2P9IB

Crystal structure of bovine arp2/3 complex co-crystallized with adp and crosslinked with gluteraldehyde
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
354
structure length
272
Chain Sequence
VVCDNGTGFVKCGYAGSNFPEHIFPALDDMKHLWDYTFGPLLTEPPMVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 76
structure length 272
sequence length 354
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9iB02
3.30.420.520 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9iB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9iB03
1DEJA 1JCEA 3UKUB 4EIAA 3OHRA 5KPRA 4JN4A 3LDQA 4JHDB 2Q0RA 1HKGA 3MN5A 1HPMA 1RDWX 4WYBA 3ZEUB 2ASOA 4WQ4A 3FE1A 3VEWA 1YUWA 3D2FB 4B1WB 5KQ8A 4K41A 4RWTA 2BUPA 1U2VB 2A42A 3LDPA 4FPBA 4H0VB 1NGCA 3GG4A 3UB5A 3VGKA 4CI6A 5F1XA 3ATVA 5AZIB 3O1WA 2A6AA 4FWRA 4H0OA 3O80A 4ISFA 3ID8A 5FPMA 1BOTO 1HLUA 5KQDA 1IG8A 4H5NA 1G99A 1ZC6A 3VOVA 2D1KA 1SZ2A 4JNEA 4CBXA 2Q1NA 5AZJB 5BREA 1CZAN 2DPNA 2GTDA 5AQZA 4FWPA 4QS8A 3H46O 4DB3A 3O08A 3HTVA 3KHYA 4BG8A 5LJWA 3F9MA 2GEMA 5CE3A 3FZMA 4LC9B 1K8KB 3VPZA 1LCUA 1Y64A 1GLAG 3RSEB 2GWJA 2YJFA 2P9NB 3FFKB 3FZFA 3JXUA 4H03B 5JLFA 2QWLA 4O8KA 2P9IB 4FO0A 5EX5A 3GL1A 1SAZA 4XH1A 3LDNA 3VESA 1KAZA 4CZIA 3B8AX 2CGLA 2ZWHA 3SMSA 1NGBA 3FZHA 4HWIA 5AQQA 1BDGA 4MLEA 1KAYA 3R6MA 1NMDA 3ATUA 4BQZA 1MA9B 3P4IA 3FZKA 5JICA 4H0YB 4RCHA 3DXKA 3WXKA 4PL7A 5TKYA 2Q31A 1XC3A 3VF6A 1BU6O 4KBOA 3VEYA 2P9IA 3FZLA 2A41A 3CJBA 4XEIA 3FLCO 2P9KA 4H5TA 4BRGA 4CZEA 5BRDA 5AQSA 4BC2A 4WQ5C 3L6QA 3CQYA 1Z6RA 5F2RA 2P9PB 1NGAA 3EN9A 1GLLO 2EWSA 3H45C 1H1VA 2QWMA 3VEXA 1NGDA 3AAQA 3LM9A 3VERA 2E1YA 3LDLA 5AR0A 1JCFA 3L0QA 5BPNA 3UKRB 5BRFA 3ZX2A 3BUZB 1X9JA 1HUXA 3TPQA 2P9LB 3L4IA 1C0GA 3C0BA 4BR0A 3VEZA 3W3DA 4BRFA 3WXLA 5E26A 1X3MA 4FOIA 2QWOA 1TYQA 3IMXA 4ISEA 4ISGA 3VF4A 3J8AA 2V51B 2Q36A 2P9SA 3DJCA 5AQYA 4DCHA 5BN8A 3H1VX 4FPAA 1NGGA 4A62A 1TUUA 5KPZA 3H3NO 4FWMA 4AM6A 2GELA 1IJJA 2WUSA 2YHXA 3CI5A 4M7YA 4M7XA 2A40A 2CGJA 2NLXA 3LDOA 4IZ9A 2BTFA 5FPNA 5LJVA 2E20A 3R9PA 3CJ9A 4MO5A 4PKHA 4YDUC 3QBWA 3SMPA 4F9OA 3SJHA 4BROA 4MO4A 5EXWA 4EHUA 2V7ZA 1NGFA 2E2OA 2YHWA 3BF3A 3ZETB 4FSVA 2IVPA 2VWBA 3CJ7A 1WUAA 3FGUA 5AFUH 3MK6A 4YDUA 3WEEA 3IDHA 3VEOA 4BRIA 3GOIA 4CZMA 3IUCA 3MN7A 2IVOA 1GLBG 2Q2RA 1ZBSA 3EKUA 1NGHA 3WUHA 5JMVA 3JS6A 1T6DA 3BP8A 5AQLA 2ASPA 5BPMA 3HM8A 3ZETA 4CD3A 3U4LA 4BR9A 4K43A 4BVPA 2I7NA 3D2EA 2QW9A 4B1XB 4BC3A 4DQ8A 4CZFA 3CERA 4K42A 4E1JA 2Q0UA 4BR2A 4IWVA 3R8EA 4CZKA 4FWNA 2HOEA 3HSCA 4O5FA 4A61A 5KPTA 2E8AA 2Q97A 4H5RA 4Y0WA 3S41A 1X3NA 3DXKB 3A5MC 1DKGD 3QFUA 2V52B 5AFUA 2A3ZA 4FWQA 3CQXA 2P9KB 1DGKN 2HF4A 4H5VA 3WXIA 3ENHA 3WXJA 1EQYA 1V4TA 3AARA 2ASMA 4PL8A 3I8BA 4H0PA 3MMVA 5AQHA 2CGKA 1JCGA 4EFHA 3IFRA 3KZBA 4NO7A 4PKGA 1NGEA 1ATSA 3CETA 3GE1A 3MN9A 2HMPA 1TUYA 1ATNA 4CD1A 5AQKA 4BREA 3CJAA 2FSNA 3O1BA 4BRPA 3QBXA 5FPEA 3QMLA 4XH4A 4A2BA 3WQUA 4BRKA 4I6MA 4NB4A 3AAPA 4BRDA 1TYQB 3MDQA 1ZXOA 1BG3A 2E2NA 2P9SB 5AQUA 5AQGA 4XH5A 4WQ5A 4FOEA 1YAGA 5AQIA 4DHYA 3BF1A 3U8XA 3EO3A 4CZJA 3O8MA 1BWFO 4BRCA 3MCPA 3VGMA 2F9WA 2NZTA 1YXQA 1QZ5A 3A0IX 3D7EO 2UYTA 2W40A 2FSKA 4BR4A 2AA4A 4B1VA 5ELZA 1E4GT 1ESVA 3VENA 1GLJO 1T6CA 3I33A 4L3QA 2FF3B 5E84A 2ZF5O 3C7NA 3EZWA 1NGJA 1QQOA 1BA1A 1QHAA 1J6ZA 4CBWA 2QWNA 1Z05A 1BO5O 1KXPA 2E88A 2KHOA 4BQLA 5F0XA 3BEXA 3WEEB 4FWKA 1E4FT 4BRQA 4QS7A 3U9DA 4BRNA 3DXMA 2GWKA 3G25A 1HJOA 3ULEA 3O4WA 4IXCA 1HKBA 2P9UA 1KAXA 1GLDG 2E2PA 3FR0A 3H3OB 3A5NC 4B9QA 4K25A 2NRHA 1QQMA 4BRMA 2D4WA 3WQTA 4H5WA 3M1FA 2FF6A 4M63C 3GBTA 4BGBA 2ITMA 3D2EB 3DAWA 2AP1A 5AQXA 2YI1A 2VYPA 4WQ4C 3HI0A 3VGLA 4H0TB 4JD2B 4CZGA 1SQKA 3UE5A 4BGAA 1GLEG 1NGIA 5LY3A 4A2AA 3DWLA 1MWKA 1XQSC 2FLOA 3A5LC 1MDUB 3EL2A 2A5XA 3GDQA 1MWMA 3M3ZA 3CIPA 1U6ZA 4Z94A 4JD2A 1S22A 2HF3A 5BRHA 3UKUA 4GNIA 4BRHA 4H0XB 1NLVA 5FPDA 4BVOA 3HBTA 4HTLA 4JHDA 3O6WA 5I9EB 3H1QA 5AQJA 3ZEUA 4FWOA 2FSJA 3D2FA 3M6GA 3SK3A 4FL9A 3WT0A 3TU5A 4BG9A 5AQFA 4CZLA 1U2VA 1RGIA 5BPLA 3U9ZA 1XUPO 2W41A 4B1YB 1GLFO 1QZ6A 5AZIA 5EVZA 3EKSA 2IVNA 3W0LA 4I6MB 1YVNA 2CH6A 2ZGZA 3ENOA 4BC5A 2J4RA 1HX1A 2I7PA 3VETA 4IJAA 4BR5A 2QWQA 1V4SA 1GLCG 3A5OC 4AM7A 5AZJA 3QDKA 1RFQA 3H6EA 5AQWA 2H3GX 3HZ6A 3A8YA 1K8KA 3KVGA 2PBDA 4B1ZA 4IJNA 5AQMA 4CBUA 5B8HA 3RSEA 1NM1A 1D4XA 2P9NA 3LL3A 2PAVA 3SLCA 3C7NB 1S3XA 2QXLA 2YCHA 4BRLA 3VF2A 3ZX3A 1HKCA 2CH5A 3VEVA 2GUPA 2E1ZA 1OKJA 1WOQA 1NBWA 3QFPA 5AQRA 4QS9A 1C0FA 5ADXH 3DXMB 3ULEB 5AQOA 1NWKA 2QWRA 5AQNA 4CJ7A 5AQVA 4PKIA 2P9UB 4EAHD 2QWPA 4GY2B 5JLHA 2VCPA 3ZX0A 2OANA 2D0PA 2YHYA 3LM2A 4BRAA 3CHWA 4IO8A 2IIRA 2P9PA 4BC4A 2FXUA 3QICA 5BN9A 4FWLA 2E2QA 2D0OA 2ZGYA 4J8FA 5EOYA 3MN6A 4B1UB 1T44A 3AY9A 1BUPA 1BA0A 4RTFD 5EY4A 2F9TA 1R59O 3CJ1A 3O5BA 4BR7A 1LOTB 4FWSA 3UKRA 1Q18A 2QM1A 1ATRA 2V7YA 4EHTA 5BR9A 1P8ZA 4MLHA 4CZHA 3QB0A 5ADXA 5AQTA 4JAXA 1QQNA 2P9LA 2YJEA 3CJCA 4C23A 5AQPA
chains in the Genus database with same CATH superfamily
1DEJA 1KVAA 1JCEA 3UKUB 3VQDA 3NCIA 1XHZA 3CYGA 2W00A 4CFAA 1Z25A 4FYDA 1HYSA 1K8AO 4YOUA 3ZSZA 3THXB 4WYBA 3ZEUB 4A5AA 1ASUA 4O4GA 1RT6A 4OKKA 2D0AA 4IFYA 5AZIB 3QEXA 2W6LA 1VQ9N 5GADP 1NK4A 3ID8A 3VQQA 3QEPA 5CYMA 1IG8A 2QA4N 3PY8A 4FLYA 1A5WA 4Z4EA 4CK1A 1LWCA 3V1QA 1NJXA 5AQZA 1RTJA 2D0BA 4F3TA 5T7BA 4BY9C 3K9KA 3HTVA 2IC3A 3KHYA 3LP0A 2GEMA 3NMUA 1BGXT 1VK0A 3FZMA 3O4NA 1W97L 4DSKA 3M8SA 3VPZA 1LCUA 1GLAG 4FLWA 3JXUA 5FDLA 3AGRA 4E7HA 4DQSA 2HHVA 4O8KA 4DV0K 5JS2A 4AF1A 3R1XA 3GL1A 2P1JA 4FJGA 1RTDA 4CZIA 3SQ1A 2UUAK 2CGLA 2ZWHA 3FZHA 5AQQA 4DR7K 1BDGA 4DTSA 2HHTA 1XC9A 1TL3A 4KH4A 3R6MA 4BQZA 5JICA 1MA9B 3P4IA 3FZKA 3MEGA 4RCHA 2I5JA 5TKYA 3ASMA 4F4KA 3K5NA 4KBOA 4YOTA 4I2PA 4FCYA 3CJBA 4DV2K 4R79A 1VQPN 2HBKA 4BC2A 3E9LA 3C95A 3L2QA 1T3VA 2HBLA 4DR6K 3EN9A 4JEPA 4I9QA 1NKCA 3VEXA 3KTQA 1NGDA 4FW2A 1HQUA 3LM9A 5D3GA 3VERA 3ZT4A 3LDLA 5AR0A 4W5QA 3T7ZA 3L0QA 1VSJA 5BRFA 4FM1A 3ZX2A 1ASWA 1LWEA 3BUZB 2PFUA 1RT5A 1HUXA 3P83D 1N34K 2XY8A 2P9LB 3L4IA 1C0GA 3C0BA 4B9TA 3HO1A 3W3DA 4DUZK 4FLZA 3H08A 5E26A 1X3MA 3NGZA 4JS5A 1TYQA 4ISGA 1OH5A 3PO5A 5AQYA 1VSMA 2JWLA 4DCHA 1NU0A 1XI1A 4FPAA 1TUUA 3KJVA 1RTHA 4XJXA 4AM6A 3L3UA 1KRPA 1L3SA 1VHXA 4FJ8A 3LP3A 2HHUA 4KTWA 2NLXA 4J2AA 2BTFA 4WFNL 3CCEN 5FPNA 3DMJA 5LJVA 4CEBA 4B3OA 4MO5A 4J2EA 4YDUC 1U49A 3QBWA 3V6DA 3RTVA 5I3UA 2JLEA 4AHCA 5M1KA 1YHQN 4B3SK 2V7ZA 3BF3A 3D45A 3MK6A 3CC7N 3HL8A 5HP1A 3THYA 1S9EA 1O13A 3NH1A 3IUCA 4FJHA 3T19A 3NAEA 4HTUA 1SL1A 1IKYA 3MXJA 3JS6A 4GVEA 1YITN 4CGIA 3VA0A 4MDBA 1B9DA 4DQ8A 1Z26A 2Q0UA 1SKSA 4BE0A 4FWNA 4O5FA 1X3NA 2HHQA 4WE1A 4FJXA 2A3ZA 3DLLL 5CZ1A 1JLCA 3E9PA 4DFPA 4A59A 1M1KO 4ELVA 1V4TA 3HXMA 5K14A 4H0PA 4C8MA 5AQHA 4B9SA 4PKGA 1NGEA 4CE9A 3CETA 3GE1A 2B6AA 4NLCA 4CF2A 5AJ3K 4N76A 4IOCL 1EX4A 5DM6L 4CJTA 3V9WA 1TUYA 1Q86O 4CD1A 3SNNA 4DF8A 2F4VK 3O1BA 4LFCK 1ZBFA 4O5BA 3KD1E 5FPEA 3ISNC 3WQUA 2G8HA 4NB4A 1UAXA 1MU2A 4IG0A 4HUEA 4M3UA 1VQ6N 5AQGA 4WQ5A 3PSFA 4ILGB 3K9JA 5A2QO 1L3VA 3RR7A 3KLGA 4IOXA 1NK0A 1BWFO 4JKAA 4O0JA 4PWDA 2Y1IA 3MCPA 1NK6A 3C6TA 4J2DA 4FLUA 3TANA 2VGNA 3BDPA 1FKOA 3R3LA 1RBSA 3D7EO 5C0YA 2W40A 4BR4A 4KV8A 5ELZA 1OVYA 3SUPA 1GLJO 3G71N 4YHHK 3U3YA 4LFBK 4DV7K 3J7AP 1NNEA 3C7NA 3OS2A 1QQOA 2WBNA 4DKWA 1QHAA 3AO2A 4G9ZA 3CM6A 4IG3A 3VQ8A 1BO5O 2KHOA 5F0XA 3WEEB 4O8UA 4M42A 3CFRA 3TTCA 2ZJQL 4BRNA 3OVNA 3G25A 1I3AA 3SV3A 4C8KA 2E2PA 1GLDG 2D4WA 3WQTA 4CEZA 2IOCA 1YIJN 4DSJA 4K8ZA 4CF9A 3A2FA 3O9SA 2ITMA 3DAWA 2NNWA 3CCQN 2VYPA 3G10A 3HI0A 1VSHA 3V9XA 3RRGA 3P31A 1TKZA 4B9VA 5KRSA 4DTXA 1Q9YA 1VQ4N 1KVCA 3A5LC 4W5RA 4DV5K 2A5XA 4O44A 3CYMA 4FJ9A 4DFMA 2G8WA 4KPYA 1RDAA 3OYBA 2HF3A 3UKUA 2HHWA 1T05A 1NLVA 3AO4A 1LV5A 5FPDA 3HP6A 3O6WA 3DYAA 3THXA 5I9EB 3SPYA 4O0IA 3ZEUA 2C1IA 1U48A 1JLBA 1WSGA 3TU5A 3KLIA 2WOMA 1RGIA 1M90O 3U9ZA 4K0KK 3PX0A 4OPHA 1GLFO 1CZ9A 2JGUA 2PYLA 