2P9IA

Crystal structure of bovine arp2/3 complex co-crystallized with adp and crosslinked with gluteraldehyde
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
410
structure length
393
Chain Sequence
b'GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 131
structure length 393
sequence length 410
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9iA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9iA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9iA03
4H0YB 4MLEA 4CZHA 3UB5A 4JHDA 4CZLA 5LY3A 4CZKA 4XH5A 4FL9A 4XH1A 3TU5A 5AQGA 2NZTA 5F1XA 4B1VA 4MO4A 2D0OA 4NB4A 3VESA 4JNEA 3L6QA 1GLJO 1ATRA 3UKRB 2QM1A 5FPMA 1YVNA 4BR0A 3DXKB 3LDNA 1LCUA 2P9SB 5LJVA 5BRHA 1G99A 1QQMA 3M6GA 3CJ7A 1K8KA 1QQOA 3AAQA 4H0PA 3VEYA 2NLXA 2F9WA 1BDGA 1S22A 4I6MB 3UKUA 2QWPA 3CJAA 2YJFA 2H3GX 4IJNA 5AQQA 1JCEA 3ULEA 4WQ5C 2ZF5O 5JMVA 1NGDA 4BROA 1KXPA 3D2FB 5BRFA 2IVOA 3W3DA 2AA4A 1TUUA 2FLOA 1MA9B 3H1QA 4M63C 3VEXA 2VYPA 1NLVA 4DQ8A 1X3MA 1ATSA 3R9PA 2E2QA 4O5FA 3B8AX 2P9PA 1SAZA 3O1WA 2ASPA 2IVPA 2CH6A 3D7EO 3SJHA 1KAYA 1QZ6A 5JICA 2P9IA 2D1KA 3AAPA 4B1YB 1NGHA 3C7NA 3GL1A 2PBDA 4PL8A 5AQOA 4H5VA 2QWNA 5AFUH 4BRPA 3VENA 4LC9B 3O6WA 2I7PA 2YHYA 3WEEB 1HUXA 3P4IA 4BC2A 2QW9A 2A3ZA 1NGEA 4EFHA 2BTFA 3CJ9A 4BRQA 4BC3A 5AQFA 3IUCA 1SQKA 3WT0A 1HLUA 5AQUA 2Q1NA 3ID8A 4BRIA 4C23A 1BU6O 3DXMA 3QB0A 4CZEA 1GLDG 3DWLA 3I8BA 5EOYA 4EHUA 4CBXA 5AFUA 3ZEUA 4GY2B 3UKRA 3CJBA 3ATUA 3DXKA 3KVGA 4BR2A 2P9SA 3IFRA 3S41A 4F9OA 1Z6RA 3VGKA 1MWKA 4WQ5A 3VF4A 3W0LA 3ATVA 1NGGA 3H3NO 4JN4A 4BREA 5BREA 4BRDA 4I6MA 4FWPA 2A40A 4A2AA 1T6DA 5ADXH 1CZAN 4WQ4C 2CGJA 3SMPA 3ZX2A 4CZIA 2GWKA 5AQMA 1TYQB 3QFUA 4CBWA 4B1ZA 5KPZA 2D0PA 1BA0A 2I7NA 4PKGA 3EO3A 3QFPA 2P9KB 5AQLA 5AQHA 2GELA 5EY4A 2DPNA 3WQTA 3VF6A 4FPBA 4QS7A 5BN9A 5AZJB 4BGBA 1DKGD 1D4XA 3O80A 4BRNA 2QWQA 1ZXOA 1QQNA 4FWKA 4A61A 3H6EA 1E4FT 1KAZA 5ADXA 3ENOA 5F2RA 4H0XB 2A6AA 3VOVA 3AY9A 5FPNA 2PAVA 3LL3A 3FGUA 4BQLA 1RFQA 3CQYA 3H3OB 3ENHA 3FFKB 3WEEA 1SZ2A 3CJ1A 5AZIB 2E1ZA 4IJAA 2Q36A 1RGIA 1HKBA 4H5RA 2E20A 3WXIA 3LDLA 3QICA 5BPMA 4H03B 4BG9A 1T6CA 2CGKA 3HTVA 5LJWA 4H0OA 1DGKN 5AQYA 3U9DA 2NRHA 5F0XA 3LM9A 5AQKA 3F9MA 3KZBA 3MN7A 3EN9A 4CZJA 4L3QA 3A8YA 4O8KA 4CZMA 2GTDA 1GLFO 1EQYA 4E1JA 1DEJA 2D4WA 2GUPA 4FOEA 2QXLA 3HM8A 4FWQA 1GLBG 3C0BA 5AR0A 3D2EA 1GLLO 2P9LB 3TPQA 1T44A 2Q0UA 3ZX0A 1NGBA 4WQ4A 4JD2B 4RTFD 2E2OA 3OHRA 1IJJA 4K42A 5KQ8A 1NGJA 4Y0WA 5TKYA 4CBUA 3JXUA 4M7YA 3BF1A 1C0FA 1HKCA 1TYQA 3CI5A 4ISFA 4BRLA 1QZ5A 4IZ9A 3U9ZA 3VEWA 3HZ6A 4IO8A 5AQTA 3L0QA 4AM7A 1HKGA 5EXWA 5AQJA 2P9KA 2E8AA 3O5BA 4KBOA 5BRDA 2Q2RA 2A5XA 2FSKA 3FZMA 3HBTA 2V51B 5AZJA 5B8HA 4XH4A 4BC4A 3WXJA 1ATNA 4BQZA 1BA1A 1GLCG 3H1VX 1ZC6A 3MN5A 1NGIA 1JCGA 2P9NB 2E2PA 3QBWA 3RSEB 2E88A 1WUAA 4BVPA 3VEOA 1K8KB 2ZWHA 3FZFA 4FWSA 4YDUC 5BPNA 4DCHA 2QWMA 4B1WB 4WYBA 4EHTA 5AQSA 3LDPA 3JS6A 2ITMA 3WUHA 1ZBSA 2J4RA 3A5NC 1GLAG 5AZIA 3ULEB 1U2VB 4EIAA 5AQNA 3M3ZA 2HOEA 4ISEA 1V4SA 3HI0A 2HMPA 4FWRA 3SMSA 2VCPA 1YAGA 4HWIA 3VF2A 3VGLA 3D2FA 3EKSA 4M7XA 3VPZA 2HF3A 1NM1A 3FZLA 4NO7A 3H46O 4BC5A 2IVNA 5AQVA 2FF6A 4J8FA 5JLFA 1S3XA 5EVZA 2P9IB 2YI1A 3WQUA 2EWSA 3CHWA 3HSCA 3C7NB 3U8XA 3CJCA 3DJCA 3SK3A 1HX1A 2F9TA 5FPEA 1Q18A 3MCPA 4JD2A 4FWOA 2FSNA 4BRCA 2E2NA 4EAHD 4H0TB 4CZGA 3A5MC 1NMDA 5AQXA 3J8AA 1HPMA 4MO5A 1QHAA 4DHYA 4H5TA 4QS9A 1YUWA 1XUPO 4Z94A 3O1BA 4CI6A 3A5OC 2Q31A 2QWLA 1R59O 3DXMB 1V4TA 2CGLA 2KHOA 3QBXA 4PKHA 4ISGA 5E84A 2FF3B 1MWMA 2P9UB 3ZETB 4FSVA 3ZEUB 3L4IA 3BF3A 4H0VB 2V7YA 3LM2A 5FPDA 4BRAA 1BG3A 2P9NA 4YDUA 3RSEA 3GOIA 2A42A 3ZX3A 3H45C 3AARA 4BR7A 5BN8A 3FE1A 1JCFA 2ASOA 4FPAA 3A0IX 3VGMA 3CQXA 4BRHA 3MK6A 3LDOA 4FWNA 4B1XB 1U2VA 3FR0A 4AM6A 1YXQA 1C0GA 1RDWX 3O8MA 3U4LA 1NWKA 2V7ZA 3A5LC 3GG4A 2GWJA 2QWOA 4K41A 3GDQA 4FWLA 1HJOA 4BRMA 2ZGZA 2Q0RA 2OANA 3EL2A 5AQRA 5KQDA 4BG8A 3O08A 3LDQA 2HF4A 5AQPA 1XQSC 4JHDB 2VWBA 4BRKA 2YJEA 3MN6A 1Y64A 2W40A 2IIRA 3BUZB 3G25A 3IMXA 5E26A 4H5WA 1LOTB 3FZHA 1TUYA 3MMVA 5AQIA 5KPTA 1Z05A 3O4WA 1U6ZA 3QMLA 1E4GT 5JLHA 5EX5A 1J6ZA 4FOIA 4CJ7A 1NGCA 4CD3A 5BR9A 5KPRA 2FSJA 2CH5A 3CIPA 3QDKA 4PKIA 4QS8A 3WXLA 4BRGA 2YHXA 1NBWA 4K25A 4FWMA 1XC3A 4XEIA 4A62A 2YCHA 2FXUA 2UYTA 4B9QA 4B1UB 2V52B 3UKUB 3VEZA 3CERA 1KAXA 3BEXA 5AQWA 3R8EA 4BR5A 1NGAA 3FLCO 5AQZA 4PL7A 4HTLA 2BUPA 4K43A 1BUPA 3KHYA 3MN9A 3VERA 1X9JA 3SLCA 2Q97A 3R6MA 2P9UA 5I9EB 4JAXA 3ZETA 1OKJA 5CE3A 4GNIA 4MLHA 2ASMA 1BOTO 2WUSA 3MDQA 2P9PB 5BPLA 1X3NA 3GE1A 4IWVA 2E1YA 3EKUA 4CZFA 4CD1A 3D2EB 3VEVA 4BRFA 3VETA 5ELZA 3I33A 1BO5O 3EZWA 1MDUB 1H1VA 3BP8A 4BR4A 3WXKA 4DB3A 2P9LA 2QWRA 2ZGYA 4IXCA 3FZKA 1NGFA 4A2BA 4BR9A 2GEMA 1GLEG 2W41A 3CETA 1ESVA 3UE5A 4RWTA 1BWFO 4FO0A 3DAWA 1P8ZA 1WOQA 4BGAA 2A41A 2YHWA 3GBTA 3M1FA 4H5NA 3IDHA 2AP1A 1IG8A 4RCHA 4BVOA
chains in the Genus database with same CATH superfamily
4MLEA 3AO3A 4DQQA 4XH5A 3C94A 3OYIA 1N5YA 5CR4A 2FBTA 3ZT4A 3V1RA 4MO4A 2D0OA 1OH8A 4NB4A 4JNEA 4LF6K 2D0CA 3UKRB 2JLEA 5I3UA 3M8SA 4RG8A 3DXKB 3LDNA 2P9SB 3VQAA 2X74A 1G99A 4OLAA 3P83D 5C24A 4DU3A 4FJ8A 1VHXA 4H0PA 3HP9A 3ITHA 1Q9XA 3QLHA 1S22A 2F7TA 3NFAA 4J2EA 2YJFA 5AQQA 3ULEA 1JXEA 4WQ5C 1SUQA 3M8RA 4LFBK 1KXPA 1WAJA 4LH5A 3AO2A 1NU0A 2AA4A 1TUUA 4M63C 3O9UA 5JS1A 1NLVA 2JGUA 2JWLA 3V9ZA 2FBXA 4CFCA 3R9PA 3F5TA 3SBTA 4KHPK 3SV4A 3V1OA 3MWTA 5FRMA 4GKJK 2P9PA 4A5BA 4CCHA 2ASPA 2NRTA 2CH6A 3RRHA 3CCLN 3AVCA 1QZ6A 5JICA 4CHQA 2IOCA 4GV6A 2O8FB 4B3MK 2D1KA 3AAPA 1NGHA 1X1PA 5JENA 2BDPA 1SKRA 4B08A 4DSKA 3PSIA 2QWNA 3MXIA 1GOAA 4BRPA 5C42A 3OBYA 1UA0A 1WSGA 1T7PA 3QETA 3T3FA 2QW9A 2QK9A 2BTFA 2GX9A 2HB5A 3IUCA 4YOVA 3T1HK 4E89A 4GV9A 4W5NA 3V81A 4BRIA 4C23A 1BU6O 1EX4A 1KSPA 5GADP 3D0PA 4YORA 4EHUA 4CBXA 4YOTA 4GY2B 1KRPA 1IBKK 2WONA 4LF5K 4E7IA 1GOBA 4DSIA 3SCXA 4DQRA 4L8RB 4RW7A 1MWKA 2ETJA 4BE1A 4YOWA 3VQ4A 1ASWA 3EY1A 4FJIA 4JN4A 4I6MA 3TTCA 4LF8K 4CIEA 1BQMA 1D8YA 3NH1A 2HVIA 3HL8A 5A2QO 3ZX2A 3NH0A 3KK1A 1K9MO 2Z1HA 3BDPA 3QNOA 4KH6A 1TYQB 4O44A 3QFUA 4CBWA 4KI4A 1VK0A 2VG5A 4DMNA 2W00A 1NJYA 5AQHA 3HT3A 4HUGA 4HCCA 3LAKA 3KD5E 4QS7A 3K58A 5BN9A 4BGBA 2QWQA 4E1NA 3SQ1A 3I0RA 3WNFA 1HYVA 1KAZA 1YT3A 5F2RA 2RF2A 4KKOA 1VRTA 3VOVA 4Z0UA 5M1QA 3G4SN 3FFKB 3WEEA 4JKFA 5J1EA 4Z4IA 4GKKK 3DYAA 3HPGA 4IJAA 4OGCA 1G15A 1RGIA 2NRVA 3HOSA 2E20A 4LF7K 4KREA 2UXDK 1N8RO 3HTVA 1T8EA 3SUPA 1U47A 1RBSA 4H0OA 1DGKN 1S72N 3AVIA 2NRHA 1HNZK 3KZBA 3MN7A 2OZMA 4FJXA 1BISA 1OVYA 4DR4K 3EN9A 3SYZA 3ZSQA 4FZYA 1Q7YO 2GTDA 1U49A 4DSFA 1GLFO 2D4WA 2GUPA 4FOEA 2QXLA 4R79A 3OYLA 3LDSA 4IFVA 3OYGA 4DKWA 1N33K 1GLLO 1HRHA 2UUAK 4WQ4A 3OYJA 4JD2B 1LW0A 2XRIA 2E2OA 3LP3A 2ATQA 1IJJA 3AO1A 4OO1J 1HMVA 1NMNA 4Y0WA 4FLYA 4FM1A 3PLAA 3AO5A 1BI4B 4LSNA 4FJNA 3F2KA 1VSFA 3O9SA 1C0FA 5C15A 1HJRA 1N32K 4BRLA 3U9ZA 2ZE2A 1SL1A 4CEQA 4OKEA 1JLQA 5HRPA 2HHWA 2DFHA 3SJJA 4FK4A 4FZZA 2Q2RA 3LWLA 2RN2A 1U04A 2IAJA 3HBTA 3T1AA 5KRTA 2NRZA 1C0UA 4XH4A 4BC4A 5CHIA 3WXJA 1NOYA 5DM7L 1ATNA 3KWIA 1LWCA 3H1VX 2O8EA 4Y1CA 5LL6Z 4DV1K 2G8WA 3B6PA 3FZFA 4JI1K 4DSEA 2QWMA 2B6AA 4ILGB 3PX0A 3LDPA 1XMOK 3A5NC 3ULEB 2W6LA 3M3ZA 3ULDA 4AF1A 3NGZA 4DR5K 2HMPA 4X66K 2IS3A 1TV6A 1NKCA 4HWIA 1YI2N 3VF2A 3HSTB 3HP6A 3VQ8A 4NO7A 3FZLA 2RE2A 2WFBA 1XC9A 1O1WA 4JYAK 3PV8A 1VQ6N 4C1NI 4CJPA 4Q0BA 4UQGA 4QAGA 3AV9A 4BACA 4JKAA 2EHGA 4DTRA 3CCRN 3SK3A 1RNHA 1HX1A 3SNNA 5FPEA 4I2PA 3KK7A 2VGNA 3VQ7A 3MCPA 3HXMA 4NYNA 4BRCA 4CZGA 4JLHA 4CJWA 1C1BA 3CCJN 2KLAA 4N41A 3OJUA 4QS9A 2XHBA 1HQUA 1CXQA 4DQPA 1XUPO 4Z94A 3O1BA 3CMAN 3C6AA 3QIPA 4CI6A 2Q31A 2QWLA 4A59A 1R59O 4ISGA 3ZSYA 5M1FA 3THYB 4CHZA 1RILA 2F8SA 1CZBA 3BF3A 4B8CA 3NF6A 4BRAA 1QSLA 1S1WA 2P9NA 4YDUA 1N36K 3C6TA 3OW2M 3CCEN 5C25A 3G6EN 3DOLA 3SBGA 4B9MA 3H45C 4B3SK 4DR7K 4CEBA 2OTLN 3VGMA 3DI6A 3MK6A 5FLXO 1U2VA 1S1UA 1UOCA 3FR0A 