3A5OC

Crystal structure of a dictyostelium p109i ca2+-actin in complex with human gelsolin segment 1
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
370
structure length
366
Chain Sequence
QALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGKDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAILNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAAAAIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Gelsolin
publication title Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release
pubmed doi rcsb
source organism Homo sapiens
total genus 114
structure length 366
sequence length 370
ec nomenclature
pdb deposition date 2009-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5oC01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5oC02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3a5oC03
4BGAA 4QS7A 5CE3A 3SMSA 4JD2B 3O8MA 2GELA 4BVOA 2QWNA 4FWOA 4BG8A 3AAQA 4CZKA 4BC5A 1IJJA 1NGAA 3EKUA 3LDPA 2HOEA 3QICA 1NGGA 3EO3A 5FPNA 5BPMA 3F9MA 4BRQA 3ZEUB 3FZHA 2ASOA 3O1BA 1NGHA 1NGCA 5TKYA 3FR0A 3VGLA 5E26A 3W0LA 5ADXA 4F9OA 3C7NB 2ASMA 1HKBA 1NGFA 2P9IA 4EIAA 3CI5A 4HWIA 4A2AA 2E88A 4BR2A 3MN6A 1ATSA 1S22A 5AQIA 3KZBA 4GY2B 4PKHA 5EXWA 3U4LA 4BC4A 4GNIA 1QQNA 3IUCA 5JMVA 3A5OC 3LDOA 5AQQA 1TUYA 4BR0A 4BQZA 2V7ZA 2FF6A 3ENOA 3FGUA 2NZTA 5JICA 2QWRA 3O1WA 4YDUC 4H03B 4DCHA 3UKUA 1SQKA 3U9DA 5KPTA 4DB3A 3UB5A 5AQNA 4ISFA 2A41A 3ZX3A 4PKGA 4Z94A 3ZETA 4FWNA 4AM7A 4RTFD 3D2FB 2YJEA 1SAZA 2HF4A 1X3MA 1RDWX 2P9SA 3S41A 2GWKA 2CH6A 4BRCA 1XUPO 3SMPA 1HX1A 1NGDA 2CGJA 3A0IX 4DQ8A 4FSVA 1U2VA 3UE5A 5FPMA 3H1QA 1Z05A 2BTFA 4FO0A 4FOIA 4WQ4A 4H5TA 3D2EB 3GE1A 4Y0WA 5AQVA 2KHOA 2Q97A 3RSEA 2OANA 2NRHA 2D1KA 2FF3B 4HTLA 3ZX0A 4BRFA 4CD3A 4MO4A 5FPDA 1BA1A 2QXLA 3FLCO 5AQSA 1X3NA 3QBXA 2ASPA 3B8AX 4K42A 5EOYA 3CJAA 1NBWA 3BF3A 3GG4A 1QQOA 4PKIA 2H3GX 3GL1A 4FOEA 3M6GA 1RGIA 4CZGA 4BR7A 1NGEA 3MK6A 2Q31A 4JN4A 1QHAA 3ULEB 3LM2A 4CZEA 3ZX2A 2P9PA 4WQ5A 5BN9A 3WXLA 1RFQA 5BPLA 2J4RA 2QM1A 1U6ZA 1GLLO 1E4GT 3FZKA 4BRGA 3BF1A 4B1YB 3H45C 2IVPA 4O8KA 1NM1A 5AQHA 5KPZA 2P9NB 1XC3A 4JHDB 2QWLA 4FWKA 1XQSC 1MA9B 3VEOA 3QDKA 3LDQA 3WEEA 4CZFA 2P9KA 4H5VA 3HBTA 4FWLA 3CJ9A 4BC3A 4B1UB 5BRFA 3WXKA 2IIRA 2A3ZA 3O5BA 1E4FT 1C0FA 5AZJA 2PBDA 3QMLA 3AAPA 3QFUA 3UKRA 4BRLA 4E1JA 3LM9A 1HKCA 4BR9A 2D0PA 5AQXA 4BRNA 1SZ2A 5BRDA 2ZF5O 4WQ4C 2CGLA 1Z6RA 3VEXA 2E2NA 3CJBA 5AQGA 1YAGA 5EY4A 2YHXA 1C0GA 1X9JA 3FZFA 3ZEUA 4AM6A 1BO5O 3DXMB 3QFPA 4XH1A 1NGBA 3H6EA 2F9WA 3QB0A 1BG3A 4ISGA 4IJAA 2D0OA 4FL9A 1YXQA 5AQPA 3VF4A 1GLEG 1MDUB 2YHYA 3O6WA 3MN7A 5JLFA 1TUUA 3P4IA 2Q2RA 1QZ5A 1KAXA 1YVNA 2IVNA 2ZGYA 1CZAN 3TPQA 3CHWA 5AQKA 1BA0A 2ZWHA 4BRHA 2F9TA 1HPMA 2FLOA 3GOIA 3HI0A 3O08A 3JS6A 4BG9A 4BROA 3C0BA 3IMXA 2WUSA 4K41A 4M7YA 4CZMA 4CZHA 3U8XA 2D4WA 3EL2A 5AQTA 2E2PA 4NO7A 2A40A 4BRDA 1GLCG 3VEVA 4M7XA 1G99A 4XEIA 2V52B 5AFUA 2FXUA 3FE1A 5E84A 4BC2A 2W41A 1ZC6A 4H0XB 3VF2A 5BPNA 3TU5A 4DHYA 5AZIB 3WXJA 1K8KB 3FFKB 2QWPA 1DKGD 3CQXA 3AARA 2GEMA 3ZETB 3CJCA 3SLCA 1J6ZA 4FWPA 4I6MB 3VETA 5KQDA 5AQLA 3CQYA 3JXUA 2P9SB 2Q0RA 1BOTO 3KVGA 3D2FA 3O80A 2HMPA 2YCHA 1R59O 3EZWA 4CBXA 4IXCA 4A61A 5BR9A 3DAWA 4CI6A 4FWQA 3DXKA 5ELZA 2P9LB 1HJOA 2A5XA 2CH5A 5B8HA 1TYQA 3SJHA 4A2BA 3D7EO 2BUPA 4PL8A 4MLEA 1NGJA 5ADXH 5AQMA 3ATUA 3CETA 4A62A 3HSCA 3R9PA 1KAZA 3DJCA 5JLHA 3OHRA 1GLDG 3HZ6A 4XH5A 3MMVA 1HUXA 3BP8A 1BWFO 3VERA 3CERA 2P9PB 5FPEA 1GLAG 2V7YA 1MWKA 1NGIA 1V4SA 1WUAA 1NMDA 4FPAA 4H0PA 3SK3A 4CBWA 4L3QA 3U9ZA 1KAYA 4EFHA 3H3NO 4LC9B 2P9UB 3VOVA 2I7NA 5KQ8A 2YHWA 2CGKA 1HLUA 4CBUA 4PL7A 2P9NA 4BVPA 5EVZA 4CD1A 4EHUA 2QWOA 4IO8A 3BEXA 4YDUA 1T6DA 4BRKA 1JCGA 4BQLA 4K43A 5AQFA 4JD2A 3M1FA 4IJNA 1OKJA 3AY9A 4IWVA 2V51B 3R8EA 4RWTA 4B1ZA 1MWMA 3FZLA 4KBOA 3VESA 4FWRA 2A6AA 5KPRA 2FSNA 4H0VB 1P8ZA 2AA4A 3ID8A 1BU6O 1LOTB 4CZLA 2GUPA 4RCHA 4FWMA 5I9EB 3VENA 2P9IB 4M63C 4BRPA 1V4TA 4JNEA 2AP1A 4JAXA 3C7NA 2QWMA 2I7PA 2Q36A 2E8AA 3CJ1A 2DPNA 1H1VA 3O4WA 3VEZA 1QZ6A 1QQMA 2GTDA 3DXMA 3GBTA 4WQ5C 3VEWA 2Q1NA 1DEJA 5AR0A 1DGKN 4QS9A 3I33A 3MDQA 2QWQA 2ITMA 5LJVA 4BRAA 4O5FA 1GLFO 3IDHA 5EX5A 3W3DA 1D4XA 3KHYA 3UKUB 3WQTA 3WXIA 3EN9A 1S3XA 1YUWA 4BRIA 1BDGA 3BUZB 3HTVA 2GWJA 3A5MC 3MCPA 3H3OB 5AQOA 3VPZA 4CZIA 1BUPA 2VCPA 4CZJA 1ATRA 4H5WA 1NLVA 5BRHA 5AQZA 1Y64A 4H5NA 1JCEA 4FWSA 1ZBSA 3A5NC 2PAVA 4XH4A 1U2VB 4B1VA 5AZIA 2Q0UA 3M3ZA 1K8KA 3MN9A 5F0XA 2W40A 4I6MA 1T44A 2ZGZA 3CJ7A 3LL3A 3VGMA 4H0YB 5BREA 4B1XB 5AQRA 3WT0A 2FSJA 3L6QA 3L0QA 3RSEB 3WQUA 3R6MA 2E1YA 5AQWA 4BRMA 3WUHA 3VEYA 4MLHA 3D2EA 2UYTA 3DXKB 3DWLA 4J8FA 4WYBA 1HKGA 1TYQB 3LDLA 2E1ZA 5AQUA 4K25A 5AQYA 3H1VX 5AQJA 1NWKA 5BN8A 3CIPA 2EWSA 2P9LA 2YI1A 1LCUA 2NLXA 4BR5A 4H0TB 3H46O 3EKSA 1WOQA 3ATVA 3VF6A 4NB4A 2YJFA 4FPBA 4C23A 1KXPA 4MO5A 3ULEA 3J8AA 5LY3A 4EHTA 2HF3A 4BGBA 3FZMA 4BREA 1JCFA 1GLBG 1T6CA 4QS8A 2E2OA 4B1WB 2E20A 3MN5A 1IG8A 2VWBA 5F1XA 3G25A 1ATNA 5F2RA 4EAHD 3A5LC 3GDQA 2FSKA 1ZXOA 3I8BA 4H0OA 1Q18A 4IZ9A 4B9QA 1GLJO 3QBWA 3WEEB 4H5RA 4CJ7A 1EQYA 3IFRA 2P9KB 4JHDA 3A8YA 5LJWA 4BR4A 2P9UA 3ENHA 2E2QA 3HM8A 5AFUH 3L4IA 5AZJB 2A42A 4ISEA 3UKRB 2IVOA 3LDNA 3VGKA 1ESVA 2VYPA 2QW9A
chains in the Genus database with same CATH superfamily
4BGAA 4QS7A 3PSIA 3R1XA 3ENBA 4JD2B 4FJ5A 5C2DA 2GELA 2ATQA 4GV9A 1RBVA 1S1UA 1IJJA 1NGAA 2QI2A 3SPYA 3EKUA 3BZCA 5BPMA 3EO3A 4OJRA 3THYB 4BRQA 5JVGL 3M5RA 3ZT1A 3J80O 1NOZA 4TSXA 3W0LA 3NH2A 4ELTA 3P38A 4J2AA 3HSTB 3RWUA 1X9SA 1HKBA 4HUEA 4YOXA 1XMOK 2NRWA 4B3RK 3KLEA 2KQ2A 2WOMA 1TK5A 4A2AA 1KD1O 1C0UA 3KD5E 4CJPA 1HNXK 4M41A 1S22A 3QEIA 1U4BA 4B3SK 1D5AA 3SQ4A 4KREA 3V6DA 3KZBA 4BC4A 4GNIA 1IG9A 1G15A 5JMVA 4IEEA 3QINA 4ICLA 4DTPA 1J53A 4CERA 4LD0A 2V7ZA 4DTOA 3ENOA 3FGUA 5JICA 1BI4B 4DCHA 2FBXA 4CEQA 1YT3A 2QKBA 3TAEA 2GBZA 3NGIA 4LF7K 3ZT3A 1HR0K 4F4KA 3ZETA 2HHTA 4AM7A 3K2PA 4RTFD 3MX2A 1SAZA 1XMQK 1TK8A 1RDWX 2P9SA 4B08A 4BRCA 5J2NA 1NGDA 3A0IX 5J2PA 3O4NA 1EX4A 3OA9A 4NLCA 1U2VA 3E9OA 4O4GA 1BISA 3UE5A 4PUOA 4KHYA 5M1OA 1Z05A 4ID1A 5KI6A 1EETA 4FOIA 2KHOA 5FROA 4CFAA 4C8OA 2DTUA 2OA8A 3AGKA 3ZX0A 5GINA 4B9TA 3KKSA 3QBXA 1NBWA 3I55N 1QQOA 4N47A 2IS3A 4JK9A 2H3GX 4DQQA 3GL1A 3VQEA 3M6GA 1RGIA 4JK8A 3OYEA 2G8IA 1XNRK 4AHRA 1QHAA 3ZSWA 4M3XA 5CR4A 4DR6K 1EWRA 3HPHA 4WQ5A 5BN9A 2PYLA 2QM1A 1U6ZA 1JLEA 1J5OA 1RT5A 4WFNL 1N8RO 1K8AO 3H45C 4O8KA 4EP4A 4FW1A 1CXUA 3DLGA 5AQHA 5KPZA 2P9NB 1XC3A 3K9JA 4PHTX 2NRRA 3TANA 4NXMK 4DTXA 4FK2A 4DR2K 3CMEN 3AO5A 4H5VA 4BC3A 2X78A 4B1UB 5BRFA 3WXKA 3P1GA 2IIRA 4JV5K 2PBDA 3QFUA 4FJ8A 1RCHA 3L3UA 3V4IA 3HPOA 3LM9A 4E7KA 3TABA 2C1GA 4BRNA 3SBTA 4LF8K 3CF5L 1SZ2A 1T03A 1SKWA 5DMRA 3N4QA 1LAVA 2Z1HA 3EEQA 5AQGA 1YAGA 2D0AA 3CCJN 4DS5A 1X9JA 3FZFA 3J7AP 2FBVA 2F8SA 3H6EA 2F9WA 4ISGA 3RMDA 1W97L 1TL1A 4IJAA 4CHYA 1OVQA 5AQPA 2YNGA 4LH5A 2B4JA 3U3GA 2IOCA 1VQPN 2P5OA 2RE2A 2G8VA 1ZBUA 5C2FA 3F9KA 1KAXA 2OPRA 3FFIA 3KLIA 1Q8IA 3TPQA 3CHWA 5AQKA 3KK2A 4DTRA 2ZWHA 1CZ9A 2XO7A 1VQMN 2FLOA 4ZHRA 4DV6K 4DTSA 3JS6A 4BG9A 4DSIA 3C0BA 3IMXA 4K41A 1YI2N 5J2QA 4B9MA 2D4WA 5AQTA 4QCLA 5HLFA 3J7YP 2FXUA 3FE1A 3PY8A 1ZC6A 3DOLA 3TAGA 1N34K 3TU5A 4A5BA 2UUAK 4LF6K 3O3GA 1WSJA 3SAFA 5AZIB 3WXJA 4CGDA 5D3GA 2LSNA 3AARA 4AH9A 4FVMA 2O8FA 3CQ8A 3MWPA 4BE0A 4DU3A 5M1PA 3I0RA 1K6YA 1QVGM 4O5BA 2YCHA 4FW2A 4CBXA 3KK3A 1WSGA 2F4VK 5BR9A 2KZZA 1HYSA 5ELZA 2P9LB 3C95A 1HJOA 5B8HA 3SJHA 4MLEA 2QTDA 3PO4A 3ATUA 3CETA 4Z4IA 4A62A 3NH0A 4AHTA 1VAZA 2W00A 4CGFA 2XY6A 3HZ6A 4XH5A 3T1AA 4X66K 3V1QA 2DFEA 2P9PB 1NK4A 4FJJA 2OTJN 3AVJA 1SL0A 3MEDA 1NMDA 3PLAA 2B5JA 2D5RA 4CBWA 1KAYA 3H3NO 2QA4N 5GADP 3VOVA 4JRPA 2UXDK 2YHWA 5FLXO 1HLUA 4M45A 4CBUA 3TI0A 2ZD1A 4M3YA 4WE1A 3KLHA 1RT6A 4JKCA 2NUBA 3V81A 3HYFA 3OYFA 1BCMA 3VQ7A 3LZJA 4JD2A 4DTJA 3AO2A 1OKJA 3AY9A 2V51B 3R8EA 5KGWA 1MWMA 3NBPA 4F8RA 5A2QO 4H0VB 3THYA 3V1OA 5C0YA 