1YAGA

Structure of the yeast actin-human gelsolin segment 1 complex
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
372
structure length
372
Chain Sequence
EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ACTIN)
publication title The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 116
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 1998-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1yagA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yagA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yagA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1yagA04
2ZGZA 2QXLA 2ZGYA 3VEXA 5AQHA 1QQMA 2WUSA 4EFHA 2CGKA 4FWLA 2DPNA 3QFUA 4NO7A 3FZLA 2P9UB 3LDOA 4H0XB 1HKGA 3WEEA 2FSJA 3DXKA 2QWMA 3LDQA 3D7EO 5AQIA 3MDQA 3CJAA 1NWKA 5AR0A 3GL1A 5AQUA 4DB3A 5JLHA 4B1XB 4JHDA 4BC4A 5AZIA 1NGJA 4BRDA 3WXIA 1ATRA 2AP1A 1BA0A 2Q97A 5BPNA 3IFRA 1JCEA 2IIRA 2QWLA 4BG8A 4BR5A 4PL8A 4JNEA 4H0TB 2J4RA 3ZX3A 5JMVA 5BPMA 1NGCA 3EKSA 4BC2A 2QM1A 4BR0A 3CIPA 2CGJA 4H5TA 4H0VB 1G99A 4AM7A 5FPNA 2NRHA 4IZ9A 3ZX2A 4RWTA 2I7NA 2UYTA 3FZFA 1NGAA 1V4TA 3SMPA 5EOYA 1BDGA 1XQSC 2P9NB 3C7NA 3O8MA 1JCGA 3UE5A 3W0LA 2HOEA 3VF6A 2IVPA 1C0GA 1RGIA 1NGGA 4L3QA 4CBUA 3QMLA 2E1ZA 3IUCA 4NB4A 2QW9A 2V7YA 2A41A 3EO3A 3VPZA 4DCHA 3CJCA 1GLCG 3G25A 4HWIA 3RSEA 4EAHD 5AQVA 2CH5A 3UKRA 2OANA 3FLCO 5AZJA 3VGLA 4BRGA 2VYPA 4KBOA 1V4SA 2HF4A 5AQRA 4CZFA 1JCFA 1NLVA 3GDQA 3GG4A 4BR9A 5AQLA 3B8AX 3HI0A 3DXKB 5EXWA 5AQPA 4XEIA 5EX5A 3H6EA 4AM6A 4MLHA 3KZBA 1LCUA 3WQTA 1EQYA 2EWSA 2I7PA 2QWPA 5AZIB 5JICA 3GOIA 3R9PA 2Q0RA 5AFUH 4BR7A 2V52B 4IXCA 5AQWA 4H5VA 5AQYA 1IJJA 3ATVA 4CI6A 1RFQA 2F9WA 5BN9A 5F1XA 4H5WA 2P9NA 1S22A 4BVPA 3WT0A 4BRCA 4IJAA 2ASMA 4CD3A 1X3NA 4BRNA 4XH5A 3VF2A 3SLCA 1U2VB 3U8XA 2A5XA 2H3GX 3O1WA 3TPQA 2ASPA 4CZLA 1NM1A 1X9JA 1NGEA 3MN9A 4PL7A 5JLFA 3H1QA 4CBWA 5AQFA 4BRHA 1MWMA 4JD2A 1QZ6A 3SMSA 4BGBA 3QICA 4FOIA 4BR2A 2A6AA 1ATNA 3EL2A 1R59O 4ISGA 3IMXA 3VGMA 4CZEA 1GLLO 2ITMA 4BRAA 3CERA 3MN5A 3MK6A 3AY9A 2Q36A 4FWKA 4CZMA 2P9IB 3VENA 3S41A 4BG9A 4A62A 4FSVA 2YJEA 3FGUA 2IVOA 5EVZA 3QB0A 2YHXA 3RSEB 3SK3A 3MCPA 3H1VX 4FPBA 3H3NO 4B1UB 3UKRB 5AZJB 1MA9B 1TYQB 4M63C 3L0QA 3MN7A 4GY2B 2D0OA 3QDKA 4MLEA 4BQZA 1XUPO 3L6QA 1DKGD 1HJOA 5AQTA 2QWQA 3ENOA 1YAGA 5TKYA 4B1WB 3HM8A 4H0OA 5BREA 2QWRA 4K43A 3VESA 4FWPA 2A42A 4O5FA 3IDHA 1ZBSA 2V51B 2E2NA 1U2VA 4JN4A 3ZX0A 3H45C 5E84A 4E1JA 4FOEA 4CBXA 3CI5A 2ZWHA 4B1ZA 4YDUC 4WQ4C 1WOQA 4MO4A 5AQNA 1CZAN 3U9ZA 4I6MB 5AQGA 2GTDA 4ISFA 1LOTB 3AAQA 2GELA 2Q0UA 5FPEA 1GLEG 3BUZB 4CZHA 3VGKA 4CD1A 1GLJO 3QBWA 2W41A 3UKUA 2P9IA 3LDLA 4JD2B 1KXPA 1ATSA 2NZTA 4CZIA 2P9PA 2ZF5O 4Y0WA 3FZMA 3JS6A 5AQXA 4EIAA 1HUXA 4FWOA 3U9DA 3J8AA 3FE1A 3D2EB 2VWBA 1TYQA 5LY3A 3I8BA 3AAPA 2YHYA 3H3OB 2YCHA 3O08A 4H5NA 1WUAA 5CE3A 1HX1A 1KAYA 1QQOA 1BO5O 1QHAA 2E2OA 5F0XA 4C23A 1NGIA 2FF3B 3M3ZA 4BRMA 3D2FB 3HBTA 1KAZA 3F9MA 1NBWA 1SZ2A 3A8YA 4GNIA 3WXJA 4BC5A 4LC9B 5E26A 1Z05A 3SJHA 2Q1NA 1NMDA 1D4XA 1YXQA 2D0PA 5ELZA 2QWOA 4BRQA 1NGBA 4I6MA 4BREA 3A5OC 2AA4A 2A3ZA 4QS8A 4H03B 3MMVA 1HKBA 3CQXA 5BRDA 2HF3A 4F9OA 3CJ1A 4K41A 3WXLA 4XH1A 3CHWA 5AQZA 4WQ5C 1K8KA 1MWKA 3KVGA 1HKCA 1SQKA 3LDPA 3ID8A 1QQNA 2F9TA 3A5NC 1E4FT 2P9LA 3HTVA 3VEWA 3DWLA 5I9EB 3D2EA 1OKJA 2W40A 2FSKA 3ZEUA 3W3DA 1T6DA 5AQJA 4RCHA 5ADXH 2BTFA 2CH6A 5AQOA 1P8ZA 1GLDG 3O5BA 3UKUB 1T6CA 4FWRA 2Q31A 3WQUA 2E1YA 4XH4A 4H0YB 3VERA 3U4LA 5KQDA 2P9PB 2E2PA 4PKIA 2YHWA 3D2FA 3FZHA 4EHTA 3FFKB 1XC3A 1IG8A 4EHUA 3DJCA 2P9KB 3M6GA 2PAVA 1S3XA 2FF6A 1GLBG 3UB5A 3H46O 5KPRA 4BRFA 1QZ5A 1RDWX 5FPMA 4QS7A 3R8EA 3VF4A 4O8KA 4K25A 4FL9A 4IJNA 2GWJA 3O1BA 1E4GT 3VETA 4PKGA 3DAWA 1BG3A 3A5LC 2E8AA 5KPZA 1U6ZA 1MDUB 3CETA 4B9QA 3GE1A 2PBDA 1Z6RA 3CJBA 3BF1A 5BPLA 2FLOA 2KHOA 4M7YA 5LJWA 5BN8A 4BQLA 3JXUA 4QS9A 1NGFA 3VOVA 3ZETA 4B1YB 3HSCA 2P9SB 1ESVA 1YVNA 5B8HA 2VCPA 3EN9A 4MO5A 4BRIA 4CZGA 1DGKN 2V7ZA 3I33A 1Y64A 2CGLA 2QWNA 1HPMA 4BRLA 1NGHA 2A40A 3EZWA 2FSNA 1TUUA 3BF3A 3DXMB 5BRHA 3VEZA 4YDUA 2FXUA 4WQ4A 3ULEB 5AQKA 5AQSA 4A61A 3O4WA 3CQYA 4BC3A 1K8KB 3LM2A 4FWNA 4Z94A 5AQQA 3P4IA 3A0IX 1T44A 2P9LB 3R6MA 3TU5A 2D1KA 2P9KA 3KHYA 3QFPA 1ZC6A 2HMPA 4ISEA 4IWVA 3ZEUB 3BP8A 4BGAA 2D4WA 5BR9A 1DEJA 2E20A 3CJ9A 4FWSA 4BR4A 2GWKA 5AQMA 2ASOA 2BUPA 1BUPA 2E88A 2P9UA 5KPTA 2GUPA 1HLUA 4CZJA 5FPDA 1GLFO 4BRPA 2YJFA 2E2QA 3A5MC 4FPAA 3WXKA 3GBTA 4DQ8A 4HTLA 1ZXOA 4FWMA 5AFUA 3CJ7A 4BRKA 4CJ7A 4A2AA 2P9SA 4IO8A 4PKHA 1BU6O 4K42A 5F2RA 1J6ZA 3WEEB 1BWFO 3ENHA 4BROA 3LDNA 3QBXA 3OHRA 3BEXA 4JAXA 4J8FA 3O80A 4A2BA 3DXMA 3MN6A 1BOTO 3ULEA 1GLAG 3ZETB 3HZ6A 4JHDB 3M1FA 1YUWA 1C0FA 1SAZA 2IVNA 3O6WA 1BA1A 3FR0A 3FZKA 4DHYA 4FO0A 1NGDA 4CZKA 5BRFA 3C0BA 1TUYA 2YI1A 4BVOA 4WQ5A 5KQ8A 5LJVA 3WUHA 5ADXA 4H0PA 4WYBA 1KAXA 3L4IA 4H5RA 1H1VA 3ATUA 3EKUA 3LL3A 3VEYA 3LM9A 2NLXA 2GEMA 4B1VA 2Q2RA 5EY4A 4FWQA 4M7XA 4RTFD 3C7NB 3VEVA 3VEOA 1X3MA 1Q18A 3AARA
chains in the Genus database with same CATH superfamily
2QXLA 3UIQA 2ZGYA 3VEXA 1KFDA 3CCEN 4ZTJA 3CCJN 3DRPA 3F2KA 1CLQA 3ZSQA 2UXDK 3WEEA 4E7IA 3LDQA 3LP2A 5AQIA 3HXMA 3U3YA 4YORA 3GL1A 4CGDA 2OYQA 3AVCA 3THWA 5AZIA 1BA0A 2WC9A 3PSFA 2G8VA 1VQ7N 3OYMA 4DQIA 3T69A 4PL8A 4B8CA 2J4RA 3SQ0A 4N76A 1NGCA 3VQ7A 4BC2A 4BR0A 3B6PA 4H5TA 4IKFA 1YITN 4I2QA 1G99A 2B4JA 1VSHA 3HPOA 1W0HA 1NGAA 1NK7A 3SMPA 1BDGA 3NH1A 3ZCMA 1NKCA 4YOUA 1RT7A 1JCGA 3UE5A 3AVGA 2IVPA 1RGIA 1NGGA 3QMLA 2QW9A 2V7YA 3SAHA 3EO3A 3VPZA 3SPYA 2F8TA 3AVIA 3NF7A 3O3FA 4E3SA 1KD1O 4O0JA 3I0RA 4EAHD 5AQVA 4FYDA 2CH5A 1HYZA 1S1WA 5AZJA 4F2SA 3VQ8A 4C1NK 1J5OA 4CE9A 3VQAA 2VWKA 3HPGA 4HCBA 1JCFA 1UOCA 2ZD1A 5AQLA 3B8AX 2O8CB 5EXWA 1L5UA 4XEIA 5EX5A 3VQBA 4MLHA 3WQTA 1EQYA 3RMAA 1HJRA 5CR4A 2QWPA 3GOIA 3R9PA 2V52B 1VQ4N 3HVTA 5AQWA 3L8BA 2HBMA 2F9WA 2P5GA 4H5WA 4CVNE 4BVPA 4J2BA 4PA1A 4IJAA 2ASMA 2Y1IA 4XJXA 3SLCA 1U2VB 1VSDA 4IFYA 5DM7L 4DQPA 1GOAA 3O1WA 1NGEA 4PL7A 1ASUA 2Z1GA 1E3MA 1SUQA 3EY1A 3SMSA 2C1IA 1EWRA 1HNIA 4YHHK 3EL2A 2WFBA 4EP5A 1TK8A 3CCRN 3MXIA 5FLXO 3I8DA 2ITMA 3MN5A 1W97L 4R5PA 2P9IB 2HHHK 4RG8A 4BG9A 2VWJA 2O8CA 4DFPA 3S3MA 3QB0A 3RSEB 4FJ9A 3H1VX 4B1UB 3UKRB 1N34K 4GVMA 5M1OA 1I94K 5LMUK 2Z1HA 1J9AA 4BQZA 5FRNA 3L2VA 3ALYA 3NF8A 1HJOA 3R3LA 1VSIA 4BY9C 2PYJA 4I9QA 4B1WB 1RBRA 3TSQA 3ZT2A 3NE6A 1W9HA 5BREA 2QWRA 4I9LA 2A42A 4O5FA 1C1CA 3IDHA 2UUCK 2V51B 1U2VA 1JXBA 4DTSA 2ZWHA 1BCOA 2IS3A 2WONA 1QVGM 4I2PA 1ILYA 4DTUA 3U9ZA 3G4SN 4O4GA 3TANA 1LOTB 3ZSYA 2Q0UA 5FPEA 3LALA 3NVMA 4CZHA 4E1MA 3O3HA 4CD1A 1GLJO 4CCHA 2UU9K 2KZMA 3OBWA 4CEZA 3QBWA 2W41A 2P9IA 4JD2B 1ATSA 1SKSA 4KHQA 1Q9XA 1XHXA 2QKBA 1EO1A 3V9WA 3AA4A 1VQ9N 4DR5K 4EIAA 5LY3A 3KWIA 2YHBA 4H5NA 1HX1A 4CFAA 4BRMA 3OTOK 3D2FB 1SKRA 2YKNA 4CF0A 5HOOA 4IG0A 1WB9A 4FJ5A 4C8MA 4MDBA 3LPTA 2D0BA 1X1PA 1A5WA 3P5JA 1NK0A 1B9DA 1BI4A 4CHQA 3A8YA 3U3GA 4CJLA 4LC9B 4OLBA 3OJUA 5A2QO 4GKKK 2QWOA 5M1QA 4FK2A 2D5RA 1NGBA 4H4OA 5GAEP 3AVHA 2A3ZA 3TWHA 3V9XA 2RHKA 4KV8A 5BRDA 3E1YA 3CJ1A 3JYTA 4K41A 1SL2A 4Z4HA 4JKGA 3NGIA 3TABA 1NOZA 2P5OA 2NRXA 5AQZA 1K8KA 3MEEA 3T1HK 5SZTA 1SQKA 4CJEA 2P1JA 2F9TA 3A5NC 4E72A 1N36K 3J7AP 1GOBA 4O44A 2VGMA 2F7TA 4JK8A 5I9EB 2W40A 3QNOA 1TVRA 3L3VA 4X64K 5C24A 3DYAA 3UKUB 4DSEA 4FWRA 4OJRA 4CFCA 4DUZK 3QEWA 4KHSA 4XH4A 5GIPA 2P9PB 5M1FA 3D2FA 2RKIA 1RT1A 3FFKB 3HK2A 4FM2A 3TTDA 2IC3A 4BRFA 5KPRA 5FPMA 4QS7A 4O8KA 2O8FA 3VQEA 1E4GT 5KI6A 3K5OA 2QTDA 2OCEA 2HW3A 4BE2A 3BGRA 3A5LC 1I3AA 4IBNA 3CC7N 1MDUB 3CETA 4M41A 2UUAK 1WSFA 4ILJA 5DM6L 3BF1A 5BPLA 1S5JA 4DQRA 1EP4A 4M7YA 3ZSWA 4GVEA 4OLAA 2O4IA 4Z4EA 1NGFA 4B1YB 3OS0A 3HSCA 2P9SB 1ESVA 1TKXA 1YVNA 3THYA 4KH4A 1CXQA 4BRIA 4CJQA 3I33A 1JLAA 2CGLA 4N47A 3LP0A 2JWLA 2QEXN 2A40A 1YHQN 1N6QA 3PSIA 3C95A 5BRHA 3TAGA 3KD5E 3AO3A 2X74A 5AQKA 3WNFA 2GUIA 4FZZA 4DR4K 4BACA 1S6QA 3ZSZA 