2P9LB

Crystal structure of bovine arp2/3 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
203
structure length
201
Chain Sequence
IQAVLTLYAQGLGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 54
structure length 201
sequence length 203
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9lB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9lB02
4A61A 1BU6O 3O08A 2OANA 2E2OA 3C7NB 5AQLA 3CJ1A 3QBXA 4RTFD 1QZ5A 2Q36A 5AZJA 1KXPA 3ENHA 4F9OA 3IDHA 4CJ7A 5AZIB 2F9WA 2PAVA 3VESA 5E26A 4CZEA 3A8YA 5TKYA 2P9IA 4B1VA 1BA0A 3DXKB 4PKGA 2GEMA 3O80A 3FR0A 2GWKA 2PBDA 3IUCA 3U8XA 3DWLA 1XC3A 4YDUC 2FLOA 4M63C 3H46O 5BR9A 3H1QA 1IG8A 1NGIA 2ASMA 4O8KA 4IWVA 1JCGA 3MN7A 1MDUB 1QQNA 1GLCG 4PL8A 3ZEUB 4FWRA 2E8AA 3D2EB 1Q18A 2AP1A 3HM8A 3ZETB 4CD1A 3D2FA 4JD2B 5AQFA 3KZBA 1KAZA 3U9ZA 2QWRA 3A0IX 1HKGA 2D0OA 1DEJA 5AQYA 1T6DA 1V4SA 5AQGA 3WEEB 2P9NB 5AQIA 4H5NA 4IJAA 4H0PA 3FZFA 2Q0UA 4WQ4A 2P9PA 4K43A 3ZX2A 3QB0A 3R8EA 3TPQA 5ELZA 2YHWA 3DXMA 4IO8A 1QQMA 3ENOA 5AFUA 4FO0A 3BUZB 4K41A 5AQHA 1HX1A 1X3NA 1X3MA 2VYPA 3EZWA 1GLDG 1YXQA 2A3ZA 3LDNA 2GTDA 5AQRA 4BRCA 2FSKA 3W3DA 2FF3B 4BRAA 2CGLA 2KHOA 2P9LA 3H45C 1BOTO 3SMPA 4FOEA 4FPAA 5AQVA 3RSEA 2IIRA 5BRHA 3BEXA 3EKSA 4BVOA 3BP8A 3H3NO 4B1ZA 1KAYA 1U2VA 1C0GA 4YDUA 4CZIA 3ZX3A 3SK3A 4CI6A 4IJNA 2V52B 2D0PA 3M1FA 3MCPA 1RFQA 2GWJA 4H5TA 3HI0A 5KPTA 2NZTA 1NGFA 4ISFA 5AQNA 3VETA 4XH5A 1BUPA 1GLJO 1TUUA 4BC5A 2F9TA 4BC3A 4EFHA 2YJEA 1QQOA 4PKIA 5BN9A 5AQMA 1H1VA 4CBUA 5BPLA 1NGBA 4LC9B 4DHYA 4E1JA 2QWLA 4H5WA 2E2NA 3QBWA 5JICA 5E84A 1LOTB 3VENA 4WQ4C 3ULEA 2A6AA 3GE1A 2HMPA 4FWOA 2Q97A 3MN9A 5AQZA 4CZMA 1BA1A 3DJCA 1GLEG 1E4GT 3ZETA 3U9DA 2I7NA 4FWPA 3FFKB 2VCPA 5AQOA 1NLVA 4L3QA 1K8KB 4CZJA 1T6CA 4RWTA 4C23A 3EN9A 3EKUA 3UKUB 4BG8A 2ASOA 2GUPA 1MWMA 1HKCA 3QDKA 4B1XB 1T44A 4FWMA 4AM6A 5BRDA 3B8AX 4KBOA 4B1UB 4H0OA 3ATVA 1QZ6A 3VGKA 1TYQB 2QW9A 1NGGA 2CGKA 1J6ZA 2QXLA 4XEIA 4BC2A 5ADXA 3H3OB 4FWNA 4JHDB 3HTVA 1YUWA 4EHTA 3F9MA 1NGEA 4BRPA 3DAWA 4QS7A 4FSVA 1MWKA 2Q1NA 5EY4A 4DCHA 2A40A 1R59O 4BR7A 1LCUA 3VEXA 1SAZA 4GY2B 1C0FA 1JCEA 4EIAA 4H5RA 1NM1A 4JN4A 4BGBA 2ZGZA 2NLXA 1G99A 1NBWA 4BRMA 3J8AA 3WQTA 3C0BA 3QFUA 5BN8A 2P9SA 3VEOA 3GBTA 4JNEA 4H0YB 3CJBA 3ID8A 2BTFA 4NB4A 3WXJA 4MO4A 2E20A 3G25A 1WUAA 1NGDA 2H3GX 5I9EB 4HTLA 4O5FA 4JAXA 2V51B 3JS6A 4FPBA 5EVZA 4QS9A 3SLCA 3UKRA 3VF2A 3WXIA 3CETA 2V7YA 2P9KA 5AZJB 1NMDA 3HSCA 3O5BA 1NWKA 1HUXA 4A2AA 5JLFA 3R9PA 4XH1A 3LDOA 1DGKN 4M7XA 3OHRA 1NGJA 2D4WA 3IMXA 3VGLA 1RGIA 4GNIA 2E88A 2EWSA 2P9IB 3O1WA 3QFPA 2VWBA 4FWLA 4BG9A 1GLAG 5F0XA 3CJCA 3KHYA 2FXUA 3CJ9A 2UYTA 4CZKA 3WT0A 4K42A 2ITMA 3VF4A 1U6ZA 3C7NA 2E2PA 2ASPA 4I6MB 2E1YA 3WUHA 4DQ8A 5JMVA 1S22A 3BF3A 5AZIA 3AARA 4BR0A 4ISGA 3L6QA 3CJAA 3VEWA 3QMLA 3M3ZA 4MLHA 3DXKA 2HF4A 4ISEA 2FSNA 2DPNA 2E2QA 3D2FB 3WXLA 5BREA 4QS8A 3VEYA 4BGAA 4Z94A 1NGAA 3GOIA 2Q31A 3EL2A 5KQDA 4BROA 1Z05A 2IVOA 4CZGA 5BPNA 5FPMA 2GELA 4H0VB 4BRLA 3GL1A 1XQSC 3KVGA 3VEZA 3CQYA 2P9PB 1TUYA 3LDQA 1ESVA 3SMSA 4AM7A 3ZEUA 1QHAA 1YVNA 3DXMB 3D2EA 2D1KA 3ATUA 1V4TA 4BRQA 2W41A 3A5OC 4JD2A 4A62A 5F2RA 2QWMA 3MN6A 1ATRA 3FLCO 4WQ5C 2BUPA 2ZWHA 1EQYA 5AQTA 4CD3A 4DB3A 3S41A 3MK6A 4XH4A 1KAXA 3WEEA 2P9NA 3A5MC 4K25A 1HLUA 2P9LB 5FPEA 1X9JA 3WXKA 3HBTA 4B1YB 3D7EO 1IJJA 5BPMA 3BF1A 5B8HA 1Y64A 3RSEB 3H6EA 2HOEA 3UB5A 5CE3A 5LY3A 4IXCA 3W0LA 5FPDA 2IVPA 3CERA 1SQKA 2E1ZA 1RDWX 1ZC6A 1U2VB 1OKJA 2P9UB 5AQPA 5EXWA 1S3XA 4BQLA 1D4XA 4MO5A 3UE5A 3FZKA 4BRKA 5AFUH 3FZLA 1NGHA 1E4FT 2W40A 4BRGA 1P8ZA 1ZXOA 1JCFA 1BG3A 2CGJA 3VGMA 5AQSA 4BVPA 3GG4A 2A41A 4CBWA 3SJHA 2FSJA 3QICA 2V7ZA 2QWOA 3VF6A 4BRDA 4H0XB 1HJOA 3LDPA 3FGUA 3EO3A 3I33A 4I6MA 2QWNA 1DKGD 3CI5A 3IFRA 4RCHA 5KPRA 3WQUA 4NO7A 3R6MA 3I8BA 3ULEB 4BQZA 1WOQA 2ZGYA 4CZLA 3CIPA 5AR0A 4WYBA 3CQXA 3LDLA 3M6GA 4PKHA 2CH6A 4FWKA 4A2BA 1GLLO 4BR5A 2A42A 1BO5O 4WQ5A 1BWFO 1XUPO 4BRNA 1BDGA 2IVNA 4MLEA 5AQJA 4BR9A 2NRHA 4H0TB 3O6WA 3L4IA 2QWPA 4M7YA 3TU5A 3P4IA 1CZAN 4CZFA 2A5XA 2YHXA 2WUSA 3VERA 3GDQA 1ZBSA 3FZHA 3LM2A 3AY9A 3FZMA 1NGCA 4H5VA 5AQUA 4PL7A 4BRFA 2YI1A 3MDQA 3MMVA 1K8KA 1MA9B 3U4LA 4HWIA 3A5NC 4BR4A 4FWQA 3UKUA 2YHYA 5JLHA 3CHWA 3A5LC 3CJ7A 1ATSA 1Z6RA 3L0QA 4J8FA 1HPMA 5LJVA 1YAGA 2QWQA 3VPZA 3O8MA 2ZF5O 3AAPA 1TYQA 5FPNA 2P9UA 2Q2RA 4IZ9A 1GLFO 5AQKA 5EOYA 4Y0WA 5LJWA 3VOVA 4BR2A 3JXUA 2I7PA 4BRIA 4JHDA 4CZHA 2J4RA 2P9SB 2FF6A 4FOIA 3H1VX 5ADXH 2AA4A 1SZ2A 3O1BA 3HZ6A 2YCHA 5AQXA 2YJFA 3ZX0A 3UKRB 4B9QA 1ATNA 2P9KB 4EAHD 3FE1A 5KPZA 5EX5A 3AAQA 5AQQA 5AQWA 1GLBG 3LL3A 4BC4A 1HKBA 3LM9A 2Q0RA 4FL9A 4B1WB 5BRFA 4FWSA 2CH5A 4EHUA 4BRHA 4BREA 3MN5A 4CBXA 5F1XA 4H03B 2QM1A 3VEVA 5KQ8A 3O4WA 2HF3A
chains in the Genus database with same CATH superfamily
3D6RA 2OANA 4CHYA 3C7NB 5AQLA 1K8AO 1RT7A 2Q36A 3VMFB 3THWA 2X78A 5K14A 2O4IA 3KK3A 5AZIB 2FBYA 3A8YA 3MXMA 1WAFA 2XHBA 3AVAA 4PKGA 4CJ3A 4DTNA 2HHHK 4CJEA 2XY7A 4BY9C 3U8XA 1S1VA 4ILJA 4DQSA 3H1QA 4JK8A 3ENBA 4AH9A 4IWVA 5DMRA 2OYQA 3MN7A 1MDUB 4F2RA 4PL8A 3TAMA 2YNGA 4FJIA 2AP1A 4E89A 4BDZA 3ZETB 1K9MO 3KZBA 1N36K 3ZSZA 1KAZA 3U9ZA 1HKGA 1DEJA 4B9TA 3M8QA 1X1PA 3WEEB 3OS0A 4ID1A 4A5AA 1NK4A 1CLQA 4H0PA 3KK7A 4K43A 1X9MA 5J2MA 3HPHA 1EP4A 3TABA 1KRPA 3QB0A 4OGEA 3TPQA 5ELZA 4Z4GA 1ASVA 1YVUA 5JS2A 2B4JA 4IO8A 1KCFA 1I94K 5C2DA 3PSIA 5AFUA 4K41A 2O4GA 4F2SA 5JVGL 1HX1A 5LL6Z 4CJSA 3V6DA 3W3DA 2FF3B 1XHXA 3SCXA 2NNWA 3T1HK 5CY4A 3SMPA 4CFDA 4FOEA 4FPAA 3R3LA 3NH0A 4BVOA 1U48A 4CZIA 3OYNA 4CEQA 1WLJA 2G8KA 3SK3A 4CI6A 3SBGA 3K58A 4KPYA 2X6NA 2D0PA 1RT3A 2D0CA 3LP1A 3K5NA 3QLHA 1VQ5N 4FJLA 2R7YA 4ISFA 5AQNA 4DTXA 1BUPA 3V9WA 4EFHA 2G8HA 1QQOA 4PKIA 3J7ZO 3AA4A 5BPLA 3SPYA 4LC9B 3IS9A 1TL1A 3AVNA 2RF2A 4KO0A 5E84A 2O8CA 2O8BB 2VQEK 4FYDA 2OZSA 1DTQA 4J2EA 4FK2A 1WSFA 3GE1A 2A1RA 5AQZA 4OPJA 3CD6N 4QAGA 1E4GT 4F4KA 1GOAA 3U9DA 2I7NA 4G1QA 3ZSRA 1K8KB 2QKBA 5GIOA 3TAGA 3OYEA 3NBPA 1T7PA 4F3TA 4DTOA 3RVCA 4IFEA 3DLEA 1RTJA 3EN9A 4OO1J 2GUPA 3VQEA 4ZTFA 3QDKA 3AGKA 4FWMA 5CYMA 5BRDA 2RHKA 4B1UB 4H0OA 2IC3A 1TYQB 2QW9A 5C2FA 1KQSM 3CQ8A 4BC2A 1BCMA 3HTVA 1OVQA 1YUWA 2NRRA 1EX4A 4GKKK 3HT3A 3F9MA 1NGEA 3DAWA 4JRPA 1RBVA 1TKXA 4DCHA 2VWJA 3VTIA 2AJQA 3TARA 1HRHA 4EIAA 4H5RA 2OTLN 3OY9A 1VHXA 3CCEN 2ZGZA 4MFBA 3AVHA 4E7KA 1G99A 1NOZA 4O44A 1NKCA 1Q9YA 1NK7A 4R79A 3ISNC 2G8IA 1B9DA 1IKXA 4K8ZA 4MO4A 3G25A 3PLAA 1DTTA 2H3GX 1JLGA 3JS6A 4JAXA 5EVZA 1W2BM 4FLZA 2P9KA 3JAMO 2OA8A 3HSCA 1HUXA 3WNHA 4O0IA 3THXB 1IKWA 4RW6A 4XH1A 3T19A 1DGKN 4M7XA 3OHRA 4BWMA 4E3SA 2PYLA 3VGLA 1FK9A 3Q7CA 4O8UA 1CZBA 1UA1A 4KHSA 4DMNA 2PFUA 2FXUA 4CEOA 3MWPA 4LY7A 4O5BA 2ITMA 1YHQN 1U6ZA 2E2PA 5CZ2A 4W5RA 2E6LA 4CVNE 5JMVA 1W7AA 4GVMA 3UIQA 1O1WA 3AARA 3IKMA 4W5NA 3V81A 3AA2A 1BIUA 2E5LK 4CEEA 1E3MA 5C42A 4FM1A 2HF4A 2DPNA 2E2QA 3D2FB 3WXLA 1NMNA 3O3HA 1ZBUA 2HHTA 4E7IA 1NGAA 3EEQA 4OX9K 1G15A 1WSGA 5J2PA 4GVEA 1Z05A 5BPNA 2NRWA 2QKKA 1LAVA 1YVNA 4DU3A 4ID5A 4BRQA 1EXQA 3A5OC 4A62A 4CJFA 1HJRA 1TAUA 3MN6A 1ATRA 3TSQA 1WAJA 1HNVA 2O8FA 3AVFA 3S41A 4DG1A 3OS2A 4XH4A 3CCUN 4K25A 3G4SN 3DRPA 4N56A 3SQ2A 1UWBA 4CFCA 1Y64A 3H6EA 3DI6A 1C1BA 5LY3A 3KLHA 5FPDA 4CJVA 3O9SA 4I2QA 3CC7N 4CGJA 1U45A 4KFBA 1LV5A 4BRKA 1SKSA 3MXJA 1IKVA 1ZXOA 3THYA 2KFNA 3N4PA 3CFRA 1JJ2M 4JI3K 3CXCM 4KKOA 1BISA 5AQSA 3NFAA 4CBWA 3ZYYX 4FLUA 4LF7K 2QWOA 5IWAK 4LF6K 5KRTA 1VRUA 1HJOA 4ELVA 4I6MA 3CYGA 1GOBA 2KW4A 2NRXA 3CI5A 3IFRA 5KPRA 3SZ2A 1BIZA 4NO7A 3WQUA 3LWMA 2F7TA 3R6MA 4BQZA 3KLIA 1J54A 1S6QA 4CZLA 2YHBA 3KKSA 3WNGA 1Q8IA 3HPOA 1NKEA 3LDLA 4LF9K 2Z1JA 1NJYA 4DSFA 4FWKA 4M41A 4A2BA 4JK7A 1NK0A 3ZSWA 1EWQA 3OYCA 1KVBA 1Z25A 1BO5O 3OA9A 3M5RA 3PUFA 1BWFO 2BDPA 3DLKA 4BR9A 3AVCA 4WFBL 1C1AA 4DR4K 4B3OA 4KH4A 2XY5A 1DT9A 2HBMA 3OYLA 2WONA 2ATQA 3KK2A 4WCEL 3KTQA 2HBKA 3LM2A 3FZMA 3ZT1A 3RR8A 