1YAGA

Structure of the yeast actin-human gelsolin segment 1 complex
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
372
structure length
372
Chain Sequence
EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords PROTEIN (ACTIN)
total genus 116
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 1998-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1yagA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yagA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yagA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1yagA04
3QMLA 5BREA 3DXMA 3ZEUA 3CJ9A 1BDGA 3UKRA 1LOTB 2A3ZA 3FLCO 3H3NO 3H1VX 3ATVA 2VWBA 4LC9B 3H3OB 4CZMA 4WQ5C 4BC5A 5AQGA 2BUPA 5AQIA 3WXLA 2YHXA 2A40A 1BA0A 4FWQA 4FOIA 2QWPA 1T44A 3DXKA 3CQXA 4ISFA 3DJCA 4BGAA 4FPAA 5BRFA 5CE3A 5AR0A 4CZIA 2GEMA 5AQMA 1C0GA 4AM7A 4PKHA 2ASMA 1MWMA 3EL2A 1MA9B 1ZC6A 3U8XA 4EAHD 3QICA 2P9NA 4CZLA 1NGCA 5KPZA 5BPLA 1K8KB 3VESA 4FL9A 2A41A 2YI1A 5KQ8A 1ATNA 3U9DA 5ADXA 2P9PA 3GE1A 3GG4A 2UYTA 3ENHA 3FZFA 4PKIA 3DAWA 1S22A 2P9LB 4XH4A 5BR9A 1U6ZA 4JAXA 3L0QA 4B1ZA 1H1VA 2EWSA 2GUPA 1E4GT 4CI6A 4BRQA 2PBDA 3DXKB 3UE5A 3VEZA 2FF6A 4DB3A 3P4IA 1IJJA 3CI5A 3WQTA 3VENA 2E2QA 1WOQA 4RWTA 4AM6A 3D2EB 2CGKA 2NZTA 3IFRA 5AQOA 3VEYA 1NM1A 4BG9A 1K8KA 3O8MA 3VEVA 4BG8A 4A2AA 1IG8A 2FSKA 3WXIA 1V4TA 3R9PA 4BVOA 1GLDG 4WYBA 1OKJA 2Q0UA 2QXLA 2A42A 3W3DA 1QQNA 2BTFA 1BOTO 5LJWA 4BQZA 1NGDA 4M63C 4XH5A 1XUPO 2GELA 4H0YB 3FGUA 4H5NA 5E26A 2QWLA 3RSEA 4FOEA 1NGJA 3WXJA 4L3QA 3EN9A 1HJOA 3VERA 3BP8A 5EXWA 3D7EO 2Q1NA 3DWLA 4H0PA 4A2BA 4M7XA 3LM9A 3CJCA 3LDPA 2D0PA 2P9UB 2E1ZA 2GTDA 4KBOA 3L6QA 5KQDA 5AZJB 2FSJA 5F0XA 4BREA 3KVGA 3ZEUB 2D0OA 1J6ZA 3ENOA 4C23A 4BRMA 4B1XB 2WUSA 1NBWA 1Y64A 2CGLA 1YUWA 4A62A 3ZETB 1XC3A 5EVZA 1SAZA 3A5NC 1NWKA 3HTVA 2CH6A 3CERA 1P8ZA 4FSVA 1GLJO 1LCUA 2CGJA 3O08A 1HKBA 4BRKA 1XQSC 4IJNA 2E2OA 4BR4A 1ATSA 3SMPA 4I6MB 4MO5A 3VEXA 4WQ4C 1TYQA 2GWKA 1NGEA 3A0IX 4BGBA 4BR5A 3HSCA 3TPQA 1NGGA 3LDLA 5EY4A 1NGHA 3O80A 3ULEB 4CZEA 4J8FA 2IVOA 3C7NA 3EO3A 3L4IA 4Y0WA 2ZGZA 2QM1A 1GLCG 1BG3A 4IXCA 5JLFA 4CZGA 4QS8A 5FPDA 2E20A 4H0VB 4CBUA 3SMSA 3U9ZA 1DKGD 3H45C 2I7NA 3WQUA 4CBXA 1U2VB 4H5TA 3EZWA 4FWMA 1EQYA 3FZLA 3FZHA 3WXKA 5AQQA 2E88A 2D4WA 4FWKA 4ISGA 1X9JA 3HBTA 3WEEA 4H0TB 2KHOA 2QWQA 3TU5A 4BRPA 3CJBA 4JHDB 4MO4A 1C0FA 1QZ6A 2CH5A 3GL1A 3M6GA 3MDQA 5ELZA 4BR0A 3QB0A 2QWNA 3BF1A 3ZX0A 4MLHA 1Q18A 4BRFA 1SZ2A 2FXUA 3R6MA 4B1VA 1QHAA 3RSEB 3KZBA 3CHWA 4CD3A 2D1KA 3M1FA 2V52B 4BC3A 2Q0RA 3VEOA 2ZGYA 4XEIA 3AARA 4BROA 1DEJA 2ASOA 4Z94A 2YJEA 1GLLO 5I9EB 2P9IA 2I7PA 4DQ8A 4O8KA 1DGKN 1QQMA 1SQKA 1JCEA 4QS9A 3VF6A 4WQ4A 1S3XA 2HMPA 3D2FA 4JNEA 4QS7A 2ASPA 4BC2A 4DCHA 3LL3A 5AQRA 4ISEA 2E1YA 4FWNA 3LDNA 3SK3A 1HX1A 4BRGA 5AQNA 5LY3A 2E2PA 4RTFD 3FE1A 2P9SB 4F9OA 4K41A 2HOEA 3W0LA 4CD1A 2YCHA 5BRDA 3CJ7A 4FWLA 5LJVA 4BC4A 4CBWA 1QQOA 2OANA 2PAVA 3HI0A 1V4SA 4K43A 4BR7A 4CZKA 1RGIA 5BPNA 2VYPA 4BRNA 3CJAA 3I8BA 4YDUC 5AQUA 3QDKA 4EIAA 1CZAN 4A61A 4B1YB 3LDQA 2F9TA 4CJ7A 4PL8A 3VF2A 1X3MA 4H5RA 1KAXA 4HWIA 3O6WA 2J4RA 3OHRA 3BEXA 1NGIA 4JD2A 2P9KB 5AQPA 2DPNA 2Q31A 3HZ6A 3MN9A 3S41A 5BN8A 2NLXA 4WQ5A 4B1WB 1MDUB 1BUPA 5EOYA 2A6AA 2V7YA 3QBXA 3G25A 5BPMA 2AA4A 1X3NA 1ZBSA 3MN7A 2QWMA 4BRDA 4H0XB 3D2EA 4NB4A 4FPBA 2IVNA 3MCPA 3HM8A 4JN4A 1E4FT 5AZIB 5AFUH 4FWSA 2FSNA 5AQTA 3JXUA 5KPTA 5AQKA 5AQHA 3VETA 1GLEG 2P9KA 3UKRB 5BN9A 3A5LC 4H03B 2P9LA 3ZETA 3UB5A 3SJHA 3MK6A 4H5VA 3O1WA 1NLVA 3QBWA 1KAYA 1HKCA 3U4LA 1R59O 3CJ1A 4K42A 5AQLA 1YXQA 2YJFA 4K25A 2P9IB 4MLEA 3ZX2A 4I6MA 3IMXA 3VOVA 4YDUA 2P9NB 4BRAA 3AAQA 5KPRA 1NGBA 5AZIA 3D2FB 4PL7A 3WT0A 4BR2A 2FLOA 2A5XA 5AQJA 2IIRA 2ITMA 2P9PB 4EHTA 2V51B 1JCGA 5B8HA 4EFHA 5ADXH 4BVPA 4H0OA 3F9MA 1G99A 5BRHA 2P9SA 3KHYA 5AQWA 4IWVA 3ID8A 5TKYA 1Z05A 5AFUA 4CZHA 3IDHA 3MN6A 5FPMA 3VPZA 5AQVA 5F1XA 3EKSA 1KXPA 3CIPA 1RFQA 2QW9A 2AP1A 5AQZA 2VCPA 3FFKB 5JLHA 5AQYA 1WUAA 3DXMB 4JHDA 3H1QA 5AQFA 5FPNA 4CZJA 3VF4A 3ZX3A 3I33A 3UKUA 3C7NB 5AQXA 4XH1A 3GOIA 4O5FA 3BUZB 3H6EA 4E1JA 2V7ZA 3A5OC 3ATUA 4M7YA 1T6CA 3AAPA 5JMVA 4FWOA 4NO7A 4CZFA 1BU6O 3SLCA 4PKGA 2GWJA 3M3ZA 3QFUA 3BF3A 4DHYA 4EHUA 3CQYA 3VEWA 1ZXOA 2W40A 2ZF5O 3IUCA 5AQSA 4B1UB 3O5BA 5FPEA 1QZ5A 1GLFO 1NGAA 3EKUA 1HPMA 2YHWA 2F9WA 3FR0A 3O1BA 3GDQA 3ULEA 4FWPA 4RCHA 1BWFO 1GLAG 5F2RA 3UKUB 1TUYA 5E84A 1D4XA 4BRIA 3CETA 3O4WA 4IZ9A 3JS6A 1HLUA 3QFPA 4H5WA 3GBTA 4BRHA 4FWRA 1YAGA 3VGMA 2NRHA 1BO5O 1MWKA 1NMDA 3J8AA 4BQLA 3LDOA 1TYQB 2YHYA 1HUXA 3WEEB 2FF3B 4B9QA 2W41A 2QWOA 3A8YA 4GY2B 2E8AA 3FZMA 4JD2B 2HF3A 1YVNA 5EX5A 3B8AX 1Z6RA 4HTLA 1JCFA 3MMVA 2Q2RA 2IVPA 4GNIA 1GLBG 3VGLA 2ZWHA 3AY9A 3C0BA 1HKGA 2QWRA 3A5MC 2E2NA 3LM2A 2Q97A 1ESVA 4BR9A 1KAZA 3MN5A 4BRCA 1ATRA 2H3GX 5JICA 1RDWX 3H46O 3R8EA 3WUHA 1TUUA 1U2VA 2HF4A 3FZKA 4FO0A 3VGKA 1T6DA 2Q36A 1NGFA 4BRLA 4IO8A 2P9UA 4IJAA 5AZJA 1BA1A
chains in the Genus database with same CATH superfamily
3QMLA 5BREA 2YX6A 3CJ9A 3V9WA 3B6OA 2YHBA 3H3NO 4KV8A 3K59A 3AVCA 1E3MA 4FM1A 3T1HK 4WQ5C 2RE2A 3RRHA 4FJKA 2YHXA 2D0BA 3PV8A 2A40A 4DQIA 3MX5A 4FWQA 1T44A 3P38A 4ISFA 1NKBA 4CZIA 4EZ9A 2GEMA 5AQMA 1C0GA 4Y1DA 4AM7A 3V9SA 4J2AA 4PKHA 2ASMA 1KSPA 1JL1A 1HNWK 3EL2A 3MX2A 3E1YA 1NKCA 4LSNA 2P9NA 4CZLA 1NGCA 3D6RA 3CCUN 1NJWA 2UXDK 4LF7K 1HNVA 4FL9A 1VSFA 1YF5L 4DTSA 1SL0A 3U9DA 3LAMA 5ADXA 2VQFK 4KB1A 3GG4A 3FZFA 2ZJRL 2QK9A 4PKIA 4DR2K 1Q82O 2ITGA 2D5RA 5HRRA 4A57A 4CGJA 4JAXA 1T05A 2A1SA 4B1ZA 4FM0A 2EWSA 4IFEA 1JLFA 4CGHA 2PBDA 1VAZA 3KD1E 3P39A 2OZMA 3OA9A 4FK4A 3CI5A 1C1AA 4B9VA 4RWTA 1WLJA 3R1XA 3JYTA 3RVCA 3HJFA 4G1QA 5CYQA 5AQOA 1ILYA 2IC3A 1RBUA 3O8MA 5HRNA 4JK9A 4E3SA 3R9PA 4DU3A 4DR1K 3OYJA 2G8FA 4JI3K 3P83D 5GIOA 3S3MA 3QINA 2YKMA 2A42A 4IFVA 1RNHA 3W3DA 1QQNA 1IH7A 1BOTO 3ZT3A 2P5OA 5LJWA 2RN2A 5CR4A 1HYZA 3ULDA 4F2RA 1DLOA 3C6HA 2NUBA 3FGUA 3AO3A 4IO9L 1BQMA 4W5NA 3K9JA 3MAQA 4DV2K 4FOEA 3WNFA 4KTQA 3KLHA 3O9TA 3O4NA 5KRSA 4Z4IA 2Q1NA 3DWLA 4H0PA 4CJPA 1JLBA 3LM9A 1S6PA 2O8EA 5F0XA 2FSJA 1KC8O 4M41A 2OYQA 3SZ2A 4V19S 2W42A 3WNHA 4JKGB 4B3SK 1HMVA 4B1XB 1S1WA 1Y64A 4A62A 1LWFA 1XC3A 3SUQA 1RDUA 5EVZA 1NWKA 4B3MK 2XY6A 1VSLA 1C1CA 1LCUA 2CGJA 4JKAA 4YY3K 2NNWA 3SMPA 4IBNA 3QETA 3THYA 3VEXA 1QQCA 2HNZA 3D45A 3M8PA 1NGEA 1DTQA 3HSCA 1NGGA 4DV4K 4YNQA 1NGHA 3ULEB 3KKRA 4BE1A 4J8FA 4FLXA 4DR4K 4DSKA 4Y0WA 4E7JA 1KQSM 2WFBA 1N5YA 1RTDA 3VMFB 5FPDA 2IGIA 3VQ8A 2KTQA 4AH9A 3ZCMA 4CBUA 3SMSA 4U7BA 5KGWA 1MU2A 3QEWA 2VG7A 3U9ZA 3WQUA 1YI2N 2I7NA 4DSEA 3VQQA 3EZWA 4JI4K 4I2QA 1ITGA 3NFAA 3QIPA 2D4WA 4M45A 2G8VA 1X9JA 3MXIA 1N32K 4FZZA 4JKDA 4H0TB 1JJ2M 2B4JA 4Z0UA 3DYAA 3MDQA 4BR0A 3TAQA 3BZCA 1JKHA 2QWNA 2Z1IA 4MLHA 4BRFA 1LAVA 3AVBA 4B1VA 1QHAA 2WONA 3RSEB 2OPPA 4Z4FA 4C8LA 2V52B 2Q0RA 4FK2A 2ZGYA 3I55N 4Z94A 1GLLO 2I7PA 3THWB 4M42A 3L2QA 4O8KA 3T19A 5KRTA 4JI7K 4WQ4A 2HMPA 3C6TA 4DTMA 3TABA 4OKKA 2VG6A 4JKGA 4ISEA 2E1YA 1L3SA 3SK3A 4YOTA 3VQCA 3KLEA 5LY3A 1C0TA 1SL2A 3AA5X 4F9OA 4FJHA 4C8MA 5BRDA 4TSXA 3ENBA 4JRPA 4MFBA 4FWLA 1VHXA 5LJVA 3T3FA 4C8NA 4CBWA 1QQOA 5BPNA 4BRNA 4NLBA 3K5MA 1CZAN 1WSEA 2KKZA 3TTDA 4DTRA 4JI5K 3KTQA 3KWIA 2F9TA 3BDPA 2QXFA 3HSTB 3VQBA 4DLGA 4JD2A 2P9KB 3NH1A 3RMDA 2Q31A 3HZ6A 3S41A 3PSFA 3OYMA 5C12A 4WQ5A 1MDUB 4OLBA 3OJSA 4E0DA 5BPMA 3T1AA 1WSHA 4DU1A 2HHWA 1X3NA 3AO2A 3DOKA 2QWMA 1KVCA 3ASMA 4NB4A 5J2PA 4FPBA 3MCPA 3J80O 3DRSA 4IFYA 1OH6A 1E4FT 4CK3A 2FBXA 5AFUH 3AO4A 4CEAA 4KPYA 1Z25A 4DS4A 5AQKA 3VETA 1XMOK 1GLEG 5BN9A 2G8HA 3A5LC 4BDYA 3ZETA 3UB5A 4ICLA 4WF9L 1XNRK 4AHSA 2XRIA 3SQ0A 5GAGP 5C2FA 1NU0A 1IBLK 2JLEA 3AVHA 3OYEA 3LP1A 2QA4N 4FLVA 1S9GA 4K42A 4HVJA 1YXQA 4ID1A 4CF1A 4DG1A 2PFUA 3ZSYA 4I6MA 3IMXA 3VOVA 4YDUA 4KHWA 3AAQA 4DMNA 4FM2A 3F5TA 2P9PB 5B8HA 4J2EA 3ZSZA 1HYSA 3F9MA 2RKIA 3VQAA 3T7ZA 5BRHA 3AV9A 1Q86O 1SV5A 2E6MA 3ID8A 