A;  2F7T A;  3KHY A;  4QS7 A;  5AQH A;  2E8A A;  4CD3 A;  1VQ5 N;  3MMV A;  3ULE B;  1P8Z A;  5F1X A;  3QBW A;  2VGM A;  4EHU A;  3SAF A;  4GV6 A;  3LL3 A;  1J6Z A;  1QVF M;  2E88 A;  2WBN A;  3CJB A;  1LOT B;  3DJC A;  4YOR A;  1C0G A;  4IFE A;  2KLA A;  3A5N C;  5AQW A;  4BR4 A;  4BRG A;  3R3L A;  3ATU A;  2RHK A;  3GE1 A;  3KZB A;  2P9U B;  2QWR A;  3T69 A;  1CZA N;  3VEV A;  2Q31 A;  3WQU A;  4JKB A;  4EFH A;  1ZBS A;  5DM7 L;  4YOV A;  1YJN N;  5C2F A;  4BRC A;  3K9J A;  5AQR A;  2NLX A;  3IUC A;  1VQO N;  1M90 O;  1QZ5 A;  1MDU B;  4GVE A;  5JLF A;  3CCV N;  2GX9 A;  5AZI B;  4FWQ A;  3OBW A;  5FPM A;  3MWT A;  5GAE P;  3OHR A;  4IJN A;  3UKU A;  4G9Z A;  4WQ4 C;  1M1K O;  4H5W A;  1T3V A;  3EE8 A;  3U9Z A;  5JVG L;  3N4Q A;  4MO4 A;  3SJH A;  1YUW A;  4CZH A;  4BRL A;  4IJA A;  4JK9 A;  4Z94 A;  4WFN L;  3DLL L;  4QS8 A;  3CJ1 A;  4JKG A;  2GEL A;  3CC7 N;  1KC8 O;  1XQS C;  2HF3 A;  1HKC A;  5FPN A;  2Q36 A;  5KPZ A;  3LDO A;  3KWI A;  1GLC G;  2NRV A;  4AM6 A;  3EZW A;  4LC9 B;  2IIR A;  1XC3 A;  4IOA L;  4YOU A;  4FPA A;  1Q7Y O;  3WXI A;  3CCE N;  4PL8 A;  3W0L A;  3C7N A;  3UKR B;  1QVG M;  4MDA A;  3QDK A;  5M1O A;  2A41 A;  3WT0 A;  3H3O B;  5AQX A;  3MX5 A;  1QHA A;  3HM8 A;  4IO8 A;  3LDL A;  5AQI A;  1IJJ A;  4A5A A;  4C1N K;  4CZG A;  1ATR A;  3ID8 A;  4C1N I;  2FXU A;  3G25 A;  3UB5 A;  1LCU A;  2YHY A;  4JKC A;  5M1Q A;  2D1K A;  3CHW A;  4IEE A;  3RSE B;  3LDP A;  4YOX A;  2C1I A;  3IKM A;  2IVP A;  4H5N A;  1T6D A;  5AQK A;  3ZEU B;  4H0T B;  4H5V A;  5JIC A;  2Q0R A;  3AAP A;  2P9I A;  3EN9 A;  5LJW A;  3TPQ A;  3L0Q A;  2RE2 A;  2GUP A;  3CER A;  4BRA A;  5FPD A;  2HBL A;  3E9L A;  3NVK A;  5LY3 A;  1VQK N;  3P4I A;  4BRM A;  1HKG A;  1QQN A;  1YAG A;  3CJ9 A;  1SQK A;  5AQT A;  3B8A X;  5BR9 A;  1NGI A;  4DB3 A;  5M1N A;  3WEE B;  3G6E N;  3CME N;  3E1Y A;  1MWM A;  1S72 N;  3CCJ N;  5AQG A;  3WUH A;  2E1Z A;  2QXL A;  2ITM A;  3PIO L;  3D7E O;  2P9S B;  4A57 A;  3AAQ A;  4H0X B;  2Q97 A;  5AQL A;  2F9T A;  4WCE L;  3CC2 N;  4BGB A;  3DXK B;  1C0F A;  3I33 A;  3M5R A;  5AQJ A;  3CI5 A;  3RVC A;  4IOX A;  4BEB A;  3D2F A;  4FSV A;  3LDN A;  4XH5 A;  3GBT A;  3EKU A;  3SMP A;  1SZ2 A;  4HWI A;  3CXC M;  4B9Q A;  3AGK A;  3O8M A;  3CD6 N;  1GLA G;  3H1Q A;  2FLO A;  5AQF A;  4UY8 O;  1HPM A;  3VF6 A;  3WXK A;  2FSK A;  4BQZ A;  2E2N A;  4BRK A;  3FZH A;  4BR9 A;  3VOV A;  1JJ2 M;  4A61 A;  4H0Y B;  1EQY A;  4K41 A;  4E1J A;  1BDG A;  2BTF