4QOZB 4YOVA 4DSJA 4JEPA 1ASUA 3MX5A 3QNOA 3HO1A 4KB1A 4BR4A 2E6MA 4CESA 4M3UA 4BECA 2X6SA 1BQMA 3CHWA 3A5LC 1VRTA 3CYMA 5HRRA 4I2PA 2VWKA 4LF8K 2UXCK 1YAGA 2PZSA 3O8MA 4HUFA 3AAPA 2OPQA 4M3YA 3J80O 4Y0WA 3I55N 3DYAA 2OPPA 4GW6A 4Z4EA 4CZHA 2J4RA 3O9QA 2FF6A 1D5AA 2AA4A 3HL8A 3SV4A 3SV3A 4BEBA 1SZ2A 3J7AP 3OJSA 3HZ6A 4ICLA 3ZX0A 1SKWA 3MEEA 4B9QA 4BE1A 2NUBA 2X74A 4LSNA 5HRSA 3CCJN 4IO9L 1HKBA 2Q0RA 5GADP 2ZD1A 4FWSA 4IFVA 3MN5A 4CGDA 4JKHA 5F1XA 4H03B 3RMBA 3VEVA 2JWLA 5J2NA 4YOYA 3ZSVA 3ULDA 1P90A 3VQ8A 4FW2A 5AZJA 1KXPA 1SKRA 4F9OA 3O3GA 5E26A 3F9KA 1XMOK 2VQFK 1Q7YO 2P9IA 4NXNK 2W00A 4DR2K 2GEMA 3O80A 4DFJA 1IKYA 3IUCA 5HRPA 4E1MA 2ZQBA 4M63C 5BR9A 1TKTA 1FKPA 2FBXA 4DV5K 1X9WA 1XNRK 3E66A 2GUIA 1IG8A 4JKBA 5T7BA 4FXDA 3NE6A 2ZJPL 1N33K 3ZSOA 4CJPA 3J7YP 1S6PA 3ZEUB 2EX3A 4FW1A 4B8CA 1RTDA 2O8EB 5FDLA 3NF9A 4CJWA 1D8YA 2QWRA 2PY5A 3CCVN 3K5OA 2ZM6K 2P9NB 1TKZA 2LSNA 4BE2A 2G8VA 3ZX2A 3R8EA 3QESA 1NJZA 4M45A 3ZT3A 4BWJA 4EP5A 4I9LA 1QQMA 2UUAK 4DV6K 5AQHA 3CPWM 4FVUA 4BRCA 2GTDA 2FSKA 2KHOA 2P9LA 3QERA 3DM2A 1BOTO 3I0RA 3G0ZA 4M3WA 3H3NO 4JKDA 1KAYA 1U2VA 1HYVA 2FBTA 2V52B 3KWIA 4JKAA 3MCPA 2O8DB 1NNEA 4OJRA 5C12A 4H5TA 3HI0A 5KPTA 3VA0A 2YNHA 2UUBK 3VETA 4XH5A 4FM2A 4BC5A 2OTJN 2F9TA 4KI6A 3KWGA 4Q0BA 2YJEA 4AHCA 3PX0A 5AQMA 1H1VA 4GV3A 4NYFA 3O9UA 1NGBA 3CF5L 3NGYA 4H5WA 4A59A 2DTUA 1LOTB 1O13A 5M1OA 5C15A 5BR8K 4DU4A 2KFZA 3H08A 4DFPA 3P5JA 3MEDA 3NVMA 2PYJA 2Q97A 1VSFA 4IEIA 1L3UA 2IDOA 2YHAA 1GLEG 3BZCA 3ZETA 2BGGA 4CJQA 2VCPA 3OTOK 1IBKK 3C6AA 1T6CA 2D0BA 4DF8A 4JI1K 4IOAL 4Z0UA 2A1SA 1YI2N 2ASOA 3C95A 1OH8A 1HKCA 4B3MK 1NJWA 4B1XB 4CGFA 1S9GA 1QE1A 4MDAA 3VGKA 3ATVA 1OH5A 4KHWA 4BE7B 4Z4HA 3S3MA 1IH7A 1WNSA 4DLEA 2CGKA 5HP1A 1SL1A 3BDPA 2QXLA 3OYMA 2KQ2A 3H3OB 4JHDB 1XMQK 4EHTA 4CFAA 4BDYA 5J2QA 1VSHA 4QS7A 1VQNN 4FSVA 4FK4A 2Q1NA 5EY4A 4CE9A 2A40A 1M90O 3DOLA 1LCUA 3R1XA 1SAZA 4GY2B 1C0FA 1J5EK 3B6OA 4BGBA 4DV1K 3SNNA 3AVBA 3DRRA 3NMUA 1NBWA 1VSJA 2VGMA 3J8AA 3WQTA 4AQYK 3C0BA 5BN8A 5DK5A 4JYAK 4JNEA 5D3GA 1J53A 1W0HA 3OYHA 4C1NK 4B9SA 3NAEA 3E9OA 4C8OA 1QQCA 2E20A 2HNYA 4LH4A 2UUCK 3CFOA 4O5FA 3I0SA 4FPBA 3UKRA 5E41A 2IS3A 3WXIA 2FBVA 3THWB 1NMDA 3NCIA 4A2AA 5JLFA 3R9PA 5LMUK 1TV6A 3LDOA 4EZ9A 1RTIA 3V4IA 4GNIA 4HVJA 3O1WA 2NRTA 1KFSA 3CJCA 3KHYA 1YITN 5KI6A 2UYTA 1N34K 3WT0A 1S1WA 3LP3A 4CHOA 4U7BA 4CERA 3SQ1A 4O0JA 1W9HA 4JI4K 1VQ4N 4NLBA 4E7JA 4BR0A 4I9QA 4DV0K 3CJAA 4JI8K 2ZE2A 3LPTA 3VEWA 3F2KA 4FVMA 3M3ZA 1NK8A 5M1NA 4MLHA 4B9VA 3DXKA 4ISEA 1ZYQA 2HW3A 2FSNA 3RTVA 4KB0A 3ALYA 4CJUA 4M3XA 1SS6A 5BREA 3L2UA 4LF4K 4BGAA 4Z94A 1HQUA 5CZ1A 3GOIA 2Q31A 3EL2A 5KQDA 3KIOA 3O9RA 3LZJA 3OYKA 4H0VB 1IG9A 4LSLA 3ZT2A 4DR5K 4KHYA 4CECA 3VEZA 3CQYA 3LDQA 4CF2A 1TKDA 1QHAA 3QNNA 3SUPA 4Z4FA 3D2EA 1YTUA 1V4TA 3NH1A 2W41A 1RT6A 2HHVA 4JD2A 3CCLN 2QWMA 4OPKA 4WQ5C 1QVGM 1S72N 4DB3A 3MK6A 4IEEA 1VSEA 3AVJA 4C1NI 3AVLA 1X9JA 1RTHA 2WFBA 3WXKA 5FPEA 3K59A 3K2PA 4CEFA 1IJJA 5B8HA 4CF1A 2HOEA 1ZBLA 4FLXA 2WOMA 4R5PA 1VSKA 4IXCA 2IVPA 3NGZA 4GV6A 4DR6K 2E1ZA 1ZC6A 1NKBA 5GAHP 1WBBA 5EXWA 1RT2A 4BQLA 2Q3SA 1HYZA 1WSEA 4CW7B 1NGHA 4BRGA 3SJJA 3L8BA 3SPZA 4NYNA 4LFAK 4ZHRA 4L8RB 4JI7K 1KVCA 3QEWA 4E72A 2YV0X 2CGJA 3CCRN 3GG4A 3SUQA 1IBMK 2HBLA 2V7ZA 4FJXA 4CJ5A 4CJKA 4E0DA 2B5JA 5EU7A 3LDPA 4B3TK 3FGUA 3I33A 2QWNA 1S1TA 5C10A 2HSTA 4J2DA 1DKGD 4X66K 2O8CB 3RMCA 1TK8A 1QSSA 3I8BA 5TKWA 3OVNA 3CQXA 1T8EA 1N5YA 4DWIA 4DS5A 3MX2A 4KRFA 4PUOA 4WQ5A 4FJ8A 1XUPO 4MLEA 3V1QA 5AQJA 3ITHA 1K6YA 2NRHA 3VQDA 3L4IA 2QWPA 4IKFA 4NCBA 4CIFA 3KLGA 3TU5A 3ZLJA 2YKMA 4IG3A 1BQNA 1NJXA 4CZFA 5IT9O 1TK0A 2WUSA 4RG8A 3P31A 2ETJA 1EETA 3AY9A 3S5TA 4H5VA 5AQUA 1BI4A 4B9LA 4PL7A 3NF8A 1SL2A 5GAGP 4QCLA 1QTMA 3CPEA 4FWQA 3T3FA 3UKUA 2YHYA 3HVRA 5FROA 3CJ7A 4PQUA 1ATSA 1Z6RA 5FLXO 1A5VA 4J8FA 3VPZA 4A57A 1NK5A 5AQKA 4IZ9A 1JXBA 5EOYA 5LJWA 3PY8A 3VOVA 3M8RA 4BR2A 1A5WA 4YOUA 4BRIA 3ZT0A 4M42A 3H1VX 5ADXH 4OLAA 1FJGK 1TAQA 4DTSA 3NDKA 2ITGA 2YCHA 5AQXA 3HP6A 1RDAA 3C65A 3CC4N 3O9TA 1ATNA 3JYTA 2P9KB 4OKJA 1BCOA 3FE1A 5AQWA 5A2QO 1GLBG 4AHRA 1CXUA 3DRSA 4DTPA 4CCHA 4HCBA 3PV8A 4RW8A 2CH5A 4Z4CA 4FCYA 1HNIA 2G8FA 5I42A 5KQ8A 4G9ZA 3SUOA 3LP0A 2HF3A 3WNEA 3DLLL 3V9ZA 3PIPL 1JLQA 4EZ6A 1JKHA 4E7HA 3L3VA 3CJ1A 3QBXA 4RTFD 2VG5A 4DS4A 2F96A 3NH2A 4DTRA 3C6TA 4RW9A 4CJ7A 2PAVA 2VGNA 5KRSA 2IOCA 4B3RK 5TKYA 2ZJQL 1KD1O 4DFKA 3FR0A 2GWKA 2PBDA 3PSFA 1HNZK 4FK0A 1XC3A 3LPUA 3LWLA 2FLOA 1NJIO 3H46O 2P5OA 4AF1A 2E4LA 3ZCMA 3SQ4A 2WBNA 1QQNA 2QXFA 1VQ6N 4FWRA 3O4NA 1Q18A 4WFAL 3HSTB 1YIJN 3SAHA 3T7ZA 1HNXK 5AQFA 4PHTX 4OVLA 4IOXA 2O8FB 3J81O 2W6LA 1IV0A 2RKIA 4AHTA 2GBZA 4HTUA 4PA1A 4IJAA 1LWCA 2Q0UA 4WQ4A 1S1XA 2P9PA 3AA5X 3A2FA 3DXMA 4CK3A 3QEIA 1VSDA 3ENOA 4FO0A 4CJRA 3L2WA 4DTUA 1YJ9N 2I5JA 2VYPA 1SV5A 3EZWA 4N47A 1GLDG 1YXQA 3LDNA 3THYB 5AQRA 4DQPA 4JS5A 4BRAA 2CGLA 3H45C 3OBWA 4YOWA 4DUZK 3TAEA 4LF5K 4CGGA 1B9FA 4YFUA 5AQVA 3RSEA 5CYQA 2Z1IA 3BEXA 2FC0A 4FJJA 1TGOA 3BP8A 4Q5VA 5C0YA 3KLFA 3ZX3A 3AVMA 4OGCA 3KLEA 1T03A 4FZYA 4IDKA 2KZZA 3LALA 4IG0A 3AVKA 2GWJA 4YOTA 3IG1A 3SQ0A 1RT1A 4CHNA 2NZTA 1EWRA 1NGFA 3IRXA 4MDBA 4CJ4A 1XI1A 4JKGA 1GLJO 1TUUA 4JKFA 3QEPA 4BC3A 1WBDA 3DLBA 4EP4A 2VG7A 5BN9A 4CF9A 4CBUA 2XRIA 1X9SA 4E1JA 4DHYA 5GAEP 3S9HA 2E2NA 1YJWN 4NCGA 1HMVA 1D9FA 4B9MA 5JICA 1LWEA 4CHQA 4CEBA 3ULEA 1VSIA 1R0AA 3AVIA 2F8SA 2HMPA 3P1GA 4FWOA 3MN9A 4CZMA 1BA1A 3DJCA 3TTDA 3TAFA 3OYIA 4FWPA 4M3ZA 4DV4K 3FFKB 1NLVA 4X64K 3CMAN 1FW6A 3D0PA 3E1YA 4KTZA 3CC2N 4FJ9A 1T44A 4E19A 3B8AX 1QZ6A 3S3OA 2UXBK 1HR0K 3QEVA 1J6ZA 1Q86O 4XEIA 4FWNA 3T69A 3VTHA 4DV3K 1VAZA 4HUGA 4BRPA 5FRNA 1RILA 4C8MA 1WSIA 4N5SA 3C94A 4CJLA 3QIOA 1R59O 1L3SA 4BR7A 1JLFA 1N8RO 3VEXA 4X65K 1Q9XA 4FJGA 3MECA 4GV9A 1JCEA 4NCAA 3HM9A 2HBJA 4KAZA 4CEZA 1QVFM 4BRMA 4CEAA 3QFUA 3MXIA 2P9SA 3D45A 3VEOA 3HVTA 2OPSA 3DMJA 4H0YB 3CJBA 3F5TA 4I7FA 2BTFA 4NB4A 3WXJA 1KLNA 4PY5A 3TANA 1WUAA 5I9EB 4HTLA 3VF2A 2V51B 3SLCA 4QS9A 4W5OA 5MLCQ 5AZJB 4KI4A 2Z1GA 3O5BA 1NWKA 3P83D 4JKEA 3SBTA 1JLBA 2EWSA 4OPAA 1SUQA 2P9IB 4H4MA 3QFPA 4FWLA 1W97L 4BG9A 1GLAG 3M8PA 1YF5L 1KSPA 4V19S 1VQMN 3C7NA 4CIGA 2ASPA 4N76A 2E1YA 3LZIA 3BF3A 5AZIA 3RRGA 4ISGA 2HHQA 3ID6A 1QHTA 4Z4IA 1C0TA 3CFPA 1JLCA 4AHUA 1RDUA 4KV8A 4QS8A 3AO2A 3K9KA 3OYDA 1S5JA 1S1UA 4BROA 4CHPA 2D5RA 3B6PA 2IVOA 4CZGA 4FZZA 3AO4A 4X62K 1T05A 1K73O 4BRLA 2XY8A 3GL1A 1XQSC 2JGUA 3KVGA 1TUYA 1ESVA 1C0UA 1CXQA 1RDDA 4DR7K 2HVIA 3P39A 2OPRA 1Q81O 3AA3A 5F2RA 3U3GA 3FLCO 1VQKN 1EQYA 4YOXA 5AQTA 5JVHL 1KAXA 3WEEA 4HUEA 3A5MC 3TTFA 1HLUA 2P9LB 4B1YB 5BPMA 3BF1A 3TSPA 4AHVA 3O4QA 3UB5A 5CE3A 3W0LA 2KZMA 3LAKA 1OH6A 3LAMA 1RDWX 3AO1A 3I8DA 1YJNN 1ZBHA 1U2VB 1OKJA 2P9UB 1D4XA 4MO5A 3UE5A 4KH6A 5AFUH 4FLWA 2RN2A 4W5QA 2W40A 4AILC 1P8ZA 3U6FA 1VQ9N 1VQLN 4BVPA 4CIEA 2F4VK 4DLGA 3KD5E 2FSJA 3RMDA 4OLBA 5SWMA 1VQ8N 1KLMA 4RW4A 3VF6A 4H0XB 2HHXA 4JKCA 2BE2A 2WC9A 3Q7BA 4YY3K 3PO4A 4RCHA 3MWTA 4N41A 3VQ9A 4YNQA 4LFBK 1ITGA 1WOQA 1B92A 5AR0A 4WYBA 1RCHA 4DUYK 2NRVA 3HK2A 3M6GA 4PKHA 1XWLA 3HYFA 1NK9A 4LFCK 2A42A 1NG9A 3AGRA 4MQ3A 1L5UA 1JL2A 4BRNA 1BDGA 2DFHA 3VN5A 4H0TB 2D0AA 2P51A 3O6WA 1LAWA 2O8BA 3BY5A 3RWUA 4J2BA 4IDHA 3P4IA 4CHZA 3OYJA 4DQQA 1GOCA 1CZAN 3VQCA 2JLEA 1U4BA 3GDQA 1NGCA 4XIUA 4K8XA 4BRFA 3G71N 2YI1A 3VQ6A 1K8KA 4B08A 3OYAA 1JXEA 3A5NC 3C6HA 4FJMA 4WE1A 4CFBA 4BDPA 2YNFA 1ASWA 1N6QA 2QWQA 4IFYA 2ZF5O 3NHGA 3L3UA 1TYQA 2RE2A 5FPNA 2Q2RA 1GLFO 3E9PA 3ZT4A 3OW2M 2YX6A 4DTMA 1WSJA 4DU1A 4IOCL 4FOIA 4OKEA 3VA3A 1J5OA 4DSEA 3O1BA 1RDBA 3L2QA 2IAJA 4ZTJA 4DKWA 3UKRB 3U3YA 3ZSYA 3KJVA 1WN7A 5KPZA 3THVA 3T1AA 2YKNA 2QI2A 2KLAA 3AAQA 1N32K 3LL3A 4BC4A 4DQRA 2Z1HA 3MAQA 3AV9A 1L3VA 4DTJA 2OZMA 2QM1A 3OYFA 4A61A 2ZJRL 4E1NA 1BU6O 3O08A 3TR8A 2E2OA 4UY8O 5KGWA 2HNZA 3K5LA 2JWKA 1QZ5A 3N4QA 