1YAGA

Structure of the yeast actin-human gelsolin segment 1 complex
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
372
structure length
372
Chain Sequence
EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords PROTEIN (ACTIN)
publication title The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 1998-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1yagA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yagA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yagA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1yagA04
1SAZA 5JLFA 3EN9A 1KXPA 3MDQA 1WOQA 3R9PA 3AAPA 4K42A 4CD3A 4GY2B 4JAXA 4XH4A 5ADXA 4BC4A 5AZIB 1P8ZA 3W3DA 3FGUA 1R59O 3H46O 4CZLA 4F9OA 4C23A 1K8KA 1X3MA 1NGBA 3CJ1A 1JCEA 1Z05A 3VF6A 4BVOA 3SJHA 5B8HA 5LJVA 3GBTA 3LDOA 2P9KB 3AY9A 5AQYA 4I6MB 3CJCA 1NGEA 1E4FT 1HKBA 3KVGA 1C0GA 3FZFA 5AZJA 1NWKA 2P9SA 3U4LA 3HTVA 4B9QA 4B1ZA 5EOYA 2P9IA 1SZ2A 5AFUA 4PKGA 3O1BA 3HZ6A 4BRDA 1X9JA 1Q18A 3WQUA 3GOIA 5AQRA 5JMVA 2E1YA 4B1WB 4CZIA 2YI1A 1NBWA 1GLCG 3G25A 3ZX3A 3CHWA 2E2NA 3D7EO 2P9LB 1TUYA 2V51B 1GLEG 4BR4A 2IVNA 4H0TB 5TKYA 1XUPO 1QQMA 4AM6A 5AQFA 4BRFA 2BTFA 5AQNA 4B1YB 4WQ4C 4DQ8A 4BR7A 2GWKA 3A5NC 2I7NA 3A5LC 4EHTA 2A3ZA 1NGDA 3VGMA 1HKGA 4DHYA 4Z94A 4CZKA 1BA0A 4B1XB 4FOEA 2YCHA 3WT0A 5JICA 4FWMA 3ZEUA 2E2PA 4BRHA 3DXMB 4JD2B 1HPMA 4FWNA 4BC3A 5F0XA 2VYPA 2IIRA 3KZBA 3MCPA 1T6CA 4H03B 2FSJA 2YJEA 3CQXA 2E2OA 3EZWA 4JN4A 3DXKA 4K43A 3QICA 1RGIA 5AQWA 1NM1A 4M7XA 1QZ6A 3GG4A 2VWBA 4A61A 2BUPA 4QS9A 4FWSA 4FWLA 1H1VA 1ESVA 2Q0RA 5AQUA 4CJ7A 3A0IX 4BGBA 5BN8A 3RSEA 2P9PA 2Q97A 3UKUB 4AM7A 1NGAA 3B8AX 4H0PA 3VEXA 4XH1A 3DWLA 2NZTA 4E1JA 4BRQA 5AQHA 1ATSA 3JXUA 5AQJA 1ZBSA 5AZIA 5AQQA 2E8AA 5FPDA 1BWFO 3WXJA 1NGCA 2ZWHA 4CBUA 3AARA 1HX1A 4I6MA 4L3QA 5BPNA 2CGLA 5E84A 4WYBA 1TYQB 1MA9B 1DKGD 2CH5A 3LDNA 3I33A 3FZLA 1HJOA 4CZMA 2W40A 4H5VA 5KPZA 3WXLA 3O8MA 2QWPA 3H45C 2A6AA 1QQOA 1GLAG 4GNIA 5AQMA 2CH6A 2UYTA 3VPZA 4EAHD 5KPTA 2I7PA 1GLDG 3I8BA 2P9LA 1NGIA 5KPRA 4J8FA 4WQ5A 3ENOA 4BROA 2QWLA 4H5WA 3VERA 2HOEA 1TUUA 3JS6A 5AQVA 4JHDB 3IDHA 3VEOA 4CBWA 1C0FA 1MWMA 1YXQA 3EKUA 4RWTA 1QQNA 4BRAA 3QMLA 3HI0A 2A41A 2VCPA 4O5FA 4H0YB 2NRHA 1IJJA 3FZMA 1NGJA 3WXKA 4H5TA 3O4WA 1WUAA 3A5OC 3FE1A 3QFUA 4IXCA 1YUWA 5BPMA 4CBXA 5AQPA 2ITMA 2FSNA 4JD2A 4H0XB 4KBOA 3ZX0A 1IG8A 3VETA 2E1ZA 2Q36A 1HUXA 2ZGYA 1BDGA 2FF3B 4ISGA 5FPEA 4A2BA 5I9EB 4H0VB 3LM2A 4BG9A 2AP1A 4BQLA 2F9TA 3M1FA 4M7YA 1RDWX 2D0OA 4CZFA 3MN6A 3KHYA 2QWQA 1J6ZA 4H0OA 2A40A 2OANA 3MN7A 3O1WA 3QFPA 4MLHA 4BR0A 3D2EB 3WQTA 3BEXA 4BR9A 2Q31A 3O08A 3GL1A 1S3XA 2Q0UA 2Q1NA 4FWRA 3QDKA 1S22A 2QWRA 3VEVA 3TPQA 4BGAA 2F9WA 4A62A 4BRPA 5KQ8A 4B1VA 1BOTO 3BP8A 3M3ZA 3U9ZA 3IFRA 3HM8A 1BUPA 4HTLA 2NLXA 3L4IA 3EO3A 5FPNA 4RCHA 3SLCA 2FF6A 1EQYA 2QW9A 3C7NB 2D1KA 3CQYA 1TYQA 3H6EA 3H3NO 5LY3A 2A42A 5AQIA 4FSVA 1U2VA 3IMXA 3L6QA 4MLEA 3MN5A 4BRMA 3FZHA 3R8EA 4DB3A 2HF4A 3CJAA 3D2FB 3BF1A 4BR5A 5KQDA 5EXWA 3U9DA 3P4IA 2DPNA 3VF2A 3ZETB 3BF3A 4IO8A 3OHRA 4IJAA 5BN9A 3TU5A 4PL7A 2D0PA 3MMVA 1ZC6A 2YJFA 2PAVA 2P9KA 1Z6RA 3ID8A 5EX5A 3VOVA 4FWKA 4ISEA 4BRKA 5BREA 4CZHA 2V7YA 3GDQA 1LCUA 1ATNA 2E2QA 4O8KA 5LJWA 2YHWA 4JHDA 2QWOA 1NMDA 1HKCA 1BG3A 4PKIA 3BUZB 4WQ4A 4HWIA 4A2AA 3H3OB 3MK6A 1ATRA 3CJ7A 3CJ9A 5AQLA 3U8XA 4FWOA 1MWKA 4ISFA 3UKRB 1OKJA 2W41A 3H1VX 3VF4A 2H3GX 2YHYA 3LDLA 5CE3A 1GLBG 2EWSA 2V52B 5AR0A 4DCHA 2HF3A 1V4SA 2P9UB 3A8YA 4FWQA 5ADXH 2FXUA 2GUPA 2KHOA 2GEMA 5AQKA 4IWVA 5ELZA 3S41A 2P9NB 1BO5O 3O80A 4XEIA 4NB4A 4YDUC 5F1XA 4CD1A 5AQXA 1JCFA 2QM1A 5BRDA 3WUHA 1GLFO 1XC3A 2ASOA 2FSKA 3FLCO 3WEEB 1RFQA 5AQGA 3VGKA 4BREA 1QHAA 1NGHA 4CZEA 3EKSA 1LOTB 4EFHA 3D2EA 5AFUH 4K25A 2IVPA 3DXMA 3ULEB 1KAYA 3LDQA 3FR0A 3CETA 4JNEA 3VENA 3J8AA 5BPLA 2E88A 2ASPA 4Y0WA 1X3NA 3QBWA 1GLJO 3ATVA 3CI5A 3GE1A 4B1UB 1JCGA 4IZ9A 1K8KB 5AQTA 2YHXA 4FOIA 4FPAA 2WUSA 2CGKA 3C7NA 3UB5A 3H1QA 1D4XA 1KAXA 3CIPA 4EHUA 5AQZA 5AZJB 2QWNA 2P9SB 3QB0A 2QXLA 4H5NA 5JLHA 1DEJA 3UKUA 2P9IB 3LL3A 4QS8A 3D2FA 1V4TA 3LM9A 5AQOA 3VEYA 4H5RA 1NGGA 3ZETA 4BRIA 4FL9A 3QBXA 1G99A 3CERA 4NO7A 3W0LA 4CZGA 2PBDA 4BR2A 3FZKA 4PKHA 1BA1A 4PL8A 3DAWA 4WQ5C 1T6DA 4BVPA 1CZAN 1T44A 1HLUA 1QZ5A 4XH5A 3DJCA 4BG8A 2FLOA 1BU6O 3LDPA 1U6ZA 3O6WA 5EVZA 1DGKN 3HSCA 1SQKA 1NLVA 3VGLA 1KAZA 2ASMA 2D4WA 3VEWA 1GLLO 4YDUA 4FO0A 2CGJA 5BRFA 2A5XA 2AA4A 3UKRA 4K41A 2GWJA 5EY4A 3FFKB 5BR9A 3CJBA 1XQSC 3ZX2A 3IUCA 3WXIA 4CZJA 2ZF5O 3ZEUB 1YAGA 2V7ZA 3AAQA 3VESA 2P9UA 3M6GA 4FWPA 4BRCA 5BRHA 5E26A 4QS7A 1YVNA 4BRNA 3ATUA 4BC5A 5F2RA 2ZGZA 4BQZA 2P9NA 3EL2A 4RTFD 3R6MA 4LC9B 2E20A 3SMPA 2HMPA 1NGFA 3C0BA 5FPMA 3DXKB 5AQSA 4BRGA 4MO4A 4BRLA 4MO5A 1Y64A 3F9MA 4M63C 3L0QA 2GELA 4IJNA 4BC2A 3WEEA 3UE5A 2QWMA 1MDUB 1ZXOA 3HBTA 4FPBA 4CI6A 4EIAA 2Q2RA 3VEZA 2IVOA 3A5MC 1U2VB 1E4GT 3RSEB 3ULEA 2P9PB 3MN9A 2GTDA 3SK3A 3SMSA 3ENHA 3O5BA 2J4RA
chains in the Genus database with same CATH superfamily
1HNIA 5JLFA 4DSLA 3MDQA 3R9PA 2B4JA 4CD3A 5HROA 4JAXA 3IKMA 3VN5A 1R59O 3H46O 4CZLA 4F9OA 1SKWA 2W6LA 4BVOA 5B8HA 3HPGA 2VWJA 1O1WA 2AJQA 2X78A 4W5TA 1S9GA 1RCHA 3CJCA 5JVHL 3SYZA 3KVGA 3FZFA 5AZJA 4IEEA 2F4VK 4CJLA 5EOYA 2P5OA 3WNEA 3KLFA 4JYAK 2HBKA 4J2AA 1QTMA 3O1BA 2UXCK 5GINA 3PIPL 4F4KA 3KWGA 3ULDA 4CEAA 1BI4B 1EXQA 1Q18A 1KRPA 2YI1A 1UOCA 4CF1A 2IDOA 4JKEA 5CY4A 3CHWA 2E2NA 4DR5K 1KVBA 5C42A 1N6QA 4BR4A 3CFPA 4DSEA 2ZJRL 5LMUK 1HNWK 2VGNA 3CCUN 1XHXA 4JI5K 4AM6A 1RDDA 3CCMN 4BRFA 2BTFA 3THYB 4B3RK 4WQ4C 1JLCA 4Q5VA 4C8KA 4DR1K 3V9ZA 2GWKA 3K5OA 1Q9XA 2I7NA 1P90A 3LPTA 1QS4A 3VGMA 3Q7BA 3DLEA 1TVRA 4FWMA 4IBNA 4DTXA 4FWNA 2FBVA 4JKGA 2VYPA 3MCPA 1NK8A 3DRPA 4H03B 4KO0A 1KFSA 2YJEA 5M1OA 3QICA 3DYAA 4Z4FA 4LY7A 3GG4A 3DLRA 1GOCA 1WSHA 3SUOA 1NK0A 4FWSA 1ESVA 1BL3A 5AQUA 3AVJA 1VQLN 3UKUB 4H4OA 4FLYA 1N5YA 1JLFA 4JRQA 4XH1A 2NZTA 3PX4A 1M90O 3SUNA 1ZYQA 2KTQA 4MFBA 1Q7YO 1ZBSA 5AZIA 4X66K 1TAUA 4QOZB 2E8AA 3WXJA 1NGCA 3U3GA 3THVA 4EZ9A 3B6PA 4KH5A 3E9PA 5M1PA 3CPEA 4I6MA 4M3UA 4HUGA 1MA9B 2CH5A 3LDNA 5HRNA 4DKWA 1HJOA 3C6AA 3L3VA 1S1VA 2DFFA 1XC9A 3K5LA 1HQEA 3KWIA 3P39A 4PQUA 3N4PA 3P38A 5CZ1A 1GLAG 5AQMA 3HRGA 4KREA 4E1NA 4KRFA 4LF8K 2KZMA 2P9LA 3RMDA 1SKSA 4BROA 3SV3A 3G0ZA 1UAXA 4H5WA 3VERA 1M1KO 4YOTA 3IDHA 1VK0A 4JK7A 1C0FA 1MWMA 1CXQA 3DOKA 3O9UA 1QQNA 4DTNA 3QMLA 4DTRA 3ID6A 2A41A 4OX9K 2IGIA 3ZSOA 4YFUA 3FZMA 5IT9O 2QKKA 1NGJA 3SQ0A 2NNWA 5HL7L 4DWIA 3HP9A 5BPMA 3CQ8A 4JD2A 4KBOA 1NG9A 3ZX0A 4HUFA 3VETA 4IG3A 1HUXA 3OYBA 2HBMA 2O8EA 2FBTA 4KH6A 3OYGA 3LM2A 2JWLA 3CCRN 4F2RA 4CEZA 5FDLA 3QLHA 1JJ2M 3ZT3A 1VHXA 3KHYA 2QWQA 4H0OA 3ZSYA 3Q7CA 2KFNA 3O1WA 4WFBL 1TK8A 3D2EB 3TTCA 4DFPA 5J1EA 1S3XA 4FWRA 4CIGA 3ASMA 5KQ8A 5C2DA 4Y1CA 3QNNA 1VQ7N 1Z26A 2NLXA 4OLBA 3V1QA 2G8KA 1IBKK 3MAQA 1EQYA 5HRRA 4KB0A 4FW2A 2VG6A 3SUQA 4CF0A 4FSVA 1U2VA 1BCOA 3CF5L 4HVJA 2HF4A 1IBLK 3D2FB 2X6SA 3CCVN 3BDPA 3OHRA 4IJAA 1J9AA 1N36K 4R79A 3SUPA 1ZC6A 2YJFA 1VQPN 2P9KA 1Z6RA 3VOVA 4FLUA 4A59A 4CZHA 2V7YA 1LCUA 4DLEA 4E7HA 4O8KA 5LJWA 3CCSN 3F9KA 2FBYA 1NMDA 3P83D 1JXBA 4WF9L 3LAMA 4WQ4A 4HWIA 3DLKA 4Z0UA 2HB5A 1S1UA 3CJ7A 4CW7B 1MWKA 4DV2K 1OKJA 5C10A 5DM6L 5CE3A 1IG9A 3OYFA 2P9UB 1WAFA 3CM6A 2FXUA 2GUPA 2KHOA 3VQQA 1T8EA 3M5RA 3T1YK 4KHWA 2P9NB 4R5PA 1WSGA 4LSLA 4NB4A 2QXFA 4XJXA 1YI2N 4Z4EA 1SL2A 1XC3A 2ASOA 3FLCO 4I2PA 5AQGA 4CGGA 5JVGL 5C12A 1W9HA 3V81A 4EFHA 4FVUA 3OJUA 1RBUA 3KIOA 3ULEB 4L8RB 3AVKA 1KAYA 1LWCA 4CJUA 1VSKA 5KRTA 4E89A 3SCXA 2HHUA 4C1NK 5FRNA 4CJ4A 4DR3K 4DV4K 3RR8A 3PX6A 3RMAA 3NE6A 3HYFA 4B1UB 2OPPA 1B9FA 2D0BA 3R3LA 3OTOK 3MXJA 4Z4HA 5JS2A 1TKDA 3K0SA 3C7NA 1QVGM 3H1QA 4X64K 1KAXA 1KCFA 5AQZA 3THWB 3QB0A 1DEJA 2HBJA 4AHUA 1A5VA 5AQOA 3VEYA 3QBXA 1G99A 3ZSXA 3CERA 5IWAK 2OA8A 1C1BA 4FJNA 3AO5A 5KGWA 4PL8A 4WQ5C 4EP4A 1CZAN 3O9SA 1Q81O 1WSIA 4XH5A 4AHCA 