2P9IA

Crystal structure of bovine arp2/3 complex co-crystallized with adp and crosslinked with gluteraldehyde
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
410
structure length
393
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 131
structure length 393
sequence length 410
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9iA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9iA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9iA03
5AQWA 2EWSA 4KBOA 4CZKA 2ZGYA 4FWOA 3R9PA 4CZIA 4FWNA 2QWRA 2QWNA 2QWOA 4BRDA 2W41A 5E84A 4H0YB 3FZLA 3WEEB 4HTLA 3LM9A 2NLXA 4WQ4A 3HTVA 1TUUA 1K8KB 3VGMA 1DGKN 2P9NA 1DKGD 3DJCA 3LL3A 1V4SA 2HMPA 1XQSC 5BRHA 3KHYA 2P9UA 2P9KA 3H1VX 4C23A 2YJFA 3DXMB 3VF6A 2NRHA 1GLAG 4RCHA 5EXWA 3CERA 5LJVA 3OHRA 5B8HA 2I7NA 2D0PA 4CBWA 2ASOA 4FPAA 5AQIA 3VERA 4EHTA 4BR9A 2IVPA 3VESA 3O80A 4BRLA 2I7PA 4XH1A 4H5RA 3WT0A 4FPBA 3BF3A 3FE1A 3QICA 5ADXH 2GWJA 4BRQA 3SLCA 4H0TB 3GBTA 4BRGA 2E2QA 1GLCG 3L6QA 4FWKA 1S3XA 1KAYA 3LDLA 3UKRA 3WXIA 4O8KA 3CQXA 2QWPA 1T6DA 4GY2B 3J8AA 3O5BA 3VOVA 2UYTA 2V52B 4K25A 2Q0RA 3G25A 3VEWA 2FSKA 3IUCA 1WUAA 4EFHA 1TYQB 1IJJA 1RDWX 2CH5A 3ZX3A 1KAXA 3AAPA 4JD2A 1NGAA 3D2FA 4CBXA 3D2EB 2A42A 1QZ6A 2FLOA 3ZETA 3GOIA 2VCPA 5JICA 2ITMA 4A61A 3MN6A 3S41A 5AQXA 1NGJA 1IG8A 2J4RA 2Q2RA 4IWVA 2OANA 3O6WA 1HUXA 2HF3A 2E1ZA 5EOYA 2FF6A 5AR0A 3SK3A 1NLVA 2Q0UA 2IVNA 3VF4A 3HI0A 1BU6O 3HZ6A 5F2RA 4DCHA 4PKGA 5JMVA 4F9OA 2Q36A 4JHDA 3CJ1A 4IJAA 1CZAN 4ISEA 2PAVA 3WEEA 4MLHA 2HOEA 2P9IB 4BC5A 1NBWA 1ESVA 4BQZA 1HKCA 4B1UB 5JLHA 2P9SA 2H3GX 3H45C 5BREA 5KQDA 2FSJA 1Q18A 1XC3A 2P9LB 3ULEA 5CE3A 2CGLA 1BDGA 1BO5O 4QS9A 3M3ZA 5AQVA 1Z6RA 2E2OA 5EX5A 5AZJB 4AM7A 1RGIA 3WQTA 3H6EA 3VEZA 1ZXOA 3QB0A 4MO4A 3F9MA 3FZFA 3FLCO 2E88A 3ZX2A 3LM2A 4EAHD 1C0FA 4FWQA 1C0GA 1ATSA 1NGDA 4BG8A 4O5FA 3FGUA 2YHWA 5BRDA 1U2VA 5FPMA 1KXPA 2D0OA 3O1BA 1E4GT 3M6GA 4JN4A 4FO0A 2E20A 3U4LA 3MN7A 5ADXA 3ENHA 3LDNA 4WQ5C 3FZKA 2ASPA 1E4FT 3HSCA 1MWMA 1U6ZA 1BA0A 2QW9A 3IDHA 3VEOA 5FPDA 3L0QA 4CD3A 1GLEG 2NZTA 1H1VA 2P9PA 1XUPO 4I6MB 3DXKA 3WQUA 3GE1A 3A5LC 3H3OB 4FOEA 3ZEUA 4HWIA 2KHOA 4BRKA 3VF2A 2IIRA 2YJEA 3I33A 1KAZA 5BPMA 3HM8A 4BVOA 4K42A 1YVNA 5AQQA 1R59O 4XH4A 3WUHA 2VYPA 4PL8A 3SJHA 2QWMA 1GLDG 5AQNA 4FL9A 5LJWA 1MA9B 2CGKA 5TKYA 2A5XA 4B1YB 1HKGA 1LOTB 2CGJA 3O8MA 4WYBA 3QFUA 2E1YA 5AQFA 1NGGA 3A0IX 4CZHA 4QS7A 4BR2A 1HJOA 4YDUA 5F1XA 2P9LA 3H46O 3IMXA 3MMVA 4BR4A 4XEIA 2ZF5O 1G99A 4BROA 1SAZA 2ASMA 2YCHA 3CI5A 4CZGA 3VEVA 2QM1A 4E1JA 1BWFO 1ZBSA 1V4TA 3RSEA 3UB5A 5AZIA 2A41A 3CJBA 3H1QA 3EO3A 5KPTA 4IXCA 5KQ8A 2V7ZA 4IJNA 1SQKA 5BN9A 4L3QA 2P9NB 2W40A 4FWMA 4H0XB 4CZMA 4BRAA 2WUSA 5AQHA 4BRNA 4FSVA 1QHAA 1YAGA 4K41A 3VGKA 2P9UB 2P9KB 3BP8A 1ATRA 2GELA 3UE5A 3QBXA 3LDOA 3BUZB 3VENA 1ZC6A 4AM6A 1K8KA 2E8AA 1NGHA 3GL1A 1P8ZA 3QDKA 1ATNA 4M7XA 3U8XA 4M7YA 4BRPA 3UKUB 4WQ5A 2HF4A 4A2BA 1EQYA 4BRFA 3ID8A 5AQZA 1X9JA 1HX1A 4QS8A 3HBTA 3DXMA 2FF3B 2Q1NA 3ATVA 5AFUA 2QWQA 1J6ZA 4DB3A 5BPNA 1GLBG 1NGCA 3MDQA 4LC9B 1S22A 3ATUA 4H5TA 1JCEA 3L4IA 3UKRB 5BRFA 4RWTA 2GUPA 4JAXA 5FPEA 1NMDA 1NGFA 3CETA 5AQMA 4MO5A 4H5NA 3SMSA 1OKJA 4H5VA 2VWBA 1JCGA 4FWRA 5AFUH 3U9DA 4DQ8A 3GG4A 4ISGA 4JD2B 4B9QA 3VETA 3D2FB 2D4WA 3ZETB 1Y64A 3B8AX 3C0BA 3QFPA 3EKUA 4BRCA 3WXJA 1T6CA 2A40A 1TYQA 4BVPA 1NGBA 2ZWHA 4BG9A 4FWSA 4FOIA 3EL2A 3D2EA 2DPNA 1BA1A 4BREA 3KVGA 4CZJA 4M63C 3C7NB 4PKHA 5AQTA 2FSNA 4PL7A 4B1WB 2YHYA 2F9TA 1X3NA 4H5WA 3P4IA 3A5MC 4BR7A 3VEYA 3W0LA 1BG3A 2IVOA 4JHDB 4GNIA 5JLFA 3D7EO 4BRIA 3AARA 1YXQA 3WXLA 5KPZA 2CH6A 2Q97A 2D1KA 2PBDA 1QQMA 2V7YA 3CJ9A 3O1WA 5F0XA 2P9SB 3DAWA 5ELZA 1T44A 5AQUA 3QBWA 3JXUA 3EKSA 1QQNA 3CHWA 3LDQA 4CZLA 1D4XA 1BOTO 1X3MA 2P9IA 2QXLA 3FZMA 3ULEB 3EZWA 3SMPA 4IO8A 4RTFD 2FXUA 3UKUA 5AQGA 2Q31A 5BPLA 4BC2A 2V51B 1HLUA 4H0PA 4PKIA 1GLJO 4BC4A 1HPMA 1NWKA 4BR0A 3LDPA 5FPNA 2AA4A 4Z94A 4BRHA 5EVZA 5I9EB 2A3ZA 4B1ZA 1NGEA 2QWLA 1MDUB 4K43A 4Y0WA 1QZ5A 3CJAA 1GLLO 5AZJA 1NM1A 3A5NC 3QMLA 4J8FA 5KPRA 4CI6A 4DHYA 1Z05A 1U2VB 3MK6A 4EHUA 3DWLA 1JCFA 3EN9A 3R8EA 4CJ7A 4NO7A 3MN5A 3U9ZA 1TUYA 4BRMA 4WQ4C 2GEMA 4H0OA 2F9WA 5E26A 4A62A 3CJ7A 3AAQA 5BN8A 1BUPA 4FWPA 2GTDA 3BEXA 3KZBA 3ENOA 2AP1A 2P9PB 3A5OC 3IFRA 2E2NA 3DXKB 3TU5A 5AQOA 1RFQA 3FR0A 3O08A 3I8BA 4EIAA 1MWKA 3ZEUB 3CQYA 1NGIA 3BF1A 3C7NA 5AQJA 3WXKA 4XH5A 4A2AA 5LY3A 3R6MA 3GDQA 1LCUA 3A8YA 3MCPA 3TPQA 4CD1A 3JS6A 5AQRA 4B1XB 1SZ2A 3M1FA 3ZX0A 4FWLA 1DEJA 3CIPA 3CJCA 4BQLA 2YI1A 4I6MA 4H0VB 5BR9A 2E2PA 2BUPA 4IZ9A 2ZGZA 3O4WA 4BGAA 5EY4A 1WOQA 5AQYA 2GWKA 3W3DA 4CBUA 4CZFA 5AQKA 5AQSA 4NB4A 3VGLA 1YUWA 3FZHA 4BGBA 3VEXA 4MLEA 4YDUC 4BR5A 2BTFA 2YHXA 4BC3A 2A6AA 5AQLA 3RSEB 5AZIB 4CZEA 1GLFO 3H3NO 4JNEA 4H03B 1HKBA 3VPZA 3MN9A 4ISFA 3FFKB 5AQPA 4B1VA 1QQOA 3AY9A
chains in the Genus database with same CATH superfamily
4DQSA 3V9SA 3HPHA 2EWSA 2ZGYA 4CJRA 4CZIA 2Y1JA 3K5NA 2Z1IA 4WFNL 2DTUA 2QWOA 4Z4FA 3B6OA 4H0YB 3J80O 3WEEB 3AVNA 4E19A 2A1RA 3LP1A 1TUUA 2P5GA 4E3SA 2P9NA 3DOKA 3JYTA 4DF8A 2O8BB 5BRHA 3H1VX 4C23A 4JS4A 1SL1A 1HNXK 4RG8A 3DXMB 3TAEA 3O9SA 1KVAA 5B8HA 1EO1A 2D0PA 1WAJA 3VQ6A 1REVA 1YIJN 2G8FA 1EX4A 4CIEA 3SPZA 4M3YA 3VESA 4DG1A 2YNFA 2ZE2A 5EU7A 4XH1A 4OO1J 3FE1A 4F3TA 4RW7A 4YOVA 1QQCA 1RDBA 2GWJA 2IAJA 3SLCA 1NK4A 4BRGA 3L6QA 4I7FA 4IO9L 3WXIA 2UU9K 4BE7B 1TGOA 4J2DA 2QWPA 3THXA 1EXQA 4GY2B 3AVAA 3RRHA 1TYQB 1RDWX 2O4GA 1K73O 4C8LA 4OGCA 3QETA 3DI6A 1QZ6A 3ZETA 4ZHRA 4M3WA 2VCPA 2ITMA 1BQNA 3QO9A 3S41A 5AQXA 1IG8A 2VWJA 2F96A 5J2MA 2G8VA 4DQQA 1SUQA 2XY6A 4EZ9A 4DR3K 2HF3A 3V9WA 4KRFA 4CESA 1NLVA 1BU6O 3HZ6A 4MQ3A 2X78A 1P90A 5CZ2A 1CZ9A 3DLEA 1S5JA 2HOEA 2F7TA 4DLGA 4CJUA 1JLCA 4CJSA 3KWIA 2O8CA 3L8BA 3THYB 4OKJA 5BREA 1SL0A 4DQRA 4DV2K 1Q18A 4R5PA 4CFDA 3QEXA 3ZCMA 2XRIA 1BO5O 1E3MA 3VQDA 3L2VA 1UA0A 4FW1A 3PX4A 2HB5A 5EX5A 5HRNA 2HHIA 3H6EA 1RBVA 1ZXOA 2HHWA 5HRSA 5GAHP 3TTCA 4DV1K 3P38A 3Q7CA 3LM2A 2UUBK 4EAHD 2DFEA 3PX6A 4CJ3A 1C0FA 5C0YA 1GOCA 4O5FA 3TAMA 3FGUA 2YHWA 5FROA 4CGFA 5BRDA 3AO3A 2RKIA 2D0OA 3MEDA 3O1BA 1RCHA 4E7IA 2OPSA 3HVTA 1KQSM 3LDNA 3VEOA 1IG9A 1GLEG 2RHKA 2P9PA 4CFAA 1XUPO 4DR2K 5J2NA 3A5LC 3A2FA 1F21A 2FBVA 1BQMA 5J1EA 1WSFA 2KHOA 3OYEA 4LFAK 1KAZA 3KLGA 3HM9A 4KHSA 3NH2A 4CE9A 5AQQA 4CHYA 4B8CA 1R59O 4CGGA 1YF5L 4FL9A 3QLHA 3TARA 5LJWA 5TKYA 2FBYA 4UQGA 1LV5A 3WNHA 3AGKA 2E1YA 1RDDA 5KI6A 3A0IX 3TSUA 4QS7A 1M1KO 1S1XA 3G71N 5GAEP 3AVHA 4JK7A 4B9TA 4AF1A 1VSEA 3MMVA 4IG0A 4KH5A 4FCYA 4KHWA 3WNFA 2XHBA 4N56A 1SS6A 3SUNA 3NF6A 2QM1A 4E1JA 1BWFO 1V4TA 4DV7K 1ITGA 1Q86O 1NK5A 5HROA 1SL2A 4O8UA 4GKJK 2W40A 1Z25A 2X74A 4YOTA 3VQEA 3CMAN 5AQHA 4BRNA 1QHAA 1YAGA 4F2SA 3VGKA 1SKSA 2P9KB 3TSPA 3AVCA 3M8RA 3DLGA 1RTHA 2XY8A 3UE5A 5KGXA 3F2KA 3VENA 1K8KA 4Q0BA 4M7XA 3U8XA 2E8AA 1NGHA 1ATNA 3QIPA 4WQ5A 1C0UA 3NGZA 2G8IA 3SI6A 4ID1A 5AFUA 2QWQA 4NLCA 4IKFA 1JL2A 4CHNA 3L4IA 4KHNA 1TK0A 5C10A 1RBSA 1UAXA 3ALYA 1KC8O 5FPEA 3CETA 1NGFA 4H5NA 2EX3A 1NKEA 3OYGA 4O0IA 4KTWA 5C24A 2VG7A 2GX9A 4JD2B 1ILYA 3VETA 3D2FB 3BDPA 1N6QA 1YVUA 1S1WA 3VQ4A 4B3OA 1NJZA 2FBTA 3QIOA 4A5BA 2WC9A 3HT3A 2LSNA 4CEFA 5KTQA 4CVNE 4BVPA 2WFBA 1NGBA 2DFFA 2ZWHA 4DU1A 4C1NI 1WSJA 1YT3A 1JLGA 4FOIA 1BA1A 1W0HA 5JS2A 1DT9A 4M63C 4MDBA 4WF9L 4PL7A 2O8DB 4B9NA 1X3NA 3A5MC 1ASUA 3D7EO 3AARA 5HLFA 3IKMA 4DS4A 3SQ4A 3PY8A 1Q9YA 3QESA 1YJ9N 1WSEA 2WBNA 5AQUA 3QBWA 4L8RB 1FW6A 1VK0A 4CJKA 3HSTB 2KFNA 1TKTA 1X3MA 1JLFA 4JKEA 4IO8A 3SMPA 2FXUA 4OLAA 2KZZA 1JXEA 1JLEA 2Q3SA 4BR0A 4B08A 4CJEA 3B6PA 4XJXA 4Z4GA 3HRGA 4JLHA 1XI1A 3P83D 4IFVA 5HL7L 5EVZA 3ZSRA 2A3ZA 3J81O 4AILC 4FW2A 4KV8A 4X65K 1MDUB 5KRSA 1NM1A 1D5AA 4DTXA 3DLKA 3ZYYX 4O4GA 4ELTA 3AV9A 1Z05A 1HQUA 1HJRA 4FZXC 1TKXA 5TKWA 4BWMA 4CJ7A 1XNRK 4CJQA 1S6QA 3OYCA 3QEIA 2QK9A 3KTQA 2RPIA 4FJ5A 4GVEA 2AP1A 4BDZA 