4I6MB

Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of swi/snf chromatin remodeler.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
437
structure length
396
Chain Sequence
PFRQDSILIIYPRSQTTLVQFGLNEETFTVPELEIPTQIYRTTRQDGSYTYHSTNKDNKAELIKPIQNGEIIDISAFTQFLRLIFVSILSDRANKNQDAFEAELSNIPLLLITHHSWSQSDLEIITQYVFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTHHTDIIPIVDYAQLDHLVSSIPMGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSKNSDLEFNTFWDEKGNEIKVGKQRFQGCNNLIKNISNRVGLTLDNIDDINKAKAVWENIIIVGGTTSISGFKEALLGQLLKDHLIIEPEEEKSKREEEAKSFVPTIEYVQCPTVIKLAKYPDYFPEWKKSGYSEIIFLGAQIVSKQIFTHPKDTFYITREKYNMKGPAALWDVQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 7
publication title Structure of an actin-related subcomplex of the SWI/SNF chromatin remodeler.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
total genus 115
structure length 396
sequence length 437
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4i6mB02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4i6mB01
3.90.640.60 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4i6mB03
1NGJA 2ASMA 3O1WA 3O5BA 3MK6A 4BRFA 3EO3A 5KPTA 4PKIA 3LDPA 3IMXA 5AZJA 3G25A 4EHUA 3UKUA 2P9IA 3CJ7A 4M7XA 2VYPA 5ADXA 1YVNA 3WXLA 4CD1A 1NGBA 3HTVA 4H0TB 2A3ZA 2E1YA 2IVOA 4BC5A 1G99A 1S3XA 4FSVA 2P9NB 4E1JA 4H5RA 3GG4A 2NLXA 2E88A 3QMLA 3WEEB 3VEZA 1D4XA 2Q2RA 4BRNA 2GTDA 2D1KA 3M6GA 3ID8A 3SLCA 1QQMA 5LJVA 3VF2A 5BPNA 1NGGA 3R6MA 3VF6A 3LM2A 3WQUA 1KXPA 3RSEB 4M7YA 1QHAA 4JHDA 3W3DA 3O08A 2QXLA 4FPAA 4FPBA 3LDNA 1MDUB 3ZEUB 4H0OA 2D4WA 3IDHA 4WYBA 1BA1A 3FZKA 1RDWX 4FWOA 4CI6A 1NGIA 3A5NC 1HLUA 1GLEG 3AAQA 3MMVA 4BRCA 1Y64A 4BRLA 3ENOA 1C0GA 1C0FA 3CHWA 3MN5A 1LOTB 1NLVA 3L6QA 1GLFO 2Q36A 3H46O 1JCFA 3CJ1A 2IIRA 2QW9A 1U6ZA 4I6MA 3DXKA 4BR7A 4JD2A 1BA0A 3ZETB 2QM1A 2A40A 1HX1A 1IG8A 2FSNA 1CZAN 4XH5A 2FSJA 3VEWA 3EKUA 3UB5A 1R59O 1X9JA 4BRQA 3JXUA 1HKGA 3MN9A 3DJCA 3GE1A 5AQIA 3ULEB 3CETA 4BRIA 3FZHA 3UE5A 4A2AA 4CZFA 3H3OB 2BUPA 4BG8A 2YHXA 1MA9B 1J6ZA 4M63C 2P9UA 2QWOA 4CZEA 3W0LA 3GDQA 2E2OA 4H5NA 5BREA 1QZ6A 1V4SA 3CJCA 1SZ2A 3MCPA 3O8MA 1NGFA 5AQJA 3ZX2A 5AZIA 4H5VA 4B1YB 5AQSA 3AARA 4IJNA 1NGAA 4IZ9A 3A5MC 5JMVA 4B9QA 3CQYA 2KHOA 1YUWA 4Z94A 4CZHA 2F9TA 3WUHA 4BGBA 5KPZA 3D2EA 5BRFA 1HPMA 3A5OC 3BEXA 4FWLA 2V7YA 2CGLA 3EKSA 1ZBSA 3IUCA 4L3QA 2V7ZA 3C7NB 4HTLA 4QS7A 4BR9A 5JLHA 2ZWHA 5AZJB 2DPNA 2P9IB 5CE3A 2CGJA 5ADXH 5BPLA 2CGKA 3FLCO 4JN4A 2QWLA 2ZF5O 3VGMA 3CJ9A 3UKRA 2ZGZA 4BREA 4YDUA 4PKGA 1HKBA 2V51B 4FWQA 4IO8A 2UYTA 3FR0A 2D0PA 2QWMA 4BRKA 2W41A 3F9MA 4O8KA 5AQQA 1BOTO 4K41A 2D0OA 1U2VA 2YHWA 3MN6A 5F0XA 2Q31A 2Q0RA 4EAHD 1T44A 2GEMA 3H6EA 2HMPA 4FOEA 1YXQA 5AQZA 3U8XA 1BO5O 3VGKA 3ENHA 3QBWA 5AQUA 3M1FA 4BQLA 3A8YA 5I9EB 1RGIA 4QS8A 4NO7A 4O5FA 2VCPA 3VERA 2P9SB 3LDOA 2GUPA 3D2FA 3H45C 2P9KA 4RCHA 4A62A 2NZTA 5AQOA 2W40A 1BG3A 2I7NA 4I6MB 1HKCA 3MDQA 2P9NA 3DXKB 4F9OA 4JD2B 3VF4A 1E4FT 1Z05A 3HI0A 4PL8A 4CZGA 3FZMA 1TYQB 3EZWA 4BQZA 2IVPA 4DB3A 3H3NO 5AQGA 4BRMA 1KAXA 4RWTA 3HSCA 3LDLA 2A6AA 2A41A 3DAWA 5EX5A 3U9ZA 3RSEA 5EOYA 1BU6O 1NBWA 4BR0A 1S22A 5TKYA 4YDUC 4FO0A 4AM7A 3VEXA 3DXMB 5JICA 2AP1A 4CBWA 3EN9A 1BWFO 3ZEUA 1NGHA 3FE1A 3M3ZA 4FWMA 3FFKB 2P9LB 4FWNA 4GY2B 2WUSA 1ESVA 2EWSA 2QWPA 1K8KA 1NM1A 5E84A 2BTFA 1TUUA 2PAVA 3CERA 2I7PA 3H1VX 5AZIB 2A5XA 5KQ8A 4K43A 3SK3A 3SMPA 1ZC6A 2VWBA 4EIAA 2FXUA 1YAGA 2ASPA 4H0YB 3EL2A 3JS6A 3LL3A 5AQVA 2E20A 2E2QA 3CJAA 5AFUA 2F9WA 1JCGA 5KQDA 1MWKA 4RTFD 3HZ6A 2J4RA 4J8FA 2FSKA 4FWSA 2V52B 2E1ZA 4B1UB 3BF3A 4CZIA 5AQWA 2FF6A 4H03B 2QWNA 1DGKN 3WXKA 4KBOA 4H0VB 1EQYA 2ITMA 5F2RA 4FWPA 1MWMA 1ATSA 5AQYA 5AQNA 3UKRB 3VETA 3A0IX 1SAZA 1BDGA 5EY4A 3VENA 4WQ4A 4BVOA 3I33A 5FPDA 2Q1NA 3KVGA 1RFQA 5AQKA 4MO4A 3UKUB 4B1ZA 3CJBA 4XH4A 1P8ZA 5ELZA 4H5WA 2CH6A 3QDKA 4CZJA 5BPMA 3GBTA 4XH1A 4JAXA 4H5TA 1LCUA 4C23A 4A61A 1XC3A 3AY9A 4JNEA 3J8AA 5BRDA 1WUAA 4IJAA 1BUPA 4AM6A 1QQNA 3IFRA 3ATVA 4K42A 1XUPO 5AQHA 1GLAG 3LM9A 5AQPA 4JHDB 3WT0A 1Z6RA 1NWKA 3C7NA 4H0PA 2P9PA 4B1WB 4DCHA 4EHTA 2FF3B 4QS9A 5LJWA 3D2FB 2HF3A 2P9KB 3FZFA 4MLHA 3I8BA 2A42A 5B8HA 2E2NA 2GWKA 2GELA 4FWRA 3U4LA 4B1VA 3FZLA 2IVNA 3U9DA 4CBUA 5F1XA 3VGLA 3L0QA 4MLEA 4A2BA 2YHYA 1GLDG 1GLJO 3GL1A 3ZX0A 5AQMA 3VEYA 4FWKA 3CIPA 1DKGD 2CH5A 3QBXA 3H1QA 4BRAA 5AQLA 3WXJA 3WXIA 2QWQA 2H3GX 3WEEA 1T6DA 5KPRA 3GOIA 4WQ5C 1NGEA 2YJEA 4WQ4C 4Y0WA 3SJHA 4EFHA 5FPEA 1NMDA 4BG9A 2Q97A 4NB4A 3SMSA 1HJOA 1V4TA 4BC4A 3A5LC 1SQKA 2GWJA 5AQXA 4PL7A 4BC3A 1K8KB 2NRHA 5AQFA 4BRPA 2P9SA 1GLCG 3AAPA 4BRDA 3ZX3A 4XEIA 4IWVA 2P9UB 4BR4A 4FL9A 1GLBG 2OANA 1XQSC 3O1BA 5AR0A 4BR5A 5JLFA 1HUXA 2Q0UA 5AFUH 3VPZA 4B1XB 2FLOA 4CZMA 1IJJA 5FPMA 1TYQA 1ATRA 4ISEA 3CQXA 3WQTA 2PBDA 2YJFA 3L4IA 4IXCA 1H1VA 4MO5A 4BC2A 3ZETA 2QWRA 5AQRA 3C0BA 1KAYA 3D2EB 1JCEA 2AA4A 4K25A 4BRGA 1ZXOA 3VEVA 4CD3A 4ISGA 2ASOA 3DWLA 1OKJA 3BF1A 3DXMA 3OHRA 4DHYA 1X3NA 1E4GT 3ULEA 5AQTA 4BRHA 4PKHA 2P9LA 5BR9A 4FOIA 5BN8A 4LC9B 3BUZB 4H0XB 5BRHA 1GLLO 4BGAA 2YI1A 5EVZA 3KHYA 3QFPA 4CZLA 3TPQA 4DQ8A 4CJ7A 1NGDA 3R8EA 3ATUA 4WQ5A 2E8AA 1Q18A 3O80A 2YCHA 4GNIA 3VESA 1NGCA 3S41A 3HBTA 3B8AX 5FPNA 3QICA 4ISFA 3QB0A 3TU5A 1X3MA 4BR2A 3MN7A 3LDQA 1ATNA 1DEJA 3FGUA 3VOVA 4BVPA 1QQOA 5EXWA 1QZ5A 1U2VB 1WOQA 3D7EO 2HF4A 3CI5A 5E26A 4BROA 1KAZA 1T6CA 3R9PA 1TUYA 5LY3A 3HM8A 4HWIA 5BN9A 3O4WA 3VEOA 2P9PB 3BP8A 2HOEA 3QFUA 3KZBA 4CBXA 3O6WA 2E2PA 3P4IA 2ZGYA 4CZKA
chains in the Genus database with same CATH superfamily
3O1WA 3O5BA 3ZSOA 2KKZA 4DTRA 3LDPA 3IMXA 2UUCK 4C1NK 4CHYA 3CJ7A 4H8KA 4KI6A 4ID1A 5ADXA 1NMNA 1YVNA 1CXQA 3OYJA 1NGBA 3CYMA 1NKBA 4FK4A 2KZZA 1S3XA 3ISNC 3GG4A 3V4IA 4JI8K 2NLXA 4DUYK 3KWIA 1QSSA 4KHWA 2YNFA 1RTIA 3VQ7A 1TAQA 4NCBA 2JWLA 4OKKA 4DV3K 4M3RA 3MXIA 5HRPA 3R6MA 4RW7A 1BCMA 4DQPA 3VF6A 3LM2A 3P5JA 3J81O 4F4KA 3SUPA 1LAVA 3W3DA 3RTVA 2QXLA 3O9QA 4FPAA 3ZSVA 3UIQA 3D45A 3U3YA 1OH8A 1NOZA 4KHPK 1EETA 3FZKA 4FWOA 1NGIA 3THYA 3M5RA 1HNWK 2X6SA 3CFPA 1IBMK 3L6QA 5IWAK 4K0KK 1JCFA 3ZT0A 1TKDA 1YJNN 1U6ZA 4BWJA 2NRWA 3OYGA 2ZM6K 4BR7A 3WXMB 1HX1A 1WAJA 2HHHK 3VEWA 3UB5A 1RBSA 4PHTX 1HKGA 2UUBK 2UU9K 3GE1A 1S9GA 4E7HA 2VQFK 3ENBA 3NVMA 2OPRA 3UE5A 4A2AA 3CCQN 4CZFA 4AHVA 3CMAN 2B6AA 2YHXA 3CCSN 2P9UA 4CIEA 2F4VK 2ZD1A 4UY8O 4CF9A 4KHYA 4FZYA 1V4SA 3CJCA 3MCPA 3K5MA 1NGFA 1SKRA 2P5GA 5M1QA 4JKDA 4DF8A 1IBKK 1EO1A 1XWLA 4IJNA 2E6MA 4DQIA 1LW2A 4CJQA 2EHGA 3SPZA 3SQ4A 5J2PA 5T7BA 1EWQA 3NF6A 2QKKA 3RRHA 4BGBA 1HPMA 4KV8A 4FWLA 3DM2A 2CGLA 3O4NA 4CJ5A 1LW0A 2V7ZA 3C7NB 2ZWHA 3PLAA 1FKOA 5ADXH 3BZCA 3ZCMA 3FLCO 5J2NA 2NNWA 3VGMA 4JKCA 3CJ9A 3UKRA 4BREA 3PX0A 3O9RA 4CHOA 4YDUA 4FLYA 5GINA 2UYTA 3DLGA 5AQQA 1NKCA 4O8KA 1JLCA 3CM5A 4AQYK 4LF6K 1BOTO 4OLBA 3AA2A 2D0OA 3BY5A 1K6YA 4C8OA 3AVLA 1TK8A 3OVNA 2C1IA 4Y1CA 4B3MK 3H6EA 4CGFA 4KH5A 1YXQA 3CM6A 5HRNA 3VQEA 1BO5O 3ENHA 5H1SQ 3TR8A 4PUOA 3PY8A 4CHZA 4DMNA 3AA3A 4O5FA 1IBLK 4B9UA 3J80O 4HHTA 4FLZA 4AHTA 2VCPA 2C1GA 1VHXA 3JAMO 3ZLJA 1VQ8N 1YITN 4HUEA 4A62A 5HROA 5AQOA 2W40A 2I7NA 4YOYA 4I6MB 3QEPA 5HRRA 3SV4A 4FLUA 4F9OA 4JD2B 4J2DA 5M1KA 3HI0A 3K59A 4OGCA 4CZGA 4DTUA 1LWFA 1C1CA 3EZWA 4CFDA 3J7YP 4HCCA 4RW4A 3THXB 3NF8A 4DQSA 4RWTA 4XJXA 3LDLA 5EX5A 3CXCM 5JVHL 2XY5A 2G8WA 3L3VA 3QO9A 4IEIA 3VEXA 4ILHA 3CCEN 2AP1A 3HPGA 3FE1A 3M3ZA 4CEEA 3T69A 5HL7L 3EYZA 2DFHA 4CJKA 3NGZA 3RR7A 1S72N 4GY2B 4PA1A 2QWPA 2BTFA 3CERA 2PAVA 3TAFA 3SK3A 3SMPA 3CQ8A 2PYJA 3DMJA 4H0YB 4B9MA 3JS6A 3LL3A 5AQVA 3TAMA 3LWMA 3ZSQA 2E2QA 2F9WA 3U6FA 5CYMA 4Y1DA 4XIUA 4U7BA 4RW9A 2VWJA 4JI0K 4DS4A 1VRTA 4FJJA 1OH6A 3NF9A 4B1UB 2OZMA 3VTHA 2FF6A 2QWNA 1S6PA 1ZBFA 1EQYA 4LF5K 2ITMA 4ZTFA 1ATSA 5AQNA 3C94A 5K14A 1BDGA 4DTJA 1JLEA 1RFQA 3KVGA 3UKUB 4AH9A 2O8CB 4B1ZA 4YORA 1P8ZA 4H4OA 4CFBA 5ELZA 3OTOK 4CZJA 1GOCA 3E66A 4XH1A 4JAXA 3E01A 2RF2A 1HJRA 1QS4A 1HQUA 2FBTA 1HNVA 4NXMK 4FJIA 5CR4A 5CZ2A 