4I6MB

Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of swi/snf chromatin remodeler.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
437
structure length
396
Chain Sequence
PFRQDSILIIYPRSQTTLVQFGLNEETFTVPELEIPTQIYRTTRQDGSYTYHSTNKDNKAELIKPIQNGEIIDISAFTQFLRLIFVSILSDRANKNQDAFEAELSNIPLLLITHHSWSQSDLEIITQYVFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTHHTDIIPIVDYAQLDHLVSSIPMGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSKNSDLEFNTFWDEKGNEIKVGKQRFQGCNNLIKNISNRVGLTLDNIDDINKAKAVWENIIIVGGTTSISGFKEALLGQLLKDHLIIEPEEEKSKREEEAKSFVPTIEYVQCPTVIKLAKYPDYFPEWKKSGYSEIIFLGAQIVSKQIFTHPKDTFYITREKYNMKGPAALWDVQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an actin-related subcomplex of the SWI/SNF chromatin remodeler.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
molecule keywords Actin-related protein 7
total genus 115
structure length 396
sequence length 437
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4i6mB02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4i6mB01
3.90.640.60 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4i6mB03
4BRQA 4H5VA 4I6MA 3U9ZA 1BU6O 1S3XA 5JMVA 3VGLA 3O1BA 4A61A 3AAQA 3CJAA 4BR2A 4H0XB 3AARA 2ZF5O 3UKRA 5AQRA 3SJHA 4CZIA 3C0BA 4PKIA 4LC9B 3J8AA 2QWOA 1QQOA 2Q0UA 2QWMA 2P9KB 2IIRA 1NLVA 3O4WA 5AZIB 2CH5A 4BR0A 3W3DA 4B1VA 1K8KB 4KBOA 4WQ5A 2P9LB 3HSCA 4H03B 4XH4A 4M7YA 3TU5A 3BEXA 1EQYA 1TYQB 4WQ4A 2P9IB 3VGKA 3WXLA 1HX1A 4MO4A 3D2EB 2E20A 3KZBA 4BREA 3U4LA 4MO5A 4K42A 1HKBA 3ZEUB 3HZ6A 4CZLA 3H3NO 3VEOA 3VERA 4H5WA 3CERA 4JAXA 2F9TA 1HUXA 1S22A 5FPMA 4H5RA 1BUPA 4BVPA 5KQ8A 2Q0RA 2GEMA 3A0IX 3L6QA 4H0PA 4PKHA 5AQJA 3TPQA 1NGEA 1GLBG 3EO3A 2FF3B 1WOQA 3M1FA 3H3OB 2J4RA 1LCUA 3VEWA 1Z6RA 2Q31A 3UB5A 4FPBA 3LDOA 5LJWA 2Q36A 4C23A 3DJCA 4HWIA 2YHWA 3VF4A 3A5MC 3QFUA 4CJ7A 4BROA 3HBTA 5F1XA 4CZJA 4IXCA 2NLXA 2QWNA 5AQSA 1NGCA 4PKGA 1JCFA 2A3ZA 3O8MA 3QB0A 4IJAA 1GLJO 5AQLA 1KXPA 3U9DA 4CZFA 4QS8A 3GG4A 2BTFA 5BRDA 5JLFA 5LY3A 4FO0A 2KHOA 4J8FA 4CBUA 4FWLA 5AQXA 1D4XA 4M63C 1NBWA 5KPRA 5AR0A 2QM1A 3WT0A 1C0GA 2P9NA 4JD2B 5EX5A 4IO8A 1C0FA 4FPAA 3RSEB 4MLEA 3FLCO 3QMLA 1XUPO 3JXUA 1BOTO 2EWSA 4BR4A 2A6AA 3GDQA 1HJOA 2QW9A 3FE1A 1ZC6A 1NMDA 3MN6A 5AQFA 1P8ZA 2E1ZA 1YUWA 4DCHA 3S41A 3IDHA 1QZ6A 3O1WA 1QHAA 2V52B 3SMPA 4F9OA 2A5XA 3CJ9A 2CH6A 4BRMA 4FWRA 4CZKA 4QS7A 2ITMA 4DB3A 1MWMA 4CBXA 1KAZA 3ZETA 2GUPA 2I7NA 5CE3A 2CGLA 2FXUA 2CGKA 3ATUA 3IMXA 4H0VB 4CBWA 5ADXA 3ZX0A 2GWJA 2GTDA 2ZGZA 3VPZA 2P9UA 2YHYA 3MCPA 3P4IA 4YDUC 2HF4A 1BG3A 3SK3A 1V4TA 3EZWA 4NO7A 5AQPA 2ASOA 2NZTA 3U8XA 1CZAN 1U6ZA 3M6GA 4WYBA 2I7PA 4I6MB 4YDUA 5AQWA 3R8EA 3UE5A 4CD3A 2W41A 3A5OC 3ATVA 3VEYA 2VCPA 5AQKA 3G25A 3WUHA 2D0OA 2P9IA 4DHYA 4E1JA 3VOVA 1HKCA 2V51B 3H6EA 3HM8A 4JHDA 5AFUA 2P9LA 4AM7A 4FWKA 1ESVA 5JICA 1RGIA 3KHYA 5AZIA 4FWMA 2Q2RA 2E88A 1YXQA 2IVPA 3HTVA 1JCEA 1Z05A 2IVNA 3ZX2A 3F9MA 4PL8A 5AQMA 4CI6A 3VGMA 2IVOA 1NGBA 1GLAG 1HKGA 3FZKA 5BPLA 4EIAA 2FLOA 3ZETB 4A62A 3UKUA 2VWBA 1K8KA 1MDUB 3LDPA 1Y64A 4JHDB 5BRHA 1BA1A 3FZFA 2D1KA 5AQGA 3R9PA 1NGHA 5FPNA 4K25A 3SMSA 3CIPA 4GY2B 5I9EB 3H1QA 4BR5A 3L0QA 3LM2A 3I8BA 2W40A 3MN9A 2PBDA 5AQIA 2Q1NA 2A42A 1JCGA 3WXKA 5EOYA 4ISFA 2GELA 3ZX3A 1E4GT 3D2FB 2PAVA 1U2VB 5EY4A 2D4WA 2E2PA 1XC3A 4BC3A 3LM9A 1NGFA 4CZMA 3SLCA 3BUZB 3CJ1A 3DXMB 5EXWA 4QS9A 1DEJA 1X3NA 2WUSA 5KPTA 3KVGA 2DPNA 2OANA 3VESA 3H45C 3FZHA 1T44A 2E2OA 4FSVA 5AZJA 2BUPA 3EN9A 4BQLA 1SAZA 2CGJA 4FOIA 3EL2A 2P9PA 3EKSA 4H0YB 2V7ZA 4BR9A 3ID8A 2H3GX 3O80A 3AAPA 2D0PA 1ATNA 1T6CA 4BRKA 3O08A 4Y0WA 3FGUA 3M3ZA 4B1UB 3B8AX 1NGAA 5AQVA 5BPMA 1ATSA 3BF1A 2QWQA 2HF3A 4IZ9A 5LJVA 3LDNA 4H0OA 4JD2A 3C7NB 1X3MA 3LL3A 2QWRA 2YI1A 3A5LC 3VF2A 4B1XB 1TUUA 5F2RA 1SQKA 3VEZA 2AA4A 3EKUA 4A2AA 3CQYA 2ASMA 2YHXA 4CZEA 4EHUA 4BRNA 4K41A 3WXIA 4L3QA 2UYTA 5JLHA 1ZBSA 2Q97A 1YVNA 1DGKN 4XH5A 5AQOA 4XEIA 3D2EA 2GWKA 1BDGA 5FPEA 4BRCA 3AY9A 2P9UB 1TYQA 4RWTA 3CJ7A 4EFHA 3IFRA 1RDWX 2YJFA 3CI5A 2FSJA 4IWVA 1HLUA 4BG8A 3CHWA 2P9KA 2FSKA 4B1ZA 5AQTA 4AM6A 1T6DA 3GL1A 1WUAA 1BO5O 2E8AA 3FFKB 3GBTA 1BA0A 4DQ8A 3A5NC 4WQ4C 1NGIA 3WXJA 3O5BA 1H1VA 4WQ5C 1NGJA 4BRDA 3WEEA 3FZLA 1QQMA 5ELZA 4JN4A 5AQUA 2NRHA 3VETA 5AQHA 1TUYA 3FR0A 2QXLA 2ZGYA 4EHTA 5B8HA 4BQZA 4BC2A 3RSEA 1XQSC 3VEXA 3VF6A 2P9NB 1OKJA 5BN9A 4O8KA 3C7NA 3H1VX 3DAWA 3QBWA 2HMPA 4RCHA 1IG8A 5BRFA 2P9SA 4FOEA 4Z94A 3HI0A 4B1WB 1IJJA 1MA9B 3DWLA 1ATRA 4FWOA 3ULEB 3MDQA 3ENOA 3QFPA 4K43A 3DXKA 5FPDA 3MK6A 5ADXH 3WEEB 4H0TB 3CJCA 3O6WA 3WQTA 1DKGD 1BWFO 3IUCA 3L4IA 1NWKA 3MMVA 1HPMA 1G99A 4ISGA 3OHRA 3ZEUA 5AQZA 4BRGA 2A40A 2E2QA 2P9PB 4FWNA 3QDKA 2FF6A 3LDLA 3D7EO 4BR7A 5AQYA 4IJNA 5AZJB 1QQNA 5BN8A 3H46O 5AFUH 3DXKB 4H5TA 3QICA 4FWPA 3MN7A 3W0LA 5E84A 1GLFO 4JNEA 2A41A 2AP1A 1GLEG 1U2VA 1KAYA 4BC4A 3LDQA 4BRFA 1NM1A 2VYPA 3D2FA 1YAGA 2HOEA 3ENHA 4CZHA 4FWQA 1QZ5A 3BF3A 4ISEA 3A8YA 3GOIA 1SZ2A 4B9QA 4B1YB 4BG9A 1J6ZA 4BGBA 4H5NA 4EAHD 5E26A 4CZGA 1E4FT 1V4SA 4HTLA 3CJBA 5TKYA 1KAXA 3CETA 5BREA 1NGDA 5BPNA 3R6MA 4BVOA 2F9WA 1Q18A 1RFQA 2QWLA 1GLDG 4CD1A 5AQQA 1GLLO 3QBXA 2E2NA 4PL7A 3UKUB 4NB4A 4FL9A 3I33A 4M7XA 5BR9A 3CQXA 5F0XA 3DXMA 1LOTB 2V7YA 1ZXOA 4FWSA 5AQNA 1X9JA 4RTFD 2YCHA 2ZWHA 4BC5A 3FZMA 3GE1A 3BP8A 3MN5A 4BGAA 4BRPA 1R59O 3UKRB 2E1YA 2QWPA 3JS6A 3VEVA 4BRLA 1GLCG 4A2BA 3WQUA 3ULEA 2ASPA 4GNIA 3VENA 1NGGA 4MLHA 2P9SB 2FSNA 4BRAA 4BRIA 1MWKA 5KQDA 4O5FA 4XH1A 5KPZA 4BRHA 5EVZA 2YJEA
chains in the Genus database with same CATH superfamily
1ZBFA 3U9ZA 5GINA 1EKEA 2KLAA 2FBXA 3DRSA 1RBRA 4DSKA 3NF6A 5AQRA 3SJHA 3S3OA 1T3VA 3C0BA 2UXDK 2QWOA 1RCHA 2ZJQL 1T05A 1VQPN 4FJKA 4FXDA 2P9KB 2A1RA 4HCBA 3AVHA 4BR0A 3W3DA 1KVAA 1K8KB 4XIUA 1I94K 2O4GA 4OGEA 3SUQA 4QCLA 2HW3A 4E7JA 3HSCA 4H03B 4XH4A 2HHXA 4FJHA 3HVRA 1TK8A 3VGKA 3SBTA 1BI4B 1XMOK 5LMUK 1HX1A 2OYQA 4PWDA 4WCEL 3ZEUB 4LH4A 3SPYA 1QSYA 3OYKA 3SV3A 4DR2K 3O9RA 4CJLA 4KKOA 1BIZA 3LAKA 1S1VA 5FPMA 4BVPA 3LZIA 3OYMA 1HNZK 1RDBA 1EO1A 3QNNA 3RRGA 1P90A 2GEMA 2Q0RA 3MWPA 3L6QA 3OYEA 2QEXN 1NGEA 3TWHA 3EO3A 4FJ9A 4KH5A 5C2FA 1WOQA 3ZSVA 4DR1K 3DLEA 1OVYA 1Z6RA 3MAQA 2Y1JA 2HBMA 4B9UA 3NFAA 1EXQA 3DLBA 4A57A 4F2SA 4C23A 4CERA 3NH1A 3LWMA 1S6QA 3THYA 3KLIA 2OPPA 3EE9A 4CHQA 3TTDA 5HLFA 1NG9A 2F4VK 3M8RA 4CZJA 2ZQBA 1BIUA 2LSNA 5AQSA 1M90O 4CHOA 1Z26A 3HOSA 3P38A 2A3ZA 1GLJO 3NH0A 1S72N 2YNIA 4CGGA 1WBBA 4FK4A 5AJ3K 5BRDA 3ZLJA 3THXA 1GOCA 4KREA 4ILJA 3AVJA 4M63C 1S1XA 1VQ9N 3QMLA 4Y1CA 4DFPA 3S3MA 1IKWA 4BR4A 2C1IA 1JLBA 1ZC6A 1NMDA 3MN6A 4MQ3A 5AQFA 2PZSA 4DCHA 2O8EB 4FYDA 3ZT0A 3IDHA 1QZ6A 3O1WA 4CFDA 4JI5K 5J2PA 3SMPA 2A5XA 5M1NA 2KFNA 3BZCA 3IAYA 4DV5K 1ASUA 2HNYA 3RTVA 1L3VA 2I7NA 4E7HA 1KSPA 2CGLA 3LZJA 3IMXA 1KVBA 3ATUA 3TABA 4ZHRA 2O8CB 4CJWA 2YHYA 3CCLN 4C8LA 1NOYA 4JI8K 1L3TA 5M1PA 1BG3A 3SUNA 1QQCA 4B9VA 4NO7A 1KFDA 2ASOA 4E3SA 1E3MA 1KCFA 1U6ZA 3O9TA 4J2AA 2I7PA 4I6MB 4JI3K 1U45A 5DM6L 3SAFA 4OLAA 3VEYA 4U67L 2E4LA 1W7AA 1HKCA 4N5SA 4IBNA 2YHBA 5AFUA 5M1OA 4AM7A 3TI0A 1JLAA 4DQSA 1RGIA 5AZIA 3TAEA 1VK0A 1VSJA 2Q2RA 4OX9K 2D0AA 1YXQA 2IVPA 1JCEA 1Z05A 2ETJA 2G8WA 4M3UA 4DTUA 3F9MA 4IFEA 4BE0A 4J2BA 3JSMA 5J2MA 4ID1A 3K58A 2IVOA 1NGBA 3NGIA 3FZKA 4CEEA 5BPLA 4A62A 2YKNA 4M3ZA 2VWBA 1JLGA 2NUBA 2YKMA 5M1QA 4CJSA 4CW7B 4BR5A 1CZBA 3SI6A 4PHTX 2W40A 3TTCA 1QE1A 2PBDA 4DUYK 1JCGA 4JRQA 1SV5A 3FFIA 3F5TA 4AHSA 5HROA 4E19A 3D2FB 3ZSQA 3SAHA 2E2PA 4M41A 3EYZA 1XC3A 4BC3A 3T19A 4YHHK 3HSTB 3VA3A 3CF5L 3CJ1A 3DXMB 5EXWA 4CJFA 4H8KA 4B9NA 1DEJA 1X3NA 3QNOA 1N34K 4K0KK 5GAHP 3TAMA 3FZHA 4I9QA 4FOIA 4KRFA 3KLFA 1VQLN 4IDKA 3VQ7A 1GOAA 4BR9A 2HHSA 4BDZA 4JI4K 3KK2A 4W5NA 4ELVA 3FGUA 1VRUA 1D5AA 3KLEA 4B3SK 5AQVA 1ATSA 3CCVN 4AF1A 3Q7CA 4QOZB 1WSGA 5HRPA 4CJTA 4H0OA 1RDDA 2KW4A 2YI1A 3OYNA 4B1XB 1TUUA 5F2RA 3EEQA 1HQUA 1SL1A 2UXBK 3B6OA 3KK7A 4I2QA 4BRNA 4K41A 4N76A 5DMRA 3HXMA 3V1OA 4KHYA 4H4MA 1ZBSA 