3A5LC

Crystal structure of a dictyostelium p109a mg2+-actin in complex with human gelsolin segment 1
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
370
structure length
363
Chain Sequence
b'QALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAALNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAAAAIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gelsolin
publication title Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 115
structure length 363
sequence length 370
ec nomenclature
pdb deposition date 2009-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5lC01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5lC02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3a5lC03
3H3NO 3WQTA 3MK6A 3R8EA 2P9IA 1JCGA 3D2EB 3VETA 2NRHA 2IVOA 3U4LA 4EHUA 5F2RA 2E1YA 4MO4A 5EY4A 4BRNA 4DHYA 4KBOA 2ZGYA 4NB4A 4BRDA 3ENOA 4H0VB 3D2FB 1T44A 3O80A 3WXLA 3U9ZA 5CE3A 2W41A 4DCHA 4CBWA 2V51B 2YHYA 5JLFA 3SK3A 1GLJO 3FZHA 4FOEA 1SAZA 3AAQA 3DWLA 2Q97A 5AQFA 2Q1NA 2QWRA 3W0LA 3M1FA 3O8MA 3L0QA 2A5XA 3DXMB 3KVGA 4FOIA 4K25A 3HBTA 3CJAA 5FPNA 4H0PA 5JLHA 3J8AA 4PKHA 2GELA 5AZJA 1NGHA 1NGCA 4JD2A 5KPRA 2P9NA 2Q31A 3EN9A 1BA0A 2BUPA 1XQSC 4CI6A 4CZKA 3GDQA 3QBXA 3DXKA 2F9TA 5EX5A 2QWQA 1GLAG 2E20A 5BN8A 3QMLA 4JHDB 1HUXA 4O8KA 2UYTA 3CJ9A 4XH4A 5AFUA 2FF6A 2BTFA 2QW9A 1QHAA 1Q18A 1ATSA 1NM1A 4JN4A 4DB3A 3UKRB 1C0FA 5AQGA 4M7YA 5BRFA 2IVNA 1OKJA 2D1KA 3GBTA 3C0BA 3L6QA 1V4TA 1NGFA 2P9KA 1RGIA 5E84A 5ADXA 4BR9A 3W3DA 3VESA 2E1ZA 3AY9A 4Z94A 2AP1A 3EL2A 3BF1A 3WEEB 2OANA 4I6MB 3WT0A 2CGLA 2A41A 3C7NB 1X3MA 3JXUA 4IJNA 3VGMA 1HX1A 3B8AX 3FZKA 5EVZA 4BRAA 1NGDA 5BRHA 5AZIA 2P9IB 2HF3A 3L4IA 4H5VA 4CD3A 1WOQA 4MLHA 2ZGZA 3JS6A 1X9JA 5AQJA 2V7ZA 4LC9B 1D4XA 2P9LA 5AQPA 5AQKA 4FO0A 2ASMA 2FSKA 3WXKA 1RFQA 4BRFA 1TUUA 1TYQA 4BRPA 4BR2A 4PKGA 5AQSA 4BRLA 4K41A 5BPNA 1XC3A 4XH5A 1NGBA 2IVPA 3D7EO 3U9DA 2F9WA 1NMDA 5AZJB 4BG9A 4JD2B 2P9NB 4WQ4A 3MN7A 3BP8A 1BUPA 3GOIA 3LL3A 3VEYA 1QQMA 3H1QA 3VOVA 2EWSA 3QICA 5KQ8A 3FE1A 3CJCA 5BRDA 3DXKB 1E4GT 2HOEA 1DEJA 2DPNA 4IWVA 4F9OA 5BREA 1K8KA 4BREA 1NGAA 3SJHA 3ATVA 3GG4A 3EKSA 2E88A 3ID8A 5F1XA 1YVNA 4B1YB 5AQMA 1WUAA 5AFUH 5F0XA 5AQOA 2I7NA 2QWNA 3A8YA 4GY2B 1GLDG 1HKBA 4BQZA 2QWMA 3A5MC 3FGUA 3M3ZA 2P9UA 4B1ZA 3F9MA 3H6EA 3UKUA 4M7XA 5ADXH 1ZC6A 4EHTA 5KQDA 2QM1A 3LDLA 5FPEA 3WXJA 2FLOA 3BUZB 4H0TB 5BN9A 4BR5A 2NZTA 1DGKN 3ZEUA 1MDUB 4FPBA 1KAZA 1MWMA 1T6CA 4A61A 3CETA 2P9SA 5AZIB 4PKIA 3IFRA 2Q2RA 1ATNA 4ISGA 3QBWA 3QFUA 5KPZA 1U6ZA 2E2NA 2VWBA 4XH1A 1NBWA 3MN5A 2E2OA 3CJBA 2A6AA 2ZWHA 4BR4A 5LY3A 1LOTB 1BOTO 2P9LB 2Q0RA 4QS8A 2P9PA 5ELZA 5I9EB 4CZLA 2PAVA 2HMPA 4H5WA 3O4WA 3R9PA 4A2BA 4BC4A 3GE1A 3OHRA 3ATUA 1TYQB 3EO3A 5LJVA 3QB0A 3LM9A 1HJOA 1G99A 2FF3B 4YDUC 1GLCG 3FZMA 1T6DA 2GEMA 1V4SA 2A42A 1QZ5A 5FPDA 4ISFA 3G25A 5AQZA 3MN6A 3VF6A 3LM2A 4RCHA 4B1WB 2GTDA 1IG8A 1E4FT 5BR9A 1BU6O 1BWFO 3EZWA 4RWTA 1IJJA 3O1WA 4RTFD 3LDNA 3MCPA 1P8ZA 2ZF5O 5AR0A 5B8HA 1NGEA 1GLEG 3IDHA 4BG8A 4CJ7A 4B1UB 3VGLA 4WQ5C 1NGIA 2YHXA 3A5LC 1YXQA 1LCUA 3VEVA 2ASPA 4MO5A 4XEIA 3H1VX 4FWOA 3WQUA 3O1BA 1MA9B 2P9UB 1Z6RA 4BRIA 1EQYA 5AQLA 5AQNA 2FSJA 5AQYA 3WXIA 1JCFA 3KHYA 3A5OC 2I7PA 4NO7A 4BVOA 3CERA 1U2VA 3I8BA 1KAXA 4QS7A 3M6GA 3SMSA 1Z05A 3FLCO 4CZGA 3ZEUB 1HLUA 4FSVA 3ZX0A 3HZ6A 5EOYA 2P9SB 3HI0A 2Q0UA 2YHWA 1NLVA 1Y64A 3TPQA 3VF4A 3WUHA 4MLEA 2QWPA 3ZETA 5AQUA 4BGBA 3A0IX 1ATRA 5LJWA 1XUPO 1X3NA 3VERA 3EKUA 3MMVA 4H5RA 2IIRA 5TKYA 2HF4A 1HKCA 3U8XA 4H0YB 4ISEA 5AQHA 4BRGA 4AM7A 4Y0WA 2W40A 2ITMA 4CZIA 1NGGA 2VYPA 4H5TA 1S3XA 2QXLA 3GL1A 4EAHD 4FWNA 1ESVA 3LDQA 3DJCA 4CZFA 3ZX2A 2CH6A 3RSEA 4BROA 1SQKA 5JICA 1QQNA 5E26A 4A62A 2P9KB 3ULEA 2CGKA 4A2AA 4L3QA 4JNEA 4CZEA 3C7NA 4B1VA 3KZBA 4EFHA 4E1JA 4M63C 3CJ7A 4J8FA 4WYBA 3O08A 1RDWX 1NWKA 1C0GA 3CQXA 4PL8A 1NGJA 4PL7A 4BVPA 4WQ5A 2J4RA 2CGJA 4H03B 3ENHA 1JCEA 4BR0A 1YAGA 1KXPA 4BR7A 2YI1A 5JMVA 4BGAA 5BPLA 4CBUA 4CD1A 3SMPA 4CZHA 4JAXA 4B9QA 5AQVA 3ZX3A 2QWOA 3LDPA 3VEWA 2FSNA 3FZLA 2AA4A 3H3OB 4C23A 4FPAA 3VENA 4HTLA 3VGKA 2FXUA 5AQIA 3BEXA 3FFKB 1U2VB 4BRHA 4BC5A 4H0OA 3CIPA 1R59O 3CQYA 1BO5O 1MWKA 4WQ4C 2PBDA 1BG3A 2A3ZA 3O6WA 3VEXA 4FL9A 4K43A 3HSCA 5KPTA 1GLLO 3MN9A 3ZETB 3R6MA 2D4WA 4BC3A 3CI5A 2GUPA 4FWKA 3D2EA 4FWQA 4EIAA 4IO8A 3VPZA 2ASOA 5AQWA 1K8KB 2YJFA 4AM6A 3HM8A 3UE5A 2H3GX 3S41A 1CZAN 4O5FA 1DKGD 3IUCA 4GNIA 4BRQA 1TUYA 5BPMA 3AAPA 1QQOA 3H45C 3D2FA 4IXCA 3RSEB 4BRKA 4QS9A 1H1VA 2YJEA 3HTVA 1GLBG 3DAWA 3A5NC 2V52B 3ULEB 1ZXOA 3P4IA 5EXWA 1GLFO 2D0PA 4H5NA 5FPMA 3UKUB 3VEZA 2KHOA 2WUSA 1ZBSA 3DXMA 3H46O 1SZ2A 4CZJA 2QWLA 3AARA 2D0OA 2E8AA 2VCPA 4BRCA 5AQQA 3SLCA 4FWRA 3I33A 2E2PA 1S22A 4IJAA 3FZFA 4FWPA 3BF3A 2Q36A 2E2QA 3FR0A 5AQXA 4IZ9A 4JHDA 4K42A 2YCHA 3IMXA 4CZMA 4H0XB 1KAYA 4BQLA 3CHWA 4FWMA 2GWJA 4FWSA 3UKRA 1HKGA 2P9PB 3VF2A 4DQ8A 4B1XB 5AQRA 1J6ZA 2V7YA 4CBXA 5AQTA 4YDUA 1YUWA 3O5BA 1BA1A 1BDGA 4FWLA 2NLXA 4HWIA 3QFPA 3TU5A 2GWKA 3UB5A 1QZ6A 3WEEA 4I6MA 2A40A 3MDQA 3QDKA 3CJ1A 4BRMA 3LDOA 2CH5A 1HPMA 4BC2A 3VEOA
chains in the Genus database with same CATH superfamily