5BRDA 1JXBA 1WUAA 4FLVA 5BR8K 1BUPA 3SYZA 2ZJQL 4M3XA 1ASVA 2B5JA 3P39A 3ATVA 1XUPO 2YV0X 3OYCA 2VWKA 1GLAG 4JHDB 4QOZB 1Z6RA 1NWKA 3C7NA 3HRGA 4DCHA 1WBDA 2HF3A 1WAFA 2HBMA 4OPHA 2E2NA 3Q7CA 1ZBIA 3U4LA 1CZ9A 3VQPA 4YY3K 4MLEA 3KLFA 1VSJA 4F2RA 2ITGA 3VQQA 4JI7K 4CJPA 2RN2A 5FRMA 2YJEA 4JKGB 5C10A 4BG9A 1W2BM 3V9XA 1HJOA 1TL3A 3OJSA 3G10A 3IG1A 1SQKA 2KLAA 4DU3A 4PL7A 3J7ZO 4GKKK 4C8NA 5AQFA 1GLCG 3AAPA 4FJ7A 4XEIA 4IWVA 1BI4B 2XY8A 4ILGB 4X66K 3OS2A 1EWRA 4BEBA 2EX3A 1VSEA 2FLOA 4RW8A 1IO2A 3TAEA 3BZKA 3CF5L 1VRUA 1J5OA 1ATRA 2HHVA 4CF8A 4F3TA 2YJFA 3SNNA 3T7ZA 3HSTB 4BC2A 4CJFA 5LMNK 3SQ1A 1ITGA 1D9DA 3AVJA 3D2EB 1VQ4N 4DLGA 3N4QA 2IDOA 2G8KA 3OHRA 4DHYA 5FRNA 5BR9A 1VSLA 3BUZB 1RDBA 3CCLN 5KGXA 2QXFA 2YI1A 3KHYA 3AGRA 2D5RA 4WQ5A 4DG1A 3K9JA 3MX2A 4FLXA 1NGCA 3HBTA 3I0SA 4ISFA 4M42A 3AO2A 4OVLA 4BR2A 1Y97A 3OYKA 1DEJA 3FGUA 3MAQA 4KHNA 1OH5A 1U2VB 4FJMA 1RCHA 1IV0A 3IRXA 4FJ5A 5LMUK 3VEOA 2P9PB 4C8KA 3ALYA 4WE1A 3P4IA 4JK8A 3CPWM 3V9UA 1RDAA 1N36K 2ZGYA 2ASMA 4BRFA 4OPKA 3V9ZA 4PKIA 5AZJA 3UKUA 4W5OA 2VYPA 4CD1A 1S6QA 4DSLA 4ELUA 3QNOA 4BC5A 2P9NB 4A57A 4FW2A 5LL6Z 3WEEB 3VEZA 3DLBA 2GTDA 2D1KA 3JSMA 4DR6K 1O1WA 3AVGA 5BPNA 1NGGA 4W5RA 2NUBA 3RSEB 4JHDA 2OPQA 1WLJA 4FPBA 3LDNA 1KD1O 1RTJA 3ZEUB 4JS4A 2D4WA 3KK1A 1BA1A 4YHHK 1RDWX 4CK2A 4CI6A 1HLUA 1GLEG 3L4QA 3KLIA 3ENOA 1C0FA 3CHWA 3MN5A 3RVCA 1J5EK 3QIOA 4IDHA 4UQGA 2PY5A 1N32K 1U4BA 4YOTA 5EU7A 4CECA 2P1JA 3M8SA 3E9PA 3AVIA 4IKFA 4DSJA 3R1XA 4B9SA 3AVBA 1NJZA 4CGIA 1BA0A 3ZETB 2QM1A 4KTQA 3OY9A 1U48A 1RTDA 1I3AA 1IG8A 2W42A 4IOXA 4BRQA 1T7PA 3S3OA 4JKFA 3MN9A 3SBGA 4DU4A 3C6HA 5AQIA 3SAFA 3EY1A 1W7AA 4MFBA 2OCEA 3T1HK 4A59A 1XC9A 3M8PA 3LZIA 2NRTA 2A1RA 4FJ8A 4FM1A 4DUZK 2OTJN 4M63C 1J6ZA 4J2BA 3I8DA 3KKSA 1BI4A 3ZSXA 3TTDA 2E2OA 3OS1A 1QZ6A 2WONA 4CEFA 3SZ2A 4B3SK 3TTFA 3ULDA 4RG8A 4GVMA 1D5AA 4KH6A 1I39A 3ZX2A 5AZIA 1HYZA 4YOUA 4YOVA 5J2QA 1HNZK 2O8DB 3M8RA 4NLBA 3A5MC 2OA8A 5JMVA 1IKYA 3CQYA 4EP5A 2HHIA 4Z94A 2JWKA 4CZHA 4B08A 3WUHA 3D2EA 3KLHA 2JGUA 3ZT1A 3A5OC 1BL3A 3OYAA 2OYQA 3DLRA 4YOWA 1ZBSA 4L3QA 4HTLA 4QS7A 4O8UA 5C2FA 1W0HA 2DPNA 2P9IB 3HO1A 3ZSYA 2CGJA 4I2QA 2VG5A 3LDSA 1VSKA 2GUIA 2FBVA 4PKGA 1HKBA 3OYDA 1WNSA 3FR0A 3QINA 1DTTA 3F9MA 2HHQA 3QEXA 4K41A 1U2VA 1SL1A 1TK5A 4FZXC 1NK0A 5F0XA 4KRFA 4IEEA 3K9KA 2GEMA 2HMPA 5HRSA 3G6EN 3U8XA 1FW6A 3MWPA 3DLLL 2X78A 5AQUA 3QBWA 1RT2A 3KTQA 3HVRA 4NLCA 3B6OA 4DSEA 3CMEN 3ZYYX 5M1OA 4DR7K 4H4MA 3MXJA 2GUPA 3D2FA 3H45C 2YNIA 3LANA 2P9KA 4RCHA 4FM2A 4LH5A 2OTLN 2KFNA 2P9NA 3DXKB 4E7IA 4FJ9A 1Z05A 3HT3A 1RNHA 4A5AA 4PL8A 2HVIA 1TK0A 3O4QA 1L3TA 2HHXA 4HVJA 4CCHA 4DKWA 3V1OA 2FBYA 2IVPA 3ZT2A 5C15A 4EZ9A 4LF7K 2Z1HA 3U9ZA 3RSEA 1RBTA 1S22A 1SL0A 1KQSM 3DXMB 3KLEA 3ZEUA 1C0UA 3AVKA 4FWMA 1XMQK 2HBJA 4OKJA 2WUSA 3CFRA 4LFAK 3HM9A 4DR5K 1K8KA 1JLQA 2A5XA 2YKNA 4EIAA 2HHTA 1FK9A 4BDZA 2D0AA 1P90A 3EL2A 1M90O 4WF9L 1VQPN 3CJAA 5AFUA 1DLOA 1JCGA 1CZBA 4M41A 3V1RA 1MWKA 3SUQA 3THWB 1X1PA 2A1SA 2J4RA 5E41A 2FSKA 4LSLA 4CF0A 4DV1K 1W9HA 3IKMA 4FWSA 1VK0A 3T3FA 3SCXA 3PV8A 1NK8A 4H03B 3ZT3A 1DGKN 1N34K 4H0VB 4E7LA 2NRRA 4FWPA 1MWMA 1ZYQA 1L3UA 4W5NA 2ZE2A 3SQ2A 3VETA 3A0IX 5EY4A 1HNXK 4WQ4A 3SQ0A 2Q1NA 5AQKA 1IKWA 4MO4A 1K9MO 4XH4A 4DWIA 4CEZA 1HMVA 2O8DA 3CFOA 4C8LA 1XC3A 3OYHA 4CEOA 1S1WA 3P31A 2QTDA 5AQHA 4DFPA 1F21A 2GV9A 3WT0A 1I94K 4FK0A 4H0PA 4N5SA 1EKEA 1X9MA 4IO9L 2O8FA 5JENA 4EHTA 2HVHA 1Z26A 4DFKA 3QNNA 2E5LK 4MLHA 4DV5K 1L3VA 2VQEK 4NCGA 2GWKA 2GELA 4FWRA 4HCBA 4OX9K 2NRVA 3U9DA 3O9UA 3HK2A 2VGNA 1RT4A 2O8EB 5J1EA 1DTQA 4WFBL 1YTAA 3K5OA 1DKGD 2CH5A 5GAEP 4N41A 3G0ZA 1NKEA 1A5XA 4ICLA 5DK5A 3TWHA 2XO7A 1ZBHA 3R3LA 3AGKA 4JK9A 3TAGA 3GOIA 1X9WA 4WQ5C 4N76A 1NGEA 3P83D 1RT6A 1NJYA 3SJHA 2BGGA 4EFHA 4I9LA 5FPEA 2Q97A 3SMSA 1T8EA 1YVUA 3A5LC 2WBNA 3L2RA 1VQ6N 2HW3A 5AQXA 1YTUA 3AA4A 2UXDK 3SPYA 4CEQA 5IT9O 3MEGA 1OVQA 4IFYA 5HP1A 1GLBG 4YFUA 1S1TA 4BR5A 4DQQA 2Q0UA 5M1PA 5AFUH 1B92A 2G8FA 1JLBA 3OYMA 5I3UA 4ISEA 3ITHA 3LP2A 2PBDA 1H1VA 4DTNA 2QWRA 1QE1A 2GX9A 4EP4A 3SV3A 2YHBA 2AA4A 3C6UA 3QLHA 4Z4IA 4ISGA 2ASOA 3DXMA 2G8VA 4B8AB 3NE6A 4E1MA 4CJTA 4KTZA 3HP6A 3PSIA 4FOIA 1KFDA 5BN8A 1SKWA 4BGAA 3VA3A 3OJUA 4CZLA 4E3SA 3HJFA 4CJ7A 3R8EA 3T1YK 3P1GA 3ATUA 4CGDA 4CGHA 3OW2M 2E8AA 4GNIA 4AHUA 1VQMN 1NJXA 1UOCA 5HBMA 4I7FA 1Q8IA 3MN7A 3LZJA 1VQNN 1ATNA 4AHSA 1QQOA 3TSPA 4CEAA 3THWA 3AA5X 3F9KA 4ZTJA 4F3OA 3D7EO 3CI5A 2P5OA 1KRPA 3RMAA 1W97L 1TUYA 3LWLA 4JLHA 4HWIA 3SAGA 3BP8A 4DR4K 4B3RK 3QFUA 4OPAA 1VQ9N 3V81A 3KZBA 3O6WA 1NJWA 4MDBA 4LH4A 2W00A 3T1AA 3EO3A 1SV5A 4M3YA 4EHUA 4CF2A 3EE9A 3OS0A 4E89A 3C6TA 3WXLA 4DFMA 2PYLA 4H0TB 2AJQA 1NK4A 1G99A 4H5RA 2OPPA 1WSIA 1D4XA 3VQ4A 2Q2RA 4BRNA 3HPHA 3VQCA 3E9OA 3K5LA 3ID8A 5DM7L 4DF4A 3E9LA 1QQMA 2WOMA 3VF2A 4CJRA 1NU0A 4GMJB 4GV6A 4JI4K 4CFAA 3MEDA 3WQUA 3CC2N 1QSYA 1KXPA 4M7YA 1QHAA 3MX5A 4KTWA 4GVEA 2XY7A 5M1NA 1MDUB 1OH7A 4OJRA 2P51A 3IDHA 1T05A 1HNIA 1NJIO 4FYDA 3AAQA 3MMVA 4BRCA 5I42A 3LPTA 1T3VA 1C0GA 3J7AP 3C65A 4DR2K 1XNQK 2QA4N 4OLAA 2Q36A 3H46O 4X65K 2HHSA 1LAWA 3MECA 2HHWA 4I6MA 4DS5A 1O13A 1HRHA 2F8SA 4JD2A 1U45A 4KB0A 2A40A 1CZAN 2FSJA 3EKUA 5SZTA 1R59O 1X9JA 1TAUA 3HL8A 3S9HA 1HYVA 2XHBA 3THXA 3DJCA 3DRPA 3ULEB 5GAGP 2D0CA 4BRIA 3FZHA 2RHKA 5TKWA 1B9FA 2B4JA 1BQMA 5J2MA 4HUGA 3HXMA 3SAHA 4BG8A 4O0IA 2QWOA 4H5NA 5BREA 4FM0A 3NAEA 4V19S 2PZSA 4KI4A 1FJGK 5C12A 1LV5A 2IC3A 3P38A 5AQSA 4B1YB 1IG9A 4DR1K 4IFEA 4KAZA 3TSUA 4Z4GA 2JLEA 4KHUA 3I0RA 2KHOA 4JRQA 1YUWA 2FC0A 1JLFA 4I9QA 3MEEA 1KSPA 4Z4CA 4KO0A 4ELTA 4PY5A 3KWGA 2V7YA 1EP4A 2ETJA 1HR0K 1TKTA 2Z1IA 4E0DA 3EKSA 3IUCA 4BR9A 3MXMA 1EXQA 4FZZA 5CE3A 2CGKA 4JN4A 2QWLA 2ZF5O 4LD0A 1VSFA 1Q9YA 4AILC 3THVA 3VQ5A 2O8CA 4W5QA 1JL1A 2W41A 4CE9A 2QKBA 3LALA 1BHLA 3RMDA 3S5TA 2Y1JA 2YHWA 1N6QA 2Q31A 4EAHD 4KH4A 1T44A 5AQZA 5AJ3K 3I56N 2YNGA 3VGKA 3WNEA 2ZQBA 5CHIA 4Z4EA 1QSLA 3OYBA 4BQLA 3A8YA 4ELVA 1RGIA 4NO7A 3THYB 2YNHA 4DTXA 2IOCA 3CD6N 2P9SB 3D6RA 3DRRA 3LDOA 1VSMA 3ID6A 4JYAK 2NRXA 1HYSA 1BG3A 4JI6K 2R7YA 2WTUA 3VF4A 1E4FT 1L5UA 2WC9A 5KI6A 1XHXA 3PX4A 1Q7YO 4CF1A 4FLWA 4J2AA 1TYQB 4DB3A 3H3NO 5AQGA 1EX4A 3U3GA 1YF5L 2A41A 4CW7B 1WSGA 5EOYA 5KGWA 4BR0A 2O4IA 4YDUC 2Y1IA 4FO0A 3KKRA 3PUFA 4JKGA 5C25A 5JICA 4HTUA 4CBWA 3EN9A 3QEWA 4PQUA 4Q0BA 2P9LB 4R79A 1T03A 3WNHA 4FWNA 2HNYA 4CJVA 3F73A 1ESVA 4N56A 1UA1A 2XY6A 1NM1A 1TUUA 2I7PA 4K43A 4B3OA 3NF7A 3CCJN 2ASPA 2ZJPL 2E20A 4JI2K 4G9ZA 3LAMA 4C1NI 3DOKA 3HPOA 1ZBLA 4MQ3A 3O9SA 4RTFD 3ZSRA 1D8YA 4J8FA 1Q86O 1RDUA 4J2EA 4U67L 1ZBUA 1OVYA 1WSEA 3BF3A 5AQWA 1A5VA 2YKMA 2I5JA 1S1VA 1TL1A 3DLKA 1C1AA 3C95A 4IG0A 1VQ5N 4JV5K 5AQYA 3UKRB 4O5BA 1J54A 3O3HA 1SAZA 3I33A 5FPDA 4IBNA 4M3TA 2CH6A 1VSHA 1BIZA 5BPMA 4LF9K 1N8RO 4CFCA 4H5TA 1LCUA 3OYEA 1VQON 4O4GA 4JNEA 2YX6A 2X74A 1S1UA 2XRIA 1YJWN 4AM6A 2RPIA 1QQNA 1NK5A 3IFRA 2KZMA 4X64K 4K42A 3QERA 1C1BA 3G4SN 1GOBA 1JXEA 4JKEA 4OKEA 2P9PA 4B8CA 4B1WB 5GAHP 4DFJA 4KHQA 2FF3B 5LJWA 1IH7A 1XMOK 4CIFA 5C24A 3FZFA 2HNDA 1RT5A 2UUAK 3QETA 2ATQA 3I8BA 4LFBK 5B8HA 3NFAA 4FW1A 4IOCL 4B1VA 1QVFM 2HBLA 2VG6A 3FZLA 4CBUA 5JVGL 3KK7A 1JKHA 1GLDG 1GLJO 3GL1A 4GW6A 5AQMA 5KTQA 3VEYA 3OYNA 4IOAL 1RBUA 3CIPA 3QBXA 3H1QA 1Z25A 5M1FA 2WFBA 3WXJA 2Q3SA 2H3GX 3WEEA 1L3SA 2BE2A 4Y0WA 1LWEA 1VSDA 4BY9C 1DT9A 5FDLA 3S3NA 2F8TA 1UA0A 1V4TA 1SS6A 2NRZA 4DTOA 4NYFA 4JKBA 3CC7N 2IS3A 4O0JA 2NRHA 3F5TA 1U04A 2P9SA 4BRDA 3OYFA 3ZX3A 4CK1A 3L2UA 3CCRN 4BR4A 3NMUA 3AVFA 3ZSZA 1XQSC 5AR0A 3RRGA 3VQ9A 2DY4A 1HUXA 2HMIA 3VPZA 4B1XB 4CJLA 4CZMA 1IJJA 3K0SA 3PSFA 3TI0A 3ZSWA 3DLHA 4LF4K 2VGMA 1TYQA 3DYAA 3CQXA 1MU2A 3L4IA 4IXCA 2Z1GA 3AO3A 4MO5A 1JJ2M 3ZETA 5AQRA 2F7TA 3C0BA 4DSKA 1KAYA 1JCEA 1JLAA 3KD5E 1ZXOA 2OZSA 3K58A 4E72A 3DWLA 2KFZA 4FK2A 1X3NA 1E4GT 1S9EA 2P9LA 4DV4K 4H0XB 4KHSA 1GLLO 5MLCQ 1XI1A 5C0YA 3QFPA 4JI3K 1N33K 3TPQA 1NGDA 1XHZA 3V6DA 3G71N 2E4LA 2YCHA 4FJXA 