2P9LB

Crystal structure of bovine arp2/3 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
203
structure length
201
Chain Sequence
IQAVLTLYAQGLGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
total genus 54
structure length 201
sequence length 203
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9lB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9lB02
3BF3A 4HWIA 4PKIA 4BGBA 3DXMB 2CGJA 3DAWA 4BC2A 1KXPA 3C7NA 1EQYA 3H46O 3J8AA 4B9QA 3L4IA 3HSCA 1HPMA 1IJJA 3A8YA 4WQ5A 5EOYA 3BP8A 1MDUB 5LJWA 3O6WA 1T44A 3VEXA 3B8AX 3QDKA 2VYPA 4JHDA 4CZJA 4BRMA 1ATNA 2UYTA 4AM6A 2VWBA 1HLUA 1TYQA 4B1WB 1NM1A 5AQHA 4FWRA 3ULEB 3DJCA 4BC5A 4ISGA 4O5FA 2OANA 4BVOA 3H45C 3LL3A 2P9PA 4RWTA 3TU5A 4H5RA 4H03B 3JXUA 4BQLA 1Q18A 3FE1A 4ISEA 2P9LB 3GBTA 1TUYA 2A41A 2IVOA 5AQVA 5BN8A 3HZ6A 3SJHA 4BR7A 2D4WA 2PBDA 4BRLA 4BRFA 4BG9A 4IO8A 4NB4A 3U9DA 3U4LA 2D0PA 3O1WA 3LDOA 4CBUA 1RGIA 4MLEA 3A5MC 1BUPA 3GL1A 1BWFO 4H5WA 3D2EB 4KBOA 4BR0A 3VF4A 4CBWA 2P9IB 5AZIA 1C0FA 4H0TB 1XC3A 1YVNA 3VEZA 5AQMA 3VERA 2YHWA 1S3XA 1ATRA 3U8XA 5BREA 2DPNA 3UKRB 1BDGA 2KHOA 5AQJA 2QM1A 3O4WA 4XH5A 2CGKA 4IWVA 1NGAA 4C23A 1GLDG 5ELZA 4QS9A 1MA9B 3AAPA 4IJNA 4FWSA 4BC4A 4B1UB 2FSKA 2GWKA 3CERA 5AQRA 5BN9A 3RSEB 5FPMA 3UKUA 2GUPA 4O8KA 2ITMA 4CD3A 2ZGZA 4BGAA 2P9SB 3SLCA 4BVPA 2P9UA 2Q31A 3F9MA 3O5BA 1RDWX 5EX5A 2BTFA 3LDNA 4B1ZA 2PAVA 3QICA 1NBWA 1BA1A 2V52B 3KZBA 1K8KB 1QQOA 1MWMA 2P9NA 1NGEA 3WXLA 1SZ2A 2GWJA 3CETA 3GE1A 5BRDA 3AAQA 1NMDA 4DHYA 5BRFA 4CZMA 5I9EB 2FSJA 2Q36A 3I8BA 1BA0A 1HX1A 3MCPA 1OKJA 4M7YA 3UE5A 5AQIA 5F2RA 3CJ7A 3EN9A 3VOVA 1XUPO 4WYBA 4FSVA 3VEWA 4I6MB 3IMXA 1NLVA 2J4RA 4BRDA 4K25A 3IFRA 4BRPA 1YXQA 5AQOA 3FZLA 5AQNA 3FLCO 1U2VB 2GELA 2NRHA 2GEMA 1DKGD 3FZKA 2E2PA 3O1BA 3FFKB 3WXKA 1BU6O 4QS8A 4L3QA 4YDUC 3LDQA 4CZLA 4FPAA 3EKSA 2ZWHA 2A40A 4H0VB 3ZETB 1CZAN 3ENHA 3O8MA 2FF3B 4IZ9A 1X3MA 3ZX2A 5KPTA 3VEVA 4WQ4A 3DXKB 5E84A 2Q97A 1JCFA 2HF4A 1QQNA 4H5VA 1T6DA 2EWSA 2GTDA 3WEEB 2YI1A 3H6EA 5JLHA 3ZX0A 3MK6A 1ZBSA 2E2QA 3HBTA 2ASOA 3R8EA 2NLXA 4CJ7A 4FPBA 2QWPA 3VGMA 2YJFA 2D0OA 5AQTA 1ZXOA 3WT0A 2A5XA 1E4FT 3ZX3A 2E2NA 5AZJB 3ZEUA 5BPLA 3ENOA 2QWMA 1JCGA 2Q2RA 2YCHA 3L6QA 4MO5A 5KPRA 2YHXA 4M7XA 4DB3A 4BROA 3ATUA 3A5LC 5AR0A 1GLEG 4CD1A 3GOIA 4EHTA 3FGUA 3JS6A 5JLFA 3G25A 4BR2A 3WQUA 1GLJO 2E2OA 4BRHA 4JN4A 4BRQA 3ATVA 3MN5A 3FZHA 3VEOA 2P9KB 3IUCA 4A61A 4FOIA 4DQ8A 3BUZB 2FLOA 3CJ1A 3DXMA 2Q0UA 4H0OA 3VF2A 3KHYA 3KVGA 1H1VA 1NGHA 3H1VX 3LM2A 1GLBG 4K43A 4MO4A 1NGJA 1QQMA 3HI0A 3D2FB 3CIPA 1TUUA 1WOQA 3M1FA 4F9OA 3R6MA 1QZ6A 3CJ9A 1GLLO 2ZF5O 5AQQA 3P4IA 2V7ZA 5JICA 5ADXH 3LDPA 1KAZA 3WXJA 4PKHA 3S41A 3ULEA 5B8HA 3GG4A 4B1XB 3VETA 4FWOA 4FO0A 2ZGYA 2AA4A 4K41A 4H0XB 5KPZA 4BRCA 1GLAG 4B1YB 5ADXA 1ATSA 2QW9A 2QWRA 2ASMA 5AQKA 2P9LA 2QWNA 3CI5A 4XEIA 1J6ZA 3VEYA 3D7EO 2FF6A 5EXWA 4A2BA 2E8AA 3BEXA 4H5NA 4M63C 3OHRA 4IJAA 3MMVA 3W0LA 1V4SA 1QZ5A 4CI6A 4AM7A 4FWLA 3D2EA 1YUWA 2P9IA 4CZFA 4JD2B 3CJAA 4GY2B 3WUHA 1P8ZA 4GNIA 3QB0A 1HKGA 1NGDA 2ASPA 1Y64A 2BUPA 3CQXA 3M3ZA 3UKRA 2QWOA 1BG3A 3C7NB 2A6AA 4PL7A 4BQZA 2E1YA 3MN6A 3VF6A 4CZIA 2W40A 3TPQA 3UB5A 4JAXA 2I7NA 3I33A 5AQWA 4Y0WA 4BR5A 1BOTO 2CH6A 4JHDB 4XH4A 5BR9A 3FZFA 1HJOA 1IG8A 1NGIA 1TYQB 1V4TA 2QWLA 3QFPA 2F9WA 5BPNA 3MN9A 3RSEA 4HTLA 2V51B 4FOEA 4H0PA 1ZC6A 5FPDA 5F1XA 4CZEA 2P9SA 2P9PB 4IXCA 3SMPA 4YDUA 3H3NO 4BR4A 1K8KA 4BRNA 5FPNA 4BRIA 4FWMA 3EZWA 2IVPA 5AQZA 3FZMA 3O08A 3MDQA 1HUXA 2NZTA 2Q0RA 2H3GX 1NGBA 4FWQA 4WQ4C 2HF3A 4CZGA 4WQ5C 3ID8A 5AZIB 2CGLA 5AQLA 3QMLA 1NWKA 4BRKA 4PKGA 4I6MA 1NGGA 1DEJA 2AP1A 1KAXA 1X3NA 2HOEA 2FXUA 3EKUA 5AQYA 1LCUA 1LOTB 2I7PA 1U2VA 4RCHA 1RFQA 5AQXA 1SAZA 1WUAA 1GLFO 5F0XA 3FR0A 2A3ZA 1NGFA 1JCEA 4FWKA 3HM8A 3ZETA 2E20A 1T6CA 1D4XA 3H3OB 1SQKA 1XQSC 5FPEA 4K42A 1G99A 3O80A 3UKUB 3DXKA 5KQ8A 1YAGA 1Z6RA 3SMSA 1NGCA 3WEEA 2E1ZA 2P9UB 3R9PA 4PL8A 1HKCA 4E1JA 4CZHA 5AQPA 1Z05A 3AY9A 4BC3A 3MN7A 2P9NB 3U9ZA 4CZKA 2WUSA 4H5TA 3DWLA 3AARA 3M6GA 5AQFA 4EHUA 4XH1A 5AQUA 3VGLA 5BPMA 2YJEA 4EAHD 1MWKA 5AZJA 1S22A 1C0GA 2W41A 3CQYA 3CJBA 3BF1A 3GDQA 2E88A 4QS7A 2CH5A 4EIAA 2F9TA 2YHYA 1ESVA 1BO5O 3VESA 5BRHA 3CJCA 4MLHA 2P9KA 4FWNA 3A5OC 2D1KA 3EO3A 3LM9A 2QWQA 5AQSA 5JMVA 1QHAA 3A5NC 3H1QA 3LDLA 1E4GT 3VENA 3D2FA 5E26A 3QFUA 4BRAA 4FWPA 2IIRA 4DCHA 4BG8A 1HKBA 3HTVA 4BREA 4B1VA 5TKYA 2VCPA 2FSNA 5EVZA 3C0BA 3SK3A 1U6ZA 2A42A 2QXLA 4NO7A 4A62A 3EL2A 5AFUH 4EFHA 4BRGA 5LY3A 4CBXA 3L0QA 3ZEUB 2HMPA 5KQDA 4FL9A 1R59O 4A2AA 1KAYA 3CHWA 3VPZA 5EY4A 2IVNA 4H0YB 4Z94A 3QBWA 3W3DA 1DGKN 3IDHA 4ISFA 2V7YA 5AQGA 5AFUA 4JNEA 3A0IX 3WXIA 3VGKA 4LC9B 4BR9A 4J8FA 5LJVA 2Q1NA 5CE3A 4JD2A 3QBXA 4RTFD 3WQTA 1X9JA 1GLCG
chains in the Genus database with same CATH superfamily
3PSIA 4BGBA 4KI6A 4B3SK 3DXMB 4N5SA 1S9EA 5GIOA 4KPYA 4CE9A 3OYKA 3DOKA 3KKRA 3CYGA 4BDZA 1MDUB 2JWKA 5LJWA 1JLFA 3O6WA 3B8AX 3QDKA 2UU9K 1ATNA 2UYTA 3S3MA 4AM6A 1HLUA 2QI2A 4B1WB 1KLMA 4FWRA 1WSJA 1UA1A 4E7KA 4Z4EA 4O5FA 4BVOA 3LL3A 3CYMA 4LSLA 1NJIO 4BQLA 1WAJA 3V9UA 1CZBA 1OH6A 5C2FA 1IH7A 1NK7A 2B5JA 4BR7A 2PBDA 4BACA 4IOAL 2ZD1A 3CCVN 3ZT3A 4JKGA 3AVKA 3V9XA 1BUPA 3PLAA 1YVUA 3QEVA 3SQ4A 4H5WA 4BR0A 4CBWA 1C0FA 4H0TB 1XC3A 1YVNA 3QEXA 3CF5L 5HRRA 2YHWA 4NLCA 2O4IA 1RT4A 2KTQA 4BEBA 1TL1A 4JI6K 2KHOA 2WBNA 1X9SA 4QCLA 1NOZA 3O4WA 4B3MK 4MQ3A 1ILYA 4KH4A 4NCGA 4C8MA 3V81A 3AVLA 1BI4B 4JI1K 4C23A 4DS5A 2QXFA 5ELZA 4DR7K 4I7FA 3TAMA 4KKOA 5FRNA 3ZT1A 2GWKA 3CERA 5BN9A 3UKUA 3EE8A 1QSLA 2Z1HA 4DQIA 4O8KA 3T1AA 4IFYA 4BDPA 3CCSN 2Q31A 5EX5A 3LDNA 4B1ZA 3L4QA 4LF8K 3MEEA 3IKMA 5FROA 3WXLA 1NK9A 3GE1A 4CEFA 4CGFA 1NMDA 3CC7N 5BRFA 5I9EB 1GOBA 2KQ2A 5HROA 4FK4A 3C6TA 3KLFA 1OKJA 4X66K 2O8DB 4DF4A 4WCEL 1YT3A 3CJ7A 3HOSA 3IS9A 5BR8K 3VEWA 4LH4A 5HRNA 4I6MB 4HUFA 2J4RA 4BRPA 2F7TA 1LV5A 5AQNA 4DSFA 1U2VB 2GELA 2NRHA 2RN2A 2GEMA 2NRTA 3O1BA 4AHVA 4Q0BA 1S1VA 3CFPA 3DRRA 3VQ8A 1WSGA 2ZWHA 5C42A 4IZ9A 3LALA 3BDPA 1X3MA 3VEVA 1JLQA 4V19S 2HF4A 2EWSA 2XY7A 3WEEB 3CFRA 2YI1A 3WXMB 3CCLN 4JI4K 4DV3K 5CY4A 1ZBSA 1IKWA 3CD6N 3R8EA 4EZ9A 1HJRA 4FPBA 5GIPA 4X64K 4CK1A 3OS0A 5AQTA 3LWLA 3CXCM 2A5XA 2G8KA 2XY5A 4DV6K 4DQRA 2Q2RA 4KI4A 5KPRA 3QLHA 4M7XA 1YJNN 1OH7A 4BROA 1KVCA 3VTHA 3JS6A 1IBLK 2GUIA 3G25A 1ZBLA 3WQUA 3G6EN 4E3SA 4JN4A 4BRQA 5H1SQ 3O3GA 5J2QA 2BH1A 2P9KB 3ZSRA 3RWUA 4DQ8A 3AA4A 1YTAA 1W97L 1KCFA 1BGXT 3OBYA 2Q0UA 3P83D 5CYQA 3J7YP 1SUQA 3EYZA 1JLEA 3D2FB 4J2BA 3CIPA 3M1FA 4F9OA 1GLLO 1S5JA 3HK2A 4KHPK 3AA5X 3SUPA 3I55N 2V7ZA 4GKKK 2G8HA 1IKYA 3LDPA 2G8WA 1BL3A 4U7BA 3K5MA 3ALYA 3S41A 3ULEA 4B1XB 4FWOA 4YOWA 4B3TK 5KPZA 4DFPA 1ATSA 2QW9A 1TK0A 5AQKA 1N32K 2NNWA 4XEIA 1J6ZA 2B6AA 3VEYA 5EXWA 2E8AA 3SZ2A 3BEXA 4H8KA 4KHQA 4IJAA 3DLEA 3LAKA 4AM7A 1K9MO 4NCBA 1SKRA 2E6MA 1Q81O 2P9IA 2PFUA 3VQ6A 3NFAA 3CJAA 2O4GA 4CFDA 1KFDA 2E6LA 4L8RB 4ELUA 4GNIA 3L2QA 1YTUA 1NGDA 4J2EA 4NCAA 2NRWA 4DTMA 2A6AA 3HPHA 2E1YA 5JVHL 2I7NA 4CVNE 1SS6A 2HHXA 5AQWA 4AH9A 4UQGA 4XH4A 3RMDA 2Z1JA 1IG8A 2RKIA 3QFPA 2F9WA 3V1QA 3JYTA 4DR1K 3MN9A 3RSEA 4FZYA 2V51B 5FPDA 1BIZA 1YF5L 3K9JA 1VSMA 3HVTA 2P9SA 1B9FA 3ZT4A 4FLUA 4CCHA 4BR4A 4U67L 1LWEA 4BRNA 3LWMA 4CHPA 3VA0A 4DU1A 1RBRA 1U49A 1ASWA 2GV9A 3FZMA 4CGGA 3MDQA 3TSPA 1D9DA 2NZTA 2H3GX 4JKGB 3LP0A 5DMRA 4DV0K 4WQ4C 2VQEK 2HF3A 1NK4A 2D0CA 1N36K 4CIEA 4M45A 3AGKA 1JXEA 3K59A 3MCAB 4CJQA 1NWKA 1B9DA 1YHQN 3EY1A 2AP1A 2OPSA 1KAXA 2OA8A 4B9UA 1LOTB 2I7PA 3N4PA 3HJFA 2LSNA 4Z4GA 1D5AA 1R0AA 4B9LA 4KH6A 3TAEA 1SAZA 3JAMO 1QE1A 3T7ZA 3S3NA 3VTIA 5F0XA 4DV2K 3TAQA 1NGFA 3HM8A 3ZETA 1OVYA 3KWGA 4IDHA 4OVLA 1XQSC 2WC9A 4K42A 3PO5A 1VRTA 3UKUB 3AO3A 3CC2N 5KGWA 1RT3A 3MWTA 2OTLN 4CJKA 5J1EA 4CZHA 4JKHA 4CFAA 5AJ3K 2HBKA 3MN7A 4CZKA 2WUSA 4JS5A 4GMJB 4LF9K 5GAGP 4JKFA 1C6VA 3M6GA 5AQUA 3VGLA 1TKDA 3O3FA 5AZJA 