3A5OC

Crystal structure of a dictyostelium p109i ca2+-actin in complex with human gelsolin segment 1
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
370
structure length
366
Chain Sequence
b'QALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGKDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAILNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAAAAIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gelsolin
publication title Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 114
structure length 366
sequence length 370
ec nomenclature
pdb deposition date 2009-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5oC01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5oC02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3a5oC03
3AARA 4FWKA 4FPAA 2E8AA 1R59O 3CETA 5AQWA 1S3XA 5AQZA 3VPZA 4A2BA 3QFUA 5AQPA 4BG9A 5ADXA 3H46O 4GNIA 2I7NA 1BUPA 5F2RA 5AQFA 5AQNA 3CJ1A 2ZGZA 4WQ5C 2FXUA 5CE3A 3LM9A 3BF1A 3U9ZA 4H0OA 4GY2B 3ZEUA 1K8KB 3VF2A 4MO5A 2GTDA 5BRFA 3D2EB 3WQTA 5AZIB 4CZGA 4BRAA 2E1ZA 2GWJA 4F9OA 2IIRA 1GLBG 4I6MB 3GE1A 5BR9A 5KQ8A 3R9PA 4BRDA 3H1VX 5KQDA 2P9SB 1KAYA 4CD3A 3VEVA 4B1VA 1NGJA 2NZTA 1MWKA 2E2QA 1K8KA 3J8AA 4WQ5A 5AQSA 2QWMA 5AQQA 1GLLO 4QS7A 4CD1A 3VEWA 3VF4A 4IJNA 4XEIA 4EHTA 4FPBA 3WXLA 4CZMA 4BRLA 2HOEA 2Q2RA 1KAZA 2HF4A 2P9SA 4BC3A 2VWBA 2AP1A 1HUXA 2D1KA 3CJ9A 3CQYA 3VEXA 2FSJA 4LC9B 3DXKB 2NLXA 3EO3A 2YHWA 3A8YA 2F9TA 3CJBA 3WXJA 3LDOA 5BREA 4BC5A 1BDGA 2NRHA 4H0VB 1S22A 4NO7A 1RDWX 1C0FA 2E2OA 5AQIA 4RCHA 5LJWA 3O6WA 2QW9A 3HI0A 3ENOA 5KPTA 4CZKA 1H1VA 1SQKA 4H5VA 2QWQA 3MDQA 2FF6A 3O1BA 3TU5A 3JXUA 4FWPA 2P9LA 2PAVA 4J8FA 1RGIA 5ELZA 4MO4A 4CJ7A 3SJHA 2E88A 4JNEA 2CH5A 2QWNA 4BVOA 4AM7A 3CJ7A 2WUSA 4FWQA 5AFUA 1DKGD 2VYPA 4NB4A 5FPNA 2YHXA 2A5XA 4BC2A 4M7YA 1GLJO 1HKCA 5AQXA 1NGHA 4ISFA 3HBTA 2EWSA 3HM8A 1WUAA 4IO8A 1X3MA 2E2NA 4O5FA 4H5TA 1U2VB 4IWVA 4JD2B 4FWRA 4Z94A 1SAZA 2E1YA 1GLCG 3ATUA 4H5WA 3UKRB 4B1WB 1MA9B 4WYBA 3IDHA 4JAXA 5B8HA 1JCFA 4CBWA 5KPRA 2YJEA 4XH1A 3I8BA 5FPDA 4JHDB 4BRKA 3A5OC 3DWLA 4K43A 4B1XB 4BRCA 4A61A 4FL9A 1NM1A 3EL2A 2YCHA 5BPNA 3CIPA 4JN4A 4RTFD 3CERA 2ASOA 3ZX2A 3GG4A 3FGUA 1HLUA 2H3GX 3A5LC 4CI6A 1Z6RA 1HKGA 5FPEA 2D0OA 1ZC6A 1NGBA 5AQOA 1HJOA 4PKGA 1NGEA 3AAQA 3WXKA 2A42A 1XUPO 1BA0A 3FZLA 4FWOA 4BR9A 3D2FA 2GWKA 3ZEUB 4BR7A 2D0PA 1CZAN 5I9EB 1QHAA 1SZ2A 2P9PA 2Q97A 3C0BA 5EXWA 1ZBSA 5AZJB 1C0GA 2YI1A 3ULEB 3MN6A 3DAWA 4CZLA 3L6QA 2Q31A 1DEJA 3O08A 4BGBA 2E20A 4BREA 4EAHD 4XH5A 5AQHA 1HKBA 3UE5A 5AZJA 3ULEA 4MLEA 5EX5A 3MMVA 5TKYA 4PL7A 3FE1A 3M6GA 4AM6A 2I7PA 3BF3A 1T6CA 2GEMA 3KZBA 2QWLA 3DJCA 1Q18A 3GL1A 2QWRA 2F9WA 4BRGA 1DGKN 2ASPA 3VEZA 3BUZB 3VF6A 2V7ZA 1HX1A 4L3QA 1YAGA 3HTVA 4ISGA 4BC4A 3FR0A 2CGJA 4FO0A 5BN9A 1NGFA 4H5NA 3VGLA 2FLOA 4H0XB 5JICA 2ZGYA 4EFHA 3CQXA 3IUCA 4EHUA 1TUUA 2P9LB 3CHWA 3CJCA 5AQTA 1ATNA 1X9JA 3F9MA 3LDNA 1HPMA 5BN8A 4CZEA 1J6ZA 1D4XA 4DHYA 3CI5A 3ZX3A 3H1QA 3VEOA 2ZWHA 4BRIA 2DPNA 3WXIA 3W0LA 3WEEA 3HSCA 5BPLA 3QFPA 3LM2A 3SLCA 4IJAA 3W3DA 3JS6A 4XH4A 3ATVA 4QS9A 2P9UB 4DB3A 4BRQA 1NGDA 1YXQA 1GLEG 3GDQA 4B9QA 1P8ZA 3RSEA 2BTFA 3O5BA 3AAPA 3DXMB 4BRNA 4K25A 4DCHA 1GLAG 3WT0A 2Q36A 4BQLA 5JLHA 2OANA 1ATSA 3M3ZA 3SMSA 1XQSC 2P9UA 2QM1A 4BRFA 3VEYA 4KBOA 5EVZA 3O4WA 4Y0WA 3G25A 3DXMA 2FSNA 3UB5A 1LOTB 3ZX0A 2HF3A 3BP8A 4H5RA 2CH6A 5EY4A 3AY9A 3VOVA 3A5MC 4EIAA 1QZ6A 3QBXA 4PKHA 4B1UB 4BGAA 1BU6O 4BVPA 5BRDA 3ID8A 3FZKA 1V4TA 2V51B 1TYQA 2IVPA 4QS8A 1NLVA 4PL8A 2VCPA 3SK3A 1X3NA 3IMXA 5AQGA 5EOYA 4A62A 1GLFO 3LDQA 2YHYA 2ITMA 3D2FB 1Z05A 1GLDG 2J4RA 4CBUA 5AQRA 1MWMA 1WOQA 3U9DA 5ADXH 1E4GT 5E26A 2P9PB 4BRPA 1NGCA 3H45C 3QB0A 4DQ8A 1IJJA 2W41A 4FOEA 3L0QA 3LDPA 1BA1A 4RWTA 2CGKA 5LJVA 4BROA 3KVGA 1LCUA 5AQKA 4FWSA 4IZ9A 5AQVA 4H03B 1IG8A 3R6MA 4O8KA 4CZIA 4CZHA 3LL3A 1JCGA 2FSKA 2V7YA 3C7NB 4CZJA 1BOTO 1V4SA 4YDUC 5JMVA 3OHRA 4HTLA 3VGKA 2P9IA 4ISEA 1Y64A 4WQ4C 2FF3B 3FLCO 1QQOA 5AQMA 3O1WA 2PBDA 3M1FA 3O80A 3MK6A 3C7NA 2IVOA 3O8MA 3P4IA 3S41A 1QQMA 2HMPA 3I33A 4YDUA 1ZXOA 1YVNA 3MCPA 3ZETB 4FOIA 1QZ5A 1NWKA 3VERA 1U6ZA 4WQ4A 2UYTA 3EKSA 1TUYA 2Q0UA 3BEXA 4M63C 4B1YB 3MN7A 1OKJA 3WUHA 1T44A 4BR4A 5AR0A 2P9KB 1EQYA 2ASMA 3ZETA 3IFRA 3B8AX 4CZFA 3A5NC 5FPMA 2YJFA 3D2EA 3VENA 5LY3A 3WEEB 5AZIA 2P9NB 3VESA 4E1JA 4H0YB 4BR0A 4I6MA 2GUPA 3GOIA 4BRMA 2P9KA 5AFUH 1G99A 5F1XA 3MN5A 3H3NO 3FZMA 3RSEB 2Q1NA 2P9NA 3HZ6A 1BWFO 4BG8A 5AQJA 3MN9A 4M7XA 1NGIA 4BR2A 3H6EA 3FFKB 3EKUA 3UKUB 5AQYA 5KPZA 1KAXA 2IVNA 3DXKA 4H0TB 5BPMA 3L4IA 5F0XA 1ESVA 1QQNA 3QDKA 4K41A 4PKIA 2AA4A 3WQUA 4CBXA 2W40A 3UKUA 4BR5A 3ENHA 4H0PA 5AQLA 3H3OB 1TYQB 3EZWA 3CJAA 3LDLA 5E84A 4BRHA 1T6DA 2QWOA 2CGLA 1BO5O 3FZHA 4K42A 2KHOA 3U8XA 3VETA 1NBWA 2ZF5O 1RFQA 3SMPA 5AQUA 3D7EO 5BRHA 3EN9A 2QXLA 5JLFA 2E2PA 4B1ZA 2A3ZA 1MDUB 2V52B 1YUWA 1NGAA 4HWIA 3U4LA 4FSVA 1NGGA 1JCEA 3FZFA 4FWNA 1E4FT 2A6AA 2GELA 2QWPA 2A40A 3QICA 2Q0RA 3TPQA 3QMLA 1U2VA 4JD2A 2D4WA 3GBTA 3VGMA 3UKRA 1ATRA 2A41A 2BUPA 3KHYA 3QBWA 4A2AA 4FWLA 3A0IX 1KXPA 2P9IB 4MLHA 1NMDA 1XC3A 4JHDA 4BQZA 4IXCA 4FWMA 4C23A 1BG3A 3R8EA
chains in the Genus database with same CATH superfamily
1ZBIA 1VHXA 3CYMA 3OYCA 3CETA 4DR2K 4BWJA 3VPZA 2HB5A 3H46O 4DTNA 2I7NA 1QSYA 4MDBA 1KFSA 1C0TA 1HYZA 4KH4A 1UA0A 3OYBA 4WQ5C 1R0AA 4JK7A 4DR5K 1SKRA 1N36K 1KRPA 3U9ZA 4W5TA 4DR7K 5GINA 2VG6A 4CJPA 1T05A 1EX4A 4MO5A 5BRFA 3WQTA 3NE6A 4BRAA 3G10A 4I7FA 1QVGM 3MEDA 4K8XA 5GAEP 5DK5A 5CYMA 3K5LA 1KAYA 4Z4FA 2BANA 3VEVA 1JLFA 4B1VA 4JKAA 4E7JA 2WONA 4WQ5A 3J8AA 4CGIA 3O4QA 5AQQA 1QS4A 4GVMA 5HRRA 3VF4A 1A5VA 4KAZA 4FPBA 3WXLA 1RBUA 4NXMK 2HOEA 3L2QA 4PWDA 4BC3A 1BI4B 1HUXA 4C8NA 3CJ9A 3VEXA 4YOUA 3KLHA 3DXKB 4DTUA 2O8CA 3A8YA 3CJBA 4CJKA 3V1RA 3E66A 5FDLA 4C1NI 1BI4A 1NMNA 3DLLL 1K73O 2NRHA 1S22A 4NO7A 1NK8A 1ASUA 2D0CA 3H08A 3O6WA 1U48A 2QW9A 4E1NA 4CZKA 3V9UA 3HP9A 4E7LA 4QOZB 3OYLA 1VQMN 4FWPA 4KO0A 3HJFA 1RGIA 3RMBA 4CJ7A 3NF9A 4A57A 4CF9A 1TV6A 3EZ5A 4QAGA 4DFMA 3BZCA 1YHQN 2VYPA 4KTWA 2XO7A 1F21A 2YHXA 4BC2A 4YOYA 1GLJO 5AQXA 1BL3A 2EX3A 2DY4A 2X6SA 2EWSA 2Z1GA 1WUAA 3J81O 3AVKA 3KK3A 4AHCA 3LPTA 4H5TA 4Z4GA 1C6VA 3HVTA 1W0HA 2VGMA 1K6YA 4LF9K 4O0JA 1VSHA 1I39A 5B8HA 1X9SA 5KPRA 1S1XA 2UXCK 1VAZA 3DWLA 4K43A 1YI2N 2DFFA 3SNNA 4BDYA 1XMQK 3C6UA 3G4SN 4B3OA 2GBZA 3E9LA 1TK8A 3GG4A 3FGUA 2ZQBA 2H3GX 3SBTA 4CESA 1Z6RA 2D0OA 3AAQA 3R3LA 4F2SA 2ZJQL 4EP4A 4HUFA 3PIPL 3VQDA 3DMJA 2HNYA 2WOMA 3CCLN 4CJWA 1SZ2A 5GAHP 2Q97A 2YNHA 1C0GA 2W00A 3MN6A 2KW4A 4JEPA 3L6QA 1DEJA 3NGZA 3O08A 3S3MA 4BREA 4FLVA 5FRNA 3ZSWA 4DTSA 2G8WA 1N33K 3QNOA 1TK5A 4E0DA 3P39A 3VA0A 4ZHRA 2HHWA 3DRRA 4AM6A 4B08A 3S3NA 1QSSA 3DJCA 1VQ5N 1Q18A 3L2RA 3CM5A 1N6QA 4JKCA 3IRXA 1DGKN 2ASPA 3VEZA 3QEXA 1W2BM 4BE2A 3BUZB 3MXIA 4L3QA 1SL0A 3HTVA 1WSEA 2KKZA 2IOCA 4AH9A 4E7KA 4H0XB 3KJVA 4EFHA 1HYSA 1VSDA 4KHWA 4EHUA 3CMAN 4JV5K 3CHWA 4DQSA 3CJCA 2AJQA 1ATNA 4CJ5A 3F9MA 3LDNA 4JRPA 5BN8A 4CZEA 2ZD1A 5KGXA 5I3UA 3LP0A 1BIUA 2BDPA 1YVUA 2DPNA 3WXIA 4IDHA 4OKEA 5BPLA 3QFPA 1XMOK 3LM2A 4IJAA 1X9WA 3DOKA 3I0RA 4XH4A 3G71N 3DLBA 4O5BA 4BEBA 1C1BA 4BRQA 1NGDA 3GDQA 4IEIA 3CCVN 4BRNA 2BTFA 4LF7K 3AAPA 3HL8A 1N32K 1IH7A 2VQFK 3TAFA 4DCHA 3LP2A 3V6DA 4DG1A 3O3HA 3NHGA 2OANA 2HBLA 2O8EB 1XQSC 2ATQA 4FM2A 2G8KA 4JI2K 2IC3A 4CGJA 4DV5K 1I3AA 1U47A 2FSNA 1BIZA 4FK2A 3UB5A 2HF3A 3RRGA 4H5RA 4JRQA 2O8EA 2O8BB 4FZXC 4FZYA 2PY5A 4FJIA 3VQ4A 4PKHA 1J9AA 3QBXA 1DTTA 3AA3A 4CEZA 4UY8O 2XY6A 2V51B 1TYQA 2D5RA 1NLVA 4IDKA 4PL8A 3U3YA 5AQGA 3NGIA 1GLFO 3LDQA 1IKWA 2NUBA 4DSEA 2QA4N 1MWMA 4KHSA 4W5OA 4KTZA 3HRGA 4LFAK 4BRPA 3CYGA 4DQ8A 4CW7B 2W41A 4FOEA 2UXDK 2DFEA 3LDPA 4RWTA 3KVGA 4FWSA 4FXDA 3M8SA 5KGWA 1CLQA 3NVKA 1RT3A 3C6TA 1EXQA 2UU9K 3LL3A 3ZSQA 4CZJA 4GV6A 4DS5A 4JKEA 4B9UA 4HTLA 1T3VA 1Y64A 4WQ4C 4DKWA 3LAMA 3O1WA 2XY7A 3QEWA 3O9TA 