4I6MB

Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of swi/snf chromatin remodeler.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
437
structure length
396
Chain Sequence
b'PFRQDSILIIYPRSQTTLVQFGLNEETFTVPELEIPTQIYRTTRQDGSYTYHSTNKDNKAELIKPIQNGEIIDISAFTQFLRLIFVSILSDRANKNQDAFEAELSNIPLLLITHHSWSQSDLEIITQYVFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTHHTDIIPIVDYAQLDHLVSSIPMGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSKNSDLEFNTFWDEKGNEIKVGKQRFQGCNNLIKNISNRVGLTLDNIDDINKAKAVWENIIIVGGTTSISGFKEALLGQLLKDHLIIEPEEEKSKREEEAKSFVPTIEYVQCPTVIKLAKYPDYFPEWKKSGYSEIIFLGAQIVSKQIFTHPKDTFYITREKYNMKGPAALWDVQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 7
publication title Structure of an actin-related subcomplex of the SWI/SNF chromatin remodeler.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
total genus 115
structure length 396
sequence length 437
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4i6mB02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4i6mB01
3.90.640.60 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4i6mB03
4B1YB 2NRHA 1LOTB 1KXPA 1BA1A 3GBTA 2Q36A 1WUAA 2F9WA 2YI1A 4FWSA 3DWLA 3FFKB 3LM9A 3H1QA 4NB4A 4JN4A 4I6MB 4FWPA 4O8KA 3VF6A 2FSJA 1TYQB 5AQVA 1S22A 2E1ZA 3MN6A 5E26A 3C0BA 3DXMB 1QQMA 3R6MA 4JD2A 1HPMA 2GTDA 4CBUA 4FPBA 1KAZA 3GG4A 3WT0A 3HI0A 2P9KA 4H03B 3AARA 4FL9A 3LDLA 4BR9A 1DEJA 3SK3A 2QXLA 4IO8A 1NM1A 5ADXH 4K42A 4FWRA 3IDHA 3IFRA 3D7EO 4K43A 4ISFA 4DCHA 5ELZA 3O6WA 3BP8A 3H46O 5JICA 1JCEA 3CJBA 4I6MA 2A3ZA 3L0QA 1HUXA 2W41A 3VF2A 3MN5A 2P9NB 3ENHA 4BRGA 5BRFA 1TYQA 4CZHA 4WQ5A 1BU6O 3DXMA 3GE1A 3MCPA 1YUWA 4BC3A 3R9PA 3VENA 2QWOA 3LDNA 3WXIA 2ZF5O 5TKYA 3HTVA 1QZ6A 4BVPA 5BPNA 4J8FA 3I33A 2E20A 3W3DA 5AQSA 4EFHA 3SLCA 1KAXA 1GLCG 4AM6A 3A5NC 4BG8A 2FF6A 3HM8A 2ZWHA 4A2BA 5F0XA 3WEEB 1LCUA 4FPAA 1DGKN 3WXLA 3BF1A 5KQ8A 2YHWA 2P9NA 4MO5A 4QS8A 1P8ZA 5LY3A 2PBDA 1TUUA 3MMVA 3O1BA 4K25A 4PKHA 1YAGA 5E84A 1Y64A 1HKCA 5AZIB 2CGKA 2OANA 1U6ZA 5AQRA 4A61A 3CJ1A 3VGKA 2D0PA 3HSCA 4BRKA 3UKUB 1RGIA 5JMVA 1JCFA 2BUPA 4BRNA 2Q0UA 3QMLA 1MWKA 2FSNA 1OKJA 4YDUC 3WEEA 4YDUA 2VWBA 4F9OA 2D0OA 4A62A 2A40A 5F2RA 3SJHA 5AQGA 2YJFA 1X3MA 2ZGZA 4H5VA 4CZIA 2KHOA 4XH5A 3A8YA 4XH4A 5AZIA 4IJAA 3AAPA 5AQFA 3CIPA 2QWNA 3A5OC 4BRIA 1S3XA 1NGBA 1X9JA 1NMDA 1C0FA 3LL3A 1Z05A 1XC3A 4FSVA 3UKUA 2P9IB 3A5LC 3AAQA 4CBXA 1XUPO 3M3ZA 4HWIA 3ZX3A 4A2AA 4M7XA 1WOQA 5AQPA 2VCPA 4BQZA 5LJWA 1DKGD 5B8HA 3O5BA 3VGLA 1GLEG 3A0IX 5FPMA 3VEVA 1H1VA 3FZMA 2P9PB 2GELA 4CZGA 4BRAA 2Q0RA 5AQTA 4H0OA 4BRPA 4JAXA 3ZX0A 1V4SA 3VESA 3EKUA 4IWVA 5FPNA 3QICA 2D4WA 3VEOA 3MN7A 3EN9A 2QWLA 3FLCO 1V4TA 4RWTA 3ULEB 5AQKA 3VEYA 4GNIA 1KAYA 2I7NA 2P9IA 4H0YB 5I9EB 1T6DA 4BC4A 1Q18A 4FO0A 1SZ2A 4BR7A 2I7PA 2FXUA 2YJEA 3ATVA 4B1VA 5FPEA 4BRLA 4IXCA 5KPZA 3KZBA 3CJ9A 3JXUA 3U9ZA 2P9LA 5AQOA 2F9TA 4CD1A 1Z6RA 4E1JA 4CZLA 2V7YA 5EVZA 3LDOA 5AZJB 3H45C 5AQXA 1IJJA 2ASOA 3HBTA 1MDUB 4RTFD 2Q97A 1BUPA 3TU5A 2QW9A 3M6GA 1ZC6A 4PL7A 2EWSA 2E2NA 1NGHA 1NGEA 3UB5A 2HMPA 3ULEA 4H5NA 1BG3A 2A42A 5JLHA 1NWKA 3FZFA 3J8AA 4BGBA 4BQLA 3QFPA 2Q31A 3CI5A 2CGLA 1E4FT 1X3NA 1J6ZA 2CGJA 3GDQA 2P9UB 5AQMA 2ASPA 3H6EA 3DJCA 4FWQA 3VPZA 1ZBSA 4H0PA 5AZJA 3LDPA 3O4WA 3VEZA 1BDGA 2CH5A 4HTLA 4NO7A 3O1WA 4IZ9A 2H3GX 3FZHA 3O08A 3EKSA 5AQHA 4C23A 3VEXA 2QWPA 1ESVA 1QQNA 3LDQA 2GUPA 2IVNA 3IUCA 4CJ7A 4BRDA 3FZLA 5EX5A 5BREA 3WQUA 2P9UA 4WQ4C 1GLLO 4ISGA 2NLXA 3EL2A 5BN9A 3H3NO 3CHWA 1GLAG 3L6QA 3FGUA 4M7YA 2QWQA 3A5MC 4PL8A 4LC9B 1HLUA 4CZEA 3VEWA 1RFQA 4BRFA 4PKIA 2GEMA 3QBWA 3WQTA 3JS6A 1MWMA 1K8KB 2HF3A 4MLEA 3UKRB 4BROA 1HX1A 2PAVA 1E4GT 2V52B 5AQYA 4JHDB 3ZETB 3VETA 4JNEA 4BGAA 2HOEA 4MLHA 1JCGA 1EQYA 2Q1NA 5AR0A 3H3OB 4FWMA 1NGAA 3ENOA 1SQKA 1ATSA 1NGJA 5CE3A 4CD3A 2YCHA 1XQSC 1NGDA 3FZKA 2VYPA 5KPTA 2UYTA 1YXQA 3QDKA 5JLFA 3EO3A 1BO5O 3KHYA 1MA9B 4FWKA 1NLVA 4Z94A 3UKRA 1K8KA 1GLFO 1GLDG 4L3QA 2AA4A 4FOIA 4JHDA 1NGCA 5EXWA 1R59O 2E2OA 3ID8A 1QHAA 3P4IA 2QM1A 5BRDA 4EIAA 3MN9A 4AM7A 1GLBG 3SMPA 3U8XA 4CI6A 4BR0A 5AQZA 2Q2RA 3WUHA 5KQDA 5AQJA 4CZFA 4DHYA 1QZ5A 4IJNA 4H0TB 4BR5A 4XH1A 4FWLA 2P9PA 1NGIA 1HKGA 3D2FB 2ZGYA 3M1FA 2QWRA 3D2EB 3H1VX 1ZXOA 3LM2A 5AQIA 3CJCA 1G99A 1ATRA 3GOIA 3CJAA 5AFUH 3BUZB 2GWKA 4O5FA 5AQNA 3VF4A 5EOYA 4B1UB 4B9QA 2P9SB 4CBWA 1QQOA 4BG9A 4B1ZA 2AP1A 4BRMA 4BR2A 3DAWA 3EZWA 4H0XB 4FWOA 1NBWA 4FOEA 4MO4A 2A6AA 1TUYA 4DQ8A 1SAZA 3UE5A 2ASMA 4BVOA 3HZ6A 4CZKA 3CQXA 5AQUA 5BN8A 3MK6A 3SMSA 3D2FA 3B8AX 4H5RA 1BA0A 3BF3A 4CZJA 5BPLA 1IG8A 4WQ5C 3D2EA 3KVGA 2YHXA 3CERA 2E2QA 5BPMA 2WUSA 3WXJA 4PKGA 4XEIA 3R8EA 3L4IA 3MDQA 2P9SA 1YVNA 5BRHA 5AQQA 2V51B 3U4LA 3FE1A 1T6CA 3W0LA 3ZEUB 2BTFA 4H0VB 3FR0A 1HJOA 2ITMA 3WXKA 3I8BA 2QWMA 1BOTO 3GL1A 2NZTA 3RSEB 3IMXA 1C0GA 2FLOA 3U9DA 3OHRA 2FSKA 1NGGA 3AY9A 3QBXA 4WQ4A 4EAHD 5AFUA 4QS9A 2DPNA 3O80A 2IIRA 4FWNA 5EY4A 2A5XA 1ATNA 4B1XB 4BC2A 2YHYA 2E1YA 2J4RA 4CZMA 1U2VB 4BC5A 3VGMA 5ADXA 3C7NB 2IVOA 4WYBA 2IVPA 3DXKB 2GWJA 4EHUA 3ZEUA 2E2PA 4H5WA 4DB3A 2A41A 3RSEA 4BR4A 3QB0A 5LJVA 3VERA 2D1KA 1D4XA 5F1XA 2W40A 4QS7A 3VOVA 5FPDA 5BR9A 1HKBA 4B1WB 3ZX2A 3CJ7A 4KBOA 3CQYA 3BEXA 2CH6A 3F9MA 4K41A 3TPQA 1U2VA 4BREA 3S41A 3O8MA 1T44A 3C7NA 3DXKA 4H5TA 1GLJO 3CETA 2FF3B 3ZETA 4RCHA 1NGFA 4BRQA 4M63C 1BWFO 3QFUA 4Y0WA 4JD2B 5AQWA 5AQLA 1CZAN 4EHTA 4ISEA 2P9KB 4BRCA 3ATUA 2E88A 3G25A 2E8AA 4GY2B 4BRHA 1RDWX 5KPRA 2V7ZA 2P9LB 2HF4A
chains in the Genus database with same CATH superfamily
3NCIA 1HR0K 1SKWA 4E89A 2RN2A 1NK7A 3OYHA 1WUAA 4FWSA 1KFSA 2DFHA 3DWLA 3LWLA 4JI6K 4NB4A 5JS1A 5EU7A 3T1HK 4KHQA 3MCAB 4DUZK 1JLBA 1GOCA 3MN6A 5E26A 5CZ1A 3DXMB 1I39A 1QQMA 3R6MA 4JK9A 4M41A 3LP3A 4CBUA 1D5AA 4YORA 2P9KA 3AARA 4ILJA 4O4GA 3LDLA 2QXLA 4IO8A 4CHYA 5ADXH 3IDHA 3IFRA 4DUYK 2QKBA 3ISNC 4QCLA 1N34K 3VN5A 1ASUA 3TANA 3H46O 4NCGA 1JCEA 1TKTA 1VSEA 4I2QA 2DFFA 4ZHRA 5BRFA 1WNSA 2P9NB 4BRGA 5D3GA 5GIPA 3AVFA 4ILHA 1BU6O 2FC0A 3NGYA 3DLLL 3VENA 3QESA 4OKEA 5FLXO 3TSPA 4BVPA 2VWJA 3MX2A 3A5NC 4BG8A 4Y1CA 3AA5X 4A2BA 4G1QA 5F0XA 4WFNL 1HQEA 3O3FA 4FPAA 5KQ8A 2DY4A 4FJGA 1M1KO 4MO5A 4FZZA 1EWRA 4IFVA 3WXMB 1N33K 1KCFA 1L3SA 1QQCA 1WLJA 3HPHA 4CJKA 1U6ZA 3CCLN 4GVEA 3K9KA 4I2PA 3D45A 3HSCA 4BRKA 4LH5A 4NLBA 1S1VA 4JI4K 2HHWA 2Q0UA 1OKJA 2ZD1A 1FKPA 3SJJA 4YDUA 3DOKA 4B3TK 5JVHL 2D0OA 3L2UA 1OVYA 3A2FA 5HLFA 1RCHA 4PUOA 5AZIA 3AAPA 3CIPA 1S3XA 1X9JA 4W5NA 1NK9A 3K57A 3V9WA 3A5LC 3AAQA 4IKFA 3KK3A 4A2AA 4C8KA 3NMUA 1W7AA 5AQPA 2QA4N 1DKGD 5B8HA 3VGLA 1GLEG 3A0IX 4DSFA 1QSLA 1HMVA 5E41A 3OYGA 2QK9A 4CJ5A 3VEVA 1H1VA 1HJRA 4DV0K 3DLKA 3AVHA 1NU0A 4OJRA 3PX6A 4JAXA 3ZX0A 5FPNA 4BDPA 3QICA 4CHZA 3MN7A 1VQ9N 3AVIA 3EN9A 3ULEB 1HNZK 1RDBA 5I9EB 2HBJA 4BR7A 1Q18A 4FO0A 1XHZA 4JKBA 3MEEA 4BRLA 5KPZA 3JXUA 3U9ZA 1GOAA 2P9LA 4DFMA 4AILC 1BCMA 1OH7A 4B3MK 1Z6RA 1WAJA 4B3SK 1LWEA 2V7YA 5AJ3K 2F8SA 2UXBK 5AZJB 1YI2N 1IJJA 4Q5VA 4C8NA 3SQ0A 3S3NA 2ASOA 4B8CA 1MDUB 1BUPA 3TU5A 2NUBA 3N4PA 1VSKA 1NGHA 1NGEA 1RT5A 2HMPA 2A42A 4W5QA 4BQLA 4BECA 3T1AA 5JENA 3QFPA 4XIUA 1X9MA 1KLNA 4CW7B 4AF1A 1J6ZA 1S1XA 4CCHA 3DLGA 3CCSN 1VQNN 4FWQA 1S1WA 4H0PA 1BISA 1KRPA 3O4WA 3TR8A 3VEZA 2HB5A 4YY3K 3TWHA 4HTLA 4NO7A 1JJ2M 4IZ9A 2H3GX 2KQ2A 4O55A 4OLAA 4C23A 3THYA 3PIPL 3OYLA 3H08A 1NOZA 4YOUA 2GUPA 1XHXA 2D0BA 4CGHA 4IOAL 3MAQA 2P9UA 4WQ4C 3HOTA 1GLLO 4GMJB 3J7ZO 2P5GA 4GKJK 2UXDK 1GLAG 3K0SA 2QWQA 4PL8A 1RILA 1WSFA 3V4IA 1HYZA 4CEEA 3QBWA 3WQTA 1VQ8N 1KSPA 3UKRB 4MLEA 1E4GT 1YTAA 1WB9A 4FJ5A 3OYJA 2JWKA 1DLOA 1TL1A 2HOEA 1EQYA 3RRHA 4IFYA 1TKZA 4FWMA 4GV3A 1DTTA 1JLCA 3M5RA 1ATSA 3R3LA 5CE3A 1KFDA 4UY8O 5KPTA 3AO1A 1RT3A 1YXQA 4CJQA 1OH8A 3EO3A 4CEQA 1RDCA 1NLVA 3DYAA 4KFBA 2BDPA 4U7BA 3E1YA 4JS5A 3C6UA 3NH1A 4NXMK 3ZSWA 2GX9A 4JHDA 4FOIA 1YVUA 1NGCA 1W0HA 1YJNN 2G8UA 2QM1A 2OTJN 1O13A 3HM9A 3KD5E 4JKEA 2VGMA 2AJQA 3OYEA 1UA1A 4JEPA 1KVCA 