4CGJA 1REVA 3JSMA 2W41A 3RMBA 4DTOA 4Z4HA 2UUAK 5C24A 3PIOL 3J81O 1S72N 3V9WA 4QS7A 5C15A 4M3RA 4LFCK 1T05A 4DTSA 4B9VA 2D1KA 4E7IA 4FJ9A 4IBNA 4YFUA 1YIJN 1JKHA 1TKTA 4KV8A 1VQ8N 2HHUA 4BREA 5HP1A 4B1VA 1IKXA 3LPUA 2VCPA 4GVEA 5E41A 1TGOA 1KFSA 3TSQA 3C0BA 1U6ZA 2A42A 3C65A 5A2QO 2VWJA 3WNGA 1CLQA 2QKBA 3VQ7A 4DQSA 4EFHA 2F8TA 4O0JA 3NGYA 3L0QA 3OYDA 4E19A 4A5AA 2IAJA 1MU2A 4DS4A 4DTRA 4AHRA 1VSDA 2OCEA 3T69A 3MEGA 3CC4N 4CGIA 4ISFA 3AVHA 4C1NK 4JNEA 3WXIA 3AVCA 3D6RA 4BR9A 4W5NA 3L3VA 4JD2A 2UUCK 1NK8A 4Z4FA 3BF3A 4PKIA 3THWA 3DLKA 4OLBA 4C1NI 3G10A 3DAWA 4BC2A 1TAQA 1EQYA 2ATQA 5SWMA 1W0HA 3SUOA 4CF1A 4B9QA 3L4IA 3HSCA 5EOYA 3BP8A 1U48A 3VEXA 4BE0A 1KD1O 3DLRA 3SQ0A 1DLOA 2VWBA 4JYAK 1NM1A 1KC8O 4W5QA 3ULEB 3OS2A 4F3OA 2KLAA 4ISGA 1U45A 3FFIA 2P9PA 4H5RA 4CHYA 4JKBA 3KD1E 4RW4A 3VMFB 2A41A 2IGIA 2IVOA 5AQVA 3SAFA 5BN8A 4BRLA 3E9OA 3SJHA 4BRFA 1TK5A 4NB4A 3U9DA 3SQ2A 4O5BA 2D0PA 4B8CA 3A5MC 4CERA 1BWFO 3K5NA 2P9IB 5HRSA 3P5JA 1IBMK 3L2UA 3VEZA 3VERA 1ATRA 4IEIA 2DFEA 3U8XA 2O8EA 2DPNA 1BDGA 4Z0UA 4CGHA 3S5TA 5KI6A 3J7ZO 4XH5A 2CGKA 1EKEA 4MDAA 4GV6A 1GLDG 2WFBA 1MA9B 2GX9A 3QINA 1S9GA 1YITN 4BC4A 2BDPA 3OYNA 2FSKA 1IKVA 3RSEB 5FDLA 1VSHA 4O8UA 4DSKA 3ID6A 2GUPA 4Z4CA 2P9SB 1YJ9N 4B9TA 1VSIA 1RDWX 2PAVA 3O9UA 1K73O 2V52B 2EX3A 3WNEA 1MWMA 1NGEA 5CZ1A 3LZIA 2GWJA 3CETA 4BE7B 4Y1CA 3AAQA 4DHYA 4IEEA 1BA0A 3KK7A 2HNYA 4FLWA 4H4OA 1HX1A 4B9MA 4B9SA 4CK2A 4N47A 4WE1A 3UE5A 4CJRA 1W9HA 4FJ5A 1XWLA 4FSVA 1NLVA 1JLAA 4K25A 3IFRA 3RTVA 5AQOA 3TWHA 3CCQN 4AQYK 4OPKA 4KTQA 1RNHA 3AV9A 2A1RA 3NMUA 4QS8A 4YDUC 2YKNA 4LSNA 2OZSA 3OBWA 3ZETB 1RT2A 5KPTA 2FF3B 4CJSA 3AVGA 4ILGB 5E84A 4M3TA 2Q97A 1JCFA 3ZT2A 1T6DA 2F8SA 4JKEA 3VQEA 5JLHA 1CZ9A 4JKAA 3ZX0A 2E2QA 3HBTA 4WFBL 4LF5K 2ASOA 4DTXA 1WBBA 3R3LA 1YI2N 2QWPA 3LP1A 3ZX3A 4C8KA 4OKJA 5AZJB 4DTUA 1QVGM 3ZEUA 4WFNL 2QWMA 3O4QA 4C8LA 4DV5K 1Q7YO 2YHXA 3RMCA 5AR0A 1GLEG 3GOIA 3FGUA 4XJXA 2JLEA 3G4SN 2E2OA 4BY9C 1JLGA 3SV4A 3VEOA 1NU0A 4A61A 4FLZA 2XHBA 2AJQA 3OYAA 4FOIA 1S1XA 1SKSA 2HVHA 2FLOA 3CJ1A 1RDAA 3O9SA 4H0OA 3SV3A 1NMNA 3H1VX 1KVBA 3TR8A 3HI0A 1L3VA 3L2RA 4PUOA 4CEDA 1WOQA 3R6MA 3HYFA 1SV5A 5JVGL 1JL1A 3P4IA 5MLCQ 5JICA 5M1NA 4AHUA 4CJ5A 3CG7A 2HVIA 4CF0A 3WXJA 4PKHA 4DTPA 3K9KA 1RT7A 1VRUA 4LF7K 5B8HA 3OJSA 2FBVA 4UY8O 1BQNA 4RG8A 3VN5A 2X74A 2AA4A 2BE2A 1LWCA 5ADXA 1EX4A 3CPEA 2ASMA 3M8RA 2P9LA 3J7AP 5D3GA 4FJIA 3D7EO 3G0ZA 4ZTJA 3IRXA 4M63C 1LAWA 4FW1A 3L8BA 3NVMA 1IO2A 5HOOA 3W0LA 4M41A 3HPGA 3PUFA 2IOCA 1BHLA 5DM6L 3MX5A 1YUWA 2VG7A 1VQMN 3TARA 4JD2B 1J54A 4CEZA 1VSJA 2D0AA 4GY2B 3VQDA 2FBYA 4KHSA 3QB0A 3THWB 2QWOA 3OS1A 4OX9K 4BQZA 4CZIA 3VF6A 4CFCA 1P90A 3UB5A 1RTHA 1T3VA 2VWKA 2YNGA 3I33A 3O9TA 2RE2A 1U04A 1BOTO 1IBKK 1JLCA 2CH6A 4IKFA 2X6SA 4NLBA 1IG9A 4TSXA 3ZSYA 3FZFA 2QWLA 3ZCMA 5BPNA 4YOVA 4HTLA 1ZC6A 5GAEP 1NJZA 2P9PB 4KRFA 1VQ7N 3MX2A 4FLTA 3THXA 1K8KA 3AVBA 3MWPA 3MXJA 3ENBA 4HUEA 3SUNA 1Q86O 3HT3A 1K8AO 1GOAA 4XIUA 1A5WA 4FM2A 3ITHA 2Q0RA 1NGBA 1L3SA 4JI2K 4CZGA 1J5EK 4ELVA 4WQ5C 3QEPA 2CGLA 1NJWA 3BZCA 4PKGA 2O8EB 1NGGA 1DEJA 1XNQK 2O8CA 1C0TA 1X3NA 3AVIA 5AQYA 3LAMA 1LCUA 4RCHA 4PHTX 3HSTB 4E1MA 1RFQA 1VAZA 1X1PA 5AQXA 1WUAA 1GLFO 3AVNA 5HLFA 3H08A 3RR8A 1BIUA 3DYAA 4DSEA 1JCEA 4B8AB 1EWQA 1CXQA 2ZM6K 1FJGK 1T6CA 1SQKA 3QETA 3O80A 1WN7A 1KVAA 1YAGA 1NK5A 3OW2M 1DT9A 5C12A 4FJHA 4E1JA 3U3YA 1WSEA 3AY9A 5J2MA 3P1GA 2FBTA 3BGRA 4ZTFA 3SQ1A 4C8NA 4DTJA 3SI6A 4QAGA 3AARA 2OYQA 2JGUA 4K8XA 1K6YA 4CFBA 4EAHD 5T7BA 4K0KK 3PX6A 3V9SA 3CQYA 3NHGA 2HHSA 2NRXA 3CJBA 3NAEA 3BF1A 3GDQA 2E88A 4JEPA 1X9MA 2CH5A 4EIAA 2YHYA 3HXMA 1ESVA 1JJ2M 3VESA 4GW6A 4KREA 3CJCA 4PWDA 3OYEA 3EO3A 4X62K 4CJUA 5AQSA 1C1AA 5JMVA 4LY7A 3AA2A 2FBXA 1E4GT 1OH8A 1RBUA 2NRRA 1RBVA 3OVNA 2QTDA 4BRAA 4OJRA 4BG8A 2VG5A 1HKBA 1RDUA 3HTVA 4CHQA 2IC3A 4J2AA 2HHHK 1FK9A 1KQSM 4E72A 4CEAA 3N4QA 1T8EA 1RCHA 5EVZA 1WNSA 3TTDA 4B3RK 2QXLA 5GAHP 5HL7L 3RMAA 3EL2A 3KJVA 4CJTA 3AVFA 4FCYA 4KTZA 4LH5A 3DMJA 5AFUH 3OYLA 3QO9A 2P5GA 1QSSA 1KSPA 5LY3A 1NK0A 3ZEUB 4KB1A 2HMPA 1R59O 4FJLA 4A2AA 4EP5A 2IVNA 4H0YB 4Z94A 3W3DA 3ZSWA 3LPTA 3EEQA 1O1WA 3AVMA 5AQGA 4N41A 3A0IX 5KRTA 3ZSZA 1QHTA 1NJXA 4KHWA 4J8FA 2D5RA 5CE3A 2WONA 3HP6A 3QBXA 4CIGA 3WQTA 4FWLA 2X78A 1X9JA 1GLCG 1HQEA 5CYMA 3THVA 1KXPA 1BCOA 3K5LA 4DR6K 5TKWA 4OGCA 5LMNK 1IJJA 3MECA 1EWRA 3NF6A 3DM2A 1T44A 1WSHA 2VYPA 4JHDA 3PX0A 4BRMA 2C1IA 1TYQA 2KZMA 4YORA 4DR3K 3DJCA 4BC5A 5C0YA 4E89A 3QNNA 3AVJA 3H45C 3RVCA 3IAYA 3VQ4A 4RWTA 3TU5A 1A5VA 5KTQA 4N56A 2P9LB 3SCXA 3GBTA 2UXBK 1BQMA 2ZQBA 3HZ6A 5K14A 4DV4K 3AA3A 2QKKA 4IO8A 5DM7L 1W7AA 3V1OA 4F8RA 3E9PA 3LDOA 4CBUA 1RGIA 3TTFA 2PYLA 4KO0A 3AVAA 4DLEA 3THYA 4KHYA 3L3UA 3VQBA 4FZXC 1TKXA 1HR0K 3VQQA 2X6NA 1FKPA 4IWVA 1S1TA 4DMNA 3L2WA 3K0SA 2YHAA 4CW7B 3U3GA 4CEBA 1VQON 1JLBA 1ZYQA 1HNVA 3AAPA 1Q82O 4IJNA 4FWSA 1J5OA 1I39A 4B1UB 5AQRA 3HM9A 5FPMA 4AF1A 4DU3A 4IFEA 2ITMA 4CD3A 3G71N 1VHXA 4BGAA 3SLCA 2YX6A 3E66A 2P9UA 4BVPA 3F9MA 2BGGA 3LDSA 2BTFA 2YKMA 3QICA 1Z26A 4G1QA 3CCUN 1NBWA 3THXB 1ASVA 2A1SA 3KZBA 3O4NA 1K8KB 4H4MA 5BRDA 4CZMA 1C0UA 2FSJA 2Q36A 3WNHA 4DSLA 4RW8A 1TV6A 1LW0A 4B3OA 1S1UA 4CECA 3MCPA 4M7YA 1HYSA 3NCIA 2G8FA 1EXQA 2NUBA 5AQIA 4CJ4A 5F2RA 3EN9A 3VOVA 4FJXA 1SKWA 3IMXA 4WFAL 4BRDA 2O8CB 1YXQA 3FZLA 2UXDK 2HHVA 3FLCO 4JV5K 3FZKA 2E2PA 3FFKB 5EU7A 1BCMA 4GVMA 3WXKA 4DKWA 4N76A 4M3ZA 4DLGA 3TANA 1RILA 4FPAA 2RPIA 1QSYA 3A2FA 3EKSA 2A40A 3KLIA 4H0VB 5I42A 2G8VA 1HRHA 3ZX2A 3ENHA 3O8MA 3PY8A 3R1XA 1NKBA 4ILHA 4FJNA 4H5VA 2P1JA 3VQ9A 4DFKA 3MXIA 4FLVA 2YNHA 5HRPA 2UUBK 2KW4A 2NLXA 3NF8A 5SZTA 4CJ7A 1VQKN 3SJJA 4O55A 4E7JA 1VQ9N 4FM1A 3M5RA 3VGMA 2YJFA 2D0OA 1E4FT 1HNWK 1TL3A 2E2NA 3ASMA 3KK2A 4YOTA 4R5PA 1FKOA 3ENOA 4JK8A 1Q8IA 4MO5A 2YCHA 3NDKA 2EHGA 4DB3A 4JI0K 3NH1A 4EHTA 4CD1A 4OPHA 3P31A 3OYJA 4BR2A 1GLJO 4KAZA 3KK1A 4BRHA 5KRSA 3ATVA 3MN5A 4JKCA 3IUCA 3RRHA 1TAUA 3SYZA 3VF2A 3KHYA 1H1VA 1NGHA 4K43A 2B4JA 1GLBG 2P5OA 4MO4A 2Q3SA 2ZJPL 2F96A 3RR7A 2ZE2A 4LFAK 3D45A 5AQQA 4IO9L 3KIOA 3B6OA 3QERA 4B9NA 4HHTA 1KAZA 1QS4A 4NYFA 1DTQA 3GG4A 2HB5A 1I3AA 4O44A 3VETA 4FO0A 1LW2A 5M1KA 4M42A 4K41A 4BRCA 1C1CA 4CJ3A 4DU4A 3DI6A 4LD0A 4B1YB 2QWRA 4E7HA 1VSFA 2QWNA 4OKKA 2FF6A 2HBMA 4A2BA 3DLGA 3ZSOA 3I56N 5JS1A 1X9WA 3VA3A 3OHRA 3MMVA 4JI3K 1V4SA 1QZ5A 5HBMA 1RT1A 4RW7A 3D2EA 4DUYK 2OPRA 2VGMA 3AO2A 2E4LA 2HNDA 2BUPA 3UKRA 1BG3A 1S6QA 2Z1GA 4PL7A 4DUZK 2PZSA 3MN6A 2D0BA 3D0PA 4DR4K 3F73A 2YNFA 4Y0WA 3CCRN 4X65K 2YHBA 4JHDB 5BR9A 1TYQB 1NGIA 4FZZA 4F3TA 4NYNA 4NXNK 4IDKA 4B08A 4H0PA 1FW6A 4W5RA 2KZZA 4FVUA 4YDUA 4YOYA 3H3NO 3OYHA 2HNZA 1HNZK 1Q9XA 4C8OA 3P38A 4M3WA 4FWMA 3NF9A 3SPYA 4LF6K 4FK2A 3LP2A 3AO5A 4FJ7A 2ZJQL 4DV1K 2IVPA 4J2DA 4CK3A 4HCCA 3DRPA 1HUXA 2IDOA 3AGRA 1M90O 3DLBA 4IFVA 1WLJA 3THYB 4CJWA 2HHWA 3DRSA 4R79A 2W42A 3QMLA 3F9KA 1N34K 1XI1A 3VQPA 2OZMA 4BRKA 5GADP 1ZBIA 3DLLL 1L5UA 2HOEA 2FXUA 3AO1A 1RDDA 5FRMA 2FC0A 5C10A 3VQCA 4FWKA 1EO1A 1LWFA 2E20A 3H3OB 2JWLA 1TKZA 5FPEA 3EZ5A 4FLYA 3DXKA 2RF2A 1Z6RA 3B6PA 3SMSA 1A5XA 4FM0A 1NGCA 1RBTA 4K8ZA 3OYIA 2E1ZA 2P9UB 2WOMA 3HPOA 5AQPA 3TAGA 1Z05A 3SBTA 4FVMA 3U9ZA 3NGZA 2RHKA 1VSKA 3KK3A 4H5TA 1NK6A 4EHUA 4JI7K 1ZBHA 4PA1A 5BPMA 2ETJA 2YJEA 4MDBA 1VQ4N 3T1YK 1S22A 3O9RA 4DV7K 3C95A 4KB0A 3T1HK 3HO1A 5IWAK 3T3FA 2F4VK 3F2KA 2NRVA 1UA0A 3ZSXA 5M1QA 4F4KA 3F5TA 2QK9A 3KLEA 3K57A 5J2NA 2Y1IA 1VK0A 3A5OC 3SBGA 1VQNN 2PY5A 3QEWA 4DSIA 2KKZA 2QWQA 3RRGA 1QHAA 1XHXA 1OH5A 3LDLA 4OPAA 5CZ2A 3MXMA 1VQ5N 2KFNA 4FWPA 2IIRA 4DCHA 4FJMA 4FW2A 4O0IA 2QEXN 5LMUK 1JL2A 1NKEA 3CCJN 2HHIA 2FSNA 4CEOA 3MEDA 4A62A 4CJVA 3M8QA 3CFOA 2DFFA 1ZBUA 2HHTA 1N33K 1S1WA 4FL9A 3C6UA 3VPZA 4A5BA 1CXUA 3QBWA 1SL2A 1DGKN 4Q5VA 2G8IA 2V7YA 1RTIA 5JENA 4YOXA 4FJGA 3K5OA 4HCBA 3VGKA 1WBDA 4LC9B 2Q1NA 