2D5RA 5EVZA 1ZBLA 3V9WA 4LF6K 4ILJA 3VGLA 1KTQA 4OKKA 4KI4A 3PSFA 1WBBA 1RT2A 4RW7A 4FO0A 5BRFA 2A5XA 2AA4A 4JK8A 4DV0K 4B8CA 3HO1A 3D0PA 3HVTA 1W0HA 3UKRA 2OTLN 3M8RA 5EY4A 4BE2A 4QAGA 1XMOK 4Z4GA 4CZJA 3ZSRA 3ZEUB 1YAGA 3AAQA 4FWPA 3QERA 4C8LA 4CEFA 3DRRA 4QS7A 1YVNA 2ZGZA 5C0YA 1QSSA 3OYEA 1X1PA 4DR4K 2E20A 2HMPA 3DXKB 3AO3A 1Y64A 4MO5A 4IOAL 2UXDK 4M63C 5J2QA 3L0QA 4IJNA 1T03A 4F3OA 3UE5A 3O4NA 2QWMA 3HBTA 2IS3A 5EU7A 4CJKA 2Y1JA 1KVAA 4CJRA 2RHKA 1U2VB 3MN9A 4MDAA 2GTDA 2QKBA 4K42A 3ENHA 1G15A 3O5BA 4FZYA 2J4RA 1Y97A 1KXPA 3V9SA 3OVNA 2D0CA 4YHHK 3AAPA 4F8RA 5ADXA 2G8WA 4BC4A 1IO2A 3HL8A 1J5OA 1IKXA 3W3DA 4CJPA 5GAHP 3OYCA 1NOZA 1TKXA 4C23A 1NGBA 3NVMA 1ASUA 1JCEA 4JI1K 4FM1A 3TAEA 3GBTA 3QESA 2P9KB 3AY9A 5AJ3K 1NU0A 4MDBA 4RW8A 2KZZA 1E4FT 4YY3K 1QVFM 3HTVA 3AVGA 1K73O 1NK7A 1RT1A 1I94K 3IS9A 2P9IA 1HYVA 3SPZA 1SZ2A 1JL1A 5AFUA 4B9TA 4BRDA 4AILC 1TK5A 1X9JA 3PLAA 5AQRA 2PYLA 3OS0A 4CZIA 1NBWA 4FJ8A 1GLCG 3RMBA 1WSFA 1FJGK 4GVEA 3ZX3A 3D7EO 1TUYA 2V51B 4GMJB 4YORA 4DU1A 4QCLA 4H0TB 1K6YA 1NK9A 1Q9YA 5CZ2A 2ZQBA 3ZT2A 1RBSA 1QQMA 2BE2A 2KLAA 2GUIA 5AQFA 3SBGA 4B1YB 4DQ8A 4BR7A 4CIEA 1XI1A 3ZLJA 3A5NC 4N47A 3A5LC 4EHTA 4RG8A 1NGDA 4OGCA 4B9UA 4B8AB 4FOEA 3CCJN 4DR6K 2O8FB 4DQQA 1EP4A 3WT0A 2E2PA 3SQ4A 2O8DA 4BC3A 4KHPK 4JLHA 2IIRA 3IAYA 1IBMK 4DR2K 3N4QA 4DTUA 2E2OA 3EZWA 3VQPA 1NK5A 4HCBA 2WONA 4M7XA 5K14A 2P5GA 4OJRA 1JXEA 4DFMA 4FWLA 4CJ7A 5BN8A 3RSEA 1WAJA 5C2FA 1BQNA 4FYDA 2W6KA 4AM7A 1NGAA 4KH4A 4O4GA 3LWLA 4RW4A 3DWLA 1YJWN 1HJRA 1ATSA 3VQAA 5AQJA 1U47A 4CGHA 4FJKA 4ZTJA 4U67L 2O8BB 1JLBA 2UU9K 4KKOA 4M3RA 2DY4A 1JLAA 1NK6A 2ETJA 1KD1O 2RN2A 4WYBA 1DKGD 2YHBA 3FZLA 4E72A 4CJEA 4CZMA 4LF5K 4N5SA 3K57A 2YNFA 3JSMA 4PWDA 2BANA 3L8BA 3O8MA 2A6AA 3NCIA 1NKBA 1NJXA 4JKHA 2UYTA 4KV8A 4EAHD 3O3FA 4DUYK 2I7PA 3VTIA 4ELUA 5KPRA 3NF9A 4WQ5A 3CMAN 3O9TA 4FJ7A 3VQBA 1E3MA 3JS6A 3VA0A 3V4IA 1ZBHA 4JHDB 2XY7A 4DG1A 4JI4K 4RWTA 4CJSA 4EP5A 2NRVA 1L3UA 4O5FA 2HNZA 4G1QA 4CF8A 4H0YB 4O8UA 1LAWA 1IJJA 1TL1A 1TL3A 1WUAA 1HNZK 4IXCA 3OW2M 1VQON 4KPYA 4AHRA 3OS1A 2ITMA 4LF7K 2RF2A 2E1ZA 3FFIA 1HNXK 3VQDA 4HCCA 4ISGA 5FPEA 4LFCK 4H0VB 3O3GA 4WE1A 4CF9A 3MWTA 3OJSA 4PA1A 3M1FA 4CZFA 3MN6A 3SQ2A 4JI7K 3NFAA 3I56N 2A40A 3MN7A 3P31A 1VAZA 3U3YA 3KKRA 4DMNA 4BR9A 3LDSA 1YITN 1W2BM 2Q0UA 4GKJK 1S22A 4BGAA 4OPAA 3TPQA 4B9SA 4A62A 3ZT1A 4FW1A 3BP8A 4LH5A 1U04A 2YHAA 1FXXA 1GOBA 1DLOA 4HTLA 2HSTA 3SLCA 4FCYA 3RRHA 3ZCMA 2C1GA 2YKNA 2FF6A 2QW9A 4DF8A 2WC9A 2D1KA 3CQYA 4FLWA 1TYQA 1VQ6N 3CCQN 3H3NO 2A42A 3O3HA 4M41A 4MLEA 3DI6A 1ZBIA 4BRMA 4DB3A 4E0DA 3HM9A 4BR5A 5EXWA 3ZSZA 3VF2A 3ZETB 1VQ8N 3CG7A 4IO8A 3ISNC 1T3VA 4DV6K 3TU5A 2XY6A 4JRPA 2NUBA 5EX5A 3H08A 4KB1A 4IDHA 3GDQA 4FJJA 1ATNA 1J54A 5KI6A 4LD0A 2E6MA 3MX5A 4DLGA 1BG3A 2EHGA 2IAJA 1C0UA 1YT3A 3V1OA 4A2AA 1D9FA 4FLTA 1CLQA 1EWRA 3WNFA 4DQIA 2VGMA 4BACA 2W41A 3VF4A 3LDLA 4M3XA 3VA3A 2V52B 4DCHA 4H8KA 3TAFA 2HF3A 3LPUA 1VQMN 4OGEA 3MECA 1BIZA 3EZ5A 3LWMA 3THXB 4AHTA 2GEMA 3U6FA 4IWVA 1BQMA 4CEBA 4B3TK 1BO5O 3O4QA 3C65A 5F1XA 3OYDA 3LALA 3MEDA 3VQ7A 4CD1A 2QM1A 2I5JA 1NKCA 3TAQA 4J2DA 4BECA 1GLFO 3CPWM 1S1WA 3K2PA 4OKJA 4Z4IA 3OYHA 3WEEB 3BY5A 4BREA 3NGZA 4CECA 4CZEA 3NBPA 3J7ZO 3M8PA 3DXMA 4BWMA 3QIPA 3LZIA 4DV1K 2E88A 2HNYA 3K59A 1RBTA 3QBWA 1GLJO 3ATVA 3CI5A 1TK0A 3GE1A 2XO7A 4IZ9A 4C1NI 3CCEN 3KK1A 4FOIA 4FPAA 4ZHRA 3L4QA 3LP1A 2CGKA 3AGRA 1XHZA 1D4XA 4FM0A 2JWKA 1RT7A 5AZJB 4H5NA 2O8CA 1TKTA 5C15A 3NF6A 1RBVA 1RBRA 1V4TA 3LM9A 2OTJN 3NH0A 4H5RA 2UUCK 4NO7A 4CZGA 2PBDA 1BA1A 4FK2A 4BVPA 1O13A 1T44A 1HLUA 1QZ5A 4CEOA 4IFEA 3DJCA 1JKHA 5LMNK 3LDPA 1U6ZA 4DTOA 4CHOA 5TKWA 4ID1A 4DV3K 1DGKN 3HSCA 4CFAA 1SQKA 1NLVA 1KAZA 3SAHA 2CGJA 1X9MA 2NRRA 4X62K 4K41A 5MLCQ 2E4LA 1LWEA 4FJ5A 3E9LA 1RDCA 3HOTA 2A1RA 3MEEA 5E26A 2WTUA 3ATUA 4CF2A 3QINA 4JKGB 4CEEA 3NH1A 2F8SA 3R6MA 4M3ZA 1NJWA 4IOCL 3C0BA 1B92A 3TARA 4MO4A 2W00A 1I3AA 2B5JA 2GELA 4K8ZA 1SL1A 4BC2A 1QE1A 5DMRA 1RTIA 1N8RO 4CI6A 1MDUB 1ZXOA 5GIOA 1EO1A 4EIAA 1X9SA 3VEZA 3AVIA 3C95A 2F96A 3SMSA 3SK3A 5GADP 3UB5A 1HYZA 1OVYA 3K9KA 1SV5A 1SAZA 4GW6A 3EN9A 2OZMA 1WOQA 3AA3A 4XH4A 3EE9A 1OH8A 5AZIB 1P8ZA 3S9HA 3TTFA 1B9DA 1K8KA 3E01A 3I0RA 3S3MA 3CJ1A 4KTWA 4B3OA 1Z05A 3VF6A 5LJVA 3LDOA 4RW6A 4CGDA 1BIUA 4I6MB 3NDKA 1NGEA 1HKBA 4FJIA 3AO4A 4ILHA 3OBWA 2P9SA 3U4LA 1WLJA 5HBMA 3L2VA 4IDKA 1LW2A 4H4MA 3CM5A 4BE7B 3AO1A 3HZ6A 3E1YA 4DS4A 3J7YP 3WQUA 3GOIA 3E9OA 1RNHA 3CYMA 4DSJA 5JMVA 2VWKA 1U48A 4LSNA 1WBDA 3ZSQA 2A1SA 2P9LB 3AVFA 3SI6A 1GLEG 4DF4A 1A5XA 1NNEA 4FJMA 1TKZA 3AA2A 2IVNA 3UIQA 3SNNA 5FLXO 3MXMA 3LZJA 1YTUA 1J53A 3KLHA 3HT3A 4BDPA 3HPOA 3AVMA 5AQNA 4OO1J 1ASVA 3HXMA 4F3TA 4BY9C 2HHWA 1RILA 1HKGA 4DHYA 4N56A 4KHUA 1BA0A 4CHYA 4B1XB 4KFBA 3RRGA 2YCHA 5JICA 2YNIA 4I9QA 2HHIA 4DS5A 1EETA 4BRHA 3DXMB 4JD2B 1HPMA 1QSLA 5F0XA 5DK5A 2O8EB 2FSJA 1I39A 4NCAA 4YOVA 4JN4A 4K43A 2YKMA 2Z1IA 4CJ3A 1QZ6A 4WFNL 3P1GA 4DV5K 3S3NA 2IC3A 2VWBA 4A61A 4KAZA 2BUPA 4QS9A 4DTMA 2UUAK 4DV7K 2Q0RA 3NHGA 1NJZA 3J7AP 4BGBA 2P9PA 1CZBA 2FBXA 2Q97A 4MQ3A 1ITGA 3B8AX 2VG7A 3VEXA 3TANA 5AQHA 5CHIA 3JXUA 4AHVA 1WSEA 2F7TA 5FPDA 3OYKA 3TAPA 4J2BA 2ZWHA 2HVHA 3AARA 1HX1A 4A57A 4DUZK 5BPNA 2CGLA 5E84A 1K8AO 1SS6A 1KC8O 4U7BA 4M3WA 3I33A 2B6AA 2QTDA 5GIPA 4O0JA 3JAMO 2C1IA 2WBNA 3WXLA 2BDPA 2LSNA 4DTPA 1BI4A 3CFRA 3VQEA 4CVNE 1YIJN 4GNIA 1CXUA 2CH6A 5KPTA 3K58A 1GLDG 1NGIA 4J8FA 4CGFA 3ENOA 4CE9A 4LH4A 3PO4A 2RKIA 1IV0A 2NRXA 4CHPA 2ZJPL 3THYA 2YX6A 2QK9A 3NGYA 1X9WA 3AO2A 1MU2A 4LF9K 3KD1E 3BGRA 3ENBA 4OPHA 3WXKA 1U49A 2VG5A 4H5TA 3O4WA 3FE1A 3CC4N 3QFUA 2ATQA 1YUWA 4CBXA 4B9VA 2DFEA 3OYIA 2Q36A 2RPIA 4NYNA 1BDGA 1LWFA 4A2BA 5I9EB 5DM7L 4CGIA 4OLAA 4BG9A 1IKYA 4LFBK 4BQLA 2F9TA 1RDWX 1ZBUA 4NLBA 3RVCA 1HR0K 2JLEA 2OANA 5SWMA 4MLHA 4PUOA 2HW3A 3OYLA 3BEXA 5C24A 4X65K 3GL1A 2Q1NA 4IEIA 2QWRA 5E41A 4UY8O 1BHLA 2KFZA 4FJHA 4CERA 3WNHA 5I3UA 1U4BA 3M3ZA 3U9ZA 3IFRA 1UA1A 1S1TA 5KGXA 3I0SA 1W7AA 3L4IA 5FPNA 4RCHA 1CZ9A 3C7NB 3PX0A 4F2SA 1S9EA 4I7FA 3C6HA 3L2UA 3H6EA 3SAFA 5LY3A 4KTZA 3L2QA 3IMXA 3KLIA 3L6QA 2XY8A 4Q0BA 1KLMA 4JKFA 3FZHA 4IFVA 3CJAA 1XNRK 3PUFA 3MXIA 3U9DA 2DPNA 3BF3A 3LAKA 4IKFA 5M1QA 4BE1A 4NXNK 1L3SA 4PL7A 4W5OA 3D45A 5J2PA 1N33K 3RMCA 4O0IA 3F73A 4KHYA 2VQFK 4DU3A 4M3YA 2O4IA 3VMFB 3VTHA 4CFDA 3R1XA 5FRMA 1RTJA 5HRSA 2YHWA 3S5TA 1VRUA 4NCGA 2D0AA 1HKCA 3KTQA 2ZE2A 4NXMK 1TGOA 1YJNN 4CJQA 1TV6A 2XRIA 3KLGA 3MK6A 4CEQA 3OA9A 1ATRA 3CJ9A 1HYSA 1J5EK 3U8XA 4OPKA 4FWOA 3UKRB 4FJ9A 4O55A 1KFDA 2ZD1A 3EYZA 1YJ9N 5LL6Z 1Q8IA 5AR0A 4DQPA 4N41A 3L3UA 2GX9A 1V4SA 3AVNA 3A8YA 2HNDA 4DSIA 3RR7A 5ADXH 1ILYA 5AQKA 2OPQA 3S41A 4M42A 4IFYA 4UQGA 4CESA 3S3OA 2JGUA 5M1NA 4FJLA 1JCFA 5BRDA 3WUHA 3AA4A 3K5NA 2FSKA 1RFQA 2E5LK 3VGKA 4AQYK 1QHTA 1NGHA 1LOTB 3D2EA 5AFUH 4RW9A 3PSIA 3F2KA 3QEXA 2DTUA 3FR0A 4JNEA 3VENA 3J8AA 4Y1DA 4HUEA 5BR8K 1NKEA 4FK0A 4OPJA 2ASPA 4Y0WA 4K8XA 1RT4A 2F8TA 3ZT0A 1JCGA 2HHQA 5J2NA 5AQTA 3M8SA 1YVUA 2G8HA 4JKCA 1FKPA 1VRTA 3KD5E 3TAMA 4CJFA 4EHUA 2QWNA 4E7KA 3QEWA 2P9IB 1L5UA 3DMJA 4FLVA 3D2FA 1RTDA 4AF1A 4KHSA 4CJTA 2EX3A 3W0LA 1UA0A 4CK3A 3FZKA 4NLCA 1N32K 3V9XA 2GBZA 4JKDA 2PY5A 3HK2A 4KHQA 5CYMA 4FK4A 4DSFA 4BG8A 1JL2A 2NRZA 3EY1A 1VQ5N 4JI3K 3QNOA 3VQ6A 3O9RA 3EE8A 3O6WA 2YNGA 5HLFA 3D6RA 1GLLO 4YDUA 1WN7A 2VQEK 2UXBK 2X74A 5FROA 1VQ4N 4JI2K 3K5MA 3CJBA 2YNHA 3SPYA 5A2QO 3VESA 4CK2A 4CGJA 2P9UA 2P51A 3M6GA 4BRCA 5GAEP 3CC7N 3IG1A 1EKEA 1RDBA 2XHBA 4GV3A 1S72N 4BRNA 2O8DB 1L3VA 1S5JA 2Y1IA 3T1AA 3OYJA 4FLXA 2P9NA 3EL2A 2HBLA 1FKOA 4LC9B 3EEQA 2G8VA 3SMPA 4LF4K 4K0KK 4GV6A 4WFAL 1NGFA 1LV5A 3WNGA 1N34K 3AGKA 4BRLA 1IKVA 4B3SK 1S6PA 2ZJQL 3VQ8A 4FLZA 3LP2A 4ELTA 4FPBA 1OVQA 2Q2RA 5J2MA 2R7YA 4JI8K 4G9ZA 3PV8A 3QIOA 3KLEA 3DLHA 3A5MC 4E7JA 3RSEB 3ULEA 3ZSVA 2UUBK 1HMVA 1JLQA 4BDYA 1REVA 4GY2B 