3DXKA

Structure of bos taurus arp2/3 complex with bound inhibitor ck0944636
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
415
structure length
397
Chain Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-related protein 3
publication title Characterization of two classes of small molecule inhibitors of Arp2/3 complex
pubmed doi rcsb
total genus 120
structure length 397
sequence length 415
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3dxkA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxkA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxkA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3dxkA04
4PL8A 3EO3A 3C7NA 4A2AA 4BR7A 1TUYA 3U9ZA 4M7YA 3RSEB 5KQDA 2E2OA 3H1QA 1EQYA 2E1ZA 3EN9A 3IUCA 4A2BA 2V7ZA 1P8ZA 2P9IA 4QS8A 4WQ5A 3O1BA 4H0TB 4CZIA 3JS6A 4AM7A 2QWRA 3UKRA 3EL2A 3VEWA 3EKUA 1GLDG 3WEEB 1KXPA 4H5NA 3SMSA 3AAPA 5AZIB 3BF1A 1T44A 3R9PA 3GL1A 1QZ6A 3FZKA 3JXUA 2AP1A 4BRDA 1LOTB 4BG9A 3QFPA 3LM9A 1NGHA 3SJHA 2QW9A 1MA9B 1YXQA 4YDUC 4BRKA 3ZEUA 1DGKN 4BC5A 2DPNA 3B8AX 1QQNA 2CH6A 4XEIA 1KAXA 3A8YA 5BN8A 3L0QA 3VEZA 4FOIA 4JD2A 1G99A 3LDQA 1ZC6A 2QWOA 3ULEA 1GLCG 2I7NA 1QQMA 4WQ4A 3SK3A 3CETA 1SAZA 5AZJA 3HI0A 5FPDA 5BPMA 4FWSA 3A5NC 2P9LB 4IJAA 1BUPA 5AQSA 4JHDA 4CI6A 5BN9A 1YUWA 3ENOA 5KQ8A 3VGMA 5BRDA 3CIPA 2FSJA 4Y0WA 2CGJA 1NMDA 3A5LC 3WT0A 4CBWA 4XH4A 4DCHA 1IG8A 4H5VA 4MLHA 2IVNA 2CGLA 1JCGA 3H1VX 4IXCA 3TU5A 4NO7A 4K25A 3BUZB 2AA4A 3L6QA 4CZFA 4BRNA 3VENA 4BRQA 3GG4A 4F9OA 3MN6A 1X3MA 2YJEA 4BREA 3CJCA 2CH5A 4BRGA 3I8BA 2A42A 3CJBA 4H03B 4JNEA 2Q0RA 5AQUA 3M6GA 5AQXA 3D2EB 4B1ZA 2YCHA 3GOIA 4FOEA 4FO0A 3KZBA 2FLOA 4IJNA 1X9JA 1YAGA 2QXLA 2NZTA 4I6MB 5AQZA 2D0PA 2A40A 2HOEA 4H5RA 5JLHA 3DXMB 1Z6RA 5AQWA 3VESA 2GWJA 4CZJA 3CQYA 3WXJA 1KAZA 4BR2A 1BG3A 5JLFA 5EOYA 4EIAA 2QWPA 3WQUA 2BUPA 2NRHA 4BROA 1YVNA 2E2QA 1NGAA 4BGAA 3KVGA 3VPZA 2GEMA 3IDHA 3ENHA 3UB5A 1BDGA 5AQMA 3BF3A 5FPMA 1NGCA 4BVPA 5BPNA 1K8KB 5BRFA 1GLFO 5BRHA 3A0IX 4B1XB 2QWQA 5AQNA 1RFQA 3LM2A 3FZLA 4BC4A 1HJOA 2W41A 3QICA 3QDKA 4H0YB 3DWLA 3O8MA 2FF3B 3A5OC 4CBXA 3D2FB 5E26A 4MLEA 3W3DA 2E2PA 5EVZA 5F1XA 4H5TA 3U9DA 1TYQB 3LDNA 2P9PB 1D4XA 3IMXA 3D7EO 1GLJO 5KPZA 3M3ZA 5AQIA 4BRIA 2EWSA 3CERA 4JN4A 3ZX2A 1V4SA 4BR9A 3QBWA 3VEXA 3P4IA 2D1KA 2P9NB 3UKUB 2PAVA 2YHXA 1V4TA 1NGEA 2YJFA 3ATVA 1QZ5A 1E4FT 4CZLA 2ITMA 3H45C 3LL3A 4IO8A 1ESVA 4FWOA 4CZMA 3GBTA 2ZGZA 1NWKA 5ELZA 1RGIA 3VGLA 5BPLA 4Z94A 4DHYA 3CJAA 3O08A 2ASMA 3FLCO 2IIRA 1U2VB 4BRLA 3FGUA 2FSKA 2BTFA 1ATNA 3LDOA 4GNIA 1OKJA 3R6MA 2A6AA 2V52B 3VGKA 4BRMA 4EAHD 3ZX3A 4CD3A 4H0PA 3FZFA 4BQZA 4FWNA 3AAQA 3EZWA 4PKHA 4BRAA 4PKGA 2CGKA 3AY9A 3MN5A 2ZGYA 2A3ZA 3ZETB 4XH1A 4BR4A 1T6DA 1NGGA 2GTDA 3FZHA 4CJ7A 4K43A 4GY2B 4BRFA 2GWKA 2J4RA 2VWBA 3VEYA 4BRHA 4EHUA 4YDUA 3O5BA 4AM6A 2ASPA 2H3GX 2HF3A 4I6MA 5AQFA 2QWNA 4BR0A 3DXMA 1BA0A 4FSVA 2Q1NA 3QB0A 5FPEA 4FPBA 1GLLO 3UE5A 2E2NA 3VEVA 4CZKA 3QBXA 4H0OA 5AQHA 4BVOA 5BREA 4A62A 5EY4A 3J8AA 3W0LA 1NBWA 3VETA 5AZJB 2A41A 2P9UB 3ATUA 1NGIA 3CJ1A 4L3QA 2P9KB 2ASOA 4ISGA 4FWQA 3M1FA 1CZAN 1Y64A 3DAWA 3AARA 5B8HA 5EX5A 2NLXA 1C0GA 1K8KA 2UYTA 3VF4A 3IFRA 4HTLA 3OHRA 1NGFA 2KHOA 4RTFD 1H1VA 3O1WA 2E1YA 3WQTA 4QS7A 2Q36A 1J6ZA 1NGJA 4LC9B 5AQVA 3HBTA 4H0XB 3CJ7A 5AFUA 2VCPA 3LDPA 4XH5A 3H6EA 2Q31A 3U8XA 2E20A 2QWLA 3BEXA 1MDUB 2OANA 2HMPA 2ZF5O 4HWIA 3SLCA 5LJVA 4J8FA 5AQTA 4H5WA 1TYQA 3QFUA 2P9PA 5F0XA 3RSEA 3TPQA 5AQGA 1HKBA 5AQRA 4BC2A 3HM8A 3O80A 4BC3A 2Q2RA 4FPAA 1T6CA 4WQ5C 1MWKA 3ID8A 2FSNA 3VF6A 3VOVA 4WYBA 1BO5O 3WEEA 2YHYA 4BGBA 5AZIA 2P9NA 3O4WA 2QM1A 4IWVA 5FPNA 2F9TA 4FWMA 4PL7A 1ZXOA 5TKYA 1ATRA 4BQLA 4EHTA 4FWPA 2V7YA 5E84A 2A5XA 3H46O 5KPTA 3L4IA 4K42A 3DXKB 2ZWHA 3DJCA 1MWMA 5AQOA 2V51B 2PBDA 1XC3A 2I7PA 2HF4A 1QQOA 3ZX0A 1U2VA 3MDQA 4WQ4C 4BRCA 5AQPA 1GLBG 2P9SB 1WUAA 1X3NA 2VYPA 3FZMA 2P9LA 1NGDA 4FWRA 1BU6O 5I9EB 2YI1A 1BA1A 4O8KA 2FF6A 4FL9A 4C23A 3VERA 3ZETA 3C7NB 1NM1A 3CHWA 5AQQA 1NGBA 4M63C 4RWTA 3MN7A 4ISEA 4O5FA 3WXLA 5ADXA 3C0BA 4EFHA 1ATSA 4IZ9A 2P9IB 5AQKA 1QHAA 3UKRB 2IVOA 3U4LA 4B1VA 1JCFA 3FFKB 3FR0A 4B1WB 3MMVA 4H0VB 4NB4A 3MCPA 3D2EA 2W40A 5F2RA 4CBUA 3O6WA 1WOQA 2P9UA 1XQSC 3ZEUB 2P9KA 1Q18A 4MO4A 4A61A 5AFUH 1LCUA 1SQKA 2GUPA 4JD2B 5JMVA 1IJJA 3WXIA 3ULEB 5LY3A 1DEJA 1KAYA 4DB3A 2D0OA 3HSCA 5BR9A 1JCEA 1RDWX 1HUXA 3H3NO 3BP8A 4QS9A 4JAXA 4JHDB 5AQYA 3KHYA 1Z05A 3G25A 3WUHA 1U6ZA 5JICA 4DQ8A 4B1UB 3CI5A 2Q0UA 4K41A 5KPRA 3H3OB 4E1JA 3R8EA 5EXWA 2F9WA 3S41A 1HKGA 5CE3A 5AQJA 4BG8A 1C0FA 4CZHA 3D2FA 3EKSA 1ZBSA 1R59O 4CD1A 1TUUA 1S22A 4ISFA 1GLAG 4BR5A 4M7XA 4FWKA 4B9QA 2D4WA 4KBOA 1SZ2A 3MN9A 4MO5A 5AQLA 5LJWA 2QWMA 4CZGA 4CZEA 3GE1A 1E4GT 1BOTO 3DXKA 4FWLA 3HZ6A 2E8AA 1DKGD 3VEOA 1HKCA 4B1YB 3UKUA 3F9MA 3MK6A 3QMLA 3CQXA 2YHWA 2WUSA 1S3XA 3GDQA 1BWFO 3WXKA 2P9SA 3LDLA 4PKIA 3HTVA 4RCHA 2GELA 3CJ9A 3A5MC 1HPMA 5AR0A 3VF2A 4BRPA 5ADXH 1XUPO 3FE1A 2FXUA 1GLEG 2IVPA 2Q97A 3SMPA 1HLUA 3I33A 1NLVA 2E88A 1HX1A
chains in the Genus database with same CATH superfamily
3EO3A 1KVCA 3HO1A 3HP9A 1TUYA 4B9LA 3AVLA 4M7YA 3SQ0A 4C1NI 1WB9A 2OZSA 3DOKA 1VQNN 3IUCA 4FZZA 3TSPA 1XHXA 3JS6A 4LF4K 3WEEB 3EL2A 3EKUA 3T7ZA 1KXPA 3OYHA 3SMSA 4FJ7A 4DF8A 3AAPA 1UA0A 3BF1A 3BZCA 4KB0A 2XY5A 2D5RA 3GL1A 1QZ6A 3FZKA 1LOTB 3QFPA 3SJHA 4DTJA 1YXQA 4RG8A 1DGKN 1TV6A 4I9QA 1XNQK 3RR7A 4BWJA 1W2BM 4XEIA 3SJJA 5BN8A 3CFPA 3VEZA 1B9FA 4KFBA 3L2UA 1G99A 3LDQA 3HOTA 4DTOA 4HTUA 3ULEA 3AA5X 2O8CA 4PHTX 1FXXA 5FPDA 5C25A 4EP4A 4FWSA 4IJAA 1WLJA 5BN9A 4CEZA 3ID6A 5KQ8A 4Y0WA 3WT0A 4CBWA 4DCHA 1VQ5N 1IG8A 4MLHA 4DMNA 1JCGA 4LD0A 3IAYA 3LAKA 1ITGA 3TU5A 3EZ5A 3BUZB 3IS9A 1FKOA 3E1YA 4DV4K 2HSTA 4BRQA 1X3MA 3RRGA 3DLLL 3CC2N 1XWLA 4H03B 4JNEA 3PIOL 1KLMA 3M6GA 2HBKA 3ZCMA 1ASUA 3TI0A 1XHZA 1YI2N 2G8WA 4A5AA 4W5RA 2GV9A 3V9XA 4B1ZA 1HRHA 4IJNA 1YAGA 4I6MB 1ILYA 2HVHA 2D0PA 4H5RA 3SPZA 3AVCA 3CQYA 3WXJA 2R7YA 1S6PA 1HNVA 5HRRA 4WFBL 2UUBK 3WQUA 4W5TA 3E9PA 2NRHA 2E2QA 1NGAA 4JKGA 3HVRA 3VPZA 3IDHA 3UB5A 4IDHA 4E7LA 3SYZA 3BF3A 5FPMA 4CHPA 4CJ5A 4CERA 1WN7A 1RBSA 2QWQA 2JGUA 3ASMA 5HP1A 1RFQA 3DWLA 4DV3K 2FF3B 3A5OC 4CBXA 1VSMA 3D2FB 4MLEA 4J2BA 5EVZA 3NBPA 4IOAL 2P9PB 5HRPA 2UXCK 5FRNA 4DR5K 1HR0K 4OKEA 2NRXA 2YV0X 3NF7A 3F5TA 3OTOK 3ZX2A 4B3TK 1EWQA 1SKRA 3LZIA 1UA1A 3TTFA 1ZBLA 2YHXA 1V4TA 4JI4K 2YJFA 3HM9A 4DFKA 1QZ5A 1EP4A 1QQCA 1JLGA 5A2QO 5GAHP 1C1BA 4IO8A 1ESVA 4M3RA 3SAFA 2F96A 2ZGZA 3G71N 1RGIA 1NJZA 3VQAA 2ASMA 2JLEA 3FLCO 1U2VB 1KQSM 3LPUA 3OBYA 4CJWA 3FGUA 2OPSA 3VQEA 2BTFA 1ATNA 4GNIA 2A6AA 3LANA 5M1QA 4KHWA 3L3VA 3TAEA 2QI2A 3CPEA 4PKGA 3DOLA 2CGKA 2HHTA 4IEIA 2ZGYA 4IDKA 1TKXA 3QEXA 1T8EA 2E5LK 4XH1A 3NE6A 1K73O 2DFFA 1R0AA 3CMAN 4OLBA 3NGZA 3OYKA 3V1OA 4YDUA 4C8LA 1VQON 1LW2A 3MWTA 5K14A 3NGYA 5HL7L 4BECA 3DXMA 4DTXA 3QB0A 4LSLA 1GLLO 2E2NA 2G8FA 2JWLA 3N4PA 4H0OA 5AQHA 3E9OA 3J7ZO 4Z0UA 4JRPA 5HLFA 3PO5A 1W0HA 4CJQA 4LFAK 4ELUA 5AZJB 4OGEA 1CXUA 3ATUA 4CJUA 2P9KB 4QCLA 3CC7N 3M1FA 1CZAN 3AARA 4FVMA 3HJFA 2NLXA 3LWLA 4CJSA 3VF4A 3CCLN 4AF1A 4CJ3A 4RW9A 4BACA 4OPHA 5IT9O 4ZTFA 2PY5A 1L5UA 1NK5A 3K5MA 3K5OA 4B3RK 1VSDA 3HBTA 4M3XA 1B9DA 4H0XB 3L3UA 3LDPA 4LF6K 3BEXA 2OANA 2RE2A 2HMPA 2ZF5O 3SLCA 3N4QA 1IKXA 4DLEA 3R3LA 4E0DA 1KTQA 4V19S 2W00A 1NU0A 3PX0A 3QFUA 3RSEA 5AQGA 3PLAA 1GOBA 1U49A 1IKYA 4ILGB 3AO5A 4FPAA 3NHGA 1RDBA 3ID8A 2FSNA 4LF5K 3K59A 3OYDA 4KB1A 2O4IA 5AZIA 4OVLA 4LY7A 2YNIA 2BDPA 4ELVA 3K58A 2F9TA 1Q82O 4PWDA 1ZXOA 1ATRA 3JAMO 3CCJN 4BQLA 2G8UA 1ZBHA 4TSXA 5DM6L 2A5XA 4WF9L 1O13A 4PA1A 3L4IA 4HVJA 4K42A 4CJLA 3DJCA 1MWMA 4CGGA 2V51B 2PBDA 4DV7K 2HF4A 3VQCA 2KW4A 1HPZA 3C94A 4Q5VA 5AQPA 1VSLA 1IBMK 2VYPA 3FZMA 1NGDA 4AHTA 5GIOA 4FWRA 1X1PA 4KH4A 2O8EA 2KFNA 2YI1A 4EZ6A 3B6OA 1YTAA 1RDDA 3CD6N 2IOCA 4L8RB 3C7NB 3R1XA 4X66K 4DR6K 4N56A 3F2KA 3C0BA 4GV6A 1C0TA 4CHYA 