3DXKA

Structure of bos taurus arp2/3 complex with bound inhibitor ck0944636
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
415
structure length
397
Chain Sequence
b'AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Characterization of two classes of small molecule inhibitors of Arp2/3 complex
pubmed doi rcsb
molecule tags Structural protein
total genus 120
structure length 397
sequence length 415
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3dxkA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxkA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxkA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3dxkA04
1QQMA 3BF1A 4MO4A 4C23A 5AQIA 3OHRA 2V7YA 5E84A 5EY4A 1QQOA 3U9ZA 3UE5A 1TUUA 3VF6A 2FLOA 4FSVA 5TKYA 4H0PA 3D2FB 3U4LA 3C7NA 4FL9A 3LDNA 2P9UB 3I8BA 3SMPA 2E1ZA 3FFKB 3IUCA 3FGUA 5LJWA 3H3NO 2CH5A 3HZ6A 3GE1A 3AARA 2P9KA 2Q0UA 2A41A 1BO5O 5KPZA 2ZGYA 2PAVA 3WEEA 1HPMA 1IG8A 2BUPA 5JLFA 3DXKA 1TUYA 5AZJA 3FZLA 3FZKA 4MLEA 4FOIA 3FZHA 3WXJA 4WQ4C 4DHYA 4B1UB 4B1XB 4F9OA 2GTDA 3FR0A 3QFUA 2P9NA 4K25A 1ZC6A 5AR0A 3VOVA 5JLHA 3EO3A 4PL7A 3UKRA 3MMVA 3O8MA 4IXCA 1NM1A 1DGKN 4ISEA 5AZIA 1C0GA 4BG9A 4CZMA 4A62A 4H03B 1NGAA 3WQTA 3A5OC 3GDQA 4RWTA 3O5BA 4CI6A 2Q2RA 3D2FA 3ZX2A 2D0PA 2FSKA 3HM8A 2CGJA 2YHYA 4BRFA 4GNIA 1BWFO 5BPMA 3LDPA 5BRFA 3HTVA 1BA1A 1DKGD 1ZXOA 5AQLA 3ZX3A 2A5XA 4IO8A 1H1VA 1K8KB 3LDQA 4BREA 1BG3A 3U9DA 1JCFA 1QQNA 4MLHA 1Y64A 3O1WA 3MDQA 3H45C 3DJCA 3CERA 3HI0A 1MWKA 3ULEB 2Q0RA 1P8ZA 5FPEA 4MO5A 2FSJA 3M6GA 3CETA 1MDUB 3VETA 4BRIA 3G25A 3WT0A 5KPRA 2VCPA 2ZF5O 4B1WB 1NMDA 5AQPA 4FWPA 2QWPA 4BRLA 2HOEA 4BR7A 1GLAG 4DCHA 1GLEG 4BR5A 4B9QA 1HLUA 2HF4A 3I33A 4YDUC 2I7NA 3D2EA 1CZAN 3VF4A 3R9PA 5AQQA 2ASOA 2E2OA 4AM7A 4BRPA 2NRHA 3BUZB 2D1KA 1ESVA 1GLBG 3IMXA 4WQ4A 4LC9B 1R59O 2P9PB 4BC3A 4FWKA 4BR0A 4BG8A 4GY2B 4JAXA 4EHTA 1V4TA 3FZFA 5AQRA 2FSNA 4L3QA 3EL2A 4IJNA 2CH6A 1RFQA 3WXKA 3S41A 4BRHA 2QM1A 5AQKA 1NWKA 4FWNA 2QW9A 3M3ZA 4WYBA 4BRCA 1T6CA 4CBUA 4RTFD 4M63C 3DXMB 1SAZA 3KHYA 3WQUA 1SZ2A 3HSCA 3L6QA 2E88A 5AQNA 1NGIA 3R8EA 4H5VA 4XH5A 2V51B 2I7PA 3H46O 4HTLA 3EZWA 2QWMA 3AAPA 4BRKA 3BEXA 4H0OA 1BDGA 2ZGZA 4BR4A 4M7XA 4CBXA 4CZKA 1BOTO 5ADXA 5AQVA 1GLDG 4CZJA 3QB0A 2A42A 4KBOA 5JMVA 4CZFA 4FWMA 3L0QA 1OKJA 4BQZA 2PBDA 2P9PA 2E2NA 3SJHA 2HF3A 2NLXA 5JICA 2OANA 3A0IX 3CHWA 5KQ8A 2W40A 2YJEA 3VPZA 4E1JA 3R6MA 4FWOA 2VYPA 5KQDA 3U8XA 4PKIA 4YDUA 3CIPA 4JHDB 3DAWA 1QHAA 3M1FA 4CZEA 5AQXA 2CGKA 4A2BA 3WXIA 3DXMA 1U6ZA 3FE1A 4H5NA 3MK6A 2P9LB 3KVGA 2GWJA 2H3GX 2E20A 2W41A 2P9UA 1D4XA 2CGLA 3JXUA 3MN5A 4B1VA 4CD3A 2A3ZA 3AAQA 1XQSC 1IJJA 4BGBA 3IDHA 1WOQA 1KAZA 4BRDA 3O4WA 3MN9A 4RCHA 1HKBA 1NGDA 3IFRA 3SLCA 2F9TA 5AQYA 4NB4A 5BPNA 1Q18A 2WUSA 3RSEB 3LDOA 3A5NC 3W3DA 4QS9A 4BR9A 3MCPA 3ZEUB 1KAYA 1Z05A 3CJCA 4EFHA 5AQHA 3CJBA 3BP8A 1RDWX 2A6AA 4FWQA 5EOYA 3EKUA 1X9JA 2FF6A 5AQUA 3UB5A 2IVNA 4A61A 5AQGA 3LM9A 1TYQB 2AA4A 2NZTA 4NO7A 4Y0WA 4JHDA 1JCGA 5AQZA 5ADXH 3C0BA 3CJ9A 1BU6O 5AQWA 2GUPA 5I9EB 1DEJA 1X3MA 4B1YB 2P9LA 3ZETB 1HUXA 1NLVA 3LDLA 1LOTB 3QICA 1HKCA 3W0LA 1ZBSA 4CZHA 2ZWHA 4WQ5C 3CI5A 4K43A 3LL3A 4DB3A 1K8KA 1S3XA 3ID8A 4CBWA 3O08A 2V7ZA 1GLCG 2DPNA 5CE3A 4XH4A 2P9KB 1HX1A 1T6DA 3H1VX 3RSEA 1RGIA 3ZEUA 3ULEA 5AQSA 2D0OA 3D7EO 1JCEA 3ATVA 5BN9A 3VF2A 2YJFA 5AZJB 3QFPA 4HWIA 5FPDA 3O6WA 2P9SB 2ASMA 3CJ1A 4FWLA 4JNEA 4CZGA 4J8FA 3KZBA 4BC4A 1TYQA 2E2QA 4BRAA 1G99A 5BR9A 3P4IA 3ZX0A 1V4SA 1NGGA 2P9IB 4FPBA 4XH1A 1YAGA 4BROA 4B1ZA 4O5FA 1T44A 1ATRA 3QBXA 5LY3A 3ZETA 2A40A 5AFUA 5E26A 2QWQA 1XC3A 3H6EA 3QDKA 4BRMA 2E8AA 2GELA 5LJVA 5AQTA 1BA0A 1YVNA 1ATNA 5F2RA 3CJAA 3L4IA 3GG4A 1YUWA 2IVOA 3VEZA 2QWLA 1NGHA 4H0VB 3WXLA 1MA9B 1U2VB 3H3OB 4IJAA 3QMLA 3ATUA 4ISGA 3HBTA 3TU5A 2QWRA 4EHUA 4FWSA 5AQFA 1QZ5A 3SK3A 4FOEA 2FF3B 4PKGA 3VEWA 3H1QA 2Q97A 1XUPO 1WUAA 4QS7A 2HMPA 3SMSA 2P9SA 3GBTA 5EVZA 4CJ7A 2ITMA 1QZ6A 5BRDA 2Q36A 2QWOA 4O8KA 4QS8A 3WUHA 2E1YA 2QWNA 4PL8A 1C0FA 2P9IA 4WQ5A 4BC5A 3A5LC 4JD2B 4DQ8A 2F9WA 3VEOA 2J4RA 3B8AX 3CQXA 3JS6A 4BQLA 4EIAA 4H5RA 1GLLO 1HKGA 4K42A 3VESA 4BC2A 4AM6A 3UKUB 3J8AA 4CD1A 1SQKA 4CZIA 3EKSA 2IVPA 5BREA 1E4FT 3D2EB 3VGLA 4BVPA 2EWSA 4Z94A 1YXQA 3LM2A 1EQYA 4FWRA 3CQYA 1MWMA 1NGCA 4EAHD 1U2VA 5F1XA 4FPAA 5ELZA 2D4WA 5BPLA 2Q31A 4H5TA 4IZ9A 4JN4A 5FPMA 5FPNA 1LCUA 4BRQA 3CJ7A 4I6MB 5B8HA 2ASPA 4IWVA 1KAXA 1NGBA 1X3NA 1J6ZA 4H5WA 3VEYA 5AFUH 3ENHA 3F9MA 2AP1A 1E4GT 5AQOA 4BVOA 3ENOA 3AY9A 4BRGA 3FLCO 4FO0A 1ATSA 2VWBA 3VEXA 4H0XB 4A2AA 5F0XA 5KPTA 4PKHA 2UYTA 3BF3A 3O1BA 4JD2A 2YI1A 4BR2A 2YCHA 2BTFA 2E2PA 2QXLA 3VGKA 3C7NB 4BRNA 3UKUA 1NGJA 3EN9A 2GEMA 3GOIA 5BN8A 3MN6A 3A8YA 5EXWA 1NGFA 2Q1NA 2KHOA 1NGEA 3A5MC 4H0YB 2GWKA 5AQJA 3TPQA 1Z6RA 1GLJO 4ISFA 3GL1A 4CZLA 1HJOA 3VEVA 3WEEB 4XEIA 1S22A 3O80A 3VERA 3DXKB 4H0TB 5EX5A 5BRHA 3VENA 2YHXA 4I6MA 4K41A 5AQMA 1KXPA 1BUPA 2P9NB 1NBWA 2YHWA 3FZMA 3UKRB 4BGAA 3MN7A 1GLFO 2IIRA 4M7YA 3VGMA 5AZIB 3DWLA 2FXUA 3QBWA 2V52B
chains in the Genus database with same CATH superfamily
1XMQK 4C23A 5AQIA 3OHRA 2HVHA 4E72A 3AVKA 1TUUA 4CJWA 2FLOA 4CVNE 4C8OA 1VSKA 4M3TA 3ZT1A 4W5NA 3C7NA 4FL9A 4Z4HA 2P9UB 3AVLA 1KVAA 3P5JA 3IUCA 1NKEA 3QLHA 3CFPA 4DQSA 1Q81O 2JLEA 3LPUA 4C1NI 4CEFA 2KW4A 4CEAA 4LFAK 3IG1A 4R5PA 1IG8A 5AZJA 1B92A 3FZKA 4DR7K 2OPRA 3WXJA 2ZE2A 1C6VA 3ZSVA 4CFCA 4F9OA 2KFNA 2B4JA 4Q0BA 4JKHA 4PL7A 3QEVA 4CEOA 4CGIA 2A1SA 4E0DA 2JWLA 4CZMA 3K5OA 4A62A 2C1IA 4OGCA 3AVIA 1VSFA 2UXBK 3PX6A 3S3MA 3D2FA 1VAZA 4EP4A 5LMNK 4FLUA 3ZX2A 3CMEN 4LF9K 4O0JA 2FSKA 4BEBA 1BWFO 5BPMA 4DV1K 5BRFA 3KIOA 4FW2A 3HTVA 1BA1A 1DKGD 3BY5A 2YKNA 3HOSA 1ZXOA 5AQLA 3ZX3A 2A5XA 4IO8A 3J7YP 4BREA 4CGFA 1XHZA 1QHTA 2Q3SA 5J2PA 1IV0A 2Q0RA 5FPEA 4MO5A 5HRSA 4CECA 3VMFB 2Y1IA 3T19A 1HMVA 4KHNA 1VQ8N 1U47A 3E9PA 1IKYA 2KQ2A 4KO0A 1VQON 4DV4K 1IKXA 2BE2A 1GLEG 4DCHA 2GUIA 4B9QA 1CZAN 3O4QA 4A5BA 3T1AA 1IO2A 4DWIA 1C0TA 1RBTA 4H4OA 1FKPA 1DT9A 3BUZB 3G6EN 4OKJA 4EZ6A 2YKMA 1NK8A 4I2QA 3IMXA 1TL1A 4FK4A 3I56N 4WQ4A 1WLJA 1Q9YA 1OVYA 1M90O 4FWKA 4HHTA 4BG8A 3RMDA 4LFBK 4JAXA 4JKDA 3VQDA 4CJLA 1T05A 3G0ZA 3K5NA 3PX0A 2CH6A 3Q7CA 3WXKA 3S41A 2QM1A 5AQKA 4CFBA 1YI2N 1LWCA 1NK4A 1F21A 3DXMB 5C42A 4JI8K 2O8FB 2IDOA 3HSCA 1NGIA 1BQNA 3OYIA 2PFUA 4XH5A 3K0SA 2I7PA 4FLWA 4X64K 3H46O 1SKWA 3OYHA 3V9WA 4OLBA 4JLHA 3SNNA 2QWMA 4BRKA 1NG9A 3QEWA 3TSPA 1BDGA 2ZGZA 4M7XA 1YJWN 5A2QO 4FW1A 3QNNA 1BIUA 3QNOA 1QTMA 4CJVA 3AV9A 3K59A 4DSFA 4CZFA 1C1CA 3L0QA 1OKJA 2YHBA 1EP4A 3HSTB 3SJHA 4LH5A 5JICA 5KQ8A 2W40A 1WBDA 4BDPA 2HSTA 2QA4N 1FXXA 3CCRN 3DAWA 4RW8A 5J1EA 3LDSA 5M1PA 2CGKA 4FLTA 4YOYA 2W41A 2P9UA 4PA1A 2HNZA 3KLIA 4CD3A 5HOOA 1CZ9A 2DTUA 1KAZA 4DF4A 4NYFA 4CHZA 4HVJA 3SLCA 1ZYQA 3KD5E 4NB4A 1GOCA 3SBTA 1TAUA 1VSJA 1Q18A 3RSEB 3LDOA 4QS9A 3TABA 3MCPA 3ZEUB 3PO5A 1NKCA 4N76A 1JKHA 3TWHA 1XNQK 3CJBA 1S1XA 5BR8K 4KH4A 1TKXA 3JSMA 2G8HA 5AQGA 2AA4A 2NZTA 1BHLA 4DV0K 2HBJA 5AQZA 3J81O 4FJGA 5ADXH 1P90A 2GUPA 5JS2A 5I9EB 1X3MA 1RT5A 2OTJN 4DR3K 4B1YB 4IOCL 3ENBA 4CF1A 1W2BM 3SUPA 3QICA 1HKCA 2C1GA 1BI4A 3MEGA 2YX6A 3HT3A 1ZBIA 1TK0A 1JLQA 2NRRA 2DFHA 4OKKA 4XH4A 2UUAK 5AQSA 2VWKA 3D7EO 5BN9A 3VF2A 3BDPA 1TGOA 3OS1A 3E9OA 5FLXO 4JNEA 4JRPA 3CJ1A 4FJLA 4B9UA 4BC4A 1TYQA 4B3TK 5BR9A 3P4IA 1HQEA 1QE1A 4G1QA 4NCGA 4Z0UA 1ASUA 4JI6K 2E5LK 4O5FA 2F8TA 1ATRA 4CIEA 1KVBA 1WNSA 4DU4A 2IS3A 4FK0A 4FM2A 3M8QA 4FZZA 3DLLL 3O9TA 5AQTA 3BZKA 1JLCA 2EHGA 2X78A 3CJAA 3L4IA 5DM6L 2IVOA 3CPEA 1RBSA 3QMLA 3ATUA 4ISGA 4A57A 4E7JA 4B3OA 4I7FA 4EHUA 3RMAA 3CM6A 3S3NA 3QIOA 1IKVA 3NGZA 3VEWA 3M8RA 4QS7A 5TKWA 4Z4FA 3SMSA 5EVZA 1SKSA 2ITMA 4EZ9A 4KREA 2QWOA 3WUHA 1OH7A 4DSLA 3AGRA 2OZMA 5M1FA 4WQ5A 3VQ8A 3VEOA 2ZD1A 2J4RA 4CF0A 3CC7N 5EU7A 1WAJA 3V4IA 4K42A 1TV6A 4BC2A 3J8AA 3EKSA 3OYAA 2EWSA 1YXQA 4FWRA 4DLGA 3TAQA 4ILJA 1U2VA 