4I6MB

Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of swi/snf chromatin remodeler.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
437
structure length
396
Chain Sequence
PFRQDSILIIYPRSQTTLVQFGLNEETFTVPELEIPTQIYRTTRQDGSYTYHSTNKDNKAELIKPIQNGEIIDISAFTQFLRLIFVSILSDRANKNQDAFEAELSNIPLLLITHHSWSQSDLEIITQYVFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTHHTDIIPIVDYAQLDHLVSSIPMGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSKNSDLEFNTFWDEKGNEIKVGKQRFQGCNNLIKNISNRVGLTLDNIDDINKAKAVWENIIIVGGTTSISGFKEALLGQLLKDHLIIEPEEEKSKREEEAKSFVPTIEYVQCPTVIKLAKYPDYFPEWKKSGYSEIIFLGAQIVSKQIFTHPKDTFYITREKYNMKGPAALWDVQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/hydrolase
molecule keywords Actin-related protein 7
publication title Structure of an actin-related subcomplex of the SWI/SNF chromatin remodeler.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 115
structure length 396
sequence length 437
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4i6mB02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4i6mB01
3.90.640.60 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4i6mB03
2A41A 4ISEA 1NLVA 2ASPA 3LDQA 4CZLA 4H0XB 1TUUA 3RSEB 1ATNA 4BRNA 3WQTA 3IUCA 4RCHA 1C0GA 3QMLA 3LDNA 2P9IA 3FE1A 4BRLA 3H6EA 3ULEA 3M3ZA 4BC5A 4JAXA 1D4XA 4FWPA 4IJAA 1E4GT 4FWOA 3VF6A 3VEYA 2HOEA 2CGLA 3O5BA 2NLXA 4F9OA 2GTDA 2Q0UA 3HTVA 5BR9A 3BF3A 4Y0WA 1GLCG 2J4RA 3DXKA 1E4FT 4Z94A 4O8KA 3UE5A 3VENA 1WUAA 3MK6A 4DB3A 1NGDA 2YJEA 3AAPA 4BR5A 1TYQB 2BTFA 4IJNA 4C23A 3LM2A 4IZ9A 1ATRA 2ZWHA 3EN9A 3BF1A 3QFUA 5FPEA 1RDWX 5E26A 3I33A 1NGHA 1NGGA 3FFKB 5JMVA 2P9SB 3LM9A 4BGAA 3D2FB 5FPNA 5EVZA 4BRDA 2P9KB 3FZMA 2V7YA 3ATUA 2E2PA 3H3OB 3EO3A 1KAYA 4A2BA 4I6MB 5BPNA 1T6CA 2QWLA 4JNEA 3VPZA 1IJJA 5B8HA 1ZXOA 3FZFA 4CZGA 2E2NA 5BREA 3AY9A 3H3NO 3MCPA 2IVNA 4NB4A 3HSCA 2AP1A 2YHYA 3VEOA 2QWMA 1DGKN 3J8AA 1NMDA 2QWRA 4CBXA 4A62A 4H0PA 2FSJA 4FWNA 2E2OA 4MO5A 2DPNA 4L3QA 2ASMA 3RSEA 4BRKA 2FXUA 3VERA 1BU6O 4EAHD 4H0TB 4CI6A 2PBDA 1WOQA 5FPDA 2V52B 4FSVA 4PL8A 3G25A 3DAWA 4GY2B 1TUYA 5AQLA 3IDHA 4DQ8A 4WYBA 4H5NA 4EHTA 4H5WA 2GWJA 4CZIA 3KHYA 5EOYA 1MA9B 1RGIA 2NZTA 1X9JA 3C7NB 4CJ7A 5AQVA 4ISFA 1GLDG 1OKJA 2HF4A 4K41A 3VETA 5F1XA 5AQWA 3ENOA 2Q1NA 4EFHA 1KAXA 1JCEA 2YHWA 1NM1A 3CERA 5AQUA 2P9NA 1S22A 4BQLA 4FPAA 3MMVA 3QB0A 3QFPA 3VEZA 5JLFA 5KQ8A 3H1VX 1KAZA 4H5VA 5AQPA 3ZX2A 4QS7A 5BN8A 3O1BA 3QDKA 2QM1A 2I7PA 3CQXA 2P9PB 3CJBA 1YVNA 4BRFA 4B1ZA 3BUZB 4BREA 3ZETB 1K8KB 3MN5A 3VESA 1XUPO 4PL7A 3W3DA 2P9UB 2OANA 4CD1A 3ENHA 4CD3A 3D2EB 2VYPA 5AQRA 4XH1A 3UKRB 4I6MA 2CH5A 1ESVA 2Q36A 3L4IA 2FF6A 4IO8A 1HKGA 5EY4A 1J6ZA 5AFUH 4BVPA 5AZIB 2GWKA 1HUXA 5F0XA 4JD2A 3DXMA 3VGLA 2AA4A 4FWSA 1SQKA 2Q2RA 2D1KA 3CI5A 5BRFA 4BRIA 3QBWA 2QWNA 2W41A 4BG8A 4FO0A 4DHYA 5AQQA 2QWQA 4FWMA 4GNIA 2YI1A 4H0VB 2BUPA 3GE1A 1NGEA 3QICA 3OHRA 3CIPA 3U4LA 3O08A 4XH4A 5AZJA 5AQNA 3W0LA 3CJ9A 4BRMA 3WEEA 3CETA 4K25A 3KZBA 4FWLA 5EXWA 4BGBA 4CZKA 4AM7A 4H0OA 4IWVA 2WUSA 5BPLA 3A0IX 3SLCA 2HF3A 2PAVA 3A5MC 4MO4A 1QZ5A 4FWKA 2A40A 2A5XA 5FPMA 4RWTA 3SK3A 1NWKA 3CQYA 3FR0A 3UKUB 2V51B 2YJFA 3MN7A 1X3MA 3DJCA 5ELZA 3WXJA 2EWSA 3ZEUB 4DCHA 4HWIA 1BO5O 2E1ZA 1V4SA 2ZF5O 3A5NC 2P9IB 3WXLA 3GDQA 3ULEB 2A6AA 3VEXA 2E1YA 4CZHA 3O6WA 4BRQA 3QBXA 5JLHA 3O8MA 4WQ5C 4B1VA 4BC2A 3TU5A 2P9LA 1GLJO 2I7NA 3GG4A 4K42A 4WQ5A 4BR9A 4BC3A 2YCHA 1S3XA 1HKBA 1BA0A 4CZEA 4B1XB 1GLEG 1YUWA 3O80A 1JCGA 3ZETA 2Q97A 3CJAA 1P8ZA 4JHDB 5AQKA 3ZX3A 1LOTB 5KPTA 1BWFO 2D0OA 3D2EA 3VGKA 3I8BA 3UKRA 4BRCA 4BG9A 2E20A 1DEJA 3AARA 3BP8A 5AQZA 4BRGA 1NGFA 4FL9A 3GBTA 3A8YA 4YDUC 4PKIA 4YDUA 1GLAG 2UYTA 4BRAA 2F9TA 3B8AX 5JICA 3LL3A 1QQNA 1TYQA 3UB5A 2NRHA 3U9DA 3WQUA 1NBWA 4FPBA 5LJWA 4CZMA 3D7EO 2CGKA 5CE3A 4MLHA 1Z6RA 3JS6A 3VGMA 4XH5A 4H0YB 5LJVA 4IXCA 2P9SA 3M1FA 4M63C 4FOEA 3MN6A 5EX5A 4KBOA 3F9MA 1XC3A 4O5FA 3D2FA 4H5RA 2IIRA 5AQXA 1MWMA 2Q0RA 1QQMA 3WT0A 3EKUA 2F9WA 2FLOA 2P9KA 3H1QA 5KPZA 1ZBSA 3HBTA 3HZ6A 5BN9A 3U9ZA 5AFUA 2V7ZA 3FZKA 3FZLA 3M6GA 3EZWA 2VWBA 3VEWA 3L6QA 4BR4A 2E8AA 4BRHA 5KPRA 3VOVA 1LCUA 3GL1A 1SAZA 3UKUA 3HI0A 4PKGA 2CGJA 4MLEA 3HM8A 1BUPA 3ZEUA 3CJ1A 5BRHA 5BRDA 3H45C 4BR2A 1G99A 2W40A 2Q31A 2E88A 4JN4A 4EHUA 1NGIA 5AQFA 3A5OC 1BG3A 4B1YB 1QQOA 1QZ6A 2IVPA 2CH6A 1H1VA 2YHXA 1BOTO 4A2AA 4B9QA 3WUHA 4E1JA 2FSKA 2HMPA 5AQTA 1NGAA 2ASOA 4BR0A 4QS9A 1HKCA 2ITMA 1MDUB 1SZ2A 1GLLO 2H3GX 4BRPA 1V4TA 1YAGA 1EQYA 1U2VB 3SMSA 3CJ7A 5BPMA 2P9NB 4JHDA 4CBUA 5KQDA 4B1WB 1CZAN 3FLCO 3R6MA 4EIAA 4M7YA 5I9EB 1IG8A 2GUPA 3VF4A 3IMXA 1HJOA 2VCPA 2ZGYA 3MN9A 5AQOA 4QS8A 1T44A 3JXUA 1NGCA 3C7NA 4BROA 3SJHA 2QW9A 2KHOA 3ATVA 4H03B 4A61A 3EKSA 3VEVA 1HPMA 2E2QA 5F2RA 3C0BA 3IFRA 3H46O 3CHWA 5TKYA 4M7XA 3L0QA 3ZX0A 3P4IA 3AAQA 2A42A 3DXKB 3ID8A 1U6ZA 2P9PA 5E84A 3GOIA 1X3NA 4H5TA 4LC9B 3CJCA 4XEIA 4JD2B 3DXMB 5AQGA 5AQIA 2FF3B 2ZGZA 3EL2A 3LDOA 4J8FA 4BR7A 2QWOA 1KXPA 1MWKA 1K8KA 1Q18A 5AQYA 3R8EA 1ATSA 1Z05A 4BVOA 4CZFA 5LY3A 3VF2A 4BQZA 2P9UA 3S41A 4K43A 4B1UB 1JCFA 3A5LC 1T6DA 2A3ZA 2D4WA 2GELA 5AQSA 1GLFO 3O4WA 5AZJB 1RFQA 1Y64A 3LDPA 3WEEB 5AZIA 1QHAA 3FGUA 2QWPA 3R9PA 5AR0A 1R59O 4BC4A 4FOIA 1C0FA 4CZJA 3O1WA 5AQJA 1GLBG 4FWRA 4PKHA 4ISGA 3WXKA 1NGJA 5ADXA 1DKGD 3KVGA 5AQHA 3TPQA 3BEXA 4FWQA 2GEMA 1NGBA 3DWLA 1XQSC 1U2VA 3SMPA 1YXQA 1HX1A 4AM6A 1ZC6A 3LDLA 1BDGA 1HLUA 5ADXH 1BA1A 4CBWA 4NO7A 2QXLA 2D0PA 5AQMA 3U8XA 4HTLA 2IVOA 2P9LB 4WQ4C 4WQ4A 3WXIA 3MDQA 3FZHA 2FSNA 4RTFD
chains in the Genus database with same CATH superfamily
1YTAA 2A41A 4ISEA 4JI8K 3LDQA 4Z4IA 4B9TA 1TUUA 2KZZA 3OW2M 4BRNA 3D0PA 3WQTA 3LDNA 4G9ZA 2P9IA 3FE1A 3K0SA 3NDKA 4FJKA 1WBBA 5C0YA 5KRTA 3M3ZA 4IJAA 2QK9A 4FWOA 1EWRA 3VEYA 2P1JA 1S1UA 1HRHA 1S9EA 4ELVA 4F3TA 4F3OA 2HHIA 5BR9A 3BF3A 2Z1HA 3DXKA 4Z94A 1LWFA 1WUAA 3MK6A 2YJEA 3AAPA 4BR5A 3HK2A 1P90A 1DT9A 1RTJA 1TYQB 2BTFA 4IJNA 3SUQA 3AVMA 4JI7K 1HQEA 4FJNA 1FKPA 3SJJA 1QVFM 5FPEA 2F7TA 1BCMA 3I33A 1VSEA 1K8AO 5JMVA 1WLJA 3HT3A 4C8KA 2W42A 4KTZA 2Z1JA 3SQ0A 3N4QA 2GV9A 5EVZA 4E1NA 1WAJA 4BRDA 3FZMA 2V7YA 2E2PA 1JL2A 1KAYA 2DFHA 3DLRA 4IOXA 3AGKA 3O4NA 2F4VK 4M41A 3NVMA 2Z1GA 4DS5A 4ELUA 4JNEA 1IJJA 4KH5A 3FZFA 2E2NA 4DF4A 5C24A 4AILC 4CGJA 4JK7A 1DGKN 3O9RA 3U6FA 1Z26A 1IBKK 4H0PA 3SZ2A 4FWNA 2E2OA 2BANA 5LL6Z 3S3OA 2X6NA 4M3RA 2GUIA 2OCEA 3I0RA 4PUOA 3AA4A 4BE1A 1CXQA 4DUZK 2ZJPL 2HVIA 4E1MA 1YITN 4PL8A 3G25A 4CEDA 1UA0A 4CJRA 2HVHA 1TUYA 5AQLA 4M42A 4B9VA 4FLXA 2G8HA 2IGIA 3KHYA 3V1RA 1I3AA 4CJPA 3WXMB 5AQVA 5JENA 2WOMA 1QQCA 4FW1A 3R1XA 4LF7K 3ZSYA 4NCAA 3HPGA 5AQUA 2P9NA 3S3NA 3BDPA 4FPAA 3MMVA 4KH4A 3NF6A 2DFEA 2KW4A 4H5VA 4QS7A 3O1BA 3NF9A 2I7PA 3CQXA 3CJBA 4HVJA 4RW9A 2B5JA 3MXIA 3HXMA 4ILJA 3VESA 4HUGA 2QXFA 4FJJA 4X66K 4DFPA 3D2EB 4CF1A 4H8KA 4XH1A 2ZE2A 4I6MA 5JVHL 3QEPA 3BY5A 1VQLN 3NH1A 1HKGA 1J6ZA 4LFAK 3KK1A 2GWKA 4IEIA 1YJNN 3ENBA 4B9MA 4KFBA 4EZ9A 3VN5A 1SQKA 2Q2RA 1M90O 1ASWA 3AA3A 3LP3A 4DHYA 1VQ6N 3MAQA 4H0VB 2YI1A 2O4IA 4KTQA 4KB1A 1C1CA 4ID5A 4XH4A 3M8RA 1KTQA 3F5TA 5AZJA 3CYGA 1LW0A 5SWMA 3CETA 4K25A 4B8AB 4FLZA 4CZKA 4H0OA 1WAFA 4AHCA 4EP4A 2HF3A 3WNGA 2PAVA 3HVTA 4RWTA 5FPMA 4X62K 2AJQA 4W5OA 3L2QA 1NWKA 3IS9A 1BL3A 3MXMA 3MEDA 1NK4A 3CCMN 4LFBK 3MN7A 4JKGA 1X3MA 3DJCA 3WXJA 5HOOA 4HWIA 3LZIA 4PY5A 3KTQA 3V9WA 2KLAA 3TTDA 3O9QA 2FBXA 3Q7CA 2BH1A 1IH7A 1C0MA 1HPZA 4V19S 1KD1O 3LWMA 2OA8A 3K5MA 4BC3A 4CEQA 4FM0A 4W5QA 5IWAK 2RHKA 4DKWA 1BA0A 1YUWA 4GVMA 4CFCA 1JCGA 4JKFA 3ZETA 1ZBUA 3O9SA 2YKMA 3Q7BA 4JI3K 5JVGL 3ZX3A 2JGUA 3LDSA 4HTUA 1LOTB 5KPTA 4YOXA 4RW7A 1NNEA 2D0OA 3TABA 4BRCA 3RRGA 1DEJA 3CM6A 3T7ZA 4JV5K 1RBRA 3T69A 4YDUC 4PKIA 3ZSQA 1L3SA 1IKVA 1B92A 4BRAA 2F9TA 5JICA 5A2QO 3LALA 1BISA 3H08A 1TYQA 5CY4A 2ETJA 1NBWA 2XY5A 2XY6A 2CGKA 3HRGA 1HNIA 5CE3A 3TI0A 4FJ7A 5LJVA 4BDYA 4CEFA 4FOEA 2FBYA 5EX5A 3F9MA 4O5FA 3CCRN 3V9XA 1BIZA 3PX6A 2DFFA 4U7BA 4OLBA 