4KHQA 4K0KK 3ENHA 2P5GA 1NU0A 3IDHA 2F9WA 4RW7A 3VESA 2RPIA 3THXA 4B9NA 4CZEA 1I39A 2KKZA 4AHSA 3VQPA 5J1EA 2P1JA 4B1VA 1JLEA 1BA0A 3DXKB 2DY4A 4KTQA 2BANA 3ZSQA 3SYZA 3DWLA 3C6UA 4YDUC 4JRQA 5C24A 4CJTA 3TWHA 4NXMK 2GX9A 4M3TA 1NGIA 3V9UA 2ASMA 4ILGB 4O8KA 1JCGA 4JLHA 3K0SA 1LWFA 1YTAA 1GLCG 3RR7A 3L2RA 3NVKA 5I3UA 2E8AA 3LANA 3D2EB 3HRGA 4GMJB 4DF4A 3HM8A 4CD1A 3D2FA 4JD2B 4LH5A 3SUNA 3V1RA 3A0IX 2KTQA 2C1GA 2D0OA 3CM5A 5M1QA 5AQYA 1T6DA 1V4SA 5AQGA 1SL0A 5M1KA 1RT5A 5AQIA 1VK0A 5AJ3K 4H5NA 3VQ5A 1NK6A 5JENA 3FZFA 2Y1IA 4DQIA 2HHSA 2YHWA 1Z26A 3S3NA 4DSLA 1T3VA 5LMNK 3G6EN 3BUZB 3WNFA 1EO1A 3V9XA 5GINA 1X3NA 1X3MA 3QO9A 3VQAA 3TI0A 1NOYA 1KC8O 2A3ZA 4JV5K 4FJKA 1WSHA 1QSYA 2XO7A 1UAXA 5FRMA 2VG6A 2IIRA 3SAFA 5BRHA 1OH7A 4H8KA 3EKSA 4F3OA 4ELTA 2HB5A 4B9UA 4B1ZA 1C0GA 4YDUA 1U49A 2HHWA 4IJNA 3M1FA 3OS1A 3JSMA 4C8NA 1RFQA 2GV9A 3HJFA 4DR3K 4OPHA 3QIPA 2QK9A 1VSMA 1Q82O 1HYSA 4CK2A 2QEXN 4LD0A 4CK1A 3BZKA 4BACA 3V9SA 2WTUA 1L3TA 3CCSN 1KFDA 2QWLA 1RDCA 3IAYA 3QBWA 5C25A 3VENA 4FLVA 5DM6L 3QINA 4WQ4C 1EKEA 2A6AA 2YNIA 3OBYA 3PX6A 4DV7K 4KREA 3G10A 4J2AA 1LW2A 1BI4B 3OYBA 5AQOA 3VQ4A 4L3QA 3V1OA 4CZJA 4RWTA 3HOTA 4C23A 4F8RA 2UXDK 3EKUA 3UKUB 4BG8A 5HLFA 1MWMA 4CEDA 3NGIA 2B6AA 1HQEA 4E7LA 3BGRA 4AM6A 4FJNA 4KBOA 1OVYA 1XHZA 1NGGA 4ILHA 3K57A 1FXXA 1HNWK 1A5XA 3KKRA 3CMEN 3E01A 5ADXA 5HBMA 2G8WA 5CHIA 1RT4A 1MWKA 3WXMB 3QETA 2EHGA 1U04A 3CCQN 1FKOA 4ELUA 5JS1A 4C8KA 1NM1A 4JN4A 3L2VA 2NLXA 2DFEA 3OYGA 3GBTA 4JS4A 3PX4A 5HRNA 3ID8A 1NGDA 3CG7A 4DSIA 2QA4N 3VQ7A 2BH1A 1IBLK 5HOOA 3CETA 1F21A 2V7YA 3F73A 4UQGA 4WFNL 3K5MA 1VQON 1XC9A 3HXMA 1TK5A 5HROA 4XJXA 4C8LA 1NGJA 3EYZA 2D4WA 3IMXA 4DR1K 1U47A 1RGIA 2HMIA 2E88A 3SI6A 2HHIA 1RBRA 3CM6A 4FJ5A 2VWBA 1Y97A 4YHHK 5F0XA 3CJ9A 4CZKA 5GIPA 4K42A 3VF4A 3L4QA 3M8SA 4I6MB 3WUHA 4DQ8A 3PIOL 1S22A 3ASMA 3DLRA 1QSLA 3L6QA 1UA0A 3VQQA 2DFFA 5H1SQ 3QMLA 1YT3A 3VQBA 4A5BA 3OJUA 3DLGA 3VEYA 3HPGA 4CF0A 3TSUA 4FJ7A 1BHLA 4IBNA 3EE8A 1DLOA 3I56N 5FPMA 2GELA 3DLHA 3E9LA 4KTWA 3P38A 3NF7A 2P9PB 3SMSA 4B8AB 4AM7A 1RNHA 2W6KA 3ZEUA 3DXMB 2D1KA 3ATUA 5DM7L 2O8EA 4Y1DA 4KH5A 5SZTA 2BUPA 2ZWHA 4CD3A 2P9NA 4O55A 3RRHA 1QS4A 1RBSA 3HBTA 4CGHA 1WB9A 3AVGA 3D7EO 1I3AA 3RSEB 4DFMA 4M3RA 3CERA 1SQKA 3MCAB 1RBTA 3O3FA 1UOCA 5AQPA 3HP9A 1ILYA 1S3XA 4JI5K 4FZXC 3KK1A 3FZKA 3FZLA 1E4FT 1JCFA 1VQ7N 4WF9L 4JKGB 1BG3A 3VGMA 4OKKA 1LW0A 2A41A 3SJHA 3QICA 1JL1A 1M1KO 3FFIA 4BRDA 3PO5A 3EO3A 4JK9A 4FM0A 1TL3A 3LP2A 2O8DA 4KHUA 3ULEB 2ZGYA 3CIPA 1IO2A 2F8TA 4NLCA 1KVAA 2HHUA 1XNQK 1C6VA 2CH6A 3DOKA 1GLLO 4O4GA 4BR5A 4JI2K 3SAGA 4FJHA 3CCMN 3NF6A 1VQPN 1TVRA 4DSKA 1BGXT 2IVNA 3LDSA 5M1FA 4M7YA 4PWDA 1D9DA 4TSXA 2W42A 2A5XA 2YHXA 4HCCA 4BE0A 4JI0K 3VERA 4CGIA 5HL7L 1ZBSA 3FZHA 2UU9K 4JI6K 1RBUA 4KHNA 2XY6A 3MDQA 3MMVA 1MA9B 1REVA 3U4LA 3KD1E 4HWIA 3AO3A 3EE9A 3EY1A 5JLHA 4U67L 4FLTA 3EZ5A 2HNDA 3K9JA 3L0QA 5KGXA 1HPMA 5LJVA 4GKJK 1VSLA 3ZSXA 2HVHA 1S9EA 1CZ9A 2P9UA 1J9AA 3T1YK 3RMAA 1MU2A 3JXUA 2I7PA 1C1CA 4JHDA 2QTDA 4Y1CA 2P9SB 1JLAA 3HOSA 3TAQA 5M1PA 3MEGA 1ZBFA 1KTQA 4YORA 3AO5A 2YJFA 4B3SK 3TTCA 1BL3A 4FLYA 5CR4A 1C0MA 4DV2K 4EAHD 4KHPK 5KTQA 2Y1JA 5EX5A 4W5TA 3TAPA 4HHTA 2IGIA 5AQQA 1HPZA 2C1IA 3LM9A 2G8UA 1ZBIA 4FL9A 4B1WB 5BRFA 4H4OA 4EHUA 4BRHA 4BREA 4CF8A 4CBXA 2NRZA 3QEXA 2OCEA 3O4WA
chains in the Genus database with same CATH topology
4A61A 3PIPL 3D6RA 2ZJRL 1BU6O 3O08A 2OANA 2E2OA 4UY8O 3C7NB 5AQLA 1K8AO 3CJ1A 2JWKA 3QBXA 4RTFD 1QZ5A 3N4QA 1P90A 2Q36A 3VMFB 5AZJA 1KXPA 3ENHA 4F9OA 3IDHA 4CJ7A 5AZIB 2F9WA 2PAVA 2VGNA 3VESA 5E26A 4CZEA 3A8YA 2KKZA 1Q7YO 5TKYA 2ZJQL 2P9IA 1KD1O 4B1VA 2W00A 1BA0A 3DXKB 4PKGA 2GEMA 3O80A 3FR0A 2GWKA 2PBDA 3IUCA 4BY9C 3U8XA 3DWLA 1XC3A 4YDUC 2FLOA 1NJIO 4ILJA 4M63C 3H46O 5BR9A 3H1QA 3E66A 4JK8A 3ENBA 2GX9A 4AF1A 1IG8A 1NGIA 4JKBA 2ASMA 4ILGB 4O8KA 4IWVA 1JCGA 2ZJPL 2WBNA 3MN7A 1MDUB 1QQNA 1GLCG 4PL8A 1VQ6N 3NVKA 3ZEUB 4FWRA 2E8AA 3D2EB 3HRGA 1Q18A 4WFAL 2AP1A 3HM8A 3ZETB 1YIJN 4CD1A 3D2FA 1K9MO 4JD2B 3SAHA 3T7ZA 5AQFA 3KZBA 4PHTX 1KAZA 3U9ZA 2QWRA 4IOXA 3A0IX 1HKGA 2C1GA 2D0OA 1DEJA 5M1QA 5AQYA 3CCVN 1T6DA 1V4SA 5AQGA 3WEEB 2P9NB 4A5AA 5M1KA 5AQIA 4H5NA 4IJAA 4H0PA 3FZFA 2Q0UA 4WQ4A 3KK7A 2P9PA 4K43A 3ZX2A 3QB0A 3R8EA 3TPQA 5ELZA 2YHWA 3DXMA 4IO8A 1T3VA 5C2DA 1QQMA 3G6EN 3ENOA 5AFUA 4FO0A 3BUZB 4K41A 1EO1A 1YJ9N 5JVGL 5AQHA 3CPWM 1HX1A 5GINA 1X3NA 1X3MA 2VYPA 3EZWA 1KC8O 1GLDG 1YXQA 4FVUA 2A3ZA 3LDNA 2GTDA 5AQRA 4BRCA 2FSKA 3W3DA 2FF3B 4BRAA 2CGLA 2KHOA 2P9LA 2NNWA 3H45C 3OBWA 4YOWA 1BOTO 3SMPA 4FOEA 4FPAA 5AQVA 3RSEA 3R3LA 2IIRA 3SAFA 5BRHA 3BEXA 3EKSA 4BVOA 3BP8A 3H3NO 4JKDA 4B1ZA 5C0YA 1KAYA 1U2VA 1C0GA 4YDUA 4CZIA 3ZX3A 3SK3A 4CI6A 3SBGA 4IJNA 2V52B 3KWIA 2D0PA 3M1FA 4JKAA 3MCPA 1RFQA 2GWJA 4YOTA 5C12A 4H5TA 4OPHA 3HI0A 1VQ5N 5KPTA 2NZTA 1NGFA 4ISFA 4MDBA 5AQNA 3VETA 4XH5A 1BUPA 4JKGA 1GLJO 1TUUA 4JKFA 2F9TA 4BC5A 4BC3A 1Q82O 2OTJN 3KWGA 4EFHA 2YJEA 1QQOA 4PKIA 5BN9A 3J7ZO 2QEXN 5AQMA 1H1VA 4GV3A 4CBUA 3O9UA 5BPLA 1NGBA 3CCSN 4LC9B 4DHYA 4E1JA 2QWLA 5GAEP 3CF5L 4H5WA 2E2NA 3QBWA 1YJWN 5JICA 4A59A 5E84A 1LOTB 1O13A 3VENA 5M1OA 5C15A 5DM6L 4WQ4C 3ULEA 2A6AA 3NVMA 3GE1A 2HMPA 3OBYA 4FWOA 2Q97A 4IEIA 3MN9A 5AQZA 4CZMA 3CD6N 1BA1A 3DJCA 3TTDA 1GLEG 1E4GT 3ZETA 3U9DA 2I7NA 4FWPA 3FFKB 2VCPA 5AQOA 1NLVA 4L3QA 1K8KB 3C6AA 3CMAN 4CZJA 1T6CA 4RWTA 5GIOA 3HOTA 4C23A 3E1YA 3RVCA 4IFEA 3EN9A 3EKUA 4IOAL 3UKUB 4BG8A 2ASOA 2GUPA 1YI2N 4OO1J 1MWMA 3CC2N 1HKCA 3QDKA 4B1XB 1T44A 3AGKA 4FWMA 4AM6A 5BRDA 2RHKA 3B8AX 4KBOA 1OVYA 4H0OA 3ATVA 1QZ6A 4MDAA 3VGKA 4B1UB 1TYQB 2QW9A 1NGGA 4ILHA 4BE7B 2CGKA 1J6ZA 5C2FA 3CMEN 1KQSM 1Q86O 2QXLA 4XEIA 4BC2A 5ADXA 3H3OB 4FWNA 4JHDB 3HTVA 3T69A 1YUWA 2NRRA 3VTHA 4EHTA 3F9MA 1VAZA 5CHIA 1NGEA 4BRPA 3DAWA 4QS7A 1VQNN 4FSVA 1MWKA 2Q1NA 5EY4A 3WXMB 4DCHA 3VTIA 2A40A 1M90O 1R59O 4BR7A 3CCQN 1LCUA 1N8RO 3VEXA 3R1XA 1SAZA 4GY2B 1C0FA 4GV9A 1JCEA 4EIAA 4H5RA 1NM1A 4JN4A 4BGBA 2OTLN 2HBJA 3CCEN 2ZGZA 2NLXA 3NMUA 1QVFM 1G99A 1NBWA 2VGMA 4BRMA 3J8AA 3WQTA 3C0BA 3QFUA 5BN8A 2P9SA 3VEOA 4R79A 3GBTA 4JNEA 4H0YB 3CJBA 3F5TA 4C1NK 3ID8A 3E9OA 2BTFA 4NB4A 3WXJA 4MO4A 2E20A 3G25A 1WUAA 1NGDA 3PLAA 2H3GX 5I9EB 4HTLA 4O5FA 4JAXA 2V51B 3JS6A 4FPBA 5EVZA 4QS9A 3SLCA 3UKRA 3VF2A 3WXIA 2QA4N 1W2BM 2BH1A 5HOOA 3CETA 2V7YA 5MLCQ 2P9KA 5AZJB 4WFNL 1VQON 1NMDA 3HSCA 3O5BA 1NWKA 1HUXA 4A2AA 5JLFA 3R9PA 4XH1A 4XJXA 3LDOA 1DGKN 4M7XA 3OHRA 1NGJA 4JKEA 2D4WA 3IMXA 3SBTA 3VGLA 1RGIA 4GNIA 2E88A 3Q7CA 4O8UA 2EWSA 4OPAA 2P9IB 3O1WA 3QFPA 2VWBA 1W97L 2NRTA 4FWLA 4BG9A 1GLAG 5F0XA 1YF5L 2PFUA 3CJCA 3KHYA 2FXUA 3CJ9A 1YITN 2UYTA 3MWPA 3WT0A 4CZKA 5GIPA 4K42A 2ITMA 3VF4A 1YHQN 1U6ZA 1VQMN 3C7NA 3L4QA 2E2PA 2ASPA 4I6MB 2E1YA 4U7BA 3WUHA 4DQ8A 5JMVA 1S22A 3PIOL 1VQ4N 3BF3A 4NLBA 5AZIA 3AARA 4BR0A 3IKMA 4ISGA 3L6QA 3CJAA 3ID6A 3VEWA 5H1SQ 3F2KA 3QMLA 4A5BA 3M3ZA 5M1NA 4MLHA 3DXKA 2HF4A 4ISEA 2FSNA 2DPNA 2E2QA 3D2FB 3WXLA 1RDUA 1SS6A 5BREA 4QS8A 3VEYA 4BGAA 4Z94A 1NGAA 3GOIA 2Q31A 3K9KA 3TSUA 3EL2A 5KQDA 3EE8A 4GVEA 1Z05A 4BROA 3I56N 3O9RA 2IVOA 4CZGA 5BPNA 1K73O 5FPMA 2GELA 4H0VB 4BRLA 3GL1A 1XQSC 3E9LA 2NRWA 3P38A 3KVGA 3VEZA 3CQYA 2P9PB 1TUYA 3LDQA 1ESVA 3SMSA 4AM7A 3ZEUA 1QHAA 1YVNA 3DXMB 3D2EA 2D1KA 3ATUA 5DM7L 1V4TA 4BRQA 3P39A 2W41A 3A5OC 1Q81O 4JD2A 4A62A 4KH5A 5F2RA 2QWMA 3MN6A 3CCLN 1ATRA 3FLCO 4WQ5C 1QVGM 2BUPA 2ZWHA 1EQYA 3TSQA 1S72N 1VQKN 4YOXA 5AQTA 4CD3A 4DB3A 3S41A 5JVHL 3MK6A 4XH4A 1KAXA 3WEEA 4IEEA 3CCUN 2P9NA 3A5MC 4C1NI 4K25A 3TTFA 1HLUA 2P9LB 3G4SN 5FPEA 1X9JA 2WFBA 3HBTA 3WXKA 4B1YB 3D7EO 1IJJA 5BPMA 3BF1A 5B8HA 1Y64A 3RSEB 3TSPA 3H6EA 2HOEA 3UB5A 5CE3A 5LY3A 4IXCA 3W0LA 5FPDA 2IVPA 3CERA 1SQKA 3O9SA 3MCAB 4GV6A 2E1ZA 1RDWX 3CC7N 1ZC6A 1YJNN 1U2VB 1OKJA 2P9UB 5AQPA 5EXWA 5GAHP 1ILYA 1S3XA 4BQLA 