1YAGA

Structure of the yeast actin-human gelsolin segment 1 complex
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
372
structure length
372
Chain Sequence
EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords PROTEIN (ACTIN)
total genus 116
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 1998-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1yagA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yagA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yagA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1yagA04
4E1JA 2HF3A 3MN9A 4YDUA 1WUAA 3LM2A 3ID8A 1YVNA 4H0TB 2GWJA 4A61A 4B1XB 1EQYA 5AQZA 1ATSA 4FWPA 5JLHA 2OANA 1KXPA 3EL2A 1NMDA 3A0IX 4BRGA 4YDUC 5BRDA 4BR0A 4MO4A 3O1WA 3WXIA 4MLEA 2ITMA 1YAGA 3HTVA 1QZ5A 3H6EA 3UE5A 3DWLA 3KHYA 2P9IB 3L0QA 2A42A 4BVPA 1G99A 1K8KA 4FWRA 4EAHD 4FWSA 4BRDA 1Z6RA 3QB0A 3EZWA 3VGLA 3VF2A 3KZBA 3DJCA 1Q18A 3DXKA 4BR5A 4JNEA 4IJNA 3IDHA 4BRPA 3H1QA 5AFUH 3L4IA 1NGEA 1NGFA 1MA9B 3MK6A 3H3NO 3FZMA 3O8MA 4EHTA 1NGIA 3CI5A 3TPQA 4JN4A 3O80A 2WUSA 2A5XA 3FZKA 3MN7A 1H1VA 2YJFA 3J8AA 4B1UB 1BU6O 3A5OC 4PL7A 2VCPA 1X3NA 3FR0A 4H03B 1D4XA 3VGKA 4QS7A 3O6WA 2P9UA 2CH6A 1BA1A 4CZHA 4K25A 4BR2A 3VETA 4BVOA 1E4FT 3HSCA 3MN5A 3WXLA 3DAWA 3QFUA 3WXKA 2P9KA 2IVOA 2F9TA 4M7XA 4DQ8A 4JHDB 1YUWA 2IVNA 3FGUA 2P9NA 1BDGA 4FSVA 3AAPA 3VGMA 4PL8A 5KQDA 1GLAG 3ATUA 3WUHA 3FZHA 1X9JA 5BN9A 3R6MA 4XH5A 2W40A 4BRNA 1NGDA 2QWMA 3ZX0A 4BG9A 1E4GT 4CZLA 2QW9A 1HLUA 4WYBA 4CBXA 2UYTA 4CJ7A 4DB3A 3LDOA 4FWNA 1BWFO 1JCEA 1CZAN 4JD2B 4H0VB 3SJHA 5EOYA 1SAZA 1DGKN 4H0PA 4FPAA 2CGJA 2QXLA 3CERA 3ZETB 2YCHA 1P8ZA 1HJOA 3A5MC 2PAVA 4LC9B 5TKYA 5ADXA 1RFQA 2HMPA 3CHWA 1KAXA 4AM7A 4B9QA 1OKJA 2P9PA 2E20A 1RGIA 1RDWX 4Y0WA 1U6ZA 1TUYA 3H3OB 2QWOA 2AP1A 2A3ZA 2FF6A 5AZIB 1YXQA 2ZGYA 2GWKA 1V4TA 3A8YA 3AARA 4BQLA 4H5TA 1J6ZA 2Q0RA 3GBTA 3WQUA 5ELZA 5F0XA 4BROA 1S3XA 1NGGA 1MWMA 1TUUA 1T6DA 3QDKA 4BC4A 5AQUA 5AQWA 2QWNA 1HUXA 3FZFA 3W0LA 4CZGA 3HBTA 3L6QA 1T44A 2KHOA 3CJ1A 4CZJA 2I7PA 2YHXA 4O8KA 1X3MA 2BTFA 5AQLA 3UKRB 2HF4A 3ULEA 5BRHA 3VEWA 3GDQA 4JHDA 3DXMA 2Q97A 3BP8A 5BPNA 2V51B 3D2EA 4J8FA 3O1BA 1BUPA 2P9SB 5E84A 4BGBA 3ENHA 2J4RA 5AQVA 4FWMA 5FPEA 4EIAA 2NLXA 5AQIA 5BR9A 4BC3A 3QMLA 3ZEUB 2V7ZA 1C0FA 2FXUA 4MO5A 5EY4A 4F9OA 5B8HA 3FLCO 4B1ZA 4H5NA 3VENA 2D0OA 3F9MA 3HI0A 2E88A 1C0GA 3LDPA 3UKUB 5FPMA 4XH4A 1IG8A 4FOEA 3UB5A 4IJAA 1LOTB 5EX5A 4BC2A 4CZFA 3M3ZA 1HKBA 3CETA 3I8BA 4I6MB 4DHYA 2A6AA 2ASOA 2E2QA 3QFPA 4BRLA 1SQKA 2A41A 4QS9A 3CJBA 4CD3A 5AQOA 1WOQA 1ZC6A 4IXCA 2QWLA 3VEYA 2CGLA 2NRHA 2GTDA 1SZ2A 1BA0A 3W3DA 1XUPO 5AQPA 3SMPA 5AR0A 1DKGD 1NGCA 1BG3A 5AQNA 5AQMA 5CE3A 3GL1A 4H5VA 4A62A 4BRFA 4PKIA 4FWQA 3TU5A 4CD1A 3G25A 3D2EB 4WQ4A 1GLLO 4PKGA 3ULEB 3ENOA 2BUPA 4CI6A 3VEXA 4CZMA 1GLCG 3D2FA 4BR4A 1NGBA 5KPRA 3M1FA 2ASMA 4O5FA 3A5NC 5BREA 1HKGA 1QQOA 3IFRA 5E26A 4GNIA 4BR7A 5F1XA 3EO3A 1K8KB 5AQJA 1XC3A 4A2BA 3JS6A 3CJ7A 1KAYA 2ZF5O 2ZGZA 3C0BA 1Y64A 1GLFO 3A5LC 4FPBA 1HKCA 5AZIA 2YHYA 1GLEG 3O5BA 1NGJA 4FWKA 2Q31A 3ATVA 3U8XA 2W41A 3H1VX 2YI1A 2D1KA 2GEMA 4HTLA 3VEOA 2VWBA 4DCHA 1ESVA 2V7YA 3MMVA 4JD2A 3BEXA 4BC5A 5FPNA 2E2NA 2D4WA 3QICA 2P9KB 3CJ9A 4CZIA 2H3GX 5AQHA 3RSEB 3S41A 1U2VB 1NBWA 3I33A 4K41A 3OHRA 4BGAA 4BRKA 4C23A 4L3QA 2QM1A 3MN6A 4EFHA 1GLJO 3QBWA 3U4LA 1BOTO 4RWTA 3CJCA 2PBDA 5FPDA 3HZ6A 4BR9A 5AQKA 5EVZA 3C7NB 3H45C 2P9LA 3R8EA 5JLFA 2FLOA 4BREA 1QHAA 4BRHA 4BRIA 4ISFA 3QBXA 4KBOA 4JAXA 1ATNA 4Z94A 2P9NB 2IIRA 2P9LB 3VOVA 3UKUA 2Q1NA 2P9UB 3GG4A 4FWOA 4B1YB 3LDQA 5LY3A 3EKUA 3VPZA 4H0XB 2Q2RA 5ADXH 4H0OA 4IWVA 3AAQA 1XQSC 2FSNA 3WT0A 3RSEA 2GUPA 1NLVA 4M7YA 1TYQB 1ZXOA 2F9WA 3MDQA 1QQMA 2V52B 3U9ZA 3LL3A 4WQ4C 5EXWA 3LM9A 4BRAA 2E2PA 5BPMA 1QZ6A 3AY9A 3DXMB 3LDLA 4CZEA 3M6GA 5LJVA 3UKRA 5AZJB 4XEIA 1HX1A 1QQNA 5AQXA 4RTFD 3D7EO 2IVPA 4GY2B 2FF3B 3SLCA 3WEEA 5JICA 5BPLA 3ZX2A 3BF3A 3BF1A 2P9IA 5AQQA 4EHUA 2E8AA 1R59O 2E1YA 3FZLA 3WQTA 3SMSA 4HWIA 3WXJA 2QWQA 3EKSA 3LDNA 3VESA 3HM8A 1JCFA 4ISEA 2Q0UA 3D2FB 3R9PA 4B1VA 3FE1A 4B1WB 5AQGA 5AZJA 3VERA 2P9PB 5KPTA 4IZ9A 2E2OA 4BRMA 3JXUA 2VYPA 5JMVA 3KVGA 4IO8A 4XH1A 3ZETA 2CGKA 2YJEA 4QS8A 2Q36A 2NZTA 1T6CA 2ZWHA 3IMXA 5AQTA 2E1ZA 3SK3A 4BRQA 4FO0A 3B8AX 5I9EB 1DEJA 2QWRA 4K43A 3VF4A 1TYQA 3MCPA 5KPZA 1NGAA 4AM6A 3WEEB 5BRFA 4NB4A 1HPMA 1V4SA 3FFKB 4H5RA 5AQRA 4I6MA 3O4WA 2EWSA 2HOEA 5AQYA 3CJAA 4MLHA 1GLBG 4CBWA 2FSJA 4WQ5A 4FWLA 3GOIA 5LJWA 3GE1A 1Z05A 1ZBSA 1JCGA 3CQYA 3ZEUA 1ATRA 2CH5A 4H5WA 5KQ8A 3BUZB 3VF6A 3U9DA 2QWPA 3O08A 1U2VA 4BRCA 4WQ5C 4H0YB 4FL9A 4RCHA 3CQXA 1MDUB 1LCUA 5AQSA 1NGHA 2D0PA 3VEVA 2P9SA 4ISGA 1NWKA 3H46O 4FOIA 3ZX3A 5AFUA 2GELA 2YHWA 2DPNA 4M63C 4BQZA 2ASPA 4PKHA 2AA4A 5BN8A 1GLDG 3P4IA 1S22A 2I7NA 1IJJA 4CZKA 4A2AA 3C7NA 3VEZA 1NM1A 1MWKA 4K42A 1KAZA 3DXKB 3IUCA 5F2RA 3CIPA 1BO5O 4BG8A 3EN9A 4CBUA 2FSKA 4NO7A 5AQFA 2A40A
chains in the Genus database with same CATH superfamily
4E1JA 3SI6A 5C2FA 3CXCM 3LM2A 4A61A 3QETA 1EQYA 1M90O 3NH2A 1KVBA 1SKSA 2OANA 1S1VA 4ZTJA 4IFYA 3WXIA 4MLEA 3CFOA 2KKZA 3UE5A 4ZHRA 2P9IB 2ZD1A 4GV3A 4ELTA 4KTQA 3T69A 5I3UA 3O9SA 3JYTA 1C6VA 4HCCA 3G10A 4JK9A 3THWB 3SUOA 2YHBA 4DKWA 4IKFA 3EZWA 3VGLA 3VF2A 4B9UA 1LAWA 2E5LK 1TKTA 3CD6N 2G8VA 4JNEA 3H1QA 3J7YP 3L4IA 3L3UA 4PQUA 1MA9B 1VK0A 2JWKA 4ELUA 4M42A 5HRRA 3O8MA 4ILGB 4FLTA 3PY8A 2HBKA 3O80A 2E4LA 4XIUA 2WUSA 2A5XA 4A5BA 4CFDA 2DFEA 3THVA 3J8AA 4B1UB 1VSIA 3SPZA 5CHIA 2VCPA 2O8FB 1VSHA 4J2EA 2HHUA 4FJGA 3VGKA 4QS7A 2CH6A 4CZHA 4J2BA 3NMUA 4KTWA 1EKEA 3QIOA 1E4FT 3ITHA 1N34K 3HSCA 3MN5A 2IVOA 4M7XA 4DQ8A 4CK2A 3CC2N 1YUWA 2P9NA 4PA1A 3WNEA 1KC8O 1BDGA 2XY7A 3AAPA 2HHSA 4RW9A 2HBMA 3TTDA 3K57A 1NK9A 3WUHA 3L2VA 5M1PA 1X9JA 4B3TK 2W40A 4BRNA 3RRGA 4CGGA 4NCBA 1E4GT 4CZLA 2QW9A 4O4GA 3LZIA 3O9RA 3SV4A 5LMNK 3P83D 1BWFO 4JD2B 4IO9L 3SJHA 4DR5K 2UXCK 1IO2A 1SAZA 2P5OA 3PO5A 1I39A 1VSJA 2YCHA 5TKYA 3A5MC 4DFPA 2XHBA 3KD1E 3NH0A 1KAXA 2X74A 1VSLA 5M1NA 1XHZA 2HHXA 1RDWX 1TUYA 3TR8A 4JKHA 4DSLA 1S1WA 3TABA 4M3UA 4KV8A 2FF6A 2ZGYA 4H8KA 2RKIA 3A8YA 4BQLA 3RMCA 4IG3A 1IKYA 4BROA 2YV0X 1T6DA 4BC4A 1RT6A 3MWTA 3RMBA 1T44A 4KB0A 3HPGA 4M3RA 3I55N 3ULEA 4IOAL 1B9FA 3BP8A 5BPNA 1X1PA 3KWGA 3P1GA 2HHWA 3OYIA 4FWMA 4I9QA 4DTRA 1UA0A 4BC3A 1C0FA 2G8FA 4CEBA 2O8FA 4CJVA 2E88A 3LDPA 4E7HA 4XH4A 2BGGA 1BCOA 4AHUA 1U47A 4JK8A 4OPJA 1LOTB 5EX5A 4CHPA 1HKBA 1ZBLA 2ASOA 1YJNN 4BRLA 1SQKA 1TK5A 4CD3A 1ZC6A 3DLGA 1N32K 4IXCA 3RMDA 4Z4CA 1L5UA 4AHVA 3ZT4A 4JI8K 1SZ2A 1BA0A 3AA2A 1XUPO 5KRSA 1DKGD 1NGCA 1Z26A 1BG3A 5AQNA 1NJXA 2NRXA 1X9WA 4F8RA 4CD1A 4YORA 2GBZA 4PKGA 3D6RA 2BUPA 4HUFA 1NGBA 5KPRA 4O5FA 2ASMA 3VQ5A 1IBMK 4BR7A 1K8KB 3RRHA 3CJ7A 2YNFA 4DQQA 4KHYA 5AZIA 2YHYA 4JI2K 3E01A 1W9HA 1NGJA 4FWKA 3C6UA 1NMNA 1OH7A 2GEMA 3DLBA 5KGXA 3K59A 4E7LA 5IWAK 3OYEA 1L3VA 4JD2A 3Q7BA 3SQ2A 1KTQA 4DUYK 5FPNA 2R7YA 1QTMA 1CXQA 5HL7L 2P9KB 3LANA 2H3GX 3ZSVA 3BZKA 2IC3A 4KFBA 3QO9A 3CCUN 4EFHA 3G71N 1RTDA 1GLJO 2NRZA 3VMFB 4Z4HA 4WE1A 4RWTA 3CJCA 5FPDA 4DMNA 1KLNA 2P9LA 1IH7A 2QKBA 3K5NA 2D5RA 3KLHA 4FM2A 4CJPA 2IIRA 2P9LB 3VOVA 4DV1K 1IG9A 1TAUA 3HYFA 4LD0A 1VQKN 4RG8A 3LP2A 3UKUA 3QNNA 3SPYA 4FWOA 4B1YB 3MXJA 5LY3A 1Z25A 1WBBA 3VPZA 1ZBIA 2OA8A 3DLKA 3AAQA 3CCRN 3P39A 2UUAK 1GOBA 1HYVA 2G8HA 4M7YA 3P38A 1Y97A 3MDQA 3PO4A 3LL3A 3LM9A 2RHKA 4ID5A 3DXMB 3HXMA 5CR4A 5LJVA 2KW4A 3UKRA 3M5RA 4DTSA 1XWLA 2QTDA 1U45A 1Q82O 5AQXA 4RTFD 1Q9XA 3TAEA 4KRFA 3AVFA 5H1SQ 2FF3B 3ENBA 2D0BA 2HBJA 5BPLA 2QXFA 4BE7B 2BE2A 2EHGA 2P9IA 4FYDA 4CGFA 2KFNA 1FXXA 2E8AA 4CIGA 4M3WA 4HWIA 1K8AO 4N5SA 3PV8A 2Q0UA 3FE1A 4F2SA 5AZJA 3NH1A 1T7PA 2P5GA 4IZ9A 3AA3A 2RPIA 5JMVA 4K8XA 2Y1IA 3ZSQA 3E66A 4BE1A 2UU9K 3SNNA 4O0IA 1T6CA 3IMXA 2WONA 2FBYA 4DQPA 3TI0A 5M1OA 2QWRA 1XMQK 1IKWA 4F2RA 2ZJRL 1KD1O 1C0TA 1JLFA 4AM6A 1W7AA 4CHZA 