3A5LC

Crystal structure of a dictyostelium p109a mg2+-actin in complex with human gelsolin segment 1
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
370
structure length
363
Chain Sequence
QALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAALNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAAAAIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Gelsolin
publication title Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 363
sequence length 370
ec nomenclature
pdb deposition date 2009-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5lC01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5lC02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3a5lC03
3J8AA 4H03B 4YDUA 3UKRB 1SZ2A 3D2EB 3MDQA 2WUSA 4CZHA 5BRFA 3EN9A 2A41A 5JMVA 4GY2B 2FSKA 3FZLA 5AQUA 2E8AA 4B1UB 4EHUA 3KZBA 3ATUA 4CJ7A 2VCPA 2Q2RA 4BC4A 4CBXA 1X3NA 5LJWA 1YXQA 3W3DA 2CGJA 4LC9B 4BC3A 5AQFA 1DGKN 4A2BA 1Z05A 4CZJA 3M3ZA 3FZFA 5AZJA 1HPMA 2YCHA 4H0OA 4BR0A 3BEXA 3JS6A 1ESVA 4H5NA 3ULEB 4CD1A 4RWTA 4HTLA 3MN6A 3IFRA 3MK6A 4QS8A 3BF1A 2UYTA 5ADXH 3KVGA 2FSNA 4CZLA 2ZGZA 3VOVA 2HF3A 1C0GA 3H6EA 5AQGA 4MLHA 4CZGA 2F9TA 1CZAN 4JHDA 4FWQA 1K8KA 5JLFA 2W41A 5EXWA 4BRAA 1RGIA 2QW9A 2QWOA 2NLXA 4BRMA 2P9SA 1BDGA 3CI5A 3OHRA 4C23A 3WXLA 4AM7A 1U2VB 3MMVA 4QS7A 3LDNA 1S3XA 1C0FA 1QQOA 4IWVA 5KPZA 3QB0A 2J4RA 3ATVA 2Q0UA 1DKGD 2ITMA 2P9IB 1MA9B 3A5MC 5JLHA 4F9OA 3AARA 3VGKA 3C7NB 1QQNA 5AR0A 5LY3A 1Z6RA 3VPZA 5AQRA 1LCUA 3LDOA 4BRNA 3VERA 2E1YA 3CJCA 2D0PA 1EQYA 3FLCO 2AP1A 3H45C 1BO5O 3WXKA 4O8KA 4NB4A 4BRHA 5FPEA 4DCHA 2V51B 1TUYA 3JXUA 2E20A 1NWKA 3I33A 3U9DA 4FWPA 1RDWX 2V7YA 4KBOA 3R6MA 4Z94A 1LOTB 5LJVA 3DXKB 3W0LA 3RSEB 1JCEA 3WUHA 3ID8A 3C0BA 3CJ9A 3HBTA 1OKJA 1NGBA 4JAXA 2ZGYA 3LL3A 4I6MB 4ISEA 4BROA 5BREA 2QWLA 3D2FA 4A61A 4H0PA 4BR4A 4A62A 1RFQA 3R8EA 2A5XA 1IJJA 4GNIA 5FPDA 3SJHA 3H3OB 4CBUA 2BTFA 3L0QA 2Q0RA 1KXPA 1MWKA 3CQXA 1NGIA 1HLUA 3CJ7A 4BR2A 3U8XA 4DB3A 2CGKA 5AQPA 2P9LB 4BRGA 5AQVA 1ATSA 3QFUA 2AA4A 4BRLA 3MCPA 4HWIA 1JCFA 2FLOA 2D0OA 3CERA 4BC2A 3CETA 4H0VB 5AQWA 5JICA 2DPNA 2F9WA 2GUPA 2VYPA 4B1ZA 3CIPA 4K43A 4L3QA 2YHXA 4RCHA 2P9UB 3UE5A 1GLBG 2ZF5O 5F2RA 3HI0A 2A40A 1J6ZA 2W40A 1X9JA 3VF2A 2QWPA 4BGAA 5EOYA 4CZEA 3BF3A 3O80A 1E4FT 2ASOA 4WYBA 3CQYA 2E2PA 1QHAA 1E4GT 3SLCA 3VEVA 5BRHA 1HKGA 3ZX0A 5F1XA 1GLJO 2GELA 3ZEUB 3VEWA 3O4WA 4RTFD 2QWRA 5CE3A 2CH5A 1WUAA 2ASPA 1NGCA 1HKCA 3UKUA 2QM1A 5AZIB 3HSCA 3O8MA 3U4LA 2IVOA 2EWSA 1QZ5A 1X3MA 2V52B 5AQSA 1QQMA 1HJOA 4A2AA 4EIAA 4XH4A 2KHOA 1NGAA 3WXJA 4MLEA 2NRHA 3H1QA 4DQ8A 3AY9A 5AQXA 2BUPA 1U2VA 2A42A 4XH1A 4M63C 2IVNA 3GBTA 5AFUH 5AQTA 4QS9A 1GLFO 2V7ZA 3QBXA 3ENHA 4JD2A 2E2NA 2P9IA 3H1VX 3DXMB 3B8AX 3C7NA 3VGLA 5AQOA 5FPMA 3A5LC 1BA0A 4H5RA 2ZWHA 4BRIA 4BQZA 2P9KB 3VENA 1ATNA 3CJBA 4PKHA 3CJ1A 3VESA 2P9PA 4CZMA 4JN4A 4DHYA 1WOQA 3SMSA 4B1YB 4PL7A 3DJCA 1NLVA 2PBDA 3VETA 4BREA 4FWSA 3ZETB 2NZTA 2D1KA 4IO8A 5AQLA 3FFKB 1U6ZA 3DXKA 3P4IA 5E26A 1NGEA 3HM8A 4FO0A 1NGDA 3BP8A 3WEEB 3VEZA 3HZ6A 3M6GA 3O5BA 4FWNA 4I6MA 3U9ZA 1V4TA 1ATRA 3QICA 3UB5A 1YAGA 1HUXA 3LM9A 4BR9A 1YVNA 5EVZA 2FSJA 1NMDA 2YJEA 5BN9A 4J8FA 1YUWA 3D7EO 5KQ8A 2FF6A 2PAVA 4FWKA 5BPLA 4PKGA 4BRCA 2HMPA 4PKIA 3LDPA 4H5VA 3KHYA 1GLEG 2YHYA 3EKUA 3MN7A 4BVPA 4WQ4C 1NGFA 1BWFO 2Q1NA 5TKYA 1H1VA 5AQJA 3WXIA 3ZX3A 3SMPA 3UKRA 4H0TB 1NM1A 3D2EA 5FPNA 4MO5A 4M7YA 1DEJA 3QFPA 5EX5A 4BRQA 4NO7A 1TYQB 3DAWA 1T44A 3F9MA 2P9UA 3L6QA 2H3GX 4WQ4A 4E1JA 2ASMA 2P9NB 5AQHA 3FR0A 2GEMA 3AAPA 4FOIA 3IUCA 4CZIA 1T6DA 2I7NA 4B9QA 4BRKA 3VEOA 4IJNA 4BVOA 4BRFA 4H0XB 5KQDA 1HKBA 4BRDA 4BG8A 3QBWA 5AQYA 3ZEUA 1NGJA 4BR5A 3ENOA 1GLCG 4FWOA 3ULEA 1BA1A 1T6CA 1NBWA 3A5NC 2CH6A 3MN9A 3QMLA 5AZIA 2Q97A 3FE1A 1D4XA 2IIRA 5AQIA 3L4IA 4PL8A 5KPRA 4BC5A 4H0YB 4B1XB 1MDUB 1GLDG 3H46O 5AQNA 4M7XA 2E2OA 5BN8A 1BUPA 4FSVA 5ADXA 2QWQA 5BPNA 5AQZA 2HF4A 2OANA 3O1WA 5AZJB 3EZWA 4FL9A 4BQLA 4FPAA 4XEIA 2VWBA 5BRDA 4K41A 3UKUB 5E84A 5BR9A 2E2QA 3VEXA 1KAYA 1NGHA 2HOEA 1G99A 2GWJA 4CZFA 1NGGA 5EY4A 1SAZA 4EHTA 5I9EB 3IMXA 2GTDA 4JNEA 3DXMA 4FPBA 1BU6O 3EL2A 2I7PA 1K8KB 2D4WA 4JHDB 5ELZA 4BR7A 4CD3A 3I8BA 3TU5A 5AFUA 4ISFA 4ISGA 1P8ZA 1KAZA 5AQQA 2P9SB 3FZHA 2GWKA 2Q36A 2P9KA 4FOEA 3WQUA 5B8HA 5BPMA 3O1BA 1TUUA 1HX1A 1S22A 3GG4A 3FZMA 2IVPA 2QXLA 3R9PA 4O5FA 3TPQA 3WQTA 4EAHD 3GDQA 3EO3A 2E1ZA 3GE1A 5F0XA 1BG3A 4AM6A 1IG8A 4XH5A 3VF6A 4JD2B 3LM2A 3ZETA 3A8YA 4IZ9A 3BUZB 4K25A 3MN5A 4FWMA 1XC3A 3O08A 4WQ5C 1BOTO 2QWMA 4Y0WA 3RSEA 3M1FA 2YJFA 1JCGA 4IJAA 3GOIA 1Y64A 3WEEA 3EKSA 4IXCA 3A5OC 3LDQA 3AAQA 2A6AA 2E88A 2P9PB 4FWRA 3VF4A 4WQ5A 5KPTA 3VEYA 1ZC6A 3SK3A 1Q18A 4BRPA 1XQSC 2FF3B 4H5WA 3ZX2A 2Q31A 3VGMA 3FGUA 3WT0A 2P9LA 3S41A 4B1WB 3CHWA 1GLLO 2YHWA 4K42A 3HTVA 3H3NO 1MWMA 1SQKA 3D2FB 1R59O 2A3ZA 3QDKA 3G25A 5AQMA 1ZXOA 1ZBSA 3GL1A 4BGBA 3CJAA 1GLAG 2FXUA 1TYQA 1V4SA 3O6WA 4MO4A 4YDUC 4CZKA 2QWNA 4BG9A 3IDHA 3LDLA 4B1VA 4CI6A 5AQKA 2P9NA 4FWLA 4EFHA 2YI1A 3DWLA 4CBWA 3FZKA 3A0IX 1XUPO 1QZ6A 1KAXA 4H5TA 2CGLA
chains in the Genus database with same CATH superfamily
3CD6N 4E7JA 3HK2A 3UKRB 1SZ2A 1HRHA 3D2EB 3RMAA 4CZHA 3EN9A 1D8YA 4CHPA 5IT9O 4DS5A 4CJTA 4J2EA 4IOAL 1FJGK 3MX2A 2E8AA 1WSJA 3MEDA 3TAPA 3OYFA 3K9KA 4ID5A 1O1WA 2HHXA 1F21A 5LJWA 1YXQA 2BANA 2VGNA 3QINA 3CFOA 3THWB 1DGKN 4CZJA 5AZJA 4FYDA 4LD0A 3KK1A 4CD1A 5DM7L 5GAHP 1OH6A 2YHAA 2ZGZA 2UUCK 2HF3A 1C0GA 2RN2A 5AQGA 1ITGA 1CZAN 2YX6A 3C6HA 3BDPA 2QW9A 1WSIA 3KK3A 1BDGA 3CI5A 1JJ2M 4B9LA 4AM7A 1S3XA 5KGXA 5KPZA 3AO1A 3VGKA 2Y1JA 4PUOA 3C7NB 5LY3A 2OTJN 2YHBA 3VQ5A 3CQ8A 3PX0A 1RT3A 2UXDK 1QSLA 1DLOA 3FLCO 1SV5A 2OZSA 3H45C 1BO5O 4O8KA 4BRHA 5FPEA 1J54A 2O8EB 2V51B 3VQPA 3NMUA 1NWKA 3I33A 1RDWX 2V7YA 4FJGA 3DLKA 4YOWA 4EZ9A 1JCEA 4B8AB 1T3VA 4CVNE 3TSUA 4KTWA 4YOXA 1OKJA 1YTUA 3PX6A 1Z25A 2ZGYA 4ISEA 2JGUA 2QWLA 2G8WA 1HNWK 4A61A 3D6RA 4H0PA 1RFQA 3SJHA 3H3OB 3L0QA 2P9LB 2RHKA 4BRGA 5M1KA 4B8CA 4B08A 3MWPA 4FW1A 3THYB 4I2PA 3MCPA 1JCFA 2DFFA 4E7KA 4KH6A 4FJNA 4BC2A 2HHWA 5AQWA 5JICA 2GUPA 4K43A 1UA1A 2QI2A 2IS3A 4KHQA 1JL2A 2YHXA 3UE5A 3DLGA 3KK7A 3I56N 4K8XA 1J6ZA 2W42A 1X9JA 1OVQA 2FBVA 3NH1A 3AVIA 1GOBA 2E2PA 1E4GT 3SLCA 5F1XA 1T7PA 4N47A 2GELA 3L2RA 3CC4N 1RTDA 3CMAN 1JXEA 3AVJA 3KKRA 2QM1A 3CF5L 3U4LA 2QKBA 5GADP 2V52B 1QQMA 2XY8A 1GOAA 3SV4A 4A2AA 3K59A 4EP5A 1TKDA 2YV0X 3AA3A 3WXJA 4MLEA 2NRHA 3CCQN 3AY9A 4CJ5A 4JS5A 5AQXA 4B3TK 1N33K 1QE1A 2BUPA 4JKFA 2A42A 3AGRA 4M63C 4DSIA 4FLYA 3SPYA 1U04A 4QS9A 3LDSA 2UUBK 4CIGA 4KHNA 3QBXA 1WAJA 4N76A 3TANA 3B8AX 4CJKA 4GMJB 1HMVA 5FPMA 3A5LC 3DRSA 4H5RA 4BRIA 4BQZA 3CYGA 3HP9A 3FFIA 4CESA 4JK7A 3CFRA 4JKHA 3VENA 5GAGP 3EEQA 2G8VA 2HVHA 2OYQA 4JN4A 1LAWA 1WLJA 3WNFA 3RRGA 3DJCA 4DR2K 3AVKA 3VETA 4JKAA 4FJ8A 3EZ5A 1SKRA 3M8SA 3DXKA 3P4IA 3HM8A 1IH7A 1NK9A 1RT5A 4I6MA 4W5QA 1IKVA 3QICA 2HHSA 1YAGA 4YHHK 1HNZK 1OVYA 4BDPA 5BN9A 1TAQA 4FWKA 4DUZK 4PKGA 4BRCA 4NLBA 4BY9C 4DU3A 3LDPA 3C6TA 3SAGA 4H5VA 3DLLL 1WBBA 1GLEG 4KHWA 4BVPA 1QSSA 1BWFO 2Q1NA 4FCYA 3WXIA 4JI3K 3N4PA 1VQPN 1W7AA 3T3FA 2WONA 3QETA 1TYQB 3F9MA 1RT1A 1KCFA 1BQNA 4WCEL 3O3HA 1EX4A 4WQ4A 4OLBA 2YNIA 2E5LK 4ZHRA 4DSKA 3LALA 3AAPA 3RTVA 1Y97A 3O9UA 2I7NA 4B9QA 4IJNA 3NF9A 5E41A 1ZBFA 3ZEUA 1GLCG 3SBGA 1T6CA 1E3MA 3MN9A 4DV6K 4OVLA 5AZIA 3BZCA 2WTUA 3L4IA 1IO2A 3SNNA 1TV6A 3VQDA 4M7XA 4FSVA 4CERA 2XRIA 5BPNA 3VQ8A 2HF4A 2OANA 1VQ6N 1HYZA 4FL9A 4FPAA 4XEIA 5E84A 3VEXA 4QCLA 1XMOK 1VRUA 3HO1A 1UWBA 1VSFA 2OTLN 1FXXA 3E66A 3SQ1A 2QKKA 4JNEA 3DXMA 1BU6O 2I7PA 3I8BA 5AFUA 4DR5K 1SL0A 2DTUA 3LANA 2G8HA 4E1MA 3OYKA 2IDOA 2HNYA 4MFBA 4LF4K 4IKFA 3LWLA 4FOEA 3WQUA 5B8HA 5BPMA 1S22A 1RDUA 3FZMA 2E1ZA 1U4BA 3RMDA 3SPZA 3VF6A 3RMBA 3ZETA 1LAVA 2EHGA 3BUZB 4IZ9A 2W6KA 4K25A 1YT3A 3NH2A 4DR7K 4B3RK 1XC3A 1BISA 2XY5A 2QWMA 3RSEA 2NRWA 1NJXA 4MQ3A 1Y64A 3OYNA 