4DLGA 5AZIA 3S3MA 4OO1J 2IVNA 3W0LA 4I6MB 4BE7B 3ENOA 1XNQK 1W0HA 4JRPA 2QWQA 1NK9A 4MQ3A 3J7YP 2OPSA 4AM7A 4ELTA 1QS4A 4CJKA 3SAGA 3QDKA 3H6EA 4E19A 2B5JA 1LAWA 3AVKA 1TKTA 3A8YA 3DLKA 3KVGA 2PBDA 5GAEP 3JAMO 4YOYA 3NH2A 1ZBHA 4CBUA 1QVGM 4CECA 1Y97A 5M1PA 3WNGA 1D4XA 3OYGA 2PAVA 4BRLA 4M3RA 2IAJA 1DTQA 3MECA 1SKWA 1WOQA 4JKBA 2RE2A 1NBWA 2O8DB 4KTQA 1RT4A 5AQRA 4DSLA 1C0FA 1ILYA 3SQ0A 4JKGB 4OVLA 4PKIA 4RW6A 5AQVA 1KQSM 1RDCA 4EAHD 3HPGA 4GY2B 5JLHA 4CJWA 1QSSA 3AA2A 3SCXA 3V9UA 2YHYA 4X65K 2QTDA 3CHWA 1TK5A 1QSYA 2YKNA 4BC4A 2VG5A 5EOYA 2E2QA 4J8FA 3MN6A 3AY9A 4M3WA 2X78A 5KI6A 4M3XA 2OPRA 4GKKK 2HNYA 4B3TK 3SPZA 1ATRA 4EHTA 4YOXA 5GAHP 4CZHA 3C94A 3RMCA 3AVJA 3OYNA 3BY5A 1QQNA 2P9LA 4FJKA 2ZJRL 4FLTA 3SUQA 2VQEK 4EIAA 5KPRA 2QK9A 3SUOA 2RKIA 3LDQA 2Q3SA 3L4QA 3KWGA 3MN5A 3RRHA 1RDWX 3I0SA 3MX5A 4M41A 3QEIA 4K41A 4RWTA 4FJ5A 1U2VB 4Q5VA 1WSEA 4DR1K 3LDPA 4H0VB 4F3OA 4CI6A 2UU9K 4H0OA 5HLFA 4PHTX 1BOTO 2HB5A 5KQDA 4DUYK 4F2RA 1G99A 1VSDA 1SZ2A 4JNEA 3CPWM 1NJYA 2KZZA 2DPNA 2GTDA 3EE8A 4QS8A 1VQLN 4DB3A 4LF8K 5LJWA 1K8KB 1C0TA 4E7IA 3V1OA 4CIEA 4DV6K 2GWJA 2YJFA 4Z0UA 3FFKB 3FZFA 2QWLA 2P9IB 3DRPA 4JKFA 3D0PA 1DT9A 2KLAA 4CFBA 3PIOL 3AVIA 4ILJA 4B9LA 4H4OA 1J5OA 1KAZA 4FJNA 4JKHA 3LP2A 4HWIA 4MLEA 3VQ4A 3KWIA 3M8QA 1NMDA 3ATUA 4E1MA 4LF9K 1RDDA 3S3OA 3VF6A 4KRFA 3VTHA 1JLEA 1L3TA 3G6EN 4XEIA 3ZSXA 2O4GA 1VSEA 4BRGA 4CZEA 4IFEA 5AQSA 1X9SA 3P5JA 3L6QA 1Z6RA 5F2RA 3FFIA 2P9PB 3RMDA 1NGAA 5C2FA 4CHQA 1TAQA 1D9DA 4DQQA 1YI2N 1UA1A 1QQCA 4KI4A 3UKRB 3OYAA 4CIGA 4KAZA 3TPQA 1OH6A 5C12A 4NXNK 2HHXA 4OLBA 4IDKA 4JI3K 3V9SA 3QEVA 1U04A 4FOIA 1TAUA 3VF4A 1IKVA 3J8AA 2Q36A 3DJCA 3H1VX 1TVRA 4A62A 4DU3A 2VGMA 4FWMA 2GELA 3K5LA 2YHXA 2WUSA 5BR8K 4JKDA 4M7XA 5HRPA 3TWHA 1K6YA 4IZ9A 5M1FA 3LAMA 4KTZA 3KLEA 4KH6A 3R9PA 3CJ9A 1S1VA 3LDSA 3SJHA 4EP4A 1FK9A 3N4PA 4MO4A 4B3MK 4CFCA 2E2OA 4E7KA 4FVUA 2IVPA 3QNOA 4ZTFA 1ZBUA 4YDUA 5M1QA 3WEEA 3AV9A 3OJUA 3VEOA 1VQ5N 4OKJA 4C1NI 4CZMA 4OLAA 4GV3A 4JS4A 2F8TA 3U6FA 1GLBG 4DV3K 1S9GA 3NFAA 3EKUA 3WUHA 1GOAA 1T6DA 2YHAA 5AQLA 5BPMA 3ZETA 3U4LA 4BR9A 4BVPA 2KZMA 2FBXA 4ICLA 2NRZA 4CJLA 3K5MA 4JI2K 4ID1A 4BC3A 2RPIA 3CERA 4K42A 4E1JA 1KC8O 4BR2A 1J9AA 3O3HA 3NF7A 1C1BA 4IO9L 4CZKA 3HSCA 5KPTA 2E8AA 2Q97A 4Y0WA 1D9FA 1YT3A 3S41A 3DXKB 3A5MC 3ZT1A 1ASVA 3QFUA 1NK5A 3CC2N 5FRMA 4KFBA 2V52B 3ALYA 4FM0A 3I8DA 1Q82O 3NGIA 4RW7A 2ZE2A 5CY4A 3ENHA 1C0MA 3WXJA 1NOYA 4OPAA 4PL8A 4LF6K 4Z4IA 4JV5K 4BEBA 4EFHA 2HHSA 3IFRA 1BQMA 1JL2A 2BDPA 4E3SA 4JI0K 1ATSA 1WLJA 2VG7A 3AVLA 3MN9A 1BISA 2WC9A 3TSPA 1ATNA 1HRHA 3KK3A 5AQKA 4BREA 4YOVA 2OTLN 2G8KA 3QNNA 4YY3K 4BRPA 3QBXA 3VQCA 3QMLA 3VMFB 4XH4A 3J80O 4I6MA 1VAZA 3RWUA 4CHOA 1HPZA 3TAMA 1E3MA 4DTJA 1QTMA 3O9QA 5AQUA 2XHBA 3TABA 3BGRA 4JI4K 1NJZA 4FOEA 4KHNA 5AQIA 1IBKK 4EP5A 3O8MA 1XMQK 4JI7K 3NF9A 2XY5A 4DSFA 3CCUN 1YXQA 3NBPA 4JI5K 3AA5X 2FSKA 2AA4A 3TSUA 4B1VA 1E4GT 1ESVA 4L3QA 1X1PA 3S3NA 3CF5L 1HNIA 1UOCA 3EY1A 4CBWA 4PQUA 1Z05A 2Z1IA 3VQBA 1KXPA 2O8DA 4HCCA 5DK5A 1E4FT 5GINA 3S9HA 2KQ2A 1BCOA 1Q81O 4BRQA 1RBUA 1N5YA 4IXCA 3OBYA 1HKBA 3H3OB 4B9QA 4K25A 2NRHA 1QQMA 1VRUA 3N4QA 4H5WA 3LANA 4CGHA 2FF6A 5C25A 3GBTA 3ID6A 2WONA 5AQXA 4LSLA 2PY5A 5C24A 4KB0A 3QERA 3VGLA 4JD2B 1EETA 4NCBA 3KKSA 3OS1A 1GLEG 5LY3A 3HOSA 1XQSC 2FLOA 1BIUA 1HJRA 4DQPA 1WBBA 3EL2A 4LH4A 4DTPA 3OYFA 2OZMA 3HPOA 3OW2M 4IEIA 1J5EK 3PLAA 4Z94A 1T8EA 4K8XA 4JI1K 4CHNA 4AHUA 5BRHA 4GNIA 1JLAA 4Z4FA 3ZT2A 2YNGA 2XY7A 4I9LA 4FWOA 3WT0A 3CCMN 3WXMB 4N56A 4CZLA 1U2VA 1XUPO 4IEEA 2W41A 1KFDA 1HR0K 1JXEA 1L3UA 3OBWA 1S72N 2W42A 1W7AA 4IJAA 3I0RA 3F9KA 4AHSA 1WAFA 1N33K 1GLCG 1KVBA 3AO3A 3OYIA 3O9TA 2HHIA 1I39A 3MXIA 4PY5A 4C8LA 5HROA 1K8KA 1S6PA 1VQMN 1T03A 4IJNA 1NM1A 4IBNA 4JKEA 3OA9A 4WF9L 4A57A 3RR8A 2YCHA 3ZSRA 3VF2A 1OKJA 1ZBIA 3J7ZO 3OYMA 3QFPA 1IKWA 1W9HA 3WNEA 3PO4A 2LSNA 5C2DA 3DXMB 3ULEB 4FLXA 4CJ7A 5HRNA 3OYDA 2QWPA 2GV9A 1F21A 4CIFA 4JI6K 1BI4B 1IV0A 3LM2A 4JK8A 4IO8A 4KH5A 4LF7K 2IIRA 3CXCM 2P9PA 4CEEA 2FXUA 3AVNA 2ZGYA 3NGYA 3QIOA 3ZLJA 5EY4A 3CJ1A 1R59O 1RBVA 3O5BA 2XO7A 1LOTB 3RMBA 3UKRA 1Q18A 2QM1A 4N41A 3ZT0A 5BR9A 3VTIA 2OZSA 3QB0A 2O8BB 5GIOA 4LSNA 1IKXA 2NUBA 1A5VA 3Q7BA 3C65A 1S1XA 1IG9A 3CJCA 4C23A 5M1OA 5JVGL 4JN4A 4CJ5A 1IBMK 3K2PA 4FZXC 4JHDB 5KTQA 2Q0RA 1XMOK 1HPMA 4CW7B 3K59A 1C0UA 4E89A 4WQ4A 1YUWA 4B1WB 5KQ8A 5GIPA 5LMUK 2BUPA 1YJ9N 3KLFA 4C8NA 4AHTA 3K58A 2D0CA 4FPBA 1NGCA 1RT2A 3VGKA 5F1XA 4DR4K 4Z4GA 2A1RA 3QEWA 4DU4A 2A6AA 2BH1A 3TAGA 4CJFA 3C6AA 1EKEA 3MWTA 4LF5K 4H5NA 1ZC6A 3OTOK 3VQEA 4BWJA 1HYVA 3TTFA 1S1TA 2Q1NA 1N8RO 3K0SA 2PZSA 1LWFA 3H46O 5J2QA 4F2SA 1SUQA 3F9MA 5CE3A 4LC9B 4M3TA 1Y64A 3IRXA 3RSEB 5CR4A 2P9NB 4JLHA 4YFUA 1FJGK 3CPEA 1FXXA 3AA4A 5JLFA 4FO0A 1B9FA 3EEQA 5EX5A 1LW2A 5IT9O 4XH1A 2O8CB 1EWRA 2X6NA 3LDNA 4FJMA 3B8AX 1NJIO 3SMSA 3ULDA 3HJFA 1A5XA 1J54A 4JKCA 4H0YB 3DXKA 2G8VA 4PL7A 3V1RA 4ZTJA 2Q31A 1BL3A 1XC3A 1UA0A 4F8RA 1BU6O 3VEYA 2A41A 4Z4CA 1CLQA 4H5TA 4WQ5C 2KFZA 3SI6A 1VSIA 3EZ5A 4CERA 1H1VA 2QWMA 3AAQA 2E1YA 4HUFA 3ENBA 1JCFA 3KD5E 4DF4A 3NHGA 4N47A 4B9UA 4IKFA 3U3GA 4NCAA 1TGOA 3KKRA 4LH5A 3CCJN 3VEZA 4BRFA 3NH0A 4TSXA 3LZJA 2DFHA 2QWOA 2V51B 4OJRA 3L2VA 4W5OA 5BN8A 2Y1JA 4BACA 2YV0X 4NCGA 1NGGA 5KPZA 1VQNN 3H3NO 2KTQA 1WN7A 3CI5A 4GMJB 4M7YA 1S1UA 1DLOA 1TK0A 1RILA 3LDOA 2E6MA 3NVMA 1KD1O 1XHXA 3AA3A 5H1SQ 3MWPA 4F9OA 3TAFA 4BROA 2E4LA 1JJ2M 4EHUA 2YHWA 3EE9A 3D6RA 4FSVA 2HMIA 2VWBA 1O1WA 2RN2A 3CJ7A 3IS9A 3FGUA 5AFUH 4CGJA 4JK9A 2XRIA 3CCRN 3TTDA 4DSEA 1C1CA 2OCEA 3AVMA 2X6SA 2Q2RA 1ZBSA 4CEAA 3SJJA 2YX6A 3HOTA 4AQYK 2ASPA 4AHVA 1YVUA 4X62K 2QW9A 4B1XB 4Y1CA 3T69A 4CZFA 2IDOA 1JLQA 3THWB 3SQ4A 3L3VA 2ETJA 4A61A 2G8UA 2Z1JA 1D8YA 4BWMA 4KHYA 1DKGD 4FZZA 2ATQA 3T1HK 1FW6A 5AFUA 4E7JA 4LY7A 4FWQA 3L2RA 2VQFK 2P9KB 3C6HA 3WXIA 4FJIA 4DV1K 3AVGA 4ID5A 4DQIA 1GOBA 3MMVA 3O9RA 2CGKA 1I94K 1YTAA 2GX9A 3CQ8A 1Q7YO 2F96A 4AILC 3AVCA 1KLNA 4IDHA 2RF2A 3OY9A 4A2BA 4BRKA 1HMVA 4GKJK 3DI6A 2ZD1A 2XY6A 2E2NA 2P9SB 2QKKA 4XH5A 1WB9A 1YAGA 4FM2A 4DHYA 3PSIA 4CZJA 4DTUA 5J1EA 3UIQA 4BRCA 2OTJN 3CD6N 3VGMA 3NF8A 1JLFA 4BDYA 5LL6Z 1QHTA 2NZTA 2O4IA 1WAJA 1NKEA 4CGGA 3B6OA 2UYTA 4YOWA 2EX3A 3IAYA 2HHHK 3VENA 1T6CA 4L8RB 3CG7A 1WNSA 1X9WA 3VQ7A 3CM5A 3EZWA 3F2KA 4GW6A 1KLMA 1BA1A 3KIOA 4BDZA 1RDUA 4I2QA 1VSLA 2QWNA 2E88A 1YJWN 3BEXA 3DLEA 4FWKA 4E1NA 1WSFA 3U9DA 1NMNA 2HNZA 3PX4A 3DXMA 2GWKA 3ULEA 4DS4A 4E72A 3MCAB 3SBGA 4CJSA 1KAXA 3FR0A 3SZ2A 2X74A 4BRMA 4HCBA 3DLBA 3P1GA 3DRRA 3OYKA 3I56N 3QETA 1BI4A 2DFFA 3D2EB 4CESA 1Q8IA 5CZ2A 2QEXN 5E41A 2YI1A 4MFBA 4HHTA 4DFJA 3C6UA 5HOOA 3L8BA 3F73A 1NGIA 5JS1A 1MWKA 4OKEA 3PX6A 4PUOA 3AVBA 1S6QA 3LAKA 5I42A 3JYTA 3V81A 3M3ZA 1MWMA 3NVKA 3B6PA 2O8BA 3CIPA 4FK2A 4Z4HA 4RG8A 1RNHA 3JSMA 3M5RA 1S22A 2ZM6K 4LFAK 2D5RA 4BRHA 4CEDA 3E01A 2VG6A 3HBTA 4JHDA 3VQ6A 4JYAK 3H1QA 1EO1A 5AQJA 5FROA 3ZSVA 2FSJA 1G15A 3SK3A 4FL9A 3KK2A 4UY8O 3SAHA 5AQFA 5BPLA 3THVA 3VQ5A 4B1YB 1R0AA 1QZ6A 2O8FB 1HYZA 1BHLA 5M1NA 1YVNA 2CH6A 2UXDK 3OYCA 4BC5A 2J4RA 1HX1A 2I7PA 3DLGA 3VETA 4BR5A 3O4QA 1V4SA 3KK1A 2UXBK 3E9OA 4M3YA 3IG1A 4M45A 4KHSA 2OPPA 2FBVA 4BE2A 3BZCA 1NOZA 3J81O 3T1YK 4B1ZA 2UUCK 5AQMA 5B8HA 3HM9A 5DMRA 3PV8A 3CFOA 3RSEA 2P9NA 3LL3A 2QKBA 4CHPA 1VQKN 3SLCA 3VA3A 2O8CA 2OYQA 1HKCA 1SS6A 2CH5A 5J2PA 2E1ZA 1JKHA 1BQNA 1SL2A 2DTUA 3TSQA 4QS9A 1TL1A 4CJ4A 3SUNA 3NF6A 2O8EB 1NWKA 3ZCMA 2QWRA 5AQNA 2ITGA 2P9UB 3WNFA 3CCLN 2VCPA 3ZX0A 3BZKA 2OANA 1TKXA 2D0PA 5HL7L 4IOAL 3LWMA 2F7TA 1UWBA 4B08A 4FXDA 3QICA 5BN9A 2D0OA 3HK2A 4B1UB 1P90A 1T44A 3EYZA 3CCSN 3HVRA 4AHRA 4JKGA 4DR5K 4RTFD 4BR7A 4CGFA 3AVFA 3DOKA 2UUBK 1YJNN 1EWQA 5HRSA 2E5LK 1W2BM 4GV6A 3HYFA 2BE2A 4MLHA 2FBTA 3OYHA 4FJJA 2R7YA 4JAXA 5AQPA 4RW9A 2W6KA 4FJ7A 3OHRA 4V19S 1EXQA 3PIPL 3ZYYX 1HNWK 2HW3A 1HKGA 1JL1A 3SV4A 