4JD2A

Crystal structure of bos taurus arp2/3 complex binding with mus musculus gmf
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
414
structure length
398
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structural basis for regulation of Arp2/3 complex by GMF.
pubmed doi rcsb
molecule tags Structural protein
total genus 124
structure length 398
sequence length 414
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jd2A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4jd2A02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4jd2A03
4EFHA 4ISEA 2ITMA 4XEIA 2IIRA 3FZLA 3QB0A 3TU5A 3LM9A 5AR0A 3CJAA 3ATVA 4CD1A 3A5MC 3H3OB 3FZHA 1BA0A 3O4WA 3ENHA 3C7NB 4H5RA 3VF2A 3MN7A 1T6CA 3VGKA 2DPNA 1R59O 3HZ6A 4EAHD 4BC3A 4BRMA 5BN8A 1KAZA 3FR0A 5AQIA 2ZGYA 1RGIA 4CBWA 3BUZB 2P9PB 4E1JA 3H3NO 4MLEA 1GLLO 2P9IB 4FWMA 1P8ZA 4MLHA 3VEWA 2Q2RA 4RCHA 3GDQA 3QMLA 1SZ2A 2IVOA 2ZF5O 4H0YB 1WOQA 1TYQA 2F9TA 3KVGA 3LDQA 4MO4A 4H5NA 3WXJA 2E2PA 1YXQA 4WQ4A 4WQ5A 1YVNA 4XH1A 5LJVA 2HF3A 4H5VA 1NM1A 4FOIA 2I7NA 3DJCA 3S41A 4A61A 4EHUA 3R8EA 4B1ZA 1HX1A 4PL7A 2FSKA 4K25A 1JCGA 2EWSA 4EIAA 2P9LB 3EN9A 3WXIA 5BN9A 3LM2A 4K43A 2E2NA 1E4FT 2GWJA 2GTDA 1YAGA 3UKRB 4BVPA 2CGLA 2IVPA 3BF3A 4H5TA 3CJ1A 1NGCA 3LDPA 4H0VB 5AQWA 5FPDA 3CQYA 3O80A 1JCFA 5EOYA 4DB3A 3G25A 4DQ8A 2ASPA 3EKSA 4CZMA 1GLJO 3EL2A 3FZFA 2QWOA 4L3QA 3CIPA 2F9WA 2V7ZA 3ENOA 3W0LA 4BRLA 3UB5A 1HJOA 5AQVA 3CI5A 3R9PA 4BC5A 4H5WA 1G99A 3ZX2A 4BRGA 2P9PA 3IMXA 2Q36A 4IJNA 3D2EB 4NB4A 2YJEA 2CH6A 3U4LA 1ZBSA 4GNIA 4HWIA 2YCHA 3MDQA 1U6ZA 2A42A 4GY2B 2CGKA 3BP8A 3DAWA 5BRFA 4H03B 1K8KA 2NZTA 3U8XA 5AZJB 4BR2A 4LC9B 4BRNA 4BRDA 3ZX3A 5I9EB 4DHYA 3O08A 2H3GX 2I7PA 4FWQA 4H0XB 3DXKB 4FWNA 2BTFA 5E84A 1NGFA 3WQUA 2D1KA 2P9LA 1KAYA 2WUSA 2OANA 4J8FA 5AQQA 4A2BA 4EHTA 3A5OC 5JLFA 1C0FA 3UKRA 1Q18A 4FWOA 5KQDA 5AZIB 2A5XA 1KAXA 3QDKA 4NO7A 3ULEA 4CZHA 5AQYA 4QS9A 2V51B 3AAPA 4FPBA 4JHDB 1DEJA 4FOEA 5FPMA 4CZLA 1T6DA 2P9NB 4A2AA 3QICA 3D7EO 3ZETB 1NLVA 3LDLA 2NLXA 3UE5A 3WQTA 1GLFO 1Z05A 4RTFD 3A0IX 4B1XB 1RFQA 2P9UB 4CZEA 4IO8A 3CJBA 3AARA 4FO0A 5KQ8A 4M63C 2AA4A 1X3MA 3DWLA 4BRKA 3OHRA 3D2EA 2FLOA 2P9KB 4WQ4C 4AM7A 5AQXA 4M7XA 1YUWA 1CZAN 3D2FB 3ATUA 5BREA 5AQGA 2IVNA 1XUPO 3MN5A 1MWMA 5AQZA 5AQSA 5TKYA 1QZ5A 2D0OA 4BQZA 4FWSA 1NGGA 5AZJA 5AQTA 2PAVA 3O8MA 1H1VA 3M1FA 3O6WA 4YDUA 5AQMA 4QS7A 1BU6O 2E20A 1J6ZA 4BRFA 3LL3A 1BO5O 2VCPA 1MWKA 2FF6A 1U2VB 3VPZA 3HBTA 5JMVA 4PKIA 3CERA 2YJFA 2QXLA 3VF4A 2GWKA 1HKGA 1HKCA 5KPTA 5EXWA 1NWKA 3H1QA 1QZ6A 5AZIA 4A62A 2YHWA 3P4IA 4BRHA 5CE3A 5EVZA 3VEZA 1ATSA 1GLEG 1D4XA 1QQNA 2A40A 4IXCA 4BC2A 2P9NA 3SJHA 1V4TA 2KHOA 5AQNA 5KPZA 3QBXA 3W3DA 5JICA 2P9SB 4BR7A 4BRPA 2P9UA 1V4SA 3C7NA 3ZX0A 4H0PA 1HKBA 4BVOA 2E2OA 4HTLA 1X9JA 2HMPA 3ID8A 3MMVA 2ZWHA 4BG8A 3H45C 3WT0A 4FWKA 3WEEB 2J4RA 3HM8A 2ZGZA 4JD2B 5BRDA 4B1UB 3I33A 4PKGA 3UKUB 5F0XA 3C0BA 3BF1A 3IFRA 5AQLA 3M6GA 2HF4A 5AQJA 3FFKB 2BUPA 5AQUA 2ASOA 2A3ZA 2NRHA 1NGDA 3CHWA 2YI1A 3O1WA 2P9IA 4PKHA 2QWNA 3MN9A 2Q97A 3J8AA 4B1VA 1C0GA 4CBUA 4H0OA 1BG3A 5BR9A 3VEVA 2V52B 2A6AA 3FLCO 3MCPA 3SLCA 4JN4A 4IZ9A 5F2RA 2QWMA 4KBOA 4BC4A 1NGAA 1HPMA 4CZKA 3VF6A 4CZJA 2V7YA 1ZC6A 2ASMA 3U9ZA 3VEOA 2GELA 5AQKA 4CD3A 3GL1A 5BRHA 2QW9A 3SMSA 3RSEB 4Z94A 2VWBA 4JNEA 4XH4A 3M3ZA 2D4WA 2PBDA 3FZMA 1NGIA 3VGMA 3H1VX 4BGBA 3GG4A 3HSCA 2P9SA 4BR4A 4BREA 3CJ7A 3BEXA 4IJAA 4FWRA 3EZWA 5E26A 3SMPA 2QWLA 4CBXA 5BPNA 1QHAA 2FXUA 3AY9A 4YDUC 2CH5A 4C23A 3VETA 3SK3A 3WEEA 5AQFA 4JD2A 4BRIA 4CJ7A 3UKUA 5AQHA 3VEYA 1GLDG 4FWLA 2E1ZA 3VEXA 1NMDA 5JLHA 3VERA 2VYPA 3B8AX 2FSJA 3U9DA 5ADXH 2W41A 4WQ5C 2GEMA 3VENA 3DXMB 5ADXA 4F9OA 1Z6RA 2QWRA 1TUYA 3QBWA 2UYTA 3A8YA 1HLUA 1OKJA 1KXPA 3IUCA 3L6QA 3EKUA 2AP1A 1GLBG 3KHYA 1NGEA 1XC3A 3R6MA 3I8BA 5B8HA 5ELZA 3DXKA 3LDNA 2Q1NA 1BOTO 5AFUH 2Q0RA 1DGKN 2W40A 3RSEA 1MDUB 1ATRA 3CETA 5AFUA 5F1XA 3EO3A 1JCEA 4ISGA 4CZIA 5EX5A 4XH5A 3AAQA 4AM6A 1NGHA 4BR5A 4M7YA 1SAZA 3O5BA 3L0QA 4BROA 3H6EA 4FL9A 4JHDA 5AQOA 5FPNA 1LOTB 3F9MA 3ZETA 4FSVA 1K8KB 1QQOA 3A5LC 4BRCA 3TPQA 5BPLA 2YHYA 4CZGA 2A41A 2Q0UA 1RDWX 1TUUA 4I6MB 1NBWA 3GE1A 1X3NA 3VGLA 4IWVA 1SQKA 3HTVA 3VOVA 3WXLA 4CI6A 2E8AA 3IDHA 4K42A 5AQPA 5EY4A 5KPRA 1GLCG 2P9KA 2HOEA 1E4GT 1T44A 4H0TB 2YHXA 1MA9B 3D2FA 4DCHA 3DXMA 3ZEUB 1S3XA 2E2QA 4FPAA 1EQYA 4ISFA 1ATNA 2FSNA 3FGUA 1LCUA 4BG9A 3JS6A 3O1BA 3ULEB 2FF3B 1ZXOA 1QQMA 4QS8A 4BR0A 4CZFA 1DKGD 3CQXA 4MO5A 1IJJA 2QM1A 4BRQA 3MN6A 3QFPA 1GLAG 1NGJA 1XQSC 4FWPA 3GOIA 1IG8A 3GBTA 3L4IA 1BUPA 2GUPA 1ESVA 3HI0A 1Y64A 1U2VA 1WUAA 2E88A 4RWTA 1NGBA 3JXUA 3H46O 2QWPA 4K41A 3CJCA 2D0PA 4B1WB 4O5FA 5LY3A 5LJWA 3WUHA 3CJ9A 3MK6A 3LDOA 4WYBA 1S22A 1BA1A 4BGAA 5FPEA 4BQLA 3FZKA 1BWFO 3A5NC 3QFUA 3WXKA 4B1YB 4BR9A 1BDGA 4I6MA 1HUXA 5AQRA 4O8KA 2QWQA 2E1YA 3KZBA 2CGJA 4B9QA 4PL8A 4JAXA 1TYQB 5BPMA 3ZEUA 3VESA 3FE1A 2Q31A 4BRAA 4Y0WA
chains in the Genus database with same CATH superfamily
4RG8A 4ISEA 2IIRA 1CXQA 2O8CB 3NBPA 2VQEK 4RW7A 3LM9A 2FBVA 1WLJA 3T1AA 3H3OB 1RT1A 3O4WA 2OA8A 2PZSA 2GX9A 3C7NB 1T7PA 3VQ7A 3VF2A 1WAFA 1D9FA 3TSUA 4FZZA 3RRGA 1T6CA 2DPNA 3K5OA 4CIEA 3HZ6A 5CYMA 2OCEA 3CM6A 5AQIA 4DR3K 3LP1A 4AHUA 2XY7A 1JJ2M 4E1JA 3NH1A 2ZJQL 1VSFA 4EZ9A 1WSIA 2OTJN 2P9IB 1W9HA 3ZT1A 4KV8A 4DTMA 4RCHA 3VQDA 3K58A 4YFUA 3SUNA 2ZF5O 1WOQA 4J2DA 2F9TA 3KVGA 3LDQA 3K0SA 1S6PA 4C8NA 4MFBA 3G0ZA 2HHSA 1QSLA 4XH1A 4H5VA 2HVHA 4FOIA 3S41A 3LAMA 3R8EA 3OS1A 2E4LA 1P90A 3SQ4A 1T03A 2G8UA 2EWSA 3CMEN 1Q8IA 2UU9K 4YOVA 3EN9A 3QEVA 5BN9A 1VQKN 3UKRB 4F3TA 2CGLA 2Z1IA 3LDPA 1JKHA 4CJKA 5AQWA 4XJXA 3CQYA 4DQ8A 1A5WA 1NJZA 4C8KA 1RTHA 1VSLA 3B6PA 2RN2A 3CPEA 3BDPA 3O4NA 1ILYA 1QS4A 3AVJA 4BRLA 4KH6A 3AO2A 1HJOA 3LALA 4CGIA 3QERA 4GVEA 3R9PA 4XIUA 1RDCA 3OW2M 3DOLA 3R1XA 4H5WA 4BRGA 3CC4N 1U47A 3KTQA 2D0BA 4IJNA 1CZ9A 4DQPA 4B8AB 5KTQA 4DTPA 2YJEA 3TABA 1VQNN 4HWIA 3CFPA 4CHYA 4CJ3A 2E6LA 3AO4A 2CGKA 2YHBA 3BP8A 3DAWA 4JV5K 1K8KA 1IKWA 1NOYA 3VQEA 3PY8A 3HOTA 1SL0A 4BRDA 4CJEA 3O9TA 4CF9A 2QI2A 2H3GX 4CGGA 1BIZA 4FWQA 1OVYA 3KK7A 3WQUA 2D1KA 4HCCA 1S1WA 4OX9K 1K6YA 3NF7A 2WUSA 1RTJA 2HNZA 4WFAL 2HBLA 3H08A 4B3TK 1OH5A 4LF8K 4JKBA 4FWOA 5KQDA 4FJNA 3TTCA 4FJ7A 1JL2A 1WN7A 4NO7A 3OYBA 3ULEA 3CQ8A 4DR2K 3AAPA 3CM5A 3QESA 2IDOA 5FPMA 3P1GA 4FVMA 4KTQA 2NLXA 3UE5A 3WQTA 4B3SK 2KLAA 3CD6N 4CZEA 3SBTA 4K0KK 3CJBA 3NHGA 4KH4A 3QEIA 2GV9A 3CCQN 1IBLK 3D2EA 4WQ4C 4AM7A 5AQXA 2R7YA 3CC7N 1CZAN 3D2FB 2QKBA 2UXCK 5AQGA 3MX2A 2YHAA 4I9QA 3V9WA 2IGIA 4YNQA 4G1QA 4BY9C 1JXBA 5AQZA 5TKYA 4DFJA 3RMCA 4FWSA 1NGGA 5AZJA 3NMUA 5KGWA 4CEZA 3G6EN 4DQIA 1BU6O 2JWLA 4AH9A 2HHTA 1K9MO 4CJWA 1ZBLA 4B9UA 1UWBA 3HBTA 4M3TA 4AHRA 1KSPA 4FM0A 2QTDA 1IKYA 5AZIA 2XRIA 1SKSA 4IOXA 3HPGA 4E7KA 4BRHA 4OJRA 4G9ZA 4IXCA 1GOAA 3PX4A 3QNOA 3QLHA 1V4TA 4C8MA 3IAYA 4CHPA 1QSSA 1LV5A 4B3RK 4BR7A 2OPRA 5SZTA 4CF1A 4BVOA 1NKBA 4HTLA 5HRPA 3MMVA 4DV7K 2ITGA 3H45C 3L2RA 4R79A 3WEEB 2J4RA 4LF7K 4B1UB 4CHOA 4CFDA 3HSTB 1KC8O 3OY9A 3PIOL 3BF1A 1LWCA 4DUZK 1FK9A 5AQLA 4KB0A 4OGEA 4C1NI 4EP5A 2BUPA 3SAHA 4DSFA 1JXEA 4V19S 1C0GA 3LWMA 3CCVN 1T05A 1VSKA 1TGOA 1XHZA 3VEVA 1SKWA 1I94K 1WSFA 2HBKA 3PUFA 3ZT2A 3KLIA 4DV4K 3V4IA 1NGAA 1S5JA 2ASMA 3DI6A 3U9ZA 2GELA 1D5AA 3SMSA 5SWMA 1YITN 3RSEB 4DSKA 4JNEA 4FJ9A 3H1VX 4QOZB 4IEIA 1S1VA 2NUBA 4FWRA 5J1EA 5E26A 3PX0A 4F8RA 2QWLA 5DM6L 1SV5A 5BPNA 3K2PA 3EY1A 3JAMO 1WAJA 3VETA 3OJSA 3CCLN 5M1FA 1SL2A 4DV6K 1U48A 4JI5K 4O55A 1J5EK 3V1RA 4CJ7A 3UKUA 3VEYA 4FWLA 2E1ZA 3VEXA 2KQ2A 5JENA 2FC0A 2VYPA 3CFOA 2UXDK 5HBMA 3AGKA 3NH2A 3VENA 3DXMB 4DQSA 3NVMA 1Z6RA 4F9OA 2QWRA 1N32K 2HB5A 4O0JA 3J7AP 4M42A 1QQCA 3AVGA 4CJSA 3JSMA 1VSJA 3L6QA 4I9LA 4E7LA 3SJJA 2G8VA 3EKUA 3THXB 2AP1A 4ELUA 1XC3A 1HYZA 3V6DA 2NRZA 1S9EA 3I8BA 3DXKA 3LDNA 5D3GA 5AFUH 4CERA 4LFAK 1DGKN 1WSJA 1ATRA 