1BU6O 3DMJA 4IFEA 4CZLA 4FLWA 3L2QA 4EZ9A 3LPUA 4Z4GA 5FRMA 4N5SA 3ZSQA 1WBDA 4W5RA 3HK2A 3NH1A 2Q36A 2DPNA 1VQLN 3VEWA 1P90A 4PA1A 4KO0A 1SL2A 4I2PA 1BIUA 4F3OA 4O8UA 5C25A 4QS9A 3NGYA 1LW0A 2PY5A 4IG0A 3MEEA 2QWQA 3K9KA 1GLFO 3AVGA 4IBNA 3IRXA 4IO9L 3CFPA 3WQTA 3KK7A 4E72A 1M1KO 1YUWA 4BRIA 1BDGA 3BZKA 3D0PA 4CJ4A 3C6UA 4CZIA 3OW2M 2QXFA 4NYNA 3NHGA 4CZJA 1ATRA 4NYFA 1N36K 1L3TA 5DM6L 1KSPA 3VQPA 1VQ8N 1JCEA 1S1XA 2E6MA 2BH1A 1D9FA 4XH4A 1U2VB 5KGXA 3VQCA 4ZTJA 1K8KA 3MN9A 2HB5A 4I6MA 3VGMA 2DFFA 4A57A 5BREA 2HHWA 3SYZA 1WBBA 4CJQA 1IKWA 3VEYA 1W0HA 4C1NK 3OJSA 3DXKB 2O8DA 1XWLA 4WYBA 1JKHA 3LDLA 4FLUA 1Q81O 4V19S 4CEFA 5AQYA 3QO9A 3CIPA 1NK7A 2YI1A 4DS4A 2NLXA 1EKEA 3QIPA 4U7BA 3QLHA 3VF6A 3K5OA 4C23A 1KXPA 1BCOA 2A1SA 3LP2A 5LY3A 3Q7CA 4BGBA 2G8UA 3FZMA 4KI4A 2IGIA 1JCFA 1GLBG 1S6QA 1ATNA 2OPQA 5F2RA 4CFBA 1Q7YO 4CJTA 2FSKA 1RT1A 4CGHA 1GLJO 3QBWA 1YJWN 1Y97A 3E01A 3IFRA 4FM0A 3U6FA 2P9UA 2E2QA 3S3MA 3HM8A 4DTUA 3KD1E 4DQPA 4ISEA 4CF1A 4OPKA 3SUQA 1A5XA 2JLEA 2IVOA 3SAGA 3VGKA 1ESVA 4KTQA 1IBKK 3TTFA 5CE3A 4IFVA 4FLTA 1OH8A 2PFUA 4FWOA 4Y1DA 1HQUA 2NRVA 4BG8A 2OCEA 3AAQA 4E7IA 4CZKA 1RDCA 3T19A 4GKJK 1L3VA 2YKNA 1S9EA 2HOEA 4M3ZA 1SUQA 4FK0A 1O13A 3V1RA 2QEXN 1CZBA 1NGCA 5TKYA 3OS2A 5E26A 3K5MA 2HW3A 4FZYA 5ADXA 4F9OA 1ASVA 2YX6A 2ASMA 1YVUA 4EIAA 4JKGA 3AO4A 4BR2A 1S1TA 1WN7A 3KK1A 3RMBA 3SQ2A 1ATSA 3TAMA 4GY2B 3U4LA 4W5OA 4X62K 1QQNA 3OBWA 3A5OC 5GIPA 4B9LA 2A1RA 3LDOA 3SUOA 1YHQN 4O55A 3NDKA 3I0SA 1LV5A 1NU0A 4MQ3A 4BR0A 4BQZA 2UU9K 1NJXA 3NVKA 4M3TA 4YDUC 1WSIA 2HBMA 1BIZA 3LP0A 1SQKA 4YOVA 3ZLJA 3ITHA 4JKBA 2O8FB 2JWKA 4MFBA 4KRFA 4DB3A 3MXIA 2BDPA 4FLYA 4CIFA 4U67L 3VQ9A 4KHNA 2YJEA 1UA0A 5GIOA 3OYHA 1LWEA 1ZBIA 1WSEA 3OS1A 1HX1A 3HRGA 3NF8A 4DQ8A 1VQ5N 4FSVA 3OYKA 1S1VA 4NCAA 4FO0A 4C8MA 3MECA 3DI6A 1I3AA 2Q97A 4I9QA 2NRHA 2D1KA 2FF3B 1NK5A 5LMNK 3KTQA 1RBTA 4FK4A 1X3NA 3OYAA 3V9SA 2ASPA 5EOYA 3C6AA 4KH6A 3OS0A 4PKIA 5E41A 3Q7BA 3E1YA 3TR8A 1XHXA 3LM2A 3ZX2A 2P9PA 3WXLA 4DFJA 4LFAK 3BF1A 1VQ4N 1RT3A 4JHDB 4B9SA 3NE6A 2QWLA 3QNOA 4NXNK 1XQSC 3VEOA 3QDKA 3KKRA 2P9KA 2NRTA 4FWLA 4JI0K 3AO1A 5KTQA 1IH7A 1RBUA 3DLKA 3O5BA 1C0FA 1N33K 5AZJA 3AVCA 3UKRA 4MDBA 2RHKA 4FJLA 3TARA 1RTIA 2P5GA 1TKDA 3F5TA 5BRDA 3CPEA 3AVMA 5EY4A 2OPPA 1FK9A 4XIUA 3MEGA 1NKCA 2OZSA 2YNFA 3ZEUA 1KLMA 4YOWA 1XC9A 3DOKA 4YFUA 4AM6A 1FW6A 4XH1A 1NGBA 1BG3A 4O44A 1NOYA 3B6PA 4DQIA 1S5JA 3VF4A 1GLEG 1MDUB 1XHZA 4FJNA 3OYCA 1J9AA 3M8QA 1NJWA 3SNNA 1YVNA 3H08A 2HSTA 2IVNA 1BA0A 2IC3A 3SV3A 3S9HA 3NFAA 3EY1A 2G8WA 3O08A 1DTQA 4AHVA 4H4MA 4CZMA 3QESA 2KFNA 4M7YA 1M90O 2E2PA 4M7XA 4AQYK 2ZJRL 4YORA 4AHUA 3VF2A 5BPNA 4MDAA 3CCSN 2XY7A 3CD6N 4BY9C 3RRGA 3SUPA 3WXMB 1K8KB 3FFKB 3CQXA 3TWHA 3CJCA 4FJXA 1J6ZA 4I6MB 4RW8A 2Z1GA 3SJJA 3CQYA 4KFBA 3JXUA 4KHWA 3OYJA 3ID6A 3V9UA 1HYZA 1QTMA 4KHSA 2HMPA 4JS4A 5CYQA 1KLNA 3OYNA 2O8DB 4OPAA 1T8EA 3KLFA 4CI6A 3LAKA 4BDPA 2HNDA 3DXKA 1JL2A 4RG8A 2CH5A 4BE7B 1RDDA 2BUPA 1NGJA 1SS6A 5AQMA 3SPZA 1Q9YA 3HSCA 3R9PA 3JSMA 1HNWK 4I7FA 4PQUA 1GLDG 1D9DA 3MMVA 1GOBA 4R79A 3BP8A 4FJIA 3ZT4A 2VQFK 4M3RA 3CFOA 1YTUA 4HCCA 3CERA 5FPEA 1NGIA 1V4SA 1WUAA 4KKOA 5C10A 4CEBA 1OH7A 4K0KK 1NJIO 2UXBK 1I39A 4DLEA 4LC9B 2P9UB 3NCIA 2I7NA 3QERA 2CGKA 3OYIA 2HBJA 4CF2A 3VQ5A 3G6EN 4BECA 1JLBA 2XY8A 1OH6A 1T6DA 3RR8A 3LP3A 3K5NA 2YNHA 4BQLA 1XNQK 4FVUA 4E19A 3RVCA 3G4SN 4RWTA 5TKWA 2E5LK 4B1ZA 1U45A 5HROA 4CHOA 1REVA 1NKEA 5KPRA 3ASMA 1P8ZA 2AA4A 4DSLA 1LOTB 2GUPA 4RCHA 3NF6A 4FWMA 4DKWA 2O8CB 4M63C 1Q9XA 4JKGB 4JNEA 5HBMA 4CGGA 1NG9A 2VGMA 1VRTA 1KVCA 1B9DA 4FJ7A 3I8DA 5HL7L 3D45A 5C15A 4K8XA 3VTHA 2HHVA 3O4WA 1QZ6A 1QQMA 2GTDA 3CCVN 4YNQA 5M1FA 4CCHA 1RBSA 2WFBA 4CE9A 1U49A 3P5JA 4CEZA 3HOTA 3HP6A 3MDQA 4N56A 1Q82O 2QK9A 4FZZA 1QS4A 2ITMA 4NCGA 4BRAA 2HNZA 5EX5A 3TAPA 4X65K 3KHYA 1U48A 1GOAA 1VSLA 1N6QA 4OVLA 3KWIA 3HP9A 4WFBL 3L2RA 1ASWA 3HVRA 3MXMA 5HRNA 3HTVA 2GWJA 2D0BA 4BDZA 5AQOA 3VPZA 4W5QA 1BUPA 3SCXA 3IKMA 3PX6A 1Y64A 1IO2A 1ZBSA 1IV0A 4DR4K 4KV8A 1NK6A 2PAVA 1T7PA 1QE1A 5F0XA 2HHQA 4CF9A 4OO1J 1W9HA 3NAEA 4GKKK 5AQRA 1JL1A 2FSJA 3TTCA 3L0QA 3R6MA 3MCAB 4MLHA 3THVA 3DWLA 3VQ4A 4N76A 2E1ZA 1VHXA 3O9RA 4K25A 4YOYA 3H1VX 3NF7A 1NWKA 5AQJA 4CJLA 5J1EA 3LWMA 4B9VA 5LL6Z 3LANA 4BR5A 3ATVA 4NB4A 2YJFA 3E9LA 4FPBA 3VQDA 3ALYA 4B8CA 4CECA 4MO5A 2P1JA 2YNIA 2OTLN 3J8AA 3LAMA 2HF3A 4AF1A 1WLJA 2E2OA 2ETJA 4B1WB 3BY5A 4DU1A 3WNFA 4FJ9A 1S1WA 4DR7K 3G25A 4DF8A 5JS2A 1TGOA 4EAHD 1IKYA 5GAGP 1ZXOA 3I8BA 4IZ9A 4B9QA 3IS9A 4HUFA 2GX9A 4B3MK 2HNYA 4FJKA 2KTQA 4H5RA 1EQYA 3T69A 2P9KB 4JHDA 5IT9O 4BR4A 4LF4K 4W5TA 2WC9A 1RDUA 2ZQBA 5AZJB 4CGJA 2A42A 3UKRB 1IBMK 4CHZA 2VYPA 2QW9A 3SMSA 4LFCK 4M3WA 3O8MA 2QWNA 3OYGA 3EE8A 5CHIA 4M42A 3RMCA 1I94K 4FYDA 3LDPA 3G71N 5FPNA 3ZEUB 3FZHA 3O1BA 1NGHA 2DY4A 2Y1IA 3O9TA 2RPIA 3VGLA 4CEDA 3LDSA 3KWGA 2OYQA 3L2VA 4FM2A 1NGFA 1UA1A 1A5WA 4JKFA 3CI5A 3G0ZA 4HWIA 4DU4A 2E88A 4YY3K 2Z1IA 3E66A 3MN6A 2IAJA 1WB9A 1QSYA 5AQIA 3WNHA 3HL8A 4HUGA 1ILYA 3L2UA 3F2KA 4KPYA 3HXMA 1C0TA 4DQSA 3AA3A 3CCEN 1BL3A 3OJUA 4JYAK 4JI1K 4CHPA 4DV0K 2G8KA 3VN5A 3ZYYX 3LWLA 2WTUA 1HNZK 1Z25A 2FF6A 3K0SA 2QWRA 3O1WA 1J54A 4Z4HA 4Z0UA 2PYJA 5KPTA 5MLCQ 4BACA 1RBRA 4GV6A 4FJHA 3UB5A 4ISFA 2A41A 3ZX3A 3RMAA 3D6RA 3RRHA 4FWNA 2HHUA 4JRQA 2VQEK 3S41A 3OTOK 2GWKA 2CH6A 1TK0A 1XUPO 4CGIA 4OPHA 4CK1A 2AJQA 3WNEA 5HRSA 3TAFA 4B9UA 3DRSA 3NVMA 4CJRA 4J2BA 4OKKA 1CXQA 3DLEA 4WQ4A 1XI1A 4H5TA 3GE1A 4AHCA 4Y0WA 4UQGA 4KAZA 4LSLA 1WAJA 2WBNA 2QKKA 2OANA 4JLHA 4DTMA 2P51A 2HHIA 1LWCA 2NRXA 4CD3A 5FPDA 4MO4A 4NCBA 2QXLA 5AQSA 4K42A 3CJAA 3BF3A 4EZ6A 4FM1A 3CFRA 4RW6A 4BR7A 4CZGA 3L8BA 1K73O 5J2MA 2ZJQL 3MK6A 1C1AA 4JN4A 4CZEA 4FJMA 3EE9A 1RFQA 5BPLA 2J4RA 3O3FA 3QIOA 3CCLN 2O8EB 4AILC 1E4GT 2RN2A 3AV9A 3FZKA 4BRGA 4DSEA 4HCBA 4B1YB 5GAHP 3PX0A 2IVPA 1NKBA 4C1NI 3OYDA 3C6HA 1KQSM 2FBTA 2I5JA 4CESA 5JVHL 1MA9B 3LDQA 4CJVA 3THWA 4OGEA 4CZFA 1NK8A 1YJNN 3CJ9A 4CF0A 4YHHK 4ID5A 2A3ZA 4WF9L 4LF9K 1E4FT 4Z4FA 3AAPA 1EWQA 3AGRA 1X9WA 3DLHA 3TSQA 4E1JA 1NNEA 4BR9A 1WSFA 1NK0A 3T7ZA 5AQXA 3VQQA 4ILHA 1N5YA 1EXQA 2ZF5O 2OPSA 3J7ZO 3RTVA 1JLGA 2E2NA 1HPZA 1VQNN 1QSLA 2O8CA 2YHXA 3NGZA 2E4LA 4X64K 4DSFA 1C0GA 2YHBA 2G8FA 1E3MA 4FCYA 1BO5O 3QFPA 5BR8K 5I3UA 3QB0A 1WSHA 4KHQA 2IDOA 2D0OA 1YXQA 1JLAA 2YHYA 4JKDA 3VA0A 3O6WA 5JLFA 4M3UA 3P4IA 3ULDA 3S3OA 1JJ2M 4BRHA 2VG6A 3CM6A 1TAUA 1HQEA 3RR7A 3CC7N 4BROA 4CIGA 1C1BA 2WUSA 3U8XA 3EL2A 4DSJA 2FC0A 2A40A 4H4OA 1RTHA 1GLCG 3VEVA 4BE2A 4XEIA 4C8LA 5AFUA 1VQON 2FBYA 4BC2A 4H0XB 4DHYA 1VSDA 4I2QA 4KHPK 2QWPA 2GEMA 4FWPA 1U04A 3VETA 3PX4A 5KQDA 5AQLA 4PY5A 1BQNA 1RDAA 3K5LA 3V9WA 4E7JA 1KRPA 5C24A 1BOTO 3KVGA 3D2FA 1GOCA 5H1SQ 1RILA 5SZTA 3EZWA 3DLRA 3O4QA 4IXCA 3I56N 2W6KA 3DAWA 3JYTA 3QEVA 3LZIA 1LAWA 2A5XA 3V9XA 4A2BA 3TSPA 4ZTFA 4BWMA 2VWJA 5ADXH 4F2RA 1IKXA 3C6TA 4A59A 4J2DA 4JEPA 1VSMA 1LW2A 2VG5A 2RF2A 1HUXA 4E0DA 1EP4A 1BWFO 3VERA 5C42A 1D8YA 2HHSA 4DV7K 2V7YA 3ISNC 4O0IA 3OY9A 3SK3A 4H0PA 1HNVA 4EFHA 4BDYA 4FLXA 5KQ8A 3TAQA 5HP1A 1RTJA 1JLCA 4PL7A 4DLGA 4DF4A 4DFKA 4A5AA 1L3UA 3ZSVA 4KH4A 4CVNE 4CK3A 5EVZA 4JKAA 4ILGB 4EHUA 2QWOA 4YDUA 4DV3K 5FDLA 4DUZK 4JS5A 3PO5A 1HRHA 2YHAA 1KFDA 4RW4A 4K43A 3QETA 4O0JA 5CY4A 3M1FA 2VWKA 4IJNA 2BANA 4KBOA 3VESA 4FWRA 5LMUK 3HO1A 1C0MA 4G1QA 3VENA 4FXDA 2KZMA 1V4TA 2YV0X 2XY5A 4H8KA 4JAXA 2F7TA 1T05A 5CZ1A 2E8AA 3CJ1A 1H1VA 2X74A 4B3OA 3DXMA 4DR5K 3T1HK 4WQ5C 4E1NA 4KB1A 5JENA 3VTIA 1DEJA 4DWIA 1C1CA 2R7YA 1DGKN 1BQMA 2E6LA 2O4GA 4IDKA 4L8RB 2G8HA 4E3SA 3LP1A 4DFMA 4O5FA 3HM9A 3B6OA 3W3DA 4B3TK 3J81O 4CJ5A 3H3OB 1OVYA 2GUIA 4YOTA 1NLVA 2JWLA 1FJGK 3AVHA 4FWSA 4F3TA 3MXJA 1NJYA 3S5TA 3A5NC 3ZT0A 4B1VA 1W2BM 2W40A 4JI7K 2ZGZA 1S9GA 3LL3A 4H0YB 4B1XB 3L4QA 3WT0A 3OBYA 3NF9A 4BRMA 4CFCA 1UOCA 2ITGA 4OLAA 4CEEA 2WONA 3CM5A 3OVNA 3L2WA 4J8FA 1HKGA 3OYMA 3CXCM 1TYQB 