4Z4HA 3B8AX 4AF1A 5FPNA 3TU5A 1RDDA 4IFVA 3ZT4A 3OBYA 3SUOA 1WSFA 1VQKN 3VOVA 4OGEA 4BVPA 5HOOA 1NK9A 1K73O 1D9FA 1QZ5A 1WOQA 3QEVA 4CESA 4NCAA 1A5WA 4BROA 5LY3A 1TKZA 4PWDA 3HYFA 3HM8A 5BN9A 3O4WA 4BACA 3KLGA 1IKVA 4LF8K 1QVGM 2E2PA 1WB9A 4CZIA 1NGJA 5KPTA 3MK6A 4KKOA 4Z4FA 3G25A 2P9IA 4BECA 3VQDA 3WNGA 4BDPA 3TAPA 4M7XA 4GV9A 4CHPA 3HTVA 2A3ZA 2E1YA 2IVOA 4FSVA 4E1JA 4BE1A 2LSNA 4F2SA 4JKHA 2E88A 3QMLA 3F2KA 3E1YA 3NCIA 3M6GA 2GBZA 1RBRA 2O8BB 3SLCA 3V1QA 5LJVA 4CJ3A 1BCOA 3PIOL 3RMBA 3K57A 4DR3K 2G8HA 4JS5A 3O08A 1RT7A 5A2QO 3VN5A 3Q7BA 4H0OA 3PO4A 4WYBA 4Z0UA 3O3GA 4MDAA 3A5NC 1SUQA 1Q82O 1Y64A 4BRLA 3V9WA 1S1XA 5HLFA 3CG7A 1LOTB 1NLVA 4KFBA 1QTMA 3VQ8A 3SUNA 1GLFO 1R0AA 3NBPA 1VAZA 2KQ2A 2IIRA 2QW9A 3CJ1A 4B9TA 4FVMA 3DXKA 2QK9A 3AV9A 2FSNA 3NH0A 1K8AO 4XH5A 4FVUA 4K8XA 4CERA 3AO4A 3O3FA 2FBXA 3NGIA 3JXUA 4DTMA 4LY7A 4YNQA 3CETA 3EE8A 3AVNA 5KRSA 4CJUA 3KD1E 2YHAA 4HUFA 3H3OB 2BUPA 4IG3A 4CJEA 1MA9B 2HB5A 4CK3A 2VG7A 3O9TA 4AHRA 4CZEA 3W0LA 1JL2A 3GDQA 3A2FA 3HP9A 4OPJA 1RT3A 1S5JA 1SZ2A 3O8MA 5AQJA 4CGJA 4H5VA 4TSXA 3AARA 1NGAA 2W6KA 4IZ9A 4B9QA 4NYNA 4JRPA 1WBBA 2F9TA 1UWBA 5KPZA 5BRFA 1ASWA 4FJKA 3BEXA 3NGYA 3CCUN 1YIJN 3CYGA 4LFCK 5JLHA 3LP0A 5AZJB 1WN7A 4E7KA 4DSIA 2HNZA 3HOSA 5BPLA 1BQNA 1RILA 3AO1A 2ZGZA 3KJVA 3OYIA 2X6NA 3DLEA 2V51B 2Z1JA 4FWQA 4IO8A 1RT1A 2D0PA 3TABA 4JKAA 3N4PA 1BISA 2BDPA 2QWMA 4BRKA 1TKXA 4LSNA 3MN6A 1C0TA 3PO5A 3AVHA 1KVBA 3RR8A 2Q0RA 3HVTA 4GKJK 4FOEA 1HQEA 3OBWA 4ZHRA 4BE7B 1M1KO 1J9AA 3M1FA 5I9EB 4IDKA 3L2QA 4DV7K 4QS8A 4CGGA 2RE2A 4E1NA 1VSIA 3RMCA 3H08A 2DTUA 2PFUA 3CPEA 3VERA 1TVRA 4JK7A 3DI6A 4W5TA 1KVCA 3PX6A 3L3UA 2NZTA 1ASUA 1HKCA 3MDQA 3LP1A 4C8MA 1RTHA 2O8EA 4BE0A 3FZMA 3OA9A 3PIPL 1SKSA 1KFSA 1RBVA 4BQZA 2O8BA 1HPZA 2IGIA 3K2PA 4BRMA 1KAXA 3HSCA 4M3UA 2A6AA 3DAWA 2W6LA 1BU6O 1NBWA 1WSJA 4DU1A 5TKYA 5CZ1A 4AM7A 5JS1A 3BDPA 1UAXA 5C42A 3L2WA 3AVCA 3AVMA 1BWFO 1NGHA 1RDCA 3CCMN 1ILYA 3FFKB 1LWCA 1NNEA 1CXUA 1FKPA 1QHTA 2EWSA 1TGOA 4EZ6A 5E84A 3AO5A 3DOLA 3H1VX 5AZIB 4GV3A 2BANA 5KQ8A 2ZJRL 4AHCA 4E7JA 1ZC6A 2VWBA 2FXUA 4DLEA 1YAGA 4DV6K 1NK6A 1KLNA 4ID5A 3OYLA 5KQDA 4CHNA 2G8IA 2E6LA 3MWTA 3HZ6A 4CEBA 4RW6A 4E19A 4JI5K 1NG9A 3L8BA 4DV2K 1BIUA 1GOAA 3TARA 1CLQA 4FJHA 2V52B 2E1ZA 4B9VA 3KIOA 4M3WA 5DMRA 2QEXN 3WXKA 4CIGA 4KBOA 1KC8O 5F2RA 2DFEA 4O44A 4BVOA 3VENA 2D0BA 3SI6A 4WCEL 3CJBA 4H5WA 2RKIA 3L2VA 3CCVN 4KREA 3V9SA 3QDKA 2KW4A 2O4GA 3GBTA 4A5BA 1KCFA 3BGRA 3DRSA 3IAYA 5DM6L 1NOYA 2OPSA 4O55A 4C23A 1U47A 4A61A 5D3GA 4F8RA 3AY9A 3J8AA 4CJ4A 4B3TK 4IJAA 3T19A 4X62K 3VQAA 3LM9A 5FROA 5C2DA 4DSFA 3ASMA 3FFIA 4G1QA 5AQPA 4WFNL 4DV0K 1YJ9N 3EZ5A 4M3ZA 1U49A 3LP3A 4QS9A 3D0PA 3QESA 3D2FB 1C0MA 2P9KB 4I2PA 3VTIA 2A42A 4BE2A 4CHQA 3RWUA 2IVNA 3TANA 4CVNE 5F1XA 3VGLA 3L0QA 4A2BA 2YHYA 1WSHA 3ZX0A 3S3MA 4CJWA 4FJNA 4FWKA 3LPUA 1J53A 3SJJA 4BRAA 3CC4N 4QCLA 5AQLA 2IAJA 2UXCK 3WXIA 2QWQA 1T6DA 5KPRA 3VQBA 4WQ4C 3HOTA 1KTQA 4DTSA 3TSQA 1NMDA 3QEIA 4NB4A 4BC4A 1YI2N 4N47A 3NH2A 4OO1J 2GWJA 2DFFA 1VQLN 2F96A 4BC3A 1K8KB 2G8UA 1E3MA 4BRPA 1KVAA 3TTCA 1FXXA 1Q81O 3VQ6A 1VQ7N 2P9UB 4JEPA 4FL9A 4B9NA 1C6VA 2OANA 5SWMA 2HBKA 3O1BA 5JLFA 5KRTA 2QI2A 3I55N 4YOXA 2KTQA 4FJGA 4FXDA 1BGXT 5FPMA 3KK2A 4ILJA 3C6AA 4M45A 2BH1A 4JI1K 3KK3A 3WQTA 5GIPA 4FJLA 1KLMA 4FLTA 4K8ZA 1B9DA 3B6PA 4QAGA 1YHQN 3VA0A 4BDYA 4CJSA 4K25A 4BRGA 3NHGA 3VEVA 4CD3A 3WNFA 2UXBK 1X9SA 1OKJA 3BF1A 5FLXO 3ULEA 5GADP 5AQTA 4BRHA 4PKHA 3MCAB 4B9LA 1G15A 4LC9B 5BRHA 5GIOA 4R5PA 3TAQA 4KB1A 5EVZA 3NVKA 4CEDA 5JS2A 2HSTA 3NDKA 3IS9A 4DQRA 4DQ8A 1SL2A 3VMFB 3LAKA 1QQCA 3EEQA 4FCYA 1Q18A 3O80A 3VESA 3M8QA 3S41A 3QIPA 1N5YA 1IKXA 3QICA 4BWMA 4L8RB 3QB0A 1X3MA 1TV6A 3LDQA 5CYQA 4WFAL 4NXNK 4DTPA 3NH1A 5EXWA 3JYTA 1Q9XA 2HHUA 2HF4A 1JLGA 3AVAA 5E26A 1KAZA 1T6CA 3R9PA 3SBTA 1XNRK 4Q5VA 1NK7A 2HOEA 2O8FB 4CBXA 3K5NA 4KPYA 1YT3A 5CY4A 1REVA 4CZKA
chains in the Genus database with same CATH topology
1NGJA 2ASMA 3O1WA 3O5BA 3MK6A 4BRFA 3EO3A 5KPTA 2KKZA 4PKIA 3LDPA 3IMXA 5AZJA 4C1NK 3G25A 4EHUA 3UKUA 2P9IA 4BECA 3CJ7A 4M7XA 2VYPA 3EE9A 5ADXA 4GV9A 1YVNA 3WXLA 4CD1A 1NGBA 3HTVA 4H0TB 2A3ZA 2E1YA 2IVOA 4BC5A 1G99A 1S3XA 4FSVA 2P9NB 4E1JA 4H5RA 4A57A 4JKHA 3GG4A 2NLXA 2E88A 3QMLA 3KWIA 3F2KA 3WEEB 3VEZA 3E1YA 1D4XA 2Q2RA 4BRNA 2GTDA 2D1KA 3M6GA 3E9OA 3ID8A 5DM7L 3E9LA 2JWLA 3SLCA 1QQMA 5LJVA 3VF2A 5BPNA 1NGGA 4GV6A 3R6MA 3VF6A 3LM2A 3WQUA 3PIOL 3CC2N 1KXPA 3RSEB 4M7YA 1QHAA 3MX5A 4JHDA 3W3DA 4GVEA 3O08A 2QXLA 3O9QA 4FPAA 5M1NA 4FPBA 3LDNA 1MDUB 1KD1O 3Q7BA 3ZEUB 4H0OA 2D4WA 3IDHA 4WYBA 1BA1A 1RDWX 3FZKA 4FWOA 4MDAA 4CI6A 1NGIA 3A5NC 1HLUA 1NJIO 1GLEG 3L4QA 3AAQA 3MMVA 4BRCA 1Q82O 1Y64A 1T3VA 4BRLA 3ENOA 1C0GA 1C0FA 3CHWA 3MN5A 3RVCA 3M5RA 3C65A 1LOTB 1NLVA 4IDHA 2QA4N 4YOTA 3L6QA 1GLFO 2Q36A 3E9PA 3H46O 1JCFA 1VAZA 3CJ1A 2IIRA 2QW9A 3R1XA 1YJNN 1U6ZA 4I6MA 1O13A 2NRWA 3DXKA 4BR7A 4JD2A 1BA0A 3ZETB 2QM1A 2A40A 1HX1A 3WXMB 1IG8A 2FSNA 1K8AO 1CZAN 4XH5A 4FVUA 2FSJA 3VEWA 3EKUA 3UB5A 1R59O 1X9JA 4IOXA 4BRQA 3JXUA 4JKFA 1HKGA 3MN9A 4PHTX 3SBGA 3DJCA 3GE1A 3C6HA 5AQIA 3ULEB 5GAGP 3SAFA 3CETA 4BRIA 3FZHA 2RHKA 3EE8A 5TKWA 3ENBA 3NVMA 3UE5A 4A59A 2NRTA 4A2AA 3CCQN 4CZFA 3CMAN 3H3OB 3SAHA 2BUPA 4BG8A 2YHXA 2OTJN 1MA9B 1J6ZA 4M63C 3CCSN 3O9TA 2P9UA 2QWOA 4CZEA 3TTDA 3W0LA 3GDQA 2E2OA 4H5NA 5BREA 4UY8O 1QZ6A 1V4SA 3TTFA 3CJCA 1SZ2A 3MCPA 3O8MA 1NGFA 5C12A 4KH6A 5AQJA 3ZX2A 5AZIA 4YOUA 4H5VA 3P38A 5AQSA 4B1YB 5M1QA 4JKDA 4YOVA 3AARA 1EO1A 4IFEA 4IJNA 1NGAA 4IZ9A 3TSUA 4NLBA 3A5MC 5JMVA 4B9QA 3CQYA 2KHOA 1YUWA 4Z94A 2JWKA 4CZHA 2F9TA 3WUHA 4BGBA 5KPZA 3D2EA 5BRFA 1HPMA 3A5OC 3BEXA 4FWLA 3KWGA 2V7YA 3CCUN 1YIJN 2CGLA 4YOWA 3EKSA 1ZBSA 3IUCA 4L3QA 2V7ZA 3C7NB 4HTLA 4QS7A 4BR9A 5JLHA 2ZWHA 5AZJB 4O8UA 3PLAA 5C2FA 2DPNA 2P9IB 3HOSA 5CE3A 2CGJA 5ADXH 5BPLA 2CGKA 3FLCO 2NNWA 2QWLA 2ZF5O 4JN4A 4JKCA 3CJ9A 3VGMA 3UKRA 2ZGZA 4BREA 3O9RA 4YDUA 4PKGA 1HKBA 2V51B 4FWQA 4IO8A 5GINA 2UYTA 3FR0A 2D0PA 4JKAA 3N4PA 2QWMA 4BRKA 2W41A 3F9MA 4O8KA 5AQQA 1BOTO 4K41A 2D0OA 1U2VA 2YHWA 3MN6A 5F0XA 2Q31A 2Q0RA 4IEEA 4KH4A 4EAHD 1T44A 3K9KA 2C1IA 2GEMA 3H6EA 2HMPA 4FOEA 1YXQA 4KH5A 5AQZA 3G6EN 3U8XA 3I56N 3MWPA 3OBWA 1BO5O 3VGKA 3DLLL 4BE7B 3ENHA 3QBWA 5AQUA 5CHIA 5H1SQ 1M1KO 3M1FA 4NLCA 3A8YA 4BQLA 5I9EB 3CMEN 1RGIA 4QS8A 4NO7A 4O5FA 3ZYYX 5M1OA 2RE2A 3CD6N 2PFUA 2VCPA 3CPEA 3VERA 2C1GA 2P9SB 3D6RA 1VQ8N 1YITN 3LDOA 2GUPA 3ID6A 4JK7A 3D2FA 3H45C 2P9KA 4RCHA 2NRXA 4A62A 2NZTA 2OTLN 5AQOA 2W40A 1BG3A 2I7NA 4YOYA 4I6MB 1HKCA 3MDQA 2P9NA 3DXKB 4F9OA 4JD2B 3VF4A 1E4FT 2WC9A 1Z05A 3HI0A 5M1KA 4A5AA 4PL8A 1Q7YO 4CZGA 3FZMA 3OA9A 3PIPL 1TYQB 3EZWA 4DKWA 4BQZA 2IVPA 5C15A 4DB3A 3H3NO 5AQGA 4BRMA 1KAXA 4RWTA 4XJXA 3HSCA 1YF5L 3LDLA 2A6AA 2A41A 3DAWA 5EX5A 3CXCM 5JVHL 3U9ZA 3RSEA 5EOYA 1BU6O 1NBWA 4BR0A 1S22A 5TKYA 4YDUC 4FO0A 4AM7A 4IEIA 3VEXA 1KQSM 4JKGA 3DXMB 4ILHA 5JICA 3CCEN 2AP1A 4CBWA 3EN9A 1BWFO 3ZEUA 1NGHA 3FE1A 1ILYA 3CCMN 3M3ZA 4FWMA 3FFKB 2P9LB 3T69A 4R79A 5HL7L 2HBJA 4FWNA 1S72N 4GY2B 2WUSA 1ESVA 2EWSA 2QWPA 1K8KA 1NM1A 5E84A 2BTFA 1TUUA 2PAVA 3CERA 2I7PA 3H1VX 5AZIB 4GV3A 2A5XA 5KQ8A 4K43A 3SK3A 3SMPA 2ZJRL 1ZC6A 2VWBA 4EIAA 2FXUA 3CCJN 1YAGA 2ASPA 4H0YB 3EL2A 1P90A 3JS6A 3LL3A 2E20A 5AQVA 2ZJPL 1M90O 4G9ZA 4WF9L 4C1NI 1VQPN 2E2QA 3CJAA 5AFUA 2F9WA 1JCGA 5KQDA 1MWKA 3O9SA 4RTFD 3MWTA 3HZ6A 2J4RA 4U7BA 4J8FA 2FSKA 1Q86O 1RDUA 3IKMA 4FWSA 4U67L 2V52B 1OVYA 2E1ZA 4B1UB 3BF3A 4CZIA 5AQWA 3VTHA 2FF6A 4H03B 2QWNA 2QEXN 1DGKN 3WXKA 4KBOA 4H0VB 1EQYA 1KC8O 2NRRA 2ITMA 5F2RA 4FWPA 1MWMA 1VQ5N 1ATSA 5AQYA 5AQNA 3UKRB 3VETA 3A0IX 1SAZA 1BDGA 5EY4A 3VENA 4WQ4A 4BVOA 3I33A 5FPDA 2Q1NA 3KVGA 1RFQA 5AQKA 4MO4A 3UKUB 4WCEL 4B1ZA 1K9MO 3CJBA 4XH4A 4YORA 1P8ZA 5ELZA 4H5WA 3CCVN 2CH6A 3QDKA 4CZJA 5BPMA 3E66A 3GBTA 4XH1A 4A5BA 4JAXA 1N8RO 5DM6L 4H5TA 1LCUA 4C23A 1VQON 4A61A 1XC3A 3AY9A 5CR4A 4JNEA 3J8AA 