3E9PA 3LDQA 4LFCK 1TK0A 1C0UA 3N4QA 3THXA 3V4IA 1ZBUA 2NRZA 4WQ5A 3VEYA 4DSLA 5C2DA 1TL1A 1XQSC 3HL8A 1BIZA 4IFYA 3G4SN 2FF3B 3CXCM 3FGUA 3WT0A 4CW7B 3ZYYX 4Q0BA 1RBVA 3S41A 3EY1A 4K42A 3HTVA 3OBWA 1NK0A 1S5JA 3KKSA 1NJWA 1ZXOA 3LWMA 1ZBSA 4IOXA 3G6EN 4FLUA 4B9NA 4RW9A 1K73O 3OS1A 4IFVA 3O3FA 1V4SA 4MO4A 2P5GA 2VGMA 4YDUC 4M41A 4FLVA 4BG9A 3IDHA 4CI6A 5AQKA 4EFHA 1I94K 1J9AA 2GUIA 4KI4A 4PWDA 3DWLA 4YOTA 4CBWA 4JRQA 2HNZA 4PA1A 3NH0A 4KTZA 3KD5E 5T7BA 2ITGA 4H03B 5FRMA 3J81O 3MDQA 1VQMN 5BRFA 2IOCA 2A41A 1VSLA 3PLAA 2KFNA 2FSKA 4Z4IA 5AQUA 4TSXA 4CJPA 3KZBA 4KO0A 3K9JA 3ATUA 2Q2RA 4NLCA 4BC4A 4FVMA 3W3DA 4JI5K 4LF5K 3AA5X 2CGJA 3DYAA 4CJEA 4DUYK 4OKKA 1Z05A 1BHLA 3M3ZA 3FZFA 4YFUA 1HPMA 1W9HA 2YCHA 4BR0A 3JS6A 4H5NA 4RW8A 4DFKA 4N41A 5HL7L 2X74A 3MN6A 4I7FA 1IBKK 2O8CA 3OYCA 4OPAA 3KVGA 1NJZA 1U48A 4CZLA 4U67L 5C12A 4DTUA 5GINA 4CZGA 2RF2A 4DMNA 1NK5A 4FWQA 1K8KA 4A57A 4GKJK 4BE2A 3AVMA 3NGYA 2UXCK 2HHIA 4DSJA 1WNSA 2RKIA 1CXQA 3OHRA 3J7YP 4BDZA 1U2VB 4YORA 2NNWA 2QK9A 3TARA 4BWMA 4JI2K 5IWAK 1QQOA 1L3UA 1TGOA 1KVAA 4O8UA 5HBMA 2VG6A 3VQ6A 4DTSA 3QB0A 2J4RA 2P51A 2Q0UA 1ZBLA 1K6YA 2P9IB 1XHXA 4FXDA 1VQ9N 4CHZA 4ILHA 4AQYK 1S1XA 2QXFA 3ZSRA 3J80O 3V9ZA 5AQRA 3LDOA 4AHCA 3VERA 3IAYA 2D0PA 3LPUA 1C1BA 3WXKA 2ZQBA 2BDPA 3NGIA 3L3UA 5TKWA 1TUYA 4FWPA 1C1AA 3KLIA 3V9SA 3R6MA 1XWLA 1KFDA 5LJVA 3WUHA 4F8RA 3QEVA 1NK4A 4H8KA 2XY7A 3G10A 1NK6A 1C0TA 4ID1A 2OPSA 5A2QO 1JLCA 3LL3A 2UU9K 2Y1IA 3D2FA 1LWCA 3QLHA 4A62A 3OYBA 1IJJA 4C8NA 2BTFA 1EKEA 3HM9A 4HCBA 2Q0RA 1TAUA 3CC7N 2E6MA 1L5UA 3MXIA 1HLUA 3K57A 2CGKA 1WB9A 3OYJA 3SAFA 4M3YA 3O3GA 5AQVA 3QFUA 3TAEA 2O8FB 5C24A 4KH5A 3R3LA 3TTDA 2ZD1A 4DV0K 4W5OA 3AA4A 2DPNA 3CG7A 4B1ZA 2PY5A 1CZ9A 3LAKA 2O8DA 4M3WA 4DQQA 2X6NA 4RCHA 1B92A 4KFBA 4GV9A 2F96A 2QWPA 4BGAA 5D3GA 5EOYA 3T1AA 3VTHA 3DRPA 3BF3A 3O80A 4CHOA 2ASOA 3AVFA 4NCBA 3DLBA 1FW6A 5LL6Z 1QHAA 4JS4A 2BGGA 1B9DA 2WOMA 3B6OA 4KB1A 3L2VA 3VEWA 5FROA 4BEBA 2JWLA 1WUAA 1NGCA 1HKCA 4JYAK 3DM2A 2G8UA 4AH9A 1IBMK 4JI7K 4CHNA 2G8FA 3O8MA 3MCAB 5FLXO 1W0HA 5AQSA 3C6UA 4EIAA 3ZT2A 1WSFA 2KHOA 3NFAA 1NGAA 5KRTA 5J2NA 3HOTA 3RR7A 4FJMA 1TKZA 1NOYA 1TKTA 4DQIA 4DV1K 4KHYA 1YJWN 3OVNA 1Q7YO 5CR4A 3LP0A 1VSIA 3LP3A 1LW2A 3ENHA 4JKBA 3J7AP 1BI4A 3C7NA 3KWGA 3VGLA 3L4QA 4M3RA 3KTQA 1BA0A 4CJSA 3V1RA 3EYZA 3OYAA 1RTHA 4IBNA 2P9KB 2DFHA 2HHUA 1RCHA 3P39A 3CJBA 2O8EA 2P9PA 3ZSWA 3KIOA 4B1YB 4PL7A 1NLVA 2PBDA 1VSDA 4DU4A 2NZTA 2Z1HA 2D1KA 4IO8A 1IG9A 4ICLA 5AQLA 4DFJA 3VQCA 3PO4A 3K0SA 3VQ4A 1NGEA 4JKEA 1D9DA 5J2MA 3WEEB 4FJ5A 3VEZA 1X9MA 3E1YA 1QHTA 3OA9A 4XIUA 3E9OA 1V4TA 2QTDA 3LM9A 2D0AA 5EVZA 1NMDA 4F3TA 2PYLA 4J8FA 1YUWA 1BQMA 2D0CA 3S3OA 1X9WA 1KAXA 4PKIA 2O8BA 2GBZA 1RTJA 2KQ2A 3OBYA 4RW4A 2YHYA 3THYA 5HRRA 4O0IA 4X66K 4JKGA 4OGCA 4B9SA 2OA8A 2F4VK 3MECA 3VQEA 1VQLN 5FRNA 1IV0A 3JAMO 4E72A 4PY5A 4AHRA 2NRVA 4ZTJA 1KTQA 1T44A 3DAWA 3TSPA 4DSFA 2H3GX 1HNIA 2IGIA 2GV9A 5AQHA 3ZSVA 2HSTA 4FOIA 2PYJA 1VQ8N 3IUCA 4CZIA 4BRKA 3DI6A 4BRFA 1HKBA 1NGJA 1UOCA 4KRFA 2YNHA 4WFNL 3ULEA 3A5NC 5DM6L 4O0JA 3QNNA 4E89A 5J1EA 2Q97A 2HB5A 1I3AA 5AQIA 3HT3A 4BC5A 4H0YB 2HHVA 3H46O 3CCMN 4DV2K 3QERA 1SL1A 4KI6A 3AVNA 1EETA 3EZWA 4LH4A 4FK2A 2KW4A 5FDLA 3AV9A 5BR9A 4IOCL 2E2QA 2JWKA 2AJQA 2A1RA 4CHQA 1Q9XA 5EY4A 5I3UA 1YVUA 2GTDA 2KKZA 4FPBA 4JHDB 5C10A 3TU5A 3F2KA 5CZ1A 1KLMA 3RVCA 5C25A 1SKSA 1TK5A 5KRSA 5AQQA 2P9SB 3FZHA 1EXQA 5GIPA 4I9QA 4CFBA 2Q36A 1NJIO 3O1BA 3BGRA 3TPQA 3R9PA 3T69A 4O5FA 3I8DA 3NGZA 1BIUA 4DU1A 1IG8A 3LM2A 2KZMA 3A8YA 3MN5A 1NK7A 3T1YK 3O08A 3OW2M 1YI2N 4DTOA 1Q86O 3M1FA 2YJFA 4IJAA 3GOIA 4Y1DA 4BE7B 4R79A 2RE2A 1N8RO 5HRPA 3RR8A 4IXCA 3A5OC 3TWHA 3AVAA 1HQUA 4FM2A 4IEEA 2E88A 4FWRA 1HYVA 3VF4A 4CJVA 1TVRA 1ZC6A 4BRPA 1S6QA 4QOZB 4DV4K 1RNHA 3U3YA 4H5WA 3O9QA 1A5XA 4ILGB 4B1WB 4FJ7A 2HNDA 1RTIA 3L3VA 4DLGA 4L8RB 1R59O 3BZKA 3SAHA 1N6QA 5AQMA 1VQ5N 1RDAA 3O4NA 1ZBIA 4KHSA 1NKBA 1TYQA 4DV7K 3O6WA 4FJIA 2FBXA 3AO5A 1L3VA 3ENBA 2KFZA 4ELUA 4DTMA 2YI1A 4YY3K 3MEGA 3VQQA 2G8KA 3VQBA 1Q82O 3A0IX 1XUPO 3LAMA 1QZ6A 3M8PA 1YHQN 2XO7A 1HQEA 4IDKA 2WUSA 5C2FA 2WFBA 4Z4GA 1RT2A 4GY2B 3FZLA 4B1UB 1XC9A 3OY9A 2NRTA 2BE2A 4H4OA 3TAMA 4DFMA 1Q81O 2VCPA 4CBXA 1VK0A 5M1OA 4LC9B 4KHUA 3LP2A 3V9XA 3DOLA 4DV3K 4H0OA 4WFBL 3BEXA 3RWUA 1ESVA 4NYFA 4RWTA 3D0PA 4HTLA 3IFRA 4QS8A 3OYMA 4C8KA 4E3SA 2UYTA 3VA3A 1S1WA 3V9UA 4M3XA 3HRGA 2HBLA 3VOVA 3QO9A 3H6EA 4FW2A 4MLHA 2PFUA 2ZJRL 4FJJA 2F9TA 4O55A 2OPPA 5EXWA 1BGXT 3PSFA 5EU7A 1VRTA 1P90A 2QWOA 3AGKA 1D5AA 3ZSZA 2NLXA 1VAZA 4BRMA 1KSPA 3MMVA 4Z4EA 1XI1A 1WSEA 4QS7A 1RDCA 3LDNA 3QEXA 1C0FA 1U45A 3SUPA 3WXMB 4CJQA 1ZYQA 3A5MC 2VG5A 3NHGA 4JK9A 4F9OA 3AARA 2UXBK 5CYQA 3V81A 3AVHA 3K2PA 1VSEA 1LWFA 5KTQA 4J2BA 2EX3A 2BH1A 3CJCA 1FKOA 4CEAA 1N5YA 4R5PA 4NB4A 4DFPA 4DCHA 3PV8A 5SWMA 3H08A 3AVCA 2E20A 3U9DA 2VWKA 3HOSA 3THVA 2Z1JA 4ILJA 4KBOA 4Z94A 1T03A 4Z4CA 3K58A 3TI0A 3W0LA 3RSEB 4AHSA 3ID8A 3HPOA 1D9FA 4V19S 3VA0A 3C0BA 3G0ZA 4CJFA 2F8TA 4KAZA 4JI1K 4BROA 5BREA 1T05A 3NVKA 4BR4A 3SBTA 4JI4K 2A5XA 4GNIA 3E9LA 4CBUA 4NYNA 4E19A 1KXPA 4QAGA 3U8XA 5AQPA 3CCEN 4C8OA 5DK5A 2AA4A 4BRLA 4HWIA 5AJ3K 3EE8A 2FLOA 1XNRK 1C0MA 2D0OA 1JXBA 3WNHA 3CETA 1HNVA 1QS4A 1KVBA 1REVA 4K0KK 1JLGA 1CLQA 4B3MK 1VSMA 1KLNA 4L3QA 2PZSA 3SCXA 2P9UB 5F2RA 1VSJA 3HI0A 5BR8K 2A40A 3AVBA 3IKMA 2W40A 2NUBA 1DTQA 1NJYA 5C0YA 1RBRA 4NXMK 4CJRA 1DTTA 1JKHA 4DQSA 1HKGA 1GLJO 2YNGA 1NMNA 4ELVA 4FLXA 1MU2A 3T1HK 1JL1A 3O4WA 1RT4A 3KWIA 2QWRA 4HVJA 2CH5A 2ASPA 3UKUA 3JSMA 4OLAA 3HSCA 4FJHA 3VQAA 1EP4A 2HBJA 1ASUA 2IVOA 3I0RA 4AILC 1QZ5A 4DWIA 3K5NA 4FLZA 4XH4A 3V1QA 4DTNA 1U47A 1VHXA 1EO1A 4E0DA 4BE1A 1OH7A 1U2VA 4XH1A 2O8CB 3HXMA 3GBTA 5AFUH 1CZBA 3ITHA 3IG1A 3BY5A 1GLFO 4IG0A 2V7ZA 4LFBK 5JVGL 1LW0A 4JD2A 2E2NA 2P9IA 3H1VX 3TABA 4CF0A 2HVIA 1QSYA 2G8IA 4FZZA 4YOYA 3EE9A 2ZWHA 1S1TA 3WNEA 1NNEA 3E01A 4B3SK 5C42A 4J2DA 4OPHA 4DTXA 2I5JA 1LV5A 4FJ9A 1ATNA 2LSNA 3CJ1A 3VESA 4RW6A 4CZMA 4DHYA 3TAGA 2IC3A 5JVHL 1WOQA 3SMSA 3Q7BA 4CF2A 4GV6A 4BREA 1WBDA 2HBKA 2XHBA 3AVLA 4F2SA 5GIOA 3FFKB 1U6ZA 3DRRA 2YKNA 5E26A 3CCSN 3WNGA 3R1XA 4DTPA 4JKDA 3O5BA 1WSHA 3O9RA 4KPYA 4CK1A 5M1PA 4FLWA 4DSEA 1HUXA 3P31A 3S9HA 4BR9A 3HPGA 2HHQA 5J2QA 3HVRA 2FSJA 4CK2A 1BL3A 4I9LA 3NDKA 4CGHA 2FF6A 5KQ8A 4CEEA 3KLEA 1YJ9N 1TL3A 1KRPA 3KHYA 1JLBA 3PO5A 3EKUA 4JI6K 4FJLA 1KD1O 4YNQA 1R0AA 4WQ4C 1L3TA 4M3ZA 1H1VA 3IRXA 1IKWA 1K8AO 3SMPA 3UKRA 1Q8IA 1NM1A 3D2EA 5FPNA 5K14A 4CFAA 2QA4N 4LSLA 3QFPA 2OPQA 4OX9K 1GOCA 2YKMA 3L6QA 2ASMA 2Z1GA 4UQGA 2P9NB 5HRNA 4KHPK 3C6AA 4OKJA 1T6DA 4UY8O 4CHYA 3VEOA 4BVOA 3THWA 3SZ2A 3SQ2A 5KQDA 4BRDA 4G1QA 3QBWA 3ZSOA 3ENOA 1X1PA 4LFAK 1IBLK 3IS9A 1UA0A 3CC2N 2O8DB 4F3OA 3OYIA 2CH6A 3OS0A 1ILYA 3JYTA 4U7BA 1XNQK 5HOOA 3QMLA 3AO2A 3FE1A 3F9KA 1D4XA 2IIRA 4B1XB 1MDUB 3OTOK 4N5SA 1GLDG 5AQNA 3CYMA 5BN8A 1BUPA 5ADXA 3ZT3A 1WSGA 2QWQA 2P5OA 5LMUK 5AZJB 4FK0A 4GVEA 1RDDA 4BQLA 4F2RA 4K41A 1NOZA 1QVGM 5KGWA 3OYEA 2HOEA 5GAEP 4A5BA 4CJLA 2KLAA 1Q9YA 4CZFA 1NGGA 5H1SQ 1SAZA 4CGIA 5I9EB 2UUAK 3TSQA 3EL2A 5ELZA 3ZT1A 2D4WA 3U3GA 3PSIA 1N32K 4KB0A 1SS6A 4CGDA 2DFEA 4JI8K 5I42A 1NKEA 4DG1A 2P9KA 2HMIA 2GX9A 3AVGA 1TUUA 1HX1A 1LWEA 5CYMA 3DLHA 1DT9A 3GG4A 2IVPA 2QXLA 3WQTA 3S5TA 4EAHD 3GDQA 1BG3A 4XH5A 1RILA 3KJVA 3PIPL 5HLFA 4FWMA 4FM1A 1BI4B 4WQ5C 4B3OA 1BOTO 2KZZA 1WN7A 4Z4FA 3OYGA 3SQ0A 3NF7A 3WEEA 1U49A 4HUGA 3D45A 3AO3A 1QQCA 5HP1A 4OO1J 2A6AA 2P9PB 4C1NI 3LZJA 5KPTA 3SK3A 1Q18A 1N34K 1HNXK 1N36K 3NCIA 4Q5VA 2Q31A 3HSTB 4LSNA 2P9LA 3NVMA 4E7LA 1HPZA 3CHWA 3CMEN 2D0BA 3CPWM 3H3NO 5M1NA 1MWMA 1SQKA 1NG9A 3ZLJA 4DTJA 5JENA 2A3ZA 3QDKA 3G25A 2B4JA 3ZT4A 3NF8A 3GL1A 4BGBA 2FXUA 3MAQA 3ZCMA 2P1JA 2QWNA 4DF4A 4CCHA 1CXUA 1RBTA 4DR1K 1VQON 3TAFA 2O8BB 4CGJA 4JKGB 4B9VA 3RRHA 4H5TA 4HTUA 2FC0A 3J8AA 4YDUA 3L2QA 1HJRA 5JMVA 4IO9L 4BE0A 