4LF9K 4JKBA 4BE2A 4F2RA 3U9ZA 5BN9A 2V7ZA 3NCIA 3ZT0A 3FZLA 2VWBA 3VEWA 2NRVA 4E7JA 2P51A 3WNHA 3VMFB 4CJ3A 3V4IA 4FLUA 1FKOA 4PKGA 4MLEA 3ZEUA 3P31A 4IFYA 3CJ1A 3HYFA 4CJSA 1JXEA 4BR2A 2W40A 1T8EA 1RBSA 5AQFA 4R79A 1SL0A 4B1YB 4JI1K 1Q8IA 1NG9A 2ASOA 1HKCA 4QCLA 4GV9A 1MDUB 5J1EA 3SAGA 1NOYA 2IS3A 4AHSA 4CFDA 3SMSA 1NK7A 2PYJA 4MDAA 1JLGA 4JHDA 3IRXA 4B1WB 1CZAN 1S1VA 4O55A 1IG8A 2GUPA 3VF4A 1HJOA 1OVYA 3TAFA 5AQOA 3SNNA 4WFAL 3JXUA 3QEXA 4BROA 2QW9A 3CMAN 2JLEA 4DSFA 3RWUA 5CZ2A 4CFAA 4I9LA 4FJXA 4CJFA 4J2DA 3PX0A 4CHOA 4LH5A 3OYFA 1UWBA 4CEBA 5DM7L 1KC8O 3DXKB 1U6ZA 4H5TA 2OPQA 4YNQA 4JD2B 3FFIA 3B6PA 3EL2A 4YORA 3L8BA 1ITGA 4W5TA 1Q18A 3QESA 5AQYA 3R8EA 1ATSA 5C12A 3SBGA 2O8BB 3SAFA 4C8MA 1DTQA 4KB0A 3OYKA 3S41A 3T1AA 1T03A 5KRSA 2A3ZA 2D4WA 3NFAA 4DS4A 3U3YA 1RFQA 3LDPA 4DTOA 3S9HA 2UUCK 3KLGA 4B9LA 3FGUA 3T1YK 3TTCA 4DFMA 3CCSN 3MXJA 3DLEA 1N5YA 3QIOA 4FJLA 4MFBA 1RT2A 5AQJA 4FWRA 1RT3A 2OTLN 1NGJA 4IG3A 4M45A 3BEXA 4OKKA 1SUQA 1EETA 3P5JA 1J9AA 4CJUA 4F4KA 1U2VA 2GBZA 3AO4A 4B3RK 1VSIA 1VQ5N 4AM6A 1VQ4N 1X1PA 1W0HA 1ZC6A 2W6LA 3LDLA 5IT9O 1HLUA 3P39A 5ADXH 4HUEA 2UUBK 4WE1A 1C1BA 4KKOA 1NMNA 3FZHA 4DSEA 1NLVA 1RTIA 2ASPA 2WBNA 5CR4A 4DTMA 3QEIA 1RDBA 5C2DA 1RNHA 3H6EA 4JAXA 1T05A 4N41A 2IAJA 3L2UA 3LZJA 4FWPA 4FLTA 1E4GT 1W97L 3DYAA 2HNZA 1CZBA 4B9UA 4FJMA 2NLXA 4B08A 4F9OA 3IKMA 3KJVA 3AO5A 4OPJA 2J4RA 3ASMA 3PIOL 3BGRA 2VWKA 4JI6K 4JYAK 1VSMA 2KZMA 4DB3A 4LF8K 4CIEA 3OYLA 1N34K 3LM2A 3TTFA 1VQMN 2KQ2A 1ATRA 4J2EA 3KLHA 2YHBA 1N32K 5E26A 3SUPA 2O8DB 2ZJQL 2B6AA 3KK2A 4DTJA 3LM9A 2IOCA 1NKBA 3OY9A 4B3SK 3ZSXA 5CHIA 4I2PA 4Z4HA 4I6MB 1J5EK 1ZXOA 2HHVA 3H3NO 5BR8K 3ZSZA 3HSCA 1S9GA 2AP1A 5EU7A 3ULDA 1RDAA 1VRTA 2QWRA 4FZYA 4DR7K 4CBXA 2IDOA 2FSJA 3LANA 4ID1A 4MO5A 1RT1A 1UOCA 1QVGM 2HHXA 4DR5K 2W6KA 3RSEA 3VERA 1TKXA 4DQQA 4EAHD 5M1KA 1BQNA 4GW6A 1WOQA 3AVIA 1YTUA 3CQ8A 2DTUA 1WSGA 2V52B 2VG7A 3OBWA 1C0UA 3DI6A 3G4SN 3OS1A 2OZMA 1TK8A 2HHQA 3OYDA 1UAXA 1OH5A 4WYBA 4H5NA 2GWJA 3V1OA 1XHXA 5FRMA 2XO7A 1X9JA 4GKKK 4CJ7A 4ISFA 5K14A 4ELTA 2QKKA 1ZYQA 2EHGA 2BGGA 4G1QA 2LSNA 3VETA 5F1XA 1JKHA 4JEPA 5M1FA 4AHTA 4EFHA 1KAXA 1JCEA 4N76A 1NM1A 3HJFA 2YHAA 4CHYA 4M3UA 3L3UA 1WSHA 3OJUA 3CCJN 1S6PA 3QB0A 3VEZA 5JLFA 1KAZA 5AQPA 3HOTA 3ZX2A 4KV8A 1NKCA 3CC7N 5BN8A 3ITHA 4BRFA 3AVKA 2P5OA 3BUZB 3NBPA 3DRSA 4LY7A 3ZETB 1D8YA 1VSKA 2O8EB 2VQFK 3W3DA 3OS2A 2P9UB 1RT4A 4AQYK 1QE1A 1T3VA 5MLCQ 4IFEA 5AQRA 4ILHA 2CH5A 5EY4A 1VRUA 4CEOA 3ALYA 2UXDK 5AZIB 4JD2A 2ATQA 1NJIO 3NH0A 2AA4A 5BRFA 3PO5A 2W41A 2O8BA 2BUPA 3GE1A 5HL7L 3QINA 3U4LA 2X78A 3W0LA 1TKDA 4FWLA 3CG7A 4YFUA 4BGBA 4AM7A 4H4MA 2WUSA 3EYZA 3A0IX 3SLCA 2YNHA 4HCCA 1YIJN 1BCOA 4WFBL 2A40A 2A5XA 4DUYK 3FR0A 1LAVA 2V51B 1XMQK 4FK4A 3ZEUB 4DCHA 2ZF5O 1RT6A 3WXLA 2B4JA 3ULEB 3THYA 2A6AA 3QNNA 2E1YA 4CZHA 4AHRA 4BRQA 1WNSA 4KHNA 1D5AA 4B1VA 3G10A 3TU5A 2ZD1A 2I7NA 4K42A 4A57A 1RTDA 3K59A 2YCHA 4XIUA 4W5NA 1S5JA 3PIPL 1S3XA 1HKBA 4CZEA 4W5RA 2VQEK 1S1XA 5HBMA 3VQAA 1ZBLA 4RW8A 1X9WA 2Q97A 4FVMA 1P8ZA 4JHDB 3VQ8A 3EY1A 4FJGA 4FM1A 1YHQN 1VSJA 4CGFA 3TAMA 5M1QA 4BG9A 3NAEA 3SQ1A 3AARA 5AQZA 1NGFA 4FL9A 3GBTA 3A8YA 5KTQA 3CD6N 4YDUA 3KWIA 4EP5A 5HRNA 1FJGK 1L3UA 3LL3A 4CJWA 3U9DA 1K6YA 1IO2A 2I5JA 2D5RA 4M3ZA 3CCLN 4CZMA 3F9KA 4DTRA 4DTNA 1OH7A 3F2KA 2IC3A 4H0YB 2O8DA 3SBTA 4IFVA 4M63C 5HRSA 3AA5X 1Y97A 2WTUA 4I2QA 5AQXA 1X9MA 3J7YP 3KLIA 3WT0A 4WCEL 3EKUA 2HHTA 4DLGA 3SV4A 2F9WA 3SV3A 3H1QA 1NK0A 3CCEN 5AFUA 1TAUA 3O9UA 3EZWA 4CK3A 2KTQA 1KVBA 4KHSA 1E3MA 1B9FA 3VOVA 2NRZA 3GL1A 1IKWA 4IKFA 3UKUA 4F8RA 1SV5A 3ISNC 1KSPA 3HM8A 3TSUA 5BRDA 2A1RA 4BY9C 4IOCL 5M1PA 4YHHK 3QEWA 4CHPA 1KRPA 2Q31A 2E88A 4JN4A 4EHUA 1NGIA 1IBMK 4H4OA 1JLQA 3M8PA 1QQOA 1QZ6A 2IVPA 3D45A 2CH6A 1H1VA 4JRQA 3C6UA 4A2AA 1XI1A 3AV9A 3U3GA 1K9MO 1NGAA 2ITMA 1L3VA 4B9SA 3LPTA 1GLLO 4BRPA 1L3TA 1V4TA 1YAGA 3K2PA 4R5PA 1NK6A 1U2VB 3CJ7A 2KFZA 2UU9K 4DSLA 2Y1JA 4B9NA 1Q9XA 4E7LA 5CYMA 3R6MA 4JLHA 3ZT3A 1J53A 3SI6A 4QS8A 3CCVN 4BDPA 1HPMA 4O5BA 5J2QA 3KKRA 5F2RA 3C0BA 1FW6A 4DTPA 1U47A 5SZTA 3CF5L 4DFJA 3E66A 4M7XA 3L0QA 3AGRA 3S3MA 3AVAA 5HRPA 5C10A 4NCBA 3HP6A 2A42A 2ZM6K 1BHLA 4JI2K 5E84A 3GOIA 5GAGP 3MX5A 2RKIA 4LC9B 1I39A 4XEIA 5AQGA 5AQIA 1HYZA 3LDOA 2QWOA 3HPHA 4CCHA 1Z25A 2O8EA 2A1SA 5GAHP 2YKNA 2P9UA 2ZQBA 3SUOA 3K58A 4O0JA 5J2PA 4DR3K 5T7BA 4DV7K 2GELA 2YV0X 5AQSA 3F73A 1RBUA 1C0TA 3QNOA 2PYLA 2FC0A 1XWLA 5AZIA 4CHQA 1QHAA 3TWHA 4EZ6A 4DQPA 3R9PA 1R59O 4CFBA 4BC4A 4BE7B 2WONA 4DTUA 1C0FA 1GLBG 4JS4A 1IG9A 4LH4A 4UY8O 3OYMA 5ADXA 3TPQA 3CFPA 4JI4K 3J81O 2GEMA 1NGBA 3DWLA 2NRRA 4DMNA 4E7HA 3O3FA 3OYCA 3THXA 3E01A 3RMCA 4KH6A 3VQBA 1BDGA 1TAQA 4Q0BA 3VQPA 5AQMA 4HTLA 2IVOA 3WXIA 2FSNA 3A2FA 3G6EN 1ASUA 3IG1A 4H0XB 3ZT1A 3RSEB 1ATNA 2F8SA 3ZSOA 1I94K 3TANA 3ULEA 3L2WA 3JYTA 1SS6A 2HHUA 4CESA 3VF6A 2HOEA 1VQPN 2CGLA 1WB9A 1BQMA 1VQON 2GTDA 5KGWA 1WN7A 2OYQA 1Q81O 1GLCG 2FBTA 1W2BM 2PZSA 3SPYA 1NOZA 3CC4N 3VQQA 4N56A 1NGDA 4CF2A 4NXNK 3MX2A 4CJVA 3EE9A 1CXUA 4CGHA 2Z1IA 4IEEA 4FZZA 3AO1A 4IDHA 1U4BA 2WC9A 2ZWHA 4GV6A 3KLFA 1HQUA 4E3SA 4PA1A 2P9SB 1S6QA 3OYHA 4K0KK 3EE8A 4MDBA 2QA4N 3AVGA 4FLVA 3DOLA 3PX4A 4B3OA 4DV4K 3CCQN 3T3FA 3DOKA 2P9KB 4Z4CA 4CIFA 1QSLA 3ATUA 2VGNA 5HP1A 1U04A 3EO3A 4NXMK 4A2BA 3ZT2A 5BPNA 4CEAA 4FJ9A 3SPZA 4FK0A 3VPZA 1RILA 1TVRA 4LF5K 5B8HA 1QSYA 4LSNA 4OPAA 3TARA 2OPRA 5BREA 1O13A 1EKEA 3HM9A 4ILGB 2WFBA 3VEOA 2QWMA 4YOTA 4DQSA 2PY5A 3J8AA 4XJXA 1NMDA 3P38A 4A62A 3OBYA 1RT7A 1KFDA 1EX4A 2XRIA 5DK5A 4X64K 2HBJA 2ASMA 4BRKA 2FXUA 1BU6O 1YJWN 4FJ8A 4H0TB 4CI6A 4BWMA 1NJWA 3L2RA 5KGXA 1JLBA 1HYVA 3OYEA 3DAWA 4GY2B 3OS0A 4EHTA 3NH2A 5GINA 1T7PA 1N36K 1HR0K 4PWDA 4CZIA 3QLHA 5EOYA 1MA9B 4DR2K 1RGIA 2NZTA 3OYAA 3C6HA 1ILYA 1OKJA 2HF4A 3ZSVA 4K41A 3E9PA 4M3WA 4CEEA 1ASVA 5AQWA 2XY7A 3THYB 3ENOA 2Q1NA 3O3GA 4B8CA 3CERA 3VTHA 3QFPA 3KD1E 1GOBA 4FJ5A 4DSKA 2DY4A 1N6QA 1WBDA 1U49A 4YOUA 3AVBA 1TKZA 2QM1A 3QDKA 5KI6A 2P9PB 3RMAA 4FK2A 1YVNA 4IBNA 3CFOA 4B1ZA 3LPUA 1IKXA 4BREA 3DRRA 1K8KB 5GADP 3CXCM 4TSXA 1BIUA 4LFCK 4CIGA 3ENHA 3HSTB 4NYNA 4GKJK 2OZSA 4AF1A 2Q36A 3L4IA 1B9DA 2FF6A 1HMVA 2NRTA 4BVPA 3I55N 3CYMA 5F0XA 3VGLA 3NHGA 2HBMA 4FWSA 4HHTA 2D1KA 4JK9A 4BG8A 4FO0A 4E7KA 4FWMA 2EX3A 3QICA 4DF8A 3EEQA 3KIOA 1TKTA 4NCGA 4A5BA 4CERA 3NVKA 3BZKA 3UIQA 3AVCA 4BRMA 4Z4EA 4FM2A 3KZBA 2HB5A 3DM2A 3HVRA 5EXWA 2HSTA 4Z0UA 3SUNA 4KHUA 5BPLA 1NJXA 4C8NA 3A5MC 2GX9A 4MO4A 1QZ5A 4FWKA 4BEBA 1EO1A 1KLMA 3UKUB 4FLWA 2YJFA 1TK5A 4ZTFA 5ELZA 5D3GA 2EWSA 4LSLA 5J2MA 3MWTA 4Q5VA 4C8OA 1BO5O 1WSJA 4OPKA 1V4SA 3SYZA 2F96A 1VK0A 2YNGA 3M5RA 3QBXA 3LWLA 1NK9A 1QS4A 1HNZK 4E19A 1JLFA 4WQ5C 3D6RA 2QI2A 1KVAA 4BC2A 1GLJO 3GG4A 3I0SA 2JWLA 4BR9A 4HUFA 3HOSA 2XY8A 3KWGA 4HCBA 3DRPA 4DR6K 2E4LA 4KTWA 4LF6K 4KREA 3CPWM 2HW3A 3EZ5A 2QEXN 3O80A 3AVFA 4UQGA 5GIOA 3CJAA 4FLYA 2NRWA 5AQKA 3RMBA 4A59A 3I8BA 3UKRA 2E20A 3BP8A 2F8TA 2QTDA 3V6DA 3V9UA 1LV5A 1QQNA 1JLEA 2VGMA 3UB5A 2FBVA 2NRHA 4FPBA 5LJWA 2G8WA 3DLKA 3D7EO 1XNRK 3B6OA 4MLHA 4IO9L 3NMUA 4IXCA 2P9SA 3M1FA 4MQ3A 4CVNE 4KBOA 1XC3A 4JKEA 1FXXA 2IIRA 3OYJA 1MWMA 2Q0RA 1QQMA 4GVEA 4YOYA 2P9KA 3OTOK 4DV0K 5KPZA 3HBTA 3HZ6A 5LMUK 1IV0A 1NK8A 4FYDA 4KRFA 3M6GA 4BR4A 2E8AA 4BRHA 2D0CA 3TAGA 2O8FB 1RBTA 1SAZA 1SL2A 2CGJA 1BUPA 4KHWA 1Q7YO 1R0AA 4O8UA 3K9KA 5DMRA 4BDZA 3E9LA 1QSSA 3WNFA 3THWA 1RBVA 3VQ5A 3A5OC 1X9SA 3DLHA 5C42A 4C1NK 1NJYA 2YHXA 2C1GA 3CPEA 4B9QA 4DR1K 3WUHA 4QAGA 4JI0K 4QS9A 1RTHA 3OYBA 4RW4A 3TSQA 5E41A 3THXB 3ZLJA 4B3MK 2BE2A 4JKHA 3OJSA 3TAEA 5KQDA 3VQ9A 1CZ9A 4CGDA 4OO1J 5DM6L 4NLBA 5I9EB 1LWCA 2NNWA 1IKYA 3J80O 1NGCA 3SJHA 2XHBA 2KHOA 3ATVA 4H03B 3VEVA 2E2QA 3C6AA 4CJ4A 5FRNA 4CECA 1KLNA 3H46O 3CHWA 5TKYA 3I8DA 5C15A 1LWEA 2RF2A 3ZX0A 2YNFA 2BDPA 3KD5E 4KI4A 3E9OA 1BI4A 4JKAA 2P9PA 3O4QA 3DXMB 2FF3B 1YI2N 1VSDA 5M1OA 4FJIA 4BR7A 2YX6A 1MWKA 3OYNA 1K8KA 3I56N 3AA2A 5M1NA 4CZFA 