2YX6A 5BRDA 1WUAA 4IJAA 1BUPA 1YJWN 4AM6A 2ZJQL 1QQNA 3IFRA 3P39A 3ATVA 3P31A 4K42A 1XUPO 2QTDA 5AQHA 1GLAG 3LM9A 5C2DA 5AQPA 4JHDB 4WFNL 3WT0A 3G4SN 1Z6RA 1NWKA 4JKEA 1YJ9N 3C7NA 4H0PA 2P9PA 3HRGA 4B1WB 4IO9L 5GAHP 4DCHA 4EHTA 2FF3B 4QS9A 5LJWA 3D2FB 2HF3A 2P9KB 3FZFA 4MLHA 3I8BA 3VTIA 2A42A 5B8HA 2HBMA 4OPHA 2E2NA 3Q7CA 4IOCL 2GWKA 2GELA 4FWRA 3U4LA 4B1VA 2HBLA 1QVFM 2NRVA 3FZLA 2IVNA 3U9DA 4CBUA 5JVGL 5F1XA 3VGLA 3KK7A 3O9UA 2VGNA 3L0QA 4MLEA 4A2BA 2YHYA 1GLDG 1GLJO 3GL1A 3ZX0A 5AQMA 4IOAL 3VEYA 4WFBL 4FWKA 3CIPA 1DKGD 2CH5A 5GAEP 3QBXA 3H1QA 4BRAA 5M1FA 3CC4N 2WFBA 5AQLA 3R3LA 3WXJA 3WXIA 3AGKA 2QWQA 2H3GX 4JK9A 1T6DA 3WEEA 5KPRA 3GOIA 4WQ5C 1NGEA 2YJEA 4WQ4C 4Y0WA 3HOTA 3TSQA 3SJHA 4BY9C 1DT9A 4JKGB 4EFHA 5FPEA 1NMDA 5C10A 4BG9A 1W2BM 2Q97A 4NB4A 3SMSA 1HJOA 1V4TA 1SS6A 2NRZA 3A5LC 4BC4A 1YI2N 4JKBA 4OO1J 2WBNA 3CC7N 1SQKA 2GWJA 1VQ6N 2KLAA 5AQXA 4PL7A 3J7ZO 1VQLN 4BC3A 1K8KB 2NRHA 3F5TA 5AQFA 4BRPA 2P9SA 1GLCG 3AAPA 4BRDA 3TTCA 1Q81O 1VQ7N 3ZX3A 4XEIA 4IWVA 2P9UB 3CCRN 4JEPA 4ILGB 4BR4A 4FL9A 3NMUA 1GLBG 2OANA 2HBKA 4BEBA 1XQSC 3O1BA 5AR0A 4BR5A 2QI2A 5JLFA 4YOXA 3I55N 1HUXA 2Q0UA 5M1PA 5AFUH 3VPZA 4B1XB 2FLOA 4CZMA 1IJJA 5FPMA 4ILJA 3CF5L 2VGMA 1TYQA 1ATRA 3C6AA 4ISEA 2BH1A 3CQXA 3WQTA 5GIPA 2PBDA 2YJFA 3L4IA 4IXCA 1H1VA 4MO5A 3T7ZA 1JJ2M 4BC2A 3ZETA 2QWRA 5AQRA 2F7TA 2GX9A 3C0BA 1KAYA 1YHQN 3D2EB 1JCEA 1VQ4N 2AA4A 4K25A 4BRGA 1ZXOA 3VEVA 4CD3A 3N4QA 4ISGA 2ASOA 3DWLA 1OKJA 3BF1A 3DXMA 3OHRA 4DHYA 1X3NA 1E4GT 3ULEA 5GADP 5AQTA 4BRHA 4PKHA 2P9LA 5BR9A 3MCAB 4FOIA 5BN8A 4LC9B 3BUZB 4H0XB 5BRHA 5GIOA 1GLLO 3CCLN 5MLCQ 4BGAA 2YI1A 5EVZA 3NVKA 3KHYA 2HSTA 5C0YA 3QFPA 3AGRA 4CZLA 3TPQA 4DQ8A 4CJ7A 1NGDA 3R8EA 3VMFB 3ATUA 4WQ5A 3K9JA 3MX2A 3OW2M 2E8AA 1Q18A 3O80A 2YCHA 4GNIA 3VESA 1NGCA 3G71N 1VQMN 3S41A 3HBTA 3B8AX 4AF1A 5FPNA 3QICA 4ISFA 3QB0A 3TU5A 1X3MA 4BR2A 3MN7A 3OBYA 1VQNN 3LDQA 4WFAL 1ATNA 1DEJA 3FGUA 1VQKN 3VOVA 4BVPA 1QQOA 3TSPA 5HOOA 1K73O 5EXWA 1QZ5A 1U2VB 1WOQA 3D7EO 2HF4A 3CI5A 5E26A 4BROA 1KAZA 1T6CA 3R9PA 3SBTA 1W97L 1TUYA 5LY3A 3HM8A 4HWIA 5BN9A 3O4WA 3VEOA 3SAGA 2P9PB 3BP8A 2HOEA 3QFUA 4OPAA 1VQ9N 3KZBA 4CBXA 1QVGM 3O6WA 2E2PA 3P4IA 4JK8A 4MDBA 3CPWM 2W00A 2ZGYA 4CZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGJ A;  2ASM A;  3O1W A;  3O5B A;  3MK6 A;  4BRF A;  3EO3 A;  5KPT A;  4PKI A;  3LDP A;  3IMX A;  5AZJ A;  3G25 A;  4EHU A;  3UKU A;  2P9I A;  3CJ7 A;  4M7X A;  2VYP A;  5ADX A;  1YVN A;  3WXL A;  4CD1 A;  1NGB A;  3HTV A;  4H0T B;  2A3Z A;  2E1Y A;  2IVO A;  4BC5 A;  1G99 A;  1S3X A;  4FSV A;  2P9N B;  4E1J A;  4H5R A;  3GG4 A;  2NLX A;  2E88 A;  3QML A;  3WEE B;  3VEZ A;  1D4X A;  2Q2R A;  4BRN A;  2GTD A;  2D1K A;  3M6G A;  3ID8 A;  3SLC A;  1QQM A;  5LJV A;  3VF2 A;  5BPN A;  1NGG A;  3R6M A;  3VF6 A;  3LM2 A;  3WQU A;  1KXP A;  3RSE B;  4M7Y A;  1QHA A;  4JHD A;  3W3D A;  3O08 A;  2QXL A;  4FPA A;  4FPB A;  3LDN A;  1MDU B;  3ZEU B;  4H0O A;  2D4W A;  3IDH A;  4WYB A;  1BA1 A;  3FZK A;  1RDW X;  4FWO A;  4CI6 A;  1NGI A;  3A5N C;  1HLU A;  1GLE G;  3AAQ A;  3MMV A;  4BRC A;  1Y64 A;  4BRL A;  3ENO A;  1C0G A;  1C0F A;  3CHW A;  3MN5 A;  1LOT B;  1NLV A;  3L6Q A;  1GLF O;  2Q36 A;  3H46 O;  1JCF A;  3CJ1 A;  2IIR A;  2QW9 A;  1U6Z A;  4I6M A;  3DXK A;  4BR7 A;  4JD2 A;  1BA0 A;  3ZET B;  2QM1 A;  2A40 A;  1HX1 A;  1IG8 A;  2FSN A;  1CZA N;  4XH5 A;  2FSJ A;  3VEW A;  3EKU A;  3UB5 A;  1R59 O;  1X9J A;  4BRQ A;  3JXU A;  1HKG A;  3MN9 A;  3DJC A;  3GE1 A;  5AQI A;  3ULE B;  3CET A;  4BRI A;  3FZH A;  3UE5 A;  4A2A A;  4CZF A;  3H3O B;  2BUP A;  4BG8 A;  2YHX A;  1MA9 B;  1J6Z A;  4M63 C;  2P9U A;  2QWO A;  4CZE A;  3W0L A;  3GDQ A;  2E2O A;  4H5N A;  5BRE A;  1QZ6 A;  1V4S A;  3CJC A;  1SZ2 A;  3MCP A;  3O8M A;  1NGF A;  5AQJ A;  3ZX2 A;  5AZI A;  4H5V A;  4B1Y B;  5AQS A;  3AAR A;  4IJN A;  1NGA A;  4IZ9 A;  3A5M C;  5JMV A;  4B9Q A;  3CQY A;  2KHO A;  1YUW A;  4Z94 A;  4CZH A;  2F9T A;  3WUH A;  4BGB A;  5KPZ A;  3D2E A;  5BRF A;  1HPM A;  3A5O C;  3BEX A;  4FWL A;  2V7Y A;  2CGL A;  3EKS A;  1ZBS A;  3IUC A;  4L3Q A;  2V7Z A;  3C7N B;  4HTL A;  4QS7 A;  4BR9 A;  5JLH A;  2ZWH A;  5AZJ B;  2DPN A;  2P9I B;  5CE3 A;  2CGJ A;  5ADX H;  5BPL A;  2CGK A;  3FLC O;  4JN4 A;  2QWL A;  2ZF5 O;  3VGM A;  3CJ9 A;  3UKR A;  2ZGZ A;  4BRE A;  4YDU A;  4PKG A;  1HKB A;  2V51 B;  4FWQ A;  4IO8 A;  2UYT A;  3FR0 A;  2D0P A;  2QWM A;  4BRK A;  2W41 A;  3F9M A;  4O8K A;  5AQQ A;  1BOT O;  4K41 A;  2D0O A;  1U2V A;  2YHW A;  3MN6 A;  5F0X A;  2Q31 A;  2Q0R A;  4EAH D;  1T44 A;  2GEM A;  3H6E A;  2HMP A;  4FOE A;  1YXQ A;  5AQZ A;  3U8X A;  1BO5 O;  3VGK A;  3ENH A;  3QBW A;  5AQU A;  3M1F A;  4BQL A;  3A8Y A;  5I9E B;  1RGI A;  4QS8 A;  4NO7 A;  4O5F A;  2VCP A;  3VER A;  2P9S B;  3LDO A;  2GUP A;  3D2F A;  3H45 C;  2P9K A;  4RCH A;  4A62 A;  2NZT A;  5AQO A;  2W40 A;  1BG3 A;  2I7N A;  4I6M B;  1HKC A;  3MDQ A;  2P9N A;  3DXK B;  4F9O A;  4JD2 B;  3VF4 A;  1E4F T;  1Z05 A;  3HI0 A;  4PL8 A;  4CZG A;  3FZM A;  1TYQ B;  3EZW A;  4BQZ A;  2IVP A;  4DB3 A;  3H3N O;  5AQG A;  4BRM A;  1KAX A;  4RWT A;  3HSC A;  3LDL A;  2A6A A;  2A41 A;  3DAW A;  5EX5 A;  3U9Z A;  3RSE A;  5EOY A;  1BU6 O;  1NBW A;  4BR0 A;  1S22 A;  5TKY A;  4YDU C;  4FO0 A;  4AM7 A;  3VEX A;  3DXM B;  5JIC A;  2AP1 A;  4CBW A;  3EN9 A;  1BWF O;  3ZEU A;  1NGH A;  3FE1 A;  3M3Z A;  4FWM A;  3FFK B;  2P9L B;  4FWN A;  4GY2 B;  2WUS A;  1ESV A;  2EWS A;  2QWP A;  1K8K A;  1NM1 A;  5E84 A;  2BTF A;  1TUU A;  2PAV A;  3CER A;  2I7P A;  3H1V X;  5AZI B;  2A5X A;  5KQ8 A;  4K43 A;  3SK3 A;  3SMP A;  1ZC6 A;  2VWB A;  4EIA A;  2FXU A;  1YAG A;  2ASP A;  4H0Y B;  3EL2 A;  3JS6 A;  3LL3 A;  5AQV A;  2E20 A;  2E2Q A;  3CJA A;  5AFU A;  2F9W A;  1JCG A;  5KQD A;  1MWK A;  4RTF D;  3HZ6 A;  2J4R A;  4J8F A;  2FSK A;  4FWS A;  2V52 B;  2E1Z A;  4B1U B;  3BF3 A;  4CZI A;  5AQW A;  2FF6 A;  4H03 B;  2QWN A;  1DGK N;  3WXK A;  4KBO A;  4H0V B;  1EQY A;  2ITM A;  5F2R A;  4FWP A;  1MWM A;  1ATS A;  5AQY A;  5AQN A;  3UKR B;  3VET A;  3A0I X;  1SAZ A;  1BDG A;  5EY4 A;  3VEN A;  4WQ4 A;  4BVO A;  3I33 A;  5FPD A;  2Q1N A;  3KVG A;  1RFQ A;  5AQK A;  4MO4 A;  3UKU B;  4B1Z A;  3CJB A;  4XH4 A;  1P8Z A;  5ELZ A;  4H5W A;  2CH6 A;  3QDK A;  4CZJ A;  5BPM A;  3GBT A;  4XH1 A;  4JAX A;  4H5T A;  1LCU A;  4C23 A;  4A61 A;  1XC3 A;  3AY9 A;  4JNE A;  3J8A A;  5BRD A;  1WUA A;  4IJA A;  1BUP A;  4AM6 A;  1QQN A;  3IFR A;  3ATV A;  4K42 A;  1XUP O;  5AQH A;  1GLA G;  3LM9 A;  5AQP A;  4JHD B;  3WT0 A;  1Z6R A;  1NWK A;  3C7N A;  4H0P A;  2P9P A;  4B1W B;  4DCH A;  4EHT A;  2FF3 B;  4QS9 A;  5LJW A;  3D2F B;  2HF3 A;  2P9K B;  3FZF A;  4MLH A;  3I8B A;  2A42 A;  5B8H A;  2E2N A;  2GWK A;  2GEL A;  4FWR A;  3U4L A;  4B1V A;  3FZL A;  2IVN A;  3U9D A;  4CBU A;  5F1X A;  3VGL A;  3L0Q A;  4MLE A;  4A2B A;  2YHY A;  1GLD G;  1GLJ O;  3GL1 A;  3ZX0 A;  5AQM A;  3VEY A;  4FWK A;  3CIP A;  1DKG D;  2CH5 A;  3QBX A;  3H1Q A;  4BRA A;  5AQL A;  3WXJ A;  3WXI A;  2QWQ A;  2H3G X;  3WEE A;  1T6D A;  5KPR A;  3GOI A;  4WQ5 C;  1NGE A;  2YJE A;  4WQ4 C;  4Y0W A;  3SJH A;  4EFH A;  5FPE A;  1NMD A;  4BG9 A;  2Q97 A;  4NB4 A;  3SMS A;  1HJO A;  1V4T A;  4BC4 A;  3A5L C;  1SQK A;  2GWJ A;  5AQX A;  4PL7 A;  4BC3 A;  1K8K B;  2NRH A;  5AQF A;  4BRP A;  2P9S A;  1GLC G;  3AAP A;  4BRD A;  3ZX3 A;  4XEI A;  4IWV A;  2P9U B;  4BR4 A;  4FL9 A;  1GLB G;  2OAN A;  1XQS C;  3O1B A;  5AR0 A;  4BR5 A;  5JLF A;  1HUX A;  2Q0U A;  5AFU H;  3VPZ A;  4B1X B;  2FLO A;  4CZM A;  1IJJ A;  5FPM A;  1TYQ A;  1ATR A;  4ISE A;  3CQX A;  3WQT A;  2PBD A;  2YJF A;  3L4I A;  4IXC A;  1H1V A;  4MO5 A;  4BC2 A;  3ZET A;  2QWR A;  5AQR A;  3C0B A;  1KAY A;  3D2E B;  1JCE A;  2AA4 A;  4K25 A;  4BRG A;  1ZXO A;  3VEV A;  4CD3 A;  4ISG A;  2ASO A;  3DWL A;  1OKJ A;  3BF1 A;  3DXM A;  3OHR A;  4DHY A;  1X3N A;  1E4G T;  3ULE A;  5AQT A;  4BRH A;  4PKH A;  2P9L A;  5BR9 A;  4FOI A;  5BN8 A;  4LC9 B;  3BUZ B;  4H0X B;  5BRH A;  1GLL O;  4BGA A;  2YI1 A;  5EVZ A;  3KHY A;  3QFP A;  4CZL A;  3TPQ A;  4DQ8 A;  4CJ7 A;  1NGD A;  3R8E A;  3ATU A;  4WQ5 A;  2E8A A;  1Q18 A;  3O80 A;  2YCH A;  4GNI A;  3VES A;  1NGC A;  3S41 A;  3HBT A;  3B8A X;  5FPN A;  3QIC A;  4ISF A;  3QB0 A;  3TU5 A;  1X3M A;  4BR2 A;  3MN7 A;  3LDQ A;  1ATN A;  1DEJ A;  3FGU A;  3VOV A;  4BVP A;  1QQO A;  5EXW A;  1QZ5 A;  1U2V B;  1WOQ A;  3D7E O;  2HF4 A;  3CI5 A;  5E26 A;  4BRO A;  1KAZ A;  1T6C A;  3R9P A;  1TUY A;  5LY3 A;  3HM8 A;  4HWI A;  5BN9 A;  3O4W A;  3VEO A;  2P9P B;  3BP8 A;  2HOE A;  3QFU A;  3KZB A;  4CBX A;  3O6W A;  2E2P A;  3P4I A;  2ZGY A;  4CZK A; 
