2P9LB

Crystal structure of bovine arp2/3 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
203
structure length
201
Chain Sequence
b'IQAVLTLYAQGLGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 54
structure length 201
sequence length 203
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9lB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9lB02
4IO8A 3W0LA 3H46O 3D2EB 5AFUH 4H03B 3DXKA 3CJAA 3FZHA 5F2RA 4RWTA 4MLEA 3UKRA 4CZEA 4M7XA 5AZJB 3M6GA 2P9UA 2P9UB 3DJCA 2NLXA 3IMXA 2WUSA 3VEVA 2ZF5O 4NO7A 3FZKA 3CI5A 1HLUA 3O80A 1QZ6A 3CJCA 3B8AX 3SMSA 1DGKN 4CZFA 4AM6A 1NWKA 4B9QA 2W41A 2QWOA 4BRCA 5AZIA 3FR0A 4XH1A 5AZIB 3QB0A 3EN9A 1D4XA 2V51B 3LL3A 1E4FT 3R6MA 3OHRA 4FWLA 4H0VB 3SK3A 2QWPA 3AAPA 3DXMB 1NLVA 3GOIA 4JHDA 1RDWX 2P9KA 2P9KB 5BN9A 3IUCA 3HBTA 4MO5A 3ZX0A 2A5XA 2YHWA 3ENHA 2H3GX 4B1WB 4H5VA 2AP1A 3L4IA 5FPNA 3U8XA 3MN5A 3AAQA 2V7YA 4H0XB 3SMPA 3VF6A 2E2NA 3U9DA 1BG3A 2QW9A 3QMLA 3CERA 3GBTA 4BRPA 1K8KB 1V4TA 1JCGA 1OKJA 1KXPA 3WEEA 3WEEB 2VCPA 1R59O 2YHYA 4FOIA 4K43A 3GE1A 1HKCA 1G99A 4BRIA 5KPTA 2FF3B 2P9PB 1HPMA 1Q18A 2F9WA 3U4LA 2Q2RA 3CJ9A 3VESA 1BUPA 1BDGA 4K25A 4CZHA 1NGBA 3VETA 5BPLA 2PAVA 4WQ4C 2A3ZA 3EZWA 3FZFA 4FWMA 4A62A 5AQZA 4CBUA 2QWMA 1GLJO 3GG4A 1WUAA 2A40A 5AQPA 2P9NA 4K42A 4H5NA 4WQ4A 3BF3A 4CZLA 3EO3A 1IG8A 2A41A 2GUPA 1KAYA 3A5OC 4BR2A 3KHYA 1NGJA 4L3QA 4BRHA 2PBDA 3WQUA 2P9IA 2P9IB 4RTFD 1E4GT 3O8MA 5ADXH 1QZ5A 4BQZA 4PL7A 3QDKA 1YVNA 3HSCA 5BN8A 5I9EB 1IJJA 4PKGA 4IZ9A 4XEIA 2HF4A 3UB5A 1DKGD 3JXUA 3ZETB 4QS8A 2Q36A 3A8YA 2HF3A 4CZKA 5EX5A 3CQYA 3MN6A 2ZWHA 4BGBA 4ISFA 3TU5A 2D0OA 2FSJA 3L6QA 1NMDA 1ATRA 3ID8A 4EIAA 4BRQA 3WUHA 3LDPA 2QWNA 3LM9A 5E26A 5AQUA 3D2EA 1J6ZA 1C0GA 2IVOA 4QS7A 2W40A 1LCUA 4BRFA 2YHXA 2Q1NA 3A5MC 2NRHA 3CJ1A 4CZMA 5AZJA 2CGLA 4FWPA 2OANA 4K41A 5AQQA 1BWFO 3VEYA 3A5NC 5AQMA 4FOEA 1HKBA 4AM7A 1SQKA 1NGFA 5TKYA 3H1QA 3P4IA 4XH4A 3GDQA 4B1UB 2EWSA 3G25A 3LDQA 4PL8A 4MLHA 5AQXA 2ZGYA 4BRGA 1LOTB 3O08A 4BC3A 2E88A 1GLBG 1X3NA 4BRNA 1QHAA 4WYBA 1WOQA 5AQTA 4BG8A 4HTLA 5AQVA 3VEXA 1NM1A 4B1YB 2J4RA 3LDNA 4H0YB 3DXMA 5AQLA 4H0PA 3O6WA 1MWMA 4CZJA 3HI0A 4CD3A 3MK6A 4FPAA 1ZXOA 1S22A 4KBOA 1MA9B 4ISEA 4J8FA 3R8EA 1XQSC 2ASPA 1T6CA 3HTVA 1DEJA 1GLDG 5AQSA 5ELZA 3UKUB 5JMVA 5BRHA 5JLHA 4M63C 1TYQB 4O8KA 2E8AA 4B1VA 3FFKB 2CH6A 1BO5O 2KHOA 1K8KA 1NGEA 1KAZA 5E84A 4IJNA 5JLFA 4JD2A 4JD2B 4IXCA 3H45C 2Q0UA 5AR0A 1NGHA 5BRFA 2CH5A 3H3NO 1HKGA 4BC4A 4PKHA 5ADXA 3O1BA 4FWSA 3VGMA 2P9PA 3ATUA 4A61A 5BREA 3WXJA 3ATVA 4M7YA 5F0XA 2BUPA 4DCHA 3WXIA 1T44A 3UE5A 1Z05A 1GLFO 3FZLA 4FO0A 3S41A 1EQYA 3LM2A 4BROA 4CBWA 3ZEUB 3QFPA 2YCHA 3CIPA 1ATNA 3HM8A 2A42A 1U2VB 4BVOA 2DPNA 5AQHA 2V7ZA 2YI1A 4H5WA 5AQYA 3O1WA 3KZBA 4JAXA 4BREA 1NBWA 3H1VX 1JCEA 2Q0RA 4BR9A 3VPZA 4BG9A 4BRMA 2GELA 3BF1A 3CJBA 3CHWA 3VGKA 4CZIA 1MWKA 3H3OB 4FSVA 3VGLA 3MN7A 1KAXA 3ZETA 5KQ8A 3IDHA 5BPNA 4CBXA 4GY2B 3R9PA 1V4SA 3SJHA 5AQKA 3BUZB 4GNIA 3JS6A 1H1VA 3KVGA 2P9LA 2P9LB 3ULEA 3ULEB 4BQLA 5EOYA 4FWOA 1NGIA 3QFUA 4HWIA 3TPQA 1GLEG 1MDUB 3RSEB 1JCFA 3EKSA 3FE1A 3DWLA 4A2AA 1BA0A 3BP8A 4WQ5C 5FPMA 2ZGZA 4MO4A 1U6ZA 5AQOA 2D0PA 4E1JA 2GTDA 3D2FB 3D2FA 4IJAA 4BVPA 3WXKA 4WQ5A 4JN4A 5KPRA 1HX1A 2P9SB 5BPMA 1P8ZA 1ESVA 5B8HA 2IVNA 4PKIA 3SLCA 1RFQA 1SZ2A 2F9TA 2YJFA 2HOEA 4BR4A 4FPBA 3MMVA 3DXKB 4FL9A 4H0OA 1BOTO 4BRLA 2FLOA 3UKRB 4CJ7A 5LY3A 1HUXA 4CI6A 4XH5A 5BR9A 4YDUC 5JICA 4BRDA 4ISGA 3H6EA 3A5LC 2BTFA 4EHUA 3HZ6A 1SAZA 2E1ZA 3VEZA 3DAWA 4YDUA 3QBXA 3QBWA 1XUPO 4EAHD 5AQNA 3VENA 2E2QA 2YJEA 3QICA 1ZC6A 1YUWA 1RGIA 3O5BA 3C7NA 3C7NB 3M1FA 4H5RA 5EXWA 2D1KA 5AQRA 1TUUA 3VF4A 3UKUA 4LC9B 3LDLA 3MN9A 3WQTA 5EY4A 1TYQA 4NB4A 2GWJA 1BA1A 1HJOA 4JNEA 5AQGA 3WXLA 2FSNA 5KQDA 3VOVA 1X3MA 4Y0WA 3C0BA 4JHDB 4F9OA 3L0QA 4BGAA 2QWLA 5EVZA 1BU6O 1C0FA 3VF2A 3WT0A 2V52B 2AA4A 2E2OA 3MDQA 5AQJA 4I6MA 4I6MB 4C23A 4BRAA 3MCPA 2I7NA 3ZX2A 4IWVA 2CGJA 5LJVA 4BR5A 4BR0A 3ZEUA 2CGKA 3M3ZA 4FWKA 2HMPA 2GWKA 2IIRA 2Q31A 5BRDA 3VERA 5KPZA 2E1YA 2GEMA 5AQFA 4BC5A 1Y64A 1U2VA 4DQ8A 4B1ZA 2FF6A 1GLLO 2Q97A 2QM1A 3A0IX 3FLCO 4A2BA 2D4WA 4CD1A 5AQIA 4DHYA 3U9ZA 4FWNA 3LDOA 4EHTA 2QWQA 1QQOA 3GL1A 1GLAG 1QQNA 1YAGA 2FSKA 4B1XB 2P9NB 4H5TA 3FZMA 4BC2A 4BRKA 3ENOA 2UYTA 2ASOA 1CZAN 2VYPA 1ATSA 3VEWA 2FXUA 1NGAA 1NGGA 3I8BA 3I33A 1NGCA 2ASMA 5AFUA 4FWQA 4DB3A 5F1XA 5AQWA 2E20A 2QWRA 4H0TB 1YXQA 3EKUA 4QS9A 1NGDA 4RCHA 2ITMA 3CQXA 4Z94A 3D7EO 5FPEA 4O5FA 2A6AA 3FGUA 3CJ7A 3F9MA 1X9JA 2NZTA 5CE3A 3O4WA 1XC3A 3RSEA 3IFRA 1TUYA 1ZBSA 1T6DA 4FWRA 3BEXA 4BR7A 4CZGA 5FPDA 3CETA 1GLCG 2E2PA 3AY9A 1S3XA 3VEOA 1QQMA 4EFHA 3AARA 5LJWA 3ZX3A 2P9SA 2QXLA 3EL2A 1Z6RA 3J8AA 2IVPA 3W3DA 2VWBA 2I7PA
chains in the Genus database with same CATH superfamily
5A2QO 3T3FA 3D2EB 3NGIA 3PUFA 3U3YA 3DLLL 5M1PA 4BACA 1M1KO 2O8CA 4CZEA 3QNNA 5AZJB 3C94A 4U7BA 3DJCA 3EYZA 2NLXA 3V9SA 4BECA 3MCAB 2O8FA 3HOSA 4YOTA 5SWMA 3S9HA 4DTXA 2HHUA 3CJCA 3B8AX 3SMSA 2D5RA 4YOUA 3PX4A 3L3VA 2B6AA 1NU0A 5JVHL 4CHPA 3EEQA 4B9QA 4KI6A 1RTJA 4BRCA 3OYLA 5AZIB 5KRTA 3LL3A 4W5QA 3O9TA 3TARA 3CM5A 4H0VB 3SK3A 1RDWX 3CFRA 1OH8A 4N5SA 2FBTA 4C8LA 1Q81O 3HBTA 4MO5A 4B3OA 3ENHA 4H5VA 2AP1A 3U8XA 2WTUA 3SMPA 5FDLA 1S9EA 3U9DA 3IAYA 3TSUA 3GBTA 3AVJA 2YHAA 3KLIA 1JCGA 1DTQA 4JI1K 2OA8A 2YX6A 3L2QA 3WEEA 2VCPA 4IG0A 3U3GA 1R59O 1RT7A 3ZSOA 1HNZK 4F3OA 4BWMA 4YOWA 3VN5A 4BRIA 2OZMA 2FF3B 2P9PB 1HPMA 2Q2RA 1BDGA 3TTDA 1TL3A 5CYMA 1TK8A 4HUFA 3OYIA 4E7LA 2A3ZA 2HHHK 5AQZA 2JLEA 4WFAL 3O9UA 5AQPA 5LMNK 1VAZA 2KTQA 3E9LA 2DY4A 1WSHA 3ZT4A 3NCIA 4CZLA 2B4JA 3EO3A 1RDBA 2A41A 3QNOA 4DQPA 4AQYK 1KAYA 1KLNA 2XO7A 2IGIA 3K9KA 5SZTA 1VQON 3AVAA 5IWAK 2O8BB 2PBDA 2XY6A 4RTFD 5ADXH 1QZ5A 4DQRA 1YVNA 3HSCA 5BN8A 1S6PA 3QETA 1KFDA 4XEIA 3SCXA 4C8MA 4DR4K 2HF4A 2GV9A 4DV7K 4JS4A 4IKFA 4JKHA 4CZKA 5K14A 5EX5A 3M8SA 3CQYA 3MN6A 2OPRA 1EX4A 4H4MA 4BGBA 4CEBA 4ISFA 2FSJA 1ATRA 1ZBUA 3SUOA 3WNFA 4BRQA 1J9AA 3WUHA 4B3RK 5I3UA 3LDPA 3HM9A 4JK8A 3O3FA 3LM9A 4DUYK 5E26A 4CF8A 4YOYA 1J6ZA 1LCUA 2YHXA 3VQDA 1WAJA 4AILC 4ID5A 2CGLA 1KD1O 4K41A 1BWFO 4M3UA 5J2MA 4FOEA 3M5RA 3L2VA 3V9UA 3P4IA 5HRNA 1U47A 4DTJA 4A57A 4B1UB 4IOAL 3CC7N 1GOBA 3O08A 4DTMA 1A5VA 4BG8A 3F73A 4CHNA 4H0YB 4JKEA 4X65K 1S1XA 5AQLA 4H0PA 1RILA 4B9TA 3O6WA 3OYMA 4JI7K 3ZT0A 3SV3A 2Z1JA 2KQ2A 5M1NA 4DU3A 4FZYA 4J8FA 3DMJA 4G9ZA 3DM2A 2ASPA 3QEVA 1GLDG 3THWB 3VQCA 3V1QA 5JMVA 3U6FA 2RKIA 4KHNA 4I9LA 2E8AA 4O8KA 4B1VA 2HHTA 3TAEA 1A5WA 2KW4A 5AR0A 1NK7A 2Q0UA 4C8NA 5BRFA 2X78A 3OA9A 3H3NO 1K73O 2KLAA 3LAKA 1NJWA 5F0XA 3ATUA 3NF8A 4A61A 3WXJA 3AVNA 5BREA 1BQMA 4DFPA 4M3WA 4CGIA 1MU2A 3SNNA 3WXIA 1WSFA 4KTQA 4FO0A 1YJWN 3LM2A 3CCMN 2RF2A 2EX3A 2YCHA 4CJVA 4E7JA 3VQ6A 3PIOL 1RBRA 4BVOA 4FLYA 5AQHA 3HPOA 2YI1A 3KZBA 1NBWA 1RT5A 3G4SN 2QI2A 3PX0A 4EZ6A 4OPHA 3I55N 4ILJA 3KK7A 3RMDA 3CHWA 1VQPN 4GKJK 4DS4A 1IKXA 2ZM6K 1MWKA 1L3UA 4FXDA 4FW1A 3TSQA 4FSVA 3VGLA 3IDHA 3SV4A 4E7HA 3SQ2A 1TL1A 3BUZB 4DF8A 4RG8A 2P9LA 4BQLA 5EOYA 3I8DA 4FW2A 3F5TA 3HSTB 1ASUA 2IOCA 2VG7A 4CGDA 4QOZB 1MDUB 3RMCA 1JCFA 1BISA 1P90A 2F8TA 1L3TA 3CD6N 4C1NI 4A2AA 2ZGZA 1EWRA 1TKDA 3NAEA 1YJ9N 1EWQA 3LP3A 3D2FB 4BVPA 4K0KK 3AGRA 2P9SB 1LAVA 4IFYA 4CHQA 4B3SK 5B8HA 2IVNA 5EU7A 3SLCA 1IKYA 1RFQA 2F9TA 4BR4A 3QO9A 1OVYA 3CM6A 1HR0K 1EP4A 2VQEK 4FJMA 1BOTO 4BRLA 5GAHP 3VQEA 4CI6A 2IC3A 3CCUN 4YDUC 5JICA 3H6EA 4EHUA 2E1ZA 3VEZA 3DAWA 4YDUA 5DM6L 2QTDA 1XMQK 3VENA 4DS5A 2E2QA 3QICA 1YUWA 3MEDA 3O5BA 1N36K 3C7NB 4ZHRA 4H5RA 2D1KA 3OY9A 3VA0A 1TUUA 3O3GA 3JYTA 3UKUA 3WQTA 3MN9A 1NOYA 1HNXK 1HJOA 3HJFA 3WXLA 5KQDA 1X3MA 4Y0WA 3J7ZO 3L0QA 4BGAA 4R79A 4DSKA 1C0MA 1C0FA 3G0ZA 3NDKA 4CJ5A 1CXUA 1NG9A 4JV5K 5T7BA 2E2OA 1Y97A 2F7TA 3MDQA 5AQJA 5KRSA 2W42A 2VWKA 4CJFA 4I6MB 4C23A 4BRAA 3VQ7A 1VRUA 2ZQBA 3ZSYA 3ZX2A 4IWVA 