1YAGA

Structure of the yeast actin-human gelsolin segment 1 complex
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
372
structure length
372
Chain Sequence
b'EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ACTIN)
publication title The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 116
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 1998-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1yagA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yagA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yagA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1yagA04
1K8KB 4XH4A 2GTDA 1X3MA 4CZLA 3VESA 1NGHA 3ULEB 1XC3A 3VOVA 4LC9B 5AQRA 4CD1A 1ATSA 4YDUA 1DKGD 4BR9A 3EKUA 1H1VA 3L0QA 3QBWA 5E84A 4BRDA 1OKJA 3HZ6A 4JHDA 3LM2A 1YUWA 4Y0WA 4BRHA 5JLFA 5F1XA 4H0PA 3A5OC 3GL1A 4H0XB 1HUXA 5AZIA 4BR4A 3ZETA 5EXWA 3GOIA 3AAPA 1JCFA 4FWRA 4FWSA 3O80A 1BG3A 1WUAA 5AQHA 3CQXA 4B1YB 2CGKA 1GLLO 2CGLA 3LL3A 3QFPA 2ASMA 4MLEA 2HF4A 3M6GA 3VPZA 5AQFA 3TPQA 3M3ZA 4DHYA 4FOIA 3D7EO 3L6QA 1GLBG 3FZLA 4FWLA 4CZIA 2YHWA 3D2FB 2P9KA 3GBTA 4BRPA 2P9UA 1BU6O 2WUSA 2FXUA 1G99A 5AFUA 1V4TA 4BR5A 4EAHD 4CBUA 3UKRB 3SLCA 4FWNA 4O5FA 4BC3A 3A5LC 4E1JA 5BN9A 3MN9A 1TUUA 3VEOA 4B1XB 5F0XA 4J8FA 4H5NA 2YHXA 2E2QA 3DXMB 5EY4A 1BOTO 5FPEA 3JS6A 3MN5A 1R59O 2HMPA 1Y64A 2I7NA 3FE1A 1MDUB 4ISEA 4CBWA 5BPMA 4BC5A 1SQKA 3IFRA 1GLEG 3JXUA 2BTFA 4RCHA 1S3XA 5JLHA 2PBDA 3H1QA 3DXMA 4K25A 3F9MA 2FLOA 3A5MC 3J8AA 1ZC6A 2AP1A 5FPMA 3U4LA 2VCPA 1HJOA 3HI0A 1T44A 4FPAA 1WOQA 3G25A 5EOYA 3U9ZA 3LDLA 2NZTA 4JN4A 4EHTA 2NLXA 4A62A 4NB4A 2OANA 2Q31A 1P8ZA 1C0FA 2Q36A 1U2VB 2QWOA 3HM8A 1IG8A 2D0PA 3I33A 2P9LB 5KQDA 3WUHA 1JCEA 3ZX0A 4IJNA 4WQ5C 2HF3A 4O8KA 1NMDA 5AZJB 1MA9B 2A5XA 1U2VA 2VYPA 2YI1A 4A61A 4H0YB 2KHOA 2Q1NA 4A2BA 3FZMA 4JAXA 3S41A 5AQXA 4AM7A 5CE3A 1NM1A 2GWJA 4BR7A 5AZJA 4HWIA 2QWQA 4H5VA 4A2AA 3VEXA 1U6ZA 2VWBA 1TYQB 1YVNA 4M63C 3QB0A 2P9PB 2A42A 3WQTA 3CERA 2GEMA 1KAXA 3O6WA 2GELA 2IVPA 4FWPA 5AQIA 3SMSA 1HKGA 1E4FT 3AAQA 3WXKA 3GG4A 1GLJO 3CIPA 2ZWHA 3LDQA 4BG9A 3VGKA 2ASPA 3WEEA 4BQLA 4K43A 3CI5A 4XEIA 1NGFA 4BR0A 3A0IX 5AQOA 2D0OA 4ISGA 4JHDB 3IDHA 1ATNA 4JD2A 1IJJA 3VF2A 4Z94A 5AQNA 1QZ5A 1TUYA 5AZIB 3ZETB 5BRFA 4EFHA 1SAZA 2E1ZA 2ZGYA 4HTLA 3CJ7A 2NRHA 3VF6A 5AQTA 1XQSC 4CI6A 3L4IA 1LCUA 3LDNA 3CJAA 2D4WA 2QWNA 5I9EB 2BUPA 4PL8A 1ATRA 3VETA 1LOTB 4BC4A 5AQMA 1QQNA 4PKHA 1ZBSA 4DB3A 3UKUA 1C0GA 1RFQA 1BO5O 2P9KB 3BF3A 3A5NC 4XH5A 2P9UB 2V52B 3EO3A 2E88A 3I8BA 1BA0A 3WT0A 1KAZA 3KZBA 4BC2A 4B1UB 2A3ZA 1RGIA 3HSCA 2P9SB 4ISFA 4QS8A 1T6DA 3LM9A 2P9IA 3QDKA 3DAWA 2CGJA 2PAVA 2YJFA 2P9NA 4RTFD 3RSEB 1SZ2A 2P9SA 4FSVA 4M7YA 1NGBA 3GDQA 1BWFO 2D1KA 3MN7A 3CJ1A 2GWKA 4EIAA 4CZFA 1DGKN 4NO7A 3RSEA 3O4WA 2CH6A 3BUZB 1NGAA 5LJWA 3FLCO 4FWMA 4I6MB 1NGIA 2A6AA 4H0OA 1NGCA 3VEWA 5BPLA 5ADXH 5AQPA 2FF6A 1HX1A 5AQYA 4BRMA 5AQUA 1NLVA 4I6MA 4PL7A 3H3OB 2E8AA 5AQJA 2GUPA 3UE5A 4IJAA 4BRFA 1KXPA 3O1BA 3LDOA 1Q18A 2J4RA 4CZGA 3GE1A 4JNEA 4MLHA 1T6CA 3DXKA 3H3NO 4B1ZA 2F9TA 4AM6A 3EL2A 5BRHA 4BVOA 4RWTA 3BF1A 3VERA 3C7NA 2CH5A 5BRDA 1E4GT 5KQ8A 3MN6A 1DEJA 4XH1A 3FZFA 5AQGA 1QQOA 1HKCA 5AQWA 3VGMA 2A41A 1RDWX 3IMXA 1Z6RA 4H03B 3WEEB 1NGDA 3D2EB 4PKGA 3WXJA 3FGUA 4H5RA 3SK3A 3M1FA 3H1VX 2A40A 3FFKB 4BRGA 3ID8A 3WQUA 4PKIA 3D2EA 4JD2B 4EHUA 5KPZA 3BP8A 3QFUA 1QZ6A 3VF4A 4CD3A 1X9JA 3WXIA 3WXLA 4CZHA 2YJEA 5JICA 3R6MA 2ITMA 3EZWA 4H5WA 4C23A 4DQ8A 4CBXA 4BREA 4M7XA 3QMLA 2F9WA 3FZKA 4BVPA 3ENOA 1D4XA 2FF3B 4BRKA 3MDQA 4FOEA 1BUPA 1BDGA 1ZXOA 3B8AX 4IXCA 3R9PA 3O08A 5KPTA 2QXLA 4CZKA 4BRAA 3FR0A 4GNIA 3UKUB 1YXQA 1GLCG 1YAGA 3KHYA 1KAYA 5BN8A 4BGAA 3W0LA 4B1WB 1V4SA 1K8KA 2QWPA 3AARA 1NGGA 3O1WA 3ULEA 3OHRA 1S22A 3FZHA 4WQ4C 5B8HA 1GLDG 1NBWA 4H5TA 4BROA 5ELZA 2P9IB 4CZJA 2FSNA 3KVGA 3LDPA 2IVOA 4MO5A 2E1YA 5AQZA 3VEZA 4B9QA 4BRCA 4F9OA 2ZGZA 5AFUH 2FSJA 3BEXA 2HOEA 2P9NB 4FWKA 1XUPO 1HKBA 1QQMA 3CJCA 4WQ5A 5TKYA 4FO0A 4DCHA 2DPNA 5BR9A 3CJBA 1CZAN 3UB5A 3SMPA 1MWMA 2YHYA 3VEYA 3QBXA 5AQSA 1BA1A 3ZX3A 3IUCA 5FPDA 2V7ZA 1HPMA 4QS7A 3CQYA 3HTVA 2Q0RA 2IVNA 2V7YA 5E26A 5KPRA 3TU5A 2QWRA 4H0TB 2E2NA 3MK6A 2H3GX 4BRNA 2E2OA 3MCPA 4IWVA 4K42A 3H45C 1NGJA 3D2FA 5FPNA 3SJHA 3EKSA 5EVZA 4YDUC 4KBOA 4FPBA 4BRLA 2QW9A 3C0BA 5AQLA 4BR2A 3DXKB 3O5BA 3UKRA 4BQZA 4CZMA 2ZF5O 3O8MA 5JMVA 1Z05A 1JCGA 3QICA 4BGBA 2AA4A 2V51B 4BRQA 3DJCA 2I7PA 3C7NB 5AR0A 1EQYA 1ESVA 3ATUA 1GLFO 3ZX2A 2IIRA 4FWQA 3R8EA 3P4IA 4B1VA 5ADXA 4FL9A 2W41A 2UYTA 2E2PA 2YCHA 5F2RA 4WYBA 3ZEUB 4CJ7A 4L3QA 3A8YA 5BPNA 2Q97A 5LY3A 5EX5A 3W3DA 2FSKA 3DWLA 3H46O 4GY2B 3ZEUA 1HLUA 3VEVA 5AQVA 4CZEA 2ASOA 1GLAG 1J6ZA 3HBTA 5LJVA 4K41A 4WQ4A 3ENHA 4MO4A 2P9LA 2QWMA 3EN9A 4BG8A 5AQQA 1NGEA 1X3NA 1QHAA 2E20A 5BREA 4IZ9A 3CJ9A 3MMVA 2EWSA 2Q0UA 2QM1A 2QWLA 3U8XA 3CHWA 4IO8A 3AY9A 2Q2RA 3VENA 2W40A 3ATVA 3CETA 4H0VB 4QS9A 3VGLA 4FWOA 5AQKA 1MWKA 1TYQA 3H6EA 3U9DA 2P9PA 4BRIA 1NWKA
chains in the Genus database with same CATH superfamily
1K8KB 5DMRA 3OYGA 2YKNA 1RCHA 4QCLA 1NU0A 3L4QA 1VSKA 4A57A 5HRNA 3ULEB 4DV4K 3ZSQA 1BQNA 4LC9B 4FJJA 5AQRA 5KGWA 1NNEA 4CD1A 1ATSA 4YDUA 3E9LA 4FLZA 3J80O 4CHOA 1OKJA 3HZ6A 4JHDA 3RRGA 3NGIA 2GBZA 2O4IA 4H0PA 5AZIA 2HSTA 4FZXC 3NHGA 2NRRA 4NXMK 1JCFA 4CF1A 5JVHL 1BISA 3QNOA 3O80A 4E7JA 3B6OA 2F96A 5AQHA 3CQXA 2UUAK 4DQIA 1GLLO 1VQMN 2OZSA 4MLEA 1N36K 3VPZA 4OJRA 1X9WA 3I0RA 3VQAA 3D7EO 3FZLA 4PA1A 2JGUA 2P9UA 3IRXA 4CF9A 2UU9K 2FXUA 1N33K 1NKEA 5AFUA 2NRZA 1V4TA 4AF1A 4EAHD 1KD1O 3DMJA 2EX3A 3MN9A 1TUUA 3AA2A 2VWKA 1HR0K 4B9UA 3K2PA 1SL1A 2FBXA 1D9FA 3QINA 4CJ4A 1RT1A 2YHXA 2E2QA 2Z1JA 3DXMB 3K57A 1BOTO 5FPEA 1LAVA 3FE1A 1FK9A 1Y64A 5LMUK 4O0JA 2G8FA 1KVAA 4FK4A 2HBKA 3SCXA 3NAEA 1KCFA 3U4LA 3MX2A 4LH4A 4O5BA 5FPMA 3I56N 1EO1A 1HJOA 4Z0UA 3RMBA 4B3RK 3G25A 1FJGK 2F4VK 4EHTA 5CHIA 2XO7A 2NLXA 4DF4A 3TSPA 2D0CA 4HVJA 1WLJA 4KHYA 1P8ZA 4C8OA 3M8RA 4KHSA 2D0PA 2P9LB 4GVMA 1QQCA 1XNQK 3WUHA 3CCJN 1S1XA 2HF3A 3PUFA 4WQ5C 5GADP 1IV0A 3AVIA 1U2VA 4A61A 3QNNA 2KHOA 3FZMA 4LY7A 4OPHA 4W5RA 4GV9A 2GWJA 3VA3A 1EXQA 1CLQA 4HWIA 3VEXA 1Q82O 2VWBA 4KI4A 1YITN 3LPTA 1XWLA 3SMSA 1HKGA 3PY8A 1E4FT 3GG4A 1WAFA 2W42A 4DTJA 2ZWHA 1G15A 2ASPA 5J2PA 4A5BA 1J5EK 1NGFA 4H8KA 4BR0A 4GMJB 5AQOA 4KTWA 4MDBA 2WONA 1J53A 4DSKA 4JHDB 3ITHA 1RDCA 5AQNA 5AZIB 4DTSA 5HL7L 1KC8O 1HYSA 2E1ZA 3THVA 3CJ7A 4J2AA 3LZJA 3CCMN 5HLFA 4UQGA 3HOTA 4FJLA 2B5JA 5FRMA 4EZ9A 1QVFM 1VSFA 3EY1A 2ZJPL 2QWNA 5I9EB 1A5WA 3VETA 4M3RA 1S1UA 3M8QA 4PKHA 1VQ5N 4DB3A 1C0GA 4U67L 4BEBA 2D0AA 3AVFA 2P9UB 4CJEA 1S6QA 3KLIA 4N41A 4DLEA 5DM6L 4JKGB 4CJ5A 3EYZA 2P9SB 3LP0A 1U45A 1U47A 1T6DA 2VGMA 3RWUA 1REVA 3L3VA 1Q7YO 2CGJA 4NCAA 1QS4A 3TAEA 2HHHK 4FSVA 1Y97A 3GDQA 1BWFO 5JVGL 4F4KA 4ELUA 4EIAA 4FW2A 3L2QA 4WFAL 1KFDA 1NJZA 1GOBA 1NGAA 3BUZB 3VQCA 4CJFA 2A1RA 1JLBA 2A6AA 4H0OA 5BPLA 4NYFA 1S5JA 5AQPA 2FF6A 5AQYA 3QESA 2G8UA 1RILA 2HBJA 5AQUA 2XY8A 1L3UA 2QA4N 5JENA 5AQJA 1RT7A 4IJAA 4KTQA 1KXPA 3O1BA 1JLQA 4KRFA 2GUIA 1LWFA 3CPWM 2O4GA 3OYLA 3EL2A 4CGIA 4N56A 2XHBA 3BF1A 4KV8A 4OPJA 3DRRA 3OS2A 3MN6A 3O3GA 3SZ2A 4JI5K 4XH1A 5AQGA 1QQOA 1VK0A 1HKCA 5AQWA 2VWJA 3CFOA 3Q7BA 5KI6A 5M1FA 2E4LA 4H5RA 3M1FA 2A40A 3ZLJA 4I9LA 2DY4A 1VQPN 4PKIA 1BCOA 2Z1GA 4CECA 4B3MK 4B9MA 3BP8A 3LANA 3NGZA 4CEQA 1YI2N 1HQUA 3WXIA 3SAHA 2IAJA 2YJEA 5JICA 4DR4K 4C23A 4DQ8A 1L3VA 1QE1A 4DSEA 4BREA 2OTLN 3CCUN 3KD1E 3FZKA 4E7IA 1FW6A 4BRKA 3ALYA 3MDQA 4FOEA 4IEEA 5M1KA 3B8AX 4BRAA 4E7KA 2XY6A 3WNHA 5K14A 1YXQA 5C12A 2P1JA 2BDPA 1TL3A 5BN8A 1JLEA 3OYDA 2QWPA 3AARA 3VMFB 1VQLN 3O1WA 1VRUA 4DR2K 4WQ4C 5B8HA 1N8RO 3LWMA 2JWKA 4CZJA 4DQRA 4MO5A 1I3AA 2E1YA 3VEZA 3I8DA 3HVTA 4JI2K 1X1PA 3BEXA 4A59A 3SQ0A 4FWKA 1XUPO 4R5PA 4H4MA 4CE9A 2RPIA 1RDBA 5BR9A 3UB5A 3BDPA 3K9JA 3KK1A 5M1NA 3VEYA 1CXUA 2YNIA 4CW7B 3ZX3A 4ELVA 