2P9IB

Crystal structure of bovine arp2/3 complex co-crystallized with adp and crosslinked with gluteraldehyde
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
354
structure length
272
Chain Sequence
b'VVCDNGTGFVKCGYAGSNFPEHIFPALDDMKHLWDYTFGPLLTEPPMVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 76
structure length 272
sequence length 354
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9iB02
3.30.420.520 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9iB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9iB03
1E4FT 1GLBG 3CERA 2F9TA 3O80A 1NGAA 4JHDA 3BF3A 1X3MA 1GLLO 3GDQA 3BEXA 3D7EO 2E2NA 2ZGZA 2QM1A 4CBUA 3GL1A 5AQGA 1ZBSA 1GLAG 4XH1A 5EOYA 1BA1A 3B8AX 2NRHA 3HZ6A 4A2AA 1XQSC 2E2PA 5AQTA 3HBTA 3J8AA 3UKUB 1NWKA 4MO5A 1Z05A 2FF6A 2QWPA 1HUXA 4WQ4C 5BN8A 3S41A 4FWQA 1GLEG 4FWSA 4O5FA 2Q0RA 3MDQA 2P9KB 2CH6A 1BWFO 1NGFA 4M63C 3VESA 1NGDA 2QWNA 4BRMA 4H03B 2QXLA 3CJAA 4BRIA 3C7NA 2A41A 3LL3A 2FSJA 1CZAN 5AQQA 1V4TA 1XUPO 2P9LA 3VENA 3WQUA 3O1WA 1ATRA 2YJEA 2ASPA 2KHOA 5AQLA 1GLJO 1T6DA 5BR9A 2IVOA 2YI1A 1U2VB 5BRHA 5KQ8A 3WEEB 3VF4A 3SMPA 4DHYA 3FZLA 4FWOA 3SMSA 1BOTO 2E88A 4K43A 2QWLA 2ZWHA 3CQXA 3VEVA 4WQ5A 3UE5A 4IJAA 3VGLA 2CH5A 3UKRA 2E20A 4BRDA 3CJ9A 2J4RA 1T44A 4BR2A 4PL8A 4FPAA 3MN5A 3FLCO 5AQMA 4BRFA 5AQPA 3L0QA 3ULEA 5AQUA 5BN9A 4BROA 3VERA 1X9JA 4RTFD 4BR4A 3CJ1A 4H0OA 4B1XB 4DB3A 3I33A 3AARA 4FOEA 4YDUA 3G25A 3HI0A 5AQIA 3R8EA 5BPLA 4FL9A 2Q31A 1BA0A 3ZEUA 5LY3A 3A8YA 4L3QA 2E1ZA 3FZKA 2GELA 1BG3A 1BDGA 2GTDA 3HSCA 4A2BA 4H0TB 3MCPA 1DEJA 1G99A 3BP8A 2A3ZA 2DPNA 4FSVA 3IFRA 3MMVA 5KPRA 4QS7A 5ELZA 2QW9A 3VEZA 4C23A 4LC9B 2GWJA 2YHWA 4XEIA 2P9SA 3DXKB 2PBDA 3VEWA 2D1KA 5JMVA 3FZFA 1S22A 4CZKA 3GOIA 3ZX2A 3FR0A 3A5LC 1NM1A 5AZIB 1X3NA 3D2FA 4K41A 4QS9A 3ZETB 4BRLA 3RSEB 2P9NB 2ITMA 2CGLA 1C0GA 4DCHA 1GLCG 5AZJA 4CD1A 1U6ZA 5AQSA 1WOQA 4A61A 3HM8A 2ZF5O 5LJVA 3HTVA 2P9PA 1V4SA 3DXMA 4BGAA 1NGIA 1EQYA 4HWIA 5AQJA 4E1JA 3M3ZA 2GEMA 4BC4A 4ISFA 2D0OA 5BRDA 2VCPA 4BRPA 3A5OC 3H3NO 1NGBA 4H5WA 5BPNA 1D4XA 3BF1A 3WQTA 1T6CA 3D2EA 4F9OA 3WXKA 2VYPA 2FLOA 4JHDB 3UKUA 1ATSA 1C0FA 2I7PA 4I6MA 5AQKA 3AY9A 3U9DA 1MWMA 4JNEA 3DWLA 1KXPA 5I9EB 3LDQA 5AQVA 3W0LA 2A42A 3C0BA 3KHYA 2IVNA 2V7ZA 3VEXA 5BREA 3QDKA 4QS8A 1P8ZA 1K8KA 3AAQA 3EN9A 1E4GT 4BR7A 4CZGA 1TUYA 2V7YA 3R9PA 4AM7A 3O6WA 4BC2A 2V52B 2W41A 4H0VB 3SK3A 2HF3A 1YXQA 1ATNA 2BUPA 4H5RA 2ASOA 4IXCA 2NZTA 3QB0A 3I8BA 4BC3A 1NGEA 1HLUA 3FFKB 4FWKA 5EX5A 5F0XA 4PL7A 3VPZA 2QWQA 1QHAA 3WXLA 5AQWA 3TPQA 4B1WB 4B1ZA 3AAPA 3FZMA 4Y0WA 3QFUA 2P9IA 1JCEA 3C7NB 1ZC6A 2A5XA 3H3OB 1JCGA 1KAXA 3GG4A 3EO3A 3QICA 2P9UA 1QQOA 4XH5A 2P9LB 1QZ6A 3FE1A 4IZ9A 4CBWA 5BPMA 2W40A 2AA4A 3M6GA 4CZFA 1GLFO 3CI5A 4WQ5C 4IJNA 3MN9A 4FWPA 1NLVA 1HKGA 1XC3A 3IDHA 3ZX3A 2E2OA 1R59O 4GNIA 3DJCA 1NGCA 5EY4A 3BUZB 2QWOA 5EXWA 3UB5A 1LOTB 1SZ2A 3VF2A 3QBWA 4FWLA 5AQNA 5FPDA 3GE1A 1RFQA 4H0YB 1J6ZA 4RWTA 4YDUC 2AP1A 2Q1NA 2QWRA 4WYBA 3ULEB 2FF3B 4AM6A 1H1VA 2YHXA 4EHTA 5AQYA 3H46O 4GY2B 4JD2A 5AQZA 1MWKA 4FO0A 4JAXA 4EHUA 1GLDG 3CJBA 4B9QA 1Y64A 3ZEUB 1MA9B 3CQYA 2YJFA 3U9ZA 3L4IA 5KQDA 3R6MA 1MDUB 3A5NC 2CGJA 1OKJA 3FZHA 1TYQB 5AZIA 4BRKA 1Z6RA 3VGMA 3CJ7A 4EFHA 1YVNA 3ENOA 4BVOA 3LM9A 4CZHA 2D0PA 2GWKA 3LM2A 4KBOA 5AFUA 1QQNA 1IJJA 5JLFA 4CZJA 2P9SB 5ADXA 5AQRA 1BO5O 1QZ5A 3EZWA 2E2QA 3H45C 5EVZA 3O1BA 3SLCA 1HKCA 3D2FB 4K42A 1HPMA 3CIPA 4IWVA 2H3GX 3W3DA 3LDOA 2IIRA 2CGKA 5AZJB 4H5NA 4JN4A 2EWSA 3M1FA 3MN7A 3ATUA 3CJCA 3ID8A 4FPBA 3WXJA 3ZX0A 2FXUA 4O8KA 4NB4A 3VGKA 2E1YA 4B1VA 2P9PB 3TU5A 2A40A 1RGIA 2FSKA 3A5MC 3DXMB 4CZIA 4MLEA 4A62A 3EL2A 5AFUH 2QWMA 3F9MA 5ADXH 3QMLA 4CZMA 3VETA 5LJWA 3VEOA 3U8XA 2P9KA 4PKIA 3VEYA 4NO7A 3VF6A 2HOEA 2Q36A 4CZLA 4WQ4A 4FOIA 4K25A 1IG8A 3D2EB 2IVPA 1QQMA 4FWMA 1TUUA 5FPMA 3WUHA 4BQLA 5F1XA 3DAWA 1NGGA 2WUSA 2Q2RA 4I6MB 4PKHA 4PKGA 2V51B 5E84A 2FSNA 3O4WA 1KAZA 3ATVA 5AQHA 5AQXA 1SQKA 1U2VA 3QBXA 4BRCA 5KPZA 4B1YB 3WEEA 4CJ7A 1K8KB 2I7NA 3O8MA 1HX1A 1LCUA 1HJOA 1YAGA 4BVPA 5JICA 4EIAA 4BG9A 4M7XA 2YCHA 3JS6A 1YUWA 3CHWA 4EAHD 4BGBA 4BRHA 1WUAA 4J8FA 4BQZA 2HF4A 3H1VX 5AQFA 5F2RA 3MN6A 2Q97A 1SAZA 3OHRA 4Z94A 5AR0A 4BR5A 1DGKN 3IMXA 4B1UB 2ZGYA 3LDLA 3QFPA 4BR9A 1NMDA 5TKYA 5CE3A 4CD3A 2D4WA 3IUCA 2P9IB 3LDPA 2VWBA 4CBXA 3CETA 3ENHA 3H6EA 3JXUA 4BRAA 4BRQA 2P9UB 2F9WA 3O5BA 4IO8A 3UKRB 3O08A 2OANA 3VOVA 1NBWA 3FGUA 4BG8A 4FWRA 3U4LA 1S3XA 4H0PA 1NGJA 3SJHA 2Q0UA 4MO4A 4XH4A 4BREA 4RCHA 4MLHA 1HKBA 1DKGD 2YHYA 4BC5A 3EKUA 5FPNA 3WXIA 2ASMA 3MK6A 3L6QA 3P4IA 4ISGA 5FPEA 4H5VA 5AQOA 1ESVA 2A6AA 3DXKA 1NGHA 4BRGA 5E26A 4H5TA 4ISEA 1ZXOA 1TYQA 1Q18A 2NLXA 1RDWX 3ZETA 3H1QA 3RSEA 2P9NA 3EKSA 1BU6O 4JD2B 5KPTA 3LDNA 4H0XB 4FWNA 4CZEA 2E8AA 2HMPA 3WT0A 1JCFA 1BUPA 5BRFA 4HTLA 2BTFA 1KAYA 3KVGA 3KZBA 4CI6A 2PAVA 5JLHA 4BR0A 4BRNA 4M7YA 4DQ8A 3A0IX 2GUPA 2UYTA 3GBTA 5B8HA
chains in the Genus database with same CATH superfamily
1E4FT 4X66K 3O80A 3VQ8A 4JHDA 3BF3A 4DFKA 1JLAA 3AVBA 1X3MA 1GLLO 1I39A 4CGFA 3NFAA 4JYAK 1VSMA 1S6PA 4Z4FA 1KRPA 4DSEA 1BA1A 3S5TA 2NRHA 1J54A 1C6VA 3DRRA 4ILJA 3NVMA 2O4IA 2D0AA 3L2WA 4YOWA 3DLRA 3M8SA 3THYA 3UKUB 4X62K 5IT9O 1EETA 4B3RK 5LMNK 3HYFA 3TAQA 1L3SA 1J5EK 2X78A 2P9KB 1C1AA 3OYAA 2QWNA 4DV2K 4H03B 4BRIA 2HHTA 4KO0A 2A41A 3LL3A 4AHVA 1ASWA 1U04A 3KK7A 4JV5K 4HCCA 1M1KO 3ZSQA 2P9LA 4RW9A 1HQUA 4Q0BA 4PQUA 1NK9A 3ALYA 1WNSA 3V4IA 3CYMA 3HP6A 4DHYA 3SMSA 3ZLJA 1BOTO 2E88A 3OBWA 3NCIA 2UUBK 5JS2A 3VEVA 4WQ5A 2HHWA 1OH6A 2G8UA 2GUIA 2DFHA 1XI1A 5JVHL 4RW8A 3CFPA 2Y1IA 1ZYQA 1P90A 2FBYA 5AQMA 5HP1A 1S1TA 3MWTA 3L0QA 3ULEA 1RCHA 4DMNA 4DV4K 3OYMA 3HPHA 4CHQA 1CXQA 4Y1CA 4FOEA 3NAEA 3MXMA 1BA0A 4L3QA 1Q9XA 2DY4A 4AHRA 3B6OA 3PV8A 4DSLA 1BDGA 4Z0UA 1YI2N 3ULDA 3P1GA 4H0TB 1DEJA 4M41A 1XNQK 4CJRA 2UXCK 3KKRA 2DPNA 3IFRA 3CCEN 4WFBL 4DUZK 4JKGB 3VQAA 1Q81O 1S6QA 4QS7A 5ELZA 1UA1A 2QW9A 4C23A 4LC9B 3CCJN 4CHZA 4L8RB 4DWIA 2P9SA 2HHSA 3PO4A 3VEWA 3KLHA 3M8QA 3VQ4A 3FR0A 3OS0A 3VQ9A 5M1QA 2FC0A 4FVMA 5AZIB 4K41A 4BRLA 2ITMA 2O8CB 1XMOK 5AZJA 2RN2A 5FRNA 1U6ZA 5AQSA 4E7KA 1WOQA 1BQMA 5CZ1A 3HM8A 4CCHA 1NNEA 1IBKK 3AVMA 5HROA 4BGAA 2G8WA 2E6LA 1EQYA 2XO7A 1HNWK 1KVBA 3M3ZA 2GEMA 4BC4A 4U67L 5M1KA 1YJNN 1BHLA 3C65A 4FZYA 3VMFB 1BGXT 4FLXA 2XY6A 1VSLA 2Y1JA 4JHDB 2PY5A 1YTAA 4JKBA 5AQKA 3AY9A 1MWMA 4FJ7A 3ENBA 3K5OA 4OPHA 4ILHA 3SJJA 3W0LA 2A42A 5BREA 2V7ZA 3QDKA 3AAQA 3ZSYA 4CZGA 4B8AB 1RT4A 1NJIO 2V52B 3CCLN 5MLCQ 3THYB 3RRHA 5CR4A 1WLJA 1YXQA 1SL0A 4H5RA 3RMCA 4CJUA 2ZJQL 4CF1A 1U4BA 1HLUA 1W97L 5F0XA 2G8VA 3S3MA 1IV0A 1EO1A 4F2RA 3OYHA 5AQWA 4B1WB 4CJ5A 3LAMA 1I94K 3FZMA 4Y0WA 3DRSA 3EY1A 1JCEA 2C1IA 1ZC6A 4H4OA 4JI1K 4XH5A 2WONA 3AGKA 3MEEA 2P9LB 4DTOA 3FE1A 1N6QA 5BPMA 4CZFA 5SZTA 1GLFO 4J2EA 4WQ5C 1QVFM 4DU1A 4Z4GA 3LWMA 1HKGA 1XC3A 1VAZA 3DOKA 3QINA 3DJCA 3WNGA 1HNXK 1IO2A 3VQ6A 1Q86O 4GV3A 4RW7A 4FWLA 1RFQA 4IBNA 1J6ZA 2YX6A 3LP3A 2HHHK 5T7BA 4WYBA 3ULEB 3QETA 4A5AA 5HRPA 2ZJPL 1TGOA 1RBUA 2KQ2A 5AQYA 4DQPA 1JLBA 3ITHA 4YHHK 4FO0A 1O1WA 4B9QA 3CQYA 4B3TK 4DR7K 3AA4A 5HL7L 3D0PA 2YKNA 3FZHA 1TYQB 3NF6A 2F96A 3VGMA 3CJ7A 4JI7K 3AGRA 3ENOA 3MCAB 3SUOA 1VQ6N 3PSFA 4NLCA 4FXDA 3O9UA 4C8MA 5AFUA 5JLFA 2P9SB 1DTQA 5AQRA 3OYGA 4RW4A 1EKEA 4B8CA 1YITN 1Y97A 5EVZA 3THVA 3B6PA 3ZSVA 1HKCA 3VN5A 1W9HA 4ID5A 4BDPA 5C2DA 4JI0K 3AVIA 3LDOA 4EP5A 2O8DA 5AZJB 4CE9A 5C10A 2VWKA 3E9OA 2EWSA 2KFZA 2FXUA 4NB4A 3VGKA 4FJGA 4FZZA 3ISNC 3A5MC 3L2VA 5TKWA 1WSIA 2HB5A 2R7YA 4ICLA 3EL2A 3IKMA 5ADXH 3L3UA 4F3TA 3VEYA 3V1RA 2D0CA 3OS1A 2HOEA 4FM2A 2Q36A 4B9VA 1N34K 3AVJA 4FOIA 2DFEA 2NRVA 3F2KA 2IVPA 1QQMA 4JRPA 4FWMA 3WUHA 4EP4A 3DAWA 1D5AA 4YFUA 3CFRA 3ATVA 3ZYYX 4QCLA 5AQXA 3U3GA 3QEVA 4BEBA 4B1YB 3WEEA 4A5BA 1TK8A 1HX1A 2KFNA 4E7JA 1SKSA 3M8PA 3S3NA 4OKEA 4OLAA 1YUWA 1WUAA 4J8FA 4FVUA 4BQZA 