3WQTA 2B4JA 2P9IA 4X65K 1JCGA 2ITGA 2O8EA 3VETA 2QKBA 5M1QA 2RE2A 1BHLA 2IVOA 4CHQA 2E1YA 3VTIA 4BRNA 4KBOA 4CEAA 2IAJA 3ENOA 3AO5A 3D2FB 3CFPA 3SQ2A 1U04A 5JLFA 4NCBA 1GLJO 1NKEA 3AAQA 4JI5K 3P5JA 2Q1NA 2BE2A 3M1FA 5J2NA 3O8MA 3L0QA 3DXMB 3VQ4A 1RBUA 5AZJA 2X6NA 4JD2A 3F73A 2P9NA 2Q31A 1KFSA 1BA0A 2BUPA 1O1WA 1EWRA 2DFHA 3GDQA 3QBXA 4FJ5A 3DXKA 5EX5A 4HUEA 5SWMA 1Q86O 3CMEN 1CZ9A 1IBLK 3E01A 1OVQA 3K5NA 4LY7A 3V6DA 3BDPA 5AQGA 3M8QA 1Z26A 1BGXT 5A2QO 4FM1A 2P9KA 1RT4A 4FJXA 3KIOA 3MECA 3TAFA 3W3DA 1IO2A 3L3UA 3O9RA 5KGXA 4CFAA 2XY6A 3QERA 2OTLN 3RTVA 3C7NB 1X3MA 4IJNA 3B8AX 5EVZA 3TSUA 5BRHA 4NLBA 3TTDA 1RTIA 3ZYYX 1L3UA 4YOUA 2Z1IA 1Z25A 2XRIA 4BDZA 1X9JA 4IEIA 2V7ZA 3NCIA 3HP6A 1D4XA 1RT5A 4ELTA 2X74A 4N47A 3E9OA 1TUUA 3I56N 3MX5A 3SV3A 5AQSA 2GX9A 4YOVA 4YHHK 4CIFA 2IVPA 1HNXK 2F9WA 4CF0A 3O9QA 3K5MA 3HPOA 3MN7A 3H08A 3BP8A 1BUPA 3L2RA 3LL3A 3MAQA 3FE1A 2O8CA 3VN5A 2HOEA 3VQBA 3L4QA 2YNHA 3C6AA 3GG4A 4Q5VA 3ID8A 1YVNA 4E1MA 1GOAA 1XI1A 5AQMA 3PO4A 3HJFA 4JV5K 2O8FA 1NJXA 3S3MA 1BI4B 1GLDG 1T8EA 4B9SA 2HHIA 4BQZA 3VQ7A 4DR6K 3UIQA 3A5MC 3PX6A 2P9UA 1EXQA 4B1ZA 3F9MA 1XWLA 2G8HA 4JS5A 3PX4A 2UUCK 3H6EA 4M7XA 1ZC6A 4EHTA 2FLOA 3NF6A 3K0SA 5J2PA 4KHNA 4FM0A 3K9KA 2NZTA 1JL2A 3VQ9A 3J7AP 4FPBA 2F7TA 3CETA 2P9SA 5E41A 4FJ7A 1ATNA 3F5TA 3OYJA 4NLCA 3QFUA 5KPZA 4DUZK 2VWBA 3MN5A 1QSYA 2E2OA 3K5OA 1S1WA 5LY3A 1S9GA 5C12A 4KHPK 3G6EN 4IOXA 2P9PA 1NJIO 1RT3A 5I9EB 4CEEA 1RDAA 1K9MO 3KLIA 4W5QA 3NFAA 4YDUC 4FW1A 3FZMA 2O4IA 3MWPA 2GEMA 4FZZA 1V4SA 4JEPA 5FRMA 1DTQA 4WCEL 2WFBA 2HBMA 1SL1A 3LANA 3VF6A 3P31A 4B1WB 1TK5A 1LAWA 5BR9A 3LZJA 4B3SK 4RWTA 4E1NA 1B9FA 3FFIA 3B6PA 3MCPA 1TVRA 3C95A 1P8ZA 2ZF5O 3CPWM 5B8HA 5KGWA 3DM2A 3EZ5A 1ZYQA 4CF8A 2P1JA 4ILHA 3T7ZA 4B1UB 4PHTX 4B08A 3NHGA 3VQ6A 2G8FA 4DTOA 1NGIA 1FKOA 3A5LC 1UA0A 1YJWN 1D8YA 2RPIA 1MA9B 3AVHA 3NH0A 3WXIA 3CCRN 1W9HA 1JCFA 1WAJA 1ZBIA 3LP0A 4YORA 3WNGA 1NOZA 3U3GA 3RRGA 3F2KA 5JVGL 1U2VA 4RW4A 1NG9A 4DFPA 3SMSA 1Z05A 3FLCO 1WNSA 1JLQA 3NGIA 4GKJK 4FSVA 3QETA 5EOYA 2HW3A 1G15A 3HI0A 2Q0UA 1NLVA 4C8NA 2QWPA 4BGBA 1KC8O 1X3NA 4XIUA 3P83D 4OLAA 4G9ZA 2HF4A 3SQ1A 5K14A 3TI0A 4M42A 1FXXA 5AQHA 1TL1A 4DFMA 4Y0WA 1LAVA 2VYPA 2QK9A 5C15A 2R7YA 4EAHD 1SUQA 1WBBA 1ESVA 3LP1A 4MQ3A 4CZFA 3RMAA 2B5JA 1SQKA 1IH7A 4A62A 4E7LA 3THWB 4R79A 1ZBHA 3C7NA 4DR3K 1YVUA 3KZBA 1X9MA 4E1JA 2G8KA 3BGRA 3CQ8A 3CJ7A 2WONA 5J2MA 1REVA 1T3VA 3CQXA 3MXJA 5IWAK 4BVPA 4LF5K 2J4RA 2O8DA 2CGJA 1S1VA 4CJUA 4CFDA 1JCEA 1C0MA 3ZT4A 4BGAA 5BPLA 1VSJA 5TKWA 2ATQA 3CM6A 4F3OA 1RDUA 4JAXA 4ID5A 2UXBK 1JLAA 4O0JA 3ZT1A 4J2DA 3MEEA 4DUYK 1IV0A 3QEVA 4KHWA 4I2PA 1NK9A 5AQIA 4DTRA 1VSDA 3BEXA 3LAKA 4KFBA 3QESA 4H0OA 1NKBA 4XJXA 1BO5O 3VQPA 3G10A 2A3ZA 3VEXA 4E7JA 1ILYA 4GW6A 3MN9A 4FJLA 3ZETB 3R6MA 4PQUA 3AVFA 3CI5A 4YY3K 3D2EA 4FWQA 4EIAA 1CLQA 2VWKA 3LWMA 3UE5A 1BI4A 4O44A 5HRRA 4A5BA 3IUCA 4BRQA 5BPMA 3RR8A 2ETJA 2ZQBA 3H45C 2YV0X 3K58A 4O55A 4FK2A 4DU4A 3VMFB 4FK4A 4J2EA 1I39A 3PIPL 3CCMN 4CHNA 1GLFO 2D0PA 1KTQA 3T69A 4YOYA 1S1UA 4PUOA 3H46O 3THXA 1C1AA 2D0CA 2E8AA 4CERA 3OYLA 2VCPA 3L8BA 1FJGK 2HHWA 4JYAK 1DLOA 3VQQA 3HRGA 4DV0K 4IJAA 3FZFA 4FWPA 4FXDA 4CJRA 1NK4A 4FJ9A 3THYA 2KZMA 4IZ9A 2E6LA 4B3TK 3C65A 1C1BA 3P38A 4CZMA 4HHTA 1KAYA 3O9TA 3E66A 5HRNA 4A59A 4FJKA 3SCXA 2WBNA 3EYZA 1TAQA 4FWSA 3AVJA 3UKRA 4DQQA 4B9VA 5CY4A 5AJ3K 3OVNA 4B1XB 1K8AO 4CFCA 5AQTA 2F4VK 5D3GA 3SPZA 2HHHK 4CJVA 3CCUN 3KLGA 4AQYK 2OPPA 3VTHA 2A40A 2KW4A 3SQ4A 2ZJQL 1ASVA 3LDOA 2OA8A 1M1KO 1M90O 1GOCA 1NJYA 3IG1A 2Y1IA 4KHQA 3SJJA 2BDPA 3U4LA 4EHUA 5F2RA 2W6KA 1VRTA 2Z1HA 4BRDA 3BZKA 4Y1CA 4H0VB 4DCHA 4CBWA 5FRNA 3L2QA 4FJHA 4PWDA 5AQFA 2QWRA 3Q7CA 4FOIA 2KFNA 3NVMA 4K25A 3CJAA 1ZBUA 4PKHA 3JSMA 1QS4A 2GELA 3SQ0A 2BANA 4B9TA 4DR1K 3DLHA 1JL1A 4W5OA 3AVMA 3EEQA 3WNHA 1VQPN 4HCCA 2VG5A 1JLFA 1RILA 3OYNA 1GLAG 4B3OA 3ZCMA 5BN8A 1FKPA 5GAEP 1HUXA 4O8KA 3D45A 2C1IA 4YOXA 3CJ9A 2IC3A 2BTFA 1IBMK 4R5PA 3AO4A 1Q18A 4PA1A 3VQDA 4CIGA 3OJSA 4DTNA 1I94K 1RT1A 3VA3A 2UU9K 4J2BA 3KJVA 3OYBA 5I42A 4YNQA 4YFUA 4JLHA 4Z94A 4JK8A 3LPUA 3E1YA 4DMNA 3WEEB 2OANA 2DFFA 3R1XA 1C6VA 4CHZA 3K57A 4I7FA 4CESA 4JI8K 3KD1E 3VGMA 3V1QA 5AZIA 3P1GA 3V9SA 2HF3A 3L4IA 4CD3A 3TWHA 5AQJA 4CHYA 4LC9B 5AQPA 5AQKA 2FSKA 3O3GA 1RFQA 2XY8A 4TSXA 4BRFA 5C2DA 1JLEA 2BGGA 3S9HA 4BRPA 2RF2A 3D6RA 5DK5A 1QSSA 4K41A 3QINA 1XC3A 4FLZA 1VQLN 3WNEA 1NGBA 3D7EO 4GMJB 1NMDA 4BG9A 4WQ4A 1KCFA 3GOIA 1LW2A 1QQMA 5KQ8A 3CFOA 2EWSA 4IG0A 2DTUA 1HJRA 2F96A 1YI2N 5JS1A 4AHUA 1KVCA 1N6QA 3NH2A 4K8XA 2HBJA 4JKGA 4CJTA 1ITGA 4RW8A 4F2SA 2E88A 2G8WA 4OKEA 4DF4A 5AFUH 4CGJA 1HQEA 3VQ8A 5GIPA 1HKBA 2QWMA 3QEXA 3TAGA 4K0KK 4DTJA 4AHTA 1VQMN 5ADXH 4NCAA 5FPEA 3WXJA 3NGZA 1QQCA 3BUZB 4C1NK 1OH6A 1VSHA 3AVBA 2UXCK 3ZEUA 1DGKN 1T6CA 4A61A 4DFKA 3J80O 3PSFA 3THVA 1VSEA 2Q2RA 1FK9A 1XNQK 1U6ZA 2E2NA 4XH1A 1NBWA 1W97L 4AHCA 3CJBA 4E7HA 3RRHA 2ZWHA 4JK9A 4LH5A 2P9LB 4CJFA 4QS8A 3L3VA 4M3YA 1VK0A 4X64K 2B6AA 3OBWA 2HMPA 4H5WA 3CD6N 1VSMA 1XC9A 3ATUA 1TYQB 2D0AA 3ZT2A 1F21A 4DSJA 3QB0A 3K59A 2PYJA 1GLCG 3ZT3A 4FLVA 1T6DA 3M5RA 4GKKK 4ISFA 5AQZA 4HVJA 3LM2A 3J81O 1E4FT 4HUFA 4KI6A 1BU6O 4DLGA 1BWFO 3EZWA 2HNYA 4BWMA 2KLAA 3O1WA 3CC4N 1QHTA 2W42A 4RTFD 3LDNA 3D0PA 2YKNA 1VQ5N 3CF5L 1NGEA 3NF8A 4Z4EA 4JI3K 4CEOA 4Z4CA 3OYGA 4KRFA 2NRZA 2NRTA 4WQ5C 1C0TA 3I8DA 3CXCM 2YHXA 1LCUA 2ASPA 4IOAL 4MO5A 4XEIA 4FWOA 4NYFA 3TTCA 3O1BA 2ZJPL 2RHKA 5AQLA 5HLFA 5M1PA 2D5RA 4GVEA 4DU1A 3CYMA 1JLGA 2D0BA 3QNNA 1EO1A 3OTOK 3KHYA 3AVNA 3CCLN 4NO7A 2I5JA 3CERA 2O4GA 3T19A 2XO7A 3M6GA 4CZGA 1S72N 4LSLA 5GINA 1TKZA 3OYAA 3NE6A 1HLUA 1XHXA 3HZ6A 2F8SA 3L2VA 5HROA 4YOTA 1QVGM 1Y64A 3VF4A 4MLEA 4KHSA 3A0IX 1ATRA 5LJWA 1NK7A 3SBTA 3MMVA 2IIRA 1GOBA 5TKYA 1LW0A 3ZSOA 3HP9A 4JI1K 4QCLA 1LWCA 2ITMA 3SUPA 2QXLA 4M41A 1TAUA 2EHGA 5DMRA 1J5OA 3RSEA 3S3NA 4BROA 2Q3SA 4ICLA 5E26A 4ZHRA 3ZT0A 1DT9A 2ZD1A 5FDLA 1JJ2M 3O4NA 3P39A 4JNEA 1L3TA 2F8TA 1HRHA 2NUBA 5CZ2A 4FJJA 4CEQA 1WLJA 1HPZA 4EFHA 3L2WA 4M63C 4FM2A 4J8FA 3C6TA 3O08A 3KK3A 4PL8A 4IBNA 1X1PA 4DS5A 1Q9YA 4NXMK 4LFAK 4WE1A 1YAGA 5JMVA 1RBSA 5SZTA 4DV6K 3VQ5A 4L8RB 2HBLA 1WSJA 4B9QA 5AQVA 3RR7A 2OCEA 2QWOA 1T05A 2FSNA 4CJ3A 4JRPA 3FZLA 2AA4A 3H3OB 3VENA 4LFCK 2FXUA 3AV9A 2OPSA 3T1YK 3QEIA 2E6MA 4M3RA 4BC5A 3SUQA 1MWKA 2PBDA 1BG3A 3MX2A 2PYLA 1GLLO 3V4IA 