3V4IA 4O0IA 4BWMA 2E6MA 4CEZA 1ZBLA 3U4LA 2QWOA 4K41A 1HJOA 2ZGZA 4AHUA 3G71N 1NNEA 2HHTA 4EZ9A 2P51A 3O3HA 1SKWA 1ZBIA 3LDQA 4KH5A 2HF4A 2OYQA 1XQSC 4HUFA 4FJHA 4CF9A 5M1OA 4CEFA 3BUZB 3IMXA 3EE9A 2RHKA 4M3UA 1TUYA 4KRFA 3QMLA 4CJQA 4ID5A 4F4KA 3ZCMA 2D0BA 2F8TA 1NK4A 5BR9A 2P1JA 4FJ7A 2VG7A 4QS8A 1NBWA 3CFPA 3AVJA 1YTUA 2FXUA 2UYTA 1IKVA 3EE8A 1WN7A 4GW6A 4DF4A 4E1MA 4DR3K 5AQWA 1VQ8N 5AQZA 3PO4A 5HRRA 2WBNA 2O8DB 3EEQA 3MX2A 2GBZA 3THXA 2P9UA 4GVMA 2HHXA 1Z25A 4JAXA 5FDLA 5CE3A 2UU9K 4FVMA 2FC0A 4MLHA 1C0TA 3SV3A 2VWKA 4NLBA 1BQNA 4IWVA 5KTQA 4CJSA 2E1YA 2YNFA 1BGXT 2OPPA 3VEVA 5ELZA 1F21A 1BO5O 1W2BM 3KLIA 1MDUB 1H1VA 3BP8A 3L2RA 3KD1E 2ZGYA 4IXCA 3D6RA 4BR9A 1VQMN 4IG3A 3QESA 1JLAA 3CETA 3UE5A 2GUIA 4FO0A 3DAWA 5GAGP 4CFBA 1P8ZA 4OPJA 2YHWA 3GBTA 3K5MA 3IDHA 4FLVA 2OCEA 3KK3A 4CZHA 4JHDA 4WF9L 4CZKA 4B9UA 4K8ZA 1XNRK 3OYDA 5AQGA 1Q81O 5F1XA 1VSJA 4J2AA 4HCBA 2O8EB 4JEPA 3VESA 3L6QA 4DR2K 1ATRA 5FPMA 2R7YA 4DUZK 4BR0A 5BR8K 2QI2A 5BRHA 4NYFA 3CFOA 3M6GA 3OYHA 4PHTX 1K8KA 1QQOA 3AAQA 3OTOK 1SKSA 3V9SA 4K8XA 4U67L 3MX5A 3CJAA 3MCAB 1JCEA 5C2DA 4Z4FA 1JLEA 5JMVA 1NGDA 3WXMB 4FZXC 2KFNA 3W3DA 3L2QA 1MA9B 3VEXA 2VYPA 1VQLN 1TVRA 4E3SA 4M3TA 1VQ7N 2XY5A 3KKRA 3D45A 3E9PA 4KHSA 4AHRA 3WNEA 1OH6A 3SJHA 2O8CB 2DY4A 3OS2A 1RT3A 3M5RA 1RBRA 5DK5A 3OYAA 4KHUA 1KVBA 3GL1A 4PL8A 4H5VA 3TARA 4MDAA 2E4LA 1XI1A 2D5RA 3T1YK 3TR8A 3MXMA 3FFIA 3VN5A 3I55N 1YIJN 3OJSA 1NGEA 3BGRA 4EFHA 4IBNA 3SAFA 4BC3A 5AQFA 5GINA 4FM0A 4JKHA 3WT0A 4DTJA 4N47A 5SWMA 4BDPA 2VG6A 3DXMA 4RW8A 1TAQA 3ZSWA 4JV5K 3DLKA 1J53A 1GLDG 1RBTA 3DWLA 3NBPA 5EOYA 4ILHA 3PX4A 3LALA 3E9OA 3ATUA 1S5JA 1VSHA 3DLRA 3KVGA 1X9SA 4DFMA 3S41A 4F9OA 4FJMA 3TAGA 3ZSRA 3W0LA 5BREA 1NGGA 4CJ3A 2A40A 3KLGA 1JLFA 4WQ4C 2CGJA 2OPQA 4CZIA 1JXBA 3CD6N 2BH1A 4B1ZA 5KPZA 2P9KB 1C1CA 3VTIA 3ZT3A 5AJ3K 5DMRA 2VQEK 5AZJB 1DKGD 1D4XA 3O80A 4IEEA 1QQNA 4K0KK 3LZJA 1KLMA 5ADXA 3K2PA 2OPSA 3AA5X 1IH7A 3AA4A 1RFQA 3H3OB 4O0JA 4A5AA 3CCSN 4DS5A 3HO1A 3CJ1A 5AZIB 2E1ZA 1SV5A 1HKBA 4H5RA 3O4NA 4CEDA 3WXIA 4OPAA 1EETA 3QICA 4Z4EA 1ILYA 3NGYA 4C8KA 2CGKA 1ASUA 3A2FA 4CJUA 3T69A 3VQ9A 3V9WA 3F9MA 2QTDA 1DTQA 2YKNA 2BGGA 4CZJA 3TABA 4OJRA 1YJNN 1VQ9N 4O8KA 1NJWA 4DQSA 3P38A 2HSTA 4E1JA 1D9FA 1XMQK 3HM8A 4BE7B 4B3OA 5AR0A 3D2EA 1K73O 3K0SA 1T44A 4DFJA 3T19A 4UY8O 3P1GA 4CEEA 3S5TA 4NCAA 3PSFA 3HPHA 4K42A 4EP4A 1XWLA 4CBUA 4KAZA 4NLCA 2Q3SA 1QZ5A 3RMAA 3HJFA 1I94K 5AQTA 2YNGA 5KRSA 3L8BA 4AHCA 4KBOA 1NKBA 5BRDA 4KH4A 3RWUA 3FZMA 2V51B 4I2QA 4JK8A 4BQZA 3HPOA 4LF4K 3RMDA 2E2PA 2YKMA 3RSEB 1QVGM 4I9LA 2E88A 1IO2A 4OKKA 3VEOA 1K8KB 5KGXA 4FLZA 4DFPA 4YDUC 1EWRA 1CZ9A 5BPNA 4YHHK 3DRPA 4B1WB 3U6FA 1VQKN 1C1AA 2ITMA 4W5TA 2J4RA 4F2SA 4J2BA 2OTJN 1SL2A 4IDKA 1MU2A 2PY5A 2HOEA 4ISEA 5FRNA 1WLJA 3HI0A 4KFBA 4DWIA 1CXUA 1T03A 4JI3K 4B9NA 4QOZB 1UAXA 1NM1A 3H46O 1RTIA 3SUOA 1D9DA 2FF6A 4FCYA 2Z1JA 4JKDA 5EVZA 3MWPA 3WQUA 3NMUA 2EWSA 4DG1A 1RT1A 3HSCA 3R3LA 3VQEA 3S9HA 1N6QA 1I39A 3U8XA 3QEPA 1JL2A 1JLCA 3DJCA 3O3FA 4DU1A 4WFNL 1YVUA 4FWOA 4FLTA 4OLBA 2G8IA 5J2MA 1Q8IA 3HM9A 1W0HA 4H0TB 3A5MC 1NMDA 5AQXA 3J8AA 1ITGA 4MO5A 4Q5VA 5TKWA 1QHAA 2B4JA 2HBKA 4H5TA 4U7BA 1YUWA 1ZYQA 4CK2A 1KVAA 4AHTA 3DXMB 4PKHA 2KZMA 5JS2A 1DT9A 3OYCA 4CJ4A 3NVMA 4O55A 2F96A 3J7YP 3NF9A 3LM2A 1BG3A 4H4OA 3GOIA 4CGGA 1ASVA 3PX6A 1DLOA 3TSPA 4BR7A 3DM2A 3K9KA 2X6NA 2ASOA 2UXCK 4FPAA 3A0IX 5IWAK 3LDOA 5CZ2A 4YNQA 4W5RA 1SL0A 3AVKA 5HBMA 1LWEA 3NGIA 1QSSA 2V7ZA 3AVAA 1HNXK 4BRMA 2Q0RA 1X9MA 4JRQA 3OS0A 2G8UA 3C95A 4FW2A 4IEIA 4C8LA 5AQRA 2C1IA 1W97L 1WSJA 4DTMA 5AQPA 4CJFA 4BRKA 2E6LA 2I5JA 1NJXA 1IKXA 2W40A 3QERA 1NK9A 4Z4HA 4PA1A 2YX6A 1LOTB 1LAWA 5KPTA 4X62K 3NAEA 5LMUK 3V9XA 5JLHA 1E4GT 4KB0A 1J6ZA 2DFEA 4CECA 1NGCA 5EU7A 2CH5A 3QDKA 5H1SQ 2G8VA 4XEIA 3WNHA 1VRUA 2Z1IA 3MEEA 4JKEA 4B1UB 4KHYA 2Y1JA 2V52B 3B6OA 4KPYA 3VEZA 3CPWM 3R8EA 1NGAA 3AA3A 1KVCA 3KHYA 4XIUA 4PWDA 3VERA 3C65A 4DTXA 3SLCA 5SZTA 4BDYA 3ZETA 1OKJA 4JKGA 4YOYA 4GNIA 3CMEN 2WUSA 3IAYA 2P9PB 3AA2A 3EKUA 1OH7A 3CM5A 4CZFA 4CD1A 3KK2A 3D2EB 3VETA 2XY6A 4E19A 4FW1A 3OBWA 2ZJPL 2PYJA 4BR4A 2P9LA 4WFAL 4A2BA 4B9LA 4JK7A 1X9WA 1S9GA 1ESVA 4CGFA 1BWFO 5HRNA 1NK0A 1WOQA 5KI6A 1BIZA 5FROA 1TKTA 3O9TA 1IG8A 4H0YB 1R0AA 4CZLA 3G0ZA 5LY3A 2UUBK 4CIGA 4FL9A 3TU5A 3BZCA 1RCHA 2NZTA 4CERA 4B1VA 3LAMA 4IDHA 1W9HA 1RTHA 1FJGK 2YHBA 4DUYK 3AO4A 2QM1A 3IRXA 4MFBA 1YVNA 3SZ2A 4B9TA 5CZ1A 3L4QA 3CC7N 5LJVA 2C1GA 2HHIA 3J81O 3OYKA 1QQMA 4GMJB 1W7AA 4CHOA 1KC8O 3T7ZA 3V1QA 1VQPN 2HMIA 3VEYA 4OGEA 1HR0K 1A5XA 1NK6A 1UA1A 1BDGA 4I6MB 3UKUA 4G9ZA 5HROA 4CJRA 4IFEA 2ZF5O 3VA3A 3PUFA 5BRFA 4FK0A 2P5OA 4WE1A 2FLOA 1RBVA 3NF8A 3AVLA 4DQ8A 1X3MA 3QO9A 3PIOL 3VQ6A 4KV8A 4HTUA 4TSXA 3B8AX 4FXDA 4CK3A 3KLEA 3O1WA 5IT9O 3AVHA 4DV7K 4YY3K 1HNWK 5M1PA 3C7NA 3THWA 1BCOA 2PBDA 2W6KA 3CCUN 4ZHRA 1NKEA 4JI8K 2UUCK 1U4BA 4LC9B 3O6WA 5MLCQ 1TGOA 2I7PA 2YHYA 3WEEB 4CF1A 3P4IA 4B9VA 1VAZA 3ZT0A 4N5SA 2DFFA 3CJ9A 2Z1GA 5KGWA 1QTMA 2A1RA 1SQKA 1BL3A 3ID8A 3QEXA 3TTDA 4LSLA 4CZEA 1KCFA 3I8BA 4YOXA 5AFUA 1WNSA 4KO0A 1EP4A 3CF5L 4DTNA 3UKRA 1J54A 3CJBA 1NOZA 3P39A 4QCLA 3DXKA 4BR2A 3AVFA 2P9SA 3I8DA 3AVNA 2XY8A 4R5PA 3CC2N 3OYEA 4Z4GA 1FK9A 1Z26A 3VGKA 4MDBA 4DU4A 3E01A 3VF4A 4BREA 3OYNA 4HHTA 3IKMA 4BRDA 3SPZA 2HVHA 4FWPA 1S6PA 1S1TA 2D0AA 1T6DA 5ADXH 2HHVA 4N56A 3TSUA 3BY5A 3SMPA 1HYSA 1DTTA 5GIPA 1VSKA 2D0PA 4CFDA 1JKHA 2HNDA 2I7NA 3EO3A 3AVBA 1IBMK 2HHHK 2AJQA 5AQLA 4DR1K 5EY4A 3WQTA 4MQ3A 4DLEA 4RW9A 2O8FA 4FWKA 3ASMA 2HBLA 3H6EA 4JI5K 1KFDA 3SQ0A 3ENOA 3ID6A 4F3TA 2A6AA 3QINA 1GOCA 3AY9A 5FPNA 3FGUA 4BQLA 3ENHA 4C8NA 4DQIA 1RT2A 1SZ2A 1N34K 2HW3A 1KQSM 1FXXA 1QE1A 4H03B 4BG9A 4PQUA 3WNGA 3O3GA 2XO7A 1Q86O 1TKXA 2HBJA 3LP0A 2NRXA 3KTQA 1RDBA 1K8AO 4L3QA 3A8YA 1EXQA 4CZMA 3M8PA 4LF9K 4LFCK 3Q7BA 4FWQA 1GLBG 3OA9A 2X78A 3C0BA 5I42A 3HOTA 2P9LB 4CGJA 4RW6A 3K5NA 3ZX0A 1XHXA 3PIPL 2G8HA 4RTFD 3OHRA 3NF7A 5KQ8A 1NGJA 3KKSA 3DOKA 1I3AA 5TKYA 4YOUA 3JXUA 3ZSXA 4ID1A 1TYQA 3TI0A 4IZ9A 3HZ6A 1RTJA 1M1KO 1HKGA 4DF8A 5EXWA 4BEBA 5AQJA 4LFAK 2E8AA 1EO1A 4FVUA 4IFYA 4JI4K 4F2RA 1U48A 5B8HA 3KLFA 1S1VA 3RVCA 1GLCG 4B9SA 3JAMO 1ZC6A 1QSYA 1JCGA 2P9NB 1IBLK 4BVPA 1WUAA 2O4IA 2ZWHA 1HPZA 4DCHA 3SUQA 1VSLA 4BDZA 4I9QA 3CPEA 1U2VB 3PO5A 4EIAA 5AQNA 2WC9A 2HBMA 2O8BA 2HHQA 1V4SA 3DLLL 4E7LA 4CJEA 3NVKA 3D2FA 3EKSA 3VPZA 2HF3A 4OX9K 2HHSA 1NG9A 4J8FA 1ZBUA 3K9JA 2VQFK 2YI1A 3CHWA 1C0MA 2BANA 3C7NB 3THWB 1T3VA 3N4PA 4F8RA 3OYMA 2F9TA 3Q7CA 4KI6A 4C1NK 1TAUA 4AHSA 4H8KA 4JD2A 2FSNA 2E2NA 4X65K 3VTHA 1HQEA 1NJIO 4FYDA 3TSQA 1HPMA 4CEOA 3PY8A 2YV0X 1FW6A 1VQON 2RKIA 4KHNA 3ZT1A 3LP2A 3RTVA 3R1XA 3OY9A 2KHOA 2FF3B 1MWMA 3THXB 2P9UB 3TAQA 1QVFM 4FSVA 4CF2A 3EZ5A 5LMNK 3L4IA 4H0VB 2V7YA 4CHPA 3ISNC 1QS4A 4DLGA 1L3UA 4J2DA 3ZT2A 1LV5A 3AARA 5HL7L 1QHTA 1JCFA 3L2VA 1A5VA 1VSEA 3CQXA 3L3VA 4FWNA 1E3MA 4IG0A 4AM6A 1S9EA 1YXQA 1C0GA 1RDWX 3O8MA 3KJVA 1RDUA 3GG4A 5E41A 3GDQA 4PY5A 3RR8A 2EX3A 4FJLA 3TANA 3ZYYX 3O08A 1S1XA 1B9DA 4G1QA 4BE0A 4JHDB 2VWBA 2BE2A 1B92A 3MN6A 3OS1A 1Y64A 5GAEP 5E26A 1TK5A 4H5WA 4IKFA 1RDAA 3FZHA 3LZIA 3MMVA 5AQIA 2W42A 3SI6A 4N76A 3O4WA 4JI7K 1U45A 5EX5A 4CGDA 4FOIA 4CJ7A 4CD3A 4E72A 5CYQA 4YFUA 2OA8A 4OKJA 1KLNA 1YF5L 4DSLA 4A62A 2DTUA 4B9QA 4CESA 4EZ6A 3VQCA 4C8OA 1KAXA 3BEXA 4LD0A 4PL7A 3FLCO 2JWKA 1TKDA 4ELUA 4K43A 3MN9A 2YHAA 3RMBA 3THYA 2WTUA 3HK2A 5I9EB 2Y1IA 3H08A 3ZSZA 4Z4CA 5BPLA 1X3NA 2LSNA 3K5LA 1IV0A 4BRFA 1C6VA 1VSIA 1YTAA 4ELVA 4M42A 3DRSA 3NHGA 2QA4N 3VQQA 3ENBA 2QWRA 4M3WA 3FZKA 1NGFA 2YNHA 3HYFA 1FKOA 4BWJA 5J2QA 1YHQN 4EP5A 2W41A 3AVMA 1M90O 4BGAA 2E5LK 2FBVA 4NCGA 4H5NA 1XNQK 2O4GA 2AP1A 4RCHA 4BVOA 3EYZA 4A57A 3UB5A 1HNIA 1WAFA 3F73A 4RW4A 1B9FA 3TTFA 3ZLJA 4XH1A 1RDDA 2NNWA 1WSIA 3DRRA 5HP1A 3M8QA 1L3SA 1GLJO 1Q82O 2QXFA 1TK0A 1VQNN 3DLGA 