3TWHA 3VA0A 2HF4A 1RILA 3H1VX 3MN6A 2ZE2A 3C95A 4Z94A 1BI4B 4E72A 1S1XA 1L3UA 3IMXA 2G8FA 3O3FA 4CECA 4XJXA 1A5WA 4O4GA 1U47A 1N32K 3IUCA 1IKVA 4JKCA 3OJSA 4DV7K 3SBGA 3ENHA 3T1YK 2F9WA 3CF5L 3DLBA 2HW3A 4OX9K 3AVKA 3QIOA 1NBWA 4C1NI 1QE1A 3LPUA 4MO4A 3WXIA 2ASMA 3L6QA 5FPEA 2PYJA 1B9DA 1ESVA 3DXKA 4CEDA 4NLBA 1KC8O 2BE2A 4DTRA 2NLXA 3D45A 3JSMA 2P9NA 5M1OA 1BU6O 3TAGA 4I9LA 1YT3A 2QXFA 2QKBA 1QSYA 3OYDA 4FWNA 2E8AA 1L3TA 3SPZA 4HTLA 4X65K 1FKOA 3CCVN 3SI6A 4IG0A 3SBTA 5JLHA 1TV6A 2YNIA 3G71N 3OVNA 4JKAA 4BRNA 4M3XA 4M7YA 1WN7A 2HVIA 1SUQA 4DFPA 5H1SQ 3GBTA 4E7IA 1GLBG 2YV0X 2HBLA 1NGAA 2HNZA 4LY7A 3H08A 2HNYA 2OPQA 4CJSA 4CGJA 4W5RA 2HBMA 2ZGZA 2IDOA 3GL1A 5J2NA 5AQGA 3LP1A 1ZBSA 4B9TA 3IAYA 4KHSA 5EOYA 3J7AP 3SV3A 3B8AX 3ZT2A 4JK8A 3K5LA 4FZXC 4GV6A 4OLBA 2O8DB 3HZ6A 4PY5A 5AQTA 3HBTA 3SQ0A 3K58A 5SWMA 5KGWA 3K9JA 2FF6A 3P31A 3K59A 5BN8A 1NKEA 4B3MK 4KHUA 4LSNA 4FWQA 5C15A 3K5NA 3DLLL 3MDQA 3KKSA 3SAHA 3P83D 3G6EN 4U7BA 5CY4A 1S1VA 2QXLA 3CJAA 4YNQA 4CW7B 1WSGA 1LWEA 1TVRA 5DMRA 3ZSZA 1NK0A 4KAZA 3VENA 1CLQA 1JLCA 3O1WA 3CQ8A 1OVYA 1YTUA 3SQ1A 2KZZA 3AVFA 1T6DA 3PSIA 2YI1A 5BRHA 1RTDA 3WEEB 3SCXA 3SV4A 5HRSA 1JXBA 3FZLA 4FWOA 3NH0A 3ZCMA 3KD1E 1QTMA 2ZWHA 1C0UA 4IFEA 3L2QA 3TARA 1TKZA 3UE5A 1QSLA 4IJAA 3VGLA 4PWDA 1K8AO 3MXJA 3QNOA 2CH5A 3UKRA 3C6UA 3MN5A 3O4QA 4KTQA 4IFYA 2VGNA 4BROA 3CM5A 4CVNE 3TSUA 4AF1A 1L5UA 3OW2M 5JS1A 1JJ2M 1XHZA 4DTXA 3HI0A 5AQIA 3R8EA 4CJEA 4F8RA 2IOCA 2E1ZA 3FZKA 4G9ZA 1BG3A 4FJKA 5HBMA 1S1UA 2ATQA 1X9SA 4GV9A 3M5RA 1G99A 1TKXA 4IOCL 3BP8A 4C8LA 3MMVA 3M8RA 5KPRA 1YJWN 3CCQN 1WSFA 3OTOK 4Z4EA 2VGMA 4IDHA 1T7PA 4XEIA 3DXKB 2PBDA 2D1KA 4CZKA 2HHXA 2JWKA 3ZX2A 2BDPA 1KSPA 1X3NA 4DG1A 1K9MO 1NU0A 2P9NB 4EZ9A 4J2AA 4CIGA 4CD1A 4E1NA 2OZMA 4GVEA 4CFBA 4A61A 4OO1J 1S5JA 2XY8A 5DK5A 4OKKA 5LJVA 2P9PA 1NJXA 3P39A 4YOXA 3PX6A 4HWIA 4JEPA 4KH4A 1DLOA 4DQSA 5AJ3K 1RNHA 3H3NO 3HOTA 1NGBA 4FK4A 1Z26A 1C1CA 5KI6A 1D4XA 3BF1A 3F9KA 4F9OA 2QEXN 2I7PA 1KVAA 3P38A 4JNEA 4TSXA 1KXPA 3CC7N 1HR0K 4OPJA 3MEDA 2VG7A 4BE0A 4DR4K 2IVNA 2RKIA 1GOBA 1NG9A 4FW2A 1WB9A 4LF5K 4AM7A 4FJXA 3HXMA 4H0VB 3SK3A 2KLAA 2HF3A 4Z4HA 2ASOA 2NZTA 4JI3K 1ZBUA 1NGEA 5EX5A 2QWQA 4A57A 2B5JA 5CYMA 4CJVA 3MX5A 3LDSA 2NRZA 2ZJRL 3RR7A 3I0RA 3VQDA 5J2PA 3AA5X 1ITGA 1KLNA 1HYSA 3GG4A 3QICA 2P9UA 4OJRA 1Q9YA 4Y1DA 3L2RA 4E1MA 2W40A 3M6GA 1BCMA 1X1PA 2YHAA 4DF4A 3UIQA 4KHQA 4RG8A 3BZCA 3MN9A 3PY8A 1NLVA 1UA0A 2GBZA 3E9PA 4GKJK 4GNIA 3J7YP 4BE1A 3QIPA 3BUZB 3UB5A 3V9WA 1N5YA 3QBWA 4FJHA 4H0YB 1RT2A 4NCGA 3I56N 4FJJA 1A5XA 3O9RA 4H8KA 3V6DA 1GOCA 4KFBA 1VQNN 4DS5A 2Q3SA 3P5JA 4EHUA 1GLDG 3CJBA 2A1RA 4CJPA 4WFAL 1MA9B 3BGRA 2ZQBA 3U9ZA 3R6MA 1MDUB 3QEWA 4BACA 4DV1K 1OKJA 3AVGA 4BRKA 1Z6RA 3THWA 3AVCA 2VQFK 4DQIA 4EFHA 4DUYK 4LH5A 3KWIA 5HRRA 4BVOA 3SUPA 3KLFA 5DM7L 2D0PA 3ZT4A 1RBRA 1ZBLA 4KBOA 3MAQA 3EZWA 5HLFA 1EWRA 3SLCA 1HPMA 2HHUA 2P5OA 4DTNA 3DLKA 4IWVA 1JLEA 1DT9A 4PA1A 3W3DA 1B9FA 3VTHA 2IIRA 2CGKA 3C94A 1RDBA 2VG5A 3MN7A 3CJCA 2X6NA 4R79A 4IKFA 3TSQA 4B1VA 5I42A 1SKWA 2P9PB 3T7ZA 2FSKA 1VSIA 2I5JA 4Q5VA 1QVGM 1WAJA 4IEIA 4MLEA 4A62A 5AFUH 2QWMA 3WNHA 3NE6A 3F9MA 3EE8A 3OBYA 4O0JA 3QMLA 3VEOA 3U8XA 4JK9A 3VF6A 1ZBHA 4CEAA 1WBBA 1XC9A 2DFFA 1FK9A 1TUUA 5FPMA 5F1XA 2WC9A 1TKDA 4PKHA 3BDPA 3ZSXA 4FLWA 1DTTA 3O4WA 4LF6K 4CGIA 3E1YA 4JS5A 3QBXA 5C0YA 4BRCA 5KPZA 3O8MA 1VSDA 3O9QA 5LMUK 4OPAA 1YAGA 3OYBA 4BG9A 3QEPA 2YCHA 1U48A 3CHWA 1BL3A 2XY5A 4KREA 4BRHA 2XY7A 5AQFA 1VSEA 4O55A 1SAZA 3OHRA 1KVCA 3DYAA 3TSPA 1DGKN 2YNFA 4B1UB 3VQPA 2Z1IA 1NMDA 5CE3A 3V9ZA 3SUNA 3NH2A 4CD3A 2D4WA 2VWBA 4JKFA 3G10A 2P9UB 4IO8A 3PX4A 3O08A 2OANA 2F8SA 4FWRA 3U4LA 3LANA 3SQ2A 4H0PA 1VQON 3SQ4A 1ILYA 1K73O 1NK5A 3TABA 1S9EA 2Q0UA 1KFSA 4JI5K 4BREA 3T69A 4E3SA 4MLHA 2E5LK 4UY8O 1EWQA 3EKUA 5FPNA 3AA2A 4CK2A 3MK6A 3R1XA 2W42A 4Z4IA 4H5VA 2A6AA 1NGHA 4BRGA 5E26A 4X64K 4H5TA 1UOCA 5GIOA 1SL1A 2PFUA 4W5QA 1VSHA 3OYEA 3ZETA 1KLMA 3H1QA 3AA3A 1ZBFA 3EKSA 4B3SK 5KPTA 1D9FA 3OYLA 1D9DA 1GOAA 1REVA 3TAPA 3WT0A 1JCFA 4J2DA 3WNEA 3KVGA 4DTPA 2D0BA 4CI6A 1UWBA 2PAVA 4CEZA 3THWB 4DS4A 4DKWA 4ELTA 3OYNA 3A0IX 2GUPA 4LF8K 2UYTA 1E3MA 2P5GA 4CFCA 1QHTA 3AO5A 4IOAL 4BECA 3KLGA 4NCBA 1R0AA 3ID6A 2QM1A 1T03A 1NK8A 4M3ZA 4A2AA 5DM6L 2E2PA 5GAEP 4YORA 3J8AA 1NWKA 1Z05A 4AILC 3RTVA 1VQMN 2QWPA 4FK2A 1XHXA 2RHKA 4N5SA 3QO9A 1VSKA 4JI6K 4CF2A 3S41A 3O9TA 4M3TA 1GLEG 5GAHP 3WXMB 3LZIA 1KFDA 4M63C 5KRTA 4ZHRA 5FRMA 2BANA 3MWPA 3C7NA 2QTDA 2FSJA 3NGYA 4BWMA 3K9KA 3HVRA 1CZAN 3K0SA 2BH1A 3K2PA 3T3FA 1XUPO 3WQUA 4C8OA 2DTUA 2F8TA 1RT5A 4R5PA 5JVGL 2ASPA 2KHOA 5AQLA 1GLJO 1B92A 1RBVA 2IVOA 5BR9A 1ASUA 3OA9A 3VF4A 4DF8A 3SMPA 1JLGA 1C1BA 3PX0A 4DTJA 4K43A 4KTWA 3RMAA 4DSJA 3CQXA 2E4LA 4DR1K 2E20A 4BRDA 4ZTFA 3CM6A 2J4RA 2YNHA 1T44A 4PL8A 4FPAA 3CPEA 3NDKA 5D3GA 4BRFA 2G8HA 5AQPA 4E7HA 1FJGK 1X9JA 4YOYA 1WSJA 1MU2A 1BCOA 4BR4A 1RT3A 4FM0A 3V9UA 4H0OA 2RF2A 4B9LA 3G25A 4WF9L 4FL9A 2Q31A 3ZEUA 3CC4N 3TAFA 3NMUA 1JL1A 4LF9K 2GELA 4HVJA 4K8ZA 2G8KA 1NK6A 3HSCA 3AVLA 4FLTA 3MCPA 1WSEA 2A3ZA 3HJFA 4FSVA 3VEZA 3AO1A 1EX4A 2GWJA 2WFBA 3V9XA 3T19A 1N33K 3FZFA 1S22A 3GOIA 3L4QA 2WTUA 1VQKN 4CEBA 1NM1A 3D2FA 3ZETB 4DR3K 4DFJA 1HJRA 3J80O 3PIOL 2CGLA 1C0GA 2ZF5O 5EU7A 1IH7A 3CC2N 4DLEA 1NGIA 1OVQA 5AQJA 4E1JA 4LF7K 4ISFA 2VCPA 2WOMA 4BRPA 4H5WA 2G8IA 2W6LA 3WQTA 2OPSA 3BY5A 3RMDA 1T6CA 3D2EA 4JKHA 1FKPA 2FLOA 5HRNA 3UKUA 3EZ5A 1NOYA 4DTMA 3C6HA 1CZBA 3U9DA 4I6MA 1EP4A 3DWLA 1SL2A 3VQ7A 3SPYA 3OS2A 1FXXA 5I9EB 3LDQA 5AQVA 5E41A 1VQ8N 2HHIA 3C0BA 3KHYA 2YKMA 4QS8A 1P8ZA 1ASVA 1K8KA 2VG6A 1E4GT 3EN9A 4BR7A 4C8NA 2RE2A 4OKJA 2IC3A 3DLEA 3R9PA 2E6MA 1W2BM 1T05A 1IKXA 4CJ4A 4UQGA 5C24A 3I8DA 4BY9C 1ATNA 4M3RA 3QB0A 3I8BA 4V19S 4BC3A 2AJQA 3OYFA 4B3OA 1QHAA 3TPQA 1LAWA 1JLQA 5FDLA 4FJIA 3AAPA 1U49A 4CEEA 3QFUA 4ID1A 4E19A 2P9IA 3KIOA 3HO1A 3C7NB 3KTQA 2A5XA 3ZSWA 1RDUA 1JCGA 3SAFA 3U3YA 4E7LA 1VSJA 3NF7A 1QZ6A 1EXQA 4CBWA 4YOVA 3KJVA 4CJFA 4IJNA 3C6AA 3KD5E 3LALA 5HOOA 3ZX3A 4O0IA 3CMEN 4FLUA 4NYNA 3J81O 2QWOA 1X9WA 2Z1JA 1LOTB 4DU4A 5AQNA 5FPDA 3O3GA 3PUFA 1W0HA 4CERA 3NF9A 2AP1A 2QWRA 4NXMK 4OGEA 4AM6A 1H1VA 4EHTA 4HHTA 4KHPK 5AQZA 4JD2A 4LFCK 4JKGA 3V81A 4FYDA 4IO9L 5A2QO 2HHQA 4DV6K 1SV5A 1Y64A 3ZEUB 2ZM6K 2VWJA 4O44A 3L4IA 2QI2A 3A5NC 1RBTA 4AHUA 1KTQA 3IG1A 2CGJA 4JRQA 5AZIA 4CGGA 1VQ4N 3K5MA 4F3OA 1YVNA 3QLHA 4CJWA 3LM9A 3U6FA 4DFMA 3CCUN 2O8FA 2GWKA 4ELVA 4IOXA 1IJJA 4CZJA 2VQEK 1BO5O 1QZ5A 2E2QA 3H45C 3AO2A 3TTFA 3D2FB 4K42A 4CJKA 4WCEL 3HL8A 4CF0A 4CFDA 2H3GX 3OYKA 4JN4A 2NRRA 1RDAA 3M1FA 4FPBA 4IG3A 4NYFA 4W5NA 3LP2A 3HP9A 1TKTA 3CG7A 3IRXA 2QKKA 1RGIA 4KI4A 1JL2A 2KZMA 4M3YA 4HTUA 4GMJB 4CZMA 5LJWA 3J7ZO 1HNVA 4GVMA 4ZTJA 4NO7A 3QNNA 4CZLA 4KB1A 3QEIA 4WQ4A 3OYJA 1RTHA 1NMNA 4K25A 3D2EB 3HSTB 5M1PA 3PO5A 1LW2A 2EX3A 3CPWM 3A2FA 1NGGA 2WUSA 4I6MB 3QERA 4PKGA 4CGHA 2V51B 1SS6A 4JKEA 4FLYA 3TTDA 1KAZA 1BIUA 4A59A 4AH9A 1U2VA 1K8KB 2I7NA 4DSKA 2UUCK 3DOLA 1LCUA 1HJOA 4BVPA 1G15A 5KGXA 1YIJN 4EIAA 1VQ9N 1TL1A 3D6RA 3JS6A 4EAHD 3CXCM 4J2BA 4BGBA 1XMQK 1LAVA 4DR5K 3V1OA 5F2RA 3S9HA 1IG9A 2Q97A 3NBPA 3CFOA 4CF8A 3V1QA 4BR5A 4B9MA 3THXA 3AO3A 1OH8A 1BQNA 2P9IB 3I0SA 1YVUA 4C1NK 3RR8A 3H6EA 2ZD1A 3JXUA 4BRQA 4PHTX 3SZ2A 3O5BA 1J9AA 1RTIA 3UKRB 3SNNA 2QA4N 3VOVA 3FGUA 4BG8A 5GIPA 3L8BA 3SJHA 1QS4A 2O8BA 3TTCA 1DKGD 2P51A 1YHQN 3KK1A 3IS9A 4NXNK 2F7TA 3CCMN 2W00A 4F2SA 3PLAA 4JI8K 1Z25A 5LL6Z 5AQOA 1S1WA 2PZSA 4F4KA 1RBSA 4FCYA 4LFBK 4ISEA 4I2QA 1TYQA 1Q18A 3E01A 4K8XA 4CEQA 1RDWX 3CCSN 3PIPL 3RSEA 3F5TA 5CZ2A 1LV5A 4JD2B 4OVLA 3ZT0A 3LDNA 4H0XB 3VQCA 3AO4A 1X9MA 2ETJA 3EEQA 3RRGA 4KHWA 1KCFA 2HMPA 3LPTA 1S72N 2XRIA 3DM2A 1KAYA 3KZBA 2BGGA 4FM1A 4LF4K 4DQ8A 4M42A 4JS4A 3CERA 2KW4A 1WAFA 1CZ9A 2F9TA 1YJ9N 3VQBA 4I9QA 4K0KK 1BIZA 2O8FB 3LWLA 2JGUA 3TI0A 3CMAN 