5FDLA 1YVNA 3AVAA 3G6EN 5AQOA 3HPGA 1M1KO 3D2EA 4U7BA 3THYB 4BRCA 3AY9A 3KKSA 2P9UB 1KVCA 1TYQA 2RF2A 3OA9A 4CEBA 1VQ5N 2HBJA 1RDWX 2YJFA 4DTNA 2D0CA 2P9KA 5AQTA 2QTDA 1BO5O 3G10A 2W00A 1BA0A 2UUBK 1WSEA 2IS3A 4B8CA 3OYJA 4FLVA 1REVA 4DV7K 3WEEA 5KTQA 3OS2A 4DR4K 5ELZA 3C95A 3EE8A 5AQUA 3VETA 4EHTA 2Y1IA 5B8HA 3VQEA 3VEXA 5JS1A 5M1FA 3C7NA 3H1VX 3QBWA 4CEAA 4FOEA 3HPHA 5C24A 2HBLA 1ATRA 4FWOA 1X1PA 3WNFA 5ADXH 1LW2A 3O6WA 2KZMA 1T03A 2RE2A 4MDBA 2VG5A 3MMVA 3SPZA 4CJRA 4M3XA 4JI2K 4M42A 4O0JA 4KTWA 3OYDA 2E2QA 4DU3A 4FJ7A 2WONA 4M45A 5AZJB 4MFBA 5BN8A 4X66K 3DXKB 5FRNA 3W0LA 3AO4A 3MEEA 3K59A 1GLFO 1ZBLA 4JNEA 4GV3A 2A41A 1U2VA 4BC4A 3LDQA 3KLGA 2VYPA 1YAGA 3ENHA 3L3VA 3DLGA 4E7IA 4FWQA 4C8NA 1QZ5A 3CC4N 3LPTA 3GOIA 1O13A 3ZSRA 1X9SA 1N36K 3THWB 3I0SA 4H5NA 5E26A 1V4SA 2RPIA 3CETA 4IOCL 3VQAA 4DUZK 5CZ1A 3DLLL 1GLDG 4CD1A 1J9AA 5AQQA 1GLLO 3KK3A 1JKHA 4NB4A 4FL9A 3I33A 5BR9A 2P5OA 2HBKA 2HHTA 5LL6Z 1LOTB 4EP5A 1Q7YO 1A5VA 5EU7A 4FWSA 4HUFA 2YCHA 3C6HA 2VG6A 4CJ4A 4JS4A 4OPKA 1DTTA 3BP8A 2AJQA 3CPEA 1VAZA 2HMIA 4BGAA 3CFPA 3O9UA 2W6KA 3UKRB 2E1YA 3AVFA 4KB1A 1C0UA 5DK5A 2ASPA 3IKMA 3ZSYA 1UOCA 4A5BA 4GNIA 5HRNA 1HMVA 4MLHA 1FJGK 2P9SB 1J5OA 4KH4A 3A2FA 2KZZA 4BECA 4OJRA 5KPZA 1TKDA 1WAFA 1A5WA 4CF9A 3VEWA 2OTJN 4JKFA 3AO2A 1BU6O 3HP9A 3PLAA 3T1AA 4WFBL 4LF5K 4BR2A 4H0XB 3AARA 4DR6K 2VGMA 4KV8A 4CZIA 5M1KA 4YOXA 4PKIA 2BANA 3J8AA 1L3UA 3L2UA 1VHXA 1BHLA 2ZE2A 4CHPA 3R3LA 3ISNC 4CFAA 3O4WA 2CH5A 4LSNA 4X64K 1OH6A 4B1VA 4KBOA 2P9LB 2OPSA 4ELTA 3TU5A 3BEXA 1EQYA 4WQ4A 4JKDA 3KZBA 2XY5A 4BREA 3J81O 1Q9YA 1U04A 3C65A 1DT9A 4K42A 4W5TA 3HZ6A 3VEOA 3CERA 1HNVA 3NDKA 1CXQA 5FRMA 1HUXA 4JKGB 4R5PA 4H5RA 4FJ8A 4DS5A 3AVBA 3F2KA 3KD5E 5AQJA 4E7KA 1K73O 4FVMA 3AGRA 5K14A 3H3OB 2F96A 1LCUA 3RVCA 3ZT1A 1IKVA 4FPBA 5KRTA 4CHYA 3OW2M 3OYIA 4CIFA 3L2VA 1U48A 4WFNL 2Q36A 1ASVA 4HWIA 3HOTA 2YHWA 3VF4A 1YJ9N 3CM5A 3HBTA 4FJGA 4FLYA 4IXCA 1KFSA 2NLXA 2QWNA 5T7BA 3VQPA 1NGCA 4PKGA 3O8MA 4IJAA 5HRRA 1NJWA 5AQLA 2XY6A 3LWLA 1KXPA 2VGNA 4FZYA 4CZFA 3DYAA 2O8BA 2BTFA 5JLFA 1CXUA 4YOTA 2KHOA 5AQXA 2FC0A 5KPRA 5AR0A 1C0GA 3P83D 4IO8A 3RSEB 4MLEA 3FLCO 1VSHA 1B9DA 2A6AA 1RILA 1HJOA 3E66A 1P8ZA 5CY4A 4Z4CA 4LD0A 4A5AA 4K8XA 2VQFK 1QHAA 2V52B 2OPQA 1NNEA 4CJKA 2CH6A 4BRMA 3RWUA 4NLBA 2E5LK 4FWRA 3F73A 1Y97A 4CZKA 4QS7A 1QVGM 1XNRK 3HT3A 3KWGA 4IKFA 1EETA 5CE3A 4B3MK 2FXUA 4H0VB 2Z1HA 3ZX0A 2GWJA 4DR7K 2ZGZA 5I3UA 4FK2A 4C8KA 2P5GA 1WAJA 3R1XA 4YDUC 5CHIA 4KHUA 3EZWA 2RHKA 2PYLA 4FLUA 1WSIA 3HL8A 4WYBA 4YDUA 4KHNA 5MLCQ 3UE5A 4AHVA 1NJZA 3ATVA 4J2EA 2DTUA 5AQKA 3PSFA 3OYGA 3WUHA 2D0OA 1WN7A 2P9IA 5J1EA 3VOVA 4JHDA 4DR5K 4DTJA 1BCMA 2P9LA 4FWKA 4JKCA 4E1NA 1ESVA 3KK1A 2KFZA 3CCQN 3M8QA 3PX0A 1SKSA 4FWMA 4DFMA 2E88A 3HTVA 1C0TA 3K2PA 4FLWA 1RBVA 3O3FA 3LPUA 4IO9L 4FJLA 3AO5A 1BI4A 4IG3A 4GVMA 2HHWA 1GLAG 1OH7A 2W42A 4CHNA 1LV5A 3ZETB 1J53A 1IBKK 1MDUB 1N6QA 3NVMA 4Q5VA 2VG7A 4LF7K 1VQON 3NBPA 4GW6A 4B9TA 5AQGA 5FPNA 3SMSA 1IG9A 3CIPA 3O9SA 1NKEA 3I8BA 1K6YA 1TKXA 3MN9A 2WBNA 3O3GA 1JL1A 5AQIA 3CCEN 3WXKA 5EOYA 2G8KA 4RW7A 2GELA 3ZX3A 3M5RA 1E4GT 1KLNA 1IH7A 2OZSA 1TAUA 2E6MA 1NGFA 3SLCA 1FK9A 4QS9A 2YHAA 3I56N 2WUSA 3KVGA 2DPNA 3H45C 1T44A 2HSTA 4BQLA 1SAZA 4DFJA 2CGJA 4C8MA 1BQMA 3T3FA 2P9PA 1XHZA 4DTPA 1QVFM 4Z4EA 4FW1A 1N32K 3EKSA 4H0YB 3NF9A 2H3GX 1RTIA 3DMJA 4C8OA 4FZZA 4DV0K 3AAPA 3KIOA 5D3GA 1NU0A 3DLRA 1IO2A 3V9UA 4B1UB 3M3ZA 5CR4A 4JEPA 1NK5A 1VQKN 3K0SA 1W9HA 3TAQA 1HYVA 4JD2A 3C7NB 2QWRA 3A5LC 3VF2A 1RT1A 2HNDA 3MEGA 3G71N 4FJXA 1SQKA 1A5XA 4BWMA 1HYZA 2AA4A 3P1GA 2YHXA 3QERA 1K9MO 4L3QA 3CM6A 4CGDA 2UYTA 2NRZA 1VQ4N 4HVJA 4ILGB 2Q97A 2DY4A 4XH5A 4CK1A 3VQ6A 2X74A 1JXBA 4XEIA 5FPEA 1ILYA 5CYMA 1G15A 3ZT2A 4CEDA 3CJ7A 3CXCM 4EFHA 3CCMN 4GMJB 5GIOA 1TKZA 2FSJA 3MECA 4IWVA 1RBTA 4B8AB 1HLUA 3S3NA 4RW6A 4B1ZA 3SBGA 4AM6A 4PQUA 2C1GA 2QK9A 3GL1A 2E8AA 1UA0A 3ZSWA 1XMQK 3RMDA 3WXJA 3SCXA 1H1VA 4WQ5C 2OTLN 1WBDA 1GOBA 3ID6A 4QAGA 1U49A 4E7LA 1QQMA 3ZSXA 3PX6A 3VQ9A 4FVUA 1HNXK 2PFUA 4BC2A 2G8HA 4C1NI 1XQSC 1VQNN 2I5JA 1OKJA 3B6PA 4JI1K 5JVGL 3ZT3A 2HMPA 4RCHA 1IG8A 3T7ZA 5BRFA 1RT7A 3THXB 1W0HA 4Z94A 4YOWA 3ENBA 3ULEB 1TAQA 3DXKA 3MK6A 3WEEB 3PIOL 3CJCA 4O55A 3WQTA 3CMAN 1DKGD 3H08A 4ISGA 3ZEUA 3V4IA 1JLFA 5AQZA 2HHQA 5FLXO 1C1BA 2O8DB 4FZXC 4BRGA 2A40A 2P9PB 4FWNA 1NOZA 1VQ8N 4IEIA 1B9FA 3D7EO 4BR7A 1KD1O 5GAEP 4DLEA 3H46O 3QICA 4O5BA 3AVNA 4W5OA 4FWPA 2O8FA 4JKBA 1SKWA 2XHBA 2JWLA 3CYGA 4WE1A 3O4QA 1F21A 2BH1A 2AP1A 1GLEG 4DSLA 3TR8A 4JI0K 2HOEA 3PUFA 3KTQA 2D5RA 1WSFA 1Q8IA 2OCEA 1SZ2A 4B9QA 2HHVA 1J6ZA 4BGBA 3NAEA 4CZGA 4BY9C 4O4GA 1XC9A 5HOOA 5KRSA 3WNHA 3CJBA 4FJIA 3CFRA 4DQRA 5BPNA 1RFQA 3QBXA 2E2NA 3UKUB 4EP4A 3CC2N 4M7XA 5I42A 2KTQA 4DWIA 3CQXA 2V7YA 3N4QA 5AQNA 3OYHA 4RTFD 2ZWHA 3D45A 3FZMA 1L5UA 3AGKA 3GE1A 3OTOK 3MN5A 2NRVA 2QWPA 4BRLA 2F7TA 3OBYA 3WQUA 3BGRA 2VWKA 3TTFA 1NGGA 2RKIA 4GKJK 4BRAA 3D6RA 5FROA 4XH1A 3K9KA 5C10A 3ALYA 4BRHA 5EVZA 3RRHA 4H5VA 2YNFA 4WFAL 3AA2A 3HVTA 5JMVA 3SV4A 1I39A 4A61A 4JK8A 3CJAA 5J2NA 4KI6A 3QLHA 2ZF5O 3UKRA 4YFUA 3CG7A 1QQOA 2GX9A 3E01A 4CJ3A 2FBVA 1FW6A 3K5OA 1NLVA 3TSQA 5SZTA 1BQNA 4CJEA 4LF4K 2Z1GA 4WQ5A 4DTSA 4M7YA 3HYFA 3SUOA 4BDPA 1NMNA 4CF0A 4MO4A 3D2EB 4KTZA 4DU4A 3OJSA 1HKBA 3BZKA 3H3NO 1Z25A 4H5WA 4ILHA 4IEEA 3CPWM 1QHTA 3L2RA 1IBMK 2XY7A 4DV1K 3A0IX 5KGWA 1GLBG 1J54A 3KLHA 2FF3B 4DSFA 1RDCA 4CJVA 2WTUA 3NGZA 1W97L 3UB5A 2Q31A 1RT5A 5H1SQ 4DSIA 4Z4FA 4JI6K 2G8FA 4CJQA 3SNNA 3KKRA 5LJWA 2O4IA 2IGIA 4FCYA 4YY3K 4DV4K 5KGXA 4BEBA 4RG8A 3DJCA 5C42A 2EHGA 3LALA 3G0ZA 1FKPA 4CJ7A 5F1XA 5IT9O 4OLBA 3NCIA 2XY8A 3DLHA 4K8ZA 3V9ZA 1SL0A 4RW9A 3K5LA 1QSLA 4B9SA 4QS8A 2DFHA 1IV0A 4FWLA 3VQDA 1D4XA 1NBWA 3CD6N 2QM1A 1VSLA 4JKGA 3WT0A 4JD2B 3O3HA 4FPAA 1XUPO 3VQBA 1HJRA 4KH6A 2UUAK 3GDQA 2QW9A 4IOXA 4XJXA 3S41A 3ULDA 4YOYA 1OH8A 1NK4A 1XNQK 4CVNE 4YOUA 3VQ8A 4L8RB 4UY8O 4BWJA 3C6TA 3CCSN 2ITMA 4DB3A 2HVIA 4ICLA 1KAZA 3ZETA 3S5TA 2IC3A 2GUPA 4F3TA 3QEPA 4W5QA 4CBWA 3QIOA 3CMEN 4OPJA 3OJUA 3NF8A 1IBLK 2GTDA 4FLZA 1TK0A 3MCPA 3J7ZO 4G9ZA 3P4IA 2HF4A 5AQPA 5CZ2A 2NZTA 4DV3K 3M6GA 2KKZA 3K57A 1RT2A 4FM0A 3TAGA 4HUEA 3CQ8A 1RTHA 2VCPA 4DU1A 4E1JA 3BDPA 1EWQA 2V51B 3H6EA 1KLMA 4NYNA 3MXJA 3WNEA 4RW4A 4HUGA 1SKRA 4CIEA 1ASWA 1ZBIA 3KHYA 1C6VA 4OPHA 3KJVA 2QKBA 2X78A 3ZX2A 1RNHA 2IVNA 1OVQA 4W5RA 3OS1A 4Q0BA 4PY5A 3K5MA 4CI6A 3VGMA 3E9PA 1WNSA 3C94A 3UKUA 3E9OA 1K8KA 1Y64A 4JHDB 1BA1A 2P51A 1NGHA 4DQQA 3SUPA 3CCUN 1ITGA 4AHRA 5I9EB 3L0QA 1YT3A 3U3GA 2ATQA 2B6AA 4CEQA 4CGJA 4ISFA 3LAMA 4GV9A 1D9DA 5EY4A 2D4WA 2PY5A 4E72A 1NK7A 4CJ5A 4KHSA 2E6LA 3AA4A 4F2RA 2OANA 3DOLA 2E2OA 5AZJA 3NE6A 1QTMA 1RTJA 4WF9L 1B92A 3AA3A 1LW0A 3ZYYX 3EL2A 2QKKA 3OVNA 2YV0X 4KAZA 4JK7A 4CK3A 2PYJA 2O8DA 1EP4A 4JRPA 1RDUA 3ID8A 2HNZA 4JKHA 2D0PA 2IAJA 1NJIO 1T6CA 3T1YK 1UAXA 4Y0WA 2P1JA 3B8AX 5A2QO 2RN2A 3HP6A 5BPMA 1N8RO 3BF1A 4DMNA 4NCGA 2X6NA 4IZ9A 3I0RA 3LP3A 2GV9A 3SJJA 4M3WA 5HP1A 1XWLA 5DM7L 1N33K 2BDPA 1VSFA 3EKUA 4CZEA 4A2AA 5C25A 4KHWA 4PUOA 1RT4A 3OYFA 1VSIA 3NH2A 3WXMB 2HB5A 1D9FA 1BDGA 3PV8A 4CE9A 1KRPA 1C1CA 4RWTA 1S1WA 1U47A 1JXEA 2O8FB 3QEIA 1DTQA 4AHCA 4FW2A 4CEZA 4EZ6A 4KI4A 3CI5A 2F8TA 1RT3A 1EX4A 2FSKA 1T6DA 1TL3A 4I2PA 3P31A 1WUAA 3FFKB 4DV6K 5HBMA 3Q7BA 3THVA 4DQ8A 3A5NC 4WQ4C 1NGIA 4E89A 3MXMA 2UXCK 1T8EA 3V1RA 3K5NA 3O5BA 5E41A 3NF7A 2O8EA 4BRDA 1RTDA 3FZLA 4JN4A 3DM2A 4Z4IA 1BGXT 3QIPA 5AQHA 1TUYA 3V6DA 1JL2A 3PSIA 4AHUA 4BQZA 3AA5X 2P9NB 3AVCA 4X62K 3RMBA 5BN9A 3MEDA 1UA1A 3WNGA 4YOVA 2FBYA 4CGHA 3RR7A 4B1WB 1IJJA 1KQSM 1MA9B 1YITN 1TGOA 3DWLA 3MDQA 3ENOA 3QFPA 2WFBA 1C1AA 4O44A 4LFBK 1RBUA 2X6SA 1BWFO 1C0MA 3QEWA 3IUCA 2Z1IA 5GAGP 1G99A 1HQEA 2HHUA 3C6AA 4AHTA 4B9MA 4FK0A 3QDKA 2FF6A 4IJNA 1QQNA 3OYCA 4DTMA 2XO7A 3MN7A 3LDSA 4DSJA 3UIQA 4DF4A 3AO3A 4KTQA 1TKTA 3TAFA 3VQ5A 4IOAL 4BRFA 4B08A 1CLQA 3AVGA 3V1QA 3HRGA 3M8PA 4CZHA 