3O80A 3MK6A 5MLCQ 1E3MA 1U45A 4CF8A 5M1PA 3OTOK 2YNIA 1O1WA 4FLZA 4JI6K 4YNQA 2VG5A 5C2FA 3LWMA 4ILGB 2OTLN 3RMAA 3VERA 1LWCA 1U6ZA 4WQ4A 4M63C 1T44A 1QVFM 5AR0A 3SQ1A 1ZYQA 3ZSYA 3B8AX 3D2EA 3VENA 5LY3A 2KZZA 4I6MA 1FXXA 4BRMA 4ID5A 1C0MA 1FW6A 2Z1IA 3MN5A 4F8RA 3H3NO 4NLBA 4Z4CA 1M90O 3RSEB 4QCLA 4LFCK 2C1IA 1IKVA 4BR2A 1KAXA 5BPMA 3OS2A 3L4IA 1IG9A 3ASMA 5EU7A 1ESVA 3WQUA 2AA4A 3KK1A 2NRTA 4DU1A 3ENHA 1DTQA 3VQ5A 3HM9A 3T69A 3K0SA 1NG9A 5E84A 3HOTA 3DLHA 2HBJA 4H8KA 4CGGA 1LWEA 1NBWA 3ID6A 4ELVA 3QIPA 4FYDA 3OVNA 3L2VA 3D7EO 4CK2A 3V9WA 1IBKK 1RT7A 1RT1A 4O0IA 1RCHA 2VWJA 4HWIA 1NGGA 3V1OA 4FWNA 1LWFA 1BQNA 2GELA 2QWPA 1HMVA 3K5MA 3CPEA 2O8FB 3NBPA 2E4LA 3QESA 3C6HA 2D4WA 3O4NA 3VGMA 3EEQA 5SZTA 3UKRA 4HCCA 4JLHA 3SUNA 3V9ZA 3TAGA 2C1GA 3QBWA 3HT3A 2XY8A 4OX9K 2O8FA 1HNVA 3DRSA 4JHDA 5D3GA 4DTJA 4FWMA 2KFZA 2QXFA 3AVFA 2O8DB 5FLXO 1T03A 4JI7K 4CJQA 3ZSVA 4FJGA 1NJZA 4B9SA 3HPGA 3QFUA 5AQPA 4GNIA 3NF7A 4RG8A 4EP5A 3CJ1A 2ZGZA 2FXUA 3LM9A 4LF6K 1XI1A 3BF1A 5TKWA 4M41A 4JI0K 3HOSA 4GY2B 3ZEUA 3CG7A 3NF6A 3PUFA 3VF2A 1K9MO 4B9TA 5AZIB 4CZGA 1T7PA 1GLBG 5KQ8A 4PQUA 3P5JA 3E1YA 1NKBA 4UQGA 1OH7A 1NGJA 3BDPA 1MWKA 4FM1A 5AQSA 3K5OA 4Z4EA 1GLLO 3VEWA 3LALA 4XEIA 4B9NA 3QETA 4IOAL 3VMFB 2B5JA 1NK4A 2HF4A 4TSXA 4U7BA 1DLOA 4KI6A 4DSKA 3CQYA 4JS5A 2FSJA 1FK9A 4CF0A 4LC9B 4CVNE 4IG3A 3EO3A 3CC4N 1VQON 2G8FA 3CQ8A 3WXJA 3AVHA 5BREA 2PZSA 4C8OA 1ASWA 2RKIA 3M5RA 4K8ZA 3U3GA 4B3MK 5KPTA 4OVLA 3THYA 1ZBUA 5LL6Z 1H1VA 4H5VA 4KH5A 2QWQA 2G8VA 3OYIA 3O1BA 2QEXN 1WSHA 3JXUA 3TU5A 2UUCK 3SQ0A 4J8FA 5C24A 4IBNA 5ELZA 3SJJA 1KLNA 3C94A 3OS0A 4JNEA 2CH5A 2QWNA 4BVOA 3CJ7A 1B92A 1REVA 2OTJN 1UOCA 4NB4A 5FPNA 1HQEA 2A5XA 3AVMA 3T1YK 1HKCA 4BDZA 1NGHA 3Q7BA 3CM6A 3SV4A 3RRHA 4DTOA 1Y97A 4B9VA 1X3MA 4O5FA 3ZT3A 1U2VB 4FWRA 4CHPA 4Z94A 5C12A 2NRZA 3ATUA 4B1WB 4E72A 1L3VA 4WYBA 4JAXA 4CFAA 2YJEA 3AA2A 4DV6K 1I94K 4CEFA 4M3ZA 4CEOA 4B1XB 4BRCA 4FL9A 3J7ZO 1B9DA 2ITGA 2YCHA 1RDAA 4C1NK 3MECA 3OYHA 1HPZA 1C0UA 5BPNA 2OYQA 4JN4A 1W97L 3A5LC 5FPEA 1HKGA 1J5EK 1UWBA 1Z25A 2D0BA 4PKGA 3T1AA 3FZLA 3D0PA 4FK0A 4CJFA 2GWKA 3CMEN 4F2RA 1B9FA 1CZAN 4N76A 5I9EB 1BHLA 1QHAA 2P9PA 2HVHA 3C0BA 1O13A 4I9QA 1ZBSA 3NF8A 4A5BA 5AZJB 4IOXA 3ULEB 1RDCA 3D45A 3DAWA 4KB0A 3NH2A 4RW8A 2E6MA 3MEGA 3QERA 4Y1DA 2E20A 4NCBA 4PHTX 4U67L 1QQCA 1Q86O 5AQHA 1HKBA 1C1AA 3LZJA 2KLAA 5AZJA 3V9XA 2A1RA 3ULEA 5EX5A 2OPQA 1HR0K 3CCJN 5TKYA 4PL7A 4L8RB 1IBMK 4CECA 3M6GA 4OO1J 2I7PA 1BGXT 3BF3A 3IAYA 4J2DA 3KZBA 1C1CA 2O8CB 2QWRA 2IAJA 1VQ8N 3PSIA 3KD1E 4IO9L 4I2PA 5CHIA 3S3OA 3SI6A 3L3VA 3P31A 3VA3A 2E6LA 2P5GA 4BC4A 1IO2A 1VSJA 4C8KA 3I55N 3AVJA 2FLOA 3TTCA 4N41A 3AGKA 4MQ3A 3CQXA 4RW4A 3IUCA 3OS1A 1VRTA 3AGRA 1HPMA 2YNFA 1D4XA 4DHYA 1S1WA 4KKOA 4KHQA 1WSGA 4DU3A 3VQPA 3SLCA 4KREA 5T7BA 1VSLA 3DI6A 3F9KA 3EE8A 2YKNA 4YOWA 4LH5A 3JYTA 1KSPA 3O5BA 3E01A 4K25A 2WFBA 1GLAG 4JKDA 5JLHA 1KVCA 3CXCM 3SMSA 3LWLA 4DR1K 4BRFA 4KBOA 5EVZA 4JKGB 4V19S 3OYJA 4BE7B 4DLGA 1LOTB 3KLIA 3BP8A 4DSLA 1A5WA 1J53A 4DMNA 1ITGA 3DRPA 1RILA 1QZ6A 3L8BA 4BGAA 5BRDA 4JKGA 2HHTA 3ID8A 1VQ6N 1VSIA 3KWGA 4Y1CA 1V4TA 4DV1K 5C2DA 4CEEA 1XNQK 1KVBA 2GUIA 3O3FA 4QS8A 1X3NA 3IMXA 5J2QA 4GKKK 1IKXA 2YHYA 3LAKA 1Z05A 1VQLN 2J4RA 2DFHA 1WOQA 1E4GT 4CFBA 3OYAA 1VQ4N 3K2PA 5M1OA 2XY5A 5LJVA 5IT9O 4BROA 1LCUA 4DFJA 2UXBK 3DLGA 4O8KA 4CZIA 1JCGA 1BISA 2V7YA 3NDKA 1WSFA 1BQMA 4YDUC 1TKDA 1NNEA 1Q82O 3N4QA 2F8SA 3VGKA 2KFNA 2FF3B 3AVCA 3FLCO 1QQOA 2HHQA 2PBDA 5SWMA 3ZSRA 3OYKA 1Q9YA 3P4IA 1QQMA 3I33A 4YDUA 3F2KA 4N47A 5H1SQ 3MCPA 3HPHA 1NWKA 4CHYA 4FLYA 3THWA 1TUYA 2VQEK 1OKJA 3TWHA 4KPYA 3PIOL 4GW6A 3L2WA 3IFRA 2XHBA 2NRRA 3CCUN 2YX6A 4E1JA 4BR0A 4FW1A 4N56A 4LF4K 3GOIA 1JJ2M 3PSFA 1FKOA 4M45A 1RTDA 2JWKA 1J5OA 3M8RA 2BH1A 1LV5A 3OYDA 2HW3A 3OYFA 3K9JA 1RT4A 4LF5K 2Q3SA 2IVNA 3TTDA 1S6QA 1QTMA 1X9MA 5F0XA 2P51A 3QDKA 4K41A 4PKIA 3ZT2A 3ZT4A 3AA4A 4XJXA 4OJRA 4NLCA 1YTAA 4H0PA 3H3OB 1NK6A 1TYQB 4BRHA 3IKMA 3M8PA 1T6DA 2QWOA 3LDSA 5C0YA 2FBTA 1EETA 3VETA 3M8QA 3QEPA 4W5RA 4LSLA 3SMPA 4E19A 3VQ9A 1JL2A 3WNFA 4CF1A 5JVGL 3NAEA 3LPUA 2E2PA 4B1ZA 3CCEN 4B9MA 1NGAA 3U4LA 3G6EN 5JENA 2G8IA 4LF8K 4WCEL 4YFUA 3K57A 4Z4HA 3QICA 2Q0RA 2YHBA 5C25A 2HBKA 4JD2A 1RDBA 2IGIA 4CHZA 2BUPA 4A2AA 4CJRA 1WSJA 3A0IX 4H4MA 1KXPA 4DSJA 1NMDA 4DFKA 4F4KA 4BQZA 2Z1HA 4IXCA 2YV0X 5HRSA 3T19A 1KC8O 3AVNA 3LP1A 1YJWN 3L4QA 4CJSA 3AARA 4FWKA 4FPAA 4DV2K 4AHUA 1T8EA 1R59O 4YOXA 1U04A 2R7YA 4A59A 3ZYYX 2FBVA 1LAVA 1S3XA 4A2BA 4BG9A 5ADXA 5CZ1A 5F2RA 2HNZA 3VQCA 1VQKN 4DSIA 1HQUA 5AQNA 1RT5A 1N5YA 4GKJK 5CE3A 4IFVA 2RPIA 3SAHA 1RT2A 3C65A 4H0OA 4KI4A 1K8KB 5J2MA 1GOCA 2GTDA 3D2EB 1XHZA 2E1ZA 3KLGA 1TGOA 4I6MB 3R9PA 3CFPA 1S1UA 4CD3A 3QEIA 1IKYA 1K8KA 4QS7A 2QKKA 4IJNA 4EHTA 4CZMA 4DTMA 4BRLA 4AHTA 1DT9A 3PX6A 2Q2RA 1L3UA 2PYLA 3SAGA 3F5TA 2VWBA 3VN5A 2AP1A 4BWMA 1SL2A 4B8AB 4DTRA 4A5AA 4B8CA 2F9TA 3PO4A 3LDOA 3MCAB 5M1FA 4KHYA 1NK7A 1BDGA 2HHIA 4DQRA 2NRWA 1RDWX 2E2OA 4RCHA 5LJWA 3ALYA 1JKHA 1L3TA 1SQKA 3TSQA 2P9LA 2PAVA 5HOOA 4FLTA 4M3XA 4MO4A 1S5JA 4J2EA 4DQQA 3OBYA 4ZTJA 3JAMO 4PY5A 2QI2A 2HHSA 1TK0A 2BE2A 1DKGD 1S6PA 4C8MA 4E3SA 3O9SA 5DM7L 4M7YA 4CIFA 4ISFA 4FJNA 4CJTA 4AHRA 1YF5L 3HBTA 4IEEA 3HM8A 4IO8A 3JSMA 4B3RK 1L3SA 3QO9A 5C15A 3FFIA 2X78A 4JI5K 5IWAK 1GLCG 3UKRB 3EYZA 1MA9B 4DF4A 1UAXA 2I5JA 1JCFA 4CBWA 3ZT0A 4DF8A 3ENBA 4XH1A 4JHDB 4BRKA 1NKEA 2F4VK 4OPKA 3VQ8A 3K5NA 2Y1IA 1W7AA 3EL2A 5CZ2A 4RW9A 4JKFA 1WB9A 1S72N 3CIPA 4FW2A 3CERA 3C6AA 1JLGA 2P5OA 4DSFA 4FM0A 1ZC6A 5J1EA 4N5SA 3KLFA 1HJOA 1HNWK 2NRVA 1BA0A 4FWOA 1FJGK 4BR9A 3D2FA 4OGEA 3ZEUB 1TAQA 2OZMA 4BR7A 4X62K 2KQ2A 1Q7YO 1CZ9A 1KVAA 4FVUA 4CK1A 1IBLK 2Q31A 4JI1K 1TL3A 4BGBA 4FCYA 4EAHD 4XH5A 4CJEA 1KD1O 1TKTA 3UE5A 1QHTA 1XHXA 3CC2N 4KTQA 4J2AA 4MLEA 3HP6A 3AVAA 1W9HA 1YJNN 4M3WA 3FE1A 4DQIA 3K59A 3RR8A 3CCQN 4M3UA 3TABA 1HJRA 2PYJA 5HP1A 4BRGA 3IG1A 4IG0A 1HX1A 3SPYA 4DUZK 3DM2A 4ISGA 3VQEA 4BECA 3THVA 2OPRA 3THYB 1NGFA 1VRUA 4H5NA 3VGLA 2UUAK 4E7HA 5JICA 1NJIO 5GIOA 4KV8A 1GOBA 2E5LK 3V1QA 2Y1JA 1RNHA 5AQTA 3TAQA 4NCAA 1X9JA 3ZCMA 3LZIA 1Q81O 2PFUA 3AVLA 3ZX3A 4CGFA 3H1QA 3VEOA 5JVHL 4W5NA 2P1JA 4YORA 3W0LA 3WEEA 4CIEA 3HSCA 3W3DA 1WBBA 3CCSN 3JS6A 4WF9L 1NK9A 3VQAA 4QS9A 2O4IA 1YXQA 1GLEG 4NCGA 4B9QA 3OJSA 1JLCA 3DXMB 3EY1A 2ZM6K 4JI4K 3TR8A 3RMCA 4CERA 1ATSA 1D9DA 1S1VA 1RT6A 1VSMA 5J2NA 2QM1A 1GOAA 3VEYA 4LSNA 3SAFA 3O4WA 2QTDA 4Y0WA 3DXMA 3SUQA 3HSTB 1U49A 4B3SK 2CH6A 3T3FA 5E41A 4FJKA 4EIAA 4FLXA 3ZLJA 4BVPA 3MEEA 1RBSA 1WAFA 4JK8A 3MXMA 2IVPA 4G1QA 5HRNA 4DFPA 2VCPA 3AO3A 4WFBL 3SK3A 4A62A 2OZSA 4ELUA 5ADXH 1A5XA 5AQRA 2OPPA 5E26A 2P9PB 3V9SA 1TAUA 5FRMA 2W42A 1NGCA 3H45C 3QB0A 2D0AA 1HRHA 1BCMA 3NGYA 4G9ZA 3MX5A 1NJWA 5M1QA 1CZBA 3BY5A 4FJJA 2DTUA 2OPSA 1XC9A 4DUYK 5AQKA 3KWIA 4IZ9A 5AQVA 4H03B 1IG8A 3R6MA 3PX0A 4CZHA 3KK2A 2RN2A 3SZ2A 3C7NB 3D6RA 4O55A 3K58A 1V4SA 4K0KK 3KD5E 3OHRA 3ZT1A 4X66K 2P9IA 4IOCL 4DV3K 1WLJA 4DV7K 1CXQA 3NH1A 2GV9A 3R1XA 3QNNA 3C7NA 1NOZA 3S41A 4KB1A 4E89A 2X6NA 1ASVA 1ZXOA 2OCEA 4O4GA 3AO2A 4FOIA 1QZ5A 3F73A 4HUEA 4DS4A 3EKSA 1IV0A 2ZJRL 4HCBA 2Q0UA 3QLHA 1JL1A 3MN7A 1OH8A 1VK0A 4BR4A 1EQYA 4FLUA 3I8DA 3CC7N 2F8TA 4Q0BA 4KHNA 3A5NC 2YJFA 3PY8A 5FROA 2P9NB 2RHKA 1OH6A 4O8UA 5GADP 2GUPA 3I0SA 4DLEA 4BE0A 4E1MA 3ITHA 1G99A 4LY7A 4JI8K 5KTQA 3SCXA 2NNWA 4OGCA 5CY4A 2Q1NA 2P9NA 3KIOA 5BR8K 4BG8A 5AQJA 3WNGA 3N4PA 3AA5X 3H6EA 3UKUB 5AQYA 3SPZA 3MWTA 3DXKA 4GMJB 4M42A 4GVEA 2WBNA 1WSIA 1QQNA 2NRXA 4CEDA 2W40A 3UKUA 3L3UA 4DTXA 1RBVA 3NCIA 4HTUA 4BR5A 1N8RO 4KFBA 1EWQA 5AQLA 3LDLA 1JLBA 5AJ3K 4I2QA 4PA1A 3V4IA 1BO5O 1XWLA 3FZHA 2KHOA 4MDAA 1RFQA 4CF2A 5AQUA 4AILC 3ZSOA 3J80O 4WFAL 1HNXK 1TVRA 2QXLA 2QKBA 2HHXA 2WTUA 3TAEA 2A3ZA 2RF2A 3A2FA 4CHNA 4CJVA 4FSVA 1HNIA 3WNHA 3OJUA 1VQNN 4DQPA 4DU4A 4OPHA 4Q5VA 3TANA 4FLWA 4KHPK 1G15A 3TPQA 