2A1SA 1JCEA 4EP4A 2Z1JA 5EX5A 3OYJA 2O4IA 1HQEA 1O1WA 3O3HA 4BDPA 4RW4A 3HK2A 1KVAA 1SAZA 3O5BA 1HNVA 2HMIA 5JS1A 3H6EA 1QVFM 3L2WA 1LOTB 3IKMA 3B6OA 2ZD1A 1K8KB 4CZGA 3CG7A 1C1BA 3O9UA 2A41A 1BQMA 4I6MB 4CHNA 4W5TA 1RT6A 3GE1A 1X3NA 4B08A 3AA4A 5BR8K 4F3OA 1RBSA 4ELVA 5AQPA 4NXMK 2HOEA 1E4GT 2YHXA 3S3MA 3NGIA 1TVRA 3G71N 2F7TA 4CEOA 3CC2N 1ATNA 2FSNA 3BZCA 1RT2A 3ULEB 4KHNA 4AHSA 1ZXOA 3MWPA 1LW0A 4BRQA 4A57A 2O8BA 3RR8A 1NGJA 4ID1A 4FLZA 1Y64A 1NJYA 1VQ4N 1NK0A 3H46O 1BGXT 3O3FA 4TSXA 4UY8O 1J5OA 1NJXA 2GBZA 3KWIA 4M3RA 5DMRA 3O9RA 3PSIA 4JI1K 1IBKK 1KVCA 4WYBA 2VG6A 1BA1A 5FPEA 4BQLA 4BECA 4OGCA 4CJ4A 4BR9A 1RILA 3ZSYA 4FYDA 1EWQA 5C25A 3AVFA 2QWQA 2D0AA 2CGJA 3C94A 5C0YA 3VQ6A 1TYQB 5GAGP 1VSDA 2HSTA 4X66K 3G4SN 3ZEUA 2Q31A 4BRAA 3CYMA 3KKSA 4OKJA 3TAQA 2FBTA 3MECA 3V9SA 4ILHA 3VA3A 1YJWN 3N4QA 4DS5A 1XI1A 2NRXA 3M8RA 4DQQA 3ZSRA 3TWHA 1WB9A 1K73O 3LANA 3OA9A 1YJNN 4KHPK 1LW2A 3ENHA 4KKOA 2BANA 4H5RA 3SNNA 1XNRK 4BE1A 2NNWA 4GV3A 4WFBL 4W5NA 1R59O 2VWJA 4WFNL 2ETJA 4KI6A 4BC3A 4BRMA 1KRPA 3FR0A 4U67L 3H3NO 4JKFA 3VA0A 1Q9YA 5C42A 1XMOK 1L3UA 4FJGA 3NH0A 3VEWA 4BACA 4CFBA 1IO2A 3KK2A 3IRXA 3J7ZO 1QSYA 3RMBA 3OVNA 4JKCA 5C10A 3KJVA 4CJTA 2AJQA 4H5NA 2E2PA 2DY4A 4OVLA 2UXBK 5LJVA 4Z4GA 3TAPA 1NM1A 4FM1A 4A61A 4KI4A 4OPJA 2XY5A 4K25A 3OYFA 3NAEA 2P9LB 5JVHL 3QIOA 3WXIA 1ASUA 1HNZK 2UUAK 1E4FT 2GWJA 2VG7A 1HQUA 2GTDA 1YAGA 3L8BA 4BVPA 4JKAA 1TKXA 3JYTA 4H5TA 4JKEA 3AVHA 4CF0A 1VSHA 4KAZA 5EOYA 1ASVA 1VQON 4CZMA 1GLJO 4E19A 3FZFA 2ATQA 2F96A 3CIPA 2F9WA 1XHXA 2V7ZA 4CJLA 4JKHA 4YOTA 3HYFA 1DT9A 3KLEA 1G99A 5GAEP 2P9PA 1TK5A 4NYFA 2RE2A 5LMUK 1S9GA 1ITGA 4A5AA 4DTJA 1VRUA 1C1CA 3QIPA 1OH6A 4NCAA 3KLFA 4DTRA 1HNXK 1NU0A 4CFCA 2YCHA 3MDQA 1CLQA 1U6ZA 4GY2B 4GVMA 4X64K 3U8XA 1C0TA 4BRNA 5I9EB 4DHYA 3AVLA 3AO3A 4RW9A 4H0XB 3DXKB 4FK0A 3AA2A 5E84A 3Q7CA 4BDYA 3RTVA 2F8TA 2OANA 2OZSA 3NF6A 3AV9A 4N41A 3DRSA 1Q18A 1VQLN 4L8RB 1KAXA 3QDKA 1HPZA 1BIUA 1SL1A 1WSHA 4O8UA 2V51B 4FPBA 4IFEA 4FOEA 4A2AA 3LDLA 2VGMA 4YHHK 1GLFO 4B1XB 2P9UB 4JLHA 4KB1A 1W0HA 3AARA 1YTAA 3SUOA 3ENBA 4MDBA 2AA4A 1X3MA 2WFBA 3OHRA 2FLOA 3VQBA 5FRMA 1EWRA 3MN5A 2OPSA 3PV8A 1VQ7N 3J7YP 4BQZA 2PAVA 3NFAA 1H1VA 1TKTA 3RMDA 1X9MA 5DM7L 2E20A 4B9NA 4KHYA 4CCHA 4J2BA 2WTUA 1Z25A 3CYGA 2YJFA 2GWKA 3TAMA 3MEDA 3H1QA 2B6AA 4JKGA 2VG5A 2XHBA 5CE3A 4OLAA 5EVZA 1ATSA 2A40A 4UQGA 2P9NA 3SJHA 3TSQA 3SQ1A 1HNWK 3QEXA 4HTUA 2P9SB 4BRPA 1V4SA 1NKEA 4H0PA 3VQQA 3HP6A 1X9JA 2HMPA 3ID8A 3MX5A 2ZWHA 4NLBA 3SZ2A 4HCBA 3K5MA 1K8AO 4N76A 2OPPA 4JYAK 1T3VA 2QK9A 3OJUA 1HR0K 1VSIA 2JWKA 3I33A 1Q82O 3C0BA 3E9PA 3OBWA 3IFRA 4E7JA 3M6GA 3J80O 1ZBUA 5AQUA 1DTQA 2NRHA 5LMNK 1NGDA 5HROA 4BDZA 2YX6A 4CJVA 4PKHA 2O8DA 2QWNA 3CCSN 3MN9A 4CF2A 1IKXA 1RBTA 4DU3A 2Z1GA 1L3VA 3DRRA 3KD5E 4H0OA 2V52B 3FLCO 2PY5A 1UAXA 4HHTA 3SYZA 4FJXA 4KBOA 4I7FA 4DV2K 5EU7A 2KTQA 5C24A 4Z4HA 4CIGA 4FLWA 1ZC6A 3ASMA 3VEOA 5AQKA 2WONA 3GL1A 5M1KA 1NK8A 4Z94A 2VWBA 2PBDA 4CE9A 3VGMA 5HLFA 4BGBA 1KLMA 3ID6A 1VRTA 4BR4A 2VGNA 4Z4EA 2NRWA 4BREA 2ZJPL 1YI2N 2DFHA 5M1NA 1OH8A 3SMPA 4J2AA 3VQ5A 3SUPA 4YDUC 2CH5A 4C23A 2O8FB 3DLGA 5CZ1A 3S3OA 2RKIA 3LPUA 1OH7A 4JD2A 4BRIA 3ZT0A 5AQHA 3TR8A 4O4GA 4JI4K 3T7ZA 1JLGA 1NMDA 3R3LA 5ADXH 2DTUA 3EEQA 4CK2A 1TUYA 4JI6K 2KFNA 2UYTA 2HHVA 5K14A 1ZBFA 1KXPA 3V9ZA 1VSEA 3CCJN 3L2QA 3KHYA 1NGEA 1RBVA 3R6MA 5HOOA 2X78A 4LD0A 1TK8A 4I2PA 1NK7A 2KZMA 1LWFA 2Q0RA 3QEWA 1XWLA 3CETA 3NF9A 5AFUA 1S1UA 5CZ2A 1NK5A 4Z4IA 3SV3A 1Y97A 4XH5A 3THVA 4JI0K 3KD1E 3AAQA 4AM6A 1TAUA 4FJ5A 3L0QA 1VQ9N 4FL9A 5FPNA 4CFAA 4E7IA 2P5GA 5KRSA 3AVMA 3ZETA 1HNIA 1EKEA 1QQOA 1RT7A 4BRCA 5BPLA 3THYB 4DFPA 2Q0UA 1TUUA 4GKKK 2XY8A 3C6TA 2F4VK 4KPYA 1SQKA 3HTVA 4CI6A 2E8AA 4K42A 3HPHA 5KPRA 2UUCK 3SAGA 2RPIA 1T44A 3VQCA 5IT9O 1MA9B 1VQMN 2C1GA 3E9OA 1J53A 4Z4FA 1JLEA 3IS9A 2E2QA 3V9XA 4GMJB 5J2PA 1N5YA 3FGUA 1RDDA 3K57A 2FF3B 4JEPA 3QNNA 4JI3K 4DSJA 4OPAA 3RMAA 1GLAG 1D8YA 2YKNA 4FWPA 3T3FA 3GOIA 3GBTA 3L4IA 1BUPA 5T7BA 4W5OA 3HI0A 2HHWA 4JS4A 1WUAA 2E88A 4JK8A 5C2DA 3CJCA 1FKPA 3LP0A 2D0PA 3VTIA 2KFZA 5C2FA 4M45A 2IS3A 3MK6A 3LDOA 1BQNA 1WBDA 3A5NC 3NE6A 3D0PA 4B9SA 1HUXA 3HPOA 1IG9A 1BHLA 2X6SA 3CCEN 3KZBA 4B9QA 3SI6A 3MEGA 2HHUA 3WNEA 4FJJA 5JS2A 5BPMA 5FRNA 4N47A 3EE8A 2WC9A 4CJPA 4BE2A 4Y0WA 1UA1A 4JK9A 4JKGB 1BCOA 4EFHA 2ITMA 1U45A 3QB0A 3TU5A 5AR0A 3DLEA 4YOWA 5TKWA 4PWDA 1R0AA 1BA0A 4FW2A 4CGJA 2XY6A 4CJ5A 3HO1A 4DR4K 4DSIA 3MN7A 3OS2A 4LH5A 4DS4A 4GW6A 3VGKA 4IG0A 5GAHP 3MXIA 3LP2A 4EAHD 4CGHA 3M8SA 3K5LA 3NGYA 5BN8A 1GOCA 4AHCA 1E3MA 4FJKA 4CBWA 1CZBA 5CR4A 4YORA 4MLEA 4DSLA 4N5SA 1IKVA 3VQPA 2IOCA 2O8DB 1VQ5N 4FWMA 1YVUA 3LZIA 4NYNA 4MLHA 3QMLA 1SZ2A 3LWLA 2IVOA 4CEFA 3E66A 1HYVA 4MO4A 4C1NK 1YXQA 3L4QA 4WQ4A 1YVNA 4MDAA 4DFKA 4DF4A 2I7NA 4PA1A 3AVKA 4EHUA 4IFYA 4CGFA 4HVJA 1HX1A 2FSKA 3ZCMA 4B9VA 1JCGA 4EIAA 1YJ9N 4E72A 3QETA 4K43A 4FJMA 4DKWA 1KD1O 3CJ1A 3CMAN 3EE9A 1TAQA 3LZJA 3VQ9A 5FPDA 3O80A 2HHHK 1JCFA 3SPZA 4DB3A 3RRHA 4IEEA 2ASPA 3IG1A 1JLCA 3EKSA 3KLHA 4F2RA 4Y1DA 3L2VA 5IWAK 5HRSA 4L3QA 3T1YK 3ENOA 3SPYA 3UB5A 5AQVA 4FLXA 1VK0A 3CI5A 4BC5A 2G8FA 1VHXA 3WNFA 3Q7BA 4FLYA 3K9JA 1OVQA 3IMXA 2Q36A 3D2EB 1MU2A 4DU4A 2YV0X 3OYAA 4AF1A 4CEQA 1QE1A 4GNIA 4DR7K 4X65K 3TAEA 1VSMA 4AQYK 2NRRA 4O0IA 1D9DA 3P38A 2G8KA 2IAJA 3ZSVA 4H03B 1EXQA 4FCYA 5AZJB 1RT4A 4KHQA 4B3OA 3ZX3A 3KWGA 4OPHA 5FROA 3DMJA 1REVA 3NVKA 2I7PA 2BTFA 4O5BA 1RNHA 1NGFA 4DLGA 2A1RA 4CEAA 4J8FA 1B92A 4A2BA 4EHTA 4JRQA 4DF8A 1NK9A 4FJIA 1KTQA 3A5OC 5JLFA 1C0FA 3UKRA 2OZMA 1NK4A 2W6LA 5AZIB 4YOUA 4OKKA 1Q7YO 3CCMN 2X6NA 1HJRA 3V9UA 2BDPA 4QS9A 1DEJA 4CZLA 3ZETB 1RDBA 4LFCK 2DFFA 1BCMA 4FW1A 2YNHA 4IO8A 1HRHA 4M63C 3DWLA 4BRKA 4W5QA 4M7XA 1YUWA 3ATUA 5BREA 2XO7A 3OYMA 1XUPO 4FLVA 3ZT3A 5AQSA 3O3GA 3O9QA 1QZ5A 2D0OA 4HUEA 5C12A 1WBBA 4CGDA 4LSNA 5AQTA 3M1FA 4Q5VA 4QS7A 3AVNA 4B9TA 3I56N 4FLUA 1RCHA 1JLBA 3I0SA 1BO5O 4JI2K 1W2BM 1N6QA 5J2NA 1Q9XA 2HBJA 3MWTA 1MWKA 4CECA 1CXUA 5JMVA 3F73A 4DSEA 3ZYYX 1HKGA 1HKCA 1RDAA 3A2FA 1T8EA 1JLAA 1NWKA 1QZ6A 1EO1A 2YHWA 4DUYK 4JK7A 3HOSA 3P4IA 1C0MA 3VEZA 1A5XA 1GLEG 1QQNA 1TL3A 4LY7A 4KHUA 2KHOA 5M1PA 3W3DA 5JICA 1L5UA 3KK3A 4DU1A 4IG3A 1QVGM 1HKBA 4A59A 3CCRN 4AHTA 2E2OA 2RF2A 5FDLA 4M3YA 2OTLN 1JL1A 3DM2A 3OYGA 4LF5K 1UA0A 3HM8A 3UKUB 4W5RA 1N33K 1C6VA 4IOAL 5AQJA 4U7BA 3FFKB 3LP3A 3SQ0A 4KHWA 5I42A 1FW6A 4IOCL 2Q97A 1NK6A 1YT3A 4DV0K 4IBNA 4B1VA 4CBUA 4M3WA 1BG3A 3ZSWA 4NXNK 2C1IA 1WNSA 1YHQN 1W7AA 2W42A 3MCPA 3SLCA 3T19A 4JN4A 4DFMA 4IZ9A 5F2RA 3SUQA 3C6AA 3HVTA 4BC4A 1HPMA 4CZKA 3VF6A 4CZJA 2V7YA 1X1PA 1RTIA 3SCXA 3FZMA 4DTSA 4KREA 2QXFA 4FM2A 3P5JA 4IJAA 3MXMA 1RBRA 3T69A 3EZWA 3CPWM 3C6HA 4CBXA 4X62K 3DRPA 2ZM6K 2FXUA 3AY9A 3SK3A 5JVGL 3WEEA 1GOBA 2ZE2A 1RBUA 3F9KA 1KQSM 5JLHA 3I8DA 4ZTJA 1J9AA 3C95A 3O9SA 4B3MK 5GIOA 3B8AX 4WQ5C 3VMFB 3K59A 4KTZA 3ULDA 4NLCA 5ADXA 3PO5A 1O13A 3P39A 2WOMA 4FK4A 2HNDA 1EETA 3HM9A 4AILC 2O8EA 5I3UA 1GLBG 1IH7A 4KTWA 2KZZA 2O8BB 5B8HA 2Q1NA 5CYQA 3HRGA 3OS0A 2EHGA 5HRNA 3KLGA 3RSEA 5H1SQ 1MDUB 5F1XA 3EO3A 3KIOA 1Q86O 1JLFA 3AA5X 4DTXA 2E5LK 4M7YA 3ZSOA 4BROA 2HNYA 5AQOA 4JHDA 1A5VA 4CF8A 3M8QA 4FSVA 2YHYA 3KK1A 5A2QO 1RDWX 4PUOA 3PIPL 1NJWA 1NBWA 1XC9A 4IWVA 4FXDA 4WCEL 5KI6A 3WXLA 3T1HK 2PYLA 4DTOA 2P9KA 1RDUA 2B5JA 4H0TB 4DQRA 3DXMA 3ZEUB 3PX6A 1S3XA 4PQUA 1FKOA 3DYAA 4FPAA 1EQYA 3QINA 1WSGA 3JS6A 1VQ6N 3CXCM 1QQMA 4QS8A 4BR0A 3NGZA 4DV3K 1DKGD 3CQXA 4MO5A 2P5OA 1IJJA 3HXMA 3THXA 4Q0BA 3MN6A 3VQ4A 2BH1A 1M1KO 1BL3A 3C6UA 3QFPA 4A5BA 4J2EA 1XQSC 3I55N 1IG8A 4CHQA 4ILGB 4LF9K 4BE0A 2QKKA 1U2VA 3BGRA 4DR6K 4CK1A 3JXUA 1HMVA 1X9SA 4K41A 2E6MA 5DK5A 1ZBIA 4O5FA 1F21A 5LJWA 3ISNC 4IO9L 2Y1JA 5HP1A 3ALYA 1S22A 4BGAA 1L3TA 3WXKA 1BWFO 4B1YB 1BDGA 4I6MA 3HJFA 5AQRA 1B9FA 4FK2A 3TANA 2BGGA 1TL1A 3PO4A 1KFDA 4PL8A 3D45A 