2V7ZA 4DU1A 1HPMA 1JLCA 1I39A 3CQYA 2YNFA 3TU5A 1N6QA 5JS2A 4O8UA 3T7ZA 1XC9A 2QKBA 1BI4A 4F8RA 4RG8A 3SJHA 1KLMA 4KBOA 3SYZA 4KH4A 1RT6A 2W6KA 4BR2A 3OYAA 3UKRA 4BQZA 2ZF5O 1UOCA 3O9TA 3QICA 4DFKA 3F5TA 4BRQA 1Q81O 4KHUA 3VQQA 1ESVA 3AVAA 1R0AA 2PY5A 4NLBA 1K6YA 3KKSA 3G10A 4OPAA 4BE7B 4FWQA 5ADXA 4WE1A 1YIJN 1RTHA 4ILGB 1LAWA 2XY7A 2E2PA 1TKTA 3F9KA 4YOWA 4CF8A 4E3SA 5EX5A 3TAFA 4GY2B 3KWGA 1C0UA 3NH2A 4HCCA 3DOKA 3OBYA 4EZ6A 1KTQA 5AQVA 3SUNA 2ASOA 4CF0A 4WQ4A 4DV0K 3TR8A 5GAHP 3OYHA 3H08A 2C1IA 1NK5A 4MO4A 3EN9A 3AVMA 4BG8A 5AQQA 1NGEA 5LMNK 2E20A 5BREA 2F7TA 2KQ2A 3LAKA 1C0MA 1YHQN 4CEBA 3SUOA 4JKDA 4ILHA 5HOOA 2EHGA 3U8XA 3OTOK 3L2VA 3HPGA 3E1YA 4QS9A 4H0VB 4IFEA 4WYBA 4B8AB 1BQMA 4CIFA 1BIUA 3IAYA 1NGHA 2KZZA 1Q8IA 4DLGA 1JKHA 5EU7A 1DLOA 3BZCA 3L2WA 1S6PA 2BH1A 2ZJRL 3QBWA 3AO4A 5E84A 1WSFA 4Y0WA 2Q3SA 4H0XB 3GL1A 1HUXA 5J1EA 1SL2A 1ZBIA 2OCEA 2UXCK 4FWRA 4FWSA 1BG3A 4DV7K 3AA4A 2VQEK 5FDLA 4B1YB 1TL1A 4JS5A 4W5NA 2CGLA 3LL3A 3CMAN 1C1BA 4BDYA 3MEDA 2GV9A 3WNEA 1JLFA 1RT4A 1WNSA 4R79A 4DHYA 4JI7K 4FOIA 4FM0A 3L6QA 4FWLA 4IDHA 3OVNA 2FBYA 4X64K 3PO4A 1BI4B 1T05A 4FJ9A 4A5AA 4CJQA 4BE0A 2WUSA 5SZTA 4FJGA 4BR5A 4CBUA 3UKRB 3A5LC 3MEEA 5BN9A 1NK7A 4O55A 3ZSXA 4H5NA 4CEEA 4FK0A 3CFPA 3V9SA 1U48A 3JS6A 4ISEA 2HMPA 2I7NA 4FLXA 1KVCA 2IS3A 2BTFA 3ZT4A 4KHQA 5JLHA 2UXDK 3H1QA 3DXMA 3F9MA 2FLOA 1CZ9A 3AVBA 2VCPA 4K8ZA 2FBTA 1T44A 4FPAA 3DM2A 2BGGA 3VN5A 1F21A 4JN4A 2YNGA 1FKPA 1FXXA 1ILYA 4M3UA 4M45A 4DV5K 4EP5A 2IC3A 1NOYA 2Q36A 1VSEA 3HP6A 4KTZA 3V4IA 1LWEA 5M1PA 3KLEA 3EE8A 3ZX0A 4BDZA 3AVLA 3NDKA 4H0YB 4JAXA 3S41A 4E7LA 2W00A 4AM7A 1X9MA 2QTDA 1XMOK 1IBLK 3KK7A 3QLHA 4AILC 4AQYK 1U6ZA 4CIGA 2ZJQL 3V1OA 3DLKA 1KAXA 3O6WA 2GELA 2IVPA 2RHKA 1VQ9N 3J7AP 4J2BA 1RT2A 3WXKA 5GAEP 3AO1A 3CIPA 4BG9A 4KHWA 3HYFA 3K5OA 1WSJA 4XEIA 2D0OA 2XRIA 1LV5A 1IKWA 3IDHA 3E01A 3T1HK 4CJPA 1IJJA 3BZKA 1ASUA 4Z94A 4PHTX 1QZ5A 2D0BA 2F8TA 1ASWA 3TSQA 2F8SA 4DR6K 1SAZA 3TSUA 4HTLA 3NF6A 4FJHA 3CCVN 4BECA 5AQTA 1NKCA 4CI6A 4MQ3A 4B08A 3CYMA 4F3OA 1QSYA 3THWB 1O1WA 2BUPA 4HTUA 1ATRA 4FZZA 4FLTA 3VTIA 3C6UA 3CF5L 1ZBSA 4BE2A 4N76A 4FW1A 2OPSA 4E19A 4JI1K 3PSFA 4W5QA 3V9UA 2E88A 3I8BA 1BA0A 3WT0A 2W6LA 3PSIA 3ASMA 2A3ZA 1RGIA 3CCRN 1C6VA 4ISFA 4QS8A 2P9IA 3CMEN 5CYMA 1YJ9N 3C6HA 3D0PA 4JKGA 3AVNA 2PAVA 3RSEB 2P9NA 4KO0A 4NLCA 3KIOA 4I2QA 2VG6A 2P9SA 4DQPA 1NGBA 2WFBA 3C6AA 3EEQA 1WBBA 3DLBA 4CZFA 3OJSA 3O4WA 3ZSRA 5LJWA 5GINA 1RT3A 3FLCO 4FWMA 4WF9L 3VQ7A 4I6MB 1NGIA 1NGCA 1W97L 1HX1A 4KAZA 3OYCA 1NLVA 4AHSA 4PL7A 1BL3A 4PQUA 1VQ4N 2GUPA 3SJJA 3BY5A 5KRTA 4C1NI 3CCSN 4JNEA 3OJUA 1HNWK 2O8EB 2HHWA 1RNHA 4YY3K 5BRHA 2IGIA 4BVOA 1QVGM 3WXMB 1VQON 4KHNA 3VERA 3C7NA 4YFUA 4CF2A 1E4GT 1J5OA 4JK7A 3NH0A 5KQ8A 4OKEA 4LF9K 4Z4CA 3FZFA 3B6PA 3CM5A 3IMXA 4DQQA 3MX5A 1NGDA 3D2EB 3CCLN 3SK3A 2B6AA 3RR7A 3HSTB 4FJ8A 3FFKB 4BRGA 1B92A 1EX4A 3WQUA 4OO1J 2HNDA 4LFBK 5HBMA 4CK3A 4CIEA 2RKIA 4CD3A 1X9JA 2NRVA 2P51A 4DTPA 3HO1A 3O3FA 4ID1A 3QMLA 3S3OA 3ZT1A 4DFMA 2HHSA 1BUPA 1NMNA 3R9PA 1W2BM 3O08A 4FLWA 4F2RA 1SKWA 1ZBHA 3NH1A 4GNIA 4XIUA 1XNRK 1KAYA 1IKYA 1S72N 3FFIA 1WSGA 4BGAA 3W0LA 4B1WB 3K0SA 1HQEA 2R7YA 2KKZA 1S1VA 3OHRA 3FZHA 3LP3A 4H5TA 4BROA 4M3XA 2P9IB 3DOLA 2FSNA 3KVGA 3LDPA 2IVOA 5AQZA 3NMUA 3THYA 5GIPA 2ZM6K 2ZGZA 2FSJA 1OH7A 4XJXA 2P9NB 3HRGA 1DTTA 1OVQA 4CJTA 1HKBA 3CXCM 3PX6A 1TGOA 3MCAB 2FBVA 4WQ5A 3C94A 3SNNA 4FO0A 3F2KA 4DCHA 4C8LA 3CJBA 1CZAN 1ZYQA 4CK2A 3HP9A 3S3MA 2HNYA 1XMQK 3OY9A 3QBXA 1J54A 4BDPA 2UUCK 2WBNA 5AQSA 1VQ6N 3SBTA 3IUCA 4CGHA 5FPDA 4JRQA 4KB0A 3HTVA 2Q0RA 2IVNA 3LALA 5E26A 5HROA 3AGKA 1B9FA 4H0TB 3MCPA 1DT9A 3H45C 1NGJA 5FPNA 5D3GA 3K5LA 3MAQA 3EKSA 3OYNA 4KKOA 4JKFA 1ZBLA 3HPHA 3DLRA 4CEZA 3VQ6A 1KSPA 3LPUA 4KB1A 3SV4A 2AA4A 2I7PA 3C7NB 3DRSA 1EQYA 1YTAA 3ATUA 2JWLA 4YOTA 4CERA 1EP4A 2IIRA 4H4OA 3R8EA 1SKRA 3TTFA 3O9RA 3CQ8A 4E7HA 3ZEUB 1YT3A 4L3QA 4HHTA 4E72A 5BPNA 2E6LA 3W3DA 2FSKA 3DWLA 2ZQBA 3VQ5A 5HRPA 4DR5K 3CC4N 3VEVA 1VSLA 1SV5A 3UIQA 1J6ZA 4K41A 3ENHA 1HNVA 2HHUA 3K59A 4CJLA 3QIPA 5C2DA 4CFBA 5FROA 3LP2A 2Q0UA 1UA0A 2QWLA 4DS4A 3WNFA 3AY9A 2G8HA 4CHNA 2W40A 1RDUA 3VGLA 3PV8A 2HW3A 1TYQA 3U9DA 2P9PA 4BRIA 3P39A 3TAQA 1IO2A 5HP1A 3AGRA 4XH4A 1N34K 3IS9A 1UWBA 4CZLA 3OYIA 3VESA 3SQ1A 1XC3A 1D8YA 4JLHA 2AJQA 1DKGD 4BR9A 3THYB 4FJXA 1H1VA 4CJKA 3DLHA 3S5TA 4FJNA 3LM2A 2Y1IA 4BRHA 1IBMK 5F1XA 1Z26A 4BR4A 2PYJA 3OW2M 1WSIA 5EXWA 3GOIA 3AAPA 3AO2A 2O8DB 3OYMA 1C0TA 4DR1K 1BCMA 4RW9A 1T3VA 3QFPA 4LFAK 2ASMA 1NG9A 4OX9K 4KHPK 3RRHA 3PX4A 3M6GA 3MXMA 2WTUA 3NF8A 5AQFA 3M3ZA 3NGYA 4FVUA 1GLBG 4KI6A 2YHWA 3GBTA 3K5NA 4IG3A 3RMDA 4G9ZA 1G99A 2PFUA 3SLCA 1NK0A 4FWNA 4BC3A 4E1JA 3V6DA 4BACA 4DR7K 3U3YA 4C8NA 3OYEA 3VEOA 5F0XA 2B4JA 4J8FA 3AA5X 5EY4A 4IOCL 2VG7A 3MN5A 1R59O 1MDUB 5BPMA 4BC5A 1SQKA 3IFRA 1K8AO 3JXUA 3MEGA 3O4QA 1S3XA 5E41A 4KREA 1VSHA 3SPZA 4K25A 3A5MC 3J8AA 3O9UA 4FJKA 3G6EN 1DTQA 3HI0A 4JRPA 1RBSA 4LH5A 4Z4IA 2OTJN 3LDLA 3OYBA 5CYQA 4A62A 4Z4EA 4QAGA 4NB4A 3OA9A 4CHPA 2QKKA 4FXDA 3HM8A 3OS1A 1IG8A 2P5GA 4NCGA 3AO3A 5KQDA 3ZSZA 4IJNA 4AH9A 1T03A 4O8KA 1NMDA 4FCYA 5AZJB 2P5OA 1MA9B 4KH6A 3O4NA 2VYPA 2YI1A 4FJIA 4M41A 3CG7A 5AQXA 1TK5A 2NRWA 1NM1A 4BR7A 4CFDA 2DTUA 4A2AA 4O44A 4I2PA 5H1SQ 1N5YA 3OYKA 1TYQB 1YVNA 4M63C 3QB0A 2P9PB 1TV6A 3CERA 2GEMA 4NXNK 4AHCA 5C25A 4E1NA 4X62K 3AV9A 4HUGA 4CJ3A 3AAQA 1BGXT 4RW7A 2XY5A 3LDQA 3J7YP 4DQSA 1VHXA 3VGKA 4BQLA 2NRTA 1YVUA 3NVMA 3CI5A 4DV6K 3OYJA 3T1YK 4OKKA 4IKFA 3WNGA 3PX0A 1OH5A 4FZYA 1VQ8N 2VG5A 3Q7CA 2OZMA 1NKBA 4JD2A 5I3UA 3VF2A 4DU3A 4HCBA 4CJSA 1IKXA 4C1NK 1TUYA 4DTXA 4J2EA 1W9HA 2HHVA 5GAGP 1GOCA 3AVJA 2YHAA 3V9XA 4I7FA 1XQSC 1LCUA 3LDNA 5HRSA 3CJAA 3HJFA 5C42A 4JKEA 4PL8A 4BC4A 4DMNA 3A2FA 4JKCA 4DV2K 4I9QA 3UKUA 1EETA 3C65A 1BO5O 3THWA 1RBRA 3A5NC 4XH5A 3AVHA 2V52B 3JAMO 4FJ5A 5CZ2A 4BC2A 5C0YA 4B1UB 3PIOL 4B3SK 4DTRA 1TK0A 4GV3A 2KW4A 4DU4A 4CFCA 1JL2A 3DAWA 2YJFA 4RTFD 1SZ2A 3DYAA 4KFBA 2D1KA 3CJ1A 2GWKA 3KJVA 1HYVA 1WB9A 1DGKN 2E6MA 4NO7A 3RSEA 1UA1A 2I5JA 4B9NA 4FLYA 3KD5E 4B9SA 2VGNA 2DFEA 1JXBA 4BRMA 4OGCA 4PY5A 2QI2A 4I6MA 5J2NA 1M90O 4LF7K 1QSSA 4BRFA 1KQSM 1Q18A 3SQ4A 4CZGA 3GE1A 4DF8A 3D6RA 3RMCA 3SUPA 3DXKA 3H3NO 3QEWA 5GIOA 4AM6A 3T1AA 4AHVA 4DSLA 2O8EA 1OH8A 2BANA 3I0SA 5FLXO 1ASVA 2QXFA 3TAPA 3ZCMA 1FKOA 2A41A 1RDWX 1T7PA 4LF8K 4LSNA 4PKGA 4JKBA 3WXJA 2Y1JA 3OYFA 4MDAA 1QTMA 4JS4A 1TAUA 1W7AA 4NYNA 3D2EA 4JD2B 3QFUA 3CYGA 2HVHA 2LSNA 4YNQA 1VQNN 1HMVA 4JYAK 3WXLA 3NVKA 3O9QA 3R6MA 2ITMA 3EZWA 3L3UA 1S1WA 1A5XA 2C1GA 1VSMA 2F9WA 1Q9YA 4DR3K 3KK2A 2HB5A 1D4XA 2FF3B 4BE1A 1EKEA 1TVRA 1ZXOA 4FYDA 5KPTA 1HNXK 3TI0A 2QXLA 3QEPA 3TWHA 4CZKA 3FR0A 4GW6A 2IDOA 2HHQA 3UKUB 4W5TA 3KHYA 1KFSA 2GX9A 1YF5L 3G71N 1S9EA 3TABA 3G0ZA 3MECA 3QO9A 1V4SA 1B9DA 3VA0A 2JLEA 2WOMA 1NBWA 4OLAA 2KFZA 4B9QA 4F9OA 4BRCA 4Y1CA 3MXJA 4YOVA 1YJWN 5AFUH 2G8VA 3ISNC 2G8KA 3S3NA 4IG0A 4K8XA 5M1QA 5TKYA 5DM7L 3DI6A 4CHQA 3HK2A 4L8RB 2UXBK 2YHYA 3MXIA 3SI6A 4DG1A 3KLHA 3N4QA 1SS6A 2NUBA 3LP1A 4BY9C 3CD6N 4IDKA 4CEAA 3SAFA 5KTQA 5M1OA 4CESA 2V7YA 3T69A 4GKKK 1L3SA 2QWRA 3E9PA 3MK6A 2H3GX 2E2OA 1KLNA 4HUFA 3AVCA 3D2FA 5CZ1A 3HT3A 4ILJA 3IKMA 4FPBA 3DXKB 3LZIA 4JI6K 3VQEA 4CZMA 3O8MA 1Q86O 1RDAA 3V9WA 1Z05A 1JCGA 3VQDA 3V81A 2V51B 3DJCA 5AR0A 4DSFA 4DSIA 4GKJK 1GLFO 4DV3K 1RBVA 4C8KA 4OKJA 5MLCQ 1L3TA 4B1VA 4CHZA 4FL9A 3EE9A 3RMAA 4U7BA 4CJ7A 3A8YA 1WAJA 2Q97A 4JEPA 5CY4A 5LY3A 1NOZA 4ICLA 1IKVA 2OPQA 4CCHA 3H46O 1EWQA 1S1TA 2DFFA 1HLUA 3ZEUA 2O8BA 3M8SA 2OPPA 4CZEA 1TK8A 1GLAG 3HBTA 2ZE2A 1QHTA 4M3ZA 2QWMA 3ZSOA 5T7BA 1X3NA 2HHIA 4DTNA 1QHAA 4IOXA 2NNWA 3NBPA 3MMVA 4DS5A 2EWSA 4ZTJA 3MWTA 1BHLA 3CHWA 3ID6A 3OBWA 2DFHA 3SV3A 1WBDA 1OVYA 3VENA 4RW6A 1O13A 4CEFA 3ATVA 3CETA 3M5RA 2UUBK 5C2FA 2KLAA 1MWKA 3AA3A 3QEXA 4WFNL 4B3TK 3DLEA 4UY8O 3T19A 