1D4XA 4MO5A 3UE5A 3FZKA 4KH6A 4BRKA 5AFUH 1NGHA 3FZLA 1E4FT 2W40A 4BRGA 1P8ZA 1ZXOA 1JCFA 1VQ7N 4WF9L 1VQ9N 3N4PA 1JJ2M 3CXCM 1VQLN 4JKGB 1BG3A 2CGJA 3VGMA 3CCRN 5AQSA 4BVPA 3GG4A 2A41A 4CBWA 3SJHA 2FSJA 2HBLA 3ZYYX 3QICA 2V7ZA 1VQ8N 2QWOA 1M1KO 3VF6A 4BRDA 4H0XB 1HJOA 3LDPA 3FGUA 3EO3A 3I33A 4I6MA 4JK9A 2QWNA 4JKCA 5C10A 2WC9A 2HSTA 3Q7BA 2NRXA 1DKGD 3CI5A 3IFRA 4RCHA 5KPRA 3WQUA 4NO7A 3MWTA 2F7TA 3R6MA 3I8BA 5TKWA 3ULEB 4BQZA 1WOQA 2ZGYA 4CZLA 3CIPA 5AR0A 4WYBA 3CQXA 3LDLA 2NRVA 4NLCA 3M6GA 4PKHA 2CH6A 4FWKA 4A2BA 4JK7A 1GLLO 4BR5A 3SAGA 3MX2A 2A42A 3CCMN 1VQPN 1BO5O 3AGRA 3OA9A 3M5RA 4WQ5A 1BWFO 1XUPO 4BRNA 1BDGA 2IVNA 4MLEA 5AQJA 4BR9A 5M1FA 2NRHA 4WFBL 4H0TB 3O6WA 3L4IA 2QWPA 4M7YA 4KH4A 1DT9A 2HBMA 3TU5A 4IDHA 3P4IA 1CZAN 4CZFA 2A5XA 2YHXA 2WUSA 3P31A 4WCEL 3VERA 3GDQA 5HL7L 1ZBSA 3FZHA 2HBKA 3LM2A 3AY9A 3FZMA 1NGCA 4H5VA 5AQUA 4PL7A 4BRFA 3G71N 2YI1A 3MDQA 3MMVA 1K8KA 5GAGP 1MA9B 4YOVA 3U4LA 4HWIA 4JEPA 3A5NC 3MX5A 4BR4A 3C6HA 3CPEA 3EE9A 4BECA 4FWQA 3UKUA 2YHYA 5JLHA 3CHWA 3A5LC 3CJ7A 4U67L 1ATSA 1Z6RA 3K9JA 3L0QA 4J8FA 1HPMA 5LJVA 1YAGA 2QWQA 3VPZA 4A57A 3O8MA 2ZF5O 3AAPA 1TYQA 2RE2A 5FPNA 2P9UA 2Q2RA 4IZ9A 1GLFO 3E9PA 5AQKA 4Y0WA 2YX6A 5EOYA 5LJWA 3I55N 3OW2M 3VOVA 4BR2A 4YOUA 3JXUA 2I7PA 4BRIA 4JHDA 2QTDA 4CZHA 2J4RA 3O9QA 2P9SB 4IOCL 2FF6A 4FOIA 3HOSA 3H1VX 5ADXH 2AA4A 4BEBA 1SZ2A 5M1PA 3O1BA 4YORA 3HZ6A 2YCHA 4DKWA 5AQXA 2YJFA 3ZX0A 3TTCA 3C65A 3UKRB 3CC4N 5CR4A 3O9TA 4B9QA 1ATNA 2P9KB 4EAHD 3FE1A 5KPZA 5EX5A 2QI2A 2KLAA 3AAQA 5AQQA 5AQWA 1GLBG 3LL3A 3CCJN 4BC4A 1HKBA 3LM9A 4IO9L 2Q0RA 5GADP 4FL9A 4B1WB 5BRFA 2C1IA 4FWSA 2CH5A 4EHUA 4BRHA 4BREA 3MN5A 4JKHA 4CBXA 2NRZA 5F1XA 4H03B 2QM1A 3VEVA 2JWLA 5KQ8A 4G9ZA 3O4WA 4YOYA 2HF3A 3DLLL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A61 A;  1BU6 O;  3O08 A;  2OAN A;  2E2O A;  3C7N B;  5AQL A;  3CJ1 A;  3QBX A;  4RTF D;  1QZ5 A;  2Q36 A;  5AZJ A;  1KXP A;  3ENH A;  4F9O A;  3IDH A;  4CJ7 A;  5AZI B;  2F9W A;  2PAV A;  3VES A;  5E26 A;  4CZE A;  3A8Y A;  5TKY A;  2P9I A;  4B1V A;  1BA0 A;  3DXK B;  4PKG A;  2GEM A;  3O80 A;  3FR0 A;  2GWK A;  2PBD A;  3IUC A;  3U8X A;  3DWL A;  1XC3 A;  4YDU C;  2FLO A;  4M63 C;  3H46 O;  5BR9 A;  3H1Q A;  1IG8 A;  1NGI A;  2ASM A;  4O8K A;  4IWV A;  1JCG A;  3MN7 A;  1MDU B;  1QQN A;  1GLC G;  4PL8 A;  3ZEU B;  4FWR A;  2E8A A;  3D2E B;  1Q18 A;  2AP1 A;  3HM8 A;  3ZET B;  4CD1 A;  3D2F A;  4JD2 B;  5AQF A;  3KZB A;  1KAZ A;  3U9Z A;  2QWR A;  3A0I X;  1HKG A;  2D0O A;  1DEJ A;  5AQY A;  1T6D A;  1V4S A;  5AQG A;  3WEE B;  2P9N B;  5AQI A;  4H5N A;  4IJA A;  4H0P A;  3FZF A;  2Q0U A;  4WQ4 A;  2P9P A;  4K43 A;  3ZX2 A;  3QB0 A;  3R8E A;  3TPQ A;  5ELZ A;  2YHW A;  3DXM A;  4IO8 A;  1QQM A;  3ENO A;  5AFU A;  4FO0 A;  3BUZ B;  4K41 A;  5AQH A;  1HX1 A;  1X3N A;  1X3M A;  2VYP A;  3EZW A;  1GLD G;  1YXQ A;  2A3Z A;  3LDN A;  2GTD A;  5AQR A;  4BRC A;  2FSK A;  3W3D A;  2FF3 B;  4BRA A;  2CGL A;  2KHO A;  2P9L A;  3H45 C;  1BOT O;  3SMP A;  4FOE A;  4FPA A;  5AQV A;  3RSE A;  2IIR A;  5BRH A;  3BEX A;  3EKS A;  4BVO A;  3BP8 A;  3H3N O;  4B1Z A;  1KAY A;  1U2V A;  1C0G A;  4YDU A;  4CZI A;  3ZX3 A;  3SK3 A;  4CI6 A;  4IJN A;  2V52 B;  2D0P A;  3M1F A;  3MCP A;  1RFQ A;  2GWJ A;  4H5T A;  3HI0 A;  5KPT A;  2NZT A;  1NGF A;  4ISF A;  5AQN A;  3VET A;  4XH5 A;  1BUP A;  1GLJ O;  1TUU A;  4BC5 A;  2F9T A;  4BC3 A;  4EFH A;  2YJE A;  1QQO A;  4PKI A;  5BN9 A;  5AQM A;  1H1V A;  4CBU A;  5BPL A;  1NGB A;  4LC9 B;  4DHY A;  4E1J A;  2QWL A;  4H5W A;  2E2N A;  3QBW A;  5JIC A;  5E84 A;  1LOT B;  3VEN A;  4WQ4 C;  3ULE A;  2A6A A;  3GE1 A;  2HMP A;  4FWO A;  2Q97 A;  3MN9 A;  5AQZ A;  4CZM A;  1BA1 A;  3DJC A;  1GLE G;  1E4G T;  3ZET A;  3U9D A;  2I7N A;  4FWP A;  3FFK B;  2VCP A;  5AQO A;  1NLV A;  4L3Q A;  1K8K B;  4CZJ A;  1T6C A;  4RWT A;  4C23 A;  3EN9 A;  3EKU A;  3UKU B;  4BG8 A;  2ASO A;  2GUP A;  1MWM A;  1HKC A;  3QDK A;  4B1X B;  1T44 A;  4FWM A;  4AM6 A;  5BRD A;  3B8A X;  4KBO A;  4B1U B;  4H0O A;  3ATV A;  1QZ6 A;  3VGK A;  1TYQ B;  2QW9 A;  1NGG A;  2CGK A;  1J6Z A;  2QXL A;  4XEI A;  4BC2 A;  5ADX A;  3H3O B;  4FWN A;  4JHD B;  3HTV A;  1YUW A;  4EHT A;  3F9M A;  1NGE A;  4BRP A;  3DAW A;  4QS7 A;  4FSV A;  1MWK A;  2Q1N A;  5EY4 A;  4DCH A;  2A40 A;  1R59 O;  4BR7 A;  1LCU A;  3VEX A;  1SAZ A;  4GY2 B;  1C0F A;  1JCE A;  4EIA A;  4H5R A;  1NM1 A;  4JN4 A;  4BGB A;  2ZGZ A;  2NLX A;  1G99 A;  1NBW A;  4BRM A;  3J8A A;  3WQT A;  3C0B A;  3QFU A;  5BN8 A;  2P9S A;  3VEO A;  3GBT A;  4JNE A;  4H0Y B;  3CJB A;  3ID8 A;  2BTF A;  4NB4 A;  3WXJ A;  4MO4 A;  2E20 A;  3G25 A;  1WUA A;  1NGD A;  2H3G X;  5I9E B;  4HTL A;  4O5F A;  4JAX A;  2V51 B;  3JS6 A;  4FPB A;  5EVZ A;  4QS9 A;  3SLC A;  3UKR A;  3VF2 A;  3WXI A;  3CET A;  2V7Y A;  2P9K A;  5AZJ B;  1NMD A;  3HSC A;  3O5B A;  1NWK A;  1HUX A;  4A2A A;  5JLF A;  3R9P A;  4XH1 A;  3LDO A;  1DGK N;  4M7X A;  3OHR A;  1NGJ A;  2D4W A;  3IMX A;  3VGL A;  1RGI A;  4GNI A;  2E88 A;  2EWS A;  2P9I B;  3O1W A;  3QFP A;  2VWB A;  4FWL A;  4BG9 A;  1GLA G;  5F0X A;  3CJC A;  3KHY A;  2FXU A;  3CJ9 A;  2UYT A;  4CZK A;  3WT0 A;  4K42 A;  2ITM A;  3VF4 A;  1U6Z A;  3C7N A;  2E2P A;  2ASP A;  4I6M B;  2E1Y A;  3WUH A;  4DQ8 A;  5JMV A;  1S22 A;  3BF3 A;  5AZI A;  3AAR A;  4BR0 A;  4ISG A;  3L6Q A;  3CJA A;  3VEW A;  3QML A;  3M3Z A;  4MLH A;  3DXK A;  2HF4 A;  4ISE A;  2FSN A;  2DPN A;  2E2Q A;  3D2F B;  3WXL A;  5BRE A;  4QS8 A;  3VEY A;  4BGA A;  4Z94 A;  1NGA A;  3GOI A;  2Q31 A;  3EL2 A;  5KQD A;  4BRO A;  1Z05 A;  2IVO A;  4CZG A;  5BPN A;  5FPM A;  2GEL A;  4H0V B;  4BRL A;  3GL1 A;  1XQS C;  3KVG A;  3VEZ A;  3CQY A;  2P9P B;  1TUY A;  3LDQ A;  1ESV A;  3SMS A;  4AM7 A;  3ZEU A;  1QHA A;  1YVN A;  3DXM B;  3D2E A;  2D1K A;  3ATU A;  1V4T A;  4BRQ A;  2W41 A;  3A5O C;  4JD2 A;  4A62 A;  5F2R A;  2QWM A;  3MN6 A;  1ATR A;  3FLC O;  4WQ5 C;  2BUP A;  2ZWH A;  1EQY A;  5AQT A;  4CD3 A;  4DB3 A;  3S41 A;  3MK6 A;  4XH4 A;  1KAX A;  3WEE A;  2P9N A;  3A5M C;  4K25 A;  1HLU A;  2P9L B;  5FPE A;  1X9J A;  3WXK A;  3HBT A;  4B1Y B;  3D7E O;  1IJJ A;  5BPM A;  3BF1 A;  5B8H A;  1Y64 A;  3RSE B;  3H6E A;  2HOE A;  3UB5 A;  5CE3 A;  5LY3 A;  4IXC A;  3W0L A;  5FPD A;  2IVP A;  3CER A;  1SQK A;  2E1Z A;  1RDW X;  1ZC6 A;  1U2V B;  1OKJ A;  2P9U B;  5AQP A;  5EXW A;  1S3X A;  4BQL A;  1D4X A;  4MO5 A;  3UE5 A;  3FZK A;  4BRK A;  5AFU H;  3FZL A;  1NGH A;  1E4F T;  2W40 A;  4BRG A;  1P8Z A;  1ZXO A;  1JCF A;  1BG3 A;  2CGJ A;  3VGM A;  5AQS A;  4BVP A;  3GG4 A;  2A41 A;  4CBW A;  3SJH A;  2FSJ A;  3QIC A;  2V7Z A;  2QWO A;  3VF6 A;  4BRD A;  4H0X B;  1HJO A;  3LDP A;  3FGU A;  3EO3 A;  3I33 A;  4I6M A;  2QWN A;  1DKG D;  3CI5 A;  3IFR A;  4RCH A;  5KPR A;  3WQU A;  4NO7 A;  3R6M A;  3I8B A;  3ULE B;  4BQZ A;  1WOQ A;  2ZGY A;  4CZL A;  3CIP A;  5AR0 A;  4WYB A;  3CQX A;  3LDL A;  3M6G A;  4PKH A;  2CH6 A;  4FWK A;  4A2B A;  1GLL O;  4BR5 A;  2A42 A;  1BO5 O;  4WQ5 A;  1BWF O;  1XUP O;  4BRN A;  1BDG A;  2IVN A;  4MLE A;  5AQJ A;  4BR9 A;  2NRH A;  4H0T B;  3O6W A;  3L4I A;  2QWP A;  4M7Y A;  3TU5 A;  3P4I A;  1CZA N;  4CZF A;  2A5X A;  2YHX A;  2WUS A;  3VER A;  3GDQ A;  1ZBS A;  3FZH A;  3LM2 A;  3AY9 A;  3FZM A;  1NGC A;  4H5V A;  5AQU A;  4PL7 A;  4BRF A;  2YI1 A;  3MDQ A;  3MMV A;  1K8K A;  1MA9 B;  3U4L A;  4HWI A;  3A5N C;  4BR4 A;  4FWQ A;  3UKU A;  2YHY A;  5JLH A;  3CHW A;  3A5L C;  3CJ7 A;  1ATS A;  1Z6R A;  3L0Q A;  4J8F A;  1HPM A;  5LJV A;  1YAG A;  2QWQ A;  3VPZ A;  3O8M A;  2ZF5 O;  3AAP A;  1TYQ A;  5FPN A;  2P9U A;  2Q2R A;  4IZ9 A;  1GLF O;  5AQK A;  5EOY A;  4Y0W A;  5LJW A;  3VOV A;  4BR2 A;  3JXU A;  2I7P A;  4BRI A;  4JHD A;  4CZH A;  2J4R A;  2P9S B;  2FF6 A;  4FOI A;  3H1V X;  5ADX H;  2AA4 A;  1SZ2 A;  3O1B A;  3HZ6 A;  2YCH A;  5AQX A;  2YJF A;  3ZX0 A;  3UKR B;  4B9Q A;  1ATN A;  2P9K B;  4EAH D;  3FE1 A;  5KPZ A;  5EX5 A;  3AAQ A;  5AQQ A;  5AQW A;  1GLB G;  3LL3 A;  4BC4 A;  1HKB A;  3LM9 A;  2Q0R A;  4FL9 A;  4B1W B;  5BRF A;  4FWS A;  2CH5 A;  4EHU A;  4BRH A;  4BRE A;  3MN5 A;  4CBX A;  5F1X A;  4H03 B;  2QM1 A;  3VEV A;  5KQ8 A;  3O4W A;  2HF3 A; 