4YOWA 1OH6A 1EX4A 5M1KA 3FGUA 2P1JA 1NOYA 1X3MA 3OYNA 5CYQA 2OYQA 3SJHA 3I8DA 3AV9A 3CYGA 5AQYA 3E66A 1C0GA 1NWKA 3IRXA 3QO9A 5CR4A 3THWA 1FW6A 3CCLN 4B9QA 4B1ZA 5C25A 1F21A 3HJFA 4PKGA 4CHZA 1NMNA 4DU4A 2Z1GA 2NRWA 1YHQN 2E1YA 4B1WB 3PO5A 4YOYA 3L2RA 3G25A 5M1FA 4W5QA 4XIUA 4PY5A 3O9QA 1HRHA 3DRSA 5TKYA 1K9MO 1XUPO 3V1RA 2XY5A 4FJGA 2HHSA 4DFKA 3KKSA 4CJVA 4I9LA 1OH7A 1WNSA 1YF5L 1VQKN 3MX2A 4KTQA 4ZTFA 2Z1HA 2A3ZA 3NMUA 4CIFA 2W42A 4Z94A 4CZKA 1EWQA 1FK9A 4A5AA 4A5BA 1RT6A 1KSPA 3M8QA 3ZEUA 1BISA 3KK2A 3TTDA 3CMEN 3KZBA 2IOCA 1HPZA 1T6CA 1T05A 2PYJA 3CQXA 4GKKK 3DXKA 2OZSA 4JEPA 1RGIA 3KK3A 5AQWA 3V6DA 2KW4A 1NM1A 4JI6K 4E1MA 3RWUA 5SZTA 1VSEA 5HP1A 1LAVA 3AVLA 1H1VA 3MEGA 3A0IX 2NRTA 1D8YA 1JLGA 4NYFA 4CK1A 5T7BA 4H0PA 1R0AA 1VSLA 4O44A 3PY8A 4E1JA 4BRQA 3ZT4A 3AVBA 1SL0A 1SKRA 1YTAA 5AQQA 1BWFO 1DT9A 1WB9A 4CBUA 4OKEA 4TSXA 2GV9A 4L3QA 3SBTA 1TYQB 2G8UA 4HHTA 5D3GA 4CJWA 3B6OA 3HPHA 3AVHA 2W40A 4H5VA 3BZKA 5KPZA 4C8MA 4WCEL 1C0TA 4IG0A 4CFCA 2QWPA 3H45C 2OPSA 3TABA 1Q82O 1QQOA 4BDZA 3VPZA 3I8BA 3TR8A 3NH2A 5I42A 1S6QA 2QWLA 1S1XA 2HOEA 1TUUA 3LP0A 5AQVA 3T69A 3VEOA 4CBWA 3TI0A 1YXQA 3EKUA 4BRAA 3VQ5A 4IOXA 3QETA 3HI0A 2WOMA 1XNQK 1C1CA 2VCPA 5JENA 3OY9A 1IKWA 2NRHA 2X6NA 4J2EA 3HOSA 3PIOL 1RT3A 2O8FA 3A5OC 4B08A 3A2FA 2HVIA 5AQPA 2FSNA 1GOAA 3F5TA 4H0XB 1IG8A 4FJXA 2ZGYA 3I55N 3G71N 2FF3B 4I2QA 3SQ1A 2Q3SA 1TAQA 1VSHA 5JS1A 1DTTA 3G6EN 2AP1A 2Z1JA 4FXDA 2QA4N 4M7YA 4M45A 2D0OA 2HHHK 3TAGA 1U45A 4ILGB 3OYMA 1J6ZA 3CXCM 3QFPA 4C8OA 3C6UA 1RDUA 1HQUA 4BR0A 2RE2A 4PHTX 3WQTA 4N76A 2Q31A 3O08A 3BZCA 3J81O 1VSJA 3QDKA 3VEVA 5HRPA 4LFAK 2F9WA 3KJVA 4DTSA 4BRPA 1OH5A 4YOUA 4B1VA 1BOTO 1VSFA 3DOLA 2YV0X 2E6LA 4DFJA 1A5WA 2PZSA 3HM8A 2O8BA 1BUPA 4E19A 1KQSM 3VQCA 3EO3A 3AVCA 3T3FA 3NF7A 3JYTA 5AQIA 3OYAA 2O8CB 4FM2A 3MN5A 4OVLA 3HVRA 3AVAA 3LANA 3C94A 3R8EA 3DLBA 3BF1A 5KQDA 1NK4A 3P4IA 3V9UA 1D5AA 3SV4A 4JK9A 1RT5A 5BN9A 3ALYA 4ICLA 2D0PA 4BE0A 3MMVA 4GVMA 2PAVA 3ID8A 4BRKA 2QI2A 3K9JA 3AA5X 4FWKA 4ISEA 5BREA 2QEXN 1KVCA 1NJIO 4CCHA 1BCMA 2E2QA 1IH7A 2HHVA 3OBYA 4JHDA 2QWOA 4JKAA 3VQ4A 4KHNA 4PKIA 3BUZB 1RDAA 2OPRA 3ZSWA 3H3OB 4CEDA 4JS5A 5AQLA 2ZM6K 1QSYA 3T1HK 4ISFA 3MWPA 3H1VX 3TSUA 2H3GX 2YHYA 1NJYA 1DTQA 1GLBG 2EWSA 1D9DA 1SUQA 4FWQA 3ZYYX 3DLLL 5ELZA 3NGIA 4FZZA 3O80A 4XEIA 1L3TA 4YDUC 1T7PA 4BWJA 5AQXA 3T19A 3VQ9A 3HSTB 3T7ZA 4O5BA 4DR7K 2HHTA 1C0MA 1QHAA 3KK7A 3EKSA 2O4GA 5H1SQ 4K25A 2IVPA 5GAGP 2BGGA 4Z4CA 2KKZA 1VSIA 3LDQA 1LW0A 3CETA 1JLEA 3ITHA 5BPLA 4M3TA 4NCBA 3WXMB 4B9NA 4V19S 1X3NA 1ASWA 1QQCA 1K8KB 2YHXA 4E3SA 2DFHA 2HHXA 2WUSA 4E7IA 1BGXT 2WFBA 4CHQA 3CIPA 1ZBFA 4DTJA 3HP6A 2P9SB 2QXLA 5JLHA 3NVKA 3UKUA 3SJJA 1XWLA 3LL3A 4QS8A 3SAGA 3DM2A 2PFUA 3L2WA 3CC2N 3ZETA 1NGGA 1HNVA 4BRIA 5KTQA 4FL9A 3RTVA 3G4SN 4FVMA 2OCEA 4EZ6A 4BR2A 4HTUA 4JKBA 1VSDA 1W97L 1RTHA 4PKHA 4W5NA 3NAEA 4AH9A 5KRSA 3DAWA 2G8FA 1T6DA 1WSJA 3TSQA 4YOXA 2FLOA 1XMQK 1Z25A 3TSPA 1BU6O 3J80O 4JS4A 4JV5K 3SZ2A 4ELVA 2BH1A 4B3MK 3C6TA 4AHSA 4C8NA 4ID5A 4W5RA 2ASMA 2D4WA 3VEWA 3OS2A 1VQNN 3LP3A 3G10A 3NF8A 4B9LA 3MCAB 1VSMA 2GWJA 4DQSA 3FFKB 3QEPA 5BR9A 1XQSC 3ZX2A 3IUCA 3WXIA 3TWHA 2ZF5O 1C1AA 4BEBA 2V7ZA 4CFBA 5BRHA 4IO9L 3THXA 3DLGA 4BC5A 5F2RA 4KI6A 1Q86O 4JI0K 4BQZA 4RTFD 5HOOA 4DQRA 2G8IA 3CD6N 5FPMA 2FC0A 2HMIA 5AQSA 4DSKA 4BRGA 2KQ2A 2ITGA 3QEVA 3F9MA 4B9MA 3P5JA 1VQ9N 3WEEA 3QEIA 4CHNA 4YNQA 1UWBA 1C6VA 4GV9A 2IVOA 4CJ5A 4E7LA 1E4GT 2P9PB 4FZXC 1KLNA 3CFOA
chains in the Genus database with same CATH topology
1SAZA 5JLFA 3EN9A 1KXPA 3MDQA 1WOQA 3R9PA 3AAPA 4K42A 4CD3A 4GY2B 4JAXA 4XH4A 5ADXA 3IKMA 4BC4A 4YOWA 3EE9A 5AZIB 1QVFM 1P8ZA 3W3DA 3FGUA 5M1KA 1R59O 3H46O 3TTFA 4CZLA 4C23A 4F9OA 1K8KA 5GAHP 1X3MA 1NGBA 3CJ1A 3NVMA 1JCEA 1Z05A 3VF6A 4BVOA 3SJHA 5B8HA 5LJVA 3GBTA 3LDOA 2P9KB 3AY9A 4MDBA 5AQYA 4I6MB 3CJCA 1NGEA 3E66A 1E4FT 1HKBA 3KVGA 1C0GA 5JVHL 3FZFA 4ILHA 3OBWA 1NWKA 5CR4A 5AZJA 2P9SA 3U4LA 3HTVA 4IEEA 1K73O 3CCLN 4B9QA 4B1ZA 5EOYA 2P9IA 1SZ2A 2HBKA 5AFUA 4PKGA 3O1BA 5GINA 3PIPL 4BE7B 3HZ6A 4BRDA 3E1YA 3KWGA 1X9JA 1Q18A 3PLAA 3WQUA 2NRWA 3GOIA 1YHQN 3E9OA 5AQRA 5JMVA 2E1YA 4B1WB 4CZIA 2YI1A 1NBWA 1GLCG 4YOYA 3G25A 4GVEA 4JKEA 3CHWA 3ZX3A 5M1FA 2E2NA 3D7EO 2P9LB 1TUYA 2V51B 1GLEG 4YORA 4BR4A 3O9QA 2IVNA 4H0TB 4BEBA 2ZJRL 2VGNA 5TKYA 3CCUN 1K9MO 1XUPO 1QQMA 2KLAA 4AM6A 3CCMN 5AQFA 4BRFA 2BTFA 5AQNA 3SBGA 4B1YB 4WQ4C 4OO1J 1YF5L 1VQKN 4DQ8A 3MX2A 4BR7A 2GWKA 3A5NC 4BY9C 2I7NA 3A5LC 1P90A 2A3ZA 4EHTA 1NGDA 3VGMA 3NMUA 1HKGA 4DHYA 4Z94A 3Q7BA 4CZKA 1BA0A 4B1XB 4FOEA 4A5AA 4A5BA 3CCJN 2YCHA 3WT0A 5JICA 4FWMA 3ZEUA 2E2PA 4BRHA 3DXMB 4JD2B 1HPMA 3TTDA 4FWNA 4BC3A 5F0XA 3CMEN 4JKGA 2VYPA 2IIRA 3KZBA 3MCPA 1T6CA 4H03B 2FSJA 2YJEA 3CQXA 3N4QA 2E2OA 5M1OA 3EZWA 4YOVA 4JN4A 3DXKA 4K43A 3QICA 4JEPA 1RGIA 5AQWA 1NM1A 4M7XA 1QZ6A 3GG4A 4WFNL 2VWBA 4A61A 2BUPA 4QS9A 4FWSA 4FWLA 1H1VA 1ESVA 2Q0RA 5AQUA 4CJ7A 3A0IX 4BGBA 5BN8A 2NRTA 3RSEA 2P9PA 5C2FA 1VQLN 2Q97A 3UKUB 4AM7A 1NGAA 3B8AX 4H0PA 4KH4A 3VEXA 4XH1A 3DWLA 2NZTA 4E1JA 4BRQA 1YJWN 1M90O 5AQHA 5CHIA 1ATSA 3JXUA 5AQJA 1Q7YO 1ZBSA 5AZIA 5AQQA 2E8AA 2F7TA 4U67L 1BWFO 5FPDA 3WXJA 1NGCA 2ZWHA 1DT9A 4CBUA 4KH5A 1KD1O 3AARA 1HX1A 4A57A 3E9PA 5M1PA 3CPEA 4I6MA 4L3QA 3SBTA 5BPNA 2CGLA 5E84A 4WYBA 1TYQB 1MA9B 1DKGD 2CH5A 1SS6A 3LDNA 1KC8O 1K8AO 4U7BA 3I33A 3FZLA 4DKWA 1HJOA 3C6AA 2QTDA 4CZMA 5GIPA 2W40A 4H5VA 2C1IA 5KPZA 2WBNA 3WXLA 4WCEL 3O8MA 3KWIA 3P39A 2QWPA 3H45C 2A6AA 1YIJN 1Q82O 3N4PA 3P38A 1QQOA 1GLAG 4GNIA 3HRGA 4JKHA 2CH6A 2UYTA 5AQMA 3VPZA 4EAHD 5KPTA 2I7PA 3VTIA 1GLDG 3I8BA 2P9LA 1NGIA 5KPRA 4J8FA 4WQ5A 3ENOA 3CMAN 4BROA 3O9TA 2QWLA 4H5WA 3VERA 2HOEA 1TUUA 3JS6A 1M1KO 5AQVA 4YOTA 4JHDB 3IDHA 3T69A 2NRXA 3VEOA 4CBWA 4JK7A 1C0FA 1MWMA 1YXQA 3EKUA 4RWTA 3O9UA 1QQNA 4BRAA 3QMLA 4IOXA 2ZJPL 2YX6A 2NRVA 3ID6A 3HI0A 2A41A 2VCPA 4O5FA 4H0YB 4O8UA 2NRHA 1IJJA 3HOSA 3ENBA 3FZMA 3PIOL 1NGJA 4OPHA 3WXKA 2NNWA 5HL7L 4H5TA 3O4WA 1WUAA 3A5OC 3FE1A 3QFUA 3CC4N 4IXCA 3OW2M 1VQON 1YUWA 5BPMA 4CBXA 5AQPA 2ITMA 2FSNA 4JD2A 3F5TA 4H0XB 4KBOA 3ZX0A 1IG8A 3VETA 2E1ZA 2Q36A 1HUXA 2ZGYA 3I55N 3G71N 2HBMA 1BDGA 2FF3B 4ISGA 5FPEA 4A2BA 5I9EB 4H0VB 4KH6A 5DM7L 3LM2A 4BG9A 3G6EN 2JWLA 2AP1A 3MWTA 4BQLA 3CCRN 2F9TA 2QA4N 3M1FA 4M7YA 1RDWX 2D0OA 4NLBA 4CZFA 4ILGB 3MN6A 3RVCA 3KHYA 1JJ2M 2QWQA 1J6ZA 4H0OA 3Q7CA 2A40A 2OANA 3I56N 3CXCM 3MN7A 3O1WA 3P31A 3QFPA 4WFBL 1RDUA 1VAZA 4MLHA 4BR0A 2RE2A 3D2EB 3WQTA 4PHTX 3TTCA 3BEXA 4BR9A 2Q31A 3O08A 1YITN 3GL1A 1W2BM 1S3XA 2Q0UA 2Q1NA 4FWRA 4IEIA 3QDKA 1S22A 2QWRA 4OPAA 3TPQA 3VEVA 4BGAA 4UY8O 2F9WA 4A62A 4BRPA 5KQ8A 4YOUA 4B1VA 5C2DA 1BOTO 3BP8A 3M3ZA 3U9ZA 3IFRA 1VQ7N 3HM8A 1BUPA 1KQSM 4HTLA 2HSTA 2NLXA 3L4IA 3EO3A 5FPNA 4RCHA 3SLCA 2C1GA 2FF6A 1EQYA 2QW9A 3C7NB 2WC9A 2D1KA 3CQYA 3C6HA 1TYQA 3H6EA 3SAFA 3CCQN 1VQ6N 3H3NO 5LY3A 2A42A 5AQIA 4FSVA 1U2VA 3IMXA 3L6QA 4MLEA 3MN5A 3CF5L 4BRMA 4JKFA 3FZHA 3R8EA 4DB3A 2HF4A 3CJAA 3D2FB 3BF1A 4BR5A 5KQDA 5EXWA 3U9DA 3P4IA 2DPNA 3VF2A 3ZETB 3BF3A 3CCVN 1VQ8N 4IO8A 5M1QA 3OHRA 4IJAA 1T3VA 4JK9A 5BN9A 3TU5A 4PL7A 4R79A 2D0PA 3MMVA 1ZC6A 2YJFA 2PAVA 2P9KA 1Z6RA 3ID8A 5EX5A 3VOVA 2QI2A 3K9JA 4FWKA 4ISEA 4A59A 4BRKA 5BREA 1NJIO 4CZHA 2V7YA 4IDHA 3GDQA 3VMFB 2QEXN 3VTHA 1LCUA 1ATNA 2E2QA 3R1XA 4O8KA 3OBYA 5LJWA 2YHWA 4JHDA 3CCSN 2QWOA 3MX5A 1NMDA 4JKAA 1HKCA 1BG3A 4PKIA 4WF9L 3BUZB 4WQ4A 4HWIA 1YJNN 4A2AA 3H3OB 3MK6A 3OA9A 1ATRA 3CJ7A 3CJ9A 5AQLA 2VGMA 3U8XA 4FWOA 1MWKA 4ISFA 3UKRB 1OKJA 3MWPA 2W41A 3H1VX 3VF4A 3TSUA 5C10A 2H3GX 2YHYA 3LDLA 5CE3A 5DM6L 1VQPN 1YJ9N 1GLBG 2EWSA 2V52B 5AR0A 4DCHA 2HF3A 1VQMN 2GX9A 1V4SA 2P9UB 3A8YA 4FWQA 5ADXH 2FXUA 2GUPA 3ZYYX 2KHOA 1ILYA 2GEMA 3M5RA 3DLLL 5AQKA 4IWVA 5ELZA 3S41A 2P9NB 1BO5O 3O80A 4XEIA 4NB4A 3C65A 4YDUC 5F1XA 4CD1A 5AQXA 5M1NA 4XJXA 1JCFA 