4JAXA 3DLHA 4EZ6A 4ILJA 3ZLJA 3E1YA 1L3SA 1U04A 1YF5L 2NRTA 5FLXO 4DR5K 1YIJN 2D0CA 2B4JA 2JGUA 4XEIA 3FZLA 5M1QA 5MLCQ 3CJAA 3ATVA 2G8IA 4CD1A 1N8RO 4BWJA 3A5MC 3SBGA 2KW4A 3FZHA 4BE7B 1U4BA 5CHIA 2NRVA 4R5PA 1VQPN 5GINA 3EZ5A 3CFRA 4C8OA 1KAZA 2ZGYA 2FBYA 1RGIA 3KKRA 3BUZB 4C8LA 2P9PB 2YNIA 3AO5A 3EYZA 4LF6K 2BE2A 1B9DA 1GLLO 2D5RA 2ZJRL 4ZTFA 1P8ZA 2Q2RA 3GDQA 1SKRA 3TTFA 3SV4A 1LWEA 4H0YB 1SS6A 1YTUA 3NF8A 1TYQA 3WXJA 1Q81O 3ZT4A 4M3XA 4WQ5A 2Z1HA 2HF3A 4CK3A 3HP9A 3TSPA 2X74A 3DJCA 3THWA 1TK0A 4LF4K 2KKZA 4B1ZA 1BISA 4PL7A 4FJHA 4HUFA 3LM2A 3VTHA 2E2NA 4WE1A 1I39A 3TAFA 2ZQBA 1N34K 2IVPA 3BF3A 3PSFA 1NGCA 4H0VB 1J54A 4RW6A 2O4GA 3ZSXA 3MAQA 4CHZA 3G25A 4CJQA 2QA4N 2F8SA 2FBXA 3S3NA 3EL2A 3RR7A 3HVRA 4ELTA 2QWOA 1RTDA 4O44A 4E1MA 1S6QA 3W0LA 4YY3K 3V81A 3ZX2A 2HBMA 4NB4A 1LAVA 4DWIA 4ZHRA 1BI4A 2QEXN 4ID5A 1NJIO 2CH6A 3U4LA 1ZBSA 4CJFA 5HL7L 1NKCA 2A42A 5BRFA 2NZTA 5LL6Z 4BR2A 1UOCA 4LC9B 2O8EB 3OYNA 4M41A 4GV9A 3AGRA 1IBMK 3O08A 3AO1A 4JI8K 3SAFA 4IDHA 4FWNA 2JLEA 4FJ8A 4Z0UA 3S9HA 2I5JA 3J81O 3V1QA 3MXJA 2P9LA 1KAYA 5AQQA 2A5XA 2PYJA 4Z4CA 4CZHA 5AQYA 4JHDB 3SQ2A 2YNGA 1T6DA 2P9NB 4WF9L 3QICA 3D7EO 1NLVA 3DLBA 4DV1K 1Z05A 4RTFD 3A0IX 1RFQA 2HHIA 1I3AA 1KLNA 4LFBK 4FO0A 5KQ8A 4E0DA 2P9KB 3ZSQA 4M3UA 2HW3A 1C0UA 2IVNA 2PFUA 3HT3A 3BY5A 1MWMA 1EX4A 1QHTA 3ZSZA 4E89A 1W97L 4OKEA 1IV0A 4GV6A 3O8MA 3O6WA 4YDUA 5AQMA 5GADP 4CESA 4KH5A 1ZBHA 1J6ZA 4BRFA 2W6KA 3LL3A 1XMQK 2VCPA 3C65A 1TV6A 2FF6A 4CJRA 1U2VB 3VPZA 4YOXA 4PKIA 4K8ZA 3MEEA 3CERA 2QXLA 4CW7B 3VF4A 3OTOK 1NOZA 5KPTA 3WNGA 4H4MA 3LAKA 4IFVA 5EXWA 4A62A 3HL8A 3G10A 1M90O 3WXMB 1TKZA 4IDKA 2O8CA 3LDSA 3DLLL 2HHXA 1D4XA 4BC2A 1S1TA 4KHSA 2RHKA 1ASWA 2WBNA 3AA3A 5AQNA 5KPZA 1N36K 3QBXA 4DG1A 1TKDA 2P9UA 3F5TA 4YOYA 3C7NA 3LPTA 3ZX0A 1FJGK 2VWKA 4CIFA 4BG8A 3L3UA 3WT0A 4FWKA 1S1XA 4HUGA 4E7HA 4LH4A 3UIQA 4DLEA 4FJLA 4JD2B 2ZGZA 5BRDA 4PKGA 5F0XA 3L2UA 1G15A 4CJUA 2HF4A 2YKMA 2ASOA 1C1AA 2A3ZA 3CHWA 2P51A 2YI1A 4FZYA 3O1WA 2P9IA 1KVBA 3VN5A 1HYSA 3TI0A 3BZKA 3J8AA 4KFBA 1NNEA 2W00A 4OPKA 1FXXA 5BR9A 4NCBA 2A6AA 4B8CA 4E1NA 2OYQA 3RWUA 2QWMA 5CY4A 1KFSA 3AVAA 1VQ8N 1S72N 5BRHA 4CD3A 2QW9A 2EX3A 4DR1K 4XH4A 3M3ZA 2D4WA 4OO1J 4KO0A 1NGIA 3K9KA 2HHQA 3E9LA 3GG4A 3HSCA 2P9SA 3L3VA 3PLAA 2UUBK 3NDKA 3CJ7A 3BEXA 3VQ8A 4F4KA 2Y1IA 1QHAA 3M8PA 3OYCA 4DTUA 2G8WA 3P83D 4B9LA 5GIPA 5AQFA 3DOKA 1GLDG 3THWB 5C15A 5J2QA 4JI7K 3VERA 3U9DA 3CF5L 2FSJA 4IKFA 4M3ZA 2W41A 2GEMA 4DTNA 3MCAB 3DLKA 3N4PA 3QBWA 4B9MA 1Z26A 3A8YA 4OLBA 1HLUA 3TTDA 1OKJA 3IUCA 1DTTA 2VQFK 1EP4A 3CCUN 2P1JA 4CVNE 3RVCA 4DV5K 2DFEA 5ELZA 1BOTO 1RT3A 1XNQK 3U3YA 2W40A 3OYEA 3OYHA 4JS5A 3AVIA 4ISGA 4CZIA 5M1OA 4CEDA 2Q3SA 1BI4B 3D6RA 3P31A 1NGHA 4BR5A 3M5RA 1X9WA 2LSNA 5AJ3K 4KRFA 3F9MA 1RT5A 3S5TA 2O8FA 3A5LC 3TPQA 2HVIA 2IC3A 4H4OA 3NCIA 3OYKA 3DLRA 3VGLA 1KCFA 3VOVA 3OYLA 3IDHA 3F2KA 3ITHA 5EY4A 3TAGA 4BEBA 1GLCG 4FLTA 5KGXA 4JKDA 4FZXC 3OYDA 3D2FA 3VQAA 4DCHA 4PY5A 1JLQA 3AVCA 4ISFA 4NCGA 1LCUA 4BG9A 3O1BA 4I2QA 4CEEA 4CZFA 1U49A 1SUQA 4LSLA 4MQ3A 2QM1A 4DMNA 3FFIA 4FVUA 3OBYA 2OPQA 4H8KA 4PHTX 3V1OA 3I0RA 1NMNA 5J2MA 5KRTA 2GUPA 1WSEA 1ESVA 1LAWA 2YNFA 4RWTA 4CEBA 1NGBA 3QO9A 2QWPA 3WNHA 3OYIA 3TARA 3K5NA 5HRRA 1ZYQA 4B1WB 4K8XA 4F2SA 4Y1CA 5LY3A 4E3SA 3E01A 1VAZA 3AVBA 5E41A 4JRPA 4ICLA 1DLOA 3WUHA 3CJ9A 4RW8A 3FZKA 3QFUA 1NG9A 2G8HA 4BWMA 3THYA 4O8KA 2E1YA 4QCLA 3QEPA 1QTMA 4GKJK 2GUIA 4QAGA 3O4QA 4AHVA 4N56A 3U6FA 3VESA 3FE1A 3U3GA
chains in the Genus database with same CATH topology
4JK9A 4ILHA 4ISEA 4JKGB 2ITMA 4EFHA 4XEIA 2IIRA 3FZLA 1YJWN 3N4QA 3QB0A 5M1QA 3TU5A 2NRXA 5MLCQ 3LM9A 5AR0A 3CJAA 3ATVA 4YOWA 1K73O 4CD1A 1N8RO 3A5MC 3H3OB 5TKWA 3SBGA 3OA9A 3FZHA 1BA0A 3O4WA 1YJNN 4BE7B 3ENHA 2NRVA 5CHIA 2GX9A 3C7NB 4H5RA 1VQPN 3VF2A 5GINA 3MN7A 3TSUA 1T6CA 2NNWA 3VGKA 4GV3A 4WFBL 2DPNA 1R59O 5GAHP 3HZ6A 4WFNL 4EAHD 4BC3A 4BRMA 5BN8A 1KAZA 3FR0A 5AQIA 2ZGYA 1RGIA 4U67L 4CBWA 3BUZB 2P9PB 5CR4A 1JJ2M 4YORA 4E1JA 3H3NO 2ZJQL 4MLEA 4JKFA 1GLLO 2OTJN 2P9IB 1VQ5N 4FWMA 2ZJRL 1P8ZA 4MLHA 3VEWA 2Q2RA 4RCHA 3GDQA 3QMLA 1SZ2A 3TTFA 3J7ZO 2IVOA 2ZF5O 4JKCA 4H0YB 1WOQA 1SS6A 3E66A 5C10A 1TYQA 2F9TA 3KVGA 3LDQA 4MO4A 4H5NA 3WXJA 1Q81O 4C1NK 2E2PA 1YXQA 3L4QA 4WQ4A 4WQ5A 1YVNA 4XH1A 5LJVA 4MDAA 2HF3A 4H5VA 3TSPA 1NM1A 4FOIA 2I7NA 3DJCA 3S41A 4A61A 4EHUA 3R8EA 2KKZA 1P90A 4B1ZA 1HX1A 4PL7A 2FSKA 4K25A 1JCGA 2EWSA 4EIAA 1YJ9N 3CMEN 2P9LB 4YOVA 3EN9A 5JVHL 3WXIA 5BN9A 3LM2A 3VTHA 4K43A 2E2NA 1E4FT 2GWJA 4DKWA 2GTDA 1YAGA 1KD1O 3UKRB 4BVPA 2CGLA 2IVPA 3BF3A 4JKAA 1VQKN 4H5TA 3CJ1A 4JKEA 1NGCA 3CMAN 3EE9A 3LDPA 4H0VB 5AQWA 5FPDA 3CQYA 3O80A 1JCFA 4XJXA 5EOYA 4DB3A 3G25A 4DQ8A 4IEEA 2ASPA 1VQON 3EKSA 2QA4N 4CZMA 1ILYA 3CPEA 1GLJO 3EL2A 3FZFA 2QWOA 4L3QA 3CIPA 2F9WA 2V7ZA 3ENOA 4KH6A 3W0LA 4BRLA 3UB5A 1HJOA 5AQVA 3CI5A 4JKHA 4GVEA 3R9PA 4YOTA 4BC5A 3OW2M 1DT9A 3R1XA 4H5WA 1G99A 3ZX2A 4BRGA 3Q7BA 5GAEP 2HBMA 3K9JA 2P9PA 3IMXA 3CC4N 2Q36A 4IJNA 3D2EB 4NB4A 2RE2A 2YJEA 1VQNN 2QEXN 4A5AA 1NJIO 2CH6A 3U4LA 1ZBSA 4AF1A 4GNIA 4HWIA 5HL7L 2YCHA 3MDQA 2NRRA 1U6ZA 2A42A 4GY2B 2CGKA 3BP8A 3DAWA 3P38A 5BRFA 4H03B 1K8KA 2NZTA 3U8XA 5AZJB 4BR2A 4LC9B 3HOTA 4BRNA 4BRDA 3ZX3A 5I9EB 3AGRA 4GV9A 3KWGA 4OPHA 3O9TA 4DHYA 3O08A 2QI2A 2H3GX 3NVKA 2I7PA 4FWQA 4H0XB 4IDHA 3SAFA 3DXKB 4FWNA 1OVYA 2BTFA 3KK7A 1NGFA 5E84A 2D1KA 3WQUA 3Q7CA 2P9LA 1KAYA 2WUSA 2OANA 4J8FA 5AQQA 4A2BA 4EHTA 4WFAL 2HBLA 3A5OC 5JLFA 1C0FA 3UKRA 1Q18A 4JKBA 4FWOA 5KQDA 1VQLN 5AZIB 4YOUA 3TTCA 2A5XA 1KAXA 3QDKA 1Q7YO 3CCMN 4NO7A 3ULEA 4CZHA 5AQYA 4O8UA 2V51B 3AAPA 4FPBA 4IFEA 1DEJA 4JHDB 4QS9A 4FOEA 5FPMA 4CZLA 1T6DA 2P9NB 4A2AA 3QICA 4WF9L 3D7EO 3ZETB 1NLVA 3LDLA 2NLXA 2VGMA 3UE5A 3WQTA 1GLFO 1Z05A 4RTFD 3A0IX 4B1XB 1RFQA 2KLAA 2P9UB 3CD6N 4CZEA 4IO8A 3SBTA 3CJBA 3AARA 4KH4A 4FO0A 5KQ8A 3ENBA 4MDBA 4M63C 2AA4A 1X3MA 2WFBA 3DWLA 4BRKA 3CCQN 3OHRA 3D2EA 2FLOA 2P9KB 4WQ4C 4AM7A 5AQXA 3CC7N 4M7XA 1YUWA 1CZAN 3D2FB 3ATUA 5BREA 5AQGA 2IVNA 3MX2A 1XUPO 2PFUA 3MN5A 4BY9C 1MWMA 5AQZA 5AQSA 5TKYA 1VQ7N 3O9QA 1QZ5A 2D0OA 5C12A 4BQZA 1W97L 1NGGA 4FWSA 5AQTA 5AZJA 3NMUA 2PAVA 4GV6A 3O8MA 1H1VA 3M1FA 3O6WA 4YDUA 5AQMA 5GADP 4QS7A 3G6EN 5DM7L 1BU6O 4KH5A 2JWLA 2E20A 1J6ZA 4BRFA 3I56N 3LL3A 1BO5O 2VCPA 1W2BM 1K9MO 3C65A 2HBJA 3MWTA 1MWKA 2FF6A 1U2VB 3VPZA 3HBTA 5JMVA 4YOXA 4PKIA 3CERA 2YJFA 2QXLA 3ZYYX 3VF4A 2QTDA 2GWKA 1HKGA 1HKCA 5KPTA 5EXWA 1NWKA 3H1QA 1QZ6A 5AZIA 4A62A 2YHWA 1EO1A 4JKGA 4JK7A 1M90O 4IOXA 3HOSA 3WXMB 3P4IA 4BRHA 5CE3A 5EVZA 3VEZA 3DLLL 1ATSA 1GLEG 1D4XA 1QQNA 2A40A 4IXCA 4BC2A 4G9ZA 2P9NA 2RHKA 3SJHA 3TSQA 1V4TA 2WBNA 2KHOA 5AQNA 5KPZA 3QBXA 5M1PA 3W3DA 5JICA 2P9SB 4BR7A 4BRPA 2P9UA 3F5TA 1V4SA 4YOYA 3C7NA 3ZX0A 1QVGM 4H0PA 1HKBA 4BVOA 4A59A 3CCRN 2E2OA 4HTLA 1X9JA 2HMPA 3ID8A 3MMVA 2ZWHA 3MX5A 4NLBA 4BG8A 1K8AO 2OTLN 1T3VA 3H45C 3WT0A 4FWKA 4R79A 3WEEB 2J4RA 3HM8A 2ZGZA 4JD2B 2JWKA 5BRDA 4B1UB 3I33A 4PKGA 3UKUB 1Q82O 5F0XA 1KC8O 3C0BA 3E9PA 3PIOL 3BF1A 4IOAL 3OBWA 3IFRA 5AQLA 3M6GA 2HF4A 5AQJA 4C1NI 4U7BA 3FFKB 2BUPA 5AQUA 2ASOA 2A3ZA 2NRHA 1NGDA 3CHWA 3SAHA 2YI1A 3O1WA 2P9IA 2YX6A 4PKHA 4IOCL 2QWNA 3CCSN 3MN9A 2Q97A 3J8AA 4B1VA 1C0GA 2W00A 3CCVN 4CBUA 4H0OA 1BG3A 5BR9A 2C1IA 3VEVA 1YHQN 2V52B 2A6AA 3FLCO 2HBKA 3MCPA 3SLCA 4JN4A 4IZ9A 5F2RA 2QWMA 3C6AA 4KBOA 4BC4A 1NGAA 1HPMA 4CZKA 1VQ8N 3VF6A 4CZJA 2V7YA 1ZC6A 2ASMA 3U9ZA 3VEOA 2GELA 5AQKA 4CD3A 3GL1A 5BRHA 5M1KA 2QW9A 3SMSA 1YITN 3RSEB 4Z94A 2VWBA 4JNEA 4XH4A 3M3ZA 2D4WA 2PBDA 3FZMA 4OO1J 1NGIA 3K9KA 3H1VX 3VGMA 3E9LA 4IEIA 4BGBA 3ID6A 3GG4A 3HSCA 2P9SA 4BR4A 3PLAA 2VGNA 2NRWA 4BREA 3CJ7A 3BEXA 4IJAA 2ZJPL 1YI2N 5M1NA 4FWRA 3EZWA 5E26A 3SMPA 3T69A 3C6HA 2QWLA 4CBXA 5DM6L 3CPWM 5BPNA 1QHAA 2FXUA 3AY9A 4YDUC 2CH5A 4C23A 3VETA 3CCLN 5M1FA 3SK3A 5JVGL 3WEEA 5GIPA 5AQFA 