#chains in the Genus database with same CATH topology
 3D6R A;  2OAN A;  4CHY A;  3C7N B;  5AQL A;  1K8A O;  1RT7 A;  2Q36 A;  3VMF B;  3THW A;  2X78 A;  5K14 A;  2O4I A;  3KK3 A;  5AZI B;  2FBY A;  3A8Y A;  3MXM A;  1WAF A;  2XHB A;  3AVA A;  4PKG A;  4CJ3 A;  4DTN A;  2HHH K;  4CJE A;  2XY7 A;  4BY9 C;  3U8X A;  1S1V A;  4ILJ A;  4DQS A;  3H1Q A;  4JK8 A;  3ENB A;  4AH9 A;  4IWV A;  5DMR A;  2OYQ A;  3MN7 A;  1MDU B;  4F2R A;  4PL8 A;  3TAM A;  2YNG A;  4FJI A;  2AP1 A;  4E89 A;  4BDZ A;  3ZET B;  1K9M O;  3KZB A;  1N36 K;  3ZSZ A;  1KAZ A;  3U9Z A;  1HKG A;  1DEJ A;  4B9T A;  3M8Q A;  1X1P A;  3WEE B;  3OS0 A;  4ID1 A;  4A5A A;  1NK4 A;  1CLQ A;  4H0P A;  3KK7 A;  4K43 A;  1X9M A;  5J2M A;  3HPH A;  1EP4 A;  3TAB A;  1KRP A;  3QB0 A;  4OGE A;  3TPQ A;  5ELZ A;  4Z4G A;  1ASV A;  1YVU A;  5JS2 A;  2B4J A;  4IO8 A;  1KCF A;  1I94 K;  5C2D A;  3PSI A;  5AFU A;  4K41 A;  2O4G A;  4F2S A;  5JVG L;  1HX1 A;  5LL6 Z;  4CJS A;  3V6D A;  3W3D A;  2FF3 B;  1XHX A;  3SCX A;  2NNW A;  3T1H K;  5CY4 A;  3SMP A;  4CFD A;  4FOE A;  4FPA A;  3R3L A;  3NH0 A;  4BVO A;  1U48 A;  4CZI A;  3OYN A;  4CEQ A;  1WLJ A;  2G8K A;  3SK3 A;  4CI6 A;  3SBG A;  3K58 A;  4KPY A;  2X6N A;  2D0P A;  1RT3 A;  2D0C A;  3LP1 A;  3K5N A;  3QLH A;  1VQ5 N;  4FJL A;  2R7Y A;  4ISF A;  5AQN A;  4DTX A;  1BUP A;  3V9W A;  4EFH A;  2G8H A;  1QQO A;  4PKI A;  3J7Z O;  3AA4 A;  5BPL A;  3SPY A;  4LC9 B;  3IS9 A;  1TL1 A;  3AVN A;  2RF2 A;  4KO0 A;  5E84 A;  2O8C A;  2O8B B;  2VQE K;  4FYD A;  2OZS A;  1DTQ A;  4J2E A;  4FK2 A;  1WSF A;  3GE1 A;  2A1R A;  5AQZ A;  4OPJ A;  3CD6 N;  4QAG A;  1E4G T;  4F4K A;  1GOA A;  3U9D A;  2I7N A;  4G1Q A;  3ZSR A;  1K8K B;  2QKB A;  5GIO A;  3TAG A;  3OYE A;  3NBP A;  1T7P A;  4F3T A;  4DTO A;  3RVC A;  4IFE A;  3DLE A;  1RTJ A;  3EN9 A;  4OO1 J;  2GUP A;  3VQE A;  4ZTF A;  3QDK A;  3AGK A;  4FWM A;  5CYM A;  5BRD A;  2RHK A;  4B1U B;  4H0O A;  2IC3 A;  1TYQ B;  2QW9 A;  5C2F A;  1KQS M;  3CQ8 A;  4BC2 A;  1BCM A;  3HTV A;  1OVQ A;  1YUW A;  2NRR A;  1EX4 A;  4GKK K;  3HT3 A;  3F9M A;  1NGE A;  3DAW A;  4JRP A;  1RBV A;  1TKX A;  4DCH A;  2VWJ A;  3VTI A;  2AJQ A;  3TAR A;  1HRH A;  4EIA A;  4H5R A;  2OTL N;  3OY9 A;  1VHX A;  3CCE N;  2ZGZ A;  4MFB A;  3AVH A;  4E7K A;  1G99 A;  1NOZ A;  4O44 A;  1NKC A;  1Q9Y A;  1NK7 A;  4R79 A;  3ISN C;  2G8I A;  1B9D A;  1IKX A;  4K8Z A;  4MO4 A;  3G25 A;  3PLA A;  1DTT A;  2H3G X;  1JLG A;  3JS6 A;  4JAX A;  5EVZ A;  1W2B M;  4FLZ A;  2P9K A;  3JAM O;  2OA8 A;  3HSC A;  1HUX A;  3WNH A;  4O0I A;  3THX B;  1IKW A;  4RW6 A;  4XH1 A;  3T19 A;  1DGK N;  4M7X A;  3OHR A;  4BWM A;  4E3S A;  2PYL A;  3VGL A;  1FK9 A;  3Q7C A;  4O8U A;  1CZB A;  1UA1 A;  4KHS A;  4DMN A;  2PFU A;  2FXU A;  4CEO A;  3MWP A;  4LY7 A;  4O5B A;  2ITM A;  1YHQ N;  1U6Z A;  2E2P A;  5CZ2 A;  4W5R A;  2E6L A;  4CVN E;  5JMV A;  1W7A A;  4GVM A;  3UIQ A;  1O1W A;  3AAR A;  3IKM A;  4W5N A;  3V81 A;  3AA2 A;  1BIU A;  2E5L K;  4CEE A;  1E3M A;  5C42 A;  4FM1 A;  2HF4 A;  2DPN A;  2E2Q A;  3D2F B;  3WXL A;  1NMN A;  3O3H A;  1ZBU A;  2HHT A;  4E7I A;  1NGA A;  3EEQ A;  4OX9 K;  1G15 A;  1WSG A;  5J2P A;  4GVE A;  1Z05 A;  5BPN A;  2NRW A;  2QKK A;  1LAV A;  1YVN A;  4DU3 A;  4ID5 A;  4BRQ A;  1EXQ A;  3A5O C;  4A62 A;  4CJF A;  1HJR A;  1TAU A;  3MN6 A;  1ATR A;  3TSQ A;  1WAJ A;  1HNV A;  2O8F A;  3AVF A;  3S41 A;  4DG1 A;  3OS2 A;  4XH4 A;  3CCU N;  4K25 A;  3G4S N;  3DRP A;  4N56 A;  3SQ2 A;  1UWB A;  4CFC A;  1Y64 A;  3H6E A;  3DI6 A;  1C1B A;  5LY3 A;  3KLH A;  5FPD A;  4CJV A;  3O9S A;  4I2Q A;  3CC7 N;  4CGJ A;  1U45 A;  4KFB A;  1LV5 A;  4BRK A;  1SKS A;  3MXJ A;  1IKV A;  1ZXO A;  3THY A;  2KFN A;  3N4P A;  3CFR A;  1JJ2 M;  4JI3 K;  3CXC M;  4KKO A;  1BIS A;  5AQS A;  3NFA A;  4CBW A;  3ZYY X;  4FLU A;  4LF7 K;  2QWO A;  5IWA K;  4LF6 K;  5KRT A;  1VRU A;  1HJO A;  4ELV A;  4I6M A;  3CYG A;  1GOB A;  2KW4 A;  2NRX A;  3CI5 A;  3IFR A;  5KPR A;  3SZ2 A;  1BIZ A;  4NO7 A;  3WQU A;  3LWM A;  2F7T A;  3R6M A;  4BQZ A;  3KLI A;  1J54 A;  1S6Q A;  4CZL A;  2YHB A;  3KKS A;  3WNG A;  1Q8I A;  3HPO A;  1NKE A;  3LDL A;  4LF9 K;  2Z1J A;  1NJY A;  4DSF A;  4FWK A;  4M41 A;  4A2B A;  4JK7 A;  1NK0 A;  3ZSW A;  1EWQ A;  3OYC A;  1KVB A;  1Z25 A;  1BO5 O;  3OA9 A;  3M5R A;  3PUF A;  1BWF O;  2BDP A;  3DLK A;  4BR9 A;  3AVC A;  4WFB L;  1C1A A;  4DR4 K;  4B3O A;  4KH4 A;  2XY5 A;  1DT9 A;  2HBM A;  3OYL A;  2WON A;  2ATQ A;  3KK2 A;  4WCE L;  3KTQ A;  2HBK A;  3LM2 A;  3FZM A;  3ZT1 A;  3RR8 A;  4QOZ B;  4YOV A;  4DSJ A;  4JEP A;  1ASU A;  3MX5 A;  3QNO A;  3HO1 A;  4KB1 A;  4BR4 A;  2E6M A;  4CES A;  4M3U A;  4BEC A;  2X6S A;  1BQM A;  3CHW A;  3A5L C;  1VRT A;  3CYM A;  5HRR A;  4I2P A;  2VWK A;  4LF8 K;  2UXC K;  1YAG A;  2PZS A;  3O8M A;  4HUF A;  3AAP A;  2OPQ A;  4M3Y A;  3J80 O;  4Y0W A;  3I55 N;  3DYA A;  2OPP A;  4GW6 A;  4Z4E A;  4CZH A;  2J4R A;  3O9Q A;  2FF6 A;  1D5A A;  2AA4 A;  3HL8 A;  3SV4 A;  3SV3 A;  4BEB A;  1SZ2 A;  3J7A P;  3OJS A;  3HZ6 A;  4ICL A;  3ZX0 A;  1SKW A;  3MEE A;  4B9Q A;  4BE1 A;  2NUB A;  2X74 A;  4LSN A;  5HRS A;  3CCJ N;  4IO9 L;  1HKB A;  2Q0R A;  5GAD P;  2ZD1 A;  4FWS A;  4IFV A;  3MN5 A;  4CGD A;  4JKH A;  5F1X A;  4H03 B;  3RMB A;  3VEV A;  2JWL A;  5J2N A;  4YOY A;  3ZSV A;  3ULD A;  1P90 A;  3VQ8 A;  4FW2 A;  5AZJ A;  1KXP A;  1SKR A;  4F9O A;  3O3G A;  5E26 A;  3F9K A;  1XMO K;  2VQF K;  1Q7Y O;  2P9I A;  4NXN K;  2W00 A;  4DR2 K;  2GEM A;  3O80 A;  4DFJ A;  1IKY A;  3IUC A;  5HRP A;  4E1M A;  2ZQB A;  4M63 C;  5BR9 A;  1TKT A;  1FKP A;  2FBX A;  4DV5 K;  1X9W A;  1XNR K;  3E66 A;  2GUI A;  1IG8 A;  4JKB A;  5T7B A;  4FXD A;  3NE6 A;  2ZJP L;  1N33 K;  3ZSO A;  4CJP A;  3J7Y P;  1S6P A;  3ZEU B;  2EX3 A;  4FW1 A;  4B8C A;  1RTD A;  2O8E B;  5FDL A;  3NF9 A;  4CJW A;  1D8Y A;  2QWR A;  2PY5 A;  3CCV N;  3K5O A;  2ZM6 K;  2P9N B;  1TKZ A;  2LSN A;  4BE2 A;  2G8V A;  3ZX2 A;  3R8E A;  3QES A;  1NJZ A;  4M45 A;  3ZT3 A;  4BWJ A;  4EP5 A;  4I9L A;  1QQM A;  2UUA K;  4DV6 K;  5AQH A;  3CPW M;  4FVU A;  4BRC A;  2GTD A;  2FSK A;  2KHO A;  2P9L A;  3QER A;  3DM2 A;  1BOT O;  3I0R A;  3G0Z A;  4M3W A;  3H3N O;  4JKD A;  1KAY A;  1U2V A;  1HYV A;  2FBT A;  2V52 B;  3KWI A;  4JKA A;  3MCP A;  2O8D B;  1NNE A;  4OJR A;  5C12 A;  4H5T A;  3HI0 A;  5KPT A;  3VA0 A;  2YNH A;  2UUB K;  3VET A;  4XH5 A;  4FM2 A;  4BC5 A;  2OTJ N;  2F9T A;  4KI6 A;  3KWG A;  4Q0B A;  2YJE A;  4AHC A;  3PX0 A;  5AQM A;  1H1V A;  4GV3 A;  4NYF A;  3O9U A;  1NGB A;  3CF5 L;  3NGY A;  4H5W A;  4A59 A;  2DTU A;  1LOT B;  1O13 A;  5M1O A;  5C15 A;  5BR8 K;  4DU4 A;  2KFZ A;  3H08 A;  4DFP A;  3P5J A;  3MED A;  3NVM A;  2PYJ A;  2Q97 A;  1VSF A;  4IEI A;  1L3U A;  2IDO A;  2YHA A;  1GLE G;  3BZC A;  3ZET A;  2BGG A;  4CJQ A;  2VCP A;  3OTO K;  1IBK K;  3C6A A;  1T6C A;  2D0B A;  4DF8 A;  4JI1 K;  4IOA L;  4Z0U A;  2A1S A;  1YI2 N;  2ASO A;  3C95 A;  1OH8 A;  1HKC A;  4B3M K;  1NJW A;  4B1X B;  4CGF A;  1S9G A;  1QE1 A;  4MDA A;  3VGK A;  3ATV A;  1OH5 A;  4KHW A;  4BE7 B;  4Z4H A;  3S3M A;  1IH7 A;  1WNS A;  4DLE A;  2CGK A;  5HP1 A;  1SL1 A;  3BDP A;  2QXL A;  3OYM A;  2KQ2 