4CF2A 1HPZA 1NK9A 4ISEA 3A8YA 4BG9A 2JGUA 4B9LA 4CGFA 4OKEA 4HTLA 5TKYA 2OPRA 5BREA 4DTRA 1NK8A 1NGDA 1Q18A 4LH5A 2QWLA 1IKYA 4PL7A 1TV6A 1SL2A 4E0DA 4DS4A 3HPOA 4NCBA 1DLOA 5F0XA 3DXMA 1J5EK 5CYQA 4A59A 2G8VA 1X9JA 3AO1A 3VTIA 4BC5A 3L4QA 4O8UA 3CCJN 2WC9A 3TARA 2HHIA 2YX6A 4BRPA 1R59O 3MCAB 3OBWA 3THWA 3VEVA 1GLCG 4A2BA 4GKKK 5C15A 3OS0A 4HCCA 1NK0A 4I9LA 1NK6A 4BRIA 3VQCA 1MWKA 5KQDA 3OYLA 1VSEA 3P39A 4BRQA 1D8YA 4I6MA 3CYMA 4FLXA 4JV5K 1S3XA 5JVHL 1HYSA 3VGLA 1L3SA 3O1BA 2Z1JA 3AAQA 3SAGA 4OVLA 2B5JA 3U6FA 4I7FA 1N5YA 4LC9B 1ZYQA 2Q0UA 2EX3A 2QWMA 3L2QA 2IIRA 5AZIB 1VQ6N 1K8AO 4ZTJA 1TYQB 2FBTA 2P9IB 4ELUA 3WXLA 2E20A 4UQGA 2IOCA 3U4LA 1ZBUA 4MO5A 4CZLA 3QO9A 3VERA 3L3UA 4OGCA 4JAXA 3RR8A 2F9TA 5GIPA 3I55N 3ZCMA 3QEXA 4FJMA 1S22A 3BY5A 1YI2N 1BUPA 5KQ8A 4N47A 1HR0K 3OYBA 4JK9A 5LMNK 2YNGA 3AVKA 3CCRN 4H0PA 4PKHA 3TPQA 2NNWA 3SQ1A 2O8BB 5SWMA 1KTQA 1LWEA 3M1FA 4RW8A 2J4RA 2KQ2A 4NXMK 4DR3K 3DRRA 3LDOA 4FJNA 3SYZA 1YF5L 4DQPA 4CESA 1JLEA 4O0IA 3A5MC 3QFUA 5JS2A 4BROA 4DTXA 1UWBA 1VQ7N 1JCFA 4KB0A 4CK2A 3QB0A 3LP1A 1JLQA 1S9EA 3AVLA 4C1NK 3U9DA 3GG4A 4FM2A 3SQ2A 5TKWA 3CC7N 4Y1DA 1I3AA 3N4PA 4FO0A 5LY3A 1EWRA 4J8FA 4LY7A 4CBUA 2VQEK 4KFBA 3MXIA 3RMCA 4LF6K 2QXFA 4OKKA 2P9NA 5EX5A 1C0FA 5GADP 2F8SA 3JXUA 4M3TA 1BOTO 2EWSA 1RT6A 4CIGA 3TAPA 2JLEA 4NYFA 1JJ2M 3FE1A 2E1ZA 3E9LA 1YUWA 4MDAA 4OPAA 3G4SN 1KC8O 4YORA 1R0AA 4F9OA 3CJ9A 1LAWA 4LFCK 1MWMA 2GUIA 4CBXA 4FM1A 4JI7K 2CGKA 3SQ4A 5ADXA 2HVHA 1HNIA 3O4NA 1X9WA 1XHXA 2YNHA 4M3YA 2JWKA 3VPZA 4TSXA 2P9UA 3VTHA 3SK3A 1V4TA 4F8RA 3U8XA 3EZ5A 1CZAN 4DFKA 2BE2A 1NKBA 2R7YA 2NRXA 4DF8A 5AQWA 3R8EA 4CD3A 1YHQN 2ZM6K 2W41A 3A5OC 1S5JA 3K9JA 4AQYK 3G25A 2Q3SA 4DHYA 4V19S 4X65K 2BGGA 3HM8A 4BE7B 4YNQA 4R79A 5JICA 2ZJPL 2UU9K 1CZ9A 3DOKA 3ITHA 4GV6A 4CF1A 5KI6A 4JS5A 1JLCA 4NCAA 2A1SA 3L2WA 1Q82O 1ZBHA 4CFBA 2O8CA 4DLGA 3JAMO 4PL8A 5AQMA 3ZSOA 1HKGA 3OY9A 1LAVA 4EIAA 2FLOA 1X9MA 3PO4A 1NKCA 4N41A 3VN5A 4AH9A 4JKAA 3KWIA 3LDPA 2XRIA 3AV9A 5BRHA 3DLKA 3FZFA 2D1KA 3NMUA 3R9PA 4K25A 4GY2B 3T1HK 3LANA 3H1QA 4IDHA 4FJJA 3LM2A 2D0BA 4KHPK 3J7AP 2Q1NA 2A42A 4LSLA 3PO5A 1VRTA 1YTUA 5HL7L 4BE2A 1Q81O 1IKXA 4JKEA 4M3RA 2PAVA 4DTOA 1U2VB 1RBSA 3QINA 1Q86O 1WLJA 3LM9A 4CZMA 3BUZB 3L8BA 5KPTA 3P5JA 3VA0A 3VESA 2IDOA 2B4JA 4FSVA 2BUPA 3EN9A 4AILC 1Q9XA 3DI6A 4CCHA 4F4KA 4G1QA 2V7ZA 1S9GA 5C0YA 4FJ5A 3O80A 1YVUA 4CFCA 1ATNA 4ZTFA 4BRKA 3O08A 3CFOA 4PA1A 1NGAA 3EY1A 1TVRA 2QWQA 2HF3A 4N56A 5LJVA 3LDNA 3V9WA 5C2DA 3VMFB 2QI2A 1X3MA 3LL3A 3MWTA 3DRPA 4B3RK 4Z0UA 4KO0A 3NVKA 2W6LA 1FKOA 2GBZA 3VEZA 3CQYA 2ASMA 4EHUA 3MX5A 1BL3A 3J7YP 3WXIA 4B3OA 1WSJA 4IFVA 1S6PA 1S1UA 1WSHA 3QEVA 5JLHA 2DFFA 1WB9A 1RDAA 1NJYA 1VSMA 4DV2K 3RMAA 4B3TK 1DGKN 3TSPA 1VQMN 4ID5A 2GWKA 1FXXA 2G8IA 3LP0A 2UUCK 4KPYA 3QETA 3TSUA 3IS9A 3QESA 2QA4N 4EZ9A 4J2DA 3IFRA 1LWCA 2ITGA 1OH5A 3VQQA 2NRWA 3HK2A 4CEFA 4HHTA 4BG8A 3JYTA 2NRTA 3CHWA 3ZT4A 1S1TA 4DSEA 1O1WA 1SS6A 3GBTA 4HTUA 3U3YA 2G8UA 3OYAA 1YJWN 4OO1J 3S9HA 1NGJA 3IG1A 1YJNN 4OKJA 4DG1A 3PIPL 2NRHA 3C6UA 3D0PA 3NHGA 3FR0A 2QXLA 2ZGYA 3F9KA 3RSEA 3T69A 2VWJA 3VF6A 4F3OA 4O8KA 5C12A 3DAWA 4BDYA 1VSDA 2P9SA 3HI0A 4IG0A 3I8DA 3TANA 4E1MA 3SQ0A 3VQ4A 4K43A 5FPDA 3ASMA 1QS4A 4CF8A 4H0TB 1VSKA 4IFYA 3AVIA 2ZD1A 3L4IA 1NWKA 1QSSA 1HPMA 1YTAA 3OHRA 4CJPA 5BR8K 4FLTA 2OZMA 4DKWA 1BISA 1U4BA 4JYAK 2HHHK 2OA8A 3ZSZA 4NLCA 3LDLA 5AQYA 3IRXA 3LP2A 5AFUH 4H5TA 1TL1A 3KD1E 5JENA 5E84A 1LWFA 1W2BM 4GVEA 3NGYA 1SUQA 1MU2A 1YIJN 2ZJRL 1KAYA 3V9SA 1NM1A 3D2FA 4DQIA 3BF3A 3V9XA 4JLHA 4B1YB 4EAHD 1TK5A 1E4FT 4NXNK 4BACA 1KAXA 4BE1A 3R6MA 4BVOA 2F9WA 3HM9A 1HNWK 5HRSA 3E1YA 4CECA 4CJUA 2WOMA 4Z4HA 1HRHA 3J80O 4LFAK 3HJFA 1T7PA 3SZ2A 1NJXA 1ZXOA 5IWAK 1XI1A 3MX2A 4KHQA 3PX4A 3AVMA 4LF9K 2NRRA 3JS6A 3O9QA 3ULEA 3M8SA 4CGIA 3HO1A 4CHZA 3VENA 2DFEA 3PY8A 1BCOA 2FSNA 4H4OA 3V81A 5J2QA 4O5FA 4LF8K 4CEOA 4Z4GA 2YJEA
chains in the Genus database with same CATH topology
2OTJN 4BRQA 4H5VA 4I6MA 4JKFA 3U9ZA 4WFAL 5GINA 1BU6O 1S3XA 5JVHL 2KLAA 5JMVA 3VGLA 3O1BA 4A61A 3AAQA 4JK8A 3SAGA 3PLAA 3CJAA 4WFBL 4BR2A 4H0XB 3AARA 2VGMA 2ZF5O 3UKRA 5AQRA 3SJHA 1T3VA 3C0BA 4CZIA 5M1KA 4YOXA 4PKIA 4LC9B 3J8AA 2QWOA 2ZJQL 1QQOA 2Q0UA 1VQPN 2GX9A 2QWMA 2P9KB 3R3LA 2IIRA 1NLVA 3TSQA 3O4WA 5AZIB 2CH5A 4BR0A 1VQ6N 3W3DA 4B1VA 1K8KB 4KBOA 4WQ5A 2P9LB 3HSCA 4H03B 4XH4A 1K8AO 4M7YA 3TU5A 3BEXA 1EQYA 1TYQB 4WQ4A 2P9IB 3VGKA 3SBTA 3WXLA 1HX1A 4MO4A 4JKDA 3D2EB 2E20A 3KZBA 4WCEL 4BREA 3U4LA 3C65A 4MO5A 1DT9A 4K42A 1HKBA 3ZEUB 3HZ6A 4CZLA 3H3NO 3VEOA 3VERA 4H5WA 4ILHA 3CERA 4IEEA 3CPWM 4JAXA 2F9TA 3O9RA 5GIPA 3CD6N 3I55N 1HUXA 4JKGB 1S22A 5FPMA 4H5RA 1BUPA 4BVPA 5KQ8A 1YI2N 1EO1A 4JK9A 1P90A 2GEMA 2Q0RA 3MWPA 3A0IX 3CCRN 3F2KA 3L6QA 4H0PA 4PKHA 2NNWA 5AQJA 1NGEA 1GLBG 3EO3A 3TPQA 2QEXN 1K73O 2FF3B 4KH5A 5C2FA 1WOQA 3AGRA 3M1FA 3H3OB 2J4RA 1LCUA 1W97L 3RVCA 1OVYA 1Z6RA 2Q31A 3UB5A 4FPBA 3VEWA 5H1SQ 3LDOA 1YF5L 2HBMA 3OW2M 5LJWA 4A57A 4WFNL 2Q36A 4C23A 4BEBA 3DJCA 4HWIA 3EE9A 3HOTA 3TTDA 2YHWA 3VF4A 3A5MC 3QFUA 4CJ7A 4BROA 1YJ9N 3HBTA 5F1XA 4CZJA 4IXCA 2NLXA 2QWNA 5AQSA 1M90O 1VQ7N 3HOSA 1NGCA 4PKGA 1JCFA 3P38A 2A3ZA 3O8MA 3QB0A 4IJAA 1GLJO 5AQLA 4C1NK 1KXPA 2VGNA 3U9DA 1S72N 4CZFA 4QS8A 3GG4A 2BTFA 5TKWA 3CC7N 5BRDA 5JLFA 3N4PA 4FO0A 4YOTA 2KHOA 4J8FA 4CBUA 5LY3A 4FWLA 4ILJA 5AQXA 1D4XA 4M63C 1NBWA 5KPRA 5AR0A 1VQ9N 2QM1A 4JKGA 3WT0A 1C0GA 2P9NA 4JD2B 5EX5A 4IO8A 1C0FA 4FPAA 3RSEB 4MLEA 3FLCO 5GADP 3QMLA 1XUPO 3JXUA 4KH6A 1BOTO 2EWSA 4BR4A 2A6AA 3GDQA 1JJ2M 1HJOA 2QW9A 3E66A 3FE1A 1ZC6A 2C1IA 1NMDA 3MN6A 4IOXA 1P8ZA 5AQFA 4XJXA 2E1ZA 3E9LA 1YUWA 4A5AA 4DCHA 4MDAA 4OPAA 3S41A 3IDHA 3G4SN 1QZ6A 1KC8O 3O1WA 1QHAA 2V52B 4YORA 4YOYA 3SMPA 4F9OA 2A5XA 3CJ9A 5M1NA 2CH6A 4BRMA 4NLBA 4YOUA 4FWRA 4UY8O 3CCSN 4CZKA 4QS7A 1QVGM 2ITMA 4DB3A 1MWMA 4CBXA 1KAZA 3ZETA 3KWGA 2GUPA 2I7NA 5CE3A 2CGLA 2FXUA 2CGKA 3ATUA 3IMXA 4H0VB 4CBWA 5ADXA 3CMEN 3ZX0A 2GWJA 2GTDA 2ZGZA 2JWKA 3VPZA 2P9UA 2YHYA 3MCPA 3CCLN 3VTHA 3J7ZO 4G9ZA 3P4IA 3R1XA 4YDUC 5M1PA 2HF4A 1BG3A 3SK3A 5CHIA 1V4TA 3EZWA 2RHKA 4NO7A 5AQPA 2ASOA 2NZTA 3U8XA 1CZAN 1U6ZA 3O9TA 3M6GA 2NRXA 4WYBA 2I7PA 4I6MB 4YDUA 5MLCQ 5AQWA 3R8EA 3UE5A 4CD3A 1YHQN 2KKZA 5DM6L 3SAFA 2W41A 3A5OC 3ATVA 3VEYA 3K9JA 2VCPA 5AQKA 3G25A 3WUHA 2D0OA 2P9IA 4DHYA 4E1JA 4U67L 3VOVA 1HKCA 2V51B 3H6EA 3HM8A 4BE7B 4JHDA 5AFUA 2P9LA 5M1OA 4FWKA 4JKCA 4AM7A 1ESVA 4R79A 5JICA 2ZJPL 3CCQN 1RGIA 3KHYA 5AZIA 4FWMA 4GV6A 2Q2RA 4OPHA 2E88A 1YXQA 2IVPA 3HTVA 1JCEA 1Z05A 2IVNA 3ZX2A 1Q82O 3F9MA 4IFEA 4IO9L 4PL8A 5AQMA 4CI6A 3VGMA 3E9PA 2IVOA 1NGBA 1GLAG 1HKGA 3FZKA 5BPLA 4EIAA 2FLOA 3ZETB 4A62A 3UKUA 3E9OA 2VWBA 4JKAA 1K8KA 1MDUB 3KWIA 3LDPA 1Y64A 3NVMA 4JHDB 5BRHA 1BA1A 3FZFA 5M1QA 1VQON 2D1KA 3NMUA 5AQGA 3R9PA 1NGHA 5FPNA 4K25A 3SMSA 3CCUN 3CIPA 4GY2B 5I9EB 3H1QA 4IDHA 3O9SA 4BR5A 3L0QA 3LM2A 3I8BA 4PHTX 2W40A 3MN9A 2WBNA 3TTCA 2PBDA 5AQIA 2Q1NA 3CCEN 2A42A 1JCGA 3WXKA 5EOYA 4ISFA 2GELA 3ZX3A 3M5RA 1E4GT 3F5TA 5HL7L 1Q81O 4JKEA 3D2FB 2PAVA 4GV9A 1U2VB 5EY4A 2D4WA 3SAHA 2E2PA 1Q86O 1XC3A 4BC3A 3LM9A 1NGFA 4CZMA 3SLCA 3BUZB 3CJ1A 3DXMB 5EXWA 4QS9A 3CF5L 1DEJA 1X3NA 3I56N 2WUSA 5KPTA 3KVGA 2DPNA 5GAHP 2OANA 3VESA 3H45C 3FZHA 1T44A 2E2OA 4FSVA 5AZJA 2BUPA 2HSTA 3EN9A 1SAZA 4BQLA 4WF9L 2CGJA 4FOIA 3ZYYX 3EL2A 2P9PA 1QVFM 4JK7A 1VQLN 3EKSA 4H0YB 2V7ZA 1RDUA 3ID8A 4BR9A 2H3GX 5C0YA 3O80A 4JKHA 3AAPA 2D0PA 1NJIO 1ATNA 1T6CA 4BRKA 3O08A 4Y0WA 3FGUA 3M3ZA 4B1UB 3B8AX 1NGAA 4JEPA 5CR4A 1VQKN 5AQVA 5BPMA 1N8RO 1ATSA 3BF1A 3CCVN 4AF1A 2QWQA 2HF3A 3Q7CA 4IZ9A 5LJVA 3LDNA 4H0OA 5C2DA 4JD2A 3VMFB 2QI2A 1X3MA 3C7NB 3LL3A 3MWTA 2QWRA 2YI1A 3A5LC 3VF2A 3G71N 4B1XB 1TUUA 3NVKA 5F2RA 5DM7L 1SQKA 3VEZA 2AA4A 3EKUA 4A2AA 3CQYA 2ASMA 2YHXA 3KK7A 4CZEA 4EHUA 3MX5A 4BRNA 4K41A 3WXIA 1K9MO 4L3QA 2UYTA 2NRZA 5JLHA 1ZBSA 1VQ4N 4ILGB 2Q97A 1YVNA 1DGKN 3G6EN 4XH5A 5AQOA 3TSPA 