4EP5A 2VGMA 2Q31A 4DFJA 4IZ9A 2HBMA 4JN4A 5FPMA 5FPNA 2VG6A 3CJ7A 3P38A 5C2FA 3AVAA 1W0HA 3NGYA 1J6ZA 4DQRA 3VEYA 2P5GA 3F9MA 5LMUK 3HL8A 1NU0A 5HRRA 5J2MA 1QVGM 4BDZA 5FRMA 4BWMA 1ATSA 4CJRA 2RE2A 3NFAA 3MWTA 4PKHA 4CGHA 4GVMA 3F2KA 3OYFA 4JI4K 2UYTA 3O1BA 4JD2A 2YI1A 1U4BA 3CF5L 5KTQA 4E7HA 1FK9A 4LSLA 2E2PA 3C7NB 4OO1J 3TAEA 4JEPA 4BECA 4AHVA 2R7YA 1LW2A 5BN8A 2YV0X 4CJSA 2BGGA 3DLEA 1T7PA 2WOMA 1NJXA 3A5MC 3KLEA 5AQJA 5IWAK 1Z6RA 3VEVA 3O4NA 5GADP 4XJXA 3WNEA 5EX5A 4OPJA 1VSDA 3T69A 3RMCA 4K41A 5CY4A 4JI7K 1X1PA 3LP2A 4CJUA 1NBWA 4DS5A 2HHVA 3FZMA 4WFAL 4KAZA 3MN7A 1GLFO 3NF8A 3C6TA 3NH2A 4FLYA 1VQ4N 3BF1A 2DFEA 3OYBA 1N32K 3U9ZA 4W5TA 1SL0A 4DSEA 3D2FB 1N34K 5JVHL 1EWQA 2E1ZA 5K14A 3FGUA 2IGIA 3SCXA 3HYFA 2CH5A 3HZ6A 3C94A 1RTIA 1EWRA 1RT4A 4DTOA 2PAVA 4B9LA 4GW6A 3C6HA 1S5JA 1TUYA 3OVNA 3E66A 4MLEA 2D5RA 4FOIA 2QI2A 3NMUA 3FZHA 3IRXA 2GTDA 2P9NA 3EO3A 3UKRA 2G8VA 1DGKN 4ISEA 3ZSXA 1I3AA 4Y1CA 4BG9A 1WSEA 1Z26A 2W42A 3WQTA 3A5OC 4KI4A 5M1QA 4YORA 4N56A 3O5BA 3HO1A 3L3VA 4DR6K 3PSIA 3MCAB 3ZSOA 3SPYA 1XHXA 2PY5A 4DUZK 3OYJA 4F8RA 2YHYA 4GNIA 3LDPA 2G8FA 1WN7A 3CYMA 1OH8A 3C65A 4ILHA 3PUFA 4YOWA 3KWGA 3TTDA 1VHXA 3MXIA 3THWA 1K8KB 3LDQA 2OA8A 3U9DA 1JCFA 1B9DA 4M45A 3O1WA 3H45C 1R0AA 3M5RA 4DR4K 1MWKA 1VSEA 3OW2M 4CJEA 4CHPA 3MEEA 5D3GA 2B6AA 1YVUA 4WF9L 3M6GA 3LPTA 5KPRA 2VCPA 2ZF5O 4M41A 4B1WB 4BE2A 5AQPA 2YNIA 3CCQN 4BR7A 1GLAG 3O9UA 1HLUA 4YDUC 2NRWA 3ZT2A 3AVBA 3R9PA 5AQQA 4DTJA 4YOUA 1L3UA 3TAFA 2E2OA 4CHQA 4KB1A 2VG5A 1KFSA 1ESVA 1GLBG 1K73O 3PV8A 4BC3A 3K5MA 3HJFA 3VQBA 2DFFA 4DR5K 4GY2B 1HNVA 3FZFA 4L8RB 1CLQA 2Z1JA 1RNHA 1WB9A 3EL2A 1JLGA 1GOAA 2OPPA 4BRHA 1NWKA 4BRCA 2E4LA 4CBUA 1I94K 1KVCA 1SAZA 3KHYA 4KFBA 3RR7A 5CR4A 4JKFA 2B5JA 3SPZA 4CEBA 4QOZB 4FYDA 1Z25A 3BEXA 1BL3A 2XY6A 4LSNA 1YITN 3AA2A 4BE0A 3HPOA 3DMJA 2QTDA 3U3GA 3L4QA 4C8KA 4CZJA 5JMVA 2NRXA 4FWMA 2P9PA 1WSFA 3HPHA 4WCEL 1JXBA 4G9ZA 3O3FA 3A0IX 3CHWA 4DSJA 1Q82O 2VYPA 3CPWM 4PKIA 4CZEA 2UUCK 4E3SA 1VRTA 3LP0A 4A2BA 2E6MA 1HNIA 3MK6A 1RCHA 2E20A 2CGLA 4Q5VA 3G10A 3AAQA 2KKZA 1IJJA 3IDHA 5CYQA 4FJJA 1S6QA 3KK3A 1UWBA 3DYAA 3D6RA 4RCHA 3V1RA 1BI4B 1HKBA 3K57A 1NOYA 2W00A 3RVCA 3KD1E 1WAFA 1RT2A 4CEDA 3EY1A 4XIUA 2F9TA 4CHNA 4O0IA 4KHUA 4C8MA 5DMRA 3NF7A 4B3MK 3A5NC 1QVFM 3B6OA 1YIJN 4LF4K 4EFHA 5AQHA 5HROA 3TR8A 3P83D 1RDWX 5EOYA 4GV9A 1X9JA 2FF6A 5HBMA 5CZ2A 3OYMA 4CERA 1TYQB 3AVNA 2ATQA 3DRSA 1KC8O 4Y0WA 1ITGA 1JCGA 3C0BA 4KRFA 4AHTA 1TVRA 1YF5L 4ILGB 1NLVA 2O8EA 3IS9A 3W0LA 4IFEA 4JRQA 4IKFA 1ZBSA 3VA0A 3TAGA 3M8PA 4YOXA 5T7BA 1K8KA 3PX4A 1QSSA 4CBWA 4DFMA 2JGUA 3O08A 2V7ZA 1GLCG 4BY9C 1HX1A 1T6DA 4DU1A 5C24A 2YNGA 2RPIA 4B8CA 3L2QA 5CYMA 2HMIA 3VQ4A 4AH9A 3ATVA 3I0RA 3CM5A 3OBYA 4KH6A 2ASMA 1SUQA 3KZBA 1VSIA 4FLXA 4FJ7A 3KLFA 2I5JA 1IG9A 4DQQA 3NVMA 1YAGA 4BROA 3LAKA 1RT6A 1VSMA 5LY3A 4X66K 3ZETA 3L2WA 2A40A 5AFUA 2NRZA 1L3TA 3QDKA 4BRMA 2E8AA 5LJVA 1N6QA 4CF9A 1ATNA 5F2RA 3GG4A 3QEIA 2QWLA 4H0VB 1U2VB 5HRPA 4X65K 4RW9A 4I2PA 4IJAA 3HBTA 3TU5A 4CF8A 3TTFA 2XO7A 3P39A 2UU9K 5GAHP 4FWSA 2FBYA 1NK9A 4HUFA 5AQFA 3KWIA 4M42A 3SK3A 2KZMA 4PKGA 2ZQBA 4O8UA 4DKWA 1XUPO 3OBWA 1G15A 4NYNA 4AILC 1WUAA 2HMPA 1J53A 2P9SA 4DSKA 2HNDA 2OPSA 3BZCA 4O8KA 4QS8A 2QWNA 4KH5A 4CF2A 2P9IA 4BC5A 4JD2B 4FJMA 4DQ8A 2F9WA 3QINA 5SZTA 1DTQA 2O8DB 3C95A 1T03A 4CD1A 3ZSRA 4KB0A 2IVPA 2NNWA 5BREA 4BE1A 4BVPA 3L8BA 4QCLA 3LM2A 4O5BA 3CQYA 4Z4IA 3O9QA 3T3FA 4K8ZA 5BPLA 5M1NA 1ZBFA 3SUNA 5GAGP 5B8HA 4IWVA 3V9ZA 3SUOA 1C0UA 3THYA 1VQNN 3LZJA 4DG1A 2OCEA 3ENHA 3CCJN 2AP1A 4N47A 4UY8O 2ZJPL 1OH6A 5AQOA 3AY9A 3JYTA 5GIOA 3VEXA 4DTUA 5KPTA 4A2AA 4ID1A 2FBVA 3P31A 3PIOL 2UUBK 3ZLJA 4JV5K 3BGRA 4V19S 3DRRA 3LWLA 3VQCA 2QKKA 4AF1A 4B8AB 4F3TA 2QXLA 4NLBA 4NCAA 1JLBA 3UKUA 3ULDA 1CXUA 2FBTA 3VTHA 3MN6A 1NGFA 1J5EK 1NGEA 1KSPA 1GLJO 4DV3K 3GL1A 5KGWA 1S22A 3AO2A 1JLFA 3VERA 4YOTA 4RW4A 3NH0A 4CW7B 5BRHA 4W5RA 4GMJB 5AQMA 1KXPA 1S72N 4PHTX 2X6SA 1BUPA 4ELVA 2P9NB 2Z1IA 3UKRB 1N8RO 3VGMA 4YY3K 3DWLA 3QBWA 4XH1A 2V52B 4MQ3A 4DFKA 1QQOA 1RDAA 3UE5A 4GV6A 3VF6A 3LP1A 4H0PA 3E1YA 1RBRA 3U4LA 3LDNA 2XY8A 3I8BA 4WFBL 3FFKB 3SUQA 5LJWA 3K2PA 2Y1JA 2W6KA 3GE1A 3AARA 3NDKA 2G8IA 2HHUA 1X9SA 4AHSA 4NLCA 3THWB 2FBXA 4NXMK 3AO1A 3F9KA 3WEEA 1DTTA 1BIZA 3CFRA 5JLFA 3DXKA 2OPQA 4CGJA 1OH5A 5JS1A 3ZSZA 3FZLA 4F4KA 3PIPL 1HNXK 4B1XB 3QFUA 3HOTA 1ZC6A 1TKTA 1RT7A 3ISNC 3O8MA 2KZZA 1NM1A 1IBMK 3CYGA 5AZIA 3AVGA 3K9KA 1C0GA 1W7AA 4JK7A 5I42A 5JENA 4MFBA 4DTNA 3KLGA 5IT9O 3GDQA 2Q2RA 2XY5A 3T7ZA 4WE1A 3U6FA 4K8XA 2D0PA 3DLKA 3ZSYA 1HQUA 3HM8A 2CGJA 4IO9L 1W9HA 4BRFA 2PYJA 4CJFA 2D0AA 4LF8K 4BE7B 4Z4EA 1HJRA 3AVCA 1UAXA 3KK1A 3CD6N 1H1VA 1SV5A 1BG3A 1N5YA 3CCSN 1EX4A 1ZBLA 1EKEA 3E01A 2YNHA 5C15A 4CK1A 3ZYYX 3HI0A 2G8KA 4C8NA 3ULEB 1HYZA 3VA3A 3KK7A 4PQUA 4K0KK 1K6YA 3CETA 1MDUB 3VQEA 3G25A 3K9JA 2O8DA 2O4GA 5KI6A 4OKEA 2UXCK 4OPHA 1TL3A 2HOEA 4ZHRA 3AO3A 3I33A 2I7NA 4KTWA 2ZM6K 1OVQA 1HYVA 3WNFA 4AM7A 4LF5K 4IG0A 2NRHA 1RBUA 3CFOA 2D1KA 1A5XA 3LWMA 3SV3A 4KKOA 3OYCA 2VG7A 4KV8A 3O9RA 4LC9B 4JKAA 4DTXA 3VTIA 3O3HA 1R59O 2P9PB 1RDDA 5AQRA 3THVA 2F8SA 4FCYA 2O8BA 1O13A 3CCEN 2FSNA 4L3QA 3SQ1A 4IJNA 1GOBA 1RFQA 1CZBA 3MX2A 3AO5A 1T8EA 4FWNA 2QW9A 4GV3A 4WYBA 3ZSQA 4M63C 3WQUA 1SZ2A 4JKEA 1BCOA 2E88A 1DLOA 2HBKA 2HB5A 5AQNA 3NAEA 4KTZA 2V51B 4JK9A 5DM7L 3EZWA 4H0OA 3QESA 3VN5A 1UA0A 3I55N 4CZKA 1EETA 1BOTO 4GKKK 1FJGK 4CFAA 5ADXA 4DQIA 3EEQA 3NHGA 1HR0K 2O4IA 1GLDG 3QB0A 2A42A 3O9SA 3ZSWA 4BQZA 2PBDA 2E2NA 3RWUA 4JKGA 2HF3A 2NLXA 2KTQA 2VQFK 2OANA 4H8KA 2W6LA 3RMBA 4IOAL 2YJEA 3VPZA 3ZT0A 4CHOA 1XMOK 4FWOA 4O55A 5KQDA 3SQ0A 3U8XA 4ID5A 4YDUA 4CGDA 1QHAA 3M1FA 3IAYA 1KCFA 3G71N 4H5NA 4J2DA 3OA9A 2XRIA 2GWJA 2P5OA 2A3ZA 2O8EB 1XQSC 3WXMB 4BRDA 3PY8A 3QEXA 1JLEA 1RDUA 3G4SN 1NGDA 4BACA 5HRNA 3IFRA 4Z4CA 2P1JA 4F3OA 4YHHK 5CZ1A 2HHTA 5AQYA 3CCLN 4R79A 2O8CA 3HP6A 3LP3A 5BPNA 2IOCA 3W3DA 3OS0A 4ELUA 4E19A 1Z05A 4CGGA 3DLHA 3CG7A 4O4GA 2IAJA 3BP8A 2A6AA 3MAQA 2YNFA 3EKUA 1D9DA 3V9UA 3UB5A 4A61A 2IVNA 2GBZA 1JLAA 3LM9A 4NO7A 4OX9K 4CJPA 4JHDA 3K58A 2GX9A 4B9MA 4CHYA 5C0YA 1DEJA 3HRGA 1S9GA 2P9LA 3ZETB 1VQKN 2QK9A 3LDLA 2G8UA 1S1WA 4J2AA 3NE6A 1LW0A 4CZHA 2ZWHA 4IDKA 5KRSA 3M8SA 3LL3A 4DB3A 3K5LA 1EXQA 2DPNA 3HXMA 5CE3A 3ID6A 3KK2A 2P9KB 1J54A 3OJUA 1RGIA 3ULEA 2EX3A 1JCEA 1BISA 1C1AA 1VQ9N 2YJFA 5FPDA 1VSLA 2P9SB 2WONA 3ASMA 4FJNA 4J8FA 2ETJA 2WTUA 4BRAA 1G99A 1NJIO 4A59A 1V4SA 1NGGA 2P9IB 4FPBA 4CJTA 4LY7A 2OTLN 1T44A 4JI2K 3HPGA 4DTSA 1VSHA 3EE8A 1Q86O 5E26A 2QWQA 3TI0A 2KLAA 3P1GA 1E3MA 4IFYA 2BH1A 1BA0A 1YVNA 3VQPA 4E1NA 5J2QA 3J7AP 1YUWA 1ILYA 4DV7K 4KPYA 2D0BA 1C1BA 3L2RA 2QWRA 4N5SA 1FW6A 4AHUA 3THYB 1QZ5A 1KFDA 1RDBA 2FF3B 3CMAN 1QQCA 2Q97A 4CJ5A 2HHSA 4CJ7A 5GIPA 1A5VA 2RKIA 2BDPA 1QZ6A 4J2EA 2Q36A 4FLVA 4ZTJA 1RILA 2E1YA 4PL8A 4IDHA 1XI1A 2XHBA 3NGIA 4DFPA 3B8AX 3CQXA 4EIAA 3RRGA 3HK2A 4JI5K 4PUOA 3E9LA 3UKUB 1SQKA 3JAMO 1E4FT 3PO4A 3D2EB 3UIQA 5SWMA 3F5TA 4Z94A 3THXA 1ASVA 3H08A 1MWMA 4FPAA 1S1TA 2D4WA 3J80O 1MU2A 4DR2K 4H5TA 1LCUA 4BRQA 3OYEA 4N41A 2ASPA 3DLRA 4JS5A 1KAXA 4DMNA 1QS4A 1X3NA 1NK0A 3AA3A 4NXNK 4JS4A 3N4PA 3I0SA 3ZCMA 1E4GT 3QIPA 3MXMA 4BVOA 2HHXA 4CE9A 3ENOA 3CCMN 4BRGA 3RR8A 4FO0A 3FLCO 4H0XB 4E89A 5F0XA 1Q7YO 3LALA 4CEQA 4HCCA 3AA4A 1O1WA 3BF3A 1TAQA 1S1UA 4IOXA 4M3YA 4BR2A 4M3RA 1XC9A 2YCHA 2BTFA 1ZBUA 4HTUA 1IH7A 2WC9A 2Z1HA 1SKRA 1I39A 1K8AO 1NGJA 3EN9A 2GEMA 3GOIA 3KJVA 2KHOA 3V1OA 1L5UA 4CIGA 2RF2A 3TPQA 4B08A 4CIFA 4CZLA 1HJOA 3WEEB 4XEIA 4M3WA 3DXKB 4H0TB 4LD0A 3VENA 2LSNA 2HHHK 4FZYA 4I6MA 1RTDA 4DUYK 4PY5A 4E1MA 3RTVA 1NJZA 2X74A 2OZSA 1RDCA 3MX5A 2IIRA 4RW6A 5AZIB 3SAHA 4JI3K 3R1XA 2JWKA 1YHQN 5C12A 2ZJQL 3V9XA 1QQMA 4MO4A 1JL1A 2V7YA 5E84A 5EY4A 1NK7A 4FSVA 3T1HK 5TKYA 2NRVA 3KKRA 2F4VK 3SMPA 1UA1A 4B3SK 1KLMA 3H3NO 2P9KA 2Q0UA 3U3YA 