3NFAA 4Z4HA 1JL1A 3F73A 2GTDA 1X3MA 1HJRA 1SL0A 4E0DA 1X9SA 2FC0A 3VOVA 4DFJA 3K5MA 5DK5A 3E9OA 3EKUA 5AJ3K 4O4GA 3L0QA 4BRDA 1XHZA 1D5AA 5C24A 2O8FA 1CXQA 1YUWA 5JLFA 3ZSYA 3A5OC 3DLLL 3TAGA 1K73O 3IG1A 4DV1K 3SQ2A 3ZETA 4EP4A 4KH5A 3KLGA 4JI0K 2RN2A 1JJ2M 3RTVA 1WUAA 3QERA 2CGKA 3QEIA 5J2QA 4JV5K 2HF4A 2O8DA 3C95A 5BR8K 3TPQA 3T3FA 3R3LA 5C10A 2KTQA 3CFRA 4CZIA 3D2FB 2P9KA 2A1SA 4F3TA 3TTCA 4BRPA 2HNZA 1BU6O 1TKXA 3K58A 4YOXA 4O5FA 2WC9A 2O8CA 4CJUA 4B1XB 3SBGA 3RR8A 1YJNN 4CBWA 3THXA 1GLEG 4RCHA 2PBDA 2G8IA 4FK2A 1ZC6A 2AP1A 2X74A 3S9HA 1M1KO 1WOQA 5EOYA 2HVIA 3U9ZA 2X6NA 2NZTA 4FM1A 4LD0A 5C15A 3HOSA 5IWAK 4PUOA 2HMIA 2O8BB 2OANA 3J7ZO 2Q31A 3ENBA 1C0FA 5KRSA 1U2VB 2QWOA 3M8PA 3I33A 4YOYA 1JLAA 1JCEA 1P90A 3LDSA 3ZSWA 4IO9L 2A5XA 1LW2A 1LW0A 2Q1NA 3QETA 4A2BA 2ATQA 1Z25A 5CE3A 3JSMA 4FLVA 5AZJA 4B9TA 2QWQA 2HBLA 4H5VA 2OPRA 4FJMA 3ZSVA 1NK9A 1OH6A 4OPKA 4DWIA 4IFYA 3WQTA 2A42A 3TTDA 1K9MO 4FWPA 5AQIA 4CGGA 1NJYA 4B9VA 4M3WA 1NK8A 2PZSA 3I55N 3V1QA 1GLJO 3L2RA 3AO5A 4E89A 2YHBA 3G4SN 4DFPA 3WEEA 4K43A 1UAXA 4WFBL 3KK3A 3O3HA 4AHUA 3A0IX 2ETJA 4ID5A 1VSJA 4ISGA 3HXMA 5CR4A 2O8FB 1ATNA 4YOUA 4JK9A 1KRPA 4X65K 4CJRA 4JKAA 1I94K 3ZETB 5BRFA 3JYTA 1GOAA 4EFHA 4M3TA 1BIZA 2ZGYA 1U04A 4CK1A 2NRHA 3VF6A 2ZD1A 3V1RA 1TKDA 3L4IA 2BE2A 2D4WA 4OVLA 1JXEA 1LOTB 5AQMA 1QQNA 3CCQN 4K0KK 1ITGA 1WSHA 3CM6A 4B8CA 1NK6A 4CGDA 1RFQA 3NF7A 4AHTA 2Z1HA 4LFCK 2P9KB 1WSEA 3BF3A 4Y1DA 3EO3A 4B3OA 1TAQA 3HVRA 2IOCA 3J81O 1KAZA 1C1CA 3ZT0A 3KZBA 5A2QO 5J2MA 4DTUA 1XI1A 2O8CB 3HSCA 5IT9O 3LM9A 4V19S 1RTJA 3VQPA 3P31A 3QDKA 3THXB 4Q5VA 1RTIA 2YKMA 4M7YA 1TKZA 3MN7A 4KPYA 3NCIA 2QEXN 2CH6A 1T8EA 1NK4A 4M42A 1EWRA 2OYQA 3VEWA 4C8MA 5ADXH 4YHHK 3D45A 1VQKN 3H3OB 2E8AA 4JI8K 1VQ7N 4FLUA 3UE5A 5SWMA 3K9KA 2QK9A 4Z4FA 1WN7A 3LDOA 1HYZA 2J4RA 3PLAA 1LWCA 2RF2A 4RW8A 5JS1A 4MLHA 1T6CA 4B1ZA 2F9TA 1YTUA 1HNZK 4RWTA 3KTQA 2CH5A 3DLGA 5BRDA 3CC2N 2PYLA 1DEJA 4IFVA 1U4BA 1Q9XA 3VGMA 1RT5A 4DSJA 2G8WA 1SKSA 1HPZA 3QIOA 1Z6RA 2KFNA 4H03B 3WEEB 4N47A 3FGUA 3P5JA 4X66K 3H1VX 4O0IA 4MFBA 3ID8A 5KGXA 3AVKA 4WCEL 5HRRA 4EHUA 5KPZA 5FRNA 3ULDA 1QZ6A 3VF4A 3KKRA 4JI3K 4CZHA 4H5WA 1VRTA 4CBXA 4M7XA 4CJVA 4FJ7A 4BVPA 3ENOA 3RVCA 1BDGA 4IXCA 1IG9A 4RW4A 3PIPL 4OGEA 1A5VA 2NRXA 1ZBUA 4GVEA 3PO5A 1GLCG 1YAGA 1N32K 1U49A 4DTOA 4CFAA 1K8KA 1RTDA 4CGJA 4YORA 3ZT3A 1IBKK 3L8BA 4FM2A 4G1QA 1NGGA 4DTMA 3ULEA 3VQ4A 5TKWA 1S22A 1RDDA 2YX6A 3HL8A 1GLDG 3L2UA 4W5OA 3EZ5A 4F2SA 5ELZA 4B9LA 3P1GA 4CGFA 2KZMA 4NCBA 2HOEA 4FVMA 3SAGA 1VSDA 2VQFK 1QQMA 5LL6Z 3CJCA 1J9AA 3KLFA 3O9SA 4OLBA 2DPNA 3N4PA 3P83D 1QSLA 1E3MA 3SMPA 3CCEN 1C1AA 1JLGA 1MWMA 4LF5K 4BWMA 4DUYK 4LF6K 1NJIO 4J2DA 1S9GA 1BA1A 3QEVA 4CHYA 3BGRA 1KVBA 4CVNE 3C6TA 4QS7A 4DUZK 1D9DA 4TSXA 4DKWA 3U6FA 2RE2A 5KPRA 2E5LK 3ZT2A 4BRNA 2E2NA 5I42A 3P38A 2YNHA 4IWVA 3ZYYX 4GV6A 4K42A 3E66A 3U3GA 5EVZA 4YDUC 4BRLA 2QW9A 3C0BA 2D5RA 5AQLA 1RBTA 3SPYA 3O5BA 3NF9A 5JMVA 3HPOA 2Z1IA 4BGBA 1XHXA 4LSLA 1CZBA 3LAMA 3LWLA 4JK8A 1RBUA 1IH7A 4AHRA 3OS0A 4LF4K 4IEIA 4QOZB 3ZX2A 4Q0BA 3P4IA 1W0HA 2YV0X 3CC7N 2W41A 4ZTFA 2UYTA 2YCHA 3AVGA 5F2RA 4CEDA 2ITGA 3HM9A 3R1XA 4CEOA 4PWDA 4M3YA 2HHTA 3VQ9A 4CJWA 1SUQA 4BWJA 3MWPA 4JI4K 1MU2A 1ZBFA 2X78A 5LJVA 3VTHA 2HBMA 3VQBA 3TARA 3V9ZA 3KWIA 4Z4GA 4N5SA 4ELTA 2P9LA 2X6SA 4IOAL 4ZHRA 3TAMA 4IZ9A 3CPEA 3SUQA 2HHXA 1L5UA 3CJ9A 2QM1A 3TANA 3NE6A 1HRHA 1VSIA 3DRPA 4IO8A 1VAZA 4HUEA 2Q2RA 4JKHA 1NJXA 1HNIA 1NJWA 4IBNA 4FWOA 5AQKA 4E1MA 3H6EA 2OA8A 3VQ8A 1NWKA
chains in the Genus database with same CATH topology
1K8KB 3AGRA 4XH4A 2GTDA 1X3MA 3L4QA 4A57A 4CZLA 3VESA 1NGHA 3ULEB 1XC3A 3VOVA 4LC9B 5AQRA 1KD1O 4CD1A 1ATSA 2BH1A 4YDUA 1DKGD 3E9OA 3E9LA 3EKUA 4BR9A 1H1VA 2ZJRL 3L0QA 3QBWA 5E84A 4BRDA 1OKJA 3HZ6A 4JHDA 3LM2A 1YUWA 4Y0WA 4BRHA 5JLFA 5F1XA 4H0PA 3A5OC 3GL1A 4H0XB 3DLLL 1HUXA 1K73O 5AZIA 4BR4A 2HSTA 3OW2M 2NRRA 3ZETA 5EXWA 3GOIA 4KH5A 3AAPA 1JCFA 4FWRA 5JVHL 4FWSA 3O80A 1BG3A 1JJ2M 1WUAA 5AQHA 3CQXA 4B1YB 2CGKA 1GLLO 1T3VA 2CGLA 3LL3A 3QFPA 3CMAN 2ASMA 1VQMN 4MLEA 2HF4A 3M6GA 3VPZA 5AQFA 3TPQA 3M3ZA 4DHYA 4R79A 3R3LA 4FOIA 5C10A 3D7EO 3L6QA 4FVUA 1GLBG 3FZLA 4FWLA 4IDHA 4CZIA 2YHWA 3D2FB 2P9KA 3GBTA 3TTCA 4BRPA 2P9UA 4A5AA 1BU6O 4G9ZA 2WUSA 2FXUA 1G99A 5AFUA 2NRZA 2PFUA 1V4TA 4AF1A 4BR5A 4EAHD 4CBUA 3UKRB 3SLCA 4YOXA 4FWNA 4IFEA 4O5FA 4BC3A 3A5LC 4E1JA 2WC9A 5BN9A 3MN9A 1TUUA 3VEOA 4B1XB 5F0XA 3SBGA 4J8FA 4H5NA 2YHXA 2E2QA 3DXMB 5EY4A 4IOCL 1BOTO 5FPEA 3JS6A 3MN5A 1R59O 2HMPA 1Y64A 2I7NA 3FE1A 1MDUB 4ISEA 4CBWA 5BPMA 4BC5A 1SQKA 3IFRA 1K8AO 1GLEG 3JXUA 2BTFA 2HBKA 4RCHA 1S3XA 5JLHA 2PBDA 3H1QA 3DXMA 4K25A 3F9MA 2FLOA 3A5MC 3J8AA 1ZC6A 2AP1A 3MX2A 3O9UA 5FPMA 2VCPA 3U4LA 3I56N 3G6EN 1EO1A 1HJOA 3HI0A 1T44A 4FPAA 1M1KO 1WOQA 3G25A 5EOYA 3U9ZA 4BRNA 3LDLA 2OTJN 2NZTA 4JN4A 4EHTA 5CHIA 2NLXA 4A62A 5C15A 3TSPA 3HOSA 4NB4A 2OANA 1ILYA 3J7ZO 2Q31A 3ENBA 1P8ZA 1C0FA 3OA9A 2Q36A 1U2VB 2QWOA 3HM8A 1IG8A 2D0PA 3I33A 2P9LB 4YOYA 5M1PA 5KQDA 3WUHA 1JCEA 3EE8A 3ZX0A 4IJNA 3CCJN 1P90A 4WQ5C 2HF3A 4O8KA 1NMDA 5GADP 4IO9L 5AZJB 1MA9B 4KH6A 2A5XA 1U2VA 2VYPA 2YI1A 4A61A 4H0YB 2KHOA 2Q1NA 4A2BA 3FZMA 4JAXA 3S41A 5AQXA 2W00A 4OPHA 4AM7A 2NRWA 5CE3A 1NM1A 2QTDA 2GWJA 4GV9A 4BR7A 3KK7A 4HWIA 2QWQA 2HBLA 4H5VA 4A2AA 5AZJA 3VEXA 1U6ZA 1Q82O 2VWBA 5H1SQ 1TYQB 1YVNA 2ZJQL 4M63C 3QB0A 2P9PB 2A42A 3TTDA 3WQTA 3CERA 1YITN 1K9MO 2GEMA 1KAXA 3O6WA 2GELA 2IVPA 2RHKA 4FWPA 5AQIA 3SMSA 1HKGA 1VQ9N 1E4FT 3AAQA 3WXKA 3GG4A 3I55N 1GLJO 5GAEP 3CIPA 2ZWHA 3LDQA 4BG9A 3G4SN 3VGKA 2ASPA 3WEEA 4BQLA 2NRTA 4A5BA 4K43A 4WFBL 3NVMA 3CI5A 4XEIA 1NGFA 4BR0A 3A0IX 5AQOA 2D0OA 4MDBA 4ISGA 4JHDB 3IDHA 5CR4A 1ATNA 3Q7CA 4YOUA 1VQ8N 4JK9A 4JD2A 1IJJA 3VF2A 4Z94A 5AQNA 4PHTX 1QZ5A 4JKAA 4C1NK 1TUYA 5AZIB 5HL7L 1KC8O 3ZETB 3TSQA 5GAGP 5BRFA 4EFHA 1SAZA 2E1ZA 3TSUA 2ZGYA 4HTLA 3CJ7A 3CCVN 2NRHA 3VF6A 5AQTA 4BECA 1XQSC 3CCMN 4CI6A 3HOTA 3L4IA 1LCUA 1QVFM 3LDNA 2ZJPL 3CJAA 2D4WA 2QWNA 5I9EB 4JKEA 2BUPA 4PL8A 1ATRA 3VETA 1LOTB 4BC4A 5AQMA 1QQNA 4JKCA 3VTIA 3CCQN 3CF5L 4PKHA 1ZBSA 1VQ5N 4DB3A 3UKUA 1C0GA 3C65A 1RFQA 1BO5O 4U67L 4BEBA 2P9KB 3BF3A 3A5NC 4XH5A 2P9UB 2V52B 3EO3A 2E88A 3I8BA 1BA0A 3WT0A 1KAZA 5DM6L 4JKGB 3KZBA 4BC2A 5C0YA 4B1UB 2A3ZA 1RGIA 3HSCA 3PIOL 2P9SB 3CCRN 4ISFA 4QS8A 1T6DA 3LM9A 2P9IA 2VGMA 1YJ9N 3CMEN 3C6HA 4GV3A 3P31A 4JKGA 3QDKA 3DAWA 2CGJA 2PAVA 2YJFA 2P9NA 4RTFD 3RSEB 1Q7YO 4NLCA 1SZ2A 2P9SA 4FSVA 4M7YA 1NGBA 3GDQA 1BWFO 2D1KA 2WFBA 3CJ1A 3MN7A 3C6AA 5JVGL 2GWKA 4EIAA 4CZFA 1DGKN 4NO7A 3RSEA 4WFAL 2QEXN 3O4WA 2CH6A 3BUZB 1NGAA 5LJWA 5GINA 3FLCO 4FWMA 4WF9L 4I6MB 1NGIA 2A6AA 2VGNA 1NGCA 4H0OA 3VEWA 5BPLA 1W97L 5ADXH 5AQPA 2FF6A 1HX1A 5AQYA 2HBJA 5AQUA 4BRMA 1NLVA 2QI2A 4I6MA 4PL7A 1M90O 1VQKN 3H3OB 2E8AA 1VQ4N 2QA4N 5AQJA 2GUPA 1VQ7N 3UE5A 3K9KA 4IJAA 4BRFA 1KXPA 3O1BA 1KQSM 3LDOA 1Q18A 2J4RA 3PLAA 4CZGA 4C1NI 3CCSN 3GE1A 4JNEA 3D6RA 4MLHA 3CPWM 1T6CA 3DXKA 3H3NO 4B1ZA 5GIOA 2F9TA 4AM6A 3EL2A 5BRHA 4BVOA 1QVGM 3WXMB 1VQON 4RWTA 3BF1A 3VERA 3C7NA 2CH5A 5BRDA 3CC2N 1E4GT 4JK7A 5KQ8A 3MN6A 1DEJA 4XH1A 3FZFA 5AQGA 1QQOA 1HKCA 5AQWA 3VGMA 2A41A 1RDWX 3IMXA 1Z6RA 3Q7BA 3MX5A 4H03B 5M1FA 3WEEB 1NGDA 3D2EB 4PKGA 4JKBA 3WXJA 3FGUA 3CCLN 4H5RA 3SK3A 3M1FA 3H1VX 2A40A 3FFKB 4MDAA 4BRGA 1VQPN 3ID8A 3WQUA 4PKIA 4OO1J 4WCEL 3D2EA 4JD2B 4EHUA 5KPZA 3BP8A 3QFUA 1QZ6A 1YI2N 1VQNN 3VF4A 4CD3A 1X9JA 3WXIA 3WXLA 4CZHA 2NRVA 2YJEA 3SAHA 3NVKA 3O9QA 5JICA 3R6MA 2ITMA 3EZWA 4H5WA 4C23A 4DQ8A 4CBXA 4BREA 2OTLN 4M7XA 3CCUN 2C1GA 3QMLA 1YJNN 2F9WA 3FZKA 4BVPA 3ENOA 3RVCA 1D4XA 2FF3B 4BRKA 3MDQA 4FOEA 4IEEA 5M1KA 1BUPA 1BDGA 1ZXOA 3B8AX 4IXCA 3R9PA 3O08A 5KPTA 1W2BM 3PIPL 2QXLA 4CZKA 4BRAA 3FR0A 4GNIA 2NRXA 4GVEA 3UKUB 1YXQA 1GLCG 1YAGA 5C12A 3KHYA 1KAYA 1S72N 2GX9A 1YF5L 3G71N 5BN8A 4BGAA 3W0LA 4B1WB 1V4SA 