1LCUA 4DR6K 5T7BA 5J2NA 3NH2A 2A1SA 3CJ7A 3QIOA 3E9LA 3S3OA 2NLXA 2F9WA 2O8BB 2QWPA 1VSMA 4IJNA 2H3GX 4DFKA 1JJ2M 4CJTA 4BROA 3D2FB 4XJXA 2IVOA 2O8DA 1Q9YA 3H1QA 5K14A 1NK5A 1ATSA 1L5UA 3CM6A 1A5WA 3RRGA 2E2QA 2QKBA 4O5FA 2YNIA 4M3RA 1O13A 4M41A 3MAQA 3RMCA 1SAZA 2IVPA 3D7EO 1J5EK 4CGHA 1S6QA 1KAYA 1YJ9N 2QKKA 1K6YA 2P9IA 4B1YB 3OVNA 5D3GA 4IOAL 3AVGA 4ICLA 5AQOA 4GV3A 5AFUH 4DTPA 3VENA 4IO9L 3K5OA 4CJVA 4X64K 4WFBL 1HUXA 3VQ5A 4DS4A 4BC2A 4CHNA 2PYLA 2A3ZA 1TL1A 4BRQA 3C6HA 2HNYA 1HLUA 5AQUA 2Q1NA 1KFSA 4KHWA 3QB0A 4DV3K 3I0SA 3QEVA 4CFAA 3LANA 5M1NA 3NDKA 4O5BA 3ZEUA 2B5JA 3TAEA 3IFRA 1Z6RA 3VQBA 4ILJA 3TAFA 3KIOA 4NXNK 4WQ5A 3ATVA 3H3NO 3VA0A 3J7AP 4E7HA 1WBDA 4A2AA 4LH4A 2ZJQL 3SAHA 1CZAN 3AGRA 3I56N 3J80O 2VGMA 2GWKA 5AQMA 3O9RA 3QEWA 1BA0A 2KW4A 4PKGA 3CYMA 3QFPA 3HVRA 2GELA 2DPNA 3VF6A 4FPBA 2ZM6K 2O8CA 3O9QA 1IG9A 4FJ9A 4BRNA 1ZXOA 3SQ4A 4BE2A 1VQ5N 4W5QA 4A61A 3JYTA 1HYZA 1E4FT 4OPHA 3HVTA 3CCVN 3DLBA 4M3YA 4H0XB 1XHZA 1NK8A 4NCBA 3OYBA 2PAVA 3DMJA 3LL3A 3CG7A 3CQYA 4BY9C 4OVLA 4FLXA 2OPRA 3CCQN 1TKZA 3ZSOA 3QNNA 2Q36A 4JRPA 3U3GA 4WCEL 3LDLA 2X6SA 5BPMA 4NXMK 2OZSA 4KTQA 4Y1DA 2GV9A 1T6CA 4KB1A 1WSEA 3VQPA 5LJWA 3S3MA 1LWFA 5AQYA 4CJ5A 3U9DA 2ZD1A 4CGIA 4V19S 5F0XA 3LM9A 4DV5K 4FJKA 5AQKA 3C6UA 4B3RK 4CIFA 3RR7A 4FM2A 5CY4A 1EQYA 4B3TK 1DEJA 4DTSA 2KTQA 3ALYA 5HRSA 1IKWA 4JS5A 3TPQA 4HVJA 2Q0UA 3SQ2A 1ZBHA 2RPIA 3E1YA 1NGBA 5GIOA 1L3TA 4O4GA 4JK9A 1NJZA 3ZSVA 3K57A 1VSDA 4CJLA 5C10A 1TK8A 4M7YA 3BF1A 3P5JA 1HKCA 3CI5A 2NRWA 4ISFA 3BZKA 3VEWA 4IO8A 3L0QA 4AM7A 2QEXN 4O8UA 1BHLA 2P9KA 2PZSA 3O5BA 4FJ5A 3CFRA 1BIUA 2A5XA 4W5OA 2FSKA 1D5AA 5AZJA 4AQYK 1IKYA 3AGKA 3VMFB 1NK7A 1BA1A 3E66A 3MN5A 4JI6K 1NGIA 3QEIA 3QBWA 5M1KA 4FWSA 4FJGA 4CVNE 1YITN 4IOCL 4WYBA 4EHTA 5AQSA 1SS6A 3JS6A 1RDCA 1ZBSA 1HNVA 5AZIA 1GLAG 3WUHA 2KQ2A 4DV4K 3V9UA 1RT7A 3KWGA 3V6DA 1RTDA 3OYFA 4BECA 3J7ZO 2KFZA 4E7KA 1RT6A 4FWRA 3SMSA 1YJWN 2VCPA 4AILC 2XY7A 1YAGA 2NUBA 4DTUA 3VGLA 3UIQA 4M7XA 1JL1A 1EKEA 3F9KA 1T05A 4BC5A 2IVNA 5AQVA 3THVA 4FK2A 5JLFA 2ITGA 1S3XA 2P9IB 1LAVA 3L2UA 2HHUA 3U3YA 3IS9A 3NCIA 3SPYA 3CJCA 3CQ8A 2UXBK 4FLWA 1Q18A 5C2FA 1OH5A 1RBUA 4EAHD 1REVA 3HRGA 4KTZA 5HOOA 1KD1O 4E7JA 3CCMN 1ZBFA 1QQCA 2FBYA 3SAGA 4C8MA 4DHYA 4CHYA 2G8KA 2NRRA 4DV6K 1TL3A 3P31A 3A5OC 5J2PA 3IG1A 2WOMA 1P90A 1V4TA 1JLBA 2CGLA 3QBXA 5E84A 2ZQBA 4DV0K 1JLGA 4CF0A 3MEDA 4JI2K 3ZETB 3MXJA 4JKGB 3ZEUB 4KHQA 4E0DA 5FPDA 3MECA 3G10A 3RSEA 1J5OA 2A42A 3N4QA 3ZX3A 2PFUA 4HUEA 1VQ4N 5BN8A 3FE1A 3JSMA 5C12A 3KLHA 4B8AB 4BRHA 2F4VK 4CF8A 2G8FA 4B1XB 4AH9A 1RT4A 4M3XA 4H4MA 4ELTA 1NWKA 1WSHA 3A5LC 5GAHP 3TWHA 2GWJA 1WBBA 4FWLA 4OPKA 3LPUA 5HLFA 4DSJA 2OANA 3EL2A 5KQDA 4PUOA 4BG8A 2HNZA 4JKCA 3TAMA 4CK1A 4FLUA 2YJEA 3DLHA 2P5GA 1OVQA 2KZZA 2IIRA 3DLEA 3G25A 1BCMA 4DV2K 3SUNA 1J9AA 3L3UA 1Z05A 3S3NA 1U6ZA 3O4QA 4I7FA 4CW7B 4JKBA 5KPRA 2FSJA 4PKIA 5CYMA 3CIPA 3MEGA 4BRGA 3WXLA 3LP1A 2YHXA 5JVHL 4K25A 1WB9A 4FWMA 2VWJA 3CYGA 1XC3A 1KTQA 2YCHA 2IGIA 1WSFA 4IOXA 4FJJA 4AHVA 2KKZA 3UKUB 3K59A 3CERA 4BR5A 5C0YA 4LY7A 4GVEA 3CXCM 4HTLA 2BUPA 1BUPA 2IC3A 4DTOA 5JVGL 4F3OA 4KTWA 1X9JA 2Q97A 3R6MA 4CEAA 4ZTFA 1EWQA 4JI0K 4CE9A 2ASMA 1BOTO 1UWBA 1RT5A 3MDQA 1Y97A 3GE1A 5DM6L 2ZJRL 3LWMA 4M3ZA 4ZTJA 2IDOA 3LPTA 3I33A 3EZWA 1CLQA 1L3VA 1LW2A 3WXKA 4DB3A 3VQDA 4JS4A 2GEMA 1GLEG 3NE6A 4RWTA 3L2WA 4M45A 1FKPA 2A41A 1BI4A 3M1FA 3CC4N 3TAPA 4CJKA
chains in the Genus database with same CATH topology
4H0YB 4MLEA 4CZHA 4A57A 3UB5A 4JHDA 4CZLA 4WF9L 5LY3A 4CZKA 4XH5A 3TTFA 4FL9A 4XH1A 3TU5A 5AQGA 1Q81O 2NZTA 5F1XA 5CR4A 4B1VA 2NNWA 4IDHA 4MO4A 2D0OA 4NB4A 4JEPA 3VESA 4JNEA 3L6QA 1GLJO 1Q82O 1ATRA 3UKRB 2QM1A 5FPMA 1YVNA 4BR0A 1VQNN 3DXKB 3L4QA 1LCUA 2P9SB 2QI2A 3LDNA 5BRHA 5LJVA 1G99A 3CC7N 2C1GA 1QQMA 3M6GA 3CJ7A 4PHTX 1K8KA 1KC8O 1QQOA 3AAQA 3T7ZA 4H0PA 3E9LA 1VQPN 3VEYA 2NLXA 2F9WA 4U67L 1BDGA 1S22A 2F7TA 3MX5A 2QWPA 4I6MB 3CJAA 3UKUA 2YJFA 2H3GX 4IJNA 3MCAB 5AQQA 1JJ2M 1JCEA 4IFEA 4WQ5C 2ZF5O 3ULEA 5C2DA 5JMVA 1NGDA 3WXMB 4BROA 1KXPA 3D2FB 5BRFA 4XJXA 2IVOA 3W3DA 2AA4A 1TUUA 2FLOA 1MA9B 3H1QA 3O9UA 4M63C 2VYPA 3VEXA 1NLVA 4DQ8A 1X3MA 1ATSA 2JWLA 3PIOL 1VQLN 3R9PA 3F5TA 3SBTA 2E2QA 1VQ7N 4O5FA 3MWTA 1O13A 3B8AX 2P9PA 3E9PA 4A5BA 1SAZA 3O1WA 2ASPA 2IVPA 2NRTA 2CH6A 3CCLN 3D7EO 3SJHA 1YJ9N 1KAYA 1QZ6A 5JICA 4GV6A 2P9IA 2D1KA 3AAPA 4B1YB 1NGHA 3M5RA 4IOAL 5M1PA 3C7NA 3GL1A 2PBDA 4PL8A 5AQOA 3CCUN 4GV3A 4H5VA 2QWNA 5AFUH 4MDAA 4BRPA 3VENA 4IO9L 4LC9B 3OBYA 3O6WA 5MLCQ 2I7PA 2YHYA 3WEEB 4WFBL 1HUXA 3P4IA 4BC2A 3I55N 1YIJN 2QW9A 4G9ZA 2A3ZA 1NGEA 1VAZA 2BTFA 4EFHA 3SAFA 3CJ9A 4BRQA 4BC3A 2GX9A 3C6HA 5AQFA 3IUCA 5GINA 4YOVA 1VQ8N 1SQKA 4JKHA 3WT0A 4GV9A 1HLUA 5AQUA 2Q1NA 3ID8A 4BRIA 4C23A 1BU6O 3TTDA 3DXMA 3QB0A 4CZEA 1GLDG 3DWLA 5GADP 4YORA 3I8BA 5EOYA 4EHUA 4YOXA 4ILHA 4CBXA 5AFUA 5M1NA 4YOTA 3E9OA 3CF5L 3ZEUA 4GY2B 3UKRA 3CJBA 3P39A 3ATUA 3DXKA 3KVGA 4BR2A 2P9SA 3IFRA 3S41A 4F9OA 1Z6RA 4ILJA 3CC2N 3VGKA 1MWKA 4MDBA 4YOWA 4WQ5A 3VF4A 3W0LA 3ATVA 1NGGA 3H3NO 4JN4A 4BREA 5BREA 3IKMA 4I6MA 3TTCA 4BRDA 4FWPA 2A40A 4A2AA 2ZJQL 1T6DA 3SAHA 5ADXH 1CZAN 3AGRA 4WQ4C 3I56N 2CGJA 3TSUA 3SMPA 3ZX2A 2VGMA 1K9MO 4CZIA 2GWKA 5AQMA 3O9RA 4KH6A 1TYQB 3CD6N 2BH1A 3QFUA 4CBWA 4B1ZA 5GIPA 5KPZA 2D0PA 1BA0A 2I7NA 4PKGA 3EO3A 3QFPA 2P9KB 5AQLA 3VTIA 2W00A 5AQHA 2GELA 5EY4A 2DPNA 3WQTA 3VF6A 4FPBA 4QS7A 5BN9A 5AZJB 3O9QA 4BGBA 1DKGD 1D4XA 3O80A 4BRNA 2QWQA 1ZXOA 4IEEA 1QQNA 4FWKA 1VQ5N 2HBLA 4A61A 3H6EA 4OPHA 1E4FT 1KAZA 5ADXA 3CCVN 3ENOA 5F2RA 4H0XB 3ID6A 2A6AA 3VOVA 3AY9A 5FPNA 2PAVA 3LL3A 5M1QA 3FGUA 4BQLA 1RFQA 3G4SN 3CQYA 3H3OB 4BY9C 3ENHA 3FFKB 3WEEA 4JKFA 4A5AA 3CCSN 1SZ2A 3CJ1A 5AZIB 2E1ZA 3CCQN 1KQSM 4IJAA 2Q36A 1RGIA 1HKBA 2NRVA 4H5RA 3HOSA 2E20A 3WXIA 3LDLA 4WCEL 4OPAA 3QICA 5BPMA 1ILYA 4H03B 4BG9A 1N8RO 1T6CA 2CGKA 3HTVA 5LJWA 1Q86O 4H0OA 1DGKN 5AQYA 3U9DA 1S72N 2HBJA 2NRHA 3T69A 2NRXA 5F0XA 3LM9A 5AQKA 3F9MA 2QTDA 3KZBA 3MN7A 1OVYA 3EN9A 4CZJA 1K8AO 4L3QA 1YJNN 3A8YA 4O8KA 1Q7YO 4CZMA 2GTDA 1VQ9N 1GLFO 1EQYA 2HSTA 3P38A 4E1JA 1DEJA 2D4WA 2GUPA 3Q7BA 2QXLA 3HM8A 4FOEA 4R79A 4FWQA 4BE7B 1GLBG 3OA9A 3C0BA 5AR0A 3HOTA 4DKWA 3D2EA 1GLLO 2P9LB 1K73O 3TPQA 1T44A 2Q0UA 3ZX0A 3E1YA 4UY8O 1NGBA 5GIOA 4WQ4A 3PIPL 4JD2B 4JK9A 4RTFD 2E2OA 3OHRA 1IJJA 4K42A 4OO1J 5KQ8A 5C10A 1NGJA 4Y0WA 3PLAA 5TKYA 4CBUA 4YOUA 3JXUA 3F2KA 4M7YA 3BF1A 3O9SA 1C0FA 1HKCA 1TYQA 4NLCA 5C15A 3CI5A 2NRWA 4ISFA 4BRLA 1QZ5A 4IZ9A 3U9ZA 3VEWA 3HZ6A 4IO8A 5AQTA 3L0QA 4AM7A 1HKGA 1M1KO 5EXWA 2QEXN 4BEBA 4O8UA 5AQJA 2P9KA 2E8AA 3O5BA 4KBOA 1EO1A 5BRDA 4KH4A 4FVUA 2Q2RA 2A5XA 2FSKA 3FZMA 3HBTA 2V51B 2NRZA 5AZJA 5B8HA 4XH4A 4BC4A 3AGKA 3VMFB 3WXJA 5CHIA 5DM7L 1ATNA 4JK8A 4BQZA 3KWIA 3RVCA 1BA1A 1GLCG 3E66A 3H1VX 1ZC6A 3MN5A 1NGIA 1JCGA 2P9NB 2E2PA 3QBWA 3RSEB 1QVGM 2E88A 1WUAA 4BVPA 3VEOA 5M1KA 1K8KB 2ZWHA 3FZFA 4FWSA 1YITN 4IOCL 4YDUC 5BPNA 4DCHA 2QWMA 4B1WB 4WYBA 4EHTA 5AQSA 4ILGB 1VQKN 3LDPA 1SS6A 3JS6A 2ITMA 1ZBSA 2J4RA 3A5NC 1GLAG 3CPEA 5AZIA 3ULEB 3WUHA 2OTJN 1U2VB 4EIAA 5AQNA 3KWGA 3M3ZA 2WC9A 2HBMA 4AF1A 2HOEA 4ISEA 4BECA 3J7ZO 1V4SA 3HI0A 2HMPA 3DLLL 4FWRA 3SMSA 1YJWN 2VCPA 1YAGA 4HWIA 1YI2N 3VF2A 3NVKA 3VGLA 3D2FA 3EKSA 4M7XA 3VPZA 2HF3A 1NM1A 2RE2A 3FZLA 4NO7A 3H46O 2WFBA 4BC5A 2IVNA 5AQVA 2FF6A 4J8FA 4JKDA 5JLFA 3K9JA 1S3XA 1VQ6N 4C1NI 5EVZA 2P9IB 2YI1A 3MWPA 3WQUA 4JKAA 3NMUA 2EWSA 3CHWA 3HSCA 3R3LA 3C7NB 1T3VA 3U8XA 3N4PA 3CJCA 3CCRN 3DJCA 3SK3A 1HX1A 2F9TA 3Q7CA 5FPEA 3KK7A 4C1NK 2VGNA 1Q18A 3MCPA 5C2FA 4WFNL 4JD2A 4FWOA 2FSNA 4BRCA 2E2NA 4EAHD 4H0TB 3VTHA 4CZGA 1NJIO 3A5MC 1NMDA 5AQXA 3HRGA 3J8AA 3TSQA 5HOOA 3CCJN 1HPMA 4MO5A 1KD1O 5TKWA 1QHAA 3CCMN 2HBKA 2KLAA 3SAGA 4DHYA 1VQON 4H5TA 4QS9A 4U7BA 1YUWA 2NRRA 1XUPO 3P31A 4Z94A 3O1BA 3CMAN 3C6AA 3A5OC 4CI6A 2Q31A 