A;  3H3O B;  4JHD B;  1XMQ K;  4EHT A;  4CFA A;  4BDY A;  5J2Q A;  1VSH A;  4QS7 A;  1VQN N;  4FSV A;  4FK4 A;  2Q1N A;  5EY4 A;  4CE9 A;  2A40 A;  1M90 O;  3DOL A;  1LCU A;  3R1X A;  1SAZ A;  4GY2 B;  1C0F A;  1J5E K;  3B6O A;  4BGB A;  4DV1 K;  3SNN A;  3AVB A;  3DRR A;  3NMU A;  1NBW A;  1VSJ A;  2VGM A;  3J8A A;  3WQT A;  4AQY K;  3C0B A;  5BN8 A;  5DK5 A;  4JYA K;  4JNE A;  5D3G A;  1J53 A;  1W0H A;  3OYH A;  4C1N K;  4B9S A;  3NAE A;  3E9O A;  4C8O A;  1QQC A;  2E20 A;  2HNY A;  4LH4 A;  2UUC K;  3CFO A;  4O5F A;  3I0S A;  4FPB A;  3UKR A;  5E41 A;  2IS3 A;  3WXI A;  2FBV A;  3THW B;  1NMD A;  3NCI A;  4A2A A;  5JLF A;  3R9P A;  5LMU K;  1TV6 A;  3LDO A;  4EZ9 A;  1RTI A;  3V4I A;  4GNI A;  4HVJ A;  3O1W A;  2NRT A;  1KFS A;  3CJC A;  3KHY A;  1YIT N;  5KI6 A;  2UYT A;  1N34 K;  3WT0 A;  1S1W A;  3LP3 A;  4CHO A;  4U7B A;  4CER A;  3SQ1 A;  4O0J A;  1W9H A;  4JI4 K;  1VQ4 N;  4NLB A;  4E7J A;  4BR0 A;  4I9Q A;  4DV0 K;  3CJA A;  4JI8 K;  2ZE2 A;  3LPT A;  3VEW A;  3F2K A;  4FVM A;  3M3Z A;  1NK8 A;  5M1N A;  4MLH A;  4B9V A;  3DXK A;  4ISE A;  1ZYQ A;  2HW3 A;  2FSN A;  3RTV A;  4KB0 A;  3ALY A;  4CJU A;  4M3X A;  1SS6 A;  5BRE A;  3L2U A;  4LF4 K;  4BGA A;  4Z94 A;  1HQU A;  5CZ1 A;  3GOI A;  2Q31 A;  3EL2 A;  5KQD A;  3KIO A;  3O9R A;  3LZJ A;  3OYK A;  4H0V B;  1IG9 A;  4LSL A;  3ZT2 A;  4DR5 K;  4KHY A;  4CEC A;  3VEZ A;  3CQY A;  3LDQ A;  4CF2 A;  1TKD A;  1QHA A;  3QNN A;  3SUP A;  4Z4F A;  3D2E A;  1YTU A;  1V4T A;  3NH1 A;  2W41 A;  1RT6 A;  2HHV A;  4JD2 A;  3CCL N;  2QWM A;  4OPK A;  4WQ5 C;  1QVG M;  1S72 N;  4DB3 A;  3MK6 A;  4IEE A;  1VSE A;  3AVJ A;  4C1N I;  3AVL A;  1X9J A;  1RTH A;  2WFB A;  3WXK A;  5FPE A;  3K59 A;  3K2P A;  4CEF A;  1IJJ A;  5B8H A;  4CF1 A;  2HOE A;  1ZBL A;  4FLX A;  2WOM A;  4R5P A;  1VSK A;  4IXC A;  2IVP A;  3NGZ A;  4GV6 A;  4DR6 K;  2E1Z A;  1ZC6 A;  1NKB A;  5GAH P;  1WBB A;  5EXW A;  1RT2 A;  4BQL A;  2Q3S A;  1HYZ A;  1WSE A;  4CW7 B;  1NGH A;  4BRG A;  3SJJ A;  3L8B A;  3SPZ A;  4NYN A;  4LFA K;  4ZHR A;  4L8R B;  4JI7 K;  1KVC A;  3QEW A;  4E72 A;  2YV0 X;  2CGJ A;  3CCR N;  3GG4 A;  3SUQ A;  1IBM K;  2HBL A;  2V7Z A;  4FJX A;  4CJ5 A;  4CJK A;  4E0D A;  2B5J A;  5EU7 A;  3LDP A;  4B3T K;  3FGU A;  3I33 A;  2QWN A;  1S1T A;  5C10 A;  2HST A;  4J2D A;  1DKG D;  4X66 K;  2O8C B;  3RMC A;  1TK8 A;  1QSS A;  3I8B A;  5TKW A;  3OVN A;  3CQX A;  1T8E A;  1N5Y A;  4DWI A;  4DS5 A;  3MX2 A;  4KRF A;  4PUO A;  4WQ5 A;  4FJ8 A;  1XUP O;  4MLE A;  3V1Q A;  5AQJ A;  3ITH A;  1K6Y A;  2NRH A;  3VQD A;  3L4I A;  2QWP A;  4IKF A;  4NCB A;  4CIF A;  3KLG A;  3TU5 A;  3ZLJ A;  2YKM A;  4IG3 A;  1BQN A;  1NJX A;  4CZF A;  5IT9 O;  1TK0 A;  2WUS A;  4RG8 A;  3P31 A;  2ETJ A;  1EET A;  3AY9 A;  3S5T A;  4H5V A;  5AQU A;  1BI4 A;  4B9L A;  4PL7 A;  3NF8 A;  1SL2 A;  5GAG P;  4QCL A;  1QTM A;  3CPE A;  4FWQ A;  3T3F A;  3UKU A;  2YHY A;  3HVR A;  5FRO A;  3CJ7 A;  4PQU A;  1ATS A;  1Z6R A;  5FLX O;  1A5V A;  4J8F A;  3VPZ A;  4A57 A;  1NK5 A;  5AQK A;  4IZ9 A;  1JXB A;  5EOY A;  5LJW A;  3PY8 A;  3VOV A;  3M8R A;  4BR2 A;  1A5W A;  4YOU A;  4BRI A;  3ZT0 A;  4M42 A;  3H1V X;  5ADX H;  4OLA A;  1FJG K;  1TAQ A;  4DTS A;  3NDK A;  2ITG A;  2YCH A;  5AQX A;  3HP6 A;  1RDA A;  3C65 A;  3CC4 N;  3O9T A;  1ATN A;  3JYT A;  2P9K B;  4OKJ A;  1BCO A;  3FE1 A;  5AQW A;  5A2Q O;  1GLB G;  4AHR A;  1CXU A;  3DRS A;  4DTP A;  4CCH A;  4HCB A;  3PV8 A;  4RW8 A;  2CH5 A;  4Z4C A;  4FCY A;  1HNI A;  2G8F A;  5I42 A;  5KQ8 A;  4G9Z A;  3SUO A;  3LP0 A;  2HF3 A;  3WNE A;  3DLL L;  3V9Z A;  3PIP L;  1JLQ A;  4EZ6 A;  1JKH A;  4E7H A;  3L3V A;  3CJ1 A;  3QBX A;  4RTF D;  2VG5 A;  4DS4 A;  2F96 A;  3NH2 A;  4DTR A;  3C6T A;  4RW9 A;  4CJ7 A;  2PAV A;  2VGN A;  5KRS A;  2IOC A;  4B3R K;  5TKY A;  2ZJQ L;  1KD1 O;  4DFK A;  3FR0 A;  2GWK A;  2PBD A;  3PSF A;  1HNZ K;  4FK0 A;  1XC3 A;  3LPU A;  3LWL A;  2FLO A;  1NJI O;  3H46 O;  2P5O A;  4AF1 A;  2E4L A;  3ZCM A;  3SQ4 A;  2WBN A;  1QQN A;  2QXF A;  1VQ6 N;  4FWR A;  3O4N A;  1Q18 A;  4WFA L;  3HST B;  1YIJ N;  3SAH A;  3T7Z A;  1HNX K;  5AQF A;  4PHT X;  4OVL A;  4IOX A;  2O8F B;  3J81 O;  2W6L A;  1IV0 A;  2RKI A;  4AHT A;  2GBZ A;  4HTU A;  4PA1 A;  4IJA A;  1LWC A;  2Q0U A;  4WQ4 A;  1S1X A;  2P9P A;  3AA5 X;  3A2F A;  3DXM A;  4CK3 A;  3QEI A;  1VSD A;  3ENO A;  4FO0 A;  4CJR A;  3L2W A;  4DTU A;  1YJ9 N;  2I5J A;  2VYP A;  1SV5 A;  3EZW A;  4N47 A;  1GLD G;  1YXQ A;  3LDN A;  3THY B;  5AQR A;  4DQP A;  4JS5 A;  4BRA A;  2CGL A;  3H45 C;  3OBW A;  4YOW A;  4DUZ K;  3TAE A;  4LF5 K;  4CGG A;  1B9F A;  4YFU A;  5AQV A;  3RSE A;  5CYQ A;  2Z1I A;  3BEX A;  2FC0 A;  4FJJ A;  1TGO A;  3BP8 A;  4Q5V A;  5C0Y A;  3KLF A;  3ZX3 A;  3AVM A;  4OGC A;  3KLE A;  1T03 A;  4FZY A;  4IDK A;  2KZZ A;  3LAL A;  4IG0 A;  3AVK A;  2GWJ A;  4YOT A;  3IG1 A;  3SQ0 A;  1RT1 A;  4CHN A;  2NZT A;  1EWR A;  1NGF A;  3IRX A;  4MDB A;  4CJ4 A;  1XI1 A;  4JKG A;  1GLJ O;  1TUU A;  4JKF A;  3QEP A;  4BC3 A;  1WBD A;  3DLB A;  4EP4 A;  2VG7 A;  5BN9 A;  4CF9 A;  4CBU A;  2XRI A;  1X9S A;  4E1J A;  4DHY A;  5GAE P;  3S9H A;  2E2N A;  1YJW N;  4NCG A;  1HMV A;  1D9F A;  4B9M A;  5JIC A;  1LWE A;  4CHQ A;  4CEB A;  3ULE A;  1VSI A;  1R0A A;  3AVI A;  2F8S A;  2HMP A;  3P1G A;  4FWO A;  3MN9 A;  4CZM A;  1BA1 A;  3DJC A;  3TTD A;  3TAF A;  3OYI A;  4FWP A;  4M3Z A;  4DV4 K;  3FFK B;  1NLV A;  4X64 K;  3CMA N;  1FW6 A;  3D0P A;  3E1Y A;  4KTZ A;  3CC2 N;  4FJ9 A;  1T44 A;  4E19 A;  3B8A X;  1QZ6 A;  3S3O A;  2UXB K;  1HR0 K;  3QEV A;  1J6Z A;  1Q86 O;  4XEI A;  4FWN A;  3T69 A;  3VTH A;  4DV3 K;  1VAZ A;  4HUG A;  4BRP A;  5FRN A;  1RIL A;  4C8M A;  1WSI A;  4N5S A;  3C94 A;  4CJL A;  3QIO A;  1R59 O;  1L3S A;  4BR7 A;  1JLF A;  1N8R O;  3VEX A;  4X65 K;  1Q9X A;  4FJG A;  3MEC A;  4GV9 A;  1JCE A;  4NCA A;  3HM9 A;  2HBJ A;  4KAZ A;  4CEZ A;  1QVF M;  4BRM A;  4CEA A;  3QFU A;  3MXI A;  2P9S A;  3D45 A;  3VEO A;  3HVT A;  2OPS A;  3DMJ A;  4H0Y B;  3CJB A;  3F5T A;  4I7F A;  2BTF A;  4NB4 A;  3WXJ A;  1KLN A;  4PY5 A;  3TAN A;  1WUA A;  5I9E B;  4HTL A;  3VF2 A;  2V51 B;  3SLC A;  4QS9 A;  4W5O A;  5MLC Q;  5AZJ B;  4KI4 A;  2Z1G A;  3O5B A;  1NWK A;  3P83 D;  4JKE A;  3SBT A;  1JLB A;  2EWS A;  4OPA A;  1SUQ A;  2P9I B;  4H4M A;  3QFP A;  4FWL A;  1W97 L;  4BG9 A;  1GLA G;  3M8P A;  1YF5 L;  1KSP A;  4V19 S;  1VQM N;  3C7N A;  4CIG A;  2ASP A;  4N76 A;  2E1Y A;  3LZI A;  3BF3 A;  5AZI A;  3RRG A;  4ISG A;  2HHQ A;  3ID6 A;  1QHT A;  4Z4I A;  1C0T A;  3CFP A;  1JLC A;  4AHU A;  1RDU A;  4KV8 A;  4QS8 A;  3AO2 A;  3K9K A;  3OYD A;  1S5J A;  1S1U A;  4BRO A;  4CHP A;  2D5R A;  3B6P A;  2IVO A;  4CZG A;  4FZZ A;  3AO4 A;  4X62 K;  1T05 A;  1K73 O;  4BRL A;  2XY8 A;  3GL1 A;  1XQS C;  2JGU A;  3KVG A;  1TUY A;  1ESV A;  1C0U A;  1CXQ A;  1RDD A;  4DR7 K;  2HVI A;  3P39 A;  2OPR A;  1Q81 O;  3AA3 A;  5F2R A;  3U3G A;  3FLC O;  1VQK N;  1EQY A;  4YOX A;  5AQT A;  5JVH L;  1KAX A;  3WEE A;  4HUE A;  3A5M C;  3TTF A;  1HLU A;  2P9L B;  4B1Y B;  5BPM A;  3BF1 A;  3TSP A;  4AHV A;  3O4Q A;  3UB5 A;  5CE3 A;  3W0L A;  2KZM A;  3LAK A;  1OH6 A;  3LAM A;  1RDW X;  3AO1 A;  3I8D A;  1YJN N;  1ZBH A;  1U2V B;  1OKJ A;  2P9U B;  1D4X A;  4MO5 A;  3UE5 A;  4KH6 A;  5AFU H;  4FLW A;  2RN2 A;  4W5Q A;  2W40 A;  4AIL C;  1P8Z A;  3U6F A;  1VQ9 N;  1VQL N;  4BVP A;  4CIE A;  2F4V K;  4DLG A;  3KD5 E;  2FSJ A;  3RMD A;  4OLB A;  5SWM A;  1VQ8 N;  1KLM A;  4RW4 A;  3VF6 A;  4H0X B;  2HHX A;  4JKC A;  2BE2 A;  2WC9 A;  3Q7B A;  4YY3 K;  3PO4 A;  4RCH A;  3MWT A;  4N41 A;  3VQ9 A;  4YNQ A;  4LFB K;  1ITG A;  1WOQ A;  1B92 A;  5AR0 