2NRZA 4RTFD 2XRIA 4HWIA 3NF7A 3O9QA 2ITGA 2CGJA 3C7NA 3H46O 3J8AA 3CMEN 1Z25A 4KH5A 3V9ZA 1HPMA 3A8YA 4WQ5A 2XO7A 3QIPA 1HNXK 4JRQA 3E01A 3HOTA 3CPWM 4A59A 2C1GA 3NE6A 4DG1A 4CZJA 2HMIA 3BZKA 4KTWA 4BDYA 3LZJA 4ILJA 4RW9A 5AQHA 4MFBA 3OYFA 3CMAN 2OANA 3DLHA 1J9AA 1RBSA 4H03B 2OTJN 4IG0A 3JXUA 1WSIA 1Q18A 3KKSA 3FE1A 4ISEA 2W6LA 3PX4A 1TUYA 5C25A 4CHNA 4E7LA 2D4WA 1ZBFA 1RTDA 4BG9A 4IOCL 3PSFA 2UXCK 3OYCA 3OYGA 4DFMA 3U4LA 3T19A 3O1WA 4MLEA 5JS2A 3GL1A 3V1RA 3LANA 3D2EB 3ZLJA 4KBOA 2O8BA 3VF4A 3SNNA 5AZIA 4OO1J 4HUGA 4M3YA 5AQMA 4DTNA 1T7PA 1S3XA 1VSEA 3SAHA 5BREA 3KWIA 3S9HA 3UKRB 4EZ6A 4G9ZA 4O4GA 3SPZA 1KLNA 5AQJA 3ULDA 3OY9A 2KFZA 2QM1A 5CHIA 2PYJA 4CEQA 3V4IA 4DR5K 1NGAA 4ID5A 4CJFA 4JI5K 4OLAA 3V6DA 5FLXO 4QS9A 4OGEA 4FJJA 1NG9A 4I9LA 1XHZA 2HW3A 3CM5A 2GBZA 1FXXA 2ZGZA 2IS3A 3AO4A 3O5BA 1GOCA 4I9QA 2HBLA 1BA1A 1I94K 4BECA 1QQOA 2P9NA 2YV0X 1ASUA 1SZ2A 4YOUA 1J53A 1NOYA 3I8BA 3C6HA 3O3HA 1O13A 2OPQA 4GV3A 4AHCA 2XY6A 1XUPO 4WYBA 1NNEA 4FYDA 2E5LK 1G15A 3QNOA 4CEEA 4M3XA 3NBPA 2VG6A 4PY5A 2VGNA 1DKGD 4ZHRA 4W5TA 1VQLN 3K58A 4CHZA 3CCMN 3HL8A 1BU6O 4YHHK 1C0MA 4L3QA 3CCEN 3LDQA 1E3MA 1UAXA 4CZLA 3HVRA 1NKCA 1CZAN 4FK0A 4WQ4A 3DXKB 4EP4A 1QQNA 4YY3K 2GTDA 3H6EA 5LL6Z 3MK6A 1RDCA 4M3UA 1VQ6N 3QEIA 3NH0A 1ZXOA 3WT0A 4CGDA 1UWBA 4CF2A 4JRPA 5BPLA 2DTUA 2I5JA 4LF4K 3VQ5A 2O8FA 1HMVA 1JCGA 3L6QA 1SL1A 3S3OA 3PIPL 3ATUA 3A5LC 4YNQA 3CQ8A 5M1OA 1SL0A 5JLFA 4NXMK 4ICLA 4F2RA 5GINA 3FZHA 1RT6A 4KFBA 3TTCA 3HRGA 4HTUA 3BUZB 3DXMA 1NJYA 3KVGA 3LM2A 1JXBA 1NGJA 1QQMA 4W5OA 3TAFA 2ZJRL 1TUUA 1QZ6A 3CJ9A 4A57A 3U6FA 2DFHA 2ZF5O 1XC9A 1N5YA 5ADXH 3L2VA 1QTMA 3I8DA 5I3UA 5IT9O 1LAVA 2ZGYA 2Y1JA 4H0XB 4CJLA 1GLAG 1DTTA 4ELTA 3KLHA 4CJPA 3CI5A 1WAFA 4H5NA 4BE1A 4LFBK 1ITGA 3ISNC 4GKJK 1N6QA 3WNFA 4CF8A 4CI6A 1Q9YA 5M1FA 3PV8A 2DY4A 4I2PA 4AHSA 3KTQA 2YNIA 4CZFA 4KHUA 3WUHA 4RW6A 1P8ZA 1HKGA 2ASPA 3CQXA 1Y64A 3M3ZA 5CR4A 1HYVA 3C7NB 3I0SA 3BY5A 4PQUA 3M8PA 4DQQA 2W40A 3TPQA 4JAXA 1WB9A 5C2DA 2HHQA 1BI4A 4BR5A 1QVFM 1TVRA 3TI0A 1HJOA 2W6KA 1V4TA 3KLGA 3M8SA 1XMQK 4FOEA 3ZSVA 5F1XA 1S6PA 4HVJA 3Q7BA 4CZEA 4IXCA 3SMPA 2W00A 4WF9L 4CIFA 1D9FA 3PO4A 4Z4IA 5FPNA 4E0DA 4BRIA 3EZWA 1M1KO 4CESA 1UOCA 1HPZA 5AQZA 1C1BA 3O08A 3QESA 3ZYYX 4FWQA 2R7YA 4BWJA 3UIQA 4IG3A 3SUQA 2O8DA 2O8BB 3ID8A 5AZIB 4DSJA 5AQLA 1QQCA 1XMOK 3TAPA 4JS4A 4I6MA 4FLXA 4F2SA 3CM6A 3EKUA 2XY8A 1U2VA 3C94A 2WTUA 3MAQA 4DQPA 4DWIA 4GV9A 4JLHA 3FR0A 2A3ZA 4AILC 4JK7A 1B92A 2OPPA 4FJ8A 3NVKA 1D4XA 1RT5A 1G99A 5KQ8A 3NH2A 4DF8A 3WEEA 4CJEA 3R9PA 4PL8A 1HKCA 4E1NA 3LP3A 1D8YA 4BC3A 3HP9A 2P9NB 4JKDA 4OKEA 1Y97A 3DWLA 1T03A 1IV0A 5AQFA 3IG1A 3P39A 4XH1A 2Z1IA 5DK5A 1N8RO 1W2BM 1MWKA 1BISA 3ZSQA 3OYMA 1C0GA 3C6AA 1EP4A 1HQUA 4FJKA 4DR2K 1RDBA 1WSFA 4BE2A 2F9TA 1BO5O 4JI8K 3J80O 5BRHA 1U4BA 2HBJA 2P9KA 4MLHA 4FWNA 1EETA 1L3UA 4KHNA 1F21A 3LM9A 3K2PA 2VQFK 4JK9A 3A5NC 3H1QA 3Q7CA 1HNIA 3I0RA 1KRPA 3E1YA 4DFJA 1RTJA 3VENA 3NGIA 3D2FA 4Y1DA 4CF9A 4ID1A 5E26A 3VQAA 3OJUA 3QFUA 3TABA 1VQPN 3OTOK 2BANA 5TKYA 3EE9A 2G8UA 3OYBA 3SK3A 4NO7A 1U47A 4BWMA 1OVQA 3TSUA 5KGXA 1XNRK 4BRGA 4CBXA 5KQDA 1TK8A 3DOLA 5J2PA 1KAYA 3CHWA 5EY4A 2O8FB 4AHTA 5M1PA 3IDHA 2QA4N 3E9LA 1YJWN 4FXDA 5AFUA 4QOZB 1L3TA 3ZT0A 1VSLA 2P51A 1KTQA 4OPJA 1HYZA 4CHOA 2HSTA 4IOXA 3SAGA 5LJVA 4I2QA 3QIOA 3OA9A 3KD5E
chains in the Genus database with same CATH topology
3BF3A 4HWIA 3O9QA 4PKIA 4BGBA 3DXMB 4C1NI 2CGJA 3DAWA 4BC2A 1KXPA 3C7NA 1EQYA 3H46O 3J8AA 5TKWA 5GIOA 3CMEN 4KH5A 4B9QA 3L4IA 3HSCA 1HPMA 1IJJA 3A8YA 4WQ5A 5EOYA 3BP8A 3HOTA 1MDUB 2JWKA 5LJWA 4A59A 3CPWM 3O6WA 1T44A 2C1GA 3VEXA 3B8AX 1KD1O 3QDKA 2VYPA 4JHDA 4CZJA 4BRMA 1ATNA 2UYTA 4AM6A 2C1IA 2VWBA 1HLUA 1TYQA 2QI2A 4B1WB 1NM1A 4YORA 4ILJA 5AQHA 1KC8O 4FWRA 3ULEB 3DJCA 2KLAA 4BC5A 4ISGA 5C0YA 4O5FA 3CMAN 2OANA 4BVOA 3H45C 3LL3A 2P9PA 3RVCA 4RWTA 3TU5A 4H5RA 4H03B 2OTJN 1NJIO 3JXUA 4JKBA 4BQLA 1Q18A 3FE1A 4ISEA 2P9LB 3VMFB 5C2FA 3GBTA 1TUYA 2A41A 2IVOA 5AQVA 3SAFA 5BN8A 3HZ6A 3E9OA 3SJHA 2D4WA 2PBDA 4BR7A 4BRFA 4BRLA 4IOAL 3CCVN 4BG9A 4IOCL 4IO8A 4NB4A 3U9DA 5DM7L 4JKGA 3U4LA 2D0PA 3E9PA 3LDOA 3O1WA 4CBUA 1RGIA 4MLEA 3A5MC 1BUPA 3PLAA 3TTFA 3GL1A 1BWFO 4H5WA 3D2EB 4KBOA 4BR0A 3VF4A 4CBWA 2P9IB 5AZIA 1C0FA 4OO1J 4H0TB 1XC3A 1YVNA 3CF5L 3VEZA 5AQMA 3VERA 2YHWA 4NLCA 1S3XA 3SAHA 1ATRA 4IEIA 3U8XA 5BREA 2DPNA 3KWIA 4BEBA 3UKRB 1BDGA 2KHOA 2WBNA 4G9ZA 5AQJA 2QM1A 3O4WA 5CHIA 3J7ZO 4XH5A 1ILYA 4KH4A 2CGKA 4IWVA 4MDAA 4GV6A 1NGAA 4C23A 1GLDG 2WFBA 5ELZA 4QS9A 1MA9B 1VQON 2GX9A 3AAPA 1YITN 1Q82O 4IJNA 4FWSA 4BC4A 4B1UB 2FSKA 2GWKA 3CERA 5AQRA 5BN9A 3RSEB 3EE8A 5FPMA 3UKUA 4O8UA 3ID6A 4AF1A 2GUPA 4IFEA 4O8KA 2ITMA 4CD3A 3G71N 2ZGZA 4BGAA 2P9SB 3SLCA 1YJ9N 2YX6A 3E66A 2P9UA 4BVPA 3CCSN 2Q31A 3F9MA 3O5BA 1RDWX 5EX5A 2BTFA 3LDNA 4B1ZA 2PAVA 3L4QA 3O9UA 3QICA 2HBLA 1NBWA 1BA1A 3IKMA 2V52B 3CCUN 3KZBA 1K73O 1K8KB 4BECA 1QQOA 1MWMA 2P9NA 1NGEA 3WXLA 1SZ2A 2GWJA 3CETA 4YOUA 4BE7B 3GE1A 5BRDA 3AAQA 1NMDA 3CC7N 4DHYA 4IEEA 4CZMA 5BRFA 2FSJA 2Q36A 3C6HA 3I8BA 5I9EB 1BA0A 3KK7A 1O13A 1HX1A 3MCPA 1OKJA 4M7YA 4WCEL 4GV3A 3UE5A 5AQIA 5F2RA 3CJ7A 3EN9A 3VOVA 3HOSA 1XUPO 4WYBA 4FSVA 3VEWA 4I6MB 3IMXA 1NLVA 4WFAL 2J4RA 4BRDA 4K25A 3IFRA 4BRPA 1YXQA 5AQOA 2F7TA 3FZLA 3CCQN 5AQNA 3FLCO 1U2VB 2GELA 2VGNA 2NRHA 2GEMA 1DKGD 3FZKA 1VQLN 2E2PA 2NRTA 3O1BA 3FFKB 3WXKA 3CCMN 3NMUA 4DKWA 1BU6O 4QS8A 4L3QA 4YDUC 3CCEN 3LDQA 4CZLA 4FPAA 3EKSA 2ZWHA 2A40A 4H0VB 3OBWA 3ZETB 1CZAN 3ENHA 3O8MA 2FF3B 4IZ9A 1X3MA 3ZX2A 5KPTA 3R1XA 3VEVA 4WQ4A 3DXKB 4ILGB 5E84A 2Q97A 1JCFA 4ILHA 2HF4A 1QQNA 4H5VA 1T6DA 2EWSA 2GTDA 3WEEB 2YI1A 3H6EA 4JKEA 5JLHA 3WXMB 4JKAA 3CCLN 3ZX0A 3MK6A 1ZBSA 2E2QA 3HBTA 4WFBL 2ASOA 3CD6N 3R8EA 2NLXA 3R3LA 4CJ7A 4FPBA 5GIPA 1YI2N 1VQKN 2QWPA 1VQ9N 1VQ6N 3M5RA 3VGMA 2YJFA 2D0OA 5AQTA 1ZXOA 3WT0A 3CXCM 2A5XA 1E4FT 3ZX3A 2E2NA 1QVGM 5AZJB 3ZEUA 5BPLA 4YOTA 4WFNL 3ENOA 2QWMA 4JK8A 1JCGA 2Q2RA 2YCHA 3L6QA 4MO5A 5KPRA 2YHXA 1Q7YO 4M7XA 4DB3A 3PIPL 1YJNN 4BROA 3ATUA 3A5LC 5AR0A 1GLEG 4CD1A 3GOIA 3VTHA 3FGUA 4EHTA 4OPHA 5M1OA 4XJXA 3JS6A 5JLFA 3P31A 3G4SN 3G25A 4BR2A 3WQUA 1GLJO 3G6EN 2E2OA 4BRHA 4JN4A 4BRQA 5GINA 5H1SQ 3ATVA 4BY9C 3MN5A 3FZHA 3VEOA 4JKCA 2BH1A 2P9KB 3IUCA 4A61A 4FOIA 4DQ8A 3TTCA 1W97L 3HRGA 3BUZB 2FLOA 3CJ1A 3DXMA 3OBYA 2Q0UA 3O9SA 4H0OA 3VF2A 3KHYA 3KVGA 1H1VA 1NGHA 3H1VX 3LM2A 1GLBG 4K43A 4MO4A 1NGJA 1QQMA 3HI0A 2ZJRL 3D2FB 3CIPA 2ZJPL 1TUUA 1WOQA 3M1FA 4F9OA 3R6MA 1QZ6A 1GLLO 3CJ9A 4A57A 2ZF5O 5JVGL 5AQQA 3I55N 3P4IA 5MLCQ 2V7ZA 5JICA 5ADXH 5M1NA 4IO9L 3LDPA 4U7BA 1KAZA 3WXJA 4PKHA 3K9KA 3S41A 3ULEA 5B8HA 3GG4A 4B1XB 4UY8O 3VETA 4FWOA 4FO0A 4YOWA 2ZGYA 5M1KA 2AA4A 4K41A 4H0XB 5KPZA 4BRCA 1GLAG 4B1YB 5ADXA 1ATSA 2QW9A 3CPEA 2QWRA 2ASMA 5AQKA 2NNWA 2P9LA 2QWNA 3CI5A 4XEIA 1J6ZA 3VEYA 3D7EO 2FF6A 2HBMA 5EXWA 4A2BA 2E8AA 3I56N 3BEXA 4H5NA 4M63C 3OHRA 4IJAA 3MMVA 3NVMA 5HOOA 3W0LA 1V4SA 1QZ5A 4CI6A 4AM7A 5M1FA 4FWLA 1K9MO 3D2EA 5DM6L 3MX5A 1YUWA 1Q81O 1VQMN 2P9IA 2PFUA 2VGMA 4CZFA 4JD2B 3CJAA 4GY2B 3WUHA 1P8ZA 4GNIA 3QB0A 1HKGA 1NGDA 2ASPA 1Y64A 2BUPA 2NRWA 3CQXA 3M3ZA 3UKRA 2QWOA 5CR4A 1BG3A 3C7NB 2A6AA 4PL7A 4BQZA 2E1YA 3MN6A 3VF6A 4CZIA 1P90A 2W40A 3TPQA 3UB5A 5JVHL 4JAXA 5C2DA 2I7NA 1SS6A 1T3VA 3O9TA 3I33A 5AQWA 2RE2A 4Y0WA 4BR5A 1BOTO 3CCRN 2CH6A 4JHDB 4XH4A 1QVFM 4NLBA 5BR9A 3FZFA 1HJOA 1IG8A 1NGIA 1TYQB 1V4TA 2QWLA 3QFPA 2F9WA 5BPNA 4YOVA 3MN9A 3RSEA 4HTLA 2V51B 4FOEA 4H0PA 1ZC6A 5GAEP 5FPDA 1YF5L 3K9JA 5F1XA 3Q7BA 2P9SA 2P9PB 4CZEA 4IXCA 3SMPA 4YDUA 4FVUA 4YOYA 3H3NO 1VQ7N 2W00A 3MX2A 4WF9L 4BR4A 4U67L 1K8KA 4BRNA 3P38A 5FPNA 3MWPA 4BRIA 4FWMA 3ENBA 3EZWA 1M1KO 2ZJQL 2IVPA 1Q86O 5AQZA 1K8AO 3FZMA 3O08A 3MDQA 3TSPA 1HUXA 3AGRA 2NZTA 1M90O 2Q0RA 2H3GX 1NGBA 4JKGB 4FWQA 3ZYYX 4WQ4C 2HF3A 4CZGA 4WQ5C 