1UWBA 5AQUA 3CCQN 2EWSA 3VQBA 4JI8K 4H0TB 3H46O 1WOQA 3KJVA 1T3VA 3AO3A 4N41A 3AVNA 1CLQA 3KLGA 4JKHA 1RT4A 3AA4A 4CIEA 4EHTA 4BREA 4IEIA 2KLAA 1VQKN 1T6CA 3TSUA 4AHSA 3TTDA 3VA3A 5JS1A 4F2SA 4BWJA 3MN5A 1QQCA 1IG8A 1OH5A 2VWBA 2O8EA 3ZSOA 4GVEA 3A5LC 3GDQA 1Q18A 4IKFA 5DM7L 4ELVA 1VQ7N 3THWB 3HJFA 4GV3A 3A8YA 1WAFA 3IG1A 3O9UA 1VSJA 1KCFA 4GVMA 4RW7A 1SL1A 1FXXA 3LDNA 4WFAL 1KFSA 2HBLA 5SWMA 1S72N 1ZBFA 4FLVA 4BVOA 4FLZA 4DR3K 5I42A 1C6VA 4BC5A 2Y1JA 1TAQA 3ZSYA 2D0CA 3QICA 1NGGA 4DV2K 3F9MA 4EP5A 3SZ2A 1N32K 2ASOA 1VSIA 4CJWA 3FR0A 3DLLL 4QAGA 2KFZA 5IWAK 4JI3K 3C7NB 4IOXA 2P9IA 4C8KA 1B9FA 2O8BA 5KRSA 1JLFA 4IOCL 5M1KA 3P39A 4DUYK 4RW9A 3SQ1A 4IG3A 1HMVA 4PKHA 5EXWA 3L3VA 1O1WA 3IUCA 1SKSA 3PSFA 2HHHK 5T7BA 4DR1K 2W6LA 5AQQA 1TUYA 1KC8O 1VRUA 4DMNA 2NZTA 4H03B 4HHTA 1BGXT 3UKUA 4JK7A 1L3SA 3U9DA 3AVAA 1ZBHA 1DTTA 4CF8A 3THXA 5AQNA 4CEAA 4YOUA 4PKGA 4CJUA 4Z94A 4CK2A 3AVKA 3D2FB 1DT9A 2HF4A 1X3MA 1Q86O 3SMPA 2CGJA 3ZSZA 1ZBLA 3BGRA 5FPMA 3H1QA 3K57A 4DFPA 4BEBA 2BTFA 2YKMA 2KKZA 4JI5K 3D2EB 3KIOA 1VQ9N 5AQVA 4GMJB 2UXCK 3RSEA 4HTLA 1VSHA 4OX9K 2DFHA 4BRFA 1BA1A 3FLCO 4IFYA 3B8AX 3AA5X 2BGGA 3GG4A 3AVFA 4XJXA 4DV1K 2F8TA 2Q3SA 4DSKA 4FOEA 1FKOA 2XHBA 1SKRA 1NGEA 2Q31A 4CEOA 3JAMO 3ULEB 3DLBA 3VQAA 3R3LA 5HRRA 3PV8A 4W5NA 3AVIA 1TL3A 5GAEP 3AA2A 2O4IA 1GLLO 4CHNA 4GW6A 1NM1A 1HJRA 4R5PA 3M8RA 4E89A 2X6SA 4FWKA 1VSKA 1WNSA 4CFDA 4Q0BA 3WEEA 4OPJA 1MU2A 3CG7A 1UAXA 3CPWM 3HBTA 4E1MA 5EU7A 3PUFA 3K59A 3QMLA 4BRLA 4OGCA 3VMFB 4ILJA 2B6AA 1HKCA 3O9QA 3ZT2A 2D0PA 3LPTA 4CHQA 4WQ4C 2CGLA 1L5UA 1RDBA 1TKZA 1Z6RA 3VEXA 3CJBA 3CC2N 3G10A 1JXBA 2UUCK 3SBGA 3SAHA 2KW4A 3E9PA 3DXMB 4CJ3A 1VQ6N 3VQ8A 2HVIA 4FL9A 4HTUA 2Z1JA 3MN7A 1TUUA 3EYZA 4Z4EA 1W7AA 2Q2RA 1QZ5A 4JI6K 2ZGYA 1CZAN 3A2FA 4JI4K 4LY7A 1S6PA 3HPGA 4E7HA 3C65A 1X1PA 2F9TA 1HPMA 3GOIA 2OZMA 3HOSA 4KI6A 3HI0A 4CZHA 4K8ZA 4QOZB 4KHUA 1JXEA 4NO7A 2HVHA 5HOOA 4BRDA 4FZXC 1G99A 2V52B 3MAQA 2EX3A 1TKTA 4OLBA 5E84A 2W41A 4DV4K 4PWDA 3DRRA 4KH5A 1BI4A 2VG7A 5CYMA 1J5EK 1TKXA 1YTAA 3ZETB 1DKGD 3QEWA 3SLCA 1KTQA 2EHGA 1QSSA 2P9SB 2Q0RA 4OKJA 3ZCMA 1LWFA 4KTZA 3DM2A 1RNHA 3OYBA 3O80A 1YF5L 2NRZA 3O9SA 1R59O 3SI6A 4A61A 1TV6A 1NJZA 4KTWA 1VSEA 1RT7A 1A5VA 4FWQA 1TVRA 1QHTA 1TYQA 1HYVA 3D7EO 4PL8A 2NNWA 2UUBK 1F21A 4DTNA 3CC4N 2GV9A 1KAZA 2RKIA 3DJCA 5AJ3K 5KRTA 5JLHA 3OHRA 1QVFM 2ZE2A 3ZSXA 2HBKA 2PZSA 3HT3A 1NMNA 3UIQA 1BHLA 3EZ5A 1NK9A 1GLAG 4LF5K 4I9LA 1MWKA 4FPAA 4L3QA 3U9ZA 4B8AB 4CJFA 4G9ZA 5DK5A 1X9MA 1DLOA 1IKVA 3HVTA 3CYMA 3NMUA 3CYGA 2P9NA 3N4PA 4BVPA 2HMIA 4CD1A 1YITN 5M1NA 4IO8A 3BEXA 3PIPL 4BRKA 3K58A 4IDHA 4BE1A 1JCGA 2JGUA 5AQFA 2XRIA 5K14A 1RT2A 4IWVA 3P83D 3M8PA 1ZYQA 3FZLA 3LALA 2A6AA 2FSNA 1YJ9N 3ID8A 5M1QA 5I9EB 2P9IB 3T3FA 4BRPA 2O8BB 4IOAL 3C94A 2AP1A 3F73A 3WNGA 3T1YK 1R0AA 3C7NA 2QWMA 2I7PA 4Y1CA 1Z26A 1IBLK 3DYAA 1B92A 1FKPA 4J2EA 1JLQA 3VEZA 3GBTA 4OKEA 4JKEA 1HNIA 2Q1NA 2ZM6K 1VSFA 5AR0A 3S3NA 3I33A 4JI2K 3QEXA 4C8NA 5LJVA 3CCRN 4LSNA 3IDHA 1D4XA 3UKUB 3SV4A 3WXIA 4B9NA 3EN9A 1S3XA 3VQ6A 3AVBA 3BUZB 2VGNA 3A5MC 3THXB 3MCPA 1RTDA 3PIOL 4DQRA 2VCPA 3AVLA 5FRNA 4H5WA 5BRHA 5AQZA 3MWTA 4H5NA 3U3YA 4LH4A 3DRPA 4WCEL 1ITGA 4CW7B 5AZIA 2Q0UA 3M3ZA 4CJEA 1T44A 3CJ7A 3MX5A 4Z4CA 5HRPA 3M8SA 3BDPA 3L6QA 3CMAN 4ELUA 3RSEB 3WQUA 5AQWA 2E1YA 3WUHA 3D2EA 3V9ZA 3CCUN 2C1IA 2UYTA 4FJGA 4Q5VA 1ASUA 4E7LA 3IAYA 4LFBK 3O3HA 1EO1A 5BN8A 2P9LA 4HVJA 2BE2A 1LCUA 3OYLA 4DV5K 3EKSA 3SQ0A 2X6NA 1VK0A 5CZ2A 3QEPA 3ULEA 3SUNA 4CJSA 4QS8A 2W42A 2E20A 5F1XA 4CJKA 1YIJN 2HHXA 5C12A 4H0OA 3CCMN 1KVAA 3ZSRA 3WEEB 4CJ7A 1KVBA 2ZJPL 4DG1A 5LJWA 1K9MO 1U47A 3ENHA 5AFUH 3L4IA 2F96A 1SV5A 4NLBA 3QNNA 4UY8O 3P31A 4KB0A
chains in the Genus database with same CATH topology
4BGAA 4QS7A 2HBLA 5CE3A 3R1XA 3SMSA 1S72N 3ENBA 4JD2B 3O8MA 2GELA 5C2DA 2PFUA 2QWNA 4FWOA 4BVOA 2NRVA 3EE8A 3AAQA 4BG8A 5CHIA 4CZKA 4GV9A 4BC5A 1IJJA 1NGAA 2QI2A 3EKUA 3LDPA 2HOEA 3QICA 1NGGA 3EO3A 5FPNA 5BPMA 3G71N 3F9MA 4BRQA 3ZEUB 5JVGL 3FZHA 1O13A 2ASOA 3M5RA 3O1BA 2QEXN 1NGHA 1NGCA 5TKYA 3FR0A 3O9TA 3DLLL 3VGLA 5E26A 3KWGA 3W0LA 3P38A 5ADXA 4F9OA 2YX6A 3C7NB 2ASMA 4IOXA 1HKBA 1NGFA 2P9IA 4YOXA 2NRWA 4EIAA 4JKGA 4JKFA 3CI5A 4HWIA 4A2AA 1KD1O 2E88A 4BR2A 3E66A 4IOCL 5M1KA 3P39A 3MN6A 1ATSA 1S22A 5AQIA 1ILYA 3F2KA 3KZBA 4GY2B 4PKHA 5EXWA 3U4LA 4BC4A 4GNIA 1QQNA 3CCEN 3IUCA 3OBWA 5JMVA 3A5OC 5GIPA 1VQLN 3LDOA 4IEEA 1YHQN 3ZYYX 5AQQA 1TUYA 1KC8O 4BR0A 4BQZA 2V7ZA 2FF6A 3ENOA 3FGUA 2NZTA 5JICA 2QWRA 3NVKA 3O1WA 4YDUC 4H03B 4DCHA 2HBMA 3UKUA 4JK7A 1SQKA 4YOVA 3U9DA 4JKBA 5KPTA 5MLCQ 4GV6A 2JWKA 4DB3A 3UB5A 5AQNA 4ISFA 4YOUA 2A41A 3ZX3A 4PKGA 3D6RA 4Z94A 3ZETA 4FWNA 4AM7A 4U67L 4RTFD 3D2FB 3MX2A 2YJEA 1DT9A 1SAZA 2HF4A 1X3MA 5GIOA 1RDWX 2P9SA 3S41A 1Q86O 2GWKA 2CH6A 4BRCA 1XUPO 4OPHA 3SMPA 1HX1A 1NGDA 2CGJA 3A0IX 3HRGA 4DQ8A 1VQ5N 4FSVA 3OA9A 4NLCA 1U2VA 3E9OA 3UE5A 5FPMA 3H1QA 5M1OA 3NVMA 1Z05A 4BEBA 2BTFA 4FO0A 4FOIA 4WQ4A 2KKZA 4H5TA 3D2EB 3GE1A 1VQ9N 4Y0WA 5AQVA 2KHOA 2Q97A 2WBNA 3AGKA 2OANA 2NRHA 3RSEA 2D1KA 2FF3B 4HTLA 2NRXA 3ZX0A 5GINA 4BRFA 4CD3A 4MO4A 5FPDA 1BA1A 2QXLA 3FLCO 5AQSA 1X3NA 3QBXA 2ASPA 3B8AX 4K42A 5EOYA 3CJAA 1NBWA 3BF3A 3C6AA 3GG4A 4KH6A 3I55N 1QQOA 4XJXA 4PKIA 4JK9A 2H3GX 1VQKN 3GL1A 4FOEA 3M6GA 1RGIA 3Q7BA 4JK8A 4BR7A 4CZGA 1NGEA 1K73O 3E1YA 2ZJQL 3MK6A 2Q31A 4JN4A 1QHAA 3ULEB 3LM2A 3R3LA 4CZEA 5CR4A 3ZX2A 2P9PA 4WQ5A 5BN9A 3WXLA 3EE9A 5GAEP 1RFQA 5BPLA 2J4RA 2QM1A 1U6ZA 3CCLN 1GLLO 1E4GT 3FZKA 4BRGA 4WFNL 3BF1A 4B1YB 5GAHP 1N8RO 3H45C 2IVPA 4O8KA 1K8AO 1NM1A 1VQ4N 4C1NI 5AQHA 3C6HA 5KPZA 2P9NB 1KQSM 1XC3A 3K9JA 4PHTX 4JHDB 2NRRA 2QWLA 4FWKA 5JVHL 1XQSC 1MA9B 3VEOA 3QDKA 3LDQA 3WEEA 3CMEN 4CZFA 1YJNN 2P9KA 2NRTA 4H5VA 3HBTA 4FWLA 3CJ9A 4BC3A 3CPWM 4B1UB 5BRFA 3WXKA 2IIRA 2A3ZA 3O5BA 4WF9L 1E4FT 1C0FA 5AZJA 2PBDA 3QMLA 3AAPA 3QFUA 3AGRA 3UKRA 1EO1A 4MDBA 4BRLA 2RHKA 3TSQA 3VMFB 4ILJA 4E1JA 3LM9A 1HKCA 3O9QA 4BR9A 2C1GA 3T7ZA 2D0PA 5AQXA 4BRNA 3SBTA 3CF5L 1SZ2A 3F5TA 4ILHA 3N4QA 5BRDA 2ZF5O 4WQ4C 2CGLA 3J7ZO 3CPEA 3CC2N 1Z6RA 3VEXA 2E2NA 3CJBA 5AQGA 1YAGA 1VQNN 5EY4A 2YHXA 3SBGA 3CCJN 1C0GA 1X9JA 3FZFA 3ZEUA 3E9PA 3SAHA 4YOWA 4AM6A 1BO5O 3DXMB 3QFPA 4XH1A 1NGBA 3H6EA 1VQ6N 2F9WA 3QB0A 1BG3A 4ISGA 1W97L 4IJAA 2D0OA 4FL9A 1YXQA 5AQPA 3VF4A 1GLEG 1MDUB 1VQPN 2YHYA 2RE2A 4JKDA 3O6WA 3MN7A 5JLFA 1TUUA 3P4IA 5C2FA 2Q2RA 1QZ5A 1KAXA 1YVNA 2HSTA 2IVNA 2ZGYA 1CZAN 3CHWA 5AQKA 1BA0A 3TPQA 1JJ2M 2ZWHA 1VQMN 3C65A 4BRHA 2F9TA 1HPMA 2FLOA 3GOIA 3HOSA 3HI0A 3O08A 3CC7N 3JS6A 4BG9A 4BROA 3C0BA 3IMXA 2WUSA 4K41A 4M7YA 4CZMA 4CZHA 1YI2N 3U8XA 2D4WA 3EL2A 5AQTA 2E2PA 1M90O 4NO7A 2A40A 5HOOA 4BRDA 1GLCG 3VEVA 4M7XA 1G99A 4XEIA 2V52B 5AFUA 1VQON 2ZJRL 2FXUA 3FE1A 5E84A 4BC2A 4YORA 2W41A 1ZC6A 4H0XB 3VF2A 5BPNA 4MDAA 3TU5A 4DHYA 3CCSN 4KH5A 4A5BA 3CD6N 4BY9C 3SAFA 3WXMB 5AZIB 3WXJA 1K8KB 3FFKB 2QWPA 1DKGD 3CQXA 3AARA 2GEMA 3ZETB 3CJCA 3SLCA 1J6ZA 4FWPA 4I6MB 3VETA 5KQDA 5AQLA 3CQYA 3MWPA 3JXUA 2P9SB 2Q0RA 3ID6A 5M1PA 1BOTO 3KVGA 3D2FA 3O80A 5H1SQ 1YF5L 2NRZA 1QVGM 2HMPA 2YCHA 3O9SA 1R59O 3EZWA 4CBXA 4IXCA 4A61A 4OPAA 5BR9A 3I56N 3DAWA 4CI6A 4FWQA 3DXKA 5ELZA 2P9LB 1HJOA 2A5XA 2CH5A 5B8HA 1TYQA 3SJHA 4BE7B 4A2BA 3D7EO 2BUPA 4PL8A 3TSPA 2NNWA 4MLEA 1NGJA 1SS6A 2QTDA 5ADXH 5AQMA 3ATUA 3CETA 4A62A 3CC4N 4A59A 3HSCA 3R9PA 1VAZA 1KAZA 3DJCA 4JEPA 2W00A 5JLHA 3OHRA 1GLDG 1QVFM 3HZ6A 4XH5A 3MMVA 2HBKA 1HUXA 4R79A 3BP8A 1BWFO 3VERA 3CERA 2P9PB 2OTJN 5FPEA 1GLAG 2V7YA 1MWKA 1NGIA 1V4SA 1WUAA 5C10A 1NMDA 3PLAA 4FPAA 4H0PA 3SK3A 1NJIO 4CBWA 4L3QA 3U9ZA 1KAYA 4EFHA 3H3NO 2QA4N 4LC9B 2P9UB 3VOVA 2I7NA 5KQ8A 5GADP 2YHWA 2CGKA 4G9ZA 1HLUA 2HBJA 4CBUA 4PL7A 4A5AA 4KH4A 3G6EN 4BECA 3NMUA 2P9NA 3N4PA 4BVPA 5EVZA 4JKAA 4CD1A 1YITN 4ILGB 4EHUA 2QWOA 5M1NA 4IO8A 3BEXA 4JKCA 4YDUA 3PIPL 1T6DA 4BRKA 4IDHA 1JCGA 4BQLA 4K43A 5AQFA 