4JD2A

Crystal structure of bos taurus arp2/3 complex binding with mus musculus gmf
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
414
structure length
398
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structural basis for regulation of Arp2/3 complex by GMF.
pubmed doi rcsb
molecule tags Structural protein
total genus 124
structure length 398
sequence length 414
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jd2A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jd2A02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4jd2A03
2YI1A 2DPNA 2P9PA 2P9SA 1JCFA 3O08A 4CZIA 1SQKA 2NZTA 2KHOA 2PBDA 5AQYA 4EFHA 1MWKA 1Z6RA 2GELA 4IJAA 3QBWA 1HLUA 4H5NA 4BGAA 5JICA 5AQNA 3O6WA 1QHAA 1HJOA 2E2NA 1LOTB 3A0IX 3WXJA 3GOIA 5BPNA 4BC5A 4H0XB 4BRPA 3VF4A 4JD2A 4PL7A 3CJ1A 5F1XA 3VOVA 4B1VA 2FF6A 1ESVA 5BRFA 1TUUA 3LDLA 1TYQB 2QWLA 2FF3B 3WXLA 4EHUA 3UKUB 5EXWA 2IIRA 5AZJB 3DJCA 1JCGA 5BR9A 4BR7A 4BR9A 4C23A 2GUPA 1GLCG 2YHWA 4XH5A 2NLXA 3H3NO 5AZIA 4JNEA 3AAQA 4QS8A 4FSVA 3MDQA 1J6ZA 5BRHA 4BRMA 2FLOA 3VESA 4BRIA 4H0TB 3FZKA 2P9PB 2E2PA 4PL8A 2P9SB 3TPQA 1CZAN 3CERA 3ZEUA 5AQHA 2ZF5O 5AQIA 3AAPA 3O8MA 4K42A 4IWVA 4BRGA 1T6DA 1D4XA 3WQUA 1C0GA 4BRDA 1K8KA 1EQYA 1KAYA 3CI5A 4B1YB 1QQOA 3QFUA 3WT0A 3IUCA 4JD2B 4BR4A 3OHRA 3GG4A 5JMVA 4CBUA 5JLHA 3C0BA 1DEJA 4AM7A 4BROA 3D2FA 4CD1A 5KQDA 3L4IA 4MO4A 3JS6A 1WUAA 3CJ9A 2E1YA 1Y64A 3H46O 3HZ6A 4FWMA 3VENA 3CJAA 1HKBA 2Q0RA 3GBTA 3P4IA 2CH6A 4J8FA 3VERA 3CHWA 4CD3A 2FXUA 3QMLA 2BTFA 5ADXA 2Q36A 3FR0A 4E1JA 2UYTA 3H45C 5EOYA 1U6ZA 3SMPA 1RGIA 3A5OC 1MWMA 3EN9A 5F2RA 2QM1A 2E20A 3VEYA 5AZIB 3O5BA 2FSNA 5JLFA 3LDOA 2QWOA 3ZX2A 1V4TA 5AQSA 3EO3A 4MLHA 1BOTO 3GL1A 1BA0A 1KAZA 4FWPA 5B8HA 4QS9A 1NGDA 1S22A 3BEXA 3LL3A 2ZWHA 2E1ZA 5EX5A 4A61A 1ZXOA 3H1QA 3BUZB 4HWIA 3ZEUB 4QS7A 4YDUC 1KXPA 2QWNA 1R59O 3KVGA 3WQTA 3O4WA 2ZGYA 4FWLA 4B1XB 1NGEA 3WEEA 3RSEA 4F9OA 1ATSA 3WXIA 1HX1A 2Q1NA 3HTVA 4CZGA 4JHDA 4CZEA 3SJHA 4YDUA 2HMPA 4JN4A 3CQYA 1H1VA 1K8KB 3FFKB 5AQPA 2BUPA 3M3ZA 4EAHD 2HF3A 3BF3A 3MN7A 2H3GX 3IDHA 4FWRA 1BO5O 4FWNA 3D2FB 3FGUA 2D0OA 2V52B 4FOEA 4ISGA 1ZBSA 4CJ7A 2J4RA 3HBTA 5AQRA 5BRDA 5KPTA 1Z05A 3MMVA 4M7YA 1U2VA 3FZFA 3J8AA 5AFUA 3VF6A 1ZC6A 4A2BA 5BN8A 4H5TA 4IJNA 4XH1A 1ATRA 3DXKA 1GLEG 1T6CA 4CZLA 4FL9A 1GLLO 3QDKA 3HSCA 5AFUH 4CZFA 2YJEA 4WYBA 3R6MA 4XEIA 1NM1A 2GTDA 3FZHA 3O80A 5AQTA 4BC4A 3EKSA 4PKGA 2NRHA 4H5VA 4CBWA 3L6QA 5FPDA 5BPMA 3SK3A 2IVNA 4RTFD 4H0OA 1SZ2A 4A62A 4Y0WA 2VYPA 3WEEB 3RSEB 3VEWA 4CBXA 1MA9B 4M7XA 3D2EB 3VEVA 4JHDB 3ZX3A 5LJVA 3U4LA 2I7NA 2P9NA 2GEMA 3VF2A 1NGAA 1NGCA 5ELZA 4WQ4C 1DGKN 2W40A 4M63C 2Q2RA 1NGJA 2ASOA 1GLAG 1QZ5A 2Q97A 3D7EO 5EVZA 4WQ4A 2F9TA 1BUPA 3A8YA 1BU6O 5BREA 3MK6A 4BG9A 2CGJA 1YUWA 3A5MC 4RWTA 2W41A 2Q31A 5KPRA 3ENHA 1JCEA 1E4GT 2D0PA 1LCUA 1GLJO 3CJCA 3O1WA 3EL2A 1GLDG 5BPLA 1U2VB 3DXMA 5AQMA 1G99A 3FZLA 3GDQA 5FPMA 4BREA 4IO8A 2Q0UA 3HM8A 3SLCA 3DXKB 3MN6A 5LJWA 3WXKA 3M1FA 4FPBA 1Q18A 4DB3A 4H5RA 5E26A 1BWFO 2ZGZA 4B1ZA 1GLBG 5AQJA 3U8XA 3VEOA 4H0PA 2A42A 4NB4A 2QXLA 1NMDA 1X3NA 4DQ8A 2FSJA 4BRFA 2CGKA 1E4FT 3C7NA 1NGFA 5LY3A 2CH5A 1OKJA 1GLFO 4FOIA 3W0LA 4BC3A 1QQMA 5KQ8A 3IFRA 3MCPA 3ZETA 1QQNA 2P9NB 2V51B 3UE5A 1IG8A 4B1WB 3MN9A 3S41A 1NGGA 4BG8A 3EKUA 5FPEA 2A6AA 3UB5A 2YJFA 3QBXA 4AM6A 1TUYA 4BRHA 2FSKA 3LDPA 3D2EA 1SAZA 5AQKA 4BRNA 4NO7A 3H6EA 3FLCO 4BRKA 4CZMA 2P9LA 3QICA 4EHTA 3ULEA 4PKHA 4GY2B 1S3XA 2AP1A 3I8BA 3UKRA 3VEXA 3BF1A 3DXMB 1RDWX 2IVPA 2VCPA 2AA4A 4WQ5C 5F0XA 2I7PA 2IVOA 3U9DA 4FO0A 1XQSC 2V7ZA 3LDQA 2V7YA 1T44A 2QWQA 3CJBA 3VGLA 2D4WA 2GWJA 3H3OB 4H5WA 3ATUA 4H0VB 4WQ5A 4BR2A 1NBWA 2CGLA 3GE1A 4CI6A 3QB0A 1HKCA 3JXUA 1KAXA 2HF4A 1HKGA 1HUXA 2HOEA 3C7NB 3AY9A 5AQZA 4BR5A 4B9QA 4K43A 3MN5A 3ZETB 2ITMA 1WOQA 4FPAA 3M6GA 1C0FA 2P9UA 5AQUA 2ASPA 4BRLA 3A5NC 4K41A 4BVPA 4FWOA 1NGBA 3H1VX 1X3MA 2P9KA 3F9MA 2A41A 3KZBA 5AQQA 5AQWA 4KBOA 2E88A 3WUHA 3KHYA 1RFQA 3DAWA 1XC3A 3VETA 4HTLA 1NWKA 1IJJA 2P9LB 3FE1A 3ID8A 2D1KA 3ULEB 3VGMA 3CQXA 4MO5A 3VGKA 3UKRB 1P8ZA 2P9IA 2VWBA 3DWLA 4BVOA 1DKGD 4I6MA 4RCHA 1MDUB 3AARA 4FWSA 3I33A 5KPZA 4CZHA 4DHYA 4EIAA 3VEZA 1NGHA 3LM2A 2OANA 5EY4A 1BA1A 2YHXA 4BRQA 5AR0A 1BDGA 3LDNA 2GWKA 4BGBA 2A40A 3EZWA 4ISFA 5AQXA 4JAXA 5E84A 2E2QA 4ISEA 5AQOA 3U9ZA 3CETA 3IMXA 3VPZA 1QZ6A 2E8AA 2QWRA 4O8KA 2QW9A 4Z94A 2QWMA 4H03B 5FPNA 3CIPA 4BC2A 2EWSA 4L3QA 3BP8A 2P9UB 4XH4A 2YCHA 2F9WA 4CZJA 1HPMA 5AQVA 3R8EA 4K25A 5I9EB 5TKYA 1NGIA 2P9KB 4BRCA 4DCHA 4IXCA 1NLVA 3R9PA 1BG3A 4FWKA 3G25A 5CE3A 3SMSA 2QWPA 4H0YB 5AQFA 2P9IB 1X9JA 2PAVA 3ENOA 3A5LC 5AQGA 4GNIA 4I6MB 4BRAA 4BR0A 3TU5A 3FZMA 2ASMA 3QFPA 4BQZA 3LM9A 4FWQA 3L0QA 2A5XA 1TYQA 5ADXH 2YHYA 1YAGA 3ATVA 3O1BA 2A3ZA 2E2OA 4A2AA 3UKUA 1ATNA 4O5FA 5AZJA 2WUSA 4MLEA 1YVNA 5AQLA 3W3DA 3CJ7A 1YXQA 4B1UB 4PKIA 4BQLA 1XUPO 3ZX0A 3HI0A 4IZ9A 4LC9B 1V4SA 3B8AX 4CZKA 5BN9A
chains in the Genus database with same CATH superfamily
2YI1A 5C2FA 3AGKA 1EO1A 3HPGA 4RW4A 3O4QA 2P9SA 3DLGA 2P5OA 3KWGA 3DYAA 4CJ5A 4HUGA 3TTCA 4E1MA 1VQ7N 4BWMA 3QETA 1U48A 2PY5A 4IJAA 5AQNA 4IOAL 3A0IX 1HJRA 2G8VA 3VQAA 4M3YA 4DUZK 3WXJA 4LH5A 5BPNA 4PL7A 2BE2A 1E3MA 1N5YA 4O55A 4B1VA 1XWLA 1OH7A 4OPAA 3PX0A 4FJ8A 4OLAA 3SV3A 2QWLA 2FF3B 5J2PA 3V9XA 5GAHP 3UKUB 4CHNA 5EXWA 2IIRA 3DJCA 4CVNE 5LMNK 1RT7A 3L4QA 4BR7A 1Q82O 4C23A 3CYMA 1WAJA 4HVJA 5JVGL 2GUPA 1S72N 1GLCG 1A5VA 4B3OA 4B3TK 4OKJA 3S3MA 4FSVA 3MDQA 4MDAA 2G8IA 4JKDA 3VESA 4BRIA 4FJ7A 1NJWA 2VWJA 3AO5A 3SV4A 1U4BA 3FZKA 1VHXA 4FZYA 4CHYA 4M3XA 2E2PA 3CCJN 1NK7A 2ZF5O 2B4JA 3TAGA 4DFKA 1KD1O 4X66K 4NLBA 3SQ0A 4IWVA 4ILHA 3VQDA 1QSLA 2R7YA 4CEEA 1B9FA 2O8FA 1VSMA 1VAZA 4O4GA 1WLJA 4M3TA 2KKZA 4B1YB 3QFUA 3IUCA 4JD2B 3OS2A 1NKBA 5JLHA 4AM7A 3CMAN 3F5TA 5KQDA 3P5JA 4IBNA 1S1TA 4MO4A 3JS6A 1WUAA 3K0SA 3SNNA 3H46O 3O3FA 4FWMA 4GMJB 4IOCL 1JL2A 1HKBA 4J8FA 2CH6A 4FLVA 4CD3A 2FXUA 3MX5A 1RBRA 2BTFA 2Q36A 3OA9A 5EOYA 4AH9A 4CFAA 1JXBA 3OYGA 3A5OC 2HNDA 5HL7L 5F2RA 2OPRA 4LF9K 4DR6K 1ZBUA 2KLAA 2E6LA 3EO3A 3GL1A 5B8HA 1NGDA 4FK2A 3LL3A 3VTIA 5EX5A 1C0TA 3ZEUB 4E7KA 4I2QA 1P90A 3ZT4A 1NGEA 2DFEA 3KIOA 4JLHA 1TKTA 1HX1A 3HTVA 5HBMA 3CFRA 2XY8A 4JN4A 4IFVA 3M3ZA 5JVHL 4C1NI 2PZSA 4KV8A 2JLEA 2WOMA 4RW7A 3LP2A 3J81O 4IG3A 1KRPA 4Z4FA 3TAFA 3D2FB 2HBKA 3E1YA 3VQ6A 4R5PA 3THWB 4B9SA 4JI2K 4ISGA 5KRSA 4O8UA 5AQRA 1SL2A 3DI6A 1Z05A 3MMVA 4M7YA 4FJKA 3AA2A 4CF8A 2D0BA 4H5TA 1ATRA 3DXKA 1EKEA 3NF7A 3SPZA 1RT5A 1T03A 1VQ4N 3ZT1A 1LV5A 4CJLA 4CZFA 2YJEA 4WYBA 3QERA 2GTDA 3O80A 4DG1A 1FXXA 4PKGA 4OKEA 4M3WA 5IWAK 1UA1A 2OPSA 3QIPA 1HNXK 4K8XA 2I5JA 3AGRA 4YOTA 2OTJN 4Y0WA 2VYPA 3WEEB 3RSEB 1WN7A 3VEWA 4CBXA 1FKPA 3QESA 3NF6A 5LJVA 5CZ1A 3NGYA 3DLLL 1RT1A 1NG9A 4YHHK 4WQ4C 3MXJA 4M63C 4KHYA 3H08A 2Q2RA 2GV9A 1QZ5A 2Q97A 4WQ4A 3A8YA 5BREA 4RWTA 2XY7A 3U6FA 1VQKN 5KPRA 3TANA 3ENHA 1LCUA 1GOBA 3LANA 5AQMA 5FPMA 4X64K 3ZT0A 3CQ8A 4BREA 4IO8A 3K2PA 5C12A 3MN6A 3CC2N 3WXKA 1FKOA 4FPBA 1JLFA 1Q18A 4O0JA 3RVCA 4FM2A 4K8ZA 3U8XA 2GBZA 5IT9O 3ZT3A 3VQ5A 3TR8A 1NMDA 2HW3A 4RW6A 4DS5A 4M41A 1HYSA 3BZCA 2CGKA 4H4MA 4IEIA 5LY3A 1OKJA 3IAYA 4NXNK 1ASVA 3OYJA 1CZBA 1J9AA 4BC3A 2O8BB 4E89A 3HRGA 5KQ8A 1NJXA 1Y97A 3OYEA 1QQNA 3PUFA 4EZ6A 3HSTB 4KHQA 4B1WB 1RBSA 1YTAA 4BG8A 3EKUA 3CCLN 3L2UA 1NKEA 4J2EA 4AM6A 4FLTA 1J54A 3JSMA 1VQ6N 5MLCQ 4BRNA 3H6EA 3FLCO 3HOTA 3ULEA 5GIOA 1S3XA 3T1AA 4EP4A 4WFBL 1NK4A 4NYFA 4WQ5C 4DQRA 1XQSC 2V7YA 1T44A 3VGLA 5C10A 3MEGA 2QKBA 4LY7A 3KWIA 1VK0A 3SBTA 4H5WA 4H0VB 4WQ5A 1C0MA 1NBWA 3BY5A 4JI6K 3CCQN 4DSLA 4I7FA 1KAXA 1HKGA 1HUXA 4ID5A 3C7NB 3AY9A 3KKSA 4WE1A 5AQZA 4CJSA 4R79A 4B9QA 3KD1E 2OTLN 3MN5A 3ZETB 2ITMA 1IBKK 4DQIA 2C1IA 1C0FA 1Q8IA 5AQUA 4E7LA 1VQ9N 2ASPA 3A5NC 4FZXC 4CJFA 4CE9A 4K41A 4BVPA 1N36K 2BANA 1NGBA 3U3GA 1X9WA 4DS4A 3F9MA 3PIOL 2E88A 3M5RA 