4A57A 3L2WA 3ZEUB 3CQYA 5AQJA 4CFBA 5C12A 1OH8A 3TPQA 5AQRA 4FWLA 3QEWA 1DEJA 1KRPA 4GV9A 2YI1A 3KKSA 3OYAA 3G0ZA 2DFHA 3P5JA 3VA3A 3L2RA 5C25A 4CJFA 1HNWK 3W3DA 2KW4A 4CZFA 2UUCK 2Z1HA 3AVKA 3RVCA 4FJJA 5GAGP 2VQEK 4E89A 2BTFA 1T03A 3RSEB 3P31A 5AZIB 1GLFO 3H3NO 4JNEA 4H03B 4ISFA 2G8KA 3NE6A 5AQPA 4DSFA 4B1VA 3AY9A 5AQWA 4YOYA 4DS5A 1I39A 4FWOA 3R9PA 2GUIA 4FWNA 2QWRA 3U6FA 2QWNA 3I56N 4X62K 1HMVA 4Y1CA 2KKZA 1S9GA 3D0PA 3BZKA 3LM9A 2NLXA 3DJCA 2W6KA 3LL3A 1V4SA 2HMPA 1XQSC 1NJXA 3CFPA 3EE9A 4I2PA 3KHYA 2P9UA 4HUFA 3KLIA 5DM7L 4LF4K 4KHYA 1EETA 3LAKA 2YKMA 4FJ9A 4B8AB 1O1WA 2NRHA 1GLAG 5EXWA 1XC9A 3L3UA 1NU0A 5AQIA 4UY8O 1NK8A 4CJTA 4FZYA 4FLUA 4O5BA 4BR9A 2IVPA 4JI6K 3K9KA 4EP4A 2I7PA 2E5LK 3T1YK 2HNZA 4GV3A 4NXNK 4FVUA 4BRQA 2VGNA 3GBTA 1Q8IA 4FWKA 1OH6A 3PIOL 3UKRA 1NJWA 3K5LA 4HUEA 4NLBA 1IBLK 3M5RA 1N36K 3VOVA 1L3VA 1RT5A 1K8AO 3AVIA 2NUBA 2HSTA 2Q0RA 2YV0X 3VEWA 4W5NA 3V9ZA 3VN5A 4C8NA 5I42A 1KAXA 3AAPA 2HHVA 4LH4A 2HHTA 3D2EB 2A42A 4E0DA 1FJGK 4DSLA 1NKBA 4KO0A 2C1GA 5JICA 3KK3A 1D9FA 4FJ7A 1BGXT 4I9LA 4JKGA 4XIUA 3AVFA 2PZSA 2Q2RA 3OYFA 3TABA 4CJWA 1QSYA 3RMBA 3SV3A 3SCXA 3S3NA 4CF1A 3NVKA 1DTQA 5HRRA 5EOYA 4M42A 3LANA 2FF6A 5AR0A 4DTSA 5F2RA 4Y1DA 2ATQA 1VQ5N 3THWB 1W7AA 4F9OA 2Q36A 4JHDA 2O8EB 4Z4IA 3CJ1A 3WEEA 2P9IB 3QEPA 5H1SQ 2ITGA 2UXBK 1YHQN 2QEXN 2P9SA 4FXDA 3CCLN 2H3GX 2ZQBA 2W00A 3C94A 2I5JA 3H08A 1XC3A 1QSSA 2P9LB 3RR8A 3ULEA 4DR7K 2P5OA 3OS0A 1BDGA 1J53A 1VRUA 3ZT1A 3NDKA 4QS9A 3M3ZA 3IG1A 4GKKK 5AZJB 3S3MA 3VEZA 1TAUA 4C8KA 4GW6A 2B6AA 3FLCO 1NMNA 1TAQA 3HXMA 4FJGA 4CJVA 3CD6N 1C0GA 1N33K 4DF4A 2IDOA 3ZSVA 1BL3A 3CC7N 2IC3A 3LWMA 1WNSA 4RW9A 1XHXA 3EYZA 3ZT2A 3T1AA 4LF7K 1KLMA 4WQ5C 2QW9A 1U6ZA 1BA0A 5FPDA 2HMIA 4EZ6A 1QVFM 2P1JA 3L0QA 4CD3A 2NZTA 3QNNA 3F73A 4I6MB 3DXKA 3VMFB 3H3OB 3LZJA 3JAMO 2YNIA 5BPMA 5SWMA 1KFDA 2QKKA 4XH4A 3WUHA 3KLHA 2PFUA 2B4JA 1GLDG 5AQNA 3R3LA 1MA9B 2CGKA 3RRGA 4B1YB 2CGJA 1TV6A 1U49A 2PY5A 4CF2A 4BE1A 2KTQA 3V1OA 4B3TK 1HJOA 1BI4B 1BCMA 3EEQA 1KSPA 1G99A 3CI5A 2YCHA 4DV0K 4IOCL 4DFJA 1S1VA 3LZIA 3SUPA 5KPTA 4IXCA 1RDAA 2V7ZA 1SQKA 3CG7A 2NRRA 2YNHA 1I94K 3LWLA 4L3QA 2P9NB 3OYBA 4FWMA 4H0XB 5C2FA 1R0AA 4FM2A 4FSVA 1QHTA 4ILGB 2NRTA 3BP8A 2HBJA 4FVMA 1LW0A 2GELA 4Z4EA 3QBXA 3LDOA 4DTUA 3MEEA 2YKNA 4M7YA 3UKUB 4A2BA 1BISA 4RW8A 4BRFA 1NJIO 1Q81O 4CIFA 4QS8A 1S1TA 2FF3B 3O9RA 4CK3A 1GLBG 1NGCA 4LC9B 3AO4A 4G1QA 4H5TA 3THVA 5DK5A 2VGMA 5M1NA 3THXB 4F2RA 4H5VA 5BR8K 4CEDA 3I55N 4FWRA 3CCMN 4DV3K 5AFUH 4DQ8A 2JGUA 3TI0A 3ZETB 4O0JA 1UOCA 3ENBA 3S5TA 3B8AX 3N4PA 3N4QA 3K9JA 1SKRA 3EKUA 4DFMA 4RW6A 5C2DA 1KCFA 3KK1A 4M41A 1WAFA 3CMEN 1YTUA 4FWSA 3LP2A 1W9HA 2DPNA 3LP0A 1C6VA 4BREA 3KVGA 2D5RA 3C7NB 5AQTA 1I3AA 2YHYA 3OJSA 1XNQK 4CEZA 4NYFA 3VEYA 1LWEA 2NRZA 4KREA 5T7BA 4X66K 1HNZK 4M3XA 5CZ1A 4BDYA 1RBRA 3VQCA 1BCOA 3V6DA 1YXQA 3WXLA 2CH6A 1BIZA 1CZBA 1N8RO 3O1WA 2O8CB 3CC4N 1UA1A 4DLEA 1L3SA 1RTDA 1QQNA 2X6SA 3U3GA 1D4XA 3FZMA 2QXLA 1TKDA 4RTFD 2PYLA 1DLOA 3PO5A 3PO4A 2GBZA 3RWUA 3OY9A 5AQGA 4NYNA 3HPOA 2V51B 1HLUA 4PKIA 3I8DA 4BC4A 2A1SA 1NWKA 4KHPK 3LDPA 3CCRN 2OCEA 3OYKA 1ASWA 5I9EB 3K5MA 4B1ZA 1C1AA 1RTIA 2QWLA 5A2QO 4Y0WA 4KHQA 4IOAL 3AVLA 2XY5A 1WSHA 2R7YA 4CI6A 4DR1K 4JS5A 3RMAA 3AO5A 2GV9A 1NK9A 2QI2A 2KLAA 3R1XA 4JI3K 3U9ZA 4ILHA 3E9LA 5E26A 4DTPA 4N41A 3VQ9A 1C1CA 2VG5A 4CFCA 1BUPA 2HHUA 3BEXA 3KZBA 4CEOA 3F5TA 3S3OA 1VQ6N 4M45A 3HYFA 1KVCA 3ENOA 4G9ZA 1VSLA 4DR5K 2P9PB 2XY7A 3IFRA 3K58A 1B9FA 3TU5A 3P39A 1RFQA 3FR0A 3VQ8A 1MWKA 2YHAA 4A2AA 4EIAA 3SBGA 3NVMA 3WXKA 3TAPA 3LPUA 3O3GA 1RILA 5LY3A 3R6MA 3GDQA 4ICLA 4BDPA 3O9TA 3C95A 4CD1A 1C1BA 2F8TA 4K8ZA 1YITN 1HPZA 3CJCA 3C6AA 4BQLA 2O8FA 2NRXA 5JVGL 1A5XA 2E2PA 3LDSA 1X9MA 3ZT0A 4IZ9A 3SUOA 2OPPA 3T7ZA 2ZGZA 5EY4A 3M8PA 3OBYA 2GWKA 2XO7A 5AQKA 4CEEA 4I2QA 2HHQA 3SYZA 3VGLA 3IS9A 3FZHA 3FFIA 3CYGA 4BACA 4YDUC 3TANA 1EP4A 2ZM6K 4YHHK 4DTNA 3KK2A 5I3UA 3CC2N 4CGIA 1LAWA 3TAGA 4KBOA 4CZKA 4HCBA 3NF7A 4FLXA 1JLAA 3CCUN 5FRMA 4BRDA 3OYHA 2QTDA 3FZLA 3CCVN 4JEPA 4DTRA 4WQ4A 1K8KB 1DKGD 2WOMA 4DQIA 3I0SA 1VSMA 1YTAA 4CF0A 4FJIA 3NAEA 1IKYA 4HHTA 4LH5A 5HOOA 4OX9K 2YJFA 4DV6K 5JENA 1W97L 3VF6A 2UUAK 4FJ8A 1XHZA 1ZBFA 1T8EA 3CERA 3OHRA 3TAFA 1KFSA 2ASOA 4FPAA 4EHTA 3CCQN 4IFEA 4E7JA 3IRXA 1WB9A 3OA9A 4YFUA 4H5RA 4QAGA 3WT0A 3BF3A 4NCAA 3K2PA 4AHCA 4JRPA 4H0TB 2E2QA 1GLCG 4LF9K 3BY5A 1S3XA 1KAYA 3DLBA 1RDUA 4DSIA 3CQXA 2VWKA 3J8AA 3O5BA 3NHGA 3G25A 1U4BA 3IUCA 4EFHA 1VQ9N 2G8UA 4OKKA 1IJJA 3ZX3A 1C0TA 1NGAA 3BGRA 2G8HA 4KI4A 1YJWN 2FLOA 4BWJA 2FC0A 2E6MA 3K5OA 3NF9A 1IO2A 3SPYA 4OPJA 2J4RA 3DRPA 2HVHA 4IWVA 3G6EN 1KLNA 1G15A 2UXCK 2E1ZA 3L2QA 2OA8A 4BEBA 3C6UA 3SK3A 3HJFA 2Q0UA 3HI0A 4DCHA 1XWLA 4PKGA 5JMVA 3LPTA 4AHTA 2D0AA 3SQ0A 4FLVA 2HHSA 2PAVA 4B3RK 3HPGA 4MLHA 4R79A 4CK2A 4JKCA 1ESVA 1TK8A 3V81A 4YOUA 1HKCA 4ELVA 4B1UB 4CJPA 2E4LA 3M8QA 1J5OA 1JLQA 2JLEA 3H45C 5KQDA 3HP9A 4TSXA 2FSJA 1X9WA 4CEAA 3KIOA 4YY3K 3O9UA 5CE3A 2CGLA 4JK9A 1K9MO 2YX6A 1L3TA 5AQVA 4YOXA 1C0MA 2VG6A 3QEVA 3ISNC 4AM7A 3WQTA 4KAZA 3QB0A 4MO4A 4DR6K 2YHBA 4LY7A 3ZX2A 3MEGA 4FLYA 3PUFA 4I9QA 4CGHA 3TWHA 4FLZA 4DR4K 3ZSQA 3SAFA 1IV0A 1T3VA 4FWQA 1ATSA 4BG8A 3MX2A 1JJ2M 5M1PA 1VQ8N 1U2VA 5FPMA 1WSGA 1KXPA 5M1FA 3SAGA 1E4GT 3M6GA 4FJHA 4FO0A 3MN7A 4CGDA 4KTZA 2ASPA 1E4FT 1TKZA 1MWMA 3HSCA 3LP3A 3EE8A 3OBWA 1IBMK 4N5SA 2G8WA 4DV4K 3HO1A 3O9QA 1EKEA 3GE1A 4DTOA 4HWIA 4KFBA 4BRKA 2IIRA 3I33A 3RMDA 3HM8A 4IFYA 4FJXA 4K42A 5GINA 1YVNA 4B3SK 3KD5E 4CHZA 3NH0A 5CHIA 4PL8A 4MFBA 3T19A 2QA4N 4FZZA 3S9HA 1CLQA 1VAZA 1X1PA 1HKGA 1LOTB 4WYBA 3QFUA 5AQFA 3P1GA 4DFKA 3RR7A 4CZHA 2ETJA 1ASVA 4KH6A 1VQPN 4BR2A 1TL3A 3TTDA 2Z1JA 4YDUA 4HVJA 5JS1A 1J5EK 3OYMA 2P9LA 5LL6Z 3H46O 5AJ3K 3VQBA 4XEIA 2ZF5O 3DRSA 1SAZA 5M1KA 3CFRA 3OYDA 4WFBL 5CR4A 3EY1A 2A41A 3CJBA 3TR8A 4OLBA 3H1QA 3EO3A 5KQ8A 3J7AP 1XMQK 4IJNA 1QVGM 4PWDA 5BN9A 1IKWA 3MWTA 3O3HA 2HNDA 4BRAA 2P9UB 3HOSA 2D0CA 1ATRA 4JI2K 1HR0K 1NK0A 1RT3A 1Q9XA 3BUZB 4B9UA 1ZC6A 4DUZK 3OVNA 4YOWA 3QDKA 2F8SA 2D0BA 3SUQA 1HNIA 4KH4A 2O8BA 1EQYA 4W5OA 3HBTA 3DXMA 1A5VA 4DWIA 3ATVA 5SZTA 4KI6A 1VSFA 5BPNA 4W5TA 3K0SA 3ATUA 3Q7BA 2WONA 3OS2A 4OPHA 1JCEA 5E41A 3UKRB 4CHPA 3KLFA 3EZ5A 3RMCA 4RWTA 4V19S 4JAXA 1ZBHA 4M3TA 3O4NA 1NMDA 3CM5A 2Y1IA 4MO5A 3SMSA 1OKJA 2VWBA 5IT9O 1JCGA 4ZTJA 4JV5K 1O13A 5GIPA 3U9DA 3GG4A 4ISGA 5JVHL 2ZJQL 4B9QA 4AHVA 4CCHA 1HRHA 4IDKA 4X64K 1WN7A 3OS1A 3C0BA 4OKEA 3QFPA 4BRCA 3WXJA 2A40A 2RF2A 1KTQA 3AO2A 1TYQA 4JKHA 3SBTA 3HP6A 1S9EA 1NK6A 4ZTFA 4A59A 5J2PA 4H8KA 5HP1A 3SJJA 4B1WB 1VSJA 4CF8A 2HHHK 4H5WA 3P4IA 1RBTA 4KTQA 4WE1A 2IVOA 2RN2A 4JHDB 5MLCQ 4GNIA 5JLFA 1LAVA 4Q5VA 4BRIA 4JKBA 3SQ2A 3L4QA 2E6LA 2Q97A 4JI5K 2ZJPL 2V7YA 3SAHA 2UXDK 5F0XA 1RT2A 2P9SB 3CCJN 4C8OA 2NNWA 4CF9A 2OPQA 1T44A 3CHWA 3LDQA 4M3UA 4FM1A 4K0KK 3ULEB 1VHXA 3EZWA 4A5AA 3E9PA 4F4KA 4DU4A 3UKUA 3CF5L 3DRRA 5BPLA 2BDPA 4BC2A 2HNYA 1HPMA 1RNHA 3THYA 3JSMA 4Z94A 3AVJA 4BRHA 3V4IA 3CPEA 2VQFK 2IGIA 4NXMK 4E1NA 1NGEA 3NGIA 3SNNA 3CJAA 4E7LA 3QNOA 3A5NC 3QMLA 4J8FA 5KPRA 5M1OA 4DHYA 3MK6A 1JCFA 1IKVA 3RTVA 3AA2A 1HQEA 1T05A 1TUYA 4BRMA 4WQ4C 2Z1GA 4H0OA 1OH5A 4F3OA 2JWLA 1EWQA 3CPWM 3CJ7A 3AAQA 5BN8A 4B9LA 5KRTA 2GTDA 3MAQA 3LAMA 3DXKB 5AQOA 3I8BA 3G4SN 1NGIA 3BF1A 3C7NA 4E1MA 2PYJA 1LCUA 2OZMA 1B9DA 2WTUA 4LF8K 4B1XB 2W6LA 1SZ2A 4FJMA 3ZX0A 3O3FA 3CIPA 1NG9A 3ZT3A 4IBNA 2HBKA 3MWPA 4JI1K 1BIUA 1J9AA 3O4WA 4WFAL 3LALA 3HOTA 1JL1A 3DM2A 4FM0A 4CJ4A 4DU3A 4LFBK 5AQSA 3PLAA 1YUWA 3C65A 2X6NA 3OYLA 1SKWA 3VEXA 1U04A 3PIPL 4BY9C 1FKOA 1RT7A 3ZLJA 2YHXA 3AA4A 4BC3A 1RBUA 2A6AA 5AQLA 3T1HK 1GOBA 1HKBA 3VPZA 1N5YA 3MN9A 2BH1A 3UIQA 3L3VA 3FFKB 1EWRA 3V9XA 1QQOA 2KFZA 1A5WA 4LF6K 3VA0A 4KKOA 1L5UA 1OH7A 2W41A 1S1UA 5E84A 4FK4A 4AHRA 4HTLA 2OPRA 3OYJA 3HTVA 3VGMA 5HBMA 1DGKN 3E1YA 