4FVUA 3RVCA 3G4SN 4JD2A 3M1FA 4IJNA 1OKJA 3AY9A 4IWVA 2V51B 5TKWA 3R8EA 4RWTA 4B1ZA 1MWMA 3FZLA 4KBOA 3VESA 4FWRA 2A6AA 5KPRA 2FSNA 4H0VB 1P8ZA 2AA4A 3ID8A 1YJ9N 5C0YA 1BU6O 1LOTB 4IFEA 5M1QA 4CZLA 2GUPA 4RCHA 4FWMA 4DKWA 5I9EB 3VENA 2P9IB 4M63C 4BRPA 1V4TA 4IOAL 4JKGB 4JNEA 2AP1A 4JAXA 2F7TA 2VGMA 3C7NA 2QWMA 2I7PA 2Q36A 5HL7L 5C15A 2E8AA 3VTHA 3CJ1A 2DPNA 1H1VA 3O4WA 3VEZA 1QZ6A 1QQMA 2GTDA 3DXMA 1P90A 3GBTA 4JKEA 4WQ5C 3VEWA 3CCVN 2Q1NA 3VTIA 5M1FA 1DEJA 2WFBA 5AR0A 4O8UA 1DGKN 3HOTA 4QS9A 3I33A 3MDQA 1Q82O 2QWQA 2ITMA 5LJVA 3K9KA 4BRAA 4O5FA 3CCRN 1GLFO 3IDHA 5EX5A 3W3DA 1D4XA 3KHYA 4IO9L 3UKUB 3WQTA 3WXIA 3KK7A 3EN9A 3KWIA 4WFBL 1M1KO 1S3XA 1YUWA 4BRIA 1BDGA 3BUZB 3HTVA 2GWJA 2VGNA 3A5MC 3MCPA 3H3OB 5AQOA 1OVYA 3VPZA 4CZIA 3PIOL 1BUPA 4YOTA 3OW2M 2VCPA 4CZJA 1ATRA 4H5WA 1NLVA 3IKMA 5BRHA 2JWLA 5AQZA 5DM6L 1Y64A 3MWTA 4H5NA 1VQ8N 1JCEA 4FWSA 1ZBSA 2BH1A 4WCEL 3A5NC 2PAVA 4XH4A 1U2VB 4B1VA 5AZIA 1W2BM 2Q0UA 3M3ZA 1K8KA 3MN9A 5F0XA 4OO1J 2W40A 4I6MA 1T44A 2ZGZA 3CJ7A 3LL3A 3MX5A 4H0YB 3VGMA 4A57A 4B1XB 5BREA 3L4QA 5AQRA 3WT0A 2FSJA 3OBYA 3L6QA 3TTCA 3CMAN 3L0QA 3RSEB 3WQUA 3R6MA 2E1YA 5AQWA 3MCAB 4BRMA 3WUHA 3VEYA 4MLHA 3D2EA 4C1NK 3CCUN 2C1IA 2UYTA 3DXKB 3DWLA 4J8FA 4WYBA 1HKGA 3CXCM 1TYQB 3LDLA 2E1ZA 1Q81O 3O9RA 5AQUA 4K25A 5AQYA 3H1VX 5AQJA 1NWKA 5BN8A 4YOYA 3CIPA 3CCQN 2EWSA 2P9LA 2YI1A 1LCUA 2NLXA 4BR5A 4H0TB 3H46O 3EKSA 1WOQA 4U7BA 3ATVA 3VF6A 4NB4A 1T3VA 2YJFA 3E9LA 4FPBA 4JKHA 4C23A 1KXPA 4MO5A 3ULEA 2OTLN 3J8AA 5LY3A 3Q7CA 4EHTA 2HF3A 4BGBA 3FZMA 4BREA 4IEIA 1JCFA 1GLBG 2KLAA 1T6CA 3TSUA 4QS8A 2E2OA 3TTDA 4AF1A 4B1WB 2E20A 3MN5A 1IG8A 2VWBA 5F1XA 3G25A 1ATNA 5F2RA 4EAHD 1YIJN 1Q7YO 4GVEA 3A5LC 3GDQA 5GAGP 2FSKA 1ZXOA 3I8BA 4H0OA 1Q18A 4IZ9A 5C12A 3CCMN 4B9QA 2GX9A 1GLJO 5DM7L 1VQ7N 3QBWA 3WEEB 4H5RA 4CJ7A 1YJWN 1EQYA 3T69A 3IFRA 2ZJPL 2P9KB 4JHDA 3A8YA 4GV3A 5LJWA 1K9MO 4BR4A 3O9UA 2P9UA 3ENHA 2WC9A 1RDUA 2E2QA 3HM8A 5AFUH 3L4IA 5AZJB 2A42A 4ISEA 3UKRB 4NLBA 4UY8O 2IVOA 3LDNA 3VGKA 3SAGA 1ESVA 3P31A 4WFAL 2VYPA 3TTFA 2QW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BGA A;  4QS7 A;  5CE3 A;  3SMS A;  4JD2 B;  3O8M A;  2GEL A;  4BVO A;  2QWN A;  4FWO A;  4BG8 A;  3AAQ A;  4CZK A;  4BC5 A;  1IJJ A;  1NGA A;  3EKU A;  3LDP A;  2HOE A;  3QIC A;  1NGG A;  3EO3 A;  5FPN A;  5BPM A;  3F9M A;  4BRQ A;  3ZEU B;  3FZH A;  2ASO A;  3O1B A;  1NGH A;  1NGC A;  5TKY A;  3FR0 A;  3VGL A;  5E26 A;  3W0L A;  5ADX A;  4F9O A;  3C7N B;  2ASM A;  1HKB A;  1NGF A;  2P9I A;  4EIA A;  3CI5 A;  4HWI A;  4A2A A;  2E88 A;  4BR2 A;  3MN6 A;  1ATS A;  1S22 A;  5AQI A;  3KZB A;  4GY2 B;  4PKH A;  5EXW A;  3U4L A;  4BC4 A;  4GNI A;  1QQN A;  3IUC A;  5JMV A;  3A5O C;  3LDO A;  5AQQ A;  1TUY A;  4BR0 A;  4BQZ A;  2V7Z A;  2FF6 A;  3ENO A;  3FGU A;  2NZT A;  5JIC A;  2QWR A;  3O1W A;  4YDU C;  4H03 B;  4DCH A;  3UKU A;  1SQK A;  3U9D A;  5KPT A;  4DB3 A;  3UB5 A;  5AQN A;  4ISF A;  2A41 A;  3ZX3 A;  4PKG A;  4Z94 A;  3ZET A;  4FWN A;  4AM7 A;  4RTF D;  3D2F B;  2YJE A;  1SAZ A;  2HF4 A;  1X3M A;  1RDW X;  2P9S A;  3S41 A;  2GWK A;  2CH6 A;  4BRC A;  1XUP O;  3SMP A;  1HX1 A;  1NGD A;  2CGJ A;  3A0I X;  4DQ8 A;  4FSV A;  1U2V A;  3UE5 A;  5FPM A;  3H1Q A;  1Z05 A;  2BTF A;  4FO0 A;  4FOI A;  4WQ4 A;  4H5T A;  3D2E B;  3GE1 A;  4Y0W A;  5AQV A;  2KHO A;  2Q97 A;  3RSE A;  2OAN A;  2NRH A;  2D1K A;  2FF3 B;  4HTL A;  3ZX0 A;  4BRF A;  4CD3 A;  4MO4 A;  5FPD A;  1BA1 A;  2QXL A;  3FLC O;  5AQS A;  1X3N A;  3QBX A;  2ASP A;  3B8A X;  4K42 A;  5EOY A;  3CJA A;  1NBW A;  3BF3 A;  3GG4 A;  1QQO A;  4PKI A;  2H3G X;  3GL1 A;  4FOE A;  3M6G A;  1RGI A;  4CZG A;  4BR7 A;  1NGE A;  3MK6 A;  2Q31 A;  4JN4 A;  1QHA A;  3ULE B;  3LM2 A;  4CZE A;  3ZX2 A;  2P9P A;  4WQ5 A;  5BN9 A;  3WXL A;  1RFQ A;  5BPL A;  2J4R A;  2QM1 A;  1U6Z A;  1GLL O;  1E4G T;  3FZK A;  4BRG A;  3BF1 A;  4B1Y B;  3H45 C;  2IVP A;  4O8K A;  1NM1 A;  5AQH A;  5KPZ A;  2P9N B;  1XC3 A;  4JHD B;  2QWL A;  4FWK A;  1XQS C;  1MA9 B;  3VEO A;  3QDK A;  3LDQ A;  3WEE A;  4CZF A;  2P9K A;  4H5V A;  3HBT A;  4FWL A;  3CJ9 A;  4BC3 A;  4B1U B;  5BRF A;  3WXK A;  2IIR A;  2A3Z A;  3O5B A;  1E4F T;  1C0F A;  5AZJ A;  2PBD A;  3QML A;  3AAP A;  3QFU A;  3UKR A;  4BRL A;  4E1J A;  3LM9 A;  1HKC A;  4BR9 A;  2D0P A;  5AQX A;  4BRN A;  1SZ2 A;  5BRD A;  2ZF5 O;  4WQ4 C;  2CGL A;  1Z6R A;  3VEX A;  2E2N A;  3CJB A;  5AQG A;  1YAG A;  5EY4 A;  2YHX A;  1C0G A;  1X9J A;  3FZF A;  3ZEU A;  4AM6 A;  1BO5 O;  3DXM B;  3QFP A;  4XH1 A;  1NGB A;  3H6E A;  2F9W A;  3QB0 A;  1BG3 A;  4ISG A;  4IJA A;  2D0O A;  4FL9 A;  1YXQ A;  5AQP A;  3VF4 A;  1GLE G;  1MDU B;  2YHY A;  3O6W A;  3MN7 A;  5JLF A;  1TUU A;  3P4I A;  2Q2R A;  1QZ5 A;  1KAX A;  1YVN A;  2IVN A;  2ZGY A;  1CZA N;  3TPQ A;  3CHW A;  5AQK A;  1BA0 A;  2ZWH A;  4BRH A;  2F9T A;  1HPM A;  2FLO A;  3GOI A;  3HI0 A;  3O08 A;  3JS6 A;  4BG9 A;  4BRO A;  3C0B A;  3IMX A;  2WUS A;  4K41 A;  4M7Y A;  4CZM A;  4CZH A;  3U8X A;  2D4W A;  3EL2 A;  5AQT A;  2E2P A;  4NO7 A;  2A40 A;  4BRD A;  1GLC G;  3VEV A;  4M7X A;  1G99 A;  4XEI A;  2V52 B;  5AFU A;  2FXU A;  3FE1 A;  5E84 A;  4BC2 A;  2W41 A;  1ZC6 A;  4H0X B;  3VF2 A;  5BPN A;  3TU5 A;  4DHY A;  5AZI B;  3WXJ A;  1K8K B;  3FFK B;  2QWP A;  1DKG D;  3CQX A;  3AAR A;  2GEM A;  3ZET B;  3CJC A;  3SLC A;  1J6Z A;  4FWP A;  4I6M B;  3VET A;  5KQD A;  5AQL A;  3CQY A;  3JXU A;  2P9S B;  2Q0R A;  1BOT O;  3KVG A;  3D2F A;  3O80 A;  2HMP A;  2YCH A;  1R59 O;  3EZW A;  4CBX A;  4IXC A;  4A61 A;  5BR9 A;  3DAW A;  4CI6 A;  4FWQ A;  3DXK A;  5ELZ A;  2P9L B;  1HJO A;  2A5X A;  2CH5 A;  5B8H A;  1TYQ A;  3SJH A;  4A2B A;  3D7E O;  2BUP A;  4PL8 A;  4MLE A;  1NGJ A;  5ADX H;  5AQM A;  3ATU A;  3CET A;  4A62 A;  3HSC A;  3R9P A;  1KAZ A;  3DJC A;  5JLH A;  3OHR A;  1GLD G;  3HZ6 A;  4XH5 A;  3MMV A;  1HUX A;  3BP8 A;  1BWF O;  3VER A;  3CER A;  2P9P B;  5FPE A;  1GLA G;  2V7Y A;  1MWK A;  1NGI A;  1V4S A;  1WUA A;  1NMD A;  4FPA A;  4H0P A;  3SK3 A;  4CBW A;  4L3Q A;  3U9Z A;  1KAY A;  4EFH A;  3H3N O;  4LC9 B;  2P9U B;  3VOV A;  2I7N A;  5KQ8 A;  2YHW A;  2CGK A;  1HLU A;  4CBU A;  4PL7 A;  2P9N A;  4BVP A;  5EVZ A;  4CD1 A;  4EHU A;  2QWO A;  4IO8 A;  3BEX A;  4YDU A;  1T6D A;  4BRK A;  1JCG A;  4BQL A;  4K43 A;  5AQF A;  4JD2 A;  3M1F A;  4IJN A;  1OKJ A;  3AY9 A;  4IWV A;  2V51 B;  3R8E A;  4RWT A;  4B1Z A;  1MWM A;  3FZL A;  4KBO A;  3VES A;  4FWR A;  2A6A A;  5KPR A;  2FSN A;  4H0V B;  1P8Z A;  2AA4 A;  3ID8 A;  1BU6 O;  1LOT B;  4CZL A;  2GUP A;  4RCH A;  4FWM A;  5I9E B;  3VEN A;  2P9I B;  4M63 C;  4BRP A;  1V4T A;  4JNE A;  2AP1 A;  4JAX A;  3C7N A;  2QWM A;  2I7P A;  2Q36 A;  2E8A A;  3CJ1 A;  2DPN A;  1H1V A;  3O4W A;  3VEZ A;  1QZ6 A;  1QQM A;  2GTD A;  3DXM A;  3GBT A;  4WQ5 C;  3VEW A;  2Q1N A;  1DEJ A;  5AR0 A;  1DGK N;  4QS9 A;  3I33 A;  3MDQ A;  2QWQ A;  2ITM A;  5LJV A;  4BRA A;  4O5F A;  1GLF O;  3IDH A;  5EX5 A;  3W3D A;  1D4X A;  3KHY A;  3UKU B;  3WQT A;  3WXI A;  3EN9 A;  1S3X A;  1YUW A;  4BRI A;  1BDG A;  3BUZ B;  3HTV A;  2GWJ A;  3A5M C;  3MCP A;  3H3O B;  5AQO A;  3VPZ A;  4CZI A;  1BUP A;  2VCP A;  4CZJ A;  1ATR A;  4H5W A;  1NLV A;  5BRH A;  5AQZ A;  1Y64 A;  4H5N A;  1JCE A;  4FWS A;  1ZBS A;  3A5N C;  2PAV A;  4XH4 A;  1U2V B;  4B1V A;  5AZI A;  2Q0U A;  3M3Z A;  1K8K A;  3MN9 A;  5F0X A;  2W40 A;  4I6M A;  1T44 A;  2ZGZ A;  3CJ7 A;  3LL3 A;  3VGM A;  4H0Y B;  5BRE A;  4B1X B;  5AQR A;  3WT0 A;  2FSJ A;  3L6Q A;  3L0Q A;  3RSE B;  3WQU A;  3R6M A;  2E1Y A;  5AQW A;  4BRM A;  3WUH A;  3VEY A;  4MLH A;  3D2E A;  2UYT A;  3DXK B;  3DWL A;  4J8F A;  4WYB A;  1HKG A;  1TYQ B;  3LDL A;  2E1Z A;  5AQU A;  4K25 A;  5AQY A;  3H1V X;  5AQJ A;  1NWK A;  5BN8 A;  3CIP A;  2EWS A;  2P9L A;  2YI1 A;  1LCU A;  2NLX A;  4BR5 A;  4H0T B;  3H46 O;  3EKS A;  1WOQ A;  3ATV A;  3VF6 A;  4NB4 A;  2YJF A;  4FPB A;  4C23 A;  1KXP A;  4MO5 A;  3ULE A;  3J8A A;  5LY3 A;  4EHT A;  2HF3 A;  4BGB A;  3FZM A;  4BRE A;  1JCF A;  1GLB G;  1T6C A;  4QS8 A;  2E2O A;  4B1W B;  2E20 A;  3MN5 A;  1IG8 A;  2VWB A;  5F1X A;  3G25 A;  1ATN A;  5F2R A;  4EAH D;  3A5L C;  3GDQ A;  2FSK A;  1ZXO A;  3I8B A;  4H0O A;  1Q18 A;  4IZ9 A;  4B9Q A;  1GLJ O;  3QBW A;  3WEE B;  4H5R A;  4CJ7 A;  1EQY A;  3IFR A;  2P9K B;  4JHD A;  3A8Y A;  5LJW A;  4BR4 A;  2P9U A;  3ENH A;  2E2Q A;  3HM8 A;  5AFU H;  3L4I A;  5AZJ B;  2A42 A;  4ISE A;  3UKR B;  2IVO A;  3LDN A;  3VGK A;  1ESV A;  2VYP A;  2QW9 A; 