4OKJA 4CF8A 3VF2A 4GMJB 4OKEA 4BQZA 3QIPA 2UUAK 4CJQA 3V9ZA 3A5LC 3AVNA 1OH6A 4DQIA 4O4GA 3PSFA 4CF9A 3KK7A 1CLQA 1JLCA 3LP2A 3ZYYX 3WEEB 2Y1IA 4ICLA 3RVCA 1JLAA 1G15A 3HL8A 1GOAA 2X6SA 1XNQK 3CFRA 3O1WA 4PKHA 4ISGA 3WXKA 3LAMA 1JXBA 5AQHA 4DV6K 4OLAA 1MU2A 3TSPA 3TAQA 1F21A 3R3LA 1XQSC 1REVA 3SMPA 4CEZA 2D0AA 4M3XA 2E5LK 1XMOK 1BA1A 4CBWA 4NO7A 1TGOA 1D9DA 2QXLA 2D0PA 3K5OA 3U8XA 3VQDA 1A5WA 2P9LB 4WQ4C 1UA1A 4RTFD 4CJ5A 2HBKA 4CZLA 3PO4A 1WSEA 4F2SA 3IUCA 2NRXA 4RCHA 1C0GA 4U67L 3QMLA 4FZXC 2G8IA 4BRLA 3K5LA 4BC5A 4DV1K 2YNIA 3PY8A 4KHQA 4OJRA 1D4XA 4CK1A 3E1YA 3ZCMA 5GIPA 5FLXO 4NYFA 3ZSRA 3O5BA 1NJZA 4DU1A 2Q0UA 3HTVA 3SAHA 4Y0WA 1E4FT 4O8KA 3DLLL 1K73O 5I3UA 3UE5A 4OVLA 1EXQA 3VENA 1XHZA 3T19A 1O1WA 2D0BA 4BACA 1Q86O 4C23A 3K5NA 4IZ9A 4CF0A 4WF9L 2HHSA 2UXBK 3EN9A 3BF1A 3QFUA 4KHPK 1RDWX 1NGHA 1NGGA 3FFKB 1RDUA 4BGAA 3D2FB 2G8UA 5FPNA 4KHYA 1HNWK 1EWQA 1JJ2M 3AO3A 1OH8A 4CGIA 4O44A 3H3OB 3VQCA 4O0IA 4E0DA 4DFKA 1QHTA 2G8KA 4LD0A 1T6CA 2QWLA 1WSFA 3V81A 1S1WA 2O8CB 2PFUA 4B3TK 3SQ4A 4CZGA 3AY9A 4J2BA 3MCPA 2IVNA 4NB4A 4FW2A 2YHYA 3MECA 4QOZB 4J2AA 5C2FA 3SQ2A 3RMDA 2O8FA 4I7FA 2DPNA 1S72N 4K8ZA 4JKDA 4L3QA 4DTXA 4DTSA 3BZCA 4DU3A 4WFNL 1TK0A 5CZ1A 2NUBA 2PBDA 2RN2A 1LW2A 3CM5A 5FPDA 5JS1A 3OYIA 4AHUA 4FSVA 4DR4K 1TV6A 4DQ8A 3IDHA 4H5WA 2RPIA 2KKZA 4M3YA 2UXCK 1J5OA 1YF5L 3PUFA 5FDLA 4IDKA 4N5SA 3C7NB 3RRHA 1GLDG 2HHHK 1SKWA 3P1GA 3HPOA 4FCYA 4JKCA 4L8RB 2YHWA 1VQNN 1S22A 4BQLA 5HROA 4CJKA 3ZSWA 4DV2K 5KQ8A 3H1VX 3K57A 3MCAB 3G0ZA 4DG1A 1KFSA 1VHXA 4YOVA 3NGYA 1HYSA 1TL3A 1VSFA 2RE2A 3K9JA 1TL1A 3MN5A 1XUPO 1EP4A 4PL7A 4JS5A 4RG8A 2G8VA 3KK3A 2OANA 4CD1A 4FXDA 1OVQA 4CD3A 3MWPA 2KFNA 2VYPA 3UKRB 1NKEA 1ESVA 2OPPA 3RTVA 4IO8A 5AFUH 3O9TA 3TAPA 3CMEN 1HUXA 3DXMA 2HNDA 4ZHRA 4CJEA 1ZBHA 1S1TA 2JWKA 4CW7B 3CI5A 4KO0A 4BRIA 3J7AP 3QBWA 2QWNA 1YVUA 4K8XA 5AQQA 2QWQA 4E72A 1M1KO 4GNIA 3C95A 2OTJN 3CC2N 1NGEA 3OHRA 3CIPA 3VTIA 3PV8A 3QO9A 5TKWA 3HP9A 3O08A 5AQNA 3CJ9A 3WEEA 3QERA 3AO2A 2HHWA 2X74A 5CYQA 4GV3A 3VA3A 4IWVA 4FVUA 4CJTA 5FROA 4IG0A 3SK3A 2W00A 3CQYA 4BE0A 1LAWA 3LP0A 5I42A 3OYGA 3NF8A 2E1ZA 1VSHA 3A5NC 2P9IB 3GDQA 1J54A 3L2VA 3THWB 3VEXA 1C1AA 3O6WA 2VG6A 5JLHA 3O8MA 1RDCA 2P9LA 4WQ5A 1NK5A 3ID6A 4C1NI 3VQ4A 3QETA 3VA0A 3P83D 4OPHA 4B1XB 3DMJA 1L5UA 1U45A 1VQ9N 3C65A 1GLEG 1ZBFA 3OVNA 3VQ7A 3V1QA 4OX9K 3S5TA 4JRPA 4IOAL 4NLCA 1YJ9N 1BWFO 1N8RO 4YOWA 2O4GA 3D2EA 3VGKA 4ZTJA 4LF4K 3QEVA 1DLOA 2HMIA 4RW6A 4BRGA 4CHZA 4KI6A 1YT3A 1GLAG 2UYTA 4YY3K 3B8AX 3KLEA 5GAEP 3WQUA 2VWJA 4OGCA 1C6VA 1Z6RA 3JS6A 3G71N 3VGMA 1Q82O 1WSIA 4XH5A 2HBLA 4JK8A 4FJHA 3O3HA 1BI4B 3MN6A 1VQKN 3DLBA 3D2FA 4H5RA 1VQ8N 1D9FA 4BWJA 3RR8A 4DU4A 1RCHA 4KAZA 2FLOA 1GOCA 1ZBSA 4M3TA 3FZKA 1VAZA 3L6QA 3IAYA 2R7YA 3LAKA 3NF7A 5KPRA 3ZT4A 1LCUA 3C6TA 1KQSM 1XC9A 3HI0A 3CCUN 2O8CA 3MEGA 3M8QA 1IBLK 1KVCA 3AVLA 5BRHA 1VQ7N 3H45C 4OGEA 4CK2A 4DV3K 1G99A 1QTMA 3RR7A 1BGXT 3DLGA 1Q9YA 3VQ6A 1BG3A 4DSIA 1RT5A 4PQUA 1RDDA 1BOTO 1DTTA 4CGGA 4E1JA 2FSKA 2HMPA 1HJRA 2OPSA 5AQTA 1JL1A 1SZ2A 2H3GX 1N33K 1EQYA 3THVA 5BPMA 4DLEA 2ZJRL 2P9NB 4KPYA 4CBUA 3LP1A 3FLCO 4EIAA 4M7YA 4AH9A 5HLFA 3IMXA 4E89A 5LMNK 2VCPA 2ZGYA 3V9SA 3MN9A 3NGZA 1T44A 3C7NA 3NE6A 4A61A 2P5GA 3EKSA 3MEEA 3TR8A 3J7ZO 1VSLA 3JAMO 3M8SA 3OA9A 3IFRA 5C25A 4PHTX 4BECA 4CJLA 4X65K 3WNEA 5HRRA 4DSJA 3P4IA 4CHNA 3AAQA 1KCFA 2C1IA 2G8FA 3ID8A 1NU0A 1X3NA 3PSIA 4Z4FA 3CJCA 2ZGZA 4J8FA 4JI5K 1KXPA 4E7IA 5J2NA 4Z4GA 3L4QA 1Z05A 4BVOA 2HNYA 5H1SQ 2E6MA 5LY3A 2VG5A 3JSMA 1FK9A 1ZBIA 4K43A 4B1UB 3L3VA 1JCFA 1T6DA 4Y1CA 3SCXA 1GLFO 2QKBA 1A5VA 3O4WA 4N47A 3N4PA 1Y64A 5AZJB 1SKSA 3PLAA 2ITGA 3KKSA 3VQEA 1HNVA 2QWPA 3AVJA 5AR0A 3HO1A 3C94A 4FOIA 4CZJA 1A5XA 1U48A 3NGIA 1SKRA 1W7AA 4JKGB 1DKGD 3KVGA 2Q3SA 4CE9A 4FWQA 5AJ3K 3AVHA 5JS2A 4DQRA 4Y1DA 3T1HK 4DWIA 1W9HA 1YXQA 1SL1A 1HX1A 4A5AA 4AHVA 1HNXK 4DV5K 2E6LA 4I9QA 4C8LA 4WQ4A 3MDQA 4BR0A
chains in the Genus database with same CATH topology
2A41A 4ISEA 1NLVA 3G6EN 2ASPA 2WBNA 3LDQA 5CR4A 2HBKA 4CZLA 4H0XB 1TUUA 3RSEB 1ATNA 3OW2M 4BRNA 3WQTA 3IUCA 2NRXA 4RCHA 1C0GA 4U67L 5C2DA 3CMEN 3QMLA 3LDNA 4G9ZA 2P9IA 3FE1A 5C0YA 4BRLA 3H6EA 3ULEA 3M3ZA 4BC5A 4JAXA 1SS6A 1D4XA 4FWPA 4IJAA 1E4GT 1W97L 4FWOA 3VF6A 3E1YA 3VEYA 5GIPA 2HOEA 1VQPN 2CGLA 3O5BA 2NLXA 4F9OA 3IKMA 1VQON 2GTDA 2Q0UA 3HTVA 3SAHA 5BR9A 3BF3A 4Y0WA 1Q81O 1GLCG 2J4RA 3PIOL 3DXKA 1E4FT 4Z94A 1W2BM 4O8KA 3DLLL 1K73O 3UE5A 3VENA 3CC4N 1WUAA 3MK6A 4DB3A 1NGDA 2YJEA 3AAPA 4BR5A 1P90A 1DT9A 1Q86O 1TYQB 2BTFA 3MX2A 4IJNA 4C23A 3LM2A 3EE9A 4IZ9A 3TTFA 1VQMN 1ATRA 4WF9L 4IEEA 1QVFM 4IDHA 2WC9A 2ZWHA 3EN9A 3BF1A 3QFUA 5FPEA 4GV6A 1RDWX 5E26A 2F7TA 1K8AO 3I33A 1NGHA 1NGGA 3FFKB 5JMVA 2ZJQL 2P9SB 3LM9A 1RDUA 3EE8A 4MDBA 2QA4N 4BGAA 3D2FB 3N4QA 5FPNA 5EVZA 1JJ2M 4BRDA 3CCQN 2P9KB 3FZMA 2V7YA 3ATUA 2E2PA 2VGNA 3H3OB 3EO3A 1KAYA 5CHIA 4A2BA 4IOXA 4I6MB 3AGKA 5BPNA 1T6CA 3NVMA 2QWLA 4JNEA 3VPZA 1IJJA 5B8HA 1ZXOA 2PFUA 4OPAA 4KH5A 3FZFA 4CZGA 2E2NA 5BREA 3AY9A 3H3NO 1O13A 3MCPA 2IVNA 4NB4A 3HSCA 4ILGB 2AP1A 4JK7A 2WFBA 2YHYA 2QWMA 1DGKN 4YOTA 3VEOA 3J8AA 4XJXA 5C2FA 1NMDA 2QWRA 3O9RA 4CBXA 3P38A 4A62A 4H0PA 3OBYA 2FSJA 4FWNA 2E2OA 4MO5A 2DPNA 1QVGM 2HBJA 1S72N 4JKDA 4L3QA 2ASMA 3RSEA 4BRKA 2FXUA 3VERA 1BU6O 4EAHD 1YJWN 5M1KA 4WFNL 4H0TB 4CI6A 2PBDA 1WOQA 2ZJPL 5FPDA 2V52B 4FSVA 3OBWA 1YITN 4PL8A 3G25A 5H1SQ 3G4SN 3DAWA 4GY2B 1TUYA 5AQLA 3IDHA 4DQ8A 4WYBA 4H5NA 4EHTA 5GINA 4H5WA 2GWJA 2KKZA 4CZIA 3KHYA 1YF5L 1MA9B 5EOYA 1RGIA 2NZTA 1X9JA 3C7NB 3WXMB 5AQVA 4CJ7A 4ISFA 3C6HA 1ILYA 1GLDG 1OKJA 2HF4A 4K41A 3R1XA 3E9PA 3VETA 5F1XA 5AQWA 4JEPA 4JKCA 5M1FA 3ENOA 2Q1NA 4EFHA 1KAXA 1JCEA 2YHWA 1NM1A 3CERA 5AQUA 2P9NA 3VTHA 4BR9A 1VQNN 1S22A 4BQLA 4FPAA 3MMVA 3CCJN 3QB0A 3QFPA 4KH4A 3VEZA 5JLFA 5KQ8A 3H1VX 1KAZA 3MCAB 4H5VA 5AQPA 3HOTA 3ZX2A 4QS7A 4YOUA 3CC7N 5BN8A 3O1BA 3QDKA 2QM1A 2I7PA 3CQXA 2P9PB 3CJBA 1YVNA 4BRFA 4B1ZA 4YOVA 2RE2A 3BUZB 3K9JA 4BREA 4ILJA 3ZETB 1K8KB 3MN5A 3VESA 5GADP 3CXCM 1XUPO 4PL7A 3W3DA 2P9UB 2OANA 4CD1A 3ENHA 4CD3A 1T3VA 5MLCQ 3MWPA 3D2EB 4IFEA 2VYPA 5AQRA 4ILHA 4XH1A 3UKRB 4I6MA 2CH5A 4AF1A 1ESVA 5JVHL 2Q36A 3L4IA 2FF6A 1VQLN 4IO8A 1HKGA 5EY4A 2NRTA 1J6ZA 5AFUH 3O9TA 4BVPA 5AZIB 2GWKA 1HUXA 4IEIA 4B1VA 5F0XA 4JD2A 3I55N 3DXMA 1YJNN 3VGLA 3ENBA 1NJIO 2AA4A 2HBMA 1SQKA 2Q2RA 2JWKA 2D1KA 3CI5A 4FWSA 4JK9A 5BRFA 4BRIA 1M90O 3QBWA 2QWNA 2W41A 4BG8A 4FO0A 4DHYA 5AQQA 1VQ6N 2QWQA 4FWMA 1M1KO 4GNIA 2YI1A 4H0VB 2BUPA 3GE1A 5HL7L 2OTJN 3CC2N 1NGEA 3QICA 3OHRA 4BC2A 3CIPA 3VTIA 5TKWA 4A5BA 3U4LA 3O08A 4XH4A 3NVKA 3F5TA 5AQNA 3W0LA 5AZJA 3CJ9A 4BRMA 3WEEA 3CETA 4K25A 3KZBA 4FWLA 5EXWA 2HSTA 4BGBA 4CZKA 4AM7A 4GV3A 4H0OA 4IWVA 4FVUA 2WUSA 5BPLA 3A0IX 3SLCA 2HF3A 2PAVA 1YIJN 3A5MC 2GX9A 4MO4A 4WFBL 1QZ5A 4FWKA 2A40A 2A5XA 5FPMA 4RWTA 3SK3A 4BEBA 1EO1A 1NWKA 3CQYA 2W00A 3FR0A 3UKUB 2V51B 3CCMN 2YJFA 3MN7A 4JKGA 1X3MA 3DJCA 5ELZA 3WXJA 2EWSA 3ZEUB 4DCHA 4HWIA 5HOOA 3MWTA 1BO5O 2E1ZA 1V4SA 2ZF5O 3A5NC 2P9IB 3WXLA 3GDQA 2KLAA 3TTDA 3ULEB 3O9QA 2A6AA 3VEXA 2E1YA 4CZHA 3Q7CA 3M5RA 2BH1A 3O6WA 4BRQA 3QBXA 5JLHA 3O8MA 3D6RA 4WQ5C 2QI2A 3TU5A 2P9LA 1GLJO 2I7NA 3GG4A 2JWLA 4K42A 4WQ5A 4A57A 4BC3A 3HOSA 1KD1O 3ID6A 3KWGA 2YCHA 4C1NI 3PIPL 1S3XA 1HKBA 2RHKA 4DKWA 1BA0A 4OPHA 4CZEA 4B1XB 3CPWM 1VQ9N 3C65A 1GLEG 1YUWA 2QEXN 3O80A 1JCGA 4JKFA 3ZETA 3O9SA 5GIOA 3Q7BA 5JVGL 2Q97A 3CJAA 1P8ZA 4JHDB 2NRWA 5AQKA 3ZX3A 1LOTB 4IOAL 5KPTA 4NLCA 4YOXA 1YJ9N 1BWFO 1N8RO 2D0OA 4A59A 3D2EA 3VGKA 4YOWA 3I8BA 1YHQN 3UKRA 4BRCA 5M1QA 4BG9A 2E20A 1DEJA 3T7ZA 3AARA 3BP8A 5AQZA 4BRGA 1NGFA 4FL9A 3GBTA 3A8YA 4YDUC 3T69A 4PKIA 3CD6N 4YDUA 1GLAG 3KWIA 2UYTA 2QTDA 4BRAA 2F9TA 3B8AX 5JICA 3LL3A 5GAEP 1QQNA 1TYQA 2VGMA 3UB5A 2NRHA 3U9DA 3WQUA 1NBWA 4FPBA 5LJWA 3CCLN 4CZMA 3D7EO 2CGKA 3HRGA 5CE3A 4MLHA 3F2KA 1Z6RA 3JS6A 3G71N 3VGMA 4IO9L 1Q82O 4XH5A 3NMUA 2HBLA 4H0YB 