3C94A 3IRXA 3MN6A 3MWPA 5J2MA 3TSUA 4XIUA 3NVKA 1RT2A 4DV5K 5E41A 3OBWA 1RFQA 1RDAA 3DI6A 2P1JA 5I42A 4ELUA 1HR0K 1WSFA 5FROA 3DLHA 3H1QA 4OO1J 5FPNA 4YOXA 3VF4A 1RBRA 3I33A 1NOZA 3C7NB 4XH1A 2Z1JA 3E9LA 2W6KA 3H6EA 4E1JA 2V7ZA 3ATUA 1HNZK 4KI6A 2ZQBA 1A5WA 5DK5A 1S1VA 3M3ZA 3SAHA 3CQYA 1ASVA 1D9DA 4CJEA 4BE7B 3LP0A 3SUNA 4G9ZA 5AQSA 2XY7A 4CVNE 4QCLA 3V6DA 3C6UA 1K6YA 3EKUA 3Q7CA 1YT3A 1TL3A 2C1GA 4JKCA 2VG5A 4RCHA 4KFBA 4JLHA 5TKWA 1D4XA 4BRIA 3JSMA 2HBLA 3SV4A 1HLUA 4H8KA 4O5BA 3VN5A 4YOYA 4CIGA 5FRNA 4FWRA 3K57A 2VGMA 2NRHA 1NMDA 3LP2A 2WBNA 3LDOA 1TYQB 2YHYA 1HUXA 1YITN 2FF3B 2W41A 3T1YK 1L5UA 4JD2B 4DQRA 2G8IA 4GV9A 1JCFA 4DTUA 4JKEA 3EYZA 4CK1A 4KHSA 1JL2A 2PY5A 3U3GA 1OH5A 1GLBG 2ZWHA 3LM2A 2E2NA 2Q97A 4E19A 3AA4A 4BR9A 3OVNA 2H3GX 2W00A 3H46O 3WUHA 5M1FA 3V81A 1NJZA 2XY8A 4BEBA 1T6DA 2Q36A 2O8FB 4IJAA 5AZJA 1U45A 1M1KO 3UKRA 1YJ9N 1LOTB 2A3ZA 3FLCO 3VQ5A 1T03A 3ATVA 2VWBA 3KJVA 1SKSA 2F96A 5AQIA 3V9UA 3OY9A 1BA0A 1RTIA 2QWPA 3DXKA 3CQXA 4BGAA 3DJCA 1N34K 3K5LA 1NNEA 2HHIA 4OX9K 4CEBA 3U8XA 5KPZA 1RBSA 2A41A 4KHYA 2YI1A 2IOCA 3CPEA 4QAGA 1RCHA 3M8RA 1ATNA 2P9PA 4ID5A 4NXMK 2EX3A 2KQ2A 4RW8A 4O55A 4YHHK 4BE0A 2P9LB 3V1OA 4W5OA 5BR9A 1NK8A 4CJRA 3P31A 3L0QA 3PX6A 2GUPA 4BRQA 5CY4A 4DB3A 1VSMA 3P4IA 5KTQA 1W97L 1WOQA 2ZM6K 3V9ZA 4UQGA 3IFRA 4LD0A 3VEYA 4H4OA 4BG9A 2UXCK 3DLLL 5KI6A 4I7FA 2NRRA 1I94K 4A2AA 3O9QA 2FSKA 1V4TA 4KKOA 1GLDG 4WYBA 2QXLA 2VQEK 5M1OA 4DV3K 3TANA 1NGDA 3LWMA 3QNOA 4FLYA 2QWLA 3RSEA 1S6QA 4B3OA 1W7AA 1WSGA 1BL3A 1FKOA 3MCAB 1O1WA 3WXJA 1BIUA 1HJOA 4M3RA 3CM5A 5GADP 1JLAA 3D7EO 2R7YA 4A2BA 3THYB 4CHZA 1QSSA 3CJCA 2E5LK 1CXUA 5AZJB 3CC4N 1N8RO 1FKPA 2D0OA 5M1NA 3L2VA 1GOBA 3HRGA 5EU7A 2OPSA 4ILHA 1SAZA 3NGZA 3C95A 3HTVA 5JS1A 1KCFA 4B3RK 1P8ZA 3I56N 1GLJO 1HKBA 4BRKA 4BR4A 3O3GA 4BY9C 4OGEA 4FLZA 4FVUA 1C6VA 3O9RA 4B9UA 3HPGA 4CGFA 4HUGA 2O8DA 3E66A 4O44A 1WAFA 3O80A 4W5RA 4N41A 3EO3A 1EETA 4X66K 5HRSA 4DQSA 1BG3A 5JLFA 3LANA 5CZ2A 2HNYA 1Q9XA 4BACA 3OYFA 1DKGD 1U2VB 1HQEA 3C6AA 2HW3A 3TAGA 4YOUA 3ZT1A 3WXKA 5AQQA 5GINA 4CEZA 3HBTA 3HP6A 3OYGA 3TU5A 4JHDB 1BHLA 1C0FA 5GAEP 1QZ6A 4B08A 2CH5A 5ELZA 3GL1A 3M6GA 3OW2M 4DS5A 3QB0A 4DWIA 1RT5A 4FJXA 4JEPA 3E9OA 4GVMA 1SZ2A 2FXUA 3R6MA 4ELVA 4RW4A 3J81O 5J2NA 3AVNA 4NYNA 4DQQA 3AVKA 2HSTA 3L3UA 1HNXK 4N76A 1IV0A 1BISA 3N4PA 3DLRA 4DSFA 5I9EB 5DM7L 1QQMA 1JCEA 3SI6A 3OS0A 2ASPA 3AA2A 4BC2A 3CPWM 3CCLN 3NH0A 3E9PA 4FWNA 3OYIA 1HX1A 4IDKA 3OYLA 3FE1A 3TSPA 3O3HA 3KK7A 4K41A 1VQ4N 1KFSA 2YCHA 4ZTJA 4F2SA 4JI2K 3RMBA 3CJ7A 4M3UA 3NF8A 2DFHA 4FCYA 3HI0A 1V4SA 4CZKA 3N4QA 4B9SA 3I8BA 4B9MA 1JLCA 3QDKA 4EIAA 1ASWA 4YOVA 3TAEA 3F2KA 1SL1A 4BWJA 4NYFA 3LDQA 3VF2A 1T3VA 4HWIA 1S5JA 3BEXA 2ZD1A 2DPNA 2NLXA 4I9LA 5IWAK 4KHPK 3MXMA 1ASUA 1U49A 2V7YA 3AGRA 3QBXA 5HBMA 2AA4A 4F3TA 5SWMA 2OTJN 1HJRA 2F7TA 1X1PA 4N47A 4C8KA 2O4IA 5C0YA 5I3UA 2IVNA 4GKJK 4DV7K 5AZIB 3AVFA 4FWSA 4NCGA 3SQ4A 1TKZA 2FSNA 4OPHA 5AQHA 3MECA 1ZBFA 3SJHA 1S9EA 1KFDA 4CF8A 4H5VA 3QBWA 4DR6K 4U67L 3AVJA 1VRTA 1FXXA 3HVRA 1HKCA 1EP4A 3CM6A 3AO5A 3V4IA 1N6QA 4FJ5A 2E4LA 1NJYA 3IKMA 4MLEA 3ZX2A 4CJKA 4BRAA 2KFNA 3S5TA 1TK0A 5KPRA 1VK0A 1NGBA 3TWHA 4BR2A 2O8BA 2FLOA 1Z26A 4OJRA 5AQJA 1HPZA 4EHTA 3LWLA 1J5OA 4EFHA 4H0OA 4E7IA 2HVIA 4OVLA 4CJQA 4FYDA 4IWVA 3NVMA 4CCHA 1RDCA 3U6FA 1IBKK 4JKBA 1TAQA 1KXPA 4KH5A 4AHTA 1KRPA 4J2BA 2AP1A 5AQZA 2VCPA 3FFKB 5JLHA 5AQYA 3BZKA 3CCVN 4KO0A 4Z4GA 3DXMB 4GV3A 2HNDA 2X78A 5D3GA 4C1NK 4CZJA 3ZT0A 4MDAA 1XC9A 2AJQA 3GOIA 4E1NA 1SS6A 5CYMA 1NJIO 4M7YA 1TGOA 4PWDA 4CFBA 5HOOA 5JMVA 4FWOA 4NO7A 3NMUA 1BU6O 1KVAA 4PQUA 2GWJA 3BF3A 2ZF5O 3O9UA 4Z4CA 4RW6A 3O5BA 4HTUA 4IOCL 1SKWA 2FBVA 1NK4A 5FPEA 4PY5A 3G6EN 1HPMA 3ZSVA 3U3YA 3ULEA 4CGGA 1GLAG 5GAHP 3SBGA 4DTPA 2OZSA 1EKEA 3ZSQA 3CCQN 4CJWA 5MLCQ 1RT4A 4DUZK 3VGMA 3ALYA 1W2BM 1VQPN 3EE9A 2NRWA 3T69A 4FW1A 3L4QA 4BQLA 4DTOA 4CJVA 2FBTA 4B9QA 4RW9A 3FZMA 4DF8A 3DLEA 1IBMK 1Z6RA 4ZTFA 2XO7A 2Q2RA 2IVPA 3WNGA 2HHTA 2BE2A 4OLAA 4BDZA 4DKWA 5KGXA 3L2RA 1HKGA 3A5MC 2HVHA 1ESVA 2DFEA 5LL6Z 4A5AA 4DQPA 5HRPA 5JICA 4CEDA 1Q7YO 3L2UA 4FO0A 3VGKA 3SAFA 3DXMA 3ZEUA 2D0AA 1YIJN 4FZXC 3I0RA 3QEPA 1IKYA 4CGDA 3H3OB 4CZMA 1TL1A 4BC5A 5AQGA 4LF9K 2BUPA 4LH4A 2X74A 1VSKA 5AR0A 2Z1GA 1YJNN 2YHAA 4LFBK 1TKXA 3UIQA 1MA9B 3QICA 1BI4A 3KK3A 2B5JA 4O0IA 1NKEA 3VQ6A 4CHQA 3ENHA 4CHNA 2HHUA 1S22A 2NRZA 3CYMA 3LZJA 4XH4A 1S72N 4CHOA 3NGIA 1J5EK 1H1VA 4CI6A 1YHQN 3UE5A 3VEZA 3ID6A 4NCBA 5A2QO 1J54A 4IOXA 1CLQA 3VENA 1UOCA 2UUAK 4FJ8A 5C42A 3P1GA 4WCEL 5DM6L 3D2EB 1GOAA 2NZTA 1TVRA 5HP1A 1ZBIA 3AVLA 1YTAA 3TAMA 1K8KA 1L3TA 4CHPA 3SAGA 4BG8A 3NDKA 1IG8A 3WXIA 1U04A 2RHKA 3CG7A 2KLAA 4JRQA 4BQZA 4LF8K 4M63C 3CCEN 4XH5A 1XUPO 2GELA 2OPRA 3C65A 4H5NA 5E26A 1TK5A 3PIPL 1NGJA 4F3OA 4LF4K 1QE1A 1OVYA 2Z1HA 2Y1JA 4L3QA 2ATQA 3EN9A 3VERA 3BP8A 1HQUA 1IO2A 4M7XA 4JKHA 1VQLN 2D0PA 4KBOA 5C15A 4Z4HA 3L6QA 1BCOA 3THXA 1UAXA 2HMIA 3KVGA 3ZEUB 3AGKA 3TAPA 4X64K 4C23A 4AHVA 4BRMA 2IAJA 2JWLA 2WUSA 4FLUA 4DV6K 4BWMA 4HCCA 3ZT4A 5M1PA 3A5NC 2Q3SA 1I39A 3MEEA 2O4GA 5FRMA 3CFRA 1RTJA 2CH6A 5C25A 2JWKA 3VA3A 1XQSC 4Z4EA 3NF6A 4IJNA 2E2OA 3KD5E 4JI6K 3CC7N 5CHIA 1OH8A 3VQ9A 1TYQA 3HYFA 3NF9A 3A0IX 4BR5A 2HHVA 3TPQA 3OTOK 3MEDA 2UUBK 1IKWA 4CF2A 3OYAA 5EY4A 4CZEA 1ZBHA 1OVQA 2IVOA 3L4IA 3DLGA 3J7ZO 2ZGZA 2QM1A 1KLMA 3BGRA 3SCXA 4O0JA 3DM2A 4IXCA 1YVUA 4QS8A 3D0PA 2E20A 4KHUA 4H0VB 3CCSN 4DV1K 2XY5A 1JXBA 1U48A 3H45C 4CBXA 4N5SA 3VQEA 1EWQA 1C0MA 1VQMN 4GW6A 5M1QA 3PY8A 4E72A 3OYBA 4FWKA 4ISGA 4LSLA 3WEEA 3CFOA 3E01A 3LAKA 2QWQA 2A1RA 2YKNA 4BRPA 3CJBA 3CF5L 1D9FA 4CGIA 3ZX0A 1KD1O 2YNHA 4FLTA 3TSQA 1JLEA 3CCRN 3KKSA 3KZBA 3CHWA 1K73O 4CD3A 3PLAA 3M1FA 3VEOA 4F4KA 5HLFA 4BROA 1WNSA 1DEJA 2ASOA 1UA1A 2P9IA 4B9TA 1R0AA 2PYLA 4NXNK 3SV3A 1WSJA 3NH2A 4QS9A 3VF6A 3VA0A 1S3XA 4JI1K 4CJ3A 4JNEA 4QS7A 5JS2A 5AQRA 3ZT2A 4R79A 4EZ6A 3V9XA 3M8SA 3CMEN 5AQNA 1WBBA 2RPIA 3AVIA 4RTFD 3NGYA 2P9SB 2HOEA 4BDPA 2QKBA 4CD1A 3KK1A 2DFFA 4E1MA 4BC4A 2PAVA 4K43A 4B8AB 3K0SA 1RGIA 2VYPA 3CJAA 4JI0K 5AQUA 1S1UA 1SUQA 1J53A 4A59A 4A61A 1HYVA 4B1YB 4CJ7A 3RTVA 4ELTA 4PL8A 4KTZA 1RBTA 4H5RA 4IDHA 3O6WA 3OHRA 4CFDA 4GV6A 4KRFA 1HRHA 4CEQA 5AQPA 3QEVA 5BN8A 1KTQA 1LV5A 3G25A 1TKDA 4B3TK 1X9WA 4W5TA 4BRDA 3HM8A 4AHRA 3OYDA 3THXB 4CFCA 4IG0A 4KHNA 4Q5VA 1BGXT 5AQTA 3MWTA 5KPTA 3PX4A 2O8BB 1VQON 3VQDA 4NCAA 4H03B 2P9LA 4JKFA 2HHSA 3NE6A 3MK6A 1VQNN 1NLVA 4KB0A 3O9SA 3DMJA 1KAYA 3VQ4A 1R59O 3PSIA 2YJFA 3S3NA 1EWRA 4Q0BA 1NJXA 2P9IB 3CMAN 2P9NB 1NK9A 1IKVA 1NK5A 4PL7A 2IS3A 4FJLA 1GOCA 2IIRA 3ZYYX 4E7LA 4CK2A 2V51B 4CE9A 3MXJA 4PUOA 1UWBA 5IT9O 3P5JA 1C0UA 5ADXH 3BY5A 1G99A 3AO1A 2P9SA 3LZIA 2QEXN 5AQWA 2HB5A 4JYAK 1N33K 3QERA 1Z05A 4FVMA 4CZHA 5FPMA 5AQVA 4JI8K 1X9MA 2F8SA 4CHYA 5T7BA 3TARA 3CIPA 3I0SA 3OYKA 4CEFA 3HPHA 2ZJQL 1Q8IA 3G4SN 3OS2A 4JHDA 4ILGB 4LH5A 5AQFA 1M90O 4FJIA 4CERA 3M8QA 4DTJA 3THVA 4DTXA 3IAYA 5M1KA 4M3ZA 2KFZA 4O8UA 3WXMB 4O5FA 4B9NA 3IS9A 1QSYA 1T6CA 1WBDA 3TAFA 4CZFA 1Q9YA 3F73A 3NF7A 4PKGA 2B6AA 4FXDA 1QHTA 4CJFA 4DHYA 4EHUA 3G71N 3EY1A 1W0HA 1BI4B 2W40A 2W6LA 3IUCA 3F9KA 4B1UB 4K8XA 3SYZA 4DSJA 3LALA 1NGAA 4EP4A 2F9WA 3GDQA 4CEOA 1KVBA 1O13A 4LF6K 2BH1A 3UKUB 1WSIA 5HL7L 4FJNA 3RWUA 3CETA 3O4WA 4MQ3A 2QKKA 3JS6A 1VQ5N 4H5WA 2HBKA 3GBTA 2DY4A 4BRHA 4DR7K 3THWA 1BO5O 3AA3A 3EZ5A 3SUOA 3RR8A 1QSLA 3ISNC 4GY2B 3A8YA 2E8AA 3SQ2A 3K58A 1NK0A 5EX5A 3B8AX 2GX9A 4QOZB 3QNNA 3ZSXA 4ZHRA 1FW6A 1B92A 4UY8O 3PUFA 4RW7A 2IDOA 3VGLA 3AY9A 3C0BA 1EO1A 2QWRA 4DSLA 2UU9K 2YV0X 3MEGA 3WNEA 1KAZA 1ATRA 4EP5A 5FLXO 1RDWX 3R8EA 2NRTA 1TUUA 3KWGA 2UUCK 4BRLA 2X6NA 4YFUA 5K14A 3AVGA 1BA1A 1S1TA 4KHQA 1K9MO 1JXEA 2VWJA 1BDGA 3HXMA 1L3UA 3H1VX 4FJGA 4LC9B 3I8DA 4L8RB 4GVEA 4CJ5A 2HHQA 4DFKA 1IKXA 3WXLA 3ZLJA 4FOIA 1RILA 5BRFA 3LPTA 5CE3A 3B6PA 4FPAA 