2P9IB

Crystal structure of bovine arp2/3 complex co-crystallized with adp and crosslinked with gluteraldehyde
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
354
structure length
272
Chain Sequence
VVCDNGTGFVKCGYAGSNFPEHIFPALDDMKHLWDYTFGPLLTEPPMVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
total genus 76
structure length 272
sequence length 354
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9iB02
3.30.420.520 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9iB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9iB03
1WUAA 4BRPA 1C0FA 4IJNA 1GLFO 3IMXA 5JMVA 3H6EA 1NMDA 2J4RA 3O4WA 4WQ5A 4JAXA 4XH1A 1NBWA 1BU6O 1S22A 1JCGA 4CD3A 3GDQA 3UKUA 1HJOA 1T6DA 3FLCO 1LCUA 3D2EB 4DHYA 1C0GA 2Q36A 3I8BA 2H3GX 1X9JA 2D0PA 1GLCG 4CZJA 3MN5A 3ZETA 4EIAA 1ATSA 1RGIA 2Q97A 3EKSA 4BR7A 1J6ZA 5E26A 3OHRA 2QW9A 3ZX0A 4JN4A 5CE3A 4BR9A 4PKHA 2GWKA 1YXQA 2ASPA 4O8KA 5AQPA 3GL1A 4CZKA 4I6MA 3O1WA 1MWMA 1JCEA 1GLDG 3M1FA 3R6MA 3FZHA 1V4SA 5ELZA 1ATRA 2ITMA 4BRHA 2AP1A 3CI5A 4QS7A 5KPRA 5FPEA 3U8XA 3I33A 4BRIA 3WXJA 3ENOA 5BRHA 4BC3A 3AARA 4FWQA 4BC4A 3LDNA 4H5WA 4JHDB 3A5MC 1QZ5A 3SMSA 1E4FT 1ZXOA 5AQOA 4CZEA 4FWPA 4MLHA 3S41A 2F9WA 5TKYA 3DXMA 3H1VX 3O80A 4FWRA 3UKRB 3VF6A 5AZIB 1KXPA 2E20A 4A61A 4WQ4C 3L4IA 3QFUA 2P9SA 5AZJB 2QWRA 3W3DA 3AAQA 4F9OA 1DKGD 5F0XA 4CJ7A 2A3ZA 1U6ZA 2ZGZA 1U2VB 3EKUA 4AM7A 3ULEB 3WUHA 3FE1A 2Q0UA 1GLLO 2E1ZA 4BGAA 3MN7A 4B1VA 4H5RA 4BQLA 3C0BA 2V52B 3IDHA 2FXUA 4PKGA 3WQUA 4Y0WA 1NGBA 4EHTA 1Z05A 4BRDA 4WYBA 1BUPA 5BPMA 4B1ZA 3CJ7A 1Q18A 4DB3A 4FWMA 4CZIA 5AQRA 1GLEG 1IG8A 4IXCA 3UB5A 4BREA 1BA0A 5BPNA 5AR0A 3QBXA 5JLFA 3C7NB 2ZWHA 3TPQA 3DAWA 5LY3A 2P9IA 3FZLA 3GG4A 4PKIA 2V7YA 3QMLA 4A2AA 5AQKA 3CJBA 3WEEA 3L0QA 1MA9B 2IVPA 5EOYA 3VGKA 3CHWA 3MN9A 2E8AA 4H5NA 2BUPA 5BRFA 3HBTA 3O6WA 1KAZA 3MCPA 3ID8A 3O5BA 3VESA 4FWSA 1CZAN 3CQXA 2E2PA 4RTFD 5FPMA 1QQNA 2AA4A 4K43A 3GBTA 1X3MA 3FZKA 3EZWA 3VETA 2FF3B 4H5TA 3HM8A 3U9DA 3U4LA 1D4XA 2Q1NA 3CQYA 4H0YB 1X3NA 5AQZA 2QWLA 2KHOA 4B1WB 4H0OA 4BRMA 4BRLA 4CI6A 1NLVA 4FWOA 3VEZA 2FSNA 2V51B 3ENHA 4FWLA 1XQSC 2P9UB 3D2EA 4CBXA 1MDUB 4FWNA 4A2BA 1HX1A 1TYQA 3WT0A 4BVOA 2VYPA 1NGCA 3VOVA 1SAZA 2IVNA 3HZ6A 1BWFO 1ESVA 5AQGA 4EHUA 3EL2A 1NGFA 4DCHA 5AQXA 2HOEA 2F9TA 2A5XA 5JICA 1Y64A 2YHXA 3QBWA 5JLHA 4IZ9A 1T6CA 3SK3A 1XC3A 4BG8A 3J8AA 2NZTA 2IVOA 5FPDA 4IJAA 1S3XA 3FFKB 2VWBA 3VF4A 5AQFA 4MO5A 2GUPA 4CBUA 5EY4A 4RCHA 3UKUB 3AY9A 4JD2A 3ATUA 4BRGA 2YCHA 3RSEB 4JHDA 5BN9A 4BC5A 2CH5A 2A41A 5EX5A 4BR5A 2E1YA 2YI1A 3ZX3A 1K8KA 2UYTA 3TU5A 4CBWA 3WQTA 3O08A 2A40A 3D2FA 2HF3A 4MLEA 3O1BA 2DPNA 4I6MB 4H03B 1GLBG 4M7YA 4A62A 3MK6A 2A42A 4H5VA 4FOIA 3VGLA 2BTFA 2QWNA 5BR9A 3JS6A 5AQQA 1E4GT 3VEWA 4B9QA 3H1QA 3QICA 4M63C 4KBOA 4L3QA 2E88A 4BRNA 1NGDA 4YDUC 2P9LA 3WXKA 2VCPA 1QQMA 5AQHA 4HTLA 1GLJO 3EN9A 4BRFA 1BG3A 2D4WA 2ZGYA 3DXMB 1BDGA 1NGEA 5BN8A 3A0IX 3CIPA 2P9PA 4BR4A 4J8FA 5B8HA 2WUSA 4WQ5C 3ZEUA 1NGJA 2P9SB 2QWMA 3GE1A 1KAYA 1P8ZA 4XEIA 5FPNA 3C7NA 1QQOA 4CZHA 2FLOA 4CZGA 2P9KA 5AFUA 3BP8A 5AQJA 5F2RA 5AQYA 4C23A 3R8EA 3L6QA 2FF6A 4ISFA 2GELA 4K41A 2D1KA 3VF2A 2CH6A 4BR2A 2ASOA 3D7EO 3DXKA 1DEJA 5KPTA 1BO5O 4QS8A 4PL8A 4BG9A 3HI0A 4H0PA 1OKJA 1NGGA 2I7PA 3EO3A 2P9NB 1SZ2A 1XUPO 3H45C 4BC2A 1NGHA 4BRCA 3G25A 1ATNA 3VGMA 3A5OC 4GNIA 1NGAA 2D0OA 4WQ4A 1Z6RA 2P9IB 4FSVA 2I7NA 1GLAG 2YJEA 2YJFA 3LDQA 2A6AA 3JXUA 3O8MA 1YUWA 1R59O 3WEEB 4PL7A 4NB4A 5I9EB 3CETA 1HLUA 1H1VA 3VERA 2PBDA 5LJVA 4NO7A 5EVZA 3FGUA 4B1XB 4EFHA 4B1UB 1QZ6A 4M7XA 3WXLA 4BRQA 1EQYA 4AM6A 1HPMA 2Q31A 3BEXA 3KVGA 1KAXA 2HMPA 2GWJA 2PAVA 1RDWX 1JCFA 2QWQA 2NLXA 4EAHD 3IUCA 3DWLA 5AQSA 2V7ZA 3H46O 5AQUA 3H3NO 4FO0A 2QM1A 5F1XA 3M3ZA 1HKGA 3RSEA 3FZFA 1TYQB 3QB0A 1HKBA 1TUYA 4Z94A 2GTDA 4ISGA 4BROA 4CZMA 1T44A 3ZETB 3ZX2A 4BVPA 2FSJA 1SQKA 3W0LA 2EWSA 3LDPA 4XH4A 3ATVA 3SMPA 4K42A 2NRHA 3UKRA 2Q0RA 4FWKA 3F9MA 1V4TA 5AZIA 5BREA 1NWKA 1DGKN 3VPZA 3DJCA 3VEVA 2GEMA 3BUZB 2CGKA 3FZMA 2HF4A 4IWVA 5AZJA 4E1JA 3BF3A 3GOIA 3MN6A 4FPAA 5ADXA 2ASMA 4JD2B 3KHYA 2YHYA 3A5NC 1QHAA 1NGIA 1WOQA 4BRAA 3SJHA 3A5LC 3B8AX 1U2VA 2QWOA 3ULEA 3BF1A 5EXWA 4FPBA 1RFQA 4H0TB 4B1YB 1K8KB 3R9PA 1YAGA 5AQLA 5KQDA 4BRKA 4CD1A 4JNEA 2IIRA 4MO4A 3VEXA 1MWKA 1BA1A 3CJ9A 3D2FB 1LOTB 3CJCA 5E84A 4CZFA 4DQ8A 3HTVA 2E2NA 5AQVA 3LM9A 3QDKA 3CJ1A 5AQWA 1IJJA 4BQZA 3SLCA 3WXIA 4XH5A 4FOEA 3LM2A 3CERA 3MMVA 3FR0A 4LC9B 5ADXH 2P9LB 3QFPA 3MDQA 3IFRA 2Q2RA 5AQIA 3VEYA 2E2OA 1NM1A 4H0XB 2FSKA 3LL3A 2P9PB 3KZBA 4CZLA 2P9NA 4RWTA 2CGLA 4BGBA 3ZEUB 1ZC6A 4FL9A 3AAPA 3U9ZA 5AQNA 1TUUA 4ISEA 4QS9A 2W41A 2P9KB 3LDOA 1G99A 4GY2B 3UE5A 1HKCA 1ZBSA 1YVNA 3CJAA 2E2QA 3A8YA 5BPLA 4K25A 2P9UA 3H3OB 5LJWA 5AQTA 3M6GA 4HWIA 3LDLA 3P4IA 2OANA 2QXLA 5AQMA 5AFUH 5KQ8A 2YHWA 1BOTO 2CGJA 3DXKB 3HSCA 5BRDA 4YDUA 2ZF5O 3VENA 1HUXA 4O5FA 3VEOA 2W40A 5KPZA 4H0VB 4BR0A 2QWPA 4IO8A
chains in the Genus database with same CATH superfamily
4BRPA 4IJNA 3IMXA 5JMVA 4JV5K 4N5SA 1VK0A 3HP9A 4Q5VA 4FLUA 3NAEA 3L2VA 4CJVA 4JAXA 4B3RK 3SI6A 1S22A 3O4QA 4KV8A 1JCGA 1JJ2M 1JLEA 3UKUA 2ZE2A 1BQNA 4DTSA 3AVJA 4CIGA 4WFNL 1VHXA 2D5RA 4KFBA 1X9JA 3HYFA 4E3SA 2PYLA 3MN5A 3KWGA 4YOXA 4M45A 4WF9L 2Q97A 3EYZA 1BGXT 1VQ7N 2HNDA 4JN4A 5CE3A 3KK2A 4CJ5A 1C0MA 4DFPA 4IG3A 1UWBA 4PKHA 1YXQA 2ASPA 4AHSA 4W5TA 3P5JA 3O1WA 3T1YK 1JCEA 2PYJA 1CLQA 5ELZA 3WNHA 4BRHA 1NG9A 3CI5A 5KPRA 3U8XA 3I33A 1SS6A 3WNGA 4BRIA 4Q0BA 4BC4A 1TV6A 1C6VA 2YX6A 4DV7K 1NU0A 1QZ5A 3AA3A 3SMSA 5M1QA 1TK0A 1ZXOA 4WFBL 2HHQA 2JLEA 1QSSA 1LWFA 2YKNA 3O9UA 2NRVA 5TKYA 3K57A 1CXUA 1KXPA 4C8KA 4A61A 4BACA 3ZSQA 3L4IA 3QFUA 3S9HA 4KHQA 5F0XA 2ZJRL 4CJ7A 3J7ZO 3S3OA 4KTZA 4AM7A 1U2VB 3OYNA 4JKDA 3WUHA 4M3UA 4FLYA 2FC0A 4CK2A 3M5RA 1NKEA 2OPSA 1NK7A 3CPEA 3MAQA 4BQLA 3C0BA 4FJKA 3OYCA 3IDHA 1NGBA 2YHAA 1W9HA 1VSLA 4O4GA 4BRDA 2VWKA 1FKPA 3OYMA 5BPMA 2X74A 1Q18A 4FWMA 4B9UA 1GLEG 1NJYA 4IXCA 4PHTX 4BREA 4Z4IA 4WE1A 1ZBIA 4DR5K 3CC2N 2ZWHA 3TPQA 3DAWA 5A2QO 4KH4A 1XHXA 2P9IA 4K8ZA 4EZ9A 5I3UA 1VQMN 4X62K 1KSPA 4FJIA 4WCEL 1K6YA 3QEXA 3TSQA 3HRGA 4CE9A 4J2DA 2IAJA 1EWRA 3ZT0A 3DMJA 3O5BA 1WSIA 2AA4A 4B8CA 3EZWA 1WBBA 1RBTA 3OYJA 4H5TA 3U9DA 3UIQA 2O8CA 4H0YB 2Q1NA 5AQZA 2KHOA 4DV2K 4BRMA 4CI6A 1NLVA 4CJKA 3PIPL 1LAVA 3ENHA 4FLZA 1XQSC 3D2EA 4RG8A 4A2BA 3WT0A 4BVOA 4PUOA 4KB0A 4CJQA 1Y97A 1SAZA 5FLXO 5AQGA 4EHUA 4ILHA 3L2RA 4DCHA 5AQXA 1SL0A 2A5XA 1XHZA 2QK9A 1RTHA 1T6CA 4QOZB 2VG7A 4KTQA 4BG8A 2NZTA 5FPDA 3CCUN 1YTUA 2O8EB 2VWBA 3DOLA 2D0BA 1HNXK 4MO5A 4CBUA 4CJWA 1C1CA 3NH0A 4BC5A 4CEBA 4CK1A 2E1YA 2O8BA 2JGUA 2OZMA 4J2EA 4HCCA 3ZX3A 1K8KA 4GV9A 3MEGA 3TU5A 4CBWA 3RVCA 3O08A 3QINA 1RTDA 1CXQA 2HF3A 1VRTA 5GAEP 3HOSA 4H03B 1GLBG 4M7YA 2QTDA 1D9DA 4H5VA 1JLQA 3VGLA 3PIOL 3SYZA 2BTFA 5BR9A 2LSNA 5D3GA 4KI6A 1NJXA 2UUCK 4M3WA 1UA1A 1L3UA 1RDDA 4CHOA 4CF2A 4BRNA 5IWAK 1L3VA 1DTTA 4YDUC 3F5TA 3SUPA 3CYGA 3CCSN 3QEWA 4FJ9A 3VTHA 3AVAA 4F2RA 3DXMB 1BDGA 4FM0A 1T05A 4OO1J 1DTQA 5FRNA 4WQ5C 3T19A 2E5LK 2B5JA 2VGMA 1HYSA 4JRPA 5E41A 4DV0K 3V6DA 2VWJA 4LF4K 3BP8A 4KTWA 2E4LA 4M3TA 1IBLK 2HHHK 4C23A 3R8EA 4JKFA 3I55N 3DM2A 4K41A 4KAZA 1F21A 4DTOA 1OVYA 3VQQA 3S5TA 1WSEA 3SAHA 3OYLA 1DEJA 4PL8A 3HI0A 1OKJA 1WSJA 3EO3A 2P9NB 3TANA 4B9SA 1SZ2A 3TAFA 1TAQA 3L2QA 1NGHA 4BRCA 1TKZA 3V1QA 3NGIA 1IV0A 4X66K 3TAMA 3OW2M 1GLAG 3PV8A 2A6AA 2O8FA 1R59O 4PL7A 5I9EB 3VERA 1SKWA 1KVBA 2IGIA 3DRRA 2UU9K 1QZ6A 2HNYA 4QAGA 4M7XA 3WXLA 4BRQA 1EQYA 4B9VA 3ZT3A 2Q31A 1BL3A 3WNEA 2HMPA 2GWJA 1ZBLA 3TSUA 1XNRK 1JCFA 4DV5K 5C25A 1VSDA 4GV3A 2HHUA 2X6NA 3H3NO 4I2PA 3OYGA 2P1JA 2ZM6K 3TR8A 1TYQB 5DM7L 3QB0A 1HKBA 1JLAA 3RMDA 2QEXN 1TUYA 2P51A 4CHZA 3AO1A 4DFJA 4ISGA 3LZIA 4CZMA 3THYB 3ZSVA 1T44A 1O1WA 1SQKA 3PLAA 3CMEN 4XH4A 3E9PA 4C8OA 4E72A 2O8DB 4K42A 4NYNA 2KFZA 4GVEA 2Q0RA 4E7KA 1V4TA 1DGKN 