3WXMB 1M1KO 4XEIA 3D2EA 2GWKA 1BDGA 4U7BA 1VQMN 5FPEA 4BRCA 3AY9A 2P9UB 1ILYA 1TYQA 4RWTA 3TSUA 3CXCM 3CJ7A 3OA9A 4EFHA 3CCMN 1VQ5N 2QA4N 2HBJA 5GIOA 3IFRA 1RDWX 2YJFA 3CI5A 2FSJA 2NRWA 4IWVA 1HLUA 4BG8A 2NRTA 3CHWA 2P9KA 2FSKA 4B1ZA 3SBGA 5AQTA 4AM6A 1T6DA 2QTDA 1SS6A 2C1GA 3GL1A 3P31A 1WUAA 1BO5O 2E8AA 3FFKB 2W00A 3Q7BA 3GBTA 1BA0A 4DQ8A 3A5NC 4WQ4C 1NGIA 3WXJA 1YJWN 4OO1J 3O5BA 1H1VA 4WQ5C 2OTLN 1NGJA 4BRDA 3WEEA 3ID6A 1YJNN 3FZLA 1QQMA 5ELZA 4JN4A 3EE8A 3PIPL 5AQUA 2NRHA 3VETA 4FVUA 5AQHA 1TUYA 3FR0A 2QXLA 2ZGYA 4EHTA 5B8HA 2PFUA 4BC2A 4BQZA 3RSEA 3T69A 1XQSC 3VEXA 4C1NI 3VF6A 2P9NB 1VQNN 1OKJA 5M1FA 5BN9A 4O8KA 5JVGL 3C7NA 3H1VX 3DAWA 3QBWA 5C12A 2HMPA 4RCHA 1IG8A 3T7ZA 5BRFA 2P9SA 4FOEA 4Z94A 4YOVA 3HI0A 4YOWA 4B1WB 2HBLA 1IJJA 1KQSM 1MA9B 3ENBA 3DWLA 1ATRA 1YITN 4FWOA 3ULEB 3MDQA 3ENOA 3QFPA 4K43A 3DXKA 2WFBA 5FPDA 3MK6A 5ADXH 3WEEB 4H0TB 3PIOL 3CJCA 3O6WA 3WQTA 3CMAN 1DKGD 1BWFO 2RE2A 3IUCA 3L4IA 4MDBA 1NWKA 5GAGP 3MMVA 1HPMA 1G99A 4ISGA 3OHRA 3C6AA 3ZEUA 5AQZA 4DKWA 4BRGA 2A40A 2E2QA 2P9PB 4FWNA 3QDKA 2FF6A 3LDLA 4IEIA 4NLCA 1VQ8N 3D7EO 4BR7A 1KD1O 5AQYA 5GAEP 4IJNA 5AZJB 1QQNA 5BN8A 3H46O 5AFUH 3DXKB 4H5TA 3QICA 4FWPA 3MN7A 4JKBA 2JWLA 3W0LA 5E84A 1W2BM 1GLFO 4GVEA 4JNEA 4GV3A 2A41A 1YIJN 2BH1A 2AP1A 1GLEG 2ZJRL 1U2VA 1KAYA 4BC4A 3LDQA 4IOAL 4BRFA 1NM1A 2VYPA 3D2FA 1YAGA 2HOEA 3ENHA 3HRGA 4CZHA 4FWQA 1QZ5A 3BF3A 4ISEA 3CC4N 3A8YA 3GOIA 1O13A 1SZ2A 4B9QA 4B1YB 4BG9A 1J6ZA 4BGBA 4H5NA 4EAHD 5E26A 4CZGA 4BY9C 5HOOA 1E4FT 1V4SA 4HTLA 3CJBA 5TKYA 1KAXA 3CETA 5BREA 4IOCL 1NGDA 5BPNA 3R6MA 4BVOA 2F9WA 1Q18A 3DLLL 1RFQA 2QWLA 1GLDG 4CD1A 5AQQA 1GLLO 3QBXA 3E1YA 2E2NA 4PL7A 3UKUB 3CC2N 4NB4A 4FL9A 3I33A 4M7XA 5BR9A 2HBKA 3CQXA 5F0XA 3DXMA 1LOTB 2V7YA 1Q7YO 4A59A 1ZXOA 3N4QA 4FWSA 5AQNA 1X9JA 4RTFD 3VTIA 2YCHA 3C6HA 2ZWHA 3MX2A 4BC5A 3L4QA 4O8UA 3CCJN 3FZMA 2WC9A 3AGKA 3GE1A 3BP8A 3MN5A 2NRVA 2YX6A 3CPEA 1VAZA 4BGAA 4BRPA 1R59O 2NRRA 3MCAB 3O9UA 3OBWA 3UKRB 2E1YA 2QWPA 3JS6A 3VEVA 4BRLA 2F7TA 1GLCG 3OBYA 4A2BA 3O9QA 3WQUA 3ULEA 2ASPA 3IKMA 4A5BA 4GNIA 3TTFA 3VENA 1NGGA 4MLHA 5C15A 2P9SB 2FSNA 3D6RA 4KH4A 4BRAA 4BRIA 1MWKA 5KQDA 4O5FA 4XH1A 3K9KA 5C10A 4BECA 5KPZA 4BRHA 5EVZA 2YJEA 3P39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BRQ A;  4H5V A;  4I6M A;  3U9Z A;  1BU6 O;  1S3X A;  5JMV A;  3VGL A;  3O1B A;  4A61 A;  3AAQ A;  3CJA A;  4BR2 A;  4H0X B;  3AAR A;  2ZF5 O;  3UKR A;  5AQR A;  3SJH A;  4CZI A;  3C0B A;  4PKI A;  4LC9 B;  3J8A A;  2QWO A;  1QQO A;  2Q0U A;  2QWM A;  2P9K B;  2IIR A;  1NLV A;  3O4W A;  5AZI B;  2CH5 A;  4BR0 A;  3W3D A;  4B1V A;  1K8K B;  4KBO A;  4WQ5 A;  2P9L B;  3HSC A;  4H03 B;  4XH4 A;  4M7Y A;  3TU5 A;  3BEX A;  1EQY A;  1TYQ B;  4WQ4 A;  2P9I B;  3VGK A;  3WXL A;  1HX1 A;  4MO4 A;  3D2E B;  2E20 A;  3KZB A;  4BRE A;  3U4L A;  4MO5 A;  4K42 A;  1HKB A;  3ZEU B;  3HZ6 A;  4CZL A;  3H3N O;  3VEO A;  3VER A;  4H5W A;  3CER A;  4JAX A;  2F9T A;  1HUX A;  1S22 A;  5FPM A;  4H5R A;  1BUP A;  4BVP A;  5KQ8 A;  2Q0R A;  2GEM A;  3A0I X;  3L6Q A;  4H0P A;  4PKH A;  5AQJ A;  3TPQ A;  1NGE A;  1GLB G;  3EO3 A;  2FF3 B;  1WOQ A;  3M1F A;  3H3O B;  2J4R A;  1LCU A;  3VEW A;  1Z6R A;  2Q31 A;  3UB5 A;  4FPB A;  3LDO A;  5LJW A;  2Q36 A;  4C23 A;  3DJC A;  4HWI A;  2YHW A;  3VF4 A;  3A5M C;  3QFU A;  4CJ7 A;  4BRO A;  3HBT A;  5F1X A;  4CZJ A;  4IXC A;  2NLX A;  2QWN A;  5AQS A;  1NGC A;  4PKG A;  1JCF A;  2A3Z A;  3O8M A;  3QB0 A;  4IJA A;  1GLJ O;  5AQL A;  1KXP A;  3U9D A;  4CZF A;  4QS8 A;  3GG4 A;  2BTF A;  5BRD A;  5JLF A;  5LY3 A;  4FO0 A;  2KHO A;  4J8F A;  4CBU A;  4FWL A;  5AQX A;  1D4X A;  4M63 C;  1NBW A;  5KPR A;  5AR0 A;  2QM1 A;  3WT0 A;  1C0G A;  2P9N A;  4JD2 B;  5EX5 A;  4IO8 A;  1C0F A;  4FPA A;  3RSE B;  4MLE A;  3FLC O;  3QML A;  1XUP O;  3JXU A;  1BOT O;  2EWS A;  4BR4 A;  2A6A A;  3GDQ A;  1HJO A;  2QW9 A;  3FE1 A;  1ZC6 A;  1NMD A;  3MN6 A;  5AQF A;  1P8Z A;  2E1Z A;  1YUW A;  4DCH A;  3S41 A;  3IDH A;  1QZ6 A;  3O1W A;  1QHA A;  2V52 B;  3SMP A;  4F9O A;  2A5X A;  3CJ9 A;  2CH6 A;  4BRM A;  4FWR A;  4CZK A;  4QS7 A;  2ITM A;  4DB3 A;  1MWM A;  4CBX A;  1KAZ A;  3ZET A;  2GUP A;  2I7N A;  5CE3 A;  2CGL A;  2FXU A;  2CGK A;  3ATU A;  3IMX A;  4H0V B;  4CBW A;  5ADX A;  3ZX0 A;  2GWJ A;  2GTD A;  2ZGZ A;  3VPZ A;  2P9U A;  2YHY A;  3MCP A;  3P4I A;  4YDU C;  2HF4 A;  1BG3 A;  3SK3 A;  1V4T A;  3EZW A;  4NO7 A;  5AQP A;  2ASO A;  2NZT A;  3U8X A;  1CZA N;  1U6Z A;  3M6G A;  4WYB A;  2I7P A;  4I6M B;  4YDU A;  5AQW A;  3R8E A;  3UE5 A;  4CD3 A;  2W41 A;  3A5O C;  3ATV A;  3VEY A;  2VCP A;  5AQK A;  3G25 A;  3WUH A;  2D0O A;  2P9I A;  4DHY A;  4E1J A;  3VOV A;  1HKC A;  2V51 B;  3H6E A;  3HM8 A;  4JHD A;  5AFU A;  2P9L A;  4AM7 A;  4FWK A;  1ESV A;  5JIC A;  1RGI A;  3KHY A;  5AZI A;  4FWM A;  2Q2R A;  2E88 A;  1YXQ A;  2IVP A;  3HTV A;  1JCE A;  1Z05 A;  2IVN A;  3ZX2 A;  3F9M A;  4PL8 A;  5AQM A;  4CI6 A;  3VGM A;  2IVO A;  1NGB A;  1GLA G;  1HKG A;  3FZK A;  5BPL A;  4EIA A;  2FLO A;  3ZET B;  4A62 A;  3UKU A;  2VWB A;  1K8K A;  1MDU B;  3LDP A;  1Y64 A;  4JHD B;  5BRH A;  1BA1 A;  3FZF A;  2D1K A;  5AQG A;  3R9P A;  1NGH A;  5FPN A;  4K25 A;  3SMS A;  3CIP A;  4GY2 B;  5I9E B;  3H1Q A;  4BR5 A;  3L0Q A;  3LM2 A;  3I8B A;  2W40 A;  3MN9 A;  2PBD A;  5AQI A;  2Q1N A;  2A42 A;  1JCG A;  3WXK A;  5EOY A;  4ISF A;  2GEL A;  3ZX3 A;  1E4G T;  3D2F B;  2PAV A;  1U2V B;  5EY4 A;  2D4W A;  2E2P A;  1XC3 A;  4BC3 A;  3LM9 A;  1NGF A;  4CZM A;  3SLC A;  3BUZ B;  3CJ1 A;  3DXM B;  5EXW A;  4QS9 A;  1DEJ A;  1X3N A;  2WUS A;  5KPT A;  3KVG A;  2DPN A;  2OAN A;  3VES A;  3H45 C;  3FZH A;  1T44 A;  2E2O A;  4FSV A;  5AZJ A;  2BUP A;  3EN9 A;  4BQL A;  1SAZ A;  2CGJ A;  4FOI A;  3EL2 A;  2P9P A;  3EKS A;  4H0Y B;  2V7Z A;  4BR9 A;  3ID8 A;  2H3G X;  3O80 A;  3AAP A;  2D0P A;  1ATN A;  1T6C A;  4BRK A;  3O08 A;  4Y0W A;  3FGU A;  3M3Z A;  4B1U B;  3B8A X;  1NGA A;  5AQV A;  5BPM A;  1ATS A;  3BF1 A;  2QWQ A;  2HF3 A;  4IZ9 A;  5LJV A;  3LDN A;  4H0O A;  4JD2 A;  3C7N B;  1X3M A;  3LL3 A;  2QWR A;  2YI1 A;  3A5L C;  3VF2 A;  4B1X B;  1TUU A;  5F2R A;  1SQK A;  3VEZ A;  2AA4 A;  3EKU A;  4A2A A;  3CQY A;  2ASM A;  2YHX A;  4CZE A;  4EHU A;  4BRN A;  4K41 A;  3WXI A;  4L3Q A;  2UYT A;  5JLH A;  1ZBS A;  2Q97 A;  1YVN A;  1DGK N;  4XH5 A;  5AQO A;  4XEI A;  3D2E A;  2GWK A;  1BDG A;  5FPE A;  4BRC A;  3AY9 A;  2P9U B;  1TYQ A;  4RWT A;  3CJ7 A;  4EFH A;  3IFR A;  1RDW X;  2YJF A;  3CI5 A;  2FSJ A;  4IWV A;  1HLU A;  4BG8 A;  3CHW A;  2P9K A;  2FSK A;  4B1Z A;  5AQT A;  4AM6 A;  1T6D A;  3GL1 A;  1WUA A;  1BO5 O;  2E8A A;  3FFK B;  3GBT A;  1BA0 A;  4DQ8 A;  3A5N C;  4WQ4 C;  1NGI A;  3WXJ A;  3O5B A;  1H1V A;  4WQ5 C;  1NGJ A;  4BRD A;  3WEE A;  3FZL A;  1QQM A;  5ELZ A;  4JN4 A;  5AQU A;  2NRH A;  3VET A;  5AQH A;  1TUY A;  3FR0 A;  2QXL A;  2ZGY A;  4EHT A;  5B8H A;  4BQZ A;  4BC2 A;  3RSE A;  1XQS C;  3VEX A;  3VF6 A;  2P9N B;  1OKJ A;  5BN9 A;  4O8K A;  3C7N A;  3H1V X;  3DAW A;  3QBW A;  2HMP A;  4RCH A;  1IG8 A;  5BRF A;  2P9S A;  4FOE A;  4Z94 A;  3HI0 A;  4B1W B;  1IJJ A;  1MA9 B;  3DWL A;  1ATR A;  4FWO A;  3ULE B;  3MDQ A;  3ENO A;  3QFP A;  4K43 A;  3DXK A;  5FPD A;  3MK6 A;  5ADX H;  3WEE B;  4H0T B;  3CJC A;  3O6W A;  3WQT A;  1DKG D;  1BWF O;  3IUC A;  3L4I A;  1NWK A;  3MMV A;  1HPM A;  1G99 A;  4ISG A;  3OHR A;  3ZEU A;  5AQZ A;  4BRG A;  2A40 A;  2E2Q A;  2P9P B;  4FWN A;  3QDK A;  2FF6 A;  3LDL A;  3D7E O;  4BR7 A;  5AQY A;  4IJN A;  5AZJ B;  1QQN A;  5BN8 A;  3H46 O;  5AFU H;  3DXK B;  4H5T A;  3QIC A;  4FWP A;  3MN7 A;  3W0L A;  5E84 A;  1GLF O;  4JNE A;  2A41 A;  2AP1 A;  1GLE G;  1U2V A;  1KAY A;  4BC4 A;  3LDQ A;  4BRF A;  1NM1 A;  2VYP A;  3D2F A;  1YAG A;  2HOE A;  3ENH A;  4CZH A;  4FWQ A;  1QZ5 A;  3BF3 A;  4ISE A;  3A8Y A;  3GOI A;  1SZ2 A;  4B9Q A;  4B1Y B;  4BG9 A;  1J6Z A;  4BGB A;  4H5N A;  4EAH D;  5E26 A;  4CZG A;  1E4F T;  1V4S A;  4HTL A;  3CJB A;  5TKY A;  1KAX A;  3CET A;  5BRE A;  1NGD A;  5BPN A;  3R6M A;  4BVO A;  2F9W A;  1Q18 A;  1RFQ A;  2QWL A;  1GLD G;  4CD1 A;  5AQQ A;  1GLL O;  3QBX A;  2E2N A;  4PL7 A;  3UKU B;  4NB4 A;  4FL9 A;  3I33 A;  4M7X A;  5BR9 A;  3CQX A;  5F0X A;  3DXM A;  1LOT B;  2V7Y A;  1ZXO A;  4FWS A;  5AQN A;  1X9J A;  4RTF D;  2YCH A;  2ZWH A;  4BC5 A;  3FZM A;  3GE1 A;  3BP8 A;  3MN5 A;  4BGA A;  4BRP A;  1R59 O;  3UKR B;  2E1Y A;  2QWP A;  3JS6 A;  3VEV A;  4BRL A;  1GLC G;  4A2B A;  3WQU A;  3ULE A;  2ASP A;  4GNI A;  3VEN A;  1NGG A;  4MLH A;  2P9S B;  2FSN A;  4BRA A;  4BRI A;  1MWK A;  5KQD A;  4O5F A;  4XH1 A;  5KPZ A;  4BRH A;  5EVZ A;  2YJE A; 