4QCLA 4CGJA 3ITHA 1ZBIA 4BECA 1U48A 1RDCA 2P9KA 2NRVA 4FJKA 4MDAA 1VQ4N 3J7ZO 4N76A 1VSIA 4RCHA 4DSEA 5LJVA 4E7KA 2I7NA 4CBWA 3VERA 4E72A 4CW7B 1RT6A 4NCBA 3DMJA 4ID5A 3O80A 1K6YA 4BRLA 3KWGA 4FPBA 3NFAA 3QICA 5ADXH 2KQ2A 4JKFA 4ILJA 4CK1A 2OYQA 4OVLA 3LDLA 2RE2A 4DTJA 4O8KA 3NH1A 1T6DA 3OYNA 2UYTA 2V52B 4K25A 1RT4A 2FSKA 1WUAA 4NCGA 4U67L 1Z26A 3O4QA 2CH5A 4JD2A 3D2FA 3E01A 4CBXA 4LSLA 4HCCA 3GOIA 3U3YA 5GADP 4A61A 1YI2N 3MN6A 3T69A 4JI4K 4DV5K 3WNGA 1NGJA 4CERA 1LWFA 4IEIA 2OTLN 2OANA 3PSIA 3TTFA 2O4IA 3O6WA 1HUXA 4DMNA 1VQNN 4FK2A 1W2BM 4KB0A 4AHUA 3MXIA 4Z4CA 4FYDA 3VF4A 1VQLN 2IVNA 3NCIA 3ULDA 3NGYA 2O8DA 1IH7A 4F8RA 3DLLL 4IJAA 1CZAN 4ISEA 3ZSYA 4U7BA 4BC5A 1NBWA 1TL1A 4BQZA 4CJ5A 2OTJN 2EHGA 2DY4A 5JLHA 3SZ2A 2C1IA 5GIOA 4Z4HA 4IEEA 2OZSA 4PUOA 3AGRA 2BGGA 4M3ZA 4DFPA 1RTJA 4O44A 4IDHA 1Z6RA 2E2OA 3QINA 4GV6A 1RGIA 4BE2A 4E7HA 3F9MA 1KVBA 3FZFA 4CECA 1VQ7N 1Q82O 1HYVA 2E88A 1N34K 4AH9A 3D45A 2BANA 3HVRA 3VQAA 3C6TA 1NGDA 5C15A 4WCEL 4LFCK 3AVMA 3M8SA 4KPYA 1WSIA 1LW2A 5FDLA 4JKAA 4DTMA 1HNVA 3AO1A 3K59A 4Z0UA 3PSFA 2QKBA 4JN4A 4CHOA 4W5QA 2E20A 3U4LA 5ADXA 4QOZB 3ENHA 3FZKA 1ZBUA 3IDHA 3ZT4A 3ZSXA 1H1VA 1QS4A 3OTOK 4J2EA 2O8FB 3WQUA 1GOAA 4FOEA 3ZEUA 3AA3A 2B5JA 3BZCA 3VF2A 2YJEA 3NBPA 3G10A 4KHUA 5K14A 4BVOA 4CEBA 2VYPA 3SJHA 2QWMA 1MU2A 4LD0A 4RW4A 2A5XA 1Y97A 3O8MA 1VRTA 4GMJB 1T7PA 1NGGA 3V1QA 3V1RA 1KD1O 4IOXA 1J54A 4H4OA 1S72N 5F1XA 3WXMB 1SV5A 2BE2A 3IMXA 4B9SA 3MX5A 4BR4A 1FKPA 4BROA 4CZGA 2ASMA 4PY5A 3VEVA 4AHSA 1UWBA 1ZBSA 3RSEA 3UB5A 5AZIA 1S6PA 1NNEA 5FLXO 3DLHA 5CY4A 4JK8A 4YNQA 1NKCA 3OJUA 4N47A 3OYIA 4CZMA 4J2BA 2WUSA 3HK2A 3NF8A 3AA5X 4K41A 3MXMA 1QSLA 4DQPA 4B9VA 4GVMA 3SV4A 4J2AA 1U45A 1WBDA 3ID6A 4AM6A 3GL1A 5C42A 1P8ZA 4BRPA 1NOYA 2HF4A 5FRNA 3ID8A 5AQZA 4PA1A 1CXUA 1HX1A 1X9JA 3DOLA 3J7YP 2Q1NA 2HW3A 1Q7YO 2FBXA 1J6ZA 4DB3A 4JI7K 3MDQA 3VQQA 4JI0K 1FK9A 1S22A 4OJRA 4C1NK 1QTMA 5IWAK 3I0RA 5BRFA 2GUPA 1OVYA 1D8YA 3WNEA 1XMOK 5AQMA 1JKHA 4FLTA 4DSKA 2QXFA 4B9MA 1YJNN 4KB1A 1DTTA 1VQON 2D4WA 1HYZA 4AQYK 3KK7A 1L3UA 1Y64A 3MECA 5D3GA 3KKRA 5M1QA 1T6CA 4DKWA 4ELUA 4PQUA 1FXXA 5LMUK 3OW2M 1JXBA 4BG9A 4FJLA 3EL2A 3D2EA 1VSHA 4CZJA 3ASMA 3ZSZA 4PKHA 3K57A 2FSNA 2IOCA 1M90O 3CM6A 2F9TA 3CFOA 4OGEA 1NJYA 4BR7A 3DYAA 3W0LA 1BG3A 1IKXA 4C8MA 3PV8A 4JYAK 4IG3A 3ZSOA 1JLBA 4YORA 4EP5A 5KPZA 1D9DA 2HVIA 2D1KA 1VQKN 2PBDA 2AJQA 1QQMA 1TK5A 3CJ9A 3AVGA 4H4MA 2IS3A 3DAWA 3THWA 3KD1E 5ELZA 3V9UA 1VSDA 2O8EA 4CHQA 3JXUA 3EKSA 4CZLA 1BOTO 1QE1A 2P51A 2P9IA 3QERA 1LWCA 4FK0A 4M3RA 2Q31A 4LSNA 1B92A 4H0PA 1GLJO 2YNGA 3CXCM 5FPNA 2AA4A 1WLJA 3MXJA 3CYMA 1HYSA 1WBBA 1U47A 1ZYQA 4K43A 1QZ5A 1IBKK 1VQMN 1GLLO 5AZJA 3HL8A 3C6HA 2HHXA 2HBMA 1U2VB 4OPKA 2NRWA 4EHUA 3L2UA 3DWLA 3EN9A 4FLWA 5DMRA 3R8EA 1NOZA 3VTIA 1VSKA 4NO7A 3MN5A 4CIGA 4DUYK 2GEMA 2F9WA 4HUGA 3E9OA 4A62A 5J2QA 3VQ7A 1CXQA 3SQ1A 4FWPA 2F4VK 3VQPA 4JKDA 3T3FA 5CYMA 4W5RA 3IAYA 1RT1A 3A5OC 3CCSN 3MCAB 2E2NA 2JWKA 3PX0A 3KLEA 3F9KA 3O08A 4O55A 4JRQA 3DLRA 5KGWA 4JI8K 4DSJA 4XH5A 4LF5K 3VQ5A 2ZD1A 3A8YA 3MCPA 3KJVA 3NMUA 3JS6A 4CEQA 5HRPA 2W42A 1OVQA 3M1FA 3TSQA 3ZSWA 2ZJRL 3CCEN 3CQ8A 4I6MA 4HTUA 3E66A 4H0VB 1X9SA 3VTHA 2HBLA 5BR9A 5DM6L 2BUPA 3D6RA 5CYQA 4BGAA 5LMNK 4FJNA 1WOQA 4PHTX 1NK7A 5AQYA 4CBUA 4NB4A 4OPAA 2KZMA 1N32K 4B3MK 4BGBA 4MLEA 4K8XA 4JKGB 4BR5A 1BHLA 1TVRA 1ZBLA 3AVBA 4CZEA 4CJLA 4BE0A 3TAQA 1BI4A
chains in the Genus database with same CATH topology
5AQWA 4YOYA 2EWSA 4KBOA 4CZKA 2ZGYA 4FWOA 3R9PA 4CZIA 4FWNA 2QWRA 2QWNA 3I56N 4WFNL 2QWOA 3CCUN 4BRDA 2W41A 2KKZA 5E84A 4H0YB 2QTDA 3FZLA 3WEEB 4HTLA 3CCVN 4JEPA 3LM9A 2NLXA 4WQ4A 3HTVA 1TUUA 1K8KB 3VGMA 1DGKN 2P9NA 1DKGD 3DJCA 3E1YA 3LL3A 1V4SA 2HMPA 1XQSC 4BECA 5BRHA 3EE9A 3KHYA 2P9UA 2P9KA 3H1VX 4C23A 2NRVA 2YJFA 5HOOA 5DM7L 3DXMB 1W97L 3VF6A 4MDAA 1VQ4N 3J7ZO 2NRHA 1GLAG 4RCHA 5EXWA 3CERA 3O9SA 5LJVA 3OHRA 5B8HA 2I7NA 1EO1A 2D0PA 4CBWA 2ASOA 4FPAA 5AQIA 3VERA 4EHTA 3CCQN 1YIJN 4UY8O 4BR9A 2IVPA 4IFEA 3VESA 3O80A 4BRLA 3K9KA 3KWGA 3OA9A 2I7PA 4XH1A 4H5RA 4OO1J 3WT0A 4FPBA 3BF3A 3FE1A 4GV3A 3QICA 5ADXH 4YOVA 2GWJA 4JKFA 4FVUA 4BRQA 3SLCA 2VGNA 4H0TB 4ILJA 3GBTA 4BRGA 2E2QA 1GLCG 3L6QA 4FWKA 3PIOL 1S3XA 4IO9L 1KAYA 2RE2A 3LDLA 3UKRA 3WXIA 4BE7B 1RDUA 4O8KA 4NLBA 3CQXA 2QWPA 3M5RA 1T6DA 4GY2B 3J8AA 3O5BA 3VOVA 2UYTA 2V52B 4K25A 1K8AO 2Q0RA 2HSTA 3G25A 3VEWA 2FSKA 3IUCA 1WUAA 4EFHA 4U67L 1TYQB 1VQ9N 3G4SN 1IJJA 1RDWX 2CH5A 3ZX3A 1KAXA 3AAPA 4JD2A 1K73O 1NGAA 3D2FA 4CBXA 3D2EB 2A42A 1YJWN 1QZ6A 2FLOA 3ZETA 3GOIA 2C1GA 2VCPA 5JICA 2ITMA 4A61A 5GADP 1YI2N 3MN6A 3T69A 3S41A 5AQXA 1NGJA 1IG8A 2J4RA 4JKGA 4IEIA 2Q2RA 4IWVA 3G6EN 2OTLN 2OANA 3TTFA 3O6WA 1HUXA 1VQNN 2HF3A 3NVKA 2E1ZA 1W2BM 5EOYA 2FF6A 5AR0A 4BEBA 3SK3A 1NLVA 2Q0UA 2IVNA 3VF4A 1VQLN 3HI0A 1BU6O 3HZ6A 5F2RA 4DCHA 4PKGA 1VQ5N 5JMVA 1P90A 4F9OA 2Q36A 4JHDA 3DLLL 3CJ1A 4IJAA 1CZAN 4ISEA 2PAVA 3WEEA 4MLHA 4R79A 2HOEA 4U7BA 2F7TA 4JKCA 2P9IB 4BC5A 1NBWA 1ESVA 4BQZA 5H1SQ 4YOUA 2OTJN 1HKCA 4B1UB 1YHQN 5JLHA 2C1IA 5GIOA 3KWIA 2P9SA 2QEXN 4IEEA 3CCLN 2H3GX 3H45C 5BREA 3AGRA 5KQDA 2W00A 2FSJA 1Q18A 1XC3A 2P9LB 3O9UA 3ULEA 5CE3A 2CGLA 4JK9A 1K9MO 1BDGA 4IDHA 1BO5O 2YX6A 4QS9A 3M3ZA 5AQVA 4YOXA 1Z6RA 2E2OA 5EX5A 5AZJB 4AM7A 4GV6A 1RGIA 3WQTA 3H6EA 3VEZA 1ZXOA 3QB0A 4MO4A 3F9MA 3FZFA 3FLCO 5GAHP 2E88A 3TTCA 3ZX2A 1Q82O 1VQ7N 3P38A 3Q7CA 3LM2A 4EAHD 3SAFA 5C0YA 1C0FA 1T3VA 4FWQA 1C0GA 1ATSA 1NGDA 3MX2A 4BG8A 5C15A 4O5FA 1JJ2M 3CD6N 4WCEL 3FGUA 5M1PA 1VQ8N 2YHWA 5BRDA 3CC7N 1U2VA 5FPMA 1KXPA 4JKAA 2D0OA 5M1FA 3O1BA 1E4GT 3SAGA 3M6GA 4JN4A 4FO0A 2E20A 3U4LA 3MN7A 5ADXA 1KQSM 3ENHA 3LDNA 4WQ5C 3FZKA 2ASPA 1E4FT 3HSCA 1MWMA 1U6ZA 1BA0A 2QW9A 3IDHA 3VEOA 5FPDA 1QVFM 3EE8A 3L0QA 4CD3A 1GLEG 3OBWA 2RHKA 2NZTA 1H1VA 2P9PA 1XUPO 4I6MB 3DXKA 3O9QA 3WQUA 3GE1A 3A5LC 3VMFB 3H3OB 4FOEA 3ZEUA 4HWIA 2KHOA 4BRKA 3VF2A 2IIRA 2YJEA 3I33A 1KAZA 5BPMA 3HM8A 4BVOA 4K42A 5GINA 1YVNA 5AQQA 1R59O 4XH4A 3WUHA 2VYPA 5CHIA 2PFUA 4PL8A 3SJHA 1YF5L 2QWMA 1GLDG 5AQNA 4FL9A 3R3LA 1MA9B 2CGKA 5TKYA 5LJWA 2QA4N 2A5XA 1VAZA 4B1YB 1HKGA 1LOTB 2CGJA 3AGKA 3O8MA 3QFUA 4WYBA 2E1YA 5AQFA 1NGGA 3A0IX 4CZHA 3TSUA 4QS7A 1KD1O 1M1KO 4IOXA 4KH6A 1VQPN 4BR2A 1S72N 3TTDA 3G71N 5GAEP 1HJOA 4YDUA 4JK7A 5F1XA 3WXMB 4AF1A 2P9LA 3H46O 3IMXA 3MMVA 4KH5A 3MX5A 4BR4A 4XEIA 2ZF5O 1SS6A 1G99A 1SAZA 2ASMA 2YCHA 3CI5A 4BROA 4CZGA 3VEVA 5M1KA 2QM1A 4E1JA 1BWFO 1ZBSA 1V4TA 3RSEA 3UB5A 5AZIA 4WFBL 5CR4A 4IOCL 2A41A 3CJBA 3H1QA 3EO3A 5KPTA 4IXCA 5KQ8A 1Q86O 2V7ZA 4IJNA 4JK8A 1SQKA 1QVGM 2NRRA 5BN9A 4L3QA 2P9NB 4O8UA 3MWTA 2W40A 4FWMA 4H0XB 4CZMA 4YOTA 4BRAA 5C2FA 3CMAN 2WUSA 5AQHA 4BRNA 4FSVA 1QHAA 1YAGA 4ILGB 4K41A 2NRTA 3VGKA 2P9UB 2P9KB 3TSPA 3HOSA 3BP8A 1ATRA 2HBJA 2GELA 3UE5A 3QBXA 3LDOA 3F2KA 3BUZB 3VENA 1ZC6A 3ID6A 4AM6A 1K8KA 2E8AA 1NGHA 3GL1A 1P8ZA 3QDKA 1ATNA 4M7XA 3U8XA 4M7YA 4BRPA 3UKUB 4WQ5A 2HF4A 4A2BA 4KH4A 1EQYA 4BRFA 3ID8A 1NJIO 5AQZA 1X9JA 1HX1A 1Q81O 4QS8A 3HBTA 3DXMA 2FF3B 2Q1NA 3ATVA 3O9RA 1Q7YO 5AFUA 2QWQA 1J6ZA 4DB3A 5BPNA 1GLBG 1NGCA 3MDQA 4NLCA 4LC9B 1S22A 3ATUA 3Q7BA 4H5TA 4C1NK 4OPHA 1JCEA 3L4IA 3UKRB 5BRFA 5C10A 4RWTA 2GUPA 1OVYA 4JAXA 2VGMA 1KC8O 5FPEA 1NMDA 1NGFA 3CETA 5AQMA 4MO5A 5M1NA 4H5NA 3SMSA 1OKJA 4H5VA 2VWBA 3I55N 1JCGA 1YJNN 4FWRA 3CCMN 1O13A 5AFUH 3U9DA 4DQ8A 3GG4A 4ISGA 2GX9A 4JD2B 5GIPA 2ZJQL 4B9QA 3VETA 5JVHL 3D2FB 1VQON 2D4WA 3KK7A 3ZETB 1Y64A 3ENBA 3B8AX 3N4PA 3N4QA 3C0BA 3QFPA 3K9JA 3EKUA 5M1QA 4BRCA 3WXJA 1T6CA 2A40A 4DKWA 4A5BA 2WC9A 5C2DA 1TYQA 4BVPA 2WFBA 4JKHA 3SBTA 1NGBA 3OW2M 2ZWHA 4C1NI 3CMEN 4BG9A 4FWSA 4FOIA 3EL2A 3D2EA 2DPNA 4A59A 1BA1A 1DT9A 4BREA 3KVGA 4CZJA 4M63C 4MDBA 4WF9L 3C7NB 4PKHA 5AQTA 2FSNA 1M90O 4PL7A 4B1WB 2YHYA 2F9TA 1X3NA 4H5WA 3P4IA 3A5MC 4BR7A 3VEYA 3W0LA 1BG3A 2IVOA 2NRZA 4JHDB 