2QM1A 5BRDA 1YI2N 3WUHA 3T7ZA 4BECA 1GLFO 1XC3A 3CPWM 2ASOA 2FSKA 3FLCO 3WEEB 1RFQA 5AQGA 3VGKA 4BREA 1QHAA 1NGHA 3KK7A 4CZEA 5C12A 3EKSA 1LOTB 4EFHA 3D2EA 5H1SQ 5JVGL 5AFUH 4K25A 2IVPA 4FVUA 5GAGP 3J7ZO 3DXMA 2KKZA 3F2KA 3ULEB 1KAYA 3LDQA 3FR0A 3CETA 4JNEA 3VENA 3J8AA 5BPLA 4C1NK 2E88A 2ASPA 4Y0WA 3WXMB 1X3NA 3QBWA 1GLJO 3ATVA 3CI5A 3GE1A 4B1UB 1JCGA 3R3LA 4IZ9A 4C1NI 1K8KB 5AQTA 2YHXA 3CCEN 4FOIA 4FPAA 2WUSA 3L4QA 2CGKA 3AGRA 3C7NA 4JKCA 3UB5A 1QVGM 3H1QA 1D4XA 2WFBA 1KAXA 3CIPA 2JWKA 4EHUA 5AQZA 5AZJB 2QWNA 2P9SB 3QB0A 2QXLA 4H5NA 5JLHA 3NVKA 1DEJA 2HBJA 3UKUA 2P9IB 5C15A 3LL3A 4QS8A 3SAGA 3D2FA 1V4TA 3LM9A 2PFUA 2OTJN 4AF1A 5AQOA 3CC2N 3VEYA 4H5RA 1NGGA 3ZETA 4BRIA 4FL9A 3QBXA 3G4SN 1G99A 3CERA 4NO7A 3W0LA 4CZGA 2PBDA 4BR2A 4JKBA 3FZKA 4NLCA 1W97L 4PKHA 1BA1A 4PL8A 3DAWA 4WQ5C 1T6DA 1O13A 4BVPA 1CZAN 3O9SA 4JKDA 1T44A 1Q81O 1HLUA 1QZ5A 4XH5A 4IFEA 3TSQA 3DJCA 4YOXA 4BG8A 1VQ5N 2NRZA 2FLOA 3TSPA 1BU6O 3LDPA 3O9RA 1U6ZA 3EE8A 3O6WA 5TKWA 5EVZA 2BH1A 1DGKN 3HSCA 3D6RA 4ILJA 1SQKA 1NLVA 3VGLA 1KAZA 2ASMA 2D4WA 3VEWA 3SAHA 1VQNN 1GLLO 4YDUA 4FO0A 2CGJA 5BRFA 2A5XA 2AA4A 2NRRA 4JK8A 3MCAB 3UKRA 2OTLN 4K41A 2GWJA 1VQ4N 5EY4A 3FFKB 5MLCQ 5BR9A 3CJBA 1XQSC 3ZX2A 3E9LA 3IUCA 3WXIA 4CZJA 2ZF5O 3HOTA 3ZEUB 1YAGA 2V7ZA 3AAQA 3VESA 2P9UA 3M6GA 4FWPA 4BRCA 5GAEP 5BRHA 3CC7N 4IO9L 5E26A 4QS7A 4GV3A 1YVNA 1S72N 4BRNA 3ATUA 4BC5A 4JKGB 5F2RA 2ZGZA 1Q86O 5C0YA 4BQZA 2P9NA 3EL2A 2HBLA 4RTFD 5HOOA 3R6MA 4LC9B 2E20A 3SMPA 2HMPA 4GV6A 4WFAL 1NGFA 4IOCL 3CD6N 3C0BA 5FPMA 3DXKB 5AQSA 4BRGA 4MO4A 3AGKA 4BRLA 4MO5A 1Y64A 4IOAL 2W00A 3F9MA 4M63C 2ZJQL 1VQ9N 3L0QA 2GELA 4IJNA 4BC2A 3WEEA 1N8RO 3UE5A 2QWMA 1MDUB 1ZXOA 3HBTA 4FPBA 4CI6A 4EIAA 5GIOA 1EO1A 2Q2RA 3VEZA 4G9ZA 4GV9A 2RHKA 2IVOA 3A5MC 1U2VB 1E4GT 3RSEB 3ULEA 2P9PB 3MN9A 4MDAA 2GTDA 3SK3A 3SMSA 3ENHA 1OVYA 3O5BA 5GADP 3K9KA 2J4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SAZ A;  5JLF A;  3EN9 A;  1KXP A;  3MDQ A;  1WOQ A;  3R9P A;  3AAP A;  4K42 A;  4CD3 A;  4GY2 B;  4JAX A;  4XH4 A;  5ADX A;  4BC4 A;  5AZI B;  1P8Z A;  3W3D A;  3FGU A;  1R59 O;  3H46 O;  4CZL A;  4F9O A;  4C23 A;  1K8K A;  1X3M A;  1NGB A;  3CJ1 A;  1JCE A;  1Z05 A;  3VF6 A;  4BVO A;  3SJH A;  5B8H A;  5LJV A;  3GBT A;  3LDO A;  2P9K B;  3AY9 A;  5AQY A;  4I6M B;  3CJC A;  1NGE A;  1E4F T;  1HKB A;  3KVG A;  1C0G A;  3FZF A;  5AZJ A;  1NWK A;  2P9S A;  3U4L A;  3HTV A;  4B9Q A;  4B1Z A;  5EOY A;  2P9I A;  1SZ2 A;  5AFU A;  4PKG A;  3O1B A;  3HZ6 A;  4BRD A;  1X9J A;  1Q18 A;  3WQU A;  3GOI A;  5AQR A;  5JMV A;  2E1Y A;  4B1W B;  4CZI A;  2YI1 A;  1NBW A;  1GLC G;  3G25 A;  3ZX3 A;  3CHW A;  2E2N A;  3D7E O;  2P9L B;  1TUY A;  2V51 B;  1GLE G;  4BR4 A;  2IVN A;  4H0T B;  5TKY A;  1XUP O;  1QQM A;  4AM6 A;  5AQF A;  4BRF A;  2BTF A;  5AQN A;  4B1Y B;  4WQ4 C;  4DQ8 A;  4BR7 A;  2GWK A;  3A5N C;  2I7N A;  3A5L C;  4EHT A;  2A3Z A;  1NGD A;  3VGM A;  1HKG A;  4DHY A;  4Z94 A;  4CZK A;  1BA0 A;  4B1X B;  4FOE A;  2YCH A;  3WT0 A;  5JIC A;  4FWM A;  3ZEU A;  2E2P A;  4BRH A;  3DXM B;  4JD2 B;  1HPM A;  4FWN A;  4BC3 A;  5F0X A;  2VYP A;  2IIR A;  3KZB A;  3MCP A;  1T6C A;  4H03 B;  2FSJ A;  2YJE A;  3CQX A;  2E2O A;  3EZW A;  4JN4 A;  3DXK A;  4K43 A;  3QIC A;  1RGI A;  5AQW A;  1NM1 A;  4M7X A;  1QZ6 A;  3GG4 A;  2VWB A;  4A61 A;  2BUP A;  4QS9 A;  4FWS A;  4FWL A;  1H1V A;  1ESV A;  2Q0R A;  5AQU A;  4CJ7 A;  3A0I X;  4BGB A;  5BN8 A;  3RSE A;  2P9P A;  2Q97 A;  3UKU B;  4AM7 A;  1NGA A;  3B8A X;  4H0P A;  3VEX A;  4XH1 A;  3DWL A;  2NZT A;  4E1J A;  4BRQ A;  5AQH A;  1ATS A;  3JXU A;  5AQJ A;  1ZBS A;  5AZI A;  5AQQ A;  2E8A A;  5FPD A;  1BWF O;  3WXJ A;  1NGC A;  2ZWH A;  4CBU A;  3AAR A;  1HX1 A;  4I6M A;  4L3Q A;  5BPN A;  2CGL A;  5E84 A;  4WYB A;  1TYQ B;  1MA9 B;  1DKG D;  2CH5 A;  3LDN A;  3I33 A;  3FZL A;  1HJO A;  4CZM A;  2W40 A;  4H5V A;  5KPZ A;  3WXL A;  3O8M A;  2QWP A;  3H45 C;  2A6A A;  1QQO A;  1GLA G;  4GNI A;  5AQM A;  2CH6 A;  2UYT A;  3VPZ A;  4EAH D;  5KPT A;  2I7P A;  1GLD G;  3I8B A;  2P9L A;  1NGI A;  5KPR A;  4J8F A;  4WQ5 A;  3ENO A;  4BRO A;  2QWL A;  4H5W A;  3VER A;  2HOE A;  1TUU A;  3JS6 A;  5AQV A;  4JHD B;  3IDH A;  3VEO A;  4CBW A;  1C0F A;  1MWM A;  1YXQ A;  3EKU A;  4RWT A;  1QQN A;  4BRA A;  3QML A;  3HI0 A;  2A41 A;  2VCP A;  4O5F A;  4H0Y B;  2NRH A;  1IJJ A;  3FZM A;  1NGJ A;  3WXK A;  4H5T A;  3O4W A;  1WUA A;  3A5O C;  3FE1 A;  3QFU A;  4IXC A;  1YUW A;  5BPM A;  4CBX A;  5AQP A;  2ITM A;  2FSN A;  4JD2 A;  4H0X B;  4KBO A;  3ZX0 A;  1IG8 A;  3VET A;  2E1Z A;  2Q36 A;  1HUX A;  2ZGY A;  1BDG A;  2FF3 B;  4ISG A;  5FPE A;  4A2B A;  5I9E B;  4H0V B;  3LM2 A;  4BG9 A;  2AP1 A;  4BQL A;  2F9T A;  3M1F A;  4M7Y A;  1RDW X;  2D0O A;  4CZF A;  3MN6 A;  3KHY A;  2QWQ A;  1J6Z A;  4H0O A;  2A40 A;  2OAN A;  3MN7 A;  3O1W A;  3QFP A;  4MLH A;  4BR0 A;  3D2E B;  3WQT A;  3BEX A;  4BR9 A;  2Q31 A;  3O08 A;  3GL1 A;  1S3X A;  2Q0U A;  2Q1N A;  4FWR A;  3QDK A;  1S22 A;  2QWR A;  3VEV A;  3TPQ A;  4BGA A;  2F9W A;  4A62 A;  4BRP A;  5KQ8 A;  4B1V A;  1BOT O;  3BP8 A;  3M3Z A;  3U9Z A;  3IFR A;  3HM8 A;  1BUP A;  4HTL A;  2NLX A;  3L4I A;  3EO3 A;  5FPN A;  4RCH A;  3SLC A;  2FF6 A;  1EQY A;  2QW9 A;  3C7N B;  2D1K A;  3CQY A;  1TYQ A;  3H6E A;  3H3N O;  5LY3 A;  2A42 A;  5AQI A;  4FSV A;  1U2V A;  3IMX A;  3L6Q A;  4MLE A;  3MN5 A;  4BRM A;  3FZH A;  3R8E A;  4DB3 A;  2HF4 A;  3CJA A;  3D2F B;  3BF1 A;  4BR5 A;  5KQD A;  5EXW A;  3U9D A;  3P4I A;  2DPN A;  3VF2 A;  3ZET B;  3BF3 A;  4IO8 A;  3OHR A;  4IJA A;  5BN9 A;  3TU5 A;  4PL7 A;  2D0P A;  3MMV A;  1ZC6 A;  2YJF A;  2PAV A;  2P9K A;  1Z6R A;  3ID8 A;  5EX5 A;  3VOV A;  4FWK A;  4ISE A;  4BRK A;  5BRE A;  4CZH A;  2V7Y A;  3GDQ A;  1LCU A;  1ATN A;  2E2Q A;  4O8K A;  5LJW A;  2YHW A;  4JHD A;  2QWO A;  1NMD A;  1HKC A;  1BG3 A;  4PKI A;  3BUZ B;  4WQ4 A;  4HWI A;  4A2A A;  3H3O B;  3MK6 A;  1ATR A;  3CJ7 A;  3CJ9 A;  5AQL A;  3U8X A;  4FWO A;  1MWK A;  4ISF A;  3UKR B;  1OKJ A;  2W41 A;  3H1V X;  3VF4 A;  2H3G X;  2YHY A;  3LDL A;  5CE3 A;  1GLB G;  2EWS A;  2V52 B;  5AR0 A;  4DCH A;  2HF3 A;  1V4S A;  2P9U B;  3A8Y A;  4FWQ A;  5ADX H;  2FXU A;  2GUP A;  2KHO A;  2GEM A;  5AQK A;  4IWV A;  5ELZ A;  3S41 A;  2P9N B;  1BO5 O;  3O80 A;  4XEI A;  4NB4 A;  4YDU C;  5F1X A;  4CD1 A;  5AQX A;  1JCF A;  2QM1 A;  5BRD A;  3WUH A;  1GLF O;  1XC3 A;  2ASO A;  2FSK A;  3FLC O;  3WEE B;  1RFQ A;  5AQG A;  3VGK A;  4BRE A;  1QHA A;  1NGH A;  4CZE A;  3EKS A;  1LOT B;  4EFH A;  3D2E A;  5AFU H;  4K25 A;  2IVP A;  3DXM A;  3ULE B;  1KAY A;  3LDQ A;  3FR0 A;  3CET A;  4JNE A;  3VEN A;  3J8A A;  5BPL A;  2E88 A;  2ASP A;  4Y0W A;  1X3N A;  3QBW A;  1GLJ O;  3ATV A;  3CI5 A;  3GE1 A;  4B1U B;  1JCG A;  4IZ9 A;  1K8K B;  5AQT A;  2YHX A;  4FOI A;  4FPA A;  2WUS A;  2CGK A;  3C7N A;  3UB5 A;  3H1Q A;  1D4X A;  1KAX A;  3CIP A;  4EHU A;  5AQZ A;  5AZJ B;  2QWN A;  2P9S B;  3QB0 A;  2QXL A;  4H5N A;  5JLH A;  1DEJ A;  3UKU A;  2P9I B;  3LL3 A;  4QS8 A;  3D2F A;  1V4T A;  3LM9 A;  5AQO A;  3VEY A;  4H5R A;  1NGG A;  3ZET A;  4BRI A;  4FL9 A;  3QBX A;  1G99 A;  3CER A;  4NO7 A;  3W0L A;  4CZG A;  2PBD A;  4BR2 A;  3FZK A;  4PKH A;  1BA1 A;  4PL8 A;  3DAW A;  4WQ5 C;  1T6D A;  4BVP A;  1CZA N;  1T44 A;  1HLU A;  1QZ5 A;  4XH5 A;  3DJC A;  4BG8 A;  2FLO A;  1BU6 O;  3LDP A;  1U6Z A;  3O6W A;  5EVZ A;  1DGK N;  3HSC A;  1SQK A;  1NLV A;  3VGL A;  1KAZ A;  2ASM A;  2D4W A;  3VEW A;  1GLL O;  4YDU A;  4FO0 A;  2CGJ A;  5BRF A;  2A5X A;  2AA4 A;  3UKR A;  4K41 A;  2GWJ A;  5EY4 A;  3FFK B;  5BR9 A;  3CJB A;  1XQS C;  3ZX2 A;  3IUC A;  3WXI A;  4CZJ A;  2ZF5 O;  3ZEU B;  1YAG A;  2V7Z A;  3AAQ A;  3VES A;  2P9U A;  3M6G A;  4FWP A;  4BRC A;  5BRH A;  5E26 A;  4QS7 A;  1YVN A;  4BRN A;  3ATU A;  4BC5 A;  5F2R A;  2ZGZ A;  4BQZ A;  2P9N A;  3EL2 A;  4RTF D;  3R6M A;  4LC9 B;  2E20 A;  3SMP A;  2HMP A;  1NGF A;  3C0B A;  5FPM A;  3DXK B;  5AQS A;  4BRG A;  4MO4 A;  4BRL A;  4MO5 A;  1Y64 A;  3F9M A;  4M63 C;  3L0Q A;  2GEL A;  4IJN A;  4BC2 A;  3WEE A;  3UE5 A;  2QWM A;  1MDU B;  1ZXO A;  3HBT A;  4FPB A;  4CI6 A;  4EIA A;  2Q2R A;  3VEZ A;  2IVO A;  3A5M C;  1U2V B;  1E4G T;  3RSE B;  3ULE A;  2P9P B;  3MN9 A;  2GTD A;  3SK3 A;  3SMS A;  3ENH A;  3O5B A;  2J4R A; 