2IS3A 2ASOA 1OVQA 3FE1A 3D2FB 3VEWA 1CXUA 1N36K 1TK8A 3Q7CA 2A42A 3KLHA 3P38A 5GAGP 1X9MA 3GG4A 3UB5A 2ZQBA 3O3GA 3ATVA 2B4JA 3O1WA 4FW1A 4LD0A 4FWRA 3O80A 4ISFA 5FPMA 4CJPA 1KTQA 3L2UA 3MAQA 1U4BA 1HLUA 4UQGA 3VOVA 2D1KA 4CBXA 5AZJB 5BREA 1CZAN 3AGKA 4DTMA 5KGWA 3NDKA 4FWPA 3SYZA 4CEQA 2YHBA 3O08A 4CGDA 3MXMA 2OPQA 4BG8A 3I55N 1TKDA 4FZYA 5C10A 1ITGA 3TR8A 4C1NK 1Q9XA 1ZYQA 3AVAA 4H03B 3TARA 1RT3A 1SAZA 3M8RA 3VESA 2Z1HA 4X64K 1NGBA 3THWA 3WNHA 4U7BA 4BDPA 2HNDA 2C1GA 3T3FA 1KAYA 3AO5A 3WXKA 4NYNA 2HVIA 4CHYA 2P9IA 3FZLA 3FLCO 2P9KA 4C8OA 2YNHA 1D5AA 2YNIA 4DG1A 5BRDA 3TAPA 3SAFA 1WBDA 4EZ9A 4KI6A 1ZBLA 4DTNA 1RDBA 1DTTA 3ZSOA 3CQYA 1JLGA 1N32K 1RBRA 2YNFA 1RBTA 1GLLO 2EWSA 4CFDA 3H45C 4NYFA 4DR3K 2FC0A 3NE6A 4DTRA 4CVNE 5BPNA 3LALA 4I7FA 4DSIA 4KKOA 1FKPA 1X9JA 5TKWA 1NG9A 4BR0A 4FK0A 1S5JA 2Z1GA 4W5TA 3WXLA 3HT3A 1VSKA 4ISEA 3IMXA 1IO2A 1IH7A 3O3FA 1S1WA 4HUGA 2P9SA 5C42A 2PYJA 5LMNK 3ZSQA 2VWJA 3VQPA 4WCEL 1B92A 4MDAA 1IJJA 2HBJA 2A40A 1HQEA 1WSHA 2CGJA 2NRTA 1BCMA 2E20A 2P51A 4PKHA 3SMPA 4YNQA 2EHGA 5EXWA 4R5PA 5J2MA 1NGFA 1VQON 4Q0BA 3ZETB 4FVMA 4H8KA 3LZIA 1WUAA 3DRSA 1SL0A 1NK8A 2G8FA 3IDHA 3QIPA 4FLVA 4FJLA 4BRIA 3GOIA 5KRTA 2DFEA 3MN7A 2IVOA 4YORA 4CEOA 1NGHA 4NLBA 4QOZB 5JMVA 3BP8A 3HM8A 1NKBA 1GOCA 4CD3A 1U45A 4K43A 3SQ2A 2I7NA 3D2EA 3G0ZA 5FRNA 4E0DA 5KGXA 1JXBA 4KO0A 4KREA 4HVJA 1K9MO 2F8SA 1XWLA 4IWVA 3R8EA 2HOEA 4H5RA 5EU7A 3LWLA 4CEFA 4B9NA 4OPKA 3OJSA 2G8IA 4CJEA 3RVCA 3CQXA 3TAQA 4O55A 1DGKN 2HF4A 4DMNA 4H5VA 4CK2A 4ELUA 1EQYA 2QI2A 3AARA 2ASMA 4CF0A 3I8BA 3CMEN 1NJWA 1JCGA 4WFBL 3RMAA 2BGGA 1VRTA 3KZBA 4NO7A 3P39A 1REVA 1SKRA 2E6LA 4J2BA 3L2WA 1L5UA 2HMPA 1HNVA 4KB1A 2P5GA 1WSIA 4B8AB 3MX2A 1XNRK 3CJAA 1SV5A 2FSNA 1HNZK 2NRXA 1QVFM 3ZSYA 4GVMA 2O8FA 1BIZA 1HNXK 1U47A 3AAPA 4BRDA 5DM7L 4E7LA 1QSLA 1TYQB 3MDQA 1ZXOA 1BG3A 1C1AA 3MEDA 3BF1A 3V4IA 3U8XA 3EO3A 1RT1A 4JK7A 4A5BA 4CJ3A 4KHUA 2KW4A 3E1YA 3CC4N 3VN5A 5SZTA 3DLRA 2KKZA 2F9WA 1NK7A 1QZ5A 4DS5A 3A0IX 3LPTA 4OGEA 4CHZA 3VQAA 2UXCK 5HRRA 3I33A 3DLHA 2NRVA 3QLHA 4DU1A 4KHWA 2FF3B 5E84A 2ZF5O 2BANA 1NGJA 1VSFA 3QINA 3OYJA 1J6ZA 5IWAK 1K73O 4CJVA 4BQLA 1VQ7N 4M3ZA 4DWIA 2DY4A 3THYB 3IKMA 1J53A 1LW0A 4QS7A 1HJOA 3PUFA 2O8EA 2YKMA 3O4WA 2P9UA 4B3RK 3A5NC 2JWKA 3ZSWA 3M8PA 3E66A 3M1FA 4M63C 4BGBA 3TAEA 4B8CA 3TI0A 2NRWA 2AP1A 1QE1A 2WFBA 4WQ4C 4H4MA 4H0TB 2HVHA 4CZGA 5FLXO 1SQKA 1VQ8N 3UE5A 1WSJA 5SWMA 4BGAA 1CXQA 3K57A 4A2AA 4AH9A 4XIUA 4DFKA 3DWLA 4N5SA 4CK3A 3T1AA 2OA8A 3OYEA 1MDUB 3LPUA 3GDQA 3LP1A 3QO9A 4GV9A 4PA1A 1LAVA 1KCFA 2ZJPL 5HBMA 4QCLA 2GBZA 1U6ZA 4Y1DA 4W5NA 4JD2A 1RT7A 3HVTA 4H0XB 3HP9A 2WTUA 4BVOA 2QXFA 4OGCA 4HTLA 2FBYA 4DQRA 2RHKA 5JVHL 4FK4A 1CZBA 3D2FA 3M6GA 5CYQA 5J2NA 3DOLA 3F5TA 4RW8A 4CJUA 4BG9A 1KSPA 2AJQA 4LF4K 3AO1A 3CMAN 2A1SA 5EVZA 4B9MA 3EKSA 1OH7A 2ZGZA 3MEEA 4CJRA 2NRRA 1T7PA 4CCHA 1EP4A 3VQ9A 3A5OC 2HBMA 4U67L 4QAGA 5AZJA 3ITHA 4JI8K 1RFQA 5AQWA 4ILHA 3ZT3A 3HZ6A 2H3GX 3CCVN 4NXMK 3G4SN 3QESA 3K5OA 2HSTA 4X66K 4DTOA 3C7NB 4ZHRA 1S3XA 2QXLA 1RTIA 3ZX3A 3KK7A 3VEVA 2GUPA 4OX9K 4BECA 5MLCQ 1IBLK 3OYLA 4JRQA 4EZ6A 5ADXH 2GUIA 3HRGA 5AQOA 4KHQA 1N6QA 2KFNA 5C15A 3HPHA 5CHIA 4RW4A 2P5OA 4CF8A 4OPJA 1YTUA 1C6VA 4BRAA 3V9ZA 4WFAL 3OS0A 4DLEA 4IFVA 4KHPK 4DR2K 4DV4K 4FWLA 3DM2A 1KFSA 1BUPA 1BA0A 3CFPA 1RCHA 2F9TA 4BE1A 3S5TA 4FWSA 1OH8A 2VWKA 3AVHA 2V7YA 3SBTA 1P8ZA 3HSTB 3O9UA 5ADXA 4G1QA 2IGIA 5AQTA 1TV6A 2YJEA 1YF5L 4CF1A 4CJQA 5JENA
chains in the Genus database with same CATH topology
1DEJA 1JCEA 3UKUB 5JVGL 2W00A 4EIAA 3OHRA 5KPRA 4JN4A 3PIPL 1K8AO 3LDQA 4YOUA 3ZYYX 4JHDB 2Q0RA 3L4QA 1HKGA 3KWGA 3MN5A 1HPMA 1RDWX 3MX5A 4WYBA 3ZEUB 2ASOA 4WQ4A 4A5AA 3FE1A 3VEWA 1YUWA 3D2FB 4B1WB 5KQ8A 4K41A 4RWTA 5GIPA 2BUPA 1YJ9N 3Q7CA 1U2VB 2A42A 3LDPA 4FPBA 3P38A 4H0VB 1NGCA 3GG4A 5GAGP 3UB5A 3VGKA 4CI6A 5F1XA 3ATVA 5AZIB 3O1WA 2A6AA 4FWRA 2BH1A 1VQ9N 5GADP 4H0OA 3O80A 3C6AA 4ISFA 3ID8A 3MWTA 5FPMA 4PHTX 1BOTO 1HLUA 5KQDA 1IG8A 2QA4N 4H5NA 1G99A 1ZC6A 3VOVA 2D1KA 1SZ2A 4JNEA 3TTFA 4CBXA 3CPWM 2Q1NA 5AZJB 5BREA 1CZAN 3AGKA 1N8RO 2DPNA 2GTDA 5AQZA 3EE8A 4FWPA 4QS8A 3H46O 1VQLN 4DB3A 4BY9C 3K9KA 3O08A 3HTVA 3KHYA 4BG8A 5LJWA 3F9MA 2GEMA 5CE3A 3NMUA 3I55N 3FZMA 4LC9B 1K8KB 1W97L 5C10A 3VPZA 1LCUA 4C1NK 1Y64A 1GLAG 3RSEB 2GWJA 2YJFA 2P9NB 5CR4A 3FFKB 3FZFA 3JXUA 3CPEA 4H03B 3AGRA 2QWLA 5JLFA 4O8KA 2P9IB 4FO0A 4JKFA 4AF1A 5EX5A 3R1XA 3GL1A 1SAZA 4XH1A 1DT9A 2KLAA 3PIOL 3LDNA 4ILJA 3VESA 1KAZA 4CZIA 3B8AX 4JKHA 2CGLA 2ZWHA 3SMSA 1NJIO 1NGBA 3FZHA 4HWIA 5AQQA 1BDGA 4MLEA 4U7BA 2C1GA 3KWIA 4KH4A 1KAYA 3R6MA 1NMDA 3ATUA 4BQZA 1MA9B 3P4IA 3FZKA 4JKCA 4H0YB 5JICA 4RCHA 3DXKA 3WXKA 4PL7A 5TKYA 2Q31A 1XC3A 3VF6A 1BU6O 3VTHA 4KBOA 4YOTA 3VEYA 2P9IA 3FZLA 3G6EN 2A41A 3CJBA 4XEIA 3FLCO 2P9KA 4R79A 1VQPN 4H5TA 2HBKA 4BRGA 4CZEA 5BRDA 4IFEA 5AQSA 3E9LA 4BC2A 4WQ5C 3SAFA 3L6QA 1T3VA 3CQYA 2HBLA 1Z6RA 5F2RA 2P9PB 1NGAA 3EN9A 1GLLO 4JEPA 5C2FA 2EWSA 3H45C 1H1VA 2QWMA 3VEXA 1NGDA 3AAQA 3LM9A 1YI2N 3VERA 2E1YA 3LDLA 3ENBA 1JCFA 5AR0A 3T7ZA 3L0QA 5BPNA 3UKRB 5BRFA 3ZX2A 3BUZB 2PFUA 1X9JA 1HUXA 3TPQA 5C12A 2P9LB 3L4IA 1C0GA 3C0BA 5TKWA 4BR0A 3CCJN 3VEZA 3W3DA 4BRFA 3WXLA 5E26A 1X3MA 4FOIA 2QWOA 1TYQA 3IMXA 4ISEA 4ISGA 3VF4A 3J8AA 2V51B 2Q36A 2P9SA 3DJCA 5AQYA 2JWLA 4DCHA 5BN8A 3H1VX 4FPAA 1NGGA 4A62A 1TUUA 4WCEL 5KPZA 2VGMA 3H3NO 4FWMA 1VQNN 4XJXA 4MDAA 4AM6A 2GELA 1IJJA 2WUSA 2YHXA 2HBJA 3CI5A 4M7YA 4JKDA 4M7XA 2A40A 2NRTA 2CGJA 2NLXA 3LDOA 4IZ9A 5M1FA 2BTFA 4WFNL 3NVMA 5FPNA 4KH6A 5LJVA 2E20A 1KD1O 3CCEN 3R9PA 3CJ9A 5H1SQ 3MWPA 4MO5A 4PKHA 4YDUC 3QBWA 3SMPA 4F9OA 3SJHA 4BROA 3N4PA 4MO4A 5M1KA 1JJ2M 5EXWA 1YHQN 4EHUA 2V7ZA 1NGFA 2E2OA 1VQON 2YHWA 3BF3A 4FVUA 3EE9A 3D6RA 3ZETB 4FSVA 2IVPA 2VWBA 3CJ7A 1WUAA 3FGUA 5AFUH 4JK9A 3MK6A 4YDUA 5M1QA 3CC7N 3WEEA 3IDHA 3CCRN 3VEOA 1O13A 1VQ5N 4BRIA 3GOIA 3TTDA 4C1NI 4CZMA 3IUCA 4GV3A 3MN7A 2IVOA 4YORA 1GLBG 2Q2RA 1ZBSA 3EKUA 1NGHA 2YX6A 4NLBA 3WUHA 5JMVA 3JS6A 3HOTA 1T6DA 3BP8A 5AQLA 4GVEA 2ASPA 5BPMA 3HM8A 1YITN 3ZETA 4CD3A 3U4LA 4BR9A 4K43A 4BVPA 2I7NA 3D2EA 2NRZA 4MDBA 2QW9A 4B1XB 3T69A 4BC3A 4DQ8A 4CZFA 3CERA 4K42A 4E1JA 2Q0UA 1K9MO 1KC8O 4BR2A 4IWVA 4IO9L 3R8EA 4CZKA 4FWNA 2HOEA 3HSCA 4O5FA 4A61A 5KPTA 2E8AA 2Q97A 4H5RA 4Y0WA 3S41A 1X3NA 3DXKB 3A5MC 1DKGD 3QFUA 3CC2N 2V52B 5AFUA 2A3ZA 3DLLL 4FWQA 1Q82O 3RVCA 3CQXA 3E9PA 2P9KB 1DGKN 2HF4A 3C6HA 4H5VA 3WXIA 3ENHA 3WXJA 4A59A 1M1KO 1EQYA 1V4TA 2QI2A 3AARA 2ASMA 4OPAA 4PL8A 3I8BA 4H0PA 3CMEN 3MMVA 3O9RA 5AQHA 2CGKA 1JCGA 4BEBA 4EFHA 4WFBL 3IFRA 3KZBA 4NO7A 4PKGA 1NGEA 3P39A 1ATSA 3CETA 3GE1A 4NLCA 3MN9A 4IOCL 2GX9A 2WC9A 5DM6L 1Q7YO 2HMPA 3TSPA 1TUYA 1ATNA 1Q86O 4CD1A 3MX2A 5AQKA 4BREA 3CJAA 2FSNA 4YOVA 2OTLN 3O1BA 2NRXA 1QVFM 4IDHA 4BRPA 3QBXA 5FPEA 3QMLA 3VMFB 4XH4A 4A2BA 3WQUA 4BRKA 4I6MA 1VAZA 4NB4A 3AAPA 4BRDA 5DM7L 1TYQB 3MDQA 1ZXOA 1BG3A 2E2NA 3O9QA 2P9SB 5AQUA 1VQ6N 5AQGA 4XH5A 4WQ5A 4FOEA 1YAGA 4ILGB 5AQIA 3K9JA 4DHYA 3BF1A 3U8XA 3EO3A 4CZJA 4IOXA 3O8MA 4JK7A 1BWFO 4JKAA 4A5BA 4BRCA 2OTJN 3MCPA 3E1YA 3CC4N 3CD6N 3VGMA 2VGNA 2KKZA 2F9WA 2NZTA 3CCUN 1YXQA 1QZ5A 3R3LA 3A0IX 3D7EO 5C0YA 2UYTA 2W40A 2FSKA 4BR4A 2AA4A 4YOWA 3TSUA 4B1VA 5ELZA 1E4GT 1ESVA 1OVYA 3VENA 1GLJO 1T6CA 3I33A 2NRVA 4L3QA 3G71N 2FF3B 5E84A 2ZF5O 3C7NA 3EZWA 1NGJA 1QQOA 2WBNA 3F2KA 4DKWA 1BA1A 1QHAA 3CF5L 1RDUA 4G9ZA 1J6ZA 4CBWA 2QWNA 1Z05A 1K73O 1BO5O 1KXPA 2E88A 2KHOA 4BQLA 5F0XA 3BEXA 3WEEB 1YJWN 1VQ7N 4FWKA 4O8UA 1E4FT 5GINA 1Q81O 3IKMA 4BRQA 3TTCA 4QS7A 3U9DA 4BRNA 2ZJQL 3DXMA 2GWKA 3G25A 1HJOA 3ULEA 3MCAB 3O4WA 4IXCA 3OBYA 3SBGA 1HKBA 2P9UA 1KAXA 1GLDG 2E2PA 3FR0A 3H3OB 3A5NC 2JWKA 4K25A 2NRHA 1QQMA 4B9QA 2D4WA 3WQTA 4BRMA 3E66A 2ZJRL 3N4QA 4H5WA 1YIJN 3M1FA 2FF6A 4M63C 3I56N 3GBTA 4BGBA 3O9SA 2ITMA 3D2EB 3DAWA 3ID6A 2NRWA 2AP1A 