2A41A 1BO5O 4FJ8A 4CEEA 2G8WA 5KPZA 2ZGYA 1HPMA 2BUPA 5AJ3K 2VGNA 1YTUA 3QO9A 4WQ4C 4DHYA 4B1UB 4K25A 3FR0A 4NCBA 5AR0A 3VOVA 5JLHA 4O44A 5CHIA 4AHRA 1L3VA 4KHPK 3MMVA 4IXCA 4JK8A 2IC3A 4FK2A 4KI6A 3S9HA 1D9FA 3OYNA 4KTQA 1N36K 3SZ2A 4JI1K 4H03B 4U67L 1NGAA 4LFCK 4YNQA 4CK2A 3A2FA 4RWTA 4CI6A 3AVMA 3S5TA 4KHSA 3V9SA 3ZT4A 3L2UA 3ALYA 1U48A 1IBLK 1VQLN 1HNWK 5M1OA 1NKBA 3QETA 1VQMN 4DU3A 2ITGA 1LWEA 1W97L 3OYDA 1N33K 3VQ7A 3L2VA 1BGXT 1LAWA 4IFVA 4A5AA 4MDAA 1RT3A 2FC0A 1NJWA 1SL2A 3TAPA 2WBNA 4JYAK 1QQNA 2O8BB 4MLHA 1JXEA 1Y64A 3SAFA 3MDQA 3DJCA 3CERA 3CXCM 4DLEA 3AVJA 4FJHA 1C0MA 1P8ZA 4M3UA 3AO4A 2F7TA 2FSJA 3AVFA 4CJ4A 4OPKA 3VETA 4BRIA 3WT0A 4E7IA 3SJJA 1B9FA 4TSXA 1HYSA 2HNYA 4B9NA 1NMDA 3VQ9A 4W5QA 4M3XA 1KLNA 1TK8A 3SQ4A 4FWPA 2QWPA 4BRLA 1D8YA 1WSJA 3MXJA 4BR5A 2HF4A 2P51A 3D2EA 3CCUN 3VF4A 3VQQA 3SQ2A 1IBKK 2VWJA 2ASOA 4WFNL 4DSIA 4BRPA 3TTCA 2YHAA 3SAGA 2NUBA 1WSHA 2HBLA 5JVGL 4DV6K 3SYZA 1NK6A 4B3RK 4OGEA 4BR0A 3V81A 4B9SA 4HCBA 4JKGB 1V4TA 4EHTA 4FXDA 4FVUA 3TARA 1NJYA 3IKMA 1TK5A 2PZSA 2HHIA 4UQGA 1JJ2M 3MWPA 3M3ZA 1BQMA 3J7ZO 1T6CA 3ITHA 4FJ5A 1RTHA 4RTFD 3VQAA 4Y1DA 1XWLA 1YT3A 1VQPN 3L6QA 3R8EA 4H5VA 3DI6A 1LWFA 2QEXN 4HTLA 1EO1A 3DRPA 3AAPA 3DOKA 4BR4A 4CBXA 1HNZK 2GV9A 5AQVA 5HLFA 1D5AA 1ZBHA 2O8CB 1QSLA 4KBOA 3RRHA 3CC2N 3V6DA 4LF7K 5M1KA 4E7KA 1HRHA 3QEPA 3DM2A 3N4QA 4E1JA 2HW3A 3R6MA 4RW7A 4JI0K 1TKDA 3CIPA 4JHDB 5AQXA 3LZIA 1IKWA 4B9TA 3EZ5A 3OYLA 1REVA 3WXIA 3DXMA 1U6ZA 3FE1A 1VRUA 5C25A 2O8FA 5HP1A 3OYGA 2P9LB 2WFBA 3KVGA 2H3GX 3C6UA 4RG8A 3JXUA 1D4XA 3MN5A 4BWJA 4B1VA 5KRTA 3NH1A 2HVIA 4JKCA 4BGBA 1WOQA 5E41A 3O4WA 3MN9A 5LL6Z 4ZTFA 1LAVA 4CJKA 3TAMA 3D0PA 4FJKA 4I9QA 3TSUA 1S1VA 1YJ9N 1YTAA 2WUSA 4BR9A 4DTPA 1KAYA 4OVLA 3CJCA 5H1SQ 3VQ6A 3MEDA 4FJIA 3AVHA 4FWQA 4IEIA 2ZJRL 4F2RA 5AQUA 3WNGA 5J2NA 3HM9A 1XNRK 4U7BA 2X6NA 4Z4GA 3FFIA 1Q8IA 3LAMA 3KLHA 3CJ9A 2QKBA 1BU6O 4OJRA 5AQWA 4DV2K 4X62K 4CESA 3B6PA 1RT1A 1HUXA 1LOTB 3I8DA 3T1YK 1WSIA 3HVRA 3C6AA 3R3LA 1U45A 3Q7BA 1X9MA 4DQPA 1CXQA 4WQ5C 4FJ9A 1A5WA 3CI5A 4I9LA 3DLGA 4K43A 3KTQA 4GKJK 1S3XA 4FM0A 3ID8A 3HVTA 4AHCA 2DY4A 3ZT3A 3MECA 5GAEP 4ELTA 3H1VX 1BCMA 1UOCA 3RSEA 4OLAA 3ZEUA 1VK0A 2D0OA 4DV5K 3PLAA 1J9AA 2BANA 5AZJB 2NRTA 1L3SA 3QFPA 4HWIA 3SI6A 4E7LA 2UXDK 3O6WA 4FWLA 4CZGA 1ASWA 4CJQA 1JL2A 2E2QA 4FM1A 4CFDA 3O3GA 3ZX0A 1KTQA 4F2SA 2PYLA 4B1ZA 4DS4A 3QBXA 4OPAA 3SBGA 1J5OA 4DF8A 1KD1O 1XC3A 3H6EA 4LH4A 3LANA 4CJ3A 2GELA 4J2BA 2Z1GA 3L3UA 3THXB 3VEZA 3NF6A 1NGHA 3WXLA 1MA9B 4HUGA 3H3OB 4PWDA 3WNHA 4M3ZA 1S6PA 2QXFA 5DK5A 1KRPA 3HP9A 1YJNN 3D45A 5FRNA 3S3OA 1HPZA 1SL1A 4FJXA 3NF9A 4FOEA 5FDLA 4H4MA 3H1QA 4IEEA 3SV4A 3OJSA 4DTRA 4GVEA 4IG3A 1VQ7N 1K9MO 3CQ8A 3OTOK 4HUEA 3GBTA 3V1QA 1SS6A 4KHYA 5BRDA 4KHWA 4CK3A 5C2DA 1C0FA 4JKBA 3A5LC 2RHKA 3OS2A 1QSYA 1VQ5N 3JS6A 5I3UA 4BQLA 4ICLA 1U49A 4H5RA 4YFUA 1GLLO 4C1NK 1HKGA 1NMNA 3VESA 2VQEK 1NK5A 4FZXC 4AM6A 4LF6K 1FKOA 4CZIA 3AA5X 4YOVA 2HHQA 1RTJA 3VGLA 1U04A 1EQYA 4B9VA 4CEZA 1NGCA 4EAHD 5F1XA 5ELZA 4KHQA 5MLCQ 4FVMA 3OYKA 1RBVA 3VQ5A 3KKSA 4I6MB 2AJQA 2RN2A 1X9WA 1LV5A 1NGBA 1M1KO 4H5WA 2XY7A 5AFUH 1TKZA 2D0CA 3NBPA 4AQYK 2E6LA 2VWBA 3EYZA 1WBBA 5FROA 3F73A 3OY9A 4DTMA 3EE9A 4DR1K 1KQSM 4FLZA 1WSGA 4IBNA 3VGKA 3NVKA 4BRNA 2OYQA 1Q9XA 1NOZA 4MDBA 3A8YA 5EXWA 3DLBA 1NNEA 3NCIA 2Q1NA 1Y97A 4QAGA 4CCHA 4H0YB 2KFZA 2GWKA 5C10A 1T3VA 4ISFA 5HL7L 5KGXA 3AGKA 3DOLA 1VQ6N 3O80A 4W5OA 2HHWA 4C8LA 2YHXA 1S9EA 2A1RA 3PSFA 3CCVN 2YHWA 3TANA 4BGAA 2F96A 4M7YA 5GINA 3CC4N 2FXUA 3TSQA 4BDYA 3QERA
chains in the Genus database with same CATH topology
1QQMA 3BF1A 4MO4A 4C23A 5AQIA 3OHRA 2V7YA 5E84A 5EY4A 1QQOA 3U9ZA 3UE5A 4GV6A 1TUUA 3VF6A 2FLOA 4FSVA 5TKYA 4H0PA 3D2FB 3E1YA 3U4LA 5JVHL 3C7NA 4FL9A 2NRVA 3LDNA 2P9UB 3I8BA 3SMPA 2E1ZA 4WFBL 3FFKB 3IUCA 3FGUA 5LJWA 3H3NO 2CH5A 3HZ6A 3GE1A 3AARA 1Q81O 2P9KA 2Q0UA 4C1NI 2A41A 1BO5O 4NLCA 5KPZA 2ZGYA 2PAVA 3WEEA 1HPMA 1IG8A 2BUPA 5JLFA 3DXKA 3C6HA 1TUYA 5AZJA 2VGNA 3FZLA 3FZKA 3E66A 4MLEA 4FOIA 2QI2A 3NMUA 3FZHA 3WXJA 4WQ4C 4DHYA 4B1UB 3PIPL 4B1XB 4F9OA 2GTDA 3FR0A 3QFUA 2P9NA 4K25A 1ZC6A 5AR0A 3VOVA 5JLHA 3HOTA 5CHIA 4JKHA 3EO3A 4PL7A 3UKRA 3MMVA 3O8MA 4IXCA 4JK8A 1NM1A 1DGKN 4ISEA 5AZIA 3TSQA 3K9KA 1C0GA 2JWLA 4BG9A 4CZMA 4A62A 2C1IA 4H03B 4JK7A 1NGAA 3WQTA 4U67L 3A5OC 5M1QA 4YORA 3GDQA 4RWTA 3O5BA 4CI6A 2Q2RA 3T7ZA 3MCAB 3D2FA 1VQLN 1VAZA 3CMEN 5M1OA 2D0PA 3ZX2A 2FSKA 3HM8A 1VQMN 2CGJA 2YHYA 4IO9L 4BRFA 4GNIA 4BEBA 1BWFO 5BPMA 3LDPA 5BRFA 1W97L 3C65A 3HTVA 1BA1A 1DKGD 4ILHA 4BE7B 4YOWA 3HOSA 1ZXOA 3KWGA 4A5AA 4MDAA 3TTDA 5AQLA 3ZX3A 2A5XA 4IO8A 2WBNA 3CD6N 1H1VA 1K8KB 3LDQA 4BREA 1BG3A 3U9DA 1JCFA 3CCSN 1QQNA 4MLHA 1Y64A 3SAFA 3O1WA 5C15A 3MDQA 3H45C 3DJCA 3CERA 3ZYYX 3HI0A 3M5RA 3CXCM 1MWKA 3ULEB 3OW2M 2Q0RA 3KK7A 1P8ZA 5FPEA 4MO5A 2F7TA 2FSJA 3M6GA 4WF9L 3CETA 3VMFB 1MDUB 3VETA 4BRIA 3G25A 3K9JA 3WT0A 5KPRA 2VCPA 1VQ8N 2ZF5O 4B1WB 3E9PA 1NMDA 1VQON 5AQPA 4FWPA 4OPHA 3CCQN 2QWPA 4BRLA 2HOEA 4BR7A 1GLAG 3O9UA 4DCHA 1GLEG 4BR5A 4B9QA 1HLUA 2HF4A 3I33A 4YDUC 2I7NA 2NRWA 3D2EA 3CCUN 1CZAN 3VF4A 4A5BA 3R9PA 5AQQA 4YOUA 2ASOA 2E2OA 4AM7A 4WFNL 4BRPA 2NRHA 1DT9A 3BUZB 3TTCA 3G6EN 2D1KA 1ESVA 1GLBG 3SAGA 3IMXA 3I56N 4WQ4A 2HBLA 3O9RA 4LC9B 4JKAA 1K73O 5JVGL 3VTIA 1OVYA 1M90O 1R59O 2P9PB 4BC3A 4FWKA 4BR0A 4BG8A 4GY2B 4JAXA 4JKGB 1V4TA 4EHTA 4JKDA 3FZFA 5AQRA 4FVUA 1O13A 3IKMA 3CCEN 2FSNA 4L3QA 3EL2A 4IJNA 2CH6A 1RFQA 3Q7CA 3WXKA 3S41A 3MX2A 1JJ2M 4BRHA 2QM1A 5AQKA 1YI2N 1NWKA 3MWPA 2QW9A 3M3ZA 4WYBA 4FWNA 4GV3A 4BRCA 3J7ZO 1T6CA 4CBUA 4RTFD 4M63C 3DXMB 1SAZA 3KHYA 5CR4A 3WQUA 1SZ2A 4JKFA 1VQPN 4JKEA 3HSCA 3L6QA 2HBKA 2E88A 5AQNA 1NGIA 3R8EA 4H5VA 2PFUA 4XH5A 2V51B 2I7PA 4JK9A 2QEXN 3H46O 4HTLA 5DM7L 1EO1A 3EZWA 2QWMA 3AAPA 4BRKA 3BEXA 4H0OA 3TSPA 1BDGA 2ZGZA 4BR4A 3I55N 1YITN 4M7XA 4CBXA 4CZKA 1YJWN 1BOTO 2QTDA 5ADXA 3L4QA 5AQVA 1GLDG 4CZJA 3QB0A 2A42A 3O9SA 4KBOA 4CZFA 2NRXA 4FWMA 5JMVA 3L0QA 3CC2N 1OKJA 4BQZA 4XJXA 2PBDA 2P9PA 4WCEL 2E2NA 4JKGA 5M1KA 3SJHA 4G9ZA 2HF3A 2NLXA 5JICA 2OANA 3A0IX 3CHWA 3N4QA 5KQ8A 2W40A 4IOAL 2YJEA 3VPZA 4E1JA 3R6MA 1Q82O 4FWOA 2VYPA 2HSTA 5KQDA 2QA4N 3U8XA 4PKIA 4YDUA 3CIPA 3CPWM 4JHDB 3DAWA 1QHAA 3M1FA 4CZEA 3CCRN 5AQXA 5M1PA 2CGKA 4A2BA 3WXIA 3G71N 3DXMA 1U6ZA 3FE1A 4H5NA 3MK6A 3OA9A 2P9LB 2WFBA 2GWJA 3KVGA 2H3GX 4YOYA 2E20A 2W41A 2P9UA 1D4XA 2CGLA 3JXUA 3MN5A 4B1VA 4CD3A 4JKCA 2A3ZA 2KKZA 3AAQA 1XQSC 1IJJA 3WXMB 3IDHA 4BGBA 1WOQA 1KAZA 4BRDA 5HOOA 3O4WA 3MN9A 1RDUA 3D6RA 4RCHA 1HKBA 2W00A 3G4SN 1NGDA 3RVCA 3IFRA 3SLCA 2F9TA 5AQYA 3TSUA 4NB4A 4R79A 3SBTA 3CCLN 1YJ9N 5BPNA 1Q18A 2WUSA 3RSEB 3LDOA 3A5NC 3W3DA 4QS9A 4BR9A 3MCPA 1QVFM 3ZEUB 1YIJN 1KAYA 1Z05A 3CJCA 5H1SQ 4EFHA 5AQHA 3CJBA 3BP8A 1RDWX 2A6AA 4KH4A 4FWQA 5EOYA 4IEIA 2ZJRL 4GV9A 3EKUA 1X9JA 2FF6A 5AQUA 3UB5A 2IVNA 4A61A 5AQGA 3LM9A 1TYQB 4U7BA 2AA4A 1KC8O 2NZTA 4NO7A 4Y0WA 4JHDA 2HBJA 1JCGA 5AQZA 5ADXH 3C0BA 3CJ9A 1BU6O 1P90A 5AQWA 2GX9A 2GUPA 5I9EB 1DEJA 5C0YA 1X3MA 3HRGA 1YF5L 4ILGB 2OTJN 4B1YB 2P9LA 3ZETB 4IOCL 3ENBA 1VQKN 1HUXA 1NLVA 3LDLA 1W2BM 1LOTB 3QICA 3C6AA 3R3LA 1HKCA 2C1GA 3Q7BA 3W0LA 4IFEA 1ZBSA 4CZHA 2ZWHA 4WQ5C 3CI5A 2YX6A 4K43A 3LL3A 4DB3A 4YOXA 1K8KA 1S3XA 3ID8A 4CBWA 3O08A 2NRRA 2V7ZA 1GLCG 2DPNA 5CE3A 3ID6A 4XH4A 2P9KB 1HX1A 1T6DA 3H1VX 5GAEP 3RSEA 4BY9C 1RGIA 3ZEUA 3ULEA 5AQSA 2D0OA 3PLAA 3D7EO 1JCEA 3ATVA 1VQ9N 5BN9A 3VF2A 2YJFA 2NRTA 5AZJB 3QFPA 4HWIA 3E9OA 5FPDA 3OBYA 4KH6A 3O6WA 2P9SB 2ASMA 3CJ1A 4FWLA 4JNEA 4CZGA 4J8FA 3KZBA 4BC4A 1TYQA 2E2QA 4BRAA 1G99A 5BR9A 1NJIO 3P4IA 4A59A 3ZX0A 1V4SA 1NGGA 2P9IB 4FPBA 4XH1A 3NVMA 1YAGA 4BROA 4B1ZA 2OTLN 4O5FA 1T44A 1ATRA 3QBXA 4OPAA 5LY3A 3SBGA 3ZETA 2A40A 3EE8A 5AFUA 1Q86O 1KD1O 5E26A 2QWQA 2NRZA 2KLAA 1XC3A 3H6EA 3DLLL 3QDKA 4BRMA 2E8AA 2GELA 5LJVA 2BH1A 3O9TA 5AQTA 1BA0A 