3CQ8A 2CGJA 2NRRA 3NMUA 4BR0A 3ZEUA 3OJSA 3ZSWA 3V6DA 2NRXA 1IBMK 2Q31A 3VERA 5KTQA 3L2WA 1NNEA 3LP1A 4A59A 2YKMA 3M8RA 4YHHK 1GLLO 3LALA 2NNWA 5HL7L 2D4WA 3I0RA 4UQGA 1J53A 1Q86O 5DK5A 3SI6A 5C25A 2RPIA 4EHTA 3S5TA 1QS4A 2PFUA 2HBMA 1W9HA 4EP4A 1RBUA 3DLEA 3GL1A 3NGYA 4JKGA 2P9NB 4BC2A 3AVCA 1LWCA 1SL1A 1CZAN 3VEWA 1Q82O 1HYVA 4C8KA 3OYGA 5HBMA 3OYAA 3K58A 3THYA 1VSLA 4RCHA 4H0TB 1YXQA 3EKUA 1EETA 5FPEA 4E1MA 4CIEA 3KLEA 1W2BM 5J2QA 2NZTA 3T69A 1VRTA 1LAWA 1E3MA 4G1QA 2G8HA 1SV5A 1YF5L 3CETA 4BWJA 4LFAK 4BE7B 2E2PA 1S3XA 3VEOA 4N76A 1QQMA 2QA4N 3QLHA 5LJWA 3K9JA 2QXLA 3B6OA 4I7FA 3K5NA 4FJ8A 5DM7L 4CFBA 3W3DA 4FJXA 2UXCK 3K5OA 3H46O 1VQKN 3NVMA 3DXKA 3QINA 3P39A 2NRVA 3FZHA 1RDDA 2FBXA 1Q9XA 4BE1A 2P9UB 2WUSA 4Z4EA 3NF9A 4O4GA 4NO7A 3FZKA 2VGNA 3OYHA 2ZE2A 3P83D 1LWFA 4ILHA 4E0DA 3KLHA 3V9WA 4J2EA 3LP2A 4AM6A 3F9KA 1O13A 5GADP 2W41A 1N34K 2QWOA 5AZIA 2UUCK 2XY7A 3EN9A 4FLWA 1KVAA 2V51B 3R6MA 4JK9A 1SKWA 3DOKA 3DXMB 2ZJPL 4CK1A 4JHDA 3SYZA 1SL0A 4HUGA 1QVGM 4CF0A 4XIUA 2P9KB 3T1HK 1L3VA 1RDAA 1FJGK 4KH6A 2IAJA 4B1WB 1C1BA 3L4IA 2BE2A 3AAQA 2V7YA 3VF6A 2E2NA 1BG3A 4V19S 3QMLA 1VSIA 5JENA 3SQ1A 1K8KB 1OKJA 3RVCA 1KXPA 3O4NA 4HUEA 2Z1HA 4DTUA 4AHRA 3LWLA 4FOIA 2QK9A 1HKCA 1REVA 4QCLA 1BL3A 1UWBA 2C1GA 3HP6A 4WFNL 1CZ9A 1T7PA 4FCYA 4LSLA 4N41A 2D0CA 1BUPA 1NJYA 3HK2A 2DFFA 3VETA 2PAVA 3EZWA 1W7AA 1OH7A 3O4QA 4U67L 2A40A 3ZLJA 4K42A 4FM2A 4CJSA 1IG8A 5I42A 2FBVA 4B08A 1QQCA 1NGJA 4CERA 3WQUA 5C0YA 4CEEA 1FW6A 4PL7A 2UXBK 4TSXA 1U4BA 4F3TA 1DKGD 3JXUA 3WXMB 2Q36A 4HCBA 3A8YA 1K9MO 2Z1GA 4KFBA 4PA1A 4MDAA 1RDCA 4XJXA 2XHBA 3D6RA 4KHUA 2HVIA 1SKSA 2JWLA 1HQUA 1TK5A 5AQUA 3M8QA 2IVOA 3ISNC 4BRFA 3ITHA 3A2FA 5JS2A 2NRHA 3PO4A 1B92A 4LSNA 3KLFA 4DV6K 3CPWM 3AO3A 5AQQA 4AHCA 1RTIA 4IBNA 3A5NC 5AQMA 2PY5A 3AVGA 4DFJA 1HKBA 4DR6K 1VSFA 1SQKA 3OYCA 3ZT1A 4X62K 3EZ5A 3LDQA 4DV1K 3NH2A 1LWEA 2ZGYA 4OPKA 4BRGA 1LOTB 3R1XA 4WE1A 1N6QA 3HPGA 4BRNA 4BE0A 5AQVA 4I2QA 4B1YB 2J4RA 3LDNA 3MX5A 3PLAA 3DLRA 1MWMA 4DV0K 2ATQA 3MK6A 4JKBA 1NK8A 1ZXOA 1S22A 1D9DA 3HTVA 4O0JA 1DEJA 5AQSA 4DSFA 5E41A 3N4PA 3TR8A 4M63C 1TYQB 4OX9K 4Y1DA 1BO5O 3LDSA 1NGEA 3AA5X 4IJNA 3VTHA 5JLFA 3KLGA 4JD2B 4FM1A 3THVA 2CH5A 3NHGA 1ZBFA 1RDUA 4PKHA 5C12A 3P5JA 3O1BA 4CEZA 2XRIA 5HRRA 4JKCA 1S1WA 2BUPA 3TTCA 5M1FA 4M3ZA 1OVQA 3AVIA 1QTMA 1K8AO 1ITGA 4DV2K 3QFPA 5GIOA 2NRWA 3AVHA 4KHQA 1ATNA 3PV8A 1U2VB 2V7ZA 5AQYA 1C1CA 4O8UA 3C6UA 4BR9A 1RT2A 3PSIA 4OVLA 2GELA 2W00A 4JI2K 2G8WA 1JXBA 4CZIA 3NF6A 4MDBA 3OJUA 1KVBA 4CJRA 2JWKA 4EP5A 4E1NA 1KAXA 3ZETA 1YTAA 5BPNA 4GY2B 3SAFA 3R9PA 1XHZA 4FK4A 4IEIA 1HNIA 3SBTA 4GNIA 3SPZA 3D45A 2X6NA 3KVGA 3ULEB 3V81A 1NJXA 2P5GA 2NRTA 4CF9A 1NGIA 3LPTA 4IG3A 3TPQA 3QESA 3AO2A 1KCFA 1WBBA 5HRSA 4DTSA 1YVUA 4KKOA 4JRPA 4WQ5C 4W5RA 1VK0A 5C15A 2XY5A 1X1PA 3D2FA 4NCBA 4IJAA 4WQ5A 1HX1A 1S1TA 3HXMA 1QE1A 4OGEA 2YJFA 1JLBA 4CJ3A 3KIOA 4FVMA 2O8CB 4CIFA 5GAGP 4PY5A 2BTFA 3E66A 3AO4A 3MECA 4A5AA 1BCOA 4FJJA 2VGMA 4M45A 1WNSA 3QBXA 4CJTA 3QBWA 4ICLA 3WNHA 4M3XA 1U04A 1XUPO 4EAHD 4IFEA 1XI1A 1ASWA 2YJEA 2QEXN 1ZC6A 4C1NK 1KRPA 1N5YA 3C7NA 5EXWA 1D9FA 3MXIA 4ID1A 3VF4A 2OYQA 3LDLA 3J80O 3OS1A 2JGUA 5EY4A 4UY8O 4Z4FA 2GWJA 1BA1A 3MEEA 4JNEA 4E89A 3OS2A 2ETJA 1WB9A 4KHWA 5CYQA 2HB5A 1IV0A 1YHQN 3MWTA 4PQUA 4CJQA 3K57A 3VF2A 3TAFA 4OKKA 4R5PA 1X9MA 3R3LA 3AO1A 4I6MA 3ZSRA 3NF7A 3MCPA 3S3NA 1SKRA 2WBNA 4CEOA 3SUNA 2BANA 1IBLK 2GWKA 1DTTA 4DSIA 4OLAA 3VQPA 5KPZA 2E1YA 2GEMA 2HHQA 3Q7BA 1ZBLA 1Y64A 1JLAA 1J5OA 1EKEA 2Q97A 3PO5A 4JKDA 2RN2A 4FJNA 3KK3A 4CEFA 3U9ZA 3CMEN 1TAUA 1WBDA 4FWNA 4W5TA 4WF9L 1VQMN 1XC9A 3J7YP 4PUOA 1QQNA 4YOXA 4B1XB 5KI6A 4H5TA 3FZMA 4RW9A 2VYPA 4Y1CA 1WSEA 3ZSQA 1VSEA 1NGGA 3I8BA 3I33A 1NGCA 3CCEN 1KVCA 3DLHA 4O55A 3I56N 4DB3A 5AQWA 4DLEA 2ITMA 2E20A 4QS9A 3V9XA 3CQXA 1RTDA 4Z94A 3MXJA 1TV6A 4O5FA 4CGHA 4NYFA 2A6AA 4B9LA 3TABA 4CJUA 3O4WA 3RSEA 4K8ZA 3OW2M 5LMUK 2RHKA 2ZD1A 3SZ2A 4BDPA 4FWRA 4CZGA 4BR7A 1WSGA 3LP0A 3O3HA 4DTPA 3T7ZA 1CZBA 3AY9A 3AARA 3V4IA 3EL2A 4KH4A 1Z6RA 3K5MA 4BDYA 3J8AA 4RW8A 4IO8A 3OYEA 3AVFA 3SJJA 2OTJN 4F8RA 4CEQA 1NK4A 5F2RA 4MLEA 2B5JA 3UKRA 1JLGA 4M7XA 1Q8IA 2P9UA 4M3YA 1J54A 4AH9A 4CEDA 4I9QA 1HLUA 1TKZA 1YIJN 4FLUA 1DGKN 1XNRK 4IOXA 3CCRN 1IH7A 4NXNK 4WFBL 3OYJA 1BCMA 1T3VA 2IDOA 3VQQA 4LFBK 1Q9YA 3MX2A 3FR0A 3QB0A 1D4XA 4J2AA 1E4FT 4DSEA 4CFCA 1RBVA 2WFBA 2QWPA 1NLVA 5C10A 2G8FA 2F96A 1CLQA 2P9KA 2FC0A 2Z1IA 4FJ9A 1RTHA 3ZX0A 2A5XA 4YNQA 1VQ5N 3MN5A 4WCEL 3CXCM 2QW9A 4LY7A 2D0AA 3CERA 3PIPL 3OYDA 1S72N 5JS1A 1V4TA 1NJIO 1OH5A 2YHYA 4K43A 4KTWA 3GE1A 3AO5A 1G99A 1IO2A 3SPYA 5KPTA 1S5JA 3CFOA 2E5LK 4A5BA 1RCHA 1FXXA 2F9WA 3U4LA 3CJ9A 3VESA 4HTUA 4E3SA 4K25A 4DMNA 1NGBA 5BPLA 3C65A 2W6KA 4A62A 3TI0A 3WNGA 1KSPA 4CBUA 4HHTA 3HOTA 3GG4A 4LF4K 1UOCA 1XHXA 2A1SA 4H5NA 1QSSA 2G8UA 2HMIA 3KWIA 1T03A 5CZ1A 1BI4B 1OH6A 3N4QA 3KHYA 1N8RO 4L3QA 4BRHA 2P9IB 2HNDA 1E4GT 3EY1A 3QDKA 1C1AA 3IKMA 5JVGL 2VWJA 2HHIA 1IJJA 4PKGA 2O8DA 4IZ9A 4JRQA 1EXQA 3TAQA 4CESA 2WC9A 1YITN 3UB5A 1NMNA 3G71N 3THXA 3NE6A 1A5XA 1I39A 2HF3A 2HNYA 3NFAA 3DI6A 3HVRA 3CC2N 2ZWHA 4FZZA 1JL1A 4BE2A 4LH4A 1BIUA 4NYNA 3CCSN 3SQ0A 3L6QA 3ID8A 3L8BA 4EIAA 4GMJB 5CHIA 4KO0A 3P31A 2QWNA 4DSLA 1WN7A 2D0BA 3D2EA 4LF8K 4QS7A 5KGXA 2O8EB 4RW7A 1C0UA 3B6PA 1J5EK 4DTNA 3A5MC 3G10A 3CJ1A 3MWPA 5AZJA 1HPZA 3VQAA 3RRHA 4JI4K 4I2PA 4KHSA 4NCGA 2VG6A 3RR8A 4DWIA 3VQ8A 2OCEA 5HOOA 4DG1A 5M1KA 4B8AB 2ZJRL 4CJ4A 2P5OA 2EWSA 1Z25A 4PL8A 4MLHA 3CCVN 5J2NA 1JL2A 2E88A 4KB1A 4M3RA 1GOCA 2OZSA 3PY8A 4WYBA 5AQTA 4O0IA 4HTLA 3LPUA 3VEXA 3QIOA 3L2UA 3SBGA 2HNZA 1W97L 1JXEA 3C95A 4BDZA 3HI0A 4CD3A 3HPHA 2WOMA 4Q0BA 3VA3A 4NLBA 4KBOA 1BQNA 4B3TK 3R8EA 3CYMA 1T6CA 1QVFM 1O1WA 2WONA 1QSYA 5ELZA 3UKUB 4YORA 4AHTA 4FJ7A 5BRHA 5JLHA 2HHVA 4E19A 2GUIA 3ZT2A 3FFKB 1G15A 3BGRA 4LF7K 2KHOA 1KAZA 2YNHA 5E84A 5TKWA 3SQ4A 4JD2A 4IXCA 3H45C 1LW2A 1NGHA 1N33K 2UU9K 4M3TA 4BC4A 5ADXA 3KD1E 2HHXA 4CGJA 4FWSA 3VGMA 2P9PA 1UAXA 4CJPA 1I94K 2UXDK 3ATVA 4M7YA 4DCHA 1Z05A 1GLFO 1YJNN 1EQYA 4BROA 4LF6K 5H1SQ 4CBWA 3ZEUB 4YOVA 1B9DA 4DLGA 5GAEP 4E7IA 3HM8A 2A42A 3DRPA 5C2DA 1TK0A 5C24A 4CF1A 3O1WA 1T8EA 3ZYYX 4BREA 4CE9A 3AVLA 4CK2A 3H1VX 1JCEA 1U48A 4QAGA 2O8BA 1VSJA 3BF1A 3CJBA 4LF5K 1Q7YO 4JI3K 4FJLA 1DLOA 3AA4A 4FLXA 4JKGB 4FJKA 3O9QA 4DV4K 3H3OB 4LH5A 4DU4A 4MQ3A 5M1QA 4DFKA 2FBYA 4FVUA 2IS3A 5KQ8A 4ELVA 4KB0A 3ULEA 1SS6A 3WNEA 1CXQA 4FWOA 1WSJA 3QFUA 3RMBA 3THYB 2VG5A 4HWIA 3ENBA 1D8YA 2G8KA 3DLGA 4FK0A 1GLEG 1NK5A 2W6LA 4GVMA 2E6MA 3IS9A 1VSDA 4DFMA 3FE1A 1BA0A 3DLKA 3BP8A 5FPMA 1U6ZA 3QIPA 3TAPA 4CJWA 2OPPA 4E1JA 2GTDA 3V9ZA 3WXKA 5KPRA 1Z26A 1WLJA 4CHOA 4LF9K 1BGXT 2Q3SA 1TGOA 1EO1A 1N32K 3DRRA 4CFAA 1SZ2A 2HOEA 3TAMA 3JSMA 4CJEA 3DXKB 1TKXA 2ITGA 4RW6A 4Z4HA 3HO1A 2FLOA 4CJ7A 3DOLA 3RMAA 5BR9A 2Y1IA 3A5LC 4JLHA 3HZ6A 4FZXC 3K2PA 4CHYA 3AVKA 4F2SA 3EE8A 4Z4GA 2HW3A 5AQRA 5FLXO 3LZIA 3THWA 1FK9A 3NGZA 4FM0A 2F4VK 1HNVA 4LC9B 4L8RB 4NB4A 4DKWA 3SUQA 2FSNA 4LFCK 3VOVA 4B9MA 4DR2K 3C0BA 4JHDB 4ILGB 2QWLA 5EVZA 4KHPK 1NK9A 3WT0A 4C8OA 1HQEA 2VQFK 4DSJA 3CCQN 4O44A 3CFPA 3SUPA 4FLZA 4BR5A 3SAGA 3L3UA 2CGKA 2YKNA 3M3ZA 4FWKA 5BRDA 1VQNN 2I5JA 4DQ8A 2GX9A 4B1ZA 2FF6A 2HBKA 3MXMA 4CEAA 4NXMK 2QM1A 4A2BA 3A0IX 3M8PA 1KFSA 4CD1A 3C6TA 5AQIA 4DHYA 5C2FA 1NKCA 3AVBA 2AJQA 4DUZK 3LDOA 1L3SA 1NKBA 3NH0A 1QQOA 2G8IA 3VQBA 4JS5A 1S6QA 1GLAG 2FSKA 1VQ9N 1JLEA 3NVKA 1JLQA 3LAMA 3QERA 4B9NA 2ASOA 3TSPA 1YI2N 2FXUA 2BGGA 1ZYQA 1RT3A 2ASMA 1VQ4N 4LD0A 3OBYA 5M1OA 5F1XA 3KKSA 1YTUA 4GV6A 4FYDA 2QWRA 3E01A 1NGDA 5FRMA 1KTQA 1RT4A 3D7EO 4NLCA 1HYZA 3FGUA 3HP9A 3HT3A 3L2RA 1D5AA 4PWDA 3IFRA 1NOZA 3BEXA 5FPDA 3RRGA 4IOCL 1GLCG 1NJZA 3O9SA 4CGFA 4DV5K 5DMRA 4HCCA 3C6HA 3V1RA 3UIQA 1ASVA 3ZX3A 2P9SA 4N56A 4X66K 2RE2A 2IVPA 3J7AP 2QXFA 