2NNWA 5AQXA 2QEXN 3CCQN 2YI1A 2VYPA 2WFBA 4WQ4C 3HI0A 3VGLA 4H0TB 3P31A 4JD2B 4CZGA 1SQKA 1VQ8N 3UE5A 4BGAA 5HOOA 1GLEG 1NGIA 5LY3A 4A2AA 3DWLA 1MWKA 3HOSA 1XQSC 2FLOA 1VQ4N 3A5LC 1MDUB 3EL2A 2A5XA 3GDQA 1MWMA 3M3ZA 4GV9A 3NVKA 2ZJPL 3CIPA 1U6ZA 3OW2M 4IEIA 3PLAA 4Z94A 4JD2A 3M5RA 1S22A 2HF3A 5BRHA 3UKUA 4GNIA 4BRHA 4H0XB 1NLVA 5FPDA 4BVOA 3HBTA 4HTLA 4JHDA 3O6WA 5I9EB 3H1QA 1EO1A 5AQJA 2RHKA 3ZEUA 5JVHL 4FWOA 2C1IA 2FSJA 3D2FA 3M6GA 3SK3A 4FL9A 3WT0A 3CCMN 3F5TA 3WXMB 4UY8O 3TU5A 4BG9A 3SAHA 5AQFA 4CZLA 1U2VA 1RGIA 5BPLA 3U9ZA 1M90O 1XUPO 4IEEA 4OPHA 2W41A 4B1YB 1GLFO 1QZ6A 3CMAN 5AZIA 5EVZA 4OO1J 3EKSA 2IVNA 5M1NA 3W0LA 4I6MB 4BE7B 1YVNA 2CH6A 2ZGZA 3ENOA 3OBWA 2J4RA 1HX1A 2I7PA 3VETA 4BC5A 1S72N 4IJAA 2NRRA 4BR5A 2QWQA 1V4SA 1GLCG 3A5OC 2HBMA 4AM7A 4U67L 5AZJA 3E9OA 3O9TA 3SAGA 3QDKA 1RFQA 3H6EA 5AQWA 4ILHA 2H3GX 3HZ6A 3CCVN 3A8YA 1K8KA 3KVGA 2PBDA 5GAEP 4B1ZA 4YOYA 1VQMN 4IJNA 5AQMA 4CBUA 5B8HA 1QVGM 5M1PA 3G4SN 3RSEA 1NM1A 1D4XA 2P9NA 4JKEA 3LL3A 3OA9A 2HSTA 2PAVA 1VQKN 3SLCA 3C7NB 4A57A 4WF9L 1S3XA 2QXLA 2YCHA 4BRLA 3VF2A 3ZX3A 1HKCA 1SS6A 3KK7A 2CH5A 3VEVA 2GUPA 4BECA 2E1ZA 1OKJA 1WOQA 4JKBA 2RE2A 1NBWA 3J7ZO 3QFPA 5MLCQ 5AQRA 3TSQA 4QS9A 1C0FA 5ADXH 1ILYA 5C2DA 3HRGA 3DXMB 3ULEB 5AQOA 1NWKA 2QWRA 5AQNA 4JKGB 5AQVA 4PKIA 2P9UB 4CJ7A 1KQSM 4EAHD 2QWPA 4GY2B 5C15A 2VCPA 5JLHA 3ZX0A 3CCLN 2OANA 5CHIA 2D0PA 2YHYA 2QTDA 3LM2A 5HL7L 4IOAL 4BRAA 3CHWA 4JK8A 4WFAL 4IO8A 4KH5A 2IIRA 3CXCM 2F7TA 2P9PA 4BC4A 2FXUA 3QICA 5BN9A 4FWLA 2E2QA 2D0OA 2ZGYA 4J8FA 5EOYA 3MN6A 1P90A 4B1UB 1T44A 3AY9A 3CCSN 1BUPA 4JKGA 1BA0A 4RTFD 5EY4A 2F9TA 1R59O 3CJ1A 3O5BA 4BR7A 1LOTB 4FWSA 3UKRA 1YJNN 1Q18A 2QM1A 1W2BM 1ATRA 2V7YA 4GV6A 3SBTA 4EHTA 5BR9A 1P8ZA 5GAHP 4YOXA 4MLHA 4CZHA 3VTIA 3QB0A 3O9UA 5ADXA 5AQTA 4JAXA 5GIOA 1QQNA 2P9LA 2YJEA 3Q7BA 1YF5L 3C65A 3CJCA 4C23A 5AQPA 5M1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DEJ A;  1JCE A;  3UKU B;  4EIA A;  3OHR A;  5KPR A;  4JN4 A;  3LDQ A;  4JHD B;  2Q0R A;  1HKG A;  3MN5 A;  1HPM A;  1RDW X;  4WYB A;  3ZEU B;  2ASO A;  4WQ4 A;  3FE1 A;  3VEW A;  1YUW A;  3D2F B;  4B1W B;  5KQ8 A;  4K41 A;  4RWT A;  2BUP A;  1U2V B;  2A42 A;  3LDP A;  4FPB A;  4H0V B;  1NGC A;  3GG4 A;  3UB5 A;  3VGK A;  4CI6 A;  5F1X A;  3ATV A;  5AZI B;  3O1W A;  2A6A A;  4FWR A;  4H0O A;  3O80 A;  4ISF A;  3ID8 A;  5FPM A;  1BOT O;  1HLU A;  5KQD A;  1IG8 A;  4H5N A;  1G99 A;  1ZC6 A;  3VOV A;  2D1K A;  1SZ2 A;  4JNE A;  4CBX A;  2Q1N A;  5AZJ B;  5BRE A;  1CZA N;  2DPN A;  2GTD A;  5AQZ A;  4FWP A;  4QS8 A;  3H46 O;  4DB3 A;  3O08 A;  3HTV A;  3KHY A;  4BG8 A;  5LJW A;  3F9M A;  2GEM A;  5CE3 A;  3FZM A;  4LC9 B;  1K8K B;  3VPZ A;  1LCU A;  1Y64 A;  1GLA G;  3RSE B;  2GWJ A;  2YJF A;  2P9N B;  3FFK B;  3FZF A;  3JXU A;  4H03 B;  5JLF A;  2QWL A;  4O8K A;  2P9I B;  4FO0 A;  5EX5 A;  3GL1 A;  1SAZ A;  4XH1 A;  3LDN A;  3VES A;  1KAZ A;  4CZI A;  3B8A X;  2CGL A;  2ZWH A;  3SMS A;  1NGB A;  3FZH A;  4HWI A;  5AQQ A;  1BDG A;  4MLE A;  1KAY A;  3R6M A;  1NMD A;  3ATU A;  4BQZ A;  1MA9 B;  3P4I A;  3FZK A;  5JIC A;  4H0Y B;  4RCH A;  3DXK A;  3WXK A;  4PL7 A;  5TKY A;  2Q31 A;  1XC3 A;  3VF6 A;  1BU6 O;  4KBO A;  3VEY A;  2P9I A;  3FZL A;  2A41 A;  3CJB A;  4XEI A;  3FLC O;  2P9K A;  4H5T A;  4BRG A;  4CZE A;  5BRD A;  5AQS A;  4BC2 A;  4WQ5 C;  3L6Q A;  3CQY A;  1Z6R A;  5F2R A;  2P9P B;  1NGA A;  3EN9 A;  1GLL O;  2EWS A;  3H45 C;  1H1V A;  2QWM A;  3VEX A;  1NGD A;  3AAQ A;  3LM9 A;  3VER A;  2E1Y A;  3LDL A;  5AR0 A;  1JCF A;  3L0Q A;  5BPN A;  3UKR B;  5BRF A;  3ZX2 A;  3BUZ B;  1X9J A;  1HUX A;  3TPQ A;  2P9L B;  3L4I A;  1C0G A;  3C0B A;  4BR0 A;  3VEZ A;  3W3D A;  4BRF A;  3WXL A;  5E26 A;  1X3M A;  4FOI A;  2QWO A;  1TYQ A;  3IMX A;  4ISE A;  4ISG A;  3VF4 A;  3J8A A;  2V51 B;  2Q36 A;  2P9S A;  3DJC A;  5AQY A;  4DCH A;  5BN8 A;  3H1V X;  4FPA A;  1NGG A;  4A62 A;  1TUU A;  5KPZ A;  3H3N O;  4FWM A;  4AM6 A;  2GEL A;  1IJJ A;  2WUS A;  2YHX A;  3CI5 A;  4M7Y A;  4M7X A;  2A40 A;  2CGJ A;  2NLX A;  3LDO A;  4IZ9 A;  2BTF A;  5FPN A;  5LJV A;  2E20 A;  3R9P A;  3CJ9 A;  4MO5 A;  4PKH A;  4YDU C;  3QBW A;  3SMP A;  4F9O A;  3SJH A;  4BRO A;  4MO4 A;  5EXW A;  4EHU A;  2V7Z A;  1NGF A;  2E2O A;  2YHW A;  3BF3 A;  3ZET B;  4FSV A;  2IVP A;  2VWB A;  3CJ7 A;  1WUA A;  3FGU A;  5AFU H;  3MK6 A;  4YDU A;  3WEE A;  3IDH A;  3VEO A;  4BRI A;  3GOI A;  4CZM A;  3IUC A;  3MN7 A;  2IVO A;  1GLB G;  2Q2R A;  1ZBS A;  3EKU A;  1NGH A;  3WUH A;  5JMV A;  3JS6 A;  1T6D A;  3BP8 A;  5AQL A;  2ASP A;  5BPM A;  3HM8 A;  3ZET A;  4CD3 A;  3U4L A;  4BR9 A;  4K43 A;  4BVP A;  2I7N A;  3D2E A;  2QW9 A;  4B1X B;  4BC3 A;  4DQ8 A;  4CZF A;  3CER A;  4K42 A;  4E1J A;  2Q0U A;  4BR2 A;  4IWV A;  3R8E A;  4CZK A;  4FWN A;  2HOE A;  3HSC A;  4O5F A;  4A61 A;  5KPT A;  2E8A A;  2Q97 A;  4H5R A;  4Y0W A;  3S41 A;  1X3N A;  3DXK B;  3A5M C;  1DKG D;  3QFU A;  2V52 B;  5AFU A;  2A3Z A;  4FWQ A;  3CQX A;  2P9K B;  1DGK N;  2HF4 A;  4H5V A;  3WXI A;  3ENH A;  3WXJ A;  1EQY A;  1V4T A;  3AAR A;  2ASM A;  4PL8 A;  3I8B A;  4H0P A;  3MMV A;  5AQH A;  2CGK A;  1JCG A;  4EFH A;  3IFR A;  3KZB A;  4NO7 A;  4PKG A;  1NGE A;  1ATS A;  3CET A;  3GE1 A;  3MN9 A;  2HMP A;  1TUY A;  1ATN A;  4CD1 A;  5AQK A;  4BRE A;  3CJA A;  2FSN A;  3O1B A;  4BRP A;  3QBX A;  5FPE A;  3QML A;  4XH4 A;  4A2B A;  3WQU A;  4BRK A;  4I6M A;  4NB4 A;  3AAP A;  4BRD A;  1TYQ B;  3MDQ A;  1ZXO A;  1BG3 A;  2E2N A;  2P9S B;  5AQU A;  5AQG A;  4XH5 A;  4WQ5 A;  4FOE A;  1YAG A;  5AQI A;  4DHY A;  3BF1 A;  3U8X A;  3EO3 A;  4CZJ A;  3O8M A;  1BWF O;  4BRC A;  3MCP A;  3VGM A;  2F9W A;  2NZT A;  1YXQ A;  1QZ5 A;  3A0I X;  3D7E O;  2UYT A;  2W40 A;  2FSK A;  4BR4 A;  2AA4 A;  4B1V A;  5ELZ A;  1E4G T;  1ESV A;  3VEN A;  1GLJ O;  1T6C A;  3I33 A;  4L3Q A;  2FF3 B;  5E84 A;  2ZF5 O;  3C7N A;  3EZW A;  1NGJ A;  1QQO A;  1BA1 A;  1QHA A;  1J6Z A;  4CBW A;  2QWN A;  1Z05 A;  1BO5 O;  1KXP A;  2E88 A;  2KHO A;  4BQL A;  5F0X A;  3BEX A;  3WEE B;  4FWK A;  1E4F T;  4BRQ A;  4QS7 A;  3U9D A;  4BRN A;  3DXM A;  2GWK A;  3G25 A;  1HJO A;  3ULE A;  3O4W A;  4IXC A;  1HKB A;  2P9U A;  1KAX A;  1GLD G;  2E2P A;  3FR0 A;  3H3O B;  3A5N C;  4B9Q A;  4K25 A;  2NRH A;  1QQM A;  4BRM A;  2D4W A;  3WQT A;  4H5W A;  3M1F A;  2FF6 A;  4M63 C;  3GBT A;  4BGB A;  2ITM A;  3D2E B;  3DAW A;  2AP1 A;  5AQX A;  2YI1 A;  2VYP A;  4WQ4 C;  3HI0 A;  3VGL A;  4H0T B;  4JD2 B;  4CZG A;  1SQK A;  3UE5 A;  4BGA A;  1GLE G;  1NGI A;  5LY3 A;  4A2A A;  3DWL A;  1MWK A;  1XQS C;  2FLO A;  3A5L C;  1MDU B;  3EL2 A;  2A5X A;  3GDQ A;  1MWM A;  3M3Z A;  3CIP A;  1U6Z A;  4Z94 A;  4JD2 A;  1S22 A;  2HF3 A;  5BRH A;  3UKU A;  4GNI A;  4BRH A;  4H0X B;  1NLV A;  5FPD A;  4BVO A;  3HBT A;  4HTL A;  4JHD A;  3O6W A;  5I9E B;  3H1Q A;  5AQJ A;  3ZEU A;  4FWO A;  2FSJ A;  3D2F A;  3M6G A;  3SK3 A;  4FL9 A;  3WT0 A;  3TU5 A;  4BG9 A;  5AQF A;  4CZL A;  1U2V A;  1RGI A;  5BPL A;  3U9Z A;  1XUP O;  2W41 A;  4B1Y B;  1GLF O;  1QZ6 A;  5AZI A;  5EVZ A;  3EKS A;  2IVN A;  3W0L A;  4I6M B;  1YVN A;  2CH6 A;  2ZGZ A;  3ENO A;  4BC5 A;  2J4R A;  1HX1 A;  2I7P A;  3VET A;  4IJA A;  4BR5 A;  2QWQ A;  1V4S A;  1GLC G;  3A5O C;  4AM7 A;  5AZJ A;  3QDK A;  1RFQ A;  3H6E A;  5AQW A;  2H3G X;  3HZ6 A;  3A8Y A;  1K8K A;  3KVG A;  2PBD A;  4B1Z A;  4IJN A;  5AQM A;  4CBU A;  5B8H A;  3RSE A;  1NM1 A;  1D4X A;  2P9N A;  3LL3 A;  2PAV A;  3SLC A;  3C7N B;  1S3X A;  2QXL A;  2YCH A;  4BRL A;  3VF2 A;  3ZX3 A;  1HKC A;  2CH5 A;  3VEV A;  2GUP A;  2E1Z A;  1OKJ A;  1WOQ A;  1NBW A;  3QFP A;  5AQR A;  4QS9 A;  1C0F A;  5ADX H;  3DXM B;  3ULE B;  5AQO A;  1NWK A;  2QWR A;  5AQN A;  4CJ7 A;  5AQV A;  4PKI A;  2P9U B;  4EAH D;  2QWP A;  4GY2 B;  5JLH A;  2VCP A;  3ZX0 A;  2OAN A;  2D0P A;  2YHY A;  3LM2 A;  4BRA A;  3CHW A;  4IO8 A;  2IIR A;  2P9P A;  4BC4 A;  2FXU A;  3QIC A;  5BN9 A;  4FWL A;  2E2Q A;  2D0O A;  2ZGY A;  4J8F A;  5EOY A;  3MN6 A;  4B1U B;  1T44 A;  3AY9 A;  1BUP A;  1BA0 A;  4RTF D;  5EY4 A;  2F9T A;  1R59 O;  3CJ1 A;  3O5B A;  4BR7 A;  1LOT B;  4FWS A;  3UKR A;  1Q18 A;  2QM1 A;  1ATR A;  2V7Y A;  4EHT A;  5BR9 A;  1P8Z A;  4MLH A;  4CZH A;  3QB0 A;  5ADX A;  5AQT A;  4JAX A;  1QQN A;  2P9L A;  2YJE A;  3CJC A;  4C23 A;  5AQP A; 