5MLCQ 4GNIA 5JLFA 3D7EO 4BRIA 4JKBA 3AARA 3L4QA 1YXQA 3WXLA 3IKMA 4YORA 5KPZA 2CH6A 2Q97A 1N8RO 2D1KA 2ZJPL 1VQKN 2PBDA 1QQMA 2V7YA 3CJ9A 3SAHA 3O1WA 5F0XA 4YOWA 2P9SB 3CCJN 3DAWA 1YJ9N 2NNWA 5ELZA 1T44A 2WBNA 3QBWA 5AQUA 3CC4N 3JXUA 3EKSA 1QQNA 3CHWA 3LDQA 4CZLA 1D4XA 1BOTO 1X3MA 2P9IA 2QXLA 3FZMA 3ULEB 3EZWA 4JKEA 4IO8A 4RTFD 3E9PA 2FXUA 3SMPA 4A5AA 3UKUA 3CF5L 5AQGA 2Q31A 5BPLA 4BC2A 2V51B 1HLUA 4H0PA 4PKIA 1GLJO 4BC4A 1HPMA 1NWKA 4BR0A 3CXCM 4XJXA 3LDPA 5FPNA 2AA4A 3CCRN 4Z94A 3HRGA 4BRHA 5HL7L 5EVZA 5I9EB 3CPEA 2A3ZA 4B1ZA 1NGEA 2QWLA 1MDUB 4K43A 4Y0WA 4IOAL 1QZ5A 3CJAA 1VQMN 1GLLO 5AZJA 1NM1A 3A5NC 3QMLA 4J8FA 5M1OA 5KPRA 3ZYYX 4CI6A 3C6HA 4DHYA 1Z05A 2HBMA 1U2VB 3MK6A 2NRWA 4EHUA 3DWLA 1JCFA 3EN9A 3R8EA 3VTIA 5TKWA 2QI2A 2KLAA 3R1XA 4NO7A 3MN5A 4CJ7A 3U9ZA 1TUYA 4BRMA 4WQ4C 2GEMA 3E9LA 2F9WA 4H0OA 4ILHA 5E26A 2JWLA 3E9OA 4A62A 3CPWM 3CJ7A 3AAQA 5BN8A 1BUPA 4FWPA 2GTDA 3BEXA 3KZBA 3F5TA 4JKDA 1VQ6N 3ENOA 4GVEA 2AP1A 4G9ZA 2P9PB 3A5OC 4A57A 3CCSN 3IFRA 2E2NA 3DXKB 2JWKA 3MCAB 5AQOA 3P39A 3TU5A 1RFQA 3FR0A 3O08A 3I8BA 4EIAA 1MWKA 3ZEUB 3CQYA 1NGIA 3BF1A 3C7NA 3NVMA 5AQJA 4XH5A 3SBGA 3WXKA 4A2AA 5C12A 3R6MA 3GDQA 5LY3A 1LCUA 3A8YA 3MCPA 3O9TA 3TPQA 4CD1A 3JS6A 5AQRA 3NMUA 4B1XB 1SZ2A 3M1FA 3ZX0A 1YITN 4FWLA 3TSQA 2ZJRL 3CCEN 1DEJA 3C6AA 3CIPA 3CJCA 4GV9A 4BQLA 2YI1A 4I6MA 3E66A 4H0VB 1ILYA 2NRXA 3VTHA 5JVGL 2HBLA 5BR9A 5DM6L 2E2PA 2HBKA 3MWPA 2BUPA 3D6RA 4IZ9A 3T7ZA 2ZGZA 3O4WA 4BGAA 5EY4A 4WFAL 3HOTA 3OBYA 1WOQA 4PHTX 5AQYA 2GWKA 3W3DA 4CBUA 4CZFA 5AQKA 5AQSA 4NB4A 3PLAA 3RVCA 5GAGP 3VGLA 1YUWA 3C65A 4OPAA 3FZHA 4BGBA 3VEXA 3PIPL 4MLEA 4BY9C 4YDUC 4JKGB 4BR5A 2BTFA 2YHXA 4BC3A 2A6AA 5AQLA 3RSEB 3P31A 5AZIB 4CZEA 1GLFO 3H3NO 4JNEA 4H03B 1HKBA 3VPZA 3MN9A 2BH1A 3CC2N 4ISFA 3FFKB 5AQPA 4B1VA 1QQOA 3AY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQW A;  2EWS A;  4KBO A;  4CZK A;  2ZGY A;  4FWO A;  3R9P A;  4CZI A;  4FWN A;  2QWR A;  2QWN A;  2QWO A;  4BRD A;  2W41 A;  5E84 A;  4H0Y B;  3FZL A;  3WEE B;  4HTL A;  3LM9 A;  2NLX A;  4WQ4 A;  3HTV A;  1TUU A;  1K8K B;  3VGM A;  1DGK N;  2P9N A;  1DKG D;  3DJC A;  3LL3 A;  1V4S A;  2HMP A;  1XQS C;  5BRH A;  3KHY A;  2P9U A;  2P9K A;  3H1V X;  4C23 A;  2YJF A;  3DXM B;  3VF6 A;  2NRH A;  1GLA G;  4RCH A;  5EXW A;  3CER A;  5LJV A;  3OHR A;  5B8H A;  2I7N A;  2D0P A;  4CBW A;  2ASO A;  4FPA A;  5AQI A;  3VER A;  4EHT A;  4BR9 A;  2IVP A;  3VES A;  3O80 A;  4BRL A;  2I7P A;  4XH1 A;  4H5R A;  3WT0 A;  4FPB A;  3BF3 A;  3FE1 A;  3QIC A;  5ADX H;  2GWJ A;  4BRQ A;  3SLC A;  4H0T B;  3GBT A;  4BRG A;  2E2Q A;  1GLC G;  3L6Q A;  4FWK A;  1S3X A;  1KAY A;  3LDL A;  3UKR A;  3WXI A;  4O8K A;  3CQX A;  2QWP A;  1T6D A;  4GY2 B;  3J8A A;  3O5B A;  3VOV A;  2UYT A;  2V52 B;  4K25 A;  2Q0R A;  3G25 A;  3VEW A;  2FSK A;  3IUC A;  1WUA A;  4EFH A;  1TYQ B;  1IJJ A;  1RDW X;  2CH5 A;  3ZX3 A;  1KAX A;  3AAP A;  4JD2 A;  1NGA A;  3D2F A;  4CBX A;  3D2E B;  2A42 A;  1QZ6 A;  2FLO A;  3ZET A;  3GOI A;  2VCP A;  5JIC A;  2ITM A;  4A61 A;  3MN6 A;  3S41 A;  5AQX A;  1NGJ A;  1IG8 A;  2J4R A;  2Q2R A;  4IWV A;  2OAN A;  3O6W A;  1HUX A;  2HF3 A;  2E1Z A;  5EOY A;  2FF6 A;  5AR0 A;  3SK3 A;  1NLV A;  2Q0U A;  2IVN A;  3VF4 A;  3HI0 A;  1BU6 O;  3HZ6 A;  5F2R A;  4DCH A;  4PKG A;  5JMV A;  4F9O A;  2Q36 A;  4JHD A;  3CJ1 A;  4IJA A;  1CZA N;  4ISE A;  2PAV A;  3WEE A;  4MLH A;  2HOE A;  2P9I B;  4BC5 A;  1NBW A;  1ESV A;  4BQZ A;  1HKC A;  4B1U B;  5JLH A;  2P9S A;  2H3G X;  3H45 C;  5BRE A;  5KQD A;  2FSJ A;  1Q18 A;  1XC3 A;  2P9L B;  3ULE A;  5CE3 A;  2CGL A;  1BDG A;  1BO5 O;  4QS9 A;  3M3Z A;  5AQV A;  1Z6R A;  2E2O A;  5EX5 A;  5AZJ B;  4AM7 A;  1RGI A;  3WQT A;  3H6E A;  3VEZ A;  1ZXO A;  3QB0 A;  4MO4 A;  3F9M A;  3FZF A;  3FLC O;  2E88 A;  3ZX2 A;  3LM2 A;  4EAH D;  1C0F A;  4FWQ A;  1C0G A;  1ATS A;  1NGD A;  4BG8 A;  4O5F A;  3FGU A;  2YHW A;  5BRD A;  1U2V A;  5FPM A;  1KXP A;  2D0O A;  3O1B A;  1E4G T;  3M6G A;  4JN4 A;  4FO0 A;  2E20 A;  3U4L A;  3MN7 A;  5ADX A;  3ENH A;  3LDN A;  4WQ5 C;  3FZK A;  2ASP A;  1E4F T;  3HSC A;  1MWM A;  1U6Z A;  1BA0 A;  2QW9 A;  3IDH A;  3VEO A;  5FPD A;  3L0Q A;  4CD3 A;  1GLE G;  2NZT A;  1H1V A;  2P9P A;  1XUP O;  4I6M B;  3DXK A;  3WQU A;  3GE1 A;  3A5L C;  3H3O B;  4FOE A;  3ZEU A;  4HWI A;  2KHO A;  4BRK A;  3VF2 A;  2IIR A;  2YJE A;  3I33 A;  1KAZ A;  5BPM A;  3HM8 A;  4BVO A;  4K42 A;  1YVN A;  5AQQ A;  1R59 O;  4XH4 A;  3WUH A;  2VYP A;  4PL8 A;  3SJH A;  2QWM A;  1GLD G;  5AQN A;  4FL9 A;  5LJW A;  1MA9 B;  2CGK A;  5TKY A;  2A5X A;  4B1Y B;  1HKG A;  1LOT B;  2CGJ A;  3O8M A;  4WYB A;  3QFU A;  2E1Y A;  5AQF A;  1NGG A;  3A0I X;  4CZH A;  4QS7 A;  4BR2 A;  1HJO A;  4YDU A;  5F1X A;  2P9L A;  3H46 O;  3IMX A;  3MMV A;  4BR4 A;  4XEI A;  2ZF5 O;  1G99 A;  4BRO A;  1SAZ A;  2ASM A;  2YCH A;  3CI5 A;  4CZG A;  3VEV A;  2QM1 A;  4E1J A;  1BWF O;  1ZBS A;  1V4T A;  3RSE A;  3UB5 A;  5AZI A;  2A41 A;  3CJB A;  3H1Q A;  3EO3 A;  5KPT A;  4IXC A;  5KQ8 A;  2V7Z A;  4IJN A;  1SQK A;  5BN9 A;  4L3Q A;  2P9N B;  2W40 A;  4FWM A;  4H0X B;  4CZM A;  4BRA A;  2WUS A;  5AQH A;  4BRN A;  4FSV A;  1QHA A;  1YAG A;  4K41 A;  3VGK A;  2P9U B;  2P9K B;  3BP8 A;  1ATR A;  2GEL A;  3UE5 A;  3QBX A;  3LDO A;  3BUZ B;  3VEN A;  1ZC6 A;  4AM6 A;  1K8K A;  2E8A A;  1NGH A;  3GL1 A;  1P8Z A;  3QDK A;  1ATN A;  4M7X A;  3U8X A;  4M7Y A;  4BRP A;  3UKU B;  4WQ5 A;  2HF4 A;  4A2B A;  1EQY A;  4BRF A;  3ID8 A;  5AQZ A;  1X9J A;  1HX1 A;  4QS8 A;  3HBT A;  3DXM A;  2FF3 B;  2Q1N A;  3ATV A;  5AFU A;  2QWQ A;  1J6Z A;  4DB3 A;  5BPN A;  1GLB G;  1NGC A;  3MDQ A;  4LC9 B;  1S22 A;  3ATU A;  4H5T A;  1JCE A;  3L4I A;  3UKR B;  5BRF A;  4RWT A;  2GUP A;  4JAX A;  5FPE A;  1NMD A;  1NGF A;  3CET A;  5AQM A;  4MO5 A;  4H5N A;  3SMS A;  1OKJ A;  4H5V A;  2VWB A;  1JCG A;  4FWR A;  5AFU H;  3U9D A;  4DQ8 A;  3GG4 A;  4ISG A;  4JD2 B;  4B9Q A;  3VET A;  3D2F B;  2D4W A;  3ZET B;  1Y64 A;  3B8A X;  3C0B A;  3QFP A;  3EKU A;  4BRC A;  3WXJ A;  1T6C A;  2A40 A;  1TYQ A;  4BVP A;  1NGB A;  2ZWH A;  4BG9 A;  4FWS A;  4FOI A;  3EL2 A;  3D2E A;  2DPN A;  1BA1 A;  4BRE A;  3KVG A;  4CZJ A;  4M63 C;  3C7N B;  4PKH A;  5AQT A;  2FSN A;  4PL7 A;  4B1W B;  2YHY A;  2F9T A;  1X3N A;  4H5W A;  3P4I A;  3A5M C;  4BR7 A;  3VEY A;  3W0L A;  1BG3 A;  2IVO A;  4JHD B;  4GNI A;  5JLF A;  3D7E O;  4BRI A;  3AAR A;  1YXQ A;  3WXL A;  5KPZ A;  2CH6 A;  2Q97 A;  2D1K A;  2PBD A;  1QQM A;  2V7Y A;  3CJ9 A;  3O1W A;  5F0X A;  2P9S B;  3DAW A;  5ELZ A;  1T44 A;  5AQU A;  3QBW A;  3JXU A;  3EKS A;  1QQN A;  3CHW A;  3LDQ A;  4CZL A;  1D4X A;  1BOT O;  1X3M A;  2P9I A;  2QXL A;  3FZM A;  3ULE B;  3EZW A;  3SMP A;  4IO8 A;  4RTF D;  2FXU A;  3UKU A;  5AQG A;  2Q31 A;  5BPL A;  4BC2 A;  2V51 B;  1HLU A;  4H0P A;  4PKI A;  1GLJ O;  4BC4 A;  1HPM A;  1NWK A;  4BR0 A;  3LDP A;  5FPN A;  2AA4 A;  4Z94 A;  4BRH A;  5EVZ A;  5I9E B;  2A3Z A;  4B1Z A;  1NGE A;  2QWL A;  1MDU B;  4K43 A;  4Y0W A;  1QZ5 A;  3CJA A;  1GLL O;  5AZJ A;  1NM1 A;  3A5N C;  3QML A;  4J8F A;  5KPR A;  4CI6 A;  4DHY A;  1Z05 A;  1U2V B;  3MK6 A;  4EHU A;  3DWL A;  1JCF A;  3EN9 A;  3R8E A;  4CJ7 A;  4NO7 A;  3MN5 A;  3U9Z A;  1TUY A;  4BRM A;  4WQ4 C;  2GEM A;  4H0O A;  2F9W A;  5E26 A;  4A62 A;  3CJ7 A;  3AAQ A;  5BN8 A;  1BUP A;  4FWP A;  2GTD A;  3BEX A;  3KZB A;  3ENO A;  2AP1 A;  2P9P B;  3A5O C;  3IFR A;  2E2N A;  3DXK B;  3TU5 A;  5AQO A;  1RFQ A;  3FR0 A;  3O08 A;  3I8B A;  4EIA A;  1MWK A;  3ZEU B;  3CQY A;  1NGI A;  3BF1 A;  3C7N A;  5AQJ A;  3WXK A;  4XH5 A;  4A2A A;  5LY3 A;  3R6M A;  3GDQ A;  1LCU A;  3A8Y A;  3MCP A;  3TPQ A;  4CD1 A;  3JS6 A;  5AQR A;  4B1X B;  1SZ2 A;  3M1F A;  3ZX0 A;  4FWL A;  1DEJ A;  3CIP A;  3CJC A;  4BQL A;  2YI1 A;  4I6M A;  4H0V B;  5BR9 A;  2E2P A;  2BUP A;  4IZ9 A;  2ZGZ A;  3O4W A;  4BGA A;  5EY4 A;  1WOQ A;  5AQY A;  2GWK A;  3W3D A;  4CBU A;  4CZF A;  5AQK A;  5AQS A;  4NB4 A;  3VGL A;  1YUW A;  3FZH A;  4BGB A;  3VEX A;  4MLE A;  4YDU C;  4BR5 A;  2BTF A;  2YHX A;  4BC3 A;  2A6A A;  5AQL A;  3RSE B;  5AZI B;  4CZE A;  1GLF O;  3H3N O;  4JNE A;  4H03 B;  1HKB A;  3VPZ A;  3MN9 A;  4ISF A;  3FFK B;  5AQP A;  4B1V A;  1QQO A;  3AY9 A; 
