3A5LC

Crystal structure of a dictyostelium p109a mg2+-actin in complex with human gelsolin segment 1
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
370
structure length
363
Chain Sequence
QALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAALNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAAAAIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords Gelsolin
total genus 115
structure length 363
sequence length 370
ec nomenclature
pdb deposition date 2009-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5lC01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5lC02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3a5lC03
2ZF5O 3CQXA 3ID8A 4HTLA 2H3GX 4LC9B 1K8KB 1D4XA 4BQZA 4EIAA 1BOTO 1ATSA 4CZMA 1NGAA 1U6ZA 4BG8A 4QS8A 5LJWA 3H1QA 3H3OB 3MN9A 1ATRA 4B1ZA 3H1VX 2A6AA 4H0TB 5BPLA 2YI1A 4CZJA 4FL9A 1YXQA 4K43A 5AQRA 3VESA 5AR0A 3L4IA 3ZEUB 3TU5A 2V7YA 2FSKA 3SMPA 3CHWA 3ULEA 5AZJA 3D7EO 3MMVA 5E26A 3VGLA 5JLFA 3IUCA 4CD1A 1T44A 2PBDA 3ZX3A 5KPTA 3BUZB 3DXMB 5EVZA 1SZ2A 1BA1A 4YDUA 2ITMA 4JHDA 3H46O 3WQTA 5BRDA 5AQXA 3LDLA 3FR0A 2FSJA 4A62A 2NZTA 4FOEA 1NGEA 4BC3A 5AQKA 1QZ5A 4JAXA 2F9TA 4PKIA 1QQMA 5AQYA 3WXKA 2E88A 2P9KA 3KVGA 4BR9A 3CQYA 3BF3A 4BC2A 4H03B 2I7PA 3RSEA 1HUXA 1ATNA 3U9DA 4PKGA 4I6MB 4B1UB 4EFHA 3A5NC 1SQKA 1ZBSA 4CD3A 2P9NB 4XEIA 2D4WA 2CH5A 1HPMA 4H0VB 3H45C 5F2RA 1NGHA 3AARA 1S3XA 1YAGA 2GELA 3LDOA 3CI5A 4CZGA 4GNIA 3S41A 3SMSA 5AQUA 3UKRA 4CZEA 1Z05A 2FSNA 3BP8A 1LCUA 4RCHA 1NMDA 2GWJA 2Q0RA 3GG4A 1HKGA 3O6WA 3WEEB 4H5TA 2YJEA 4FWNA 4H5WA 4IJNA 5AQZA 2QWPA 4WQ4A 3GBTA 1U2VB 1TUYA 2E2OA 4BRDA 5F0XA 1NGJA 4BR4A 3KZBA 1V4TA 3IDHA 4IXCA 1X3MA 3O5BA 1NBWA 3A5MC 4PL7A 3LDQA 3LM2A 1SAZA 5EXWA 2QWNA 3EL2A 5BRFA 3W3DA 3MN5A 3JXUA 5KQ8A 4A61A 4QS7A 1NLVA 3UKUB 2PAVA 4H0OA 4BQLA 2I7NA 3VEOA 5BREA 5AQHA 4BRKA 4XH1A 1XUPO 4K41A 2WUSA 4JD2B 2FLOA 4BR5A 4FWRA 3SK3A 4IZ9A 2QWQA 4BRAA 4Z94A 3CJAA 4DCHA 3QICA 5AQMA 3ATUA 2V51B 2HMPA 4MO5A 2DPNA 3QBWA 3VETA 4CZFA 5BRHA 1BU6O 4I6MA 1NGFA 1BA0A 3CJ1A 4NO7A 3VPZA 3W0LA 3HBTA 3P4IA 3CERA 3MCPA 3HZ6A 5FPMA 1BO5O 1LOTB 2CGKA 3ATVA 3CETA 1QQNA 5KPZA 3ZX2A 1TUUA 1Y64A 2IIRA 4BR7A 4FWSA 1NGIA 3F9MA 4J8FA 4BVPA 3SJHA 4IJAA 4QS9A 3FZKA 2HF4A 3M3ZA 2QWLA 2V7ZA 4BRLA 1P8ZA 2IVNA 2YHXA 4FOIA 4MLHA 3FGUA 4FPBA 3FFKB 4BC5A 3U8XA 3U9ZA 2W40A 5AQWA 2E2QA 3ZEUA 4IWVA 3CJ7A 2D0PA 3VOVA 3A8YA 3ENOA 3CJBA 3EO3A 1TYQB 4FWOA 1NWKA 4BGBA 3GDQA 1X3NA 4A2BA 2P9UB 4M63C 1JCGA 3HTVA 3MDQA 3D2FB 5EOYA 1XQSC 3WT0A 4H5VA 4PL8A 4BRGA 1GLLO 3UB5A 4ISFA 3QFPA 5B8HA 3QBXA 2HF3A 4PKHA 4WQ4C 2FF6A 2VYPA 2IVOA 4M7XA 5AQPA 3GE1A 4BRHA 1IG8A 2Q0UA 5ADXH 4BR2A 3ZETB 2CGLA 4H0YB 4Y0WA 1KAXA 4BVOA 2QWOA 1K8KA 4JNEA 2E1ZA 3WXJA 4BRIA 2UYTA 3QDKA 4BRPA 3WUHA 2Q2RA 2P9LA 3LM9A 5AQFA 3QFUA 3VEXA 4DB3A 3VEWA 3C7NA 3FLCO 1GLEG 4JHDB 5JLHA 2V52B 2E8AA 5EY4A 1BWFO 2CH6A 4B1VA 3C7NB 1XC3A 1V4SA 4H0XB 4GY2B 1GLJO 3UKRB 2P9SA 4MLEA 2P9PB 2W41A 5AQSA 5ELZA 4K25A 2Q36A 3QB0A 4CJ7A 3IFRA 3ZETA 5KQDA 2P9IB 3AAPA 1GLBG 4F9OA 1KAZA 2ZWHA 4FWMA 4EHTA 2ZGYA 2GWKA 3BEXA 4HWIA 1QZ6A 4XH5A 1ZXOA 3ULEB 4AM7A 1HKBA 1OKJA 1U2VA 3LDNA 3L6QA 3LL3A 1EQYA 2ZGZA 1RFQA 5AQGA 1DEJA 1ESVA 2E2PA 3UE5A 1MWMA 4BRMA 4YDUC 4BREA 2GEMA 2QM1A 3H3NO 4FWQA 5I9EB 2P9SB 3KHYA 4FWKA 1HX1A 3J8AA 5AQNA 1BDGA 3DXKB 1G99A 3DWLA 2IVPA 4DHYA 3O8MA 2A40A 2P9KB 1T6DA 4RTFD 5AQIA 3WXIA 3TPQA 3C0BA 1YVNA 2FF3B 3MN7A 3VERA 5AQJA 4O8KA 5KPRA 3WXLA 2CGJA 4B1YB 3R8EA 3D2FA 4DQ8A 3VENA 4O5FA 1E4FT 4K42A 3VEZA 3VF2A 3ZX0A 5LJVA 2KHOA 1S22A 1NGDA 1KXPA 3EN9A 3FZFA 3QMLA 3I33A 4BROA 4FO0A 3O1WA 3MN6A 3A0IX 4WQ5A 3HSCA 3IMXA 5BN8A 3FE1A 1IJJA 2GTDA 2P9IA 2NLXA 4CZKA 4NB4A 3H6EA 1HKCA 3GOIA 2QWRA 4ISGA 1TYQA 3VGMA 3HI0A 4RWTA 1NGBA 3OHRA 1RDWX 2GUPA 3L0QA 2A41A 3M6GA 4FWPA 3HM8A 5AQLA 3VF6A 4BRFA 4A2AA 1HJOA 2E2NA 1E4GT 1MA9B 2P9UA 5AZIB 3EKSA 2BUPA 4FPAA 3I8BA 1ZC6A 4L3QA 3VF4A 4EHUA 2OANA 4CBUA 2AA4A 2YCHA 5AQOA 5TKYA 2ASOA 4CZHA 5BPNA 1RGIA 1YUWA 3A5LC 1GLFO 5AQQA 3AAQA 4BRQA 5FPNA 5LY3A 5JICA 3EKUA 1JCEA 5BR9A 3CIPA 4CI6A 5JMVA 4H0PA 4BGAA 4KBOA 3R9PA 2A3ZA 1HLUA 1C0FA 3LDPA 1NM1A 2ASPA 1Q18A 2QWMA 4E1JA 3B8AX 1MWKA 4ISEA 2YHWA 5AFUH 1MDUB 3CJ9A 3SLCA 4EAHD 4CZIA 5BN9A 5AQTA 1KAYA 1R59O 3R6MA 1BUPA 3DJCA 4JN4A 4BC4A 5AZIA 5AQVA 3CJCA 2EWSA 3JS6A 4BRCA 5ADXA 2YHYA 2A5XA 4MO4A 3O08A 2BTFA 5AZJB 5AFUA 2HOEA 1JCFA 3D2EB 1GLDG 3VEYA 3O80A 4M7YA 4H5NA 3MK6A 4WYBA 5CE3A 1T6CA 3G25A 2Q31A 3AY9A 4H5RA 3DAWA 2A42A 1DGKN 3D2EA 4BRNA 3M1FA 5FPEA 2VCPA 2FXUA 3WQUA 5EX5A 5FPDA 2Q97A 2F9WA 4CBXA 3RSEB 1C0GA 1DKGD 3O1BA 1GLAG 1H1VA 1QHAA 4B1XB 3ENHA 4B9QA 2E1YA 3U4LA 4FSVA 2P9NA 3VGKA 2P9LB 2Q1NA 4XH4A 3FZMA 3VEVA 3A5OC 1BG3A 2J4RA 2E20A 1CZAN 2D0OA 5F1XA 4IO8A 4C23A 3GL1A 3UKUA 3FZHA 5BPMA 1GLCG 1X9JA 2VWBA 2QW9A 4CBWA 5E84A 1NGGA 3EZWA 4AM6A 4JD2A 2P9PA 2ASMA 1Z6RA 1QQOA 1WOQA 3BF1A 3O4WA 2NRHA 4CZLA 4FWLA 4B1WB 1NGCA 2YJFA 2AP1A 1WUAA 2D1KA 2QXLA 1J6ZA 3WEEA 4BR0A 4BG9A 3DXKA 3DXMA 3FZLA 4WQ5C
chains in the Genus database with same CATH superfamily
5HRNA 4I2QA 3CQXA 2QTDA 4HTLA 3RVCA 1VAZA 5BR8K 2QKKA 4WFNL 4BG8A 4ZTFA 5LJWA 3MN9A 2W00A 3PX0A 1EWQA 3AVNA 5CYMA 4CZJA 1KVCA 3PSIA 4K43A 2HVHA 3DLEA 3VESA 1TKZA 3ZEUB 3TU5A 4JI4K 2V7YA 4GV3A 4BWJA 5J2NA 4CF2A 3TSUA 1S9EA 1NJYA 2KW4A 1Z25A 3SMPA 3CHWA 5AZJA 3OYNA 3D7EO 3VGLA 3ALYA 5JLFA 4CD1A 3NMUA 3TTCA 3DXMB 1VK0A 1BA1A 1NK8A 2ITMA 3K5NA 1VQON 3H46O 5AQXA 1NJWA 2FSJA 3DLKA 1CXQA 3ZT1A 4LY7A 1SV5A 4ID1A 5AQKA 5M1PA 5JS2A 4IBNA 3V1QA 3T3FA 3P5JA 4FM1A 2P9KA 3BDPA 2FC0A 4CIGA 2XY6A 2OA8A 1XWLA 1S72N 1VQ8N 4DLGA 3D45A 4I6MB 4WCEL 2F96A 4B9NA 1T8EA 3IG1A 3ZSXA 4CFDA 3KLIA 2CH5A 1HPMA 1RILA 3ZSYA 3AARA 4K0KK 4H4MA 2E6LA 1G15A 4CZGA 3VQ4A 3TAFA 5AQUA 1FKPA 3BZCA 3UKRA 3L2WA 3HSTB 4MQ3A 1Z05A 3NFAA 3LP1A 2O8BA 1WSFA 2OZMA 3QEPA 4CHPA 4KHWA 1U2VB 3PV8A 4IDHA 1X9SA 1NNEA 1HNZK 4DTPA 4W5TA 3OY9A 4CCHA 2HBMA 5GINA 3LM2A 3EL2A 3OS1A 3RR7A 4GW6A 5BRFA 3W3DA 4KI4A 4NYFA 5TKWA 2X6SA 2QI2A 5BREA 4KTQA 4DQIA 4XH1A 3O3HA 2KFZA 1WNSA 4FWRA 4CJWA 2DY4A 4Z94A 3TSQA 4IOXA 1VSKA 1N5YA 4DR1K 2HMPA 1C1CA 2DPNA 3QBWA 3VETA 1KVBA 4U7BA 1BU6O 4H4OA 1BA0A 1NKEA 1HNVA 1R0AA 3IRXA 1U4BA 3MWPA 3AVFA 3ZCMA 5KPZA 4HUFA 5C25A 4BR7A 4UQGA 3G10A 4DG1A 3NHGA 1C0TA 1XC9A 2QWLA 1P8ZA 4FOIA 1VSDA 3CCJN 2P5OA 2YHBA 1S6QA 3U9ZA 2W40A 3MWTA 4JRPA 4IWVA 1HNIA 4YOYA 3VOVA 3V81A 1TKDA 2BH1A 3ENOA 1TYQB 1JXBA 4JKEA 3SUQA 4KHNA 3MDQA 4DLEA 4KHPK 5E41A 3M5RA 4DTUA 1N32K 4PL8A 3KIOA 3S3OA 2G8WA 3MX5A 4CEEA 1KRPA 3CG7A 1WN7A 4CVNE 3O9SA 3MAQA 2EHGA 3E01A 4M41A 2QA4N 3AO3A 1K8KA 4E72A 4JNEA 2E1ZA 3THWA 4YOXA 5AQFA 4DU1A 3FLCO 1JKHA 2VQEK 4NLBA 2V52B 4FJ9A 4FLTA 5EY4A 1BWFO 4N56A 2G8VA 1XC3A 2WTUA 3ZYYX 1GLJO 3C6TA 3L2RA 2P9PB 3HM9A 5AQSA 3DLRA 2Q36A 3QB0A 4RW4A 1U45A 3ZETA 4CFAA 3RTVA 3OBWA 4YORA 1QZ6A 3CCMN 3THYB 1X9MA 3AVCA 4E3SA 1OKJA 3LDNA 3DRRA 3L6QA 2HVIA 1FK9A 5AQGA 3OYMA 1DEJA 5JVGL 1ESVA 3KTQA 3KWIA 1HMVA 3QIPA 4DS4A 4B3RK 4KI6A 3F9KA 2W6LA 4YOUA 4KAZA 1RNHA 1WAJA 5HROA 4CEQA 1BDGA 3LPTA 2IVPA 2QXFA 3C6AA 4R79A 2P9KB 1T6DA 5AQIA 1VSJA 4JK7A 2HHXA 1YVNA 3P38A 1YIJN 1BQMA 4WFAL 4FJNA 2F8TA 2FF3B 4DV4K 5FROA 4JLHA 4O5FA 1REVA 4K42A 1NG9A 2XY7A 3ZX0A 2KHOA 4X62K 1NGDA 1RTHA 4AH9A 1RTJA 1RDUA 3CQ8A 4BROA 4Z4CA 3TTDA 3A0IX 4WQ5A 5BN8A 2OTLN 3FE1A 4KTWA 3H6EA 3O4QA 1B9FA 3M8QA 4RW7A 3VQEA 3O9TA 4FLUA 3VGMA 2GX9A 2OZSA 4RWTA 2OPQA 1NGBA 4AHTA 4DV1K 1EWRA 2O8CA 1RDWX 3THVA 4A5BA 3M6GA 3WNFA 3VQCA 4F2RA 3NCIA 1HJOA 4B08A 2E2NA 4CK1A 5AZIB 4CJUA 2BUPA 2WONA 2KZMA 4HTUA 4CEDA 1TAUA 4AHRA 4O5BA 4CBUA 2YCHA 2NUBA 3ZSOA 5BPNA 1RTDA 2Z1JA 3VQBA 4R5PA 4IFYA 1TL1A 3T1YK 2VGMA 3A5LC 5J1EA 4F2SA 3AAQA 4CJEA 5FPNA 5JICA 4NXMK 4W5RA 1I94K 4CI6A 1DTQA 4H0PA 4BGAA 3R9PA 5C15A 1M90O 2QK9A 3LDPA 1Q18A 3DLGA 2QWMA 3ID6A 1J54A 4JI0K 1ZBIA 4N41A 