1K8KA 2QWPA 3AARA 4YORA 3VMFB 1NGGA 2KKZA 1VQLN 3O1WA 3ULEA 3OHRA 1S22A 3FZHA 5TKWA 2YX6A 4WQ4C 1GLDG 1NBWA 4H5TA 4BROA 5B8HA 2JWKA 5ELZA 1N8RO 2P9IB 4CZJA 2FSNA 3KVGA 3LDPA 2IVOA 4MO5A 2E1YA 5AQZA 3VEZA 4B9QA 4BRCA 4F9OA 4YOVA 1YJWN 5GIPA 2ZGZA 5AFUH 2FSJA 2HOEA 3BEXA 4A59A 2P9NB 3HRGA 4FWKA 1XUPO 3CXCM 1HKBA 3SAGA 3MCAB 1QQMA 3CJCA 4WQ5A 5M1QA 3O9SA 4FO0A 3F2KA 5TKYA 4DCHA 2DPNA 5BR9A 5DM7L 3CJBA 1CZAN 3N4PA 3UB5A 3SMPA 3CCEN 1MWMA 2YHYA 3K9JA 5M1NA 3VEYA 3N4QA 3QBXA 1SS6A 1NJIO 2WBNA 5AQSA 4XJXA 1VQ6N 1BA1A 3ZX3A 4BY9C 3SBTA 3IUCA 5FPDA 3SAFA 3CD6N 2V7ZA 1HPMA 5M1OA 4QS7A 3CQYA 3HTVA 2Q0RA 4DKWA 2IVNA 2V7YA 5E26A 3T69A 2RE2A 5KPRA 3AGKA 3TU5A 2QWRA 4H0TB 2E2NA 3E9PA 2H3GX 3MK6A 2E2OA 3MCPA 3P38A 1DT9A 4IWVA 4O8UA 3T7ZA 3ZYYX 4GV6A 4K42A 3H45C 1NGJA 3D2FA 5FPNA 3E66A 3SJHA 3EKSA 5EVZA 4ILJA 4KBOA 4YDUC 3IKMA 4FPBA 4BRLA 2QW9A 3C0BA 4KH4A 5AQLA 4BR2A 3DXKB 3O5BA 3UKRA 4BQZA 4JKFA 4CZMA 2ZF5O 3O8MA 1Q86O 5JMVA 1Z05A 1JCGA 3O9TA 3QICA 3F5TA 2AA4A 2V51B 4BGBA 4BRQA 1Q81O 3DJCA 2I7PA 3C7NB 5AR0A 1EQYA 1ESVA 3ATUA 1GLFO 2JWLA 4NLBA 4JK8A 3NMUA 4IEIA 4OPAA 3ZX2A 4BE7B 4YOTA 2IIRA 4FWQA 5MLCQ 3R8EA 3P4IA 4B1VA 5ADXA 4ILGB 4FL9A 3TTFA 1YIJN 3CC7N 3EE9A 2W41A 3O9RA 2UYTA 2E2PA 2YCHA 5F2RA 4WYBA 3ZEUB 4U7BA 4CJ7A 4YOWA 4L3QA 3A8YA 5BPNA 2Q97A 4JEPA 5LY3A 3R1XA 5EX5A 3W3DA 2FSKA 3DWLA 3H46O 4GY2B 3KWGA 3ZEUA 1HLUA 3MWPA 3OBYA 3CC4N 3VEVA 5AQVA 4CZEA 2ASOA 1GLAG 1J6ZA 3HBTA 5LJVA 4K41A 4WQ4A 2HBMA 3ENHA 3VTHA 5GAHP 2C1IA 3KWIA 4MO4A 2P9LA 2QWMA 3EN9A 4BG8A 4IOAL 5AQQA 1NGEA 1X3NA 5C2DA 1QHAA 2E20A 5BREA 4IZ9A 2F7TA 3CPEA 4IOXA 2NNWA 3CJ9A 1YHQN 3MMVA 2EWSA 2Q0UA 2QM1A 4JKDA 4ILHA 5HOOA 3MWTA 2QWLA 3U8XA 3CHWA 3ID6A 4IO8A 3OBWA 3AY9A 1VAZA 1OVYA 2Q2RA 3VENA 2W40A 3E1YA 1RDUA 4JKHA 1O13A 3ATVA 3CETA 3M5RA 4H0VB 4QS9A 3VGLA 5C2FA 2KLAA 4FWOA 5AQKA 1MWKA 1TYQA 4UY8O 3H6EA 3U9DA 4WFNL 2P9PA 4BRIA 1NWKA 3P39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8K B;  4XH4 A;  2GTD A;  1X3M A;  4CZL A;  3VES A;  1NGH A;  3ULE B;  1XC3 A;  3VOV A;  4LC9 B;  5AQR A;  4CD1 A;  1ATS A;  4YDU A;  1DKG D;  4BR9 A;  3EKU A;  1H1V A;  3L0Q A;  3QBW A;  5E84 A;  4BRD A;  1OKJ A;  3HZ6 A;  4JHD A;  3LM2 A;  1YUW A;  4Y0W A;  4BRH A;  5JLF A;  5F1X A;  4H0P A;  3A5O C;  3GL1 A;  4H0X B;  1HUX A;  5AZI A;  4BR4 A;  3ZET A;  5EXW A;  3GOI A;  3AAP A;  1JCF A;  4FWR A;  4FWS A;  3O80 A;  1BG3 A;  1WUA A;  5AQH A;  3CQX A;  4B1Y B;  2CGK A;  1GLL O;  2CGL A;  3LL3 A;  3QFP A;  2ASM A;  4MLE A;  2HF4 A;  3M6G A;  3VPZ A;  5AQF A;  3TPQ A;  3M3Z A;  4DHY A;  4FOI A;  3D7E O;  3L6Q A;  1GLB G;  3FZL A;  4FWL A;  4CZI A;  2YHW A;  3D2F B;  2P9K A;  3GBT A;  4BRP A;  2P9U A;  1BU6 O;  2WUS A;  2FXU A;  1G99 A;  5AFU A;  1V4T A;  4BR5 A;  4EAH D;  4CBU A;  3UKR B;  3SLC A;  4FWN A;  4O5F A;  4BC3 A;  3A5L C;  4E1J A;  5BN9 A;  3MN9 A;  1TUU A;  3VEO A;  4B1X B;  5F0X A;  4J8F A;  4H5N A;  2YHX A;  2E2Q A;  3DXM B;  5EY4 A;  1BOT O;  5FPE A;  3JS6 A;  3MN5 A;  1R59 O;  2HMP A;  1Y64 A;  2I7N A;  3FE1 A;  1MDU B;  4ISE A;  4CBW A;  5BPM A;  4BC5 A;  1SQK A;  3IFR A;  1GLE G;  3JXU A;  2BTF A;  4RCH A;  1S3X A;  5JLH A;  2PBD A;  3H1Q A;  3DXM A;  4K25 A;  3F9M A;  2FLO A;  3A5M C;  3J8A A;  1ZC6 A;  2AP1 A;  5FPM A;  3U4L A;  2VCP A;  1HJO A;  3HI0 A;  1T44 A;  4FPA A;  1WOQ A;  3G25 A;  5EOY A;  3U9Z A;  3LDL A;  2NZT A;  4JN4 A;  4EHT A;  2NLX A;  4A62 A;  4NB4 A;  2OAN A;  2Q31 A;  1P8Z A;  1C0F A;  2Q36 A;  1U2V B;  2QWO A;  3HM8 A;  1IG8 A;  2D0P A;  3I33 A;  2P9L B;  5KQD A;  3WUH A;  1JCE A;  3ZX0 A;  4IJN A;  4WQ5 C;  2HF3 A;  4O8K A;  1NMD A;  5AZJ B;  1MA9 B;  2A5X A;  1U2V A;  2VYP A;  2YI1 A;  4A61 A;  4H0Y B;  2KHO A;  2Q1N A;  4A2B A;  3FZM A;  4JAX A;  3S41 A;  5AQX A;  4AM7 A;  5CE3 A;  1NM1 A;  2GWJ A;  4BR7 A;  5AZJ A;  4HWI A;  2QWQ A;  4H5V A;  4A2A A;  3VEX A;  1U6Z A;  2VWB A;  1TYQ B;  1YVN A;  4M63 C;  3QB0 A;  2P9P B;  2A42 A;  3WQT A;  3CER A;  2GEM A;  1KAX A;  3O6W A;  2GEL A;  2IVP A;  4FWP A;  5AQI A;  3SMS A;  1HKG A;  1E4F T;  3AAQ A;  3WXK A;  3GG4 A;  1GLJ O;  3CIP A;  2ZWH A;  3LDQ A;  4BG9 A;  3VGK A;  2ASP A;  3WEE A;  4BQL A;  4K43 A;  3CI5 A;  4XEI A;  1NGF A;  4BR0 A;  3A0I X;  5AQO A;  2D0O A;  4ISG A;  4JHD B;  3IDH A;  1ATN A;  4JD2 A;  1IJJ A;  3VF2 A;  4Z94 A;  5AQN A;  1QZ5 A;  1TUY A;  5AZI B;  3ZET B;  5BRF A;  4EFH A;  1SAZ A;  2E1Z A;  2ZGY A;  4HTL A;  3CJ7 A;  2NRH A;  3VF6 A;  5AQT A;  1XQS C;  4CI6 A;  3L4I A;  1LCU A;  3LDN A;  3CJA A;  2D4W A;  2QWN A;  5I9E B;  2BUP A;  4PL8 A;  1ATR A;  3VET A;  1LOT B;  4BC4 A;  5AQM A;  1QQN A;  4PKH A;  1ZBS A;  4DB3 A;  3UKU A;  1C0G A;  1RFQ A;  1BO5 O;  2P9K B;  3BF3 A;  3A5N C;  4XH5 A;  2P9U B;  2V52 B;  3EO3 A;  2E88 A;  3I8B A;  1BA0 A;  3WT0 A;  1KAZ A;  3KZB A;  4BC2 A;  4B1U B;  2A3Z A;  1RGI A;  3HSC A;  2P9S B;  4ISF A;  4QS8 A;  1T6D A;  3LM9 A;  2P9I A;  3QDK A;  3DAW A;  2CGJ A;  2PAV A;  2YJF A;  2P9N A;  4RTF D;  3RSE B;  1SZ2 A;  2P9S A;  4FSV A;  4M7Y A;  1NGB A;  3GDQ A;  1BWF O;  2D1K A;  3MN7 A;  3CJ1 A;  2GWK A;  4EIA A;  4CZF A;  1DGK N;  4NO7 A;  3RSE A;  3O4W A;  2CH6 A;  3BUZ B;  1NGA A;  5LJW A;  3FLC O;  4FWM A;  4I6M B;  1NGI A;  2A6A A;  4H0O A;  1NGC A;  3VEW A;  5BPL A;  5ADX H;  5AQP A;  2FF6 A;  1HX1 A;  5AQY A;  4BRM A;  5AQU A;  1NLV A;  4I6M A;  4PL7 A;  3H3O B;  2E8A A;  5AQJ A;  2GUP A;  3UE5 A;  4IJA A;  4BRF A;  1KXP A;  3O1B A;  3LDO A;  1Q18 A;  2J4R A;  4CZG A;  3GE1 A;  4JNE A;  4MLH A;  1T6C A;  3DXK A;  3H3N O;  4B1Z A;  2F9T A;  4AM6 A;  3EL2 A;  5BRH A;  4BVO A;  4RWT A;  3BF1 A;  3VER A;  3C7N A;  2CH5 A;  5BRD A;  1E4G T;  5KQ8 A;  3MN6 A;  1DEJ A;  4XH1 A;  3FZF A;  5AQG A;  1QQO A;  1HKC A;  5AQW A;  3VGM A;  2A41 A;  1RDW X;  3IMX A;  1Z6R A;  4H03 B;  3WEE B;  1NGD A;  3D2E B;  4PKG A;  3WXJ A;  3FGU A;  4H5R A;  3SK3 A;  3M1F A;  3H1V X;  2A40 A;  3FFK B;  4BRG A;  3ID8 A;  3WQU A;  4PKI A;  3D2E A;  4JD2 B;  4EHU A;  5KPZ A;  3BP8 A;  3QFU A;  1QZ6 A;  3VF4 A;  4CD3 A;  1X9J A;  3WXI A;  3WXL A;  4CZH A;  2YJE A;  5JIC A;  3R6M A;  2ITM A;  3EZW A;  4H5W A;  4C23 A;  4DQ8 A;  4CBX A;  4BRE A;  4M7X A;  3QML A;  2F9W A;  3FZK A;  4BVP A;  3ENO A;  1D4X A;  2FF3 B;  4BRK A;  3MDQ A;  4FOE A;  1BUP A;  1BDG A;  1ZXO A;  3B8A X;  4IXC A;  3R9P A;  3O08 A;  5KPT A;  2QXL A;  4CZK A;  4BRA A;  3FR0 A;  4GNI A;  3UKU B;  1YXQ A;  1GLC G;  1YAG A;  3KHY A;  1KAY A;  5BN8 A;  4BGA A;  3W0L A;  4B1W B;  1V4S A;  1K8K A;  2QWP A;  3AAR A;  1NGG A;  3O1W A;  3ULE A;  3OHR A;  1S22 A;  3FZH A;  4WQ4 C;  5B8H A;  1GLD G;  1NBW A;  4H5T A;  4BRO A;  5ELZ A;  2P9I B;  4CZJ A;  2FSN A;  3KVG A;  3LDP A;  2IVO A;  4MO5 A;  2E1Y A;  5AQZ A;  3VEZ A;  4B9Q A;  4BRC A;  4F9O A;  2ZGZ A;  5AFU H;  2FSJ A;  3BEX A;  2HOE A;  2P9N B;  4FWK A;  1XUP O;  1HKB A;  1QQM A;  3CJC A;  4WQ5 A;  5TKY A;  4FO0 A;  4DCH A;  2DPN A;  5BR9 A;  3CJB A;  1CZA N;  3UB5 A;  3SMP A;  1MWM A;  2YHY A;  3VEY A;  3QBX A;  5AQS A;  1BA1 A;  3ZX3 A;  3IUC A;  5FPD A;  2V7Z A;  1HPM A;  4QS7 A;  3CQY A;  3HTV A;  2Q0R A;  2IVN A;  2V7Y A;  5E26 A;  5KPR A;  3TU5 A;  2QWR A;  4H0T B;  2E2N A;  3MK6 A;  2H3G X;  4BRN A;  2E2O A;  3MCP A;  4IWV A;  4K42 A;  3H45 C;  1NGJ A;  3D2F A;  5FPN A;  3SJH A;  3EKS A;  5EVZ A;  4YDU C;  4KBO A;  4FPB A;  4BRL A;  2QW9 A;  3C0B A;  5AQL A;  4BR2 A;  3DXK B;  3O5B A;  3UKR A;  4BQZ A;  4CZM A;  2ZF5 O;  3O8M A;  5JMV A;  1Z05 A;  1JCG A;  3QIC A;  4BGB A;  2AA4 A;  2V51 B;  4BRQ A;  3DJC A;  2I7P A;  3C7N B;  5AR0 A;  1EQY A;  1ESV A;  3ATU A;  1GLF O;  3ZX2 A;  2IIR A;  4FWQ A;  3R8E A;  3P4I A;  4B1V A;  5ADX A;  4FL9 A;  2W41 A;  2UYT A;  2E2P A;  2YCH A;  5F2R A;  4WYB A;  3ZEU B;  4CJ7 A;  4L3Q A;  3A8Y A;  5BPN A;  2Q97 A;  5LY3 A;  5EX5 A;  3W3D A;  2FSK A;  3DWL A;  3H46 O;  4GY2 B;  3ZEU A;  1HLU A;  3VEV A;  5AQV A;  4CZE A;  2ASO A;  1GLA G;  1J6Z A;  3HBT A;  5LJV A;  4K41 A;  4WQ4 A;  3ENH A;  4MO4 A;  2P9L A;  2QWM A;  3EN9 A;  4BG8 A;  5AQQ A;  1NGE A;  1X3N A;  1QHA A;  2E20 A;  5BRE A;  4IZ9 A;  3CJ9 A;  3MMV A;  2EWS A;  2Q0U A;  2QM1 A;  2QWL A;  3U8X A;  3CHW A;  4IO8 A;  3AY9 A;  2Q2R A;  3VEN A;  2W40 A;  3ATV A;  3CET A;  4H0V B;  4QS9 A;  3VGL A;  4FWO A;  5AQK A;  1MWK A;  1TYQ A;  3H6E A;  3U9D A;  2P9P A;  4BRI A;  1NWK A; 