3THWB 1K9MO 1HNWK 3J80O 1RTIA 1JLGA 2BGGA 1BHLA 2CGKA 3WNFA 4IWVA 5I42A 4C8MA 4KHYA 1JLBA 3GOIA 5ADXA 4JD2B 4YOTA 2YHYA 1VSJA 1U4BA 5GIPA 4BRAA 3SJHA 4JI4K 3A5LC 3B8AX 1U2VA 4MQ3A 1TL3A 3BF1A 4FPBA 2F8TA 1RFQA 1JL2A 5J2MA 3AGRA 3V9XA 3TTFA 4CD1A 1IKWA 4N56A 2QKBA 4E19A 1MWKA 3RTVA 4FJLA 3CJ9A 4FM2A 4ICLA 1KVAA 4CF9A 1IBKK 4BDPA 2E2NA 3ZCMA 1WNSA 4MDBA 3SUNA 5SWMA 2KTQA 3ENBA 4I2QA 1IJJA 4BQZA 3SLCA 3WXIA 5GAGP 4FOEA 3MMVA 4E7HA 2NRRA 5ADXH 4DTPA 1WN7A 3MDQA 1YHQN 3RMAA 3QIOA 4BE7B 4B3SK 2HHVA 4KRFA 1N33K 4LF9K 2E2OA 4AHCA 3NF9A 3E9LA 2ZJQL 4AQYK 3LL3A 2P9PB 3KZBA 4B08A 4BGBA 1VAZA 1S6QA 5EU7A 1S9GA 4JK7A 3TI0A 1B9FA 3AAPA 3U9ZA 3RWUA 3LAKA 5C2DA 4QS9A 4GY2B 1ZBSA 4M42A 2KQ2A 3E66A 2BDPA 4N41A 4CFDA 4R79A 1X9MA 4KO0A 2F8SA 2QXLA 5AFUH 3VN5A 3BGRA 3DLHA 1BOTO 2CGJA 3DXKB 3HSCA 5BRDA 5JS1A 4YDUA 1DT9A 3PSFA 4YNQA 4MDAA 3NE6A 1WUAA 3QERA 2IOCA 5KRTA 3G0ZA 1GLFO 1I39A 3H6EA 2X78A 4FXDA 3G10A 2J4RA 4CESA 4YY3K 1IG9A 2O8CB 4WQ5A 2O8EA 3QETA 4XH1A 1NBWA 3E01A 1HNZK 3GDQA 3CD6N 1J53A 1T6DA 2GV9A 1G15A 3D2EB 4DHYA 1C0GA 2Q36A 2F7TA 3ISNC 4CZJA 5LL6Z 1NK5A 3AO4A 4EIAA 3VQEA 3OHRA 3SQ2A 1RNHA 5M1OA 3CQ8A 1FKOA 4BE2A 2XY8A 2G8FA 3K58A 3KK3A 1NK9A 1JLFA 5AQPA 4CZKA 1S5JA 4DWIA 4CIEA 3BZKA 4DTUA 5FPEA 3TABA 5BRHA 2DY4A 4CJRA 3LDNA 4H5WA 1N32K 3A5MC 1LWEA 4KREA 3O4NA 4JKCA 4CZEA 1Q7YO 5KGXA 3T1HK 4GKJK 4MLHA 5GINA 3HVRA 1S1UA 4C1NK 1NKBA 3DXMA 4HVJA 1ASVA 3CFPA 1J54A 1FK9A 1OH5A 3VF6A 2E20A 4WQ4C 4OPKA 3QO9A 4OKEA 3NHGA 3K5MA 5AZJB 5GIOA 4DV1K 1RDUA 2FBYA 1UAXA 2QWRA 3CPWM 2A3ZA 3EKUA 2G8KA 3QEIA 2Y1JA 3M8PA 1RT7A 4LFAK 4BGAA 3NH2A 4FLTA 1VQNN 4H5RA 3LP1A 3BY5A 2V52B 3PX6A 3F73A 2FXUA 3WQUA 4LF7K 4GVMA 2FBVA 3NVMA 5FDLA 3K9KA 5JS2A 1TK8A 2HHWA 3CJ7A 3TAGA 3LP2A 2OTJN 1NJZA 4DB3A 2VG5A 4CJEA 1BA0A 4DKWA 3SNNA 5CZ1A 3KKSA 5LY3A 4B9NA 2JWLA 4PKIA 2V7YA 4H4MA 3HM9A 3E1YA 5AQKA 5LMUK 3C94A 3L0QA 1MA9B 4CW7B 4YORA 4TSXA 4LH5A 5EOYA 2E8AA 4CEQA 2KLAA 4OPJA 3O6WA 3ID8A 4K8XA 3CQXA 5CR4A 2E2PA 3GBTA 1X3MA 3VQAA 4DQIA 4JI7K 3FZKA 5M1PA 4CCHA 4DF8A 1X3NA 3TAPA 3CCJN 4O0JA 4BRLA 3LAMA 4RW8A 3VEZA 1RBUA 2HBJA 2UUBK 3THVA 4FLVA 4CBXA 4FWNA 1TYQA 2O8FB 3HZ6A 3OS0A 4O0IA 3EL2A 1B9DA 4JKAA 4FJ7A 3THYA 3PSIA 2F9TA 2EHGA 5SZTA 3L4QA 3QBWA 3NF8A 1TL1A 3CM6A 4IZ9A 3C65A 3KWIA 2O8DA 4DQPA 3IKMA 3VQ7A 4IJAA 3THWA 4E89A 4NLCA 4IDHA 4FJJA 1W2BM 1KD1O 3VTIA 4DR2K 3CCVN 4GV6A 4JD2A 3JYTA 4JHDA 3HPGA 1J5OA 4GMJB 5MLCQ 3OYBA 4JKGB 4W5OA 4DFKA 2UYTA 3SCXA 1Q82O 4K0KK 4OPHA 4W5NA 1BISA 3I0SA 3WQTA 3S3NA 1VRUA 2A40A 1QS4A 4I6MB 4U67L 3MK6A 4H4OA 4CEFA 4FOIA 3Q7BA 2QWNA 3ZSRA 1E4GT 3VEWA 1MU2A 1TKXA 4BWMA 4V19S 3NGZA 1NGDA 3J7YP 3WXKA 5JVHL 2VCPA 1QQMA 1W97L 3O9TA 3K0SA 1RDBA 4BRFA 2D4WA 1LWCA 4DTRA 2KZMA 3VQ9A 1QQCA 1NK4A 3L3VA 2EX3A 4IG0A 2UUAK 3CIPA 2P9PA 4CHQA 2XY6A 3PX0A 3AVMA 2QWMA 2G8UA 3GE1A 4AHRA 1P8ZA 3C7NA 3EY1A 4CZGA 2DTUA 1K73O 1SUQA 4IO9L 5AQYA 1X9SA 2PZSA 2FF6A 2GELA 3KTQA 4M41A 2ASOA 4DR3K 3HPOA 3D7EO 3DXKA 3SQ0A 2XY7A 1XC9A 3RR8A 3SPYA 3SZ2A 4QS8A 4BG9A 3VQPA 2I7PA 4X65K 4ID5A 3M8RA 4DQRA 1I3AA 3THXA 4FK2A 3MWPA 3LPUA 4BDZA 1NGAA 4WQ4A 3AVKA 4FSVA 4KB1A 3V81A 4CJSA 2YJEA 4DF4A 4FVUA 2YJFA 3JXUA 4DLEA 1QHTA 2IS3A 1ZYQA 3OBWA 1CZBA 3WEEB 4NB4A 3J81O 3KLHA 3CETA 1H1VA 4NO7A 3I0RA 5IT9O 5EVZA 3FGUA 4B1XB 4B1UB 3OYDA 3BEXA 4ELUA 1KAXA 4IOXA 2PAVA 4HHTA 1RDWX 1HJRA 2QWQA 2NLXA 1EP4A 4EAHD 3LP0A 2V7ZA 4OGCA 3ITHA 5KRSA 3HK2A 2QM1A 4CIFA 3M3ZA 3JAMO 5DM6L 3RSEA 3SPZA 3KD1E 3FZFA 3OYKA 1VSEA 3OTOK 2FBXA 1REVA 1XNQK 2GTDA 3ZX2A 2HHXA 2ITGA 2DFHA 4FJGA 1C0TA 4Z4HA 4BEBA 3SMPA 2PFUA 4CJPA 1HQEA 3HP6A 1NWKA 1CZ9A 2RE2A 4H8KA 1BCOA 3FZMA 4KI4A 2HF4A 5AZJA 2HBMA 1WSGA 1JL1A 3MN6A 3Q7CA 4LF5K 5C10A 1WOQA 1D8YA 5HRSA 3NMUA 1EKEA 1J5EK 3JSMA 3VA0A 2BANA 5LMNK 3V4IA 4NCGA 5AQLA 4FJNA 4BRKA 1RILA 5CHIA 3CMAN 1LOTB 5C42A 4CZFA 2QKKA 4J2AA 4JI1K 1RBSA 3LM9A 3QDKA 4FW1A 1VQKN 2YNIA 3IS9A 3CJ1A 3O9QA 1IKXA 1XMOK 4IFYA 3LM2A 1FJGK 4AHVA 2QXFA 3HXMA 4C8NA 1HQUA 4Y1CA 3AVBA 1NM1A 5J2NA 1GOBA 4CZLA 1RT3A 3DLRA 2UXDK 2F4VK 4IOAL 4FL9A 1R0AA 5AQNA 2UXBK 4HTUA 3F9KA 4ISEA 1OH8A 2W41A 2P9KB 3LDOA 3UE5A 3OYHA 3CJAA 2P5GA 1SV5A 4K25A 3ZSOA 1OVQA 5LJWA 4DTJA 1HNVA 3M6GA 4IOCL 3LDLA 3ZT4A 3QESA 3P31A 1BIUA 4FW2A 4E7LA 4FK4A 3MXIA 4JI5K 2ZF5O 3VEOA 2NRZA 4DU1A 2NNWA 5HL7L 4DFMA 3NDKA 2W40A 3QIPA 5KPZA 5H1SQ 4BR0A 2QWPA 3LWLA 3EE9A 1C0FA 2HBKA 3TARA 1S72N 1NMDA 3CXCM 5HP1A 4CECA 2NUBA 3O4WA 4FCYA 1YF5L 4DR7K 3LP3A 4N47A 2WBNA 1BU6O 3OVNA 1KTQA 4FYDA 1HJOA 1LCUA 1O13A 3I8BA 3ZSWA 3CCEN 2H3GX 3L2UA 5CYQA 1N5YA 1GLCG 4JKGA 3P38A 1ATSA 1RT1A 2QW9A 3ZX0A 1WSFA 1HRHA 2Z1IA 4BR9A 4EP4A 4DQQA 3T1AA 1KC8O 4O5BA 4I6MA 1BQMA 3VMFB 1U45A 1GLDG 5HROA 4XJXA 3R6MA 1V4SA 3OJSA 2AP1A 1VQ6N 4QS7A 3WXJA 5KGWA 5J2PA 4DSLA 1JLCA 3AARA 3AVHA 4BC3A 4DMNA 1LW0A 3AA2A 3AVCA 3OYEA 4JHDB 2YKMA 4DV3K 3ZYYX 4A59A 1TKDA 4GKKK 2HHIA 3LALA 4DS5A 1X9WA 1T03A 2YHBA 4FWPA 3V9UA 3IAYA 4NYFA 3H1VX 3AVNA 4M3RA 4DU4A 1FW6A 3O80A 4LF8K 1QVFM 4CEEA 5AZIB 1HYZA 3BZCA 2YNHA 4KHNA 4AHTA 3RMCA 4E7IA 4F9OA 1DKGD 3DLBA 2B4JA 3ULEB 3H08A 3FE1A 1GLLO 2WONA 1QSYA 2YV0X 4RW4A 4B1VA 2ZJPL 4CJUA 1S1XA 2ZQBA 4PKGA 4FK0A 2RN2A 4FJ8A 2HBLA 3WXMB 5JENA 1Z05A 1RT6A 3CCMN 4DU3A 4CZIA 4LY7A 5AQRA 1SL2A 1IG8A 3OY9A 5AR0A 5JLFA 3C7NB 5M1KA 4J2BA 1I94K 1ASUA 1JKHA 1VQ9N 3MXMA 3FZLA 4W5RA 5DK5A 3GG4A 3QMLA 1RT4A 4A2AA 4JLHA 3RMBA 3WEEA 3C6UA 1A5VA 2IVPA 2C1GA 4H5NA 2BUPA 3HBTA 4DQSA 3V1RA 4FWSA 1CZAN 4NLBA 3V9ZA 4K43A 3VETA 1NK0A 1OH7A 3QNNA 4I7FA 2FF3B 2A1SA 4B3OA 2O4IA 2OPPA 3U4LA 3THXB 1D4XA 1S1WA 4B1WB 3DYAA 2QWLA 4JEPA 2BH1A 4H0OA 3KJVA 4FWOA 2FSNA 2QA4N 4O44A 5KTQA 3HO1A 1HX1A 3SQ1A 5HOOA 3AVFA 2IVNA 1BWFO 4OGEA 1ESVA 4DTXA 1TVRA 1NK6A 1HMVA 3DLKA 1C0UA 3LDSA 2D0CA 1XC3A 4DG1A 2XHBA 5C12A 2IVOA 4R5PA 1S3XA 3K9JA 2NRXA 3PX4A 2A1RA 2G8WA 4CGHA 5AQFA 2GX9A 3VQCA 1YI2N 5EY4A 4RCHA 3AY9A 3KLIA 3CCRN 4JI3K 1DLOA 4ZTJA 1D9FA 3L8BA 3O9RA 4CK3A 2HNZA 2YCHA 4IFEA 3RSEB 2A41A 3OYAA 5EX5A 1TAUA 4FVMA 3AO3A 2OPQA 2YI1A 4LFBK 4M3XA 4DV6K 4ELTA 3NBPA 3AA5X 4MLEA 1L5UA 1J9AA 4A62A 3CC4N 3P1GA 4YOVA 2A42A 5BR8K 2RHKA 1YITN 5AQQA 3B6PA 4CJFA 1RT5A 4B9QA 1UOCA 4M63C 4YOYA 4L3QA 1VSHA 1C1AA 4AHUA 3L2WA 3MCAB 4CF0A 1NOYA 4C8LA 5HRNA 2IC3A 4Z4GA 5AQHA 4GW6A 4HTLA 1GLJO 3EN9A 4B3TK 2OCEA 1VSMA 2C1IA 5BN8A 3A0IX 5K14A 4J8FA 5B8HA 3ZSXA 1NGJA 3MEDA 1GOAA 2P9SB 1RDAA 3DLGA 4XEIA 5FPNA 1QQOA 2FLOA 1YJ9N 2P9KA 2Z1GA 4F3OA 1YTAA 5AQJA 1WBDA 1KFSA 1L3TA 1LAWA 1RBRA 3L6QA 1TGOA 4ISFA 2D1KA 3VF2A 2CH6A 1Q86O 2XRIA 1Q81O 2G8IA 1ZBFA 3VQ5A 3VQBA 4HUEA 4DR6K 2GBZA 4H0PA 1NGGA 4JKBA 5AJ3K 4LF6K 4JI8K 3RRHA 4W5QA 3H45C 1NNEA 1ATNA 4LFCK 3RR7A 2D0OA 1Z6RA 3V1OA 4YOWA 3AO2A 4JKHA 3U3YA 3C6TA 3MXJA 1EX4A 3MECA 1YUWA 1N34K 4DSJA 4CHYA 3NCIA 1IO2A 5LJVA 2WOMA 4CGIA 4LSLA 3KK1A 4F3TA 4DTNA 2IDOA 3AVLA 5C24A 3P39A 2HSTA 1HNIA 4CJTA 1L3SA 4OKKA 2VQFK 4E1NA 3M8QA 1OH6A 4JK9A 1T3VA 2XY5A 5KI6A 3HPHA 4B3MK 4FO0A 5F1XA 4CF8A 1W7AA 1NJIO 2I5JA 1ZBHA 3ID6A 5FROA 5GAHP 4Z94A 2G8VA 1QSLA 3IRXA 5C0YA 3T3FA 3PO5A 2EWSA 1X1PA 4FJMA 1BI4A 3QEVA 3ATVA 1HR0K 3K5OA 4QCLA 3CG7A 4FWKA 5AZIA 5BREA 3SUQA 4IFVA 1XMQK 3DJCA 1EXQA 2DFEA 4LSNA 3VEVA 4FZYA 2GEMA 3BUZB 4KH6A 1TK5A 1VSIA 4ID1A 4KH5A 4FPAA 2ASMA 3O3HA 3KHYA 3K5LA 3CC7N 1WSHA 3U3GA 2W42A 1ASWA 3ULEA 5EXWA 1UA0A 4DR4K 4H0TB 5HRPA 1W0HA 4B1YB 3M8SA 4PA1A 1S1TA 4DSFA 4JNEA 4MO4A 1BA1A 3D2FB 5J1EA 3CFRA 3HTVA 5AQVA 1SKRA 2FBTA 1KCFA 1EO1A 3NF6A 4A5AA 5TKWA 3C6HA 4A57A 1WAJA 4NCBA 4LC9B 3SBGA 4CHPA 2P9LB 3QFPA 3IFRA 3D0PA 4F8RA 1IBMK 2F96A 3MWTA 3VEYA 4H0XB 4WFAL 2X6SA 4RWTA 3DLEA 1VSKA 2CGLA 2W6LA 3V9WA 3TAEA 3ZEUB 3LWMA 1ZC6A 2ZD1A 4B8AB 3V9SA 1TUUA 4UY8O 4E0DA 3DOKA 4EP5A 1G99A 3VQ6A 1HKCA 2OPRA 1YVNA 1KRPA 3DRPA 3PUFA 2QI2A 2E2QA 3A8YA 3AGKA 3D6RA 1HYVA 4OX9K 1KLNA 3P4IA 3ASMA 4BE0A 5KQ8A 2VGNA 