#chains in the Genus database with same CATH topology
 3O1W A;  3O5B A;  3ZSO A;  2KKZ A;  4DTR A;  3LDP A;  3IMX A;  2UUC K;  4C1N K;  4CHY A;  3CJ7 A;  4H8K A;  4KI6 A;  4ID1 A;  5ADX A;  1NMN A;  1YVN A;  1CXQ A;  3OYJ A;  1NGB A;  3CYM A;  1NKB A;  4FK4 A;  2KZZ A;  1S3X A;  3ISN C;  3GG4 A;  3V4I A;  4JI8 K;  2NLX A;  4DUY K;  3KWI A;  1QSS A;  4KHW A;  2YNF A;  1RTI A;  3VQ7 A;  1TAQ A;  4NCB A;  2JWL A;  4OKK A;  4DV3 K;  4M3R A;  3MXI A;  5HRP A;  3R6M A;  4RW7 A;  1BCM A;  4DQP A;  3VF6 A;  3LM2 A;  3P5J A;  3J81 O;  4F4K A;  3SUP A;  1LAV A;  3W3D A;  3RTV A;  2QXL A;  3O9Q A;  4FPA A;  3ZSV A;  3UIQ A;  3D45 A;  3U3Y A;  1OH8 A;  1NOZ A;  4KHP K;  1EET A;  3FZK A;  4FWO A;  1NGI A;  3THY A;  3M5R A;  1HNW K;  2X6S A;  3CFP A;  1IBM K;  3L6Q A;  5IWA K;  4K0K K;  1JCF A;  3ZT0 A;  1TKD A;  1YJN N;  1U6Z A;  4BWJ A;  2NRW A;  3OYG A;  2ZM6 K;  4BR7 A;  3WXM B;  1HX1 A;  1WAJ A;  2HHH K;  3VEW A;  3UB5 A;  1RBS A;  4PHT X;  1HKG A;  2UUB K;  2UU9 K;  3GE1 A;  1S9G A;  4E7H A;  2VQF K;  3ENB A;  3NVM A;  2OPR A;  3UE5 A;  4A2A A;  3CCQ N;  4CZF A;  4AHV A;  3CMA N;  2B6A A;  2YHX A;  3CCS N;  2P9U A;  4CIE A;  2F4V K;  2ZD1 A;  4UY8 O;  4CF9 A;  4KHY A;  4FZY A;  1V4S A;  3CJC A;  3MCP A;  3K5M A;  1NGF A;  1SKR A;  2P5G A;  5M1Q A;  4JKD A;  4DF8 A;  1IBK K;  1EO1 A;  1XWL A;  4IJN A;  2E6M A;  4DQI A;  1LW2 A;  4CJQ A;  2EHG A;  3SPZ A;  3SQ4 A;  5J2P A;  5T7B A;  1EWQ A;  3NF6 A;  2QKK A;  3RRH A;  4BGB A;  1HPM A;  4KV8 A;  4FWL A;  3DM2 A;  2CGL A;  3O4N A;  4CJ5 A;  1LW0 A;  2V7Z A;  3C7N B;  2ZWH A;  3PLA A;  1FKO A;  5ADX H;  3BZC A;  3ZCM A;  3FLC O;  5J2N A;  2NNW A;  3VGM A;  4JKC A;  3CJ9 A;  3UKR A;  4BRE A;  3PX0 A;  3O9R A;  4CHO A;  4YDU A;  4FLY A;  5GIN A;  2UYT A;  3DLG A;  5AQQ A;  1NKC A;  4O8K A;  1JLC A;  3CM5 A;  4AQY K;  4LF6 K;  1BOT O;  4OLB A;  3AA2 A;  2D0O A;  3BY5 A;  1K6Y A;  4C8O A;  3AVL A;  1TK8 A;  3OVN A;  2C1I A;  4Y1C A;  4B3M K;  3H6E A;  4CGF A;  4KH5 A;  1YXQ A;  3CM6 A;  5HRN A;  3VQE A;  1BO5 O;  3ENH A;  5H1S Q;  3TR8 A;  4PUO A;  3PY8 A;  4CHZ A;  4DMN A;  3AA3 A;  4O5F A;  1IBL K;  4B9U A;  3J80 O;  4HHT A;  4FLZ A;  4AHT A;  2VCP A;  2C1G A;  1VHX A;  3JAM O;  3ZLJ A;  1VQ8 N;  1YIT N;  4HUE A;  4A62 A;  5HRO A;  5AQO A;  2W40 A;  2I7N A;  4YOY A;  4I6M B;  3QEP A;  5HRR A;  3SV4 A;  4FLU A;  4F9O A;  4JD2 B;  4J2D A;  5M1K A;  3HI0 A;  3K59 A;  4OGC A;  4CZG A;  4DTU A;  1LWF A;  1C1C A;  3EZW A;  4CFD A;  3J7Y P;  4HCC A;  4RW4 A;  3THX B;  3NF8 A;  4DQS A;  4RWT A;  4XJX A;  3LDL A;  5EX5 A;  3CXC M;  5JVH L;  2XY5 A;  2G8W A;  3L3V A;  3QO9 A;  4IEI A;  3VEX A;  4ILH A;  3CCE N;  2AP1 A;  3HPG A;  3FE1 A;  3M3Z A;  4CEE A;  3T69 A;  5HL7 L;  3EYZ A;  2DFH A;  4CJK A;  3NGZ A;  3RR7 A;  1S72 N;  4GY2 B;  4PA1 A;  2QWP A;  2BTF A;  3CER A;  2PAV A;  3TAF A;  3SK3 A;  3SMP A;  3CQ8 A;  2PYJ A;  3DMJ A;  4H0Y B;  4B9M A;  3JS6 A;  3LL3 A;  5AQV A;  3TAM A;  3LWM A;  3ZSQ A;  2E2Q A;  2F9W A;  3U6F A;  5CYM A;  4Y1D A;  4XIU A;  4U7B A;  4RW9 A;  2VWJ A;  4JI0 K;  4DS4 A;  1VRT A;  4FJJ A;  1OH6 A;  3NF9 A;  4B1U B;  2OZM A;  3VTH A;  2FF6 A;  2QWN A;  1S6P A;  1ZBF A;  1EQY A;  4LF5 K;  2ITM A;  4ZTF A;  1ATS A;  5AQN A;  3C94 A;  5K14 A;  1BDG A;  4DTJ A;  1JLE A;  1RFQ A;  3KVG A;  3UKU B;  4AH9 A;  2O8C B;  4B1Z A;  4YOR A;  1P8Z A;  4H4O A;  4CFB A;  5ELZ A;  3OTO K;  4CZJ A;  1GOC A;  3E66 A;  4XH1 A;  4JAX A;  3E01 A;  2RF2 A;  1HJR A;  1QS4 A;  1HQU A;  2FBT A;  1HNV A;  4NXM K;  4FJI A;  5CR4 A;  5CZ2 A;  5BRD A;  1JXB A;  1WUA A;  4FLV A;  5BR8 K;  1BUP A;  3SYZ A;  2ZJQ L;  4M3X A;  1ASV A;  2B5J A;  3P39 A;  3ATV A;  1XUP O;  2YV0 X;  3OYC A;  2VWK A;  1GLA G;  4JHD B;  4QOZ B;  1Z6R A;  1NWK A;  3C7N A;  3HRG A;  4DCH A;  1WBD A;  2HF3 A;  1WAF A;  2HBM A;  4OPH A;  2E2N A;  3Q7C A;  1ZBI A;  3U4L A;  1CZ9 A;  3VQP A;  4YY3 K;  4MLE A;  3KLF A;  1VSJ A;  4F2R A;  2ITG A;  3VQQ A;  4JI7 K;  4CJP A;  2RN2 A;  5FRM A;  2YJE A;  4JKG B;  5C10 A;  4BG9 A;  1W2B M;  3V9X A;  1HJO A;  1TL3 A;  3OJS A;  3G10 A;  3IG1 A;  1SQK A;  2KLA A;  4DU3 A;  4PL7 A;  3J7Z O;  4GKK K;  4C8N A;  5AQF A;  1GLC G;  3AAP A;  4FJ7 A;  4XEI A;  4IWV A;  1BI4 B;  2XY8 A;  4ILG B;  4X66 K;  3OS2 A;  1EWR A;  4BEB A;  2EX3 A;  1VSE A;  2FLO A;  4RW8 A;  1IO2 A;  3TAE A;  3BZK A;  3CF5 L;  1VRU A;  1J5O A;  1ATR A;  2HHV A;  4CF8 A;  4F3T A;  2YJF A;  3SNN A;  3T7Z A;  3HST B;  4BC2 A;  4CJF A;  5LMN K;  3SQ1 A;  1ITG A;  1D9D A;  3AVJ A;  3D2E B;  1VQ4 N;  4DLG A;  3N4Q A;  2IDO A;  2G8K A;  3OHR A;  4DHY A;  5FRN A;  5BR9 A;  1VSL A;  3BUZ B;  1RDB A;  3CCL N;  5KGX A;  2QXF A;  2YI1 A;  3KHY A;  3AGR A;  2D5R A;  4WQ5 A;  4DG1 A;  3K9J A;  3MX2 A;  4FLX A;  1NGC A;  3HBT A;  3I0S A;  4ISF A;  4M42 A;  3AO2 A;  4OVL A;  4BR2 A;  1Y97 A;  3OYK A;  1DEJ A;  3FGU A;  3MAQ A;  4KHN A;  1OH5 A;  1U2V B;  4FJM A;  1RCH A;  1IV0 A;  3IRX A;  4FJ5 A;  5LMU K;  3VEO A;  2P9P B;  4C8K A;  3ALY A;  4WE1 A;  3P4I A;  4JK8 A;  3CPW M;  3V9U A;  1RDA A;  1N36 K;  2ZGY A;  2ASM A;  4BRF A;  4OPK A;  3V9Z A;  4PKI A;  5AZJ A;  3UKU A;  4W5O A;  2VYP A;  4CD1 A;  1S6Q A;  4DSL A;  4ELU A;  3QNO A;  4BC5 A;  2P9N B;  4A57 A;  4FW2 A;  5LL6 Z;  3WEE B;  3VEZ A;  3DLB A;  2GTD A;  2D1K A;  3JSM A;  4DR6 K;  1O1W A;  3AVG A;  5BPN A;  1NGG A;  4W5R A;  2NUB A;  3RSE B;  4JHD A;  2OPQ A;  1WLJ A;  4FPB A;  3LDN A;  1KD1 O;  1RTJ A;  3ZEU B;  4JS4 A;  2D4W A;  3KK1 A;  1BA1 A;  4YHH K;  1RDW X;  4CK2 A;  4CI6 A;  1HLU A;  1GLE G;  3L4Q A;  3KLI A;  3ENO A;  1C0F A;  3CHW A;  3MN5 A;  3RVC A;  1J5E K;  3QIO A;  4IDH A;  4UQG A;  2PY5 A;  1N32 K;  1U4B A;  4YOT A;  5EU7 A;  4CEC A;  2P1J A;  3M8S A;  3E9P A;  3AVI A;  4IKF A;  4DSJ A;  3R1X A;  4B9S A;  3AVB A;  1NJZ A;  4CGI A;  1BA0 A;  3ZET B;  2QM1 A;  4KTQ A;  3OY9 A;  1U48 A;  1RTD A;  1I3A A;  1IG8 A;  2W42 A;  4IOX A;  4BRQ A;  1T7P A;  3S3O A;  4JKF A;  3MN9 A;  3SBG A;  4DU4 A;  3C6H A;  5AQI A;  3SAF A;  3EY1 A;  1W7A A;  4MFB A;  2OCE A;  3T1H K;  4A59 A;  1XC9 A;  3M8P A;  3LZI A;  2NRT A;  2A1R A;  4FJ8 A;  4FM1 A;  4DUZ K;  2OTJ N;  4M63 C;  1J6Z A;  4J2B A;  3I8D A;  3KKS A;  1BI4 A;  3ZSX A;  3TTD A;  2E2O A;  3OS1 A;  1QZ6 A;  2WON A;  4CEF A;  3SZ2 A;  4B3S K;  3TTF A;  3ULD A;  4RG8 A;  4GVM A;  1D5A A;  4KH6 A;  1I39 A;  3ZX2 A;  5AZI A;  1HYZ A;  4YOU A;  4YOV A;  5J2Q A;  1HNZ K;  2O8D B;  3M8R A;  4NLB A;  3A5M C;  2OA8 A;  5JMV A;  1IKY A;  3CQY A;  4EP5 A;  2HHI A;  4Z94 A;  2JWK A;  4CZH A;  4B08 A;  3WUH A;  3D2E A;  3KLH A;  2JGU A;  3ZT1 A;  3A5O C;  1BL3 A;  3OYA A;  2OYQ A;  3DLR A;  4YOW A;  1ZBS A;  4L3Q A;  4HTL A;  4QS7 A;  4O8U A;  5C2F A;  1W0H A;  2DPN A;  2P9I B;  3HO1 A;  3ZSY A;  2CGJ A;  4I2Q A;  2VG5 A;  3LDS A;  1VSK A;  2GUI A;  2FBV A;  4PKG A;  1HKB A;  3OYD A;  1WNS A;  3FR0 A;  3QIN A;  1DTT A;  3F9M