#chains in the Genus database with same CATH topology
 4DQS A;  3V9S A;  3HPH A;  2EWS A;  2ZGY A;  4CJR A;  4CZI A;  2Y1J A;  3K5N A;  2Z1I A;  4WFN L;  2DTU A;  2QWO A;  4Z4F A;  3B6O A;  4H0Y B;  3J80 O;  3WEE B;  3AVN A;  4E19 A;  2A1R A;  3LP1 A;  1TUU A;  2P5G A;  4E3S A;  2P9N A;  3DOK A;  3JYT A;  4DF8 A;  2O8B B;  5BRH A;  3H1V X;  4C23 A;  4JS4 A;  1SL1 A;  1HNX K;  4RG8 A;  3DXM B;  3TAE A;  3O9S A;  1KVA A;  5B8H A;  1EO1 A;  2D0P A;  1WAJ A;  3VQ6 A;  1REV A;  1YIJ N;  2G8F A;  1EX4 A;  4CIE A;  3SPZ A;  4M3Y A;  3VES A;  4DG1 A;  2YNF A;  2ZE2 A;  5EU7 A;  4XH1 A;  4OO1 J;  3FE1 A;  4F3T A;  4RW7 A;  4YOV A;  1QQC A;  1RDB A;  2GWJ A;  2IAJ A;  3SLC A;  1NK4 A;  4BRG A;  3L6Q A;  4I7F A;  4IO9 L;  3WXI A;  2UU9 K;  4BE7 B;  1TGO A;  4J2D A;  2QWP A;  3THX A;  1EXQ A;  4GY2 B;  3AVA A;  3RRH A;  1TYQ B;  1RDW X;  2O4G A;  1K73 O;  4C8L A;  4OGC A;  3QET A;  3DI6 A;  1QZ6 A;  3ZET A;  4ZHR A;  4M3W A;  2VCP A;  2ITM A;  1BQN A;  3QO9 A;  3S41 A;  5AQX A;  1IG8 A;  2VWJ A;  2F96 A;  5J2M A;  2G8V A;  4DQQ A;  1SUQ A;  2XY6 A;  4EZ9 A;  4DR3 K;  2HF3 A;  3V9W A;  4KRF A;  4CES A;  1NLV A;  1BU6 O;  3HZ6 A;  4MQ3 A;  2X78 A;  1P90 A;  5CZ2 A;  1CZ9 A;  3DLE A;  1S5J A;  2HOE A;  2F7T A;  4DLG A;  4CJU A;  1JLC A;  4CJS A;  3KWI A;  2O8C A;  3L8B A;  3THY B;  4OKJ A;  5BRE A;  1SL0 A;  4DQR A;  4DV2 K;  1Q18 A;  4R5P A;  4CFD A;  3QEX A;  3ZCM A;  2XRI A;  1BO5 O;  1E3M A;  3VQD A;  3L2V A;  1UA0 A;  4FW1 A;  3PX4 A;  2HB5 A;  5EX5 A;  5HRN A;  2HHI A;  3H6E A;  1RBV A;  1ZXO A;  2HHW A;  5HRS A;  5GAH P;  3TTC A;  4DV1 K;  3P38 A;  3Q7C A;  3LM2 A;  2UUB K;  4EAH D;  2DFE A;  3PX6 A;  4CJ3 A;  1C0F A;  5C0Y A;  1GOC A;  4O5F A;  3TAM A;  3FGU A;  2YHW A;  5FRO A;  4CGF A;  5BRD A;  3AO3 A;  2RKI A;  2D0O A;  3MED A;  3O1B A;  1RCH A;  4E7I A;  2OPS A;  3HVT A;  1KQS M;  3LDN A;  3VEO A;  1IG9 A;  1GLE G;  2RHK A;  2P9P A;  4CFA A;  1XUP O;  4DR2 K;  5J2N A;  3A5L C;  3A2F A;  1F21 A;  2FBV A;  1BQM A;  5J1E A;  1WSF A;  2KHO A;  3OYE A;  4LFA K;  1KAZ A;  3KLG A;  3HM9 A;  4KHS A;  3NH2 A;  4CE9 A;  5AQQ A;  4CHY A;  4B8C A;  1R59 O;  4CGG A;  1YF5 L;  4FL9 A;  3QLH A;  3TAR A;  5LJW A;  5TKY A;  2FBY A;  4UQG A;  1LV5 A;  3WNH A;  3AGK A;  2E1Y A;  1RDD A;  5KI6 A;  3A0I X;  3TSU A;  4QS7 A;  1M1K O;  1S1X A;  3G71 N;  5GAE P;  3AVH A;  4JK7 A;  4B9T A;  4AF1 A;  1VSE A;  3MMV A;  4IG0 A;  4KH5 A;  4FCY A;  4KHW A;  3WNF A;  2XHB A;  4N56 A;  1SS6 A;  3SUN A;  3NF6 A;  2QM1 A;  4E1J A;  1BWF O;  1V4T A;  4DV7 K;  1ITG A;  1Q86 O;  1NK5 A;  5HRO A;  1SL2 A;  4O8U A;  4GKJ K;  2W40 A;  1Z25 A;  2X74 A;  4YOT A;  3VQE A;  3CMA N;  5AQH A;  4BRN A;  1QHA A;  1YAG A;  4F2S A;  3VGK A;  1SKS A;  2P9K B;  3TSP A;  3AVC A;  3M8R A;  3DLG A;  1RTH A;  2XY8 A;  3UE5 A;  5KGX A;  3F2K A;  3VEN A;  1K8K A;  4Q0B A;  4M7X A;  3U8X A;  2E8A A;  1NGH A;  1ATN A;  3QIP A;  4WQ5 A;  1C0U A;  3NGZ A;  2G8I A;  3SI6 A;  4ID1 A;  5AFU A;  2QWQ A;  4NLC A;  4IKF A;  1JL2 A;  4CHN A;  3L4I A;  4KHN A;  1TK0 A;  5C10 A;  1RBS A;  1UAX A;  3ALY A;  1KC8 O;  5FPE A;  3CET A;  1NGF A;  4H5N A;  2EX3 A;  1NKE A;  3OYG A;  4O0I A;  4KTW A;  5C24 A;  2VG7 A;  2GX9 A;  4JD2 B;  1ILY A;  3VET A;  3D2F B;  3BDP A;  1N6Q A;  1YVU A;  1S1W A;  3VQ4 A;  4B3O A;  1NJZ A;  2FBT A;  3QIO A;  4A5B A;  2WC9 A;  3HT3 A;  2LSN A;  4CEF A;  5KTQ A;  4CVN E;  4BVP A;  2WFB A;  1NGB A;  2DFF A;  2ZWH A;  4DU1 A;  4C1N I;  1WSJ A;  1YT3 A;  1JLG A;  4FOI A;  1BA1 A;  1W0H A;  5JS2 A;  1DT9 A;  4M63 C;  4MDB A;  4WF9 L;  4PL7 A;  2O8D B;  4B9N A;  1X3N A;  3A5M C;  1ASU A;  3D7E O;  3AAR A;  5HLF A;  3IKM A;  4DS4 A;  3SQ4 A;  3PY8 A;  1Q9Y A;  3QES A;  1YJ9 N;  1WSE A;  2WBN A;  5AQU A;  3QBW A;  4L8R B;  1FW6 A;  1VK0 A;  4CJK A;  3HST B;  2KFN A;  1TKT A;  1X3M A;  1JLF A;  4JKE A;  4IO8 A;  3SMP A;  2FXU A;  4OLA A;  2KZZ A;  1JXE A;  1JLE A;  2Q3S A;  4BR0 A;  4B08 A;  4CJE A;  3B6P A;  4XJX A;  4Z4G A;  3HRG A;  4JLH A;  1XI1 A;  3P83 D;  4IFV A;  5HL7 L;  5EVZ A;  3ZSR A;  2A3Z A;  3J81 O;  4AIL C;  4FW2 A;  4KV8 A;  4X65 K;  1MDU B;  5KRS A;  1NM1 A;  1D5A A;  4DTX A;  3DLK A;  3ZYY X;  4O4G A;  4ELT A;  3AV9 A;  1Z05 A;  1HQU A;  1HJR A;  4FZX C;  1TKX A;  5TKW A;  4BWM A;  4CJ7 A;  1XNR K;  4CJQ A;  1S6Q A;  3OYC A;  3QEI A;  2QK9 A;  3KTQ A;  2RPI A;  4FJ5 A;  4GVE A;  2AP1 A;  4BDZ A;  4A57 A;  3L2W A;  3ZEU B;  3CQY A;  5AQJ A;  4CFB A;  5C12 A;  1OH8 A;  3TPQ A;  5AQR A;  4FWL A;  3QEW A;  1DEJ A;  1KRP A;  4GV9 A;  2YI1 A;  3KKS A;  3OYA A;  3G0Z A;  2DFH A;  3P5J A;  3VA3 A;  3L2R A;  5C25 A;  4CJF A;  1HNW K;  3W3D A;  2KW4 A;  4CZF A;  2UUC K;  2Z1H A;  3AVK A;  3RVC A;  4FJJ A;  5GAG P;  2VQE K;  4E89 A;  2BTF A;  1T03 A;  3RSE B;  3P31 A;  5AZI B;  1GLF O;  3H3N O;  4JNE A;  4H03 B;  4ISF A;  2G8K A;  3NE6 A;  5AQP A;  4DSF A;  4B1V A;  3AY9 A;  5AQW A;  4YOY A;  4DS5 A;  1I39 A;  4FWO A;  3R9P A;  2GUI A;  4FWN A;  2QWR A;  3U6F A;  2QWN A;  3I56 N;  4X62 K;  1HMV A;  4Y1C A;  2KKZ A;  1S9G A;  3D0P A;  3BZK A;  3LM9 A;  2NLX A;  3DJC A;  2W6K A;  3LL3 A;  1V4S A;  2HMP A;  1XQS C;  1NJX A;  3CFP A;  3EE9 A;  4I2P A;  3KHY A;  2P9U A;  4HUF A;  3KLI A;  5DM7 L;  4LF4 K;  4KHY A;  1EET A;  3LAK A;  2YKM A;  4FJ9 A;  4B8A B;  1O1W A;  2NRH A;  1GLA G;  5EXW A;  1XC9 A;  3L3U A;  1NU0 A;  5AQI A;  4UY8 O;  1NK8 A;  4CJT A;  4FZY A;  4FLU A;  4O5B A;  4BR9 A;  2IVP A;  4JI6 K;  3K9K A;  4EP4 A;  2I7P A;  2E5L K;  3T1Y K;  2HNZ A;  4GV3 A;  4NXN K;  4FVU A;  4BRQ A;  2VGN A;  3GBT A;  1Q8I A;  4FWK A;  1OH6 A;  3PIO L;  3UKR A;  1NJW A;  3K5L A;  4HUE A;  4NLB A;  1IBL K;  3M5R A;  1N36 K;  3VOV A;  1L3V A;  1RT5 A;  1K8A O;  3AVI A;  2NUB A;  2HST A;  2Q0R A;  2YV0 X;  3VEW A;  4W5N A;  3V9Z A;  3VN5 A;  4C8N A;  5I42 A;  1KAX A;  3AAP A;  2HHV A;  4LH4 A;  2HHT A;  3D2E B;  2A42 A;  4E0D A;  1FJG K;  4DSL A;  1NKB A;  4KO0 A;  2C1G A;  5JIC A;  3KK3 A;  1D9F A;  4FJ7 A;  1BGX T;  4I9L A;  4JKG A;  4XIU A;  3AVF A;  2PZS A;  2Q2R A;  3OYF A;  3TAB A;  4CJW A;  1QSY A;  3RMB A;  3SV3 A;  3SCX A;  3S3N A;  4CF1 A;  3NVK A;  1DTQ A;  5HRR A;  5EOY A;  4M42 A;  3LAN A;  2FF6 A;  5AR0 A;  4DTS A;  5F2R A;  4Y1D A;  2ATQ A;  1VQ5 N;  3THW B;  1W7A A;  4F9O A;  2Q36 A;  4JHD A;  2O8E B;  4Z4I A;  3CJ1 A;  3WEE A;  2P9I B;  3QEP A;  5H1S Q;  2ITG A;  2UXB K;  1YHQ N;  2QEX N;  2P9S A;  4FXD A;  3CCL N;  2H3G X;  2ZQB A;  2W00 A;  3C94 A;  2I5J A;  3H08 A;  1XC3 A;  1QSS A;  2P9L B;  3RR8 A;  3ULE A;  4DR7 K;  2P5O A;  3OS0 A;  1BDG A;  1J53 A;  1VRU A;  3ZT1 A;  3NDK A;  4QS9 A;  3M3Z A;  3IG1 A;  4GKK K;  5AZJ B;  3S3M A;  3VEZ A;  1TAU A;  4C8K A;  4GW6 A;  2B6A A;  3FLC O;  1NMN A;  1TAQ A;  3HXM A;  4FJG A;  4CJV A;  3CD6 N;  1C0G A;  1N33 K;  4DF4 A;  2IDO A;  3ZSV A;  1BL3 A;  3CC7 N;  2IC3 A;  3LWM A;  1WNS A;  4RW9 A;  1XHX A;  3EYZ A;  3ZT2 A;  3T1A A;  4LF7 K;  1KLM A;  4WQ5 C;  2QW9 A;  1U6Z A;  1BA0 A;  5FPD A;  2HMI A;  4EZ6 A;  1QVF M;  2P1J A;  3L0Q A;  4CD3 A;  2NZT A;  3QNN A;  3F73 A;  4I6M B;  3DXK A;  3VMF B;  3H3O B;  3LZJ A;  3JAM O;  2YNI A;  5BPM