4KHSA 3VENA 1A5XA 4DLGA 4H0VB 4G1QA 4KPYA 4IO8A 4Z0UA 4C1NI 3CFOA 4CGGA 2KKZA 3MEEA 3SV3A 1XWLA 4CD3A 4OVLA 3FLCO 5FRMA 2KFNA 2D0PA 1NOZA 4DS4A 1Q9YA 3SUOA 3ZETA 1RGIA 4Y1DA 3EKSA 4BR7A 1J6ZA 5E26A 3LZJA 3ZT2A 2HMIA 2RKIA 4Z4FA 3NFAA 2GWKA 1NJWA 4O8KA 3HOTA 4AILC 4A5BA 3K2PA 3GL1A 1MWMA 1VQ5N 1Z26A 5M1FA 3AV9A 3EE8A 3M1FA 4JKEA 4PQUA 3FZHA 1ATRA 1VSFA 2ITMA 3KKRA 2O4GA 3ENOA 4FWQA 4DSEA 4CHNA 5C15A 1YT3A 5HLFA 4AF1A 1XI1A 1E4FT 2OTLN 5AQOA 3TWHA 1U48A 4ILGB 3KLEA 3S41A 2F9WA 4IDKA 4DSKA 4FLWA 3CYMA 1FXXA 4FJHA 4FWRA 3UKRB 5JVGL 4KHWA 2ETJA 1IH7A 2P9SA 4CEDA 2HW3A 3W3DA 3AAQA 3J7AP 3CCLN 1RCHA 1U6ZA 2ZGZA 1EWQA 2Q0UA 1TKTA 4N76A 2E1ZA 3MN7A 4NXNK 3TTDA 2Z1HA 4Y0WA 4EHTA 3TAQA 4JYAK 4WYBA 1BUPA 3OA9A 3O3FA 3VQ4A 4B1ZA 3K5NA 1ITGA 5T7BA 4EZ6A 3UB5A 5M1NA 5BPNA 3PO4A 1NKCA 3QBXA 1Z25A 4FZXC 4IEIA 3QNOA 1SKSA 3NVKA 1NK8A 1YJWN 3EZ5A 2HVHA 3CJBA 3QLHA 4MFBA 3LANA 3VGKA 3CHWA 3MN9A 3I8DA 5BRFA 1KAZA 3MCPA 2VQEK 4CEAA 3VESA 1N6QA 5FPMA 1RT2A 4RTFD 1QQNA 3PY8A 4YOUA 2P5OA 4BY9C 3HM8A 1JXBA 3CQYA 4CEZA 3P83D 2WFBA 3T69A 3HT3A 4Z4EA 2V51B 4FWLA 4BE1A 2P9UB 1LV5A 1MDUB 4YFUA 3AO5A 2VYPA 1NGCA 3VOVA 3DRSA 4IEEA 3R1XA 1U49A 2RF2A 1NGFA 2HOEA 5JICA 3G4SN 1Y64A 1E3MA 2YHXA 5JLHA 3SK3A 4JI2K 5HBMA 2R7YA 2KZZA 3J8AA 4FZZA 3FFKB 2XO7A 3ZT1A 2Z1JA 3VF4A 4FM1A 2GUPA 3UKUB 4X64K 4CERA 3ATUA 4BRGA 4DUYK 3O3GA 4O8UA 5BN9A 2CH5A 4IKFA 5CZ2A 4BR5A 3S3MA 4JS5A 1M90O 1S6PA 3TSPA 4JK8A 3SJJA 4CEOA 3SV4A 4KKOA 4U7BA 3G6EN 2DFFA 2NRWA 1BI4B 1Q8IA 2KW4A 3D2FA 3MX5A 3O1BA 2DPNA 2ATQA 4F2SA 1BIZA 5CYMA 4Z4CA 1HPZA 3JS6A 3ALYA 3MX2A 4ILJA 4CJ4A 3H1QA 3QICA 4I9QA 4KBOA 4DR1K 2E88A 3C6AA 1YIJN 1S1VA 1KFDA 1LW2A 4IBNA 2P9LA 2W6KA 1QTMA 2VG6A 1BG3A 3CM5A 1IKYA 2ZGYA 3HVTA 4JI6K 4E7JA 3FFIA 4M3YA 2G8HA 1NGEA 3BDPA 4KHPK 3DI6A 4BR4A 2B6AA 2WUSA 3RRGA 5DMRA 3ZEUA 3U6FA 1KAYA 1EETA 4CZHA 4I9LA 1VQLN 1D5AA 2JWKA 1QVGM 1NMNA 5AFUA 1U04A 5F2RA 3SQ4A 3L3UA 2BE2A 3OS1A 3OYFA 1K8AO 4BR2A 3SAFA 1VQPN 3HJFA 5KPTA 1YJNN 1BO5O 2E6LA 3NH1A 1VQON 1C1BA 4CFBA 2WTUA 1BCMA 3C95A 4B9TA 4RW6A 1S9EA 1XUPO 4BC2A 3G25A 5GADP 3VGMA 3A5OC 4GNIA 3VQ8A 4CGFA 4RW9A 3NF7A 2UXCK 2P9IB 1U47A 2I7NA 4RW7A 3SAGA 1M1KO 4KHUA 3OYIA 3AVIA 3LDQA 1QE1A 3O8MA 4DTMA 2HB5A 1RDCA 2GUIA 3OJUA 3N4QA 1HLUA 2OA8A 4XIUA 2PBDA 2Q3SA 1ZBUA 3VA3A 4CFAA 2Y1IA 4EFHA 1P90A 3ZSYA 4DSIA 2RPIA 4O55A 3KIOA 3IG1A 3K59A 2PY5A 3R3LA 4AM6A 3B6OA 3G71N 1HPMA 4HUFA 5C2FA 1B92A 3KVGA 1WB9A 1N36K 4DV4K 3O9SA 3CCQN 3IUCA 3DWLA 5AQSA 4OKJA 3H46O 3KK7A 5AQUA 1HKGA 3EEQA 4ZTFA 2WC9A 1VQ4N 1RTJA 4UQGA 3I56N 3ULDA 3A2FA 3AA4A 4BROA 3ZETB 4DUZK 4BVPA 2HVIA 2FSJA 5J2QA 3W0LA 4AH9A 3LDPA 4NXMK 4ZHRA 1WLJA 3T7ZA 2OZSA 1VQ8N 4OLAA 2NRHA 4OPAA 3UKRA 1T7PA 3F9MA 3VPZA 4HCBA 4PY5A 4CGDA 4E1JA 3BF3A 1T8EA 3D45A 1QHAA 3A5NC 1NGIA 5CY4A 2HHSA 2QWOA 4G9ZA 2O8BB 4CVNE 1ILYA 4CJ3A 3ZLJA 1K8KB 3R9PA 1YAGA 5KQDA 2OYQA 4OJRA 2E6MA 3NGYA 2IIRA 3CF5L 4PWDA 4BECA 1RBVA 3VEXA 3CJCA 5E84A 3TTCA 4DQ8A 1A5WA 3F2KA 2YNGA 4FJXA 4CF1A 1N8RO 4CFCA 4JRQA 5AQWA 3N4PA 3AVGA 4XH5A 1SL1A 3CERA 3SBTA 3FR0A 3OBYA 4LD0A 1YVUA 4M3ZA 3KLGA 5HRRA 4L8RB 4NCAA 2Q2RA 3DLLL 2D0AA 2HHTA 2W00A 5AQIA 3VQDA 4LH4A 2FSKA 1JXEA 4F4KA 1KVCA 2P9NA 3E9OA 2AJQA 1Q9XA 1WAFA 4ELVA 4BDYA 3HL8A 3ZSZA 4E1MA 3HSTB 4JI0K 4B9MA 4B9LA 2NRTA 4CJLA 4YHHK 3KD5E 3LPTA 4JS4A 3OS2A 4OLBA 4FLXA 5BPLA 1KQSM 2P9UA 3H3OB 5AQTA 4CGJA 4FJ5A 4HWIA 2OANA 5AQMA 1IKVA 3KLFA 3QEPA 2YHWA 2YNFA 1HUXA 4O5FA 4HUGA 1KLMA 1GOCA 4BWJA
chains in the Genus database with same CATH topology
1WUAA 4BRPA 1C0FA 2HBKA 4IJNA 4C1NI 1GLFO 3IMXA 5JMVA 3H6EA 1S72N 1NMDA 3CXCM 2J4RA 2KKZA 3O4WA 4WQ5A 4JAXA 1YF5L 4XH1A 1NBWA 2WBNA 1BU6O 1S22A 1JCGA 4CD3A 1JJ2M 3GDQA 3UKUA 3CD6N 1HJOA 1T6DA 3FLCO 1LCUA 3D2EB 4DHYA 1C0GA 1O13A 2Q36A 3I8BA 4WFNL 2F7TA 3CCEN 2H3GX 1X9JA 2D0PA 1GLCG 4CZJA 3MN5A 3KWGA 4JKGA 4YOXA 3P38A 3ZETA 4WF9L 4EIAA 1ATSA 1RGIA 2Q97A 3EKSA 4BR7A 1J6ZA 5E26A 3OHRA 2QW9A 1VQ7N 3ZX0A 4JN4A 5M1OA 5CE3A 4BR9A 4PKHA 2GWKA 1YXQA 2ASPA 4O8KA 3HOTA 4A5BA 1KC8O 5AQPA 3GL1A 4CZKA 4I6MA 3O1WA 1MWMA 1VQ5N 5M1FA 1JCEA 3VMFB 1GLDG 3M1FA 3EE8A 3R6MA 4JKEA 4XJXA 3FZHA 1V4SA 5ELZA 1ATRA 2ITMA 4BRHA 2AP1A 1VQ6N 3CI5A 4QS7A 5KPRA 5FPEA 3U8XA 3I33A 1SS6A 3WXJA 3ENOA 4BRIA 5BRHA 4BC3A 3AARA 4FWQA 4BC4A 2YX6A 3LDNA 4H5WA 5C15A 4JHDB 4AF1A 3ZYYX 3A5MC 1QZ5A 3SMSA 4A59A 1E4FT 5M1QA 1ZXOA 2OTLN 4JKCA 4WFBL 5AQOA 4CZEA 1Q7YO 4FWPA 4ILGB 4MLHA 5GINA 3O9UA 3S41A 2NRVA 2F9WA 5TKYA 4C1NK 3DXMA 3H1VX 3O80A 4FWRA 3UKRB 1QVFM 3VF6A 5AZIB 5JVGL 1KXPA 2E20A 4A61A 4WQ4C 3L4IA 3QFUA 2P9SA 5AZJB 5GIOA 1RDUA 2QWRA 3W3DA 3AAQA 4F9OA 1DKGD 5F0XA 3CPWM 2ZJRL 3CCLN 4CJ7A 3J7ZO 2A3ZA 1U6ZA 2ZGZA 1U2VB 3EKUA 4JKDA 3ULEB 3WUHA 4AM7A 3FE1A 2Q0UA 1GLLO 2E1ZA 4BGAA 3MN7A 3TTDA 4B1VA 3M5RA 2ZJPL 1VQNN 4H5RA 3CPEA 4BQLA 3C0BA 2V52B 3IDHA 2FXUA 4PKGA 3WQUA 4Y0WA 1NGBA 2HBLA 4EHTA 3WXMB 1Z05A 3NVMA 4BRDA 3K9KA 4WYBA 1BUPA 5BPMA 3OA9A 4B1ZA 3CJ7A 1Q18A 3CCMN 4DB3A 2OTJN 4FWMA 4CZIA 5AQRA 1GLEG 1IG8A 4IXCA 3UB5A 4PHTX 4BREA 5M1NA 1BA0A 4DKWA 5BPNA 5AR0A 3QBXA 5JLFA 3C7NB 3CC2N 5M1KA 2ZWHA 4IEIA 3TPQA 3DAWA 4KH4A 5LY3A 2P9IA 3NVKA 1VQ9N 3FZLA 1YJWN 2JWLA 3GG4A 4PKIA 2V7YA 1VQMN 3QMLA 4A2AA 3E1YA 5AQKA 4WCEL 3CJBA 3WEEA 3TSQA 3L0QA 1MA9B 3HRGA 4YORA 2IVPA 5EOYA 3VGKA 3CHWA 3MN9A 2C1GA 2E8AA 4H5NA 2BUPA 5BRFA 2KLAA 3HBTA 3O6WA 1KAZA 3MCPA 3ID8A 3O5BA 3VESA 4FWSA 1CZAN 3CQXA 2E2PA 4NLBA 4RTFD 5CR4A 5FPMA 1QQNA 2AA4A 4K43A 3GBTA 1X3MA 4YOUA 3FZKA 3EZWA 5M1PA 3VETA 4BY9C 2FF3B 4H5TA 3HM8A 3U9DA 3U4LA 1D4XA 2Q1NA 3CQYA 4H0YB 1X3NA 5AQZA 2QWLA 2KHOA 4B1WB 4JEPA 3CCJN 2BH1A 4H0OA 2WFBA 4BRMA 3T69A 4BRLA 4CI6A 1NLVA 4FWOA 3PIPL 3VEZA 2FSNA 2V51B 3ENHA 4FWLA 2HBJA 2QA4N 1XQSC 2P9UB 3D2EA 4CBXA 1MDUB 4FWNA 4A2BA 1HX1A 1TYQA 3WT0A 4BVOA 2VYPA 5HOOA 1NGCA 3VOVA 1SAZA 2IVNA 3HZ6A 1BWFO 3R1XA 1ESVA 4IEEA 5AQGA 4EHUA 3EL2A 4ILHA 1NGFA 4JKAA 4DCHA 5AQXA 2HOEA 2F9TA 2A5XA 5JICA 3G4SN 1Y64A 3L4QA 2YHXA 3QBWA 5JLHA 4IZ9A 1T6CA 3C65A 3SK3A 3KWIA 1XC3A 3IKMA 4BG8A 3J8AA 5C12A 2NZTA 2IVOA 5FPDA 4IJAA 3CCUN 1S3XA 3K9JA 3FFKB 2NRXA 4NLCA 2VWBA 3VF4A 4IDHA 5AQFA 4MO5A 2GUPA 2GX9A 4CBUA 1W2BM 3VTIA 1KD1O 1YI2N 5EY4A 4RCHA 3UKUB 3AY9A 3CCRN 3CCVN 4GV6A 4JD2A 3ATUA 4BRGA 3O9RA 2YCHA 4IFEA 4JHDA 4O8UA 5BN9A 2CH5A 3RSEB 4BC5A 2A41A 5EX5A 5MLCQ 4BR5A 4JKGB 2E1YA 2YI1A 1M90O 3ZX3A 1K8KA 4GV9A 2UYTA 3TU5A 3TSPA 4JK8A 1Q82O 4OPHA 4CBWA 3WQTA 3RVCA 3O08A 4U7BA 3G6EN 2A40A 2NRWA 3D2FA 2HF3A 4MLEA 3MX5A 3O1BA 5GAEP 3HOSA 2DPNA 4I6MB 4H03B 1GLBG 4M7YA 4A62A 3MK6A 4U67L 3CC4N 2QTDA 4YOVA 2A42A 4H5VA 4FOIA 3Q7BA 3VGLA 3PIOL 2BTFA 2QWNA 2RHKA 1YITN 5BR9A 3JS6A 5AQQA 1E4GT 3MX2A 4ILJA 3VEWA 4B9QA 3H1QA 3QICA 4M63C 4KBOA 4YOYA 4L3QA 3C6AA 2E88A 4BRNA 1YIJN 3MCAB 1NGDA 3F5TA 4YDUC 2P9LA 3WXKA 5JVHL 2VCPA 1QQMA 1W97L 3O9TA 5AQHA 3CCSN 4HTLA 1GLJO 3EN9A 4BRFA 1BG3A 2D4WA 3VTHA 2ZGYA 3DXMB 1BDGA 4OO1J 2C1IA 1NGEA 5BN8A 3A0IX 3CIPA 2P9PA 4BR4A 4J8FA 5B8HA 2WUSA 4WQ5C 3ZEUA 1NGJA 2P9SB 2QWMA 3GE1A 1KAYA 1P8ZA 4XEIA 2VGMA 3C7NA 1QQOA 5FPNA 4CZHA 2FLOA 1VQLN 1YJ9N 4CZGA 2P9KA 2JWKA 1QVGM 1K73O 5AFUA 3BP8A 5AQJA 5F2RA 4IO9L 5AQYA 4C23A 3R8EA 4JKFA 3L6QA 2FF6A 4ISFA 2GELA 4K41A 3I55N 2D1KA 1K8AO 1OVYA 3VF2A 2CH6A 4BR2A 3SAFA 2ASOA 3SAHA 1VQPN 1Q86O 1Q81O 3D7EO 3DXKA 1DEJA 5KPTA 1YJNN 1BO5O 1VQON 4QS8A 4PL8A 4BG9A 3HI0A 4H0PA 1OKJA 1NGGA 2I7PA 4JKBA 3EO3A 2P9NB 1SZ2A 1XUPO 3H45C 4BC2A 1NGHA 4BRCA 3G25A 3MWPA 5GADP 1ATNA 3VGMA 3A5OC 4GNIA 1NGAA 2D0OA 4WQ4A 1Z6RA 2P9IB 4FSVA 2I7NA 4JKHA 4YOWA 3OW2M 1GLAG 3SAGA 1M1KO 2YJEA 4FVUA 2YJFA 3LDQA 2A6AA 3JXUA 3O8MA 1YUWA 1R59O 3OBWA 3WEEB 4PL7A 4NB4A 5I9EB 3CETA 3N4QA 1HLUA 1H1VA 3VERA 2PBDA 5LJVA 4NO7A 5EVZA 3FGUA 4B1XB 1P90A 4EFHA 4B1UB 1QZ6A 3P39A 4M7XA 2HSTA 3WXLA 4BRQA 1EQYA 3R3LA 4AM6A 3G71N 1HPMA 2Q31A 5C2FA 3BEXA 3KVGA 