3CFOA 2ZD1A 4OPAA 3VTHA 5KTQA 4CJ5A 4EAHD 3CJ9A 3CF5L 4CZIA 3K5OA 5AQTA 3HOTA 1L3VA 1Q81O 1IKWA 1O13A 5AZIA 4PA1A 5AQVA 1TVRA 1CXUA 2DFEA 2EWSA 4CEZA 1DT9A 4CHYA 1W9HA 3JS6A 4FJHA 4BRCA 1C0UA 2HHTA 4AILC 4IG0A 3OYCA 2ZE2A 2GV9A 4I2PA 5FRNA 3EZ5A 3CCUN 1S1WA 3VEYA 4CJLA 3O80A 4FW2A 2Q31A 3NF9A 3SPZA 1LWEA 3D2EA 4BRNA 1D9FA 5FPEA 1Q8IA 2DTUA 2VQFK 4YOWA 2FXUA 4JKDA 3E1YA 4DFJA 4OJRA 4PQUA 4Z4FA 4JKBA 4LF4K 2A1SA 4FVMA 1QHAA 4B1XB 4KRFA 2O8BB 4KHSA 3G4SN 3BGRA 4XH4A 4I9LA 3VEVA 3QEWA 1VSEA 3A5OC 3LAKA 1BG3A 1CZAN 2W6KA 1VRTA 3GL1A 3UKUA 4WFBL 5GAHP 1X9JA 3PIPL 3WXMB 4FW1A 3M8SA 1TV6A 3G71N 4FK0A 1QQOA 4CHZA 1WOQA 2ZQBA 1WUAA 4DFPA 3PLAA 2Y1JA 1N33K 5KGXA 4JI8K 2HNZA 2DFFA 4LFBK 1NU0A 3O9UA 3RMBA 1S1XA 3O3GA 4NYNA 2Y1IA 1U47A 1VSMA 4BQZA 4JI1K 3I0SA 2G8HA 1XHZA 1U6ZA 3VQPA 3H3OB 2HHIA 4DU4A 3OJSA 5HP1A 3H1VX 2HSTA 1NJXA 4H0TB 4DTJA 3V6DA 5BPLA 4I7FA 1J9AA 4MFBA 4J2AA 5AR0A 1Q9XA 4DTOA 1YT3A 2B4JA 2FSKA 3EE9A 2YKMA 3ULEA 3HVTA 1LW2A 2O8EA 4N47A 2B5JA 5CZ1A 1XMQK 1T44A 5HL7L 4KH5A 1IKVA 4BY9C 4DSIA 3AO1A 3VMFB 5BRDA 1NMNA 4CF8A 4A62A 3ZSQA 2NZTA 4F3OA 3PUFA 3QIOA 4B8CA 2F9TA 4JS5A 4FK4A 3V9ZA 4CJQA 4U67L 2E88A 4BR9A 2XO7A 4OGEA 2ZJRL 3NH1A 3RSEA 3RMCA 1DLOA 2OPSA 3A5NC 1ZBSA 4CD3A 3PO5A 1QQCA 4B9UA 4JI3K 3KK3A 2Z1IA 3H45C 3I55N 2GELA 1I3AA 1JL1A 2FBVA 4E0DA 4C8KA 4ELTA 1WSHA 4Y1CA 4RCHA 4FLVA 2GWJA 5DM7L 1HKGA 3WEEB 3DLHA 3KKRA 2YJEA 5DMRA 1QVGM 3HPGA 4DF8A 2QWPA 4L8RB 4WQ4A 1W97L 3HP9A 4BRDA 1CZBA 2YNFA 3NF6A 5F0XA 3CD6N 5JS1A 2IGIA 3ZT4A 3SCXA 1V4TA 4IXCA 3O5BA 1NBWA 1SAZA 3NGZA 3LP2A 3MN5A 3JXUA 5J2MA 4DV3K 4A61A 4QS7A 3UKUB 1NK5A 2O8DA 2NRZA 3SAGA 4H0OA 3OYBA 3VEOA 3O9QA 4PUOA 1JLGA 4EZ6A 2EX3A 2VWJA 1GOAA 4K41A 2WUSA 4JD2B 1RT6A 4BR5A 3RRHA 1SKRA 4BRAA 2QWQA 5KI6A 3U3YA 4YNQA 4KH4A 3QICA 5AQMA 2G8FA 1BISA 3OS2A 2RPIA 3HP6A 5BRHA 1YVUA 3CJ1A 3CXCM 4IOCL 3CCEN 3CCQN 1VQNN 3VPZA 3H08A 4QOZB 3P4IA 3CERA 3MCPA 1SL1A 1RDCA 1BO5O 3CETA 1QQNA 1TUUA 2IIRA 1NGIA 2G8IA 5CYQA 4CERA 1HRHA 3SJHA 4IJAA 5GADP 5HLFA 3FZKA 3P39A 1XMOK 1S9GA 2O8DB 2C1IA 2IVNA 2X6NA 3KKSA 4MLHA 4FPBA 3VQ9A 4CECA 1NKBA 3ZEUA 2E2QA 2D0PA 1HQUA 3A8YA 4DV2K 2BDPA 2WBNA 4WF9L 3CJBA 3P1GA 4N76A 4FWOA 4BGBA 3GDQA 3J80O 3K59A 2YHAA 2P9UB 3OYKA 2HHWA 2P1JA 3D2FB 3NVKA 3WNEA 3F2KA 1KCFA 5H1SQ 3WT0A 1GLLO 5A2QO 4ISFA 1B9DA 3QFPA 1A5VA 3TI0A 2E5LK 4PKHA 4CHQA 1IO2A 3GE1A 4LFCK 1IG8A 3L3UA 5SZTA 4M3RA 1KAXA 5CY4A 3CCRN 1QSLA 1OH7A 4CEFA 4BRIA 2UYTA 5C2DA 4BRPA 3HYFA 2Q2RA 2P9LA 4E19A 3U6FA 3QFUA 1VQPN 1NK4A 4M3XA 3VEWA 3ZT3A 3C7NA 1IKYA 2KFNA 2G8KA 4DR3K 3SBGA 1BHLA 1RT1A 3AVLA 3CMAN 3L4QA 1KLMA 4MLEA 4KHUA 4CGJA 4CJ7A 4DUZK 3VA0A 3NGYA 3TAMA 2XHBA 2ZWHA 4FWMA 4EHTA 2UU9K 3BEXA 2FBXA 4LF7K 1SS6A 3P83D 3KLHA 3ULEB 1QHTA 1DTTA 4HHTA 1RTIA 1U2VA 4DSFA 2ZGZA 4YOTA 2E2PA 1MWMA 4YDUC 2ATQA 1X1PA 4OPHA 3MEEA 1NK0A 4IO9L 1ZYQA 3OYIA 1J5EK 3J8AA 3QEXA 4FLXA 1KFSA 2YNGA 4YHHK 3DWLA 3MX2A 4YY3K 2A40A 1RT3A 3TPQA 5C12A 4CJ4A 4E89A 3MN7A 3ZLJA 4GKJK 1BGXT 1UA0A 3BZKA 4B1YB 4CK3A 1ZBLA 1E4FT 3VEZA 5FDLA 3VF2A 3VQ5A 5LJVA 4XIUA 2VWKA 3FZFA 3MXJA 3QMLA 4IEEA 1IBLK 3OYDA 5J2PA 3R1XA 5C0YA 2NNWA 1YJ9N 2QWRA 1RBVA 4ISGA 2BGGA 1EXQA 1RT7A 4CHOA 4NCBA 1RDAA 2W42A 4BE1A 2HHHK 5M1KA 4FWPA 3HM8A 4BRFA 4C8MA 1E4GT 4LSNA 2P9UA 3AVGA 3EKSA 4FPAA 3I8BA 4XJXA 4E7KA 3VF4A 4DTXA 1N36K 3AA3A 4FJGA 4N5SA 4AHUA 4Z4HA 1GOCA 4DR7K 4IDKA 1LWFA 1YUWA 4M3WA 1GLFO 4GV6A 3TARA 1IG9A 2KLAA 3SQ2A 3HPHA 2LSNA 1YI2N 3OJUA 2A3ZA 2RE2A 1HLUA 1C0FA 3C94A 1NM1A 4KFBA 1W0HA 2RF2A 5I42A 1YF5L 4Z4GA 1N8RO 5BN9A 3M8RA 3R6MA 2WC9A 1NJZA 1U49A 1VQ4N 4JN4A 1JLFA 1KTQA 1SUQA 5M1NA 4GVMA 4LH5A 2AJQA 3K9KA 3RMDA 1L3UA 3AVJA 2YHYA 4MO4A 3UIQA 5C10A 1HNXK 4DV0K 1TGOA 2HOEA 3KLFA 4F3TA 1LW0A 4H5NA 3MK6A 4WYBA 3L8BA 1GOBA 1JLQA 4FM2A 3AY9A 3ZSWA 3DAWA 4FXDA 2D0AA 3AVMA 1TL3A 1VQLN 4Z4EA 4DQQA 4FZZA 5FPDA 3RSEB 1DKGD 1H1VA 3AVBA 3V4IA 4B9QA 2E1YA 1K8AO 3SQ1A 2J4RA 5F1XA 4IO8A 4X65K 4DTRA 3FZHA 1A5WA 1KC8O 2IAJA 3N4QA 1S5JA 3J81O 1Q86O 5E84A 1NGGA 4AM6A 2ASMA 3E9LA 3VQQA 4KREA 1BI4B 3BF1A 4B9SA 2NRHA 4O44A 3CYMA 4FWLA 3DM2A 3CCLN 3QEIA 2AP1A 1NGCA 1KSPA 2QXLA 3L2UA 4FJKA 3SQ4A 3DXKA 1SL2A 1A5XA 1E3MA 5FLXO 2JGUA 3QESA 3ID8A 5LL6Z 4LC9B 3K5LA 4FK2A 1ZBHA 1K73O 1ATSA 3AO4A 4MDAA 4CZMA 1NGAA 2WOMA 1NJIO 3I0RA 4B1ZA 1ATRA 3OVNA 2UUCK 2A6AA 3V9SA 5KRSA 2YI1A 1YXQA 1XI1A 1Q9YA 1ASVA 4AF1A 1HJRA 1NKCA 4NCGA 1SL0A 2KTQA 4HUGA 3LWMA 1OH5A 4F4KA 5KPTA 5EU7A 1SKWA 2P51A 4OKKA 1SZ2A 5EVZA 5IT9O 3J7YP 1OVQA 5HRRA 4JHDA 3WQTA 4WE1A 2UUAK 3CPWM 4ILJA 4FOEA 1NGEA 1QZ5A 4JAXA 4PKIA 1QQMA 3TSPA 5AQYA 3WXKA 3NF8A 3BF3A 3VQ7A 4H03B 1VQKN 4EP5A 1HPZA 1HUXA 1ATNA 4EZ9A 3U9DA 4PKGA 2OPRA 4B1UB 4EFHA 1OH8A 2ITGA 1JXEA 2P9NB 4XEIA 4EP4A 1C6VA 2D4WA 1K6YA 3ULDA 4F8RA 4YOVA 2HBKA 3SV4A 1YAGA 3LDOA 3PIOL 4W5NA 2VGNA 3CI5A 2B6AA 4GNIA 4UY8O 4CZEA 5D3GA 1MU2A 3BP8A 1NMDA 4B9LA 3O6WA 4KTZA 3AGRA 4IJNA 4KHQA 1ASUA 1TUYA 3THXA 1L5UA 3MEDA 5GAEP 3KZBA 3NBPA 3IDHA 3DI6A 4BWMA 3ZSZA 4PL7A 4FLYA 1L3SA 4C1NK 4JI7K 5EXWA 2QWNA 4RW9A 2HNDA 2XY8A 1HNWK 4CJKA 5KQ8A 3CC7N 2ZM6K 4E1MA 1XNQK 4BQLA 3O4NA 1YJWN 1YJNN 3LZJA 3ZSRA 4PY5A 3P31A 3SK3A 3OYJA 2D0BA 2PFUA 3CJAA 4DCHA 2HNYA 3ATUA 2V51B 4DWIA 1CLQA 4JK8A 2XRIA 2KQ2A 3HBTA 3G6EN 3HZ6A 5FPMA 2CGKA 3TAGA 4ELVA 4CJSA 1OVYA 1S1TA 4LH4A 4FWSA 3F9MA 4E7IA 4X64K 4DFMA 4J8FA 2I5JA 4FJMA 1Y97A 5IWAK 2HF4A 3M3ZA 3T1HK 1SKSA 3E9OA 3U8XA 4JI6K 3TANA 5AQWA 4DS5A 3WNHA 3M8PA 3K0SA 5DK5A 3K57A 3EO3A 1NWKA 1X3NA 4YFUA 5LMNK 1RDDA 4M63C 4CGHA 1JCGA 4GMJB 3EY1A 1FKOA 4KB0A 1N34K 5EOYA 4DSLA 1RT5A 3SUPA 4H5VA 3DRSA 4B3MK 3UB5A 1ASWA 1WSJA 3NGIA 3FFIA 1VSFA 2YNIA 4JKCA 4LSLA 4CGFA 5LMUK 3L3VA 2IVOA 4M7XA 1TKTA 1KVAA 1OH6A 5ADXH 3DRPA 4CJ3A 2CGLA 1EX4A 4BVOA 2QWOA 4JKFA 1VHXA 3WXJA 4CK2A 4B9MA 4CJFA 3WUHA 5T7BA 1IBKK 3LM9A 3VQ8A 2VG6A 5GIOA 1GLEG 4JHDB 3DOKA 5JLHA 2E8AA 3SAHA 4B1VA 4OPJA 3C7NB 4GY2B 3UKRB 4DQRA 1B92A 1WSGA 2P9SA 3JAMO 4M3TA 3AO2A 3IFRA 5KQDA 1Q7YO 3AAPA 2NRVA 2HBLA 2X78A 1EO1A 2GWKA 2HHSA 4M42A 1KLNA 2X74A 1ZXOA 1RBRA 4ZTJA 4KHYA 3LL3A 3O3FA 1RFQA 2NRWA 1WBBA 3UE5A 2JLEA 3IKMA 4BRMA 4BREA 3C6UA 3NAEA 3H3NO 4AQYK 2HB5A 4FWQA 5SWMA 4CFBA 4FJIA 1QE1A 4FWKA 1HX1A 1TK8A 3ASMA 2Z1HA 4LFAK 3J7ZO 4LF6K 3O8MA 4DV5K 3K9JA 3WXIA 1BI4A 3C0BA 4A57A 1VSLA 4M3YA 3ZT2A 3R8EA 3D2FA 4DQ8A 2IC3A 1S22A 1EETA 4H8KA 4LF9K 1ITGA 4NCAA 3KLGA 3I33A 1HQEA 3O1WA 3HSCA 3N4PA 3ZSVA 1WB9A 3IMXA 5CHIA 1IJJA 2P9IA 1UWBA 2NLXA 4M3ZA 4NB4A 3A2FA 1HKCA 3CC2N 3HOSA 3O9RA 1N6QA 5CZ2A 3V9XA 4ILGB 3HI0A 4HCCA 2GUPA 3L0QA 5AQLA 3VF6A 4AHVA 3E9PA 1Q82O 1MA9B 4HVJA 3CCSN 2O8CB 1ZC6A 4L3QA 5HRPA 4EHUA 5C2FA 4ZHRA 4NLCA 3PX6A 1RBSA 2ASOA 4CZHA 3PX4A 4O0JA 3KK1A 4OKJA 1F21A 4KV8A 3OYFA 3QERA 4E7LA 4BRQA 1BL3A 3TTFA 3EKUA 1JCEA 5BR9A 4OLAA 1UAXA 5JENA 5JMVA 4NXNK 4OKEA 1QS4A 4O0IA 4OGCA 1KFDA 4MDBA 2F7TA 3RR8A 4C8LA 3TWHA 1WBDA 1MWKA 4ISEA 1QTMA 2YHWA 3LANA 3HRGA 2HHVA 1KAYA 1R59O 2ZJPL 3DJCA 3S9HA 2PYLA 3THWB 1S1VA 3E66A 1YTUA 2HHUA 4DU3A 4E7JA 2BANA 1WSEA 1WSIA 3SUNA 3C95A 4BE0A 4DFKA 3I56N 5AZJB 3QINA 1VQ5N 3T7ZA 1GLDG 3HT3A 3AA2A 1U48A 5CE3A 1M1KO 1IV0A 1JLAA 3G25A 4JKAA 4H5RA 3HO1A 1Z26A 2A42A 4FJJA 2O4IA 4ID5A 4BEBA 3WQUA 4DSEA 3TAEA 5EX5A 2Q97A 3OTOK 3TR8A 2R7YA 2F9WA 4CBXA 3CPEA 4OO1J 1C0GA 3O1BA 4CHNA 1GLAG 4DR6K 2C1GA 4CF0A 4OLBA 3U4LA 3V9UA 4FSVA 4C8OA 4LF8K 3NDKA 3VGKA 2P9LB 4HUEA 4J2EA 4DV7K 3FZMA 1W7AA 3V1RA 4FJ7A 4JYAK 3KLEA 4OVLA 3C6HA 4C23A 4E7HA 1JLEA 5BPMA 3CM5A 1GLCG 3S3MA 2VWBA 4CBWA 4FCYA 1JLCA 5M1FA 3K5MA 4CJTA 2P9PA 2XY5A 4DQSA 4CF1A 1Z6RA 3KK7A 4KO0A 5FRMA 3O4WA 4CZLA 4W5QA 4Z0UA 3TABA 3SJJA 4CIEA 4AHSA 3LP3A 2D1KA 2F4VK 3CFPA 3AVKA 3WEEA 4DF4A 3FZLA 2ZF5O 3NH2A 4CEBA 4G1QA 3RMAA 2H3GX 3OBYA 4IKFA 1K8KB 1D4XA 4CFCA 1VQ7N 2PY5A 4EIAA 3QETA 1BOTO 3QNOA 4O55A 3KJVA 4B9VA 2QKBA 3HXMA 4QS8A 1TAQA 3H1QA 3T1AA 