1GLBG 3SMPA 4BR0A 3WUHA 3T7ZA 4DHYA 1QZ5A 3P39A 4IJNA 3V9SA 1D9DA 5CYQA 2P9PA 4DU3A 1NGIA 1HKGA 1SL2A 3DLRA 4CECA 4CK1A 4CJ4A 2HSTA 4DG1A 3CJCA 1G99A 3GOIA 1Z26A 3AVCA 2GWKA 4B9QA 2A1SA 2OTLN 4BRMA 5LL6Z 1SKRA 4FWOA 1NBWA 4HVJA 4MO4A 5CYMA 2D0AA 1TK5A 3WNHA 2BANA 1IKYA 4DF4A 3SV4A 2HHQA 1RBRA 4CZKA 3CQXA 2YKMA 2UUCK 4CGJA 3MEDA 4GVMA 3HVTA 1SKSA 3CYGA 5A2QO 3HPOA 4WQ5C 3D2EA 2YHXA 5BPMA 1EO1A 4BEBA 3L4IA 3MDQA 1NK5A 4KTZA 1HJOA 2XY7A 1HYVA 3PLAA 4OGEA 2YNHA 5HRSA 4JI8K 3OHRA 3AY9A 3NFAA 3QBXA 2GUIA 2BGGA 1NJYA 3HSTB 1N8RO 1Q82O 1CZ9A 4DV1K 4DTUA 4FWNA 2O8FB 2HNZA 2HHTA 1ATNA 4B1XB 3K58A 3SV3A 2HBKA 4FLUA 4E7IA 1U2VB 3T19A 4JKGA 3VGMA 3PX4A 1HQUA 5ADXA 4DSKA 1S6PA 3IRXA 3C7NB 4FLTA 3VA0A 3DXKB 3BZCA 4H5WA 3BDPA 2A41A 3LDSA 4KRFA 4LF9K 3VQDA 2C1GA 5H1SQ 4E19A 4J2DA 2W40A 1LAVA 4WF9L 3E9LA 5FPDA 3PY8A 1T3VA 1ASVA 3CJ7A 4N56A 4IEIA 4WE1A 3BEXA 2CH6A 2P51A 3TPQA 4CJVA 4N41A 3CETA 4ID5A 2OZMA 2FBTA 1NGFA 4RCHA 4BRQA 4KREA 4M63C 2NRWA 4FJ7A 3NVKA 4FCYA 4ISEA 2UU9K 4DR7K 4GY2B 4BRHA 1RDWX 2V7ZA 4MDBA 3BGRA 3KKRA 3ZT0A 3SPYA 5M1OA 2NNWA 4O0IA 1LOTB 5HROA 4KPYA 4H4MA 3GBTA 4YFUA 3SAFA 2YI1A 1RBUA 4I6MB 4E7KA 2KW4A 4O8KA 2RF2A 3M8QA 1S22A 2E1ZA 1ZYQA 1SUQA 4JD2A 1HPMA 4CE9A 1KAZA 1W97L 1G15A 3DMJA 4RW7A 4FLXA 3VQ8A 2OPQA 2XY8A 3T69A 1DEJA 2VQFK 4BWMA 4DV3K 4IOXA 3TARA 2HMIA 4V19S 4M3YA 4HCCA 1NJIO 4PQUA 4MQ3A 4OKKA 1XI1A 4GKKK 3OYCA 3MECA 3PSIA 1DT9A 2W41A 4N47A 1ZBIA 3VF2A 3MN5A 1FJGK 4KB0A 3DXMA 3E9PA 3AVLA 1RT6A 3M8PA 3R9PA 4IG3A 3WXIA 1S6QA 1VSFA 1VRTA 5M1KA 4W5OA 5BPNA 4J8FA 4X65K 3I33A 2E20A 3W3DA 5AQSA 3SLCA 4C8MA 5HL7L 4K0KK 4DV7K 1DTQA 4JI3K 3DRRA 2UUBK 2ATQA 4X66K 2YHWA 2P9NA 4KI4A 3TAFA 3PO5A 3OS0A 4R5PA 3MMVA 4K25A 3KLHA 2DTUA 1YAGA 4CHOA 5E84A 1VSDA 4FM2A 4OPAA 4PWDA 3NF9A 3HRGA 3VQPA 4A61A 1RBVA 3B6PA 3WNGA 4DFJA 4NXNK 1HYSA 3SNNA 1SS6A 4O8UA 1RGIA 5TKWA 1JCFA 4ELUA 5KGXA 4YOWA 3OBYA 1VRUA 2FSNA 2F4VK 3I56N 4CEBA 1HNXK 4CGFA 4JKDA 4AQYK 2G8VA 3SUOA 4IG0A 3DRPA 3SUPA 1VQMN 4DS4A 4KHUA 1B92A 4I7FA 4Z0UA 3VQAA 4BY9C 2YJFA 4CZIA 2KHOA 3CQ8A 3A8YA 4IJAA 4HUEA 4BRIA 3LL3A 1XC3A 3OYMA 2O8EB 2P9IB 5JS2A 4CBXA 2O8DB 4DTNA 2NRTA 1UAXA 3ZX3A 3OYIA 1YT3A 1NMNA 3O5BA 3KK2A 1IV0A 3TAMA 4E3SA 3FZMA 2WOMA 1NKCA 4OO1J 2HBLA 2GELA 3DRSA 4H0OA 4BRPA 3SZ2A 1FK9A 4KKOA 4W5TA 1QS4A 1VQON 2D4WA 3VEOA 5AQKA 1O1WA 3VEYA 4GNIA 1RTJA 1C0TA 4CHNA 1KAYA 4H0YB 3LWMA 4FZXC 4A5BA 1T6DA 3AVBA 4BC4A 1KTQA 4B1VA 2YJEA 5FPEA 2XY6A 3KZBA 3L2WA 1QVFM 3LAMA 5J1EA 4B9MA 4DU4A 1ILYA 1VSHA 5EVZA 5AQXA 4CJPA 3VQ6A 4RW6A 3OJSA 3HBTA 1IBLK 4RTFD 5GAHP 1NNEA 4CJUA 3QEVA 4M45A 1ZC6A 1U47A 1BIZA 4DTJA 1RTHA 3UB5A 3ULEA 1WBDA 1WSEA 3OW2M 2NRXA 4FZYA 3FZFA 4MDAA 3AVGA 4BGBA 4CHPA 1ZBUA 4H4OA 4DR5K 1X3NA 4M3TA 3AVNA 5AQMA 4JI0K 3QIPA 3H6EA 4DWIA 5AZJA 3L3VA 3LDPA 3QERA 4FLWA 4LSNA 2ZQBA 4CF8A 1K73O 4ELTA 1RDUA 3EKSA 3THVA 4DTOA 1QQNA 3Q7BA 3CFRA 3KD1E 4EP4A 3IUCA 3CCMN 3CCVN 4DU1A 4BRDA 1WSIA 4CF2A 3FZLA 3O4QA 5EX5A 3QEPA 3K2PA 3HO1A 1GOBA 4I9QA 4K8XA 4LF6K 1JKHA 3SQ4A 2PYJA 3ZT4A 3NH0A 1VSIA 2JGUA 3A5MC 3V6DA 2IAJA 1HLUA 2FBYA 3G10A 4PKIA 4EZ9A 4FXDA 1TKXA 1K8KB 2HF3A 4CIEA 2PAVA 5BR8K 4B9LA 3ZETB 4DSEA 4JNEA 3P1GA 4CFAA 1K8AO 4MLHA 5DMRA 4B8AB 1QHTA 2UUAK 2OZSA 3H3OB 3L2VA 3CCEN 4KTWA 1NOYA 3ENBA 1NGJA 4CD3A 4FJ9A 3RRGA 2VYPA 3VQ4A 1NGDA 2YCHA 1T8EA 4FK2A 3PX0A 3QDKA 4IO9L 3THXB 3KHYA 5C2FA 4Z94A 3ZSOA 3S3OA 3UKRA 4W5RA 3OY9A 1TAQA 1IBKK 1GLDG 2ETJA 2AA4A 3SBTA 3K5OA 4BACA 3K5MA 1RDDA 2D0CA 4E0DA 4DKWA 3RTVA 4FJXA 5HP1A 1Z25A 5K14A 3P4IA 3KLEA 3LZJA 1B9FA 3ALYA 1TL3A 4FLVA 4DFPA 2FBXA 1EXQA 4O44A 1IO2A 3SCXA 5CY4A 2IOCA 1RT2A 3VTIA 5AQJA 4CZFA 3BZKA 4BR5A 3D2FB 5JVGL 3I55N 4YOVA 4CF9A 3EE8A 4JK7A 4JKCA 3M1FA 2HBMA 2G8HA 1XNRK 2HVIA 5AQIA 3BUZB 4O5FA 5AQNA 4B1UB 1C1BA 2QXFA 3E66A 1QQOA 3ZCMA 4JS4A 4HUFA 1NG9A 1Q9YA 4K8ZA 4N5SA 4FJ8A 3DAWA 1S9EA 3EZWA 3S5TA 4FOEA 3V9UA 3UE5A 3M8RA 3CD6N 4IBNA 3HZ6A 4KH6A 1CLQA 3TTFA 4BE2A 5AQUA 5BN8A 3ZYYX 1VHXA 4OVLA 5BPLA 3CERA 1TK0A 3R1XA 4PKGA 1C1CA 2C1IA 1L3UA 4LY7A 3PV8A 1YVNA 2X6SA 4A57A 5BRHA 4ZTFA 4LF8K 3WXKA 1ZBFA 3RSEB 3IMXA 4JKAA 2XHBA 5KI6A 4CF0A 4DR3K 3QO9A 4CJEA 3E9OA 5AFUA 4QS9A 2F7TA 4CGGA 3AVAA 2Q3SA 3CMEN 4Z4GA 2A5XA 3I0SA 1A5VA 4GV6A 3CG7A 2E1YA 3LAKA 2J4RA 4CZMA 4CK3A 4BC5A 3VQ7A 3IKMA 4CJWA 2IVOA 2NRZA 4IFEA 3NF7A 2GWJA 5HOOA 3SUQA 2ZJPL 2P5OA 3IG1A 4BR4A 1L3TA 3QB0A 2Y1IA 3J81O 5IT9O 4FM0A 2HNYA 5FDLA 1JLEA 3RMDA 3OJUA 2O8FA 2XO7A 5BR9A 3ZX2A 4KBOA 4BWJA 5T7BA 1U2VA 4DR2K 1IBMK 4DSIA 1D8YA 1P90A 3C7NA 4NLCA 4FVUA 4DS5A 3DXKA 3KK1A 4F8RA 1GLJO 2FF3B 3SUNA 2QEXN 4O0JA 4YOTA 1BWFO 5AQWA 4U67L 1U45A 2YX6A 5AQLA 3C65A 3AVMA 3NF8A 1LWFA 3C94A 3VA3A 2RKIA 1WSHA 2P9LB 3I0RA 4CJRA 4Z4IA 3HPGA 4B1YB 3WNEA 5J2QA 2X78A 2RHKA 1BA1A 3TSUA 2Q36A 3VTHA 4AHVA 2F9WA 4DSLA 5KRSA 3H1QA 2HHUA 1TAUA 4FW1A 4JN4A 4FWPA 3VF6A 2KZMA 1IH7A 1M90O 1TYQB 1C6VA 5LMNK 3WT0A 4BE0A 3HI0A 4J2AA 3ZLJA 4TSXA 5M1PA 4FL9A 3THWB 4BR9A 1J5OA 1NM1A 2KZZA 4FWRA 3V9ZA 5C42A 3CCJN 4E1MA 3D7EO 1U4BA 2HHIA 4CGIA 3O6WA 4F2RA 1QVGM 1XNQK 5JICA 1QE1A 4I6MA 3L0QA 1HUXA 3SI6A 4OPJA 3QEWA 2PYLA 3NAEA 1NK0A 4CZHA 3THYB 3ZT3A 5KRTA 1T05A 3MCPA 3MXMA 2QWOA 3LDNA 2ZF5O 4PA1A 5TKYA 4HHTA 1QZ6A 3ZSRA 4EFHA 1KAXA 1GLCG 3PUFA 3QNNA 4CEZA 3LP0A 2FF6A 5HRPA 2ZWHA 4KHWA 3WEEB 1LCUA 2E6MA 1C1AA 3BF1A 4X64K 3HK2A 3SBGA 3PIOL 3C6AA 1JLGA 1P8ZA 1B9DA 2RE2A 4JK8A 2R7YA 1Y64A 4DV2K 1HKCA 4F3TA 2CGKA 4LF7K 5CHIA 5AQRA 4JRQA 2Z1JA 4M3WA 3VGKA 4CJFA 2YKNA 3UKUB 2YNGA 1NK4A 5JMVA 2BUPA 4BRNA 2E5LK 1MWKA 3VQEA 3C6HA 2W6KA 2VWBA 3T3FA 4F9OA 2B5JA 5GINA 4F2SA 1FKOA 3EY1A 4A62A 2A40A 1L3VA 2VG5A 1QSSA 5AQGA 4JI1K 1TKDA 3G71N 4H5VA 1JL1A 2VQEK 3OYBA 2VWKA 1RT4A 4FJJA 1NGBA 3SQ2A 4RW4A 4CJLA 4Z4HA 2KFNA 2KKZA 2OPRA 4J2EA 2FBVA 4AHTA 1XUPO 3I8DA 4M7XA 1RTIA 2VCPA 3MEGA 3K59A 4CFBA 4FJNA 3CFOA 2P9PB 2W6LA 5HBMA 4BRAA 2Q0RA 4FK0A 3IAYA 3J80O 1V4SA 2QWLA 1V4TA 2EHGA 2O8EA 1S9GA 1RDAA 2P9IA 4IOCL 2O8DA 1F21A 1SZ2A 3KLGA 4X62K 2O8CB 4IXCA 3V1RA 4Q0BA 4KB1A 3CJ9A 1LAWA 4CESA 2F9TA 4DLGA 3D0PA 4CZLA 3LDOA 3JYTA 4KHYA 3H45C 1K6YA 1U48A 2XY5A 2BH1A 4FYDA 3O9UA 3DOLA 1EWQA 1S72N 3CM5A 4B9SA 4KAZA 2WBNA 1J54A 4PL7A 3AA3A 4FLZA 4B3RK 3SAHA 3HP9A 4CEDA 3VQ5A 1S1TA 4H5NA 2QKKA 3J7YP 4FM1A 1X9WA 1NWKA 3J8AA 1N32K 1JL2A 2VGNA 4KTQA 2O4IA 1YHQN 2CGJA 2ASPA 2A1RA 3E01A 3DJCA 3OVNA 3VPZA 1ZBSA 1BI4B 3VQ9A 4FLYA 5FRMA 2HHSA 3OBWA 3CM6A 3P83D 2CH5A 1K9MO 4JKHA 3O1WA 3TSQA 3O08A 1WN7A 4DLEA 5C0YA 4CEAA 3OTOK 2QWPA 1ESVA 3HXMA 3TAGA 2IVNA 1SL0A 4CJ7A 3L2RA 3NH2A 1ITGA 4CK2A 5BREA 3WQUA 5DM7L 4FJLA 2O8BB 1VQPN 4LFCK 2G8WA 3O4NA 3MXIA 4M3XA 3NBPA 2G8KA 3L6QA 1TV6A 4RW8A 5KTQA 4M7YA 2G8FA 1ASWA 4LC9B 2WFBA 4M3UA 2B6AA 4BRFA 2GEMA 1XMQK 3V1OA 5DM6L 3CC4N 3V81A 4BROA 1HX1A 3VETA 4BGAA 4DQPA 1VK0A 1TVRA 2Q1NA 3ZSQA 4FJKA 3ENOA 4ILGB 3AA2A 3AA4A 3VQQA 3EYZA 3FFIA 3FZKA 2I5JA 4AH9A 2ZJRL 2HVHA 5JLFA 3P38A 1BO5O 3OYKA 3KJVA 4AHRA 1K8KA 1VSLA 1IKVA 1XC9A 4L3QA 3LALA 4DF8A 5EXWA 3PO4A 1BL3A 3J7AP 4HTUA 4LD0A 1QHAA 4NCBA 1J5EK 4CHQA 1YJ9N 4LF5K 5BRDA 3QINA 4EIAA 3TI0A 1VSMA 3MN9A 4AM7A 3DI6A 4CI6A 5AQZA 2Q2RA 2PZSA 4CEOA 3THXA 2P1JA 1J53A 3AGRA 4XH1A 3O3HA 4YOXA 4B9TA 4FJIA 4C1NK 3CC2N 3QETA 2QWRA 3H1VX 3Q7CA 1ZXOA 3LM2A 1ATRA 2YNFA 3LZIA 2KLAA 4EP5A 1UWBA 5EOYA 5GADP 2P9SB 4BR2A 4B1ZA 2X6NA 4JLHA 2Z1GA 4H0XB 1X9SA 4CJSA 3SQ1A 1EX4A 2A6AA 4E1NA 4DQ8A 2ASMA 4BVOA 4CFCA 1KVAA 3PSFA 3UIQA 3SMSA 4C1NI 3D2FA 3B8AX 1IKWA 5J2PA 4H5RA 1BA0A 4OGCA 3BF3A 4CZJA 3CXCM 1IG8A 2Z1HA 3SYZA 2YV0X 4BE1A 2JLEA 2WUSA 3WXJA 3CMAN 1VQ6N 4RW9A 4XEIA 3R8EA 5GAEP 4DSJA 1VAZA 3QEIA 5AQQA 1FW6A 3U4LA 3FE1A 3NGZA 5J2NA 3JAMO 3ZEUB 1JLQA 2BTFA 4WCEL 5J2MA 3DLHA 4JI5K 2QWMA 3AO4A 1BOTO 3GL1A 3MWTA 1C0GA 4KO0A 2E4LA 1NGGA 2FSKA 4WQ4A 4BE7B 1Q9XA 2NRRA 1VQKN 4GW6A 3O80A 2IIRA 3F5TA 1RT1A 1D9FA 3ZT2A 4BC2A 2YHYA 1JXBA 3EE9A 3AO2A 1VQ4N 4DMNA 1JLAA 4DQIA 3ITHA 3NGIA 