1YVNA 1ATNA 5F2RA 3CJAA 3L4IA 3GG4A 5DM6L 1YUWA 2IVOA 3VEZA 3CPEA 2QWLA 1NGHA 4H0VB 3WXLA 1MA9B 1ILYA 1U2VB 3H3OB 4IJAA 3QMLA 3ATUA 4ISGA 3HBTA 3TU5A 1YJNN 3TTFA 3P39A 2QWRA 4A57A 5GAHP 4EHUA 4FWSA 5AQFA 3KWIA 1QZ5A 3SK3A 4FOEA 2FF3B 4PKGA 3VEWA 3CMAN 3H1QA 4IEEA 4O8UA 4DKWA 2Q97A 1XUPO 3OBWA 4GVEA 1WUAA 1VQ7N 4QS7A 2HMPA 5TKWA 1K9MO 3SMSA 2P9SA 3GBTA 5EVZA 1SS6A 4CJ7A 2ITMA 5GIPA 1QZ6A 5BRDA 2Q36A 2QWOA 4O8KA 4QS8A 3WUHA 2E1YA 2QWNA 3AGRA 4IDHA 4PL8A 5C2DA 1C0FA 4KH5A 4JKBA 2P9IA 4WQ5A 5M1FA 4BC5A 3A5LC 4JD2B 2RHKA 2F9WA 4DQ8A 3VEOA 1VQ5N 2J4RA 3B8AX 3CQXA 3JS6A 4BQLA 4EIAA 3CC7N 4H5RA 1GLLO 4C1NK 1HKGA 4K42A 3VESA 4BC2A 4AM6A 3E9LA 3UKUB 3J8AA 4CD1A 1SQKA 4CZIA 4YOVA 3EKSA 2IVPA 2NNWA 5BREA 1E4FT 3D2EB 3VGLA 4BVPA 2EWSA 3F5TA 4Z94A 1YXQA 3LM2A 1EQYA 4FWRA 3CQYA 4ILJA 1MWMA 1NGCA 3O9QA 1U2VA 4EAHD 5F1XA 4FPAA 5ELZA 2D4WA 5BPLA 2VGMA 2Q31A 5MLCQ 5M1NA 4H5TA 4IZ9A 2HBMA 4JN4A 5FPMA 5FPNA 1LCUA 4BRQA 3CJ7A 4I6MB 5GAGP 3P38A 5B8HA 5C2FA 2ASPA 4IWVA 1KAXA 1VQNN 1NGBA 1X3NA 1M1KO 1J6ZA 4H5WA 3VEYA 5AFUH 3ENHA 3F9MA 3CCJN 3N4PA 2AP1A 4UY8O 1E4GT 2ZJPL 1QVGM 5AQOA 4BVOA 3ENOA 3CCMN 3AY9A 4BRGA 4FO0A 3FLCO 5GIOA 1ATSA 2VWBA 3VEXA 4H0XB 4A2AA 5F0XA 2RE2A 3P31A 3MWTA 4PKHA 5KPTA 1Q7YO 3PIOL 3F2KA 2UYTA 3BF3A 3EE9A 3O1BA 2YI1A 4IOXA 4JD2A 4BR2A 3CF5L 2YCHA 2BTFA 4AF1A 1KQSM 2E2PA 2QXLA 2WC9A 3C7NB 4NLBA 3VGKA 3NVKA 4OO1J 4BRNA 4JEPA 1K8AO 3UKUA 4BECA 1NGJA 3EN9A 2GEMA 3GOIA 3VTHA 3MN6A 3A8YA 4MDBA 5EXWA 5BN8A 1NGFA 2Q1NA 2KHOA 1NGEA 3A5MC 4H0YB 2GWKA 5AQJA 5C10A 1T3VA 1Z6RA 1GLJO 4ISFA 3TPQA 3GL1A 4CZLA 1HJOA 3VEVA 5HL7L 3AGKA 3WEEB 5GADP 4XEIA 1S22A 3O80A 3VERA 3DXKB 4H0TB 4YOTA 1VQ6N 5EX5A 5BRHA 3VENA 2YHXA 4I6MA 3T69A 4K41A 5AQMA 1KXPA 1S72N 4PHTX 1BUPA 2P9NB 3CCVN 1NBWA 2YHWA 3FZMA 3UKRB 1N8RO 4WFAL 4BGAA 3MN7A 1GLFO 2IIRA 3MX5A 4M7YA 5GINA 3CC4N 3VGMA 5AZIB 3SAHA 3R1XA 2JWKA 3DWLA 2FXUA 3QBWA 5C12A 2V52B 1YHQN 1VQ4N 2ZJQL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQM A;  3BF1 A;  4MO4 A;  4C23 A;  5AQI A;  3OHR A;  2V7Y A;  5E84 A;  5EY4 A;  1QQO A;  3U9Z A;  3UE5 A;  1TUU A;  3VF6 A;  2FLO A;  4FSV A;  5TKY A;  4H0P A;  3D2F B;  3U4L A;  3C7N A;  4FL9 A;  3LDN A;  2P9U B;  3I8B A;  3SMP A;  2E1Z A;  3FFK B;  3IUC A;  3FGU A;  5LJW A;  3H3N O;  2CH5 A;  3HZ6 A;  3GE1 A;  3AAR A;  2P9K A;  2Q0U A;  2A41 A;  1BO5 O;  5KPZ A;  2ZGY A;  2PAV A;  3WEE A;  1HPM A;  1IG8 A;  2BUP A;  5JLF A;  3DXK A;  1TUY A;  5AZJ A;  3FZL A;  3FZK A;  4MLE A;  4FOI A;  3FZH A;  3WXJ A;  4WQ4 C;  4DHY A;  4B1U B;  4B1X B;  4F9O A;  2GTD A;  3FR0 A;  3QFU A;  2P9N A;  4K25 A;  1ZC6 A;  5AR0 A;  3VOV A;  5JLH A;  3EO3 A;  4PL7 A;  3UKR A;  3MMV A;  3O8M A;  4IXC A;  1NM1 A;  1DGK N;  4ISE A;  5AZI A;  1C0G A;  4BG9 A;  4CZM A;  4A62 A;  4H03 B;  1NGA A;  3WQT A;  3A5O C;  3GDQ A;  4RWT A;  3O5B A;  4CI6 A;  2Q2R A;  3D2F A;  3ZX2 A;  2D0P A;  2FSK A;  3HM8 A;  2CGJ A;  2YHY A;  4BRF A;  4GNI A;  1BWF O;  5BPM A;  3LDP A;  5BRF A;  3HTV A;  1BA1 A;  1DKG D;  1ZXO A;  5AQL A;  3ZX3 A;  2A5X A;  4IO8 A;  1H1V A;  1K8K B;  3LDQ A;  4BRE A;  1BG3 A;  3U9D A;  1JCF A;  1QQN A;  4MLH A;  1Y64 A;  3O1W A;  3MDQ A;  3H45 C;  3DJC A;  3CER A;  3HI0 A;  1MWK A;  3ULE B;  2Q0R A;  1P8Z A;  5FPE A;  4MO5 A;  2FSJ A;  3M6G A;  3CET A;  1MDU B;  3VET A;  4BRI A;  3G25 A;  3WT0 A;  5KPR A;  2VCP A;  2ZF5 O;  4B1W B;  1NMD A;  5AQP A;  4FWP A;  2QWP A;  4BRL A;  2HOE A;  4BR7 A;  1GLA G;  4DCH A;  1GLE G;  4BR5 A;  4B9Q A;  1HLU A;  2HF4 A;  3I33 A;  4YDU C;  2I7N A;  3D2E A;  1CZA N;  3VF4 A;  3R9P A;  5AQQ A;  2ASO A;  2E2O A;  4AM7 A;  4BRP A;  2NRH A;  3BUZ B;  2D1K A;  1ESV A;  1GLB G;  3IMX A;  4WQ4 A;  4LC9 B;  1R59 O;  2P9P B;  4BC3 A;  4FWK A;  4BR0 A;  4BG8 A;  4GY2 B;  4JAX A;  4EHT A;  1V4T A;  3FZF A;  5AQR A;  2FSN A;  4L3Q A;  3EL2 A;  4IJN A;  2CH6 A;  1RFQ A;  3WXK A;  3S41 A;  4BRH A;  2QM1 A;  5AQK A;  1NWK A;  4FWN A;  2QW9 A;  3M3Z A;  4WYB A;  4BRC A;  1T6C A;  4CBU A;  4RTF D;  4M63 C;  3DXM B;  1SAZ A;  3KHY A;  3WQU A;  1SZ2 A;  3HSC A;  3L6Q A;  2E88 A;  5AQN A;  1NGI A;  3R8E A;  4H5V A;  4XH5 A;  2V51 B;  2I7P A;  3H46 O;  4HTL A;  3EZW A;  2QWM A;  3AAP A;  4BRK A;  3BEX A;  4H0O A;  1BDG A;  2ZGZ A;  4BR4 A;  4M7X A;  4CBX A;  4CZK A;  1BOT O;  5ADX A;  5AQV A;  1GLD G;  4CZJ A;  3QB0 A;  2A42 A;  4KBO A;  5JMV A;  4CZF A;  4FWM A;  3L0Q A;  1OKJ A;  4BQZ A;  2PBD A;  2P9P A;  2E2N A;  3SJH A;  2HF3 A;  2NLX A;  5JIC A;  2OAN A;  3A0I X;  3CHW A;  5KQ8 A;  2W40 A;  2YJE A;  3VPZ A;  4E1J A;  3R6M A;  4FWO A;  2VYP A;  5KQD A;  3U8X A;  4PKI A;  4YDU A;  3CIP A;  4JHD B;  3DAW A;  1QHA A;  3M1F A;  4CZE A;  5AQX A;  2CGK A;  4A2B A;  3WXI A;  3DXM A;  1U6Z A;  3FE1 A;  4H5N A;  3MK6 A;  2P9L B;  3KVG A;  2GWJ A;  2H3G X;  2E20 A;  2W41 A;  2P9U A;  1D4X A;  2CGL A;  3JXU A;  3MN5 A;  4B1V A;  4CD3 A;  2A3Z A;  3AAQ A;  1XQS C;  1IJJ A;  4BGB A;  3IDH A;  1WOQ A;  1KAZ A;  4BRD A;  3O4W A;  3MN9 A;  4RCH A;  1HKB A;  1NGD A;  3IFR A;  3SLC A;  2F9T A;  5AQY A;  4NB4 A;  5BPN A;  1Q18 A;  2WUS A;  3RSE B;  3LDO A;  3A5N C;  3W3D A;  4QS9 A;  4BR9 A;  3MCP A;  3ZEU B;  1KAY A;  1Z05 A;  3CJC A;  4EFH A;  5AQH A;  3CJB A;  3BP8 A;  1RDW X;  2A6A A;  4FWQ A;  5EOY A;  3EKU A;  1X9J A;  2FF6 A;  5AQU A;  3UB5 A;  2IVN A;  4A61 A;  5AQG A;  3LM9 A;  1TYQ B;  2AA4 A;  2NZT A;  4NO7 A;  4Y0W A;  4JHD A;  1JCG A;  5AQZ A;  5ADX H;  3C0B A;  3CJ9 A;  1BU6 O;  5AQW A;  2GUP A;  5I9E B;  1DEJ A;  1X3M A;  4B1Y B;  2P9L A;  3ZET B;  1HUX A;  1NLV A;  3LDL A;  1LOT B;  3QIC A;  1HKC A;  3W0L A;  1ZBS A;  4CZH A;  2ZWH A;  4WQ5 C;  3CI5 A;  4K43 A;  3LL3 A;  4DB3 A;  1K8K A;  1S3X A;  3ID8 A;  4CBW A;  3O08 A;  2V7Z A;  1GLC G;  2DPN A;  5CE3 A;  4XH4 A;  2P9K B;  1HX1 A;  1T6D A;  3H1V X;  3RSE A;  1RGI A;  3ZEU A;  3ULE A;  5AQS A;  2D0O A;  3D7E O;  1JCE A;  3ATV A;  5BN9 A;  3VF2 A;  2YJF A;  5AZJ B;  3QFP A;  4HWI A;  5FPD A;  3O6W A;  2P9S B;  2ASM A;  3CJ1 A;  4FWL A;  4JNE A;  4CZG A;  4J8F A;  3KZB A;  4BC4 A;  1TYQ A;  2E2Q A;  4BRA A;  1G99 A;  5BR9 A;  3P4I A;  3ZX0 A;  1V4S A;  1NGG A;  2P9I B;  4FPB A;  4XH1 A;  1YAG A;  4BRO A;  4B1Z A;  4O5F A;  1T44 A;  1ATR A;  3QBX A;  5LY3 A;  3ZET A;  2A40 A;  5AFU A;  5E26 A;  2QWQ A;  1XC3 A;  3H6E A;  3QDK A;  4BRM A;  2E8A A;  2GEL A;  5LJV A;  5AQT A;  1BA0 A;  1YVN A;  1ATN A;  5F2R A;  3CJA A;  3L4I A;  3GG4 A;  1YUW A;  2IVO A;  3VEZ A;  2QWL A;  1NGH A;  4H0V B;  3WXL A;  1MA9 B;  1U2V B;  3H3O B;  4IJA A;  3QML A;  3ATU A;  4ISG A;  3HBT A;  3TU5 A;  2QWR A;  4EHU A;  4FWS A;  5AQF A;  1QZ5 A;  3SK3 A;  4FOE A;  2FF3 B;  4PKG A;  3VEW A;  3H1Q A;  2Q97 A;  1XUP O;  1WUA A;  4QS7 A;  2HMP A;  3SMS A;  2P9S A;  3GBT A;  5EVZ A;  4CJ7 A;  2ITM A;  1QZ6 A;  5BRD A;  2Q36 A;  2QWO A;  4O8K A;  4QS8 A;  3WUH A;  2E1Y A;  2QWN A;  4PL8 A;  1C0F A;  2P9I A;  4WQ5 A;  4BC5 A;  3A5L C;  4JD2 B;  4DQ8 A;  2F9W A;  3VEO A;  2J4R A;  3B8A X;  3CQX A;  3JS6 A;  4BQL A;  4EIA A;  4H5R A;  1GLL O;  1HKG A;  4K42 A;  3VES A;  4BC2 A;  4AM6 A;  3UKU B;  3J8A A;  4CD1 A;  1SQK A;  4CZI A;  3EKS A;  2IVP A;  5BRE A;  1E4F T;  3D2E B;  3VGL A;  4BVP A;  2EWS A;  4Z94 A;  1YXQ A;  3LM2 A;  1EQY A;  4FWR A;  3CQY A;  1MWM A;  1NGC A;  4EAH D;  1U2V A;  5F1X A;  4FPA A;  5ELZ A;  2D4W A;  5BPL A;  2Q31 A;  4H5T A;  4IZ9 A;  4JN4 A;  5FPM A;  5FPN A;  1LCU A;  4BRQ A;  3CJ7 A;  4I6M B;  5B8H A;  2ASP A;  4IWV A;  1KAX A;  1NGB A;  1X3N A;  1J6Z A;  4H5W A;  3VEY A;  5AFU H;  3ENH A;  3F9M A;  2AP1 A;  1E4G T;  5AQO A;  4BVO A;  3ENO A;  3AY9 A;  4BRG A;  3FLC O;  4FO0 A;  1ATS A;  2VWB A;  3VEX A;  4H0X B;  4A2A A;  5F0X A;  5KPT A;  4PKH A;  2UYT A;  3BF3 A;  3O1B A;  4JD2 A;  2YI1 A;  4BR2 A;  2YCH A;  2BTF A;  2E2P A;  2QXL A;  3VGK A;  3C7N B;  4BRN A;  3UKU A;  1NGJ A;  3EN9 A;  2GEM A;  3GOI A;  5BN8 A;  3MN6 A;  3A8Y A;  5EXW A;  1NGF A;  2Q1N A;  2KHO A;  1NGE A;  3A5M C;  4H0Y B;  2GWK A;  5AQJ A;  3TPQ A;  1Z6R A;  1GLJ O;  4ISF A;  3GL1 A;  4CZL A;  1HJO A;  3VEV A;  3WEE B;  4XEI A;  1S22 A;  3O80 A;  3VER A;  3DXK B;  4H0T B;  5EX5 A;  5BRH A;  3VEN A;  2YHX A;  4I6M A;  4K41 A;  5AQM A;  1KXP A;  1BUP A;  2P9N B;  1NBW A;  2YHW A;  3FZM A;  3UKR B;  4BGA A;  3MN7 A;  1GLF O;  2IIR A;  4M7Y A;  3VGM A;  5AZI B;  3DWL A;  2FXU A;  3QBW A;  2V52 B; 