1VQ9N 3G0ZA 1RT4A 4JKHA 4CGDA 4JS4A 1LAWA 5GIPA 4DTMA 1P90A 3D0PA 2OYQA 4FL9A 3OW2M 5AQRA 1IKXA 3L4IA 4KB1A 3MXIA 3J7AP 4FJ5A 1JL2A 3HL8A 3AVAA 3MMVA 5E26A 3IUCA 3ZX3A 2PBDA 4CESA 1RBUA 5JVHL 3BUZB 1KD1O 4GV9A 3IS9A 3VQAA 4YDUA 1U04A 5HOOA 4OX9K 3LDLA 3FR0A 3S5TA 4OPKA 4BC3A 3AGKA 1RCHA 1ZBUA 3C65A 1W2BM 2NRRA 3Q7CA 2BE2A 3R3LA 4BDPA 3KVGA 5CR4A 3CQYA 3S3NA 2RHKA 4BC2A 4JK9A 1K9MO 3EYZA 2I7PA 4BE2A 4PWDA 3CM6A 3TAPA 4B8AB 3OYAA 2NRXA 1RT2A 1SQKA 4V19S 3L2VA 3EE8A 1UA1A 2UXDK 4H0VB 5F2RA 2OPPA 1NGHA 4Q0BA 4A5AA 1S3XA 3OYLA 3LDSA 1J5OA 1EP4A 2RKIA 3QLHA 3S41A 3VTIA 1XNRK 3SMSA 1T03A 3HVRA 2JWKA 3PO4A 2FSNA 1LCUA 4FM0A 2Q0RA 3GG4A 3VN5A 4H5TA 3RRGA 2Z1GA 4FWNA 4H5WA 4IFEA 5AQZA 3F5TA 4LF5K 1S1UA 3L2QA 3GBTA 2E2OA 3SUOA 1NGJA 1YITN 4BR4A 3LALA 4KH6A 4DMNA 1X3MA 3NH0A 4DR5K 3A5MC 3HJFA 3LDQA 3OYEA 1X9WA 2UXBK 1RBTA 1JLBA 3CMEN 4DR4K 2HW3A 1NLVA 3DLBA 2PAVA 3PY8A 4JKGA 2I7NA 4BE7B 2F8SA 5AQHA 4BRKA 1C1BA 3VQ6A 4C1NI 3DLLL 1XUPO 1LAVA 4TSXA 2FLOA 3T19A 4IZ9A 3LP0A 4BACA 4DSJA 3AO5A 2G8UA 4ELUA 2YX6A 4MO5A 5C24A 1YHQN 4CZFA 3B6PA 2O8EB 4I6MA 1NGFA 3LAMA 4NO7A 4CE9A 4CIFA 3W0LA 1TKXA 1D9DA 4O4GA 1NK7A 4DTSA 1LOTB 2E6MA 3MECA 1HYVA 3ATVA 3ZX2A 1Y64A 5K14A 3CFRA 4M45A 4BVPA 1VSHA 4GVEA 4QS9A 3KD1E 4CF9A 4BRLA 2V7ZA 3QO9A 2YHXA 3F73A 3FGUA 4BC5A 3FFKB 2GUIA 4DKWA 3B6OA 3I8DA 3ZT0A 3CJ7A 5C42A 3ITHA 1TK0A 1FW6A 3Q7BA 1D5AA 4KPYA 1WLJA 4IFVA 1XHXA 3AA4A 4A2BA 4BDYA 2JWLA 3HTVA 1J53A 4J2DA 1BIUA 1I39A 1XQSC 4JRQA 3AVHA 3OA9A 3KK2A 4BRGA 4FLZA 4DQPA 4CW7B 3JYTA 5B8HA 3QBXA 2D0CA 2HF3A 4WQ4C 2FF6A 2IOCA 4BRHA 2VYPA 5AQPA 4K8ZA 4RG8A 3V9WA 2Q0UA 2P5GA 4BR2A 3ZETB 4H0YB 4Y0WA 3QEVA 1HYZA 4C8NA 4FJ8A 3QDKA 2A1RA 1FJGK 3VEXA 4DB3A 4JV5K 1BIZA 1LWCA 1JJ2M 2CH6A 1HR0K 1V4SA 4H0XB 5DM6L 4IEIA 3T69A 2W41A 5ELZA 4K25A 1RDBA 4RW6A 4CJVA 1L3TA 2P9IB 1GLBG 4FLWA 4F9OA 1KAZA 3MCAB 2ZGYA 2WFBA 4HWIA 4XH5A 4FJXA 3OYGA 4AM7A 2QEXN 1T3VA 1HKBA 3THXB 4B3SK 1EQYA 5HBMA 2D5RA 3IAYA 2GEMA 2QM1A 2VG5A 5I9EB 1EKEA 2O4GA 2P9SB 3KD5E 2O8FA 1YTAA 4B3TK 4I9QA 1BQNA 4BECA 3KHYA 3SZ2A 3D6RA 5AQNA 3DXKB 1G99A 3ISNC 4DHYA 3CC4N 1T7PA 1FXXA 3DOLA 4RTFD 3WNGA 2HBJA 3JSMA 4Z4IA 3EEQA 3ENBA 5M1OA 3VERA 5AQJA 4O8KA 5KPRA 2YNHA 3WXLA 2Q3SA 1BCOA 1ZBFA 2CGJA 2OTJN 3VENA 3HPOA 2PZSA 4FJLA 1KXPA 3EN9A 5AJ3K 4DR2K 4O8UA 4CGIA 1QSYA 4CJPA 4FO0A 4DV6K 4HCBA 3MN6A 2KZZA 3OS0A 1O1WA 2GTDA 4CZKA 3DMJA 4G9ZA 1HYSA 3GOIA 4K8XA 1C0MA 3RWUA 1TYQA 1UOCA 3AA5X 4B9TA 1VSIA 3OHRA 3SBTA 2UUBK 5KGWA 2A41A 3NE6A 4X66K 4A2AA 3TAQA 5M1QA 4FYDA 3U3GA 4RW8A 5MLCQ 3SQ0A 3VA3A 2NRTA 1WAFA 4QAGA 4J2BA 1D8YA 2OANA 3V1OA 2AA4A 5AQOA 5GAGP 5TKYA 4FZYA 4CJRA 1RGIA 5AQQA 3MXMA 5LY3A 4BDZA 2ETJA 2YV0X 3SAFA 1C1AA 1BCMA 3CIPA 2E4LA 2PYJA 1QVFM 4KBOA 2KKZA 1ILYA 4DSKA 4KKOA 2ZJQL 4A59A 2ASPA 1VRUA 4E1JA 3B8AX 1NOYA 3K58A 2FBTA 5AFUH 4B3OA 3KWGA 1MDUB 3SLCA 3SNNA 1VQMN 4JI5K 1BUPA 4IOAL 1TK5A 3PSFA 4BC4A 1CZ9A 4PHTX 3OYHA 4LD0A 2YKNA 3CJCA 4E1NA 2RN2A 4DTNA 4CEOA 3QNNA 5ADXA 4JEPA 1KQSM 2A5XA 1S6PA 4CGGA 4FZXC 2VG7A 1NK9A 1NK6A 2GBZA 3VQDA 3CCVN 4FVUA 3O08A 2BTFA 5AFUA 5KRTA 1LV5A 2IS3A 1JCFA 4ICLA 1IH7A 3D2EB 3NF7A 4M7YA 3LPUA 5J2QA 1T6CA 4Y1DA 3BY5A 2FBYA 1DGKN 4Q5VA 3M1FA 3K2PA 2VCPA 4ILHA 4AHCA 3THYA 3AV9A 4IG3A 3DYAA 3HK2A 4GKKK 3ENHA 2OCEA 1NOZA 2DFHA 3CYGA 2P9NA 2Q1NA 4QCLA 3SI6A 5I3UA 3AVIA 2E20A 3LZIA 2D0OA 5HRSA 2HHQA 3SV3A 4CEAA 2HMIA 1IBMK 1QSSA 2QW9A 3EZWA 4W5OA 4JD2A 2UXCK 3LWLA 2O8FB 3SPYA 4M3UA 4JKGB 1VQ6N 3MEGA 2IDOA 4B1WB 2YJFA 4JI2K 1T05A 1J6ZA 3SYZA 4BR0A 4BG9A 4DUYK 3DXMA 3NVMA 4WQ5C
chains in the Genus database with same CATH topology
2ZF5O 3O9UA 3CQXA 2QTDA 3ID8A 4HTLA 2H3GX 3OBYA 4LC9B 1K8KB 1D4XA 3RVCA 1VQ7N 1VAZA 4BQZA 4EIAA 1BOTO 1K73O 1ATSA 4MDAA 4CZMA 1NGAA 1U6ZA 4WFNL 4BG8A 1NJIO 4QS8A 5LJWA 3H1QA 3H3OB 3MN9A 1ATRA 4B1ZA 1VQ9N 2W00A 3H1VX 2HSTA 2A6AA 4H0TB 4JKHA 5GIPA 5BPLA 1P90A 2YI1A 4CZJA 4FL9A 3OW2M 1YXQA 4K43A 5AQRA 3VESA 5AR0A 3L4IA 3ZEUB 3TU5A 4AF1A 2V7YA 4GV3A 2FSKA 3TSUA 3EE9A 3SMPA 3CHWA 3ULEA 5AZJA 3D7EO 3MMVA 5E26A 3VGLA 5JLFA 3IUCA 4CD1A 3NMUA 1T44A 2PBDA 3TTCA 3ZX3A 5HL7L 5JVHL 5KPTA 3BUZB 3DXMB 4KH5A 5EVZA 1KD1O 1SZ2A 4GV9A 4BY9C 1BA1A 4YDUA 2ITMA 1VQON 4JHDA 3VMFB 3H46O 3WQTA 5BRDA 5HOOA 5AQXA 3LDLA 3FR0A 2FSJA 3CPWM 4A62A 4ILJA 2NZTA 4FOEA 1NGEA 4BC3A 5AQKA 1QZ5A 3AGKA 5M1PA 3C65A 4JAXA 2F9TA 4PKIA 1QQMA 3TSPA 5AQYA 2NRRA 3Q7CA 3WXKA 1W2BM 3R3LA 4U67L 2E88A 2P9KA 3KVGA 4BR9A 5CR4A 3CQYA 3BF3A 2RHKA 4BC2A 4H03B 4JK9A 2ZJRL 1K9MO 2I7PA 3RSEA 1S72N 1VQ8N 1VQKN 1HUXA 1ATNA 3U9DA 4PKGA 2NRXA 4I6MB 4B1UB 4EFHA 3A5NC 1SQKA 1ZBSA 4CD3A 4WCEL 2P9NB 3EE8A 4XEIA 2D4WA 2CH5A 1HPMA 4H0VB 3H45C 5F2RA 1NGHA 3AARA 4YOVA 2HBKA 4A5AA 3I55N 1S3XA 1YAGA 2GELA 3LDOA 3PIOL 2VGNA 3CI5A 4CZGA 4GNIA 3S41A 3VTIA 4UY8O 3SMSA 5AQUA 3UKRA 4CZEA 2JWKA 1Z05A 2FSNA 3BP8A 1LCUA 4RCHA 1NMDA 2GWJA 5DM7L 2Q0RA 3GG4A 1HKGA 3O6WA 3WEEB 4H5TA 2YJEA 4FWNA 4H5WA 3AGRA 4IFEA 4IJNA 3F5TA 2QWPA 5AQZA 1QVGM 4WQ4A 1W97L 3GBTA 1U2VB 1TUYA 2E2OA 4BRDA 5F0XA 4IDHA 3CD6N 1NGJA 1YITN 4BR4A 5GAEP 3KZBA 4KH6A 1V4TA 2HBMA 3IDHA 1X3MA 3O5BA 1NBWA 3A5MC 4IXCA 4PL7A 3LDQA 4C1NK 3LM2A 5GINA 1SAZA 5EXWA 2QWNA 3EL2A 5BRFA 3W3DA 3MN5A 3JXUA 3CMEN 5KQ8A 4A61A 4QS7A 1NLVA 3UKUB 3CC7N 2PAVA 2NRZA 5TKWA 3SAGA 4H0OA 4JKGA 4BQLA 2I7NA 3VEOA 3O9QA 4BE7B 5BREA 2QI2A 5AQHA 4BRKA 1YJWN 4XH1A 4C1NI 3DLLL 1YJNN 1XUPO 4K41A 2WUSA 4JD2B 2FLOA 4BR5A 4FWRA 3P31A 3SK3A 4IZ9A 2QWQA 4IOXA 3TSQA 4BRAA 4Z94A 3CJAA 2PFUA 4DCHA 4KH4A 3QICA 5AQMA 3ATUA 2V51B 2YX6A 2HMPA 4MO5A 2DPNA 3QBWA 3VETA 1YHQN 4CZFA 4JK8A 5BRHA 1BU6O 4I6MA 4U7BA 1NGFA 1BA0A 3CJ1A 4NO7A 3CXCM 4IOCL 3CCQN 3CCEN 3VPZA 1VQNN 3W0LA 3HBTA 3P4IA 3CERA 3MCPA 3G6EN 3HZ6A 5FPMA 3MWPA 1BO5O 1LOTB 2CGKA 3ATVA 3CETA 1QQNA 5KPZA 1OVYA 3ZX2A 1TUUA 1Y64A 2IIRA 4BR7A 4FWSA 1NGIA 3F9MA 4J8FA 4BVPA 3SJHA 4IJAA 4GVEA 4QS9A 5GADP 3FZKA 3P39A 2HF4A 3M3ZA 2QWLA 2V7ZA 4BRLA 1P8ZA 2IVNA 2YHXA 4FOIA 2C1IA 4MLHA 3FGUA 3E9OA 3FFKB 4FPBA 4BC5A 3CCJN 3U8XA 3U9ZA 4DKWA 2W40A 3MWTA 5AQWA 2E2QA 3ZEUA 4IWVA 3CJ7A 2D0PA 4YOYA 3VOVA 3A8YA 2BH1A 3Q7BA 3ENOA 2WBNA 4WF9L 3CJBA 3EO3A 1TYQB 4FWOA 1NWKA 4BGBA 3GDQA 1X3NA 4A2BA 2P9UB 4JKEA 4M63C 2JWLA 1JCGA 3HTVA 3MDQA 3D2FB 3NVKA 3F2KA 5EOYA 3M5RA 1XQSC 5H1SQ 3WT0A 3OA9A 4H5VA 4PL8A 4BRGA 1GLLO 3UB5A 4ISFA 3QFPA 4JKCA 3MX5A 5B8HA 3QBXA 2HF3A 4PKHA 4WQ4C 2FF6A 2VYPA 2IVOA 4M7XA 5AQPA 3GE1A 4BRHA 1IG8A 2Q0UA 3O9SA 5ADXH 4BR2A 3ZETB 2QA4N 2CGLA 4H0YB 4Y0WA 1KAXA 4BVOA 2QWOA 1K8KA 3CCRN 4JNEA 2E1ZA 4JKFA 3WXJA 4BRIA 2UYTA 3QDKA 4BRPA 5C2DA 3WUHA 4YOXA 2Q2RA 2P9LA 3LM9A 5AQFA 3QFUA 3VEXA 4DB3A 1VQPN 3VEWA 3C7NA 5GIOA 3FLCO 1GLEG 4NLBA 4JHDB 5JLHA 2V52B 2E8AA 3SAHA 3SBGA 5EY4A 1BWFO 1JJ2M 2CH6A 4B1VA 3C7NB 1XC3A 3CMAN 1V4SA 3L4QA 4H0XB 4GY2B 3ZYYX 1GLJO 3UKRB 2P9SA 4MLEA 5DM6L 4IEIA 3T69A 2P9PB 2W41A 5AQSA 5ELZA 4K25A 2Q36A 3QB0A 4CJ7A 3IFRA 3ZETA 5KQDA 1Q7YO 2P9IB 3AAPA 1GLBG 4F9OA 3OBWA 1KAZA 4YORA 3MCAB 2ZWHA 4FWMA 4EHTA 2NRVA 2HBLA 2ZGYA 2WFBA 2GWKA 3BEXA 1EO1A 4HWIA 1QZ6A 3CCMN 4XH5A 1SS6A 1ZXOA 3ULEB 4AM7A 2QEXN 1T3VA 1HKBA 1OKJA 1U2VA 3LDNA 3L6QA 3LL3A 1EQYA 2ZGZA 1RFQA 5AQGA 2NRWA 1DEJA 5JVGL 1ESVA 4YOTA 2E2PA 3IKMA 1MWMA 3KWIA 3UE5A 4YDUC 4BRMA 4BREA 2GEMA 2QM1A 3H3NO 4FWQA 5I9EB 4OPHA 2P9SB 4YOUA 4IO9L 4BECA 3KHYA 4FWKA 1HX1A 3J8AA 3D6RA 5AQNA 1BDGA 3DXKB 1G99A 3DWLA 2IVPA 3MX2A 4DHYA 3J7ZO 3C6AA 3O8MA 4R79A 3CC4N 2A40A 2P9KB 1T6DA 4RTFD 2HBJA 5AQIA 3K9JA 3TPQA 4JK7A 3WXIA 5C12A 3C0BA 4A57A 1YVNA 3ENBA 3P38A 1YIJN 5M1OA 4WFAL 2FF3B 3MN7A 3VERA 5AQJA 4O8KA 5KPRA 3WXLA 2CGJA 4B1YB 3R8EA 3D2FA 4DQ8A 3VENA 4O5FA 2OTJN 1E4FT 4K42A 3VEZA 3VF2A 3ZX0A 5LJVA 2KHOA 1S22A 1NGDA 1KXPA 3EN9A 3FZFA 1RDUA 4O8UA 3QMLA 3I33A 4IEEA 4BROA 4FO0A 3TTDA 3O1WA 3R1XA 3MN6A 3A0IX 5C0YA 4WQ5A 3HSCA 3N4PA 2NNWA 3IMXA 5BN8A 1YJ9N 2OTLN 5CHIA 