A;  4WYB A;  1RCH A;  4DUY K;  2NRV A;  3HK2 A;  3M6G A;  4PKH A;  1XWL A;  3HYF A;  1NK9 A;  4LFC K;  2A42 A;  1NG9 A;  3AGR A;  4MQ3 A;  1L5U A;  1JL2 A;  4BRN A;  1BDG A;  2DFH A;  3VN5 A;  4H0T B;  2D0A A;  2P51 A;  3O6W A;  1LAW A;  2O8B A;  3BY5 A;  3RWU A;  4J2B A;  4IDH A;  3P4I A;  4CHZ A;  3OYJ A;  4DQQ A;  1GOC A;  1CZA N;  3VQC A;  2JLE A;  1U4B A;  3GDQ A;  1NGC A;  4XIU A;  4K8X A;  4BRF A;  3G71 N;  2YI1 A;  3VQ6 A;  1K8K A;  4B08 A;  3OYA A;  1JXE A;  3A5N C;  3C6H A;  4FJM A;  4WE1 A;  4CFB A;  4BDP A;  2YNF A;  1ASW A;  1N6Q A;  2QWQ A;  4IFY A;  2ZF5 O;  3NHG A;  3L3U A;  1TYQ A;  2RE2 A;  5FPN A;  2Q2R A;  1GLF O;  3E9P A;  3ZT4 A;  3OW2 M;  2YX6 A;  4DTM A;  1WSJ A;  4DU1 A;  4IOC L;  4FOI A;  4OKE A;  3VA3 A;  1J5O A;  4DSE A;  3O1B A;  1RDB A;  3L2Q A;  2IAJ A;  4ZTJ A;  4DKW A;  3UKR B;  3U3Y A;  3ZSY A;  3KJV A;  1WN7 A;  5KPZ A;  3THV A;  3T1A A;  2YKN A;  2QI2 A;  2KLA A;  3AAQ A;  1N32 K;  3LL3 A;  4BC4 A;  4DQR A;  2Z1H A;  3MAQ A;  3AV9 A;  1L3V A;  4DTJ A;  2OZM A;  2QM1 A;  3OYF A;  4A61 A;  2ZJR L;  4E1N A;  1BU6 O;  3O08 A;  3TR8 A;  2E2O A;  4UY8 O;  5KGW A;  2HNZ A;  3K5L A;  2JWK A;  1QZ5 A;  3N4Q A;  4KHQ A;  4K0K K;  3ENH A;  2P5G A;  1NU0 A;  3IDH A;  2F9W A;  4RW7 A;  3VES A;  2RPI A;  3THX A;  4B9N A;  4CZE A;  1I39 A;  2KKZ A;  4AHS A;  3VQP A;  5J1E A;  2P1J A;  4B1V A;  1JLE A;  1BA0 A;  3DXK B;  2DY4 A;  4KTQ A;  2BAN A;  3ZSQ A;  3SYZ A;  3DWL A;  3C6U A;  4YDU C;  4JRQ A;  5C24 A;  4CJT A;  3TWH A;  4NXM K;  2GX9 A;  4M3T A;  1NGI A;  3V9U A;  2ASM A;  4ILG B;  4O8K A;  1JCG A;  4JLH A;  3K0S A;  1LWF A;  1YTA A;  1GLC G;  3RR7 A;  3L2R A;  3NVK A;  5I3U A;  2E8A A;  3LAN A;  3D2E B;  3HRG A;  4GMJ B;  4DF4 A;  3HM8 A;  4CD1 A;  3D2F A;  4JD2 B;  4LH5 A;  3SUN A;  3V1R A;  3A0I X;  2KTQ A;  2C1G A;  2D0O A;  3CM5 A;  5M1Q A;  5AQY A;  1T6D A;  1V4S A;  5AQG A;  1SL0 A;  5M1K A;  1RT5 A;  5AQI A;  1VK0 A;  5AJ3 K;  4H5N A;  3VQ5 A;  1NK6 A;  5JEN A;  3FZF A;  2Y1I A;  4DQI A;  2HHS A;  2YHW A;  1Z26 A;  3S3N A;  4DSL A;  1T3V A;  5LMN K;  3G6E N;  3BUZ B;  3WNF A;  1EO1 A;  3V9X A;  5GIN A;  1X3N A;  1X3M A;  3QO9 A;  3VQA A;  3TI0 A;  1NOY A;  1KC8 O;  2A3Z A;  4JV5 K;  4FJK A;  1WSH A;  1QSY A;  2XO7 A;  1UAX A;  5FRM A;  2VG6 A;  2IIR A;  3SAF A;  5BRH A;  1OH7 A;  4H8K A;  3EKS A;  4F3O A;  4ELT A;  2HB5 A;  4B9U A;  4B1Z A;  1C0G A;  4YDU A;  1U49 A;  2HHW A;  4IJN A;  3M1F A;  3OS1 A;  3JSM A;  4C8N A;  1RFQ A;  2GV9 A;  3HJF A;  4DR3 K;  4OPH A;  3QIP A;  2QK9 A;  1VSM A;  1Q82 O;  1HYS A;  4CK2 A;  2QEX N;  4LD0 A;  4CK1 A;  3BZK A;  4BAC A;  3V9S A;  2WTU A;  1L3T A;  3CCS N;  1KFD A;  2QWL A;  1RDC A;  3IAY A;  3QBW A;  5C25 A;  3VEN A;  4FLV A;  5DM6 L;  3QIN A;  4WQ4 C;  1EKE A;  2A6A A;  2YNI A;  3OBY A;  3PX6 A;  4DV7 K;  4KRE A;  3G10 A;  4J2A A;  1LW2 A;  1BI4 B;  3OYB A;  5AQO A;  3VQ4 A;  4L3Q A;  3V1O A;  4CZJ A;  4RWT A;  3HOT A;  4C23 A;  4F8R A;  2UXD K;  3EKU A;  3UKU B;  4BG8 A;  5HLF A;  1MWM A;  4CED A;  3NGI A;  2B6A A;  1HQE A;  4E7L A;  3BGR A;  4AM6 A;  4FJN A;  4KBO A;  1OVY A;  1XHZ A;  1NGG A;  4ILH A;  3K57 A;  1FXX A;  1HNW K;  1A5X A;  3KKR A;  3CME N;  3E01 A;  5ADX A;  5HBM A;  2G8W A;  5CHI A;  1RT4 A;  1MWK A;  3WXM B;  3QET A;  2EHG A;  1U04 A;  3CCQ N;  1FKO A;  4ELU A;  5JS1 A;  4C8K A;  1NM1 A;  4JN4 A;  3L2V A;  2NLX A;  2DFE A;  3OYG A;  3GBT A;  4JS4 A;  3PX4 A;  5HRN A;  3ID8 A;  1NGD A;  3CG7 A;  4DSI A;  2QA4 N;  3VQ7 A;  2BH1 A;  1IBL K;  5HOO A;  3CET A;  1F21 A;  2V7Y A;  3F73 A;  4UQG A;  4WFN L;  3K5M A;  1VQO N;  1XC9 A;  3HXM A;  1TK5 A;  5HRO A;  4XJX A;  4C8L A;  1NGJ A;  3EYZ A;  2D4W A;  3IMX A;  4DR1 K;  1U47 A;  1RGI A;  2HMI A;  2E88 A;  3SI6 A;  2HHI A;  1RBR A;  3CM6 A;  4FJ5 A;  2VWB A;  1Y97 A;  4YHH K;  5F0X A;  3CJ9 A;  4CZK A;  5GIP A;  4K42 A;  3VF4 A;  3L4Q A;  3M8S A;  4I6M B;  3WUH A;  4DQ8 A;  3PIO L;  1S22 A;  3ASM A;  3DLR A;  1QSL A;  3L6Q A;  1UA0 A;  3VQQ A;  2DFF A;  5H1S Q;  3QML A;  1YT3 A;  3VQB A;  4A5B A;  3OJU A;  3DLG A;  3VEY A;  3HPG A;  4CF0 A;  3TSU A;  4FJ7 A;  1BHL A;  4IBN A;  3EE8 A;  1DLO A;  3I56 N;  5FPM A;  2GEL A;  3DLH A;  3E9L A;  4KTW A;  3P38 A;  3NF7 A;  2P9P B;  3SMS A;  4B8A B;  4AM7 A;  1RNH A;  2W6K A;  3ZEU A;  3DXM B;  2D1K A;  3ATU A;  5DM7 L;  2O8E A;  4Y1D A;  4KH5 A;  5SZT A;  2BUP A;  2ZWH A;  4CD3 A;  2P9N A;  4O55 A;  3RRH A;  1QS4 A;  1RBS A;  3HBT A;  4CGH A;  1WB9 A;  3AVG A;  3D7E O;  1I3A A;  3RSE B;  4DFM A;  4M3R A;  3CER A;  1SQK A;  3MCA B;  1RBT A;  3O3F A;  1UOC A;  5AQP A;  3HP9 A;  1ILY A;  1S3X A;  4JI5 K;  4FZX C;  3KK1 A;  3FZK A;  3FZL A;  1E4F T;  1JCF A;  1VQ7 N;  4WF9 L;  4JKG B;  1BG3 A;  3VGM A;  4OKK A;  1LW0 A;  2A41 A;  3SJH A;  3QIC A;  1JL1 A;  1M1K O;  3FFI A;  4BRD A;  3PO5 A;  3EO3 A;  4JK9 A;  4FM0 A;  1TL3 A;  3LP2 A;  2O8D A;  4KHU A;  3ULE B;  2ZGY A;  3CIP A;  1IO2 A;  2F8T A;  4NLC A;  1KVA A;  2HHU A;  1XNQ K;  1C6V A;  2CH6 A;  3DOK A;  1GLL O;  4O4G A;  4BR5 A;  4JI2 K;  3SAG A;  4FJH A;  3CCM N;  3NF6 A;  1VQP N;  1TVR A;  4DSK A;  1BGX T;  2IVN A;  3LDS A;  5M1F A;  4M7Y A;  4PWD A;  1D9D A;  4TSX A;  2W42 A;  2A5X A;  2YHX A;  4HCC A;  4BE0 A;  4JI0 K;  3VER A;  4CGI A;  5HL7 L;  1ZBS A;  3FZH A;  2UU9 K;  4JI6 K;  1RBU A;  4KHN A;  2XY6 A;  3MDQ A;  3MMV A;  1MA9 B;  1REV A;  3U4L A;  3KD1 E;  4HWI A;  3AO3 A;  3EE9 A;  3EY1 A;  5JLH A;  4U67 L;  4FLT A;  3EZ5 A;  2HND A;  3K9J A;  3L0Q A;  5KGX A;  1HPM A;  5LJV A;  4GKJ K;  1VSL A;  3ZSX A;  2HVH A;  1S9E A;  1CZ9 A;  2P9U A;  1J9A A;  3T1Y K;  3RMA A;  1MU2 A;  3JXU A;  2I7P A;  1C1C A;  4JHD A;  2QTD A;  4Y1C A;  2P9S B;  1JLA A;  3HOS A;  3TAQ A;  5M1P A;  3MEG A;  1ZBF A;  1KTQ A;  4YOR A;  3AO5 A;  2YJF A;  4B3S K;  3TTC A;  1BL3 A;  4FLY A;  5CR4 A;  1C0M A;  4DV2 K;  4EAH D;  4KHP K;  5KTQ A;  2Y1J A;  5EX5 A;  4W5T A;  3TAP A;  4HHT A;  2IGI A;  5AQQ A;  1HPZ A;  2C1I A;  3LM9 A;  2G8U A;  1ZBI A;  4FL9 A;  4B1W B;  5BRF A;  4H4O A;  4EHU A;  4BRH A;  4BRE A;  4CF8 A;  4CBX A;  2NRZ A;  3QEX A;  2OCE A;  3O4W A; 
#chains in the Genus database with same CATH homology
 4A61 A;  3PIP L;  3D6R A;  2ZJR L;  1BU6 O;  3O08 A;  2OAN A;  2E2O A;  4UY8 O;  3C7N B;  5AQL A;  1K8A O;  3CJ1 A;  2JWK A;  3QBX A;  4RTF D;  1QZ5 A;  3N4Q A;  1P90 A;  2Q36 A;  3VMF B;  5AZJ A;  1KXP A;  3ENH A;  4F9O A;  3IDH A;  4CJ7 A;  5AZI B;  2F9W A;  2PAV A;  2VGN A;  3VES A;  5E26 A;  4CZE A;  3A8Y A;  2KKZ A;  1Q7Y O;  5TKY A;  2ZJQ L;  2P9I A;  1KD1 O;  4B1V A;  2W00 A;  1BA0 A;  3DXK B;  4PKG A;  2GEM A;  3O80 A;  3FR0 A;  2GWK A;  2PBD A;  3IUC A;  4BY9 C;  3U8X A;  3DWL A;  1XC3 A;  4YDU C;  2FLO A;  1NJI O;  4ILJ A;  4M63 C;  3H46 O;  5BR9 A;  3H1Q A;  3E66 A;  4JK8 A;  3ENB A;  2GX9 A;  4AF1 A;  1IG8 A;  1NGI A;  4JKB A;  2ASM A;  4ILG B;  4O8K A;  4IWV A;  1JCG A;  2ZJP L;  2WBN A;  3MN7 A;  1MDU B;  1QQN A;  1GLC G;  4PL8 A;  1VQ6 N;  3NVK A;  3ZEU B;  4FWR A;  2E8A A;  3D2E B;  3HRG A;  1Q18 A;  4WFA L;  2AP1 A;  3HM8 A;  3ZET B;  1YIJ N;  4CD1 A;  3D2F A;  1K9M O;  4JD2 B;  3SAH A;  3T7Z A;  5AQF A;  3KZB A;  4PHT X;  1KAZ A;  3U9Z A;  2QWR A;  4IOX A;  3A0I X;  1HKG A;  2C1G A;  2D0O A;  1DEJ A;  5M1Q A;  5AQY A;  3CCV N;  1T6D A;  1V4S A;  5AQG A;  3WEE B;  2P9N B;  4A5A A;  5M1K A;  5AQI A;  4H5N A;  4IJA A;  4H0P A;  3FZF A;  2Q0U A;  4WQ4 A;  3KK7 A;  2P9P A;  4K43 A;  3ZX2 A;  3QB0 A;  3R8E A;  3TPQ A;  5ELZ A;  2YHW A;  3DXM A;  4IO8 A;  1T3V A;  5C2D A;  1QQM A;  3G6E N;  3ENO A;  5AFU A;  4FO0 A;  3BUZ B;  4K41 A;  1EO1 A;  1YJ9 N;  5JVG L;  5AQH A;  3CPW M;  1HX1 A;  5GIN A;  1X3N