2EHGA 3V1RA 3CC2N 1RT3A 3LPUA 2FC0A 1MWMA 3QIOA 5LMUK 1QVGM 4LFAK 1ZC6A 4EAHD 3VTIA 1XI1A 3VQPA 1D8YA 3CFPA 5BPLA 3SPZA 1K8KB 1NOYA 4YORA 3VESA 2O8FA 5KQ8A 3QESA 5C2DA 1TK8A 2BDPA 3GE1A 2UYTA 1U4BA 3M5RA 1DTTA 1VQ8N 3DAWA 4R5PA 3HK2A 3CD6N 1J9AA 1L3VA 2KZZA 1U6ZA 4CFAA 2PYJA 3KLIA 3SNNA 1RT6A 1E4GT 1XWLA 3DXKB 1U47A 2FF6A 2O8CB 3H08A 4M3YA 1IJJA 3WQTA 2E2QA 4CF0A 2G8UA 4XJXA 4HCBA 4AM6A 2CGKA 5C10A 4CECA 1C1BA 4HUFA 1VQ7N 3L2WA 1NM1A 3VEVA 4OKEA 3EEQA 4BVOA 4DUYK 4FJMA 2Q0UA 1OKJA 3HL8A 1QTMA 2BTFA 1LWEA 1RBVA 4CJSA 5BR8K 3K2PA 4M3WA 4H0YB 2WTUA 3A2FA 1Y97A 2OTLN 2D0CA 1LWCA 4CJUA 1OH7A 2VGNA 5EXWA 1D5AA 1XMQK 4A5BA 3LDPA 4AHUA 2P9UB 2E1ZA 2GTDA 3TI0A 1RT1A 5KQDA 3QEIA 3RMCA 2X6SA 4BREA 2OPQA 1J6ZA 3ENOA 1VQKN 3CXCM 1NBWA 4FZYA 2CGLA 1YUWA 1JLQA 4RG8A 3ZETB 1VQ6N 2YNFA 1NG9A 3HO1A 3CYGA 5FDLA 4FJ9A 5JENA 2E6LA 1BCMA 3CERA 4IEEA 1HNIA 4FSVA 3O08A 4O4GA 4KTWA 1VSEA 1YTUA 2JGUA 4M3XA 1ATSA 2HHHK 4I6MB 4WFAL 4MO5A 1LW2A 4E7HA 1CZ9A 4K8ZA 4AHCA 3HPOA 4WQ4C 4LF5K 2GWKA 1KLNA 4CJTA 1CZBA 1DT9A 1QVFM 4BGBA 4CEEA 3ZSOA 1XHZA 3LDLA 1VRUA 1WN7A 4DSIA 4OPAA 3ZSRA 4OPJA 3C7NA 4E7KA 1NK6A 3OJUA 3KIOA 1GLCG 1S1XA 4B9LA 4CZGA 4DLEA 1TKTA 3SPYA 3DLBA 1JLGA 1LAWA 3PO5A 3G0ZA 3QLHA 3TR8A 4I9QA 2RF2A 2G8WA 4H5TA 4DF4A 4FWMA 5H1SQ 4LFCK 1EQYA 3FZLA 3FZHA 2E88A 4DR5K 1B9DA 1REVA 3Q7BA 3HT3A 4GMJB 1VQ9N 3SJJA 2KHOA 4MO4A 4KREA 2I5JA 2WOMA 3OS1A 2NRXA 1VSHA 1A5XA 3BF1A 4KI4A 1Q18A 1N36K 1FK9A 1ZYQA 4DV0K 3HOTA 3HP9A 4JK7A 2D1KA 2Y1IA 4KAZA 1BIZA 1I3AA 4BC3A 2P5GA 3AARA 4XEIA 2YJEA 3DRRA 4OKJA 4JS5A 4CIFA 4DQ8A 1WB9A 1W9HA 1DGKN 1SQKA 3D2FA 3TTFA 2WC9A 4AILC 4DCHA 1ZBLA 3LL3A 1NK7A 4DFJA 1TAUA 3LDNA 3NAEA 4BRGA 4PA1A 1T8EA 2E2PA 3W0LA 1UA0A 1X9SA 1RDBA 5LMNK 3RMAA 2DTUA 4I2PA 4C1NI 2OCEA 4FW2A 2OANA 4BR7A 2UXBK 5HROA 4YDUC 4JS4A 3O3FA 4BE2A 1XNQK 4H4MA 5J2QA 5J1EA 3HVTA 1X3MA 1KAXA 2J4RA 1NGIA 1TV6A 4M3TA 3MN9A 4DFPA 2F8TA 4W5QA 4FJ7A 4KH4A 4B1WB 3PIOL 2FBYA 3K5NA 1BUPA 5EOYA 2A6AA 4OPKA 2HBJA 3NHGA 3S3OA 1QS4A 3VQ7A 4HUEA 1T7PA 1NMNA 1ZBSA 2VWKA 3MN7A 2OA8A 4F8RA 4H0XB 3RR7A 3D2EA 4JK8A 4JN4A 4E89A 1SKRA 5C24A 2GUIA 2KZMA 3CQ8A 1LW0A 2G8KA 1EX4A 2YNGA 1VSJA 2QI2A 3JXUA 4CJ4A 3K5OA 2P9KA 3UKRB 3J7AP 4WE1A 3DOLA 1RDDA 3G10A 1P90A 3FFIA 3O1WA 3AVAA 4DR3K 3U4LA 4FJJA 3KLFA 3CJ1A 5AQLA 4K25A 4DFMA 4NLCA 3L8BA 2PZSA 4J2DA 3KK2A 3HM9A 5AZIA 4PHTX 1FJGK 4WFNL 3D2FB 4FK0A 1VSIA 3WT0A 2A5XA 4YOWA 2KW4A 2ITMA 3OYCA 3HOSA 1JCGA 3OYHA 3ZSWA 2P51A 3SBTA 5DMRA 4BVPA 5SZTA 3OBYA 3KHYA 5JVHL 1VSDA 5TKYA 4IKFA 5AFUA 3TTCA 4DTNA 2QTDA 3IDHA 3VPZA 5F1XA 3OYNA 3EKSA 3JAMO 3QO9A 2QW9A 4KH6A 3CCMN 1IG9A 2NRVA 2ETJA 3NBPA 5JVGL 3SUPA 1WUAA 1CXQA 2YNIA 3LDSA 4BECA 3ZX3A 1A5VA 3UKUA 5AQXA 1Q81O 3BUZB 1XHXA 3A5OC 3S9HA 3VTHA 3AAPA 2ZJPL 1YJWN 3SLCA 4FLWA 3IG1A 3QFUA 4AQYK 3PO4A 4N56A 3VEWA 2HHXA 1ZXOA 4DU4A 3CCJN 4CF9A 2GBZA 1RTHA 1WAJA 4OGCA 4B8CA 2O8EB 2O8DB 1EXQA 1QZ5A 1GLFO 4CJLA 2BGGA 2YHWA 3FR0A 3O1BA 1ZBUA 4FWPA 1BWFO 1K8AO 4JV5K 5F2RA 1TUYA 1G15A 5E84A 1B9FA 4LY7A 4GKKK 4IZ9A 1RT7A 3L3VA 2O8CA 4K0KK 2HBMA 3KLGA 3QFPA 4IG3A 1F21A 1BQNA 1YAGA 2BANA 4X65K 3LP3A 2F4VK 3DRPA 3V1QA 1MWKA 3PX0A 2GV9A 3EE8A 3J8AA 4ILJA 3WEEB 3RRGA 3O4QA 2QWOA 3K9KA 4C8OA 2HF3A 2ZE2A 5CZ1A 1YVNA 4CIEA 2XHBA 4IOAL 4HTLA 3MMVA 3NCIA 2C1IA 4AF1A 4WFBL 4CW7B 4X62K 2LSNA 4GNIA 3SQ1A 3DLKA 3MN5A 4BRCA 4Y1CA 3QEXA 5AJ3K 1U2VA 2HF4A 3ITHA 3FZKA 3J7YP 5GIPA 4HHTA 1NGFA 3R3LA 4CESA 3AVMA 4IO8A 4IEIA 2P9UA 4MDBA
chains in the Genus database with same CATH topology
3QMLA 5BREA 3DXMA 3ZEUA 2YX6A 3CJ9A 1K9MO 1YIJN 1BDGA 1M1KO 3UKRA 1YJ9N 1LOTB 2A3ZA 3FLCO 3H1VX 3H3NO 3ATVA 2VWBA 4LC9B 3H3OB 4CZMA 4GVEA 4WQ5C 2RE2A 4BC5A 5AQGA 2BUPA 5AQIA 3WXLA 2YHXA 2A40A 1BA0A 3MX5A 4FWQA 2QWPA 1T44A 3DXKA 3CQXA 3P38A 3DJCA 4FOIA 4FPAA 4ISFA 4BGAA 5AR0A 4CZIA 5CE3A 2GEMA 5AQMA 1C0GA 4AM7A 3CC2N 4PKHA 2ASMA 1MWMA 1YJNN 3EL2A 1MA9B 3E1YA 1ZC6A 3MX2A 3U8XA 3VTIA 4EAHD 1QVGM 3QICA 2P9NA 4CZLA 1NGCA 3D6RA 5KPZA 3CCUN 5BPLA 1K8KB 4YORA 3VESA 4FL9A 2A41A 1YF5L 2YI1A 3CPEA 5KQ8A 5C2DA 1ATNA 3U9DA 5ADXA 2P9PA 3GE1A 2UYTA 3FZFA 3ENHA 3GG4A 3M5RA 2ZJRL 1VQ8N 4PKIA 3DAWA 1Q82O 1S22A 4A57A 2P9LB 3CD6N 2NRZA 1S72N 4XH4A 5BR9A 1U6ZA 3P31A 4JAXA 3L0QA 4B1ZA 1H1VA 2EWSA 2GUPA 1E4GT 4IFEA 4BRQA 2PBDA 4CI6A 3DXKB 1YHQN 3UE5A 3VEZA 1VAZA 2FF6A 3ID6A 3P39A 4DB3A 4IOXA 3OA9A 3P4IA 1IJJA 1W97L 3CI5A 3WQTA 3VENA 2E2QA 1WOQA 4RWTA 4XJXA 3R1XA 4AM6A 3RVCA 4WCEL 5DM6L 3D2EB 2CGKA 5C10A 2NZTA 3IFRA 5AQOA 1ILYA 3VEYA 1VQ7N 1NM1A 4BG9A 1K8KA 3O8MA 3DLLL 5BRFA 3SAGA 2NRRA 3VEVA 4BG8A 4JK9A 4A2AA 1IG8A 2FSKA 3O9QA 1V4TA 3WXIA 3R9PA 2RHKA 1GLDG 4BVOA 4WYBA 1OKJA 2Q0UA 2QXLA 5GIOA 2A42A 2KLAA 3W3DA 1QQNA 2BTFA 5M1OA 1BOTO 5LJWA 5CR4A 4BQZA 1NGDA 4M63C 3CCEN 4XH5A 3C6HA 1XUPO 2GELA 3C65A 3FGUA 4H0YB 4H5NA 2QWLA 5E26A 3RSEA 3K9JA 4IO9L 4FOEA 3PIPL 1NGJA 2OTLN 3MCAB 3O9TA 1OVYA 3WXJA 4L3QA 3EN9A 1HJOA 3VERA 2VGNA 3BP8A 5EXWA 5GADP 3D7EO 2Q1NA 3DWLA 4H0PA 4A2BA 4M7XA 3LM9A 4A5BA 4JKHA 3CJCA 3LDPA 1VQLN 2D0PA 2P9UB 2E1ZA 2GTDA 4KBOA 3L6QA 5C15A 5KQDA 5AZJB 2FSJA 5F0XA 3CC4N 1N8RO 1KC8O 4BREA 3KVGA 3ZEUB 3AGKA 2D0OA 5M1NA 1J6ZA 3ENOA 3HRGA 4C23A 4BRMA 4JKGB 4B1XB 2JWLA 2WUSA 1VQKN 3CXCM 1NBWA 1Y64A 2CGLA 1YUWA 4ILHA 4A62A 3ZETB 1VQ6N 1XC3A 1RDUA 5M1PA 5EVZA 1SAZA 3A5NC 1NWKA 3HTVA 2CH6A 2JWKA 3CERA 1P8ZA 4IEEA 3I56N 4FSVA 1GLJO 1LCUA 2CGJA 3O08A 1HKBA 4BRKA 1XQSC 4IJNA 4JKAA 2NNWA 2E2OA 4BR4A 1ATSA 3CC7N 4BY9C 3SMPA 4I6MB 5CHIA 4WFAL 4MO5A 3VEXA 4FVUA 4WQ4C 1TYQA 2GWKA 3O9RA 1DT9A 1QVFM 1NGEA 3A0IX 4BGBA 4BR5A 3HSCA 3E66A 3TPQA 1NGGA 3LDLA 5EY4A 1NGHA 3O80A 3ULEB 4CZEA 4OPAA 4J8FA 2IVOA 3C7NA 3EO3A 3L4IA 3J7ZO 4Y0WA 2ZGZA 2QM1A 1GLCG 1BG3A 1KQSM 4IXCA 5JLFA 2WFBA 4CZGA 4QS8A 3VMFB 5FPDA 2E20A 4H0VB 4CBUA 3SMSA 4U7BA 3CCSN 3U9ZA 1DKGD 3H45C 2I7NA 3WQUA 4CBXA 1YI2N 1U2VB 3C6AA 3EZWA 4H5TA 4FWMA 5H1SQ 1EQYA 3FZLA 4YOUA 3FZHA 3WXKA 5AQQA 1VQMN 2E88A 5M1QA 2D4WA 5GINA 4FWKA 4ISGA 1X9JA 3HBTA 3WEEA 3Q7BA 4JKDA 4H0TB 1VQ9N 2KHOA 2QWQA 3TU5A 4BRPA 3CJBA 4JHDB 4MO4A 3CF5L 1JJ2M 1C0FA 5GAEP 1QZ6A 2CH5A 2NRXA 3GL1A 3M6GA 3MDQA 5ELZA 3QB0A 4BR0A 3OW2M 2QWNA 3BF1A 3ZX0A 1KD1O 4MLHA 1Q18A 4JEPA 3E9OA 4BRFA 1SZ2A 2FXUA 3R6MA 3TSQA 4B1VA 3CCRN 3HOTA 1QHAA 3RSEB 3KZBA 3CHWA 4JK7A 1K73O 4CD3A 3PLAA 2D1KA 2HSTA 3M1FA 2V52B 4BC3A 2Q0RA 3VEOA 2ZGYA 4XEIA 3AARA 3N4PA 3I55N 4BROA 1DEJA 2ASOA 4Z94A 2YJEA 1GLLO 5I9EB 5DM7L 2P9IA 2I7PA 4DQ8A 4O8KA 1DGKN 1QQMA 1SQKA 1JCEA 4QS9A 3VF6A 4WQ4A 1S3XA 2HMPA 3D2FA 4JNEA 3TTFA 2WC9A 3G6EN 4QS7A 2ASPA 4BC2A 4DCHA 3CPWM 3CCLN 3LL3A 4JKGA 5AQRA 4ISEA 2E1YA 3E9PA 4FWNA 4R79A 3LDNA 3SK3A 3CMEN 1HX1A 4YOTA 4BRGA 5AQNA 5LY3A 2E2PA 4RTFD 3FE1A 3TSPA 2P9SB 4F9OA 3KK7A 4K41A 2HOEA 3W0LA 1VQ4N 4CD1A 2YCHA 5BRDA 3ENBA 3CJ7A 4FWLA 5LJVA 4BC4A 4C1NI 4CBWA 1QQOA 2OANA 2PAVA 3HI0A 1V4SA 4K43A 4BR7A 4CZKA 3N4QA 1RGIA 5BPNA 2VYPA 4BRNA 3CJAA 3I8BA 4NLBA 4YDUC 5AQUA 3QDKA 4EIAA 1CZAN 3TTDA 2KKZA 4A61A 4A59A 3F2KA 4YOVA 4B1YB 3KWIA 3LDQA 2F9TA 4CJ7A 4PL8A 3VF2A 1X3MA 4H5RA 1T3VA 1KAXA 4HWIA 4IDHA 3O6WA 2J4RA 3OHRA 4GV6A 3BEXA 1NGIA 4JD2A 2P9KB 5AQPA 2DPNA 2Q31A 3HZ6A 3MN9A 3S41A 5BN8A 2NLXA 4KH4A 5C12A 4WQ5A 4B1WB 3PIOL 1MDUB 1BUPA 5EOYA 2A6AA 2V7YA 2HBJA 3AGRA 3QBXA 3G25A 5BPMA 2AA4A 2OTJN 1X3NA 1ZBSA 2F7TA 3MN7A 2QWMA 4BRDA 4H0XB 5C0YA 3D2EA 4NB4A 4FPBA 2IVNA 3MCPA 3HM8A 4JK8A 4JN4A 1E4FT 5AZIB 5AFUH 4FWSA 2FSNA 2QI2A 5AQTA 3JXUA 3MWTA 4OPHA 5KPTA 1VQON 5AQKA 5AQHA 3VETA 1GLEG 2P9KA 3UKRB 5BN9A 3A5LC 4H03B 2P9LA 4JKFA 3ZETA 3UB5A 3SJHA 1P90A 3MK6A 4WF9L 4H5VA 1VQNN 3O1WA 1NLVA 3QBWA 3O9SA 5GAGP 4U67L 5C2FA 1KAYA 1HKCA 3U4LA 2QA4N 1R59O 3CJ1A 4K42A 5AQLA 1YXQA 2YJFA 4K25A 2PFUA 3IKMA 2P9IB 4MLEA 4NLCA 3ZX2A 3CMAN 4I6MA 3IMXA 3VOVA 4YDUA 2P9NB 4BRAA 3AAQA 5KPRA 1NGBA 5AZIA 4PHTX 4WFNL 3D2FB 4PL7A 3WT0A 