#chains in the Genus database with same CATH topology
 4BGA A;  4QS7 A;  3PSI A;  3R1X A;  3ENB A;  4JD2 B;  4FJ5 A;  5C2D A;  2GEL A;  2ATQ A;  4GV9 A;  1RBV A;  1S1U A;  1IJJ A;  1NGA A;  2QI2 A;  3SPY A;  3EKU A;  3BZC A;  5BPM A;  3EO3 A;  4OJR A;  3THY B;  4BRQ A;  5JVG L;  3M5R A;  3ZT1 A;  3J80 O;  1NOZ A;  4TSX A;  3W0L A;  3NH2 A;  4ELT A;  3P38 A;  4J2A A;  3HST B;  3RWU A;  1X9S A;  1HKB A;  4HUE A;  4YOX A;  1XMO K;  2NRW A;  4B3R K;  3KLE A;  2KQ2 A;  2WOM A;  1TK5 A;  4A2A A;  1KD1 O;  1C0U A;  3KD5 E;  4CJP A;  1HNX K;  4M41 A;  1S22 A;  3QEI A;  1U4B A;  4B3S K;  1D5A A;  3SQ4 A;  4KRE A;  3V6D A;  3KZB A;  4BC4 A;  4GNI A;  1IG9 A;  1G15 A;  5JMV A;  4IEE A;  3QIN A;  4ICL A;  4DTP A;  1J53 A;  4CER A;  4LD0 A;  2V7Z A;  4DTO A;  3ENO A;  3FGU A;  5JIC A;  1BI4 B;  4DCH A;  2FBX A;  4CEQ A;  1YT3 A;  2QKB A;  3TAE A;  2GBZ A;  3NGI A;  4LF7 K;  3ZT3 A;  1HR0 K;  4F4K A;  3ZET A;  2HHT A;  4AM7 A;  3K2P A;  4RTF D;  3MX2 A;  1SAZ A;  1XMQ K;  1TK8 A;  1RDW X;  2P9S A;  4B08 A;  4BRC A;  5J2N A;  1NGD A;  3A0I X;  5J2P A;  3O4N A;  1EX4 A;  3OA9 A;  4NLC A;  1U2V A;  3E9O A;  4O4G A;  1BIS A;  3UE5 A;  4PUO A;  4KHY A;  5M1O A;  1Z05 A;  4ID1 A;  5KI6 A;  1EET A;  4FOI A;  2KHO A;  5FRO A;  4CFA A;  4C8O A;  2DTU A;  2OA8 A;  3AGK A;  3ZX0 A;  5GIN A;  4B9T A;  3KKS A;  3QBX A;  1NBW A;  3I55 N;  1QQO A;  4N47 A;  2IS3 A;  4JK9 A;  2H3G X;  4DQQ A;  3GL1 A;  3VQE A;  3M6G A;  1RGI A;  4JK8 A;  3OYE A;  2G8I A;  1XNR K;  4AHR A;  1QHA A;  3ZSW A;  4M3X A;  5CR4 A;  4DR6 K;  1EWR A;  3HPH A;  4WQ5 A;  5BN9 A;  2PYL A;  2QM1 A;  1U6Z A;  1JLE A;  1J5O A;  1RT5 A;  4WFN L;  1N8R O;  1K8A O;  3H45 C;  4O8K A;  4EP4 A;  4FW1 A;  1CXU A;  3DLG A;  5AQH A;  5KPZ A;  2P9N B;  1XC3 A;  3K9J A;  4PHT X;  2NRR A;  3TAN A;  4NXM K;  4DTX A;  4FK2 A;  4DR2 K;  3CME N;  3AO5 A;  4H5V A;  4BC3 A;  2X78 A;  4B1U B;  5BRF A;  3WXK A;  3P1G A;  2IIR A;  4JV5 K;  2PBD A;  3QFU A;  4FJ8 A;  1RCH A;  3L3U A;  3V4I A;  3HPO A;  3LM9 A;  4E7K A;  3TAB A;  2C1G A;  4BRN A;  3SBT A;  4LF8 K;  3CF5 L;  1SZ2 A;  1T03 A;  1SKW A;  5DMR A;  3N4Q A;  1LAV A;  2Z1H A;  3EEQ A;  5AQG A;  1YAG A;  2D0A A;  3CCJ N;  4DS5 A;  1X9J A;  3FZF A;  3J7A P;  2FBV A;  2F8S A;  3H6E A;  2F9W A;  4ISG A;  3RMD A;  1W97 L;  1TL1 A;  4IJA A;  4CHY A;  1OVQ A;  5AQP A;  2YNG A;  4LH5 A;  2B4J A;  3U3G A;  2IOC A;  1VQP N;  2P5O A;  2RE2 A;  2G8V A;  1ZBU A;  5C2F A;  3F9K A;  1KAX A;  2OPR A;  3FFI A;  3KLI A;  1Q8I A;  3TPQ A;  3CHW A;  5AQK A;  3KK2 A;  4DTR A;  2ZWH A;  1CZ9 A;  2XO7 A;  1VQM N;  2FLO A;  4ZHR A;  4DV6 K;  4DTS A;  3JS6 A;  4BG9 A;  4DSI A;  3C0B A;  3IMX A;  4K41 A;  1YI2 N;  5J2Q A;  4B9M A;  2D4W A;  5AQT A;  4QCL A;  5HLF A;  3J7Y P;  2FXU A;  3FE1 A;  3PY8 A;  1ZC6 A;  3DOL A;  3TAG A;  1N34 K;  3TU5 A;  4A5B A;  2UUA K;  4LF6 K;  3O3G A;  1WSJ A;  3SAF A;  5AZI B;  3WXJ A;  4CGD A;  5D3G A;  2LSN A;  3AAR A;  4AH9 A;  4FVM A;  2O8F A;  3CQ8 A;  3MWP A;  4BE0 A;  4DU3 A;  5M1P A;  3I0R A;  1K6Y A;  1QVG M;  4O5B A;  2YCH A;  4FW2 A;  4CBX A;  3KK3 A;  1WSG A;  2F4V K;  5BR9 A;  2KZZ A;  1HYS A;  5ELZ A;  2P9L B;  3C95 A;  1HJO A;  5B8H A;  3SJH A;  4MLE A;  2QTD A;  3PO4 A;  3ATU A;  3CET A;  4Z4I A;  4A62 A;  3NH0 A;  4AHT A;  1VAZ A;  2W00 A;  4CGF A;  2XY6 A;  3HZ6 A;  4XH5 A;  3T1A A;  4X66 K;  3V1Q A;  2DFE A;  2P9P B;  1NK4 A;  4FJJ A;  2OTJ N;  3AVJ A;  1SL0 A;  3MED A;  1NMD A;  3PLA A;  2B5J A;  2D5R A;  4CBW A;  1KAY A;  3H3N O;  2QA4 N;  5GAD P;  3VOV A;  4JRP A;  2UXD K;  2YHW A;  5FLX O;  1HLU A;  4M45 A;  4CBU A;  3TI0 A;  2ZD1 A;  4M3Y A;  4WE1 A;  3KLH A;  1RT6 A;  4JKC A;  2NUB A;  3V81 A;  3HYF A;  3OYF A;  1BCM A;  3VQ7 A;  3LZJ A;  4JD2 A;  4DTJ A;  3AO2 A;  1OKJ A;  3AY9 A;  2V51 B;  3R8E A;  5KGW A;  1MWM A;  3NBP A;  4F8R A;  5A2Q O;  4H0V B;  3THY A;  3V1O A;  5C0Y A;  1BU6 O;  3DMJ A;  4IFE A;  4CZL A;  4FLW A;  3L2Q A;  4EZ9 A;  3LPU A;  4Z4G A;  5FRM A;  4N5S A;  3ZSQ A;  1WBD A;  4W5R A;  3HK2 A;  3NH1 A;  2Q36 A;  2DPN A;  1VQL N;  3VEW A;  1P90 A;  4PA1 A;  4KO0 A;  1SL2 A;  4I2P A;  1BIU A;  4F3O A;  4O8U A;  5C25 A;  4QS9 A;  3NGY A;  1LW0 A;  2PY5 A;  4IG0 A;  3MEE A;  2QWQ A;  3K9K A;  1GLF O;  3AVG A;  4IBN A;  3IRX A;  4IO9 L;  3CFP A;  3WQT A;  3KK7 A;  4E72 A;  1M1K O;  1YUW A;  4BRI A;  1BDG A;  3BZK A;  3D0P A;  4CJ4 A;  3C6U A;  4CZI A;  3OW2 M;  2QXF A;  4NYN A;  3NHG A;  4CZJ A;  1ATR A;  4NYF A;  1N36 K;  1L3T A;  5DM6 L;  1KSP A;  3VQP A;  1VQ8 N;  1JCE A;  1S1X A;  2E6M A;  2BH1 A;  1D9F A;  4XH4 A;  1U2V B;  5KGX A;  3VQC A;  4ZTJ A;  1K8K A;  3MN9 A;  2HB5 A;  4I6M A;  3VGM A;  2DFF A;  4A57 A;  5BRE A;  2HHW A;  3SYZ A;  1WBB A;  4CJQ A;  1IKW A;  3VEY A;  1W0H A;  4C1N K;  3OJS A;  3DXK B;  2O8D A;  1XWL A;  4WYB A;  1JKH A;  3LDL A;  4FLU A;  1Q81 O;  4V19 S;  4CEF A;  5AQY A;  3QO9 A;  3CIP A;  1NK7 A;  2YI1 A;  4DS4 A;  2NLX A;  1EKE A;  3QIP A;  4U7B A;  3QLH A;  3VF6 A;  3K5O A;  4C23 A;  1KXP A;  1BCO A;  2A1S A;  3LP2 A;  5LY3 A;  3Q7C A;  4BGB A;  2G8U A;  3FZM A;  4KI4 A;  2IGI A;  1JCF A;  1GLB G;  1S6Q A;  1ATN A;  2OPQ A;  5F2R A;  4CFB A;  1Q7Y O;  4CJT A;  2FSK A;  1RT1 A;  4CGH A;  1GLJ O;  3QBW A;  1YJW N;  1Y97 A;  3E01 A;  3IFR A;  4FM0 A;  3U6F A;  2P9U A;  2E2Q A;  3S3M A;  3HM8 A;  4DTU A;  3KD1 E;  4DQP A;  4ISE A;  4CF1 A;  4OPK A;  3SUQ A;  1A5X A;  2JLE A;  2IVO A;  3SAG A;  3VGK A;  1ESV A;  4KTQ A;  1IBK K;  3TTF A;  5CE3 A;  4IFV A;  4FLT A;  1OH8 A;  2PFU A;  4FWO A;  4Y1D A;  1HQU A;  2NRV A;  4BG8 A;  2OCE A;  3AAQ A;  4E7I A;  4CZK A;  1RDC A;  3T19 A;  4GKJ K;  1L3V A;  2YKN A;  1S9E A;  2HOE A;  4M3Z A;  1SUQ A;  4FK0 A;  1O13 A;  3V1R A;  2QEX N;  1CZB A;  1NGC A;  5TKY A;  3OS2 A;  5E26 A;  3K5M A;  2HW3 A;  4FZY A;  5ADX A;  4F9O A;  1ASV A;  2YX6 A;  2ASM A;  1YVU A;  4EIA A;  4JKG A;  3AO4 A;  4BR2 A;  1S1T A;  1WN7 A;  3KK1 A;  3RMB A;  3SQ2 A;  1ATS A;  3TAM A;  4GY2 B;  3U4L A;  4W5O A;  4X62 K;  1QQN A;  3OBW A;  3A5O C;  5GIP A;  4B9L A;  2A1R A;  3LDO A;  3SUO A;  1YHQ N;  4O55 A;  3NDK A;  3I0S A;  1LV5 A;  1NU0 A;  4MQ3 A;  4BR0 A;  4BQZ A;  2UU9 K;  1NJX A;  3NVK A;  4M3T A;  4YDU C;  1WSI A;  2HBM A;  1BIZ A;  3LP0 A;  1SQK A;  4YOV A;  3ZLJ A;  3ITH A;  4JKB A;  2O8F B;  2JWK A;  4MFB A;  4KRF A;  4DB3 A;  3MXI A;  2BDP A;  4FLY A;  4CIF A;  4U67 L;  3VQ9 A;  4KHN A;  2YJE A;  1UA0 A;  5GIO A;  3OYH A;  1LWE A;  1ZBI A;  1WSE A;  3OS1 A;  1HX1 A;  3HRG A;  3NF8 A;  4DQ8 A;  1VQ5 N;  4FSV A;  3OYK A;  1S1V A;  4NCA A;  4FO0 A;  4C8M A;  3MEC A;  3DI6 A;  1I3A A;  2Q97 A;  4I9Q A;  2NRH A;  2D1K A;  2FF3 B;  1NK5 A;  5LMN K;  3KTQ A;  1RBT A;  4FK4 A;  1X3N A;  3OYA A;  3V9S A;  2ASP A;  5EOY A;  3C6A A;  4KH6 A;  3OS0 A;  4PKI A;  5E41 A;  3Q7B A;  3E1Y A;  3TR8 A;  1XHX A;  3LM2 A;  3ZX2 A;  2P9P A;  3WXL A;  4DFJ A;  4LFA K;  3BF1 A;  1VQ4 N;  1RT3 A;  4JHD B;  4B9S A;  3NE6 A;  2QWL A;  3QNO A;  4NXN K;  1XQS C;  