4WF9L 3WUHA 4CGGA 1RFQA 3DAWA 1XC3A 3VETA 3OYLA 4MFBA 3CQXA 1NK5A 2P9IA 4RCHA 3EEQA 2F4VK 4CJEA 3LP1A 4IKFA 3MEEA 1T3VA 5H1SQ 3HVTA 4CJVA 4NCBA 3KLIA 1HNZK 3OYFA 1NGHA 4YOWA 2RF2A 4CGHA 2UXDK 4ILGB 5EY4A 3C65A 4N5SA 1BA1A 2YHXA 5AR0A 3LDNA 4IO9L 2A40A 4ISFA 5AQXA 1A5WA 4JAXA 5E84A 3OYAA 2E2QA 4BE0A 1QZ6A 1DTQA 4BC2A 3T1HK 4L3QA 4O44A 4XH4A 3T19A 3THVA 1RNHA 4DV2K 1HPMA 3MAQA 3QEVA 5I9EB 3C95A 4B9MA 3CFPA 2KZMA 2NRRA 2XY5A 4CFDA 1BG3A 4C1NK 2YHBA 1QTMA 1S9EA 4O5BA 3MWPA 1BIZA 4GW6A 4OX9K 4TSXA 3OYMA 3WNEA 3HT3A 4JS5A 4H0YB 4YNQA 1WSFA 3ZT2A 3OJUA 3TWHA 1TL3A 4BR0A 3RMDA 3FZMA 5BR8K 4JRPA 3CC7N 5C2DA 3SAFA 4FWQA 3K5MA 5ADXH 2YHYA 2NNWA 4A2AA 2VG7A 3UKUA 4FM0A 1ATNA 1S9GA 4DR5K 1YVNA 5AQLA 3CJ7A 4OVLA 4DU1A 1TAUA 2IGIA 1O13A 4BQLA 4M45A 3ZYYX 1XUPO 3ZX0A 4Z4CA 4PA1A 4KTQA 3B8AX 4DR1K 3OYKA 3LALA 1TGOA 4J2AA 4DLEA 3O08A 5EU7A 1GOCA 4CZIA 3TABA 4YOVA 1SQKA 2NZTA 3BDPA 4LFBK 2DFFA 2GELA 1Z6RA 2FC0A 1EWQA 1HLUA 4H5NA 4V19S 3NVKA 1QHAA 4LF5K 1SUQA 4BACA 4NYNA 4DU3A 1BISA 1X9SA 4DF8A 3GOIA 4BRPA 3E9LA 4JD2A 3M8SA 2F8SA 3PLAA 5F1XA 4CIEA 1NK9A 1L5UA 5BRFA 1YIJN 1ZBFA 1TUUA 3G0ZA 2B5JA 1WNSA 1OH8A 1TYQB 3MWTA 3B6OA 4N41A 4EHUA 4CGJA 3AVHA 3LP3A 1Q81O 1Z26A 5AZJB 1L3VA 5CYQA 1L3SA 5M1QA 3EZ5A 3H3NO 3KK7A 3EY1A 4CJPA 5AJ3K 4QS8A 5BRHA 2PYLA 5GADP 3T1YK 3TTFA 4CEBA 4DTOA 1CZAN 4KKOA 4PY5A 3BZKA 4J2BA 4M3RA 3ZEUA 1BL3A 4N76A 4C8LA 5AQIA 3AAPA 4K42A 1VSLA 2Y1JA 4W5RA 5J2NA 3K5LA 1BGXT 4FJGA 4I9LA 3OTOK 4GVEA 1JL1A 1C0GA 2NRWA 3J7AP 1EQYA 1KAYA 4F3TA 3E01A 1XI1A 3WT0A 1S1VA 4BR4A 4KFBA 3GG4A 1K8AO 4BROA 3D2FA 2YHAA 4KREA 4U7BA 2NRVA 2GUIA 2E1YA 3THWA 1Y64A 1RDAA 3HZ6A 3CJAA 3WNGA 4YOUA 1NJIO 2Q0RA 4FJHA 1TK8A 1SV5A 3VERA 2DY4A 3L3VA 4K0KK 4E1JA 2FBXA 3SMPA 4KAZA 4X62K 2NRTA 2QM1A 2E20A 3LP0A 4LF6K 3LWLA 5JLFA 3LDOA 3C6TA 3ZX2A 4M3UA 1V4TA 2F7TA 1XMQK 3RMBA 1KAZA 1S22A 3BEXA 5FLXO 4A5BA 4KHPK 4GV3A 3Q7BA 4HWIA 3SUOA 4QS7A 4YDUC 1KXPA 2QWNA 1R59O 3KVGA 4JI0K 3Q7CA 2ZGYA 4B1XB 3WEEA 1VSJA 3RSEA 4FVMA 5HRPA 1X9MA 2Q1NA 5DMRA 4CZEA 3SJHA 4YDUA 2HMPA 4F2RA 4DSEA 3DOKA 3CQYA 1RT6A 1K8KB 5LMUK 4EAHD 3CC4N 1BQMA 3AVIA 5CZ2A 2QXFA 3THXB 3BF3A 2H3GX 2VGMA 1BO5O 3RR8A 3P83D 1K9MO 3FGUA 2D0OA 5M1NA 2V52B 3THYB 4FOEA 4DKWA 4ELUA 4OGCA 1YT3A 2ATQA 4CERA 5BRDA 4DFMA 1WBDA 1QE1A 1ZC6A 5BN8A 2Z1JA 1GLEG 1SKRA 1T6CA 1BCMA 4CZLA 1RT4A 3OYHA 3NF8A 3QDKA 2UU9K 4DV5K 1NK6A 2UUAK 1NM1A 1NU0A 3T7ZA 4CJTA 2QKKA 2IC3A 4Z4HA 3OYIA 3EKSA 4YOXA 1C1CA 3VN5A 4DSJA 4CBWA 3S3NA 4FJ9A 5K14A 4H0OA 4A62A 1RDDA 2O8BA 5C24A 4M7XA 3D2EB 4JHDB 2HNYA 2I7NA 3KLFA 3VF2A 1VQPN 3V1RA 1NGCA 5ELZA 2HHQA 1DGKN 4JS4A 1M1KO 2HSTA 1NGJA 2ASOA 3EE8A 4E1NA 1NOZA 1UWBA 2BH1A 5EVZA 1BHLA 4CESA 3D6RA 3A5MC 1YUWA 3VQ9A 2VQFK 2W41A 3HL8A 2Q31A 1JCEA 4CFBA 2D0PA 3QIOA 3O1WA 3EL2A 4DQQA 1UA0A 4OPJA 1U2VB 4KB0A 5JS1A 2Q0UA 3SLCA 4I9QA 4E7JA 3TSQA 3F73A 2OA8A 1KQSM 4H5RA 5CR4A 2Z1GA 3AA4A 4M42A 4B1ZA 1WB9A 3RMAA 4B8CA 2QXLA 3HK2A 1RBUA 1X3NA 4IOXA 4DQ8A 2FSJA 3C7NA 4FJNA 4Q0BA 5HRRA 3CXCM 1GLFO 1HNIA 1K6YA 2HNZA 3IS9A 3W0LA 4GV6A 4IFYA 2OYQA 1RILA 3ZETA 3KJVA 1X1PA 2E4LA 3UE5A 1IG8A 1REVA 3M8RA 3MN9A 3S41A 1RTJA 3CF5L 3RR7A 2A6AA 3V1OA 3QBXA 3SBGA 3L2VA 4BRHA 2KFNA 2FSKA 1SAZA 2HHXA 5I42A 3HP9A 1ZBHA 4CZMA 4BE2A 3QICA 4EHTA 2FBTA 5E41A 4GY2B 3I8BA 2AP1A 3VEXA 5DM6L 3I55N 3BF1A 3LWMA 3DXMB 4CF0A 3ALYA 2VCPA 5SWMA 4ZTJA 1VSDA 5F0XA 4DTNA 1KC8O 3QEIA 3QNOA 3LDQA 4JKCA 4FJMA 1I39A 4CW7B 2QWQA 4HHTA 2OCEA 2D4WA 1W0HA 1EWRA 3AO2A 3ATUA 2Z1IA 1NK8A 3GE1A 4CI6A 3QB0A 1HKCA 3J7YP 3ULDA 1HRHA 3HPHA 2ITGA 3PSFA 3G10A 1A5XA 3ID6A 1KFDA 4CK1A 2X74A 3N4PA 4AHVA 4JKBA 4FPAA 4CF9A 1RDUA 4BRLA 4DFJA 3T3FA 2FBVA 1EP4A 5C25A 2Z1HA 1Z25A 2A41A 3KZBA 5AQQA 1SKSA 4IG0A 3AVGA 1LWFA 1WSGA 2OPPA 1JJ2M 4B08A 5M1OA 4DTRA 4PWDA 2P9LB 3B6PA 3FE1A 3ID8A 4AF1A 1IKVA 1BCOA 2D1KA 3IKMA 4DV6K 1B9DA 1WAFA 3VGMA 3VGKA 5KGWA 3UKRB 1P8ZA 1OVQA 4O0IA 1ASUA 3NHGA 3O9UA 3M8QA 1BI4B 2HHUA 3OW2M 3I33A 5KPZA 1WBBA 2G8UA 4EIAA 2HBJA 3DLKA 4RW9A 3F2KA 1BDGA 1D8YA 1LW0A 2GWKA 4CFCA 4JK7A 5GINA 3EZWA 1UOCA 2XO7A 3VA0A 3DRSA 4ISEA 4JI1K 3HXMA 4E7HA 3CETA 2PFUA 2E8AA 1W2BM 3RRHA 3OS1A 4O8KA 2QW9A 1IBMK 3AO1A 5FPNA 4LSNA 4FCYA 3BP8A 2E6MA 4DQSA 2YCHA 4CZJA 4BDPA 1S1UA 1YF5L 4K25A 5TKYA 2P9KB 2HHTA 3RRGA 4DSKA 4DCHA 4A5AA 4DTJA 5CE3A 4ZHRA 2A1SA 4B9LA 2QWPA 4KTWA 1HNVA 4N47A 1W9HA 3NE6A 5AQGA 4F8RA 1VRTA 4GNIA 3CCMN 4CEFA 4GKKK 3TU5A 2ASMA 3QFPA 4BQZA 1W7AA 1JKHA 2A5XA 1TYQA 1S6QA 2AJQA 4FJLA 2LSNA 4LFCK 3D45A 2WUSA 5AZJA 1NOYA 3OYNA 4BDZA 3VQCA 4CJWA 2YNGA 3HI0A 1QQCA 3C94A 2QK9A 2DPNA 4BY9C 1G15A 1ITGA 4EZ9A 1BIUA 4CHZA 4FJJA 4CK2A 2P51A 2OZMA 4FLZA 5AQYA 2YKNA 1S5JA 3K9JA 4EFHA 3MXIA 3QBWA 1KCFA 5JICA 1N32K 3MXMA 1XNRK 2E2NA 4JI8K 2DTUA 1VQON 3NH2A 4C8OA 4CEOA 1J5OA 4BC5A 4H0XB 3VF4A 3CJ1A 1CXUA 1L3TA 3S9HA 1ESVA 5C42A 3N4QA 3V1QA 1OVYA 4C8MA 4DLGA 1HYVA 4OKKA 3WXLA 3EE9A 4KRFA 1R0AA 2RPIA 4CJQA 4BR9A 4Z4IA 4BE1A 1C1BA 4XH5A 5HROA 3ZSYA 4JNEA 2Y1IA 4DTXA 1J6ZA 3HP6A 1VQMN 4BRMA 2FLOA 2XHBA 4HTUA 1U04A 4H0TB 3EYZA 2P9PB 1NJYA 1XNQK 2RN2A 3TPQA 1IG9A 3CERA 4FYDA 3O8MA 3QEPA 1T6DA 3ZCMA 3M8PA 1K73O 3WQUA 1WSEA 4BRDA 1HQEA 1K8KA 3CD6N 1TV6A 3VQEA 3PO4A 1QQOA 3THXA 3SAGA 3VQ8A 3OHRA 1WSIA 5KRTA 4BDYA 2VG5A 5KTQA 1N34K 3C0BA 1DEJA 3TARA 4DF4A 4Z4GA 4CD1A 4B9NA 3DLBA 3CJ9A 3CCVN 2WBNA 3THYA 1IKWA 2RHKA 2XRIA 4ELVA 3U3YA 5M1FA 3CHWA 3CM6A 3QMLA 2YNIA 5ADXA 4DUYK 4BEBA 2UYTA 3H45C 2HMIA 4LSLA 3KTQA 1RGIA 3ASMA 3TAMA 1CXQA 3SCXA 4CGDA 3HOSA 3NH1A 4MQ3A 5AZIB 3O5BA 2QWOA 3AVBA 5AQSA 4MLHA 1BOTO 1BA0A 3P1GA 4FWPA 4QS9A 4PHTX 2ZWHA 2ZE2A 3H1QA 3BUZB 3WQTA 3O4WA 4FWLA 4LFAK 3CM5A 4DV7K 4KH5A 1ATSA 3WXMB 1KVCA 1QVGM 3NGZA 4CZGA 4JHDA 3E9OA 4AQYK 3RTVA 1H1VA 5AQPA 1RDBA 4JRQA 1XHXA 3O9TA 4OO1J 1D9DA 3NDKA 4FWRA 3KK2A 1JLQA 1JLBA 2NRXA 2HHVA 3CCEN 3PX4A 4FLUA 2BDPA 1JLCA 4BE7B 3AV9A 1ZBSA 4FLXA 4CJ7A 2WTUA 4W5QA 3PV8A 3O3HA 3CFOA 1SKWA 1U2VA 3FZFA 5LL6Z 5C0YA 5J2MA 3ZSWA 5J2QA 4B3SK 4WFNL 2O8CB 3K59A 3NF9A 1N8RO 3MECA 4FL9A 4FZZA 2G8FA 4XEIA 3R6MA 3FZHA 5AQTA 1SL1A 4XIUA 2VGNA 4AHRA 3L6QA 3NAEA 5BPMA 2QI2A 3SK3A 4RTFD 1SZ2A 1KLNA 4NLCA 4LF7K 3VEVA 3ZX3A 4Q5VA 2RKIA 3SQ2A 1RDCA 1QVFM 1IH7A 4NCAA 2X6NA 3LZIA 4QOZB 4NXMK 3AO4A 4LD0A 4FJIA 1OH6A 3D7EO 2A1RA 2F9TA 1BUPA 3VTHA 4FW2A 3CPWM 1U45A 1KVAA 4DV3K 2D0CA 2VG6A 2UXCK 3G4SN 4JI5K 2UXBK 1GLDG 3HPOA 3DXMA 4CEZA 1G99A 3CYGA 5HRSA 4DR3K 3DLHA 3HO1A 4KHWA 3HM8A 5FDLA 2NUBA 3VQ4A 2ZQBA 5LJWA 4B9VA 4CJRA 3JAMO 5E26A 5GIPA 1BWFO 3V81A 2UUBK 2IAJA 2ZGZA 4LF4K 3ZSVA 2A42A 1JLAA 4RW8A 3SQ4A 1E4FT 1NGFA 2CH5A 2W00A 4FOIA 2O4IA 3K58A 1RT2A 1QQMA 3K57A 3IFRA 4CEDA 4CIGA 2W42A 1ASWA 2P9NB 2V51B 4DV1K 1RTDA 2ZJRL 2G8KA 4Z0UA 5FPEA 4JI7K 2YJFA 1DTTA 4CJ4A 4KHNA 4N56A 3LDPA 3V9UA 3LDSA 3KK3A 4NO7A 3ZSQA 4ICLA 3BGRA 2P9LA 1YHQN 3SUQA 3PX6A 3UKRA 3KLGA 1RDWX 4DTSA 4YY3K 3V9WA 4W5OA 2I7PA 2IVOA 3U9DA 2G8HA 4FO0A 1BI4A 4QCLA 3O9QA 2GWJA 3H3OB 1LWCA 3AVMA 4KO0A 4CJKA 2CGLA 2KZZA 3I0RA 3QLHA 4CECA 1U47A 3L2WA 3LAMA 3PSIA 4J2DA 4H4OA 2HF4A 5T7BA 3QINA 2O8EB 1VSEA 3OBWA 2EX3A 2PYJA 5M1KA 4K43A 4KHUA 3ZSXA 4DSFA 1WOQA 1XMOK 2ZJPL 1VQLN 4FLWA 4OGEA 2P9KA 3AA5X 2QA4N 5AQWA 4KBOA 4JK9A 3HVRA 4HTLA 4M3ZA 3T69A 1IJJA 1TVRA 2HHIA 4AHCA 5FROA 5CHIA 4DV4K 4KHSA 3JYTA 3TAEA 5FRNA 4HUEA 2JWLA 4WFAL 4FK4A 3TSPA 4HCBA 3UIQA 4FWSA 1QS4A 3LM2A 4KI4A 5GAEP 3O9RA 4G9ZA 4BRQA 4BGBA 1VQ8N 4JK8A 2IS3A 2YNFA 3IMXA 4B8AB 3DRPA 1DLOA 2QWRA 2HBLA 4YFUA 4Z94A 3L8BA 2C1GA 3CIPA 1FK9A 3KLHA 2P9UB 5J1EA 4JYAK 1VQ5N 2F9WA 2IOCA 4YORA 3O3GA 1RT3A 3TAQA 3R8EA 1BQNA 5I3UA 4BRCA 2EHGA 3NBPA 2HHHK 4E3SA 3NCIA 3AVFA 3VQPA 3V9SA 3TSUA 4A57A 4GKJK 4FXDA 3C6AA 2P5GA 5AQFA 4G1QA 4CHOA 3ISNC 4I6MB 4A59A 4C8NA 4AILC 3VQQA 1EETA 1YAGA 2ZD1A 3ATVA 4CJUA 3O1BA 1IKXA 2Q3SA 4FLYA 3WNHA 4QAGA 4MLEA 4W5TA 3NGIA 4WCEL 4PKIA 5M1PA 