1IJJA 3FE1A 2GTDA 2P9IA 2NLXA 4CZKA 4G9ZA 4NB4A 3H6EA 1HKCA 3GOIA 2QWRA 3CC2N 3HOSA 3O9RA 1TYQA 4ISGA 3O9TA 3VGMA 2GX9A 4ILGB 3HI0A 4RWTA 1NGBA 3OHRA 3SBTA 1RDWX 2GUPA 3L0QA 4A5BA 2A41A 3M6GA 4FWPA 3HM8A 5AQLA 5M1KA 3VF6A 4BRFA 4A2AA 3E9PA 5M1QA 1HJOA 1Q82O 2E2NA 1E4GT 1MA9B 2P9UA 3CCSN 5AZIB 3EKSA 2BUPA 4FPAA 5MLCQ 2NRTA 1ZC6A 3I8BA 4L3QA 3VF4A 4XJXA 4EHUA 5C2FA 2OANA 4NLCA 2AA4A 2YCHA 5AQOA 4CBUA 5GAGP 5TKYA 2ASOA 4CZHA 5BPNA 2VGMA 1RGIA 1YUWA 3A5LC 1GLFO 5AQQA 3AAQA 4GV6A 4BRQA 5FPNA 5LY3A 3TTFA 5JICA 3SAFA 3EKUA 2KLAA 1JCEA 5BR9A 3CIPA 4CI6A 5JMVA 4H0PA 4BGAA 1QVFM 4KBOA 3R9PA 2KKZA 5C15A 1YI2N 1M90O 2A3ZA 2RE2A 1ILYA 1HLUA 1C0FA 3LDPA 2ZJQL 1NM1A 2ASPA 1Q18A 2F7TA 4MDBA 4A59A 2QWMA 3ID6A 4E1JA 3B8AX 1MWKA 4ISEA 1YF5L 2YHWA 4OPAA 3VTHA 5AFUH 3HRGA 3KWGA 1MDUB 3CJ9A 3SLCA 4EAHD 3CF5L 4CZIA 1N8RO 5BN9A 5AQTA 1VQMN 1KAYA 1R59O 2WC9A 3R6MA 3HOTA 1BUPA 2ZJPL 3DJCA 4JN4A 1VQ4N 1Q81O 4BC4A 4IOAL 4PHTX 1O13A 5AZIA 3E66A 5AQVA 5M1NA 3CJCA 3K9KA 2EWSA 1DT9A 3JS6A 4BRCA 5ADXA 4JEPA 1KQSM 2YHYA 2A5XA 4MO4A 5C10A 4FVUA 3CCVN 3I56N 3O08A 2BTFA 5AZJB 5AFUA 3CCUN 2HOEA 1JCFA 1VQ5N 3D2EB 1GLDG 3T7ZA 3VEYA 3O80A 4M7YA 4H5NA 3MK6A 4WYBA 5CE3A 1T6CA 1M1KO 3G25A 2Q31A 3AY9A 4JKAA 4H5RA 3DAWA 2A42A 1DGKN 3D2EA 4BRNA 3M1FA 1VQLN 5FPEA 4BEBA 2VCPA 2FXUA 4ILHA 3WQUA 4YOWA 4JKDA 5EX5A 5FPDA 2Q97A 3E1YA 2F9WA 4CBXA 3RSEB 3CPEA 4OO1J 4JKBA 1C0GA 1DKGD 3O1BA 1GLAG 1H1VA 2C1GA 1QHAA 4B1XB 3ENHA 4B9QA 2E1YA 3U4LA 1K8AO 4FSVA 3G4SN 2P9NA 3VGKA 2P9LB 2Q1NA 4XH4A 3FZMA 3VEVA 3A5OC 1BG3A 2J4RA 2E20A 1CZAN 3C6HA 2D0OA 5F1XA 4IO8A 4C23A 3GL1A 3UKUA 4WFBL 5GAHP 3FZHA 5BPMA 1KC8O 1GLCG 1X9JA 3PIPL 3N4QA 3WXMB 2VWBA 2QW9A 1Q86O 4CBWA 5M1FA 5E84A 1NGGA 3EZWA 4AM6A 4JD2A 2P9PA 3G71N 2ASMA 3E9LA 1Z6RA 1QQOA 1WOQA 3KK7A 4JKGB 1VQ6N 3BF1A 3O4WA 2NRHA 4CZLA 4FWLA 4B1WB 3CCLN 1NGCA 2YJFA 2AP1A 1WUAA 2D1KA 2QXLA 1J6ZA 3PLAA 3WEEA 4BR0A 4BG9A 3DXKA 3DXMA 3FZLA 3NVMA 4WQ5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZF5 O;  3CQX A;  3ID8 A;  4HTL A;  2H3G X;  4LC9 B;  1K8K B;  1D4X A;  4BQZ A;  4EIA A;  1BOT O;  1ATS A;  4CZM A;  1NGA A;  1U6Z A;  4BG8 A;  4QS8 A;  5LJW A;  3H1Q A;  3H3O B;  3MN9 A;  1ATR A;  4B1Z A;  3H1V X;  2A6A A;  4H0T B;  5BPL A;  2YI1 A;  4CZJ A;  4FL9 A;  1YXQ A;  4K43 A;  5AQR A;  3VES A;  5AR0 A;  3L4I A;  3ZEU B;  3TU5 A;  2V7Y A;  2FSK A;  3SMP A;  3CHW A;  3ULE A;  5AZJ A;  3D7E O;  3MMV A;  5E26 A;  3VGL A;  5JLF A;  3IUC A;  4CD1 A;  1T44 A;  2PBD A;  3ZX3 A;  5KPT A;  3BUZ B;  3DXM B;  5EVZ A;  1SZ2 A;  1BA1 A;  4YDU A;  2ITM A;  4JHD A;  3H46 O;  3WQT A;  5BRD A;  5AQX A;  3LDL A;  3FR0 A;  2FSJ A;  4A62 A;  2NZT A;  4FOE A;  1NGE A;  4BC3 A;  5AQK A;  1QZ5 A;  4JAX A;  2F9T A;  4PKI A;  1QQM A;  5AQY A;  3WXK A;  2E88 A;  2P9K A;  3KVG A;  4BR9 A;  3CQY A;  3BF3 A;  4BC2 A;  4H03 B;  2I7P A;  3RSE A;  1HUX A;  1ATN A;  3U9D A;  4PKG A;  4I6M B;  4B1U B;  4EFH A;  3A5N C;  1SQK A;  1ZBS A;  4CD3 A;  2P9N B;  4XEI A;  2D4W A;  2CH5 A;  1HPM A;  4H0V B;  3H45 C;  5F2R A;  1NGH A;  3AAR A;  1S3X A;  1YAG A;  2GEL A;  3LDO A;  3CI5 A;  4CZG A;  4GNI A;  3S41 A;  3SMS A;  5AQU A;  3UKR A;  4CZE A;  1Z05 A;  2FSN A;  3BP8 A;  1LCU A;  4RCH A;  1NMD A;  2GWJ A;  2Q0R A;  3GG4 A;  1HKG A;  3O6W A;  3WEE B;  4H5T A;  2YJE A;  4FWN A;  4H5W A;  4IJN A;  5AQZ A;  2QWP A;  4WQ4 A;  3GBT A;  1U2V B;  1TUY A;  2E2O A;  4BRD A;  5F0X A;  1NGJ A;  4BR4 A;  3KZB A;  1V4T A;  3IDH A;  4IXC A;  1X3M A;  3O5B A;  1NBW A;  3A5M C;  4PL7 A;  3LDQ A;  3LM2 A;  1SAZ A;  5EXW A;  2QWN A;  3EL2 A;  5BRF A;  3W3D A;  3MN5 A;  3JXU A;  5KQ8 A;  4A61 A;  4QS7 A;  1NLV A;  3UKU B;  2PAV A;  4H0O A;  4BQL A;  2I7N A;  3VEO A;  5BRE A;  5AQH A;  4BRK A;  4XH1 A;  1XUP O;  4K41 A;  2WUS A;  4JD2 B;  2FLO A;  4BR5 A;  4FWR A;  3SK3 A;  4IZ9 A;  2QWQ A;  4BRA A;  4Z94 A;  3CJA A;  4DCH A;  3QIC A;  5AQM A;  3ATU A;  2V51 B;  2HMP A;  4MO5 A;  2DPN A;  3QBW A;  3VET A;  4CZF A;  5BRH A;  1BU6 O;  4I6M A;  1NGF A;  1BA0 A;  3CJ1 A;  4NO7 A;  3VPZ A;  3W0L A;  3HBT A;  3P4I A;  3CER A;  3MCP A;  3HZ6 A;  5FPM A;  1BO5 O;  1LOT B;  2CGK A;  3ATV A;  3CET A;  1QQN A;  5KPZ A;  3ZX2 A;  1TUU A;  1Y64 A;  2IIR A;  4BR7 A;  4FWS A;  1NGI A;  3F9M A;  4J8F A;  4BVP A;  3SJH A;  4IJA A;  4QS9 A;  3FZK A;  2HF4 A;  3M3Z A;  2QWL A;  2V7Z A;  4BRL A;  1P8Z A;  2IVN A;  2YHX A;  4FOI A;  4MLH A;  3FGU A;  4FPB A;  3FFK B;  4BC5 A;  3U8X A;  3U9Z A;  2W40 A;  5AQW A;  2E2Q A;  3ZEU A;  4IWV A;  3CJ7 A;  2D0P A;  3VOV A;  3A8Y A;  3ENO A;  3CJB A;  3EO3 A;  1TYQ B;  4FWO A;  1NWK A;  4BGB A;  3GDQ A;  1X3N A;  4A2B A;  2P9U B;  4M63 C;  1JCG A;  3HTV A;  3MDQ A;  3D2F B;  5EOY A;  1XQS C;  3WT0 A;  4H5V A;  4PL8 A;  4BRG A;  1GLL O;  3UB5 A;  4ISF A;  3QFP A;  5B8H A;  3QBX A;  2HF3 A;  4PKH A;  4WQ4 C;  2FF6 A;  2VYP A;  2IVO A;  4M7X A;  5AQP A;  3GE1 A;  4BRH A;  1IG8 A;  2Q0U A;  5ADX H;  4BR2 A;  3ZET B;  2CGL A;  4H0Y B;  4Y0W A;  1KAX A;  4BVO A;  2QWO A;  1K8K A;  4JNE A;  2E1Z A;  3WXJ A;  4BRI A;  2UYT A;  3QDK A;  4BRP A;  3WUH A;  2Q2R A;  2P9L A;  3LM9 A;  5AQF A;  3QFU A;  3VEX A;  4DB3 A;  3VEW A;  3C7N A;  3FLC O;  1GLE G;  4JHD B;  5JLH A;  2V52 B;  2E8A A;  5EY4 A;  1BWF O;  2CH6 A;  4B1V A;  3C7N B;  1XC3 A;  1V4S A;  4H0X B;  4GY2 B;  1GLJ O;  3UKR B;  2P9S A;  4MLE A;  2P9P B;  2W41 A;  5AQS A;  5ELZ A;  4K25 A;  2Q36 A;  3QB0 A;  4CJ7 A;  3IFR A;  3ZET A;  5KQD A;  2P9I B;  3AAP A;  1GLB G;  4F9O A;  1KAZ A;  2ZWH A;  4FWM A;  4EHT A;  2ZGY A;  2GWK A;  3BEX A;  4HWI A;  1QZ6 A;  4XH5 A;  1ZXO A;  3ULE B;  4AM7 A;  1HKB A;  1OKJ A;  1U2V A;  3LDN A;  3L6Q A;  3LL3 A;  1EQY A;  2ZGZ A;  1RFQ A;  5AQG A;  1DEJ A;  1ESV A;  2E2P A;  3UE5 A;  1MWM A;  4BRM A;  4YDU C;  4BRE A;  2GEM A;  2QM1 A;  3H3N O;  4FWQ A;  5I9E B;  2P9S B;  3KHY A;  4FWK A;  1HX1 A;  3J8A A;  5AQN A;  1BDG A;  3DXK B;  1G99 A;  3DWL A;  2IVP A;  4DHY A;  3O8M A;  2A40 A;  2P9K B;  1T6D A;  4RTF D;  5AQI A;  3WXI A;  3TPQ A;  3C0B A;  1YVN A;  2FF3 B;  3MN7 A;  3VER A;  5AQJ A;  4O8K A;  5KPR A;  3WXL A;  2CGJ A;  4B1Y B;  3R8E A;  3D2F A;  4DQ8 A;  3VEN A;  4O5F A;  1E4F T;  4K42 A;  3VEZ A;  3VF2 A;  3ZX0 A;  5LJV A;  2KHO A;  1S22 A;  1NGD A;  1KXP A;  3EN9 A;  3FZF A;  3QML A;  3I33 A;  4BRO A;  4FO0 A;  3O1W A;  3MN6 A;  3A0I X;  4WQ5 A;  3HSC A;  3IMX A;  5BN8 A;  3FE1 A;  1IJJ A;  2GTD A;  2P9I A;  2NLX A;  4CZK A;  4NB4 A;  3H6E A;  1HKC A;  3GOI A;  2QWR A;  4ISG A;  1TYQ A;  3VGM A;  3HI0 A;  4RWT A;  1NGB A;  3OHR A;  1RDW X;  2GUP A;  3L0Q A;  2A41 A;  3M6G A;  4FWP A;  3HM8 A;  5AQL A;  3VF6 A;  4BRF A;  4A2A A;  1HJO A;  2E2N A;  1E4G T;  1MA9 B;  2P9U A;  5AZI B;  3EKS A;  2BUP A;  4FPA A;  3I8B A;  1ZC6 A;  4L3Q A;  3VF4 A;  4EHU A;  2OAN A;  4CBU A;  2AA4 A;  2YCH A;  5AQO A;  5TKY A;  2ASO A;  4CZH A;  5BPN A;  1RGI A;  1YUW A;  3A5L C;  1GLF O;  5AQQ A;  3AAQ A;  4BRQ A;  5FPN A;  5LY3 A;  5JIC A;  3EKU A;  1JCE A;  5BR9 A;  3CIP A;  4CI6 A;  5JMV A;  4H0P A;  4BGA A;  4KBO A;  3R9P A;  2A3Z A;  1HLU A;  1C0F A;  3LDP A;  1NM1 A;  2ASP A;  1Q18 A;  2QWM A;  4E1J A;  3B8A X;  1MWK A;  4ISE A;  2YHW A;  5AFU H;  1MDU B;  3CJ9 A;  3SLC A;  4EAH D;  4CZI A;  5BN9 A;  5AQT A;  1KAY A;  1R59 O;  3R6M A;  1BUP A;  3DJC A;  4JN4 A;  4BC4 A;  5AZI A;  5AQV A;  3CJC A;  2EWS A;  3JS6 A;  4BRC A;  5ADX A;  2YHY A;  2A5X A;  4MO4 A;  3O08 A;  2BTF A;  5AZJ B;  5AFU A;  2HOE A;  1JCF A;  3D2E B;  1GLD G;  3VEY A;  3O80 A;  4M7Y A;  4H5N A;  3MK6 A;  4WYB A;  5CE3 A;  1T6C A;  3G25 A;  2Q31 A;  3AY9 A;  4H5R A;  3DAW A;  2A42 A;  1DGK N;  3D2E A;  4BRN A;  3M1F A;  5FPE A;  2VCP A;  2FXU A;  3WQU A;  5EX5 A;  5FPD A;  2Q97 A;  2F9W A;  4CBX A;  3RSE B;  1C0G A;  1DKG D;  3O1B A;  1GLA G;  1H1V A;  1QHA A;  4B1X B;  3ENH A;  4B9Q A;  2E1Y A;  3U4L A;  4FSV A;  2P9N A;  3VGK A;  2P9L B;  2Q1N A;  4XH4 A;  3FZM A;  3VEV A;  3A5O C;  1BG3 A;  2J4R A;  2E20 A;  1CZA N;  2D0O A;  5F1X A;  4IO8 A;  4C23 A;  3GL1 A;  3UKU A;  3FZH A;  5BPM A;  1GLC G;  1X9J A;  2VWB A;  2QW9 A;  4CBW A;  5E84 A;  1NGG A;  3EZW A;  4AM6 A;  4JD2 A;  2P9P A;  2ASM A;  1Z6R A;  1QQO A;  1WOQ A;  3BF1 A;  3O4W A;  2NRH A;  4CZL A;  4FWL A;  4B1W B;  1NGC A;  2YJF A;  2AP1 A;  1WUA A;  2D1K A;  2QXL A;  1J6Z A;  3WEE A;  4BR0 A;  4BG9 A;  3DXK A;  3DXM A;  3FZL A;  4WQ5 C; 