4B9UA 1TL3A 3GDQA 3BEXA 3D7EO 1WBDA 2E2NA 1NKCA 1YF5L 4CBUA 4FJ5A 4MDAA 4FJMA 4YOTA 1GLAG 4XH1A 2IS3A 1RT6A 2W6KA 2KKZA 1VQ7N 1XQSC 2HMIA 5I3UA 3VQQA 3OYIA 2OYQA 1HQEA 2X74A 4MO5A 5J1EA 1BISA 4CJTA 1HUXA 4WQ4C 2OPRA 3CYGA 4CEFA 4FWSA 4O5FA 2Q0RA 3DLGA 1NOZA 4KV8A 2CH6A 4N47A 1BWFO 1NGFA 4CHNA 3QEXA 4E0DA 1JLFA 3VESA 1NGDA 4BRMA 3R3LA 4KKOA 1KD1O 1J53A 4DR6K 5C25A 4BDZA 4KPYA 1NJZA 5AQQA 1V4TA 2RPIA 1JKHA 2FBTA 3MECA 1ATRA 2YJEA 1BI4A 5KQ8A 4B9SA 1U2VB 1O13A 3ZT1A 4WFNL 1Q8IA 2QWLA 5GAGP 2WBNA 1VQLN 3RMBA 3HK2A 4JLHA 1N36K 4KI6A 1C0MA 3CJ9A 4BR2A 1NK4A 3FLCO 2NRWA 2OA8A 2HHVA 3THXB 4CJQA 2HBJA 1M90O 4KB0A 5AQUA 5BN9A 4DQRA 3VERA 3N4QA 3ZT3A 4RTFD 2UU9K 3CJ1A 4B1XB 4FJLA 4DB3A 3I33A 3AARA 4C8KA 4YDUA 4LSLA 5BPLA 4YOUA 1N8RO 5LY3A 3A8YA 3CCRN 2NRXA 1IKWA 2GTDA 4A2BA 1FW6A 2O8BB 1Q82O 1HNZK 5KTQA 1XWLA 3ZSRA 4CFAA 4DR2K 2Z1HA 5CYQA 4FW1A 4N41A 1IKYA 2YHWA 3EYZA 2HVHA 5JMVA 5JENA 4CIFA 3LP0A 5M1FA 3NH1A 3A5LC 3AVHA 4QS9A 3G4SN 2JLEA 3RSEB 4CHOA 3OY9A 1VK0A 4DCHA 1GLCG 3SAGA 4PUOA 5CHIA 3HTVA 3NVKA 1V4SA 3DXMA 5M1NA 1Q7YO 5BR8K 1UAXA 1D8YA 4M3WA 3TR8A 4W5TA 3AV9A 3E66A 1A5VA 2D0OA 5BRDA 4BE2A 3A5OC 4CIEA 3F73A 3BZKA 4LH4A 4HUEA 1VQPN 4JI4K 4M3UA 4CF9A 5BPNA 1S9GA 4H4MA 4GW6A 3O4NA 2VYPA 4KH6A 3WXKA 1ATSA 1C0FA 5J2QA 4G1QA 4KHNA 4FJ9A 3LZJA 4IDKA 1J5OA 1QQCA 4HCBA 4FJNA 1TK0A 3VEXA 1I3AA 3RVCA 2OTLN 1TUYA 2V7YA 4KHYA 1LWCA 3Q7BA 3O6WA 4BC2A 1HYZA 3NGIA 1TAUA 2W41A 3VQEA 2UXDK 2BUPA 4IXCA 4ELUA 3HPGA 1HRHA 3FFKB 4FWKA 4PL7A 3VPZA 3JYTA 2UUAK 4DU3A 4OPKA 3WXLA 4BWJA 5C42A 1NKBA 3AVAA 1HYVA 4B1ZA 2NNWA 2OZSA 1L3VA 1IBLK 4O8UA 3VTIA 4IFVA 3H3OB 1KAXA 2PYLA 3EO3A 3KK3A 1QQOA 3DMJA 4E89A 3Q7CA 4CEOA 4RW6A 2IGIA 4IZ9A 1VQ5N 2GV9A 1HNIA 2AA4A 4DTSA 4FK0A 3CI5A 3OJUA 3O9SA 4BDYA 1VSFA 3VA3A 2FBVA 4FWPA 1KQSM 3IDHA 2E2OA 1R59O 3WNFA 4WE1A 3TANA 2OPPA 4MFBA 1NGCA 5EY4A 1U45A 4CJ3A 5EXWA 1SZ2A 3VF2A 4N56A 3ASMA 3GE1A 1NJYA 4RWTA 4YDUC 4QOZB 2Q1NA 2A1SA 2FF3B 1XNRK 4DV5K 2YHXA 4AHTA 2OCEA 3H46O 4CGDA 4GY2B 4JKDA 2UXBK 4MDBA 1MWKA 1QSSA 4AHCA 4JAXA 2B6AA 1T8EA 2O8EA 4JK7A 3N4PA 3HT3A 4DSFA 4N76A 5J2MA 2YJFA 5KQDA 3AVNA 4EZ6A 3G0ZA 3L2UA 4BE7B 5FLXO 1NJWA 3HRGA 3HPOA 5GINA 4DQQA 2ITGA 4DSIA 2XHBA 3T1HK 2F4VK 1RTJA 4W5OA 4CZHA 5IWAK 3LM2A 1QQNA 5C2FA 5ADXA 4CJLA 3O1BA 2Z1GA 3DI6A 3CD6N 3SUQA 1RDDA 3CIPA 5C12A 1WSHA 4YY3K 3KLEA 4H5NA 4O5BA 3WXJA 3ATUA 3ID8A 3ZX0A 3NHGA 4O8KA 3L3VA 2E1YA 3TU5A 2A40A 3DXMB 4CZIA 3JAMO 1RT7A 4B08A 5GADP 3QESA 2LSNA 4CK3A 3VETA 4CK1A 4GKKK 4CHYA 2P9KA 4PKIA 2IAJA 4DLGA 1LWFA 2HNDA 1IG8A 3HM9A 1RT1A 3NGZA 4BQLA 3SYZA 1JXEA 2Q2RA 5E84A 2FSNA 1NK7A 1C0TA 3I55N 3RWUA 5AQHA 1SQKA 3VQ5A 4ILGB 4CJ7A 4KRFA 1RDCA 2O4GA 3HVTA 1OH7A 3NF8A 1SKRA 3KWGA 2EHGA 2NRTA 5JICA 4QAGA 3KK2A 4M7XA 1ZBIA 3TAEA 1VRUA 2P1JA 3DLHA 3MX2A 3O3HA 4I7FA 5AR0A 3E9LA 3T1AA 3EE9A 4JI2K 2ZGYA 2YNGA 3LDLA 3QFPA 4LFAK 1CXUA 4BR9A 4FJ8A 5TKYA 3MEGA 3LDPA 4CBXA 4I2PA 2QK9A 3CETA 3LAKA 4XIUA 4BRAA 4FLZA 2FBXA 5FROA 1OH5A 1IBMK 4AQYK 5K14A 1S3XA 2D5RA 1NGJA 3ZSOA 4M45A 4KTZA 4XH4A 4RCHA 4KH5A 1HKBA 1LW0A 2YHYA 3S3OA 4BC5A 2YHBA 2NUBA 3P4IA 4MQ3A 4ISGA 3K57A 4DV3K 4HUFA 1VHXA 3MXIA 3C6TA 4B9NA 4LD0A 3KLIA 3V9SA 1ZXOA 3TAMA 5KRSA 4Z4CA 1VRTA 1W7AA 4IEEA 2O8CA 1HMVA 4DV0K 3DRPA 2OTJN 2JWLA 4CESA 4FLVA 4DTUA 2HSTA 2X6SA 4AHSA 3HOSA 4CHPA 2B4JA 2KTQA 2O8EB 4CZEA 2C1GA 1BUPA 3OYCA 5BRFA 1T3VA 2BTFA 4HUGA 4NCAA 2HBKA 2GX9A 4BR0A 4OGCA 1K6YA 1HPZA 3FFIA 1TAQA 1TK5A 1F21A 5B8HA
chains in the Genus database with same CATH topology
1E4FT 1GLBG 3CERA 1YJ9N 2F9TA 2HBLA 3O80A 1NGAA 4JHDA 3BF3A 4IOAL 3CMAN 1X3MA 4BECA 1GLLO 3GDQA 3BEXA 3D7EO 2E2NA 2HBMA 2QM1A 2ZGZA 1YF5L 3ID6A 3GL1A 4CBUA 5AQGA 4MDAA 1ZBSA 4YOTA 1GLAG 4XH1A 5EOYA 1BA1A 3B8AX 4JK8A 2NRHA 4GV6A 3HZ6A 4ILJA 2KKZA 3NVMA 4A2AA 1VQ7N 1XQSC 5DM6L 2E2PA 5GAEP 5AQTA 3HBTA 4YORA 4YOWA 3J8AA 3UKUB 1NWKA 4MO5A 1Z05A 3K9JA 2FF6A 1VQMN 2QWPA 1HUXA 3P31A 4WQ4C 2RHKA 5BN8A 3S41A 3O9TA 4FWQA 5C15A 1GLEG 4FWSA 4O5FA 2Q0RA 3MDQA 3WXMB 3SAHA 5GAHP 3DLLL 3G6EN 2P9KB 2CH6A 1BWFO 1NGFA 4U7BA 4M63C 3VESA 1NGDA 2QWNA 4BRMA 4H03B 2QXLA 3CJAA 3R3LA 4BRIA 3MWPA 3C7NA 1KD1O 2A41A 2QTDA 3LL3A 2FSJA 3K9KA 1CZAN 3KK7A 2BH1A 5AQQA 1M1KO 1V4TA 1XUPO 2P9LA 3VENA 3WQUA 3O1WA 1ATRA 2YJEA 5JVGL 2ASPA 2KHOA 5AQLA 1OVYA 1GLJO 1T6DA 5BR9A 2IVOA 2YI1A 1U2VB 5BRHA 5KQ8A 3OA9A 3VF4A 3WEEB 3SMPA 4DHYA 1O13A 4WFNL 3FZLA 4FWOA 3SMSA 1BOTO 2E88A 3OBWA 4K43A 2QWLA 5GAGP 2ZWHA 4IFEA 3CQXA 2WBNA 3VEVA 1VQLN 4WQ5A 3UE5A 4IJAA 3VGLA 1K8AO 2CH5A 3UKRA 2E20A 4BRDA 3CJ9A 2J4RA 1T44A 5JVHL 4BR2A 4PL8A 4FPAA 3CPEA 3MN5A 3FLCO 2NRWA 1P90A 5AQMA 2HBJA 2VGNA 4BRFA 3MWTA 5AQPA 3L0QA 3ULEA 5AQUA 5BN9A 4BROA 1M90O 3TSUA 3VERA 4AF1A 3N4QA 3OW2M 1X9JA 4YOYA 4RTFD 1JJ2M 4BR4A 3CJ1A 4H0OA 4B1XB 4DB3A 3I33A 3AARA 4FOEA 4YDUA 3G25A 4WF9L 3HI0A 5AQIA 3R8EA 4YOUA 4FL9A 2Q31A 5BPLA 1BA0A 3ZEUA 5LY3A 3A8YA 4L3QA 3CC4N 2E1ZA 3FZKA 3NMUA 4G9ZA 2GELA 1BG3A 3CCRN 1BDGA 2NRXA 2GTDA 3HSCA 4A2BA 1YI2N 4H0TB 3MCPA 1DEJA 1Q82O 4GV9A 3M5RA 1G99A 4IOCL 3BP8A 2A3ZA 2DPNA 4FSVA 3IFRA 3CCEN 3MMVA 4WFBL 4JKGB 5KPRA 1Q81O 4QS7A 1YJWN 3CCQN 5ELZA 2QW9A 3VEZA 2VGMA 4IDHA 4LC9B 4C23A 3CCJN 2GWJA 2WFBA 2YHWA 2P9SA 3DXKB 4XEIA 2PBDA 3VEWA 2D1KA 5JMVA 3FZFA 1S22A 4CZKA 2JWKA 3GOIA 3ZX2A 3FR0A 3L4QA 5M1FA 5M1QA 1VQKN 3A5LC 1NM1A 5AZIB 1X3NA 3D2FA 4K41A 4QS9A 1K9MO 3ZETB 4BRLA 3G4SN 3RSEB 3PIOL 2P9NB 2ITMA 2CGLA 1C0GA 4DCHA 1GLCG 5AZJA 4CD1A 1U6ZA 5AQSA 1WOQA 4GVEA 4A61A 4OO1J 3HM8A 3SAGA 2ZF5O 5LJVA 3HTVA 2P9PA 5CHIA 3NVKA 1V4SA 3DXMA 3P39A 3CC2N 4BGAA 5M1NA 4YOXA 1Q7YO 1NGIA 1EQYA 4HWIA 4JEPA 4KH4A 5AQJA 4E1JA 3M3ZA 2GEMA 4BC4A 3E66A 4ISFA 2D0OA 5BRDA 2VCPA 4BRPA 3A5OC 3H3NO 4U67L 5M1KA 1NGBA 3HOTA 1YJNN 3C65A 4H5WA 1VQPN 3VMFB 5BPNA 1D4XA 3BF1A 3WQTA 1T6CA 3D2EA 4F9OA 4KH6A 2VYPA 4JKHA 2FLOA 3WXKA 4JHDB 3UKUA 1ATSA 1C0FA 3C6HA 4JKBA 2I7PA 4I6MA 5AQKA 3AY9A 3U9DA 1MWMA 3P38A 2QEXN 4JNEA 3DWLA 1KXPA 3CC7N 3ENBA 4OPHA 5I9EB 3LDQA 4ILHA 5AQVA 1VQ8N 3W0LA 2A42A 3C0BA 3KHYA 2IVNA 2V7ZA 3VEXA 3RVCA 3QDKA 4QS8A 5BREA 1P8ZA 1K8KA 3AAQA 3EN9A 1E4GT 4BR7A 4CZGA 2OTLN 2RE2A 1TUYA 2V7YA 3R9PA 4AM7A 3Q7BA 3O6WA 4BC2A 1NJIO 2V52B 1W2BM 2W41A 3CCLN 5MLCQ 4H0VB 3SK3A 2KLAA 5CR4A 2HF3A 1YXQA 4BY9C 1ATNA 2BUPA 4H5RA 2ASOA 4IXCA 2ZJQL 2NZTA 3QB0A 3I8BA 4BC3A 1NGEA 1HLUA 1W97L 3FFKB 4FWKA 5EX5A 5F0XA 4PL7A 3VPZA 1EO1A 2QWQA 4A57A 1QHAA 3WXLA 5AQWA 3TPQA 4B1WB 3MX5A 4B1ZA 2NNWA 2NRZA 2ZJRL 3AAPA 3FZMA 4Y0WA 3QFUA 4O8UA 3VTIA 2P9IA 1JCEA 3C7NB 2C1IA 1ZC6A 2A5XA 3SAFA 1RDUA 1JCGA 1KAXA 3GG4A 3H3OB 3EO3A 3QICA 2P9UA 1QQOA 3AGKA 4XH5A 2P9LB 1QZ6A 3Q7CA 3FE1A 4IZ9A 4CBWA 4YOVA 1VQ5N 5BPMA 2W40A 2AA4A 3M6GA 4CZFA 1GLFO 3CI5A 4WQ5C 3O9SA 4IJNA 1QVFM 3C6AA 3MN9A 4FWPA 1KQSM 1NLVA 1HKGA 1XC3A 1VAZA 3IDHA 3ZX3A 2E2OA 5HOOA 1R59O 3E9PA 4GNIA 3DJCA 3CMEN 1NGCA 5EY4A 3BUZB 2QWOA 5EXWA 3UB5A 1LOTB 1Q86O 1SZ2A 3VF2A 3QBWA 4GV3A 4FWLA 5AQNA 5FPDA 3GE1A 1RFQA 4H0YB 1J6ZA 3I56N 4RWTA 2YX6A 4YDUC 3O9RA 2AP1A 2Q1NA 2QWRA 4WYBA 3ULEB 4A5AA 2FF3B 4AM6A 2ZJPL 1H1VA 2YHXA 1VQNN 4EHTA 5AQYA 3H46O 4GY2B 4JD2A 5AQZA 4JKGA 4JKDA 4MDBA 1MWKA 4FO0A 4JAXA 4IO9L 4EHUA 1GLDG 3CJBA 4B9QA 4JK7A 1Y64A 3N4PA 3ZEUB 4WFAL 1MA9B 3CQYA 2YJFA 3U9ZA 3L4IA 5KQDA 3R6MA 1MDUB 2QI2A 3A5NC 5HL7L 2CGJA 1OKJA 3FZHA 1TYQB 5AZIA 4BRKA 4BE7B 1Z6RA 3VGMA 3CJ7A 1VQ4N 3AGRA 4EFHA 3HRGA 1YVNA 3ENOA 3MCAB 5GINA 3KWIA 1VQ6N 4BVOA 3LM9A 4CZHA 3CCUN 5DM7L 4NLCA 2D0PA 3O9UA 2GWKA 3LM2A 4IOXA 4KBOA 5AFUA 1QQNA 1IJJA 5C2FA 5JLFA 4CZJA 2P9SB 5ADXA 5AQRA 1BO5O 1QZ5A 3EZWA 1YITN 2E2QA 3H45C 5EVZA 3O1BA 3TTFA 3SLCA 1HKCA 3D2FB 4K42A 3CD6N 4WCEL 1HPMA 3CIPA 4IWVA 5C2DA 2H3GX 1DT9A 3W3DA 3VTHA 5C12A 3LDOA 2IIRA 2CGKA 5AZJB 5C10A 4H5NA 4JN4A 2NRRA 3E9OA 2EWSA 3M1FA 3MN7A 3ATUA 3CJCA 3ID8A 4FPBA 3WXJA 3ZX0A 4R79A 2FXUA 4O8KA 4NB4A 