4PQUA 1M90O 1T05A 4JKHA 1HR0K 1N6QA 1V4SA 1FW6A 3OYCA 2B6AA 2VWKA 2P9PA 2RE2A 5JS2A 4CF1A 1O1WA 3S5TA 4L8RB 1JCFA 4JKGB 2P1JA 1ZYQA 3CCRN 2KHOA 2PBDA 1VSFA 4AHTA 4CEQA 5D3GA 1MWKA 4BGAA 3O6WA 3V4IA 2FBYA 1HJOA 3CG7A 2HVIA 1LOTB 4DV0K 1HQUA 1LWEA 1YVUA 3VOVA 3QNNA 2QEXN 2FF6A 1TK5A 2HVHA 4KI6A 2WONA 4EP5A 3LDLA 1Q7YO 3SYZA 1JXEA 1RBVA 3ZSRA 3OJSA 1IV0A 3LAKA 1KLMA 4FM1A 1JCGA 5BR9A 3DLRA 1NNEA 2O8DB 1WSJA 2YHWA 2NLXA 2DFHA 5AZIA 2O4GA 3AAQA 3NH0A 3E9PA 3AO3A 1QHTA 4PL8A 5HRNA 2P9SB 4PUOA 3KD5E 3LPUA 5AQHA 1TAQA 3NFAA 1F21A 4F3OA 3A2FA 4FJ5A 4BRGA 1D4XA 3VA3A 1CZ9A 4CCHA 4X65K 3CI5A 1W97L 4OJRA 3G71N 5JMVA 4CBUA 4DTUA 4HUFA 1NKCA 3L4IA 4F4KA 5KI6A 2W6KA 1I3AA 4JEPA 3S3OA 3VENA 3GBTA 3P4IA 3SZ2A 2HHWA 1VSIA 1C6VA 4IFEA 3ITHA 3FR0A 3TTDA 3K5NA 1U6ZA 4JV5K 3KKRA 1MWMA 3EN9A 1TKXA 3VEYA 2O8CA 2FSNA 3QO9A 2F8TA 4C8KA 3DLEA 4ID1A 4UY8O 2E1ZA 1S1WA 1JLEA 1ZXOA 4A61A 3K9KA 3RMCA 4YOYA 1C1AA 1ZBLA 4Y1CA 4ELTA 1S6PA 2KQ2A 4F9OA 5FRMA 3NMUA 3WXIA 2VQEK 3LPTA 1RCHA 1YTUA 3QEXA 2O8FB 3PY8A 1NJZA 3FFKB 2BUPA 1YJWN 1VSKA 1T7PA 2HF3A 1EXQA 3OVNA 3MN7A 3OY9A 3IDHA 3SPYA 4FWNA 2ZJQL 2KW4A 4B9UA 4CF2A 1RTIA 1IO2A 2ETJA 2J4RA 3HBTA 5KPTA 4IDHA 4DMNA 5HLFA 4JKEA 3L2RA 1GOAA 3J8AA 5AFUA 3VF6A 2X6SA 4A2BA 3L2QA 2F96A 4XH1A 4IJNA 1OH5A 3CMEN 2HBMA 4CGIA 2ZM6K 4FVUA 1GLLO 3HSCA 5AFUH 3R1XA 4HCCA 3ENBA 4F2SA 4BC4A 4CHQA 4DR4K 3R3LA 4DR7K 1Q9XA 2NRHA 4H5VA 5FPDA 3V9ZA 1RTHA 1T8EA 2IVNA 1N33K 1XC9A 1C0UA 3SJJA 3NVMA 5KGXA 1MA9B 4KH4A 3DOLA 2W6LA 3U4LA 2P9NA 1SS6A 2GEMA 1J5EK 3C6HA 1NGAA 3AVLA 3P39A 2W40A 3F9KA 3DMJA 3MEDA 3HYFA 5A2QO 1NK0A 1VSHA 3J80O 3FFIA 1FJGK 1GLAG 3OYDA 1VQNN 3TAPA 1XHZA 1BU6O 3AVKA 3MK6A 4JKAA 4OPHA 4BG9A 2CGJA 4UQGA 1HYZA 3L3UA 3SAHA 1E4GT 1KSPA 2D5RA 1GLJO 3CJCA 3C6UA 5BPLA 2KFZA 3CPEA 4MDBA 1D9FA 3ZSOA 3FZLA 3GDQA 3OYBA 1TKDA 4AHSA 4FW1A 2OZSA 3DXKB 3KK1A 3D0PA 1TK0A 3M1FA 4DB3A 4DU4A 1TL1A 3OBYA 1EX4A 2XY6A 4E7IA 1GLBG 5AQJA 3VEOA 3V6DA 4H0PA 4Z4EA 4NB4A 4LH4A 3J7ZO 4BRFA 3AVNA 1B92A 3HM9A 4DTPA 2O8EA 3OS0A 3MCPA 4CHPA 4U67L 3I56N 1NGGA 4CIFA 3UB5A 4E19A 1IBLK 1TUYA 1HMVA 3DM2A 4B3RK 2HHSA 4DTMA 3D2EA 4H8KA 3PIPL 4DFPA 5AQKA 1KTQA 5SZTA 4BRKA 2E5LK 2HB5A 4PKHA 4CEAA 4BWJA 5DM7L 2IVPA 2AA4A 1J53A 3AVJA 2NRZA 2OPQA 2V7ZA 2JGUA 3SI6A 2G8WA 3CJBA 4KPYA 5JENA 3K5OA 4BR2A 1YJNN 3RWUA 5HOOA 5DK5A 3KLEA 2YX6A 4I2PA 3JXUA 4AHUA 1KFSA 5CYMA 2UUCK 2HOEA 3P31A 4E0DA 1Q86O 3AA3A 3VQBA 4BR5A 1CLQA 1RBTA 2D0AA 1LW2A 3P38A 4GV9A 1KVBA 4FK0A 3M6GA 2P9UA 1YJ9N 1S1XA 2YNHA 1MU2A 1UAXA 2JWKA 4LF8K 4FWOA 3SQ1A 4ZTFA 3H1VX 1VRUA 3HJFA 2YV0X 3MCAB 1X3MA 3CCUN 4DR2K 1NMNA 3KHYA 3IRXA 4DSIA 1NWKA 4OLBA 5GAGP 3AVAA 3ULEB 4IDKA 3O9SA 5HP1A 5C15A 2YKMA 4MO5A 2X78A 1L3UA 2VWBA 3DWLA 4BVOA 1DKGD 2IDOA 4Y1DA 4I6MA 2QTDA 1MDUB 4RG8A 3ZLJA 3AARA 3AVCA 4KTZA 4CZHA 4DHYA 3VEZA 4OPKA 2OANA 3CCSN 1SL0A 4B9TA 1HNWK 1IKYA 3IG1A 1I94K 3MX2A 4XJXA 4KH6A 1HPZA 4FJXA 4JKFA 5AQOA 3U9ZA 1YITN 3SUPA 3PO5A 3ZSZA 3VPZA 4JI4K 3E66A 2QWMA 4H03B 3WNFA 2EWSA 3TI0A 4JKGA 3SUNA 1ZBIA 5AQVA 3O4NA 4JI3K 1NGIA 3VMFB 4NCGA 1Q9YA 4BECA 1WSHA 3G6EN 4DQPA 4IXCA 1NLVA 3R9PA 1JLGA 4FWKA 3G25A 4CK3A 2KTQA 5TKWA 3SMSA 4CGFA 4W5NA 2P9IB 1X9JA 1TKZA 2PAVA 3A5LC 3ENOA 4BRAA 4IEEA 3I8DA 1ILYA 2BGGA 4E72A 2GX9A 3LM9A 3L0QA 1LAVA 4GVMA 2A3ZA 2E2OA 4ILJA 3DRRA 1D5AA 4O5FA 5CY4A 1QSYA 3QEWA 1QSSA 2WFBA 1DT9A 3W3DA 1YXQA 4B1UB 4B3MK 2O8DA 3VQ7A 4CJ3A 4KB1A 1LAWA 3LZJA 2WC9A 4IZ9A 4DWIA 4LC9B 3I0SA 4CZKA 5BN9A 1U49A 1YI2N
chains in the Genus database with same CATH topology
2YI1A 5C2FA 2DPNA 3AGKA 1EO1A 4BY9C 2P9PA 2P9SA 2RE2A 1JCFA 3KWGA 3O08A 4JKGB 4CZIA 4YOVA 1SQKA 2NZTA 2KHOA 2PBDA 3CCRN 3TTCA 5AQYA 1VQ7N 3K9JA 4EFHA 1MWKA 1Z6RA 2GELA 4IJAA 3QBWA 1HLUA 4H5NA 4BGAA 5JICA 3NVKA 5AQNA 4IOAL 3O6WA 1QHAA 1HJOA 2E2NA 1VQON 1LOTB 3A0IX 3WXJA 3GOIA 5BPNA 4BC5A 4H0XB 4BRPA 3E9LA 4JD2A 3VF4A 4PL7A 3CJ1A 3PLAA 5F1XA 3VOVA 4B1VA 2QEXN 2FF6A 1ESVA 5BRFA 1YIJN 1TUUA 3LDLA 1Q7YO 4OPAA 3N4QA 1OVYA 1TYQB 3MWTA 2QWLA 2FF3B 3WXLA 4EHUA 3EE9A 1Q81O 5GAHP 3UKUB 5EXWA 2IIRA 5AZJB 3DJCA 1JCGA 5BR9A 3L4QA 4BR7A 1Q82O 4BR9A 5M1QA 4C23A 5JVGL 1S72N 2GUPA 1GLCG 2YHWA 4XH5A 2NLXA 3H3NO 3KK7A 5AZIA 4JNEA 3AAQA 4QS8A 4FSVA 3MDQA 1J6ZA 4MDAA 5BRHA 1VQMN 4JKDA 4BRMA 2FLOA 3VESA 4BRIA 5GADP 4H0TB 3TTFA 3E9PA 3FZKA 2P9PB 2E2PA 4PL8A 2P9SB 3TPQA 1CZAN 3CCJN 3CERA 3ZEUA 5AQHA 2ZF5O 5AQIA 3AAPA 3O8MA 4K42A 1KD1O 4NLBA 4IWVA 4BRGA 4ILHA 1T6DA 4GVEA 1K73O 1D4XA 3WQUA 1C0GA 4BRDA 2NRWA 1K8KA 3CD6N 1VAZA 1EQYA 1KAYA 3CI5A 2KKZA 4B1YB 1QQOA 3QFUA 3WT0A 3IUCA 4JD2B 4BR4A 3SAGA 3OHRA 1W97L 3G71N 3GG4A 5JMVA 4CBUA 5JLHA 3C0BA 1DEJA 4AM7A 3CMAN 1K8AO 3F5TA 3D2FA 4BROA 4CD1A 3L4IA 5KQDA 4MO4A 3JS6A 1WUAA 3CJ9A 2NRVA 4U7BA 2E1YA 2WBNA 1Y64A 3H46O 3HZ6A 3CCVN 4JEPA 4FWMA 3VENA 2RHKA 3CJAA 4YOUA 4IOCL 1NJIO 1HKBA 2Q0RA 3GBTA 3P4IA 2CH6A 4J8FA 3VERA 5M1FA 3CHWA 4CD3A 2FXUA 3MX5A 2BTFA 3QMLA 4IFEA 5ADXA 2Q36A 3OA9A 3FR0A 4BEBA 4E1JA 2UYTA 3H45C 5EOYA 1U6ZA 3TTDA 3SMPA 1RGIA 3A5OC 1MWMA 3EN9A 5HL7L 5F2RA 3HOSA 2NRTA 2QM1A 2E20A 3VEYA 5AZIB 3O5BA 2FSNA 5JLFA 3LDOA 2KLAA 2QWOA 3ZX2A 1V4TA 2F7TA 3EO3A 4MLHA 5AQSA 1BOTO 3GL1A 1BA0A 1KAZA 4FWPA 5B8HA 4QS9A 1NGDA 1S22A 3BEXA 4UY8O 3LL3A 3VTIA 2ZWHA 2E1ZA 5EX5A 4A61A 1ZXOA 4A5BA 4PHTX 4GV3A 3H1QA 3Q7BA 3BUZB 4HWIA 3ZEUB 3K9KA 4QS7A 4YDUC 1KXPA 1P90A 1R59O 2QWNA 3KVGA 3O4WA 3Q7CA 3WQTA 2ZGYA 4FWLA 4B1XB 4YOYA 1NGEA 3WEEA 3RSEA 4F9OA 4KH5A 1ATSA 3WXMB 3NMUA 3WXIA 1QVGM 1HX1A 2Q1NA 3HTVA 4CZGA 4JHDA 4CZEA 3E9OA 3SJHA 4YDUA 2HMPA 4JN4A 3CQYA 1H1VA 1K8KB 3FFKB 5AQPA 2BUPA 3M3ZA 1YJWN 4EAHD 3CC4N 3O9TA 4OO1J 2HF3A 3BF3A 5JVHL 4C1NI 3MN7A 2H3GX 2VGMA 3IDHA 4FWRA 1BO5O 4FWNA 2ZJQL 2NRXA 3D2FB 3CCEN 2HBKA 3E1YA 1K9MO 3FGUA 2D0OA 5M1NA 2V52B 4BE7B 4FOEA 4ISGA 4DKWA 1ZBSA 4CJ7A 4O8UA 2J4RA 3HBTA 5AQRA 5BRDA 4IDHA 5KPTA 4JKEA 1Z05A 3MMVA 4M7YA 1U2VA 3FZFA 3J8AA 5AFUA 5C0YA 3VF6A 1ZC6A 4A2BA 5BN8A 4H5TA 4IJNA 4XH1A 1ATRA 3DXKA 3CMEN 1GLEG 4WFNL 1T6CA 4CZLA 1N8RO 2HBMA 4FL9A 4FVUA 1VQ4N 1GLLO 3QDKA 3HSCA 5AFUH 3R1XA 3ENBA 4CZFA 2YJEA 4WYBA 3R6MA 4XEIA 1NM1A 2GTDA 3FZHA 3O80A 5AQTA 3T7ZA 4BC4A 3EKSA 4PKGA 3R3LA 4YOXA 2NRHA 4H5VA 2VGNA 4CBWA 3L6QA 5FPDA 5BPMA 2QI2A 3SK3A 2IVNA 4RTFD 4H0OA 1SZ2A 3AGRA 4A62A 4YOTA 2OTJN 4NLCA 4Y0WA 2VYPA 3WEEB 3RSEB 3NVMA 3VEWA 1MA9B 4KH4A 4M7XA 3D2EB 4CBXA 3VEVA 4JHDB 3ZX3A 5LJVA 3U4LA 2I7NA 2P9NA 1SS6A 2GEMA 3C6HA 3VF2A 1VQPN 1QVFM 1NGAA 1NGCA 3DLLL 5ELZA 3P39A 1DGKN 2W40A 4M63C 4WQ4C 1M1KO 2Q2RA 2HSTA 1NGJA 2ASOA 3EE8A 1GLAG 1QZ5A 2BH1A 2Q97A 3D7EO 4WQ4A 5EVZA 1VQNN 2F9TA 1BUPA 3A8YA 1BU6O 3VTHA 3CPWM 5BREA 3D6RA 3MK6A 4JKAA 4OPHA 2CGJA 1YUWA 3A5MC 4BG9A 4RWTA 2W41A 1VQKN 2Q31A 5KPRA 3SAHA 3ENHA 1JCEA 1E4GT 2D0PA 1LCUA 1GLJO 3CJCA 3O1WA 3G4SN 3EL2A 1GLDG 5BPLA 3CPEA 4MDBA 1U2VB 3DXMA 5AQMA 1G99A 3FZLA 3GDQA 5FPMA 4BREA 4IO8A 2Q0UA 3HM8A 3SLCA 5C12A 3DXKB 3MN6A 3CC2N 5LJWA 3TSQA 3WXKA 3M1FA 4FPBA 1Q18A 4DB3A 1KQSM 3RVCA 4H5RA 5CR4A 3OBYA 5E26A 5GIPA 1BWFO 2ZGZA 4B1ZA 1GLBG 5AQJA 3U8XA 3VEOA 4H0PA 2A42A 4NB4A 2QXLA 1NMDA 1X3NA 4IOXA 4DQ8A 2FSJA 3J7ZO 4BRFA 2CGKA 1E4FT 3C7NA 4IEIA 1NGFA 5LY3A 2CH5A 1OKJA 2W00A 3CXCM 1GLFO 4FOIA 3W0LA 4GV6A 4BC3A 1QQMA 3HRGA 5KQ8A 3IFRA 3MCPA 3ZETA 1QQNA 4U67L 2P9NB 2V51B 3UE5A 1IG8A 3I56N 2ZJRL 4B1WB 3MN9A 3S41A 1NGGA 4BG8A 3CF5L 3EKUA 5FPEA 3CCLN 2A6AA 3UB5A 2YJFA 3QBXA 3SBGA 4AM6A 1TUYA 4BRHA 2FSKA 3LDPA 1VQ6N 3D2EA 3PIPL 1SAZA 5MLCQ 5AQKA 4BRNA 4NO7A 3H6EA 3FLCO 3HOTA 4BRKA 4CZMA 2P9LA 3QICA 4EHTA 3ULEA 4PKHA 5GIOA 1YHQN 4GY2B 1S3XA 2AP1A 3I8BA 3UKRA 3VEXA 5DM6L 3I55N 3BF1A 5DM7L 3DXMB 1RDWX 2IVPA 2VCPA 2AA4A 4WFBL 4WQ5C 5F0XA 1KC8O 2I7PA 2IVOA 3U9DA 2NRZA 4FO0A 1XQSC 2V7ZA 3LDQA 4JKCA 2V7YA 1T44A 2QWQA 3CJBA 3VGLA 5C10A 3O9QA 2D4WA 2GWJA 3H3OB 3KWIA 3SBTA 4H5WA 3ATUA 4H0VB 4WQ5A 4BR2A 1YJNN 5HOOA 