3QMLA 3G0ZA 3GBTA 2UUBK 3T7ZA 4CEBA 3KHYA 4HHTA 4E7IA 4MLHA 4NYFA 1UA1A 1NKCA 2HNDA 4FJHA 3SYZA 3ULDA 4BACA 3TAMA 4M3TA 4OKKA 1BG3A 3O9RA 2YNGA 3AV9A 2E8AA 1D8YA 1L5UA 1CXUA 5AQWA 4OKJA 3HO1A 4CJ3A 5AQZA 2HMIA 5DM6L 2FC0A 3OBWA 3CF5L 1BUPA 4RW6A 3OYGA 5AQFA 1RDDA 1VSKA 3THWB 4DV4K 1EP4A 3CPWM 1NU0A 3DLEA 2VG7A 4JYAK 2HBMA 3PX4A 3K9KA 5M1KA 2HHHK 1YTUA 3AVIA 2GWJA 4F9OA 2IIRA 5BR9A 3GE1A 4BRDA 3H1VX 5KQDA 2P9SB 3MXJA 2NZTA 2E2QA 3HK2A 4B3TK 4FJ8A 2B6AA 2QWMA 4CD1A 1U4BA 1D9FA 2GX9A 1KAZA 3AO4A 4IFYA 2P9SA 4DR6K 2D1KA 1YITN 3TAPA 1LW2A 2IS3A 3PV8A 2NLXA 2F7TA 3L2UA 2YHWA 4CFDA 4CGHA 2YHAA 4BC5A 1MU2A 4H0VB 3V81A 3HVRA 1C0FA 3VQBA 4MFBA 5AQIA 4FJ5A 4DV0K 3HI0A 3NH0A 3ENOA 3MDQA 2FF6A 1EKEA 2KZMA 4LD0A 4FJ9A 1SKSA 2HHVA 3WXMB 3SJHA 2E88A 4CCHA 4LFBK 3IS9A 4AM7A 4FWQA 2WUSA 5AFUA 1HNZK 3E9PA 3VTHA 4DWIA 2JLEA 4HVJA 1S9EA 4DTPA 3VTIA 2ZE2A 3SV3A 4FVMA 4I9LA 1KQSM 3J7YP 4BY9C 2E2NA 4M3YA 1SKWA 3C95A 4IWVA 3BZKA 3TSPA 1WN7A 4JD2B 3HYFA 1VSFA 1SAZA 2E1YA 4H5WA 1EWRA 4DR3K 1RDUA 3IDHA 3J7AP 2G8HA 3KKSA 2BGGA 4CFCA 3I8BA 5FPDA 3TSUA 3KKRA 3A5OC 3DLKA 4CHOA 1S1TA 4A61A 3TARA 4F3TA 1NM1A 1ILYA 1P90A 1NK0A 4JS4A 1SS6A 2O8BA 3THXB 4YOTA 4RTFD 4JKBA 4GV3A 3VQ6A 1NJYA 2JWLA 2ASOA 3O9UA 3P38A 3ZX2A 3LANA 4Z4IA 1HLUA 4CI6A 1NOYA 5JS2A 1NGBA 5AQOA 1NGEA 4WFNL 4NXNK 4AF1A 3WXKA 3THXA 2A42A 1XUPO 4JKHA 3CFOA 4EZ6A 4RW7A 1QE1A 2D0PA 3RMDA 4FJXA 4KHUA 5EXWA 4M3RA 1D5AA 2ZJPL 2YI1A 4Z0UA 4YOVA 4CZLA 5DMRA 1NJXA 3OYNA 2WC9A 4ZTFA 4KRFA 4O44A 2F96A 3SUPA 2OA8A 3MMVA 4HUGA 3S9HA 1SV5A 1K8AO 1Q9XA 2LSNA 1T6CA 5A2QO 2HSTA 4CE9A 2GEMA 2QWLA 1RTHA 3GL1A 1RTIA 2F9WA 2FBXA 4FK4A 1RBRA 1YJ9N 3Q7CA 3VF6A 2V7ZA 4IFEA 4CIGA 4J2BA 5LMNK 4CK3A 3DLRA 1YAGA 2O4GA 2RE2A 1S9GA 3FR0A 2CGJA 4FO0A 5BN9A 3PLAA 1VSEA 2ZGYA 1TUUA 2P9LB 3QIOA 3EE9A 4IKFA 3O3GA 5CYQA 1J6ZA 3CI5A 4R5PA 1YIJN 2ZWHA 4BRIA 4OPAA 3CFRA 2G8UA 2ETJA 4ID1A 2VGNA 1JLQA 2KTQA 3MAQA 3ATVA 3TTFA 2P9UB 4DB3A 3KTQA 2YKMA 1OH5A 5C42A 1TKZA 2QK9A 1RTJA 1FKPA 1P8ZA 3RSEA 3OYMA 3HXMA 2Z1JA 3U6FA 1VQPN 3WT0A 2Q36A 4BQLA 1KTQA 3UIQA 4BE1A 4F3OA 2B4JA 3M3ZA 4CJ4A 4ELTA 2P9UA 4OPJA 1ZBLA 5KI6A 3G25A 3ZX0A 1RBTA 1JXEA 3O9QA 3AO5A 1BCOA 5EY4A 4JI3K 3AY9A 3VOVA 3A5MC 4B1UB 1Q8IA 1YT3A 1BU6O 3P83D 1KLMA 3FZKA 3SBGA 1J54A 1NK5A 1HYVA 5EOYA 3NVMA 2ITMA 3D2FB 4FZZA 1GLDG 4CBUA 3U9DA 5KRTA 4C8LA 1WAJA 1JLAA 4R79A 3QEVA 1IJJA 4AQYK 3L0QA 1LW0A 1BA1A 4CEQA 3NMUA 4GV9A 2CGKA 4YY3K 3BGRA 3DOLA 3CCRN 1SL1A 1N34K 3SQ4A 3VQ7A 2FSKA 1ZBHA 1BOTO 3MWPA 5JMVA 4ICLA 5M1NA 3RR7A 1JLEA 1KCFA 1WBDA 4ISEA 4BDPA 4CHQA 5AQMA 4EZ9A 3M1FA 4OLBA 2O8DA 2IVOA 3O8MA 3P1GA 3S5TA 2FBYA 2HMPA 1OVYA 1YVNA 3ZETB 4FJ7A 4WE1A 4FJLA 2UYTA 3BEXA 4B1YB 3E9OA 3WUHA 5K14A 3WNEA 2P9KB 3CD6N 2ASMA 3ZETA 3NFAA 3I56N 4CZFA 3OY9A 5FPMA 5HL7L 3WEEB 5AZIA 5HROA 4H4OA 3VESA 4H0YB 4PUOA 3RVCA 4ILHA 2X74A 5JS1A 3TI0A 2P9KA 5AFUH 5F1XA 2W6LA 1EO1A 3MX2A 3FZMA 1QSLA 5GAGP 3ZSZA 5GIPA 4CJLA 5J2PA 3B6PA 1X1PA 3HZ6A 4YHHK 3RTVA 1BWFO 1TKXA 2XRIA 3ZSXA 3MN9A 2IDOA 4JK9A 4M7XA 1NGIA 1SUQA 3FFKB 3EKUA 4AHSA 4W5QA 5KPZA 4DR4K 4CJUA 3OYEA 4H0TB 2W6KA 1TL1A 5HLFA 4CBXA 3B6OA 3VQQA 3ISNC 1Z26A 3HPOA 2EHGA 3OA9A 1LAWA 2A1SA 2JGUA 3EZWA 3CJAA 1KFDA 3T1HK 5HBMA 4X64K 3SUOA 3KK7A 4FJMA 2CGLA 4K42A 4X65K 3DYAA 3U8XA 2ZF5O 5HRPA 4B9LA 3OW2M 5BRHA 3AVBA 3EN9A 1VQ9N 5JLFA 1MDUB 2V52B 4AHVA 1YUWA 2HHUA 3AVGA 1ZBFA 3QINA 3LP3A 1JCEA 4KH6A 5CR4A 3FZFA 3PO5A 1E4FT 4XIUA 1XNRK 2A6AA 3CCMN 4LH4A 2A40A 4OLAA 1JXBA 1M1KO 3SQ2A 2HVIA 1OVQA 1U2VA 1WNSA 5I42A 5C10A 4NYNA 3RWUA 1ATRA 5LMUK 2A41A 5KRSA 3KLEA 4CGDA 4CEAA 2VWKA 4ILJA 4FWLA 3AO1A 2P9IB 1XC3A 1VQ7N 4C23A 3R8EA
chains in the Genus database with same CATH topology
3AARA 4FWKA 3O9RA 4FPAA 2E8AA 1R59O 3CETA 4YOXA 5AQWA 4A59A 3ZYYX 1S3XA 5AQZA 3VPZA 4A2BA 5DM6L 3QFUA 5AQPA 4BG9A 5ADXA 3H46O 3OBWA 2I7NA 1BUPA 4GNIA 5F2RA 3CF5L 4MDBA 5AQFA 1VQKN 5AQNA 4KH4A 3CJ1A 2ZGZA 4WQ5C 2FXUA 5CE3A 3LM9A 3SAHA 3BF1A 4JK7A 5TKWA 3CPWM 3C65A 3U9ZA 4H0OA 5GINA 3HOSA 4GY2B 3ZEUA 1K8KB 3VF2A 2HBMA 4MO5A 2GTDA 3K9KA 5BRFA 5M1KA 3D2EB 1K9MO 3WQTA 5AZIB 4CZGA 4BRAA 2E1ZA 2GWJA 4F9OA 2IIRA 1GLBG 4I6MB 3GE1A 5BR9A 5GAEP 5KQ8A 3E1YA 1QVGM 3R9PA 4BRDA 3H1VX 5KQDA 2P9SB 1KAYA 4CD3A 3VEVA 4B1VA 4JKAA 1NGJA 2NZTA 1MWKA 2E2QA 1K8KA 3J8AA 4WQ5A 5AQSA 2QWMA 5AQQA 1GLLO 4QS7A 4CD1A 3VEWA 3VF4A 4IJNA 4XEIA 4EHTA 2GX9A 4FPBA 3WXLA 4CZMA 4BRLA 2HOEA 4IOAL 1DT9A 3VMFB 2Q2RA 1KAZA 2HF4A 3SAGA 2P9SA 4BC3A 4U7BA 3F5TA 2VWBA 2AP1A 1HUXA 2D1KA 3CJ9A 3CQYA 4YOUA 3VEXA 1YITN 2FSJA 4LC9B 3DXKB 2NLXA 3EO3A 3CC4N 1VQON 2F7TA 4A5AA 2YHWA 3A8YA 2F9TA 3CJBA 3WXJA 3LDOA 3MCAB 5M1FA 3E66A 3CCVN 5BREA 4BC5A 1BDGA 4C1NI 3DLLL 2NRWA 1K73O 2NRHA 4H0VB 1S22A 4NO7A 1RDWX 1C0FA 2E2OA 5AQIA 4RCHA 5LJWA 3O6WA 3M5RA 2QW9A 3HI0A 3ENOA 5KPTA 4CZKA 1H1VA 1SQKA 4H5VA 2QWQA 3MDQA 4KH5A 2FF6A 3O1BA 2QEXN 3TU5A 3JXUA 1VQMN 3TSQA 4FWPA 2P9LA 2PAVA 5HOOA 4J8FA 1RGIA 5ELZA 4MO4A 4CJ7A 3WXMB 3OBYA 3SJHA 2E88A 4JNEA 4A57A 2CH5A 2QWNA 4BVOA 4AM7A 3CJ7A 2WUSA 4FWQA 2QI2A 3E9PA 3VTHA 5AFUA 2OTJN 1YHQN 1DKGD 2VYPA 4NB4A 5FPNA 2YHXA 2A5XA 3O9SA 4BC2A 5DM7L 4YOYA 4M7YA 1GLJO 1HKCA 5AQXA 1NGHA 3Q7BA 4ISFA 3VTIA 1YF5L 3HBTA 4IEEA 2EWSA 3HM8A 1WUAA 4IO8A 1KQSM 4BY9C 1X3MA 2E2NA 4O5FA 4H5TA 5C15A 1U2VB 4IWVA 3TSPA 4JD2B 4FWRA 4Z94A 5C12A 2VGMA 1SAZA 2E1YA 2NRZA 1GLCG 3ATUA 4H5WA 3UKRB 4B1WB 1MA9B 4WYBA 1RDUA 3IDHA 4JAXA 5B8HA 1JCFA 4CBWA 5KPRA 2YJEA 3ENBA 4XH1A 3I8BA 5FPDA 3TSUA 4JHDB 4BRKA 3A5OC 1VAZA 3DWLA 4K43A 1YI2N 4B1XB 4BRCA 4A61A 4FL9A 1ILYA 1NM1A 3J7ZO 1P90A 3EL2A 2YCHA 4C1NK 1SS6A 4JKFA 1S72N 4YOTA 5BPNA 3CIPA 4JN4A 4RTFD 4JKBA 4GV3A 3G4SN 3CERA 2JWLA 2ASOA 3O9UA 1W97L 3P38A 3C6AA 3E9LA 3ZX2A 3GG4A 3FGUA 1HLUA 2H3GX 3A5LC 3SBTA 1Z6RA 1HKGA 4CI6A 2D0OA 5FPEA 1ZC6A 1NGBA 5AQOA 1HJOA 4PKGA 1NGEA 4WFNL 4AF1A 3AAQA 3WXKA 3R3LA 2NRVA 2A42A 2ZJQL 1XUPO 4JKHA 3PIPL 1BA0A 3FZLA 4FWOA 4BR9A 3D2FA 2GWKA 3ZEUB 3CMEN 4BR7A 2D0PA 1CZAN 3CCLN 5I9EB 1QHAA 1SZ2A 2P9PA 2Q97A 3C0BA 5EXWA 5GAHP 1O13A 1Q7YO 1ZBSA 4A5BA 5AZJB 4IOXA 2ZJPL 1C0GA 2YI1A 3ULEB 4FVUA 3MN6A 2W00A 4YOVA 3DAWA 4CZLA 4JEPA 3L6QA 2Q31A 1DEJA 3R8EA 3O08A 4BGBA 2E20A 4BREA 4EAHD 4PHTX 4XH5A 4U67L 1Q86O 5AQHA 1KD1O 1HKBA 2KLAA 2WC9A 3UE5A 3CC2N 5AZJA 3ULEA 4MLEA 5EX5A 3MMVA 3P39A 3CCJN 5TKYA 4PL7A 1YJNN 3FE1A 3M6GA 1K8AO 4AM6A 4OO1J 2I7PA 3BF3A 1T6CA 2HSTA 2GEMA 3KZBA 2QWLA 3CCQN 3DJCA 1VQ5N 1Q18A 3GL1A 2QWRA 2F9WA 4JKCA 1VQ8N 4BRGA 1DGKN 1YJ9N 2ASPA 3VEZA 1W2BM 3Q7CA 4IO9L 3BUZB 3VF6A 2V7ZA 1HX1A 4IFEA 5CHIA 3P31A 4L3QA 1YAGA 3HTVA 4ISGA 4BC4A 2RE2A 4BECA 2KKZA 3FR0A 2CGJA 4FO0A 5BN9A 3PLAA 1NGFA 4H5NA 3I55N 3VGLA 2FLOA 4H0XB 5JICA 3TTCA 1NJIO 2ZGYA 3AGKA 4EFHA 3CQXA 5GIOA 3IUCA 4EHUA 3CMAN 1TUUA 2P9LB 3CHWA 3CJCA 5AQTA 1ATNA 1X9JA 3AGRA 3EE9A 3F9MA 3LDNA 1HPMA 5BN8A 4CZEA 1J6ZA 1Q81O 1D4XA 2PFUA 4DHYA 3CI5A 3ZX3A 3H1QA 3VEOA 5JVHL 1YIJN 2ZWHA 4BRIA 4OPAA 2DPNA 4YORA 3WXIA 3W0LA 3WEEA 4IDHA 3HSCA 5BPLA 3QFPA 3LM2A 3SLCA 2VGNA 4IJAA 3W3DA 3CCSN 3JS6A 4WF9L 4XH4A 3G71N 3ATVA 4QS9A 3TTFA 2P9UB 4DB3A 4BEBA 4BRQA 1NGDA 1YXQA 3EE8A 1GLEG 4YOWA 3GDQA 4IEIA 1P8ZA 3RSEA 2BTFA 3O5BA 3AAPA 3DXMB 4B9QA 4BRNA 4K25A 1VQPN 4DCHA 2WFBA 1GLAG 4JKDA 2Q36A 3WT0A 4BQLA 5JLHA 2OANA 1ATSA 3M3ZA 2HBLA 3CXCM 3SMSA 1XQSC 2P9UA 2QM1A 4BRFA 3VEYA 4KBOA 3SAFA 5EVZA 3O4WA 4JKGB 2QTDA 4Y0WA 4BE7B 3G25A 3DXMA 2FSNA 3UB5A 1LOTB 3ZX0A 2HF3A 3BP8A 4H5RA 3O9QA 2CH6A 5EY4A 3AY9A 3VOVA 3A5MC 4EIAA 1QZ6A 3QBXA 4PKHA 4B1UB 4BGAA 1BU6O 4JKGA 4BVPA 3ID8A 5BRDA 3FZKA 1VQ6N 3KWGA 1V4TA 5C2DA 4JK8A 4UY8O 3SBGA 2V51B 1TYQA 2IVPA 4QS8A 1NLVA 4PL8A 2VCPA 4WFBL 3SK3A 1X3NA 3IMXA 5AQGA 5EOYA 4A62A 1GLFO 3NVMA 3LDQA 2YHYA 2ITMA 3D2FB 1Z05A 1VQLN 1GLDG 2J4RA 4CBUA 5AQRA 1MWMA 1WOQA 3U9DA 5ADXH 1E4GT 2QA4N 5E26A 2P9PB 3HRGA 4R79A 1VQ4N 4BRPA 1NGCA 5M1OA 3H45C 3QB0A 4DQ8A 1IJJA 