4BR2A 2FLOA 2A5XA 5AQJA 2IIRA 3F5TA 2P9PB 2ITMA 3ZYYX 4EHTA 4YOWA 3HOSA 2V51B 1JCGA 5B8HA 4EFHA 3SBTA 5ADXH 4BVPA 4H0OA 3F9MA 1G99A 3T7ZA 5BRHA 3OBYA 2P9SA 3KHYA 5JVHL 5AQWA 2QEXN 4IWVA 1Q86O 3ID8A 5TKYA 1Z05A 3NVMA 5AFUA 4CZHA 3TTCA 2QTDA 3IDHA 3MN6A 3MWPA 5FPMA 3TSUA 3VPZA 5AQVA 5F1XA 3EKSA 4JKBA 3NVKA 1KXPA 3OBWA 4KH5A 3CIPA 1RFQA 2QW9A 2AP1A 5AQZA 2VCPA 4KH6A 3CCMN 3FFKB 2NRVA 5JLHA 5AQYA 3CCVN 5JVGL 1WUAA 3DXMB 4GV3A 2ZJQL 3G4SN 4JHDA 3H1QA 4ILGB 5AQFA 1M90O 4OO1J 5FPNA 4C1NK 4CZJA 4YOXA 4MDAA 4BECA 3VF4A 3ZX3A 3I33A 5M1KA 3UKUA 3C7NB 4O8UA 4XH1A 5AQXA 3E9LA 1Q81O 3GOIA 4O5FA 3WXMB 1SS6A 3BUZB 3H6EA 4E1JA 1NJIO 2V7ZA 3A5OC 3ATUA 4M7YA 3VTHA 5HOOA 1T6CA 3AAPA 5JMVA 4FWOA 4NO7A 4CZFA 2ZJPL 3NMUA 1YJWN 1BU6O 3SLCA 4PKGA 2GWJA 3SAHA 3M3ZA 3QFUA 3G71N 3BF3A 4DHYA 4EHUA 3CQYA 3VEWA 1ZXOA 3CCJN 2W40A 2ZF5O 3O9UA 3IUCA 4BE7B 4G9ZA 5AQSA 4B1UB 3O5BA 4IOCL 5FPEA 1QZ5A 1GLFO 1NGAA 3EKUA 1HPMA 2YHWA 2F9WA 3FR0A 3O1BA 3ULEA 3GDQA 3Q7CA 4FWPA 4JKCA 1BWFO 4RCHA 1K8AO 1GLAG 1O13A 5F2RA 2BH1A 5TKWA 1TUYA 3UKUB 5HL7L 5GAHP 3SBGA 5E84A 1D4XA 4BRIA 3CETA 3O4WA 4IZ9A 3CCQN 2HBLA 3JS6A 1VQ5N 1HLUA 5MLCQ 2HBMA 3QFPA 4H5WA 2HBKA 3GBTA 4YOYA 4BRHA 4FWRA 1YAGA 2VGMA 3VGMA 2NRHA 1BO5O 1W2BM 1VQPN 1MWKA 1NMDA 2NRWA 3EE9A 3T69A 3EE8A 3J8AA 2WBNA 3L4QA 3LDOA 1TYQB 2YHYA 4ILJA 1HUXA 4BQLA 1YITN 3WEEB 2FF3B 4B9QA 2W41A 2QWOA 3A8YA 3K9KA 4GY2B 2E8AA 3FZMA 4JD2B 2HF3A 1YVNA 5EX5A 3B8AX 4GV9A 1Z6RA 2GX9A 4HTLA 4IOAL 1JCFA 2C1GA 3MMVA 2C1IA 2Q2RA 4JKEA 4AF1A 4WFBL 2IVPA 4UY8O 4GNIA 1GLBG 3VGLA 4DKWA 3C0BA 2ZWHA 3AY9A 1HKGA 2QWRA 3A5MC 2E2NA 3LM2A 2Q97A 1EO1A 1ESVA 4A5AA 4BR9A 1KAZA 3MN5A 4BRCA 1ATRA 2H3GX 5JICA 1RDWX 2W00A 3H46O 3R8EA 2NRTA 3WUHA 1TUUA 1U2VA 2HF4A 3KWGA 3FZKA 5M1FA 4FO0A 1Q7YO 5GIPA 3VGKA 4BEBA 1T6DA 2Q36A 1NGFA 3R3LA 4BRLA 4IO8A 4IEIA 3SAFA 2P9UA 4MDBA 4IJAA 5AZJA 1BA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QML A;  5BRE A;  3DXM A;  3ZEU A;  3CJ9 A;  1BDG A;  3UKR A;  1LOT B;  2A3Z A;  3FLC O;  3H3N O;  3H1V X;  3ATV A;  2VWB A;  4LC9 B;  3H3O B;  4CZM A;  4WQ5 C;  4BC5 A;  5AQG A;  2BUP A;  5AQI A;  3WXL A;  2YHX A;  2A40 A;  1BA0 A;  4FWQ A;  4FOI A;  2QWP A;  1T44 A;  3DXK A;  3CQX A;  4ISF A;  3DJC A;  4BGA A;  4FPA A;  5BRF A;  5CE3 A;  5AR0 A;  4CZI A;  2GEM A;  5AQM A;  1C0G A;  4AM7 A;  4PKH A;  2ASM A;  1MWM A;  3EL2 A;  1MA9 B;  1ZC6 A;  3U8X A;  4EAH D;  3QIC A;  2P9N A;  4CZL A;  1NGC A;  5KPZ A;  5BPL A;  1K8K B;  3VES A;  4FL9 A;  2A41 A;  2YI1 A;  5KQ8 A;  1ATN A;  3U9D A;  5ADX A;  2P9P A;  3GE1 A;  3GG4 A;  2UYT A;  3ENH A;  3FZF A;  4PKI A;  3DAW A;  1S22 A;  2P9L B;  4XH4 A;  5BR9 A;  1U6Z A;  4JAX A;  3L0Q A;  4B1Z A;  1H1V A;  2EWS A;  2GUP A;  1E4G T;  4CI6 A;  4BRQ A;  2PBD A;  3DXK B;  3UE5 A;  3VEZ A;  2FF6 A;  4DB3 A;  3P4I A;  1IJJ A;  3CI5 A;  3WQT A;  3VEN A;  2E2Q A;  1WOQ A;  4RWT A;  4AM6 A;  3D2E B;  2CGK A;  2NZT A;  3IFR A;  5AQO A;  3VEY A;  1NM1 A;  4BG9 A;  1K8K A;  3O8M A;  3VEV A;  4BG8 A;  4A2A A;  1IG8 A;  2FSK A;  3WXI A;  1V4T A;  3R9P A;  4BVO A;  1GLD G;  4WYB A;  1OKJ A;  2Q0U A;  2QXL A;  2A42 A;  3W3D A;  1QQN A;  2BTF A;  1BOT O;  5LJW A;  4BQZ A;  1NGD A;  4M63 C;  4XH5 A;  1XUP O;  2GEL A;  4H0Y B;  3FGU A;  4H5N A;  5E26 A;  2QWL A;  3RSE A;  4FOE A;  1NGJ A;  3WXJ A;  4L3Q A;  3EN9 A;  1HJO A;  3VER A;  3BP8 A;  5EXW A;  3D7E O;  2Q1N A;  3DWL A;  4H0P A;  4A2B A;  4M7X A;  3LM9 A;  3CJC A;  3LDP A;  2D0P A;  2P9U B;  2E1Z A;  2GTD A;  4KBO A;  3L6Q A;  5KQD A;  5AZJ B;  2FSJ A;  5F0X A;  4BRE A;  3KVG A;  3ZEU B;  2D0O A;  1J6Z A;  3ENO A;  4C23 A;  4BRM A;  4B1X B;  2WUS A;  1NBW A;  1Y64 A;  2CGL A;  1YUW A;  4A62 A;  3ZET B;  1XC3 A;  5EVZ A;  1SAZ A;  3A5N C;  1NWK A;  3HTV A;  2CH6 A;  3CER A;  1P8Z A;  4FSV A;  1GLJ O;  1LCU A;  2CGJ A;  3O08 A;  1HKB A;  4BRK A;  1XQS C;  4IJN A;  2E2O A;  4BR4 A;  1ATS A;  3SMP A;  4I6M B;  4MO5 A;  3VEX A;  4WQ4 C;  1TYQ A;  2GWK A;  1NGE A;  3A0I X;  4BGB A;  4BR5 A;  3HSC A;  3TPQ A;  1NGG A;  3LDL A;  5EY4 A;  1NGH A;  3O80 A;  3ULE B;  4CZE A;  4J8F A;  2IVO A;  3C7N A;  3EO3 A;  3L4I A;  4Y0W A;  2ZGZ A;  2QM1 A;  1GLC G;  1BG3 A;  4IXC A;  5JLF A;  4CZG A;  4QS8 A;  5FPD A;  2E20 A;  4H0V B;  4CBU A;  3SMS A;  3U9Z A;  1DKG D;  3H45 C;  2I7N A;  3WQU A;  4CBX A;  1U2V B;  4H5T A;  3EZW A;  4FWM A;  1EQY A;  3FZL A;  3FZH A;  3WXK A;  5AQQ A;  2E88 A;  2D4W A;  4FWK A;  4ISG A;  1X9J A;  3HBT A;  3WEE A;  4H0T B;  2KHO A;  2QWQ A;  3TU5 A;  4BRP A;  3CJB A;  4JHD B;  4MO4 A;  1C0F A;  1QZ6 A;  2CH5 A;  3GL1 A;  3M6G A;  3MDQ A;  5ELZ A;  4BR0 A;  3QB0 A;  2QWN A;  3BF1 A;  3ZX0 A;  4MLH A;  1Q18 A;  4BRF A;  1SZ2 A;  2FXU A;  3R6M A;  4B1V A;  1QHA A;  3RSE B;  3KZB A;  3CHW A;  4CD3 A;  2D1K A;  3M1F A;  2V52 B;  4BC3 A;  2Q0R A;  3VEO A;  2ZGY A;  4XEI A;  3AAR A;  4BRO A;  1DEJ A;  2ASO A;  4Z94 A;  2YJE A;  1GLL O;  5I9E B;  2P9I A;  2I7P A;  4DQ8 A;  4O8K A;  1DGK N;  1QQM A;  1SQK A;  1JCE A;  4QS9 A;  3VF6 A;  4WQ4 A;  1S3X A;  2HMP A;  3D2F A;  4JNE A;  4QS7 A;  2ASP A;  4BC2 A;  4DCH A;  3LL3 A;  5AQR A;  4ISE A;  2E1Y A;  4FWN A;  3LDN A;  3SK3 A;  1HX1 A;  4BRG A;  5AQN A;  5LY3 A;  2E2P A;  4RTF D;  3FE1 A;  2P9S B;  4F9O A;  4K41 A;  2HOE A;  3W0L A;  4CD1 A;  2YCH A;  5BRD A;  3CJ7 A;  4FWL A;  5LJV A;  4BC4 A;  4CBW A;  1QQO A;  2OAN A;  2PAV A;  3HI0 A;  1V4S A;  4K43 A;  4BR7 A;  4CZK A;  1RGI A;  5BPN A;  2VYP A;  4BRN A;  3CJA A;  3I8B A;  4YDU C;  5AQU A;  3QDK A;  4EIA A;  1CZA N;  4A61 A;  4B1Y B;  3LDQ A;  2F9T A;  4CJ7 A;  4PL8 A;  3VF2 A;  1X3M A;  4H5R A;  1KAX A;  4HWI A;  3O6W A;  2J4R A;  3OHR A;  3BEX A;  1NGI A;  4JD2 A;  2P9K B;  5AQP A;  2DPN A;  2Q31 A;  3HZ6 A;  3MN9 A;  3S41 A;  5BN8 A;  2NLX A;  4WQ5 A;  4B1W B;  1MDU B;  1BUP A;  5EOY A;  2A6A A;  2V7Y A;  3QBX A;  3G25 A;  5BPM A;  2AA4 A;  1X3N A;  1ZBS A;  3MN7 A;  2QWM A;  4BRD A;  4H0X B;  3D2E A;  4NB4 A;  4FPB A;  2IVN A;  3MCP A;  3HM8 A;  4JN4 A;  1E4F T;  5AZI B;  5AFU H;  4FWS A;  2FSN A;  5AQT A;  3JXU A;  5KPT A;  5AQK A;  5AQH A;  3VET A;  1GLE G;  2P9K A;  3UKR B;  5BN9 A;  3A5L C;  4H03 B;  2P9L A;  3ZET A;  3UB5 A;  3SJH A;  3MK6 A;  4H5V A;  3O1W A;  1NLV A;  3QBW A;  1KAY A;  1HKC A;  3U4L A;  1R59 O;  3CJ1 A;  4K42 A;  5AQL A;  1YXQ A;  2YJF A;  4K25 A;  2P9I B;  4MLE A;  3ZX2 A;  4I6M A;  3IMX A;  3VOV A;  4YDU A;  2P9N B;  4BRA A;  3AAQ A;  5KPR A;  1NGB A;  5AZI A;  3D2F B;  4PL7 A;  3WT0 A;  4BR2 A;  2FLO A;  2A5X A;  5AQJ A;  2IIR A;  2ITM A;  2P9P B;  4EHT A;  2V51 B;  1JCG A;  5B8H A;  4EFH A;  5ADX H;  4BVP A;  4H0O A;  3F9M A;  1G99 A;  5BRH A;  2P9S A;  3KHY A;  5AQW A;  4IWV A;  3ID8 A;  5TKY A;  1Z05 A;  5AFU A;  4CZH A;  3IDH A;  3MN6 A;  5FPM A;  3VPZ A;  5AQV A;  5F1X A;  3EKS A;  1KXP A;  3CIP A;  1RFQ A;  2QW9 A;  2AP1 A;  5AQZ A;  2VCP A;  3FFK B;  5JLH A;  5AQY A;  1WUA A;  3DXM B;  4JHD A;  3H1Q A;  5AQF A;  5FPN A;  4CZJ A;  3VF4 A;  3ZX3 A;  3I33 A;  3UKU A;  3C7N B;  5AQX A;  4XH1 A;  3GOI A;  4O5F A;  3BUZ B;  3H6E A;  4E1J A;  2V7Z A;  3A5O C;  3ATU A;  4M7Y A;  1T6C A;  3AAP A;  5JMV A;  4FWO A;  4NO7 A;  4CZF A;  1BU6 O;  3SLC A;  4PKG A;  2GWJ A;  3M3Z A;  3QFU A;  3BF3 A;  4DHY A;  4EHU A;  3CQY A;  3VEW A;  1ZXO A;  2W40 A;  2ZF5 O;  3IUC A;  5AQS A;  4B1U B;  3O5B A;  5FPE A;  1QZ5 A;  1GLF O;  1NGA A;  3EKU A;  1HPM A;  2YHW A;  2F9W A;  3FR0 A;  3O1B A;  3GDQ A;  3ULE A;  4FWP A;  4RCH A;  1BWF O;  1GLA G;  5F2R A;  3UKU B;  1TUY A;  5E84 A;  1D4X A;  4BRI A;  3CET A;  3O4W A;  4IZ9 A;  3JS6 A;  1HLU A;  3QFP A;  4H5W A;  3GBT A;  4BRH A;  4FWR A;  1YAG A;  3VGM A;  2NRH A;  1BO5 O;  1MWK A;  1NMD A;  3J8A A;  4BQL A;  3LDO A;  1TYQ B;  2YHY A;  1HUX A;  3WEE B;  2FF3 B;  4B9Q A;  2W41 A;  2QWO A;  3A8Y A;  4GY2 B;  2E8A A;  3FZM A;  4JD2 B;  2HF3 A;  1YVN A;  5EX5 A;  3B8A X;  1Z6R A;  4HTL A;  1JCF A;  3MMV A;  2Q2R A;  2IVP A;  4GNI A;  1GLB G;  3VGL A;  2ZWH A;  3AY9 A;  3C0B A;  1HKG A;  2QWR A;  3A5M C;  2E2N A;  3LM2 A;  2Q97 A;  1ESV A;  4BR9 A;  1KAZ A;  3MN5 A;  4BRC A;  1ATR A;  2H3G X;  5JIC A;  1RDW X;  3H46 O;  3R8E A;  3WUH A;  1TUU A;  1U2V A;  2HF4 A;  3FZK A;  4FO0 A;  3VGK A;  1T6D A;  2Q36 A;  1NGF A;  4BRL A;  4IO8 A;  2P9U A;  4IJA A;  5AZJ A;  1BA1 A; 