#chains in the Genus database with same CATH topology
 1DEJ A;  1KVA A;  1JCE A;  3UKU B;  3VQD A;  3NCI A;  1XHZ A;  3CYG A;  2W00 A;  4CFA A;  1Z25 A;  4FYD A;  1HYS A;  1K8A O;  4YOU A;  3ZSZ A;  3THX B;  4WYB A;  3ZEU B;  4A5A A;  1ASU A;  4O4G A;  1RT6 A;  4OKK A;  2D0A A;  4IFY A;  5AZI B;  3QEX A;  2W6L A;  1VQ9 N;  5GAD P;  1NK4 A;  3ID8 A;  3VQQ A;  3QEP A;  5CYM A;  1IG8 A;  2QA4 N;  3PY8 A;  4FLY A;  1A5W A;  4Z4E A;  4CK1 A;  1LWC A;  3V1Q A;  1NJX A;  5AQZ A;  1RTJ A;  2D0B A;  4F3T A;  5T7B A;  4BY9 C;  3K9K A;  3HTV A;  2IC3 A;  3KHY A;  3LP0 A;  2GEM A;  3NMU A;  1BGX T;  1VK0 A;  3FZM A;  3O4N A;  1W97 L;  4DSK A;  3M8S A;  3VPZ A;  1LCU A;  1GLA G;  4FLW A;  3JXU A;  5FDL A;  3AGR A;  4E7H A;  4DQS A;  2HHV A;  4O8K A;  4DV0 K;  5JS2 A;  4AF1 A;  3R1X A;  3GL1 A;  2P1J A;  4FJG A;  1RTD A;  4CZI A;  3SQ1 A;  2UUA K;  2CGL A;  2ZWH A;  3FZH A;  5AQQ A;  4DR7 K;  1BDG A;  4DTS A;  2HHT A;  1XC9 A;  1TL3 A;  4KH4 A;  3R6M A;  4BQZ A;  5JIC A;  1MA9 B;  3P4I A;  3FZK A;  3MEG A;  4RCH A;  2I5J A;  5TKY A;  3ASM A;  4F4K A;  3K5N A;  4KBO A;  4YOT A;  4I2P A;  4FCY A;  3CJB A;  4DV2 K;  4R79 A;  1VQP N;  2HBK A;  4BC2 A;  3E9L A;  3C95 A;  3L2Q A;  1T3V A;  2HBL A;  4DR6 K;  3EN9 A;  4JEP A;  4I9Q A;  1NKC A;  3VEX A;  3KTQ A;  1NGD A;  4FW2 A;  1HQU A;  3LM9 A;  5D3G A;  3VER A;  3ZT4 A;  3LDL A;  5AR0 A;  4W5Q A;  3T7Z A;  3L0Q A;  1VSJ A;  5BRF A;  4FM1 A;  3ZX2 A;  1ASW A;  1LWE A;  3BUZ B;  2PFU A;  1RT5 A;  1HUX A;  3P83 D;  1N34 K;  2XY8 A;  2P9L B;  3L4I A;  1C0G A;  3C0B A;  4B9T A;  3HO1 A;  3W3D A;  4DUZ K;  4FLZ A;  3H08 A;  5E26 A;  1X3M A;  3NGZ A;  4JS5 A;  1TYQ A;  4ISG A;  1OH5 A;  3PO5 A;  5AQY A;  1VSM A;  2JWL A;  4DCH A;  1NU0 A;  1XI1 A;  4FPA A;  1TUU A;  3KJV A;  1RTH A;  4XJX A;  4AM6 A;  3L3U A;  1KRP A;  1L3S A;  1VHX A;  4FJ8 A;  3LP3 A;  2HHU A;  4KTW A;  2NLX A;  4J2A A;  2BTF A;  4WFN L;  3CCE N;  5FPN A;  3DMJ A;  5LJV A;  4CEB A;  4B3O A;  4MO5 A;  4J2E A;  4YDU C;  1U49 A;  3QBW A;  3V6D A;  3RTV A;  5I3U A;  2JLE A;  4AHC A;  5M1K A;  1YHQ N;  4B3S K;  2V7Z A;  3BF3 A;  3D45 A;  3MK6 A;  3CC7 N;  3HL8 A;  5HP1 A;  3THY A;  1S9E A;  1O13 A;  3NH1 A;  3IUC A;  4FJH A;  3T19 A;  3NAE A;  4HTU A;  1SL1 A;  1IKY A;  3MXJ A;  3JS6 A;  4GVE A;  1YIT N;  4CGI A;  3VA0 A;  4MDB A;  1B9D A;  4DQ8 A;  1Z26 A;  2Q0U A;  1SKS A;  4BE0 A;  4FWN A;  4O5F A;  1X3N A;  2HHQ A;  4WE1 A;  4FJX A;  2A3Z A;  3DLL L;  5CZ1 A;  1JLC A;  3E9P A;  4DFP A;  4A59 A;  1M1K O;  4ELV A;  1V4T A;  3HXM A;  5K14 A;  4H0P A;  4C8M A;  5AQH A;  4B9S A;  4PKG A;  1NGE A;  4CE9 A;  3CET A;  3GE1 A;  2B6A A;  4NLC A;  4CF2 A;  5AJ3 K;  4N76 A;  4IOC L;  1EX4 A;  5DM6 L;  4CJT A;  3V9W A;  1TUY A;  1Q86 O;  4CD1 A;  3SNN A;  4DF8 A;  2F4V K;  3O1B A;  4LFC K;  1ZBF A;  4O5B A;  3KD1 E;  5FPE A;  3ISN C;  3WQU A;  2G8H A;  4NB4 A;  1UAX A;  1MU2 A;  4IG0 A;  4HUE A;  4M3U A;  1VQ6 N;  5AQG A;  4WQ5 A;  3PSF A;  4ILG B;  3K9J A;  5A2Q O;  1L3V A;  3RR7 A;  3KLG A;  4IOX A;  1NK0 A;  1BWF O;  4JKA A;  4O0J A;  4PWD A;  2Y1I A;  3MCP A;  1NK6 A;  3C6T A;  4J2D A;  4FLU A;  3TAN A;  2VGN A;  3BDP A;  1FKO A;  3R3L A;  1RBS A;  3D7E O;  5C0Y A;  2W40 A;  4BR4 A;  4KV8 A;  5ELZ A;  1OVY A;  3SUP A;  1GLJ O;  3G71 N;  4YHH K;  3U3Y A;  4LFB K;  4DV7 K;  3J7A P;  1NNE A;  3C7N A;  3OS2 A;  1QQO A;  2WBN A;  4DKW A;  1QHA A;  3AO2 A;  4G9Z A;  3CM6 A;  4IG3 A;  3VQ8 A;  1BO5 O;  2KHO A;  5F0X A;  3WEE B;  4O8U A;  4M42 A;  3CFR A;  3TTC A;  2ZJQ L;  4BRN A;  3OVN A;  3G25 A;  1I3A A;  3SV3 A;  4C8K A;  2E2P A;  1GLD G;  2D4W A;  3WQT A;  4CEZ A;  2IOC A;  1YIJ N;  4DSJ A;  4K8Z A;  4CF9 A;  3A2F A;  3O9S A;  2ITM A;  3DAW A;  2NNW A;  3CCQ N;  2VYP A;  3G10 A;  3HI0 A;  1VSH A;  3V9X A;  3RRG A;  3P31 A;  1TKZ A;  4B9V A;  5KRS A;  4DTX A;  1Q9Y A;  1VQ4 N;  1KVC A;  3A5L C;  4W5R A;  4DV5 K;  2A5X A;  4O44 A;  3CYM A;  4FJ9 A;  4DFM A;  2G8W A;  4KPY A;  1RDA A;  3OYB A;  2HF3 A;  3UKU A;  2HHW A;  1T05 A;  1NLV A;  3AO4 A;  1LV5 A;  5FPD A;  3HP6 A;  3O6W A;  3DYA A;  3THX A;  5I9E B;  3SPY A;  4O0I A;  3ZEU A;  2C1I A;  1U48 A;  1JLB A;  1WSG A;  3TU5 A;  3KLI A;  2WOM A;  1RGI A;  1M90 O;  3U9Z A;  4K0K K;  3PX0 A;  4OPH A;  1GLF O;  1CZ9 A;  2JGU A;  2PYL A;  4DLG A;  5AZI A;  3S3M A;  4OO1 J;  2IVN A;  3W0L A;  4I6M B;  4BE7 B;  3ENO A;  1XNQ K;  1W0H A;  4JRP A;  2QWQ A;  1NK9 A;  4MQ3 A;  3J7Y P;  2OPS A;  4AM7 A;  4ELT A;  1QS4 A;  4CJK A;  3SAG A;  3QDK A;  3H6E A;  4E19 A;  2B5J A;  1LAW A;  3AVK A;  1TKT A;  3A8Y A;  3DLK A;  3KVG A;  2PBD A;  5GAE P;  3JAM O;  4YOY A;  3NH2 A;  1ZBH A;  4CBU A;  1QVG M;  4CEC A;  1Y97 A;  5M1P A;  3WNG A;  1D4X A;  3OYG A;  2PAV A;  4BRL A;  4M3R A;  2IAJ A;  1DTQ A;  3MEC A;  1SKW A;  1WOQ A;  4JKB A;  2RE2 A;  1NBW A;  2O8D B;  4KTQ A;  1RT4 A;  5AQR A;  4DSL A;  1C0F A;  1ILY A;  3SQ0 A;  4JKG B;  4OVL A;  4PKI A;  4RW6 A;  5AQV A;  1KQS M;  1RDC A;  4EAH D;  3HPG A;  4GY2 B;  5JLH A;  4CJW A;  1QSS A;  3AA2 A;  3SCX A;  3V9U A;  2YHY A;  4X65 K;  2QTD A;  3CHW A;  1TK5 A;  1QSY A;  2YKN A;  4BC4 A;  2VG5 A;  5EOY A;  2E2Q A;  4J8F A;  3MN6 A;  3AY9 A;  4M3W A;  2X78 A;  5KI6 A;  4M3X A;  2OPR A;  4GKK K;  2HNY A;  4B3T K;  3SPZ A;  1ATR A;  4EHT A;  4YOX A;  5GAH P;  4CZH A;  3C94 A;  3RMC A;  3AVJ A;  3OYN A;  3BY5 A;  1QQN A;  2P9L A;  4FJK A;  2ZJR L;  4FLT A;  3SUQ A;  2VQE K;  4EIA A;  5KPR A;  2QK9 A;  3SUO A;  2RKI A;  3LDQ A;  2Q3S A;  3L4Q A;  3KWG A;  3MN5 A;  3RRH A;  1RDW X;  3I0S A;  3MX5 A;  4M41 A;  3QEI A;  4K41 A;  4RWT A;  4FJ5 A;  1U2V B;  4Q5V A;  1WSE A;  4DR1 K;  3LDP A;  4H0V B;  4F3O A;  4CI6 A;  2UU9 K;  4H0O A;  5HLF A;  4PHT X;  1BOT O;  2HB5 A;  5KQD A;  4DUY K;  4F2R A;  1G99 A;  1VSD A;  1SZ2 A;  4JNE A;  3CPW M;  1NJY A;  2KZZ A;  2DPN A;  2GTD A;  3EE8 A;  4QS8 A;  1VQL N;  4DB3 A;  4LF8 K;  5LJW A;  1K8K B;  1C0T A;  4E7I A;  3V1O A;  4CIE A;  4DV6 K;  2GWJ A;  2YJF A;  4Z0U A;  3FFK B;  3FZF A;  2QWL A;  2P9I B;  3DRP A;  4JKF A;  3D0P A;  1DT9 A;  2KLA A;  4CFB A;  3PIO L;  3AVI A;  4ILJ A;  4B9L A;  4H4O A;  1J5O A;  1KAZ A;  4FJN A;  4JKH A;  3LP2 A;  4HWI A;  4MLE A;  3VQ4 A;  3KWI A;  3M8Q A;  1NMD A;  3ATU A;  4E1M A;  4LF9 K;  1RDD A;  3S3O A;  3VF6 A;  4KRF A;  3VTH A;  1JLE A;  1L3T A;  3G6E N;  4XEI A;  3ZSX A;  2O4G A;  1VSE A;  4BRG A;  4CZE A;  4IFE A;  5AQS A;  1X9S A;  3P5J A;  3L6Q A;  1Z6R A;  5F2R A;  3FFI A;  2P9P B;  3RMD A;  1NGA A;  5C2F A;  4CHQ A;  1TAQ A;  1D9D A;  4DQQ A;  1YI2 N;  1UA1 A;  1QQC A;  4KI4 A;  3UKR B;  3OYA A;  4CIG A;  4KAZ A;  3TPQ A;  1OH6 A;  5C12 A;  4NXN K;  2HHX A;  4OLB A;  4IDK A;  4JI3 K;  3V9S A;  3QEV A;  1U04 A;  4FOI A;  1TAU A;  3VF4 A;  1IKV A;  3J8A A;  2Q36 A;  3DJC A;  3H1V X;  1TVR A;  4A62 A;  4DU3 A;  2VGM A;  4FWM A;  2GEL A;  3K5L A;  2YHX A;  2WUS A;  5BR8 K;  4JKD A;  4M7X A;  5HRP A;  3TWH A;  1K6Y A;  4IZ9 A;  5M1F A;  3LAM A;  4KTZ A;  3KLE A;  4KH6 A;  3R9P A;  3CJ9 A;  1S1V A;  3LDS A;  3SJH A;  4EP4 A;  1FK9 A;  3N4P A;  4MO4 A;  4B3M K;  4CFC A;  2E2O A;  