#chains in the Genus database with same CATH topology
 1XMQ K;  4C23 A;  5AQI A;  3OHR A;  2HVH A;  4E72 A;  3AVK A;  1TUU A;  4CJW A;  2FLO A;  4CVN E;  4C8O A;  1VSK A;  4M3T A;  3ZT1 A;  4W5N A;  3C7N A;  4FL9 A;  4Z4H A;  2P9U B;  3AVL A;  1KVA A;  3P5J A;  3IUC A;  1NKE A;  3QLH A;  3CFP A;  4DQS A;  1Q81 O;  2JLE A;  3LPU A;  4C1N I;  4CEF A;  2KW4 A;  4CEA A;  4LFA K;  3IG1 A;  4R5P A;  1IG8 A;  5AZJ A;  1B92 A;  3FZK A;  4DR7 K;  2OPR A;  3WXJ A;  2ZE2 A;  1C6V A;  3ZSV A;  4CFC A;  4F9O A;  2KFN A;  2B4J A;  4Q0B A;  4JKH A;  4PL7 A;  3QEV A;  4CEO A;  4CGI A;  2A1S A;  4E0D A;  2JWL A;  4CZM A;  3K5O A;  4A62 A;  2C1I A;  4OGC A;  3AVI A;  1VSF A;  2UXB K;  3PX6 A;  3S3M A;  3D2F A;  1VAZ A;  4EP4 A;  5LMN K;  4FLU A;  3ZX2 A;  3CME N;  4LF9 K;  4O0J A;  2FSK A;  4BEB A;  1BWF O;  5BPM A;  4DV1 K;  5BRF A;  3KIO A;  4FW2 A;  3HTV A;  1BA1 A;  1DKG D;  3BY5 A;  2YKN A;  3HOS A;  1ZXO A;  5AQL A;  3ZX3 A;  2A5X A;  4IO8 A;  3J7Y P;  4BRE A;  4CGF A;  1XHZ A;  1QHT A;  2Q3S A;  5J2P A;  1IV0 A;  2Q0R A;  5FPE A;  4MO5 A;  5HRS A;  4CEC A;  3VMF B;  2Y1I A;  3T19 A;  1HMV A;  4KHN A;  1VQ8 N;  1U47 A;  3E9P A;  1IKY A;  2KQ2 A;  4KO0 A;  1VQO N;  4DV4 K;  1IKX A;  2BE2 A;  1GLE G;  4DCH A;  2GUI A;  4B9Q A;  1CZA N;  3O4Q A;  4A5B A;  3T1A A;  1IO2 A;  4DWI A;  1C0T A;  1RBT A;  4H4O A;  1FKP A;  1DT9 A;  3BUZ B;  3G6E N;  4OKJ A;  4EZ6 A;  2YKM A;  1NK8 A;  4I2Q A;  3IMX A;  1TL1 A;  4FK4 A;  3I56 N;  4WQ4 A;  1WLJ A;  1Q9Y A;  1OVY A;  1M90 O;  4FWK A;  4HHT A;  4BG8 A;  3RMD A;  4LFB K;  4JAX A;  4JKD A;  3VQD A;  4CJL A;  1T05 A;  3G0Z A;  3K5N A;  3PX0 A;  2CH6 A;  3Q7C A;  3WXK A;  3S41 A;  2QM1 A;  5AQK A;  4CFB A;  1YI2 N;  1LWC A;  1NK4 A;  1F21 A;  3DXM B;  5C42 A;  4JI8 K;  2O8F B;  2IDO A;  3HSC A;  1NGI A;  1BQN A;  3OYI A;  2PFU A;  4XH5 A;  3K0S A;  2I7P A;  4FLW A;  4X64 K;  3H46 O;  1SKW A;  3OYH A;  3V9W A;  4OLB A;  4JLH A;  3SNN A;  2QWM A;  4BRK A;  1NG9 A;  3QEW A;  3TSP A;  1BDG A;  2ZGZ A;  4M7X A;  1YJW N;  5A2Q O;  4FW1 A;  3QNN A;  1BIU A;  3QNO A;  1QTM A;  4CJV A;  3AV9 A;  3K59 A;  4DSF A;  4CZF A;  1C1C A;  3L0Q A;  1OKJ A;  2YHB A;  1EP4 A;  3HST B;  3SJH A;  4LH5 A;  5JIC A;  5KQ8 A;  2W40 A;  1WBD A;  4BDP A;  2HST A;  2QA4 N;  1FXX A;  3CCR N;  3DAW A;  4RW8 A;  5J1E A;  3LDS A;  5M1P A;  2CGK A;  4FLT A;  4YOY A;  2W41 A;  2P9U A;  4PA1 A;  2HNZ A;  3KLI A;  4CD3 A;  5HOO A;  1CZ9 A;  2DTU A;  1KAZ A;  4DF4 A;  4NYF A;  4CHZ A;  4HVJ A;  3SLC A;  1ZYQ A;  3KD5 E;  4NB4 A;  1GOC A;  3SBT A;  1TAU A;  1VSJ A;  1Q18 A;  3RSE B;  3LDO A;  4QS9 A;  3TAB A;  3MCP A;  3ZEU B;  3PO5 A;  1NKC A;  4N76 A;  1JKH A;  3TWH A;  1XNQ K;  3CJB A;  1S1X A;  5BR8 K;  4KH4 A;  1TKX A;  3JSM A;  2G8H A;  5AQG A;  2AA4 A;  2NZT A;  1BHL A;  4DV0 K;  2HBJ A;  5AQZ A;  3J81 O;  4FJG A;  5ADX H;  1P90 A;  2GUP A;  5JS2 A;  5I9E B;  1X3M A;  1RT5 A;  2OTJ N;  4DR3 K;  4B1Y B;  4IOC L;  3ENB A;  4CF1 A;  1W2B M;  3SUP A;  3QIC A;  1HKC A;  2C1G A;  1BI4 A;  3MEG A;  2YX6 A;  3HT3 A;  1ZBI A;  1TK0 A;  1JLQ A;  2NRR A;  2DFH A;  4OKK A;  4XH4 A;  2UUA K;  5AQS A;  2VWK A;  3D7E O;  5BN9 A;  3VF2 A;  3BDP A;  1TGO A;  3OS1 A;  3E9O A;  5FLX O;  4JNE A;  4JRP A;  3CJ1 A;  4FJL A;  4B9U A;  4BC4 A;  1TYQ A;  4B3T K;  5BR9 A;  3P4I A;  1HQE A;  1QE1 A;  4G1Q A;  4NCG A;  4Z0U A;  1ASU A;  4JI6 K;  2E5L K;  4O5F A;  2F8T A;  1ATR A;  4CIE A;  1KVB A;  1WNS A;  4DU4 A;  2IS3 A;  4FK0 A;  4FM2 A;  3M8Q A;  4FZZ A;  3DLL L;  3O9T A;  5AQT A;  3BZK A;  1JLC A;  2EHG A;  2X78 A;  3CJA A;  3L4I A;  5DM6 L;  2IVO A;  3CPE A;  1RBS A;  3QML A;  3ATU A;  4ISG A;  4A57 A;  4E7J A;  4B3O A;  4I7F A;  4EHU A;  3RMA A;  3CM6 A;  3S3N A;  3QIO A;  1IKV A;  3NGZ A;  3VEW A;  3M8R A;  4QS7 A;  5TKW A;  4Z4F A;  3SMS A;  5EVZ A;  1SKS A;  2ITM A;  4EZ9 A;  4KRE A;  2QWO A;  3WUH A;  1OH7 A;  4DSL A;  3AGR A;  2OZM A;  5M1F A;  4WQ5 A;  3VQ8 A;  3VEO A;  2ZD1 A;  2J4R A;  4CF0 A;  3CC7 N;  5EU7 A;  1WAJ A;  3V4I A;  4K42 A;  1TV6 A;  4BC2 A;  3J8A A;  3EKS A;  3OYA A;  2EWS A;  1YXQ A;  4FWR A;  4DLG A;  3TAQ A;  4ILJ A;  1U2V A;  4EP5 A;  2VGM A;  2Q31 A;  4DFJ A;  4IZ9 A;  2HBM A;  4JN4 A;  5FPM A;  5FPN A;  2VG6 A;  3CJ7 A;  3P38 A;  5C2F A;  3AVA A;  1W0H A;  3NGY A;  1J6Z A;  4DQR A;  3VEY A;  2P5G A;  3F9M A;  5LMU K;  3HL8 A;  1NU0 A;  5HRR A;  5J2M A;  1QVG M;  4BDZ A;  5FRM A;  4BWM A;  1ATS A;  4CJR A;  2RE2 A;  3NFA A;  3MWT A;  4PKH A;  4CGH A;  4GVM A;  3F2K A;  3OYF A;  4JI4 K;  2UYT A;  3O1B A;  4JD2 A;  2YI1 A;  1U4B A;  3CF5 L;  5KTQ A;  4E7H A;  1FK9 A;  4LSL A;  2E2P A;  3C7N B;  4OO1 J;  3TAE A;  4JEP A;  4BEC A;  4AHV A;  2R7Y A;  1LW2 A;  5BN8 A;  2YV0 X;  4CJS A;  2BGG A;  3DLE A;  1T7P A;  2WOM A;  1NJX A;  3A5M C;  3KLE A;  5AQJ A;  5IWA K;  1Z6R A;  3VEV A;  3O4N A;  5GAD P;  4XJX A;  3WNE A;  5EX5 A;  4OPJ A;  1VSD A;  3T69 A;  3RMC A;  4K41 A;  5CY4 A;  4JI7 K;  1X1P A;  3LP2 A;  4CJU A;  1NBW A;  4DS5 A;  2HHV A;  3FZM A;  4WFA L;  4KAZ A;  3MN7 A;  1GLF O;  3NF8 A;  3C6T A;  3NH2 A;  4FLY A;  1VQ4 N;  3BF1 A;  2DFE A;  3OYB A;  1N32 K;  3U9Z A;  4W5T A;  1SL0 A;  4DSE A;  3D2F B;  1N34 K;  5JVH L;  1EWQ A;  2E1Z A;  5K14 A;  3FGU A;  2IGI A;  3SCX A;  3HYF A;  2CH5 A;  3HZ6 A;  3C94 A;  1RTI A;  1EWR A;  1RT4 A;  4DTO A;  2PAV A;  4B9L A;  4GW6 A;  3C6H A;  1S5J A;  1TUY A;  3OVN A;  3E66 A;  4MLE A;  2D5R A;  4FOI A;  2QI2 A;  3NMU A;  3FZH A;  3IRX A;  2GTD A;  2P9N A;  3EO3 A;  3UKR A;  2G8V A;  1DGK N;  4ISE A;  3ZSX A;  1I3A A;  4Y1C A;  4BG9 A;  1WSE A;  1Z26 A;  2W42 A;  3WQT A;  3A5O C;  4KI4 A;  5M1Q A;  4YOR A;  4N56 A;  3O5B A;  3HO1 A;  3L3V A;  4DR6 K;  3PSI A;  3MCA B;  3ZSO A;  3SPY A;  1XHX A;  2PY5 A;  4DUZ K;  3OYJ A;  4F8R A;  2YHY A;  4GNI A;  3LDP A;  2G8F A;  1WN7 A;  3CYM A;  1OH8 A;  3C65 A;  4ILH A;  3PUF A;  4YOW A;  3KWG A;  3TTD A;  1VHX A;  3MXI A;  3THW A;  1K8K B;  3LDQ A;  2OA8 A;  3U9D A;  1JCF A;  1B9D A;  4M45 A;  3O1W A;  3H45 C;  1R0A A;  3M5R A;  4DR4 K;  1MWK A;  1VSE A;  3OW2 M;  4CJE A;  4CHP A;  3MEE A;  5D3G A;  2B6A A;  1YVU A;  4WF9 L;  3M6G A;  3LPT A;  5KPR A;  2VCP A;  2ZF5 O;  4M41 A;  4B1W B;  4BE2 A;  5AQP A;  2YNI A;  3CCQ N;  4BR7 A;  1GLA G;  3O9U A;  1HLU A;  4YDU C;  2NRW A;  3ZT2 A;  3AVB A;  3R9P A;  5AQQ A;  4DTJ A;  4YOU A;  1L3U A;  3TAF A;  2E2O A;  4CHQ A;  4KB1 A;  2VG5 A;  1KFS A;  1ESV A;  1GLB G;  1K73 O;  3PV8 A;  4BC3 A;  3K5M A;  3HJF A;  3VQB A;  2DFF A;  4DR5 K;  4GY2 B;  1HNV A;  3FZF A;  4L8R B;  1CLQ A;  2Z1J A;  1RNH A;  1WB9 A;  3EL2 A;  1JLG A;  1GOA A;  2OPP A;  4BRH A;  1NWK A;  4BRC A;  2E4L A;  4CBU A;  1I94 K;  1KVC A;  1SAZ A;  3KHY A;  4KFB A;  3RR7 A;  5CR4 A;  4JKF A;  2B5J A;  3SPZ A;  4CEB A;  4QOZ B;  4FYD A;  1Z25 A;  3BEX A;  1BL3 A;  2XY6 A;  4LSN A;  1YIT N;  3AA2 A;  4BE0 A;  3HPO A;  3DMJ A;  2QTD A;  3U3G A;  3L4Q A;  4C8K A;  4CZJ A;  5JMV A;  2NRX A;  4FWM A;  2P9P A;  1WSF A;  3HPH A;  4WCE L;  1JXB A;  4G9Z A;  3O3F A;  3A0I X;  3CHW A;  4DSJ A;  1Q82 