1KAXA 4IOXA 2HMPA 2GWJA 2PAVA 3TSUA 1RDWX 1JCFA 2QWQA 4JK9A 2NLXA 4GV3A 1T3VA 3O9SA 3IUCA 4EAHD 3CCQN 3DWLA 5AQSA 2V7ZA 3H46O 3KK7A 5AQUA 3H3NO 4FO0A 2QM1A 5F1XA 3M3ZA 1HKGA 5DM6L 3RSEA 2WC9A 3FZFA 1TYQB 1NJIO 1VQ4N 3ID6A 3QB0A 1HKBA 5DM7L 5GAHP 3I56N 2QEXN 1TUYA 4Z94A 2GTDA 4ISGA 4BROA 4CZMA 1T44A 3ZETB 5C0YA 3ZX2A 4BVPA 2FSJA 1SQKA 3W0LA 2EWSA 3PLAA 3LDPA 3CMEN 4XH4A 4BEBA 3ATVA 3SMPA 3E9PA 3T7ZA 2PFUA 4K42A 1VQ8N 2NRHA 4GVEA 4OPAA 3UKRA 2Q0RA 4FWKA 3F9MA 1V4TA 5AZIA 5BREA 1NWKA 1DGKN 1K9MO 3VPZA 3DJCA 3VEVA 2GEMA 2RE2A 3BUZB 4KH6A 2CGKA 3FZMA 2HF4A 4IWVA 5AZJA 2HBMA 4KH5A 4E1JA 3BF3A 3GOIA 3MN6A 4FPAA 5ADXA 2ASMA 3Q7CA 3KHYA 4JD2B 4YOTA 3CC7N 2YHYA 3A5NC 1QHAA 5C10A 1NGIA 1WOQA 4BRAA 5GIPA 3NMUA 3SJHA 3A5LC 3B8AX 1U2VA 2QWOA 3ULEA 3BF1A 5EXWA 4FPBA 4G9ZA 1RFQA 1ILYA 4H0TB 4B1YB 1K8KB 3AGRA 3R9PA 1YAGA 5AQLA 3TTFA 5KQDA 4BRKA 4CD1A 4JNEA 2IIRA 3CF5L 4BECA 4MO4A 3VEXA 1MWKA 1BA1A 3CJ9A 5CHIA 3CMAN 3D2FB 1LOTB 3CJCA 5E84A 3TTCA 4CZFA 4DQ8A 3HTVA 2E2NA 5AQVA 3LM9A 3QDKA 3F2KA 1EO1A 1VQKN 1N8RO 4MDBA 4A5AA 3CJ1A 5AQWA 3ENBA 3O9QA 5TKWA 3C6HA 3N4PA 4A57A 1IJJA 4BQZA 3SLCA 3WXIA 4XH5A 4FOEA 3LM2A 3CERA 5GAGP 3MMVA 3SBTA 3FR0A 3OBYA 4LC9B 2NRRA 5ADXH 3SBGA 2P9LB 3QFPA 3MDQA 1YHQN 3IFRA 2Q2RA 3DLLL 2W00A 4BE7B 5AQIA 3MWTA 3VEYA 2E2OA 1NM1A 4H0XB 4WFAL 2FSKA 3E9LA 2ZJQL 3LL3A 2P9PB 3KZBA 4CZLA 2P9NA 3E9OA 4RWTA 2CGLA 4BGBA 1VAZA 3ZEUB 4IOAL 4JK7A 1ZC6A 4FL9A 2NRTA 3AAPA 5AQNA 3U9ZA 1TUUA 4ISEA 5C2DA 4UY8O 4QS9A 2W41A 2P9KB 3LDOA 1G99A 4GY2B 3UE5A 1HKCA 1ZBSA 1YVNA 3CJAA 3E66A 2QI2A 2E2QA 3A8YA 3AGKA 5BPLA 3D6RA 4K25A 1KQSM 2P9UA 3H3OB 5LJWA 5AQTA 4R79A 3M6GA 4HWIA 3LDLA 3P4IA 2OANA 4IOCL 2QXLA 3P31A 5AQMA 5AFUH 5KQ8A 2VGNA 2YHWA 1BOTO 2CGJA 3DXKB 3HSCA 5BRDA 4YDUA 2ZF5O 3VENA 1HUXA 4O5FA 2NRZA 3VEOA 1DT9A 2NNWA 5HL7L 2W40A 5KPZA 4H0VB 5H1SQ 4BR0A 2QWPA 4MDAA 3EE9A 4IO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WUA A;  4BRP A;  1C0F A;  4IJN A;  1GLF O;  3IMX A;  5JMV A;  3H6E A;  1NMD A;  2J4R A;  3O4W A;  4WQ5 A;  4JAX A;  4XH1 A;  1NBW A;  1BU6 O;  1S22 A;  1JCG A;  4CD3 A;  3GDQ A;  3UKU A;  1HJO A;  1T6D A;  3FLC O;  1LCU A;  3D2E B;  4DHY A;  1C0G A;  2Q36 A;  3I8B A;  2H3G X;  1X9J A;  2D0P A;  1GLC G;  4CZJ A;  3MN5 A;  3ZET A;  4EIA A;  1ATS A;  1RGI A;  2Q97 A;  3EKS A;  4BR7 A;  1J6Z A;  5E26 A;  3OHR A;  2QW9 A;  3ZX0 A;  4JN4 A;  5CE3 A;  4BR9 A;  4PKH A;  2GWK A;  1YXQ A;  2ASP A;  4O8K A;  5AQP A;  3GL1 A;  4CZK A;  4I6M A;  3O1W A;  1MWM A;  1JCE A;  1GLD G;  3M1F A;  3R6M A;  3FZH A;  1V4S A;  5ELZ A;  1ATR A;  2ITM A;  4BRH A;  2AP1 A;  3CI5 A;  4QS7 A;  5KPR A;  5FPE A;  3U8X A;  3I33 A;  4BRI A;  3WXJ A;  3ENO A;  5BRH A;  4BC3 A;  3AAR A;  4FWQ A;  4BC4 A;  3LDN A;  4H5W A;  4JHD B;  3A5M C;  1QZ5 A;  3SMS A;  1E4F T;  1ZXO A;  5AQO A;  4CZE A;  4FWP A;  4MLH A;  3S41 A;  2F9W A;  5TKY A;  3DXM A;  3H1V X;  3O80 A;  4FWR A;  3UKR B;  3VF6 A;  5AZI B;  1KXP A;  2E20 A;  4A61 A;  4WQ4 C;  3L4I A;  3QFU A;  2P9S A;  5AZJ B;  2QWR A;  3W3D A;  3AAQ A;  4F9O A;  1DKG D;  5F0X A;  4CJ7 A;  2A3Z A;  1U6Z A;  2ZGZ A;  1U2V B;  3EKU A;  4AM7 A;  3ULE B;  3WUH A;  3FE1 A;  2Q0U A;  1GLL O;  2E1Z A;  4BGA A;  3MN7 A;  4B1V A;  4H5R A;  4BQL A;  3C0B A;  2V52 B;  3IDH A;  2FXU A;  4PKG A;  3WQU A;  4Y0W A;  1NGB A;  4EHT A;  1Z05 A;  4BRD A;  4WYB A;  1BUP A;  5BPM A;  4B1Z A;  3CJ7 A;  1Q18 A;  4DB3 A;  4FWM A;  4CZI A;  5AQR A;  1GLE G;  1IG8 A;  4IXC A;  3UB5 A;  4BRE A;  1BA0 A;  5BPN A;  5AR0 A;  3QBX A;  5JLF A;  3C7N B;  2ZWH A;  3TPQ A;  3DAW A;  5LY3 A;  2P9I A;  3FZL A;  3GG4 A;  4PKI A;  2V7Y A;  3QML A;  4A2A A;  5AQK A;  3CJB A;  3WEE A;  3L0Q A;  1MA9 B;  2IVP A;  5EOY A;  3VGK A;  3CHW A;  3MN9 A;  2E8A A;  4H5N A;  2BUP A;  5BRF A;  3HBT A;  3O6W A;  1KAZ A;  3MCP A;  3ID8 A;  3O5B A;  3VES A;  4FWS A;  1CZA N;  3CQX A;  2E2P A;  4RTF D;  5FPM A;  1QQN A;  2AA4 A;  4K43 A;  3GBT A;  1X3M A;  3FZK A;  3EZW A;  3VET A;  2FF3 B;  4H5T A;  3HM8 A;  3U9D A;  3U4L A;  1D4X A;  2Q1N A;  3CQY A;  4H0Y B;  1X3N A;  5AQZ A;  2QWL A;  2KHO A;  4B1W B;  4H0O A;  4BRM A;  4BRL A;  4CI6 A;  1NLV A;  4FWO A;  3VEZ A;  2FSN A;  2V51 B;  3ENH A;  4FWL A;  1XQS C;  2P9U B;  3D2E A;  4CBX A;  1MDU B;  4FWN A;  4A2B A;  1HX1 A;  1TYQ A;  3WT0 A;  4BVO A;  2VYP A;  1NGC A;  3VOV A;  1SAZ A;  2IVN A;  3HZ6 A;  1BWF O;  1ESV A;  5AQG A;  4EHU A;  3EL2 A;  1NGF A;  4DCH A;  5AQX A;  2HOE A;  2F9T A;  2A5X A;  5JIC A;  1Y64 A;  2YHX A;  3QBW A;  5JLH A;  4IZ9 A;  1T6C A;  3SK3 A;  1XC3 A;  4BG8 A;  3J8A A;  2NZT A;  2IVO A;  5FPD A;  4IJA A;  1S3X A;  3FFK B;  2VWB A;  3VF4 A;  5AQF A;  4MO5 A;  2GUP A;  4CBU A;  5EY4 A;  4RCH A;  3UKU B;  3AY9 A;  4JD2 A;  3ATU A;  4BRG A;  2YCH A;  3RSE B;  4JHD A;  5BN9 A;  4BC5 A;  2CH5 A;  2A41 A;  5EX5 A;  4BR5 A;  2E1Y A;  2YI1 A;  3ZX3 A;  1K8K A;  2UYT A;  3TU5 A;  4CBW A;  3WQT A;  3O08 A;  2A40 A;  3D2F A;  2HF3 A;  4MLE A;  3O1B A;  2DPN A;  4I6M B;  4H03 B;  1GLB G;  4M7Y A;  4A62 A;  3MK6 A;  2A42 A;  4H5V A;  4FOI A;  3VGL A;  2BTF A;  2QWN A;  5BR9 A;  3JS6 A;  5AQQ A;  1E4G T;  3VEW A;  4B9Q A;  3H1Q A;  3QIC A;  4M63 C;  4KBO A;  4L3Q A;  2E88 A;  4BRN A;  1NGD A;  4YDU C;  2P9L A;  3WXK A;  2VCP A;  1QQM A;  5AQH A;  4HTL A;  1GLJ O;  3EN9 A;  4BRF A;  1BG3 A;  2D4W A;  2ZGY A;  3DXM B;  1BDG A;  1NGE A;  5BN8 A;  3A0I X;  3CIP A;  2P9P A;  4BR4 A;  4J8F A;  5B8H A;  2WUS A;  4WQ5 C;  3ZEU A;  1NGJ A;  2P9S B;  2QWM A;  3GE1 A;  1KAY A;  1P8Z A;  4XEI A;  5FPN A;  3C7N A;  1QQO A;  4CZH A;  2FLO A;  4CZG A;  2P9K A;  5AFU A;  3BP8 A;  5AQJ A;  5F2R A;  5AQY A;  4C23 A;  3R8E A;  3L6Q A;  2FF6 A;  4ISF A;  2GEL A;  4K41 A;  2D1K A;  3VF2 A;  2CH6 A;  4BR2 A;  2ASO A;  3D7E O;  3DXK A;  1DEJ A;  5KPT A;  1BO5 O;  4QS8 A;  4PL8 A;  4BG9 A;  3HI0 A;  4H0P A;  1OKJ A;  1NGG A;  2I7P A;  3EO3 A;  2P9N B;  1SZ2 A;  1XUP O;  3H45 C;  4BC2 A;  1NGH A;  4BRC A;  3G25 A;  1ATN A;  3VGM A;  3A5O C;  4GNI A;  1NGA A;  2D0O A;  4WQ4 A;  1Z6R A;  2P9I B;  4FSV A;  2I7N A;  1GLA G;  2YJE A;  2YJF A;  3LDQ A;  2A6A A;  3JXU A;  3O8M A;  1YUW A;  1R59 O;  3WEE B;  4PL7 A;  4NB4 A;  5I9E B;  3CET A;  1HLU A;  1H1V A;  3VER A;  2PBD A;  5LJV A;  4NO7 A;  5EVZ A;  3FGU A;  4B1X B;  4EFH A;  4B1U B;  1QZ6 A;  4M7X A;  3WXL A;  4BRQ A;  1EQY A;  4AM6 A;  1HPM A;  2Q31 A;  3BEX A;  3KVG A;  1KAX A;  2HMP A;  2GWJ A;  2PAV A;  1RDW X;  1JCF A;  2QWQ A;  2NLX A;  4EAH D;  3IUC A;  3DWL A;  5AQS A;  2V7Z A;  3H46 O;  5AQU A;  3H3N O;  4FO0 A;  2QM1 A;  5F1X A;  3M3Z A;  1HKG A;  3RSE A;  3FZF A;  1TYQ B;  3QB0 A;  1HKB A;  1TUY A;  4Z94 A;  2GTD A;  4ISG A;  4BRO A;  4CZM A;  1T44 A;  3ZET B;  3ZX2 A;  4BVP A;  2FSJ A;  1SQK A;  3W0L A;  2EWS A;  3LDP A;  4XH4 A;  3ATV A;  3SMP A;  4K42 A;  2NRH A;  3UKR A;  2Q0R A;  4FWK A;  3F9M A;  1V4T A;  5AZI A;  5BRE A;  1NWK A;  1DGK N;  3VPZ A;  3DJC A;  3VEV A;  2GEM A;  3BUZ B;  2CGK A;  3FZM A;  2HF4 A;  4IWV A;  5AZJ A;  4E1J A;  3BF3 A;  3GOI A;  3MN6 A;  4FPA A;  5ADX A;  2ASM A;  4JD2 B;  3KHY A;  2YHY A;  3A5N C;  1QHA A;  1NGI A;  1WOQ A;  4BRA A;  3SJH A;  3A5L C;  3B8A X;  1U2V A;  2QWO A;  3ULE A;  3BF1 A;  5EXW A;  4FPB A;  1RFQ A;  4H0T B;  4B1Y B;  1K8K B;  3R9P A;  1YAG A;  5AQL A;  5KQD A;  4BRK A;  4CD1 A;  4JNE A;  2IIR A;  4MO4 A;  3VEX A;  1MWK A;  1BA1 A;  3CJ9 A;  3D2F B;  1LOT B;  3CJC A;  5E84 A;  4CZF A;  4DQ8 A;  3HTV A;  2E2N A;  5AQV A;  3LM9 A;  3QDK A;  3CJ1 A;  5AQW A;  1IJJ A;  4BQZ A;  3SLC A;  3WXI A;  4XH5 A;  4FOE A;  3LM2 A;  3CER A;  3MMV A;  3FR0 A;  4LC9 B;  5ADX H;  2P9L B;  3QFP A;  3MDQ A;  3IFR A;  2Q2R A;  5AQI A;  3VEY A;  2E2O A;  1NM1 A;  4H0X B;  2FSK A;  3LL3 A;  2P9P B;  3KZB A;  4CZL A;  2P9N A;  4RWT A;  2CGL A;  4BGB A;  3ZEU B;  1ZC6 A;  4FL9 A;  3AAP A;  3U9Z A;  5AQN A;  1TUU A;  4ISE A;  4QS9 A;  2W41 A;  2P9K B;  3LDO A;  1G99 A;  4GY2 B;  3UE5 A;  1HKC A;  1ZBS A;  1YVN A;  3CJA A;  2E2Q A;  3A8Y A;  5BPL A;  4K25 A;  2P9U A;  3H3O B;  5LJW A;  5AQT A;  3M6G A;  4HWI A;  3LDL A;  3P4I A;  2OAN A;  2QXL A;  5AQM A;  5AFU H;  5KQ8 A;  2YHW A;  1BOT O;  2CGJ A;  3DXK B;  3HSC A;  5BRD A;  4YDU A;  2ZF5 O;  3VEN A;  1HUX A;  4O5F A;  3VEO A;  2W40 A;  5KPZ A;  4H0V B;  4BR0 A;  2QWP A;  4IO8 A; 