#chains in the Genus database with same CATH topology
 1HNI A;  5JLF A;  4DSL A;  3MDQ A;  3R9P A;  2B4J A;  4CD3 A;  5HRO A;  4JAX A;  3IKM A;  3VN5 A;  1R59 O;  3H46 O;  4CZL A;  4F9O A;  1SKW A;  2W6L A;  4BVO A;  5B8H A;  3HPG A;  2VWJ A;  1O1W A;  2AJQ A;  2X78 A;  4W5T A;  1S9G A;  1RCH A;  3CJC A;  5JVH L;  3SYZ A;  3KVG A;  3FZF A;  5AZJ A;  4IEE A;  2F4V K;  4CJL A;  5EOY A;  2P5O A;  3WNE A;  3KLF A;  4JYA K;  2HBK A;  4J2A A;  1QTM A;  3O1B A;  2UXC K;  5GIN A;  3PIP L;  4F4K A;  3KWG A;  3ULD A;  4CEA A;  1BI4 B;  1EXQ A;  1Q18 A;  1KRP A;  2YI1 A;  1UOC A;  4CF1 A;  2IDO A;  4JKE A;  5CY4 A;  3CHW A;  2E2N A;  4DR5 K;  1KVB A;  5C42 A;  1N6Q A;  4BR4 A;  3CFP A;  4DSE A;  2ZJR L;  5LMU K;  1HNW K;  2VGN A;  3CCU N;  1XHX A;  4JI5 K;  4AM6 A;  1RDD A;  3CCM N;  4BRF A;  2BTF A;  3THY B;  4B3R K;  4WQ4 C;  1JLC A;  4Q5V A;  4C8K A;  4DR1 K;  3V9Z A;  2GWK A;  3K5O A;  1Q9X A;  2I7N A;  1P90 A;  3LPT A;  1QS4 A;  3VGM A;  3Q7B A;  3DLE A;  1TVR A;  4FWM A;  4IBN A;  4DTX A;  4FWN A;  2FBV A;  4JKG A;  2VYP A;  3MCP A;  1NK8 A;  3DRP A;  4H03 B;  4KO0 A;  1KFS A;  2YJE A;  5M1O A;  3QIC A;  3DYA A;  4Z4F A;  4LY7 A;  3GG4 A;  3DLR A;  1GOC A;  1WSH A;  3SUO A;  1NK0 A;  4FWS A;  1ESV A;  1BL3 A;  5AQU A;  3AVJ A;  1VQL N;  3UKU B;  4H4O A;  4FLY A;  1N5Y A;  1JLF A;  4JRQ A;  4XH1 A;  2NZT A;  3PX4 A;  1M90 O;  3SUN A;  1ZYQ A;  2KTQ A;  4MFB A;  1Q7Y O;  1ZBS A;  5AZI A;  4X66 K;  1TAU A;  4QOZ B;  2E8A A;  3WXJ A;  1NGC A;  3U3G A;  3THV A;  4EZ9 A;  3B6P A;  4KH5 A;  3E9P A;  5M1P A;  3CPE A;  4I6M A;  4M3U A;  4HUG A;  1MA9 B;  2CH5 A;  3LDN A;  5HRN A;  4DKW A;  1HJO A;  3C6A A;  3L3V A;  1S1V A;  2DFF A;  1XC9 A;  3K5L A;  1HQE A;  3KWI A;  3P39 A;  4PQU A;  3N4P A;  3P38 A;  5CZ1 A;  1GLA G;  5AQM A;  3HRG A;  4KRE A;  4E1N A;  4KRF A;  4LF8 K;  2KZM A;  2P9L A;  3RMD A;  1SKS A;  4BRO A;  3SV3 A;  3G0Z A;  1UAX A;  4H5W A;  3VER A;  1M1K O;  4YOT A;  3IDH A;  1VK0 A;  4JK7 A;  1C0F A;  1MWM A;  1CXQ A;  3DOK A;  3O9U A;  1QQN A;  4DTN A;  3QML A;  4DTR A;  3ID6 A;  2A41 A;  4OX9 K;  2IGI A;  3ZSO A;  4YFU A;  3FZM A;  5IT9 O;  2QKK A;  1NGJ A;  3SQ0 A;  2NNW A;  5HL7 L;  4DWI A;  3HP9 A;  5BPM A;  3CQ8 A;  4JD2 A;  4KBO A;  1NG9 A;  3ZX0 A;  4HUF A;  3VET A;  4IG3 A;  1HUX A;  3OYB A;  2HBM A;  2O8E A;  2FBT A;  4KH6 A;  3OYG A;  3LM2 A;  2JWL A;  3CCR N;  4F2R A;  4CEZ A;  5FDL A;  3QLH A;  1JJ2 M;  3ZT3 A;  1VHX A;  3KHY A;  2QWQ A;  4H0O A;  3ZSY A;  3Q7C A;  2KFN A;  3O1W A;  4WFB L;  1TK8 A;  3D2E B;  3TTC A;  4DFP A;  5J1E A;  1S3X A;  4FWR A;  4CIG A;  3ASM A;  5KQ8 A;  5C2D A;  4Y1C A;  3QNN A;  1VQ7 N;  1Z26 A;  2NLX A;  4OLB A;  3V1Q A;  2G8K A;  1IBK K;  3MAQ A;  1EQY A;  5HRR A;  4KB0 A;  4FW2 A;  2VG6 A;  3SUQ A;  4CF0 A;  4FSV A;  1U2V A;  1BCO A;  3CF5 L;  4HVJ A;  2HF4 A;  1IBL K;  3D2F B;  2X6S A;  3CCV N;  3BDP A;  3OHR A;  4IJA A;  1J9A A;  1N36 K;  4R79 A;  3SUP A;  1ZC6 A;  2YJF A;  1VQP N;  2P9K A;  1Z6R A;  3VOV A;  4FLU A;  4A59 A;  4CZH A;  2V7Y A;  1LCU A;  4DLE A;  4E7H A;  4O8K A;  5LJW A;  3CCS N;  3F9K A;  2FBY A;  1NMD A;  3P83 D;  1JXB A;  4WF9 L;  3LAM A;  4WQ4 A;  4HWI A;  3DLK A;  4Z0U A;  2HB5 A;  1S1U A;  3CJ7 A;  4CW7 B;  1MWK A;  4DV2 K;  1OKJ A;  5C10 A;  5DM6 L;  5CE3 A;  1IG9 A;  3OYF A;  2P9U B;  1WAF A;  3CM6 A;  2FXU A;  2GUP A;  2KHO A;  3VQQ A;  1T8E A;  3M5R A;  3T1Y K;  4KHW A;  2P9N B;  4R5P A;  1WSG A;  4LSL A;  4NB4 A;  2QXF A;  4XJX A;  1YI2 N;  4Z4E A;  1SL2 A;  1XC3 A;  2ASO A;  3FLC O;  4I2P A;  5AQG A;  4CGG A;  5JVG L;  5C12 A;  1W9H A;  3V81 A;  4EFH A;  4FVU A;  3OJU A;  1RBU A;  3KIO A;  3ULE B;  4L8R B;  3AVK A;  1KAY A;  1LWC A;  4CJU A;  1VSK A;  5KRT A;  4E89 A;  3SCX A;  2HHU A;  4C1N K;  5FRN A;  4CJ4 A;  4DR3 K;  4DV4 K;  3RR8 A;  3PX6 A;  3RMA A;  3NE6 A;  3HYF A;  4B1U B;  2OPP A;  1B9F A;  2D0B A;  3R3L A;  3OTO K;  3MXJ A;  4Z4H A;  5JS2 A;  1TKD A;  3K0S A;  3C7N A;  1QVG M;  3H1Q A;  4X64 K;  1KAX A;  1KCF A;  5AQZ A;  3THW B;  3QB0 A;  1DEJ A;  2HBJ A;  4AHU A;  1A5V A;  5AQO A;  3VEY A;  3QBX A;  1G99 A;  3ZSX A;  3CER A;  5IWA K;  2OA8 A;  1C1B A;  4FJN A;  3AO5 A;  5KGW A;  4PL8 A;  4WQ5 C;  4EP4 A;  1CZA N;  3O9S A;  1Q81 O;  1WSI A;  4XH5 A;  4AHC A;  2D5R A;  5EVZ A;  1ZBL A;  3V9W A;  4LF6 K;  4ILJ A;  3VGL A;  1KTQ A;  4OKK A;  4KI4 A;  3PSF A;  1WBB A;  1RT2 A;  4RW7 A;  4FO0 A;  5BRF A;  2A5X A;  2AA4 A;  4JK8 A;  4DV0 K;  4B8C A;  3HO1 A;  3D0P A;  3HVT A;  1W0H A;  3UKR A;  2OTL N;  3M8R A;  5EY4 A;  4BE2 A;  4QAG A;  1XMO K;  4Z4G A;  4CZJ A;  3ZSR A;  3ZEU B;  1YAG A;  3AAQ A;  4FWP A;  3QER A;  4C8L A;  4CEF A;  3DRR A;  4QS7 A;  1YVN A;  2ZGZ A;  5C0Y A;  1QSS A;  3OYE A;  1X1P A;  4DR4 K;  2E20 A;  2HMP A;  3DXK B;  3AO3 A;  1Y64 A;  4MO5 A;  4IOA L;  2UXD K;  4M63 C;  5J2Q A;  3L0Q A;  4IJN A;  1T03 A;  4F3O A;  3UE5 A;  3O4N A;  2QWM A;  3HBT A;  2IS3 A;  5EU7 A;  4CJK A;  2Y1J A;  1KVA A;  4CJR A;  2RHK A;  1U2V B;  3MN9 A;  4MDA A;  2GTD A;  2QKB A;  4K42 A;  3ENH A;  1G15 A;  3O5B A;  4FZY A;  2J4R A;  1Y97 A;  1KXP A;  3V9S A;  3OVN A;  2D0C A;  4YHH K;  3AAP A;  4F8R A;  5ADX A;  2G8W A;  4BC4 A;  1IO2 A;  3HL8 A;  1J5O A;  1IKX A;  3W3D A;  4CJP A;  5GAH P;  3OYC A;  1NOZ A;  1TKX A;  4C23 A;  1NGB A;  3NVM A;  1ASU A;  1JCE A;  4JI1 K;  4FM1 A;  3TAE A;  3GBT A;  3QES A;  2P9K B;  3AY9 A;  5AJ3 K;  1NU0 A;  4MDB A;  4RW8 A;  2KZZ A;  1E4F T;  4YY3 K;  1QVF M;  3HTV A;  3AVG A;  1K73 O;  1NK7 A;  1RT1 A;  1I94 K;  3IS9 A;  2P9I A;  1HYV A;  3SPZ A;  1SZ2 A;  1JL1 A;  5AFU A;  4B9T A;  4BRD A;  4AIL C;  1TK5 A;  1X9J A;  3PLA A;  5AQR A;  2PYL A;  3OS0 A;  4CZI A;  1NBW A;  4FJ8 A;  1GLC G;  3RMB A;  1WSF A;  1FJG K;  4GVE A;  3ZX3 A;  3D7E O;  1TUY A;  2V51 B;  4GMJ B;  4YOR A;  4DU1 A;  4QCL A;  4H0T B;  1K6Y A;  1NK9 A;  1Q9Y A;  5CZ2 A;  2ZQB A;  3ZT2 A;  1RBS A;  1QQM A;  2BE2 A;  2KLA A;  2GUI A;  5AQF A;  3SBG A;  4B1Y B;  4DQ8 A;  4BR7 A;  4CIE A;  1XI1 A;  3ZLJ A;  3A5N C;  4N47 A;  3A5L C;  4EHT A;  4RG8 A;  1NGD A;  4OGC A;  4B9U A;  4B8A B;  4FOE A;  3CCJ N;  4DR6 K;  2O8F B;  4DQQ A;  1EP4 A;  3WT0 A;  2E2P A;  3SQ4 A;  2O8D A;  4BC3 A;  4KHP K;  4JLH A;  2IIR A;  3IAY A;  1IBM K;  4DR2 K;  3N4Q A;  4DTU A;  2E2O A;  3EZW A;  3VQP A;  1NK5 A;  4HCB A;  2WON A;  4M7X A;  5K14 A;  2P5G A;  4OJR A;  1JXE A;  4DFM A;  4FWL A;  4CJ7 A;  5BN8 A;  3RSE A;  1WAJ A;  5C2F A;  1BQN A;  4FYD A;  2W6K A;  4AM7 A;  1NGA A;  4KH4 A;  4O4G A;  3LWL A;  4RW4 A;  3DWL A;  1YJW N;  1HJR A;  1ATS A;  3VQA A;  5AQJ A;  1U47 A;  4CGH A;  4FJK A;  4ZTJ A;  4U67 L;  2O8B B;  1JLB A;  2UU9 K;  4KKO A;  4M3R A;  2DY4 A;  1JLA A;  1NK6 A;  2ETJ A;  1KD1 O;  2RN2 A;  4WYB A;  1DKG D;  2YHB A;  3FZL A;  4E72 A;  4CJE A;  4CZM A;  4LF5 K;  4N5S A;  3K57 A;  2YNF A;  3JSM A;  4PWD A;  2BAN A;  3L8B A;  3O8M A;  2A6A A;  3NCI A;  1NKB A;  1NJX A;  4JKH A;  2UYT A;  4KV8 A;  4EAH D;  3O3F A;  4DUY K;  2I7P A;  3VTI A;  4ELU A;  5KPR A;  3NF9 A;  4WQ5 A;  3CMA N;  3O9T A;  4FJ7 A;  3VQB A;  1E3M A;  3JS6 A;  3VA0 