4NB4A 3VQAA 4LH4A 1V4SA 3VTIA 3FFKB 5SWMA 4CJ5A 2XY8A 4JV5K 1WAJA 3MX2A 4DS4A 1G15A 5JENA 3ZCMA 4DQIA 4DS5A 1XHXA 5M1QA 3C6HA 1NK0A 4WQ5A 1NK8A 5J2QA 5TKWA 3HVRA 3TWHA 3VF6A 1EXQA 2JLEA 4WQ5C 3EY1A 1RT5A 1HJRA 1MDUB 1LCUA 3VEVA 2WC9A 3NFAA 3L2RA 1JJ2M 4ISGA 3DLEA 1RBVA 4F4KA 3ZX3A 4FOIA 2YHWA 1VSFA 1HR0K 4OO1J 4PKHA 4QOZB 1JXEA 3DMJA 3Q7CA 3PX0A 1GLDG 3DYAA 2JWLA 3OJSA 1YF5L 1OH6A 4AQYK 3CM6A 1YTAA 3CIPA 2IOCA 3RWUA 3HPOA 4LFCK 3EN9A 4IDHA 2NNWA 1NJZA 5C0YA 1VQ6N 3G6EN 1TK8A 3T1AA 1JLAA 5KGWA 3VTHA 1D9DA 3MN9A 1JL2A 3AVNA 3O9QA 4YDUA 2GWJA 1YT3A 1RDDA 1WLJA 4E0DA 4B1XB 1RT1A 2WTUA 4FLZA 5AQZA 1TKDA 1KXPA 3IRXA 1NMDA 4YDUC 1B92A 4BR0A 3O1WA 3CCMN 3OS1A 3PIOL 4IEIA 3HTVA 4DR1K 3H6EA 1NK7A 3UIQA 3KHYA 2B5JA 3VN5A 1VSDA 3L0QA 1C1BA 2OZMA 1JLCA 1Q81O 3OBYA 4EAHD 2X6SA 4PUOA 1M1KO 3QB0A 1BQMA 4AHRA 1HNWK 3H08A 3AVLA 4B9TA 3DJCA 2O4IA 1LW0A 1NJWA 3AVBA 4IJNA 4CGHA 4LSNA 1ASVA 2QKKA 3HK2A 4EHTA 1NGIA 3VA3A 3CI5A 3TPQA 5DMRA 3MN7A 1H1VA 4OKJA 3CCQN 3NE6A 4DR3K 4JI5K 3HT3A 1BU6O 4DTOA 3HPHA 5C12A 3OTOK 1ZYQA 1SKRA 2F8TA 3FR0A 4H03B 2IDOA 1QVGM 2DFHA 5LL6Z 3ISNC 3VETA 3L2QA 3WXLA 2QI2A 4FJLA 4DU3A 2P9KA 2YNIA 1J9AA 4C8NA 4DV4K 4JHDB 3NF9A 3FGUA 3NBPA 2W00A 2FBXA 3D45A 3OYGA 3MX5A 4LSLA 1F21A 3DRPA 2HW3A 3AVAA 3FZHA 3OJUA 3THYA 4XH5A 1N6QA 4JKAA 5HOOA 4BG9A 2HHVA 1HLUA 3QINA 2UYTA 4FK0A 2RF2A 3LDOA 4KI4A 3DM2A 4JK7A 4C8OA 3KLGA 4FJIA 1KCFA 1NJIO 4H0PA 4FPAA 5EU7A 3ZETB 1P8ZA 3I0RA 1RFQA 4FCYA 3DRRA 4AM7A 3OYBA 1OKJA 2LSNA 4CK1A 4YHHK 2E20A 4OKEA 4WF9L 4EP4A 3EYZA 4JYAK 4CJWA 1U6ZA 4MDBA 3SCXA 2AP1A 3OVNA 2GWKA 4NYNA 2KTQA 2HHQA 3WQUA 4JI6K 2O8DB 2HHHK 2GUIA 1S3XA 1MWMA 5GADP 1TUUA 3QDKA 1EX4A 5AQUA 1FKPA 5AQWA 1VSMA 4JEPA 3NCIA 3AO5A 4I2PA 3HBTA 1VQ4N 4MFBA 2OPQA 3OYCA 2I7PA 1X3MA 2BTFA 5AQLA 3SQ0A 4DUZK 3GDQA 2V51B 3D2EA 3O1BA 4W5QA 1FW6A 1TL1A 4FW1A 4FZXC 1HNZK 3HJFA 3P5JA 4GKJK 3SZ2A 4E19A 2BDPA 3QMLA 3ZEUB 2FBVA 2FXUA 2OZSA 4F9OA 3CFRA 4GKKK 3FLCO 4NYFA 5E41A 4H5NA 4O44A 4KHWA 3F9MA 3HI0A 5HLFA 2IGIA 2HMIA 1OH8A 1ZBUA 4FOEA 1BIUA 3CPWM 4IJAA 3K9JA 1TV6A 4GVMA 4CZFA 3CETA 3I8BA 4FLWA 3QFPA 3CJBA 4DFKA 3DOLA 4CIEA 1JLBA 4KHNA 3KD5E 1RDBA 1S1TA 3ASMA 1WNSA 1BI4B 1C0MA 3AO3A 3AVIA 5AR0A 3PSFA 5AQMA 5CE3A 1TGOA 4PKIA 3D2EB 4K8ZA 4CGDA 4WQ4A 4DV6K 5FLXO 4CI6A 4CZMA 2O8CB 3S9HA 4B3MK 3M1FA 4M3ZA 1HKGA 1QQOA 3G0ZA 4KI6A 5F1XA 4A2BA 2F8SA 3F2KA 3JS6A 1BHLA 3V6DA 1RTJA 2Z1IA 1QSYA 1Y64A 3ZSOA 2Z1GA 3O5BA 3TAQA 2W41A 4W5NA 4F3OA 2YI1A 1L3SA 3VEOA 3CCEN 1ESVA 1GOAA 3LDSA 3O3FA 2V7YA 3MMVA 2UXBK 1W2BM 4BC5A 3C95A 4DU1A 2BANA 4PWDA 3QICA 3TAFA 3O4NA 3RSEB 3S41A 3EE8A 3OHRA 3MN6A 2G8KA 4A59A 3QBWA 1BOTO 3CMAN 5AQKA 3C7NB 4CK3A 3THYB 1X9SA 1XMOK 3BZCA 4BREA 1BIZA 4BRHA 4BRIA 4LF5K 4PHTX 3O3GA 4JAXA 1VQNN 1ATNA 1SL0A 4FZYA 1E3MA 2ETJA 1WSEA 2Q1NA 2HVIA 2P9UB 3GG4A 3RMAA 4UY8O 4JRQA 1NKEA 2Q3SA 3E1YA 1QSSA 3ZLJA 3CF5L 1XQSC 2GV9A 2FSNA 2PY5A 3WT0A 4CJQA 1NOYA 1NLVA 4CHOA 5KTQA 1TYQB 1CXUA 4I7FA 3THXB 4R5PA 4BRAA 4HHTA 1QZ6A 4YOVA 4BEBA 4AH9A 2Z1HA 3U6FA 5AZJB 4XEIA 4JKCA 1R0AA 1HX1A 4Z4GA 1QQNA 1XI1A 4CGJA 3PSIA 3CCSN 5GAGP 2O8BA 3SLCA 4A5AA 3V9UA 5JICA 4KKOA 1FKOA 3MEEA 3I8DA 4G1QA 3BF1A 2HHTA 5AQQA 2E1YA 1IBLK 5CZ1A 1K9MO 4FJKA 2QWQA 3NHGA 1T03A 3VESA 2YNGA 1KLMA 3HM8A 3VQPA 4CEAA 1HNXK 4B1VA 3D2FB 2QA4N 4FJMA 3ZSXA 4B1WB 2P9PB 5KPTA 4Y1DA 1J53A 3EEQA 1KFSA 1C0UA 2RE2A 2ZQBA 3TAMA 3L3VA 3WNHA 2NZTA 3AA4A 1ZBFA 5I9EB 5FRNA 3TSPA 4OLBA 3TARA 4W5TA 1UAXA 4B9LA 4K43A 3VF4A 5KPZA 3OYAA 2G8IA 1NGAA 3VQBA 2F4VK 3NVKA 3KWIA 3T19A 2NRTA 3OBWA 2O8BB 3OYKA 4I6MA 2ATQA 3O3HA 1U4BA 3I56N 4FJXA 3SYZA 4CVNE 4YOYA 3CJAA 1GLBG 3K5OA 3OYMA 1KVCA 4DTMA 5LJWA 3E9OA 4DV7K 2ZE2A 4JI4K 1S72N 1ATRA 5KQ8A 3OY9A 3OYJA 1YHQN 2W42A 3BUZB 4RCHA 1O1WA 1GOCA 1S9EA 3J80O 4JS4A 1NWKA 5AFUA 2GELA 2FBTA 3QEXA 2ASPA 4DV5K 3DOKA 4KH4A 3ZT0A 4TSXA 5JVGL 2OYQA 3P4IA 4OGEA 4CZKA 3C7NA 3VEZA 1NM1A 4GV6A 4JRPA 3R1XA 4LF6K 4LF7K 4CEQA 3DXKB 4KH6A 1BO5O 4FM0A 2FSKA 2F7TA 2HF3A 3VQ9A 1WUAA 3ID8A 1YVNA 2OCEA 4CJTA 3EZ5A 1WSJA 3J7AP 3VQ4A 1TKZA 4LFAK 4ZTFA 3EL2A 1CZBA 3A0IX 3S3OA 3VA0A 1Q7YO 5BRDA 4JKFA 4MO4A 4CEDA 3ZT2A 2C1IA 3CG7A 4CF9A 4DTPA 1QZ5A 3DWLA 3CCJN 3KKRA 2A42A 3QESA 3HL8A 2XO7A 4FWRA 4BRDA 1Z6RA 1WBDA 3KZBA 4CJUA 4UQGA 4DQRA 3TANA 3VQ7A 3DXKA 4HVJA 4BRPA 5AFUH 1NGFA 4M3XA 3H3NO 4CJ3A 3FZMA 4KHPK 3KK7A 4FLYA 2VQFK 3AVJA 3OS2A 4HUEA 4JN4A 4L8RB 4OKKA 1JXBA 2JGUA 1WSGA 1QQCA 4E72A 2YJFA 4HTUA 2XY5A 4PL7A 4H4MA 3L2UA 4NCGA 4FJNA 1UWBA 3QLHA 1Q86O 1BA1A 1P90A 2VG5A 1ASWA 2ZJQL 5T7BA 4CFCA 1N5YA 4DWIA 2OPSA 3DAWA 5A2QO 5C25A 3OYNA 4BWMA 4O55A 1YTUA 4HUGA 3IG1A 4FJ5A 4WFAL 1YJWN 2IVNA 3AVGA 2AJQA 1VQLN 4DR4K 4JS5A 3VGMA 4DLGA 4JI7K 1VQ7N 5KQDA 3U3GA 1GLAG 3ATUA 3LWLA 3NGYA 5BN9A 2P51A 1NGDA 2QWMA 3ZX0A 4FK2A 2A1SA 3NF7A 3MXMA 4WYBA 4CJ7A 4DB3A 1QE1A 1HQEA 3AA5X 2HBLA 1JCEA 1NK4A 3TAPA 1CZAN 4NXMK 3HVTA 4H0VB 4JI0K 3QEPA 4I9LA 4NXNK 4LY7A 5EOYA 4YFUA 2OPPA 3NAEA 3OYHA 1IKXA 1DGKN 2CGJA 2QXLA 1BQNA 1HJOA 4CESA 3SBGA 3B6PA 5ADXA 3CHWA 2OPRA 2P9PA 1RGIA 3V9WA 4DSJA 2VGMA 3H3OB 4CF1A 1XNQK 4AF1A 5AZIB 1YXQA 3AARA 4H5TA 5ELZA 5F0XA 4J2AA 1NGGA 1VQ9N 4FM1A 4ELVA 1HUXA 3W0LA 2IS3A 1RT2A 3L6QA 4AHTA 3P31A 1KSPA 3CJ1A 4CZJA 3KK3A 2HHIA 4OVLA 4IFVA 2YHXA 4O8KA 4DLEA 1NK5A 5BRHA 3VEWA 2HNYA 4J8FA 1DTTA 1BUPA 2P9SB 4CFBA 3V9SA 3ENHA 2J4RA 5AQVA 2NLXA 5AQIA 1VRUA 5SZTA 4LH5A 4BDZA 4V19S 4CJKA 3T1HK 4MO5A 4H4OA 5GAEP 2D0OA 3WNFA 1C0GA 1RCHA 3J81O 4B3RK 1IG8A 3V1QA 1KRPA 1KVAA 3CYGA 3QNOA 4BC2A 2VG6A 4BWJA 2E6MA 4B8CA 1UA1A 4DHYA 3K5MA 4FLUA 2A6AA 5J1EA 2E2QA 2A41A 1W97L 2E6LA 5AQOA 4CERA 3THWA 4KHQA 2QWLA 1SKWA 2NRHA 4CJ4A 5FRMA 3W3DA 4CF0A 1DT9A 4DSKA 4RW8A 3GL1A 4BRFA 5J2MA 2X78A 3G25A 3ZT1A 3CYMA 3ID6A 2UUBK 1DTQA 3SQ1A 1GLLO 3ULEB 1VQMN 1SS6A 1CLQA 4CGIA 3AV9A 1JLEA 1GLCG 1SUQA 2UUCK 1RDUA 4O5BA 4FLXA 4C8KA 3AO2A 1I3AA 3IFRA 4GNIA 4EP5A 4B3SK 3BY5A 4ILHA 4CFAA 5AQJA 1XC3A 3M8QA 3RR7A 5LMUK 3RVCA 2B6AA 4DTUA 4YOTA 1KAYA 2ZF5O 1RT3A 3C0BA 1GLFO 4JKBA 2KZMA 3N4QA 5DK5A 4C8MA 2O4GA 3U8XA 3H1VX 4GW6A 2D1KA 4HTLA 1VQ5N 4AHCA 1S9GA 4FJ8A 1JLGA 3VQCA 1N33K 3TTFA 1UOCA 4I2QA 4B9VA 1TAQA 2E2NA 4FK4A 3TTCA 3CJ9A 4KAZA 3OA9A 3HM9A 4FZZA 4AHSA 4C23A 4BRKA 4K41A 2DFFA 4M41A 4FJHA 3K58A 4BE0A 4BR9A 4NLCA 4DTXA 3H45C 3LAKA 3R8EA 5CY4A 2DY4A 1QHAA 3MECA 3NGZA 3FFIA 4ISFA 5GIOA 3QBXA 3I0SA 1EETA 3QEIA 2P9NB 4KH5A 4DSFA 4CHYA 3F5TA 1VQ8N 4AILC 3K0SA 4ID1A 4BDYA 4BDPA 3ZSRA 3LDQA 3EKUA 3T1YK 2Q2RA 4DQSA 3C65A 3HRGA 3VQ8A 1U04A 3V9XA 3CMEN 4YOWA 2F9WA 3O9UA 1QQMA 2V52B 2UXDK 5EXWA 2E2PA 2WBNA 1WN7A 4ICLA 3AY9A 4OJRA 3LDLA 1O13A 4CZEA 3M6GA 4B9SA 1L3TA 4X66K 4B9NA 1S1XA 2GX9A 3KIOA 4QCLA 2IVPA 4WFNL 2YX6A 4RW6A 3LAMA 1QHTA 3OYLA 3DLLL 4Y1CA 3AVKA 5FROA 1EO1A 4EHUA 1R59O 1BISA 3SMSA 3MEDA 3EKSA 3LDNA 3ALYA 1JCFA 4ISEA 5AQGA 3VERA 4LF8K 4BRMA 4YOUA 5C2DA 4LF9K 3JXUA 2VYPA 4CECA 3KVGA 4IO8A 3PX4A 3MCAB 4XH1A 3ZETA 5HRNA 2CGKA 2YJEA 3KTQA 5HRPA 5DM6L 4QS8A 4O0JA 1WSHA 3K2PA 2X6NA 2ZWHA 3SK3A 2F96A 2E1ZA 5AQTA 2KLAA 4FO0A 1OVYA 5HBMA 3ZYYX 1RDAA 3KLEA 5D3GA 2P1JA 1LWCA 3T3FA 3BGRA 1TYQA 3MCPA 2VQEK 4M3YA 3CCLN 4K0KK 3QEVA 1RT4A 1Q9YA 3KLFA 3DI6A 4H5RA 4B08A 4LFBK 1BCMA 1TK0A 2HOEA 5AQYA 2O8EB 2W6KA 1HMVA 4GV9A 4CBWA 2YKNA 3CC4N 3ZSYA 4CIFA 3GE1A 1SV5A 1EWQA 2D0AA 2Z1JA 4H5WA 3BDPA 3O9TA 3SJJA 4GMJB 3U9DA 4Z4EA 3AVMA 4JI1K 4CHNA 4KB1A 3O08A 1U2VA 4BRCA 1EWRA 4OPHA 4H0YB 1YVUA 3VQEA 2D0PA 4R79A 2P9SA 3H46O 3HSTB 3O4QA 4M63C 4BQZA 1LV5A 3WNGA 4DG1A 2NRRA 5C15A 5JS1A 3OYDA 1DLOA 1HNVA 1IJJA 1RILA 2KZZA 4C8LA 3OW2M 4K42A 1KAZA 1J5OA 1WAFA 1VRTA 3K9KA 1IV0A 4NO7A 5AQFA 1HYSA 3LP0A 2OTLN 5C24A 1TL3A 3AGKA 4XJXA 4H0TB 4CF2A 4DV2K 4DTNA 1VQPN 1RBUA 2KQ2A 1NOZA 3RTVA 2HSTA 1LW2A 3AO4A 4JLHA 4FJJA 1ATSA 4FWPA 5JLHA 1BGXT 2O8CA 1JL1A 2PZSA 4BRGA 3HP6A 1NJYA 2IAJA 1ILYA 1YITN 