#chains in the Genus database with same CATH topology
 5HRN A;  4I2Q A;  3CQX A;  2QTD A;  4HTL A;  3RVC A;  1VAZ A;  5BR8 K;  2QKK A;  4WFN L;  4BG8 A;  4ZTF A;  5LJW A;  3MN9 A;  2W00 A;  3PX0 A;  1EWQ A;  3AVN A;  5CYM A;  4CZJ A;  1KVC A;  3PSI A;  4K43 A;  2HVH A;  3DLE A;  3VES A;  1TKZ A;  3ZEU B;  3TU5 A;  4JI4 K;  2V7Y A;  4GV3 A;  4BWJ A;  5J2N A;  4CF2 A;  3TSU A;  1S9E A;  1NJY A;  2KW4 A;  1Z25 A;  3SMP A;  3CHW A;  5AZJ A;  3OYN A;  3D7E O;  3VGL A;  3ALY A;  5JLF A;  4CD1 A;  3NMU A;  3TTC A;  3DXM B;  1VK0 A;  1BA1 A;  1NK8 A;  2ITM A;  3K5N A;  1VQO N;  3H46 O;  5AQX A;  1NJW A;  2FSJ A;  3DLK A;  1CXQ A;  3ZT1 A;  4LY7 A;  1SV5 A;  4ID1 A;  5AQK A;  5M1P A;  5JS2 A;  4IBN A;  3V1Q A;  3T3F A;  3P5J A;  4FM1 A;  2P9K A;  3BDP A;  2FC0 A;  4CIG A;  2XY6 A;  2OA8 A;  1XWL A;  1S72 N;  1VQ8 N;  4DLG A;  3D45 A;  4I6M B;  4WCE L;  2F96 A;  4B9N A;  1T8E A;  3IG1 A;  3ZSX A;  4CFD A;  3KLI A;  2CH5 A;  1HPM A;  1RIL A;  3ZSY A;  3AAR A;  4K0K K;  4H4M A;  2E6L A;  1G15 A;  4CZG A;  3VQ4 A;  3TAF A;  5AQU A;  1FKP A;  3BZC A;  3UKR A;  3L2W A;  3HST B;  4MQ3 A;  1Z05 A;  3NFA A;  3LP1 A;  2O8B A;  1WSF A;  2OZM A;  3QEP A;  4CHP A;  4KHW A;  1U2V B;  3PV8 A;  4IDH A;  1X9S A;  1NNE A;  1HNZ K;  4DTP A;  4W5T A;  3OY9 A;  4CCH A;  2HBM A;  5GIN A;  3LM2 A;  3EL2 A;  3OS1 A;  3RR7 A;  4GW6 A;  5BRF A;  3W3D A;  4KI4 A;  4NYF A;  5TKW A;  2X6S A;  2QI2 A;  5BRE A;  4KTQ A;  4DQI A;  4XH1 A;  3O3H A;  2KFZ A;  1WNS A;  4FWR A;  4CJW A;  2DY4 A;  4Z94 A;  3TSQ A;  4IOX A;  1VSK A;  1N5Y A;  4DR1 K;  2HMP A;  1C1C A;  2DPN A;  3QBW A;  3VET A;  1KVB A;  4U7B A;  1BU6 O;  4H4O A;  1BA0 A;  1NKE A;  1HNV A;  1R0A A;  3IRX A;  1U4B A;  3MWP A;  3AVF A;  3ZCM A;  5KPZ A;  4HUF A;  5C25 A;  4BR7 A;  4UQG A;  3G10 A;  4DG1 A;  3NHG A;  1C0T A;  1XC9 A;  2QWL A;  1P8Z A;  4FOI A;  1VSD A;  3CCJ N;  2P5O A;  2YHB A;  1S6Q A;  3U9Z A;  2W40 A;  3MWT A;  4JRP A;  4IWV A;  1HNI A;  4YOY A;  3VOV A;  3V81 A;  1TKD A;  2BH1 A;  3ENO A;  1TYQ B;  1JXB A;  4JKE A;  3SUQ A;  4KHN A;  3MDQ A;  4DLE A;  4KHP K;  5E41 A;  3M5R A;  4DTU A;  1N32 K;  4PL8 A;  3KIO A;  3S3O A;  2G8W A;  3MX5 A;  4CEE A;  1KRP A;  3CG7 A;  1WN7 A;  4CVN E;  3O9S A;  3MAQ A;  2EHG A;  3E01 A;  4M41 A;  2QA4 N;  3AO3 A;  1K8K A;  4E72 A;  4JNE A;  2E1Z A;  3THW A;  4YOX A;  5AQF A;  4DU1 A;  3FLC O;  1JKH A;  2VQE K;  4NLB A;  2V52 B;  4FJ9 A;  4FLT A;  5EY4 A;  1BWF O;  4N56 A;  2G8V A;  1XC3 A;  2WTU A;  3ZYY X;  1GLJ O;  3C6T A;  3L2R A;  2P9P B;  3HM9 A;  5AQS A;  3DLR A;  2Q36 A;  3QB0 A;  4RW4 A;  1U45 A;  3ZET A;  4CFA A;  3RTV A;  3OBW A;  4YOR A;  1QZ6 A;  3CCM N;  3THY B;  1X9M A;  3AVC A;  4E3S A;  1OKJ A;  3LDN A;  3DRR A;  3L6Q A;  2HVI A;  1FK9 A;  5AQG A;  3OYM A;  1DEJ A;  5JVG L;  1ESV A;  3KTQ A;  3KWI A;  1HMV A;  3QIP A;  4DS4 A;  4B3R K;  4KI6 A;  3F9K A;  2W6L A;  4YOU A;  4KAZ A;  1RNH A;  1WAJ A;  5HRO A;  4CEQ A;  1BDG A;  3LPT A;  2IVP A;  2QXF A;  3C6A A;  4R79 A;  2P9K B;  1T6D A;  5AQI A;  1VSJ A;  4JK7 A;  2HHX A;  1YVN A;  3P38 A;  1YIJ N;  1BQM A;  4WFA L;  4FJN A;  2F8T A;  2FF3 B;  4DV4 K;  5FRO A;  4JLH A;  4O5F A;  1REV A;  4K42 A;  1NG9 A;  2XY7 A;  3ZX0 A;  2KHO A;  4X62 K;  1NGD A;  1RTH A;  4AH9 A;  1RTJ A;  1RDU A;  3CQ8 A;  4BRO A;  4Z4C A;  3TTD A;  3A0I X;  4WQ5 A;  5BN8 A;  2OTL N;  3FE1 A;  4KTW A;  3H6E A;  3O4Q A;  1B9F A;  3M8Q A;  4RW7 A;  3VQE A;  3O9T A;  4FLU A;  3VGM A;  2GX9 A;  2OZS A;  4RWT A;  2OPQ A;  1NGB A;  4AHT A;  4DV1 K;  1EWR A;  2O8C A;  1RDW X;  3THV A;  4A5B A;  3M6G A;  3WNF A;  3VQC A;  4F2R A;  3NCI A;  1HJO A;  4B08 A;  2E2N A;  4CK1 A;  5AZI B;  4CJU A;  2BUP A;  2WON A;  2KZM A;  4HTU A;  4CED A;  1TAU A;  4AHR A;  4O5B A;  4CBU A;  2YCH A;  2NUB A;  3ZSO A;  5BPN A;  1RTD A;  2Z1J A;  3VQB A;  4R5P A;  4IFY A;  1TL1 A;  3T1Y K;  2VGM A;  3A5L C;  5J1E A;  4F2S A;  3AAQ A;  4CJE A;  5FPN A;  5JIC A;  4NXM K;  4W5R A;  1I94 K;  4CI6 A;  1DTQ A;  4H0P A;  4BGA A;  3R9P A;  5C15 A;  1M90 O;  2QK9 A;  3LDP A;  1Q18 A;  3DLG A;  2QWM A;  3ID6 A;  1J54 A;  4JI0 K;  1ZBI A;  4N41 A;  3CFO A;  2ZD1 A;  4OPA A;  3VTH A;  5KTQ A;  4CJ5 A;  4EAH D;  3CJ9 A;  3CF5 L;  4CZI A;  3K5O A;  5AQT A;  3HOT A;  1L3V A;  1Q81 O;  1IKW A;  1O13 A;  5AZI A;  4PA1 A;  5AQV A;  1TVR A;  1CXU A;  2DFE A;  2EWS A;  4CEZ A;  1DT9 A;  4CHY A;  1W9H A;  3JS6 A;  4FJH A;  4BRC A;  1C0U A;  2HHT A;  4AIL C;  4IG0 A;  3OYC A;  2ZE2 A;  2GV9 A;  4I2P A;  5FRN A;  3EZ5 A;  3CCU N;  1S1W A;  3VEY A;  4CJL A;  3O80 A;  4FW2 A;  2Q31 A;  3NF9 A;  3SPZ A;  1LWE A;  3D2E A;  4BRN A;  1D9F A;  5FPE A;  1Q8I A;  2DTU A;  2VQF K;  4YOW A;  2FXU A;  4JKD A;  3E1Y A;  4DFJ A;  4OJR A;  4PQU A;  4Z4F A;  4JKB A;  4LF4 K;  2A1S A;  4FVM A;  1QHA A;  4B1X B;  4KRF A;  2O8B B;  4KHS A;  3G4S N;  3BGR A;  4XH4 A;  4I9L A;  3VEV A;  3QEW A;  1VSE A;  3A5O C;  3LAK A;  1BG3 A;  1CZA N;  2W6K A;  1VRT A;  3GL1 A;  3UKU A;  4WFB L;  5GAH P;  1X9J A;  3PIP L;  3WXM B;  4FW1 A;  3M8S A;  1TV6 A;  3G71 N;  4FK0 A;  1QQO A;  4CHZ A;  1WOQ A;  2ZQB A;  1WUA A;  4DFP A;  3PLA A;  2Y1J A;  1N33 K;  5KGX A;  4JI8 K;  2HNZ A;  2DFF A;  4LFB K;  1NU0 A;  3O9U A;  3RMB A;  1S1X A;  3O3G A;  4NYN A;  2Y1I A;  1U47 A;  1VSM A;  4BQZ A;  4JI1 K;  3I0S A;  2G8H A;  1XHZ A;  1U6Z A;  3VQP A;  3H3O B;  2HHI A;  4DU4 A;  3OJS A;  5HP1 A;  3H1V X;  2HST A;  1NJX A;  4H0T B;  4DTJ A;  3V6D A;  5BPL A;  4I7F A;  1J9A A;  4MFB A;  4J2A A;  5AR0 A;  1Q9X A;  4DTO A;  1YT3 A;  2B4J A;  2FSK A;  3EE9 A;  2YKM A;  3ULE A;  3HVT A;  1LW2 A;  2O8E A;  4N47 A;  2B5J A;  5CZ1 A;  1XMQ K;  1T44 A;  5HL7 L;  4KH5 A;  1IKV A;  4BY9 C;  4DSI A;  3AO1 A;  3VMF B;  5BRD A;  1NMN A;  4CF8 A;  4A62 A;  3ZSQ A;  2NZT A;  4F3O A;  3PUF A;  3QIO A;  4B8C A;  2F9T A;  4JS5 A;  4FK4 A;  3V9Z A;  4CJQ A;  4U67 L;  2E88 A;  4BR9 A;  2XO7 A;  4OGE A;  2ZJR L;  3NH1 A;  3RSE A;  3RMC A;  1DLO A;  2OPS A;  3A5N C;  1ZBS A;  4CD3 A;  3PO5 A;  1QQC A;  4B9U A;  4JI3 K;  3KK3 A;  2Z1I A;  3H45 C;  3I55 N;  2GEL A;  1I3A A;  1JL1 A;  2FBV A;  4E0D A;  4C8K A;  4ELT A;  1WSH A;  4Y1C A;  4RCH A;  4FLV A;  2GWJ A;  5DM7 L;  1HKG A;  3WEE B;  3DLH A;  3KKR A;  2YJE A;  5DMR A;  1QVG M;  3HPG A;  4DF8 A;  2QWP A;  4L8R B;  4WQ4 A;  1W97 L;  3HP9 A;  4BRD A;  1CZB A;  2YNF A;  3NF6 A;  5F0X A;  3CD6 N;  5JS1 A;  2IGI A;  3ZT4 A;  3SCX A;  1V4T A;  4IXC A;  3O5B A;  1NBW A;  1SAZ A;  3NGZ A;  3LP2 A;  3MN5 A;  3JXU A;  5J2M A;  4DV3 K;  4A61 A;  4QS7 A;  3UKU B;  1NK5 A;  2O8D A;  2NRZ A;  3SAG A;  4H0O A;  3OYB A;  3VEO A;  3O9Q A;  4PUO A;  1JLG A;  4EZ6 A;  2EX3 A;  2VWJ A;  1GOA A;  4K41 A;  2WUS A;  4JD2 B;  1RT6 A;  4BR5 A;  3RRH A;  1SKR A;  4BRA A;  2QWQ A;  5KI6 A;  3U3Y A;  4YNQ A;  4KH4 A;  3QIC A;  5AQM A;  2G8F A;  1BIS A;  3OS2 A;  2RPI A;  3HP6 A;  5BRH A;  1YVU A;  3CJ1 A;  3CXC M;  4IOC L;  3CCE N;  3CCQ N;  1VQN N;  3VPZ A;  3H08 A;  4QOZ B;  3P4I A;  3CER A;  3MCP A;  1SL1 A;  1RDC A;  1BO5 O;  3CET A;  1QQN A;  1TUU A;  