4KH4A 4CGGA 3ALYA 3ISNC 4CEFA 4FVUA 4H4MA 1KC8O 2B5JA 3Q7CA 3NBPA 4GW6A 4EHUA 3CCVN 4HUFA 3ID6A 2JLEA 4CJ7A 4LF7K 4X62K 1X3NA 4CK3A 4CEQA 4BC3A 5AQFA 4DR3K 4A2BA 1C1CA 4OPJA 3ULEB 4IG3A 3CCLN 4FK4A 4LF9K 3OJUA 3MK6A 4HCCA 3BF1A 3PUFA 5ADXH 3LPTA 2FSNA 3MXJA 4I2QA 1S6PA 3SYZA 2VQFK 5LMNK 4JHDA 5HRSA 4OJRA 5JS2A 1O13A 5JLFA 2W41A 4BRAA 1RGIA 3QEIA 3U6FA 1VQNN 4CFCA 2P9SA 3AA2A 4C23A 3WXLA 4AHVA 4BACA 4IWVA 3OYDA 4AF1A 3G71N 3ATVA 2C1IA 4RG8A 1DKGD 5M1QA 2ITMA 4CJWA 2HW3A 1MA9B 5JLHA 2X78A 1YITN 5AR0A 1QQNA 3OYLA 1Z6RA 3VPZA 1LCUA 4BRNA 3P1GA 3P38A 2FBYA 4DS4A 4CF9A 2E1YA 1EQYA 2AP1A 1RBSA 3C65A 5MLCQ 1HR0K 4CEZA 3HP6A 1VQ4N 1VSKA 4AHUA 4OGEA 4WF9L 4CE9A 3SQ4A 3JXUA 4HHTA 3HVTA 2X6SA 3MX5A 3NAEA 3K5OA 2ETJA 4LF8K 1LOTB 3CM6A 3DXKB 3SI6A 1YTAA 3A2FA 1S72N 2E6LA 1L3SA 1C6VA 2O4GA 1S9GA 3CJ9A 3HBTA 2O4IA 1TKXA 4X64K 4CFDA 1NGBA 4JAXA 4I6MB 1IKXA 3VN5A 4M3UA 3R8EA 5FPDA 2WBNA 4M42A 3HPHA 1J53A 3CQXA 1MWKA 3QIPA 4IEIA 1NGIA 1FKPA 3CJ7A 4O44A 4BR2A 4DB3A 3CM5A 2R7YA 1ATSA 1BCMA 3KD1E 4ELTA 3CERA 4H0VB 4JLHA 3SUQA 4K8ZA 3V9WA 2E4LA 4XJXA 2F9WA 2VYPA 3CFPA 3CIPA 3DLRA 4O4GA 4Y1CA 1GLBG 2ZF5O 4MDBA 4WFAL 1EWQA 3CCRN 3QIOA 3VF2A 4CZEA 4GKKK 5KI6A 1E4FT 3O9TA 1RBUA 4WYBA 3CQYA 3SUNA 4J2AA 4GV3A 3LZIA 3VEVA 5BRHA 3ZX0A 4X65K 3DMJA 3ZEUB 4B9UA 4M3TA 5JS1A 5CZ2A 3P5JA 4RTFD 5HROA 5CE3A 2W00A 3NF6A 4NCAA 1I39A 5AZIB 2NRRA 4Z0UA 4N56A 1OH5A 2EWSA 4CF1A 3PX4A 1JLAA 1X3MA 1KVCA 1HJOA 1Z26A 2B6AA 3I55N 2ZJQL 1M1KO 1JLQA 3NE6A 1S1UA 2OZMA 5CHIA 3H1QA 4DQ8A 4CIFA 5DMRA 4E7HA 1VQKN 2IVNA 1NU0A 5AQTA 3CCJN 1NK8A 4W5NA 4FM0A 2VWJA 4PHTX 3ZSYA 3J7ZO 3DXMB 1RT7A 4MDAA 3TR8A 3S3NA 4RW7A 1T8EA 2Z1IA 5AQOA 1XHZA 4JEPA 3AO4A 3B6PA 1TK8A 3M5RA 4PKHA 3CCUN 3HJFA 2Q3SA 4IDHA 1S1VA 1G15A 3TTCA 3O4QA 5CY4A 4BECA 1KQSM 4JK8A 1X9SA 4FWSA 3ZETB 3V6DA 3UIQA 4CEDA 3L8BA 3VTIA 2VG7A 3LP1A 4FLTA 1QTMA 3KK2A 4IFEA 1S9EA 4E7IA 4FO0A 1NGDA 3BP8A 3HZ6A 1YF5L 3M6GA 4FWNA 4CIEA 3THXB 3U9ZA 2WC9A 4CGFA 4DLEA 1ATRA 3UB5A 4LY7A 1YVNA 4CJ4A 1RDBA 3ULDA 4M45A 4EZ6A 1IKYA 2YJEA 4CJUA 3D7EO 3VQ9A 2PAVA 5BPLA 3DLEA 4FJXA 2NRXA 2ZJPL 2XY6A 1W2BM 2HMPA 1OH8A 4CECA 4YOVA 4JRPA 2FBTA 3MN7A 2VQEK 1NGFA 5TKYA 5AQJA 4GVMA 3ZX3A 4H0TB 4A5AA 4MO5A 1XMQK 4M7YA 1DEJA 5EX5A 4BRQA 1SKWA 4NO7A 2P9UA 3MWTA 3SV3A 4DQRA 1HYSA 4E1JA 3K5LA 3QEWA 2KTQA 1RT6A 3FR0A 2GEMA 4JV5K 2IAJA 3SJJA 1YIJN 3M8RA 4H0XB 3KLHA 4BG8A 4W5RA 5AQYA 4BR5A 4FWOA 4CEBA 4F4KA 3TTFA 1BA1A 4KTQA 1NBWA 1NKCA 4OPKA 4DR6K 3DOKA 2D5RA 4C8MA 4KREA 3K5MA 3PY8A 4EP4A 2OCEA 3QESA 1SL2A 3QNOA 2OPRA 2ZE2A 2ZM6K 4PL8A 5KPRA 3OJSA 2HBMA 5C15A 4JKCA 2E2OA 4BDYA 3OS2A 4YOUA 2QEXN 5AQZA 4DKWA 1SUQA 3O1WA 1BCOA 1WAFA 3ASMA 2VWBA 4KV8A 4KKOA 3P83D 1UAXA 5BRDA 3UKUB 3KLGA 1K9MO 3F73A 2F7TA 4BWJA 1KAYA 4FZXC 4FJKA 1NGHA 1G99A 2HHHK 4CEOA 2GWJA 4PQUA 2HHTA 4CF8A 4EHTA 3SUOA 1YJNN 1VQ7N 3IMXA 4BR7A 1K8KB 3O9SA 3RMCA 4CD3A 1ASVA 1FK9A 4C8LA 3KLFA 4ISFA 4ISGA 4FZYA 1P8ZA 1W97L 1KAZA 4CJ3A 3L2UA 3CPEA 2GWKA 3ZSQA 4ZTFA 3MXMA 4HUEA 1JLEA 5J2PA 3ZSXA 3EO3A 3GE1A 5F0XA 4AM6A 3ZT0A 4JD2B 5M1FA 1M90O 1J5EK 3C95A 4NXNK 3HYFA 4Y0WA 3F5TA 4Z4HA 4OKEA 1JCGA 2DY4A 1J5OA 3EKSA 3VMFB 4DV5K 5SZTA 2ATQA 1EWRA 3AAQA 1QVFM 3V1OA 3TAQA 1B9FA 1VSHA 2C1GA 4WE1A 4LF6K 4A59A 4JI0K 3VQ7A 4O5BA 4DR4K 4DTRA 2F8SA 1ASWA 3ZX2A 3S3MA 3I0SA 3VGMA 2W6LA 3OYHA 3PIOL 4LH5A 3M8QA 3T19A 4DQPA 4C1NK 4W5TA 1GLLO 2YHWA 2O8FA 2A1SA 2YNFA 3D2FB 4DF8A 1JLFA 1KFSA 4E1NA 1ZBHA 3L2WA 4B9TA 3QEPA 2RPIA 3CJAA 1GLAG 4B9MA 4NCGA 4CZKA 3LDLA 4B1VA 4AHTA 3T7ZA 1A5WA 2P9NA 4FWLA 1A5VA 3FZKA 3MEEA 4G9ZA 3C94A 2CGLA
chains in the Genus database with same CATH topology
3J8AA 3CD6N 4H03B 4YDUA 3UKRB 1SZ2A 1YHQN 3D2EB 3MDQA 5C2FA 2WUSA 4CZHA 1VQMN 5BRFA 3EN9A 2WFBA 2A41A 5JMVA 4IO9L 4IOAL 4KH4A 3PLAA 4GY2B 2FSKA 3FZLA 3MX2A 5AQUA 2E8AA 4FVUA 1KC8O 3Q7CA 4B1UB 4EHUA 3CCVN 2NRTA 3KZBA 3ID6A 3K9KA 3K9JA 3ATUA 4CJ7A 1Q81O 2VCPA 2Q2RA 4NLCA 4BC4A 4CBXA 1X3NA 5LJWA 1YXQA 3W3DA 2VGNA 5M1OA 2CGJA 4LC9B 4BC3A 5AQFA 1DGKN 4A2BA 1Z05A 4CZJA 3M3ZA 3FZFA 5AZJA 1HPMA 2YCHA 4H0OA 4BR0A 4WFBL 3BEXA 3JS6A 1ESVA 4H5NA 3ULEB 4CD1A 3CCLN 4RWTA 4HTLA 5HL7L 5DM7L 3MN6A 3IFRA 3MK6A 4QS8A 3BF1A 2UYTA 5GAHP 5ADXH 4OPAA 3KVGA 2FSNA 3HRGA 2HBLA 2ZGZA 3VOVA 2HF3A 4CZLA 1C0GA 4U67L 5C12A 3H6EA 5AQGA 5GINA 4MLHA 2PFUA 4CZGA 2ZJRL 2F9TA 1CZAN 2YX6A 3C6HA 4JHDA 4FWQA 1K8KA 5JLFA 1O13A 4A57A 2W41A 5EXWA 4BRAA 1RGIA 2QW9A 1P90A 2QWOA 3AGKA 1VQNN 2NLXA 1VAZA 4BRMA 2P9SA 1BDGA 3CI5A 3OHRA 4C23A 1JJ2M 3WXLA 4AM7A 1U2VB 3MMVA 2NNWA 4YORA 4QS7A 3LDNA 1S3XA 1C0FA 1QQOA 4IWVA 4O8UA 5KPZA 3WXMB 4AF1A 3G71N 3QB0A 2J4RA 3ATVA 2C1IA 2Q0UA 1DKGD 5M1QA 2ITMA 2P9IB 1MA9B 3A5MC 1VQ9N 4JK9A 4F9OA 5JLHA 3AARA 4ILHA 3VGKA 1YITN 3C7NB 1QQNA 5AR0A 5LY3A 2OTJN 1Z6RA 3VPZA 5AQRA 1LCUA 3LDOA 4BRNA 3P38A 3VERA 2BH1A 2E1YA 2D0PA 3CJCA 1EQYA 3FLCO 2AP1A 3C65A 5MLCQ 3H45C 1BO5O 3WXKA 4O8KA 4NB4A 4BRHA 5FPEA 4DCHA 1VQ4N 2V51B 4WF9L 5TKWA 1TUYA 3JXUA 2E20A 3NMUA 1NWKA 3I33A 3U9DA 3HOSA 4FWPA 3MX5A 1RDWX 2V7YA 4ILJA 4KBOA 3R6MA 4BR7A 4YOWA 4Z94A 1LOTB 5LJVA 3DXKB 3W0LA 3RSEB 1JCEA 3WUHA 3ID8A 1T3VA 1S72N 3C0BA 3TSUA 4YOXA 3CJ9A 3HBTA 1OKJA 1NGBA 4JAXA 2ZGYA 3LL3A 4I6MB 4ISEA 4BROA 5BREA 2QWLA 3D2FA 4A61A 3D6RA 4H0PA 4BR4A 3NVKA 4A62A 3SBTA 1RFQA 3R8EA 2A5XA 1IJJA 4GNIA 5FPDA 2WBNA 3SJHA 3H3OB 3E9LA 4CBUA 2BTFA 3L0QA 2Q0RA 1KXPA 1MWKA 3CQXA 4IEIA 1NGIA 3CC7N 1HLUA 3CJ7A 4BR2A 3U8XA 4DB3A 2CGKA 5AQPA 2P9LB 3CCEN 2RHKA 4BRGA 5M1KA 3SAFA 3MWPA 5AQVA 1ATSA 3QFUA 2AA4A 4BRLA 3MCPA 4HWIA 1JCFA 2FLOA 3EE8A 3R3LA 4KH5A 3TTDA 2D0OA 4KH6A 3CERA 4BC2A 3CETA 4H0VB 5AQWA 5JICA 4XJXA 2DPNA 2F9WA 2GUPA 2VYPA 4B1ZA 3CIPA 4K43A 2QI2A 4L3QA 2YHXA 4RCHA 2P9UB 3UE5A 2ZF5O 1GLBG 5F2RA 3HI0A 3KK7A 2A40A 4MDBA 3IKMA 4WFAL 3I56N 1J6ZA 2W40A 1X9JA 3VF2A 3CCRN 4GV9A 2QWPA 4BGAA 5EOYA 4CZEA 3VTHA 5C0YA 3BF3A 3O80A 1E4FT 2ASOA 3O9TA 4WYBA 3CQYA 4GV3A 2E2PA 1QHAA 1E4GT 3SLCA 3VEVA 5BRHA 1HKGA 3ZX0A 5F1XA 1GLJO 2GELA 3ZEUB 3CC4N 3CMAN 3VEWA 3O4WA 4RTFD 3KWIA 4BEBA 2QWRA 5CE3A 2CH5A 2JWLA 1WUAA 2W00A 2ASPA 1NGCA 1HKCA 3UKUA 2QM1A 5AZIB 3HSCA 3CF5L 3O8MA 3U4LA 2HBJA 2NRRA 2IVOA 5GADP 3MCAB 2EWSA 1QZ5A 1X3MA 2V52B 5AQSA 1QQMA 1HJOA 3I55N 2ZJQL 4A2AA 4EIAA 1M1KO 4XH4A 2KHOA 1NGAA 3WXJA 5CHIA 4MLEA 2NRHA 3CCQN 3HOTA 3H1QA 1EO1A 4DQ8A 3AY9A 5AQXA 2BUPA 1U2VA 4JKFA 2A42A 3AGRA 4M63C 4XH1A 1YJWN 2IVNA 1VQKN 1Q7YO 3GBTA 5CR4A 5AFUH 5AQTA 3CCJN 4QS9A 1GLFO 2V7ZA 3QBXA 5JVGL 3ENHA 4JD2A 4JKBA 2E2NA 4PHTX 2P9IA 3J7ZO 3H1VX 3DXMB 3B8AX 3C7NA 3KWGA 4MDAA 3VGLA 3L4QA 5AQOA 5FPMA 3A5LC 4YOYA 3EE9A 1BA0A 4H5RA 4JEPA 2ZWHA 4BRIA 4BQZA 3M5RA 4JK7A 2P9KB 4JKHA 4OPHA 3VENA 5GAGP 3P39A 1ATNA 3CJBA 4PKHA 3CJ1A 3CCUN 3VESA 2P9PA 4IDHA 4CZMA 4JN4A 4DHYA 5JVHL 3TTCA 1WOQA 3SMSA 4B1YB 4PL7A 3DJCA 1NLVA 3Q7BA 4BECA 2PBDA 4JK8A 3VETA 4BREA 4FWSA 3ZETB 2HBKA 4JKAA 1KQSM 4GV6A 2NZTA 2D1KA 4IO8A 3VTIA 5AQLA 5GIOA 3FFKB 1U6ZA 3DXKA 3P4IA 5C10A 5E26A 3CCSN 4IFEA 1NGEA 3HM8A 4JKEA 3R1XA 4FO0A 1NGDA 3BP8A 3WEEB 3VEZA 4JKDA 3E1YA 3HZ6A 1YF5L 3M6GA 3O5BA 3OA9A 4FWNA 4I6MA 3E9OA 3U9ZA 2WC9A 3O9RA 1V4TA 1ATRA 3QICA 3UB5A 1YAGA 5M1PA 1HUXA 2QTDA 3P31A 3LM9A 4BR9A 1YVNA 5EVZA 2FSJA 1OVYA 1NMDA 2YJEA 5BN9A 4J8FA 1YUWA 3D7EO 5KQ8A 2FF6A 2PAVA 4FWKA 5BPLA 4PKGA 4BRCA 2NRXA 2ZJPL 4NLBA 1W2BM 4BY9C 1YJ9N 2HMPA 4PKIA 3LDPA 3SAGA 4H5VA 3KHYA 3DLLL 3OBYA 1GLEG 4YOVA 2YHYA 3EKUA 3MN7A 4JKGA 1KD1O 4BVPA 4WQ4C 1NGFA 1BWFO 2Q1NA 5TKYA 1H1VA 5AQJA 3WXIA 1K8AO 3ZX3A 3SMPA 3UKRA 1VQLN 4H0TB 1NM1A 3D2EA 3N4PA 5FPNA 4A5AA 1VQPN 2QA4N 4MO5A 4M7YA 1DEJA 3QFPA 2NRVA 5EX5A 4BRQA 4NO7A 1TYQB 3DAWA 1T44A 3TSPA 3F9MA 2P9UA 3MWTA 3L6QA 2H3GX 4WCEL 4WQ4A 4E1JA 2ASMA 2P9NB 5AQHA 3FR0A 2GEMA 3AAPA 2HSTA 3C6AA 4FOIA 1VQ8N 3IUCA 3O9UA 4CZIA 1T6DA 2I7NA 1YIJN 4B9QA 4UY8O 4BRKA 3VEOA 4IJNA 4BVOA 4BRFA 4H0XB 5KQDA 1HKBA 4BRDA 