3VGKA 2E1YA 3TSQA 4B1VA 2P9PB 3T7ZA 3TU5A 2A40A 1RGIA 2FSKA 3A5MC 3DXMB 4CZIA 1QVGM 4IEIA 4MLEA 5TKWA 4A62A 3EL2A 5AFUH 2QWMA 3IKMA 5GADP 3F9MA 3EE8A 5ADXH 3OBYA 3QMLA 4CZMA 3VETA 5LJWA 3VEOA 3U8XA 2P9KA 4PKIA 3VEYA 3J7ZO 4JK9A 4NO7A 3VF6A 2HOEA 2Q36A 4CZLA 4WQ4A 4FOIA 2NRVA 3F2KA 4K25A 5M1PA 1IG8A 3D2EB 2IVPA 1QQMA 4FWMA 1TUUA 5FPMA 3WUHA 4BQLA 5F1XA 3CPWM 3DAWA 1NGGA 2WUSA 2Q2RA 2WC9A 4I6MB 4PKGA 4PKHA 2V51B 1SS6A 4JKEA 5E84A 3TTDA 2FSNA 3O4WA 1KAZA 3ATVA 3ZYYX 3I55N 3E1YA 5AQHA 5AQXA 4A59A 1SQKA 1U2VA 3QBXA 4ILGB 5C0YA 4BEBA 4BRCA 5KPZA 4B1YB 3WEEA 4CJ7A 1K8KB 2I7NA 3O8MA 4A5BA 1HX1A 3O9QA 4OPAA 3KWGA 1LCUA 1HJOA 1YAGA 2NRTA 4BVPA 5JICA 1YIJN 4EIAA 1VQ9N 4BG9A 4M7XA 3D6RA 2YCHA 3JS6A 1YUWA 3CHWA 4EAHD 4BGBA 3CXCM 4BRHA 1WUAA 4J8FA 4FVUA 4BQZA 2HF4A 3H1VX 5AQFA 3MX2A 3MN6A 5F2RA 2Q97A 1SAZA 3OHRA 4Z94A 5AR0A 3TSPA 4BR5A 1DGKN 3E9LA 3IMXA 4B1UB 3EE9A 2ZGYA 3LDLA 3QFPA 4BR9A 1NMDA 5TKYA 4XJXA 5CE3A 4CD3A 2D4WA 3IUCA 2P9IB 4JKCA 3LDPA 2VWBA 4CBXA 4JKFA 3CETA 3SBGA 4C1NK 3ENHA 3H6EA 3JXUA 4BRAA 4BRQA 2P9UB 4PHTX 2F9WA 3O5BA 4IO8A 3CF5L 3UKRB 3O08A 2QA4N 2OANA 3VOVA 1NBWA 3FGUA 4BG8A 4FWRA 3U4LA 4C1NI 5GIPA 1S3XA 4H0PA 1VQON 1NGJA 3SJHA 1ILYA 1K73O 2Q0UA 4MO4A 3TTCA 4XH4A 4BREA 3T69A 4RCHA 4KH5A 1HKBA 4MLHA 1DKGD 2YHYA 4BC5A 4UY8O 3EKUA 5FPNA 3WXIA 2ASMA 1YHQN 3MK6A 3R1XA 3L6QA 3P4IA 2F7TA 4ISGA 5FPEA 3CCMN 2W00A 3PLAA 4H5VA 5AQOA 1ESVA 2A6AA 3DXKA 1NGHA 4NLBA 4BRGA 5E26A 1KC8O 4H5TA 5GIOA 2PFUA 4ISEA 1ZXOA 1TYQA 1Q18A 2NLXA 1RDWX 3ZETA 3H1QA 3CCSN 3PIPL 3RSEA 2P9NA 3EKSA 5M1OA 4IEEA 3F5TA 1BU6O 2OTJN 4JD2B 2JWLA 5KPTA 2HSTA 3LDNA 4H0XB 3HOSA 4FWNA 4CZEA 2C1GA 2E8AA 2HMPA 3WT0A 1JCFA 1S72N 1BUPA 5BRFA 1T3VA 4HTLA 2BTFA 3CCVN 1N8RO 1KAYA 3KVGA 3KZBA 3SBTA 4CI6A 2PAVA 5JLHA 2HBKA 3G71N 2GX9A 4BR0A 4JKAA 4BRNA 4M7YA 4DKWA 4DQ8A 3A0IX 2GUPA 2UYTA 5H1SQ 3GBTA 5B8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E4F T;  1GLB G;  3CER A;  2F9T A;  3O80 A;  1NGA A;  4JHD A;  3BF3 A;  1X3M A;  1GLL O;  3GDQ A;  3BEX A;  3D7E O;  2E2N A;  2ZGZ A;  2QM1 A;  4CBU A;  3GL1 A;  5AQG A;  1ZBS A;  1GLA G;  4XH1 A;  5EOY A;  1BA1 A;  3B8A X;  2NRH A;  3HZ6 A;  4A2A A;  1XQS C;  2E2P A;  5AQT A;  3HBT A;  3J8A A;  3UKU B;  1NWK A;  4MO5 A;  1Z05 A;  2FF6 A;  2QWP A;  1HUX A;  4WQ4 C;  5BN8 A;  3S41 A;  4FWQ A;  1GLE G;  4FWS A;  4O5F A;  2Q0R A;  3MDQ A;  2P9K B;  2CH6 A;  1BWF O;  1NGF A;  4M63 C;  3VES A;  1NGD A;  2QWN A;  4BRM A;  4H03 B;  2QXL A;  3CJA A;  4BRI A;  3C7N A;  2A41 A;  3LL3 A;  2FSJ A;  1CZA N;  5AQQ A;  1V4T A;  1XUP O;  2P9L A;  3VEN A;  3WQU A;  3O1W A;  1ATR A;  2YJE A;  2ASP A;  2KHO A;  5AQL A;  1GLJ O;  1T6D A;  5BR9 A;  2IVO A;  2YI1 A;  1U2V B;  5BRH A;  5KQ8 A;  3WEE B;  3VF4 A;  3SMP A;  4DHY A;  3FZL A;  4FWO A;  3SMS A;  1BOT O;  2E88 A;  4K43 A;  2QWL A;  2ZWH A;  3CQX A;  3VEV A;  4WQ5 A;  3UE5 A;  4IJA A;  3VGL A;  2CH5 A;  3UKR A;  2E20 A;  4BRD A;  3CJ9 A;  2J4R A;  1T44 A;  4BR2 A;  4PL8 A;  4FPA A;  3MN5 A;  3FLC O;  5AQM A;  4BRF A;  5AQP A;  3L0Q A;  3ULE A;  5AQU A;  5BN9 A;  4BRO A;  3VER A;  1X9J A;  4RTF D;  4BR4 A;  3CJ1 A;  4H0O A;  4B1X B;  4DB3 A;  3I33 A;  3AAR A;  4FOE A;  4YDU A;  3G25 A;  3HI0 A;  5AQI A;  3R8E A;  5BPL A;  4FL9 A;  2Q31 A;  1BA0 A;  3ZEU A;  5LY3 A;  3A8Y A;  4L3Q A;  2E1Z A;  3FZK A;  2GEL A;  1BG3 A;  1BDG A;  2GTD A;  3HSC A;  4A2B A;  4H0T B;  3MCP A;  1DEJ A;  1G99 A;  3BP8 A;  2A3Z A;  2DPN A;  4FSV A;  3IFR A;  3MMV A;  5KPR A;  4QS7 A;  5ELZ A;  2QW9 A;  3VEZ A;  4C23 A;  4LC9 B;  2GWJ A;  2YHW A;  4XEI A;  2P9S A;  3DXK B;  2PBD A;  3VEW A;  2D1K A;  5JMV A;  3FZF A;  1S22 A;  4CZK A;  3GOI A;  3ZX2 A;  3FR0 A;  3A5L C;  1NM1 A;  5AZI B;  1X3N A;  3D2F A;  4K41 A;  4QS9 A;  3ZET B;  4BRL A;  3RSE B;  2P9N B;  2ITM A;  2CGL A;  1C0G A;  4DCH A;  1GLC G;  5AZJ A;  4CD1 A;  1U6Z A;  5AQS A;  1WOQ A;  4A61 A;  3HM8 A;  2ZF5 O;  5LJV A;  3HTV A;  2P9P A;  1V4S A;  3DXM A;  4BGA A;  1NGI A;  1EQY A;  4HWI A;  5AQJ A;  4E1J A;  3M3Z A;  2GEM A;  4BC4 A;  4ISF A;  2D0O A;  5BRD A;  2VCP A;  4BRP A;  3A5O C;  3H3N O;  1NGB A;  4H5W A;  5BPN A;  1D4X A;  3BF1 A;  3WQT A;  1T6C A;  3D2E A;  4F9O A;  3WXK A;  2VYP A;  2FLO A;  4JHD B;  3UKU A;  1ATS A;  1C0F A;  2I7P A;  4I6M A;  5AQK A;  3AY9 A;  3U9D A;  1MWM A;  4JNE A;  3DWL A;  1KXP A;  5I9E B;  3LDQ A;  5AQV A;  3W0L A;  2A42 A;  3C0B A;  3KHY A;  2IVN A;  2V7Z A;  3VEX A;  5BRE A;  3QDK A;  4QS8 A;  1P8Z A;  1K8K A;  3AAQ A;  3EN9 A;  1E4G T;  4BR7 A;  4CZG A;  1TUY A;  2V7Y A;  3R9P A;  4AM7 A;  3O6W A;  4BC2 A;  2V52 B;  2W41 A;  4H0V B;  3SK3 A;  2HF3 A;  1YXQ A;  1ATN A;  2BUP A;  4H5R A;  2ASO A;  4IXC A;  2NZT A;  3QB0 A;  3I8B A;  4BC3 A;  1NGE A;  1HLU A;  3FFK B;  4FWK A;  5EX5 A;  5F0X A;  4PL7 A;  3VPZ A;  2QWQ A;  1QHA A;  3WXL A;  5AQW A;  3TPQ A;  4B1W B;  4B1Z A;  3AAP A;  3FZM A;  4Y0W A;  3QFU A;  2P9I A;  1JCE A;  3C7N B;  1ZC6 A;  2A5X A;  3H3O B;  1JCG A;  1KAX A;  3GG4 A;  3EO3 A;  3QIC A;  2P9U A;  1QQO A;  4XH5 A;  2P9L B;  1QZ6 A;  3FE1 A;  4IZ9 A;  4CBW A;  5BPM A;  2W40 A;  2AA4 A;  3M6G A;  4CZF A;  1GLF O;  3CI5 A;  4WQ5 C;  4IJN A;  3MN9 A;  4FWP A;  1NLV A;  1HKG A;  1XC3 A;  3IDH A;  3ZX3 A;  2E2O A;  1R59 O;  4GNI A;  3DJC A;  1NGC A;  5EY4 A;  3BUZ B;  2QWO A;  5EXW A;  3UB5 A;  1LOT B;  1SZ2 A;  3VF2 A;  3QBW A;  4FWL A;  5AQN A;  5FPD A;  3GE1 A;  1RFQ A;  4H0Y B;  1J6Z A;  4RWT A;  4YDU C;  2AP1 A;  2Q1N A;  2QWR A;  4WYB A;  3ULE B;  2FF3 B;  4AM6 A;  1H1V A;  2YHX A;  4EHT A;  5AQY A;  3H46 O;  4GY2 B;  4JD2 A;  5AQZ A;  1MWK A;  4FO0 A;  4JAX A;  4EHU A;  1GLD G;  3CJB A;  4B9Q A;  1Y64 A;  3ZEU B;  1MA9 B;  3CQY A;  2YJF A;  3U9Z A;  3L4I A;  5KQD A;  3R6M A;  1MDU B;  3A5N C;  2CGJ A;  1OKJ A;  3FZH A;  1TYQ B;  5AZI A;  4BRK A;  1Z6R A;  3VGM A;  3CJ7 A;  4EFH A;  1YVN A;  3ENO A;  4BVO A;  3LM9 A;  4CZH A;  2D0P A;  2GWK A;  3LM2 A;  4KBO A;  5AFU A;  1QQN A;  1IJJ A;  5JLF A;  4CZJ A;  2P9S B;  5ADX A;  5AQR A;  1BO5 O;  1QZ5 A;  3EZW A;  2E2Q A;  3H45 C;  5EVZ A;  3O1B A;  3SLC A;  1HKC A;  3D2F B;  4K42 A;  1HPM A;  3CIP A;  4IWV A;  2H3G X;  3W3D A;  3LDO A;  2IIR A;  2CGK A;  5AZJ B;  4H5N A;  4JN4 A;  2EWS A;  3M1F A;  3MN7 A;  3ATU A;  3CJC A;  3ID8 A;  4FPB A;  3WXJ A;  3ZX0 A;  2FXU A;  4O8K A;  4NB4 A;  3VGK A;  2E1Y A;  4B1V A;  2P9P B;  3TU5 A;  2A40 A;  1RGI A;  2FSK A;  3A5M C;  3DXM B;  4CZI A;  4MLE A;  4A62 A;  3EL2 A;  5AFU H;  2QWM A;  3F9M A;  5ADX H;  3QML A;  4CZM A;  3VET A;  5LJW A;  3VEO A;  3U8X A;  2P9K A;  4PKI A;  3VEY A;  4NO7 A;  3VF6 A;  2HOE A;  2Q36 A;  4CZL A;  4WQ4 A;  4FOI A;  4K25 A;  1IG8 A;  3D2E B;  2IVP A;  1QQM A;  4FWM A;  1TUU A;  5FPM A;  3WUH A;  4BQL A;  5F1X A;  3DAW A;  1NGG A;  2WUS A;  2Q2R A;  4I6M B;  4PKH A;  4PKG A;  2V51 B;  5E84 A;  2FSN A;  3O4W A;  1KAZ A;  3ATV A;  5AQH A;  5AQX A;  1SQK A;  1U2V A;  3QBX A;  4BRC A;  5KPZ A;  4B1Y B;  3WEE A;  4CJ7 A;  1K8K B;  2I7N A;  3O8M A;  1HX1 A;  1LCU A;  1HJO A;  1YAG A;  4BVP A;  5JIC A;  4EIA A;  4BG9 A;  4M7X A;  2YCH A;  3JS6 A;  1YUW A;  3CHW A;  4EAH D;  4BGB A;  4BRH A;  1WUA A;  4J8F A;  4BQZ A;  2HF4 A;  3H1V X;  5AQF A;  5F2R A;  3MN6 A;  2Q97 A;  1SAZ A;  3OHR A;  4Z94 A;  5AR0 A;  4BR5 A;  1DGK N;  3IMX A;  4B1U B;  2ZGY A;  3LDL A;  3QFP A;  4BR9 A;  1NMD A;  5TKY A;  5CE3 A;  4CD3 A;  2D4W A;  3IUC A;  2P9I B;  3LDP A;  2VWB A;  4CBX A;  3CET A;  3ENH A;  3H6E A;  3JXU A;  4BRA A;  4BRQ A;  2P9U B;  2F9W A;  3O5B A;  4IO8 A;  3UKR B;  3O08 A;  2OAN A;  3VOV A;  1NBW A;  3FGU A;  4BG8 A;  4FWR A;  3U4L A;  1S3X A;  4H0P A;  1NGJ A;  3SJH A;  2Q0U A;  4MO4 A;  4XH4 A;  4BRE A;  4RCH A;  4MLH A;  1HKB A;  1DKG D;  2YHY A;  4BC5 A;  3EKU A;  5FPN A;  3WXI A;  2ASM A;  3MK6 A;  3L6Q A;  3P4I A;  4ISG A;  5FPE A;  4H5V A;  5AQO A;  1ESV A;  2A6A A;  3DXK A;  1NGH A;  4BRG A;  5E26 A;  4H5T A;  4ISE A;  1ZXO A;  1TYQ A;  1Q18 A;  2NLX A;  1RDW X;  3ZET A;  3H1Q A;  3RSE A;  2P9N A;  3EKS A;  1BU6 O;  4JD2 B;  5KPT A;  3LDN A;  4H0X B;  4FWN A;  4CZE A;  2E8A A;  2HMP A;  3WT0 A;  1JCF A;  1BUP A;  5BRF A;  4HTL A;  2BTF A;  1KAY A;  3KVG A;  3KZB A;  4CI6 A;  2PAV A;  5JLH A;  4BR0 A;  4BRN A;  4M7Y A;  4DQ8 A;  3A0I X;  2GUP A;  2UYT A;  3GBT A;  5B8H A; 