1HMVA 3CQYA 4FJ8A 4FWNA 3K58A 3P1GA 2HB5A 3SCXA 4PQUA 3P4IA 1NK6A 2XO7A 3OBYA 2OTJN 1RBVA 3QFPA 4CHPA 4FLYA 4CGGA 1VQON 2YKMA 4KI4A 1KTQA 4OKEA 1DEJA 3CJ9A 1D8YA 4JI6K 2GWKA 3QIOA 5AQMA 1OVQA 4KHYA 3DI6A 1EXQA 3VTHA 3RRHA 1LV5A 2P9UA 1HR0K 1YJNN 1LWFA 2YJFA 1X9MA 1LW0A 4DQ8A 4KB1A 4DSLA 4CJVA 1B92A 2P9SA 1BCMA 4PKHA 5CZ1A 5MLCQ 4BE1A 1ASWA 4K42A 3TAFA 4F8RA 4DTJA 3ENHA 3KKSA 4B9TA 4Q0BA 4BROA 3LDNA 3BEXA 3M8RA 4M3WA 4A2BA 3SBTA 4WE1A 1JL1A 4JHDB 1C0FA 4L8RB 3O6WA 4DS5A 4FVUA 1C0TA 1XNQK 4JK7A 3RRGA 4B3MK 4CZKA 1WNSA 3SYZA 3ASMA 4BVOA 5KQ8A 4WQ5A 4GW6A 5FRMA 3WUHA 1M90O 3L4IA 4B9VA 3CC4N 4FZYA 4FLZA 4JS4A 1X9SA 4B9NA 4B3OA 4OO1J 3K0SA 4M7XA 4RTFD 3AO4A 3C7NB 1Q81O 3IKMA 2VG6A 3CM6A 2ZGZA 4WFAL 4K0KK 2ZQBA 2C1GA 4QAGA 1WBBA 2WUSA 4OKKA 2A1RA 4KTQA 1VK0A 3C94A 3CYGA 2CGKA 4FM1A 3VA0A 3BY5A 1S6PA 4H0XB 4DFKA 4DR2K 5CZ2A 2KFZA 2FBVA 4CW7B 3K5MA 3THVA 1VHXA 3SQ1A 2OZSA 1NWKA 1QTMA 3AO1A 4DB3A 4Z4CA 5JLHA 4B1XB 3TAMA 4JHDA 1X9WA 3FFIA 3WXIA 1ATRA 5BPNA 1W2BM 2DTUA 2IIRA 4BG8A 4DF4A 4BR5A 1K9MO 3D45A 1QSLA 2NNWA 2E5LK 4DTOA 4LFBK 4GV9A 4LF6K 1FKPA 5BPMA 1TKDA 4M3YA 4C8NA 2WBNA 1VRTA 3AO2A 4C8LA 4LFAK 3E9OA 3CIPA 5H1SQ 2KW4A 2HHXA 4DQQA 4FJKA 4AM7A 2Z1IA 3K9JA 4OGEA 3LAKA 4H4MA 3VN5A 2UYTA 1MU2A 3FZFA 3QERA 4YOYA 1YIJN 2P9NB 3C7NA 2XY5A 2NRZA 3TAPA 1WAFA 3VF6A 3AV9A 4CBUA 2ETJA 4KTZA 3OYJA 2E1ZA 3IUCA 3LWLA 3AVFA 3NAEA 2A41A 3HYFA 1RDBA 4IFEA 3KLFA 3K59A 4DCHA 3OYIA 4DG1A 3CJCA 1XC9A 2OANA 3VGLA 2DY4A 2VYPA 1K8AO 4JRQA 1DT9A 5AQRA 4CF9A 1NLVA 3GDQA 2QKKA 5C15A 4JLHA 1YF5L 4NYFA 2XRIA 4CJ5A 1Q82O 4IO9L 1GOCA 3OYHA 4DKWA 2I7PA 3T3FA 5AZIB 5JICA 2Q0RA 5M1NA 4YY3K 3NVKA 3AA3A 4IXCA 1IJJA 3SQ4A 4CI6A 1RFQA 4DR1K 2P9NA 3ZSOA 3MXJA 4CD3A 4BRNA 5HRRA 4CEDA 4BE7B 2BGGA 2G8IA 2OZMA 3OYBA 4OX9K 1D5AA 1RDCA 4CJ3A 4E7JA 3SUPA 1IO2A 4ISGA 4ZHRA 4CJFA 3VGMA 4CZEA 4ELVA 4LFCK 2HSTA 2HNZA 3CERA 1S1TA 3WNGA 4CZMA 3S41A 4KREA 3AGKA 4A62A 3QINA 2ZM6K 2IDOA 4JKBA 4AHTA 2YJEA 4KB0A 1WSJA 4CJSA 1QS4A 3DLEA 1WLJA 5AZJB 5TKWA 4M63C 3PX0A 3PIPL 3QDKA 4CEBA 1YTUA 1RTHA 1HNWK 5AQTA 3ENOA 4CEEA 5TKYA 1XNRK 3AA2A 4IFVA 3TSUA 4H0OA 3VESA 4NCAA 4FWPA 2VGNA 4EZ6A 1KRPA 2KTQA 3QNNA 4EP4A 2E2NA 2OPQA 1KCFA 4JN4A 3HVRA 4A57A 3H45C 4E1JA 3L3UA 3CI5A 4CBXA 5IT9O 3Q7BA 3OYLA 3MAQA 3LANA 4MO4A 4WQ4C 4E7KA 1YT3A 1DTQA 4E19A 4I6MB 1VQPN 5AQGA 1NKBA 3F5TA 3DRRA 3VQQA 3WNEA 1HNVA 4B9SA 5J2NA 3LDSA 4AF1A 5C25A 1JLCA 4CGJA 3VQCA 4FXDA 1CZ9A 1KXPA 2NZTA 4CIFA 4H8KA 4AHCA 4FVMA 3V9ZA 4Y0WA 3FZMA 3JS6A 4OKJA 4FWOA 3D2EB 2VWBA 4CGIA 1VSMA 3H3OB 4DTPA 5CE3A 4IG3A 3KK1A 4DMNA 1QHAA 2RF2A 1JLBA 1NKEA 2FF3B 4DSJA 4J2AA 3HBTA 3J80O 3KK3A 1YVUA 1TK0A 1LAWA 3KWGA 3L2QA 4W5QA 3OA9A 5E26A 3BZCA 1D4XA 3C6AA 1Q7YO 5C2FA 4BRQA 4JS5A 4I6MA 4BREA 2OPSA 3A5OC 4H03B 5DK5A 4XH1A 3KK7A 3AO5A 1MWKA 4DV7K 1HKCA 3ID8A 4QOZB 3HP9A 1U48A 3F73A 2RN2A 2P9LA 3KTQA 3VEWA 3D2EA 2ZE2A 3AA5X 1HYSA 4RCHA 5ADXH 2BTFA 3PO5A 1NU0A 1S1VA 5AQOA 3NCIA 3M5RA 4GMJB 1T6CA 3IG1A 1EKEA 4H0YB 3U4LA 3VERA 3VQDA 4MDAA 4C1NI 4FJJA 4CF2A 4EHTA 5KGWA 1XC3A 2P9KB 1KQSM 1LAVA 1NJZA 4JI7K 3SV4A 4K25A 3S5TA 2YNIA 3O1BA 1LW2A 4PKGA 4YOWA 4FJXA 1EX4A 4HUGA 1OH5A 3S9HA 4M3RA 4LH5A 2E8AA 5KPZA 1U6ZA 1XHZA 2PBDA 4RW7A 1Z6RA 3CJBA 1T05A 3HT3A 3RMCA 1M1KO 4KTWA 3RR8A 1K73O 3DLBA 1RT2A 1BI4B 1D9DA 4F4KA 4CERA 3JXUA 5CHIA 3V81A 3J7YP 4QS9A 5JS1A 1DTTA 1IKXA 4HUFA 1OH7A 2VCPA 4KI6A 4PWDA 1Y64A 3U6FA 4B8AB 2KQ2A 4BRLA 1NGHA 4E0DA 3EZWA 3C6HA 1NOYA 3CCQN 5C2DA 3VEZA 4YDUA 3IAYA 3CPEA 4BECA 4IOCL 2GBZA 4A61A 4JYAK 4JKGB 1NK9A 1S9GA 3PY8A 4O8UA 1K8KB 3LM2A 4YOTA 5GAHP 3OJSA 4X62K 5AQQA 2AJQA 4KHPK 3THXB 2E4LA 4KHUA 2P9KA 3KHYA 3L2UA 3G10A 2D4WA 4LF8K 2DFFA 1QSYA 4E89A 2HHQA 4CJKA 3C65A 3TTCA 4GKJK 3KJVA 2X6NA 2G8WA 1BUPA 3G0ZA 4FCYA 3PO4A 1Z26A 4JKAA 1RDUA 2W6KA 1HLUA 4CZJA 4CHOA 4CHYA 3LWMA 3A5MC 3EYZA 2O8FB 2R7YA 1TK5A 4AH9A 4LSLA 4M3ZA 3KIOA 4BRKA 5E41A 4A2AA 2HVHA 5F2RA 5JVHL 3EE8A 3QBXA 4KHWA 4JAXA 4B9MA 4J8FA 4V19S 4CEAA 3LZJA 4AHVA 3HOSA 3HSTB 3HZ6A 3M1FA 3KD1E 3THYB 1SAZA 1WSEA 1C1AA 1LWCA 3SZ2A 3SPZA 1BA1A 3FR0A 5C10A 3THXA 4IOAL 4IEIA 4O5BA 3ZT4A 4FO0A 2O4GA 1ZBHA 3OYFA 3C0BA 1TUYA 5KRSA 2QXFA 5ADXA 4H0PA 2WTUA 4WYBA 1SKWA 1QHTA 1H1VA 3CF5L 3EKUA 2NLXA 3P39A 2B5JA 5EY4A 4FWQA 4KRFA 1VQ8N 4KH6A 3VQPA 4FM0A 1SL1A 3VEOA 1RT3A 1UWBA 2W6LA 1RDDA 3AARA 3AVKA 3EZ5A 4ZTFA 1C6VA 1Y97A 1QQMA 4IEEA 4BE0A 3CYMA 4DTMA 2WOMA 4FWLA 2DPNA 3QFUA 4B3RK 3KLEA 2P9UB 3V1RA 4BDPA 1HKGA 3DXKA 3CG7A 1C0UA 3G71N 3LP3A 3SV3A 4DFMA 5AQUA 1NK8A 4DLEA 1OVYA 3NF9A 1NGJA 1L3TA 2Q97A 4M3UA 1JCEA 2QWLA 3TARA 3AVAA 4M42A 3NGZA 2ZJPL 3MX2A 2QM1A 4CHNA 3CMEN 2FBYA 4IZ9A 3ID6A 4RWTA 3HOTA 4Q5VA 3CCLN 3KLGA 2I7NA 3D6RA 3E9PA 1V4TA 1KVAA 5EOYA 3O8MA 1JLFA 3W0LA 4YNQA 3AVNA 1VQKN 1C0GA 4FJNA 2BANA 4B9LA 2NRWA 5C42A 4J2DA 2VQFK 4CJTA 1UA1A 3T19A 4CK3A 1WSHA 2I5JA 5HRPA 1Q86O 2HMIA 3DLGA 1VAZA 3DOLA 4BRGA 3OW2M 4DS4A 1FXXA 1WBDA 1OH6A 2HF4A 2XY7A 4DR6K 4CZFA 4RW4A 3GG4A 3CCSN 3CFRA 1IKYA 3H6EA 4AM6A 3PX6A 4OPHA 5GIOA 4FK4A 4IDKA 5GINA 2EWSA 2NRVA 1YJWN 3CFOA 5IWAK 3E01A 5AFUH 4BR7A 1XMQK 4JEPA 4FJ7A 1N33K 4H5VA 1UA0A 3V4IA 3ATVA 1XI1A 5F1XA 3L2RA 1S22A 3ISNC 5EU7A 3WT0A 4CJWA 2NUBA 1S9EA 1X3NA 1VRUA 4BEBA 2A5XA 4CZLA 1NM1A 3ZT3A 3SQ2A 5KTQA 1XMOK 5JLFA 3H1QA 3V1QA 3EE9A 5AQFA 4BRHA 1QZ6A 1IBMK 3QICA 2QI2A 4FLWA 5JENA 3NBPA 3K5LA 5GAGP 4C8OA 4R79A 1R59O 3E9LA 1ZBUA 3CPWM 4CF8A 1GLLO 4BRAA 3MK6A 3VENA 3OVNA 4FSVA 2IVOA 5EVZA 2YHXA 3SK3A 3MCPA 3H3NO 1TYQB 2PZSA 4F2RA 3OS1A 3MN7A 2O8DB 3L6QA 3KK2A 3G6EN 3SNNA 3QEXA 1YAGA 3HM8A 4K43A 1ITGA 1Q8IA 4DU1A 1NJYA 1T3VA 1C1BA 2IAJA 1BHLA 3P38A 5FROA 3LP1A 5E84A 4FOEA 2BDPA 3HPHA 4B1ZA 4CESA 3O9RA 3NHGA 2HHVA 4DUYK 1CZAN 3DLRA 3PV8A 3O9TA 4DTNA 1TV6A 1IBLK 4ISFA 1F21A 4YFUA 5J2QA 3AAQA 2GELA 2JWKA 4FW1A 1W7AA 1RT6A 1A5XA 3LDLA 4KKOA 1QVFM 3ZSVA 3QETA 2FBTA 2NRTA 1R0AA 1BL3A 4DFJA 1TYQA 1U47A 3M8QA 2YHYA 1HNXK 2O8DA 4DF8A 2YCHA 3VQ5A 1WUAA 1HPZA 2HNDA 1QQOA 3OYNA 3VMFB 4C23A 1IKVA 3M3ZA 4NCBA 2E6LA 2O8EA 4K8XA 3F9MA 4A5BA 1HYVA 4NLCA 1L3SA 4PY5A 4KPYA 3MXMA 1N8RO 1TAQA 3MEGA 4JK9A 3WXJA 4CJ4A 4BC5A 2Y1JA 1Z05A 2Q1NA 4JI0K 3V9SA 2D0PA 1KSPA 3TTFA 3QEIA 3M8SA 1EETA 4IDHA 5HLFA 2AA4A 2YNHA 4WFBL 4PUOA 3MMVA 1HKBA 3DRSA 1NG9A 3CQXA 4JKHA 3S3NA 2KZZA 2HF3A 4F9OA 5I3UA 3CMAN 5AJ3K 4YOVA 5J1EA 4WQ5C 3HL8A 1QQNA 4OVLA 1E4FT 4Z0UA 1BISA 4HTUA 3DWLA 5C12A 1OKJA 2FSKA 3ZEUA 2XHBA 1T6DA 5LMNK 4JV5K 5AQJA 1NJWA 2CH6A 3QESA 2G8FA 5HRNA 2ZJQL 2Q31A 4JI5K 3WQUA 2E1YA 2E2PA 4PKIA 2YHWA 3FZHA 4FJLA 2YNGA 1YI2N 1IG8A 1NJIO 4EHUA 3DJCA 3M6GA 1BGXT 3UB5A 3RTVA 1QZ5A 1RDWX 2F96A 4CECA 3C6UA 4RW9A 3MCAB 3O9UA 3LAMA 3O3GA 1S1UA 3DAWA 1UAXA 1BG3A 1U4BA 3BZKA 4KO0A 3RR7A 3J7ZO 5CYMA 3K57A 2PY5A 3CQ8A 3RWUA 4JKCA 2HNYA 2A1SA 4FLTA 1N5YA 5D3GA 1DLOA 5LJWA 3WXMB 4FLVA 4M45A 3ZETA 4BDYA 3TR8A 1WAJA 2OPRA 1TL3A 4JI2K 1HRHA 4MO5A 2HBJA 4CZGA 1BIZA 1DGKN 3ZLJA 3JSMA 1HPMA 1RTIA 1VSLA 2BE2A 4WCEL 1VSKA 4N5SA 3V6DA 3DXMB 3ULEB 1RTJA 1K6YA 4DU4A 1O13A 2FC0A 4BC3A 4LSNA 3SUOA 4ID1A 4W5OA 2HHWA 1VQ5N 3A0IX 2P9LB 3R6MA 3HO1A 1HQUA 1ZC6A 4ISEA 3BP8A 4OGCA 4XIUA 3SAFA 4BR4A 2W42A 3C6TA 3K5NA 5HL7L 3MWPA 5KPTA 3SAGA 2GUPA 2GX9A 3O4NA 4GV6A 1GLFO 1KC8O 4Z4GA 4BRPA 4FLXA 3NFAA 4LH4A 3WXKA 4G9ZA 4HTLA 3IS9A 4LF9K 1ZYQA 1QSSA 3SBGA 1HQEA 3P83D 4HHTA 4DTXA 3OYGA 1BU6O 1VQLN 4GV3A 2D0CA 3RMDA 4F3TA 1N32K 1BWFO 3T1AA 4KH5A 1JLEA 3O80A 3DXMA 3WNHA 1BOTO 2HBLA 3VQ4A 3ULEA 1C0MA 2UUBK 1EWQA 4DSKA 5JVGL 2IVNA 4E7HA 3FZKA 3I0SA 4NXMK 4AHRA 1NJXA 4DHYA 3S3OA 3Q7CA 5CYQA 1KLMA 1OH8A 4DV6K 2HHTA 4FJHA 4JI1K 3TSPA 1KAXA 4H5RA 4NXNK 2KKZA 3DMJA 3ATUA 3DLKA 3LM9A 2E6MA 1T8EA 2GEMA 1ZBIA 2HHIA 4CFBA 5C0YA 2Z1JA 1REVA 4CIGA 3OYKA 2O8BB 1RDAA 4JRPA 2IOCA 3QIPA 1Q18A 4AQYK 4JI8K 3L2WA 5AQHA 4E7LA 1J54A 1RNHA 1VSFA 4EFHA 4M3XA 4NO7A 3FZLA 3LDOA 4O0IA 