3W0LA 1K6YA 5GIPA 5AFUH 4H03B 4CIGA 2BDPA 4JI0K 2YV0X 4KPYA 3CJAA 4DV3K 2DTUA 2HBLA 4RWTA 3BDPA 4M42A 3M6GA 3IMXA 4CW7B 2XY8A 3VEVA 4DR3K 2NUBA 2O8FB 2ZF5O 1U45A 4CJLA 3D0PA 2PYJA 3CI5A 3O80A 1HMVA 1QZ6A 3OYBA 4AHUA 4FJIA 3HL8A 4KH5A 4CZFA 1VQ6N 1NWKA 2PZSA 3DYAA 1S9GA 3KK1A 2GBZA 2KKZA 4XH1A 3QEIA 2DFEA 5MLCQ 2YNGA 3OHRA 2G8VA 4FWLA 3LWMA 1U49A 3AAPA 2HSTA 5FROA 3GOIA 1RT1A 2X74A 4Z0UA 5BN9A 3ZCMA 4CK3A 2E6LA 3IUCA 2YHWA 2H3GX 3C6AA 2LSNA 3IRXA 4O5BA 3VMFB 1VQ8N 5FPNA 4H0XB 2QKBA 5CY4A 1B9FA 5J1EA 4BRPA 1TKTA 3O9RA 3OBWA 1S1UA 3WEEB 3AV9A 4GW6A 1UA0A 3L4QA 1JLFA 3SAHA 3CCLN 1X9SA 3DLBA 3TTFA 4JYAK 1Q18A 3NH1A 4EZ9A 3HVTA 4CZHA 4CJKA 3ALYA 1XNQK 4OLBA 4GV3A 4WQ4C 3FZFA 4FWMA 5AJ3K 4F4KA 2QWMA 1NK6A 4X64K 1X9WA 1GLJO 4CF2A 1WUAA 2P9NA 5C42A 4WQ4A 1L5UA 3BF3A 3AA3A 4BEBA 5J2PA 2GUPA 5LL6Z 4DQQA 1BI4A 3NBPA 1IBKK 3A5OC 1SL2A 1IKVA 4BR2A 1M90O 3KD5E 1VSHA 1QHTA 4JI6K 2KFZA 2P9IA 4CGGA 1FKOA 3O8MA 4B3MK 2BH1A 4BQZA 2KZZA 2O4GA 3CC4N 5I9EB 3RR7A 3KK2A 4B8CA 3ZETB 4QS8A 4FK2A 1BIZA 3RTVA 1XWLA 2HHSA 1LW0A 4B9VA 3F2KA 5IT9O 2ZJQL 4PHTX 1JKHA 3TU5A 2D0OA 3FFIA 1NMDA 1SUQA 3E9PA 4KTZA 4CVNE 3K5LA 3ZT3A 2O8EA 1C0GA 2W40A 4DF4A 4FLVA 1LV5A 2Q1NA 1WAFA 3ZSVA 4CZMA 4CECA 4FJ5A 1DT9A 4FWPA 3ZSZA 3LZJA 2OANA 4Q5VA 3VEYA 3HYFA 1NK0A 1TAQA 4H4OA 3PX6A 4YY3K 4AM7A 1NGFA 5TKYA 3H1QA 4XH4A 3GDQA 3G25A 4W5NA 5AQXA 3OS0A 3EE9A 4BC3A 2NRZA 1GLBG 4AHSA 1X3NA 4K8XA 3VQ4A 4DTRA 1S1VA 3KWGA 1QHAA 4DQIA 1WOQA 1NM1A 1ILYA 4IEEA 2YNIA 3DXMA 4CZJA 3S3OA 3OYNA 4FPAA 3I0SA 3E9OA 1I3AA 2X6SA 1MA9B 4ISEA 1XQSC 4DR5K 5BR8K 3AVMA 3V1OA 4ELUA 2CH6A 3BY5A 3BZKA 1K8KA 3AA2A 1ZBIA 3CPEA 1KQSM 1TVRA 2UUBK 2PYLA 2C1IA 4CFDA 1HKGA 1VQ7N 4RW4A 1F21A 1QSLA 1NKEA 1T44A 3UE5A 3FZLA 3S41A 2OPQA 3AGKA 4JKFA 2OPSA 4E72A 3CIPA 1HNWK 1VQLN 4FJHA 4GVEA 2DPNA 4IO9L 4H5WA 3OTOK 4DR7K 2HHWA 4OGCA 4JAXA 2UUAK 3CMAN 4ELTA 2Q0RA 2O4IA 5FRNA 3VPZA 4BG9A 4H8KA 4BRMA 1YT3A 3VGKA 4B9SA 3VQ5A 1VSKA 1KLMA 5CZ2A 3OYKA 3MN7A 3CYGA 4BY9C 3VTIA 4CBXA 3TANA 1V4SA 3SJHA 4OJRA 5AQKA 5GINA 1T05A 3HRGA 1RBTA 3JS6A 1H1VA 2P9LB 1R0AA 5HP1A 3ULDA 3CG7A 3T1AA 5HLFA 4IDKA 3QEXA 1IKWA 1VSMA 2P51A 2F8SA 3RSEB 4JKAA 1JLCA 3EKSA 5KGWA 3DWLA 4OO1J 1ZBHA 4MO4A 1IG9A 2YNFA 3T19A 5AQOA 2D0PA 1BHLA 2E4LA 2QKKA 4JN4A 3S3MA 4JK7A 5BPMA 3ID6A 1P8ZA 1ESVA 4JI5K 4CCHA 4PKIA 3H08A 2A1RA 2OTLN 4FPBA 3MMVA 3KTQA 4FL9A 4KV8A 4H0OA 2KFNA 3G6EN 3UKRB 5LY3A 4AF1A 1HUXA 4KI4A 4XH5A 4DR1K 5HROA 3MEGA 4BRDA 3ASMA 4GV9A 4ISGA 3J81O 4IFVA 4CHZA 4DTOA 3JAMO 4J2BA 1SAZA 5AQNA 3CCJN 1RGIA 3K59A 1GOAA 3M1FA 4MFBA 4F2RA 1W0HA 4JI8K 4OPJA 4FJGA 4W5OA 3BZCA 2KZMA 1TYQA 2HVHA 3KJVA 1RT6A 5AQGA 3QEPA 4JEPA 4E7KA 4F9OA 1FKPA 1WSIA 1BU6O 3RWUA 4YFUA 2Y1JA 2V52B 2AA4A 4IDHA 4ZTFA 3E1YA 3PSFA 2YHBA 2I7NA 4B9UA 5LJVA 2R7YA 4M41A 1HJRA 2HMPA 2IIRA 5AQFA 4BC5A 3T1YK 1U2VA 4HVJA 3TWHA 4KRFA 3FLCO 3OVNA 4GKKK 3OYFA 4OKEA 3IG1A 1XMOK 4OKJA 1RBSA 5D3GA 3TAGA 4AHVA 2QWQA 4NCAA 1YAGA 4J2DA 4ZTJA 3K0SA 4KAZA 3MAQA 1HYSA 1HRHA 1RNHA 4BRKA 3ENOA 2UYTA 1ATSA 1C6VA 1NGAA 3VQ9A 3ZSXA 1KC8O 5AFUA 4DQSA 4N47A 4FWQA 4FLTA 3DRSA 3QEWA 1UA1A 4KHYA 3CJ7A 3F9MA 1X9JA 2O8DB 5CE3A 1XC3A 1TUYA 3P38A 3CF5L 1ZBSA 1T6DA 3THXB 5HRPA 2EHGA 3Q7CA 2HBJA 1VHXA 4EFHA 3LANA 2DFHA 3P1GA 1JJ2M 3KKRA 2P1JA 4Z4IA 4DU1A 4KREA 2VWBA 4OPAA 1C0TA 5CR4A 2I7PA 4Z4CA
chains in the Genus database with same CATH topology
4IO8A 3W0LA 3H46O 3D2EB 5GIPA 5AFUH 4H03B 3NVMA 1VQKN 2OTJN 3DXKA 3CJAA 3P39A 3DLLL 2HBLA 5M1PA 2NRVA 3FZHA 5F2RA 4RWTA 4MLEA 3UKRA 1M1KO 4CZEA 4M7XA 5AZJB 3M6GA 2P9UA 2P9UB 3DJCA 4U7BA 2NLXA 3IMXA 4BECA 2WUSA 3MCAB 3VEVA 2ZF5O 4NO7A 3HOSA 3FZKA 4YOTA 2VGNA 3CI5A 1HLUA 3O80A 1QZ6A 3CJCA 1YIJN 3B8AX 3SMSA 4ILHA 4YOUA 1DGKN 4KH5A 4CZFA 4IOXA 3CCRN 5JVHL 4AM6A 1VQ6N 4WFBL 1NWKA 4B9QA 1O13A 5GADP 1T3VA 2W41A 2QWOA 2KKZA 4BRCA 3MX2A 5AZIA 3FR0A 4XH1A 5AZIB 3QB0A 3EN9A 1D4XA 2V51B 3LL3A 1E4FT 3R6MA 3O9TA 4JK9A 3OHRA 5MLCQ 4FWLA 2WFBA 4H0VB 3SK3A 2QWPA 3AAPA 2HSTA 3DXMB 2ZJPL 1NLVA 3GOIA 5C10A 4JHDA 1RDWX 1QVGM 2P9KA 2P9KB 5BN9A 3IUCA 3HBTA 1Q81O 4MO5A 3ZX0A 2A5XA 2YHWA 3ENHA 2H3GX 4KH6A 4B1WB 3C6AA 4H5VA 2AP1A 1VQ8N 3VMFB 3L4IA 5FPNA 3U8XA 1VQ5N 3MN5A 3AAQA 4WCEL 2V7YA 4H0XB 3SMPA 3VF6A 3CXCM 2E2NA 3U9DA 1BG3A 2QW9A 3QMLA 3CERA 3GBTA 3TSUA 4BRPA 3PIPL 1S72N 1K8KB 1V4TA 1JCGA 1OKJA 2YX6A 1KXPA 3O9RA 3OBWA 3RVCA 1NJIO 3WEEA 3WEEB 2VCPA 1R59O 2YHYA 4FOIA 4K43A 3GE1A 1HKCA 3L4QA 1G99A 2C1GA 4YOWA 4BRIA 5KPTA 2FF3B 3SAHA 4WFNL 3CCLN 2P9PB 1HPMA 3TTFA 4A5BA 1Q18A 2F9WA 3U4LA 2Q2RA 3CJ9A 3VESA 1BUPA 1BDGA 3TTDA 4K25A 4CZHA 1NGBA 3VETA 5BPLA 4GV3A 3C65A 2PAVA 4WQ4C 2A3ZA 3EZWA 3FZFA 4FWMA 4A62A 5AQZA 4CBUA 4U67L 2QWMA 4WFAL 1GLJO 3HOTA 3GG4A 3O9UA 1WUAA 2A40A 5AQPA 2P9NA 1VAZA 4K42A 3E9LA 4H5NA 4WQ4A 3BF3A 3KWIA 3EO3A 4CZLA 4BEBA 1IG8A 2A41A 2GUPA 1KAYA 3N4QA 3A5OC 3K9KA 4BR2A 1VQON 1M90O 3KHYA 1N8RO 1NGJA 4L3QA 4BRHA 2PBDA 3WQUA 5C0YA 2P9IA 2P9IB 4RTFD 1E4GT 3O8MA 5ADXH 1QZ5A 2BH1A 4BQZA 4PL7A 3QDKA 1YVNA 3IKMA 3HSCA 5JVGL 3CC4N 5BN8A 5I9EB 1IJJA 4PKGA 4IZ9A 4XEIA 2HF4A 2WC9A 3UB5A 1DKGD 3JXUA 3ZETB 1YITN 4QS8A 3G71N 3WXMB 2Q36A 4JKHA 3A8YA 2HF3A 4CZKA 5EX5A 3CQYA 3CC2N 3MN6A 2ZWHA 4BGBA 1K9MO 4MDAA 3F2KA 2ZJQL 4ISFA 3TU5A 4PHTX 2D0OA 3CCSN 2FSJA 4XJXA 3L6QA 1NMDA 1ATRA 3ID8A 3D6RA 4EIAA 4BRQA 3E9PA 5CHIA 3WUHA 2JWLA 3LDPA 2QWNA 3P31A 4JK8A 3LM9A 5E26A 5AQUA 3D2EA 4YOYA 1J6ZA 1C0GA 2IVOA 4QS7A 2W40A 1LCUA 4BRFA 2YHXA 2Q1NA 3A5MC 2NRHA 3CJ1A 4CZMA 3MWPA 5AZJA 2CGLA 1KD1O 1DT9A 4FWPA 3CPWM 2OANA 4K41A 5AQQA 1BWFO 3VEYA 5HOOA 3A5NC 5AQMA 5M1KA 4FOEA 1HKBA 3M5RA 2ZJRL 4AM7A 1SQKA 1NGFA 5TKYA 3H1QA 3P4IA 4XH4A 4A57A 3GDQA 4B1UB 2EWSA 3G25A 3LDQA 4IOAL 3CC7N 4PL8A 4MLHA 5AQXA 2ZGYA 3CCVN 4BRGA 1LOTB 3EE9A 3O08A 3R1XA 4BC3A 2E88A 2NRZA 1GLBG 1X3NA 4BRNA 3KWGA 1QHAA 4WYBA 1WOQA 5AQTA 4BG8A 4HTLA 5AQVA 3VEXA 1NM1A 4B1YB 2J4RA 3LDNA 3MX5A 4H0YB 4IEEA 4JKEA 3DXMA 5AQLA 3SBGA 1W97L 3PLAA 4H0PA 3O6WA 1MWMA 4CZJA 3HI0A 4CD3A 3MK6A 4FPAA 4JKBA 5M1NA 3E9OA 1ZXOA 1S22A 4KBOA 1MA9B 4ISEA 4NLBA 4J8FA 4G9ZA 3R8EA 1XQSC 2ASPA 1T6CA 3HTVA 1DEJA 1GLDG 1QVFM 5AQSA 3N4PA 5ELZA 4YORA 3UKUB 5JMVA 5BRHA 5JLHA 4M63C 1TYQB 4O8KA 2E8AA 4B1VA 3FFKB 2CH6A 1BO5O 2KHOA 1K8KA 1NGEA 1KAZA 5E84A 5TKWA 3CPEA 4IJNA 3VTHA 5JLFA 4JD2A 4JD2B 4IXCA 3H45C 2Q0UA 5AR0A 1KQSM 1NGHA 2C1IA 5BRFA 2CH5A 3OA9A 3H3NO 1HKGA 1RDUA 4BC4A 4PKHA 2KLAA 5C12A 5ADXA 1K73O 1VQ7N 3O1BA 4FWSA 3VGMA 2P9PA 3ATUA 4A61A 5BREA 3WXJA 3ATVA 4M7YA 5F0XA 4JKCA 2BUPA 3TTCA 4DCHA 5M1FA 3WXIA 1T44A 3UE5A 1Z05A 1GLFO 3FZLA 4FO0A 1YJNN 1YJWN 3S41A 1EQYA 3LM2A 4BROA 3CCMN 3AGKA 5H1SQ 4JKFA 1K8AO 4CBWA 3ZEUB 4YOVA 3QFPA 2YCHA 3CIPA 5GIOA 2NRWA 5GAEP 3PIOL 1VQLN 1ATNA 3HM8A 2A42A 1U2VB 4BVOA 4GVEA 2DPNA 5AQHA 2V7ZA 5C2DA 4IO9L 2YI1A 4H5WA 5AQYA 3O1WA 4O8UA 3KZBA 3ZYYX 4JAXA 4BREA 1NBWA 3CMAN 3H1VX 3G4SN 1JCEA 2Q0RA 2QI2A 4BR9A 3VPZA 4BG9A 4OPHA 3I55N 4ILJA 3KK7A 4BRMA 2GELA 3BF1A 3CJBA 2W00A 3CHWA 1VQPN 3VGKA 1Q7YO 4CZIA 4JKGB 4MDBA 1MWKA 3O9QA 3H3OB 3TSQA 4FSVA 2JWKA 3VGLA 5M1QA 3MN7A 1KAXA 3ZETA 4FVUA 5KQ8A 3IDHA 5BPNA 3VTIA 4BY9C 4CBXA 4GY2B 3SAFA 3R9PA 1V4SA 3SJHA 5AQKA 5GINA 3BUZB 3HRGA 4IEIA 3SBTA 4GNIA 3JS6A 1H1VA 3KVGA 2P9LA 2P9LB 3ULEA 3ULEB 4BQLA 1SS6A 5EOYA 2NRTA 4FWOA 1NGIA 3F5TA 3QFUA 4HWIA 3ENBA 3TPQA 1GLEG 1MDUB 3RSEB 1JCFA 1P90A 4JKAA 3CD6N 3EKSA 3FE1A 4C1NI 3DWLA 4A2AA 1BA0A 4OO1J 3BP8A 4WQ5C 5FPMA 2ZGZA 4MO4A 1U6ZA 5AQOA 5C15A 2D0PA 1YJ9N 4E1JA 2GTDA 3D2FB 3D2FA 4IJAA 4BVPA 3WXKA 3AGRA 4JN4A 4WQ5A 1HX1A 2P9SB 5KPRA 4JK7A 5BPMA 3ID6A 1P8ZA 1EO1A 1ESVA 5B8HA 2IVNA 4PKIA 3SLCA 1RFQA 2OTLN 1SZ2A 2F9TA 2YJFA 2HOEA 4BR4A 4FPBA 1OVYA 3MMVA 3DXKB 4FL9A 4H0OA 1BOTO 3G6EN 4BRLA 2FLOA 3UKRB 4CJ7A 5LY3A 5GAHP 4AF1A 1HUXA 4CI6A 4XH5A 3CCUN 5BR9A 4YDUC 5JICA 4BRDA 4GV9A 4ISGA 5GAGP 