A;  2QWN A;  4M7Y A;  4I6M A;  3VEZ A;  4BE7 B;  4XH4 A;  5GAD P;  4PKI A;  4CZJ A;  5BRF A;  4FL9 A;  2UYT A;  4IOC L;  5GAH P;  3O1W A;  5BPL A;  3BEX A;  4H0O A;  5M1K A;  3VMF B;  3AAR A;  5E84 A;  4DQ8 A;  2NRT A;  3SLC A;  2ZWH A;  2D4W A;  3CIP A;  2A40 A;  2IVN A;  3O6W A;  4IDH A;  2QW9 A;  4A2B A;  2KKZ A;  4FWM A;  5BN9 A;  4CI6 A;  2KHO A;  1HKB A;  3TSQ A;  1TYQ A;  5DM6 L;  1VQL N;  1JCF A;  1KAX A;  1RDW X;  2BUP A;  4KBO A;  3FZF A;  4A62 A;  5AQS A;  3H6E A;  2A6A A;  3LM2 A;  4FWN A;  2P9P B;  1Q82 O;  1N8R O;  3HBT A;  4BR7 A;  3SBG A;  3U4L A;  1NGC A;  3FGU A;  4BRD A;  3L6Q A;  3OA9 A;  3R9P A;  1NGG A;  1NGE A;  2NRH A;  5LJV A;  3M1F A;  4JK7 A;  4K25 A;  1GLE G;  3O80 A;  3O4W A;  3QB0 A;  4JN4 A;  4BRP A;  4EIA A;  3A8Y A;  2GWJ A;  1HUX A;  3CCQ N;  1NGF A;  3QBX A;  3K9K A;  3WXL A;  4H03 B;  4KH5 A;  4BR2 A;  1K73 O;  5TKW A;  1QQO A;  4BVP A;  3QML A;  1KAY A;  4IXC A;  3MDQ A;  3R8E A;  3P31 A;  1YJW N;  1KQS M;  3F2K A;  5BN8 A;  2A42 A;  2A3Z A;  3VF2 A;  2BH1 A;  4JKF A;  2ASM A;  2QWM A;  5H1S Q;  4FWR A;  4FOE A;  4FWK A;  1VQN N;  3CCL N;  2A5X A;  2E20 A;  5AQV A;  1YF5 L;  4OPA A;  1WOQ A;  2NNW A;  2PAV A;  1NWK A;  1K8A O;  4FWO A;  2Q0U A;  3H46 O;  1YHQ N;  1Q81 O;  5AQO A;  4GV9 A;  1YI2 N;  3O9S A;  3O5B A;  3VEN A;  5JVH L;  5BRE A;  1G99 A;  3L4Q A;  1NMD A;  3O1B A;  5F0X A;  3IMX A;  4NB4 A;  5B8H A;  4WYB A;  1SS6 A;  3E66 A;  3A5M C;  4ILH A;  2NRX A;  5KPT A;  3A0I X;  2E2P A;  4B1Y B;  2VYP A;  5EX5 A;  3I8B A;  1ZXO A;  3HSC A;  1TYQ B;  3VF4 A;  4CZK A;  2ZJQ L;  2GTD A;  2WC9 A;  4DHY A;  4O8U A;  4A2A A;  2WFB A;  3O9Q A;  4WFA L;  3ZX2 A;  3CCM N;  4BEC A;  2ZGY A;  3LM9 A;  5CE3 A;  1EO1 A;  1K8K A;  3SK3 A;  4ISF A;  2OAN A;  4O5F A;  3CET A;  5AFU H;  3N4P A;  3PLA A;  3F5T A;  2OTL N;  5AQY A;  3HZ6 A;  5I9E B;  3JXU A;  4YOY A;  2P9N A;  3EL2 A;  4O8K A;  3KVG A;  3MN9 A;  5M1P A;  4JKH A;  2AP1 A;  4IZ9 A;  4RCH A;  4A59 A;  1BA1 A;  5BRH A;  3VER A;  2P9K A;  2FF3 B;  1H1V A;  3AY9 A;  3CPE A;  4XH1 A;  1GLD G;  2HBJ A;  3H1V X;  1W97 L;  3HOS A;  2J4R A;  3M6G A;  3UE5 A;  3VEO A;  4B1V A;  1YIT N;  3FFK B;  1VQ6 N;  3GDQ A;  1X9J A;  3HRG A;  5C10 A;  3CCR N;  1T6C A;  2QWO A;  4CZL A;  3FLC O;  2EWS A;  1RDU A;  4BRQ A;  1U2V A;  2NRZ A;  3E9P A;  4PKG A;  5AFU A;  2VCP A;  2NZT A;  4F9O A;  3W3D A;  3BP8 A;  4WQ5 C;  1V4T A;  2HBM A;  1MWK A;  2QM1 A;  3FZM A;  3UKU B;  4BQL A;  2CGL A;  1ILY