4JD2A 4BRIA 4CJ7A 3UKUA 5AQHA 3VEYA 1GLDG 4FWLA 3T7ZA 2E1ZA 3VEXA 1KQSM 1NMDA 5C15A 5JLHA 3O9SA 3VERA 2VYPA 3B8AX 2FSJA 3R3LA 3U9DA 2W41A 4WQ5C 3VMFB 5ADXH 5GIOA 3CF5L 2GEMA 3AGKA 4NLCA 3VENA 3DXMB 5ADXA 3NVMA 1Z6RA 4F9OA 1O13A 2QWRA 1TUYA 3MCAB 3P39A 3QBWA 3N4PA 2UYTA 3A8YA 1HLUA 3TTDA 1OKJA 1KXPA 3IUCA 3L6QA 3CCJN 3EKUA 2AP1A 1GLBG 3KHYA 1NGEA 3CCUN 1XC3A 3R6MA 5HOOA 3RVCA 2NRZA 3I8BA 5B8HA 5ELZA 3DXKA 3LDNA 2Q1NA 1BOTO 3HRGA 5AFUH 2Q0RA 1DGKN 2W40A 3RSEA 5H1SQ 1MDUB 1ATRA 3CETA 5AFUA 5F1XA 3EO3A 1JCEA 4ISGA 1Q86O 4CZIA 5EX5A 4XH5A 5M1OA 3AAQA 3D6RA 3P31A 4AM6A 1NGHA 4BR5A 4M7YA 3M5RA 1SAZA 3O5BA 3L0QA 4BROA 1VQ9N 3H6EA 4FL9A 4JHDA 5AQOA 5FPNA 1QVFM 1LOTB 3F9MA 3IKMA 3ZETA 4FSVA 1K8KB 1QQOA 3A5LC 4BRCA 3TPQA 5BPLA 2YHYA 4CZGA 3O9UA 2A41A 2Q0UA 1RDWX 1TUUA 4I6MB 3PIPL 1NBWA 3GE1A 1X3NA 3VGLA 4IWVA 1SQKA 3HTVA 3VOVA 4WCEL 3WXLA 4CI6A 2E8AA 3IDHA 4K42A 3F2KA 5AQPA 5EY4A 5KPRA 4BEBA 1GLCG 2P9KA 1RDUA 2HOEA 3SAGA 1E4GT 4JKDA 1T44A 4H0TB 2YHXA 1MA9B 1VQMN 3D2FA 4DCHA 2C1GA 3E9OA 3DXMA 3ZEUB 1S3XA 2E2QA 4FPAA 1EQYA 3G71N 2F7TA 3CC2N 4ISFA 1ATNA 2FSNA 3FGUA 1LCUA 4BG9A 3JS6A 3O1BA 1VQ6N 3CXCM 3ULEB 2FF3B 1ZXOA 1QQMA 4JEPA 4QS8A 3MWPA 4BR0A 1DKGD 3CQXA 4MO5A 4CZFA 1IJJA 2QM1A 4BRQA 4A57A 3MN6A 4OPAA 4FVUA 3OBYA 2BH1A 1M1KO 3QFPA 1GLAG 4A5BA 1NGJA 1XQSC 4FWPA 4PHTX 3GOIA 3I55N 1IG8A 3GBTA 4ILGB 3L4IA 1BUPA 1S72N 2GUPA 1ESVA 3HI0A 1Y64A 1U2VA 1WUAA 2E88A 4RWTA 1VQ4N 1NGBA 3JXUA 3H46O 4JK8A 2QWPA 4K41A 5C2DA 3CJCA 2D0PA 4B1WB 3VTIA 4UY8O 4O5FA 5LY3A 5LJWA 1VAZA 3KWIA 4IO9L 3O9RA 5C2FA 3WUHA 3CJ9A 3MK6A 3LDOA 4WYBA 1S22A 1BA1A 4BGAA 5FPEA 4BQLA 4BECA 3FZKA 1BWFO 3A5NC 3QFUA 3WXKA 4B1YB 4BR9A 1BDGA 4I6MA 1HUXA 5AQRA 4O8KA 2QWQA 2E1YA 3CCEN 3KZBA 2CGJA 4B9QA 4PL8A 5C0YA 4JAXA 1TYQB 5GAGP 4ILJA 2HSTA 3E1YA 5BPMA 3G4SN 3ZEUA 3EE8A 3FE1A 2Q31A 3VESA 4BRAA 1YF5L 2WC9A 2NRTA 1YIJN 4Y0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EFH A;  4ISE A;  2ITM A;  4XEI A;  2IIR A;  3FZL A;  3QB0 A;  3TU5 A;  3LM9 A;  5AR0 A;  3CJA A;  3ATV A;  4CD1 A;  3A5M C;  3H3O B;  3FZH A;  1BA0 A;  3O4W A;  3ENH A;  3C7N B;  4H5R A;  3VF2 A;  3MN7 A;  1T6C A;  3VGK A;  2DPN A;  1R59 O;  3HZ6 A;  4EAH D;  4BC3 A;  4BRM A;  5BN8 A;  1KAZ A;  3FR0 A;  5AQI A;  2ZGY A;  1RGI A;  4CBW A;  3BUZ B;  2P9P B;  4E1J A;  3H3N O;  4MLE A;  1GLL O;  2P9I B;  4FWM A;  1P8Z A;  4MLH A;  3VEW A;  2Q2R A;  4RCH A;  3GDQ A;  3QML A;  1SZ2 A;  2IVO A;  2ZF5 O;  4H0Y B;  1WOQ A;  1TYQ A;  2F9T A;  3KVG A;  3LDQ A;  4MO4 A;  4H5N A;  3WXJ A;  2E2P A;  1YXQ A;  4WQ4 A;  4WQ5 A;  1YVN A;  4XH1 A;  5LJV A;  2HF3 A;  4H5V A;  1NM1 A;  4FOI A;  2I7N A;  3DJC A;  3S41 A;  4A61 A;  4EHU A;  3R8E A;  4B1Z A;  1HX1 A;  4PL7 A;  2FSK A;  4K25 A;  1JCG A;  2EWS A;  4EIA A;  2P9L B;  3EN9 A;  3WXI A;  5BN9 A;  3LM2 A;  4K43 A;  2E2N A;  1E4F T;  2GWJ A;  2GTD A;  1YAG A;  3UKR B;  4BVP A;  2CGL A;  2IVP A;  3BF3 A;  4H5T A;  3CJ1 A;  1NGC A;  3LDP A;  4H0V B;  5AQW A;  5FPD A;  3CQY A;  3O80 A;  1JCF A;  5EOY A;  4DB3 A;  3G25 A;  4DQ8 A;  2ASP A;  3EKS A;  4CZM A;  1GLJ O;  3EL2 A;  3FZF A;  2QWO A;  4L3Q A;  3CIP A;  2F9W A;  2V7Z A;  3ENO A;  3W0L A;  4BRL A;  3UB5 A;  1HJO A;  5AQV A;  3CI5 A;  3R9P A;  4BC5 A;  4H5W A;  1G99 A;  3ZX2 A;  4BRG A;  2P9P A;  3IMX A;  2Q36 A;  4IJN A;  3D2E B;  4NB4 A;  2YJE A;  2CH6 A;  3U4L A;  1ZBS A;  4GNI A;  4HWI A;  2YCH A;  3MDQ A;  1U6Z A;  2A42 A;  4GY2 B;  2CGK A;  3BP8 A;  3DAW A;  5BRF A;  4H03 B;  1K8K A;  2NZT A;  3U8X A;  5AZJ B;  4BR2 A;  4LC9 B;  4BRN A;  4BRD A;  3ZX3 A;  5I9E B;  4DHY A;  3O08 A;  2H3G X;  2I7P A;  4FWQ A;  4H0X B;  3DXK B;  4FWN A;  2BTF A;  5E84 A;  1NGF A;  3WQU A;  2D1K A;  2P9L A;  1KAY A;  2WUS A;  2OAN A;  4J8F A;  5AQQ A;  4A2B A;  4EHT A;  3A5O C;  5JLF A;  1C0F A;  3UKR A;  1Q18 A;  4FWO A;  5KQD A;  5AZI B;  2A5X A;  1KAX A;  3QDK A;  4NO7 A;  3ULE A;  4CZH A;  5AQY A;  4QS9 A;  2V51 B;  3AAP A;  4FPB A;  4JHD B;  1DEJ A;  4FOE A;  5FPM A;  4CZL A;  1T6D A;  2P9N B;  4A2A A;  3QIC A;  3D7E O;  3ZET B;  1NLV A;  3LDL A;  2NLX A;  3UE5 A;  3WQT A;  1GLF O;  1Z05 A;  4RTF D;  3A0I X;  4B1X B;  1RFQ A;  2P9U B;  4CZE A;  4IO8 A;  3CJB A;  3AAR A;  4FO0 A;  5KQ8 A;  4M63 C;  2AA4 A;  1X3M A;  3DWL A;  4BRK A;  3OHR A;  3D2E A;  2FLO A;  2P9K B;  4WQ4 C;  4AM7 A;  5AQX A;  4M7X A;  1YUW A;  1CZA N;  3D2F B;  3ATU A;  5BRE A;  5AQG A;  2IVN A;  1XUP O;  3MN5 A;  1MWM A;  5AQZ A;  5AQS A;  5TKY A;  1QZ5 A;  2D0O A;  4BQZ A;  4FWS A;  1NGG A;  5AZJ A;  5AQT A;  2PAV A;  3O8M A;  1H1V A;  3M1F A;  3O6W A;  4YDU A;  5AQM A;  4QS7 A;  1BU6 O;  2E20 A;  1J6Z A;  4BRF A;  3LL3 A;  1BO5 O;  2VCP A;  1MWK A;  2FF6 A;  1U2V B;  3VPZ A;  3HBT A;  5JMV A;  4PKI A;  3CER A;  2YJF A;  2QXL A;  3VF4 A;  2GWK A;  1HKG A;  1HKC A;  5KPT A;  5EXW A;  1NWK A;  3H1Q A;  1QZ6 A;  5AZI A;  4A62 A;  2YHW A;  3P4I A;  4BRH A;  5CE3 A;  5EVZ A;  3VEZ A;  1ATS A;  1GLE G;  1D4X A;  1QQN A;  2A40 A;  4IXC A;  4BC2 A;  2P9N A;  3SJH A;  1V4T A;  2KHO A;  5AQN A;  5KPZ A;  3QBX A;  3W3D A;  5JIC A;  2P9S B;  4BR7 A;  4BRP A;  2P9U A;  1V4S A;  3C7N A;  3ZX0 A;  4H0P A;  1HKB A;  4BVO A;  2E2O A;  4HTL A;  1X9J A;  2HMP A;  3ID8 A;  3MMV A;  2ZWH A;  4BG8 A;  3H45 C;  3WT0 A;  4FWK A;  3WEE B;  2J4R A;  3HM8 A;  2ZGZ A;  4JD2 B;  5BRD A;  4B1U B;  3I33 A;  4PKG A;  3UKU B;  5F0X A;  3C0B A;  3BF1 A;  3IFR A;  5AQL A;  3M6G A;  2HF4 A;  5AQJ A;  3FFK B;  2BUP A;  5AQU A;  2ASO A;  2A3Z A;  2NRH A;  1NGD A;  3CHW A;  2YI1 A;  3O1W A;  2P9I A;  4PKH A;  2QWN A;  3MN9 A;  2Q97 A;  3J8A A;  4B1V A;  1C0G A;  4CBU A;  4H0O A;  1BG3 A;  5BR9 A;  3VEV A;  2V52 B;  2A6A A;  3FLC O;  3MCP A;  3SLC A;  4JN4 A;  4IZ9 A;  5F2R A;  2QWM A;  4KBO A;  4BC4 A;  1NGA A;  1HPM A;  4CZK A;  3VF6 A;  4CZJ A;  2V7Y A;  1ZC6 A;  2ASM A;  3U9Z A;  3VEO A;  2GEL A;  5AQK A;  4CD3 A;  3GL1 A;  5BRH A;  2QW9 A;  3SMS A;  3RSE B;  4Z94 A;  2VWB A;  4JNE A;  4XH4 A;  3M3Z A;  2D4W A;  2PBD A;  3FZM A;  1NGI A;  3VGM A;  3H1V X;  4BGB A;  3GG4 A;  3HSC A;  2P9S A;  4BR4 A;  4BRE A;  3CJ7 A;  3BEX A;  4IJA A;  4FWR A;  3EZW A;  5E26 A;  3SMP A;  2QWL A;  4CBX A;  5BPN A;  1QHA A;  2FXU A;  3AY9 A;  4YDU C;  2CH5 A;  4C23 A;  3VET A;  3SK3 A;  3WEE A;  5AQF A;  4JD2 A;  4BRI A;  4CJ7 A;  3UKU A;  5AQH A;  3VEY A;  1GLD G;  4FWL A;  2E1Z A;  3VEX A;  1NMD A;  5JLH A;  3VER A;  2VYP A;  3B8A X;  2FSJ A;  3U9D A;  5ADX H;  2W41 A;  4WQ5 C;  2GEM A;  3VEN A;  3DXM B;  5ADX A;  4F9O A;  1Z6R A;  2QWR A;  1TUY A;  3QBW A;  2UYT A;  3A8Y A;  1HLU A;  1OKJ A;  1KXP A;  3IUC A;  3L6Q A;  3EKU A;  2AP1 A;  1GLB G;  3KHY A;  1NGE A;  1XC3 A;  3R6M A;  3I8B A;  5B8H A;  5ELZ A;  3DXK A;  3LDN A;  2Q1N A;  1BOT O;  5AFU H;  2Q0R A;  1DGK N;  2W40 A;  3RSE A;  1MDU B;  1ATR A;  3CET A;  5AFU A;  5F1X A;  3EO3 A;  1JCE A;  4ISG A;  4CZI A;  5EX5 A;  4XH5 A;  3AAQ A;  4AM6 A;  1NGH A;  4BR5 A;  4M7Y A;  1SAZ A;  3O5B A;  3L0Q A;  4BRO A;  3H6E A;  4FL9 A;  4JHD A;  5AQO A;  5FPN A;  1LOT B;  3F9M A;  3ZET A;  4FSV A;  1K8K B;  1QQO A;  3A5L C;  4BRC A;  3TPQ A;  5BPL A;  2YHY A;  4CZG A;  2A41 A;  2Q0U A;  1RDW X;  1TUU A;  4I6M B;  1NBW A;  3GE1 A;  1X3N A;  3VGL A;  4IWV A;  1SQK A;  3HTV A;  3VOV A;  3WXL A;  4CI6 A;  2E8A A;  3IDH A;  4K42 A;  5AQP A;  5EY4 A;  5KPR A;  1GLC G;  2P9K A;  2HOE A;  1E4G T;  1T44 A;  4H0T B;  2YHX A;  1MA9 B;  3D2F A;  4DCH A;  3DXM A;  3ZEU B;  1S3X A;  2E2Q A;  4FPA A;  1EQY A;  4ISF A;  1ATN A;  2FSN A;  3FGU A;  1LCU A;  4BG9 A;  3JS6 A;  3O1B A;  3ULE B;  2FF3 B;  1ZXO A;  1QQM A;  4QS8 A;  4BR0 A;  4CZF A;  1DKG D;  3CQX A;  4MO5 A;  1IJJ A;  2QM1 A;  4BRQ A;  3MN6 A;  3QFP A;  1GLA G;  1NGJ A;  1XQS C;  4FWP A;  3GOI A;  1IG8 A;  3GBT A;  3L4I A;  1BUP A;  2GUP A;  1ESV A;  3HI0 A;  1Y64 A;  1U2V A;  1WUA A;  2E88 A;  4RWT A;  1NGB A;  3JXU A;  3H46 O;  2QWP A;  4K41 A;  3CJC A;  2D0P A;  4B1W B;  4O5F A;  5LY3 A;  5LJW A;  3WUH A;  3CJ9 A;  3MK6 A;  3LDO A;  4WYB A;  1S22 A;  1BA1 A;  4BGA A;  5FPE A;  4BQL A;  3FZK A;  1BWF O;  3A5N C;  3QFU A;  3WXK A;  4B1Y B;  4BR9 A;  1BDG A;  4I6M A;  1HUX A;  5AQR A;  4O8K A;  2QWQ A;  2E1Y A;  3KZB A;  2CGJ A;  4B9Q A;  4PL8 A;  4JAX A;  1TYQ B;  5BPM A;  3ZEU A;  3VES A;  3FE1 A;  2Q31 A;  4BRA A;  4Y0W A; 