3H6EA 3A5LC 2BTFA 3E66A 4EHUA 3HZ6A 1SAZA 4A5AA 2VGMA 2E1ZA 3VEZA 3DAWA 4YDUA 3QBXA 5DM6L 2QTDA 3QBWA 1XUPO 4EAHD 5AQNA 4IFEA 3VENA 2E2QA 2YJEA 3QICA 3CCJN 2QEXN 1ZC6A 1YUWA 1RGIA 3O5BA 4C1NK 1ILYA 3EE8A 3C7NA 3C7NB 3M1FA 4H5RA 5EXWA 2D1KA 5AQRA 1TUUA 3VF4A 3UKUA 4LC9B 3LDLA 3MN9A 3WQTA 5EY4A 1TYQA 4UY8O 4NB4A 2GWJA 1BA1A 4DKWA 1HJOA 4JNEA 5AQGA 3WXLA 2FSNA 5KQDA 3VOVA 1X3MA 4Y0WA 4JEPA 3C0BA 4JHDB 3J7ZO 1YHQN 4F9OA 4ILGB 3MWTA 3L0QA 4BGAA 4R79A 2QWLA 5EVZA 1BU6O 1C0FA 3VF2A 3WT0A 3R3LA 2V52B 2AA4A 2E2OA 4IDHA 2F7TA 3MDQA 3E1YA 5AQJA 3CCQN 4I6MA 4I6MB 4C23A 4BRAA 3MCPA 2I7NA 3ZX2A 4IWVA 2CGJA 5LJVA 4BR5A 2WBNA 2NRRA 3NMUA 4BR0A 3SAGA 3ZEUA 2CGKA 3M3ZA 4FWKA 2HMPA 2GWKA 2NRXA 2IIRA 2Q31A 5BRDA 3VERA 1VQNN 5KPZA 2E1YA 2GEMA 3Q7BA 5AQFA 4BC5A 1Y64A 4A59A 1U2VA 4DQ8A 2GX9A 4B1ZA 2FF6A 2HBKA 1GLLO 2Q97A 2QM1A 2NNWA 3A0IX 3FLCO 4JKDA 2D4WA 4A2BA 5HL7L 4CD1A 5AQIA 4DHYA 3U9ZA 5C2FA 3CMEN 1Q86O 4FWNA 3LDOA 4EHTA 2QWQA 4WF9L 1QQOA 1VQMN 2PFUA 2HBMA 3GL1A 4JKGA 1GLAG 1QQNA 1YAGA 4YOXA 2FSKA 4B1XB 1VQ9N 3NVKA 2P9NB 4H5TA 3FZMA 4BC2A 4BRKA 3ENOA 2UYTA 2ASOA 1CZAN 2VYPA 1ATSA 3TSPA 3VEWA 1YI2N 1Q82O 2FXUA 1NGAA 1NGGA 3I8BA 3I33A 1NGCA 1KC8O 3CCEN 2ASMA 5AFUA 1VQ4N 3I56N 4FWQA 3OBYA 5M1OA 4DB3A 5F1XA 5AQWA 4GV6A 2E20A 2QWRA 4H0TB 1YXQA 3EKUA 4QS9A 1NGDA 4RCHA 2ITMA 3CQXA 4Z94A 3D7EO 5FPEA 4O5FA 4NLCA 2A6AA 3FGUA 1W2BM 3CJ7A 3F9MA 1X9JA 2NZTA 3T69A 3O4WA 1XC3A 3RSEA 5CE3A 3IFRA 3OW2M 1TUYA 3P38A 3CF5L 2RHKA 1ZBSA 1T6DA 1YF5L 3BEXA 4FWRA 4BR7A 4CZGA 5FPDA 3CETA 4IOCL 1GLCG 3T7ZA 4BE7B 2E2PA 3AY9A 3O9SA 1S3XA 3Q7CA 3VEOA 1QQMA 2HBJA 4EFHA 2QA4N 3C6HA 3AARA 5LJWA 3K9JA 3ZX3A 2P9SA 2QXLA 1JJ2M 3EL2A 4KH4A 1Z6RA 3J8AA 5DM7L 2RE2A 2IVPA 3W3DA 2VWBA 4OPAA 5CR4A 2I7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IO8 A;  3W0L A;  3H46 O;  3D2E B;  5AFU H;  4H03 B;  3DXK A;  3CJA A;  3FZH A;  5F2R A;  4RWT A;  4MLE A;  3UKR A;  4CZE A;  4M7X A;  5AZJ B;  3M6G A;  2P9U A;  2P9U B;  3DJC A;  2NLX A;  3IMX A;  2WUS A;  3VEV A;  2ZF5 O;  4NO7 A;  3FZK A;  3CI5 A;  1HLU A;  3O80 A;  1QZ6 A;  3CJC A;  3B8A X;  3SMS A;  1DGK N;  4CZF A;  4AM6 A;  1NWK A;  4B9Q A;  2W41 A;  2QWO A;  4BRC A;  5AZI A;  3FR0 A;  4XH1 A;  5AZI B;  3QB0 A;  3EN9 A;  1D4X A;  2V51 B;  3LL3 A;  1E4F T;  3R6M A;  3OHR A;  4FWL A;  4H0V B;  3SK3 A;  2QWP A;  3AAP A;  3DXM B;  1NLV A;  3GOI A;  4JHD A;  1RDW X;  2P9K A;  2P9K B;  5BN9 A;  3IUC A;  3HBT A;  4MO5 A;  3ZX0 A;  2A5X A;  2YHW A;  3ENH A;  2H3G X;  4B1W B;  4H5V A;  2AP1 A;  3L4I A;  5FPN A;  3U8X A;  3MN5 A;  3AAQ A;  2V7Y A;  4H0X B;  3SMP A;  3VF6 A;  2E2N A;  3U9D A;  1BG3 A;  2QW9 A;  3QML A;  3CER A;  3GBT A;  4BRP A;  1K8K B;  1V4T A;  1JCG A;  1OKJ A;  1KXP A;  3WEE A;  3WEE B;  2VCP A;  1R59 O;  2YHY A;  4FOI A;  4K43 A;  3GE1 A;  1HKC A;  1G99 A;  4BRI A;  5KPT A;  2FF3 B;  2P9P B;  1HPM A;  1Q18 A;  2F9W A;  3U4L A;  2Q2R A;  3CJ9 A;  3VES A;  1BUP A;  1BDG A;  4K25 A;  4CZH A;  1NGB A;  3VET A;  5BPL A;  2PAV A;  4WQ4 C;  2A3Z A;  3EZW A;  3FZF A;  4FWM A;  4A62 A;  5AQZ A;  4CBU A;  2QWM A;  1GLJ O;  3GG4 A;  1WUA A;  2A40 A;  5AQP A;  2P9N A;  4K42 A;  4H5N A;  4WQ4 A;  3BF3 A;  4CZL A;  3EO3 A;  1IG8 A;  2A41 A;  2GUP A;  1KAY A;  3A5O C;  4BR2 A;  3KHY A;  1NGJ A;  4L3Q A;  4BRH A;  2PBD A;  3WQU A;  2P9I A;  2P9I B;  4RTF D;  1E4G T;  3O8M A;  5ADX H;  1QZ5 A;  4BQZ A;  4PL7 A;  3QDK A;  1YVN A;  3HSC A;  5BN8 A;  5I9E B;  1IJJ A;  4PKG A;  4IZ9 A;  4XEI A;  2HF4 A;  3UB5 A;  1DKG D;  3JXU A;  3ZET B;  4QS8 A;  2Q36 A;  3A8Y A;  2HF3 A;  4CZK A;  5EX5 A;  3CQY A;  3MN6 A;  2ZWH A;  4BGB A;  4ISF A;  3TU5 A;  2D0O A;  2FSJ A;  3L6Q A;  1NMD A;  1ATR A;  3ID8 A;  4EIA A;  4BRQ A;  3WUH A;  3LDP A;  2QWN A;  3LM9 A;  5E26 A;  5AQU A;  3D2E A;  1J6Z A;  1C0G A;  2IVO A;  4QS7 A;  2W40 A;  1LCU A;  4BRF A;  2YHX A;  2Q1N A;  3A5M C;  2NRH A;  3CJ1 A;  4CZM A;  5AZJ A;  2CGL A;  4FWP A;  2OAN A;  4K41 A;  5AQQ A;  1BWF O;  3VEY A;  3A5N C;  5AQM A;  4FOE A;  1HKB A;  4AM7 A;  1SQK A;  1NGF A;  5TKY A;  3H1Q A;  3P4I A;  4XH4 A;  3GDQ A;  4B1U B;  2EWS A;  3G25 A;  3LDQ A;  4PL8 A;  4MLH A;  5AQX A;  2ZGY A;  4BRG A;  1LOT B;  3O08 A;  4BC3 A;  2E88 A;  1GLB G;  1X3N A;  4BRN A;  1QHA A;  4WYB A;  1WOQ A;  5AQT A;  4BG8 A;  4HTL A;  5AQV A;  3VEX A;  1NM1 A;  4B1Y B;  2J4R A;  3LDN A;  4H0Y B;  3DXM A;  5AQL A;  4H0P A;  3O6W A;  1MWM A;  4CZJ A;  3HI0 A;  4CD3 A;  3MK6 A;  4FPA A;  1ZXO A;  1S22 A;  4KBO A;  1MA9 B;  4ISE A;  4J8F A;  3R8E A;  1XQS C;  2ASP A;  1T6C A;  3HTV A;  1DEJ A;  1GLD G;  5AQS A;  5ELZ A;  3UKU B;  5JMV A;  5BRH A;  5JLH A;  4M63 C;  1TYQ B;  4O8K A;  2E8A A;  4B1V A;  3FFK B;  2CH6 A;  1BO5 O;  2KHO A;  1K8K A;  1NGE A;  1KAZ A;  5E84 A;  4IJN A;  5JLF A;  4JD2 A;  4JD2 B;  4IXC A;  3H45 C;  2Q0U A;  5AR0 A;  1NGH A;  5BRF A;  2CH5 A;  3H3N O;  1HKG A;  4BC4 A;  4PKH A;  5ADX A;  3O1B A;  4FWS A;  3VGM A;  2P9P A;  3ATU A;  4A61 A;  5BRE A;  3WXJ A;  3ATV A;  4M7Y A;  5F0X A;  2BUP A;  4DCH A;  3WXI A;  1T44 A;  3UE5 A;  1Z05 A;  1GLF O;  3FZL A;  4FO0 A;  3S41 A;  1EQY A;  3LM2 A;  4BRO A;  4CBW A;  3ZEU B;  3QFP A;  2YCH A;  3CIP A;  1ATN A;  3HM8 A;  2A42 A;  1U2V B;  4BVO A;  2DPN A;  5AQH A;  2V7Z A;  2YI1 A;  4H5W A;  5AQY A;  3O1W A;  3KZB A;  4JAX A;  4BRE A;  1NBW A;  3H1V X;  1JCE A;  2Q0R A;  4BR9 A;  3VPZ A;  4BG9 A;  4BRM A;  2GEL A;  3BF1 A;  3CJB A;  3CHW A;  3VGK A;  4CZI A;  1MWK A;  3H3O B;  4FSV A;  3VGL A;  3MN7 A;  1KAX A;  3ZET A;  5KQ8 A;  3IDH A;  5BPN A;  4CBX A;  4GY2 B;  3R9P A;  1V4S A;  3SJH A;  5AQK A;  3BUZ B;  4GNI A;  3JS6 A;  1H1V A;  3KVG A;  2P9L A;  2P9L B;  3ULE A;  3ULE B;  4BQL A;  5EOY A;  4FWO A;  1NGI A;  3QFU A;  4HWI A;  3TPQ A;  1GLE G;  1MDU B;  3RSE B;  1JCF A;  3EKS A;  3FE1 A;  3DWL A;  4A2A A;  1BA0 A;  3BP8 A;  4WQ5 C;  5FPM A;  2ZGZ A;  4MO4 A;  1U6Z A;  5AQO A;  2D0P A;  4E1J A;  2GTD A;  3D2F B;  3D2F A;  4IJA A;  4BVP A;  3WXK A;  4WQ5 A;  4JN4 A;  5KPR A;  1HX1 A;  2P9S B;  5BPM A;  1P8Z A;  1ESV A;  5B8H A;  2IVN A;  4PKI A;  3SLC A;  1RFQ A;  1SZ2 A;  2F9T A;  2YJF A;  2HOE A;  4BR4 A;  4FPB A;  3MMV A;  3DXK B;  4FL9 A;  4H0O A;  1BOT O;  4BRL A;  2FLO A;  3UKR B;  4CJ7 A;  5LY3 A;  1HUX A;  4CI6 A;  4XH5 A;  5BR9 A;  4YDU C;  5JIC A;  4BRD A;  4ISG A;  3H6E A;  3A5L C;  2BTF A;  4EHU A;  3HZ6 A;  1SAZ A;  2E1Z A;  3VEZ A;  3DAW A;  4YDU A;  3QBX A;  3QBW A;  1XUP O;  4EAH D;  5AQN A;  3VEN A;  2E2Q A;  2YJE A;  3QIC A;  1ZC6 A;  1YUW A;  1RGI A;  3O5B A;  3C7N A;  3C7N B;  3M1F A;  4H5R A;  5EXW A;  2D1K A;  5AQR A;  1TUU A;  3VF4 A;  3UKU A;  4LC9 B;  3LDL A;  3MN9 A;  3WQT A;  5EY4 A;  1TYQ A;  4NB4 A;  2GWJ A;  1BA1 A;  1HJO A;  4JNE A;  5AQG A;  3WXL A;  2FSN A;  5KQD A;  3VOV A;  1X3M A;  4Y0W A;  3C0B A;  4JHD B;  4F9O A;  3L0Q A;  4BGA A;  2QWL A;  5EVZ A;  1BU6 O;  1C0F A;  3VF2 A;  3WT0 A;  2V52 B;  2AA4 A;  2E2O A;  3MDQ A;  5AQJ A;  4I6M A;  4I6M B;  4C23 A;  4BRA A;  3MCP A;  2I7N A;  3ZX2 A;  4IWV A;  2CGJ A;  5LJV A;  4BR5 A;  4BR0 A;  3ZEU A;  2CGK A;  3M3Z A;  4FWK A;  2HMP A;  2GWK A;  2IIR A;  2Q31 A;  5BRD A;  3VER A;  5KPZ A;  2E1Y A;  2GEM A;  5AQF A;  4BC5 A;  1Y64 A;  1U2V A;  4DQ8 A;  4B1Z A;  2FF6 A;  1GLL O;  2Q97 A;  2QM1 A;  3A0I X;  3FLC O;  4A2B A;  2D4W A;  4CD1 A;  5AQI A;  4DHY A;  3U9Z A;  4FWN A;  3LDO A;  4EHT A;  2QWQ A;  1QQO A;  3GL1 A;  1GLA G;  1QQN A;  1YAG A;  2FSK A;  4B1X B;  2P9N B;  4H5T A;  3FZM A;  4BC2 A;  4BRK A;  3ENO A;  2UYT A;  2ASO A;  1CZA N;  2VYP A;  1ATS A;  3VEW A;  2FXU A;  1NGA A;  1NGG A;  3I8B A;  3I33 A;  1NGC A;  2ASM A;  5AFU A;  4FWQ A;  4DB3 A;  5F1X A;  5AQW A;  2E20 A;  2QWR A;  4H0T B;  1YXQ A;  3EKU A;  4QS9 A;  1NGD A;  4RCH A;  2ITM A;  3CQX A;  4Z94 A;  3D7E O;  5FPE A;  4O5F A;  2A6A A;  3FGU A;  3CJ7 A;  3F9M A;  1X9J A;  2NZT A;  5CE3 A;  3O4W A;  1XC3 A;  3RSE A;  3IFR A;  1TUY A;  1ZBS A;  1T6D A;  4FWR A;  3BEX A;  4BR7 A;  4CZG A;  5FPD A;  3CET A;  1GLC G;  2E2P A;  3AY9 A;  1S3X A;  3VEO A;  1QQM A;  4EFH A;  3AAR A;  5LJW A;  3ZX3 A;  2P9S A;  2QXL A;  3EL2 A;  1Z6R A;  3J8A A;  2IVP A;  3W3D A;  2VWB A;  2I7P A; 