3SUQA 3OYEA 2FSJA 2QWMA 2PYLA 1TKZA 4LF4K 3I55N 3D7EO 4ILHA 3MDQA 2HHSA 4CK2A 3CJAA 4DWIA 5AR0A 3L4QA 2UXBK 3K2PA 4BC4A 4BRDA 4JKFA 2AP1A 3CCVN 3IFRA 5DMRA 4JNEA 4H0TB 3ZX3A 5JMVA 3CCUN 3EKSA 2CGJA 4ELTA 3SI6A 4H0VB 1CXUA 5FPNA 2NRHA 3ZX2A 4ILGB 4C8KA 5CY4A 4ICLA 3H08A 3MECA 2VQEK 4BWJA 1XQSC 2O8BA 3NF6A 2X6SA 4RW8A 2HOEA 5I42A 2HVIA 4L3QA 3OY9A 2G8HA 4UY8O 3CCMN 3DLHA 4ELUA 4NB4A 3E66A 1VSJA 2YX6A 4Y1CA 1ZBLA 4DV2K 4KAZA 2D0AA 2EHGA 2DFEA 3TI0A 2HHUA 1RILA 1GLCG 1JXEA 3G25A 4HWIA 4I7FA 3RSEA 4FJIA 3UKRA 3FLCO 3P31A 4WF9L 3NH2A 1I39A 4KBOA 4B9UA 1V4SA 4WFNL 3ZSXA 4BR9A 3HI0A 3DXKB 4CGHA 1L3UA 5AQPA 3KZBA 1LCUA 4BDZA 3EEQA 4CEQA 2YNFA 2EX3A 3DM2A 3KLIA 3CXCM 2ATQA 1RT4A 5AQYA 4CJRA 3O9SA 3ULDA 5BN9A 1S1XA 3KLHA 2KLAA 5LL6Z 4BRCA 3PLAA 3PUFA 3QEVA 4XH5A 3VF2A 5M1KA 1WN7A 3U8XA 2H3GX 3TPQA 4AILC 2ASPA 1X9JA 3MN9A 1KVBA 4CBWA 1SV5A 1MWMA 4KHNA 4JD2A 3HRGA 4BGBA 1WSIA 3NH0A 2XY8A 1Q9YA 4FOIA 4BR2A 1IH7A 2A6AA 1ATNA 2VG7A 1RBSA 1B9FA 2ZJRL 2BH1A 4J2EA 4FJMA 3IMXA 1S72N 2F4VK 2P51A 3T1YK 3AY9A 2Q36A 5KRTA 4RW6A 4FWKA 1JLGA 1YJ9N 2UXCK 3FGUA 1QE1A 3ZSRA 4K8ZA 4FPBA 1MA9B 2FBXA 1RT5A 4TSXA 3QLHA 3L0QA 4OPAA 4CIEA 4GY2B 1G15A 3JAMO 2D0OA 4MLEA 4DV0K 2YHAA 1XUPO 2X78A 1BQNA 4DR7K 1DKGD 2NRRA 4KFBA 1L3VA 2QWQA 4CF1A 2LSNA 1XWLA 5KGXA 2F8SA 5BR8K 2QA4N 3KKRA 2B6AA 1BIUA 1ZBSA 3V9UA 1TGOA 1O1WA 1JL2A 3K9KA 4LF5K 3ZX0A 4A59A 4DV5K 3ZYYX 1JJ2M 2G8UA 2W00A 4YDUC 3F9KA 1WOQA 4FW2A 5AQNA 4Z4IA 3OS2A 3IRXA 1IV0A 2GTDA 3PIOL 1Z25A 1FW6A 1GLEG 3BUZB 4CJPA 3VGKA 3QEPA 3ZT1A 4B3TK 2QK9A 1JLQA 2GV9A 3UKUA 3CC2N 4CZIA 1FKOA 3QO9A 2P9PA 5SWMA 4LD0A 3VQ9A 3ZT0A 4M3TA 2ZF5O 4G1QA 5AQXA 4F3OA 1HUXA 3U9DA 3J8AA 3FE1A 3LZIA 4DR3K 3I8BA 4DV1K 4DTRA 3AAPA 1VQNN 1ASVA 3O08A 3V1OA 2JGUA 1KAYA 1KFSA 1BO5O 2E2OA 4MQ3A 4JKDA 5F0XA 4NYNA 5HRSA 4AHUA 1NGIA 1RTDA 1KAZA 2JLEA 1NK5A 3DLLL 3SJJA 1NBWA 1SZ2A 3AVLA 4E1NA 4GNIA 4N41A 1VSEA 3SJHA 1NMDA 4CJUA 1YXQA 4O55A 5ELZA 2PFUA 3A2FA 1VQ6N 4HVJA 4QS8A 3MX5A 2Q3SA 1J5EK 2KFNA 2OPPA 4HUEA 4OPKA 3DOKA 3WXLA 1TL1A 3CHWA 3KVGA 4U67L 3LDPA 3VQ6A 1RBUA 3SUNA 3HTVA 3AVBA 1VQMN 5K14A 3W3DA 3HP6A 1WSGA 1NMNA 4YOXA 2G8KA 4LF7K 4X66K 1J53A 1P8ZA 1GLDG 3O5BA 4NCGA 5T7BA 3NDKA 1U49A 2ITGA 4CHZA 4CEOA 5KQDA 4UQGA 2PAVA 1S3XA 3CFPA 4B08A 2FF6A 1GLBG 3H46O 4DU3A 3NMUA 3R8EA 3VF4A 3I56N 4IJNA 1CZBA 4FL9A 2GWJA 1TAUA 3VETA 2VG5A 2RE2A 1D9FA 3O4QA 1U04A 4B9QA 2O8EB 3GE1A 1BQMA 1IBKK 2FLOA 3R1XA 2KHOA 3O9QA 4BWMA 5GADP 1KLNA 4HCCA 5BN8A 4OPJA 4BQLA 3VOVA 3MEDA 2DFHA 3N4QA 1TKTA 4DLGA 3AVMA 5B8HA 3EN9A 3B6OA 4DV4K 2V7ZA 2YV0X 4DSFA 2QWNA 4FZXC 5FDLA 3VTIA 2FSNA 1TUUA 4W5TA 1YTAA 1IG9A 3BF3A 3RMBA 5JS2A 3NGYA 3OYAA 2FXUA 4JKEA 4WQ4A 4IOXA 5J2MA 4W5RA 5AQSA 3O4WA 4Z4FA 3MWTA 1SL0A 3BDPA 4Z94A 4NLBA 3AGRA 1T44A 1IKWA 3TU5A 2D1KA 1NK4A 4JI3K 2HMPA 4DSIA 4IWVA 3ZEUB 4FK0A 5BR9A 4BGAA 3RVCA 4DV3K 2E20A 4FWSA 4FLUA 1T7PA 3OYCA 2OTLN 2ASOA 2BUPA 3HJFA 4PHTX 4W5NA 1NNEA 2E88A 5HP1A 3CD6N 5FPDA 2E2QA 4FPAA 3GBTA 1ZXOA 5HBMA 4FJGA 4FWMA 5AFUA 4B3SK 3CJ7A 3TAEA 2OA8A 4CJ7A 4IO8A 1U45A 3N4PA 1RBTA 5M1PA 1LWEA 1A5VA 2RPIA 3ITHA 3LPUA 3T7ZA 1J6ZA 3WEEB 4U7BA 3VA3A 4ID5A 2IGIA 3OHRA 1RCHA 1HNZK 3AVJA 3MN6A 2XY6A 4N56A 1GLAG 1FK9A 4AHSA 3ZETB 3THWB 1YUWA 2HBKA 1QQCA 3M8PA 3D0PA 4Y1DA 1NGDA 4CGFA 3CM5A 3PX4A 3J81O 1JKHA 5BRFA 4CFDA 5HROA 2YI1A 5LJVA 1P90A 1KVCA 3ENBA 4DQSA 5J2PA 3OYDA 3LL3A 3VEYA 4X65K 4MFBA 4JI4K 4B1VA 2Q2RA 1SS6A 4CK1A 1FJGK 3TAQA 3VEVA 1T03A 4EZ9A 1ZBFA 4QCLA 1X3MA 4A5AA 3HM9A 4LY7A 4CEFA
chains in the Genus database with same CATH topology
2ZGZA 2QXLA 4WFAL 2ZGYA 3VEXA 3CCEN 2C1GA 5AQHA 1QQMA 4IEEA 2WUSA 4EFHA 2CGKA 4FWLA 2DPNA 3QFUA 4NO7A 3CCJN 3F2KA 3FZLA 2P9UB 3LDOA 4H0XB 1HKGA 3WEEA 2FSJA 3DXKA 2QWMA 3LDQA 3I55N 3D7EO 4ILHA 5AQIA 3MDQA 3CJAA 3G71N 1NWKA 4YORA 5AR0A 3L4QA 3GL1A 5AQUA 4DB3A 5JLHA 4B1XB 1OVYA 4JHDA 4BC4A 5AZIA 1NGJA 4BRDA 3WXIA 1ATRA 4JKFA 2AP1A 1BA0A 2Q97A 5BPNA 2WC9A 3IFRA 1JCEA 2IIRA 2QWLA 4BG8A 3CCVN 1W2BM 1VQ7N 3T69A 4BR5A 1K9MO 4PL8A 4JNEA 4H0TB 2NNWA 2J4RA 3ZX3A 5JMVA 4GV9A 5BPMA 1NGCA 2WBNA 2ZJPL 3CCUN 3EKSA 3MX2A 4BC2A 2QM1A 4BR0A 3E9OA 3CIPA 5H1SQ 2CGJA 3CMEN 4H5TA 1YITN 4H0VB 1G99A 4AM7A 5FPNA 2NRHA 3K9JA 3ID6A 4IZ9A 3ZX2A 4RWTA 3HOTA 4ILGB 3CCLN 2I7NA 2UYTA 3FZFA 3D6RA 1NGAA 3E9PA 1V4TA 3SMPA 4YOYA 5EOYA 1YIJN 1BDGA 1XQSC 2P9NB 3C7NA 4YOUA 3O8MA 1JCGA 2NRZA 3UE5A 2HOEA 3W0LA 1VQKN 3VF6A 2IVPA 1C0GA 1RGIA 1NGGA 4L3QA 4CBUA 3QMLA 4UY8O 3CCMN 2E1ZA 3IUCA 4NB4A 2QW9A 2NRWA 2V7YA 3E66A 3SAHA 2YX6A 2A41A 3EO3A 3VPZA 4IFEA 4DCHA 1KD1O 3CJCA 1GLCG 3G25A 4HWIA 3RSEA 1Q86O 4EAHD 5AQVA 2CH5A 3UKRA 2OANA 3FLCO 5AZJA 1VAZA 4C1NK 3P31A 3VGLA 4WF9L 4BRGA 3OW2M 2VYPA 4KBOA 1K8AO 1V4SA 2HF4A 1DT9A 5AQRA 4CZFA 1JCFA 4WFNL 1NLVA 3GDQA 3CCSN 3GG4A 4BR9A 5C15A 1YF5L 5AQLA 3B8AX 3HI0A 3DXKB 5EXWA 5AQPA 4XEIA 5EX5A 3H6EA 4AM6A 1Q82O 4OPHA 4MLHA 3KZBA 5GIOA 4IO9L 1LCUA 3WQTA 1EQYA 5GINA 4DKWA 2EWSA 2NRVA 5CR4A 2I7PA 2QWPA 5AZIB 5JICA 1YJWN 3GOIA 3R9PA 2Q0RA 5AFUH 5M1NA 4BR7A 2V52B 1VQ4N 4IXCA 5AQWA 4JEPA 3NVKA 3CXCM 4H5VA 5AQYA 1IJJA 3O9SA 3ATVA 2HBMA 1RFQA 4CI6A 2F9WA 5BN9A 5F1XA 4H5WA 2P9NA 1S22A 4BVPA 2KLAA 3WT0A 4BRCA 4IJAA 2ASMA 3PLAA 4CD3A 1X3NA 4BRNA 4BE7B 4XH5A 3VF2A 4XJXA 3SLCA 4BEBA 1U2VB 5M1KA 5DM7L 3U8XA 2A5XA 2H3GX 3O1WA 3TPQA 2ASPA 4CZLA 1NM1A 1X9JA 1NGEA 3MN9A 4PL7A 5JLFA 3H1QA 4CBWA 3EE9A 5AQFA 1MWMA 4BRHA 4JD2A 1QZ6A 3HRGA 3SMSA 4BGBA 3QICA 2C1IA 2QI2A 4FOIA 4BR2A 2A6AA 1ATNA 5GAGP 3EL2A 2ZJRL 4R79A 1R59O 2BH1A 2WFBA 3E9LA 4ISGA 3IMXA 3CPWM 3CCRN 3VGMA 4CZEA 1S72N 1GLLO 2HSTA 2ITMA 4BRAA 3CERA 3MN5A 1W97L 3MK6A 3AY9A 2Q36A 4FWKA 4CZMA 2P9IB 3VENA 3S41A 4BG9A 1YJ9N 3AGKA 4A62A 4JKBA 4FSVA 2YJEA 3FGUA 2IVOA 5EVZA 3QB0A 2YHXA 3RSEB 3SK3A 3MCPA 3H1VX 4FPBA 3H3NO 4B1UB 3UKRB 5AZJB 1MA9B 1TYQB 5TKWA 4M63C 5M1OA 3PIPL 3L0QA 3MN7A 4OPAA 4GY2B 2D0OA 3QDKA 4MLEA 4BQZA 1XUPO 3L6QA 3G6EN 1DKGD 1HJOA 2NRRA 5AQTA 3R3LA 2QWQA 3ENOA 1YAGA 5TKYA 4BY9C 4B1WB 3TSUA 3TSQA 3HM8A 4H0OA 5BREA 2QWRA 4K43A 3VESA 2QA4N 4FWPA 2A42A 2VGNA 1T3VA 4O5FA 3IDHA 1ZBSA 3P38A 2V51B 2E2NA 1U2VA 4JN4A 3K9KA 4A57A 3ZX0A 3H45C 5E84A 4A59A 4FOEA 3ZYYX 3CI5A 4CBXA 4E1JA 1JJ2M 2W00A 2ZWHA 3Q7BA 4B1ZA 3O9RA 4YDUC 4WQ4C 1WOQA 4MO4A 5AQNA 1QVGM 1CZAN 1ILYA 3O9TA 3U9ZA 4I6MB 1VQPN 5AQGA 2GTDA 3G4SN 3F5TA 4ISFA 1LOTB 3AAQA 2GELA 3PIOL 2Q0UA 5FPEA 1GLEG 3BUZB 3NVMA 4CZHA 2JWKA 3VGKA 4CD1A 1GLJO 4AF1A 3OBWA 3QBWA 2W41A 3UKUA 2P9IA 3LDLA 3CC2N 4JD2B 1KXPA 1ATSA 2NZTA 4CZIA 1QVFM 2P9PA 1EO1A 1VQ9N 2ZF5O 4Y0WA 3FZMA 3JS6A 5AQXA 4EIAA 1HUXA 2NRTA 4FWOA 3U9DA 3J8AA 3FE1A 3D2EB 2VWBA 1TYQA 5LY3A 3I8BA 3KWIA 3AAPA 2YHYA 1VQNN 3H3OB 2YCHA 3O08A 4H5NA 1WUAA 5CE3A 1HX1A 1KAYA 1QQOA 1BO5O 1QHAA 2E2OA 4JKDA 3VMFB 5F0XA 4C23A 1NGIA 2FF3B 3M3ZA 4BRMA 3D2FB 3HBTA 1KAZA 3F9MA 5HOOA 4A5BA 4NLCA 3DLLL 4MDBA 1NBWA 1SZ2A 3KWGA 1N8RO 3A8YA 4JK9A 4GNIA 3WXJA 3OA9A 4BC5A 4LC9B 5E26A 1Z05A 3SJHA 2Q1NA 1NMDA 1D4XA 1YXQA 2D0PA 3C6AA 5ELZA 1Q7YO 3TTFA 2QWOA 5M1QA 5C2FA 2PFUA 4BRQA 1VQ6N 1NGBA 4I6MA 4BREA 4IDHA 5GAEP 3A5OC 2AA4A 2A3ZA 4QS8A 4H03B 3MX5A 4WFBL 2RHKA 3MMVA 1HKBA 3CQXA 4JKHA 5BRDA 3E1YA 2HF3A 4F9OA 3CJ1A 4K41A 3WXLA 4XH1A 4JKGA 3CMAN 3KK7A 4YOVA 2NRXA 3CHWA 5AQZA 4WQ5C 1K8KA 1MWKA 3KVGA 4U67L 1HKCA 1SQKA 3LDPA 3ID8A 1QQNA 2F9TA 3A5NC 2P9LA 1E4FT 3HTVA 1VQMN 3VEWA 3DWLA 5C12A 2VGMA 2F7TA 3D2EA 1OKJA 2W40A 4JK8A 2FSKA 5I9EB 3ZEUA 3W3DA 1T6DA 5AQJA 4RCHA 5ADXH 4YOXA 2BTFA 2CH6A 5AQOA 1P8ZA 1GLDG 3M5RA 3O5BA 2ZJQL 3UKUB 1T6CA 4FWRA 2Q31A 3WQUA 2E1YA 4XH4A 4H0YB 3VERA 3U4LA 5KQDA 2P9PB 5GIPA 4C1NI 2E2PA 4PKIA 2YHWA 3D2FA 3FZHA 4MDAA 5M1FA 4EHTA 3FFKB 1XC3A 1YI2N 1IG8A 1NJIO 4EHUA 3DJCA 2P9KB 3M6GA 2PAVA 1S3XA 1KQSM 2FF6A 1GLBG 3TTDA 3H46O 3UB5A 5KPRA 4BRFA 1QZ5A 1RDWX 5FPMA 3NMUA 4QS7A 3R8EA 3VF4A 3I56N 4O8KA 4K25A 3MCAB 4FL9A 3O9UA 