3DXKA

Structure of bos taurus arp2/3 complex with bound inhibitor ck0944636
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
415
structure length
397
Chain Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Characterization of two classes of small molecule inhibitors of Arp2/3 complex
pubmed doi rcsb
molecule tags Structural protein
total genus 120
structure length 397
sequence length 415
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3dxkA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxkA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxkA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3dxkA04
5BPMA 5AR0A 4F9OA 3BF3A 3CERA 3M6GA 5BN8A 1GLBG 3JS6A 4LC9B 3FZMA 5AQHA 5FPMA 3R8EA 4BRLA 4CZEA 2HF4A 3FLCO 3O1WA 2E2OA 4O8KA 4H5TA 3L0QA 3VGLA 2CGKA 1KAYA 2Q0RA 3O8MA 2D1KA 2VYPA 4C23A 4MLEA 3VOVA 5AQRA 5AZJA 4M63C 5TKYA 2CGJA 2FF3B 3P4IA 4JNEA 3ZETB 5AQZA 4BGAA 3WUHA 2YHWA 4IXCA 3VF4A 1G99A 2P9LB 5BR9A 4CJ7A 3FFKB 2KHOA 4A61A 5AQQA 2GWKA 5AQXA 4BC5A 5AQVA 4B9QA 1ZBSA 5B8HA 1HKGA 5KPZA 4K42A 3W3DA 2IVPA 1NLVA 3QBXA 1JCEA 4BQLA 3SK3A 3OHRA 3O08A 4XH1A 3CI5A 4FWLA 4M7XA 5CE3A 1X3NA 2QWOA 3QB0A 4RTFD 4BG8A 1JCGA 4CI6A 3CJ1A 4H0YB 2QWQA 2QWPA 3MK6A 2A6AA 3H1QA 4BC4A 3O6WA 3J8AA 1WUAA 4H5VA 1ATSA 3DXMA 3HTVA 5AQWA 1E4FT 1LOTB 2P9PB 5BREA 1T6CA 2P9IB 4IJNA 4A62A 3D7EO 5EX5A 1S3XA 2P9KB 3ZEUA 2QWLA 2YJFA 3A0IX 2P9SA 4WYBA 1IG8A 3U9DA 3D2EA 1NWKA 3WEEA 3CJCA 3GG4A 3VEXA 3I8BA 3UE5A 4IWVA 3WXKA 5AZIA 3EKUA 1BA1A 3O1BA 3SJHA 3VGMA 1T6DA 4FWKA 2H3GX 4RCHA 1XQSC 3O80A 5KPTA 3WXIA 3A8YA 2I7PA 1YUWA 3WXLA 1BWFO 5EY4A 3CJ7A 5F1XA 3MN5A 5BPNA 3CJAA 4CZKA 3VESA 2QXLA 2W40A 3QFPA 2V7YA 4BQZA 3VGKA 5ELZA 1X9JA 3FE1A 4CZLA 3VENA 1QQMA 4Y0WA 4BGBA 3ENHA 3UKRA 1NGBA 4WQ4A 2PAVA 3MDQA 4BRMA 4JD2A 2AA4A 1DKGD 1Q18A 1ZXOA 4QS8A 3ZX2A 4FWSA 1E4GT 3WQUA 2D0OA 5FPDA 2GEMA 4CBXA 1NGAA 1KAZA 2NLXA 1XUPO 4FWNA 4BR9A 3DJCA 3VPZA 2YHXA 5E26A 4BRCA 2Q31A 4JHDB 1JCFA 2ASOA 2NZTA 1U2VB 5AQUA 1MWMA 2A3ZA 5AQFA 4BVOA 1YXQA 2EWSA 3VETA 3VEWA 2QWNA 5LJVA 4MO4A 2CH6A 2HOEA 2DPNA 1SZ2A 2D0PA 4H03B 2J4RA 1K8KA 3SLCA 3VEYA 4PL7A 3WXJA 3IFRA 4DQ8A 2Q97A 3S41A 3WT0A 4IO8A 4NO7A 1NGFA 3UKUB 3IMXA 3DXKB 3LDNA 2ZGYA 2OANA 5EOYA 1NGDA 5AQIA 5KQ8A 1BO5O 2E88A 3CHWA 1WOQA 5AQOA 3QBWA 5AQYA 4FWRA 5JLHA 1P8ZA 4GY2B 3QMLA 1OKJA 3MN6A 1CZAN 1S22A 1QZ6A 3EZWA 3H45C 3FZHA 4H0PA 2P9SB 2Q0UA 1QQOA 1GLFO 3MCPA 2FXUA 5FPNA 4EFHA 4PKIA 4WQ4C 4BR5A 1BG3A 1DEJA 1RDWX 5AQLA 3LDLA 2P9NA 4H0OA 3BP8A 3D2FA 1NGJA 4FWPA 4IJAA 3C0BA 4CD1A 1NGGA 2WUSA 2FSKA 1HKBA 4ISEA 2HMPA 1X3MA 4JAXA 4CD3A 4DB3A 2E2QA 1MA9B 3HZ6A 4FWMA 3QFUA 3LM2A 4CZHA 4BC3A 4K41A 3DAWA 3C7NB 3KVGA 1NM1A 3GDQA 3LL3A 4BRFA 1GLJO 2QW9A 2A5XA 3ULEB 2VCPA 4I6MB 1V4SA 4CZMA 5AFUA 3EN9A 3B8AX 2E8AA 3ZETA 2NRHA 2E2PA 3R9PA 3A5NC 1NGCA 2P9LA 1QQNA 3EKSA 3QICA 1HLUA 5BRFA 4XH5A 3AAPA 4KBOA 2P9UB 4GNIA 3CJ9A 1GLEG 3RSEB 4B1XB 1U6ZA 3R6MA 4FWQA 4RWTA 4CZIA 3QDKA 1XC3A 1QZ5A 2CH5A 2E20A 5AQMA 3U4LA 1NBWA 3G25A 3LDPA 5AQNA 1GLAG 1HKCA 2GUPA 5LY3A 5KQDA 3MMVA 3FZKA 3H6EA 5AQKA 4JN4A 4B1ZA 4B1UB 4CZGA 4BRPA 5EVZA 2ITMA 3ZX0A 3CQXA 3HBTA 4AM6A 5BRDA 1H1VA 4BRIA 2Q36A 5JMVA 4A2AA 3TPQA 2ASPA 3AAQA 5LJWA 2GWJA 5AZJB 2VWBA 3CJBA 2P9PA 2A41A 2P9IA 4H5WA 1J6ZA 4BR7A 4CBUA 5BRHA 2E1ZA 2D4WA 2ASMA 1SAZA 1RFQA 2P9KA 2UYTA 4NB4A 4CZFA 4FOEA 5ADXA 4HWIA 2F9WA 2IVNA 3IUCA 3SMSA 3U8XA 3A5OC 4BREA 4WQ5A 1YVNA 3AARA 3CIPA 2Q1NA 4A2BA 5E84A 4EHUA 3VEVA 1HPMA 3GBTA 2YI1A 3MN9A 4DCHA 1Y64A 5AQJA 4K43A 4BROA 4BRDA 1TUUA 4BRAA 4BRQA 2FSJA 3TU5A 1IJJA 1KAXA 3M3ZA 4CZJA 4PKHA 4QS7A 3VERA 5JICA 2BTFA 1BA0A 4FPBA 3ZX3A 5KPRA 5AQSA 4ISGA 2BUPA 3H3NO 1NMDA 1HUXA 3HSCA 4AM7A 3DXMB 3HI0A 3UB5A 2IVOA 4IZ9A 2PBDA 4H0TB 1RGIA 1TYQA 4L3QA 3ZEUB 5F0XA 2E2NA 4M7YA 4BR0A 1NGIA 4MO5A 3A5LC 4Z94A 4B1YB 2V7ZA 1GLDG 4FWOA 2QM1A 4BR4A 4BRNA 1ESVA 3D2EB 4H0XB 3WEEB 2YCHA 4JHDA 5AZIB 3ATVA 1HJOA 1U2VA 1ATNA 1T44A 4QS9A 3EL2A 3BUZB 3FR0A 4PL8A 3KZBA 3JXUA 4MLHA 3AY9A 4PKGA 3ENOA 3U9ZA 3LDQA 1NGEA 5I9EB 4BVPA 2I7NA 1BUPA 4BRGA 3H46O 1HX1A 3EO3A 2F9TA 4WQ5C 5ADXH 1TUYA 2GELA 1EQYA 4YDUC 5EXWA 3UKRB 3UKUA 1DGKN 3DXKA 1GLLO 2FLOA 3GOIA 2ZGZA 3H1VX 3MN7A 4JD2B 1MWKA 1Z6RA 4FSVA 4B1WB 2GTDA 3IDHA 5BN9A 1SQKA 5AQTA 3VF6A 2FF6A 2YJEA 2IIRA 2QWMA 3HM8A 3LM9A 3H3OB 2HF3A 3BF1A 3W0LA 4BRHA 4K25A 3O5BA 4BC2A 3I33A 4E1JA 4H5NA 3BEXA 1BOTO 2AP1A 3CETA 4H5RA 1C0FA 3L4IA 5AQPA 4EAHD 4O5FA 3SMPA 2ZF5O 5F2RA 3GL1A 1BDGA 4H0VB 4BRKA 3FGUA 2ZWHA 2CGLA 1K8KB 4EIAA 4BR2A 2A42A 4EHTA 5BPLA 4FL9A 2FSNA 2V52B 4BG9A 5AQGA 3VF2A 3ATUA 2A40A 1ZC6A 4XH4A 1Z05A 2QWRA 3L6QA 3M1FA 1YAGA 1R59O 3O4WA 4ISFA 3DWLA 3VEZA 1KXPA 5FPEA 3FZFA 3FZLA 4B1VA 3C7NA 1D4XA 4XEIA 3KHYA 2W41A 1NGHA 2Q2RA 3ULEA 4FOIA 4I6MA 3A5MC 3VEOA 2E1YA 1GLCG 4FPAA 3F9MA 3WQTA 1TYQB 3LDOA 4YDUA 1QHAA 5JLFA 2V51B 3CQYA 4DHYA 4FO0A 1MDUB 1LCUA 2P9UA 1C0GA 3RSEA 2P9NB 4HTLA 1V4TA 4J8FA 3GE1A 3D2FB 1BU6O 5AFUH 3ID8A 2YHYA 1ATRA 4CBWA
chains in the Genus database with same CATH superfamily
4EP4A 5BPMA 2KLAA 2HHQA 3QEWA 5FPMA 1BQNA 1KQSM 2JWKA 3ZSRA 2HHXA 1YVUA 5FRMA 1NJIO 3O8MA 1NMNA 1ILYA 3VOVA 5AQRA 5AZJA 2CGJA 3NDKA 3ZETB 4IXCA 2FBYA 1VQMN 4FJMA 1FJGK 3HPGA 5BR9A 4NXMK 3FFKB 5EU7A 2KHOA 4FLUA 3WNHA 3S3OA 1JKHA 2VG5A 5AQVA 4LF6K 3DLEA 3THWA 1XNQK 1ZYQA 1TGOA 2VGNA 4NLCA 4OGEA 3CM6A 1LW2A 3PO5A 4OPJA 1YJNN 1Q9XA 1JCEA 1BL3A 4PA1A 4KB1A 3OHRA 4Z4IA 5FROA 3CI5A 4M7XA 4DV1K 3CJ1A 3CF5L 1N6QA 2WONA 3QEVA 2W42A 3OS0A 4H5VA 5AQWA 3DXMA 5J1EA 1LOTB 4A62A 3D7EO 3HK2A 1S3XA 2FBVA 1RT2A 4WYBA 3A0IX 3AGRA 3U9DA 3PIPL 3MEGA 4C8LA 4HVJA 4IOAL 1JL1A 1HNWK 3NVKA 3SYZA 4B3RK 4JK9A 3CJCA 3M8RA 3VEXA 1RCHA 3UE5A 1D5AA 4IWVA 4Z4GA 2OTJN 3AVNA 3WXKA 2QA4N 5AZIA 3VGMA 1T6DA 2JGUA 2QEXN 1XQSC 1P90A 1T8EA 5EY4A 4J2DA 3TAMA 2W40A 4DFPA 2HW3A 5SZTA 3RRHA 3VGKA 3AVBA 4A5BA 1N34K 4CZLA 3O3FA 5DM7L 3C6UA 1KLNA 1TK8A 2BANA 5SWMA 3MDQA 4BRMA 3KWIA 4JKHA 4JRPA 4B9UA 1ZXOA 2Q3SA 3LDSA 1ZBHA 3ZX2A 4KHNA 5C2DA 3NGIA 1C1AA 1W2BM 4BDYA 3VQCA 4FWNA 2NLXA 3SCXA 3DJCA 4BRCA 1D9FA 3DLHA 2ASOA 1WSJA 1YJWN 2NZTA 4DSFA 4HUEA 5GAEP 4Z4FA 4CHQA 5HL7L 2NRTA 4DTNA 3OYHA 1D9DA 3V9WA 2CH6A 2HOEA 1SZ2A 4IBNA 5CYMA 3CPWM 4E7LA 4FM1A 1RT3A 3MXIA 3SZ2A 4DU1A 3KK2A 3S41A 1QTMA 4I2PA 2VG6A 4NO7A 4DR4K 4JKBA 3IMXA 5AJ3K 5M1QA 5KQ8A 4FVUA 3AVGA 4OLBA 3K57A 3EE9A 4DR3K 5JLHA 1TK0A 5LMNK 2WOMA 3D0PA 1NJXA 3EZWA 3H45C 2GV9A 4CF9A 4JK8A 2OTLN 1GLFO 1VK0A 4DFMA 4DV5K 2NRRA 2EX3A 5FPNA 4JI0K 4PKIA 2NRVA 4JKAA 4BR5A 5BR8K 5HRSA 1DEJA 1HNZK 5M1NA 4DV0K 2P9NA 1KFDA 3SUOA 4DQQA 2DTUA 1NGJA 4BDPA 3QEIA 1NGGA 4O55A 4FJNA 4M3ZA 4ISEA 2HMPA 4DQRA 1RDCA 1JLQA 4ELUA 3TR8A 4N76A 2C1IA 4WF9L 4JKEA 4BC3A 4K41A 4HHTA 3AVMA 3HOTA 4FLZA 2A5XA 2VCPA 4I6MB 3AA2A 4IG3A 3QIOA 4LFBK 3OYKA 3I56N 2KFNA 1QQNA 1VQLN 4DWIA 3QICA 5BRFA 3V9XA 5HRRA 4M3UA 4CHZA 2W00A 1WAFA 4GNIA 3RSEB 4B1XB 1OH5A 1W9HA 4FWQA 4JI7K 4DSLA 4CZIA 1VQON 4FVMA 4BE2A 1QZ5A 1CZ9A 2CH5A 2E20A 1NK8A 4FLYA 2RF2A 1GLAG 4DR1K 4K8ZA 3SQ2A 1TKZA 2IGIA 1IBKK 3H6EA 4B1ZA 4B1UB 2A1RA 3VQ7A 4J2BA 2GBZA 4JI3K 5BRDA 3SUQA 1X9MA 4FXDA 1N32K 3CCEN 4CJUA 1H1VA 4BRIA 4LF8K 4BDZA 1VRTA 4IFYA 4L8RB 3ZT0A 4DR6K 4CJTA 2ASPA 3CCRN 3T69A 2DFEA 2P9PA 3V9SA 3KD1E 1BIUA 2ASMA 2P9KA 2KKZA 4CZFA 1B9FA 4FM2A 4I7FA 5KRSA 3A5OC 4WQ5A 1S5JA 3MXMA 3ALYA 3SNNA 3L4QA 4YOUA 4KH6A 2D0BA 2XY5A 4CGFA 4KHUA 5AQJA 4K43A 4BROA 4NYNA 4MDBA 5GIPA 1HYVA 4DS4A 1U49A 3TU5A 4Z4CA 5A2QO 3AA4A 1S72N 2QXFA 2R7YA 4B9VA 4NXNK 1RDDA 3ZX3A 1U47A 4CIEA 4A57A 4ISGA 2BUPA 1HUXA 5J2PA 3HXMA 3VA3A 3UB5A 3TSPA 1ZBIA 4L3QA 3QNOA 4M7YA 1VQKN 3NF7A 1GLDG 2QM1A 3NH1A 3S5TA 1NK5A 1KSPA 1SKWA 3QLHA 3PX6A 4CEOA 1QVGM 3E01A 3KK7A 1ATNA 1T44A 1HYSA 3EL2A 3NBPA 4CHPA 1J5OA 3O3HA 2WBNA 1VQNN 3JXUA 4PKGA 3ENOA 3OYBA 3V9UA 1C6VA 4CJVA 4QOZB 4BVPA 3HOSA 3LP3A 3SQ1A 