A;  5SWM A;  1KFD A;  2QKK A;  4XH4 A;  3WUH A;  3KLH A;  2PFU A;  2B4J A;  1GLD G;  5AQN A;  3R3L A;  1MA9 B;  2CGK A;  3RRG A;  4B1Y B;  2CGJ A;  1TV6 A;  1U49 A;  2PY5 A;  4CF2 A;  4BE1 A;  2KTQ A;  3V1O A;  4B3T K;  1HJO A;  1BI4 B;  1BCM A;  3EEQ A;  1KSP A;  1G99 A;  3CI5 A;  2YCH A;  4DV0 K;  4IOC L;  4DFJ A;  1S1V A;  3LZI A;  3SUP A;  5KPT A;  4IXC A;  1RDA A;  2V7Z A;  1SQK A;  3CG7 A;  2NRR A;  2YNH A;  1I94 K;  3LWL A;  4L3Q A;  2P9N B;  3OYB A;  4FWM A;  4H0X B;  5C2F A;  1R0A A;  4FM2 A;  4FSV A;  1QHT A;  4ILG B;  2NRT A;  3BP8 A;  2HBJ A;  4FVM A;  1LW0 A;  2GEL A;  4Z4E A;  3QBX A;  3LDO A;  4DTU A;  3MEE A;  2YKN A;  4M7Y A;  3UKU B;  4A2B A;  1BIS A;  4RW8 A;  4BRF A;  1NJI O;  1Q81 O;  4CIF A;  4QS8 A;  1S1T A;  2FF3 B;  3O9R A;  4CK3 A;  1GLB G;  1NGC A;  4LC9 B;  3AO4 A;  4G1Q A;  4H5T A;  3THV A;  5DK5 A;  2VGM A;  5M1N A;  3THX B;  4F2R A;  4H5V A;  5BR8 K;  4CED A;  3I55 N;  4FWR A;  3CCM N;  4DV3 K;  5AFU H;  4DQ8 A;  2JGU A;  3TI0 A;  3ZET B;  4O0J A;  1UOC A;  3ENB A;  3S5T A;  3B8A X;  3N4P A;  3N4Q A;  3K9J A;  1SKR A;  3EKU A;  4DFM A;  4RW6 A;  5C2D A;  1KCF A;  3KK1 A;  4M41 A;  1WAF A;  3CME N;  1YTU A;  4FWS A;  3LP2 A;  1W9H A;  2DPN A;  3LP0 A;  1C6V A;  4BRE A;  3KVG A;  2D5R A;  3C7N B;  5AQT A;  1I3A A;  2YHY A;  3OJS A;  1XNQ K;  4CEZ A;  4NYF A;  3VEY A;  1LWE A;  2NRZ A;  4KRE A;  5T7B A;  4X66 K;  1HNZ K;  4M3X A;  5CZ1 A;  4BDY A;  1RBR A;  3VQC A;  1BCO A;  3V6D A;  1YXQ A;  3WXL A;  2CH6 A;  1BIZ A;  1CZB A;  1N8R O;  3O1W A;  2O8C B;  3CC4 N;  1UA1 A;  4DLE A;  1L3S A;  1RTD A;  1QQN A;  2X6S A;  3U3G A;  1D4X A;  3FZM A;  2QXL A;  1TKD A;  4RTF D;  2PYL A;  1DLO A;  3PO5 A;  3PO4 A;  2GBZ A;  3RWU A;  3OY9 A;  5AQG A;  4NYN A;  3HPO A;  2V51 B;  1HLU A;  4PKI A;  3I8D A;  4BC4 A;  2A1S A;  1NWK A;  4KHP K;  3LDP A;  3CCR N;  2OCE A;  3OYK A;  1ASW A;  5I9E B;  3K5M A;  4B1Z A;  1C1A A;  1RTI A;  2QWL A;  5A2Q O;  4Y0W A;  4KHQ A;  4IOA L;  3AVL A;  2XY5 A;  1WSH A;  2R7Y A;  4CI6 A;  4DR1 K;  4JS5 A;  3RMA A;  3AO5 A;  2GV9 A;  1NK9 A;  2QI2 A;  2KLA A;  3R1X A;  4JI3 K;  3U9Z A;  4ILH A;  3E9L A;  5E26 A;  4DTP A;  4N41 A;  3VQ9 A;  1C1C A;  2VG5 A;  4CFC A;  1BUP A;  2HHU A;  3BEX A;  3KZB A;  4CEO A;  3F5T A;  3S3O A;  1VQ6 N;  4M45 A;  3HYF A;  1KVC A;  3ENO A;  4G9Z A;  1VSL A;  4DR5 K;  2P9P B;  2XY7 A;  3IFR A;  3K58 A;  1B9F A;  3TU5 A;  3P39 A;  1RFQ A;  3FR0 A;  3VQ8 A;  1MWK A;  2YHA A;  4A2A A;  4EIA A;  3SBG A;  3NVM A;  3WXK A;  3TAP A;  3LPU A;  3O3G A;  1RIL A;  5LY3 A;  3R6M A;  3GDQ A;  4ICL A;  4BDP A;  3O9T A;  3C95 A;  4CD1 A;  1C1B A;  2F8T A;  4K8Z A;  1YIT N;  1HPZ A;  3CJC A;  3C6A A;  4BQL A;  2O8F A;  2NRX A;  5JVG L;  1A5X A;  2E2P A;  3LDS A;  1X9M A;  3ZT0 A;  4IZ9 A;  3SUO A;  2OPP A;  3T7Z A;  2ZGZ A;  5EY4 A;  3M8P A;  3OBY A;  2GWK A;  2XO7 A;  5AQK A;  4CEE A;  4I2Q A;  2HHQ A;  3SYZ A;  3VGL A;  3IS9 A;  3FZH A;  3FFI A;  3CYG A;  4BAC A;  4YDU C;  3TAN A;  1EP4 A;  2ZM6 K;  4YHH K;  4DTN A;  3KK2 A;  5I3U A;  3CC2 N;  4CGI A;  1LAW A;  3TAG A;  4KBO A;  4CZK A;  4HCB A;  3NF7 A;  4FLX A;  1JLA A;  3CCU N;  5FRM A;  4BRD A;  3OYH A;  2QTD A;  3FZL A;  3CCV N;  4JEP A;  4DTR A;  4WQ4 A;  1K8K B;  1DKG D;  2WOM A;  4DQI A;  3I0S A;  1VSM A;  1YTA A;  4CF0 A;  4FJI A;  3NAE A;  1IKY A;  4HHT A;  4LH5 A;  5HOO A;  4OX9 K;  2YJF A;  4DV6 K;  5JEN A;  1W97 L;  3VF6 A;  2UUA K;  4FJ8 A;  1XHZ A;  1ZBF A;  1T8E A;  3CER A;  3OHR A;  3TAF A;  1KFS A;  2ASO A;  4FPA A;  4EHT A;  3CCQ N;  4IFE A;  4E7J A;  3IRX A;  1WB9 A;  3OA9 A;  4YFU A;  4H5R A;  4QAG A;  3WT0 A;  3BF3 A;  4NCA A;  3K2P A;  4AHC A;  4JRP A;  4H0T B;  2E2Q A;  1GLC G;  4LF9 K;  3BY5 A;  1S3X A;  1KAY A;  3DLB A;  1RDU A;  4DSI A;  3CQX A;  2VWK A;  3J8A A;  3O5B A;  3NHG A;  3G25 A;  1U4B A;  3IUC A;  4EFH A;  1VQ9 N;  2G8U A;  4OKK A;  1IJJ A;  3ZX3 A;  1C0T A;  1NGA A;  3BGR A;  2G8H A;  4KI4 A;  1YJW N;  2FLO A;  4BWJ A;  2FC0 A;  2E6M A;  3K5O A;  3NF9 A;  1IO2 A;  3SPY A;  4OPJ A;  2J4R A;  3DRP A;  2HVH A;  4IWV A;  3G6E N;  1KLN A;  1G15 A;  2UXC K;  2E1Z A;  3L2Q A;  2OA8 A;  4BEB A;  3C6U A;  3SK3 A;  3HJF A;  2Q0U A;  3HI0 A;  4DCH A;  1XWL A;  4PKG A;  5JMV A;  3LPT A;  4AHT A;  2D0A A;  3SQ0 A;  4FLV A;  2HHS A;  2PAV A;  4B3R K;  3HPG A;  4MLH A;  4R79 A;  4CK2 A;  4JKC A;  1ESV A;  1TK8 A;  3V81 A;  4YOU A;  1HKC A;  4ELV A;  4B1U B;  4CJP A;  2E4L A;  3M8Q A;  1J5O A;  1JLQ A;  2JLE A;  3H45 C;  5KQD A;  3HP9 A;  4TSX A;  2FSJ A;  1X9W A;  4CEA A;  3KIO A;  4YY3 K;  3O9U A;  5CE3 A;  2CGL A;  4JK9 A;  1K9M O;  2YX6 A;  1L3T A;  5AQV A;  4YOX A;  1C0M A;  2VG6 A;  3QEV A;  3ISN C;  4AM7 A;  3WQT A;  4KAZ A;  3QB0 A;  4MO4 A;  4DR6 K;  2YHB A;  4LY7 A;  3ZX2 A;  3MEG A;  4FLY A;  3PUF A;  4I9Q A;  4CGH A;  3TWH A;  4FLZ A;  4DR4 K;  3ZSQ A;  3SAF A;  1IV0 A;  1T3V A;  4FWQ A;  1ATS A;  4BG8 A;  3MX2 A;  1JJ2 M;  5M1P A;  1VQ8 N;  1U2V A;  5FPM A;  1WSG A;  1KXP A;  5M1F A;  3SAG A;  1E4G T;  3M6G A;  4FJH A;  4FO0 A;  3MN7 A;  4CGD A;  4KTZ A;  2ASP A;  1E4F T;  1TKZ A;  1MWM A;  3HSC A;  3LP3 A;  3EE8 A;  3OBW A;  1IBM K;  4N5S A;  2G8W A;  4DV4 K;  3HO1 A;  3O9Q A;  1EKE A;  3GE1 A;  4DTO A;  4HWI A;  4KFB A;  4BRK A;  2IIR A;  3I33 A;  3RMD A;  3HM8 A;  4IFY A;  4FJX A;  4K42 A;  5GIN A;  1YVN A;  4B3S K;  3KD5 E;  4CHZ A;  3NH0 A;  5CHI A;  4PL8 A;  4MFB A;  3T19 A;  2QA4 N;  4FZZ A;  3S9H A;  1CLQ A;  1VAZ A;  1X1P A;  1HKG A;  1LOT B;  4WYB A;  3QFU A;  5AQF A;  3P1G A;  4DFK A;  3RR7 A;  4CZH A;  2ETJ A;  1ASV A;  4KH6 A;  1VQP N;  4BR2 A;  1TL3 A;  3TTD A;  2Z1J A;  4YDU A;  4HVJ A;  5JS1 A;  1J5E K;  3OYM A;  2P9L A;  5LL6 Z;  3H46 O;  5AJ3 K;  3VQB A;  4XEI A;  2ZF5 O;  3DRS A;  1SAZ A;  5M1K A;  3CFR A;  3OYD A;  4WFB L;  5CR4 A;  3EY1 A;  2A41 A;  3CJB A;  3TR8 A;  4OLB A;  3H1Q A;  3EO3 A;  5KQ8 A;  3J7A P;  1XMQ K;  4IJN A;  1QVG M;  4PWD A;  5BN9 A;  1IKW A;  3MWT A;  3O3H A;  2HND A;  4BRA A;  2P9U B;  3HOS A;  2D0C A;  1ATR A;  4JI2 K;  1HR0 K;  1NK0 A;  1RT3 A;  1Q9X A;  3BUZ B;  4B9U A;  1ZC6 A;  4DUZ K;  3OVN A;  4YOW A;  3QDK A;  2F8S A;  2D0B A;  3SUQ A;  1HNI A;  4KH4 A;  2O8B A;  1EQY A;  4W5O A;  3HBT A;  3DXM A;  1A5V A;  4DWI A;  3ATV A;  5SZT A;  4KI6 A;  1VSF A;  5BPN A;  4W5T A;  3K0S A;  3ATU A;  3Q7B A;  2WON A;  3OS2 A;  4OPH A;  1JCE A;  5E41 A;  3UKR B;  4CHP A;  3KLF A;  3EZ5 A;  3RMC A;  4RWT A;  4V19 S;  4JAX A;  1ZBH A;  4M3T A;  3O4N A;  1NMD A;  3CM5 A;  2Y1I A;  4MO5 A;  3SMS A;  1OKJ A;  2VWB A;  5IT9 O;  1JCG A;  4ZTJ A;  4JV5 K;  1O13 A;  5GIP A;  3U9D A;  3GG4 A;  4ISG A;  5JVH L;  2ZJQ L;  4B9Q A;  4AHV A;  4CCH A;  1HRH A;  4IDK A;  4X64 K;  1WN7 A;  3OS1 A;  3C0B A;  4OKE A;  3QFP A;  4BRC A;  3WXJ A;  2A40 A;  2RF2 A;  1KTQ A;  3AO2 A;  1TYQ A;  4JKH A;  3SBT A;  3HP6 A;  1S9E A;  1NK6 A;  4ZTF A;  4A59 A;  5J2P A;  4H8K A;  5HP1 A;  3SJJ A;  4B1W B;  1VSJ A;  4CF8 A;  2HHH K;  4H5W A;  3P4I A;  1RBT A;  4KTQ A;  4WE1 A;  2IVO A;  2RN2 A;  4JHD B;  5MLC Q;  4GNI A;  5JLF A;  1LAV A;  4Q5V A;  4BRI A;  4JKB A;  3SQ2 A;  3L4Q A;  2E6L A;  2Q97 A;  4JI5 K;  2ZJP L;  2V7Y A;  3SAH A;  2UXD K;  5F0X A;  1RT2 A;  2P9S B;  3CCJ N;  4C8O A;  2NNW A;  4CF9 A;  2OPQ A;  1T44 A;  3CHW A;  3LDQ A;  4M3U A;  4FM1 A;  4K0K K;  3ULE B;  1VHX A;  3EZW A;  4A5A A;  3E9P A;  4F4K A;  4DU4 A;  3UKU A;  3CF5 L;  3DRR A;  5BPL A;  2BDP A;  4BC2 A;  2HNY A;  1HPM A;  1RNH A;  3THY A;  3JSM A;  4Z94 A;  3AVJ A;  4BRH A;  3V4I A;  3CPE A;  2VQF K;  2IGI A;  4NXM K;  4E1N A;  1NGE A;  3NGI A;  3SNN A;  3CJA A;  4E7L A;  3QNO A;  3A5N C;  3QML A;  4J8F A;  5KPR A;  5M1O A;  