3OA9A 1VSKA 1OH7A 1J9AA 5CR4A 3VQAA 1L5UA 4IO8A 2XY7A 1K8KB 4AM6A 3KLFA 4M45A 4C8KA 4E7IA 4F8RA 1IBKK 3PIOL 5LMUK 3D2FA 1C0UA 4F3TA 4QS9A 1GLBG 1TKTA 4CEZA 3A5NC 2V52B 3ULEB 3ZSQA 5EU7A 1ZXOA 3P4IA 1NJZA 5EXWA 2YNIA 3VEZA 2WUSA 3JAMO 3DXMA 1SZ2A 4CZJA 3AARA 1YTAA 1NKCA 3Q7BA 1HNWK 5AQQA 2ZE2A 2O8BB 2IOCA 3RVCA 1VSFA 2KZZA 4DQRA 3I33A 2E2PA 3WNFA 4DKWA 4Z4IA 2QKKA 3CCSN 1BIZA 2OTJN 3BF3A 4YOWA 2Q36A 1KQSM 2E2QA 5AQXA 3KTQA 1VAZA 2YCHA 3IMXA 3M8PA 3AGRA 3I0RA 4H0XB 3MWTA 3CHWA 4BE0A 4EP4A 1HKGA 3HPGA 3SUOA 3VF2A 4H4OA 3ZSRA 3DOKA 4CJQA 2V7YA 4MDAA 2X6SA 4UQGA 1C1CA 1VQ4N 4PY5A 1TKXA 4W5NA 2WC9A 1SKWA 3AO2A 4QOZB 2E4LA 3MDQA 3CJ1A 2AJQA 4O8UA 3DLKA 3ISNC 4H4MA 1XMOK 3PUFA 2NRXA 5KRSA 3VEOA 4OGEA 4GV3A 1IKYA 3MK6A 3NF7A 3R8EA 3K5LA 2NRHA 4KTZA 2GV9A 4W5RA 4DQIA 4OKJA 4LD0A 4NB4A 1JLBA 2KQ2A 4JK7A 1T44A 3O80A 4DV4K 4C8OA 4QAGA 5CE3A 1BCMA 3AVIA 3CCVN 2V51B 2YHYA 3AA3A 4DQPA 3SK3A 1J54A 4FOEA 4J2AA 4Z4HA 4IFVA 3W0LA 1UAXA 1BCOA 3SAFA 3KVGA 4OPHA 5JLHA 3HBTA 3AVCA 1NU0A 1NGHA 3AO3A 1KD1O 2VG7A 1WN7A 1XQSC 3LALA 4JI4K 2F9TA 2QWQA 4CHOA 1SS6A 4WFNL 2E20A 3QMLA 4JHDB 5FROA 1XHZA 4GV9A 4XH4A 2FF6A 2QW9A 4LF8K 1EKEA 3CCJN 4LFBK 1QHAA 1ATSA 1NM1A 1DTTA 4HCBA 4O0IA 1C0FA 4M7YA 3OYCA 2IVNA 2D1KA 3PV8A 4DU3A 3GBTA 3C0BA 1HYZA 3QEPA 4DSKA 1V4TA 4CF2A 1NGFA 3OYDA 1S5JA 2FBTA 4A5AA 1RTJA 4BR9A 4MDBA 2PZSA 4DSIA 2E1ZA 3AY9A 3EL2A 4IFEA 1KLNA 4M3XA 1VQ8N 4I6MB 2VQEK 2CGLA 4OPKA 3L2UA 3VA0A 2Z1GA 3JXUA 2P51A 1VRUA 1HX1A 2GUIA 3FZKA 1VHXA 4M3ZA 2HNDA 4GVMA 3DRPA 2P9IB 2WOMA 3LWLA 2O8EB 1WOQA 5JS2A 1CXQA 4MLHA 4FCYA 4E3SA 4M3WA 3T1HK 1WBDA 3QO9A 2JLEA 1YF5L 2ASMA 4CGIA 3KWIA 3WXKA 1VSLA 5I3UA 4BR2A 4PKGA 4JI2K 5GIOA 3CG7A 3QEWA 1WAFA 3OS0A 2UUAK 2ZJRL 4IOCL 5BPNA 2FBXA 2FBYA 4XH5A 3U9DA 1L3VA 3F9KA 5AZJB 3ULDA 4JD2B 4M3UA 2P9NB 5IT9O 1UWBA 1VSIA 3VOVA 3CJCA 5BRDA 3DXKB 3SI6A 4U7BA 2DPNA 4IWVA 5CHIA 4CW7B 5BREA 1K8KA 3NGYA 2DFEA 3ATVA 3HL8A 1KVAA 2FBVA 4B1YB 1RBTA 1UOCA 5CZ1A 1FW6A 1VQON 5F0XA 4CJ5A 4ZTFA 1N36K 5AQOA 4KPYA 2I7NA 2QWNA 1BQNA 3A8YA 3MEDA 2JWLA 1NK5A 4WFBL 1RT2A 2PFUA 2YNGA 2E5LK 4CCHA 2ZM6K 5KQDA 2QM1A 2XY5A 4H0TB 4OX9K 1YTUA 3V81A 2O8BA 2LSNA 1E3MA 3LAMA 4G1QA 1VQKN 1MDUB 4OPAA 4EZ9A 1KSPA 1MWMA 1OVYA 3DLGA 4PKIA 1SL2A 3QIPA 2HSTA 4CK1A 3QBWA 1EETA 2A6AA 4AHSA 1LOTB 3CFRA 1BOTO 5ELZA 3T1AA 4CZLA 2PAVA 4DV7K 4IKFA 1MU2A 3O4WA 3R9PA 4IG3A 3GE1A 3EO3A 3TR8A 5LJVA 2G8IA 4LF6K 5CYQA 3OYIA 5M1OA 4CEDA 1QZ5A 3SV4A 4FK0A 5FPDA 3THWA 4BECA 3O9UA 3G25A 3MN6A 3O3HA 4RCHA 1YHQN 3OBYA 2QI2A 4CFBA 2VGNA 1IJJA 4KHUA 3EY1A 4GV6A 2Y1JA 1GLEG 2NRVA 4CJ7A 3VGLA 2A1RA 4CK3A 1RNHA 2O8FB 1YXQA 2BH1A 3VEVA 3ASMA 4DF8A 1ASWA 3WQUA 1QSLA 3PO5A 1JKHA 2P9UB 3V9XA 1EQYA 3SZ2A 1YJNN 4CJ4A 4FJGA 4UY8O 5AQYA 1T03A 3OYHA 4RW6A 3A5OC 2I7PA 4BVOA 3AVAA 3TARA 4B3MK 1N32K 1KAXA 3IKMA 3HOTA 3TAQA 4DV2K 3HOSA 1EWQA 1NMNA 3ZX0A 3HT3A 2P9SB 3O3FA 3TPQA 5J2QA 3ZETA 2OZMA 1BIUA 1TK8A 3U8XA 4H8KA 4CJSA 4AM7A 5M1FA 1RCHA 4H5TA 1IG9A 4JKBA 1S3XA 3NBPA 1LV5A 3GL1A 3HM9A 2HHSA 4CEFA 4FWNA 3O9SA 3DJCA 2CH6A 1VQNN 1D9DA 4BEBA 3MXIA 4DV3K 3LP3A 2C1GA 1SL0A 4A2AA 4L3QA 4NYNA 2YX6A 3ZSXA 3HO1A 5M1NA 4WYBA 3SPYA 4B9MA 4O5BA 1NWKA 1C0GA 2RN2A 3HVTA 1S1TA 1A5WA 4WQ5A 2OPQA 4BR0A 1BISA 1B9DA 4BR7A 2HHVA 4W5TA 5HL7L 3EE9A 1LWEA 4DTSA 4KB1A 4CBUA 4CD1A 4HUGA 4CGGA 4ELUA 2YHBA 4E0DA 3SYZA 3IS9A 1HNVA 2QEXN 5H1SQ 3ZX3A 3LDPA 4AH9A 3SUNA 3VEWA 4WFAL 1EX4A 2UXDK 4JKDA 4CJWA 4MFBA 3IAYA 3RWUA 4C23A 5DM7L 3CM5A 4HTLA 3VGKA 2X78A 4CECA 4U67L 2OZSA 1CXUA 3FFKB 3IRXA 1U2VB 3CIPA 4FW2A 3KWGA 4WQ4C 4DSEA 4BDYA 1NNEA 4JKHA 3U6FA 3HSCA 5KPTA 1JXBA 2D4WA 2NNWA 4BC3A 5JVHL 5KTQA 3HSTB 4C1NI 4CIEA 4KH5A 2VQFK 3LPTA 1HNIA 2ASOA 3S3OA 3HM8A 3LP2A 3DLRA 3SNNA 3NMUA 1RT7A 1BQMA 3M8SA 1S6QA 1TUYA 3AAPA 5HBMA 1U4BA 4FVMA 2WTUA 4X66K 4O4GA 4LSNA 4FLXA 1H1VA 3AA5X 1U47A 3G4SN 3DAWA 4Q0BA 3J7YP 5FPMA 3UKUB 3TSPA 5KI6A 4FLTA 1ZBSA 4N41A 2QWLA 2D0OA 3C6UA 4BRCA 1A5XA 1S6PA 3LDSA 4LF4K 3SLCA 4IFYA 3TABA 4DTPA 2O8DB 2XHBA 1S22A 2QXFA 4CEBA 4IDHA 1XNRK 4BE1A 5C25A 1Y97A 3QNOA 3B6OA 1NJWA 4BQLA 4CK2A 4FWMA 3BY5A 1NK6A 3CC2N 3DMJA 5AQRA 4B9UA 1HMVA 4JI0K 4YDUA 3O5BA 1BDGA 4FWLA 5FLXO 4RW7A 5CYMA 4B9LA 4HWIA 2GWKA 1SKSA 4KTQA 3WEEA 4CE9A 3QDKA 4JI6K 3NDKA 1Q9XA 4KO0A 2OPRA 3K9JA 2DY4A 3H3NO 4DQSA 3D2EB 4CJLA 4OJRA 1BL3A 4IDKA 5EY4A 4MO4A 5T7BA 4DHYA 2ZGYA 3WXLA 3U9ZA 1B92A 3PY8A 1RDCA 2W41A 3C94A 4F2RA 3FZHA 4KB0A 1SAZA 2KFZA 1OH5A 3DWLA 2Q97A 5C10A 1SKRA 1N33K 3ZSYA 4X62K 5FPNA 2A5XA 3DLEA 3THXB 4H0PA 3J8AA 3E9LA 1NGCA 5KPRA 3EN9A 1Q7YO 1U48A 5MLCQ 3S5TA 3AGKA 3DRSA 4CI6A 3NVKA 4CZKA 4JKEA 1P90A 4FJNA 2YNFA 4E72A 3THYB 3AVGA 1Q8IA 1WSIA 2UYTA 5AFUA 1RTDA 2HHQA 4JN4A 4DB3A 3UKRB 1YITN 4I2QA 4FLWA 4DSLA 5BRFA 4EP5A 1RDBA 1OKJA 3VQCA 3V9UA 3MXMA 3E9PA 4EZ6A 3L6QA 1RGIA 3AA2A 5E84A 5ADXA 4Z4GA 1ZBFA 3KLHA 4WF9L 2JGUA 1D5AA 4KH4A 3VESA 3NAEA 4KREA 1J53A 2AP1A 4ID1A 3BF1A 3TAMA 1JXEA 3WT0A 1D9FA 4IEEA 1T7PA 5C42A 2A41A 4OPJA 4BRAA 1NGDA 1RBVA 1XMQK 2HVIA 3TSQA 4H5VA 1J5EK 2ZGZA 3JS6A 4KTWA 2P9LA 1HQUA 1A5VA 2Z1JA 3OY9A 3DLBA 3AA4A 4FO0A 3ZSVA 4N56A 4CJKA 2YKMA 3OYKA 1TKDA 1YIJN 2HHXA 4KKOA 1TYQA 3ENBA 4BRLA 4ILJA 4FYDA 4FLUA 3V1RA 4OKKA 2KTQA 4Z4FA 3U3YA 4Z0UA 4DR2K 1HNZK 5KRTA 3VEYA 3H1QA 5LL6Z 3QICA 3PLAA 2IDOA 1IKWA 2NRWA 3G0ZA 4DV1K 1E4GT 1DEJA 4F9OA 1ASUA 4BREA 4BACA 4K8ZA 1NGAA 3SJHA 3EKSA 4Y1DA 5F1XA 3QIOA 1WUAA 4CVNE 5JENA 4CGDA 3DOLA 2G8VA 4GY2B 4JRQA 4B9NA 3KLEA 3M8RA 4FZYA 4N5SA 3FGUA 3M3ZA 4CHPA 2PY5A 3NH1A 2RKIA 4E19A 2UUBK 4JKCA 3UKUA 4JKFA 2IGIA 3LDLA 1K6YA 1X9SA 3OJUA 1TGOA 3N4QA 5BN9A 4BR5A 1KAZA 1KLMA 3KD5E 5AZIB 3CCQN 3IFRA 4ISGA 4OGCA 4DR7K 4FZXC 3KK1A 3N4PA 4BR4A 1K73O 3DLLL 4DSFA 4LF9K 4AF1A 2Q0RA 3O4QA 3CCEN 