5I42A 4KH5A 4WQ5C 5ADXH 4H4MA 2F7TA 2Z1HA 1FXXA 3LZIA 4HCBA 1B92A 1DGKN 1VAZA 4B08A 3L3VA 4B1WB 4DQSA 3IDHA 4CJLA 1CLQA 1WSEA 4TSXA 2YJEA 4DR5K 2QWMA 3HM8A 3LM9A 3HVRA 4BWJA 4B9MA 3H3OB 4CFBA 4O8UA 4BRHA 3VMFB 1IKWA 4ILGB 4C8MA 1J5EK 4I2QA 4B8CA 3M8SA 4GV3A 1IBMK 1BOTO 2OZMA 4CIGA 2AP1A 1NU0A 3SBGA 3L4IA 4O5FA 3SMPA 4DKWA 3RMAA 4FJIA 3HYFA 1QSSA 3OYIA 3G71N 2CGLA 4EIAA 3K0SA 2OYQA 4BE7B 4EHTA 1LAWA 1EX4A 1VSMA 2O8CA 4IG0A 2NRWA 2O4IA 3L6QA 4JK7A 3SAFA 1YAGA 3O4WA 2HHIA 5M1FA 5FPEA 4JS5A 1WBBA 5C12A 2NUBA 1W0HA 3CC2N 4MFBA 2YHBA 1OH8A 3A5MC 3VEOA 3WQTA 4CECA 4OGCA 4YDUA 2HVIA 2FC0A 4MQ3A 3HPHA 4JEPA 4DHYA 1XMOK 1SKSA 1FKPA 4V19S 2YNGA 1MDUB 1C0GA 1HNVA 4PWDA 4DLGA 3M8QA 3WNEA 4B3OA 1BU6O 3QNNA 3L8BA 3ID8A 2EHGA 1S1XA 5AR0A 2F96A 3BF3A 5CYQA 4LSLA 3M5RA 4CHOA 3RVCA 2HF4A 3FLCO 3O1WA 4H5TA 3L0QA 3VQ8A 4GV9A 3VGLA 4GVMA 2O8EA 3OYLA 1RBSA 2CGKA 3ITHA 3LWLA 4C23A 1EXQA 5C24A 3K9JA 4JNEA 5AQZA 1OH6A 3CYMA 3QETA 2YHWA 5MLCQ 3VF4A 1NOZA 1TKXA 5K14A 4H4OA 2HVHA 4KI4A 3HP6A 1S6QA 2GWKA 2IAJA 4CGGA 4DTMA 1Y97A 3O9SA 5KPZA 3ZCMA 2IVPA 1NLVA 4A5AA 1L3UA 4CHNA 4C8NA 4F4KA 3IS9A 4BQLA 1VRUA 1W97L 3O08A 4IEEA 5CE3A 1X3NA 4YFUA 3TAGA 3QB0A 3LP0A 4CEEA 1KLMA 2A6AA 3H1QA 1W7AA 3WNFA 3J8AA 3KK3A 3MWPA 2IOCA 4KI6A 2E4LA 1ATSA 3OS1A 1LWCA 4WFBL 4KREA 5M1OA 5BREA 5DM6L 3ZEUA 2QWLA 2YJFA 1R0AA 2P9SA 2KZMA 4DTOA 3SUNA 4CK1A 4IEIA 3WEEA 3GG4A 4FW2A 3O9TA 3OS2A 4WE1A 3T1YK 2P5OA 3O1BA 3SJHA 1NJZA 4FWKA 4RCHA 3WXIA 1HQUA 4ILHA 1BWFO 4PY5A 1UWBA 1QSLA 5F1XA 2UU9K 4CZKA 3AVIA 3VESA 3QFPA 4E72A 3CMAN 4AHRA 2VG7A 1NGBA 2PAVA 1VQ6N 2O8EB 1IH7A 4JD2A 4E0DA 5CR4A 3G10A 1DKGD 1Q18A 4CF1A 3KLEA 3AVCA 1SS6A 4FWSA 1E4GT 2GEMA 4DQPA 3CC4N 4NYFA 5E26A 2ATQA 4JHDB 4YOYA 1U2VB 5J2MA 3KD5E 3MWTA 2BH1A 5AQFA 4LF7K 3EE8A 3VETA 2QWNA 4FW1A 3O9UA 2OPSA 2D0PA 4FYDA 3ID6A 2J4RA 1C1BA 2RN2A 1LWFA 3KK1A 2IS3A 4RW4A 3LZJA 3SLCA 4DU3A 2FBXA 2OPPA 2O8FA 4IOXA 1LAVA 4CJSA 3WT0A 3T3FA 2XHBA 3LDNA 2ZGYA 5EOYA 2PZSA 4YOVA 4RW6A 1NKEA 4OPKA 2E88A 3CHWA 5AQOA 4UY8O 3QBWA 4O4GA 2G8UA 4GY2B 4JKFA 4FJ7A 3AGKA 3SQ0A 1ASVA 3MEDA 3V1RA 2GUIA 2P9SB 3U3GA 3SV4A 3MX2A 2YNHA 4EFHA 3JAMO 3C6AA 3K5OA 4ID1A 5AQLA 4H0OA 1NJYA 3J7ZO 3BP8A 1ZBLA 1U4BA 3HPOA 5E41A 3TSQA 4CD1A 1EO1A 2HNZA 2WUSA 5JENA 3RR7A 4CD3A 1O1WA 4DB3A 3OY9A 3S3MA 4OLAA 3HZ6A 3DAWA 3C7NB 3V1QA 4BRFA 5DMRA 1JXBA 3ULEB 2ZQBA 5KI6A 1V4SA 2ZD1A 3AVAA 4CZMA 5AFUA 3EN9A 3B8AX 3B6PA 1L3VA 2NRHA 3CCQN 3R9PA 1RDAA 2P9LA 4CGJA 1HLUA 3RRGA 3NH2A 3TAPA 4KBOA 2UXCK 3THXB 1X9WA 3CJ9A 1VSIA 1DTQA 1U6ZA 1BI4B 2OPQA 4DV4K 5AQMA 1NBWA 3LDPA 3MX5A 1BIZA 1HKCA 4MDAA 5LY3A 1CXQA 4CZGA 5EVZA 2ITMA 3ZX0A 4DUZK 3CYGA 4CIFA 4JI6K 4CFAA 3LP2A 3DYAA 1BHLA 5JMVA 3QEPA 3QEXA 3VQEA 4C8KA 3IKMA 5LJWA 2GWJA 5AZJB 2XRIA 2VWBA 3L2WA 1JLFA 2GX9A 2P9IA 4OJRA 4ZTFA 1J6ZA 1K73O 1N5YA 5BRHA 1WSIA 2I5JA 1RFQA 5ADXA 4HWIA 4O0IA 3SMSA 2C1GA 3U8XA 3KLGA 1L5UA 1RILA 3NHGA 3AO3A 4XJXA 4BREA 3ZSWA 5HRNA 3KWGA 1RT5A 2O8BA 5M1KA 5C0YA 3AARA 1REVA 4PHTX 3THWB 3CIPA 3L3UA 1GOCA 3D45A 2O8DA 3VEVA 2Y1JA 1HPMA 3GBTA 4FJGA 2YI1A 3TAFA 3VQAA 4RW7A 4X65K 4BRQA 1YHQN 4DSIA 1XNRK 3DRPA 1F21A 5JICA 4B9NA 5FRNA 1BA0A 5AQSA 3H3NO 4B3MK 1NMDA 1KRPA 2D5RA 2RPIA 3DXMB 3AVKA 3HI0A 4B9SA 4M3WA 2PBDA 1TYQA 3OJSA 4H8KA 3CCLN 4BR0A 1NGIA 3F73A 1QQCA 3T1AA 5I3UA 1CXUA 3LANA 2JWLA 4BRNA 1HJRA 1YF5L 4BY9C 2X6NA 4BWMA 2G8IA 2OZSA 2UXDK 4F3TA 2G8KA 5AZIB 3ATVA 1HJOA 3AA3A 4QCLA 1MU2A 2P5GA 4MLHA 3PIOL 1TAQA 4YOTA 3U9ZA 3HRGA 1XMQK 1KTQA 3HSTB 2I7NA 4DSEA 4BRGA 4B3TK 3EO3A 3PLAA 2WTUA 3AVHA 3VQPA 1IO2A 3UKUA 3DXKA 5IWAK 3H1VX 2ZGZA 3H08A 3MN7A 3E9OA 3O9QA 1FK9A 1C0MA 1U45A 1TKDA 2GTDA 3N4PA 5AQTA 4KRFA 2A1SA 4FLXA 3KLIA 3OYAA 4HUFA 4FJLA 2HF3A 4K8XA 5D3GA 3BY5A 1Z26A 1TAUA 3I33A 4H5NA 4NLBA 4NCAA 4CEQA 5C15A 3CPEA 3NF9A 1WNSA 1I39A 3GL1A 4DSJA 4X64K 2KQ2A 3OVNA 1KVCA 1RT7A 1BGXT 3FGUA 4W5QA 1RT6A 2DFHA 2ZWHA 4OX9K 3CFRA 4KHYA 4BR2A 1T3VA 5BPLA 3V81A 2FSNA 4C1NK 4YNQA 4BG9A 3VQ5A 3NF6A 1ZC6A 1Z05A 3RMDA 2Z1IA 4AQYK 4AH9A 4EZ9A 4RG8A 3DWLA 4KO0A 1KXPA 3TSUA 3ZSOA 3FZFA 1SUQA 4B1VA 1RBTA 4FK0A 2F8TA 2Q2RA 1FKOA 1S9GA 4DF8A 3SAGA 4FJXA 1TYQB 1IBLK 5JVHL 3AA5X 1M1KO 5JLFA 4E19A 4W5RA 3T7ZA 2HNDA 1T03A 3P39A 2P9UA 4NCBA 4DTUA 2P9NB 3I0RA 1NG9A 3GE1A 5AFUH 1RBVA 4R79A 1ATRA 4CVNE 5HBMA 4DU4A 3CERA 1DLOA 1O13A 4LC9B 3FZMA 5AQHA 4GKJK 3O4QA 3TAEA 1S1WA 4FZXC 4FJJA 3E66A 2G8HA 4BECA 3THVA 5KGXA 4IDHA 1RBUA 4HTUA 1KAYA 2D1KA 2VYPA 1Q8IA 4B8AB 2YHAA 3WXMB 4M63C 5TKYA 4B3SK 4FJKA 2FF3B 4CF8A 2HHUA 4BGAA 3K2PA 4E7JA 4M3TA 4JKCA 1G99A 3CG7A 3J80O 3N4QA 1IV0A 4CJ7A 4A61A 3TANA 4YOWA 1OVYA 4CE9A 4BC5A 2BE2A 3SUPA 3MECA 4CESA 1WAJA 2FBTA 3AO5A 1VSJA 5C2FA 1ZBSA 1L3TA 1GOBA 4K42A 3W3DA 1IKVA 4UQGA 3QBXA 4E1MA 4IOCL 4KAZA 3SK3A 4XH1A 4KHQA 4FWLA 2QWOA 3ZT3A 2NRXA 1RTJA 4RTFD 5CHIA 3I55N 4H0YB 2QWPA 3MK6A 5C25A 3O6WA 1WUAA 1JLBA 1QE1A 4CEBA 4YHHK 3J7YP 2OA8A 1E4FT 3AV9A 2P9PB 1T6CA 4LSNA 5J2NA 2P9KB 3EEQA 4EZ6A 3IAYA 1VSFA 3F5TA 4KTZA 3NCIA 4FJ9A 3D2EA 1NWKA 3IG1A 3OYNA 1N8RO 2LSNA 2W6LA 1BA1A 4YORA 2HHVA 2H3GX 3O80A 1QSYA 3A8YA 2I7PA 1YUWA 4Z4EA 3WXLA 1J54A 2ZJRL 3CJ7A 3MCAB 3MN5A 1YTUA 1HMVA 4Q5VA 4DFJA 3OYCA 2V7YA 3CD6N 3VQ9A 2JLEA 4KTWA 5HOOA 4ILJA 1TL3A 3VENA 1QQMA 1FW6A 2VQFK 1EKEA 3ENHA 3UKRA 2QKBA 4WQ4A 1Q81O 4FM0A 4BEBA 5KTQA 2YNFA 4JKGA 4LF9K 4J2EA 3WQUA 2D0OA 4JI2K 1BCOA 4CBXA 3KJVA 4CF2A 3VPZA 2E6MA 2XY8A 2VQEK 4O44A 1RDBA 3DI6A 4BVOA 4M42A 4ZHRA 2EWSA 1K8AO 1HQEA 2DPNA 3K9KA 1LWEA 1K8KA 2ZE2A 3AVLA 4BACA 4PL7A 4G9ZA 3WXJA 3IFRA 3C65A 4LH5A 3ZSXA 2Q97A 4CGHA 3F2KA 4IO8A 3E9PA 5M1PA 2RE2A 4DTSA 4CJKA 1JLGA 1NGDA 1WOQA 4A59A 2UUBK 1OVQA 1Q86O 2QK9A 1P8ZA 3DLBA 3A2FA 4BE1A 1OKJA 2HBKA 3MN6A 4YOXA 3VQDA 3QINA 3FZHA 4H0PA 4X62K 2Q0UA 3MCPA 2FXUA 4WQ4C 2YX6A 1BG3A 1Z25A 1RDWX 3V4IA 3LDLA 4DS5A 1BQMA 4FLTA 3D2FA 1NKBA 1JLEA 2O8CB 2IC3A 5FLXO 4JAXA 1ASUA 2E2QA 1MA9B 2VWJA 3QERA 3AVJA 4FWMA 3LM2A 4CZHA 1RBRA 4AILC 4HCCA 1EP4A 3GDQA 4W5TA 1GLJO 5C10A 1UA0A 4JI5K 4OVLA 4FJ8A 2E8AA 4LF4K 3ZETA 1JLCA 3PO4A 3ENBA 4KKOA 4AHVA 3G6EN 1XC9A 3NVMA 3A5NC 1NGCA 3EKSA 3P1GA 1I3AA 3AAPA 3P5JA 4XH5A 3P31A 1SL1A 4CJFA 3R6MA 2PY5A 3V9ZA 4LH4A 4RWTA 4E7IA 1VQ4N 1UAXA 3QDKA 1XC3A 3U4LA 3G25A 5AQNA 2GUPA 1A5VA 3FZKA 4JN4A 3L2RA 4KTQA 1YITN 3HBTA 4JI4K 4N41A 4ELTA 3E9LA 5DK5A 2Q36A 5CZ1A 4DV3K 5HROA 4A2AA 4CFDA 3AAQA 3MXJA 2HHSA 1YIJN 3K5MA 2HHTA 4H5WA 1WB9A 2BDPA 2KTQA 2X6SA 3TI0A 2D4WA 2UYTA 1SAZA 4FOEA 3SPZA 4CGDA 2IVNA 3IUCA 2E5LK 3CMEN 4OKKA 4CFCA 4C1NI 1YVNA 3PUFA 4F3OA 4G1QA 4A2BA 3IRXA 5HLFA 4F8RA 1WN7A 5E84A 4EHUA 3CC7N 4LFCK 1RT4A 2AJQA 3MN9A 4EP5A 4DCHA 5TKWA 3PX4A 4IKFA 2Z1GA 2QTDA 4BRAA 3C95A 4LY7A 2FSJA 4CZJA 3M3ZA 4PKHA 4ICLA 2BTFA 4K0KK 3ZLJA 4FPBA 3F9KA 4N56A 5KPRA 3KKSA 5IT9O 5JS1A 3DOLA 4IZ9A 1VQPN 4H0TB 4JI1K 1QHTA 5F0XA 3ZEUB 3E1YA 4F2SA 2E2NA 4O0JA 4M3RA 1QVFM 3A5LC 4Z94A 3MAQA 1T7PA 2V7ZA 4BR4A 4FZYA 1ESVA 4RW9A 3WEEB 2YCHA 4OPHA 5GADP 4N47A 4BE0A 3HJFA 1SV5A 3JYTA 3VA0A 2UUCK 4DFKA 4QS9A 3ZSYA 3AO4A 4X66K 2HBLA 4IDKA 3RR8A 4ZTJA 3BUZB 3FR0A 4CJEA 3AY9A 1UOCA 3SBTA 2RKIA 3LDQA 2D0AA 1JLAA 1BUPA 1S6PA 3H46O 1HX1A 1TKTA 4E1NA 4FLVA 2IDOA 1XHXA 1ZBUA 4HUGA 5EXWA 5T7BA 1JL2A 1K9MO 5GAGP 2FLOA 4JD2B 1MWKA 1Z6RA 1NK0A 2FF6A 1EETA 3OYEA 2IIRA 3LP1A 4I9LA 3PX0A 4GMJB 1TL1A 1Q7YO 3BF1A 3SQ4A 3PSIA 3M8PA 4DTJA 4K25A 1WBDA 4GKKK 4E1JA 1X9SA 4CJQA 3CETA 1C0FA 2YKMA 5F2RA 1X1PA 1BDGA 2NNWA 4H0VB 1LW0A 4CK2A 3HO1A 1YTAA 2BGGA 4DTPA 4XIUA 2O8FB 1CZBA 4QAGA 1C0TA 2OCEA 4XH4A 3THYA 1VSEA 3U6FA 1J9AA 2KW4A 1R59O 3M1FA 4ISFA 3ZSQA 3WNGA 1VSKA 1N33K 1L3SA 1D4XA 4XEIA 3KHYA 4FOIA 4I6MA 2E1YA 3DLGA 4FPAA 3F9MA 1QHAA 4J2AA 4W5NA 1GOAA 2V51B 3CQYA 3SI6A 4FO0A 2O4GA 4FJHA 4AHCA 2YNIA 1LCUA 4E3SA 3RSEA 1V4TA 4JV5K 2KZZA 3K58A 3KTQA 4J8FA 1NK6A 1I94K 1BCMA 3BZKA 3PY8A 1KD1O 4F9OA 3M6GA 4CCHA 5BN8A 