4DHY A;  3MK6 A;  1JCF A;  1IKV A;  3RTV A;  3AA2 A;  1HQE A;  1T05 A;  1TUY A;  4BRM A;  4WQ4 C;  2Z1G A;  4H0O A;  1OH5 A;  4F3O A;  2JWL A;  1EWQ A;  3CPW M;  3CJ7 A;  3AAQ A;  5BN8 A;  4B9L A;  5KRT A;  2GTD A;  3MAQ A;  3LAM A;  3DXK B;  5AQO A;  3I8B A;  3G4S N;  1NGI A;  3BF1 A;  3C7N A;  4E1M A;  2PYJ A;  1LCU A;  2OZM A;  1B9D A;  2WTU A;  4LF8 K;  4B1X B;  2W6L A;  1SZ2 A;  4FJM A;  3ZX0 A;  3O3F A;  3CIP A;  1NG9 A;  3ZT3 A;  4IBN A;  2HBK A;  3MWP A;  4JI1 K;  1BIU A;  1J9A A;  3O4W A;  4WFA L;  3LAL A;  3HOT A;  1JL1 A;  3DM2 A;  4FM0 A;  4CJ4 A;  4DU3 A;  4LFB K;  5AQS A;  3PLA A;  1YUW A;  3C65 A;  2X6N A;  3OYL A;  1SKW A;  3VEX A;  1U04 A;  3PIP L;  4BY9 C;  1FKO A;  1RT7 A;  3ZLJ A;  2YHX A;  3AA4 A;  4BC3 A;  1RBU A;  2A6A A;  5AQL A;  3T1H K;  1GOB A;  1HKB A;  3VPZ A;  1N5Y A;  3MN9 A;  2BH1 A;  3UIQ A;  3L3V A;  3FFK B;  1EWR A;  3V9X A;  1QQO A;  2KFZ A;  1A5W A;  4LF6 K;  3VA0 A;  4KKO A;  1L5U A;  1OH7 A;  2W41 A;  1S1U A;  5E84 A;  4FK4 A;  4AHR A;  4HTL A;  2OPR A;  3OYJ A;  3HTV A;  3VGM A;  5HBM A;  1DGK N;  3E1Y A;  4QCL A;  4CGJ A;  3ITH A;  1ZBI A;  4BEC A;  1U48 A;  1RDC A;  2P9K A;  2NRV A;  4FJK A;  4MDA A;  1VQ4 N;  3J7Z O;  4N76 A;  1VSI A;  4RCH A;  4DSE A;  5LJV A;  4E7K A;  2I7N A;  4CBW A;  3VER A;  4E72 A;  4CW7 B;  1RT6 A;  4NCB A;  3DMJ A;  4ID5 A;  3O80 A;  1K6Y A;  4BRL A;  3KWG A;  4FPB A;  3NFA A;  3QIC A;  5ADX H;  2KQ2 A;  4JKF A;  4ILJ A;  4CK1 A;  2OYQ A;  4OVL A;  3LDL A;  2RE2 A;  4DTJ A;  4O8K A;  3NH1 A;  1T6D A;  3OYN A;  2UYT A;  2V52 B;  4K25 A;  1RT4 A;  2FSK A;  1WUA A;  4NCG A;  4U67 L;  1Z26 A;  3O4Q A;  2CH5 A;  4JD2 A;  3D2F A;  3E01 A;  4CBX A;  4LSL A;  4HCC A;  3GOI A;  3U3Y A;  5GAD P;  4A61 A;  1YI2 N;  3MN6 A;  3T69 A;  4JI4 K;  4DV5 K;  3WNG A;  1NGJ A;  4CER A;  1LWF A;  4IEI A;  2OTL N;  2OAN A;  3PSI A;  3TTF A;  2O4I A;  3O6W A;  1HUX A;  4DMN A;  1VQN N;  4FK2 A;  1W2B M;  4KB0 A;  4AHU A;  3MXI A;  4Z4C A;  4FYD A;  3VF4 A;  1VQL N;  2IVN A;  3NCI A;  3ULD A;  3NGY A;  2O8D A;  1IH7 A;  4F8R A;  3DLL L;  4IJA A;  1CZA N;  4ISE A;  3ZSY A;  4U7B A;  4BC5 A;  1NBW A;  1TL1 A;  4BQZ A;  4CJ5 A;  2OTJ N;  2EHG A;  2DY4 A;  5JLH A;  3SZ2 A;  2C1I A;  5GIO A;  4Z4H A;  4IEE A;  2OZS A;  4PUO A;  3AGR A;  2BGG A;  4M3Z A;  4DFP A;  1RTJ A;  4O44 A;  4IDH A;  1Z6R A;  2E2O A;  3QIN A;  4GV6 A;  1RGI A;  4BE2 A;  4E7H A;  3F9M A;  1KVB A;  3FZF A;  4CEC A;  1VQ7 N;  1Q82 O;  1HYV A;  2E88 A;  1N34 K;  4AH9 A;  3D45 A;  2BAN A;  3HVR A;  3VQA A;  3C6T A;  1NGD A;  5C15 A;  4WCE L;  4LFC K;  3AVM A;  3M8S A;  4KPY A;  1WSI A;  1LW2 A;  5FDL A;  4JKA A;  4DTM A;  1HNV A;  3AO1 A;  3K59 A;  4Z0U A;  3PSF A;  2QKB A;  4JN4 A;  4CHO A;  4W5Q A;  2E20 A;  3U4L A;  5ADX A;  4QOZ B;  3ENH A;  3FZK A;  1ZBU A;  3IDH A;  3ZT4 A;  3ZSX A;  1H1V A;  1QS4 A;  3OTO K;  4J2E A;  2O8F B;  3WQU A;  1GOA A;  4FOE A;  3ZEU A;  3AA3 A;  2B5J A;  3BZC A;  3VF2 A;  2YJE A;  3NBP A;  3G10 A;  4KHU A;  5K14 A;  4BVO A;  4CEB A;  2VYP A;  3SJH A;  2QWM A;  1MU2 A;  4LD0 A;  4RW4 A;  2A5X A;  1Y97 A;  3O8M A;  1VRT A;  4GMJ B;  1T7P A;  1NGG A;  3V1Q A;  3V1R A;  1KD1 O;  4IOX A;  1J54 A;  4H4O A;  1S72 N;  5F1X A;  3WXM B;  1SV5 A;  2BE2 A;  3IMX A;  4B9S A;  3MX5 A;  4BR4 A;  1FKP A;  4BRO A;  4CZG A;  2ASM A;  4PY5 A;  3VEV A;  4AHS A;  1UWB A;  1ZBS A;  3RSE A;  3UB5 A;  5AZI A;  1S6P A;  1NNE A;  5FLX O;  3DLH A;  5CY4 A;  4JK8 A;  4YNQ A;  1NKC A;  3OJU A;  4N47 A;  3OYI A;  4CZM A;  4J2B A;  2WUS A;  3HK2 A;  3NF8 A;  3AA5 X;  4K41 A;  3MXM A;  1QSL A;  4DQP A;  4B9V A;  4GVM A;  3SV4 A;  4J2A A;  1U45 A;  1WBD A;  3ID6 A;  4AM6 A;  3GL1 A;  5C42 A;  1P8Z A;  4BRP A;  1NOY A;  2HF4 A;  5FRN A;  3ID8 A;  5AQZ A;  4PA1 A;  1CXU A;  1HX1 A;  1X9J A;  3DOL A;  3J7Y P;  2Q1N A;  2HW3 A;  1Q7Y O;  2FBX A;  1J6Z A;  4DB3 A;  4JI7 K;  3MDQ A;  3VQQ A;  4JI0 K;  1FK9 A;  1S22 A;  4OJR A;  4C1N K;  1QTM A;  5IWA K;  3I0R A;  5BRF A;  2GUP A;  1OVY A;  1D8Y A;  3WNE A;  1XMO K;  5AQM A;  1JKH A;  4FLT A;  4DSK A;  2QXF A;  4B9M A;  1YJN N;  4KB1 A;  1DTT A;  1VQO N;  2D4W A;  1HYZ A;  4AQY K;  3KK7 A;  1L3U A;  1Y64 A;  3MEC A;  5D3G A;  3KKR A;  5M1Q A;  1T6C A;  4DKW A;  4ELU A;  4PQU A;  1FXX A;  5LMU K;  3OW2 M;  1JXB A;  4BG9 A;  4FJL A;  3EL2 A;  3D2E A;  1VSH A;  4CZJ A;  3ASM A;  3ZSZ A;  4PKH A;  3K57 A;  2FSN A;  2IOC A;  1M90 O;  3CM6 A;  2F9T A;  3CFO A;  4OGE A;  1NJY A;  4BR7 A;  3DYA A;  3W0L A;  1BG3 A;  1IKX A;  4C8M A;  3PV8 A;  4JYA K;  4IG3 A;  3ZSO A;  1JLB A;  4YOR A;  4EP5 A;  5KPZ A;  1D9D A;  2HVI A;  2D1K A;  1VQK N;  2PBD A;  2AJQ A;  1QQM A;  1TK5 A;  3CJ9 A;  3AVG A;  4H4M A;  2IS3 A;  3DAW A;  3THW A;  3KD1 E;  5ELZ A;  3V9U A;  1VSD A;  2O8E A;  4CHQ A;  3JXU A;  3EKS A;  4CZL A;  1BOT O;  1QE1 A;  2P51 A;  2P9I A;  3QER A;  1LWC A;  4FK0 A;  4M3R A;  2Q31 A;  4LSN A;  1B92 A;  4H0P A;  1GLJ O;  2YNG A;  3CXC M;  5FPN A;  2AA4 A;  1WLJ A;  3MXJ A;  3CYM A;  1HYS A;  1WBB A;  1U47 A;  1ZYQ A;  4K43 A;  1QZ5 A;  1IBK K;  1VQM N;  1GLL O;  5AZJ A;  3HL8 A;  3C6H A;  2HHX A;  2HBM A;  1U2V B;  4OPK A;  2NRW A;  4EHU A;  3L2U A;  3DWL A;  3EN9 A;  4FLW A;  5DMR A;  3R8E A;  1NOZ A;  3VTI A;  1VSK A;  4NO7 A;  3MN5 A;  4CIG A;  4DUY K;  2GEM A;  2F9W A;  4HUG A;  3E9O A;  4A62 A;  5J2Q A;  3VQ7 A;  1CXQ A;  3SQ1 A;  4FWP A;  2F4V K;  3VQP A;  4JKD A;  3T3F A;  5CYM A;  4W5R A;  3IAY A;  1RT1 A;  3A5O C;  3CCS N;  3MCA B;  2E2N A;  2JWK A;  3PX0 A;  3KLE A;  3F9K A;  3O08 A;  4O55 A;  4JRQ A;  3DLR A;  5KGW A;  4JI8 K;  4DSJ A;  4XH5 A;  4LF5 K;  3VQ5 A;  2ZD1 A;  3A8Y A;  3MCP A;  3KJV A;  3NMU A;  3JS6 A;  4CEQ A;  5HRP A;  2W42 A;  1OVQ A;  3M1F A;  3TSQ A;  3ZSW A;  2ZJR L;  3CCE N;  3CQ8 A;  4I6M A;  4HTU A;  3E66 A;  4H0V B;  1X9S A;  3VTH A;  2HBL A;  5BR9 A;  5DM6 L;  2BUP A;  3D6R A;  5CYQ A;  4BGA A;  5LMN K;  4FJN A;  1WOQ A;  4PHT X;  1NK7 A;  5AQY A;  4CBU A;  4NB4 A;  4OPA A;  2KZM A;  1N32 K;  4B3M K;  4BGB A;  4MLE A;  4K8X A;  4JKG B;  4BR5 A;  1BHL A;  1TVR A;  1ZBL A;  3AVB A;  4CZE A;  4CJL A;  4BE0 A;  3TAQ A;  1BI4 A; 
#chains in the Genus database with same CATH homology
 5AQW A;  4YOY A;  2EWS A;  4KBO A;  4CZK A;  2ZGY A;  4FWO A;  3R9P A;  4CZI A;  4FWN A;  2QWR A;  2QWN A;  3I56 N;  4WFN L;  2QWO A;  3CCU N;  4BRD A;  2W41 A;  2KKZ A;  5E84 A;  4H0Y B;  2QTD A;  3FZL A;  3WEE B;  4HTL A;  3CCV N;  4JEP A;  3LM9 A;  2NLX A;  4WQ4 A;  3HTV A;  1TUU A;  1K8K B;  3VGM A;  1DGK N;  2P9N A;  1DKG D;  3DJC A;  3E1Y A;  3LL3 A;  1V4S A;  2HMP A;  1XQS C;  4BEC A;  5BRH A;  3EE9 A;  3KHY A;  2P9U A;  2P9K A;  3H1V X;  4C23 A;  2NRV A;  2YJF A;  5HOO A;  5DM7 L;  3DXM B;  1W97 L;  3VF6 A;  4MDA A;  1VQ4 N;  3J7Z O;  2NRH A;  1GLA G;  4RCH A;  5EXW A;  3CER A;  3O9S A;  5LJV A;  3OHR A;  5B8H A;  2I7N A;  1EO1 A;  2D0P A;  4CBW A;  2ASO A;  4FPA A;  5AQI A;  3VER A;  4EHT A;  3CCQ N;  1YIJ N;  4UY8 O;  4BR9 A;  2IVP A;  4IFE A;  3VES A;  3O80 A;  4BRL A;  3K9K A;  3KWG A;  3OA9 A;  2I7P A;  4XH1 A;  4H5R A;  4OO1 J;  3WT0 A;  4FPB A;  3BF3 A;  3FE1 A;  4GV3 A;  3QIC A;  5ADX H;  4YOV A;  2GWJ A;  4JKF A;  4FVU A;  4BRQ A;  3SLC A;  2VGN A;  4H0T B;  4ILJ A;  3GBT A;  4BRG A;  2E2Q A;  1GLC G;  3L6Q A;  4FWK A;  3PIO L;  1S3X A;  4IO9 L;  1KAY A;  2RE2 A;  3LDL A;  3UKR A;  3WXI A;  4BE7 B;  1RDU A;  4O8K A;  4NLB A;  3CQX A;  2QWP A;  3M5R A;  1T6D A;  4GY2 B;  3J8A A;  3O5B A;  3VOV A;  2UYT A;  2V52 B;  4K25 A;  1K8A O;  2Q0R A;  2HST A;  3G25 A;  3VEW A;  2FSK A;  3IUC A;  1WUA A;  4EFH A;  4U67 L;  1TYQ B;  1VQ9 N;  3G4S N;  1IJJ A;  1RDW X;  2CH5 A;  3ZX3 A;  1KAX A;  