3O9RA 1N33K 2QKKA 1QHAA 5GINA 4OKKA 3KLGA 4B1VA 4WCEL 1JCFA 1XMQK 3S9HA 1BGXT 2KZMA 3QIOA 3D2EA 2W40A 3MAQA 5F2RA 3THYA 3MXIA 1WOQA 2P9UA 4DTPA 4W5QA 1XMOK 5AFUH 1HNZK 2XO7A 5JS2A 3SV4A 3SQ2A 4DR2K 5JMVA 4Z4IA 5BR8K 1DEJA 4DB3A 3J7YP 4O55A 4JHDB 4FZYA 3THXA 3ZSOA 4DLGA 4FJ8A 1ZYQA 1Z05A 1U6ZA 2Q0UA 3OJSA 1BCOA 4B8AB 1JJ2M 3T19A 4HUEA 3EE9A 3H3OB 4E1JA 3DMJA 4FLZA 1U47A 4A5BA 4Q0BA 2QTDA 5EU7A 4CGDA 3EKSA 1ZBSA 4DTSA 1GLAG 2A1SA 3K9JA 1U04A 4BR5A 4M7XA 3J7AP 4FWKA 3M5RA 4B9QA 4CECA 3MN9A 2QWMA 1NJIO 4Y1DA 1E4GT 1BOTO 1VSEA 3KKRA 4ILHA 4CJKA 4CHQA 4CIGA 2YKNA 3HL8A 4B1YB 3UKUA 3SBGA 3QMLA 4KREA 2WUSA 3E9LA 3GDQA 3LDLA 4PKIA 2OPPA 4FM1A 1NNEA 4DF4A 3C6AA 4FM2A 4M41A 4B8CA 3VF2A 5ADXH 1VQPN 2UXDK 1YJWN 2Q97A 4DUZK 3A2FA 1RT3A 3NGIA 3LWMA 4CF1A 3L2WA 5C12A 1RCHA 1LV5A 3QESA 5J2QA 1QSSA 3NH1A 5KQDA 3OVNA 4H4OA 1EQYA 3EN9A 1IG9A 1VQ6N 4A2BA 1SV5A 4QS8A 4WQ5A 5HOOA 4CZIA 3UKRA 1ZBIA 1SL0A 2XHBA 4H8KA 1T44A 1SS6A 3SUQA 1NGHA 1MA9B 1EX4A 1C1CA 4J2AA 4YDUC 4BRKA 1RDUA 1N8RO 2ZJPL 4EP5A 1J53A 4FOIA 5KRTA 2RN2A 3L4QA 2QWOA 3CCMN 1QQMA 1X9WA 2NRTA 3AA2A 3HI0A 3AGRA 2PZSA 3A5NC 2P9LB 1BUPA 4DWIA 1S1VA 3NF6A 3VGMA 5BRDA 2CGJA 3LP2A 1TKDA 4XH4A 4N47A 2CGLA 3Q7CA 3KWIA 4FJLA 3H1VX 1OH6A 1NMNA 4CESA 4JS5A 3L6QA 3IKMA 3THWB 3TAQA 4RW6A 4DSIA 3AVMA 3AVBA 4I7FA 2Z1GA 4F9OA 3UIQA 1HYSA 4U7BA 3CJCA 4BRGA 2QEXN 4CHOA 2VGMA 4JI6K 3DRSA 3BDPA 4AH9A 1UAXA 3D6RA 1HQEA 5J2NA 2FLOA 3HPOA 4DU4A 5HBMA 4CW7B 3TTCA 3G10A 5AQZA 1RDAA 1Z6RA 1NJWA 3VESA 1JL1A 2GWJA 1KAZA 1BG3A 3K2PA 4Z4EA 3SQ4A 5JLFA 1O1WA 1YJ9N 4NXNK 1A5XA 1YVNA 3OS1A 4BGAA 3S3OA 4B9SA 2GEMA 4CIEA 2W6LA 3O9UA 3ENHA 2LSNA 4OGCA 1N34K 5BPNA 1K8KB 5TKWA 3CCQN 1GLFO 2O8DA 2KLAA 3CPWM 3ZT2A 3SAGA 1NKEA 4H0YB 1C0UA 4CF0A 4FVUA 3W3DA 3MECA 1VSFA 4IFVA 2E2PA 4BDZA 4FXDA 4CFBA 1HYZA 1TYQB 4E72A 5J2PA 1N36K 3D7EO 3DM2A 1RT7A 4BRIA 5C0YA 4Y1CA 3L2VA 2JWKA 3OYEA 5GAGP 4BR9A 1V4SA 3EEQA 1JLAA 3HPGA 1GOAA 3CMEN 3PSIA 4O5BA 3OYJA 3ISNC 3I55N 3ATVA 1NK8A 3HPHA 1VQLN 5I42A 3VGLA 1N5YA 4IOXA 3VQ6A 2P5OA 3V9WA 3ZSWA 4DTMA 1Q7YO 2FSKA 4C8KA 1RNHA 1SUQA 1VSKA 3LDOA 3R6MA 3V6DA 2OTJN 4AHSA 4KTWA 4BRMA 1T03A 4RW8A 3AVIA 5FDLA 4KAZA 1BI4B 3AAQA 4OJRA 3EZWA 1WSEA 4C8NA 4BRAA 1UWBA 3AO3A 2A3ZA 3ZETB 5C15A 2GTDA 3M8RA 3CM5A 5KI6A 1W9HA 4BRFA 2VWBA 4C1NK 3O5BA 4AM6A 2H3GX 4I6MA 5AQFA 4DUYK 2WBNA 5FPEA 4FSVA 2Q1NA 3UE5A 1LWFA 1KD1O 4JRQA 1TL1A 1S5JA 5EY4A 4AHRA 5C42A 2O8CB 1VK0A 4B9MA 3ZSXA 1RDCA 4L3QA 4O4GA 2ASOA 4ISGA 4UQGA 4H4MA 1XC9A 4HCCA 4JI3K 4B9TA 4CEBA 5B8HA 1WAJA 2UYTA 3OHRA 3OYNA 3NF9A 1CZ9A 1BQNA 1NJYA 4QS7A 3ZT0A 4LC9B 4LF7K 4DFMA 3QIPA 2E20A 3AO2A 4HWIA 1ZBUA 3PX4A 4J8FA 5AQTA 2F7TA 4LFCK 4Z4HA 2P9PA 4ZTJA 1HNWK 5AQRA 2VG6A 1QTMA 4BC3A 4BWMA 1T6CA 1TGOA 4WQ5C 4FLXA 5CY4A 4JKEA 3VF6A 3VOVA 3CG7A 3QNNA 2YHYA 3S3NA 3O4WA 2D0AA 2PFUA 3O4NA 5FPNA 3G4SN 2OA8A 3E01A 1VRTA 4FWMA 4JEPA 1VQ7N 3S5TA 5TKYA 3OYCA 2O8BB 3J81O 4FWPA 3BGRA 3I0RA 3H46O 2XY7A 4JYAK 4YOYA 1U2VA 3MDQA 3SUNA 3VQ7A 4BY9C 4BRCA 2P9SB 2VQEK 3L2QA 1X3NA 1WSFA 3LP0A 1HQUA 4B9NA 2ITGA 3O3FA 4CEAA 4GW6A 3MEDA 3ZT3A 1KFSA 2FF6A 3RMCA 4FL9A 1NG9A 2PYLA 4K8XA 2KTQA 4CJ4A 5JS1A 3CHWA 5JVHL 1BHLA 2RHKA 5AJ3K 4W5NA 4B3SK 2A1RA 3QEIA 3AVAA 3WXLA 1TVRA 4K8ZA 4EFHA 5KGWA 4IZ9A 2P9IB 2Z1JA 5AQKA 5KRSA 5I3UA 3U4LA 2NUBA 2W42A 1SKSA 5M1FA 3FFKB 3FR0A 3T1AA 4B1WB 4FJ5A 3MMVA 3DRPA 1OVQA 3MCPA 2NRRA 2X78A 1XQSC 3ZEUB 2P9KA 4ICLA 1OH8A 3O3GA 4BE7B 4MO4A 3V81A 3QLHA 4FLYA 3KK2A 4GKJK 1SQKA 2HHUA 1QHTA 1RBRA 4JD2B 1D9DA 4NCAA 3WXIA 5CYMA 2B6AA 1IV0A 1QS4A 2D0OA 4IOCL 5BR9A 1HUXA 3ZSYA 1G15A 2HHVA 1WAFA 4JAXA 1NK0A 2E6LA 5AQYA 3V9ZA 4BE1A 3G25A 3AGKA 1J9AA 1IKVA 3E66A 3CI5A 4B1UB 1RT1A 3QEPA 4B3MK 1MU2A 5M1OA 3P38A 2WOMA 1EXQA 4DV1K 4FLWA 1P90A 5EXWA 1W97L 2F9WA 2ATQA 1J5EK 1HKGA 4BG8A 2FC0A 4DR1K 5CZ2A 4CGIA 1Z25A 1R59O 4CD1A 1TUUA 2FBYA 1E3MA 1YT3A 4FJMA 2NRVA 1Z26A 4KBOA 1SZ2A 1VSHA 4MO5A 5LJWA 2HMIA 4CZGA 4FWLA 2GBZA 1DLOA 4HCBA 1S6QA 4FLUA 4FJGA 2E8AA 1DKGD 3PV8A 3NH0A 3F9MA 3MK6A 1BWFO 1FJGK 3WXKA 3LP3A 3HTVA 3ZSQA 3CJ9A 1I3AA 1RT5A 1LW0A 4J2EA 3K5LA 3QETA 3FE1A 3CC4N 2IVPA 1RTJA 3S3MA 2VGNA 3I33A 4BDYA 1NLVA 3HXMA 4JK7A 5AQUA 1HX1A 4PL8A 3C7NA 4JLHA 4AHCA 3HRGA 3RSEB 2E2OA 3H1QA 1ASWA 4ZHRA 4CFDA 4F8RA 3K5NA 2V7ZA 1P8ZA 3O1BA 4H0TB 4AM7A 3MXMA 3TTDA 5AZIB 1HMVA 4KHNA 3JXUA 3KLEA 1FW6A 2AP1A 4BRDA 1TKZA 1TL3A 2BGGA 3PUFA 3ZT1A 1JLQA 2DPNA 3B8AX 1QQNA 3SCXA 3A8YA 2WC9A 2YNHA 4HUFA 4I2QA 3L0QA 4KTQA 4G9ZA 3L8BA 1FKPA 1ZC6A 3CCRN 4N76A 2I7NA 3CETA 1N6QA 5BPMA 4IBNA 4JHDA 1YUWA 1J54A 2HNZA 3CIPA 1T05A 3A5LC 1BCMA 2C1GA 3RR8A 4KPYA 2IVNA 3D45A 3VA3A 4FK0A 4IXCA 4NO7A 1VQKN 2VWKA 3O9SA 2AA4A 4CZFA 2BANA 4YOXA 3G6EN 4BRNA 3TABA 1I39A 3DLGA 3AV9A 3GG4A 3TSQA 4BREA 3I8BA 2A42A 2Q0RA 1L3SA 4DSLA 1TK8A 4DU3A 5AQXA 4KI4A 3H08A 4YOUA 3D2EB 3VTHA 3GOIA 3OW2M 4FO0A 1GOCA 2YNFA 2W6KA 3HYFA 4DR4K 2NZTA 3OYLA 4M45A 3AVJA 2A40A 2DFEA 5JLHA 4CFCA 3AA3A 5AQWA 2X6SA 3PX6A 1DTTA 5EOYA 4CEEA 4EIAA 3VQ9A 2BUPA 4F2RA 3B6PA 1C1AA 3WNHA 3WNFA 3CM6A 1A5WA 1HYVA 5DM7L 4M42A 4JKDA 5AQMA 1A5VA 1NGCA 1RT4A 3A0IX 4CJVA 4B1XB 5CZ1A 5AQNA 3KKSA 1CXQA 5J2MA 2OCEA 4CJTA 1NJXA 2W41A 3QDKA 4GVMA 3O8MA 1LAVA 4JI2K 1OH7A 3NAEA 1S1UA 4KHPK 4MFBA 1K9MO 1DTQA 5CHIA 3U9DA 3TR8A 1VQ4N 4BEBA 4KHYA 3LDNA 2F8TA 1KLNA 1U48A 4CK3A 1QVFM 2O8FB 4F4KA 1TKTA 4M3TA 1HNIA 5JENA 4MQ3A 2EWSA 2EX3A 3CERA 3DLHA 4JN4A 1VQ9N 1S1WA 1SL1A 3P4IA 3SAHA 1TK5A 2P9NB 3UKUB 2PAVA 4FCYA 4GV3A 1KSPA 2RPIA 3QINA 2E6MA 3NVMA 3OYBA 4CZMA 4FWOA 3KK3A 3THVA 5ELZA 3ZLJA 5HRNA 5BPLA 3K9KA 4Z4CA 3O08A 1XNRK 4BRLA 4KH6A 3HK2A 3J80O 2RF2A 3OS0A 3THWA 1OKJA 2V52B 3KJVA 4QOZB 4EAHD 3ZX3A 4JKCA 4H0PA 4PY5A 1KCFA 4W5OA 4BQZA 1WNSA 4PKHA 4I9LA 1BISA 4KRFA 3MN5A 4KV8A 4E7IA 4AQYK 4JI5K 4XIUA 4LH5A 4BR4A 1NGGA 3FZHA 4CJ7A 4YOVA 2ZE2A 4IEEA 2J4RA 4FK4A 4IG3A 4CGHA 4BRHA 4EHUA 3DRRA 5LL6Z 4E7JA 1BIUA 3RWUA 1YVUA 1BA0A 5KGXA 3SV3A 4CZKA 4CF9A 2KFZA 3VTIA 4BVOA 3DI6A 4NLBA 4FM0A 1Y97A 4FK2A 3J8AA 4GMJB 1NBWA 3ENBA 3VETA 3W0LA 2A41A 3MEEA 1NGIA 4CEDA 3C6UA 3CCUN 3OJUA 3CJ1A 4IFYA 4NCGA 1LWCA 4FWQA 1WBDA 1Y64A 4CHZA 5HROA 2IAJA 1K8KA 2HNDA 2E4LA 3IFRA 4HTLA 3P5JA 4LFBK 1NGFA 2KHOA 4RTFD 1H1VA 3O1WA 4CJRA 2Q36A 1RBTA 4JKHA 1J6ZA 4DFPA 1VQMN 1NGJA 3VQ4A 2VCPA 3U8XA 2FBVA 2QWLA 1BQMA 4KO0A 3LZJA 4F3OA 4DKWA 4H5WA 1TYQA 3OYIA 5F0XA 1HKBA 3OYFA 4OX9K 2D0CA 2Q2RA 4G1QA 4OPKA 1RBVA 3C6HA 3SUOA 1MWKA 1YF5L 3T69A 4J2DA 4DR7K 4BE2A 4WYBA 3WEEA 1Q9YA 3C6TA 4JKAA 3HOSA 4X64K 1U45A 3RMBA 4O44A 1C6VA 1WBBA 1T3VA 1K6YA 4RW4A 3JSMA 5SZTA 1Q81O 2V7YA 1VSJA 3LDSA 3U3GA 5C2DA 3CQ8A 3DXKB 3OYAA 2KZZA 3V9SA 3VN5A 3PY8A 4KI6A 3PSFA 4PUOA 3RTVA 4DSEA 4OKJA 1GLBG 4B3OA 2OPQA 2O8DB 1QVGM 1QSYA 4JV5K 3KLFA 1BU6O 3MX2A 2XY8A 4KHUA 4N5SA 1BI4A 1BA1A 2IDOA 4O8KA 1C0MA 3SPYA 3V4IA 2BH1A 3VERA 4BDPA 1VSIA 3ZETA 1NM1A 4DQIA 5AQQA 3VQPA 1NGBA 4GV9A 4RWTA 3SUPA 1YIJN 3TARA 3EY1A 4B9VA 2G8IA 3HSTB 4NB4A 1YITN 1OH5A 1IBLK 1M1KO 3CFRA 2ZQBA 2FBTA 3K57A 1RTHA 4A61A 4GVEA 3VQ8A 2ETJA 5J1EA 2VWJA 3NH2A 4IKFA 4DSKA 4ILJA 1RILA 4JI1K 1YJNN 3KLHA 3LAMA 1D8YA 1IJJA 3ULEB 1VHXA 3QEWA 3HSCA 3TWHA 4QS9A 1RDWX 4OPJA 4DV5K 2HNYA 3VQ5A 4B08A 2HHHK 3RMAA 4NCBA 3KHYA 1RTDA 5JICA 2YHBA 2NRZA 5KTQA 4QAGA 1JLCA 4M3UA 5C2FA 2OTLN 2HHIA 3S41A 5CE3A 3O4QA 1C0FA 2YNGA 2VQFK 3EE8A 4JI0K 3D2FA 4M3YA 1WSHA 3TAGA 4WE1A 1S22A 4ISFA 2O8BA 2D4WA 3AVHA 3QEVA 5AQLA 4CZEA 3GE1A 4NYFA 5CR4A 2YHAA 2HBJA 1W7AA 2D0BA 3OBWA 3HZ6A 2NNWA 4RW7A 4FJXA 3CQXA 3KK1A 4CE9A 3CCSN 2P9SA 4CGJA 4MDAA 4FZXC 1D5AA 3A5MC 1U4BA 1XI1A 4BRPA 2QXFA 4O0IA 4JKGB 3SMPA 4M3ZA 1TAUA 4NYNA 4CHNA 2E88A 3U3YA 3ITHA 3F73A 4A2AA 3WNEA 4BR7A 4N41A 4R5PA 3U9ZA 3D0PA 3CYMA 3WXMB 3DLEA 4CVNE 1NK4A 3V1RA 2E1ZA 1ZBFA 1JXBA 2P9IA 2QWRA 3VEWA 2P5GA 2F4VK 1GLDG 4CEFA 4H5NA 1JKHA 2DTUA 4FJJA 4FJNA 4PQUA 4FW2A 3R9PA 4M3WA 