1NBWA 2CGLA 3CCQN 2YX6A 3GE1A 4CI6A 3QB0A 1HKCA 3JXUA 1KAXA 2HF4A 1HKGA 1HUXA 2HOEA 3P31A 3C7NB 3AY9A 3ID6A 1Q86O 5AQZA 4BR5A 3OBWA 4R79A 4B9QA 5M1KA 3N4PA 4K43A 3P38A 4GV9A 2OTLN 3MN5A 3ZETB 4JKBA 2ITMA 1WOQA 4FPAA 3M6GA 2C1IA 1C0FA 2P9UA 1RDUA 5AQUA 1YJ9N 1VQ9N 2ASPA 4BRLA 2ZJPL 1VQLN 3A5NC 4K41A 4BVPA 2JWKA 4FWOA 1NGBA 3H1VX 3MCAB 1X3MA 3CCUN 2P9KA 2QA4N 3F9MA 2A41A 3KZBA 5AQQA 5AQWA 3PIOL 4KBOA 2E88A 3M5RA 4WF9L 3WUHA 1JJ2M 3KHYA 4JK9A 1RFQA 3DAWA 1XC3A 5M1OA 3VETA 4HTLA 1NWKA 3T69A 1IJJA 2P9LB 3FE1A 3ID8A 4AF1A 5GAGP 3IKMA 2D1KA 3ULEB 5CHIA 3O9SA 3VGMA 3CQXA 5C15A 4MO5A 3VGKA 3UKRB 1P8ZA 2P9IA 2VWBA 3DWLA 4BVOA 1DKGD 4I6MA 2JWLA 4RCHA 3O9UA 2QTDA 4WFAL 1MDUB 3TSPA 3OW2M 1T3VA 3AARA 4FWSA 5H1SQ 3I33A 5KPZA 4CZHA 4DHYA 4EIAA 3VEZA 2HBJA 1NGHA 3LM2A 3F2KA 4YOWA 2OANA 5GAEP 4ILGB 3O9RA 3CCSN 5EY4A 3C65A 4G9ZA 1BA1A 2YHXA 4BRQA 5AR0A 1BDGA 3LDNA 4IO9L 2GWKA 4BGBA 2A40A 4JK7A 5GINA 3EZWA 4ISFA 5AQXA 4JAXA 1VQ8N 5E84A 3MX2A 2E2QA 4JK8A 4KH6A 4XJXA 4ISEA 4JKFA 5AQOA 3U9ZA 1YITN 3CETA 3IMXA 3VPZA 1QZ6A 2PFUA 2E8AA 1W2BM 2QWRA 2HBLA 4O8KA 2QW9A 3E66A 4Z94A 2QWMA 4H03B 2C1GA 5FPNA 3CIPA 4BC2A 2EWSA 4L3QA 3BP8A 2P9UB 4XH4A 4JKGA 1VQ5N 2YCHA 2F9WA 4YORA 4CZJA 1HPMA 5AQVA 3R8EA 1YF5L 4K25A 5I9EB 5TKYA 1NGIA 2P9KB 3VMFB 4BRCA 4BECA 4DCHA 3G6EN 2NRRA 4IXCA 4A5AA 1NLVA 3R9PA 1BG3A 4C1NK 4FWKA 3G25A 5CE3A 3MWPA 5TKWA 3SMSA 2QWPA 3TSUA 4A57A 3C6AA 4H0YB 5AQFA 2P9IB 1X9JA 2PAVA 3ENOA 3A5LC 5AQGA 4GNIA 4I6MB 3CCMN 4A59A 4BRAA 4IEEA 4BR0A 1ILYA 3TU5A 3FZMA 2GX9A 2ASMA 3CC7N 3QFPA 4BQZA 3LM9A 5C2DA 3SAFA 4FWQA 3L0QA 2A5XA 1TYQA 5ADXH 2YHYA 1YAGA 3ATVA 3O1BA 2NNWA 2A3ZA 2E2OA 4ILJA 4A2AA 3UKUA 1ATNA 4O5FA 5AZJA 2WUSA 4MLEA 2WFBA 1YVNA 1DT9A 5AQLA 3CJ7A 3W3DA 1YXQA 4WCEL 4B1UB 4PKIA 5M1PA 1O13A 4BQLA 1M90O 3ZYYX 1XUPO 3ZX0A 2WC9A 4JKHA 3HI0A 4IZ9A 4LC9B 1V4SA 3B8AX 4CZKA 5BN9A 1YI2N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YI1 A;  2DPN A;  2P9P A;  2P9S A;  1JCF A;  3O08 A;  4CZI A;  1SQK A;  2NZT A;  2KHO A;  2PBD A;  5AQY A;  4EFH A;  1MWK A;  1Z6R A;  2GEL A;  4IJA A;  3QBW A;  1HLU A;  4H5N A;  4BGA A;  5JIC A;  5AQN A;  3O6W A;  1QHA A;  1HJO A;  2E2N A;  1LOT B;  3A0I X;  3WXJ A;  3GOI A;  5BPN A;  4BC5 A;  4H0X B;  4BRP A;  3VF4 A;  4JD2 A;  4PL7 A;  3CJ1 A;  5F1X A;  3VOV A;  4B1V A;  2FF6 A;  1ESV A;  5BRF A;  1TUU A;  3LDL A;  1TYQ B;  2QWL A;  2FF3 B;  3WXL A;  4EHU A;  3UKU B;  5EXW A;  2IIR A;  5AZJ B;  3DJC A;  1JCG A;  5BR9 A;  4BR7 A;  4BR9 A;  4C23 A;  2GUP A;  1GLC G;  2YHW A;  4XH5 A;  2NLX A;  3H3N O;  5AZI A;  4JNE A;  3AAQ A;  4QS8 A;  4FSV A;  3MDQ A;  1J6Z A;  5BRH A;  4BRM A;  2FLO A;  3VES A;  4BRI A;  4H0T B;  3FZK A;  2P9P B;  2E2P A;  4PL8 A;  2P9S B;  3TPQ A;  1CZA N;  3CER A;  3ZEU A;  5AQH A;  2ZF5 O;  5AQI A;  3AAP A;  3O8M A;  4K42 A;  4IWV A;  4BRG A;  1T6D A;  1D4X A;  3WQU A;  1C0G A;  4BRD A;  1K8K A;  1EQY A;  1KAY A;  3CI5 A;  4B1Y B;  1QQO A;  3QFU A;  3WT0 A;  3IUC A;  4JD2 B;  4BR4 A;  3OHR A;  3GG4 A;  5JMV A;  4CBU A;  5JLH A;  3C0B A;  1DEJ A;  4AM7 A;  4BRO A;  3D2F A;  4CD1 A;  5KQD A;  3L4I A;  4MO4 A;  3JS6 A;  1WUA A;  3CJ9 A;  2E1Y A;  1Y64 A;  3H46 O;  3HZ6 A;  4FWM A;  3VEN A;  3CJA A;  1HKB A;  2Q0R A;  3GBT A;  3P4I A;  2CH6 A;  4J8F A;  3VER A;  3CHW A;  4CD3 A;  2FXU A;  3QML A;  2BTF A;  5ADX A;  2Q36 A;  3FR0 A;  4E1J A;  2UYT A;  3H45 C;  5EOY A;  1U6Z A;  3SMP A;  1RGI A;  3A5O C;  1MWM A;  3EN9 A;  5F2R A;  2QM1 A;  2E20 A;  3VEY A;  5AZI B;  3O5B A;  2FSN A;  5JLF A;  3LDO A;  2QWO A;  3ZX2 A;  1V4T A;  5AQS A;  3EO3 A;  4MLH A;  1BOT O;  3GL1 A;  1BA0 A;  1KAZ A;  4FWP A;  5B8H A;  4QS9 A;  1NGD A;  1S22 A;  3BEX A;  3LL3 A;  2ZWH A;  2E1Z A;  5EX5 A;  4A61 A;  1ZXO A;  3H1Q A;  3BUZ B;  4HWI A;  3ZEU B;  4QS7 A;  4YDU C;  1KXP A;  2QWN A;  1R59 O;  3KVG A;  3WQT A;  3O4W A;  2ZGY A;  4FWL A;  4B1X B;  1NGE A;  3WEE A;  3RSE A;  4F9O A;  1ATS A;  3WXI A;  1HX1 A;  2Q1N A;  3HTV A;  4CZG A;  4JHD A;  4CZE A;  3SJH A;  4YDU A;  2HMP A;  4JN4 A;  3CQY A;  1H1V A;  1K8K B;  3FFK B;  5AQP A;  2BUP A;  3M3Z A;  4EAH D;  2HF3 A;  3BF3 A;  3MN7 A;  2H3G X;  3IDH A;  4FWR A;  1BO5 O;  4FWN A;  3D2F B;  3FGU A;  2D0O A;  2V52 B;  4FOE A;  4ISG A;  1ZBS A;  4CJ7 A;  2J4R A;  3HBT A;  5AQR A;  5BRD A;  5KPT A;  1Z05 A;  3MMV A;  4M7Y A;  1U2V A;  3FZF A;  3J8A A;  5AFU A;  3VF6 A;  1ZC6 A;  4A2B A;  5BN8 A;  4H5T A;  4IJN A;  4XH1 A;  1ATR A;  3DXK A;  1GLE G;  1T6C A;  4CZL A;  4FL9 A;  1GLL O;  3QDK A;  3HSC A;  5AFU H;  4CZF A;  2YJE A;  4WYB A;  3R6M A;  4XEI A;  1NM1 A;  2GTD A;  3FZH A;  3O80 A;  5AQT A;  4BC4 A;  3EKS A;  4PKG A;  2NRH A;  4H5V A;  4CBW A;  3L6Q A;  5FPD A;  5BPM A;  3SK3 A;  2IVN A;  4RTF D;  4H0O A;  1SZ2 A;  4A62 A;  4Y0W A;  2VYP A;  3WEE B;  3RSE B;  3VEW A;  4CBX A;  1MA9 B;  4M7X A;  3D2E B;  3VEV A;  4JHD B;  3ZX3 A;  5LJV A;  3U4L A;  2I7N A;  2P9N A;  2GEM A;  3VF2 A;  1NGA A;  1NGC A;  5ELZ A;  4WQ4 C;  1DGK N;  2W40 A;  4M63 C;  2Q2R A;  1NGJ A;  2ASO A;  1GLA G;  1QZ5 A;  2Q97 A;  3D7E O;  5EVZ A;  4WQ4 A;  2F9T A;  1BUP A;  3A8Y A;  1BU6 O;  5BRE A;  3MK6 A;  4BG9 A;  2CGJ A;  1YUW A;  3A5M C;  4RWT A;  2W41 A;  2Q31 A;  5KPR A;  3ENH A;  1JCE A;  1E4G T;  2D0P A;  1LCU A;  1GLJ O;  3CJC A;  3O1W A;  3EL2 A;  1GLD G;  5BPL A;  1U2V B;  3DXM A;  5AQM A;  1G99 A;  3FZL A;  3GDQ A;  5FPM A;  4BRE A;  4IO8 A;  2Q0U A;  3HM8 A;  3SLC A;  3DXK B;  3MN6 A;  5LJW A;  3WXK A;  3M1F A;  4FPB A;  1Q18 A;  4DB3 A;  4H5R A;  5E26 A;  1BWF O;  2ZGZ A;  4B1Z A;  1GLB G;  5AQJ A;  3U8X A;  3VEO A;  4H0P A;  2A42 A;  4NB4 A;  2QXL A;  1NMD A;  1X3N A;  4DQ8 A;  2FSJ A;  4BRF A;  2CGK A;  1E4F T;  3C7N A;  1NGF A;  5LY3 A;  2CH5 A;  1OKJ A;  1GLF O;  4FOI A;  3W0L A;  4BC3 A;  1QQM A;  5KQ8 A;  3IFR A;  3MCP A;  3ZET A;  1QQN A;  2P9N B;  2V51 B;  3UE5 A;  1IG8 A;  4B1W B;  3MN9 A;  3S41 A;  1NGG A;  4BG8 A;  3EKU A;  5FPE A;  2A6A A;  3UB5 A;  2YJF A;  3QBX A;  4AM6 A;  1TUY A;  4BRH A;  2FSK A;  3LDP A;  3D2E A;  1SAZ A;  5AQK A;  4BRN A;  4NO7 A;  3H6E A;  3FLC O;  4BRK A;  4CZM A;  2P9L A;  3QIC A;  4EHT A;  3ULE A;  4PKH A;  4GY2 B;  1S3X A;  2AP1 A;  3I8B A;  3UKR A;  3VEX A;  3BF1 A;  3DXM B;  1RDW X;  2IVP A;  2VCP A;  2AA4 A;  4WQ5 C;  5F0X A;  2I7P A;  2IVO A;  3U9D A;  4FO0 A;  1XQS C;  2V7Z A;  3LDQ A;  2V7Y A;  1T44 A;  2QWQ A;  3CJB A;  3VGL A;  2D4W A;  2GWJ A;  3H3O B;  4H5W A;  3ATU A;  4H0V B;  4WQ5 A;  4BR2 A;  1NBW A;  2CGL A;  3GE1 A;  4CI6 A;  3QB0 A;  1HKC A;  3JXU A;  1KAX A;  2HF4 A;  1HKG A;  1HUX A;  2HOE A;  3C7N B;  3AY9 A;  5AQZ A;  4BR5 A;  4B9Q A;  4K43 A;  3MN5 A;  3ZET B;  2ITM A;  1WOQ A;  4FPA A;  3M6G A;  1C0F A;  2P9U A;  5AQU A;  2ASP A;  4BRL A;  3A5N C;  4K41 A;  4BVP A;  4FWO A;  1NGB A;  3H1V X;  1X3M A;  2P9K A;  3F9M A;  2A41 A;  3KZB A;  5AQQ A;  5AQW A;  4KBO A;  2E88 A;  3WUH A;  3KHY A;  1RFQ A;  3DAW A;  1XC3 A;  3VET A;  4HTL A;  1NWK A;  1IJJ A;  2P9L B;  3FE1 A;  3ID8 A;  2D1K A;  3ULE B;  3VGM A;  3CQX A;  4MO5 A;  3VGK A;  3UKR B;  1P8Z A;  2P9I A;  2VWB A;  3DWL A;  4BVO A;  1DKG D;  4I6M A;  4RCH A;  1MDU B;  3AAR A;  4FWS A;  3I33 A;  5KPZ A;  4CZH A;  4DHY A;  4EIA A;  3VEZ A;  1NGH A;  3LM2 A;  2OAN A;  5EY4 A;  1BA1 A;  2YHX A;  4BRQ A;  5AR0 A;  1BDG A;  3LDN A;  2GWK A;  4BGB A;  2A40 A;  3EZW A;  4ISF A;  5AQX A;  4JAX A;  5E84 A;  2E2Q A;  4ISE A;  5AQO A;  3U9Z A;  3CET A;  3IMX A;  3VPZ A;  1QZ6 A;  2E8A A;  2QWR A;  4O8K A;  2QW9 A;  4Z94 A;  2QWM A;  4H03 B;  5FPN A;  3CIP A;  4BC2 A;  2EWS A;  4L3Q A;  3BP8 A;  2P9U B;  4XH4 A;  2YCH A;  2F9W A;  4CZJ A;  1HPM A;  5AQV A;  3R8E A;  4K25 A;  5I9E B;  5TKY A;  1NGI A;  2P9K B;  4BRC A;  4DCH A;  4IXC A;  1NLV A;  3R9P A;  1BG3 A;  4FWK A;  3G25 A;  5CE3 A;  3SMS A;  2QWP A;  4H0Y B;  5AQF A;  2P9I B;  1X9J A;  2PAV A;  3ENO A;  3A5L C;  5AQG A;  4GNI A;  4I6M B;  4BRA A;  4BR0 A;  3TU5 A;  3FZM A;  2ASM A;  3QFP A;  4BQZ A;  3LM9 A;  4FWQ A;  3L0Q A;  2A5X A;  1TYQ A;  5ADX H;  2YHY A;  1YAG A;  3ATV A;  3O1B A;  2A3Z A;  2E2O A;  4A2A A;  3UKU A;  1ATN A;  4O5F A;  5AZJ A;  2WUS A;  4MLE A;  1YVN A;  5AQL A;  3W3D A;  3CJ7 A;  1YXQ A;  4B1U B;  4PKI A;  4BQL A;  1XUP O;  3ZX0 A;  3HI0 A;  4IZ9 A;  4LC9 B;  1V4S A;  3B8A X;  4CZK A;  5BN9 A; 