#chains in the Genus database with same CATH topology
 3QML A;  5BRE A;  2YX6 A;  3CJ9 A;  3V9W A;  3B6O A;  2YHB A;  3H3N O;  4KV8 A;  3K59 A;  3AVC A;  1E3M A;  4FM1 A;  3T1H K;  4WQ5 C;  2RE2 A;  3RRH A;  4FJK A;  2YHX A;  2D0B A;  3PV8 A;  2A40 A;  4DQI A;  3MX5 A;  4FWQ A;  1T44 A;  3P38 A;  4ISF A;  1NKB A;  4CZI A;  4EZ9 A;  2GEM A;  5AQM A;  1C0G A;  4Y1D A;  4AM7 A;  3V9S A;  4J2A A;  4PKH A;  2ASM A;  1KSP A;  1JL1 A;  1HNW K;  3EL2 A;  3MX2 A;  3E1Y A;  1NKC A;  4LSN A;  2P9N A;  4CZL A;  1NGC A;  3D6R A;  3CCU N;  1NJW A;  2UXD K;  4LF7 K;  1HNV A;  4FL9 A;  1VSF A;  1YF5 L;  4DTS A;  1SL0 A;  3U9D A;  3LAM A;  5ADX A;  2VQF K;  4KB1 A;  3GG4 A;  3FZF A;  2ZJR L;  2QK9 A;  4PKI A;  4DR2 K;  1Q82 O;  2ITG A;  2D5R A;  5HRR A;  4A57 A;  4CGJ A;  4JAX A;  1T05 A;  2A1S A;  4B1Z A;  4FM0 A;  2EWS A;  4IFE A;  1JLF A;  4CGH A;  2PBD A;  1VAZ A;  3KD1 E;  3P39 A;  2OZM A;  3OA9 A;  4FK4 A;  3CI5 A;  1C1A A;  4B9V A;  4RWT A;  1WLJ A;  3R1X A;  3JYT A;  3RVC A;  3HJF A;  4G1Q A;  5CYQ A;  5AQO A;  1ILY A;  2IC3 A;  1RBU A;  3O8M A;  5HRN A;  4JK9 A;  4E3S A;  3R9P A;  4DU3 A;  4DR1 K;  3OYJ A;  2G8F A;  4JI3 K;  3P83 D;  5GIO A;  3S3M A;  3QIN A;  2YKM A;  2A42 A;  4IFV A;  1RNH A;  3W3D A;  1QQN A;  1IH7 A;  1BOT O;  3ZT3 A;  2P5O A;  5LJW A;  2RN2 A;  5CR4 A;  1HYZ A;  3ULD A;  4F2R A;  1DLO A;  3C6H A;  2NUB A;  3FGU A;  3AO3 A;  4IO9 L;  1BQM A;  4W5N A;  3K9J A;  3MAQ A;  4DV2 K;  4FOE A;  3WNF A;  4KTQ A;  3KLH A;  3O9T A;  3O4N A;  5KRS A;  4Z4I A;  2Q1N A;  3DWL A;  4H0P A;  4CJP A;  1JLB A;  3LM9 A;  1S6P A;  2O8E A;  5F0X A;  2FSJ A;  1KC8 O;  4M41 A;  2OYQ A;  3SZ2 A;  4V19 S;  2W42 A;  3WNH A;  4JKG B;  4B3S K;  1HMV A;  4B1X B;  1S1W A;  1Y64 A;  4A62 A;  1LWF A;  1XC3 A;  3SUQ A;  1RDU A;  5EVZ A;  1NWK A;  4B3M K;  2XY6 A;  1VSL A;  1C1C A;  1LCU A;  2CGJ A;  4JKA A;  4YY3 K;  2NNW A;  3SMP A;  4IBN A;  3QET A;  3THY A;  3VEX A;  1QQC A;  2HNZ A;  3D45 A;  3M8P A;  1NGE A;  1DTQ A;  3HSC A;  1NGG A;  4DV4 K;  4YNQ A;  1NGH A;  3ULE B;  3KKR A;  4BE1 A;  4J8F A;  4FLX A;  4DR4 K;  4DSK A;  4Y0W A;  4E7J A;  1KQS M;  2WFB A;  1N5Y A;  1RTD A;  3VMF B;  5FPD A;  2IGI A;  3VQ8 A;  2KTQ A;  4AH9 A;  3ZCM A;  4CBU A;  3SMS A;  4U7B A;  5KGW A;  1MU2 A;  3QEW A;  2VG7 A;  3U9Z A;  3WQU A;  1YI2 N;  2I7N A;  4DSE A;  3VQQ A;  3EZW A;  4JI4 K;  4I2Q A;  1ITG A;  3NFA A;  3QIP A;  2D4W A;  4M45 A;  2G8V A;  1X9J A;  3MXI A;  1N32 K;  4FZZ A;  4JKD A;  4H0T B;  1JJ2 M;  2B4J A;  4Z0U A;  3DYA A;  3MDQ A;  4BR0 A;  3TAQ A;  3BZC A;  1JKH A;  2QWN A;  2Z1I A;  4MLH A;  4BRF A;  1LAV A;  3AVB A;  4B1V A;  1QHA A;  2WON A;  3RSE B;  2OPP A;  4Z4F A;  4C8L A;  2V52 B;  2Q0R A;  4FK2 A;  2ZGY A;  3I55 N;  4Z94 A;  1GLL O;  2I7P A;  3THW B;  4M42 A;  3L2Q A;  4O8K A;  3T19 A;  5KRT A;  4JI7 K;  4WQ4 A;  2HMP A;  3C6T A;  4DTM A;  3TAB A;  4OKK A;  2VG6 A;  4JKG A;  4ISE A;  2E1Y A;  1L3S A;  3SK3 A;  4YOT A;  3VQC A;  3KLE A;  5LY3 A;  1C0T A;  1SL2 A;  3AA5 X;  4F9O A;  4FJH A;  4C8M A;  5BRD A;  4TSX A;  3ENB A;  4JRP A;  4MFB A;  4FWL A;  1VHX A;  5LJV A;  3T3F A;  4C8N A;  4CBW A;  1QQO A;  5BPN A;  4BRN A;  4NLB A;  3K5M A;  1CZA N;  1WSE A;  2KKZ A;  3TTD A;  4DTR A;  4JI5 K;  3KTQ A;  3KWI A;  2F9T A;  3BDP A;  2QXF A;  3HST B;  3VQB A;  4DLG A;  4JD2 A;  2P9K B;  3NH1 A;  3RMD A;  2Q31 A;  3HZ6 A;  3S41 A;  3PSF A;  3OYM A;  5C12 A;  4WQ5 A;  1MDU B;  4OLB A;  3OJS A;  4E0D A;  5BPM A;  3T1A A;  1WSH A;  4DU1 A;  2HHW A;  1X3N A;  3AO2 A;  3DOK A;  2QWM A;  1KVC A;  3ASM A;  4NB4 A;  5J2P A;  4FPB A;  3MCP A;  3J80 O;  3DRS A;  4IFY A;  1OH6 A;  1E4F T;  4CK3 A;  2FBX A;  5AFU H;  3AO4 A;  4CEA A;  4KPY A;  1Z25 A;  4DS4 A;  5AQK A;  3VET A;  1XMO K;  1GLE G;  5BN9 A;  2G8H A;  3A5L C;  4BDY A;  3ZET A;  3UB5 A;  4ICL A;  4WF9 L;  1XNR K;  4AHS A;  2XRI A;  3SQ0 A;  5GAG P;  5C2F A;  1NU0 A;  1IBL K;  2JLE A;  3AVH A;  3OYE A;  3LP1 A;  2QA4 N;  4FLV A;  1S9G A;  4K42 A;  4HVJ A;  1YXQ A;  4ID1 A;  4CF1 A;  4DG1 A;  2PFU A;  3ZSY A;  4I6M A;  3IMX A;  3VOV A;  4YDU A;  4KHW A;  3AAQ A;  4DMN A;  4FM2 A;  3F5T A;  2P9P B;  5B8H A;  4J2E A;  3ZSZ A;  1HYS A;  3F9M A;  2RKI A;  3VQA A;  3T7Z A;  5BRH A;  3AV9 A;  1Q86 O;  1SV5 A;  2E6M A;  3ID8 A;  3C94 A;  3IRX A;  3MN6 A;  3MWP A;  5J2M A;  3TSU A;  4XIU A;  3NVK A;  1RT2 A;  4DV5 K;  5E41 A;  3OBW A;  1RFQ A;  1RDA A;  3DI6 A;  2P1J A;  5I42 A;  4ELU A;  1HR0 K;  1WSF A;  5FRO A;  3DLH A;  3H1Q A;  4OO1 J;  5FPN A;  4YOX A;  3VF4 A;  1RBR A;  3I33 A;  1NOZ A;  3C7N B;  4XH1 A;  2Z1J A;  3E9L A;  2W6K A;  3H6E A;  4E1J A;  2V7Z A;  3ATU A;  1HNZ K;  4KI6 A;  2ZQB A;  1A5W A;  5DK5 A;  1S1V A;  3M3Z A;  3SAH A;  3CQY A;  1ASV A;  1D9D A;  4CJE A;  4BE7 B;  3LP0 A;  3SUN A;  4G9Z A;  5AQS A;  2XY7 A;  4CVN E;  4QCL A;  3V6D A;  3C6U A;  1K6Y A;  3EKU A;  3Q7C A;  1YT3 A;  1TL3 A;  2C1G A;  4JKC A;  2VG5 A;  4RCH A;  4KFB A;  4JLH A;  5TKW A;  1D4X A;  4BRI A;  3JSM A;  2HBL A;  3SV4 A;  1HLU A;  4H8K A;  4O5B A;  3VN5 A;  4YOY A;  4CIG A;  5FRN A;  4FWR A;  3K57 A;  2VGM A;  2NRH A;  1NMD A;  3LP2 A;  2WBN A;  3LDO A;  1TYQ B;  2YHY A;  1HUX A;  1YIT N;  2FF3 B;  2W41 A;  3T1Y K;  1L5U A;  4JD2 B;  4DQR A;  2G8I A;  4GV9 A;  1JCF A;  4DTU A;  4JKE A;  3EYZ A;  4CK1 A;  4KHS A;  1JL2 A;  2PY5 A;  3U3G A;  1OH5 A;  1GLB G;  2ZWH A;  3LM2 A;  2E2N A;  2Q97 A;  4E19 A;  3AA4 A;  4BR9 A;  3OVN A;  2H3G X;  2W00 A;  3H46 O;  3WUH A;  5M1F A;  3V81 A;  1NJZ A;  2XY8 A;  4BEB A;  1T6D A;  2Q36 A;  2O8F B;  4IJA A;  5AZJ A;  1U45 A;  1M1K O;  3UKR A;  1YJ9 N;  1LOT B;  2A3Z A;  3FLC O;  3VQ5 A;  1T03 A;  3ATV A;  2VWB A;  3KJV A;  1SKS A;  2F96 A;  5AQI A;  3V9U A;  3OY9 A;  1BA0 A;  1RTI A;  2QWP A;  3DXK A;  3CQX A;  4BGA A;  3DJC A;  1N34 K;  3K5L A;  1NNE A;  2HHI A;  4OX9 K;  4CEB A;  3U8X A;  5KPZ A;  1RBS A;  2A41 A;  4KHY A;  2YI1 A;  2IOC A;  3CPE A;  4QAG A;  1RCH A;  3M8R A;  1ATN A;  2P9P A;  4ID5 A;  4NXM K;  2EX3 A;  2KQ2 A;  4RW8 A;  4O55 A;  4YHH K;  4BE0 A;  2P9L B;  3V1O A;  4W5O A;  5BR9 A;  1NK8 A;  4CJR A;  3P31 A;  3L0Q A;  3PX6 A;  2GUP A;  4BRQ A;  5CY4 A;  4DB3 A;  1VSM A;  3P4I A;  5KTQ A;  1W97 L;  1WOQ A;  2ZM6 K;  3V9Z A;  4UQG A;  3IFR A;  4LD0 A;  3VEY A;  4H4O A;  4BG9 A;  2UXC K;  3DLL L;  5KI6 A;  4I7F A;  2NRR A;  1I94 K;  4A2A A;  3O9Q A;  2FSK A;  1V4T A;  4KKO A;  1GLD G;  4WYB A;  2QXL A;  2VQE K;  5M1O A;  4DV3 K;  3TAN A;  1NGD A;  3LWM A;  3QNO A;  4FLY A;  2QWL A;  3RSE A;  1S6Q A;  4B3O A;  1W7A A;  1WSG A;  1BL3 A;  1FKO A;  3MCA B;  1O1W A;  3WXJ A;  1BIU A;  1HJO A;  4M3R A;  3CM5 A;  5GAD P;  1JLA A;  3D7E O;  2R7Y A;  4A2B A;  3THY B;  4CHZ A;  1QSS A;  3CJC A;  2E5L K;  1CXU A;  5AZJ B;  3CC4 N;  1N8R O;  1FKP A;  2D0O A;  5M1N A;  3L2V A;  1GOB A;  3HRG A;  5EU7 A;  2OPS A;  4ILH A;  1SAZ A;  3NGZ A;  3C95 A;  3HTV A;  5JS1 A;  1KCF A;  4B3R K;  1P8Z A;  3I56 N;  1GLJ O;  1HKB A;  4BRK A;  4BR4 A;  3O3G A;  4BY9 C;  4OGE A;  4FLZ A;  4FVU A;  1C6V A;  3O9R A;  4B9U A;  3HPG A;  4CGF A;  4HUG A;  2O8D A;  3E66 A;  