2WFBA 4MDBA 3AO1A 3CCEN 2XY6A 4BG9A 3LM9A 2QK9A 2QW9A 1RBUA 3CYGA 3ZEUA 4BC5A 4HHTA 2ZJRL 1JL2A 2XRIA 1M90O 2CH6A 4ID1A 1KAXA 3OY9A 2QA4N 3V9UA 5FLXO 4O8UA 4WFAL 5T7BA 1LWEA 3OYMA 4DTRA 4JD2A 4WQ4A 1GLCG 3SK3A 2HHSA 4FJ9A 1SAZA 1IH7A 4JKFA 5AZJA 4ELTA 5AQSA 3KD5E 4CI6A 1Q86O 3ENOA 1VQ8N 5MLCQ 2FSJA 1NMDA 4FLTA 5FRMA 3SNNA 4H5VA 4KHQA 4DS5A 4YY3K 1X9MA 2IC3A 5LMUK 3AA4A 4K25A 3VQDA 5CYQA 3ULDA 3G0ZA 2BE2A 1EKEA 3VENA 4DQQA 1SKWA 1RT2A 2B5JA 3O9TA 4OPAA 3MN6A 1S72N 2YJEA 4FJIA 4YFUA 2VG7A 3TAFA 1YHQN 2CH5A 5DK5A 3V1QA 5HRSA 1SL2A 1NK7A 3CJBA 3AVKA 4IFEA 3HP6A 4FLVA 3NF8A 3M8QA 4I2PA 3QERA 4E19A 1S9EA 1Q8IA 1I94K 4DTNA 2YCHA 2YKMA 4FOEA 2X74A 4CK1A 3KZBA 2YX6A 1X9JA 2QXLA 1HJRA 2HB5A 3ZSRA 5H1SQ 3BZKA 2HOEA 3DXMB 5FROA 1BL3A 4CGFA 3M8PA 4CZJA 4BR2A 4X65K 4DV2K 2B4JA 2QWPA 4CFAA 4DG1A 4JS4A 4BROA 4LF9K 4CEOA 3KVGA 2RKIA 1IO2A 1LAWA 5DMRA 4E7HA 1B92A 1BDGA 1D9FA 4FJHA 4BVPA 1KFDA 1CLQA 3OYGA 3O3HA 3VQQA 5BRFA 4KTZA 4U67L 5BRHA 3KK7A 4DV0K 3LM2A 3I0SA 4C8MA 3FZLA 4YORA 4BC4A 4IO9L 1N32K 1HJOA 4BE0A 3QICA 2EHGA 3P1GA 4DR3K 1BIZA 3QNOA 2GUIA 3MCAB 5E26A 4E1MA 5F1XA 4H5TA 1X9SA 4NXMK 3KTQA 1D4XA 3IMXA 1GLJO 3VA0A 5KPZA 3M3ZA 4LH4A 2G8HA 2UXBK 4JKBA 3KD1E 4FW1A 5AQIA 5GADP 1L3UA 4YHHK 4HUGA 4DTUA 3T1HK 3QBWA 4DS4A 3VEXA 4FJKA 2D1KA 2PYJA 3VQBA 5E41A 3CF5L 1IBKK 1NGEA 3AVGA 1E4FT 4CZLA 1NKBA 2ITMA 3H45C 3LL3A 4DQPA 4CJEA 1JXEA 3GBTA 1J5OA 1ASVA 1NWKA 4AHVA 2O4GA 3I56N 3DLKA 4Z94A 4DHYA 3CJAA 2IIRA 2G8VA 2WTUA 4AILC 3KIOA 2AJQA 2KQ2A 3RRHA 1QSLA 3IRXA 3LP1A 3VGKA 2O8EB 1S1XA 4CD3A 5GIPA 3FZFA 4FWNA 4DQSA 4DU1A 3NVKA 3AY9A 1TAQA 1VAZA 1L3TA 4E89A 1RTIA 1T6DA 5D3GA 3TAMA 2HBMA 4E7KA 4K43A 4GY2B 2GWKA 3VEYA 4CIFA 5GAEP 4DSFA 1OVYA 2ASPA 2HF3A 4C8OA 1KRPA 2QWNA 4BR0A 3JYTA 2FBXA 4FPBA 3VEVA 2WONA 3NFAA 3QBXA 5BREA 4A62A 1UOCA 3THYB 2HHQA 2P9UB 5C24A 3MEGA 4YOTA 1WSIA 4EZ9A 1S1TA 3DAWA 1S9GA 5EX5A 1C0GA 3K0SA 4F2SA 1NK9A 1KC8O 4JI7K 4FYDA 2HHWA 1JLFA 2E1YA 3WQTA 4LSNA 1K8AO 1DT9A 2Y1IA 3EYZA 5AQVA 2Y1JA 4CF8A 3CJ7A 5AFUA 4XH5A 3H6EA 2Q31A 3Q7BA 3THXB 1T7PA 1MDUB 3C65A 5LJVA 4YNQA 1WSGA 1IKWA 5M1NA 1L3VA 2IGIA 3TPQA 2O8FA 3ZSZA 4BC2A 3HM8A 3O80A 4XJXA 2HW3A 1REVA 5IWAK 1KVAA 3NDKA 3MXJA 1BO5O 2X6NA 4BGBA 3P31A 2P9NA 4E1NA 3F9KA 2QM1A 4IWVA 1JLBA 2QKBA 3VMFB 1VRUA 5LMNK 4PL7A 2HVIA 4EHTA 4IG0A 5E84A 4NLCA 4LF8K 4OLAA 5KPTA 2ZWHA 4GKKK 5AQOA 4KH5A 1XC3A 3TSUA 2I7PA 2OPRA 4DV6K 2KKZA 3KWGA 1QQOA 3ZSVA 3WNGA 3ZX0A 3SI6A 4UY8O 4WQ4C 3RMDA 1WUAA 3M8SA 5M1PA 2P9LA 2OYQA 4E3SA 1RT6A 1F21A 5I9EB 4DFJA 2C1IA 3OS2A 2F8SA 3ZYYX 2UUCK 4C23A 3AO4A 1QE1A 1NKCA 3DLRA 3IG1A 3I8DA 2P51A 1FK9A 2Z1HA 3AVFA 4M63C 3NMUA 3CXCM 4Z4GA 3MN7A 4ISEA 2NRWA 3LALA 4O5FA 5ADXA 4JI8K 2HBLA 3P39A 2ZD1A 1ATSA 2DFHA 3UKRB 2IVOA 3FFIA 5SWMA 2G8KA 4H0VB 3AVNA 2I5JA 4AHUA 4JK9A 4CBUA 3O6WA 1EO1A 4DQRA 1NOYA 3OA9A 4A59A 4CK2A 4K0KK 4JK8A 1Q18A 4B9UA 3O9QA 3ALYA 4KKOA 1LCUA 3ZT4A 2ZJQL 3SZ2A 3TAPA 3MX5A 4DSJA 5M1KA 2GUPA 2Z1IA 3PO4A 3P83D 5LY3A 4Z4FA 1KAYA 3CCVN 4R79A 1JCEA 3H3NO 3BP8A 1TK0A 2UU9K 3DYAA 2ZM6K 3SBTA 3WUHA 4X62K 2DY4A 4DQ8A 3T3FA 4K41A 3NCIA 5KPRA 3R8EA 3C95A 3DLBA 3RVCA 5AQJA 3T1YK 4CCHA 4CZHA 2P1JA 4CF2A 2IS3A 3L2RA 4O0JA 5C10A 5JVGL 1HNXK 3U6FA 4WFNL 2Q3SA 2GX9A 1EWRA 4YOWA 4CEQA 2UUAK 2OZMA 4ID5A 4OO1J 3MWPA 3DXKA 1NOZA 3HT3A 3SQ1A 4KHSA 3CFOA 1CZBA 1YTUA 3HVTA 3VEOA 1HKCA 4CJFA 2YHWA 1S3XA 3KLIA 4A57A 2HHXA 4RCHA 4F3TA 2GELA 1HPMA 2VG5A 5AR0A 4CJPA 3QO9A 1Q9XA 1XUPO 2FXUA 1GLEG 1NK6A 1HLUA 1WSJA 3BY5A 3LPTA 1KVBA 1JLEA 3PIPL 1EETA 3TANA
chains in the Genus database with same CATH topology
4PL8A 3EO3A 3C7NA 4A2AA 4BR7A 1TUYA 3U9ZA 3HRGA 4M7YA 3RSEB 5KQDA 2E2OA 4C1NI 3H1QA 3WXMB 1EQYA 2E1ZA 3EN9A 1VQNN 3IUCA 1VQ6N 4A2BA 2V7ZA 1P8ZA 2P9IA 4QS8A 4WQ5A 3O1BA 3TSPA 4H0TB 4CZIA 3JS6A 4AM7A 5HOOA 2QWRA 3UKRA 3EL2A 3TTDA 3EKUA 1GLDG 3VEWA 3T7ZA 1KXPA 4H5NA 3SMSA 3AAPA 5AZIB 3BF1A 1T44A 1SS6A 3GL1A 3R9PA 1QZ6A 2WFBA 3FZKA 4MDBA 3JXUA 3CCEN 2AP1A 4BRDA 1LOTB 4BG9A 3QFPA 3LM9A 1NGHA 3SJHA 2QW9A 1MA9B 1YXQA 4YDUC 4BRKA 3ZEUA 1DGKN 4BC5A 2ZJRL 1RDUA 2DPNA 3B8AX 1QQNA 2CH6A 2ZJPL 1N8RO 1W2BM 1M90O 4XEIA 1KAXA 3A8YA 5BN8A 2WC9A 2QA4N 3L0QA 4O8UA 3VEZA 4WFAL 4FOIA 3L4QA 4JD2A 4G9ZA 1G99A 3LDQA 1ZC6A 2QWOA 3HOTA 3CCMN 3ULEA 1GLCG 2I7NA 1QQMA 4WQ4A 3SK3A 2NRTA 3CETA 4PHTX 1SAZA 5AZJA 4JKFA 3HI0A 3AGRA 5FPDA 5BPMA 4FWSA 3A5NC 2P9LB 4IJAA 1BUPA 5AQSA 4JHDA 4CI6A 1Q86O 5BN9A 3ID6A 1YUWA 3ENOA 5KQ8A 3VGMA 5BRDA 3CIPA 1VQ8N 5MLCQ 2FSJA 4Y0WA 2CGJA 1NMDA 3A5LC 3WT0A 4CBWA 4XH4A 4DCHA 1VQ5N 2C1GA 1IG8A 4H5VA 4MLHA 2IVNA 2CGLA 3Q7CA 3KWIA 1JCGA 3H1VX 4IXCA 3TU5A 4NO7A 4K25A 1VQKN 3BUZB 3O9SA 2AA4A 3L6QA 3IKMA 4CZFA 4YOXA 3G6EN 4BRNA 3E1YA 3VENA 2HSTA 4BRQA 3O9TA 3GG4A 4OPAA 3MN6A 4F9OA 1X3MA 2YJEA 1S72N 4U7BA 3DLLL 3TSQA 1YHQN 4BREA 3CJCA 2CH5A 4BRGA 3I8BA 3CC2N 2QEXN 2A42A 3CJBA 4H03B 4JNEA 2Q0RA 4IFEA 5AQUA 2VGMA 3M6GA 3PIOL 2HBKA 5AQXA 4YOUA 1YI2N 4A5AA 3D2EB 3VTHA 4B1ZA 2YCHA 3GOIA 3D6RA 4FO0A 4FOEA 3OW2M 3KZBA 2YX6A 2FLOA 4IJNA 1X9JA 1YAGA 2QXLA 3TTCA 2NZTA 4I6MB 1ILYA 5AQZA 5H1SQ 2D0PA 2A40A 2HOEA 4H5RA 5JLHA 3DXMB 1Z6RA 5AQWA 3VESA 2GWJA 4CZJA 3CQYA 3WXJA 1KAZA 4BR2A 1BG3A 5JLFA 5EOYA 4EIAA 4WFBL 2QWPA 3WQUA 1YJ9N 2BUPA 3E9PA 2NRHA 4BROA 1YVNA 2E2QA 1NGAA 4JKGA 4BGAA 3KVGA 3VPZA 2GEMA 3IDHA 3O9UA 3ENHA 3UB5A 5DM7L 4IDHA 4JKDA 1BDGA 5AQMA 3BF3A 5FPMA 1NGCA 4BVPA 5BPNA 1K8KB 5TKWA 5BRFA 3CCQN 1GLFO 4U67L 5BRHA 3A0IX 4B1XB 2QWQA 2KLAA 5AQNA 3CPWM 3KK7A 1RFQA 3LM2A 3FZLA 4YORA 4BC4A 4IO9L 1HJOA 2W41A 3QICA 3QDKA 4H0YB 3SAGA 3DWLA 3O8MA 2FF3B 3A5OC 4FVUA 3MCAB 4CBXA 3D2FB 5E26A 4MLEA 3W3DA 1K9MO 2E2PA 5EVZA 5F1XA 4IOAL 4H5TA 5CHIA 3U9DA 1VQ4N 1TYQB 4BEBA 3LDNA 2P9PB 1D4XA 3IMXA 1QVFM 3D7EO 1GLJO 5KPZA 3M3ZA 2NRXA 4JKBA 5AQIA 4BRIA 5GADP 5C0YA 2EWSA 3CERA 2JWKA 4JN4A 5GAGP 3F5TA 1VQ9N 3ZX2A 1V4SA 4BR9A 3QBWA 3VEXA 3P4IA 2D1KA 3SAHA 2P9NB 3UKUB 3TTFA 2PAVA 3CF5L 3CMEN 2YHXA 4GV3A 1V4TA 1NGEA 2YJFA 3I55N 3ATVA 1QZ5A 1E4FT 4CZLA 2ITMA 3H45C 3LL3A 3NVMA 5GAHP 1VQLN 4IO8A 1ESVA 4FWOA 4CZMA 3SAFA 3GBTA 2ZGZA 3G71N 1NWKA 5ELZA 1RGIA 3VGLA 4IOXA 3I56N 5BPLA 4Z94A 3K9KA 3CJAA 3O08A 2ASMA 3FLCO 2IIRA 4DHYA 4OO1J 1U2VB 1KQSM 4BRLA 3OBYA 3FGUA 2FSKA 4KH6A 1Q7YO 2BTFA 1ATNA 3LDOA 4GNIA 1OKJA 3R6MA 2A6AA 2OTJN 2V52B 5M1QA 3VGKA 4BRMA 4EAHD 3ZX3A 5GIPA 4JKCA 4CD3A 4H0PA 3FZFA 4BQZA 4FWNA 3AAQA 3EZWA 4PKHA 2QI2A 3CPEA 4PKGA 4BRAA 2CGKA 3NVKA 3AY9A 3MN5A 4IEIA 1VAZA 2ZGYA 2A3ZA 3ZETB 4XH1A 4BR4A 1T6DA 5C15A 1K73O 2HBMA 1NGGA 2GTDA 3FZHA 4CJ7A 4YOVA 3CMAN 4K43A 4GY2B 4BRFA 2GWKA 4IEEA 2J4RA 2VWBA 4C1NK 3VEYA 4BRHA 4EHUA 4YDUA 5GAEP 3O5BA 1OVYA 4AM6A 2ASPA 2H3GX 2HF3A 1VQON 3MWTA 4I6MA 5AQFA 2QWNA 4BR0A 5HL7L 2WBNA 4BECA 3DXMA 1BA0A 4FSVA 2Q1NA 3QB0A 5FPEA 4FPBA 1GLLO 3UE5A 2E2NA 3VEVA 4CZKA 2JWLA 1KD1O 3N4PA 3QBXA 4H0OA 3E9OA 5AQHA 3VTIA 3J7ZO 4BVOA 5BREA 4NLBA 4A62A 5EY4A 3J8AA 3W0LA 1NBWA 3ENBA 3VETA 5AZJB 2A41A 2P9UB 3ATUA 1NGIA 3CCUN 3CJ1A 4L3QA 2P9KB 2ASOA 4ISGA 4FWQA 4YOTA 3CC7N 3M1FA 1CZAN 1Y64A 3DAWA 3AARA 5B8HA 5EX5A 2NLXA 1C0GA 1K8KA 2UYTA 3VF4A 3IFRA 3CCRN 4HTLA 4AF1A 3CCLN 3OHRA 1NGFA 2KHOA 1KC8O 4RTFD 4OPHA 1H1VA 3O1WA 2E1YA 3WQTA 4QS7A 2Q36A 4JKHA 1J6ZA 1K8AO 1DT9A 1VQMN 1NGJA 4LC9B 5AQVA 3HBTA 4H0XB 3CJ7A 5AFUA 2VCPA 3LDPA 4XH5A 3H6EA 2Q31A 3Q7BA 2E20A 2QWLA 3BEXA 3U8XA 1MDUB 2OANA 2HMPA 2RE2A 2ZF5O 3C65A 3N4QA 4HWIA 3SLCA 3R3LA 5LJVA 4J8FA 5AQTA 2W00A 2F7TA 4H5WA 4DKWA 1TYQA 3QFUA 2P9PA 5F0XA 3RSEA 5M1NA 3TPQA 5AQGA 3PLAA 1HKBA 5AQRA 4BC2A 3HM8A 3O80A 4ILGB 4BC3A 2Q2RA 4XJXA 4FPAA 1T6CA 3C6HA 4WQ5C 1MWKA 1YF5L 2FSNA 3ID8A 3T69A 4JKEA 3VF6A 4WYBA 1BO5O 3VOVA 3WEEA 2YHYA 4BGBA 5AZIA 3P31A 2P9NA 4JKAA 3O4WA 3HOSA 2PFUA 2QM1A 4IWVA 5FPNA 2F9TA 3G4SN 3VMFB 4FWMA 4JEPA 1Q82O 1T3VA 4PL7A 1ZXOA 1VQ7N 5TKYA 1ATRA 3CCJN 4BQLA 4EHTA 5DM6L 1Q81O 4FWPA 