A;  3V4I A;  1ZBH A;  4JHD B;  2XY7 A;  4DG1 A;  4JI4 K;  4RWT A;  4CJS A;  4EP5 A;  2NRV A;  1L3U A;  4O5F A;  2HNZ A;  4G1Q A;  4CF8 A;  4H0Y B;  4O8U A;  1LAW A;  1IJJ A;  1TL1 A;  1TL3 A;  1WUA A;  1HNZ K;  4IXC A;  3OW2 M;  1VQO N;  4KPY A;  4AHR A;  3OS1 A;  2ITM A;  4LF7 K;  2RF2 A;  2E1Z A;  3FFI A;  1HNX K;  3VQD A;  4HCC A;  4ISG A;  5FPE A;  4LFC K;  4H0V B;  3O3G A;  4WE1 A;  4CF9 A;  3MWT A;  3OJS A;  4PA1 A;  3M1F A;  4CZF A;  3MN6 A;  3SQ2 A;  4JI7 K;  3NFA A;  3I56 N;  2A40 A;  3MN7 A;  3P31 A;  1VAZ A;  3U3Y A;  3KKR A;  4DMN A;  4BR9 A;  3LDS A;  1YIT N;  1W2B M;  2Q0U A;  4GKJ K;  1S22 A;  4BGA A;  4OPA A;  3TPQ A;  4B9S A;  4A62 A;  3ZT1 A;  4FW1 A;  3BP8 A;  4LH5 A;  1U04 A;  2YHA A;  1FXX A;  1GOB A;  1DLO A;  4HTL A;  2HST A;  3SLC A;  4FCY A;  3RRH A;  3ZCM A;  2C1G A;  2YKN A;  2FF6 A;  2QW9 A;  4DF8 A;  2WC9 A;  2D1K A;  3CQY A;  4FLW A;  1TYQ A;  1VQ6 N;  3CCQ N;  3H3N O;  2A42 A;  3O3H A;  4M41 A;  4MLE A;  3DI6 A;  1ZBI A;  4BRM A;  4DB3 A;  4E0D A;  3HM9 A;  4BR5 A;  5EXW A;  3ZSZ A;  3VF2 A;  3ZET B;  1VQ8 N;  3CG7 A;  4IO8 A;  3ISN C;  1T3V A;  4DV6 K;  3TU5 A;  2XY6 A;  4JRP A;  2NUB A;  5EX5 A;  3H08 A;  4KB1 A;  4IDH A;  3GDQ A;  4FJJ A;  1ATN A;  1J54 A;  5KI6 A;  4LD0 A;  2E6M A;  3MX5 A;  4DLG A;  1BG3 A;  2EHG A;  2IAJ A;  1C0U A;  1YT3 A;  3V1O A;  4A2A A;  1D9F A;  4FLT A;  1CLQ A;  1EWR A;  3WNF A;  4DQI A;  2VGM A;  4BAC A;  2W41 A;  3VF4 A;  3LDL A;  4M3X A;  3VA3 A;  2V52 B;  4DCH A;  4H8K A;  3TAF A;  2HF3 A;  3LPU A;  1VQM N;  4OGE A;  3MEC A;  1BIZ A;  3EZ5 A;  3LWM A;  3THX B;  4AHT A;  2GEM A;  3U6F A;  4IWV A;  1BQM A;  4CEB A;  4B3T K;  1BO5 O;  3O4Q A;  3C65 A;  5F1X A;  3OYD A;  3LAL A;  3MED A;  3VQ7 A;  4CD1 A;  2QM1 A;  2I5J A;  1NKC A;  3TAQ A;  4J2D A;  4BEC A;  1GLF O;  3CPW M;  1S1W A;  3K2P A;  4OKJ A;  4Z4I A;  3OYH A;  3WEE B;  3BY5 A;  4BRE A;  3NGZ A;  4CEC A;  4CZE A;  3NBP A;  3J7Z O;  3M8P A;  3DXM A;  4BWM A;  3QIP A;  3LZI A;  4DV1 K;  2E88 A;  2HNY A;  3K59 A;  1RBT A;  3QBW A;  1GLJ O;  3ATV A;  3CI5 A;  1TK0 A;  3GE1 A;  2XO7 A;  4IZ9 A;  4C1N I;  3CCE N;  3KK1 A;  4FOI A;  4FPA A;  4ZHR A;  3L4Q A;  3LP1 A;  2CGK A;  3AGR A;  1XHZ A;  1D4X A;  4FM0 A;  2JWK A;  1RT7 A;  5AZJ B;  4H5N A;  2O8C A;  1TKT A;  5C15 A;  3NF6 A;  1RBV A;  1RBR A;  1V4T A;  3LM9 A;  2OTJ N;  3NH0 A;  4H5R A;  2UUC K;  4NO7 A;  4CZG A;  2PBD A;  1BA1 A;  4FK2 A;  4BVP A;  1O13 A;  1T44 A;  1HLU A;  1QZ5 A;  4CEO A;  4IFE A;  3DJC A;  1JKH A;  5LMN K;  3LDP A;  1U6Z A;  4DTO A;  4CHO A;  5TKW A;  4ID1 A;  4DV3 K;  1DGK N;  3HSC A;  4CFA A;  1SQK A;  1NLV A;  1KAZ A;  3SAH A;  2CGJ A;  1X9M A;  2NRR A;  4X62 K;  4K41 A;  5MLC Q;  2E4L A;  1LWE A;  4FJ5 A;  3E9L A;  1RDC A;  3HOT A;  2A1R A;  3MEE A;  5E26 A;  2WTU A;  3ATU A;  4CF2 A;  3QIN A;  4JKG B;  4CEE A;  3NH1 A;  2F8S A;  3R6M A;  4M3Z A;  1NJW A;  4IOC L;  3C0B A;  1B92 A;  3TAR A;  4MO4 A;  2W00 A;  1I3A A;  2B5J A;  2GEL A;  4K8Z A;  1SL1 A;  4BC2 A;  1QE1 A;  5DMR A;  1RTI A;  1N8R O;  4CI6 A;  1MDU B;  1ZXO A;  5GIO A;  1EO1 A;  4EIA A;  1X9S A;  3VEZ A;  3AVI A;  3C95 A;  2F96 A;  3SMS A;  3SK3 A;  5GAD P;  3UB5 A;  1HYZ A;  1OVY A;  3K9K A;  1SV5 A;  1SAZ A;  4GW6 A;  3EN9 A;  2OZM A;  1WOQ A;  3AA3 A;  4XH4 A;  3EE9 A;  1OH8 A;  5AZI B;  1P8Z A;  3S9H A;  3TTF A;  1B9D A;  1K8K A;  3E01 A;  3I0R A;  3S3M A;  3CJ1 A;  4KTW A;  4B3O A;  1Z05 A;  3VF6 A;  5LJV A;  3LDO A;  4RW6 A;  4CGD A;  1BIU A;  4I6M B;  3NDK A;  1NGE A;  1HKB A;  4FJI A;  3AO4 A;  4ILH A;  3OBW A;  2P9S A;  3U4L A;  1WLJ A;  5HBM A;  3L2V A;  4IDK A;  1LW2 A;  4H4M A;  3CM5 A;  4BE7 B;  3AO1 A;  3HZ6 A;  3E1Y A;  4DS4 A;  3J7Y P;  3WQU A;  3GOI A;  3E9O A;  1RNH A;  3CYM A;  4DSJ A;  5JMV A;  2VWK A;  1U48 A;  4LSN A;  1WBD A;  3ZSQ A;  2A1S A;  2P9L B;  3AVF A;  3SI6 A;  1GLE G;  4DF4 A;  1A5X A;  1NNE A;  4FJM A;  1TKZ A;  3AA2 A;  2IVN A;  3UIQ A;  3SNN A;  5FLX O;  3MXM A;  3LZJ A;  1YTU A;  1J53 A;  3KLH A;  3HT3 A;  4BDP A;  3HPO A;  3AVM A;  5AQN A;  4OO1 J;  1ASV A;  3HXM A;  4F3T A;  4BY9 C;  2HHW A;  1RIL A;  1HKG A;  4DHY A;  4N56 A;  4KHU A;  1BA0 A;  4CHY A;  4B1X B;  4KFB A;  3RRG A;  2YCH A;  5JIC A;  2YNI A;  4I9Q A;  2HHI A;  4DS5 A;  1EET A;  4BRH A;  3DXM B;  4JD2 B;  1HPM A;  1QSL A;  5F0X A;  5DK5 A;  2O8E B;  2FSJ A;  1I39 A;  4NCA A;  4YOV A;  4JN4 A;  4K43 A;  2YKM A;  2Z1I A;  4CJ3 A;  1QZ6 A;  4WFN L;  3P1G A;  4DV5 K;  3S3N A;  2IC3 A;  2VWB A;  4A61 A;  4KAZ A;  2BUP A;  4QS9 A;  4DTM A;  2UUA K;  4DV7 K;  2Q0R A;  3NHG A;  1NJZ A;  3J7A P;  4BGB A;  2P9P A;  1CZB A;  2FBX A;  2Q97 A;  4MQ3 A;  1ITG A;  3B8A X;  2VG7 A;  3VEX A;  3TAN A;  5AQH A;  5CHI A;  3JXU A;  4AHV A;  1WSE A;  2F7T A;  5FPD A;  3OYK A;  3TAP A;  4J2B A;  2ZWH A;  2HVH A;  3AAR A;  1HX1 A;  4A57 A;  4DUZ K;  5BPN A;  2CGL A;  5E84 A;  1K8A O;  1SS6 A;  1KC8 O;  4U7B A;  4M3W A;  3I33 A;  2B6A A;  2QTD A;  5GIP A;  4O0J A;  3JAM O;  2C1I A;  2WBN A;  3WXL A;  2BDP A;  2LSN A;  4DTP A;  1BI4 A;  3CFR A;  3VQE A;  4CVN E;  1YIJ N;  4GNI A;  1CXU A;  2CH6 A;  5KPT A;  3K58 A;  1GLD G;  1NGI A;  4J8F A;  4CGF A;  3ENO A;  4CE9 A;  4LH4 A;  3PO4 A;  2RKI A;  1IV0 A;  2NRX A;  4CHP A;  2ZJP L;  3THY A;  2YX6 A;  2QK9 A;  3NGY A;  1X9W A;  3AO2 A;  1MU2 A;  4LF9 K;  3KD1 E;  3BGR A;  3ENB A;  4OPH A;  3WXK A;  1U49 A;  2VG5 A;  4H5T A;  3O4W A;  3FE1 A;  3CC4 N;  3QFU A;  2ATQ A;  1YUW A;  4CBX A;  4B9V A;  2DFE A;  3OYI A;  2Q36 A;  2RPI A;  4NYN A;  1BDG A;  1LWF A;  4A2B A;  5I9E B;  5DM7 L;  4CGI A;  4OLA A;  4BG9 A;  1IKY A;  4LFB K;  4BQL A;  2F9T A;  1RDW X;  1ZBU A;  4NLB A;  3RVC A;  1HR0 K;  2JLE A;  2OAN A;  5SWM A;  4MLH A;  4PUO A;  2HW3 A;  3OYL A;  3BEX A;  5C24 A;  4X65 K;  3GL1 A;  2Q1N A;  4IEI A;  2QWR A;  5E41 A;  4UY8 O;  1BHL A;  2KFZ A;  4FJH A;  4CER A;  3WNH A;  5I3U A;  1U4B A;  3M3Z A;  3U9Z A;  3IFR A;  1UA1 A;  1S1T A;  5KGX A;  3I0S A;  1W7A A;  3L4I A;  5FPN A;  4RCH A;  1CZ9 A;  3C7N B;  3PX0 A;  4F2S A;  1S9E A;  4I7F A;  3C6H A;  3L2U A;  3H6E A;  3SAF A;  5LY3 A;  4KTZ A;  3L2Q A;  3IMX A;  3KLI A;  3L6Q A;  2XY8 A;  4Q0B A;  1KLM A;  4JKF A;  3FZH A;  4IFV A;  3CJA A;  1XNR K;  3PUF A;  3MXI A;  3U9D A;  2DPN A;  3BF3 A;  3LAK A;  4IKF A;  5M1Q A;  4BE1 A;  4NXN K;  1L3S A;  4PL7 A;  4W5O A;  3D45 A;  5J2P A;  1N33 K;  3RMC A;  4O0I A;  3F73 A;  4KHY A;  2VQF K;  4DU3 A;  4M3Y A;  2O4I A;  3VMF B;  3VTH A;  4CFD A;  3R1X A;  5FRM A;  1RTJ A;  5HRS A;  2YHW A;  3S5T A;  1VRU A;  4NCG A;  2D0A A;  1HKC A;  3KTQ A;  2ZE2 A;  4NXM K;  1TGO A;  1YJN N;  4CJQ A;  1TV6 A;  2XRI A;  3KLG A;  3MK6 A;  4CEQ A;  3OA9 A;  1ATR A;  3CJ9 A;  1HYS A;  1J5E K;  3U8X A;  4OPK A;  4FWO A;  3UKR B;  4FJ9 A;  4O55 A;  1KFD A;  2ZD1 A;  3EYZ A;  1YJ9 N;  5LL6 Z;  1Q8I A;  5AR0 A;  4DQP A;  4N41 A;  3L3U A;  2GX9 A;  1V4S A;  3AVN A;  3A8Y A;  2HND A;  4DSI A;  3RR7 A;  5ADX H;  1ILY A;  5AQK A;  2OPQ A;  3S41 A;  4M42 A;  4IFY A;  4UQG A;  4CES A;  3S3O A;  2JGU A;  5M1N A;  4FJL A;  1JCF A;  5BRD A;  3WUH A;  3AA4 A;  3K5N A;  2FSK A;  1RFQ A;  2E5L K;  3VGK A;  4AQY K;  1QHT A;  1NGH A;  1LOT B;  3D2E A;  5AFU H;  4RW9 A;  3PSI A;  3F2K A;  3QEX A;  2DTU A;  3FR0 A;  4JNE A;  3VEN A;  3J8A A;  4Y1D A;  4HUE A;  5BR8 K;  1NKE A;  4FK0 A;  4OPJ A;  2ASP A;  4Y0W A;  4K8X A;  1RT4 A;  2F8T A;  3ZT0 A;  1JCG A;  2HHQ A;  5J2N A;  5AQT A;  3M8S A;  1YVU A;  2G8H A;  4JKC A;  1FKP A;  1VRT A;  3KD5 E;  3TAM A;  4CJF A;  4EHU A;  2QWN A;  4E7K A;  3QEW A;  2P9I B;  1L5U A;  3DMJ A;  4FLV A;  3D2F A;  1RTD A;  4AF1 A;  4KHS A;  4CJT A;  2EX3 A;  3W0L A;  1UA0 A;  4CK3 A;  3FZK A;  