4BG8A 3QBWA 5AQYA 3ZEUA 1NGJA 4BR5A 3ENOA 1GLCG 3CC2N 4FWOA 3SBGA 3TTFA 4WFNL 3ULEA 1BA1A 1T6CA 1NBWA 3A5NC 2CH6A 3MN9A 5DM6L 1ILYA 4U7BA 5HOOA 3QMLA 5AZIA 2Q97A 3FE1A 1D4XA 2IIRA 5AQIA 3L4IA 4PL8A 5KPRA 4BC5A 4H0YB 4B1XB 1MDUB 2HBMA 5C15A 1GLDG 3H46O 5AQNA 4M7XA 4JKCA 3CCMN 2E2OA 2QEXN 5BN8A 4YOUA 1BUPA 4FSVA 5ADXA 2QWQA 5BPNA 5AQZA 4DKWA 2HF4A 2OANA 3O1WA 5AZJB 3EZWA 1VQ6N 4GVEA 4FL9A 4BQLA 4FPAA 4XEIA 2VWBA 5BRDA 4K41A 3UKUB 5E84A 5BR9A 2E2QA 2F7TA 2JWKA 4IOCL 1QVGM 3VEXA 1K9MO 1KAYA 1NGHA 2HOEA 1G99A 5GAEP 4A5BA 2KLAA 2GWJA 4CZFA 2OTLN 1NGGA 5EY4A 1SAZA 3E66A 5H1SQ 4EHTA 1YJNN 5I9EB 1VQ7N 3IMXA 2GTDA 4JNEA 3DXMA 2KKZA 1BU6O 3EL2A 2I7PA 1K8KB 2D4WA 4FPBA 3O9SA 4JHDB 5ELZA 3TSQA 3I8BA 3TU5A 3F2KA 3RVCA 4CD3A 4ISFA 4ISGA 5AFUA 1SS6A 1P8ZA 1W97L 1KAZA 5AQQA 2P9SB 3FZHA 5GIPA 3CPEA 2GWKA 2Q36A 2P9KA 1NJIO 4FOEA 3WQUA 5B8HA 5BPMA 2GX9A 3O1BA 1TUUA 1HX1A 1S22A 1DT9A 1RDUA 2IVPA 2QXLA 3FZMA 3GG4A 4O5FA 3R9PA 3T69A 3TPQA 3WQTA 4EAHD 3GDQA 3EO3A 2E1ZA 3GE1A 5F0XA 1BG3A 4AM6A 1IG8A 4XH5A 3VF6A 4JD2B 3LM2A 5M1FA 3ZETA 3A8YA 3PIPL 4IZ9A 3BUZB 4K25A 1M90O 3MN5A 4FWMA 1XC3A 3O08A 4WQ5C 3OW2M 1YI2N 1BOTO 2QWMA 4Y0WA 3RSEA 3M1FA 2YJFA 3F5TA 1Q86O 1JCGA 2NRWA 3GOIA 4IJAA 4BE7B 1Y64A 4R79A 2RE2A 1N8RO 3WEEA 3EKSA 3VMFB 3E9PA 4IXCA 3A5OC 3LDQA 3N4QA 3AAQA 1QVFM 4OO1J 4IEEA 2A6AA 2E88A 2P9PB 4C1NI 4FWRA 3VF4A 2NRZA 4WQ5A 3VEYA 5KPTA 2C1GA 1ZC6A 3SK3A 1Q18A 4BRPA 4A59A 5C2DA 1XQSC 3G4SN 2FF3B 3CXCM 4H5WA 3ZX2A 2Q31A 3VGMA 3O9QA 3FGUA 3PIOL 3WT0A 3ZYYX 2P9LA 3S41A 3NVMA 4ILGB 4C1NK 4B1WB 3CHWA 1GLLO 3CMEN 2YHWA 4K42A 3HTVA 3H3NO 5M1NA 3CPWM 3OBWA 1MWMA 1SQKA 3D2FB 1R59O 2A3ZA 3QDKA 3SAHA 3G25A 5AQMA 1VQ5N 1ZXOA 1ZBSA 4IOXA 3G6EN 3GL1A 4BGBA 3CJAA 1GLAG 1K73O 2FXUA 1TYQA 1V4SA 3O6WA 4MO4A 2VGMA 4YDUC 2QWNA 4CZKA 4BG9A 3IDHA 3LDLA 4B1VA 1VQON 4CI6A 3T7ZA 3ENBA 5AQKA 2P9NA 4FWLA 4EFHA 2YI1A 3DWLA 4YOTA 4CBWA 1Q82O 3FZKA 4JKGB 3A0IX 1XUPO 1QZ6A 4G9ZA 1KAXA 4H5TA 2CGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J8A A;  4H03 B;  4YDU A;  3UKR B;  1SZ2 A;  3D2E B;  3MDQ A;  2WUS A;  4CZH A;  5BRF A;  3EN9 A;  2A41 A;  5JMV A;  4GY2 B;  2FSK A;  3FZL A;  5AQU A;  2E8A A;  4B1U B;  4EHU A;  3KZB A;  3ATU A;  4CJ7 A;  2VCP A;  2Q2R A;  4BC4 A;  4CBX A;  1X3N A;  5LJW A;  1YXQ A;  3W3D A;  2CGJ A;  4LC9 B;  4BC3 A;  5AQF A;  1DGK N;  4A2B A;  1Z05 A;  4CZJ A;  3M3Z A;  3FZF A;  5AZJ A;  1HPM A;  2YCH A;  4H0O A;  4BR0 A;  3BEX A;  3JS6 A;  1ESV A;  4H5N A;  3ULE B;  4CD1 A;  4RWT A;  4HTL A;  3MN6 A;  3IFR A;  3MK6 A;  4QS8 A;  3BF1 A;  2UYT A;  5ADX H;  3KVG A;  2FSN A;  4CZL A;  2ZGZ A;  3VOV A;  2HF3 A;  1C0G A;  3H6E A;  5AQG A;  4MLH A;  4CZG A;  2F9T A;  1CZA N;  4JHD A;  4FWQ A;  1K8K A;  5JLF A;  2W41 A;  5EXW A;  4BRA A;  1RGI A;  2QW9 A;  2QWO A;  2NLX A;  4BRM A;  2P9S A;  1BDG A;  3CI5 A;  3OHR A;  4C23 A;  3WXL A;  4AM7 A;  1U2V B;  3MMV A;  4QS7 A;  3LDN A;  1S3X A;  1C0F A;  1QQO A;  4IWV A;  5KPZ A;  3QB0 A;  2J4R A;  3ATV A;  2Q0U A;  1DKG D;  2ITM A;  2P9I B;  1MA9 B;  3A5M C;  5JLH A;  4F9O A;  3AAR A;  3VGK A;  3C7N B;  1QQN A;  5AR0 A;  5LY3 A;  1Z6R A;  3VPZ A;  5AQR A;  1LCU A;  3LDO A;  4BRN A;  3VER A;  2E1Y A;  3CJC A;  2D0P A;  1EQY A;  3FLC O;  2AP1 A;  3H45 C;  1BO5 O;  3WXK A;  4O8K A;  4NB4 A;  4BRH A;  5FPE A;  4DCH A;  2V51 B;  1TUY A;  3JXU A;  2E20 A;  1NWK A;  3I33 A;  3U9D A;  4FWP A;  1RDW X;  2V7Y A;  4KBO A;  3R6M A;  4Z94 A;  1LOT B;  5LJV A;  3DXK B;  3W0L A;  3RSE B;  1JCE A;  3WUH A;  3ID8 A;  3C0B A;  3CJ9 A;  3HBT A;  1OKJ A;  1NGB A;  4JAX A;  2ZGY A;  3LL3 A;  4I6M B;  4ISE A;  4BRO A;  5BRE A;  2QWL A;  3D2F A;  4A61 A;  4H0P A;  4BR4 A;  4A62 A;  1RFQ A;  3R8E A;  2A5X A;  1IJJ A;  4GNI A;  5FPD A;  3SJH A;  3H3O B;  4CBU A;  2BTF A;  3L0Q A;  2Q0R A;  1KXP A;  1MWK A;  3CQX A;  1NGI A;  1HLU A;  3CJ7 A;  4BR2 A;  3U8X A;  4DB3 A;  2CGK A;  5AQP A;  2P9L B;  4BRG A;  5AQV A;  1ATS A;  3QFU A;  2AA4 A;  4BRL A;  3MCP A;  4HWI A;  1JCF A;  2FLO A;  2D0O A;  3CER A;  4BC2 A;  3CET A;  4H0V B;  5AQW A;  5JIC A;  2DPN A;  2F9W A;  2GUP A;  2VYP A;  4B1Z A;  3CIP A;  4K43 A;  4L3Q A;  2YHX A;  4RCH A;  2P9U B;  3UE5 A;  1GLB G;  2ZF5 O;  5F2R A;  3HI0 A;  2A40 A;  1J6Z A;  2W40 A;  1X9J A;  3VF2 A;  2QWP A;  4BGA A;  5EOY A;  4CZE A;  3BF3 A;  3O80 A;  1E4F T;  2ASO A;  4WYB A;  3CQY A;  2E2P A;  1QHA A;  1E4G T;  3SLC A;  3VEV A;  5BRH A;  1HKG A;  3ZX0 A;  5F1X A;  1GLJ O;  2GEL A;  3ZEU B;  3VEW A;  3O4W A;  4RTF D;  2QWR A;  5CE3 A;  2CH5 A;  1WUA A;  2ASP A;  1NGC A;  1HKC A;  3UKU A;  2QM1 A;  5AZI B;  3HSC A;  3O8M A;  3U4L A;  2IVO A;  2EWS A;  1QZ5 A;  1X3M A;  2V52 B;  5AQS A;  1QQM A;  1HJO A;  4A2A A;  4EIA A;  4XH4 A;  2KHO A;  1NGA A;  3WXJ A;  4MLE A;  2NRH A;  3H1Q A;  4DQ8 A;  3AY9 A;  5AQX A;  2BUP A;  1U2V A;  2A42 A;  4XH1 A;  4M63 C;  2IVN A;  3GBT A;  5AFU H;  5AQT A;  4QS9 A;  1GLF O;  2V7Z A;  3QBX A;  3ENH A;  4JD2 A;  2E2N A;  2P9I A;  3H1V X;  3DXM B;  3B8A X;  3C7N A;  3VGL A;  5AQO A;  5FPM A;  3A5L C;  1BA0 A;  4H5R A;  2ZWH A;  4BRI A;  4BQZ A;  2P9K B;  3VEN A;  1ATN A;  3CJB A;  4PKH A;  3CJ1 A;  3VES A;  2P9P A;  4CZM A;  4JN4 A;  4DHY A;  1WOQ A;  3SMS A;  4B1Y B;  4PL7 A;  3DJC A;  1NLV A;  2PBD A;  3VET A;  4BRE A;  4FWS A;  3ZET B;  2NZT A;  2D1K A;  4IO8 A;  5AQL A;  3FFK B;  1U6Z A;  3DXK A;  3P4I A;  5E26 A;  1NGE A;  3HM8 A;  4FO0 A;  1NGD A;  3BP8 A;  3WEE B;  3VEZ A;  3HZ6 A;  3M6G A;  3O5B A;  4FWN A;  4I6M A;  3U9Z A;  1V4T A;  1ATR A;  3QIC A;  3UB5 A;  1YAG A;  1HUX A;  3LM9 A;  4BR9 A;  1YVN A;  5EVZ A;  2FSJ A;  1NMD A;  2YJE A;  5BN9 A;  4J8F A;  1YUW A;  3D7E O;  5KQ8 A;  2FF6 A;  2PAV A;  4FWK A;  5BPL A;  4PKG A;  4BRC A;  2HMP A;  4PKI A;  3LDP A;  4H5V A;  3KHY A;  1GLE G;  2YHY A;  3EKU A;  3MN7 A;  4BVP A;  4WQ4 C;  1NGF A;  1BWF O;  2Q1N A;  5TKY A;  1H1V A;  5AQJ A;  3WXI A;  3ZX3 A;  3SMP A;  3UKR A;  4H0T B;  1NM1 A;  3D2E A;  5FPN A;  4MO5 A;  4M7Y A;  1DEJ A;  3QFP A;  5EX5 A;  4BRQ A;  4NO7 A;  1TYQ B;  3DAW A;  1T44 A;  3F9M A;  2P9U A;  3L6Q A;  2H3G X;  4WQ4 A;  4E1J A;  2ASM A;  2P9N B;  5AQH A;  3FR0 A;  2GEM A;  3AAP A;  4FOI A;  3IUC A;  4CZI A;  1T6D A;  2I7N A;  4B9Q A;  4BRK A;  3VEO A;  4IJN A;  4BVO A;  4BRF A;  4H0X B;  5KQD A;  1HKB A;  4BRD A;  4BG8 A;  3QBW A;  5AQY A;  3ZEU A;  1NGJ A;  4BR5 A;  3ENO A;  1GLC G;  4FWO A;  3ULE A;  1BA1 A;  1T6C A;  1NBW A;  3A5N C;  2CH6 A;  3MN9 A;  3QML A;  5AZI A;  2Q97 A;  3FE1 A;  1D4X A;  2IIR A;  5AQI A;  3L4I A;  4PL8 A;  5KPR A;  4BC5 A;  4H0Y B;  4B1X B;  1MDU B;  1GLD G;  3H46 O;  5AQN A;  4M7X A;  2E2O A;  5BN8 A;  1BUP A;  4FSV A;  5ADX A;  2QWQ A;  5BPN A;  5AQZ A;  2HF4 A;  2OAN A;  3O1W A;  5AZJ B;  3EZW A;  4FL9 A;  4BQL A;  4FPA A;  4XEI A;  2VWB A;  5BRD A;  4K41 A;  3UKU B;  5E84 A;  5BR9 A;  2E2Q A;  3VEX A;  1KAY A;  1NGH A;  2HOE A;  1G99 A;  2GWJ A;  4CZF A;  1NGG A;  5EY4 A;  1SAZ A;  4EHT A;  5I9E B;  3IMX A;  2GTD A;  4JNE A;  3DXM A;  4FPB A;  1BU6 O;  3EL2 A;  2I7P A;  1K8K B;  2D4W A;  4JHD B;  5ELZ A;  4BR7 A;  4CD3 A;  3I8B A;  3TU5 A;  5AFU A;  4ISF A;  4ISG A;  1P8Z A;  1KAZ A;  5AQQ A;  2P9S B;  3FZH A;  2GWK A;  2Q36 A;  2P9K A;  4FOE A;  3WQU A;  5B8H A;  5BPM A;  3O1B A;  1TUU A;  1HX1 A;  1S22 A;  3GG4 A;  3FZM A;  2IVP A;  2QXL A;  3R9P A;  4O5F A;  3TPQ A;  3WQT A;  4EAH D;  3GDQ A;  3EO3 A;  2E1Z A;  3GE1 A;  5F0X A;  1BG3 A;  4AM6 A;  1IG8 A;  4XH5 A;  3VF6 A;  4JD2 B;  3LM2 A;  3ZET A;  3A8Y A;  4IZ9 A;  3BUZ B;  4K25 A;  3MN5 A;  4FWM A;  1XC3 A;  3O08 A;  4WQ5 C;  1BOT O;  2QWM A;  4Y0W A;  3RSE A;  3M1F A;  2YJF A;  1JCG A;  4IJA A;  3GOI A;  1Y64 A;  3WEE A;  3EKS A;  4IXC A;  3A5O C;  3LDQ A;  3AAQ A;  2A6A A;  2E88 A;  2P9P B;  4FWR A;  3VF4 A;  4WQ5 A;  5KPT A;  3VEY A;  1ZC6 A;  3SK3 A;  1Q18 A;  4BRP A;  1XQS C;  2FF3 B;  4H5W A;  3ZX2 A;  2Q31 A;  3VGM A;  3FGU A;  3WT0 A;  2P9L A;  3S41 A;  4B1W B;  3CHW A;  1GLL O;  2YHW A;  4K42 A;  3HTV A;  3H3N O;  1MWM A;  1SQK A;  3D2F B;  1R59 O;  2A3Z A;  3QDK A;  3G25 A;  5AQM A;  1ZXO A;  1ZBS A;  3GL1 A;  4BGB A;  3CJA A;  1GLA G;  2FXU A;  1TYQ A;  1V4S A;  3O6W A;  4MO4 A;  4YDU C;  4CZK A;  2QWN A;  4BG9 A;  3IDH A;  3LDL A;  4B1V A;  4CI6 A;  5AQK A;  2P9N A;  4FWL A;  4EFH A;  2YI1 A;  3DWL A;  4CBW A;  3FZK A;  3A0I X;  1XUP O;  1QZ6 A;  1KAX A;  4H5T A;  2CGL A; 