#chains in the Genus database with same CATH topology
 5A2Q O;  3T3F A;  3D2E B;  3NGI A;  3PUF A;  3U3Y A;  3DLL L;  5M1P A;  4BAC A;  1M1K O;  2O8C A;  4CZE A;  3QNN A;  5AZJ B;  3C94 A;  4U7B A;  3DJC A;  3EYZ A;  2NLX A;  3V9S A;  4BEC A;  3MCA B;  2O8F A;  3HOS A;  4YOT A;  5SWM A;  3S9H A;  4DTX A;  2HHU A;  3CJC A;  3B8A X;  3SMS A;  2D5R A;  4YOU A;  3PX4 A;  3L3V A;  2B6A A;  1NU0 A;  5JVH L;  4CHP A;  3EEQ A;  4B9Q A;  4KI6 A;  1RTJ A;  4BRC A;  3OYL A;  5AZI B;  5KRT A;  3LL3 A;  4W5Q A;  3O9T A;  3TAR A;  3CM5 A;  4H0V B;  3SK3 A;  1RDW X;  3CFR A;  1OH8 A;  4N5S A;  2FBT A;  4C8L A;  1Q81 O;  3HBT A;  4MO5 A;  4B3O A;  3ENH A;  4H5V A;  2AP1 A;  3U8X A;  2WTU A;  3SMP A;  5FDL A;  1S9E A;  3U9D A;  3IAY A;  3TSU A;  3GBT A;  3AVJ A;  2YHA A;  3KLI A;  1JCG A;  1DTQ A;  4JI1 K;  2OA8 A;  2YX6 A;  3L2Q A;  3WEE A;  2VCP A;  4IG0 A;  3U3G A;  1R59 O;  1RT7 A;  3ZSO A;  1HNZ K;  4F3O A;  4BWM A;  4YOW A;  3VN5 A;  4BRI A;  2OZM A;  2FF3 B;  2P9P B;  1HPM A;  2Q2R A;  1BDG A;  3TTD A;  1TL3 A;  5CYM A;  1TK8 A;  4HUF A;  3OYI A;  4E7L A;  2A3Z A;  2HHH K;  5AQZ A;  2JLE A;  4WFA L;  3O9U A;  5AQP A;  5LMN K;  1VAZ A;  2KTQ A;  3E9L A;  2DY4 A;  1WSH A;  3ZT4 A;  3NCI A;  4CZL A;  2B4J A;  3EO3 A;  1RDB A;  2A41 A;  3QNO A;  4DQP A;  4AQY K;  1KAY A;  1KLN A;  2XO7 A;  2IGI A;  3K9K A;  5SZT A;  1VQO N;  3AVA A;  5IWA K;  2O8B B;  2PBD A;  2XY6 A;  4RTF D;  5ADX H;  1QZ5 A;  4DQR A;  1YVN A;  3HSC A;  5BN8 A;  1S6P A;  3QET A;  1KFD A;  4XEI A;  3SCX A;  4C8M A;  4DR4 K;  2HF4 A;  2GV9 A;  4DV7 K;  4JS4 A;  4IKF A;  4JKH A;  4CZK A;  5K14 A;  5EX5 A;  3M8S A;  3CQY A;  3MN6 A;  2OPR A;  1EX4 A;  4H4M A;  4BGB A;  4CEB A;  4ISF A;  2FSJ A;  1ATR A;  1ZBU A;  3SUO A;  3WNF A;  4BRQ A;  1J9A A;  3WUH A;  4B3R K;  5I3U A;  3LDP A;  3HM9 A;  4JK8 A;  3O3F A;  3LM9 A;  4DUY K;  5E26 A;  4CF8 A;  4YOY A;  1J6Z A;  1LCU A;  2YHX A;  3VQD A;  1WAJ A;  4AIL C;  4ID5 A;  2CGL A;  1KD1 O;  4K41 A;  1BWF O;  4M3U A;  5J2M A;  4FOE A;  3M5R A;  3L2V A;  3V9U A;  3P4I A;  5HRN A;  1U47 A;  4DTJ A;  4A57 A;  4B1U B;  4IOA L;  3CC7 N;  1GOB A;  3O08 A;  4DTM A;  1A5V A;  4BG8 A;  3F73 A;  4CHN A;  4H0Y B;  4JKE A;  4X65 K;  1S1X A;  5AQL A;  4H0P A;  1RIL A;  4B9T A;  3O6W A;  3OYM A;  4JI7 K;  3ZT0 A;  3SV3 A;  2Z1J A;  2KQ2 A;  5M1N A;  4DU3 A;  4FZY A;  4J8F A;  3DMJ A;  4G9Z A;  3DM2 A;  2ASP A;  3QEV A;  1GLD G;  3THW B;  3VQC A;  3V1Q A;  5JMV A;  3U6F A;  2RKI A;  4KHN A;  4I9L A;  2E8A A;  4O8K A;  4B1V A;  2HHT A;  3TAE A;  1A5W A;  2KW4 A;  5AR0 A;  1NK7 A;  2Q0U A;  4C8N A;  5BRF A;  2X78 A;  3OA9 A;  3H3N O;  1K73 O;  2KLA A;  3LAK A;  1NJW A;  5F0X A;  3ATU A;  3NF8 A;  4A61 A;  3WXJ A;  3AVN A;  5BRE A;  1BQM A;  4DFP A;  4M3W A;  4CGI A;  1MU2 A;  3SNN A;  3WXI A;  1WSF A;  4KTQ A;  4FO0 A;  1YJW N;  3LM2 A;  3CCM N;  2RF2 A;  2EX3 A;  2YCH A;  4CJV A;  4E7J A;  3VQ6 A;  3PIO L;  1RBR A;  4BVO A;  4FLY A;  5AQH A;  3HPO A;  2YI1 A;  3KZB A;  1NBW A;  1RT5 A;  3G4S N;  2QI2 A;  3PX0 A;  4EZ6 A;  4OPH A;  3I55 N;  4ILJ A;  3KK7 A;  3RMD A;  3CHW A;  1VQP N;  4GKJ K;  4DS4 A;  1IKX A;  2ZM6 K;  1MWK A;  1L3U A;  4FXD A;  4FW1 A;  3TSQ A;  4FSV A;  3VGL A;  3IDH A;  3SV4 A;  4E7H A;  3SQ2 A;  1TL1 A;  3BUZ B;  4DF8 A;  4RG8 A;  2P9L A;  4BQL A;  5EOY A;  3I8D A;  4FW2 A;  3F5T A;  3HST B;  1ASU A;  2IOC A;  2VG7 A;  4CGD A;  4QOZ B;  1MDU B;  3RMC A;  1JCF A;  1BIS A;  1P90 A;  2F8T A;  1L3T A;  3CD6 N;  4C1N I;  4A2A A;  2ZGZ A;  1EWR A;  1TKD A;  3NAE A;  1YJ9 N;  1EWQ A;  3LP3 A;  3D2F B;  4BVP A;  4K0K K;  3AGR A;  2P9S B;  1LAV A;  4IFY A;  4CHQ A;  4B3S K;  5B8H A;  2IVN A;  5EU7 A;  3SLC A;  1IKY A;  1RFQ A;  2F9T A;  4BR4 A;  3QO9 A;  1OVY A;  3CM6 A;  1HR0 K;  1EP4 A;  2VQE K;  4FJM A;  1BOT O;  4BRL A;  5GAH P;  3VQE A;  4CI6 A;  2IC3 A;  3CCU N;  4YDU C;  5JIC A;  3H6E A;  4EHU A;  2E1Z A;  3VEZ A;  3DAW A;  4YDU A;  5DM6 L;  2QTD A;  1XMQ K;  3VEN A;  4DS5 A;  2E2Q A;  3QIC A;  1YUW A;  3MED A;  3O5B A;  1N36 K;  3C7N B;  4ZHR A;  4H5R A;  2D1K A;  3OY9 A;  3VA0 A;  1TUU A;  3O3G A;  3JYT A;  3UKU A;  3WQT A;  3MN9 A;  1NOY A;  1HNX K;  1HJO A;  3HJF A;  3WXL A;  5KQD A;  1X3M A;  4Y0W A;  3J7Z O;  3L0Q A;  4BGA A;  4R79 A;  4DSK A;  1C0M A;  1C0F A;  3G0Z A;  3NDK A;  4CJ5 A;  1CXU A;  1NG9 A;  4JV5 K;  5T7B A;  2E2O A;  1Y97 A;  2F7T A;  3MDQ A;  5AQJ A;  5KRS A;  2W42 A;  2VWK A;  4CJF A;  4I6M B;  4C23 A;  4BRA A;  3VQ7 A;  1VRU A;  2ZQB A;  3ZSY A;  3ZX2 A;  4IWV A;  3CQ8 A;  2CGJ A;  2NRR A;  3NMU A;  4BR0 A;  3ZEU A;  3OJS A;  3ZSW A;  3V6D A;  2NRX A;  1IBM K;  2Q31 A;  3VER A;  5KTQ A;  3L2W A;  1NNE A;  3LP1 A;  4A59 A;  2YKM A;  3M8R A;  4YHH K;  1GLL O;  3LAL A;  2NNW A;  5HL7 L;  2D4W A;  3I0R A;  4UQG A;  1J53 A;  1Q86 O;  5DK5 A;  3SI6 A;  5C25 A;  2RPI A;  4EHT A;  3S5T A;  1QS4 A;  2PFU A;  2HBM A;  1W9H A;  4EP4 A;  1RBU A;  3DLE A;  3GL1 A;  3NGY A;  4JKG A;  2P9N B;  4BC2 A;  3AVC A;  1LWC A;  1SL1 A;  1CZA N;  3VEW A;  1Q82 O;  1HYV A;  4C8K A;  3OYG A;  5HBM A;  3OYA A;  3K58 A;  3THY A;  1VSL A;  4RCH A;  4H0T B;  1YXQ A;  3EKU A;  1EET A;  5FPE A;  4E1M A;  4CIE A;  3KLE A;  1W2B M;  5J2Q A;  2NZT A;  3T69 A;  1VRT A;  1LAW A;  1E3M A;  4G1Q A;  2G8H A;  1SV5 A;  1YF5 L;  3CET A;  4BWJ A;  4LFA K;  4BE7 B;  2E2P A;  1S3X A;  3VEO A;  4N76 A;  1QQM A;  2QA4 N;  3QLH A;  5LJW A;  3K9J A;  2QXL A;  3B6O A;  4I7F A;  3K5N A;  4FJ8 A;  5DM7 L;  4CFB A;  3W3D A;  4FJX A;  2UXC K;  3K5O A;  3H46 O;  1VQK N;  3NVM A;  3DXK A;  3QIN A;  3P39 A;  2NRV A;  3FZH A;  1RDD A;  2FBX A;  1Q9X A;  4BE1 A;  2P9U B;  2WUS A;  4Z4E A;  3NF9 A;  4O4G A;  4NO7 A;  3FZK A;  2VGN A;  3OYH A;  2ZE2 A;  3P83 D;  1LWF A;  4ILH A;  4E0D A;  3KLH A;  3V9W A;  4J2E A;  3LP2 A;  4AM6 A;  3F9K A;  1O13 A;  5GAD P;  2W41 A;  1N34 K;  2QWO A;  5AZI A;  2UUC K;  2XY7 A;  3EN9 A;  4FLW A;  1KVA A;  2V51 B;  3R6M A;  4JK9 A;  1SKW A;  3DOK A;  3DXM B;  2ZJP L;  4CK1 A;  4JHD A;  3SYZ A;  1SL0 A;  4HUG A;  1QVG M;  4CF0 A;  4XIU A;  2P9K B;  3T1H K;  1L3V A;  1RDA A;  1FJG K;  4KH6 A;  2IAJ A;  4B1W B;  1C1B A;  3L4I A;  2BE2 A;  3AAQ A;  2V7Y A;  3VF6 A;  2E2N A;  1BG3 A;  4V19 S;  3QML A;  1VSI A;  5JEN A;  3SQ1 A;  1K8K B;  1OKJ A;  3RVC A;  1KXP A;  3O4N A;  4HUE A;  2Z1H A;  4DTU A;  4AHR A;  3LWL A;  4FOI A;  2QK9 A;  1HKC A;  1REV A;  4QCL A;  1BL3 A;  1UWB A;  2C1G A;  3HP6 A;  4WFN L;  1CZ9 A;  1T7P A;  4FCY A;  4LSL A;  4N41 A;  2D0C A;  1BUP A;  1NJY A;  3HK2 A;  2DFF A;  3VET A;  2PAV A;  3EZW A;  1W7A A;  1OH7 A;  3O4Q A;  4U67 L;  2A40 A;  3ZLJ A;  4K42 A;  4FM2 A;  4CJS A;  1IG8 A;  5I42 A;  2FBV A;  4B08 A;  1QQC A;  1NGJ A;  4CER A;  3WQU A;  5C0Y A;  4CEE A;  1FW6 A;  4PL7 A;  2UXB K;  4TSX A;  1U4B A;  4F3T A;  1DKG D;  3JXU A;  3WXM B;  2Q36 A;  4HCB A;  3A8Y A;  1K9M O;  2Z1G A;  4KFB A;  4PA1 A;  4MDA A;  1RDC A;  4XJX A;  2XHB A;  3D6R A;  4KHU A;  2HVI A;  1SKS A;  2JWL A;  1HQU A;  1TK5 A;  5AQU A;  3M8Q A;  2IVO A;  3ISN C;  4BRF A;  3ITH A;  3A2F A;  5JS2 A;  2NRH A;  3PO4 A;  1B92 A;  4LSN A;  3KLF A;  4DV6 K;  3CPW M;  3AO3 A;  5AQQ A;  4AHC A;  1RTI