1GLBG 3JS6A 4BRLA 4CZEA 3R8EA 1HRHA 3ZSVA 1RNHA 3RMBA 2E2OA 4O8KA 3P38A 3ZYYX 2X78A 2XO7A 3DLRA 3OBWA 1JXEA 2P51A 3OYJA 5GIOA 4DSKA 2Q0RA 3CM5A 3TTCA 4MLEA 1YJ9N 3P4IA 4ELVA 4E7HA 3EZ5A 3WUHA 3OYGA 2P9LB 3K5LA 1RTHA 4OO1J 3CCMN 4KV8A 5AQQA 5AQXA 2F4VK 1RTIA 4CEDA 3K59A 1D8YA 3SAHA 4B9QA 1E3MA 3S9HA 1NK7A 5B8HA 3DMJA 1HKGA 3TWHA 2DFFA 4FK4A 4FZZA 3L2QA 3CQ8A 4DTXA 4GVEA 1DTTA 2B4JA 4BG8A 2QKKA 3QESA 1JCGA 4CI6A 2QWQA 4BC4A 1Q82O 4FLWA 3THYB 5CZ2A 3V1OA 1NNEA 3HTVA 3C94A 2G8VA 2P9IB 4IJNA 1G15A 5EX5A 4RW8A 3OBYA 4U7BA 1IG8A 4M45A 4KHWA 1XI1A 2HBJA 2O8BB 4ID5A 3I8BA 4AF1A 4WFNL 3EKUA 1HNIA 2O8DB 5GINA 3DLKA 2NRZA 5KPTA 5LMUK 1UA1A 5BPNA 1WSHA 3CJAA 1S1TA 2YV0X 3ZT4A 3VQ4A 3AO1A 2D0CA 2QXLA 4BQZA 1SL2A 1VHXA 5ELZA 1X9JA 2Y1IA 3VN5A 3FE1A 4JI8K 4Y0WA 4BGBA 1WSGA 1N36K 1WLJA 5KGWA 1K6YA 3TARA 3G4SN 2AA4A 3CFOA 4AHUA 4QS8A 2ITGA 5FPDA 1EWRA 3BGRA 1C1CA 1NGAA 1KAZA 4CJRA 1XUPO 4BR9A 3I8DA 2YHXA 2Q31A 1S1UA 1JCFA 4O5BA 1VSDA 5AQUA 3DRRA 4IO9L 1B9DA 1QS4A 1MWMA 2KFZA 2A3ZA 3RWUA 1Q9YA 1LV5A 1YXQA 3C6HA 4DV2K 3VEWA 5LJVA 2X74A 4MO4A 1NK9A 4DLEA 4H03B 5JVGL 2HMIA 4CJ3A 3EYZA 3TTDA 4E89A 3VEYA 4DQ8A 3QO9A 4GW6A 3UIQA 2YKNA 3NGYA 2RHKA 1NGFA 4LD0A 3UKUB 3KLHA 4JYAK 3KKRA 3DXKB 1NOYA 1KCFA 2OANA 5AQIA 3NE6A 2ZJPL 1BO5O 3O4NA 4OKEA 4N5SA 1M90O 1KVAA 1C0UA 2ZM6K 5AQYA 2B5JA 2HNYA 5FDLA 4FWRA 4CEFA 3U3YA 3L2VA 3CCVN 2E6LA 3QMLA 1RTDA 5KRTA 3TTFA 1CZAN 1S22A 1QZ6A 3VTHA 1U48A 4Z0UA 1QQOA 2ZJQL 5HRPA 1IKXA 1TV6A 1NK4A 5H1SQ 4FK2A 1HYZA 4FWPA 4IJAA 3C0BA 3OW2M 3OYMA 4WCEL 2FSKA 2XY6A 1HKBA 3VTIA 3R3LA 3VQ6A 3AVFA 1X3MA 3T1HK 2QI2A 4YY3K 4KHPK 3BDPA 4C8OA 3QFUA 4R5PA 4OPAA 3KVGA 1NM1A 3LL3A 2QW9A 3OJUA 4AHTA 3DOKA 2E2PA 1KFSA 1NKCA 4CW7B 1BISA 3FFIA 1XHZA 1RDUA 2P9UB 3RMCA 1VQ9N 1GLEG 3HM9A 1VQ5N 1RT1A 3QIPA 4CJWA 3NFAA 4B9LA 2P1JA 4DMNA 1YI2N 3I0SA 1IKYA 3KLFA 2B6AA 5KQDA 3MMVA 3JSMA 5AQKA 4E7KA 4BRPA 4JS4A 3NGZA 3J81O 3CQXA 4Q0BA 4AM6A 1XWLA 4IFEA 3DM2A 1KVBA 1TVRA 4CEAA 3OTOK 1HPZA 3PSFA 4AHSA 4W5OA 2UXBK 5CY4A 3TPQA 1JJ2M 3KIOA 3O9RA 5GAHP 3CJBA 3PV8A 1SKRA 2A41A 1J53A 4BR7A 4CBUA 2E1ZA 4KPYA 4NB4A 3S3NA 3LAMA 2F9WA 1VSHA 3J7AP 3CCSN 1HR0K 4KFBA 4DF4A 4B9TA 4CHYA 2Q1NA 1A5XA 1ITGA 3CXCM 3TAQA 1NJWA 4PQUA 4LF5K 4M3XA 4M41A 1U04A 1Y64A 3B6OA 4BRDA 1TUUA 4PUOA 4DUYK 4GV6A 1TK5A 4KB0A 1KAXA 1IJJA 3DLLL 2VGMA 4CK3A 4QS7A 3VERA 4CJ4A 3HP9A 1T05A 1DT9A 5JS2A 3ZSZA 3NMUA 3C6TA 3ISNC 2WC9A 2PYJA 3HSCA 4AM7A 2IVOA 3K5NA 4I9QA 1RGIA 4FJ5A 3T19A 4MO5A 4B1YB 4FWOA 1EWQA 3D2EB 3G0ZA 2PFUA 4H0XB 4DG1A 4DTRA 4CERA 2G8WA 3TABA 3Q7BA 4JHDA 3SPYA 1U2VA 3VQBA 4PL8A 3KZBA 4WFAL 5LL6Z 4LFAK 1ASWA 2ETJA 1SL0A 1S9EA 1NGEA 2UUAK 5I9EB 2F8SA 5J2QA 4JKDA 3D6RA 4NCGA 3NAEA 2F9TA 1TUYA 2GELA 2PYLA 1EQYA 1WSFA 4YDUC 3UKRB 3ULDA 1GLLO 4CJPA 3GOIA 4FSVA 3OYDA 4JKGB 5BN9A 1IG9A 1HNXK 1SQKA 3VF6A 3CCJN 3L2UA 3P83D 4CJ5A 2DY4A 4CGIA 3OYFA 3LPTA 4Y1CA 3W0LA 3NF8A 3AO2A 3O5BA 2W6KA 4BC2A 2XY7A 2HHHK 3HL8A 2HSTA 4DR2K 3BEXA 4OKJA 4H5RA 4EAHD 5AQPA 4KHSA 4Z4HA 2ZF5O 3BZCA 3CCUN 4BRKA 3RTVA 4KH4A 2OPRA 3HT3A 1YT3A 1K8KB 2HHWA 3VQQA 2A42A 3R1XA 1VQ8N 2VWKA 4FL9A 4CF0A 3LWMA 3CFPA 1OH7A 3LALA 2V52B 5AQGA 3VF2A 3ATUA 4FCYA 2HB5A 2A40A 2QWRA 4Y1DA 4JRQA 3O3GA 3LAKA 3VEZA 5C42A 4DQIA 1VSLA 3FZLA 3ZT1A 4U67L 1ZBFA 3Q7CA 3C7NA 4IFVA 4DR7K 2W41A 4CEZA 1NGHA 3EY1A 3ULEA 4M3YA 3LPUA 4DV7K 1GLCG 3SV3A 2G8FA 3DRSA 2Z1JA 3LDOA 3ZT2A 3OA9A 3NH0A 4DV6K 1KC8O 3SJJA 1S1VA 2WFBA 1VQ7N 3THXA 5HP1A 4JLHA 3V6DA 4HTLA 3MEEA 4F2RA 2HBMA 1BI4A 3D2FB 3HVTA 2YHYA 4CBWA 1A5WA 3ASMA
chains in the Genus database with same CATH topology
5BPMA 2KLAA 5AR0A 4F9OA 3BF3A 3CERA 3M6GA 5BN8A 1GLBG 1O13A 3JS6A 4LC9B 3FZMA 5AQHA 3M5RA 5FPMA 3R8EA 4BRLA 3RVCA 2HF4A 4CZEA 3FLCO 3O1WA 2E2OA 4O8KA 3P38A 3E66A 3L0QA 4H5TA 3ZYYX 2JWKA 1KQSM 4GV9A 3VGLA 3OBWA 4BECA 4IDHA 5GIOA 2CGKA 1KAYA 2Q0RA 3TTCA 3O8MA 1NJIO 2D1KA 2VYPA 4C23A 4MLEA 1ILYA 3VOVA 5AQRA 3WXMB 4M63C 5TKYA 5AZJA 2CGJA 2FF3B 3K9JA 3P4IA 4JNEA 1YJ9N 3ZETB 5AQZA 4BGAA 3WUHA 2YHWA 5MLCQ 4IXCA 4JKCA 3VF4A 1G99A 2P9LB 1VQMN 3N4QA 5BR9A 4OO1J 4CJ7A 3FFKB 2KHOA 4A61A 3CCMN 4YOWA 1OVYA 5AQQA 2GWKA 5AQXA 4BC5A 5AQVA 3SAHA 4B9QA 5C2FA 4NLCA 1ZBSA 2VGNA 5B8HA 1HKGA 3O9SA 5KPZA 4K42A 3W3DA 2IVPA 1NLVA 3QBXA 4A5AA 4IOCL 1YJNN 1JCEA 4BQLA 1W97L 3SK3A 3OHRA 3O08A 4XH1A 3CI5A 4FWLA 4IEEA 4M7XA 1X3NA 2QWOA 5CE3A 4GVEA 2NRXA 3QB0A 4RTFD 4BG8A 5CHIA 1JCGA 4CI6A 3I55N 3CJ1A 4H0YB 2QWQA 3CF5L 2QWPA 3MK6A 2A6AA 3H1QA 4BC4A 1Q82O 3O6WA 3J8AA 1WUAA 3MWPA 4H5VA 1ATSA 3DXMA 3HTVA 5AQWA 1E4FT 4WFBL 1LOTB 2P9PB 5M1OA 5BREA 1T6CA 2P9IB 4IJNA 4A62A 5DM6L 3D7EO 5EX5A 1S3XA 2P9KB 3ZEUA 2QWLA 3OBYA 2YJFA 3A0IX 2P9SA 4WYBA 1IG8A 3AGRA 3F5TA 3U9DA 4U7BA 3PIPL 4IOAL 2HBJA 3NVKA 4IEIA 3D2EA 1NWKA 4JK9A 3WEEA 3CJCA 3GG4A 3VEXA 3I8BA 3UE5A 1N8RO 3O9TA 4IWVA 4AF1A 2OTJN 3WXKA 4WFNL 2QA4N 5AZIA 3EKUA 1BA1A 3O1BA 3SJHA 4YORA 3VGMA 1T6DA 5GINA 2NRZA 2H3GX 4FWKA 1XQSC 3O80A 4RCHA 3WXIA 5KPTA 1P90A 3A8YA 2I7PA 1YUWA 4ILHA 3WXLA 1BWFO 5EY4A 2ZJRL 3CJ7A 3MCAB 3MN5A 5BPNA 3CJAA 5F1XA 4CZKA 3VESA 2W40A 2QXLA 3QFPA 2V7YA 3CD6N 4BQZA 3VGKA 4A5BA 5ELZA 1X9JA 4ILJA 5HOOA 3CMAN 3FE1A 4CZLA 5DM7L 3VENA 1QQMA 4Y0WA 4BGBA 3ENHA 3UKRA 1NGBA 4WQ4A 2PAVA 1Q81O 4BEBA 3G4SN 3MDQA 1VQ6N 4BRMA 4JD2A 2AA4A 3KWIA 5CR4A 4JKGA 1DKGD 4JKHA 1Q18A 1ZXOA 4QS8A 3ZX2A 1SS6A 4FWSA 1E4GT 3WQUA 5C2DA 2D0OA 5FPDA 2GEMA 3CC4N 1W2BM 4CBXA 1NGAA 1KAZA 2NLXA 1XUPO 4FWNA 4BR9A 3DJCA 3VPZA 2YHXA 5E26A 4BRCA 2Q31A 4JHDB 4YOYA 1JCFA 2ASOA 1YJWN 2NZTA 1U2VB 5AQUA 4IO9L 3MWTA 5GAEP 1MWMA 2A3ZA 2BH1A 5AQFA 4BVOA 5HL7L 2NRTA 3EE8A 1YXQA 2EWSA 3C6HA 3VETA 3VEWA 2QWNA 5LJVA 1K8AO 4MO4A 2CH6A 2HOEA 3O9UA 2DPNA 3K9KA 1SZ2A 2D0PA 4H03B 3ID6A 2J4RA 5JVGL 3CPWM 1K8KA 3TTDA 3SLCA 3VEYA 4PL7A 4G9ZA 3WXJA 3IFRA 3C65A 4DQ8A 4IOXA 2Q97A 3S41A 3WT0A 3F2KA 2RHKA 3E9PA 1NGFA 4IO8A 2RE2A 4JKBA 3IMXA 4NO7A 5M1PA 3DXKB 3LDNA 2ZGYA 5M1QA 2OANA 5EOYA 1NGDA 5AQIA 5KQ8A 4YOVA 1BO5O 2ZJPL 2E88A 3CHWA 1WOQA 1M90O 4A59A 4FVUA 5AQOA 4UY8O 3QBWA 5AQYA 1Q86O 4FWRA 3EE9A 5JLHA 1P8ZA 3CCVN 4GY2B 3QMLA 1OKJA 4JKFA 3AGKA 2HBKA 3MN6A 3TTFA 4YOXA 1CZAN 1S22A 1QZ6A 3EZWA 3H45C 3VTHA 3FZHA 4H0PA 2Q0UA 2P9SB 4JK8A 1QQOA 1GLFO 3MCPA 2ZJQL 2FXUA 2OTLN 2NRRA 3MX2A 5FPNA 3UKUB 4PKIA 3C6AA 2NRVA 4JKAA 2YX6A 4WQ4C 4BR5A 4EFHA 1BG3A 1DEJA 1RDWX 5AQLA 3LDLA 5M1NA 2P9NA 4H0OA 3J7ZO 3BP8A 3D2FA 5H1SQ 1NGJA 4FWPA 4IJAA 3C0BA 3OW2M 3TSQA 4CD1A 1NGGA 1EO1A 2WUSA 4WCEL 2FSKA 1HKBA 4ISEA 3R3LA 3VTIA 2HMPA 1X3MA 2QI2A 4JAXA 4CD3A 4DB3A 2E2QA 1MA9B 3HZ6A 4FWMA 3QFUA 3LM2A 4CZHA 4WF9L 2C1IA 4JKEA 4BC3A 4K41A 4OPAA 3DAWA 3C7NB 3KVGA 1NM1A 3GDQA 3LL3A 4BRFA 3HOTA 1GLJO 2QW9A 2A5XA 5C10A 3ULEB 2VCPA 4I6MB 1V4SA 4CZMA 5AFUA 3EN9A 3B8AX 2E8AA 3ZETA 2NRHA 3CCQN 3ENBA 2E2PA 3R9PA 3G6EN 3NVMA 3I56N 3A5NC 1NGCA 2P9LA 1QQNA 3EKSA 1VQLN 3QICA 1HLUA 5BRFA 4XH5A 3AAPA 4KBOA 3P31A 1RDUA 2P9UB 2W00A 1VQ9N 4GNIA 3CJ9A 1GLEG 3RSEB 4B1XB 1U6ZA 3R6MA 4FWQA 1VQ5N 4RWTA 4CZIA 1VQON 1VQ4N 3QDKA 1XC3A 1QZ5A 2CH5A 2E20A 5AQMA 3U4LA 1NBWA 3G25A 3LDPA 3MX5A 5AQNA 1YI2N 1GLAG 1HKCA 2GUPA 4MDAA 5LY3A 2QEXN 5KQDA 3MMVA 3FZKA 3H6EA 5AQKA 4JN4A 4B1ZA 4B1UB 4CZGA 4BRPA 5EVZA 2ITMA 3ZX0A 1YITN 3CQXA 3HBTA 4AM6A 5BRDA 4IFEA 3CCEN 1H1VA 3E9LA 4BRIA 2Q36A 5JMVA 4A2AA 3TPQA 1JJ2M 2ASPA 3IKMA 3AAQA 5LJWA 2GWJA 5AZJB 3CCRN 3T69A 3O9RA 2VWBA 5GAHP 3CJBA 1YIJN 2P9PA 2A41A 2GX9A 2P9IA 4H5WA 1K73O 1J6ZA 4BR7A 4CBUA 5BRHA 2E1ZA 2D4WA 2ASMA 1SAZA 1RFQA 2P9KA 2KKZA 2UYTA 4NB4A 4FOEA 4CZFA 5ADXA 4HWIA 2F9WA 2IVNA 3IUCA 3SMSA 3U8XA 2C1GA 3A5OC 3CMEN 4XJXA 4BREA 3CCSN 4WQ5A 3KWGA 5C0YA 4C1NI 5M1KA 1YVNA 3AARA 3L4QA 4YOUA 4PHTX 4KH6A 3CIPA 2Q1NA 4A2BA 3CXCM 5E84A 4EHUA 3VEVA 3CC7N 1HPMA 3GBTA 2YI1A 3MN9A 4DCHA 1Y64A 5TKWA 5AQJA 4K43A 4BROA 4BRDA 2QTDA 1TUUA 4MDBA 4BRAA 5GIPA 4GV6A 4BRQA 1YHQN 2FSJA 3TU5A 