4G9ZA 2W41A 3MX5A 5M1QA 4FOEA 3L0QA 3LDPA 1BA1A 3NMUA 4GV9A 4RWTA 2CGKA 5LJVA 4BROA 3KVGA 1LCUA 5AQKA 4FWSA 3CCRN 3KWIA 3NVKA 4IZ9A 5AQVA 4H03B 1IG8A 3R6MA 4O8KA 4CZIA 4CZHA 3LL3A 1JCGA 2FSKA 2V7YA 3C7NB 3D6RA 4CZJA 1BOTO 1V4SA 3MWPA 4YDUC 5JMVA 4GV6A 4JKEA 1Q82O 5M1NA 3N4QA 3OHRA 4HTLA 3VGKA 2P9IA 1T3VA 4ISEA 1Y64A 4WQ4C 2FF3B 3FLCO 4DKWA 4IOCL 1QQOA 5AQMA 3O1WA 3O9TA 3R1XA 2PBDA 3M1FA 3O80A 3MK6A 3C7NA 2IVOA 5MLCQ 3O8MA 3P4IA 3S41A 5M1PA 1QQMA 2HMPA 3I33A 1OVYA 4YDUA 1ZXOA 1YVNA 3F2KA 5C2FA 5H1SQ 4ILGB 2OTLN 3MCPA 3ZETB 4FOIA 1QZ5A 1NWKA 3VERA 1U6ZA 4WQ4A 2UYTA 3EKSA 2ZJRL 1TUYA 2Q0UA 3BEXA 4M63C 4B1YB 3MN7A 1OKJA 3E9OA 3WUHA 1T44A 1QVFM 4BR4A 5AR0A 2P9KB 1EQYA 2ASMA 3CC7N 3CD6N 3PIOL 3ZETA 3IFRA 2NRRA 3B8AX 4CZFA 3I56N 3A5NC 5FPMA 2YJFA 3D2EA 3VENA 5LY3A 3WEEB 5AZIA 2YX6A 5HL7L 2P9NB 2RHKA 3VESA 4E1JA 4H0YB 4BR0A 4I6MA 4O8UA 4ILHA 3RVCA 5GADP 2GUPA 3GOIA 4BRMA 1JJ2M 2P9KA 5AFUH 1G99A 5F1XA 3MN5A 1YJWN 2JWKA 3H3NO 3MX2A 3FZMA 4NLBA 5GAGP 5GIPA 1EO1A 1M90O 2NNWA 3RSEB 2Q1NA 2P9NA 3HZ6A 1BWFO 4BG8A 5AQJA 2C1IA 3MN9A 2BH1A 3N4PA 4JK9A 4M7XA 1NGIA 4BR2A 3H6EA 3FFKB 3EKUA 3UKUB 5AQYA 5KPZA 1KAXA 3K9JA 3MWTA 2IVNA 3DXKA 4H0TB 5BPMA 3TTDA 4GVEA 3L4IA 5F0XA 1ESVA 2WBNA 1QQNA 3QDKA 4K41A 4PKIA 2AA4A 2NRXA 3WQUA 4CBXA 2W40A 3UKUA 2NRTA 4BR5A 1N8RO 3ENHA 4XJXA 4NLCA 3OA9A 4H0PA 5AQLA 3T69A 3H3OB 1TYQB 3EZWA 3CJAA 3IKMA 3LDLA 5E84A 4BRHA 3HOTA 1T6DA 2HBJA 2QWOA 3KK7A 5C0YA 2CGLA 1BO5O 3FZHA 4K42A 2KHOA 3U8XA 4MDAA 1NBWA 2ZF5O 3ID6A 3VETA 1RFQA 3SMPA 5AQUA 3OW2M 3D7EO 5BRHA 4WFAL 5JVGL 3EN9A 2QXLA 1VQ9N 5JLFA 2E2PA 4B1ZA 3CCEN 2A3ZA 1MDUB 2V52B 1YUWA 1NGAA 4HWIA 3U4LA 4FSVA 4KH6A 1NGGA 1JCEA 5CR4A 3G6EN 3FZFA 4FWNA 1E4FT 1VQNN 4WCEL 2A6AA 2GELA 3CCMN 3CCUN 2QWPA 2A40A 4OPHA 1M1KO 3CPEA 3QICA 2Q0RA 3TPQA 3QMLA 1U2VA 3C6HA 2HBKA 4JD2A 2D4WA 5C10A 3GBTA 3VGMA 3T7ZA 3UKRA 1ATRA 2A41A 2BUPA 3KHYA 4ILJA 3QBWA 4A2AA 4FWLA 2C1GA 3A0IX 1KXPA 2P9IB 4MLHA 1NMDA 1XC3A 4JHDA 4BQZA 4IXCA 1KC8O 4FWMA 1VQ7N 4C23A 1BG3A 3L4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAR A;  4FWK A;  4FPA A;  2E8A A;  1R59 O;  3CET A;  5AQW A;  1S3X A;  5AQZ A;  3VPZ A;  4A2B A;  3QFU A;  5AQP A;  4BG9 A;  5ADX A;  3H46 O;  4GNI A;  2I7N A;  1BUP A;  5F2R A;  5AQF A;  5AQN A;  3CJ1 A;  2ZGZ A;  4WQ5 C;  2FXU A;  5CE3 A;  3LM9 A;  3BF1 A;  3U9Z A;  4H0O A;  4GY2 B;  3ZEU A;  1K8K B;  3VF2 A;  4MO5 A;  2GTD A;  5BRF A;  3D2E B;  3WQT A;  5AZI B;  4CZG A;  4BRA A;  2E1Z A;  2GWJ A;  4F9O A;  2IIR A;  1GLB G;  4I6M B;  3GE1 A;  5BR9 A;  5KQ8 A;  3R9P A;  4BRD A;  3H1V X;  5KQD A;  2P9S B;  1KAY A;  4CD3 A;  3VEV A;  4B1V A;  1NGJ A;  2NZT A;  1MWK A;  2E2Q A;  1K8K A;  3J8A A;  4WQ5 A;  5AQS A;  2QWM A;  5AQQ A;  1GLL O;  4QS7 A;  4CD1 A;  3VEW A;  3VF4 A;  4IJN A;  4XEI A;  4EHT A;  4FPB A;  3WXL A;  4CZM A;  4BRL A;  2HOE A;  2Q2R A;  1KAZ A;  2HF4 A;  2P9S A;  4BC3 A;  2VWB A;  2AP1 A;  1HUX A;  2D1K A;  3CJ9 A;  3CQY A;  3VEX A;  2FSJ A;  4LC9 B;  3DXK B;  2NLX A;  3EO3 A;  2YHW A;  3A8Y A;  2F9T A;  3CJB A;  3WXJ A;  3LDO A;  5BRE A;  4BC5 A;  1BDG A;  2NRH A;  4H0V B;  1S22 A;  4NO7 A;  1RDW X;  1C0F A;  2E2O A;  5AQI A;  4RCH A;  5LJW A;  3O6W A;  2QW9 A;  3HI0 A;  3ENO A;  5KPT A;  4CZK A;  1H1V A;  1SQK A;  4H5V A;  2QWQ A;  3MDQ A;  2FF6 A;  3O1B A;  3TU5 A;  3JXU A;  4FWP A;  2P9L A;  2PAV A;  4J8F A;  1RGI A;  5ELZ A;  4MO4 A;  4CJ7 A;  3SJH A;  2E88 A;  4JNE A;  2CH5 A;  2QWN A;  4BVO A;  4AM7 A;  3CJ7 A;  2WUS A;  4FWQ A;  5AFU A;  1DKG D;  2VYP A;  4NB4 A;  5FPN A;  2YHX A;  2A5X A;  4BC2 A;  4M7Y A;  1GLJ O;  1HKC A;  5AQX A;  1NGH A;  4ISF A;  3HBT A;  2EWS A;  3HM8 A;  1WUA A;  4IO8 A;  1X3M A;  2E2N A;  4O5F A;  4H5T A;  1U2V B;  4IWV A;  4JD2 B;  4FWR A;  4Z94 A;  1SAZ A;  2E1Y A;  1GLC G;  3ATU A;  4H5W A;  3UKR B;  4B1W B;  1MA9 B;  4WYB A;  3IDH A;  4JAX A;  5B8H A;  1JCF A;  4CBW A;  5KPR A;  2YJE A;  4XH1 A;  3I8B A;  5FPD A;  4JHD B;  4BRK A;  3A5O C;  3DWL A;  4K43 A;  4B1X B;  4BRC A;  4A61 A;  4FL9 A;  1NM1 A;  3EL2 A;  2YCH A;  5BPN A;  3CIP A;  4JN4 A;  4RTF D;  3CER A;  2ASO A;  3ZX2 A;  3GG4 A;  3FGU A;  1HLU A;  2H3G X;  3A5L C;  4CI6 A;  1Z6R A;  1HKG A;  5FPE A;  2D0O A;  1ZC6 A;  1NGB A;  5AQO A;  1HJO A;  4PKG A;  1NGE A;  3AAQ A;  3WXK A;  2A42 A;  1XUP O;  1BA0 A;  3FZL A;  4FWO A;  4BR9 A;  3D2F A;  2GWK A;  3ZEU B;  4BR7 A;  2D0P A;  1CZA N;  5I9E B;  1QHA A;  1SZ2 A;  2P9P A;  2Q97 A;  3C0B A;  5EXW A;  1ZBS A;  5AZJ B;  1C0G A;  2YI1 A;  3ULE B;  3MN6 A;  3DAW A;  4CZL A;  3L6Q A;  2Q31 A;  1DEJ A;  3O08 A;  4BGB A;  2E20 A;  4BRE A;  4EAH D;  4XH5 A;  5AQH A;  1HKB A;  3UE5 A;  5AZJ A;  3ULE A;  4MLE A;  5EX5 A;  3MMV A;  5TKY A;  4PL7 A;  3FE1 A;  3M6G A;  4AM6 A;  2I7P A;  3BF3 A;  1T6C A;  2GEM A;  3KZB A;  2QWL A;  3DJC A;  1Q18 A;  3GL1 A;  2QWR A;  2F9W A;  4BRG A;  1DGK N;  2ASP A;  3VEZ A;  3BUZ B;  3VF6 A;  2V7Z A;  1HX1 A;  4L3Q A;  1YAG A;  3HTV A;  4ISG A;  4BC4 A;  3FR0 A;  2CGJ A;  4FO0 A;  5BN9 A;  1NGF A;  4H5N A;  3VGL A;  2FLO A;  4H0X B;  5JIC A;  2ZGY A;  4EFH A;  3CQX A;  3IUC A;  4EHU A;  1TUU A;  2P9L B;  3CHW A;  3CJC A;  5AQT A;  1ATN A;  1X9J A;  3F9M A;  3LDN A;  1HPM A;  5BN8 A;  4CZE A;  1J6Z A;  1D4X A;  4DHY A;  3CI5 A;  3ZX3 A;  3H1Q A;  3VEO A;  2ZWH A;  4BRI A;  2DPN A;  3WXI A;  3W0L A;  3WEE A;  3HSC A;  5BPL A;  3QFP A;  3LM2 A;  3SLC A;  4IJA A;  3W3D A;  3JS6 A;  4XH4 A;  3ATV A;  4QS9 A;  2P9U B;  4DB3 A;  4BRQ A;  1NGD A;  1YXQ A;  1GLE G;  3GDQ A;  4B9Q A;  1P8Z A;  3RSE A;  2BTF A;  3O5B A;  3AAP A;  3DXM B;  4BRN A;  4K25 A;  4DCH A;  1GLA G;  3WT0 A;  2Q36 A;  4BQL A;  5JLH A;  2OAN A;  1ATS A;  3M3Z A;  3SMS A;  1XQS C;  2P9U A;  2QM1 A;  4BRF A;  3VEY A;  4KBO A;  5EVZ A;  3O4W A;  4Y0W A;  3G25 A;  3DXM A;  2FSN A;  3UB5 A;  1LOT B;  3ZX0 A;  2HF3 A;  3BP8 A;  4H5R A;  2CH6 A;  5EY4 A;  3AY9 A;  3VOV A;  3A5M C;  4EIA A;  1QZ6 A;  3QBX A;  4PKH A;  4B1U B;  4BGA A;  1BU6 O;  4BVP A;  5BRD A;  3ID8 A;  3FZK A;  1V4T A;  2V51 B;  1TYQ A;  2IVP A;  4QS8 A;  1NLV A;  4PL8 A;  2VCP A;  3SK3 A;  1X3N A;  3IMX A;  5AQG A;  5EOY A;  4A62 A;  1GLF O;  3LDQ A;  2YHY A;  2ITM A;  3D2F B;  1Z05 A;  1GLD G;  2J4R A;  4CBU A;  5AQR A;  1MWM A;  1WOQ A;  3U9D A;  5ADX H;  1E4G T;  5E26 A;  2P9P B;  4BRP A;  1NGC A;  3H45 C;  3QB0 A;  4DQ8 A;  1IJJ A;  2W41 A;  4FOE A;  3L0Q A;  3LDP A;  1BA1 A;  4RWT A;  2CGK A;  5LJV A;  4BRO A;  3KVG A;  1LCU A;  5AQK A;  4FWS A;  4IZ9 A;  5AQV A;  4H03 B;  1IG8 A;  3R6M A;  4O8K A;  4CZI A;  4CZH A;  3LL3 A;  1JCG A;  2FSK A;  2V7Y A;  3C7N B;  4CZJ A;  1BOT O;  1V4S A;  4YDU C;  5JMV A;  3OHR A;  4HTL A;  3VGK A;  2P9I A;  4ISE A;  1Y64 A;  4WQ4 C;  2FF3 B;  3FLC O;  1QQO A;  5AQM A;  3O1W A;  2PBD A;  3M1F A;  3O80 A;  3MK6 A;  3C7N A;  2IVO A;  3O8M A;  3P4I A;  3S41 A;  1QQM A;  2HMP A;  3I33 A;  4YDU A;  1ZXO A;  1YVN A;  3MCP A;  3ZET B;  4FOI A;  1QZ5 A;  1NWK A;  3VER A;  1U6Z A;  4WQ4 A;  2UYT A;  3EKS A;  1TUY A;  2Q0U A;  3BEX A;  4M63 C;  4B1Y B;  3MN7 A;  1OKJ A;  3WUH A;  1T44 A;  4BR4 A;  5AR0 A;  2P9K B;  1EQY A;  2ASM A;  3ZET A;  3IFR A;  3B8A X;  4CZF A;  3A5N C;  5FPM A;  2YJF A;  3D2E A;  3VEN A;  5LY3 A;  3WEE B;  5AZI A;  2P9N B;  3VES A;  4E1J A;  4H0Y B;  4BR0 A;  4I6M A;  2GUP A;  3GOI A;  4BRM A;  2P9K A;  5AFU H;  1G99 A;  5F1X A;  3MN5 A;  3H3N O;  3FZM A;  3RSE B;  2Q1N A;  2P9N A;  3HZ6 A;  1BWF O;  4BG8 A;  5AQJ A;  3MN9 A;  4M7X A;  1NGI A;  4BR2 A;  3H6E A;  3FFK B;  3EKU A;  3UKU B;  5AQY A;  5KPZ A;  1KAX A;  2IVN A;  3DXK A;  4H0T B;  5BPM A;  3L4I A;  5F0X A;  1ESV A;  1QQN A;  3QDK A;  4K41 A;  4PKI A;  2AA4 A;  3WQU A;  4CBX A;  2W40 A;  3UKU A;  4BR5 A;  3ENH A;  4H0P A;  5AQL A;  3H3O B;  1TYQ B;  3EZW A;  3CJA A;  3LDL A;  5E84 A;  4BRH A;  1T6D A;  2QWO A;  2CGL A;  1BO5 O;  3FZH A;  4K42 A;  2KHO A;  3U8X A;  3VET A;  1NBW A;  2ZF5 O;  1RFQ A;  3SMP A;  5AQU A;  3D7E O;  5BRH A;  3EN9 A;  2QXL A;  5JLF A;  2E2P A;  4B1Z A;  2A3Z A;  1MDU B;  2V52 B;  1YUW A;  1NGA A;  4HWI A;  3U4L A;  4FSV A;  1NGG A;  1JCE A;  3FZF A;  4FWN A;  1E4F T;  2A6A A;  2GEL A;  2QWP A;  2A40 A;  3QIC A;  2Q0R A;  3TPQ A;  3QML A;  1U2V A;  4JD2 A;  2D4W A;  3GBT A;  3VGM A;  3UKR A;  1ATR A;  2A41 A;  2BUP A;  3KHY A;  3QBW A;  4A2A A;  4FWL A;  3A0I X;  1KXP A;  2P9I B;  4MLH A;  1NMD A;  1XC3 A;  4JHD A;  4BQZ A;  4IXC A;  4FWM A;  4C23 A;  1BG3 A;  3R8E A; 