#chains in the Genus database with same CATH topology
 1E4F T;  4X66 K;  3O80 A;  3VQ8 A;  4JHD A;  3BF3 A;  4DFK A;  1JLA A;  3AVB A;  1X3M A;  1GLL O;  1I39 A;  4CGF A;  3NFA A;  4JYA K;  1VSM A;  1S6P A;  4Z4F A;  1KRP A;  4DSE A;  1BA1 A;  3S5T A;  2NRH A;  1J54 A;  1C6V A;  3DRR A;  4ILJ A;  3NVM A;  2O4I A;  2D0A A;  3L2W A;  4YOW A;  3DLR A;  3M8S A;  3THY A;  3UKU B;  4X62 K;  5IT9 O;  1EET A;  4B3R K;  5LMN K;  3HYF A;  3TAQ A;  1L3S A;  1J5E K;  2X78 A;  2P9K B;  1C1A A;  3OYA A;  2QWN A;  4DV2 K;  4H03 B;  4BRI A;  2HHT A;  4KO0 A;  2A41 A;  3LL3 A;  4AHV A;  1ASW A;  1U04 A;  3KK7 A;  4JV5 K;  4HCC A;  1M1K O;  3ZSQ A;  2P9L A;  4RW9 A;  1HQU A;  4Q0B A;  4PQU A;  1NK9 A;  3ALY A;  1WNS A;  3V4I A;  3CYM A;  3HP6 A;  4DHY A;  3SMS A;  3ZLJ A;  1BOT O;  2E88 A;  3OBW A;  3NCI A;  2UUB K;  5JS2 A;  3VEV A;  4WQ5 A;  2HHW A;  1OH6 A;  2G8U A;  2GUI A;  2DFH A;  1XI1 A;  5JVH L;  4RW8 A;  3CFP A;  2Y1I A;  1ZYQ A;  1P90 A;  2FBY A;  5AQM A;  5HP1 A;  1S1T A;  3MWT A;  3L0Q A;  3ULE A;  1RCH A;  4DMN A;  4DV4 K;  3OYM A;  3HPH A;  4CHQ A;  1CXQ A;  4Y1C A;  4FOE A;  3NAE A;  3MXM A;  1BA0 A;  4L3Q A;  1Q9X A;  2DY4 A;  4AHR A;  3B6O A;  3PV8 A;  4DSL A;  1BDG A;  4Z0U A;  1YI2 N;  3ULD A;  3P1G A;  4H0T B;  1DEJ A;  4M41 A;  1XNQ K;  4CJR A;  2UXC K;  3KKR A;  2DPN A;  3IFR A;  3CCE N;  4WFB L;  4DUZ K;  4JKG B;  3VQA A;  1Q81 O;  1S6Q A;  4QS7 A;  5ELZ A;  1UA1 A;  2QW9 A;  4C23 A;  4LC9 B;  3CCJ N;  4CHZ A;  4L8R B;  4DWI A;  2P9S A;  2HHS A;  3PO4 A;  3VEW A;  3KLH A;  3M8Q A;  3VQ4 A;  3FR0 A;  3OS0 A;  3VQ9 A;  5M1Q A;  2FC0 A;  4FVM A;  5AZI B;  4K41 A;  4BRL A;  2ITM A;  2O8C B;  1XMO K;  5AZJ A;  2RN2 A;  5FRN A;  1U6Z A;  5AQS A;  4E7K A;  1WOQ A;  1BQM A;  5CZ1 A;  3HM8 A;  4CCH A;  1NNE A;  1IBK K;  3AVM A;  5HRO A;  4BGA A;  2G8W A;  2E6L A;  1EQY A;  2XO7 A;  1HNW K;  1KVB A;  3M3Z A;  2GEM A;  4BC4 A;  4U67 L;  5M1K A;  1YJN N;  1BHL A;  3C65 A;  4FZY A;  3VMF B;  1BGX T;  4FLX A;  2XY6 A;  1VSL A;  2Y1J A;  4JHD B;  2PY5 A;  1YTA A;  4JKB A;  5AQK A;  3AY9 A;  1MWM A;  4FJ7 A;  3ENB A;  3K5O A;  4OPH A;  4ILH A;  3SJJ A;  3W0L A;  2A42 A;  5BRE A;  2V7Z A;  3QDK A;  3AAQ A;  3ZSY A;  4CZG A;  4B8A B;  1RT4 A;  1NJI O;  2V52 B;  3CCL N;  5MLC Q;  3THY B;  3RRH A;  5CR4 A;  1WLJ A;  1YXQ A;  1SL0 A;  4H5R A;  3RMC A;  4CJU A;  2ZJQ L;  4CF1 A;  1U4B A;  1HLU A;  1W97 L;  5F0X A;  2G8V A;  3S3M A;  1IV0 A;  1EO1 A;  4F2R A;  3OYH A;  5AQW A;  4B1W B;  4CJ5 A;  3LAM A;  1I94 K;  3FZM A;  4Y0W A;  3DRS A;  3EY1 A;  1JCE A;  2C1I A;  1ZC6 A;  4H4O A;  4JI1 K;  4XH5 A;  2WON A;  3AGK A;  3MEE A;  2P9L B;  4DTO A;  3FE1 A;  1N6Q A;  5BPM A;  4CZF A;  5SZT A;  1GLF O;  4J2E A;  4WQ5 C;  1QVF M;  4DU1 A;  4Z4G A;  3LWM A;  1HKG A;  1XC3 A;  1VAZ A;  3DOK A;  3QIN A;  3DJC A;  3WNG A;  1HNX K;  1IO2 A;  3VQ6 A;  1Q86 O;  4GV3 A;  4RW7 A;  4FWL A;  1RFQ A;  4IBN A;  1J6Z A;  2YX6 A;  3LP3 A;  2HHH K;  5T7B A;  4WYB A;  3ULE B;  3QET A;  4A5A A;  5HRP A;  2ZJP L;  1TGO A;  1RBU A;  2KQ2 A;  5AQY A;  4DQP A;  1JLB A;  3ITH A;  4YHH K;  4FO0 A;  1O1W A;  4B9Q A;  3CQY A;  4B3T K;  4DR7 K;  3AA4 A;  5HL7 L;  3D0P A;  2YKN A;  3FZH A;  1TYQ B;  3NF6 A;  2F96 A;  3VGM A;  3CJ7 A;  4JI7 K;  3AGR A;  3ENO A;  3MCA B;  3SUO A;  1VQ6 N;  3PSF A;  4NLC A;  4FXD A;  3O9U A;  4C8M A;  5AFU A;  5JLF A;  2P9S B;  1DTQ A;  5AQR A;  3OYG A;  4RW4 A;  1EKE A;  4B8C A;  1YIT N;  1Y97 A;  5EVZ A;  3THV A;  3B6P A;  3ZSV A;  1HKC A;  3VN5 A;  1W9H A;  4ID5 A;  4BDP A;  5C2D A;  4JI0 K;  3AVI A;  3LDO A;  4EP5 A;  2O8D A;  5AZJ B;  4CE9 A;  5C10 A;  2VWK A;  3E9O A;  2EWS A;  2KFZ A;  2FXU A;  4NB4 A;  3VGK A;  4FJG A;  4FZZ A;  3ISN C;  3A5M C;  3L2V A;  5TKW A;  1WSI A;  2HB5 A;  2R7Y A;  4ICL A;  3EL2 A;  3IKM A;  5ADX H;  3L3U A;  4F3T A;  3VEY A;  3V1R A;  2D0C A;  3OS1 A;  2HOE A;  4FM2 A;  2Q36 A;  4B9V A;  1N34 K;  3AVJ A;  4FOI A;  2DFE A;  2NRV A;  3F2K A;  2IVP A;  1QQM A;  4JRP A;  4FWM A;  3WUH A;  4EP4 A;  3DAW A;  1D5A A;  4YFU A;  3CFR A;  3ATV A;  3ZYY X;  4QCL A;  5AQX A;  3U3G A;  3QEV A;  4BEB A;  4B1Y B;  3WEE A;  4A5B A;  1TK8 A;  1HX1 A;  2KFN A;  4E7J A;  1SKS A;  3M8P A;  3S3N A;  4OKE A;  4OLA A;  1YUW A;  1WUA A;  4J8F A;  4FVU A;  4BQZ A;  3TWH A;  3VA0 A;  2HF4 A;  1RIL A;  3H1V X;  3MN6 A;  2ZE2 A;  3C95 A;  4Z94 A;  1BI4 B;  4E72 A;  1S1X A;  1L3U A;  3IMX A;  2G8F A;  3O3F A;  4CEC A;  4XJX A;  1A5W A;  4O4G A;  1U47 A;  1N32 K;  3IUC A;  1IKV A;  4JKC A;  3OJS A;  4DV7 K;  3SBG A;  3ENH A;  3T1Y K;  2F9W A;  3CF5 L;  3DLB A;  2HW3 A;  4OX9 K;  3AVK A;  3QIO A;  1NBW A;  4C1N I;  1QE1 A;  3LPU A;  4MO4 A;  3WXI A;  2ASM A;  3L6Q A;  5FPE A;  2PYJ A;  1B9D A;  1ESV A;  3DXK A;  4CED A;  4NLB A;  1KC8 O;  2BE2 A;  4DTR A;  2NLX A;  3D45 A;  3JSM A;  2P9N A;  5M1O A;  1BU6 O;  3TAG A;  4I9L A;  1YT3 A;  2QXF A;  2QKB A;  1QSY A;  3OYD A;  4FWN A;  2E8A A;  1L3T A;  3SPZ A;  4HTL A;  4X65 K;  1FKO A;  3CCV N;  3SI6 A;  4IG0 A;  3SBT A;  5JLH A;  1TV6 A;  2YNI A;  3G71 N;  3OVN A;  4JKA A;  4BRN A;  4M3X A;  4M7Y A;  1WN7 A;  2HVI A;  1SUQ A;  4DFP A;  5H1S Q;  3GBT A;  4E7I A;  1GLB G;  2YV0 X;  2HBL A;  1NGA A;  2HNZ A;  4LY7 A;  3H08 A;  2HNY A;  2OPQ A;  4CJS A;  4CGJ A;  4W5R A;  2HBM A;  2ZGZ A;  2IDO A;  3GL1 A;  5J2N A;  5AQG A;  3LP1 A;  1ZBS A;  4B9T A;  3IAY A;  4KHS A;  5EOY A;  3J7A P;  3SV3 A;  3B8A X;  3ZT2 A;  4JK8 A;  3K5L A;  4FZX C;  4GV6 A;  4OLB A;  2O8D B;  3HZ6 A;  4PY5 A;  5AQT A;  3HBT A;  3SQ0 A;  3K58 A;  5SWM A;  5KGW A;  3K9J A;  2FF6 A;  3P31 A;  3K59 A;  5BN8 A;  1NKE A;  4B3M K;  4KHU A;  4LSN A;  4FWQ A;  5C15 A;  3K5N A;  3DLL L;  3MDQ A;  3KKS A;  3SAH A;  3P83 D;  3G6E N;  4U7B A;  5CY4 A;  1S1V A;  2QXL A;  3CJA A;  4YNQ A;  4CW7 B;  1WSG A;  1LWE A;  1TVR A;  5DMR A;  3ZSZ A;  1NK0 A;  4KAZ A;  3VEN A;  1CLQ A;  1JLC A;  3O1W A;  3CQ8 A;  1OVY A;  1YTU A;  3SQ1 A;  2KZZ A;  3AVF A;  1T6D A;  3PSI A;  2YI1 A;  5BRH A;  1RTD A;  3WEE B;  3SCX A;  3SV4 A;  5HRS A;  1JXB A;  3FZL A;  4FWO A;  3NH0 A;  3ZCM A;  3KD1 E;  1QTM A;  2ZWH A;  1C0U A;  4IFE A;  3L2Q A;  3TAR A;  1TKZ A;  3UE5 A;  1QSL A;  4IJA A;  3VGL A;  4PWD A;  1K8A O;  3MXJ A;  3QNO A;  2CH5 A;  3UKR A;  3C6U A;  3MN5 A;  3O4Q A;  4KTQ A;  4IFY A;  2VGN A;  4BRO A;  3CM5 A;  4CVN E;  3TSU A;  4AF1 A;  1L5U A;  3OW2 M;  5JS1 A;  1JJ2 M;  1XHZ A;  4DTX A;  3HI0 A;  5AQI A;  3R8E A;  4CJE A;  4F8R A;  2IOC A;  2E1Z A;  3FZK A;  4G9Z A;  1BG3 A;  4FJK A;  5HBM A;  1S1U A;  2ATQ A;  1X9S A;  4GV9 A;  3M5R A;  1G99 A;  1TKX A;  4IOC L;  3BP8 A;  4C8L A;  3MMV A;  3M8R A;  5KPR A;  1YJW N;  3CCQ N;  1WSF A;  3OTO K;  4Z4E A;  2VGM A;  4IDH A;  1T7P A;  4XEI A;  3DXK B;  2PBD A;  2D1K A;  4CZK A;  2HHX A;  2JWK A;  3ZX2 A;  2BDP A;  1KSP A;  1X3N A;  4DG1 A;  1K9M O;  1NU0 A;  2P9N B;  4EZ9 A;  4J2A A;  4CIG A;  4CD1 A;  4E1N A;  2OZM A;  4GVE A;  4CFB A;  4A61 A;  4OO1 J;  1S5J A;  2XY8 A;  5DK5 A;  4OKK A;  5LJV A;  2P9P A;  1NJX A;  3P39 A;  4YOX A;  3PX6 A;  4HWI A;  4JEP A;  4KH4 A;  1DLO A;  4DQS A;  