2IIR A;  1NGI A;  2G8I A;  5CYQ A;  4CER A;  1HRH A;  3SJH A;  4IJA A;  5GAD P;  5HLF A;  3FZK A;  3P39 A;  1XMO K;  1S9G A;  2O8D B;  2C1I A;  2IVN A;  2X6N A;  3KKS A;  4MLH A;  4FPB A;  3VQ9 A;  4CEC A;  1NKB A;  3ZEU A;  2E2Q A;  2D0P A;  1HQU A;  3A8Y A;  4DV2 K;  2BDP A;  2WBN A;  4WF9 L;  3CJB A;  3P1G A;  4N76 A;  4FWO A;  4BGB A;  3GDQ A;  3J80 O;  3K59 A;  2YHA A;  2P9U B;  3OYK A;  2HHW A;  2P1J A;  3D2F B;  3NVK A;  3WNE A;  3F2K A;  1KCF A;  5H1S Q;  3WT0 A;  1GLL O;  5A2Q O;  4ISF A;  1B9D A;  3QFP A;  1A5V A;  3TI0 A;  2E5L K;  4PKH A;  4CHQ A;  1IO2 A;  3GE1 A;  4LFC K;  1IG8 A;  3L3U A;  5SZT A;  4M3R A;  1KAX A;  5CY4 A;  3CCR N;  1QSL A;  1OH7 A;  4CEF A;  4BRI A;  2UYT A;  5C2D A;  4BRP A;  3HYF A;  2Q2R A;  2P9L A;  4E19 A;  3U6F A;  3QFU A;  1VQP N;  1NK4 A;  4M3X A;  3VEW A;  3ZT3 A;  3C7N A;  1IKY A;  2KFN A;  2G8K A;  4DR3 K;  3SBG A;  1BHL A;  1RT1 A;  3AVL A;  3CMA N;  3L4Q A;  1KLM A;  4MLE A;  4KHU A;  4CGJ A;  4CJ7 A;  4DUZ K;  3VA0 A;  3NGY A;  3TAM A;  2XHB A;  2ZWH A;  4FWM A;  4EHT A;  2UU9 K;  3BEX A;  2FBX A;  4LF7 K;  1SS6 A;  3P83 D;  3KLH A;  3ULE B;  1QHT A;  1DTT A;  4HHT A;  1RTI A;  1U2V A;  4DSF A;  2ZGZ A;  4YOT A;  2E2P A;  1MWM A;  4YDU C;  2ATQ A;  1X1P A;  4OPH A;  3MEE A;  1NK0 A;  4IO9 L;  1ZYQ A;  3OYI A;  1J5E K;  3J8A A;  3QEX A;  4FLX A;  1KFS A;  2YNG A;  4YHH K;  3DWL A;  3MX2 A;  4YY3 K;  2A40 A;  1RT3 A;  3TPQ A;  5C12 A;  4CJ4 A;  4E89 A;  3MN7 A;  3ZLJ A;  4GKJ K;  1BGX T;  1UA0 A;  3BZK A;  4B1Y B;  4CK3 A;  1ZBL A;  1E4F T;  3VEZ A;  5FDL A;  3VF2 A;  3VQ5 A;  5LJV A;  4XIU A;  2VWK A;  3FZF A;  3MXJ A;  3QML A;  4IEE A;  1IBL K;  3OYD A;  5J2P A;  3R1X A;  5C0Y A;  2NNW A;  1YJ9 N;  2QWR A;  1RBV A;  4ISG A;  2BGG A;  1EXQ A;  1RT7 A;  4CHO A;  4NCB A;  1RDA A;  2W42 A;  4BE1 A;  2HHH K;  5M1K A;  4FWP A;  3HM8 A;  4BRF A;  4C8M A;  1E4G T;  4LSN A;  2P9U A;  3AVG A;  3EKS A;  4FPA A;  3I8B A;  4XJX A;  4E7K A;  3VF4 A;  4DTX A;  1N36 K;  3AA3 A;  4FJG A;  4N5S A;  4AHU A;  4Z4H A;  1GOC A;  4DR7 K;  4IDK A;  1LWF A;  1YUW A;  4M3W A;  1GLF O;  4GV6 A;  3TAR A;  1IG9 A;  2KLA A;  3SQ2 A;  3HPH A;  2LSN A;  1YI2 N;  3OJU A;  2A3Z A;  2RE2 A;  1HLU A;  1C0F A;  3C94 A;  1NM1 A;  4KFB A;  1W0H A;  2RF2 A;  5I42 A;  1YF5 L;  4Z4G A;  1N8R O;  5BN9 A;  3M8R A;  3R6M A;  2WC9 A;  1NJZ A;  1U49 A;  1VQ4 N;  4JN4 A;  1JLF A;  1KTQ A;  1SUQ A;  5M1N A;  4GVM A;  4LH5 A;  2AJQ A;  3K9K A;  3RMD A;  1L3U A;  3AVJ A;  2YHY A;  4MO4 A;  3UIQ A;  5C10 A;  1HNX K;  4DV0 K;  1TGO A;  2HOE A;  3KLF A;  4F3T A;  1LW0 A;  4H5N A;  3MK6 A;  4WYB A;  3L8B A;  1GOB A;  1JLQ A;  4FM2 A;  3AY9 A;  3ZSW A;  3DAW A;  4FXD A;  2D0A A;  3AVM A;  1TL3 A;  1VQL N;  4Z4E A;  4DQQ A;  4FZZ A;  5FPD A;  3RSE B;  1DKG D;  1H1V A;  3AVB A;  3V4I A;  4B9Q A;  2E1Y A;  1K8A O;  3SQ1 A;  2J4R A;  5F1X A;  4IO8 A;  4X65 K;  4DTR A;  3FZH A;  1A5W A;  1KC8 O;  2IAJ A;  3N4Q A;  1S5J A;  3J81 O;  1Q86 O;  5E84 A;  1NGG A;  4AM6 A;  2ASM A;  3E9L A;  3VQQ A;  4KRE A;  1BI4 B;  3BF1 A;  4B9S A;  2NRH A;  4O44 A;  3CYM A;  4FWL A;  3DM2 A;  3CCL N;  3QEI A;  2AP1 A;  1NGC A;  1KSP A;  2QXL A;  3L2U A;  4FJK A;  3SQ4 A;  3DXK A;  1SL2 A;  1A5X A;  1E3M A;  5FLX O;  2JGU A;  3QES A;  3ID8 A;  5LL6 Z;  4LC9 B;  3K5L A;  4FK2 A;  1ZBH A;  1K73 O;  1ATS A;  3AO4 A;  4MDA A;  4CZM A;  1NGA A;  2WOM A;  1NJI O;  3I0R A;  4B1Z A;  1ATR A;  3OVN A;  2UUC K;  2A6A A;  3V9S A;  5KRS A;  2YI1 A;  1YXQ A;  1XI1 A;  1Q9Y A;  1ASV A;  4AF1 A;  1HJR A;  1NKC A;  4NCG A;  1SL0 A;  2KTQ A;  4HUG A;  3LWM A;  1OH5 A;  4F4K A;  5KPT A;  5EU7 A;  1SKW A;  2P51 A;  4OKK A;  1SZ2 A;  5EVZ A;  5IT9 O;  3J7Y P;  1OVQ A;  5HRR A;  4JHD A;  3WQT A;  4WE1 A;  2UUA K;  3CPW M;  4ILJ A;  4FOE A;  1NGE A;  1QZ5 A;  4JAX A;  4PKI A;  1QQM A;  3TSP A;  5AQY A;  3WXK A;  3NF8 A;  3BF3 A;  3VQ7 A;  4H03 B;  1VQK N;  4EP5 A;  1HPZ A;  1HUX A;  1ATN A;  4EZ9 A;  3U9D A;  4PKG A;  2OPR A;  4B1U B;  4EFH A;  1OH8 A;  2ITG A;  1JXE A;  2P9N B;  4XEI A;  4EP4 A;  1C6V A;  2D4W A;  1K6Y A;  3ULD A;  4F8R A;  4YOV A;  2HBK A;  3SV4 A;  1YAG A;  3LDO A;  3PIO L;  4W5N A;  2VGN A;  3CI5 A;  2B6A A;  4GNI A;  4UY8 O;  4CZE A;  5D3G A;  1MU2 A;  3BP8 A;  1NMD A;  4B9L A;  3O6W A;  4KTZ A;  3AGR A;  4IJN A;  4KHQ A;  1ASU A;  1TUY A;  3THX A;  1L5U A;  3MED A;  5GAE P;  3KZB A;  3NBP A;  3IDH A;  3DI6 A;  4BWM A;  3ZSZ A;  4PL7 A;  4FLY A;  1L3S A;  4C1N K;  4JI7 K;  5EXW A;  2QWN A;  4RW9 A;  2HND A;  2XY8 A;  1HNW K;  4CJK A;  5KQ8 A;  3CC7 N;  2ZM6 K;  4E1M A;  1XNQ K;  4BQL A;  3O4N A;  1YJW N;  1YJN N;  3LZJ A;  3ZSR A;  4PY5 A;  3P31 A;  3SK3 A;  3OYJ A;  2D0B A;  2PFU A;  3CJA A;  4DCH A;  2HNY A;  3ATU A;  2V51 B;  4DWI A;  1CLQ A;  4JK8 A;  2XRI A;  2KQ2 A;  3HBT A;  3G6E N;  3HZ6 A;  5FPM A;  2CGK A;  3TAG A;  4ELV A;  4CJS A;  1OVY A;  1S1T A;  4LH4 A;  4FWS A;  3F9M A;  4E7I A;  4X64 K;  4DFM A;  4J8F A;  2I5J A;  4FJM A;  1Y97 A;  5IWA K;  2HF4 A;  3M3Z A;  3T1H K;  1SKS A;  3E9O A;  3U8X A;  4JI6 K;  3TAN A;  5AQW A;  4DS5 A;  3WNH A;  3M8P A;  3K0S A;  5DK5 A;  3K57 A;  3EO3 A;  1NWK A;  1X3N A;  4YFU A;  5LMN K;  1RDD A;  4M63 C;  4CGH A;  1JCG A;  4GMJ B;  3EY1 A;  1FKO A;  4KB0 A;  1N34 K;  5EOY A;  4DSL A;  1RT5 A;  3SUP A;  4H5V A;  3DRS A;  4B3M K;  3UB5 A;  1ASW A;  1WSJ A;  3NGI A;  3FFI A;  1VSF A;  2YNI A;  4JKC A;  4LSL A;  4CGF A;  5LMU K;  3L3V A;  2IVO A;  4M7X A;  1TKT A;  1KVA A;  1OH6 A;  5ADX H;  3DRP A;  4CJ3 A;  2CGL A;  1EX4 A;  4BVO A;  2QWO A;  4JKF A;  1VHX A;  3WXJ A;  4CK2 A;  4B9M A;  4CJF A;  3WUH A;  5T7B A;  1IBK K;  3LM9 A;  3VQ8 A;  2VG6 A;  5GIO A;  1GLE G;  4JHD B;  3DOK A;  5JLH A;  2E8A A;  3SAH A;  4B1V A;  4OPJ A;  3C7N B;  4GY2 B;  3UKR B;  4DQR A;  1B92 A;  1WSG A;  2P9S A;  3JAM O;  4M3T A;  3AO2 A;  3IFR A;  5KQD A;  1Q7Y O;  3AAP A;  2NRV A;  2HBL A;  2X78 A;  1EO1 A;  2GWK A;  2HHS A;  4M42 A;  1KLN A;  2X74 A;  1ZXO A;  1RBR A;  4ZTJ A;  4KHY A;  3LL3 A;  3O3F A;  1RFQ A;  2NRW A;  1WBB A;  3UE5 A;  2JLE A;  3IKM A;  4BRM A;  4BRE A;  3C6U A;  3NAE A;  3H3N O;  4AQY K;  2HB5 A;  4FWQ A;  5SWM A;  4CFB A;  4FJI A;  1QE1 A;  4FWK A;  1HX1 A;  1TK8 A;  3ASM A;  2Z1H A;  4LFA K;  3J7Z O;  4LF6 K;  3O8M A;  4DV5 K;  3K9J A;  3WXI A;  1BI4 A;  3C0B A;  4A57 A;  1VSL A;  4M3Y A;  3ZT2 A;  3R8E A;  3D2F A;  4DQ8 A;  2IC3 A;  1S22 A;  1EET A;  4H8K A;  4LF9 K;  1ITG A;  4NCA A;  3KLG A;  3I33 A;  1HQE A;  3O1W A;  3HSC A;  3N4P A;  3ZSV A;  1WB9 A;  3IMX A;  5CHI A;  1IJJ A;  2P9I A;  1UWB A;  2NLX A;  4M3Z A;  4NB4 A;  3A2F A;  1HKC A;  3CC2 N;  3HOS A;  3O9R A;  1N6Q A;  5CZ2 A;  3V9X A;  4ILG B;  3HI0 A;  4HCC A;  2GUP A;  3L0Q A;  5AQL A;  3VF6 A;  4AHV A;  3E9P A;  1Q82 O;  1MA9 B;  4HVJ A;  3CCS N;  2O8C B;  1ZC6 A;  4L3Q A;  5HRP A;  4EHU A;  5C2F A;  4ZHR A;  4NLC A;  3PX6 A;  1RBS A;  2ASO A;  4CZH A;  3PX4 A;  4O0J A;  3KK1 A;  4OKJ A;  1F21 A;  4KV8 A;  3OYF A;  3QER A;  4E7L A;  4BRQ A;  1BL3 A;  3TTF A;  3EKU A;  1JCE A;  5BR9 A;  4OLA A;  1UAX A;  5JEN A;  5JMV A;  4NXN K;  4OKE A;  1QS4 A;  4O0I A;  4OGC A;  1KFD A;  4MDB A;  2F7T A;  3RR8 A;  4C8L A;  3TWH A;  1WBD A;  1MWK A;  4ISE A;  1QTM A;  2YHW A;  3LAN A;  3HRG A;  2HHV A;  1KAY A;  1R59 O;  2ZJP L;  3DJC A;  3S9H A;  2PYL A;  3THW B;  1S1V A;  3E66 A;  1YTU A;  2HHU A;  4DU3 A;  4E7J A;  2BAN A;  1WSE A;  1WSI A;  3SUN A;  3C95 A;  4BE0 A;  4DFK A;  3I56 N;  5AZJ B;  3QIN A;  1VQ5 N;  3T7Z A;  1GLD G;  3HT3 A;  3AA2 A;  1U48 A;  5CE3 A;  1M1K O;  1IV0 A;  1JLA A;  3G25 A;  4JKA A;  4H5R A;  3HO1 A;  1Z26 A;  2A42 A;  4FJJ A;  2O4I A;  4ID5 A;  4BEB A;  3WQU A;  4DSE A;  3TAE A;  5EX5 