2ITMA 1YAGA 4U7BA 3SUQA 4RW7A 3C94A 3MXIA 2PYJA 4BVPA 1LAVA 3J7ZO 1G99A 1K8KA 3OS0A 4X65K 4CF8A 4FWSA 4DF4A 3C6TA 3L8BA 2ITGA 1D9FA 4Z4IA 3AVCA 1Q18A 3KK1A 3A2FA 3HOSA 4X64K 4BR5A 4DFJA 3IDHA 3MEGA 2WFBA 1NGEA 1RBSA 3AVHA 3MK6A 1RBRA 3M8PA 3TSUA 2W6LA 3HO1A 4CW7B 4F3TA 3LALA 3K5LA 4DV0K 3FZKA 3G4SN 4E1MA 1BL3A 4DR6K 2YHAA 3LPTA 4KHUA 3A5OC 3VQQA 2QK9A 1X3NA 4FXDA 1D4XA 3U3YA 4BY9C 3O6WA 1XC9A 2P9UA 3D0PA 1SL2A 1JKHA 4K25A 1A5VA 4BR2A 3SQ4A 1N8RO 4BVOA 1U48A 3PX6A 3NGIA 4FW2A 3QFUA 3WXKA 3LP1A 1RNHA 4GVEA 2F9TA 3TSQA 5I42A 1YIJN 1LWFA 3ZT3A 4CEEA 5CZ2A 4E3SA 2FC0A 4IOCL 2VGNA 4FSVA 1HPZA 2PFUA 4DV3K 3QEWA 4MDAA 4PL8A 3KKSA 5C42A 4DSEA 3R6MA 3EE9A 3SV3A 4DFMA 5GIPA 4MQ3A 3T7ZA 4CBXA 1S6QA 4FWNA 4DR2K 3SAHA 2G8UA 3S3NA 5K14A 4KREA 1RBTA 5J2PA 1L3UA 2XY6A 3CERA 2PAVA 4LC9B 1C1AA 2HMPA 4B9QA 3QIPA 2Y1JA 4BECA 4KO0A 4Y0WA 4X62K 1S1UA 2QWOA 2NUBA 2A3ZA 3HP9A 4DSIA 1V4TA 4B9MA 1J6ZA 2Q0RA 3GBTA 1A5XA 5JS2A 1HQUA 2C1GA 3F73A 1ZBHA 1YI2N 2QWNA 4KTZA 3FZFA 4CZGA 2KHOA 5JVHL 1C1CA 1TKXA 1QS4A 1T3VA 3L4QA 3UKRB 2HF4A 1VQON 4A57A 1J5EK 1J54A 4JHDA 3DXMA 2Q97A 1OH5A 1BI4A 3IAYA 1I94K 5E84A 5KRTA 4BGBA 2DTUA 5FPEA 4Z0UA 4EIAA 2ZM6K 5BR9A 2YKMA 2NRWA 3ZSWA 3L2WA 3V4IA 1IBKK 2XRIA 3PLAA 2V7ZA 5EY4A 3CC7N 5B8HA 4Z4FA 4B1ZA 3VENA 3SAGA 4JKGA 3UKUB 5FPMA 1TVRA 1K6YA 4ILJA 3UB5A 3NVMA 1S6PA 2VWJA 3M3ZA 3LWMA 4I6MB 5HP1A 4FJ9A 2RN2A 1LWEA 3OYFA 4QS9A 4JKGB 1WOQA 1WSIA 1QVFM 4FVMA 1N36K 3VEYA 2CGLA 3AO1A 2GTDA 3KJVA 3IKMA 5AQPA 3SMPA 4B8AB 4OX9K 3IS9A 2NRVA 5FDLA 1W0HA 1CZ9A 4H5VA 4A62A 4IBNA 4FWQA 3TU5A 3B6OA 3PUFA 1D5AA 3N4PA 1RTHA 1HNIA 3ENOA 3VEXA 4DTJA 3D2FA 4BR4A 4FJ7A 2O8DA 3A5NC 5BREA 1ASUA 3NDKA 5E26A 1YJ9N 3DLHA 4LF4K 4YOXA 3EO3A 1HRHA 4CJSA 3SBTA 3CM5A 1MU2A 4CE9A 2ZGZA 1VSKA 2BH1A 1NKCA 3A5LC 4FPBA 1HKCA 4WFBL 3QERA 1GLEG 3CPEA 2Q31A 3ATVA 2YNHA 4E1NA 5HROA 5HRSA 4G9ZA 5M1FA 2VWBA 4DCHA 2D0CA 3SUPA 3BEXA 1NK6A 1ITGA 3THXA 2D4WA 4OPKA 3V1RA 4CZIA 3DLRA 1VAZA 3R3LA 5AQHA 4J2DA 4IDKA 2HB5A 1U2VB 1NBWA 3I33A 3CQ8A 4BGAA 1Q8IA 4IEEA 4L3QA 2QM1A 4E7JA 4E7KA 1A5WA 3U4LA 1WSFA 2PBDA 3NF6A 3HZ6A 4KHSA 4CCHA 4NCAA 5EVZA 4M3TA 4CJFA 5JLFA 1FJGK 2FLOA 4EZ6A 4CEFA 1RT7A 4KBOA 4FVUA 4Z94A 3CFPA 4N56A 4CHQA 3M8SA 4EZ9A 1JLQA 3PIPL 1X9MA 3V81A 1REVA 4H0XB 2B4JA 5ADXH 4C1NK 4H0OA 4IWVA 3VQ6A 3RSEA 2GUPA 3E9LA 3V1OA 1OVQA 3SUNA 1ZXOA 4C1NI 4CJLA 2KFZA 3U9ZA 3E9PA 4WQ4C 1IKVA 3NF8A 3JAMO 5BPMA 4YNQA 3ULDA 2QEXN 4O8UA 4E89A 3JSMA 4OPAA 4JI3K 3AGRA 1VHXA 3KK2A 3V9ZA 4Q0BA 1B9DA 3LZJA 5M1KA 2G8WA 3D7EO 2VWKA 3SAFA 4GY2B 5CYMA 4QAGA 3DRSA 3WEEA 3ZX2A 4FLVA 5IT9O 3BF3A 1KQSM 3FZLA 3WQTA 4E7IA 4N41A 3WXJA 4IOXA 4CEZA 4JKEA 2VG7A 4IG0A 3R9PA 4BACA 4M45A 3TAGA 4OLAA 5J2NA 5DM7L 2E2OA 4U67L 1NG9A 3RR8A 2I5JA 4W5RA 1T05A 3VQDA 2Q36A 3WXMB 3KLIA 4BRQA 3B8AX 1RTIA 1SL1A 1DEJA 4Q5VA 1NKBA 3MAQA 3F9KA 5BRFA 3LP3A 3WEEB 3S3MA 1U49A 4HCBA 1FK9A 2WOMA 1HYZA 1HPMA 4DU4A 4CJEA 4W5OA 4JKDA 5AQRA 4CEOA 5KI6A 4IFEA 3C6AA 4N76A 3S5TA 3O4WA 2EWSA 4RW4A 2PYLA 5AJ3K 3M8RA 4B3OA 4MLHA 5MLCQ 2FSJA 4FWLA 3GOIA 4N47A 4NLBA 3ZSZA 4PY5A 1Z05A 1ZBSA 1JCGA 4DR7K 3CQYA 3ZEUA 2CH5A 2EX3A 3CCVN 3HOTA 1XNRK 2QWPA 4FL9A 3MWPA 1EP4A 3CQXA 4CJRA 5BR8K 4WCEL 1WB9A 4KPYA 5AQSA 1NGHA 1NU0A 1D8YA 5GINA 2ZJPL 1K73O 2OTJN 5GAHP 1KFDA 2DPNA 1T8EA 1S5JA 2HVHA 3LPUA 2AA4A 1NNEA 1QSLA 4DF8A 5BN8A 1S22A 2I7NA 4BE2A 4A2AA 2O8EA 1MWKA 4YY3K 1VSEA 2HNZA 5CYQA 1RDCA 5C10A 3IUCA 5F2RA 4BG8A 4CBUA 2A1RA 2HNDA 2A40A 4OGCA
chains in the Genus database with same CATH topology
4E1JA 3VTHA 2HF3A 3MN9A 3O9QA 3AGKA 4YDUA 5C2FA 1WUAA 3CXCM 3LM2A 3ID8A 4XJXA 1YVNA 4H0TB 2GWJA 4A61A 1VQPN 4B1XB 1EQYA 1M90O 2HSTA 5AQZA 1ATSA 4FWPA 5JLHA 2OANA 1KXPA 3EL2A 1NMDA 3A0IX 4BRGA 4YDUC 1Q7YO 5BRDA 4JKFA 4BR0A 4MO4A 3O1WA 3CCMN 3WXIA 2C1IA 3PIOL 1ILYA 4MLEA 1YITN 2ITMA 4IEIA 1YAGA 3HTVA 4U7BA 1QZ5A 2KKZA 3H6EA 3UE5A 3DWLA 3KHYA 3CCJN 2P9IB 4GV3A 3L0QA 2A42A 4BVPA 3J7ZO 1G99A 3T69A 3O9SA 1K8KA 1Q81O 4JK9A 4FWRA 3OBYA 4EAHD 4FWSA 4BRDA 1M1KO 4DKWA 1Z6RA 3QB0A 3EZWA 3VGLA 3VF2A 3KZBA 3DJCA 1Q18A 3HOSA 3CD6N 3DXKA 4BR5A 4JNEA 4IJNA 3IDHA 4BRPA 2WFBA 3H1QA 5AFUH 3L4IA 1NGEA 1NGFA 1MA9B 3MK6A 2JWKA 3H3NO 3TSUA 3FZMA 3KK7A 3O8MA 4ILGB 4EHTA 1NGIA 3CI5A 3TPQA 2HBKA 3O80A 4JN4A 2WUSA 2A5XA 3FZKA 3MN7A 3G4SN 1H1VA 4A5BA 3CCQN 2YJFA 3J8AA 4B1UB 1BU6O 3A5OC 4PL7A 5C12A 5CHIA 2VCPA 1X3NA 3FR0A 4H03B 1D4XA 3VGKA 4QS7A 4BY9C 3O6WA 1QVGM 1Q86O 2P9UA 2CH6A 1BA1A 1P90A 4CZHA 3NMUA 4K25A 2ZJQL 4BR2A 1N8RO 3VETA 4BVOA 1E4FT 3HSCA 2QI2A 3MN5A 3WXLA 3DAWA 3QFUA 3WXKA 2P9KA 2IVOA 4GVEA 2F9TA 4M7XA 3TSQA 4DQ8A 4JHDB 1YIJN 3CC2N 1YUWA 4WFAL 1YJWN 2IVNA 3FGUA 2W00A 2P9NA 4IOCL 1KC8O 1BDGA 2VGNA 4FSVA 3MX5A 1VQLN 3AAPA 2PFUA 2HBMA 4MDAA 3TTDA 3VGMA 4PL8A 1VQ7N 5KQDA 1GLAG 3ATUA 3WUHA 5M1PA 3FZHA 1X9JA 5BN9A 3R6MA 4XH5A 2W40A 4BRNA 3EE9A 1NGDA 2QWMA 4JKAA 3ZX0A 5HOOA 4BG9A 1E4GT 4CZLA 2QW9A 5GIPA 1HLUA 4WYBA 3T7ZA 4CBXA 2UYTA 4CJ7A 4DB3A 3O9RA 2HBLA 3LDOA 4FWNA 1BWFO 1JCEA 3SAHA 1CZAN 4JD2B 4H0VB 3SJHA 4IO9L 4JK7A 5EOYA 1SAZA 1NJIO 1DGKN 4H0PA 4FPAA 2CGJA 2QXLA 3CERA 3ZETB 2YCHA 1P8ZA 1HJOA 3A5MC 2PAVA 4LC9B 5TKYA 3SBGA 5ADXA 1RFQA 2HMPA 3CHWA 1KAXA 4AM7A 4B9QA 1OKJA 4BECA 5M1NA 2P9PA 2E20A 1RGIA 1RDWX 4Y0WA 4WF9L 1U6ZA 1TUYA 2VGMA 3H3OB 4MDBA 2QWOA 4JKHA 2AP1A 2A3ZA 4AF1A 2FF6A 5AZIB 1YXQA 2ZGYA 2GWKA 1V4TA 3A8YA 3AARA 4BQLA 4H5TA 1J6ZA 2Q0RA 3GBTA 3WQUA 2C1GA 5ELZA 5F0XA 4BROA 1S3XA 1YI2N 1NGGA 1VQ9N 1MWMA 5GADP 1TUUA 1T6DA 3QDKA 4BC4A 3MWTA 5AQUA 5AQWA 2QWNA 1HUXA 3FZFA 4JEPA 3W0LA 4CZGA 3HBTA 3L6QA 1VQ4N 3P31A 1T44A 2KHOA 5JVHL 3CJ1A 4CZJA 2I7PA 2YHXA 4O8KA 1X3MA 2BTFA 1T3VA 3L4QA 5AQLA 3UKRB 2HF4A 1VQON 4A57A 3ULEA 5BRHA 3VEWA 3I55N 4IOAL 3GDQA 4JHDA 3DXMA 2Q97A 3BP8A 5BPNA 2V51B 3D2EA 3KWGA 4J8FA 3O1BA 1BUPA 2P9SB 5E84A 4BGBA 3ENHA 2J4RA 5AQVA 4FWMA 5FPEA 4EIAA 2NLXA 5AQIA 5BR9A 2NRWA 4BC3A 3QMLA 3PLAA 3ZEUB 2V7ZA 1C0FA 2FXUA 4MO5A 5EY4A 4F9OA 3CC7N 5B8HA 3FLCO 4B1ZA 4H5NA 3VENA 5GAEP 2D0OA 3SAGA 3F9MA 3HI0A 2E88A 1C0GA 4JKGA 3LDPA 3UKUB 5FPMA 4XH4A 1IG8A 4FOEA 4ILJA 4JK8A 3UB5A 3CPWM 4IJAA 1LOTB 3K9JA 3NVMA 5EX5A 4BC2A 4CZFA 3M3ZA 1HKBA 3CETA 3I8BA 4I6MB 4DHYA 2A6AA 2ASOA 2E2QA 3QFPA 1YJNN 4BRLA 1SQKA 2A41A 1W97L 3CJBA 4QS9A 4JKGB 5AQOA 4CD3A 1WOQA 1ZC6A 4IXCA 2QWLA 1QVFM 3VEYA 2CGLA 2NRHA 2GTDA 1SZ2A 1BA0A 3IKMA 3W3DA 1XUPO 5AQPA 3SMPA 5AR0A 1DT9A 1DKGD 1NGCA 2NRVA 1BG3A 5AQNA 5AQMA 5CE3A 3GL1A 2NRXA 4H5VA 4A62A 4BRFA 4PKIA 4FWQA 3TU5A 4CD1A 3G25A 3D2EB 3ID6A 4YORA 4WQ4A 1GLLO 3N4PA 4PKGA 3D6RA 3ULEB 1VQMN 3ENOA 1SS6A 2BUPA 3VEXA 4CI6A 4CZMA 1GLCG 3D2FA 4BR4A 1NGBA 5KPRA 3M1FA 2ASMA 1RDUA 4O5FA 3A5NC 5BREA 1HKGA 1QQOA 3IFRA 5E26A 1YJ9N 4GNIA 4BR7A 4ILHA 5F1XA 3EO3A 4YOXA 1K8KB 5AQJA 1XC3A 4A2BA 3SBTA 3F2KA 3JS6A 3RVCA 3CJ7A 4YOTA 1KAYA 2ZF5O 2ZGZA 4G9ZA 3C0BA 1Y64A 2BH1A 1GLFO 4JKBA 3A5LC 3N4QA 1HKCA 4FPBA 5AZIA 2YHYA 4WFBL 1GLEG 3CPEA 3O5BA 1NGJA 4FWKA 2Q31A 3ATVA 3U8XA 2W41A 3H1VX 2YI1A 2D1KA 2GEMA 4HTLA 3VEOA 5M1FA 2VWBA 4DCHA 1VQ5N 1ESVA 3CCEN 2V7YA 3MMVA 3Q7BA 4JD2A 3TTFA 1W2BM 3BEXA 4BC5A 5FPNA 2E2NA 2D4WA 5HL7L 3QICA 3TTCA 2P9KB 3CJ9A 4CZIA 2H3GX 1VAZA 3R3LA 5AQHA 3OA9A 3RSEB 3S41A 1U2VB 1NBWA 3I33A 4K41A 3EE8A 3OHRA 4BGAA 4IEEA 4L3QA 4BRKA 4C23A 2QM1A 3MN6A 3CCUN 4EFHA 3G71N 4A59A 1GLJO 2NRZA 3VMFB 3QBWA 3U4LA 1BOTO 4RWTA 3CJCA 2PBDA 5FPDA 3CMAN 3HZ6A 4BR9A 4NLCA 5AQKA 5EVZA 3C7NB 3H45C 2P9LA 3R8EA 5JLFA 2FLOA 4BREA 1QHAA 4BRHA 4BRIA 4ISFA 4PHTX 5GIOA 3QBXA 4KBOA 4JAXA 1VQNN 4FVUA 1ATNA 4Z94A 2P9NB 4KH5A 2IIRA 2P9LB 3VOVA 3F5TA 1VQ8N 3UKUA 1VQKN 2Q1NA 3PIPL 2P9UB 3GG4A 4FWOA 4B1YB 4UY8O 3LDQA 5LY3A 3EKUA 3VPZA 4H0XB 2Q2RA 5ADXH 4C1NK 3E1YA 3C65A 4H0OA 4IWVA 3CF5L 3AAQA 1XQSC 3CCRN 2FSNA 3HRGA 3WT0A 3RSEA 3P39A 3CMEN 2GUPA 1NLVA 4YOWA 3E9LA 4M7YA 3P38A 1TYQB 1ZXOA 4C1NI 2F9WA 3O9UA 