4JK8A 3SBTA 5LJVA 4IXCA 2P9SA 3M1FA 4M63C 4FOEA 3MN6A 5EX5A 4KBOA 3F9MA 1VQKN 1XC3A 4O5FA 4JKEA 3D2FA 4H5RA 2IIRA 5AQXA 1MWMA 2Q0RA 3CCRN 1QQMA 1VQ8N 3WT0A 4WCEL 3EKUA 4U7BA 2F9WA 4GVEA 4YOYA 2FLOA 2P9KA 3H1QA 4JKBA 5KPZA 1ZBSA 3HBTA 3HZ6A 5BN9A 3U9ZA 5AFUA 3CCEN 2V7ZA 3FZKA 3O9UA 3FZLA 1VAZA 3M6GA 3EZWA 2VWBA 3VEWA 3L6QA 4BR4A 2NRVA 2E8AA 4BRHA 5KPRA 3VOVA 1LCUA 2NRZA 3GL1A 3VMFB 1SAZA 1KQSM 3UKUA 3HI0A 5GAHP 4PKGA 2CGJA 4MLEA 3HM8A 1BUPA 3ZEUA 3TSUA 3CCUN 3P31A 1Q7YO 3CJ1A 5BRHA 4O8UA 3K9KA 1VQ7N 5BRDA 4BY9C 3E9LA 3H45C 4IOCL 5M1PA 4BR2A 2W40A 1G99A 2Q31A 2E88A 4JN4A 4EHUA 1NGIA 5AQFA 4R79A 3A5OC 1BG3A 4B1YB 1QQOA 1QZ6A 2IVPA 4C1NK 2CH6A 1H1VA 2YHXA 2C1GA 1BOTO 3CPEA 4A2AA 4B9QA 3WUHA 4E1JA 2FSKA 2HMPA 1K9MO 5AQTA 1NGAA 2ASOA 4BR0A 4QS9A 1HKCA 4GV9A 2ITMA 1MDUB 1SZ2A 3SAGA 1GLLO 2H3GX 4BRPA 1V4TA 1YAGA 1EQYA 1U2VB 3SMSA 3TSQA 3CJ7A 5BPMA 4MDAA 2ZJRL 4JKHA 2P9NB 4JHDA 4CBUA 5KQDA 4B1WB 1CZAN 3FLCO 3R6MA 4EIAA 4M7YA 4OO1J 5DM6L 4NLBA 1IG8A 2GUPA 3VF4A 2NNWA 3IMXA 5I9EB 1HJOA 2VCPA 1OVYA 2ZGYA 3MN9A 5AQOA 4QS8A 1T44A 3CCVN 4WFAL 3JXUA 1NGCA 3C7NA 4BROA 3SJHA 2QW9A 2KHOA 3ATVA 4H03B 4A61A 3CMAN 3EKSA 3VEVA 1HPMA 3J7ZO 2E2QA 5F2RA 3C6AA 3OA9A 3C0BA 3IFRA 4PHTX 3CF5L 4BECA 3H46O 3CHWA 5TKYA 3E66A 5C15A 4M7XA 3L0QA 3AGRA 3ZX0A 3P4IA 5C10A 3AAQA 2C1IA 5DM7L 3E9OA 1KC8O 2A42A 3DXKB 3ID8A 1U6ZA 4JKAA 2P9PA 5E84A 3GOIA 1X3NA 4H5TA 5GAGP 3MX5A 4LC9B 3CJCA 4XEIA 4JD2B 3DXMB 5AQGA 5AQIA 2FF3B 2ZGZA 3EL2A 4YORA 1YI2N 3LDOA 5M1OA 4J8FA 4BR7A 2QWOA 1KXPA 1MWKA 1K8KA 2YX6A 3I56N 1Q18A 5AQYA 5M1NA 3L4QA 1ATSA 1Z05A 3R8EA 4BVOA 4CZFA 3SBGA 3VF2A 4BQZA 2P9UA 5C12A 5LY3A 3SAFA 3S41A 4K43A 4B1UB 1JCFA 3A5LC 1T6DA 2A3ZA 2D4WA 2GELA 5AQSA 3KK7A 1GLFO 3O4WA 3N4PA 1RFQA 1Y64A 5AZJB 3LDPA 3PLAA 3ZYYX 3WEEB 5AZIA 1QHAA 3FGUA 3RVCA 2QWPA 3R9PA 5AR0A 3TTCA 1R59O 4BC4A 4BE7B 3CCSN 4FOIA 1C0FA 4CZJA 3O1WA 5AQJA 1GLBG 4UY8O 4FWRA 4PKHA 2OTLN 4ISGA 3WXKA 1NGJA 4JKGB 1DKGD 3KVGA 5ADXA 5AQHA 3TPQA 3BEXA 4FWQA 2GEMA 3TSPA 1NGBA 3DWLA 2NRRA 3R3LA 1XQSC 1U2VA 3SMPA 1YXQA 1VQ5N 1HX1A 4AM6A 1VQ4N 1ZC6A 3LDLA 4KH6A 4A5AA 1BDGA 1HLUA 3P39A 5ADXH 1BA1A 4CBWA 4NO7A 2QXLA 2D0PA 5AQMA 3U8XA 4HTLA 2IVOA 2P9LB 4WQ4C 4WQ4A 3WXIA 3MDQA 3FZHA 2FSNA 4RTFD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A41 A;  4ISE A;  1NLV A;  2ASP A;  3LDQ A;  4CZL A;  4H0X B;  1TUU A;  3RSE B;  1ATN A;  4BRN A;  3WQT A;  3IUC A;  4RCH A;  1C0G A;  3QML A;  3LDN A;  2P9I A;  3FE1 A;  4BRL A;  3H6E A;  3ULE A;  3M3Z A;  4BC5 A;  4JAX A;  1D4X A;  4FWP A;  4IJA A;  1E4G T;  4FWO A;  3VF6 A;  3VEY A;  2HOE A;  2CGL A;  3O5B A;  2NLX A;  4F9O A;  2GTD A;  2Q0U A;  3HTV A;  5BR9 A;  3BF3 A;  4Y0W A;  1GLC G;  2J4R A;  3DXK A;  1E4F T;  4Z94 A;  4O8K A;  3UE5 A;  3VEN A;  1WUA A;  3MK6 A;  4DB3 A;  1NGD A;  2YJE A;  3AAP A;  4BR5 A;  1TYQ B;  2BTF A;  4IJN A;  4C23 A;  3LM2 A;  4IZ9 A;  1ATR A;  2ZWH A;  3EN9 A;  3BF1 A;  3QFU A;  5FPE A;  1RDW X;  5E26 A;  3I33 A;  1NGH A;  1NGG A;  3FFK B;  5JMV A;  2P9S B;  3LM9 A;  4BGA A;  3D2F B;  5FPN A;  5EVZ A;  4BRD A;  2P9K B;  3FZM A;  2V7Y A;  3ATU A;  2E2P A;  3H3O B;  3EO3 A;  1KAY A;  4A2B A;  4I6M B;  5BPN A;  1T6C A;  2QWL A;  4JNE A;  3VPZ A;  1IJJ A;  5B8H A;  1ZXO A;  3FZF A;  4CZG A;  2E2N A;  5BRE A;  3AY9 A;  3H3N O;  3MCP A;  2IVN A;  4NB4 A;  3HSC A;  2AP1 A;  2YHY A;  3VEO A;  2QWM A;  1DGK N;  3J8A A;  1NMD A;  2QWR A;  4CBX A;  4A62 A;  4H0P A;  2FSJ A;  4FWN A;  2E2O A;  4MO5 A;  2DPN A;  4L3Q A;  2ASM A;  3RSE A;  4BRK A;  2FXU A;  3VER A;  1BU6 O;  4EAH D;  4H0T B;  4CI6 A;  2PBD A;  1WOQ A;  5FPD A;  2V52 B;  4FSV A;  4PL8 A;  3G25 A;  3DAW A;  4GY2 B;  1TUY A;  5AQL A;  3IDH A;  4DQ8 A;  4WYB A;  4H5N A;  4EHT A;  4H5W A;  2GWJ A;  4CZI A;  3KHY A;  5EOY A;  1MA9 B;  1RGI A;  2NZT A;  1X9J A;  3C7N B;  4CJ7 A;  5AQV A;  4ISF A;  1GLD G;  1OKJ A;  2HF4 A;  4K41 A;  3VET A;  5F1X A;  5AQW A;  3ENO A;  2Q1N A;  4EFH A;  1KAX A;  1JCE A;  2YHW A;  1NM1 A;  3CER A;  5AQU A;  2P9N A;  1S22 A;  4BQL A;  4FPA A;  3MMV A;  3QB0 A;  3QFP A;  3VEZ A;  5JLF A;  5KQ8 A;  3H1V X;  1KAZ A;  4H5V A;  5AQP A;  3ZX2 A;  4QS7 A;  5BN8 A;  3O1B A;  3QDK A;  2QM1 A;  2I7P A;  3CQX A;  2P9P B;  3CJB A;  1YVN A;  4BRF A;  4B1Z A;  3BUZ B;  4BRE A;  3ZET B;  1K8K B;  3MN5 A;  3VES A;  1XUP O;  4PL7 A;  3W3D A;  2P9U B;  2OAN A;  4CD1 A;  3ENH A;  4CD3 A;  3D2E B;  2VYP A;  5AQR A;  4XH1 A;  3UKR B;  4I6M A;  2CH5 A;  1ESV A;  2Q36 A;  3L4I A;  2FF6 A;  4IO8 A;  1HKG A;  5EY4 A;  1J6Z A;  5AFU H;  4BVP A;  5AZI B;  2GWK A;  1HUX A;  5F0X A;  4JD2 A;  3DXM A;  3VGL A;  2AA4 A;  4FWS A;  1SQK A;  2Q2R A;  2D1K A;  3CI5 A;  5BRF A;  4BRI A;  3QBW A;  2QWN A;  2W41 A;  4BG8 A;  4FO0 A;  4DHY A;  5AQQ A;  2QWQ A;  4FWM A;  4GNI A;  2YI1 A;  4H0V B;  2BUP A;  3GE1 A;  1NGE A;  3QIC A;  3OHR A;  3CIP A;  3U4L A;  3O08 A;  4XH4 A;  5AZJ A;  5AQN A;  3W0L A;  3CJ9 A;  4BRM A;  3WEE A;  3CET A;  4K25 A;  3KZB A;  4FWL A;  5EXW A;  4BGB A;  4CZK A;  4AM7 A;  4H0O A;  4IWV A;  2WUS A;  5BPL A;  3A0I X;  3SLC A;  2HF3 A;  2PAV A;  3A5M C;  4MO4 A;  1QZ5 A;  4FWK A;  2A40 A;  2A5X A;  5FPM A;  4RWT A;  3SK3 A;  1NWK A;  3CQY A;  3FR0 A;  3UKU B;  2V51 B;  2YJF A;  3MN7 A;  1X3M A;  3DJC A;  5ELZ A;  3WXJ A;  2EWS A;  3ZEU B;  4DCH A;  4HWI A;  1BO5 O;  2E1Z A;  1V4S A;  2ZF5 O;  3A5N C;  2P9I B;  3WXL A;  3GDQ A;  3ULE B;  2A6A A;  3VEX A;  2E1Y A;  4CZH A;  3O6W A;  4BRQ A;  3QBX A;  5JLH A;  3O8M A;  4WQ5 C;  4B1V A;  4BC2 A;  3TU5 A;  2P9L A;  1GLJ O;  2I7N A;  3GG4 A;  4K42 A;  4WQ5 A;  4BR9 A;  4BC3 A;  2YCH A;  1S3X A;  1HKB A;  1BA0 A;  4CZE A;  4B1X B;  1GLE G;  1YUW A;  3O80 A;  1JCG A;  3ZET A;  2Q97 A;  3CJA A;  1P8Z A;  4JHD B;  5AQK A;  3ZX3 A;  1LOT B;  5KPT A;  1BWF O;  2D0O A;  3D2E A;  3VGK A;  3I8B A;  3UKR A;  4BRC A;  4BG9 A;  2E20 A;  1DEJ A;  3AAR A;  3BP8 A;  5AQZ A;  4BRG A;  1NGF A;  4FL9 A;  3GBT A;  3A8Y A;  4YDU C;  4PKI A;  4YDU A;  1GLA G;  2UYT A;  4BRA A;  2F9T A;  3B8A X;  5JIC A;  3LL3 A;  1QQN A;  1TYQ A;  3UB5 A;  2NRH A;  3U9D A;  3WQU A;  1NBW A;  4FPB A;  5LJW A;  4CZM A;  3D7E O;  2CGK A;  5CE3 A;  4MLH A;  1Z6R A;  3JS6 A;  3VGM A;  4XH5 A;  4H0Y B;  5LJV A;  4IXC A;  2P9S A;  3M1F A;  4M63 C;  4FOE A;  3MN6 A;  5EX5 A;  4KBO A;  3F9M A;  1XC3 A;  4O5F A;  3D2F A;  4H5R A;  2IIR A;  5AQX A;  1MWM A;  2Q0R A;  1QQM A;  3WT0 A;  3EKU A;  2F9W A;  2FLO A;  2P9K A;  3H1Q A;  5KPZ A;  1ZBS A;  3HBT A;  3HZ6 A;  5BN9 A;  3U9Z A;  5AFU A;  2V7Z A;  3FZK A;  3FZL A;  3M6G A;  3EZW A;  2VWB A;  3VEW A;  3L6Q A;  4BR4 A;  2E8A A;  4BRH A;  5KPR A;  3VOV A;  1LCU A;  3GL1 A;  1SAZ A;  3UKU A;  3HI0 A;  4PKG A;  2CGJ A;  4MLE A;  3HM8 A;  1BUP A;  3ZEU A;  3CJ1 A;  5BRH A;  5BRD A;  3H45 C;  4BR2 A;  1G99 A;  2W40 A;  2Q31 A;  2E88 A;  4JN4 A;  4EHU A;  1NGI A;  5AQF A;  3A5O C;  1BG3 A;  4B1Y B;  1QQO A;  1QZ6 A;  2IVP A;  2CH6 A;  1H1V A;  2YHX A;  1BOT O;  4A2A A;  4B9Q A;  3WUH A;  4E1J A;  2FSK A;  2HMP A;  5AQT A;  1NGA A;  2ASO A;  4BR0 A;  4QS9 A;  1HKC A;  2ITM A;  1MDU B;  1SZ2 A;  1GLL O;  2H3G X;  4BRP A;  1V4T A;  1YAG A;  1EQY A;  1U2V B;  3SMS A;  3CJ7 A;  5BPM A;  2P9N B;  4JHD A;  4CBU A;  5KQD A;  4B1W B;  1CZA N;  3FLC O;  3R6M A;  4EIA A;  4M7Y A;  5I9E B;  1IG8 A;  2GUP A;  3VF4 A;  3IMX A;  1HJO A;  2VCP A;  2ZGY A;  3MN9 A;  5AQO A;  4QS8 A;  1T44 A;  3JXU A;  1NGC A;  3C7N A;  4BRO A;  3SJH A;  2QW9 A;  2KHO A;  3ATV A;  4H03 B;  4A61 A;  3EKS A;  3VEV A;  1HPM A;  2E2Q A;  5F2R A;  3C0B A;  3IFR A;  3H46 O;  3CHW A;  5TKY A;  4M7X A;  3L0Q A;  3ZX0 A;  3P4I A;  3AAQ A;  2A42 A;  3DXK B;  3ID8 A;  1U6Z A;  2P9P A;  5E84 A;  3GOI A;  1X3N A;  4H5T A;  4LC9 B;  3CJC A;  4XEI A;  4JD2 B;  3DXM B;  5AQG A;  5AQI A;  2FF3 B;  2ZGZ A;  3EL2 A;  3LDO A;  4J8F A;  4BR7 A;  2QWO A;  1KXP A;  1MWK A;  1K8K A;  1Q18 A;  5AQY A;  3R8E A;  1ATS A;  1Z05 A;  4BVO A;  4CZF A;  5LY3 A;  3VF2 A;  4BQZ A;  2P9U A;  3S41 A;  4K43 A;  4B1U B;  1JCF A;  3A5L C;  1T6D A;  2A3Z A;  2D4W A;  2GEL A;  5AQS A;  1GLF O;  3O4W A;  5AZJ B;  1RFQ A;  1Y64 A;  3LDP A;  3WEE B;  5AZI A;  1QHA A;  3FGU A;  2QWP A;  3R9P A;  5AR0 A;  1R59 O;  4BC4 A;  4FOI A;  1C0F A;  4CZJ A;  3O1W A;  5AQJ A;  1GLB G;  4FWR A;  4PKH A;  4ISG A;  3WXK A;  1NGJ A;  5ADX A;  1DKG D;  3KVG A;  5AQH A;  3TPQ A;  3BEX A;  4FWQ A;  2GEM A;  1NGB A;  3DWL A;  1XQS C;  1U2V A;  3SMP A;  1YXQ A;  1HX1 A;  4AM6 A;  1ZC6 A;  3LDL A;  1BDG A;  1HLU A;  5ADX H;  1BA1 A;  4CBW A;  4NO7 A;  2QXL A;  2D0P A;  5AQM A;  3U8X A;  4HTL A;  2IVO A;  2P9L B;  4WQ4 C;  4WQ4 A;  3WXI A;  3MDQ A;  3FZH A;  2FSN A;  4RTF D; 