2V7YA 5E84A 2A5XA 4WF9L 1O13A 4NLCA 3H46O 5C2DA 3L4IA 5KPTA 4K42A 3DXKB 2ZWHA 3DJCA 1MWMA 5AQOA 4KH5A 2V51B 2PBDA 1XC3A 3TSUA 2I7PA 2HF4A 2KKZA 3KWGA 1QQOA 4YOYA 3ZX0A 1U2VA 4UY8O 3MDQA 4WQ4C 4BY9C 4BRCA 5AQPA 1GLBG 2P9SB 3WEEB 1WUAA 5M1PA 1X3NA 2VYPA 3FZMA 2P9LA 1NGDA 1QVGM 5GIOA 4FWRA 1BU6O 3MX2A 4KH4A 5I9EB 2C1IA 2YI1A 1BA1A 4O8KA 3ZYYX 2FF6A 3CD6N 4FL9A 4C23A 2BH1A 3VERA 3ZETA 3C7NB 1NM1A 3CHWA 5JVHL 5AQQA 1NGBA 2RHKA 4M63C 3NMUA 4GV9A 4RWTA 1YIJN 3R1XA 3CXCM 3MN7A 4ISEA 2NRWA 4O5FA 3WXLA 5ADXA 3F2KA 3C0BA 4GV6A 2HBLA 3P39A 3O9RA 1ATSA 4EFHA 4IZ9A 2P9IB 5AQKA 1QHAA 5GINA 3UKRB 2IVOA 3U4LA 4B1VA 5M1FA 4WCEL 1JCFA 3FFKB 3FR0A 4B1WB 3MMVA 4H0VB 4NB4A 3MCPA 3D2EA 2NRRA 2W40A 4JK9A 1YITN 5F2RA 4CBUA 3O6WA 1M1KO 1EO1A 1WOQA 2P9UA 3OA9A 4A59A 1XQSC 3ZEUB 2P9KA 4JK8A 4BE7B 1Q18A 4GVEA 4MO4A 4A61A 5AFUH 3O9QA 4ILJA 2ZJQL 1LCUA 3MX5A 1SQKA 1YJNN 5M1KA 2GUPA 4JD2B 5JMVA 1IJJA 3WXIA 3ULEB 5LY3A 1DEJA 1KAYA 4DB3A 2D0OA 3HSCA 3CCVN 4IOCL 4R79A 5BR9A 1JCEA 1RDWX 1HUXA 3H3NO 3BP8A 4QS9A 4JAXA 4JHDB 5AQYA 3KHYA 3SBTA 1Z05A 3G25A 3WUHA 1U6ZA 3AGKA 5JICA 4DQ8A 3E66A 3CI5A 4B1UB 2Q0UA 1JJ2M 4K41A 5KPRA 5M1OA 3EE9A 2NRZA 3P38A 3H3OB 4E1JA 3R8EA 1P90A 5EXWA 5C2FA 1W97L 2F9WA 2OTLN 3RVCA 1HKGA 3S41A 5AQJA 4A5BA 5CE3A 2QTDA 4BG8A 1C0FA 3EE8A 4CZHA 3D2FA 3EKSA 1ZBSA 1R59O 4CD1A 5C10A 5JVGL 1TUUA 4WFNL 1S22A 4ISFA 1GLAG 2GX9A 3K9JA 4BR5A 4M7XA 2NRVA 4FWKA 3M5RA 2D4WA 4KBOA 4B9QA 4YOWA 1SZ2A 3MN9A 4MO5A 5AQLA 5LJWA 2QWMA 4CZGA 4CZEA 3GE1A 1NJIO 1E4GT 2HBJA 1BOTO 3DXKA 3MWPA 4ILHA 4FWLA 5CR4A 3OBWA 3HZ6A 2NNWA 2E8AA 1DKGD 3VEOA 1HKCA 4B1YB 3UKUA 3SBGA 3F9MA 3MK6A 3QMLA 3CQXA 2YHWA 2WUSA 1S3XA 3E9LA 3CCSN 3GDQA 1BWFO 3WXKA 2P9SA 3LDLA 4PKIA 4A57A 3HTVA 4MDAA 3C6AA 4RCHA 2GELA 3CJ9A 3A5MC 1HPMA 5AR0A 3VF2A 4BRPA 5ADXH 1VQPN 1XUPO 3FE1A 2FXUA 3CC4N 1YJWN 1GLEG 2IVPA 2Q97A 4JKGB 3SMPA 1HLUA 2VGNA 3I33A 1NLVA 2E88A 3PIPL 4JK7A 1HX1A 5C12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PL8 A;  3EO3 A;  3C7N A;  4A2A A;  4BR7 A;  1TUY A;  3U9Z A;  4M7Y A;  3RSE B;  5KQD A;  2E2O A;  3H1Q A;  1EQY A;  2E1Z A;  3EN9 A;  3IUC A;  4A2B A;  2V7Z A;  1P8Z A;  2P9I A;  4QS8 A;  4WQ5 A;  3O1B A;  4H0T B;  4CZI A;  3JS6 A;  4AM7 A;  2QWR A;  3UKR A;  3EL2 A;  3VEW A;  3EKU A;  1GLD G;  3WEE B;  1KXP A;  4H5N A;  3SMS A;  3AAP A;  5AZI B;  3BF1 A;  1T44 A;  3R9P A;  3GL1 A;  1QZ6 A;  3FZK A;  3JXU A;  2AP1 A;  4BRD A;  1LOT B;  4BG9 A;  3QFP A;  3LM9 A;  1NGH A;  3SJH A;  2QW9 A;  1MA9 B;  1YXQ A;  4YDU C;  4BRK A;  3ZEU A;  1DGK N;  4BC5 A;  2DPN A;  3B8A X;  1QQN A;  2CH6 A;  4XEI A;  1KAX A;  3A8Y A;  5BN8 A;  3L0Q A;  3VEZ A;  4FOI A;  4JD2 A;  1G99 A;  3LDQ A;  1ZC6 A;  2QWO A;  3ULE A;  1GLC G;  2I7N A;  1QQM A;  4WQ4 A;  3SK3 A;  3CET A;  1SAZ A;  5AZJ A;  3HI0 A;  5FPD A;  5BPM A;  4FWS A;  3A5N C;  2P9L B;  4IJA A;  1BUP A;  5AQS A;  4JHD A;  4CI6 A;  5BN9 A;  1YUW A;  3ENO A;  5KQ8 A;  3VGM A;  5BRD A;  3CIP A;  2FSJ A;  4Y0W A;  2CGJ A;  1NMD A;  3A5L C;  3WT0 A;  4CBW A;  4XH4 A;  4DCH A;  1IG8 A;  4H5V A;  4MLH A;  2IVN A;  2CGL A;  1JCG A;  3H1V X;  4IXC A;  3TU5 A;  4NO7 A;  4K25 A;  3BUZ B;  2AA4 A;  3L6Q A;  4CZF A;  4BRN A;  3VEN A;  4BRQ A;  3GG4 A;  4F9O A;  3MN6 A;  1X3M A;  2YJE A;  4BRE A;  3CJC A;  2CH5 A;  4BRG A;  3I8B A;  2A42 A;  3CJB A;  4H03 B;  4JNE A;  2Q0R A;  5AQU A;  3M6G A;  5AQX A;  3D2E B;  4B1Z A;  2YCH A;  3GOI A;  4FOE A;  4FO0 A;  3KZB A;  2FLO A;  4IJN A;  1X9J A;  1YAG A;  2QXL A;  2NZT A;  4I6M B;  5AQZ A;  2D0P A;  2A40 A;  2HOE A;  4H5R A;  5JLH A;  3DXM B;  1Z6R A;  5AQW A;  3VES A;  2GWJ A;  4CZJ A;  3CQY A;  3WXJ A;  1KAZ A;  4BR2 A;  1BG3 A;  5JLF A;  5EOY A;  4EIA A;  2QWP A;  3WQU A;  2BUP A;  2NRH A;  4BRO A;  1YVN A;  2E2Q A;  1NGA A;  4BGA A;  3KVG A;  3VPZ A;  2GEM A;  3IDH A;  3ENH A;  3UB5 A;  1BDG A;  5AQM A;  3BF3 A;  5FPM A;  1NGC A;  4BVP A;  5BPN A;  1K8K B;  5BRF A;  1GLF O;  5BRH A;  3A0I X;  4B1X B;  2QWQ A;  5AQN A;  1RFQ A;  3LM2 A;  3FZL A;  4BC4 A;  1HJO A;  2W41 A;  3QIC A;  3QDK A;  4H0Y B;  3DWL A;  3O8M A;  2FF3 B;  3A5O C;  4CBX A;  3D2F B;  5E26 A;  4MLE A;  3W3D A;  2E2P A;  5EVZ A;  5F1X A;  4H5T A;  3U9D A;  1TYQ B;  3LDN A;  2P9P B;  1D4X A;  3IMX A;  3D7E O;  1GLJ O;  5KPZ A;  3M3Z A;  5AQI A;  4BRI A;  2EWS A;  3CER A;  4JN4 A;  3ZX2 A;  1V4S A;  4BR9 A;  3QBW A;  3VEX A;  3P4I A;  2D1K A;  2P9N B;  3UKU B;  2PAV A;  2YHX A;  1V4T A;  1NGE A;  2YJF A;  3ATV A;  1QZ5 A;  1E4F T;  4CZL A;  2ITM A;  3H45 C;  3LL3 A;  4IO8 A;  1ESV A;  4FWO A;  4CZM A;  3GBT A;  2ZGZ A;  1NWK A;  5ELZ A;  1RGI A;  3VGL A;  5BPL A;  4Z94 A;  4DHY A;  3CJA A;  3O08 A;  2ASM A;  3FLC O;  2IIR A;  1U2V B;  4BRL A;  3FGU A;  2FSK A;  2BTF A;  1ATN A;  3LDO A;  4GNI A;  1OKJ A;  3R6M A;  2A6A A;  2V52 B;  3VGK A;  4BRM A;  4EAH D;  3ZX3 A;  4CD3 A;  4H0P A;  3FZF A;  4BQZ A;  4FWN A;  3AAQ A;  3EZW A;  4PKH A;  4BRA A;  4PKG A;  2CGK A;  3AY9 A;  3MN5 A;  2ZGY A;  2A3Z A;  3ZET B;  4XH1 A;  4BR4 A;  1T6D A;  1NGG A;  2GTD A;  3FZH A;  4CJ7 A;  4K43 A;  4GY2 B;  4BRF A;  2GWK A;  2J4R A;  2VWB A;  3VEY A;  4BRH A;  4EHU A;  4YDU A;  3O5B A;  4AM6 A;  2ASP A;  2H3G X;  2HF3 A;  4I6M A;  5AQF A;  2QWN A;  4BR0 A;  3DXM A;  1BA0 A;  4FSV A;  2Q1N A;  3QB0 A;  5FPE A;  4FPB A;  1GLL O;  3UE5 A;  2E2N A;  3VEV A;  4CZK A;  3QBX A;  4H0O A;  5AQH A;  4BVO A;  5BRE A;  4A62 A;  5EY4 A;  3J8A A;  3W0L A;  1NBW A;  3VET A;  5AZJ B;  2A41 A;  2P9U B;  3ATU A;  1NGI A;  3CJ1 A;  4L3Q A;  2P9K B;  2ASO A;  4ISG A;  4FWQ A;  3M1F A;  1CZA N;  1Y64 A;  3DAW A;  3AAR A;  5B8H A;  5EX5 A;  2NLX A;  1C0G A;  1K8K A;  2UYT A;  3VF4 A;  3IFR A;  4HTL A;  3OHR A;  1NGF A;  2KHO A;  4RTF D;  1H1V A;  3O1W A;  2E1Y A;  3WQT A;  4QS7 A;  2Q36 A;  1J6Z A;  1NGJ A;  4LC9 B;  5AQV A;  3HBT A;  4H0X B;  3CJ7 A;  5AFU A;  2VCP A;  3LDP A;  4XH5 A;  3H6E A;  2Q31 A;  3U8X A;  2E20 A;  2QWL A;  3BEX A;  1MDU B;  2OAN A;  2HMP A;  2ZF5 O;  4HWI A;  3SLC A;  5LJV A;  4J8F A;  5AQT A;  4H5W A;  1TYQ A;  3QFU A;  2P9P A;  5F0X A;  3RSE A;  3TPQ A;  5AQG A;  1HKB A;  5AQR A;  4BC2 A;  3HM8 A;  3O80 A;  4BC3 A;  2Q2R A;  4FPA A;  1T6C A;  4WQ5 C;  1MWK A;  3ID8 A;  2FSN A;  3VF6 A;  3VOV A;  4WYB A;  1BO5 O;  3WEE A;  2YHY A;  4BGB A;  5AZI A;  2P9N A;  3O4W A;  2QM1 A;  4IWV A;  5FPN A;  2F9T A;  4FWM A;  4PL7 A;  1ZXO A;  5TKY A;  1ATR A;  4BQL A;  4EHT A;  4FWP A;  2V7Y A;  5E84 A;  2A5X A;  3H46 O;  5KPT A;  3L4I A;  4K42 A;  3DXK B;  2ZWH A;  3DJC A;  1MWM A;  5AQO A;  2V51 B;  2PBD A;  1XC3 A;  2I7P A;  2HF4 A;  1QQO A;  3ZX0 A;  1U2V A;  3MDQ A;  4WQ4 C;  4BRC A;  5AQP A;  1GLB G;  2P9S B;  1WUA A;  1X3N A;  2VYP A;  3FZM A;  2P9L A;  1NGD A;  4FWR A;  1BU6 O;  5I9E B;  2YI1 A;  1BA1 A;  4O8K A;  2FF6 A;  4FL9 A;  4C23 A;  3VER A;  3ZET A;  3C7N B;  1NM1 A;  3CHW A;  5AQQ A;  1NGB A;  4M63 C;  4RWT A;  3MN7 A;  4ISE A;  4O5F A;  3WXL A;  5ADX A;  3C0B A;  4EFH A;  1ATS A;  4IZ9 A;  2P9I B;  5AQK A;  1QHA A;  3UKR B;  2IVO A;  3U4L A;  4B1V A;  1JCF A;  3FFK B;  3FR0 A;  4B1W B;  3MMV A;  4H0V B;  4NB4 A;  3MCP A;  3D2E A;  2W40 A;  5F2R A;  4CBU A;  3O6W A;  1WOQ A;  2P9U A;  1XQS C;  3ZEU B;  2P9K A;  1Q18 A;  4MO4 A;  4A61 A;  5AFU H;  1LCU A;  1SQK A;  2GUP A;  4JD2 B;  5JMV A;  1IJJ A;  3WXI A;  3ULE B;  5LY3 A;  1DEJ A;  1KAY A;  4DB3 A;  2D0O A;  3HSC A;  5BR9 A;  1JCE A;  1RDW X;  1HUX A;  3H3N O;  3BP8 A;  4QS9 A;  4JAX A;  4JHD B;  5AQY A;  3KHY A;  1Z05 A;  3G25 A;  3WUH A;  1U6Z A;  5JIC A;  4DQ8 A;  4B1U B;  3CI5 A;  2Q0U A;  4K41 A;  5KPR A;  3H3O B;  4E1J A;  3R8E A;  5EXW A;  2F9W A;  3S41 A;  1HKG A;  5CE3 A;  5AQJ A;  4BG8 A;  1C0F A;  4CZH A;  3D2F A;  3EKS A;  1ZBS A;  1R59 O;  4CD1 A;  1TUU A;  1S22 A;  4ISF A;  1GLA G;  4BR5 A;  4M7X A;  4FWK A;  4B9Q A;  2D4W A;  4KBO A;  1SZ2 A;  3MN9 A;  4MO5 A;  5AQL A;  5LJW A;  2QWM A;  4CZG A;  4CZE A;  3GE1 A;  1E4G T;  1BOT O;  3DXK A;  4FWL A;  3HZ6 A;  2E8A A;  1DKG D;  3VEO A;  1HKC A;  4B1Y B;  3UKU A;  3F9M A;  3MK6 A;  3QML A;  3CQX A;  2YHW A;  2WUS A;  1S3X A;  3GDQ A;  1BWF O;  3WXK A;  2P9S A;  3LDL A;  4PKI A;  3HTV A;  4RCH A;  2GEL A;  3CJ9 A;  3A5M C;  1HPM A;  5AR0 A;  3VF2 A;  4BRP A;  5ADX H;  1XUP O;  3FE1 A;  2FXU A;  1GLE G;  2IVP A;  2Q97 A;  3SMP A;  1HLU A;  3I33 A;  1NLV A;  2E88 A;  1HX1 A; 