4E7K A;  4FVU A;  2IVP A;  3QNO A;  4ZTF A;  1ZBU A;  4YDU A;  5M1Q A;  3WEE A;  3AV9 A;  3OJU A;  3VEO A;  1VQ5 N;  4OKJ A;  4C1N I;  4CZM A;  4OLA A;  4GV3 A;  4JS4 A;  2F8T A;  3U6F A;  1GLB G;  4DV3 K;  1S9G A;  3NFA A;  3EKU A;  3WUH A;  1GOA A;  1T6D A;  2YHA A;  5AQL A;  5BPM A;  3ZET A;  3U4L A;  4BR9 A;  4BVP A;  2KZM A;  2FBX A;  4ICL A;  2NRZ A;  4CJL A;  3K5M A;  4JI2 K;  4ID1 A;  4BC3 A;  2RPI A;  3CER A;  4K42 A;  4E1J A;  1KC8 O;  4BR2 A;  1J9A A;  3O3H A;  3NF7 A;  1C1B A;  4IO9 L;  4CZK A;  3HSC A;  5KPT A;  2E8A A;  2Q97 A;  4Y0W A;  1D9F A;  1YT3 A;  3S41 A;  3DXK B;  3A5M C;  3ZT1 A;  1ASV A;  3QFU A;  1NK5 A;  3CC2 N;  5FRM A;  4KFB A;  2V52 B;  3ALY A;  4FM0 A;  3I8D A;  1Q82 O;  3NGI A;  4RW7 A;  2ZE2 A;  5CY4 A;  3ENH A;  1C0M A;  3WXJ A;  1NOY A;  4OPA A;  4PL8 A;  4LF6 K;  4Z4I A;  4JV5 K;  4BEB A;  4EFH A;  2HHS A;  3IFR A;  1BQM A;  1JL2 A;  2BDP A;  4E3S A;  4JI0 K;  1ATS A;  1WLJ A;  2VG7 A;  3AVL A;  3MN9 A;  1BIS A;  2WC9 A;  3TSP A;  1ATN A;  1HRH A;  3KK3 A;  5AQK A;  4BRE A;  4YOV A;  2OTL N;  2G8K A;  3QNN A;  4YY3 K;  4BRP A;  3QBX A;  3VQC A;  3QML A;  3VMF B;  4XH4 A;  3J80 O;  4I6M A;  1VAZ A;  3RWU A;  4CHO A;  1HPZ A;  3TAM A;  1E3M A;  4DTJ A;  1QTM A;  3O9Q A;  5AQU A;  2XHB A;  3TAB A;  3BGR A;  4JI4 K;  1NJZ A;  4FOE A;  4KHN A;  5AQI A;  1IBK K;  4EP5 A;  3O8M A;  1XMQ K;  4JI7 K;  3NF9 A;  2XY5 A;  4DSF A;  3CCU N;  1YXQ A;  3NBP A;  4JI5 K;  3AA5 X;  2FSK A;  2AA4 A;  3TSU A;  4B1V A;  1E4G T;  1ESV A;  4L3Q A;  1X1P A;  3S3N A;  3CF5 L;  1HNI A;  1UOC A;  3EY1 A;  4CBW A;  4PQU A;  1Z05 A;  2Z1I A;  3VQB A;  1KXP A;  2O8D A;  4HCC A;  5DK5 A;  1E4F T;  5GIN A;  3S9H A;  2KQ2 A;  1BCO A;  1Q81 O;  4BRQ A;  1RBU A;  1N5Y A;  4IXC A;  3OBY A;  1HKB A;  3H3O B;  4B9Q A;  4K25 A;  2NRH A;  1QQM A;  1VRU A;  3N4Q A;  4H5W A;  3LAN A;  4CGH A;  2FF6 A;  5C25 A;  3GBT A;  3ID6 A;  2WON A;  5AQX A;  4LSL A;  2PY5 A;  5C24 A;  4KB0 A;  3QER A;  3VGL A;  4JD2 B;  1EET A;  4NCB A;  3KKS A;  3OS1 A;  1GLE G;  5LY3 A;  3HOS A;  1XQS C;  2FLO A;  1BIU A;  1HJR A;  4DQP A;  1WBB A;  3EL2 A;  4LH4 A;  4DTP A;  3OYF A;  2OZM A;  3HPO A;  3OW2 M;  4IEI A;  1J5E K;  3PLA A;  4Z94 A;  1T8E A;  4K8X A;  4JI1 K;  4CHN A;  4AHU A;  5BRH A;  4GNI A;  1JLA A;  4Z4F A;  3ZT2 A;  2YNG A;  2XY7 A;  4I9L A;  4FWO A;  3WT0 A;  3CCM N;  3WXM B;  4N56 A;  4CZL A;  1U2V A;  1XUP O;  4IEE A;  2W41 A;  1KFD A;  1HR0 K;  1JXE A;  1L3U A;  3OBW A;  1S72 N;  2W42 A;  1W7A A;  4IJA A;  3I0R A;  3F9K A;  4AHS A;  1WAF A;  1N33 K;  1GLC G;  1KVB A;  3AO3 A;  3OYI A;  3O9T A;  2HHI A;  1I39 A;  3MXI A;  4PY5 A;  4C8L A;  5HRO A;  1K8K A;  1S6P A;  1VQM N;  1T03 A;  4IJN A;  1NM1 A;  4IBN A;  4JKE A;  3OA9 A;  4WF9 L;  4A57 A;  3RR8 A;  2YCH A;  3ZSR A;  3VF2 A;  1OKJ A;  1ZBI A;  3J7Z O;  3OYM A;  3QFP A;  1IKW A;  1W9H A;  3WNE A;  3PO4 A;  2LSN A;  5C2D A;  3DXM B;  3ULE B;  4FLX A;  4CJ7 A;  5HRN A;  3OYD A;  2QWP A;  2GV9 A;  1F21 A;  4CIF A;  4JI6 K;  1BI4 B;  1IV0 A;  3LM2 A;  4JK8 A;  4IO8 A;  4KH5 A;  4LF7 K;  2IIR A;  3CXC M;  2P9P A;  4CEE A;  2FXU A;  3AVN A;  2ZGY A;  3NGY A;  3QIO A;  3ZLJ A;  5EY4 A;  3CJ1 A;  1R59 O;  1RBV A;  3O5B A;  2XO7 A;  1LOT B;  3RMB A;  3UKR A;  1Q18 A;  2QM1 A;  4N41 A;  3ZT0 A;  5BR9 A;  3VTI A;  2OZS A;  3QB0 A;  2O8B B;  5GIO A;  4LSN A;  1IKX A;  2NUB A;  1A5V A;  3Q7B A;  3C65 A;  1S1X A;  1IG9 A;  3CJC A;  4C23 A;  5M1O A;  5JVG L;  4JN4 A;  4CJ5 A;  1IBM K;  3K2P A;  4FZX C;  4JHD B;  5KTQ A;  2Q0R A;  1XMO K;  1HPM A;  4CW7 B;  3K59 A;  1C0U A;  4E89 A;  4WQ4 A;  1YUW A;  4B1W B;  5KQ8 A;  5GIP A;  5LMU K;  2BUP A;  1YJ9 N;  3KLF A;  4C8N A;  4AHT A;  3K58 A;  2D0C A;  4FPB A;  1NGC A;  1RT2 A;  3VGK A;  5F1X A;  4DR4 K;  4Z4G A;  2A1R A;  3QEW A;  4DU4 A;  2A6A A;  2BH1 A;  3TAG A;  4CJF A;  3C6A A;  1EKE A;  3MWT A;  4LF5 K;  4H5N A;  1ZC6 A;  3OTO K;  3VQE A;  4BWJ A;  1HYV A;  3TTF A;  1S1T A;  2Q1N A;  1N8R O;  3K0S A;  2PZS A;  1LWF A;  3H46 O;  5J2Q A;  4F2S A;  1SUQ A;  3F9M A;  5CE3 A;  4LC9 B;  4M3T A;  1Y64 A;  3IRX A;  3RSE B;  5CR4 A;  2P9N B;  4JLH A;  4YFU A;  1FJG K;  3CPE A;  1FXX A;  3AA4 A;  5JLF A;  4FO0 A;  1B9F A;  3EEQ A;  5EX5 A;  1LW2 A;  5IT9 O;  4XH1 A;  2O8C B;  1EWR A;  2X6N A;  3LDN A;  4FJM A;  3B8A X;  1NJI O;  3SMS A;  3ULD A;  3HJF A;  1A5X A;  1J54 A;  4JKC A;  4H0Y B;  3DXK A;  2G8V A;  4PL7 A;  3V1R A;  4ZTJ A;  2Q31 A;  1BL3 A;  1XC3 A;  1UA0 A;  4F8R A;  1BU6 O;  3VEY A;  2A41 A;  4Z4C A;  1CLQ A;  4H5T A;  4WQ5 C;  2KFZ A;  3SI6 A;  1VSI A;  3EZ5 A;  4CER A;  1H1V A;  2QWM A;  3AAQ A;  2E1Y A;  4HUF A;  3ENB A;  1JCF A;  3KD5 E;  4DF4 A;  3NHG A;  4N47 A;  4B9U A;  4IKF A;  3U3G A;  4NCA A;  1TGO A;  3KKR A;  4LH5 A;  3CCJ N;  3VEZ A;  4BRF A;  3NH0 A;  4TSX A;  3LZJ A;  2DFH A;  2QWO A;  2V51 B;  4OJR A;  3L2V A;  4W5O A;  5BN8 A;  2Y1J A;  4BAC A;  2YV0 X;  4NCG A;  1NGG A;  5KPZ A;  1VQN N;  3H3N O;  2KTQ A;  1WN7 A;  3CI5 A;  4GMJ B;  4M7Y A;  1S1U A;  1DLO A;  1TK0 A;  1RIL A;  3LDO A;  2E6M A;  3NVM A;  1KD1 O;  1XHX A;  3AA3 A;  5H1S Q;  3MWP A;  4F9O A;  3TAF A;  4BRO A;  2E4L A;  1JJ2 M;  4EHU A;  2YHW A;  3EE9 A;  3D6R A;  4FSV A;  2HMI A;  2VWB A;  1O1W A;  2RN2 A;  3CJ7 A;  3IS9 A;  3FGU A;  5AFU H;  4CGJ A;  4JK9 A;  2XRI A;  3CCR N;  3TTD A;  4DSE A;  1C1C A;  2OCE A;  3AVM A;  2X6S A;  2Q2R A;  1ZBS A;  4CEA A;  3SJJ A;  2YX6 A;  3HOT A;  4AQY K;  2ASP A;  4AHV A;  1YVU A;  4X62 K;  2QW9 A;  4B1X B;  4Y1C A;  3T69 A;  4CZF A;  2IDO A;  1JLQ A;  3THW B;  3SQ4 A;  3L3V A;  2ETJ A;  4A61 A;  2G8U A;  2Z1J A;  1D8Y A;  4BWM A;  4KHY A;  1DKG D;  4FZZ A;  2ATQ A;  3T1H K;  1FW6 A;  5AFU A;  4E7J A;  4LY7 A;  4FWQ A;  3L2R A;  2VQF K;  2P9K B;  3C6H A;  3WXI A;  4FJI A;  4DV1 K;  3AVG A;  4ID5 A;  4DQI A;  1GOB A;  3MMV A;  3O9R A;  2CGK A;  1I94 K;  1YTA A;  2GX9 A;  3CQ8 A;  1Q7Y O;  2F96 A;  4AIL C;  3AVC A;  1KLN A;  4IDH A;  2RF2 A;  3OY9 A;  4A2B A;  4BRK A;  1HMV A;  4GKJ K;  3DI6 A;  2ZD1 A;  2XY6 A;  2E2N A;  2P9S B;  2QKK A;  4XH5 A;  1WB9 A;  1YAG A;  4FM2 A;  4DHY A;  3PSI A;  4CZJ A;  4DTU A;  5J1E A;  3UIQ A;  4BRC A;  2OTJ N;  3CD6 N;  3VGM A;  3NF8 A;  1JLF A;  4BDY A;  5LL6 Z;  1QHT A;  2NZT A;  2O4I A;  1WAJ A;  1NKE A;  4CGG A;  3B6O A;  2UYT A;  4YOW A;  2EX3 A;  3IAY A;  2HHH K;  3VEN A;  1T6C A;  4L8R B;  3CG7 A;  1WNS A;  1X9W A;  3VQ7 A;  3CM5 A;  3EZW A;  3F2K A;  4GW6 A;  1KLM A;  1BA1 A;  3KIO A;  4BDZ A;  1RDU A;  4I2Q A;  1VSL A;  2QWN A;  2E88 A;  1YJW N;  3BEX A;  3DLE A;  4FWK A;  4E1N A;  1WSF A;  3U9D A;  1NMN A;  2HNZ A;  3PX4 A;  3DXM A;  2GWK A;  3ULE A;  4DS4 A;  4E72 A;  3MCA B;  3SBG A;  4CJS A;  1KAX A;  3FR0 A;  3SZ2 A;  2X74 A;  4BRM A;  4HCB A;  3DLB A;  3P1G A;  3DRR A;  3OYK A;  3I56 N;  3QET A;  1BI4 A;  2DFF A;  3D2E B;  4CES A;  1Q8I A;  5CZ2 A;  2QEX N;  5E41 A;  2YI1 A;  4MFB A;  4HHT A;  4DFJ A;  3C6U A;  5HOO A;  3L8B A;  3F73 A;  1NGI A;  5JS1 A;  1MWK A;  4OKE A;  3PX6 A;  4PUO A;  3AVB A;  1S6Q A;  3LAK A;  5I42 A;  3JYT A;  3V81 A;  3M3Z A;  1MWM A;  3NVK A;  3B6P A;  2O8B A;  3CIP A;  4FK2 A;  4Z4H A;  4RG8 A;  1RNH A;  3JSM A;  3M5R A;  1S22 A;  2ZM6 K;  4LFA K;  2D5R A;  4BRH A;  4CED A;  3E01 A;  2VG6 A;  3HBT A;  4JHD A;  3VQ6 A;  4JYA K;  3H1Q A;  1EO1 A;  5AQJ A;  5FRO A;  3ZSV A;  2FSJ A;  1G15 A;  3SK3 A;  4FL9 A;  3KK2 A;  4UY8 O;  3SAH A;  5AQF A;  5BPL A;  3THV A;  3VQ5 A;  4B1Y B;  1R0A A;  1QZ6 A;  2O8F B;  1HYZ A;  1BHL A;  5M1N A;  1YVN A;  2CH6 A;  2UXD K;  3OYC A;  4BC5 A;  2J4R A;  1HX1 A;  2I7P A;  3DLG A;  3VET A;  4BR5 A;  3O4Q A;  1V4S A;  3KK1 A;  2UXB K;  3E9O A;  4M3Y A;  3IG1 