#chains in the Genus database with same CATH topology
 3CD6 N;  4E7J A;  3HK2 A;  3UKR B;  1SZ2 A;  1HRH A;  3D2E B;  3RMA A;  4CZH A;  3EN9 A;  1D8Y A;  4CHP A;  5IT9 O;  4DS5 A;  4CJT A;  4J2E A;  4IOA L;  1FJG K;  3MX2 A;  2E8A A;  1WSJ A;  3MED A;  3TAP A;  3OYF A;  3K9K A;  4ID5 A;  1O1W A;  2HHX A;  1F21 A;  5LJW A;  1YXQ A;  2BAN A;  2VGN A;  3QIN A;  3CFO A;  3THW B;  1DGK N;  4CZJ A;  5AZJ A;  4FYD A;  4LD0 A;  3KK1 A;  4CD1 A;  5DM7 L;  5GAH P;  1OH6 A;  2YHA A;  2ZGZ A;  2UUC K;  2HF3 A;  1C0G A;  2RN2 A;  5AQG A;  1ITG A;  1CZA N;  2YX6 A;  3C6H A;  3BDP A;  2QW9 A;  1WSI A;  3KK3 A;  1BDG A;  3CI5 A;  1JJ2 M;  4B9L A;  4AM7 A;  1S3X A;  5KGX A;  5KPZ A;  3AO1 A;  3VGK A;  2Y1J A;  4PUO A;  3C7N B;  5LY3 A;  2OTJ N;  2YHB A;  3VQ5 A;  3CQ8 A;  3PX0 A;  1RT3 A;  2UXD K;  1QSL A;  1DLO A;  3FLC O;  1SV5 A;  2OZS A;  3H45 C;  1BO5 O;  4O8K A;  4BRH A;  5FPE A;  1J54 A;  2O8E B;  2V51 B;  3VQP A;  3NMU A;  1NWK A;  3I33 A;  1RDW X;  2V7Y A;  4FJG A;  3DLK A;  4YOW A;  4EZ9 A;  1JCE A;  4B8A B;  1T3V A;  4CVN E;  3TSU A;  4KTW A;  4YOX A;  1OKJ A;  1YTU A;  3PX6 A;  1Z25 A;  2ZGY A;  4ISE A;  2JGU A;  2QWL A;  2G8W A;  1HNW K;  4A61 A;  3D6R A;  4H0P A;  1RFQ A;  3SJH A;  3H3O B;  3L0Q A;  2P9L B;  2RHK A;  4BRG A;  5M1K A;  4B8C A;  4B08 A;  3MWP A;  4FW1 A;  3THY B;  4I2P A;  3MCP A;  1JCF A;  2DFF A;  4E7K A;  4KH6 A;  4FJN A;  4BC2 A;  2HHW A;  5AQW A;  5JIC A;  2GUP A;  4K43 A;  1UA1 A;  2QI2 A;  2IS3 A;  4KHQ A;  1JL2 A;  2YHX A;  3UE5 A;  3DLG A;  3KK7 A;  3I56 N;  4K8X A;  1J6Z A;  2W42 A;  1X9J A;  1OVQ A;  2FBV A;  3NH1 A;  3AVI A;  1GOB A;  2E2P A;  1E4G T;  3SLC A;  5F1X A;  1T7P A;  4N47 A;  2GEL A;  3L2R A;  3CC4 N;  1RTD A;  3CMA N;  1JXE A;  3AVJ A;  3KKR A;  2QM1 A;  3CF5 L;  3U4L A;  2QKB A;  5GAD P;  2V52 B;  1QQM A;  2XY8 A;  1GOA A;  3SV4 A;  4A2A A;  3K59 A;  4EP5 A;  1TKD A;  2YV0 X;  3AA3 A;  3WXJ A;  4MLE A;  2NRH A;  3CCQ N;  3AY9 A;  4CJ5 A;  4JS5 A;  5AQX A;  4B3T K;  1N33 K;  1QE1 A;  2BUP A;  4JKF A;  2A42 A;  3AGR A;  4M63 C;  4DSI A;  4FLY A;  3SPY A;  1U04 A;  4QS9 A;  3LDS A;  2UUB K;  4CIG A;  4KHN A;  3QBX A;  1WAJ A;  4N76 A;  3TAN A;  3B8A X;  4CJK A;  4GMJ B;  1HMV A;  5FPM A;  3A5L C;  3DRS A;  4H5R A;  4BRI A;  4BQZ A;  3CYG A;  3HP9 A;  3FFI A;  4CES A;  4JK7 A;  3CFR A;  4JKH A;  3VEN A;  5GAG P;  3EEQ A;  2G8V A;  2HVH A;  2OYQ A;  4JN4 A;  1LAW A;  1WLJ A;  3WNF A;  3RRG A;  3DJC A;  4DR2 K;  3AVK A;  3VET A;  4JKA A;  4FJ8 A;  3EZ5 A;  1SKR A;  3M8S A;  3DXK A;  3P4I A;  3HM8 A;  1IH7 A;  1NK9 A;  1RT5 A;  4I6M A;  4W5Q A;  1IKV A;  3QIC A;  2HHS A;  1YAG A;  4YHH K;  1HNZ K;  1OVY A;  4BDP A;  5BN9 A;  1TAQ A;  4FWK A;  4DUZ K;  4PKG A;  4BRC A;  4NLB A;  4BY9 C;  4DU3 A;  3LDP A;  3C6T A;  3SAG A;  4H5V A;  3DLL L;  1WBB A;  1GLE G;  4KHW A;  4BVP A;  1QSS A;  1BWF O;  2Q1N A;  4FCY A;  3WXI A;  4JI3 K;  3N4P A;  1VQP N;  1W7A A;  3T3F A;  2WON A;  3QET A;  1TYQ B;  3F9M A;  1RT1 A;  1KCF A;  1BQN A;  4WCE L;  3O3H A;  1EX4 A;  4WQ4 A;  4OLB A;  2YNI A;  2E5L K;  4ZHR A;  4DSK A;  3LAL A;  3AAP A;  3RTV A;  1Y97 A;  3O9U A;  2I7N A;  4B9Q A;  4IJN A;  3NF9 A;  5E41 A;  1ZBF A;  3ZEU A;  1GLC G;  3SBG A;  1T6C A;  1E3M A;  3MN9 A;  4DV6 K;  4OVL A;  5AZI A;  3BZC A;  2WTU A;  3L4I A;  1IO2 A;  3SNN A;  1TV6 A;  3VQD A;  4M7X A;  4FSV A;  4CER A;  2XRI A;  5BPN A;  3VQ8 A;  2HF4 A;  2OAN A;  1VQ6 N;  1HYZ A;  4FL9 A;  4FPA A;  4XEI A;  5E84 A;  3VEX A;  4QCL A;  1XMO K;  1VRU A;  3HO1 A;  1UWB A;  1VSF A;  2OTL N;  1FXX A;  3E66 A;  3SQ1 A;  2QKK A;  4JNE A;  3DXM A;  1BU6 O;  2I7P A;  3I8B A;  5AFU A;  4DR5 K;  1SL0 A;  2DTU A;  3LAN A;  2G8H A;  4E1M A;  3OYK A;  2IDO A;  2HNY A;  4MFB A;  4LF4 K;  4IKF A;  3LWL A;  4FOE A;  3WQU A;  5B8H A;  5BPM A;  1S22 A;  1RDU A;  3FZM A;  2E1Z A;  1U4B A;  3RMD A;  3SPZ A;  3VF6 A;  3RMB A;  3ZET A;  1LAV A;  2EHG A;  3BUZ B;  4IZ9 A;  2W6K A;  4K25 A;  1YT3 A;  3NH2 A;  4DR7 K;  4B3R K;  1XC3 A;  1BIS A;  2XY5 A;  2QWM A;  3RSE A;  2NRW A;  1NJX A;  4MQ3 A;  1Y64 A;  3OYN A;  3E9P A;  3LDQ A;  4LFC K;  1TK0 A;  1C0U A;  3N4Q A;  3THX A;  3V4I A;  1ZBU A;  2NRZ A;  4WQ5 A;  3VEY A;  4DSL A;  5C2D A;  1TL1 A;  1XQS C;  3HL8 A;  1BIZ A;  4IFY A;  3G4S N;  2FF3 B;  3CXC M;  3FGU A;  3WT0 A;  4CW7 B;  3ZYY X;  4Q0B A;  1RBV A;  3S41 A;  3EY1 A;  4K42 A;  3HTV A;  3OBW A;  1NK0 A;  1S5J A;  3KKS A;  1NJW A;  1ZXO A;  3LWM A;  1ZBS A;  4IOX A;  3G6E N;  4FLU A;  4B9N A;  4RW9 A;  1K73 O;  3OS1 A;  4IFV A;  3O3F A;  1V4S A;  4MO4 A;  2P5G A;  2VGM A;  4YDU C;  4M41 A;  4FLV A;  4BG9 A;  3IDH A;  4CI6 A;  5AQK A;  4EFH A;  1I94 K;  1J9A A;  2GUI A;  4KI4 A;  4PWD A;  3DWL A;  4YOT A;  4CBW A;  4JRQ A;  2HNZ A;  4PA1 A;  3NH0 A;  4KTZ A;  3KD5 E;  5T7B A;  2ITG A;  4H03 B;  5FRM A;  3J81 O;  3MDQ A;  1VQM N;  5BRF A;  2IOC A;  2A41 A;  1VSL A;  3PLA A;  2KFN A;  2FSK A;  4Z4I A;  5AQU A;  4TSX A;  4CJP A;  3KZB A;  4KO0 A;  3K9J A;  3ATU A;  2Q2R A;  4NLC A;  4BC4 A;  4FVM A;  3W3D A;  4JI5 K;  4LF5 K;  3AA5 X;  2CGJ A;  3DYA A;  4CJE A;  4DUY K;  4OKK A;  1Z05 A;  1BHL A;  3M3Z A;  3FZF A;  4YFU A;  1HPM A;  1W9H A;  2YCH A;  4BR0 A;  3JS6 A;  4H5N A;  4RW8 A;  4DFK A;  4N41 A;  5HL7 L;  2X74 A;  3MN6 A;  4I7F A;  1IBK K;  2O8C A;  3OYC A;  4OPA A;  3KVG A;  1NJZ A;  1U48 A;  4CZL A;  4U67 L;  5C12 A;  4DTU A;  5GIN A;  4CZG A;  2RF2 A;  4DMN A;  1NK5 A;  4FWQ A;  1K8K A;  4A57 A;  4GKJ K;  4BE2 A;  3AVM A;  3NGY A;  2UXC K;  2HHI A;  4DSJ A;  1WNS A;  2RKI A;  1CXQ A;  3OHR A;  3J7Y P;  4BDZ A;  1U2V B;  4YOR A;  2NNW A;  2QK9 A;  3TAR A;  4BWM A;  4JI2 K;  5IWA K;  1QQO A;  1L3U A;  1TGO A;  1KVA A;  4O8U A;  5HBM A;  2VG6 A;  3VQ6 A;  4DTS A;  3QB0 A;  2J4R A;  2P51 A;  2Q0U A;  1ZBL A;  1K6Y A;  2P9I B;  1XHX A;  4FXD A;  1VQ9 N;  4CHZ A;  4ILH A;  4AQY K;  1S1X A;  2QXF A;  3ZSR A;  3J80 O;  3V9Z A;  5AQR A;  3LDO A;  4AHC A;  3VER A;  3IAY A;  2D0P A;  3LPU A;  1C1B A;  3WXK A;  2ZQB A;  2BDP A;  3NGI A;  3L3U A;  5TKW A;  1TUY A;  4FWP A;  1C1A A;  3KLI A;  3V9S A;  3R6M A;  1XWL A;  1KFD A;  5LJV A;  3WUH A;  4F8R A;  3QEV A;  1NK4 A;  4H8K A;  2XY7 A;  3G10 A;  1NK6 A;  1C0T A;  4ID1 A;  2OPS A;  5A2Q O;  1JLC A;  3LL3 A;  2UU9 K;  2Y1I A;  3D2F A;  1LWC A;  3QLH A;  4A62 A;  3OYB A;  1IJJ A;  4C8N A;  2BTF A;  1EKE A;  3HM9 A;  4HCB A;  2Q0R A;  1TAU A;  3CC7 N;  2E6M A;  1L5U A;  3MXI A;  1HLU A;  3K57 A;  2CGK A;  1WB9 A;  3OYJ A;  3SAF A;  4M3Y A;  3O3G A;  5AQV A;  3QFU A;  3TAE A;  2O8F B;  5C24 A;  4KH5 A;  3R3L A;  3TTD A;  2ZD1 A;  4DV0 K;  4W5O A;  3AA4 A;  2DPN A;  3CG7 A;  4B1Z A;  2PY5 A;  1CZ9 A;  3LAK A;  2O8D A;  4M3W A;  4DQQ A;  2X6N A;  4RCH A;  1B92 A;  4KFB A;  4GV9 A;  2F96 A;  2QWP A;  4BGA A;  5D3G A;  5EOY A;  3T1A A;  3VTH A;  3DRP A;  3BF3 A;  3O80 A;  4CHO A;  2ASO A;  3AVF A;  4NCB A;  3DLB A;  1FW6 A;  5LL6 Z;  1QHA A;  4JS4 A;  2BGG A;  1B9D A;  2WOM A;  3B6O A;  4KB1 A;  3L2V A;  3VEW A;  5FRO A;  4BEB A;  2JWL A;  1WUA A;  1NGC A;  