#chains in the Genus database with same CATH topology
 2YI1 A;  5C2F A;  3AGK A;  1EO1 A;  3HPG A;  4RW4 A;  3O4Q A;  2P9S A;  3DLG A;  2P5O A;  3KWG A;  3DYA A;  4CJ5 A;  4HUG A;  3TTC A;  4E1M A;  1VQ7 N;  4BWM A;  3QET A;  1U48 A;  2PY5 A;  4IJA A;  5AQN A;  4IOA L;  3A0I X;  1HJR A;  2G8V A;  3VQA A;  4M3Y A;  4DUZ K;  3WXJ A;  4LH5 A;  5BPN A;  4PL7 A;  2BE2 A;  1E3M A;  1N5Y A;  4O55 A;  4B1V A;  1XWL A;  1OH7 A;  4OPA A;  3PX0 A;  4FJ8 A;  4OLA A;  3SV3 A;  2QWL A;  2FF3 B;  5J2P A;  3V9X A;  5GAH P;  3UKU B;  4CHN A;  5EXW A;  2IIR A;  3DJC A;  4CVN E;  5LMN K;  1RT7 A;  3L4Q A;  4BR7 A;  1Q82 O;  4C23 A;  3CYM A;  1WAJ A;  4HVJ A;  5JVG L;  2GUP A;  1S72 N;  1GLC G;  1A5V A;  4B3O A;  4B3T K;  4OKJ A;  3S3M A;  4FSV A;  3MDQ A;  4MDA A;  2G8I A;  4JKD A;  3VES A;  4BRI A;  4FJ7 A;  1NJW A;  2VWJ A;  3AO5 A;  3SV4 A;  1U4B A;  3FZK A;  1VHX A;  4FZY A;  4CHY A;  4M3X A;  2E2P A;  3CCJ N;  1NK7 A;  2ZF5 O;  2B4J A;  3TAG A;  4DFK A;  1KD1 O;  4X66 K;  4NLB A;  3SQ0 A;  4IWV A;  4ILH A;  3VQD A;  1QSL A;  2R7Y A;  4CEE A;  1B9F A;  2O8F A;  1VSM A;  1VAZ A;  4O4G A;  1WLJ A;  4M3T A;  2KKZ A;  4B1Y B;  3QFU A;  3IUC A;  4JD2 B;  3OS2 A;  1NKB A;  5JLH A;  4AM7 A;  3CMA N;  3F5T A;  5KQD A;  3P5J A;  4IBN A;  1S1T A;  4MO4 A;  3JS6 A;  1WUA A;  3K0S A;  3SNN A;  3H46 O;  3O3F A;  4FWM A;  4GMJ B;  4IOC L;  1JL2 A;  1HKB A;  4J8F A;  2CH6 A;  4FLV A;  4CD3 A;  2FXU A;  3MX5 A;  1RBR A;  2BTF A;  2Q36 A;  3OA9 A;  5EOY A;  4AH9 A;  4CFA A;  1JXB A;  3OYG A;  3A5O C;  2HND A;  5HL7 L;  5F2R A;  2OPR A;  4LF9 K;  4DR6 K;  1ZBU A;  2KLA A;  2E6L A;  3EO3 A;  3GL1 A;  5B8H A;  1NGD A;  4FK2 A;  3LL3 A;  3VTI A;  5EX5 A;  1C0T A;  3ZEU B;  4E7K A;  4I2Q A;  1P90 A;  3ZT4 A;  1NGE A;  2DFE A;  3KIO A;  4JLH A;  1TKT A;  1HX1 A;  3HTV A;  5HBM A;  3CFR A;  2XY8 A;  4JN4 A;  4IFV A;  3M3Z A;  5JVH L;  4C1N I;  2PZS A;  4KV8 A;  2JLE A;  2WOM A;  4RW7 A;  3LP2 A;  3J81 O;  4IG3 A;  1KRP A;  4Z4F A;  3TAF A;  3D2F B;  2HBK A;  3E1Y A;  3VQ6 A;  4R5P A;  3THW B;  4B9S A;  4JI2 K;  4ISG A;  5KRS A;  4O8U A;  5AQR A;  1SL2 A;  3DI6 A;  1Z05 A;  3MMV A;  4M7Y A;  4FJK A;  3AA2 A;  4CF8 A;  2D0B A;  4H5T A;  1ATR A;  3DXK A;  1EKE A;  3NF7 A;  3SPZ A;  1RT5 A;  1T03 A;  1VQ4 N;  3ZT1 A;  1LV5 A;  4CJL A;  4CZF A;  2YJE A;  4WYB A;  3QER A;  2GTD A;  3O80 A;  4DG1 A;  1FXX A;  4PKG A;  4OKE A;  4M3W A;  5IWA K;  1UA1 A;  2OPS A;  3QIP A;  1HNX K;  4K8X A;  2I5J A;  3AGR A;  4YOT A;  2OTJ N;  4Y0W A;  2VYP A;  3WEE B;  3RSE B;  1WN7 A;  3VEW A;  4CBX A;  1FKP A;  3QES A;  3NF6 A;  5LJV A;  5CZ1 A;  3NGY A;  3DLL L;  1RT1 A;  1NG9 A;  4YHH K;  4WQ4 C;  3MXJ A;  4M63 C;  4KHY A;  3H08 A;  2Q2R A;  2GV9 A;  1QZ5 A;  2Q97 A;  4WQ4 A;  3A8Y A;  5BRE A;  4RWT A;  2XY7 A;  3U6F A;  1VQK N;  5KPR A;  3TAN A;  3ENH A;  1LCU A;  1GOB A;  3LAN A;  5AQM A;  5FPM A;  4X64 K;  3ZT0 A;  3CQ8 A;  4BRE A;  4IO8 A;  3K2P A;  5C12 A;  3MN6 A;  3CC2 N;  3WXK A;  1FKO A;  4FPB A;  1JLF A;  1Q18 A;  4O0J A;  3RVC A;  4FM2 A;  4K8Z A;  3U8X A;  2GBZ A;  5IT9 O;  3ZT3 A;  3VQ5 A;  3TR8 A;  1NMD A;  2HW3 A;  4RW6 A;  4DS5 A;  4M41 A;  1HYS A;  3BZC A;  2CGK A;  4H4M A;  4IEI A;  5LY3 A;  1OKJ A;  3IAY A;  4NXN K;  1ASV A;  3OYJ A;  1CZB A;  1J9A A;  4BC3 A;  2O8B B;  4E89 A;  3HRG A;  5KQ8 A;  1NJX A;  1Y97 A;  3OYE A;  1QQN A;  3PUF A;  4EZ6 A;  3HST B;  4KHQ A;  4B1W B;  1RBS A;  1YTA A;  4BG8 A;  3EKU A;  3CCL N;  3L2U A;  1NKE A;  4J2E A;  4AM6 A;  4FLT A;  1J54 A;  3JSM A;  1VQ6 N;  5MLC Q;  4BRN A;  3H6E A;  3FLC O;  3HOT A;  3ULE A;  5GIO A;  1S3X A;  3T1A A;  4EP4 A;  4WFB L;  1NK4 A;  4NYF A;  4WQ5 C;  4DQR A;  1XQS C;  2V7Y A;  1T44 A;  3VGL A;  5C10 A;  3MEG A;  2QKB A;  4LY7 A;  3KWI A;  1VK0 A;  3SBT A;  4H5W A;  4H0V B;  4WQ5 A;  1C0M A;  1NBW A;  3BY5 A;  4JI6 K;  3CCQ N;  4DSL A;  4I7F A;  1KAX A;  1HKG A;  1HUX A;  4ID5 A;  3C7N B;  3AY9 A;  3KKS A;  4WE1 A;  5AQZ A;  4CJS A;  4R79 A;  4B9Q A;  3KD1 E;  2OTL N;  3MN5 A;  3ZET B;  2ITM A;  1IBK K;  4DQI A;  2C1I A;  1C0F A;  1Q8I A;  5AQU A;  4E7L A;  1VQ9 N;  2ASP A;  3A5N C;  4FZX C;  4CJF A;  4CE9 A;  4K41 A;  4BVP A;  1N36 K;  2BAN A;  1NGB A;  3U3G A;  1X9W A;  4DS4 A;  3F9M A;  3PIO L;  2E88 A;  3M5R A;  4WF9 L;  3WUH A;  4CGG A;  1RFQ A;  3DAW A;  1XC3 A;  3VET A;  3OYL A;  4MFB A;  3CQX A;  1NK5 A;  2P9I A;  4RCH A;  3EEQ A;  2F4V K;  4CJE A;  3LP1 A;  4IKF A;  3MEE A;  1T3V A;  5H1S Q;  3HVT A;  4CJV A;  4NCB A;  3KLI A;  1HNZ K;  3OYF A;  1NGH A;  4YOW A;  2RF2 A;  4CGH A;  2UXD K;  4ILG B;  5EY4 A;  3C65 A;  4N5S A;  1BA1 A;  2YHX A;  5AR0 A;  3LDN A;  4IO9 L;  2A40 A;  4ISF A;  5AQX A;  1A5W A;  4JAX A;  5E84 A;  3OYA A;  2E2Q A;  4BE0 A;  1QZ6 A;  1DTQ A;  4BC2 A;  3T1H K;  4L3Q A;  4O44 A;  4XH4 A;  3T19 A;  3THV A;  1RNH A;  4DV2 K;  1HPM A;  3MAQ A;  3QEV A;  5I9E B;  3C95 A;  4B9M A;  3CFP A;  2KZM A;  2NRR A;  2XY5 A;  4CFD A;  1BG3 A;  4C1N K;  2YHB A;  1QTM A;  1S9E A;  4O5B A;  3MWP A;  1BIZ A;  4GW6 A;  4OX9 K;  4TSX A;  3OYM A;  3WNE A;  3HT3 A;  4JS5 A;  4H0Y B;  4YNQ A;  1WSF A;  3ZT2 A;  3OJU A;  3TWH A;  1TL3 A;  4BR0 A;  3RMD A;  3FZM A;  5BR8 K;  4JRP A;  3CC7 N;  5C2D A;  3SAF A;  4FWQ A;  3K5M A;  5ADX H;  2YHY A;  2NNW A;  4A2A A;  2VG7 A;  3UKU A;  4FM0 A;  1ATN A;  1S9G A;  4DR5 K;  1YVN A;  5AQL A;  3CJ7 A;  4OVL A;  4DU1 A;  1TAU A;  2IGI A;  1O13 A;  4BQL A;  4M45 A;  3ZYY X;  1XUP O;  3ZX0 A;  4Z4C A;  4PA1 A;  4KTQ A;  3B8A X;  4DR1 K;  3OYK A;  3LAL A;  1TGO A;  4J2A A;  4DLE A;  3O08 A;  5EU7 A;  1GOC A;  4CZI A;  3TAB A;  4YOV A;  1SQK A;  2NZT A;  3BDP A;  4LFB K;  2DFF A;  2GEL A;  1Z6R A;  2FC0 A;  1EWQ A;  1HLU A;  4H5N A;  4V19 S;  3NVK A;  1QHA A;  4LF5 K;  1SUQ A;  4BAC A;  4NYN A;  4DU3 A;  1BIS A;  1X9S A;  4DF8 A;  3GOI A;  4BRP A;  3E9L A;  4JD2 A;  3M8S A;  2F8S A;  3PLA A;  5F1X A;  4CIE A;  1NK9 A;  1L5U A;  5BRF A;  1YIJ N;  1ZBF A;  1TUU A;  3G0Z A;  2B5J A;  1WNS A;  1OH8 A;  1TYQ B;  3MWT A;  3B6O A;  4N41 A;  4EHU A;  4CGJ A;  3AVH A;  3LP3 A;  1Q81 O;  1Z26 A;  5AZJ B;  1L3V A;  5CYQ A;  1L3S A;  5M1Q A;  3EZ5 A;  3H3N O;  3KK7 A;  3EY1 A;  4CJP A;  5AJ3 K;  4QS8 A;  5BRH A;  2PYL A;  5GAD P;  3T1Y K;  3TTF A;  4CEB A;  4DTO A;  1CZA N;  4KKO A;  4PY5 A;  3BZK A;  4J2B A;  4M3R A;  3ZEU A;  1BL3 A;  4N76 A;  4C8L A;  5AQI A;  3AAP A;  4K42 A;  1VSL A;  2Y1J A;  4W5R A;  5J2N A;  3K5L A;  1BGX T;  4FJG A;  4I9L A;  3OTO K;  4GVE A;  1JL1 A;  1C0G A;  2NRW A;  3J7A P;  1EQY A;  1KAY A;  4F3T A;  3E01 A;  1XI1 A;  3WT0 A;  1S1V A;  4BR4 A;  4KFB A;  3GG4 A;  1K8A O;  4BRO A;  3D2F A;  2YHA A;  4KRE A;  4U7B A;  2NRV A;  2GUI A;  2E1Y A;  3THW A;  1Y64 A;  1RDA A;  3HZ6 A;  3CJA A;  3WNG A;  4YOU A;  1NJI O;  2Q0R A;  4FJH A;  1TK8 A;  1SV5 A;  3VER A;  2DY4 A;  3L3V A;  4K0K K;  4E1J A;  2FBX A;  3SMP A;  4KAZ A;  4X62 K;  2NRT A;  2QM1 A;  2E20 A;  3LP0 A;  4LF6 K;  3LWL A;  5JLF A;  3LDO A;  3C6T A;  3ZX2 A;  4M3U A;  1V4T A;  2F7T A;  1XMQ K;  3RMB A;  1KAZ A;  1S22 A;  3BEX A;  5FLX O;  4A5B A;  4KHP K;  4GV3 A;  3Q7B