4O44 A;  1WAF A;  3O80 A;  4W5R A;  4N41 A;  3EO3 A;  1EET A;  4X66 K;  5HRS A;  4DQS A;  1BG3 A;  5JLF A;  3LAN A;  5CZ2 A;  2HNY A;  1Q9X A;  4BAC A;  3OYF A;  1DKG D;  1U2V B;  1HQE A;  3C6A A;  2HW3 A;  3TAG A;  4YOU A;  3ZT1 A;  3WXK A;  5AQQ A;  5GIN A;  4CEZ A;  3HBT A;  3HP6 A;  3OYG A;  3TU5 A;  4JHD B;  1BHL A;  1C0F A;  5GAE P;  1QZ6 A;  4B08 A;  2CH5 A;  5ELZ A;  3GL1 A;  3M6G A;  3OW2 M;  4DS5 A;  3QB0 A;  4DWI A;  1RT5 A;  4FJX A;  4JEP A;  3E9O A;  4GVM A;  1SZ2 A;  2FXU A;  3R6M A;  4ELV A;  4RW4 A;  3J81 O;  5J2N A;  3AVN A;  4NYN A;  4DQQ A;  3AVK A;  2HST A;  3L3U A;  1HNX K;  4N76 A;  1IV0 A;  1BIS A;  3N4P A;  3DLR A;  4DSF A;  5I9E B;  5DM7 L;  1QQM A;  1JCE A;  3SI6 A;  3OS0 A;  2ASP A;  3AA2 A;  4BC2 A;  3CPW M;  3CCL N;  3NH0 A;  3E9P A;  4FWN A;  3OYI A;  1HX1 A;  4IDK A;  3OYL A;  3FE1 A;  3TSP A;  3O3H A;  3KK7 A;  4K41 A;  1VQ4 N;  1KFS A;  2YCH A;  4ZTJ A;  4F2S A;  4JI2 K;  3RMB A;  3CJ7 A;  4M3U A;  3NF8 A;  2DFH A;  4FCY A;  3HI0 A;  1V4S A;  4CZK A;  3N4Q A;  4B9S A;  3I8B A;  4B9M A;  1JLC A;  3QDK A;  4EIA A;  1ASW A;  4YOV A;  3TAE A;  3F2K A;  1SL1 A;  4BWJ A;  4NYF A;  3LDQ A;  3VF2 A;  1T3V A;  4HWI A;  1S5J A;  3BEX A;  2ZD1 A;  2DPN A;  2NLX A;  4I9L A;  5IWA K;  4KHP K;  3MXM A;  1ASU A;  1U49 A;  2V7Y A;  3AGR A;  3QBX A;  5HBM A;  2AA4 A;  4F3T A;  5SWM A;  2OTJ N;  1HJR A;  2F7T A;  1X1P A;  4N47 A;  4C8K A;  2O4I A;  5C0Y A;  5I3U A;  2IVN A;  4GKJ K;  4DV7 K;  5AZI B;  3AVF A;  4FWS A;  4NCG A;  3SQ4 A;  1TKZ A;  2FSN A;  4OPH A;  5AQH A;  3MEC A;  1ZBF A;  3SJH A;  1S9E A;  1KFD A;  4CF8 A;  4H5V A;  3QBW A;  4DR6 K;  4U67 L;  3AVJ A;  1VRT A;  1FXX A;  3HVR A;  1HKC A;  1EP4 A;  3CM6 A;  3AO5 A;  3V4I A;  1N6Q A;  4FJ5 A;  2E4L A;  1NJY A;  3IKM A;  4MLE A;  3ZX2 A;  4CJK A;  4BRA A;  2KFN A;  3S5T A;  1TK0 A;  5KPR A;  1VK0 A;  1NGB A;  3TWH A;  4BR2 A;  2O8B A;  2FLO A;  1Z26 A;  4OJR A;  5AQJ A;  1HPZ A;  4EHT A;  3LWL A;  1J5O A;  4EFH A;  4H0O A;  4E7I A;  2HVI A;  4OVL A;  4CJQ A;  4FYD A;  4IWV A;  3NVM A;  4CCH A;  1RDC A;  3U6F A;  1IBK K;  4JKB A;  1TAQ A;  1KXP A;  4KH5 A;  4AHT A;  1KRP A;  4J2B A;  2AP1 A;  5AQZ A;  2VCP A;  3FFK B;  5JLH A;  5AQY A;  3BZK A;  3CCV N;  4KO0 A;  4Z4G A;  3DXM B;  4GV3 A;  2HND A;  2X78 A;  5D3G A;  4C1N K;  4CZJ A;  3ZT0 A;  4MDA A;  1XC9 A;  2AJQ A;  3GOI A;  4E1N A;  1SS6 A;  5CYM A;  1NJI O;  4M7Y A;  1TGO A;  4PWD A;  4CFB A;  5HOO A;  5JMV A;  4FWO A;  4NO7 A;  3NMU A;  1BU6 O;  1KVA A;  4PQU A;  2GWJ A;  3BF3 A;  2ZF5 O;  3O9U A;  4Z4C A;  4RW6 A;  3O5B A;  4HTU A;  4IOC L;  1SKW A;  2FBV A;  1NK4 A;  5FPE A;  4PY5 A;  3G6E N;  1HPM A;  3ZSV A;  3U3Y A;  3ULE A;  4CGG A;  1GLA G;  5GAH P;  3SBG A;  4DTP A;  2OZS A;  1EKE A;  3ZSQ A;  3CCQ N;  4CJW A;  5MLC Q;  1RT4 A;  4DUZ K;  3VGM A;  3ALY A;  1W2B M;  1VQP N;  3EE9 A;  2NRW A;  3T69 A;  4FW1 A;  3L4Q A;  4BQL A;  4DTO A;  4CJV A;  2FBT A;  4B9Q A;  4RW9 A;  3FZM A;  4DF8 A;  3DLE A;  1IBM K;  1Z6R A;  4ZTF A;  2XO7 A;  2Q2R A;  2IVP A;  3WNG A;  2HHT A;  2BE2 A;  4OLA A;  4BDZ A;  4DKW A;  5KGX A;  3L2R A;  1HKG A;  3A5M C;  2HVH A;  1ESV A;  2DFE A;  5LL6 Z;  4A5A A;  4DQP A;  5HRP A;  5JIC A;  4CED A;  1Q7Y O;  3L2U A;  4FO0 A;  3VGK A;  3SAF A;  3DXM A;  3ZEU A;  2D0A A;  1YIJ N;  4FZX C;  3I0R A;  3QEP A;  1IKY A;  4CGD A;  3H3O B;  4CZM A;  1TL1 A;  4BC5 A;  5AQG A;  4LF9 K;  2BUP A;  4LH4 A;  2X74 A;  1VSK A;  5AR0 A;  2Z1G A;  1YJN N;  2YHA A;  4LFB K;  1TKX A;  3UIQ A;  1MA9 B;  3QIC A;  1BI4 A;  3KK3 A;  2B5J A;  4O0I A;  1NKE A;  3VQ6 A;  4CHQ A;  3ENH A;  4CHN A;  2HHU A;  1S22 A;  2NRZ A;  3CYM A;  3LZJ A;  4XH4 A;  1S72 N;  4CHO A;  3NGI A;  1J5E K;  1H1V A;  4CI6 A;  1YHQ N;  3UE5 A;  3VEZ A;  3ID6 A;  4NCB A;  5A2Q O;  1J54 A;  4IOX A;  1CLQ A;  3VEN A;  1UOC A;  2UUA K;  4FJ8 A;  5C42 A;  3P1G A;  4WCE L;  5DM6 L;  3D2E B;  1GOA A;  2NZT A;  1TVR A;  5HP1 A;  1ZBI A;  3AVL A;  1YTA A;  3TAM A;  1K8K A;  1L3T A;  4CHP A;  3SAG A;  4BG8 A;  3NDK A;  1IG8 A;  3WXI A;  1U04 A;  2RHK A;  3CG7 A;  2KLA A;  4JRQ A;  4BQZ A;  4LF8 K;  4M63 C;  3CCE N;  4XH5 A;  1XUP O;  2GEL A;  2OPR A;  3C65 A;  4H5N A;  5E26 A;  1TK5 A;  3PIP L;  1NGJ A;  4F3O A;  4LF4 K;  1QE1 A;  1OVY A;  2Z1H A;  2Y1J A;  4L3Q A;  2ATQ A;  3EN9 A;  3VER A;  3BP8 A;  1HQU A;  1IO2 A;  4M7X A;  4JKH A;  1VQL N;  2D0P A;  4KBO A;  5C15 A;  4Z4H A;  3L6Q A;  1BCO A;  3THX A;  1UAX A;  2HMI A;  3KVG A;  3ZEU B;  3AGK A;  3TAP A;  4X64 K;  4C23 A;  4AHV A;  4BRM A;  2IAJ A;  2JWL A;  2WUS A;  4FLU A;  4DV6 K;  4BWM A;  4HCC A;  3ZT4 A;  5M1P A;  3A5N C;  2Q3S A;  1I39 A;  3MEE A;  2O4G A;  5FRM A;  3CFR A;  1RTJ A;  2CH6 A;  5C25 A;  2JWK A;  3VA3 A;  1XQS C;  4Z4E A;  3NF6 A;  4IJN A;  2E2O A;  3KD5 E;  4JI6 K;  3CC7 N;  5CHI A;  1OH8 A;  3VQ9 A;  1TYQ A;  3HYF A;  3NF9 A;  3A0I X;  4BR5 A;  2HHV A;  3TPQ A;  3OTO K;  3MED A;  2UUB K;  1IKW A;  4CF2 A;  3OYA A;  5EY4 A;  4CZE A;  1ZBH A;  1OVQ A;  2IVO A;  3L4I A;  3DLG A;  3J7Z O;  2ZGZ A;  2QM1 A;  1KLM A;  3BGR A;  3SCX A;  4O0J A;  3DM2 A;  4IXC A;  1YVU A;  4QS8 A;  3D0P A;  2E20 A;  4KHU A;  4H0V B;  3CCS N;  4DV1 K;  2XY5 A;  1JXB A;  1U48 A;  3H45 C;  4CBX A;  4N5S A;  3VQE A;  1EWQ A;  1C0M A;  1VQM N;  4GW6 A;  5M1Q A;  3PY8 A;  4E72 A;  3OYB A;  4FWK A;  4ISG A;  4LSL A;  3WEE A;  3CFO A;  3E01 A;  3LAK A;  2QWQ A;  2A1R A;  2YKN A;  4BRP A;  3CJB A;  3CF5 L;  1D9F A;  4CGI A;  3ZX0 A;  1KD1 O;  2YNH A;  4FLT A;  3TSQ A;  1JLE A;  3CCR N;  3KKS A;  3KZB A;  3CHW A;  1K73 O;  4CD3 A;  3PLA A;  3M1F A;  3VEO A;  4F4K A;  5HLF A;  4BRO A;  1WNS A;  1DEJ A;  2ASO A;  1UA1 A;  2P9I A;  4B9T A;  1R0A A;  2PYL A;  4NXN K;  3SV3 A;  1WSJ A;  3NH2 A;  4QS9 A;  3VF6 A;  3VA0 A;  1S3X A;  4JI1 K;  4CJ3 A;  4JNE A;  4QS7 A;  5JS2 A;  5AQR A;  3ZT2 A;  4R79 A;  4EZ6 A;  3V9X A;  3M8S A;  3CME N;  5AQN A;  1WBB A;  2RPI A;  3AVI A;  4RTF D;  3NGY A;  2P9S B;  2HOE A;  4BDP A;  2QKB A;  4CD1 A;  3KK1 A;  2DFF A;  4E1M A;  4BC4 A;  2PAV A;  4K43 A;  4B8A B;  3K0S A;  1RGI A;  2VYP A;  3CJA A;  4JI0 K;  5AQU A;  1S1U A;  1SUQ A;  1J53 A;  4A59 A;  4A61 A;  1HYV A;  4B1Y B;  4CJ7 A;  3RTV A;  4ELT A;  4PL8 A;  4KTZ A;  1RBT A;  4H5R A;  4IDH A;  3O6W A;  3OHR A;  4CFD A;  4GV6 A;  4KRF A;  1HRH A;  4CEQ A;  5AQP A;  3QEV A;  5BN8 A;  1KTQ A;  1LV5 A;  3G25 A;  1TKD A;  4B3T K;  1X9W A;  4W5T A;  4BRD A;  3HM8 A;  4AHR A;  3OYD A;  3THX B;  4CFC A;  4IG0 A;  4KHN A;  4Q5V A;  1BGX T;  5AQT A;  3MWT A;  5KPT A;  3PX4 A;  2O8B B;  1VQO N;  3VQD A;  4NCA A;  4H03 B;  2P9L A;  4JKF A;  2HHS A;  3NE6 A;  3MK6 A;  1VQN N;  1NLV A;  4KB0 A;  3O9S A;  3DMJ A;  1KAY A;  3VQ4 A;  1R59 O;  3PSI A;  2YJF A;  3S3N A;  1EWR A;  4Q0B A;  1NJX A;  2P9I B;  3CMA N;  2P9N B;  1NK9 A;  1IKV A;  1NK5 A;  4PL7 A;  2IS3 A;  4FJL A;  1GOC A;  2IIR A;  3ZYY X;  4E7L A;  4CK2 A;  2V51 B;  4CE9 A;  3MXJ A;  4PUO A;  1UWB A;  5IT9 O;  3P5J A;  1C0U A;  5ADX H;  3BY5 A;  1G99 A;  3AO1 A;  2P9S A;  3LZI A;  2QEX N;  5AQW A;  2HB5 A;  4JYA K;  1N33 K;  3QER A;  1Z05 A;  4FVM A;  4CZH A;  5FPM A;  5AQV A;  4JI8 K;  1X9M A;  2F8S A;  4CHY A;  5T7B A;  3TAR A;  3CIP A;  3I0S A;  3OYK A;  4CEF A;  3HPH A;  2ZJQ L;  1Q8I A;  3G4S N;  3OS2 A;  4JHD A;  4ILG B;  4LH5 A;  5AQF A;  1M90 O;  4FJI A;  4CER A;  3M8Q A;  4DTJ A;  3THV A;  4DTX A;  3IAY A;  5M1K A;  4M3Z A;  2KFZ A;  4O8U A;  3WXM B;  4O5F A;  4B9N A;  3IS9 A;  1QSY A;  1T6C A;  1WBD A;  3TAF A;  4CZF A;  1Q9Y A;  3F73 A;  3NF7 A;  4PKG A;  2B6A A;  4FXD A;  1QHT A;  4CJF A;  4DHY A;  4EHU A;  3G71 N;  3EY1 A;  1W0H A;  1BI4 B;  2W40 A;  2W6L A;  3IUC A;  3F9K A;  4B1U