A;  4CJ7 A;  1RFQ A;  3U8X A;  2QEX N;  1Z6R A;  2E1Y A;  2QWP A;  5AQZ A;  4FWL A;  2W41 A;  2FSN A;  4JHD A;  3SMS A;  3CJC A;  4JKG B;  4BRE A;  1BOT O;  4OPH A;  3NMU A;  3CCU N;  2H3G X;  1OVY A;  3DXM A;  4CBW A;  2I7P A;  4M63 C;  3ULE A;  3VPZ A;  1BU6 O;  4BRF A;  3CMA N;  1YJ9 N;  4FWS A;  2DPN A;  2Q2R A;  2ZJR L;  4WQ4 A;  3E9O A;  3GL1 A;  3C7N B;  1VQ9 N;  2P9N B;  5KQD A;  2ZGZ A;  1YVN A;  1BWF O;  1HX1 A;  4BRO A;  3R1X A;  1VAZ A;  1NGH A;  1VQM N;  4NLB A;  2NRW A;  2YCH A;  1NGA A;  3MWP A;  2D0P A;  5CR4 A;  4GNI A;  3MX2 A;  3VEW A;  4BRN A;  4FWP A;  1GLJ O;  4H5T A;  3SAH A;  2HOE A;  4EAH D;  3CCS N;  3C6H A;  3QIC A;  3GG4 A;  1TUY A;  2P9I B;  1NJI O;  2V7Y A;  1OKJ A;  4R79 A;  3VEX A;  3ZX3 A;  3FR0 A;  3MCA B;  1DKG D;  5C12 A;  4ILJ A;  4JNE A;  5AZJ A;  5GIN A;  5AQQ A;  4BG9 A;  1QZ6 A;  1VQ7 N;  1E4G T;  3FZK A;  3ZYY X;  4FPB A;  4B1X B;  3I56 N;  4ISE A;  4IEI A;  3Q7B A;  3VTI A;  3C65 A;  2QWL A;  1K9M O;  3MN7 A;  1RGI A;  4PL7 A;  5MLC Q;  3DWL A;  4BC4 A;  1W2B M;  4QS9 A;  2QI2 A;  3J8A A;  4JKE A;  3WXM B;  3VGK A;  2GEM A;  2P9L A;  3CC4 N;  2V52 B;  3TSU A;  4DKW A;  4EHT A;  2W40 A;  2HBK A;  1NLV A;  1ZC6 A;  2CH6 A;  2HMP A;  4K43 A;  2YHX A;  4U7B A;  1KXP A;  3D2F B;  5KQ8 A;  2C1G A;  2CGK A;  2W00 A;  4WQ5 A;  1R59 O;  5BPM A;  2ZF5 O;  3VGL A;  3ENH A;  3ZX0 A;  2YHW A;  3HTV A;  4U67 L;  1Q86 O;  4MO5 A;  1VQ4 N;  4BR0 A;  3QFP A;  2ASO A;  1MA9 B;  2ASP A;  3JS6 A;  4FO0 A;  4BR5 A;  3EE9 A;  5M1F A;  3NVM A;  3WXJ A;  5KPR A;  3D2E A;  3EO3 A;  4CZM A;  4Y0W A;  1VQP N;  2V7Z A;  3UKR A;  4I6M B;  5AQP A;  4BC3 A;  1IG8 A;  2GWK A;  3I55 N;  3O9R A;  3O08 A;  3U9D A;  4WFB L;  5ADX H;  4MDB A;  4BC2 A;  1U6Z A;  3G4S N;  2AA4 A;  3RSE A;  5AZJ B;  2PFU A;  5AQM A;  4XJX A;  3OW2 M;  2IVO A;  4IWV A;  3ZEU A;  3M3Z A;  4DCH A;  3F9M A;  1GLF O;  1JCE A;  4CD1 A;  3BF1 A;  2JWK A;  1P90 A;  3HOT A;  4RTF D;  4NLC A;  4PHT X;  1HLU A;  4KH6 A;  3C0B A;  1NGD A;  2P9L B;  3D6R A;  4BRI A;  2PBD A;  1WUA A;  3FE1 A;  2ZJP L;  4BG8 A;  1DGK N;  3VGM A;  4JD2 A;  4RWT A;  4YOW A;  4BC5 A;  5E26 A;  3MN5 A;  4YDU C;  3TU5 A;  3WEE A;  4A5B A;  5ADX A;  1NGB A;  5F2R A;  3SAG A;  1BG3 A;  4H0P A;  1YIJ N;  5AQU A;  2YX6 A;  1NM1 A;  4HTL A;  2D0O A;  3CQY A;  2YJE A;  3LDQ A;  4JKA A;  2P9S A;  3MK6 A;  3VEY A;  4CZI A;  4L3Q A;  4FOI A;  1NBW A;  1O13 A;  1TUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...