1IJJA 1KAXA 3M3ZA 4CZJA 3DLLL 1S72N 2VGMA 4PKHA 4QS7A 3VERA 5JICA 3NMUA 2BTFA 1DT9A 1BA0A 4FPBA 3ZX3A 5KPRA 4A57A 5AQSA 4ISGA 2BUPA 3H3NO 1NMDA 2WC9A 1HUXA 3HSCA 4AM7A 3DXMB 3HI0A 3UB5A 2IVOA 4IZ9A 3TSPA 1VQPN 2PBDA 4H0TB 1RGIA 1TYQA 4L3QA 3ZEUB 3E1YA 5F0XA 2E2NA 4M7YA 3CCLN 4BR0A 1VQKN 1NGIA 4MO5A 1QVFM 3A5LC 4Z94A 4B1YB 2V7ZA 1GLDG 4FWOA 2QM1A 2JWLA 4BR4A 4BRNA 1ESVA 3D2EB 2PFUA 4H0XB 3WEEB 2YCHA 1YF5L 4OPHA 5GADP 4BY9C 1QVGM 3Q7BA 4JHDA 5AZIB 3ATVA 1HJOA 1U2VA 3KK7A 1ATNA 1T44A 4QS9A 2HBLA 3EL2A 2WBNA 3BUZB 3FR0A 4PL8A 1VQNN 3KZBA 3JXUA 4WFAL 4MLHA 3AY9A 4PKGA 3ENOA 3PIOL 4YOTA 3SBTA 3U9ZA 3HRGA 3LDQA 1NGEA 5I9EB 4BVPA 2I7NA 1BUPA 4JKDA 3D6RA 3HOSA 4BRGA 3H46O 1HX1A 4KH5A 2F9TA 3EO3A 4WQ5C 5ADXH 3PLAA 1TUYA 2GELA 1EQYA 2F7TA 4YDUC 5EXWA 3UKRB 1K9MO 3UKUA 5GAGP 1DGKN 3DXKA 1GLLO 1VAZA 2FLOA 3GOIA 2ZGZA 3H1VX 3MN7A 3E9OA 3O9QA 4JD2B 1MWKA 1Z6RA 4FSVA 4B1WB 2GTDA 4JKGB 3IDHA 3N4PA 5BN9A 1SQKA 5AQTA 3VF6A 2FF6A 3CCJN 2YJEA 2IIRA 2QWMA 3HM8A 3LM9A 3H3OB 1Q7YO 2HF3A 3BF1A 4O8UA 3W0LA 4BRHA 3VMFB 4K25A 4ILGB 3O5BA 4BC2A 3I33A 4E1JA 4GV3A 2HSTA 4H5NA 3BEXA 1BOTO 4NLBA 5C15A 2AP1A 3CETA 3SBGA 4H5RA 1C0FA 3CPEA 3L4IA 5AQPA 4O5FA 3SMPA 4DKWA 4EAHD 2ZF5O 5F2RA 3GL1A 1BDGA 2NNWA 4H0VB 4BRKA 3CCUN 4KH4A 3FGUA 2ZWHA 3G71N 2CGLA 1K8KB 4EIAA 4BR2A 1T3VA 4BE7B 2A42A 4EHTA 3R1XA 5BPLA 1VQ8N 4FL9A 2FSNA 4C1NK 2V52B 4BG9A 5AQGA 3VF2A 3ATUA 2A40A 1ZC6A 4XH4A 1Z05A 2QWRA 2NRWA 3L6QA 4JK7A 3M1FA 1YAGA 1R59O 3O4WA 4ISFA 3DWLA 3SAFA 3VEZA 5M1FA 1KXPA 3TSUA 5FPEA 3FZFA 3FZLA 4B1VA 4U67L 3Q7CA 3C7NA 1D4XA 4XEIA 3KHYA 5C12A 2W41A 1NGHA 2Q2RA 3ULEA 4FOIA 3CC2N 4I6MA 3A5MC 3VEOA 2E1YA 1GLCG 4FPAA 3SAGA 3F9MA 3WQTA 1TYQB 3LDOA 4YDUA 3OA9A 5JVHL 1QHAA 1KC8O 1M1KO 5JLFA 2V51B 3CQYA 4JEPA 4DHYA 3T7ZA 4FO0A 2WFBA 1MDUB 3P39A 1VQ7N 1LCUA 2P9UA 1C0GA 3RSEA 2P9NB 4HTLA 1V4TA 4J8FA 2HBMA 3GE1A 3D2FB 1BU6O 5AFUH 3ID8A 2YHYA 4R79A 1ATRA 1KD1O 4CBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPM A;  5AR0 A;  4F9O A;  3BF3 A;  3CER A;  3M6G A;  5BN8 A;  1GLB G;  3JS6 A;  4LC9 B;  3FZM A;  5AQH A;  5FPM A;  3R8E A;  4BRL A;  4CZE A;  2HF4 A;  3FLC O;  3O1W A;  2E2O A;  4O8K A;  4H5T A;  3L0Q A;  3VGL A;  2CGK A;  1KAY A;  2Q0R A;  3O8M A;  2D1K A;  2VYP A;  4C23 A;  4MLE A;  3VOV A;  5AQR A;  5AZJ A;  4M63 C;  5TKY A;  2CGJ A;  2FF3 B;  3P4I A;  4JNE A;  3ZET B;  5AQZ A;  4BGA A;  3WUH A;  2YHW A;  4IXC A;  3VF4 A;  1G99 A;  2P9L B;  5BR9 A;  4CJ7 A;  3FFK B;  2KHO A;  4A61 A;  5AQQ A;  2GWK A;  5AQX A;  4BC5 A;  5AQV A;  4B9Q A;  1ZBS A;  5B8H A;  1HKG A;  5KPZ A;  4K42 A;  3W3D A;  2IVP A;  1NLV A;  3QBX A;  1JCE A;  4BQL A;  3SK3 A;  3OHR A;  3O08 A;  4XH1 A;  3CI5 A;  4FWL A;  4M7X A;  5CE3 A;  1X3N A;  2QWO A;  3QB0 A;  4RTF D;  4BG8 A;  1JCG A;  4CI6 A;  3CJ1 A;  4H0Y B;  2QWQ A;  2QWP A;  3MK6 A;  2A6A A;  3H1Q A;  4BC4 A;  3O6W A;  3J8A A;  1WUA A;  4H5V A;  1ATS A;  3DXM A;  3HTV A;  5AQW A;  1E4F T;  1LOT B;  2P9P B;  5BRE A;  1T6C A;  2P9I B;  4IJN A;  4A62 A;  3D7E O;  5EX5 A;  1S3X A;  2P9K B;  3ZEU A;  2QWL A;  2YJF A;  3A0I X;  2P9S A;  4WYB A;  1IG8 A;  3U9D A;  3D2E A;  1NWK A;  3WEE A;  3CJC A;  3GG4 A;  3VEX A;  3I8B A;  3UE5 A;  4IWV A;  3WXK A;  5AZI A;  3EKU A;  1BA1 A;  3O1B A;  3SJH A;  3VGM A;  1T6D A;  4FWK A;  2H3G X;  4RCH A;  1XQS C;  3O80 A;  5KPT A;  3WXI A;  3A8Y A;  2I7P A;  1YUW A;  3WXL A;  1BWF O;  5EY4 A;  3CJ7 A;  5F1X A;  3MN5 A;  5BPN A;  3CJA A;  4CZK A;  3VES A;  2QXL A;  2W40 A;  3QFP A;  2V7Y A;  4BQZ A;  3VGK A;  5ELZ A;  1X9J A;  3FE1 A;  4CZL A;  3VEN A;  1QQM A;  4Y0W A;  4BGB A;  3ENH A;  3UKR A;  1NGB A;  4WQ4 A;  2PAV A;  3MDQ A;  4BRM A;  4JD2 A;  2AA4 A;  1DKG D;  1Q18 A;  1ZXO A;  4QS8 A;  3ZX2 A;  4FWS A;  1E4G T;  3WQU A;  2D0O A;  5FPD A;  2GEM A;  4CBX A;  1NGA A;  1KAZ A;  2NLX A;  1XUP O;  4FWN A;  4BR9 A;  3DJC A;  3VPZ A;  2YHX A;  5E26 A;  4BRC A;  2Q31 A;  4JHD B;  1JCF A;  2ASO A;  2NZT A;  1U2V B;  5AQU A;  1MWM A;  2A3Z A;  5AQF A;  4BVO A;  1YXQ A;  2EWS A;  3VET A;  3VEW A;  2QWN A;  5LJV A;  4MO4 A;  2CH6 A;  2HOE A;  2DPN A;  1SZ2 A;  2D0P A;  4H03 B;  2J4R A;  1K8K A;  3SLC A;  3VEY A;  4PL7 A;  3WXJ A;  3IFR A;  4DQ8 A;  2Q97 A;  3S41 A;  3WT0 A;  4IO8 A;  4NO7 A;  1NGF A;  3UKU B;  3IMX A;  3DXK B;  3LDN A;  2ZGY A;  2OAN A;  5EOY A;  1NGD A;  5AQI A;  5KQ8 A;  1BO5 O;  2E88 A;  3CHW A;  1WOQ A;  5AQO A;  3QBW A;  5AQY A;  4FWR A;  5JLH A;  1P8Z A;  4GY2 B;  3QML A;  1OKJ A;  3MN6 A;  1CZA N;  1S22 A;  1QZ6 A;  3EZW A;  3H45 C;  3FZH A;  4H0P A;  2P9S B;  2Q0U A;  1QQO A;  1GLF O;  3MCP A;  2FXU A;  5FPN A;  4EFH A;  4PKI A;  4WQ4 C;  4BR5 A;  1BG3 A;  1DEJ A;  1RDW X;  5AQL A;  3LDL A;  2P9N A;  4H0O A;  3BP8 A;  3D2F A;  1NGJ A;  4FWP A;  4IJA A;  3C0B A;  4CD1 A;  1NGG A;  2WUS A;  2FSK A;  1HKB A;  4ISE A;  2HMP A;  1X3M A;  4JAX A;  4CD3 A;  4DB3 A;  2E2Q A;  1MA9 B;  3HZ6 A;  4FWM A;  3QFU A;  3LM2 A;  4CZH A;  4BC3 A;  4K41 A;  3DAW A;  3C7N B;  3KVG A;  1NM1 A;  3GDQ A;  3LL3 A;  4BRF A;  1GLJ O;  2QW9 A;  2A5X A;  3ULE B;  2VCP A;  4I6M B;  1V4S A;  4CZM A;  5AFU A;  3EN9 A;  3B8A X;  2E8A A;  3ZET A;  2NRH A;  2E2P A;  3R9P A;  3A5N C;  1NGC A;  2P9L A;  1QQN A;  3EKS A;  3QIC A;  1HLU A;  5BRF A;  4XH5 A;  3AAP A;  4KBO A;  2P9U B;  4GNI A;  3CJ9 A;  1GLE G;  3RSE B;  4B1X B;  1U6Z A;  3R6M A;  4FWQ A;  4RWT A;  4CZI A;  3QDK A;  1XC3 A;  1QZ5 A;  2CH5 A;  2E20 A;  5AQM A;  3U4L A;  1NBW A;  3G25 A;  3LDP A;  5AQN A;  1GLA G;  1HKC A;  2GUP A;  5LY3 A;  5KQD A;  3MMV A;  3FZK A;  3H6E A;  5AQK A;  4JN4 A;  4B1Z A;  4B1U B;  4CZG A;  4BRP A;  5EVZ A;  2ITM A;  3ZX0 A;  3CQX A;  3HBT A;  4AM6 A;  5BRD A;  1H1V A;  4BRI A;  2Q36 A;  5JMV A;  4A2A A;  3TPQ A;  2ASP A;  3AAQ A;  5LJW A;  2GWJ A;  5AZJ B;  2VWB A;  3CJB A;  2P9P A;  2A41 A;  2P9I A;  4H5W A;  1J6Z A;  4BR7 A;  4CBU A;  5BRH A;  2E1Z A;  2D4W A;  2ASM A;  1SAZ A;  1RFQ A;  2P9K A;  2UYT A;  4NB4 A;  4CZF A;  4FOE A;  5ADX A;  4HWI A;  2F9W A;  2IVN A;  3IUC A;  3SMS A;  3U8X A;  3A5O C;  4BRE A;  4WQ5 A;  1YVN A;  3AAR A;  3CIP A;  2Q1N A;  4A2B A;  5E84 A;  4EHU A;  3VEV A;  1HPM A;  3GBT A;  2YI1 A;  3MN9 A;  4DCH A;  1Y64 A;  5AQJ A;  4K43 A;  4BRO A;  4BRD A;  1TUU A;  4BRA A;  4BRQ A;  2FSJ A;  3TU5 A;  1IJJ A;  1KAX A;  3M3Z A;  4CZJ A;  4PKH A;  4QS7 A;  3VER A;  5JIC A;  2BTF A;  1BA0 A;  4FPB A;  3ZX3 A;  5KPR A;  5AQS A;  4ISG A;  2BUP A;  3H3N O;  1NMD A;  1HUX A;  3HSC A;  4AM7 A;  3DXM B;  3HI0 A;  3UB5 A;  2IVO A;  4IZ9 A;  2PBD A;  4H0T B;  1RGI A;  1TYQ A;  4L3Q A;  3ZEU B;  5F0X A;  2E2N A;  4M7Y A;  4BR0 A;  1NGI A;  4MO5 A;  3A5L C;  4Z94 A;  4B1Y B;  2V7Z A;  1GLD G;  4FWO A;  2QM1 A;  4BR4 A;  4BRN A;  1ESV A;  3D2E B;  4H0X B;  3WEE B;  2YCH A;  4JHD A;  5AZI B;  3ATV A;  1HJO A;  1U2V A;  1ATN A;  1T44 A;  4QS9 A;  3EL2 A;  3BUZ B;  3FR0 A;  4PL8 A;  3KZB A;  3JXU A;  4MLH A;  3AY9 A;  4PKG A;  3ENO A;  3U9Z A;  3LDQ A;  1NGE A;  5I9E B;  4BVP A;  2I7N A;  1BUP A;  4BRG A;  3H46 O;  1HX1 A;  3EO3 A;  2F9T A;  4WQ5 C;  5ADX H;  1TUY A;  2GEL A;  1EQY A;  4YDU C;  5EXW A;  3UKR B;  3UKU A;  1DGK N;  3DXK A;  1GLL O;  2FLO A;  3GOI A;  2ZGZ A;  3H1V X;  3MN7 A;  4JD2 B;  1MWK A;  1Z6R A;  4FSV A;  4B1W B;  2GTD A;  3IDH A;  5BN9 A;  1SQK A;  5AQT A;  3VF6 A;  2FF6 A;  2YJE A;  2IIR A;  2QWM A;  3HM8 A;  3LM9 A;  3H3O B;  2HF3 A;  3BF1 A;  3W0L A;  4BRH A;  4K25 A;  3O5B A;  4BC2 A;  3I33 A;  4E1J A;  4H5N A;  3BEX A;  1BOT O;  2AP1 A;  3CET A;  4H5R A;  1C0F A;  3L4I A;  5AQP A;  4EAH D;  4O5F A;  3SMP A;  2ZF5 O;  5F2R A;  3GL1 A;  1BDG A;  4H0V B;  4BRK A;  3FGU A;  2ZWH A;  2CGL A;  1K8K B;  4EIA A;  4BR2 A;  2A42 A;  4EHT A;  5BPL A;  4FL9 A;  2FSN A;  2V52 B;  4BG9 A;  5AQG A;  3VF2 A;  3ATU A;  2A40 A;  1ZC6 A;  4XH4 A;  1Z05 A;  2QWR A;  3L6Q A;  3M1F A;  1YAG A;  1R59 O;  3O4W A;  4ISF A;  3DWL A;  3VEZ A;  1KXP A;  5FPE A;  3FZF A;  3FZL A;  4B1V A;  3C7N A;  1D4X A;  4XEI A;  3KHY A;  2W41 A;  1NGH A;  2Q2R A;  3ULE A;  4FOI A;  4I6M A;  3A5M C;  3VEO A;  2E1Y A;  1GLC G;  4FPA A;  3F9M A;  3WQT A;  1TYQ B;  3LDO A;  4YDU A;  1QHA A;  5JLF A;  2V51 B;  3CQY A;  4DHY A;  4FO0 A;  1MDU B;  1LCU A;  2P9U A;  1C0G A;  3RSE A;  2P9N B;  4HTL A;  1V4T A;  4J8F A;  3GE1 A;  3D2F B;  1BU6 O;  5AFU H;  3ID8 A;  2YHY A;  1ATR A;  4CBW A; 