#chains in the Genus database with same CATH topology
 3EO3 A;  1KVC A;  3HO1 A;  3HP9 A;  1TUY A;  4B9L A;  3AVL A;  4M7Y A;  3SQ0 A;  4C1N I;  1WB9 A;  2OZS A;  3DOK A;  1VQN N;  3IUC A;  4FZZ A;  3TSP A;  1XHX A;  3JS6 A;  4LF4 K;  3WEE B;  3EL2 A;  3EKU A;  3T7Z A;  1KXP A;  3OYH A;  3SMS A;  4FJ7 A;  4DF8 A;  3AAP A;  1UA0 A;  3BF1 A;  3BZC A;  4KB0 A;  2XY5 A;  2D5R A;  3GL1 A;  1QZ6 A;  3FZK A;  1LOT B;  3QFP A;  3SJH A;  4DTJ A;  1YXQ A;  4RG8 A;  1DGK N;  1TV6 A;  4I9Q A;  1XNQ K;  3RR7 A;  4BWJ A;  1W2B M;  4XEI A;  3SJJ A;  5BN8 A;  3CFP A;  3VEZ A;  1B9F A;  4KFB A;  3L2U A;  1G99 A;  3LDQ A;  3HOT A;  4DTO A;  4HTU A;  3ULE A;  3AA5 X;  2O8C A;  4PHT X;  1FXX A;  5FPD A;  5C25 A;  4EP4 A;  4FWS A;  4IJA A;  1WLJ A;  5BN9 A;  4CEZ A;  3ID6 A;  5KQ8 A;  4Y0W A;  3WT0 A;  4CBW A;  4DCH A;  1VQ5 N;  1IG8 A;  4MLH A;  4DMN A;  1JCG A;  4LD0 A;  3IAY A;  3LAK A;  1ITG A;  3TU5 A;  3EZ5 A;  3BUZ B;  3IS9 A;  1FKO A;  3E1Y A;  4DV4 K;  2HST A;  4BRQ A;  1X3M A;  3RRG A;  3DLL L;  3CC2 N;  1XWL A;  4H03 B;  4JNE A;  3PIO L;  1KLM A;  3M6G A;  2HBK A;  3ZCM A;  1ASU A;  3TI0 A;  1XHZ A;  1YI2 N;  2G8W A;  4A5A A;  4W5R A;  2GV9 A;  3V9X A;  4B1Z A;  1HRH A;  4IJN A;  1YAG A;  4I6M B;  1ILY A;  2HVH A;  2D0P A;  4H5R A;  3SPZ A;  3AVC A;  3CQY A;  3WXJ A;  2R7Y A;  1S6P A;  1HNV A;  5HRR A;  4WFB L;  2UUB K;  3WQU A;  4W5T A;  3E9P A;  2NRH A;  2E2Q A;  1NGA A;  4JKG A;  3HVR A;  3VPZ A;  3IDH A;  3UB5 A;  4IDH A;  4E7L A;  3SYZ A;  3BF3 A;  5FPM A;  4CHP A;  4CJ5 A;  4CER A;  1WN7 A;  1RBS A;  2QWQ A;  2JGU A;  3ASM A;  5HP1 A;  1RFQ A;  3DWL A;  4DV3 K;  2FF3 B;  3A5O C;  4CBX A;  1VSM A;  3D2F B;  4MLE A;  4J2B A;  5EVZ A;  3NBP A;  4IOA L;  2P9P B;  5HRP A;  2UXC K;  5FRN A;  4DR5 K;  1HR0 K;  4OKE A;  2NRX A;  2YV0 X;  3NF7 A;  3F5T A;  3OTO K;  3ZX2 A;  4B3T K;  1EWQ A;  1SKR A;  3LZI A;  1UA1 A;  3TTF A;  1ZBL A;  2YHX A;  1V4T A;  4JI4 K;  2YJF A;  3HM9 A;  4DFK A;  1QZ5 A;  1EP4 A;  1QQC A;  1JLG A;  5A2Q O;  5GAH P;  1C1B A;  4IO8 A;  1ESV A;  4M3R A;  3SAF A;  2F96 A;  2ZGZ A;  3G71 N;  1RGI A;  1NJZ A;  3VQA A;  2ASM A;  2JLE A;  3FLC O;  1U2V B;  1KQS M;  3LPU A;  3OBY A;  4CJW A;  3FGU A;  2OPS A;  3VQE A;  2BTF A;  1ATN A;  4GNI A;  2A6A A;  3LAN A;  5M1Q A;  4KHW A;  3L3V A;  3TAE A;  2QI2 A;  3CPE A;  4PKG A;  3DOL A;  2CGK A;  2HHT A;  4IEI A;  2ZGY A;  4IDK A;  1TKX A;  3QEX A;  1T8E A;  2E5L K;  4XH1 A;  3NE6 A;  1K73 O;  2DFF A;  1R0A A;  3CMA N;  4OLB A;  3NGZ A;  3OYK A;  3V1O A;  4YDU A;  4C8L A;  1VQO N;  1LW2 A;  3MWT A;  5K14 A;  3NGY A;  5HL7 L;  4BEC A;  3DXM A;  4DTX A;  3QB0 A;  4LSL A;  1GLL O;  2E2N A;  2G8F A;  2JWL A;  3N4P A;  4H0O A;  5AQH A;  3E9O A;  3J7Z O;  4Z0U A;  4JRP A;  5HLF A;  3PO5 A;  1W0H A;  4CJQ A;  4LFA K;  4ELU A;  5AZJ B;  4OGE A;  1CXU A;  3ATU A;  4CJU A;  2P9K B;  4QCL A;  3CC7 N;  3M1F A;  1CZA N;  3AAR A;  4FVM A;  3HJF A;  2NLX A;  3LWL A;  4CJS A;  3VF4 A;  3CCL N;  4AF1 A;  4CJ3 A;  4RW9 A;  4BAC A;  4OPH A;  5IT9 O;  4ZTF A;  2PY5 A;  1L5U A;  1NK5 A;  3K5M A;  3K5O A;  4B3R K;  1VSD A;  3HBT A;  4M3X A;  1B9D A;  4H0X B;  3L3U A;  3LDP A;  4LF6 K;  3BEX A;  2OAN A;  2RE2 A;  2HMP A;  2ZF5 O;  3SLC A;  3N4Q A;  1IKX A;  4DLE A;  3R3L A;  4E0D A;  1KTQ A;  4V19 S;  2W00 A;  1NU0 A;  3PX0 A;  3QFU A;  3RSE A;  5AQG A;  3PLA A;  1GOB A;  1U49 A;  1IKY A;  4ILG B;  3AO5 A;  4FPA A;  3NHG A;  1RDB A;  3ID8 A;  2FSN A;  4LF5 K;  3K59 A;  3OYD A;  4KB1 A;  2O4I A;  5AZI A;  4OVL A;  4LY7 A;  2YNI A;  2BDP A;  4ELV A;  3K58 A;  2F9T A;  1Q82 O;  4PWD A;  1ZXO A;  1ATR A;  3JAM O;  3CCJ N;  4BQL A;  2G8U A;  1ZBH A;  4TSX A;  5DM6 L;  2A5X A;  4WF9 L;  1O13 A;  4PA1 A;  3L4I A;  4HVJ A;  4K42 A;  4CJL A;  3DJC A;  1MWM A;  4CGG A;  2V51 B;  2PBD A;  4DV7 K;  2HF4 A;  3VQC A;  2KW4 A;  1HPZ A;  3C94 A;  4Q5V A;  5AQP A;  1VSL A;  1IBM K;  2VYP A;  3FZM A;  1NGD A;  4AHT A;  5GIO A;  4FWR A;  1X1P A;  4KH4 A;  2O8E A;  2KFN A;  2YI1 A;  4EZ6 A;  3B6O A;  1YTA A;  1RDD A;  3CD6 N;  2IOC A;  4L8R B;  3C7N B;  3R1X A;  4X66 K;  4DR6 K;  4N56 A;  3F2K A;  3C0B A;  4GV6 A;  1C0T A;  4CHY A;  3O9R A;  1N33 K;  2QKK A;  1QHA A;  5GIN A;  4OKK A;  3KLG A;  4B1V A;  4WCE L;  1JCF A;  1XMQ K;  3S9H A;  1BGX T;  2KZM A;  3QIO A;  3D2E A;  2W40 A;  3MAQ A;  5F2R A;  3THY A;  3MXI A;  1WOQ A;  2P9U A;  4DTP A;  4W5Q A;  1XMO K;  5AFU H;  1HNZ K;  2XO7 A;  5JS2 A;  3SV4 A;  3SQ2 A;  4DR2 K;  5JMV A;  4Z4I A;  5BR8 K;  1DEJ A;  4DB3 A;  3J7Y P;  4O55 A;  4JHD B;  4FZY A;  3THX A;  3ZSO A;  4DLG A;  4FJ8 A;  1ZYQ A;  1Z05 A;  1U6Z A;  2Q0U A;  3OJS A;  1BCO A;  4B8A B;  1JJ2 M;  3T19 A;  4HUE A;  3EE9 A;  3H3O B;  4E1J A;  3DMJ A;  4FLZ A;  1U47 A;  4A5B A;  4Q0B A;  2QTD A;  5EU7 A;  4CGD A;  3EKS A;  1ZBS A;  4DTS A;  1GLA G;  2A1S A;  3K9J A;  1U04 A;  4BR5 A;  4M7X A;  3J7A P;  4FWK A;  3M5R A;  4B9Q A;  4CEC A;  3MN9 A;  2QWM A;  1NJI O;  4Y1D A;  1E4G T;  1BOT O;  1VSE A;  3KKR A;  4ILH A;  4CJK A;  4CHQ A;  4CIG A;  2YKN A;  3HL8 A;  4B1Y B;  3UKU A;  3SBG A;  3QML A;  4KRE A;  2WUS A;  3E9L A;  3GDQ A;  3LDL A;  4PKI A;  2OPP A;  4FM1 A;  1NNE A;  4DF4 A;  3C6A A;  4FM2 A;  4M41 A;  4B8C A;  3VF2 A;  5ADX H;  1VQP N;  2UXD K;  1YJW N;  2Q97 A;  4DUZ K;  3A2F A;  1RT3 A;  3NGI A;  3LWM A;  4CF1 A;  3L2W A;  5C12 A;  1RCH A;  1LV5 A;  3QES A;  5J2Q A;  1QSS A;  3NH1 A;  5KQD A;  3OVN A;  4H4O A;  1EQY A;  3EN9 A;  1IG9 A;  1VQ6 N;  4A2B A;  1SV5 A;  4QS8 A;  4WQ5 A;  5HOO A;  4CZI A;  3UKR A;  1ZBI A;  1SL0 A;  2XHB A;  4H8K A;  1T44 A;  1SS6 A;  3SUQ A;  1NGH A;  1MA9 B;  1EX4 A;  1C1C A;  4J2A A;  4YDU C;  4BRK A;  1RDU A;  1N8R O;  2ZJP L;  4EP5 A;  1J53 A;  4FOI A;  5KRT A;  2RN2 A;  3L4Q A;  2QWO A;  3CCM N;  1QQM A;  1X9W A;  2NRT A;  3AA2 A;  3HI0 A;  3AGR A;  2PZS A;  3A5N C;  2P9L B;  1BUP A;  4DWI A;  1S1V A;  3NF6 A;  3VGM A;  5BRD A;  2CGJ A;  3LP2 A;  1TKD A;  4XH4 A;  4N47 A;  2CGL A;  3Q7C A;  3KWI A;  4FJL A;  3H1V X;  1OH6 A;  1NMN A;  4CES A;  4JS5 A;  3L6Q A;  3IKM A;  3THW B;  3TAQ A;  4RW6 A;  4DSI A;  3AVM A;  3AVB A;  4I7F A;  2Z1G A;  4F9O A;  3UIQ A;  1HYS A;  4U7B A;  3CJC A;  4BRG A;  2QEX N;  4CHO A;  2VGM A;  4JI6 K;  3DRS A;  3BDP A;  4AH9 A;  1UAX A;  3D6R A;  1HQE A;  5J2N A;  2FLO A;  3HPO A;  4DU4 A;  5HBM A;  4CW7 B;  3TTC A;  3G10 A;  5AQZ A;  1RDA A;  1Z6R A;  1NJW A;  3VES A;  1JL1 A;  2GWJ A;  1KAZ A;  1BG3 A;  3K2P A;  4Z4E A;  3SQ4 A;  5JLF A;  1O1W A;  1YJ9 N;  4NXN K;  1A5X A;  1YVN A;  3OS1 A;  4BGA A;  3S3O A;  4B9S A;  2GEM A;  4CIE A;  2W6L A;  3O9U A;  3ENH A;  2LSN A;  4OGC A;  1N34 K;  5BPN A;  1K8K B;  5TKW A;  3CCQ N;  1GLF O;  2O8D A;  2KLA A;  3CPW M;  3ZT2 A;  3SAG A;  1NKE A;  4H0Y B;  1C0U A;  4CF0 A;  4FVU A;  3W3D A;  3MEC A;  1VSF A;  4IFV A;  2E2P A;  4BDZ A;  4FXD A;  4CFB A;  1HYZ A;  1TYQ B;  4E72 A;  5J2P A;  1N36 K;  3D7E O;  3DM2 A;  1RT7 A;  4BRI A;  5C0Y A;  4Y1C A;  3L2V A;  2JWK A;  3OYE A;  5GAG P;  4BR9 A;  1V4S A;  3EEQ A;  1JLA A;  3HPG A;  1GOA A;  3CME N;  