#chains in the Genus database with same CATH topology
 4BRP A;  4IJN A;  3IMX A;  5JMV A;  4JV5 K;  4N5S A;  1VK0 A;  3HP9 A;  4Q5V A;  4FLU A;  3NAE A;  3L2V A;  4CJV A;  4JAX A;  4B3R K;  3SI6 A;  1S22 A;  3O4Q A;  4KV8 A;  1JCG A;  1JJ2 M;  1JLE A;  3UKU A;  2ZE2 A;  1BQN A;  4DTS A;  3AVJ A;  4CIG A;  4WFN L;  1VHX A;  2D5R A;  4KFB A;  1X9J A;  3HYF A;  4E3S A;  2PYL A;  3MN5 A;  3KWG A;  4YOX A;  4M45 A;  4WF9 L;  2Q97 A;  3EYZ A;  1BGX T;  1VQ7 N;  2HND A;  4JN4 A;  5CE3 A;  3KK2 A;  4CJ5 A;  1C0M A;  4DFP A;  4IG3 A;  1UWB A;  4PKH A;  1YXQ A;  2ASP A;  4AHS A;  4W5T A;  3P5J A;  3O1W A;  3T1Y K;  1JCE A;  2PYJ A;  1CLQ A;  5ELZ A;  3WNH A;  4BRH A;  1NG9 A;  3CI5 A;  5KPR A;  3U8X A;  3I33 A;  1SS6 A;  3WNG A;  4BRI A;  4Q0B A;  4BC4 A;  1TV6 A;  1C6V A;  2YX6 A;  4DV7 K;  1NU0 A;  1QZ5 A;  3AA3 A;  3SMS A;  5M1Q A;  1TK0 A;  1ZXO A;  4WFB L;  2HHQ A;  2JLE A;  1QSS A;  1LWF A;  2YKN A;  3O9U A;  2NRV A;  5TKY A;  3K57 A;  1CXU A;  1KXP A;  4C8K A;  4A61 A;  4BAC A;  3ZSQ A;  3L4I A;  3QFU A;  3S9H A;  4KHQ A;  5F0X A;  2ZJR L;  4CJ7 A;  3J7Z O;  3S3O A;  4KTZ A;  4AM7 A;  1U2V B;  3OYN A;  4JKD A;  3WUH A;  4M3U A;  4FLY A;  2FC0 A;  4CK2 A;  3M5R A;  1NKE A;  2OPS A;  1NK7 A;  3CPE A;  3MAQ A;  4BQL A;  3C0B A;  4FJK A;  3OYC A;  3IDH A;  1NGB A;  2YHA A;  1W9H A;  1VSL A;  4O4G A;  4BRD A;  2VWK A;  1FKP A;  3OYM A;  5BPM A;  2X74 A;  1Q18 A;  4FWM A;  4B9U A;  1GLE G;  1NJY A;  4IXC A;  4PHT X;  4BRE A;  4Z4I A;  4WE1 A;  1ZBI A;  4DR5 K;  3CC2 N;  2ZWH A;  3TPQ A;  3DAW A;  5A2Q O;  4KH4 A;  1XHX A;  2P9I A;  4K8Z A;  4EZ9 A;  5I3U A;  1VQM N;  4X62 K;  1KSP A;  4FJI A;  4WCE L;  1K6Y A;  3QEX A;  3TSQ A;  3HRG A;  4CE9 A;  4J2D A;  2IAJ A;  1EWR A;  3ZT0 A;  3DMJ A;  3O5B A;  1WSI A;  2AA4 A;  4B8C A;  3EZW A;  1WBB A;  1RBT A;  3OYJ A;  4H5T A;  3U9D A;  3UIQ A;  2O8C A;  4H0Y B;  2Q1N A;  5AQZ A;  2KHO A;  4DV2 K;  4BRM A;  4CI6 A;  1NLV A;  4CJK A;  3PIP L;  1LAV A;  3ENH A;  4FLZ A;  1XQS C;  3D2E A;  4RG8 A;  4A2B A;  3WT0 A;  4BVO A;  4PUO A;  4KB0 A;  4CJQ A;  1Y97 A;  1SAZ A;  5FLX O;  5AQG A;  4EHU A;  4ILH A;  3L2R A;  4DCH A;  5AQX A;  1SL0 A;  2A5X A;  1XHZ A;  2QK9 A;  1RTH A;  1T6C A;  4QOZ B;  2VG7 A;  4KTQ A;  4BG8 A;  2NZT A;  5FPD A;  3CCU N;  1YTU A;  2O8E B;  2VWB A;  3DOL A;  2D0B A;  1HNX K;  4MO5 A;  4CBU A;  4CJW A;  1C1C A;  3NH0 A;  4BC5 A;  4CEB A;  4CK1 A;  2E1Y A;  2O8B A;  2JGU A;  2OZM A;  4J2E A;  4HCC A;  3ZX3 A;  1K8K A;  4GV9 A;  3MEG A;  3TU5 A;  4CBW A;  3RVC A;  3O08 A;  3QIN A;  1RTD A;  1CXQ A;  2HF3 A;  1VRT A;  5GAE P;  3HOS A;  4H03 B;  1GLB G;  4M7Y A;  2QTD A;  1D9D A;  4H5V A;  1JLQ A;  3VGL A;  3PIO L;  3SYZ A;  2BTF A;  5BR9 A;  2LSN A;  5D3G A;  4KI6 A;  1NJX A;  2UUC K;  4M3W A;  1UA1 A;  1L3U A;  1RDD A;  4CHO A;  4CF2 A;  4BRN A;  5IWA K;  1L3V A;  1DTT A;  4YDU C;  3F5T A;  3SUP A;  3CYG A;  3CCS N;  3QEW A;  4FJ9 A;  3VTH A;  3AVA A;  4F2R A;  3DXM B;  1BDG A;  4FM0 A;  1T05 A;  4OO1 J;  1DTQ A;  5FRN A;  4WQ5 C;  3T19 A;  2E5L K;  2B5J A;  2VGM A;  1HYS A;  4JRP A;  5E41 A;  4DV0 K;  3V6D A;  2VWJ A;  4LF4 K;  3BP8 A;  4KTW A;  2E4L A;  4M3T A;  1IBL K;  2HHH K;  4C23 A;  3R8E A;  4JKF A;  3I55 N;  3DM2 A;  4K41 A;  4KAZ A;  1F21 A;  4DTO A;  1OVY A;  3VQQ A;  3S5T A;  1WSE A;  3SAH A;  3OYL A;  1DEJ A;  4PL8 A;  3HI0 A;  1OKJ A;  1WSJ A;  3EO3 A;  2P9N B;  3TAN A;  4B9S A;  1SZ2 A;  3TAF A;  1TAQ A;  3L2Q A;  1NGH A;  4BRC A;  1TKZ A;  3V1Q A;  3NGI A;  1IV0 A;  4X66 K;  3TAM A;  3OW2 M;  1GLA G;  3PV8 A;  2A6A A;  2O8F A;  1R59 O;  4PL7 A;  5I9E B;  3VER A;  1SKW A;  1KVB A;  2IGI A;  3DRR A;  2UU9 K;  1QZ6 A;  2HNY A;  4QAG A;  4M7X A;  3WXL A;  4BRQ A;  1EQY A;  4B9V A;  3ZT3 A;  2Q31 A;  1BL3 A;  3WNE A;  2HMP A;  2GWJ A;  1ZBL A;  3TSU A;  1XNR K;  1JCF A;  4DV5 K;  5C25 A;  1VSD A;  4GV3 A;  2HHU A;  2X6N A;  3H3N O;  4I2P A;  3OYG A;  2P1J A;  2ZM6 K;  3TR8 A;  1TYQ B;  5DM7 L;  3QB0 A;  1HKB A;  1JLA A;  3RMD A;  2QEX N;  1TUY A;  2P51 A;  4CHZ A;  3AO1 A;  4DFJ A;  4ISG A;  3LZI A;  4CZM A;  3THY B;  3ZSV A;  1T44 A;  1O1W A;  1SQK A;  3PLA A;  3CME N;  4XH4 A;  3E9P A;  4C8O A;  4E72 A;  2O8D B;  4K42 A;  4NYN A;  2KFZ A;  4GVE A;  2Q0R A;  4E7K A;  1V4T A;  1DGK N;  3THW B;  1K9M O;  1HNW K;  3J80 O;  1RTI A;  1JLG A;  2BGG A;  1BHL A;  2CGK A;  3WNF A;  4IWV A;  5I42 A;  4C8M A;  4KHY A;  1JLB A;  3GOI A;  5ADX A;  4JD2 B;  4YOT A;  2YHY A;  1VSJ A;  1U4B A;  5GIP A;  4BRA A;  3SJH A;  4JI4 K;  3A5L C;  3B8A X;  1U2V A;  4MQ3 A;  1TL3 A;  3BF1 A;  4FPB A;  2F8T A;  1RFQ A;  1JL2 A;  5J2M A;  3AGR A;  3V9X A;  3TTF A;  4CD1 A;  1IKW A;  4N56 A;  2QKB A;  4E19 A;  1MWK A;  3RTV A;  4FJL A;  3CJ9 A;  4FM2 A;  4ICL A;  1KVA A;  4CF9 A;  1IBK K;  4BDP A;  2E2N A;  3ZCM A;  1WNS A;  4MDB A;  3SUN A;  5SWM A;  2KTQ A;  3ENB A;  4I2Q A;  1IJJ A;  4BQZ A;  3SLC A;  3WXI A;  5GAG P;  4FOE A;  3MMV A;  4E7H A;  2NRR A;  5ADX H;  4DTP A;  1WN7 A;  3MDQ A;  1YHQ N;  3RMA A;  3QIO A;  4BE7 B;  4B3S K;  2HHV A;  4KRF A;  1N33 K;  4LF9 K;  2E2O A;  4AHC A;  3NF9 A;  3E9L A;  2ZJQ L;  4AQY K;  3LL3 A;  2P9P B;  3KZB A;  4B08 A;  4BGB A;  1VAZ A;  1S6Q A;  5EU7 A;  1S9G A;  4JK7 A;  3TI0 A;  1B9F A;  3AAP A;  3U9Z A;  3RWU A;  3LAK A;  5C2D A;  4QS9 A;  4GY2 B;  1ZBS A;  4M42 A;  2KQ2 A;  3E66 A;  2BDP A;  4N41 A;  4CFD A;  4R79 A;  1X9M A;  4KO0 A;  2F8S A;  2QXL A;  5AFU H;  3VN5 A;  3BGR A;  3DLH A;  1BOT O;  2CGJ A;  3DXK B;  3HSC A;  5BRD A;  5JS1 A;  4YDU A;  1DT9 A;  3PSF A;  4YNQ A;  4MDA A;  3NE6 A;  1WUA A;  3QER A;  2IOC A;  5KRT A;  3G0Z A;  1GLF O;  1I39 A;  3H6E A;  2X78 A;  4FXD A;  3G10 A;  2J4R A;  4CES A;  4YY3 K;  1IG9 A;  2O8C B;  4WQ5 A;  2O8E A;  3QET A;  4XH1 A;  1NBW A;  3E01 A;  1HNZ K;  3GDQ A;  3CD6 N;  1J53 A;  1T6D A;  2GV9 A;  1G15 A;  3D2E B;  4DHY A;  1C0G A;  2Q36 A;  2F7T A;  3ISN C;  4CZJ A;  5LL6 Z;  1NK5 A;  3AO4 A;  4EIA A;  3VQE A;  3OHR A;  3SQ2 A;  1RNH A;  5M1O A;  3CQ8 A;  1FKO A;  4BE2 A;  2XY8 A;  2G8F A;  3K58 A;  3KK3 A;  1NK9 A;  1JLF A;  5AQP A;  4CZK A;  1S5J A;  4DWI A;  4CIE A;  3BZK A;  4DTU A;  5FPE A;  3TAB A;  5BRH A;  2DY4 A;  4CJR A;  3LDN A;  4H5W A;  1N32 K;  3A5M C;  1LWE A;  4KRE A;  3O4N A;  4JKC A;  4CZE A;  1Q7Y O;  5KGX A;  3T1H K;  4GKJ K;  4MLH A;  5GIN A;  3HVR A;  1S1U A;  4C1N K;  1NKB A;  3DXM A;  4HVJ A;  1ASV A;  3CFP A;  1J54 A;  1FK9 A;  1OH5 A;  3VF6 A;  2E20 A;  4WQ4 C;  4OPK A;  3QO9 A;  4OKE A;  3NHG A;  3K5M A;  5AZJ B;  5GIO A;  4DV1 K;  1RDU A;  2FBY A;  1UAX A;  2QWR A;  3CPW M;  2A3Z A;  3EKU A;  2G8K A;  3QEI A;  2Y1J A;  3M8P A;  1RT7 A;  4LFA K;  4BGA A;  3NH2 A;  4FLT A;  1VQN N;  4H5R A;  3LP1 A;  3BY5 A;  2V52 B;  3PX6 A;  3F73 A;  2FXU A;  3WQU A;  4LF7 K;  4GVM A;  2FBV A;  3NVM A;  5FDL A;  3K9K A;  5JS2 A;  1TK8 A;  2HHW A;  3CJ7 A;  3TAG A;  3LP2 A;  2OTJ N;  1NJZ A;  4DB3 A;  2VG5 A;  4CJE A;  1BA0 A;  4DKW A;  3SNN A;  5CZ1 A;  3KKS A;  5LY3 A;  4B9N A;  2JWL A;  4PKI A;  2V7Y A;  4H4M A;  3HM9 A;  3E1Y A;  5AQK A;  5LMU K;  3C94 A;  3L0Q A;  1MA9 