3AGKA 3ID8A 5AZIB 2CGLA 5AQLA 4R79A 3QMLA 3MCAB 1NWKA 4BRKA 4PKGA 4I6MA 1NGGA 1YHQN 1DEJA 5GADP 2AP1A 3DLLL 1KAXA 1X3NA 2HOEA 2FXUA 3EKUA 5AQYA 1LCUA 1LOTB 2I7PA 1U2VA 3N4PA 4RCHA 4PHTX 1RFQA 1VAZA 5AQXA 4KH6A 4GV9A 1SAZA 1WUAA 1GLFO 5C10A 3T7ZA 3VTIA 3FR0A 2A3ZA 5F0XA 1NGFA 1JCEA 4FWKA 4JK7A 3HM8A 3ZETA 1EO1A 1OVYA 2E20A 3NVKA 1T6CA 1D4XA 3H3OB 2JWLA 1SQKA 1XQSC 2WC9A 3KWGA 4IDHA 4K42A 5FPEA 1G99A 3O80A 3UKUB 3DXKA 5KQ8A 1YAGA 3CC2N 1Z6RA 3MWTA 3SMSA 1NGCA 3WEEA 2OTLN 2E1ZA 2P9UB 3R9PA 1DT9A 4PL8A 5C12A 3OW2M 1HKCA 4E1JA 4CZHA 5AQPA 4JKHA 1Z05A 3AY9A 2HBKA 3SBTA 4BC3A 3MN7A 2P9NB 4JKDA 3U9ZA 2WUSA 4CZKA 2RHKA 5GAGP 4JKFA 4H5TA 3DWLA 3AARA 3M6GA 5AQFA 4EHUA 3P39A 4XH1A 5AQUA 3VGLA 5BPMA 1N8RO 2YJEA 1W2BM 4EAHD 1MWKA 4MDBA 5AZJA 1VQ4N 1S22A 3O9RA 1C0GA 2W41A 3C6AA 3CQYA 2NRXA 3CJBA 3BF1A 3PIOL 1S72N 3GDQA 2E88A 4JEPA 4QS7A 3F2KA 2CH5A 4EIAA 2F9TA 5C15A 2NRVA 2YHYA 1ESVA 1BO5O 1JJ2M 5M1QA 3VESA 3F5TA 5BRHA 3CJCA 2HBJA 2P9KA 4MLHA 4FWNA 3A5OC 2D1KA 3EO3A 3LM9A 3SBGA 1VQNN 2KKZA 2QWQA 5AQSA 5JMVA 1QHAA 3A5NC 3H1QA 3LDLA 4JK9A 3Q7CA 1E4GT 1YIJN 3E1YA 3VENA 2NRRA 3D2FA 4OPAA 5E26A 2QTDA 1VQ8N 1VQ5N 3QFUA 4BRAA 4FWPA 2IIRA 4DCHA 4BG8A 1VQPN 1HKBA 1RDUA 3HTVA 4BREA 4B1VA 2QEXN 5TKYA 2VCPA 4GVEA 3CCJN 1KQSM 3EE9A 3N4QA 3TSQA 2FSNA 5EVZA 3C0BA 3SK3A 3TTDA 1U6ZA 2A42A 2QXLA 4NO7A 3C65A 4A62A 5GAHP 5HL7L 3EL2A 3TSUA 5AFUH 4EFHA 4BRGA 5LY3A 4CBXA 3L0QA 3ZEUB 2HMPA 5KQDA 4FL9A 1R59O 4A5AA 4A2AA 1KAYA 3CHWA 3VPZA 5EY4A 2IVNA 4A5BA 4H0YB 4Z94A 5M1PA 3T69A 3QBWA 3W3DA 1DGKN 3IDHA 3CC4N 2QA4N 3E9LA 4ISFA 2V7YA 1YJWN 5AQGA 4YOXA 5AFUA 4C1NK 4JNEA 3A0IX 3WXIA 3VGKA 4LC9B 3D6RA 2HSTA 4IOXA 3SAGA 4BR9A 4J8FA 5LJVA 2Q1NA 5CE3A 4JD2A 2NRZA 3OA9A 3QBXA 4RTFD 3WQTA 1X9JA 1GLCG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BF3 A;  4HWI A;  4PKI A;  4BGB A;  3DXM B;  2CGJ A;  3DAW A;  4BC2 A;  1KXP A;  3C7N A;  1EQY A;  3H46 O;  3J8A A;  4B9Q A;  3L4I A;  3HSC A;  1HPM A;  1IJJ A;  3A8Y A;  4WQ5 A;  5EOY A;  3BP8 A;  1MDU B;  5LJW A;  3O6W A;  1T44 A;  3VEX A;  3B8A X;  3QDK A;  2VYP A;  4JHD A;  4CZJ A;  4BRM A;  1ATN A;  2UYT A;  4AM6 A;  2VWB A;  1HLU A;  1TYQ A;  4B1W B;  1NM1 A;  5AQH A;  4FWR A;  3ULE B;  3DJC A;  4BC5 A;  4ISG A;  4O5F A;  2OAN A;  4BVO A;  3H45 C;  3LL3 A;  2P9P A;  4RWT A;  3TU5 A;  4H5R A;  4H03 B;  3JXU A;  4BQL A;  1Q18 A;  3FE1 A;  4ISE A;  2P9L B;  3GBT A;  1TUY A;  2A41 A;  2IVO A;  5AQV A;  5BN8 A;  3HZ6 A;  3SJH A;  4BR7 A;  2D4W A;  2PBD A;  4BRL A;  4BRF A;  4BG9 A;  4IO8 A;  4NB4 A;  3U9D A;  3U4L A;  2D0P A;  3O1W A;  3LDO A;  4CBU A;  1RGI A;  4MLE A;  3A5M C;  1BUP A;  3GL1 A;  1BWF O;  4H5W A;  3D2E B;  4KBO A;  4BR0 A;  3VF4 A;  4CBW A;  2P9I B;  5AZI A;  1C0F A;  4H0T B;  1XC3 A;  1YVN A;  3VEZ A;  5AQM A;  3VER A;  2YHW A;  1S3X A;  1ATR A;  3U8X A;  5BRE A;  2DPN A;  3UKR B;  1BDG A;  2KHO A;  5AQJ A;  2QM1 A;  3O4W A;  4XH5 A;  2CGK A;  4IWV A;  1NGA A;  4C23 A;  1GLD G;  5ELZ A;  4QS9 A;  1MA9 B;  3AAP A;  4IJN A;  4FWS A;  4BC4 A;  4B1U B;  2FSK A;  2GWK A;  3CER A;  5AQR A;  5BN9 A;  3RSE B;  5FPM A;  3UKU A;  2GUP A;  4O8K A;  2ITM A;  4CD3 A;  2ZGZ A;  4BGA A;  2P9S B;  3SLC A;  4BVP A;  2P9U A;  2Q31 A;  3F9M A;  3O5B A;  1RDW X;  5EX5 A;  2BTF A;  3LDN A;  4B1Z A;  2PAV A;  3QIC A;  1NBW A;  1BA1 A;  2V52 B;  3KZB A;  1K8K B;  1QQO A;  1MWM A;  2P9N A;  1NGE A;  3WXL A;  1SZ2 A;  2GWJ A;  3CET A;  3GE1 A;  5BRD A;  3AAQ A;  1NMD A;  4DHY A;  5BRF A;  4CZM A;  5I9E B;  2FSJ A;  2Q36 A;  3I8B A;  1BA0 A;  1HX1 A;  3MCP A;  1OKJ A;  4M7Y A;  3UE5 A;  5AQI A;  5F2R A;  3CJ7 A;  3EN9 A;  3VOV A;  1XUP O;  4WYB A;  4FSV A;  3VEW A;  4I6M B;  3IMX A;  1NLV A;  2J4R A;  4BRD A;  4K25 A;  3IFR A;  4BRP A;  1YXQ A;  5AQO A;  3FZL A;  5AQN A;  3FLC O;  1U2V B;  2GEL A;  2NRH A;  2GEM A;  1DKG D;  3FZK A;  2E2P A;  3O1B A;  3FFK B;  3WXK A;  1BU6 O;  4QS8 A;  4L3Q A;  4YDU C;  3LDQ A;  4CZL A;  4FPA A;  3EKS A;  2ZWH A;  2A40 A;  4H0V B;  3ZET B;  1CZA N;  3ENH A;  3O8M A;  2FF3 B;  4IZ9 A;  1X3M A;  3ZX2 A;  5KPT A;  3VEV A;  4WQ4 A;  3DXK B;  5E84 A;  2Q97 A;  1JCF A;  2HF4 A;  1QQN A;  4H5V A;  1T6D A;  2EWS A;  2GTD A;  3WEE B;  2YI1 A;  3H6E A;  5JLH A;  3ZX0 A;  3MK6 A;  1ZBS A;  2E2Q A;  3HBT A;  2ASO A;  3R8E A;  2NLX A;  4CJ7 A;  4FPB A;  2QWP A;  3VGM A;  2YJF A;  2D0O A;  5AQT A;  1ZXO A;  3WT0 A;  2A5X A;  1E4F T;  3ZX3 A;  2E2N A;  5AZJ B;  3ZEU A;  5BPL A;  3ENO A;  2QWM A;  1JCG A;  2Q2R A;  2YCH A;  3L6Q A;  4MO5 A;  5KPR A;  2YHX A;  4M7X A;  4DB3 A;  4BRO A;  3ATU A;  3A5L C;  5AR0 A;  1GLE G;  4CD1 A;  3GOI A;  4EHT A;  3FGU A;  3JS6 A;  5JLF A;  3G25 A;  4BR2 A;  3WQU A;  1GLJ O;  2E2O A;  4BRH A;  4JN4 A;  4BRQ A;  3ATV A;  3MN5 A;  3FZH A;  3VEO A;  2P9K B;  3IUC A;  4A61 A;  4FOI A;  4DQ8 A;  3BUZ B;  2FLO A;  3CJ1 A;  3DXM A;  2Q0U A;  4H0O A;  3VF2 A;  3KHY A;  3KVG A;  1H1V A;  1NGH A;  3H1V X;  3LM2 A;  1GLB G;  4K43 A;  4MO4 A;  1NGJ A;  1QQM A;  3HI0 A;  3D2F B;  3CIP A;  1TUU A;  1WOQ A;  3M1F A;  4F9O A;  3R6M A;  1QZ6 A;  3CJ9 A;  1GLL O;  2ZF5 O;  5AQQ A;  3P4I A;  2V7Z A;  5JIC A;  5ADX H;  3LDP A;  1KAZ A;  3WXJ A;  4PKH A;  3S41 A;  3ULE A;  5B8H A;  3GG4 A;  4B1X B;  3VET A;  4FWO A;  4FO0 A;  2ZGY A;  2AA4 A;  4K41 A;  4H0X B;  5KPZ A;  4BRC A;  1GLA G;  4B1Y B;  5ADX A;  1ATS A;  2QW9 A;  2QWR A;  2ASM A;  5AQK A;  2P9L A;  2QWN A;  3CI5 A;  4XEI A;  1J6Z A;  3VEY A;  3D7E O;  2FF6 A;  5EXW A;  4A2B A;  2E8A A;  3BEX A;  4H5N A;  4M63 C;  3OHR A;  4IJA A;  3MMV A;  3W0L A;  1V4S A;  1QZ5 A;  4CI6 A;  4AM7 A;  4FWL A;  3D2E A;  1YUW A;  2P9I A;  4CZF A;  4JD2 B;  3CJA A;  4GY2 B;  3WUH A;  1P8Z A;  4GNI A;  3QB0 A;  1HKG A;  1NGD A;  2ASP A;  1Y64 A;  2BUP A;  3CQX A;  3M3Z A;  3UKR A;  2QWO A;  1BG3 A;  3C7N B;  2A6A A;  4PL7 A;  4BQZ A;  2E1Y A;  3MN6 A;  3VF6 A;  4CZI A;  2W40 A;  3TPQ A;  3UB5 A;  4JAX A;  2I7N A;  3I33 A;  5AQW A;  4Y0W A;  4BR5 A;  1BOT O;  2CH6 A;  4JHD B;  4XH4 A;  5BR9 A;  3FZF A;  1HJO A;  1IG8 A;  1NGI A;  1TYQ B;  1V4T A;  2QWL A;  3QFP A;  2F9W A;  5BPN A;  3MN9 A;  3RSE A;  4HTL A;  2V51 B;  4FOE A;  4H0P A;  1ZC6 A;  5FPD A;  5F1X A;  4CZE A;  2P9S A;  2P9P B;  4IXC A;  3SMP A;  4YDU A;  3H3N O;  4BR4 A;  1K8K A;  4BRN A;  5FPN A;  4BRI A;  4FWM A;  3EZW A;  2IVP A;  5AQZ A;  3FZM A;  3O08 A;  3MDQ A;  1HUX A;  2NZT A;  2Q0R A;  2H3G X;  1NGB A;  4FWQ A;  4WQ4 C;  2HF3 A;  4CZG A;  4WQ5 C;  3ID8 A;  5AZI B;  2CGL A;  5AQL A;  3QML A;  1NWK A;  4BRK A;  4PKG A;  4I6M A;  1NGG A;  1DEJ A;  2AP1 A;  1KAX A;  1X3N A;  2HOE A;  2FXU A;  3EKU A;  5AQY A;  1LCU A;  1LOT B;  2I7P A;  1U2V A;  4RCH A;  1RFQ A;  5AQX A;  1SAZ A;  1WUA A;  1GLF O;  5F0X A;  3FR0 A;  2A3Z A;  1NGF A;  1JCE A;  4FWK A;  3HM8 A;  3ZET A;  2E20 A;  1T6C A;  1D4X A;  3H3O B;  1SQK A;  1XQS C;  5FPE A;  4K42 A;  1G99 A;  3O80 A;  3UKU B;  3DXK A;  5KQ8 A;  1YAG A;  1Z6R A;  3SMS A;  1NGC A;  3WEE A;  2E1Z A;  2P9U B;  3R9P A;  4PL8 A;  1HKC A;  4E1J A;  4CZH A;  5AQP A;  1Z05 A;  3AY9 A;  4BC3 A;  3MN7 A;  2P9N B;  3U9Z A;  4CZK A;  2WUS A;  4H5T A;  3DWL A;  3AAR A;  3M6G A;  5AQF A;  4EHU A;  4XH1 A;  5AQU A;  3VGL A;  5BPM A;  2YJE A;  4EAH D;  1MWK A;  5AZJ A;  1S22 A;  1C0G A;  2W41 A;  3CQY A;  3CJB A;  3BF1 A;  3GDQ A;  2E88 A;  4QS7 A;  2CH5 A;  4EIA A;  2F9T A;  2YHY A;  1ESV A;  1BO5 O;  3VES A;  5BRH A;  3CJC A;  4MLH A;  2P9K A;  4FWN A;  3A5O C;  2D1K A;  3EO3 A;  3LM9 A;  2QWQ A;  5AQS A;  5JMV A;  1QHA A;  3A5N C;  3H1Q A;  3LDL A;  1E4G T;  3VEN A;  3D2F A;  5E26 A;  3QFU A;  4BRA A;  4FWP A;  2IIR A;  4DCH A;  4BG8 A;  1HKB A;  3HTV A;  4BRE A;  4B1V A;  5TKY A;  2VCP A;  2FSN A;  5EVZ A;  3C0B A;  3SK3 A;  1U6Z A;  2A42 A;  2QXL A;  4NO7 A;  4A62 A;  3EL2 A;  5AFU H;  4EFH A;  4BRG A;  5LY3 A;  4CBX A;  3L0Q A;  3ZEU B;  2HMP A;  5KQD A;  4FL9 A;  1R59 O;  4A2A A;  1KAY A;  3CHW A;  3VPZ A;  5EY4 A;  2IVN A;  4H0Y B;  4Z94 A;  3QBW A;  3W3D A;  1DGK N;  3IDH A;  4ISF A;  2V7Y A;  5AQG A;  5AFU A;  4JNE A;  3A0I X;  3WXI A;  3VGK A;  4LC9 B;  4BR9 A;  4J8F A;  5LJV A;  2Q1N A;  5CE3 A;  4JD2 A;  3QBX A;  4RTF D;  3WQT A;  1X9J A;  1GLC G; 