1A5XA 4WYBA 4EHUA 4DB3A 3OYAA 1R0AA 3HT3A 2HHXA 1QSYA 3QEXA 4C8LA 2W00A 3RSEA 1MU2A 3OYFA 5C10A 4DFKA 4H8KA 4CIGA 5FRNA 3VERA 5C2DA 2D1KA 1D4XA 5F1XA 2RPIA 1I3AA 3IS9A 1HKBA 4B1WB 4KHNA 4ZTJA 3L8BA 3F9MA 4K41A 2QTDA 4BREA 4YHHK 4LF4K 1HNWK 3S41A 3O8MA 1T44A 4F4KA 3VMFB 3ZSYA 3NVMA 5GAGP 1E3MA 4KH5A 4FJHA 2WONA 3NHGA 4Y0WA 3QFUA 1VSJA 3HP6A 1CZAN 4EHTA 2P9KB 3CYMA 1Q86O 3ATUA 2E88A 4CIFA 3DLBA 4YNQA 2ZJQL 2HF4A 2NRHA 1X1PA 1KXPA 4PY5A 3KLFA 3OYDA 2WTUA 2VG6A 3FFKB 3ZSXA 3LM9A 4OLBA 4IDKA 4M3RA 4Z4FA 3ULDA 3DM2A 2ITGA 4ELVA 1SV5A 2FSJA 2IC3A 5AQVA 3C0BA 4DTSA 1S5JA 2GTDA 4B9UA 4FPBA 3GG4A 1NJWA 3L3UA 4H03B 2EX3A 1BQNA 4ICLA 3SK3A 3QNOA 4NCAA 2JWLA 3KK7A 4K42A 3G0ZA 1NKEA 4B9VA 4K43A 4ISFA 4DTPA 4DCHA 5ELZA 3CC7N 3BP8A 3O9RA 1VQ7N 3O9QA 3CJBA 3O3GA 2A3ZA 1CXUA 3T1YK 3ENHA 2PFUA 3S3MA 1TYQA 4WQ5A 3GE1A 3KLIA 3OA9A 3V1QA 2YNIA 1YUWA 4BC3A 3MWPA 3THWA 3HTVA 1FXXA 1RNHA 1BCOA 3KKSA 3LPTA 4DTMA 3O9TA 4A59A 4AM6A 1W2BM 3D6RA 3ID6A 2KTQA 3HM8A 2PY5A 1YIJN 4F3OA 1DGKN 1HPZA 3WXLA 4CF1A 4KV8A 5C24A 1RBTA 2IS3A 2VG7A 4QS8A 1CXQA 5LY3A 2PBDA 5SWMA 1TUUA 4HUGA 1EP4A 2XRIA 3O1BA 4PKHA 4A5AA 2YHAA 3MX5A 5AZIB 2OANA 3HL8A 3AVKA 3CJ1A 2D0PA 4OPKA 3LPUA 1IKXA 4QOZB 4JI7K 1WSGA 3QMLA 1WAFA 4JI2K 1KC8O 3QLHA 4YDUC 1C0MA 5M1FA 2O4GA 1YTUA 4E72A 3WEEA 4NYFA 4CEFA 1C0UA 3EEQA 4M42A 5F2RA 2OPPA 3SJHA 1LWCA 3LANA 3ZSZA 3RR7A 4E7JA 1IG9A 1RT7A 1X3MA 2ZGZA 4JRPA 4XH5A 4XH4A 2NRVA 5M1NA 2W42A 3KWGA 5AQFA 4CJTA 4J2BA 2QWNA 3A5OC 4IDHA 1NMDA 1C0FA 4KHSA 3L4QA 1W9HA 1Z05A 4FSVA 3TTCA 3UKUA 4B08A 1A5WA 3S9HA 1ZBLA 4CJ3A 3M3ZA 2F96A 4HWIA 1WOQA 1OH5A 4BQZA 5LJWA 2HNDA 3C95A 1HNIA 5FPMA 4DQSA 5LMUK 4JYAK 4L8RB 4CZGA 4M3ZA 5AQTA 5SZTA 1HNVA 2HW3A 4Z4CA 3VESA 3EKUA 1L5UA 4IWVA 4B3OA 3M8SA 3FLCO 4RWTA 4FJMA 2BE2A 2I7NA 1J9AA 4EZ6A 3TTDA 2I7PA 4DTRA 2FXUA 3ATVA 3AV9A 3ZT1A 4DV5K 1JLFA 5MLCQ 5AQOA 4CD1A 4JV5K 3P5JA 4E1JA 5HRRA 4E7LA 1U49A 2GV9A 4AHUA 4FW2A 4BDZA 3F73A 1QTMA 4DQRA 2Q97A 3WNFA 2QW9A 3M6GA 4CERA 2EWSA 4MFBA 2E2NA 1BG3A 3TAQA 5JLHA 3EZ5A 4O5BA 3TABA 2O8CA 4RG8A 2Q31A 2IGIA 3CI5A 3TAPA 1T7PA 2CGLA 1E4FT 3U6FA 1LW0A 1XWLA 3GDQA 2P9UB 3CFPA 4WFAL 3HJFA 1Q8IA 1BDGA 3AVJA 2OYQA 4WFBL 3FZHA 5AQHA 5DK5A 3VEXA 2UXCK 3HOSA 3SPZA 2B4JA 4DV6K 4AHCA 2D5RA 4LFAK 3LDQA 5I42A 4OPHA 5CR4A 4FVMA 4DR1K 4DQQA 3CCQN 2G8IA 4HCBA 4ISGA 1EETA 2NLXA 3EL2A 5BN9A 1BIUA 3H3NO 3U3GA 1BI4A 1U04A 3CHWA 3FGUA 4KHPK 3OYNA 5FROA 4PHTX 3F2KA 4OKJA 3G6EN 2Z1IA 2ZE2A 4CZEA 3VEWA 4C8OA 1RFQA 1N6QA 3RWUA 3JS6A 1MWMA 2WC9A 2V52B 3VQBA 5AQYA 1RBSA 4DV4K 4JHDB 4DTXA 1S1UA 3RMCA 1EKEA 4ID1A 1JCGA 5C25A 2O8BA 5AR0A 3NDKA 4CFDA 1NGAA 1KLMA 3QIOA 1SQKA 3RVCA 4DR4K 1XQSC 3BY5A 3O9SA 3B6OA 3LP1A 1Q81O 2UYTA 1WBBA 1CZBA 1TGOA 1MA9B 4FWKA 4GV9A 1GLFO 3K9JA 3DLEA 5I3UA 3LP2A 1R59O 2E2OA 3ID8A 1Q7YO 2E6LA 3HYFA 3NE6A 1YJWN 2DFEA 2Y1JA 4XJXA 4LH4A 4R79A 1REVA 3U8XA 1OH6A 4B9NA 4KH4A 5KQDA 2OA8A 1NK6A 3U3YA 4H0TB 1BGXT 4FWLA 3CF5L 1BHLA 5IWAK 3CPWM 2ZGYA 1NJZA 5C15A 4DR6K 3D2EB 3HVRA 2HHVA 3CJAA 2X74A 5AFUH 3VF4A 4AHSA 4CBWA 4BG9A 2AP1A 3CCUN 3VQCA 3RMAA 3N4QA 3L2QA 1TUYA 3SAGA 4LSLA 4CVNE 3AO5A 1SAZA 3MXJA 3KTQA 2QI2A 3KIOA 1XMOK 4KI6A 3MK6A 1NKBA 1RTDA 4G9ZA 3KVGA 5KGWA 2HHHK 4Z4EA 2E2QA 1I94K 1HRHA 3K5NA 3NF6A 3RMBA 3ASMA 4JKGB 2F8TA 2P9SA 1VQ5N 2OPSA 4IEEA 1BQMA 4QAGA 3P31A 2V51B 1NK8A 1T6CA 1KD1O 3W0LA 4H0VB 3FR0A 2ITMA 3I8BA 2NZTA 1OVQA 1VQLN 4JKFA 2FLOA 3U9DA 4BDYA 4UQGA 4EAHD 1UA0A 2DPNA 5EY4A 1TK8A 3OS2A 2GBZA 3K5LA 3V9XA 2IDOA 1UOCA 3CCRN 1WSJA 3RR8A 1SL1A 2IVPA 3ZEUA 2E2PA 1LW2A 1ZBHA 4NYNA 4LFBK 3OS1A 3F9KA 5CZ2A 3ZSVA 5LJVA 3CPEA 4N76A 1KVBA 3KWIA 3TAEA 4E7HA 4QS7A 3VOVA 3JSMA 2KFZA 4YOYA 1YF5L 4Y1DA 1YITN 5HRNA 2OCEA 3CQYA 1JXEA 1T03A 1NJXA 1KQSM 3G4SN 4OX9K 4CGDA 5M1QA 5GIOA 4H5TA 4I9LA 2LSNA 3ZETA 2ZM6K 3AO3A 4JD2B 4FK4A 1Y97A 1N5YA 2YHBA 3AGKA 4BRCA 1LV5A 3C6TA 2E8AA 3G25A 5C12A 1N36K 5KPRA
chains in the Genus database with same CATH topology
4B1YB 2NRHA 5M1OA 2NNWA 1LOTB 1KXPA 2RHKA 1BA1A 3TSUA 3GBTA 2Q36A 3VTHA 1WUAA 3SAFA 2F9WA 2YI1A 4FWSA 3DWLA 3FFKB 3LM9A 3H1QA 4NB4A 4JN4A 4I6MB 4FWPA 4O8KA 3VF6A 3MCAB 2FSJA 1M90O 1TYQB 5AQVA 1S22A 2E1ZA 3MN6A 5E26A 3C0BA 3DXMB 1QQMA 3R6MA 4JK9A 4JD2A 1HPMA 2GTDA 4CBUA 4FPBA 1KAZA 3GG4A 4YORA 3HI0A 3WT0A 1W97L 2P9KA 4H03B 3AARA 4ILJA 5M1PA 4FL9A 3LDLA 3T69A 4BR9A 1DEJA 3SK3A 2QXLA 4IO8A 4IOXA 2JWLA 1NM1A 3KK7A 4K42A 5ADXH 4FWRA 3IDHA 3IFRA 3CCJN 1NJIO 3D7EO 4K43A 4ISFA 4DCHA 5ELZA 3CC7N 3O6WA 3BP8A 3O9RA 1VQ7N 3H46O 1QVGM 5JICA 1JCEA 3O9QA 3CJBA 4I6MA 2A3ZA 1DT9A 3L0QA 1HUXA 2W41A 3VF2A 3MN5A 2P9NB 3ENHA 2PFUA 4BRGA 5BRFA 5GIPA 1TYQA 4CZHA 4ILHA 4WQ5A 1BU6O 3DXMA 3E9PA 3GE1A 3MCPA 3OA9A 1YUWA 4BC3A 3DLLL 3R9PA 3VENA 2QWOA 3MWPA 3LDNA 3WXIA 2ZF5O 5TKYA 5M1KA 3TSPA 3HTVA 1QZ6A 4BVPA 5BPNA 4J8FA 3I33A 2E20A 3MX2A 3W3DA 5AQSA 3O9TA 4EFHA 4A59A 3SLCA 1KAXA 1GLCG 4AM6A 1W2BM 3D6RA 5HL7L 3A5NC 3ID6A 4BG8A 2FF6A 3HM8A 2ZWHA 4A2BA 1YIJN 4WFNL 5F0XA 3WEEB 1LCUA 4FPAA 1DGKN 3WXLA 3BF1A 5KQ8A 2YHWA 2P9NA 3SBGA 3PIOL 3C6AA 4MO5A 4QS8A 1M1KO 1P8ZA 5LY3A 2RE2A 4JK8A 3WXMB 2PBDA 1TUUA 3MMVA 3O1BA 4K25A 4PKHA 4A5AA 1YAGA 5E84A 1Y64A 1HKCA 3MX5A 5AZIB 2CGKA 4OPAA 5CHIA 2OANA 1U6ZA 3HRGA 5AQRA 3CCLN 4A61A 3CJ1A 4GVEA 3VGKA 3K9KA 2D0PA 3HSCA 4BRKA 3UKUB 1SS6A 4NLBA 4O8UA 1RGIA 5JMVA 5TKWA 1JCFA 2BUPA 4BRNA 2Q0UA 3QMLA 4YOWA 3OBYA 1MWKA 2FSNA 1KC8O 1OKJA 4YDUC 5M1FA 3C6HA 3I56N 4JKDA 3WEEA 4YDUA 2VWBA 5JVHL 4F9OA 2D0OA 5GINA 4A62A 2A40A 1OVYA 5F2RA 3SJHA 1VQMN 5AQGA 3G71N 4BY9C 2YJFA 1X3MA 2ZGZA 4H5VA 4CZIA 2KHOA 4XH5A 3A8YA 4XH4A 2NRVA 5AZIA 5M1NA 4IJAA 3AAPA 3KWGA 3CIPA 5AQFA 2QWNA 3A5OC 4IDHA 1S3XA 1NGBA 1X9JA 1NMDA 1C0FA 4BRIA 3L4QA 3LL3A 1Z05A 1XC3A 4FSVA 3TTCA 2KKZA 2P9IB 3A5LC 3AAQA 3UKUA 4CBXA 1XUPO 2NRTA 3M3ZA 4HWIA 3ZX3A 4A2AA 4M7XA 3NMUA 1WOQA 5AQPA 2VCPA 4BQZA 5LJWA 2QA4N 1DKGD 5B8HA 3O5BA 3VGLA 1GLEG 3A0IX 5FPMA 3VEVA 1H1VA 3FZMA 2P9PB 4OO1J 2HBLA 2GELA 4CZGA 4BRAA 2Q0RA 5AQTA 4H0OA 4BRPA 4JAXA 3ZX0A 1V4SA 3VESA 3EKUA 4IWVA 1VQON 5FPNA 3QICA 2D4WA 3VEOA 3MN7A 1VQ9N 3EN9A 2QWLA 3FLCO 1V4TA 4RWTA 3ULEB 5AQKA 3VEYA 4GNIA 1KAYA 2I7NA 2P9IA 4IOCL 4H0YB 4A5BA 1T6DA 5I9EB 2HBJA 4BC4A 1Q18A 4FO0A 1SZ2A 4JKBA 3TTDA 2I7PA 4BR7A 2FXUA 2YJEA 3ATVA 4B1VA 5FPEA 4BRLA 4IXCA 5KPZA 3KZBA 3CJ9A 3JXUA 3U9ZA 2P9LA 5MLCQ 1QVFM 5AQOA 2F9TA 4CD1A 1Z6RA 4E1JA 4CZLA 2V7YA 1ILYA 5EVZA 3LDOA 5AZJB 1YI2N 3H45C 5AQXA 1IJJA 4MDBA 2BH1A 2ASOA 3O9UA 3HBTA 1MDUB 1S72N 4RTFD 5GAHP 2Q97A 1BUPA 2WBNA 3TU5A 2QW9A 3M6GA 1ZC6A 4PL7A 3N4PA 2EWSA 3SAHA 2E2NA 1NGHA 1NGEA 3UB5A 2HMPA 3ULEA 4H5NA 1BG3A 2A42A 5JLHA 3OW2M 2NRXA 1NWKA 3FZFA 4MDAA 3J8AA 4BGBA 4BQLA 4BECA 3QFPA 2Q31A 3CI5A 2VGNA 2CGLA 1E4FT 1YHQN 4AF1A 1X3NA 1J6ZA 2CGJA 3GDQA 2P9UB 5AQMA 3CCSN 1VQNN 2ASPA 3H6EA 3DJCA 4FWQA 3VPZA 4WFAL 1ZBSA 4H0PA 5AZJA 3LDPA 3O4WA 3VEZA 1BDGA 3OBWA 2CH5A 4HTLA 4WFBL 1K9MO 4NO7A 4JKHA 1JJ2M 3O1WA 4IZ9A 3TSQA 1K73O 2H3GX 1RDUA 3FZHA 3O08A 3EKSA 5AQHA 5C0YA 4C23A 3VEXA 3HOSA 3PIPL 2QWPA 1ESVA 1QQNA 3Q7BA 4YOUA 3LDQA 2GUPA 2IVNA 3IUCA 4OPHA 4CJ7A 3CCMN 5CR4A 4BRDA 3CCVN 3FZLA 5EX5A 5BREA 3CCQN 3WQUA 5DM7L 4IOAL 1VQPN 2P9UA 4WQ4C 3HOTA 1GLLO 4ISGA 3J7ZO 2NLXA 3EL2A 5BN9A 3H3NO 3CHWA 1GLAG 3L6QA 3FGUA 4M7YA 2QWQA 3A5MC 4PHTX 4PL8A 3F2KA 3G6EN 4LC9B 1HLUA 4CZEA 3VEWA 2WFBA 1RFQA 4BRFA 4PKIA 2GEMA 3QBWA 3WQTA 1VQ8N 5DM6L 3CC4N 3JS6A 1MWMA 1K8KB 2HF3A 4MLEA 3UKRB 4BROA 1HX1A 2WC9A 2PAVA 1E4GT 2V52B 5AQYA 4JHDB 3ZETB 2JWKA 4JNEA 3VETA 4BGAA 2HOEA 1K8AO 4MLHA 1JCGA 1EQYA 2Q1NA 5AR0A 3H3OB 4FWMA 3CCEN 4GV3A 1NGAA 3ENBA 3ENOA 1SQKA 3M5RA 1ATSA 1NGJA 3R3LA 4ILGB 3RVCA 4CD3A 5CE3A 4UY8O 2YCHA 1XQSC 1NGDA 2VYPA 3FZKA 3O9SA 2UYTA 5KPTA 1Q81O 1YXQA 2ZJRL 3QDKA 5JLFA 3P38A 4IO9L 3EO3A 1BO5O 3KHYA 5C2FA 1MA9B 4FWKA 1NLVA 4Z94A 4GV9A 3UKRA 1K8KA 1GLFO 4U7BA 3E1YA 3K9JA 1GLDG 2GX9A 4L3QA 2AA4A 4FOIA 4JHDA 3SBTA 1NGCA 5EXWA 4DKWA 