3MDQA 1QQMA 2V52B 3U9ZA 3E9PA 3LL3A 4WQ4C 5EXWA 3LM9A 2RHKA 4BRAA 2E2PA 5BPMA 2WBNA 2QEXN 1QZ6A 3AY9A 3DXMB 4YOVA 4BEBA 3LDLA 1O13A 4O8UA 5CR4A 4CZEA 3M6GA 5LJVA 3M5RA 3UKRA 5AZJB 4XEIA 4JKCA 4OPAA 1HX1A 2QTDA 1QQNA 3AGRA 5AQXA 1Q82O 4RTFD 5M1KA 3D7EO 3CCSN 2GX9A 5GAGP 2IVPA 3SAFA 4WFNL 2YX6A 5H1SQ 4GY2B 2FF3B 3ENBA 3SLCA 4A5AA 3WEEA 5JICA 3DLLL 2HBJA 5BPLA 4BE7B 3ZX2A 3BF3A 3BF1A 2P9IA 5AQQA 1EO1A 4EHUA 2E8AA 1R59O 2E1YA 3FZLA 3WQTA 1K9MO 3SMSA 1KQSM 4HWIA 3WXJA 2QWQA 4IOXA 1K8AO 3EKSA 3LDNA 4JKEA 3VESA 3HM8A 1JCFA 4ISEA 2Q0UA 3D2FB 3R9PA 4B1VA 2QA4N 3FE1A 4B1WB 5AQGA 5AZJA 3VERA 2P9PB 5KPTA 4IZ9A 5DM7L 2E2OA 4BRMA 4YOUA 5C2DA 3JXUA 2VYPA 4U67L 5JMVA 3KVGA 4IO8A 2RE2A 3MCAB 4XH1A 3ZETA 2CGKA 3E66A 2YJEA 5DM6L 4QS8A 2Q36A 3WXMB 2NZTA 1T6CA 2ZWHA 3IMXA 5AQTA 2E1ZA 3SK3A 2KLAA 4BRQA 4FO0A 1OVYA 3B8AX 3ZYYX 5I9EB 3TSPA 1DEJA 5M1OA 2QWRA 4K43A 3VF4A 1TYQA 3MCPA 5KPZA 1NGAA 2ZJRL 1KD1O 3NVKA 4AM6A 3KWIA 3WEEB 5BRFA 3CCLN 2NRTA 4NB4A 1HPMA 1V4SA 3OBWA 3VTIA 3FFKB 4H5RA 4JKDA 5AQRA 4I6MA 4IFEA 3C6AA 3MX2A 3O4WA 2EWSA 3I56N 2HOEA 5AQYA 4YOYA 3CJAA 4MLHA 1GLBG 4GV9A 4CBWA 5M1QA 2FSJA 3C6HA 5MLCQ 4WQ5A 4FWLA 3CC4N 3GOIA 5LJWA 3E9OA 3GE1A 4NLBA 1Z05A 1ZBSA 1JCGA 1S72N 5TKWA 3CQYA 3ZEUA 1ATRA 2CH5A 4H5WA 5KQ8A 3CCVN 1YHQN 3BUZB 3O9TA 3VF6A 3HOTA 3U9DA 2QWPA 3O08A 1U2VA 4OPHA 4WQ5C 4H0YB 4BRCA 4FL9A 3MWPA 4RCHA 3CQXA 1MDUB 1LCUA 4WCEL 5AQSA 1NGHA 2D0PA 2WC9A 3VEVA 4R79A 2P9SA 1JJ2M 4ISGA 1NWKA 3H46O 4FOIA 3ZX3A 5AFUA 5GINA 2GELA 2ZJPL 2YHWA 1K73O 2OTJN 5GAHP 2DPNA 4M63C 4BQZA 4OO1J 2ASPA 4PKHA 4KH4A 2AA4A 3Q7CA 2NRRA 5C15A 5BN8A 5JVGL 1GLDG 3P4IA 1S22A 2I7NA 1IJJA 4CZKA 2JWLA 4A2AA 3C7NA 1YF5L 3VEZA 1NM1A 3OW2M 1MWKA 4GV6A 4K42A 3R1XA 1KAZA 5C10A 3DXKB 3IUCA 5F2RA 3CIPA 3K9KA 4KH6A 1BO5O 4BG8A 3EN9A 4IDHA 4CBUA 2FSKA 2F7TA 4NO7A 2NNWA 5C0YA 1VQ6N 5AQFA 2A40A 3G6EN 2OTLN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1J A;  2HF3 A;  3MN9 A;  4YDU A;  1WUA A;  3LM2 A;  3ID8 A;  1YVN A;  4H0T B;  2GWJ A;  4A61 A;  4B1X B;  1EQY A;  5AQZ A;  1ATS A;  4FWP A;  5JLH A;  2OAN A;  1KXP A;  3EL2 A;  1NMD A;  3A0I X;  4BRG A;  4YDU C;  5BRD A;  4BR0 A;  4MO4 A;  3O1W A;  3WXI A;  4MLE A;  2ITM A;  1YAG A;  3HTV A;  1QZ5 A;  3H6E A;  3UE5 A;  3DWL A;  3KHY A;  2P9I B;  3L0Q A;  2A42 A;  4BVP A;  1G99 A;  1K8K A;  4FWR A;  4EAH D;  4FWS A;  4BRD A;  1Z6R A;  3QB0 A;  3EZW A;  3VGL A;  3VF2 A;  3KZB A;  3DJC A;  1Q18 A;  3DXK A;  4BR5 A;  4JNE A;  4IJN A;  3IDH A;  4BRP A;  3H1Q A;  5AFU H;  3L4I A;  1NGE A;  1NGF A;  1MA9 B;  3MK6 A;  3H3N O;  3FZM A;  3O8M A;  4EHT A;  1NGI A;  3CI5 A;  3TPQ A;  4JN4 A;  3O80 A;  2WUS A;  2A5X A;  3FZK A;  3MN7 A;  1H1V A;  2YJF A;  3J8A A;  4B1U B;  1BU6 O;  3A5O C;  4PL7 A;  2VCP A;  1X3N A;  3FR0 A;  4H03 B;  1D4X A;  3VGK A;  4QS7 A;  3O6W A;  2P9U A;  2CH6 A;  1BA1 A;  4CZH A;  4K25 A;  4BR2 A;  3VET A;  4BVO A;  1E4F T;  3HSC A;  3MN5 A;  3WXL A;  3DAW A;  3QFU A;  3WXK A;  2P9K A;  2IVO A;  2F9T A;  4M7X A;  4DQ8 A;  4JHD B;  1YUW A;  2IVN A;  3FGU A;  2P9N A;  1BDG A;  4FSV A;  3AAP A;  3VGM A;  4PL8 A;  5KQD A;  1GLA G;  3ATU A;  3WUH A;  3FZH A;  1X9J A;  5BN9 A;  3R6M A;  4XH5 A;  2W40 A;  4BRN A;  1NGD A;  2QWM A;  3ZX0 A;  4BG9 A;  1E4G T;  4CZL A;  2QW9 A;  1HLU A;  4WYB A;  4CBX A;  2UYT A;  4CJ7 A;  4DB3 A;  3LDO A;  4FWN A;  1BWF O;  1JCE A;  1CZA N;  4JD2 B;  4H0V B;  3SJH A;  5EOY A;  1SAZ A;  1DGK N;  4H0P A;  4FPA A;  2CGJ A;  2QXL A;  3CER A;  3ZET B;  2YCH A;  1P8Z A;  1HJO A;  3A5M C;  2PAV A;  4LC9 B;  5TKY A;  5ADX A;  1RFQ A;  2HMP A;  3CHW A;  1KAX A;  4AM7 A;  4B9Q A;  1OKJ A;  2P9P A;  2E20 A;  1RGI A;  1RDW X;  4Y0W A;  1U6Z A;  1TUY A;  3H3O B;  2QWO A;  2AP1 A;  2A3Z A;  2FF6 A;  5AZI B;  1YXQ A;  2ZGY A;  2GWK A;  1V4T A;  3A8Y A;  3AAR A;  4BQL A;  4H5T A;  1J6Z A;  2Q0R A;  3GBT A;  3WQU A;  5ELZ A;  5F0X A;  4BRO A;  1S3X A;  1NGG A;  1MWM A;  1TUU A;  1T6D A;  3QDK A;  4BC4 A;  5AQU A;  5AQW A;  2QWN A;  1HUX A;  3FZF A;  3W0L A;  4CZG A;  3HBT A;  3L6Q A;  1T44 A;  2KHO A;  3CJ1 A;  4CZJ A;  2I7P A;  2YHX A;  4O8K A;  1X3M A;  2BTF A;  5AQL A;  3UKR B;  2HF4 A;  3ULE A;  5BRH A;  3VEW A;  3GDQ A;  4JHD A;  3DXM A;  2Q97 A;  3BP8 A;  5BPN A;  2V51 B;  3D2E A;  4J8F A;  3O1B A;  1BUP A;  2P9S B;  5E84 A;  4BGB A;  3ENH A;  2J4R A;  5AQV A;  4FWM A;  5FPE A;  4EIA A;  2NLX A;  5AQI A;  5BR9 A;  4BC3 A;  3QML A;  3ZEU B;  2V7Z A;  1C0F A;  2FXU A;  4MO5 A;  5EY4 A;  4F9O A;  5B8H A;  3FLC O;  4B1Z A;  4H5N A;  3VEN A;  2D0O A;  3F9M A;  3HI0 A;  2E88 A;  1C0G A;  3LDP A;  3UKU B;  5FPM A;  4XH4 A;  1IG8 A;  4FOE A;  3UB5 A;  4IJA A;  1LOT B;  5EX5 A;  4BC2 A;  4CZF A;  3M3Z A;  1HKB A;  3CET A;  3I8B A;  4I6M B;  4DHY A;  2A6A A;  2ASO A;  2E2Q A;  3QFP A;  4BRL A;  1SQK A;  2A41 A;  4QS9 A;  3CJB A;  4CD3 A;  5AQO A;  1WOQ A;  1ZC6 A;  4IXC A;  2QWL A;  3VEY A;  2CGL A;  2NRH A;  2GTD A;  1SZ2 A;  1BA0 A;  3W3D A;  1XUP O;  5AQP A;  3SMP A;  5AR0 A;  1DKG D;  1NGC A;  1BG3 A;  5AQN A;  5AQM A;  5CE3 A;  3GL1 A;  4H5V A;  4A62 A;  4BRF A;  4PKI A;  4FWQ A;  3TU5 A;  4CD1 A;  3G25 A;  3D2E B;  4WQ4 A;  1GLL O;  4PKG A;  3ULE B;  3ENO A;  2BUP A;  4CI6 A;  3VEX A;  4CZM A;  1GLC G;  3D2F A;  4BR4 A;  1NGB A;  5KPR A;  3M1F A;  2ASM A;  4O5F A;  3A5N C;  5BRE A;  1HKG A;  1QQO A;  3IFR A;  5E26 A;  4GNI A;  4BR7 A;  5F1X A;  3EO3 A;  1K8K B;  5AQJ A;  1XC3 A;  4A2B A;  3JS6 A;  3CJ7 A;  1KAY A;  2ZF5 O;  2ZGZ A;  3C0B A;  1Y64 A;  1GLF O;  3A5L C;  4FPB A;  1HKC A;  5AZI A;  2YHY A;  1GLE G;  3O5B A;  1NGJ A;  4FWK A;  2Q31 A;  3ATV A;  3U8X A;  2W41 A;  3H1V X;  2YI1 A;  2D1K A;  2GEM A;  4HTL A;  3VEO A;  2VWB A;  4DCH A;  1ESV A;  2V7Y A;  3MMV A;  4JD2 A;  3BEX A;  4BC5 A;  5FPN A;  2E2N A;  2D4W A;  3QIC A;  2P9K B;  3CJ9 A;  4CZI A;  2H3G X;  5AQH A;  3RSE B;  3S41 A;  1U2V B;  1NBW A;  3I33 A;  4K41 A;  3OHR A;  4BGA A;  4BRK A;  4C23 A;  4L3Q A;  2QM1 A;  3MN6 A;  4EFH A;  1GLJ O;  3QBW A;  3U4L A;  1BOT O;  4RWT A;  3CJC A;  2PBD A;  5FPD A;  3HZ6 A;  4BR9 A;  5AQK A;  5EVZ A;  3C7N B;  3H45 C;  2P9L A;  3R8E A;  5JLF A;  2FLO A;  4BRE A;  1QHA A;  4BRH A;  4BRI A;  4ISF A;  3QBX A;  4KBO A;  4JAX A;  1ATN A;  4Z94 A;  2P9N B;  2IIR A;  2P9L B;  3VOV A;  3UKU A;  2Q1N A;  2P9U B;  3GG4 A;  4FWO A;  4B1Y B;  3LDQ A;  5LY3 A;  3EKU A;  3VPZ A;  4H0X B;  2Q2R A;  5ADX H;  4H0O A;  4IWV A;  3AAQ A;  1XQS C;  2FSN A;  3WT0 A;  3RSE A;  2GUP A;  1NLV A;  4M7Y A;  1TYQ B;  1ZXO A;  2F9W A;  3MDQ A;  1QQM A;  2V52 B;  3U9Z A;  3LL3 A;  4WQ4 C;  5EXW A;  3LM9 A;  4BRA A;  2E2P A;  5BPM A;  1QZ6 A;  3AY9 A;  3DXM B;  3LDL A;  4CZE A;  3M6G A;  5LJV A;  3UKR A;  5AZJ B;  4XEI A;  1HX1 A;  1QQN A;  5AQX A;  4RTF D;  3D7E O;  2IVP A;  4GY2 B;  2FF3 B;  3SLC A;  3WEE A;  5JIC A;  5BPL A;  3ZX2 A;  3BF3 A;  3BF1 A;  2P9I A;  5AQQ A;  4EHU A;  2E8A A;  1R59 O;  2E1Y A;  3FZL A;  3WQT A;  3SMS A;  4HWI A;  3WXJ A;  2QWQ A;  3EKS A;  3LDN A;  3VES A;  3HM8 A;  1JCF A;  4ISE A;  2Q0U A;  3D2F B;  3R9P A;  4B1V A;  3FE1 A;  4B1W B;  5AQG A;  5AZJ A;  3VER A;  2P9P B;  5KPT A;  4IZ9 A;  2E2O A;  4BRM A;  3JXU A;  2VYP A;  5JMV A;  3KVG A;  4IO8 A;  4XH1 A;  3ZET A;  2CGK A;  2YJE A;  4QS8 A;  2Q36 A;  2NZT A;  1T6C A;  2ZWH A;  3IMX A;  5AQT A;  2E1Z A;  3SK3 A;  4BRQ A;  4FO0 A;  3B8A X;  5I9E B;  1DEJ A;  2QWR A;  4K43 A;  3VF4 A;  1TYQ A;  3MCP A;  5KPZ A;  1NGA A;  4AM6 A;  3WEE B;  5BRF A;  4NB4 A;  1HPM A;  1V4S A;  3FFK B;  4H5R A;  5AQR A;  4I6M A;  3O4W A;  2EWS A;  2HOE A;  5AQY A;  3CJA A;  4MLH A;  1GLB G;  4CBW A;  2FSJ A;  4WQ5 A;  4FWL A;  3GOI A;  5LJW A;  3GE1 A;  1Z05 A;  1ZBS A;  1JCG A;  3CQY A;  3ZEU A;  1ATR A;  2CH5 A;  4H5W A;  5KQ8 A;  3BUZ B;  3VF6 A;  3U9D A;  2QWP A;  3O08 A;  1U2V A;  4BRC A;  4WQ5 C;  4H0Y B;  4FL9 A;  4RCH A;  3CQX A;  1MDU B;  1LCU A;  5AQS A;  1NGH A;  2D0P A;  3VEV A;  2P9S A;  4ISG A;  1NWK A;  3H46 O;  4FOI A;  3ZX3 A;  5AFU A;  2GEL A;  2YHW A;  2DPN A;  4M63 C;  4BQZ A;  2ASP A;  4PKH A;  2AA4 A;  5BN8 A;  1GLD G;  3P4I A;  1S22 A;  2I7N A;  1IJJ A;  4CZK A;  4A2A A;  3C7N A;  3VEZ A;  1NM1 A;  1MWK A;  4K42 A;  1KAZ A;  3DXK B;  3IUC A;  5F2R A;  3CIP A;  1BO5 O;  4BG8 A;  3EN9 A;  4CBU A;  2FSK A;  4NO7 A;  5AQF A;  2A40 A; 