O;  2VYP A;  3CPW M;  4PKI A;  4CZE A;  2UUC K;  4E3S A;  1VRT A;  3LP0 A;  4A2B A;  2E6M A;  1HNI A;  3MK6 A;  1RCH A;  2E20 A;  2CGL A;  4Q5V A;  3G10 A;  3AAQ A;  2KKZ A;  1IJJ A;  3IDH A;  5CYQ A;  4FJJ A;  1S6Q A;  3KK3 A;  1UWB A;  3DYA A;  3D6R A;  4RCH A;  3V1R A;  1BI4 B;  1HKB A;  3K57 A;  1NOY A;  2W00 A;  3RVC A;  3KD1 E;  1WAF A;  1RT2 A;  4CED A;  3EY1 A;  4XIU A;  2F9T A;  4CHN A;  4O0I A;  4KHU A;  4C8M A;  5DMR A;  3NF7 A;  4B3M K;  3A5N C;  1QVF M;  3B6O A;  1YIJ N;  4LF4 K;  4EFH A;  5AQH A;  5HRO A;  3TR8 A;  3P83 D;  1RDW X;  5EOY A;  4GV9 A;  1X9J A;  2FF6 A;  5HBM A;  5CZ2 A;  3OYM A;  4CER A;  1TYQ B;  3AVN A;  2ATQ A;  3DRS A;  1KC8 O;  4Y0W A;  1ITG A;  1JCG A;  3C0B A;  4KRF A;  4AHT A;  1TVR A;  1YF5 L;  4ILG B;  1NLV A;  2O8E A;  3IS9 A;  3W0L A;  4IFE A;  4JRQ A;  4IKF A;  1ZBS A;  3VA0 A;  3TAG A;  3M8P A;  4YOX A;  5T7B A;  1K8K A;  3PX4 A;  1QSS A;  4CBW A;  4DFM A;  2JGU A;  3O08 A;  2V7Z A;  1GLC G;  4BY9 C;  1HX1 A;  1T6D A;  4DU1 A;  5C24 A;  2YNG A;  2RPI A;  4B8C A;  3L2Q A;  5CYM A;  2HMI A;  3VQ4 A;  4AH9 A;  3ATV A;  3I0R A;  3CM5 A;  3OBY A;  4KH6 A;  2ASM A;  1SUQ A;  3KZB A;  1VSI A;  4FLX A;  4FJ7 A;  3KLF A;  2I5J A;  1IG9 A;  4DQQ A;  3NVM A;  1YAG A;  4BRO A;  3LAK A;  1RT6 A;  1VSM A;  5LY3 A;  4X66 K;  3ZET A;  3L2W A;  2A40 A;  5AFU A;  2NRZ A;  1L3T A;  3QDK A;  4BRM A;  2E8A A;  5LJV A;  1N6Q A;  4CF9 A;  1ATN A;  5F2R A;  3GG4 A;  3QEI A;  2QWL A;  4H0V B;  1U2V B;  5HRP A;  4X65 K;  4RW9 A;  4I2P A;  4IJA A;  3HBT A;  3TU5 A;  4CF8 A;  3TTF A;  2XO7 A;  3P39 A;  2UU9 K;  5GAH P;  4FWS A;  2FBY A;  1NK9 A;  4HUF A;  5AQF A;  3KWI A;  4M42 A;  3SK3 A;  2KZM A;  4PKG A;  2ZQB A;  4O8U A;  4DKW A;  1XUP O;  3OBW A;  1G15 A;  4NYN A;  4AIL C;  1WUA A;  2HMP A;  1J53 A;  2P9S A;  4DSK A;  2HND A;  2OPS A;  3BZC A;  4O8K A;  4QS8 A;  2QWN A;  4KH5 A;  4CF2 A;  2P9I A;  4BC5 A;  4JD2 B;  4FJM A;  4DQ8 A;  2F9W A;  3QIN A;  5SZT A;  1DTQ A;  2O8D B;  3C95 A;  1T03 A;  4CD1 A;  3ZSR A;  4KB0 A;  2IVP A;  2NNW A;  5BRE A;  4BE1 A;  4BVP A;  3L8B A;  4QCL A;  3LM2 A;  4O5B A;  3CQY A;  4Z4I A;  3O9Q A;  3T3F A;  4K8Z A;  5BPL A;  5M1N A;  1ZBF A;  3SUN A;  5GAG P;  5B8H A;  4IWV A;  3V9Z A;  3SUO A;  1C0U A;  3THY A;  1VQN N;  3LZJ A;  4DG1 A;  2OCE A;  3ENH A;  3CCJ N;  2AP1 A;  4N47 A;  4UY8 O;  2ZJP L;  1OH6 A;  5AQO A;  3AY9 A;  3JYT A;  5GIO A;  3VEX A;  4DTU A;  5KPT A;  4A2A A;  4ID1 A;  2FBV A;  3P31 A;  3PIO L;  2UUB K;  3ZLJ A;  4JV5 K;  3BGR A;  4V19 S;  3DRR A;  3LWL A;  3VQC A;  2QKK A;  4AF1 A;  4B8A B;  4F3T A;  2QXL A;  4NLB A;  4NCA A;  1JLB A;  3UKU A;  3ULD A;  1CXU A;  2FBT A;  3VTH A;  3MN6 A;  1NGF A;  1J5E K;  1NGE A;  1KSP A;  1GLJ O;  4DV3 K;  3GL1 A;  5KGW A;  1S22 A;  3AO2 A;  1JLF A;  3VER A;  4YOT A;  4RW4 A;  3NH0 A;  4CW7 B;  5BRH A;  4W5R A;  4GMJ B;  5AQM A;  1KXP A;  1S72 N;  4PHT X;  2X6S A;  1BUP A;  4ELV A;  2P9N B;  2Z1I A;  3UKR B;  1N8R O;  3VGM A;  4YY3 K;  3DWL A;  3QBW A;  4XH1 A;  2V52 B;  4MQ3 A;  4DFK A;  1QQO A;  1RDA A;  3UE5 A;  4GV6 A;  3VF6 A;  3LP1 A;  4H0P A;  3E1Y A;  1RBR A;  3U4L A;  3LDN A;  2XY8 A;  3I8B A;  4WFB L;  3FFK B;  3SUQ A;  5LJW A;  3K2P A;  2Y1J A;  2W6K A;  3GE1 A;  3AAR A;  3NDK A;  2G8I A;  2HHU A;  1X9S A;  4AHS A;  4NLC A;  3THW B;  2FBX A;  4NXM K;  3AO1 A;  3F9K A;  3WEE A;  1DTT A;  1BIZ A;  3CFR A;  5JLF A;  3DXK A;  2OPQ A;  4CGJ A;  1OH5 A;  5JS1 A;  3ZSZ A;  3FZL A;  4F4K A;  3PIP L;  1HNX K;  4B1X B;  3QFU A;  3HOT A;  1ZC6 A;  1TKT A;  1RT7 A;  3ISN C;  3O8M A;  2KZZ A;  1NM1 A;  1IBM K;  3CYG A;  5AZI A;  3AVG A;  3K9K A;  1C0G A;  1W7A A;  4JK7 A;  5I42 A;  5JEN A;  4MFB A;  4DTN A;  3KLG A;  5IT9 O;  3GDQ A;  2Q2R A;  2XY5 A;  3T7Z A;  4WE1 A;  3U6F A;  4K8X A;  2D0P A;  3DLK A;  3ZSY A;  1HQU A;  3HM8 A;  2CGJ A;  4IO9 L;  1W9H A;  4BRF A;  2PYJ A;  4CJF A;  2D0A A;  4LF8 K;  4BE7 B;  4Z4E A;  1HJR A;  3AVC A;  1UAX A;  3KK1 A;  3CD6 N;  1H1V A;  1SV5 A;  1BG3 A;  1N5Y A;  3CCS N;  1EX4 A;  1ZBL A;  1EKE A;  3E01 A;  2YNH A;  5C15 A;  4CK1 A;  3ZYY X;  3HI0 A;  2G8K A;  4C8N A;  3ULE B;  1HYZ A;  3VA3 A;  3KK7 A;  4PQU A;  4K0K K;  1K6Y A;  3CET A;  1MDU B;  3VQE A;  3G25 A;  3K9J A;  2O8D A;  2O4G A;  5KI6 A;  4OKE A;  2UXC K;  4OPH A;  1TL3 A;  2HOE A;  4ZHR A;  3AO3 A;  3I33 A;  2I7N A;  4KTW A;  2ZM6 K;  1OVQ A;  1HYV A;  3WNF A;  4AM7 A;  4LF5 K;  4IG0 A;  2NRH A;  1RBU A;  3CFO A;  2D1K A;  1A5X A;  3LWM A;  3SV3 A;  4KKO A;  3OYC A;  2VG7 A;  4KV8 A;  3O9R A;  4LC9 B;  4JKA A;  4DTX A;  3VTI A;  3O3H A;  1R59 O;  2P9P B;  1RDD A;  5AQR A;  3THV A;  2F8S A;  4FCY A;  2O8B A;  1O13 A;  3CCE N;  2FSN A;  4L3Q A;  3SQ1 A;  4IJN A;  1GOB A;  1RFQ A;  1CZB A;  3MX2 A;  3AO5 A;  1T8E A;  4FWN A;  2QW9 A;  4GV3 A;  4WYB A;  3ZSQ A;  4M63 C;  3WQU A;  1SZ2 A;  4JKE A;  1BCO A;  2E88 A;  1DLO A;  2HBK A;  2HB5 A;  5AQN A;  3NAE A;  4KTZ A;  2V51 B;  4JK9 A;  5DM7 L;  3EZW A;  4H0O A;  3QES A;  3VN5 A;  1UA0 A;  3I55 N;  4CZK A;  1EET A;  1BOT O;  4GKK K;  1FJG K;  4CFA A;  5ADX A;  4DQI A;  3EEQ A;  3NHG A;  1HR0 K;  2O4I A;  1GLD G;  3QB0 A;  2A42 A;  3O9S A;  3ZSW A;  4BQZ A;  2PBD A;  2E2N A;  3RWU A;  4JKG A;  2HF3 A;  2NLX A;  2KTQ A;  2VQF K;  2OAN A;  4H8K A;  2W6L A;  3RMB A;  4IOA L;  2YJE A;  3VPZ A;  3ZT0 A;  4CHO A;  1XMO K;  4FWO A;  4O55 A;  5KQD A;  3SQ0 A;  3U8X A;  4ID5 A;  4YDU A;  4CGD A;  1QHA A;  3M1F A;  3IAY A;  1KCF A;  3G71 N;  4H5N A;  4J2D A;  3OA9 A;  2XRI A;  2GWJ A;  2P5O A;  2A3Z A;  2O8E B;  1XQS C;  3WXM B;  4BRD A;  3PY8 A;  3QEX A;  1JLE A;  1RDU A;  3G4S N;  1NGD A;  4BAC A;  5HRN A;  3IFR A;  4Z4C A;  2P1J A;  4F3O A;  4YHH K;  5CZ1 A;  2HHT A;  5AQY A;  3CCL N;  4R79 A;  2O8C A;  3HP6 A;  3LP3 A;  5BPN A;  2IOC A;  3W3D A;  3OS0 A;  4ELU A;  4E19 A;  1Z05 A;  4CGG A;  3DLH A;  3CG7 A;  4O4G A;  2IAJ A;  3BP8 A;  2A6A A;  3MAQ A;  2YNF A;  3EKU A;  1D9D A;  3V9U A;  3UB5 A;  4A61 A;  2IVN A;  2GBZ A;  1JLA A;  3LM9 A;  4NO7 A;  4OX9 K;  4CJP A;  4JHD A;  3K58 A;  2GX9 A;  4B9M A;  4CHY A;  5C0Y A;  1DEJ A;  3HRG A;  1S9G A;  2P9L A;  3ZET B;  1VQK N;  2QK9 A;  3LDL A;  2G8U A;  1S1W A;  4J2A A;  3NE6 A;  1LW0 A;  4CZH A;  2ZWH A;  4IDK A;  5KRS A;  3M8S A;  3LL3 A;  4DB3 A;  3K5L A;  1EXQ A;  2DPN A;  3HXM A;  5CE3 A;  3ID6 A;  3KK2 A;  2P9K B;  1J54 A;  3OJU A;  1RGI A;  3ULE A;  2EX3 A;  1JCE A;  1BIS A;  1C1A A;  1VQ9 N;  2YJF A;  5FPD A;  1VSL A;  2P9S B;  2WON A;  3ASM A;  4FJN A;  4J8F A;  2ETJ A;  2WTU A;  4BRA A;  1G99 A;  1NJI O;  4A59 A;  1V4S A;  1NGG A;  2P9I B;  4FPB A;  4CJT A;  4LY7 A;  2OTL N;  1T44 A;  4JI2 K;  3HPG A;  4DTS A;  1VSH A;  3EE8 A;  1Q86 O;  5E26 A;  2QWQ A;  3TI0 A;  2KLA A;  3P1G A;  1E3M A;  4IFY A;  2BH1 A;  1BA0 A;  1YVN A;  3VQP A;  4E1N A;  5J2Q A;  3J7A P;  1YUW A;  1ILY A;  4DV7 K;  4KPY A;  2D0B A;  1C1B A;  3L2R A;  2QWR A;  4N5S A;  1FW6 A;  4AHU A;  3THY B;  1QZ5 A;  1KFD A;  1RDB A;  2FF3 B;  3CMA N;  1QQC A;  2Q97 A;  4CJ5 A;  2HHS A;  4CJ7 A;  5GIP A;  1A5V A;  2RKI A;  2BDP A;  1QZ6 A;  4J2E A;  2Q36 A;  4FLV A;  4ZTJ A;  1RIL A;  2E1Y A;  4PL8 A;  4IDH A;  1XI1 A;  2XHB A;  3NGI A;  4DFP A;  3B8A X;  3CQX A;  4EIA A;  3RRG A;  3HK2 A;  4JI5 K;  4PUO A;  3E9L A;  3UKU B;  1SQK A;  3JAM O;  1E4F T;  3PO4 A;  3D2E B;  3UIQ A;  5SWM A;  3F5T A;  4Z94 A;  3THX A;  1ASV A;  3H08 A;  1MWM A;  4FPA A;  1S1T A;  2D4W A;  3J80 O;  1MU2 A;  4DR2 K;  4H5T A;  1LCU A;  4BRQ A;  3OYE A;  4N41 A;  2ASP A;  3DLR A;  4JS5 A;  1KAX A;  4DMN A;  1QS4 A;  1X3N A;  1NK0 A;  3AA3 A;  4NXN K;  4JS4 A;  3N4P A;  3I0S A;  3ZCM A;  1E4G T;  3QIP A;  3MXM A;  4BVO A;  2HHX A;  4CE9 A;  3ENO