#chains in the Genus database with same CATH topology
 1YTA A;  2A41 A;  4ISE A;  4JI8 K;  3LDQ A;  4Z4I A;  4B9T A;  1TUU A;  2KZZ A;  3OW2 M;  4BRN A;  3D0P A;  3WQT A;  3LDN A;  4G9Z A;  2P9I A;  3FE1 A;  3K0S A;  3NDK A;  4FJK A;  1WBB A;  5C0Y A;  5KRT A;  3M3Z A;  4IJA A;  2QK9 A;  4FWO A;  1EWR A;  3VEY A;  2P1J A;  1S1U A;  1HRH A;  1S9E A;  4ELV A;  4F3T A;  4F3O A;  2HHI A;  5BR9 A;  3BF3 A;  2Z1H A;  3DXK A;  4Z94 A;  1LWF A;  1WUA A;  3MK6 A;  2YJE A;  3AAP A;  4BR5 A;  3HK2 A;  1P90 A;  1DT9 A;  1RTJ A;  1TYQ B;  2BTF A;  4IJN A;  3SUQ A;  3AVM A;  4JI7 K;  1HQE A;  4FJN A;  1FKP A;  3SJJ A;  1QVF M;  5FPE A;  2F7T A;  1BCM A;  3I33 A;  1VSE A;  1K8A O;  5JMV A;  1WLJ A;  3HT3 A;  4C8K A;  2W42 A;  4KTZ A;  2Z1J A;  3SQ0 A;  3N4Q A;  2GV9 A;  5EVZ A;  4E1N A;  1WAJ A;  4BRD A;  3FZM A;  2V7Y A;  2E2P A;  1JL2 A;  1KAY A;  2DFH A;  3DLR A;  4IOX A;  3AGK A;  3O4N A;  2F4V K;  4M41 A;  3NVM A;  2Z1G A;  4DS5 A;  4ELU A;  4JNE A;  1IJJ A;  4KH5 A;  3FZF A;  2E2N A;  4DF4 A;  5C24 A;  4AIL C;  4CGJ A;  4JK7 A;  1DGK N;  3O9R A;  3U6F A;  1Z26 A;  1IBK K;  4H0P A;  3SZ2 A;  4FWN A;  2E2O A;  2BAN A;  5LL6 Z;  3S3O A;  2X6N A;  4M3R A;  2GUI A;  2OCE A;  3I0R A;  4PUO A;  3AA4 A;  4BE1 A;  1CXQ A;  4DUZ K;  2ZJP L;  2HVI A;  4E1M A;  1YIT N;  4PL8 A;  3G25 A;  4CED A;  1UA0 A;  4CJR A;  2HVH A;  1TUY A;  5AQL A;  4M42 A;  4B9V A;  4FLX A;  2G8H A;  2IGI A;  3KHY A;  3V1R A;  1I3A A;  4CJP A;  3WXM B;  5AQV A;  5JEN A;  2WOM A;  1QQC A;  4FW1 A;  3R1X A;  4LF7 K;  3ZSY A;  4NCA A;  3HPG A;  5AQU A;  2P9N A;  3S3N A;  3BDP A;  4FPA A;  3MMV A;  4KH4 A;  3NF6 A;  2DFE A;  2KW4 A;  4H5V A;  4QS7 A;  3O1B A;  3NF9 A;  2I7P A;  3CQX A;  3CJB A;  4HVJ A;  4RW9 A;  2B5J A;  3MXI A;  3HXM A;  4ILJ A;  3VES A;  4HUG A;  2QXF A;  4FJJ A;  4X66 K;  4DFP A;  3D2E B;  4CF1 A;  4H8K A;  4XH1 A;  2ZE2 A;  4I6M A;  5JVH L;  3QEP A;  3BY5 A;  1VQL N;  3NH1 A;  1HKG A;  1J6Z A;  4LFA K;  3KK1 A;  2GWK A;  4IEI A;  1YJN N;  3ENB A;  4B9M A;  4KFB A;  4EZ9 A;  3VN5 A;  1SQK A;  2Q2R A;  1M90 O;  1ASW A;  3AA3 A;  3LP3 A;  4DHY A;  1VQ6 N;  3MAQ A;  4H0V B;  2YI1 A;  2O4I A;  4KTQ A;  4KB1 A;  1C1C A;  4ID5 A;  4XH4 A;  3M8R A;  1KTQ A;  3F5T A;  5AZJ A;  3CYG A;  1LW0 A;  5SWM A;  3CET A;  4K25 A;  4B8A B;  4FLZ A;  4CZK A;  4H0O A;  1WAF A;  4AHC A;  4EP4 A;  2HF3 A;  3WNG A;  2PAV A;  3HVT A;  4RWT A;  5FPM A;  4X62 K;  2AJQ A;  4W5O A;  3L2Q A;  1NWK A;  3IS9 A;  1BL3 A;  3MXM A;  3MED A;  1NK4 A;  3CCM N;  4LFB K;  3MN7 A;  4JKG A;  1X3M A;  3DJC A;  3WXJ A;  5HOO A;  4HWI A;  3LZI A;  4PY5 A;  3KTQ A;  3V9W A;  2KLA A;  3TTD A;  3O9Q A;  2FBX A;  3Q7C A;  2BH1 A;  1IH7 A;  1C0M A;  1HPZ A;  4V19 S;  1KD1 O;  3LWM A;  2OA8 A;  3K5M A;  4BC3 A;  4CEQ A;  4FM0 A;  4W5Q A;  5IWA K;  2RHK A;  4DKW A;  1BA0 A;  1YUW A;  4GVM A;  4CFC A;  1JCG A;  4JKF A;  3ZET A;  1ZBU A;  3O9S A;  2YKM A;  3Q7B A;  4JI3 K;  5JVG L;  3ZX3 A;  2JGU A;  3LDS A;  4HTU A;  1LOT B;  5KPT A;  4YOX A;  4RW7 A;  1NNE A;  2D0O A;  3TAB A;  4BRC A;  3RRG A;  1DEJ A;  3CM6 A;  3T7Z A;  4JV5 K;  1RBR A;  3T69 A;  4YDU C;  4PKI A;  3ZSQ A;  1L3S A;  1IKV A;  1B92 A;  4BRA A;  2F9T A;  5JIC A;  5A2Q O;  3LAL A;  1BIS A;  3H08 A;  1TYQ A;  5CY4 A;  2ETJ A;  1NBW A;  2XY5 A;  2XY6 A;  2CGK A;  3HRG A;  1HNI A;  5CE3 A;  3TI0 A;  4FJ7 A;  5LJV A;  4BDY A;  4CEF A;  4FOE A;  2FBY A;  5EX5 A;  3F9M A;  4O5F A;  3CCR N;  3V9X A;  1BIZ A;  3PX6 A;  2DFF A;  4U7B A;  4OLB A;  4LF9 K;  4JKB A;  4BE2 A;  4F2R A;  3U9Z A;  5BN9 A;  2V7Z A;  3NCI A;  3ZT0 A;  3FZL A;  2VWB A;  3VEW A;  2NRV A;  4E7J A;  2P51 A;  3WNH A;  3VMF B;  4CJ3 A;  3V4I A;  4FLU A;  1FKO A;  4PKG A;  4MLE A;  3ZEU A;  3P31 A;  4IFY A;  3CJ1 A;  3HYF A;  4CJS A;  1JXE A;  4BR2 A;  2W40 A;  1T8E A;  1RBS A;  5AQF A;  4R79 A;  1SL0 A;  4B1Y B;  4JI1 K;  1Q8I A;  1NG9 A;  2ASO A;  1HKC A;  4QCL A;  4GV9 A;  1MDU B;  5J1E A;  3SAG A;  1NOY A;  2IS3 A;  4AHS A;  4CFD A;  3SMS A;  1NK7 A;  2PYJ A;  4MDA A;  1JLG A;  4JHD A;  3IRX A;  4B1W B;  1CZA N;  1S1V A;  4O55 A;  1IG8 A;  2GUP A;  3VF4 A;  1HJO A;  1OVY A;  3TAF A;  5AQO A;  3SNN A;  4WFA L;  3JXU A;  3QEX A;  4BRO A;  2QW9 A;  3CMA N;  2JLE A;  4DSF A;  3RWU A;  5CZ2 A;  4CFA A;  4I9L A;  4FJX A;  4CJF A;  4J2D A;  3PX0 A;  4CHO A;  4LH5 A;  3OYF A;  1UWB A;  4CEB A;  5DM7 L;  1KC8 O;  3DXK B;  1U6Z A;  4H5T A;  2OPQ A;  4YNQ A;  4JD2 B;  3FFI A;  3B6P A;  3EL2 A;  4YOR A;  3L8B A;  1ITG A;  4W5T A;  1Q18 A;  3QES A;  5AQY A;  3R8E A;  1ATS A;  5C12 A;  3SBG A;  2O8B B;  3SAF A;  4C8M A;  1DTQ A;  4KB0 A;  3OYK A;  3S41 A;  3T1A A;  1T03 A;  5KRS A;  2A3Z A;  2D4W A;  3NFA A;  4DS4 A;  3U3Y A;  1RFQ A;  3LDP A;  4DTO A;  3S9H A;  2UUC K;  3KLG A;  4B9L A;  3FGU A;  3T1Y K;  3TTC A;  4DFM A;  3CCS N;  3MXJ A;  3DLE A;  1N5Y A;  3QIO A;  4FJL A;  4MFB A;  1RT2 A;  5AQJ A;  4FWR A;  1RT3 A;  2OTL N;  1NGJ A;  4IG3 A;  4M45 A;  3BEX A;  4OKK A;  1SUQ A;  1EET A;  3P5J A;  1J9A A;  4CJU A;  4F4K A;  1U2V A;  2GBZ A;  3AO4 A;  4B3R K;  1VSI A;  1VQ5 N;  4AM6 A;  1VQ4 N;  1X1P A;  1W0H A;  1ZC6 A;  2W6L A;  3LDL A;  5IT9 O;  1HLU A;  3P39 A;  5ADX H;  4HUE A;  2UUB K;  4WE1 A;  1C1B A;  4KKO A;  1NMN A;  3FZH A;  4DSE A;  1NLV A;  1RTI A;  2ASP A;  2WBN A;  5CR4 A;  4DTM A;  3QEI A;  1RDB A;  5C2D A;  1RNH A;  3H6E A;  4JAX A;  1T05 A;  4N41 A;  2IAJ A;  3L2U A;  3LZJ A;  4FWP A;  4FLT A;  1E4G T;  1W97 L;  3DYA A;  2HNZ A;  1CZB A;  4B9U A;  4FJM A;  2NLX A;  4B08 A;  4F9O A;  3IKM A;  3KJV A;  3AO5 A;  4OPJ A;  2J4R A;  3ASM A;  3PIO L;  3BGR A;  2VWK A;  4JI6 K;  4JYA K;  1VSM A;  2KZM A;  4DB3 A;  4LF8 K;  4CIE A;  3OYL A;  1N34 K;  3LM2 A;  3TTF A;  1VQM N;  2KQ2 A;  1ATR A;  4J2E A;  3KLH A;  2YHB A;  1N32 K;  5E26 A;  3SUP A;  2O8D B;  2ZJQ L;  2B6A A;  3KK2 A;  4DTJ A;  3LM9 A;  2IOC A;  1NKB A;  3OY9 A;  4B3S K;  3ZSX A;  5CHI A;  4I2P A;  4Z4H A;  4I6M B;  1J5E K;  1ZXO A;  2HHV A;  3H3N O;  5BR8 K;  3ZSZ A;  3HSC A;  1S9G A;  2AP1 A;  5EU7 A;  3ULD A;  1RDA A;  1VRT A;  2QWR A;  4FZY A;  4DR7 K;  4CBX A;  2IDO A;  2FSJ A;  3LAN A;  4ID1 A;  4MO5 A;  1RT1 A;  1UOC A;  1QVG M;  2HHX A;  4DR5 K;  2W6K A;  3RSE A;  3VER A;  1TKX A;  4DQQ A;  4EAH D;  5M1K A;  1BQN A;  4GW6 A;  1WOQ A;  3AVI A;  1YTU A;  3CQ8 A;  2DTU A;  1WSG A;  2V52 B;  2VG7 A;  3OBW A;  1C0U A;  3DI6 A;  3G4S N;  3OS1 A;  2OZM A;  1TK8 A;  2HHQ A;  3OYD A;  1UAX A;  1OH5 A;  4WYB A;  4H5N A;  2GWJ A;  3V1O A;  1XHX A;  5FRM A;  2XO7 A;  1X9J A;  4GKK K;  4CJ7 A;  4ISF A;  5K14 A;  4ELT A;  2QKK A;  1ZYQ A;  2EHG A;  2BGG A;  4G1Q A;  2LSN A;  3VET A;  5F1X A;  1JKH A;  4JEP A;  5M1F A;  4AHT A;  4EFH A;  1KAX A;  1JCE A;  4N76 A;  1NM1 A;  3HJF A;  2YHA A;  4CHY A;  4M3U A;  3L3U A;  1WSH A;  3OJU A;  3CCJ N;  1S6P A;  3QB0 A;  3VEZ A;  5JLF A;  1KAZ A;  5AQP A;  