#chains in the Genus database with same CATH topology
 1ZBI A;  1VHX A;  3CYM A;  3OYC A;  3CET A;  4DR2 K;  4BWJ A;  3VPZ A;  2HB5 A;  3H46 O;  4DTN A;  2I7N A;  1QSY A;  4MDB A;  1KFS A;  1C0T A;  1HYZ A;  4KH4 A;  1UA0 A;  3OYB A;  4WQ5 C;  1R0A A;  4JK7 A;  4DR5 K;  1SKR A;  1N36 K;  1KRP A;  3U9Z A;  4W5T A;  4DR7 K;  5GIN A;  2VG6 A;  4CJP A;  1T05 A;  1EX4 A;  4MO5 A;  5BRF A;  3WQT A;  3NE6 A;  4BRA A;  3G10 A;  4I7F A;  1QVG M;  3MED A;  4K8X A;  5GAE P;  5DK5 A;  5CYM A;  3K5L A;  1KAY A;  4Z4F A;  2BAN A;  3VEV A;  1JLF A;  4B1V A;  4JKA A;  4E7J A;  2WON A;  4WQ5 A;  3J8A A;  4CGI A;  3O4Q A;  5AQQ A;  1QS4 A;  4GVM A;  5HRR A;  3VF4 A;  1A5V A;  4KAZ A;  4FPB A;  3WXL A;  1RBU A;  4NXM K;  2HOE A;  3L2Q A;  4PWD A;  4BC3 A;  1BI4 B;  1HUX A;  4C8N A;  3CJ9 A;  3VEX A;  4YOU A;  3KLH A;  3DXK B;  4DTU A;  2O8C A;  3A8Y A;  3CJB A;  4CJK A;  3V1R A;  3E66 A;  5FDL A;  4C1N I;  1BI4 A;  1NMN A;  3DLL L;  1K73 O;  2NRH A;  1S22 A;  4NO7 A;  1NK8 A;  1ASU A;  2D0C A;  3H08 A;  3O6W A;  1U48 A;  2QW9 A;  4E1N A;  4CZK A;  3V9U A;  3HP9 A;  4E7L A;  4QOZ B;  3OYL A;  1VQM N;  4FWP A;  4KO0 A;  3HJF A;  1RGI A;  3RMB A;  4CJ7 A;  3NF9 A;  4A57 A;  4CF9 A;  1TV6 A;  3EZ5 A;  4QAG A;  4DFM A;  3BZC A;  1YHQ N;  2VYP A;  4KTW A;  2XO7 A;  1F21 A;  2YHX A;  4BC2 A;  4YOY A;  1GLJ O;  5AQX A;  1BL3 A;  2EX3 A;  2DY4 A;  2X6S A;  2EWS A;  2Z1G A;  1WUA A;  3J81 O;  3AVK A;  3KK3 A;  4AHC A;  3LPT A;  4H5T A;  4Z4G A;  1C6V A;  3HVT A;  1W0H A;  2VGM A;  1K6Y A;  4LF9 K;  4O0J A;  1VSH A;  1I39 A;  5B8H A;  1X9S A;  5KPR A;  1S1X A;  2UXC K;  1VAZ A;  3DWL A;  4K43 A;  1YI2 N;  2DFF A;  3SNN A;  4BDY A;  1XMQ K;  3C6U A;  3G4S N;  4B3O A;  2GBZ A;  3E9L A;  1TK8 A;  3GG4 A;  3FGU A;  2ZQB A;  2H3G X;  3SBT A;  4CES A;  1Z6R A;  2D0O A;  3AAQ A;  3R3L A;  4F2S A;  2ZJQ L;  4EP4 A;  4HUF A;  3PIP L;  3VQD A;  3DMJ A;  2HNY A;  2WOM A;  3CCL N;  4CJW A;  1SZ2 A;  5GAH P;  2Q97 A;  2YNH A;  1C0G A;  2W00 A;  3MN6 A;  2KW4 A;  4JEP A;  3L6Q A;  1DEJ A;  3NGZ A;  3O08 A;  3S3M A;  4BRE A;  4FLV A;  5FRN A;  3ZSW A;  4DTS A;  2G8W A;  1N33 K;  3QNO A;  1TK5 A;  4E0D A;  3P39 A;  3VA0 A;  4ZHR A;  2HHW A;  3DRR A;  4AM6 A;  4B08 A;  3S3N A;  1QSS A;  3DJC A;  1VQ5 N;  1Q18 A;  3L2R A;  3CM5 A;  1N6Q A;  4JKC A;  3IRX A;  1DGK N;  2ASP A;  3VEZ A;  3QEX A;  1W2B M;  4BE2 A;  3BUZ B;  3MXI A;  4L3Q A;  1SL0 A;  3HTV A;  1WSE A;  2KKZ A;  2IOC A;  4AH9 A;  4E7K A;  4H0X B;  3KJV A;  4EFH A;  1HYS A;  1VSD A;  4KHW A;  4EHU A;  3CMA N;  4JV5 K;  3CHW A;  4DQS A;  3CJC A;  2AJQ A;  1ATN A;  4CJ5 A;  3F9M A;  3LDN A;  4JRP A;  5BN8 A;  4CZE A;  2ZD1 A;  5KGX A;  5I3U A;  3LP0 A;  1BIU A;  2BDP A;  1YVU A;  2DPN A;  3WXI A;  4IDH A;  4OKE A;  5BPL A;  3QFP A;  1XMO K;  3LM2 A;  4IJA A;  1X9W A;  3DOK A;  3I0R A;  4XH4 A;  3G71 N;  3DLB A;  4O5B A;  4BEB A;  1C1B A;  4BRQ A;  1NGD A;  3GDQ A;  4IEI A;  3CCV N;  4BRN A;  2BTF A;  4LF7 K;  3AAP A;  3HL8 A;  1N32 K;  1IH7 A;  2VQF K;  3TAF A;  4DCH A;  3LP2 A;  3V6D A;  4DG1 A;  3O3H A;  3NHG A;  2OAN A;  2HBL A;  2O8E B;  1XQS C;  2ATQ A;  4FM2 A;  2G8K A;  4JI2 K;  2IC3 A;  4CGJ A;  4DV5 K;  1I3A A;  1U47 A;  2FSN A;  1BIZ A;  4FK2 A;  3UB5 A;  2HF3 A;  3RRG A;  4H5R A;  4JRQ A;  2O8E A;  2O8B B;  4FZX C;  4FZY A;  2PY5 A;  4FJI A;  3VQ4 A;  4PKH A;  1J9A A;  3QBX A;  1DTT A;  3AA3 A;  4CEZ A;  4UY8 O;  2XY6 A;  2V51 B;  1TYQ A;  2D5R A;  1NLV A;  4IDK A;  4PL8 A;  3U3Y A;  5AQG A;  3NGI A;  1GLF O;  3LDQ A;  1IKW A;  2NUB A;  4DSE A;  2QA4 N;  1MWM A;  4KHS A;  4W5O A;  4KTZ A;  3HRG A;  4LFA K;  4BRP A;  3CYG A;  4DQ8 A;  4CW7 B;  2W41 A;  4FOE A;  2UXD K;  2DFE A;  3LDP A;  4RWT A;  3KVG A;  4FWS A;  4FXD A;  3M8S A;  5KGW A;  1CLQ A;  3NVK A;  1RT3 A;  3C6T A;  1EXQ A;  2UU9 K;  3LL3 A;  3ZSQ A;  4CZJ A;  4GV6 A;  4DS5 A;  4JKE A;  4B9U A;  4HTL A;  1T3V A;  1Y64 A;  4WQ4 C;  4DKW A;  3LAM A;  3O1W A;  2XY7 A;  3QEW A;  3O9T A;  3O80 A;  3MK6 A;  5MLC Q;  1E3M A;  1U45 A;  4CF8 A;  5M1P A;  3OTO K;  2YNI A;  1O1W A;  4FLZ A;  4JI6 K;  4YNQ A;  2VG5 A;  5C2F A;  3LWM A;  4ILG B;  2OTL N;  3RMA A;  3VER A;  1LWC A;  1U6Z A;  4WQ4 A;  4M63 C;  1T44 A;  1QVF M;  5AR0 A;  3SQ1 A;  1ZYQ A;  3ZSY A;  3B8A X;  3D2E A;  3VEN A;  5LY3 A;  2KZZ A;  4I6M A;  1FXX A;  4BRM A;  4ID5 A;  1C0M A;  1FW6 A;  2Z1I A;  3MN5 A;  4F8R A;  3H3N O;  4NLB A;  4Z4C A;  1M90 O;  3RSE B;  4QCL A;  4LFC K;  2C1I A;  1IKV A;  4BR2 A;  1KAX A;  5BPM A;  3OS2 A;  3L4I A;  1IG9 A;  3ASM A;  5EU7 A;  1ESV A;  3WQU A;  2AA4 A;  3KK1 A;  2NRT A;  4DU1 A;  3ENH A;  1DTQ A;  3VQ5 A;  3HM9 A;  3T69 A;  3K0S A;  1NG9 A;  5E84 A;  3HOT A;  3DLH A;  2HBJ A;  4H8K A;  4CGG A;  1LWE A;  1NBW A;  3ID6 A;  4ELV A;  3QIP A;  4FYD A;  3OVN A;  3L2V A;  3D7E O;  4CK2 A;  3V9W A;  1IBK K;  1RT7 A;  1RT1 A;  4O0I A;  1RCH A;  2VWJ A;  4HWI A;  1NGG A;  3V1O A;  4FWN A;  1LWF A;  1BQN A;  2GEL A;  2QWP A;  1HMV A;  3K5M A;  3CPE A;  2O8F B;  3NBP A;  2E4L A;  3QES A;  3C6H A;  2D4W A;  3O4N A;  3VGM A;  3EEQ A;  5SZT A;  3UKR A;  4HCC A;  4JLH A;  3SUN A;  3V9Z A;  3TAG A;  2C1G A;  3QBW A;  3HT3 A;  2XY8 A;  4OX9 K;  2O8F A;  1HNV A;  3DRS A;  4JHD A;  5D3G A;  4DTJ A;  4FWM A;  2KFZ A;  2QXF A;  3AVF A;  2O8D B;  5FLX O;  1T03 A;  4JI7 K;  4CJQ A;  3ZSV A;  4FJG A;  1NJZ A;  4B9S A;  3HPG A;  3QFU A;  5AQP A;  4GNI A;  3NF7 A;  4RG8 A;  4EP5 A;  3CJ1 A;  2ZGZ A;  2FXU A;  3LM9 A;  4LF6 K;  1XI1 A;  3BF1 A;  5TKW A;  4M41 A;  4JI0 K;  3HOS A;  4GY2 B;  3ZEU A;  3CG7 A;  3NF6 A;  3PUF A;  3VF2 A;  1K9M O;  4B9T A;  5AZI B;  4CZG A;  1T7P A;  1GLB G;  5KQ8 A;  4PQU A;  3P5J A;  3E1Y A;  1NKB A;  4UQG A;  1OH7 A;  1NGJ A;  3BDP A;  1MWK A;  4FM1 A;  5AQS A;  3K5O A;  4Z4E A;  1GLL O;  3VEW A;  3LAL A;  4XEI A;  4B9N A;  3QET A;  4IOA L;  3VMF B;  2B5J A;  1NK4 A;  2HF4 A;  4TSX A;  4U7B A;  1DLO A;  4KI6 A;  4DSK A;  3CQY A;  4JS5 A;  2FSJ A;  1FK9 A;  4CF0 A;  4LC9 B;  4CVN E;  4IG3 A;  3EO3 A;  3CC4 N;  1VQO N;  2G8F A;  3CQ8 A;  3WXJ A;  3AVH A;  5BRE A;  2PZS A;  4C8O A;  1ASW A;  2RKI A;  3M5R A;  4K8Z A;  3U3G A;  4B3M K;  5KPT A;  4OVL A;  3THY A;  1ZBU A;  5LL6 Z;  1H1V A;  4H5V A;  4KH5 A;  2QWQ A;  2G8V A;  3OYI A;  3O1B A;  2QEX N;  1WSH A;  3JXU A;  3TU5 A;  2UUC K;  3SQ0 A;  4J8F A;  5C24 A;  4IBN A;  5ELZ A;  3SJJ A;  1KLN A;  3C94 A;  3OS0 A;  4JNE A;  2CH5 A;  2QWN A;  4BVO A;  3CJ7 A;  1B92 A;  1REV A;  2OTJ N;  1UOC A;  4NB4 A;  5FPN A;  1HQE A;  2A5X A;  3AVM A;  3T1Y K;  1HKC A;  4BDZ A;  1NGH A;  3Q7B A;  3CM6 A;  3SV4 A;  3RRH A;  4DTO A;  1Y97 A;  4B9V A;  1X3M A;  4O5F A;  3ZT3 A;  1U2V B;  4FWR A;  4CHP A;  4Z94 A;  5C12 A;  2NRZ A;  3ATU A;  4B1W B;  4E72 A;  1L3V A;  4WYB A;  4JAX A;  4CFA A;  2YJE A;  3AA2 A;  4DV6 K;  1I94 K;  4CEF A;  4M3Z A;  4CEO A;  4B1X B;  4BRC A;  4FL9 A;  3J7Z O;  1B9D A;  2ITG A;  2YCH A;  1RDA A;  4C1N K;  3MEC A;  3OYH A;  1HPZ A;  1C0U A;  5BPN A;  2OYQ A;  4JN4 A;  1W97 L;  3A5L C;  5FPE