#chains in the Genus database with same CATH topology
 4RG8 A;  4ISE A;  2IIR A;  1CXQ A;  2O8C B;  3NBP A;  2VQE K;  4RW7 A;  3LM9 A;  2FBV A;  1WLJ A;  3T1A A;  3H3O B;  1RT1 A;  3O4W A;  2OA8 A;  2PZS A;  2GX9 A;  3C7N B;  1T7P A;  3VQ7 A;  3VF2 A;  1WAF A;  1D9F A;  3TSU A;  4FZZ A;  3RRG A;  1T6C A;  2DPN A;  3K5O A;  4CIE A;  3HZ6 A;  5CYM A;  2OCE A;  3CM6 A;  5AQI A;  4DR3 K;  3LP1 A;  4AHU A;  2XY7 A;  1JJ2 M;  4E1J A;  3NH1 A;  2ZJQ L;  1VSF A;  4EZ9 A;  1WSI A;  2OTJ N;  2P9I B;  1W9H A;  3ZT1 A;  4KV8 A;  4DTM A;  4RCH A;  3VQD A;  3K58 A;  4YFU A;  3SUN A;  2ZF5 O;  1WOQ A;  4J2D A;  2F9T A;  3KVG A;  3LDQ A;  3K0S A;  1S6P A;  4C8N A;  4MFB A;  3G0Z A;  2HHS A;  1QSL A;  4XH1 A;  4H5V A;  2HVH A;  4FOI A;  3S41 A;  3LAM A;  3R8E A;  3OS1 A;  2E4L A;  1P90 A;  3SQ4 A;  1T03 A;  2G8U A;  2EWS A;  3CME N;  1Q8I A;  2UU9 K;  4YOV A;  3EN9 A;  3QEV A;  5BN9 A;  1VQK N;  3UKR B;  4F3T A;  2CGL A;  2Z1I A;  3LDP A;  1JKH A;  4CJK A;  5AQW A;  4XJX A;  3CQY A;  4DQ8 A;  1A5W A;  1NJZ A;  4C8K A;  1RTH A;  1VSL A;  3B6P A;  2RN2 A;  3CPE A;  3BDP A;  3O4N A;  1ILY A;  1QS4 A;  3AVJ A;  4BRL A;  4KH6 A;  3AO2 A;  1HJO A;  3LAL A;  4CGI A;  3QER A;  4GVE A;  3R9P A;  4XIU A;  1RDC A;  3OW2 M;  3DOL A;  3R1X A;  4H5W A;  4BRG A;  3CC4 N;  1U47 A;  3KTQ A;  2D0B A;  4IJN A;  1CZ9 A;  4DQP A;  4B8A B;  5KTQ A;  4DTP A;  2YJE A;  3TAB A;  1VQN N;  4HWI A;  3CFP A;  4CHY A;  4CJ3 A;  2E6L A;  3AO4 A;  2CGK A;  2YHB A;  3BP8 A;  3DAW A;  4JV5 K;  1K8K A;  1IKW A;  1NOY A;  3VQE A;  3PY8 A;  3HOT A;  1SL0 A;  4BRD A;  4CJE A;  3O9T A;  4CF9 A;  2QI2 A;  2H3G X;  4CGG A;  1BIZ A;  4FWQ A;  1OVY A;  3KK7 A;  3WQU A;  2D1K A;  4HCC A;  1S1W A;  4OX9 K;  1K6Y A;  3NF7 A;  2WUS A;  1RTJ A;  2HNZ A;  4WFA L;  2HBL A;  3H08 A;  4B3T K;  1OH5 A;  4LF8 K;  4JKB A;  4FWO A;  5KQD A;  4FJN A;  3TTC A;  4FJ7 A;  1JL2 A;  1WN7 A;  4NO7 A;  3OYB A;  3ULE A;  3CQ8 A;  4DR2 K;  3AAP A;  3CM5 A;  3QES A;  2IDO A;  5FPM A;  3P1G A;  4FVM A;  4KTQ A;  2NLX A;  3UE5 A;  3WQT A;  4B3S K;  2KLA A;  3CD6 N;  4CZE A;  3SBT A;  4K0K K;  3CJB A;  3NHG A;  4KH4 A;  3QEI A;  2GV9 A;  3CCQ N;  1IBL K;  3D2E A;  4WQ4 C;  4AM7 A;  5AQX A;  2R7Y A;  3CC7 N;  1CZA N;  3D2F B;  2QKB A;  2UXC K;  5AQG A;  3MX2 A;  2YHA A;  4I9Q A;  3V9W A;  2IGI A;  4YNQ A;  4G1Q A;  4BY9 C;  1JXB A;  5AQZ A;  5TKY A;  4DFJ A;  3RMC A;  4FWS A;  1NGG A;  5AZJ A;  3NMU A;  5KGW A;  4CEZ A;  3G6E N;  4DQI A;  1BU6 O;  2JWL A;  4AH9 A;  2HHT A;  1K9M O;  4CJW A;  1ZBL A;  4B9U A;  1UWB A;  3HBT A;  4M3T A;  4AHR A;  1KSP A;  4FM0 A;  2QTD A;  1IKY A;  5AZI A;  2XRI A;  1SKS A;  4IOX A;  3HPG A;  4E7K A;  4BRH A;  4OJR A;  4G9Z A;  4IXC A;  1GOA A;  3PX4 A;  3QNO A;  3QLH A;  1V4T A;  4C8M A;  3IAY A;  4CHP A;  1QSS A;  1LV5 A;  4B3R K;  4BR7 A;  2OPR A;  5SZT A;  4CF1 A;  4BVO A;  1NKB A;  4HTL A;  5HRP A;  3MMV A;  4DV7 K;  2ITG A;  3H45 C;  3L2R A;  4R79 A;  3WEE B;  2J4R A;  4LF7 K;  4B1U B;  4CHO A;  4CFD A;  3HST B;  1KC8 O;  3OY9 A;  3PIO L;  3BF1 A;  1LWC A;  4DUZ K;  1FK9 A;  5AQL A;  4KB0 A;  4OGE A;  4C1N I;  4EP5 A;  2BUP A;  3SAH A;  4DSF A;  1JXE A;  4V19 S;  1C0G A;  3LWM A;  3CCV N;  1T05 A;  1VSK A;  1TGO A;  1XHZ A;  3VEV A;  1SKW A;  1I94 K;  1WSF A;  2HBK A;  3PUF A;  3ZT2 A;  3KLI A;  4DV4 K;  3V4I A;  1NGA A;  1S5J A;  2ASM A;  3DI6 A;  3U9Z A;  2GEL A;  1D5A A;  3SMS A;  5SWM A;  1YIT N;  3RSE B;  4DSK A;  4JNE A;  4FJ9 A;  3H1V X;  4QOZ B;  4IEI A;  1S1V A;  2NUB A;  4FWR A;  5J1E A;  5E26 A;  3PX0 A;  4F8R A;  2QWL A;  5DM6 L;  1SV5 A;  5BPN A;  3K2P A;  3EY1 A;  3JAM O;  1WAJ A;  3VET A;  3OJS A;  3CCL N;  5M1F A;  1SL2 A;  4DV6 K;  1U48 A;  4JI5 K;  4O55 A;  1J5E K;  3V1R A;  4CJ7 A;  3UKU A;  3VEY A;  4FWL A;  2E1Z A;  3VEX A;  2KQ2 A;  5JEN A;  2FC0 A;  2VYP A;  3CFO A;  2UXD K;  5HBM A;  3AGK A;  3NH2 A;  3VEN A;  3DXM B;  4DQS A;  3NVM A;  1Z6R A;  4F9O A;  2QWR A;  1N32 K;  2HB5 A;  4O0J A;  3J7A P;  4M42 A;  1QQC A;  3AVG A;  4CJS A;  3JSM A;  1VSJ A;  3L6Q A;  4I9L A;  4E7L A;  3SJJ A;  2G8V A;  3EKU A;  3THX B;  2AP1 A;  4ELU A;  1XC3 A;  1HYZ A;  3V6D A;  2NRZ A;  1S9E A;  3I8B A;  3DXK A;  3LDN A;  5D3G A;  5AFU H;  4CER A;  4LFA K;  1DGK N;  1WSJ A;  1ATR A;  2A1S A;  1JCE A;  4EP4 A;  2Z1J A;  5EX5 A;  3OYJ A;  2O4I A;  1HQE A;  1O1W A;  3O3H A;  4BDP A;  4RW4 A;  3HK2 A;  1KVA A;  1SAZ A;  3O5B A;  1HNV A;  2HMI A;  5JS1 A;  3H6E A;  1QVF M;  3L2W A;  1LOT B;  3IKM A;  3B6O A;  2ZD1 A;  1K8K B;  4CZG A;  3CG7 A;  1C1B A;  3O9U A;  2A41 A;  1BQM A;  4I6M B;  4CHN A;  4W5T A;  1RT6 A;  3GE1 A;  1X3N A;  4B08 A;  3AA4 A;  5BR8 K;  4F3O A;  1RBS A;  4ELV A;  5AQP A;  4NXM K;  2HOE A;  1E4G T;  2YHX A;  3S3M A;  3NGI A;  1TVR A;  3G71 N;  2F7T A;  4CEO A;  3CC2 N;  1ATN A;  2FSN A;  3BZC A;  1RT2 A;  3ULE B;  4KHN A;  4AHS A;  1ZXO A;  3MWP A;  1LW0 A;  4BRQ A;  4A57 A;  2O8B A;  3RR8 A;  1NGJ A;  4ID1 A;  4FLZ A;  1Y64 A;  1NJY A;  1VQ4 N;  1NK0 A;  3H46 O;  1BGX T;  3O3F A;  4TSX A;  4UY8 O;  1J5O A;  1NJX A;  2GBZ A;  3KWI A;  4M3R A;  5DMR A;  3O9R A;  3PSI A;  4JI1 K;  1IBK K;  1KVC A;  4WYB A;  2VG6 A;  1BA1 A;  5FPE A;  4BQL A;  4BEC A;  4OGC A;  4CJ4 A;  4BR9 A;  1RIL A;  3ZSY A;  4FYD A;  1EWQ A;  5C25 A;  3AVF A;  2QWQ A;  2D0A A;  2CGJ A;  3C94 A;  5C0Y A;  3VQ6 A;  1TYQ B;  5GAG P;  1VSD A;  2HST A;  4X66 K;  3G4S N;  3ZEU A;  2Q31 A;  4BRA A;  3CYM A;  3KKS A;  4OKJ A;  3TAQ A;  2FBT A;  3MEC A;  3V9S A;  4ILH A;  3VA3 A;  1YJW N;  3N4Q A;  4DS5 A;  1XI1 A;  2NRX A;  3M8R A;  4DQQ A;  3ZSR A;  3TWH A;  1WB9 A;  1K73 O;  3LAN A;  3OA9 A;  1YJN N;  4KHP K;  1LW2 A;  3ENH A;  4KKO A;  2BAN A;  4H5R A;  3SNN A;  1XNR K;  4BE1 A;  2NNW A;  4GV3 A;  4WFB L;  4W5N A;  1R59 O;  2VWJ A;  4WFN L;  2ETJ A;  4KI6 A;  4BC3 A;  4BRM A;  1KRP A;  3FR0 A;  4U67 L;  3H3N O;  4JKF A;  3VA0 A;  1Q9Y A;  5C42 A;  1XMO K;  1L3U A;  4FJG A;  3NH0 A;  3VEW A;  4BAC A;  4CFB A;  1IO2 A;  3KK2 A;  3IRX A;  3J7Z O;  1QSY A;  3RMB A;  3OVN A;  4JKC A;  5C10 A;  3KJV A;  4CJT A;  2AJQ A;  4H5N A;  2E2P A;  2DY4 A;  4OVL A;  2UXB K;  5LJV A;  4Z4G A;  3TAP A;  1NM1 A;  4FM1 A;  4A61 A;  4KI4 A;  4OPJ A;  2XY5 A;  4K25 A;  3OYF A;  3NAE A;  2P9L B;  5JVH L;  3QIO A;  3WXI A;  1ASU A;  1HNZ K;  2UUA K;  1E4F T;  2GWJ A;  2VG7 A;  1HQU A;  2GTD A;  1YAG A;  3L8B A;  4BVP A;  4JKA A;  1TKX A;  3JYT A;  4H5T A;  4JKE A;  3AVH A;  4CF0 A;  1VSH A;  4KAZ A;  5EOY A;  1ASV A;  1VQO N;  4CZM A;  1GLJ O;  4E19 A;  3FZF A;  2ATQ A;  2F96 A;  3CIP A;  2F9W A;  1XHX A;  2V7Z A;  4CJL A;  4JKH A;  4YOT A;  3HYF A;  1DT9 A;  3KLE A;  1G99 A;  5GAE P;  2P9P A;  1TK5 A;  4NYF A;  2RE2 A;  5LMU K;  1S9G A;  1ITG A;  4A5A A;  4DTJ A;  1VRU A;  1C1C A;  3QIP A;  1OH6 A;  4NCA A;  3KLF A;  4DTR A;  1HNX K;  1NU0 A;  4CFC A;  2YCH A;  3MDQ A;  1CLQ A;  1U6Z A;  4GY2 B;  4GVM A;  4X64 K;  3U8X A;  1C0T A;  4BRN A;  5I9E B;  4DHY A;  3AVL A;  3AO3 A;  4RW9 A;  4H0X B;  3DXK B;  4FK0 A;  3AA2 A;  5E84 A;  3Q7C A;  4BDY A;  3RTV A;  2F8T A;  2OAN A;  2OZS A;  3NF6 A;  3AV9 