2QWLA 4A59A 3R1XA 1R59O 1P90A 1V4TA 3DXMB 2CGLA 2KHOA 3QBXA 4PKHA 4ISGA 5E84A 2FF3B 1MWMA 1DT9A 2P9UB 5M1FA 1QVFM 3ZETB 4FSVA 4JKGB 3ZEUB 3NVMA 3L4IA 3BF3A 4H0VB 2V7YA 3LM2A 5FPDA 4BRAA 1BG3A 2P9NA 4YDUA 3RSEA 3OW2M 3GOIA 3CCEN 3G6EN 3SBGA 2A42A 3N4QA 3ZX3A 2PFUA 3H45C 3AARA 3TSPA 1VQ4N 4BR7A 5HL7L 3K9KA 3FE1A 5BN8A 1JCFA 5C12A 2OTLN 2ASOA 4FPAA 3A0IX 3VGMA 3CQXA 4BRHA 3MK6A 3LDOA 4FWNA 4B1XB 1U2VA 3FR0A 4AM6A 1YXQA 1C0GA 1RDWX 3O8MA 1RDUA 3U4LA 1NWKA 2V7ZA 3A5LC 3GG4A 5GAHP 2GWJA 2QWOA 4K41A 3GDQA 4FWLA 1HJOA 4BRMA 2ZGZA 2Q0RA 3G71N 2OANA 4IEIA 3EL2A 5AQRA 3ZYYX 5KQDA 2C1IA 4BG8A 3O08A 1W97L 3LDQA 4KH5A 2HF4A 4JKCA 1XQSC 4JHDB 2VWBA 5AQPA 4BRKA 2YJEA 3MN6A 1Y64A 2W40A 2IIRA 5M1OA 3BUZB 5GAEP 3G25A 2YX6A 3EE9A 3IMXA 4H5WA 1LOTB 2RHKA 3FZHA 5E26A 1TUYA 3MMVA 5AQIA 5KPTA 1Z05A 3O4WA 1U6ZA 3QMLA 1E4GT 5JLHA 5EX5A 1J6ZA 4JKBA 4FOIA 4CJ7A 1NGCA 4CD3A 5BR9A 5KPRA 2FSJA 2CH5A 3CIPA 3QDKA 4PKIA 4QS8A 3WXLA 4BRGA 2YHXA 5JVHL 1NBWA 4K25A 1YF5L 4FWMA 5H1SQ 1XC3A 4XEIA 4A62A 2YCHA 4IOXA 2FXUA 2UYTA 4B9QA 4JKEA 4B1UB 3EE8A 2V52B 2KKZA 3UKUB 3VEZA 3CERA 3CPWM 1KAXA 3BEXA 5AQWA 3R8EA 4BR5A 1NGAA 3FLCO 5AQZA 4PL7A 4GVEA 3CXCM 4HTLA 2JWKA 2BUPA 4K43A 1BUPA 3KHYA 3MN9A 2WBNA 3MX2A 5JVGL 3VERA 3C65A 1X9JA 3SLCA 2Q97A 3R6MA 2P9UA 5I9EB 5C0YA 4JAXA 3ZETA 1OKJA 4JKGA 4YOYA 5CE3A 4GNIA 3CMEN 4MLHA 2ASMA 1BOTO 2WUSA 3MDQA 2P9PB 5BPLA 4NLBA 1X3NA 3GE1A 4IWVA 5DM6L 2E1YA 3EKUA 2ZJRL 4CZFA 4CD1A 3D2EB 3VEVA 4BRFA 3VETA 5ELZA 3I33A 1BO5O 3EZWA 1W2BM 1MDUB 1H1VA 3OBWA 2ZJPL 3BP8A 4BR4A 3WXKA 2QA4N 4DB3A 2P9LA 3ENBA 2QWRA 2ZGYA 4IXCA 3FZKA 3D6RA 1NGFA 4WFAL 4A2BA 4BR9A 1VQMN 2GEMA 1GLEG 4JK7A 1YHQN 2W41A 3CETA 1ESVA 3UE5A 4RWTA 1BWFO 4FO0A 3DAWA 5GAGP 1P8ZA 1WOQA 1M90O 4BGAA 2A41A 2YHWA 3GBTA 3M1FA 4H5NA 3IDHA 3O9TA 3CC4N 2AP1A 1IG8A 4RCHA 4BVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0Y B;  4MLE A;  4CZH A;  3UB5 A;  4JHD A;  4CZL A;  5LY3 A;  4CZK A;  4XH5 A;  4FL9 A;  4XH1 A;  3TU5 A;  5AQG A;  2NZT A;  5F1X A;  4B1V A;  4MO4 A;  2D0O A;  4NB4 A;  3VES A;  4JNE A;  3L6Q A;  1GLJ O;  1ATR A;  3UKR B;  2QM1 A;  5FPM A;  1YVN A;  4BR0 A;  3DXK B;  3LDN A;  1LCU A;  2P9S B;  5LJV A;  5BRH A;  1G99 A;  1QQM A;  3M6G A;  3CJ7 A;  1K8K A;  1QQO A;  3AAQ A;  4H0P A;  3VEY A;  2NLX A;  2F9W A;  1BDG A;  1S22 A;  4I6M B;  3UKU A;  2QWP A;  3CJA A;  2YJF A;  2H3G X;  4IJN A;  5AQQ A;  1JCE A;  3ULE A;  4WQ5 C;  2ZF5 O;  5JMV A;  1NGD A;  4BRO A;  1KXP A;  3D2F B;  5BRF A;  2IVO A;  3W3D A;  2AA4 A;  1TUU A;  2FLO A;  1MA9 B;  3H1Q A;  4M63 C;  3VEX A;  2VYP A;  1NLV A;  4DQ8 A;  1X3M A;  1ATS A;  3R9P A;  2E2Q A;  4O5F A;  3B8A X;  2P9P A;  1SAZ A;  3O1W A;  2ASP A;  2IVP A;  2CH6 A;  3D7E O;  3SJH A;  1KAY A;  1QZ6 A;  5JIC A;  2P9I A;  2D1K A;  3AAP A;  4B1Y B;  1NGH A;  3C7N A;  3GL1 A;  2PBD A;  4PL8 A;  5AQO A;  4H5V A;  2QWN A;  5AFU H;  4BRP A;  3VEN A;  4LC9 B;  3O6W A;  2I7P A;  2YHY A;  3WEE B;  1HUX A;  3P4I A;  4BC2 A;  2QW9 A;  2A3Z A;  1NGE A;  4EFH A;  2BTF A;  3CJ9 A;  4BRQ A;  4BC3 A;  5AQF A;  3IUC A;  1SQK A;  3WT0 A;  1HLU A;  5AQU A;  2Q1N A;  3ID8 A;  4BRI A;  4C23 A;  1BU6 O;  3DXM A;  3QB0 A;  4CZE A;  1GLD G;  3DWL A;  3I8B A;  5EOY A;  4EHU A;  4CBX A;  5AFU A;  3ZEU A;  4GY2 B;  3UKR A;  3CJB A;  3ATU A;  3DXK A;  3KVG A;  4BR2 A;  2P9S A;  3IFR A;  3S41 A;  4F9O A;  1Z6R A;  3VGK A;  1MWK A;  4WQ5 A;  3VF4 A;  3W0L A;  3ATV A;  1NGG A;  3H3N O;  4JN4 A;  4BRE A;  5BRE A;  4BRD A;  4I6M A;  4FWP A;  2A40 A;  4A2A A;  1T6D A;  5ADX H;  1CZA N;  4WQ4 C;  2CGJ A;  3SMP A;  3ZX2 A;  4CZI A;  2GWK A;  5AQM A;  1TYQ B;  3QFU A;  4CBW A;  4B1Z A;  5KPZ A;  2D0P A;  1BA0 A;  2I7N A;  4PKG A;  3EO3 A;  3QFP A;  2P9K B;  5AQL A;  5AQH A;  2GEL A;  5EY4 A;  2DPN A;  3WQT A;  3VF6 A;  4FPB A;  4QS7 A;  5BN9 A;  5AZJ B;  4BGB A;  1DKG D;  1D4X A;  3O80 A;  4BRN A;  2QWQ A;  1ZXO A;  1QQN A;  4FWK A;  4A61 A;  3H6E A;  1E4F T;  1KAZ A;  5ADX A;  3ENO A;  5F2R A;  4H0X B;  2A6A A;  3VOV A;  3AY9 A;  5FPN A;  2PAV A;  3LL3 A;  3FGU A;  4BQL A;  1RFQ A;  3CQY A;  3H3O B;  3ENH A;  3FFK B;  3WEE A;  1SZ2 A;  3CJ1 A;  5AZI B;  2E1Z A;  4IJA A;  2Q36 A;  1RGI A;  1HKB A;  4H5R A;  2E20 A;  3WXI A;  3LDL A;  3QIC A;  5BPM A;  4H03 B;  4BG9 A;  1T6C A;  2CGK A;  3HTV A;  5LJW A;  4H0O A;  1DGK N;  5AQY A;  3U9D A;  2NRH A;  5F0X A;  3LM9 A;  5AQK A;  3F9M A;  3KZB A;  3MN7 A;  3EN9 A;  4CZJ A;  4L3Q A;  3A8Y A;  4O8K A;  4CZM A;  2GTD A;  1GLF O;  1EQY A;  4E1J A;  1DEJ A;  2D4W A;  2GUP A;  4FOE A;  2QXL A;  3HM8 A;  4FWQ A;  1GLB G;  3C0B A;  5AR0 A;  3D2E A;  1GLL O;  2P9L B;  3TPQ A;  1T44 A;  2Q0U A;  3ZX0 A;  1NGB A;  4WQ4 A;  4JD2 B;  4RTF D;  2E2O A;  3OHR A;  1IJJ A;  4K42 A;  5KQ8 A;  1NGJ A;  4Y0W A;  5TKY A;  4CBU A;  3JXU A;  4M7Y A;  3BF1 A;  1C0F A;  1HKC A;  1TYQ A;  3CI5 A;  4ISF A;  4BRL A;  1QZ5 A;  4IZ9 A;  3U9Z A;  3VEW A;  3HZ6 A;  4IO8 A;  5AQT A;  3L0Q A;  4AM7 A;  1HKG A;  5EXW A;  5AQJ A;  2P9K A;  2E8A A;  3O5B A;  4KBO A;  5BRD A;  2Q2R A;  2A5X A;  2FSK A;  3FZM A;  3HBT A;  2V51 B;  5AZJ A;  5B8H A;  4XH4 A;  4BC4 A;  3WXJ A;  1ATN A;  4BQZ A;  1BA1 A;  1GLC G;  3H1V X;  1ZC6 A;  3MN5 A;  1NGI A;  1JCG A;  2P9N B;  2E2P A;  3QBW A;  3RSE B;  2E88 A;  1WUA A;  4BVP A;  3VEO A;  1K8K B;  2ZWH A;  3FZF A;  4FWS A;  4YDU C;  5BPN A;  4DCH A;  2QWM A;  4B1W B;  4WYB A;  4EHT A;  5AQS A;  3LDP A;  3JS6 A;  2ITM A;  3WUH A;  1ZBS A;  2J4R A;  3A5N C;  1GLA G;  5AZI A;  3ULE B;  1U2V B;  4EIA A;  5AQN A;  3M3Z A;  2HOE A;  4ISE A;  1V4S A;  3HI0 A;  2HMP A;  4FWR A;  3SMS A;  2VCP A;  1YAG A;  4HWI A;  3VF2 A;  3VGL A;  3D2F A;  3EKS A;  4M7X A;  3VPZ A;  2HF3 A;  1NM1 A;  3FZL A;  4NO7 A;  3H46 O;  4BC5 A;  2IVN A;  5AQV A;  2FF6 A;  4J8F A;  5JLF A;  1S3X A;  5EVZ A;  2P9I B;  2YI1 A;  3WQU A;  2EWS A;  3CHW A;  3HSC A;  3C7N B;  3U8X A;  3CJC A;  3DJC A;  3SK3 A;  1HX1 A;  2F9T A;  5FPE A;  1Q18 A;  3MCP A;  4JD2 A;  4FWO A;  2FSN A;  4BRC A;  2E2N A;  4EAH D;  4H0T B;  4CZG A;  3A5M C;  1NMD A;  5AQX A;  3J8A A;  1HPM A;  4MO5 A;  1QHA A;  4DHY A;  4H5T A;  4QS9 A;  1YUW A;  1XUP O;  4Z94 A;  3O1B A;  4CI6 A;  3A5O C;  2Q31 A;  2QWL A;  1R59 O;  3DXM B;  1V4T A;  2CGL A;  2KHO A;  3QBX A;  4PKH A;  4ISG A;  5E84 A;  2FF3 B;  1MWM A;  2P9U B;  3ZET B;  4FSV A;  3ZEU B;  3L4I A;  3BF3 A;  4H0V B;  2V7Y A;  3LM2 A;  5FPD A;  4BRA A;  1BG3 A;  2P9N A;  4YDU A;  3RSE A;  3GOI A;  2A42 A;  3ZX3 A;  3H45 C;  3AAR A;  4BR7 A;  5BN8 A;  3FE1 A;  1JCF A;  2ASO A;  4FPA A;  3A0I X;  3VGM A;  3CQX A;  4BRH A;  3MK6 A;  3LDO A;  4FWN A;  4B1X B;  1U2V A;  3FR0 A;  4AM6 A;  1YXQ A;  1C0G A;  1RDW X;  3O8M A;  3U4L A;  1NWK A;  2V7Z A;  3A5L C;  3GG4 A;  2GWJ A;  2QWO A;  4K41 A;  3GDQ A;  4FWL A;  1HJO A;  4BRM A;  2ZGZ A;  2Q0R A;  2OAN A;  3EL2 A;  5AQR A;  5KQD A;  4BG8 A;  3O08 A;  3LDQ A;  2HF4 A;  5AQP A;  1XQS C;  4JHD B;  2VWB A;  4BRK A;  2YJE A;  3MN6 A;  1Y64 A;  2W40 A;  2IIR A;  3BUZ B;  3G25 A;  3IMX A;  5E26 A;  4H5W A;  1LOT B;  3FZH A;  1TUY A;  3MMV A;  5AQI A;  5KPT A;  1Z05 A;  3O4W A;  1U6Z A;  3QML A;  1E4G T;  5JLH A;  5EX5 A;  1J6Z A;  4FOI A;  4CJ7 A;  1NGC A;  4CD3 A;  5BR9 A;  5KPR A;  2FSJ A;  2CH5 A;  3CIP A;  3QDK A;  4PKI A;  4QS8 A;  3WXL A;  4BRG A;  2YHX A;  1NBW A;  4K25 A;  4FWM A;  1XC3 A;  4XEI A;  4A62 A;  2YCH A;  2FXU A;  2UYT A;  4B9Q A;  4B1U B;  2V52 B;  3UKU B;  3VEZ A;  3CER A;  1KAX A;  3BEX A;  5AQW A;  3R8E A;  4BR5 A;  1NGA A;  3FLC O;  5AQZ A;  4PL7 A;  4HTL A;  2BUP A;  4K43 A;  1BUP A;  3KHY A;  3MN9 A;  3VER A;  1X9J A;  3SLC A;  2Q97 A;  3R6M A;  2P9U A;  5I9E B;  4JAX A;  3ZET A;  1OKJ A;  5CE3 A;  4GNI A;  4MLH A;  2ASM A;  1BOT O;  2WUS A;  3MDQ A;  2P9P B;  5BPL A;  1X3N A;  3GE1 A;  4IWV A;  2E1Y A;  3EKU A;  4CZF A;  4CD1 A;  3D2E B;  3VEV A;  4BRF A;  3VET A;  5ELZ A;  3I33 A;  1BO5 O;  3EZW A;  1MDU B;  1H1V A;  3BP8 A;  4BR4 A;  3WXK A;  4DB3 A;  2P9L A;  2QWR A;  2ZGY A;  4IXC A;  3FZK A;  1NGF A;  4A2B A;  4BR9 A;  2GEM A;  1GLE G;  2W41 A;  3CET A;  1ESV A;  3UE5 A;  4RWT A;  1BWF O;  4FO0 A;  3DAW A;  1P8Z A;  1WOQ A;  4BGA A;  2A41 A;  2YHW A;  3GBT A;  3M1F A;  4H5N A;  3IDH A;  2AP1 A;  1IG8 A;  4RCH A;  4BVO A; 