2GWJA 4IJNA 3O1BA 1E4GT 3VETA 2QTDA 4PKGA 3DAWA 4YOWA 1BG3A 2RE2A 3A5LC 2E8AA 5KPZA 3CC7N 1U6ZA 1MDUB 3CETA 3J7ZO 4ILJA 4B9QA 3GE1A 2PBDA 5DM6L 1Z6RA 3CJBA 3BF1A 4JKCA 2FLOA 5BPLA 1M1KO 3R1XA 2KHOA 3O9QA 1K73O 4M7YA 5GADP 4GVEA 5LJWA 5BN8A 3WXMB 4BQLA 3JXUA 5CHIA 4QS9A 1NGFA 3VOVA 3ZETA 4B1YB 3HSCA 3N4QA 2P9SB 1ESVA 1YVNA 5B8HA 2VCPA 3EN9A 4KH4A 4MO5A 2HBJA 4BRIA 4CZGA 1DGKN 2V7ZA 3I33A 1Y64A 2CGLA 2QWNA 1HPMA 4WCEL 4BRLA 1NGHA 2JWLA 2A40A 3EZWA 3C6HA 3VTIA 1YHQN 2QEXN 3CCQN 2FSNA 1TUUA 5C2DA 3BF3A 3DXMB 5BRHA 3VEZA 4YDUA 2FXUA 4JKEA 3CPEA 4WQ4A 5AQKA 3ULEB 4IOXA 4IOCL 4BECA 5AQSA 4A61A 4JKGB 3O4WA 1O13A 3MWTA 4O8UA 3CQYA 4BC3A 1K8KB 3LM2A 4YOTA 5GAHP 4FWNA 4Z94A 5AQQA 4NLBA 3P4IA 1VQ5N 3A0IX 3AGRA 1T44A 2P9LB 3OBYA 3R6MA 3TU5A 2OTJN 2D1KA 2P9KA 3KHYA 3QFPA 1ZC6A 2HMPA 4ISEA 4IWVA 3ZEUB 1VQON 3BP8A 4BGAA 2D4WA 5BR9A 1DEJA 3RVCA 2E20A 3CJ9A 4FWSA 3SAFA 4BR4A 2GWKA 5AQMA 2OTLN 2ASOA 3C65A 2BUPA 3TTCA 4PHTX 3VTHA 1BUPA 5HL7L 3MWPA 2E88A 4JKAA 2P9UA 5KPTA 1RDUA 3CD6N 3SAGA 2GUPA 1HLUA 2GX9A 4CZJA 5FPDA 4GV6A 1GLFO 1KC8O 4BRPA 1YJNN 2YJFA 2E2QA 3A5MC 4FPAA 3WXKA 3GBTA 4DQ8A 4G9ZA 4HTLA 1ZXOA 4FWMA 5AFUA 3CJ7A 3SBGA 4BRKA 4CJ7A 4A2AA 2P9SA 4IO8A 4PKHA 5MLCQ 1BU6O 4K42A 1VQLN 4GV3A 3N4PA 5M1PA 5F2RA 3T7ZA 1J6ZA 3WEEB 5JVHL 1BWFO 3ENHA 4U7BA 3EE8A 4BROA 3LDNA 3QBXA 3OHRA 3BEXA 4JAXA 4KH5A 4J8FA 3O80A 4A2BA 3DXMA 3MN6A 1BOTO 2HBLA 3SBTA 3ULEA 1GLAG 3HOSA 3ZETB 3HZ6A 4JHDB 3M1FA 5JVGL 1YUWA 2HBKA 1C0FA 1SAZA 2IVNA 3O6WA 4FVUA 1BA1A 3FR0A 5C10A 3FZKA 4IOAL 4IEIA 4JK7A 4DHYA 4FO0A 1NGDA 4CZKA 5BRFA 3C0BA 3Q7CA 1TUYA 2YI1A 4BVOA 4WQ5A 5KQ8A 5LJVA 3WUHA 5ADXA 1P90A 3TSPA 4H0PA 4WYBA 1M90O 1KAXA 3ENBA 3L4IA 4H5RA 3CC4N 2KKZA 1H1VA 3ATUA 3CF5L 3EKUA 3LL3A 3VEYA 3LM9A 2NLXA 2GEMA 3P39A 4B1VA 2Q2RA 5EY4A 1SS6A 4OO1J 4FWQA 4M7XA 5C0YA 1VQ8N 4KH6A 4RTFD 3C7NB 3VEVA 3VEOA 1Q81O 3IKMA 1X3MA 4A5AA 1Q18A 3AARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZGZ A;  2QXL A;  2ZGY A;  3VEX A;  5AQH A;  1QQM A;  2WUS A;  4EFH A;  2CGK A;  4FWL A;  2DPN A;  3QFU A;  4NO7 A;  3FZL A;  2P9U B;  3LDO A;  4H0X B;  1HKG A;  3WEE A;  2FSJ A;  3DXK A;  2QWM A;  3LDQ A;  3D7E O;  5AQI A;  3MDQ A;  3CJA A;  1NWK A;  5AR0 A;  3GL1 A;  5AQU A;  4DB3 A;  5JLH A;  4B1X B;  4JHD A;  4BC4 A;  5AZI A;  1NGJ A;  4BRD A;  3WXI A;  1ATR A;  2AP1 A;  1BA0 A;  2Q97 A;  5BPN A;  3IFR A;  1JCE A;  2IIR A;  2QWL A;  4BG8 A;  4BR5 A;  4PL8 A;  4JNE A;  4H0T B;  2J4R A;  3ZX3 A;  5JMV A;  5BPM A;  1NGC A;  3EKS A;  4BC2 A;  2QM1 A;  4BR0 A;  3CIP A;  2CGJ A;  4H5T A;  4H0V B;  1G99 A;  4AM7 A;  5FPN A;  2NRH A;  4IZ9 A;  3ZX2 A;  4RWT A;  2I7N A;  2UYT A;  3FZF A;  1NGA A;  1V4T A;  3SMP A;  5EOY A;  1BDG A;  1XQS C;  2P9N B;  3C7N A;  3O8M A;  1JCG A;  3UE5 A;  3W0L A;  2HOE A;  3VF6 A;  2IVP A;  1C0G A;  1RGI A;  1NGG A;  4L3Q A;  4CBU A;  3QML A;  2E1Z A;  3IUC A;  4NB4 A;  2QW9 A;  2V7Y A;  2A41 A;  3EO3 A;  3VPZ A;  4DCH A;  3CJC A;  1GLC G;  3G25 A;  4HWI A;  3RSE A;  4EAH D;  5AQV A;  2CH5 A;  3UKR A;  2OAN A;  3FLC O;  5AZJ A;  3VGL A;  4BRG A;  2VYP A;  4KBO A;  1V4S A;  2HF4 A;  5AQR A;  4CZF A;  1JCF A;  1NLV A;  3GDQ A;  3GG4 A;  4BR9 A;  5AQL A;  3B8A X;  3HI0 A;  3DXK B;  5EXW A;  5AQP A;  4XEI A;  5EX5 A;  3H6E A;  4AM6 A;  4MLH A;  3KZB A;  1LCU A;  3WQT A;  1EQY A;  2EWS A;  2I7P A;  2QWP A;  5AZI B;  5JIC A;  3GOI A;  3R9P A;  2Q0R A;  5AFU H;  4BR7 A;  2V52 B;  4IXC A;  5AQW A;  4H5V A;  5AQY A;  1IJJ A;  3ATV A;  4CI6 A;  1RFQ A;  2F9W A;  5BN9 A;  5F1X A;  4H5W A;  2P9N A;  1S22 A;  4BVP A;  3WT0 A;  4BRC A;  4IJA A;  2ASM A;  4CD3 A;  1X3N A;  4BRN A;  4XH5 A;  3VF2 A;  3SLC A;  1U2V B;  3U8X A;  2A5X A;  2H3G X;  3O1W A;  3TPQ A;  2ASP A;  4CZL A;  1NM1 A;  1X9J A;  1NGE A;  3MN9 A;  4PL7 A;  5JLF A;  3H1Q A;  4CBW A;  5AQF A;  4BRH A;  1MWM A;  4JD2 A;  1QZ6 A;  3SMS A;  4BGB A;  3QIC A;  4FOI A;  4BR2 A;  2A6A A;  1ATN A;  3EL2 A;  1R59 O;  4ISG A;  3IMX A;  3VGM A;  4CZE A;  1GLL O;  2ITM A;  4BRA A;  3CER A;  3MN5 A;  3MK6 A;  3AY9 A;  2Q36 A;  4FWK A;  4CZM A;  2P9I B;  3VEN A;  3S41 A;  4BG9 A;  4A62 A;  4FSV A;  2YJE A;  3FGU A;  2IVO A;  5EVZ A;  3QB0 A;  2YHX A;  3RSE B;  3SK3 A;  3MCP A;  3H1V X;  4FPB A;  3H3N O;  4B1U B;  3UKR B;  5AZJ B;  1MA9 B;  1TYQ B;  4M63 C;  3L0Q A;  3MN7 A;  4GY2 B;  2D0O A;  3QDK A;  4MLE A;  4BQZ A;  1XUP O;  3L6Q A;  1DKG D;  1HJO A;  5AQT A;  2QWQ A;  3ENO A;  1YAG A;  5TKY A;  4B1W B;  3HM8 A;  4H0O A;  5BRE A;  2QWR A;  4K43 A;  3VES A;  4FWP A;  2A42 A;  4O5F A;  3IDH A;  1ZBS A;  2V51 B;  2E2N A;  1U2V A;  4JN4 A;  3ZX0 A;  3H45 C;  5E84 A;  4E1J A;  4FOE A;  4CBX A;  3CI5 A;  2ZWH A;  4B1Z A;  4YDU C;  4WQ4 C;  1WOQ A;  4MO4 A;  5AQN A;  1CZA N;  3U9Z A;  4I6M B;  5AQG A;  2GTD A;  4ISF A;  1LOT B;  3AAQ A;  2GEL A;  2Q0U A;  5FPE A;  1GLE G;  3BUZ B;  4CZH A;  3VGK A;  4CD1 A;  1GLJ O;  3QBW A;  2W41 A;  3UKU A;  2P9I A;  3LDL A;  4JD2 B;  1KXP A;  1ATS A;  2NZT A;  4CZI A;  2P9P A;  2ZF5 O;  4Y0W A;  3FZM A;  3JS6 A;  5AQX A;  4EIA A;  1HUX A;  4FWO A;  3U9D A;  3J8A A;  3FE1 A;  3D2E B;  2VWB A;  1TYQ A;  5LY3 A;  3I8B A;  3AAP A;  2YHY A;  3H3O B;  2YCH A;  3O08 A;  4H5N A;  1WUA A;  5CE3 A;  1HX1 A;  1KAY A;  1QQO A;  1BO5 O;  1QHA A;  2E2O A;  5F0X A;  4C23 A;  1NGI A;  2FF3 B;  3M3Z A;  4BRM A;  3D2F B;  3HBT A;  1KAZ A;  3F9M A;  1NBW A;  1SZ2 A;  3A8Y A;  4GNI A;  3WXJ A;  4BC5 A;  4LC9 B;  5E26 A;  1Z05 A;  3SJH A;  2Q1N A;  1NMD A;  1D4X A;  1YXQ A;  2D0P A;  5ELZ A;  2QWO A;  4BRQ A;  1NGB A;  4I6M A;  4BRE A;  3A5O C;  2AA4 A;  2A3Z A;  4QS8 A;  4H03 B;  3MMV A;  1HKB A;  3CQX A;  5BRD A;  2HF3 A;  4F9O A;  3CJ1 A;  4K41 A;  3WXL A;  4XH1 A;  3CHW A;  5AQZ A;  4WQ5 C;  1K8K A;  1MWK A;  3KVG A;  1HKC A;  1SQK A;  3LDP A;  3ID8 A;  1QQN A;  2F9T A;  3A5N C;  1E4F T;  2P9L A;  3HTV A;  3VEW A;  3DWL A;  5I9E B;  3D2E A;  1OKJ A;  2W40 A;  2FSK A;  3ZEU A;  3W3D A;  1T6D A;  5AQJ A;  4RCH A;  5ADX H;  2BTF A;  2CH6 A;  5AQO A;  1P8Z A;  1GLD G;  3O5B A;  3UKU B;  1T6C A;  4FWR A;  2Q31 A;  3WQU A;  2E1Y A;  4XH4 A;  4H0Y B;  3VER A;  3U4L A;  5KQD A;  2P9P B;  2E2P A;  4PKI A;  2YHW A;  3D2F A;  3FZH A;  4EHT A;  3FFK B;  1XC3 A;  1IG8 A;  4EHU A;  3DJC A;  2P9K B;  3M6G A;  2PAV A;  1S3X A;  2FF6 A;  1GLB G;  3UB5 A;  3H46 O;  5KPR A;  4BRF A;  1QZ5 A;  1RDW X;  5FPM A;  4QS7 A;  3R8E A;  3VF4 A;  4O8K A;  4K25 A;  4FL9 A;  4IJN A;  2GWJ A;  3O1B A;  1E4G T;  3VET A;  4PKG A;  3DAW A;  1BG3 A;  3A5L C;  2E8A A;  5KPZ A;  1U6Z A;  1MDU B;  3CET A;  4B9Q A;  3GE1 A;  2PBD A;  1Z6R A;  3CJB A;  3BF1 A;  5BPL A;  2FLO A;  2KHO A;  4M7Y A;  5LJW A;  5BN8 A;  4BQL A;  3JXU A;  4QS9 A;  1NGF A;  3VOV A;  3ZET A;  4B1Y B;  3HSC A;  2P9S B;  1ESV A;  1YVN A;  5B8H A;  2VCP A;  3EN9 A;  4MO5 A;  4BRI A;  4CZG A;  1DGK N;  2V7Z A;  3I33 A;  1Y64 A;  2CGL A;  2QWN A;  1HPM A;  4BRL A;  1NGH A;  2A40 A;  3EZW A;  2FSN A;  1TUU A;  3BF3 A;  3DXM B;  5BRH A;  3VEZ A;  4YDU A;  2FXU A;  4WQ4 A;  3ULE B;  5AQK A;  5AQS A;  4A61 A;  3O4W A;  3CQY A;  4BC3 A;  1K8K B;  3LM2 A;  4FWN A;  4Z94 A;  5AQQ A;  3P4I A;  3A0I X;  1T44 A;  2P9L B;  3R6M A;  3TU5 A;  2D1K A;  2P9K A;  3KHY A;  3QFP A;  1ZC6 A;  2HMP A;  4ISE A;  4IWV A;  3ZEU B;  3BP8 A;  4BGA A;  2D4W A;  5BR9 A;  1DEJ A;  2E20 A;  3CJ9 A;  4FWS A;  4BR4 A;  2GWK A;  5AQM A;  2ASO A;  2BUP A;  1BUP A;  2E88 A;  2P9U A;  5KPT A;  2GUP A;  1HLU A;  4CZJ A;  5FPD A;  1GLF O;  4BRP A;  2YJF A;  2E2Q A;  3A5M C;  4FPA A;  3WXK A;  3GBT A;  4DQ8 A;  4HTL A;  1ZXO A;  4FWM A;  5AFU A;  3CJ7 A;  4BRK A;  4CJ7 A;  4A2A A;  2P9S A;  4IO8 A;  4PKH A;  1BU6 O;  4K42 A;  5F2R A;  1J6Z A;  3WEE B;  1BWF O;  3ENH A;  4BRO A;  3LDN A;  3QBX A;  3OHR A;  3BEX A;  4JAX A;  4J8F A;  3O80 A;  4A2B A;  3DXM A;  3MN6 A;  1BOT O;  3ULE A;  1GLA G;  3ZET B;  3HZ6 A;  4JHD B;  3M1F A;  1YUW A;  1C0F A;  1SAZ A;  2IVN A;  3O6W A;  1BA1 A;  3FR0 A;  3FZK A;  4DHY A;  4FO0 A;  1NGD A;  4CZK A;  5BRF A;  3C0B A;  1TUY A;  2YI1 A;  4BVO A;  4WQ5 A;  5KQ8 A;  5LJV A;  3WUH A;  5ADX A;  4H0P A;  4WYB A;  1KAX A;  3L4I A;  4H5R A;  1H1V A;  3ATU A;  3EKU A;  3LL3 A;  3VEY A;  3LM9 A;  2NLX A;  2GEM A;  4B1V A;  2Q2R A;  5EY4 A;  4FWQ A;  4M7X A;  4RTF D;  3C7N B;  3VEV A;  3VEO A;  1X3M A;  1Q18 A;  3AAR A; 