A;  4N41 A;  3DRS A;  1Q18 A;  1VQL N;  4L8R B;  1KAX A;  3QDK A;  1HPZ A;  1BIU A;  1SL1 A;  1WSH A;  4O8U A;  2V51 B;  4FPB A;  4IFE A;  4FOE A;  4A2A A;  3LDL A;  2VGM A;  4YHH K;  1GLF O;  4B1X B;  2P9U B;  4JLH A;  4KB1 A;  1W0H A;  3AAR A;  1YTA A;  3SUO A;  3ENB A;  4MDB A;  2AA4 A;  1X3M A;  2WFB A;  3OHR A;  2FLO A;  3VQB A;  5FRM A;  1EWR A;  3MN5 A;  2OPS A;  3PV8 A;  1VQ7 N;  3J7Y P;  4BQZ A;  2PAV A;  3NFA A;  1H1V A;  1TKT A;  3RMD A;  1X9M A;  5DM7 L;  2E20 A;  4B9N A;  4KHY A;  4CCH A;  4J2B A;  2WTU A;  1Z25 A;  3CYG A;  2YJF A;  2GWK A;  3TAM A;  3MED A;  3H1Q A;  2B6A A;  4JKG A;  2VG5 A;  2XHB A;  5CE3 A;  4OLA A;  5EVZ A;  1ATS A;  2A40 A;  4UQG A;  2P9N A;  3SJH A;  3TSQ A;  3SQ1 A;  1HNW K;  3QEX A;  4HTU A;  2P9S B;  4BRP A;  1V4S A;  1NKE A;  4H0P A;  3VQQ A;  3HP6 A;  1X9J A;  2HMP A;  3ID8 A;  3MX5 A;  2ZWH A;  4NLB A;  3SZ2 A;  4HCB A;  3K5M A;  1K8A O;  4N76 A;  2OPP A;  4JYA K;  1T3V A;  2QK9 A;  3OJU A;  1HR0 K;  1VSI A;  2JWK A;  3I33 A;  1Q82 O;  3C0B A;  3E9P A;  3OBW A;  3IFR A;  4E7J A;  3M6G A;  3J80 O;  1ZBU A;  5AQU A;  1DTQ A;  2NRH A;  5LMN K;  1NGD A;  5HRO A;  4BDZ A;  2YX6 A;  4CJV A;  4PKH A;  2O8D A;  2QWN A;  3CCS N;  3MN9 A;  4CF2 A;  1IKX A;  1RBT A;  4DU3 A;  2Z1G A;  1L3V A;  3DRR A;  3KD5 E;  4H0O A;  2V52 B;  3FLC O;  2PY5 A;  1UAX A;  4HHT A;  3SYZ A;  4FJX A;  4KBO A;  4I7F A;  4DV2 K;  5EU7 A;  2KTQ A;  5C24 A;  4Z4H A;  4CIG A;  4FLW A;  1ZC6 A;  3ASM A;  3VEO A;  5AQK A;  2WON A;  3GL1 A;  5M1K A;  1NK8 A;  4Z94 A;  2VWB A;  2PBD A;  4CE9 A;  3VGM A;  5HLF A;  4BGB A;  1KLM A;  3ID6 A;  1VRT A;  4BR4 A;  2VGN A;  4Z4E A;  2NRW A;  4BRE A;  2ZJP L;  1YI2 N;  2DFH A;  5M1N A;  1OH8 A;  3SMP A;  4J2A A;  3VQ5 A;  3SUP A;  4YDU C;  2CH5 A;  4C23 A;  2O8F B;  3DLG A;  5CZ1 A;  3S3O A;  2RKI A;  3LPU A;  1OH7 A;  4JD2 A;  4BRI A;  3ZT0 A;  5AQH A;  3TR8 A;  4O4G A;  4JI4 K;  3T7Z A;  1JLG A;  1NMD A;  3R3L A;  5ADX H;  2DTU A;  3EEQ A;  4CK2 A;  1TUY A;  4JI6 K;  2KFN A;  2UYT A;  2HHV A;  5K14 A;  1ZBF A;  1KXP A;  3V9Z A;  1VSE A;  3CCJ N;  3L2Q A;  3KHY A;  1NGE A;  1RBV A;  3R6M A;  5HOO A;  2X78 A;  4LD0 A;  1TK8 A;  4I2P A;  1NK7 A;  2KZM A;  1LWF A;  2Q0R A;  3QEW A;  1XWL A;  3CET A;  3NF9 A;  5AFU A;  1S1U A;  5CZ2 A;  1NK5 A;  4Z4I A;  3SV3 A;  1Y97 A;  4XH5 A;  3THV A;  4JI0 K;  3KD1 E;  3AAQ A;  4AM6 A;  1TAU A;  4FJ5 A;  3L0Q A;  1VQ9 N;  4FL9 A;  5FPN A;  4CFA A;  4E7I A;  2P5G A;  5KRS A;  3AVM A;  3ZET A;  1HNI A;  1EKE A;  1QQO A;  1RT7 A;  4BRC A;  5BPL A;  3THY B;  4DFP A;  2Q0U A;  1TUU A;  4GKK K;  2XY8 A;  3C6T A;  2F4V K;  4KPY A;  1SQK A;  3HTV A;  4CI6 A;  2E8A A;  4K42 A;  3HPH A;  5KPR A;  2UUC K;  3SAG A;  2RPI A;  1T44 A;  3VQC A;  5IT9 O;  1MA9 B;  1VQM N;  2C1G A;  3E9O A;  1J53 A;  4Z4F A;  1JLE A;  3IS9 A;  2E2Q A;  3V9X A;  4GMJ B;  5J2P A;  1N5Y A;  3FGU A;  1RDD A;  3K57 A;  2FF3 B;  4JEP A;  3QNN A;  4JI3 K;  4DSJ A;  4OPA A;  3RMA A;  1GLA G;  1D8Y A;  2YKN A;  4FWP A;  3T3F A;  3GOI A;  3GBT A;  3L4I A;  1BUP A;  5T7B A;  4W5O A;  3HI0 A;  2HHW A;  4JS4 A;  1WUA A;  2E88 A;  4JK8 A;  5C2D A;  3CJC A;  1FKP A;  3LP0 A;  2D0P A;  3VTI A;  2KFZ A;  5C2F A;  4M45 A;  2IS3 A;  3MK6 A;  3LDO A;  1BQN A;  1WBD A;  3A5N C;  3NE6 A;  3D0P A;  4B9S A;  1HUX A;  3HPO A;  1IG9 A;  1BHL A;  2X6S A;  3CCE N;  3KZB A;  4B9Q A;  3SI6 A;  3MEG A;  2HHU A;  3WNE A;  4FJJ A;  5JS2 A;  5BPM A;  5FRN A;  4N47 A;  3EE8 A;  2WC9 A;  4CJP A;  4BE2 A;  4Y0W A;  1UA1 A;  4JK9 A;  4JKG B;  1BCO A;  4EFH A;  2ITM A;  1U45 A;  3QB0 A;  3TU5 A;  5AR0 A;  3DLE A;  4YOW A;  5TKW A;  4PWD A;  1R0A A;  1BA0 A;  4FW2 A;  4CGJ A;  2XY6 A;  4CJ5 A;  3HO1 A;  4DR4 K;  4DSI A;  3MN7 A;  3OS2 A;  4LH5 A;  4DS4 A;  4GW6 A;  3VGK A;  4IG0 A;  5GAH P;  3MXI A;  3LP2 A;  4EAH D;  4CGH A;  3M8S A;  3K5L A;  3NGY A;  5BN8 A;  1GOC A;  4AHC A;  1E3M A;  4FJK A;  4CBW A;  1CZB A;  5CR4 A;  4YOR A;  4MLE A;  4DSL A;  4N5S A;  1IKV A;  3VQP A;  2IOC A;  2O8D B;  1VQ5 N;  4FWM A;  1YVU A;  3LZI A;  4NYN A;  4MLH A;  3QML A;  1SZ2 A;  3LWL A;  2IVO A;  4CEF A;  3E66 A;  1HYV A;  4MO4 A;  4C1N K;  1YXQ A;  3L4Q A;  4WQ4 A;  1YVN A;  4MDA A;  4DFK A;  4DF4 A;  2I7N A;  4PA1 A;  3AVK A;  4EHU A;  4IFY A;  4CGF A;  4HVJ A;  1HX1 A;  2FSK A;  3ZCM A;  4B9V A;  1JCG A;  4EIA A;  1YJ9 N;  4E72 A;  3QET A;  4K43 A;  4FJM A;  4DKW A;  1KD1 O;  3CJ1 A;  3CMA N;  3EE9 A;  1TAQ A;  3LZJ A;  3VQ9 A;  5FPD A;  3O80 A;  2HHH K;  1JCF A;  3SPZ A;  4DB3 A;  3RRH A;  4IEE A;  2ASP A;  3IG1 A;  1JLC A;  3EKS A;  3KLH A;  4F2R A;  4Y1D A;  3L2V A;  5IWA K;  5HRS A;  4L3Q A;  3T1Y K;  3ENO A;  3SPY A;  3UB5 A;  5AQV A;  4FLX A;  1VK0 A;  3CI5 A;  4BC5 A;  2G8F A;  1VHX A;  3WNF A;  3Q7B A;  4FLY A;  3K9J A;  1OVQ A;  3IMX A;  2Q36 A;  3D2E B;  1MU2 A;  4DU4 A;  2YV0 X;  3OYA A;  4AF1 A;  4CEQ A;  1QE1 A;  4GNI A;  4DR7 K;  4X65 K;  3TAE A;  1VSM A;  4AQY K;  2NRR A;  4O0I A;  1D9D A;  3P38 A;  2G8K A;  2IAJ A;  3ZSV A;  4H03 B;  1EXQ A;  4FCY A;  5AZJ B;  1RT4 A;  4KHQ A;  4B3O A;  3ZX3 A;  3KWG A;  4OPH A;  5FRO A;  3DMJ A;  1REV A;  3NVK A;  2I7P A;  2BTF A;  4O5B A;  1RNH A;  1NGF A;  4DLG A;  2A1R A;  4CEA A;  4J8F A;  1B92 A;  4A2B A;  4EHT A;  4JRQ A;  4DF8 A;  1NK9 A;  4FJI A;  1KTQ A;  3A5O C;  5JLF A;  1C0F A;  3UKR A;  2OZM A;  1NK4 A;  2W6L A;  5AZI B;  4YOU A;  4OKK A;  1Q7Y O;  3CCM N;  2X6N A;  1HJR A;  3V9U A;  2BDP A;  4QS9 A;  1DEJ A;  4CZL A;  3ZET B;  1RDB A;  4LFC K;  2DFF A;  1BCM A;  4FW1 A;  2YNH A;  4IO8 A;  1HRH A;  4M63 C;  3DWL A;  4BRK A;  4W5Q A;  4M7X A;  1YUW A;  3ATU A;  5BRE A;  2XO7 A;  3OYM A;  1XUP O;  4FLV A;  3ZT3 A;  5AQS A;  3O3G A;  3O9Q A;  1QZ5 A;  2D0O A;  4HUE A;  5C12 A;  1WBB A;  4CGD A;  4LSN A;  5AQT A;  3M1F A;  4Q5V A;  4QS7 A;  3AVN A;  4B9T A;  3I56 N;  4FLU A;  1RCH A;  1JLB A;  3I0S A;  1BO5 O;  4JI2 K;  1W2B M;  1N6Q A;  5J2N A;  1Q9X A;  2HBJ A;  3MWT A;  1MWK A;  4CEC A;  1CXU A;  5JMV A;  3F73 A;  4DSE A;  3ZYY X;  1HKG A;  1HKC A;  1RDA A;  3A2F A;  1T8E A;  1JLA A;  1NWK A;  1QZ6 A;  1EO1 A;  2YHW A;  4DUY K;  4JK7 A;  3HOS A;  3P4I A;  1C0M A;  3VEZ A;  1A5X A;  1GLE G;  1QQN A;  1TL3 A;  4LY7 A;  4KHU A;  2KHO A;  5M1P A;  3W3D A;  5JIC A;  1L5U A;  3KK3 A;  4DU1 A;  4IG3 A;  1QVG M;  1HKB A;  4A59 A;  3CCR N;  4AHT A;  2E2O A;  2RF2 A;  5FDL A;  4M3Y A;  2OTL N;  1JL1 A;  3DM2 A;  3OYG A;  4LF5 K;  1UA0 A;  3HM8 A;  3UKU B;  4W5R A;  1N33 K;  1C6V A;  4IOA L;  5AQJ A;  4U7B A;  3FFK B;  3LP3 A;  3SQ0 A;  4KHW A;  5I42 A;  1FW6 A;  4IOC L;  2Q97 A;  1NK6 A;  1YT3 A;  4DV0 K;  4IBN A;  4B1V A;  4CBU A;  4M3W A;  1BG3 A;  3ZSW A;  4NXN K;  2C1I A;  1WNS A;  1YHQ N;  1W7A A;  2W42 A;  3MCP A;  3SLC A;  3T19 A;  4JN4 A;  4DFM A;  4IZ9 A;  5F2R A;  3SUQ A;  3C6A A;  3HVT A;  4BC4 A;  1HPM A;  4CZK A;  3VF6 A;  4CZJ A;  2V7Y A;  1X1P A;  1RTI A;  3SCX A;  3FZM A;  4DTS A;  4KRE A;  2QXF A;  4FM2 A;  3P5J A;  4IJA A;  3MXM A;  1RBR A;  3T69 A;  3EZW A;  3CPW M;  3C6H A;  4CBX A;  4X62 K;  3DRP A;  2ZM6 K;  2FXU A;  3AY9 A;  3SK3 A;  5JVG L;  3WEE A;  1GOB A;  2ZE2 A;  1RBU A;  3F9K A;  1KQS M;  5JLH A;  3I8D A;  4ZTJ A;  1J9A A;  3C95 A;  3O9S A;  4B3M K;  5GIO A;  3B8A X;  4WQ5 C;  3VMF B;  3K59 A;  4KTZ A;  3ULD A;  4NLC A;  5ADX A;  3PO5 A;  1O13 A;  3P39 A;  2WOM A;  4FK4 A;  2HND A;  1EET A;  3HM9 A;  4AIL C;  2O8E A;  5I3U A;  1GLB G;  1IH7 A;  4KTW A;  2KZZ A;  2O8B B;  5B8H A;  2Q1N A;  5CYQ A;  3HRG A;  3OS0 A;  2EHG A;  5HRN A;  3KLG A;  3RSE A;  5H1S Q;  1MDU B;  5F1X A;  3EO3 A;  3KIO A;  1Q86 O;  1JLF A;  3AA5 X;  4DTX A;  2E5L K;  4M7Y A;  3ZSO A;  4BRO A;  2HNY A;  5AQO A;  