A;  3CCM N;  4BRG A;  3RR8 A;  4FO0 A;  3FLC O;  4H0X B;  4E89 A;  5F0X A;  1Q7Y O;  3LAL A;  4CEQ A;  4HCC A;  3AA4 A;  1O1W A;  3BF3 A;  1TAQ A;  1S1U A;  4IOX A;  4M3Y A;  4BR2 A;  4M3R A;  1XC9 A;  2YCH A;  2BTF A;  1ZBU A;  4HTU A;  1IH7 A;  2WC9 A;  2Z1H A;  1SKR A;  1I39 A;  1K8A O;  1NGJ A;  3EN9 A;  2GEM A;  3GOI A;  3KJV A;  2KHO A;  3V1O A;  1L5U A;  4CIG A;  2RF2 A;  3TPQ A;  4B08 A;  4CIF A;  4CZL A;  1HJO A;  3WEE B;  4XEI A;  4M3W A;  3DXK B;  4H0T B;  4LD0 A;  3VEN A;  2LSN A;  2HHH K;  4FZY A;  4I6M A;  1RTD A;  4DUY K;  4PY5 A;  4E1M A;  3RTV A;  1NJZ A;  2X74 A;  2OZS A;  1RDC A;  3MX5 A;  2IIR A;  4RW6 A;  5AZI B;  3SAH A;  4JI3 K;  3R1X A;  2JWK A;  1YHQ N;  5C12 A;  2ZJQ L;  3V9X A;  1QQM A;  4MO4 A;  1JL1 A;  2V7Y A;  5E84 A;  5EY4 A;  1NK7 A;  4FSV A;  3T1H K;  5TKY A;  2NRV A;  3KKR A;  2F4V K;  3SMP A;  1UA1 A;  4B3S K;  1KLM A;  3H3N O;  2P9K A;  2Q0U A;  3U3Y A;  2A41 A;  1BO5 O;  4FJ8 A;  4CEE A;  2G8W A;  5KPZ A;  2ZGY A;  1HPM A;  2BUP A;  5AJ3 K;  2VGN A;  1YTU A;  3QO9 A;  4WQ4 C;  4DHY A;  4B1U B;  4K25 A;  3FR0 A;  4NCB A;  5AR0 A;  3VOV A;  5JLH A;  4O44 A;  5CHI A;  4AHR A;  1L3V A;  4KHP K;  3MMV A;  4IXC A;  4JK8 A;  2IC3 A;  4FK2 A;  4KI6 A;  3S9H A;  1D9F A;  3OYN A;  4KTQ A;  1N36 K;  3SZ2 A;  4JI1 K;  4H03 B;  4U67 L;  1NGA A;  4LFC K;  4YNQ A;  4CK2 A;  3A2F A;  4RWT A;  4CI6 A;  3AVM A;  3S5T A;  4KHS A;  3V9S A;  3ZT4 A;  3L2U A;  3ALY A;  1U48 A;  1IBL K;  1VQL N;  1HNW K;  5M1O A;  1NKB A;  3QET A;  1VQM N;  4DU3 A;  2ITG A;  1LWE A;  1W97 L;  3OYD A;  1N33 K;  3VQ7 A;  3L2V A;  1BGX T;  1LAW A;  4IFV A;  4A5A A;  4MDA A;  1RT3 A;  2FC0 A;  1NJW A;  1SL2 A;  3TAP A;  2WBN A;  4JYA K;  1QQN A;  2O8B B;  4MLH A;  1JXE A;  1Y64 A;  3SAF A;  3MDQ A;  3DJC A;  3CER A;  3CXC M;  4DLE A;  3AVJ A;  4FJH A;  1C0M A;  1P8Z A;  4M3U A;  3AO4 A;  2F7T A;  2FSJ A;  3AVF A;  4CJ4 A;  4OPK A;  3VET A;  4BRI A;  3WT0 A;  4E7I A;  3SJJ A;  1B9F A;  4TSX A;  1HYS A;  2HNY A;  4B9N A;  1NMD A;  3VQ9 A;  4W5Q A;  4M3X A;  1KLN A;  1TK8 A;  3SQ4 A;  4FWP A;  2QWP A;  4BRL A;  1D8Y A;  1WSJ A;  3MXJ A;  4BR5 A;  2HF4 A;  2P51 A;  3D2E A;  3CCU N;  3VF4 A;  3VQQ A;  3SQ2 A;  1IBK K;  2VWJ A;  2ASO A;  4WFN L;  4DSI A;  4BRP A;  3TTC A;  2YHA A;  3SAG A;  2NUB A;  1WSH A;  2HBL A;  5JVG L;  4DV6 K;  3SYZ A;  1NK6 A;  4B3R K;  4OGE A;  4BR0 A;  3V81 A;  4B9S A;  4HCB A;  4JKG B;  1V4T A;  4EHT A;  4FXD A;  4FVU A;  3TAR A;  1NJY A;  3IKM A;  1TK5 A;  2PZS A;  2HHI A;  4UQG A;  1JJ2 M;  3MWP A;  3M3Z A;  1BQM A;  3J7Z O;  1T6C A;  3ITH A;  4FJ5 A;  1RTH A;  4RTF D;  3VQA A;  4Y1D A;  1XWL A;  1YT3 A;  1VQP N;  3L6Q A;  3R8E A;  4H5V A;  3DI6 A;  1LWF A;  2QEX N;  4HTL A;  1EO1 A;  3DRP A;  3AAP A;  3DOK A;  4BR4 A;  4CBX A;  1HNZ K;  2GV9 A;  5AQV A;  5HLF A;  1D5A A;  1ZBH A;  2O8C B;  1QSL A;  4KBO A;  3RRH A;  3CC2 N;  3V6D A;  4LF7 K;  5M1K A;  4E7K A;  1HRH A;  3QEP A;  3DM2 A;  3N4Q A;  4E1J A;  2HW3 A;  3R6M A;  4RW7 A;  4JI0 K;  1TKD A;  3CIP A;  4JHD B;  5AQX A;  3LZI A;  1IKW A;  4B9T A;  3EZ5 A;  3OYL A;  1REV A;  3WXI A;  3DXM A;  1U6Z A;  3FE1 A;  1VRU A;  5C25 A;  2O8F A;  5HP1 A;  3OYG A;  2P9L B;  2WFB A;  3KVG A;  2H3G X;  3C6U A;  4RG8 A;  3JXU A;  1D4X A;  3MN5 A;  4BWJ A;  4B1V A;  5KRT A;  3NH1 A;  2HVI A;  4JKC A;  4BGB A;  1WOQ A;  5E41 A;  3O4W A;  3MN9 A;  5LL6 Z;  4ZTF A;  1LAV A;  4CJK A;  3TAM A;  3D0P A;  4FJK A;  4I9Q A;  3TSU A;  1S1V A;  1YJ9 N;  1YTA A;  2WUS A;  4BR9 A;  4DTP A;  1KAY A;  4OVL A;  3CJC A;  5H1S Q;  3VQ6 A;  3MED A;  4FJI A;  3AVH A;  4FWQ A;  4IEI A;  2ZJR L;  4F2R A;  5AQU A;  3WNG A;  5J2N A;  3HM9 A;  1XNR K;  4U7B A;  2X6N A;  4Z4G A;  3FFI A;  1Q8I A;  3LAM A;  3KLH A;  3CJ9 A;  2QKB A;  1BU6 O;  4OJR A;  5AQW A;  4DV2 K;  4X62 K;  4CES A;  3B6P A;  1RT1 A;  1HUX A;  1LOT B;  3I8D A;  3T1Y K;  1WSI A;  3HVR A;  3C6A A;  3R3L A;  1U45 A;  3Q7B A;  1X9M A;  4DQP A;  1CXQ A;  4WQ5 C;  4FJ9 A;  1A5W A;  3CI5 A;  4I9L A;  3DLG A;  4K43 A;  3KTQ A;  4GKJ K;  1S3X A;  4FM0 A;  3ID8 A;  3HVT A;  4AHC A;  2DY4 A;  3ZT3 A;  3MEC A;  5GAE P;  4ELT A;  3H1V X;  1BCM A;  1UOC A;  3RSE A;  4OLA A;  3ZEU A;  1VK0 A;  2D0O A;  4DV5 K;  3PLA A;  1J9A A;  2BAN A;  5AZJ B;  2NRT A;  1L3S A;  3QFP A;  4HWI A;  3SI6 A;  4E7L A;  2UXD K;  3O6W A;  4FWL A;  4CZG A;  1ASW A;  4CJQ A;  1JL2 A;  2E2Q A;  4FM1 A;  4CFD A;  3O3G A;  3ZX0 A;  1KTQ A;  4F2S A;  2PYL A;  4B1Z A;  4DS4 A;  3QBX A;  4OPA A;  3SBG A;  1J5O A;  4DF8 A;  1KD1 O;  1XC3 A;  3H6E A;  4LH4 A;  3LAN A;  4CJ3 A;  2GEL A;  4J2B A;  2Z1G A;  3L3U A;  3THX B;  3VEZ A;  3NF6 A;  1NGH A;  3WXL A;  1MA9 B;  4HUG A;  3H3O B;  4PWD A;  3WNH A;  4M3Z A;  1S6P A;  2QXF A;  5DK5 A;  1KRP A;  3HP9 A;  1YJN N;  3D45 A;  5FRN A;  3S3O A;  1HPZ A;  1SL1 A;  4FJX A;  3NF9 A;  4FOE A;  5FDL A;  4H4M A;  3H1Q A;  4IEE A;  3SV4 A;  3OJS A;  4DTR A;  4GVE A;  4IG3 A;  1VQ7 N;  1K9M O;  3CQ8 A;  3OTO K;  4HUE A;  3GBT A;  3V1Q A;  1SS6 A;  4KHY A;  5BRD A;  4KHW A;  4CK3 A;  5C2D A;  1C0F A;  4JKB A;  3A5L C;  2RHK A;  3OS2 A;  1QSY A;  1VQ5 N;  3JS6 A;  5I3U A;  4BQL A;  4ICL A;  1U49 A;  4H5R A;  4YFU A;  1GLL O;  4C1N K;  1HKG A;  1NMN A;  3VES A;  2VQE K;  1NK5 A;  4FZX C;  4AM6 A;  4LF6 K;  1FKO A;  4CZI A;  3AA5 X;  4YOV A;  2HHQ A;  1RTJ A;  3VGL A;  1U04 A;  1EQY A;  4B9V A;  4CEZ A;  1NGC A;  4EAH D;  5F1X A;  5ELZ A;  4KHQ A;  5MLC Q;  4FVM A;  3OYK A;  1RBV A;  3VQ5 A;  3KKS A;  4I6M B;  2AJQ A;  2RN2 A;  1X9W A;  1LV5 A;  1NGB A;  1M1K O;  4H5W A;  2XY7 A;  5AFU H;  1TKZ A;  2D0C A;  3NBP A;  4AQY K;  2E6L A;  2VWB A;  3EYZ A;  1WBB A;  5FRO A;  3F73 A;  3OY9 A;  4DTM A;  3EE9 A;  4DR1 K;  1KQS M;  4FLZ A;  1WSG A;  4IBN A;  3VGK A;  3NVK A;  4BRN A;  2OYQ A;  1Q9X A;  1NOZ A;  4MDB A;  3A8Y A;  5EXW A;  3DLB A;  1NNE A;  3NCI A;  2Q1N A;  1Y97 A;  4QAG A;  4CCH A;  4H0Y B;  2KFZ A;  2GWK A;  5C10 A;  1T3V A;  4ISF A;  5HL7 L;  5KGX A;  3AGK A;  3DOL A;  1VQ6 N;  3O80 A;  4W5O A;  2HHW A;  4C8L A;  2YHX A;  1S9E A;  2A1R A;  3PSF A;  3CCV N;  2YHW A;  3TAN A;  4BGA A;  2F96 A;  4M7Y A;  5GIN A;  3CC4 N;  2FXU A;  3TSQ A;  4BDY A;  3QER A; 
#chains in the Genus database with same CATH homology
 1QQM A;  3BF1 A;  4MO4 A;  4C23 A;  5AQI A;  3OHR A;  2V7Y A;  5E84 A;  5EY4 A;  1QQO A;  3U9Z A;  3UE5 A;  4GV6 A;  1TUU A;  3VF6 A;  2FLO A;  4FSV A;  5TKY A;  4H0P A;  3D2F B;  3E1Y A;  3U4L A;  5JVH L;  3C7N A;  4FL9 A;  2NRV A;  3LDN A;  2P9U B;  3I8B A;  3SMP A;  2E1Z A;  4WFB L;  3FFK B;  3IUC A;  3FGU A;  5LJW A;  3H3N O;  2CH5 A;  3HZ6 A;  3GE1 A;  3AAR A;  1Q81 O;  2P9K A;  2Q0U A;  4C1N I;  2A41 A;  1BO5 O;  4NLC A;  5KPZ A;  2ZGY A;  2PAV A;  3WEE A;  1HPM A;  1IG8 A;  2BUP A;  5JLF A;  3DXK A;  3C6H A;  1TUY A;  5AZJ A;  2VGN A;  3FZL A;  3FZK A;  3E66 A;  4MLE A;  4FOI A;  2QI2 A;  3NMU A;  3FZH A;  3WXJ A;  4WQ4 C;  4DHY A;  4B1U B;  3PIP L;  4B1X B;  4F9O A;  2GTD A;  3FR0 A;  3QFU A;  2P9N A;  4K25 A;  1ZC6 A;  5AR0 A;  3VOV A;  5JLH A;  3HOT A;  5CHI A;  4JKH A;  3EO3 A;  4PL7 A;  3UKR A;  3MMV A;  3O8M A;  4IXC A;  4JK8 A;  1NM1 A;  1DGK N;  4ISE A;  5AZI A;  3TSQ A;  3K9K A;  1C0G A;  2JWL A;  4BG9 A;  4CZM A;  4A62 A;  2C1I A;  4H03 B;  4JK7 A;  1NGA A;  3WQT A;  4U67 L;  3A5O C;  5M1Q A;  4YOR A;  3GDQ A;  4RWT A;  3O5B A;  4CI6 A;  2Q2R A;  3T7Z A;  3MCA B;  3D2F A;  1VQL N;  1VAZ A;  3CME N;  5M1O A;  2D0P A;  3ZX2 A;  2FSK A;  3HM8 A;  1VQM N;  2CGJ A;  2YHY A;  4IO9 L;  4BRF A;  4GNI A;  4BEB A;  1BWF O;  5BPM A;  3LDP A;  5BRF A;  1W97 L;  3C65 A;  3HTV A;  1BA1 A;  1DKG D;  4ILH A;  4BE7 B;  4YOW A;  3HOS A;  1ZXO A;  3KWG A;  4A5A A;  4MDA A;  3TTD