#chains in the Genus database with same CATH topology
 4MLE A;  3AO3 A;  4DQQ A;  4XH5 A;  3C94 A;  3OYI A;  1N5Y A;  5CR4 A;  2FBT A;  3ZT4 A;  3V1R A;  4MO4 A;  2D0O A;  1OH8 A;  4NB4 A;  4JNE A;  4LF6 K;  2D0C A;  3UKR B;  2JLE A;  5I3U A;  3M8S A;  4RG8 A;  3DXK B;  3LDN A;  2P9S B;  3VQA A;  2X74 A;  1G99 A;  4OLA A;  3P83 D;  5C24 A;  4DU3 A;  4FJ8 A;  1VHX A;  4H0P A;  3HP9 A;  3ITH A;  1Q9X A;  3QLH A;  1S22 A;  2F7T A;  3NFA A;  4J2E A;  2YJF A;  5AQQ A;  3ULE A;  1JXE A;  4WQ5 C;  1SUQ A;  3M8R A;  4LFB K;  1KXP A;  1WAJ A;  4LH5 A;  3AO2 A;  1NU0 A;  2AA4 A;  1TUU A;  4M63 C;  3O9U A;  5JS1 A;  1NLV A;  2JGU A;  2JWL A;  3V9Z A;  2FBX A;  4CFC A;  3R9P A;  3F5T A;  3SBT A;  4KHP K;  3SV4 A;  3V1O A;  3MWT A;  5FRM A;  4GKJ K;  2P9P A;  4A5B A;  4CCH A;  2ASP A;  2NRT A;  2CH6 A;  3RRH A;  3CCL N;  3AVC A;  1QZ6 A;  5JIC A;  4CHQ A;  2IOC A;  4GV6 A;  2O8F B;  4B3M K;  2D1K A;  3AAP A;  1NGH A;  1X1P A;  5JEN A;  2BDP A;  1SKR A;  4B08 A;  4DSK A;  3PSI A;  2QWN A;  3MXI A;  1GOA A;  4BRP A;  5C42 A;  3OBY A;  1UA0 A;  1WSG A;  1T7P A;  3QET A;  3T3F A;  2QW9 A;  2QK9 A;  2BTF A;  2GX9 A;  2HB5 A;  3IUC A;  4YOV A;  3T1H K;  4E89 A;  4GV9 A;  4W5N A;  3V81 A;  4BRI A;  4C23 A;  1BU6 O;  1EX4 A;  1KSP A;  5GAD P;  3D0P A;  4YOR A;  4EHU A;  4CBX A;  4YOT A;  4GY2 B;  1KRP A;  1IBK K;  2WON A;  4LF5 K;  4E7I A;  1GOB A;  4DSI A;  3SCX A;  4DQR A;  4L8R B;  4RW7 A;  1MWK A;  2ETJ A;  4BE1 A;  4YOW A;  3VQ4 A;  1ASW A;  3EY1 A;  4FJI A;  4JN4 A;  4I6M A;  3TTC A;  4LF8 K;  4CIE A;  1BQM A;  1D8Y A;  3NH1 A;  2HVI A;  3HL8 A;  5A2Q O;  3ZX2 A;  3NH0 A;  3KK1 A;  1K9M O;  2Z1H A;  3BDP A;  3QNO A;  4KH6 A;  1TYQ B;  4O44 A;  3QFU A;  4CBW A;  4KI4 A;  1VK0 A;  2VG5 A;  4DMN A;  2W00 A;  1NJY A;  5AQH A;  3HT3 A;  4HUG A;  4HCC A;  3LAK A;  3KD5 E;  4QS7 A;  3K58 A;  5BN9 A;  4BGB A;  2QWQ A;  4E1N A;  3SQ1 A;  3I0R A;  3WNF A;  1HYV A;  1KAZ A;  1YT3 A;  5F2R A;  2RF2 A;  4KKO A;  1VRT A;  3VOV A;  4Z0U A;  5M1Q A;  3G4S N;  3FFK B;  3WEE A;  4JKF A;  5J1E A;  4Z4I A;  4GKK K;  3DYA A;  3HPG A;  4IJA A;  4OGC A;  1G15 A;  1RGI A;  2NRV A;  3HOS A;  2E20 A;  4LF7 K;  4KRE A;  2UXD K;  1N8R O;  3HTV A;  1T8E A;  3SUP A;  1U47 A;  1RBS A;  4H0O A;  1DGK N;  1S72 N;  3AVI A;  2NRH A;  1HNZ K;  3KZB A;  3MN7 A;  2OZM A;  4FJX A;  1BIS A;  1OVY A;  4DR4 K;  3EN9 A;  3SYZ A;  3ZSQ A;  4FZY A;  1Q7Y O;  2GTD A;  1U49 A;  4DSF A;  1GLF O;  2D4W A;  2GUP A;  4FOE A;  2QXL A;  4R79 A;  3OYL A;  3LDS A;  4IFV A;  3OYG A;  4DKW A;  1N33 K;  1GLL O;  1HRH A;  2UUA K;  4WQ4 A;  3OYJ A;  4JD2 B;  1LW0 A;  2XRI A;  2E2O A;  3LP3 A;  2ATQ A;  1IJJ A;  3AO1 A;  4OO1 J;  1HMV A;  1NMN A;  4Y0W A;  4FLY A;  4FM1 A;  3PLA A;  3AO5 A;  1BI4 B;  4LSN A;  4FJN A;  3F2K A;  1VSF A;  3O9S A;  1C0F A;  5C15 A;  1HJR A;  1N32 K;  4BRL A;  3U9Z A;  2ZE2 A;  1SL1 A;  4CEQ A;  4OKE A;  1JLQ A;  5HRP A;  2HHW A;  2DFH A;  3SJJ A;  4FK4 A;  4FZZ A;  2Q2R A;  3LWL A;  2RN2 A;  1U04 A;  2IAJ A;  3HBT A;  3T1A A;  5KRT A;  2NRZ A;  1C0U A;  4XH4 A;  4BC4 A;  5CHI A;  3WXJ A;  1NOY A;  5DM7 L;  1ATN A;  3KWI A;  1LWC A;  3H1V X;  2O8E A;  4Y1C A;  5LL6 Z;  4DV1 K;  2G8W A;  3B6P A;  3FZF A;  4JI1 K;  4DSE A;  2QWM A;  2B6A A;  4ILG B;  3PX0 A;  3LDP A;  1XMO K;  3A5N C;  3ULE B;  2W6L A;  3M3Z A;  3ULD A;  4AF1 A;  3NGZ A;  4DR5 K;  2HMP A;  4X66 K;  2IS3 A;  1TV6 A;  1NKC A;  4HWI A;  1YI2 N;  3VF2 A;  3HST B;  3HP6 A;  3VQ8 A;  4NO7 A;  3FZL A;  2RE2 A;  2WFB A;  1XC9 A;  1O1W A;  4JYA K;  3PV8 A;  1VQ6 N;  4C1N I;  4CJP A;  4Q0B A;  4UQG A;  4QAG A;  3AV9 A;  4BAC A;  4JKA A;  2EHG A;  4DTR A;  3CCR N;  3SK3 A;  1RNH A;  1HX1 A;  3SNN A;  5FPE A;  4I2P A;  3KK7 A;  2VGN A;  3VQ7 A;  3MCP A;  3HXM A;  4NYN A;  4BRC A;  4CZG A;  4JLH A;  4CJW A;  1C1B A;  3CCJ N;  2KLA A;  4N41 A;  3OJU A;  4QS9 A;  2XHB A;  1HQU A;  1CXQ A;  4DQP A;  1XUP O;  4Z94 A;  3O1B A;  3CMA N;  3C6A A;  3QIP A;  4CI6 A;  2Q31 A;  2QWL A;  4A59 A;  1R59 O;  4ISG A;  3ZSY A;  5M1F A;  3THY B;  4CHZ A;  1RIL A;  2F8S A;  1CZB A;  3BF3 A;  4B8C A;  3NF6 A;  4BRA A;  1QSL A;  1S1W A;  2P9N A;  4YDU A;  1N36 K;  3C6T A;  3OW2 M;  3CCE N;  5C25 A;  3G6E N;  3DOL A;  3SBG A;  4B9M A;  3H45 C;  4B3S K;  4DR7 K;  4CEB A;  2OTL N;  3VGM A;  3DI6 A;  3MK6 A;  5FLX O;  1U2V A;  1S1U A;  1UOC A;  3FR0 A;  3V4I A;  4O0I A;  4BWM A;  2E6M A;  4CEZ A;  1ZBL A;  3U4L A;  2QWO A;  4K41 A;  1HJO A;  2ZGZ A;  4AHU A;  3G71 N;  1NNE A;  2HHT A;  4EZ9 A;  2P51 A;  3O3H A;  1SKW A;  1ZBI A;  3LDQ A;  4KH5 A;  2HF4 A;  2OYQ A;  1XQS C;  4HUF A;  4FJH A;  4CF9 A;  5M1O A;  4CEF A;  3BUZ B;  3IMX A;  3EE9 A;  2RHK A;  4M3U A;  1TUY A;  4KRF A;  3QML A;  4CJQ A;  4ID5 A;  4F4K A;  3ZCM A;  2D0B A;  2F8T A;  1NK4 A;  5BR9 A;  2P1J A;  4FJ7 A;  2VG7 A;  4QS8 A;  1NBW A;  3CFP A;  3AVJ A;  1YTU A;  2FXU A;  2UYT A;  1IKV A;  3EE8 A;  1WN7 A;  4GW6 A;  4DF4 A;  4E1M A;  4DR3 K;  5AQW A;  1VQ8 N;  5AQZ A;  3PO4 A;  5HRR A;  2WBN A;  2O8D B;  3EEQ A;  3MX2 A;  2GBZ A;  3THX A;  2P9U A;  4GVM A;  2HHX A;  1Z25 A;  4JAX A;  5FDL A;  5CE3 A;  2UU9 K;  4FVM A;  2FC0 A;  4MLH A;  1C0T A;  3SV3 A;  2VWK A;  4NLB A;  1BQN A;  4IWV A;  5KTQ A;  4CJS A;  2E1Y A;  2YNF A;  1BGX T;  2OPP A;  3VEV A;  5ELZ A;  1F21 A;  1BO5 O;  1W2B M;  3KLI A;  1MDU B;  1H1V A;  3BP8 A;  3L2R A;  3KD1 E;  2ZGY A;  4IXC A;  3D6R A;  4BR9 A;  1VQM N;  4IG3 A;  3QES A;  1JLA A;  3CET A;  3UE5 A;  2GUI A;  4FO0 A;  3DAW A;  5GAG P;  4CFB A;  1P8Z A;  4OPJ A;  2YHW A;  3GBT A;  3K5M A;  3IDH A;  4FLV A;  2OCE A;  3KK3 A;  4CZH A;  4JHD A;  4WF9 L;  4CZK A;  4B9U A;  4K8Z A;  1XNR K;  3OYD A;  5AQG A;  1Q81 O;  5F1X A;  1VSJ A;  4J2A A;  4HCB A;  2O8E B;  4JEP A;  3VES A;  3L6Q A;  4DR2 K;  1ATR A;  5FPM A;  2R7Y A;  4DUZ K;  4BR0 A;  5BR8 K;  2QI2 A;  5BRH A;  4NYF A;  3CFO A;  3M6G A;  3OYH A;  4PHT X;  1K8K A;  1QQO A;  3AAQ A;  3OTO K;  1SKS A;  3V9S A;  4K8X A;  4U67 L;  3MX5 A;  3CJA A;  3MCA B;  1JCE A;  5C2D A;  4Z4F A;  1JLE A;  5JMV A;  1NGD A;  3WXM B;  4FZX C;  2KFN A;  3W3D A;  3L2Q A;  1MA9 B;  3VEX A;  2VYP A;  1VQL N;  1TVR A;  4E3S A;  4M3T A;  1VQ7 N;  2XY5 A;  3KKR A;  3D45 A;  3E9P A;  4KHS A;  4AHR A;  3WNE A;  1OH6 A;  3SJH A;  2O8C B;  2DY4 A;  3OS2 A;  1RT3 A;  3M5R A;  1RBR A;  5DK5 A;  3OYA A;  4KHU A;  1KVB A;  3GL1 A;  4PL8 A;  4H5V A;  3TAR A;  4MDA A;  2E4L A;  1XI1 A;  2D5R A;  3T1Y K;  3TR8 A;  3MXM A;  3FFI A;  3VN5 A;  3I55 N;  1YIJ N;  3OJS A;  1NGE A;  3BGR A;  4EFH A;  4IBN A;  3SAF A;  4BC3 A;  5AQF A;  5GIN A;  4FM0 A;  4JKH A;  3WT0 A;  4DTJ A;  4N47 A;  5SWM A;  4BDP A;  2VG6 A;  3DXM A;  4RW8 A;  1TAQ A;  3ZSW A;  4JV5 K;  3DLK A;  1J53 A;  1GLD G;  1RBT A;  3DWL A;  3NBP A;  5EOY A;  4ILH A;  3PX4 A;  3LAL A;  3E9O A;  3ATU A;  1S5J A;  1VSH A;  3DLR A;  3KVG A;  1X9S A;  4DFM A;  3S41 A;  4F9O A;  4FJM A;  3TAG A;  3ZSR A;  3W0L A;  5BRE A;  1NGG A;  4CJ3 A;  2A40 A;  3KLG A;  1JLF A;  4WQ4 C;  2CGJ A;  2OPQ A;  4CZI A;  1JXB A;  3CD6 N;  2BH1 A;  4B1Z A;  5KPZ A;  2P9K B;  1C1C A;  3VTI A;  3ZT3 A;  5AJ3 K;  5DMR