4JHD A;  1A5V A;  4CF8 A;  3M8Q A;  4FSV A;  2YHY A;  3KK1 A;  5A2Q O;  1RDW X;  4PUO A;  3PIP L;  1NJW A;  1NBW A;  1XC9 A;  4IWV A;  4FXD A;  4WCE L;  5KI6 A;  3WXL A;  3T1H K;  2PYL A;  4DTO A;  2P9K A;  1RDU A;  2B5J A;  4H0T B;  4DQR A;  3DXM A;  3ZEU B;  3PX6 A;  1S3X A;  4PQU A;  1FKO A;  3DYA A;  4FPA A;  1EQY A;  3QIN A;  1WSG A;  3JS6 A;  1VQ6 N;  3CXC M;  1QQM A;  4QS8 A;  4BR0 A;  3NGZ A;  4DV3 K;  1DKG D;  3CQX A;  4MO5 A;  2P5O A;  1IJJ A;  3HXM A;  3THX A;  4Q0B A;  3MN6 A;  3VQ4 A;  2BH1 A;  1M1K O;  1BL3 A;  3C6U A;  3QFP A;  4A5B A;  4J2E A;  1XQS C;  3I55 N;  1IG8 A;  4CHQ A;  4ILG B;  4LF9 K;  4BE0 A;  2QKK A;  1U2V A;  3BGR A;  4DR6 K;  4CK1 A;  3JXU A;  1HMV A;  1X9S A;  4K41 A;  2E6M A;  5DK5 A;  1ZBI A;  4O5F A;  1F21 A;  5LJW A;  3ISN C;  4IO9 L;  2Y1J A;  5HP1 A;  3ALY A;  1S22 A;  4BGA A;  1L3T A;  3WXK A;  1BWF O;  4B1Y B;  1BDG A;  4I6M A;  3HJF A;  5AQR A;  1B9F A;  4FK2 A;  3TAN A;  2BGG A;  1TL1 A;  3PO4 A;  1KFD A;  4PL8 A;  3D45 A;  4JAX A;  3DLH A;  4EZ6 A;  4ILJ A;  3ZLJ A;  3E1Y A;  1L3S A;  1U04 A;  1YF5 L;  2NRT A;  5FLX O;  4DR5 K;  1YIJ N;  2D0C A;  2B4J A;  2JGU A;  4XEI A;  3FZL A;  5M1Q A;  5MLC Q;  3CJA A;  3ATV A;  2G8I A;  4CD1 A;  1N8R O;  4BWJ A;  3A5M C;  3SBG A;  2KW4 A;  3FZH A;  4BE7 B;  1U4B A;  5CHI A;  2NRV A;  4R5P A;  1VQP N;  5GIN A;  3EZ5 A;  3CFR A;  4C8O A;  1KAZ A;  2ZGY A;  2FBY A;  1RGI A;  3KKR A;  3BUZ B;  4C8L A;  2P9P B;  2YNI A;  3AO5 A;  3EYZ A;  4LF6 K;  2BE2 A;  1B9D A;  1GLL O;  2D5R A;  2ZJR L;  4ZTF A;  1P8Z A;  2Q2R A;  3GDQ A;  1SKR A;  3TTF A;  3SV4 A;  1LWE A;  4H0Y B;  1SS6 A;  1YTU A;  3NF8 A;  1TYQ A;  3WXJ A;  1Q81 O;  3ZT4 A;  4M3X A;  4WQ5 A;  2Z1H A;  2HF3 A;  4CK3 A;  3HP9 A;  3TSP A;  2X74 A;  3DJC A;  3THW A;  1TK0 A;  4LF4 K;  2KKZ A;  4B1Z A;  1BIS A;  4PL7 A;  4FJH A;  4HUF A;  3LM2 A;  3VTH A;  2E2N A;  4WE1 A;  1I39 A;  3TAF A;  2ZQB A;  1N34 K;  2IVP A;  3BF3 A;  3PSF A;  1NGC A;  4H0V B;  1J54 A;  4RW6 A;  2O4G A;  3ZSX A;  3MAQ A;  4CHZ A;  3G25 A;  4CJQ A;  2QA4 N;  2F8S A;  2FBX A;  3S3N A;  3EL2 A;  3RR7 A;  3HVR A;  4ELT A;  2QWO A;  1RTD A;  4O44 A;  4E1M A;  1S6Q A;  3W0L A;  4YY3 K;  3V81 A;  3ZX2 A;  2HBM A;  4NB4 A;  1LAV A;  4DWI A;  4ZHR A;  1BI4 A;  2QEX N;  4ID5 A;  1NJI O;  2CH6 A;  3U4L A;  1ZBS A;  4CJF A;  5HL7 L;  1NKC A;  2A42 A;  5BRF A;  2NZT A;  5LL6 Z;  4BR2 A;  1UOC A;  4LC9 B;  2O8E B;  3OYN A;  4M41 A;  4GV9 A;  3AGR A;  1IBM K;  3O08 A;  3AO1 A;  4JI8 K;  3SAF A;  4IDH A;  4FWN A;  2JLE A;  4FJ8 A;  4Z0U A;  3S9H A;  2I5J A;  3J81 O;  3V1Q A;  3MXJ A;  2P9L A;  1KAY A;  5AQQ A;  2A5X A;  2PYJ A;  4Z4C A;  4CZH A;  5AQY A;  4JHD B;  3SQ2 A;  2YNG A;  1T6D A;  2P9N B;  4WF9 L;  3QIC A;  3D7E O;  1NLV A;  3DLB A;  4DV1 K;  1Z05 A;  4RTF D;  3A0I X;  1RFQ A;  2HHI A;  1I3A A;  1KLN A;  4LFB K;  4FO0 A;  5KQ8 A;  4E0D A;  2P9K B;  3ZSQ A;  4M3U A;  2HW3 A;  1C0U A;  2IVN A;  2PFU A;  3HT3 A;  3BY5 A;  1MWM A;  1EX4 A;  1QHT A;  3ZSZ A;  4E89 A;  1W97 L;  4OKE A;  1IV0 A;  4GV6 A;  3O8M A;  3O6W A;  4YDU A;  5AQM A;  5GAD P;  4CES A;  4KH5 A;  1ZBH A;  1J6Z A;  4BRF A;  2W6K A;  3LL3 A;  1XMQ K;  2VCP A;  3C65 A;  1TV6 A;  2FF6 A;  4CJR A;  1U2V B;  3VPZ A;  4YOX A;  4PKI A;  4K8Z A;  3MEE A;  3CER A;  2QXL A;  4CW7 B;  3VF4 A;  3OTO K;  1NOZ A;  5KPT A;  3WNG A;  4H4M A;  3LAK A;  4IFV A;  5EXW A;  4A62 A;  3HL8 A;  3G10 A;  1M90 O;  3WXM B;  1TKZ A;  4IDK A;  2O8C A;  3LDS A;  3DLL L;  2HHX A;  1D4X A;  4BC2 A;  1S1T A;  4KHS A;  2RHK A;  1ASW A;  2WBN A;  3AA3 A;  5AQN A;  5KPZ A;  1N36 K;  3QBX A;  4DG1 A;  1TKD A;  2P9U A;  3F5T A;  4YOY A;  3C7N A;  3LPT A;  3ZX0 A;  1FJG K;  2VWK A;  4CIF A;  4BG8 A;  3L3U A;  3WT0 A;  4FWK A;  1S1X A;  4HUG A;  4E7H A;  4LH4 A;  3UIQ A;  4DLE A;  4FJL A;  4JD2 B;  2ZGZ A;  5BRD A;  4PKG A;  5F0X A;  3L2U A;  1G15 A;  4CJU A;  2HF4 A;  2YKM A;  2ASO A;  1C1A A;  2A3Z A;  3CHW A;  2P51 A;  2YI1 A;  4FZY A;  3O1W A;  2P9I A;  1KVB A;  3VN5 A;  1HYS A;  3TI0 A;  3BZK A;  3J8A A;  4KFB A;  1NNE A;  2W00 A;  4OPK A;  1FXX A;  5BR9 A;  4NCB A;  2A6A A;  4B8C A;  4E1N A;  2OYQ A;  3RWU A;  2QWM A;  5CY4 A;  1KFS A;  3AVA A;  1VQ8 N;  1S72 N;  5BRH A;  4CD3 A;  2QW9 A;  2EX3 A;  4DR1 K;  4XH4 A;  3M3Z A;  2D4W A;  4OO1 J;  4KO0 A;  1NGI A;  3K9K A;  2HHQ A;  3E9L A;  3GG4 A;  3HSC A;  2P9S A;  3L3V A;  3PLA A;  2UUB K;  3NDK A;  3CJ7 A;  3BEX A;  3VQ8 A;  4F4K A;  2Y1I A;  1QHA A;  3M8P A;  3OYC A;  4DTU A;  2G8W A;  3P83 D;  4B9L A;  5GIP A;  5AQF A;  3DOK A;  1GLD G;  3THW B;  5C15 A;  5J2Q A;  4JI7 K;  3VER A;  3U9D A;  3CF5 L;  2FSJ A;  4IKF A;  4M3Z A;  2W41 A;  2GEM A;  4DTN A;  3MCA B;  3DLK A;  3N4P A;  3QBW A;  4B9M A;  1Z26 A;  3A8Y A;  4OLB A;  1HLU A;  3TTD A;  1OKJ A;  3IUC A;  1DTT A;  2VQF K;  1EP4 A;  3CCU N;  2P1J A;  4CVN E;  3RVC A;  4DV5 K;  2DFE A;  5ELZ A;  1BOT O;  1RT3 A;  1XNQ K;  3U3Y A;  2W40 A;  3OYE A;  3OYH A;  4JS5 A;  3AVI A;  4ISG A;  4CZI A;  5M1O A;  4CED A;  2Q3S A;  1BI4 B;  3D6R A;  3P31 A;  1NGH A;  4BR5 A;  3M5R A;  1X9W A;  2LSN A;  5AJ3 K;  4KRF A;  3F9M A;  1RT5 A;  3S5T A;  2O8F A;  3A5L C;  3TPQ A;  2HVI A;  2IC3 A;  4H4O A;  3NCI A;  3OYK A;  3DLR A;  3VGL A;  1KCF A;  3VOV A;  3OYL A;  3IDH A;  3F2K A;  3ITH A;  5EY4 A;  3TAG A;  4BEB A;  1GLC G;  4FLT A;  5KGX A;  4JKD A;  4FZX C;  3OYD A;  3D2F A;  3VQA A;  4DCH A;  4PY5 A;  1JLQ A;  3AVC A;  4ISF A;  4NCG A;  1LCU A;  4BG9 A;  3O1B A;  4I2Q A;  4CEE A;  4CZF A;  1U49 A;  1SUQ A;  4LSL A;  4MQ3 A;  2QM1 A;  4DMN A;  3FFI A;  4FVU A;  3OBY A;  2OPQ A;  4H8K A;  4PHT X;  3V1O A;  3I0R A;  1NMN A;  5J2M A;  5KRT A;  2GUP A;  1WSE A;  1ESV A;  1LAW A;  2YNF A;  4RWT A;  4CEB A;  1NGB A;  3QO9 A;  2QWP A;  3WNH A;  3OYI A;  3TAR A;  3K5N A;  5HRR A;  1ZYQ A;  4B1W B;  4K8X A;  4F2S A;  4Y1C A;  5LY3 A;  4E3S A;  3E01 A;  1VAZ A;  3AVB A;  5E41 A;  4JRP A;  4ICL A;  1DLO A;  3WUH A;  3CJ9 A;  4RW8 A;  3FZK A;  3QFU A;  1NG9 A;  2G8H A;  4BWM A;  3THY A;  4O8K A;  2E1Y A;  4QCL A;  3QEP A;  1QTM A;  4GKJ K;  2GUI A;  4QAG A;  3O4Q A;  4AHV A;  4N56 A;  3U6F A;  3VES A;  3FE1 A;  3U3G A; 
#chains in the Genus database with same CATH homology
 4JK9 A;  4ILH A;  4ISE A;  4JKG B;  2ITM A;  4EFH A;  4XEI A;  2IIR A;  3FZL A;  1YJW N;  3N4Q A;  3QB0 A;  5M1Q A;  3TU5 A;  2NRX A;  5MLC Q;  3LM9 A;  5AR0 A;  3CJA A;  3ATV A;  4YOW A;  1K73 O;  4CD1 A;  1N8R O;  3A5M C;  3H3O B;  5TKW A;  3SBG A;  3OA9 A;  3FZH A;  1BA0 A;  3O4W A;  1YJN N;  4BE7 B;  3ENH A;  2NRV A;  5CHI A;  2GX9 A;  3C7N B;  4H5R A;  1VQP N;  3VF2 A;  5GIN A;  3MN7 A;  3TSU A;  1T6C A;  2NNW A;  3VGK A;  4GV3 A;  4WFB L;  2DPN A;  1R59 O;  5GAH P;  3HZ6 A;  4WFN L;  4EAH D;  4BC3 A;  4BRM A;  5BN8 A;  1KAZ A;  3FR0 A;  5AQI A;  2ZGY A;  1RGI A;  4U67 L;  4CBW A;  3BUZ B;  2P9P B;  5CR4 A;  1JJ2 M;  4YOR A;  4E1J A;  3H3N O;  2ZJQ L;  4MLE A;  4JKF A;  1GLL O;  2OTJ N;  2P9I B;  1VQ5 N;  4FWM A;  2ZJR L;  1P8Z A;  4MLH A;  3VEW A;  2Q2R A;  4RCH A;  3GDQ A;  3QML A;  1SZ2 A;  3TTF A;  3J7Z O;  2IVO A;  2ZF5 O;  4JKC A;  4H0Y B;  1WOQ A;  1SS6 A;  3E66 A;  5C10 A;  1TYQ A;  2F9T A;  3KVG A;  3LDQ A;  4MO4 A;  4H5N A;  3WXJ A;  1Q81 O;  4C1N K;  2E2P A;  1YXQ A;  3L4Q A;  4WQ4 A;  4WQ5 A;  1YVN A;  4XH1 A;  5LJV A;  4MDA A;  2HF3 A;  4H5V A;  3TSP A;  1NM1 A;  4FOI A;  2I7N A;  3DJC A;  3S41 A;  4A61 A;  4EHU A;  3R8E A;  2KKZ A;  1P90 A;  4B1Z A;  1HX1 A;  4PL7 A;  2FSK A;  4K25 A;  1JCG A;  2EWS A;  4EIA A;  1YJ9 N;  3CME N;  2P9L B;  4YOV A;  3EN9 A;  5JVH L;  3WXI A;  5BN9 A;  3LM2 A;  3VTH A;  4K43 A;  2E2N A;  1E4F T;  2GWJ A;  4DKW A;  2GTD A;  1YAG A;  1KD1 