A;  4IBN A;  3A5N C;  5AQM A;  2PY5 A;  3AVG A;  4DFJ A;  1HKB A;  4DR6 K;  1VSF A;  1SQK A;  3OYC A;  3ZT1 A;  4X62 K;  3EZ5 A;  3LDQ A;  4DV1 K;  3NH2 A;  1LWE A;  2ZGY A;  4OPK A;  4BRG A;  1LOT B;  3R1X A;  4WE1 A;  1N6Q A;  3HPG A;  4BRN A;  4BE0 A;  5AQV A;  4I2Q A;  4B1Y B;  2J4R A;  3LDN A;  3MX5 A;  3PLA A;  3DLR A;  1MWM A;  4DV0 K;  2ATQ A;  3MK6 A;  4JKB A;  1NK8 A;  1ZXO A;  1S22 A;  1D9D A;  3HTV A;  4O0J A;  1DEJ A;  5AQS A;  4DSF A;  5E41 A;  3N4P A;  3TR8 A;  4M63 C;  1TYQ B;  4OX9 K;  4Y1D A;  1BO5 O;  3LDS A;  1NGE A;  3AA5 X;  4IJN A;  3VTH A;  5JLF A;  3KLG A;  4JD2 B;  4FM1 A;  3THV A;  2CH5 A;  3NHG A;  1ZBF A;  1RDU A;  4PKH A;  5C12 A;  3P5J A;  3O1B A;  4CEZ A;  2XRI A;  5HRR A;  4JKC A;  1S1W A;  2BUP A;  3TTC A;  5M1F A;  4M3Z A;  1OVQ A;  3AVI A;  1QTM A;  1K8A O;  1ITG A;  4DV2 K;  3QFP A;  5GIO A;  2NRW A;  3AVH A;  4KHQ A;  1ATN A;  3PV8 A;  1U2V B;  2V7Z A;  5AQY A;  1C1C A;  4O8U A;  3C6U A;  4BR9 A;  1RT2 A;  3PSI A;  4OVL A;  2GEL A;  2W00 A;  4JI2 K;  2G8W A;  1JXB A;  4CZI A;  3NF6 A;  4MDB A;  3OJU A;  1KVB A;  4CJR A;  2JWK A;  4EP5 A;  4E1N A;  1KAX A;  3ZET A;  1YTA A;  5BPN A;  4GY2 B;  3SAF A;  3R9P A;  1XHZ A;  4FK4 A;  4IEI A;  1HNI A;  3SBT A;  4GNI A;  3SPZ A;  3D45 A;  2X6N A;  3KVG A;  3ULE B;  3V81 A;  1NJX A;  2P5G A;  2NRT A;  4CF9 A;  1NGI A;  3LPT A;  4IG3 A;  3TPQ A;  3QES A;  3AO2 A;  1KCF A;  1WBB A;  5HRS A;  4DTS A;  1YVU A;  4KKO A;  4JRP A;  4WQ5 C;  4W5R A;  1VK0 A;  5C15 A;  2XY5 A;  1X1P A;  3D2F A;  4NCB A;  4IJA A;  4WQ5 A;  1HX1 A;  1S1T A;  3HXM A;  1QE1 A;  4OGE A;  2YJF A;  1JLB A;  4CJ3 A;  3KIO A;  4FVM A;  2O8C B;  4CIF A;  5GAG P;  4PY5 A;  2BTF A;  3E66 A;  3AO4 A;  3MEC A;  4A5A A;  1BCO A;  4FJJ A;  2VGM A;  4M45 A;  1WNS A;  3QBX A;  4CJT A;  3QBW A;  4ICL A;  3WNH A;  4M3X A;  1U04 A;  1XUP O;  4EAH D;  4IFE A;  1XI1 A;  1ASW A;  2YJE A;  2QEX N;  1ZC6 A;  4C1N K;  1KRP A;  1N5Y A;  3C7N A;  5EXW A;  1D9F A;  3MXI A;  4ID1 A;  3VF4 A;  2OYQ A;  3LDL A;  3J80 O;  3OS1 A;  2JGU A;  5EY4 A;  4UY8 O;  4Z4F A;  2GWJ A;  1BA1 A;  3MEE A;  4JNE A;  4E89 A;  3OS2 A;  2ETJ A;  1WB9 A;  4KHW A;  5CYQ A;  2HB5 A;  1IV0 A;  1YHQ N;  3MWT A;  4PQU A;  4CJQ A;  3K57 A;  3VF2 A;  3TAF A;  4OKK A;  4R5P A;  1X9M A;  3R3L A;  3AO1 A;  4I6M A;  3ZSR A;  3NF7 A;  3MCP A;  3S3N A;  1SKR A;  2WBN A;  4CEO A;  3SUN A;  2BAN A;  1IBL K;  2GWK A;  1DTT A;  4DSI A;  4OLA A;  3VQP A;  5KPZ A;  2E1Y A;  2GEM A;  2HHQ A;  3Q7B A;  1ZBL A;  1Y64 A;  1JLA A;  1J5O A;  1EKE A;  2Q97 A;  3PO5 A;  4JKD A;  2RN2 A;  4FJN A;  3KK3 A;  4CEF A;  3U9Z A;  3CME N;  1TAU A;  1WBD A;  4FWN A;  4W5T A;  4WF9 L;  1VQM N;  1XC9 A;  3J7Y P;  4PUO A;  1QQN A;  4YOX A;  4B1X B;  5KI6 A;  4H5T A;  3FZM A;  4RW9 A;  2VYP A;  4Y1C A;  1WSE A;  3ZSQ A;  1VSE A;  1NGG A;  3I8B A;  3I33 A;  1NGC A;  3CCE N;  1KVC A;  3DLH A;  4O55 A;  3I56 N;  4DB3 A;  5AQW A;  4DLE A;  2ITM A;  2E20 A;  4QS9 A;  3V9X A;  3CQX A;  1RTD A;  4Z94 A;  3MXJ A;  1TV6 A;  4O5F A;  4CGH A;  4NYF A;  2A6A A;  4B9L A;  3TAB A;  4CJU A;  3O4W A;  3RSE A;  4K8Z A;  3OW2 M;  5LMU K;  2RHK A;  2ZD1 A;  3SZ2 A;  4BDP A;  4FWR A;  4CZG A;  4BR7 A;  1WSG A;  3LP0 A;  3O3H A;  4DTP A;  3T7Z A;  1CZB A;  3AY9 A;  3AAR A;  3V4I A;  3EL2 A;  4KH4 A;  1Z6R A;  3K5M A;  4BDY A;  3J8A A;  4RW8 A;  4IO8 A;  3OYE A;  3AVF A;  3SJJ A;  2OTJ N;  4F8R A;  4CEQ A;  1NK4 A;  5F2R A;  4MLE A;  2B5J A;  3UKR A;  1JLG A;  4M7X A;  1Q8I A;  2P9U A;  4M3Y A;  1J54 A;  4AH9 A;  4CED A;  4I9Q A;  1HLU A;  1TKZ A;  1YIJ N;  4FLU A;  1DGK N;  1XNR K;  4IOX A;  3CCR N;  1IH7 A;  4NXN K;  4WFB L;  3OYJ A;  1BCM A;  1T3V A;  2IDO A;  3VQQ A;  4LFB K;  1Q9Y A;  3MX2 A;  3FR0 A;  3QB0 A;  1D4X A;  4J2A A;  1E4F T;  4DSE A;  4CFC A;  1RBV A;  2WFB A;  2QWP A;  1NLV A;  5C10 A;  2G8F A;  2F96 A;  1CLQ A;  2P9K A;  2FC0 A;  2Z1I A;  4FJ9 A;  1RTH A;  3ZX0 A;  2A5X A;  4YNQ A;  1VQ5 N;  3MN5 A;  4WCE L;  3CXC M;  2QW9 A;  4LY7 A;  2D0A A;  3CER A;  3PIP L;  3OYD A;  1S72 N;  5JS1 A;  1V4T A;  1NJI O;  1OH5 A;  2YHY A;  4K43 A;  4KTW A;  3GE1 A;  3AO5 A;  1G99 A;  1IO2 A;  3SPY A;  5KPT A;  1S5J A;  3CFO A;  2E5L K;  4A5B A;  1RCH A;  1FXX A;  2F9W A;  3U4L A;  3CJ9 A;  3VES A;  4HTU A;  4E3S A;  4K25 A;  4DMN A;  1NGB A;  5BPL A;  3C65 A;  2W6K A;  4A62 A;  3TI0 A;  3WNG A;  1KSP A;  4CBU A;  4HHT A;  3HOT A;  3GG4 A;  4LF4 K;  1UOC A;  1XHX A;  2A1S A;  4H5N A;  1QSS A;  2G8U A;  2HMI A;  3KWI A;  1T03 A;  5CZ1 A;  1BI4 B;  1OH6 A;  3N4Q A;  3KHY A;  1N8R O;  4L3Q A;  4BRH A;  2P9I B;  2HND A;  1E4G T;  3EY1 A;  3QDK A;  1C1A A;  3IKM A;  5JVG L;  2VWJ A;  2HHI A;  1IJJ A;  4PKG A;  2O8D A;  4IZ9 A;  4JRQ A;  1EXQ A;  3TAQ A;  4CES A;  2WC9 A;  1YIT N;  3UB5 A;  1NMN A;  3G71 N;  3THX A;  3NE6 A;  1A5X A;  1I39 A;  2HF3 A;  2HNY A;  3NFA A;  3DI6 A;  3HVR A;  3CC2 N;  2ZWH A;  4FZZ A;  1JL1 A;  4BE2 A;  4LH4 A;  1BIU A;  4NYN A;  3CCS N;  3SQ0 A;  3L6Q A;  3ID8 A;  3L8B A;  4EIA A;  4GMJ B;  5CHI A;  4KO0 A;  3P31 A;  2QWN A;  4DSL A;  1WN7 A;  2D0B A;  3D2E A;  4LF8 K;  4QS7 A;  5KGX A;  2O8E B;  4RW7 A;  1C0U A;  3B6P A;  1J5E K;  4DTN A;  3A5M C;  3G10 A;  3CJ1 A;  3MWP A;  5AZJ A;  1HPZ A;  3VQA A;  3RRH A;  4JI4 K;  4I2P A;  4KHS A;  4NCG A;  2VG6 A;  3RR8 A;  4DWI A;  3VQ8 A;  2OCE A;  5HOO A;  4DG1 A;  5M1K A;  4B8A B;  2ZJR L;  4CJ4 A;  2P5O A;  2EWS A;  1Z25 A;  4PL8 A;  4MLH A;  3CCV N;  5J2N A;  1JL2 A;  2E88 A;  4KB1 A;  4M3R A;  1GOC A;  2OZS A;  3PY8 A;  4WYB A;  5AQT A;  4O0I A;  4HTL A;  3LPU A;  3VEX A;  3QIO A;  3L2U A;  3SBG A;  2HNZ A;  1W97 L;  1JXE A;  3C95 A;  4BDZ A;  3HI0 A;  4CD3 A;  3HPH A;  2WOM A;  4Q0B A;  3VA3 A;  4NLB A;  4KBO A;  1BQN A;  4B3T K;  3R8E A;  3CYM A;  1T6C A;  1QVF M;  1O1W A;  2WON A;  1QSY A;  5ELZ A;  3UKU B;  4YOR A;  4AHT A;  4FJ7 A;  5BRH A;  5JLH A;  2HHV A;  4E19 A;  2GUI A;  3ZT2 A;  3FFK B;  1G15 A;  3BGR A;  4LF7 K;  2KHO A;  1KAZ A;  2YNH A;  5E84 A;  5TKW A;  3SQ4 A;  4JD2 A;  4IXC A;  3H45 C;  1LW2 A;  1NGH A;  1N33 K;  2UU9 K;  4M3T A;  4BC4 A;  5ADX A;  3KD1 E;  2HHX A;  4CGJ A;  4FWS A;  3VGM A;  2P9P A;  1UAX A;  4CJP A;  1I94 K;  2UXD K;  3ATV A;  4M7Y A;  4DCH A;  1Z05 A;  1GLF O;  1YJN N;  1EQY A;  4BRO A;  4LF6 K;  5H1S Q;  4CBW A;  3ZEU B;  4YOV A;  1B9D A;  4DLG A;  5GAE P;  4E7I A;  3HM8 A;  2A42 A;  3DRP A;  5C2D A;  1TK0 A;  5C24 A;  4CF1 A;  3O1W A;  1T8E A;  3ZYY X;  4BRE A;  4CE9 A;  3AVL A;  4CK2 A;  3H1V X;  1JCE A;  1U48 A;  4QAG A;  2O8B A;  1VSJ A;  3BF1 A;  3CJB A;  4LF5 K;  1Q7Y O;  4JI3 K;  4FJL A;  1DLO A;  3AA4 A;  4FLX A;  4JKG B;  4FJK A;  3O9Q A;  4DV4 K;  3H3O B;  4LH5 A;  4DU4 A;  4MQ3 A;  5M1Q A;  4DFK A;  2FBY A;  4FVU A;  2IS3 A;  5KQ8 A;  4ELV A;  4KB0 A;  3ULE A;  1SS6 A;  3WNE A;  1CXQ A;  4FWO A;  1WSJ A;  3QFU A;  3RMB A;  3THY B;  2VG5 A;  4HWI A;  3ENB A;  1D8Y A;  2G8K A;  3DLG A;  4FK0 A;  1GLE G;  1NK5 A;  2W6L A;  4GVM A;  2E6M A;  3IS9 A;  1VSD A;  4DFM A;  3FE1 A;  1BA0 A;  3DLK A;  3BP8 A;  5FPM A;  1U6Z A;  3QIP A;  3TAP A;  4CJW A;  2OPP A;  4E1J A;  2GTD A;  3V9Z A;  3WXK A;  5KPR A;  1Z26 A;  1WLJ A;  4CHO A;  4LF9 K;  1BGX T;  2Q3S A;  1TGO A;  1EO1 A;  1N32 K;  3DRR A;  4CFA A;  1SZ2 A;  2HOE A;  3TAM A;  3JSM A;  4CJE A;  3DXK B;  1TKX A;  2ITG A;  4RW6 A;  4Z4H A;  3HO1 A;  2FLO A;  4CJ7 A;  3DOL A;  3RMA A;  5BR9 A;  2Y1I A;  3A5L C;  4JLH A;  3HZ6 A;  4FZX C;  3K2P A;  4CHY A;  3AVK A;  4F2S A;  3EE8 A;  4Z4G A;  2HW3 A;  5AQR A;  5FLX O;  3LZI A;  3THW A;  1FK9 A;  3NGZ A;  4FM0 A;  2F4V K;  1HNV A;  4LC9 B;  4L8R B;  4NB4 A;  4DKW A;  3SUQ A;  2FSN A;  4LFC