3PSI A;  4O5B A;  3OYJ A;  3ISN C;  3I55 N;  3ATV A;  1NK8 A;  3HPH A;  1VQL N;  5I42 A;  3VGL A;  1N5Y A;  4IOX A;  3VQ6 A;  2P5O A;  3V9W A;  3ZSW A;  4DTM A;  1Q7Y O;  2FSK A;  4C8K A;  1RNH A;  1SUQ A;  1VSK A;  3LDO A;  3R6M A;  3V6D A;  2OTJ N;  4AHS A;  4KTW A;  4BRM A;  1T03 A;  4RW8 A;  3AVI A;  5FDL A;  4KAZ A;  1BI4 B;  3AAQ A;  4OJR A;  3EZW A;  1WSE A;  4C8N A;  4BRA A;  1UWB A;  3AO3 A;  2A3Z A;  3ZET B;  5C15 A;  2GTD A;  3M8R A;  3CM5 A;  5KI6 A;  1W9H A;  4BRF A;  2VWB A;  4C1N K;  3O5B A;  4AM6 A;  2H3G X;  4I6M A;  5AQF A;  4DUY K;  2WBN A;  5FPE A;  4FSV A;  2Q1N A;  3UE5 A;  1LWF A;  1KD1 O;  4JRQ A;  1TL1 A;  1S5J A;  5EY4 A;  4AHR A;  5C42 A;  2O8C B;  1VK0 A;  4B9M A;  3ZSX A;  1RDC A;  4L3Q A;  4O4G A;  2ASO A;  4ISG A;  4UQG A;  4H4M A;  1XC9 A;  4HCC A;  4JI3 K;  4B9T A;  4CEB A;  5B8H A;  1WAJ A;  2UYT A;  3OHR A;  3OYN A;  3NF9 A;  1CZ9 A;  1BQN A;  1NJY A;  4QS7 A;  3ZT0 A;  4LC9 B;  4LF7 K;  4DFM A;  3QIP A;  2E20 A;  3AO2 A;  4HWI A;  1ZBU A;  3PX4 A;  4J8F A;  5AQT A;  2F7T A;  4LFC K;  4Z4H A;  2P9P A;  4ZTJ A;  1HNW K;  5AQR A;  2VG6 A;  1QTM A;  4BC3 A;  4BWM A;  1T6C A;  1TGO A;  4WQ5 C;  4FLX A;  5CY4 A;  4JKE A;  3VF6 A;  3VOV A;  3CG7 A;  3QNN A;  2YHY A;  3S3N A;  3O4W A;  2D0A A;  2PFU A;  3O4N A;  5FPN A;  3G4S N;  2OA8 A;  3E01 A;  1VRT A;  4FWM A;  4JEP A;  1VQ7 N;  3S5T A;  5TKY A;  3OYC A;  2O8B B;  3J81 O;  4FWP A;  3BGR A;  3I0R A;  3H46 O;  2XY7 A;  4JYA K;  4YOY A;  1U2V A;  3MDQ A;  3SUN A;  3VQ7 A;  4BY9 C;  4BRC A;  2P9S B;  2VQE K;  3L2Q A;  1X3N A;  1WSF A;  3LP0 A;  1HQU A;  4B9N A;  2ITG A;  3O3F A;  4CEA A;  4GW6 A;  3MED A;  3ZT3 A;  1KFS A;  2FF6 A;  3RMC A;  4FL9 A;  1NG9 A;  2PYL A;  4K8X A;  2KTQ A;  4CJ4 A;  5JS1 A;  3CHW A;  5JVH L;  1BHL A;  2RHK A;  5AJ3 K;  4W5N A;  4B3S K;  2A1R A;  3QEI A;  3AVA A;  3WXL A;  1TVR A;  4K8Z A;  4EFH A;  5KGW A;  4IZ9 A;  2P9I B;  2Z1J A;  5AQK A;  5KRS A;  5I3U A;  3U4L A;  2NUB A;  2W42 A;  1SKS A;  5M1F A;  3FFK B;  3FR0 A;  3T1A A;  4B1W B;  4FJ5 A;  3MMV A;  3DRP A;  1OVQ A;  3MCP A;  2NRR A;  2X78 A;  1XQS C;  3ZEU B;  2P9K A;  4ICL A;  1OH8 A;  3O3G A;  4BE7 B;  4MO4 A;  3V81 A;  3QLH A;  4FLY A;  3KK2 A;  4GKJ K;  1SQK A;  2HHU A;  1QHT A;  1RBR A;  4JD2 B;  1D9D A;  4NCA A;  3WXI A;  5CYM A;  2B6A A;  1IV0 A;  1QS4 A;  2D0O A;  4IOC L;  5BR9 A;  1HUX A;  3ZSY A;  1G15 A;  2HHV A;  1WAF A;  4JAX A;  1NK0 A;  2E6L A;  5AQY A;  3V9Z A;  4BE1 A;  3G25 A;  3AGK A;  1J9A A;  1IKV A;  3E66 A;  3CI5 A;  4B1U B;  1RT1 A;  3QEP A;  4B3M K;  1MU2 A;  5M1O A;  3P38 A;  2WOM A;  1EXQ A;  4DV1 K;  4FLW A;  1P90 A;  5EXW A;  1W97 L;  2F9W A;  2ATQ A;  1J5E K;  1HKG A;  4BG8 A;  2FC0 A;  4DR1 K;  5CZ2 A;  4CGI A;  1Z25 A;  1R59 O;  4CD1 A;  1TUU A;  2FBY A;  1E3M A;  1YT3 A;  4FJM A;  2NRV A;  1Z26 A;  4KBO A;  1SZ2 A;  1VSH A;  4MO5 A;  5LJW A;  2HMI A;  4CZG A;  4FWL A;  2GBZ A;  1DLO A;  4HCB A;  1S6Q A;  4FLU A;  4FJG A;  2E8A A;  1DKG D;  3PV8 A;  3NH0 A;  3F9M A;  3MK6 A;  1BWF O;  1FJG K;  3WXK A;  3LP3 A;  3HTV A;  3ZSQ A;  3CJ9 A;  1I3A A;  1RT5 A;  1LW0 A;  4J2E A;  3K5L A;  3QET A;  3FE1 A;  3CC4 N;  2IVP A;  1RTJ A;  3S3M A;  2VGN A;  3I33 A;  4BDY A;  1NLV A;  3HXM A;  4JK7 A;  5AQU A;  1HX1 A;  4PL8 A;  3C7N A;  4JLH A;  4AHC A;  3HRG A;  3RSE B;  2E2O A;  3H1Q A;  1ASW A;  4ZHR A;  4CFD A;  4F8R A;  3K5N A;  2V7Z A;  1P8Z A;  3O1B A;  4H0T B;  4AM7 A;  3MXM A;  3TTD A;  5AZI B;  1HMV A;  4KHN A;  3JXU A;  3KLE A;  1FW6 A;  2AP1 A;  4BRD A;  1TKZ A;  1TL3 A;  2BGG A;  3PUF A;  3ZT1 A;  1JLQ A;  2DPN A;  3B8A X;  1QQN A;  3SCX A;  3A8Y A;  2WC9 A;  2YNH A;  4HUF A;  4I2Q A;  3L0Q A;  4KTQ A;  4G9Z A;  3L8B A;  1FKP A;  1ZC6 A;  3CCR N;  4N76 A;  2I7N A;  3CET A;  1N6Q A;  5BPM A;  4IBN A;  4JHD A;  1YUW A;  1J54 A;  2HNZ A;  3CIP A;  1T05 A;  3A5L C;  1BCM A;  2C1G A;  3RR8 A;  4KPY A;  2IVN A;  3D45 A;  3VA3 A;  4FK0 A;  4IXC A;  4NO7 A;  1VQK N;  2VWK A;  3O9S A;  2AA4 A;  4CZF A;  2BAN A;  4YOX A;  3G6E N;  4BRN A;  3TAB A;  1I39 A;  3DLG A;  3AV9 A;  3GG4 A;  3TSQ A;  4BRE A;  3I8B A;  2A42 A;  2Q0R A;  1L3S A;  4DSL A;  1TK8 A;  4DU3 A;  5AQX A;  4KI4 A;  3H08 A;  4YOU A;  3D2E B;  3VTH A;  3GOI A;  3OW2 M;  4FO0 A;  1GOC A;  2YNF A;  2W6K A;  3HYF A;  4DR4 K;  2NZT A;  3OYL A;  4M45 A;  3AVJ A;  2A40 A;  2DFE A;  5JLH A;  4CFC A;  3AA3 A;  5AQW A;  2X6S A;  3PX6 A;  1DTT A;  5EOY A;  4CEE A;  4EIA A;  3VQ9 A;  2BUP A;  4F2R A;  3B6P A;  1C1A A;  3WNH A;  3WNF A;  3CM6 A;  1A5W A;  1HYV A;  5DM7 L;  4M42 A;  4JKD A;  5AQM A;  1A5V A;  1NGC A;  1RT4 A;  3A0I X;  4CJV A;  4B1X B;  5CZ1 A;  5AQN A;  3KKS A;  1CXQ A;  5J2M A;  2OCE A;  4CJT A;  1NJX A;  2W41 A;  3QDK A;  4GVM A;  3O8M A;  1LAV A;  4JI2 K;  1OH7 A;  3NAE A;  1S1U A;  4KHP K;  4MFB A;  1K9M O;  1DTQ A;  5CHI A;  3U9D A;  3TR8 A;  1VQ4 N;  4BEB A;  4KHY A;  3LDN A;  2F8T A;  1KLN A;  1U48 A;  4CK3 A;  1QVF M;  2O8F B;  4F4K A;  1TKT A;  4M3T A;  1HNI A;  5JEN A;  4MQ3 A;  2EWS A;  2EX3 A;  3CER A;  3DLH A;  4JN4 A;  1VQ9 N;  1S1W A;  1SL1 A;  3P4I A;  3SAH A;  1TK5 A;  2P9N B;  3UKU B;  2PAV A;  4FCY A;  4GV3 A;  1KSP A;  2RPI A;  3QIN A;  2E6M A;  3NVM A;  3OYB A;  4CZM A;  4FWO A;  3KK3 A;  3THV A;  5ELZ A;  3ZLJ A;  5HRN A;  5BPL A;  3K9K A;  4Z4C A;  3O08 A;  1XNR K;  4BRL A;  4KH6 A;  3HK2 A;  3J80 O;  2RF2 A;  3OS0 A;  3THW A;  1OKJ A;  2V52 B;  3KJV A;  4QOZ B;  4EAH D;  3ZX3 A;  4JKC A;  4H0P A;  4PY5 A;  1KCF A;  4W5O A;  4BQZ A;  1WNS A;  4PKH A;  4I9L A;  1BIS A;  4KRF A;  3MN5 A;  4KV8 A;  4E7I A;  4AQY K;  4JI5 K;  4XIU A;  4LH5 A;  4BR4 A;  1NGG A;  3FZH A;  4CJ7 A;  4YOV A;  2ZE2 A;  4IEE A;  2J4R A;  4FK4 A;  4IG3 A;  4CGH A;  4BRH A;  4EHU A;  3DRR A;  5LL6 Z;  4E7J A;  1BIU A;  3RWU A;  1YVU A;  1BA0 A;  5KGX A;  3SV3 A;  4CZK A;  4CF9 A;  2KFZ A;  3VTI A;  4BVO A;  3DI6 A;  4NLB A;  4FM0 A;  1Y97 A;  4FK2 A;  3J8A A;  4GMJ B;  1NBW A;  3ENB A;  3VET A;  3W0L A;  2A41 A;  3MEE A;  1NGI A;  4CED A;  3C6U A;  3CCU N;  3OJU A;  3CJ1 A;  4IFY A;  4NCG A;  1LWC A;  4FWQ A;  1WBD A;  1Y64 A;  4CHZ A;  5HRO A;  2IAJ A;  1K8K A;  2HND A;  2E4L A;  3IFR A;  4HTL A;  3P5J A;  4LFB K;  1NGF A;  2KHO A;  4RTF D;  1H1V A;  3O1W A;  4CJR A;  2Q36 A;  1RBT A;  4JKH A;  1J6Z A;  4DFP A;  1VQM N;  1NGJ A;  3VQ4 A;  2VCP A;  3U8X A;  2FBV A;  2QWL A;  1BQM A;  4KO0 A;  3LZJ A;  4F3O A;  4DKW A;  4H5W A;  1TYQ A;  3OYI A;  5F0X A;  1HKB A;  3OYF A;  4OX9 K;  2D0C A;  2Q2R A;  4G1Q A;  4OPK A;  1RBV A;  3C6H A;  3SUO A;  1MWK A;  1YF5 L;  3T69 A;  4J2D A;  4DR7 K;  4BE2 A;  4WYB A;  3WEE A;  1Q9Y A;  3C6T A;  4JKA A;  3HOS A;  4X64 K;  1U45 A;  3RMB A;  4O44 A;  1C6V A;  1WBB A;  1T3V A;  1K6Y A;  4RW4 A;  3JSM A;  5SZT A;  1Q81 O;  2V7Y A;  1VSJ A;  3LDS A;  3U3G A;  5C2D A;  3CQ8 A;  3DXK B;  3OYA A;  2KZZ A;  3V9S A;  3VN5 A;  3PY8 A;  4KI6 A;  3PSF A;  4PUO A;  3RTV A;  4DSE A;  4OKJ A;  1GLB G;  4B3O A;  2OPQ A;  2O8D B;  1QVG M;  1QSY A;  4JV5 K;  3KLF A;  1BU6 O;  3MX2 A;  2XY8 A;  4KHU A;  4N5S A;  1BI4 A;  1BA1 A;  2IDO A;  4O8K A;  1C0M A;  3SPY A;  3V4I A;  2BH1 A;  3VER A;  4BDP A;  1VSI A;  3ZET A;  1NM1 A;  4DQI A;  5AQQ A;  3VQP A;  1NGB A;  4GV9 A;  4RWT A;  3SUP A;  1YIJ N;  3TAR A;  3EY1 A;  4B9V A;  2G8I A;  3HST B;  4NB4 A;  1YIT N;  1OH5 A;  1IBL K;  1M1K O;  3CFR A;  2ZQB A;  2FBT A;  3K57 A;  1RTH A;  4A61 A;  4GVE A;  3VQ8 A;  2ETJ A;  5J1E A;  2VWJ A;  3NH2 A;  4IKF A;  4DSK A;  4ILJ A;  1RIL A;  4JI1 K;  1YJN N;  3KLH A;  3LAM A;  1D8Y A;  1IJJ A;  3ULE B;  1VHX A;  3QEW A;  3HSC A;  3TWH A;  4QS9 A;  1RDW X;  4OPJ A;  4DV5 K;  2HNY A;  3VQ5 A;  4B08 A;  2HHH K;  3RMA A;  4NCB A;  