1R59O 2E2OA 3ID8A 1Q7YO 1QHAA 1YJNN 3P4IA 2QM1A 2OTJN 1YJ9N 1O13A 1YJWN 5BRDA 4JKEA 2VGMA 4EIAA 4JEPA 4XJXA 3MN9A 4AM7A 1GLBG 3SMPA 4R79A 3U8XA 4CI6A 4BR0A 5AQZA 2Q2RA 4KH4A 3WUHA 5KQDA 3T7ZA 3VTIA 5AQJA 4CZFA 4DHYA 1QZ5A 3P39A 4IJNA 4H0TB 3AGRA 4XH1A 4FWLA 4BR5A 2P9PA 4YOXA 1NGIA 1HKGA 3CF5L 3D2FB 5JVGL 4C1NK 4YOVA 3I55N 3CC2N 3EE8A 3CPWM 2ZGYA 4JK7A 4JKCA 3M1FA 2HBMA 5C15A 2QWRA 3D2EB 3H1VX 3Q7CA 1ZXOA 2HSTA 3LM2A 5AQIA 3CJCA 1G99A 1ATRA 3GOIA 3CJAA 2KLAA 5AFUH 3BUZB 2GWKA 4O5FA 5AQNA 3VF4A 5EOYA 4B1UB 4B9QA 2P9SB 5GADP 4CBWA 3E66A 1QQOA 4BG9A 4B1ZA 2AP1A 4BRMA 4BR2A 2OTLN 3DAWA 3CCUN 3EZWA 4H0XB 4FWOA 1NBWA 4FOEA 3N4QA 4MO4A 2A6AA 1TUYA 4DQ8A 3SAGA 1SAZA 3UE5A 2ASMA 4BVOA 3HZ6A 3CD6N 4KH6A 2QI2A 4CZKA 3CQXA 3TTFA 5AQUA 5BN8A 3ZYYX 3MK6A 3SMSA 4C1NI 3D2FA 3B8AX 4H5RA 1BA0A 4G9ZA 3BF3A 4CZJA 5BPLA 3CXCM 1IG8A 4WQ5C 3D2EA 3KVGA 2YHXA 3CERA 2E2QA 5BPMA 2WUSA 3WXJA 1EO1A 3R1XA 4PKGA 3CMAN 2C1IA 1VQ6N 4XEIA 4BEBA 3R8EA 5GAEP 3L4IA 4JKGB 3MDQA 2P9SA 1YVNA 1VQ5N 4IEEA 4A57A 1VAZA 5BRHA 5AQQA 3P31A 2V51B 3U4LA 3FE1A 1T6CA 1KD1O 3W0LA 3ZEUB 2BTFA 4WCEL 4H0VB 3FR0A 1HJOA 2ITMA 3WXKA 3I8BA 2QWMA 3PLAA 1BOTO 3GL1A 2NZTA 3RSEB 3IMXA 3MWTA 4JKFA 1VQLN 1C0GA 2FLOA 4JKAA 3OHRA 2FSKA 1NGGA 3AY9A 3U9DA 3QBXA 4WQ4A 4EAHD 4BE7B 2NRRA 3E9OA 1N8RO 5AFUA 1VQKN 4QS9A 2F7TA 1Q82O 2DPNA 3O80A 2IIRA 3F5TA 4FWNA 3CMEN 5EY4A 2A5XA 1ATNA 4B1XB 4BC2A 2YHYA 4GV6A 3EE9A 2E1YA 2HBKA 1VQ4N 2J4RA 4CZMA 1U2VB 4BC5A 4JKGA 3VGMA 3CCRN 3IKMA 5ADXA 3C7NB 2IVOA 2NRZA 4WYBA 2IVPA 4IFEA 3DXKB 2GWJA 4EHUA 3ZEUA 2E2PA 4H5WA 4DB3A 5HOOA 2A41A 2ZJPL 2W00A 3RSEA 5C10A 4BR4A 3QB0A 5LJVA 3CPEA 2C1GA 5H1SQ 3VERA 5C2DA 2D1KA 1D4XA 5F1XA 3KWIA 2W40A 4QS7A 4WF9L 3E9LA 3VOVA 5FPDA 5BR9A 4YOYA 1HKBA 1YF5L 3ZX2A 1T3VA 4B1WB 3CJ7A 4KBOA 1YITN 4IEIA 3CQYA 3BEXA 2CH6A 3F9MA 4K41A 3TPQA 2QTDA 1U2VA 4BREA 1KQSM 3S41A 3G4SN 2ZJQL 3O8MA 1P90A 1T44A 3C7NA 4NLCA 5M1QA 3VMFB 5GAGP 3NVMA 4FVUA 3DXKA 5GIOA 4H5TA 1GLJO 3CETA 2FF3B 3ZETA 4RCHA 1NGFA 2QEXN 4BRQA 4KH5A 4M63C 4YOTA 1BWFO 2NRWA 3QFUA 4JD2B 4Y0WA 2YX6A 5AQLA 1CZAN 3C65A 5AQWA 4U67L 4EHTA 3NVKA 4ISEA 2P9KB 3AGKA 4BRCA 1Q86O 3ATUA 2E88A 3G25A 2E8AA 4GY2B 4BRHA 5C12A 1RDWX 5KPRA 2V7ZA 2P9LB 2HF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B1Y B;  2NRH A;  1LOT B;  1KXP A;  1BA1 A;  3GBT A;  2Q36 A;  1WUA A;  2F9W A;  2YI1 A;  4FWS A;  3DWL A;  3FFK B;  3LM9 A;  3H1Q A;  4NB4 A;  4JN4 A;  4I6M B;  4FWP A;  4O8K A;  3VF6 A;  2FSJ A;  1TYQ B;  5AQV A;  1S22 A;  2E1Z A;  3MN6 A;  5E26 A;  3C0B A;  3DXM B;  1QQM A;  3R6M A;  4JD2 A;  1HPM A;  2GTD A;  4CBU A;  4FPB A;  1KAZ A;  3GG4 A;  3WT0 A;  3HI0 A;  2P9K A;  4H03 B;  3AAR A;  4FL9 A;  3LDL A;  4BR9 A;  1DEJ A;  3SK3 A;  2QXL A;  4IO8 A;  1NM1 A;  5ADX H;  4K42 A;  4FWR A;  3IDH A;  3IFR A;  3D7E O;  4K43 A;  4ISF A;  4DCH A;  5ELZ A;  3O6W A;  3BP8 A;  3H46 O;  5JIC A;  1JCE A;  3CJB A;  4I6M A;  2A3Z A;  3L0Q A;  1HUX A;  2W41 A;  3VF2 A;  3MN5 A;  2P9N B;  3ENH A;  4BRG A;  5BRF A;  1TYQ A;  4CZH A;  4WQ5 A;  1BU6 O;  3DXM A;  3GE1 A;  3MCP A;  1YUW A;  4BC3 A;  3R9P A;  3VEN A;  2QWO A;  3LDN A;  3WXI A;  2ZF5 O;  5TKY A;  3HTV A;  1QZ6 A;  4BVP A;  5BPN A;  4J8F A;  3I33 A;  2E20 A;  3W3D A;  5AQS A;  4EFH A;  3SLC A;  1KAX A;  1GLC G;  4AM6 A;  3A5N C;  4BG8 A;  2FF6 A;  3HM8 A;  2ZWH A;  4A2B A;  5F0X A;  3WEE B;  1LCU A;  4FPA A;  1DGK N;  3WXL A;  3BF1 A;  5KQ8 A;  2YHW A;  2P9N A;  4MO5 A;  4QS8 A;  1P8Z A;  5LY3 A;  2PBD A;  1TUU A;  3MMV A;  3O1B A;  4K25 A;  4PKH A;  1YAG A;  5E84 A;  1Y64 A;  1HKC A;  5AZI B;  2CGK A;  2OAN A;  1U6Z A;  5AQR A;  4A61 A;  3CJ1 A;  3VGK A;  2D0P A;  3HSC A;  4BRK A;  3UKU B;  1RGI A;  5JMV A;  1JCF A;  2BUP A;  4BRN A;  2Q0U A;  3QML A;  1MWK A;  2FSN A;  1OKJ A;  4YDU C;  3WEE A;  4YDU A;  2VWB A;  4F9O A;  2D0O A;  4A62 A;  2A40 A;  5F2R A;  3SJH A;  5AQG A;  2YJF A;  1X3M A;  2ZGZ A;  4H5V A;  4CZI A;  2KHO A;  4XH5 A;  3A8Y A;  4XH4 A;  5AZI A;  4IJA A;  3AAP A;  5AQF A;  3CIP A;  2QWN A;  3A5O C;  4BRI A;  1S3X A;  1NGB A;  1X9J A;  1NMD A;  1C0F A;  3LL3 A;  1Z05 A;  1XC3 A;  4FSV A;  3UKU A;  2P9I B;  3A5L C;  3AAQ A;  4CBX A;  1XUP O;  3M3Z A;  4HWI A;  3ZX3 A;  4A2A A;  4M7X A;  1WOQ A;  5AQP A;  2VCP A;  4BQZ A;  5LJW A;  1DKG D;  5B8H A;  3O5B A;  3VGL A;  1GLE G;  3A0I X;  5FPM A;  3VEV A;  1H1V A;  3FZM A;  2P9P B;  2GEL A;  4CZG A;  4BRA A;  2Q0R A;  5AQT A;  4H0O A;  4BRP A;  4JAX A;  3ZX0 A;  1V4S A;  3VES A;  3EKU A;  4IWV A;  5FPN A;  3QIC A;  2D4W A;  3VEO A;  3MN7 A;  3EN9 A;  2QWL A;  3FLC O;  1V4T A;  4RWT A;  3ULE B;  5AQK A;  3VEY A;  4GNI A;  1KAY A;  2I7N A;  2P9I A;  4H0Y B;  5I9E B;  1T6D A;  4BC4 A;  1Q18 A;  4FO0 A;  1SZ2 A;  4BR7 A;  2I7P A;  2FXU A;  2YJE A;  3ATV A;  4B1V A;  5FPE A;  4BRL A;  4IXC A;  5KPZ A;  3KZB A;  3CJ9 A;  3JXU A;  3U9Z A;  2P9L A;  5AQO A;  2F9T A;  4CD1 A;  1Z6R A;  4E1J A;  4CZL A;  2V7Y A;  5EVZ A;  3LDO A;  5AZJ B;  3H45 C;  5AQX A;  1IJJ A;  2ASO A;  3HBT A;  1MDU B;  4RTF D;  2Q97 A;  1BUP A;  3TU5 A;  2QW9 A;  3M6G A;  1ZC6 A;  4PL7 A;  2EWS A;  2E2N A;  1NGH A;  1NGE A;  3UB5 A;  2HMP A;  3ULE A;  4H5N A;  1BG3 A;  2A42 A;  5JLH A;  1NWK A;  3FZF A;  3J8A A;  4BGB A;  4BQL A;  3QFP A;  2Q31 A;  3CI5 A;  2CGL A;  1E4F T;  1X3N A;  1J6Z A;  2CGJ A;  3GDQ A;  2P9U B;  5AQM A;  2ASP A;  3H6E A;  3DJC A;  4FWQ A;  3VPZ A;  1ZBS A;  4H0P A;  5AZJ A;  3LDP A;  3O4W A;  3VEZ A;  1BDG A;  2CH5 A;  4HTL A;  4NO7 A;  3O1W A;  4IZ9 A;  2H3G X;  3FZH A;  3O08 A;  3EKS A;  5AQH A;  4C23 A;  3VEX A;  2QWP A;  1ESV A;  1QQN A;  3LDQ A;  2GUP A;  2IVN A;  3IUC A;  4CJ7 A;  4BRD A;  3FZL A;  5EX5 A;  5BRE A;  3WQU A;  2P9U A;  4WQ4 C;  1GLL O;  4ISG A;  2NLX A;  3EL2 A;  5BN9 A;  3H3N O;  3CHW A;  1GLA G;  3L6Q A;  3FGU A;  4M7Y A;  2QWQ A;  3A5M C;  4PL8 A;  4LC9 B;  1HLU A;  4CZE A;  3VEW A;  1RFQ A;  4BRF A;  4PKI A;  2GEM A;  3QBW A;  3WQT A;  3JS6 A;  1MWM A;  1K8K B;  2HF3 A;  4MLE A;  3UKR B;  4BRO A;  1HX1 A;  2PAV A;  1E4G T;  2V52 B;  5AQY A;  4JHD B;  3ZET B;  3VET A;  4JNE A;  4BGA A;  2HOE A;  4MLH A;  1JCG A;  1EQY A;  2Q1N A;  5AR0 A;  3H3O B;  4FWM A;  1NGA A;  3ENO A;  1SQK A;  1ATS A;  1NGJ A;  5CE3 A;  4CD3 A;  2YCH A;  1XQS C;  1NGD A;  3FZK A;  2VYP A;  5KPT A;  2UYT A;  1YXQ A;  3QDK A;  5JLF A;  3EO3 A;  1BO5 O;  3KHY A;  1MA9 B;  4FWK A;  1NLV A;  4Z94 A;  3UKR A;  1K8K A;  1GLF O;  1GLD G;  4L3Q A;  2AA4 A;  4FOI A;  4JHD A;  1NGC A;  5EXW A;  1R59 O;  2E2O A;  3ID8 A;  1QHA A;  3P4I A;  2QM1 A;  5BRD A;  4EIA A;  3MN9 A;  4AM7 A;  1GLB G;  3SMP A;  3U8X A;  4CI6 A;  4BR0 A;  5AQZ A;  2Q2R A;  3WUH A;  5KQD A;  5AQJ A;  4CZF A;  4DHY A;  1QZ5 A;  4IJN A;  4H0T B;  4BR5 A;  4XH1 A;  4FWL A;  2P9P A;  1NGI A;  1HKG A;  3D2F B;  2ZGY A;  3M1F A;  2QWR A;  3D2E B;  3H1V X;  1ZXO A;  3LM2 A;  5AQI A;  3CJC A;  1G99 A;  1ATR A;  3GOI A;  3CJA A;  5AFU H;  3BUZ B;  2GWK A;  4O5F A;  5AQN A;  3VF4 A;  5EOY A;  4B1U B;  4B9Q A;  2P9S B;  4CBW A;  1QQO A;  4BG9 A;  4B1Z A;  2AP1 A;  4BRM A;  4BR2 A;  3DAW A;  3EZW A;  4H0X B;  4FWO A;  1NBW A;  4FOE A;  4MO4 A;  2A6A A;  1TUY A;  4DQ8 A;  1SAZ A;  3UE5 A;  2ASM A;  4BVO A;  3HZ6 A;  4CZK A;  3CQX A;  5AQU A;  5BN8 A;  3MK6 A;  3SMS A;  3D2F A;  3B8A X;  4H5R A;  1BA0 A;  3BF3 A;  4CZJ A;  5BPL A;  1IG8 A;  4WQ5 C;  3D2E A;  3KVG A;  2YHX A;  3CER A;  2E2Q A;  5BPM A;  2WUS A;  3WXJ A;  4PKG A;  4XEI A;  3R8E A;  3L4I A;  3MDQ A;  2P9S A;  1YVN A;  5BRH A;  5AQQ A;  2V51 B;  3U4L A;  3FE1 A;  1T6C A;  3W0L A;  3ZEU B;  2BTF A;  4H0V B;  3FR0 A;  1HJO A;  2ITM A;  3WXK A;  3I8B A;  2QWM A;  1BOT O;  3GL1 A;  2NZT A;  3RSE B;  3IMX A;  1C0G A;  2FLO A;  3U9D A;  3OHR A;  2FSK A;  1NGG A;  3AY9 A;  3QBX A;  4WQ4 A;  4EAH D;  5AFU A;  4QS9 A;  2DPN A;  3O80 A;  2IIR A;  4FWN A;  5EY4 A;  2A5X A;  1ATN A;  4B1X B;  4BC2 A;  2YHY A;  2E1Y A;  2J4R A;  4CZM A;  1U2V B;  4BC5 A;  3VGM A;  5ADX A;  3C7N B;  2IVO A;  4WYB A;  2IVP A;  3DXK B;  2GWJ A;  4EHU A;  3ZEU A;  2E2P A;  4H5W A;  4DB3 A;  2A41 A;  3RSE A;  4BR4 A;  3QB0 A;  5LJV A;  3VER A;  2D1K A;  1D4X A;  5F1X A;  2W40 A;  4QS7 A;  3VOV A;  5FPD A;  5BR9 A;  1HKB A;  4B1W B;  3ZX2 A;  3CJ7 A;  4KBO A;  3CQY A;  3BEX A;  2CH6 A;  3F9M A;  4K41 A;  3TPQ A;  1U2V A;  4BRE A;  3S41 A;  3O8M A;  1T44 A;  3C7N A;  3DXK A;  4H5T A;  1GLJ O;  3CET A;  2FF3 B;  3ZET A;  4RCH A;  1NGF A;  4BRQ A;  4M63 C;  1BWF O;  3QFU A;  4Y0W A;  4JD2 B;  5AQW A;  5AQL A;  1CZA N;  4EHT A;  4ISE A;  2P9K B;  4BRC A;  3ATU A;  2E88 A;  3G25 A;  2E8A A;  4GY2 B;  4BRH A;  1RDW X;  5KPR A;  2V7Z A;  2P9L B;  2HF4 A; 