A;  2VQE K;  5AZJ B;  1DKG D;  1D4X A;  3O80 A;  4IEE A;  1QQN A;  4K0K K;  3LZJ A;  1KLM A;  5ADX A;  3K2P A;  2OPS A;  3AA5 X;  1IH7 A;  3AA4 A;  1RFQ A;  3H3O B;  4O0J A;  4A5A A;  3CCS N;  4DS5 A;  3HO1 A;  3CJ1 A;  5AZI B;  2E1Z A;  1SV5 A;  1HKB A;  4H5R A;  3O4N A;  4CED A;  3WXI A;  4OPA A;  1EET A;  3QIC A;  4Z4E A;  1ILY A;  3NGY A;  4C8K A;  2CGK A;  1ASU A;  3A2F A;  4CJU A;  3T69 A;  3VQ9 A;  3V9W A;  3F9M A;  2QTD A;  1DTQ A;  2YKN A;  2BGG A;  4CZJ A;  3TAB A;  4OJR A;  1YJN N;  1VQ9 N;  4O8K A;  1NJW A;  4DQS A;  3P38 A;  2HST A;  4E1J A;  1D9F A;  1XMQ K;  3HM8 A;  4BE7 B;  4B3O A;  5AR0 A;  3D2E A;  1K73 O;  3K0S A;  1T44 A;  4DFJ A;  3T19 A;  4UY8 O;  3P1G A;  4CEE A;  3S5T A;  4NCA A;  3PSF A;  3HPH A;  4K42 A;  4EP4 A;  1XWL A;  4CBU A;  4KAZ A;  4NLC A;  2Q3S A;  1QZ5 A;  3RMA A;  3HJF A;  1I94 K;  5AQT A;  2YNG A;  5KRS A;  3L8B A;  4AHC A;  4KBO A;  1NKB A;  5BRD A;  4KH4 A;  3RWU A;  3FZM A;  2V51 B;  4I2Q A;  4JK8 A;  4BQZ A;  3HPO A;  4LF4 K;  3RMD A;  2E2P A;  2YKM A;  3RSE B;  1QVG M;  4I9L A;  2E88 A;  1IO2 A;  4OKK A;  3VEO A;  1K8K B;  5KGX A;  4FLZ A;  4DFP A;  4YDU C;  1EWR A;  1CZ9 A;  5BPN A;  4YHH K;  3DRP A;  4B1W B;  3U6F A;  1VQK N;  1C1A A;  2ITM A;  4W5T A;  2J4R A;  4F2S A;  4J2B A;  2OTJ N;  1SL2 A;  4IDK A;  1MU2 A;  2PY5 A;  2HOE A;  4ISE A;  5FRN A;  1WLJ A;  3HI0 A;  4KFB A;  4DWI A;  1CXU A;  1T03 A;  4JI3 K;  4B9N A;  4QOZ B;  1UAX A;  1NM1 A;  3H46 O;  1RTI A;  3SUO A;  1D9D A;  2FF6 A;  4FCY A;  2Z1J A;  4JKD A;  5EVZ A;  3MWP A;  3WQU A;  3NMU A;  2EWS A;  4DG1 A;  1RT1 A;  3HSC A;  3R3L A;  3VQE A;  3S9H A;  1N6Q A;  1I39 A;  3U8X A;  3QEP A;  1JL2 A;  1JLC A;  3DJC A;  3O3F A;  4DU1 A;  4WFN L;  1YVU A;  4FWO A;  4FLT A;  4OLB A;  2G8I A;  5J2M A;  1Q8I A;  3HM9 A;  1W0H A;  4H0T B;  3A5M C;  1NMD A;  5AQX A;  3J8A A;  1ITG A;  4MO5 A;  4Q5V A;  5TKW A;  1QHA A;  2B4J A;  2HBK A;  4H5T A;  4U7B A;  1YUW A;  1ZYQ A;  4CK2 A;  1KVA A;  4AHT A;  3DXM B;  4PKH A;  2KZM A;  5JS2 A;  1DT9 A;  3OYC A;  4CJ4 A;  3NVM A;  4O55 A;  2F96 A;  3J7Y P;  3NF9 A;  3LM2 A;  1BG3 A;  4H4O A;  3GOI A;  4CGG A;  1ASV A;  3PX6 A;  1DLO A;  3TSP A;  4BR7 A;  3DM2 A;  3K9K A;  2X6N A;  2ASO A;  2UXC K;  4FPA A;  3A0I X;  5IWA K;  3LDO A;  5CZ2 A;  4YNQ A;  4W5R A;  1SL0 A;  3AVK A;  5HBM A;  1LWE A;  3NGI A;  1QSS A;  2V7Z A;  3AVA A;  1HNX K;  4BRM A;  2Q0R A;  1X9M A;  4JRQ A;  3OS0 A;  2G8U A;  3C95 A;  4FW2 A;  4IEI A;  4C8L A;  5AQR A;  2C1I A;  1W97 L;  1WSJ A;  4DTM A;  5AQP A;  4CJF A;  4BRK A;  2E6L A;  2I5J A;  1NJX A;  1IKX A;  2W40 A;  3QER A;  1NK9 A;  4Z4H A;  4PA1 A;  2YX6 A;  1LOT B;  1LAW A;  5KPT A;  4X62 K;  3NAE A;  5LMU K;  3V9X A;  5JLH A;  1E4G T;  4KB0 A;  1J6Z A;  2DFE A;  4CEC A;  1NGC A;  5EU7 A;  2CH5 A;  3QDK A;  5H1S Q;  2G8V A;  4XEI A;  3WNH A;  1VRU A;  2Z1I A;  3MEE A;  4JKE A;  4B1U B;  4KHY A;  2Y1J A;  2V52 B;  3B6O A;  4KPY A;  3VEZ A;  3CPW M;  3R8E A;  1NGA A;  3AA3 A;  1KVC A;  3KHY A;  4XIU A;  4PWD A;  3VER A;  3C65 A;  4DTX A;  3SLC A;  5SZT A;  4BDY A;  3ZET A;  1OKJ A;  4JKG A;  4YOY A;  4GNI A;  3CME N;  2WUS A;  3IAY A;  2P9P B;  3AA2 A;  3EKU A;  1OH7 A;  3CM5 A;  4CZF A;  4CD1 A;  3KK2 A;  3D2E B;  3VET A;  2XY6 A;  4E19 A;  4FW1 A;  3OBW A;  2ZJP L;  2PYJ A;  4BR4 A;  2P9L A;  4WFA L;  4A2B A;  4B9L A;  4JK7 A;  1X9W A;  1S9G A;  1ESV A;  4CGF A;  1BWF O;  5HRN A;  1NK0 A;  1WOQ A;  5KI6 A;  1BIZ A;  5FRO A;  1TKT A;  3O9T A;  1IG8 A;  4H0Y B;  1R0A A;  4CZL A;  3G0Z A;  5LY3 A;  2UUB K;  4CIG A;  4FL9 A;  3TU5 A;  3BZC A;  1RCH A;  2NZT A;  4CER A;  4B1V A;  3LAM A;  4IDH A;  1W9H A;  1RTH A;  1FJG K;  2YHB A;  4DUY K;  3AO4 A;  2QM1 A;  3IRX A;  4MFB A;  1YVN A;  3SZ2 A;  4B9T A;  5CZ1 A;  3L4Q A;  3CC7 N;  5LJV A;  2C1G A;  2HHI A;  3J81 O;  3OYK A;  1QQM A;  4GMJ B;  1W7A A;  4CHO A;  1KC8 O;  3T7Z A;  3V1Q A;  1VQP N;  2HMI A;  3VEY A;  4OGE A;  1HR0 K;  1A5X A;  1NK6 A;  1UA1 A;  1BDG A;  4I6M B;  3UKU A;  4G9Z A;  5HRO A;  4CJR A;  4IFE A;  2ZF5 O;  3VA3 A;  3PUF A;  5BRF A;  4FK0 A;  2P5O A;  4WE1 A;  2FLO A;  1RBV A;  3NF8 A;  3AVL A;  4DQ8 A;  1X3M A;  3QO9 A;  3PIO L;  3VQ6 A;  4KV8 A;  4HTU A;  4TSX A;  3B8A X;  4FXD A;  4CK3 A;  3KLE A;  3O1W A;  5IT9 O;  3AVH A;  4DV7 K;  4YY3 K;  1HNW K;  5M1P A;  3C7N A;  3THW A;  1BCO A;  2PBD A;  2W6K A;  3CCU N;  4ZHR A;  1NKE A;  4JI8 K;  2UUC K;  1U4B A;  4LC9 B;  3O6W A;  5MLC Q;  1TGO A;  2I7P A;  2YHY A;  3WEE B;  4CF1 A;  3P4I A;  4B9V A;  1VAZ A;  3ZT0 A;  4N5S A;  2DFF A;  3CJ9 A;  2Z1G A;  5KGW A;  1QTM A;  2A1R A;  1SQK A;  1BL3 A;  3ID8 A;  3QEX A;  3TTD A;  4LSL A;  4CZE A;  1KCF A;  3I8B A;  4YOX A;  5AFU A;  1WNS A;  4KO0 A;  1EP4 A;  3CF5 L;  4DTN A;  3UKR A;  1J54 A;  3CJB A;  1NOZ A;  3P39 A;  4QCL A;  3DXK A;  4BR2 A;  3AVF A;  2P9S A;  3I8D A;  3AVN A;  2XY8 A;  4R5P A;  3CC2 N;  3OYE A;  4Z4G A;  1FK9 A;  1Z26 A;  3VGK A;  4MDB A;  4DU4 A;  3E01 A;  3VF4 A;  4BRE A;  3OYN A;  4HHT A;  3IKM A;  4BRD A;  3SPZ A;  2HVH A;  4FWP A;  1S6P A;  1S1T A;  2D0A A;  1T6D A;  5ADX H;  2HHV A;  4N56 A;  3TSU A;  3BY5 A;  3SMP A;  1HYS A;  1DTT A;  5GIP A;  1VSK A;  2D0P A;  4CFD A;  1JKH A;  2HND A;  2I7N A;  3EO3 A;  3AVB A;  1IBM K;  2HHH K;  2AJQ A;  5AQL A;  4DR1 K;  5EY4 A;  3WQT A;  4MQ3 A;  4DLE A;  4RW9 A;  2O8F A;  4FWK A;  3ASM A;  2HBL A;  3H6E A;  4JI5 K;  1KFD A;  3SQ0 A;  3ENO A;  3ID6 A;  4F3T A;  2A6A A;  3QIN A;  1GOC A;  3AY9 A;  5FPN A;  3FGU A;  4BQL A;  3ENH A;  4C8N A;  4DQI A;  1RT2 A;  1SZ2 A;  1N34 K;  2HW3 A;  1KQS M;  1FXX A;  1QE1 A;  4H03 B;  4BG9 A;  4PQU A;  3WNG A;  3O3G A;  2XO7 A;  1Q86 O;  1TKX A;  2HBJ A;  3LP0 A;  2NRX A;  3KTQ A;  1RDB A;  1K8A O;  4L3Q A;  3A8Y A;  1EXQ A;  4CZM A;  3M8P A;  4LF9 K;  4LFC K;  3Q7B A;  4FWQ A;  1GLB G;  3OA9 A;  2X78 A;  3C0B A;  5I42 A;  3HOT A;  2P9L B;  4CGJ A;  4RW6 A;  3K5N A;  3ZX0 A;  1XHX A;  3PIP L;  2G8H A;  4RTF D;  3OHR A;  3NF7 A;  5KQ8 A;  1NGJ A;  3KKS A;  3DOK A;  1I3A A;  5TKY A;  4YOU A;  3JXU A;  3ZSX A;  4ID1 A;  1TYQ A;  3TI0 A;  4IZ9 A;  3HZ6 A;  1RTJ A;  1M1K O;  1HKG A;  4DF8 A;  5EXW A;  4BEB A;  5AQJ A;  4LFA K;  2E8A A;  1EO1 A;  4FVU A;  4IFY A;  4JI4 K;  4F2R A;  1U48 A;  5B8H A;  3KLF A;  1S1V A;  3RVC A;  1GLC G;  4B9S A;  3JAM O;  1ZC6 A;  1QSY A;  1JCG A;  2P9N B;  1IBL K;  4BVP A;  1WUA A;  2O4I A;  2ZWH A;  1HPZ A;  4DCH A;  3SUQ A;  1VSL A;  4BDZ A;  4I9Q A;  3CPE A;  1U2V B;  3PO5 A;  4EIA A;  5AQN A;  2WC9 A;  2HBM A;  2O8B A;  2HHQ A;  1V4S A;  3DLL L;  4E7L A;  4CJE A;  3NVK A;  3D2F A;  3EKS A;  3VPZ A;  2HF3 A;  4OX9 K;  2HHS A;  1NG9 A;  4J8F A;  1ZBU A;  3K9J A;  2VQF K;  2YI1 A;  3CHW A;  1C0M A;  2BAN A;  3C7N B;  3THW B;  1T3V A;  3N4P A;  4F8R A;  3OYM A;  2F9T A;  3Q7C A;  4KI6 A;  4C1N K;  1TAU A;  4AHS A;  4H8K A;  4JD2 A;  2FSN A;  2E2N A;  4X65 K;  3VTH A;  1HQE A;  1NJI O;  4FYD A;  3TSQ A;  1HPM A;  4CEO A;  3PY8 A;  2YV0 X;  1FW6 A;  1VQO N;  2RKI A;  4KHN A;  3ZT1 A;  3LP2 A;  3RTV A;  3R1X A;  3OY9 A;  2KHO A;  2FF3 B;  1MWM A;  3THX B;  2P9U B;  3TAQ A;  1QVF M;  4FSV A;  4CF2 A;  3EZ5 A;  5LMN K;  3L4I A;  4H0V B;  2V7Y A;  4CHP A;  3ISN C;  1QS4 A;  4DLG A;  1L3U A;  4J2D A;  3ZT2 A;  1LV5 A;  3AAR A;  5HL7 L;  1QHT A;  1JCF A;  3L2V A;  1A5V A;  1VSE A;  3CQX A;  3L3V A;  4FWN A;  1E3M A;  4IG0 A;  4AM6 A;  1S9E A;  1YXQ A;  1C0G A;  1RDW X;  3O8M A;  3KJV A;  1RDU A;  3GG4 A;  5E41 A;  3GDQ A;  4PY5 A;  3RR8 A;  2EX3 A;  4FJL A;  3TAN A;  3ZYY X;  3O08 A;  1S1X A;  1B9D A;  4G1Q A;  4BE0 A;  4JHD B;  2VWB A;  2BE2 A;  1B92 A;  3MN6 A;  3OS1 A;  1Y64 A;  5GAE P;  5E26 A;  1TK5 A;  4H5W