A;  1HKG A;  1J5E K;  1UWB A;  1Z25 A;  2D0B A;  4PKG A;  3T1A A;  3FZL A;  3D0P A;  4FK0 A;  4CJF A;  2GWK A;  3CME N;  4F2R A;  1B9F A;  1CZA N;  4N76 A;  5I9E B;  1BHL A;  1QHA A;  2P9P A;  2HVH A;  3C0B A;  1O13 A;  4I9Q A;  1ZBS A;  3NF8 A;  4A5B A;  5AZJ B;  4IOX A;  3ULE B;  1RDC A;  3D45 A;  3DAW A;  4KB0 A;  3NH2 A;  4RW8 A;  2E6M A;  3MEG A;  3QER A;  4Y1D A;  2E20 A;  4NCB A;  4PHT X;  4U67 L;  1QQC A;  1Q86 O;  5AQH A;  1HKB A;  1C1A A;  3LZJ A;  2KLA A;  5AZJ A;  3V9X A;  2A1R A;  3ULE A;  5EX5 A;  2OPQ A;  1HR0 K;  3CCJ N;  5TKY A;  4PL7 A;  4L8R B;  1IBM K;  4CEC A;  3M6G A;  4OO1 J;  2I7P A;  1BGX T;  3BF3 A;  3IAY A;  4J2D A;  3KZB A;  1C1C A;  2O8C B;  2QWR A;  2IAJ A;  1VQ8 N;  3PSI A;  3KD1 E;  4IO9 L;  4I2P A;  5CHI A;  3S3O A;  3SI6 A;  3L3V A;  3P31 A;  3VA3 A;  2E6L A;  2P5G A;  4BC4 A;  1IO2 A;  1VSJ A;  4C8K A;  3I55 N;  3AVJ A;  2FLO A;  3TTC A;  4N41 A;  3AGK A;  4MQ3 A;  3CQX A;  4RW4 A;  3IUC A;  3OS1 A;  1VRT A;  3AGR A;  1HPM A;  2YNF A;  1D4X A;  4DHY A;  1S1W A;  4KKO A;  4KHQ A;  1WSG A;  4DU3 A;  3VQP A;  3SLC A;  4KRE A;  5T7B A;  1VSL A;  3DI6 A;  3F9K A;  3EE8 A;  2YKN A;  4YOW A;  4LH5 A;  3JYT A;  1KSP A;  3O5B A;  3E01 A;  4K25 A;  2WFB A;  1GLA G;  4JKD A;  5JLH A;  1KVC A;  3CXC M;  3SMS A;  3LWL A;  4DR1 K;  4BRF A;  4KBO A;  5EVZ A;  4JKG B;  4V19 S;  3OYJ A;  4BE7 B;  4DLG A;  1LOT B;  3KLI A;  3BP8 A;  4DSL A;  1A5W A;  1J53 A;  4DMN A;  1ITG A;  3DRP A;  1RIL A;  1QZ6 A;  3L8B A;  4BGA A;  5BRD A;  4JKG A;  2HHT A;  3ID8 A;  1VQ6 N;  1VSI A;  3KWG A;  4Y1C A;  1V4T A;  4DV1 K;  5C2D A;  4CEE A;  1XNQ K;  1KVB A;  2GUI A;  3O3F A;  4QS8 A;  1X3N A;  3IMX A;  5J2Q A;  4GKK K;  1IKX A;  2YHY A;  3LAK A;  1Z05 A;  1VQL N;  2J4R A;  2DFH A;  1WOQ A;  1E4G T;  4CFB A;  3OYA A;  1VQ4 N;  3K2P A;  5M1O A;  2XY5 A;  5LJV A;  5IT9 O;  4BRO A;  1LCU A;  4DFJ A;  2UXB K;  3DLG A;  4O8K A;  4CZI A;  1JCG A;  1BIS A;  2V7Y A;  3NDK A;  1WSF A;  1BQM A;  4YDU C;  1TKD A;  1NNE A;  1Q82 O;  3N4Q A;  2F8S A;  3VGK A;  2KFN A;  2FF3 B;  3AVC A;  3FLC O;  1QQO A;  2HHQ A;  2PBD A;  5SWM A;  3ZSR A;  3OYK A;  1Q9Y A;  3P4I A;  1QQM A;  3I33 A;  4YDU A;  3F2K A;  4N47 A;  5H1S Q;  3MCP A;  3HPH A;  1NWK A;  4CHY A;  4FLY A;  3THW A;  1TUY A;  2VQE K;  1OKJ A;  3TWH A;  4KPY A;  3PIO L;  4GW6 A;  3L2W A;  3IFR A;  2XHB A;  2NRR A;  3CCU N;  2YX6 A;  4E1J A;  4BR0 A;  4FW1 A;  4N56 A;  4LF4 K;  3GOI A;  1JJ2 M;  3PSF A;  1FKO A;  4M45 A;  1RTD A;  2JWK A;  1J5O A;  3M8R A;  2BH1 A;  1LV5 A;  3OYD A;  2HW3 A;  3OYF A;  3K9J A;  1RT4 A;  4LF5 K;  2Q3S A;  2IVN A;  3TTD A;  1S6Q A;  1QTM A;  1X9M A;  5F0X A;  2P51 A;  3QDK A;  4K41 A;  4PKI A;  3ZT2 A;  3ZT4 A;  3AA4 A;  4XJX A;  4OJR A;  4NLC A;  1YTA A;  4H0P A;  3H3O B;  1NK6 A;  1TYQ B;  4BRH A;  3IKM A;  3M8P A;  1T6D A;  2QWO A;  3LDS A;  5C0Y A;  2FBT A;  1EET A;  3VET A;  3M8Q A;  3QEP A;  4W5R A;  4LSL A;  3SMP A;  4E19 A;  3VQ9 A;  1JL2 A;  3WNF A;  4CF1 A;  5JVG L;  3NAE A;  3LPU A;  2E2P A;  4B1Z A;  3CCE N;  4B9M A;  1NGA A;  3U4L A;  3G6E N;  5JEN A;  2G8I A;  4LF8 K;  4WCE L;  4YFU A;  3K57 A;  4Z4H A;  3QIC A;  2Q0R A;  2YHB A;  5C25 A;  2HBK A;  4JD2 A;  1RDB A;  2IGI A;  4CHZ A;  2BUP A;  4A2A A;  4CJR A;  1WSJ A;  3A0I X;  4H4M A;  1KXP A;  4DSJ A;  1NMD A;  4DFK A;  4F4K A;  4BQZ A;  2Z1H A;  4IXC A;  2YV0 X;  5HRS A;  3T19 A;  1KC8 O;  3AVN A;  3LP1 A;  1YJW N;  3L4Q A;  4CJS A;  3AAR A;  4FWK A;  4FPA A;  4DV2 K;  4AHU A;  1T8E A;  1R59 O;  4YOX A;  1U04 A;  2R7Y A;  4A59 A;  3ZYY X;  2FBV A;  1LAV A;  1S3X A;  4A2B A;  4BG9 A;  5ADX A;  5CZ1 A;  5F2R A;  2HNZ A;  3VQC A;  1VQK N;  4DSI A;  1HQU A;  5AQN A;  1RT5 A;  1N5Y A;  4GKJ K;  5CE3 A;  4IFV A;  2RPI A;  3SAH A;  1RT2 A;  3C65 A;  4H0O A;  4KI4 A;  1K8K B;  5J2M A;  1GOC A;  2GTD A;  3D2E B;  1XHZ A;  2E1Z A;  3KLG A;  1TGO A;  4I6M B;  3R9P A;  3CFP A;  1S1U A;  4CD3 A;  3QEI A;  1IKY A;  1K8K A;  4QS7 A;  2QKK A;  4IJN A;  4EHT A;  4CZM A;  4DTM A;  4BRL A;  4AHT A;  1DT9 A;  3PX6 A;  2Q2R A;  1L3U A;  2PYL A;  3SAG A;  3F5T A;  2VWB A;  3VN5 A;  2AP1 A;  4BWM A;  1SL2 A;  4B8A B;  4DTR A;  4A5A A;  4B8C A;  2F9T A;  3PO4 A;  3LDO A;  3MCA B;  5M1F A;  4KHY A;  1NK7 A;  1BDG A;  2HHI A;  4DQR A;  2NRW A;  1RDW X;  2E2O A;  4RCH A;  5LJW A;  3ALY A;  1JKH A;  1L3T A;  1SQK A;  3TSQ A;  2P9L A;  2PAV A;  5HOO A;  4FLT A;  4M3X A;  4MO4 A;  1S5J A;  4J2E A;  4DQQ A;  3OBY A;  4ZTJ A;  3JAM O;  4PY5 A;  2QI2 A;  2HHS A;  1TK0 A;  2BE2 A;  1DKG D;  1S6P A;  4C8M A;  4E3S A;  3O9S A;  5DM7 L;  4M7Y A;  4CIF A;  4ISF A;  4FJN A;  4CJT A;  4AHR A;  1YF5 L;  3HBT A;  4IEE A;  3HM8 A;  4IO8 A;  3JSM A;  4B3R K;  1L3S A;  3QO9 A;  5C15 A;  3FFI A;  2X78 A;  4JI5 K;  5IWA K;  1GLC G;  3UKR B;  3EYZ A;  1MA9 B;  4DF4 A;  1UAX A;  2I5J A;  1JCF A;  4CBW A;  3ZT0 A;  4DF8 A;  3ENB A;  4XH1 A;  4JHD B;  4BRK A;  1NKE A;  2F4V K;  4OPK A;  3VQ8 A;  3K5N A;  2Y1I A;  1W7A A;  3EL2 A;  5CZ2 A;  4RW9 A;  4JKF A;  1WB9 A;  1S72 N;  3CIP A;  4FW2 A;  3CER A;  3C6A A;  1JLG A;  2P5O A;  4DSF A;  4FM0 A;  1ZC6 A;  5J1E A;  4N5S A;  3KLF A;  1HJO A;  1HNW K;  2NRV A;  1BA0 A;  4FWO A;  1FJG K;  4BR9 A;  3D2F A;  4OGE A;  3ZEU B;  1TAQ A;  2OZM A;  4BR7 A;  4X62 K;  2KQ2 A;  1Q7Y O;  1CZ9 A;  1KVA A;  4FVU A;  4CK1 A;  1IBL K;  2Q31 A;  4JI1 K;  1TL3 A;  4BGB A;  4FCY A;  4EAH D;  4XH5 A;  4CJE A;  1KD1 O;  1TKT A;  3UE5 A;  1QHT A;  1XHX A;  3CC2 N;  4KTQ A;  4J2A A;  4MLE A;  3HP6 A;  3AVA A;  1W9H A;  1YJN N;  4M3W A;  3FE1 A;  4DQI A;  3K59 A;  3RR8 A;  3CCQ N;  4M3U A;  3TAB A;  1HJR A;  2PYJ A;  5HP1 A;  4BRG A;  3IG1 A;  4IG0 A;  1HX1 A;  3SPY A;  4DUZ K;  3DM2 A;  4ISG A;  3VQE A;  4BEC A;  3THV A;  2OPR A;  3THY B;  1NGF A;  1VRU A;  4H5N A;  3VGL A;  2UUA K;  4E7H A;  5JIC A;  1NJI O;  5GIO A;  4KV8 A;  1GOB A;  2E5L K;  3V1Q A;  2Y1J A;  1RNH A;  5AQT A;  3TAQ A;  4NCA A;  1X9J A;  3ZCM A;  3LZI A;  1Q81 O;  2PFU A;  3AVL A;  3ZX3 A;  4CGF A;  3H1Q A;  3VEO A;  5JVH L;  4W5N A;  2P1J A;  4YOR A;  3W0L A;  3WEE A;  4CIE A;  3HSC A;  3W3D A;  1WBB A;  3CCS N;  3JS6 A;  4WF9 L;  1NK9 A;  3VQA A;  4QS9 A;  2O4I A;  1YXQ A;  1GLE G;  4NCG A;  4B9Q A;  3OJS A;  1JLC A;  3DXM B;  3EY1 A;  2ZM6 K;  4JI4 K;  3TR8 A;  3RMC A;  4CER A;  1ATS A;  1D9D A;  1S1V A;  1RT6 A;  1VSM A;  5J2N A;  2QM1 A;  1GOA A;  3VEY A;  4LSN A;  3SAF A;  3O4W A;  2QTD A;  4Y0W A;  3DXM A;  3SUQ A;  3HST B;  1U49 A;  4B3S K;  2CH6 A;  3T3F A;  5E41 A;  4FJK A;  4EIA A;  4FLX A;  3ZLJ A;  4BVP A;  3MEE A;  1RBS A;  1WAF A;  4JK8 A;  3MXM A;  2IVP A;  4G1Q A;  5HRN A;  4DFP A;  2VCP A;  3AO3 A;  4WFB L;  3SK3 A;  4A62 A;  2OZS A;  4ELU A;  5ADX H;  1A5X A;  5AQR A;  2OPP A;  5E26 A;  2P9P B;  3V9S A;  1TAU A;  5FRM A;  2W42 A;  1NGC A;  3H45 C;  3QB0 A;  2D0A A;  1HRH A;  1BCM A;  3NGY A;  4G9Z A;  3MX5 A;  1NJW A;  5M1Q A;  1CZB A;  3BY5 A;  4FJJ A;  2DTU A;  2OPS A;  1XC9 A;  4DUY K;  5AQK A;  3KWI A;  4IZ9 A;  5AQV A;  4H03 B;  1IG8 A;  3R6M A;  3PX0 A;  4CZH A;  3KK2 A;  2RN2 A;  3SZ2 A;  3C7N B;  3D6R A;  4O55 A;  3K58 A;  1V4S A;  4K0K K;  3KD5 E;  3OHR A;  3ZT1 A;  4X66 K;  2P9I A;  4IOC L;  4DV3 K;  1WLJ A;  4DV7 K;  1CXQ A;  3NH1 A;  2GV9 A;  3R1X A;  3QNN A;  3C7N A;  1NOZ A;  3S41 A;  4KB1 A;  4E89 A;  2X6N A;  1ASV A;  1ZXO A;  2OCE A;  4O4G A;  3AO2 A;  4FOI A;  1QZ5 A;  3F73 A;  4HUE A;  4DS4 A;  3EKS A;  1IV0 A;  2ZJR L;  4HCB A;  2Q0U A;  3QLH A;  1JL1 A;  3MN7 A;  1OH8 A;  1VK0 A;  4BR4 A;  1EQY A;  4FLU A;  3I8D A;  3CC7 N;  2F8T A;  4Q0B A;  4KHN A;  3A5N C;  2YJF A;  3PY8 A;  5FRO A;  2P9N B;  2RHK A;  1OH6 A;  4O8U A;  5GAD P;  2GUP A;  3I0S A;  4DLE A;  4BE0 A;  