5AJ3 K;  1RNH A;  3H3N O;  3HOT A;  1NGB A;  4FK4 A;  1Z26 A;  1C1C A;  5KI6 A;  1D4X A;  3BF1 A;  3F9K A;  4F9O A;  2QEX N;  2I7P A;  1KVA A;  3P38 A;  4JNE A;  4TSX A;  1KXP A;  3CC7 N;  1HR0 K;  4OPJ A;  3MED A;  2VG7 A;  4BE0 A;  4DR4 K;  2IVN A;  2RKI A;  1GOB A;  1NG9 A;  4FW2 A;  1WB9 A;  4LF5 K;  4AM7 A;  4FJX A;  3HXM A;  4H0V B;  3SK3 A;  2KLA A;  2HF3 A;  4Z4H A;  2ASO A;  2NZT A;  4JI3 K;  1ZBU A;  1NGE A;  5EX5 A;  2QWQ A;  4A57 A;  2B5J A;  5CYM A;  4CJV A;  3MX5 A;  3LDS A;  2NRZ A;  2ZJR L;  3RR7 A;  3I0R A;  3VQD A;  5J2P A;  3AA5 X;  1ITG A;  1KLN A;  1HYS A;  3GG4 A;  3QIC A;  2P9U A;  4OJR A;  1Q9Y A;  4Y1D A;  3L2R A;  4E1M A;  2W40 A;  3M6G A;  1BCM A;  1X1P A;  2YHA A;  4DF4 A;  3UIQ A;  4KHQ A;  4RG8 A;  3BZC A;  3MN9 A;  3PY8 A;  1NLV A;  1UA0 A;  2GBZ A;  3E9P A;  4GKJ K;  4GNI A;  3J7Y P;  4BE1 A;  3QIP A;  3BUZ B;  3UB5 A;  3V9W A;  1N5Y A;  3QBW A;  4FJH A;  4H0Y B;  1RT2 A;  4NCG A;  3I56 N;  4FJJ A;  1A5X A;  3O9R A;  4H8K A;  3V6D A;  1GOC A;  4KFB A;  1VQN N;  4DS5 A;  2Q3S A;  3P5J A;  4EHU A;  1GLD G;  3CJB A;  2A1R A;  4CJP A;  4WFA L;  1MA9 B;  3BGR A;  2ZQB A;  3U9Z A;  3R6M A;  1MDU B;  3QEW A;  4BAC A;  4DV1 K;  1OKJ A;  3AVG A;  4BRK A;  1Z6R A;  3THW A;  3AVC A;  2VQF K;  4DQI A;  4EFH A;  4DUY K;  4LH5 A;  3KWI A;  5HRR A;  4BVO A;  3SUP A;  3KLF A;  5DM7 L;  2D0P A;  3ZT4 A;  1RBR A;  1ZBL A;  4KBO A;  3MAQ A;  3EZW A;  5HLF A;  1EWR A;  3SLC A;  1HPM A;  2HHU A;  2P5O A;  4DTN A;  3DLK A;  4IWV A;  1JLE A;  1DT9 A;  4PA1 A;  3W3D A;  1B9F A;  3VTH A;  2IIR A;  2CGK A;  3C94 A;  1RDB A;  2VG5 A;  3MN7 A;  3CJC A;  2X6N A;  4R79 A;  4IKF A;  3TSQ A;  4B1V A;  5I42 A;  1SKW A;  2P9P B;  3T7Z A;  2FSK A;  1VSI A;  2I5J A;  4Q5V A;  1QVG M;  1WAJ A;  4IEI A;  4MLE A;  4A62 A;  5AFU H;  2QWM A;  3WNH A;  3NE6 A;  3F9M A;  3EE8 A;  3OBY A;  4O0J A;  3QML A;  3VEO A;  3U8X A;  4JK9 A;  3VF6 A;  1ZBH A;  4CEA A;  1WBB A;  1XC9 A;  2DFF A;  1FK9 A;  1TUU A;  5FPM A;  5F1X A;  2WC9 A;  1TKD A;  4PKH A;  3BDP A;  3ZSX A;  4FLW A;  1DTT A;  3O4W A;  4LF6 K;  4CGI A;  3E1Y A;  4JS5 A;  3QBX A;  5C0Y A;  4BRC A;  5KPZ A;  3O8M A;  1VSD A;  3O9Q A;  5LMU K;  4OPA A;  1YAG A;  3OYB A;  4BG9 A;  3QEP A;  2YCH A;  1U48 A;  3CHW A;  1BL3 A;  2XY5 A;  4KRE A;  4BRH A;  2XY7 A;  5AQF A;  1VSE A;  4O55 A;  1SAZ A;  3OHR A;  1KVC A;  3DYA A;  3TSP A;  1DGK N;  2YNF A;  4B1U B;  3VQP A;  2Z1I A;  1NMD A;  5CE3 A;  3V9Z A;  3SUN A;  3NH2 A;  4CD3 A;  2D4W A;  2VWB A;  4JKF A;  3G10 A;  2P9U B;  4IO8 A;  3PX4 A;  3O08 A;  2OAN A;  2F8S A;  4FWR A;  3U4L A;  3LAN A;  3SQ2 A;  4H0P A;  1VQO N;  3SQ4 A;  1ILY A;  1K73 O;  1NK5 A;  3TAB A;  1S9E A;  2Q0U A;  1KFS A;  4JI5 K;  4BRE A;  3T69 A;  4E3S A;  4MLH A;  2E5L K;  4UY8 O;  1EWQ A;  3EKU A;  5FPN A;  3AA2 A;  4CK2 A;  3MK6 A;  3R1X A;  2W42 A;  4Z4I A;  4H5V A;  2A6A A;  1NGH A;  4BRG A;  5E26 A;  4X64 K;  4H5T A;  1UOC A;  5GIO A;  1SL1 A;  2PFU A;  4W5Q A;  1VSH A;  3OYE A;  3ZET A;  1KLM A;  3H1Q A;  3AA3 A;  1ZBF A;  3EKS A;  4B3S K;  5KPT A;  1D9F A;  3OYL A;  1D9D A;  1GOA A;  1REV A;  3TAP A;  3WT0 A;  1JCF A;  4J2D A;  3WNE A;  3KVG A;  4DTP A;  2D0B A;  4CI6 A;  1UWB A;  2PAV A;  4CEZ A;  3THW B;  4DS4 A;  4DKW A;  4ELT A;  3OYN A;  3A0I X;  2GUP A;  4LF8 K;  2UYT A;  1E3M A;  2P5G A;  4CFC A;  1QHT A;  3AO5 A;  4IOA L;  4BEC A;  3KLG A;  4NCB A;  1R0A A;  3ID6 A;  2QM1 A;  1T03 A;  1NK8 A;  4M3Z A;  4A2A A;  5DM6 L;  2E2P A;  5GAE P;  4YOR A;  3J8A A;  1NWK A;  1Z05 A;  4AIL C;  3RTV A;  1VQM N;  2QWP A;  4FK2 A;  1XHX A;  2RHK A;  4N5S A;  3QO9 A;  1VSK A;  4JI6 K;  4CF2 A;  3S41 A;  3O9T A;  4M3T A;  1GLE G;  5GAH P;  3WXM B;  3LZI A;  1KFD A;  4M63 C;  5KRT A;  4ZHR A;  5FRM A;  2BAN A;  3MWP A;  3C7N A;  2QTD A;  2FSJ A;  3NGY A;  4BWM A;  3K9K A;  3HVR A;  1CZA N;  3K0S A;  2BH1 A;  3K2P A;  3T3F A;  1XUP O;  3WQU A;  4C8O A;  2DTU A;  2F8T A;  1RT5 A;  4R5P A;  5JVG L;  2ASP A;  2KHO A;  5AQL A;  1GLJ O;  1B92 A;  1RBV A;  2IVO A;  5BR9 A;  1ASU A;  3OA9 A;  3VF4 A;  4DF8 A;  3SMP A;  1JLG A;  1C1B A;  3PX0 A;  4DTJ A;  4K43 A;  4KTW A;  3RMA A;  4DSJ A;  3CQX A;  2E4L A;  4DR1 K;  2E20 A;  4BRD A;  4ZTF A;  3CM6 A;  2J4R A;  2YNH A;  1T44 A;  4PL8 A;  4FPA A;  3CPE A;  3NDK A;  5D3G A;  4BRF A;  2G8H A;  5AQP A;  4E7H A;  1FJG K;  1X9J A;  4YOY A;  1WSJ A;  1MU2 A;  1BCO A;  4BR4 A;  1RT3 A;  4FM0 A;  3V9U A;  4H0O A;  2RF2 A;  4B9L A;  3G25 A;  4WF9 L;  4FL9 A;  2Q31 A;  3ZEU A;  3CC4 N;  3TAF A;  3NMU A;  1JL1 A;  4LF9 K;  2GEL A;  4HVJ A;  4K8Z A;  2G8K A;  1NK6 A;  3HSC A;  3AVL A;  4FLT A;  3MCP A;  1WSE A;  2A3Z A;  3HJF A;  4FSV A;  3VEZ A;  3AO1 A;  1EX4 A;  2GWJ A;  2WFB A;  3V9X A;  3T19 A;  1N33 K;  3FZF A;  1S22 A;  3GOI A;  3L4Q A;  2WTU A;  1VQK N;  4CEB A;  1NM1 A;  3D2F A;  3ZET B;  4DR3 K;  4DFJ A;  1HJR A;  3J80 O;  3PIO L;  2CGL A;  1C0G A;  2ZF5 O;  5EU7 A;  1IH7 A;  3CC2 N;  4DLE A;  1NGI A;  1OVQ A;  5AQJ A;  4E1J A;  4LF7 K;  4ISF A;  2VCP A;  2WOM A;  4BRP A;  4H5W A;  2G8I A;  2W6L A;  3WQT A;  2OPS A;  3BY5 A;  3RMD A;  1T6C A;  3D2E A;  4JKH A;  1FKP A;  2FLO A;  5HRN A;  3UKU A;  3EZ5 A;  1NOY A;  4DTM A;  3C6H A;  1CZB A;  3U9D A;  4I6M A;  1EP4 A;  3DWL A;  1SL2 A;  3VQ7 A;  3SPY A;  3OS2 A;  1FXX A;  5I9E B;  3LDQ A;  5AQV A;  5E41 A;  1VQ8 N;  2HHI A;  3C0B A;  3KHY A;  2YKM A;  4QS8 A;  1P8Z A;  1ASV A;  1K8K A;  2VG6 A;  1E4G T;  3EN9 A;  4BR7 A;  4C8N A;  2RE2 A;  4OKJ A;  2IC3 A;  3DLE A;  3R9P A;  2E6M A;  1W2B M;  1T05 A;  1IKX A;  4CJ4 A;  4UQG A;  5C24 A;  3I8D A;  4BY9 C;  1ATN A;  4M3R A;  3QB0 A;  3I8B A;  4V19 S;  4BC3 A;  2AJQ A;  3OYF A;  4B3O A;  1QHA A;  3TPQ A;  1LAW A;  1JLQ A;  5FDL A;  4FJI A;  3AAP A;  1U49 A;  4CEE A;  3QFU A;  4ID1 A;  4E19 A;  2P9I A;  3KIO A;  3HO1 A;  3C7N B;  3KTQ A;  2A5X A;  3ZSW A;  1RDU A;  1JCG A;  3SAF A;  3U3Y A;  4E7L A;  1VSJ A;  3NF7 A;  1QZ6 A;  1EXQ A;  4CBW A;  4YOV A;  3KJV A;  4CJF A;  4IJN A;  3C6A A;  3KD5 E;  3LAL A;  5HOO A;  3ZX3 A;  4O0I A;  3CME N;  4FLU A;  4NYN A;  3J81 O;  2QWO A;  1X9W A;  2Z1J A;  1LOT B;  4DU4 A;  5AQN A;  5FPD A;  3O3G A;  3PUF A;  1W0H A;  4CER A;  3NF9 A;  2AP1 A;  2QWR A;  4NXM K;  4OGE A;  4AM6 A;  1H1V A;  4EHT A;  4HHT A;  4KHP K;  5AQZ A;  4JD2 A;  4LFC K;  4JKG A;  3V81 A;  4FYD A;  4IO9 L;  5A2Q O;  2HHQ A;  4DV6 K;  1SV5 A;  1Y64 A;  3ZEU B;  2ZM6 K;  2VWJ A;  4O44 A;  3L4I A;  2QI2 A;  3A5N C;  1RBT A;  4AHU A;  1KTQ A;  3IG1 A;  2CGJ A;  4JRQ A;  5AZI A;  4CGG A;  1VQ4 N;  3K5M A;  4F3O A;  1YVN A;  3QLH A;  4CJW A;  3LM9 A;  3U6F A;  4DFM A;  3CCU N;  2O8F A;  2GWK A;  4ELV A;  4IOX A;  1IJJ A;  4CZJ A;  2VQE K;  1BO5 O;  1QZ5 A;  2E2Q A;  3H45 C;  3AO2 A;  3TTF A;  3D2F B;  4K42 A;  4CJK A;  4WCE L;  3HL8 A;  4CF0 A;  4CFD A;  2H3G X;  3OYK A;  4JN4 A;  2NRR A;  1RDA A;  3M1F A;  4FPB A;  4IG3 A;  4NYF A;  4W5N A;  3LP2 A;  3HP9 A;  1TKT A;  3CG7 A;  3IRX A;  2QKK A;  1RGI A;  4KI4 A;  1JL2 A;  2KZM A;  4M3Y A;  4HTU A;  4GMJ B;  4CZM A;  5LJW A;  3J7Z O;  1HNV A;  4GVM A;  4ZTJ A;  4NO7 A;  3QNN A;  4CZL A;  4KB1 A;  3QEI A;  4WQ4 A;  3OYJ A;  1RTH A;  1NMN A;  4K25 A;  3D2E B;  3HST B;  5M1P A;  3PO5 A;  1LW2 A;  2EX3 A;  3CPW M;  3A2F A;  1NGG A;  2WUS A;  4I6M B;  3QER A;  4PKG A;  4CGH A;  2V51 B;  1SS6 A;  4JKE A;  4FLY A;  3TTD A;  1KAZ A;  1BIU A;  4A59 A;  4AH9 A;  1U2V A;  1K8K B;  2I7N A;  4DSK A;  2UUC K;  3DOL A;  1LCU A;  1HJO A;  4BVP A;  1G15 A;  5KGX A;  1YIJ N;  4EIA A;  1VQ9 N;  1TL1 A;  3D6R A;  3JS6 A;  4EAH D;  3CXC M;  4J2B A;  4BGB A;  1XMQ K;  1LAV A;  4DR5 K;  3V1O A;  5F2R A;  3S9H A;  1IG9 A;  2Q97 A;  3NBP A;  3CFO