B;  4CW7 B;  4YOR A;  4TSX A;  4LH5 A;  5EOY A;  2E8A A;  4CEQ A;  2KLA A;  4OPJ A;  3O6W A;  3ID8 A;  4K8X A;  3CQX A;  5CR4 A;  2E2P A;  3GBT A;  1X3M A;  3VQA A;  4DQI A;  4JI7 K;  3FZK A;  5M1P A;  4CCH A;  4DF8 A;  1X3N A;  3TAP A;  3CCJ N;  4O0J A;  4BRL A;  3LAM A;  4RW8 A;  3VEZ A;  1RBU A;  2HBJ A;  2UUB K;  3THV A;  4FLV A;  4CBX A;  4FWN A;  1TYQ A;  2O8F B;  3HZ6 A;  3OS0 A;  4O0I A;  3EL2 A;  1B9D A;  4JKA A;  4FJ7 A;  3THY A;  3PSI A;  2F9T A;  2EHG A;  5SZT A;  3L4Q A;  3QBW A;  3NF8 A;  1TL1 A;  3CM6 A;  4IZ9 A;  3C65 A;  3KWI A;  2O8D A;  4DQP A;  3IKM A;  3VQ7 A;  4IJA A;  3THW A;  4E89 A;  4NLC A;  4IDH A;  4FJJ A;  1W2B M;  1KD1 O;  3VTI A;  4DR2 K;  3CCV N;  4GV6 A;  4JD2 A;  3JYT A;  4JHD A;  3HPG A;  1J5O A;  4GMJ B;  5MLC Q;  3OYB A;  4JKG B;  4W5O A;  4DFK A;  2UYT A;  3SCX A;  1Q82 O;  4K0K K;  4OPH A;  4W5N A;  1BIS A;  3I0S A;  3WQT A;  3S3N A;  1VRU A;  2A40 A;  1QS4 A;  4I6M B;  4U67 L;  3MK6 A;  4H4O A;  4CEF A;  4FOI A;  3Q7B A;  2QWN A;  3ZSR A;  1E4G T;  3VEW A;  1MU2 A;  1TKX A;  4BWM A;  4V19 S;  3NGZ A;  1NGD A;  3J7Y P;  3WXK A;  5JVH L;  2VCP A;  1QQM A;  1W97 L;  3O9T A;  3K0S A;  1RDB A;  4BRF A;  2D4W A;  1LWC A;  4DTR A;  2KZM A;  3VQ9 A;  1QQC A;  1NK4 A;  3L3V A;  2EX3 A;  4IG0 A;  2UUA K;  3CIP A;  2P9P A;  4CHQ A;  2XY6 A;  3PX0 A;  3AVM A;  2QWM A;  2G8U A;  3GE1 A;  4AHR A;  1P8Z A;  3C7N A;  3EY1 A;  4CZG A;  2DTU A;  1K73 O;  1SUQ A;  4IO9 L;  5AQY A;  1X9S A;  2PZS A;  2FF6 A;  2GEL A;  3KTQ A;  4M41 A;  2ASO A;  4DR3 K;  3HPO A;  3D7E O;  3DXK A;  3SQ0 A;  2XY7 A;  1XC9 A;  3RR8 A;  3SPY A;  3SZ2 A;  4QS8 A;  4BG9 A;  3VQP A;  2I7P A;  4X65 K;  4ID5 A;  3M8R A;  4DQR A;  1I3A A;  3THX A;  4FK2 A;  3MWP A;  3LPU A;  4BDZ A;  1NGA A;  4WQ4 A;  3AVK A;  4FSV A;  4KB1 A;  3V81 A;  4CJS A;  2YJE A;  4DF4 A;  4FVU A;  2YJF A;  3JXU A;  4DLE A;  1QHT A;  2IS3 A;  1ZYQ A;  3OBW A;  1CZB A;  3WEE B;  4NB4 A;  3J81 O;  3KLH A;  3CET A;  1H1V A;  4NO7 A;  3I0R A;  5IT9 O;  5EVZ A;  3FGU A;  4B1X B;  4B1U B;  3OYD A;  3BEX A;  4ELU A;  1KAX A;  4IOX A;  2PAV A;  4HHT A;  1RDW X;  1HJR A;  2QWQ A;  2NLX A;  1EP4 A;  4EAH D;  3LP0 A;  2V7Z A;  4OGC A;  3ITH A;  5KRS A;  3HK2 A;  2QM1 A;  4CIF A;  3M3Z A;  3JAM O;  5DM6 L;  3RSE A;  3SPZ A;  3KD1 E;  3FZF A;  3OYK A;  1VSE A;  3OTO K;  2FBX A;  1REV A;  1XNQ K;  2GTD A;  3ZX2 A;  2HHX A;  2ITG A;  2DFH A;  4FJG A;  1C0T A;  4Z4H A;  4BEB A;  3SMP A;  2PFU A;  4CJP A;  1HQE A;  3HP6 A;  1NWK A;  1CZ9 A;  2RE2 A;  4H8K A;  1BCO A;  3FZM A;  4KI4 A;  2HF4 A;  5AZJ A;  2HBM A;  1WSG A;  1JL1 A;  3MN6 A;  3Q7C A;  4LF5 K;  5C10 A;  1WOQ A;  1D8Y A;  5HRS A;  3NMU A;  1EKE A;  1J5E K;  3JSM A;  3VA0 A;  2BAN A;  5LMN K;  3V4I A;  4NCG A;  5AQL A;  4FJN A;  4BRK A;  1RIL A;  5CHI A;  3CMA N;  1LOT B;  5C42 A;  4CZF A;  2QKK A;  4J2A A;  4JI1 K;  1RBS A;  3LM9 A;  3QDK A;  4FW1 A;  1VQK N;  2YNI A;  3IS9 A;  3CJ1 A;  3O9Q A;  1IKX A;  1XMO K;  4IFY A;  3LM2 A;  1FJG K;  4AHV A;  2QXF A;  3HXM A;  4C8N A;  1HQU A;  4Y1C A;  3AVB A;  1NM1 A;  5J2N A;  1GOB A;  4CZL A;  1RT3 A;  3DLR A;  2UXD K;  2F4V K;  4IOA L;  4FL9 A;  1R0A A;  5AQN A;  2UXB K;  4HTU A;  3F9K A;  4ISE A;  1OH8 A;  2W41 A;  2P9K B;  3LDO A;  3UE5 A;  3OYH A;  3CJA A;  2P5G A;  1SV5 A;  4K25 A;  3ZSO A;  1OVQ A;  5LJW A;  4DTJ A;  1HNV A;  3M6G A;  4IOC L;  3LDL A;  3ZT4 A;  3QES A;  3P31 A;  1BIU A;  4FW2 A;  4E7L A;  4FK4 A;  3MXI A;  4JI5 K;  2ZF5 O;  3VEO A;  2NRZ A;  4DU1 A;  2NNW A;  5HL7 L;  4DFM A;  3NDK A;  2W40 A;  3QIP A;  5KPZ A;  5H1S Q;  4BR0 A;  2QWP A;  3LWL A;  3EE9 A;  1C0F A;  2HBK A;  3TAR A;  1S72 N;  1NMD A;  3CXC M;  5HP1 A;  4CEC A;  2NUB A;  3O4W A;  4FCY A;  1YF5 L;  4DR7 K;  3LP3 A;  4N47 A;  2WBN A;  1BU6 O;  3OVN A;  1KTQ A;  4FYD A;  1HJO A;  1LCU A;  1O13 A;  3I8B A;  3ZSW A;  3CCE N;  2H3G X;  3L2U A;  5CYQ A;  1N5Y A;  1GLC G;  4JKG A;  3P38 A;  1ATS A;  1RT1 A;  2QW9 A;  3ZX0 A;  1WSF A;  1HRH A;  2Z1I A;  4BR9 A;  4EP4 A;  4DQQ A;  3T1A A;  1KC8 O;  4O5B A;  4I6M A;  1BQM A;  3VMF B;  1U45 A;  1GLD G;  5HRO A;  4XJX A;  3R6M A;  1V4S A;  3OJS A;  2AP1 A;  1VQ6 N;  4QS7 A;  3WXJ A;  5KGW A;  5J2P A;  4DSL A;  1JLC A;  3AAR A;  3AVH A;  4BC3 A;  4DMN A;  1LW0 A;  3AA2 A;  3AVC A;  3OYE A;  4JHD B;  2YKM A;  4DV3 K;  3ZYY X;  4A59 A;  1TKD A;  4GKK K;  2HHI A;  3LAL A;  4DS5 A;  1X9W A;  1T03 A;  2YHB A;  4FWP A;  3V9U A;  3IAY A;  4NYF A;  3H1V X;  3AVN A;  4M3R A;  4DU4 A;  1FW6 A;  3O80 A;  4LF8 K;  1QVF M;  4CEE A;  5AZI B;  1HYZ A;  3BZC A;  2YNH A;  4KHN A;  4AHT A;  3RMC A;  4E7I A;  4F9O A;  1DKG D;  3DLB A;  2B4J A;  3ULE B;  3H08 A;  3FE1 A;  1GLL O;  2WON A;  1QSY A;  2YV0 X;  4RW4 A;  4B1V A;  2ZJP L;  4CJU A;  1S1X A;  2ZQB A;  4PKG A;  4FK0 A;  2RN2 A;  4FJ8 A;  2HBL A;  3WXM B;  5JEN A;  1Z05 A;  1RT6 A;  3CCM N;  4DU3 A;  4CZI A;  4LY7 A;  5AQR A;  1SL2 A;  1IG8 A;  3OY9 A;  5AR0 A;  5JLF A;  3C7N B;  5M1K A;  4J2B A;  1I94 K;  1ASU A;  1JKH A;  1VQ9 N;  3MXM A;  3FZL A;  4W5R A;  5DK5 A;  3GG4 A;  3QML A;  1RT4 A;  4A2A A;  4JLH A;  3RMB A;  3WEE A;  3C6U A;  1A5V A;  2IVP A;  2C1G A;  4H5N A;  2BUP A;  3HBT A;  4DQS A;  3V1R A;  4FWS A;  1CZA N;  4NLB A;  3V9Z A;  4K43 A;  3VET A;  1NK0 A;  1OH7 A;  3QNN A;  4I7F A;  2FF3 B;  2A1S A;  4B3O A;  2O4I A;  2OPP A;  3U4L A;  3THX B;  1D4X A;  1S1W A;  4B1W B;  3DYA A;  2QWL A;  4JEP A;  2BH1 A;  4H0O A;  3KJV A;  4FWO A;  2FSN A;  2QA4 N;  4O44 A;  5KTQ A;  3HO1 A;  1HX1 A;  3SQ1 A;  5HOO A;  3AVF A;  2IVN A;  1BWF O;  4OGE A;  1ESV A;  4DTX A;  1TVR A;  1NK6 A;  1HMV A;  3DLK A;  1C0U A;  3LDS A;  2D0C A;  1XC3 A;  4DG1 A;  2XHB A;  5C12 A;  2IVO A;  4R5P A;  1S3X A;  3K9J A;  2NRX A;  3PX4 A;  2A1R A;  2G8W A;  4CGH A;  5AQF A;  2GX9 A;  3VQC A;  1YI2 N;  5EY4 A;  4RCH A;  3AY9 A;  3KLI A;  3CCR N;  4JI3 K;  1DLO A;  4ZTJ A;  1D9F A;  3L8B A;  3O9R A;  4CK3 A;  2HNZ A;  2YCH A;  4IFE A;  3RSE B;  2A41 A;  3OYA A;  5EX5 A;  1TAU A;  4FVM A;  3AO3 A;  2OPQ A;  2YI1 A;  4LFB K;  4M3X A;  4DV6 K;  4ELT A;  3NBP A;  3AA5 X;  4MLE A;  1L5U A;  1J9A A;  4A62 A;  3CC4 N;  3P1G A;  4YOV A;  2A42 A;  5BR8 K;  2RHK A;  1YIT N;  5AQQ A;  3B6P A;  4CJF A;  1RT5 A;  4B9Q A;  1UOC A;  4M63 C;  4YOY A;  4L3Q A;  1VSH A;  1C1A A;  4AHU A;  3L2W A;  3MCA B;  4CF0 A;  1NOY A;  4C8L A;  5HRN A;  2IC3 A;  4Z4G A;  5AQH A;  4GW6 A;  4HTL A;  1GLJ O;  3EN9 A;  4B3T K;  2OCE A;  1VSM A;  2C1I A;  5BN8 A;  3A0I X;  5K14 A;  4J8F A;  5B8H A;  3ZSX A;  1NGJ A;  3MED A;  1GOA A;  2P9S B;  1RDA A;  3DLG A;  4XEI A;  5FPN A;  1QQO A;  2FLO A;  1YJ9 N;  2P9K A;  2Z1G A;  4F3O A;  1YTA A;  5AQJ A;  1WBD A;  1KFS A;  1L3T A;  1LAW A;  1RBR A;  3L6Q A;  1TGO A;  4ISF A;  2D1K A;  3VF2 A;  2CH6 A;  1Q86 O;  2XRI A;  1Q81 O;  2G8I A;  1ZBF A;  3VQ5 A;  3VQB A;  4HUE A;  4DR6 K;  2GBZ A;  4H0P A;  1NGG A;  4JKB A;  5AJ3 K;  4LF6 K;  4JI8 K;  3RRH A;  4W5Q A;  3H45 C;  1NNE A;  1ATN A;  4LFC K;  3RR7 A;  2D0O A;  1Z6R A;  3V1O A;  4YOW A;  3AO2 A;  4JKH A;  3U3Y A;  3C6T A;  3MXJ A;  1EX4 A;  3MEC A;  1YUW A;  1N34 K;  4DSJ A;  4CHY A;  3NCI A;  1IO2 A;  5LJV A;  2WOM A;  4CGI A;  4LSL A;  3KK1 A;  4F3T A;  4DTN A;  2IDO A;  3AVL A;  5C24 A;  3P39 A;  2HST A;  1HNI A;  4CJT A;  1L3S A;  4OKK A;  2VQF K;  4E1N A;  3M8Q A;  1OH6 A;  4JK9 A;  1T3V A;  2XY5 A;  5KI6 A;  3HPH A;  4B3M K;  4FO0 A;  5F1X A;  4CF8 A;  1W7A A;  1NJI O;  2I5J A;  1ZBH A;  3ID6 A;  5FRO A;  5GAH P;  4Z94 A;  2G8V A;  1QSL A;  3IRX A;  5C0Y A;  3T3F A;  3PO5 A;  2EWS A;  1X1P A;  4FJM A;  1BI4 A;  3QEV A;  3ATV A;  1HR0 K;  3K5O A;  4QCL A;  3CG7 A;  4FWK A;  5AZI A;  5BRE A;  3SUQ A;  4IFV