#chains in the Genus database with same CATH topology
 3PSI A;  4BGB A;  4KI6 A;  4B3S K;  3DXM B;  4N5S A;  1S9E A;  5GIO A;  4KPY A;  4CE9 A;  3OYK A;  3DOK A;  3KKR A;  3CYG A;  4BDZ A;  1MDU B;  2JWK A;  5LJW A;  1JLF A;  3O6W A;  3B8A X;  3QDK A;  2UU9 K;  1ATN A;  2UYT A;  3S3M A;  4AM6 A;  1HLU A;  2QI2 A;  4B1W B;  1KLM A;  4FWR A;  1WSJ A;  1UA1 A;  4E7K A;  4Z4E A;  4O5F A;  4BVO A;  3LL3 A;  3CYM A;  4LSL A;  1NJI O;  4BQL A;  1WAJ A;  3V9U A;  1CZB A;  1OH6 A;  5C2F A;  1IH7 A;  1NK7 A;  2B5J A;  4BR7 A;  2PBD A;  4BAC A;  4IOA L;  2ZD1 A;  3CCV N;  3ZT3 A;  4JKG A;  3AVK A;  3V9X A;  1BUP A;  3PLA A;  1YVU A;  3QEV A;  3SQ4 A;  4H5W A;  4BR0 A;  4CBW A;  1C0F A;  4H0T B;  1XC3 A;  1YVN A;  3QEX A;  3CF5 L;  5HRR A;  2YHW A;  4NLC A;  2O4I A;  1RT4 A;  2KTQ A;  4BEB A;  1TL1 A;  4JI6 K;  2KHO A;  2WBN A;  1X9S A;  4QCL A;  1NOZ A;  3O4W A;  4B3M K;  4MQ3 A;  1ILY A;  4KH4 A;  4NCG A;  4C8M A;  3V81 A;  3AVL A;  1BI4 B;  4JI1 K;  4C23 A;  4DS5 A;  2QXF A;  5ELZ A;  4DR7 K;  4I7F A;  3TAM A;  4KKO A;  5FRN A;  3ZT1 A;  2GWK A;  3CER A;  5BN9 A;  3UKU A;  3EE8 A;  1QSL A;  2Z1H A;  4DQI A;  4O8K A;  3T1A A;  4IFY A;  4BDP A;  3CCS N;  2Q31 A;  5EX5 A;  3LDN A;  4B1Z A;  3L4Q A;  4LF8 K;  3MEE A;  3IKM A;  5FRO A;  3WXL A;  1NK9 A;  3GE1 A;  4CEF A;  4CGF A;  1NMD A;  3CC7 N;  5BRF A;  5I9E B;  1GOB A;  2KQ2 A;  5HRO A;  4FK4 A;  3C6T A;  3KLF A;  1OKJ A;  4X66 K;  2O8D B;  4DF4 A;  4WCE L;  1YT3 A;  3CJ7 A;  3HOS A;  3IS9 A;  5BR8 K;  3VEW A;  4LH4 A;  5HRN A;  4I6M B;  4HUF A;  2J4R A;  4BRP A;  2F7T A;  1LV5 A;  5AQN A;  4DSF A;  1U2V B;  2GEL A;  2NRH A;  2RN2 A;  2GEM A;  2NRT A;  3O1B A;  4AHV A;  4Q0B A;  1S1V A;  3CFP A;  3DRR A;  3VQ8 A;  1WSG A;  2ZWH A;  5C42 A;  4IZ9 A;  3LAL A;  3BDP A;  1X3M A;  3VEV A;  1JLQ A;  4V19 S;  2HF4 A;  2EWS A;  2XY7 A;  3WEE B;  3CFR A;  2YI1 A;  3WXM B;  3CCL N;  4JI4 K;  4DV3 K;  5CY4 A;  1ZBS A;  1IKW A;  3CD6 N;  3R8E A;  4EZ9 A;  1HJR A;  4FPB A;  5GIP A;  4X64 K;  4CK1 A;  3OS0 A;  5AQT A;  3LWL A;  3CXC M;  2A5X A;  2G8K A;  2XY5 A;  4DV6 K;  4DQR A;  2Q2R A;  4KI4 A;  5KPR A;  3QLH A;  4M7X A;  1YJN N;  1OH7 A;  4BRO A;  1KVC A;  3VTH A;  3JS6 A;  1IBL K;  2GUI A;  3G25 A;  1ZBL A;  3WQU A;  3G6E N;  4E3S A;  4JN4 A;  4BRQ A;  5H1S Q;  3O3G A;  5J2Q A;  2BH1 A;  2P9K B;  3ZSR A;  3RWU A;  4DQ8 A;  3AA4 A;  1YTA A;  1W97 L;  1KCF A;  1BGX T;  3OBY A;  2Q0U A;  3P83 D;  5CYQ A;  3J7Y P;  1SUQ A;  3EYZ A;  1JLE A;  3D2F B;  4J2B A;  3CIP A;  3M1F A;  4F9O A;  1GLL O;  1S5J A;  3HK2 A;  4KHP K;  3AA5 X;  3SUP A;  3I55 N;  2V7Z A;  4GKK K;  2G8H A;  1IKY A;  3LDP A;  2G8W A;  1BL3 A;  4U7B A;  3K5M A;  3ALY A;  3S41 A;  3ULE A;  4B1X B;  4FWO A;  4YOW A;  4B3T K;  5KPZ A;  4DFP A;  1ATS A;  2QW9 A;  1TK0 A;  5AQK A;  1N32 K;  2NNW A;  4XEI A;  1J6Z A;  2B6A A;  3VEY A;  5EXW A;  2E8A A;  3SZ2 A;  3BEX A;  4H8K A;  4KHQ A;  4IJA A;  3DLE A;  3LAK A;  4AM7 A;  1K9M O;  4NCB A;  1SKR A;  2E6M A;  1Q81 O;  2P9I A;  2PFU A;  3VQ6 A;  3NFA A;  3CJA A;  2O4G A;  4CFD A;  1KFD A;  2E6L A;  4L8R B;  4ELU A;  4GNI A;  3L2Q A;  1YTU A;  1NGD A;  4J2E A;  4NCA A;  2NRW A;  4DTM A;  2A6A A;  3HPH A;  2E1Y A;  5JVH L;  2I7N A;  4CVN E;  1SS6 A;  2HHX A;  5AQW A;  4AH9 A;  4UQG A;  4XH4 A;  3RMD A;  2Z1J A;  1IG8 A;  2RKI A;  3QFP A;  2F9W A;  3V1Q A;  3JYT A;  4DR1 K;  3MN9 A;  3RSE A;  4FZY A;  2V51 B;  5FPD A;  1BIZ A;  1YF5 L;  3K9J A;  1VSM A;  3HVT A;  2P9S A;  1B9F A;  3ZT4 A;  4FLU A;  4CCH A;  4BR4 A;  4U67 L;  1LWE A;  4BRN A;  3LWM A;  4CHP A;  3VA0 A;  4DU1 A;  1RBR A;  1U49 A;  1ASW A;  2GV9 A;  3FZM A;  4CGG A;  3MDQ A;  3TSP A;  1D9D A;  2NZT A;  2H3G X;  4JKG B;  3LP0 A;  5DMR A;  4DV0 K;  4WQ4 C;  2VQE K;  2HF3 A;  1NK4 A;  2D0C A;  1N36 K;  4CIE A;  4M45 A;  3AGK A;  1JXE A;  3K59 A;  3MCA B;  4CJQ A;  1NWK A;  1B9D A;  1YHQ N;  3EY1 A;  2AP1 A;  2OPS A;  1KAX A;  2OA8 A;  4B9U A;  1LOT B;  2I7P A;  3N4P A;  3HJF A;  2LSN A;  4Z4G A;  1D5A A;  1R0A A;  4B9L A;  4KH6 A;  3TAE A;  1SAZ A;  3JAM O;  1QE1 A;  3T7Z A;  3S3N A;  3VTI A;  5F0X A;  4DV2 K;  3TAQ A;  1NGF A;  3HM8 A;  3ZET A;  1OVY A;  3KWG A;  4IDH A;  4OVL A;  1XQS C;  2WC9 A;  4K42 A;  3PO5 A;  1VRT A;  3UKU B;  3AO3 A;  3CC2 N;  5KGW A;  1RT3 A;  3MWT A;  2OTL N;  4CJK A;  5J1E A;  4CZH A;  4JKH A;  4CFA A;  5AJ3 K;  2HBK A;  3MN7 A;  4CZK A;  2WUS A;  4JS5 A;  4GMJ B;  4LF9 K;  5GAG P;  4JKF A;  1C6V A;  3M6G A;  5AQU A;  3VGL A;  1TKD A;  3O3F A;  5AZJ A;  4CGJ A;  1REV A;  3JSM A;  2W41 A;  3RMB A;  4DTO A;  4Z4H A;  2UUA K;  5C24 A;  3PIO L;  3J81 O;  1S72 N;  3V9W A;  4QS7 A;  5C15 A;  4M3R A;  4LFC K;  1T05 A;  4DTS A;  4B9V A;  2D1K A;  4E7I A;  4FJ9 A;  4IBN A;  4YFU A;  1YIJ N;  1JKH A;  1TKT A;  4KV8 A;  1VQ8 N;  2HHU A;  4BRE A;  5HP1 A;  4B1V A;  1IKX A;  3LPU A;  2VCP A;  4GVE A;  5E41 A;  1TGO A;  1KFS A;  3TSQ A;  3C0B A;  1U6Z A;  2A42 A;  3C65 A;  5A2Q O;  2VWJ A;  3WNG A;  1CLQ A;  2QKB A;  3VQ7 A;  4DQS A;  4EFH A;  2F8T A;  4O0J A;  3NGY A;  3L0Q A;  3OYD A;  4E19 A;  4A5A A;  2IAJ A;  1MU2 A;  4DS4 A;  4DTR A;  4AHR A;  1VSD A;  2OCE A;  3T69 A;  3MEG A;  3CC4 N;  4CGI A;  4ISF A;  3AVH A;  4C1N K;  4JNE A;  3WXI A;  3AVC A;  3D6R A;  4BR9 A;  4W5N A;  3L3V A;  4JD2 A;  2UUC K;  1NK8 A;  4Z4F A;  3BF3 A;  4PKI A;  3THW A;  3DLK A;  4OLB A;  4C1N I;  3G10 A;  3DAW A;  4BC2 A;  1TAQ A;  1EQY A;  2ATQ A;  5SWM A;  1W0H A;  3SUO A;  4CF1 A;  4B9Q A;  3L4I A;  3HSC A;  5EOY A;  3BP8 A;  1U48 A;  3VEX A;  4BE0 A;  1KD1 O;  3DLR A;  3SQ0 A;  1DLO A;  2VWB A;  4JYA K;  1NM1 A;  1KC8 O;  4W5Q A;  3ULE B;  3OS2 A;  4F3O A;  2KLA A;  4ISG A;  1U45 A;  3FFI A;  2P9P A;  4H5R A;  4CHY A;  4JKB A;  3KD1 E;  4RW4 A;  3VMF B;  2A41 A;  2IGI A;  2IVO A;  5AQV A;  3SAF A;  5BN8 A;  4BRL A;  3E9O A;  3SJH A;  4BRF A;  1TK5 A;  4NB4 A;  3U9D A;  3SQ2 A;  4O5B A;  2D0P A;  4B8C A;  3A5M C;  4CER A;  1BWF O;  3K5N A;  2P9I B;  5HRS A;  3P5J A;  1IBM K;  3L2U A;  3VEZ A;  3VER A;  1ATR A;  4IEI A;  2DFE A;  3U8X A;  2O8E A;  2DPN A;  1BDG A;  4Z0U A;  4CGH A;  3S5T A;  5KI6 A;  3J7Z O;  4XH5 A;  2CGK A;  1EKE A;  4MDA A;  4GV6 A;  1GLD G;  2WFB A;  1MA9 B;  2GX9 A;  3QIN A;  1S9G A;  1YIT N;  4BC4 A;  2BDP A;  3OYN A;  2FSK A;  1IKV A;  3RSE B;  5FDL A;  1VSH A;  4O8U A;  4DSK A;  3ID6 A;  2GUP A;  4Z4C A;  2P9S B;  1YJ9 N;  4B9T A;  1VSI A;  1RDW X;  2PAV A;  3O9U A;  1K73 O;  2V52 B;  2EX3 A;  3WNE A;  1MWM A;  1NGE A;  5CZ1 A;  3LZI A;  2GWJ A;  3CET A;  4BE7 B;  4Y1C A;  3AAQ A;  4DHY A;  4IEE A;  1BA0 A;  3KK7 A;  2HNY A;  4FLW A;  4H4O A;  1HX1 A;  4B9M A;  4B9S A;  4CK2 A;  4N47 A;  4WE1 A;  3UE5 A;  4CJR A;  1W9H A;  4FJ5 A;  1XWL A;  4FSV A;  1NLV A;  1JLA A;  4K25 A;  3IFR A;  3RTV A;  5AQO A;  3TWH A;  3CCQ N;  4AQY K;  4OPK A;  4KTQ A;  1RNH A;  3AV9 A;  2A1R A;  3NMU A;  4QS8 A;  4YDU C;  2YKN A;  4LSN A;  2OZS A;  3OBW A;  3ZET B;  1RT2 A;  5KPT A;  2FF3 B;  4CJS A;  3AVG A;  4ILG B;  5E84 A;  4M3T A;  2Q97 A;  1JCF A;  3ZT2 A;  1T6D A;  2F8S A;  4JKE A;  3VQE A;  5JLH A;  1CZ9 A;  4JKA A;  3ZX0 A;  2E2Q A;  3HBT A;  4WFB L;  4LF5 K;  2ASO A;  