#chains in the Genus database with same CATH topology
 1K8K B;  5DMR A;  3OYG A;  2YKN A;  1RCH A;  4QCL A;  1NU0 A;  3L4Q A;  1VSK A;  4A57 A;  5HRN A;  3ULE B;  4DV4 K;  3ZSQ A;  1BQN A;  4LC9 B;  4FJJ A;  5AQR A;  5KGW A;  1NNE A;  4CD1 A;  1ATS A;  4YDU A;  3E9L A;  4FLZ A;  3J80 O;  4CHO A;  1OKJ A;  3HZ6 A;  4JHD A;  3RRG A;  3NGI A;  2GBZ A;  2O4I A;  4H0P A;  5AZI A;  2HST A;  4FZX C;  3NHG A;  2NRR A;  4NXM K;  1JCF A;  4CF1 A;  5JVH L;  1BIS A;  3QNO A;  3O80 A;  4E7J A;  3B6O A;  2F96 A;  5AQH A;  3CQX A;  2UUA K;  4DQI A;  1GLL O;  1VQM N;  2OZS A;  4MLE A;  1N36 K;  3VPZ A;  4OJR A;  1X9W A;  3I0R A;  3VQA A;  3D7E O;  3FZL A;  4PA1 A;  2JGU A;  2P9U A;  3IRX A;  4CF9 A;  2UU9 K;  2FXU A;  1N33 K;  1NKE A;  5AFU A;  2NRZ A;  1V4T A;  4AF1 A;  4EAH D;  1KD1 O;  3DMJ A;  2EX3 A;  3MN9 A;  1TUU A;  3AA2 A;  2VWK A;  1HR0 K;  4B9U A;  3K2P A;  1SL1 A;  2FBX A;  1D9F A;  3QIN A;  4CJ4 A;  1RT1 A;  2YHX A;  2E2Q A;  2Z1J A;  3DXM B;  3K57 A;  1BOT O;  5FPE A;  1LAV A;  3FE1 A;  1FK9 A;  1Y64 A;  5LMU K;  4O0J A;  2G8F A;  1KVA A;  4FK4 A;  2HBK A;  3SCX A;  3NAE A;  1KCF A;  3U4L A;  3MX2 A;  4LH4 A;  4O5B A;  5FPM A;  3I56 N;  1EO1 A;  1HJO A;  4Z0U A;  3RMB A;  4B3R K;  3G25 A;  1FJG K;  2F4V K;  4EHT A;  5CHI A;  2XO7 A;  2NLX A;  4DF4 A;  3TSP A;  2D0C A;  4HVJ A;  1WLJ A;  4KHY A;  1P8Z A;  4C8O A;  3M8R A;  4KHS A;  2D0P A;  2P9L B;  4GVM A;  1QQC A;  1XNQ K;  3WUH A;  3CCJ N;  1S1X A;  2HF3 A;  3PUF A;  4WQ5 C;  5GAD P;  1IV0 A;  3AVI A;  1U2V A;  4A61 A;  3QNN A;  2KHO A;  3FZM A;  4LY7 A;  4OPH A;  4W5R A;  4GV9 A;  2GWJ A;  3VA3 A;  1EXQ A;  1CLQ A;  4HWI A;  3VEX A;  1Q82 O;  2VWB A;  4KI4 A;  1YIT N;  3LPT A;  1XWL A;  3SMS A;  1HKG A;  3PY8 A;  1E4F T;  3GG4 A;  1WAF A;  2W42 A;  4DTJ A;  2ZWH A;  1G15 A;  2ASP A;  5J2P A;  4A5B A;  1J5E K;  1NGF A;  4H8K A;  4BR0 A;  4GMJ B;  5AQO A;  4KTW A;  4MDB A;  2WON A;  1J53 A;  4DSK A;  4JHD B;  3ITH A;  1RDC A;  5AQN A;  5AZI B;  4DTS A;  5HL7 L;  1KC8 O;  1HYS A;  2E1Z A;  3THV A;  3CJ7 A;  4J2A A;  3LZJ A;  3CCM N;  5HLF A;  4UQG A;  3HOT A;  4FJL A;  2B5J A;  5FRM A;  4EZ9 A;  1QVF M;  1VSF A;  3EY1 A;  2ZJP L;  2QWN A;  5I9E B;  1A5W A;  3VET A;  4M3R A;  1S1U A;  3M8Q A;  4PKH A;  1VQ5 N;  4DB3 A;  1C0G A;  4U67 L;  4BEB A;  2D0A A;  3AVF A;  2P9U B;  4CJE A;  1S6Q A;  3KLI A;  4N41 A;  4DLE A;  5DM6 L;  4JKG B;  4CJ5 A;  3EYZ A;  2P9S B;  3LP0 A;  1U45 A;  1U47 A;  1T6D A;  2VGM A;  3RWU A;  1REV A;  3L3V A;  1Q7Y O;  2CGJ A;  4NCA A;  1QS4 A;  3TAE A;  2HHH K;  4FSV A;  1Y97 A;  3GDQ A;  1BWF O;  5JVG L;  4F4K A;  4ELU A;  4EIA A;  4FW2 A;  3L2Q A;  4WFA L;  1KFD A;  1NJZ A;  1GOB A;  1NGA A;  3BUZ B;  3VQC A;  4CJF A;  2A1R A;  1JLB A;  2A6A A;  4H0O A;  5BPL A;  4NYF A;  1S5J A;  5AQP A;  2FF6 A;  5AQY A;  3QES A;  2G8U A;  1RIL A;  2HBJ A;  5AQU A;  2XY8 A;  1L3U A;  2QA4 N;  5JEN A;  5AQJ A;  1RT7 A;  4IJA A;  4KTQ A;  1KXP A;  3O1B A;  1JLQ A;  4KRF A;  2GUI A;  1LWF A;  3CPW M;  2O4G A;  3OYL A;  3EL2 A;  4CGI A;  4N56 A;  2XHB A;  3BF1 A;  4KV8 A;  4OPJ A;  3DRR A;  3OS2 A;  3MN6 A;  3O3G A;  3SZ2 A;  4JI5 K;  4XH1 A;  5AQG A;  1QQO A;  1VK0 A;  1HKC A;  5AQW A;  2VWJ A;  3CFO A;  3Q7B A;  5KI6 A;  5M1F A;  2E4L A;  4H5R A;  3M1F A;  2A40 A;  3ZLJ A;  4I9L A;  2DY4 A;  1VQP N;  4PKI A;  1BCO A;  2Z1G A;  4CEC A;  4B3M K;  4B9M A;  3BP8 A;  3LAN A;  3NGZ A;  4CEQ A;  1YI2 N;  1HQU A;  3WXI A;  3SAH A;  2IAJ A;  2YJE A;  5JIC A;  4DR4 K;  4C23 A;  4DQ8 A;  1L3V A;  1QE1 A;  4DSE A;  4BRE A;  2OTL N;  3CCU N;  3KD1 E;  3FZK A;  4E7I A;  1FW6 A;  4BRK A;  3ALY A;  3MDQ A;  4FOE A;  4IEE A;  5M1K A;  3B8A X;  4BRA A;  4E7K A;  2XY6 A;  3WNH A;  5K14 A;  1YXQ A;  5C12 A;  2P1J A;  2BDP A;  1TL3 A;  5BN8 A;  1JLE A;  3OYD A;  2QWP A;  3AAR A;  3VMF B;  1VQL N;  3O1W A;  1VRU A;  4DR2 K;  4WQ4 C;  5B8H A;  1N8R O;  3LWM A;  2JWK A;  4CZJ A;  4DQR A;  4MO5 A;  1I3A A;  2E1Y A;  3VEZ A;  3I8D A;  3HVT A;  4JI2 K;  1X1P A;  3BEX A;  4A59 A;  3SQ0 A;  4FWK A;  1XUP O;  4R5P A;  4H4M A;  4CE9 A;  2RPI A;  1RDB A;  5BR9 A;  3UB5 A;  3BDP A;  3K9J A;  3KK1 A;  5M1N A;  3VEY A;  1CXU A;  2YNI A;  4CW7 B;  3ZX3 A;  4ELV A;  2V7Z A;  4DU1 A;  1HPM A;  1JLC A;  1I39 A;  3CQY A;  2YNF A;  3TU5 A;  1N6Q A;  5JS2 A;  4O8U A;  3T7Z A;  1XC9 A;  2QKB A;  1BI4 A;  4F8R A;  4RG8 A;  3SJH A;  1KLM A;  4KBO A;  3SYZ A;  4KH4 A;  1RT6 A;  2W6K A;  4BR2 A;  3OYA A;  3UKR A;  4BQZ A;  2ZF5 O;  1UOC A;  3O9T A;  3QIC A;  4DFK A;  3F5T A;  4BRQ A;  1Q81 O;  4KHU A;  3VQQ A;  1ESV A;  3AVA A;  1R0A A;  2PY5 A;  4NLB A;  1K6Y A;  3KKS A;  3G10 A;  4OPA A;  4BE7 B;  4FWQ A;  5ADX A;  4WE1 A;  1YIJ N;  1RTH A;  4ILG B;  1LAW A;  2XY7 A;  2E2P A;  1TKT A;  3F9K A;  4YOW A;  4CF8 A;  4E3S A;  5EX5 A;  3TAF A;  4GY2 B;  3KWG A;  1C0U A;  3NH2 A;  4HCC A;  3DOK A;  3OBY A;  4EZ6 A;  1KTQ A;  5AQV A;  3SUN A;  2ASO A;  4CF0 A;  4WQ4 A;  4DV0 K;  3TR8 A;  5GAH P;  3OYH A;  3H08 A;  2C1I A;  1NK5 A;  4MO4 A;  3EN9 A;  3AVM A;  4BG8 A;  5AQQ A;  1NGE A;  5LMN K;  2E20 A;  5BRE A;  2F7T A;  2KQ2 A;  3LAK A;  1C0M A;  1YHQ N;  4CEB A;  3SUO A;  4JKD A;  4ILH A;  5HOO A;  2EHG A;  3U8X A;  3OTO K;  3L2V A;  3HPG A;  3E1Y A;  4QS9 A;  4H0V B;  4IFE A;  4WYB A;  4B8A B;  1BQM A;  4CIF A;  1BIU A;  3IAY A;  1NGH A;  2KZZ A;  1Q8I A;  4DLG A;  1JKH A;  5EU7 A;  1DLO A;  3BZC A;  3L2W A;  1S6P A;  2BH1 A;  2ZJR L;  3QBW A;  3AO4 A;  5E84 A;  1WSF A;  4Y0W A;  2Q3S A;  4H0X B;  3GL1 A;  1HUX A;  5J1E A;  1SL2 A;  1ZBI A;  2OCE A;  2UXC K;  4FWR A;  4FWS A;  1BG3 A;  4DV7 K;  3AA4 A;  2VQE K;  5FDL A;  4B1Y B;  1TL1 A;  4JS5 A;  4W5N A;  2CGL A;  3LL3 A;  3CMA N;  1C1B A;  4BDY A;  3MED A;  2GV9 A;  3WNE A;  1JLF A;  1RT4 A;  1WNS A;  4R79 A;  4DHY A;  4JI7 K;  4FOI A;  4FM0 A;  3L6Q A;  4FWL A;  4IDH A;  3OVN A;  2FBY A;  4X64 K;  3PO4 A;  1BI4 B;  1T05 A;  4FJ9 A;  4A5A A;  4CJQ A;  4BE0 A;  2WUS A;  5SZT A;  4FJG A;  4BR5 A;  4CBU A;  3UKR B;  3A5L C;  3MEE A;  5BN9 A;  1NK7 A;  4O55 A;  3ZSX A;  4H5N A;  4CEE A;  4FK0 A;  3CFP A;  3V9S A;  1U48 A;  3JS6 A;  4ISE A;  2HMP A;  2I7N A;  4FLX A;  1KVC A;  2IS3 A;  2BTF A;  3ZT4 A;  4KHQ A;  5JLH A;  2UXD K;  3H1Q A;  3DXM A;  3F9M A;  2FLO A;  1CZ9 A;  3AVB A;  2VCP A;  4K8Z A;  2FBT A;  1T44 A;  4FPA A;  3DM2 A;  2BGG A;  3VN5 A;  1F21 A;  4JN4 A;  2YNG A;  1FKP A;  1FXX A;  1ILY A;  4M3U A;  4M45 A;  4DV5 K;  4EP5 A;  2IC3 A;  1NOY A;  2Q36 A;  1VSE A;  3HP6 A;  4KTZ A;  3V4I A;  1LWE A;  5M1P A;  3KLE A;  3EE8 A;  3ZX0 A;  4BDZ A;  3AVL A;  3NDK A;  4H0Y B;  4JAX A;  3S41 A;  4E7L A;  2W00 A;  4AM7 A;  1X9M A;  2QTD A;  1XMO K;  1IBL K;  3KK7 A;  3QLH A;  4AIL C;  4AQY K;  1U6Z A;  4CIG A;  2ZJQ L;  3V1O A;  3DLK A;  1KAX A;  3O6W A;  2GEL A;  2IVP A;  2RHK A;  1VQ9 N;  3J7A P;  4J2B A;  1RT2 A;  3WXK A;  5GAE P;  3AO1 A;  3CIP A;  4BG9 A;  4KHW A;  3HYF A;  3K5O A;  1WSJ A;  4XEI A;  2D0O A;  2XRI A;  1LV5 A;  1IKW A;  3IDH A;  3E01 A;  3T1H K;  4CJP A;  1IJJ A;  3BZK A;  1ASU A;  4Z94 A;  4PHT X;  1QZ5 A;  2D0B