B;  4K8X A;  3SYZ A;  4DSJ A;  3LAL A;  1NGA A;  4EP4 A;  2F9W A;  3GDQ A;  4CEO A;  1KVB A;  1O13 A;  4LF6 K;  2BH1 A;  3UKU B;  1WSI A;  5HL7 L;  4FJN A;  3RWU A;  3CET A;  3O4W A;  4MQ3 A;  2QKK A;  3JS6 A;  1VQ5 N;  4H5W A;  2HBK A;  3GBT A;  2DY4 A;  4BRH A;  4DR7 K;  3THW A;  1BO5 O;  3AA3 A;  3EZ5 A;  3SUO A;  3RR8 A;  1QSL A;  3ISN C;  4GY2 B;  3A8Y A;  2E8A A;  3SQ2 A;  3K58 A;  1NK0 A;  5EX5 A;  3B8A X;  2GX9 A;  4QOZ B;  3QNN A;  3ZSX A;  4ZHR A;  1FW6 A;  1B92 A;  4UY8 O;  3PUF A;  4RW7 A;  2IDO A;  3VGL A;  3AY9 A;  3C0B A;  1EO1 A;  2QWR A;  4DSL A;  2UU9 K;  2YV0 X;  3MEG A;  3WNE A;  1KAZ A;  1ATR A;  4EP5 A;  5FLX O;  1RDW X;  3R8E A;  2NRT A;  1TUU A;  3KWG A;  2UUC K;  4BRL A;  2X6N A;  4YFU A;  5K14 A;  3AVG A;  1BA1 A;  1S1T A;  4KHQ A;  1K9M O;  1JXE A;  2VWJ A;  1BDG A;  3HXM A;  1L3U A;  3H1V X;  4FJG A;  4LC9 B;  3I8D A;  4L8R B;  4GVE A;  4CJ5 A;  2HHQ A;  4DFK A;  1IKX A;  3WXL A;  3ZLJ A;  4FOI A;  1RIL A;  5BRF A;  3LPT A;  5CE3 A;  3B6P A;  4FPA A;  2EHG A;  3V1R A;  3CC2 N;  1RT3 A;  3LPU A;  2FC0 A;  1MWM A;  3QIO A;  5LMU K;  1QVG M;  4LFA K;  1ZC6 A;  4EAH D;  3VTI A;  1XI1 A;  3VQP A;  1D8Y A;  3CFP A;  5BPL A;  3SPZ A;  1K8K B;  1NOY A;  4YOR A;  3VES A;  2O8F A;  5KQ8 A;  3QES A;  5C2D A;  1TK8 A;  2BDP A;  3GE1 A;  2UYT A;  1U4B A;  3M5R A;  1DTT A;  1VQ8 N;  3DAW A;  4R5P A;  3HK2 A;  3CD6 N;  1J9A A;  1L3V A;  2KZZ A;  1U6Z A;  4CFA A;  2PYJ A;  3KLI A;  3SNN A;  1RT6 A;  1E4G T;  1XWL A;  3DXK B;  1U47 A;  2FF6 A;  2O8C B;  3H08 A;  4M3Y A;  1IJJ A;  3WQT A;  2E2Q A;  4CF0 A;  2G8U A;  4XJX A;  4HCB A;  4AM6 A;  2CGK A;  5C10 A;  4CEC A;  1C1B A;  4HUF A;  1VQ7 N;  3L2W A;  1NM1 A;  3VEV A;  4OKE A;  3EEQ A;  4BVO A;  4DUY K;  4FJM A;  2Q0U A;  1OKJ A;  3HL8 A;  1QTM A;  2BTF A;  1LWE A;  1RBV A;  4CJS A;  5BR8 K;  3K2P A;  4M3W A;  4H0Y B;  2WTU A;  3A2F A;  1Y97 A;  2OTL N;  2D0C A;  1LWC A;  4CJU A;  1OH7 A;  2VGN A;  5EXW A;  1D5A A;  1XMQ K;  4A5B A;  3LDP A;  4AHU A;  2P9U B;  2E1Z A;  2GTD A;  3TI0 A;  1RT1 A;  5KQD A;  3QEI A;  3RMC A;  2X6S A;  4BRE A;  2OPQ A;  1J6Z A;  3ENO A;  1VQK N;  3CXC M;  1NBW A;  4FZY A;  2CGL A;  1YUW A;  1JLQ A;  4RG8 A;  3ZET B;  1VQ6 N;  2YNF A;  1NG9 A;  3HO1 A;  3CYG A;  5FDL A;  4FJ9 A;  5JEN A;  2E6L A;  1BCM A;  3CER A;  4IEE A;  1HNI A;  4FSV A;  3O08 A;  4O4G A;  4KTW A;  1VSE A;  1YTU A;  2JGU A;  4M3X A;  1ATS A;  2HHH K;  4I6M B;  4WFA L;  4MO5 A;  1LW2 A;  4E7H A;  1CZ9 A;  4K8Z A;  4AHC A;  3HPO A;  4WQ4 C;  4LF5 K;  2GWK A;  1KLN A;  4CJT A;  1CZB A;  1DT9 A;  1QVF M;  4BGB A;  4CEE A;  3ZSO A;  1XHZ A;  3LDL A;  1VRU A;  1WN7 A;  4DSI A;  4OPA A;  3ZSR A;  4OPJ A;  3C7N A;  4E7K A;  1NK6 A;  3OJU A;  3KIO A;  1GLC G;  1S1X A;  4B9L A;  4CZG A;  4DLE A;  1TKT A;  3SPY A;  3DLB A;  1JLG A;  1LAW A;  3PO5 A;  3G0Z A;  3QLH A;  3TR8 A;  4I9Q A;  2RF2 A;  2G8W A;  4H5T A;  4DF4 A;  4FWM A;  5H1S Q;  4LFC K;  1EQY A;  3FZL A;  3FZH A;  2E88 A;  4DR5 K;  1B9D A;  1REV A;  3Q7B A;  3HT3 A;  4GMJ B;  1VQ9 N;  3SJJ A;  2KHO A;  4MO4 A;  4KRE A;  2I5J A;  2WOM A;  3OS1 A;  2NRX A;  1VSH A;  1A5X A;  3BF1 A;  4KI4 A;  1Q18 A;  1N36 K;  1FK9 A;  1ZYQ A;  4DV0 K;  3HOT A;  3HP9 A;  4JK7 A;  2D1K A;  2Y1I A;  4KAZ A;  1BIZ A;  1I3A A;  4BC3 A;  2P5G A;  3AAR A;  4XEI A;  2YJE A;  3DRR A;  4OKJ A;  4JS5 A;  4CIF A;  4DQ8 A;  1WB9 A;  1W9H A;  1DGK N;  1SQK A;  3D2F A;  3TTF A;  2WC9 A;  4AIL C;  4DCH A;  1ZBL A;  3LL3 A;  1NK7 A;  4DFJ A;  1TAU A;  3LDN A;  3NAE A;  4BRG A;  4PA1 A;  1T8E A;  2E2P A;  3W0L A;  1UA0 A;  1X9S A;  1RDB A;  5LMN K;  3RMA A;  2DTU A;  4I2P A;  4C1N I;  2OCE A;  4FW2 A;  2OAN A;  4BR7 A;  2UXB K;  5HRO A;  4YDU C;  4JS4 A;  3O3F A;  4BE2 A;  1XNQ K;  4H4M A;  5J2Q A;  5J1E A;  3HVT A;  1X3M A;  1KAX A;  2J4R A;  1NGI A;  1TV6 A;  4M3T A;  3MN9 A;  4DFP A;  2F8T A;  4W5Q A;  4FJ7 A;  4KH4 A;  4B1W B;  3PIO L;  2FBY A;  3K5N A;  1BUP A;  5EOY A;  2A6A A;  4OPK A;  2HBJ A;  3NHG A;  3S3O A;  1QS4 A;  3VQ7 A;  4HUE A;  1T7P A;  1NMN A;  1ZBS A;  2VWK A;  3MN7 A;  2OA8 A;  4F8R A;  4H0X B;  3RR7 A;  3D2E A;  4JK8 A;  4JN4 A;  4E89 A;  1SKR A;  5C24 A;  2GUI A;  2KZM A;  3CQ8 A;  1LW0 A;  2G8K A;  1EX4 A;  2YNG A;  1VSJ A;  2QI2 A;  3JXU A;  4CJ4 A;  3K5O A;  2P9K A;  3UKR B;  3J7A P;  4WE1 A;  3DOL A;  1RDD A;  3G10 A;  1P90 A;  3FFI A;  3O1W A;  3AVA A;  4DR3 K;  3U4L A;  4FJJ A;  3KLF A;  3CJ1 A;  5AQL A;  4K25 A;  4DFM A;  4NLC A;  3L8B A;  2PZS A;  4J2D A;  3KK2 A;  3HM9 A;  5AZI A;  4PHT X;  1FJG K;  4WFN L;  3D2F B;  4FK0 A;  1VSI A;  3WT0 A;  2A5X A;  4YOW A;  2KW4 A;  2ITM A;  3OYC A;  3HOS A;  1JCG A;  3OYH A;  3ZSW A;  2P51 A;  3SBT A;  5DMR A;  4BVP A;  5SZT A;  3OBY A;  3KHY A;  5JVH L;  1VSD A;  5TKY A;  4IKF A;  5AFU A;  3TTC A;  4DTN A;  2QTD A;  3IDH A;  3VPZ A;  5F1X A;  3OYN A;  3EKS A;  3JAM O;  3QO9 A;  2QW9 A;  4KH6 A;  3CCM N;  1IG9 A;  2NRV A;  2ETJ A;  3NBP A;  5JVG L;  3SUP A;  1WUA A;  1CXQ A;  2YNI A;  3LDS A;  4BEC A;  3ZX3 A;  1A5V A;  3UKU A;  5AQX A;  1Q81 O;  3BUZ B;  1XHX A;  3A5O C;  3S9H A;  3VTH A;  3AAP A;  2ZJP L;  1YJW N;  3SLC A;  4FLW A;  3IG1 A;  3QFU A;  4AQY K;  3PO4 A;  4N56 A;  3VEW A;  2HHX A;  1ZXO A;  4DU4 A;  3CCJ N;  4CF9 A;  2GBZ A;  1RTH A;  1WAJ A;  4OGC A;  4B8C A;  2O8E B;  2O8D B;  1EXQ A;  1QZ5 A;  1GLF O;  4CJL A;  2BGG A;  2YHW A;  3FR0 A;  3O1B A;  1ZBU A;  4FWP A;  1BWF O;  1K8A O;  4JV5 K;  5F2R A;  1TUY A;  1G15 A;  5E84 A;  1B9F A;  4LY7 A;  4GKK K;  4IZ9 A;  1RT7 A;  3L3V A;  2O8C A;  4K0K K;  2HBM A;  3KLG A;  3QFP A;  4IG3 A;  1F21 A;  1BQN A;  1YAG A;  2BAN A;  4X65 K;  3LP3 A;  2F4V K;  3DRP A;  3V1Q A;  1MWK A;  3PX0 A;  2GV9 A;  3EE8 A;  3J8A A;  4ILJ A;  3WEE B;  3RRG A;  3O4Q A;  2QWO A;  3K9K A;  4C8O A;  2HF3 A;  2ZE2 A;  5CZ1 A;  1YVN A;  4CIE A;  2XHB A;  4IOA L;  4HTL A;  3MMV A;  3NCI A;  2C1I A;  4AF1 A;  4WFB L;  4CW7 B;  4X62 K;  2LSN A;  4GNI A;  3SQ1 A;  3DLK A;  3MN5 A;  4BRC A;  4Y1C A;  3QEX A;  5AJ3 K;  1U2V A;  2HF4 A;  3ITH A;  3FZK A;  3J7Y P;  5GIP A;  4HHT A;  1NGF A;  3R3L A;  4CES A;  3AVM A;  4IO8 A;  4IEI A;  2P9U A;  4MDB A; 
#chains in the Genus database with same CATH homology
 3QML A;  5BRE A;  3DXM A;  3ZEU A;  2YX6 A;  3CJ9 A;  1K9M O;  1YIJ N;  1BDG A;  1M1K O;  3UKR A;  1YJ9 N;  1LOT B;  2A3Z A;  3FLC O;  3H1V X;  3H3N O;  3ATV A;  2VWB A;  4LC9 B;  3H3O B;  4CZM A;  4GVE A;  4WQ5 C;  2RE2 A;  4BC5 A;  5AQG A;  2BUP A;  5AQI A;  3WXL A;  2YHX A;  2A40 A;  1BA0 A;  3MX5 A;  4FWQ A;  2QWP A;  1T44 A;  3DXK A;  3CQX A;  3P38 A;  3DJC A;  4FOI A;  4FPA A;  4ISF A;  4BGA A;  5AR0 A;  4CZI A;  5CE3 A;  2GEM A;  5AQM A;  1C0G A;  4AM7 A;  3CC2 N;  4PKH A;  2ASM A;  1MWM A;  1YJN N;  3EL2 A;  1MA9 B;  3E1Y A;  1ZC6 A;  3MX2 A;  3U8X A;  3VTI A;  4EAH D;  1QVG M;  3QIC A;  2P9N A;  4CZL A;  1NGC A;  3D6R A;  5KPZ A;  3CCU N;  5BPL A;  1K8K B;  4YOR A;  3VES A;  4FL9 A;  2A41 A;  1YF5 L;  2YI1 A;  3CPE A;  5KQ8 A;  5C2D A;  1ATN A;  3U9D A;  5ADX A;  2P9P A;  3GE1 A;  2UYT A;  3FZF A;  3ENH A;  3GG4 A;  3M5R A;  2ZJR L;  1VQ8 N;  4PKI A;  3DAW A;  1Q82 O;  1S22 A;  4A57 A;  2P9L B;  3CD6 N;  2NRZ A;  1S72 N;  4XH4 A;  5BR9 A;  1U6Z A;  3P31 A;  4JAX A;  3L0Q A;  4B1Z A;  1H1V A;  2EWS A;  2GUP A;  1E4G T;  4IFE A;  4BRQ A;  2PBD A;  4CI6 A;  3DXK B;  1YHQ N;  3UE5 A;  3VEZ A;  1VAZ A;  2FF6 A;  3ID6 A;  3P39 A;  4DB3 A;  4IOX A;  3OA9 A;  3P4I A;  1IJJ A;  1W97 L;  3CI5 A;  3WQT A;  3VEN A;  2E2Q A;  1WOQ A;  4RWT A;  4XJX A;  3R1X A;  4AM6 A;  3RVC A;  4WCE L;  5DM6 L;  3D2E B;  2CGK A;  5C10 A;  2NZT A;  3IFR A;  5AQO A;  1ILY A;  3VEY A;  1VQ7 N;  1NM1 A;  4BG9 A;  