3AAP A;  4JD2 A;  1K73 O;  1NGA A;  3D2F A;  4CBX A;  3D2E B;  2A42 A;  1YJW N;  1QZ6 A;  2FLO A;  3ZET A;  3GOI A;  2C1G A;  2VCP A;  5JIC A;  2ITM A;  4A61 A;  5GAD P;  1YI2 N;  3MN6 A;  3T69 A;  3S41 A;  5AQX A;  1NGJ A;  1IG8 A;  2J4R A;  4JKG A;  4IEI A;  2Q2R A;  4IWV A;  3G6E N;  2OTL N;  2OAN A;  3TTF A;  3O6W A;  1HUX A;  1VQN N;  2HF3 A;  3NVK A;  2E1Z A;  1W2B M;  5EOY A;  2FF6 A;  5AR0 A;  4BEB A;  3SK3 A;  1NLV A;  2Q0U A;  2IVN A;  3VF4 A;  1VQL N;  3HI0 A;  1BU6 O;  3HZ6 A;  5F2R A;  4DCH A;  4PKG A;  1VQ5 N;  5JMV A;  1P90 A;  4F9O A;  2Q36 A;  4JHD A;  3DLL L;  3CJ1 A;  4IJA A;  1CZA N;  4ISE A;  2PAV A;  3WEE A;  4MLH A;  4R79 A;  2HOE A;  4U7B A;  2F7T A;  4JKC A;  2P9I B;  4BC5 A;  1NBW A;  1ESV A;  4BQZ A;  5H1S Q;  4YOU A;  2OTJ N;  1HKC A;  4B1U B;  1YHQ N;  5JLH A;  2C1I A;  5GIO A;  3KWI A;  2P9S A;  2QEX N;  4IEE A;  3CCL N;  2H3G X;  3H45 C;  5BRE A;  3AGR A;  5KQD A;  2W00 A;  2FSJ A;  1Q18 A;  1XC3 A;  2P9L B;  3O9U A;  3ULE A;  5CE3 A;  2CGL A;  4JK9 A;  1K9M O;  1BDG A;  4IDH A;  1BO5 O;  2YX6 A;  4QS9 A;  3M3Z A;  5AQV A;  4YOX A;  1Z6R A;  2E2O A;  5EX5 A;  5AZJ B;  4AM7 A;  4GV6 A;  1RGI A;  3WQT A;  3H6E A;  3VEZ A;  1ZXO A;  3QB0 A;  4MO4 A;  3F9M A;  3FZF A;  3FLC O;  5GAH P;  2E88 A;  3TTC A;  3ZX2 A;  1Q82 O;  1VQ7 N;  3P38 A;  3Q7C A;  3LM2 A;  4EAH D;  3SAF A;  5C0Y A;  1C0F A;  1T3V A;  4FWQ A;  1C0G A;  1ATS A;  1NGD A;  3MX2 A;  4BG8 A;  5C15 A;  4O5F A;  1JJ2 M;  3CD6 N;  4WCE L;  3FGU A;  5M1P A;  1VQ8 N;  2YHW A;  5BRD A;  3CC7 N;  1U2V A;  5FPM A;  1KXP A;  4JKA A;  2D0O A;  5M1F A;  3O1B A;  1E4G T;  3SAG A;  3M6G A;  4JN4 A;  4FO0 A;  2E20 A;  3U4L A;  3MN7 A;  5ADX A;  1KQS M;  3ENH A;  3LDN A;  4WQ5 C;  3FZK A;  2ASP A;  1E4F T;  3HSC A;  1MWM A;  1U6Z A;  1BA0 A;  2QW9 A;  3IDH A;  3VEO A;  5FPD A;  1QVF M;  3EE8 A;  3L0Q A;  4CD3 A;  1GLE G;  3OBW A;  2RHK A;  2NZT A;  1H1V A;  2P9P A;  1XUP O;  4I6M B;  3DXK A;  3O9Q A;  3WQU A;  3GE1 A;  3A5L C;  3VMF B;  3H3O B;  4FOE A;  3ZEU A;  4HWI A;  2KHO A;  4BRK A;  3VF2 A;  2IIR A;  2YJE A;  3I33 A;  1KAZ A;  5BPM A;  3HM8 A;  4BVO A;  4K42 A;  5GIN A;  1YVN A;  5AQQ A;  1R59 O;  4XH4 A;  3WUH A;  2VYP A;  5CHI A;  2PFU A;  4PL8 A;  3SJH A;  1YF5 L;  2QWM A;  1GLD G;  5AQN A;  4FL9 A;  3R3L A;  1MA9 B;  2CGK A;  5TKY A;  5LJW A;  2QA4 N;  2A5X A;  1VAZ A;  4B1Y B;  1HKG A;  1LOT B;  2CGJ A;  3AGK A;  3O8M A;  3QFU A;  4WYB A;  2E1Y A;  5AQF A;  1NGG A;  3A0I X;  4CZH A;  3TSU A;  4QS7 A;  1KD1 O;  1M1K O;  4IOX A;  4KH6 A;  1VQP N;  4BR2 A;  1S72 N;  3TTD A;  3G71 N;  5GAE P;  1HJO A;  4YDU A;  4JK7 A;  5F1X A;  3WXM B;  4AF1 A;  2P9L A;  3H46 O;  3IMX A;  3MMV A;  4KH5 A;  3MX5 A;  4BR4 A;  4XEI A;  2ZF5 O;  1SS6 A;  1G99 A;  1SAZ A;  2ASM A;  2YCH A;  3CI5 A;  4BRO A;  4CZG A;  3VEV A;  5M1K A;  2QM1 A;  4E1J A;  1BWF O;  1ZBS A;  1V4T A;  3RSE A;  3UB5 A;  5AZI A;  4WFB L;  5CR4 A;  4IOC L;  2A41 A;  3CJB A;  3H1Q A;  3EO3 A;  5KPT A;  4IXC A;  5KQ8 A;  1Q86 O;  2V7Z A;  4IJN A;  4JK8 A;  1SQK A;  1QVG M;  2NRR A;  5BN9 A;  4L3Q A;  2P9N B;  4O8U A;  3MWT A;  2W40 A;  4FWM A;  4H0X B;  4CZM A;  4YOT A;  4BRA A;  5C2F A;  3CMA N;  2WUS A;  5AQH A;  4BRN A;  4FSV A;  1QHA A;  1YAG A;  4ILG B;  4K41 A;  2NRT A;  3VGK A;  2P9U B;  2P9K B;  3TSP A;  3HOS A;  3BP8 A;  1ATR A;  2HBJ A;  2GEL A;  3UE5 A;  3QBX A;  3LDO A;  3F2K A;  3BUZ B;  3VEN A;  1ZC6 A;  3ID6 A;  4AM6 A;  1K8K A;  2E8A A;  1NGH A;  3GL1 A;  1P8Z A;  3QDK A;  1ATN A;  4M7X A;  3U8X A;  4M7Y A;  4BRP A;  3UKU B;  4WQ5 A;  2HF4 A;  4A2B A;  4KH4 A;  1EQY A;  4BRF A;  3ID8 A;  1NJI O;  5AQZ A;  1X9J A;  1HX1 A;  1Q81 O;  4QS8 A;  3HBT A;  3DXM A;  2FF3 B;  2Q1N A;  3ATV A;  3O9R A;  1Q7Y O;  5AFU A;  2QWQ A;  1J6Z A;  4DB3 A;  5BPN A;  1GLB G;  1NGC A;  3MDQ A;  4NLC A;  4LC9 B;  1S22 A;  3ATU A;  3Q7B A;  4H5T A;  4C1N K;  4OPH A;  1JCE A;  3L4I A;  3UKR B;  5BRF A;  5C10 A;  4RWT A;  2GUP A;  1OVY A;  4JAX A;  2VGM A;  1KC8 O;  5FPE A;  1NMD A;  1NGF A;  3CET A;  5AQM A;  4MO5 A;  5M1N A;  4H5N A;  3SMS A;  1OKJ A;  4H5V A;  2VWB A;  3I55 N;  1JCG A;  1YJN N;  4FWR A;  3CCM N;  1O13 A;  5AFU H;  3U9D A;  4DQ8 A;  3GG4 A;  4ISG A;  2GX9 A;  4JD2 B;  5GIP A;  2ZJQ L;  4B9Q A;  3VET A;  5JVH L;  3D2F B;  1VQO N;  2D4W A;  3KK7 A;  3ZET B;  1Y64 A;  3ENB A;  3B8A X;  3N4P A;  3N4Q A;  3C0B A;  3QFP A;  3K9J A;  3EKU A;  5M1Q A;  4BRC A;  3WXJ A;  1T6C A;  2A40 A;  4DKW A;  4A5B A;  2WC9 A;  5C2D A;  1TYQ A;  4BVP A;  2WFB A;  4JKH A;  3SBT A;  1NGB A;  3OW2 M;  2ZWH A;  4C1N I;  3CME N;  4BG9 A;  4FWS A;  4FOI A;  3EL2 A;  3D2E A;  2DPN A;  4A59 A;  1BA1 A;  1DT9 A;  4BRE A;  3KVG A;  4CZJ A;  4M63 C;  4MDB A;  4WF9 L;  3C7N B;  4PKH A;  5AQT A;  2FSN A;  1M90 O;  4PL7 A;  4B1W B;  2YHY A;  2F9T A;  1X3N A;  4H5W A;  3P4I A;  3A5M C;  4BR7 A;  3VEY A;  3W0L A;  1BG3 A;  2IVO A;  2NRZ A;  4JHD B;  5MLC Q;  4GNI A;  5JLF A;  3D7E O;  4BRI A;  4JKB A;  3AAR A;  3L4Q A;  1YXQ A;  3WXL A;  3IKM A;  4YOR A;  5KPZ A;  2CH6 A;  2Q97 A;  1N8R O;  2D1K A;  2ZJP L;  1VQK N;  2PBD A;  1QQM A;  2V7Y A;  3CJ9 A;  3SAH A;  3O1W A;  5F0X A;  4YOW A;  2P9S B;  3CCJ N;  3DAW A;  1YJ9 N;  2NNW A;  5ELZ A;  1T44 A;  2WBN A;  3QBW A;  5AQU A;  3CC4 N;  3JXU A;  3EKS A;  1QQN A;  3CHW A;  3LDQ A;  4CZL A;  1D4X A;  1BOT O;  1X3M A;  2P9I A;  2QXL A;  3FZM A;  3ULE B;  3EZW A;  4JKE A;  4IO8 A;  4RTF D;  3E9P A;  2FXU A;  3SMP A;  4A5A A;  3UKU A;  3CF5 L;  5AQG A;  2Q31 A;  5BPL A;  4BC2 A;  2V51 B;  1HLU A;  4H0P A;  4PKI A;  1GLJ O;  4BC4 A;  1HPM A;  1NWK A;  4BR0 A;  3CXC M;  4XJX A;  3LDP A;  5FPN A;  2AA4 A;  3CCR N;  4Z94 A;  3HRG A;  4BRH A;  5HL7 L;  5EVZ A;  5I9E B;  3CPE A;  2A3Z A;  4B1Z A;  1NGE A;  2QWL A;  1MDU B;  4K43 A;  4Y0W A;  4IOA L;  1QZ5 A;  3CJA A;  1VQM N;  1GLL O;  5AZJ A;  1NM1 A;  3A5N C;  3QML A;  4J8F A;  5M1O A;  5KPR A;  3ZYY X;  4CI6 A;  3C6H A;  4DHY A;  1Z05 A;  2HBM A;  1U2V B;  3MK6 A;  2NRW A;  4EHU A;  3DWL A;  1JCF A;  3EN9 A;  3R8E A;  3VTI A;  5TKW A;  2QI2 A;  2KLA A;  3R1X A;  4NO7 A;  3MN5 A;  4CJ7 A;  3U9Z A;  1TUY A;  4BRM A;  4WQ4 C;  2GEM A;  3E9L A;  2F9W A;  4H0O A;  4ILH A;  5E26 A;  2JWL A;  3E9O A;  4A62 A;  3CPW M;  3CJ7 A;  3AAQ A;  5BN8 A;  1BUP A;  4FWP A;  2GTD A;  3BEX A;  3KZB A;  3F5T A;  4JKD A;  1VQ6 N;  3ENO A;  4GVE A;  2AP1 A;  4G9Z A;  2P9P B;  3A5O C;  4A57 A;  3CCS N;  3IFR A;  2E2N A;  3DXK B;  2JWK A;  3MCA B;  5AQO A;  3P39 A;  3TU5 A;  1RFQ A;  3FR0 A;  3O08 A;  3I8B A;  4EIA A;  1MWK A;  3ZEU B;  3CQY A;  1NGI A;  3BF1 A;  3C7N A;  3NVM A;  5AQJ A;  4XH5 A;  3SBG A;  3WXK A;  4A2A A;  5C12 A;  3R6M A;  3GDQ A;  5LY3 A;  1LCU A;  3A8Y A;  3MCP A;  3O9T A;  3TPQ A;  4CD1 A;  3JS6 A;  5AQR A;  3NMU A;  4B1X B;  1SZ2 A;  3M1F A;  3ZX0 A;  1YIT N;  4FWL A;  3TSQ A;  2ZJR L;  3CCE N;  1DEJ A;  3C6A A;  3CIP A;  3CJC A;  4GV9 A;  4BQL A;  2YI1 A;  4I6M A;  3E66 A;  4H0V B;  1ILY A;  2NRX A;  3VTH A;  5JVG L;  2HBL A;  5BR9 A;  5DM6 L;  2E2P A;  2HBK A;  3MWP A;  2BUP A;  3D6R A;  4IZ9 A;  3T7Z A;  2ZGZ A;  3O4W A;  4BGA A;  5EY4 A;  4WFA L;  3HOT A;  3OBY A;  1WOQ A;  4PHT X;  5AQY A;  2GWK A;  3W3D A;  4CBU A;  4CZF A;  5AQK A;  5AQS A;  4NB4 A;  3PLA A;  3RVC A;  5GAG P;  3VGL A;  1YUW A;  3C65 A;  4OPA A;  3FZH A;  4BGB A;  3VEX A;  3PIP L;  4MLE A;  4BY9 C;  4YDU C;  4JKG B;  4BR5 A;  2BTF A;  2YHX A;  4BC3 A;  2A6A A;  5AQL A;  3RSE B;  3P31 A;  5AZI B;  4CZE A;  1GLF O;  3H3N O;  4JNE A;  4H03 B;  1HKB A;  3VPZ A;  3MN9 A;  2BH1 A;  3CC2 N;  4ISF A;  3FFK B;  5AQP A;  4B1V A;  1QQO A;  3AY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...