A;  4M45 A;  4KHS A;  2OPP A;  2FBV A;  4BE2 A;  3BZC A;  1NOZ A;  3J81 O;  3T1Y K;  4B1Z A;  2UUC K;  5AQM A;  5B8H A;  3HM9 A;  5DMR A;  3PV8 A;  3CFO A;  3RSE A;  2P9N A;  3LL3 A;  2QKB A;  4CHP A;  1VQK N;  3SLC A;  3VA3 A;  2O8C A;  2OYQ A;  1HKC A;  1SS6 A;  2CH5 A;  5J2P A;  2E1Z A;  1JKH A;  1BQN A;  1SL2 A;  2DTU A;  3TSQ A;  4QS9 A;  1TL1 A;  4CJ4 A;  3SUN A;  3NF6 A;  2O8E B;  1NWK A;  3ZCM A;  2QWR A;  5AQN A;  2ITG A;  2P9U B;  3WNF A;  3CCL N;  2VCP A;  3ZX0 A;  3BZK A;  2OAN A;  1TKX A;  2D0P A;  5HL7 L;  4IOA L;  3LWM A;  2F7T A;  1UWB A;  4B08 A;  4FXD A;  3QIC A;  5BN9 A;  2D0O A;  3HK2 A;  4B1U B;  1P90 A;  1T44 A;  3EYZ A;  3CCS N;  3HVR A;  4AHR A;  4JKG A;  4DR5 K;  4RTF D;  4BR7 A;  4CGF A;  3AVF A;  3DOK A;  2UUB K;  1YJN N;  1EWQ A;  5HRS A;  2E5L K;  1W2B M;  4GV6 A;  3HYF A;  2BE2 A;  4MLH A;  2FBT A;  3OYH A;  4FJJ A;  2R7Y A;  4JAX A;  5AQP A;  4RW9 A;  2W6K A;  4FJ7 A;  3OHR A;  4V19 S;  1EXQ A;  3PIP L;  3ZYY X;  1HNW K;  2HW3 A;  1HKG A;  1JL1 A;  3SV4 A;  2IS3 A;  2ASO A;  1OVQ A;  3FE1 A;  3D2F B;  3VEW A;  1CXU A;  1N36 K;  1TK8 A;  3Q7C A;  2A42 A;  3KLH A;  3P38 A;  5GAG P;  1X9M A;  3GG4 A;  3UB5 A;  2ZQB A;  3O3G A;  3ATV A;  2B4J A;  3O1W A;  4FW1 A;  4LD0 A;  4FWR A;  3O80 A;  4ISF A;  5FPM A;  4CJP A;  1KTQ A;  3L2U A;  3MAQ A;  1U4B A;  1HLU A;  4UQG A;  3VOV A;  2D1K A;  4CBX A;  5AZJ B;  5BRE A;  1CZA N;  3AGK A;  4DTM A;  5KGW A;  3NDK A;  4FWP A;  3SYZ A;  4CEQ A;  2YHB A;  3O08 A;  4CGD A;  3MXM A;  2OPQ A;  4BG8 A;  3I55 N;  1TKD A;  4FZY A;  5C10 A;  1ITG A;  3TR8 A;  4C1N K;  1Q9X A;  1ZYQ A;  3AVA A;  4H03 B;  3TAR A;  1RT3 A;  1SAZ A;  3M8R A;  3VES A;  2Z1H A;  4X64 K;  1NGB A;  3THW A;  3WNH A;  4U7B A;  4BDP A;  2HND A;  2C1G A;  3T3F A;  1KAY A;  3AO5 A;  3WXK A;  4NYN A;  2HVI A;  4CHY A;  2P9I A;  3FZL A;  3FLC O;  2P9K A;  4C8O A;  2YNH A;  1D5A A;  2YNI A;  4DG1 A;  5BRD A;  3TAP A;  3SAF A;  1WBD A;  4EZ9 A;  4KI6 A;  1ZBL A;  4DTN A;  1RDB A;  1DTT A;  3ZSO A;  3CQY A;  1JLG A;  1N32 K;  1RBR A;  2YNF A;  1RBT A;  1GLL O;  2EWS A;  4CFD A;  3H45 C;  4NYF A;  4DR3 K;  2FC0 A;  3NE6 A;  4DTR A;  4CVN E;  5BPN A;  3LAL A;  4I7F A;  4DSI A;  4KKO A;  1FKP A;  1X9J A;  5TKW A;  1NG9 A;  4BR0 A;  4FK0 A;  1S5J A;  2Z1G A;  4W5T A;  3WXL A;  3HT3 A;  1VSK A;  4ISE A;  3IMX A;  1IO2 A;  1IH7 A;  3O3F A;  1S1W A;  4HUG A;  2P9S A;  5C42 A;  2PYJ A;  5LMN K;  3ZSQ A;  2VWJ A;  3VQP A;  4WCE L;  1B92 A;  4MDA A;  1IJJ A;  2HBJ A;  2A40 A;  1HQE A;  1WSH A;  2CGJ A;  2NRT A;  1BCM A;  2E20 A;  2P51 A;  4PKH A;  3SMP A;  4YNQ A;  2EHG A;  5EXW A;  4R5P A;  5J2M A;  1NGF A;  1VQO N;  4Q0B A;  3ZET B;  4FVM A;  4H8K A;  3LZI A;  1WUA A;  3DRS A;  1SL0 A;  1NK8 A;  2G8F A;  3IDH A;  3QIP A;  4FLV A;  4FJL A;  4BRI A;  3GOI A;  5KRT A;  2DFE A;  3MN7 A;  2IVO A;  4YOR A;  4CEO A;  1NGH A;  4NLB A;  4QOZ B;  5JMV A;  3BP8 A;  3HM8 A;  1NKB A;  1GOC A;  4CD3 A;  1U45 A;  4K43 A;  3SQ2 A;  2I7N A;  3D2E A;  3G0Z A;  5FRN A;  4E0D A;  5KGX A;  1JXB A;  4KO0 A;  4KRE A;  4HVJ A;  1K9M O;  2F8S A;  1XWL A;  4IWV A;  3R8E A;  2HOE A;  4H5R A;  5EU7 A;  3LWL A;  4CEF A;  4B9N A;  4OPK A;  3OJS A;  2G8I A;  4CJE A;  3RVC A;  3CQX A;  3TAQ A;  4O55 A;  1DGK N;  2HF4 A;  4DMN A;  4H5V A;  4CK2 A;  4ELU A;  1EQY A;  2QI2 A;  3AAR A;  2ASM A;  4CF0 A;  3I8B A;  3CME N;  1NJW A;  1JCG A;  4WFB L;  3RMA A;  2BGG A;  1VRT A;  3KZB A;  4NO7 A;  3P39 A;  1REV A;  1SKR A;  2E6L A;  4J2B A;  3L2W A;  1L5U A;  2HMP A;  1HNV A;  4KB1 A;  2P5G A;  1WSI A;  4B8A B;  3MX2 A;  1XNR K;  3CJA A;  1SV5 A;  2FSN A;  1HNZ K;  2NRX A;  1QVF M;  3ZSY A;  4GVM A;  2O8F A;  1BIZ A;  1HNX K;  1U47 A;  3AAP A;  4BRD A;  5DM7 L;  4E7L A;  1QSL A;  1TYQ B;  3MDQ A;  1ZXO A;  1BG3 A;  1C1A A;  3MED A;  3BF1 A;  3V4I A;  3U8X A;  3EO3 A;  1RT1 A;  4JK7 A;  4A5B A;  4CJ3 A;  4KHU A;  2KW4 A;  3E1Y A;  3CC4 N;  3VN5 A;  5SZT A;  3DLR A;  2KKZ A;  2F9W A;  1NK7 A;  1QZ5 A;  4DS5 A;  3A0I X;  3LPT A;  4OGE A;  4CHZ A;  3VQA A;  2UXC K;  5HRR A;  3I33 A;  3DLH A;  2NRV A;  3QLH A;  4DU1 A;  4KHW A;  2FF3 B;  5E84 A;  2ZF5 O;  2BAN A;  1NGJ A;  1VSF A;  3QIN A;  3OYJ A;  1J6Z A;  5IWA K;  1K73 O;  4CJV A;  4BQL A;  1VQ7 N;  4M3Z A;  4DWI A;  2DY4 A;  3THY B;  3IKM A;  1J53 A;  1LW0 A;  4QS7 A;  1HJO A;  3PUF A;  2O8E A;  2YKM A;  3O4W A;  2P9U A;  4B3R K;  3A5N C;  2JWK A;  3ZSW A;  3M8P A;  3E66 A;  3M1F A;  4M63 C;  4BGB A;  3TAE A;  4B8C A;  3TI0 A;  2NRW A;  2AP1 A;  1QE1 A;  2WFB A;  4WQ4 C;  4H4M A;  4H0T B;  2HVH A;  4CZG A;  5FLX O;  1SQK A;  1VQ8 N;  3UE5 A;  1WSJ A;  5SWM A;  4BGA A;  1CXQ A;  3K57 A;  4A2A A;  4AH9 A;  4XIU A;  4DFK A;  3DWL A;  4N5S A;  4CK3 A;  3T1A A;  2OA8 A;  3OYE A;  1MDU B;  3LPU A;  3GDQ A;  3LP1 A;  3QO9 A;  4GV9 A;  4PA1 A;  1LAV A;  1KCF A;  2ZJP L;  5HBM A;  4QCL A;  2GBZ A;  1U6Z A;  4Y1D A;  4W5N A;  4JD2 A;  1RT7 A;  3HVT A;  4H0X B;  3HP9 A;  2WTU A;  4BVO A;  2QXF A;  4OGC A;  4HTL A;  2FBY A;  4DQR A;  2RHK A;  5JVH L;  4FK4 A;  1CZB A;  3D2F A;  3M6G A;  5CYQ A;  5J2N A;  3DOL A;  3F5T A;  4RW8 A;  4CJU A;  4BG9 A;  1KSP A;  2AJQ A;  4LF4 K;  3AO1 A;  3CMA N;  2A1S A;  5EVZ A;  4B9M A;  3EKS A;  1OH7 A;  2ZGZ A;  3MEE A;  4CJR A;  2NRR A;  1T7P A;  4CCH A;  1EP4 A;  3VQ9 A;  3A5O C;  2HBM A;  4U67 L;  4QAG A;  5AZJ A;  3ITH A;  4JI8 K;  1RFQ A;  5AQW A;  4ILH A;  3ZT3 A;  3HZ6 A;  2H3G X;  3CCV N;  4NXM K;  3G4S N;  3QES A;  3K5O A;  2HST A;  4X66 K;  4DTO A;  3C7N B;  4ZHR A;  1S3X A;  2QXL A;  1RTI A;  3ZX3 A;  3KK7 A;  3VEV A;  2GUP A;  4OX9 K;  4BEC A;  5MLC Q;  1IBL K;  3OYL A;  4JRQ A;  4EZ6 A;  5ADX H;  2GUI A;  3HRG A;  5AQO A;  4KHQ A;  1N6Q A;  2KFN A;  5C15 A;  3HPH A;  5CHI A;  4RW4 A;  2P5O A;  4CF8 A;  4OPJ A;  1YTU A;  1C6V A;  4BRA A;  3V9Z A;  4WFA L;  3OS0 A;  4DLE A;  4IFV A;  4KHP K;  4DR2 K;  4DV4 K;  4FWL A;  3DM2 A;  1KFS A;  1BUP A;  1BA0 A;  3CFP A;  1RCH A;  2F9T A;  4BE1 A;  3S5T A;  4FWS A;  1OH8 A;  2VWK A;  3AVH A;  2V7Y A;  3SBT A;  1P8Z A;  3HST B;  3O9U A;  5ADX A;  4G1Q A;  2IGI A;  5AQT A;  1TV6 A;  2YJE A;  1YF5 L;  4CF1 A;  4CJQ A;  5JEN A; 
#chains in the Genus database with same CATH homology
 1DEJ A;  1JCE A;  3UKU B;  5JVG L;  2W00 A;  4EIA A;  3OHR A;  5KPR A;  4JN4 A;  3PIP L;  1K8A O;  3LDQ A;  4YOU A;  3ZYY X;  4JHD B;  2Q0R A;  3L4Q A;  1HKG A;  3KWG A;  3MN5 A;  1HPM A;  1RDW X;  3MX5 A;  4WYB A;  3ZEU B;  2ASO A;  4WQ4 A;  4A5A A;  3FE1 A;  3VEW A;  1YUW A;  3D2F B;  4B1W B;  5KQ8 A;  4K41 A;  4RWT A;  5GIP A;  2BUP A;  1YJ9 N;  3Q7C A;  1U2V B;  2A42 A;  3LDP A;  4FPB A;  3P38 A;  4H0V B;  1NGC A;  3GG4 A;  5GAG P;  3UB5 A;  3VGK A;  4CI6 A;  5F1X A;  3ATV A;  5AZI B;  3O1W A;  2A6A A;  4FWR A;  2BH1 A;  1VQ9 N;  5GAD P;  4H0O A;  3O80 A;  3C6A A;  4ISF A;  3ID8 A;  3MWT A;  5FPM A;  4PHT X;  1BOT O;  1HLU A;  5KQD A;  1IG8 A;  2QA4 N;  4H5N A;  1G99 A;  1ZC6 A;  3VOV A;  2D1K A;  1SZ2 A;  4JNE A;  3TTF A;  4CBX A;  3CPW M;  2Q1N A;  5AZJ B;  5BRE A;  1CZA N;  3AGK A;  1N8R O;  2DPN A;  2GTD A;  5AQZ A;  3EE8 A;  4FWP A;  4QS8 A;  3H46 O;  1VQL N;  4DB3 A;  4BY9 C;  3K9K A;  3O08 A;  3HTV A;  3KHY A;  4BG8 A;  5LJW A;  3F9M A;  2GEM A;  5CE3 A;  3NMU A;  3I55 N;  3FZM A;  4LC9 B;  1K8K B;  1W97 L;  5C10 A;  3VPZ A;  1LCU A;  4C1N K;  1Y64 A;  1GLA G;  3RSE B;  2GWJ A;  2YJF A;  2P9N B;  5CR4 A;  3FFK B;  3FZF A;  3JXU A;  3CPE A;  4H03 B;  3AGR A;  2QWL A;  5JLF A;  4O8K A;  2P9I B;  4FO0 A;  4JKF A;  4AF1 A;  5EX5 A;  3R1X A;  3GL1 A;  1SAZ A;  4XH1 A;  1DT9 A;  2KLA A;  3PIO L;  3LDN A;  4ILJ A;  3VES A;  1KAZ A;  4CZI A;  3B8A X;  4JKH A;  2CGL A;  2ZWH A;  3SMS A;  