#chains in the Genus database with same CATH topology
 1ZBF A;  3U9Z A;  5GIN A;  1EKE A;  2KLA A;  2FBX A;  3DRS A;  1RBR A;  4DSK A;  3NF6 A;  5AQR A;  3SJH A;  3S3O A;  1T3V A;  3C0B A;  2UXD K;  2QWO A;  1RCH A;  2ZJQ L;  1T05 A;  1VQP N;  4FJK A;  4FXD A;  2P9K B;  2A1R A;  4HCB A;  3AVH A;  4BR0 A;  3W3D A;  1KVA A;  1K8K B;  4XIU A;  1I94 K;  2O4G A;  4OGE A;  3SUQ A;  4QCL A;  2HW3 A;  4E7J A;  3HSC A;  4H03 B;  4XH4 A;  2HHX A;  4FJH A;  3HVR A;  1TK8 A;  3VGK A;  3SBT A;  1BI4 B;  1XMO K;  5LMU K;  1HX1 A;  2OYQ A;  4PWD A;  4WCE L;  3ZEU B;  4LH4 A;  3SPY A;  1QSY A;  3OYK A;  3SV3 A;  4DR2 K;  3O9R A;  4CJL A;  4KKO A;  1BIZ A;  3LAK A;  1S1V A;  5FPM A;  4BVP A;  3LZI A;  3OYM A;  1HNZ K;  1RDB A;  1EO1 A;  3QNN A;  3RRG A;  1P90 A;  2GEM A;  2Q0R A;  3MWP A;  3L6Q A;  3OYE A;  2QEX N;  1NGE A;  3TWH A;  3EO3 A;  4FJ9 A;  4KH5 A;  5C2F A;  1WOQ A;  3ZSV A;  4DR1 K;  3DLE A;  1OVY A;  1Z6R A;  3MAQ A;  2Y1J A;  2HBM A;  4B9U A;  3NFA A;  1EXQ A;  3DLB A;  4A57 A;  4F2S A;  4C23 A;  4CER A;  3NH1 A;  3LWM A;  1S6Q A;  3THY A;  3KLI A;  2OPP A;  3EE9 A;  4CHQ A;  3TTD A;  5HLF A;  1NG9 A;  2F4V K;  3M8R A;  4CZJ A;  2ZQB A;  1BIU A;  2LSN A;  5AQS A;  1M90 O;  4CHO A;  1Z26 A;  3HOS A;  3P38 A;  2A3Z A;  1GLJ O;  3NH0 A;  1S72 N;  2YNI A;  4CGG A;  1WBB A;  4FK4 A;  5AJ3 K;  5BRD A;  3ZLJ A;  3THX A;  1GOC A;  4KRE A;  4ILJ A;  3AVJ A;  4M63 C;  1S1X A;  1VQ9 N;  3QML A;  4Y1C A;  4DFP A;  3S3M A;  1IKW A;  4BR4 A;  2C1I A;  1JLB A;  1ZC6 A;  1NMD A;  3MN6 A;  4MQ3 A;  5AQF A;  2PZS A;  4DCH A;  2O8E B;  4FYD A;  3ZT0 A;  3IDH A;  1QZ6 A;  3O1W A;  4CFD A;  4JI5 K;  5J2P A;  3SMP A;  2A5X A;  5M1N A;  2KFN A;  3BZC A;  3IAY A;  4DV5 K;  1ASU A;  2HNY A;  3RTV A;  1L3V A;  2I7N A;  4E7H A;  1KSP A;  2CGL A;  3LZJ A;  3IMX A;  1KVB A;  3ATU A;  3TAB A;  4ZHR A;  2O8C B;  4CJW A;  2YHY A;  3CCL N;  4C8L A;  1NOY A;  4JI8 K;  1L3T A;  5M1P A;  1BG3 A;  3SUN A;  1QQC A;  4B9V A;  4NO7 A;  1KFD A;  2ASO A;  4E3S A;  1E3M A;  1KCF A;  1U6Z A;  3O9T A;  4J2A A;  2I7P A;  4I6M B;  4JI3 K;  1U45 A;  5DM6 L;  3SAF A;  4OLA A;  3VEY A;  4U67 L;  2E4L A;  1W7A A;  1HKC A;  4N5S A;  4IBN A;  2YHB A;  5AFU A;  5M1O A;  4AM7 A;  3TI0 A;  1JLA A;  4DQS A;  1RGI A;  5AZI A;  3TAE A;  1VK0 A;  1VSJ A;  2Q2R A;  4OX9 K;  2D0A A;  1YXQ A;  2IVP A;  1JCE A;  1Z05 A;  2ETJ A;  2G8W A;  4M3U A;  4DTU A;  3F9M A;  4IFE A;  4BE0 A;  4J2B A;  3JSM A;  5J2M A;  4ID1 A;  3K58 A;  2IVO A;  1NGB A;  3NGI A;  3FZK A;  4CEE A;  5BPL A;  4A62 A;  2YKN A;  4M3Z A;  2VWB A;  1JLG A;  2NUB A;  2YKM A;  5M1Q A;  4CJS A;  4CW7 B;  4BR5 A;  1CZB A;  3SI6 A;  4PHT X;  2W40 A;  3TTC A;  1QE1 A;  2PBD A;  4DUY K;  1JCG A;  4JRQ A;  1SV5 A;  3FFI A;  3F5T A;  4AHS A;  5HRO A;  4E19 A;  3D2F B;  3ZSQ A;  3SAH A;  2E2P A;  4M41 A;  3EYZ A;  1XC3 A;  4BC3 A;  3T19 A;  4YHH K;  3HST B;  3VA3 A;  3CF5 L;  3CJ1 A;  3DXM B;  5EXW A;  4CJF A;  4H8K A;  4B9N A;  1DEJ A;  1X3N A;  3QNO A;  1N34 K;  4K0K K;  5GAH P;  3TAM A;  3FZH A;  4I9Q A;  4FOI A;  4KRF A;  3KLF A;  1VQL N;  4IDK A;  3VQ7 A;  1GOA A;  4BR9 A;  2HHS A;  4BDZ A;  4JI4 K;  3KK2 A;  4W5N A;  4ELV A;  3FGU A;  1VRU A;  1D5A A;  3KLE A;  4B3S K;  5AQV A;  1ATS A;  3CCV N;  4AF1 A;  3Q7C A;  4QOZ B;  1WSG A;  5HRP A;  4CJT A;  4H0O A;  1RDD A;  2KW4 A;  2YI1 A;  3OYN A;  4B1X B;  1TUU A;  5F2R A;  3EEQ A;  1HQU A;  1SL1 A;  2UXB K;  3B6O A;  3KK7 A;  4I2Q A;  4BRN A;  4K41 A;  4N76 A;  5DMR A;  3HXM A;  3V1O A;  4KHY A;  4H4M A;  1ZBS A;  5FDL A;  1YVN A;  3AVA A;  3G6E N;  5AQO A;  3HPG A;  1M1K O;  3D2E A;  4U7B A;  3THY B;  4BRC A;  3AY9 A;  3KKS A;  2P9U B;  1KVC A;  1TYQ A;  2RF2 A;  3OA9 A;  4CEB A;  1VQ5 N;  2HBJ A;  1RDW X;  2YJF A;  4DTN A;  2D0C A;  2P9K A;  5AQT A;  2QTD A;  1BO5 O;  3G10 A;  2W00 A;  1BA0 A;  2UUB K;  1WSE A;  2IS3 A;  4B8C A;  3OYJ A;  4FLV A;  1REV A;  4DV7 K;  3WEE A;  5KTQ A;  3OS2 A;  4DR4 K;  5ELZ A;  3C95 A;  3EE8 A;  5AQU A;  3VET A;  4EHT A;  2Y1I A;  5B8H A;  3VQE A;  3VEX A;  5JS1 A;  5M1F A;  3C7N A;  3H1V X;  3QBW A;  4CEA A;  4FOE A;  3HPH A;  5C24 A;  2HBL A;  1ATR A;  4FWO A;  1X1P A;  3WNF A;  5ADX H;  1LW2 A;  3O6W A;  2KZM A;  1T03 A;  2RE2 A;  4MDB A;  2VG5 A;  3MMV A;  3SPZ A;  4CJR A;  4M3X A;  4JI2 K;  4M42 A;  4O0J A;  4KTW A;  3OYD A;  2E2Q A;  4DU3 A;  4FJ7 A;  2WON A;  4M45 A;  5AZJ B;  4MFB A;  5BN8 A;  4X66 K;  3DXK B;  5FRN A;  3W0L A;  3AO4 A;  3MEE A;  3K59 A;  1GLF O;  1ZBL A;  4JNE A;  4GV3 A;  2A41 A;  1U2V A;  4BC4 A;  3LDQ A;  3KLG A;  2VYP A;  1YAG A;  3ENH A;  3L3V A;  3DLG A;  4E7I A;  4FWQ A;  4C8N A;  1QZ5 A;  3CC4 N;  3LPT A;  3GOI A;  1O13 A;  3ZSR A;  1X9S A;  1N36 K;  3THW B;  3I0S A;  4H5N A;  5E26 A;  1V4S A;  2RPI A;  3CET A;  4IOC L;  3VQA A;  4DUZ K;  5CZ1 A;  3DLL L;  1GLD G;  4CD1 A;  1J9A A;  5AQQ A;  1GLL O;  3KK3 A;  1JKH A;  4NB4 A;  4FL9 A;  3I33 A;  5BR9 A;  2P5O A;  2HBK A;  2HHT A;  5LL6 Z;  1LOT B;  4EP5 A;  1Q7Y O;  1A5V A;  5EU7 A;  4FWS A;  4HUF A;  2YCH A;  3C6H A;  2VG6 A;  4CJ4 A;  4JS4 A;  4OPK A;  1DTT A;  3BP8 A;  2AJQ A;  3CPE A;  1VAZ A;  2HMI A;  4BGA A;  3CFP A;  3O9U A;  2W6K A;  3UKR B;  2E1Y A;  3AVF A;  4KB1 A;  1C0U A;  5DK5 A;  2ASP A;  3IKM A;  3ZSY A;  1UOC A;  4A5B A;  4GNI A;  5HRN A;  1HMV A;  4MLH A;  1FJG K;  2P9S B;  1J5O A;  4KH4 A;  3A2F A;  2KZZ A;  4BEC A;  4OJR A;  5KPZ A;  1TKD A;  1WAF A;  1A5W A;  4CF9 A;  3VEW A;  2OTJ N;  4JKF A;  3AO2 A;  1BU6 O;  3HP9 A;  3PLA A;  3T1A A;  4WFB L;  4LF5 K;  4BR2 A;  4H0X B;  3AAR A;  4DR6 K;  2VGM A;  4KV8 A;  4CZI A;  5M1K A;  4YOX A;  4PKI A;  2BAN A;  3J8A A;  1L3U A;  3L2U A;  1VHX A;  1BHL A;  2ZE2 A;  4CHP A;  3R3L A;  3ISN C;  4CFA A;  3O4W A;  2CH5 A;  4LSN A;  4X64 K;  1OH6 A;  4B1V A;  4KBO A;  2P9L B;  2OPS A;  4ELT A;  3TU5 A;  3BEX A;  1EQY A;  4WQ4 A;  4JKD A;  3KZB A;  2XY5 A;  4BRE A;  3J81 O;  1Q9Y A;  1U04 A;  3C65 A;  1DT9 A;  4K42 A;  4W5T A;  3HZ6 A;  3VEO A;  3CER A;  1HNV A;  3NDK A;  1CXQ A;  5FRM A;  1HUX A;  4JKG B;  4R5P A;  4H5R A;  4FJ8 A;  4DS5 A;  3AVB A;  3F2K A;  3KD5 E;  5AQJ A;  4E7K A;  1K73 O;  4FVM A;  3AGR A;  5K14 A;  3H3O B;  2F96 A;  1LCU A;  3RVC A;  3ZT1 A;  1IKV A;  4FPB A;  5KRT A;  4CHY A;  3OW2 M;  3OYI A;  4CIF A;  3L2V A;  1U48 A;  4WFN L;  2Q36 A;  1ASV A;  4HWI A;  3HOT A;  2YHW A;  3VF4 A;  1YJ9 N;  3CM5 A;  3HBT A;  4FJG A;  4FLY A;  4IXC A;  1KFS A;  2NLX A;  2QWN A;  5T7B A;  3VQP A;  1NGC A;  4PKG A;  3O8M A;  4IJA A;  5HRR A;  1NJW A;  5AQL A;  2XY6 A;  3LWL A;  1KXP A;  2VGN A;  4FZY A;  4CZF A;  3DYA A;  2O8B A;  2BTF A;  5JLF A;  1CXU A;  4YOT A;  2KHO A;  5AQX A;  2FC0 A;  5KPR A;  5AR0 A;  1C0G A;  3P83 D;  4IO8 A;  3RSE B;  4MLE A;  3FLC O;  1VSH A;  1B9D A;  2A6A A;  1RIL A;  1HJO A;  3E66 A;  1P8Z A;  5CY4 A;  4Z4C A;  4LD0 A;  4A5A A;  4K8X A;  2VQF K;  1QHA A;  2V52 