2P5GA 5C2FA 3KKRA 4A2BA 1CZBA 4BC4A 3OHRA 4DFJA 3TANA 2P5OA 2JWKA 3J7ZO 3LM9A 1W7AA 1HJOA 1HR0K 1G99A 2FF3B 1IKVA 4JS4A 3PX0A 4DLEA 4FLYA 3TTFA 4A57A 2A42A 1QTMA 1TV6A 4FJIA 4OLBA 4M3TA 5M1KA 5LMNK 3AO1A 3HK2A 2GTDA 1IG8A 2KKZA 3V9WA 4N76A 3EE8A 1RTHA 2VGMA 1JLCA 1IKXA 3ALYA 4JKGB 3K2PA 5AR0A 3IDHA 4BG8A 1WB9A 4FJMA 4ZTJA 4C8LA 1OH8A 4BE2A 4AILC 3OW2M 5C24A 2W6LA 3H1VX 5HRSA 1Z6RA 4BRIA 1N34K 3V9ZA 3ID6A 5AQNA 4HTUA 2FSJA 4ELVA 1NK8A 3C6HA 2A1SA 3OS1A 1R0AA 4B8AB 5GAGP 2HNZA 3I8BA 4QS7A 1VQ9N 3ZSZA 4E7KA 4CJEA 1KFDA 1QE1A 4ILGB 3ZEUB 3AVKA 1O13A 3HYFA 3A2FA 3CC7N 2YHWA 3WUHA 1LWFA 5AQUA 2NRRA 1XUPO 2HB5A 2GBZA 1WSGA 3VERA 3EKUA 4H5RA 3DI6A 1EP4A 4DTMA 1HKCA 1WSEA 4H0YB 4ISEA 4BRGA 3TAEA 4C8MA 2W40A 4LH4A 4CZIA 1NGGA 1W0HA 3SAHA 4B8CA 3LDQA 4DG1A 4DS4A 1U49A 3ZX2A 3AVLA 3KK7A 4JKAA 5JICA 1QQNA 2P9KB 3ULEA 2CGKA 3HPHA 4CZEA 4B1VA 3MCAB 4CF9A 1RDWX 4OO1J 1NGJA 4PL7A 1SV5A 3WXMB 4BDPA 4H03B 3ENHA 1KXPA 1L3SA 2YI1A 2EX3A 4LF7K 4BWJA 1N8RO 2QA4N 1HYVA 3SMPA 4IO9L 5HP1A 4CZHA 1W2BM 3ITHA 3KKSA 4B3RK 2HVHA 3MEGA 3NF9A 3OYEA 4NXNK 3DYAA 1S1XA 4FPAA 2VWJA 3SBGA 1YJ9N 1HYSA 4BY9C 4KV8A 4DTXA 4BRHA 1R59O 3JYTA 3RMDA 3CQYA 2W00A 4I9QA 3O6WA 4FL9A 4K43A 4F4KA 3LZIA 3TAPA 1Q82O 1VQ6N 3OYFA 1U45A 5DM6L 1WSHA 2VG6A 4RW9A 2GUPA 3ZLJA 4FWKA 2O8CB 3VPZA 4AHVA 3CPEA 5AQWA 2YJFA 3G71N 1KVBA 2H3GX 3S41A 4DR4K 3QLHA 4DR5K 1CZAN 4O5FA 3T3FA 1DKGD 5HRPA 1ZBLA 4GNIA 4DTUA 1RDDA 1QQOA 3I55N 4IXCA 4KHYA 3ZSWA 3RSEB 4BE7B 5C0YA 4BRKA 2YJEA 3HTVA 4KH6A 3BZCA 4RG8A 4CGFA 1KRPA 4DV5K 4CJPA 2IS3A 1QVFM 4H5NA 1RT6A 2KHOA 3PSIA 2QTDA 1TK0A 5HOOA 3KK2A 2HHTA 4DWIA 2YHAA 1VQ7N 4FWRA 3HXMA 2HMIA 3OS2A 3CYGA 3SAGA 4JI7K 2FC0A 1RBRA 4CGHA 4FJ8A 3DRRA 3FR0A 4JHDA 4K42A 3CMAN 3R3LA 1NOYA 1Q81O 3I0SA 1UA1A 5GADP 2OYQA 4FVUA 1X9WA 2HHUA 2GWJA 1NK0A 2P9PB 4DQ8A 2HBKA 1J6ZA 1TL3A 4CBXA 4AHRA 3RMCA 3HVRA 4NCGA 1YUWA 4E89A 4OVLA 1BA1A 3OYMA 2NLXA 4V19S 4KI4A 2G8UA 3QFPA 3TU5A 1I3AA 5BR8K 3UB5A 1QZ6A 4I6MA 1S9EA 4BRMA 5GAHP 1YT3A 5J1EA 1WSFA 3VQEA 3RMBA 1N5YA 2CH5A 4I9LA 4KAZA 1HPMA 3V1OA 4BC2A 4CF1A
chains in the Genus database with same CATH topology
3H3NO 3WQTA 4GV3A 3MK6A 3R8EA 2P9IA 1M90O 1JCGA 3D2EB 3VETA 2NRHA 5M1QA 2RE2A 2IVOA 3U4LA 4EHUA 5F2RA 2E1YA 4MO4A 5EY4A 3VTIA 4BRNA 4DHYA 4KBOA 2ZGYA 4NB4A 4BRDA 3ENOA 4H0VB 3D2FB 1T44A 3O80A 4JK7A 3WXLA 3U9ZA 5CE3A 2W41A 4DCHA 4CBWA 3CCVN 2V51B 2YHYA 5JLFA 3SK3A 1GLJO 3FZHA 4FOEA 1SAZA 3AAQA 3DWLA 2Q97A 5C10A 5AQFA 2Q1NA 2QWRA 3W0LA 3M1FA 3Q7CA 3O8MA 3SAFA 3L0QA 2A5XA 3DXMB 3KVGA 3NVMA 4FOIA 3HBTA 3CJAA 4K25A 4H0PA 4OPHA 3J8AA 4PKHA 5JLHA 2GELA 3E9LA 5AZJA 1NGHA 1NGCA 4JD2A 5KPRA 2P9NA 2Q31A 1KD1O 3EN9A 1Q7YO 1BA0A 5MLCQ 2BUPA 1XQSC 3AGKA 1VQPN 4CI6A 3NVKA 4CZKA 3GDQA 3QBXA 4JKEA 1P90A 2F9TA 3DXKA 5EX5A 2QWQA 1GLAG 1SS6A 4WFNL 2E20A 5BN8A 3QMLA 4JHDB 1Q86O 4GV9A 5GAEP 3CMEN 1HUXA 4O8KA 2C1IA 2UYTA 4YOXA 3CJ9A 4XH4A 5AFUA 2FF6A 2BTFA 2QW9A 3CCJN 1QHAA 1ATSA 1Q18A 1NM1A 4JN4A 4DB3A 3UKRB 1YITN 1C0FA 5AQGA 4M7YA 5BRFA 1M1KO 2IVNA 1OKJA 2D1KA 3E9PA 3C0BA 3GBTA 3L6QA 1V4TA 1NGFA 2P9KA 1RGIA 4A5AA 5E84A 5ADXA 4BR9A 4MDBA 4WF9L 3W3DA 4KH4A 3VESA 2E1ZA 3AY9A 4Z94A 4JK8A 2AP1A 3EL2A 4IFEA 3E1YA 3BF1A 3WEEB 1VQ8N 3O9RA 2OANA 4I6MB 3WT0A 3R1XA 4IEEA 2OTLN 2CGLA 2A41A 3C7NB 1X3MA 3JXUA 4IJNA 3VGMA 1HX1A 3B8AX 3FZKA 5EVZA 3TSUA 1NGDA 4NLBA 4BRAA 5BRHA 5AZIA 3TTDA 2P9IB 2HF3A 3L4IA 3TSQA 4H5VA 4CD3A 1WOQA 3ZYYX 4MLHA 4YOUA 2ZGZA 3JS6A 1X9JA 4IEIA 5AQJA 2V7ZA 4LC9B 1D4XA 2P9LA 5AQPA 1YF5L 5AQKA 4FO0A 2ASMA 3KWIA 2FSKA 1YIJN 3WXKA 1RFQA 4BRFA 3E9OA 5C2DA 1TUUA 3I56N 3MX5A 1TYQA 4BRPA 4BR2A 3ENBA 4PKGA 5GIOA 5AQSA 4BRLA 2GX9A 4YOVA 3D6RA 4K41A 2ZJRL 4IOCL 4ILJA 5BPNA 1XC3A 4XH5A 1VQLN 1NGBA 2IVPA 3D7EO 3U9DA 2F9WA 1NMDA 5AZJB 4BG9A 3O9QA 4JD2B 2P9NB 4WQ4A 3MN7A 3BP8A 1BUPA 3GOIA 3LL3A 3VEYA 1QQMA 3H1QA 3VOVA 2EWSA 3QICA 5KQ8A 3FE1A 3CJCA 3PLAA 2NRWA 5BRDA 3DXKB 1YI2N 1E4GT 2HOEA 1DEJA 2DPNA 4IWVA 4F9OA 5BREA 3L4QA 1K8KA 4BREA 2HBJA 5CHIA 1NGAA 3SJHA 4JKGA 3ATVA 3C6AA 3EKSA 3GG4A 2E88A 3ID8A 5F1XA 1YVNA 4B1YB 5AQMA 1WUAA 5AFUH 1VQON 5F0XA 5AQOA 2I7NA 2QWNA 3A8YA 4GY2B 5GIPA 2JWLA 1GLDG 1HKBA 4WFBL 4BQZA 2QWMA 3A5MC 2PFUA 3FGUA 3M3ZA 2P9UA 4B1ZA 3F9MA 4JKCA 3H6EA 4JKFA 4M7XA 3UKUA 1VQMN 5ADXH 1ZC6A 4EHTA 5KQDA 2QM1A 3LDLA 5FPEA 3WXJA 2FLOA 3BUZB 4C1NK 4H0TB 3K9KA 3N4QA 5BN9A 4BR5A 2NZTA 1DGKN 3ZEUA 1VQKN 1MDUB 4FPBA 4OPAA 1KAZA 1MWMA 1OVYA 1T6CA 2F7TA 3CETA 2P9SA 5AZIB 4A61A 4PKIA 3CCQN 3IFRA 2HSTA 2Q2RA 1ATNA 4ISGA 3F5TA 3QBWA 4NLCA 3QFUA 5KPZA 1U6ZA 2E2NA 2VWBA 4XH1A 1NBWA 1W97L 3MN5A 3N4PA 2E2OA 3CJBA 2A6AA 2ZWHA 4BR4A 5LY3A 5C12A 3DLLL 1K73O 4JK9A 4AF1A 1LOTB 3G6EN 1BOTO 2P9LB 2Q0RA 4IOXA 2P9PA 4QS8A 5ELZA 1NJIO 5I9EB 3OBWA 4CZLA 2PAVA 3CCEN 2HMPA 5C2FA 4H5WA 3O4WA 3CD6N 3R9PA 4A2BA 4BC4A 3GE1A 3OHRA 3ATUA 1K9MO 1TYQB 3EO3A 5LJVA 2JWKA 3QB0A 3J7ZO 3LM9A 1HJOA 1G99A 2FF3B 4YDUC 1GLCG 3FZMA 1T6DA 5M1OA 3MWPA 2GEMA 3M5RA 1V4SA 4JEPA 2A42A 1QZ5A 3TTFA 4A57A 5FPDA 4BECA 3O9UA 4ISFA 3G25A 4WCEL 2WFBA 5AQZA 2HBMA 3MN6A 5M1KA 3VF6A 1YHQN 3LM2A 3P31A 3OBYA 4RCHA 2GTDA 1IG8A 4B1WB 2KKZA 1E4FT 2QI2A 5BR9A 1BU6O 1BWFO 3EZWA 4RWTA 2VGNA 1IJJA 2KLAA 3EE8A 3O1WA 3CC4N 4GV6A 4RTFD 3LDNA 2VGMA 3MCPA 1P8ZA 2ZF5O 3CPWM 1VQ5N 4JKGB 5AR0A 5B8HA 1NGEA 1GLEG 3CF5L 3IDHA 4BG8A 2NRVA 4CJ7A 4ILHA 2NRZA 2NRTA 3T7ZA 4WQ5C 3VGLA 4B1UB 4PHTX 3CXCM 1NGIA 2YHXA 3OW2M 3A5LC 1YXQA 2BH1A 1LCUA 3VEVA 1YJWN 2ASPA 4IOAL 4MO5A 4XEIA 3H1VX 4FWOA 3WQUA 3TTCA 3O1BA 2ZJPL 1MA9B 2P9UB 1Z6RA 2RHKA 4BRIA 1EQYA 5AQLA 1YJNN 3ID6A 5AQNA 5M1PA 2FSJA 4UY8O 4GVEA 5AQYA 3WXIA 3CCRN 1JCFA 3C6HA 4YORA 1EO1A 3KHYA 3A5OC 3CCLN 2I7PA 4NO7A 4BVOA 3CERA 3F2KA 5GAGP 5JVGL 1U2VA 3I8BA 1KAXA 4QS7A 