A;  2Q97 A;  3OTO K;  3TR8 A;  2R7Y A;  2F9W A;  4CBX A;  3CPE A;  4OO1 J;  1C0G A;  3O1B A;  4CHN A;  1GLA G;  4DR6 K;  2C1G A;  4CF0 A;  4OLB A;  3U4L A;  3V9U A;  4FSV A;  4C8O A;  4LF8 K;  3NDK A;  3VGK A;  2P9L B;  4HUE A;  4J2E A;  4DV7 K;  3FZM A;  1W7A A;  3V1R A;  4FJ7 A;  4JYA K;  3KLE A;  4OVL A;  3C6H A;  4C23 A;  4E7H A;  1JLE A;  5BPM A;  3CM5 A;  1GLC G;  3S3M A;  2VWB A;  4CBW A;  4FCY A;  1JLC A;  5M1F A;  3K5M A;  4CJT A;  2P9P A;  2XY5 A;  4DQS A;  4CF1 A;  1Z6R A;  3KK7 A;  4KO0 A;  5FRM A;  3O4W A;  4CZL A;  4W5Q A;  4Z0U A;  3TAB A;  3SJJ A;  4CIE A;  4AHS A;  3LP3 A;  2D1K A;  2F4V K;  3CFP A;  3AVK A;  3WEE A;  4DF4 A;  3FZL A;  2ZF5 O;  3NH2 A;  4CEB A;  4G1Q A;  3RMA A;  2H3G X;  3OBY A;  4IKF A;  1K8K B;  1D4X A;  4CFC A;  1VQ7 N;  2PY5 A;  4EIA A;  3QET A;  1BOT O;  3QNO A;  4O55 A;  3KJV A;  4B9V A;  2QKB A;  3HXM A;  4QS8 A;  1TAQ A;  3H1Q A;  3T1A A;  1VQ9 N;  3G0Z A;  1RT4 A;  4JKH A;  4CGD A;  4JS4 A;  1LAW A;  5GIP A;  4DTM A;  1P90 A;  3D0P A;  2OYQ A;  4FL9 A;  3OW2 M;  5AQR A;  1IKX A;  3L4I A;  4KB1 A;  3MXI A;  3J7A P;  4FJ5 A;  1JL2 A;  3HL8 A;  3AVA A;  3MMV A;  5E26 A;  3IUC A;  3ZX3 A;  2PBD A;  4CES A;  1RBU A;  5JVH L;  3BUZ B;  1KD1 O;  4GV9 A;  3IS9 A;  3VQA A;  4YDU A;  1U04 A;  5HOO A;  4OX9 K;  3LDL A;  3FR0 A;  3S5T A;  4OPK A;  4BC3 A;  3AGK A;  1RCH A;  1ZBU A;  3C65 A;  1W2B M;  2NRR A;  3Q7C A;  2BE2 A;  3R3L A;  4BDP A;  3KVG A;  5CR4 A;  3CQY A;  3S3N A;  2RHK A;  4BC2 A;  4JK9 A;  1K9M O;  3EYZ A;  2I7P A;  4BE2 A;  4PWD A;  3CM6 A;  3TAP A;  4B8A B;  3OYA A;  2NRX A;  1RT2 A;  1SQK A;  4V19 S;  3L2V A;  3EE8 A;  1UA1 A;  2UXD K;  4H0V B;  5F2R A;  2OPP A;  1NGH A;  4Q0B A;  4A5A A;  1S3X A;  3OYL A;  3LDS A;  1J5O A;  1EP4 A;  2RKI A;  3QLH A;  3S41 A;  3VTI A;  1XNR K;  3SMS A;  1T03 A;  3HVR A;  2JWK A;  3PO4 A;  2FSN A;  1LCU A;  4FM0 A;  2Q0R A;  3GG4 A;  3VN5 A;  4H5T A;  3RRG A;  2Z1G A;  4FWN A;  4H5W A;  4IFE A;  5AQZ A;  3F5T A;  4LF5 K;  1S1U A;  3L2Q A;  3GBT A;  2E2O A;  3SUO A;  1NGJ A;  1YIT N;  4BR4 A;  3LAL A;  4KH6 A;  4DMN A;  1X3M A;  3NH0 A;  4DR5 K;  3A5M C;  3HJF A;  3LDQ A;  3OYE A;  1X9W A;  2UXB K;  1RBT A;  1JLB A;  3CME N;  4DR4 K;  2HW3 A;  1NLV A;  3DLB A;  2PAV A;  3PY8 A;  4JKG A;  2I7N A;  4BE7 B;  2F8S A;  5AQH A;  4BRK A;  1C1B A;  3VQ6 A;  4C1N I;  3DLL L;  1XUP O;  1LAV A;  4TSX A;  2FLO A;  3T19 A;  4IZ9 A;  3LP0 A;  4BAC A;  4DSJ A;  3AO5 A;  2G8U A;  4ELU A;  2YX6 A;  4MO5 A;  5C24 A;  1YHQ N;  4CZF A;  3B6P A;  2O8E B;  4I6M A;  1NGF A;  3LAM A;  4NO7 A;  4CE9 A;  4CIF A;  3W0L A;  1TKX A;  1D9D A;  4O4G A;  1NK7 A;  4DTS A;  1LOT B;  2E6M A;  3MEC A;  1HYV A;  3ATV A;  3ZX2 A;  1Y64 A;  5K14 A;  3CFR A;  4M45 A;  4BVP A;  1VSH A;  4GVE A;  4QS9 A;  3KD1 E;  4CF9 A;  4BRL A;  2V7Z A;  3QO9 A;  2YHX A;  3F73 A;  3FGU A;  4BC5 A;  3FFK B;  2GUI A;  4DKW A;  3B6O A;  3I8D A;  3ZT0 A;  3CJ7 A;  5C42 A;  3ITH A;  1TK0 A;  1FW6 A;  3Q7B A;  1D5A A;  4KPY A;  1WLJ A;  4IFV A;  1XHX A;  3AA4 A;  4A2B A;  4BDY A;  2JWL A;  3HTV A;  1J53 A;  4J2D A;  1BIU A;  1I39 A;  1XQS C;  4JRQ A;  3AVH A;  3OA9 A;  3KK2 A;  4BRG A;  4FLZ A;  4DQP A;  4CW7 B;  3JYT A;  5B8H A;  3QBX A;  2D0C A;  2HF3 A;  4WQ4 C;  2FF6 A;  2IOC A;  4BRH A;  2VYP A;  5AQP A;  4K8Z A;  4RG8 A;  3V9W A;  2Q0U A;  2P5G A;  4BR2 A;  3ZET B;  4H0Y B;  4Y0W A;  3QEV A;  1HYZ A;  4C8N A;  4FJ8 A;  3QDK A;  2A1R A;  1FJG K;  3VEX A;  4DB3 A;  4JV5 K;  1BIZ A;  1LWC A;  1JJ2 M;  2CH6 A;  1HR0 K;  1V4S A;  4H0X B;  5DM6 L;  4IEI A;  3T69 A;  2W41 A;  5ELZ A;  4K25 A;  1RDB A;  4RW6 A;  4CJV A;  1L3T A;  2P9I B;  1GLB G;  4FLW A;  4F9O A;  1KAZ A;  3MCA B;  2ZGY A;  2WFB A;  4HWI A;  4XH5 A;  4FJX A;  3OYG A;  4AM7 A;  2QEX N;  1T3V A;  1HKB A;  3THX B;  4B3S K;  1EQY A;  5HBM A;  2D5R A;  3IAY A;  2GEM A;  2QM1 A;  2VG5 A;  5I9E B;  1EKE A;  2O4G A;  2P9S B;  3KD5 E;  2O8F A;  1YTA A;  4B3T K;  4I9Q A;  1BQN A;  4BEC A;  3KHY A;  3SZ2 A;  3D6R A;  5AQN A;  3DXK B;  1G99 A;  3ISN C;  4DHY A;  3CC4 N;  1T7P A;  1FXX A;  3DOL A;  4RTF D;  3WNG A;  2HBJ A;  3JSM A;  4Z4I A;  3EEQ A;  3ENB A;  5M1O A;  3VER A;  5AQJ A;  4O8K A;  5KPR A;  2YNH A;  3WXL A;  2Q3S A;  1BCO A;  1ZBF A;  2CGJ A;  2OTJ N;  3VEN A;  3HPO A;  2PZS A;  4FJL A;  1KXP A;  3EN9 A;  5AJ3 K;  4DR2 K;  4O8U A;  4CGI A;  1QSY A;  4CJP A;  4FO0 A;  4DV6 K;  4HCB A;  3MN6 A;  2KZZ A;  3OS0 A;  1O1W A;  2GTD A;  4CZK A;  3DMJ A;  4G9Z A;  1HYS A;  3GOI A;  4K8X A;  1C0M A;  3RWU A;  1TYQ A;  1UOC A;  3AA5 X;  4B9T A;  1VSI A;  3OHR A;  3SBT A;  2UUB K;  5KGW A;  2A41 A;  3NE6 A;  4X66 K;  4A2A A;  3TAQ A;  5M1Q A;  4FYD A;  3U3G A;  4RW8 A;  5MLC Q;  3SQ0 A;  3VA3 A;  2NRT A;  1WAF A;  4QAG A;  4J2B A;  1D8Y A;  2OAN A;  3V1O A;  2AA4 A;  5AQO A;  5GAG P;  5TKY A;  4FZY A;  4CJR A;  1RGI A;  5AQQ A;  3MXM A;  5LY3 A;  4BDZ A;  2ETJ A;  2YV0 X;  3SAF A;  1C1A A;  1BCM A;  3CIP A;  2E4L A;  2PYJ A;  1QVF M;  4KBO A;  2KKZ A;  1ILY A;  4DSK A;  4KKO A;  2ZJQ L;  4A59 A;  2ASP A;  1VRU A;  4E1J A;  3B8A X;  1NOY A;  3K58 A;  2FBT A;  5AFU H;  4B3O A;  3KWG A;  1MDU B;  3SLC A;  3SNN A;  1VQM N;  4JI5 K;  1BUP A;  4IOA L;  1TK5 A;  3PSF A;  4BC4 A;  1CZ9 A;  4PHT X;  3OYH A;  4LD0 A;  2YKN A;  3CJC A;  4E1N A;  2RN2 A;  4DTN A;  4CEO A;  3QNN A;  5ADX A;  4JEP A;  1KQS M;  2A5X A;  1S6P A;  4CGG A;  4FZX C;  2VG7 A;  1NK9 A;  1NK6 A;  2GBZ A;  3VQD A;  3CCV N;  4FVU A;  3O08 A;  2BTF A;  5AFU A;  5KRT A;  1LV5 A;  2IS3 A;  1JCF A;  4ICL A;  1IH7 A;  3D2E B;  3NF7 A;  4M7Y A;  3LPU A;  5J2Q A;  1T6C A;  4Y1D A;  3BY5 A;  2FBY A;  1DGK N;  4Q5V A;  3M1F A;  3K2P A;  2VCP A;  4ILH A;  4AHC A;  3THY A;  3AV9 A;  4IG3 A;  3DYA A;  3HK2 A;  4GKK K;  3ENH A;  2OCE A;  1NOZ A;  2DFH A;  3CYG A;  2P9N A;  2Q1N A;  4QCL A;  3SI6 A;  5I3U A;  3AVI A;  2E20 A;  3LZI A;  2D0O A;  5HRS A;  2HHQ A;  3SV3 A;  4CEA A;  2HMI A;  1IBM K;  1QSS A;  2QW9 A;  3EZW A;  4W5O A;  4JD2 A;  2UXC K;  3LWL A;  2O8F B;  3SPY A;  4M3U A;  4JKG B;  1VQ6 N;  3MEG A;  2IDO A;  4B1W B;  2YJF A;  4JI2 K;  1T05 A;  1J6Z A;  3SYZ A;  4BR0 A;  4BG9 A;  4DUY K;  3DXM A;  3NVM A;  4WQ5 C; 
#chains in the Genus database with same CATH homology
 2ZF5 O;  3O9U A;  3CQX A;  2QTD A;  3ID8 A;  4HTL A;  2H3G X;  3OBY A;  4LC9 B;  1K8K B;  1D4X A;  3RVC A;  1VQ7 N;  1VAZ A;  4BQZ A;  4EIA A;  1BOT O;  1K73 O;  1ATS A;  4MDA A;  4CZM A;  1NGA A;  1U6Z A;  4WFN L;  4BG8 A;  1NJI O;  4QS8 A;  5LJW A;  3H1Q A;  3H3O B;  3MN9 A;  1ATR A;  4B1Z A;  1VQ9 N;  2W00 A;  3H1V X;  2HST A;  2A6A A;  4H0T B;  4JKH A;  5GIP A;  5BPL A;  1P90 A;  2YI1 A;  4CZJ A;  4FL9 A;  3OW2 M;  1YXQ A;  4K43 A;  5AQR A;  3VES A;  5AR0 A;  3L4I A;  3ZEU B;  3TU5 A;  4AF1 A;  2V7Y A;  4GV3 A;  2FSK A;  3TSU A;  3EE9 A;  3SMP A;  3CHW A;  3ULE A;  5AZJ A;  3D7E O;  3MMV A;  5E26 A;  3VGL A;  5JLF A;  3IUC A;  4CD1 A;  3NMU A;  1T44 A;  2PBD A;  3TTC A;  3ZX3 A;  5HL7 L;  5JVH L;  5KPT A;  3BUZ B;  3DXM B;  4KH5 A;  5EVZ A;  1KD1 O;  1SZ2 A;  4GV9 A;  4BY9 C;  1BA1 A;  4YDU A;  2ITM A;  1VQO N;  4JHD A;  3VMF B;  3H46 O;  3WQT A;  5BRD A;  5HOO A;  5AQX A;  3LDL A;  3FR0 A;  2FSJ A;  3CPW M;  4A62 A;  4ILJ A;  2NZT A;  4FOE A;  1NGE A;  4BC3 A;  5AQK A;  1QZ5 A;  3AGK A;  5M1P A;  3C65 A;  4JAX A;  2F9T A;  4PKI A;  1QQM A;  3TSP A;  5AQY A;  2NRR A;  3Q7C A;  3WXK A;  1W2B M;  3R3L A;  4U67 L;  2E88 A;  2P9K A;  3KVG A;  4BR9 A;  5CR4 A;  3CQY A;  3BF3 A;  2RHK A;  4BC2 A;  4H03 B;  4JK9 A;  2ZJR L;  1K9M O;  2I7P A;  3RSE A;  1S72 N;  1VQ8 N;  1VQK N;  1HUX A;  1ATN A;  3U9D A;  4PKG A;  2NRX A;  4I6M B;  4B1U B;  4EFH A;  3A5N C;  1SQK A;  1ZBS A;  4CD3 