3HOT A;  3ZX2 A;  4KV8 A;  1NKC A;  3CC7 N;  5BN8 A;  3ITH A;  4BRF A;  3AVK A;  2P5O A;  3BUZ B;  3NBP A;  3DRS A;  4LY7 A;  3ZET B;  1D8Y A;  1VSK A;  2O8E B;  2VQF K;  3W3D A;  3OS2 A;  2P9U B;  1RT4 A;  4AQY K;  1QE1 A;  1T3V A;  5MLC Q;  4IFE A;  5AQR A;  4ILH A;  2CH5 A;  5EY4 A;  1VRU A;  4CEO A;  3ALY A;  2UXD K;  5AZI B;  4JD2 A;  2ATQ A;  1NJI O;  3NH0 A;  2AA4 A;  5BRF A;  3PO5 A;  2W41 A;  2O8B A;  2BUP A;  3GE1 A;  5HL7 L;  3QIN A;  3U4L A;  2X78 A;  3W0L A;  1TKD A;  4FWL A;  3CG7 A;  4YFU A;  4BGB A;  4AM7 A;  4H4M A;  2WUS A;  3EYZ A;  3A0I X;  3SLC A;  2YNH A;  4HCC A;  1YIJ N;  1BCO A;  4WFB L;  2A40 A;  2A5X A;  4DUY K;  3FR0 A;  1LAV A;  2V51 B;  1XMQ K;  4FK4 A;  3ZEU B;  4DCH A;  2ZF5 O;  1RT6 A;  3WXL A;  2B4J A;  3ULE B;  3THY A;  2A6A A;  3QNN A;  2E1Y A;  4CZH A;  4AHR A;  4BRQ A;  1WNS A;  4KHN A;  1D5A A;  4B1V A;  3G10 A;  3TU5 A;  2ZD1 A;  2I7N A;  4K42 A;  4A57 A;  1RTD A;  3K59 A;  2YCH A;  4XIU A;  4W5N A;  1S5J A;  3PIP L;  1S3X A;  1HKB A;  4CZE A;  4W5R A;  2VQE K;  1S1X A;  5HBM A;  3VQA A;  1ZBL A;  4RW8 A;  1X9W A;  2Q97 A;  4FVM A;  1P8Z A;  4JHD B;  3VQ8 A;  3EY1 A;  4FJG A;  4FM1 A;  1YHQ N;  1VSJ A;  4CGF A;  3TAM A;  5M1Q A;  4BG9 A;  3NAE A;  3SQ1 A;  3AAR A;  5AQZ A;  1NGF A;  4FL9 A;  3GBT A;  3A8Y A;  5KTQ A;  3CD6 N;  4YDU A;  3KWI A;  4EP5 A;  5HRN A;  1FJG K;  1L3U A;  3LL3 A;  4CJW A;  3U9D A;  1K6Y A;  1IO2 A;  2I5J A;  2D5R A;  4M3Z A;  3CCL N;  4CZM A;  3F9K A;  4DTR A;  4DTN A;  1OH7 A;  3F2K A;  2IC3 A;  4H0Y B;  2O8D A;  3SBT A;  4IFV A;  4M63 C;  5HRS A;  3AA5 X;  1Y97 A;  2WTU A;  4I2Q A;  5AQX A;  1X9M A;  3J7Y P;  3KLI A;  3WT0 A;  4WCE L;  3EKU A;  2HHT A;  4DLG A;  3SV4 A;  2F9W A;  3SV3 A;  3H1Q A;  1NK0 A;  3CCE N;  5AFU A;  1TAU A;  3O9U A;  3EZW A;  4CK3 A;  2KTQ A;  1KVB A;  4KHS A;  1E3M A;  1B9F A;  3VOV A;  2NRZ A;  3GL1 A;  1IKW A;  4IKF A;  3UKU A;  4F8R A;  1SV5 A;  3ISN C;  1KSP A;  3HM8 A;  3TSU A;  5BRD A;  2A1R A;  4BY9 C;  4IOC L;  5M1P A;  4YHH K;  3QEW A;  4CHP A;  1KRP A;  2Q31 A;  2E88 A;  4JN4 A;  4EHU A;  1NGI A;  1IBM K;  4H4O A;  1JLQ A;  3M8P A;  1QQO A;  1QZ6 A;  2IVP A;  3D45 A;  2CH6 A;  1H1V A;  4JRQ A;  3C6U A;  4A2A A;  1XI1 A;  3AV9 A;  3U3G A;  1K9M O;  1NGA A;  2ITM A;  1L3V A;  4B9S A;  3LPT A;  1GLL O;  4BRP A;  1L3T A;  1V4T A;  1YAG A;  3K2P A;  4R5P A;  1NK6 A;  1U2V B;  3CJ7 A;  2KFZ A;  2UU9 K;  4DSL A;  2Y1J A;  4B9N A;  1Q9X A;  4E7L A;  5CYM A;  3R6M A;  4JLH A;  3ZT3 A;  1J53 A;  3SI6 A;  4QS8 A;  3CCV N;  4BDP A;  1HPM A;  4O5B A;  5J2Q A;  3KKR A;  5F2R A;  3C0B A;  1FW6 A;  4DTP A;  1U47 A;  5SZT A;  3CF5 L;  4DFJ A;  3E66 A;  4M7X A;  3L0Q A;  3AGR A;  3S3M A;  3AVA A;  5HRP A;  5C10 A;  4NCB A;  3HP6 A;  2A42 A;  2ZM6 K;  1BHL A;  4JI2 K;  5E84 A;  3GOI A;  5GAG P;  3MX5 A;  2RKI A;  4LC9 B;  1I39 A;  4XEI A;  5AQG A;  5AQI A;  1HYZ A;  3LDO A;  2QWO A;  3HPH A;  4CCH A;  1Z25 A;  2O8E A;  2A1S A;  5GAH P;  2YKN A;  2P9U A;  2ZQB A;  3SUO A;  3K58 A;  4O0J A;  5J2P A;  4DR3 K;  5T7B A;  4DV7 K;  2GEL A;  2YV0 X;  5AQS A;  3F73 A;  1RBU A;  1C0T A;  3QNO A;  2PYL A;  2FC0 A;  1XWL A;  5AZI A;  4CHQ A;  1QHA A;  3TWH A;  4EZ6 A;  4DQP A;  3R9P A;  1R59 O;  4CFB A;  4BC4 A;  4BE7 B;  2WON A;  4DTU A;  1C0F A;  1GLB G;  4JS4 A;  1IG9 A;  4LH4 A;  4UY8 O;  3OYM A;  5ADX A;  3TPQ A;  3CFP A;  4JI4 K;  3J81 O;  2GEM A;  1NGB A;  3DWL A;  2NRR A;  4DMN A;  4E7H A;  3O3F A;  3OYC A;  3THX A;  3E01 A;  3RMC A;  4KH6 A;  3VQB A;  1BDG A;  1TAQ A;  4Q0B A;  3VQP A;  5AQM A;  4HTL A;  2IVO A;  3WXI A;  2FSN A;  3A2F A;  3G6E N;  1ASU A;  3IG1 A;  4H0X B;  3ZT1 A;  3RSE B;  1ATN A;  2F8S A;  3ZSO A;  1I94 K;  3TAN A;  3ULE A;  3L2W A;  3JYT A;  1SS6 A;  2HHU A;  4CES A;  3VF6 A;  2HOE A;  1VQP N;  2CGL A;  1WB9 A;  1BQM A;  1VQO N;  2GTD A;  5KGW A;  1WN7 A;  2OYQ A;  1Q81 O;  1GLC G;  2FBT A;  1W2B M;  2PZS A;  3SPY A;  1NOZ A;  3CC4 N;  3VQQ A;  4N56 A;  1NGD A;  4CF2 A;  4NXN K;  3MX2 A;  4CJV A;  3EE9 A;  1CXU A;  4CGH A;  2Z1I A;  4IEE A;  4FZZ A;  3AO1 A;  4IDH A;  1U4B A;  2WC9 A;  2ZWH A;  4GV6 A;  3KLF A;  1HQU A;  4E3S A;  4PA1 A;  2P9S B;  1S6Q A;  3OYH A;  4K0K K;  3EE8 A;  4MDB A;  2QA4 N;  3AVG A;  4FLV A;  3DOL A;  3PX4 A;  4B3O A;  4DV4 K;  3CCQ N;  3T3F A;  3DOK A;  2P9K B;  4Z4C A;  4CIF A;  1QSL A;  3ATU A;  2VGN A;  5HP1 A;  1U04 A;  3EO3 A;  4NXM K;  4A2B A;  3ZT2 A;  5BPN A;  4CEA A;  4FJ9 A;  3SPZ A;  4FK0 A;  3VPZ A;  1RIL A;  1TVR A;  4LF5 K;  5B8H A;  1QSY A;  4LSN A;  4OPA A;  3TAR A;  2OPR A;  5BRE A;  1O13 A;  1EKE A;  3HM9 A;  4ILG B;  2WFB A;  3VEO A;  2QWM A;  4YOT A;  4DQS A;  2PY5 A;  3J8A A;  4XJX A;  1NMD A;  3P38 A;  4A62 A;  3OBY A;  1RT7 A;  1KFD A;  1EX4 A;  2XRI A;  5DK5 A;  4X64 K;  2HBJ A;  2ASM A;  4BRK A;  2FXU A;  1BU6 O;  1YJW N;  4FJ8 A;  4H0T B;  4CI6 A;  4BWM A;  1NJW A;  3L2R A;  5KGX A;  1JLB A;  1HYV A;  3OYE A;  3DAW A;  4GY2 B;  3OS0 A;  4EHT A;  3NH2 A;  5GIN A;  1T7P A;  1N36 K;  1HR0 K;  4PWD A;  4CZI A;  3QLH A;  5EOY A;  1MA9 B;  4DR2 K;  1RGI A;  2NZT A;  3OYA A;  3C6H A;  1ILY A;  1OKJ A;  2HF4 A;  3ZSV A;  4K41 A;  3E9P A;  4M3W A;  4CEE A;  1ASV A;  5AQW A;  2XY7 A;  3THY B;  3ENO A;  2Q1N A;  3O3G A;  4B8C A;  3CER A;  3VTH A;  3QFP A;  3KD1 E;  1GOB A;  4FJ5 A;  4DSK A;  2DY4 A;  1N6Q A;  1WBD A;  1U49 A;  4YOU A;  3AVB A;  1TKZ A;  2QM1 A;  3QDK A;  5KI6 A;  2P9P B;  3RMA A;  4FK2 A;  1YVN A;  4IBN A;  3CFO A;  4B1Z A;  3LPU A;  1IKX A;  4BRE A;  3DRR A;  1K8K B;  5GAD P;  3CXC M;  4TSX A;  1BIU A;  4LFC K;  4CIG A;  3ENH A;  3HST B;  4NYN A;  4GKJ K;  2OZS A;  4AF1 A;  2Q36 A;  3L4I A;  1B9D A;  2FF6 A;  1HMV A;  2NRT A;  4BVP A;  3I55 N;  3CYM A;  5F0X A;  3VGL A;  3NHG A;  2HBM A;  4FWS A;  4HHT A;  2D1K A;  4JK9 A;  4BG8 A;  4FO0 A;  4E7K A;  4FWM A;  2EX3 A;  3QIC A;  4DF8 A;  3EEQ A;  3KIO A;  1TKT A;  4NCG A;  4A5B A;  4CER A;  3NVK A;  3BZK A;  3UIQ A;  3AVC A;  4BRM A;  4Z4E A;  4FM2 A;  3KZB A;  2HB5 A;  3DM2 A;  3HVR A;  5EXW A;  2HST A;  4Z0U A;  3SUN A;  4KHU A;  5BPL A;  1NJX A;  4C8N A;  3A5M C;  2GX9 A;  4MO4 A;  1QZ5 A;  4FWK A;  4BEB A;  1EO1 A;  1KLM A;  3UKU B;  4FLW A;  2YJF A;  1TK5 A;  4ZTF A;  5ELZ A;  5D3G A;  2EWS A;  4LSL A;  5J2M A;  3MWT A;  4Q5V A;  4C8O A;  1BO5 O;  1WSJ A;  4OPK A;  1V4S A;  3SYZ A;  2F96 A;  1VK0 A;  2YNG A;  3M5R A;  3QBX A;  3LWL A;  1NK9 A;  1QS4 A;  1HNZ K;  4E19 A;  1JLF A;  4WQ5 C;  3D6R A;  2QI2 A;  1KVA A;  4BC2 A;  1GLJ O;  3GG4 A;  3I0S A;  2JWL A;  4BR9 A;  4HUF A;  3HOS A;  2XY8 A;  3KWG A;  4HCB A;  3DRP A;  4DR6 K;  2E4L A;  4KTW A;  4LF6 K;  4KRE A;  3CPW M;  2HW3 A;  3EZ5 A;  2QEX N;  3O80 A;  3AVF A;  4UQG A;  5GIO A;  3CJA A;  4FLY A;  2NRW A;  5AQK A;  3RMB A;  4A59 A;  3I8B A;  3UKR A;  2E20 A;  3BP8 A;  2F8T A;  2QTD A;  3V6D A;  3V9U A;  1LV5 A;  1QQN A;  1JLE A;  2VGM A;  3UB5 A;  2FBV A;  2NRH A;  4FPB A;  5LJW A;  2G8W A;  3DLK A;  3D7E O;  1XNR K;  3B6O A;  4MLH A;  4IO9 L;  3NMU A;  4IXC A;  2P9S A;  3M1F A;  4MQ3 A;  4CVN E;  4KBO A;  1XC3 A;  4JKE A;  1FXX A;  2IIR A;  3OYJ A;  1MWM A;  2Q0R A;  1QQM A;  4GVE A;  4YOY A;  2P9K A;  3OTO K;  4DV0 K;  5KPZ A;  3HBT A;  3HZ6 A;  5LMU K;  1IV0 A;  1NK8 A;  4FYD A;  4KRF A;  3M6G A;  4BR4 A;  2E8A A;  4BRH A;  2D0C A;  3TAG A;  2O8F B;  1RBT A;  1SAZ A;  1SL2 A;  2CGJ A;  1BUP A;  4KHW A;  1Q7Y O;  1R0A A;  4O8U A;  3K9K A;  5DMR A;  4BDZ A;  3E9L A;  1QSS A;  3WNF A;  3THW A;  1RBV A;  3VQ5 A;  3A5O C;  1X9S A;  3DLH A;  5C42 A;  4C1N K;  1NJY A;  2YHX A;  2C1G A;  3CPE A;  4B9Q A;  4DR1 K;  3WUH A;  4QAG A;  4JI0 K;  4QS9 A;  1RTH A;  3OYB A;  4RW4 A;  3TSQ A;  5E41 A;  3THX B;  3ZLJ A;  4B3M K;  2BE2 A;  4JKH A;  3OJS A;  3TAE A;  5KQD A;  3VQ9 A;  1CZ9 A;  4CGD A;  4OO1 J;  5DM6 L;  4NLB A;  5I9E B;  1LWC A;  2NNW A;  1IKY A;  3J80 O;  1NGC A;  3SJH A;  2XHB A;  2KHO A;  3ATV A;  4H03 B;  3VEV A;  2E2Q A;  3C6A A;  4CJ4 A;  5FRN A;  4CEC A;  1KLN A;  3H46 O;  3CHW A;  5TKY A;  3I8D A;  5C15 A;  1LWE A;  2RF2 A;  3ZX0 A;  2YNF A;  2BDP A;  3KD5 E;  4KI4 A;  3E9O A;  1BI4 A;  4JKA A;  2P9P A;  3O4Q A;  3DXM B;  2FF3 B;  1YI2 N;  1VSD A;  5M1O A;  4FJI A;  4BR7 A;  2YX6 A;  1MWK A;  3OYN A;  1K8K A;  3I56 N;  3AA2 A;  5M1N A;  4CZF A;  4OKJ A;  4CF8 A;  3VF2 A;  4GMJ B;  4OKE A;  4BQZ A;  3QIP A;  2UUA K;  4CJQ A;  3V9Z A;  3A5L C;  3AVN A;  1OH6 A;  4DQI A;  4O4G A;  3PSF A;  4CF9 A;  3KK7 A;  1CLQ A;  1JLC A;  3LP2 A;  3ZYY X;  3WEE B;  2Y1I A;  4ICL A;  3RVC A;  1JLA A;  1G15 A;  3HL8 A;  1GOA A;  2X6S A;  1XNQ K;  3CFR A;  3O1W A;  4PKH A;  4ISG A;  3WXK A;  3LAM A;  1JXB A;  5AQH A;  4DV6 K;  4OLA A;  1MU2 A;  3TSP A;  3TAQ A;  1F21 A;  3R3L A;  1XQS C;  1REV A;  3SMP A;  4CEZ A;  2D0A A;  4M3X A;  2E5L K;  1XMO K;  1BA1 A;  4CBW A;  4NO7 A;  1TGO A;  1D9D A;  2QXL A;  2D0P A;  3K5O A;  3U8X A;  3VQD A;  1A5W A;  2P9L B;  4WQ4 C;  1UA1 A;  4RTF D;  4CJ5 A;  2HBK A;  4CZL A;  3PO4 A;  1WSE A;  4F2S A;  3IUC A;  2NRX A;  4RCH A;  1C0G A;  4U67 L;  3QML A;  4FZX C;  2G8I A;  4BRL A;  3K5L A;  4BC5 A;  4DV1 K;  2YNI A;  3PY8 A;  4KHQ A;  4OJR A;  1D4X A;  4CK1 A;  3E1Y A;  3ZCM A;  5GIP A;  5FLX O;  4NYF A;  3ZSR A;  3O5B A;  1NJZ A;  4DU1 A;  2Q0U A;  3HTV A;  3SAH A;  4Y0W A;  1E4F T;  4O8K A;  3DLL L;  1K73 O;  5I3U A;  3UE5 A;  4OVL A;  1EXQ A;  3VEN A;  1XHZ A;  3T19 A;  1O1W A;  2D0B A;  4BAC A;  1Q86 O;  4C23 A;  3K5N A;  4IZ9 A;  4CF0 A;  4WF9 L;  2HHS A;  2UXB K;  3EN9 A;  3BF1 A;  3QFU A;  4KHP K;  1RDW X;  1NGH A;  1NGG A;  3FFK B;  1RDU A;  4BGA A;  3D2F B;  2G8U A;  5FPN A;  4KHY A;  1HNW K;  1EWQ A;  1JJ2 M;  3AO3 A;  1OH8 A;  4CGI A;  4O44 A;  3H3O B;  3VQC A;  4O0I A;  4E0D A;  4DFK A;  1QHT A;  2G8K A;  4LD0 A;  1T6C A;  2QWL A;  1WSF A;  3V81 A;  1S1W A;  2O8C B;  2PFU A;  4B3T K;  3SQ4 A;  4CZG A;  3AY9 A;  4J2B A;  3MCP A;  2IVN A;  4NB4 A;  4FW2 A;  2YHY A;  3MEC A;  4QOZ B;  4J2A A;  5C2F A;  3SQ2 A;  3RMD A;  2O8F A;  4I7F A;  2DPN A;  1S72 N;  4K8Z A;  4JKD A;  4L3Q A;  4DTX A;  4DTS A;  3BZC A;  4DU3 A;  4WFN L;  1TK0 A;  5CZ1 A;  2NUB A;  2PBD A;  2RN2 A;  1LW2 A;  3CM5 A;  5FPD A;  5JS1 A;  3OYI A;  4AHU A;  4FSV A;  4DR4 K;  1TV6 A;  4DQ8 A;  3IDH A;  4H5W A;  2RPI A;  2KKZ A;  4M3Y A;  2UXC K;  1J5O A;  1YF5 L;  3PUF A;  5FDL A;  4IDK A;  4N5S A;  3C7N B;  3RRH A;  1GLD G;  2HHH K;  1SKW A;  3P1G A;  3HPO A;  4FCY A;  4JKC A;  4L8R B;  2YHW A;  1VQN N;  1S22 A;  4BQL A;  5HRO A;  4CJK A;  3ZSW A;  4DV2 K;  5KQ8 A;  3H1V X;  3K57 A;  3MCA B;  3G0Z A;  4DG1 A;  1KFS A;  1VHX A;  4YOV A;  3NGY A;  1HYS A;  1TL3 A;  1VSF A;  2RE2 A;  3K9J A;  1TL1 A;  3MN5 A;  1XUP O;  1EP4 A;  4PL7 A;  4JS5 A;  4RG8 A;  2G8V A;  3KK3 A;  2OAN A;  4CD1 A;  4FXD A;  1OVQ A;  4CD3 A;  3MWP A;  2KFN A;  2VYP A;  3UKR B;  1NKE A;  1ESV A;  2OPP A;  3RTV A;  4IO8 A;  5AFU H;  3O9T A;  3TAP A;  3CME N;  1HUX A;  3DXM A;  2HND A;  4ZHR A;  4CJE A;  1ZBH A;  1S1T A;  2JWK A;  4CW7 B;  3CI5 A;  4KO0 A;  4BRI A;  3J7A P;  3QBW A;  2QWN A;  1YVU A;  4K8X A;  5AQQ A;  2QWQ A;  4E72 A;  1M1K O;  4GNI A;  3C95 A;  2OTJ N;  3CC2 N;  1NGE A;  3OHR A;  3CIP A;  3VTI A;  3PV8 A;  3QO9 A;  5TKW A;  3HP9 A;  3O08 A;  5AQN A;  3CJ9 A;  3WEE A;  3QER A;  3AO2 A;  2HHW A;  2X74 A;  5CYQ A;  4GV3 A;  3VA3 A;  4IWV A;  4FVU A;  4CJT A;  5FRO A;  4IG0 A;  3SK3 A;  2W00 A;  3CQY A;  4BE0 A;  1LAW A;  3LP0 A;  5I42 A;  3OYG A;  3NF8 A;  2E1Z A;  1VSH A;  3A5N C;  2P9I B;  3GDQ A;  1J54 A;  3L2V A;  3THW B;  3VEX A;  1C1A A;  3O6W A;  2VG6 A;  5JLH A;  3O8M A;  1RDC A;  2P9L A;  4WQ5 A;  1NK5 A;  3ID6 A;  4C1N I;  3VQ4 A;  3QET A;  3VA0 A;  3P83 D;  4OPH A;  4B1X B;  3DMJ A;  1L5U A;  1U45 A;  1VQ9 N;  3C65 A;  1GLE G;  1ZBF A;  3OVN A;  3VQ7 A;  3V1Q A;  4OX9 K;  3S5T A;  4JRP A;  4IOA L;  4NLC A;  1YJ9 N;  1BWF O;  1N8R O;  4YOW A;  2O4G A;  3D2E A;  3VGK A;  4ZTJ A;  4LF4 K;  3QEV A;  1DLO A;  2HMI A;  4RW6 A;  4BRG A;  4CHZ A;  4KI6 A;  1YT3 A;  1GLA G;  2UYT A;  4YY3 K;  3B8A X;  3KLE A;  5GAE P;  3WQU A;  2VWJ A;  4OGC A;  1C6V A;  1Z6R A;  3JS6 A;  3G71 N;  3VGM A;  1Q82 O;  1WSI A;  4XH5 A;  2HBL A;  4JK8 A;  4FJH A;  3O3H A;  1BI4 B;  3MN6 A;  1VQK N;  3DLB A;  3D2F A;  4H5R A;  1VQ8 N;  1D9F A;  4BWJ A;  3RR8 A;  4DU4 A;  1RCH A;  4KAZ A;  2FLO A;  1GOC A;  1ZBS A;  4M3T A;  3FZK A;  1VAZ A;  3L6Q A;  3IAY A;  2R7Y A;  3LAK A;  3NF7 A;  5KPR A;  3ZT4 A;  1LCU A;  3C6T A;  1KQS M;  1XC9 A;  3HI0 A;  3CCU N;  2O8C A;  3MEG A;  3M8Q A;  1IBL K;  1KVC A;  3AVL A;  5BRH A;  1VQ7 N;  3H45 C;  4OGE A;  4CK2 A;  4DV3 K;  1G99 A;  1QTM A;  3RR7 A;  1BGX T;  3DLG A;  1Q9Y A;  3VQ6 A;  1BG3 A;  4DSI A;  1RT5 A;  4PQU A;  1RDD A;  1BOT O;  1DTT A;  4CGG A;  4E1J A;  2FSK A;  2HMP A;  1HJR A;  2OPS A;  5AQT A;  1JL1 A;  1SZ2 A;  2H3G X;  1N33 K;  1EQY A;  3THV A;  5BPM A;  4DLE A;  2ZJR L;  2P9N B;  4KPY A;  4CBU A;  3LP1 A;  3FLC O;  4EIA A;  4M7Y A;  4AH9 A;  5HLF A;  3IMX A;  4E89 A;  5LMN K;  2VCP A;  2ZGY A;  3V9S A;  3MN9 A;  3NGZ A;  1T44 A;  3C7N A;  3NE6 A;  4A61 A;  2P5G A;  3EKS A;  3MEE A;  3TR8 A;  3J7Z O;  1VSL A;  3JAM O;  3M8S A;  3OA9 A;  3IFR A;  5C25 A;  4PHT X;  4BEC A;  4CJL A;  4X65 K;  3WNE A;  5HRR A;  4DSJ A;  3P4I A;  4CHN A;  3AAQ A;  1KCF A;  2C1I A;  2G8F A;  3ID8 A;  1NU0 A;  1X3N A;  3PSI A;  4Z4F A;  3CJC A;  2ZGZ A;  4J8F A;  4JI5 K;  1KXP A;  4E7I A;  5J2N A;  4Z4G A;  3L4Q A;  1Z05 A;  4BVO A;  2HNY A;  5H1S Q;  2E6M A;  5LY3 A;  2VG5 A;  3JSM A;  1FK9 A;  1ZBI A;  4K43 A;  4B1U B;  3L3V A;  1JCF A;  1T6D A;  4Y1C A;  3SCX A;  1GLF O;  2QKB A;  1A5V A;  3O4W A;  4N47 A;  3N4P A;  1Y64 A;  5AZJ B;  1SKS A;  3PLA A;  2ITG A;  3KKS A;  3VQE A;  1HNV A;  2QWP A;  3AVJ A;  5AR0 A;  3HO1 A;  3C94 A;  4FOI A;  4CZJ A;  1A5X A;  1U48 A;  3NGI A;  1SKR A;  1W7A A;  4JKG B;  1DKG D;  3KVG A;  2Q3S A;  4CE9 A;  4FWQ A;  5AJ3 K;  3AVH A;  5JS2 A;  4DQR A;  4Y1D A;  3T1H K;  4DWI A;  1W9H A;  1YXQ A;  1SL1 A;  1HX1 A;  4A5A A;  4AHV A;  1HNX K;  4DV5 K;  2E6L A;  4I9Q A;  4C8L A;  4WQ4 A;  3MDQ A;  4BR0 A; 
#chains in the Genus database with same CATH homology
 2A41 A;  4ISE A;  1NLV A;  3G6E N;  2ASP A;  2WBN A;  3LDQ A;  5CR4 A;  2HBK A;  4CZL A;  4H0X B;  1TUU A;  3RSE B;  1ATN A;  3OW2 M;  4BRN A;  3WQT A;  3IUC A;  2NRX A;  4RCH A;  1C0G A;  4U67 L;  5C2D A;  3CME N;  3QML A;  3LDN A;  4G9Z A;  2P9I A;  3FE1 A;  5C0Y A;  4BRL A;  3H6E A;  3ULE A;  3M3Z A;  4BC5 A;  4JAX A;  1SS6 A;  1D4X A;  4FWP A;  4IJA A;  1E4G T;  1W97 L;  4FWO A;  3VF6 A;  3E1Y A;  3VEY A;  5GIP A;  2HOE A;  1VQP N;  2CGL A;  3O5B A;  2NLX A;  4F9O A;  3IKM A;  1VQO N;  2GTD A;  2Q0U A;  3HTV A;  3SAH A;  5BR9 A;  3BF3 A;  4Y0W A;  1Q81 O;  1GLC G;  2J4R A;  3PIO L;  3DXK A;  1E4F T;  4Z94 A;  1W2B M;  4O8K A;  3DLL L;  1K73 O;  3UE5 A;  3VEN A;  3CC4 N;  1WUA A;  3MK6 A;  4DB3 A;  1NGD A;  2YJE A;  3AAP A;  4BR5 A;  1P90 A;  1DT9 A;  1Q86 O;  1TYQ B;  2BTF A;  3MX2 A;  4IJN A;  4C23 A;  3LM2 A;  3EE9 A;  4IZ9 A;  3TTF A;  1VQM N;  1ATR A;  4WF9 L;  4IEE A;  1QVF M;  4IDH A;  2WC9 A;  2ZWH A;  3EN9 A;  3BF1 A;  3QFU A;  5FPE A;  4GV6 A;  1RDW X;  5E26 A;  2F7T A;  1K8A O;  3I33 A;  1NGH A;  1NGG A;  3FFK B;  5JMV A;  2ZJQ L;  2P9S B;  3LM9 A;  1RDU A;  3EE8 A;  4MDB A;  2QA4 N;  4BGA A;  3D2F B;  3N4Q A;  5FPN A;  5EVZ A;  1JJ2 M;  4BRD A;  3CCQ N;  2P9K B;  3FZM A;  2V7Y A;  3ATU A;  2E2P A;  2VGN A;  3H3O B;  3EO3 A;  1KAY A;  5CHI A;  4A2B A;  4IOX A;  4I6M B;  3AGK A;  5BPN A;  1T6C A;  3NVM A;  2QWL