3VEO A;  3QDK A;  3KKR A;  2P9K A;  2NRT A;  4FWL A;  4JI0 K;  3AO1 A;  5KTQ A;  1IH7 A;  1RBU A;  3DLK A;  3O5B A;  1C0F A;  1N33 K;  5AZJ A;  3AVC A;  3UKR A;  4MDB A;  2RHK A;  4FJL A;  3TAR A;  1RTI A;  2P5G A;  1TKD A;  3F5T A;  5BRD A;  3CPE A;  3AVM A;  5EY4 A;  2OPP A;  1FK9 A;  4XIU A;  3MEG A;  1NKC A;  2OZS A;  2YNF A;  3ZEU A;  1KLM A;  4YOW A;  1XC9 A;  3DOK A;  4YFU A;  4AM6 A;  1FW6 A;  4XH1 A;  1NGB A;  1BG3 A;  4O44 A;  1NOY A;  3B6P A;  4DQI A;  1S5J A;  3VF4 A;  1GLE G;  1MDU B;  1XHZ A;  4FJN A;  3OYC A;  1J9A A;  3M8Q A;  1NJW A;  3SNN A;  1YVN A;  3H08 A;  2HST A;  2IVN A;  1BA0 A;  2IC3 A;  3SV3 A;  3S9H A;  3NFA A;  3EY1 A;  2G8W A;  3O08 A;  1DTQ A;  4AHV A;  4H4M A;  4CZM A;  3QES A;  2KFN A;  4M7Y A;  1M90 O;  2E2P A;  4M7X A;  4AQY K;  2ZJR L;  4YOR A;  4AHU A;  3VF2 A;  5BPN A;  4MDA A;  3CCS N;  2XY7 A;  3CD6 N;  4BY9 C;  3RRG A;  3SUP A;  3WXM B;  1K8K B;  3FFK B;  3CQX A;  3TWH A;  3CJC A;  4FJX A;  1J6Z A;  4I6M B;  4RW8 A;  2Z1G A;  3SJJ A;  3CQY A;  4KFB A;  3JXU A;  4KHW A;  3OYJ A;  3ID6 A;  3V9U A;  1HYZ A;  1QTM A;  4KHS A;  2HMP A;  4JS4 A;  5CYQ A;  1KLN A;  3OYN A;  2O8D B;  4OPA A;  1T8E A;  3KLF A;  4CI6 A;  3LAK A;  4BDP A;  2HND A;  3DXK A;  1JL2 A;  4RG8 A;  2CH5 A;  4BE7 B;  1RDD A;  2BUP A;  1NGJ A;  1SS6 A;  5AQM A;  3SPZ A;  1Q9Y A;  3HSC A;  3R9P A;  3JSM A;  1HNW K;  4I7F A;  4PQU A;  1GLD G;  1D9D A;  3MMV A;  1GOB A;  4R79 A;  3BP8 A;  4FJI A;  3ZT4 A;  2VQF K;  4M3R A;  3CFO A;  1YTU A;  4HCC A;  3CER A;  5FPE A;  1NGI A;  1V4S A;  1WUA A;  4KKO A;  5C10 A;  4CEB A;  1OH7 A;  4K0K K;  1NJI O;  2UXB K;  1I39 A;  4DLE A;  4LC9 B;  2P9U B;  3NCI A;  2I7N A;  3QER A;  2CGK A;  3OYI A;  2HBJ A;  4CF2 A;  3VQ5 A;  3G6E N;  4BEC A;  1JLB A;  2XY8 A;  1OH6 A;  1T6D A;  3RR8 A;  3LP3 A;  3K5N A;  2YNH A;  4BQL A;  1XNQ K;  4FVU A;  4E19 A;  3RVC A;  3G4S N;  4RWT A;  5TKW A;  2E5L K;  4B1Z A;  1U45 A;  5HRO A;  4CHO A;  1REV A;  1NKE A;  5KPR A;  3ASM A;  1P8Z A;  2AA4 A;  4DSL A;  1LOT B;  2GUP A;  4RCH A;  3NF6 A;  4FWM A;  4DKW A;  2O8C B;  4M63 C;  1Q9X A;  4JKG B;  4JNE A;  5HBM A;  4CGG A;  1NG9 A;  2VGM A;  1VRT A;  1KVC A;  1B9D A;  4FJ7 A;  3I8D A;  5HL7 L;  3D45 A;  5C15 A;  4K8X A;  3VTH A;  2HHV A;  3O4W A;  1QZ6 A;  1QQM A;  2GTD A;  3CCV N;  4YNQ A;  5M1F A;  4CCH A;  1RBS A;  2WFB A;  4CE9 A;  1U49 A;  3P5J A;  4CEZ A;  3HOT A;  3HP6 A;  3MDQ A;  4N56 A;  1Q82 O;  2QK9 A;  4FZZ A;  1QS4 A;  2ITM A;  4NCG A;  4BRA A;  2HNZ A;  5EX5 A;  3TAP A;  4X65 K;  3KHY A;  1U48 A;  1GOA A;  1VSL A;  1N6Q A;  4OVL A;  3KWI A;  3HP9 A;  4WFB L;  3L2R A;  1ASW A;  3HVR A;  3MXM A;  5HRN A;  3HTV A;  2GWJ A;  2D0B A;  4BDZ A;  5AQO A;  3VPZ A;  4W5Q A;  1BUP A;  3SCX A;  3IKM A;  3PX6 A;  1Y64 A;  1IO2 A;  1ZBS A;  1IV0 A;  4DR4 K;  4KV8 A;  1NK6 A;  2PAV A;  1T7P A;  1QE1 A;  5F0X A;  2HHQ A;  4CF9 A;  4OO1 J;  1W9H A;  3NAE A;  4GKK K;  5AQR A;  1JL1 A;  2FSJ A;  3TTC A;  3L0Q A;  3R6M A;  3MCA B;  4MLH A;  3THV A;  3DWL A;  3VQ4 A;  4N76 A;  2E1Z A;  1VHX A;  3O9R A;  4K25 A;  4YOY A;  3H1V X;  3NF7 A;  1NWK A;  5AQJ A;  4CJL A;  5J1E A;  3LWM A;  4B9V A;  5LL6 Z;  3LAN A;  4BR5 A;  3ATV A;  4NB4 A;  2YJF A;  3E9L A;  4FPB A;  3VQD A;  3ALY A;  4B8C A;  4CEC A;  4MO5 A;  2P1J A;  2YNI A;  2OTL N;  3J8A A;  3LAM A;  2HF3 A;  4AF1 A;  1WLJ A;  2E2O A;  2ETJ A;  4B1W B;  3BY5 A;  4DU1 A;  3WNF A;  4FJ9 A;  1S1W A;  4DR7 K;  3G25 A;  4DF8 A;  5JS2 A;  1TGO A;  4EAH D;  1IKY A;  5GAG P;  1ZXO A;  3I8B A;  4IZ9 A;  4B9Q A;  3IS9 A;  4HUF A;  2GX9 A;  4B3M K;  2HNY A;  4FJK A;  2KTQ A;  4H5R A;  1EQY A;  3T69 A;  2P9K B;  4JHD A;  5IT9 O;  4BR4 A;  4LF4 K;  4W5T A;  2WC9 A;  1RDU A;  2ZQB A;  5AZJ B;  4CGJ A;  2A42 A;  3UKR B;  1IBM K;  4CHZ A;  2VYP A;  2QW9 A;  3SMS A;  4LFC K;  4M3W A;  3O8M A;  2QWN A;  3OYG A;  3EE8 A;  5CHI A;  4M42 A;  3RMC A;  1I94 K;  4FYD A;  3LDP A;  3G71 N;  5FPN A;  3ZEU B;  3FZH A;  3O1B A;  1NGH A;  2DY4 A;  2Y1I A;  3O9T A;  2RPI A;  3VGL A;  4CED A;  3LDS A;  3KWG A;  2OYQ A;  3L2V A;  4FM2 A;  1NGF A;  1UA1 A;  1A5W A;  4JKF A;  3CI5 A;  3G0Z A;  4HWI A;  4DU4 A;  2E88 A;  4YY3 K;  2Z1I A;  3E66 A;  3MN6 A;  2IAJ A;  1WB9 A;  1QSY A;  5AQI A;  3WNH A;  3HL8 A;  4HUG A;  1ILY A;  3L2U A;  3F2K A;  4KPY A;  3HXM A;  1C0T A;  4DQS A;  3AA3 A;  3CCE N;  1BL3 A;  3OJU A;  4JYA K;  4JI1 K;  4CHP A;  4DV0 K;  2G8K A;  3VN5 A;  3ZYY X;  3LWL A;  2WTU A;  1HNZ K;  1Z25 A;  2FF6 A;  3K0S A;  2QWR A;  3O1W A;  1J54 A;  4Z4H A;  4Z0U A;  2PYJ A;  5KPT A;  5MLC Q;  4BAC A;  1RBR A;  4GV6 A;  4FJH A;  3UB5 A;  4ISF A;  2A41 A;  3ZX3 A;  3RMA A;  3D6R A;  3RRH A;  4FWN A;  2HHU A;  4JRQ A;  2VQE K;  3S41 A;  3OTO K;  2GWK A;  2CH6 A;  1TK0 A;  1XUP O;  4CGI A;  4OPH A;  4CK1 A;  2AJQ A;  3WNE A;  5HRS A;  3TAF A;  4B9U A;  3DRS A;  3NVM A;  4CJR A;  4J2B A;  4OKK A;  1CXQ A;  3DLE A;  4WQ4 A;  1XI1 A;  4H5T A;  3GE1 A;  4AHC A;  4Y0W A;  4UQG A;  4KAZ A;  4LSL A;  1WAJ A;  2WBN A;  2QKK A;  2OAN A;  4JLH A;  4DTM A;  2P51 A;  2HHI A;  1LWC A;  2NRX A;  4CD3 A;  5FPD A;  4MO4 A;  4NCB A;  2QXL A;  5AQS A;  4K42 A;  3CJA A;  3BF3 A;  4EZ6 A;  4FM1 A;  3CFR A;  4RW6 A;  4BR7 A;  4CZG A;  3L8B A;  1K73 O;  5J2M A;  2ZJQ L;  3MK6 A;  1C1A A;  4JN4 A;  4CZE A;  4FJM A;  3EE9 A;  1RFQ A;  5BPL A;  2J4R A;  3O3F A;  3QIO A;  3CCL N;  2O8E B;  4AIL C;  1E4G T;  2RN2 A;  3AV9 A;  3FZK A;  4BRG A;  4DSE A;  4HCB A;  4B1Y B;  5GAH P;  3PX0 A;  2IVP A;  1NKB A;  4C1N I;  3OYD A;  3C6H A;  1KQS M;  2FBT A;  2I5J A;  4CES A;  5JVH L;  1MA9 B;  3LDQ A;  4CJV A;  3THW A;  4OGE A;  4CZF A;  1NK8 A;  1YJN N;  3CJ9 A;  4CF0 A;  4YHH K;  4ID5 A;  2A3Z A;  4WF9 L;  4LF9 K;  1E4F T;  4Z4F A;  3AAP A;  1EWQ A;  3AGR A;  1X9W A;  3DLH A;  3TSQ A;  4E1J A;  1NNE A;  4BR9 A;  1WSF A;  1NK0 A;  3T7Z A;  5AQX A;  3VQQ A;  4ILH A;  1N5Y A;  1EXQ A;  2ZF5 O;  2OPS A;  3J7Z O;  3RTV A;  1JLG A;  2E2N A;  1HPZ A;  1VQN N;  1QSL A;  2O8C A;  2YHX A;  3NGZ A;  2E4L A;  4X64 K;  4DSF A;  1C0G A;  2YHB A;  2G8F A;  1E3M A;  4FCY A;  1BO5 O;  3QFP A;  5BR8 K;  5I3U A;  3QB0 A;  1WSH A;  4KHQ A;  2IDO A;  2D0O A;  1YXQ A;  1JLA A;  2YHY A;  4JKD A;  3VA0 A;  3O6W A;  5JLF A;  4M3U A;  3P4I A;  3ULD A;  3S3O A;  1JJ2 M;  4BRH A;  2VG6 A;  3CM6 A;  1TAU A;  1HQE A;  3RR7 A;  3CC7 N;  4BRO A;  4CIG A;  1C1B A;  2WUS A;  3U8X A;  3EL2 A;  4DSJ A;  2FC0 A;  2A40 A;  4H4O A;  1RTH A;  1GLC G;  3VEV A;  4BE2 A;  4XEI A;  4C8L A;  5AFU A;  1VQO N;  2FBY A;  4BC2 A;  4H0X B;  4DHY A;  1VSD A;  4I2Q A;  4KHP K;  2QWP A;  2GEM A;  4FWP A;  1U04 A;  3VET A;  3PX4 A;  5KQD A;  5AQL A;  4PY5 A;  1BQN A;  1RDA A;  3K5L A;  3V9W A;  4E7J A;  1KRP A;  5C24 A;  1BOT O;  3KVG A;  3D2F A;  1GOC A;  5H1S Q;  1RIL A;  5SZT A;  3EZW A;  3DLR A;  3O4Q A;  4IXC A;  3I56 N;  2W6K A;  3DAW A;  3JYT A;  3QEV A;  3LZI A;  1LAW A;  2A5X A;  3V9X A;  4A2B A;  3TSP A;  4ZTF A;  4BWM A;  2VWJ A;  5ADX H;  4F2R A;  1IKX A;  3C6T A;  4A59 A;  4J2D A;  4JEP A;  1VSM A;  1LW2 A;  2VG5 A;  2RF2 A;  1HUX A;  4E0D A;  1EP4 A;  1BWF O;  3VER A;  5C42 A;  1D8Y A;  2HHS A;  4DV7 K;  2V7Y A;  3ISN C;  4O0I A;  3OY9 A;  3SK3 A;  4H0P A;  1HNV A;  4EFH A;  4BDY A;  4FLX A;  5KQ8 A;  3TAQ A;  5HP1 A;  1RTJ A;  1JLC A;  4PL7 A;  4DLG A;  4DF4 A;  4DFK A;  4A5A A;  1L3U A;  3ZSV A;  4KH4 A;  4CVN E;  4CK3 A;  5EVZ A;  4JKA A;  4ILG B;  4EHU A;  2QWO A;  4YDU A;  4DV3 K;  5FDL A;  4DUZ K;  4JS5 A;  3PO5 A;  1HRH A;  2YHA A;  1KFD A;  4RW4 A;  4K43 A;  3QET A;  4O0J A;  5CY4 A;  3M1F A;  2VWK A;  4IJN A;  2BAN A;  4KBO A;  3VES A;  4FWR A;  5LMU K;  3HO1 A;  1C0M A;  4G1Q A;  3VEN A;  4FXD A;  2KZM A;  1V4T A;  2YV0 X;  2XY5 