4DTX A;  1WBB A;  3R3L A;  1YI2 N;  2QWP A;  3LP1 A;  3ZX3 A;  4C8K A;  4OKJ A;  5AZJ B;  4DTU A;  1QVG M;  3ZEU A;  4WFN L;  2QWM A;  3O4Q A;  4C8L A;  4DV5 K;  1Q7Y O;  2YHX A;  3RMC A;  5AR0 A;  1GLE G;  3GOI A;  3FGU A;  4XJX A;  2JLE A;  3G4S N;  2E2O A;  4BY9 C;  1JLG A;  3SV4 A;  3VEO A;  1NU0 A;  4A61 A;  4FLZ A;  2XHB A;  2AJQ A;  3OYA A;  4FOI A;  1S1X A;  1SKS A;  2HVH A;  2FLO A;  3CJ1 A;  1RDA A;  3O9S A;  4H0O A;  3SV3 A;  1NMN A;  3H1V X;  1KVB A;  3TR8 A;  3HI0 A;  1L3V A;  3L2R A;  4PUO A;  4CED A;  1WOQ A;  3R6M A;  3HYF A;  1SV5 A;  5JVG L;  1JL1 A;  3P4I A;  5MLC Q;  5JIC A;  5M1N A;  4AHU A;  4CJ5 A;  3CG7 A;  2HVI A;  4CF0 A;  3WXJ A;  4PKH A;  4DTP A;  3K9K A;  1RT7 A;  1VRU A;  4LF7 K;  5B8H A;  3OJS A;  2FBV A;  4UY8 O;  1BQN A;  4RG8 A;  3VN5 A;  2X74 A;  2AA4 A;  2BE2 A;  1LWC A;  5ADX A;  1EX4 A;  3CPE A;  2ASM A;  3M8R A;  2P9L A;  3J7A P;  5D3G A;  4FJI A;  3D7E O;  3G0Z A;  4ZTJ A;  3IRX A;  4M63 C;  1LAW A;  4FW1 A;  3L8B A;  3NVM A;  1IO2 A;  5HOO A;  3W0L A;  4M41 A;  3HPG A;  3PUF A;  2IOC A;  1BHL A;  5DM6 L;  3MX5 A;  1YUW A;  2VG7 A;  1VQM N;  3TAR A;  4JD2 B;  1J54 A;  4CEZ A;  1VSJ A;  2D0A A;  4GY2 B;  3VQD A;  2FBY A;  4KHS A;  3QB0 A;  3THW B;  2QWO A;  3OS1 A;  4OX9 K;  4BQZ A;  4CZI A;  3VF6 A;  4CFC A;  1P90 A;  3UB5 A;  1RTH A;  1T3V A;  2VWK A;  2YNG A;  3I33 A;  3O9T A;  2RE2 A;  1U04 A;  1BOT O;  1IBK K;  1JLC A;  2CH6 A;  4IKF A;  2X6S A;  4NLB A;  1IG9 A;  4TSX A;  3ZSY A;  3FZF A;  2QWL A;  3ZCM A;  5BPN A;  4YOV A;  4HTL A;  1ZC6 A;  5GAE P;  1NJZ A;  2P9P B;  4KRF A;  1VQ7 N;  3MX2 A;  4FLT A;  3THX A;  1K8K A;  3AVB A;  3MWP A;  3MXJ A;  3ENB A;  4HUE A;  3SUN A;  1Q86 O;  3HT3 A;  1K8A O;  1GOA A;  4XIU A;  1A5W A;  4FM2 A;  3ITH A;  2Q0R A;  1NGB A;  1L3S A;  4JI2 K;  4CZG A;  1J5E K;  4ELV A;  4WQ5 C;  3QEP A;  2CGL A;  1NJW A;  3BZC A;  4PKG A;  2O8E B;  1NGG A;  1DEJ A;  1XNQ K;  2O8C A;  1C0T A;  1X3N A;  3AVI A;  5AQY A;  3LAM A;  1LCU A;  4RCH A;  4PHT X;  3HST B;  4E1M A;  1RFQ A;  1VAZ A;  1X1P A;  5AQX A;  1WUA A;  1GLF O;  3AVN A;  5HLF A;  3H08 A;  3RR8 A;  1BIU A;  3DYA A;  4DSE A;  1JCE A;  4B8A B;  1EWQ A;  1CXQ A;  2ZM6 K;  1FJG K;  1T6C A;  1SQK A;  3QET A;  3O80 A;  1WN7 A;  1KVA A;  1YAG A;  1NK5 A;  3OW2 M;  1DT9 A;  5C12 A;  4FJH A;  4E1J A;  3U3Y A;  1WSE A;  3AY9 A;  5J2M A;  3P1G A;  2FBT A;  3BGR A;  4ZTF A;  3SQ1 A;  4C8N A;  4DTJ A;  3SI6 A;  4QAG A;  3AAR A;  2OYQ A;  2JGU A;  4K8X A;  1K6Y A;  4CFB A;  4EAH D;  5T7B A;  4K0K K;  3PX6 A;  3V9S A;  3CQY A;  3NHG A;  2HHS A;  2NRX A;  3CJB A;  3NAE A;  3BF1 A;  3GDQ A;  2E88 A;  4JEP A;  1X9M A;  2CH5 A;  4EIA A;  2YHY A;  3HXM A;  1ESV A;  1JJ2 M;  3VES A;  4GW6 A;  4KRE A;  3CJC A;  4PWD A;  3OYE A;  3EO3 A;  4X62 K;  4CJU A;  5AQS A;  1C1A A;  5JMV A;  4LY7 A;  3AA2 A;  2FBX A;  1E4G T;  1OH8 A;  1RBU A;  2NRR A;  1RBV A;  3OVN A;  2QTD A;  4BRA A;  4OJR A;  4BG8 A;  2VG5 A;  1HKB A;  1RDU A;  3HTV A;  4CHQ A;  2IC3 A;  4J2A A;  2HHH K;  1FK9 A;  1KQS M;  4E72 A;  4CEA A;  3N4Q A;  1T8E A;  1RCH A;  5EVZ A;  1WNS A;  3TTD A;  4B3R K;  2QXL A;  5GAH P;  5HL7 L;  3RMA A;  3EL2 A;  3KJV A;  4CJT A;  3AVF A;  4FCY A;  4KTZ A;  4LH5 A;  3DMJ A;  5AFU H;  3OYL A;  3QO9 A;  2P5G A;  1QSS A;  1KSP A;  5LY3 A;  1NK0 A;  3ZEU B;  4KB1 A;  2HMP A;  1R59 O;  4FJL A;  4A2A A;  4EP5 A;  2IVN A;  4H0Y B;  4Z94 A;  3W3D A;  3ZSW A;  3LPT A;  3EEQ A;  1O1W A;  3AVM A;  5AQG A;  4N41 A;  3A0I X;  5KRT A;  3ZSZ A;  1QHT A;  1NJX A;  4KHW A;  4J8F A;  2D5R A;  5CE3 A;  2WON A;  3HP6 A;  3QBX A;  4CIG A;  3WQT A;  4FWL A;  2X78 A;  1X9J A;  1GLC G;  1HQE A;  5CYM A;  3THV A;  1KXP A;  1BCO A;  3K5L A;  4DR6 K;  5TKW A;  4OGC A;  5LMN K;  1IJJ A;  3MEC A;  1EWR A;  3NF6 A;  3DM2 A;  1T44 A;  1WSH A;  2VYP A;  4JHD A;  3PX0 A;  4BRM A;  2C1I A;  1TYQ A;  2KZM A;  4YOR A;  4DR3 K;  3DJC A;  4BC5 A;  5C0Y A;  4E89 A;  3QNN A;  3AVJ A;  3H45 C;  3RVC A;  3IAY A;  3VQ4 A;  4RWT A;  3TU5 A;  1A5V A;  5KTQ A;  4N56 A;  2P9L B;  3SCX A;  3GBT A;  2UXB K;  1BQM A;  2ZQB A;  3HZ6 A;  5K14 A;  4DV4 K;  3AA3 A;  2QKK A;  4IO8 A;  5DM7 L;  1W7A A;  3V1O A;  4F8R A;  3E9P A;  3LDO A;  4CBU A;  1RGI A;  3TTF A;  2PYL A;  4KO0 A;  3AVA A;  4DLE A;  3THY A;  4KHY A;  3L3U A;  3VQB A;  4FZX C;  1TKX A;  1HR0 K;  3VQQ A;  2X6N A;  1FKP A;  4IWV A;  1S1T A;  4DMN A;  3L2W A;  3K0S A;  2YHA A;  4CW7 B;  3U3G A;  4CEB A;  1VQO N;  1JLB A;  1ZYQ A;  1HNV A;  3AAP A;  1Q82 O;  4IJN A;  4FWS A;  1J5O A;  1I39 A;  4B1U B;  5AQR A;  3HM9 A;  5FPM A;  4AF1 A;  4DU3 A;  4IFE A;  2ITM A;  4CD3 A;  3G71 N;  1VHX A;  4BGA A;  3SLC A;  2YX6 A;  3E66 A;  2P9U A;  4BVP A;  3F9M A;  2BGG A;  3LDS A;  2BTF A;  2YKM A;  3QIC A;  1Z26 A;  4G1Q A;  3CCU N;  1NBW A;  3THX B;  1ASV A;  2A1S A;  3KZB A;  3O4N A;  1K8K B;  4H4M A;  5BRD A;  4CZM A;  1C0U A;  2FSJ A;  2Q36 A;  3WNH A;  4DSL A;  4RW8 A;  1TV6 A;  1LW0 A;  4B3O A;  1S1U A;  4CEC A;  3MCP A;  4M7Y A;  1HYS A;  3NCI A;  2G8F A;  1EXQ A;  2NUB A;  5AQI A;  4CJ4 A;  5F2R A;  3EN9 A;  3VOV A;  4FJX A;  1SKW A;  3IMX A;  4WFA L;  4BRD A;  2O8C B;  1YXQ A;  3FZL A;  2UXD K;  2HHV A;  3FLC O;  4JV5 K;  3FZK A;  2E2P A;  3FFK B;  5EU7 A;  1BCM A;  4GVM A;  3WXK A;  4DKW A;  4N76 A;  4M3Z A;  4DLG A;  3TAN A;  1RIL A;  4FPA A;  2RPI A;  1QSY A;  3A2F A;  3EKS A;  2A40 A;  3KLI A;  4H0V B;  5I42 A;  2G8V A;  1HRH A;  3ZX2 A;  3ENH A;  3O8M A;  3PY8 A;  3R1X A;  1NKB A;  4ILH A;  4FJN A;  4H5V A;  2P1J A;  3VQ9 A;  4DFK A;  3MXI A;  4FLV A;  2YNH A;  5HRP A;  2UUB K;  2KW4 A;  2NLX A;  3NF8 A;  5SZT A;  4CJ7 A;  1VQK N;  3SJJ A;  4O55 A;  4E7J A;  1VQ9 N;  4FM1 A;  3M5R A;  3VGM A;  2YJF A;  2D0O A;  1E4F T;  1HNW K;  1TL3 A;  2E2N A;  3ASM A;  3KK2 A;  4YOT A;  4R5P A;  1FKO A;  3ENO A;  4JK8 A;  1Q8I A;  4MO5 A;  2YCH A;  3NDK A;  2EHG A;  4DB3 A;  4JI0 K;  3NH1 A;  4EHT A;  4CD1 A;  4OPH A;  3P31 A;  3OYJ A;  4BR2 A;  1GLJ O;  4KAZ A;  3KK1 A;  4BRH A;  5KRS A;  3ATV A;  3MN5 A;  4JKC A;  3IUC A;  3RRH A;  1TAU A;  3SYZ A;  3VF2 A;  3KHY A;  1H1V A;  1NGH A;  4K43 A;  2B4J A;  1GLB G;  2P5O A;  4MO4 A;  2Q3S A;  2ZJP L;  2F96 A;  3RR7 A;  2ZE2 A;  4LFA K;  3D45 A;  5AQQ A;  4IO9 L;  3KIO A;  3B6O A;  3QER A;  4B9N A;  4HHT A;  1KAZ A;  1QS4 A;  4NYF A;  1DTQ A;  3GG4 A;  2HB5 A;  1I3A A;  4O44 A;  3VET A;  4FO0 A;  1LW2 A;  5M1K A;  4M42 A;  4K41 A;  4BRC A;  1C1C A;  4CJ3 A;  4DU4 A;  3DI6 A;  4LD0 A;  4B1Y B;  2QWR A;  4E7H A;  1VSF A;  2QWN A;  4OKK A;  2FF6 A;  2HBM A;  4A2B A;  3DLG A;  3ZSO A;  3I56 N;  5JS1 A;  1X9W A;  3VA3 A;  3OHR A;  3MMV A;  4JI3 K;  1V4S A;  1QZ5 A;  5HBM A;  1RT1 A;  4RW7 A;  3D2E A;  4DUY K;  2OPR A;  2VGM A;  3AO2 A;  2E4L A;  2HND A;  2BUP A;  3UKR A;  1BG3 A;  1S6Q A;  2Z1G A;  4PL7 A;  4DUZ K;  2PZS A;  3MN6 A;  2D0B A;  3D0P A;  4DR4 K;  3F73 A;  2YNF A;  4Y0W A;  3CCR N;  4X65 K;  2YHB A;  4JHD B;  5BR9 A;  1TYQ B;  1NGI A;  4FZZ A;  4F3T A;  4NYN A;  4NXN K;  4IDK A;  4B08 A;  4H0P A;  1FW6 A;  4W5R A;  2KZZ A;  4FVU A;  4YDU A;  4YOY A;  3H3N O;  3OYH A;  2HNZ A;  1HNZ K;  1Q9X A;  4C8O A;  3P38 A;  4M3W A;  4FWM A;  3NF9 A;  3SPY A;  4LF6 K;  4FK2 A;  3LP2 A;  3AO5 A;  4FJ7 A;  2ZJQ L;  4DV1 K;  2IVP A;  4J2D A;  4CK3 A;  4HCC A;  3DRP A;  1HUX A;  2IDO A;  3AGR A;  1M90 O;  3DLB A;  4IFV A;  1WLJ A;  3THY B;  4CJW A;  2HHW A;  3DRS A;  4R79 A;  2W42 A;  3QML A;  3F9K A;  1N34 K;  1XI1 A;  3VQP A;  2OZM A;  4BRK A;  5GAD P;  1ZBI A;  3DLL L;  1L5U A;  2HOE A;  2FXU A;  3AO1 A;  1RDD A;  5FRM A;  2FC0 A;  5C10 A;  3VQC A;  4FWK A;  1EO1 A;  1LWF A;  2E20 A;  3H3O B;  2JWL A;  1TKZ A;  5FPE A;  3EZ5 A;  4FLY A;  3DXK A;  2RF2 A;  1Z6R A;  3B6P A;  3SMS A;  1A5X A;  4FM0 A;  1NGC A;  1RBT A;  4K8Z A;  3OYI A;  2E1Z A;  2P9U B;  2WOM A;  3HPO A;  5AQP A;  3TAG A;  1Z05 A;  3SBT A;  4FVM A;  3U9Z A;  3NGZ A;  2RHK A;  1VSK A;  3KK3 A;  4H5T A;  1NK6 A;  4EHU A;  4JI7 K;  1ZBH A;  4PA1 A;  5BPM A;  2ETJ A;  2YJE A;  4MDB A;  1VQ4 N;  3T1Y K;  1S22 A;  3O9R A;  4DV7 K;  3C95 A;  4KB0 A;  3T1H K;  3HO1 A;  5IWA K;  3T3F A;  2F4V K;  3F2K A;  2NRV A;  1UA0 A;  3ZSX A;  5M1Q A;  4F4K A;  3F5T A;  2QK9 A;  3KLE A;  3K57 A;  5J2N A;  2Y1I A;  1VK0 A;  3A5O C;  3SBG A;  1VQN N;  2PY5 A;  3QEW A;  4DSI A;  2KKZ A;  2QWQ A;  3RRG A;  1QHA A;  1XHX A;  1OH5 A;  3LDL A;  4OPA A;  5CZ2 A;  3MXM A;  1VQ5 N;  2KFN A;  4FWP A;  2IIR A;  4DCH A;  4FJM A;  4FW2 A;  4O0I A;  2QEX N;  5LMU K;  1JL2 A;  1NKE A;  3CCJ N;  2HHI A;  2FSN A;  4CEO A;  3MED A;  4A62 A;  4CJV A;  3M8Q A;  3CFO A;  2DFF A;  1ZBU A;  2HHT A;  1N33 K;  1S1W A;  4FL9 A;  3C6U A;  3VPZ A;  4A5B A;  1CXU A;  3QBW A;  1SL2 A;  1DGK N;  4Q5V A;  2G8I A;  2V7Y A;  1RTI A;  5JEN A;  4YOX A;  4FJG A;  3K5O A;  4HCB A;  3VGK A;  1WBD A;  4LC9 B;  2Q1N A;  2NRZ A;  4RTF D;  2XRI A;  4HWI A;  3NF7 A;  3O9Q A;  2ITG A;  2CGJ A;  3C7N A;  3H46 O;  3J8A A;  3CME N;  1Z25 A;  4KH5 A;  3V9Z A;  1HPM A;  3A8Y A;  4WQ5 A;  2XO7 A;  3QIP A;  1HNX K;  4JRQ A;  3E01 A;  3HOT A;  3CPW M;  4A59 A;  2C1G A;  3NE6 A;  4DG1 A;  4CZJ A;  2HMI A;  3BZK A;  4KTW A;  4BDY A;  3LZJ A;  4ILJ A;  4RW9 A;  5AQH A;  4MFB A;  3OYF A;  3CMA N;  2OAN A;  3DLH A;  1J9A A;  1RBS A;  4H03 B;  2OTJ N;  4IG0 A;  3JXU A;  1WSI A;  1Q18 A;  3KKS A;  3FE1 A;  4ISE A;  2W6L A;  3PX4 A;  1TUY A;  5C25 A;  4CHN A;  4E7L A;  2D4W A;  1ZBF A;  1RTD A;  4BG9 A;  4IOC L;  3PSF A;  2UXC K;  3OYC A;  3OYG A;  4DFM A;  3U4L A;  3T19 A;  3O1W A;  4MLE A;  5JS2 A;  3GL1 A;  3V1R A;  3LAN A;  3D2E B;  3ZLJ A;  4KBO A;  2O8B A;  3VF4 A;  3SNN A;  5AZI A;  4OO1 J;  4HUG A;  4M3Y A;  5AQM A;  4DTN A;  1T7P A;  1S3X A;  1VSE A;  3SAH A;  5BRE A;  3KWI A;  3S9H A;  3UKR B;  4EZ6 A;  4G9Z A;  4O4G A;  3SPZ A;  1KLN A;  5AQJ A;  3ULD A;  3OY9 A;  2KFZ A;  2QM1 A;  5CHI A;  2PYJ A;  4CEQ A;  3V4I A;  4DR5 K;  1NGA A;  4ID5 A;  4CJF A;  4JI5 K;  4OLA A;  3V6D A;  5FLX O;  4QS9 A;  4OGE A;  4FJJ A;  1NG9 A;  4I9L A;  1XHZ A;  2HW3 A;  3CM5 A;  2GBZ A;  1FXX A;  2ZGZ A;  2IS3 A;  3AO4 A;  3O5B A;  1GOC A;  4I9Q A;  2HBL A;  1BA1 A;  1I94 K;  4BEC A;  1QQO A;  2P9N A;  2YV0 X;  1ASU A;  1SZ2 A;  4YOU A;  1J53 A;  1NOY A;  3I8B A;  3C6H A;  3O3H A;  1O13 A;  2OPQ A;  4GV3 A;  4AHC A;  2XY6 A;  1XUP O;  4WYB A;  1NNE A;  4FYD A;  2E5L K;  1G15 A;  3QNO A;  4CEE A;  4M3X A;  3NBP A;  2VG6 A;  4PY5 A;  2VGN A;  1DKG D;  4ZHR A;  4W5T A;  1VQL N;  3K58 A;  4CHZ A;  3CCM N;  3HL8 A;  1BU6 O;  4YHH K;  1C0M A;  4L3Q A;  3CCE N;  3LDQ A;  1E3M A;  1UAX A;  4CZL A;  3HVR A;  1NKC A;  1CZA N;  4FK0 A;  4WQ4 A;  3DXK B;  4EP4 A;  1QQN A;  4YY3 K;  2GTD A;  3H6E A;  5LL6 Z;  3MK6 A;  1RDC A;  4M3U A;  1VQ6 N;  3QEI A;  3NH0 A;  1ZXO A;  3WT0 A;  4CGD A;  1UWB A;  4CF2 A;  4JRP A;  5BPL A;  2DTU A;  2I5J A;  4LF4 K;  3VQ5 A;  2O8F A;  1HMV A;  1JCG A;  3L6Q A;  1SL1 A;  3S3O A;  3PIP L;  3ATU A;  3A5L C;  4YNQ A;  3CQ8 A;  5M1O A;  1SL0 A;  5JLF A;  4NXM K;  4ICL A;  4F2R A;  5GIN A;  3FZH A;  1RT6 A;  4KFB A;  3TTC A;  3HRG A;  4HTU A;  3BUZ B;  3DXM A;  1NJY A;  3KVG A;  3LM2 A;  1JXB A;  1NGJ A;  1QQM A;  4W5O A;  3TAF A;  2ZJR L;  1TUU A;  1QZ6 A;  3CJ9 A;  4A57 A;  3U6F A;  2DFH A;  2ZF5 O;  1XC9 A;  1N5Y A;  5ADX H;  3L2V A;  1QTM A;  3I8D A;  5I3U A;  5IT9 O;  1LAV A;  2ZGY A;  2Y1J A;  4H0X B;  4CJL A;  1GLA G;  1DTT A;  4ELT A;  3KLH A;  4CJP A;  3CI5 A;  1WAF A;  4H5N A;  4BE1 A;  4LFB K;  1ITG A;  3ISN C;  4GKJ K;  1N6Q A;  3WNF A;  4CF8 A;  4CI6 A;  1Q9Y A;  5M1F A;  3PV8 A;  2DY4 A;  4I2P A;  4AHS A;  3KTQ A;  2YNI A;  4CZF A;  4KHU A;  3WUH A;  4RW6 A;  1P8Z A;  1HKG A;  2ASP A;  3CQX A;  1Y64 A;  3M3Z A;  5CR4 A;  1HYV A;  3C7N B;  3I0S A;  3BY5 A;  4PQU A;  3M8P A;  4DQQ A;  2W40 A;  3TPQ A;  4JAX A;  1WB9 A;  5C2D A;  2HHQ A;  1BI4 A;  4BR5 A;  1QVF M;  1TVR A;  3TI0 A;  1HJO A;  2W6K A;  1V4T A;  3KLG A;  3M8S A;  1XMQ K;  4FOE A;  3ZSV A;  5F1X A;  1S6P A;  4HVJ A;  3Q7B A;  4CZE A;  4IXC A;  3SMP A;  2W00 A;  4WF9 L;  4CIF A;  1D9F A;  3PO4 A;  4Z4I A;  5FPN A;  4E0D A;  4BRI A;  3EZW A;  1M1K O;  4CES A;  1UOC A;  1HPZ A;  5AQZ A;  1C1B A;  3O08 A;  3QES A;  3ZYY X;  4FWQ A;  2R7Y A;  4BWJ A;  3UIQ A;  4IG3 A;  3SUQ A;  2O8D A;  2O8B B;  3ID8 A;  5AZI B;  4DSJ A;  5AQL A;  1QQC A;  1XMO K;  3TAP A;  4JS4 A;  4I6M A;  4FLX A;  4F2S A;  3CM6 A;  3EKU A;  2XY8 A;  1U2V A;  3C94 A;  2WTU A;  3MAQ A;  4DQP A;  4DWI A;  4GV9 A;  4JLH A;  3FR0 A;  2A3Z A;  4AIL C;  4JK7 A;  1B92 A;  2OPP A;  4FJ8 A;  3NVK A;  1D4X A;  1RT5 A;  1G99 A;  5KQ8 A;  3NH2 A;  4DF8 A;  3WEE A;  4CJE A;  3R9P A;  4PL8 A;  1HKC A;  4E1N A;  3LP3 A;  1D8Y A;  4BC3 A;  3HP9 A;  2P9N B;  4JKD A;  4OKE A;  1Y97 A;  3DWL A;  1T03 A;  1IV0 A;  5AQF A;  3IG1 A;  3P39 A;  4XH1 A;  2Z1I A;  5DK5 A;  1N8R O;  1W2B M;  1MWK A;  1BIS A;  3ZSQ A;  3OYM A;  1C0G A;  3C6A A;  1EP4 A;  1HQU A;  4FJK A;  4DR2 K;  1RDB A;  1WSF A;  4BE2 A;  2F9T A;  1BO5 O;  4JI8 K;  3J80 O;  5BRH A;  1U4B A;  2HBJ A;  2P9K A;  4MLH A;  4FWN A;  1EET A;  1L3U A;  4KHN A;  1F21 A;  3LM9 A;  3K2P A;  2VQF K;  4JK9 A;  3A5N C;  3H1Q A;  3Q7C A;  1HNI A;  3I0R A;  1KRP A;  3E1Y A;  4DFJ A;  1RTJ A;  3VEN A;  3NGI A;  3D2F A;  4Y1D A;  4CF9 A;  4ID1 A;  5E26 A;  3VQA A;  3OJU A;  3QFU A;  3TAB A;  1VQP N;  3OTO K;  2BAN A;  5TKY A;  3EE9 A;  2G8U A;  3OYB A;  3SK3 A;  4NO7 A;  1U47 A;  4BWM A;  1OVQ A;  3TSU A;  5KGX A;  1XNR K;  4BRG A;  4CBX A;  5KQD A;  1TK8 A;  3DOL A;  5J2P A;  1KAY A;  3CHW A;  5EY4 A;  2O8F B;  4AHT A;  5M1P A;  3IDH A;  2QA4 N;  3E9L A;  1YJW N;  4FXD A;  5AFU A;  4QOZ B;  1L3T A;  3ZT0 A;  1VSL A;  2P51 A;  1KTQ A;  4OPJ A;  1HYZ A;  4CHO A;  2HST A;  4IOX A;  3SAG A;  5LJV A;  4I2Q A;  3QIO A;  3OA9 A;  3KD5 E; 
#chains in the Genus database with same CATH homology
 3BF3 A;  4HWI A;  3O9Q A;  4PKI A;  4BGB A;  3DXM B;  4C1N I;  2CGJ A;  3DAW A;  4BC2 A;  1KXP A;  3C7N A;  1EQY A;  3H46 O;  3J8A A;  5TKW A;  5GIO A;  3CME N;  4KH5 A;  4B9Q A;  3L4I A;  3HSC A;  1HPM A;  1IJJ A;  3A8Y A;  4WQ5 A;  5EOY A;  3BP8 A;  3HOT A;  1MDU B;  2JWK A;  5LJW A;  4A59 A;  3CPW M;  3O6W A;  1T44 A;  2C1G A;  3VEX A;  3B8A X;  1KD1 O;  3QDK A;  2VYP A;  4JHD A;  4CZJ A;  4BRM A;  1ATN A;  2UYT A;  4AM6 A;  2C1I A;  2VWB A;  1HLU A;  1TYQ A;  2QI2 A;  4B1W B;  1NM1 A;  4YOR A;  4ILJ A;  5AQH A;  1KC8 O;  4FWR A;  3ULE B;  3DJC A;  2KLA A;  4BC5 A;  4ISG A;  5C0Y A;  4O5F A;  3CMA N;  2OAN A;  4BVO A;  3H45 C;  3LL3 A;  2P9P A;  3RVC A;  4RWT A;  3TU5 A;  4H5R A;  4H03 B;  2OTJ N;  1NJI O;  3JXU A;  4JKB A;  4BQL A;  1Q18 A;  3FE1 A;  4ISE A;  2P9L B;  3VMF B;  5C2F A;  3GBT A;  1TUY A;  2A41 A;  2IVO A;  5AQV A;  3SAF A;  5BN8 A;  3HZ6 A;  3E9O A;  3SJH A;  2D4W A;  2PBD A;  4BR7 A;  4BRF A;  4BRL A;  4IOA L;  3CCV N;  4BG9 A;  4IOC L;  4IO8 A;  4NB4 A;  3U9D A;  5DM7 L;  4JKG A;  3U4L A;  2D0P A;  3E9P A;  3LDO A;  3O1W A;  4CBU A;  1RGI A;  4MLE A;  3A5M C;  1BUP A;  3PLA A;  3TTF A;  3GL1 A;  1BWF O;  4H5W A;  3D2E B;  4KBO A;  4BR0 A;  3VF4 A;  4CBW A;  2P9I B;  5AZI A;  1C0F A;  4OO1 J;  4H0T B;  1XC3 A;  1YVN A;  3CF5 L;  3VEZ A;  5AQM A;  3VER A;  2YHW A;  4NLC A;  1S3X A;  3SAH A;  1ATR A;  4IEI A;  3U8X A;  5BRE A;  2DPN A;  3KWI A;  4BEB A;  3UKR B;  1BDG A;  2KHO A;  2WBN A;  4G9Z