A;  4JNE A;  3VPZ A;  1IJJ A;  5B8H A;  1ZXO A;  2PFU A;  4OPA A;  4KH5 A;  3FZF A;  4CZG A;  2E2N A;  5BRE A;  3AY9 A;  3H3N O;  1O13 A;  3MCP A;  2IVN A;  4NB4 A;  3HSC A;  4ILG B;  2AP1 A;  4JK7 A;  2WFB A;  2YHY A;  2QWM A;  1DGK N;  4YOT A;  3VEO A;  3J8A A;  4XJX A;  5C2F A;  1NMD A;  2QWR A;  3O9R A;  4CBX A;  3P38 A;  4A62 A;  4H0P A;  3OBY A;  2FSJ A;  4FWN A;  2E2O A;  4MO5 A;  2DPN A;  1QVG M;  2HBJ A;  1S72 N;  4JKD A;  4L3Q A;  2ASM A;  3RSE A;  4BRK A;  2FXU A;  3VER A;  1BU6 O;  4EAH D;  1YJW N;  5M1K A;  4WFN L;  4H0T B;  4CI6 A;  2PBD A;  1WOQ A;  2ZJP L;  5FPD A;  2V52 B;  4FSV A;  3OBW A;  1YIT N;  4PL8 A;  3G25 A;  5H1S Q;  3G4S N;  3DAW A;  4GY2 B;  1TUY A;  5AQL A;  3IDH A;  4DQ8 A;  4WYB A;  4H5N A;  4EHT A;  5GIN A;  4H5W A;  2GWJ A;  2KKZ A;  4CZI A;  3KHY A;  1YF5 L;  1MA9 B;  5EOY A;  1RGI A;  2NZT A;  1X9J A;  3C7N B;  3WXM B;  5AQV A;  4CJ7 A;  4ISF A;  3C6H A;  1ILY A;  1GLD G;  1OKJ A;  2HF4 A;  4K41 A;  3R1X A;  3E9P A;  3VET A;  5F1X A;  5AQW A;  4JEP A;  4JKC A;  5M1F A;  3ENO A;  2Q1N A;  4EFH A;  1KAX A;  1JCE A;  2YHW A;  1NM1 A;  3CER A;  5AQU A;  2P9N A;  3VTH A;  4BR9 A;  1VQN N;  1S22 A;  4BQL A;  4FPA A;  3MMV A;  3CCJ N;  3QB0 A;  3QFP A;  4KH4 A;  3VEZ A;  5JLF A;  5KQ8 A;  3H1V X;  1KAZ A;  3MCA B;  4H5V A;  5AQP A;  3HOT A;  3ZX2 A;  4QS7 A;  4YOU A;  3CC7 N;  5BN8 A;  3O1B A;  3QDK A;  2QM1 A;  2I7P A;  3CQX A;  2P9P B;  3CJB A;  1YVN A;  4BRF A;  4B1Z A;  4YOV A;  2RE2 A;  3BUZ B;  3K9J A;  4BRE A;  4ILJ A;  3ZET B;  1K8K B;  3MN5 A;  3VES A;  5GAD P;  3CXC M;  1XUP O;  4PL7 A;  3W3D A;  2P9U B;  2OAN A;  4CD1 A;  3ENH A;  4CD3 A;  1T3V A;  5MLC Q;  3MWP A;  3D2E B;  4IFE A;  2VYP A;  5AQR A;  4ILH A;  4XH1 A;  3UKR B;  4I6M A;  2CH5 A;  4AF1 A;  1ESV A;  5JVH L;  2Q36 A;  3L4I A;  2FF6 A;  1VQL N;  4IO8 A;  1HKG A;  5EY4 A;  2NRT A;  1J6Z A;  5AFU H;  3O9T A;  4BVP A;  5AZI B;  2GWK A;  1HUX A;  4IEI A;  4B1V A;  5F0X A;  4JD2 A;  3I55 N;  3DXM A;  1YJN N;  3VGL A;  3ENB A;  1NJI O;  2AA4 A;  2HBM A;  1SQK A;  2Q2R A;  2JWK A;  2D1K A;  3CI5 A;  4FWS A;  4JK9 A;  5BRF A;  4BRI A;  1M90 O;  3QBW A;  2QWN A;  2W41 A;  4BG8 A;  4FO0 A;  4DHY A;  5AQQ A;  1VQ6 N;  2QWQ A;  4FWM A;  1M1K O;  4GNI A;  2YI1 A;  4H0V B;  2BUP A;  3GE1 A;  5HL7 L;  2OTJ N;  3CC2 N;  1NGE A;  3QIC A;  3OHR A;  4BC2 A;  3CIP A;  3VTI A;  5TKW A;  4A5B A;  3U4L A;  3O08 A;  4XH4 A;  3NVK A;  3F5T A;  5AQN A;  3W0L A;  5AZJ A;  3CJ9 A;  4BRM A;  3WEE A;  3CET A;  4K25 A;  3KZB A;  4FWL A;  5EXW A;  2HST A;  4BGB A;  4CZK A;  4AM7 A;  4GV3 A;  4H0O A;  4IWV A;  4FVU A;  2WUS A;  5BPL A;  3A0I X;  3SLC A;  2HF3 A;  2PAV A;  1YIJ N;  3A5M C;  2GX9 A;  4MO4 A;  4WFB L;  1QZ5 A;  4FWK A;  2A40 A;  2A5X A;  5FPM A;  4RWT A;  3SK3 A;  4BEB A;  1EO1 A;  1NWK A;  3CQY A;  2W00 A;  3FR0 A;  3UKU B;  2V51 B;  3CCM N;  2YJF A;  3MN7 A;  4JKG A;  1X3M A;  3DJC A;  5ELZ A;  3WXJ A;  2EWS A;  3ZEU B;  4DCH A;  4HWI A;  5HOO A;  3MWT A;  1BO5 O;  2E1Z A;  1V4S A;  2ZF5 O;  3A5N C;  2P9I B;  3WXL A;  3GDQ A;  2KLA A;  3TTD A;  3ULE B;  3O9Q A;  2A6A A;  3VEX A;  2E1Y A;  4CZH A;  3Q7C A;  3M5R A;  2BH1 A;  3O6W A;  4BRQ A;  3QBX A;  5JLH A;  3O8M A;  3D6R A;  4WQ5 C;  2QI2 A;  3TU5 A;  2P9L A;  1GLJ O;  2I7N A;  3GG4 A;  2JWL A;  4K42 A;  4WQ5 A;  4A57 A;  4BC3 A;  3HOS A;  1KD1 O;  3ID6 A;  3KWG A;  2YCH A;  4C1N I;  3PIP L;  1S3X A;  1HKB A;  2RHK A;  4DKW A;  1BA0 A;  4OPH A;  4CZE A;  4B1X B;  3CPW M;  1VQ9 N;  3C65 A;  1GLE G;  1YUW A;  2QEX N;  3O80 A;  1JCG A;  4JKF A;  3ZET A;  3O9S A;  5GIO A;  3Q7B A;  5JVG L;  2Q97 A;  3CJA A;  1P8Z A;  4JHD B;  2NRW A;  5AQK A;  3ZX3 A;  1LOT B;  4IOA L;  5KPT A;  4NLC A;  4YOX A;  1YJ9 N;  1BWF O;  1N8R O;  2D0O A;  4A59 A;  3D2E A;  3VGK A;  4YOW A;  3I8B A;  1YHQ N;  3UKR A;  4BRC A;  5M1Q A;  4BG9 A;  2E20 A;  1DEJ A;  3T7Z A;  3AAR A;  3BP8 A;  5AQZ A;  4BRG A;  1NGF A;  4FL9 A;  3GBT A;  3A8Y A;  4YDU C;  3T69 A;  4PKI A;  3CD6 N;  4YDU A;  1GLA G;  3KWI A;  2UYT A;  2QTD A;  4BRA A;  2F9T A;  3B8A X;  5JIC A;  3LL3 A;  5GAE P;  1QQN A;  1TYQ A;  2VGM A;  3UB5 A;  2NRH A;  3U9D A;  3WQU A;  1NBW A;  4FPB A;  5LJW A;  3CCL N;  4CZM A;  3D7E O;  2CGK A;  3HRG A;  5CE3 A;  4MLH A;  3F2K A;  1Z6R A;  3JS6 A;  3G71 N;  3VGM A;  4IO9 L;  1Q82 O;  4XH5 A;  3NMU A;  2HBL A;  4H0Y B;  4JK8 A;  3SBT A;  5LJV A;  4IXC A;  2P9S A;  3M1F A;  4M63 C;  4FOE A;  3MN6 A;  5EX5 A;  4KBO A;  3F9M A;  1VQK N;  1XC3 A;  4O5F A;  4JKE A;  3D2F A;  4H5R A;  2IIR A;  5AQX A;  1MWM A;  2Q0R A;  3CCR N;  1QQM A;  1VQ8 N;  3WT0 A;  4WCE L;  3EKU A;  4U7B A;  2F9W A;  4GVE A;  4YOY A;  2FLO A;  2P9K A;  3H1Q A;  4JKB A;  5KPZ A;  1ZBS A;  3HBT A;  3HZ6 A;  5BN9 A;  3U9Z A;  5AFU A;  3CCE N;  2V7Z A;  3FZK A;  3O9U A;  3FZL A;  1VAZ A;  3M6G A;  3EZW A;  2VWB A;  3VEW A;  3L6Q A;  4BR4 A;  2NRV A;  2E8A A;  4BRH A;  5KPR A;  3VOV A;  1LCU A;  2NRZ A;  3GL1 A;  3VMF B;  1SAZ A;  1KQS M;  3UKU A;  3HI0 A;  5GAH P;  4PKG A;  2CGJ A;  4MLE A;  3HM8 A;  1BUP A;  3ZEU A;  3TSU A;  3CCU N;  3P31 A;  1Q7Y O;  3CJ1 A;  5BRH A;  4O8U A;  3K9K A;  1VQ7 N;  5BRD A;  4BY9 C;  3E9L A;  3H45 C;  4IOC L;  5M1P A;  4BR2 A;  2W40 A;  1G99 A;  2Q31 A;  2E88 A;  4JN4 A;  4EHU A;  1NGI A;  5AQF A;  4R79 A;  3A5O C;  1BG3 A;  4B1Y B;  1QQO A;  1QZ6 A;  2IVP A;  4C1N K;  2CH6 A;  1H1V A;  2YHX A;  2C1G A;  1BOT O;  3CPE A;  4A2A A;  4B9Q A;  3WUH A;  4E1J A;  2FSK A;  2HMP A;  1K9M O;  5AQT A;  1NGA A;  2ASO A;  4BR0 A;  4QS9 A;  1HKC A;  4GV9 A;  2ITM A;  1MDU B;  1SZ2 A;  3SAG A;  1GLL O;  2H3G X;  4BRP A;  1V4T A;  1YAG A;  1EQY A;  1U2V B;  3SMS A;  3TSQ A;  3CJ7 A;  5BPM A;  4MDA A;  2ZJR L;  4JKH A;  2P9N B;  4JHD A;  4CBU A;  5KQD A;  4B1W B;  1CZA N;  3FLC O;  3R6M A;  4EIA A;  4M7Y A;  4OO1 J;  5DM6 L;  4NLB A;  1IG8 A;  2GUP A;  3VF4 A;  2NNW A;  3IMX A;  5I9E B;  1HJO A;  2VCP A;  1OVY A;  2ZGY A;  3MN9 A;  5AQO A;  4QS8 A;  1T44 A;  3CCV N;  4WFA L;  3JXU A;  1NGC A;  3C7N A;  4BRO A;  3SJH A;  2QW9 A;  2KHO A;  3ATV A;  4H03 B;  4A61 A;  3CMA N;  3EKS A;  3VEV A;  1HPM A;  3J7Z O;  2E2Q A;  5F2R A;  3C6A A;  3OA9 A;  3C0B A;  3IFR A;  4PHT X;  3CF5 L;  4BEC A;  3H46 O;  3CHW A;  5TKY A;  3E66 A;  5C15 A;  4M7X A;  3L0Q A;  3AGR A;  3ZX0 A;  3P4I A;  5C10 A;  3AAQ A;  2C1I A;  5DM7 L;  3E9O A;  1KC8 O;  2A42 A;  3DXK B;  3ID8 A;  1U6Z A;  4JKA A;  2P9P A;  5E84 A;  3GOI A;  1X3N A;  4H5T A;  5GAG P;  3MX5 A;  4LC9 B;  3CJC A;  4XEI A;  4JD2 B;  3DXM B;  5AQG A;  5AQI A;  2FF3 B;  2ZGZ A;  3EL2 A;  4YOR A;  1YI2 N;  3LDO A;  5M1O A;  4J8F A;  4BR7 A;  2QWO A;  1KXP A;  1MWK A;  1K8K A;  2YX6 A;  3I56 N;  1Q18 A;  5AQY A;  5M1N A;  3L4Q A;  1ATS A;  1Z05 A;  3R8E A;  4BVO A;  4CZF A;  3SBG A;  3VF2 A;  4BQZ A;  2P9U A;  5C12 A;  5LY3 A;  3SAF A;  3S41 A;  4K43 A;  4B1U B;  1JCF A;  3A5L C;  1T6D A;  2A3Z A;  2D4W A;  2GEL A;  5AQS A;  3KK7 A;  1GLF O;  3O4W A;  3N4P A;  1RFQ A;  1Y64 A;  5AZJ B;  3LDP A;  3PLA A;  3ZYY X;  3WEE B;  5AZI A;  1QHA A;  3FGU A;  3RVC A;  2QWP A;  3R9P A;  5AR0 A;  3TTC A;  1R59 O;  4BC4 A;  4BE7 B;  3CCS N;  4FOI A;  1C0F A;  4CZJ A;  3O1W A;  5AQJ A;  1GLB G;  4UY8 O;  4FWR A;  4PKH A;  2OTL N;  4ISG A;  3WXK A;  1NGJ A;  4JKG B;  1DKG D;  3KVG A;  5ADX A;  5AQH A;  3TPQ A;  3BEX A;  4FWQ A;  2GEM A;  3TSP A;  1NGB A;  3DWL A;  2NRR A;  3R3L A;  1XQS C;  1U2V A;  3SMP A;  1YXQ A;  1VQ5 N;  1HX1 A;  4AM6 A;  1VQ4 N;  1ZC6 A;  3LDL A;  4KH6 A;  4A5A A;  1BDG A;  1HLU A;  3P39 A;  5ADX H;  1BA1 A;  4CBW A;  4NO7 A;  2QXL A;  2D0P A;  5AQM A;  3U8X A;  4HTL A;  2IVO A;  2P9L B;  4WQ4 C;  4WQ4 A;  3WXI A;  3MDQ A;  3FZH A;  2FSN A;  4RTF D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...