1HKC A;  4JYA K;  3DM2 A;  2G8U A;  4AH9 A;  1IBM K;  4JI7 K;  4CHN A;  2G8F A;  3O8M A;  3MCA B;  5FLX O;  1W0H A;  5AQS A;  3C6U A;  4EIA A;  3ZT2 A;  1WSF A;  2KHO A;  3NFA A;  1NGA A;  5KRT A;  5J2N A;  3HOT A;  3RR7 A;  4FJM A;  1TKZ A;  1NOY A;  1TKT A;  4DQI A;  4DV1 K;  4KHY A;  1YJW N;  3OVN A;  1Q7Y O;  5CR4 A;  3LP0 A;  1VSI A;  3LP3 A;  1LW2 A;  3ENH A;  4JKB A;  3J7A P;  1BI4 A;  3C7N A;  3KWG A;  3VGL A;  3L4Q A;  4M3R A;  3KTQ A;  1BA0 A;  4CJS A;  3V1R A;  3EYZ A;  3OYA A;  1RTH A;  4IBN A;  2P9K B;  2DFH A;  2HHU A;  1RCH A;  3P39 A;  3CJB A;  2O8E A;  2P9P A;  3ZSW A;  3KIO A;  4B1Y B;  4PL7 A;  1NLV A;  2PBD A;  1VSD A;  4DU4 A;  2NZT A;  2Z1H A;  2D1K A;  4IO8 A;  1IG9 A;  4ICL A;  5AQL A;  4DFJ A;  3VQC A;  3PO4 A;  3K0S A;  3VQ4 A;  1NGE A;  4JKE A;  1D9D A;  5J2M A;  3WEE B;  4FJ5 A;  3VEZ A;  1X9M A;  3E1Y A;  1QHT A;  3OA9 A;  4XIU A;  3E9O A;  1V4T A;  2QTD A;  3LM9 A;  2D0A A;  5EVZ A;  1NMD A;  4F3T A;  2PYL A;  4J8F A;  1YUW A;  1BQM A;  2D0C A;  3S3O A;  1X9W A;  1KAX A;  4PKI A;  2O8B A;  2GBZ A;  1RTJ A;  2KQ2 A;  3OBY A;  4RW4 A;  2YHY A;  3THY A;  5HRR A;  4O0I A;  4X66 K;  4JKG A;  4OGC A;  4B9S A;  2OA8 A;  2F4V K;  3MEC A;  3VQE A;  1VQL N;  5FRN A;  1IV0 A;  3JAM O;  4E72 A;  4PY5 A;  4AHR A;  2NRV A;  4ZTJ A;  1KTQ A;  1T44 A;  3DAW A;  3TSP A;  4DSF A;  2H3G X;  1HNI A;  2IGI A;  2GV9 A;  5AQH A;  3ZSV A;  2HST A;  4FOI A;  2PYJ A;  1VQ8 N;  3IUC A;  4CZI A;  4BRK A;  3DI6 A;  4BRF A;  1HKB A;  1NGJ A;  1UOC A;  4KRF A;  2YNH A;  4WFN L;  3ULE A;  3A5N C;  5DM6 L;  4O0J A;  3QNN A;  4E89 A;  5J1E A;  2Q97 A;  2HB5 A;  1I3A A;  5AQI A;  3HT3 A;  4BC5 A;  4H0Y B;  2HHV A;  3H46 O;  3CCM N;  4DV2 K;  3QER A;  1SL1 A;  4KI6 A;  3AVN A;  1EET A;  3EZW A;  4LH4 A;  4FK2 A;  2KW4 A;  5FDL A;  3AV9 A;  5BR9 A;  4IOC L;  2E2Q A;  2JWK A;  2AJQ A;  2A1R A;  4CHQ A;  1Q9X A;  5EY4 A;  5I3U A;  1YVU A;  2GTD A;  2KKZ A;  4FPB A;  4JHD B;  5C10 A;  3TU5 A;  3F2K A;  5CZ1 A;  1KLM A;  3RVC A;  5C25 A;  1SKS A;  1TK5 A;  5KRS A;  5AQQ A;  2P9S B;  3FZH A;  1EXQ A;  5GIP A;  4I9Q A;  4CFB A;  2Q36 A;  1NJI O;  3O1B A;  3BGR A;  3TPQ A;  3R9P A;  3T69 A;  4O5F A;  3I8D A;  3NGZ A;  1BIU A;  4DU1 A;  1IG8 A;  3LM2 A;  2KZM A;  3A8Y A;  3MN5 A;  1NK7 A;  3T1Y K;  3O08 A;  3OW2 M;  1YI2 N;  4DTO A;  1Q86 O;  3M1F A;  2YJF A;  4IJA A;  3GOI A;  4Y1D A;  4BE7 B;  4R79 A;  2RE2 A;  1N8R O;  5HRP A;  3RR8 A;  4IXC A;  3A5O C;  3TWH A;  3AVA A;  1HQU A;  4FM2 A;  4IEE A;  2E88 A;  4FWR A;  1HYV A;  3VF4 A;  4CJV A;  1TVR A;  1ZC6 A;  4BRP A;  1S6Q A;  4QOZ B;  4DV4 K;  1RNH A;  3U3Y A;  4H5W A;  3O9Q A;  1A5X A;  4ILG B;  4B1W B;  4FJ7 A;  2HND A;  1RTI A;  3L3V A;  4DLG A;  4L8R B;  1R59 O;  3BZK A;  3SAH A;  1N6Q A;  5AQM A;  1VQ5 N;  1RDA A;  3O4N A;  1ZBI A;  4KHS A;  1NKB A;  1TYQ A;  4DV7 K;  3O6W A;  4FJI A;  2FBX A;  3AO5 A;  1L3V A;  3ENB A;  2KFZ A;  4ELU A;  4DTM A;  2YI1 A;  4YY3 K;  3MEG A;  3VQQ A;  2G8K A;  3VQB A;  1Q82 O;  3A0I X;  1XUP O;  3LAM A;  1QZ6 A;  3M8P A;  1YHQ N;  2XO7 A;  1HQE A;  4IDK A;  2WUS A;  5C2F A;  2WFB A;  4Z4G A;  1RT2 A;  4GY2 B;  3FZL A;  4B1U B;  1XC9 A;  3OY9 A;  2NRT A;  2BE2 A;  4H4O A;  3TAM A;  4DFM A;  1Q81 O;  2VCP A;  4CBX A;  1VK0 A;  5M1O A;  4LC9 B;  4KHU A;  3LP2 A;  3V9X A;  3DOL A;  4DV3 K;  4H0O A;  4WFB L;  3BEX A;  3RWU A;  1ESV A;  4NYF A;  4RWT A;  3D0P A;  4HTL A;  3IFR A;  4QS8 A;  3OYM A;  4C8K A;  4E3S A;  2UYT A;  3VA3 A;  1S1W A;  3V9U A;  4M3X A;  3HRG A;  2HBL A;  3VOV A;  3QO9 A;  3H6E A;  4FW2 A;  4MLH A;  2PFU A;  2ZJR L;  4FJJ A;  2F9T A;  4O55 A;  2OPP A;  5EXW A;  1BGX T;  3PSF A;  5EU7 A;  1VRT A;  1P90 A;  2QWO A;  3AGK A;  1D5A A;  3ZSZ A;  2NLX A;  1VAZ A;  4BRM A;  1KSP A;  3MMV A;  4Z4E A;  1XI1 A;  1WSE A;  4QS7 A;  1RDC A;  3LDN A;  3QEX A;  1C0F A;  1U45 A;  3SUP A;  3WXM B;  4CJQ A;  1ZYQ A;  3A5M C;  2VG5 A;  3NHG A;  4JK9 A;  4F9O A;  3AAR A;  2UXB K;  5CYQ A;  3V81 A;  3AVH A;  3K2P A;  1VSE A;  1LWF A;  5KTQ A;  4J2B A;  2EX3 A;  2BH1 A;  3CJC A;  1FKO A;  4CEA A;  1N5Y A;  4R5P A;  4NB4 A;  4DFP A;  4DCH A;  3PV8 A;  5SWM A;  3H08 A;  3AVC A;  2E20 A;  3U9D A;  2VWK A;  3HOS A;  3THV A;  2Z1J A;  4ILJ A;  4KBO A;  4Z94 A;  1T03 A;  4Z4C A;  3K58 A;  3TI0 A;  3W0L A;  3RSE B;  4AHS A;  3ID8 A;  3HPO A;  1D9F A;  4V19 S;  3VA0 A;  3C0B A;  3G0Z A;  4CJF A;  2F8T A;  4KAZ A;  4JI1 K;  4BRO A;  5BRE A;  1T05 A;  3NVK A;  4BR4 A;  3SBT A;  4JI4 K;  2A5X A;  4GNI A;  3E9L A;  4CBU A;  4NYN A;  4E19 A;  1KXP A;  4QAG A;  3U8X A;  5AQP A;  3CCE N;  4C8O A;  5DK5 A;  2AA4 A;  4BRL A;  4HWI A;  5AJ3 K;  3EE8 A;  2FLO A;  1XNR K;  1C0M A;  2D0O A;  1JXB A;  3WNH A;  3CET A;  1HNV A;  1QS4 A;  1KVB A;  1REV A;  4K0K K;  1JLG A;  1CLQ A;  4B3M K;  1VSM A;  1KLN A;  4L3Q A;  2PZS A;  3SCX A;  2P9U B;  5F2R A;  1VSJ A;  3HI0 A;  5BR8 K;  2A40 A;  3AVB A;  3IKM A;  2W40 A;  2NUB A;  1DTQ A;  1NJY A;  5C0Y A;  1RBR A;  4NXM K;  4CJR A;  1DTT A;  1JKH A;  4DQS A;  1HKG A;  1GLJ O;  2YNG A;  1NMN A;  4ELV A;  4FLX A;  1MU2 A;  3T1H K;  1JL1 A;  3O4W A;  1RT4 A;  3KWI A;  2QWR A;  4HVJ A;  2CH5 A;  2ASP A;  3UKU A;  3JSM A;  4OLA A;  3HSC A;  4FJH A;  3VQA A;  1EP4 A;  2HBJ A;  1ASU A;  2IVO A;  3I0R A;  4AIL C;  1QZ5 A;  4DWI A;  3K5N A;  4FLZ A;  4XH4 A;  3V1Q A;  4DTN A;  1U47 A;  1VHX A;  1EO1 A;  4E0D A;  4BE1 A;  1OH7 A;  1U2V A;  4XH1 A;  2O8C B;  3HXM A;  3GBT A;  5AFU H;  1CZB A;  3ITH A;  3IG1 A;  3BY5 A;  1GLF O;  4IG0 A;  2V7Z A;  4LFB K;  5JVG L;  1LW0 A;  4JD2 A;  2E2N A;  2P9I A;  3H1V X;  3TAB A;  4CF0 A;  2HVI A;  1QSY A;  2G8I A;  4FZZ A;  4YOY A;  3EE9 A;  2ZWH A;  1S1T A;  3WNE A;  1NNE A;  3E01 A;  4B3S K;  5C42 A;  4J2D A;  4OPH A;  4DTX A;  2I5J A;  1LV5 A;  4FJ9 A;  1ATN A;  2LSN A;  3CJ1 A;  3VES A;  4RW6 A;  4CZM A;  4DHY A;  3TAG A;  2IC3 A;  5JVH L;  1WOQ A;  3SMS A;  3Q7B A;  4CF2 A;  4GV6 A;  4BRE A;  1WBD A;  2HBK A;  2XHB A;  3AVL A;  4F2S A;  5GIO A;  3FFK B;  1U6Z A;  3DRR A;  2YKN A;  5E26 A;  3CCS N;  3WNG A;  3R1X A;  4DTP A;  4JKD A;  3O5B A;  1WSH A;  3O9R A;  4KPY A;  4CK1 A;  5M1P A;  4FLW A;  4DSE A;  1HUX A;  3P31 A;  3S9H A;  4BR9 A;  3HPG A;  2HHQ A;  5J2Q A;  3HVR A;  2FSJ A;  4CK2 A;  1BL3 A;  4I9L A;  3NDK A;  4CGH A;  2FF6 A;  5KQ8 A;  4CEE A;  3KLE A;  1YJ9 N;  1TL3 A;  1KRP A;  3KHY A;  1JLB A;  3PO5 A;  3EKU A;  4JI6 K;  4FJL A;  1KD1 O;  4YNQ A;  1R0A A;  4WQ4 C;  1L3T A;  4M3Z A;  1H1V A;  3IRX A;  1IKW A;  1K8A O;  3SMP A;  3UKR A;  1Q8I A;  1NM1 A;  3D2E A;  5FPN A;  5K14 A;  4CFA A;  2QA4 N;  4LSL A;  3QFP A;  2OPQ A;  4OX9 K;  1GOC A;  2YKM A;  3L6Q A;  2ASM A;  2Z1G A;  4UQG A;  2P9N B;  5HRN A;  4KHP K;  3C6A A;  4OKJ A;  1T6D A;  4UY8 O;  4CHY A;  3VEO A;  4BVO A;  3THW A;  3SZ2 A;  3SQ2 A;  5KQD A;  4BRD A;  4G1Q A;  3QBW A;  3ZSO A;  3ENO A;  1X1P A;  4LFA K;  1IBL K;  3IS9 A;  1UA0 A;  3CC2 N;  2O8D B;  4F3O A;  3OYI A;  2CH6 A;  3OS0 A;  1ILY A;  3JYT A;  4U7B A;  1XNQ K;  5HOO A;  3QML A;  3AO2 A;  3FE1 A;  3F9K A;  1D4X A;  2IIR A;  4B1X B;  1MDU B;  3OTO K;  4N5S A;  1GLD G;  5AQN A;  3CYM A;  5BN8 A;  1BUP A;  5ADX A;  3ZT3 A;  1WSG A;  2QWQ A;  2P5O A;  5LMU K;  5AZJ B;  4FK0 A;  4GVE A;  1RDD A;  4BQL A;  4F2R A;  4K41 A;  1NOZ A;  1QVG M;  5KGW A;  3OYE A;  2HOE A;  5GAE P;  4A5B A;  4CJL A;  2KLA A;  1Q9Y A;  4CZF A;  1NGG A;  5H1S Q;  1SAZ A;  4CGI A;  5I9E B;  2UUA K;  3TSQ A;  3EL2 A;  5ELZ A;  3ZT1 A;  2D4W A;  3U3G A;  3PSI A;  1N32 K;  4KB0 A;  1SS6 A;  4CGD A;  2DFE A;  4JI8 K;  5I42 A;  1NKE A;  4DG1 A;  2P9K A;  2HMI A;  2GX9 A;  3AVG A;  1TUU A;  1HX1 A;  1LWE A;  5CYM A;  3DLH A;  1DT9 A;  3GG4 A;  2IVP A;  2QXL