#chains in the Genus database with same CATH topology
 4E1J A;  3SI6 A;  5C2F A;  3CXC M;  3LM2 A;  4A61 A;  3QET A;  1EQY A;  1M90 O;  3NH2 A;  1KVB A;  1SKS A;  2OAN A;  1S1V A;  4ZTJ A;  4IFY A;  3WXI A;  4MLE A;  3CFO A;  2KKZ A;  3UE5 A;  4ZHR A;  2P9I B;  2ZD1 A;  4GV3 A;  4ELT A;  4KTQ A;  3T69 A;  5I3U A;  3O9S A;  3JYT A;  1C6V A;  4HCC A;  3G10 A;  4JK9 A;  3THW B;  3SUO A;  2YHB A;  4DKW A;  4IKF A;  3EZW A;  3VGL A;  3VF2 A;  4B9U A;  1LAW A;  2E5L K;  1TKT A;  3CD6 N;  2G8V A;  4JNE A;  3H1Q A;  3J7Y P;  3L4I A;  3L3U A;  4PQU A;  1MA9 B;  1VK0 A;  2JWK A;  4ELU A;  4M42 A;  5HRR A;  3O8M A;  4ILG B;  4FLT A;  3PY8 A;  2HBK A;  3O80 A;  2E4L A;  4XIU A;  2WUS A;  2A5X A;  4A5B A;  4CFD A;  2DFE A;  3THV A;  3J8A A;  4B1U B;  1VSI A;  3SPZ A;  5CHI A;  2VCP A;  2O8F B;  1VSH A;  4J2E A;  2HHU A;  4FJG A;  3VGK A;  4QS7 A;  2CH6 A;  4CZH A;  4J2B A;  3NMU A;  4KTW A;  1EKE A;  3QIO A;  1E4F T;  3ITH A;  1N34 K;  3HSC A;  3MN5 A;  2IVO A;  4M7X A;  4DQ8 A;  4CK2 A;  3CC2 N;  1YUW A;  2P9N A;  4PA1 A;  3WNE A;  1KC8 O;  1BDG A;  2XY7 A;  3AAP A;  2HHS A;  4RW9 A;  2HBM A;  3TTD A;  3K57 A;  1NK9 A;  3WUH A;  3L2V A;  5M1P A;  1X9J A;  4B3T K;  2W40 A;  4BRN A;  3RRG A;  4CGG A;  4NCB A;  1E4G T;  4CZL A;  2QW9 A;  4O4G A;  3LZI A;  3O9R A;  3SV4 A;  5LMN K;  3P83 D;  1BWF O;  4JD2 B;  4IO9 L;  3SJH A;  4DR5 K;  2UXC K;  1IO2 A;  1SAZ A;  2P5O A;  3PO5 A;  1I39 A;  1VSJ A;  2YCH A;  5TKY A;  3A5M C;  4DFP A;  2XHB A;  3KD1 E;  3NH0 A;  1KAX A;  2X74 A;  1VSL A;  5M1N A;  1XHZ A;  2HHX A;  1RDW X;  1TUY A;  3TR8 A;  4JKH A;  4DSL A;  1S1W A;  3TAB A;  4M3U A;  4KV8 A;  2FF6 A;  2ZGY A;  4H8K A;  2RKI A;  3A8Y A;  4BQL A;  3RMC A;  4IG3 A;  1IKY A;  4BRO A;  2YV0 X;  1T6D A;  4BC4 A;  1RT6 A;  3MWT A;  3RMB A;  1T44 A;  4KB0 A;  3HPG A;  4M3R A;  3I55 N;  3ULE A;  4IOA L;  1B9F A;  3BP8 A;  5BPN A;  1X1P A;  3KWG A;  3P1G A;  2HHW A;  3OYI A;  4FWM A;  4I9Q A;  4DTR A;  1UA0 A;  4BC3 A;  1C0F A;  2G8F A;  4CEB A;  2O8F A;  4CJV A;  2E88 A;  3LDP A;  4E7H A;  4XH4 A;  2BGG A;  1BCO A;  4AHU A;  1U47 A;  4JK8 A;  4OPJ A;  1LOT B;  5EX5 A;  4CHP A;  1HKB A;  1ZBL A;  2ASO A;  1YJN N;  4BRL A;  1SQK A;  1TK5 A;  4CD3 A;  1ZC6 A;  3DLG A;  1N32 K;  4IXC A;  3RMD A;  4Z4C A;  1L5U A;  4AHV A;  3ZT4 A;  4JI8 K;  1SZ2 A;  1BA0 A;  3AA2 A;  1XUP O;  5KRS A;  1DKG D;  1NGC A;  1Z26 A;  1BG3 A;  5AQN A;  1NJX A;  2NRX A;  1X9W A;  4F8R A;  4CD1 A;  4YOR A;  2GBZ A;  4PKG A;  3D6R A;  2BUP A;  4HUF A;  1NGB A;  5KPR A;  4O5F A;  2ASM A;  3VQ5 A;  1IBM K;  4BR7 A;  1K8K B;  3RRH A;  3CJ7 A;  2YNF A;  4DQQ A;  4KHY A;  5AZI A;  2YHY A;  4JI2 K;  3E01 A;  1W9H A;  1NGJ A;  4FWK A;  3C6U A;  1NMN A;  1OH7 A;  2GEM A;  3DLB A;  5KGX A;  3K59 A;  4E7L A;  5IWA K;  3OYE A;  1L3V A;  4JD2 A;  3Q7B A;  3SQ2 A;  1KTQ A;  4DUY K;  5FPN A;  2R7Y A;  1QTM A;  1CXQ A;  5HL7 L;  2P9K B;  3LAN A;  2H3G X;  3ZSV A;  3BZK A;  2IC3 A;  4KFB A;  3QO9 A;  3CCU N;  4EFH A;  3G71 N;  1RTD A;  1GLJ O;  2NRZ A;  3VMF B;  4Z4H A;  4WE1 A;  4RWT A;  3CJC A;  5FPD A;  4DMN A;  1KLN A;  2P9L A;  1IH7 A;  2QKB A;  3K5N A;  2D5R A;  3KLH A;  4FM2 A;  4CJP A;  2IIR A;  2P9L B;  3VOV A;  4DV1 K;  1IG9 A;  1TAU A;  3HYF A;  4LD0 A;  1VQK N;  4RG8 A;  3LP2 A;  3UKU A;  3QNN A;  3SPY A;  4FWO A;  4B1Y B;  3MXJ A;  5LY3 A;  1Z25 A;  1WBB A;  3VPZ A;  1ZBI A;  2OA8 A;  3DLK A;  3AAQ A;  3CCR N;  3P39 A;  2UUA K;  1GOB A;  1HYV A;  2G8H A;  4M7Y A;  3P38 A;  1Y97 A;  3MDQ A;  3PO4 A;  3LL3 A;  3LM9 A;  2RHK A;  4ID5 A;  3DXM B;  3HXM A;  5CR4 A;  5LJV A;  2KW4 A;  3UKR A;  3M5R A;  4DTS A;  1XWL A;  2QTD A;  1U45 A;  1Q82 O;  5AQX A;  4RTF D;  1Q9X A;  3TAE A;  4KRF A;  3AVF A;  5H1S Q;  2FF3 B;  3ENB A;  2D0B A;  2HBJ A;  5BPL A;  2QXF A;  4BE7 B;  2BE2 A;  2EHG A;  2P9I A;  4FYD A;  4CGF A;  2KFN A;  1FXX A;  2E8A A;  4CIG A;  4M3W A;  4HWI A;  1K8A O;  4N5S A;  3PV8 A;  2Q0U A;  3FE1 A;  4F2S A;  5AZJ A;  3NH1 A;  1T7P A;  2P5G A;  4IZ9 A;  3AA3 A;  2RPI A;  5JMV A;  4K8X A;  2Y1I A;  3ZSQ A;  3E66 A;  4BE1 A;  2UU9 K;  3SNN A;  4O0I A;  1T6C A;  3IMX A;  2WON A;  2FBY A;  4DQP A;  3TI0 A;  5M1O A;  2QWR A;  1XMQ K;  1IKW A;  4F2R A;  2ZJR L;  1KD1 O;  1C0T A;  1JLF A;  4AM6 A;  1W7A A;  4CHZ A;  4NB4 A;  3VQA A;  4LH4 A;  1V4S A;  3VTI A;  3FFK B;  5SWM A;  4CJ5 A;  2XY8 A;  4JV5 K;  1WAJ A;  3MX2 A;  4DS4 A;  1G15 A;  5JEN A;  3ZCM A;  4DQI A;  4DS5 A;  1XHX A;  5M1Q A;  3C6H A;  1NK0 A;  4WQ5 A;  1NK8 A;  5J2Q A;  5TKW A;  3HVR A;  3TWH A;  3VF6 A;  1EXQ A;  2JLE A;  4WQ5 C;  3EY1 A;  1RT5 A;  1HJR A;  1MDU B;  1LCU A;  3VEV A;  2WC9 A;  3NFA A;  3L2R A;  1JJ2 M;  4ISG A;  3DLE A;  1RBV A;  4F4K A;  3ZX3 A;  4FOI A;  2YHW A;  1VSF A;  1HR0 K;  4OO1 J;  4PKH A;  4QOZ B;  1JXE A;  3DMJ A;  3Q7C A;  3PX0 A;  1GLD G;  3DYA A;  2JWL A;  3OJS A;  1YF5 L;  1OH6 A;  4AQY K;  3CM6 A;  1YTA A;  3CIP A;  2IOC A;  3RWU A;  3HPO A;  4LFC K;  3EN9 A;  4IDH A;  2NNW A;  1NJZ A;  5C0Y A;  1VQ6 N;  3G6E N;  1TK8 A;  3T1A A;  1JLA A;  5KGW A;  3VTH A;  1D9D A;  3MN9 A;  1JL2 A;  3AVN A;  3O9Q A;  4YDU A;  2GWJ A;  1YT3 A;  1RDD A;  1WLJ A;  4E0D A;  4B1X B;  1RT1 A;  2WTU A;  4FLZ A;  5AQZ A;  1TKD A;  1KXP A;  3IRX A;  1NMD A;  4YDU C;  1B92 A;  4BR0 A;  3O1W A;  3CCM N;  3OS1 A;  3PIO L;  4IEI A;  3HTV A;  4DR1 K;  3H6E A;  1NK7 A;  3UIQ A;  3KHY A;  2B5J A;  3VN5 A;  1VSD A;  3L0Q A;  1C1B A;  2OZM A;  1JLC A;  1Q81 O;  3OBY A;  4EAH D;  2X6S A;  4PUO A;  1M1K O;  3QB0 A;  1BQM A;  4AHR A;  1HNW K;  3H08 A;  3AVL A;  4B9T A;  3DJC A;  2O4I A;  1LW0 A;  1NJW A;  3AVB A;  4IJN A;  4CGH A;  4LSN A;  1ASV A;  2QKK A;  3HK2 A;  4EHT A;  1NGI A;  3VA3 A;  3CI5 A;  3TPQ A;  5DMR A;  3MN7 A;  1H1V A;  4OKJ A;  3CCQ N;  3NE6 A;  4DR3 K;  4JI5 K;  3HT3 A;  1BU6 O;  4DTO A;  3HPH A;  5C12 A;  3OTO K;  1ZYQ A;  1SKR A;  2F8T A;  3FR0 A;  4H03 B;  2IDO A;  1QVG M;  2DFH A;  5LL6 Z;  3ISN C;  3VET A;  3L2Q A;  3WXL A;  2QI2 A;  4FJL A;  4DU3 A;  2P9K A;  2YNI A;  1J9A A;  4C8N A;  4DV4 K;  4JHD B;  3NF9 A;  3FGU A;  3NBP A;  2W00 A;  2FBX A;  3D45 A;  3OYG A;  3MX5 A;  4LSL A;  1F21 A;  3DRP A;  2HW3 A;  3AVA A;  3FZH A;  3OJU A;  3THY A;  4XH5 A;  1N6Q A;  4JKA A;  5HOO A;  4BG9 A;  2HHV A;  1HLU A;  3QIN A;  2UYT A;  4FK0 A;  2RF2 A;  3LDO A;  4KI4 A;  3DM2 A;  4JK7 A;  4C8O A;  3KLG A;  4FJI A;  1KCF A;  1NJI O;  4H0P A;  4FPA A;  5EU7 A;  3ZET B;  1P8Z A;  3I0R A;  1RFQ A;  4FCY A;  3DRR A;  4AM7 A;  3OYB A;  1OKJ A;  2LSN A;  4CK1 A;  4YHH K;  2E20 A;  4OKE A;  4WF9 L;  4EP4 A;  3EYZ A;  4JYA K;  4CJW A;  1U6Z A;  4MDB A;  3SCX A;  2AP1 A;  3OVN A;  2GWK A;  4NYN A;  2KTQ A;  2HHQ A;  3WQU A;  4JI6 K;  2O8D B;  2HHH K;  2GUI A;  1S3X A;  1MWM A;  5GAD P;  1TUU A;  3QDK A;  1EX4 A;  5AQU A;  1FKP A;  5AQW A;  1VSM A;  4JEP A;  3NCI A;  3AO5 A;  4I2P A;  3HBT A;  1VQ4 N;  4MFB A;  2OPQ A;  3OYC A;  2I7P A;  1X3M A;  2BTF A;  5AQL A;  3SQ0 A;  4DUZ K;  3GDQ A;  2V51 B;  3D2E A;  3O1B A;  4W5Q A;  1FW6 A;  1TL1 A;  4FW1 A;  4FZX C;  1HNZ K;  3HJF A;  3P5J A;  4GKJ K;  3SZ2 A;  