4E1M A;  3ITH A;  1G99 A;  4LY7 A;  4JI8 K;  5KTQ A;  3SCX A;  2NNW A;  4OGC A;  5CY4 A;  2Q1N A;  2P9N A;  3KIO A;  5BR8 K;  4BG8 A;  5AQJ A;  3WNG A;  3N4P A;  3AA5 X;  3H6E A;  3UKU B;  5AQY A;  3SPZ A;  3MWT A;  3DXK A;  4GMJ B;  4M42 A;  4GVE A;  2WBN A;  1WSI A;  1QQN A;  2NRX A;  4CED A;  2W40 A;  3UKU A;  3L3U A;  4DTX A;  1RBV A;  3NCI A;  4HTU A;  4BR5 A;  1N8R O;  4KFB A;  1EWQ A;  5AQL A;  3LDL A;  1JLB A;  5AJ3 K;  4I2Q A;  4PA1 A;  3V4I A;  1BO5 O;  1XWL A;  3FZH A;  2KHO A;  4MDA A;  1RFQ A;  4CF2 A;  5AQU A;  4AIL C;  3ZSO A;  3J80 O;  4WFA L;  1HNX K;  1TVR A;  2QXL A;  2QKB A;  2HHX A;  2WTU A;  3TAE A;  2A3Z A;  2RF2 A;  3A2F A;  4CHN A;  4CJV A;  4FSV A;  1HNI A;  3WNH A;  3OJU A;  1VQN N;  4DQP A;  4DU4 A;  4OPH A;  4Q5V A;  3TAN A;  4FLW A;  4KHP K;  1G15 A;  3TPQ A;  3QML A;  3G0Z A;  3GBT A;  2UUB K;  3T7Z A;  4CEB A;  3KHY A;  4HHT A;  4E7I A;  4MLH A;  4NYF A;  1UA1 A;  1NKC A;  2HND A;  4FJH A;  3SYZ A;  3ULD A;  4BAC A;  3TAM A;  4M3T A;  4OKK A;  1BG3 A;  3O9R A;  2YNG A;  3AV9 A;  2E8A A;  1D8Y A;  1L5U A;  1CXU A;  5AQW A;  4OKJ A;  3HO1 A;  4CJ3 A;  5AQZ A;  2HMI A;  5DM6 L;  2FC0 A;  3OBW A;  3CF5 L;  1BUP A;  4RW6 A;  3OYG A;  5AQF A;  1RDD A;  1VSK A;  3THW B;  4DV4 K;  1EP4 A;  3CPW M;  1NU0 A;  3DLE A;  2VG7 A;  4JYA K;  2HBM A;  3PX4 A;  3K9K A;  5M1K A;  2HHH K;  1YTU A;  3AVI A;  2GWJ A;  4F9O A;  2IIR A;  5BR9 A;  3GE1 A;  4BRD A;  3H1V X;  5KQD A;  2P9S B;  3MXJ A;  2NZT A;  2E2Q A;  3HK2 A;  4B3T K;  4FJ8 A;  2B6A A;  2QWM A;  4CD1 A;  1U4B A;  1D9F A;  2GX9 A;  1KAZ A;  3AO4 A;  4IFY A;  2P9S A;  4DR6 K;  2D1K A;  1YIT N;  3TAP A;  1LW2 A;  2IS3 A;  3PV8 A;  2NLX A;  2F7T A;  3L2U A;  2YHW A;  4CFD A;  4CGH A;  2YHA A;  4BC5 A;  1MU2 A;  4H0V B;  3V81 A;  3HVR A;  1C0F A;  3VQB A;  4MFB A;  5AQI A;  4FJ5 A;  4DV0 K;  3HI0 A;  3NH0 A;  3ENO A;  3MDQ A;  2FF6 A;  1EKE A;  2KZM A;  4LD0 A;  4FJ9 A;  1SKS A;  2HHV A;  3WXM B;  3SJH A;  2E88 A;  4CCH A;  4LFB K;  3IS9 A;  4AM7 A;  4FWQ A;  2WUS A;  5AFU A;  1HNZ K;  3E9P A;  3VTH A;  4DWI A;  2JLE A;  4HVJ A;  1S9E A;  4DTP A;  3VTI A;  2ZE2 A;  3SV3 A;  4FVM A;  4I9L A;  1KQS M;  3J7Y P;  4BY9 C;  2E2N A;  4M3Y A;  1SKW A;  3C95 A;  4IWV A;  3BZK A;  3TSP A;  1WN7 A;  4JD2 B;  3HYF A;  1VSF A;  1SAZ A;  2E1Y A;  4H5W A;  1EWR A;  4DR3 K;  1RDU A;  3IDH A;  3J7A P;  2G8H A;  3KKS A;  2BGG A;  4CFC A;  3I8B A;  5FPD A;  3TSU A;  3KKR A;  3A5O C;  3DLK A;  4CHO A;  1S1T A;  4A61 A;  3TAR A;  4F3T A;  1NM1 A;  1ILY A;  1P90 A;  1NK0 A;  4JS4 A;  1SS6 A;  2O8B A;  3THX B;  4YOT A;  4RTF D;  4JKB A;  4GV3 A;  3VQ6 A;  1NJY A;  2JWL A;  2ASO A;  3O9U A;  3P38 A;  3ZX2 A;  3LAN A;  4Z4I A;  1HLU A;  4CI6 A;  1NOY A;  5JS2 A;  1NGB A;  5AQO A;  1NGE A;  4WFN L;  4NXN K;  4AF1 A;  3WXK A;  3THX A;  2A42 A;  1XUP O;  4JKH A;  3CFO A;  4EZ6 A;  4RW7 A;  1QE1 A;  2D0P A;  3RMD A;  4FJX A;  4KHU A;  5EXW A;  4M3R A;  1D5A A;  2ZJP L;  2YI1 A;  4Z0U A;  4YOV A;  4CZL A;  5DMR A;  1NJX A;  3OYN A;  2WC9 A;  4ZTF A;  4KRF A;  4O44 A;  2F96 A;  3SUP A;  2OA8 A;  3MMV A;  4HUG A;  3S9H A;  1SV5 A;  1K8A O;  1Q9X A;  2LSN A;  1T6C A;  5A2Q O;  2HST A;  4CE9 A;  2GEM A;  2QWL A;  1RTH A;  3GL1 A;  1RTI A;  2F9W A;  2FBX A;  4FK4 A;  1RBR A;  1YJ9 N;  3Q7C A;  3VF6 A;  2V7Z A;  4IFE A;  4CIG A;  4J2B A;  5LMN K;  4CK3 A;  3DLR A;  1YAG A;  2O4G A;  2RE2 A;  1S9G A;  3FR0 A;  2CGJ A;  4FO0 A;  5BN9 A;  3PLA A;  1VSE A;  2ZGY A;  1TUU A;  2P9L B;  3QIO A;  3EE9 A;  4IKF A;  3O3G A;  5CYQ A;  1J6Z A;  3CI5 A;  4R5P A;  1YIJ N;  2ZWH A;  4BRI A;  4OPA A;  3CFR A;  2G8U A;  2ETJ A;  4ID1 A;  2VGN A;  1JLQ A;  2KTQ A;  3MAQ A;  3ATV A;  3TTF A;  2P9U B;  4DB3 A;  3KTQ A;  2YKM A;  1OH5 A;  5C42 A;  1TKZ A;  2QK9 A;  1RTJ A;  1FKP A;  1P8Z A;  3RSE A;  3OYM A;  3HXM A;  2Z1J A;  3U6F A;  1VQP N;  3WT0 A;  2Q36 A;  4BQL A;  1KTQ A;  3UIQ A;  4BE1 A;  4F3O A;  2B4J A;  3M3Z A;  4CJ4 A;  4ELT A;  2P9U A;  4OPJ A;  1ZBL A;  5KI6 A;  3G25 A;  3ZX0 A;  1RBT A;  1JXE A;  3O9Q A;  3AO5 A;  1BCO A;  5EY4 A;  4JI3 K;  3AY9 A;  3VOV A;  3A5M C;  4B1U B;  1Q8I A;  1YT3 A;  1BU6 O;  3P83 D;  1KLM A;  3FZK A;  3SBG A;  1J54 A;  1NK5 A;  1HYV A;  5EOY A;  3NVM A;  2ITM A;  3D2F B;  4FZZ A;  1GLD G;  4CBU A;  3U9D A;  5KRT A;  4C8L A;  1WAJ A;  1JLA A;  4R79 A;  3QEV A;  1IJJ A;  4AQY K;  3L0Q A;  1LW0 A;  1BA1 A;  4CEQ A;  3NMU A;  4GV9 A;  2CGK A;  4YY3 K;  3BGR A;  3DOL A;  3CCR N;  1SL1 A;  1N34 K;  3SQ4 A;  3VQ7 A;  2FSK A;  1ZBH A;  1BOT O;  3MWP A;  5JMV A;  4ICL A;  5M1N A;  3RR7 A;  1JLE A;  1KCF A;  1WBD A;  4ISE A;  4BDP A;  4CHQ A;  5AQM A;  4EZ9 A;  3M1F A;  4OLB A;  2O8D A;  2IVO A;  3O8M A;  3P1G A;  3S5T A;  2FBY A;  2HMP A;  1OVY A;  1YVN A;  3ZET B;  4FJ7 A;  4WE1 A;  4FJL A;  2UYT A;  3BEX A;  4B1Y B;  3E9O A;  3WUH A;  5K14 A;  3WNE A;  2P9K B;  3CD6 N;  2ASM A;  3ZET A;  3NFA A;  3I56 N;  4CZF A;  3OY9 A;  5FPM A;  5HL7 L;  3WEE B;  5AZI A;  5HRO A;  4H4O A;  3VES A;  4H0Y B;  4PUO A;  3RVC A;  4ILH A;  2X74 A;  5JS1 A;  3TI0 A;  2P9K A;  5AFU H;  5F1X A;  2W6L A;  1EO1 A;  3MX2 A;  3FZM A;  1QSL A;  5GAG P;  3ZSZ A;  5GIP A;  4CJL A;  5J2P A;  3B6P A;  1X1P A;  3HZ6 A;  4YHH K;  3RTV A;  1BWF O;  1TKX A;  2XRI A;  3ZSX A;  3MN9 A;  2IDO A;  4JK9 A;  4M7X A;  1NGI A;  1SUQ A;  3FFK B;  3EKU A;  4AHS A;  4W5Q A;  5KPZ A;  4DR4 K;  4CJU A;  3OYE A;  4H0T B;  2W6K A;  1TL1 A;  5HLF A;  4CBX A;  3B6O A;  3VQQ A;  3ISN C;  1Z26 A;  3HPO A;  2EHG A;  3OA9 A;  1LAW A;  2A1S A;  2JGU A;  3EZW A;  3CJA A;  1KFD A;  3T1H K;  5HBM A;  4X64 K;  3SUO A;  3KK7 A;  4FJM A;  2CGL A;  4K42 A;  4X65 K;  3DYA A;  3U8X A;  2ZF5 O;  5HRP A;  4B9L A;  3OW2 M;  5BRH A;  3AVB A;  3EN9 A;  1VQ9 N;  5JLF A;  1MDU B;  2V52 B;  4AHV A;  1YUW A;  2HHU A;  3AVG A;  1ZBF A;  3QIN A;  3LP3 A;  1JCE A;  4KH6 A;  5CR4 A;  3FZF A;  3PO5 A;  1E4F T;  4XIU A;  1XNR K;  2A6A A;  3CCM N;  4LH4 A;  2A40 A;  4OLA A;  1JXB A;  1M1K O;  3SQ2 A;  2HVI A;  1OVQ A;  1U2V A;  1WNS A;  5I42 A;  5C10 A;  4NYN A;  3RWU A;  1ATR A;  5LMU K;  2A41 A;  5KRS A;  3KLE A;  4CGD A;  4CEA A;  2VWK A;  4ILJ A;  4FWL A;  3AO1 A;  2P9I B;  1XC3 A;  1VQ7 N;  4C23 A;  3R8E A; 
#chains in the Genus database with same CATH homology
 3AAR A;  4FWK A;  3O9R A;  4FPA A;  2E8A A;  1R59 O;  3CET A;  4YOX A;  5AQW A;  4A59 A;  3ZYY X;  1S3X A;  5AQZ A;  3VPZ A;  4A2B A;  5DM6 L;  3QFU A;  5AQP A;  4BG9 A;  5ADX A;  3H46 O;  3OBW A;  2I7N A;  1BUP A;  4GNI A;  5F2R A;  3CF5 L;  4MDB A;  5AQF A;  1VQK N;  5AQN A;  4KH4 A;  3CJ1 A;  2ZGZ A;  4WQ5 C;  2FXU A;  5CE3 A;  3LM9 A;  3SAH A;  3BF1 A;  4JK7 A;  5TKW A;  3CPW M;  3C65 A;  3U9Z A;  4H0O A;  5GIN A;  3HOS A;  4GY2 B;  3ZEU A;  1K8K B;  3VF2 A;  2HBM A;  4MO5 A;  2GTD A;  3K9K A;  5BRF A;  5M1K A;  3D2E B;  1K9M O;  3WQT A;  5AZI B;  4CZG A;  4BRA A;  2E1Z A;  2GWJ A;  4F9O A;  2IIR A;  1GLB G;  4I6M B;  3GE1 A;  5BR9 A;  5GAE P;  5KQ8 A;  3E1Y A;  1QVG M;  3R9P A;  4BRD A;  3H1V X;  5KQD A;  2P9S B;  1KAY A;  4CD3 A;  3VEV A;  4B1V A;  4JKA A;  1NGJ A;  2NZT A;  1MWK A;  2E2Q A;  1K8K A;  3J8A A;  4WQ5 A;  5AQS A;  2QWM A;  5AQQ A;  1GLL O;  4QS7 A;  4CD1 A;  3VEW A;  3VF4 A;  4IJN A;  4XEI A;  4EHT A;  2GX9 A;  4FPB A;  3WXL A;  4CZM A;  4BRL A;  2HOE A;  4IOA L;  1DT9 A;  3VMF B;  2Q2R A;  1KAZ A;  2HF4 A;  3SAG A;  2P9S A;  4BC3 A;  4U7B A;  3F5T A;  2VWB A;  2AP1 A;  1HUX A;  2D1K A;  3CJ9 A;  3CQY A;  4YOU A;  3VEX A;  1YIT N;  2FSJ A;  4LC9 B;  3DXK B;  2NLX A;  3EO3 A;  3CC4 N;  1VQO N;  2F7T A;  4A5A A;  2YHW A;  3A8Y A;  2F9T A;  3CJB A;  3WXJ A;  3LDO A;  3MCA B;  5M1F A;  3E66 A;  3CCV N;  5BRE A;  4BC5 A;  1BDG A;  4C1N I;  3DLL L;  