#chains in the Genus database with same CATH topology
 4EP4 A;  5BPM A;  2KLA A;  2HHQ A;  3QEW A;  5FPM A;  1BQN A;  1KQS M;  2JWK A;  3ZSR A;  2HHX A;  1YVU A;  5FRM A;  1NJI O;  3O8M A;  1NMN A;  1ILY A;  3VOV A;  5AQR A;  5AZJ A;  2CGJ A;  3NDK A;  3ZET B;  4IXC A;  2FBY A;  1VQM N;  4FJM A;  1FJG K;  3HPG A;  5BR9 A;  4NXM K;  3FFK B;  5EU7 A;  2KHO A;  4FLU A;  3WNH A;  3S3O A;  1JKH A;  2VG5 A;  5AQV A;  4LF6 K;  3DLE A;  3THW A;  1XNQ K;  1ZYQ A;  1TGO A;  2VGN A;  4NLC A;  4OGE A;  3CM6 A;  1LW2 A;  3PO5 A;  4OPJ A;  1YJN N;  1Q9X A;  1JCE A;  1BL3 A;  4PA1 A;  4KB1 A;  3OHR A;  4Z4I A;  5FRO A;  3CI5 A;  4M7X A;  4DV1 K;  3CJ1 A;  3CF5 L;  1N6Q A;  2WON A;  3QEV A;  2W42 A;  3OS0 A;  4H5V A;  5AQW A;  3DXM A;  5J1E A;  1LOT B;  4A62 A;  3D7E O;  3HK2 A;  1S3X A;  2FBV A;  1RT2 A;  4WYB A;  3A0I X;  3AGR A;  3U9D A;  3PIP L;  3MEG A;  4C8L A;  4HVJ A;  4IOA L;  1JL1 A;  1HNW K;  3NVK A;  3SYZ A;  4B3R K;  4JK9 A;  3CJC A;  3M8R A;  3VEX A;  1RCH A;  3UE5 A;  1D5A A;  4IWV A;  4Z4G A;  2OTJ N;  3AVN A;  3WXK A;  2QA4 N;  5AZI A;  3VGM A;  1T6D A;  2JGU A;  2QEX N;  1XQS C;  1P90 A;  1T8E A;  5EY4 A;  4J2D A;  3TAM A;  2W40 A;  4DFP A;  2HW3 A;  5SZT A;  3RRH A;  3VGK A;  3AVB A;  4A5B A;  1N34 K;  4CZL A;  3O3F A;  5DM7 L;  3C6U A;  1KLN A;  1TK8 A;  2BAN A;  5SWM A;  3MDQ A;  4BRM A;  3KWI A;  4JKH A;  4JRP A;  4B9U A;  1ZXO A;  2Q3S A;  3LDS A;  1ZBH A;  3ZX2 A;  4KHN A;  5C2D A;  3NGI A;  1C1A A;  1W2B M;  4BDY A;  3VQC A;  4FWN A;  2NLX A;  3SCX A;  3DJC A;  4BRC A;  1D9F A;  3DLH A;  2ASO A;  1WSJ A;  1YJW N;  2NZT A;  4DSF A;  4HUE A;  5GAE P;  4Z4F A;  4CHQ A;  5HL7 L;  2NRT A;  4DTN A;  3OYH A;  1D9D A;  3V9W A;  2CH6 A;  2HOE A;  1SZ2 A;  4IBN A;  5CYM A;  3CPW M;  4E7L A;  4FM1 A;  1RT3 A;  3MXI A;  3SZ2 A;  4DU1 A;  3KK2 A;  3S41 A;  1QTM A;  4I2P A;  2VG6 A;  4NO7 A;  4DR4 K;  4JKB A;  3IMX A;  5AJ3 K;  5M1Q A;  5KQ8 A;  4FVU A;  3AVG A;  4OLB A;  3K57 A;  3EE9 A;  4DR3 K;  5JLH A;  1TK0 A;  5LMN K;  2WOM A;  3D0P A;  1NJX A;  3EZW A;  3H45 C;  2GV9 A;  4CF9 A;  4JK8 A;  2OTL N;  1GLF O;  1VK0 A;  4DFM A;  4DV5 K;  2NRR A;  2EX3 A;  5FPN A;  4JI0 K;  4PKI A;  2NRV A;  4JKA A;  4BR5 A;  5BR8 K;  5HRS A;  1DEJ A;  1HNZ K;  5M1N A;  4DV0 K;  2P9N A;  1KFD A;  3SUO A;  4DQQ A;  2DTU A;  1NGJ A;  4BDP A;  3QEI A;  1NGG A;  4O55 A;  4FJN A;  4M3Z A;  4ISE A;  2HMP A;  4DQR A;  1RDC A;  1JLQ A;  4ELU A;  3TR8 A;  4N76 A;  2C1I A;  4WF9 L;  4JKE A;  4BC3 A;  4K41 A;  4HHT A;  3AVM A;  3HOT A;  4FLZ A;  2A5X A;  2VCP A;  4I6M B;  3AA2 A;  4IG3 A;  3QIO A;  4LFB K;  3OYK A;  3I56 N;  2KFN A;  1QQN A;  1VQL N;  4DWI A;  3QIC A;  5BRF A;  3V9X A;  5HRR A;  4M3U A;  4CHZ A;  2W00 A;  1WAF A;  4GNI A;  3RSE B;  4B1X B;  1OH5 A;  1W9H A;  4FWQ A;  4JI7 K;  4DSL A;  4CZI A;  1VQO N;  4FVM A;  4BE2 A;  1QZ5 A;  1CZ9 A;  2CH5 A;  2E20 A;  1NK8 A;  4FLY A;  2RF2 A;  1GLA G;  4DR1 K;  4K8Z A;  3SQ2 A;  1TKZ A;  2IGI A;  1IBK K;  3H6E A;  4B1Z A;  4B1U B;  2A1R A;  3VQ7 A;  4J2B A;  2GBZ A;  4JI3 K;  5BRD A;  3SUQ A;  1X9M A;  4FXD A;  1N32 K;  3CCE N;  4CJU A;  1H1V A;  4BRI A;  4LF8 K;  4BDZ A;  1VRT A;  4IFY A;  4L8R B;  3ZT0 A;  4DR6 K;  4CJT A;  2ASP A;  3CCR N;  3T69 A;  2DFE A;  2P9P A;  3V9S A;  3KD1 E;  1BIU A;  2ASM A;  2P9K A;  2KKZ A;  4CZF A;  1B9F A;  4FM2 A;  4I7F A;  5KRS A;  3A5O C;  4WQ5 A;  1S5J A;  3MXM A;  3ALY A;  3SNN A;  3L4Q A;  4YOU A;  4KH6 A;  2D0B A;  2XY5 A;  4CGF A;  4KHU A;  5AQJ A;  4K43 A;  4BRO A;  4NYN A;  4MDB A;  5GIP A;  1HYV A;  4DS4 A;  1U49 A;  3TU5 A;  4Z4C A;  5A2Q O;  3AA4 A;  1S72 N;  2QXF A;  2R7Y A;  4B9V A;  4NXN K;  1RDD A;  3ZX3 A;  1U47 A;  4CIE A;  4A57 A;  4ISG A;  2BUP A;  1HUX A;  5J2P A;  3HXM A;  3VA3 A;  3UB5 A;  3TSP A;  1ZBI A;  4L3Q A;  3QNO A;  4M7Y A;  1VQK N;  3NF7 A;  1GLD G;  2QM1 A;  3NH1 A;  3S5T A;  1NK5 A;  1KSP A;  1SKW A;  3QLH A;  3PX6 A;  4CEO A;  1QVG M;  3E01 A;  3KK7 A;  1ATN A;  1T44 A;  1HYS A;  3EL2 A;  3NBP A;  4CHP A;  1J5O A;  3O3H A;  2WBN A;  1VQN N;  3JXU A;  4PKG A;  3ENO A;  3OYB A;  3V9U A;  1C6V A;  4CJV A;  4QOZ B;  4BVP A;  3HOS A;  3LP3 A;  3SQ1 A;  5I42 A;  4KH5 A;  4WQ5 C;  5ADX H;  4H4M A;  2F7T A;  2Z1H A;  1FXX A;  3LZI A;  4HCB A;  1B92 A;  1DGK N;  1VAZ A;  4B08 A;  3L3V A;  4B1W B;  4DQS A;  3IDH A;  4CJL A;  1CLQ A;  1WSE A;  4TSX A;  2YJE A;  4DR5 K;  2QWM A;  3HM8 A;  3LM9 A;  3HVR A;  4BWJ A;  4B9M A;  3H3O B;  4CFB A;  4O8U A;  4BRH A;  3VMF B;  1IKW A;  4ILG B;  4C8M A;  1J5E K;  4I2Q A;  4B8C A;  3M8S A;  4GV3 A;  1IBM K;  1BOT O;  2OZM A;  4CIG A;  2AP1 A;  1NU0 A;  3SBG A;  3L4I A;  4O5F A;  3SMP A;  4DKW A;  3RMA A;  4FJI A;  3HYF A;  1QSS A;  3OYI A;  3G71 N;  2CGL A;  4EIA A;  3K0S A;  2OYQ A;  4BE7 B;  4EHT A;  1LAW A;  1EX4 A;  1VSM A;  2O8C A;  4IG0 A;  2NRW A;  2O4I A;  3L6Q A;  4JK7 A;  3SAF A;  1YAG A;  3O4W A;  2HHI A;  5M1F A;  5FPE A;  4JS5 A;  1WBB A;  5C12 A;  2NUB A;  1W0H A;  3CC2 N;  4MFB A;  2YHB A;  1OH8 A;  3A5M C;  3VEO A;  3WQT A;  4CEC A;  4OGC A;  4YDU A;  2HVI A;  2FC0 A;  4MQ3 A;  3HPH A;  4JEP A;  4DHY A;  1XMO K;  1SKS A;  1FKP A;  4V19 S;  2YNG A;  1MDU B;  1C0G A;  1HNV A;  4PWD A;  4DLG A;  3M8Q A;  3WNE A;  4B3O A;  1BU6 O;  3QNN A;  3L8B A;  3ID8 A;  2EHG A;  1S1X A;  5AR0 A;  2F96 A;  3BF3 A;  5CYQ A;  4LSL A;  3M5R A;  4CHO A;  3RVC A;  2HF4 A;  3FLC O;  3O1W A;  4H5T A;  3L0Q A;  3VQ8 A;  4GV9 A;  3VGL A;  4GVM A;  2O8E A;  3OYL A;  1RBS A;  2CGK A;  3ITH A;  3LWL A;  4C23 A;  1EXQ A;  5C24 A;  3K9J A;  4JNE A;  5AQZ A;  1OH6 A;  3CYM A;  3QET A;  2YHW A;  5MLC Q;  3VF4 A;  1NOZ A;  1TKX A;  5K14 A;  4H4O A;  2HVH A;  4KI4 A;  3HP6 A;  1S6Q A;  2GWK A;  2IAJ A;  4CGG A;  4DTM A;  1Y97 A;  3O9S A;  5KPZ A;  3ZCM A;  2IVP A;  1NLV A;  4A5A A;  1L3U A;  4CHN A;  4C8N A;  4F4K A;  3IS9 A;  4BQL A;  1VRU A;  1W97 L;  3O08 A;  4IEE A;  5CE3 A;  1X3N A;  4YFU A;  3TAG A;  3QB0 A;  3LP0 A;  4CEE A;  1KLM A;  2A6A A;  3H1Q A;  1W7A A;  3WNF A;  3J8A A;  3KK3 A;  3MWP A;  2IOC A;  4KI6 A;  2E4L A;  1ATS A;  3OS1 A;  1LWC A;  4WFB L;  4KRE A;  5M1O A;  5BRE A;  5DM6 L;  3ZEU A;  2QWL A;  2YJF A;  1R0A A;  2P9S A;  2KZM A;  4DTO A;  3SUN A;  4CK1 A;  4IEI A;  3WEE A;  3GG4 A;  4FW2 A;  3O9T A;  3OS2 A;  4WE1 A;  3T1Y K;  2P5O A;  3O1B A;  3SJH A;  1NJZ A;  4FWK A;  4RCH A;  3WXI A;  1HQU A;  4ILH A;  1BWF O;  4PY5 A;  1UWB A;  1QSL A;  5F1X A;  2UU9 K;  4CZK A;  3AVI A;  3VES A;  3QFP A;  4E72 A;  3CMA N;  4AHR A;  2VG7 A;  1NGB A;  2PAV A;  1VQ6 N;  2O8E B;  1IH7 A;  4JD2 A;  4E0D A;  5CR4 A;  3G10 A;  1DKG D;  1Q18 A;  4CF1 A;  3KLE A;  3AVC A;  1SS6 A;  4FWS A;  1E4G T;  2GEM A;  4DQP A;  3CC4 N;  4NYF A;  5E26 A;  2ATQ A;  4JHD B;  4YOY A;  1U2V B;  5J2M A;  3KD5 E;  3MWT A;  2BH1 A;  5AQF A;  4LF7 K;  3EE8 A;  3VET A;  2QWN A;  4FW1 A;  3O9U A;  2OPS A;  2D0P A;  4FYD A;  3ID6 A;  2J4R A;  1C1B A;  2RN2 A;  1LWF A;  3KK1 A;  2IS3 A;  4RW4 A;  3LZJ A;  3SLC A;  4DU3 A;  2FBX A;  2OPP A;  2O8F A;  4IOX A;  1LAV A;  4CJS A;  3WT0 A;  3T3F A;  2XHB