K;  3VOV A;  4B9M A;  4DR2 K;  3C0B A;  4JHD B;  4ILG B;  2QWL A;  5EVZ A;  4KHP K;  1NK9 A;  3WT0 A;  4C8O A;  1HQE A;  2VQF K;  4DSJ A;  3CCQ N;  4O44 A;  3CFP A;  3SUP A;  4FLZ A;  4BR5 A;  3SAG A;  3L3U A;  2CGK A;  2YKN A;  3M3Z A;  4FWK A;  5BRD A;  1VQN N;  2I5J A;  4DQ8 A;  2GX9 A;  4B1Z A;  2FF6 A;  2HBK A;  3MXM A;  4CEA A;  4NXM K;  2QM1 A;  4A2B A;  3A0I X;  3M8P A;  1KFS A;  4CD1 A;  3C6T A;  5AQI A;  4DHY A;  5C2F A;  1NKC A;  3AVB A;  2AJQ A;  4DUZ K;  3LDO A;  1L3S A;  1NKB A;  3NH0 A;  1QQO A;  2G8I A;  3VQB A;  4JS5 A;  1S6Q A;  1GLA G;  2FSK A;  1VQ9 N;  1JLE A;  3NVK A;  1JLQ A;  3LAM A;  3QER A;  4B9N A;  2ASO A;  3TSP A;  1YI2 N;  2FXU A;  2BGG A;  1ZYQ A;  1RT3 A;  2ASM A;  1VQ4 N;  4LD0 A;  3OBY A;  5M1O A;  5F1X A;  3KKS A;  1YTU A;  4GV6 A;  4FYD A;  2QWR A;  3E01 A;  1NGD A;  5FRM A;  1KTQ A;  1RT4 A;  3D7E O;  4NLC A;  1HYZ A;  3FGU A;  3HP9 A;  3HT3 A;  3L2R A;  1D5A A;  4PWD A;  3IFR A;  1NOZ A;  3BEX A;  5FPD A;  3RRG A;  4IOC L;  1GLC G;  1NJZ A;  3O9S A;  4CGF A;  4DV5 K;  5DMR A;  4HCC A;  3C6H A;  3V1R A;  3UIQ A;  1ASV A;  3ZX3 A;  2P9S A;  4N56 A;  4X66 K;  2RE2 A;  2IVP A;  3J7A P;  2QXF A;  3W0L A;  1K6Y A;  5GIP A;  5AFU H;  4H03 B;  4CIG A;  2BDP A;  4JI0 K;  2YV0 X;  4KPY A;  3CJA A;  4DV3 K;  2DTU A;  2HBL A;  4RWT A;  3BDP A;  4M42 A;  3M6G A;  3IMX A;  4CW7 B;  2XY8 A;  3VEV A;  4DR3 K;  2NUB A;  2O8F B;  2ZF5 O;  1U45 A;  4CJL A;  3D0P A;  2PYJ A;  3CI5 A;  3O80 A;  1HMV A;  1QZ6 A;  3OYB A;  4AHU A;  4FJI A;  3HL8 A;  4KH5 A;  4CZF A;  1VQ6 N;  1NWK A;  2PZS A;  3DYA A;  1S9G A;  3KK1 A;  2GBZ A;  2KKZ A;  4XH1 A;  3QEI A;  2DFE A;  5MLC Q;  2YNG A;  3OHR A;  2G8V A;  4FWL A;  3LWM A;  1U49 A;  3AAP A;  2HST A;  5FRO A;  3GOI A;  1RT1 A;  2X74 A;  4Z0U A;  5BN9 A;  3ZCM A;  4CK3 A;  2E6L A;  3IUC A;  2YHW A;  2H3G X;  3C6A A;  2LSN A;  3IRX A;  4O5B A;  3VMF B;  1VQ8 N;  5FPN A;  4H0X B;  2QKB A;  5CY4 A;  1B9F A;  5J1E A;  4BRP A;  1TKT A;  3O9R A;  3OBW A;  1S1U A;  3WEE B;  3AV9 A;  4GW6 A;  1UA0 A;  3L4Q A;  1JLF A;  3SAH A;  3CCL N;  1X9S A;  3DLB A;  3TTF A;  4JYA K;  1Q18 A;  3NH1 A;  4EZ9 A;  3HVT A;  4CZH A;  4CJK A;  3ALY A;  1XNQ K;  4OLB A;  4GV3 A;  4WQ4 C;  3FZF A;  4FWM A;  5AJ3 K;  4F4K A;  2QWM A;  1NK6 A;  4X64 K;  1X9W A;  1GLJ O;  4CF2 A;  1WUA A;  2P9N A;  5C42 A;  4WQ4 A;  1L5U A;  3BF3 A;  3AA3 A;  4BEB A;  5J2P A;  2GUP A;  5LL6 Z;  4DQQ A;  1BI4 A;  3NBP A;  1IBK K;  3A5O C;  1SL2 A;  1IKV A;  4BR2 A;  1M90 O;  3KD5 E;  1VSH A;  1QHT A;  4JI6 K;  2KFZ A;  2P9I A;  4CGG A;  1FKO A;  3O8M A;  4B3M K;  2BH1 A;  4BQZ A;  2KZZ A;  2O4G A;  3CC4 N;  5I9E B;  3RR7 A;  3KK2 A;  4B8C A;  3ZET B;  4QS8 A;  4FK2 A;  1BIZ A;  3RTV A;  1XWL A;  2HHS A;  1LW0 A;  4B9V A;  3F2K A;  5IT9 O;  2ZJQ L;  4PHT X;  1JKH A;  3TU5 A;  2D0O A;  3FFI A;  1NMD A;  1SUQ A;  3E9P A;  4KTZ A;  4CVN E;  3K5L A;  3ZT3 A;  2O8E A;  1C0G A;  2W40 A;  4DF4 A;  4FLV A;  1LV5 A;  2Q1N A;  1WAF A;  3ZSV A;  4CZM A;  4CEC A;  4FJ5 A;  1DT9 A;  4FWP A;  3ZSZ A;  3LZJ A;  2OAN A;  4Q5V A;  3VEY A;  3HYF A;  1NK0 A;  1TAQ A;  4H4O A;  3PX6 A;  4YY3 K;  4AM7 A;  1NGF A;  5TKY A;  3H1Q A;  4XH4 A;  3GDQ A;  3G25 A;  4W5N A;  5AQX A;  3OS0 A;  3EE9 A;  4BC3 A;  2NRZ A;  1GLB G;  4AHS A;  1X3N A;  4K8X A;  3VQ4 A;  4DTR A;  1S1V A;  3KWG A;  1QHA A;  4DQI A;  1WOQ A;  1NM1 A;  1ILY A;  4IEE A;  2YNI A;  3DXM A;  4CZJ A;  3S3O A;  3OYN A;  4FPA A;  3I0S A;  3E9O A;  1I3A A;  2X6S A;  1MA9 B;  4ISE A;  1XQS C;  4DR5 K;  5BR8 K;  3AVM A;  3V1O A;  4ELU A;  2CH6 A;  3BY5 A;  3BZK A;  1K8K A;  3AA2 A;  1ZBI A;  3CPE A;  1KQS M;  1TVR A;  2UUB K;  2PYL A;  2C1I A;  4CFD A;  1HKG A;  1VQ7 N;  4RW4 A;  1F21 A;  1QSL A;  1NKE A;  1T44 A;  3UE5 A;  3FZL A;  3S41 A;  2OPQ A;  3AGK A;  4JKF A;  2OPS A;  4E72 A;  3CIP A;  1HNW K;  1VQL N;  4FJH A;  4GVE A;  2DPN A;  4IO9 L;  4H5W A;  3OTO K;  4DR7 K;  2HHW A;  4OGC A;  4JAX A;  2UUA K;  3CMA N;  4ELT A;  2Q0R A;  2O4I A;  5FRN A;  3VPZ A;  4BG9 A;  4H8K A;  4BRM A;  1YT3 A;  3VGK A;  4B9S A;  3VQ5 A;  1VSK A;  1KLM A;  5CZ2 A;  3OYK A;  3MN7 A;  3CYG A;  4BY9 C;  3VTI A;  4CBX A;  3TAN A;  1V4S A;  3SJH A;  4OJR A;  5AQK A;  5GIN A;  1T05 A;  3HRG A;  1RBT A;  3JS6 A;  1H1V A;  2P9L B;  1R0A A;  5HP1 A;  3ULD A;  3CG7 A;  3T1A A;  5HLF A;  4IDK A;  3QEX A;  1IKW A;  1VSM A;  2P51 A;  2F8S A;  3RSE B;  4JKA A;  1JLC A;  3EKS A;  5KGW A;  3DWL A;  4OO1 J;  1ZBH A;  4MO4 A;  1IG9 A;  2YNF A;  3T19 A;  5AQO A;  2D0P A;  1BHL A;  2E4L A;  2QKK A;  4JN4 A;  3S3M A;  4JK7 A;  5BPM A;  3ID6 A;  1P8Z A;  1ESV A;  4JI5 K;  4CCH A;  4PKI A;  3H08 A;  2A1R A;  2OTL N;  4FPB A;  3MMV A;  3KTQ A;  4FL9 A;  4KV8 A;  4H0O A;  2KFN A;  3G6E N;  3UKR B;  5LY3 A;  4AF1 A;  1HUX A;  4KI4 A;  4XH5 A;  4DR1 K;  5HRO A;  3MEG A;  4BRD A;  3ASM A;  4GV9 A;  4ISG A;  3J81 O;  4IFV A;  4CHZ A;  4DTO A;  3JAM O;  4J2B A;  1SAZ A;  5AQN A;  3CCJ N;  1RGI A;  3K59 A;  1GOA A;  3M1F A;  4MFB A;  4F2R A;  1W0H A;  4JI8 K;  4OPJ A;  4FJG A;  4W5O A;  3BZC A;  2KZM A;  1TYQ A;  2HVH A;  3KJV A;  1RT6 A;  5AQG A;  3QEP A;  4JEP A;  4E7K A;  4F9O A;  1FKP A;  1WSI A;  1BU6 O;  3RWU A;  4YFU A;  2Y1J A;  2V52 B;  2AA4 A;  4IDH A;  4ZTF A;  3E1Y A;  3PSF A;  2YHB A;  2I7N A;  4B9U A;  5LJV A;  2R7Y A;  4M41 A;  1HJR A;  2HMP A;  2IIR A;  5AQF A;  4BC5 A;  3T1Y K;  1U2V A;  4HVJ A;  3TWH A;  4KRF A;  3FLC O;  3OVN A;  4GKK K;  3OYF A;  4OKE A;  3IG1 A;  1XMO K;  4OKJ A;  1RBS A;  5D3G A;  3TAG A;  4AHV A;  2QWQ A;  4NCA A;  1YAG A;  4J2D A;  4ZTJ A;  3K0S A;  4KAZ A;  3MAQ A;  1HYS A;  1HRH A;  1RNH A;  4BRK A;  3ENO A;  2UYT A;  1ATS A;  1C6V A;  1NGA A;  3VQ9 A;  3ZSX A;  1KC8 O;  5AFU A;  4DQS A;  4N47 A;  4FWQ A;  4FLT A;  3DRS A;  3QEW A;  1UA1 A;  4KHY A;  3CJ7 A;  3F9M A;  1X9J A;  2O8D B;  5CE3 A;  1XC3 A;  1TUY A;  3P38 A;  3CF5 L;  1ZBS A;  1T6D A;  3THX B;  5HRP A;  2EHG A;  3Q7C A;  2HBJ A;  1VHX A;  4EFH A;  3LAN A;  2DFH A;  3P1G A;  1JJ2 M;  3KKR A;  2P1J A;  4Z4I A;  4DU1 A;  4KRE A;  2VWB A;  4OPA A;  1C0T A;  5CR4 A;  2I7P A;  4Z4C A; 
#chains in the Genus database with same CATH homology
 4IO8 A;  3W0L A;  3H46 O;  3D2E B;  5GIP A;  5AFU H;  4H03 B;  3NVM A;  1VQK N;  2OTJ N;  3DXK A;  3CJA A;  3P39 A;  3DLL L;  2HBL A;  5M1P A;  2NRV A;  3FZH A;  5F2R A;  4RWT A;  4MLE A;  3UKR A;  1M1K O;  4CZE A;  4M7X A;  5AZJ B;  3M6G A;  2P9U A;  2P9U B;  3DJC A;  4U7B A;  2NLX A;  3IMX A;  4BEC A;  2WUS A;  3MCA B;  3VEV A;  2ZF5 O;  4NO7 A;  3HOS A;  3FZK A;  4YOT A;  2VGN A;  3CI5 A;  1HLU A;  3O80 A;  1QZ6 A;  3CJC A;  1YIJ N;  3B8A X;  3SMS A;  4ILH A;  4YOU A;  1DGK N;  4KH5 A;  4CZF A;  4IOX A;  3CCR N;  5JVH L;  4AM6 A;  1VQ6 N;  4WFB L;  1NWK A;  4B9Q A;  1O13 A;  5GAD P;  1T3V A;  2W41 A;  2QWO A;  2KKZ A;  4BRC A;  3MX2 A;  5AZI A;  3FR0 A;  4XH1 A;  5AZI B;  3QB0 A;  3EN9 A;  1D4X A;  2V51 B;  3LL3 A;  1E4F T;  3R6M A;  3O9T A;  4JK9 A;  3OHR A;  5MLC Q;  4FWL A;  2WFB A;  4H0V B;  3SK3 A;  2QWP A;  3AAP A;  2HST A;  3DXM B;  2ZJP L;  1NLV A;  3GOI A;  5C10 A;  4JHD A;  1RDW X;  1QVG M;  2P9K A;  2P9K B;  5BN9 A;  3IUC A;  3HBT A;  1Q81 O;  4MO5 A;  3ZX0 A;  2A5X A;  2YHW A;  3ENH A;  2H3G X;  4KH6 A;  4B1W B;  3C6A A;  4H5V A;  2AP1 A;  1VQ8 N;  3VMF B;  3L4I A;  5FPN A;  3U8X A;  1VQ5 N;  3MN5 A;  3AAQ A;  4WCE L;  2V7Y A;  4H0X B;  3SMP A;  3VF6 A;  3CXC M;  2E2N A;  3U9D A;  1BG3 A;  2QW9 A;  3QML A;  3CER A;  3GBT A;  3TSU A;  4BRP A;  3PIP L;  1S72 N;  1K8K B;  1V4T A;  1JCG A;  1OKJ A;  2YX6 A;  1KXP A;  3O9R A;  3OBW A;  3RVC A;  1NJI O;  3WEE A;  3WEE B;  2VCP A;  1R59 O;  2YHY A;  4FOI