#chains in the Genus database with same CATH topology
 3NCI A;  1HR0 K;  1SKW A;  4E89 A;  2RN2 A;  1NK7 A;  3OYH A;  1WUA A;  4FWS A;  1KFS A;  2DFH A;  3DWL A;  3LWL A;  4JI6 K;  4NB4 A;  5JS1 A;  5EU7 A;  3T1H K;  4KHQ A;  3MCA B;  4DUZ K;  1JLB A;  1GOC A;  3MN6 A;  5E26 A;  5CZ1 A;  3DXM B;  1I39 A;  1QQM A;  3R6M A;  4JK9 A;  4M41 A;  3LP3 A;  4CBU A;  1D5A A;  4YOR A;  2P9K A;  3AAR A;  4ILJ A;  4O4G A;  3LDL A;  2QXL A;  4IO8 A;  4CHY A;  5ADX H;  3IDH A;  3IFR A;  4DUY K;  2QKB A;  3ISN C;  4QCL A;  1N34 K;  3VN5 A;  1ASU A;  3TAN A;  3H46 O;  4NCG A;  1JCE A;  1TKT A;  1VSE A;  4I2Q A;  2DFF A;  4ZHR A;  5BRF A;  1WNS A;  2P9N B;  4BRG A;  5D3G A;  5GIP A;  3AVF A;  4ILH A;  1BU6 O;  2FC0 A;  3NGY A;  3DLL L;  3VEN A;  3QES A;  4OKE A;  5FLX O;  3TSP A;  4BVP A;  2VWJ A;  3MX2 A;  3A5N C;  4BG8 A;  4Y1C A;  3AA5 X;  4A2B A;  4G1Q A;  5F0X A;  4WFN L;  1HQE A;  3O3F A;  4FPA A;  5KQ8 A;  2DY4 A;  4FJG A;  1M1K O;  4MO5 A;  4FZZ A;  1EWR A;  4IFV A;  3WXM B;  1N33 K;  1KCF A;  1L3S A;  1QQC A;  1WLJ A;  3HPH A;  4CJK A;  1U6Z A;  3CCL N;  4GVE A;  3K9K A;  4I2P A;  3D45 A;  3HSC A;  4BRK A;  4LH5 A;  4NLB A;  1S1V A;  4JI4 K;  2HHW A;  2Q0U A;  1OKJ A;  2ZD1 A;  1FKP A;  3SJJ A;  4YDU A;  3DOK A;  4B3T K;  5JVH L;  2D0O A;  3L2U A;  1OVY A;  3A2F A;  5HLF A;  1RCH A;  4PUO A;  5AZI A;  3AAP A;  3CIP A;  1S3X A;  1X9J A;  4W5N A;  1NK9 A;  3K57 A;  3V9W A;  3A5L C;  3AAQ A;  4IKF A;  3KK3 A;  4A2A A;  4C8K A;  3NMU A;  1W7A A;  5AQP A;  2QA4 N;  1DKG D;  5B8H A;  3VGL A;  1GLE G;  3A0I X;  4DSF A;  1QSL A;  1HMV A;  5E41 A;  3OYG A;  2QK9 A;  4CJ5 A;  3VEV A;  1H1V A;  1HJR A;  4DV0 K;  3DLK A;  3AVH A;  1NU0 A;  4OJR A;  3PX6 A;  4JAX A;  3ZX0 A;  5FPN A;  4BDP A;  3QIC A;  4CHZ A;  3MN7 A;  1VQ9 N;  3AVI A;  3EN9 A;  3ULE B;  1HNZ K;  1RDB A;  5I9E B;  2HBJ A;  4BR7 A;  1Q18 A;  4FO0 A;  1XHZ A;  4JKB A;  3MEE A;  4BRL A;  5KPZ A;  3JXU A;  3U9Z A;  1GOA A;  2P9L A;  4DFM A;  4AIL C;  1BCM A;  1OH7 A;  4B3M K;  1Z6R A;  1WAJ A;  4B3S K;  1LWE A;  2V7Y A;  5AJ3 K;  2F8S A;  2UXB K;  5AZJ B;  1YI2 N;  1IJJ A;  4Q5V A;  4C8N A;  3SQ0 A;  3S3N A;  2ASO A;  4B8C A;  1MDU B;  1BUP A;  3TU5 A;  2NUB A;  3N4P A;  1VSK A;  1NGH A;  1NGE A;  1RT5 A;  2HMP A;  2A42 A;  4W5Q A;  4BQL A;  4BEC A;  3T1A A;  5JEN A;  3QFP A;  4XIU A;  1X9M A;  1KLN A;  4CW7 B;  4AF1 A;  1J6Z A;  1S1X A;  4CCH A;  3DLG A;  3CCS N;  1VQN N;  4FWQ A;  1S1W A;  4H0P A;  1BIS A;  1KRP A;  3O4W A;  3TR8 A;  3VEZ A;  2HB5 A;  4YY3 K;  3TWH A;  4HTL A;  4NO7 A;  1JJ2 M;  4IZ9 A;  2H3G X;  2KQ2 A;  4O55 A;  4OLA A;  4C23 A;  3THY A;  3PIP L;  3OYL A;  3H08 A;  1NOZ A;  4YOU A;  2GUP A;  1XHX A;  2D0B A;  4CGH A;  4IOA L;  3MAQ A;  2P9U A;  4WQ4 C;  3HOT A;  1GLL O;  4GMJ B;  3J7Z O;  2P5G A;  4GKJ K;  2UXD K;  1GLA G;  3K0S A;  2QWQ A;  4PL8 A;  1RIL A;  1WSF A;  3V4I A;  1HYZ A;  4CEE A;  3QBW A;  3WQT A;  1VQ8 N;  1KSP A;  3UKR B;  4MLE A;  1E4G T;  1YTA A;  1WB9 A;  4FJ5 A;  3OYJ A;  2JWK A;  1DLO A;  1TL1 A;  2HOE A;  1EQY A;  3RRH A;  4IFY A;  1TKZ A;  4FWM A;  4GV3 A;  1DTT A;  1JLC A;  3M5R A;  1ATS A;  3R3L A;  5CE3 A;  1KFD A;  4UY8 O;  5KPT A;  3AO1 A;  1RT3 A;  1YXQ A;  4CJQ A;  1OH8 A;  3EO3 A;  4CEQ A;  1RDC A;  1NLV A;  3DYA A;  4KFB A;  2BDP A;  4U7B A;  3E1Y A;  4JS5 A;  3C6U A;  3NH1 A;  4NXM K;  3ZSW A;  2GX9 A;  4JHD A;  4FOI A;  1YVU A;  1NGC A;  1W0H A;  1YJN N;  2G8U A;  2QM1 A;  2OTJ N;  1O13 A;  3HM9 A;  3KD5 E;  4JKE A;  2VGM A;  2AJQ A;  3OYE A;  1UA1 A;  4JEP A;  1KVC A;  1GLB G;  3SMP A;  4BR0 A;  3WUH A;  3T7Z A;  4DHY A;  1QZ5 A;  3P39 A;  4IJN A;  3V9S A;  1D9D A;  5CYQ A;  2P9P A;  4DU3 A;  1NGI A;  1HKG A;  1SL2 A;  3DLR A;  4CEC A;  4CK1 A;  4CJ4 A;  2HST A;  4DG1 A;  3CJC A;  1G99 A;  3GOI A;  1Z26 A;  3AVC A;  2GWK A;  4B9Q A;  2A1S A;  2OTL N;  4BRM A;  5LL6 Z;  1SKR A;  4FWO A;  1NBW A;  4HVJ A;  4MO4 A;  5CYM A;  2D0A A;  1TK5 A;  3WNH A;  2BAN A;  1IKY A;  4DF4 A;  3SV4 A;  2HHQ A;  1RBR A;  4CZK A;  3CQX A;  2YKM A;  2UUC K;  4CGJ A;  3MED A;  4GVM A;  3HVT A;  1SKS A;  3CYG A;  5A2Q O;  3HPO A;  4WQ5 C;  3D2E A;  2YHX A;  5BPM A;  1EO1 A;  4BEB A;  3L4I A;  3MDQ A;  1NK5 A;  4KTZ A;  1HJO A;  2XY7 A;  1HYV A;  3PLA A;  4OGE A;  2YNH A;  5HRS A;  4JI8 K;  3OHR A;  3AY9 A;  3NFA A;  3QBX A;  2GUI A;  2BGG A;  1NJY A;  3HST B;  1N8R O;  1Q82 O;  1CZ9 A;  4DV1 K;  4DTU A;  4FWN A;  2O8F B;  2HNZ A;  2HHT A;  1ATN A;  4B1X B;  3K58 A;  3SV3 A;  2HBK A;  4FLU A;  4E7I A;  1U2V B;  3T19 A;  4JKG A;  3VGM A;  3PX4 A;  1HQU A;  5ADX A;  4DSK A;  1S6P A;  3IRX A;  3C7N B;  4FLT A;  3VA0 A;  3DXK B;  3BZC A;  4H5W A;  3BDP A;  2A41 A;  3LDS A;  4KRF A;  4LF9 K;  3VQD A;  2C1G A;  5H1S Q;  4E19 A;  4J2D A;  2W40 A;  1LAV A;  4WF9 L;  3E9L A;  5FPD A;  3PY8 A;  1T3V A;  1ASV A;  3CJ7 A;  4N56 A;  4IEI A;  4WE1 A;  3BEX A;  2CH6 A;  2P51 A;  3TPQ A;  4CJV A;  4N41 A;  3CET A;  4ID5 A;  2OZM A;  2FBT A;  1NGF A;  4RCH A;  4BRQ A;  4KRE A;  4M63 C;  2NRW A;  4FJ7 A;  3NVK A;  4FCY A;  4ISE A;  2UU9 K;  4DR7 K;  4GY2 B;  4BRH A;  1RDW X;  2V7Z A;  4MDB A;  3BGR A;  3KKR A;  3ZT0 A;  3SPY A;  5M1O A;  2NNW A;  4O0I A;  1LOT B;  5HRO A;  4KPY A;  4H4M A;  3GBT A;  4YFU A;  3SAF A;  2YI1 A;  1RBU A;  4I6M B;  4E7K A;  2KW4 A;  4O8K A;  2RF2 A;  3M8Q A;  1S22 A;  2E1Z A;  1ZYQ A;  1SUQ A;  4JD2 A;  1HPM A;  4CE9 A;  1KAZ A;  1W97 L;  1G15 A;  3DMJ A;  4RW7 A;  4FLX A;  3VQ8 A;  2OPQ A;  2XY8 A;  3T69 A;  1DEJ A;  2VQF K;  4BWM A;  4DV3 K;  4IOX A;  3TAR A;  2HMI A;  4V19 S;  4M3Y A;  4HCC A;  1NJI O;  4PQU A;  4MQ3 A;  4OKK A;  1XI1 A;  4GKK K;  3OYC A;  3MEC A;  3PSI A;  1DT9 A;  2W41 A;  4N47 A;  1ZBI A;  3VF2 A;  3MN5 A;  1FJG K;  4KB0 A;  3DXM A;  3E9P A;  3AVL A;  1RT6 A;  3M8P A;  3R9P A;  4IG3 A;  3WXI A;  1S6Q A;  1VSF A;  1VRT A;  5M1K A;  4W5O A;  5BPN A;  4J8F A;  4X65 K;  3I33 A;  2E20 A;  3W3D A;  5AQS A;  3SLC A;  4C8M A;  5HL7 L;  4K0K K;  4DV7 K;  1DTQ A;  4JI3 K;  3DRR A;  2UUB K;  2ATQ A;  4X66 K;  2YHW A;  2P9N A;  4KI4 A;  3TAF A;  3PO5 A;  3OS0 A;  4R5P A;  3MMV A;  4K25 A;  3KLH A;  2DTU A;  1YAG A;  4CHO A;  5E84 A;  1VSD A;  4FM2 A;  4OPA A;  4PWD A;  3NF9 A;  3HRG A;  3VQP A;  4A61 A;  1RBV A;  3B6P A;  3WNG A;  4DFJ A;  4NXN K;  1HYS A;  3SNN A;  1SS6 A;  4O8U A;  1RGI A;  5TKW A;  1JCF A;  4ELU A;  5KGX A;  4YOW A;  3OBY A;  1VRU A;  2FSN A;  2F4V K;  3I56 N;  4CEB A;  1HNX K;  4CGF A;  4JKD A;  4AQY K;  2G8V A;  3SUO A;  4IG0 A;  3DRP A;  3SUP A;  1VQM N;  4DS4 A;  4KHU A;  1B92 A;  4I7F A;  4Z0U A;  3VQA A;  4BY9 C;  2YJF A;  4CZI A;  2KHO A;  3CQ8 A;  3A8Y A;  4IJA A;  4HUE A;  4BRI A;  3LL3 A;  1XC3 A;  3OYM A;  2O8E B;  2P9I B;  5JS2 A;  4CBX A;  2O8D B;  4DTN A;  2NRT A;  1UAX A;  3ZX3 A;  3OYI A;  1YT3 A;  1NMN A;  3O5B A;  3KK2 A;  1IV0 A;  3TAM A;  4E3S A;  3FZM A;  2WOM A;  1NKC A;  4OO1 