A;  4H8K A;  4JAX A;  2F7T A;  1T05 A;  5CZ1 A;  2E8A A;  3CJ1 A;  1H1V A;  2X74 A;  4B3O A;  3DXM A;  4DR5 K;  3T1H K;  4WQ5 C;  4E1N A;  4KB1 A;  5JEN A;  3VTI A;  1DEJ A;  4DWI A;  1C1C A;  2R7Y A;  1DGK N;  1BQM A;  2E6L A;  2O4G A;  4IDK A;  4L8R B;  2G8H A;  4E3S A;  3LP1 A;  4DFM A;  4O5F A;  3HM9 A;  3B6O A;  3W3D A;  4B3T K;  3J81 O;  4CJ5 A;  3H3O B;  1OVY A;  2GUI A;  4YOT A;  1NLV A;  2JWL A;  1FJG K;  3AVH A;  4FWS A;  4F3T A;  3MXJ A;  1NJY A;  3S5T A;  3A5N C;  3ZT0 A;  4B1V A;  1W2B M;  2W40 A;  4JI7 K;  2ZGZ A;  1S9G A;  3LL3 A;  4H0Y B;  4B1X B;  3L4Q A;  3WT0 A;  3OBY A;  3NF9 A;  4BRM A;  4CFC A;  1UOC A;  2ITG A;  4OLA A;  4CEE A;  2WON A;  3CM5 A;  3OVN A;  3L2W A;  4J8F A;  1HKG A;  3OYM A;  3CXC M;  1TYQ B;  1UWB A;  5AQU A;  3CCQ N;  2EWS A;  3VQB A;  4JI8 K;  4H0T B;  3H46 O;  1WOQ A;  3KJV A;  1T3V A;  3AO3 A;  4N41 A;  3AVN A;  1CLQ A;  3KLG A;  4JKH A;  1RT4 A;  3AA4 A;  4CIE A;  4EHT A;  4BRE A;  4IEI A;  2KLA A;  1VQK N;  1T6C A;  3TSU A;  4AHS A;  3TTD A;  3VA3 A;  5JS1 A;  4F2S A;  4BWJ A;  3MN5 A;  1QQC A;  1IG8 A;  1OH5 A;  2VWB A;  2O8E A;  3ZSO A;  4GVE A;  3A5L C;  3GDQ A;  1Q18 A;  4IKF A;  5DM7 L;  4ELV A;  1VQ7 N;  3THW B;  3HJF A;  4GV3 A;  3A8Y A;  1WAF A;  3IG1 A;  3O9U A;  1VSJ A;  1KCF A;  4GVM A;  4RW7 A;  1SL1 A;  1FXX A;  3LDN A;  4WFA L;  1KFS A;  2HBL A;  5SWM A;  1S72 N;  1ZBF A;  4FLV A;  4BVO A;  4FLZ A;  4DR3 K;  5I42 A;  1C6V A;  4BC5 A;  2Y1J A;  1TAQ A;  3ZSY A;  2D0C A;  3QIC A;  1NGG A;  4DV2 K;  3F9M A;  4EP5 A;  3SZ2 A;  1N32 K;  2ASO A;  1VSI A;  4CJW A;  3FR0 A;  3DLL L;  4QAG A;  2KFZ A;  5IWA K;  4JI3 K;  3C7N B;  4IOX A;  2P9I A;  4C8K A;  1B9F A;  2O8B A;  5KRS A;  1JLF A;  4IOC L;  5M1K A;  3P39 A;  4DUY K;  4RW9 A;  3SQ1 A;  4IG3 A;  1HMV A;  4PKH A;  5EXW A;  3L3V A;  1O1W A;  3IUC A;  1SKS A;  3PSF A;  2HHH K;  5T7B A;  4DR1 K;  2W6L A;  5AQQ A;  1TUY A;  1KC8 O;  1VRU A;  4DMN A;  2NZT A;  4H03 B;  4HHT A;  1BGX T;  3UKU A;  4JK7 A;  1L3S A;  3U9D A;  3AVA A;  1ZBH A;  1DTT A;  4CF8 A;  3THX A;  5AQN A;  4CEA A;  4YOU A;  4PKG A;  4CJU A;  4Z94 A;  4CK2 A;  3AVK A;  3D2F B;  1DT9 A;  2HF4 A;  1X3M A;  1Q86 O;  3SMP A;  2CGJ A;  3ZSZ A;  1ZBL A;  3BGR A;  5FPM A;  3H1Q A;  3K57 A;  4DFP A;  4BEB A;  2BTF A;  2YKM A;  2KKZ A;  4JI5 K;  3D2E B;  3KIO A;  1VQ9 N;  5AQV A;  4GMJ B;  2UXC K;  3RSE A;  4HTL A;  1VSH A;  4OX9 K;  2DFH A;  4BRF A;  1BA1 A;  3FLC O;  4IFY A;  3B8A X;  3AA5 X;  2BGG A;  3GG4 A;  3AVF A;  4XJX A;  4DV1 K;  2F8T A;  2Q3S A;  4DSK A;  4FOE A;  1FKO A;  2XHB A;  1SKR A;  1NGE A;  2Q31 A;  4CEO A;  3JAM O;  3ULE B;  3DLB A;  3VQA A;  3R3L A;  5HRR A;  3PV8 A;  4W5N A;  3AVI A;  1TL3 A;  5GAE P;  3AA2 A;  2O4I A;  1GLL O;  4CHN A;  4GW6 A;  1NM1 A;  1HJR A;  4R5P A;  3M8R A;  4E89 A;  2X6S A;  4FWK A;  1VSK A;  1WNS A;  4CFD A;  4Q0B A;  3WEE A;  4OPJ A;  1MU2 A;  3CG7 A;  1UAX A;  3CPW M;  3HBT A;  4E1M A;  5EU7 A;  3PUF A;  3K59 A;  3QML A;  4BRL A;  4OGC A;  3VMF B;  4ILJ A;  2B6A A;  1HKC A;  3O9Q A;  3ZT2 A;  2D0P A;  3LPT A;  4CHQ A;  4WQ4 C;  2CGL A;  1L5U A;  1RDB A;  1TKZ A;  1Z6R A;  3VEX A;  3CJB A;  3CC2 N;  3G10 A;  1JXB A;  2UUC K;  3SBG A;  3SAH A;  2KW4 A;  3E9P A;  3DXM B;  4CJ3 A;  1VQ6 N;  3VQ8 A;  2HVI A;  4FL9 A;  4HTU A;  2Z1J A;  3MN7 A;  1TUU A;  3EYZ A;  4Z4E A;  1W7A A;  2Q2R A;  1QZ5 A;  4JI6 K;  2ZGY A;  1CZA N;  3A2F A;  4JI4 K;  4LY7 A;  1S6P A;  3HPG A;  4E7H A;  3C65 A;  1X1P A;  2F9T A;  1HPM A;  3GOI A;  2OZM A;  3HOS A;  4KI6 A;  3HI0 A;  4CZH A;  4K8Z A;  4QOZ B;  4KHU A;  1JXE A;  4NO7 A;  2HVH A;  5HOO A;  4BRD A;  4FZX C;  1G99 A;  2V52 B;  3MAQ A;  2EX3 A;  1TKT A;  4OLB A;  5E84 A;  2W41 A;  4DV4 K;  4PWD A;  3DRR A;  4KH5 A;  1BI4 A;  2VG7 A;  5CYM A;  1J5E K;  1TKX A;  1YTA A;  3ZET B;  1DKG D;  3QEW A;  3SLC A;  1KTQ A;  2EHG A;  1QSS A;  2P9S B;  2Q0R A;  4OKJ A;  3ZCM A;  1LWF A;  4KTZ A;  3DM2 A;  1RNH A;  3OYB A;  3O80 A;  1YF5 L;  2NRZ A;  3O9S A;  1R59 O;  3SI6 A;  4A61 A;  1TV6 A;  1NJZ A;  4KTW A;  1VSE A;  1RT7 A;  1A5V A;  4FWQ A;  1TVR A;  1QHT A;  1TYQ A;  1HYV A;  3D7E O;  4PL8 A;  2NNW A;  2UUB K;  1F21 A;  4DTN A;  3CC4 N;  2GV9 A;  1KAZ A;  2RKI A;  3DJC A;  5AJ3 K;  5KRT A;  5JLH A;  3OHR A;  1QVF M;  2ZE2 A;  3ZSX A;  2HBK A;  2PZS A;  3HT3 A;  1NMN A;  3UIQ A;  1BHL A;  3EZ5 A;  1NK9 A;  1GLA G;  4LF5 K;  4I9L A;  1MWK A;  4FPA A;  4L3Q A;  3U9Z A;  4B8A B;  4CJF A;  4G9Z A;  5DK5 A;  1X9M A;  1DLO A;  1IKV A;  3HVT A;  3CYM A;  3NMU A;  3CYG A;  2P9N A;  3N4P A;  4BVP A;  2HMI A;  4CD1 A;  1YIT N;  5M1N A;  4IO8 A;  3BEX A;  3PIP L;  4BRK A;  3K58 A;  4IDH A;  4BE1 A;  1JCG A;  2JGU A;  5AQF A;  2XRI A;  5K14 A;  1RT2 A;  4IWV A;  3P83 D;  3M8P A;  1ZYQ A;  3FZL A;  3LAL A;  2A6A A;  2FSN A;  1YJ9 N;  3ID8 A;  5M1Q A;  5I9E B;  2P9I B;  3T3F A;  4BRP A;  2O8B B;  4IOA L;  3C94 A;  2AP1 A;  3F73 A;  3WNG A;  3T1Y K;  1R0A A;  3C7N A;  2QWM A;  2I7P A;  4Y1C A;  1Z26 A;  1IBL K;  3DYA A;  1B92 A;  1FKP A;  4J2E A;  1JLQ A;  3VEZ A;  3GBT A;  4OKE A;  4JKE A;  1HNI A;  2Q1N A;  2ZM6 K;  1VSF A;  5AR0 A;  3S3N A;  3I33 A;  4JI2 K;  3QEX A;  4C8N A;  5LJV A;  3CCR N;  4LSN A;  3IDH A;  1D4X A;  3UKU B;  3SV4 A;  3WXI A;  4B9N A;  3EN9 A;  1S3X A;  3VQ6 A;  3AVB A;  3BUZ B;  2VGN A;  3A5M C;  3THX B;  3MCP A;  1RTD A;  3PIO L;  4DQR A;  2VCP A;  3AVL A;  5FRN A;  4H5W A;  5BRH A;  5AQZ A;  3MWT A;  4H5N A;  3U3Y A;  4LH4 A;  3DRP A;  4WCE L;  1ITG A;  4CW7 B;  5AZI A;  2Q0U A;  3M3Z A;  4CJE A;  1T44 A;  3CJ7 A;  3MX5 A;  4Z4C A;  5HRP A;  3M8S A;  3BDP A;  3L6Q A;  3CMA N;  4ELU A;  3RSE B;  3WQU A;  5AQW A;  2E1Y A;  3WUH A;  3D2E A;  3V9Z A;  3CCU N;  2C1I A;  2UYT A;  4FJG A;  4Q5V A;  1ASU A;  4E7L A;  3IAY A;  4LFB K;  3O3H A;  1EO1 A;  5BN8 A;  2P9L A;  4HVJ A;  2BE2 A;  1LCU A;  3OYL A;  4DV5 K;  3EKS A;  3SQ0 A;  2X6N A;  1VK0 A;  5CZ2 A;  3QEP A;  3ULE A;  3SUN A;  4CJS A;  4QS8 A;  2W42 A;  2E20 A;  5F1X A;  4CJK A;  1YIJ N;  2HHX A;  5C12 A;  4H0O A;  3CCM N;  1KVA A;  3ZSR A;  3WEE B;  4CJ7 A;  1KVB A;  2ZJP L;  4DG1 A;  5LJW A;  1K9M O;  1U47 A;  3ENH A;  5AFU H;  3L4I A;  2F96 A;  1SV5 A;  4NLB A;  3QNN A;  4UY8 O;  3P31 A;  4KB0 A; 
#chains in the Genus database with same CATH homology
 4BGA A;  4QS7 A;  2HBL A;  5CE3 A;  3R1X A;  3SMS A;  1S72 N;  3ENB A;  4JD2 B;  3O8M A;  2GEL A;  5C2D A;  2PFU A;  2QWN A;  4FWO A;  4BVO A;  2NRV A;  3EE8 A;  3AAQ A;  4BG8 A;  5CHI A;  4CZK A;  4GV9 A;  4BC5 A;  1IJJ A;  1NGA A;  2QI2 A;  3EKU A;  3LDP A;  2HOE A;  3QIC A;  1NGG A;  3EO3 A;  5FPN A;  5BPM A;  3G71 N;  3F9M A;  4BRQ A;  3ZEU B;  5JVG L;  3FZH A;  1O13 A;  2ASO A;  3M5R A;  3O1B A;  2QEX N;  1NGH A;  1NGC A;  5TKY A;  3FR0 A;  3O9T A;  3DLL L;  3VGL A;  5E26 A;  3KWG A;  3W0L A;  3P38 A;  5ADX A;  4F9O A;  2YX6 A;  3C7N B;  2ASM A;  4IOX A;  1HKB A;  1NGF A;  2P9I A;  4YOX A;  2NRW A;  4EIA A;  4JKG A;  4JKF A;  3CI5 A;  4HWI A;  4A2A A;  1KD1 O;  2E88 A;  4BR2 A;  3E66 A;  4IOC L;  5M1K A;  3P39 A;  3MN6 A;  1ATS A;  1S22 A;  5AQI A;  1ILY A;  3F2K A;  3KZB A;  4GY2 B;  4PKH A;  5EXW A;  3U4L A;  4BC4 A;  4GNI A;  1QQN A;  3CCE N;  3IUC A;  3OBW A;  5JMV A;  3A5O C;  5GIP A;  1VQL N;  3LDO A;  4IEE A;  1YHQ N;  3ZYY X;  5AQQ A;  1TUY A;  1KC8 O;  4BR0 A;  4BQZ A;  2V7Z A;  2FF6 A;  3ENO A;  3FGU A;  2NZT A;  5JIC A;  2QWR A;  3NVK A;  3O1W A;  4YDU C;  4H03 B;  4DCH A;  2HBM A;  3UKU A;  4JK7 A;  1SQK A;  4YOV A;  3U9D A;  4JKB A;  5KPT A;  5MLC Q;  4GV6 A;  2JWK A;  4DB3 A;  3UB5 A;  5AQN A;  4ISF A;  4YOU A;  2A41 A;  3ZX3 A;  4PKG A;  3D6R A;  4Z94 A;  3ZET A;  4FWN A;  4AM7 A;  4U67 L;  4RTF D;  3D2F B;  3MX2 A;  2YJE A;  1DT9 A;  