A;  2F8T A;  1ASW A;  3TSQ A;  2F8S A;  4DR6 K;  1SAZ A;  3TSU A;  4HTL A;  3NF6 A;  4FJH A;  3CCV N;  4BEC A;  5AQT A;  1NKC A;  4CI6 A;  4MQ3 A;  4B08 A;  3CYM A;  4F3O A;  1QSY A;  3THW B;  1O1W A;  2BUP A;  4HTU A;  1ATR A;  4FZZ A;  4FLT A;  3VTI A;  3C6U A;  3CF5 L;  1ZBS A;  4BE2 A;  4N76 A;  4FW1 A;  2OPS A;  4E19 A;  4JI1 K;  3PSF A;  4W5Q A;  3V9U A;  2E88 A;  3I8B A;  1BA0 A;  3WT0 A;  2W6L A;  3PSI A;  3ASM A;  2A3Z A;  1RGI A;  3CCR N;  1C6V A;  4ISF A;  4QS8 A;  2P9I A;  3CME N;  5CYM A;  1YJ9 N;  3C6H A;  3D0P A;  4JKG A;  3AVN A;  2PAV A;  3RSE B;  2P9N A;  4KO0 A;  4NLC A;  3KIO A;  4I2Q A;  2VG6 A;  2P9S A;  4DQP A;  1NGB A;  2WFB A;  3C6A A;  3EEQ A;  1WBB A;  3DLB A;  4CZF A;  3OJS A;  3O4W A;  3ZSR A;  5LJW A;  5GIN A;  1RT3 A;  3FLC O;  4FWM A;  4WF9 L;  3VQ7 A;  4I6M B;  1NGI A;  1NGC A;  1W97 L;  1HX1 A;  4KAZ A;  3OYC A;  1NLV A;  4AHS A;  4PL7 A;  1BL3 A;  4PQU A;  1VQ4 N;  2GUP A;  3SJJ A;  3BY5 A;  5KRT A;  4C1N I;  3CCS N;  4JNE A;  3OJU A;  1HNW K;  2O8E B;  2HHW A;  1RNH A;  4YY3 K;  5BRH A;  2IGI A;  4BVO A;  1QVG M;  3WXM B;  1VQO N;  4KHN A;  3VER A;  3C7N A;  4YFU A;  4CF2 A;  1E4G T;  1J5O A;  4JK7 A;  3NH0 A;  5KQ8 A;  4OKE A;  4LF9 K;  4Z4C A;  3FZF A;  3B6P A;  3CM5 A;  3IMX A;  4DQQ A;  3MX5 A;  1NGD A;  3D2E B;  3CCL N;  3SK3 A;  2B6A A;  3RR7 A;  3HST B;  4FJ8 A;  3FFK B;  4BRG A;  1B92 A;  1EX4 A;  3WQU A;  4OO1 J;  2HND A;  4LFB K;  5HBM A;  4CK3 A;  4CIE A;  2RKI A;  4CD3 A;  1X9J A;  2NRV A;  2P51 A;  4DTP A;  3HO1 A;  3O3F A;  4ID1 A;  3QML A;  3S3O A;  3ZT1 A;  4DFM A;  2HHS A;  1BUP A;  1NMN A;  3R9P A;  1W2B M;  3O08 A;  4FLW A;  4F2R A;  1SKW A;  1ZBH A;  3NH1 A;  4GNI A;  4XIU A;  1XNR K;  1KAY A;  1IKY A;  1S72 N;  3FFI A;  1WSG A;  4BGA A;  3W0L A;  4B1W B;  3K0S A;  1HQE A;  2R7Y A;  2KKZ A;  1S1V A;  3OHR A;  3FZH A;  3LP3 A;  4H5T A;  4BRO A;  4M3X A;  2P9I B;  3DOL A;  2FSN A;  3KVG A;  3LDP A;  2IVO A;  5AQZ A;  3NMU A;  3THY A;  5GIP A;  2ZM6 K;  2ZGZ A;  2FSJ A;  1OH7 A;  4XJX A;  2P9N B;  3HRG A;  1DTT A;  1OVQ A;  4CJT A;  1HKB A;  3CXC M;  3PX6 A;  1TGO A;  3MCA B;  2FBV A;  4WQ5 A;  3C94 A;  3SNN A;  4FO0 A;  3F2K A;  4DCH A;  4C8L A;  3CJB A;  1CZA N;  1ZYQ A;  4CK2 A;  3HP9 A;  3S3M A;  2HNY A;  1XMQ K;  3OY9 A;  3QBX A;  1J54 A;  4BDP A;  2UUC K;  2WBN A;  5AQS A;  1VQ6 N;  3SBT A;  3IUC A;  4CGH A;  5FPD A;  4JRQ A;  4KB0 A;  3HTV A;  2Q0R A;  2IVN A;  3LAL A;  5E26 A;  5HRO A;  3AGK A;  1B9F A;  4H0T B;  3MCP A;  1DT9 A;  3H45 C;  1NGJ A;  5FPN A;  5D3G A;  3K5L A;  3MAQ A;  3EKS A;  3OYN A;  4KKO A;  4JKF A;  1ZBL A;  3HPH A;  3DLR A;  4CEZ A;  3VQ6 A;  1KSP A;  3LPU A;  4KB1 A;  3SV4 A;  2AA4 A;  2I7P A;  3C7N B;  3DRS A;  1EQY A;  1YTA A;  3ATU A;  2JWL A;  4YOT A;  4CER A;  1EP4 A;  2IIR A;  4H4O A;  3R8E A;  1SKR A;  3TTF A;  3O9R A;  3CQ8 A;  4E7H A;  3ZEU B;  1YT3 A;  4L3Q A;  4HHT A;  4E72 A;  5BPN A;  2E6L A;  3W3D A;  2FSK A;  3DWL A;  2ZQB A;  3VQ5 A;  5HRP A;  4DR5 K;  3CC4 N;  3VEV A;  1VSL A;  1SV5 A;  3UIQ A;  1J6Z A;  4K41 A;  3ENH A;  1HNV A;  2HHU A;  3K59 A;  4CJL A;  3QIP A;  5C2D A;  4CFB A;  5FRO A;  3LP2 A;  2Q0U A;  1UA0 A;  2QWL A;  4DS4 A;  3WNF A;  3AY9 A;  2G8H A;  4CHN A;  2W40 A;  1RDU A;  3VGL A;  3PV8 A;  2HW3 A;  1TYQ A;  3U9D A;  2P9P A;  4BRI A;  3P39 A;  3TAQ A;  1IO2 A;  5HP1 A;  3AGR A;  4XH4 A;  1N34 K;  3IS9 A;  1UWB A;  4CZL A;  3OYI A;  3VES A;  3SQ1 A;  1XC3 A;  1D8Y A;  4JLH A;  2AJQ A;  1DKG D;  4BR9 A;  3THY B;  4FJX A;  1H1V A;  4CJK A;  3DLH A;  3S5T A;  4FJN A;  3LM2 A;  2Y1I A;  4BRH A;  1IBM K;  5F1X A;  1Z26 A;  4BR4 A;  2PYJ A;  3OW2 M;  1WSI A;  5EXW A;  3GOI A;  3AAP A;  3AO2 A;  2O8D B;  3OYM A;  1C0T A;  4DR1 K;  1BCM A;  4RW9 A;  1T3V A;  3QFP A;  4LFA K;  2ASM A;  1NG9 A;  4OX9 K;  4KHP K;  3RRH A;  3PX4 A;  3M6G A;  3MXM A;  2WTU A;  3NF8 A;  5AQF A;  3M3Z A;  3NGY A;  4FVU A;  1GLB G;  4KI6 A;  2YHW A;  3GBT A;  3K5N A;  4IG3 A;  3RMD A;  4G9Z A;  1G99 A;  2PFU A;  3SLC A;  1NK0 A;  4FWN A;  4BC3 A;  4E1J A;  3V6D A;  4BAC A;  4DR7 K;  3U3Y A;  4C8N A;  3OYE A;  3VEO A;  5F0X A;  2B4J A;  4J8F A;  3AA5 X;  5EY4 A;  4IOC L;  2VG7 A;  3MN5 A;  1R59 O;  1MDU B;  5BPM A;  4BC5 A;  1SQK A;  3IFR A;  1K8A O;  3JXU A;  3MEG A;  3O4Q A;  1S3X A;  5E41 A;  4KRE A;  1VSH A;  3SPZ A;  4K25 A;  3A5M C;  3J8A A;  3O9U A;  4FJK A;  3G6E N;  1DTQ A;  3HI0 A;  4JRP A;  1RBS A;  4LH5 A;  4Z4I A;  2OTJ N;  3LDL A;  3OYB A;  5CYQ A;  4A62 A;  4Z4E A;  4QAG A;  4NB4 A;  3OA9 A;  4CHP A;  2QKK A;  4FXD A;  3HM8 A;  3OS1 A;  1IG8 A;  2P5G A;  4NCG A;  3AO3 A;  5KQD A;  3ZSZ A;  4IJN A;  4AH9 A;  1T03 A;  4O8K A;  1NMD A;  4FCY A;  5AZJ B;  2P5O A;  1MA9 B;  4KH6 A;  3O4N A;  2VYP A;  2YI1 A;  4FJI A;  4M41 A;  3CG7 A;  5AQX A;  1TK5 A;  2NRW A;  1NM1 A;  4BR7 A;  4CFD A;  2DTU A;  4A2A A;  4O44 A;  4I2P A;  5H1S Q;  1N5Y A;  3OYK A;  1TYQ B;  1YVN A;  4M63 C;  3QB0 A;  2P9P B;  1TV6 A;  3CER A;  2GEM A;  4NXN K;  4AHC A;  5C25 A;  4E1N A;  4X62 K;  3AV9 A;  4HUG A;  4CJ3 A;  3AAQ A;  1BGX T;  4RW7 A;  2XY5 A;  3LDQ A;  3J7Y P;  4DQS A;  1VHX A;  3VGK A;  4BQL A;  2NRT A;  1YVU A;  3NVM A;  3CI5 A;  4DV6 K;  3OYJ A;  3T1Y K;  4OKK A;  4IKF A;  3WNG A;  3PX0 A;  1OH5 A;  4FZY A;  1VQ8 N;  2VG5 A;  3Q7C A;  2OZM A;  1NKB A;  4JD2 A;  5I3U A;  3VF2 A;  4DU3 A;  4HCB A;  4CJS A;  1IKX A;  4C1N K;  1TUY A;  4DTX A;  4J2E A;  1W9H A;  2HHV A;  5GAG P;  1GOC A;  3AVJ A;  2YHA A;  3V9X A;  4I7F A;  1XQS C;  1LCU A;  3LDN A;  5HRS A;  3CJA A;  3HJF A;  5C42 A;  4JKE A;  4PL8 A;  4BC4 A;  4DMN A;  3A2F A;  4JKC A;  4DV2 K;  4I9Q A;  3UKU A;  1EET A;  3C65 A;  1BO5 O;  3THW A;  1RBR A;  3A5N C;  4XH5 A;  3AVH A;  2V52 B;  3JAM O;  4FJ5 A;  5CZ2 A;  4BC2 A;  5C0Y A;  4B1U B;  3PIO L;  4B3S K;  4DTR A;  1TK0 A;  4GV3 A;  2KW4 A;  4DU4 A;  4CFC A;  1JL2 A;  3DAW A;  2YJF A;  4RTF D;  1SZ2 A;  3DYA A;  4KFB A;  2D1K A;  3CJ1 A;  2GWK A;  3KJV A;  1HYV A;  1WB9 A;  1DGK N;  2E6M A;  4NO7 A;  3RSE A;  1UA1 A;  2I5J A;  4B9N A;  4FLY A;  3KD5 E;  4B9S A;  2VGN A;  2DFE A;  1JXB A;  4BRM A;  4OGC A;  4PY5 A;  2QI2 A;  4I6M A;  5J2N A;  1M90 O;  4LF7 K;  1QSS A;  4BRF A;  1KQS M;  1Q18 A;  3SQ4 A;  4CZG A;  3GE1 A;  4DF8 A;  3D6R A;  3RMC A;  3SUP A;  3DXK A;  3H3N O;  3QEW A;  5GIO A;  4AM6 A;  3T1A A;  4AHV A;  4DSL A;  2O8E A;  1OH8 A;  2BAN A;  3I0S A;  5FLX O;  1ASV A;  2QXF A;  3TAP A;  3ZCM A;  1FKO A;  2A41 A;  1RDW X;  1T7P A;  4LF8 K;  4LSN A;  4PKG A;  4JKB A;  3WXJ A;  2Y1J A;  3OYF A;  4MDA A;  1QTM A;  4JS4 A;  1TAU A;  1W7A A;  4NYN A;  3D2E A;  4JD2 B;  3QFU A;  3CYG A;  2HVH A;  2LSN A;  4YNQ A;  1VQN N;  1HMV A;  4JYA K;  3WXL A;  3NVK A;  3O9Q A;  3R6M A;  2ITM A;  3EZW A;  3L3U A;  1S1W A;  1A5X A;  2C1G A;  1VSM A;  2F9W A;  1Q9Y A;  4DR3 K;  3KK2 A;  2HB5 A;  1D4X A;  2FF3 B;  4BE1 A;  1EKE A;  1TVR A;  1ZXO A;  4FYD A;  5KPT A;  1HNX K;  3TI0 A;  2QXL A;  3QEP A;  3TWH A;  4CZK A;  3FR0 A;  4GW6 A;  2IDO A;  2HHQ A;  3UKU B;  4W5T A;  3KHY A;  1KFS A;  2GX9 A;  1YF5 L;  3G71 N;  1S9E A;  3TAB A;  3G0Z A;  3MEC A;  3QO9 A;  1V4S A;  1B9D A;  3VA0 A;  2JLE A;  2WOM A;  1NBW A;  4OLA A;  2KFZ A;  4B9Q A;  4F9O A;  4BRC A;  4Y1C A;  3MXJ A;  4YOV A;  1YJW N;  5AFU H;  2G8V A;  3ISN C;  2G8K A;  3S3N A;  4IG0 A;  4K8X A;  5M1Q A;  5TKY A;  5DM7 L;  3DI6 A;  4CHQ A;  3HK2 A;  4L8R B;  2UXB K;  2YHY A;  3MXI A;  3SI6 A;  4DG1 A;  3KLH A;  3N4Q A;  1SS6 A;  2NUB A;  3LP1 A;  4BY9 C;  3CD6 N;  4IDK A;  4CEA A;  3SAF A;  5KTQ A;  5M1O A;  4CES A;  2V7Y A;  3T69 A;  4GKK K;  1L3S A;  2QWR A;  3E9P A;  3MK6 A;  2H3G X;  2E2O A;  1KLN A;  4HUF A;  3AVC A;  3D2F A;  5CZ1 A;  