4NLC A;  1N32 K;  3V9X A;  2GBZ A;  4JKD A;  2PY5 A;  3HK2 A;  4KHQ A;  5CYM A;  4FK4 A;  4DSF A;  4BG8 A;  1JL2 A;  2NRZ A;  3EY1 A;  1VQ5 N;  4JI3 K;  3QNO A;  3VQ6 A;  3O9R A;  3EE8 A;  3O6W A;  2YNG A;  5HLF A;  3D6R A;  1GLL O;  4YDU A;  1WN7 A;  2VQE K;  2UXB K;  2X74 A;  5FRO A;  1VQ4 N;  4JI2 K;  3K5M A;  3CJB A;  2YNH A;  3SPY A;  5A2Q O;  3VES A;  4CK2 A;  4CGJ A;  2P9U A;  2P51 A;  3M6G A;  4BRC A;  5GAE P;  3CC7 N;  3IG1 A;  1EKE A;  1RDB A;  2XHB A;  4GV3 A;  1S72 N;  4BRN A;  2O8D B;  1L3V A;  1S5J A;  2Y1I A;  3T1A A;  3OYJ A;  4FLX A;  2P9N A;  3EL2 A;  2HBL A;  1FKO A;  4LC9 B;  3EEQ A;  2G8V A;  3SMP A;  4LF4 K;  4K0K K;  4GV6 A;  4WFA L;  1NGF A;  1LV5 A;  3WNG A;  1N34 K;  3AGK A;  4BRL A;  1IKV A;  4B3S K;  1S6P A;  2ZJQ L;  3VQ8 A;  4FLZ A;  3LP2 A;  4ELT A;  4FPB A;  1OVQ A;  2Q2R A;  5J2M A;  2R7Y A;  4JI8 K;  4G9Z A;  3PV8 A;  3QIO A;  3KLE A;  3DLH A;  3A5M C;  4E7J A;  3RSE B;  3ULE A;  3ZSV A;  2UUB K;  1HMV A;  1JLQ A;  4BDY A;  1REV A;  4GY2 B;  4YOW A;  1OH6 A;  1EX4 A;  5M1K A;  3FGU A;  2P1J A;  1NOY A;  1X3M A;  3OYN A;  5CYQ A;  2OYQ A;  3SJH A;  3I8D A;  3AV9 A;  3CYG A;  5AQY A;  3E66 A;  1C0G A;  1NWK A;  3IRX A;  3QO9 A;  5CR4 A;  3THW A;  1FW6 A;  3CCL N;  4B9Q A;  4B1Z A;  5C25 A;  1F21 A;  3HJF A;  4PKG A;  4CHZ A;  1NMN A;  4DU4 A;  2Z1G A;  2NRW A;  1YHQ N;  2E1Y A;  4B1W B;  3PO5 A;  4YOY A;  3L2R A;  3G25 A;  5M1F A;  4W5Q A;  4XIU A;  4PY5 A;  3O9Q A;  1HRH A;  3DRS A;  5TKY A;  1K9M O;  1XUP O;  3V1R A;  2XY5 A;  4FJG A;  2HHS A;  4DFK A;  3KKS A;  4CJV A;  4I9L A;  1OH7 A;  1WNS A;  1YF5 L;  1VQK N;  3MX2 A;  4KTQ A;  4ZTF A;  2Z1H A;  2A3Z A;  3NMU A;  4CIF A;  2W42 A;  4Z94 A;  4CZK A;  1EWQ A;  1FK9 A;  4A5A A;  4A5B A;  1RT6 A;  1KSP A;  3M8Q A;  3ZEU A;  1BIS A;  3KK2 A;  3TTD A;  3CME N;  3KZB A;  2IOC A;  1HPZ A;  1T6C A;  1T05 A;  2PYJ A;  3CQX A;  4GKK K;  3DXK A;  2OZS A;  4JEP A;  1RGI A;  3KK3 A;  5AQW A;  3V6D A;  2KW4 A;  1NM1 A;  4JI6 K;  4E1M A;  3RWU A;  5SZT A;  1VSE A;  5HP1 A;  1LAV A;  3AVL A;  1H1V A;  3MEG A;  3A0I X;  2NRT A;  1D8Y A;  1JLG A;  4NYF A;  4CK1 A;  5T7B A;  4H0P A;  1R0A A;  1VSL A;  4O44 A;  3PY8 A;  4E1J A;  4BRQ A;  3ZT4 A;  3AVB A;  1SL0 A;  1SKR A;  1YTA A;  5AQQ A;  1BWF O;  1DT9 A;  1WB9 A;  4CBU A;  4OKE A;  4TSX A;  2GV9 A;  4L3Q A;  3SBT A;  1TYQ B;  2G8U A;  4HHT A;  5D3G A;  4CJW A;  3B6O A;  3HPH A;  3AVH A;  2W40 A;  4H5V A;  3BZK A;  5KPZ A;  4C8M A;  4WCE L;  1C0T A;  4IG0 A;  4CFC A;  2QWP A;  3H45 C;  2OPS A;  3TAB A;  1Q82 O;  1QQO A;  4BDZ A;  3VPZ A;  3I8B A;  3TR8 A;  3NH2 A;  5I42 A;  1S6Q A;  2QWL A;  1S1X A;  2HOE A;  1TUU A;  3LP0 A;  5AQV A;  3T69 A;  3VEO A;  4CBW A;  3TI0 A;  1YXQ A;  3EKU A;  4BRA A;  3VQ5 A;  4IOX A;  3QET A;  3HI0 A;  2WOM A;  1XNQ K;  1C1C A;  2VCP A;  5JEN A;  3OY9 A;  1IKW A;  2NRH A;  2X6N A;  4J2E A;  3HOS A;  3PIO L;  1RT3 A;  2O8F A;  3A5O C;  4B08 A;  3A2F A;  2HVI A;  5AQP A;  2FSN A;  1GOA A;  3F5T A;  4H0X B;  1IG8 A;  4FJX A;  2ZGY A;  3I55 N;  3G71 N;  2FF3 B;  4I2Q A;  3SQ1 A;  2Q3S A;  1TAQ A;  1VSH A;  5JS1 A;  1DTT A;  3G6E N;  2AP1 A;  2Z1J A;  4FXD A;  2QA4 N;  4M7Y A;  4M45 A;  2D0O A;  2HHH K;  3TAG A;  1U45 A;  4ILG B;  3OYM A;  1J6Z A;  3CXC M;  3QFP A;  4C8O A;  3C6U A;  1RDU A;  1HQU A;  4BR0 A;  2RE2 A;  4PHT X;  3WQT A;  4N76 A;  2Q31 A;  3O08 A;  3BZC A;  3J81 O;  1VSJ A;  3QDK A;  3VEV A;  5HRP A;  4LFA K;  2F9W A;  3KJV A;  4DTS A;  4BRP A;  1OH5 A;  4YOU A;  4B1V A;  1BOT O;  1VSF A;  3DOL A;  2YV0 X;  2E6L A;  4DFJ A;  1A5W A;  2PZS A;  3HM8 A;  2O8B A;  1BUP A;  4E19 A;  1KQS M;  3VQC A;  3EO3 A;  3AVC A;  3T3F A;  3NF7 A;  3JYT A;  5AQI A;  3OYA A;  2O8C B;  4FM2 A;  3MN5 A;  4OVL A;  3HVR A;  3AVA A;  3LAN A;  3C94 A;  3R8E A;  3DLB A;  3BF1 A;  5KQD A;  1NK4 A;  3P4I A;  3V9U A;  1D5A A;  3SV4 A;  4JK9 A;  1RT5 A;  5BN9 A;  3ALY A;  4ICL A;  2D0P A;  4BE0 A;  3MMV A;  4GVM A;  2PAV A;  3ID8 A;  4BRK A;  2QI2 A;  3K9J A;  3AA5 X;  4FWK A;  4ISE A;  5BRE A;  2QEX N;  1KVC A;  1NJI O;  4CCH A;  1BCM A;  2E2Q A;  1IH7 A;  2HHV A;  3OBY A;  4JHD A;  2QWO A;  4JKA A;  3VQ4 A;  4KHN A;  4PKI A;  3BUZ B;  1RDA A;  2OPR A;  3ZSW A;  3H3O B;  4CED A;  4JS5 A;  5AQL A;  2ZM6 K;  1QSY A;  3T1H K;  4ISF A;  3MWP A;  3H1V X;  3TSU A;  2H3G X;  2YHY A;  1NJY A;  1DTQ A;  1GLB G;  2EWS A;  1D9D A;  1SUQ A;  4FWQ A;  3ZYY X;  3DLL L;  5ELZ A;  3NGI A;  4FZZ A;  3O80 A;  4XEI A;  1L3T A;  4YDU C;  1T7P A;  4BWJ A;  5AQX A;  3T19 A;  3VQ9 A;  3HST B;  3T7Z A;  4O5B A;  4DR7 K;  2HHT A;  1C0M A;  1QHA A;  3KK7 A;  3EKS A;  2O4G A;  5H1S Q;  4K25 A;  2IVP A;  5GAG P;  2BGG A;  4Z4C A;  2KKZ A;  1VSI A;  3LDQ A;  1LW0 A;  3CET A;  1JLE A;  3ITH A;  5BPL A;  4M3T A;  4NCB A;  3WXM B;  4B9N A;  4V19 S;  1X3N A;  1ASW A;  1QQC A;  1K8K B;  2YHX A;  4E3S A;  2DFH A;  2HHX A;  2WUS A;  4E7I A;  1BGX T;  2WFB A;  4CHQ A;  3CIP A;  1ZBF A;  4DTJ A;  3HP6 A;  2P9S B;  2QXL A;  5JLH A;  3NVK A;  3UKU A;  3SJJ A;  1XWL A;  3LL3 A;  4QS8 A;  3SAG A;  3DM2 A;  2PFU A;  3L2W A;  3CC2 N;  3ZET A;  1NGG A;  1HNV A;  4BRI A;  5KTQ A;  4FL9 A;  3RTV A;  3G4S N;  4FVM A;  2OCE A;  4EZ6 A;  4BR2 A;  4HTU A;  4JKB A;  1VSD A;  1W97 L;  1RTH A;  4PKH A;  4W5N A;  3NAE A;  4AH9 A;  5KRS A;  3DAW A;  2G8F A;  1T6D A;  1WSJ A;  3TSQ A;  4YOX A;  2FLO A;  1XMQ K;  1Z25 A;  3TSP A;  1BU6 O;  3J80 O;  4JS4 A;  4JV5 K;  3SZ2 A;  4ELV A;  2BH1 A;  4B3M K;  3C6T A;  4AHS A;  4C8N A;  4ID5 A;  4W5R A;  2ASM A;  2D4W A;  3VEW A;  3OS2 A;  1VQN N;  3LP3 A;  3G10 A;  3NF8 A;  4B9L A;  3MCA B;  1VSM A;  2GWJ A;  4DQS A;  3FFK B;  3QEP A;  5BR9 A;  1XQS C;  3ZX2 A;  3IUC A;  3WXI A;  3TWH A;  2ZF5 O;  1C1A A;  4BEB A;  2V7Z A;  4CFB A;  5BRH A;  4IO9 L;  3THX A;  3DLG A;  4BC5 A;  5F2R A;  4KI6 A;  1Q86 O;  4JI0 K;  4BQZ A;  4RTF D;  5HOO A;  4DQR A;  2G8I A;  3CD6 N;  5FPM A;  2FC0 A;  2HMI A;  5AQS A;  4DSK A;  4BRG A;  2KQ2 A;  2ITG A;  3QEV A;  3F9M A;  4B9M A;  3P5J A;  1VQ9 N;  3WEE A;  3QEI A;  4CHN A;  4YNQ A;  1UWB A;  1C6V A;  4GV9 A;  2IVO A;  4CJ5 A;  4E7L A;  1E4G T;  2P9P B;  4FZX C;  1KLN A;  3CFO A; 
#chains in the Genus database with same CATH homology
 1SAZ A;  5JLF A;  3EN9 A;  1KXP A;  3MDQ A;  1WOQ A;  3R9P A;  3AAP A;  4K42 A;  4CD3 A;  4GY2 B;  4JAX A;  4XH4 A;  5ADX A;  3IKM A;  4BC4 A;  4YOW A;  3EE9 A;  5AZI B;  1QVF M;  1P8Z A;  3W3D A;  3FGU A;  5M1K A;  1R59 O;  3H46 O;  3TTF A;  4CZL A;  4C23 A;  4F9O A;  1K8K A;  5GAH P;  1X3M A;  1NGB A;  3CJ1 A;  3NVM A;  1JCE A;  1Z05 A;  3VF6 A;  4BVO A;  3SJH A;  5B8H A;  5LJV A;  3GBT A;  3LDO A;  2P9K B;  3AY9 A;  4MDB A;  5AQY A;  4I6M B;  3CJC A;  1NGE A;  3E66 A;  1E4F T;  1HKB A;  3KVG A;  1C0G A;  5JVH L;  3FZF A;  4ILH A;  3OBW A;  1NWK A;  5CR4 A;  5AZJ A;  2P9S A;  3U4L A;  3HTV A;  4IEE A;  1K73 O;  3CCL N;  4B9Q A;  4B1Z A;  5EOY A;  2P9I A;  1SZ2 A;  2HBK A;  5AFU A;  4PKG A;  3O1B A;  5GIN A;  3PIP L;  4BE7 B;  3HZ6 A;  4BRD A;  3E1Y A;  3KWG A;  1X9J A;  1Q18 A;  3PLA A;  3WQU A;  2NRW A;  3GOI A;  1YHQ N;  3E9O A;  5AQR A;  5JMV A;  2E1Y A;  4B1W B;  4CZI A;  2YI1 A;  1NBW A;  1GLC G;  4YOY A;  3G25 A;  4GVE A;  4JKE A;  3CHW A;  3ZX3 A;  5M1F A;  2E2N A;  3D7E O;  2P9L B;  1TUY A;  2V51 B;  1GLE G;  4YOR A;  4BR4 A;  3O9Q A;  2IVN A;  4H0T B;  4BEB A;  2ZJR L;  2VGN A;  5TKY A;  3CCU N;  1K9M O;  1XUP O;  1QQM A;  2KLA A;  4AM6 A;  3CCM N;  5AQF A;  4BRF A;  2BTF A;  5AQN A;  3SBG A;  4B1Y B;  4WQ4 C;  4OO1 J;  1YF5 L;  1VQK N;  4DQ8 A;  3MX2 A;  4BR7 A;  2GWK A;  3A5N C;  4BY9 C;  2I7N A;  3A5L C;  1P90 A;  2A3Z A;  4EHT A;  1NGD A;  3VGM A;  3NMU A;  1HKG A;  4DHY A;  