3M6GA 1VQ9N 3IKMA 3SMSA 1Z05A 3FLCO 4CZGA 5GINA 4ILGB 3HOTA 1S72N 3ZEUB 1HLUA 3HOSA 4FSVA 3ZX0A 3HZ6A 5EOYA 2P9SB 1O13A 4YOTA 1QVGM 3HI0A 3CC7N 2Q0UA 2YHWA 1NLVA 1Y64A 3TPQA 3VF4A 3WUHA 4MLEA 2QWPA 3ZETA 5AQUA 4BGBA 2NRRA 3A0IX 1ATRA 5LJWA 1KC8O 1XUPO 1X3NA 3SBTA 3VERA 3EKUA 3MMVA 4H5RA 2IIRA 5TKYA 4G9ZA 2HF4A 1HKCA 3U8XA 4H0YB 4ISEA 5AQHA 4BRGA 4AM7A 4Y0WA 2W40A 2ITMA 4CZIA 5M1FA 1NGGA 2VYPA 4H5TA 5C15A 3SAHA 4JKBA 1S3XA 2QXLA 3GL1A 4EAHD 4FWNA 1ESVA 3O9SA 3LDQA 3DJCA 4CZFA 3ZX2A 2CH6A 3RSEA 3KK7A 1VQNN 4BROA 1SQKA 4BEBA 4JKAA 5JICA 1QQNA 5E26A 4A62A 2P9KB 1DT9A 2C1GA 3ULEA 2CGKA 4A2AA 1JJ2M 3P39A 4JNEA 4L3QA 4CZEA 4R79A 3C7NA 4B1VA 2YX6A 3KZBA 4EFHA 4E1JA 4M63C 3MCAB 3CJ7A 4J8FA 4WYBA 3O08A 1RDWX 1NWKA 5M1NA 1C0GA 1T3VA 3CQXA 4PL8A 4OO1J 1NGJA 5FPNA 4PL7A 4BVPA 4WQ5A 3WXMB 2J4RA 2CGJA 4H03B 3ENHA 1JCEA 4BR0A 1YAGA 1KXPA 4BR7A 2YI1A 5JMVA 5HL7L 4BGAA 5BPLA 3EE9A 5TKWA 4CBUA 4CD1A 1N8RO 2QA4N 2HBLA 3SMPA 4IO9L 1RDUA 4CZHA 4JAXA 4B9QA 5AQVA 2QEXN 5H1SQ 1W2BM 3ZX3A 2QWOA 3LDPA 3VEWA 2FSNA 4WFAL 3FZLA 4JKDA 2AA4A 3H3OB 4C23A 5DM7L 4FPAA 3VENA 4HTLA 3VGKA 3SBGA 1YJ9N 2FXUA 5AQIA 4U67L 4BY9C 3BEXA 3FFKB 1U2VB 4BRHA 4BC5A 4H0OA 3CIPA 1R59O 2W00A 3CQYA 4XJXA 1BO5O 1MWKA 3KWGA 4WQ4C 2PBDA 1BG3A 2A3ZA 3O6WA 3VEXA 4FL9A 4JKHA 4K43A 1ILYA 3HSCA 3MX2A 5KPTA 1GLLO 3MN9A 1Q82O 1VQ6N 3ZETB 3OA9A 5DM6L 3R6MA 2D4WA 2NNWA 4BC3A 5CR4A 5JVHL 3CI5A 4C1NI 2GUPA 4KH5A 4FWKA 3D2EA 4FWQA 4EIAA 4IO8A 3VPZA 2ASOA 3CPEA 1K8KB 2YJFA 5AQWA 3HM8A 4AM6A 3G71N 3UE5A 3NMUA 2H3GX 3S41A 4A5BA 1CZAN 4O5FA 1DKGD 3IUCA 4GNIA 4BRQA 1TUYA 5BPMA 3AAPA 1QQOA 3H45C 3PIOL 3I55N 3D2FA 4IXCA 3RSEB 4BE7B 3VMFB 5C0YA 4BRKA 3PIPL 4QS9A 1H1VA 2YJEA 3HTVA 4KH6A 1GLBG 3DAWA 3G4SN 3A5NC 2V52B 3ULEB 1ZXOA 3CCMN 3P4IA 1QVFM 5EXWA 1GLFO 2D0PA 4H5NA 5FPMA 3T69A 3TSPA 2KHOA 2WUSA 3UKUB 2QTDA 3VEZA 4YOYA 1ZBSA 3DXMA 3H46O 1SZ2A 4CZJA 2QWLA 3AARA 2D0OA 2E8AA 5HOOA 2VCPA 4BRCA 3Q7BA 5AQQA 3SLCA 1VQ7N 3RVCA 4FWRA 3HRGA 3I33A 2E2PA 1S22A 4DKWA 4IJAA 3SAGA 3FZFA 4FWPA 4IDHA 3CCSN 2OTJN 3BF3A 4YOWA 2Q36A 1KQSM 2E2QA 3FR0A 5AQXA 4IZ9A 1VAZA 4JHDA 4K42A 3CMAN 2YCHA 3C65A 3IMXA 3R3LA 3P38A 3AGRA 4H0XB 1KAYA 3O9TA 4CZMA 3MWTA 4BQLA 3CHWA 1Q81O 4FWMA 3E66A 5GADP 4A59A 4FVUA 2WBNA 2GWJA 4FWSA 3UKRA 1HKGA 3CC2N 2P9PB 3VF2A 4DQ8A 4B1XB 2HBKA 5AQRA 1J6ZA 1K8AO 4U7BA 2V7YA 4CBXA 4MDAA 1VQ4N 5AQTA 4YDUA 1YUWA 3O5BA 1BA1A 1BDGA 4FWLA 2NLXA 2WC9A 3CCUN 4HWIA 3QFPA 3TU5A 2GWKA 3UB5A 1QZ6A 3WEEA 4I6MA 3VTHA 2A40A 3MDQA 3QDKA 3CJ1A 4BRMA 5GAHP 4O8UA 2ZJQL 3LDOA 2CH5A 1HPMA 4BC2A 2NRXA 3K9JA 3VEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3N O;  3WQT A;  3MK6 A;  3R8E A;  2P9I A;  1JCG A;  3D2E B;  3VET A;  2NRH A;  2IVO A;  3U4L A;  4EHU A;  5F2R A;  2E1Y A;  4MO4 A;  5EY4 A;  4BRN A;  4DHY A;  4KBO A;  2ZGY A;  4NB4 A;  4BRD A;  3ENO A;  4H0V B;  3D2F B;  1T44 A;  3O80 A;  3WXL A;  3U9Z A;  5CE3 A;  2W41 A;  4DCH A;  4CBW A;  2V51 B;  2YHY A;  5JLF A;  3SK3 A;  1GLJ O;  3FZH A;  4FOE A;  1SAZ A;  3AAQ A;  3DWL A;  2Q97 A;  5AQF A;  2Q1N A;  2QWR A;  3W0L A;  3M1F A;  3O8M A;  3L0Q A;  2A5X A;  3DXM B;  3KVG A;  4FOI A;  4K25 A;  3HBT A;  3CJA A;  5FPN A;  4H0P A;  5JLH A;  3J8A A;  4PKH A;  2GEL A;  5AZJ A;  1NGH A;  1NGC A;  4JD2 A;  5KPR A;  2P9N A;  2Q31 A;  3EN9 A;  1BA0 A;  2BUP A;  1XQS C;  4CI6 A;  4CZK A;  3GDQ A;  3QBX A;  3DXK A;  2F9T A;  5EX5 A;  2QWQ A;  1GLA G;  2E20 A;  5BN8 A;  3QML A;  4JHD B;  1HUX A;  4O8K A;  2UYT A;  3CJ9 A;  4XH4 A;  5AFU A;  2FF6 A;  2BTF A;  2QW9 A;  1QHA A;  1Q18 A;  1ATS A;  1NM1 A;  4JN4 A;  4DB3 A;  3UKR B;  1C0F A;  5AQG A;  4M7Y A;  5BRF A;  2IVN A;  1OKJ A;  2D1K A;  3GBT A;  3C0B A;  3L6Q A;  1V4T A;  1NGF A;  2P9K A;  1RGI A;  5E84 A;  5ADX A;  4BR9 A;  3W3D A;  3VES A;  2E1Z A;  3AY9 A;  4Z94 A;  2AP1 A;  3EL2 A;  3BF1 A;  3WEE B;  2OAN A;  4I6M B;  3WT0 A;  2CGL A;  2A41 A;  3C7N B;  1X3M A;  3JXU A;  4IJN A;  3VGM A;  1HX1 A;  3B8A X;  3FZK A;  5EVZ A;  4BRA A;  1NGD A;  5BRH A;  5AZI A;  2P9I B;  2HF3 A;  3L4I A;  4H5V A;  4CD3 A;  1WOQ A;  4MLH A;  2ZGZ A;  3JS6 A;  1X9J A;  5AQJ A;  2V7Z A;  4LC9 B;  1D4X A;  2P9L A;  5AQP A;  5AQK A;  4FO0 A;  2ASM A;  2FSK A;  3WXK A;  1RFQ A;  4BRF A;  1TUU A;  1TYQ A;  4BRP A;  4BR2 A;  4PKG A;  5AQS A;  4BRL A;  4K41 A;  5BPN A;  1XC3 A;  4XH5 A;  1NGB A;  2IVP A;  3D7E O;  3U9D A;  2F9W A;  1NMD A;  5AZJ B;  4BG9 A;  4JD2 B;  2P9N B;  4WQ4 A;  3MN7 A;  3BP8 A;  1BUP A;  3GOI A;  3LL3 A;  3VEY A;  1QQM A;  3H1Q A;  3VOV A;  2EWS A;  3QIC A;  5KQ8 A;  3FE1 A;  3CJC A;  5BRD A;  3DXK B;  1E4G T;  2HOE A;  1DEJ A;  2DPN A;  4IWV A;  4F9O A;  5BRE A;  1K8K A;  4BRE A;  1NGA A;  3SJH A;  3ATV A;  3GG4 A;  3EKS A;  2E88 A;  3ID8 A;  5F1X A;  1YVN A;  4B1Y B;  5AQM A;  1WUA A;  5AFU H;  5F0X A;  5AQO A;  2I7N A;  2QWN A;  3A8Y A;  4GY2 B;  1GLD G;  1HKB A;  4BQZ A;  2QWM A;  3A5M C;  3FGU A;  3M3Z A;  2P9U A;  4B1Z A;  3F9M A;  3H6E A;  3UKU A;  4M7X A;  5ADX H;  1ZC6 A;  4EHT A;  5KQD A;  2QM1 A;  3LDL A;  5FPE A;  3WXJ A;  2FLO A;  3BUZ B;  4H0T B;  5BN9 A;  4BR5 A;  2NZT A;  1DGK N;  3ZEU A;  1MDU B;  4FPB A;  1KAZ A;  1MWM A;  1T6C A;  4A61 A;  3CET A;  2P9S A;  5AZI B;  4PKI A;  3IFR A;  2Q2R A;  1ATN A;  4ISG A;  3QBW A;  3QFU A;  5KPZ A;  1U6Z A;  2E2N A;  2VWB A;  4XH1 A;  1NBW A;  3MN5 A;  2E2O A;  3CJB A;  2A6A A;  2ZWH A;  4BR4 A;  5LY3 A;  1LOT B;  1BOT O;  2P9L B;  2Q0R A;  4QS8 A;  2P9P A;  5ELZ A;  5I9E B;  4CZL A;  2PAV A;  2HMP A;  4H5W A;  3O4W A;  3R9P A;  4A2B A;  4BC4 A;  3GE1 A;  3OHR A;  3ATU A;  1TYQ B;  3EO3 A;  5LJV A;  3QB0 A;  3LM9 A;  1HJO A;  1G99 A;  2FF3 B;  4YDU C;  1GLC G;  3FZM