A;  5AQL A;  3ZX3 A;  2A5X A;  4IO8 A;  2WBN A;  3CD6 N;  1H1V A;  1K8K B;  3LDQ A;  4BRE A;  1BG3 A;  3U9D A;  1JCF A;  3CCS N;  1QQN A;  4MLH A;  1Y64 A;  3SAF A;  3O1W A;  5C15 A;  3MDQ A;  3H45 C;  3DJC A;  3CER A;  3ZYY X;  3HI0 A;  3M5R A;  3CXC M;  1MWK A;  3ULE B;  3OW2 M;  2Q0R A;  3KK7 A;  1P8Z A;  5FPE A;  4MO5 A;  2F7T A;  2FSJ A;  3M6G A;  4WF9 L;  3CET A;  3VMF B;  1MDU B;  3VET A;  4BRI A;  3G25 A;  3K9J A;  3WT0 A;  5KPR A;  2VCP A;  1VQ8 N;  2ZF5 O;  4B1W B;  3E9P A;  1NMD A;  1VQO N;  5AQP A;  4FWP A;  4OPH A;  3CCQ N;  2QWP A;  4BRL A;  2HOE A;  4BR7 A;  1GLA G;  3O9U A;  4DCH A;  1GLE G;  4BR5 A;  4B9Q A;  1HLU A;  2HF4 A;  3I33 A;  4YDU C;  2I7N A;  2NRW A;  3D2E A;  3CCU N;  1CZA N;  3VF4 A;  4A5B A;  3R9P A;  5AQQ A;  4YOU A;  2ASO A;  2E2O A;  4AM7 A;  4WFN L;  4BRP A;  2NRH A;  1DT9 A;  3BUZ B;  3TTC A;  3G6E N;  2D1K A;  1ESV A;  1GLB G;  3SAG A;  3IMX A;  3I56 N;  4WQ4 A;  2HBL A;  3O9R A;  4LC9 B;  4JKA A;  1K73 O;  5JVG L;  3VTI A;  1OVY A;  1M90 O;  1R59 O;  2P9P B;  4BC3 A;  4FWK A;  4BR0 A;  4BG8 A;  4GY2 B;  4JAX A;  4JKG B;  1V4T A;  4EHT A;  4JKD A;  3FZF A;  5AQR A;  4FVU A;  1O13 A;  3IKM A;  3CCE N;  2FSN A;  4L3Q A;  3EL2 A;  4IJN A;  2CH6 A;  1RFQ A;  3Q7C A;  3WXK A;  3S41 A;  3MX2 A;  1JJ2 M;  4BRH A;  2QM1 A;  5AQK A;  1YI2 N;  1NWK A;  3MWP A;  2QW9 A;  3M3Z A;  4WYB A;  4FWN A;  4GV3 A;  4BRC A;  3J7Z O;  1T6C A;  4CBU A;  4RTF D;  4M63 C;  3DXM B;  1SAZ A;  3KHY A;  5CR4 A;  3WQU A;  1SZ2 A;  4JKF A;  1VQP N;  4JKE A;  3HSC A;  3L6Q A;  2HBK A;  2E88 A;  5AQN A;  1NGI A;  3R8E A;  4H5V A;  2PFU A;  4XH5 A;  2V51 B;  2I7P A;  4JK9 A;  2QEX N;  3H46 O;  4HTL A;  5DM7 L;  1EO1 A;  3EZW A;  2QWM A;  3AAP A;  4BRK A;  3BEX A;  4H0O A;  3TSP A;  1BDG A;  2ZGZ A;  4BR4 A;  3I55 N;  1YIT N;  4M7X A;  4CBX A;  4CZK A;  1YJW N;  1BOT O;  2QTD A;  5ADX A;  3L4Q A;  5AQV A;  1GLD G;  4CZJ A;  3QB0 A;  2A42 A;  3O9S A;  4KBO A;  4CZF A;  2NRX A;  4FWM A;  5JMV A;  3L0Q A;  3CC2 N;  1OKJ A;  4BQZ A;  4XJX A;  2PBD A;  2P9P A;  4WCE L;  2E2N A;  4JKG A;  5M1K A;  3SJH A;  4G9Z A;  2HF3 A;  2NLX A;  5JIC A;  2OAN A;  3A0I X;  3CHW A;  3N4Q A;  5KQ8 A;  2W40 A;  4IOA L;  2YJE A;  3VPZ A;  4E1J A;  3R6M A;  1Q82 O;  4FWO A;  2VYP A;  2HST A;  5KQD A;  2QA4 N;  3U8X A;  4PKI A;  4YDU A;  3CIP A;  3CPW M;  4JHD B;  3DAW A;  1QHA A;  3M1F A;  4CZE A;  3CCR N;  5AQX A;  5M1P A;  2CGK A;  4A2B A;  3WXI A;  3G71 N;  3DXM A;  1U6Z A;  3FE1 A;  4H5N A;  3MK6 A;  3OA9 A;  2P9L B;  2WFB A;  2GWJ A;  3KVG A;  2H3G X;  4YOY A;  2E20 A;  2W41 A;  2P9U A;  1D4X A;  2CGL A;  3JXU A;  3MN5 A;  4B1V A;  4CD3 A;  4JKC A;  2A3Z A;  2KKZ A;  3AAQ A;  1XQS C;  1IJJ A;  3WXM B;  3IDH A;  4BGB A;  1WOQ A;  1KAZ A;  4BRD A;  5HOO A;  3O4W A;  3MN9 A;  1RDU A;  3D6R A;  4RCH A;  1HKB A;  2W00 A;  3G4S N;  1NGD A;  3RVC A;  3IFR A;  3SLC A;  2F9T A;  5AQY A;  3TSU A;  4NB4 A;  4R79 A;  3SBT A;  3CCL N;  1YJ9 N;  5BPN A;  1Q18 A;  2WUS A;  3RSE B;  3LDO A;  3A5N C;  3W3D A;  4QS9 A;  4BR9 A;  3MCP A;  1QVF M;  3ZEU B;  1YIJ N;  1KAY A;  1Z05 A;  3CJC A;  5H1S Q;  4EFH A;  5AQH A;  3CJB A;  3BP8 A;  1RDW X;  2A6A A;  4KH4 A;  4FWQ A;  5EOY A;  4IEI A;  2ZJR L;  4GV9 A;  3EKU A;  1X9J A;  2FF6 A;  5AQU A;  3UB5 A;  2IVN A;  4A61 A;  5AQG A;  3LM9 A;  1TYQ B;  4U7B A;  2AA4 A;  1KC8 O;  2NZT A;  4NO7 A;  4Y0W A;  4JHD A;  2HBJ A;  1JCG A;  5AQZ A;  5ADX H;  3C0B A;  3CJ9 A;  1BU6 O;  1P90 A;  5AQW A;  2GX9 A;  2GUP A;  5I9E B;  1DEJ A;  5C0Y A;  1X3M A;  3HRG A;  1YF5 L;  4ILG B;  2OTJ N;  4B1Y B;  2P9L A;  3ZET B;  4IOC L;  3ENB A;  1VQK N;  1HUX A;  1NLV A;  3LDL A;  1W2B M;  1LOT B;  3QIC A;  3C6A A;  3R3L A;  1HKC A;  2C1G A;  3Q7B A;  3W0L A;  4IFE A;  1ZBS A;  4CZH A;  2ZWH A;  4WQ5 C;  3CI5 A;  2YX6 A;  4K43 A;  3LL3 A;  4DB3 A;  4YOX A;  1K8K A;  1S3X A;  3ID8 A;  4CBW A;  3O08 A;  2NRR A;  2V7Z A;  1GLC G;  2DPN A;  5CE3 A;  3ID6 A;  4XH4 A;  2P9K B;  1HX1 A;  1T6D A;  3H1V X;  5GAE P;  3RSE A;  4BY9 C;  1RGI A;  3ZEU A;  3ULE A;  5AQS A;  2D0O A;  3PLA A;  3D7E O;  1JCE A;  3ATV A;  1VQ9 N;  5BN9 A;  3VF2 A;  2YJF A;  2NRT A;  5AZJ B;  3QFP A;  4HWI A;  3E9O A;  5FPD A;  3OBY A;  4KH6 A;  3O6W A;  2P9S B;  2ASM A;  3CJ1 A;  4FWL A;  4JNE A;  4CZG A;  4J8F A;  3KZB A;  4BC4 A;  1TYQ A;  2E2Q A;  4BRA A;  1G99 A;  5BR9 A;  1NJI O;  3P4I A;  4A59 A;  3ZX0 A;  1V4S A;  1NGG A;  2P9I B;  4FPB A;  4XH1 A;  3NVM A;  1YAG A;  4BRO A;  4B1Z A;  2OTL N;  4O5F A;  1T44 A;  1ATR A;  3QBX A;  4OPA A;  5LY3 A;  3SBG A;  3ZET A;  2A40 A;  3EE8 A;  5AFU A;  1Q86 O;  1KD1 O;  5E26 A;  2QWQ A;  2NRZ A;  2KLA A;  1XC3 A;  3H6E A;  3DLL L;  3QDK A;  4BRM A;  2E8A A;  2GEL A;  5LJV A;  2BH1 A;  3O9T A;  5AQT A;  1BA0 A;  1YVN A;  1ATN A;  5F2R A;  3CJA A;  3L4I A;  3GG4 A;  5DM6 L;  1YUW A;  2IVO A;  3VEZ A;  3CPE A;  2QWL A;  1NGH A;  4H0V B;  3WXL A;  1MA9 B;  1ILY A;  1U2V B;  3H3O B;  4IJA A;  3QML A;  3ATU A;  4ISG A;  3HBT A;  3TU5 A;  1YJN N;  3TTF A;  3P39 A;  2QWR A;  4A57 A;  5GAH P;  4EHU A;  4FWS A;  5AQF A;  3KWI A;  1QZ5 A;  3SK3 A;  4FOE A;  2FF3 B;  4PKG A;  3VEW A;  3CMA N;  3H1Q A;  4IEE A;  4O8U A;  4DKW A;  2Q97 A;  1XUP O;  3OBW A;  4GVE A;  1WUA A;  1VQ7 N;  4QS7 A;  2HMP A;  5TKW A;  1K9M O;  3SMS A;  2P9S A;  3GBT A;  5EVZ A;  1SS6 A;  4CJ7 A;  2ITM A;  5GIP A;  1QZ6 A;  5BRD A;  2Q36 A;  2QWO A;  4O8K A;  4QS8 A;  3WUH A;  2E1Y A;  2QWN A;  3AGR A;  4IDH A;  4PL8 A;  5C2D A;  1C0F A;  4KH5 A;  4JKB A;  2P9I A;  4WQ5 A;  5M1F A;  4BC5 A;  3A5L C;  4JD2 B;  2RHK A;  2F9W A;  4DQ8 A;  3VEO A;  1VQ5 N;  2J4R A;  3B8A X;  3CQX A;  3JS6 A;  4BQL A;  4EIA A;  3CC7 N;  4H5R A;  1GLL O;  4C1N K;  1HKG A;  4K42 A;  3VES A;  4BC2 A;  4AM6 A;  3E9L A;  3UKU B;  3J8A A;  4CD1 A;  1SQK A;  4CZI A;  4YOV A;  3EKS A;  2IVP A;  2NNW A;  5BRE A;  1E4F T;  3D2E B;  3VGL A;  4BVP A;  2EWS A;  3F5T A;  4Z94 A;  1YXQ A;  3LM2 A;  1EQY A;  4FWR A;  3CQY A;  4ILJ A;  1MWM A;  1NGC A;  3O9Q A;  1U2V A;  4EAH D;  5F1X A;  4FPA A;  5ELZ A;  2D4W A;  5BPL A;  2VGM A;  2Q31 A;  5MLC Q;  5M1N A;  4H5T A;  4IZ9 A;  2HBM A;  4JN4 A;  5FPM A;  5FPN A;  1LCU A;  4BRQ A;  3CJ7 A;  4I6M B;  5GAG P;  3P38 A;  5B8H A;  5C2F A;  2ASP A;  4IWV A;  1KAX A;  1VQN N;  1NGB A;  1X3N A;  1M1K O;  1J6Z A;  4H5W A;  3VEY A;  5AFU H;  3ENH A;  3F9M A;  3CCJ N;  3N4P A;  2AP1 A;  4UY8 O;  1E4G T;  2ZJP L;  1QVG M;  5AQO A;  4BVO A;  3ENO A;  3CCM N;  3AY9 A;  4BRG A;  4FO0 A;  3FLC O;  5GIO A;  1ATS A;  2VWB A;  3VEX A;  4H0X B;  4A2A A;  5F0X A;  2RE2 A;  3P31 A;  3MWT A;  4PKH A;  5KPT A;  1Q7Y O;  3PIO L;  3F2K A;  2UYT A;  3BF3 A;  3EE9 A;  3O1B A;  2YI1 A;  4IOX A;  4JD2 A;  4BR2 A;  3CF5 L;  2YCH A;  2BTF A;  4AF1 A;  1KQS M;  2E2P A;  2QXL A;  2WC9 A;  3C7N B;  4NLB A;  3VGK A;  3NVK A;  4OO1 J;  4BRN A;  4JEP A;  1K8A O;  3UKU A;  4BEC A;  1NGJ A;  3EN9 A;  2GEM A;  3GOI A;  3VTH A;  3MN6 A;  3A8Y A;  4MDB A;  5EXW A;  5BN8 A;  1NGF A;  2Q1N A;  2KHO A;  1NGE A;  3A5M C;  4H0Y B;  2GWK A;  5AQJ A;  5C10 A;  1T3V A;  1Z6R A;  1GLJ O;  4ISF A;  3TPQ A;  3GL1 A;  4CZL A;  1HJO A;  3VEV A;  5HL7 L;  3AGK A;  3WEE B;  5GAD P;  4XEI A;  1S22 A;  3O80 A;  3VER A;  3DXK B;  4H0T B;  4YOT A;  1VQ6 N;  5EX5 A;  5BRH A;  3VEN A;  2YHX A;  4I6M A;  3T69 A;  4K41 A;  5AQM A;  1KXP A;  1S72 N;  4PHT X;  1BUP A;  2P9N B;  3CCV N;  1NBW A;  2YHW A;  3FZM A;  3UKR B;  1N8R O;  4WFA L;  4BGA A;  3MN7 A;  1GLF O;  2IIR A;  3MX5 A;  4M7Y A;  5GIN A;  3CC4 N;  3VGM A;  5AZI B;  3SAH A;  3R1X A;  2JWK A;  3DWL A;  2FXU A;  3QBW A;  5C12 A;  2V52 B;  1YHQ N;  1VQ4 N;  2ZJQ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...