3HT3 A;  4ILJ A;  3IKM A;  4FPB A;  3DXK B;  3LZI A;  4JI6 K;  3VQE A;  4CZM A;  3O8M A;  1Q86 O;  1RDA A;  3V9W A;  1Z05 A;  1JCG A;  3VQD A;  3V81 A;  2V51 B;  3DJC A;  5AR0 A;  4DSF A;  4DSI A;  4GKJ K;  1GLF O;  4DV3 K;  1RBV A;  4C8K A;  4OKJ A;  5MLC Q;  1L3T A;  4B1V A;  4CHZ A;  4FL9 A;  3EE9 A;  3RMA A;  4U7B A;  4CJ7 A;  3A8Y A;  1WAJ A;  2Q97 A;  4JEP A;  5CY4 A;  5LY3 A;  1NOZ A;  4ICL A;  1IKV A;  2OPQ A;  4CCH A;  3H46 O;  1EWQ A;  1S1T A;  2DFF A;  1HLU A;  3ZEU A;  2O8B A;  3M8S A;  2OPP A;  4CZE A;  1TK8 A;  1GLA G;  3HBT A;  2ZE2 A;  1QHT A;  4M3Z A;  2QWM A;  3ZSO A;  5T7B A;  1X3N A;  2HHI A;  4DTN A;  1QHA A;  4IOX A;  2NNW A;  3NBP A;  3MMV A;  4DS5 A;  2EWS A;  4ZTJ A;  3MWT A;  1BHL A;  3CHW A;  3ID6 A;  3OBW A;  2DFH A;  3SV3 A;  1WBD A;  1OVY A;  3VEN A;  4RW6 A;  1O13 A;  4CEF A;  3ATV A;  3CET A;  3M5R A;  2UUB K;  5C2F A;  2KLA A;  1MWK A;  3AA3 A;  3QEX A;  4WFN L;  4B3T K;  3DLE A;  4UY8 O;  3T19 A;  3NFA A;  4Z4H A;  1JL1 A;  3F73 A;  2GTD A;  1X3M A;  1HJR A;  1SL0 A;  4E0D A;  1X9S A;  2FC0 A;  3VOV A;  4DFJ A;  3K5M A;  5DK5 A;  3E9O A;  3EKU A;  5AJ3 K;  4O4G A;  3L0Q A;  4BRD A;  1XHZ A;  1D5A A;  5C24 A;  2O8F A;  1CXQ A;  1YUW A;  5JLF A;  3ZSY A;  3A5O C;  3DLL L;  3TAG A;  1K73 O;  3IG1 A;  4DV1 K;  3SQ2 A;  3ZET A;  4EP4 A;  4KH5 A;  3KLG A;  4JI0 K;  2RN2 A;  1JJ2 M;  3RTV A;  1WUA A;  3QER A;  2CGK A;  3QEI A;  5J2Q A;  4JV5 K;  2HF4 A;  2O8D A;  3C95 A;  5BR8 K;  3TPQ A;  3T3F A;  3R3L A;  5C10 A;  2KTQ A;  3CFR A;  4CZI A;  3D2F B;  2P9K A;  2A1S A;  4F3T A;  3TTC A;  4BRP A;  2HNZ A;  1BU6 O;  1TKX A;  3K58 A;  4YOX A;  4O5F A;  2WC9 A;  2O8C A;  4CJU A;  4B1X B;  3SBG A;  3RR8 A;  1YJN N;  4CBW A;  3THX A;  1GLE G;  4RCH A;  2PBD A;  2G8I A;  4FK2 A;  1ZC6 A;  2AP1 A;  2X74 A;  3S9H A;  1M1K O;  1WOQ A;  5EOY A;  2HVI A;  3U9Z A;  2X6N A;  2NZT A;  4FM1 A;  4LD0 A;  5C15 A;  3HOS A;  5IWA K;  4PUO A;  2HMI A;  2O8B B;  2OAN A;  3J7Z O;  2Q31 A;  3ENB A;  1C0F A;  5KRS A;  1U2V B;  2QWO A;  3M8P A;  3I33 A;  4YOY A;  1JLA A;  1JCE A;  1P90 A;  3LDS A;  3ZSW A;  4IO9 L;  2A5X A;  1LW2 A;  1LW0 A;  2Q1N A;  3QET A;  4A2B A;  2ATQ A;  1Z25 A;  5CE3 A;  3JSM A;  4FLV A;  5AZJ A;  4B9T A;  2QWQ A;  2HBL A;  4H5V A;  2OPR A;  4FJM A;  3ZSV A;  1NK9 A;  1OH6 A;  4OPK A;  4DWI A;  4IFY A;  3WQT A;  2A42 A;  3TTD A;  1K9M O;  4FWP A;  5AQI A;  4CGG A;  1NJY A;  4B9V A;  4M3W A;  1NK8 A;  2PZS A;  3I55 N;  3V1Q A;  1GLJ O;  3L2R A;  3AO5 A;  4E89 A;  2YHB A;  3G4S N;  4DFP A;  3WEE A;  4K43 A;  1UAX A;  4WFB L;  3KK3 A;  3O3H A;  4AHU A;  3A0I X;  2ETJ A;  4ID5 A;  1VSJ A;  4ISG A;  3HXM A;  5CR4 A;  2O8F B;  1ATN A;  4YOU A;  4JK9 A;  1KRP A;  4X65 K;  4CJR A;  4JKA A;  1I94 K;  3ZET B;  5BRF A;  3JYT A;  1GOA A;  4EFH A;  4M3T A;  1BIZ A;  2ZGY A;  1U04 A;  4CK1 A;  2NRH A;  3VF6 A;  2ZD1 A;  3V1R A;  1TKD A;  3L4I A;  2BE2 A;  2D4W A;  4OVL A;  1JXE A;  1LOT B;  5AQM A;  1QQN A;  3CCQ N;  4K0K K;  1ITG A;  1WSH A;  3CM6 A;  4B8C A;  1NK6 A;  4CGD A;  1RFQ A;  3NF7 A;  4AHT A;  2Z1H A;  4LFC K;  2P9K B;  1WSE A;  3BF3 A;  4Y1D A;  3EO3 A;  4B3O A;  1TAQ A;  3HVR A;  2IOC A;  3J81 O;  1KAZ A;  1C1C A;  3ZT0 A;  3KZB A;  5A2Q O;  5J2M A;  4DTU A;  1XI1 A;  2O8C B;  3HSC A;  5IT9 O;  3LM9 A;  4V19 S;  1RTJ A;  3VQP A;  3P31 A;  3QDK A;  3THX B;  4Q5V A;  1RTI A;  2YKM A;  4M7Y A;  1TKZ A;  3MN7 A;  4KPY A;  3NCI A;  2QEX N;  2CH6 A;  1T8E A;  1NK4 A;  4M42 A;  1EWR A;  2OYQ A;  3VEW A;  4C8M A;  5ADX H;  4YHH K;  3D45 A;  1VQK N;  3H3O B;  2E8A A;  4JI8 K;  1VQ7 N;  4FLU A;  3UE5 A;  5SWM A;  3K9K A;  2QK9 A;  4Z4F A;  1WN7 A;  3LDO A;  1HYZ A;  2J4R A;  3PLA A;  1LWC A;  2RF2 A;  4RW8 A;  5JS1 A;  4MLH A;  1T6C A;  4B1Z A;  2F9T A;  1YTU A;  1HNZ K;  4RWT A;  3KTQ A;  2CH5 A;  3DLG A;  5BRD A;  3CC2 N;  2PYL A;  1DEJ A;  4IFV A;  1U4B A;  1Q9X A;  3VGM A;  1RT5 A;  4DSJ A;  2G8W A;  1SKS A;  1HPZ A;  3QIO A;  1Z6R A;  2KFN A;  4H03 B;  3WEE B;  4N47 A;  3FGU A;  3P5J A;  4X66 K;  3H1V X;  4O0I A;  4MFB A;  3ID8 A;  5KGX A;  3AVK A;  4WCE L;  5HRR A;  4EHU A;  5KPZ A;  5FRN A;  3ULD A;  1QZ6 A;  3VF4 A;  3KKR A;  4JI3 K;  4CZH A;  4H5W A;  1VRT A;  4CBX A;  4M7X A;  4CJV A;  4FJ7 A;  4BVP A;  3ENO A;  3RVC A;  1BDG A;  4IXC A;  1IG9 A;  4RW4 A;  3PIP L;  4OGE A;  1A5V A;  2NRX A;  1ZBU A;  4GVE A;  3PO5 A;  1GLC G;  1YAG A;  1N32 K;  1U49 A;  4DTO A;  4CFA A;  1K8K A;  1RTD A;  4CGJ A;  4YOR A;  3ZT3 A;  1IBK K;  3L8B A;  4FM2 A;  4G1Q A;  1NGG A;  4DTM A;  3ULE A;  3VQ4 A;  5TKW A;  1S22 A;  1RDD A;  2YX6 A;  3HL8 A;  1GLD G;  3L2U A;  4W5O A;  3EZ5 A;  4F2S A;  5ELZ A;  4B9L A;  3P1G A;  4CGF A;  2KZM A;  4NCB A;  2HOE A;  4FVM A;  3SAG A;  1VSD A;  2VQF K;  1QQM A;  5LL6 Z;  3CJC A;  1J9A A;  3KLF A;  3O9S A;  4OLB A;  2DPN A;  3N4P A;  3P83 D;  1QSL A;  1E3M A;  3SMP A;  3CCE N;  1C1A A;  1JLG A;  1MWM A;  4LF5 K;  4BWM A;  4DUY K;  4LF6 K;  1NJI O;  4J2D A;  1S9G A;  1BA1 A;  3QEV A;  4CHY A;  3BGR A;  1KVB A;  4CVN E;  3C6T A;  4QS7 A;  4DUZ K;  1D9D A;  4TSX A;  4DKW A;  3U6F A;  2RE2 A;  5KPR A;  2E5L K;  3ZT2 A;  4BRN A;  2E2N A;  5I42 A;  3P38 A;  2YNH A;  4IWV A;  3ZYY X;  4GV6 A;  4K42 A;  3E66 A;  3U3G A;  5EVZ A;  4YDU C;  4BRL A;  2QW9 A;  3C0B A;  2D5R A;  5AQL A;  1RBT A;  3SPY A;  3O5B A;  3NF9 A;  5JMV A;  3HPO A;  2Z1I A;  4BGB A;  1XHX A;  4LSL A;  1CZB A;  3LAM A;  3LWL A;  4JK8 A;  1RBU A;  1IH7 A;  4AHR A;  3OS0 A;  4LF4 K;  4IEI A;  4QOZ B;  3ZX2 A;  4Q0B A;  3P4I A;  1W0H A;  2YV0 X;  3CC7 N;  2W41 A;  4ZTF A;  2UYT A;  2YCH A;  3AVG A;  5F2R A;  4CED A;  2ITG A;  3HM9 A;  3R1X A;  4CEO A;  4PWD A;  4M3Y A;  2HHT A;  3VQ9 A;  4CJW A;  1SUQ A;  4BWJ A;  3MWP A;  4JI4 K;  1MU2 A;  1ZBF A;  2X78 A;  5LJV A;  3VTH A;  2HBM A;  3VQB A;  3TAR A;  3V9Z A;  3KWI A;  4Z4G A;  4N5S A;  4ELT A;  2P9L A;  2X6S A;  4IOA L;  4ZHR A;  3TAM A;  4IZ9 A;  3CPE A;  3SUQ A;  2HHX A;  1L5U A;  3CJ9 A;  2QM1 A;  3TAN A;  3NE6 A;  1HRH A;  1VSI A;  3DRP A;  4IO8 A;  1VAZ A;  4HUE A;  2Q2R A;  4JKH A;  1NJX A;  1HNI A;  1NJW A;  4IBN A;  4FWO A;  5AQK A;  4E1M A;  3H6E A;  2OA8 A;  3VQ8 A;  1NWK A; 
#chains in the Genus database with same CATH homology
 1K8K B;  3AGR A;  4XH4 A;  2GTD A;  1X3M A;  3L4Q A;  4A57 A;  4CZL A;  3VES A;  1NGH A;  3ULE B;  1XC3 A;  3VOV A;  4LC9 B;  5AQR A;  1KD1 O;  4CD1 A;  1ATS A;  2BH1 A;  4YDU A;  1DKG D;  3E9O A;  3E9L A;  3EKU A;  4BR9 A;  1H1V A;  2ZJR L;  3L0Q A;  3QBW A;  5E84 A;  4BRD A;  1OKJ A;  3HZ6 A;  4JHD A;  3LM2 A;  1YUW A;  4Y0W A;  4BRH A;  5JLF A;  5F1X A;  4H0P A;  3A5O C;  3GL1 A;  4H0X B;  3DLL L;  1HUX A;  1K73 O;  5AZI A;  4BR4 A;  2HST A;  3OW2 M;  2NRR A;  3ZET A;  5EXW A;  3GOI A;  4KH5 A;  3AAP A;  1JCF A;  4FWR A;  5JVH L;  4FWS A;  3O80 A;  1BG3 A;  1JJ2 M;  1WUA A;  5AQH A;  3CQX A;  4B1Y B;  2CGK A;  1GLL O;  1T3V A;  2CGL A;  3LL3 A;  3QFP A;  3CMA N;  2ASM A;  1VQM N;  4MLE A;  2HF4 A;  3M6G A;  3VPZ A;  5AQF A;  3TPQ A;  3M3Z A;  4DHY A;  4R79 A;  3R3L A;  4FOI A;  5C10 A;  3D7E O;  3L6Q A;  4FVU A;  1GLB G;  3FZL A;  4FWL A;  4IDH A;  4CZI A;  2YHW A;  3D2F B;  2P9K A;  3GBT A;  3TTC A;  4BRP A;  2P9U A;  4A5A A;  1BU6 O;  4G9Z A;  2WUS A;  2FXU A;  1G99 A;  5AFU A;  2NRZ A;  2PFU A;  1V4T A;  4AF1 A;  4BR5 A;  4EAH D;  4CBU A;  3UKR B;  3SLC A;  4YOX A;  4FWN A;  4IFE A;  4O5F A;  4BC3 A;  3A5L C;  4E1J A;  2WC9 A;  5BN9 A;  3MN9 A;  1TUU A;  3VEO A;  4B1X B;  5F0X A;  3SBG A;  4J8F A;  4H5N A;  2YHX A;  2E2Q A;  3DXM B;  5EY4 A;  4IOC L;  1BOT O;  5FPE A;  3JS6 A;  3MN5 A;  1R59 O;  2HMP A;  1Y64 A;  2I7N A;  3FE1 A;  1MDU B;  4ISE A;  4CBW A;  5BPM A;  4BC5 A;  1SQK