A;  1T6D A;  2GEM A;  1V4S A;  2A42 A;  1QZ5 A;  5FPD A;  4ISF A;  3G25 A;  5AQZ A;  3MN6 A;  3VF6 A;  3LM2 A;  4RCH A;  4B1W B;  2GTD A;  1IG8 A;  1E4F T;  5BR9 A;  1BU6 O;  1BWF O;  3EZW A;  4RWT A;  1IJJ A;  3O1W A;  4RTF D;  3LDN A;  3MCP A;  1P8Z A;  2ZF5 O;  5AR0 A;  5B8H A;  1NGE A;  1GLE G;  3IDH A;  4BG8 A;  4CJ7 A;  4B1U B;  3VGL A;  4WQ5 C;  1NGI A;  2YHX A;  3A5L C;  1YXQ A;  1LCU A;  3VEV A;  2ASP A;  4MO5 A;  4XEI A;  3H1V X;  4FWO A;  3WQU A;  3O1B A;  1MA9 B;  2P9U B;  1Z6R A;  4BRI A;  1EQY A;  5AQL A;  5AQN A;  2FSJ A;  5AQY A;  3WXI A;  1JCF A;  3KHY A;  3A5O C;  2I7P A;  4NO7 A;  4BVO A;  3CER A;  1U2V A;  3I8B A;  1KAX A;  4QS7 A;  3M6G A;  3SMS A;  1Z05 A;  3FLC O;  4CZG A;  3ZEU B;  1HLU A;  4FSV A;  3ZX0 A;  3HZ6 A;  5EOY A;  2P9S B;  3HI0 A;  2Q0U A;  2YHW A;  1NLV A;  1Y64 A;  3TPQ A;  3VF4 A;  3WUH A;  4MLE A;  2QWP A;  3ZET A;  5AQU A;  4BGB A;  3A0I X;  1ATR A;  5LJW A;  1XUP O;  1X3N A;  3VER A;  3EKU A;  3MMV A;  4H5R A;  2IIR A;  5TKY A;  2HF4 A;  1HKC A;  3U8X A;  4H0Y B;  4ISE A;  5AQH A;  4BRG A;  4AM7 A;  4Y0W A;  2W40 A;  2ITM A;  4CZI A;  1NGG A;  2VYP A;  4H5T A;  1S3X A;  2QXL A;  3GL1 A;  4EAH D;  4FWN A;  1ESV A;  3LDQ A;  3DJC A;  4CZF A;  3ZX2 A;  2CH6 A;  3RSE A;  4BRO A;  1SQK A;  5JIC A;  1QQN A;  5E26 A;  4A62 A;  2P9K B;  3ULE A;  2CGK A;  4A2A A;  4L3Q A;  4JNE A;  4CZE A;  3C7N A;  4B1V A;  3KZB A;  4EFH A;  4E1J A;  4M63 C;  3CJ7 A;  4J8F A;  4WYB A;  3O08 A;  1RDW X;  1NWK A;  1C0G A;  3CQX A;  4PL8 A;  1NGJ A;  4PL7 A;  4BVP A;  4WQ5 A;  2J4R A;  2CGJ A;  4H03 B;  3ENH A;  1JCE A;  4BR0 A;  1YAG A;  1KXP A;  4BR7 A;  2YI1 A;  5JMV A;  4BGA A;  5BPL A;  4CBU A;  4CD1 A;  3SMP A;  4CZH A;  4JAX A;  4B9Q A;  5AQV A;  3ZX3 A;  2QWO A;  3LDP A;  3VEW A;  2FSN A;  3FZL A;  2AA4 A;  3H3O B;  4C23 A;  4FPA A;  3VEN A;  4HTL A;  3VGK A;  2FXU A;  5AQI A;  3BEX A;  3FFK B;  1U2V B;  4BRH A;  4BC5 A;  4H0O A;  3CIP A;  1R59 O;  3CQY A;  1BO5 O;  1MWK A;  4WQ4 C;  2PBD A;  1BG3 A;  2A3Z A;  3O6W A;  3VEX A;  4FL9 A;  4K43 A;  3HSC A;  5KPT A;  1GLL O;  3MN9 A;  3ZET B;  3R6M A;  2D4W A;  4BC3 A;  3CI5 A;  2GUP A;  4FWK A;  3D2E A;  4FWQ A;  4EIA A;  4IO8 A;  3VPZ A;  2ASO A;  5AQW A;  1K8K B;  2YJF A;  4AM6 A;  3HM8 A;  3UE5 A;  2H3G X;  3S41 A;  1CZA N;  4O5F A;  1DKG D;  3IUC A;  4GNI A;  4BRQ A;  1TUY A;  5BPM A;  3AAP A;  1QQO A;  3H45 C;  3D2F A;  4IXC A;  3RSE B;  4BRK A;  4QS9 A;  1H1V A;  2YJE A;  3HTV A;  1GLB G;  3DAW A;  3A5N C;  2V52 B;  3ULE B;  1ZXO A;  3P4I A;  5EXW A;  1GLF O;  2D0P A;  4H5N A;  5FPM A;  3UKU B;  3VEZ A;  2KHO A;  2WUS A;  1ZBS A;  3DXM A;  3H46 O;  1SZ2 A;  4CZJ A;  2QWL A;  3AAR A;  2D0O A;  2E8A A;  2VCP A;  4BRC A;  5AQQ A;  3SLC A;  4FWR A;  3I33 A;  2E2P A;  1S22 A;  4IJA A;  3FZF A;  4FWP A;  3BF3 A;  2Q36 A;  2E2Q A;  3FR0 A;  5AQX A;  4IZ9 A;  4JHD A;  4K42 A;  2YCH A;  3IMX A;  4CZM A;  4H0X B;  1KAY A;  4BQL A;  3CHW A;  4FWM A;  2GWJ A;  4FWS A;  3UKR A;  1HKG A;  2P9P B;  3VF2 A;  4DQ8 A;  4B1X B;  5AQR A;  1J6Z A;  2V7Y A;  4CBX A;  5AQT A;  4YDU A;  1YUW A;  3O5B A;  1BA1 A;  1BDG A;  4FWL A;  2NLX A;  4HWI A;  3QFP A;  3TU5 A;  2GWK A;  3UB5 A;  1QZ6 A;  3WEE A;  4I6M A;  2A40 A;  3MDQ A;  3QDK A;  3CJ1 A;  4BRM A;  3LDO A;  2CH5 A;  1HPM A;  4BC2 A;  3VEO A; 
#chains in the Genus database with same CATH topology
 3WQT A;  2B4J A;  2P9I A;  4X65 K;  1JCG A;  2ITG A;  2O8E A;  3VET A;  2QKB A;  5M1Q A;  2RE2 A;  1BHL A;  2IVO A;  4CHQ A;  2E1Y A;  3VTI A;  4BRN A;  4KBO A;  4CEA A;  2IAJ A;  3ENO A;  3AO5 A;  3D2F B;  3CFP A;  3SQ2 A;  1U04 A;  5JLF A;  4NCB A;  1GLJ O;  1NKE A;  3AAQ A;  4JI5 K;  3P5J A;  2Q1N A;  2BE2 A;  3M1F A;  5J2N A;  3O8M A;  3L0Q A;  3DXM B;  3VQ4 A;  1RBU A;  5AZJ A;  2X6N A;  4JD2 A;  3F73 A;  2P9N A;  2Q31 A;  1KFS A;  1BA0 A;  2BUP A;  1O1W A;  1EWR A;  2DFH A;  3GDQ A;  3QBX A;  4FJ5 A;  3DXK A;  5EX5 A;  4HUE A;  5SWM A;  1Q86 O;  3CME N;  1CZ9 A;  1IBL K;  3E01 A;  1OVQ A;  3K5N A;  4LY7 A;  3V6D A;  3BDP A;  5AQG A;  3M8Q A;  1Z26 A;  1BGX T;  5A2Q O;  4FM1 A;  2P9K A;  1RT4 A;  4FJX A;  3KIO A;  3MEC A;  3TAF A;  3W3D A;  1IO2 A;  3L3U A;  3O9R A;  5KGX A;  4CFA A;  2XY6 A;  3QER A;  2OTL N;  3RTV A;  3C7N B;  1X3M A;  4IJN A;  3B8A X;  5EVZ A;  3TSU A;  5BRH A;  4NLB A;  3TTD A;  1RTI A;  3ZYY X;  1L3U A;  4YOU A;  2Z1I A;  1Z25 A;  2XRI A;  4BDZ A;  1X9J A;  4IEI A;  2V7Z A;  3NCI A;  3HP6 A;  1D4X A;  1RT5 A;  4ELT A;  2X74 A;  4N47 A;  3E9O A;  1TUU A;  3I56 N;  3MX5 A;  3SV3 A;  5AQS A;  2GX9 A;  4YOV A;  4YHH K;  4CIF A;  2IVP A;  1HNX K;  2F9W A;  4CF0 A;  3O9Q A;  3K5M A;  3HPO A;  3MN7 A;  3H08 A;  3BP8 A;  1BUP A;  3L2R A;  3LL3 A;  3MAQ A;  3FE1 A;  2O8C A;  3VN5 A;  2HOE A;  3VQB A;  3L4Q A;  2YNH A;  3C6A A;  3GG4 A;  4Q5V A;  3ID8 A;  1YVN A;  4E1M A;  1GOA A;  1XI1 A;  5AQM A;  3PO4 A;  3HJF A;  4JV5 K;  2O8F A;  1NJX A;  3S3M A;  1BI4 B;  1GLD G;  1T8E A;  4B9S A;  2HHI A;  4BQZ A;  3VQ7 A;  4DR6 K;  3UIQ A;  3A5M C;  3PX6 A;  2P9U A;  1EXQ A;  4B1Z A;  3F9M A;  1XWL A;  2G8H A;  4JS5 A;  3PX4 A;  2UUC K;  3H6E A;  4M7X A;  1ZC6 A;  4EHT A;  2FLO A;  3NF6 A;  3K0S A;  5J2P A;  4KHN A;  4FM0 A;  3K9K A;  2NZT A;  1JL2 A;  3VQ9 A;  3J7A P;  4FPB A;  2F7T A;  3CET A;  2P9S A;  5E41 A;  4FJ7 A;  1ATN A;  3F5T A;  3OYJ A;  4NLC A;  3QFU A;  5KPZ A;  4DUZ K;  2VWB A;  3MN5 A;  1QSY A;  2E2O A;  3K5O A;  1S1W A;  5LY3 A;  1S9G A;  5C12 A;  4KHP K;  3G6E N;  4IOX A;  2P9P A;  1NJI O;  1RT3 A;  5I9E B;  4CEE A;  1RDA A;  1K9M O;  3KLI A;  4W5Q A;  3NFA A;  4YDU C;  4FW1 A;  3FZM A;  2O4I A;  3MWP