4E19 A;  2BDP A;  3QML A;  3ZEU B;  2FBV A;  2FXU A;  2OZS A;  4F9O A;  3CFR A;  4GKK K;  3FLC O;  4NYF A;  5E41 A;  4H5N A;  4O44 A;  4KHW A;  3F9M A;  3HI0 A;  5HLF A;  2IGI A;  2HMI A;  1OH8 A;  1ZBU A;  4FOE A;  1BIU A;  3CPW M;  4IJA A;  3K9J A;  1TV6 A;  4GVM A;  4CZF A;  3CET A;  3I8B A;  4FLW A;  3QFP A;  3CJB A;  4DFK A;  3DOL A;  4CIE A;  1JLB A;  4KHN A;  3KD5 E;  1RDB A;  1S1T A;  3ASM A;  1WNS A;  1BI4 B;  1C0M A;  3AO3 A;  3AVI A;  5AR0 A;  3PSF A;  5AQM A;  5CE3 A;  1TGO A;  4PKI A;  3D2E B;  4K8Z A;  4CGD A;  4WQ4 A;  4DV6 K;  5FLX O;  4CI6 A;  4CZM A;  2O8C B;  3S9H A;  4B3M K;  3M1F A;  4M3Z A;  1HKG A;  1QQO A;  3G0Z A;  4KI6 A;  5F1X A;  4A2B A;  2F8S A;  3F2K A;  3JS6 A;  1BHL A;  3V6D A;  1RTJ A;  2Z1I A;  1QSY A;  1Y64 A;  3ZSO A;  2Z1G A;  3O5B A;  3TAQ A;  2W41 A;  4W5N A;  4F3O A;  2YI1 A;  1L3S A;  3VEO A;  3CCE N;  1ESV A;  1GOA A;  3LDS A;  3O3F A;  2V7Y A;  3MMV A;  2UXB K;  1W2B M;  4BC5 A;  3C95 A;  4DU1 A;  2BAN A;  4PWD A;  3QIC A;  3TAF A;  3O4N A;  3RSE B;  3S41 A;  3EE8 A;  3OHR A;  3MN6 A;  2G8K A;  4A59 A;  3QBW A;  1BOT O;  3CMA N;  5AQK A;  3C7N B;  4CK3 A;  3THY B;  1X9S A;  1XMO K;  3BZC A;  4BRE A;  1BIZ A;  4BRH A;  4BRI A;  4LF5 K;  4PHT X;  3O3G A;  4JAX A;  1VQN N;  1ATN A;  1SL0 A;  4FZY A;  1E3M A;  2ETJ A;  1WSE A;  2Q1N A;  2HVI A;  2P9U B;  3GG4 A;  3RMA A;  4UY8 O;  4JRQ A;  1NKE A;  2Q3S A;  3E1Y A;  1QSS A;  3ZLJ A;  3CF5 L;  1XQS C;  2GV9 A;  2FSN A;  2PY5 A;  3WT0 A;  4CJQ A;  1NOY A;  1NLV A;  4CHO A;  5KTQ A;  1TYQ B;  1CXU A;  4I7F A;  3THX B;  4R5P A;  4BRA A;  4HHT A;  1QZ6 A;  4YOV A;  4BEB A;  4AH9 A;  2Z1H A;  3U6F A;  5AZJ B;  4XEI A;  4JKC A;  1R0A A;  1HX1 A;  4Z4G A;  1QQN A;  1XI1 A;  4CGJ A;  3PSI A;  3CCS N;  5GAG P;  2O8B A;  3SLC A;  4A5A A;  3V9U A;  5JIC A;  4KKO A;  1FKO A;  3MEE A;  3I8D A;  4G1Q A;  3BF1 A;  2HHT A;  5AQQ A;  2E1Y A;  1IBL K;  5CZ1 A;  1K9M O;  4FJK A;  2QWQ A;  3NHG A;  1T03 A;  3VES A;  2YNG A;  1KLM A;  3HM8 A;  3VQP A;  4CEA A;  1HNX K;  4B1V A;  3D2F B;  2QA4 N;  4FJM A;  3ZSX A;  4B1W B;  2P9P B;  5KPT A;  4Y1D A;  1J53 A;  3EEQ A;  1KFS A;  1C0U A;  2RE2 A;  2ZQB A;  3TAM A;  3L3V A;  3WNH A;  2NZT A;  3AA4 A;  1ZBF A;  5I9E B;  5FRN A;  3TSP A;  4OLB A;  3TAR A;  4W5T A;  1UAX A;  4B9L A;  4K43 A;  3VF4 A;  5KPZ A;  3OYA A;  2G8I A;  1NGA A;  3VQB A;  2F4V K;  3NVK A;  3KWI A;  3T19 A;  2NRT A;  3OBW A;  2O8B B;  3OYK A;  4I6M A;  2ATQ A;  3O3H A;  1U4B A;  3I56 N;  4FJX A;  3SYZ A;  4CVN E;  4YOY A;  3CJA A;  1GLB G;  3K5O A;  3OYM A;  1KVC A;  4DTM A;  5LJW A;  3E9O A;  4DV7 K;  2ZE2 A;  4JI4 K;  1S72 N;  1ATR A;  5KQ8 A;  3OY9 A;  3OYJ A;  1YHQ N;  2W42 A;  3BUZ B;  4RCH A;  1O1W A;  1GOC A;  1S9E A;  3J80 O;  4JS4 A;  1NWK A;  5AFU A;  2GEL A;  2FBT A;  3QEX A;  2ASP A;  4DV5 K;  3DOK A;  4KH4 A;  3ZT0 A;  4TSX A;  5JVG L;  2OYQ A;  3P4I A;  4OGE A;  4CZK A;  3C7N A;  3VEZ A;  1NM1 A;  4GV6 A;  4JRP A;  3R1X A;  4LF6 K;  4LF7 K;  4CEQ A;  3DXK B;  4KH6 A;  1BO5 O;  4FM0 A;  2FSK A;  2F7T A;  2HF3 A;  3VQ9 A;  1WUA A;  3ID8 A;  1YVN A;  2OCE A;  4CJT A;  3EZ5 A;  1WSJ A;  3J7A P;  3VQ4 A;  1TKZ A;  4LFA K;  4ZTF A;  3EL2 A;  1CZB A;  3A0I X;  3S3O A;  3VA0 A;  1Q7Y O;  5BRD A;  4JKF A;  4MO4 A;  4CED A;  3ZT2 A;  2C1I A;  3CG7 A;  4CF9 A;  4DTP A;  1QZ5 A;  3DWL A;  3CCJ N;  3KKR A;  2A42 A;  3QES A;  3HL8 A;  2XO7 A;  4FWR A;  4BRD A;  1Z6R A;  1WBD A;  3KZB A;  4CJU A;  4UQG A;  4DQR A;  3TAN A;  3VQ7 A;  3DXK A;  4HVJ A;  4BRP A;  5AFU H;  1NGF A;  4M3X A;  3H3N O;  4CJ3 A;  3FZM A;  4KHP K;  3KK7 A;  4FLY A;  2VQF K;  3AVJ A;  3OS2 A;  4HUE A;  4JN4 A;  4L8R B;  4OKK A;  1JXB A;  2JGU A;  1WSG A;  1QQC A;  4E72 A;  2YJF A;  4HTU A;  2XY5 A;  4PL7 A;  4H4M A;  3L2U A;  4NCG A;  4FJN A;  1UWB A;  3QLH A;  1Q86 O;  1BA1 A;  1P90 A;  2VG5 A;  1ASW A;  2ZJQ L;  5T7B A;  4CFC A;  1N5Y A;  4DWI A;  2OPS A;  3DAW A;  5A2Q O;  5C25 A;  3OYN A;  4BWM A;  4O55 A;  1YTU A;  4HUG A;  3IG1 A;  4FJ5 A;  4WFA L;  1YJW N;  2IVN A;  3AVG A;  2AJQ A;  1VQL N;  4DR4 K;  4JS5 A;  3VGM A;  4DLG A;  4JI7 K;  1VQ7 N;  5KQD A;  3U3G A;  1GLA G;  3ATU A;  3LWL A;  3NGY A;  5BN9 A;  2P51 A;  1NGD A;  2QWM A;  3ZX0 A;  4FK2 A;  2A1S A;  3NF7 A;  3MXM A;  4WYB A;  4CJ7 A;  4DB3 A;  1QE1 A;  1HQE A;  3AA5 X;  2HBL A;  1JCE A;  1NK4 A;  3TAP A;  1CZA N;  4NXM K;  3HVT A;  4H0V B;  4JI0 K;  3QEP A;  4I9L A;  4NXN K;  4LY7 A;  5EOY A;  4YFU A;  2OPP A;  3NAE A;  3OYH A;  1IKX A;  1DGK N;  2CGJ A;  2QXL A;  1BQN A;  1HJO A;  4CES A;  3SBG A;  3B6P A;  5ADX A;  3CHW A;  2OPR A;  2P9P A;  1RGI A;  3V9W A;  4DSJ A;  2VGM A;  3H3O B;  4CF1 A;  1XNQ K;  4AF1 A;  5AZI B;  1YXQ A;  3AAR A;  4H5T A;  5ELZ A;  5F0X A;  4J2A A;  1NGG A;  1VQ9 N;  4FM1 A;  4ELV A;  1HUX A;  3W0L A;  2IS3 A;  1RT2 A;  3L6Q A;  4AHT A;  3P31 A;  1KSP A;  3CJ1 A;  4CZJ A;  3KK3 A;  2HHI A;  4OVL A;  4IFV A;  2YHX A;  4O8K A;  4DLE A;  1NK5 A;  5BRH A;  3VEW A;  2HNY A;  4J8F A;  1DTT A;  1BUP A;  2P9S B;  4CFB A;  3V9S A;  3ENH A;  2J4R A;  5AQV A;  2NLX A;  5AQI A;  1VRU A;  5SZT A;  4LH5 A;  4BDZ A;  4V19 S;  4CJK A;  3T1H K;  4MO5 A;  4H4O A;  5GAE P;  2D0O A;  3WNF A;  1C0G A;  1RCH A;  3J81 O;  4B3R K;  1IG8 A;  3V1Q A;  1KRP A;  1KVA A;  3CYG A;  3QNO A;  4BC2 A;  2VG6 A;  4BWJ A;  2E6M A;  4B8C A;  1UA1 A;  4DHY A;  3K5M A;  4FLU A;  2A6A A;  5J1E A;  2E2Q A;  2A41 A;  1W97 L;  2E6L A;  5AQO A;  4CER A;  3THW A;  4KHQ A;  2QWL A;  1SKW A;  2NRH A;  4CJ4 A;  5FRM A;  3W3D A;  4CF0 A;  1DT9 A;  4DSK A;  4RW8 A;  3GL1 A;  4BRF A;  5J2M A;  2X78 A;  3G25 A;  3ZT1 A;  3CYM A;  3ID6 A;  2UUB K;  1DTQ A;  3SQ1 A;  1GLL O;  3ULE B;  1VQM N;  1SS6 A;  1CLQ A;  4CGI A;  3AV9 A;  1JLE A;  1GLC G;  1SUQ A;  2UUC K;  1RDU A;  4O5B A;  4FLX A;  4C8K A;  3AO2 A;  1I3A A;  3IFR A;  4GNI A;  4EP5 A;  4B3S K;  3BY5 A;  4ILH A;  4CFA A;  5AQJ A;  1XC3 A;  3M8Q A;  3RR7 A;  5LMU K;  3RVC A;  2B6A A;  4DTU A;  4YOT A;  1KAY A;  2ZF5 O;  1RT3 A;  3C0B A;  1GLF O;  4JKB A;  2KZM A;  3N4Q A;  5DK5 A;  4C8M A;  2O4G A;  3U8X A;  3H1V X;  4GW6 A;  2D1K A;  4HTL A;  1VQ5 N;  4AHC A;  1S9G A;  4FJ8 A;  1JLG A;  3VQC A;  1N33 K;  3TTF A;  1UOC A;  4I2Q A;  4B9V A;  1TAQ A;  2E2N A;  4FK4 A;  3TTC A;  3CJ9 A;  4KAZ A;  3OA9 A;  3HM9 A;  4FZZ A;  4AHS A;  4C23 A;  4BRK A;  4K41 A;  2DFF A;  4M41 A;  4FJH A;  3K58 A;  4BE0 A;  4BR9 A;  4NLC A;  4DTX A;  3H45 C;  3LAK A;  3R8E A;  5CY4 A;  2DY4 A;  1QHA A;  3MEC A;  3NGZ A;  3FFI A;  4ISF A;  5GIO A;  3QBX A;  3I0S A;  1EET A;  3QEI A;  2P9N B;  4KH5 A;  4DSF A;  4CHY A;  3F5T A;  1VQ8 N;  4AIL C;  3K0S A;  4ID1 A;  4BDY A;  4BDP A;  3ZSR A;  3LDQ A;  3EKU A;  3T1Y K;  2Q2R A;  4DQS A;  3C65 A;  3HRG A;  3VQ8 A;  1U04 A;  3V9X A;  3CME N;  4YOW A;  2F9W A;  3O9U A;  1QQM A;  2V52 B;  2UXD K;  5EXW A;  2E2P A;  2WBN A;  1WN7 A;  4ICL A;  3AY9 A;  4OJR A;  3LDL A;  1O13 A;  4CZE A;  3M6G A;  4B9S A;  1L3T A;  4X66 K;  4B9N A;  1S1X A;  2GX9 A;  3KIO A;  4QCL A;  2IVP A;  4WFN L;  2YX6 A;  4RW6 A;  3LAM A;  1QHT A;  3OYL A;  3DLL L;  4Y1C A;  3AVK A;  5FRO A;  1EO1 A;  4EHU A;  1R59 O;  1BIS A;  3SMS A;  3MED A;  3EKS A;  3LDN A;  3ALY A;  1JCF A;  4ISE A;  5AQG A;  3VER A;  4LF8 K;  4BRM A;  4YOU A;  5C2D A;  4LF9 K;  3JXU A;  2VYP A;  4CEC A;  3KVG A;  4IO8 A;  3PX4 A;  3MCA B;  4XH1 A;  3ZET A;  5HRN A;  2CGK A;  2YJE A;  3KTQ A;  5HRP A;  5DM6 L;  4QS8 A;  4O0J A;  1WSH A;  3K2P A;  2X6N A;  2ZWH A;  3SK3 A;  2F96 A;  2E1Z A;  5AQT A;  2KLA A;  4FO0 A;  1OVY A;  5HBM A;  3ZYY X;  1RDA A;  3KLE A;  5D3G A;  2P1J A;  1LWC A;  3T3F A;  3BGR A;  1TYQ A;  3MCP A;  2VQE K;  4M3Y A;  3CCL N;  4K0K