A;  1XMQ K;  3DJC A;  1EXQ A;  2DFE A;  4LSN A;  3VEV A;  4FZY A;  2GEM A;  3BUZ B;  4KH6 A;  1TK5 A;  1VSI A;  4ID1 A;  4KH5 A;  4FPA A;  2ASM A;  3O3H A;  3KHY A;  3K5L A;  3CC7 N;  1WSH A;  3U3G A;  2W42 A;  1ASW A;  3ULE A;  5EXW A;  1UA0 A;  4DR4 K;  4H0T B;  5HRP A;  1W0H A;  4B1Y B;  3M8S A;  4PA1 A;  1S1T A;  4DSF A;  4JNE A;  4MO4 A;  1BA1 A;  3D2F B;  5J1E A;  3CFR A;  3HTV A;  5AQV A;  1SKR A;  2FBT A;  1KCF A;  1EO1 A;  3NF6 A;  4A5A A;  5TKW A;  3C6H A;  4A57 A;  1WAJ A;  4NCB A;  4LC9 B;  3SBG A;  4CHP A;  2P9L B;  3QFP A;  3IFR A;  3D0P A;  4F8R A;  1IBM K;  2F96 A;  3MWT A;  3VEY A;  4H0X B;  4WFA L;  2X6S A;  4RWT A;  3DLE A;  1VSK A;  2CGL A;  2W6L A;  3V9W A;  3TAE A;  3ZEU B;  3LWM A;  1ZC6 A;  2ZD1 A;  4B8A B;  3V9S A;  1TUU A;  4UY8 O;  4E0D A;  3DOK A;  4EP5 A;  1G99 A;  3VQ6 A;  1HKC A;  2OPR A;  1YVN A;  1KRP A;  3DRP A;  3PUF A;  2QI2 A;  2E2Q A;  3A8Y A;  3AGK A;  3D6R A;  1HYV A;  4OX9 K;  1KLN A;  3P4I A;  3ASM A;  4BE0 A;  5KQ8 A;  2VGN A;  4KHS A;  3VEN A;  1A5X A;  4DLG A;  4H0V B;  4G1Q A;  4KPY A;  4IO8 A;  4Z0U A;  4C1N I;  3CFO A;  4CGG A;  2KKZ A;  3MEE A;  3SV3 A;  1XWL A;  4CD3 A;  4OVL A;  3FLC O;  5FRM A;  2KFN A;  2D0P A;  1NOZ A;  4DS4 A;  1Q9Y A;  3SUO A;  3ZET A;  1RGI A;  4Y1D A;  3EKS A;  4BR7 A;  1J6Z A;  5E26 A;  3LZJ A;  3ZT2 A;  2HMI A;  2RKI A;  4Z4F A;  3NFA A;  2GWK A;  1NJW A;  4O8K A;  3HOT A;  4AIL C;  4A5B A;  3K2P A;  3GL1 A;  1MWM A;  1VQ5 N;  1Z26 A;  5M1F A;  3AV9 A;  3EE8 A;  3M1F A;  4JKE A;  4PQU A;  3FZH A;  1ATR A;  1VSF A;  2ITM A;  3KKR A;  2O4G A;  3ENO A;  4FWQ A;  4DSE A;  4CHN A;  5C15 A;  1YT3 A;  5HLF A;  4AF1 A;  1XI1 A;  1E4F T;  2OTL N;  5AQO A;  3TWH A;  1U48 A;  4ILG B;  3KLE A;  3S41 A;  2F9W A;  4IDK A;  4DSK A;  4FLW A;  3CYM A;  1FXX A;  4FJH A;  4FWR A;  3UKR B;  5JVG L;  4KHW A;  2ETJ A;  1IH7 A;  2P9S A;  4CED A;  2HW3 A;  3W3D A;  3AAQ A;  3J7A P;  3CCL N;  1RCH A;  1U6Z A;  2ZGZ A;  1EWQ A;  2Q0U A;  1TKT A;  4N76 A;  2E1Z A;  3MN7 A;  4NXN K;  3TTD A;  2Z1H A;  4Y0W A;  4EHT A;  3TAQ A;  4JYA K;  4WYB A;  1BUP A;  3OA9 A;  3O3F A;  3VQ4 A;  4B1Z A;  3K5N A;  1ITG A;  5T7B A;  4EZ6 A;  3UB5 A;  5M1N A;  5BPN A;  3PO4 A;  1NKC A;  3QBX A;  1Z25 A;  4FZX C;  4IEI A;  3QNO A;  1SKS A;  3NVK A;  1NK8 A;  1YJW N;  3EZ5 A;  2HVH A;  3CJB A;  3QLH A;  4MFB A;  3LAN A;  3VGK A;  3CHW A;  3MN9 A;  3I8D A;  5BRF A;  1KAZ A;  3MCP A;  2VQE K;  4CEA A;  3VES A;  1N6Q A;  5FPM A;  1RT2 A;  4RTF D;  1QQN A;  3PY8 A;  4YOU A;  2P5O A;  4BY9 C;  3HM8 A;  1JXB A;  3CQY A;  4CEZ A;  3P83 D;  2WFB A;  3T69 A;  3HT3 A;  4Z4E A;  2V51 B;  4FWL A;  4BE1 A;  2P9U B;  1LV5 A;  1MDU B;  4YFU A;  3AO5 A;  2VYP A;  1NGC A;  3VOV A;  3DRS A;  4IEE A;  3R1X A;  1U49 A;  2RF2 A;  1NGF A;  2HOE A;  5JIC A;  3G4S N;  1Y64 A;  1E3M A;  2YHX A;  5JLH A;  3SK3 A;  4JI2 K;  5HBM A;  2R7Y A;  2KZZ A;  3J8A A;  4FZZ A;  3FFK B;  2XO7 A;  3ZT1 A;  2Z1J A;  3VF4 A;  4FM1 A;  2GUP A;  3UKU B;  4X64 K;  4CER A;  3ATU A;  4BRG A;  4DUY K;  3O3G A;  4O8U A;  5BN9 A;  2CH5 A;  4IKF A;  5CZ2 A;  4BR5 A;  3S3M A;  4JS5 A;  1M90 O;  1S6P A;  3TSP A;  4JK8 A;  3SJJ A;  4CEO A;  3SV4 A;  4KKO A;  4U7B A;  3G6E N;  2DFF A;  2NRW A;  1BI4 B;  1Q8I A;  2KW4 A;  3D2F A;  3MX5 A;  3O1B A;  2DPN A;  2ATQ A;  4F2S A;  1BIZ A;  5CYM A;  4Z4C A;  1HPZ A;  3JS6 A;  3ALY A;  3MX2 A;  4ILJ A;  4CJ4 A;  3H1Q A;  3QIC A;  4I9Q A;  4KBO A;  4DR1 K;  2E88 A;  3C6A A;  1YIJ N;  1S1V A;  1KFD A;  1LW2 A;  4IBN A;  2P9L A;  2W6K A;  1QTM A;  2VG6 A;  1BG3 A;  3CM5 A;  1IKY A;  2ZGY A;  3HVT A;  4JI6 K;  4E7J A;  3FFI A;  4M3Y A;  2G8H A;  1NGE A;  3BDP A;  4KHP K;  3DI6 A;  4BR4 A;  2B6A A;  2WUS A;  3RRG A;  5DMR A;  3ZEU A;  3U6F A;  1KAY A;  1EET A;  4CZH A;  4I9L A;  1VQL N;  1D5A A;  2JWK A;  1QVG M;  1NMN A;  5AFU A;  1U04 A;  5F2R A;  3SQ4 A;  3L3U A;  2BE2 A;  3OS1 A;  3OYF A;  1K8A O;  4BR2 A;  3SAF A;  1VQP N;  3HJF A;  5KPT A;  1YJN N;  1BO5 O;  2E6L A;  3NH1 A;  1VQO N;  1C1B A;  4CFB A;  2WTU A;  1BCM A;  3C95 A;  4B9T A;  4RW6 A;  1S9E A;  1XUP O;  4BC2 A;  3G25 A;  5GAD P;  3VGM A;  3A5O C;  4GNI A;  3VQ8 A;  4CGF A;  4RW9 A;  3NF7 A;  2UXC K;  2P9I B;  1U47 A;  2I7N A;  4RW7 A;  3SAG A;  1M1K O;  4KHU A;  3OYI A;  3AVI A;  3LDQ A;  1QE1 A;  3O8M A;  4DTM A;  2HB5 A;  1RDC A;  2GUI A;  3OJU A;  3N4Q A;  1HLU A;  2OA8 A;  4XIU A;  2PBD A;  2Q3S A;  1ZBU A;  3VA3 A;  4CFA A;  2Y1I A;  4EFH A;  1P90 A;  3ZSY A;  4DSI A;  2RPI A;  4O55 A;  3KIO A;  3IG1 A;  3K59 A;  2PY5 A;  3R3L A;  4AM6 A;  3B6O A;  3G71 N;  1HPM A;  4HUF A;  5C2F A;  1B92 A;  3KVG A;  1WB9 A;  1N36 K;  4DV4 K;  3O9S A;  3CCQ N;  3IUC A;  3DWL A;  5AQS A;  4OKJ A;  3H46 O;  3KK7 A;  5AQU A;  1HKG A;  3EEQ A;  4ZTF A;  2WC9 A;  1VQ4 N;  1RTJ A;  4UQG A;  3I56 N;  3ULD A;  3A2F A;  3AA4 A;  4BRO A;  3ZET B;  4DUZ K;  4BVP A;  2HVI A;  2FSJ A;  5J2Q A;  3W0L A;  4AH9 A;  3LDP A;  4NXM K;  4ZHR A;  1WLJ A;  3T7Z A;  2OZS A;  1VQ8 N;  4OLA A;  2NRH A;  4OPA A;  3UKR A;  1T7P A;  3F9M A;  3VPZ A;  4HCB A;  4PY5 A;  4CGD A;  4E1J A;  3BF3 A;  1T8E A;  3D45 A;  1QHA A;  3A5N C;  1NGI A;  5CY4 A;  2HHS A;  2QWO A;  4G9Z A;  2O8B B;  4CVN E;  1ILY A;  4CJ3 A;  3ZLJ A;  1K8K B;  3R9P A;  1YAG A;  5KQD A;  2OYQ A;  4OJR A;  2E6M A;  3NGY A;  2IIR A;  3CF5 L;  4PWD A;  4BEC A;  1RBV A;  3VEX A;  3CJC A;  5E84 A;  3TTC A;  4DQ8 A;  1A5W A;  3F2K A;  2YNG A;  4FJX A;  4CF1 A;  1N8R O;  4CFC A;  4JRQ A;  5AQW A;  3N4P A;  3AVG A;  4XH5 A;  1SL1 A;  3CER A;  3SBT A;  3FR0 A;  3OBY A;  4LD0 A;  1YVU A;  4M3Z A;  3KLG A;  5HRR A;  4L8R B;  4NCA A;  2Q2R A;  3DLL L;  2D0A A;  2HHT A;  2W00 A;  5AQI A;  3VQD A;  4LH4 A;  2FSK A;  1JXE A;  4F4K A;  1KVC A;  2P9N A;  3E9O A;  2AJQ A;  1Q9X A;  1WAF A;  4ELV A;  4BDY A;  3HL8 A;  3ZSZ A;  4E1M A;  3HST B;  4JI0 K;  4B9M A;  4B9L A;  2NRT A;  4CJL A;  4YHH K;  3KD5 E;  3LPT A;  4JS4 A;  3OS2 A;  4OLB A;  4FLX A;  5BPL A;  1KQS M;  2P9U A;  3H3O B;  5AQT A;  4CGJ A;  4FJ5 A;  4HWI A;  2OAN A;  5AQM A;  1IKV A;  3KLF A;  3QEP A;  2YHW A;  2YNF A;  1HUX A;  4O5F A;  4HUG A;  1KLM A;  1GOC A;  4BWJ A; 
#chains in the Genus database with same CATH homology
 1WUA A;  4BRP A;  1C0F A;  2HBK A;  4IJN A;  4C1N I;  1GLF O;  3IMX A;  5JMV A;  3H6E A;  1S72 N;  1NMD A;  3CXC M;  2J4R A;  2KKZ A;  3O4W A;  4WQ5 A;  4JAX A;  1YF5 L;  4XH1 A;  1NBW A;  2WBN A;  1BU6 O;  1S22 A;  1JCG A;  4CD3 A;  1JJ2 M;  3GDQ A;  3UKU A;  3CD6 N;  1HJO A;  1T6D A;  3FLC O;  1LCU A;  3D2E B;  4DHY A;  1C0G A;  1O13 A;  2Q36 A;  3I8B A;  4WFN L;  2F7T A;  3CCE N;  2H3G X;  1X9J A;  2D0P A;  1GLC G;  4CZJ A;  3MN5 A;  3KWG A;  4JKG A;  4YOX A;  3P38 A;  3ZET A;  4WF9 L;  4EIA A;  1ATS A;  1RGI A;  2Q97 A;  3EKS A;  4BR7 A;  1J6Z A;  5E26 A;  3OHR A;  2QW9 A;  1VQ7 N;  3ZX0 A;  4JN4 A;  5M1O A;  5CE3 A;  4BR9 A;  4PKH A;  2GWK A;  1YXQ A;  2ASP A;  4O8K A;  3HOT A;  4A5B A;  1KC8 O;  5AQP A;  3GL1 A;  4CZK A;  4I6M A;  3O1W A;  1MWM A;  1VQ5 N;  5M1F A;  1JCE A;  3VMF B;  1GLD G;  3M1F A;  3EE8 A;  3R6M A;  4JKE A;  4XJX A;  3FZH A;  1V4S A;  5ELZ A;  1ATR A;  2ITM A;  4BRH A;  2AP1 A;  1VQ6 N;  3CI5 A;  4QS7 A;  5KPR A;  5FPE A;  3U8X A;  3I33 A;  1SS6 A;  3WXJ A;  3ENO A;  4BRI A;  5BRH A;  4BC3 A;  3AAR A;  4FWQ A;  4BC4 A;  2YX6 A;  3LDN A;  4H5W A;  5C15 A;  4JHD B;  4AF1 A;  3ZYY X;  3A5M C;  1QZ5 A;  3SMS A;  4A59 A;  1E4F T;  5M1Q A;  1ZXO A;  2OTL N;  4JKC A;  4WFB L;  5AQO A;  4CZE A;  1Q7Y O;  4FWP A;  4ILG B;  4MLH A;  5GIN A;  3O9U A;  3S41 A;  2NRV A;  2F9W A;  5TKY A;  4C1N K;  3DXM A;  3H1V X;  3O80 A;  4FWR A;  3UKR B;  1QVF M;  3VF6 A;  5AZI B;  5JVG L;  