A;  2GEM A;  4FZZ A;  1V4S A;  4JEP A;  5FRM A;  1DTQ A;  4WCE L;  2WFB A;  2HBM A;  1SL1 A;  3LAN A;  3VF6 A;  3P31 A;  4B1W B;  1TK5 A;  1LAW A;  5BR9 A;  3LZJ A;  4B3S K;  4RWT A;  4E1N A;  1B9F A;  3FFI A;  3B6P A;  3MCP A;  1TVR A;  3C95 A;  1P8Z A;  2ZF5 O;  3CPW M;  5B8H A;  5KGW A;  3DM2 A;  3EZ5 A;  1ZYQ A;  4CF8 A;  2P1J A;  4ILH A;  3T7Z A;  4B1U B;  4PHT X;  4B08 A;  3NHG A;  3VQ6 A;  2G8F A;  4DTO A;  1NGI A;  1FKO A;  3A5L C;  1UA0 A;  1YJW N;  1D8Y A;  2RPI A;  1MA9 B;  3AVH A;  3NH0 A;  3WXI A;  3CCR N;  1W9H A;  1JCF A;  1WAJ A;  1ZBI A;  3LP0 A;  4YOR A;  3WNG A;  1NOZ A;  3U3G A;  3RRG A;  3F2K A;  5JVG L;  1U2V A;  4RW4 A;  1NG9 A;  4DFP A;  3SMS A;  1Z05 A;  3FLC O;  1WNS A;  1JLQ A;  3NGI A;  4GKJ K;  4FSV A;  3QET A;  5EOY A;  2HW3 A;  1G15 A;  3HI0 A;  2Q0U A;  1NLV A;  4C8N A;  2QWP A;  4BGB A;  1KC8 O;  1X3N A;  4XIU A;  3P83 D;  4OLA A;  4G9Z A;  2HF4 A;  3SQ1 A;  5K14 A;  3TI0 A;  4M42 A;  1FXX A;  5AQH A;  1TL1 A;  4DFM A;  4Y0W A;  1LAV A;  2VYP A;  2QK9 A;  5C15 A;  2R7Y A;  4EAH D;  1SUQ A;  1WBB A;  1ESV A;  3LP1 A;  4MQ3 A;  4CZF A;  3RMA A;  2B5J A;  1SQK A;  1IH7 A;  4A62 A;  4E7L A;  3THW B;  4R79 A;  1ZBH A;  3C7N A;  4DR3 K;  1YVU A;  3KZB A;  1X9M A;  4E1J A;  2G8K A;  3BGR A;  3CQ8 A;  3CJ7 A;  2WON A;  5J2M A;  1REV A;  1T3V A;  3CQX A;  3MXJ A;  5IWA K;  4BVP A;  4LF5 K;  2J4R A;  2O8D A;  2CGJ A;  1S1V A;  4CJU A;  4CFD A;  1JCE A;  1C0M A;  3ZT4 A;  4BGA A;  5BPL A;  1VSJ A;  5TKW A;  2ATQ A;  3CM6 A;  4F3O A;  1RDU A;  4JAX A;  4ID5 A;  2UXB K;  1JLA A;  4O0J A;  3ZT1 A;  4J2D A;  3MEE A;  4DUY K;  1IV0 A;  3QEV A;  4KHW A;  4I2P A;  1NK9 A;  5AQI A;  4DTR A;  1VSD A;  3BEX A;  3LAK A;  4KFB A;  3QES A;  4H0O A;  1NKB A;  4XJX A;  1BO5 O;  3VQP A;  3G10 A;  2A3Z A;  3VEX A;  4E7J A;  1ILY A;  4GW6 A;  3MN9 A;  4FJL A;  3ZET B;  3R6M A;  4PQU A;  3AVF A;  3CI5 A;  4YY3 K;  3D2E A;  4FWQ A;  4EIA A;  1CLQ A;  2VWK A;  3LWM A;  3UE5 A;  1BI4 A;  4O44 A;  5HRR A;  4A5B A;  3IUC A;  4BRQ A;  5BPM A;  3RR8 A;  2ETJ A;  2ZQB A;  3H45 C;  2YV0 X;  3K58 A;  4O55 A;  4FK2 A;  4DU4 A;  3VMF B;  4FK4 A;  4J2E A;  1I39 A;  3PIP L;  3CCM N;  4CHN A;  1GLF O;  2D0P A;  1KTQ A;  3T69 A;  4YOY A;  1S1U A;  4PUO A;  3H46 O;  3THX A;  1C1A A;  2D0C A;  2E8A A;  4CER A;  3OYL A;  2VCP A;  3L8B A;  1FJG K;  2HHW A;  4JYA K;  1DLO A;  3VQQ A;  3HRG A;  4DV0 K;  4IJA A;  3FZF A;  4FWP A;  4FXD A;  4CJR A;  1NK4 A;  4FJ9 A;  3THY A;  2KZM A;  4IZ9 A;  2E6L A;  4B3T K;  3C65 A;  1C1B A;  3P38 A;  4CZM A;  4HHT A;  1KAY A;  3O9T A;  3E66 A;  5HRN A;  4A59 A;  4FJK A;  3SCX A;  2WBN A;  3EYZ A;  1TAQ A;  4FWS A;  3AVJ A;  3UKR A;  4DQQ A;  4B9V A;  5CY4 A;  5AJ3 K;  3OVN A;  4B1X B;  1K8A O;  4CFC A;  5AQT A;  2F4V K;  5D3G A;  3SPZ A;  2HHH K;  4CJV A;  3CCU N;  3KLG A;  4AQY K;  2OPP A;  3VTH A;  2A40 A;  2KW4 A;  3SQ4 A;  2ZJQ L;  1ASV A;  3LDO A;  2OA8 A;  1M1K O;  1M90 O;  1GOC A;  1NJY A;  3IG1 A;  2Y1I A;  4KHQ A;  3SJJ A;  2BDP A;  3U4L A;  4EHU A;  5F2R A;  2W6K A;  1VRT A;  2Z1H A;  4BRD A;  3BZK A;  4Y1C A;  4H0V B;  4DCH A;  4CBW A;  5FRN A;  3L2Q A;  4FJH A;  4PWD A;  5AQF A;  2QWR A;  3Q7C A;  4FOI A;  2KFN A;  3NVM A;  4K25 A;  3CJA A;  1ZBU A;  4PKH A;  3JSM A;  1QS4 A;  2GEL A;  3SQ0 A;  2BAN A;  4B9T A;  4DR1 K;  3DLH A;  1JL1 A;  4W5O A;  3AVM A;  3EEQ A;  3WNH A;  1VQP N;  4HCC A;  2VG5 A;  1JLF A;  1RIL A;  3OYN A;  1GLA G;  4B3O A;  3ZCM A;  5BN8 A;  1FKP A;  5GAE P;  1HUX A;  4O8K A;  3D45 A;  2C1I A;  4YOX A;  3CJ9 A;  2IC3 A;  2BTF A;  1IBM K;  4R5P A;  3AO4 A;  1Q18 A;  4PA1 A;  3VQD A;  4CIG A;  3OJS A;  4DTN A;  1I94 K;  1RT1 A;  3VA3 A;  2UU9 K;  4J2B A;  3KJV A;  3OYB A;  5I42 A;  4YNQ A;  4YFU A;  4JLH A;  4Z94 A;  4JK8 A;  3LPU A;  3E1Y A;  4DMN A;  3WEE B;  2OAN A;  2DFF A;  3R1X A;  1C6V A;  4CHZ A;  3K57 A;  4I7F A;  4CES A;  4JI8 K;  3KD1 E;  3VGM A;  3V1Q A;  5AZI A;  3P1G A;  3V9S A;  2HF3 A;  3L4I A;  4CD3 A;  3TWH A;  5AQJ A;  4CHY A;  4LC9 B;  5AQP A;  5AQK A;  2FSK A;  3O3G A;  1RFQ A;  2XY8 A;  4TSX A;  4BRF A;  5C2D A;  1JLE A;  2BGG A;  3S9H A;  4BRP A;  2RF2 A;  3D6R A;  5DK5 A;  1QSS A;  4K41 A;  3QIN A;  1XC3 A;  4FLZ A;  1VQL N;  3WNE A;  1NGB A;  3D7E O;  4GMJ B;  1NMD A;  4BG9 A;  4WQ4 A;  1KCF A;  3GOI A;  1LW2 A;  1QQM A;  5KQ8 A;  3CFO A;  2EWS A;  4IG0 A;  2DTU A;  1HJR A;  2F96 A;  1YI2 N;  5JS1 A;  4AHU A;  1KVC A;  1N6Q A;  3NH2 A;  4K8X A;  2HBJ A;  4JKG A;  4CJT A;  1ITG A;  4RW8 A;  4F2S A;  2E88 A;  2G8W A;  4OKE A;  4DF4 A;  5AFU H;  4CGJ A;  1HQE A;  3VQ8 A;  5GIP A;  1HKB A;  2QWM A;  3QEX A;  3TAG A;  4K0K K;  4DTJ A;  4AHT A;  1VQM N;  5ADX H;  4NCA A;  5FPE A;  3WXJ A;  3NGZ A;  1QQC A;  3BUZ B;  4C1N K;  1OH6 A;  1VSH A;  3AVB A;  2UXC K;  3ZEU A;  1DGK N;  1T6C A;  4A61 A;  4DFK A;  3J80 O;  3PSF A;  3THV A;  1VSE A;  2Q2R A;  1FK9 A;  1XNQ K;  1U6Z A;  2E2N A;  4XH1 A;  1NBW A;  1W97 L;  4AHC A;  3CJB A;  4E7H A;  3RRH A;  2ZWH A;  4JK9 A;  4LH5 A;  2P9L B;  4CJF A;  4QS8 A;  3L3V A;  4M3Y A;  1VK0 A;  4X64 K;  2B6A A;  3OBW A;  2HMP A;  4H5W A;  3CD6 N;  1VSM A;  1XC9 A;  3ATU A;  1TYQ B;  2D0A A;  3ZT2 A;  1F21 A;  4DSJ A;  3QB0 A;  3K59 A;  2PYJ A;  1GLC G;  3ZT3 A;  4FLV A;  1T6D A;  3M5R A;  4GKK K;  4ISF A;  5AQZ A;  4HVJ A;  3LM2 A;  3J81 O;  1E4F T;  4HUF A;  4KI6 A;  1BU6 O;  4DLG A;  1BWF O;  3EZW A;  2HNY A;  4BWM A;  2KLA A;  3O1W A;  3CC4 N;  1QHT A;  2W42 A;  4RTF D;  3LDN A;  3D0P A;  2YKN A;  1VQ5 N;  3CF5 L;  1NGE A;  3NF8 A;  4Z4E A;  4JI3 K;  4CEO A;  4Z4C A;  3OYG A;  4KRF A;  2NRZ A;  2NRT A;  4WQ5 C;  1C0T A;  3I8D