1SAZ A;  2HF4 A;  1X3M A;  5GIO A;  1RDW X;  2P9S A;  3S41 A;  1Q86 O;  2GWK A;  2CH6 A;  4BRC A;  1XUP O;  4OPH A;  3SMP A;  1HX1 A;  1NGD A;  2CGJ A;  3A0I X;  3HRG A;  4DQ8 A;  1VQ5 N;  4FSV A;  3OA9 A;  4NLC A;  1U2V A;  3E9O A;  3UE5 A;  5FPM A;  3H1Q A;  5M1O A;  3NVM A;  1Z05 A;  4BEB A;  2BTF A;  4FO0 A;  4FOI A;  4WQ4 A;  2KKZ A;  4H5T A;  3D2E B;  3GE1 A;  1VQ9 N;  4Y0W A;  5AQV A;  2KHO A;  2Q97 A;  2WBN A;  3AGK A;  2OAN A;  2NRH A;  3RSE A;  2D1K A;  2FF3 B;  4HTL A;  2NRX A;  3ZX0 A;  5GIN A;  4BRF A;  4CD3 A;  4MO4 A;  5FPD A;  1BA1 A;  2QXL A;  3FLC O;  5AQS A;  1X3N A;  3QBX A;  2ASP A;  3B8A X;  4K42 A;  5EOY A;  3CJA A;  1NBW A;  3BF3 A;  3C6A A;  3GG4 A;  4KH6 A;  3I55 N;  1QQO A;  4XJX A;  4PKI A;  4JK9 A;  2H3G X;  1VQK N;  3GL1 A;  4FOE A;  3M6G A;  1RGI A;  3Q7B A;  4JK8 A;  4BR7 A;  4CZG A;  1NGE A;  1K73 O;  3E1Y A;  2ZJQ L;  3MK6 A;  2Q31 A;  4JN4 A;  1QHA A;  3ULE B;  3LM2 A;  3R3L A;  4CZE A;  5CR4 A;  3ZX2 A;  2P9P A;  4WQ5 A;  5BN9 A;  3WXL A;  3EE9 A;  5GAE P;  1RFQ A;  5BPL A;  2J4R A;  2QM1 A;  1U6Z A;  3CCL N;  1GLL O;  1E4G T;  3FZK A;  4BRG A;  4WFN L;  3BF1 A;  4B1Y B;  5GAH P;  1N8R O;  3H45 C;  2IVP A;  4O8K A;  1K8A O;  1NM1 A;  1VQ4 N;  4C1N I;  5AQH A;  3C6H A;  5KPZ A;  2P9N B;  1KQS M;  1XC3 A;  3K9J A;  4PHT X;  4JHD B;  2NRR A;  2QWL A;  4FWK A;  5JVH L;  1XQS C;  1MA9 B;  3VEO A;  3QDK A;  3LDQ A;  3WEE A;  3CME N;  4CZF A;  1YJN N;  2P9K A;  2NRT A;  4H5V A;  3HBT A;  4FWL A;  3CJ9 A;  4BC3 A;  3CPW M;  4B1U B;  5BRF A;  3WXK A;  2IIR A;  2A3Z A;  3O5B A;  4WF9 L;  1E4F T;  1C0F A;  5AZJ A;  2PBD A;  3QML A;  3AAP A;  3QFU A;  3AGR A;  3UKR A;  1EO1 A;  4MDB A;  4BRL A;  2RHK A;  3TSQ A;  3VMF B;  4ILJ A;  4E1J A;  3LM9 A;  1HKC A;  3O9Q A;  4BR9 A;  2C1G A;  3T7Z A;  2D0P A;  5AQX A;  4BRN A;  3SBT A;  3CF5 L;  1SZ2 A;  3F5T A;  4ILH A;  3N4Q A;  5BRD A;  2ZF5 O;  4WQ4 C;  2CGL A;  3J7Z O;  3CPE A;  3CC2 N;  1Z6R A;  3VEX A;  2E2N A;  3CJB A;  5AQG A;  1YAG A;  1VQN N;  5EY4 A;  2YHX A;  3SBG A;  3CCJ N;  1C0G A;  1X9J A;  3FZF A;  3ZEU A;  3E9P A;  3SAH A;  4YOW A;  4AM6 A;  1BO5 O;  3DXM B;  3QFP A;  4XH1 A;  1NGB A;  3H6E A;  1VQ6 N;  2F9W A;  3QB0 A;  1BG3 A;  4ISG A;  1W97 L;  4IJA A;  2D0O A;  4FL9 A;  1YXQ A;  5AQP A;  3VF4 A;  1GLE G;  1MDU B;  1VQP N;  2YHY A;  2RE2 A;  4JKD A;  3O6W A;  3MN7 A;  5JLF A;  1TUU A;  3P4I A;  5C2F A;  2Q2R A;  1QZ5 A;  1KAX A;  1YVN A;  2HST A;  2IVN A;  2ZGY A;  1CZA N;  3CHW A;  5AQK A;  1BA0 A;  3TPQ A;  1JJ2 M;  2ZWH A;  1VQM N;  3C65 A;  4BRH A;  2F9T A;  1HPM A;  2FLO A;  3GOI A;  3HOS A;  3HI0 A;  3O08 A;  3CC7 N;  3JS6 A;  4BG9 A;  4BRO A;  3C0B A;  3IMX A;  2WUS A;  4K41 A;  4M7Y A;  4CZM A;  4CZH A;  1YI2 N;  3U8X A;  2D4W A;  3EL2 A;  5AQT A;  2E2P A;  1M90 O;  4NO7 A;  2A40 A;  5HOO A;  4BRD A;  1GLC G;  3VEV A;  4M7X A;  1G99 A;  4XEI A;  2V52 B;  5AFU A;  1VQO N;  2ZJR L;  2FXU A;  3FE1 A;  5E84 A;  4BC2 A;  4YOR A;  2W41 A;  1ZC6 A;  4H0X B;  3VF2 A;  5BPN A;  4MDA A;  3TU5 A;  4DHY A;  3CCS N;  4KH5 A;  4A5B A;  3CD6 N;  4BY9 C;  3SAF A;  3WXM B;  5AZI B;  3WXJ A;  1K8K B;  3FFK B;  2QWP A;  1DKG D;  3CQX A;  3AAR A;  2GEM A;  3ZET B;  3CJC A;  3SLC A;  1J6Z A;  4FWP A;  4I6M B;  3VET A;  5KQD A;  5AQL A;  3CQY A;  3MWP A;  3JXU A;  2P9S B;  2Q0R A;  3ID6 A;  5M1P A;  1BOT O;  3KVG A;  3D2F A;  3O80 A;  5H1S Q;  1YF5 L;  2NRZ A;  1QVG M;  2HMP A;  2YCH A;  3O9S A;  1R59 O;  3EZW A;  4CBX A;  4IXC A;  4A61 A;  4OPA A;  5BR9 A;  3I56 N;  3DAW A;  4CI6 A;  4FWQ A;  3DXK A;  5ELZ A;  2P9L B;  1HJO A;  2A5X A;  2CH5 A;  5B8H A;  1TYQ A;  3SJH A;  4BE7 B;  4A2B A;  3D7E O;  2BUP A;  4PL8 A;  3TSP A;  2NNW A;  4MLE A;  1NGJ A;  1SS6 A;  2QTD A;  5ADX H;  5AQM A;  3ATU A;  3CET A;  4A62 A;  3CC4 N;  4A59 A;  3HSC A;  3R9P A;  1VAZ A;  1KAZ A;  3DJC A;  4JEP A;  2W00 A;  5JLH A;  3OHR A;  1GLD G;  1QVF M;  3HZ6 A;  4XH5 A;  3MMV A;  2HBK A;  1HUX A;  4R79 A;  3BP8 A;  1BWF O;  3VER A;  3CER A;  2P9P B;  2OTJ N;  5FPE A;  1GLA G;  2V7Y A;  1MWK A;  1NGI A;  1V4S A;  1WUA A;  5C10 A;  1NMD A;  3PLA A;  4FPA A;  4H0P A;  3SK3 A;  1NJI O;  4CBW A;  4L3Q A;  3U9Z A;  1KAY A;  4EFH A;  3H3N O;  2QA4 N;  4LC9 B;  2P9U B;  3VOV A;  2I7N A;  5KQ8 A;  5GAD P;  2YHW A;  2CGK A;  4G9Z A;  1HLU A;  2HBJ A;  4CBU A;  4PL7 A;  4A5A A;  4KH4 A;  3G6E N;  4BEC A;  3NMU A;  2P9N A;  3N4P A;  4BVP A;  5EVZ A;  4JKA A;  4CD1 A;  1YIT N;  4ILG B;  4EHU A;  2QWO A;  5M1N A;  4IO8 A;  3BEX A;  4JKC A;  4YDU A;  3PIP L;  1T6D A;  4BRK A;  4IDH A;  1JCG A;  4BQL A;  4K43 A;  5AQF A;  4FVU A;  3RVC A;  3G4S N;  4JD2 A;  3M1F A;  4IJN A;  1OKJ A;  3AY9 A;  4IWV A;  2V51 B;  5TKW A;  3R8E A;  4RWT A;  4B1Z A;  1MWM A;  3FZL A;  4KBO A;  3VES A;  4FWR A;  2A6A A;  5KPR A;  2FSN A;  4H0V B;  1P8Z A;  2AA4 A;  3ID8 A;  1YJ9 N;  5C0Y A;  1BU6 O;  1LOT B;  4IFE A;  5M1Q A;  4CZL A;  2GUP A;  4RCH A;  4FWM A;  4DKW A;  5I9E B;  3VEN A;  2P9I B;  4M63 C;  4BRP A;  1V4T A;  4IOA L;  4JKG B;  4JNE A;  2AP1 A;  4JAX A;  2F7T A;  2VGM A;  3C7N A;  2QWM A;  2I7P A;  2Q36 A;  5HL7 L;  5C15 A;  2E8A A;  3VTH A;  3CJ1 A;  2DPN A;  1H1V A;  3O4W A;  3VEZ A;  1QZ6 A;  1QQM A;  2GTD A;  3DXM A;  1P90 A;  3GBT A;  4JKE A;  4WQ5 C;  3VEW A;  3CCV N;  2Q1N A;  3VTI A;  5M1F A;  1DEJ A;  2WFB A;  5AR0 A;  4O8U A;  1DGK N;  3HOT A;  4QS9 A;  3I33 A;  3MDQ A;  1Q82 O;  2QWQ A;  2ITM A;  5LJV A;  3K9K A;  4BRA A;  4O5F A;  3CCR N;  1GLF O;  3IDH A;  5EX5 A;  3W3D A;  1D4X A;  3KHY A;  4IO9 L;  3UKU B;  3WQT A;  3WXI A;  3KK7 A;  3EN9 A;  3KWI A;  4WFB L;  1M1K O;  1S3X A;  1YUW A;  4BRI A;  1BDG A;  3BUZ B;  3HTV A;  2GWJ A;  2VGN A;  3A5M C;  3MCP A;  3H3O B;  5AQO A;  1OVY A;  3VPZ A;  4CZI A;  3PIO L;  1BUP A;  4YOT A;  3OW2 M;  2VCP A;  4CZJ A;  1ATR A;  4H5W A;  1NLV A;  3IKM A;  5BRH A;  2JWL A;  5AQZ A;  5DM6 L;  1Y64 A;  3MWT A;  4H5N A;  1VQ8 N;  1JCE A;  4FWS A;  1ZBS A;  2BH1 A;  4WCE L;  3A5N C;  2PAV A;  4XH4 A;  1U2V B;  4B1V A;  5AZI A;  1W2B M;  2Q0U A;  3M3Z A;  1K8K A;  3MN9 A;  5F0X A;  4OO1 J;  2W40 A;  4I6M A;  1T44 A;  2ZGZ A;  3CJ7 A;  3LL3 A;  3MX5 A;  4H0Y B;  3VGM A;  4A57 A;  4B1X B;  5BRE A;  3L4Q A;  5AQR A;  3WT0 A;  2FSJ A;  3OBY A;  3L6Q A;  3TTC A;  3CMA N;  3L0Q A;  3RSE B;  3WQU A;  3R6M A;  2E1Y A;  5AQW A;  3MCA B;  4BRM A;  3WUH A;  3VEY A;  4MLH A;  3D2E A;  4C1N K;  3CCU N;  2C1I A;  2UYT A;  3DXK B;  3DWL A;  4J8F A;  4WYB A;  1HKG A;  3CXC M;  1TYQ B;  3LDL A;  2E1Z A;  1Q81 O;  3O9R A;  5AQU A;  4K25 A;  5AQY A;  3H1V X;  5AQJ A;  1NWK A;  5BN8 A;  4YOY A;  3CIP A;  3CCQ N;  2EWS A;  2P9L A;  2YI1 A;  1LCU A;  2NLX A;  4BR5 A;  4H0T B;  3H46 O;  3EKS A;  1WOQ A;  4U7B A;  3ATV A;  3VF6 A;  4NB4 A;  1T3V A;  2YJF A;  3E9L A;  4FPB A;  4JKH A;  4C23 A;  1KXP A;  4MO5 A;  3ULE A;  2OTL N;  3J8A A;  5LY3 A;  3Q7C A;  4EHT A;  2HF3 A;  4BGB A;  3FZM A;  4BRE A;  4IEI A;  1JCF A;  1GLB G;  2KLA A;  1T6C A;  3TSU A;  4QS8 A;  2E2O A;  3TTD A;  4AF1 A;  4B1W B;  2E20 A;  3MN5 A;  1IG8 A;  2VWB A;  5F1X A;  3G25 A;  1ATN A;  5F2R A;  4EAH D;  1YIJ N;  1Q7Y O;  4GVE A;  3A5L C;  3GDQ A;  5GAG P;  2FSK A;  1ZXO A;  3I8B A;  4H0O A;  1Q18 A;  4IZ9 A;  5C12 A;  3CCM N;  4B9Q A;  2GX9 A;  1GLJ O;  5DM7 L;  1VQ7 N;  3QBW A;  3WEE B;  4H5R A;  4CJ7 A;  1YJW N;  1EQY A;  3T69 A;  3IFR A;  2ZJP L;  2P9K B;  4JHD A;  3A8Y A;  4GV3 A;  5LJW A;  1K9M O;  4BR4 A;  3O9U A;  2P9U A;  3ENH A;  2WC9 A;  1RDU A;  2E2Q A;  3HM8 A;  5AFU H;  3L4I A;  5AZJ B;  2A42 A;  4ISE A;  3UKR B;  4NLB A;  4UY8 O;  2IVO A;  3LDN A;  3VGK A;  3SAG A;  1ESV A;  3P31 A;  4WFA L;  2VYP A;  3TTF A;  2QW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...