A;  4CF8 A;  3V1Q A;  4BR5 A;  4B9M A;  3THX A;  3AO3 A;  1OH8 A;  1BQN A;  2P9I B;  3I0S A;  1YVU A;  4C1N K;  3RR8 A;  3H6E A;  2ZD1 A;  3JXU A;  4BRQ A;  4PHT X;  3SZ2 A;  3O5B A;  1J9A A;  1RTI A;  3UKR B;  3SNN A;  2QA4 N;  3VOV A;  3FGU A;  4BG8 A;  5GIP A;  3L8B A;  3SJH A;  1QS4 A;  2O8B A;  3TTC A;  1DKG D;  2P51 A;  1YHQ N;  3KK1 A;  3IS9 A;  4NXN K;  2F7T A;  3CCM N;  2W00 A;  4F2S A;  3PLA A;  4JI8 K;  1Z25 A;  5LL6 Z;  5AQO A;  1S1W A;  2PZS A;  4F4K A;  1RBS A;  4FCY A;  4LFB K;  4ISE A;  4I2Q A;  1TYQ A;  1Q18 A;  3E01 A;  4K8X A;  4CEQ A;  1RDW X;  3CCS N;  3PIP L;  3RSE A;  3F5T A;  5CZ2 A;  1LV5 A;  4JD2 B;  4OVL A;  3ZT0 A;  3LDN A;  4H0X B;  3VQC A;  3AO4 A;  1X9M A;  2ETJ A;  3EEQ A;  3RRG A;  4KHW A;  1KCF A;  2HMP A;  3LPT A;  1S72 N;  2XRI A;  3DM2 A;  1KAY A;  3KZB A;  2BGG A;  4FM1 A;  4LF4 K;  4DQ8 A;  4M42 A;  4JS4 A;  3CER A;  2KW4 A;  1WAF A;  1CZ9 A;  2F9T A;  1YJ9 N;  3VQB A;  4I9Q A;  4K0K K;  1BIZ A;  2O8F B;  3LWL A;  2JGU A;  3TI0 A;  3CMA N;  4B9U A;  1TL3 A;  3GDQ A;  3BEX A;  3D7E O;  1WBD A;  2E2N A;  1NKC A;  1YF5 L;  4CBU A;  4FJ5 A;  4MDA A;  4FJM A;  4YOT A;  1GLA G;  4XH1 A;  2IS3 A;  1RT6 A;  2W6K A;  2KKZ A;  1VQ7 N;  1XQS C;  2HMI A;  5I3U A;  3VQQ A;  3OYI A;  2OYQ A;  1HQE A;  2X74 A;  4MO5 A;  5J1E A;  1BIS A;  4CJT A;  1HUX A;  4WQ4 C;  2OPR A;  3CYG A;  4CEF A;  4FWS A;  4O5F A;  2Q0R A;  3DLG A;  1NOZ A;  4KV8 A;  2CH6 A;  4N47 A;  1BWF O;  1NGF A;  4CHN A;  3QEX A;  4E0D A;  1JLF A;  3VES A;  1NGD A;  4BRM A;  3R3L A;  4KKO A;  1KD1 O;  1J53 A;  4DR6 K;  5C25 A;  4BDZ A;  4KPY A;  1NJZ A;  5AQQ A;  1V4T A;  2RPI A;  1JKH A;  2FBT A;  3MEC A;  1ATR A;  2YJE A;  1BI4 A;  5KQ8 A;  4B9S A;  1U2V B;  1O13 A;  3ZT1 A;  4WFN L;  1Q8I A;  2QWL A;  5GAG P;  2WBN A;  1VQL N;  3RMB A;  3HK2 A;  4JLH A;  1N36 K;  4KI6 A;  1C0M A;  3CJ9 A;  4BR2 A;  1NK4 A;  3FLC O;  2NRW A;  2OA8 A;  2HHV A;  3THX B;  4CJQ A;  2HBJ A;  1M90 O;  4KB0 A;  5AQU A;  5BN9 A;  4DQR A;  3VER A;  3N4Q A;  3ZT3 A;  4RTF D;  2UU9 K;  3CJ1 A;  4B1X B;  4FJL A;  4DB3 A;  3I33 A;  3AAR A;  4C8K A;  4YDU A;  4LSL A;  5BPL A;  4YOU A;  1N8R O;  5LY3 A;  3A8Y A;  3CCR N;  2NRX A;  1IKW A;  2GTD A;  4A2B A;  1FW6 A;  2O8B B;  1Q82 O;  1HNZ K;  5KTQ A;  1XWL A;  3ZSR A;  4CFA A;  4DR2 K;  2Z1H A;  5CYQ A;  4FW1 A;  4N41 A;  1IKY A;  2YHW A;  3EYZ A;  2HVH A;  5JMV A;  5JEN A;  4CIF A;  3LP0 A;  5M1F A;  3NH1 A;  3A5L C;  3AVH A;  4QS9 A;  3G4S N;  2JLE A;  3RSE B;  4CHO A;  3OY9 A;  1VK0 A;  4DCH A;  1GLC G;  3SAG A;  4PUO A;  5CHI A;  3HTV A;  3NVK A;  1V4S A;  3DXM A;  5M1N A;  1Q7Y O;  5BR8 K;  1UAX A;  1D8Y A;  4M3W A;  3TR8 A;  4W5T A;  3AV9 A;  3E66 A;  1A5V A;  2D0O A;  5BRD A;  4BE2 A;  3A5O C;  4CIE A;  3F73 A;  3BZK A;  4LH4 A;  4HUE A;  1VQP N;  4JI4 K;  4M3U A;  4CF9 A;  5BPN A;  1S9G A;  4H4M A;  4GW6 A;  3O4N A;  2VYP A;  4KH6 A;  3WXK A;  1ATS A;  1C0F A;  5J2Q A;  4G1Q A;  4KHN A;  4FJ9 A;  3LZJ A;  4IDK A;  1J5O A;  1QQC A;  4HCB A;  4FJN A;  1TK0 A;  3VEX A;  1I3A A;  3RVC A;  2OTL N;  1TUY A;  2V7Y A;  4KHY A;  1LWC A;  3Q7B A;  3O6W A;  4BC2 A;  1HYZ A;  3NGI A;  1TAU A;  2W41 A;  3VQE A;  2UXD K;  2BUP A;  4IXC A;  4ELU A;  3HPG A;  1HRH A;  3FFK B;  4FWK A;  4PL7 A;  3VPZ A;  3JYT A;  2UUA K;  4DU3 A;  4OPK A;  3WXL A;  4BWJ A;  5C42 A;  1NKB A;  3AVA A;  1HYV A;  4B1Z A;  2NNW A;  2OZS A;  1L3V A;  1IBL K;  4O8U A;  3VTI A;  4IFV A;  3H3O B;  1KAX A;  2PYL A;  3EO3 A;  3KK3 A;  1QQO A;  3DMJ A;  4E89 A;  3Q7C A;  4CEO A;  4RW6 A;  2IGI A;  4IZ9 A;  1VQ5 N;  2GV9 A;  1HNI A;  2AA4 A;  4DTS A;  4FK0 A;  3CI5 A;  3OJU A;  3O9S A;  4BDY A;  1VSF A;  3VA3 A;  2FBV A;  4FWP A;  1KQS M;  3IDH A;  2E2O A;  1R59 O;  3WNF A;  4WE1 A;  3TAN A;  2OPP A;  4MFB A;  1NGC A;  5EY4 A;  1U45 A;  4CJ3 A;  5EXW A;  1SZ2 A;  3VF2 A;  4N56 A;  3ASM A;  3GE1 A;  1NJY A;  4RWT A;  4YDU C;  4QOZ B;  2Q1N A;  2A1S A;  2FF3 B;  1XNR K;  4DV5 K;  2YHX A;  4AHT A;  2OCE A;  3H46 O;  4CGD A;  4GY2 B;  4JKD A;  2UXB K;  4MDB A;  1MWK A;  1QSS A;  4AHC A;  4JAX A;  2B6A A;  1T8E A;  2O8E A;  4JK7 A;  3N4P A;  3HT3 A;  4DSF A;  4N76 A;  5J2M A;  2YJF A;  5KQD A;  3AVN A;  4EZ6 A;  3G0Z A;  3L2U A;  4BE7 B;  5FLX O;  1NJW A;  3HRG A;  3HPO A;  5GIN A;  4DQQ A;  2ITG A;  4DSI A;  2XHB A;  3T1H K;  2F4V K;  1RTJ A;  4W5O A;  4CZH A;  5IWA K;  3LM2 A;  1QQN A;  5C2F A;  5ADX A;  4CJL A;  3O1B A;  2Z1G A;  3DI6 A;  3CD6 N;  3SUQ A;  1RDD A;  3CIP A;  5C12 A;  1WSH A;  4YY3 K;  3KLE A;  4H5N A;  4O5B A;  3WXJ A;  3ATU A;  3ID8 A;  3ZX0 A;  3NHG A;  4O8K A;  3L3V A;  2E1Y A;  3TU5 A;  2A40 A;  3DXM B;  4CZI A;  3JAM O;  1RT7 A;  4B08 A;  5GAD P;  3QES A;  2LSN A;  4CK3 A;  3VET A;  4CK1 A;  4GKK K;  4CHY A;  2P9K A;  4PKI A;  2IAJ A;  4DLG A;  1LWF A;  2HND A;  1IG8 A;  3HM9 A;  1RT1 A;  3NGZ A;  4BQL A;  3SYZ A;  1JXE A;  2Q2R A;  5E84 A;  2FSN A;  1NK7 A;  1C0T A;  3I55 N;  3RWU A;  5AQH A;  1SQK A;  3VQ5 A;  4ILG B;  4CJ7 A;  4KRF A;  1RDC A;  2O4G A;  3HVT A;  1OH7 A;  3NF8 A;  1SKR A;  3KWG A;  2EHG A;  2NRT A;  5JIC A;  4QAG A;  3KK2 A;  4M7X A;  1ZBI A;  3TAE A;  1VRU A;  2P1J A;  3DLH A;  3MX2 A;  3O3H A;  4I7F A;  5AR0 A;  3E9L A;  3T1A A;  3EE9 A;  4JI2 K;  2ZGY A;  2YNG A;  3LDL A;  3QFP A;  4LFA K;  1CXU A;  4BR9 A;  4FJ8 A;  5TKY A;  3MEG A;  3LDP A;  4CBX A;  4I2P A;  2QK9 A;  3CET A;  3LAK A;  4XIU A;  4BRA A;  4FLZ A;  2FBX A;  5FRO A;  1OH5 A;  1IBM K;  4AQY K;  5K14 A;  1S3X A;  2D5R A;  1NGJ A;  3ZSO A;  4M45 A;  4KTZ A;  4XH4 A;  4RCH A;  4KH5 A;  1HKB A;  1LW0 A;  2YHY A;  3S3O A;  4BC5 A;  2YHB A;  2NUB A;  3P4I A;  4MQ3 A;  4ISG A;  3K57 A;  4DV3 K;  4HUF A;  1VHX A;  3MXI A;  3C6T A;  4B9N A;  4LD0 A;  3KLI A;  3V9S A;  1ZXO A;  3TAM A;  5KRS A;  4Z4C A;  1VRT A;  1W7A A;  4IEE A;  2O8C A;  1HMV A;  4DV0 K;  3DRP A;  2OTJ N;  2JWL A;  4CES A;  4FLV A;  4DTU A;  2HST A;  2X6S A;  4AHS A;  3HOS A;  4CHP A;  2B4J A;  2KTQ A;  2O8E B;  4CZE A;  2C1G A;  1BUP A;  3OYC A;  5BRF A;  1T3V A;  2BTF A;  4HUG A;  4NCA A;  2HBK A;  2GX9 A;  4BR0 A;  4OGC A;  1K6Y A;  1HPZ A;  3FFI A;  1TAQ A;  1TK5 A;  1F21 A;  5B8H A; 
#chains in the Genus database with same CATH homology
 1E4F T;  1GLB G;  3CER A;  1YJ9 N;  2F9T A;  2HBL A;  3O80 A;  1NGA A;  4JHD A;  3BF3 A;  4IOA L;  3CMA N;  1X3M A;  4BEC A;  1GLL O;  3GDQ A;  3BEX A;  3D7E O;  2E2N A;  2HBM A;  2QM1 A;  2ZGZ A;  1YF5 L;  3ID6 A;  3GL1 A;  4CBU A;  5AQG A;  4MDA A;  1ZBS A;  4YOT A;  1GLA G;  4XH1 A;  5EOY A;  1BA1 A;  3B8A X;  4JK8 A;  2NRH A;  4GV6 A;  3HZ6 A;  4ILJ A;  2KKZ A;  3NVM A;  4A2A A;  1VQ7 N;  1XQS C;  5DM6 L;  2E2P A;  5GAE P;  5AQT A;  3HBT A;  4YOR A;  4YOW A;  3J8A A;  3UKU B;  1NWK A;  4MO5 A;  1Z05 A;  3K9J A;  2FF6 A;  1VQM N;  2QWP A;  1HUX A;  3P31 A;  4WQ4 C;  2RHK A;  5BN8 A;  3S41 A;  3O9T A;  4FWQ A;  5C15 A;  1GLE G;  4FWS A;  4O5F A;  2Q0R A;  3MDQ A;  3WXM B;  3SAH A;  5GAH P;  3DLL L;  3G6E N;  2P9K B;  2CH6 A;  1BWF O;  1NGF A;  4U7B A;  4M63 C;  3VES A;  1NGD A;  2QWN A;  4BRM A;  4H03 B;  2QXL A;  3CJA A;  3R3L A;  4BRI A;  3MWP A;  3C7N A;  1KD1 O;  2A41 A;  2QTD A;  3LL3 A;  2FSJ A;  3K9K A;  1CZA N;  3KK7 A;  2BH1 A;  5AQQ A;  1M1K O;  1V4T A;  1XUP O;  2P9L A;  3VEN A;  3WQU A;  3O1W A;  1ATR A;  2YJE A;  5JVG L;  2ASP A;  2KHO A;  5AQL A;  1OVY A;  1GLJ O;  1T6D A;  5BR9 A;  2IVO A;  2YI1 A;  1U2V B;  5BRH A;  5KQ8 A;  3OA9 A;  3VF4 A;  3WEE B;  3SMP A;  4DHY A;  1O13 A;  4WFN L;  3FZL A;  4FWO A;  3SMS A;  1BOT O;  2E88 A;  3OBW A;  4K43 A;  2QWL A;  5GAG P;  2ZWH A;  4IFE A;  3CQX A;  2WBN A;  3VEV A;  1VQL N;  4WQ5 A;  3UE5 A;  4IJA A;  3VGL A;  1K8A O;  2CH5 A;  