A;  4HWI A;  3SUO A;  4QS7 A;  4YDU C;  1KXP A;  2QWN A;  1R59 O;  3KVG A;  4JI0 K;  3Q7C A;  2ZGY A;  4B1X B;  3WEE A;  1VSJ A;  3RSE A;  4FVM A;  5HRP A;  1X9M A;  2Q1N A;  5DMR A;  4CZE A;  3SJH A;  4YDU A;  2HMP A;  4F2R A;  4DSE A;  3DOK A;  3CQY A;  1RT6 A;  1K8K B;  5LMU K;  4EAH D;  3CC4 N;  1BQM A;  3AVI A;  5CZ2 A;  2QXF A;  3THX B;  3BF3 A;  2H3G X;  2VGM A;  1BO5 O;  3RR8 A;  3P83 D;  1K9M O;  3FGU A;  2D0O A;  5M1N A;  2V52 B;  3THY B;  4FOE A;  4DKW A;  4ELU A;  4OGC A;  1YT3 A;  2ATQ A;  4CER A;  5BRD A;  4DFM A;  1WBD A;  1QE1 A;  1ZC6 A;  5BN8 A;  2Z1J A;  1GLE G;  1SKR A;  1T6C A;  1BCM A;  4CZL A;  1RT4 A;  3OYH A;  3NF8 A;  3QDK A;  2UU9 K;  4DV5 K;  1NK6 A;  2UUA K;  1NM1 A;  1NU0 A;  3T7Z A;  4CJT A;  2QKK A;  2IC3 A;  4Z4H A;  3OYI A;  3EKS A;  4YOX A;  1C1C A;  3VN5 A;  4DSJ A;  4CBW A;  3S3N A;  4FJ9 A;  5K14 A;  4H0O A;  4A62 A;  1RDD A;  2O8B A;  5C24 A;  4M7X A;  3D2E B;  4JHD B;  2HNY A;  2I7N A;  3KLF A;  3VF2 A;  1VQP N;  3V1R A;  1NGC A;  5ELZ A;  2HHQ A;  1DGK N;  4JS4 A;  1M1K O;  2HST A;  1NGJ A;  2ASO A;  3EE8 A;  4E1N A;  1NOZ A;  1UWB A;  2BH1 A;  5EVZ A;  1BHL A;  4CES A;  3D6R A;  3A5M C;  1YUW A;  3VQ9 A;  2VQF K;  2W41 A;  3HL8 A;  2Q31 A;  1JCE A;  4CFB A;  2D0P A;  3QIO A;  3O1W A;  3EL2 A;  4DQQ A;  1UA0 A;  4OPJ A;  1U2V B;  4KB0 A;  5JS1 A;  2Q0U A;  3SLC A;  4I9Q A;  4E7J A;  3TSQ A;  3F73 A;  2OA8 A;  1KQS M;  4H5R A;  5CR4 A;  2Z1G A;  3AA4 A;  4M42 A;  4B1Z A;  1WB9 A;  3RMA A;  4B8C A;  2QXL A;  3HK2 A;  1RBU A;  1X3N A;  4IOX A;  4DQ8 A;  2FSJ A;  3C7N A;  4FJN A;  4Q0B A;  5HRR A;  3CXC M;  1GLF O;  1HNI A;  1K6Y A;  2HNZ A;  3IS9 A;  3W0L A;  4GV6 A;  4IFY A;  2OYQ A;  1RIL A;  3ZET A;  3KJV A;  1X1P A;  2E4L A;  3UE5 A;  1IG8 A;  1REV A;  3M8R A;  3MN9 A;  3S41 A;  1RTJ A;  3CF5 L;  3RR7 A;  2A6A A;  3V1O A;  3QBX A;  3SBG A;  3L2V A;  4BRH A;  2KFN A;  2FSK A;  1SAZ A;  2HHX A;  5I42 A;  3HP9 A;  1ZBH A;  4CZM A;  4BE2 A;  3QIC A;  4EHT A;  2FBT A;  5E41 A;  4GY2 B;  3I8B A;  2AP1 A;  3VEX A;  5DM6 L;  3I55 N;  3BF1 A;  3LWM A;  3DXM B;  4CF0 A;  3ALY A;  2VCP A;  5SWM A;  4ZTJ A;  1VSD A;  5F0X A;  4DTN A;  1KC8 O;  3QEI A;  3QNO A;  3LDQ A;  4JKC A;  4FJM A;  1I39 A;  4CW7 B;  2QWQ A;  4HHT A;  2OCE A;  2D4W A;  1W0H A;  1EWR A;  3AO2 A;  3ATU A;  2Z1I A;  1NK8 A;  3GE1 A;  4CI6 A;  3QB0 A;  1HKC A;  3J7Y P;  3ULD A;  1HRH A;  3HPH A;  2ITG A;  3PSF A;  3G10 A;  1A5X A;  3ID6 A;  1KFD A;  4CK1 A;  2X74 A;  3N4P A;  4AHV A;  4JKB A;  4FPA A;  4CF9 A;  1RDU A;  4BRL A;  4DFJ A;  3T3F A;  2FBV A;  1EP4 A;  5C25 A;  2Z1H A;  1Z25 A;  2A41 A;  3KZB A;  5AQQ A;  1SKS A;  4IG0 A;  3AVG A;  1LWF A;  1WSG A;  2OPP A;  1JJ2 M;  4B08 A;  5M1O A;  4DTR A;  4PWD A;  2P9L B;  3B6P A;  3FE1 A;  3ID8 A;  4AF1 A;  1IKV A;  1BCO A;  2D1K A;  3IKM A;  4DV6 K;  1B9D A;  1WAF A;  3VGM A;  3VGK A;  5KGW A;  3UKR B;  1P8Z A;  1OVQ A;  4O0I A;  1ASU A;  3NHG A;  3O9U A;  3M8Q A;  1BI4 B;  2HHU A;  3OW2 M;  3I33 A;  5KPZ A;  1WBB A;  2G8U A;  4EIA A;  2HBJ A;  3DLK A;  4RW9 A;  3F2K A;  1BDG A;  1D8Y A;  1LW0 A;  2GWK A;  4CFC A;  4JK7 A;  5GIN A;  3EZW A;  1UOC A;  2XO7 A;  3VA0 A;  3DRS A;  4ISE A;  4JI1 K;  3HXM A;  4E7H A;  3CET A;  2PFU A;  2E8A A;  1W2B M;  3RRH A;  3OS1 A;  4O8K A;  2QW9 A;  1IBM K;  3AO1 A;  5FPN A;  4LSN A;  4FCY A;  3BP8 A;  2E6M A;  4DQS A;  2YCH A;  4CZJ A;  4BDP A;  1S1U A;  1YF5 L;  4K25 A;  5TKY A;  2P9K B;  2HHT A;  3RRG A;  4DSK A;  4DCH A;  4A5A A;  4DTJ A;  5CE3 A;  4ZHR A;  2A1S A;  4B9L A;  2QWP A;  4KTW A;  1HNV A;  4N47 A;  1W9H A;  3NE6 A;  5AQG A;  4F8R A;  1VRT A;  4GNI A;  3CCM N;  4CEF A;  4GKK K;  3TU5 A;  2ASM A;  3QFP A;  4BQZ A;  1W7A A;  1JKH A;  2A5X A;  1TYQ A;  1S6Q A;  2AJQ A;  4FJL A;  2LSN A;  4LFC K;  3D45 A;  2WUS A;  5AZJ A;  1NOY A;  3OYN A;  4BDZ A;  3VQC A;  4CJW A;  2YNG A;  3HI0 A;  1QQC A;  3C94 A;  2QK9 A;  2DPN A;  4BY9 C;  1G15 A;  1ITG A;  4EZ9 A;  1BIU A;  4CHZ A;  4FJJ A;  4CK2 A;  2P51 A;  2OZM A;  4FLZ A;  5AQY A;  2YKN A;  1S5J A;  3K9J A;  4EFH A;  3MXI A;  3QBW A;  1KCF A;  5JIC A;  1N32 K;  3MXM A;  1XNR K;  2E2N A;  4JI8 K;  2DTU A;  1VQO N;  3NH2 A;  4C8O A;  4CEO A;  1J5O A;  4BC5 A;  4H0X B;  3VF4 A;  3CJ1 A;  1CXU A;  1L3T A;  3S9H A;  1ESV A;  5C42 A;  3N4Q A;  3V1Q A;  1OVY A;  4C8M A;  4DLG A;  1HYV A;  4OKK A;  3WXL A;  3EE9 A;  4KRF A;  1R0A A;  2RPI A;  4CJQ A;  4BR9 A;  4Z4I A;  4BE1 A;  1C1B A;  4XH5 A;  5HRO A;  3ZSY A;  4JNE A;  2Y1I A;  4DTX A;  1J6Z A;  3HP6 A;  1VQM N;  4BRM A;  2FLO A;  2XHB A;  4HTU A;  1U04 A;  4H0T B;  3EYZ A;  2P9P B;  1NJY A;  1XNQ K;  2RN2 A;  3TPQ A;  1IG9 A;  3CER A;  4FYD A;  3O8M A;  3QEP A;  1T6D A;  3ZCM A;  3M8P A;  1K73 O;  3WQU A;  1WSE A;  4BRD A;  1HQE A;  1K8K A;  3CD6 N;  1TV6 A;  3VQE A;  3PO4 A;  1QQO A;  3THX A;  3SAG A;  3VQ8 A;  3OHR A;  1WSI A;  5KRT A;  4BDY A;  2VG5 A;  5KTQ A;  1N34 K;  3C0B A;  1DEJ A;  3TAR A;  4DF4 A;  4Z4G A;  4CD1 A;  4B9N A;  3DLB A;  3CJ9 A;  3CCV N;  2WBN A;  3THY A;  1IKW A;  2RHK A;  2XRI A;  4ELV A;  3U3Y A;  5M1F A;  3CHW A;  3CM6 A;  3QML A;  2YNI A;  5ADX A;  4DUY K;  4BEB A;  2UYT A;  3H45 C;  2HMI A;  4LSL A;  3KTQ A;  1RGI A;  3ASM A;  3TAM A;  1CXQ A;  3SCX A;  4CGD A;  3HOS A;  3NH1 A;  4MQ3 A;  5AZI B;  3O5B A;  2QWO A;  3AVB A;  5AQS A;  4MLH A;  1BOT O;  1BA0 A;  3P1G A;  4FWP A;  4QS9 A;  4PHT X;  2ZWH A;  2ZE2 A;  3H1Q A;  3BUZ B;  3WQT A;  3O4W A;  4FWL A;  4LFA K;  3CM5 A;  4DV7 K;  4KH5 A;  1ATS A;  3WXM B;  1KVC A;  1QVG M;  3NGZ A;  4CZG A;  4JHD A;  3E9O A;  4AQY K;  3RTV A;  1H1V A;  5AQP A;  1RDB A;  4JRQ A;  1XHX A;  3O9T A;  4OO1 J;  1D9D A;  3NDK A;  4FWR A;  3KK2 A;  1JLQ A;  1JLB A;  2NRX A;  2HHV A;  3CCE N;  3PX4 A;  4FLU A;  2BDP A;  1JLC A;  4BE7 B;  3AV9 A;  1ZBS A;  4FLX A;  4CJ7 A;  2WTU A;  4W5Q A;  3PV8 A;  3O3H A;  3CFO A;  1SKW A;  1U2V A;  3FZF A;  5LL6 Z;  5C0Y A;  5J2M A;  3ZSW A;  5J2Q A;  4B3S K;  4WFN L;  2O8C B;  3K59 A;  3NF9 A;  1N8R O;  3MEC A;  4FL9 A;  4FZZ A;  2G8F A;  4XEI A;  3R6M A;  3FZH A;  5AQT A;  1SL1 A;  4XIU A;  2VGN A;  4AHR A;  3L6Q A;  3NAE A;  5BPM A;  2QI2 A;  3SK3 A;  4RTF D;  1SZ2 A;  1KLN A;  4NLC A;  4LF7 K;  3VEV A;  3ZX3 A;  4Q5V A;  2RKI A;  3SQ2 A;  1RDC A;  1QVF M;  1IH7 A;  4NCA A;  2X6N A;  3LZI A;  4QOZ B;  4NXM K;  3AO4 A;  4LD0 A;  4FJI A;  1OH6 A;  3D7E O;  2A1R A;  2F9T A;  1BUP A;  3VTH A;  4FW2 A;  3CPW M;  1U45 A;  1KVA A;  4DV3 K;  2D0C A;  2VG6 A;  2UXC K;  3G4S N;  4JI5 K;  2UXB K;  1GLD G;  3HPO A;  3DXM A;  4CEZ A;  1G99 A;  3CYG A;  5HRS A;  4DR3 K;  3DLH A;  3HO1 A;  4KHW A;  3HM8 A;  5FDL A;  2NUB A;  3VQ4 A;  2ZQB A;  5LJW A;  4B9V A;  4CJR A;  3JAM O;  5E26 A;  5GIP A;  1BWF O;  3V81 A;  2UUB K;  2IAJ A;  2ZGZ A;  4LF4 K;  3ZSV A;  2A42 A;  1JLA A;  4RW8 A;  3SQ4 A;  1E4F T;  1NGF A;  2CH5 A;  2W00 A;  4FOI A;  2O4I A;  3K58 A;  1RT2 A;  1QQM A;  3K57 A;  3IFR A;  4CED A;  4CIG A;  2W42 A;  1ASW A;  2P9N B;  2V51 B;  4DV1 K;  1RTD A;  2ZJR L;  2G8K A;  4Z0U A;  5FPE A;  4JI7 K;  2YJF A;  1DTT A;  4CJ4 A;  4KHN A;  4N56 A;  3LDP A;  3V9U A;  3LDS A;  3KK3 A;  4NO7 A;  3ZSQ A;  4ICL A;  3BGR A;  2P9L A;  1YHQ N;  3SUQ A;  3PX6 A;  3UKR A;  3KLG A;  1RDW X;  4DTS A;  4YY3 K;  3V9W A;  4W5O A;  2I7P A;  2IVO A;  3U9D A;  2G8H A;  4FO0 A;  1BI4 A;  4QCL A;  3O9Q A;  2GWJ A;  3H3O B;  1LWC A;  3AVM A;  4KO0 A;  4CJK A;  2CGL A;  2KZZ A;  3I0R A;  3QLH A;  4CEC A;  1U47 A;  3L2W A;  3LAM A;  3PSI A;  4J2D A;  4H4O A;  2HF4 A;  5T7B A;  3QIN A;  2O8E B;  1VSE A;  3OBW A;  2EX3 A;  2PYJ A;  5M1K A;  4K43 A;  4KHU A;  3ZSX A;  4DSF A;  1WOQ A;  1XMO K;  2ZJP L;  1VQL N;  4FLW A;  