A;  4IKF A;  1RDA A;  3FZH A;  3LZI A;  3MMV A;  5AQI A;  2W42 A;  3SI6 A;  4N76 A;  3O4W A;  4JI7 K;  1U45 A;  5EX5 A;  4CGD A;  4FOI A;  4CJ7 A;  4CD3 A;  4E72 A;  5CYQ A;  4YFU A;  2OA8 A;  4OKJ A;  1KLN A;  1YF5 L;  4DSL A;  4A62 A;  2DTU A;  4B9Q A;  4CES A;  4EZ6 A;  3VQC A;  4C8O A;  1KAX A;  3BEX A;  4LD0 A;  4PL7 A;  3FLC O;  2JWK A;  1TKD A;  4ELU A;  4K43 A;  3MN9 A;  2YHA A;  3RMB A;  3THY A;  2WTU A;  3HK2 A;  5I9E B;  2Y1I A;  3H08 A;  3ZSZ A;  4Z4C A;  5BPL A;  1X3N A;  2LSN A;  3K5L A;  1IV0 A;  4BRF A;  1C6V A;  1VSI A;  1YTA A;  4ELV A;  4M42 A;  3DRS A;  3NHG A;  2QA4 N;  3VQQ A;  3ENB A;  2QWR A;  4M3W A;  3FZK A;  1NGF A;  2YNH A;  3HYF A;  1FKO A;  4BWJ A;  5J2Q A;  1YHQ N;  4EP5 A;  2W41 A;  3AVM A;  1M90 O;  4BGA A;  2E5L K;  2FBV A;  4NCG A;  4H5N A;  1XNQ K;  2O4G A;  2AP1 A;  4RCH A;  4BVO A;  3EYZ A;  4A57 A;  3UB5 A;  1HNI A;  1WAF A;  3F73 A;  4RW4 A;  1B9F A;  3TTF A;  3ZLJ A;  4XH1 A;  1RDD A;  2NNW A;  1WSI A;  3DRR A;  5HP1 A;  3M8Q A;  1L3S A;  1GLJ O;  1Q82 O;  2QXF A;  1TK0 A;  1VQN N;  3DLG A;  1LCU A;  4DR6 K;  5T7B A;  5J2N A;  3NH2 A;  2A1S A;  3CJ7 A;  3QIO A;  3E9L A;  3S3O A;  2NLX A;  2F9W A;  2O8B B;  2QWP A;  1VSM A;  4IJN A;  2H3G X;  4DFK A;  1JJ2 M;  4CJT A;  4BRO A;  3D2F B;  4XJX A;  2IVO A;  2O8D A;  1Q9Y A;  3H1Q A;  5K14 A;  1NK5 A;  1ATS A;  1L5U A;  3CM6 A;  1A5W A;  3RRG A;  2E2Q A;  2QKB A;  4O5F A;  2YNI A;  4M3R A;  1O13 A;  4M41 A;  3MAQ A;  3RMC A;  1SAZ A;  2IVP A;  3D7E O;  1J5E K;  4CGH A;  1S6Q A;  1KAY A;  1YJ9 N;  2QKK A;  1K6Y A;  2P9I A;  4B1Y B;  3OVN A;  5D3G A;  4IOA L;  3AVG A;  4ICL A;  5AQO A;  4GV3 A;  5AFU H;  4DTP A;  3VEN A;  4IO9 L;  3K5O A;  4CJV A;  4X64 K;  4WFB L;  1HUX A;  3VQ5 A;  4DS4 A;  4BC2 A;  4CHN A;  2PYL A;  2A3Z A;  1TL1 A;  4BRQ A;  3C6H A;  2HNY A;  1HLU A;  5AQU A;  2Q1N A;  1KFS A;  4KHW A;  3QB0 A;  4DV3 K;  3I0S A;  3QEV A;  4CFA A;  3LAN A;  5M1N A;  3NDK A;  4O5B A;  3ZEU A;  2B5J A;  3TAE A;  3IFR A;  1Z6R A;  3VQB A;  4ILJ A;  3TAF A;  3KIO A;  4NXN K;  4WQ5 A;  3ATV A;  3H3N O;  3VA0 A;  3J7A P;  4E7H A;  1WBD A;  4A2A A;  4LH4 A;  2ZJQ L;  3SAH A;  1CZA N;  3AGR A;  3I56 N;  3J80 O;  2VGM A;  2GWK A;  5AQM A;  3O9R A;  3QEW A;  1BA0 A;  2KW4 A;  4PKG A;  3CYM A;  3QFP A;  3HVR A;  2GEL A;  2DPN A;  3VF6 A;  4FPB A;  2ZM6 K;  2O8C A;  3O9Q A;  1IG9 A;  4FJ9 A;  4BRN A;  1ZXO A;  3SQ4 A;  4BE2 A;  1VQ5 N;  4W5Q A;  4A61 A;  3JYT A;  1HYZ A;  1E4F T;  4OPH A;  3HVT A;  3CCV N;  3DLB A;  4M3Y A;  4H0X B;  1XHZ A;  1NK8 A;  4NCB A;  3OYB A;  2PAV A;  3DMJ A;  3LL3 A;  3CG7 A;  3CQY A;  4BY9 C;  4OVL A;  4FLX A;  2OPR A;  3CCQ N;  1TKZ A;  3ZSO A;  3QNN A;  2Q36 A;  4JRP A;  3U3G A;  4WCE L;  3LDL A;  2X6S A;  5BPM A;  4NXM K;  2OZS A;  4KTQ A;  4Y1D A;  2GV9 A;  1T6C A;  4KB1 A;  1WSE A;  3VQP A;  5LJW A;  3S3M A;  1LWF A;  5AQY A;  4CJ5 A;  3U9D A;  2ZD1 A;  4CGI A;  4V19 S;  5F0X A;  3LM9 A;  4DV5 K;  4FJK A;  5AQK A;  3C6U A;  4B3R K;  4CIF A;  3RR7 A;  4FM2 A;  5CY4 A;  1EQY A;  4B3T K;  1DEJ A;  4DTS A;  2KTQ A;  3ALY A;  5HRS A;  1IKW A;  4JS5 A;  3TPQ A;  4HVJ A;  2Q0U A;  3SQ2 A;  1ZBH A;  2RPI A;  3E1Y A;  1NGB A;  5GIO A;  1L3T A;  4O4G A;  4JK9 A;  1NJZ A;  3ZSV A;  3K57 A;  1VSD A;  4CJL A;  5C10 A;  1TK8 A;  4M7Y A;  3BF1 A;  3P5J A;  1HKC A;  3CI5 A;  2NRW A;  4ISF A;  3BZK A;  3VEW A;  4IO8 A;  3L0Q A;  4AM7 A;  2QEX N;  4O8U A;  1BHL A;  2P9K A;  2PZS A;  3O5B A;  4FJ5 A;  3CFR A;  1BIU A;  2A5X A;  4W5O A;  2FSK A;  1D5A A;  5AZJ A;  4AQY K;  1IKY A;  3AGK A;  3VMF B;  1NK7 A;  1BA1 A;  3E66 A;  3MN5 A;  4JI6 K;  1NGI A;  3QEI A;  3QBW A;  5M1K A;  4FWS A;  4FJG A;  4CVN E;  1YIT N;  4IOC L;  4WYB A;  4EHT A;  5AQS A;  1SS6 A;  3JS6 A;  1RDC A;  1ZBS A;  1HNV A;  5AZI A;  1GLA G;  3WUH A;  2KQ2 A;  4DV4 K;  3V9U A;  1RT7 A;  3KWG A;  3V6D A;  1RTD A;  3OYF A;  4BEC A;  3J7Z O;  2KFZ A;  4E7K A;  1RT6 A;  4FWR A;  3SMS A;  1YJW N;  2VCP A;  4AIL C;  2XY7 A;  1YAG A;  2NUB A;  4DTU A;  3VGL A;  3UIQ A;  4M7X A;  1JL1 A;  1EKE A;  3F9K A;  1T05 A;  4BC5 A;  2IVN A;  5AQV A;  3THV A;  4FK2 A;  5JLF A;  2ITG A;  1S3X A;  2P9I B;  1LAV A;  3L2U A;  2HHU A;  3U3Y A;  3IS9 A;  3NCI A;  3SPY A;  3CJC A;  3CQ8 A;  2UXB K;  4FLW A;  1Q18 A;  5C2F A;  1OH5 A;  1RBU A;  4EAH D;  1REV A;  3HRG A;  4KTZ A;  5HOO A;  1KD1 O;  4E7J A;  3CCM N;  1ZBF A;  1QQC A;  2FBY A;  3SAG A;  4C8M A;  4DHY A;  4CHY A;  2G8K A;  2NRR A;  4DV6 K;  1TL3 A;  3P31 A;  3A5O C;  5J2P A;  3IG1 A;  2WOM A;  1P90 A;  1V4T A;  1JLB A;  2CGL A;  3QBX A;  5E84 A;  2ZQB A;  4DV0 K;  1JLG A;  4CF0 A;  3MED A;  4JI2 K;  3ZET B;  3MXJ A;  4JKG B;  3ZEU B;  4KHQ A;  4E0D A;  5FPD A;  3MEC A;  3G10 A;  3RSE A;  1J5O A;  2A42 A;  3N4Q A;  3ZX3 A;  2PFU A;  4HUE A;  1VQ4 N;  5BN8 A;  3FE1 A;  3JSM A;  5C12 A;  3KLH A;  4B8A B;  4BRH A;  2F4V K;  4CF8 A;  2G8F A;  4B1X B;  4AH9 A;  1RT4 A;  4M3X A;  4H4M A;  4ELT A;  1NWK A;  1WSH A;  3A5L C;  5GAH P;  3TWH A;  2GWJ A;  1WBB A;  4FWL A;  4OPK A;  3LPU A;  5HLF A;  4DSJ A;  2OAN A;  3EL2 A;  5KQD A;  4PUO A;  4BG8 A;  2HNZ A;  4JKC A;  3TAM A;  4CK1 A;  4FLU A;  2YJE A;  3DLH A;  2P5G A;  1OVQ A;  2KZZ A;  2IIR A;  3DLE A;  3G25 A;  1BCM A;  4DV2 K;  3SUN A;  1J9A A;  3L3U A;  1Z05 A;  3S3N A;  1U6Z A;  3O4Q A;  4I7F A;  4CW7 B;  4JKB A;  5KPR A;  2FSJ A;  4PKI A;  5CYM A;  3CIP A;  3MEG A;  4BRG A;  3WXL A;  3LP1 A;  2YHX A;  5JVH L;  4K25 A;  1WB9 A;  4FWM A;  2VWJ A;  3CYG A;  1XC3 A;  1KTQ A;  2YCH A;  2IGI A;  1WSF A;  4IOX A;  4FJJ A;  4AHV A;  2KKZ A;  3UKU B;  3K59 A;  3CER A;  4BR5 A;  5C0Y A;  4LY7 A;  4GVE A;  3CXC M;  4HTL A;  2BUP A;  1BUP A;  2IC3 A;  4DTO A;  5JVG L;  4F3O A;  4KTW A;  1X9J A;  2Q97 A;  3R6M A;  4CEA A;  4ZTF A;  1EWQ A;  4JI0 K;  4CE9 A;  2ASM A;  1BOT O;  1UWB A;  1RT5 A;  3MDQ A;  1Y97 A;  3GE1 A;  5DM6 L;  2ZJR L;  3LWM A;  4M3Z A;  4ZTJ A;  2IDO A;  3LPT A;  3I33 A;  3EZW A;  1CLQ A;  1L3V A;  1LW2 A;  3WXK A;  4DB3 A;  3VQD A;  4JS4 A;  2GEM A;  1GLE G;  3NE6 A;  4RWT A;  3L2W A;  4M45 A;  1FKP A;  2A41 A;  1BI4 A;  3M1F A;  3CC4 N;  3TAP A;  4CJK A; 
#chains in the Genus database with same CATH homology
 4H0Y B;  4MLE A;  4CZH A;  4A57 A;  3UB5 A;  4JHD A;  4CZL A;  4WF9 L;  5LY3 A;  4CZK A;  4XH5 A;  3TTF A;  4FL9 A;  4XH1 A;  3TU5 A;  5AQG A;  1Q81 O;  2NZT A;  5F1X A;  5CR4 A;  4B1V A;  2NNW A;  4IDH A;  4MO4 A;  2D0O A;  4NB4 A;  4JEP A;  3VES A;  4JNE A;  3L6Q A;  1GLJ O;  1Q82 O;  1ATR A;  3UKR B;  2QM1 A;  5FPM A;  1YVN A;  4BR0 A;  1VQN N;  3DXK B;  3L4Q A;  1LCU A;  2P9S B;  2QI2 A;  3LDN A;  5BRH A;  5LJV A;  1G99 A;  3CC7 N;  2C1G A;  1QQM A;  3M6G A;  3CJ7 A;  4PHT X;  1K8K A;  1KC8 O;  1QQO A;  3AAQ A;  3T7Z A;  4H0P A;  3E9L A;  1VQP N;  3VEY A;  2NLX A;  2F9W A;  4U67 L;  1BDG A;  1S22 A;  2F7T A;  3MX5 A;  2QWP A;  4I6M B;  3CJA A;  3UKU A;  2YJF A;  2H3G X;  4IJN A;  3MCA B;  5AQQ A;  1JJ2 M;  1JCE A;  4IFE A;  4WQ5 C;  2ZF5 O;  3ULE A;  5C2D A;  5JMV A;  1NGD A;  3WXM B;  4BRO A;  1KXP A;  3D2F B;  5BRF A;  4XJX A;  2IVO A;  3W3D A;  2AA4 A;  1TUU A;  2FLO A;  1MA9 B;  3H1Q A;  3O9U A;  4M63 C;  2VYP A;  3VEX A;  1NLV A;  4DQ8 A;  1X3M A;  1ATS A;  2JWL A;  3PIO L;  1VQL N;  3R9P A;  3F5T A;  3SBT A;  2E2Q A;  1VQ7 N;  4O5F A;  3MWT A;  1O13 A;  3B8A X;  2P9P A;  3E9P A;  4A5B A;  1SAZ A;  3O1W A;  2ASP A;  2IVP A;  2NRT A;  2CH6 A;  3CCL N;  3D7E O;  3SJH A;  1YJ9 N;  1KAY A;  1QZ6 A;  5JIC A;  4GV6 A;  2P9I A;  2D1K A;  3AAP A;  4B1Y B;  1NGH A;  3M5R A;  4IOA L;  5M1P A;  3C7N A;  3GL1 A;  2PBD A;  4PL8 A;  5AQO A;  3CCU N;  4GV3 A;  4H5V A;  2QWN A;  5AFU H;  4MDA A;  4BRP A;  