A;  3WQT A;  3S5T A;  4EAH D;  3GDQ A;  1BG3 A;  4XH5 A;  1RIL A;  3KJV A;  3PIP L;  5HLF A;  4FWM A;  4FM1 A;  1BI4 B;  4WQ5 C;  4B3O A;  1BOT O;  2KZZ A;  1WN7 A;  4Z4F A;  3OYG A;  3SQ0 A;  3NF7 A;  3WEE A;  1U49 A;  4HUG A;  3D45 A;  3AO3 A;  1QQC A;  5HP1 A;  4OO1 J;  2A6A A;  2P9P B;  4C1N I;  3LZJ A;  5KPT A;  3SK3 A;  1Q18 A;  1N34 K;  1HNX K;  1N36 K;  3NCI A;  4Q5V A;  2Q31 A;  3HST B;  4LSN A;  2P9L A;  3NVM A;  4E7L A;  1HPZ A;  3CHW A;  3CME N;  2D0B A;  3CPW M;  3H3N O;  5M1N A;  1MWM A;  1SQK A;  1NG9 A;  3ZLJ A;  4DTJ A;  5JEN A;  2A3Z A;  3QDK A;  3G25 A;  2B4J A;  3ZT4 A;  3NF8 A;  3GL1 A;  4BGB A;  2FXU A;  3MAQ A;  3ZCM A;  2P1J A;  2QWN A;  4DF4 A;  4CCH A;  1CXU A;  1RBT A;  4DR1 K;  1VQO N;  3TAF A;  2O8B B;  4CGJ A;  4JKG B;  4B9V A;  3RRH A;  4H5T A;  4HTU A;  2FC0 A;  3J8A A;  4YDU A;  3L2Q A;  1HJR A;  5JMV A;  4IO9 L;  4BE0 A;  4KH4 A;  4CGG A;  3ALY A;  3ISN C;  4CEF A;  4FVU A;  4H4M A;  1KC8 O;  2B5J A;  3Q7C A;  3NBP A;  4GW6 A;  4EHU A;  3CCV N;  4HUF A;  3ID6 A;  2JLE A;  4CJ7 A;  4LF7 K;  4X62 K;  1X3N A;  4CK3 A;  4CEQ A;  4BC3 A;  5AQF A;  4DR3 K;  4A2B A;  1C1C A;  4OPJ A;  3ULE B;  4IG3 A;  3CCL N;  4FK4 A;  4LF9 K;  3OJU A;  3MK6 A;  4HCC A;  3BF1 A;  3PUF A;  5ADX H;  3LPT A;  2FSN A;  3MXJ A;  4I2Q A;  1S6P A;  3SYZ A;  2VQF K;  5LMN K;  4JHD A;  5HRS A;  4OJR A;  5JS2 A;  1O13 A;  5JLF A;  2W41 A;  4BRA A;  1RGI A;  3QEI A;  3U6F A;  1VQN N;  4CFC A;  2P9S A;  3AA2 A;  4C23 A;  3WXL A;  4AHV A;  4BAC A;  4IWV A;  3OYD A;  4AF1 A;  3G71 N;  3ATV A;  2C1I A;  4RG8 A;  1DKG D;  5M1Q A;  2ITM A;  4CJW A;  2HW3 A;  1MA9 B;  5JLH A;  2X78 A;  1YIT N;  5AR0 A;  1QQN A;  3OYL A;  1Z6R A;  3VPZ A;  1LCU A;  4BRN A;  3P1G A;  3P38 A;  2FBY A;  4DS4 A;  4CF9 A;  2E1Y A;  1EQY A;  2AP1 A;  1RBS A;  3C65 A;  5MLC Q;  1HR0 K;  4CEZ A;  3HP6 A;  1VQ4 N;  1VSK A;  4AHU A;  4OGE A;  4WF9 L;  4CE9 A;  3SQ4 A;  3JXU A;  4HHT A;  3HVT A;  2X6S A;  3MX5 A;  3NAE A;  3K5O A;  2ETJ A;  4LF8 K;  1LOT B;  3CM6 A;  3DXK B;  3SI6 A;  1YTA A;  3A2F A;  1S72 N;  2E6L A;  1L3S A;  1C6V A;  2O4G A;  1S9G A;  3CJ9 A;  3HBT A;  2O4I A;  1TKX A;  4X64 K;  4CFD A;  1NGB A;  4JAX A;  4I6M B;  1IKX A;  3VN5 A;  4M3U A;  3R8E A;  5FPD A;  2WBN A;  4M42 A;  3HPH A;  1J53 A;  3CQX A;  1MWK A;  3QIP A;  4IEI A;  1NGI A;  1FKP A;  3CJ7 A;  4O44 A;  4BR2 A;  4DB3 A;  3CM5 A;  2R7Y A;  1ATS A;  1BCM A;  3KD1 E;  4ELT A;  3CER A;  4H0V B;  4JLH A;  3SUQ A;  4K8Z A;  3V9W A;  2E4L A;  4XJX A;  2F9W A;  2VYP A;  3CFP A;  3CIP A;  3DLR A;  4O4G A;  4Y1C A;  1GLB G;  2ZF5 O;  4MDB A;  4WFA L;  1EWQ A;  3CCR N;  3QIO A;  3VF2 A;  4CZE A;  4GKK K;  5KI6 A;  1E4F T;  3O9T A;  1RBU A;  4WYB A;  3CQY A;  3SUN A;  4J2A A;  4GV3 A;  3LZI A;  3VEV A;  5BRH A;  3ZX0 A;  4X65 K;  3DMJ A;  3ZEU B;  4B9U A;  4M3T A;  5JS1 A;  5CZ2 A;  3P5J A;  4RTF D;  5HRO A;  5CE3 A;  2W00 A;  3NF6 A;  4NCA A;  1I39 A;  5AZI B;  2NRR A;  4Z0U A;  4N56 A;  1OH5 A;  2EWS A;  4CF1 A;  3PX4 A;  1JLA A;  1X3M A;  1KVC A;  1HJO A;  1Z26 A;  2B6A A;  3I55 N;  2ZJQ L;  1M1K O;  1JLQ A;  3NE6 A;  1S1U A;  2OZM A;  5CHI A;  3H1Q A;  4DQ8 A;  4CIF A;  5DMR A;  4E7H A;  1VQK N;  2IVN A;  1NU0 A;  5AQT A;  3CCJ N;  1NK8 A;  4W5N A;  4FM0 A;  2VWJ A;  4PHT X;  3ZSY A;  3J7Z O;  3DXM B;  1RT7 A;  4MDA A;  3TR8 A;  3S3N A;  4RW7 A;  1T8E A;  2Z1I A;  5AQO A;  1XHZ A;  4JEP A;  3AO4 A;  3B6P A;  1TK8 A;  3M5R A;  4PKH A;  3CCU N;  3HJF A;  2Q3S A;  4IDH A;  1S1V A;  1G15 A;  3TTC A;  3O4Q A;  5CY4 A;  4BEC A;  1KQS M;  4JK8 A;  1X9S A;  4FWS A;  3ZET B;  3V6D A;  3UIQ A;  4CED A;  3L8B A;  3VTI A;  2VG7 A;  3LP1 A;  4FLT A;  1QTM A;  3KK2 A;  4IFE A;  1S9E A;  4E7I A;  4FO0 A;  1NGD A;  3BP8 A;  3HZ6 A;  1YF5 L;  3M6G A;  4FWN A;  4CIE A;  3THX B;  3U9Z A;  2WC9 A;  4CGF A;  4DLE A;  1ATR A;  3UB5 A;  4LY7 A;  1YVN A;  4CJ4 A;  1RDB A;  3ULD A;  4M45 A;  4EZ6 A;  1IKY A;  2YJE A;  4CJU A;  3D7E O;  3VQ9 A;  2PAV A;  5BPL A;  3DLE A;  4FJX A;  2NRX A;  2ZJP L;  2XY6 A;  1W2B M;  2HMP A;  1OH8 A;  4CEC A;  4YOV A;  4JRP A;  2FBT A;  3MN7 A;  2VQE K;  1NGF A;  5TKY A;  5AQJ A;  4GVM A;  3ZX3 A;  4H0T B;  4A5A A;  4MO5 A;  1XMQ K;  4M7Y A;  1DEJ A;  5EX5 A;  4BRQ A;  1SKW A;  4NO7 A;  2P9U A;  3MWT A;  3SV3 A;  4DQR A;  1HYS A;  4E1J A;  3K5L A;  3QEW A;  2KTQ A;  1RT6 A;  3FR0 A;  2GEM A;  4JV5 K;  2IAJ A;  3SJJ A;  1YIJ N;  3M8R A;  4H0X B;  3KLH A;  4BG8 A;  4W5R A;  5AQY A;  4BR5 A;  4FWO A;  4CEB A;  4F4K A;  3TTF A;  1BA1 A;  4KTQ A;  1NBW A;  1NKC A;  4OPK A;  4DR6 K;  3DOK A;  2D5R A;  4C8M A;  4KRE A;  3K5M A;  3PY8 A;  4EP4 A;  2OCE A;  3QES A;  1SL2 A;  3QNO A;  2OPR A;  2ZE2 A;  2ZM6 K;  4PL8 A;  5KPR A;  3OJS A;  2HBM A;  5C15 A;  4JKC A;  2E2O A;  4BDY A;  3OS2 A;  4YOU A;  2QEX N;  5AQZ A;  4DKW A;  1SUQ A;  3O1W A;  1BCO A;  1WAF A;  3ASM A;  2VWB A;  4KV8 A;  4KKO A;  3P83 D;  1UAX A;  5BRD A;  3UKU B;  3KLG A;  1K9M O;  3F73 A;  2F7T A;  4BWJ A;  1KAY A;  4FZX C;  4FJK A;  1NGH A;  1G99 A;  2HHH K;  4CEO A;  2GWJ A;  4PQU A;  2HHT A;  4CF8 A;  4EHT A;  3SUO A;  1YJN N;  1VQ7 N;  3IMX A;  4BR7 A;  1K8K B;  3O9S A;  3RMC A;  4CD3 A;  1ASV A;  1FK9 A;  4C8L A;  3KLF A;  4ISF A;  4ISG A;  4FZY A;  1P8Z A;  1W97 L;  1KAZ A;  4CJ3 A;  3L2U A;  3CPE A;  2GWK A;  3ZSQ A;  4ZTF A;  3MXM A;  4HUE A;  1JLE A;  5J2P A;  3ZSX A;  3EO3 A;  3GE1 A;  5F0X A;  4AM6 A;  3ZT0 A;  4JD2 B;  5M1F A;  1M90 O;  1J5E K;  3C95 A;  4NXN K;  3HYF A;  4Y0W A;  3F5T A;  4Z4H A;  4OKE A;  1JCG A;  2DY4 A;  1J5O A;  3EKS A;  3VMF B;  4DV5 K;  5SZT A;  2ATQ A;  1EWR A;  3AAQ A;  1QVF M;  3V1O A;  3TAQ A;  1B9F A;  1VSH A;  2C1G A;  4WE1 A;  4LF6 K;  4A59 A;  4JI0 K;  3VQ7 A;  4O5B A;  4DR4 K;  4DTR A;  2F8S A;  1ASW A;  3ZX2 A;  3S3M A;  3I0S A;  3VGM A;  2W6L A;  3OYH A;  3PIO L;  4LH5 A;  3M8Q A;  3T19 A;  4DQP A;  4C1N K;  4W5T A;  1GLL O;  2YHW A;  2O8F A;  2A1S A;  2YNF A;  3D2F B;  4DF8 A;  1JLF A;  1KFS A;  4E1N A;  1ZBH A;  3L2W A;  4B9T A;  3QEP A;  2RPI A;  3CJA A;  1GLA G;  4B9M A;  4NCG A;  4CZK A;  3LDL A;  4B1V A;  4AHT A;  3T7Z A;  1A5W A;  2P9N A;  4FWL A;  1A5V A;  3FZK A;  3MEE A;  4G9Z A;  3C94 A;  2CGL A; 
#chains in the Genus database with same CATH homology
 3J8A A;  3CD6 N;  4H03 B;  4YDU A;  3UKR B;  1SZ2 A;  1YHQ N;  3D2E B;  3MDQ A;  5C2F A;  2WUS A;  4CZH A;  1VQM N;  5BRF A;  3EN9 A;  2WFB A;  2A41 A;  5JMV A;  4IO9 L;  4IOA L;  4KH4 A;  3PLA A;  4GY2 B;  2FSK A;  3FZL A;  3MX2 A;  5AQU A;  2E8A A;  4FVU A;  1KC8 O;  3Q7C A;  4B1U B;  4EHU A;  3CCV N;  2NRT A;  3KZB A;  3ID6 A;  3K9K A;  3K9J A;  3ATU A;  4CJ7 A;  1Q81 O;  2VCP A;  2Q2R A;  4NLC A;  4BC4 A;  4CBX A;  1X3N A;  5LJW A;  1YXQ A;  3W3D A;  2VGN A;  5M1O A;  2CGJ A;  4LC9 B;  4BC3 A;  5AQF A;  1DGK N;  4A2B A;  1Z05 A;  4CZJ A;  3M3Z A;  3FZF A;  5AZJ A;  1HPM A;  2YCH A;  4H0O A;  4BR0 A;  4WFB L;  3BEX A;  3JS6 A;  1ESV A;  4H5N A;  3ULE B;  4CD1 A;  3CCL N;  4RWT A;  4HTL A;  5HL7 L;  5DM7 L;  3MN6 A;  3IFR A;  3MK6 A;  4QS8 A;  3BF1 A;  2UYT A;  5GAH P;  5ADX H;  4OPA A;  3KVG A;  2FSN A;  3HRG A;  2HBL A;  2ZGZ A;  3VOV A;  2HF3 A;  4CZL A;  1C0G A;  4U67 L;  5C12 A;  3H6E A;  5AQG A;  5GIN A;  4MLH A;  2PFU A;  4CZG A;  2ZJR L;  2F9T A;  1CZA N;  2YX6 A;  3C6H A;  4JHD A;  4FWQ A;  1K8K A;  5JLF A;  1O13 A;  4A57 A;  2W41 A;  5EXW A;  4BRA A;  1RGI A;  2QW9 A;  1P90 A;  2QWO A;  3AGK A;  1VQN N;  2NLX A;  1VAZ A;  4BRM A;  2P9S A;  1BDG A;  3CI5 A;  3OHR A;  4C23 A;  1JJ2 M;  3WXL A;  4AM7 A;  1U2V B;  3MMV A;  2NNW A;  4YOR A;  4QS7 A;  3LDN A;  1S3X A;  1C0F A;  1QQO A;  4IWV A;  4O8U A;  5KPZ A;  3WXM B;  4AF1 A;  3G71 N;  3QB0 A;  2J4R A;  3ATV A;  