A;  3IFR A;  1K8A O;  1GLE G;  3JXU A;  2BTF A;  2HBK A;  4RCH A;  1S3X A;  5JLH A;  2PBD A;  3H1Q A;  3DXM A;  4K25 A;  3F9M A;  2FLO A;  3A5M C;  3J8A A;  1ZC6 A;  2AP1 A;  3MX2 A;  3O9U A;  5FPM A;  2VCP A;  3U4L A;  3I56 N;  3G6E N;  1EO1 A;  1HJO A;  3HI0 A;  1T44 A;  4FPA A;  1M1K O;  1WOQ A;  3G25 A;  5EOY A;  3U9Z A;  4BRN A;  3LDL A;  2OTJ N;  2NZT A;  4JN4 A;  4EHT A;  5CHI A;  2NLX A;  4A62 A;  5C15 A;  3TSP A;  3HOS A;  4NB4 A;  2OAN A;  1ILY A;  3J7Z O;  2Q31 A;  3ENB A;  1P8Z A;  1C0F A;  3OA9 A;  2Q36 A;  1U2V B;  2QWO A;  3HM8 A;  1IG8 A;  2D0P A;  3I33 A;  2P9L B;  4YOY A;  5M1P A;  5KQD A;  3WUH A;  1JCE A;  3EE8 A;  3ZX0 A;  4IJN A;  3CCJ N;  1P90 A;  4WQ5 C;  2HF3 A;  4O8K A;  1NMD A;  5GAD P;  4IO9 L;  5AZJ B;  1MA9 B;  4KH6 A;  2A5X A;  1U2V A;  2VYP A;  2YI1 A;  4A61 A;  4H0Y B;  2KHO A;  2Q1N A;  4A2B A;  3FZM A;  4JAX A;  3S41 A;  5AQX A;  2W00 A;  4OPH A;  4AM7 A;  2NRW A;  5CE3 A;  1NM1 A;  2QTD A;  2GWJ A;  4GV9 A;  4BR7 A;  3KK7 A;  4HWI A;  2QWQ A;  2HBL A;  4H5V A;  4A2A A;  5AZJ A;  3VEX A;  1U6Z A;  1Q82 O;  2VWB A;  5H1S Q;  1TYQ B;  1YVN A;  2ZJQ L;  4M63 C;  3QB0 A;  2P9P B;  2A42 A;  3TTD A;  3WQT A;  3CER A;  1YIT N;  1K9M O;  2GEM A;  1KAX A;  3O6W A;  2GEL A;  2IVP A;  2RHK A;  4FWP A;  5AQI A;  3SMS A;  1HKG A;  1VQ9 N;  1E4F T;  3AAQ A;  3WXK A;  3GG4 A;  3I55 N;  1GLJ O;  5GAE P;  3CIP A;  2ZWH A;  3LDQ A;  4BG9 A;  3G4S N;  3VGK A;  2ASP A;  3WEE A;  4BQL A;  2NRT A;  4A5B A;  4K43 A;  4WFB L;  3NVM A;  3CI5 A;  4XEI A;  1NGF A;  4BR0 A;  3A0I X;  5AQO A;  2D0O A;  4MDB A;  4ISG A;  4JHD B;  3IDH A;  5CR4 A;  1ATN A;  3Q7C A;  4YOU A;  1VQ8 N;  4JK9 A;  4JD2 A;  1IJJ A;  3VF2 A;  4Z94 A;  5AQN A;  4PHT X;  1QZ5 A;  4JKA A;  4C1N K;  1TUY A;  5AZI B;  5HL7 L;  1KC8 O;  3ZET B;  3TSQ A;  5GAG P;  5BRF A;  4EFH A;  1SAZ A;  2E1Z A;  3TSU A;  2ZGY A;  4HTL A;  3CJ7 A;  3CCV N;  2NRH A;  3VF6 A;  5AQT A;  4BEC A;  1XQS C;  3CCM N;  4CI6 A;  3HOT A;  3L4I A;  1LCU A;  1QVF M;  3LDN A;  2ZJP L;  3CJA A;  2D4W A;  2QWN A;  5I9E B;  4JKE A;  2BUP A;  4PL8 A;  1ATR A;  3VET A;  1LOT B;  4BC4 A;  5AQM A;  1QQN A;  4JKC A;  3VTI A;  3CCQ N;  3CF5 L;  4PKH A;  1ZBS A;  1VQ5 N;  4DB3 A;  3UKU A;  1C0G A;  3C65 A;  1RFQ A;  1BO5 O;  4U67 L;  4BEB A;  2P9K B;  3BF3 A;  3A5N C;  4XH5 A;  2P9U B;  2V52 B;  3EO3 A;  2E88 A;  3I8B A;  1BA0 A;  3WT0 A;  1KAZ A;  5DM6 L;  4JKG B;  3KZB A;  4BC2 A;  5C0Y A;  4B1U B;  2A3Z A;  1RGI A;  3HSC A;  3PIO L;  2P9S B;  3CCR N;  4ISF A;  4QS8 A;  1T6D A;  3LM9 A;  2P9I A;  2VGM A;  1YJ9 N;  3CME N;  3C6H A;  4GV3 A;  3P31 A;  4JKG A;  3QDK A;  3DAW A;  2CGJ A;  2PAV A;  2YJF A;  2P9N A;  4RTF D;  3RSE B;  1Q7Y O;  4NLC A;  1SZ2 A;  2P9S A;  4FSV A;  4M7Y A;  1NGB A;  3GDQ A;  1BWF O;  2D1K A;  2WFB A;  3CJ1 A;  3MN7 A;  3C6A A;  5JVG L;  2GWK A;  4EIA A;  4CZF A;  1DGK N;  4NO7 A;  3RSE A;  4WFA L;  2QEX N;  3O4W A;  2CH6 A;  3BUZ B;  1NGA A;  5LJW A;  5GIN A;  3FLC O;  4FWM A;  4WF9 L;  4I6M B;  1NGI A;  2A6A A;  2VGN A;  1NGC A;  4H0O A;  3VEW A;  5BPL A;  1W97 L;  5ADX H;  5AQP A;  2FF6 A;  1HX1 A;  5AQY A;  2HBJ A;  5AQU A;  4BRM A;  1NLV A;  2QI2 A;  4I6M A;  4PL7 A;  1M90 O;  1VQK N;  3H3O B;  2E8A A;  1VQ4 N;  2QA4 N;  5AQJ A;  2GUP A;  1VQ7 N;  3UE5 A;  3K9K A;  4IJA A;  4BRF A;  1KXP A;  3O1B A;  1KQS M;  3LDO A;  1Q18 A;  2J4R A;  3PLA A;  4CZG A;  4C1N I;  3CCS N;  3GE1 A;  4JNE A;  3D6R A;  4MLH A;  3CPW M;  1T6C A;  3DXK A;  3H3N O;  4B1Z A;  5GIO A;  2F9T A;  4AM6 A;  3EL2 A;  5BRH A;  4BVO A;  1QVG M;  3WXM B;  1VQO N;  4RWT A;  3BF1 A;  3VER A;  3C7N A;  2CH5 A;  5BRD A;  3CC2 N;  1E4G T;  4JK7 A;  5KQ8 A;  3MN6 A;  1DEJ A;  4XH1 A;  3FZF A;  5AQG A;  1QQO A;  1HKC A;  5AQW A;  3VGM A;  2A41 A;  1RDW X;  3IMX A;  1Z6R A;  3Q7B A;  3MX5 A;  4H03 B;  5M1F A;  3WEE B;  1NGD A;  3D2E B;  4PKG A;  4JKB A;  3WXJ A;  3FGU A;  3CCL N;  4H5R A;  3SK3 A;  3M1F A;  3H1V X;  2A40 A;  3FFK B;  4MDA A;  4BRG A;  1VQP N;  3ID8 A;  3WQU A;  4PKI A;  4OO1 J;  4WCE L;  3D2E A;  4JD2 B;  4EHU A;  5KPZ A;  3BP8 A;  3QFU A;  1QZ6 A;  1YI2 N;  1VQN N;  3VF4 A;  4CD3 A;  1X9J A;  3WXI A;  3WXL A;  4CZH A;  2NRV A;  2YJE A;  3SAH A;  3NVK A;  3O9Q A;  5JIC A;  3R6M A;  2ITM A;  3EZW A;  4H5W A;  4C23 A;  4DQ8 A;  4CBX A;  4BRE A;  2OTL N;  4M7X A;  3CCU N;  2C1G A;  3QML A;  1YJN N;  2F9W A;  3FZK A;  4BVP A;  3ENO A;  3RVC A;  1D4X A;  2FF3 B;  4BRK A;  3MDQ A;  4FOE A;  4IEE A;  5M1K A;  1BUP A;  1BDG A;  1ZXO A;  3B8A X;  4IXC A;  3R9P A;  3O08 A;  5KPT A;  1W2B M;  3PIP L;  2QXL A;  4CZK A;  4BRA A;  3FR0 A;  4GNI A;  2NRX A;  4GVE A;  3UKU B;  1YXQ A;  1GLC G;  1YAG A;  5C12 A;  3KHY A;  1KAY A;  1S72 N;  2GX9 A;  1YF5 L;  3G71 N;  5BN8 A;  4BGA A;  3W0L A;  4B1W B;  1V4S A;  1K8K A;  2QWP A;  3AAR A;  4YOR A;  3VMF B;  1NGG A;  2KKZ A;  1VQL N;  3O1W A;  3ULE A;  3OHR A;  1S22 A;  3FZH A;  5TKW A;  2YX6 A;  4WQ4 C;  1GLD G;  1NBW A;  4H5T A;  4BRO A;  5B8H A;  2JWK A;  5ELZ A;  1N8R O;  2P9I B;  4CZJ A;  2FSN A;  3KVG A;  3LDP A;  2IVO A;  4MO5 A;  2E1Y A;  5AQZ A;  3VEZ A;  4B9Q A;  4BRC A;  4F9O A;  4YOV A;  1YJW N;  5GIP A;  2ZGZ A;  5AFU H;  2FSJ A;  2HOE A;  3BEX A;  4A59 A;  2P9N B;  3HRG A;  4FWK A;  1XUP O;  3CXC M;  1HKB A;  3SAG A;  3MCA B;  1QQM A;  3CJC A;  4WQ5 A;  5M1Q A;  3O9S A;  4FO0 A;  3F2K A;  5TKY A;  4DCH A;  2DPN A;  5BR9 A;  5DM7 L;  3CJB A;  1CZA N;  3N4P A;  3UB5 A;  3SMP A;  3CCE N;  1MWM A;  2YHY A;  3K9J A;  5M1N A;  3VEY A;  3N4Q A;  3QBX A;  1SS6 A;  1NJI O;  2WBN A;  5AQS A;  4XJX A;  1VQ6 N;  1BA1 A;  3ZX3 A;  4BY9 C;  3SBT A;  3IUC A;  5FPD A;  3SAF A;  3CD6 N;  2V7Z A;  1HPM A;  5M1O A;  4QS7 A;  3CQY A;  3HTV A;  2Q0R A;  4DKW A;  2IVN A;  2V7Y A;  5E26 A;  3T69 A;  2RE2 A;  5KPR A;  3AGK A;  3TU5 A;  2QWR A;  4H0T B;  2E2N A;  3E9P A;  2H3G X;  3MK6 A;  2E2O A;  3MCP A;  3P38 A;  1DT9 A;  4IWV A;  4O8U A;  3T7Z A;  3ZYY X;  4GV6 A;  4K42 A;  3H45 C;  1NGJ A;  3D2F A;  5FPN A;  3E66 A;  3SJH A;  3EKS A;  5EVZ A;  4ILJ A;  4KBO A;  4YDU C;  3IKM A;  4FPB A;  4BRL A;  2QW9 A;  3C0B A;  4KH4 A;  5AQL A;  4BR2 A;  3DXK B;  3O5B A;  3UKR A;  4BQZ A;  4JKF A;  4CZM A;  2ZF5 O;  3O8M A;  1Q86 O;  5JMV A;  1Z05 A;  1JCG A;  3O9T A;  3QIC A;  3F5T A;  2AA4 A;  2V51 B;  4BGB A;  4BRQ A;  1Q81 O;  3DJC A;  2I7P A;  3C7N B;  5AR0 A;  1EQY A;  1ESV A;  3ATU A;  1GLF O;  2JWL A;  4NLB A;  4JK8 A;  3NMU A;  4IEI A;  4OPA A;  3ZX2 A;  4BE7 B;  4YOT A;  2IIR A;  4FWQ A;  5MLC Q;  3R8E A;  3P4I A;  4B1V A;  5ADX A;  4ILG B;  4FL9 A;  3TTF A;  1YIJ N;  3CC7 N;  3EE9 A;  2W41 A;  3O9R A;  2UYT A;  2E2P A;  2YCH A;  5F2R A;  4WYB A;  3ZEU B;  4U7B A;  4CJ7 A;  4YOW A;  4L3Q A;  3A8Y A;  5BPN A;  2Q97 A;  4JEP A;  5LY3 A;  3R1X A;  5EX5 A;  3W3D A;  2FSK A;  3DWL A;  3H46 O;  4GY2 B;  3KWG A;  3ZEU A;  1HLU A;  3MWP A;  3OBY A;  3CC4 N;  3VEV A;  5AQV A;  4CZE A;  2ASO A;  1GLA G;  1J6Z A;  3HBT A;  5LJV A;  4K41 A;  4WQ4 A;  2HBM A;  3ENH A;  3VTH A;  5GAH P;  2C1I A;  3KWI A;  4MO4 A;  2P9L A;  2QWM A;  3EN9 A;  4BG8 A;  4IOA L;  5AQQ A;  1NGE A;  1X3N A;  5C2D A;  1QHA A;  2E20 A;  5BRE A;  4IZ9 A;  2F7T A;  3CPE A;  4IOX A;  2NNW A;  3CJ9 A;  1YHQ N;  3MMV A;  2EWS A;  2Q0U A;  2QM1 A;  4JKD A;  4ILH A;  5HOO A;  3MWT A;  2QWL A;  3U8X A;  3CHW A;  3ID6 A;  4IO8 A;  3OBW A;  3AY9 A;  1VAZ A;  1OVY A;  2Q2R A;  3VEN A;  2W40 A;  3E1Y A;  1RDU A;  4JKH A;  1O13 A;  3ATV A;  3CET A;  3M5R A;  4H0V B;  4QS9 A;  3VGL A;  5C2F A;  2KLA A;  4FWO A;  5AQK A;  1MWK A;  1TYQ A;  4UY8 O;  3H6E A;  3U9D A;  4WFN L;  2P9P A;  4BRI A;  1NWK A;  3P39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...