A;  4WCE L;  2P9N B;  3EE8 A;  4XEI A;  2D4W A;  2CH5 A;  1HPM A;  4H0V B;  3H45 C;  5F2R A;  1NGH A;  3AAR A;  4YOV A;  2HBK A;  4A5A A;  3I55 N;  1S3X A;  1YAG A;  2GEL A;  3LDO A;  3PIO L;  2VGN A;  3CI5 A;  4CZG A;  4GNI A;  3S41 A;  3VTI A;  4UY8 O;  3SMS A;  5AQU A;  3UKR A;  4CZE A;  2JWK A;  1Z05 A;  2FSN A;  3BP8 A;  1LCU A;  4RCH A;  1NMD A;  2GWJ A;  5DM7 L;  2Q0R A;  3GG4 A;  1HKG A;  3O6W A;  3WEE B;  4H5T A;  2YJE A;  4FWN A;  4H5W A;  3AGR A;  4IFE A;  4IJN A;  3F5T A;  2QWP A;  5AQZ A;  1QVG M;  4WQ4 A;  1W97 L;  3GBT A;  1U2V B;  1TUY A;  2E2O A;  4BRD A;  5F0X A;  4IDH A;  3CD6 N;  1NGJ A;  1YIT N;  4BR4 A;  5GAE P;  3KZB A;  4KH6 A;  1V4T A;  2HBM A;  3IDH A;  1X3M A;  3O5B A;  1NBW A;  3A5M C;  4IXC A;  4PL7 A;  3LDQ A;  4C1N K;  3LM2 A;  5GIN A;  1SAZ A;  5EXW A;  2QWN A;  3EL2 A;  5BRF A;  3W3D A;  3MN5 A;  3JXU A;  3CME N;  5KQ8 A;  4A61 A;  4QS7 A;  1NLV A;  3UKU B;  3CC7 N;  2PAV A;  2NRZ A;  5TKW A;  3SAG A;  4H0O A;  4JKG A;  4BQL A;  2I7N A;  3VEO A;  3O9Q A;  4BE7 B;  5BRE A;  2QI2 A;  5AQH A;  4BRK A;  1YJW N;  4XH1 A;  4C1N I;  3DLL L;  1YJN N;  1XUP O;  4K41 A;  2WUS A;  4JD2 B;  2FLO A;  4BR5 A;  4FWR A;  3P31 A;  3SK3 A;  4IZ9 A;  2QWQ A;  4IOX A;  3TSQ A;  4BRA A;  4Z94 A;  3CJA A;  2PFU A;  4DCH A;  4KH4 A;  3QIC A;  5AQM A;  3ATU A;  2V51 B;  2YX6 A;  2HMP A;  4MO5 A;  2DPN A;  3QBW A;  3VET A;  1YHQ N;  4CZF A;  4JK8 A;  5BRH A;  1BU6 O;  4I6M A;  4U7B A;  1NGF A;  1BA0 A;  3CJ1 A;  4NO7 A;  3CXC M;  4IOC L;  3CCQ N;  3CCE N;  3VPZ A;  1VQN N;  3W0L A;  3HBT A;  3P4I A;  3CER A;  3MCP A;  3G6E N;  3HZ6 A;  5FPM A;  3MWP A;  1BO5 O;  1LOT B;  2CGK A;  3ATV A;  3CET A;  1QQN A;  5KPZ A;  1OVY A;  3ZX2 A;  1TUU A;  1Y64 A;  2IIR A;  4BR7 A;  4FWS A;  1NGI A;  3F9M A;  4J8F A;  4BVP A;  3SJH A;  4IJA A;  4GVE A;  4QS9 A;  5GAD P;  3FZK A;  3P39 A;  2HF4 A;  3M3Z A;  2QWL A;  2V7Z A;  4BRL A;  1P8Z A;  2IVN A;  2YHX A;  4FOI A;  2C1I A;  4MLH A;  3FGU A;  3E9O A;  3FFK B;  4FPB A;  4BC5 A;  3CCJ N;  3U8X A;  3U9Z A;  4DKW A;  2W40 A;  3MWT A;  5AQW A;  2E2Q A;  3ZEU A;  4IWV A;  3CJ7 A;  2D0P A;  4YOY A;  3VOV A;  3A8Y A;  2BH1 A;  3Q7B A;  3ENO A;  2WBN A;  4WF9 L;  3CJB A;  3EO3 A;  1TYQ B;  4FWO A;  1NWK A;  4BGB A;  3GDQ A;  1X3N A;  4A2B A;  2P9U B;  4JKE A;  4M63 C;  2JWL A;  1JCG A;  3HTV A;  3MDQ A;  3D2F B;  3NVK A;  3F2K A;  5EOY A;  3M5R A;  1XQS C;  5H1S Q;  3WT0 A;  3OA9 A;  4H5V A;  4PL8 A;  4BRG A;  1GLL O;  3UB5 A;  4ISF A;  3QFP A;  4JKC A;  3MX5 A;  5B8H A;  3QBX A;  2HF3 A;  4PKH A;  4WQ4 C;  2FF6 A;  2VYP A;  2IVO A;  4M7X A;  5AQP A;  3GE1 A;  4BRH A;  1IG8 A;  2Q0U A;  3O9S A;  5ADX H;  4BR2 A;  3ZET B;  2QA4 N;  2CGL A;  4H0Y B;  4Y0W A;  1KAX A;  4BVO A;  2QWO A;  1K8K A;  3CCR N;  4JNE A;  2E1Z A;  4JKF A;  3WXJ A;  4BRI A;  2UYT A;  3QDK A;  4BRP A;  5C2D A;  3WUH A;  4YOX A;  2Q2R A;  2P9L A;  3LM9 A;  5AQF A;  3QFU A;  3VEX A;  4DB3 A;  1VQP N;  3VEW A;  3C7N A;  5GIO A;  3FLC O;  1GLE G;  4NLB A;  4JHD B;  5JLH A;  2V52 B;  2E8A A;  3SAH A;  3SBG A;  5EY4 A;  1BWF O;  1JJ2 M;  2CH6 A;  4B1V A;  3C7N B;  1XC3 A;  3CMA N;  1V4S A;  3L4Q A;  4H0X B;  4GY2 B;  3ZYY X;  1GLJ O;  3UKR B;  2P9S A;  4MLE A;  5DM6 L;  4IEI A;  3T69 A;  2P9P B;  2W41 A;  5AQS A;  5ELZ A;  4K25 A;  2Q36 A;  3QB0 A;  4CJ7 A;  3IFR A;  3ZET A;  5KQD A;  1Q7Y O;  2P9I B;  3AAP A;  1GLB G;  4F9O A;  3OBW A;  1KAZ A;  4YOR A;  3MCA B;  2ZWH A;  4FWM A;  4EHT A;  2NRV A;  2HBL A;  2ZGY A;  2WFB A;  2GWK A;  3BEX A;  1EO1 A;  4HWI A;  1QZ6 A;  3CCM N;  4XH5 A;  1SS6 A;  1ZXO A;  3ULE B;  4AM7 A;  2QEX N;  1T3V A;  1HKB A;  1OKJ A;  1U2V A;  3LDN A;  3L6Q A;  3LL3 A;  1EQY A;  2ZGZ A;  1RFQ A;  5AQG A;  2NRW A;  1DEJ A;  5JVG L;  1ESV A;  4YOT A;  2E2P A;  3IKM A;  1MWM A;  3KWI A;  3UE5 A;  4YDU C;  4BRM A;  4BRE A;  2GEM A;  2QM1 A;  3H3N O;  4FWQ A;  5I9E B;  4OPH A;  2P9S B;  4YOU A;  4IO9 L;  4BEC A;  3KHY A;  4FWK A;  1HX1 A;  3J8A A;  3D6R A;  5AQN A;  1BDG A;  3DXK B;  1G99 A;  3DWL A;  2IVP A;  3MX2 A;  4DHY A;  3J7Z O;  3C6A A;  3O8M A;  4R79 A;  3CC4 N;  2A40 A;  2P9K B;  1T6D A;  4RTF D;  2HBJ A;  5AQI A;  3K9J A;  3TPQ A;  4JK7 A;  3WXI A;  5C12 A;  3C0B A;  4A57 A;  1YVN A;  3ENB A;  3P38 A;  1YIJ N;  5M1O A;  4WFA L;  2FF3 B;  3MN7 A;  3VER A;  5AQJ A;  4O8K A;  5KPR A;  3WXL A;  2CGJ A;  4B1Y B;  3R8E A;  3D2F A;  4DQ8 A;  3VEN A;  4O5F A;  2OTJ N;  1E4F T;  4K42 A;  3VEZ A;  3VF2 A;  3ZX0 A;  5LJV A;  2KHO A;  1S22 A;  1NGD A;  1KXP A;  3EN9 A;  3FZF A;  1RDU A;  4O8U A;  3QML A;  3I33 A;  4IEE A;  4BRO A;  4FO0 A;  3TTD A;  3O1W A;  3R1X A;  3MN6 A;  3A0I X;  5C0Y A;  4WQ5 A;  3HSC A;  3N4P A;  2NNW A;  3IMX A;  5BN8 A;  1YJ9 N;  2OTL N;  5CHI A;  1IJJ A;  3FE1 A;  2GTD A;  2P9I A;  2NLX A;  4CZK A;  4G9Z A;  4NB4 A;  3H6E A;  1HKC A;  3GOI A;  2QWR A;  3CC2 N;  3HOS A;  3O9R A;  1TYQ A;  4ISG A;  3O9T A;  3VGM A;  2GX9 A;  4ILG B;  3HI0 A;  4RWT A;  1NGB A;  3OHR A;  3SBT A;  1RDW X;  2GUP A;  3L0Q A;  4A5B A;  2A41 A;  3M6G A;  4FWP A;  3HM8 A;  5AQL A;  5M1K A;  3VF6 A;  4BRF A;  4A2A A;  3E9P A;  5M1Q A;  1HJO A;  1Q82 O;  2E2N A;  1E4G T;  1MA9 B;  2P9U A;  3CCS N;  5AZI B;  3EKS A;  2BUP A;  4FPA A;  5MLC Q;  2NRT A;  1ZC6 A;  3I8B A;  4L3Q A;  3VF4 A;  4XJX A;  4EHU A;  5C2F A;  2OAN A;  4NLC A;  2AA4 A;  2YCH A;  5AQO A;  4CBU A;  5GAG P;  5TKY A;  2ASO A;  4CZH A;  5BPN A;  2VGM A;  1RGI A;  1YUW A;  3A5L C;  1GLF O;  5AQQ A;  3AAQ A;  4GV6 A;  4BRQ A;  5FPN A;  5LY3 A;  3TTF A;  5JIC A;  3SAF A;  3EKU A;  2KLA A;  1JCE A;  5BR9 A;  3CIP A;  4CI6 A;  5JMV A;  4H0P A;  4BGA A;  1QVF M;  4KBO A;  3R9P A;  2KKZ A;  5C15 A;  1YI2 N;  1M90 O;  2A3Z A;  2RE2 A;  1ILY A;  1HLU A;  1C0F A;  3LDP A;  2ZJQ L;  1NM1 A;  2ASP A;  1Q18 A;  2F7T A;  4MDB A;  4A59 A;  2QWM A;  3ID6 A;  4E1J A;  3B8A X;  1MWK A;  4ISE A;  1YF5 L;  2YHW A;  4OPA A;  3VTH A;  5AFU H;  3HRG A;  3KWG A;  1MDU B;  3CJ9 A;  3SLC A;  4EAH D;  3CF5 L;  4CZI A;  1N8R O;  5BN9 A;  5AQT A;  1VQM N;  1KAY A;  1R59 O;  2WC9 A;  3R6M A;  3HOT A;  1BUP A;  2ZJP L;  3DJC A;  4JN4 A;  1VQ4 N;  1Q81 O;  4BC4 A;  4IOA L;  4PHT X;  1O13 A;  5AZI A;  3E66 A;  5AQV A;  5M1N A;  3CJC A;  3K9K A;  2EWS A;  1DT9 A;  3JS6 A;  4BRC A;  5ADX A;  4JEP A;  1KQS M;  2YHY A;  2A5X A;  4MO4 A;  5C10 A;  4FVU A;  3CCV N;  3I56 N;  3O08 A;  2BTF A;  5AZJ B;  5AFU A;  3CCU N;  2HOE A;  1JCF A;  1VQ5 N;  3D2E B;  1GLD G;  3T7Z A;  3VEY A;  3O80 A;  4M7Y A;  4H5N A;  3MK6 A;  4WYB A;  5CE3 A;  1T6C A;  1M1K O;  3G25 A;  2Q31 A;  3AY9 A;  4JKA A;  4H5R A;  3DAW A;  2A42 A;  1DGK N;  3D2E A;  4BRN A;  3M1F A;  1VQL N;  5FPE A;  4BEB A;  2VCP A;  2FXU A;  4ILH A;  3WQU A;  4YOW A;  4JKD A;  5EX5 A;  5FPD A;  2Q97 A;  3E1Y A;  2F9W A;  4CBX A;  3RSE B;  3CPE A;  4OO1 J;  4JKB A;  1C0G A;  1DKG D;  3O1B A;  1GLA G;  1H1V A;  2C1G A;  1QHA A;  4B1X B;  3ENH A;  4B9Q A;  2E1Y A;  3U4L A;  1K8A O;  4FSV A;  3G4S N;  2P9N A;  3VGK A;  2P9L B;  2Q1N A;  4XH4 A;  3FZM A;  3VEV A;  3A5O C;  1BG3 A;  2J4R A;  2E20 A;  1CZA N;  3C6H A;  2D0O A;  5F1X A;  4IO8 A;  4C23 A;  3GL1 A;  3UKU A;  4WFB L;  5GAH P;  3FZH A;  5BPM A;  1KC8 O;  1GLC G;  1X9J A;  3PIP L;  3N4Q A;  3WXM B;  2VWB A;  2QW9 A;  1Q86 O;  4CBW A;  5M1F A;  5E84 A;  1NGG A;  3EZW A;  4AM6 A;  4JD2 A;  2P9P A;  3G71 N;  2ASM A;  3E9L A;  1Z6R A;  1QQO A;  1WOQ A;  3KK7 A;  4JKG B;  1VQ6 N;  3BF1 A;  3O4W A;  2NRH A;  4CZL A;  4FWL A;  4B1W B;  3CCL N;  1NGC A;  2YJF A;  2AP1 A;  1WUA A;  2D1K A;  2QXL A;  1J6Z A;  3PLA A;  3WEE A;  4BR0 A;  4BG9 A;  3DXK A;  3DXM A;  3FZL A;  3NVM A;  4WQ5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...