#chains in the Genus database with same CATH topology
 2QXL A;  3UIQ A;  2ZGY A;  3VEX A;  1KFD A;  3CCE N;  4ZTJ A;  3CCJ N;  3DRP A;  3F2K A;  1CLQ A;  3ZSQ A;  2UXD K;  3WEE A;  4E7I A;  3LDQ A;  3LP2 A;  5AQI A;  3HXM A;  3U3Y A;  4YOR A;  3GL1 A;  4CGD A;  2OYQ A;  3AVC A;  3THW A;  5AZI A;  1BA0 A;  2WC9 A;  3PSF A;  2G8V A;  1VQ7 N;  3OYM A;  4DQI A;  3T69 A;  4PL8 A;  4B8C A;  2J4R A;  3SQ0 A;  4N76 A;  1NGC A;  3VQ7 A;  4BC2 A;  4BR0 A;  3B6P A;  4H5T A;  4IKF A;  1YIT N;  4I2Q A;  1G99 A;  2B4J A;  1VSH A;  3HPO A;  1W0H A;  1NGA A;  1NK7 A;  3SMP A;  1BDG A;  3NH1 A;  3ZCM A;  1NKC A;  4YOU A;  1RT7 A;  1JCG A;  3UE5 A;  3AVG A;  2IVP A;  1RGI A;  1NGG A;  3QML A;  2QW9 A;  2V7Y A;  3SAH A;  3EO3 A;  3VPZ A;  3SPY A;  2F8T A;  3AVI A;  3NF7 A;  3O3F A;  4E3S A;  1KD1 O;  4O0J A;  3I0R A;  4EAH D;  5AQV A;  4FYD A;  2CH5 A;  1HYZ A;  1S1W A;  5AZJ A;  4F2S A;  3VQ8 A;  4C1N K;  1J5O A;  4CE9 A;  3VQA A;  2VWK A;  3HPG A;  4HCB A;  1JCF A;  1UOC A;  2ZD1 A;  5AQL A;  3B8A X;  2O8C B;  5EXW A;  1L5U A;  4XEI A;  5EX5 A;  3VQB A;  4MLH A;  3WQT A;  1EQY A;  3RMA A;  1HJR A;  5CR4 A;  2QWP A;  3GOI A;  3R9P A;  2V52 B;  1VQ4 N;  3HVT A;  5AQW A;  3L8B A;  2HBM A;  2F9W A;  2P5G A;  4H5W A;  4CVN E;  4BVP A;  4J2B A;  4PA1 A;  4IJA A;  2ASM A;  2Y1I A;  4XJX A;  3SLC A;  1U2V B;  1VSD A;  4IFY A;  5DM7 L;  4DQP A;  1GOA A;  3O1W A;  1NGE A;  4PL7 A;  1ASU A;  2Z1G A;  1E3M A;  1SUQ A;  3EY1 A;  3SMS A;  2C1I A;  1EWR A;  1HNI A;  4YHH K;  3EL2 A;  2WFB A;  4EP5 A;  1TK8 A;  3CCR N;  3MXI A;  5FLX O;  3I8D A;  2ITM A;  3MN5 A;  1W97 L;  4R5P A;  2P9I B;  2HHH K;  4RG8 A;  4BG9 A;  2VWJ A;  2O8C A;  4DFP A;  3S3M A;  3QB0 A;  3RSE B;  4FJ9 A;  3H1V X;  4B1U B;  3UKR B;  1N34 K;  4GVM A;  5M1O A;  1I94 K;  5LMU K;  2Z1H A;  1J9A A;  4BQZ A;  5FRN A;  3L2V A;  3ALY A;  3NF8 A;  1HJO A;  3R3L A;  1VSI A;  4BY9 C;  2PYJ A;  4I9Q A;  4B1W B;  1RBR A;  3TSQ A;  3ZT2 A;  3NE6 A;  1W9H A;  5BRE A;  2QWR A;  4I9L A;  2A42 A;  4O5F A;  1C1C A;  3IDH A;  2UUC K;  2V51 B;  1U2V A;  1JXB A;  4DTS A;  2ZWH A;  1BCO A;  2IS3 A;  2WON A;  1QVG M;  4I2P A;  1ILY A;  4DTU A;  3U9Z A;  3G4S N;  4O4G A;  3TAN A;  1LOT B;  3ZSY A;  2Q0U A;  5FPE A;  3LAL A;  3NVM A;  4CZH A;  4E1M A;  3O3H A;  4CD1 A;  1GLJ O;  4CCH A;  2UU9 K;  2KZM A;  3OBW A;  4CEZ A;  3QBW A;  2W41 A;  2P9I A;  4JD2 B;  1ATS A;  1SKS A;  4KHQ A;  1Q9X A;  1XHX A;  2QKB A;  1EO1 A;  3V9W A;  3AA4 A;  1VQ9 N;  4DR5 K;  4EIA A;  5LY3 A;  3KWI A;  2YHB A;  4H5N A;  1HX1 A;  4CFA A;  4BRM A;  3OTO K;  3D2F B;  1SKR A;  2YKN A;  4CF0 A;  5HOO A;  4IG0 A;  1WB9 A;  4FJ5 A;  4C8M A;  4MDB A;  3LPT A;  2D0B A;  1X1P A;  1A5W A;  3P5J A;  1NK0 A;  1B9D A;  1BI4 A;  4CHQ A;  3A8Y A;  3U3G A;  4CJL A;  4LC9 B;  4OLB A;  3OJU A;  5A2Q O;  4GKK K;  2QWO A;  5M1Q A;  4FK2 A;  2D5R A;  1NGB A;  4H4O A;  5GAE P;  3AVH A;  2A3Z A;  3TWH A;  3V9X A;  2RHK A;  4KV8 A;  5BRD A;  3E1Y A;  3CJ1 A;  3JYT A;  4K41 A;  1SL2 A;  4Z4H A;  4JKG A;  3NGI A;  3TAB A;  1NOZ A;  2P5O A;  2NRX A;  5AQZ A;  1K8K A;  3MEE A;  3T1H K;  5SZT A;  1SQK A;  4CJE A;  2P1J A;  2F9T A;  3A5N C;  4E72 A;  1N36 K;  3J7A P;  1GOB A;  4O44 A;  2VGM A;  2F7T A;  4JK8 A;  5I9E B;  2W40 A;  3QNO A;  1TVR A;  3L3V A;  4X64 K;  5C24 A;  3DYA A;  3UKU B;  4DSE A;  4FWR A;  4OJR A;  4CFC A;  4DUZ K;  3QEW A;  4KHS A;  4XH4 A;  5GIP A;  2P9P B;  5M1F A;  3D2F A;  2RKI A;  1RT1 A;  3FFK B;  3HK2 A;  4FM2 A;  3TTD A;  2IC3 A;  4BRF A;  5KPR A;  5FPM A;  4QS7 A;  4O8K A;  2O8F A;  3VQE A;  1E4G T;  5KI6 A;  3K5O A;  2QTD A;  2OCE A;  2HW3 A;  4BE2 A;  3BGR A;  3A5L C;  1I3A A;  4IBN A;  3CC7 N;  1MDU B;  3CET A;  4M41 A;  2UUA K;  1WSF A;  4ILJ A;  5DM6 L;  3BF1 A;  5BPL A;  1S5J A;  4DQR A;  1EP4 A;  4M7Y A;  3ZSW A;  4GVE A;  4OLA A;  2O4I A;  4Z4E A;  1NGF A;  4B1Y B;  3OS0 A;  3HSC A;  2P9S B;  1ESV A;  1TKX A;  1YVN A;  3THY A;  4KH4 A;  1CXQ A;  4BRI A;  4CJQ A;  3I33 A;  1JLA A;  2CGL A;  4N47 A;  3LP0 A;  2JWL A;  2QEX N;  2A40 A;  1YHQ N;  1N6Q A;  3PSI A;  3C95 A;  5BRH A;  3TAG A;  3KD5 E;  3AO3 A;  2X74 A;  5AQK A;  3WNF A;  2GUI A;  4FZZ A;  4DR4 K;  4BAC A;  1S6Q A;  3ZSZ A;  1HMV A;  3CQY A;  4FJ8 A;  4FWN A;  3K58 A;  3P1G A;  2HB5 A;  3SCX A;  4PQU A;  3P4I A;  1NK6 A;  2XO7 A;  3OBY A;  2OTJ N;  1RBV A;  3QFP A;  4CHP A;  4FLY A;  4CGG A;  1VQO N;  2YKM A;  4KI4 A;  1KTQ A;  4OKE A;  1DEJ A;  3CJ9 A;  1D8Y A;  4JI6 K;  2GWK A;  3QIO A;  5AQM A;  1OVQ A;  4KHY A;  3DI6 A;  1EXQ A;  3VTH A;  3RRH A;  1LV5 A;  2P9U A;  1HR0 K;  1YJN N;  1LWF A;  2YJF A;  1X9M A;  1LW0 A;  4DQ8 A;  4KB1 A;  4DSL A;  4CJV A;  1B92 A;  2P9S A;  1BCM A;  4PKH A;  5CZ1 A;  5MLC Q;  4BE1 A;  1ASW A;  4K42 A;  3TAF A;  4F8R A;  4DTJ A;  3ENH A;  3KKS A;  4B9T A;  4Q0B A;  4BRO A;  3LDN A;  3BEX A;  3M8R A;  4M3W A;  4A2B A;  3SBT A;  4WE1 A;  1JL1 A;  4JHD B;  1C0F A;  4L8R B;  3O6W A;  4DS5 A;  4FVU A;  1C0T A;  1XNQ K;  4JK7 A;  3RRG A;  4B3M K;  4CZK A;  1WNS A;  3SYZ A;  3ASM A;  4BVO A;  5KQ8 A;  4WQ5 A;  4GW6 A;  5FRM A;  3WUH A;  1M90 O;  3L4I A;  4B9V A;  3CC4 N;  4FZY A;  4FLZ A;  4JS4 A;  1X9S A;  4B9N A;  4B3O A;  4OO1 J;  3K0S A;  4M7X A;  4RTF D;  3AO4 A;  3C7N B;  1Q81 O;  3IKM A;  2VG6 A;  3CM6 A;  2ZGZ A;  4WFA L;  4K0K K;  2ZQB A;  2C1G A;  4QAG A;  1WBB A;  2WUS A;  4OKK A;  2A1R A;  4KTQ A;  1VK0 A;  3C94 A;  3CYG A;  2CGK A;  4FM1 A;  3VA0 A;  3BY5 A;  1S6P A;  4H0X B;  4DFK A;  4DR2 K;  5CZ2 A;  2KFZ A;  2FBV A;  4CW7 B;  3K5M A;  3THV A;  1VHX A;  3SQ1 A;  2OZS A;  1NWK A;  1QTM A;  3AO1 A;  4DB3 A;  4Z4C A;  5JLH A;  4B1X B;  3TAM A;  4JHD A;  1X9W A;  3FFI A;  3WXI A;  1ATR A;  5BPN A;  1W2B M;  2DTU A;  2IIR A;  4BG8 A;  4DF4 A;  4BR5 A;  1K9M O;  3D45 A;  1QSL A;  2NNW A;  2E5L K;  4DTO A;  4LFB K;  4GV9 A;  4LF6 K;  1FKP A;  5BPM A;  1TKD A;  4M3Y A;  4C8N A;  2WBN A;  1VRT A;  3AO2 A;  4C8L A;  4LFA K;  3E9O A;  3CIP A;  5H1S Q;  2KW4 A;  2HHX A;  4DQQ A;  4FJK A;  4AM7 A;  2Z1I A;  3K9J A;  4OGE A;  3LAK A;  4H4M A;  3VN5 A;  2UYT A;  1MU2 A;  3FZF A;  3QER A;  4YOY A;  1YIJ N;  2P9N B;  3C7N A;  2XY5 A;  2NRZ A;  3TAP A;  1WAF A;  3VF6 A;  3AV9 A;  4CBU A;  2ETJ A;  4KTZ A;  3OYJ A;  2E1Z A;  3IUC A;  3LWL A;  3AVF A;  3NAE A;  2A41 A;  3HYF A;  1RDB A;  4IFE A;  3KLF A;  3K59 A;  4DCH A;  3OYI A;  4DG1 A;  3CJC A;  1XC9 A;  2OAN A;  3VGL A;  2DY4 A;  2VYP A;  1K8A O;  4JRQ A;  1DT9 A;  5AQR A;  4CF9 A;  1NLV A;  3GDQ A;  2QKK A;  5C15 A;  4JLH A;  1YF5 L;  4NYF A;  2XRI A;  4CJ5 A;  1Q82 O;  4IO9 L;  1GOC A;  3OYH A;  4DKW A;  2I7P A;  3T3F A;  5AZI B;  5JIC A;  2Q0R A;  5M1N A;  4YY3 K;  3NVK A;  3AA3 A;  4IXC A;  1IJJ A;  3SQ4 A;  4CI6 A;  1RFQ A;  4DR1 K;  2P9N A;  3ZSO A;  3MXJ A;  4CD3 A;  4BRN A;  5HRR A;  4CED A;  4BE7 B;  2BGG A;  2G8I A;  2OZM A;  3OYB A;  4OX9 K;  1D5A A;  1RDC A;  4CJ3 A;  4E7J A;  3SUP A;  1IO2 A;  4ISG A;  4ZHR A;  4CJF A;  3VGM A;  4CZE A;  4ELV A;  4LFC K;  2HST A;  2HNZ A;  3CER A;  1S1T A;  3WNG A;  4CZM A;  3S41 A;  4KRE A;  3AGK A;  4A62 