A;  3LDN A;  2ZGY A;  5EOY A;  2PZS A;  4YOV A;  4RW6 A;  1NKE A;  4OPK A;  2E88 A;  3CHW A;  5AQO A;  4UY8 O;  3QBW A;  4O4G A;  2G8U A;  4GY2 B;  4JKF A;  4FJ7 A;  3AGK A;  3SQ0 A;  1ASV A;  3MED A;  3V1R A;  2GUI A;  2P9S B;  3U3G A;  3SV4 A;  3MX2 A;  2YNH A;  4EFH A;  3JAM O;  3C6A A;  3K5O A;  4ID1 A;  5AQL A;  4H0O A;  1NJY A;  3J7Z O;  3BP8 A;  1ZBL A;  1U4B A;  3HPO A;  5E41 A;  3TSQ A;  4CD1 A;  1EO1 A;  2HNZ A;  2WUS A;  5JEN A;  3RR7 A;  4CD3 A;  1O1W A;  4DB3 A;  3OY9 A;  3S3M A;  4OLA A;  3HZ6 A;  3DAW A;  3C7N B;  3V1Q A;  4BRF A;  5DMR A;  1JXB A;  3ULE B;  2ZQB A;  5KI6 A;  1V4S A;  2ZD1 A;  3AVA A;  4CZM A;  5AFU A;  3EN9 A;  3B8A X;  3B6P A;  1L3V A;  2NRH A;  3CCQ N;  3R9P A;  1RDA A;  2P9L A;  4CGJ A;  1HLU A;  3RRG A;  3NH2 A;  3TAP A;  4KBO A;  2UXC K;  3THX B;  1X9W A;  3CJ9 A;  1VSI A;  1DTQ A;  1U6Z A;  1BI4 B;  2OPQ A;  4DV4 K;  5AQM A;  1NBW A;  3LDP A;  3MX5 A;  1BIZ A;  1HKC A;  4MDA A;  5LY3 A;  1CXQ A;  4CZG A;  5EVZ A;  2ITM A;  3ZX0 A;  4DUZ K;  3CYG A;  4CIF A;  4JI6 K;  4CFA A;  3LP2 A;  3DYA A;  1BHL A;  5JMV A;  3QEP A;  3QEX A;  3VQE A;  4C8K A;  3IKM A;  5LJW A;  2GWJ A;  5AZJ B;  2XRI A;  2VWB A;  3L2W A;  1JLF A;  2GX9 A;  2P9I A;  4OJR A;  4ZTF A;  1J6Z A;  1K73 O;  1N5Y A;  5BRH A;  1WSI A;  2I5J A;  1RFQ A;  5ADX A;  4HWI A;  4O0I A;  3SMS A;  2C1G A;  3U8X A;  3KLG A;  1L5U A;  1RIL A;  3NHG A;  3AO3 A;  4XJX A;  4BRE A;  3ZSW A;  5HRN A;  3KWG A;  1RT5 A;  2O8B A;  5M1K A;  5C0Y A;  3AAR A;  1REV A;  4PHT X;  3THW B;  3CIP A;  3L3U A;  1GOC A;  3D45 A;  2O8D A;  3VEV A;  2Y1J A;  1HPM A;  3GBT A;  4FJG A;  2YI1 A;  3TAF A;  3VQA A;  4RW7 A;  4X65 K;  4BRQ A;  1YHQ N;  4DSI A;  1XNR K;  3DRP A;  1F21 A;  5JIC A;  4B9N A;  5FRN A;  1BA0 A;  5AQS A;  3H3N O;  4B3M K;  1NMD A;  1KRP A;  2D5R A;  2RPI A;  3DXM B;  3AVK A;  3HI0 A;  4B9S A;  4M3W A;  2PBD A;  1TYQ A;  3OJS A;  4H8K A;  3CCL N;  4BR0 A;  1NGI A;  3F73 A;  1QQC A;  3T1A A;  5I3U A;  1CXU A;  3LAN A;  2JWL A;  4BRN A;  1HJR A;  1YF5 L;  4BY9 C;  2X6N A;  4BWM A;  2G8I A;  2OZS A;  2UXD K;  4F3T A;  2G8K A;  5AZI B;  3ATV A;  1HJO A;  3AA3 A;  4QCL A;  1MU2 A;  2P5G A;  4MLH A;  3PIO L;  1TAQ A;  4YOT A;  3U9Z A;  3HRG A;  1XMQ K;  1KTQ A;  3HST B;  2I7N A;  4DSE A;  4BRG A;  4B3T K;  3EO3 A;  3PLA A;  2WTU A;  3AVH A;  3VQP A;  1IO2 A;  3UKU A;  3DXK A;  5IWA K;  3H1V X;  2ZGZ A;  3H08 A;  3MN7 A;  3E9O A;  3O9Q A;  1FK9 A;  1C0M A;  1U45 A;  1TKD A;  2GTD A;  3N4P A;  5AQT A;  4KRF A;  2A1S A;  4FLX A;  3KLI A;  3OYA A;  4HUF A;  4FJL A;  2HF3 A;  4K8X A;  5D3G A;  3BY5 A;  1Z26 A;  1TAU A;  3I33 A;  4H5N A;  4NLB A;  4NCA A;  4CEQ A;  5C15 A;  3CPE A;  3NF9 A;  1WNS A;  1I39 A;  3GL1 A;  4DSJ A;  4X64 K;  2KQ2 A;  3OVN A;  1KVC A;  1RT7 A;  1BGX T;  3FGU A;  4W5Q A;  1RT6 A;  2DFH A;  2ZWH A;  4OX9 K;  3CFR A;  4KHY A;  4BR2 A;  1T3V A;  5BPL A;  3V81 A;  2FSN A;  4C1N K;  4YNQ A;  4BG9 A;  3VQ5 A;  3NF6 A;  1ZC6 A;  1Z05 A;  3RMD A;  2Z1I A;  4AQY K;  4AH9 A;  4EZ9 A;  4RG8 A;  3DWL A;  4KO0 A;  1KXP A;  3TSU A;  3ZSO A;  3FZF A;  1SUQ A;  4B1V A;  1RBT A;  4FK0 A;  2F8T A;  2Q2R A;  1FKO A;  1S9G A;  4DF8 A;  3SAG A;  4FJX A;  1TYQ B;  1IBL K;  5JVH L;  3AA5 X;  1M1K O;  5JLF A;  4E19 A;  4W5R A;  3T7Z A;  2HND A;  1T03 A;  3P39 A;  2P9U A;  4NCB A;  4DTU A;  2P9N B;  3I0R A;  1NG9 A;  3GE1 A;  5AFU H;  1RBV A;  4R79 A;  1ATR A;  4CVN E;  5HBM A;  4DU4 A;  3CER A;  1DLO A;  1O13 A;  4LC9 B;  3FZM A;  5AQH A;  4GKJ K;  3O4Q A;  3TAE A;  1S1W A;  4FZX C;  4FJJ A;  3E66 A;  2G8H A;  4BEC A;  3THV A;  5KGX A;  4IDH A;  1RBU A;  4HTU A;  1KAY A;  2D1K A;  2VYP A;  1Q8I A;  4B8A B;  2YHA A;  3WXM B;  4M63 C;  5TKY A;  4B3S K;  4FJK A;  2FF3 B;  4CF8 A;  2HHU A;  4BGA A;  3K2P A;  4E7J A;  4M3T A;  4JKC A;  1G99 A;  3CG7 A;  3J80 O;  3N4Q A;  1IV0 A;  4CJ7 A;  4A61 A;  3TAN A;  4YOW A;  1OVY A;  4CE9 A;  4BC5 A;  2BE2 A;  3SUP A;  3MEC A;  4CES A;  1WAJ A;  2FBT A;  3AO5 A;  1VSJ A;  5C2F A;  1ZBS A;  1L3T A;  1GOB A;  4K42 A;  3W3D A;  1IKV A;  4UQG A;  3QBX A;  4E1M A;  4IOC L;  4KAZ A;  3SK3 A;  4XH1 A;  4KHQ A;  4FWL A;  2QWO A;  3ZT3 A;  2NRX A;  1RTJ A;  4RTF D;  5CHI A;  3I55 N;  4H0Y B;  2QWP A;  3MK6 A;  5C25 A;  3O6W A;  1WUA A;  1JLB A;  1QE1 A;  4CEB A;  4YHH K;  3J7Y P;  2OA8 A;  1E4F T;  3AV9 A;  2P9P B;  1T6C A;  4LSN A;  5J2N A;  2P9K B;  3EEQ A;  4EZ6 A;  3IAY A;  1VSF A;  3F5T A;  4KTZ A;  3NCI A;  4FJ9 A;  3D2E A;  1NWK A;  3IG1 A;  3OYN A;  1N8R O;  2LSN A;  2W6L A;  1BA1 A;  4YOR A;  2HHV A;  2H3G X;  3O80 A;  1QSY A;  3A8Y A;  2I7P A;  1YUW A;  4Z4E A;  3WXL A;  1J54 A;  2ZJR L;  3CJ7 A;  3MCA B;  3MN5 A;  1YTU A;  1HMV A;  4Q5V A;  4DFJ A;  3OYC A;  2V7Y A;  3CD6 N;  3VQ9 A;  2JLE A;  4KTW A;  5HOO A;  4ILJ A;  1TL3 A;  3VEN A;  1QQM A;  1FW6 A;  2VQF K;  1EKE A;  3ENH A;  3UKR A;  2QKB A;  4WQ4 A;  1Q81 O;  4FM0 A;  4BEB A;  5KTQ A;  2YNF A;  4JKG A;  4LF9 K;  4J2E A;  3WQU A;  2D0O A;  4JI2 K;  1BCO A;  4CBX A;  3KJV A;  4CF2 A;  3VPZ A;  2E6M A;  2XY8 A;  2VQE K;  4O44 A;  1RDB A;  3DI6 A;  4BVO A;  4M42 A;  4ZHR A;  2EWS A;  1K8A O;  1HQE A;  2DPN A;  3K9K A;  1LWE A;  1K8K A;  2ZE2 A;  3AVL A;  4BAC A;  4PL7 A;  4G9Z A;  3WXJ A;  3IFR A;  3C65 A;  4LH5 A;  3ZSX A;  2Q97 A;  4CGH A;  3F2K A;  4IO8 A;  3E9P A;  5M1P A;  2RE2 A;  4DTS A;  4CJK A;  1JLG A;  1NGD A;  1WOQ A;  4A59 A;  2UUB K;  1OVQ A;  1Q86 O;  2QK9 A;  1P8Z A;  3DLB A;  3A2F A;  4BE1 A;  1OKJ A;  2HBK A;  3MN6 A;  4YOX A;  3VQD A;  3QIN A;  3FZH A;  4H0P A;  4X62 K;  2Q0U A;  3MCP A;  2FXU A;  4WQ4 C;  2YX6 A;  1BG3 A;  1Z25 A;  1RDW X;  3V4I A;  3LDL A;  4DS5 A;  1BQM A;  4FLT A;  3D2F A;  1NKB A;  1JLE A;  2O8C B;  2IC3 A;  5FLX O;  4JAX A;  1ASU A;  2E2Q A;  1MA9 B;  2VWJ A;  3QER A;  3AVJ A;  4FWM A;  3LM2 A;  4CZH A;  1RBR A;  4AIL C;  4HCC A;  1EP4 A;  3GDQ A;  4W5T A;  1GLJ O;  5C10 A;  1UA0 A;  4JI5 K;  4OVL A;  4FJ8 A;  2E8A A;  4LF4 K;  3ZET A;  1JLC A;  3PO4 A;  3ENB A;  4KKO A;  4AHV A;  3G6E N;  1XC9 A;  3NVM A;  3A5N C;  1NGC A;  3EKS A;  3P1G A;  1I3A A;  3AAP A;  3P5J A;  4XH5 A;  3P31 A;  1SL1 A;  4CJF A;  3R6M A;  2PY5 A;  3V9Z A;  4LH4 A;  4RWT A;  4E7I A;  1VQ4 N;  1UAX A;  3QDK A;  1XC3 A;  3U4L A;  3G25 A;  5AQN A;  2GUP A;  1A5V A;  3FZK A;  4JN4 A;  3L2R A;  4KTQ A;  1YIT N;  3HBT A;  4JI4 K;  4N41 A;  4ELT A;  3E9L A;  5DK5 A;  2Q36 A;  5CZ1 A;  4DV3 K;  5HRO A;  4A2A A;  4CFD A;  3AAQ A;  3MXJ A;  2HHS A;  1YIJ N;  3K5M A;  2HHT A;  4H5W A;  1WB9 A;  2BDP A;  2KTQ A;  2X6S A;  3TI0 A;  2D4W A;  2UYT A;  1SAZ A;  4FOE A;  3SPZ A;  4CGD A;  2IVN A;  3IUC A;  2E5L K;  3CME N;  4OKK A;  4CFC A;  4C1N I;  1YVN A;  3PUF A;  4F3O A;  4G1Q A;  4A2B A;  3IRX A;  5HLF A;  4F8R A;  1WN7 A;  5E84 A;  4EHU A;  3CC7 N;  4LFC K;  1RT4 A;  2AJQ A;  3MN9 A;  4EP5 A;  4DCH A;  5TKW A;  3PX4 A;  4IKF A;  2Z1G A;  2QTD A;  4BRA A;  3C95 A;  4LY7 A;  2FSJ A;  4CZJ A;  3M3Z A;  4PKH A;  4ICL A;  2BTF A;  4K0K K;  3ZLJ A;  4FPB A;  3F9K A;  4N56 A;  5KPR A;  3KKS A;  5IT9 O;  5JS1 A;  3DOL A;  4IZ9 A;  1VQP N;  4H0T B;  4JI1 K;  1QHT A;  5F0X A;  3ZEU B;  3E1Y A;  4F2S A;  2E2N A;  4O0J A;  4M3R A;  1QVF M;  3A5L C;  4Z94 A;  3MAQ A;  1T7P A;  2V7Z A;  4BR4 A;  4FZY A;  1ESV A;  4RW9 A;  3WEE B;  2YCH A;  4OPH A;  5GAD P;  4N47 A;  4BE0 A;  3HJF A;  1SV5 A;  3JYT A;  3VA0 A;  2UUC K;  4DFK A;  4QS9 A;  3ZSY A;  3AO4 A;  4X66 K;  2HBL A;  4IDK A;  3RR8 A;  4ZTJ A;  3BUZ B;  3FR0 A;  4CJE A;  3AY9 A;  1UOC A;  3SBT A;  2RKI A;  3LDQ A;  2D0A A;  1JLA A;  1BUP A;  1S6P A;  3H46 O;  1HX1 A;  1TKT A;  4E1N A;  4FLV A;  2IDO A;  1XHX A;  1ZBU A;  4HUG A;  5EXW A;  5T7B A;  1JL2 A;  