B;  2OPQ A;  1NNE A;  4CJK A;  2CH6 A;  4BRM A;  3RWU A;  4NLB A;  2E5L K;  4FWR A;  3F73 A;  1Y97 A;  4CZK A;  4QS7 A;  1QVG M;  1XNR K;  3HT3 A;  3KWG A;  4IKF A;  1EET A;  5CE3 A;  4B3M K;  2FXU A;  4H0V B;  2Z1H A;  3ZX0 A;  2GWJ A;  4DR7 K;  2ZGZ A;  5I3U A;  4FK2 A;  4C8K A;  2P5G A;  1WAJ A;  3R1X A;  4YDU C;  5CHI A;  4KHU A;  3EZW A;  2RHK A;  2PYL A;  4FLU A;  1WSI A;  3HL8 A;  4WYB A;  4YDU A;  4KHN A;  5MLC Q;  3UE5 A;  4AHV A;  1NJZ A;  3ATV A;  4J2E A;  2DTU A;  5AQK A;  3PSF A;  3OYG A;  3WUH A;  2D0O A;  1WN7 A;  2P9I A;  5J1E A;  3VOV A;  4JHD A;  4DR5 K;  4DTJ A;  1BCM A;  2P9L A;  4FWK A;  4JKC A;  4E1N A;  1ESV A;  3KK1 A;  2KFZ A;  3CCQ N;  3M8Q A;  3PX0 A;  1SKS A;  4FWM A;  4DFM A;  2E88 A;  3HTV A;  1C0T A;  3K2P A;  4FLW A;  1RBV A;  3O3F A;  3LPU A;  4IO9 L;  4FJL A;  3AO5 A;  1BI4 A;  4IG3 A;  4GVM A;  2HHW A;  1GLA G;  1OH7 A;  2W42 A;  4CHN A;  1LV5 A;  3ZET B;  1J53 A;  1IBK K;  1MDU B;  1N6Q A;  3NVM A;  4Q5V A;  2VG7 A;  4LF7 K;  1VQO N;  3NBP A;  4GW6 A;  4B9T A;  5AQG A;  5FPN A;  3SMS A;  1IG9 A;  3CIP A;  3O9S A;  1NKE A;  3I8B A;  1K6Y A;  1TKX A;  3MN9 A;  2WBN A;  3O3G A;  1JL1 A;  5AQI A;  3CCE N;  3WXK A;  5EOY A;  2G8K A;  4RW7 A;  2GEL A;  3ZX3 A;  3M5R A;  1E4G T;  1KLN A;  1IH7 A;  2OZS A;  1TAU A;  2E6M A;  1NGF A;  3SLC A;  1FK9 A;  4QS9 A;  2YHA A;  3I56 N;  2WUS A;  3KVG A;  2DPN A;  3H45 C;  1T44 A;  2HST A;  4BQL A;  1SAZ A;  4DFJ A;  2CGJ A;  4C8M A;  1BQM A;  3T3F A;  2P9P A;  1XHZ A;  4DTP A;  1QVF M;  4Z4E A;  4FW1 A;  1N32 K;  3EKS A;  4H0Y B;  3NF9 A;  2H3G X;  1RTI A;  3DMJ A;  4C8O A;  4FZZ A;  4DV0 K;  3AAP A;  3KIO A;  5D3G A;  1NU0 A;  3DLR A;  1IO2 A;  3V9U A;  4B1U B;  3M3Z A;  5CR4 A;  4JEP A;  1NK5 A;  1VQK N;  3K0S A;  1W9H A;  3TAQ A;  1HYV A;  4JD2 A;  3C7N B;  2QWR A;  3A5L C;  3VF2 A;  1RT1 A;  2HND A;  3MEG A;  3G71 N;  4FJX A;  1SQK A;  1A5X A;  4BWM A;  1HYZ A;  2AA4 A;  3P1G A;  2YHX A;  3QER A;  1K9M O;  4L3Q A;  3CM6 A;  4CGD A;  2UYT A;  2NRZ A;  1VQ4 N;  4HVJ A;  4ILG B;  2Q97 A;  2DY4 A;  4XH5 A;  4CK1 A;  3VQ6 A;  2X74 A;  1JXB A;  4XEI A;  5FPE A;  1ILY A;  5CYM A;  1G15 A;  3ZT2 A;  4CED A;  3CJ7 A;  3CXC M;  4EFH A;  3CCM N;  4GMJ B;  5GIO A;  1TKZ A;  2FSJ A;  3MEC A;  4IWV A;  1RBT A;  4B8A B;  1HLU A;  3S3N A;  4RW6 A;  4B1Z A;  3SBG A;  4AM6 A;  4PQU A;  2C1G A;  2QK9 A;  3GL1 A;  2E8A A;  1UA0 A;  3ZSW A;  1XMQ K;  3RMD A;  3WXJ A;  3SCX A;  1H1V A;  4WQ5 C;  2OTL N;  1WBD A;  1GOB A;  3ID6 A;  4QAG A;  1U49 A;  4E7L A;  1QQM A;  3ZSX A;  3PX6 A;  3VQ9 A;  4FVU A;  1HNX K;  2PFU A;  4BC2 A;  2G8H A;  4C1N I;  1XQS C;  1VQN N;  2I5J A;  1OKJ A;  3B6P A;  4JI1 K;  5JVG L;  3ZT3 A;  2HMP A;  4RCH A;  1IG8 A;  3T7Z A;  5BRF A;  1RT7 A;  3THX B;  1W0H A;  4Z94 A;  4YOW A;  3ENB A;  3ULE B;  1TAQ A;  3DXK A;  3MK6 A;  3WEE B;  3PIO L;  3CJC A;  4O55 A;  3WQT A;  3CMA N;  1DKG D;  3H08 A;  4ISG A;  3ZEU A;  3V4I A;  1JLF A;  5AQZ A;  2HHQ A;  5FLX O;  1C1B A;  2O8D B;  4FZX C;  4BRG A;  2A40 A;  2P9P B;  4FWN A;  1NOZ A;  1VQ8 N;  4IEI A;  1B9F A;  3D7E O;  4BR7 A;  1KD1 O;  5GAE P;  4DLE A;  3H46 O;  3QIC A;  4O5B A;  3AVN A;  4W5O A;  4FWP A;  2O8F A;  4JKB A;  1SKW A;  2XHB A;  2JWL A;  3CYG A;  4WE1 A;  3O4Q A;  1F21 A;  2BH1 A;  2AP1 A;  1GLE G;  4DSL A;  3TR8 A;  4JI0 K;  2HOE A;  3PUF A;  3KTQ A;  2D5R A;  1WSF A;  1Q8I A;  2OCE A;  1SZ2 A;  4B9Q A;  2HHV A;  1J6Z A;  4BGB A;  3NAE A;  4CZG A;  4BY9 C;  4O4G A;  1XC9 A;  5HOO A;  5KRS A;  3WNH A;  3CJB A;  4FJI A;  3CFR A;  4DQR A;  5BPN A;  1RFQ A;  3QBX A;  2E2N A;  3UKU B;  4EP4 A;  3CC2 N;  4M7X A;  5I42 A;  2KTQ A;  4DWI A;  3CQX A;  2V7Y A;  3N4Q A;  5AQN A;  3OYH A;  4RTF D;  2ZWH A;  3D45 A;  3FZM A;  1L5U A;  3AGK A;  3GE1 A;  3OTO K;  3MN5 A;  2NRV A;  2QWP A;  4BRL A;  2F7T A;  3OBY A;  3WQU A;  3BGR A;  2VWK A;  3TTF A;  1NGG A;  2RKI A;  4GKJ K;  4BRA A;  3D6R A;  5FRO A;  4XH1 A;  3K9K A;  5C10 A;  3ALY A;  4BRH A;  5EVZ A;  3RRH A;  4H5V A;  2YNF A;  4WFA L;  3AA2 A;  3HVT A;  5JMV A;  3SV4 A;  1I39 A;  4A61 A;  4JK8 A;  3CJA A;  5J2N A;  4KI6 A;  3QLH A;  2ZF5 O;  3UKR A;  4YFU A;  3CG7 A;  1QQO A;  2GX9 A;  3E01 A;  4CJ3 A;  2FBV A;  1FW6 A;  3K5O A;  1NLV A;  3TSQ A;  5SZT A;  1BQN A;  4CJE A;  4LF4 K;  2Z1G A;  4WQ5 A;  4DTS A;  4M7Y A;  3HYF A;  3SUO A;  4BDP A;  1NMN A;  4CF0 A;  4MO4 A;  3D2E B;  4KTZ A;  4DU4 A;  3OJS A;  1HKB A;  3BZK A;  3H3N O;  1Z25 A;  4H5W A;  4ILH A;  4IEE A;  3CPW M;  1QHT A;  3L2R A;  1IBM K;  2XY7 A;  4DV1 K;  3A0I X;  5KGW A;  1GLB G;  1J54 A;  3KLH A;  2FF3 B;  4DSF A;  1RDC A;  4CJV A;  2WTU A;  3NGZ A;  1W97 L;  3UB5 A;  2Q31 A;  1RT5 A;  5H1S Q;  4DSI A;  4Z4F A;  4JI6 K;  2G8F A;  4CJQ A;  3SNN A;  3KKR A;  5LJW A;  2O4I A;  2IGI A;  4FCY A;  4YY3 K;  4DV4 K;  5KGX A;  4BEB A;  4RG8 A;  3DJC A;  5C42 A;  2EHG A;  3LAL A;  3G0Z A;  1FKP A;  4CJ7 A;  5F1X A;  5IT9 O;  4OLB A;  3NCI A;  2XY8 A;  3DLH A;  4K8Z A;  3V9Z A;  1SL0 A;  4RW9 A;  3K5L A;  1QSL A;  4B9S A;  4QS8 A;  2DFH A;  1IV0 A;  4FWL A;  3VQD A;  1D4X A;  1NBW A;  3CD6 N;  2QM1 A;  1VSL A;  4JKG A;  3WT0 A;  4JD2 B;  3O3H A;  4FPA A;  1XUP O;  3VQB A;  1HJR A;  4KH6 A;  2UUA K;  3GDQ A;  2QW9 A;  4IOX A;  4XJX A;  3S41 A;  3ULD A;  4YOY A;  1OH8 A;  1NK4 A;  1XNQ K;  4CVN E;  4YOU A;  3VQ8 A;  4L8R B;  4UY8 O;  4BWJ A;  3C6T A;  3CCS N;  2ITM A;  4DB3 A;  2HVI A;  4ICL A;  1KAZ A;  3ZET A;  3S5T A;  2IC3 A;  2GUP A;  4F3T A;  3QEP A;  4W5Q A;  4CBW A;  3QIO A;  3CME N;  4OPJ A;  3OJU A;  3NF8 A;  1IBL K;  2GTD A;  4FLZ A;  1TK0 A;  3MCP A;  3J7Z O;  4G9Z A;  3P4I A;  2HF4 A;  5AQP A;  5CZ2 A;  2NZT A;  4DV3 K;  3M6G A;  2KKZ A;  3K57 A;  1RT2 A;  4FM0 A;  3TAG A;  4HUE A;  3CQ8 A;  1RTH A;  2VCP A;  4DU1 A;  4E1J A;  3BDP A;  1EWQ A;  2V51 B;  3H6E A;  1KLM A;  4NYN A;  3MXJ A;  3WNE A;  4RW4 A;  4HUG A;  1SKR A;  4CIE A;  1ASW A;  1ZBI A;  3KHY A;  1C6V A;  4OPH A;  3KJV A;  2QKB A;  2X78 A;  3ZX2 A;  1RNH A;  2IVN A;  1OVQ A;  4W5R A;  3OS1 A;  4Q0B A;  4PY5 A;  3K5M A;  4CI6 A;  3VGM A;  3E9P A;  1WNS A;  3C94 A;  3UKU A;  3E9O A;  1K8K A;  1Y64 A;  4JHD B;  1BA1 A;  2P51 A;  1NGH A;  4DQQ A;  3SUP A;  3CCU N;  1ITG A;  4AHR A;  5I9E B;  3L0Q A;  1YT3 A;  3U3G A;  2ATQ A;  2B6A A;  4CEQ A;  4CGJ A;  4ISF A;  3LAM A;  4GV9 A;  1D9D A;  5EY4 A;  2D4W A;  2PY5 A;  4E72 A;  1NK7 A;  4CJ5 A;  4KHS A;  2E6L A;  3AA4 A;  4F2R A;  2OAN A;  3DOL A;  2E2O A;  5AZJ A;  3NE6 A;  1QTM A;  1RTJ A;  4WF9 L;  1B92 A;  3AA3 A;  1LW0 A;  3ZYY X;  3EL2 A;  2QKK A;  3OVN A;  2YV0 X;  4KAZ A;  4JK7 A;  4CK3 A;  2PYJ A;  2O8D A;  1EP4 A;  4JRP A;  1RDU A;  3ID8 A;  2HNZ A;  4JKH A;  2D0P A;  2IAJ A;  1NJI O;  1T6C A;  3T1Y K;  1UAX A;  4Y0W A;  2P1J A;  3B8A X;  5A2Q O;  2RN2 A;  3HP6 A;  5BPM A;  1N8R O;  3BF1 A;  4DMN A;  4NCG A;  2X6N A;  4IZ9 A;  3I0R A;  3LP3 A;  2GV9 A;  3SJJ A;  4M3W A;  5HP1 A;  1XWL A;  5DM7 L;  1N33 K;  2BDP A;  1VSF A;  3EKU A;  4CZE A;  4A2A A;  5C25 A;  4KHW A;  4PUO A;  1RT4 A;  3OYF A;  1VSI A;  3NH2 A;  3WXM B;  2HB5 A;  1D9F A;  1BDG A;  3PV8 A;  4CE9 A;  1KRP A;  1C1C A;  4RWT A;  1S1W A;  1U47 A;  1JXE A;  2O8F B;  3QEI A;  1DTQ A;  4AHC A;  4FW2 A;  4CEZ A;  4EZ6 A;  4KI4 A;  3CI5 A;  2F8T A;  1RT3 A;  1EX4 A;  2FSK A;  1T6D A;  1TL3 A;  4I2P A;  3P31 A;  1WUA A;  3FFK B;  4DV6 K;  5HBM A;  3Q7B A;  3THV A;  4DQ8 A;  3A5N C;  4WQ4 C;  1NGI A;  4E89 A;  3MXM A;  2UXC K;  1T8E A;  3V1R A;  3K5N A;  3O5B A;  5E41 A;  3NF7 A;  2O8E A;  4BRD A;  1RTD A;  3FZL A;  4JN4 A;  3DM2 A;  4Z4I A;  1BGX T;  3QIP A;  5AQH A;  1TUY A;  3V6D A;  1JL2 A;  3PSI A;  4AHU A;  4BQZ A;  3AA5 X;  2P9N B;  3AVC A;  4X62 K;  3RMB A;  5BN9 A;  3MED A;  1UA1 A;  3WNG A;  4YOV A;  2FBY