4OGE A;  2P9K A;  3AA5 X;  2QA4 N;  5AQW A;  4KBO A;  4JK9 A;  3HVR A;  4HTL A;  4M3Z A;  3T69 A;  1IJJ A;  1TVR A;  2HHI A;  4AHC A;  5FRO A;  5CHI A;  4DV4 K;  4KHS A;  3JYT A;  3TAE A;  5FRN A;  4HUE A;  2JWL A;  4WFA L;  4FK4 A;  3TSP A;  4HCB A;  3UIQ A;  4FWS A;  1QS4 A;  3LM2 A;  4KI4 A;  5GAE P;  3O9R A;  4G9Z A;  4BRQ A;  4BGB A;  1VQ8 N;  4JK8 A;  2IS3 A;  2YNF A;  3IMX A;  4B8A B;  3DRP A;  1DLO A;  2QWR A;  2HBL A;  4YFU A;  4Z94 A;  3L8B A;  2C1G A;  3CIP A;  1FK9 A;  3KLH A;  2P9U B;  5J1E A;  4JYA K;  1VQ5 N;  2F9W A;  2IOC A;  4YOR A;  3O3G A;  1RT3 A;  3TAQ A;  3R8E A;  1BQN A;  5I3U A;  4BRC A;  2EHG A;  3NBP A;  2HHH K;  4E3S A;  3NCI A;  3AVF A;  3VQP A;  3V9S A;  3TSU A;  4A57 A;  4GKJ K;  4FXD A;  3C6A A;  2P5G A;  5AQF A;  4G1Q A;  4CHO A;  3ISN C;  4I6M B;  4A59 A;  4C8N A;  4AIL C;  3VQQ A;  1EET A;  1YAG A;  2ZD1 A;  3ATV A;  4CJU A;  3O1B A;  1IKX A;  2Q3S A;  4FLY A;  3WNH A;  4QAG A;  4MLE A;  4W5T A;  3NGI A;  4WCE L;  4PKI A;  5M1P A;  4PQU A;  1M90 O;  1T05 A;  4JKH A;  1HR0 K;  1N6Q A;  1V4S A;  1FW6 A;  3OYC A;  2B6A A;  2VWK A;  2P9P A;  2RE2 A;  5JS2 A;  4CF1 A;  1O1W A;  3S5T A;  4L8R B;  1JCF A;  4JKG B;  2P1J A;  1ZYQ A;  3CCR N;  2KHO A;  2PBD A;  1VSF A;  4AHT A;  4CEQ A;  5D3G A;  1MWK A;  4BGA A;  3O6W A;  3V4I A;  2FBY A;  1HJO A;  3CG7 A;  2HVI A;  1LOT B;  4DV0 K;  1HQU A;  1LWE A;  1YVU A;  3VOV A;  3QNN A;  2QEX N;  2FF6 A;  1TK5 A;  2HVH A;  4KI6 A;  2WON A;  4EP5 A;  3LDL A;  1Q7Y O;  3SYZ A;  1JXE A;  1RBV A;  3ZSR A;  3OJS A;  1IV0 A;  3LAK A;  1KLM A;  4FM1 A;  1JCG A;  5BR9 A;  3DLR A;  1NNE A;  2O8D B;  1WSJ A;  2YHW A;  2NLX A;  2DFH A;  5AZI A;  2O4G A;  3AAQ A;  3NH0 A;  3E9P A;  3AO3 A;  1QHT A;  4PL8 A;  5HRN A;  2P9S B;  4PUO A;  3KD5 E;  3LPU A;  5AQH A;  1TAQ A;  3NFA A;  1F21 A;  4F3O A;  3A2F A;  4FJ5 A;  4BRG A;  1D4X A;  3VA3 A;  1CZ9 A;  4CCH A;  4X65 K;  3CI5 A;  1W97 L;  4OJR A;  3G71 N;  5JMV A;  4CBU A;  4DTU A;  4HUF A;  1NKC A;  3L4I A;  4F4K A;  5KI6 A;  2W6K A;  1I3A A;  4JEP A;  3S3O A;  3VEN A;  3GBT A;  3P4I A;  3SZ2 A;  2HHW A;  1VSI A;  1C6V A;  4IFE A;  3ITH A;  3FR0 A;  3TTD A;  3K5N A;  1U6Z A;  4JV5 K;  3KKR A;  1MWM A;  3EN9 A;  1TKX A;  3VEY A;  2O8C A;  2FSN A;  3QO9 A;  2F8T A;  4C8K A;  3DLE A;  4ID1 A;  4UY8 O;  2E1Z A;  1S1W A;  1JLE A;  1ZXO A;  4A61 A;  3K9K A;  3RMC A;  4YOY A;  1C1A A;  1ZBL A;  4Y1C A;  4ELT A;  1S6P A;  2KQ2 A;  4F9O A;  5FRM A;  3NMU A;  3WXI A;  2VQE K;  3LPT A;  1RCH A;  1YTU A;  3QEX A;  2O8F B;  3PY8 A;  1NJZ A;  3FFK B;  2BUP A;  1YJW N;  1VSK A;  1T7P A;  2HF3 A;  1EXQ A;  3OVN A;  3MN7 A;  3OY9 A;  3IDH A;  3SPY A;  4FWN A;  2ZJQ L;  2KW4 A;  4B9U A;  4CF2 A;  1RTI A;  1IO2 A;  2ETJ A;  2J4R A;  3HBT A;  5KPT A;  4IDH A;  4DMN A;  5HLF A;  4JKE A;  3L2R A;  1GOA A;  3J8A A;  5AFU A;  3VF6 A;  2X6S A;  4A2B A;  3L2Q A;  2F96 A;  4XH1 A;  4IJN A;  1OH5 A;  3CME N;  2HBM A;  4CGI A;  2ZM6 K;  4FVU A;  1GLL O;  3HSC A;  5AFU H;  3R1X A;  4HCC A;  3ENB A;  4F2S A;  4BC4 A;  4CHQ A;  4DR4 K;  3R3L A;  4DR7 K;  1Q9X A;  2NRH A;  4H5V A;  5FPD A;  3V9Z A;  1RTH A;  1T8E A;  2IVN A;  1N33 K;  1XC9 A;  1C0U A;  3SJJ A;  3NVM A;  5KGX A;  1MA9 B;  4KH4 A;  3DOL A;  2W6L A;  3U4L A;  2P9N A;  1SS6 A;  2GEM A;  1J5E K;  3C6H A;  1NGA A;  3AVL A;  3P39 A;  2W40 A;  3F9K A;  3DMJ A;  3MED A;  3HYF A;  5A2Q O;  1NK0 A;  1VSH A;  3J80 O;  3FFI A;  1FJG K;  1GLA G;  3OYD A;  1VQN N;  3TAP A;  1XHZ A;  1BU6 O;  3AVK A;  3MK6 A;  4JKA A;  4OPH A;  4BG9 A;  2CGJ A;  4UQG A;  1HYZ A;  3L3U A;  3SAH A;  1E4G T;  1KSP A;  2D5R A;  1GLJ O;  3CJC A;  3C6U A;  5BPL A;  2KFZ A;  3CPE A;  4MDB A;  1D9F A;  3ZSO A;  3FZL A;  3GDQ A;  3OYB A;  1TKD A;  4AHS A;  4FW1 A;  2OZS A;  3DXK B;  3KK1 A;  3D0P A;  1TK0 A;  3M1F A;  4DB3 A;  4DU4 A;  1TL1 A;  3OBY A;  1EX4 A;  2XY6 A;  4E7I A;  1GLB G;  5AQJ A;  3VEO A;  3V6D A;  4H0P A;  4Z4E A;  4NB4 A;  4LH4 A;  3J7Z O;  4BRF A;  3AVN A;  1B92 A;  3HM9 A;  4DTP A;  2O8E A;  3OS0 A;  3MCP A;  4CHP A;  4U67 L;  3I56 N;  1NGG A;  4CIF A;  3UB5 A;  4E19 A;  1IBL K;  1TUY A;  1HMV A;  3DM2 A;  4B3R K;  2HHS A;  4DTM A;  3D2E A;  4H8K A;  3PIP L;  4DFP A;  5AQK A;  1KTQ A;  5SZT A;  4BRK A;  2E5L K;  2HB5 A;  4PKH A;  4CEA A;  4BWJ A;  5DM7 L;  2IVP A;  2AA4 A;  1J53 A;  3AVJ A;  2NRZ A;  2OPQ A;  2V7Z A;  2JGU A;  3SI6 A;  2G8W A;  3CJB A;  4KPY A;  5JEN A;  3K5O A;  4BR2 A;  1YJN N;  3RWU A;  5HOO A;  5DK5 A;  3KLE A;  2YX6 A;  4I2P A;  3JXU A;  4AHU A;  1KFS A;  5CYM A;  2UUC K;  2HOE A;  3P31 A;  4E0D A;  1Q86 O;  3AA3 A;  3VQB A;  4BR5 A;  1CLQ A;  1RBT A;  2D0A A;  1LW2 A;  3P38 A;  4GV9 A;  1KVB A;  4FK0 A;  3M6G A;  2P9U A;  1YJ9 N;  1S1X A;  2YNH A;  1MU2 A;  1UAX A;  2JWK A;  4LF8 K;  4FWO A;  3SQ1 A;  4ZTF A;  3H1V X;  1VRU A;  3HJF A;  2YV0 X;  3MCA B;  1X3M A;  3CCU N;  4DR2 K;  1NMN A;  3KHY A;  3IRX A;  4DSI A;  1NWK A;  4OLB A;  5GAG P;  3AVA A;  3ULE B;  4IDK A;  3O9S A;  5HP1 A;  5C15 A;  2YKM A;  4MO5 A;  2X78 A;  1L3U A;  2VWB A;  3DWL A;  4BVO A;  1DKG D;  2IDO A;  4Y1D A;  4I6M A;  2QTD A;  1MDU B;  4RG8 A;  3ZLJ A;  3AAR A;  3AVC A;  4KTZ A;  4CZH A;  4DHY A;  3VEZ A;  4OPK A;  2OAN A;  3CCS N;  1SL0 A;  4B9T A;  1HNW K;  1IKY A;  3IG1 A;  1I94 K;  3MX2 A;  4XJX A;  4KH6 A;  1HPZ A;  4FJX A;  4JKF A;  5AQO A;  3U9Z A;  1YIT N;  3SUP A;  3PO5 A;  3ZSZ A;  3VPZ A;  4JI4 K;  3E66 A;  2QWM A;  4H03 B;  3WNF A;  2EWS A;  3TI0 A;  4JKG A;  3SUN A;  1ZBI A;  5AQV A;  3O4N A;  4JI3 K;  1NGI A;  3VMF B;  4NCG A;  1Q9Y A;  4BEC A;  1WSH A;  3G6E N;  4DQP A;  4IXC A;  1NLV A;  3R9P A;  1JLG A;  4FWK A;  3G25 A;  4CK3 A;  2KTQ A;  5TKW A;  3SMS A;  4CGF A;  4W5N A;  2P9I B;  1X9J A;  1TKZ A;  2PAV A;  3A5L C;  3ENO A;  4BRA A;  4IEE A;  3I8D A;  1ILY A;  2BGG A;  4E72 A;  2GX9 A;  3LM9 A;  3L0Q A;  1LAV A;  4GVM A;  2A3Z A;  2E2O A;  4ILJ A;  3DRR A;  1D5A A;  4O5F A;  5CY4 A;  1QSY A;  3QEW A;  1QSS A;  2WFB A;  1DT9 A;  3W3D A;  1YXQ A;  4B1U B;  4B3M K;  2O8D A;  3VQ7 A;  4CJ3 A;  4KB1 A;  1LAW A;  3LZJ A;  2WC9 A;  4IZ9 A;  4DWI A;  4LC9 B;  3I0S A;  4CZK A;  5BN9 A;  1U49 A;  1YI2 N; 
#chains in the Genus database with same CATH homology
 2YI1 A;  5C2F A;  2DPN A;  3AGK A;  1EO1 A;  4BY9 C;  2P9P A;  2P9S A;  2RE2 A;  1JCF A;  3KWG A;  3O08 A;  4JKG B;  4CZI A;  4YOV A;  1SQK A;  2NZT A;  2KHO A;  2PBD A;  3CCR N;  3TTC A;  5AQY A;  1VQ7 N;  3K9J A;  4EFH A;  1MWK A;  1Z6R A;  2GEL A;  4IJA A;  3QBW A;  1HLU A;  4H5N A;  4BGA A;  5JIC A;  3NVK A;  5AQN A;  4IOA L;  3O6W A;  1QHA A;  1HJO A;  2E2N A;  1VQO N;  1LOT B;  3A0I X;  3WXJ A;  3GOI A;  5BPN A;  4BC5 A;  4H0X B;  4BRP A;  3E9L A;  4JD2 A;  3VF4 A;  4PL7 A;  3CJ1 A;  3PLA A;  5F1X A;  3VOV A;  4B1V A;  2QEX N;  2FF6 A;  1ESV A;  5BRF A;  1YIJ N;  1TUU A;  3LDL A;  1Q7Y O;  4OPA A;  3N4Q A;  1OVY A;  1TYQ B;  3MWT A;  2QWL A;  2FF3 B;  3WXL A;  4EHU A;  3EE9 A;  1Q81 O;  5GAH P;  3UKU B;  5EXW A;  2IIR A;  5AZJ B;  3DJC A;  1JCG A;  5BR9 A;  3L4Q A;  4BR7 A;  1Q82 O;  4BR9 A;  5M1Q A;  4C23 A;  5JVG L;  1S72 N;  2GUP A;  1GLC G;  2YHW A;  4XH5 A;  2NLX A;  3H3N O;  3KK7 A;  5AZI A;  4JNE A;  3AAQ A;  4QS8 A;  4FSV A;  3MDQ A;  1J6Z A;  4MDA A;  5BRH A;  1VQM N;  4JKD A;  4BRM A;  2FLO A;  3VES A;  4BRI A;  5GAD P;  4H0T B;  3TTF A;  3E9P A;  3FZK A;  2P9P B;  2E2P A;  4PL8 A;  2P9S B;  3TPQ A;  1CZA N;  3CCJ N;  3CER A;  3ZEU A;  5AQH A;  2ZF5 O;  5AQI A;  3AAP A;  3O8M A;  4K42 A;  1KD1 O;  4NLB A;  4IWV A;  4BRG A;  4ILH A;  1T6D A;  4GVE A;  1K73 O;  1D4X A;  3WQU A;  1C0G A;  4BRD A;  2NRW A;  1K8K A;  3CD6 N;  1VAZ A;  1EQY A;  1KAY A;  3CI5 A;  2KKZ A;  4B1Y B;  