A;  2HHQ A;  3QEX A;  4K41 A;  1U2V A;  1SL1 A;  1TK5 A;  4FZX C;  1NK0 A;  5F0X A;  4KRF A;  4IEE A;  3K9K A;  2GEM A;  2HMP A;  5HRS A;  3G6E N;  3U8X A;  1FW6 A;  3MWP A;  3DLL L;  2X78 A;  5AQU A;  3QBW A;  1RT2 A;  3KTQ A;  3HVR A;  4NLC A;  3B6O A;  4DSE A;  3CME N;  3ZYY X;  5M1O A;  4DR7 K;  4H4M A;  3MXJ A;  2GUP A;  3D2F A;  3H45 C;  2YNI A;  3LAN A;  2P9K A;  4RCH A;  4FM2 A;  4LH5 A;  2OTL N;  2KFN A;  2P9N A;  3DXK B;  4E7I A;  4FJ9 A;  1Z05 A;  3HT3 A;  1RNH A;  4A5A A;  4PL8 A;  2HVI A;  1TK0 A;  3O4Q A;  1L3T A;  2HHX A;  4HVJ A;  4CCH A;  4DKW A;  3V1O A;  2FBY A;  2IVP A;  3ZT2 A;  5C15 A;  4EZ9 A;  4LF7 K;  2Z1H A;  3U9Z A;  3RSE A;  1RBT A;  1S22 A;  1SL0 A;  1KQS M;  3DXM B;  3KLE A;  3ZEU A;  1C0U A;  3AVK A;  4FWM A;  1XMQ K;  2HBJ A;  4OKJ A;  2WUS A;  3CFR A;  4LFA K;  3HM9 A;  4DR5 K;  1K8K A;  1JLQ A;  2A5X A;  2YKN A;  4EIA A;  2HHT A;  1FK9 A;  4BDZ A;  2D0A A;  1P90 A;  3EL2 A;  1M90 O;  4WF9 L;  1VQP N;  3CJA A;  5AFU A;  1DLO A;  1JCG A;  1CZB A;  4M41 A;  3V1R A;  1MWK A;  3SUQ A;  3THW B;  1X1P A;  2A1S A;  2J4R A;  5E41 A;  2FSK A;  4LSL A;  4CF0 A;  4DV1 K;  1W9H A;  3IKM A;  4FWS A;  1VK0 A;  3T3F A;  3SCX A;  3PV8 A;  1NK8 A;  4H03 B;  3ZT3 A;  1DGK N;  1N34 K;  4H0V B;  4E7L A;  2NRR A;  4FWP A;  1MWM A;  1ZYQ A;  1L3U A;  4W5N A;  2ZE2 A;  3SQ2 A;  3VET A;  3A0I X;  5EY4 A;  1HNX K;  4WQ4 A;  3SQ0 A;  2Q1N A;  5AQK A;  1IKW A;  4MO4 A;  1K9M O;  4XH4 A;  4DWI A;  4CEZ A;  1HMV A;  2O8D A;  3CFO A;  4C8L A;  1XC3 A;  3OYH A;  4CEO A;  1S1W A;  3P31 A;  2QTD A;  5AQH A;  4DFP A;  1F21 A;  2GV9 A;  3WT0 A;  1I94 K;  4FK0 A;  4H0P A;  4N5S A;  1EKE A;  1X9M A;  4IO9 L;  2O8F A;  5JEN A;  4EHT A;  2HVH A;  1Z26 A;  4DFK A;  3QNN A;  2E5L K;  4MLH A;  4DV5 K;  1L3V A;  2VQE K;  4NCG A;  2GWK A;  2GEL A;  4FWR A;  4HCB A;  4OX9 K;  2NRV A;  3U9D A;  3O9U A;  3HK2 A;  2VGN A;  1RT4 A;  2O8E B;  5J1E A;  1DTQ A;  4WFB L;  1YTA A;  3K5O A;  1DKG D;  2CH5 A;  5GAE P;  4N41 A;  3G0Z A;  1NKE A;  1A5X A;  4ICL A;  5DK5 A;  3TWH A;  2XO7 A;  1ZBH A;  3R3L A;  3AGK A;  4JK9 A;  3TAG A;  3GOI A;  1X9W A;  4WQ5 C;  4N76 A;  1NGE A;  3P83 D;  1RT6 A;  1NJY A;  3SJH A;  2BGG A;  4EFH A;  4I9L A;  5FPE A;  2Q97 A;  3SMS A;  1T8E A;  1YVU A;  3A5L C;  2WBN A;  3L2R A;  1VQ6 N;  2HW3 A;  5AQX A;  1YTU A;  3AA4 A;  2UXD K;  3SPY A;  4CEQ A;  5IT9 O;  3MEG A;  1OVQ A;  4IFY A;  5HP1 A;  1GLB G;  4YFU A;  1S1T A;  4BR5 A;  4DQQ A;  2Q0U A;  5M1P A;  5AFU H;  1B92 A;  2G8F A;  1JLB A;  3OYM A;  5I3U A;  4ISE A;  3ITH A;  3LP2 A;  2PBD A;  1H1V A;  4DTN A;  2QWR A;  1QE1 A;  2GX9 A;  4EP4 A;  3SV3 A;  2YHB A;  2AA4 A;  3C6U A;  3QLH A;  4Z4I A;  4ISG A;  2ASO A;  3DXM A;  2G8V A;  4B8A B;  3NE6 A;  4E1M A;  4CJT A;  4KTZ A;  3HP6 A;  3PSI A;  4FOI A;  1KFD A;  5BN8 A;  1SKW A;  4BGA A;  3VA3 A;  3OJU A;  4CZL A;  4E3S A;  3HJF A;  4CJ7 A;  3R8E A;  3T1Y K;  3P1G A;  3ATU A;  4CGD A;  4CGH A;  3OW2 M;  2E8A A;  4GNI A;  4AHU A;  1VQM N;  1NJX A;  1UOC A;  5HBM A;  4I7F A;  1Q8I A;  3MN7 A;  3LZJ A;  1VQN N;  1ATN A;  4AHS A;  1QQO A;  3TSP A;  4CEA A;  3THW A;  3AA5 X;  3F9K A;  4ZTJ A;  4F3O A;  3D7E O;  3CI5 A;  2P5O A;  1KRP A;  3RMA A;  1W97 L;  1TUY A;  3LWL A;  4JLH A;  4HWI A;  3SAG A;  3BP8 A;  4DR4 K;  4B3R K;  3QFU A;  4OPA A;  1VQ9 N;  3V81 A;  3KZB A;  3O6W A;  1NJW A;  4MDB A;  4LH4 A;  2W00 A;  3T1A A;  3EO3 A;  1SV5 A;  4M3Y A;  4EHU A;  4CF2 A;  3EE9 A;  3OS0 A;  4E89 A;  3C6T A;  3WXL A;  4DFM A;  2PYL A;  4H0T B;  2AJQ A;  1NK4 A;  1G99 A;  4H5R A;  2OPP A;  1WSI A;  1D4X A;  3VQ4 A;  2Q2R A;  4BRN A;  3HPH A;  3VQC A;  3E9O A;  3K5L A;  3ID8 A;  5DM7 L;  4DF4 A;  3E9L A;  1QQM A;  2WOM A;  3VF2 A;  4CJR A;  1NU0 A;  4GMJ B;  4GV6 A;  4JI4 K;  4CFA A;  3MED A;  3WQU A;  3CC2 N;  1QSY A;  1KXP A;  4M7Y A;  1QHA A;  3MX5 A;  4KTW A;  4GVE A;  2XY7 A;  5M1N A;  1MDU B;  1OH7 A;  4OJR A;  2P51 A;  3IDH A;  1T05 A;  1HNI A;  1NJI O;  4FYD A;  3AAQ A;  3MMV A;  4BRC A;  5I42 A;  3LPT A;  1T3V A;  1C0G A;  3J7A P;  3C65 A;  4DR2 K;  1XNQ K;  2QA4 N;  4OLA A;  2Q36 A;  3H46 O;  4X65 K;  2HHS A;  1LAW A;  3MEC A;  2HHW A;  4I6M A;  4DS5 A;  1O13 A;  1HRH A;  2F8S A;  4JD2 A;  1U45 A;  4KB0 A;  2A40 A;  1CZA N;  2FSJ A;  3EKU A;  5SZT A;  1R59 O;  1X9J A;  1TAU A;  3HL8 A;  3S9H A;  1HYV A;  2XHB A;  3THX A;  3DJC A;  3DRP A;  3ULE B;  5GAG P;  2D0C A;  4BRI A;  3FZH A;  2RHK A;  5TKW A;  1B9F A;  2B4J A;  1BQM A;  5J2M A;  4HUG A;  3HXM A;  3SAH A;  4BG8 A;  4O0I A;  2QWO A;  4H5N A;  5BRE A;  4FM0 A;  3NAE A;  4V19 S;  2PZS A;  4KI4 A;  1FJG K;  5C12 A;  1LV5 A;  2IC3 A;  3P38 A;  5AQS A;  4B1Y B;  1IG9 A;  4DR1 K;  4IFE A;  4KAZ A;  3TSU A;  4Z4G A;  2JLE A;  4KHU A;  3I0R A;  2KHO A;  4JRQ A;  1YUW A;  2FC0 A;  1JLF A;  4I9Q A;  3MEE A;  1KSP A;  4Z4C A;  4KO0 A;  4ELT A;  4PY5 A;  3KWG A;  2V7Y A;  1EP4 A;  2ETJ A;  1HR0 K;  1TKT A;  2Z1I A;  4E0D A;  3EKS A;  3IUC A;  4BR9 A;  3MXM A;  1EXQ A;  4FZZ A;  5CE3 A;  2CGK A;  4JN4 A;  2QWL A;  2ZF5 O;  4LD0 A;  1VSF A;  1Q9Y A;  4AIL C;  3THV A;  3VQ5 A;  2O8C A;  4W5Q A;  1JL1 A;  2W41 A;  4CE9 A;  2QKB A;  3LAL A;  1BHL A;  3RMD A;  3S5T A;  2Y1J A;  2YHW A;  1N6Q A;  2Q31 A;  4EAH D;  4KH4 A;  1T44 A;  5AQZ A;  5AJ3 K;  3I56 N;  2YNG A;  3VGK A;  3WNE A;  2ZQB A;  5CHI A;  4Z4E A;  1QSL A;  3OYB A;  4BQL A;  3A8Y A;  4ELV A;  1RGI A;  4NO7 A;  3THY B;  2YNH A;  4DTX A;  2IOC A;  3CD6 N;  2P9S B;  3D6R A;  3DRR A;  3LDO A;  1VSM A;  3ID6 A;  4JYA K;  2NRX A;  1HYS A;  1BG3 A;  4JI6 K;  2R7Y A;  2WTU A;  3VF4 A;  1E4F T;  1L5U A;  2WC9 A;  5KI6 A;  1XHX A;  3PX4 A;  1Q7Y O;  4CF1 A;  4FLW A;  4J2A A;  1TYQ B;  4DB3 A;  3H3N O;  5AQG A;  1EX4 A;  3U3G A;  1YF5 L;  2A41 A;  4CW7 B;  1WSG A;  5EOY A;  5KGW A;  4BR0 A;  2O4I A;  4YDU C;  2Y1I A;  4FO0 A;  3KKR A;  3PUF A;  4JKG A;  5C25 A;  5JIC A;  4HTU A;  4CBW A;  3EN9 A;  3QEW A;  4PQU A;  4Q0B A;  2P9L B;  4R79 A;  1T03 A;  3WNH A;  4FWN A;  2HNY A;  4CJV A;  3F73 A;  1ESV A;  4N56 A;  1UA1 A;  2XY6 A;  1NM1 A;  1TUU A;  2I7P A;  4K43 A;  4B3O A;  3NF7 A;  3CCJ N;  2ASP A;  2ZJP L;  2E20 A;  4JI2 K;  4G9Z A;  3LAM A;  4C1N I;  3DOK A;  3HPO A;  1ZBL A;  4MQ3 A;  3O9S A;  4RTF D;  3ZSR A;  1D8Y A;  4J8F A;  1Q86 O;  1RDU A;  4J2E A;  4U67 L;  1ZBU A;  1OVY A;  1WSE A;  3BF3 A;  5AQW A;  1A5V A;  2YKM A;  2I5J A;  1S1V A;  1TL1 A;  3DLK A;  1C1A A;  3C95 A;  4IG0 A;  1VQ5 N;  4JV5 K;  5AQY A;  3UKR B;  4O5B A;  1J54 A;  3O3H A;  1SAZ A;  3I33 A;  5FPD A;  4IBN A;  4M3T A;  2CH6 A;  1VSH A;  1BIZ A;  5BPM A;  4LF9 K;  1N8R O;  4CFC A;  4H5T A;  1LCU A;  3OYE A;  1VQO N;  4O4G A;  4JNE A;  2YX6 A;  2X74 A;  1S1U A;  2XRI A;  1YJW N;  4AM6 A;  2RPI A;  1QQN A;  1NK5 A;  3IFR A;  2KZM A;  4X64 K;  4K42 A;  3QER A;  1C1B A;  3G4S N;  1GOB A;  1JXE A;  4JKE A;  4OKE A;  2P9P A;  4B8C A;  4B1W B;  5GAH P;  4DFJ A;  4KHQ A;  2FF3 B;  5LJW A;  1IH7 A;  1XMO K;  4CIF A;  5C24 A;  3FZF A;  2HND A;  1RT5 A;  2UUA K;  3QET A;  2ATQ A;  3I8B A;  4LFB K;  5B8H A;  3NFA A;  4FW1 A;  4IOC L;  4B1V A;  1QVF M;  2HBL A;  2VG6 A;  3FZL A;  4CBU A;  5JVG L;  3KK7 A;  1JKH A;  1GLD G;  1GLJ O;  3GL1 A;  4GW6 A;  5AQM A;  5KTQ A;  3VEY A;  3OYN A;  4IOA L;  1RBU A;  3CIP A;  3QBX A;  3H1Q A;  1Z25 A;  5M1F A;  2WFB A;  3WXJ A;  2Q3S A;  2H3G X;  3WEE A;  1L3S A;  2BE2 A;  4Y0W A;  1LWE A;  1VSD A;  4BY9 C;  1DT9 A;  5FDL A;  3S3N A;  2F8T A;  1UA0 A;  1V4T A;  1SS6 A;  2NRZ A;  4DTO A;  4NYF A;  4JKB A;  3CC7 N;  2IS3 A;  4O0J A;  2NRH A;  3F5T A;  1U04 A;  2P9S A;  4BRD A;  3OYF A;  3ZX3 A;  4CK1 A;  3L2U A;  3CCR N;  4BR4 A;  3NMU A;  3AVF A;  3ZSZ A;  1XQS C;  5AR0 A;  3RRG A;  3VQ9 A;  2DY4 A;  1HUX A;  2HMI A;  3VPZ A;  4B1X