2C1I A;  2Q0U A;  1DKG D;  5M1Q A;  2ITM A;  2P9I B;  1MA9 B;  3A5M C;  1VQ9 N;  4JK9 A;  4F9O A;  5JLH A;  3AAR A;  4ILH A;  3VGK A;  1YIT N;  3C7N B;  1QQN A;  5AR0 A;  5LY3 A;  2OTJ N;  1Z6R A;  3VPZ A;  5AQR A;  1LCU A;  3LDO A;  4BRN A;  3P38 A;  3VER A;  2BH1 A;  2E1Y A;  2D0P A;  3CJC A;  1EQY A;  3FLC O;  2AP1 A;  3C65 A;  5MLC Q;  3H45 C;  1BO5 O;  3WXK A;  4O8K A;  4NB4 A;  4BRH A;  5FPE A;  4DCH A;  1VQ4 N;  2V51 B;  4WF9 L;  5TKW A;  1TUY A;  3JXU A;  2E20 A;  3NMU A;  1NWK A;  3I33 A;  3U9D A;  3HOS A;  4FWP A;  3MX5 A;  1RDW X;  2V7Y A;  4ILJ A;  4KBO A;  3R6M A;  4BR7 A;  4YOW A;  4Z94 A;  1LOT B;  5LJV A;  3DXK B;  3W0L A;  3RSE B;  1JCE A;  3WUH A;  3ID8 A;  1T3V A;  1S72 N;  3C0B A;  3TSU A;  4YOX A;  3CJ9 A;  3HBT A;  1OKJ A;  1NGB A;  4JAX A;  2ZGY A;  3LL3 A;  4I6M B;  4ISE A;  4BRO A;  5BRE A;  2QWL A;  3D2F A;  4A61 A;  3D6R A;  4H0P A;  4BR4 A;  3NVK A;  4A62 A;  3SBT A;  1RFQ A;  3R8E A;  2A5X A;  1IJJ A;  4GNI A;  5FPD A;  2WBN A;  3SJH A;  3H3O B;  3E9L A;  4CBU A;  2BTF A;  3L0Q A;  2Q0R A;  1KXP A;  1MWK A;  3CQX A;  4IEI A;  1NGI A;  3CC7 N;  1HLU A;  3CJ7 A;  4BR2 A;  3U8X A;  4DB3 A;  2CGK A;  5AQP A;  2P9L B;  3CCE N;  2RHK A;  4BRG A;  5M1K A;  3SAF A;  3MWP A;  5AQV A;  1ATS A;  3QFU A;  2AA4 A;  4BRL A;  3MCP A;  4HWI A;  1JCF A;  2FLO A;  3EE8 A;  3R3L A;  4KH5 A;  3TTD A;  2D0O A;  4KH6 A;  3CER A;  4BC2 A;  3CET A;  4H0V B;  5AQW A;  5JIC A;  4XJX A;  2DPN A;  2F9W A;  2GUP A;  2VYP A;  4B1Z A;  3CIP A;  4K43 A;  2QI2 A;  4L3Q A;  2YHX A;  4RCH A;  2P9U B;  3UE5 A;  2ZF5 O;  1GLB G;  5F2R A;  3HI0 A;  3KK7 A;  2A40 A;  4MDB A;  3IKM A;  4WFA L;  3I56 N;  1J6Z A;  2W40 A;  1X9J A;  3VF2 A;  3CCR N;  4GV9 A;  2QWP A;  4BGA A;  5EOY A;  4CZE A;  3VTH A;  5C0Y A;  3BF3 A;  3O80 A;  1E4F T;  2ASO A;  3O9T A;  4WYB A;  3CQY A;  4GV3 A;  2E2P A;  1QHA A;  1E4G T;  3SLC A;  3VEV A;  5BRH A;  1HKG A;  3ZX0 A;  5F1X A;  1GLJ O;  2GEL A;  3ZEU B;  3CC4 N;  3CMA N;  3VEW A;  3O4W A;  4RTF D;  3KWI A;  4BEB A;  2QWR A;  5CE3 A;  2CH5 A;  2JWL A;  1WUA A;  2W00 A;  2ASP A;  1NGC A;  1HKC A;  3UKU A;  2QM1 A;  5AZI B;  3HSC A;  3CF5 L;  3O8M A;  3U4L A;  2HBJ A;  2NRR A;  2IVO A;  5GAD P;  3MCA B;  2EWS A;  1QZ5 A;  1X3M A;  2V52 B;  5AQS A;  1QQM A;  1HJO A;  3I55 N;  2ZJQ L;  4A2A A;  4EIA A;  1M1K O;  4XH4 A;  2KHO A;  1NGA A;  3WXJ A;  5CHI A;  4MLE A;  2NRH A;  3CCQ N;  3HOT A;  3H1Q A;  1EO1 A;  4DQ8 A;  3AY9 A;  5AQX A;  2BUP A;  1U2V A;  4JKF A;  2A42 A;  3AGR A;  4M63 C;  4XH1 A;  1YJW N;  2IVN A;  1VQK N;  1Q7Y O;  3GBT A;  5CR4 A;  5AFU H;  5AQT A;  3CCJ N;  4QS9 A;  1GLF O;  2V7Z A;  3QBX A;  5JVG L;  3ENH A;  4JD2 A;  4JKB A;  2E2N A;  4PHT X;  2P9I A;  3J7Z O;  3H1V X;  3DXM B;  3B8A X;  3C7N A;  3KWG A;  4MDA A;  3VGL A;  3L4Q A;  5AQO A;  5FPM A;  3A5L C;  4YOY A;  3EE9 A;  1BA0 A;  4H5R A;  4JEP A;  2ZWH A;  4BRI A;  4BQZ A;  3M5R A;  4JK7 A;  2P9K B;  4JKH A;  4OPH A;  3VEN A;  5GAG P;  3P39 A;  1ATN A;  3CJB A;  4PKH A;  3CJ1 A;  3CCU N;  3VES A;  2P9P A;  4IDH A;  4CZM A;  4JN4 A;  4DHY A;  5JVH L;  3TTC A;  1WOQ A;  3SMS A;  4B1Y B;  4PL7 A;  3DJC A;  1NLV A;  3Q7B A;  4BEC A;  2PBD A;  4JK8 A;  3VET A;  4BRE A;  4FWS A;  3ZET B;  2HBK A;  4JKA A;  1KQS M;  4GV6 A;  2NZT A;  2D1K A;  4IO8 A;  3VTI A;  5AQL A;  5GIO A;  3FFK B;  1U6Z A;  3DXK A;  3P4I A;  5C10 A;  5E26 A;  3CCS N;  4IFE A;  1NGE A;  3HM8 A;  4JKE A;  3R1X A;  4FO0 A;  1NGD A;  3BP8 A;  3WEE B;  3VEZ A;  4JKD A;  3E1Y A;  3HZ6 A;  1YF5 L;  3M6G A;  3O5B A;  3OA9 A;  4FWN A;  4I6M A;  3E9O A;  3U9Z A;  2WC9 A;  3O9R A;  1V4T A;  1ATR A;  3QIC A;  3UB5 A;  1YAG A;  5M1P A;  1HUX A;  2QTD A;  3P31 A;  3LM9 A;  4BR9 A;  1YVN A;  5EVZ A;  2FSJ A;  1OVY A;  1NMD A;  2YJE A;  5BN9 A;  4J8F A;  1YUW A;  3D7E O;  5KQ8 A;  2FF6 A;  2PAV A;  4FWK A;  5BPL A;  4PKG A;  4BRC A;  2NRX A;  2ZJP L;  4NLB A;  1W2B M;  4BY9 C;  1YJ9 N;  2HMP A;  4PKI A;  3LDP A;  3SAG A;  4H5V A;  3KHY A;  3DLL L;  3OBY A;  1GLE G;  4YOV A;  2YHY A;  3EKU A;  3MN7 A;  4JKG A;  1KD1 O;  4BVP A;  4WQ4 C;  1NGF A;  1BWF O;  2Q1N A;  5TKY A;  1H1V A;  5AQJ A;  3WXI A;  1K8A O;  3ZX3 A;  3SMP A;  3UKR A;  1VQL N;  4H0T B;  1NM1 A;  3D2E A;  3N4P A;  5FPN A;  4A5A A;  1VQP N;  2QA4 N;  4MO5 A;  4M7Y A;  1DEJ A;  3QFP A;  2NRV A;  5EX5 A;  4BRQ A;  4NO7 A;  1TYQ B;  3DAW A;  1T44 A;  3TSP A;  3F9M A;  2P9U A;  3MWT A;  3L6Q A;  2H3G X;  4WCE L;  4WQ4 A;  4E1J A;  2ASM A;  2P9N B;  5AQH A;  3FR0 A;  2GEM A;  3AAP A;  2HST A;  3C6A A;  4FOI A;  1VQ8 N;  3IUC A;  3O9U A;  4CZI A;  1T6D A;  2I7N A;  1YIJ N;  4B9Q A;  4UY8 O;  4BRK A;  3VEO A;  4IJN A;  4BVO A;  4BRF A;  4H0X B;  5KQD A;  1HKB A;  4BRD A;  4BG8 A;  3QBW A;  5AQY A;  3ZEU A;  1NGJ A;  4BR5 A;  3ENO A;  1GLC G;  3CC2 N;  4FWO A;  3SBG A;  3TTF A;  4WFN L;  3ULE A;  1BA1 A;  1T6C A;  1NBW A;  3A5N C;  2CH6 A;  3MN9 A;  5DM6 L;  1ILY A;  4U7B A;  5HOO A;  3QML A;  5AZI A;  2Q97 A;  3FE1 A;  1D4X A;  2IIR A;  5AQI A;  3L4I A;  4PL8 A;  5KPR A;  4BC5 A;  4H0Y B;  4B1X B;  1MDU B;  2HBM A;  5C15 A;  1GLD G;  3H46 O;  5AQN A;  4M7X A;  4JKC A;  3CCM N;  2E2O A;  2QEX N;  5BN8 A;  4YOU A;  1BUP A;  4FSV A;  5ADX A;  2QWQ A;  5BPN A;  5AQZ A;  4DKW A;  2HF4 A;  2OAN A;  3O1W A;  5AZJ B;  3EZW A;  1VQ6 N;  4GVE A;  4FL9 A;  4BQL A;  4FPA A;  4XEI A;  2VWB A;  5BRD A;  4K41 A;  3UKU B;  5E84 A;  5BR9 A;  2E2Q A;  2F7T A;  2JWK A;  4IOC L;  1QVG M;  3VEX A;  1K9M O;  1KAY A;  1NGH A;  2HOE A;  1G99 A;  5GAE P;  4A5B A;  2KLA A;  2GWJ A;  4CZF A;  2OTL N;  1NGG A;  5EY4 A;  1SAZ A;  3E66 A;  5H1S Q;  4EHT A;  1YJN N;  5I9E B;  1VQ7 N;  3IMX A;  2GTD A;  4JNE A;  3DXM A;  2KKZ A;  1BU6 O;  3EL2 A;  2I7P A;  1K8K B;  2D4W A;  4FPB A;  3O9S A;  4JHD B;  5ELZ A;  3TSQ A;  3I8B A;  3TU5 A;  3F2K A;  3RVC A;  4CD3 A;  4ISF A;  4ISG A;  5AFU A;  1SS6 A;  1P8Z A;  1W97 L;  1KAZ A;  5AQQ A;  2P9S B;  3FZH A;  5GIP A;  3CPE A;  2GWK A;  2Q36 A;  2P9K A;  1NJI O;  4FOE A;  3WQU A;  5B8H A;  5BPM A;  2GX9 A;  3O1B A;  1TUU A;  1HX1 A;  1S22 A;  1DT9 A;  1RDU A;  2IVP A;  2QXL A;  3FZM A;  3GG4 A;  4O5F A;  3R9P A;  3T69 A;  3TPQ A;  3WQT A;  4EAH D;  3GDQ A;  3EO3 A;  2E1Z A;  3GE1 A;  5F0X A;  1BG3 A;  4AM6 A;  1IG8 A;  4XH5 A;  3VF6 A;  4JD2 B;  3LM2 A;  5M1F A;  3ZET A;  3A8Y A;  3PIP L;  4IZ9 A;  3BUZ B;  4K25 A;  1M90 O;  3MN5 A;  4FWM A;  1XC3 A;  3O08 A;  4WQ5 C;  3OW2 M;  1YI2 N;  1BOT O;  2QWM A;  4Y0W A;  3RSE A;  3M1F A;  2YJF A;  3F5T A;  1Q86 O;  1JCG A;  2NRW A;  3GOI A;  4IJA A;  4BE7 B;  1Y64 A;  4R79 A;  2RE2 A;  1N8R O;  3WEE A;  3EKS A;  3VMF B;  3E9P A;  4IXC A;  3A5O C;  3LDQ A;  3N4Q A;  3AAQ A;  1QVF M;  4OO1 J;  4IEE A;  2A6A A;  2E88 A;  2P9P B;  4C1N I;  4FWR A;  3VF4 A;  2NRZ A;  4WQ5 A;  3VEY A;  5KPT A;  2C1G A;  1ZC6 A;  3SK3 A;  1Q18 A;  4BRP A;  4A59 A;  5C2D A;  1XQS C;  3G4S N;  2FF3 B;  3CXC M;  4H5W A;  3ZX2 A;  2Q31 A;  3VGM A;  3O9Q A;  3FGU A;  3PIO L;  3WT0 A;  3ZYY X;  2P9L A;  3S41 A;  3NVM A;  4ILG B;  4C1N K;  4B1W B;  3CHW A;  1GLL O;  3CME N;  2YHW A;  4K42 A;  3HTV A;  3H3N O;  5M1N A;  3CPW M;  3OBW A;  1MWM A;  1SQK A;  3D2F B;  1R59 O;  2A3Z A;  3QDK A;  3SAH A;  3G25 A;  5AQM A;  1VQ5 N;  1ZXO A;  1ZBS A;  4IOX A;  3G6E N;  3GL1 A;  4BGB A;  3CJA A;  1GLA G;  1K73 O;  2FXU A;  1TYQ A;  1V4S A;  3O6W A;  4MO4 A;  2VGM A;  4YDU C;  2QWN A;  4CZK A;  4BG9 A;  3IDH A;  3LDL A;  4B1V A;  1VQO N;  4CI6 A;  3T7Z A;  3ENB A;  5AQK A;  2P9N A;  4FWL A;  4EFH A;  2YI1 A;  3DWL A;  4YOT A;  4CBW A;  1Q82 O;  3FZK A;  4JKG B;  3A0I X;  1XUP O;  1QZ6 A;  4G9Z A;  1KAX A;  4H5T A;  2CGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...