A;  1X3M A;  2VYP A;  3EZW A;  1KC8 O;  1GLD G;  1YXQ A;  4FVU A;  2A3Z A;  3LDN A;  2GTD A;  5AQR A;  4BRC A;  2FSK A;  3W3D A;  2FF3 B;  4BRA A;  2CGL A;  2KHO A;  2P9L A;  2NNW A;  3H45 C;  3OBW A;  4YOW A;  1BOT O;  3SMP A;  4FOE A;  4FPA A;  5AQV A;  3RSE A;  3R3L A;  2IIR A;  3SAF A;  5BRH A;  3BEX A;  3EKS A;  4BVO A;  3BP8 A;  3H3N O;  4JKD A;  4B1Z A;  5C0Y A;  1KAY A;  1U2V A;  1C0G A;  4YDU A;  4CZI A;  3ZX3 A;  3SK3 A;  4CI6 A;  3SBG A;  4IJN A;  2V52 B;  3KWI A;  2D0P A;  3M1F A;  4JKA A;  3MCP A;  1RFQ A;  2GWJ A;  4YOT A;  5C12 A;  4H5T A;  4OPH A;  3HI0 A;  1VQ5 N;  5KPT A;  2NZT A;  1NGF A;  4ISF A;  4MDB A;  5AQN A;  3VET A;  4XH5 A;  1BUP A;  4JKG A;  1GLJ O;  1TUU A;  4JKF A;  2F9T A;  4BC5 A;  4BC3 A;  1Q82 O;  2OTJ N;  3KWG A;  4EFH A;  2YJE A;  1QQO A;  4PKI A;  5BN9 A;  3J7Z O;  2QEX N;  5AQM A;  1H1V A;  4GV3 A;  4CBU A;  3O9U A;  5BPL A;  1NGB A;  3CCS N;  4LC9 B;  4DHY A;  4E1J A;  2QWL A;  5GAE P;  3CF5 L;  4H5W A;  2E2N A;  3QBW A;  1YJW N;  5JIC A;  4A59 A;  5E84 A;  1LOT B;  1O13 A;  3VEN A;  5M1O A;  5C15 A;  5DM6 L;  4WQ4 C;  3ULE A;  2A6A A;  3NVM A;  3GE1 A;  2HMP A;  3OBY A;  4FWO A;  2Q97 A;  4IEI A;  3MN9 A;  5AQZ A;  4CZM A;  3CD6 N;  1BA1 A;  3DJC A;  3TTD A;  1GLE G;  1E4G T;  3ZET A;  3U9D A;  2I7N A;  4FWP A;  3FFK B;  2VCP A;  5AQO A;  1NLV A;  4L3Q A;  1K8K B;  3C6A A;  3CMA N;  4CZJ A;  1T6C A;  4RWT A;  5GIO A;  3HOT A;  4C23 A;  3E1Y A;  3RVC A;  4IFE A;  3EN9 A;  3EKU A;  4IOA L;  3UKU B;  4BG8 A;  2ASO A;  2GUP A;  1YI2 N;  4OO1 J;  1MWM A;  3CC2 N;  1HKC A;  3QDK A;  4B1X B;  1T44 A;  3AGK A;  4FWM A;  4AM6 A;  5BRD A;  2RHK A;  3B8A X;  4KBO A;  1OVY A;  4H0O A;  3ATV A;  1QZ6 A;  4MDA A;  3VGK A;  4B1U B;  1TYQ B;  2QW9 A;  1NGG A;  4ILH A;  4BE7 B;  2CGK A;  1J6Z A;  5C2F A;  3CME N;  1KQS M;  1Q86 O;  2QXL A;  4XEI A;  4BC2 A;  5ADX A;  3H3O B;  4FWN A;  4JHD B;  3HTV A;  3T69 A;  1YUW A;  2NRR A;  3VTH A;  4EHT A;  3F9M A;  1VAZ A;  5CHI A;  1NGE A;  4BRP A;  3DAW A;  4QS7 A;  1VQN N;  4FSV A;  1MWK A;  2Q1N A;  5EY4 A;  3WXM B;  4DCH A;  3VTI A;  2A40 A;  1M90 O;  1R59 O;  4BR7 A;  3CCQ N;  1LCU A;  1N8R O;  3VEX A;  3R1X A;  1SAZ A;  4GY2 B;  1C0F A;  4GV9 A;  1JCE A;  4EIA A;  4H5R A;  1NM1 A;  4JN4 A;  4BGB A;  2OTL N;  2HBJ A;  3CCE N;  2ZGZ A;  2NLX A;  3NMU A;  1QVF M;  1G99 A;  1NBW A;  2VGM A;  4BRM A;  3J8A A;  3WQT A;  3C0B A;  3QFU A;  5BN8 A;  2P9S A;  3VEO A;  4R79 A;  3GBT A;  4JNE A;  4H0Y B;  3CJB A;  3F5T A;  4C1N K;  3ID8 A;  3E9O A;  2BTF A;  4NB4 A;  3WXJ A;  4MO4 A;  2E20 A;  3G25 A;  1WUA A;  1NGD A;  3PLA A;  2H3G X;  5I9E B;  4HTL A;  4O5F A;  4JAX A;  2V51 B;  3JS6 A;  4FPB A;  5EVZ A;  4QS9 A;  3SLC A;  3UKR A;  3VF2 A;  3WXI A;  2QA4 N;  1W2B M;  2BH1 A;  5HOO A;  3CET A;  2V7Y A;  5MLC Q;  2P9K A;  5AZJ B;  4WFN L;  1VQO N;  1NMD A;  3HSC A;  3O5B A;  1NWK A;  1HUX A;  4A2A A;  5JLF A;  3R9P A;  4XH1 A;  4XJX A;  3LDO A;  1DGK N;  4M7X A;  3OHR A;  1NGJ A;  4JKE A;  2D4W A;  3IMX A;  3SBT A;  3VGL A;  1RGI A;  4GNI A;  2E88 A;  3Q7C A;  4O8U A;  2EWS A;  4OPA A;  2P9I B;  3O1W A;  3QFP A;  2VWB A;  1W97 L;  2NRT A;  4FWL A;  4BG9 A;  1GLA G;  5F0X A;  1YF5 L;  2PFU A;  3CJC A;  3KHY A;  2FXU A;  3CJ9 A;  1YIT N;  2UYT A;  3MWP A;  3WT0 A;  4CZK A;  5GIP A;  4K42 A;  2ITM A;  3VF4 A;  1YHQ N;  1U6Z A;  1VQM N;  3C7N A;  3L4Q A;  2E2P A;  2ASP A;  4I6M B;  2E1Y A;  4U7B A;  3WUH A;  4DQ8 A;  5JMV A;  1S22 A;  3PIO L;  1VQ4 N;  3BF3 A;  4NLB A;  5AZI A;  3AAR A;  4BR0 A;  3IKM A;  4ISG A;  3L6Q A;  3CJA A;  3ID6 A;  3VEW A;  5H1S Q;  3F2K A;  3QML A;  4A5B A;  3M3Z A;  5M1N A;  4MLH A;  3DXK A;  2HF4 A;  4ISE A;  2FSN A;  2DPN A;  2E2Q A;  3D2F B;  3WXL A;  1RDU A;  1SS6 A;  5BRE A;  4QS8 A;  3VEY A;  4BGA A;  4Z94 A;  1NGA A;  3GOI A;  2Q31 A;  3K9K A;  3TSU A;  3EL2 A;  5KQD A;  3EE8 A;  4GVE A;  1Z05 A;  4BRO A;  3I56 N;  3O9R A;  2IVO A;  4CZG A;  5BPN A;  1K73 O;  5FPM A;  2GEL A;  4H0V B;  4BRL A;  3GL1 A;  1XQS C;  3E9L A;  2NRW A;  3P38 A;  3KVG A;  3VEZ A;  3CQY A;  2P9P B;  1TUY A;  3LDQ A;  1ESV A;  3SMS A;  4AM7 A;  3ZEU A;  1QHA A;  1YVN A;  3DXM B;  3D2E A;  2D1K A;  3ATU A;  5DM7 L;  1V4T A;  4BRQ A;  3P39 A;  2W41 A;  3A5O C;  1Q81 O;  4JD2 A;  4A62 A;  4KH5 A;  5F2R A;  2QWM A;  3MN6 A;  3CCL N;  1ATR A;  3FLC O;  4WQ5 C;  1QVG M;  2BUP A;  2ZWH A;  1EQY A;  3TSQ A;  1S72 N;  1VQK N;  4YOX A;  5AQT A;  4CD3 A;  4DB3 A;  3S41 A;  5JVH L;  3MK6 A;  4XH4 A;  1KAX A;  3WEE A;  4IEE A;  3CCU N;  2P9N A;  3A5M C;  4C1N I;  4K25 A;  3TTF A;  1HLU A;  2P9L B;  3G4S N;  5FPE A;  1X9J A;  2WFB A;  3HBT A;  3WXK A;  4B1Y B;  3D7E O;  1IJJ A;  5BPM A;  3BF1 A;  5B8H A;  1Y64 A;  3RSE B;  3TSP A;  3H6E A;  2HOE A;  3UB5 A;  5CE3 A;  5LY3 A;  4IXC A;  3W0L A;  5FPD A;  2IVP A;  3CER A;  1SQK A;  3O9S A;  3MCA B;  4GV6 A;  2E1Z A;  1RDW X;  3CC7 N;  1ZC6 A;  1YJN N;  1U2V B;  1OKJ A;  2P9U B;  5AQP A;  5EXW A;  5GAH P;  1ILY A;  1S3X A;  4BQL A;  1D4X A;  4MO5 A;  3UE5 A;  3FZK A;  4KH6 A;  4BRK A;  5AFU H;  1NGH A;  3FZL A;  1E4F T;  2W40 A;  4BRG A;  1P8Z A;  1ZXO A;  1JCF A;  1VQ7 N;  4WF9 L;  1VQ9 N;  3N4P A;  1JJ2 M;  3CXC M;  1VQL N;  4JKG B;  1BG3 A;  2CGJ A;  3VGM A;  3CCR N;  5AQS A;  4BVP A;  3GG4 A;  2A41 A;  4CBW A;  3SJH A;  2FSJ A;  2HBL A;  3ZYY X;  3QIC A;  2V7Z A;  1VQ8 N;  2QWO A;  1M1K O;  3VF6 A;  4BRD A;  4H0X B;  1HJO A;  3LDP A;  3FGU A;  3EO3 A;  3I33 A;  4I6M A;  4JK9 A;  2QWN A;  4JKC A;  5C10 A;  2WC9 A;  2HST A;  3Q7B A;  2NRX A;  1DKG D;  3CI5 A;  3IFR A;  4RCH A;  5KPR A;  3WQU A;  4NO7 A;  3MWT A;  2F7T A;  3R6M A;  3I8B A;  5TKW A;  3ULE B;  4BQZ A;  1WOQ A;  2ZGY A;  4CZL A;  3CIP A;  5AR0 A;  4WYB A;  3CQX A;  3LDL A;  2NRV A;  4NLC A;  3M6G A;  4PKH A;  2CH6 A;  4FWK A;  4A2B A;  4JK7 A;  1GLL O;  4BR5 A;  3SAG A;  3MX2 A;  2A42 A;  3CCM N;  1VQP N;  1BO5 O;  3AGR A;  3OA9 A;  3M5R A;  4WQ5 A;  1BWF O;  1XUP O;  4BRN A;  1BDG A;  2IVN A;  4MLE A;  5AQJ A;  4BR9 A;  5M1F A;  2NRH A;  4WFB L;  4H0T B;  3O6W A;  3L4I A;  2QWP A;  4M7Y A;  4KH4 A;  1DT9 A;  2HBM A;  3TU5 A;  4IDH A;  3P4I A;  1CZA N;  4CZF A;  2A5X A;  2YHX A;  2WUS A;  3P31 A;  4WCE L;  3VER A;  3GDQ A;  5HL7 L;  1ZBS A;  3FZH A;  2HBK A;  3LM2 A;  3AY9 A;  3FZM A;  1NGC A;  4H5V A;  5AQU A;  4PL7 A;  4BRF A;  3G71 N;  2YI1 A;  3MDQ A;  3MMV A;  1K8K A;  5GAG P;  1MA9 B;  4YOV A;  3U4L A;  4HWI A;  4JEP A;  3A5N C;  3MX5 A;  4BR4 A;  3C6H A;  3CPE A;  3EE9 A;  4BEC A;  4FWQ A;  3UKU A;  2YHY A;  5JLH A;  3CHW A;  3A5L C;  3CJ7 A;  4U67 L;  1ATS A;  1Z6R A;  3K9J A;  3L0Q A;  4J8F A;  1HPM A;  5LJV A;  1YAG A;  2QWQ A;  3VPZ A;  4A57 A;  3O8M A;  2ZF5 O;  3AAP A;  1TYQ A;  2RE2 A;  5FPN A;  2P9U A;  2Q2R A;  4IZ9 A;  1GLF O;  3E9P A;  5AQK A;  4Y0W A;  2YX6 A;  5EOY A;  5LJW A;  3I55 N;  3OW2 M;  3VOV A;  4BR2 A;  4YOU A;  3JXU A;  2I7P A;  4BRI A;  4JHD A;  2QTD A;  4CZH A;  2J4R A;  3O9Q A;  2P9S B;  4IOC L;  2FF6 A;  4FOI A;  3HOS A;  3H1V X;  5ADX H;  2AA4 A;  4BEB A;  1SZ2 A;  5M1P A;  3O1B A;  4YOR A;  3HZ6 A;  2YCH A;  4DKW A;  5AQX A;  2YJF A;  3ZX0 A;  3TTC A;  3C65 A;  3UKR B;  3CC4 N;  5CR4 A;  3O9T A;  4B9Q A;  1ATN A;  2P9K B;  4EAH D;  3FE1 A;  5KPZ A;  5EX5 A;  2QI2 A;  2KLA A;  3AAQ A;  5AQQ A;  5AQW A;  1GLB G;  3LL3 A;  3CCJ N;  4BC4 A;  1HKB A;  3LM9 A;  4IO9 L;  2Q0R A;  5GAD P;  4FL9 A;  4B1W B;  5BRF A;  2C1I A;  4FWS A;  2CH5 A;  4EHU A;  4BRH A;  4BRE A;  3MN5 A;  4JKH A;  4CBX A;  2NRZ A;  5F1X A;  4H03 B;  2QM1 A;  3VEV A;  2JWL A;  5KQ8 A;  4G9Z A;  3O4W A;  4YOY A;  2HF3 A;  3DLL L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...