K;  3QEV A;  1RT4 A;  1Q9Y A;  3KLF A;  3DI6 A;  4H5R A;  4B08 A;  4LFB K;  1BCM A;  1TK0 A;  2HOE A;  5AQY A;  2O8E B;  2W6K A;  1HMV A;  4GV9 A;  4CBW A;  2YKN A;  3CC4 N;  3ZSY A;  4CIF A;  3GE1 A;  1SV5 A;  1EWQ A;  2D0A A;  2Z1J A;  4H5W A;  3BDP A;  3O9T A;  3SJJ A;  4GMJ B;  3U9D A;  4Z4E A;  3AVM A;  4JI1 K;  4CHN A;  4KB1 A;  3O08 A;  1U2V A;  4BRC A;  1EWR A;  4OPH A;  4H0Y B;  1YVU A;  3VQE A;  2D0P A;  4R79 A;  2P9S A;  3H46 O;  3HST B;  3O4Q A;  4M63 C;  4BQZ A;  1LV5 A;  3WNG A;  4DG1 A;  2NRR A;  5C15 A;  5JS1 A;  3OYD A;  1DLO A;  1HNV A;  1IJJ A;  1RIL A;  2KZZ A;  4C8L A;  3OW2 M;  4K42 A;  1KAZ A;  1J5O A;  1WAF A;  1VRT A;  3K9K A;  1IV0 A;  4NO7 A;  5AQF A;  1HYS A;  3LP0 A;  2OTL N;  5C24 A;  1TL3 A;  3AGK A;  4XJX A;  4H0T B;  4CF2 A;  4DV2 K;  4DTN A;  1VQP N;  1RBU A;  2KQ2 A;  1NOZ A;  3RTV A;  2HST A;  1LW2 A;  3AO4 A;  4JLH A;  4FJJ A;  1ATS A;  4FWP A;  5JLH A;  1BGX T;  2O8C A;  1JL1 A;  2PZS A;  4BRG A;  3HP6 A;  1NJY A;  2IAJ A;  1ILY A;  1YIT N;  2ITM A;  1YAG A;  4U7B A;  3SUQ A;  4RW7 A;  3C94 A;  3MXI A;  2PYJ A;  4BVP A;  1LAV A;  3J7Z O;  1G99 A;  1K8K A;  3OS0 A;  4X65 K;  4CF8 A;  4FWS A;  4DF4 A;  3C6T A;  3L8B A;  2ITG A;  1D9F A;  4Z4I A;  3AVC A;  1Q18 A;  3KK1 A;  3A2F A;  3HOS A;  4X64 K;  4BR5 A;  4DFJ A;  3IDH A;  3MEG A;  2WFB A;  1NGE A;  1RBS A;  3AVH A;  3MK6 A;  1RBR A;  3M8P A;  3TSU A;  2W6L A;  3HO1 A;  4CW7 B;  4F3T A;  3LAL A;  3K5L A;  4DV0 K;  3FZK A;  3G4S N;  4E1M A;  1BL3 A;  4DR6 K;  2YHA A;  3LPT A;  4KHU A;  3A5O C;  3VQQ A;  2QK9 A;  1X3N A;  4FXD A;  1D4X A;  3U3Y A;  4BY9 C;  3O6W A;  1XC9 A;  2P9U A;  3D0P A;  1SL2 A;  1JKH A;  4K25 A;  1A5V A;  4BR2 A;  3SQ4 A;  1N8R O;  4BVO A;  1U48 A;  3PX6 A;  3NGI A;  4FW2 A;  3QFU A;  3WXK A;  3LP1 A;  1RNH A;  4GVE A;  2F9T A;  3TSQ A;  5I42 A;  1YIJ N;  1LWF A;  3ZT3 A;  4CEE A;  5CZ2 A;  4E3S A;  2FC0 A;  4IOC L;  2VGN A;  4FSV A;  1HPZ A;  2PFU A;  4DV3 K;  3QEW A;  4MDA A;  4PL8 A;  3KKS A;  5C42 A;  4DSE A;  3R6M A;  3EE9 A;  3SV3 A;  4DFM A;  5GIP A;  4MQ3 A;  3T7Z A;  4CBX A;  1S6Q A;  4FWN A;  4DR2 K;  3SAH A;  2G8U A;  3S3N A;  5K14 A;  4KRE A;  1RBT A;  5J2P A;  1L3U A;  2XY6 A;  3CER A;  2PAV A;  4LC9 B;  1C1A A;  2HMP A;  4B9Q A;  3QIP A;  2Y1J A;  4BEC A;  4KO0 A;  4Y0W A;  4X62 K;  1S1U A;  2QWO A;  2NUB A;  2A3Z A;  3HP9 A;  4DSI A;  1V4T A;  4B9M A;  1J6Z A;  2Q0R A;  3GBT A;  1A5X A;  5JS2 A;  1HQU A;  2C1G A;  3F73 A;  1ZBH A;  1YI2 N;  2QWN A;  4KTZ A;  3FZF A;  4CZG A;  2KHO A;  5JVH L;  1C1C A;  1TKX A;  1QS4 A;  1T3V A;  3L4Q A;  3UKR B;  2HF4 A;  1VQO N;  4A57 A;  1J5E K;  1J54 A;  4JHD A;  3DXM A;  2Q97 A;  1OH5 A;  1BI4 A;  3IAY A;  1I94 K;  5E84 A;  5KRT A;  4BGB A;  2DTU A;  5FPE A;  4Z0U A;  4EIA A;  2ZM6 K;  5BR9 A;  2YKM A;  2NRW A;  3ZSW A;  3L2W A;  3V4I A;  1IBK K;  2XRI A;  3PLA A;  2V7Z A;  5EY4 A;  3CC7 N;  5B8H A;  4Z4F A;  4B1Z A;  3VEN A;  3SAG A;  4JKG A;  3UKU B;  5FPM A;  1TVR A;  1K6Y A;  4ILJ A;  3UB5 A;  3NVM A;  1S6P A;  2VWJ A;  3M3Z A;  3LWM A;  4I6M B;  5HP1 A;  4FJ9 A;  2RN2 A;  1LWE A;  3OYF A;  4QS9 A;  4JKG B;  1WOQ A;  1WSI A;  1QVF M;  4FVM A;  1N36 K;  3VEY A;  2CGL A;  3AO1 A;  2GTD A;  3KJV A;  3IKM A;  5AQP A;  3SMP A;  4B8A B;  4OX9 K;  3IS9 A;  2NRV A;  5FDL A;  1W0H A;  1CZ9 A;  4H5V A;  4A62 A;  4IBN A;  4FWQ A;  3TU5 A;  3B6O A;  3PUF A;  1D5A A;  3N4P A;  1RTH A;  1HNI A;  3ENO A;  3VEX A;  4DTJ A;  3D2F A;  4BR4 A;  4FJ7 A;  2O8D A;  3A5N C;  5BRE A;  1ASU A;  3NDK A;  5E26 A;  1YJ9 N;  3DLH A;  4LF4 K;  4YOX A;  3EO3 A;  1HRH A;  4CJS A;  3SBT A;  3CM5 A;  1MU2 A;  4CE9 A;  2ZGZ A;  1VSK A;  2BH1 A;  1NKC A;  3A5L C;  4FPB A;  1HKC A;  4WFB L;  3QER A;  1GLE G;  3CPE A;  2Q31 A;  3ATV A;  2YNH A;  4E1N A;  5HRO A;  5HRS A;  4G9Z A;  5M1F A;  2VWB A;  4DCH A;  2D0C A;  3SUP A;  3BEX A;  1NK6 A;  1ITG A;  3THX A;  2D4W A;  4OPK A;  3V1R A;  4CZI A;  3DLR A;  1VAZ A;  3R3L A;  5AQH A;  4J2D A;  4IDK A;  2HB5 A;  1U2V B;  1NBW A;  3I33 A;  3CQ8 A;  4BGA A;  1Q8I A;  4IEE A;  4L3Q A;  2QM1 A;  4E7J A;  4E7K A;  1A5W A;  3U4L A;  1WSF A;  2PBD A;  3NF6 A;  3HZ6 A;  4KHS A;  4CCH A;  4NCA A;  5EVZ A;  4M3T A;  4CJF A;  5JLF A;  1FJG K;  2FLO A;  4EZ6 A;  4CEF A;  1RT7 A;  4KBO A;  4FVU A;  4Z94 A;  3CFP A;  4N56 A;  4CHQ A;  3M8S A;  4EZ9 A;  1JLQ A;  3PIP L;  1X9M A;  3V81 A;  1REV A;  4H0X B;  2B4J A;  5ADX H;  4C1N K;  4H0O A;  4IWV A;  3VQ6 A;  3RSE A;  2GUP A;  3E9L A;  3V1O A;  1OVQ A;  3SUN A;  1ZXO A;  4C1N I;  4CJL A;  2KFZ A;  3U9Z A;  3E9P A;  4WQ4 C;  1IKV A;  3NF8 A;  3JAM O;  5BPM A;  4YNQ A;  3ULD A;  2QEX N;  4O8U A;  4E89 A;  3JSM A;  4OPA A;  4JI3 K;  3AGR A;  1VHX A;  3KK2 A;  3V9Z A;  4Q0B A;  1B9D A;  3LZJ A;  5M1K A;  2G8W A;  3D7E O;  2VWK A;  3SAF A;  4GY2 B;  5CYM A;  4QAG A;  3DRS A;  3WEE A;  3ZX2 A;  4FLV A;  5IT9 O;  3BF3 A;  1KQS M;  3FZL A;  3WQT A;  4E7I A;  4N41 A;  3WXJ A;  4IOX A;  4CEZ A;  4JKE A;  2VG7 A;  4IG0 A;  3R9P A;  4BAC A;  4M45 A;  3TAG A;  4OLA A;  5J2N A;  5DM7 L;  2E2O A;  4U67 L;  1NG9 A;  3RR8 A;  2I5J A;  4W5R A;  1T05 A;  3VQD A;  2Q36 A;  3WXM B;  3KLI A;  4BRQ A;  3B8A X;  1RTI A;  1SL1 A;  1DEJ A;  4Q5V A;  1NKB A;  3MAQ A;  3F9K A;  5BRF A;  3LP3 A;  3WEE B;  3S3M A;  1U49 A;  4HCB A;  1FK9 A;  2WOM A;  1HYZ A;  1HPM A;  4DU4 A;  4CJE A;  4W5O A;  4JKD A;  5AQR A;  4CEO A;  5KI6 A;  4IFE A;  3C6A A;  4N76 A;  3S5T A;  3O4W A;  2EWS A;  4RW4 A;  2PYL A;  5AJ3 K;  3M8R A;  4B3O A;  4MLH A;  5MLC Q;  2FSJ A;  4FWL A;  3GOI A;  4N47 A;  4NLB A;  3ZSZ A;  4PY5 A;  1Z05 A;  1ZBS A;  1JCG A;  4DR7 K;  3CQY A;  3ZEU A;  2CH5 A;  2EX3 A;  3CCV N;  3HOT A;  1XNR K;  2QWP A;  4FL9 A;  3MWP A;  1EP4 A;  3CQX A;  4CJR A;  5BR8 K;  4WCE L;  1WB9 A;  4KPY A;  5AQS A;  1NGH A;  1NU0 A;  1D8Y A;  5GIN A;  2ZJP L;  1K73 O;  2OTJ N;  5GAH P;  1KFD A;  2DPN A;  1T8E A;  1S5J A;  2HVH A;  3LPU A;  2AA4 A;  1NNE A;  1QSL A;  4DF8 A;  5BN8 A;  1S22 A;  2I7N A;  4BE2 A;  4A2A A;  2O8E A;  1MWK A;  4YY3 K;  1VSE A;  2HNZ A;  5CYQ A;  1RDC A;  5C10 A;  3IUC A;  5F2R A;  4BG8 A;  4CBU A;  2A1R A;  2HND A;  2A40 A;  4OGC A; 
#chains in the Genus database with same CATH homology
 4E1J A;  3VTH A;  2HF3 A;  3MN9 A;  3O9Q A;  3AGK A;  4YDU A;  5C2F A;  1WUA A;  3CXC M;  3LM2 A;  3ID8 A;  4XJX A;  1YVN A;  4H0T B;  2GWJ A;  4A61 A;  1VQP N;  4B1X B;  1EQY A;  1M90 O;  2HST A;  5AQZ A;  1ATS A;  4FWP A;  5JLH A;  2OAN A;  1KXP A;  3EL2 A;  1NMD A;  3A0I X;  4BRG A;  4YDU C;  1Q7Y O;  5BRD A;  4JKF A;  4BR0 A;  4MO4 A;  3O1W A;  3CCM N;  3WXI A;  2C1I A;  3PIO L;  1ILY A;  4MLE A;  1YIT N;  2ITM A;  4IEI A;  1YAG A;  3HTV A;  4U7B A;  1QZ5 A;  2KKZ A;  3H6E A;  3UE5 A;  3DWL A;  3KHY A;  3CCJ N;  2P9I B;  4GV3 A;  3L0Q A;  2A42 A;  4BVP A;  3J7Z O;  1G99 A;  3T69 A;  3O9S A;  1K8K A;  1Q81 O;  4JK9 A;  4FWR A;  3OBY A;  4EAH D;  4FWS A;  4BRD A;  1M1K O;  4DKW A;  1Z6R A;  3QB0 A;  3EZW A;  3VGL A;  3VF2 A;  3KZB A;  3DJC A;  1Q18 A;  3HOS A;  3CD6 N;  3DXK A;  4BR5 A;  4JNE A;  4IJN A;  3IDH A;  4BRP A;  2WFB A;  3H1Q A;  5AFU H;  3L4I A;  1NGE A;  1NGF A;  1MA9 B;  3MK6 A;  2JWK A;  3H3N O;  3TSU A;  3FZM A;  3KK7 A;  3O8M A;  4ILG B;  4EHT A;  1NGI A;  3CI5 A;  3TPQ A;  2HBK A;  3O80 A;  4JN4 A;  2WUS A;  2A5X A;  3FZK A;  3MN7 A;  3G4S N;  1H1V A;  4A5B A;  3CCQ N;  2YJF A;  3J8A A;  4B1U B;  1BU6 O;  3A5O C;  4PL7 A;  5C12 A;  5CHI A;  2VCP A;  1X3N A;  3FR0 A;  4H03 B;  1D4X A;  3VGK A;  4QS7 A;  4BY9 C;  3O6W A;  1QVG M;  1Q86 O;  2P9U A;  2CH6 A;  1BA1 A;  1P90 A;  4CZH A;  3NMU A;  4K25 A;  2ZJQ L;  4BR2 A;  1N8R O;  3VET A;  4BVO A;  1E4F T;  3HSC A;  2QI2 A;  