J;  2HBL A;  2GEL A;  3DRS A;  4H0O A;  4BRP A;  3SZ2 A;  1FK9 A;  4KKO A;  4W5T A;  1QS4 A;  1VQO N;  2D4W A;  3VEO A;  5AQK A;  1O1W A;  3VEY A;  4GNI A;  1RTJ A;  1C0T A;  4CHN A;  1KAY A;  4H0Y B;  3LWM A;  4FZX C;  4A5B A;  1T6D A;  3AVB A;  4BC4 A;  1KTQ A;  4B1V A;  2YJE A;  5FPE A;  2XY6 A;  3KZB A;  3L2W A;  1QVF M;  3LAM A;  5J1E A;  4B9M A;  4DU4 A;  1ILY A;  1VSH A;  5EVZ A;  5AQX A;  4CJP A;  3VQ6 A;  4RW6 A;  3OJS A;  3HBT A;  1IBL K;  4RTF D;  5GAH P;  1NNE A;  4CJU A;  3QEV A;  4M45 A;  1ZC6 A;  1U47 A;  1BIZ A;  4DTJ A;  1RTH A;  3UB5 A;  3ULE A;  1WBD A;  1WSE A;  3OW2 M;  2NRX A;  4FZY A;  3FZF A;  4MDA A;  3AVG A;  4BGB A;  4CHP A;  1ZBU A;  4H4O A;  4DR5 K;  1X3N A;  4M3T A;  3AVN A;  5AQM A;  4JI0 K;  3QIP A;  3H6E A;  4DWI A;  5AZJ A;  3L3V A;  3LDP A;  3QER A;  4FLW A;  4LSN A;  2ZQB A;  4CF8 A;  1K73 O;  4ELT A;  1RDU A;  3EKS A;  3THV A;  4DTO A;  1QQN A;  3Q7B A;  3CFR A;  3KD1 E;  4EP4 A;  3IUC A;  3CCM N;  3CCV N;  4DU1 A;  4BRD A;  1WSI A;  4CF2 A;  3FZL A;  3O4Q A;  5EX5 A;  3QEP A;  3K2P A;  3HO1 A;  1GOB A;  4I9Q A;  4K8X A;  4LF6 K;  1JKH A;  3SQ4 A;  2PYJ A;  3ZT4 A;  3NH0 A;  1VSI A;  2JGU A;  3A5M C;  3V6D A;  2IAJ A;  1HLU A;  2FBY A;  3G10 A;  4PKI A;  4EZ9 A;  4FXD A;  1TKX A;  1K8K B;  2HF3 A;  4CIE A;  2PAV A;  5BR8 K;  4B9L A;  3ZET B;  4DSE A;  4JNE A;  3P1G A;  4CFA A;  1K8A O;  4MLH A;  5DMR A;  4B8A B;  1QHT A;  2UUA K;  2OZS A;  3H3O B;  3L2V A;  3CCE N;  4KTW A;  1NOY A;  3ENB A;  1NGJ A;  4CD3 A;  4FJ9 A;  3RRG A;  2VYP A;  3VQ4 A;  1NGD A;  2YCH A;  1T8E A;  4FK2 A;  3PX0 A;  3QDK A;  4IO9 L;  3THX B;  3KHY A;  5C2F A;  4Z94 A;  3ZSO A;  3S3O A;  3UKR A;  4W5R A;  3OY9 A;  1TAQ A;  1IBK K;  1GLD G;  2ETJ A;  2AA4 A;  3SBT A;  3K5O A;  4BAC A;  3K5M A;  1RDD A;  2D0C A;  4E0D A;  4DKW A;  3RTV A;  4FJX A;  5HP1 A;  1Z25 A;  5K14 A;  3P4I A;  3KLE A;  3LZJ A;  1B9F A;  3ALY A;  1TL3 A;  4FLV A;  4DFP A;  2FBX A;  1EXQ A;  4O44 A;  1IO2 A;  3SCX A;  5CY4 A;  2IOC A;  1RT2 A;  3VTI A;  5AQJ A;  4CZF A;  3BZK A;  4BR5 A;  3D2F B;  5JVG L;  3I55 N;  4YOV A;  4CF9 A;  3EE8 A;  4JK7 A;  4JKC A;  3M1F A;  2HBM A;  2G8H A;  1XNR K;  2HVI A;  5AQI A;  3BUZ B;  4O5F A;  5AQN A;  4B1U B;  1C1B A;  2QXF A;  3E66 A;  1QQO A;  3ZCM A;  4JS4 A;  4HUF A;  1NG9 A;  1Q9Y A;  4K8Z A;  4N5S A;  4FJ8 A;  3DAW A;  1S9E A;  3EZW A;  3S5T A;  4FOE A;  3V9U A;  3UE5 A;  3M8R A;  3CD6 N;  4IBN A;  3HZ6 A;  4KH6 A;  1CLQ A;  3TTF A;  4BE2 A;  5AQU A;  5BN8 A;  3ZYY X;  1VHX A;  4OVL A;  5BPL A;  3CER A;  1TK0 A;  3R1X A;  4PKG A;  1C1C A;  2C1I A;  1L3U A;  4LY7 A;  3PV8 A;  1YVN A;  2X6S A;  4A57 A;  5BRH A;  4ZTF A;  4LF8 K;  3WXK A;  1ZBF A;  3RSE B;  3IMX A;  4JKA A;  2XHB A;  5KI6 A;  4CF0 A;  4DR3 K;  3QO9 A;  4CJE A;  3E9O A;  5AFU A;  4QS9 A;  2F7T A;  4CGG A;  3AVA A;  2Q3S A;  3CME N;  4Z4G A;  2A5X A;  3I0S A;  1A5V A;  4GV6 A;  3CG7 A;  2E1Y A;  3LAK A;  2J4R A;  4CZM A;  4CK3 A;  4BC5 A;  3VQ7 A;  3IKM A;  4CJW A;  2IVO A;  2NRZ A;  4IFE A;  3NF7 A;  2GWJ A;  5HOO A;  3SUQ A;  2ZJP L;  2P5O A;  3IG1 A;  4BR4 A;  1L3T A;  3QB0 A;  2Y1I A;  3J81 O;  5IT9 O;  4FM0 A;  2HNY A;  5FDL A;  1JLE A;  3RMD A;  3OJU A;  2O8F A;  2XO7 A;  5BR9 A;  3ZX2 A;  4KBO A;  4BWJ A;  5T7B A;  1U2V A;  4DR2 K;  1IBM K;  4DSI A;  1D8Y A;  1P90 A;  3C7N A;  4NLC A;  4FVU A;  4DS5 A;  3DXK A;  3KK1 A;  4F8R A;  1GLJ O;  2FF3 B;  3SUN A;  2QEX N;  4O0J A;  4YOT A;  1BWF O;  5AQW A;  4U67 L;  1U45 A;  2YX6 A;  5AQL A;  3C65 A;  3AVM A;  3NF8 A;  1LWF A;  3C94 A;  3VA3 A;  2RKI A;  1WSH A;  2P9L B;  3I0R A;  4CJR A;  4Z4I A;  3HPG A;  4B1Y B;  3WNE A;  5J2Q A;  2X78 A;  2RHK A;  1BA1 A;  3TSU A;  2Q36 A;  3VTH A;  4AHV A;  2F9W A;  4DSL A;  5KRS A;  3H1Q A;  2HHU A;  1TAU A;  4FW1 A;  4JN4 A;  4FWP A;  3VF6 A;  2KZM A;  1IH7 A;  1M90 O;  1TYQ B;  1C6V A;  5LMN K;  3WT0 A;  4BE0 A;  3HI0 A;  4J2A A;  3ZLJ A;  4TSX A;  5M1P A;  4FL9 A;  3THW B;  4BR9 A;  1J5O A;  1NM1 A;  2KZZ A;  4FWR A;  3V9Z A;  5C42 A;  3CCJ N;  4E1M A;  3D7E O;  1U4B A;  2HHI A;  4CGI A;  3O6W A;  4F2R A;  1QVG M;  1XNQ K;  5JIC A;  1QE1 A;  4I6M A;  3L0Q A;  1HUX A;  3SI6 A;  4OPJ A;  3QEW A;  2PYL A;  3NAE A;  1NK0 A;  4CZH A;  3THY B;  3ZT3 A;  5KRT A;  1T05 A;  3MCP A;  3MXM A;  2QWO A;  3LDN A;  2ZF5 O;  4PA1 A;  5TKY A;  4HHT A;  1QZ6 A;  3ZSR A;  4EFH A;  1KAX A;  1GLC G;  3PUF A;  3QNN A;  4CEZ A;  3LP0 A;  2FF6 A;  5HRP A;  2ZWH A;  4KHW A;  3WEE B;  1LCU A;  2E6M A;  1C1A A;  3BF1 A;  4X64 K;  3HK2 A;  3SBG A;  3PIO L;  3C6A A;  1JLG A;  1P8Z A;  1B9D A;  2RE2 A;  4JK8 A;  2R7Y A;  1Y64 A;  4DV2 K;  1HKC A;  4F3T A;  2CGK A;  4LF7 K;  5CHI A;  5AQR A;  4JRQ A;  2Z1J A;  4M3W A;  3VGK A;  4CJF A;  2YKN A;  3UKU B;  2YNG A;  1NK4 A;  5JMV A;  2BUP A;  4BRN A;  2E5L K;  1MWK A;  3VQE A;  3C6H A;  2W6K A;  2VWB A;  3T3F A;  4F9O A;  2B5J A;  5GIN A;  4F2S A;  1FKO A;  3EY1 A;  4A62 A;  2A40 A;  1L3V A;  2VG5 A;  1QSS A;  5AQG A;  4JI1 K;  1TKD A;  3G71 N;  4H5V A;  1JL1 A;  2VQE K;  3OYB A;  2VWK A;  1RT4 A;  4FJJ A;  1NGB A;  3SQ2 A;  4RW4 A;  4CJL A;  4Z4H A;  2KFN A;  2KKZ A;  2OPR A;  4J2E A;  2FBV A;  4AHT A;  1XUP O;  3I8D A;  4M7X A;  1RTI A;  2VCP A;  3MEG A;  3K59 A;  4CFB A;  4FJN A;  3CFO A;  2P9P B;  2W6L A;  5HBM A;  4BRA A;  2Q0R A;  4FK0 A;  3IAY A;  3J80 O;  1V4S A;  2QWL A;  1V4T A;  2EHG A;  2O8E A;  1S9G A;  1RDA A;  2P9I A;  4IOC L;  2O8D A;  1F21 A;  1SZ2 A;  3KLG A;  4X62 K;  2O8C B;  4IXC A;  3V1R A;  4Q0B A;  4KB1 A;  3CJ9 A;  1LAW A;  4CES A;  2F9T A;  4DLG A;  3D0P A;  4CZL A;  3LDO A;  3JYT A;  4KHY A;  3H45 C;  1K6Y A;  1U48 A;  2XY5 A;  2BH1 A;  4FYD A;  3O9U A;  3DOL A;  1EWQ A;  1S72 N;  3CM5 A;  4B9S A;  4KAZ A;  2WBN A;  1J54 A;  4PL7 A;  3AA3 A;  4FLZ A;  4B3R K;  3SAH A;  3HP9 A;  4CED A;  3VQ5 A;  1S1T A;  4H5N A;  2QKK A;  3J7Y P;  4FM1 A;  1X9W A;  1NWK A;  3J8A A;  1N32 K;  1JL2 A;  2VGN A;  4KTQ A;  2O4I A;  1YHQ N;  2CGJ A;  2ASP A;  2A1R A;  3E01 A;  3DJC A;  3OVN A;  3VPZ A;  1ZBS A;  1BI4 B;  3VQ9 A;  4FLY A;  5FRM A;  2HHS A;  3OBW A;  3CM6 A;  3P83 D;  2CH5 A;  1K9M O;  4JKH A;  3O1W A;  3TSQ A;  3O08 A;  1WN7 A;  4DLE A;  5C0Y A;  4CEA A;  3OTO K;  2QWP A;  1ESV A;  3HXM A;  3TAG A;  2IVN A;  1SL0 A;  4CJ7 A;  3L2R A;  3NH2 A;  1ITG A;  4CK2 A;  5BRE A;  3WQU A;  5DM7 L;  4FJL A;  2O8B B;  1VQP N;  4LFC K;  2G8W A;  3O4N A;  3MXI A;  4M3X A;  3NBP A;  2G8K A;  3L6Q A;  1TV6 A;  4RW8 A;  5KTQ A;  4M7Y A;  2G8F A;  1ASW A;  4LC9 B;  2WFB A;  4M3U A;  2B6A A;  4BRF A;  2GEM A;  1XMQ K;  3V1O A;  5DM6 L;  3CC4 N;  3V81 A;  4BRO A;  1HX1 A;  3VET A;  4BGA A;  4DQP A;  1VK0 A;  1TVR A;  2Q1N A;  3ZSQ A;  4FJK A;  3ENO A;  4ILG B;  3AA2 A;  3AA4 A;  3VQQ A;  3EYZ A;  3FFI A;  3FZK A;  2I5J A;  4AH9 A;  2ZJR L;  2HVH A;  5JLF A;  3P38 A;  1BO5 O;  3OYK A;  3KJV A;  4AHR A;  1K8K A;  1VSL A;  1IKV A;  1XC9 A;  4L3Q A;  3LAL A;  4DF8 A;  5EXW A;  3PO4 A;  1BL3 A;  3J7A P;  4HTU A;  4LD0 A;  1QHA A;  4NCB A;  1J5E K;  4CHQ A;  1YJ9 N;  4LF5 K;  5BRD A;  3QIN A;  4EIA A;  3TI0 A;  1VSM A;  3MN9 A;  4AM7 A;  3DI6 A;  4CI6 A;  5AQZ A;  2Q2R A;  2PZS A;  4CEO A;  3THX A;  2P1J A;  1J53 A;  3AGR A;  4XH1 A;  3O3H A;  4YOX A;  4B9T A;  4FJI A;  4C1N K;  3CC2 N;  3QET A;  2QWR A;  3H1V X;  3Q7C A;  1ZXO A;  3LM2 A;  1ATR A;  2YNF A;  3LZI A;  2KLA A;  4EP5 A;  1UWB A;  5EOY A;  5GAD P;  2P9S B;  4BR2 A;  4B1Z A;  2X6N A;  4JLH A;  2Z1G A;  4H0X B;  1X9S A;  4CJS A;  3SQ1 A;  1EX4 A;  2A6A A;  4E1N A;  4DQ8 A;  2ASM A;  4BVO A;  4CFC A;  1KVA A;  3PSF A;  3UIQ A;  3SMS A;  4C1N I;  3D2F A;  3B8A X;  1IKW A;  5J2P A;  4H5R A;  1BA0 A;  4OGC A;  3BF3 A;  4CZJ A;  3CXC M;  1IG8 A;  2Z1H A;  3SYZ A;  2YV0 X;  4BE1 A;  2JLE