A;  4CGH A;  3RR7 A;  4B1W B;  1IJJ A;  1KQS M;  1MA9 B;  1YIT N;  1TGO A;  3DWL A;  3MDQ A;  3ENO A;  3QFP A;  2WFB A;  1C1A A;  4O44 A;  4LFB K;  1RBU A;  2X6S A;  1BWF O;  1C0M A;  3QEW A;  3IUC A;  2Z1I A;  5GAG P;  1G99 A;  1HQE A;  2HHU A;  3C6A A;  4AHT A;  4B9M A;  4FK0 A;  3QDK A;  2FF6 A;  4IJN A;  1QQN A;  3OYC A;  4DTM A;  2XO7 A;  3MN7 A;  3LDS A;  4DSJ A;  3UIQ A;  4DF4 A;  3AO3 A;  4KTQ A;  1TKT A;  3TAF A;  3VQ5 A;  4IOA L;  4BRF A;  4B08 A;  1CLQ A;  3AVG A;  3V1Q A;  3HRG A;  3M8P A;  4CZH A;  4CF2 A;  1HPZ A;  1NK9 A;  4ISE A;  3A8Y A;  4BG9 A;  2JGU A;  4B9L A;  4CGF A;  4OKE A;  4HTL A;  5TKY A;  2OPR A;  5BRE A;  4DTR A;  1NK8 A;  1NGD A;  1Q18 A;  4LH5 A;  2QWL A;  1IKY A;  4PL7 A;  1TV6 A;  1SL2 A;  4E0D A;  4DS4 A;  3HPO A;  4NCB A;  1DLO A;  5F0X A;  3DXM A;  1J5E K;  5CYQ A;  4A59 A;  2G8V A;  1X9J A;  3AO1 A;  3VTI A;  4BC5 A;  3L4Q A;  4O8U A;  3CCJ N;  2WC9 A;  3TAR A;  2HHI A;  2YX6 A;  4BRP A;  1R59 O;  3MCA B;  3OBW A;  3THW A;  3VEV A;  1GLC G;  4A2B A;  4GKK K;  5C15 A;  3OS0 A;  4HCC A;  1NK0 A;  4I9L A;  1NK6 A;  4BRI A;  3VQC A;  1MWK A;  5KQD A;  3OYL A;  1VSE A;  3P39 A;  4BRQ A;  1D8Y A;  4I6M A;  3CYM A;  4FLX A;  4JV5 K;  1S3X A;  5JVH L;  1HYS A;  3VGL A;  1L3S A;  3O1B A;  2Z1J A;  3AAQ A;  3SAG A;  4OVL A;  2B5J A;  3U6F A;  4I7F A;  1N5Y A;  4LC9 B;  1ZYQ A;  2Q0U A;  2EX3 A;  2QWM A;  3L2Q A;  2IIR A;  5AZI B;  1VQ6 N;  1K8A O;  4ZTJ A;  1TYQ B;  2FBT A;  2P9I B;  4ELU A;  3WXL A;  2E20 A;  4UQG A;  2IOC A;  3U4L A;  1ZBU A;  4MO5 A;  4CZL A;  3QO9 A;  3VER A;  3L3U A;  4OGC A;  4JAX A;  3RR8 A;  2F9T A;  5GIP A;  3I55 N;  3ZCM A;  3QEX A;  4FJM A;  1S22 A;  3BY5 A;  1YI2 N;  1BUP A;  5KQ8 A;  4N47 A;  1HR0 K;  3OYB A;  4JK9 A;  5LMN K;  2YNG A;  3AVK A;  3CCR N;  4H0P A;  4PKH A;  3TPQ A;  2NNW A;  3SQ1 A;  2O8B B;  5SWM A;  1KTQ A;  1LWE A;  3M1F A;  4RW8 A;  2J4R A;  2KQ2 A;  4NXM K;  4DR3 K;  3DRR A;  3LDO A;  4FJN A;  3SYZ A;  1YF5 L;  4DQP A;  4CES A;  1JLE A;  4O0I A;  3A5M C;  3QFU A;  5JS2 A;  4BRO A;  4DTX A;  1UWB A;  1VQ7 N;  1JCF A;  4KB0 A;  4CK2 A;  3QB0 A;  3LP1 A;  1JLQ A;  1S9E A;  3AVL A;  4C1N K;  3U9D A;  3GG4 A;  4FM2 A;  3SQ2 A;  5TKW A;  3CC7 N;  4Y1D A;  1I3A A;  3N4P A;  4FO0 A;  5LY3 A;  1EWR A;  4J8F A;  4LY7 A;  4CBU A;  2VQE K;  4KFB A;  3MXI A;  3RMC A;  4LF6 K;  2QXF A;  4OKK A;  2P9N A;  5EX5 A;  1C0F A;  5GAD P;  2F8S A;  3JXU A;  4M3T A;  1BOT O;  2EWS A;  1RT6 A;  4CIG A;  3TAP A;  2JLE A;  4NYF A;  1JJ2 M;  3FE1 A;  2E1Z A;  3E9L A;  1YUW A;  4MDA A;  4OPA A;  3G4S N;  1KC8 O;  4YOR A;  1R0A A;  4F9O A;  3CJ9 A;  1LAW A;  4LFC K;  1MWM A;  2GUI A;  4CBX A;  4FM1 A;  4JI7 K;  2CGK A;  3SQ4 A;  5ADX A;  2HVH A;  1HNI A;  3O4N A;  1X9W A;  1XHX A;  2YNH A;  4M3Y A;  2JWK A;  3VPZ A;  4TSX A;  2P9U A;  3VTH A;  3SK3 A;  1V4T A;  4F8R A;  3U8X A;  3EZ5 A;  1CZA N;  4DFK A;  2BE2 A;  1NKB A;  2R7Y A;  2NRX A;  4DF8 A;  5AQW A;  3R8E A;  4CD3 A;  1YHQ N;  2ZM6 K;  2W41 A;  3A5O C;  1S5J A;  3K9J A;  4AQY K;  3G25 A;  2Q3S A;  4DHY A;  4V19 S;  4X65 K;  2BGG A;  3HM8 A;  4BE7 B;  4YNQ A;  4R79 A;  5JIC A;  2ZJP L;  2UU9 K;  1CZ9 A;  3DOK A;  3ITH A;  4GV6 A;  4CF1 A;  5KI6 A;  4JS5 A;  1JLC A;  4NCA A;  2A1S A;  3L2W A;  1Q82 O;  1ZBH A;  4CFB A;  2O8C A;  4DLG A;  3JAM O;  4PL8 A;  5AQM A;  3ZSO A;  1HKG A;  3OY9 A;  1LAV A;  4EIA A;  2FLO A;  1X9M A;  3PO4 A;  1NKC A;  4N41 A;  3VN5 A;  4AH9 A;  4JKA A;  3KWI A;  3LDP A;  2XRI A;  3AV9 A;  5BRH A;  3DLK A;  3FZF A;  2D1K A;  3NMU A;  3R9P A;  4K25 A;  4GY2 B;  3T1H K;  3LAN A;  3H1Q A;  4IDH A;  4FJJ A;  3LM2 A;  2D0B A;  4KHP K;  3J7A P;  2Q1N A;  2A42 A;  4LSL A;  3PO5 A;  1VRT A;  1YTU A;  5HL7 L;  4BE2 A;  1Q81 O;  1IKX A;  4JKE A;  4M3R A;  2PAV A;  4DTO A;  1U2V B;  1RBS A;  3QIN A;  1Q86 O;  1WLJ A;  3LM9 A;  4CZM A;  3BUZ B;  3L8B A;  5KPT A;  3P5J A;  3VA0 A;  3VES A;  2IDO A;  2B4J A;  4FSV A;  2BUP A;  3EN9 A;  4AIL C;  1Q9X A;  3DI6 A;  4CCH A;  4F4K A;  4G1Q A;  2V7Z A;  1S9G A;  5C0Y A;  4FJ5 A;  3O80 A;  1YVU A;  4CFC A;  1ATN A;  4ZTF A;  4BRK A;  3O08 A;  3CFO A;  4PA1 A;  1NGA A;  3EY1 A;  1TVR A;  2QWQ A;  2HF3 A;  4N56 A;  5LJV A;  3LDN A;  3V9W A;  5C2D A;  3VMF B;  2QI2 A;  1X3M A;  3LL3 A;  3MWT A;  3DRP A;  4B3R K;  4Z0U A;  4KO0 A;  3NVK A;  2W6L A;  1FKO A;  2GBZ A;  3VEZ A;  3CQY A;  2ASM A;  4EHU A;  3MX5 A;  1BL3 A;  3J7Y P;  3WXI A;  4B3O A;  1WSJ A;  4IFV A;  1S6P A;  1S1U A;  1WSH A;  3QEV A;  5JLH A;  2DFF A;  1WB9 A;  1RDA A;  1NJY A;  1VSM A;  4DV2 K;  3RMA A;  4B3T K;  1DGK N;  3TSP A;  1VQM N;  4ID5 A;  2GWK A;  1FXX A;  2G8I A;  3LP0 A;  2UUC K;  4KPY A;  3QET A;  3TSU A;  3IS9 A;  3QES A;  2QA4 N;  4EZ9 A;  4J2D A;  3IFR A;  1LWC A;  2ITG A;  1OH5 A;  3VQQ A;  2NRW A;  3HK2 A;  4CEF A;  4HHT A;  4BG8 A;  3JYT A;  2NRT A;  3CHW A;  3ZT4 A;  1S1T A;  4DSE A;  1O1W A;  1SS6 A;  3GBT A;  4HTU A;  3U3Y A;  2G8U A;  3OYA A;  1YJW N;  4OO1 J;  3S9H A;  1NGJ A;  3IG1 A;  1YJN N;  4OKJ A;  4DG1 A;  3PIP L;  2NRH A;  3C6U A;  3D0P A;  3NHG A;  3FR0 A;  2QXL A;  2ZGY A;  3F9K A;  3RSE A;  3T69 A;  2VWJ A;  3VF6 A;  4F3O A;  4O8K A;  5C12 A;  3DAW A;  4BDY A;  1VSD A;  2P9S A;  3HI0 A;  4IG0 A;  3I8D A;  3TAN A;  4E1M A;  3SQ0 A;  3VQ4 A;  4K43 A;  5FPD A;  3ASM A;  1QS4 A;  4CF8 A;  4H0T B;  1VSK A;  4IFY A;  3AVI A;  2ZD1 A;  3L4I A;  1NWK A;  1QSS A;  1HPM A;  1YTA A;  3OHR A;  4CJP A;  5BR8 K;  4FLT A;  2OZM A;  4DKW A;  1BIS A;  1U4B A;  4JYA K;  2HHH K;  2OA8 A;  3ZSZ A;  4NLC A;  3LDL A;  5AQY A;  3IRX A;  3LP2 A;  5AFU H;  4H5T A;  1TL1 A;  3KD1 E;  5JEN A;  5E84 A;  1LWF A;  1W2B M;  4GVE A;  3NGY A;  1SUQ A;  1MU2 A;  1YIJ N;  2ZJR L;  1KAY A;  3V9S A;  1NM1 A;  3D2F A;  4DQI A;  3BF3 A;  3V9X A;  4JLH A;  4B1Y B;  4EAH D;  1TK5 A;  1E4F T;  4NXN K;  4BAC A;  1KAX A;  4BE1 A;  3R6M A;  4BVO A;  2F9W A;  3HM9 A;  1HNW K;  5HRS A;  3E1Y A;  4CEC A;  4CJU A;  2WOM A;  4Z4H A;  1HRH A;  3J80 O;  4LFA K;  3HJF A;  1T7P A;  3SZ2 A;  1NJX A;  1ZXO A;  5IWA K;  1XI1 A;  3MX2 A;  4KHQ A;  3PX4 A;  3AVM A;  4LF9 K;  2NRR A;  3JS6 A;  3O9Q A;  3ULE A;  3M8S A;  4CGI A;  3HO1 A;  4CHZ A;  3VEN A;  2DFE A;  3PY8 A;  1BCO A;  2FSN A;  4H4O A;  3V81 A;  5J2Q A;  4O5F A;  4LF8 K;  4CEO A;  4Z4G A;  2YJE A; 
#chains in the Genus database with same CATH homology
 2OTJ N;  4BRQ A;  4H5V A;  4I6M A;  4JKF A;  3U9Z A;  4WFA L;  5GIN A;  1BU6 O;  1S3X A;  5JVH L;  2KLA A;  5JMV A;  3VGL A;  3O1B A;  4A61 A;  3AAQ A;  4JK8 A;  3SAG A;  3PLA A;  3CJA A;  4WFB L;  4BR2 A;  4H0X B;  3AAR A;  2VGM A;  2ZF5 O;  3UKR A;  5AQR A;  3SJH A;  1T3V A;  3C0B A;  4CZI A;  5M1K A;  4YOX A;  4PKI A;  4LC9 B;  3J8A A;  2QWO A;  2ZJQ L;  1QQO A;  2Q0U A;  1VQP N;  2GX9 A;  2QWM A;  2P9K B;  3R3L A;  2IIR A;  1NLV A;  3TSQ A;  3O4W A;  5AZI B;  2CH5 A;  4BR0 A;  1VQ6 N;  3W3D A;  4B1V A;  1K8K B;  4KBO A;  4WQ5 A;  2P9L B;  3HSC A;  4H03 B;  4XH4 A;  1K8A O;  4M7Y A;  3TU5 A;  3BEX A;  1EQY A;  1TYQ B;  4WQ4 A;  2P9I B;  3VGK A;  3SBT A;  3WXL A;  1HX1 A;  4MO4 A;  4JKD A;  3D2E B;  2E20 A;  3KZB A;  4WCE L;  4BRE A;  3U4L A;  3C65 A;  4MO5 A;  1DT9 A;  4K42 A;  1HKB A;  3ZEU B;  3HZ6 A;  4CZL A;  3H3N O;  3VEO A;  3VER A;  4H5W A;  4ILH A;  3CER A;  4IEE A;  3CPW M;  4JAX A;  2F9T A;  3O9R A;  5GIP A;  3CD6 N;  3I55 N;  1HUX A;  4JKG B;  1S22 A;  5FPM A;  4H5R A;  1BUP A;  4BVP A;  5KQ8 A;  1YI2 N;  1EO1 A;  4JK9 A;  1P90 A;  2GEM A;  2Q0R A;  3MWP A;  3A0I X;  3CCR N;  3F2K A;  3L6Q A;  4H0P A;  4PKH A;  2NNW A;  5AQJ A;  1NGE A;  1GLB G;  3EO3 A;  3TPQ A;  2QEX N;  1K73 O;  2FF3 B;  4KH5 A;  5C2F A;  1WOQ A;  3AGR A;  3M1F A;  3H3O B;  2J4R A;  1LCU A;  1W97 L;  3RVC A;  1OVY A;  1Z6R A;  2Q31 A;  3UB5 