3MN5 A;  3WXL A;  3DAW A;  3QFU A;  3WXK A;  2P9K A;  2IVO A;  4GVE A;  2F9T A;  4M7X A;  3TSQ A;  4DQ8 A;  4JHD B;  1YIJ N;  3CC2 N;  1YUW A;  4WFA L;  1YJW N;  2IVN A;  3FGU A;  2W00 A;  2P9N A;  4IOC L;  1KC8 O;  1BDG A;  2VGN A;  4FSV A;  3MX5 A;  1VQL N;  3AAP A;  2PFU A;  2HBM A;  4MDA A;  3TTD A;  3VGM A;  4PL8 A;  1VQ7 N;  5KQD A;  1GLA G;  3ATU A;  3WUH A;  5M1P A;  3FZH A;  1X9J A;  5BN9 A;  3R6M A;  4XH5 A;  2W40 A;  4BRN A;  3EE9 A;  1NGD A;  2QWM A;  4JKA A;  3ZX0 A;  5HOO A;  4BG9 A;  1E4G T;  4CZL A;  2QW9 A;  5GIP A;  1HLU A;  4WYB A;  3T7Z A;  4CBX A;  2UYT A;  4CJ7 A;  4DB3 A;  3O9R A;  2HBL A;  3LDO A;  4FWN A;  1BWF O;  1JCE A;  3SAH A;  1CZA N;  4JD2 B;  4H0V B;  3SJH A;  4IO9 L;  4JK7 A;  5EOY A;  1SAZ A;  1NJI O;  1DGK N;  4H0P A;  4FPA A;  2CGJ A;  2QXL A;  3CER A;  3ZET B;  2YCH A;  1P8Z A;  1HJO A;  3A5M C;  2PAV A;  4LC9 B;  5TKY A;  3SBG A;  5ADX A;  1RFQ A;  2HMP A;  3CHW A;  1KAX A;  4AM7 A;  4B9Q A;  1OKJ A;  4BEC A;  5M1N A;  2P9P A;  2E20 A;  1RGI A;  1RDW X;  4Y0W A;  4WF9 L;  1U6Z A;  1TUY A;  2VGM A;  3H3O B;  4MDB A;  2QWO A;  4JKH A;  2AP1 A;  2A3Z A;  4AF1 A;  2FF6 A;  5AZI B;  1YXQ A;  2ZGY A;  2GWK A;  1V4T A;  3A8Y A;  3AAR A;  4BQL A;  4H5T A;  1J6Z A;  2Q0R A;  3GBT A;  3WQU A;  2C1G A;  5ELZ A;  5F0X A;  4BRO A;  1S3X A;  1YI2 N;  1NGG A;  1VQ9 N;  1MWM A;  5GAD P;  1TUU A;  1T6D A;  3QDK A;  4BC4 A;  3MWT A;  5AQU A;  5AQW A;  2QWN A;  1HUX A;  3FZF A;  4JEP A;  3W0L A;  4CZG A;  3HBT A;  3L6Q A;  1VQ4 N;  3P31 A;  1T44 A;  2KHO A;  5JVH L;  3CJ1 A;  4CZJ A;  2I7P A;  2YHX A;  4O8K A;  1X3M A;  2BTF A;  1T3V A;  3L4Q A;  5AQL A;  3UKR B;  2HF4 A;  1VQO N;  4A57 A;  3ULE A;  5BRH A;  3VEW A;  3I55 N;  4IOA L;  3GDQ A;  4JHD A;  3DXM A;  2Q97 A;  3BP8 A;  5BPN A;  2V51 B;  3D2E A;  3KWG A;  4J8F A;  3O1B A;  1BUP A;  2P9S B;  5E84 A;  4BGB A;  3ENH A;  2J4R A;  5AQV A;  4FWM A;  5FPE A;  4EIA A;  2NLX A;  5AQI A;  5BR9 A;  2NRW A;  4BC3 A;  3QML A;  3PLA A;  3ZEU B;  2V7Z A;  1C0F A;  2FXU A;  4MO5 A;  5EY4 A;  4F9O A;  3CC7 N;  5B8H A;  3FLC O;  4B1Z A;  4H5N A;  3VEN A;  5GAE P;  2D0O A;  3SAG A;  3F9M A;  3HI0 A;  2E88 A;  1C0G A;  4JKG A;  3LDP A;  3UKU B;  5FPM A;  4XH4 A;  1IG8 A;  4FOE A;  4ILJ A;  4JK8 A;  3UB5 A;  3CPW M;  4IJA A;  1LOT B;  3K9J A;  3NVM A;  5EX5 A;  4BC2 A;  4CZF A;  3M3Z A;  1HKB A;  3CET A;  3I8B A;  4I6M B;  4DHY A;  2A6A A;  2ASO A;  2E2Q A;  3QFP A;  1YJN N;  4BRL A;  1SQK A;  2A41 A;  1W97 L;  3CJB A;  4QS9 A;  4JKG B;  5AQO A;  4CD3 A;  1WOQ A;  1ZC6 A;  4IXC A;  2QWL A;  1QVF M;  3VEY A;  2CGL A;  2NRH A;  2GTD A;  1SZ2 A;  1BA0 A;  3IKM A;  3W3D A;  1XUP O;  5AQP A;  3SMP A;  5AR0 A;  1DT9 A;  1DKG D;  1NGC A;  2NRV A;  1BG3 A;  5AQN A;  5AQM A;  5CE3 A;  3GL1 A;  2NRX A;  4H5V A;  4A62 A;  4BRF A;  4PKI A;  4FWQ A;  3TU5 A;  4CD1 A;  3G25 A;  3D2E B;  3ID6 A;  4YOR A;  4WQ4 A;  1GLL O;  3N4P A;  4PKG A;  3D6R A;  3ULE B;  1VQM N;  3ENO A;  1SS6 A;  2BUP A;  3VEX A;  4CI6 A;  4CZM A;  1GLC G;  3D2F A;  4BR4 A;  1NGB A;  5KPR A;  3M1F A;  2ASM A;  1RDU A;  4O5F A;  3A5N C;  5BRE A;  1HKG A;  1QQO A;  3IFR A;  5E26 A;  1YJ9 N;  4GNI A;  4BR7 A;  4ILH A;  5F1X A;  3EO3 A;  4YOX A;  1K8K B;  5AQJ A;  1XC3 A;  4A2B A;  3SBT A;  3F2K A;  3JS6 A;  3RVC A;  3CJ7 A;  4YOT A;  1KAY A;  2ZF5 O;  2ZGZ A;  4G9Z A;  3C0B A;  1Y64 A;  2BH1 A;  1GLF O;  4JKB A;  3A5L C;  3N4Q A;  1HKC A;  4FPB A;  5AZI A;  2YHY A;  4WFB L;  1GLE G;  3CPE A;  3O5B A;  1NGJ A;  4FWK A;  2Q31 A;  3ATV A;  3U8X A;  2W41 A;  3H1V X;  2YI1 A;  2D1K A;  2GEM A;  4HTL A;  3VEO A;  5M1F A;  2VWB A;  4DCH A;  1VQ5 N;  1ESV A;  3CCE N;  2V7Y A;  3MMV A;  3Q7B A;  4JD2 A;  3TTF A;  1W2B M;  3BEX A;  4BC5 A;  5FPN A;  2E2N A;  2D4W A;  5HL7 L;  3QIC A;  3TTC A;  2P9K B;  3CJ9 A;  4CZI A;  2H3G X;  1VAZ A;  3R3L A;  5AQH A;  3OA9 A;  3RSE B;  3S41 A;  1U2V B;  1NBW A;  3I33 A;  4K41 A;  3EE8 A;  3OHR A;  4BGA A;  4IEE A;  4L3Q A;  4BRK A;  4C23 A;  2QM1 A;  3MN6 A;  3CCU N;  4EFH A;  3G71 N;  4A59 A;  1GLJ O;  2NRZ A;  3VMF B;  3QBW A;  3U4L A;  1BOT O;  4RWT A;  3CJC A;  2PBD A;  5FPD A;  3CMA N;  3HZ6 A;  4BR9 A;  4NLC A;  5AQK A;  5EVZ A;  3C7N B;  3H45 C;  2P9L A;  3R8E A;  5JLF A;  2FLO A;  4BRE A;  1QHA A;  4BRH A;  4BRI A;  4ISF A;  4PHT X;  5GIO A;  3QBX A;  4KBO A;  4JAX A;  1VQN N;  4FVU A;  1ATN A;  4Z94 A;  2P9N B;  4KH5 A;  2IIR A;  2P9L B;  3VOV A;  3F5T A;  1VQ8 N;  3UKU A;  1VQK N;  2Q1N A;  3PIP L;  2P9U B;  3GG4 A;  4FWO A;  4B1Y B;  4UY8 O;  3LDQ A;  5LY3 A;  3EKU A;  3VPZ A;  4H0X B;  2Q2R A;  5ADX H;  4C1N K;  3E1Y A;  3C65 A;  4H0O A;  4IWV A;  3CF5 L;  3AAQ A;  1XQS C;  3CCR N;  2FSN A;  3HRG A;  3WT0 A;  3RSE A;  3P39 A;  3CME N;  2GUP A;  1NLV A;  4YOW A;  3E9L A;  4M7Y A;  3P38 A;  1TYQ B;  1ZXO A;  4C1N I;  2F9W A;  3O9U A;  3MDQ A;  1QQM A;  2V52 B;  3U9Z A;  3E9P A;  3LL3 A;  4WQ4 C;  5EXW A;  3LM9 A;  2RHK A;  4BRA A;  2E2P A;  5BPM A;  2WBN A;  2QEX N;  1QZ6 A;  3AY9 A;  3DXM B;  4YOV A;  4BEB A;  3LDL A;  1O13 A;  4O8U A;  5CR4 A;  4CZE A;  3M6G A;  5LJV A;  3M5R A;  3UKR A;  5AZJ B;  4XEI A;  4JKC A;  4OPA A;  1HX1 A;  2QTD A;  1QQN A;  3AGR A;  5AQX A;  1Q82 O;  4RTF D;  5M1K A;  3D7E O;  3CCS N;  2GX9 A;  5GAG P;  2IVP A;  3SAF A;  4WFN L;  2YX6 A;  5H1S Q;  4GY2 B;  2FF3 B;  3ENB A;  3SLC A;  4A5A A;  3WEE A;  5JIC A;  3DLL L;  2HBJ A;  5BPL A;  4BE7 B;  3ZX2 A;  3BF3 A;  3BF1 A;  2P9I A;  5AQQ A;  1EO1 A;  4EHU A;  2E8A A;  1R59 O;  2E1Y A;  3FZL A;  3WQT A;  1K9M O;  3SMS A;  1KQS M;  4HWI A;  3WXJ A;  2QWQ A;  4IOX A;  1K8A O;  3EKS A;  3LDN A;  4JKE A;  3VES A;  3HM8 A;  1JCF A;  4ISE A;  2Q0U A;  3D2F B;  3R9P A;  4B1V A;  2QA4 N;  3FE1 A;  4B1W B;  5AQG A;  5AZJ A;  3VER A;  2P9P B;  5KPT A;  4IZ9 A;  5DM7 L;  2E2O A;  4BRM A;  4YOU A;  5C2D A;  3JXU A;  2VYP A;  4U67 L;  5JMV A;  3KVG A;  4IO8 A;  2RE2 A;  3MCA B;  4XH1 A;  3ZET A;  2CGK A;  3E66 A;  2YJE A;  5DM6 L;  4QS8 A;  2Q36 A;  3WXM B;  2NZT A;  1T6C A;  2ZWH A;  3IMX A;  5AQT A;  2E1Z A;  3SK3 A;  2KLA A;  4BRQ A;  4FO0 A;  1OVY A;  3B8A X;  3ZYY X;  5I9E B;  3TSP A;  1DEJ A;  5M1O A;  2QWR A;  4K43 A;  3VF4 A;  1TYQ A;  3MCP A;  5KPZ A;  1NGA A;  2ZJR L;  1KD1 O;  3NVK A;  4AM6 A;  3KWI A;  3WEE B;  5BRF A;  3CCL N;  2NRT A;  4NB4 A;  1HPM A;  1V4S A;  3OBW A;  3VTI A;  3FFK B;  4H5R A;  4JKD A;  5AQR A;  4I6M A;  4IFE A;  3C6A A;  3MX2 A;  3O4W A;  2EWS A;  3I56 N;  2HOE A;  5AQY A;  4YOY A;  3CJA A;  4MLH A;  1GLB G;  4GV9 A;  4CBW A;  5M1Q A;  2FSJ A;  3C6H A;  5MLC Q;  4WQ5 A;  4FWL A;  3CC4 N;  3GOI A;  5LJW A;  3E9O A;  3GE1 A;  4NLB A;  1Z05 A;  1ZBS A;  1JCG A;  1S72 N;  5TKW A;  3CQY A;  3ZEU A;  1ATR A;  2CH5 A;  4H5W A;  5KQ8 A;  3CCV N;  1YHQ N;  3BUZ B;  3O9T A;  3VF6 A;  3HOT A;  3U9D A;  2QWP A;  3O08 A;  1U2V A;  4OPH A;  4WQ5 C;  4H0Y B;  4BRC A;  4FL9 A;  3MWP A;  4RCH A;  3CQX A;  1MDU B;  1LCU A;  4WCE L;  5AQS A;  1NGH A;  2D0P A;  2WC9 A;  3VEV A;  4R79 A;  2P9S A;  1JJ2 M;  4ISG A;  1NWK A;  3H46 O;  4FOI A;  3ZX3 A;  5AFU A;  5GIN A;  2GEL A;  2ZJP L;  2YHW A;  1K73 O;  2OTJ N;  5GAH P;  2DPN A;  4M63 C;  4BQZ A;  4OO1 J;  2ASP A;  4PKH A;  4KH4 A;  2AA4 A;  3Q7C A;  2NRR A;  5C15 A;  5BN8 A;  5JVG L;  1GLD G;  3P4I A;  1S22 A;  2I7N A;  1IJJ A;  4CZK A;  2JWL A;  4A2A A;  3C7N A;  1YF5 L;  3VEZ A;  1NM1 A;  3OW2 M;  1MWK A;  4GV6 A;  4K42 A;  3R1X A;  1KAZ A;  5C10 A;  3DXK B;  3IUC A;  5F2R A;  3CIP A;  3K9K A;  4KH6 A;  1BO5 O;  4BG8 A;  3EN9 A;  4IDH A;  4CBU A;  2FSK A;  2F7T A;  4NO7 A;  2NNW A;  5C0Y A;  1VQ6 N;  5AQF A;  2A40 A;  3G6E N;  2OTL N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...