A;  2WUS A;  3WXJ A;  3CMA N;  1VQ6 N;  4RW9 A;  4XEI A;  3R8E A;  5GAE P;  4DSJ A;  1VAZ A;  3QEI A;  5AQQ A;  1FW6 A;  3U4L A;  3FE1 A;  3NGZ A;  5J2N A;  3JAM O;  3ZEU B;  1JLQ A;  2BTF A;  4WCE L;  5J2M A;  3DLH A;  4JI5 K;  2QWM A;  3AO4 A;  1BOT O;  3GL1 A;  3MWT A;  1C0G A;  4KO0 A;  2E4L A;  1NGG A;  2FSK A;  4WQ4 A;  4BE7 B;  1Q9X A;  2NRR A;  1VQK N;  4GW6 A;  3O80 A;  2IIR A;  3F5T A;  1RT1 A;  1D9F A;  3ZT2 A;  4BC2 A;  2YHY A;  1JXB A;  3EE9 A;  3AO2 A;  1VQ4 N;  4DMN A;  1JLA A;  4DQI A;  3ITH A;  3NGI A;  1A5X A;  4WYB A;  4EHU A;  4DB3 A;  3OYA A;  1R0A A;  3HT3 A;  2HHX A;  1QSY A;  3QEX A;  4C8L A;  2W00 A;  3RSE A;  1MU2 A;  3OYF A;  5C10 A;  4DFK A;  4H8K A;  4CIG A;  5FRN A;  3VER A;  5C2D A;  2D1K A;  1D4X A;  5F1X A;  2RPI A;  1I3A A;  3IS9 A;  1HKB A;  4B1W B;  4KHN A;  4ZTJ A;  3L8B A;  3F9M A;  4K41 A;  2QTD A;  4BRE A;  4YHH K;  4LF4 K;  1HNW K;  3S41 A;  3O8M A;  1T44 A;  4F4K A;  3VMF B;  3ZSY A;  3NVM A;  5GAG P;  1E3M A;  4KH5 A;  4FJH A;  2WON A;  3NHG A;  4Y0W A;  3QFU A;  1VSJ A;  3HP6 A;  1CZA N;  4EHT A;  2P9K B;  3CYM A;  1Q86 O;  3ATU A;  2E88 A;  4CIF A;  3DLB A;  4YNQ A;  2ZJQ L;  2HF4 A;  2NRH A;  1X1P A;  1KXP A;  4PY5 A;  3KLF A;  3OYD A;  2WTU A;  2VG6 A;  3FFK B;  3ZSX A;  3LM9 A;  4OLB A;  4IDK A;  4M3R A;  4Z4F A;  3ULD A;  3DM2 A;  2ITG A;  4ELV A;  1SV5 A;  2FSJ A;  2IC3 A;  5AQV A;  3C0B A;  4DTS A;  1S5J A;  2GTD A;  4B9U A;  4FPB A;  3GG4 A;  1NJW A;  3L3U A;  4H03 B;  2EX3 A;  1BQN A;  4ICL A;  3SK3 A;  3QNO A;  4NCA A;  2JWL A;  3KK7 A;  4K42 A;  3G0Z A;  1NKE A;  4B9V A;  4K43 A;  4ISF A;  4DTP A;  4DCH A;  5ELZ A;  3CC7 N;  3BP8 A;  3O9R A;  1VQ7 N;  3O9Q A;  3CJB A;  3O3G A;  2A3Z A;  1CXU A;  3T1Y K;  3ENH A;  2PFU A;  3S3M A;  1TYQ A;  4WQ5 A;  3GE1 A;  3KLI A;  3OA9 A;  3V1Q A;  2YNI A;  1YUW A;  4BC3 A;  3MWP A;  3THW A;  3HTV A;  1FXX A;  1RNH A;  1BCO A;  3KKS A;  3LPT A;  4DTM A;  3O9T A;  4A59 A;  4AM6 A;  1W2B M;  3D6R A;  3ID6 A;  2KTQ A;  3HM8 A;  2PY5 A;  1YIJ N;  4F3O A;  1DGK N;  1HPZ A;  3WXL A;  4CF1 A;  4KV8 A;  5C24 A;  1RBT A;  2IS3 A;  2VG7 A;  4QS8 A;  1CXQ A;  5LY3 A;  2PBD A;  5SWM A;  1TUU A;  4HUG A;  1EP4 A;  2XRI A;  3O1B A;  4PKH A;  4A5A A;  2YHA A;  3MX5 A;  5AZI B;  2OAN A;  3HL8 A;  3AVK A;  3CJ1 A;  2D0P A;  4OPK A;  3LPU A;  1IKX A;  4QOZ B;  4JI7 K;  1WSG A;  3QML A;  1WAF A;  4JI2 K;  1KC8 O;  3QLH A;  4YDU C;  1C0M A;  5M1F A;  2O4G A;  1YTU A;  4E72 A;  3WEE A;  4NYF A;  4CEF A;  1C0U A;  3EEQ A;  4M42 A;  5F2R A;  2OPP A;  3SJH A;  1LWC A;  3LAN A;  3ZSZ A;  3RR7 A;  4E7J A;  1IG9 A;  1RT7 A;  1X3M A;  2ZGZ A;  4JRP A;  4XH5 A;  4XH4 A;  2NRV A;  5M1N A;  2W42 A;  3KWG A;  5AQF A;  4CJT A;  4J2B A;  2QWN A;  3A5O C;  4IDH A;  1NMD A;  1C0F A;  4KHS A;  3L4Q A;  1W9H A;  1Z05 A;  4FSV A;  3TTC A;  3UKU A;  4B08 A;  1A5W A;  3S9H A;  1ZBL A;  4CJ3 A;  3M3Z A;  2F96 A;  4HWI A;  1WOQ A;  1OH5 A;  4BQZ A;  5LJW A;  2HND A;  3C95 A;  1HNI A;  5FPM A;  4DQS A;  5LMU K;  4JYA K;  4L8R B;  4CZG A;  4M3Z A;  5AQT A;  5SZT A;  1HNV A;  2HW3 A;  4Z4C A;  3VES A;  3EKU A;  1L5U A;  4IWV A;  4B3O A;  3M8S A;  3FLC O;  4RWT A;  4FJM A;  2BE2 A;  2I7N A;  1J9A A;  4EZ6 A;  3TTD A;  2I7P A;  4DTR A;  2FXU A;  3ATV A;  3AV9 A;  3ZT1 A;  4DV5 K;  1JLF A;  5MLC Q;  5AQO A;  4CD1 A;  4JV5 K;  3P5J A;  4E1J A;  5HRR A;  4E7L A;  1U49 A;  2GV9 A;  4AHU A;  4FW2 A;  4BDZ A;  3F73 A;  1QTM A;  4DQR A;  2Q97 A;  3WNF A;  2QW9 A;  3M6G A;  4CER A;  2EWS A;  4MFB A;  2E2N A;  1BG3 A;  3TAQ A;  5JLH A;  3EZ5 A;  4O5B A;  3TAB A;  2O8C A;  4RG8 A;  2Q31 A;  2IGI A;  3CI5 A;  3TAP A;  1T7P A;  2CGL A;  1E4F T;  3U6F A;  1LW0 A;  1XWL A;  3GDQ A;  2P9U B;  3CFP A;  4WFA L;  3HJF A;  1Q8I A;  1BDG A;  3AVJ A;  2OYQ A;  4WFB L;  3FZH A;  5AQH A;  5DK5 A;  3VEX A;  2UXC K;  3HOS A;  3SPZ A;  2B4J A;  4DV6 K;  4AHC A;  2D5R A;  4LFA K;  3LDQ A;  5I42 A;  4OPH A;  5CR4 A;  4FVM A;  4DR1 K;  4DQQ A;  3CCQ N;  2G8I A;  4HCB A;  4ISG A;  1EET A;  2NLX A;  3EL2 A;  5BN9 A;  1BIU A;  3H3N O;  3U3G A;  1BI4 A;  1U04 A;  3CHW A;  3FGU A;  4KHP K;  3OYN A;  5FRO A;  4PHT X;  3F2K A;  4OKJ A;  3G6E N;  2Z1I A;  2ZE2 A;  4CZE A;  3VEW A;  4C8O A;  1RFQ A;  1N6Q A;  3RWU A;  3JS6 A;  1MWM A;  2WC9 A;  2V52 B;  3VQB A;  5AQY A;  1RBS A;  4DV4 K;  4JHD B;  4DTX A;  1S1U A;  3RMC A;  1EKE A;  4ID1 A;  1JCG A;  5C25 A;  2O8B A;  5AR0 A;  3NDK A;  4CFD A;  1NGA A;  1KLM A;  3QIO A;  1SQK A;  3RVC A;  4DR4 K;  1XQS C;  3BY5 A;  3O9S A;  3B6O A;  3LP1 A;  1Q81 O;  2UYT A;  1WBB A;  1CZB A;  1TGO A;  1MA9 B;  4FWK A;  4GV9 A;  1GLF O;  3K9J A;  3DLE A;  5I3U A;  3LP2 A;  1R59 O;  2E2O A;  3ID8 A;  1Q7Y O;  2E6L A;  3HYF A;  3NE6 A;  1YJW N;  2DFE A;  2Y1J A;  4XJX A;  4LH4 A;  4R79 A;  1REV A;  3U8X A;  1OH6 A;  4B9N A;  4KH4 A;  5KQD A;  2OA8 A;  1NK6 A;  3U3Y A;  4H0T B;  1BGX T;  4FWL A;  3CF5 L;  1BHL A;  5IWA K;  3CPW M;  2ZGY A;  1NJZ A;  5C15 A;  4DR6 K;  3D2E B;  3HVR A;  2HHV A;  3CJA A;  2X74 A;  5AFU H;  3VF4 A;  4AHS A;  4CBW A;  4BG9 A;  2AP1 A;  3CCU N;  3VQC A;  3RMA A;  3N4Q A;  3L2Q A;  1TUY A;  3SAG A;  4LSL A;  4CVN E;  3AO5 A;  1SAZ A;  3MXJ A;  3KTQ A;  2QI2 A;  3KIO A;  1XMO K;  4KI6 A;  3MK6 A;  1NKB A;  1RTD A;  4G9Z A;  3KVG A;  5KGW A;  2HHH K;  4Z4E A;  2E2Q A;  1I94 K;  1HRH A;  3K5N A;  3NF6 A;  3RMB A;  3ASM A;  4JKG B;  2F8T A;  2P9S A;  1VQ5 N;  2OPS A;  4IEE A;  1BQM A;  4QAG A;  3P31 A;  2V51 B;  1NK8 A;  1T6C A;  1KD1 O;  3W0L A;  4H0V B;  3FR0 A;  2ITM A;  3I8B A;  2NZT A;  1OVQ A;  1VQL N;  4JKF A;  2FLO A;  3U9D A;  4BDY A;  4UQG A;  4EAH D;  1UA0 A;  2DPN A;  5EY4 A;  1TK8 A;  3OS2 A;  2GBZ A;  3K5L A;  3V9X A;  2IDO A;  1UOC A;  3CCR N;  1WSJ A;  3RR8 A;  1SL1 A;  2IVP A;  3ZEU A;  2E2P A;  1LW2 A;  1ZBH A;  4NYN A;  4LFB K;  3OS1 A;  3F9K A;  5CZ2 A;  3ZSV A;  5LJV A;  3CPE A;  4N76 A;  1KVB A;  3KWI A;  3TAE A;  4E7H A;  4QS7 A;  3VOV A;  3JSM A;  2KFZ A;  4YOY A;  1YF5 L;  4Y1D A;  1YIT N;  5HRN A;  2OCE A;  3CQY A;  1JXE A;  1T03 A;  1NJX A;  1KQS M;  3G4S N;  4OX9 K;  4CGD A;  5M1Q A;  5GIO A;  4H5T A;  4I9L A;  2LSN A;  3ZET A;  2ZM6 K;  3AO3 A;  4JD2 B;  4FK4 A;  1Y97 A;  1N5Y A;  2YHB A;  3AGK A;  4BRC A;  1LV5 A;  3C6T A;  2E8A A;  3G25 A;  5C12 A;  1N36 K;  5KPR A; 
#chains in the Genus database with same CATH homology
 4B1Y B;  2NRH A;  5M1O A;  2NNW A;  1LOT B;  1KXP A;  2RHK A;  1BA1 A;  3TSU A;  3GBT A;  2Q36 A;  3VTH A;  1WUA A;  3SAF A;  2F9W A;  2YI1 A;  4FWS A;  3DWL A;  3FFK B;  3LM9 A;  3H1Q A;  4NB4 A;  4JN4 A;  4I6M B;  4FWP A;  4O8K A;  3VF6 A;  3MCA B;  2FSJ A;  1M90 O;  1TYQ B;  5AQV A;  1S22 A;  2E1Z A;  3MN6 A;  5E26 A;  3C0B A;  3DXM B;  1QQM A;  3R6M A;  4JK9 A;  4JD2 A;  1HPM A;  2GTD A;  4CBU A;  4FPB A;  1KAZ A;  3GG4 A;  4YOR A;  3HI0 A;  3WT0 A;  1W97 L;  2P9K A;  4H03 B;  3AAR A;  4ILJ A;  5M1P A;  4FL9 A;  3LDL A;  3T69 A;  4BR9 A;  1DEJ A;  3SK3 A;  2QXL A;  4IO8 A;  4IOX A;  2JWL A;  1NM1 A;  3KK7 A;  4K42 A;  5ADX H;  4FWR A;  3IDH A;  3IFR A;  3CCJ N;  1NJI O;  3D7E O;  4K43 A;  4ISF A;  4DCH A;  5ELZ A;  3CC7 N;  3O6W A;  3BP8 A;  3O9R A;  1VQ7 N;  3H46 O;  1QVG M;  5JIC A;  1JCE A;  3O9Q A;  3CJB A;  4I6M A;  2A3Z A;  1DT9 A;  3L0Q A;  1HUX A;  2W41 A;  3VF2 A;  3MN5 A;  2P9N B;  3ENH A;  2PFU A;  4BRG A;  5BRF A;  5GIP A;  1TYQ A;  4CZH A;  4ILH A;  4WQ5 A;  1BU6 O;  3DXM A;  3E9P A;  3GE1 A;  3MCP A;  3OA9 A;  1YUW A;  4BC3 A;  3DLL L;  3R9P A;  3VEN A;  2QWO A;  3MWP A;  3LDN A;  3WXI A;  2ZF5 O;  5TKY A;  5M1K A;  3TSP A;  3HTV A;  1QZ6 A;  4BVP A;  5BPN A;  4J8F A;  3I33 A;  2E20 A;  3MX2 A;  3W3D A;  5AQS A;  3O9T A;  4EFH A;  4A59 A;  3SLC A;  1KAX A;  1GLC G;  4AM6 A;  1W2B M;  3D6R A;  5HL7 L;  3A5N