A;  4FPB A;  3VEW A;  5H1S Q;  3LDO A;  1YF5 L;  2HBM A;  3OW2 M;  5LJW A;  4A57 A;  4WFN L;  2Q36 A;  4C23 A;  4BEB A;  3DJC A;  4HWI A;  3EE9 A;  3HOT A;  3TTD A;  2YHW A;  3VF4 A;  3A5M C;  3QFU A;  4CJ7 A;  4BRO A;  1YJ9 N;  3HBT A;  5F1X A;  4CZJ A;  4IXC A;  2NLX A;  2QWN A;  5AQS A;  1M90 O;  1VQ7 N;  3HOS A;  1NGC A;  4PKG A;  1JCF A;  3P38 A;  2A3Z A;  3O8M A;  3QB0 A;  4IJA A;  1GLJ O;  5AQL A;  4C1N K;  1KXP A;  2VGN A;  3U9D A;  1S72 N;  4CZF A;  4QS8 A;  3GG4 A;  2BTF A;  5TKW A;  3CC7 N;  5BRD A;  5JLF A;  3N4P A;  4FO0 A;  4YOT A;  2KHO A;  4J8F A;  4CBU A;  5LY3 A;  4FWL A;  4ILJ A;  5AQX A;  1D4X A;  4M63 C;  1NBW A;  5KPR A;  5AR0 A;  1VQ9 N;  2QM1 A;  4JKG A;  3WT0 A;  1C0G A;  2P9N A;  4JD2 B;  5EX5 A;  4IO8 A;  1C0F A;  4FPA A;  3RSE B;  4MLE A;  3FLC O;  5GAD P;  3QML A;  1XUP O;  3JXU A;  4KH6 A;  1BOT O;  2EWS A;  4BR4 A;  2A6A A;  3GDQ A;  1JJ2 M;  1HJO A;  2QW9 A;  3E66 A;  3FE1 A;  1ZC6 A;  2C1I A;  1NMD A;  3MN6 A;  4IOX A;  1P8Z A;  5AQF A;  4XJX A;  2E1Z A;  3E9L A;  1YUW A;  4A5A A;  4DCH A;  4MDA A;  4OPA A;  3S41 A;  3IDH A;  3G4S N;  1QZ6 A;  1KC8 O;  3O1W A;  1QHA A;  2V52 B;  4YOR A;  4YOY A;  3SMP A;  4F9O A;  2A5X A;  3CJ9 A;  5M1N A;  2CH6 A;  4BRM A;  4NLB A;  4YOU A;  4FWR A;  4UY8 O;  3CCS N;  4CZK A;  4QS7 A;  1QVG M;  2ITM A;  4DB3 A;  1MWM A;  4CBX A;  1KAZ A;  3ZET A;  3KWG A;  2GUP A;  2I7N A;  5CE3 A;  2CGL A;  2FXU A;  2CGK A;  3ATU A;  3IMX A;  4H0V B;  4CBW A;  5ADX A;  3CME N;  3ZX0 A;  2GWJ A;  2GTD A;  2ZGZ A;  2JWK A;  3VPZ A;  2P9U A;  2YHY A;  3MCP A;  3CCL N;  3VTH A;  3J7Z O;  4G9Z A;  3P4I A;  3R1X A;  4YDU C;  5M1P A;  2HF4 A;  1BG3 A;  3SK3 A;  5CHI A;  1V4T A;  3EZW A;  2RHK A;  4NO7 A;  5AQP A;  2ASO A;  2NZT A;  3U8X A;  1CZA N;  1U6Z A;  3O9T A;  3M6G A;  2NRX A;  4WYB A;  2I7P A;  4I6M B;  4YDU A;  5MLC Q;  5AQW A;  3R8E A;  3UE5 A;  4CD3 A;  1YHQ N;  2KKZ A;  5DM6 L;  3SAF A;  2W41 A;  3A5O C;  3ATV A;  3VEY A;  3K9J A;  2VCP A;  5AQK A;  3G25 A;  3WUH A;  2D0O A;  2P9I A;  4DHY A;  4E1J A;  4U67 L;  3VOV A;  1HKC A;  2V51 B;  3H6E A;  3HM8 A;  4BE7 B;  4JHD A;  5AFU A;  2P9L A;  5M1O A;  4FWK A;  4JKC A;  4AM7 A;  1ESV A;  4R79 A;  5JIC A;  2ZJP L;  3CCQ N;  1RGI A;  3KHY A;  5AZI A;  4FWM A;  4GV6 A;  2Q2R A;  4OPH A;  2E88 A;  1YXQ A;  2IVP A;  3HTV A;  1JCE A;  1Z05 A;  2IVN A;  3ZX2 A;  1Q82 O;  3F9M A;  4IFE A;  4IO9 L;  4PL8 A;  5AQM A;  4CI6 A;  3VGM A;  3E9P A;  2IVO A;  1NGB A;  1GLA G;  1HKG A;  3FZK A;  5BPL A;  4EIA A;  2FLO A;  3ZET B;  4A62 A;  3UKU A;  3E9O A;  2VWB A;  4JKA A;  1K8K A;  1MDU B;  3KWI A;  3LDP A;  1Y64 A;  3NVM A;  4JHD B;  5BRH A;  1BA1 A;  3FZF A;  5M1Q A;  1VQO N;  2D1K A;  3NMU A;  5AQG A;  3R9P A;  1NGH A;  5FPN A;  4K25 A;  3SMS A;  3CCU N;  3CIP A;  4GY2 B;  5I9E B;  3H1Q A;  4IDH A;  3O9S A;  4BR5 A;  3L0Q A;  3LM2 A;  3I8B A;  4PHT X;  2W40 A;  3MN9 A;  2WBN A;  3TTC A;  2PBD A;  5AQI A;  2Q1N A;  3CCE N;  2A42 A;  1JCG A;  3WXK A;  5EOY A;  4ISF A;  2GEL A;  3ZX3 A;  3M5R A;  1E4G T;  3F5T A;  5HL7 L;  1Q81 O;  4JKE A;  3D2F B;  2PAV A;  4GV9 A;  1U2V B;  5EY4 A;  2D4W A;  3SAH A;  2E2P A;  1Q86 O;  1XC3 A;  4BC3 A;  3LM9 A;  1NGF A;  4CZM A;  3SLC A;  3BUZ B;  3CJ1 A;  3DXM B;  5EXW A;  4QS9 A;  3CF5 L;  1DEJ A;  1X3N A;  3I56 N;  2WUS A;  5KPT A;  3KVG A;  2DPN A;  5GAH P;  2OAN A;  3VES A;  3H45 C;  3FZH A;  1T44 A;  2E2O A;  4FSV A;  5AZJ A;  2BUP A;  2HST A;  3EN9 A;  1SAZ A;  4BQL A;  4WF9 L;  2CGJ A;  4FOI A;  3ZYY X;  3EL2 A;  2P9P A;  1QVF M;  4JK7 A;  1VQL N;  3EKS A;  4H0Y B;  2V7Z A;  1RDU A;  3ID8 A;  4BR9 A;  2H3G X;  5C0Y A;  3O80 A;  4JKH A;  3AAP A;  2D0P A;  1NJI O;  1ATN A;  1T6C A;  4BRK A;  3O08 A;  4Y0W A;  3FGU A;  3M3Z A;  4B1U B;  3B8A X;  1NGA A;  4JEP A;  5CR4 A;  1VQK N;  5AQV A;  5BPM A;  1N8R O;  1ATS A;  3BF1 A;  3CCV N;  4AF1 A;  2QWQ A;  2HF3 A;  3Q7C A;  4IZ9 A;  5LJV A;  3LDN A;  4H0O A;  5C2D A;  4JD2 A;  3VMF B;  2QI2 A;  1X3M A;  3C7N B;  3LL3 A;  3MWT A;  2QWR A;  2YI1 A;  3A5L C;  3VF2 A;  3G71 N;  4B1X B;  1TUU A;  3NVK A;  5F2R A;  5DM7 L;  1SQK A;  3VEZ A;  2AA4 A;  3EKU A;  4A2A A;  3CQY A;  2ASM A;  2YHX A;  3KK7 A;  4CZE A;  4EHU A;  3MX5 A;  4BRN A;  4K41 A;  3WXI A;  1K9M O;  4L3Q A;  2UYT A;  2NRZ A;  5JLH A;  1ZBS A;  1VQ4 N;  4ILG B;  2Q97 A;  1YVN A;  1DGK N;  3G6E N;  4XH5 A;  5AQO A;  3TSP A;  3WXM B;  1M1K O;  4XEI A;  3D2E A;  2GWK A;  1BDG A;  4U7B A;  1VQM N;  5FPE A;  4BRC A;  3AY9 A;  2P9U B;  1ILY A;  1TYQ A;  4RWT A;  3TSU A;  3CXC M;  3CJ7 A;  3OA9 A;  4EFH A;  3CCM N;  1VQ5 N;  2QA4 N;  2HBJ A;  5GIO A;  3IFR A;  1RDW X;  2YJF A;  3CI5 A;  2FSJ A;  2NRW A;  4IWV A;  1HLU A;  4BG8 A;  2NRT A;  3CHW A;  2P9K A;  2FSK A;  4B1Z A;  3SBG A;  5AQT A;  4AM6 A;  1T6D A;  2QTD A;  1SS6 A;  2C1G A;  3GL1 A;  3P31 A;  1WUA A;  1BO5 O;  2E8A A;  3FFK B;  2W00 A;  3Q7B A;  3GBT A;  1BA0 A;  4DQ8 A;  3A5N C;  4WQ4 C;  1NGI A;  3WXJ A;  1YJW N;  4OO1 J;  3O5B A;  1H1V A;  4WQ5 C;  2OTL N;  1NGJ A;  4BRD A;  3WEE A;  3ID6 A;  1YJN N;  3FZL A;  1QQM A;  5ELZ A;  4JN4 A;  3EE8 A;  3PIP L;  5AQU A;  2NRH A;  3VET A;  4FVU A;  5AQH A;  1TUY A;  3FR0 A;  2QXL A;  2ZGY A;  4EHT A;  5B8H A;  2PFU A;  4BC2 A;  4BQZ A;  3RSE A;  3T69 A;  1XQS C;  3VEX A;  4C1N I;  3VF6 A;  2P9N B;  1VQN N;  1OKJ A;  5M1F A;  5BN9 A;  4O8K A;  5JVG L;  3C7N A;  3H1V X;  3DAW A;  3QBW A;  5C12 A;  2HMP A;  4RCH A;  1IG8 A;  3T7Z A;  5BRF A;  2P9S A;  4FOE A;  4Z94 A;  4YOV A;  3HI0 A;  4YOW A;  4B1W B;  2HBL A;  1IJJ A;  1KQS M;  1MA9 B;  3ENB A;  3DWL A;  1ATR A;  1YIT N;  4FWO A;  3ULE B;  3MDQ A;  3ENO A;  3QFP A;  4K43 A;  3DXK A;  2WFB A;  5FPD A;  3MK6 A;  5ADX H;  3WEE B;  4H0T B;  3PIO L;  3CJC A;  3O6W A;  3WQT A;  3CMA N;  1DKG D;  1BWF O;  2RE2 A;  3IUC A;  3L4I A;  4MDB A;  1NWK A;  5GAG P;  3MMV A;  1HPM A;  1G99 A;  4ISG A;  3OHR A;  3C6A A;  3ZEU A;  5AQZ A;  4DKW A;  4BRG A;  2A40 A;  2E2Q A;  2P9P B;  4FWN A;  3QDK A;  2FF6 A;  3LDL A;  4IEI A;  4NLC A;  1VQ8 N;  3D7E O;  4BR7 A;  1KD1 O;  5AQY A;  5GAE P;  4IJN A;  5AZJ B;  1QQN A;  5BN8 A;  3H46 O;  5AFU H;  3DXK B;  4H5T A;  3QIC A;  4FWP A;  3MN7 A;  4JKB A;  2JWL A;  3W0L A;  5E84 A;  1W2B M;  1GLF O;  4GVE A;  4JNE A;  4GV3 A;  2A41 A;  1YIJ N;  2BH1 A;  2AP1 A;  1GLE G;  2ZJR L;  1U2V A;  1KAY A;  4BC4 A;  3LDQ A;  4IOA L;  4BRF A;  1NM1 A;  2VYP A;  3D2F A;  1YAG A;  2HOE A;  3ENH A;  3HRG A;  4CZH A;  4FWQ A;  1QZ5 A;  3BF3 A;  4ISE A;  3CC4 N;  3A8Y A;  3GOI A;  1O13 A;  1SZ2 A;  4B9Q A;  4B1Y B;  4BG9 A;  1J6Z A;  4BGB A;  4H5N A;  4EAH D;  5E26 A;  4CZG A;  4BY9 C;  5HOO A;  1E4F T;  1V4S A;  4HTL A;  3CJB A;  5TKY A;  1KAX A;  3CET A;  5BRE A;  4IOC L;  1NGD A;  5BPN A;  3R6M A;  4BVO A;  2F9W A;  1Q18 A;  3DLL L;  1RFQ A;  2QWL A;  1GLD G;  4CD1 A;  5AQQ A;  1GLL O;  3QBX A;  3E1Y A;  2E2N A;  4PL7 A;  3UKU B;  3CC2 N;  4NB4 A;  4FL9 A;  3I33 A;  4M7X A;  5BR9 A;  2HBK A;  3CQX A;  5F0X A;  3DXM A;  1LOT B;  2V7Y A;  1Q7Y O;  4A59 A;  1ZXO A;  3N4Q A;  4FWS A;  5AQN A;  1X9J A;  4RTF D;  3VTI A;  2YCH A;  3C6H A;  2ZWH A;  3MX2 A;  4BC5 A;  3L4Q A;  4O8U A;  3CCJ N;  3FZM A;  2WC9 A;  3AGK A;  3GE1 A;  3BP8 A;  3MN5 A;  2NRV A;  2YX6 A;  3CPE A;  1VAZ A;  4BGA A;  4BRP A;  1R59 O;  2NRR A;  3MCA B;  3O9U A;  3OBW A;  3UKR B;  2E1Y A;  2QWP A;  3JS6 A;  3VEV A;  4BRL A;  2F7T A;  1GLC G;  3OBY A;  4A2B A;  3O9Q A;  3WQU A;  3ULE A;  2ASP A;  3IKM A;  4A5B A;  4GNI A;  3TTF A;  3VEN A;  1NGG A;  4MLH A;  5C15 A;  2P9S B;  2FSN A;  3D6R A;  4KH4 A;  4BRA A;  4BRI A;  1MWK A;  5KQD A;  4O5F A;  4XH1 A;  3K9K A;  5C10 A;  4BEC A;  5KPZ A;  4BRH A;  5EVZ A;  2YJE A;  3P39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...