A;  4K43 A;  3GE1 A;  1HKC A;  3L4Q A;  1G99 A;  2C1G A;  4YOW A;  4BRI A;  5KPT A;  2FF3 B;  3SAH A;  4WFN L;  3CCL N;  2P9P B;  1HPM A;  3TTF A;  4A5B A;  1Q18 A;  2F9W A;  3U4L A;  2Q2R A;  3CJ9 A;  3VES A;  1BUP A;  1BDG A;  3TTD A;  4K25 A;  4CZH A;  1NGB A;  3VET A;  5BPL A;  4GV3 A;  3C65 A;  2PAV A;  4WQ4 C;  2A3Z A;  3EZW A;  3FZF A;  4FWM A;  4A62 A;  5AQZ A;  4CBU A;  4U67 L;  2QWM A;  4WFA L;  1GLJ O;  3HOT A;  3GG4 A;  3O9U A;  1WUA A;  2A40 A;  5AQP A;  2P9N A;  1VAZ A;  4K42 A;  3E9L A;  4H5N A;  4WQ4 A;  3BF3 A;  3KWI A;  3EO3 A;  4CZL A;  4BEB A;  1IG8 A;  2A41 A;  2GUP A;  1KAY A;  3N4Q A;  3A5O C;  3K9K A;  4BR2 A;  1VQO N;  1M90 O;  3KHY A;  1N8R O;  1NGJ A;  4L3Q A;  4BRH A;  2PBD A;  3WQU A;  5C0Y A;  2P9I A;  2P9I B;  4RTF D;  1E4G T;  3O8M A;  5ADX H;  1QZ5 A;  2BH1 A;  4BQZ A;  4PL7 A;  3QDK A;  1YVN A;  3IKM A;  3HSC A;  5JVG L;  3CC4 N;  5BN8 A;  5I9E B;  1IJJ A;  4PKG A;  4IZ9 A;  4XEI A;  2HF4 A;  2WC9 A;  3UB5 A;  1DKG D;  3JXU A;  3ZET B;  1YIT N;  4QS8 A;  3G71 N;  3WXM B;  2Q36 A;  4JKH A;  3A8Y A;  2HF3 A;  4CZK A;  5EX5 A;  3CQY A;  3CC2 N;  3MN6 A;  2ZWH A;  4BGB A;  1K9M O;  4MDA A;  3F2K A;  2ZJQ L;  4ISF A;  3TU5 A;  4PHT X;  2D0O A;  3CCS N;  2FSJ A;  4XJX A;  3L6Q A;  1NMD A;  1ATR A;  3ID8 A;  3D6R A;  4EIA A;  4BRQ A;  3E9P A;  5CHI A;  3WUH A;  2JWL A;  3LDP A;  2QWN A;  3P31 A;  4JK8 A;  3LM9 A;  5E26 A;  5AQU A;  3D2E A;  4YOY A;  1J6Z A;  1C0G A;  2IVO A;  4QS7 A;  2W40 A;  1LCU A;  4BRF A;  2YHX A;  2Q1N A;  3A5M C;  2NRH A;  3CJ1 A;  4CZM A;  3MWP A;  5AZJ A;  2CGL A;  1KD1 O;  1DT9 A;  4FWP A;  3CPW M;  2OAN A;  4K41 A;  5AQQ A;  1BWF O;  3VEY A;  5HOO A;  3A5N C;  5AQM A;  5M1K A;  4FOE A;  1HKB A;  3M5R A;  2ZJR L;  4AM7 A;  1SQK A;  1NGF A;  5TKY A;  3H1Q A;  3P4I A;  4XH4 A;  4A57 A;  3GDQ A;  4B1U B;  2EWS A;  3G25 A;  3LDQ A;  4IOA L;  3CC7 N;  4PL8 A;  4MLH A;  5AQX A;  2ZGY A;  3CCV N;  4BRG A;  1LOT B;  3EE9 A;  3O08 A;  3R1X A;  4BC3 A;  2E88 A;  2NRZ A;  1GLB G;  1X3N A;  4BRN A;  3KWG A;  1QHA A;  4WYB A;  1WOQ A;  5AQT A;  4BG8 A;  4HTL A;  5AQV A;  3VEX A;  1NM1 A;  4B1Y B;  2J4R A;  3LDN A;  3MX5 A;  4H0Y B;  4IEE A;  4JKE A;  3DXM A;  5AQL A;  3SBG A;  1W97 L;  3PLA A;  4H0P A;  3O6W A;  1MWM A;  4CZJ A;  3HI0 A;  4CD3 A;  3MK6 A;  4FPA A;  4JKB A;  5M1N A;  3E9O A;  1ZXO A;  1S22 A;  4KBO A;  1MA9 B;  4ISE A;  4NLB A;  4J8F A;  4G9Z A;  3R8E A;  1XQS C;  2ASP A;  1T6C A;  3HTV A;  1DEJ A;  1GLD G;  1QVF M;  5AQS A;  3N4P A;  5ELZ A;  4YOR A;  3UKU B;  5JMV A;  5BRH A;  5JLH A;  4M63 C;  1TYQ B;  4O8K A;  2E8A A;  4B1V A;  3FFK B;  2CH6 A;  1BO5 O;  2KHO A;  1K8K A;  1NGE A;  1KAZ A;  5E84 A;  5TKW A;  3CPE A;  4IJN A;  3VTH A;  5JLF A;  4JD2 A;  4JD2 B;  4IXC A;  3H45 C;  2Q0U A;  5AR0 A;  1KQS M;  1NGH A;  2C1I A;  5BRF A;  2CH5 A;  3OA9 A;  3H3N O;  1HKG A;  1RDU A;  4BC4 A;  4PKH A;  2KLA A;  5C12 A;  5ADX A;  1K73 O;  1VQ7 N;  3O1B A;  4FWS A;  3VGM A;  2P9P A;  3ATU A;  4A61 A;  5BRE A;  3WXJ A;  3ATV A;  4M7Y A;  5F0X A;  4JKC A;  2BUP A;  3TTC A;  4DCH A;  5M1F A;  3WXI A;  1T44 A;  3UE5 A;  1Z05 A;  1GLF O;  3FZL A;  4FO0 A;  1YJN N;  1YJW N;  3S41 A;  1EQY A;  3LM2 A;  4BRO A;  3CCM N;  3AGK A;  5H1S Q;  4JKF A;  1K8A O;  4CBW A;  3ZEU B;  4YOV A;  3QFP A;  2YCH A;  3CIP A;  5GIO A;  2NRW A;  5GAE P;  3PIO L;  1VQL N;  1ATN A;  3HM8 A;  2A42 A;  1U2V B;  4BVO A;  4GVE A;  2DPN A;  5AQH A;  2V7Z A;  5C2D A;  4IO9 L;  2YI1 A;  4H5W A;  5AQY A;  3O1W A;  4O8U A;  3KZB A;  3ZYY X;  4JAX A;  4BRE A;  1NBW A;  3CMA N;  3H1V X;  3G4S N;  1JCE A;  2Q0R A;  2QI2 A;  4BR9 A;  3VPZ A;  4BG9 A;  4OPH A;  3I55 N;  4ILJ A;  3KK7 A;  4BRM A;  2GEL A;  3BF1 A;  3CJB A;  2W00 A;  3CHW A;  1VQP N;  3VGK A;  1Q7Y O;  4CZI A;  4JKG B;  4MDB A;  1MWK A;  3O9Q A;  3H3O B;  3TSQ A;  4FSV A;  2JWK A;  3VGL A;  5M1Q A;  3MN7 A;  1KAX A;  3ZET A;  4FVU A;  5KQ8 A;  3IDH A;  5BPN A;  3VTI A;  4BY9 C;  4CBX A;  4GY2 B;  3SAF A;  3R9P A;  1V4S A;  3SJH A;  5AQK A;  5GIN A;  3BUZ B;  3HRG A;  4IEI A;  3SBT A;  4GNI A;  3JS6 A;  1H1V A;  3KVG A;  2P9L A;  2P9L B;  3ULE A;  3ULE B;  4BQL A;  1SS6 A;  5EOY A;  2NRT A;  4FWO A;  1NGI A;  3F5T A;  3QFU A;  4HWI A;  3ENB A;  3TPQ A;  1GLE G;  1MDU B;  3RSE B;  1JCF A;  1P90 A;  4JKA A;  3CD6 N;  3EKS A;  3FE1 A;  4C1N I;  3DWL A;  4A2A A;  1BA0 A;  4OO1 J;  3BP8 A;  4WQ5 C;  5FPM A;  2ZGZ A;  4MO4 A;  1U6Z A;  5AQO A;  5C15 A;  2D0P A;  1YJ9 N;  4E1J A;  2GTD A;  3D2F B;  3D2F A;  4IJA A;  4BVP A;  3WXK A;  3AGR A;  4JN4 A;  4WQ5 A;  1HX1 A;  2P9S B;  5KPR A;  4JK7 A;  5BPM A;  3ID6 A;  1P8Z A;  1EO1 A;  1ESV A;  5B8H A;  2IVN A;  4PKI A;  3SLC A;  1RFQ A;  2OTL N;  1SZ2 A;  2F9T A;  2YJF A;  2HOE A;  4BR4 A;  4FPB A;  1OVY A;  3MMV A;  3DXK B;  4FL9 A;  4H0O A;  1BOT O;  3G6E N;  4BRL A;  2FLO A;  3UKR B;  4CJ7 A;  5LY3 A;  5GAH P;  4AF1 A;  1HUX A;  4CI6 A;  4XH5 A;  3CCU N;  5BR9 A;  4YDU C;  5JIC A;  4BRD A;  4GV9 A;  4ISG A;  5GAG P;  3H6E A;  3A5L C;  2BTF A;  3E66 A;  4EHU A;  3HZ6 A;  1SAZ A;  4A5A A;  2VGM A;  2E1Z A;  3VEZ A;  3DAW A;  4YDU A;  3QBX A;  5DM6 L;  2QTD A;  3QBW A;  1XUP O;  4EAH D;  5AQN A;  4IFE A;  3VEN A;  2E2Q A;  2YJE A;  3QIC A;  3CCJ N;  2QEX N;  1ZC6 A;  1YUW A;  1RGI A;  3O5B A;  4C1N K;  1ILY A;  3EE8 A;  3C7N A;  3C7N B;  3M1F A;  4H5R A;  5EXW A;  2D1K A;  5AQR A;  1TUU A;  3VF4 A;  3UKU A;  4LC9 B;  3LDL A;  3MN9 A;  3WQT A;  5EY4 A;  1TYQ A;  4UY8 O;  4NB4 A;  2GWJ A;  1BA1 A;  4DKW A;  1HJO A;  4JNE A;  5AQG A;  3WXL A;  2FSN A;  5KQD A;  3VOV A;  1X3M A;  4Y0W A;  4JEP A;  3C0B A;  4JHD B;  3J7Z O;  1YHQ N;  4F9O A;  4ILG B;  3MWT A;  3L0Q A;  4BGA A;  4R79 A;  2QWL A;  5EVZ A;  1BU6 O;  1C0F A;  3VF2 A;  3WT0 A;  3R3L A;  2V52 B;  2AA4 A;  2E2O A;  4IDH A;  2F7T A;  3MDQ A;  3E1Y A;  5AQJ A;  3CCQ N;  4I6M A;  4I6M B;  4C23 A;  4BRA A;  3MCP A;  2I7N A;  3ZX2 A;  4IWV A;  2CGJ A;  5LJV A;  4BR5 A;  2WBN A;  2NRR A;  3NMU A;  4BR0 A;  3SAG A;  3ZEU A;  2CGK A;  3M3Z A;  4FWK A;  2HMP A;  2GWK A;  2NRX A;  2IIR A;  2Q31 A;  5BRD A;  3VER A;  1VQN N;  5KPZ A;  2E1Y A;  2GEM A;  3Q7B A;  5AQF A;  4BC5 A;  1Y64 A;  4A59 A;  1U2V A;  4DQ8 A;  2GX9 A;  4B1Z A;  2FF6 A;  2HBK A;  1GLL O;  2Q97 A;  2QM1 A;  2NNW A;  3A0I X;  3FLC O;  4JKD A;  2D4W A;  4A2B A;  5HL7 L;  4CD1 A;  5AQI A;  4DHY A;  3U9Z A;  5C2F A;  3CME N;  1Q86 O;  4FWN A;  3LDO A;  4EHT A;  2QWQ A;  4WF9 L;  1QQO A;  1VQM N;  2PFU A;  2HBM A;  3GL1 A;  4JKG A;  1GLA G;  1QQN A;  1YAG A;  4YOX A;  2FSK A;  4B1X B;  1VQ9 N;  3NVK A;  2P9N B;  4H5T A;  3FZM A;  4BC2 A;  4BRK A;  3ENO A;  2UYT A;  2ASO A;  1CZA N;  2VYP A;  1ATS A;  3TSP A;  3VEW A;  1YI2 N;  1Q82 O;  2FXU A;  1NGA A;  1NGG A;  3I8B A;  3I33 A;  1NGC A;  1KC8 O;  3CCE N;  2ASM A;  5AFU A;  1VQ4 N;  3I56 N;  4FWQ A;  3OBY A;  5M1O A;  4DB3 A;  5F1X A;  5AQW A;  4GV6 A;  2E20 A;  2QWR A;  4H0T B;  1YXQ A;  3EKU A;  4QS9 A;  1NGD A;  4RCH A;  2ITM A;  3CQX A;  4Z94 A;  3D7E O;  5FPE A;  4O5F A;  4NLC A;  2A6A A;  3FGU A;  1W2B M;  3CJ7 A;  3F9M A;  1X9J A;  2NZT A;  3T69 A;  3O4W A;  1XC3 A;  3RSE A;  5CE3 A;  3IFR A;  3OW2 M;  1TUY A;  3P38 A;  3CF5 L;  2RHK A;  1ZBS A;  1T6D A;  1YF5 L;  3BEX A;  4FWR A;  4BR7 A;  4CZG A;  5FPD A;  3CET A;  4IOC L;  1GLC G;  3T7Z A;  4BE7 B;  2E2P A;  3AY9 A;  3O9S A;  1S3X A;  3Q7C A;  3VEO A;  1QQM A;  2HBJ A;  4EFH A;  2QA4 N;  3C6H A;  3AAR A;  5LJW A;  3K9J A;  3ZX3 A;  2P9S A;  2QXL A;  1JJ2 M;  3EL2 A;  4KH4 A;  1Z6R A;  3J8A A;  5DM7 L;  2RE2 A;  2IVP A;  3W3D A;  2VWB A;  4OPA A;  5CR4 A;  2I7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...