C;  3ID6 A;  4BG8 A;  2FF6 A;  3HM8 A;  2ZWH A;  4A2B A;  1YIJ N;  4WFN L;  5F0X A;  3WEE B;  1LCU A;  4FPA A;  1DGK N;  3WXL A;  3BF1 A;  5KQ8 A;  2YHW A;  2P9N A;  3SBG A;  3PIO L;  3C6A A;  4MO5 A;  4QS8 A;  1M1K O;  1P8Z A;  5LY3 A;  2RE2 A;  4JK8 A;  3WXM B;  2PBD A;  1TUU A;  3MMV A;  3O1B A;  4K25 A;  4PKH A;  4A5A A;  1YAG A;  5E84 A;  1Y64 A;  1HKC A;  3MX5 A;  5AZI B;  2CGK A;  4OPA A;  5CHI A;  2OAN A;  1U6Z A;  3HRG A;  5AQR A;  3CCL N;  4A61 A;  3CJ1 A;  4GVE A;  3VGK A;  3K9K A;  2D0P A;  3HSC A;  4BRK A;  3UKU B;  1SS6 A;  4NLB A;  4O8U A;  1RGI A;  5JMV A;  5TKW A;  1JCF A;  2BUP A;  4BRN A;  2Q0U A;  3QML A;  4YOW A;  3OBY A;  1MWK A;  2FSN A;  1KC8 O;  1OKJ A;  4YDU C;  5M1F A;  3C6H A;  3I56 N;  4JKD A;  3WEE A;  4YDU A;  2VWB A;  5JVH L;  4F9O A;  2D0O A;  5GIN A;  4A62 A;  2A40 A;  1OVY A;  5F2R A;  3SJH A;  1VQM N;  5AQG A;  3G71 N;  4BY9 C;  2YJF A;  1X3M A;  2ZGZ A;  4H5V A;  4CZI A;  2KHO A;  4XH5 A;  3A8Y A;  4XH4 A;  2NRV A;  5AZI A;  5M1N A;  4IJA A;  3AAP A;  3KWG A;  3CIP A;  5AQF A;  2QWN A;  3A5O C;  4IDH A;  1S3X A;  1NGB A;  1X9J A;  1NMD A;  1C0F A;  4BRI A;  3L4Q A;  3LL3 A;  1Z05 A;  1XC3 A;  4FSV A;  3TTC A;  2KKZ A;  2P9I B;  3A5L C;  3AAQ A;  3UKU A;  4CBX A;  1XUP O;  2NRT A;  3M3Z A;  4HWI A;  3ZX3 A;  4A2A A;  4M7X A;  3NMU A;  1WOQ A;  5AQP A;  2VCP A;  4BQZ A;  5LJW A;  2QA4 N;  1DKG D;  5B8H A;  3O5B A;  3VGL A;  1GLE G;  3A0I X;  5FPM A;  3VEV A;  1H1V A;  3FZM A;  2P9P B;  4OO1 J;  2HBL A;  2GEL A;  4CZG A;  4BRA A;  2Q0R A;  5AQT A;  4H0O A;  4BRP A;  4JAX A;  3ZX0 A;  1V4S A;  3VES A;  3EKU A;  4IWV A;  1VQO N;  5FPN A;  3QIC A;  2D4W A;  3VEO A;  3MN7 A;  1VQ9 N;  3EN9 A;  2QWL A;  3FLC O;  1V4T A;  4RWT A;  3ULE B;  5AQK A;  3VEY A;  4GNI A;  1KAY A;  2I7N A;  2P9I A;  4IOC L;  4H0Y B;  4A5B A;  1T6D A;  5I9E B;  2HBJ A;  4BC4 A;  1Q18 A;  4FO0 A;  1SZ2 A;  4JKB A;  3TTD A;  2I7P A;  4BR7 A;  2FXU A;  2YJE A;  3ATV A;  4B1V A;  5FPE A;  4BRL A;  4IXC A;  5KPZ A;  3KZB A;  3CJ9 A;  3JXU A;  3U9Z A;  2P9L A;  5MLC Q;  1QVF M;  5AQO A;  2F9T A;  4CD1 A;  1Z6R A;  4E1J A;  4CZL A;  2V7Y A;  1ILY A;  5EVZ A;  3LDO A;  5AZJ B;  1YI2 N;  3H45 C;  5AQX A;  1IJJ A;  4MDB A;  2BH1 A;  2ASO A;  3O9U A;  3HBT A;  1MDU B;  1S72 N;  4RTF D;  5GAH P;  2Q97 A;  1BUP A;  2WBN A;  3TU5 A;  2QW9 A;  3M6G A;  1ZC6 A;  4PL7 A;  3N4P A;  2EWS A;  3SAH A;  2E2N A;  1NGH A;  1NGE A;  3UB5 A;  2HMP A;  3ULE A;  4H5N A;  1BG3 A;  2A42 A;  5JLH A;  3OW2 M;  2NRX A;  1NWK A;  3FZF A;  4MDA A;  3J8A A;  4BGB A;  4BQL A;  4BEC A;  3QFP A;  2Q31 A;  3CI5 A;  2VGN A;  2CGL A;  1E4F T;  1YHQ N;  4AF1 A;  1X3N A;  1J6Z A;  2CGJ A;  3GDQ A;  2P9U B;  5AQM A;  3CCS N;  1VQN N;  2ASP A;  3H6E A;  3DJC A;  4FWQ A;  3VPZ A;  4WFA L;  1ZBS A;  4H0P A;  5AZJ A;  3LDP A;  3O4W A;  3VEZ A;  1BDG A;  3OBW A;  2CH5 A;  4HTL A;  4WFB L;  1K9M O;  4NO7 A;  4JKH A;  1JJ2 M;  3O1W A;  4IZ9 A;  3TSQ A;  1K73 O;  2H3G X;  1RDU A;  3FZH A;  3O08 A;  3EKS A;  5AQH A;  5C0Y A;  4C23 A;  3VEX A;  3HOS A;  3PIP L;  2QWP A;  1ESV A;  1QQN A;  3Q7B A;  4YOU A;  3LDQ A;  2GUP A;  2IVN A;  3IUC A;  4OPH A;  4CJ7 A;  3CCM N;  5CR4 A;  4BRD A;  3CCV N;  3FZL A;  5EX5 A;  5BRE A;  3CCQ N;  3WQU A;  5DM7 L;  4IOA L;  1VQP N;  2P9U A;  4WQ4 C;  3HOT A;  1GLL O;  4ISG A;  3J7Z O;  2NLX A;  3EL2 A;  5BN9 A;  3H3N O;  3CHW A;  1GLA G;  3L6Q A;  3FGU A;  4M7Y A;  2QWQ A;  3A5M C;  4PHT X;  4PL8 A;  3F2K A;  3G6E N;  4LC9 B;  1HLU A;  4CZE A;  3VEW A;  2WFB A;  1RFQ A;  4BRF A;  4PKI A;  2GEM A;  3QBW A;  3WQT A;  1VQ8 N;  5DM6 L;  3CC4 N;  3JS6 A;  1MWM A;  1K8K B;  2HF3 A;  4MLE A;  3UKR B;  4BRO A;  1HX1 A;  2WC9 A;  2PAV A;  1E4G T;  2V52 B;  5AQY A;  4JHD B;  3ZET B;  2JWK A;  4JNE A;  3VET A;  4BGA A;  2HOE A;  1K8A O;  4MLH A;  1JCG A;  1EQY A;  2Q1N A;  5AR0 A;  3H3O B;  4FWM A;  3CCE N;  4GV3 A;  1NGA A;  3ENB A;  3ENO A;  1SQK A;  3M5R A;  1ATS A;  1NGJ A;  3R3L A;  4ILG B;  3RVC A;  4CD3 A;  5CE3 A;  4UY8 O;  2YCH A;  1XQS C;  1NGD A;  2VYP A;  3FZK A;  3O9S A;  2UYT A;  5KPT A;  1Q81 O;  1YXQ A;  2ZJR L;  3QDK A;  5JLF A;  3P38 A;  4IO9 L;  3EO3 A;  1BO5 O;  3KHY A;  5C2F A;  1MA9 B;  4FWK A;  1NLV A;  4Z94 A;  4GV9 A;  3UKR A;  1K8K A;  1GLF O;  4U7B A;  3E1Y A;  3K9J A;  1GLD G;  2GX9 A;  4L3Q A;  2AA4 A;  4FOI A;  4JHD A;  3SBT A;  1NGC A;  5EXW A;  4DKW A;  1R59 O;  2E2O A;  3ID8 A;  1Q7Y O;  1QHA A;  1YJN N;  3P4I A;  2QM1 A;  2OTJ N;  1YJ9 N;  1O13 A;  1YJW N;  5BRD A;  4JKE A;  2VGM A;  4EIA A;  4JEP A;  4XJX A;  3MN9 A;  4AM7 A;  1GLB G;  3SMP A;  4R79 A;  3U8X A;  4CI6 A;  4BR0 A;  5AQZ A;  2Q2R A;  4KH4 A;  3WUH A;  5KQD A;  3T7Z A;  3VTI A;  5AQJ A;  4CZF A;  4DHY A;  1QZ5 A;  3P39 A;  4IJN A;  4H0T B;  3AGR A;  4XH1 A;  4FWL A;  4BR5 A;  2P9P A;  4YOX A;  1NGI A;  1HKG A;  3CF5 L;  3D2F B;  5JVG L;  4C1N K;  4YOV A;  3I55 N;  3CC2 N;  3EE8 A;  3CPW M;  2ZGY A;  4JK7 A;  4JKC A;  3M1F A;  2HBM A;  5C15 A;  2QWR A;  3D2E B;  3H1V X;  3Q7C A;  1ZXO A;  2HST A;  3LM2 A;  5AQI A;  3CJC A;  1G99 A;  1ATR A;  3GOI A;  3CJA A;  2KLA A;  5AFU H;  3BUZ B;  2GWK A;  4O5F A;  5AQN A;  3VF4 A;  5EOY A;  4B1U B;  4B9Q A;  2P9S B;  5GAD P;  4CBW A;  3E66 A;  1QQO A;  4BG9 A;  4B1Z A;  2AP1 A;  4BRM A;  4BR2 A;  2OTL N;  3DAW A;  3CCU N;  3EZW A;  4H0X B;  4FWO A;  1NBW A;  4FOE A;  3N4Q A;  4MO4 A;  2A6A A;  1TUY A;  4DQ8 A;  3SAG A;  1SAZ A;  3UE5 A;  2ASM A;  4BVO A;  3HZ6 A;  3CD6 N;  4KH6 A;  2QI2 A;  4CZK A;  3CQX A;  3TTF A;  5AQU A;  5BN8 A;  3ZYY X;  3MK6 A;  3SMS A;  4C1N I;  3D2F A;  3B8A X;  4H5R A;  1BA0 A;  4G9Z A;  3BF3 A;  4CZJ A;  5BPL A;  3CXC M;  1IG8 A;  4WQ5 C;  3D2E A;  3KVG A;  2YHX A;  3CER A;  2E2Q A;  5BPM A;  2WUS A;  3WXJ A;  1EO1 A;  3R1X A;  4PKG A;  3CMA N;  2C1I A;  1VQ6 N;  4XEI A;  4BEB A;  3R8E A;  5GAE P;  3L4I A;  4JKG B;  3MDQ A;  2P9S A;  1YVN A;  1VQ5 N;  4IEE A;  4A57 A;  1VAZ A;  5BRH A;  5AQQ A;  3P31 A;  2V51 B;  3U4L A;  3FE1 A;  1T6C A;  1KD1 O;  3W0L A;  3ZEU B;  2BTF A;  4WCE L;  4H0V B;  3FR0 A;  1HJO A;  2ITM A;  3WXK A;  3I8B A;  2QWM A;  3PLA A;  1BOT O;  3GL1 A;  2NZT A;  3RSE B;  3IMX A;  3MWT A;  4JKF A;  1VQL N;  1C0G A;  2FLO A;  4JKA A;  3OHR A;  2FSK A;  1NGG A;  3AY9 A;  3U9D A;  3QBX A;  4WQ4 A;  4EAH D;  4BE7 B;  2NRR A;  3E9O A;  1N8R O;  5AFU A;  1VQK N;  4QS9 A;  2F7T A;  1Q82 O;  2DPN A;  3O80 A;  2IIR A;  3F5T A;  4FWN A;  3CME N;  5EY4 A;  2A5X A;  1ATN A;  4B1X B;  4BC2 A;  2YHY A;  4GV6 A;  3EE9 A;  2E1Y A;  2HBK A;  1VQ4 N;  2J4R A;  4CZM A;  1U2V B;  4BC5 A;  4JKG A;  3VGM A;  3CCR N;  3IKM A;  5ADX A;  3C7N B;  2IVO A;  2NRZ A;  4WYB A;  2IVP A;  4IFE A;  3DXK B;  2GWJ A;  4EHU A;  3ZEU A;  2E2P A;  4H5W A;  4DB3 A;  5HOO A;  2A41 A;  2ZJP L;  2W00 A;  3RSE A;  5C10 A;  4BR4 A;  3QB0 A;  5LJV A;  3CPE A;  2C1G A;  5H1S Q;  3VER A;  5C2D A;  2D1K A;  1D4X A;  5F1X A;  3KWI A;  2W40 A;  4QS7 A;  4WF9 L;  3E9L A;  3VOV A;  5FPD A;  5BR9 A;  4YOY A;  1HKB A;  1YF5 L;  3ZX2 A;  1T3V A;  4B1W B;  3CJ7 A;  4KBO A;  1YIT N;  4IEI A;  3CQY A;  3BEX A;  2CH6 A;  3F9M A;  4K41 A;  3TPQ A;  2QTD A;  1U2V A;  4BRE A;  1KQS M;  3S41 A;  3G4S N;  2ZJQ L;  3O8M A;  1P90 A;  1T44 A;  3C7N A;  4NLC A;  5M1Q A;  3VMF B;  5GAG P;  3NVM A;  4FVU A;  3DXK A;  5GIO A;  4H5T A;  1GLJ O;  3CET A;  2FF3 B;  3ZET A;  4RCH A;  1NGF A;  2QEX N;  4BRQ A;  4KH5 A;  4M63 C;  4YOT A;  1BWF O;  2NRW A;  3QFU A;  4JD2 B;  4Y0W A;  2YX6 A;  5AQL A;  1CZA N;  3C65 A;  5AQW A;  4U67 L;  4EHT A;  3NVK A;  4ISE A;  2P9K B;  3AGK A;  4BRC A;  1Q86 O;  3ATU A;  2E88 A;  3G25 A;  2E8A A;  4GY2 B;  4BRH A;  5C12 A;  1RDW X;  5KPR A;  2V7Z A;  2P9L B;  2HF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...