1NJI O;  1NGB A;  3FZH A;  4HWI A;  5AQQ A;  1BDG A;  4MLE A;  4U7B A;  2C1G A;  3KWI A;  4KH4 A;  1KAY A;  3R6M A;  1NMD A;  3ATU A;  4BQZ A;  1MA9 B;  3P4I A;  3FZK A;  4JKC A;  4H0Y B;  5JIC A;  4RCH A;  3DXK A;  3WXK A;  4PL7 A;  5TKY A;  2Q31 A;  1XC3 A;  3VF6 A;  1BU6 O;  3VTH A;  4KBO A;  4YOT A;  3VEY A;  2P9I A;  3FZL A;  3G6E N;  2A41 A;  3CJB A;  4XEI A;  3FLC O;  2P9K A;  4R79 A;  1VQP N;  4H5T A;  2HBK A;  4BRG A;  4CZE A;  5BRD A;  4IFE A;  5AQS A;  3E9L A;  4BC2 A;  4WQ5 C;  3SAF A;  3L6Q A;  1T3V A;  3CQY A;  2HBL A;  1Z6R A;  5F2R A;  2P9P B;  1NGA A;  3EN9 A;  1GLL O;  4JEP A;  5C2F A;  2EWS A;  3H45 C;  1H1V A;  2QWM A;  3VEX A;  1NGD A;  3AAQ A;  3LM9 A;  1YI2 N;  3VER A;  2E1Y A;  3LDL A;  3ENB A;  1JCF A;  5AR0 A;  3T7Z A;  3L0Q A;  5BPN A;  3UKR B;  5BRF A;  3ZX2 A;  3BUZ B;  2PFU A;  1X9J A;  1HUX A;  3TPQ A;  5C12 A;  2P9L B;  3L4I A;  1C0G A;  3C0B A;  5TKW A;  4BR0 A;  3CCJ N;  3VEZ A;  3W3D A;  4BRF A;  3WXL A;  5E26 A;  1X3M A;  4FOI A;  2QWO A;  1TYQ A;  3IMX A;  4ISE A;  4ISG A;  3VF4 A;  3J8A A;  2V51 B;  2Q36 A;  2P9S A;  3DJC A;  5AQY A;  2JWL A;  4DCH A;  5BN8 A;  3H1V X;  4FPA A;  1NGG A;  4A62 A;  1TUU A;  4WCE L;  5KPZ A;  2VGM A;  3H3N O;  4FWM A;  1VQN N;  4XJX A;  4MDA A;  4AM6 A;  2GEL A;  1IJJ A;  2WUS A;  2YHX A;  2HBJ A;  3CI5 A;  4M7Y A;  4JKD A;  4M7X A;  2A40 A;  2NRT A;  2CGJ A;  2NLX A;  3LDO A;  4IZ9 A;  5M1F A;  2BTF A;  4WFN L;  3NVM A;  5FPN A;  4KH6 A;  5LJV A;  2E20 A;  1KD1 O;  3CCE N;  3R9P A;  3CJ9 A;  5H1S Q;  3MWP A;  4MO5 A;  4PKH A;  4YDU C;  3QBW A;  3SMP A;  4F9O A;  3SJH A;  4BRO A;  3N4P A;  4MO4 A;  5M1K A;  1JJ2 M;  5EXW A;  1YHQ N;  4EHU A;  2V7Z A;  1NGF A;  2E2O A;  1VQO N;  2YHW A;  3BF3 A;  4FVU A;  3EE9 A;  3D6R A;  3ZET B;  4FSV A;  2IVP A;  2VWB A;  3CJ7 A;  1WUA A;  3FGU A;  5AFU H;  4JK9 A;  3MK6 A;  4YDU A;  5M1Q A;  3CC7 N;  3WEE A;  3IDH A;  3CCR N;  3VEO A;  1O13 A;  1VQ5 N;  4BRI A;  3GOI A;  3TTD A;  4C1N I;  4CZM A;  3IUC A;  4GV3 A;  3MN7 A;  2IVO A;  4YOR A;  1GLB G;  2Q2R A;  1ZBS A;  3EKU A;  1NGH A;  2YX6 A;  4NLB A;  3WUH A;  5JMV A;  3JS6 A;  3HOT A;  1T6D A;  3BP8 A;  5AQL A;  4GVE A;  2ASP A;  5BPM A;  3HM8 A;  1YIT N;  3ZET A;  4CD3 A;  3U4L A;  4BR9 A;  4K43 A;  4BVP A;  2I7N A;  3D2E A;  2NRZ A;  4MDB A;  2QW9 A;  4B1X B;  3T69 A;  4BC3 A;  4DQ8 A;  4CZF A;  3CER A;  4K42 A;  4E1J A;  2Q0U A;  1K9M O;  1KC8 O;  4BR2 A;  4IWV A;  4IO9 L;  3R8E A;  4CZK A;  4FWN A;  2HOE A;  3HSC A;  4O5F A;  4A61 A;  5KPT A;  2E8A A;  2Q97 A;  4H5R A;  4Y0W A;  3S41 A;  1X3N A;  3DXK B;  3A5M C;  1DKG D;  3QFU A;  3CC2 N;  2V52 B;  5AFU A;  2A3Z A;  3DLL L;  4FWQ A;  1Q82 O;  3RVC A;  3CQX A;  3E9P A;  2P9K B;  1DGK N;  2HF4 A;  3C6H A;  4H5V A;  3WXI A;  3ENH A;  3WXJ A;  4A59 A;  1M1K O;  1EQY A;  1V4T A;  2QI2 A;  3AAR A;  2ASM A;  4OPA A;  4PL8 A;  3I8B A;  4H0P A;  3CME N;  3MMV A;  3O9R A;  5AQH A;  2CGK A;  1JCG A;  4BEB A;  4EFH A;  4WFB L;  3IFR A;  3KZB A;  4NO7 A;  4PKG A;  1NGE A;  3P39 A;  1ATS A;  3CET A;  3GE1 A;  4NLC A;  3MN9 A;  4IOC L;  2GX9 A;  2WC9 A;  5DM6 L;  1Q7Y O;  2HMP A;  3TSP A;  1TUY A;  1ATN A;  1Q86 O;  4CD1 A;  3MX2 A;  5AQK A;  4BRE A;  3CJA A;  2FSN A;  4YOV A;  2OTL N;  3O1B A;  2NRX A;  1QVF M;  4IDH A;  4BRP A;  3QBX A;  5FPE A;  3QML A;  3VMF B;  4XH4 A;  4A2B A;  3WQU A;  4BRK A;  4I6M A;  1VAZ A;  4NB4 A;  3AAP A;  4BRD A;  5DM7 L;  1TYQ B;  3MDQ A;  1ZXO A;  1BG3 A;  2E2N A;  3O9Q A;  2P9S B;  5AQU A;  1VQ6 N;  5AQG A;  4XH5 A;  4WQ5 A;  4FOE A;  1YAG A;  4ILG B;  5AQI A;  3K9J A;  4DHY A;  3BF1 A;  3U8X A;  3EO3 A;  4CZJ A;  4IOX A;  3O8M A;  4JK7 A;  1BWF O;  4JKA A;  4A5B A;  4BRC A;  2OTJ N;  3MCP A;  3E1Y A;  3CC4 N;  3CD6 N;  3VGM A;  2VGN A;  2KKZ A;  2F9W A;  2NZT A;  3CCU N;  1YXQ A;  1QZ5 A;  3R3L A;  3A0I X;  3D7E O;  5C0Y A;  2UYT A;  2W40 A;  2FSK A;  4BR4 A;  2AA4 A;  4YOW A;  3TSU A;  4B1V A;  5ELZ A;  1E4G T;  1ESV A;  1OVY A;  3VEN A;  1GLJ O;  1T6C A;  3I33 A;  2NRV A;  4L3Q A;  3G71 N;  2FF3 B;  5E84 A;  2ZF5 O;  3C7N A;  3EZW A;  1NGJ A;  1QQO A;  2WBN A;  3F2K A;  4DKW A;  1BA1 A;  1QHA A;  3CF5 L;  1RDU A;  4G9Z A;  1J6Z A;  4CBW A;  2QWN A;  1Z05 A;  1K73 O;  1BO5 O;  1KXP A;  2E88 A;  2KHO A;  4BQL A;  5F0X A;  3BEX A;  3WEE B;  1YJW N;  1VQ7 N;  4FWK A;  4O8U A;  1E4F T;  5GIN A;  1Q81 O;  3IKM A;  4BRQ A;  3TTC A;  4QS7 A;  3U9D A;  4BRN A;  2ZJQ L;  3DXM A;  2GWK A;  3G25 A;  1HJO A;  3ULE A;  3MCA B;  3O4W A;  4IXC A;  3OBY A;  3SBG A;  1HKB A;  2P9U A;  1KAX A;  1GLD G;  2E2P A;  3FR0 A;  3H3O B;  3A5N C;  2JWK A;  4K25 A;  2NRH A;  1QQM A;  4B9Q A;  2D4W A;  3WQT A;  4BRM A;  3E66 A;  2ZJR L;  3N4Q A;  4H5W A;  1YIJ N;  3M1F A;  2FF6 A;  4M63 C;  3I56 N;  3GBT A;  4BGB A;  3O9S A;  2ITM A;  3D2E B;  3DAW A;  3ID6 A;  2NRW A;  2AP1 A;  2NNW A;  5AQX A;  2QEX N;  3CCQ N;  2YI1 A;  2VYP A;  2WFB A;  4WQ4 C;  3HI0 A;  3VGL A;  4H0T B;  3P31 A;  4JD2 B;  4CZG A;  1SQK A;  1VQ8 N;  3UE5 A;  4BGA A;  5HOO A;  1GLE G;  1NGI A;  5LY3 A;  4A2A A;  3DWL A;  1MWK A;  3HOS A;  1XQS C;  2FLO A;  1VQ4 N;  3A5L C;  1MDU B;  3EL2 A;  2A5X A;  3GDQ A;  1MWM A;  3M3Z A;  4GV9 A;  3NVK A;  2ZJP L;  3CIP A;  1U6Z A;  3OW2 M;  4IEI A;  3PLA A;  4Z94 A;  4JD2 A;  3M5R A;  1S22 A;  2HF3 A;  5BRH A;  3UKU A;  4GNI A;  4BRH A;  4H0X B;  1NLV A;  5FPD A;  4BVO A;  3HBT A;  4HTL A;  4JHD A;  3O6W A;  5I9E B;  3H1Q A;  1EO1 A;  5AQJ A;  2RHK A;  3ZEU A;  5JVH L;  4FWO A;  2C1I A;  2FSJ A;  3D2F A;  3M6G A;  3SK3 A;  4FL9 A;  3WT0 A;  3CCM N;  3F5T A;  3WXM B;  4UY8 O;  3TU5 A;  4BG9 A;  3SAH A;  5AQF A;  4CZL A;  1U2V A;  1RGI A;  5BPL A;  3U9Z A;  1M90 O;  1XUP O;  4IEE A;  4OPH A;  2W41 A;  4B1Y B;  1GLF O;  1QZ6 A;  3CMA N;  5AZI A;  5EVZ A;  4OO1 J;  3EKS A;  2IVN A;  5M1N A;  3W0L A;  4I6M B;  4BE7 B;  1YVN A;  2CH6 A;  2ZGZ A;  3ENO A;  3OBW A;  2J4R A;  1HX1 A;  2I7P A;  3VET A;  4BC5 A;  1S72 N;  4IJA A;  2NRR A;  4BR5 A;  2QWQ A;  1V4S A;  1GLC G;  3A5O C;  2HBM A;  4AM7 A;  4U67 L;  5AZJ A;  3E9O A;  3O9T A;  3SAG A;  3QDK A;  1RFQ A;  3H6E A;  5AQW A;  4ILH A;  2H3G X;  3HZ6 A;  3CCV N;  3A8Y A;  1K8K A;  3KVG A;  2PBD A;  5GAE P;  4B1Z A;  4YOY A;  1VQM N;  4IJN A;  5AQM A;  4CBU A;  5B8H A;  1QVG M;  5M1P A;  3G4S N;  3RSE A;  1NM1 A;  1D4X A;  2P9N A;  4JKE A;  3LL3 A;  3OA9 A;  2HST A;  2PAV A;  1VQK N;  3SLC A;  3C7N B;  4A57 A;  4WF9 L;  1S3X A;  2QXL A;  2YCH A;  4BRL A;  3VF2 A;  3ZX3 A;  1HKC A;  1SS6 A;  3KK7 A;  2CH5 A;  3VEV A;  2GUP A;  4BEC A;  2E1Z A;  1OKJ A;  1WOQ A;  4JKB A;  2RE2 A;  1NBW A;  3J7Z O;  3QFP A;  5MLC Q;  5AQR A;  3TSQ A;  4QS9 A;  1C0F A;  5ADX H;  1ILY A;  5C2D A;  3HRG A;  3DXM B;  3ULE B;  5AQO A;  1NWK A;  2QWR A;  5AQN A;  4JKG B;  5AQV A;  4PKI A;  2P9U B;  4CJ7 A;  1KQS M;  4EAH D;  2QWP A;  4GY2 B;  5C15 A;  2VCP A;  5JLH A;  3ZX0 A;  3CCL N;  2OAN A;  5CHI A;  2D0P A;  2YHY A;  2QTD A;  3LM2 A;  5HL7 L;  4IOA L;  4BRA A;  3CHW A;  4JK8 A;  4WFA L;  4IO8 A;  4KH5 A;  2IIR A;  3CXC M;  2F7T A;  2P9P A;  4BC4 A;  2FXU A;  3QIC A;  5BN9 A;  4FWL A;  2E2Q A;  2D0O A;  2ZGY A;  4J8F A;  5EOY A;  3MN6 A;  1P90 A;  4B1U B;  1T44 A;  3AY9 A;  3CCS N;  1BUP A;  4JKG A;  1BA0 A;  4RTF D;  5EY4 A;  2F9T A;  1R59 O;  3CJ1 A;  3O5B A;  4BR7 A;  1LOT B;  4FWS A;  3UKR A;  1YJN N;  1Q18 A;  2QM1 A;  1W2B M;  1ATR A;  2V7Y A;  4GV6 A;  3SBT A;  4EHT A;  5BR9 A;  1P8Z A;  5GAH P;  4YOX A;  4MLH A;  4CZH A;  3VTI A;  3QB0 A;  3O9U A;  5ADX A;  5AQT A;  4JAX A;  5GIO A;  1QQN A;  2P9L A;  2YJE A;  3Q7B A;  1YF5 L;  3C65 A;  3CJC A;  4C23 A;  5AQP A;  5M1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...