B;  4CJL A;  4CZM A;  1IJJ A;  3K0S A;  3PSF A;  3TI0 A;  3ZSW A;  3DLH A;  4LF4 K;  2VGM A;  1TYQ A;  3DYA A;  3CQX A;  1MU2 A;  3L4I A;  4IXC A;  2Z1G A;  3AO3 A;  4MO5 A;  1JJ2 M;  3ZET A;  5AQR A;  2F7T A;  3C0B A;  4DSK A;  1KAY A;  1JCE A;  1JLA A;  3KD5 E;  1ZXO A;  2OZS A;  3K58 A;  4E72 A;  3DWL A;  2KFZ A;  4FK2 A;  1X3N A;  1E4G T;  1S9E A;  2P9L A;  4DV4 K;  4H0X B;  4KHS A;  1GLL O;  5MLC Q;  1XI1 A;  5C0Y A;  3QFP A;  4JI3 K;  1N33 K;  3TPQ A;  1NGD A;  1XHZ A;  3V6D A;  3G71 N;  2E4L A;  2YCH A;  4FJX A;  4Z4H A;  3B8A X;  4AF1 A;  5FPN A;  3TU5 A;  1RDD A;  4IFV A;  3ZT4 A;  3OBY A;  3SUO A;  1WSF A;  1VQK N;  3VOV A;  4OGE A;  4BVP A;  5HOO A;  1NK9 A;  1K73 O;  1D9F A;  1QZ5 A;  1WOQ A;  3QEV A;  4CES A;  4NCA A;  1A5W A;  4BRO A;  5LY3 A;  1TKZ A;  4PWD A;  3HYF A;  3HM8 A;  5BN9 A;  3O4W A;  4BAC A;  3KLG A;  1IKV A;  4LF8 K;  1QVG M;  2E2P A;  1WB9 A;  4CZI A;  1NGJ A;  5KPT A;  3MK6 A;  4KKO A;  4Z4F A;  3G25 A;  2P9I A;  4BEC A;  3VQD A;  3WNG A;  4BDP A;  3TAP A;  4M7X A;  4GV9 A;  4CHP A;  3HTV A;  2A3Z A;  2E1Y A;  2IVO A;  4FSV A;  4E1J A;  4BE1 A;  2LSN A;  4F2S A;  4JKH A;  2E88 A;  3QML A;  3F2K A;  3E1Y A;  3NCI A;  3M6G A;  2GBZ A;  1RBR A;  2O8B B;  3SLC A;  3V1Q A;  5LJV A;  4CJ3 A;  1BCO A;  3PIO L;  3RMB A;  3K57 A;  4DR3 K;  2G8H A;  4JS5 A;  3O08 A;  1RT7 A;  5A2Q O;  3VN5 A;  3Q7B A;  4H0O A;  3PO4 A;  4WYB A;  4Z0U A;  3O3G A;  4MDA A;  3A5N C;  1SUQ A;  1Q82 O;  1Y64 A;  4BRL A;  3V9W A;  1S1X A;  5HLF A;  3CG7 A;  1LOT B;  1NLV A;  4KFB A;  1QTM A;  3VQ8 A;  3SUN A;  1GLF O;  1R0A A;  3NBP A;  1VAZ A;  2KQ2 A;  2IIR A;  2QW9 A;  3CJ1 A;  4B9T A;  4FVM A;  3DXK A;  2QK9 A;  3AV9 A;  2FSN A;  3NH0 A;  1K8A O;  4XH5 A;  4FVU A;  4K8X A;  4CER A;  3AO4 A;  3O3F A;  2FBX A;  3NGI A;  3JXU A;  4DTM A;  4LY7 A;  4YNQ A;  3CET A;  3EE8 A;  3AVN A;  5KRS A;  4CJU A;  3KD1 E;  2YHA A;  4HUF A;  3H3O B;  2BUP A;  4IG3 A;  4CJE A;  1MA9 B;  2HB5 A;  4CK3 A;  2VG7 A;  3O9T A;  4AHR A;  4CZE A;  3W0L A;  1JL2 A;  3GDQ A;  3A2F A;  3HP9 A;  4OPJ A;  1RT3 A;  1S5J A;  1SZ2 A;  3O8M A;  5AQJ A;  4CGJ A;  4H5V A;  4TSX A;  3AAR A;  1NGA A;  2W6K A;  4IZ9 A;  4B9Q A;  4NYN A;  4JRP A;  1WBB A;  2F9T A;  1UWB A;  5KPZ A;  5BRF A;  1ASW A;  4FJK A;  3BEX A;  3NGY A;  3CCU N;  1YIJ N;  3CYG A;  4LFC K;  5JLH A;  3LP0 A;  5AZJ B;  1WN7 A;  4E7K A;  4DSI A;  2HNZ A;  3HOS A;  5BPL A;  1BQN A;  1RIL A;  3AO1 A;  2ZGZ A;  3KJV A;  3OYI A;  2X6N A;  3DLE A;  2V51 B;  2Z1J A;  4FWQ A;  4IO8 A;  1RT1 A;  2D0P A;  3TAB A;  4JKA A;  3N4P A;  1BIS A;  2BDP A;  2QWM A;  4BRK A;  1TKX A;  4LSN A;  3MN6 A;  1C0T A;  3PO5 A;  3AVH A;  1KVB A;  3RR8 A;  2Q0R A;  3HVT A;  4GKJ K;  4FOE A;  1HQE A;  3OBW A;  4ZHR A;  4BE7 B;  1M1K O;  1J9A A;  3M1F A;  5I9E B;  4IDK A;  3L2Q A;  4DV7 K;  4QS8 A;  4CGG A;  2RE2 A;  4E1N A;  1VSI A;  3RMC A;  3H08 A;  2DTU A;  2PFU A;  3CPE A;  3VER A;  1TVR A;  4JK7 A;  3DI6 A;  4W5T A;  1KVC A;  3PX6 A;  3L3U A;  2NZT A;  1ASU A;  1HKC A;  3MDQ A;  3LP1 A;  4C8M A;  1RTH A;  2O8E A;  4BE0 A;  3FZM A;  3OA9 A;  3PIP L;  1SKS A;  1KFS A;  1RBV A;  4BQZ A;  2O8B A;  1HPZ A;  2IGI A;  3K2P A;  4BRM A;  1KAX A;  3HSC A;  4M3U A;  2A6A A;  3DAW A;  2W6L A;  1BU6 O;  1NBW A;  1WSJ A;  4DU1 A;  5TKY A;  5CZ1 A;  4AM7 A;  5JS1 A;  3BDP A;  1UAX A;  5C42 A;  3L2W A;  3AVC A;  3AVM A;  1BWF O;  1NGH A;  1RDC A;  3CCM N;  1ILY A;  3FFK B;  1LWC A;  1NNE A;  1CXU A;  1FKP A;  1QHT A;  2EWS A;  1TGO A;  4EZ6 A;  5E84 A;  3AO5 A;  3DOL A;  3H1V X;  5AZI B;  4GV3 A;  2BAN A;  5KQ8 A;  2ZJR L;  4AHC A;  4E7J A;  1ZC6 A;  2VWB A;  2FXU A;  4DLE A;  1YAG A;  4DV6 K;  1NK6 A;  1KLN A;  4ID5 A;  3OYL A;  5KQD A;  4CHN A;  2G8I A;  2E6L A;  3MWT A;  3HZ6 A;  4CEB A;  4RW6 A;  4E19 A;  4JI5 K;  1NG9 A;  3L8B A;  4DV2 K;  1BIU A;  1GOA A;  3TAR A;  1CLQ A;  4FJH A;  2V52 B;  2E1Z A;  4B9V A;  3KIO A;  4M3W A;  5DMR A;  2QEX N;  3WXK A;  4CIG A;  4KBO A;  1KC8 O;  5F2R A;  2DFE A;  4O44 A;  4BVO A;  3VEN A;  2D0B A;  3SI6 A;  4WCE L;  3CJB A;  4H5W A;  2RKI A;  3L2V A;  3CCV N;  4KRE A;  3V9S A;  3QDK A;  2KW4 A;  2O4G A;  3GBT A;  4A5B A;  1KCF A;  3BGR A;  3DRS A;  3IAY A;  5DM6 L;  1NOY A;  2OPS A;  4O55 A;  4C23 A;  1U47 A;  4A61 A;  5D3G A;  4F8R A;  3AY9 A;  3J8A A;  4CJ4 A;  4B3T K;  4IJA A;  3T19 A;  4X62 K;  3VQA A;  3LM9 A;  5FRO A;  5C2D A;  4DSF A;  3ASM A;  3FFI A;  4G1Q A;  5AQP A;  4WFN L;  4DV0 K;  1YJ9 N;  3EZ5 A;  4M3Z A;  1U49 A;  3LP3 A;  4QS9 A;  3D0P A;  3QES A;  3D2F B;  1C0M A;  2P9K B;  4I2P A;  3VTI A;  2A42 A;  4BE2 A;  4CHQ A;  3RWU A;  2IVN A;  3TAN A;  4CVN E;  5F1X A;  3VGL A;  3L0Q A;  4A2B A;  2YHY A;  1WSH A;  3ZX0 A;  3S3M A;  4CJW A;  4FJN A;  4FWK A;  3LPU A;  1J53 A;  3SJJ A;  4BRA A;  3CC4 N;  4QCL A;  5AQL A;  2IAJ A;  2UXC K;  3WXI A;  2QWQ A;  1T6D A;  5KPR A;  3VQB A;  4WQ4 C;  3HOT A;  1KTQ A;  4DTS A;  3TSQ A;  1NMD A;  3QEI A;  4NB4 A;  4BC4 A;  1YI2 N;  4N47 A;  3NH2 A;  4OO1 J;  2GWJ A;  2DFF A;  1VQL N;  2F96 A;  4BC3 A;  1K8K B;  2G8U A;  1E3M A;  4BRP A;  1KVA A;  3TTC A;  1FXX A;  1Q81 O;  3VQ6 A;  1VQ7 N;  2P9U B;  4JEP A;  4FL9 A;  4B9N A;  1C6V A;  2OAN A;  5SWM A;  2HBK A;  3O1B A;  5JLF A;  5KRT A;  2QI2 A;  3I55 N;  4YOX A;  2KTQ A;  4FJG A;  4FXD A;  1BGX T;  5FPM A;  3KK2 A;  4ILJ A;  3C6A A;  4M45 A;  2BH1 A;  4JI1 K;  3KK3 A;  3WQT A;  5GIP A;  4FJL A;  1KLM A;  4FLT A;  4K8Z A;  1B9D A;  3B6P A;  4QAG A;  1YHQ N;  3VA0 A;  4BDY A;  4CJS A;  4K25 A;  4BRG A;  3NHG A;  3VEV A;  4CD3 A;  3WNF A;  2UXB K;  1X9S A;  1OKJ A;  3BF1 A;  5FLX O;  3ULE A;  5GAD P;  5AQT A;  4BRH A;  4PKH A;  3MCA B;  4B9L A;  1G15 A;  4LC9 B;  5BRH A;  5GIO A;  4R5P A;  3TAQ A;  4KB1 A;  5EVZ A;  3NVK A;  4CED A;  5JS2 A;  2HST A;  3NDK A;  3IS9 A;  4DQR A;  4DQ8 A;  1SL2 A;  3VMF B;  3LAK A;  1QQC A;  3EEQ A;  4FCY A;  1Q18 A;  3O80 A;  3VES A;  3M8Q A;  3S41 A;  3QIP A;  1N5Y A;  1IKX A;  3QIC A;  4BWM A;  4L8R B;  3QB0 A;  1X3M A;  1TV6 A;  3LDQ A;  5CYQ A;  4WFA L;  4NXN K;  4DTP A;  3NH1 A;  5EXW A;  3JYT A;  1Q9X A;  2HHU A;  2HF4 A;  1JLG A;  3AVA A;  5E26 A;  1KAZ A;  1T6C A;  3R9P A;  3SBT A;  1XNR K;  4Q5V A;  1NK7 A;  2HOE A;  2O8F B;  4CBX A;  3K5N A;  4KPY A;  1YT3 A;  5CY4 A;  1REV A;  4CZK A; 
#chains in the Genus database with same CATH homology
 1NGJ A;  2ASM A;  3O1W A;  3O5B A;  3MK6 A;  4BRF A;  3EO3 A;  5KPT A;  2KKZ A;  4PKI A;  3LDP A;  3IMX A;  5AZJ A;  4C1N K;  3G25 A;  4EHU A;  3UKU A;  2P9I A;  4BEC A;  3CJ7 A;  4M7X A;  2VYP A;  3EE9 A;  5ADX A;  4GV9 A;  1YVN A;  3WXL A;  4CD1 A;  1NGB A;  3HTV A;  4H0T B;  2A3Z A;  2E1Y A;  2IVO A;  4BC5 A;  1G99 A;  1S3X A;  4FSV A;  2P9N B;  4E1J A;  4H5R A;  4A57 A;  4JKH A;  3GG4 A;  2NLX A;  2E88 A;  3QML A;  3KWI A;  3F2K A;  3WEE B;  3VEZ A;  3E1Y A;  1D4X A;  2Q2R A;  4BRN A;  2GTD A;  2D1K A;  3M6G A;  3E9O A;  3ID8 A;  5DM7 L;  3E9L A;  2JWL A;  3SLC A;  1QQM A;  5LJV A;  3VF2 A;  5BPN A;  1NGG A;  4GV6 A;  3R6M A;  3VF6 A;  3LM2 A;  3WQU A;  3PIO L;  3CC2 N;  1KXP A;  3RSE B;  4M7Y A;  1QHA A;  3MX5 A;  4JHD A;  3W3D A;  4GVE A;  3O08 A;  2QXL A;  3O9Q A;  4FPA A;  5M1N A;  4FPB A;  3LDN A;  1MDU B;  1KD1 O;  3Q7B A;  3ZEU B;  4H0O A;  2D4W A;  3IDH A;  4WYB A;  1BA1 A;  1RDW X;  3FZK A;  4FWO A;  4MDA A;  4CI6 A;  1NGI A;  3A5N C;  1HLU A;  1NJI O;  1GLE G;  3L4Q A;  3AAQ A;  3MMV A;  4BRC A;  1Q82 O;  1Y64 A;  1T3V A;  4BRL A;  3ENO A;  1C0G A;  1C0F A;  3CHW A;  3MN5 A;  3RVC A;  3M5R A;  3C65 A;  1LOT B;  1NLV A;  4IDH A;  2QA4 N;  4YOT A;  3L6Q A;  1GLF O;  2Q36 A;  3E9P A;  3H46 O;  1JCF A;  1VAZ A;  3CJ1 A;  2IIR A;  2QW9 A;  3R1X A;  1YJN N;  1U6Z A;  4I6M A;  1O13 A;  2NRW A;  3DXK A;  4BR7 A;  4JD2 