A;  3QIN A;  2ZM6 K;  2IDO A;  4JKB A;  4AHT A;  2YJE A;  4KB0 A;  1WSJ A;  4CJS A;  1QS4 A;  3DLE A;  1WLJ A;  5AZJ B;  5TKW A;  4M63 C;  3PX0 A;  3PIP L;  3QDK A;  4CEB A;  1YTU A;  1RTH A;  1HNW K;  5AQT A;  3ENO A;  4CEE A;  5TKY A;  1XNR K;  3AA2 A;  4IFV A;  3TSU A;  4H0O A;  3VES A;  4NCA A;  4FWP A;  2VGN A;  4EZ6 A;  1KRP A;  2KTQ A;  3QNN A;  4EP4 A;  2E2N A;  2OPQ A;  1KCF A;  4JN4 A;  3HVR A;  4A57 A;  3H45 C;  4E1J A;  3L3U A;  3CI5 A;  4CBX A;  5IT9 O;  3Q7B A;  3OYL A;  3MAQ A;  3LAN A;  4MO4 A;  4WQ4 C;  4E7K A;  1YT3 A;  1DTQ A;  4E19 A;  4I6M B;  1VQP N;  5AQG A;  1NKB A;  3F5T A;  3DRR A;  3VQQ A;  3WNE A;  1HNV A;  4B9S A;  5J2N A;  3LDS A;  4AF1 A;  5C25 A;  1JLC A;  4CGJ A;  3VQC A;  4FXD A;  1CZ9 A;  1KXP A;  2NZT A;  4CIF A;  4H8K A;  4AHC A;  4FVM A;  3V9Z A;  4Y0W A;  3FZM A;  3JS6 A;  4OKJ A;  4FWO A;  3D2E B;  2VWB A;  4CGI A;  1VSM A;  3H3O B;  4DTP A;  5CE3 A;  4IG3 A;  3KK1 A;  4DMN A;  1QHA A;  2RF2 A;  1JLB A;  1NKE A;  2FF3 B;  4DSJ A;  4J2A A;  3HBT A;  3J80 O;  3KK3 A;  1YVU A;  1TK0 A;  1LAW A;  3KWG A;  3L2Q A;  4W5Q A;  3OA9 A;  5E26 A;  3BZC A;  1D4X A;  3C6A A;  1Q7Y O;  5C2F A;  4BRQ A;  4JS5 A;  4I6M A;  4BRE A;  2OPS A;  3A5O C;  4H03 B;  5DK5 A;  4XH1 A;  3KK7 A;  3AO5 A;  1MWK A;  4DV7 K;  1HKC A;  3ID8 A;  4QOZ B;  3HP9 A;  1U48 A;  3F73 A;  2RN2 A;  2P9L A;  3KTQ A;  3VEW A;  3D2E A;  2ZE2 A;  3AA5 X;  1HYS A;  4RCH A;  5ADX H;  2BTF A;  3PO5 A;  1NU0 A;  1S1V A;  5AQO A;  3NCI A;  3M5R A;  4GMJ B;  1T6C A;  3IG1 A;  1EKE A;  4H0Y B;  3U4L A;  3VER A;  3VQD A;  4MDA A;  4C1N I;  4FJJ A;  4CF2 A;  4EHT A;  5KGW A;  1XC3 A;  2P9K B;  1KQS M;  1LAV A;  1NJZ A;  4JI7 K;  3SV4 A;  4K25 A;  3S5T A;  2YNI A;  3O1B A;  1LW2 A;  4PKG A;  4YOW A;  4FJX A;  1EX4 A;  4HUG A;  1OH5 A;  3S9H A;  4M3R A;  4LH5 A;  2E8A A;  5KPZ A;  1U6Z A;  1XHZ A;  2PBD A;  4RW7 A;  1Z6R A;  3CJB A;  1T05 A;  3HT3 A;  3RMC A;  1M1K O;  4KTW A;  3RR8 A;  1K73 O;  3DLB A;  1RT2 A;  1BI4 B;  1D9D A;  4F4K A;  4CER A;  3JXU A;  5CHI A;  3V81 A;  3J7Y P;  4QS9 A;  5JS1 A;  1DTT A;  1IKX A;  4HUF A;  1OH7 A;  2VCP A;  4KI6 A;  4PWD A;  1Y64 A;  3U6F A;  4B8A B;  2KQ2 A;  4BRL A;  1NGH A;  4E0D A;  3EZW A;  3C6H A;  1NOY A;  3CCQ N;  5C2D A;  3VEZ A;  4YDU A;  3IAY A;  3CPE A;  4BEC A;  4IOC L;  2GBZ A;  4A61 A;  4JYA K;  4JKG B;  1NK9 A;  1S9G A;  3PY8 A;  4O8U A;  1K8K B;  3LM2 A;  4YOT A;  5GAH P;  3OJS A;  4X62 K;  5AQQ A;  2AJQ A;  4KHP K;  3THX B;  2E4L A;  4KHU A;  2P9K A;  3KHY A;  3L2U A;  3G10 A;  2D4W A;  4LF8 K;  2DFF A;  1QSY A;  4E89 A;  2HHQ A;  4CJK A;  3C65 A;  3TTC A;  4GKJ K;  3KJV A;  2X6N A;  2G8W A;  1BUP A;  3G0Z A;  4FCY A;  3PO4 A;  1Z26 A;  4JKA A;  1RDU A;  2W6K A;  1HLU A;  4CZJ A;  4CHO A;  4CHY A;  3LWM A;  3A5M C;  3EYZ A;  2O8F B;  2R7Y A;  1TK5 A;  4AH9 A;  4LSL A;  4M3Z A;  3KIO A;  4BRK A;  5E41 A;  4A2A A;  2HVH A;  5F2R A;  5JVH L;  3EE8 A;  3QBX A;  4KHW A;  4JAX A;  4B9M A;  4J8F A;  4V19 S;  4CEA A;  3LZJ A;  4AHV A;  3HOS A;  3HST B;  3HZ6 A;  3M1F A;  3KD1 E;  3THY B;  1SAZ A;  1WSE A;  1C1A A;  1LWC A;  3SZ2 A;  3SPZ A;  1BA1 A;  3FR0 A;  5C10 A;  3THX A;  4IOA L;  4IEI A;  4O5B A;  3ZT4 A;  4FO0 A;  2O4G A;  1ZBH A;  3OYF A;  3C0B A;  1TUY A;  5KRS A;  2QXF A;  5ADX A;  4H0P A;  2WTU A;  4WYB A;  1SKW A;  1QHT A;  1H1V A;  3CF5 L;  3EKU A;  2NLX A;  3P39 A;  2B5J A;  5EY4 A;  4FWQ A;  4KRF A;  1VQ8 N;  4KH6 A;  3VQP A;  4FM0 A;  1SL1 A;  3VEO A;  1RT3 A;  1UWB A;  2W6L A;  1RDD A;  3AAR A;  3AVK A;  3EZ5 A;  4ZTF A;  1C6V A;  1Y97 A;  1QQM A;  4IEE A;  4BE0 A;  3CYM A;  4DTM A;  2WOM A;  4FWL A;  2DPN A;  3QFU A;  4B3R K;  3KLE A;  2P9U B;  3V1R A;  4BDP A;  1HKG A;  3DXK A;  3CG7 A;  1C0U A;  3G71 N;  3LP3 A;  3SV3 A;  4DFM A;  5AQU A;  1NK8 A;  4DLE A;  1OVY A;  3NF9 A;  1NGJ A;  1L3T A;  2Q97 A;  4M3U A;  1JCE A;  2QWL A;  3TAR A;  3AVA A;  4M42 A;  3NGZ A;  2ZJP L;  3MX2 A;  2QM1 A;  4CHN A;  3CME N;  2FBY A;  4IZ9 A;  3ID6 A;  4RWT A;  3HOT A;  4Q5V A;  3CCL N;  3KLG A;  2I7N A;  3D6R A;  3E9P A;  1V4T A;  1KVA A;  5EOY A;  3O8M A;  1JLF A;  3W0L A;  4YNQ A;  3AVN A;  1VQK N;  1C0G A;  4FJN A;  2BAN A;  4B9L A;  2NRW A;  5C42 A;  4J2D A;  2VQF K;  4CJT A;  1UA1 A;  3T19 A;  4CK3 A;  1WSH A;  2I5J A;  5HRP A;  1Q86 O;  2HMI A;  3DLG A;  1VAZ A;  3DOL A;  4BRG A;  3OW2 M;  4DS4 A;  1FXX A;  1WBD A;  1OH6 A;  2HF4 A;  2XY7 A;  4DR6 K;  4CZF A;  4RW4 A;  3GG4 A;  3CCS N;  3CFR A;  1IKY A;  3H6E A;  4AM6 A;  3PX6 A;  4OPH A;  5GIO A;  4FK4 A;  4IDK A;  5GIN A;  2EWS A;  2NRV A;  1YJW N;  3CFO A;  5IWA K;  3E01 A;  5AFU H;  4BR7 A;  1XMQ K;  4JEP A;  4FJ7 A;  1N33 K;  4H5V A;  1UA0 A;  3V4I A;  3ATV A;  1XI1 A;  5F1X A;  3L2R A;  1S22 A;  3ISN C;  5EU7 A;  3WT0 A;  4CJW A;  2NUB A;  1S9E A;  1X3N A;  1VRU A;  4BEB A;  2A5X A;  4CZL A;  1NM1 A;  3ZT3 A;  3SQ2 A;  5KTQ A;  1XMO K;  5JLF A;  3H1Q A;  3V1Q A;  3EE9 A;  5AQF A;  4BRH A;  1QZ6 A;  1IBM K;  3QIC A;  2QI2 A;  4FLW A;  5JEN A;  3NBP A;  3K5L A;  5GAG P;  4C8O A;  4R79 A;  1R59 O;  3E9L A;  1ZBU A;  3CPW M;  4CF8 A;  1GLL O;  4BRA A;  3MK6 A;  3VEN A;  3OVN A;  4FSV A;  2IVO A;  5EVZ A;  2YHX A;  3SK3 A;  3MCP A;  3H3N O;  1TYQ B;  2PZS A;  4F2R A;  3OS1 A;  3MN7 A;  2O8D B;  3L6Q A;  3KK2 A;  3G6E N;  3SNN A;  3QEX A;  1YAG A;  3HM8 A;  4K43 A;  1ITG A;  1Q8I A;  4DU1 A;  1NJY A;  1T3V A;  1C1B A;  2IAJ A;  1BHL A;  3P38 A;  5FRO A;  3LP1 A;  5E84 A;  4FOE A;  2BDP A;  3HPH A;  4B1Z A;  4CES A;  3O9R A;  3NHG A;  2HHV A;  4DUY K;  1CZA N;  3DLR A;  3PV8 A;  3O9T A;  4DTN A;  1TV6 A;  1IBL K;  4ISF A;  1F21 A;  4YFU A;  5J2Q A;  3AAQ A;  2GEL A;  2JWK A;  4FW1 A;  1W7A A;  1RT6 A;  1A5X A;  3LDL A;  4KKO A;  1QVF M;  3ZSV A;  3QET A;  2FBT A;  2NRT A;  1R0A A;  1BL3 A;  4DFJ A;  1TYQ A;  1U47 A;  3M8Q A;  2YHY A;  1HNX K;  2O8D A;  4DF8 A;  2YCH A;  3VQ5 A;  1WUA A;  1HPZ A;  2HND A;  1QQO A;  3OYN A;  3VMF B;  4C23 A;  1IKV A;  3M3Z A;  4NCB A;  2E6L A;  2O8E A;  4K8X A;  3F9M A;  4A5B A;  1HYV A;  4NLC A;  1L3S A;  4PY5 A;  4KPY A;  3MXM A;  1N8R O;  1TAQ A;  3MEG A;  4JK9 A;  3WXJ A;  4CJ4 A;  4BC5 A;  2Y1J A;  1Z05 A;  2Q1N A;  4JI0 K;  3V9S A;  2D0P A;  1KSP A;  3TTF A;  3QEI A;  3M8S A;  1EET A;  4IDH A;  5HLF A;  2AA4 A;  2YNH A;  4WFB L;  4PUO A;  3MMV A;  1HKB A;  3DRS A;  1NG9 A;  3CQX A;  4JKH A;  3S3N A;  2KZZ A;  2HF3 A;  4F9O A;  5I3U A;  3CMA N;  5AJ3 K;  4YOV A;  5J1E A;  4WQ5 C;  3HL8 A;  1QQN A;  4OVL A;  1E4F T;  4Z0U A;  1BIS A;  4HTU A;  3DWL A;  5C12 A;  1OKJ A;  2FSK A;  3ZEU A;  2XHB A;  1T6D A;  5LMN K;  4JV5 K;  5AQJ A;  1NJW A;  2CH6 A;  3QES A;  2G8F A;  5HRN A;  2ZJQ L;  2Q31 A;  4JI5 K;  3WQU A;  2E1Y A;  2E2P A;  4PKI A;  2YHW A;  3FZH A;  4FJL A;  2YNG A;  1YI2 N;  1IG8 A;  1NJI O;  4EHU A;  3DJC A;  3M6G A;  1BGX T;  3UB5 A;  3RTV A;  1QZ5 A;  1RDW X;  2F96 A;  4CEC A;  3C6U A;  4RW9 A;  3MCA B;  3O9U A;  3LAM A;  3O3G A;  1S1U A;  3DAW A;  1UAX A;  1BG3 A;  1U4B A;  3BZK A;  4KO0 A;  3RR7 A;  3J7Z O;  5CYM A;  3K57 A;  2PY5 A;  3CQ8 A;  3RWU A;  4JKC A;  2HNY A;  2A1S A;  4FLT A;  1N5Y A;  5D3G A;  1DLO A;  5LJW A;  3WXM B;  4FLV A;  4M45 A;  3ZET A;  4BDY A;  3TR8 A;  1WAJ A;  2OPR A;  1TL3 A;  4JI2 K;  1HRH A;  4MO5 A;  2HBJ A;  4CZG A;  1BIZ A;  1DGK N;  3ZLJ A;  3JSM A;  1HPM A;  1RTI A;  1VSL A;  2BE2 A;  4WCE L;  1VSK A;  4N5S A;  3V6D A;  3DXM B;  3ULE B;  1RTJ A;  1K6Y A;  4DU4 A;  1O13 A;  2FC0 A;  4BC3 A;  4LSN A;  3SUO A;  4ID1 A;  4W5O A;  2HHW A;  1VQ5 N;  3A0I X;  2P9L B;  3R6M A;  3HO1 A;  1HQU A;  1ZC6 A;  4ISE A;  3BP8 A;  4OGC A;  4XIU A;  3SAF A;  4BR4 A;  2W42 A;  3C6T A;  3K5N A;  5HL7 L;  3MWP A;  5KPT A;  