1QQO A;  3QFU A;  3WT0 A;  3IUC A;  4JD2 B;  4BR4 A;  3SAG A;  3OHR A;  1W97 L;  3G71 N;  3GG4 A;  5JMV A;  4CBU A;  5JLH A;  3C0B A;  1DEJ A;  4AM7 A;  3CMA N;  1K8A O;  3F5T A;  3D2F A;  4BRO A;  4CD1 A;  3L4I A;  5KQD A;  4MO4 A;  3JS6 A;  1WUA A;  3CJ9 A;  2NRV A;  4U7B A;  2E1Y A;  2WBN A;  1Y64 A;  3H46 O;  3HZ6 A;  3CCV N;  4JEP A;  4FWM A;  3VEN A;  2RHK A;  3CJA A;  4YOU A;  4IOC L;  1NJI O;  1HKB A;  2Q0R A;  3GBT A;  3P4I A;  2CH6 A;  4J8F A;  3VER A;  5M1F A;  3CHW A;  4CD3 A;  2FXU A;  3MX5 A;  2BTF A;  3QML A;  4IFE A;  5ADX A;  2Q36 A;  3OA9 A;  3FR0 A;  4BEB A;  4E1J A;  2UYT A;  3H45 C;  5EOY A;  1U6Z A;  3TTD A;  3SMP A;  1RGI A;  3A5O C;  1MWM A;  3EN9 A;  5HL7 L;  5F2R A;  3HOS A;  2NRT A;  2QM1 A;  2E20 A;  3VEY A;  5AZI B;  3O5B A;  2FSN A;  5JLF A;  3LDO A;  2KLA A;  2QWO A;  3ZX2 A;  1V4T A;  2F7T A;  3EO3 A;  4MLH A;  5AQS A;  1BOT O;  3GL1 A;  1BA0 A;  1KAZ A;  4FWP A;  5B8H A;  4QS9 A;  1NGD A;  1S22 A;  3BEX A;  4UY8 O;  3LL3 A;  3VTI A;  2ZWH A;  2E1Z A;  5EX5 A;  4A61 A;  1ZXO A;  4A5B A;  4PHT X;  4GV3 A;  3H1Q A;  3Q7B A;  3BUZ B;  4HWI A;  3ZEU B;  3K9K A;  4QS7 A;  4YDU C;  1KXP A;  1P90 A;  1R59 O;  2QWN A;  3KVG A;  3O4W A;  3Q7C A;  3WQT A;  2ZGY A;  4FWL A;  4B1X B;  4YOY A;  1NGE A;  3WEE A;  3RSE A;  4F9O A;  4KH5 A;  1ATS A;  3WXM B;  3NMU A;  3WXI A;  1QVG M;  1HX1 A;  2Q1N A;  3HTV A;  4CZG A;  4JHD A;  4CZE A;  3E9O A;  3SJH A;  4YDU A;  2HMP A;  4JN4 A;  3CQY A;  1H1V A;  1K8K B;  3FFK B;  5AQP A;  2BUP A;  3M3Z A;  1YJW N;  4EAH D;  3CC4 N;  3O9T A;  4OO1 J;  2HF3 A;  3BF3 A;  5JVH L;  4C1N I;  3MN7 A;  2H3G X;  2VGM A;  3IDH A;  4FWR A;  1BO5 O;  4FWN A;  2ZJQ L;  2NRX A;  3D2F B;  3CCE N;  2HBK A;  3E1Y A;  1K9M O;  3FGU A;  2D0O A;  5M1N A;  2V52 B;  4BE7 B;  4FOE A;  4ISG A;  4DKW A;  1ZBS A;  4CJ7 A;  4O8U A;  2J4R A;  3HBT A;  5AQR A;  5BRD A;  4IDH A;  5KPT A;  4JKE A;  1Z05 A;  3MMV A;  4M7Y A;  1U2V A;  3FZF A;  3J8A A;  5AFU A;  5C0Y A;  3VF6 A;  1ZC6 A;  4A2B A;  5BN8 A;  4H5T A;  4IJN A;  4XH1 A;  1ATR A;  3DXK A;  3CME N;  1GLE G;  4WFN L;  1T6C A;  4CZL A;  1N8R O;  2HBM A;  4FL9 A;  4FVU A;  1VQ4 N;  1GLL O;  3QDK A;  3HSC A;  5AFU H;  3R1X A;  3ENB A;  4CZF A;  2YJE A;  4WYB A;  3R6M A;  4XEI A;  1NM1 A;  2GTD A;  3FZH A;  3O80 A;  5AQT A;  3T7Z A;  4BC4 A;  3EKS A;  4PKG A;  3R3L A;  4YOX A;  2NRH A;  4H5V A;  2VGN A;  4CBW A;  3L6Q A;  5FPD A;  5BPM A;  2QI2 A;  3SK3 A;  2IVN A;  4RTF D;  4H0O A;  1SZ2 A;  3AGR A;  4A62 A;  4YOT A;  2OTJ N;  4NLC A;  4Y0W A;  2VYP A;  3WEE B;  3RSE B;  3NVM A;  3VEW A;  1MA9 B;  4KH4 A;  4M7X A;  3D2E B;  4CBX A;  3VEV A;  4JHD B;  3ZX3 A;  5LJV A;  3U4L A;  2I7N A;  2P9N A;  1SS6 A;  2GEM A;  3C6H A;  3VF2 A;  1VQP N;  1QVF M;  1NGA A;  1NGC A;  3DLL L;  5ELZ A;  3P39 A;  1DGK N;  2W40 A;  4M63 C;  4WQ4 C;  1M1K O;  2Q2R A;  2HST A;  1NGJ A;  2ASO A;  3EE8 A;  1GLA G;  1QZ5 A;  2BH1 A;  2Q97 A;  3D7E O;  4WQ4 A;  5EVZ A;  1VQN N;  2F9T A;  1BUP A;  3A8Y A;  1BU6 O;  3VTH A;  3CPW M;  5BRE A;  3D6R A;  3MK6 A;  4JKA A;  4OPH A;  2CGJ A;  1YUW A;  3A5M C;  4BG9 A;  4RWT A;  2W41 A;  1VQK N;  2Q31 A;  5KPR A;  3SAH A;  3ENH A;  1JCE A;  1E4G T;  2D0P A;  1LCU A;  1GLJ O;  3CJC A;  3O1W A;  3G4S N;  3EL2 A;  1GLD G;  5BPL A;  3CPE A;  4MDB A;  1U2V B;  3DXM A;  5AQM A;  1G99 A;  3FZL A;  3GDQ A;  5FPM A;  4BRE A;  4IO8 A;  2Q0U A;  3HM8 A;  3SLC A;  5C12 A;  3DXK B;  3MN6 A;  3CC2 N;  5LJW A;  3TSQ A;  3WXK A;  3M1F A;  4FPB A;  1Q18 A;  4DB3 A;  1KQS M;  3RVC A;  4H5R A;  5CR4 A;  3OBY A;  5E26 A;  5GIP A;  1BWF O;  2ZGZ A;  4B1Z A;  1GLB G;  5AQJ A;  3U8X A;  3VEO A;  4H0P A;  2A42 A;  4NB4 A;  2QXL A;  1NMD A;  1X3N A;  4IOX A;  4DQ8 A;  2FSJ A;  3J7Z O;  4BRF A;  2CGK A;  1E4F T;  3C7N A;  4IEI A;  1NGF A;  5LY3 A;  2CH5 A;  1OKJ A;  2W00 A;  3CXC M;  1GLF O;  4FOI A;  3W0L A;  4GV6 A;  4BC3 A;  1QQM A;  3HRG A;  5KQ8 A;  3IFR A;  3MCP A;  3ZET A;  1QQN A;  4U67 L;  2P9N B;  2V51 B;  3UE5 A;  1IG8 A;  3I56 N;  2ZJR L;  4B1W B;  3MN9 A;  3S41 A;  1NGG A;  4BG8 A;  3CF5 L;  3EKU A;  5FPE A;  3CCL N;  2A6A A;  3UB5 A;  2YJF A;  3QBX A;  3SBG A;  4AM6 A;  1TUY A;  4BRH A;  2FSK A;  3LDP A;  1VQ6 N;  3D2E A;  3PIP L;  1SAZ A;  5MLC Q;  5AQK A;  4BRN A;  4NO7 A;  3H6E A;  3FLC O;  3HOT A;  4BRK A;  4CZM A;  2P9L A;  3QIC A;  4EHT A;  3ULE A;  4PKH A;  5GIO A;  1YHQ N;  4GY2 B;  1S3X A;  2AP1 A;  3I8B A;  3UKR A;  3VEX A;  5DM6 L;  3I55 N;  3BF1 A;  5DM7 L;  3DXM B;  1RDW X;  2IVP A;  2VCP A;  2AA4 A;  4WFB L;  4WQ5 C;  5F0X A;  1KC8 O;  2I7P A;  2IVO A;  3U9D A;  2NRZ A;  4FO0 A;  1XQS C;  2V7Z A;  3LDQ A;  4JKC A;  2V7Y A;  1T44 A;  2QWQ A;  3CJB A;  3VGL A;  5C10 A;  3O9Q A;  2D4W A;  2GWJ A;  3H3O B;  3KWI A;  3SBT A;  4H5W A;  3ATU A;  4H0V B;  4WQ5 A;  4BR2 A;  1YJN N;  5HOO A;  1NBW A;  2CGL A;  3CCQ N;  2YX6 A;  3GE1 A;  4CI6 A;  3QB0 A;  1HKC A;  3JXU A;  1KAX A;  2HF4 A;  1HKG A;  1HUX A;  2HOE A;  3P31 A;  3C7N B;  3AY9 A;  3ID6 A;  1Q86 O;  5AQZ A;  4BR5 A;  3OBW A;  4R79 A;  4B9Q A;  5M1K A;  3N4P A;  4K43 A;  3P38 A;  4GV9 A;  2OTL N;  3MN5 A;  3ZET B;  4JKB A;  2ITM A;  1WOQ A;  4FPA A;  3M6G A;  2C1I A;  1C0F A;  2P9U A;  1RDU A;  5AQU A;  1YJ9 N;  1VQ9 N;  2ASP A;  4BRL A;  2ZJP L;  1VQL N;  3A5N C;  4K41 A;  4BVP A;  2JWK A;  4FWO A;  1NGB A;  3H1V X;  3MCA B;  1X3M A;  3CCU N;  2P9K A;  2QA4 N;  3F9M A;  2A41 A;  3KZB A;  5AQQ A;  5AQW A;  3PIO L;  4KBO A;  2E88 A;  3M5R A;  4WF9 L;  3WUH A;  1JJ2 M;  3KHY A;  4JK9 A;  1RFQ A;  3DAW A;  1XC3 A;  5M1O A;  3VET A;  4HTL A;  1NWK A;  3T69 A;  1IJJ A;  2P9L B;  3FE1 A;  3ID8 A;  4AF1 A;  5GAG P;  3IKM A;  2D1K A;  3ULE B;  5CHI A;  3O9S A;  3VGM A;  3CQX A;  5C15 A;  4MO5 A;  3VGK A;  3UKR B;  1P8Z A;  2P9I A;  2VWB A;  3DWL A;  4BVO A;  1DKG D;  4I6M A;  2JWL A;  4RCH A;  3O9U A;  2QTD A;  4WFA L;  1MDU B;  3TSP A;  3OW2 M;  1T3V A;  3AAR A;  4FWS A;  5H1S Q;  3I33 A;  5KPZ A;  4CZH A;  4DHY A;  4EIA A;  3VEZ A;  2HBJ A;  1NGH A;  3LM2 A;  3F2K A;  4YOW A;  2OAN A;  5GAE P;  4ILG B;  3O9R A;  3CCS N;  5EY4 A;  3C65 A;  4G9Z A;  1BA1 A;  2YHX A;  4BRQ A;  5AR0 A;  1BDG A;  3LDN A;  4IO9 L;  2GWK A;  4BGB A;  2A40 A;  4JK7 A;  5GIN A;  3EZW A;  4ISF A;  5AQX A;  4JAX A;  1VQ8 N;  5E84 A;  3MX2 A;  2E2Q A;  4JK8 A;  4KH6 A;  4XJX A;  4ISE A;  4JKF A;  5AQO A;  3U9Z A;  1YIT N;  3CET A;  3IMX A;  3VPZ A;  1QZ6 A;  2PFU A;  2E8A A;  1W2B M;  2QWR A;  2HBL A;  4O8K A;  2QW9 A;  3E66 A;  4Z94 A;  2QWM A;  4H03 B;  2C1G A;  5FPN A;  3CIP A;  4BC2 A;  2EWS A;  4L3Q A;  3BP8 A;  2P9U B;  4XH4 A;  4JKG A;  1VQ5 N;  2YCH A;  2F9W A;  4YOR A;  4CZJ A;  1HPM A;  5AQV A;  3R8E A;  1YF5 L;  4K25 A;  5I9E B;  5TKY A;  1NGI A;  2P9K B;  3VMF B;  4BRC A;  4BEC A;  4DCH A;  3G6E N;  2NRR A;  4IXC A;  4A5A A;  1NLV A;  3R9P A;  1BG3 A;  4C1N K;  4FWK A;  3G25 A;  5CE3 A;  3MWP A;  5TKW A;  3SMS A;  2QWP A;  3TSU A;  4A57 A;  3C6A A;  4H0Y B;  5AQF A;  2P9I B;  1X9J A;  2PAV A;  3ENO A;  3A5L C;  5AQG A;  4GNI A;  4I6M B;  3CCM N;  4A59 A;  4BRA A;  4IEE A;  4BR0 A;  1ILY A;  3TU5 A;  3FZM A;  2GX9 A;  2ASM A;  3CC7 N;  3QFP A;  4BQZ A;  3LM9 A;  5C2D A;  3SAF A;  4FWQ A;  3L0Q A;  2A5X A;  1TYQ A;  5ADX H;  2YHY A;  1YAG A;  3ATV A;  3O1B A;  2NNW A;  2A3Z A;  2E2O A;  4ILJ A;  4A2A A;  3UKU A;  1ATN A;  4O5F A;  5AZJ A;  2WUS A;  4MLE A;  2WFB A;  1YVN A;  1DT9 A;  5AQL A;  3CJ7 A;  3W3D A;  1YXQ A;  4WCE L;  4B1U B;  4PKI A;  5M1P A;  1O13 A;  4BQL A;  1M90 O;  3ZYY X;  1XUP O;  3ZX0 A;  2WC9 A;  4JKH A;  3HI0 A;  4IZ9 A;  4LC9 B;  1V4S A;  3B8A X;  4CZK A;  5BN9 A;  1YI2 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...