1K9M O;  5GAG P;  2FLO A;  4JD2 B;  1MWK A;  1Z6R A;  1NK0 A;  2FF6 A;  1EET A;  3OYE A;  2IIR A;  3LP1 A;  4I9L A;  3PX0 A;  4GMJ B;  1TL1 A;  1Q7Y O;  3BF1 A;  3SQ4 A;  3PSI A;  3M8P A;  4DTJ A;  4K25 A;  1WBD A;  4GKK K;  4E1J A;  1X9S A;  4CJQ A;  3CET A;  1C0F A;  2YKM A;  5F2R A;  1X1P A;  1BDG A;  2NNW A;  4H0V B;  1LW0 A;  4CK2 A;  3HO1 A;  1YTA A;  2BGG A;  4DTP A;  4XIU A;  2O8F B;  1CZB A;  4QAG A;  1C0T A;  2OCE A;  4XH4 A;  3THY A;  1VSE A;  3U6F A;  1J9A A;  2KW4 A;  1R59 O;  3M1F A;  4ISF A;  3ZSQ A;  3WNG A;  1VSK A;  1N33 K;  1L3S A;  1D4X A;  4XEI A;  3KHY A;  4FOI A;  4I6M A;  2E1Y A;  3DLG A;  4FPA A;  3F9M A;  1QHA A;  4J2A A;  4W5N A;  1GOA A;  2V51 B;  3CQY A;  3SI6 A;  4FO0 A;  2O4G A;  4FJH A;  4AHC A;  2YNI A;  1LCU A;  4E3S A;  3RSE A;  1V4T A;  4JV5 K;  2KZZ A;  3K58 A;  3KTQ A;  4J8F A;  1NK6 A;  1I94 K;  1BCM A;  3BZK A;  3PY8 A;  1KD1 O;  4F9O A;  3M6G A;  4CCH A;  5BN8 A;  1GLB G;  3JS6 A;  4BRL A;  4CZE A;  3R8E A;  1HRH A;  3ZSV A;  1RNH A;  3RMB A;  2E2O A;  4O8K A;  3P38 A;  3ZYY X;  2X78 A;  2XO7 A;  3DLR A;  3OBW A;  1JXE A;  2P51 A;  3OYJ A;  5GIO A;  4DSK A;  2Q0R A;  3CM5 A;  3TTC A;  4MLE A;  1YJ9 N;  3P4I A;  4ELV A;  4E7H A;  3EZ5 A;  3WUH A;  3OYG A;  2P9L B;  3K5L A;  1RTH A;  4OO1 J;  3CCM N;  4KV8 A;  5AQQ A;  5AQX A;  2F4V K;  1RTI A;  4CED A;  3K59 A;  1D8Y A;  3SAH A;  4B9Q A;  1E3M A;  3S9H A;  1NK7 A;  5B8H A;  3DMJ A;  1HKG A;  3TWH A;  2DFF A;  4FK4 A;  4FZZ A;  3L2Q A;  3CQ8 A;  4DTX A;  4GVE A;  1DTT A;  2B4J A;  4BG8 A;  2QKK A;  3QES A;  1JCG A;  4CI6 A;  2QWQ A;  4BC4 A;  1Q82 O;  4FLW A;  3THY B;  5CZ2 A;  3V1O A;  1NNE A;  3HTV A;  3C94 A;  2G8V A;  2P9I B;  4IJN A;  1G15 A;  5EX5 A;  4RW8 A;  3OBY A;  4U7B A;  1IG8 A;  4M45 A;  4KHW A;  1XI1 A;  2HBJ A;  2O8B B;  4ID5 A;  3I8B A;  4AF1 A;  4WFN L;  3EKU A;  1HNI A;  2O8D B;  5GIN A;  3DLK A;  2NRZ A;  5KPT A;  5LMU K;  1UA1 A;  5BPN A;  1WSH A;  3CJA A;  1S1T A;  2YV0 X;  3ZT4 A;  3VQ4 A;  3AO1 A;  2D0C A;  2QXL A;  4BQZ A;  1SL2 A;  1VHX A;  5ELZ A;  1X9J A;  2Y1I A;  3VN5 A;  3FE1 A;  4JI8 K;  4Y0W A;  4BGB A;  1WSG A;  1N36 K;  1WLJ A;  5KGW A;  1K6Y A;  3TAR A;  3G4S N;  2AA4 A;  3CFO A;  4AHU A;  4QS8 A;  2ITG A;  5FPD A;  1EWR A;  3BGR A;  1C1C A;  1NGA A;  1KAZ A;  4CJR A;  1XUP O;  4BR9 A;  3I8D A;  2YHX A;  2Q31 A;  1S1U A;  1JCF A;  4O5B A;  1VSD A;  5AQU A;  3DRR A;  4IO9 L;  1B9D A;  1QS4 A;  1MWM A;  2KFZ A;  2A3Z A;  3RWU A;  1Q9Y A;  1LV5 A;  1YXQ A;  3C6H A;  4DV2 K;  3VEW A;  5LJV A;  2X74 A;  4MO4 A;  1NK9 A;  4DLE A;  4H03 B;  5JVG L;  2HMI A;  4CJ3 A;  3EYZ A;  3TTD A;  4E89 A;  3VEY A;  4DQ8 A;  3QO9 A;  4GW6 A;  3UIQ A;  2YKN A;  3NGY A;  2RHK A;  1NGF A;  4LD0 A;  3UKU B;  3KLH A;  4JYA K;  3KKR A;  3DXK B;  1NOY A;  1KCF A;  2OAN A;  5AQI A;  3NE6 A;  2ZJP L;  1BO5 O;  3O4N A;  4OKE A;  4N5S A;  1M90 O;  1KVA A;  1C0U A;  2ZM6 K;  5AQY A;  2B5J A;  2HNY A;  5FDL A;  4FWR A;  4CEF A;  3U3Y A;  3L2V A;  3CCV N;  2E6L A;  3QML A;  1RTD A;  5KRT A;  3TTF A;  1CZA N;  1S22 A;  1QZ6 A;  3VTH A;  1U48 A;  4Z0U A;  1QQO A;  2ZJQ L;  5HRP A;  1IKX A;  1TV6 A;  1NK4 A;  5H1S Q;  4FK2 A;  1HYZ A;  4FWP A;  4IJA A;  3C0B A;  3OW2 M;  3OYM A;  4WCE L;  2FSK A;  2XY6 A;  1HKB A;  3VTI A;  3R3L A;  3VQ6 A;  3AVF A;  1X3M A;  3T1H K;  2QI2 A;  4YY3 K;  4KHP K;  3BDP A;  4C8O A;  3QFU A;  4R5P A;  4OPA A;  3KVG A;  1NM1 A;  3LL3 A;  2QW9 A;  3OJU A;  4AHT A;  3DOK A;  2E2P A;  1KFS A;  1NKC A;  4CW7 B;  1BIS A;  3FFI A;  1XHZ A;  1RDU A;  2P9U B;  3RMC A;  1VQ9 N;  1GLE G;  3HM9 A;  1VQ5 N;  1RT1 A;  3QIP A;  4CJW A;  3NFA A;  4B9L A;  2P1J A;  4DMN A;  1YI2 N;  3I0S A;  1IKY A;  3KLF A;  2B6A A;  5KQD A;  3MMV A;  3JSM A;  5AQK A;  4E7K A;  4BRP A;  4JS4 A;  3NGZ A;  3J81 O;  3CQX A;  4Q0B A;  4AM6 A;  1XWL A;  4IFE A;  3DM2 A;  1KVB A;  1TVR A;  4CEA A;  3OTO K;  1HPZ A;  3PSF A;  4AHS A;  4W5O A;  2UXB K;  5CY4 A;  3TPQ A;  1JJ2 M;  3KIO A;  3O9R A;  5GAH P;  3CJB A;  3PV8 A;  1SKR A;  2A41 A;  1J53 A;  4BR7 A;  4CBU A;  2E1Z A;  4KPY A;  4NB4 A;  3S3N A;  3LAM A;  2F9W A;  1VSH A;  3J7A P;  3CCS N;  1HR0 K;  4KFB A;  4DF4 A;  4B9T A;  4CHY A;  2Q1N A;  1A5X A;  1ITG A;  3CXC M;  3TAQ A;  1NJW A;  4PQU A;  4LF5 K;  4M3X A;  4M41 A;  1U04 A;  1Y64 A;  3B6O A;  4BRD A;  1TUU A;  4PUO A;  4DUY K;  4GV6 A;  1TK5 A;  4KB0 A;  1KAX A;  1IJJ A;  3DLL L;  2VGM A;  4CK3 A;  4QS7 A;  3VER A;  4CJ4 A;  3HP9 A;  1T05 A;  1DT9 A;  5JS2 A;  3ZSZ A;  3NMU A;  3C6T A;  3ISN C;  2WC9 A;  2PYJ A;  3HSC A;  4AM7 A;  2IVO A;  3K5N A;  4I9Q A;  1RGI A;  4FJ5 A;  3T19 A;  4MO5 A;  4B1Y B;  4FWO A;  1EWQ A;  3D2E B;  3G0Z A;  2PFU A;  4H0X B;  4DG1 A;  4DTR A;  4CER A;  2G8W A;  3TAB A;  3Q7B A;  4JHD A;  3SPY A;  1U2V A;  3VQB A;  4PL8 A;  3KZB A;  4WFA L;  5LL6 Z;  4LFA K;  1ASW A;  2ETJ A;  1SL0 A;  1S9E A;  1NGE A;  2UUA K;  5I9E B;  2F8S A;  5J2Q A;  4JKD A;  3D6R A;  4NCG A;  3NAE A;  2F9T A;  1TUY A;  2GEL A;  2PYL A;  1EQY A;  1WSF A;  4YDU C;  3UKR B;  3ULD A;  1GLL O;  4CJP A;  3GOI A;  4FSV A;  3OYD A;  4JKG B;  5BN9 A;  1IG9 A;  1HNX K;  1SQK A;  3VF6 A;  3CCJ N;  3L2U A;  3P83 D;  4CJ5 A;  2DY4 A;  4CGI A;  3OYF A;  3LPT A;  4Y1C A;  3W0L A;  3NF8 A;  3AO2 A;  3O5B A;  2W6K A;  4BC2 A;  2XY7 A;  2HHH K;  3HL8 A;  2HST A;  4DR2 K;  3BEX A;  4OKJ A;  4H5R A;  4EAH D;  5AQP A;  4KHS A;  4Z4H A;  2ZF5 O;  3BZC A;  3CCU N;  4BRK A;  3RTV A;  4KH4 A;  2OPR A;  3HT3 A;  1YT3 A;  1K8K B;  2HHW A;  3VQQ A;  2A42 A;  3R1X A;  1VQ8 N;  2VWK A;  4FL9 A;  4CF0 A;  3LWM A;  3CFP A;  1OH7 A;  3LAL A;  2V52 B;  5AQG A;  3VF2 A;  3ATU A;  4FCY A;  2HB5 A;  2A40 A;  2QWR A;  4Y1D A;  4JRQ A;  3O3G A;  3LAK A;  3VEZ A;  5C42 A;  4DQI A;  1VSL A;  3FZL A;  3ZT1 A;  4U67 L;  1ZBF A;  3Q7C A;  3C7N A;  4IFV A;  4DR7 K;  2W41 A;  4CEZ A;  1NGH A;  3EY1 A;  3ULE A;  4M3Y A;  3LPU A;  4DV7 K;  1GLC G;  3SV3 A;  2G8F A;  3DRS A;  2Z1J A;  3LDO A;  3ZT2 A;  3OA9 A;  3NH0 A;  4DV6 K;  1KC8 O;  3SJJ A;  1S1V A;  2WFB A;  1VQ7 N;  3THX A;  5HP1 A;  4JLH A;  3V6D A;  4HTL A;  3MEE A;  4F2R A;  2HBM A;  1BI4 A;  3D2F B;  3HVT A;  2YHY A;  4CBW A;  1A5W A;  3ASM A; 
#chains in the Genus database with same CATH homology
 5BPM A;  2KLA A;  5AR0 A;  4F9O A;  3BF3 A;  3CER A;  3M6G A;  5BN8 A;  1GLB G;  1O13 A;  3JS6 A;  4LC9 B;  3FZM A;  5AQH A;  3M5R A;  5FPM A;  3R8E A;  4BRL A;  3RVC A;  2HF4 A;  4CZE A;  3FLC O;  3O1W A;  2E2O A;  4O8K A;  3P38 A;  3E66 A;  3L0Q A;  4H5T A;  3ZYY X;  2JWK A;  1KQS M;  4GV9 A;  3VGL A;  3OBW A;  4BEC A;  4IDH A;  5GIO A;  2CGK A;  1KAY A;  2Q0R A;  3TTC A;  3O8M A;  1NJI O;  2D1K A;  2VYP A;  4C23 A;  4MLE A;  1ILY A;  3VOV A;  5AQR A;  3WXM B;  4M63 C;  5TKY A;  5AZJ A;  2CGJ A;  2FF3 B;  3K9J A;  3P4I A;  4JNE A;  1YJ9 N;  3ZET B;  5AQZ A;  4BGA A;  3WUH A;  2YHW A;  5MLC Q;  4IXC A;  4JKC A;  3VF4 A;  1G99 A;  2P9L B;  1VQM N;  3N4Q A;  5BR9 A;  4OO1 J;  4CJ7 A;  3FFK B;  2KHO A;  4A61 A;  3CCM N;  4YOW A;  1OVY A;  5AQQ A;  2GWK A;  5AQX A;  4BC5 A;  5AQV A;  3SAH A;  4B9Q A;  5C2F A;  4NLC A;  1ZBS A;  2VGN A;  5B8H A;  1HKG A;  3O9S A;  5KPZ A;  4K42 A;  3W3D A;  2IVP A;  1NLV A;  3QBX A;  4A5A A;  4IOC L;  1YJN N;  1JCE A;  4BQL A;  1W97 L;  3SK3 A;  3OHR A;  3O08 A;  4XH1 A;  3CI5 A;  4FWL A;  4IEE A;  4M7X A;  1X3N A;  2QWO A;  5CE3 A;  4GVE A;  2NRX A;  3QB0 A;  4RTF D;  4BG8 A;  5CHI A;  1JCG A;  4CI6 A;  3I55 N;  3CJ1 A;  4H0Y B;  2QWQ A;  3CF5 L;  2QWP A;  3MK6 A;  2A6A A;  3H1Q A;  4BC4 A;  1Q82 O;  3O6W A;  3J8A A;  1WUA A;  3MWP A;  4H5V A;  1ATS A;  3DXM A;  3HTV A;  5AQW A;  1E4F T;  4WFB L;  1LOT B;  2P9P B;  5M1O A;  5BRE A;  1T6C A;  2P9I