3UKR A;  2E20 A;  4BRD A;  3CJ9 A;  2J4R A;  1T44 A;  5JVH L;  4BR2 A;  4PL8 A;  4FPA A;  3CPE A;  3MN5 A;  3FLC O;  2NRW A;  1P90 A;  5AQM A;  2HBJ A;  2VGN A;  4BRF A;  3MWT A;  5AQP A;  3L0Q A;  3ULE A;  5AQU A;  5BN9 A;  4BRO A;  1M90 O;  3TSU A;  3VER A;  4AF1 A;  3N4Q A;  3OW2 M;  1X9J A;  4YOY A;  4RTF D;  1JJ2 M;  4BR4 A;  3CJ1 A;  4H0O A;  4B1X B;  4DB3 A;  3I33 A;  3AAR A;  4FOE A;  4YDU A;  3G25 A;  4WF9 L;  3HI0 A;  5AQI A;  3R8E A;  4YOU A;  4FL9 A;  2Q31 A;  5BPL A;  1BA0 A;  3ZEU A;  5LY3 A;  3A8Y A;  4L3Q A;  3CC4 N;  2E1Z A;  3FZK A;  3NMU A;  4G9Z A;  2GEL A;  1BG3 A;  3CCR N;  1BDG A;  2NRX A;  2GTD A;  3HSC A;  4A2B A;  1YI2 N;  4H0T B;  3MCP A;  1DEJ A;  1Q82 O;  4GV9 A;  3M5R A;  1G99 A;  4IOC L;  3BP8 A;  2A3Z A;  2DPN A;  4FSV A;  3IFR A;  3CCE N;  3MMV A;  4WFB L;  4JKG B;  5KPR A;  1Q81 O;  4QS7 A;  1YJW N;  3CCQ N;  5ELZ A;  2QW9 A;  3VEZ A;  2VGM A;  4IDH A;  4LC9 B;  4C23 A;  3CCJ N;  2GWJ A;  2WFB A;  2YHW A;  2P9S A;  3DXK B;  4XEI A;  2PBD A;  3VEW A;  2D1K A;  5JMV A;  3FZF A;  1S22 A;  4CZK A;  2JWK A;  3GOI A;  3ZX2 A;  3FR0 A;  3L4Q A;  5M1F A;  5M1Q A;  1VQK N;  3A5L C;  1NM1 A;  5AZI B;  1X3N A;  3D2F A;  4K41 A;  4QS9 A;  1K9M O;  3ZET B;  4BRL A;  3G4S N;  3RSE B;  3PIO L;  2P9N B;  2ITM A;  2CGL A;  1C0G A;  4DCH A;  1GLC G;  5AZJ A;  4CD1 A;  1U6Z A;  5AQS A;  1WOQ A;  4GVE A;  4A61 A;  4OO1 J;  3HM8 A;  3SAG A;  2ZF5 O;  5LJV A;  3HTV A;  2P9P A;  5CHI A;  3NVK A;  1V4S A;  3DXM A;  3P39 A;  3CC2 N;  4BGA A;  5M1N A;  4YOX A;  1Q7Y O;  1NGI A;  1EQY A;  4HWI A;  4JEP A;  4KH4 A;  5AQJ A;  4E1J A;  3M3Z A;  2GEM A;  4BC4 A;  3E66 A;  4ISF A;  2D0O A;  5BRD A;  2VCP A;  4BRP A;  3A5O C;  3H3N O;  4U67 L;  5M1K A;  1NGB A;  3HOT A;  1YJN N;  3C65 A;  4H5W A;  1VQP N;  3VMF B;  5BPN A;  1D4X A;  3BF1 A;  3WQT A;  1T6C A;  3D2E A;  4F9O A;  4KH6 A;  2VYP A;  4JKH A;  2FLO A;  3WXK A;  4JHD B;  3UKU A;  1ATS A;  1C0F A;  3C6H A;  4JKB A;  2I7P A;  4I6M A;  5AQK A;  3AY9 A;  3U9D A;  1MWM A;  3P38 A;  2QEX N;  4JNE A;  3DWL A;  1KXP A;  3CC7 N;  3ENB A;  4OPH A;  5I9E B;  3LDQ A;  4ILH A;  5AQV A;  1VQ8 N;  3W0L A;  2A42 A;  3C0B A;  3KHY A;  2IVN A;  2V7Z A;  3VEX A;  3RVC A;  3QDK A;  4QS8 A;  5BRE A;  1P8Z A;  1K8K A;  3AAQ A;  3EN9 A;  1E4G T;  4BR7 A;  4CZG A;  2OTL N;  2RE2 A;  1TUY A;  2V7Y A;  3R9P A;  4AM7 A;  3Q7B A;  3O6W A;  4BC2 A;  1NJI O;  2V52 B;  1W2B M;  2W41 A;  3CCL N;  5MLC Q;  4H0V B;  3SK3 A;  2KLA A;  5CR4 A;  2HF3 A;  1YXQ A;  4BY9 C;  1ATN A;  2BUP A;  4H5R A;  2ASO A;  4IXC A;  2ZJQ L;  2NZT A;  3QB0 A;  3I8B A;  4BC3 A;  1NGE A;  1HLU A;  1W97 L;  3FFK B;  4FWK A;  5EX5 A;  5F0X A;  4PL7 A;  3VPZ A;  1EO1 A;  2QWQ A;  4A57 A;  1QHA A;  3WXL A;  5AQW A;  3TPQ A;  4B1W B;  3MX5 A;  4B1Z A;  2NNW A;  2NRZ A;  2ZJR L;  3AAP A;  3FZM A;  4Y0W A;  3QFU A;  4O8U A;  3VTI A;  2P9I A;  1JCE A;  3C7N B;  2C1I A;  1ZC6 A;  2A5X A;  3SAF A;  1RDU A;  1JCG A;  1KAX A;  3GG4 A;  3H3O B;  3EO3 A;  3QIC A;  2P9U A;  1QQO A;  3AGK A;  4XH5 A;  2P9L B;  1QZ6 A;  3Q7C A;  3FE1 A;  4IZ9 A;  4CBW A;  4YOV A;  1VQ5 N;  5BPM A;  2W40 A;  2AA4 A;  3M6G A;  4CZF A;  1GLF O;  3CI5 A;  4WQ5 C;  3O9S A;  4IJN A;  1QVF M;  3C6A A;  3MN9 A;  4FWP A;  1KQS M;  1NLV A;  1HKG A;  1XC3 A;  1VAZ A;  3IDH A;  3ZX3 A;  2E2O A;  5HOO A;  1R59 O;  3E9P A;  4GNI A;  3DJC A;  3CME N;  1NGC A;  5EY4 A;  3BUZ B;  2QWO A;  5EXW A;  3UB5 A;  1LOT B;  1Q86 O;  1SZ2 A;  3VF2 A;  3QBW A;  4GV3 A;  4FWL A;  5AQN A;  5FPD A;  3GE1 A;  1RFQ A;  4H0Y B;  1J6Z A;  3I56 N;  4RWT A;  2YX6 A;  4YDU C;  3O9R A;  2AP1 A;  2Q1N A;  2QWR A;  4WYB A;  3ULE B;  4A5A A;  2FF3 B;  4AM6 A;  2ZJP L;  1H1V A;  2YHX A;  1VQN N;  4EHT A;  5AQY A;  3H46 O;  4GY2 B;  4JD2 A;  5AQZ A;  4JKG A;  4JKD A;  4MDB A;  1MWK A;  4FO0 A;  4JAX A;  4IO9 L;  4EHU A;  1GLD G;  3CJB A;  4B9Q A;  4JK7 A;  1Y64 A;  3N4P A;  3ZEU B;  4WFA L;  1MA9 B;  3CQY A;  2YJF A;  3U9Z A;  3L4I A;  5KQD A;  3R6M A;  1MDU B;  2QI2 A;  3A5N C;  5HL7 L;  2CGJ A;  1OKJ A;  3FZH A;  1TYQ B;  5AZI A;  4BRK A;  4BE7 B;  1Z6R A;  3VGM A;  3CJ7 A;  1VQ4 N;  3AGR A;  4EFH A;  3HRG A;  1YVN A;  3ENO A;  3MCA B;  5GIN A;  3KWI A;  1VQ6 N;  4BVO A;  3LM9 A;  4CZH A;  3CCU N;  5DM7 L;  4NLC A;  2D0P A;  3O9U A;  2GWK A;  3LM2 A;  4IOX A;  4KBO A;  5AFU A;  1QQN A;  1IJJ A;  5C2F A;  5JLF A;  4CZJ A;  2P9S B;  5ADX A;  5AQR A;  1BO5 O;  1QZ5 A;  3EZW A;  1YIT N;  2E2Q A;  3H45 C;  5EVZ A;  3O1B A;  3TTF A;  3SLC A;  1HKC A;  3D2F B;  4K42 A;  3CD6 N;  4WCE L;  1HPM A;  3CIP A;  4IWV A;  5C2D A;  2H3G X;  1DT9 A;  3W3D A;  3VTH A;  5C12 A;  3LDO A;  2IIR A;  2CGK A;  5AZJ B;  5C10 A;  4H5N A;  4JN4 A;  2NRR A;  3E9O A;  2EWS A;  3M1F A;  3MN7 A;  3ATU A;  3CJC A;  3ID8 A;  4FPB A;  3WXJ A;  3ZX0 A;  4R79 A;  2FXU A;  4O8K A;  4NB4 A;  3VGK A;  2E1Y A;  3TSQ A;  4B1V A;  2P9P B;  3T7Z A;  3TU5 A;  2A40 A;  1RGI A;  2FSK A;  3A5M C;  3DXM B;  4CZI A;  1QVG M;  4IEI A;  4MLE A;  5TKW A;  4A62 A;  3EL2 A;  5AFU H;  2QWM A;  3IKM A;  5GAD P;  3F9M A;  3EE8 A;  5ADX H;  3OBY A;  3QML A;  4CZM A;  3VET A;  5LJW A;  3VEO A;  3U8X A;  2P9K A;  4PKI A;  3VEY A;  3J7Z O;  4JK9 A;  4NO7 A;  3VF6 A;  2HOE A;  2Q36 A;  4CZL A;  4WQ4 A;  4FOI A;  2NRV A;  3F2K A;  4K25 A;  5M1P A;  1IG8 A;  3D2E B;  2IVP A;  1QQM A;  4FWM A;  1TUU A;  5FPM A;  3WUH A;  4BQL A;  5F1X A;  3CPW M;  3DAW A;  1NGG A;  2WUS A;  2Q2R A;  2WC9 A;  4I6M B;  4PKG A;  4PKH A;  2V51 B;  1SS6 A;  4JKE A;  5E84 A;  3TTD A;  2FSN A;  3O4W A;  1KAZ A;  3ATV A;  3ZYY X;  3I55 N;  3E1Y A;  5AQH A;  5AQX A;  4A59 A;  1SQK A;  1U2V A;  3QBX A;  4ILG B;  5C0Y A;  4BEB A;  4BRC A;  5KPZ A;  4B1Y B;  3WEE A;  4CJ7 A;  1K8K B;  2I7N A;  3O8M A;  4A5B A;  1HX1 A;  3O9Q A;  4OPA A;  3KWG A;  1LCU A;  1HJO A;  1YAG A;  2NRT A;  4BVP A;  5JIC A;  1YIJ N;  4EIA A;  1VQ9 N;  4BG9 A;  4M7X A;  3D6R A;  2YCH A;  3JS6 A;  1YUW A;  3CHW A;  4EAH D;  4BGB A;  3CXC M;  4BRH A;  1WUA A;  4J8F A;  4FVU A;  4BQZ A;  2HF4 A;  3H1V X;  5AQF A;  3MX2 A;  3MN6 A;  5F2R A;  2Q97 A;  1SAZ A;  3OHR A;  4Z94 A;  5AR0 A;  3TSP A;  4BR5 A;  1DGK N;  3E9L A;  3IMX A;  4B1U B;  3EE9 A;  2ZGY A;  3LDL A;  3QFP A;  4BR9 A;  1NMD A;  5TKY A;  4XJX A;  5CE3 A;  4CD3 A;  2D4W A;  3IUC A;  2P9I B;  4JKC A;  3LDP A;  2VWB A;  4CBX A;  4JKF A;  3CET A;  3SBG A;  4C1N K;  3ENH A;  3H6E A;  3JXU A;  4BRA A;  4BRQ A;  2P9U B;  4PHT X;  2F9W A;  3O5B A;  4IO8 A;  3CF5 L;  3UKR B;  3O08 A;  2QA4 N;  2OAN A;  3VOV A;  1NBW A;  3FGU A;  4BG8 A;  4FWR A;  3U4L A;  4C1N I;  5GIP A;  1S3X A;  4H0P A;  1VQO N;  1NGJ A;  3SJH A;  1ILY A;  1K73 O;  2Q0U A;  4MO4 A;  3TTC A;  4XH4 A;  4BRE A;  3T69 A;  4RCH A;  4KH5 A;  1HKB A;  4MLH A;  1DKG D;  2YHY A;  4BC5 A;  4UY8 O;  3EKU A;  5FPN A;  3WXI A;  2ASM A;  1YHQ N;  3MK6 A;  3R1X A;  3L6Q A;  3P4I A;  2F7T A;  4ISG A;  5FPE A;  3CCM N;  2W00 A;  3PLA A;  4H5V A;  5AQO A;  1ESV A;  2A6A A;  3DXK A;  1NGH A;  4NLB A;  4BRG A;  5E26 A;  1KC8 O;  4H5T A;  5GIO A;  2PFU A;  4ISE A;  1ZXO A;  1TYQ A;  1Q18 A;  2NLX A;  1RDW X;  3ZET A;  3H1Q A;  3CCS N;  3PIP L;  3RSE A;  2P9N A;  3EKS A;  5M1O A;  4IEE A;  3F5T A;  1BU6 O;  2OTJ N;  4JD2 B;  2JWL A;  5KPT A;  2HST A;  3LDN A;  4H0X B;  3HOS A;  4FWN A;  4CZE A;  2C1G A;  2E8A A;  2HMP A;  3WT0 A;  1JCF A;  1S72 N;  1BUP A;  5BRF A;  1T3V A;  4HTL A;  2BTF A;  3CCV N;  1N8R O;  1KAY A;  3KVG A;  3KZB A;  3SBT A;  4CI6 A;  2PAV A;  5JLH A;  2HBK A;  3G71 N;  2GX9 A;  4BR0 A;  4JKA A;  4BRN A;  4M7Y A;  4DKW A;  4DQ8 A;  3A0I X;  2GUP A;  2UYT A;  5H1S Q;  3GBT A;  5B8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...