3SAG A;  2GUP A;  2GX9 A;  3O4N A;  4GV6 A;  1GLF O;  1KC8 O;  4Z4G A;  4BRP A;  4FLX A;  3NFA A;  4LH4 A;  3WXK A;  4G9Z A;  4HTL A;  3IS9 A;  4LF9 K;  1ZYQ A;  1QSS A;  3SBG A;  1HQE A;  3P83 D;  4HHT A;  4DTX A;  3OYG A;  1BU6 O;  1VQL N;  4GV3 A;  2D0C A;  3RMD A;  4F3T A;  1N32 K;  1BWF O;  3T1A A;  4KH5 A;  1JLE A;  3O80 A;  3DXM A;  3WNH A;  1BOT O;  2HBL A;  3VQ4 A;  3ULE A;  1C0M A;  2UUB K;  1EWQ A;  4DSK A;  5JVG L;  2IVN A;  4E7H A;  3FZK A;  3I0S A;  4NXM K;  4AHR A;  1NJX A;  4DHY A;  3S3O A;  3Q7C A;  5CYQ A;  1KLM A;  1OH8 A;  4DV6 K;  2HHT A;  4FJH A;  4JI1 K;  3TSP A;  1KAX A;  4H5R A;  4NXN K;  2KKZ A;  3DMJ A;  3ATU A;  3DLK A;  3LM9 A;  2E6M A;  1T8E A;  2GEM A;  1ZBI A;  2HHI A;  4CFB A;  5C0Y A;  2Z1J A;  1REV A;  4CIG A;  3OYK A;  2O8B B;  1RDA A;  4JRP A;  2IOC A;  3QIP A;  1Q18 A;  4AQY K;  4JI8 K;  3L2W A;  5AQH A;  4E7L A;  1J54 A;  1RNH A;  1VSF A;  4EFH A;  4M3X A;  4NO7 A;  3FZL A;  3LDO A;  4O0I A;  3SUQ A;  3OYE A;  2FSJ A;  2QWM A;  2PYL A;  1TKZ A;  4LF4 K;  3I55 N;  3D7E O;  4ILH A;  3MDQ A;  2HHS A;  4CK2 A;  3CJA A;  4DWI A;  5AR0 A;  3L4Q A;  2UXB K;  3K2P A;  4BC4 A;  4BRD A;  4JKF A;  2AP1 A;  3CCV N;  3IFR A;  5DMR A;  4JNE A;  4H0T B;  3ZX3 A;  5JMV A;  3CCU N;  3EKS A;  2CGJ A;  4ELT A;  3SI6 A;  4H0V B;  1CXU A;  5FPN A;  2NRH A;  3ZX2 A;  4ILG B;  4C8K A;  5CY4 A;  4ICL A;  3H08 A;  3MEC A;  2VQE K;  4BWJ A;  1XQS C;  2O8B A;  3NF6 A;  2X6S A;  4RW8 A;  2HOE A;  5I42 A;  2HVI A;  4L3Q A;  3OY9 A;  2G8H A;  4UY8 O;  3CCM N;  3DLH A;  4ELU A;  4NB4 A;  3E66 A;  1VSJ A;  2YX6 A;  4Y1C A;  1ZBL A;  4DV2 K;  4KAZ A;  2D0A A;  2EHG A;  2DFE A;  3TI0 A;  2HHU A;  1RIL A;  1GLC G;  1JXE A;  3G25 A;  4HWI A;  4I7F A;  3RSE A;  4FJI A;  3UKR A;  3FLC O;  3P31 A;  4WF9 L;  3NH2 A;  1I39 A;  4KBO A;  4B9U A;  1V4S A;  4WFN L;  3ZSX A;  4BR9 A;  3HI0 A;  3DXK B;  4CGH A;  1L3U A;  5AQP A;  3KZB A;  1LCU A;  4BDZ A;  3EEQ A;  4CEQ A;  2YNF A;  2EX3 A;  3DM2 A;  3KLI A;  3CXC M;  2ATQ A;  1RT4 A;  5AQY A;  4CJR A;  3O9S A;  3ULD A;  5BN9 A;  1S1X A;  3KLH A;  2KLA A;  5LL6 Z;  4BRC A;  3PLA A;  3PUF A;  3QEV A;  4XH5 A;  3VF2 A;  5M1K A;  1WN7 A;  3U8X A;  2H3G X;  3TPQ A;  4AIL C;  2ASP A;  1X9J A;  3MN9 A;  1KVB A;  4CBW A;  1SV5 A;  1MWM A;  4KHN A;  4JD2 A;  3HRG A;  4BGB A;  1WSI A;  3NH0 A;  2XY8 A;  1Q9Y A;  4FOI A;  4BR2 A;  1IH7 A;  2A6A A;  1ATN A;  2VG7 A;  1RBS A;  1B9F A;  2ZJR L;  2BH1 A;  4J2E A;  4FJM A;  3IMX A;  1S72 N;  2F4V K;  2P51 A;  3T1Y K;  3AY9 A;  2Q36 A;  5KRT A;  4RW6 A;  4FWK A;  1JLG A;  1YJ9 N;  2UXC K;  3FGU A;  1QE1 A;  3ZSR A;  4K8Z A;  4FPB A;  1MA9 B;  2FBX A;  1RT5 A;  4TSX A;  3QLH A;  3L0Q A;  4OPA A;  4CIE A;  4GY2 B;  1G15 A;  3JAM O;  2D0O A;  4MLE A;  4DV0 K;  2YHA A;  1XUP O;  2X78 A;  1BQN A;  4DR7 K;  1DKG D;  2NRR A;  4KFB A;  1L3V A;  2QWQ A;  4CF1 A;  2LSN A;  1XWL A;  5KGX A;  2F8S A;  5BR8 K;  2QA4 N;  3KKR A;  2B6A A;  1BIU A;  1ZBS A;  3V9U A;  1TGO A;  1O1W A;  1JL2 A;  3K9K A;  4LF5 K;  3ZX0 A;  4A59 A;  4DV5 K;  3ZYY X;  1JJ2 M;  2G8U A;  2W00 A;  4YDU C;  3F9K A;  1WOQ A;  4FW2 A;  5AQN A;  4Z4I A;  3OS2 A;  3IRX A;  1IV0 A;  2GTD A;  3PIO L;  1Z25 A;  1FW6 A;  1GLE G;  3BUZ B;  4CJP A;  3VGK A;  3QEP A;  3ZT1 A;  4B3T K;  2QK9 A;  1JLQ A;  2GV9 A;  3UKU A;  3CC2 N;  4CZI A;  1FKO A;  3QO9 A;  2P9P A;  5SWM A;  4LD0 A;  3VQ9 A;  3ZT0 A;  4M3T A;  2ZF5 O;  4G1Q A;  5AQX A;  4F3O A;  1HUX A;  3U9D A;  3J8A A;  3FE1 A;  3LZI A;  4DR3 K;  3I8B A;  4DV1 K;  4DTR A;  3AAP A;  1VQN N;  1ASV A;  3O08 A;  3V1O A;  2JGU A;  1KAY A;  1KFS A;  1BO5 O;  2E2O A;  4MQ3 A;  4JKD A;  5F0X A;  4NYN A;  5HRS A;  4AHU A;  1NGI A;  1RTD A;  1KAZ A;  2JLE A;  1NK5 A;  3DLL L;  3SJJ A;  1NBW A;  1SZ2 A;  3AVL A;  4E1N A;  4GNI A;  4N41 A;  1VSE A;  3SJH A;  1NMD A;  4CJU A;  1YXQ A;  4O55 A;  5ELZ A;  2PFU A;  3A2F A;  1VQ6 N;  4HVJ A;  4QS8 A;  3MX5 A;  2Q3S A;  1J5E K;  2KFN A;  2OPP A;  4HUE A;  4OPK A;  3DOK A;  3WXL A;  1TL1 A;  3CHW A;  3KVG A;  4U67 L;  3LDP A;  3VQ6 A;  1RBU A;  3SUN A;  3HTV A;  3AVB A;  1VQM N;  5K14 A;  3W3D A;  3HP6 A;  1WSG A;  1NMN A;  4YOX A;  2G8K A;  4LF7 K;  4X66 K;  1J53 A;  1P8Z A;  1GLD G;  3O5B A;  4NCG A;  5T7B A;  3NDK A;  1U49 A;  2ITG A;  4CHZ A;  4CEO A;  5KQD A;  4UQG A;  2PAV A;  1S3X A;  3CFP A;  4B08 A;  2FF6 A;  1GLB G;  3H46 O;  4DU3 A;  3NMU A;  3R8E A;  3VF4 A;  3I56 N;  4IJN A;  1CZB A;  4FL9 A;  2GWJ A;  1TAU A;  3VET A;  2VG5 A;  2RE2 A;  1D9F A;  3O4Q A;  1U04 A;  4B9Q A;  2O8E B;  3GE1 A;  1BQM A;  1IBK K;  2FLO A;  3R1X A;  2KHO A;  3O9Q A;  4BWM A;  5GAD P;  1KLN A;  4HCC A;  5BN8 A;  4OPJ A;  4BQL A;  3VOV A;  3MED A;  2DFH A;  3N4Q A;  1TKT A;  4DLG A;  3AVM A;  5B8H A;  3EN9 A;  3B6O A;  4DV4 K;  2V7Z A;  2YV0 X;  4DSF A;  2QWN A;  4FZX C;  5FDL A;  3VTI A;  2FSN A;  1TUU A;  4W5T A;  1YTA A;  1IG9 A;  3BF3 A;  3RMB A;  5JS2 A;  3NGY A;  3OYA A;  2FXU A;  4JKE A;  4WQ4 A;  4IOX A;  5J2M A;  4W5R A;  5AQS A;  3O4W A;  4Z4F A;  3MWT A;  1SL0 A;  3BDP A;  4Z94 A;  4NLB A;  3AGR A;  1T44 A;  1IKW A;  3TU5 A;  2D1K A;  1NK4 A;  4JI3 K;  2HMP A;  4DSI A;  4IWV A;  3ZEU B;  4FK0 A;  5BR9 A;  4BGA A;  3RVC A;  4DV3 K;  2E20 A;  4FWS A;  4FLU A;  1T7P A;  3OYC A;  2OTL N;  2ASO A;  2BUP A;  3HJF A;  4PHT X;  4W5N A;  1NNE A;  2E88 A;  5HP1 A;  3CD6 N;  5FPD A;  2E2Q A;  4FPA A;  3GBT A;  1ZXO A;  5HBM A;  4FJG A;  4FWM A;  5AFU A;  4B3S K;  3CJ7 A;  3TAE A;  2OA8 A;  4CJ7 A;  4IO8 A;  1U45 A;  3N4P A;  1RBT A;  5M1P A;  1LWE A;  1A5V A;  2RPI A;  3ITH A;  3LPU A;  3T7Z A;  1J6Z A;  3WEE B;  4U7B A;  3VA3 A;  4ID5 A;  2IGI A;  3OHR A;  1RCH A;  1HNZ K;  3AVJ A;  3MN6 A;  2XY6 A;  4N56 A;  1GLA G;  1FK9 A;  4AHS A;  3ZET B;  3THW B;  1YUW A;  2HBK A;  1QQC A;  3M8P A;  3D0P A;  4Y1D A;  1NGD A;  4CGF A;  3CM5 A;  3PX4 A;  3J81 O;  1JKH A;  5BRF A;  4CFD A;  5HRO A;  2YI1 A;  5LJV A;  1P90 A;  1KVC A;  3ENB A;  4DQS A;  5J2P A;  3OYD A;  3LL3 A;  3VEY A;  4X65 K;  4MFB A;  4JI4 K;  4B1V A;  2Q2R A;  1SS6 A;  4CK1 A;  1FJG K;  3TAQ A;  3VEV A;  1T03 A;  4EZ9 A;  1ZBF A;  4QCL A;  1X3M A;  4A5A A;  3HM9 A;  4LY7 A;  4CEF A; 
#chains in the Genus database with same CATH homology
 2ZGZ A;  2QXL A;  4WFA L;  2ZGY A;  3VEX A;  3CCE N;  2C1G A;  5AQH A;  1QQM A;  4IEE A;  2WUS A;  4EFH A;  2CGK A;  4FWL A;  2DPN A;  3QFU A;  4NO7 A;  3CCJ N;  3F2K A;  3FZL A;  2P9U B;  3LDO A;  4H0X B;  1HKG A;  3WEE A;  2FSJ A;  3DXK A;  2QWM A;  3LDQ A;  3I55 N;  3D7E O;  4ILH A;  5AQI A;  3MDQ A;  3CJA A;  3G71 N;  1NWK A;  4YOR A;  5AR0 A;  3L4Q A;  3GL1 A;  5AQU A;  4DB3 A;  5JLH A;  4B1X B;  1OVY A;  4JHD A;  4BC4 A;  5AZI A;  1NGJ A;  4BRD A;  3WXI A;  1ATR A;  4JKF A;  2AP1 A;  1BA0 A;  2Q97 A;  5BPN A;  2WC9 A;  3IFR A;  1JCE A;  2IIR A;  2QWL A;  4BG8 A;  3CCV N;  1W2B M;  1VQ7 N;  3T69 A;  4BR5 A;  1K9M O;  4PL8 A;  4JNE A;  4H0T B;  2NNW A;  2J4R A;  3ZX3 A;  5JMV A;  4GV9 A;  5BPM A;  1NGC A;  2WBN A;  2ZJP L;  3CCU N;  3EKS A;  3MX2 A;  4BC2 A;  2QM1 A;  4BR0 A;  3E9O A;  3CIP A;  5H1S Q;  2CGJ A;  3CME N;  4H5T A;  1YIT N;  4H0V B;  1G99 A;  4AM7 A;  5FPN A;  2NRH A;  3K9J A;  3ID6 A;  4IZ9 A;  3ZX2 A;  4RWT A;  3HOT A;  4ILG B;  3CCL N;  2I7N A;  2UYT A;  3FZF A;  3D6R A;  1NGA A;  3E9P A;  1V4T A;  3SMP A;  4YOY A;  5EOY A;  1YIJ N;  1BDG A;  1XQS C;  2P9N B;  3C7N A;  4YOU A;  3O8M A;  1JCG A;  2NRZ A;  3UE5 A;  2HOE A;  3W0L A;  1VQK N;  3VF6 A;  2IVP A;  1C0G A;  1RGI A;  1NGG A;  4L3Q A;  4CBU A;  3QML A;  4UY8 O;  3CCM N;  2E1Z A;  3IUC A;  4NB4 A;  2QW9 A;  2NRW A;  2V7Y A;  3E66 A;  3SAH A;  2YX6 A;  2A41 A;  3EO3 A;  3VPZ A;  4IFE A;  4DCH A;  1KD1 O;  