3VEN A;  4IO9 L;  4LC9 B;  3OBY A;  3O6W A;  5MLC Q;  2I7P A;  2YHY A;  3WEE B;  4WFB L;  1HUX A;  3P4I A;  4BC2 A;  3I55 N;  1YIJ N;  2QW9 A;  4G9Z A;  2A3Z A;  1NGE A;  1VAZ A;  2BTF A;  4EFH A;  3SAF A;  3CJ9 A;  4BRQ A;  4BC3 A;  2GX9 A;  3C6H A;  5AQF A;  3IUC A;  5GIN A;  4YOV A;  1VQ8 N;  1SQK A;  4JKH A;  3WT0 A;  4GV9 A;  1HLU A;  5AQU A;  2Q1N A;  3ID8 A;  4BRI A;  4C23 A;  1BU6 O;  3TTD A;  3DXM A;  3QB0 A;  4CZE A;  1GLD G;  3DWL A;  5GAD P;  4YOR A;  3I8B A;  5EOY A;  4EHU A;  4YOX A;  4ILH A;  4CBX A;  5AFU A;  5M1N A;  4YOT A;  3E9O A;  3CF5 L;  3ZEU A;  4GY2 B;  3UKR A;  3CJB A;  3P39 A;  3ATU A;  3DXK A;  3KVG A;  4BR2 A;  2P9S A;  3IFR A;  3S41 A;  4F9O A;  1Z6R A;  4ILJ A;  3CC2 N;  3VGK A;  1MWK A;  4MDB A;  4YOW A;  4WQ5 A;  3VF4 A;  3W0L A;  3ATV A;  1NGG A;  3H3N O;  4JN4 A;  4BRE A;  5BRE A;  3IKM A;  4I6M A;  3TTC A;  4BRD A;  4FWP A;  2A40 A;  4A2A A;  2ZJQ L;  1T6D A;  3SAH A;  5ADX H;  1CZA N;  3AGR A;  4WQ4 C;  3I56 N;  2CGJ A;  3TSU A;  3SMP A;  3ZX2 A;  2VGM A;  1K9M O;  4CZI A;  2GWK A;  5AQM A;  3O9R A;  4KH6 A;  1TYQ B;  3CD6 N;  2BH1 A;  3QFU A;  4CBW A;  4B1Z A;  5GIP A;  5KPZ A;  2D0P A;  1BA0 A;  2I7N A;  4PKG A;  3EO3 A;  3QFP A;  2P9K B;  5AQL A;  3VTI A;  2W00 A;  5AQH A;  2GEL A;  5EY4 A;  2DPN A;  3WQT A;  3VF6 A;  4FPB A;  4QS7 A;  5BN9 A;  5AZJ B;  3O9Q A;  4BGB A;  1DKG D;  1D4X A;  3O80 A;  4BRN A;  2QWQ A;  1ZXO A;  4IEE A;  1QQN A;  4FWK A;  1VQ5 N;  2HBL A;  4A61 A;  3H6E A;  4OPH A;  1E4F T;  1KAZ A;  5ADX A;  3CCV N;  3ENO A;  5F2R A;  4H0X B;  3ID6 A;  2A6A A;  3VOV A;  3AY9 A;  5FPN A;  2PAV A;  3LL3 A;  5M1Q A;  3FGU A;  4BQL A;  1RFQ A;  3G4S N;  3CQY A;  3H3O B;  4BY9 C;  3ENH A;  3FFK B;  3WEE A;  4JKF A;  4A5A A;  3CCS N;  1SZ2 A;  3CJ1 A;  5AZI B;  2E1Z A;  3CCQ N;  1KQS M;  4IJA A;  2Q36 A;  1RGI A;  1HKB A;  2NRV A;  4H5R A;  3HOS A;  2E20 A;  3WXI A;  3LDL A;  4WCE L;  4OPA A;  3QIC A;  5BPM A;  1ILY A;  4H03 B;  4BG9 A;  1N8R O;  1T6C A;  2CGK A;  3HTV A;  5LJW A;  1Q86 O;  4H0O A;  1DGK N;  5AQY A;  3U9D A;  1S72 N;  2HBJ A;  2NRH A;  3T69 A;  2NRX A;  5F0X A;  3LM9 A;  5AQK A;  3F9M A;  2QTD A;  3KZB A;  3MN7 A;  1OVY A;  3EN9 A;  4CZJ A;  1K8A O;  4L3Q A;  1YJN N;  3A8Y A;  4O8K A;  1Q7Y O;  4CZM A;  2GTD A;  1VQ9 N;  1GLF O;  1EQY A;  2HST A;  3P38 A;  4E1J A;  1DEJ A;  2D4W A;  2GUP A;  3Q7B A;  2QXL A;  3HM8 A;  4FOE A;  4R79 A;  4FWQ A;  4BE7 B;  1GLB G;  3OA9 A;  3C0B A;  5AR0 A;  3HOT A;  4DKW A;  3D2E A;  1GLL O;  2P9L B;  1K73 O;  3TPQ A;  1T44 A;  2Q0U A;  3ZX0 A;  3E1Y A;  4UY8 O;  1NGB A;  5GIO A;  4WQ4 A;  3PIP L;  4JD2 B;  4JK9 A;  4RTF D;  2E2O A;  3OHR A;  1IJJ A;  4K42 A;  4OO1 J;  5KQ8 A;  5C10 A;  1NGJ A;  4Y0W A;  3PLA A;  5TKY A;  4CBU A;  4YOU A;  3JXU A;  3F2K A;  4M7Y A;  3BF1 A;  3O9S A;  1C0F A;  1HKC A;  1TYQ A;  4NLC A;  5C15 A;  3CI5 A;  2NRW A;  4ISF A;  4BRL A;  1QZ5 A;  4IZ9 A;  3U9Z A;  3VEW A;  3HZ6 A;  4IO8 A;  5AQT A;  3L0Q A;  4AM7 A;  1HKG A;  1M1K O;  5EXW A;  2QEX N;  4BEB A;  4O8U A;  5AQJ A;  2P9K A;  2E8A A;  3O5B A;  4KBO A;  1EO1 A;  5BRD A;  4KH4 A;  4FVU A;  2Q2R A;  2A5X A;  2FSK A;  3FZM A;  3HBT A;  2V51 B;  2NRZ A;  5AZJ A;  5B8H A;  4XH4 A;  4BC4 A;  3AGK A;  3VMF B;  3WXJ A;  5CHI A;  5DM7 L;  1ATN A;  4JK8 A;  4BQZ A;  3KWI A;  3RVC A;  1BA1 A;  1GLC G;  3E66 A;  3H1V X;  1ZC6 A;  3MN5 A;  1NGI A;  1JCG A;  2P9N B;  2E2P A;  3QBW A;  3RSE B;  1QVG M;  2E88 A;  1WUA A;  4BVP A;  3VEO A;  5M1K A;  1K8K B;  2ZWH A;  3FZF A;  4FWS A;  1YIT N;  4IOC L;  4YDU C;  5BPN A;  4DCH A;  2QWM A;  4B1W B;  4WYB A;  4EHT A;  5AQS A;  4ILG B;  1VQK N;  3LDP A;  1SS6 A;  3JS6 A;  2ITM A;  1ZBS A;  2J4R A;  3A5N C;  1GLA G;  3CPE A;  5AZI A;  3ULE B;  3WUH A;  2OTJ N;  1U2V B;  4EIA A;  5AQN A;  3KWG A;  3M3Z A;  2WC9 A;  2HBM A;  4AF1 A;  2HOE A;  4ISE A;  4BEC A;  3J7Z O;  1V4S A;  3HI0 A;  2HMP A;  3DLL L;  4FWR A;  3SMS A;  1YJW N;  2VCP A;  1YAG A;  4HWI A;  1YI2 N;  3VF2 A;  3NVK A;  3VGL A;  3D2F A;  3EKS A;  4M7X A;  3VPZ A;  2HF3 A;  1NM1 A;  2RE2 A;  3FZL A;  4NO7 A;  3H46 O;  2WFB A;  4BC5 A;  2IVN A;  5AQV A;  2FF6 A;  4J8F A;  4JKD A;  5JLF A;  3K9J A;  1S3X A;  1VQ6 N;  4C1N I;  5EVZ A;  2P9I B;  2YI1 A;  3MWP A;  3WQU A;  4JKA A;  3NMU A;  2EWS A;  3CHW A;  3HSC A;  3R3L A;  3C7N B;  1T3V A;  3U8X A;  3N4P A;  3CJC A;  3CCR N;  3DJC A;  3SK3 A;  1HX1 A;  2F9T A;  3Q7C A;  5FPE A;  3KK7 A;  4C1N K;  2VGN A;  1Q18 A;  3MCP A;  5C2F A;  4WFN L;  4JD2 A;  4FWO A;  2FSN A;  4BRC A;  2E2N A;  4EAH D;  4H0T B;  3VTH A;  4CZG A;  1NJI O;  3A5M C;  1NMD A;  5AQX A;  3HRG A;  3J8A A;  3TSQ A;  5HOO A;  3CCJ N;  1HPM A;  4MO5 A;  1KD1 O;  5TKW A;  1QHA A;  3CCM N;  2HBK A;  2KLA A;  3SAG A;  4DHY A;  1VQO N;  4H5T A;  4QS9 A;  4U7B A;  1YUW A;  2NRR A;  1XUP O;  3P31 A;  4Z94 A;  3O1B A;  3CMA N;  3C6A A;  3A5O C;  4CI6 A;  2Q31 A;  2QWL A;  4A59 A;  3R1X A;  1R59 O;  1P90 A;  1V4T A;  3DXM B;  2CGL A;  2KHO A;  3QBX A;  4PKH A;  4ISG A;  5E84 A;  2FF3 B;  1MWM A;  1DT9 A;  2P9U B;  5M1F A;  1QVF M;  3ZET B;  4FSV A;  4JKG B;  3ZEU B;  3NVM A;  3L4I A;  3BF3 A;  4H0V B;  2V7Y A;  3LM2 A;  5FPD A;  4BRA A;  1BG3 A;  2P9N A;  4YDU A;  3RSE A;  3OW2 M;  3GOI A;  3CCE N;  3G6E N;  3SBG A;  2A42 A;  3N4Q A;  3ZX3 A;  2PFU A;  3H45 C;  3AAR A;  3TSP A;  1VQ4 N;  4BR7 A;  5HL7 L;  3K9K A;  3FE1 A;  5BN8 A;  1JCF A;  5C12 A;  2OTL N;  2ASO A;  4FPA A;  3A0I X;  3VGM A;  3CQX A;  4BRH A;  3MK6 A;  3LDO A;  4FWN A;  4B1X B;  1U2V A;  3FR0 A;  4AM6 A;  1YXQ A;  1C0G A;  1RDW X;  3O8M A;  1RDU A;  3U4L A;  1NWK A;  2V7Z A;  3A5L C;  3GG4 A;  5GAH P;  2GWJ A;  2QWO A;  4K41 A;  3GDQ A;  4FWL A;  1HJO A;  4BRM A;  2ZGZ A;  2Q0R A;  3G71 N;  2OAN A;  4IEI A;  3EL2 A;  5AQR A;  3ZYY X;  5KQD A;  2C1I A;  4BG8 A;  3O08 A;  1W97 L;  3LDQ A;  4KH5 A;  2HF4 A;  4JKC A;  1XQS C;  4JHD B;  2VWB A;  5AQP A;  4BRK A;  2YJE A;  3MN6 A;  1Y64 A;  2W40 A;  2IIR A;  5M1O A;  3BUZ B;  5GAE P;  3G25 A;  2YX6 A;  3EE9 A;  3IMX A;  4H5W A;  1LOT B;  2RHK A;  3FZH A;  5E26 A;  1TUY A;  3MMV A;  5AQI A;  5KPT A;  1Z05 A;  3O4W A;  1U6Z A;  3QML A;  1E4G T;  5JLH A;  5EX5 A;  1J6Z A;  4JKB A;  4FOI A;  4CJ7 A;  1NGC A;  4CD3 A;  5BR9 A;  5KPR A;  2FSJ A;  2CH5 A;  3CIP A;  3QDK A;  4PKI A;  4QS8 A;  3WXL A;  4BRG A;  2YHX A;  5JVH L;  1NBW A;  4K25 A;  1YF5 L;  4FWM A;  5H1S Q;  1XC3 A;  4XEI A;  4A62 A;  2YCH A;  4IOX A;  2FXU A;  2UYT A;  4B9Q A;  4JKE A;  4B1U B;  3EE8 A;  2V52 B;  2KKZ A;  3UKU B;  3VEZ A;  3CER A;  3CPW M;  1KAX A;  3BEX A;  5AQW A;  3R8E A;  4BR5 A;  1NGA A;  3FLC O;  5AQZ A;  4PL7 A;  4GVE A;  3CXC M;  4HTL A;  2JWK A;  2BUP A;  4K43 A;  1BUP A;  3KHY A;  3MN9 A;  2WBN A;  3MX2 A;  5JVG L;  3VER A;  3C65 A;  1X9J A;  3SLC A;  2Q97 A;  3R6M A;  2P9U A;  5I9E B;  5C0Y A;  4JAX A;  3ZET A;  1OKJ A;  4JKG A;  4YOY A;  5CE3 A;  4GNI A;  3CME N;  4MLH A;  2ASM A;  1BOT O;  2WUS A;  3MDQ A;  2P9P B;  5BPL A;  4NLB A;  1X3N A;  3GE1 A;  4IWV A;  5DM6 L;  2E1Y A;  3EKU A;  2ZJR L;  4CZF A;  4CD1 A;  3D2E B;  3VEV A;  4BRF A;  3VET A;  5ELZ A;  3I33 A;  1BO5 O;  3EZW A;  1W2B M;  1MDU B;  1H1V A;  3OBW A;  2ZJP L;  3BP8 A;  4BR4 A;  3WXK A;  2QA4 N;  4DB3 A;  2P9L A;  3ENB A;  2QWR A;  2ZGY A;  4IXC A;  3FZK A;  3D6R A;  1NGF A;  4WFA L;  4A2B A;  4BR9 A;  1VQM N;  2GEM A;  1GLE G;  4JK7 A;  1YHQ N;  2W41 A;  3CET A;  1ESV A;  3UE5 A;  4RWT A;  1BWF O;  4FO0 A;  3DAW A;  5GAG P;  1P8Z A;  1WOQ A;  1M90 O;  4BGA A;  2A41 A;  2YHW A;  3GBT A;  3M1F A;  4H5N A;  3IDH A;  3O9T A;  3CC4 N;  2AP1 A;  1IG8 A;  4RCH A;  4BVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...