1KXP A;  2E20 A;  4A61 A;  4WQ4 C;  3L4I A;  3QFU A;  2P9S A;  5AZJ B;  5GIO A;  1RDU A;  2QWR A;  3W3D A;  3AAQ A;  4F9O A;  1DKG D;  5F0X A;  3CPW M;  2ZJR L;  3CCL N;  4CJ7 A;  3J7Z O;  2A3Z A;  1U6Z A;  2ZGZ A;  1U2V B;  3EKU A;  4JKD A;  3ULE B;  3WUH A;  4AM7 A;  3FE1 A;  2Q0U A;  1GLL O;  2E1Z A;  4BGA A;  3MN7 A;  3TTD A;  4B1V A;  3M5R A;  2ZJP L;  1VQN N;  4H5R A;  3CPE A;  4BQL A;  3C0B A;  2V52 B;  3IDH A;  2FXU A;  4PKG A;  3WQU A;  4Y0W A;  1NGB A;  2HBL A;  4EHT A;  3WXM B;  1Z05 A;  3NVM A;  4BRD A;  3K9K A;  4WYB A;  1BUP A;  5BPM A;  3OA9 A;  4B1Z A;  3CJ7 A;  1Q18 A;  3CCM N;  4DB3 A;  2OTJ N;  4FWM A;  4CZI A;  5AQR A;  1GLE G;  1IG8 A;  4IXC A;  3UB5 A;  4PHT X;  4BRE A;  5M1N A;  1BA0 A;  4DKW A;  5BPN A;  5AR0 A;  3QBX A;  5JLF A;  3C7N B;  3CC2 N;  5M1K A;  2ZWH A;  4IEI A;  3TPQ A;  3DAW A;  4KH4 A;  5LY3 A;  2P9I A;  3NVK A;  1VQ9 N;  3FZL A;  1YJW N;  2JWL A;  3GG4 A;  4PKI A;  2V7Y A;  1VQM N;  3QML A;  4A2A A;  3E1Y A;  5AQK A;  4WCE L;  3CJB A;  3WEE A;  3TSQ A;  3L0Q A;  1MA9 B;  3HRG A;  4YOR A;  2IVP A;  5EOY A;  3VGK A;  3CHW A;  3MN9 A;  2C1G A;  2E8A A;  4H5N A;  2BUP A;  5BRF A;  2KLA A;  3HBT A;  3O6W A;  1KAZ A;  3MCP A;  3ID8 A;  3O5B A;  3VES A;  4FWS A;  1CZA N;  3CQX A;  2E2P A;  4NLB A;  4RTF D;  5CR4 A;  5FPM A;  1QQN A;  2AA4 A;  4K43 A;  3GBT A;  1X3M A;  4YOU A;  3FZK A;  3EZW A;  5M1P A;  3VET A;  4BY9 C;  2FF3 B;  4H5T A;  3HM8 A;  3U9D A;  3U4L A;  1D4X A;  2Q1N A;  3CQY A;  4H0Y B;  1X3N A;  5AQZ A;  2QWL A;  2KHO A;  4B1W B;  4JEP A;  3CCJ N;  2BH1 A;  4H0O A;  2WFB A;  4BRM A;  3T69 A;  4BRL A;  4CI6 A;  1NLV A;  4FWO A;  3PIP L;  3VEZ A;  2FSN A;  2V51 B;  3ENH A;  4FWL A;  2HBJ A;  2QA4 N;  1XQS C;  2P9U B;  3D2E A;  4CBX A;  1MDU B;  4FWN A;  4A2B A;  1HX1 A;  1TYQ A;  3WT0 A;  4BVO A;  2VYP A;  5HOO A;  1NGC A;  3VOV A;  1SAZ A;  2IVN A;  3HZ6 A;  1BWF O;  3R1X A;  1ESV A;  4IEE A;  5AQG A;  4EHU A;  3EL2 A;  4ILH A;  1NGF A;  4JKA A;  4DCH A;  5AQX A;  2HOE A;  2F9T A;  2A5X A;  5JIC A;  3G4S N;  1Y64 A;  3L4Q A;  2YHX A;  3QBW A;  5JLH A;  4IZ9 A;  1T6C A;  3C65 A;  3SK3 A;  3KWI A;  1XC3 A;  3IKM A;  4BG8 A;  3J8A A;  5C12 A;  2NZT A;  2IVO A;  5FPD A;  4IJA A;  3CCU N;  1S3X A;  3K9J A;  3FFK B;  2NRX A;  4NLC A;  2VWB A;  3VF4 A;  4IDH A;  5AQF A;  4MO5 A;  2GUP A;  2GX9 A;  4CBU A;  1W2B M;  3VTI A;  1KD1 O;  1YI2 N;  5EY4 A;  4RCH A;  3UKU B;  3AY9 A;  3CCR N;  3CCV N;  4GV6 A;  4JD2 A;  3ATU A;  4BRG A;  3O9R A;  2YCH A;  4IFE A;  4JHD A;  4O8U A;  5BN9 A;  2CH5 A;  3RSE B;  4BC5 A;  2A41 A;  5EX5 A;  5MLC Q;  4BR5 A;  4JKG B;  2E1Y A;  2YI1 A;  1M90 O;  3ZX3 A;  1K8K A;  4GV9 A;  2UYT A;  3TU5 A;  3TSP A;  4JK8 A;  1Q82 O;  4OPH A;  4CBW A;  3WQT A;  3RVC A;  3O08 A;  4U7B A;  3G6E N;  2A40 A;  2NRW A;  3D2F A;  2HF3 A;  4MLE A;  3MX5 A;  3O1B A;  5GAE P;  3HOS A;  2DPN A;  4I6M B;  4H03 B;  1GLB G;  4M7Y A;  4A62 A;  3MK6 A;  4U67 L;  3CC4 N;  2QTD A;  4YOV A;  2A42 A;  4H5V A;  4FOI A;  3Q7B A;  3VGL A;  3PIO L;  2BTF A;  2QWN A;  2RHK A;  1YIT N;  5BR9 A;  3JS6 A;  5AQQ A;  1E4G T;  3MX2 A;  4ILJ A;  3VEW A;  4B9Q A;  3H1Q A;  3QIC A;  4M63 C;  4KBO A;  4YOY A;  4L3Q A;  3C6A A;  2E88 A;  4BRN A;  1YIJ N;  3MCA B;  1NGD A;  3F5T A;  4YDU C;  2P9L A;  3WXK A;  5JVH L;  2VCP A;  1QQM A;  1W97 L;  3O9T A;  5AQH A;  3CCS N;  4HTL A;  1GLJ O;  3EN9 A;  4BRF A;  1BG3 A;  2D4W A;  3VTH A;  2ZGY A;  3DXM B;  1BDG A;  4OO1 J;  2C1I A;  1NGE A;  5BN8 A;  3A0I X;  3CIP A;  2P9P A;  4BR4 A;  4J8F A;  5B8H A;  2WUS A;  4WQ5 C;  3ZEU A;  1NGJ A;  2P9S B;  2QWM A;  3GE1 A;  1KAY A;  1P8Z A;  4XEI A;  2VGM A;  3C7N A;  1QQO A;  5FPN A;  4CZH A;  2FLO A;  1VQL N;  1YJ9 N;  4CZG A;  2P9K A;  2JWK A;  1QVG M;  1K73 O;  5AFU A;  3BP8 A;  5AQJ A;  5F2R A;  4IO9 L;  5AQY A;  4C23 A;  3R8E A;  4JKF A;  3L6Q A;  2FF6 A;  4ISF A;  2GEL A;  4K41 A;  3I55 N;  2D1K A;  1K8A O;  1OVY A;  3VF2 A;  2CH6 A;  4BR2 A;  3SAF A;  2ASO A;  3SAH A;  1VQP N;  1Q86 O;  1Q81 O;  3D7E O;  3DXK A;  1DEJ A;  5KPT A;  1YJN N;  1BO5 O;  1VQO N;  4QS8 A;  4PL8 A;  4BG9 A;  3HI0 A;  4H0P A;  1OKJ A;  1NGG A;  2I7P A;  4JKB A;  3EO3 A;  2P9N B;  1SZ2 A;  1XUP O;  3H45 C;  4BC2 A;  1NGH A;  4BRC A;  3G25 A;  3MWP A;  5GAD P;  1ATN A;  3VGM A;  3A5O C;  4GNI A;  1NGA A;  2D0O A;  4WQ4 A;  1Z6R A;  2P9I B;  4FSV A;  2I7N A;  4JKH A;  4YOW A;  3OW2 M;  1GLA G;  3SAG A;  1M1K O;  2YJE A;  4FVU A;  2YJF A;  3LDQ A;  2A6A A;  3JXU A;  3O8M A;  1YUW A;  1R59 O;  3OBW A;  3WEE B;  4PL7 A;  4NB4 A;  5I9E B;  3CET A;  3N4Q A;  1HLU A;  1H1V A;  3VER A;  2PBD A;  5LJV A;  4NO7 A;  5EVZ A;  3FGU A;  4B1X B;  1P90 A;  4EFH A;  4B1U B;  1QZ6 A;  3P39 A;  4M7X A;  2HST A;  3WXL A;  4BRQ A;  1EQY A;  3R3L A;  4AM6 A;  3G71 N;  1HPM A;  2Q31 A;  5C2F A;  3BEX A;  3KVG A;  1KAX A;  4IOX A;  2HMP A;  2GWJ A;  2PAV A;  3TSU A;  1RDW X;  1JCF A;  2QWQ A;  4JK9 A;  2NLX A;  4GV3 A;  1T3V A;  3O9S A;  3IUC A;  4EAH D;  3CCQ N;  3DWL A;  5AQS A;  2V7Z A;  3H46 O;  3KK7 A;  5AQU A;  3H3N O;  4FO0 A;  2QM1 A;  5F1X A;  3M3Z A;  1HKG A;  5DM6 L;  3RSE A;  2WC9 A;  3FZF A;  1TYQ B;  1NJI O;  1VQ4 N;  3ID6 A;  3QB0 A;  1HKB A;  5DM7 L;  5GAH P;  3I56 N;  2QEX N;  1TUY A;  4Z94 A;  2GTD A;  4ISG A;  4BRO A;  4CZM A;  1T44 A;  3ZET B;  5C0Y A;  3ZX2 A;  4BVP A;  2FSJ A;  1SQK A;  3W0L A;  2EWS A;  3PLA A;  3LDP A;  3CME N;  4XH4 A;  4BEB A;  3ATV A;  3SMP A;  3E9P A;  3T7Z A;  2PFU A;  4K42 A;  1VQ8 N;  2NRH A;  4GVE A;  4OPA A;  3UKR A;  2Q0R A;  4FWK A;  3F9M A;  1V4T A;  5AZI A;  5BRE A;  1NWK A;  1DGK N;  1K9M O;  3VPZ A;  3DJC A;  3VEV A;  2GEM A;  2RE2 A;  3BUZ B;  4KH6 A;  2CGK A;  3FZM A;  2HF4 A;  4IWV A;  5AZJ A;  2HBM A;  4KH5 A;  4E1J A;  3BF3 A;  3GOI A;  3MN6 A;  4FPA A;  5ADX A;  2ASM A;  3Q7C A;  3KHY A;  4JD2 B;  4YOT A;  3CC7 N;  2YHY A;  3A5N C;  1QHA A;  5C10 A;  1NGI A;  1WOQ A;  4BRA A;  5GIP A;  3NMU A;  3SJH A;  3A5L C;  3B8A X;  1U2V A;  2QWO A;  3ULE A;  3BF1 A;  5EXW A;  4FPB A;  4G9Z A;  1RFQ A;  1ILY A;  4H0T B;  4B1Y B;  1K8K B;  3AGR A;  3R9P A;  1YAG A;  5AQL A;  3TTF A;  5KQD A;  4BRK A;  4CD1 A;  4JNE A;  2IIR A;  3CF5 L;  4BEC A;  4MO4 A;  3VEX A;  1MWK A;  1BA1 A;  3CJ9 A;  5CHI A;  3CMA N;  3D2F B;  1LOT B;  3CJC A;  5E84 A;  3TTC A;  4CZF A;  4DQ8 A;  3HTV A;  2E2N A;  5AQV A;  3LM9 A;  3QDK A;  3F2K A;  1EO1 A;  1VQK N;  1N8R O;  4MDB A;  4A5A A;  3CJ1 A;  5AQW A;  3ENB A;  3O9Q A;  5TKW A;  3C6H A;  3N4P A;  4A57 A;  1IJJ A;  4BQZ A;  3SLC A;  3WXI A;  4XH5 A;  4FOE A;  3LM2 A;  3CER A;  5GAG P;  3MMV A;  3SBT A;  3FR0 A;  3OBY A;  4LC9 B;  2NRR A;  5ADX H;  3SBG A;  2P9L B;  3QFP A;  3MDQ A;  1YHQ N;  3IFR A;  2Q2R A;  3DLL L;  2W00 A;  4BE7 B;  5AQI A;  3MWT A;  3VEY A;  2E2O A;  1NM1 A;  4H0X B;  4WFA L;  2FSK A;  3E9L A;  2ZJQ L;  3LL3 A;  2P9P B;  3KZB A;  4CZL A;  2P9N A;  3E9O A;  4RWT A;  2CGL A;  4BGB A;  1VAZ A;  3ZEU B;  4IOA L;  4JK7 A;  1ZC6 A;  4FL9 A;  2NRT A;  3AAP A;  5AQN A;  3U9Z A;  1TUU A;  4ISE A;  5C2D A;  4UY8 O;  4QS9 A;  2W41 A;  2P9K B;  3LDO A;  1G99 A;  4GY2 B;  3UE5 A;  1HKC A;  1ZBS A;  1YVN A;  3CJA A;  3E66 A;  2QI2 A;  2E2Q A;  3A8Y A;  3AGK A;  5BPL A;  3D6R A;  4K25 A;  1KQS M;  2P9U A;  3H3O B;  5LJW A;  5AQT A;  4R79 A;  3M6G A;  4HWI A;  3LDL A;  3P4I A;  2OAN A;  4IOC L;  2QXL A;  3P31 A;  5AQM A;  5AFU H;  5KQ8 A;  2VGN A;  2YHW A;  1BOT O;  2CGJ A;  3DXK B;  3HSC A;  5BRD A;  4YDU A;  2ZF5 O;  3VEN A;  1HUX A;  4O5F A;  2NRZ A;  3VEO A;  1DT9 A;  2NNW A;  5HL7 L;  2W40 A;  5KPZ A;  4H0V B;  5H1S Q;  4BR0 A;  2QWP A;  4MDA A;  3EE9 A;  4IO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...