4Z94 A;  3Q7B A;  4CZK A;  1BA0 A;  4B1X B;  4FOE A;  4A5A A;  4A5B A;  3CCJ N;  2YCH A;  3WT0 A;  5JIC A;  4FWM A;  3ZEU A;  2E2P A;  4BRH A;  3DXM B;  4JD2 B;  1HPM A;  3TTD A;  4FWN A;  4BC3 A;  5F0X A;  3CME N;  4JKG A;  2VYP A;  2IIR A;  3KZB A;  3MCP A;  1T6C A;  4H03 B;  2FSJ A;  2YJE A;  3CQX A;  3N4Q A;  2E2O A;  5M1O A;  3EZW A;  4YOV A;  4JN4 A;  3DXK A;  4K43 A;  3QIC A;  4JEP A;  1RGI A;  5AQW A;  1NM1 A;  4M7X A;  1QZ6 A;  3GG4 A;  4WFN L;  2VWB A;  4A61 A;  2BUP A;  4QS9 A;  4FWS A;  4FWL A;  1H1V A;  1ESV A;  2Q0R A;  5AQU A;  4CJ7 A;  3A0I X;  4BGB A;  5BN8 A;  2NRT A;  3RSE A;  2P9P A;  5C2F A;  1VQL N;  2Q97 A;  3UKU B;  4AM7 A;  1NGA A;  3B8A X;  4H0P A;  4KH4 A;  3VEX A;  4XH1 A;  3DWL A;  2NZT A;  4E1J A;  4BRQ A;  1YJW N;  1M90 O;  5AQH A;  5CHI A;  1ATS A;  3JXU A;  5AQJ A;  1Q7Y O;  1ZBS A;  5AZI A;  5AQQ A;  2E8A A;  2F7T A;  4U67 L;  1BWF O;  5FPD A;  3WXJ A;  1NGC A;  2ZWH A;  1DT9 A;  4CBU A;  4KH5 A;  1KD1 O;  3AAR A;  1HX1 A;  4A57 A;  3E9P A;  5M1P A;  3CPE A;  4I6M A;  4L3Q A;  3SBT A;  5BPN A;  2CGL A;  5E84 A;  4WYB A;  1TYQ B;  1MA9 B;  1DKG D;  2CH5 A;  1SS6 A;  3LDN A;  1KC8 O;  1K8A O;  4U7B A;  3I33 A;  3FZL A;  4DKW A;  1HJO A;  3C6A A;  2QTD A;  4CZM A;  5GIP A;  2W40 A;  4H5V A;  2C1I A;  5KPZ A;  2WBN A;  3WXL A;  4WCE L;  3O8M A;  3KWI A;  3P39 A;  2QWP A;  3H45 C;  2A6A A;  1YIJ N;  1Q82 O;  3N4P A;  3P38 A;  1QQO A;  1GLA G;  4GNI A;  3HRG A;  4JKH A;  2CH6 A;  2UYT A;  5AQM A;  3VPZ A;  4EAH D;  5KPT A;  2I7P A;  3VTI A;  1GLD G;  3I8B A;  2P9L A;  1NGI A;  5KPR A;  4J8F A;  4WQ5 A;  3ENO A;  3CMA N;  4BRO A;  3O9T A;  2QWL A;  4H5W A;  3VER A;  2HOE A;  1TUU A;  3JS6 A;  1M1K O;  5AQV A;  4YOT A;  4JHD B;  3IDH A;  3T69 A;  2NRX A;  3VEO A;  4CBW A;  4JK7 A;  1C0F A;  1MWM A;  1YXQ A;  3EKU A;  4RWT A;  3O9U A;  1QQN A;  4BRA A;  3QML A;  4IOX A;  2ZJP L;  2YX6 A;  2NRV A;  3ID6 A;  3HI0 A;  2A41 A;  2VCP A;  4O5F A;  4H0Y B;  4O8U A;  2NRH A;  1IJJ A;  3HOS A;  3ENB A;  3FZM A;  3PIO L;  1NGJ A;  4OPH A;  3WXK A;  2NNW A;  5HL7 L;  4H5T A;  3O4W A;  1WUA A;  3A5O C;  3FE1 A;  3QFU A;  3CC4 N;  4IXC A;  3OW2 M;  1VQO N;  1YUW A;  5BPM A;  4CBX A;  5AQP A;  2ITM A;  2FSN A;  4JD2 A;  3F5T A;  4H0X B;  4KBO A;  3ZX0 A;  1IG8 A;  3VET A;  2E1Z A;  2Q36 A;  1HUX A;  2ZGY A;  3I55 N;  3G71 N;  2HBM A;  1BDG A;  2FF3 B;  4ISG A;  5FPE A;  4A2B A;  5I9E B;  4H0V B;  4KH6 A;  5DM7 L;  3LM2 A;  4BG9 A;  3G6E N;  2JWL A;  2AP1 A;  3MWT A;  4BQL A;  3CCR N;  2F9T A;  2QA4 N;  3M1F A;  4M7Y A;  1RDW X;  2D0O A;  4NLB A;  4CZF A;  4ILG B;  3MN6 A;  3RVC A;  3KHY A;  1JJ2 M;  2QWQ A;  1J6Z A;  4H0O A;  3Q7C A;  2A40 A;  2OAN A;  3I56 N;  3CXC M;  3MN7 A;  3O1W A;  3P31 A;  3QFP A;  4WFB L;  1RDU A;  1VAZ A;  4MLH A;  4BR0 A;  2RE2 A;  3D2E B;  3WQT A;  4PHT X;  3TTC A;  3BEX A;  4BR9 A;  2Q31 A;  3O08 A;  1YIT N;  3GL1 A;  1W2B M;  1S3X A;  2Q0U A;  2Q1N A;  4FWR A;  4IEI A;  3QDK A;  1S22 A;  2QWR A;  4OPA A;  3TPQ A;  3VEV A;  4BGA A;  4UY8 O;  2F9W A;  4A62 A;  4BRP A;  5KQ8 A;  4YOU A;  4B1V A;  5C2D A;  1BOT O;  3BP8 A;  3M3Z A;  3U9Z A;  3IFR A;  1VQ7 N;  3HM8 A;  1BUP A;  1KQS M;  4HTL A;  2HST A;  2NLX A;  3L4I A;  3EO3 A;  5FPN A;  4RCH A;  3SLC A;  2C1G A;  2FF6 A;  1EQY A;  2QW9 A;  3C7N B;  2WC9 A;  2D1K A;  3CQY A;  3C6H A;  1TYQ A;  3H6E A;  3SAF A;  3CCQ N;  1VQ6 N;  3H3N O;  5LY3 A;  2A42 A;  5AQI A;  4FSV A;  1U2V A;  3IMX A;  3L6Q A;  4MLE A;  3MN5 A;  3CF5 L;  4BRM A;  4JKF A;  3FZH A;  3R8E A;  4DB3 A;  2HF4 A;  3CJA A;  3D2F B;  3BF1 A;  4BR5 A;  5KQD A;  5EXW A;  3U9D A;  3P4I A;  2DPN A;  3VF2 A;  3ZET B;  3BF3 A;  3CCV N;  1VQ8 N;  4IO8 A;  5M1Q A;  3OHR A;  4IJA A;  1T3V A;  4JK9 A;  5BN9 A;  3TU5 A;  4PL7 A;  4R79 A;  2D0P A;  3MMV A;  1ZC6 A;  2YJF A;  2PAV A;  2P9K A;  1Z6R A;  3ID8 A;  5EX5 A;  3VOV A;  2QI2 A;  3K9J A;  4FWK A;  4ISE A;  4A59 A;  4BRK A;  5BRE A;  1NJI O;  4CZH A;  2V7Y A;  4IDH A;  3GDQ A;  3VMF B;  2QEX N;  3VTH A;  1LCU A;  1ATN A;  2E2Q A;  3R1X A;  4O8K A;  3OBY A;  5LJW A;  2YHW A;  4JHD A;  3CCS N;  2QWO A;  3MX5 A;  1NMD A;  4JKA A;  1HKC A;  1BG3 A;  4PKI A;  4WF9 L;  3BUZ B;  4WQ4 A;  4HWI A;  1YJN N;  4A2A A;  3H3O B;  3MK6 A;  3OA9 A;  1ATR A;  3CJ7 A;  3CJ9 A;  5AQL A;  2VGM A;  3U8X A;  4FWO A;  1MWK A;  4ISF A;  3UKR B;  1OKJ A;  3MWP A;  2W41 A;  3H1V X;  3VF4 A;  3TSU A;  5C10 A;  2H3G X;  2YHY A;  3LDL A;  5CE3 A;  5DM6 L;  1VQP N;  1YJ9 N;  1GLB G;  2EWS A;  2V52 B;  5AR0 A;  4DCH A;  2HF3 A;  1VQM N;  2GX9 A;  1V4S A;  2P9U B;  3A8Y A;  4FWQ A;  5ADX H;  2FXU A;  2GUP A;  3ZYY X;  2KHO A;  1ILY A;  2GEM A;  3M5R A;  3DLL L;  5AQK A;  4IWV A;  5ELZ A;  3S41 A;  2P9N B;  1BO5 O;  3O80 A;  4XEI A;  4NB4 A;  3C65 A;  4YDU C;  5F1X A;  4CD1 A;  5AQX A;  5M1N A;  4XJX A;  1JCF A;  2QM1 A;  5BRD A;  1YI2 N;  3WUH A;  3T7Z A;  4BEC A;  1GLF O;  1XC3 A;  3CPW M;  2ASO A;  2FSK A;  3FLC O;  3WEE B;  1RFQ A;  5AQG A;  3VGK A;  4BRE A;  1QHA A;  1NGH A;  3KK7 A;  4CZE A;  5C12 A;  3EKS A;  1LOT B;  4EFH A;  3D2E A;  5H1S Q;  5JVG L;  5AFU H;  4K25 A;  2IVP A;  4FVU A;  5GAG P;  3J7Z O;  3DXM A;  2KKZ A;  3F2K A;  3ULE B;  1KAY A;  3LDQ A;  3FR0 A;  3CET A;  4JNE A;  3VEN A;  3J8A A;  5BPL A;  4C1N K;  2E88 A;  2ASP A;  4Y0W A;  3WXM B;  1X3N A;  3QBW A;  1GLJ O;  3ATV A;  3CI5 A;  3GE1 A;  4B1U B;  1JCG A;  3R3L A;  4IZ9 A;  4C1N I;  1K8K B;  5AQT A;  2YHX A;  3CCE N;  4FOI A;  4FPA A;  2WUS A;  3L4Q A;  2CGK A;  3AGR A;  3C7N A;  4JKC A;  3UB5 A;  1QVG M;  3H1Q A;  1D4X A;  2WFB A;  1KAX A;  3CIP A;  2JWK A;  4EHU A;  5AQZ A;  5AZJ B;  2QWN A;  2P9S B;  3QB0 A;  2QXL A;  4H5N A;  5JLH A;  3NVK A;  1DEJ A;  2HBJ A;  3UKU A;  2P9I B;  5C15 A;  3LL3 A;  4QS8 A;  3SAG A;  3D2F A;  1V4T A;  3LM9 A;  2PFU A;  2OTJ N;  4AF1 A;  5AQO A;  3CC2 N;  3VEY A;  4H5R A;  1NGG A;  3ZET A;  4BRI A;  4FL9 A;  3QBX A;  3G4S N;  1G99 A;  3CER A;  4NO7 A;  3W0L A;  4CZG A;  2PBD A;  4BR2 A;  4JKB A;  3FZK A;  4NLC A;  1W97 L;  4PKH A;  1BA1 A;  4PL8 A;  3DAW A;  4WQ5 C;  1T6D A;  1O13 A;  4BVP A;  1CZA N;  3O9S A;  4JKD A;  1T44 A;  1Q81 O;  1HLU A;  1QZ5 A;  4XH5 A;  4IFE A;  3TSQ A;  3DJC A;  4YOX A;  4BG8 A;  1VQ5 N;  2NRZ A;  2FLO A;  3TSP A;  1BU6 O;  3LDP A;  3O9R A;  1U6Z A;  3EE8 A;  3O6W A;  5TKW A;  5EVZ A;  2BH1 A;  1DGK N;  3HSC A;  3D6R A;  4ILJ A;  1SQK A;  1NLV A;  3VGL A;  1KAZ A;  2ASM A;  2D4W A;  3VEW A;  3SAH A;  1VQN N;  1GLL O;  4YDU A;  4FO0 A;  2CGJ A;  5BRF A;  2A5X A;  2AA4 A;  2NRR A;  4JK8 A;  3MCA B;  3UKR A;  2OTL N;  4K41 A;  2GWJ A;  1VQ4 N;  5EY4 A;  3FFK B;  5MLC Q;  5BR9 A;  3CJB A;  1XQS C;  3ZX2 A;  3E9L A;  3IUC A;  3WXI A;  4CZJ A;  2ZF5 O;  3HOT A;  3ZEU B;  1YAG A;  2V7Z A;  3AAQ A;  3VES A;  2P9U A;  3M6G A;  4FWP A;  4BRC A;  5GAE P;  5BRH A;  3CC7 N;  4IO9 L;  5E26 A;  4QS7 A;  4GV3 A;  1YVN A;  1S72 N;  4BRN A;  3ATU A;  4BC5 A;  4JKG B;  5F2R A;  2ZGZ A;  1Q86 O;  5C0Y A;  4BQZ A;  2P9N A;  3EL2 A;  2HBL A;  4RTF D;  5HOO A;  3R6M A;  4LC9 B;  2E20 A;  3SMP A;  2HMP A;  4GV6 A;  4WFA L;  1NGF A;  4IOC L;  3CD6 N;  3C0B A;  5FPM A;  3DXK B;  5AQS A;  4BRG A;  4MO4 A;  3AGK A;  4BRL A;  4MO5 A;  1Y64 A;  4IOA L;  2W00 A;  3F9M A;  4M63 C;  2ZJQ L;  1VQ9 N;  3L0Q A;  2GEL A;  4IJN A;  4BC2 A;  3WEE A;  1N8R O;  3UE5 A;  2QWM A;  1MDU B;  1ZXO A;  3HBT A;  4FPB A;  4CI6 A;  4EIA A;  5GIO A;  1EO1 A;  2Q2R A;  3VEZ A;  4G9Z A;  4GV9 A;  2RHK A;  2IVO A;  3A5M C;  1U2V B;  1E4G T;  3RSE B;  3ULE A;  2P9P B;  3MN9 A;  4MDA A;  2GTD A;  3SK3 A;  3SMS A;  3ENH A;  1OVY A;  3O5B A;  5GAD P;  3K9K A;  2J4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...