O;  3UKR B;  4BVP A;  2CGL A;  2IVP A;  3BF3 A;  4JKA A;  1VQK N;  4H5T A;  3CJ1 A;  4JKE A;  1NGC A;  3CMA N;  3EE9 A;  3LDP A;  4H0V B;  5AQW A;  5FPD A;  3CQY A;  3O80 A;  1JCF A;  4XJX A;  5EOY A;  4DB3 A;  3G25 A;  4DQ8 A;  4IEE A;  2ASP A;  1VQO N;  3EKS A;  2QA4 N;  4CZM A;  1ILY A;  3CPE A;  1GLJ O;  3EL2 A;  3FZF A;  2QWO A;  4L3Q A;  3CIP A;  2F9W A;  2V7Z A;  3ENO A;  4KH6 A;  3W0L A;  4BRL A;  3UB5 A;  1HJO A;  5AQV A;  3CI5 A;  4JKH A;  4GVE A;  3R9P A;  4YOT A;  4BC5 A;  3OW2 M;  1DT9 A;  3R1X A;  4H5W A;  1G99 A;  3ZX2 A;  4BRG A;  3Q7B A;  5GAE P;  2HBM A;  3K9J A;  2P9P A;  3IMX A;  3CC4 N;  2Q36 A;  4IJN A;  3D2E B;  4NB4 A;  2RE2 A;  2YJE A;  1VQN N;  2QEX N;  4A5A A;  1NJI O;  2CH6 A;  3U4L A;  1ZBS A;  4AF1 A;  4GNI A;  4HWI A;  5HL7 L;  2YCH A;  3MDQ A;  2NRR A;  1U6Z A;  2A42 A;  4GY2 B;  2CGK A;  3BP8 A;  3DAW A;  3P38 A;  5BRF A;  4H03 B;  1K8K A;  2NZT A;  3U8X A;  5AZJ B;  4BR2 A;  4LC9 B;  3HOT A;  4BRN A;  4BRD A;  3ZX3 A;  5I9E B;  3AGR A;  4GV9 A;  3KWG A;  4OPH A;  3O9T A;  4DHY A;  3O08 A;  2QI2 A;  2H3G X;  3NVK A;  2I7P A;  4FWQ A;  4H0X B;  4IDH A;  3SAF A;  3DXK B;  4FWN A;  1OVY A;  2BTF A;  3KK7 A;  1NGF A;  5E84 A;  2D1K A;  3WQU A;  3Q7C A;  2P9L A;  1KAY A;  2WUS A;  2OAN A;  4J8F A;  5AQQ A;  4A2B A;  4EHT A;  4WFA L;  2HBL A;  3A5O C;  5JLF A;  1C0F A;  3UKR A;  1Q18 A;  4JKB A;  4FWO A;  5KQD A;  1VQL N;  5AZI B;  4YOU A;  3TTC A;  2A5X A;  1KAX A;  3QDK A;  1Q7Y O;  3CCM N;  4NO7 A;  3ULE A;  4CZH A;  5AQY A;  4O8U A;  2V51 B;  3AAP A;  4FPB A;  4IFE A;  1DEJ A;  4JHD B;  4QS9 A;  4FOE A;  5FPM A;  4CZL A;  1T6D A;  2P9N B;  4A2A A;  3QIC A;  4WF9 L;  3D7E O;  3ZET B;  1NLV A;  3LDL A;  2NLX A;  2VGM A;  3UE5 A;  3WQT A;  1GLF O;  1Z05 A;  4RTF D;  3A0I X;  4B1X B;  1RFQ A;  2KLA A;  2P9U B;  3CD6 N;  4CZE A;  4IO8 A;  3SBT A;  3CJB A;  3AAR A;  4KH4 A;  4FO0 A;  5KQ8 A;  3ENB A;  4MDB A;  4M63 C;  2AA4 A;  1X3M A;  2WFB A;  3DWL A;  4BRK A;  3CCQ N;  3OHR A;  3D2E A;  2FLO A;  2P9K B;  4WQ4 C;  4AM7 A;  5AQX A;  3CC7 N;  4M7X A;  1YUW A;  1CZA N;  3D2F B;  3ATU A;  5BRE A;  5AQG A;  2IVN A;  3MX2 A;  1XUP O;  2PFU A;  3MN5 A;  4BY9 C;  1MWM A;  5AQZ A;  5AQS A;  5TKY A;  1VQ7 N;  3O9Q A;  1QZ5 A;  2D0O A;  5C12 A;  4BQZ A;  1W97 L;  1NGG A;  4FWS A;  5AQT A;  5AZJ A;  3NMU A;  2PAV A;  4GV6 A;  3O8M A;  1H1V A;  3M1F A;  3O6W A;  4YDU A;  5AQM A;  5GAD P;  4QS7 A;  3G6E N;  5DM7 L;  1BU6 O;  4KH5 A;  2JWL A;  2E20 A;  1J6Z A;  4BRF A;  3I56 N;  3LL3 A;  1BO5 O;  2VCP A;  1W2B M;  1K9M O;  3C65 A;  2HBJ A;  3MWT A;  1MWK A;  2FF6 A;  1U2V B;  3VPZ A;  3HBT A;  5JMV A;  4YOX A;  4PKI A;  3CER A;  2YJF A;  2QXL A;  3ZYY X;  3VF4 A;  2QTD A;  2GWK A;  1HKG A;  1HKC A;  5KPT A;  5EXW A;  1NWK A;  3H1Q A;  1QZ6 A;  5AZI A;  4A62 A;  2YHW A;  1EO1 A;  4JKG A;  4JK7 A;  1M90 O;  4IOX A;  3HOS A;  3WXM B;  3P4I A;  4BRH A;  5CE3 A;  5EVZ A;  3VEZ A;  3DLL L;  1ATS A;  1GLE G;  1D4X A;  1QQN A;  2A40 A;  4IXC A;  4BC2 A;  4G9Z A;  2P9N A;  2RHK A;  3SJH A;  3TSQ A;  1V4T A;  2WBN A;  2KHO A;  5AQN A;  5KPZ A;  3QBX A;  5M1P A;  3W3D A;  5JIC A;  2P9S B;  4BR7 A;  4BRP A;  2P9U A;  3F5T A;  1V4S A;  4YOY A;  3C7N A;  3ZX0 A;  1QVG M;  4H0P A;  1HKB A;  4BVO A;  4A59 A;  3CCR N;  2E2O A;  4HTL A;  1X9J A;  2HMP A;  3ID8 A;  3MMV A;  2ZWH A;  3MX5 A;  4NLB A;  4BG8 A;  1K8A O;  2OTL N;  1T3V A;  3H45 C;  3WT0 A;  4FWK A;  4R79 A;  3WEE B;  2J4R A;  3HM8 A;  2ZGZ A;  4JD2 B;  2JWK A;  5BRD A;  4B1U B;  3I33 A;  4PKG A;  3UKU B;  1Q82 O;  5F0X A;  1KC8 O;  3C0B A;  3E9P A;  3PIO L;  3BF1 A;  4IOA L;  3OBW A;  3IFR A;  5AQL A;  3M6G A;  2HF4 A;  5AQJ A;  4C1N I;  4U7B A;  3FFK B;  2BUP A;  5AQU A;  2ASO A;  2A3Z A;  2NRH A;  1NGD A;  3CHW A;  3SAH A;  2YI1 A;  3O1W A;  2P9I A;  2YX6 A;  4PKH A;  4IOC L;  2QWN A;  3CCS N;  3MN9 A;  2Q97 A;  3J8A A;  4B1V A;  1C0G A;  2W00 A;  3CCV N;  4CBU A;  4H0O A;  1BG3 A;  5BR9 A;  2C1I A;  3VEV A;  1YHQ N;  2V52 B;  2A6A A;  3FLC O;  2HBK A;  3MCP A;  3SLC A;  4JN4 A;  4IZ9 A;  5F2R A;  2QWM A;  3C6A A;  4KBO A;  4BC4 A;  1NGA A;  1HPM A;  4CZK A;  1VQ8 N;  3VF6 A;  4CZJ A;  2V7Y A;  1ZC6 A;  2ASM A;  3U9Z A;  3VEO A;  2GEL A;  5AQK A;  4CD3 A;  3GL1 A;  5BRH A;  5M1K A;  2QW9 A;  3SMS A;  1YIT N;  3RSE B;  4Z94 A;  2VWB A;  4JNE A;  4XH4 A;  3M3Z A;  2D4W A;  2PBD A;  3FZM A;  4OO1 J;  1NGI A;  3K9K A;  3H1V X;  3VGM A;  3E9L A;  4IEI A;  4BGB A;  3ID6 A;  3GG4 A;  3HSC A;  2P9S A;  4BR4 A;  3PLA A;  2VGN A;  2NRW A;  4BRE A;  3CJ7 A;  3BEX A;  4IJA A;  2ZJP L;  1YI2 N;  5M1N A;  4FWR A;  3EZW A;  5E26 A;  3SMP A;  3T69 A;  3C6H A;  2QWL A;  4CBX A;  5DM6 L;  3CPW M;  5BPN A;  1QHA A;  2FXU A;  3AY9 A;  4YDU C;  2CH5 A;  4C23 A;  3VET A;  3CCL N;  5M1F A;  3SK3 A;  5JVG L;  3WEE A;  5GIP A;  5AQF A;  4JD2 A;  4BRI A;  4CJ7 A;  3UKU A;  5AQH A;  3VEY A;  1GLD G;  4FWL A;  3T7Z A;  2E1Z A;  3VEX A;  1KQS M;  1NMD A;  5C15 A;  5JLH A;  3O9S A;  3VER A;  2VYP A;  3B8A X;  2FSJ A;  3R3L A;  3U9D A;  2W41 A;  4WQ5 C;  3VMF B;  5ADX H;  5GIO A;  3CF5 L;  2GEM A;  3AGK A;  4NLC A;  3VEN A;  3DXM B;  5ADX A;  3NVM A;  1Z6R A;  4F9O A;  1O13 A;  2QWR A;  1TUY A;  3MCA B;  3P39 A;  3QBW A;  3N4P A;  2UYT A;  3A8Y A;  1HLU A;  3TTD A;  1OKJ A;  1KXP A;  3IUC A;  3L6Q A;  3CCJ N;  3EKU A;  2AP1 A;  1GLB G;  3KHY A;  1NGE A;  3CCU N;  1XC3 A;  3R6M A;  5HOO A;  3RVC A;  2NRZ A;  3I8B A;  5B8H A;  5ELZ A;  3DXK A;  3LDN A;  2Q1N A;  1BOT O;  3HRG A;  5AFU H;  2Q0R A;  1DGK N;  2W40 A;  3RSE A;  5H1S Q;  1MDU B;  1ATR A;  3CET A;  5AFU A;  5F1X A;  3EO3 A;  1JCE A;  4ISG A;  1Q86 O;  4CZI A;  5EX5 A;  4XH5 A;  5M1O A;  3AAQ A;  3D6R A;  3P31 A;  4AM6 A;  1NGH A;  4BR5 A;  4M7Y A;  3M5R A;  1SAZ A;  3O5B A;  3L0Q A;  4BRO A;  1VQ9 N;  3H6E A;  4FL9 A;  4JHD A;  5AQO A;  5FPN A;  1QVF M;  1LOT B;  3F9M A;  3IKM A;  3ZET A;  4FSV A;  1K8K B;  1QQO A;  3A5L C;  4BRC A;  3TPQ A;  5BPL A;  2YHY A;  4CZG A;  3O9U A;  2A41 A;  2Q0U A;  1RDW X;  1TUU A;  4I6M B;  3PIP L;  1NBW A;  3GE1 A;  1X3N A;  3VGL A;  4IWV A;  1SQK A;  3HTV A;  3VOV A;  4WCE L;  3WXL A;  4CI6 A;  2E8A A;  3IDH A;  4K42 A;  3F2K A;  5AQP A;  5EY4 A;  5KPR A;  4BEB A;  1GLC G;  2P9K A;  1RDU A;  2HOE A;  3SAG A;  1E4G T;  4JKD A;  1T44 A;  4H0T B;  2YHX A;  1MA9 B;  1VQM N;  3D2F A;  4DCH A;  2C1G A;  3E9O A;  3DXM A;  3ZEU B;  1S3X A;  2E2Q A;  4FPA A;  1EQY A;  3G71 N;  2F7T A;  3CC2 N;  4ISF A;  1ATN A;  2FSN A;  3FGU A;  1LCU A;  4BG9 A;  3JS6 A;  3O1B A;  1VQ6 N;  3CXC M;  3ULE B;  2FF3 B;  1ZXO A;  1QQM A;  4JEP A;  4QS8 A;  3MWP A;  4BR0 A;  1DKG D;  3CQX A;  4MO5 A;  4CZF A;  1IJJ A;  2QM1 A;  4BRQ A;  4A57 A;  3MN6 A;  4OPA A;  4FVU A;  3OBY A;  2BH1 A;  1M1K O;  3QFP A;  1GLA G;  4A5B A;  1NGJ A;  1XQS C;  4FWP A;  4PHT X;  3GOI A;  3I55 N;  1IG8 A;  3GBT A;  4ILG B;  3L4I A;  1BUP A;  1S72 N;  2GUP A;  1ESV A;  3HI0 A;  1Y64 A;  1U2V A;  1WUA A;  2E88 A;  4RWT A;  1VQ4 N;  1NGB A;  3JXU A;  3H46 O;  4JK8 A;  2QWP A;  4K41 A;  5C2D A;  3CJC A;  2D0P A;  4B1W B;  3VTI A;  4UY8 O;  4O5F A;  5LY3 A;  5LJW A;  1VAZ A;  3KWI A;  4IO9 L;  3O9R A;  5C2F A;  3WUH A;  3CJ9 A;  3MK6 A;  3LDO A;  4WYB A;  1S22 A;  1BA1 A;  4BGA A;  5FPE A;  4BQL A;  4BEC A;  3FZK A;  1BWF O;  3A5N C;  3QFU A;  3WXK A;  4B1Y B;  4BR9 A;  1BDG A;  4I6M A;  1HUX A;  5AQR A;  4O8K A;  2QWQ A;  2E1Y A;  3CCE N;  3KZB A;  2CGJ A;  4B9Q A;  4PL8 A;  5C0Y A;  4JAX A;  1TYQ B;  5GAG P;  4ILJ A;  2HST A;  3E1Y A;  5BPM A;  3G4S N;  3ZEU A;  3EE8 A;  3FE1 A;  2Q31 A;  3VES A;  4BRA A;  1YF5 L;  2WC9 A;  2NRT A;  1YIJ N;  4Y0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...