2NRW A;  1K73 O;  2NRH A;  4H0V B;  1S22 A;  4NO7 A;  1RDW X;  1C0F A;  2E2O A;  5AQI A;  4RCH A;  5LJW A;  3O6W A;  3M5R A;  2QW9 A;  3HI0 A;  3ENO A;  5KPT A;  4CZK A;  1H1V A;  1SQK A;  4H5V A;  2QWQ A;  3MDQ A;  4KH5 A;  2FF6 A;  3O1B A;  2QEX N;  3TU5 A;  3JXU A;  1VQM N;  3TSQ A;  4FWP A;  2P9L A;  2PAV A;  5HOO A;  4J8F A;  1RGI A;  5ELZ A;  4MO4 A;  4CJ7 A;  3WXM B;  3OBY A;  3SJH A;  2E88 A;  4JNE A;  4A57 A;  2CH5 A;  2QWN A;  4BVO A;  4AM7 A;  3CJ7 A;  2WUS A;  4FWQ A;  2QI2 A;  3E9P A;  3VTH A;  5AFU A;  2OTJ N;  1YHQ N;  1DKG D;  2VYP A;  4NB4 A;  5FPN A;  2YHX A;  2A5X A;  3O9S A;  4BC2 A;  5DM7 L;  4YOY A;  4M7Y A;  1GLJ O;  1HKC A;  5AQX A;  1NGH A;  3Q7B A;  4ISF A;  3VTI A;  1YF5 L;  3HBT A;  4IEE A;  2EWS A;  3HM8 A;  1WUA A;  4IO8 A;  1KQS M;  4BY9 C;  1X3M A;  2E2N A;  4O5F A;  4H5T A;  5C15 A;  1U2V B;  4IWV A;  3TSP A;  4JD2 B;  4FWR A;  4Z94 A;  5C12 A;  2VGM A;  1SAZ A;  2E1Y A;  2NRZ A;  1GLC G;  3ATU A;  4H5W A;  3UKR B;  4B1W B;  1MA9 B;  4WYB A;  1RDU A;  3IDH A;  4JAX A;  5B8H A;  1JCF A;  4CBW A;  5KPR A;  2YJE A;  3ENB A;  4XH1 A;  3I8B A;  5FPD A;  3TSU A;  4JHD B;  4BRK A;  3A5O C;  1VAZ A;  3DWL A;  4K43 A;  1YI2 N;  4B1X B;  4BRC A;  4A61 A;  4FL9 A;  1ILY A;  1NM1 A;  3J7Z O;  1P90 A;  3EL2 A;  2YCH A;  4C1N K;  1SS6 A;  4JKF A;  1S72 N;  4YOT A;  5BPN A;  3CIP A;  4JN4 A;  4RTF D;  4JKB A;  4GV3 A;  3G4S N;  3CER A;  2JWL A;  2ASO A;  3O9U A;  1W97 L;  3P38 A;  3C6A A;  3E9L A;  3ZX2 A;  3GG4 A;  3FGU A;  1HLU A;  2H3G X;  3A5L C;  3SBT A;  1Z6R A;  1HKG A;  4CI6 A;  2D0O A;  5FPE A;  1ZC6 A;  1NGB A;  5AQO A;  1HJO A;  4PKG A;  1NGE A;  4WFN L;  4AF1 A;  3AAQ A;  3WXK A;  3R3L A;  2NRV A;  2A42 A;  2ZJQ L;  1XUP O;  4JKH A;  3PIP L;  1BA0 A;  3FZL A;  4FWO A;  4BR9 A;  3D2F A;  2GWK A;  3ZEU B;  3CME N;  4BR7 A;  2D0P A;  1CZA N;  3CCL N;  5I9E B;  1QHA A;  1SZ2 A;  2P9P A;  2Q97 A;  3C0B A;  5EXW A;  5GAH P;  1O13 A;  1Q7Y O;  1ZBS A;  4A5B A;  5AZJ B;  4IOX A;  2ZJP L;  1C0G A;  2YI1 A;  3ULE B;  4FVU A;  3MN6 A;  2W00 A;  4YOV A;  3DAW A;  4CZL A;  4JEP A;  3L6Q A;  2Q31 A;  1DEJ A;  3R8E A;  3O08 A;  4BGB A;  2E20 A;  4BRE A;  4EAH D;  4PHT X;  4XH5 A;  4U67 L;  1Q86 O;  5AQH A;  1KD1 O;  1HKB A;  2KLA A;  2WC9 A;  3UE5 A;  3CC2 N;  5AZJ A;  3ULE A;  4MLE A;  5EX5 A;  3MMV A;  3P39 A;  3CCJ N;  5TKY A;  4PL7 A;  1YJN N;  3FE1 A;  3M6G A;  1K8A O;  4AM6 A;  4OO1 J;  2I7P A;  3BF3 A;  1T6C A;  2HST A;  2GEM A;  3KZB A;  2QWL A;  3CCQ N;  3DJC A;  1VQ5 N;  1Q18 A;  3GL1 A;  2QWR A;  2F9W A;  4JKC A;  1VQ8 N;  4BRG A;  1DGK N;  1YJ9 N;  2ASP A;  3VEZ A;  1W2B M;  3Q7C A;  4IO9 L;  3BUZ B;  3VF6 A;  2V7Z A;  1HX1 A;  4IFE A;  5CHI A;  3P31 A;  4L3Q A;  1YAG A;  3HTV A;  4ISG A;  4BC4 A;  2RE2 A;  4BEC A;  2KKZ A;  3FR0 A;  2CGJ A;  4FO0 A;  5BN9 A;  3PLA A;  1NGF A;  4H5N A;  3I55 N;  3VGL A;  2FLO A;  4H0X B;  5JIC A;  3TTC A;  1NJI O;  2ZGY A;  3AGK A;  4EFH A;  3CQX A;  5GIO A;  3IUC A;  4EHU A;  3CMA N;  1TUU A;  2P9L B;  3CHW A;  3CJC A;  5AQT A;  1ATN A;  1X9J A;  3AGR A;  3EE9 A;  3F9M A;  3LDN A;  1HPM A;  5BN8 A;  4CZE A;  1J6Z A;  1Q81 O;  1D4X A;  2PFU A;  4DHY A;  3CI5 A;  3ZX3 A;  3H1Q A;  3VEO A;  5JVH L;  1YIJ N;  2ZWH A;  4BRI A;  4OPA A;  2DPN A;  4YOR A;  3WXI A;  3W0L A;  3WEE A;  4IDH A;  3HSC A;  5BPL A;  3QFP A;  3LM2 A;  3SLC A;  2VGN A;  4IJA A;  3W3D A;  3CCS N;  3JS6 A;  4WF9 L;  4XH4 A;  3G71 N;  3ATV A;  4QS9 A;  3TTF A;  2P9U B;  4DB3 A;  4BEB A;  4BRQ A;  1NGD A;  1YXQ A;  3EE8 A;  1GLE G;  4YOW A;  3GDQ A;  4IEI A;  1P8Z A;  3RSE A;  2BTF A;  3O5B A;  3AAP A;  3DXM B;  4B9Q A;  4BRN A;  4K25 A;  1VQP N;  4DCH A;  2WFB A;  1GLA G;  4JKD A;  2Q36 A;  3WT0 A;  4BQL A;  5JLH A;  2OAN A;  1ATS A;  3M3Z A;  2HBL A;  3CXC M;  3SMS A;  1XQS C;  2P9U A;  2QM1 A;  4BRF A;  3VEY A;  4KBO A;  3SAF A;  5EVZ A;  3O4W A;  4JKG B;  2QTD A;  4Y0W A;  4BE7 B;  3G25 A;  3DXM A;  2FSN A;  3UB5 A;  1LOT B;  3ZX0 A;  2HF3 A;  3BP8 A;  4H5R A;  3O9Q A;  2CH6 A;  5EY4 A;  3AY9 A;  3VOV A;  3A5M C;  4EIA A;  1QZ6 A;  3QBX A;  4PKH A;  4B1U B;  4BGA A;  1BU6 O;  4JKG A;  4BVP A;  3ID8 A;  5BRD A;  3FZK A;  1VQ6 N;  3KWG A;  1V4T A;  5C2D A;  4JK8 A;  4UY8 O;  3SBG A;  2V51 B;  1TYQ A;  2IVP A;  4QS8 A;  1NLV A;  4PL8 A;  2VCP A;  4WFB L;  3SK3 A;  1X3N A;  3IMX A;  5AQG A;  5EOY A;  4A62 A;  1GLF O;  3NVM A;  3LDQ A;  2YHY A;  2ITM A;  3D2F B;  1Z05 A;  1VQL N;  1GLD G;  2J4R A;  4CBU A;  5AQR A;  1MWM A;  1WOQ A;  3U9D A;  5ADX H;  1E4G T;  2QA4 N;  5E26 A;  2P9P B;  3HRG A;  4R79 A;  1VQ4 N;  4BRP A;  1NGC A;  5M1O A;  3H45 C;  3QB0 A;  4DQ8 A;  1IJJ A;  4G9Z A;  2W41 A;  3MX5 A;  5M1Q A;  4FOE A;  3L0Q A;  3LDP A;  1BA1 A;  3NMU A;  4GV9 A;  4RWT A;  2CGK A;  5LJV A;  4BRO A;  3KVG A;  1LCU A;  5AQK A;  4FWS A;  3CCR N;  3KWI A;  3NVK A;  4IZ9 A;  5AQV A;  4H03 B;  1IG8 A;  3R6M A;  4O8K A;  4CZI A;  4CZH A;  3LL3 A;  1JCG A;  2FSK A;  2V7Y A;  3C7N B;  3D6R A;  4CZJ A;  1BOT O;  1V4S A;  3MWP A;  4YDU C;  5JMV A;  4GV6 A;  4JKE A;  1Q82 O;  5M1N A;  3N4Q A;  3OHR A;  4HTL A;  3VGK A;  2P9I A;  1T3V A;  4ISE A;  1Y64 A;  4WQ4 C;  2FF3 B;  3FLC O;  4DKW A;  4IOC L;  1QQO A;  5AQM A;  3O1W A;  3O9T A;  3R1X A;  2PBD A;  3M1F A;  3O80 A;  3MK6 A;  3C7N A;  2IVO A;  5MLC Q;  3O8M A;  3P4I A;  3S41 A;  5M1P A;  1QQM A;  2HMP A;  3I33 A;  1OVY A;  4YDU A;  1ZXO A;  1YVN A;  3F2K A;  5C2F A;  5H1S Q;  4ILG B;  2OTL N;  3MCP A;  3ZET B;  4FOI A;  1QZ5 A;  1NWK A;  3VER A;  1U6Z A;  4WQ4 A;  2UYT A;  3EKS A;  2ZJR L;  1TUY A;  2Q0U A;  3BEX A;  4M63 C;  4B1Y B;  3MN7 A;  1OKJ A;  3E9O A;  3WUH A;  1T44 A;  1QVF M;  4BR4 A;  5AR0 A;  2P9K B;  1EQY A;  2ASM A;  3CC7 N;  3CD6 N;  3PIO L;  3ZET A;  3IFR A;  2NRR A;  3B8A X;  4CZF A;  3I56 N;  3A5N C;  5FPM A;  2YJF A;  3D2E A;  3VEN A;  5LY3 A;  3WEE B;  5AZI A;  2YX6 A;  5HL7 L;  2P9N B;  2RHK A;  3VES A;  4E1J A;  4H0Y B;  4BR0 A;  4I6M A;  4O8U A;  4ILH A;  3RVC A;  5GAD P;  2GUP A;  3GOI A;  4BRM A;  1JJ2 M;  2P9K A;  5AFU H;  1G99 A;  5F1X A;  3MN5 A;  1YJW N;  2JWK A;  3H3N O;  3MX2 A;  3FZM A;  4NLB A;  5GAG P;  5GIP A;  1EO1 A;  1M90 O;  2NNW A;  3RSE B;  2Q1N A;  2P9N A;  3HZ6 A;  1BWF O;  4BG8 A;  5AQJ A;  2C1I A;  3MN9 A;  2BH1 A;  3N4P A;  4JK9 A;  4M7X A;  1NGI A;  4BR2 A;  3H6E A;  3FFK B;  3EKU A;  3UKU B;  5AQY A;  5KPZ A;  1KAX A;  3K9J A;  3MWT A;  2IVN A;  3DXK A;  4H0T B;  5BPM A;  3TTD A;  4GVE A;  3L4I A;  5F0X A;  1ESV A;  2WBN A;  1QQN A;  3QDK A;  4K41 A;  4PKI A;  2AA4 A;  2NRX A;  3WQU A;  4CBX A;  2W40 A;  3UKU A;  2NRT A;  4BR5 A;  1N8R O;  3ENH A;  4XJX A;  4NLC A;  3OA9 A;  4H0P A;  5AQL A;  3T69 A;  3H3O B;  1TYQ B;  3EZW A;  3CJA A;  3IKM A;  3LDL A;  5E84 A;  4BRH A;  3HOT A;  1T6D A;  2HBJ A;  2QWO A;  3KK7 A;  5C0Y A;  2CGL A;  1BO5 O;  3FZH A;  4K42 A;  2KHO A;  3U8X A;  4MDA A;  1NBW A;  2ZF5 O;  3ID6 A;  3VET A;  1RFQ A;  3SMP A;  5AQU A;  3OW2 M;  3D7E O;  5BRH A;  4WFA L;  5JVG L;  3EN9 A;  2QXL A;  1VQ9 N;  5JLF A;  2E2P A;  4B1Z A;  3CCE N;  2A3Z A;  1MDU B;  2V52 B;  1YUW A;  1NGA A;  4HWI A;  3U4L A;  4FSV A;  4KH6 A;  1NGG A;  1JCE A;  5CR4 A;  3G6E N;  3FZF A;  4FWN A;  1E4F T;  1VQN N;  4WCE L;  2A6A A;  2GEL A;  3CCM N;  3CCU N;  2QWP A;  2A40 A;  4OPH A;  1M1K O;  3CPE A;  3QIC A;  2Q0R A;  3TPQ A;  3QML A;  1U2V A;  3C6H A;  2HBK A;  4JD2 A;  2D4W A;  5C10 A;  3GBT A;  3VGM A;  3T7Z A;  3UKR A;  1ATR A;  2A41 A;  2BUP A;  3KHY A;  4ILJ A;  3QBW A;  4A2A A;  4FWL A;  2C1G A;  3A0I X;  1KXP A;  2P9I B;  4MLH A;  1NMD A;  1XC3 A;  4JHD A;  4BQZ A;  4IXC A;  1KC8 O;  4FWM A;  1VQ7 N;  4C23 A;  1BG3 A;  3L4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...