A;  1BA0 A;  3ZET B;  2QM1 A;  2A40 A;  1HX1 A;  3WXM B;  1IG8 A;  2FSN A;  1K8A O;  1CZA N;  4XH5 A;  4FVU A;  2FSJ A;  3VEW A;  3EKU A;  3UB5 A;  1R59 O;  1X9J A;  4IOX A;  4BRQ A;  3JXU A;  4JKF A;  1HKG A;  3MN9 A;  4PHT X;  3SBG A;  3DJC A;  3GE1 A;  3C6H A;  5AQI A;  3ULE B;  5GAG P;  3SAF A;  3CET A;  4BRI A;  3FZH A;  2RHK A;  3EE8 A;  5TKW A;  3ENB A;  3NVM A;  3UE5 A;  4A59 A;  2NRT A;  4A2A A;  3CCQ N;  4CZF A;  3CMA N;  3H3O B;  3SAH A;  2BUP A;  4BG8 A;  2YHX A;  2OTJ N;  1MA9 B;  1J6Z A;  4M63 C;  3CCS N;  3O9T A;  2P9U A;  2QWO A;  4CZE A;  3TTD A;  3W0L A;  3GDQ A;  2E2O A;  4H5N A;  5BRE A;  4UY8 O;  1QZ6 A;  1V4S A;  3TTF A;  3CJC A;  1SZ2 A;  3MCP A;  3O8M A;  1NGF A;  5C12 A;  4KH6 A;  5AQJ A;  3ZX2 A;  5AZI A;  4YOU A;  4H5V A;  3P38 A;  5AQS A;  4B1Y B;  5M1Q A;  4JKD A;  4YOV A;  3AAR A;  1EO1 A;  4IFE A;  4IJN A;  1NGA A;  4IZ9 A;  3TSU A;  4NLB A;  3A5M C;  5JMV A;  4B9Q A;  3CQY A;  2KHO A;  1YUW A;  4Z94 A;  2JWK A;  4CZH A;  2F9T A;  3WUH A;  4BGB A;  5KPZ A;  3D2E A;  5BRF A;  1HPM A;  3A5O C;  3BEX A;  4FWL A;  3KWG A;  2V7Y A;  3CCU N;  1YIJ N;  2CGL A;  4YOW A;  3EKS A;  1ZBS A;  3IUC A;  4L3Q A;  2V7Z A;  3C7N B;  4HTL A;  4QS7 A;  4BR9 A;  5JLH A;  2ZWH A;  5AZJ B;  4O8U A;  3PLA A;  5C2F A;  2DPN A;  2P9I B;  3HOS A;  5CE3 A;  2CGJ A;  5ADX H;  5BPL A;  2CGK A;  3FLC O;  2NNW A;  2QWL A;  2ZF5 O;  4JN4 A;  4JKC A;  3CJ9 A;  3VGM A;  3UKR A;  2ZGZ A;  4BRE A;  3O9R A;  4YDU A;  4PKG A;  1HKB A;  2V51 B;  4FWQ A;  4IO8 A;  5GIN A;  2UYT A;  3FR0 A;  2D0P A;  4JKA A;  3N4P A;  2QWM A;  4BRK A;  2W41 A;  3F9M A;  4O8K A;  5AQQ A;  1BOT O;  4K41 A;  2D0O A;  1U2V A;  2YHW A;  3MN6 A;  5F0X A;  2Q31 A;  2Q0R A;  4IEE A;  4KH4 A;  4EAH D;  1T44 A;  3K9K A;  2C1I A;  2GEM A;  3H6E A;  2HMP A;  4FOE A;  1YXQ A;  4KH5 A;  5AQZ A;  3G6E N;  3U8X A;  3I56 N;  3MWP A;  3OBW A;  1BO5 O;  3VGK A;  3DLL L;  4BE7 B;  3ENH A;  3QBW A;  5AQU A;  5CHI A;  5H1S Q;  1M1K O;  3M1F A;  4NLC A;  3A8Y A;  4BQL A;  5I9E B;  3CME N;  1RGI A;  4QS8 A;  4NO7 A;  4O5F A;  3ZYY X;  5M1O A;  2RE2 A;  3CD6 N;  2PFU A;  2VCP A;  3CPE A;  3VER A;  2C1G A;  2P9S B;  3D6R A;  1VQ8 N;  1YIT N;  3LDO A;  2GUP A;  3ID6 A;  4JK7 A;  3D2F A;  3H45 C;  2P9K A;  4RCH A;  2NRX A;  4A62 A;  2NZT A;  2OTL N;  5AQO A;  2W40 A;  1BG3 A;  2I7N A;  4YOY A;  4I6M B;  1HKC A;  3MDQ A;  2P9N A;  3DXK B;  4F9O A;  4JD2 B;  3VF4 A;  1E4F T;  2WC9 A;  1Z05 A;  3HI0 A;  5M1K A;  4A5A A;  4PL8 A;  1Q7Y O;  4CZG A;  3FZM A;  3OA9 A;  3PIP L;  1TYQ B;  3EZW A;  4DKW A;  4BQZ A;  2IVP A;  5C15 A;  4DB3 A;  3H3N O;  5AQG A;  4BRM A;  1KAX A;  4RWT A;  4XJX A;  3HSC A;  1YF5 L;  3LDL A;  2A6A A;  2A41 A;  3DAW A;  5EX5 A;  3CXC M;  5JVH L;  3U9Z A;  3RSE A;  5EOY A;  1BU6 O;  1NBW A;  4BR0 A;  1S22 A;  5TKY A;  4YDU C;  4FO0 A;  4AM7 A;  4IEI A;  3VEX A;  1KQS M;  4JKG A;  3DXM B;  4ILH A;  5JIC A;  3CCE N;  2AP1 A;  4CBW A;  3EN9 A;  1BWF O;  3ZEU A;  1NGH A;  3FE1 A;  1ILY A;  3CCM N;  3M3Z A;  4FWM A;  3FFK B;  2P9L B;  3T69 A;  4R79 A;  5HL7 L;  2HBJ A;  4FWN A;  1S72 N;  4GY2 B;  2WUS A;  1ESV A;  2EWS A;  2QWP A;  1K8K A;  1NM1 A;  5E84 A;  2BTF A;  1TUU A;  2PAV A;  3CER A;  2I7P A;  3H1V X;  5AZI B;  4GV3 A;  2A5X A;  5KQ8 A;  4K43 A;  3SK3 A;  3SMP A;  2ZJR L;  1ZC6 A;  2VWB A;  4EIA A;  2FXU A;  3CCJ N;  1YAG A;  2ASP A;  4H0Y B;  3EL2 A;  1P90 A;  3JS6 A;  3LL3 A;  2E20 A;  5AQV A;  2ZJP L;  1M90 O;  4G9Z A;  4WF9 L;  4C1N I;  1VQP N;  2E2Q A;  3CJA A;  5AFU A;  2F9W A;  1JCG A;  5KQD A;  1MWK A;  3O9S A;  4RTF D;  3MWT A;  3HZ6 A;  2J4R A;  4U7B A;  4J8F A;  2FSK A;  1Q86 O;  1RDU A;  3IKM A;  4FWS A;  4U67 L;  2V52 B;  1OVY A;  2E1Z A;  4B1U B;  3BF3 A;  4CZI A;  5AQW A;  3VTH A;  2FF6 A;  4H03 B;  2QWN A;  2QEX N;  1DGK N;  3WXK A;  4KBO A;  4H0V B;  1EQY A;  1KC8 O;  2NRR A;  2ITM A;  5F2R A;  4FWP A;  1MWM A;  1VQ5 N;  1ATS A;  5AQY A;  5AQN A;  3UKR B;  3VET A;  3A0I X;  1SAZ A;  1BDG A;  5EY4 A;  3VEN A;  4WQ4 A;  4BVO A;  3I33 A;  5FPD A;  2Q1N A;  3KVG A;  1RFQ A;  5AQK A;  4MO4 A;  3UKU B;  4WCE L;  4B1Z A;  1K9M O;  3CJB A;  4XH4 A;  4YOR A;  1P8Z A;  5ELZ A;  4H5W A;  3CCV N;  2CH6 A;  3QDK A;  4CZJ A;  5BPM A;  3E66 A;  3GBT A;  4XH1 A;  4A5B A;  4JAX A;  1N8R O;  5DM6 L;  4H5T A;  1LCU A;  4C23 A;  1VQO N;  4A61 A;  1XC3 A;  3AY9 A;  5CR4 A;  4JNE A;  3J8A A;  2YX6 A;  5BRD A;  1WUA A;  4IJA A;  1BUP A;  1YJW N;  4AM6 A;  2ZJQ L;  1QQN A;  3IFR A;  3P39 A;  3ATV A;  3P31 A;  4K42 A;  1XUP O;  2QTD A;  5AQH A;  1GLA G;  3LM9 A;  5C2D A;  5AQP A;  4JHD B;  4WFN L;  3WT0 A;  3G4S N;  1Z6R A;  1NWK A;  4JKE A;  1YJ9 N;  3C7N A;  4H0P A;  2P9P A;  3HRG A;  4B1W B;  4IO9 L;  5GAH P;  4DCH A;  4EHT A;  2FF3 B;  4QS9 A;  5LJW A;  3D2F B;  2HF3 A;  2P9K B;  3FZF A;  4MLH A;  3I8B A;  3VTI A;  2A42 A;  5B8H A;  2HBM A;  4OPH A;  2E2N A;  3Q7C A;  4IOC L;  2GWK A;  2GEL A;  4FWR A;  3U4L A;  4B1V A;  2HBL A;  1QVF M;  2NRV A;  3FZL A;  2IVN A;  3U9D A;  4CBU A;  5JVG L;  5F1X A;  3VGL A;  3KK7 A;  3O9U A;  2VGN A;  3L0Q A;  4MLE A;  4A2B A;  2YHY A;  1GLD G;  1GLJ O;  3GL1 A;  3ZX0 A;  5AQM A;  4IOA L;  3VEY A;  4WFB L;  4FWK A;  3CIP A;  1DKG D;  2CH5 A;  5GAE P;  3QBX A;  3H1Q A;  4BRA A;  5M1F A;  3CC4 N;  2WFB A;  5AQL A;  3R3L A;  3WXJ A;  3WXI A;  3AGK A;  2QWQ A;  2H3G X;  4JK9 A;  1T6D A;  3WEE A;  5KPR A;  3GOI A;  4WQ5 C;  1NGE A;  2YJE A;  4WQ4 C;  4Y0W A;  3HOT A;  3TSQ A;  3SJH A;  4BY9 C;  1DT9 A;  4JKG B;  4EFH A;  5FPE A;  1NMD A;  5C10 A;  4BG9 A;  1W2B M;  2Q97 A;  4NB4 A;  3SMS A;  1HJO A;  1V4T A;  1SS6 A;  2NRZ A;  3A5L C;  4BC4 A;  1YI2 N;  4JKB A;  4OO1 J;  2WBN A;  3CC7 N;  1SQK A;  2GWJ A;  1VQ6 N;  2KLA A;  5AQX A;  4PL7 A;  3J7Z O;  1VQL N;  4BC3 A;  1K8K B;  2NRH A;  3F5T A;  5AQF A;  4BRP A;  2P9S A;  1GLC G;  3AAP A;  4BRD A;  3TTC A;  1Q81 O;  1VQ7 N;  3ZX3 A;  4XEI A;  4IWV A;  2P9U B;  3CCR N;  4JEP A;  4ILG B;  4BR4 A;  4FL9 A;  3NMU A;  1GLB G;  2OAN A;  2HBK A;  4BEB A;  1XQS C;  3O1B A;  5AR0 A;  4BR5 A;  2QI2 A;  5JLF A;  4YOX A;  3I55 N;  1HUX A;  2Q0U A;  5M1P A;  5AFU H;  3VPZ A;  4B1X B;  2FLO A;  4CZM A;  1IJJ A;  5FPM A;  4ILJ A;  3CF5 L;  2VGM A;  1TYQ A;  1ATR A;  3C6A A;  4ISE A;  2BH1 A;  3CQX A;  3WQT A;  5GIP A;  2PBD A;  2YJF A;  3L4I A;  4IXC A;  1H1V A;  4MO5 A;  3T7Z A;  1JJ2 M;  4BC2 A;  3ZET A;  2QWR A;  5AQR A;  2F7T A;  2GX9 A;  3C0B A;  1KAY A;  1YHQ N;  3D2E B;  1JCE A;  1VQ4 N;  2AA4 A;  4K25 A;  4BRG A;  1ZXO A;  3VEV A;  4CD3 A;  3N4Q A;  4ISG A;  2ASO A;  3DWL A;  1OKJ A;  3BF1 A;  3DXM A;  3OHR A;  4DHY A;  1X3N A;  1E4G T;  3ULE A;  5GAD P;  5AQT A;  4BRH A;  4PKH A;  2P9L A;  5BR9 A;  3MCA B;  4FOI A;  5BN8 A;  4LC9 B;  3BUZ B;  4H0X B;  5BRH A;  5GIO A;  1GLL O;  3CCL N;  5MLC Q;  4BGA A;  2YI1 A;  5EVZ A;  3NVK A;  3KHY A;  2HST A;  5C0Y A;  3QFP A;  3AGR A;  4CZL A;  3TPQ A;  4DQ8 A;  4CJ7 A;  1NGD A;  3R8E A;  3VMF B;  3ATU A;  4WQ5 A;  3K9J A;  3MX2 A;  3OW2 M;  2E8A A;  1Q18 A;  3O80 A;  2YCH A;  4GNI A;  3VES A;  1NGC A;  3G71 N;  1VQM N;  3S41 A;  3HBT A;  3B8A X;  4AF1 A;  5FPN A;  3QIC A;  4ISF A;  3QB0 A;  3TU5 A;  1X3M A;  4BR2 A;  3MN7 A;  3OBY A;  1VQN N;  3LDQ A;  4WFA L;  1ATN A;  1DEJ A;  3FGU A;  1VQK N;  3VOV A;  4BVP A;  1QQO A;  3TSP A;  5HOO A;  1K73 O;  5EXW A;  1QZ5 A;  1U2V B;  1WOQ A;  3D7E O;  2HF4 A;  3CI5 A;  5E26 A;  4BRO A;  1KAZ A;  1T6C A;  3R9P A;  3SBT A;  1W97 L;  1TUY A;  5LY3 A;  3HM8 A;  4HWI A;  5BN9 A;  3O4W A;  3VEO A;  3SAG A;  2P9P B;  3BP8 A;  2HOE A;  3QFU A;  4OPA A;  1VQ9 N;  3KZB A;  4CBX A;  1QVG M;  3O6W A;  2E2P A;  3P4I A;  4JK8 A;  4MDB A;  3CPW M;  2W00 A;  2ZGY A;  4CZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...