A;  5AQJ A;  2QM1 A;  3O4W A;  5CHI A;  3J7Z O;  4XH5 A;  1ILY A;  4KH4 A;  2CGK A;  4IWV A;  4MDA A;  4GV6 A;  1NGA A;  4C23 A;  1GLD G;  2WFB A;  5ELZ A;  4QS9 A;  1MA9 B;  1VQO N;  2GX9 A;  3AAP A;  1YIT N;  1Q82 O;  4IJN A;  4FWS A;  4BC4 A;  4B1U B;  2FSK A;  2GWK A;  3CER A;  5AQR A;  5BN9 A;  3RSE B;  3EE8 A;  5FPM A;  3UKU A;  4O8U A;  3ID6 A;  4AF1 A;  2GUP A;  4IFE A;  4O8K A;  2ITM A;  4CD3 A;  3G71 N;  2ZGZ A;  4BGA A;  2P9S B;  3SLC A;  1YJ9 N;  2YX6 A;  3E66 A;  2P9U A;  4BVP A;  3CCS N;  2Q31 A;  3F9M A;  3O5B A;  1RDW X;  5EX5 A;  2BTF A;  3LDN A;  4B1Z A;  2PAV A;  3L4Q A;  3O9U A;  3QIC A;  2HBL A;  1NBW A;  1BA1 A;  3IKM A;  2V52 B;  3CCU N;  3KZB A;  1K73 O;  1K8K B;  4BEC A;  1QQO A;  1MWM A;  2P9N A;  1NGE A;  3WXL A;  1SZ2 A;  2GWJ A;  3CET A;  4YOU A;  4BE7 B;  3GE1 A;  5BRD A;  3AAQ A;  1NMD A;  3CC7 N;  4DHY A;  4IEE A;  4CZM A;  5BRF A;  2FSJ A;  2Q36 A;  3C6H A;  3I8B A;  5I9E B;  1BA0 A;  3KK7 A;  1O13 A;  1HX1 A;  3MCP A;  1OKJ A;  4M7Y A;  4WCE L;  4GV3 A;  3UE5 A;  5AQI A;  5F2R A;  3CJ7 A;  3EN9 A;  3VOV A;  3HOS A;  1XUP O;  4WYB A;  4FSV A;  3VEW A;  4I6M B;  3IMX A;  1NLV A;  4WFA L;  2J4R A;  4BRD A;  4K25 A;  3IFR A;  4BRP A;  1YXQ A;  5AQO A;  2F7T A;  3FZL A;  3CCQ N;  5AQN A;  3FLC O;  1U2V B;  2GEL A;  2VGN A;  2NRH A;  2GEM A;  1DKG D;  3FZK A;  1VQL N;  2E2P A;  2NRT A;  3O1B A;  3FFK B;  3WXK A;  3CCM N;  3NMU A;  4DKW A;  1BU6 O;  4QS8 A;  4L3Q A;  4YDU C;  3CCE N;  3LDQ A;  4CZL A;  4FPA A;  3EKS A;  2ZWH A;  2A40 A;  4H0V B;  3OBW A;  3ZET B;  1CZA N;  3ENH A;  3O8M A;  2FF3 B;  4IZ9 A;  1X3M A;  3ZX2 A;  5KPT A;  3R1X A;  3VEV A;  4WQ4 A;  3DXK B;  4ILG B;  5E84 A;  2Q97 A;  1JCF A;  4ILH A;  2HF4 A;  1QQN A;  4H5V A;  1T6D A;  2EWS A;  2GTD A;  3WEE B;  2YI1 A;  3H6E A;  4JKE A;  5JLH A;  3WXM B;  4JKA A;  3CCL N;  3ZX0 A;  3MK6 A;  1ZBS A;  2E2Q A;  3HBT A;  4WFB L;  2ASO A;  3CD6 N;  3R8E A;  2NLX A;  3R3L A;  4CJ7 A;  4FPB A;  5GIP A;  1YI2 N;  1VQK N;  2QWP A;  1VQ9 N;  1VQ6 N;  3M5R A;  3VGM A;  2YJF A;  2D0O A;  5AQT A;  1ZXO A;  3WT0 A;  3CXC M;  2A5X A;  1E4F T;  3ZX3 A;  2E2N A;  1QVG M;  5AZJ B;  3ZEU A;  5BPL A;  4YOT A;  4WFN L;  3ENO A;  2QWM A;  4JK8 A;  1JCG A;  2Q2R A;  2YCH A;  3L6Q A;  4MO5 A;  5KPR A;  2YHX A;  1Q7Y O;  4M7X A;  4DB3 A;  3PIP L;  1YJN N;  4BRO A;  3ATU A;  3A5L C;  5AR0 A;  1GLE G;  4CD1 A;  3GOI A;  3VTH A;  3FGU A;  4EHT A;  4OPH A;  5M1O A;  4XJX A;  3JS6 A;  5JLF A;  3P31 A;  3G4S N;  3G25 A;  4BR2 A;  3WQU A;  1GLJ O;  3G6E N;  2E2O A;  4BRH A;  4JN4 A;  4BRQ A;  5GIN A;  5H1S Q;  3ATV A;  4BY9 C;  3MN5 A;  3FZH A;  3VEO A;  4JKC A;  2BH1 A;  2P9K B;  3IUC A;  4A61 A;  4FOI A;  4DQ8 A;  3TTC A;  1W97 L;  3HRG A;  3BUZ B;  2FLO A;  3CJ1 A;  3DXM A;  3OBY A;  2Q0U A;  3O9S A;  4H0O A;  3VF2 A;  3KHY A;  3KVG A;  1H1V A;  1NGH A;  3H1V X;  3LM2 A;  1GLB G;  4K43 A;  4MO4 A;  1NGJ A;  1QQM A;  3HI0 A;  2ZJR L;  3D2F B;  3CIP A;  2ZJP L;  1TUU A;  1WOQ A;  3M1F A;  4F9O A;  3R6M A;  1QZ6 A;  1GLL O;  3CJ9 A;  4A57 A;  2ZF5 O;  5JVG L;  5AQQ A;  3I55 N;  3P4I A;  5MLC Q;  2V7Z A;  5JIC A;  5ADX H;  5M1N A;  4IO9 L;  3LDP A;  4U7B A;  1KAZ A;  3WXJ A;  4PKH A;  3K9K A;  3S41 A;  3ULE A;  5B8H A;  3GG4 A;  4B1X B;  4UY8 O;  3VET A;  4FWO A;  4FO0 A;  4YOW A;  2ZGY A;  5M1K A;  2AA4 A;  4K41 A;  4H0X B;  5KPZ A;  4BRC A;  1GLA G;  4B1Y B;  5ADX A;  1ATS A;  2QW9 A;  3CPE A;  2QWR A;  2ASM A;  5AQK A;  2NNW A;  2P9L A;  2QWN A;  3CI5 A;  4XEI A;  1J6Z A;  3VEY A;  3D7E O;  2FF6 A;  2HBM A;  5EXW A;  4A2B A;  2E8A A;  3I56 N;  3BEX A;  4H5N A;  4M63 C;  3OHR A;  4IJA A;  3MMV A;  3NVM A;  5HOO A;  3W0L A;  1V4S A;  1QZ5 A;  4CI6 A;  4AM7 A;  5M1F A;  4FWL A;  1K9M O;  3D2E A;  5DM6 L;  3MX5 A;  1YUW A;  1Q81 O;  1VQM N;  2P9I A;  2PFU A;  2VGM A;  4CZF A;  4JD2 B;  3CJA A;  4GY2 B;  3WUH A;  1P8Z A;  4GNI A;  3QB0 A;  1HKG A;  1NGD A;  2ASP A;  1Y64 A;  2BUP A;  2NRW A;  3CQX A;  3M3Z A;  3UKR A;  2QWO A;  5CR4 A;  1BG3 A;  3C7N B;  2A6A A;  4PL7 A;  4BQZ A;  2E1Y A;  3MN6 A;  3VF6 A;  4CZI A;  1P90 A;  2W40 A;  3TPQ A;  3UB5 A;  5JVH L;  4JAX A;  5C2D A;  2I7N A;  1SS6 A;  1T3V A;  3O9T A;  3I33 A;  5AQW A;  2RE2 A;  4Y0W A;  4BR5 A;  1BOT O;  3CCR N;  2CH6 A;  4JHD B;  4XH4 A;  1QVF M;  4NLB A;  5BR9 A;  3FZF A;  1HJO A;  1IG8 A;  1NGI A;  1TYQ B;  1V4T A;  2QWL A;  3QFP A;  2F9W A;  5BPN A;  4YOV A;  3MN9 A;  3RSE A;  4HTL A;  2V51 B;  4FOE A;  4H0P A;  1ZC6 A;  5GAE P;  5FPD A;  1YF5 L;  3K9J A;  5F1X A;  3Q7B A;  2P9S A;  2P9P B;  4CZE A;  4IXC A;  3SMP A;  4YDU A;  4FVU A;  4YOY A;  3H3N O;  1VQ7 N;  2W00 A;  3MX2 A;  4WF9 L;  4BR4 A;  4U67 L;  1K8K A;  4BRN A;  3P38 A;  5FPN A;  3MWP A;  4BRI A;  4FWM A;  3ENB A;  3EZW A;  1M1K O;  2ZJQ L;  2IVP A;  1Q86 O;  5AQZ A;  1K8A O;  3FZM A;  3O08 A;  3MDQ A;  3TSP A;  1HUX A;  3AGR A;  2NZT A;  1M90 O;  2Q0R A;  2H3G X;  1NGB A;  4JKG B;  4FWQ A;  3ZYY X;  4WQ4 C;  2HF3 A;  4CZG A;  4WQ5 C;  3AGK A;  3ID8 A;  5AZI B;  2CGL A;  5AQL A;  4R79 A;  3QML A;  3MCA B;  1NWK A;  4BRK A;  4PKG A;  4I6M A;  1NGG A;  1YHQ N;  1DEJ A;  5GAD P;  2AP1 A;  3DLL L;  1KAX A;  1X3N A;  2HOE A;  2FXU A;  3EKU A;  5AQY A;  1LCU A;  1LOT B;  2I7P A;  1U2V A;  3N4P A;  4RCH A;  4PHT X;  1RFQ A;  1VAZ A;  5AQX A;  4KH6 A;  4GV9 A;  1SAZ A;  1WUA A;  1GLF O;  5C10 A;  3T7Z A;  3VTI A;  3FR0 A;  2A3Z A;  5F0X A;  1NGF A;  1JCE A;  4FWK A;  4JK7 A;  3HM8 A;  3ZET A;  1EO1 A;  1OVY A;  2E20 A;  3NVK A;  1T6C A;  1D4X A;  3H3O B;  2JWL A;  1SQK A;  1XQS C;  2WC9 A;  3KWG A;  4IDH A;  4K42 A;  5FPE A;  1G99 A;  3O80 A;  3UKU B;  3DXK A;  5KQ8 A;  1YAG A;  3CC2 N;  1Z6R A;  3MWT A;  3SMS A;  1NGC A;  3WEE A;  2OTL N;  2E1Z A;  2P9U B;  3R9P A;  1DT9 A;  4PL8 A;  5C12 A;  3OW2 M;  1HKC A;  4E1J A;  4CZH A;  5AQP A;  4JKH A;  1Z05 A;  3AY9 A;  2HBK A;  3SBT A;  4BC3 A;  3MN7 A;  2P9N B;  4JKD A;  3U9Z A;  2WUS A;  4CZK A;  2RHK A;  5GAG P;  4JKF A;  4H5T A;  3DWL A;  3AAR A;  3M6G A;  5AQF A;  4EHU A;  3P39 A;  4XH1 A;  5AQU A;  3VGL A;  5BPM A;  1N8R O;  2YJE A;  1W2B M;  4EAH D;  1MWK A;  4MDB A;  5AZJ A;  1VQ4 N;  1S22 A;  3O9R A;  1C0G A;  2W41 A;  3C6A A;  3CQY A;  2NRX A;  3CJB A;  3BF1 A;  3PIO L;  1S72 N;  3GDQ A;  2E88 A;  4JEP A;  4QS7 A;  3F2K A;  2CH5 A;  4EIA A;  2F9T A;  5C15 A;  2NRV A;  2YHY A;  1ESV A;  1BO5 O;  1JJ2 M;  5M1Q A;  3VES A;  3F5T A;  5BRH A;  3CJC A;  2HBJ A;  2P9K A;  4MLH A;  4FWN A;  3A5O C;  2D1K A;  3EO3 A;  3LM9 A;  3SBG A;  1VQN N;  2KKZ A;  2QWQ A;  5AQS A;  5JMV A;  1QHA A;  3A5N C;  3H1Q A;  3LDL A;  4JK9 A;  3Q7C A;  1E4G T;  1YIJ N;  3E1Y A;  3VEN A;  2NRR A;  3D2F A;  4OPA A;  5E26 A;  2QTD A;  1VQ8 N;  1VQ5 N;  3QFU A;  4BRA A;  4FWP A;  2IIR A;  4DCH A;  4BG8 A;  1VQP N;  1HKB A;  1RDU A;  3HTV A;  4BRE A;  4B1V A;  2QEX N;  5TKY A;  2VCP A;  4GVE A;  3CCJ N;  1KQS M;  3EE9 A;  3N4Q A;  3TSQ A;  2FSN A;  5EVZ A;  3C0B A;  3SK3 A;  3TTD A;  1U6Z A;  2A42 A;  2QXL A;  4NO7 A;  3C65 A;  4A62 A;  5GAH P;  5HL7 L;  3EL2 A;  3TSU A;  5AFU H;  4EFH A;  4BRG A;  5LY3 A;  4CBX A;  3L0Q A;  3ZEU B;  2HMP A;  5KQD A;  4FL9 A;  1R59 O;  4A5A A;  4A2A A;  1KAY A;  3CHW A;  3VPZ A;  5EY4 A;  2IVN A;  4A5B A;  4H0Y B;  4Z94 A;  5M1P A;  3T69 A;  3QBW A;  3W3D A;  1DGK N;  3IDH A;  3CC4 N;  2QA4 N;  3E9L A;  4ISF A;  2V7Y A;  1YJW N;  5AQG A;  4YOX A;  5AFU A;  4C1N K;  4JNE A;  3A0I X;  3WXI A;  3VGK A;  4LC9 B;  3D6R A;  2HST A;  4IOX A;  3SAG A;  4BR9 A;  4J8F A;  5LJV A;  2Q1N A;  5CE3 A;  4JD2 A;  2NRZ A;  3OA9 A;  3QBX A;  4RTF D;  3WQT A;  1X9J A;  1GLC G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...