3CJC A;  1GLC G;  3G25 A;  4HWI A;  3RSE A;  1Q86 O;  4EAH D;  5AQV A;  2CH5 A;  3UKR A;  2OAN A;  3FLC O;  5AZJ A;  1VAZ A;  4C1N K;  3P31 A;  3VGL A;  4WF9 L;  4BRG A;  3OW2 M;  2VYP A;  4KBO A;  1K8A O;  1V4S A;  2HF4 A;  1DT9 A;  5AQR A;  4CZF A;  1JCF A;  4WFN L;  1NLV A;  3GDQ A;  3CCS N;  3GG4 A;  4BR9 A;  5C15 A;  1YF5 L;  5AQL A;  3B8A X;  3HI0 A;  3DXK B;  5EXW A;  5AQP A;  4XEI A;  5EX5 A;  3H6E A;  4AM6 A;  1Q82 O;  4OPH A;  4MLH A;  3KZB A;  5GIO A;  4IO9 L;  1LCU A;  3WQT A;  1EQY A;  5GIN A;  4DKW A;  2EWS A;  2NRV A;  5CR4 A;  2I7P A;  2QWP A;  5AZI B;  5JIC A;  1YJW N;  3GOI A;  3R9P A;  2Q0R A;  5AFU H;  5M1N A;  4BR7 A;  2V52 B;  1VQ4 N;  4IXC A;  5AQW A;  4JEP A;  3NVK A;  3CXC M;  4H5V A;  5AQY A;  1IJJ A;  3O9S A;  3ATV A;  2HBM A;  1RFQ A;  4CI6 A;  2F9W A;  5BN9 A;  5F1X A;  4H5W A;  2P9N A;  1S22 A;  4BVP A;  2KLA A;  3WT0 A;  4BRC A;  4IJA A;  2ASM A;  3PLA A;  4CD3 A;  1X3N A;  4BRN A;  4BE7 B;  4XH5 A;  3VF2 A;  4XJX A;  3SLC A;  4BEB A;  1U2V B;  5M1K A;  5DM7 L;  3U8X A;  2A5X A;  2H3G X;  3O1W A;  3TPQ A;  2ASP A;  4CZL A;  1NM1 A;  1X9J A;  1NGE A;  3MN9 A;  4PL7 A;  5JLF A;  3H1Q A;  4CBW A;  3EE9 A;  5AQF A;  1MWM A;  4BRH A;  4JD2 A;  1QZ6 A;  3HRG A;  3SMS A;  4BGB A;  3QIC A;  2C1I A;  2QI2 A;  4FOI A;  4BR2 A;  2A6A A;  1ATN A;  5GAG P;  3EL2 A;  2ZJR L;  4R79 A;  1R59 O;  2BH1 A;  2WFB A;  3E9L A;  4ISG A;  3IMX A;  3CPW M;  3CCR N;  3VGM A;  4CZE A;  1S72 N;  1GLL O;  2HST A;  2ITM A;  4BRA A;  3CER A;  3MN5 A;  1W97 L;  3MK6 A;  3AY9 A;  2Q36 A;  4FWK A;  4CZM A;  2P9I B;  3VEN A;  3S41 A;  4BG9 A;  1YJ9 N;  3AGK A;  4A62 A;  4JKB A;  4FSV A;  2YJE A;  3FGU A;  2IVO A;  5EVZ A;  3QB0 A;  2YHX A;  3RSE B;  3SK3 A;  3MCP A;  3H1V X;  4FPB A;  3H3N O;  4B1U B;  3UKR B;  5AZJ B;  1MA9 B;  1TYQ B;  5TKW A;  4M63 C;  5M1O A;  3PIP L;  3L0Q A;  3MN7 A;  4OPA A;  4GY2 B;  2D0O A;  3QDK A;  4MLE A;  4BQZ A;  1XUP O;  3L6Q A;  3G6E N;  1DKG D;  1HJO A;  2NRR A;  5AQT A;  3R3L A;  2QWQ A;  3ENO A;  1YAG A;  5TKY A;  4BY9 C;  4B1W B;  3TSU A;  3TSQ A;  3HM8 A;  4H0O A;  5BRE A;  2QWR A;  4K43 A;  3VES A;  2QA4 N;  4FWP A;  2A42 A;  2VGN A;  1T3V A;  4O5F A;  3IDH A;  1ZBS A;  3P38 A;  2V51 B;  2E2N A;  1U2V A;  4JN4 A;  3K9K A;  4A57 A;  3ZX0 A;  3H45 C;  5E84 A;  4A59 A;  4FOE A;  3ZYY X;  3CI5 A;  4CBX A;  4E1J A;  1JJ2 M;  2W00 A;  2ZWH A;  3Q7B A;  4B1Z A;  3O9R A;  4YDU C;  4WQ4 C;  1WOQ A;  4MO4 A;  5AQN A;  1QVG M;  1CZA N;  1ILY A;  3O9T A;  3U9Z A;  4I6M B;  1VQP N;  5AQG A;  2GTD A;  3G4S N;  3F5T A;  4ISF A;  1LOT B;  3AAQ A;  2GEL A;  3PIO L;  2Q0U A;  5FPE A;  1GLE G;  3BUZ B;  3NVM A;  4CZH A;  2JWK A;  3VGK A;  4CD1 A;  1GLJ O;  4AF1 A;  3OBW A;  3QBW A;  2W41 A;  3UKU A;  2P9I A;  3LDL A;  3CC2 N;  4JD2 B;  1KXP A;  1ATS A;  2NZT A;  4CZI A;  1QVF M;  2P9P A;  1EO1 A;  1VQ9 N;  2ZF5 O;  4Y0W A;  3FZM A;  3JS6 A;  5AQX A;  4EIA A;  1HUX A;  2NRT A;  4FWO A;  3U9D A;  3J8A A;  3FE1 A;  3D2E B;  2VWB A;  1TYQ A;  5LY3 A;  3I8B A;  3KWI A;  3AAP A;  2YHY A;  1VQN N;  3H3O B;  2YCH A;  3O08 A;  4H5N A;  1WUA A;  5CE3 A;  1HX1 A;  1KAY A;  1QQO A;  1BO5 O;  1QHA A;  2E2O A;  4JKD A;  3VMF B;  5F0X A;  4C23 A;  1NGI A;  2FF3 B;  3M3Z A;  4BRM A;  3D2F B;  3HBT A;  1KAZ A;  3F9M A;  5HOO A;  4A5B A;  4NLC A;  3DLL L;  4MDB A;  1NBW A;  1SZ2 A;  3KWG A;  1N8R O;  3A8Y A;  4JK9 A;  4GNI A;  3WXJ A;  3OA9 A;  4BC5 A;  4LC9 B;  5E26 A;  1Z05 A;  3SJH A;  2Q1N A;  1NMD A;  1D4X A;  1YXQ A;  2D0P A;  3C6A A;  5ELZ A;  1Q7Y O;  3TTF A;  2QWO A;  5M1Q A;  5C2F A;  2PFU A;  4BRQ A;  1VQ6 N;  1NGB A;  4I6M A;  4BRE A;  4IDH A;  5GAE P;  3A5O C;  2AA4 A;  2A3Z A;  4QS8 A;  4H03 B;  3MX5 A;  4WFB L;  2RHK A;  3MMV A;  1HKB A;  3CQX A;  4JKH A;  5BRD A;  3E1Y A;  2HF3 A;  4F9O A;  3CJ1 A;  4K41 A;  3WXL A;  4XH1 A;  4JKG A;  3CMA N;  3KK7 A;  4YOV A;  2NRX A;  3CHW A;  5AQZ A;  4WQ5 C;  1K8K A;  1MWK A;  3KVG A;  4U67 L;  1HKC A;  1SQK A;  3LDP A;  3ID8 A;  1QQN A;  2F9T A;  3A5N C;  2P9L A;  1E4F T;  3HTV A;  1VQM N;  3VEW A;  3DWL A;  5C12 A;  2VGM A;  2F7T A;  3D2E A;  1OKJ A;  2W40 A;  4JK8 A;  2FSK A;  5I9E B;  3ZEU A;  3W3D A;  1T6D A;  5AQJ A;  4RCH A;  5ADX H;  4YOX A;  2BTF A;  2CH6 A;  5AQO A;  1P8Z A;  1GLD G;  3M5R A;  3O5B A;  2ZJQ L;  3UKU B;  1T6C A;  4FWR A;  2Q31 A;  3WQU A;  2E1Y A;  4XH4 A;  4H0Y B;  3VER A;  3U4L A;  5KQD A;  2P9P B;  5GIP A;  4C1N I;  2E2P A;  4PKI A;  2YHW A;  3D2F A;  3FZH A;  4MDA A;  5M1F A;  4EHT A;  3FFK B;  1XC3 A;  1YI2 N;  1IG8 A;  1NJI O;  4EHU A;  3DJC A;  2P9K B;  3M6G A;  2PAV A;  1S3X A;  1KQS M;  2FF6 A;  1GLB G;  3TTD A;  3H46 O;  3UB5 A;  5KPR A;  4BRF A;  1QZ5 A;  1RDW X;  5FPM A;  3NMU A;  4QS7 A;  3R8E A;  3VF4 A;  3I56 N;  4O8K A;  4K25 A;  3MCA B;  4FL9 A;  3O9U A;  2GWJ A;  4IJN A;  3O1B A;  1E4G T;  3VET A;  2QTD A;  4PKG A;  3DAW A;  4YOW A;  1BG3 A;  2RE2 A;  3A5L C;  2E8A A;  5KPZ A;  3CC7 N;  1U6Z A;  1MDU B;  3CET A;  3J7Z O;  4ILJ A;  4B9Q A;  3GE1 A;  2PBD A;  5DM6 L;  1Z6R A;  3CJB A;  3BF1 A;  4JKC A;  2FLO A;  5BPL A;  1M1K O;  3R1X A;  2KHO A;  3O9Q A;  1K73 O;  4M7Y A;  5GAD P;  4GVE A;  5LJW A;  5BN8 A;  3WXM B;  4BQL A;  3JXU A;  5CHI A;  4QS9 A;  1NGF A;  3VOV A;  3ZET A;  4B1Y B;  3HSC A;  3N4Q A;  2P9S B;  1ESV A;  1YVN A;  5B8H A;  2VCP A;  3EN9 A;  4KH4 A;  4MO5 A;  2HBJ A;  4BRI A;  4CZG A;  1DGK N;  2V7Z A;  3I33 A;  1Y64 A;  2CGL A;  2QWN A;  1HPM A;  4WCE L;  4BRL A;  1NGH A;  2JWL A;  2A40 A;  3EZW A;  3C6H A;  3VTI A;  1YHQ N;  2QEX N;  3CCQ N;  2FSN A;  1TUU A;  5C2D A;  3BF3 A;  3DXM B;  5BRH A;  3VEZ A;  4YDU A;  2FXU A;  4JKE A;  3CPE A;  4WQ4 A;  5AQK A;  3ULE B;  4IOX A;  4IOC L;  4BEC A;  5AQS A;  4A61 A;  4JKG B;  3O4W A;  1O13 A;  3MWT A;  4O8U A;  3CQY A;  4BC3 A;  1K8K B;  3LM2 A;  4YOT A;  5GAH P;  4FWN A;  4Z94 A;  5AQQ A;  4NLB A;  3P4I A;  1VQ5 N;  3A0I X;  3AGR A;  1T44 A;  2P9L B;  3OBY A;  3R6M A;  3TU5 A;  2OTJ N;  2D1K A;  2P9K A;  3KHY A;  3QFP A;  1ZC6 A;  2HMP A;  4ISE A;  4IWV A;  3ZEU B;  1VQO N;  3BP8 A;  4BGA A;  2D4W A;  5BR9 A;  1DEJ A;  3RVC A;  2E20 A;  3CJ9 A;  4FWS A;  3SAF A;  4BR4 A;  2GWK A;  5AQM A;  2OTL N;  2ASO A;  3C65 A;  2BUP A;  3TTC A;  4PHT X;  3VTH A;  1BUP A;  5HL7 L;  3MWP A;  2E88 A;  4JKA A;  2P9U A;  5KPT A;  1RDU A;  3CD6 N;  3SAG A;  2GUP A;  1HLU A;  2GX9 A;  4CZJ A;  5FPD A;  4GV6 A;  1GLF O;  1KC8 O;  4BRP A;  1YJN N;  2YJF A;  2E2Q A;  3A5M C;  4FPA A;  3WXK A;  3GBT A;  4DQ8 A;  4G9Z A;  4HTL A;  1ZXO A;  4FWM A;  5AFU A;  3CJ7 A;  3SBG A;  4BRK A;  4CJ7 A;  4A2A A;  2P9S A;  4IO8 A;  4PKH A;  5MLC Q;  1BU6 O;  4K42 A;  1VQL N;  4GV3 A;  3N4P A;  5M1P A;  5F2R A;  3T7Z A;  1J6Z A;  3WEE B;  5JVH L;  1BWF O;  3ENH A;  4U7B A;  3EE8 A;  4BRO A;  3LDN A;  3QBX A;  3OHR A;  3BEX A;  4JAX A;  4KH5 A;  4J8F A;  3O80 A;  4A2B A;  3DXM A;  3MN6 A;  1BOT O;  2HBL A;  3SBT A;  3ULE A;  1GLA G;  3HOS A;  3ZET B;  3HZ6 A;  4JHD B;  3M1F A;  5JVG L;  1YUW A;  2HBK A;  1C0F A;  1SAZ A;  2IVN A;  3O6W A;  4FVU A;  1BA1 A;  3FR0 A;  5C10 A;  3FZK A;  4IOA L;  4IEI A;  4JK7 A;  4DHY A;  4FO0 A;  1NGD A;  4CZK A;  5BRF A;  3C0B A;  3Q7C A;  1TUY A;  2YI1 A;  4BVO A;  4WQ5 A;  5KQ8 A;  5LJV A;  3WUH A;  5ADX A;  1P90 A;  3TSP A;  4H0P A;  4WYB A;  1M90 O;  1KAX A;  3ENB A;  3L4I A;  4H5R A;  3CC4 N;  2KKZ A;  1H1V A;  3ATU A;  3CF5 L;  3EKU A;  3LL3 A;  3VEY A;  3LM9 A;  2NLX A;  2GEM A;  3P39 A;  4B1V A;  2Q2R A;  5EY4 A;  1SS6 A;  4OO1 J;  4FWQ A;  4M7X A;  5C0Y A;  1VQ8 N;  4KH6 A;  4RTF D;  3C7N B;  3VEV A;  3VEO A;  1Q81 O;  3IKM A;  1X3M A;  4A5A A;  1Q18 A;  3AAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...