B;  4IJN A;  4A62 A;  5DM6 L;  3D7E O;  5EX5 A;  1S3X A;  2P9K B;  3ZEU A;  2QWL A;  3OBY A;  2YJF A;  3A0I X;  2P9S A;  4WYB A;  1IG8 A;  3AGR A;  3F5T A;  3U9D A;  4U7B A;  3PIP L;  4IOA L;  2HBJ A;  3NVK A;  4IEI A;  3D2E A;  1NWK A;  4JK9 A;  3WEE A;  3CJC A;  3GG4 A;  3VEX A;  3I8B A;  3UE5 A;  1N8R O;  3O9T A;  4IWV A;  4AF1 A;  2OTJ N;  3WXK A;  4WFN L;  2QA4 N;  5AZI A;  3EKU A;  1BA1 A;  3O1B A;  3SJH A;  4YOR A;  3VGM A;  1T6D A;  5GIN A;  2NRZ A;  2H3G X;  4FWK A;  1XQS C;  3O80 A;  4RCH A;  3WXI A;  5KPT A;  1P90 A;  3A8Y A;  2I7P A;  1YUW A;  4ILH A;  3WXL A;  1BWF O;  5EY4 A;  2ZJR L;  3CJ7 A;  3MCA B;  3MN5 A;  5BPN A;  3CJA A;  5F1X A;  4CZK A;  3VES A;  2W40 A;  2QXL A;  3QFP A;  2V7Y A;  3CD6 N;  4BQZ A;  3VGK A;  4A5B A;  5ELZ A;  1X9J A;  4ILJ A;  5HOO A;  3CMA N;  3FE1 A;  4CZL A;  5DM7 L;  3VEN A;  1QQM A;  4Y0W A;  4BGB A;  3ENH A;  3UKR A;  1NGB A;  4WQ4 A;  2PAV A;  1Q81 O;  4BEB A;  3G4S N;  3MDQ A;  1VQ6 N;  4BRM A;  4JD2 A;  2AA4 A;  3KWI A;  5CR4 A;  4JKG A;  1DKG D;  4JKH A;  1Q18 A;  1ZXO A;  4QS8 A;  3ZX2 A;  1SS6 A;  4FWS A;  1E4G T;  3WQU A;  5C2D A;  2D0O A;  5FPD A;  2GEM A;  3CC4 N;  1W2B M;  4CBX A;  1NGA A;  1KAZ A;  2NLX A;  1XUP O;  4FWN A;  4BR9 A;  3DJC A;  3VPZ A;  2YHX A;  5E26 A;  4BRC A;  2Q31 A;  4JHD B;  4YOY A;  1JCF A;  2ASO A;  1YJW N;  2NZT A;  1U2V B;  5AQU A;  4IO9 L;  3MWT A;  5GAE P;  1MWM A;  2A3Z A;  2BH1 A;  5AQF A;  4BVO A;  5HL7 L;  2NRT A;  3EE8 A;  1YXQ A;  2EWS A;  3C6H A;  3VET A;  3VEW A;  2QWN A;  5LJV A;  1K8A O;  4MO4 A;  2CH6 A;  2HOE A;  3O9U A;  2DPN A;  3K9K A;  1SZ2 A;  2D0P A;  4H03 B;  3ID6 A;  2J4R A;  5JVG L;  3CPW M;  1K8K A;  3TTD A;  3SLC A;  3VEY A;  4PL7 A;  4G9Z A;  3WXJ A;  3IFR A;  3C65 A;  4DQ8 A;  4IOX A;  2Q97 A;  3S41 A;  3WT0 A;  3F2K A;  2RHK A;  3E9P A;  1NGF A;  4IO8 A;  2RE2 A;  4JKB A;  3IMX A;  4NO7 A;  5M1P A;  3DXK B;  3LDN A;  2ZGY A;  5M1Q A;  2OAN A;  5EOY A;  1NGD A;  5AQI A;  5KQ8 A;  4YOV A;  1BO5 O;  2ZJP L;  2E88 A;  3CHW A;  1WOQ A;  1M90 O;  4A59 A;  4FVU A;  5AQO A;  4UY8 O;  3QBW A;  5AQY A;  1Q86 O;  4FWR A;  3EE9 A;  5JLH A;  1P8Z A;  3CCV N;  4GY2 B;  3QML A;  1OKJ A;  4JKF A;  3AGK A;  2HBK A;  3MN6 A;  3TTF A;  4YOX A;  1CZA N;  1S22 A;  1QZ6 A;  3EZW A;  3H45 C;  3VTH A;  3FZH A;  4H0P A;  2Q0U A;  2P9S B;  4JK8 A;  1QQO A;  1GLF O;  3MCP A;  2ZJQ L;  2FXU A;  2OTL N;  2NRR A;  3MX2 A;  5FPN A;  3UKU B;  4PKI A;  3C6A A;  2NRV A;  4JKA A;  2YX6 A;  4WQ4 C;  4BR5 A;  4EFH A;  1BG3 A;  1DEJ A;  1RDW X;  5AQL A;  3LDL A;  5M1N A;  2P9N A;  4H0O A;  3J7Z O;  3BP8 A;  3D2F A;  5H1S Q;  1NGJ A;  4FWP A;  4IJA A;  3C0B A;  3OW2 M;  3TSQ A;  4CD1 A;  1NGG A;  1EO1 A;  2WUS A;  4WCE L;  2FSK A;  1HKB A;  4ISE A;  3R3L A;  3VTI A;  2HMP A;  1X3M A;  2QI2 A;  4JAX A;  4CD3 A;  4DB3 A;  2E2Q A;  1MA9 B;  3HZ6 A;  4FWM A;  3QFU A;  3LM2 A;  4CZH A;  4WF9 L;  2C1I A;  4JKE A;  4BC3 A;  4K41 A;  4OPA A;  3DAW A;  3C7N B;  3KVG A;  1NM1 A;  3GDQ A;  3LL3 A;  4BRF A;  3HOT A;  1GLJ O;  2QW9 A;  2A5X A;  5C10 A;  3ULE B;  2VCP A;  4I6M B;  1V4S A;  4CZM A;  5AFU A;  3EN9 A;  3B8A X;  2E8A A;  3ZET A;  2NRH A;  3CCQ N;  3ENB A;  2E2P A;  3R9P A;  3G6E N;  3NVM A;  3I56 N;  3A5N C;  1NGC A;  2P9L A;  1QQN A;  3EKS A;  1VQL N;  3QIC A;  1HLU A;  5BRF A;  4XH5 A;  3AAP A;  4KBO A;  3P31 A;  1RDU A;  2P9U B;  2W00 A;  1VQ9 N;  4GNI A;  3CJ9 A;  1GLE G;  3RSE B;  4B1X B;  1U6Z A;  3R6M A;  4FWQ A;  1VQ5 N;  4RWT A;  4CZI A;  1VQO N;  1VQ4 N;  3QDK A;  1XC3 A;  1QZ5 A;  2CH5 A;  2E20 A;  5AQM A;  3U4L A;  1NBW A;  3G25 A;  3LDP A;  3MX5 A;  5AQN A;  1YI2 N;  1GLA G;  1HKC A;  2GUP A;  4MDA A;  5LY3 A;  2QEX N;  5KQD A;  3MMV A;  3FZK A;  3H6E A;  5AQK A;  4JN4 A;  4B1Z A;  4B1U B;  4CZG A;  4BRP A;  5EVZ A;  2ITM A;  3ZX0 A;  1YIT N;  3CQX A;  3HBT A;  4AM6 A;  5BRD A;  4IFE A;  3CCE N;  1H1V A;  3E9L A;  4BRI A;  2Q36 A;  5JMV A;  4A2A A;  3TPQ A;  1JJ2 M;  2ASP A;  3IKM A;  3AAQ A;  5LJW A;  2GWJ A;  5AZJ B;  3CCR N;  3T69 A;  3O9R A;  2VWB A;  5GAH P;  3CJB A;  1YIJ N;  2P9P A;  2A41 A;  2GX9 A;  2P9I A;  4H5W A;  1K73 O;  1J6Z A;  4BR7 A;  4CBU A;  5BRH A;  2E1Z A;  2D4W A;  2ASM A;  1SAZ A;  1RFQ A;  2P9K A;  2KKZ A;  2UYT A;  4NB4 A;  4FOE A;  4CZF A;  5ADX A;  4HWI A;  2F9W A;  2IVN A;  3IUC A;  3SMS A;  3U8X A;  2C1G A;  3A5O C;  3CME N;  4XJX A;  4BRE A;  3CCS N;  4WQ5 A;  3KWG A;  5C0Y A;  4C1N I;  5M1K A;  1YVN A;  3AAR A;  3L4Q A;  4YOU A;  4PHT X;  4KH6 A;  3CIP A;  2Q1N A;  4A2B A;  3CXC M;  5E84 A;  4EHU A;  3VEV A;  3CC7 N;  1HPM A;  3GBT A;  2YI1 A;  3MN9 A;  4DCH A;  1Y64 A;  5TKW A;  5AQJ A;  4K43 A;  4BRO A;  4BRD A;  2QTD A;  1TUU A;  4MDB A;  4BRA A;  5GIP A;  4GV6 A;  4BRQ A;  1YHQ N;  2FSJ A;  3TU5 A;  1IJJ A;  1KAX A;  3M3Z A;  4CZJ A;  3DLL L;  1S72 N;  2VGM A;  4PKH A;  4QS7 A;  3VER A;  5JIC A;  3NMU A;  2BTF A;  1DT9 A;  1BA0 A;  4FPB A;  3ZX3 A;  5KPR A;  4A57 A;  5AQS A;  4ISG A;  2BUP A;  3H3N O;  1NMD A;  2WC9 A;  1HUX A;  3HSC A;  4AM7 A;  3DXM B;  3HI0 A;  3UB5 A;  2IVO A;  4IZ9 A;  3TSP A;  1VQP N;  2PBD A;  4H0T B;  1RGI A;  1TYQ A;  4L3Q A;  3ZEU B;  3E1Y A;  5F0X A;  2E2N A;  4M7Y A;  3CCL N;  4BR0 A;  1VQK N;  1NGI A;  4MO5 A;  1QVF M;  3A5L C;  4Z94 A;  4B1Y B;  2V7Z A;  1GLD G;  4FWO A;  2QM1 A;  2JWL A;  4BR4 A;  4BRN A;  1ESV A;  3D2E B;  2PFU A;  4H0X B;  3WEE B;  2YCH A;  1YF5 L;  4OPH A;  5GAD P;  4BY9 C;  1QVG M;  3Q7B A;  4JHD A;  5AZI B;  3ATV A;  1HJO A;  1U2V A;  3KK7 A;  1ATN A;  1T44 A;  4QS9 A;  2HBL A;  3EL2 A;  2WBN A;  3BUZ B;  3FR0 A;  4PL8 A;  1VQN N;  3KZB A;  3JXU A;  4WFA L;  4MLH A;  3AY9 A;  4PKG A;  3ENO A;  3PIO L;  4YOT A;  3SBT A;  3U9Z A;  3HRG A;  3LDQ A;  1NGE A;  5I9E B;  4BVP A;  2I7N A;  1BUP A;  4JKD A;  3D6R A;  3HOS A;  4BRG A;  3H46 O;  1HX1 A;  4KH5 A;  2F9T A;  3EO3 A;  4WQ5 C;  5ADX H;  3PLA A;  1TUY A;  2GEL A;  1EQY A;  2F7T A;  4YDU C;  5EXW A;  3UKR B;  1K9M O;  3UKU A;  5GAG P;  1DGK N;  3DXK A;  1GLL O;  1VAZ A;  2FLO A;  3GOI A;  2ZGZ A;  3H1V X;  3MN7 A;  3E9O A;  3O9Q A;  4JD2 B;  1MWK A;  1Z6R A;  4FSV A;  4B1W B;  2GTD A;  4JKG B;  3IDH A;  3N4P A;  5BN9 A;  1SQK A;  5AQT A;  3VF6 A;  2FF6 A;  3CCJ N;  2YJE A;  2IIR A;  2QWM A;  3HM8 A;  3LM9 A;  3H3O B;  1Q7Y O;  2HF3 A;  3BF1 A;  4O8U A;  3W0L A;  4BRH A;  3VMF B;  4K25 A;  4ILG B;  3O5B A;  4BC2 A;  3I33 A;  4E1J A;  4GV3 A;  2HST A;  4H5N A;  3BEX A;  1BOT O;  4NLB A;  5C15 A;  2AP1 A;  3CET A;  3SBG A;  4H5R A;  1C0F A;  3CPE A;  3L4I A;  5AQP A;  4O5F A;  3SMP A;  4DKW A;  4EAH D;  2ZF5 O;  5F2R A;  3GL1 A;  1BDG A;  2NNW A;  4H0V B;  4BRK A;  3CCU N;  4KH4 A;  3FGU A;  2ZWH A;  3G71 N;  2CGL A;  1K8K B;  4EIA A;  4BR2 A;  1T3V A;  4BE7 B;  2A42 A;  4EHT A;  3R1X A;  5BPL A;  1VQ8 N;  4FL9 A;  2FSN A;  4C1N K;  2V52 B;  4BG9 A;  5AQG A;  3VF2 A;  3ATU A;  2A40 A;  1ZC6 A;  4XH4 A;  1Z05 A;  2QWR A;  2NRW A;  3L6Q A;  4JK7 A;  3M1F A;  1YAG A;  1R59 O;  3O4W A;  4ISF A;  3DWL A;  3SAF A;  3VEZ A;  5M1F A;  1KXP A;  3TSU A;  5FPE A;  3FZF A;  3FZL A;  4B1V A;  4U67 L;  3Q7C A;  3C7N A;  1D4X A;  4XEI A;  3KHY A;  5C12 A;  2W41 A;  1NGH A;  2Q2R A;  3ULE A;  4FOI A;  3CC2 N;  4I6M A;  3A5M C;  3VEO A;  2E1Y A;  1GLC G;  4FPA A;  3SAG A;  3F9M A;  3WQT A;  1TYQ B;  3LDO A;  4YDU A;  3OA9 A;  5JVH L;  1QHA A;  1KC8 O;  1M1K O;  5JLF A;  2V51 B;  3CQY A;  4JEP A;  4DHY A;  3T7Z A;  4FO0 A;  2WFB A;  1MDU B;  3P39 A;  1VQ7 N;  1LCU A;  2P9U A;  1C0G A;  3RSE A;  2P9N B;  4HTL A;  1V4T A;  4J8F A;  2HBM A;  3GE1 A;  3D2F B;  1BU6 O;  5AFU H;  3ID8 A;  2YHY A;  4R79 A;  1ATR A;  1KD1 O;  4CBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...