1K8K A;  3O8M A;  3DLL L;  5BRF A;  3SAG A;  2NRR A;  3VEV A;  4BG8 A;  4JK9 A;  4A2A A;  1IG8 A;  2FSK A;  3O9Q A;  1V4T A;  3WXI A;  3R9P A;  2RHK A;  1GLD G;  4BVO A;  4WYB A;  1OKJ A;  2Q0U A;  2QXL A;  5GIO A;  2A42 A;  2KLA A;  3W3D A;  1QQN A;  2BTF A;  5M1O A;  1BOT O;  5LJW A;  5CR4 A;  4BQZ A;  1NGD A;  4M63 C;  3CCE N;  4XH5 A;  3C6H A;  1XUP O;  2GEL A;  3C65 A;  3FGU A;  4H0Y B;  4H5N A;  2QWL A;  5E26 A;  3RSE A;  3K9J A;  4IO9 L;  4FOE A;  3PIP L;  1NGJ A;  2OTL N;  3MCA B;  3O9T A;  1OVY A;  3WXJ A;  4L3Q A;  3EN9 A;  1HJO A;  3VER A;  2VGN A;  3BP8 A;  5EXW A;  5GAD P;  3D7E O;  2Q1N A;  3DWL A;  4H0P A;  4A2B A;  4M7X A;  3LM9 A;  4A5B A;  4JKH A;  3CJC A;  3LDP A;  1VQL N;  2D0P A;  2P9U B;  2E1Z A;  2GTD A;  4KBO A;  3L6Q A;  5C15 A;  5KQD A;  5AZJ B;  2FSJ A;  5F0X A;  3CC4 N;  1N8R O;  1KC8 O;  4BRE A;  3KVG A;  3ZEU B;  3AGK A;  2D0O A;  5M1N A;  1J6Z A;  3ENO A;  3HRG A;  4C23 A;  4BRM A;  4JKG B;  4B1X B;  2JWL A;  2WUS A;  1VQK N;  3CXC M;  1NBW A;  1Y64 A;  2CGL A;  1YUW A;  4ILH A;  4A62 A;  3ZET B;  1VQ6 N;  1XC3 A;  1RDU A;  5M1P A;  5EVZ A;  1SAZ A;  3A5N C;  1NWK A;  3HTV A;  2CH6 A;  2JWK A;  3CER A;  1P8Z A;  4IEE A;  3I56 N;  4FSV A;  1GLJ O;  1LCU A;  2CGJ A;  3O08 A;  1HKB A;  4BRK A;  1XQS C;  4IJN A;  4JKA A;  2NNW A;  2E2O A;  4BR4 A;  1ATS A;  3CC7 N;  4BY9 C;  3SMP A;  4I6M B;  5CHI A;  4WFA L;  4MO5 A;  3VEX A;  4FVU A;  4WQ4 C;  1TYQ A;  2GWK A;  3O9R A;  1DT9 A;  1QVF M;  1NGE A;  3A0I X;  4BGB A;  4BR5 A;  3HSC A;  3E66 A;  3TPQ A;  1NGG A;  3LDL A;  5EY4 A;  1NGH A;  3O80 A;  3ULE B;  4CZE A;  4OPA A;  4J8F A;  2IVO A;  3C7N A;  3EO3 A;  3L4I A;  3J7Z O;  4Y0W A;  2ZGZ A;  2QM1 A;  1GLC G;  1BG3 A;  1KQS M;  4IXC A;  5JLF A;  2WFB A;  4CZG A;  4QS8 A;  3VMF B;  5FPD A;  2E20 A;  4H0V B;  4CBU A;  3SMS A;  4U7B A;  3CCS N;  3U9Z A;  1DKG D;  3H45 C;  2I7N A;  3WQU A;  4CBX A;  1YI2 N;  1U2V B;  3C6A A;  3EZW A;  4H5T A;  4FWM A;  5H1S Q;  1EQY A;  3FZL A;  4YOU A;  3FZH A;  3WXK A;  5AQQ A;  1VQM N;  2E88 A;  5M1Q A;  2D4W A;  5GIN A;  4FWK A;  4ISG A;  1X9J A;  3HBT A;  3WEE A;  3Q7B A;  4JKD A;  4H0T B;  1VQ9 N;  2KHO A;  2QWQ A;  3TU5 A;  4BRP A;  3CJB A;  4JHD B;  4MO4 A;  3CF5 L;  1JJ2 M;  1C0F A;  5GAE P;  1QZ6 A;  2CH5 A;  2NRX A;  3GL1 A;  3M6G A;  3MDQ A;  5ELZ A;  3QB0 A;  4BR0 A;  3OW2 M;  2QWN A;  3BF1 A;  3ZX0 A;  1KD1 O;  4MLH A;  1Q18 A;  4JEP A;  3E9O A;  4BRF A;  1SZ2 A;  2FXU A;  3R6M A;  3TSQ A;  4B1V A;  3CCR N;  3HOT A;  1QHA A;  3RSE B;  3KZB A;  3CHW A;  4JK7 A;  1K73 O;  4CD3 A;  3PLA A;  2D1K A;  2HST A;  3M1F A;  2V52 B;  4BC3 A;  2Q0R A;  3VEO A;  2ZGY A;  4XEI A;  3AAR A;  3N4P A;  3I55 N;  4BRO A;  1DEJ A;  2ASO A;  4Z94 A;  2YJE A;  1GLL O;  5I9E B;  5DM7 L;  2P9I A;  2I7P A;  4DQ8 A;  4O8K A;  1DGK N;  1QQM A;  1SQK A;  1JCE A;  4QS9 A;  3VF6 A;  4WQ4 A;  1S3X A;  2HMP A;  3D2F A;  4JNE A;  3TTF A;  2WC9 A;  3G6E N;  4QS7 A;  2ASP A;  4BC2 A;  4DCH A;  3CPW M;  3CCL N;  3LL3 A;  4JKG A;  5AQR A;  4ISE A;  2E1Y A;  3E9P A;  4FWN A;  4R79 A;  3LDN A;  3SK3 A;  3CME N;  1HX1 A;  4YOT A;  4BRG A;  5AQN A;  5LY3 A;  2E2P A;  4RTF D;  3FE1 A;  3TSP A;  2P9S B;  4F9O A;  3KK7 A;  4K41 A;  2HOE A;  3W0L A;  1VQ4 N;  4CD1 A;  2YCH A;  5BRD A;  3ENB A;  3CJ7 A;  4FWL A;  5LJV A;  4BC4 A;  4C1N I;  4CBW A;  1QQO A;  2OAN A;  2PAV A;  3HI0 A;  1V4S A;  4K43 A;  4BR7 A;  4CZK A;  3N4Q A;  1RGI A;  5BPN A;  2VYP A;  4BRN A;  3CJA A;  3I8B A;  4NLB A;  4YDU C;  5AQU A;  3QDK A;  4EIA A;  1CZA N;  3TTD A;  2KKZ A;  4A61 A;  4A59 A;  3F2K A;  4YOV A;  4B1Y B;  3KWI A;  3LDQ A;  2F9T A;  4CJ7 A;  4PL8 A;  3VF2 A;  1X3M A;  4H5R A;  1T3V A;  1KAX A;  4HWI A;  4IDH A;  3O6W A;  2J4R A;  3OHR A;  4GV6 A;  3BEX A;  1NGI A;  4JD2 A;  2P9K B;  5AQP A;  2DPN A;  2Q31 A;  3HZ6 A;  3MN9 A;  3S41 A;  5BN8 A;  2NLX A;  4KH4 A;  5C12 A;  4WQ5 A;  4B1W B;  3PIO L;  1MDU B;  1BUP A;  5EOY A;  2A6A A;  2V7Y A;  2HBJ A;  3AGR A;  3QBX A;  3G25 A;  5BPM A;  2AA4 A;  2OTJ N;  1X3N A;  1ZBS A;  2F7T A;  3MN7 A;  2QWM A;  4BRD A;  4H0X B;  5C0Y A;  3D2E A;  4NB4 A;  4FPB A;  2IVN A;  3MCP A;  3HM8 A;  4JK8 A;  4JN4 A;  1E4F T;  5AZI B;  5AFU H;  4FWS A;  2FSN A;  2QI2 A;  5AQT A;  3JXU A;  3MWT A;  4OPH A;  5KPT A;  1VQO N;  5AQK A;  5AQH A;  3VET A;  1GLE G;  2P9K A;  3UKR B;  5BN9 A;  3A5L C;  4H03 B;  2P9L A;  4JKF A;  3ZET A;  3UB5 A;  3SJH A;  1P90 A;  3MK6 A;  4WF9 L;  4H5V A;  1VQN N;  3O1W A;  1NLV A;  3QBW A;  3O9S A;  5GAG P;  4U67 L;  5C2F A;  1KAY A;  1HKC A;  3U4L A;  2QA4 N;  1R59 O;  3CJ1 A;  4K42 A;  5AQL A;  1YXQ A;  2YJF A;  4K25 A;  2PFU A;  3IKM A;  2P9I B;  4MLE A;  4NLC A;  3ZX2 A;  3CMA N;  4I6M A;  3IMX A;  3VOV A;  4YDU A;  2P9N B;  4BRA A;  3AAQ A;  5KPR A;  1NGB A;  5AZI A;  4PHT X;  4WFN L;  3D2F B;  4PL7 A;  3WT0 A;  4BR2 A;  2FLO A;  2A5X A;  5AQJ A;  2IIR A;  3F5T A;  2P9P B;  2ITM A;  3ZYY X;  4EHT A;  4YOW A;  3HOS A;  2V51 B;  1JCG A;  5B8H A;  4EFH A;  3SBT A;  5ADX H;  4BVP A;  4H0O A;  3F9M A;  1G99 A;  3T7Z A;  5BRH A;  3OBY A;  2P9S A;  3KHY A;  5JVH L;  5AQW A;  2QEX N;  4IWV A;  1Q86 O;  3ID8 A;  5TKY A;  1Z05 A;  3NVM A;  5AFU A;  4CZH A;  3TTC A;  2QTD A;  3IDH A;  3MN6 A;  3MWP A;  5FPM A;  3TSU A;  3VPZ A;  5AQV A;  5F1X A;  3EKS A;  4JKB A;  3NVK A;  1KXP A;  3OBW A;  4KH5 A;  3CIP A;  1RFQ A;  2QW9 A;  2AP1 A;  5AQZ A;  2VCP A;  4KH6 A;  3CCM N;  3FFK B;  2NRV A;  5JLH A;  5AQY A;  3CCV N;  5JVG L;  1WUA A;  3DXM B;  4GV3 A;  2ZJQ L;  3G4S N;  4JHD A;  3H1Q A;  4ILG B;  5AQF A;  1M90 O;  4OO1 J;  5FPN A;  4C1N K;  4CZJ A;  4YOX A;  4MDA A;  4BEC A;  3VF4 A;  3ZX3 A;  3I33 A;  5M1K A;  3UKU A;  3C7N B;  4O8U A;  4XH1 A;  5AQX A;  3E9L A;  1Q81 O;  3GOI A;  4O5F A;  3WXM B;  1SS6 A;  3BUZ B;  3H6E A;  4E1J A;  1NJI O;  2V7Z A;  3A5O C;  3ATU A;  4M7Y A;  3VTH A;  5HOO A;  1T6C A;  3AAP A;  5JMV A;  4FWO A;  4NO7 A;  4CZF A;  2ZJP L;  3NMU A;  1YJW N;  1BU6 O;  3SLC A;  4PKG A;  2GWJ A;  3SAH A;  3M3Z A;  3QFU A;  3G71 N;  3BF3 A;  4DHY A;  4EHU A;  3CQY A;  3VEW A;  1ZXO A;  3CCJ N;  2W40 A;  2ZF5 O;  3O9U A;  3IUC A;  4BE7 B;  4G9Z A;  5AQS A;  4B1U B;  3O5B A;  4IOC L;  5FPE A;  1QZ5 A;  1GLF O;  1NGA A;  3EKU A;  1HPM A;  2YHW A;  2F9W A;  3FR0 A;  3O1B A;  3ULE A;  3GDQ A;  3Q7C A;  4FWP A;  4JKC A;  1BWF O;  4RCH A;  1K8A O;  1GLA G;  1O13 A;  5F2R A;  2BH1 A;  5TKW A;  1TUY A;  3UKU B;  5HL7 L;  5GAH P;  3SBG A;  5E84 A;  1D4X A;  4BRI A;  3CET A;  3O4W A;  4IZ9 A;  3CCQ N;  2HBL A;  3JS6 A;  1VQ5 N;  1HLU A;  5MLC Q;  2HBM A;  3QFP A;  4H5W A;  2HBK A;  3GBT A;  4YOY A;  4BRH A;  4FWR A;  1YAG A;  2VGM A;  3VGM A;  2NRH A;  1BO5 O;  1W2B M;  1VQP N;  1MWK A;  1NMD A;  2NRW A;  3EE9 A;  3T69 A;  3EE8 A;  3J8A A;  2WBN A;  3L4Q A;  3LDO A;  1TYQ B;  2YHY A;  4ILJ A;  1HUX A;  4BQL A;  1YIT N;  3WEE B;  2FF3 B;  4B9Q A;  2W41 A;  2QWO A;  3A8Y A;  3K9K A;  4GY2 B;  2E8A A;  3FZM A;  4JD2 B;  2HF3 A;  1YVN A;  5EX5 A;  3B8A X;  4GV9 A;  1Z6R A;  2GX9 A;  4HTL A;  4IOA L;  1JCF A;  2C1G A;  3MMV A;  2C1I A;  2Q2R A;  4JKE A;  4AF1 A;  4WFB L;  2IVP A;  4UY8 O;  4GNI A;  1GLB G;  3VGL A;  4DKW A;  3C0B A;  2ZWH A;  3AY9 A;  1HKG A;  2QWR A;  3A5M C;  2E2N A;  3LM2 A;  2Q97 A;  1EO1 A;  1ESV A;  4A5A A;  4BR9 A;  1KAZ A;  3MN5 A;  4BRC A;  1ATR A;  2H3G X;  5JIC A;  1RDW X;  2W00 A;  3H46 O;  3R8E A;  2NRT A;  3WUH A;  1TUU A;  1U2V A;  2HF4 A;  3KWG A;  3FZK A;  5M1F A;  4FO0 A;  1Q7Y O;  5GIP A;  3VGK A;  4BEB A;  1T6D A;  2Q36 A;  1NGF A;  3R3L A;  4BRL A;  4IO8 A;  4IEI A;  3SAF A;  2P9U A;  4MDB A;  4IJA A;  5AZJ A;  1BA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...