3KHY A;  1RTD A;  5JIC A;  2YHB A;  2NRZ A;  5KTQ A;  4QAG A;  1JLC A;  4M3U A;  5C2F A;  2OTL N;  2HHI A;  3S41 A;  5CE3 A;  3O4Q A;  1C0F A;  2YNG A;  2VQF K;  3EE8 A;  4JI0 K;  3D2F A;  4M3Y A;  1WSH A;  3TAG A;  4WE1 A;  1S22 A;  4ISF A;  2O8B A;  2D4W A;  3AVH A;  3QEV A;  5AQL A;  4CZE A;  3GE1 A;  4NYF A;  5CR4 A;  2YHA A;  2HBJ A;  1W7A A;  2D0B A;  3OBW A;  3HZ6 A;  2NNW A;  4RW7 A;  4FJX A;  3CQX A;  3KK1 A;  4CE9 A;  3CCS N;  2P9S A;  4CGJ A;  4MDA A;  4FZX C;  1D5A A;  3A5M C;  1U4B A;  1XI1 A;  4BRP A;  2QXF A;  4O0I A;  4JKG B;  3SMP A;  4M3Z A;  1TAU A;  4NYN A;  4CHN A;  2E88 A;  3U3Y A;  3ITH A;  3F73 A;  4A2A A;  3WNE A;  4BR7 A;  4N41 A;  4R5P A;  3U9Z A;  3D0P A;  3CYM A;  3WXM B;  3DLE A;  4CVN E;  1NK4 A;  3V1R A;  2E1Z A;  1ZBF A;  1JXB A;  2P9I A;  2QWR A;  3VEW A;  2P5G A;  2F4V K;  1GLD G;  4CEF A;  4H5N A;  1JKH A;  2DTU A;  4FJJ A;  4FJN A;  4PQU A;  4FW2 A;  3R9P A;  4M3W A;  2WFB A;  4MDB A;  3AO1 A;  3CCE N;  2XY6 A;  4BG9 A;  3LM9 A;  2QK9 A;  2QW9 A;  1RBU A;  3CYG A;  3ZEU A;  4BC5 A;  4HHT A;  2ZJR L;  1JL2 A;  2XRI A;  1M90 O;  2CH6 A;  4ID1 A;  1KAX A;  3OY9 A;  2QA4 N;  3V9U A;  5FLX O;  4O8U A;  4WFA L;  5T7B A;  1LWE A;  3OYM A;  4DTR A;  4JD2 A;  4WQ4 A;  1GLC G;  3SK3 A;  2HHS A;  4FJ9 A;  1SAZ A;  1IH7 A;  4JKF A;  5AZJ A;  4ELT A;  5AQS A;  3KD5 E;  4CI6 A;  1Q86 O;  3ENO A;  1VQ8 N;  5MLC Q;  2FSJ A;  1NMD A;  4FLT A;  5FRM A;  3SNN A;  4H5V A;  4KHQ A;  4DS5 A;  4YY3 K;  1X9M A;  2IC3 A;  5LMU K;  3AA4 A;  4K25 A;  3VQD A;  5CYQ A;  3ULD A;  3G0Z A;  2BE2 A;  1EKE A;  3VEN A;  4DQQ A;  1SKW A;  1RT2 A;  2B5J A;  3O9T A;  4OPA A;  3MN6 A;  1S72 N;  2YJE A;  4FJI A;  4YFU A;  2VG7 A;  3TAF A;  1YHQ N;  2CH5 A;  5DK5 A;  3V1Q A;  5HRS A;  1SL2 A;  1NK7 A;  3CJB A;  3AVK A;  4IFE A;  3HP6 A;  4FLV A;  3NF8 A;  3M8Q A;  4I2P A;  3QER A;  4E19 A;  1S9E A;  1Q8I A;  1I94 K;  4DTN A;  2YCH A;  2YKM A;  4FOE A;  2X74 A;  4CK1 A;  3KZB A;  2YX6 A;  1X9J A;  2QXL A;  1HJR A;  2HB5 A;  3ZSR A;  5H1S Q;  3BZK A;  2HOE A;  3DXM B;  5FRO A;  1BL3 A;  4CGF A;  3M8P A;  4CZJ A;  4BR2 A;  4X65 K;  4DV2 K;  2B4J A;  2QWP A;  4CFA A;  4DG1 A;  4JS4 A;  4BRO A;  4LF9 K;  4CEO A;  3KVG A;  2RKI A;  1IO2 A;  1LAW A;  5DMR A;  4E7H A;  1B92 A;  1BDG A;  1D9F A;  4FJH A;  4BVP A;  1KFD A;  1CLQ A;  3OYG A;  3O3H A;  3VQQ A;  5BRF A;  4KTZ A;  4U67 L;  5BRH A;  3KK7 A;  4DV0 K;  3LM2 A;  3I0S A;  4C8M A;  3FZL A;  4YOR A;  4BC4 A;  4IO9 L;  1N32 K;  1HJO A;  4BE0 A;  3QIC A;  2EHG A;  3P1G A;  4DR3 K;  1BIZ A;  3QNO A;  2GUI A;  3MCA B;  5E26 A;  4E1M A;  5F1X A;  4H5T A;  1X9S A;  4NXM K;  3KTQ A;  1D4X A;  3IMX A;  1GLJ O;  3VA0 A;  5KPZ A;  3M3Z A;  4LH4 A;  2G8H A;  2UXB K;  4JKB A;  3KD1 E;  4FW1 A;  5AQI A;  5GAD P;  1L3U A;  4YHH K;  4HUG A;  4DTU A;  3T1H K;  3QBW A;  4DS4 A;  3VEX A;  4FJK A;  2D1K A;  2PYJ A;  3VQB A;  5E41 A;  3CF5 L;  1IBK K;  1NGE A;  3AVG A;  1E4F T;  4CZL A;  1NKB A;  2ITM A;  3H45 C;  3LL3 A;  4DQP A;  4CJE A;  1JXE A;  3GBT A;  1J5O A;  1ASV A;  1NWK A;  4AHV A;  2O4G A;  3I56 N;  3DLK A;  4Z94 A;  4DHY A;  3CJA A;  2IIR A;  2G8V A;  2WTU A;  4AIL C;  3KIO A;  2AJQ A;  2KQ2 A;  3RRH A;  1QSL A;  3IRX A;  3LP1 A;  3VGK A;  2O8E B;  1S1X A;  4CD3 A;  5GIP A;  3FZF A;  4FWN A;  4DQS A;  4DU1 A;  3NVK A;  3AY9 A;  1TAQ A;  1VAZ A;  1L3T A;  4E89 A;  1RTI A;  1T6D A;  5D3G A;  3TAM A;  2HBM A;  4E7K A;  4K43 A;  4GY2 B;  2GWK A;  3VEY A;  4CIF A;  5GAE P;  4DSF A;  1OVY A;  2ASP A;  2HF3 A;  4C8O A;  1KRP A;  2QWN A;  4BR0 A;  3JYT A;  2FBX A;  4FPB A;  3VEV A;  2WON A;  3NFA A;  3QBX A;  5BRE A;  4A62 A;  1UOC A;  3THY B;  2HHQ A;  2P9U B;  5C24 A;  3MEG A;  4YOT A;  1WSI A;  4EZ9 A;  1S1T A;  3DAW A;  1S9G A;  5EX5 A;  1C0G A;  3K0S A;  4F2S A;  1NK9 A;  1KC8 O;  4JI7 K;  4FYD A;  2HHW A;  1JLF A;  2E1Y A;  3WQT A;  4LSN A;  1K8A O;  1DT9 A;  2Y1I A;  3EYZ A;  5AQV A;  2Y1J A;  4CF8 A;  3CJ7 A;  5AFU A;  4XH5 A;  3H6E A;  2Q31 A;  3Q7B A;  3THX B;  1T7P A;  1MDU B;  3C65 A;  5LJV A;  4YNQ A;  1WSG A;  1IKW A;  5M1N A;  1L3V A;  2IGI A;  3TPQ A;  2O8F A;  3ZSZ A;  4BC2 A;  3HM8 A;  3O80 A;  4XJX A;  2HW3 A;  1REV A;  5IWA K;  1KVA A;  3NDK A;  3MXJ A;  1BO5 O;  2X6N A;  4BGB A;  3P31 A;  2P9N A;  4E1N A;  3F9K A;  2QM1 A;  4IWV A;  1JLB A;  2QKB A;  3VMF B;  1VRU A;  5LMN K;  4PL7 A;  2HVI A;  4EHT A;  4IG0 A;  5E84 A;  4NLC A;  4LF8 K;  4OLA A;  5KPT A;  2ZWH A;  4GKK K;  5AQO A;  4KH5 A;  1XC3 A;  3TSU A;  2I7P A;  2OPR A;  4DV6 K;  2KKZ A;  3KWG A;  1QQO A;  3ZSV A;  3WNG A;  3ZX0 A;  3SI6 A;  4UY8 O;  4WQ4 C;  3RMD A;  1WUA A;  3M8S A;  5M1P A;  2P9L A;  2OYQ A;  4E3S A;  1RT6 A;  1F21 A;  5I9E B;  4DFJ A;  2C1I A;  3OS2 A;  2F8S A;  3ZYY X;  2UUC K;  4C23 A;  3AO4 A;  1QE1 A;  1NKC A;  3DLR A;  3IG1 A;  3I8D A;  2P51 A;  1FK9 A;  2Z1H A;  3AVF A;  4M63 C;  3NMU A;  3CXC M;  4Z4G A;  3MN7 A;  4ISE A;  2NRW A;  3LAL A;  4O5F A;  5ADX A;  4JI8 K;  2HBL A;  3P39 A;  2ZD1 A;  1ATS A;  2DFH A;  3UKR B;  2IVO A;  3FFI A;  5SWM A;  2G8K A;  4H0V B;  3AVN A;  2I5J A;  4AHU A;  4JK9 A;  4CBU A;  3O6W A;  1EO1 A;  4DQR A;  1NOY A;  3OA9 A;  4A59 A;  4CK2 A;  4K0K K;  4JK8 A;  1Q18 A;  4B9U A;  3O9Q A;  3ALY A;  4KKO A;  1LCU A;  3ZT4 A;  2ZJQ L;  3SZ2 A;  3TAP A;  3MX5 A;  4DSJ A;  5M1K A;  2GUP A;  2Z1I A;  3PO4 A;  3P83 D;  5LY3 A;  4Z4F A;  1KAY A;  3CCV N;  4R79 A;  1JCE A;  3H3N O;  3BP8 A;  1TK0 A;  2UU9 K;  3DYA A;  2ZM6 K;  3SBT A;  3WUH A;  4X62 K;  2DY4 A;  4DQ8 A;  3T3F A;  4K41 A;  3NCI A;  5KPR A;  3R8E A;  3C95 A;  3DLB A;  3RVC A;  5AQJ A;  3T1Y K;  4CCH A;  4CZH A;  2P1J A;  4CF2 A;  2IS3 A;  3L2R A;  4O0J A;  5C10 A;  5JVG L;  1HNX K;  3U6F A;  4WFN L;  2Q3S A;  2GX9 A;  1EWR A;  4YOW A;  4CEQ A;  2UUA K;  2OZM A;  4ID5 A;  4OO1 J;  3MWP A;  3DXK A;  1NOZ A;  3HT3 A;  3SQ1 A;  4KHS A;  3CFO A;  1CZB A;  1YTU A;  3HVT A;  3VEO A;  1HKC A;  4CJF A;  2YHW A;  1S3X A;  3KLI A;  4A57 A;  2HHX A;  4RCH A;  4F3T A;  2GEL A;  1HPM A;  2VG5 A;  5AR0 A;  4CJP A;  3QO9 A;  1Q9X A;  1XUP O;  2FXU A;  1GLE G;  1NK6 A;  1HLU A;  1WSJ A;  3BY5 A;  3LPT A;  1KVB A;  1JLE A;  3PIP L;  1EET A;  3TAN A; 
#chains in the Genus database with same CATH homology
 4PL8 A;  3EO3 A;  3C7N A;  4A2A A;  4BR7 A;  1TUY A;  3U9Z A;  3HRG A;  4M7Y A;  3RSE B;  5KQD A;  2E2O A;  4C1N I;  3H1Q A;  3WXM B;  1EQY A;  2E1Z A;  3EN9 A;  1VQN N;  3IUC A;  1VQ6 N;  4A2B A;  2V7Z A;  1P8Z A;  2P9I A;  4QS8 A;  4WQ5 A;  3O1B A;  3TSP A;  4H0T B;  4CZI A;  3JS6 A;  4AM7 A;  5HOO A;  2QWR A;  3UKR A;  3EL2 A;  3TTD A;  3EKU A;  1GLD G;  3VEW A;  3T7Z A;  1KXP A;  4H5N A;  3SMS A;  3AAP A;  5AZI B;  3BF1 A;  1T44 A;  1SS6 A;  3GL1 A;  3R9P A;  1QZ6 A;  2WFB A;  3FZK A;  4MDB A;  3JXU A;  3CCE N;  2AP1 A;  4BRD A;  1LOT B;  4BG9 A;  3QFP A;  3LM9 A;  1NGH A;  3SJH A;  2QW9 A;  1MA9 B;  1YXQ A;  4YDU C;  4BRK A;  3ZEU A;  1DGK N;  4BC5 A;  2ZJR L;  1RDU A;  2DPN A;  3B8A X;  1QQN A;  2CH6 A;  2ZJP L;  1N8R O;  1W2B M;  1M90 O;  4XEI A;  1KAX A;  3A8Y A;  5BN8 A;  2WC9 A;  2QA4 N;  3L0Q A;  4O8U A;  3VEZ A;  4WFA L;  4FOI A;  3L4Q A;  4JD2 A;  4G9Z A;  1G99 A;  3LDQ A;  1ZC6 A;  2QWO A;  3HOT A;  3CCM N;  3ULE A;  1GLC G;  2I7N A;  1QQM A;  4WQ4 A;  3SK3 A;  2NRT A;  3CET A;  4PHT X;  1SAZ A;  5AZJ A;  4JKF A;  3HI0 A;  3AGR A;  5FPD A;  5BPM A;  4FWS A;  3A5N C;  2P9L B;  4IJA A;  1BUP A;  5AQS A;  4JHD A;  4CI6 A;  1Q86 O;  5BN9 A;  3ID6 A;  1YUW A;  3ENO A;  5KQ8 A;  3VGM A;  5BRD A;  3CIP A;  1VQ8 N;  5MLC Q;  2FSJ A;  4Y0W A;  2CGJ A;  1NMD A;  3A5L C;  3WT0 A;  4CBW A;  4XH4 A;  4DCH A;  1VQ5 N;  2C1G A;  1IG8 A;  4H5V A;  4MLH A;  2IVN A;  2CGL A;  3Q7C A;  3KWI A;  1JCG A;  3H1V X;  4IXC A;  3TU5 A;  4NO7 A;  4K25 A;  1VQK N;  3BUZ B;  3O9S A;  2AA4 A;  3L6Q A;  3IKM A;  4CZF A;  4YOX A;  3G6E N;  4BRN A;  3E1Y A;  3VEN A;  2HST A;  4BRQ A;  3O9T A;  3GG4 A;  4OPA A;  3MN6 A;  4F9O A;  1X3M A;  2YJE A;  1S72 N;  4U7B A;  3DLL L;  3TSQ A;  1YHQ N;  4BRE A;  3CJC A;  2CH5 A;  4BRG A;  3I8B A;  3CC2 N;  2QEX N;  2A42 A;  3CJB A;  4H03 B;  4JNE A;  2Q0R A;  4IFE A;  5AQU A;  2VGM A;  3M6G A;  3PIO L;  2HBK A;  5AQX A;  4YOU A;  1YI2 N;  4A5A A;  3D2E B;  3VTH A;  4B1Z A;  2YCH A;  3GOI A;  3D6R A;  4FO0 A;  4FOE A;  3OW2 M;  3KZB A;  2YX6 A;  2FLO A;  4IJN A;  1X9J A;  1YAG A;  2QXL A;  3TTC A;  2NZT A;  4I6M B;  1ILY A;  5AQZ A;  5H1S Q;  2D0P A;  2A40 A;  2HOE A;  4H5R A;  5JLH A;  3DXM B;  1Z6R A;  5AQW A;  3VES A;  2GWJ A;  4CZJ A;  3CQY A;  3WXJ A;  1KAZ A;  4BR2 A;  1BG3 A;  5JLF A;  5EOY A;  4EIA A;  4WFB L;  2QWP A;  3WQU A;  1YJ9 N;  2BUP A;  3E9P A;  2NRH A;  4BRO A;  1YVN A;  2E2Q A;  1NGA A;  4JKG A;  4BGA A;  3KVG A;  3VPZ A;  2GEM A;  3IDH A;  3O9U A;  3ENH A;  3UB5 A;  5DM7 L;  4IDH A;  4JKD A;  1BDG A;  5AQM A;  3BF3 A;  5FPM A;  1NGC A;  4BVP A;  5BPN A;  1K8K B;  5TKW A;  5BRF A;  3CCQ N;  1GLF O;  4U67 L;  5BRH A;  3A0I X;  4B1X B;  2QWQ A;  2KLA A;  5AQN A;  3CPW M;  3KK7 A;  1RFQ A;  3LM2 A;  3FZL A;  4YOR A;  4BC4 A;  4IO9 L;  1HJO A;  2W41 A;  3QIC A;  3QDK A;  4H0Y B;  3SAG A;  3DWL A;  3O8M A;  2FF3 B;  3A5O C;  4FVU A;  3MCA B;  4CBX A;  3D2F B;  5E26 A;  4MLE A;  3W3D A;  1K9M O;  2E2P A;  5EVZ A;  5F1X A;  4IOA L;  4H5T A;  5CHI A;  3U9D A;  1VQ4 N;  1TYQ B;  4BEB A;  3LDN A;  2P9P B;  1D4X A;  3IMX A;  1QVF M;  3D7E O;  1GLJ O;  5KPZ A;  3M3Z A;  2NRX A;  4JKB A;  5AQI A;  4BRI A;  5GAD P;  5C0Y A;  2EWS A;  3CER A;  2JWK A;  4JN4 A;  5GAG P;  3F5T A;  1VQ9 N;  3ZX2 A;  1V4S A;  4BR9 A;  3QBW A;  3VEX A;  3P4I A;  2D1K A;  3SAH A;  2P9N B;  3UKU B;  3TTF A;  2PAV A;  3CF5 L;  3CME N;  2YHX A;  4GV3 A;  1V4T A;  1NGE A;  2YJF A;  3I55 N;  3ATV A;  1QZ5 A;  1E4F T;  4CZL A;  2ITM A;  3H45 C;  3LL3 A;  3NVM A;  5GAH P;  1VQL N;  4IO8 A;  1ESV A;  4FWO A;  4CZM A;  3SAF A;  3GBT A;  2ZGZ A;  3G71 N;  1NWK A;  5ELZ A;  1RGI A;  3VGL A;  4IOX A;  3I56 N;  5BPL A;  4Z94 A;  3K9K A;  3CJA A;  3O08 A;  2ASM A;  3FLC O;  2IIR A;  4DHY A;  4OO1 J;  1U2V B;  1KQS M;  4BRL A;  3OBY A;  3FGU A;  2FSK A;  4KH6 A;  1Q7Y O;  2BTF A;  1ATN A;  3LDO A;  4GNI A;  1OKJ A;  3R6M A;  2A6A A;  2OTJ N;  2V52 B;  5M1Q A;  3VGK A;  4BRM A;  4EAH D;  3ZX3 A;  5GIP A;  4JKC A;  4CD3 A;  4H0P A;  3FZF A;  4BQZ A;  4FWN A;  3AAQ A;  3EZW A;  4PKH A;  2QI2 A;  3CPE A;  4PKG A;  4BRA A;  2CGK A;  3NVK A;  3AY9 A;  3MN5 A;  4IEI A;  1VAZ A;  2ZGY A;  2A3Z A;  3ZET B;  4XH1 A;  4BR4 A;  1T6D A;  5C15 A;  1K73 O;  2HBM A;  1NGG A;  2GTD A;  3FZH A;  4CJ7 A;  4YOV A;  3CMA N;  4K43 A;  4GY2 B;  4BRF A;  2GWK A;  4IEE A;  2J4R A;  2VWB A;  4C1N K;  3VEY A;  4BRH A;  4EHU A;  4YDU A;  5GAE P;  3O5B A;  1OVY A;  4AM6 A;  2ASP A;  2H3G X;  2HF3 A;  1VQO N;  3MWT A;  4I6M A;  5AQF A;  2QWN A;  4BR0 A;  5HL7 L;  2WBN A;  4BEC A;  3DXM A;  1BA0 A;  4FSV A;  2Q1N A;  3QB0 A;  5FPE A;  4FPB A;  1GLL O;  3UE5 A;  2E2N A;  3VEV A;  4CZK A;  2JWL A;  1KD1 O;  3N4P A;  3QBX A;  4H0O A;  3E9O A;  5AQH A;  3VTI A;  3J7Z O;  4BVO A;  5BRE A;  4NLB A;  4A62 A;  5EY4 A;  3J8A A;  3W0L A;  1NBW A;  3ENB A;  3VET A;  5AZJ B;  2A41 A;  2P9U B;  3ATU A;  1NGI A;  3CCU N;  3CJ1 A;  4L3Q A;  2P9K B;  2ASO A;  4ISG A;  4FWQ A;  4YOT A;  3CC7 N;  3M1F A;  1CZA N;  1Y64 A;  3DAW A;  3AAR A;  5B8H A;  5EX5 A;  2NLX A;  1C0G A;  1K8K A;  2UYT A;  3VF4 A;  3IFR A;  3CCR N;  4HTL A;  4AF1 A;  3CCL N;  3OHR A;  1NGF A;  2KHO A;  1KC8 O;  4RTF D;  4OPH A;  1H1V A;  3O1W A;  2E1Y A;  3WQT A;  4QS7 A;  2Q36 A;  4JKH A;  1J6Z A;  1K8A O;  1DT9 A;  1VQM N;  1NGJ A;  4LC9 B;  5AQV A;  3HBT A;  4H0X B;  3CJ7 A;  5AFU A;  2VCP A;  3LDP A;  4XH5 A;  3H6E A;  2Q31 A;  3Q7B A;  2E20 A;  2QWL A;  3BEX A;  3U8X A;  1MDU B;  2OAN A;  2HMP A;  2RE2 A;  2ZF5 O;  3C65 A;  3N4Q A;  4HWI A;  3SLC A;  3R3L A;  5LJV A;  4J8F A;  5AQT A;  2W00 A;  2F7T A;  4H5W A;  4DKW A;  1TYQ A;  3QFU A;  2P9P A;  5F0X A;  3RSE A;  5M1N A;  3TPQ A;  5AQG A;  3PLA A;  1HKB A;  5AQR A;  4BC2 A;  3HM8 A;  3O80 A;  4ILG B;  4BC3 A;  2Q2R A;  4XJX A;  4FPA A;  1T6C A;  3C6H A;  4WQ5 C;  1MWK A;  1YF5 L;  2FSN A;  3ID8 A;  3T69 A;  4JKE A;  3VF6 A;  4WYB A;  1BO5 O;  3VOV A;  3WEE A;  2YHY A;  4BGB A;  5AZI A;  3P31 A;  2P9N A;  4JKA A;  3O4W A;  3HOS A;  2PFU A;  2QM1 A;  4IWV A;  5FPN A;  2F9T A;  3G4S N;  3VMF B;  4FWM A;  4JEP A;  1Q82 O;  1T3V A;  4PL7 A;  1ZXO A;  1VQ7 N;  5TKY A;  1ATR A;  3CCJ N;  4BQL A;  4EHT A;  5DM6 L;  1Q81 O;  4FWP A;  2V7Y A;  5E84 A;  2A5X A;  4WF9 L;  1O13 A;  4NLC A;  3H46 O;  5C2D A;  3L4I A;  5KPT A;  4K42 A;  3DXK B;  2ZWH A;  3DJC A;  1MWM A;  5AQO A;  4KH5 A;  2V51 B;  2PBD A;  1XC3 A;  3TSU A;  2I7P A;  2HF4 A;  2KKZ A;  3KWG A;  1QQO A;  4YOY A;  3ZX0 A;  1U2V A;  4UY8 O;  3MDQ A;  4WQ4 C;  4BY9 C;  4BRC A;  5AQP A;  1GLB G;  2P9S B;  3WEE B;  1WUA A;  5M1P A;  1X3N A;  2VYP A;  3FZM A;  2P9L A;  1NGD A;  1QVG M;  5GIO A;  4FWR A;  1BU6 O;  3MX2 A;  4KH4 A;  5I9E B;  2C1I A;  2YI1 A;  1BA1 A;  4O8K A;  3ZYY X;  2FF6 A;  3CD6 N;  4FL9 A;  4C23 A;  2BH1 A;  3VER A;  3ZET A;  3C7N B;  1NM1 A;  3CHW A;  5JVH L;  5AQQ A;  1NGB A;  2RHK A;  4M63 C;  3NMU A;  4GV9 A;  4RWT A;  1YIJ N;  3R1X A;  3CXC M;  3MN7 A;  4ISE A;  2NRW A;  4O5F A;  3WXL A;  5ADX A;  3F2K A;  3C0B A;  4GV6 A;  2HBL A;  3P39 A;  3O9R A;  1ATS A;  4EFH A;  4IZ9 A;  2P9I B;  5AQK A;  1QHA A;  5GIN A;  3UKR B;  2IVO A;  3U4L A;  4B1V A;  5M1F A;  4WCE L;  1JCF A;  3FFK B;  3FR0 A;  4B1W B;  3MMV A;  4H0V B;  4NB4 A;  3MCP A;  3D2E A;  2NRR A;  2W40 A;  4JK9 A;  1YIT N;  5F2R A;  4CBU A;  3O6W A;  1M1K O;  1EO1 A;  1WOQ A;  2P9U A;  3OA9 A;  4A59 A;  1XQS C;  3ZEU B;  2P9K A;  4JK8 A;  4BE7 B;  1Q18 A;  4GVE A;  4MO4 A;  4A61 A;  5AFU H;  3O9Q A;  4ILJ A;  2ZJQ L;  1LCU A;  3MX5 A;  1SQK A;  1YJN N;  5M1K A;  2GUP A;  4JD2 B;  5JMV A;  1IJJ A;  3WXI A;  3ULE B;  5LY3 A;  1DEJ A;  1KAY A;  4DB3 A;  2D0O A;  3HSC A;  3CCV N;  4IOC L;  4R79 A;  5BR9 A;  1JCE A;  1RDW X;  1HUX A;  3H3N O;  3BP8 A;  4QS9 A;  4JAX A;  4JHD B;  5AQY A;  3KHY A;  3SBT A;  1Z05 A;  3G25 A;  3WUH A;  1U6Z A;  3AGK A;  5JIC A;  4DQ8 A;  3E66 A;  3CI5 A;  4B1U B;  2Q0U A;  1JJ2 M;  4K41 A;  5KPR A;  5M1O A;  3EE9 A;  2NRZ A;  3P38 A;  3H3O B;  4E1J A;  3R8E A;  1P90 A;  5EXW A;  5C2F A;  1W97 L;  2F9W A;  2OTL N;  3RVC A;  1HKG A;  3S41 A;  5AQJ A;  4A5B A;  5CE3 A;  2QTD A;  4BG8 A;  1C0F A;  3EE8 A;  4CZH A;  3D2F A;  3EKS A;  1ZBS A;  1R59 O;  4CD1 A;  5C10 A;  5JVG L;  1TUU A;  4WFN L;  1S22 A;  4ISF A;  1GLA G;  2GX9 A;  3K9J A;  4BR5 A;  4M7X A;  2NRV A;  4FWK A;  3M5R A;  2D4W A;  4KBO A;  4B9Q A;  4YOW A;  1SZ2 A;  3MN9 A;  4MO5 A;  5AQL A;  5LJW A;  2QWM A;  4CZG A;  4CZE A;  3GE1 A;  1NJI O;  1E4G T;  2HBJ A;  1BOT O;  3DXK A;  3MWP A;  4ILH A;  4FWL A;  5CR4 A;  3OBW A;  3HZ6 A;  2NNW A;  2E8A A;  1DKG D;  3VEO A;  1HKC A;  4B1Y B;  3UKU A;  3SBG A;  3F9M A;  3MK6 A;  3QML A;  3CQX A;  2YHW A;  2WUS A;  1S3X A;  3E9L A;  3CCS N;  3GDQ A;  1BWF O;  3WXK A;  2P9S A;  3LDL A;  4PKI A;  4A57 A;  3HTV A;  4MDA A;  3C6A A;  4RCH A;  2GEL A;  3CJ9 A;  3A5M C;  1HPM A;  5AR0 A;  3VF2 A;  4BRP A;  5ADX H;  1VQP N;  1XUP O;  3FE1 A;  2FXU A;  3CC4 N;  1YJW N;  1GLE G;  2IVP A;  2Q97 A;  4JKG B;  3SMP A;  1HLU A;  2VGN A;  3I33 A;  1NLV A;  2E88 A;  3PIP L;  4JK7 A;  1HX1 A;  5C12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...