A;  3CXC M;  2YHX A;  1LCU A;  2ASP A;  4IOA L;  4MO5 A;  4XEI A;  4FWO A;  4NYF A;  3TTC A;  3O1B A;  2ZJP L;  2RHK A;  5AQL A;  5HLF A;  5M1P A;  2D5R A;  4GVE A;  4DU1 A;  3CYM A;  1JLG A;  2D0B A;  3QNN A;  1EO1 A;  3OTO K;  3KHY A;  3AVN A;  3CCL N;  4NO7 A;  2I5J A;  3CER A;  2O4G A;  3T19 A;  2XO7 A;  3M6G A;  4CZG A;  1S72 N;  4LSL A;  5GIN A;  1TKZ A;  3OYA A;  3NE6 A;  1HLU A;  1XHX A;  3HZ6 A;  2F8S A;  3L2V A;  5HRO A;  4YOT A;  1QVG M;  1Y64 A;  3VF4 A;  4MLE A;  4KHS A;  3A0I X;  1ATR A;  5LJW A;  1NK7 A;  3SBT A;  3MMV A;  2IIR A;  1GOB A;  5TKY A;  1LW0 A;  3ZSO A;  3HP9 A;  4JI1 K;  4QCL A;  1LWC A;  2ITM A;  3SUP A;  2QXL A;  4M41 A;  1TAU A;  2EHG A;  5DMR A;  1J5O A;  3RSE A;  3S3N A;  4BRO A;  2Q3S A;  4ICL A;  5E26 A;  4ZHR A;  3ZT0 A;  1DT9 A;  2ZD1 A;  5FDL A;  1JJ2 M;  3O4N A;  3P39 A;  4JNE A;  1L3T A;  2F8T A;  1HRH A;  2NUB A;  5CZ2 A;  4FJJ A;  4CEQ A;  1WLJ A;  1HPZ A;  4EFH A;  3L2W A;  4M63 C;  4FM2 A;  4J8F A;  3C6T A;  3O08 A;  3KK3 A;  4PL8 A;  4IBN A;  1X1P A;  4DS5 A;  1Q9Y A;  4NXM K;  4LFA K;  4WE1 A;  1YAG A;  5JMV A;  1RBS A;  5SZT A;  4DV6 K;  3VQ5 A;  4L8R B;  2HBL A;  1WSJ A;  4B9Q A;  5AQV A;  3RR7 A;  2OCE A;  2QWO A;  1T05 A;  2FSN A;  4CJ3 A;  4JRP A;  3FZL A;  2AA4 A;  3H3O B;  3VEN A;  4LFC K;  2FXU A;  3AV9 A;  2OPS A;  3T1Y K;  3QEI A;  2E6M A;  4M3R A;  4BC5 A;  3SUQ A;  1MWK A;  2PBD A;  1BG3 A;  3MX2 A;  2PYL A;  1GLL O;  3V4I A;  3OA9 A;  1VSK A;  1OH7 A;  1J9A A;  5CR4 A;  3VQA A;  1L5U A;  4IO8 A;  2XY7 A;  1K8K B;  4AM6 A;  3KLF A;  4M45 A;  4C8K A;  4E7I A;  4F8R A;  1IBK K;  3PIO L;  5LMU K;  3D2F A;  1C0U A;  4F3T A;  4QS9 A;  1GLB G;  1TKT A;  4CEZ A;  3A5N C;  2V52 B;  3ULE B;  3ZSQ A;  5EU7 A;  1ZXO A;  3P4I A;  1NJZ A;  5EXW A;  2YNI A;  3VEZ A;  2WUS A;  3JAM O;  3DXM A;  1SZ2 A;  4CZJ A;  3AAR A;  1YTA A;  1NKC A;  3Q7B A;  1HNW K;  5AQQ A;  2ZE2 A;  2O8B B;  2IOC A;  3RVC A;  1VSF A;  2KZZ A;  4DQR A;  3I33 A;  2E2P A;  3WNF A;  4DKW A;  4Z4I A;  2QKK A;  3CCS N;  1BIZ A;  2OTJ N;  3BF3 A;  4YOW A;  2Q36 A;  1KQS M;  2E2Q A;  5AQX A;  3KTQ A;  1VAZ A;  2YCH A;  3IMX A;  3M8P A;  3AGR A;  3I0R A;  4H0X B;  3MWT A;  3CHW A;  4BE0 A;  4EP4 A;  1HKG A;  3HPG A;  3SUO A;  3VF2 A;  4H4O A;  3ZSR A;  3DOK A;  4CJQ A;  2V7Y A;  4MDA A;  2X6S A;  4UQG A;  1C1C A;  1VQ4 N;  4PY5 A;  1TKX A;  4W5N A;  2WC9 A;  1SKW A;  3AO2 A;  4QOZ B;  2E4L A;  3MDQ A;  3CJ1 A;  2AJQ A;  4O8U A;  3DLK A;  3ISN C;  4H4M A;  1XMO K;  3PUF A;  2NRX A;  5KRS A;  3VEO A;  4OGE A;  4GV3 A;  1IKY A;  3MK6 A;  3NF7 A;  3R8E A;  3K5L A;  2NRH A;  4KTZ A;  2GV9 A;  4W5R A;  4DQI A;  4OKJ A;  4LD0 A;  4NB4 A;  1JLB A;  2KQ2 A;  4JK7 A;  1T44 A;  3O80 A;  4DV4 K;  4C8O A;  4QAG A;  5CE3 A;  1BCM A;  3AVI A;  3CCV N;  2V51 B;  2YHY A;  3AA3 A;  4DQP A;  3SK3 A;  1J54 A;  4FOE A;  4J2A A;  4Z4H A;  4IFV A;  3W0L A;  1UAX A;  1BCO A;  3SAF A;  3KVG A;  4OPH A;  5JLH A;  3HBT A;  3AVC A;  1NU0 A;  1NGH A;  3AO3 A;  1KD1 O;  2VG7 A;  1WN7 A;  1XQS C;  3LAL A;  4JI4 K;  2F9T A;  2QWQ A;  4CHO A;  1SS6 A;  4WFN L;  2E20 A;  3QML A;  4JHD B;  5FRO A;  1XHZ A;  4GV9 A;  4XH4 A;  2FF6 A;  2QW9 A;  4LF8 K;  1EKE A;  3CCJ N;  4LFB K;  1QHA A;  1ATS A;  1NM1 A;  1DTT A;  4HCB A;  4O0I A;  1C0F A;  4M7Y A;  3OYC A;  2IVN A;  2D1K A;  3PV8 A;  4DU3 A;  3GBT A;  3C0B A;  1HYZ A;  3QEP A;  4DSK A;  1V4T A;  4CF2 A;  1NGF A;  3OYD A;  1S5J A;  2FBT A;  4A5A A;  1RTJ A;  4BR9 A;  4MDB A;  2PZS A;  4DSI A;  2E1Z A;  3AY9 A;  3EL2 A;  4IFE A;  1KLN A;  4M3X A;  1VQ8 N;  4I6M B;  2VQE K;  2CGL A;  4OPK A;  3L2U A;  3VA0 A;  2Z1G A;  3JXU A;  2P51 A;  1VRU A;  1HX1 A;  2GUI A;  3FZK A;  1VHX A;  4M3Z A;  2HND A;  4GVM A;  3DRP A;  2P9I B;  2WOM A;  3LWL A;  2O8E B;  1WOQ A;  5JS2 A;  1CXQ A;  4MLH A;  4FCY A;  4E3S A;  4M3W A;  3T1H K;  1WBD A;  3QO9 A;  2JLE A;  1YF5 L;  2ASM A;  4CGI A;  3KWI A;  3WXK A;  1VSL A;  5I3U A;  4BR2 A;  4PKG A;  4JI2 K;  5GIO A;  3CG7 A;  3QEW A;  1WAF A;  3OS0 A;  2UUA K;  2ZJR L;  4IOC L;  5BPN A;  2FBX A;  2FBY A;  4XH5 A;  3U9D A;  1L3V A;  3F9K A;  5AZJ B;  3ULD A;  4JD2 B;  4M3U A;  2P9N B;  5IT9 O;  1UWB A;  1VSI A;  3VOV A;  3CJC A;  5BRD A;  3DXK B;  3SI6 A;  4U7B A;  2DPN A;  4IWV A;  5CHI A;  4CW7 B;  5BRE A;  1K8K A;  3NGY A;  2DFE A;  3ATV A;  3HL8 A;  1KVA A;  2FBV A;  4B1Y B;  1RBT A;  1UOC A;  5CZ1 A;  1FW6 A;  1VQO N;  5F0X A;  4CJ5 A;  4ZTF A;  1N36 K;  5AQO A;  4KPY A;  2I7N A;  2QWN A;  1BQN A;  3A8Y A;  3MED A;  2JWL A;  1NK5 A;  4WFB L;  1RT2 A;  2PFU A;  2YNG A;  2E5L K;  4CCH A;  2ZM6 K;  5KQD A;  2QM1 A;  2XY5 A;  4H0T B;  4OX9 K;  1YTU A;  3V81 A;  2O8B A;  2LSN A;  1E3M A;  3LAM A;  4G1Q A;  1VQK N;  1MDU B;  4OPA A;  4EZ9 A;  1KSP A;  1MWM A;  1OVY A;  3DLG A;  4PKI A;  1SL2 A;  3QIP A;  2HST A;  4CK1 A;  3QBW A;  1EET A;  2A6A A;  4AHS A;  1LOT B;  3CFR A;  1BOT O;  5ELZ A;  3T1A A;  4CZL A;  2PAV A;  4DV7 K;  4IKF A;  1MU2 A;  3O4W A;  3R9P A;  4IG3 A;  3GE1 A;  3EO3 A;  3TR8 A;  5LJV A;  2G8I A;  4LF6 K;  5CYQ A;  3OYI A;  5M1O A;  4CED A;  1QZ5 A;  3SV4 A;  4FK0 A;  5FPD A;  3THW A;  4BEC A;  3O9U A;  3G25 A;  3MN6 A;  3O3H A;  4RCH A;  1YHQ N;  3OBY A;  2QI2 A;  4CFB A;  2VGN A;  1IJJ A;  4KHU A;  3EY1 A;  4GV6 A;  2Y1J A;  1GLE G;  2NRV A;  4CJ7 A;  3VGL A;  2A1R A;  4CK3 A;  1RNH A;  2O8F B;  1YXQ A;  2BH1 A;  3VEV A;  3ASM A;  4DF8 A;  1ASW A;  3WQU A;  1QSL A;  3PO5 A;  1JKH A;  2P9U B;  3V9X A;  1EQY A;  3SZ2 A;  1YJN N;  4CJ4 A;  4FJG A;  4UY8 O;  5AQY A;  1T03 A;  3OYH A;  4RW6 A;  3A5O C;  2I7P A;  4BVO A;  3AVA A;  3TAR A;  4B3M K;  1N32 K;  1KAX A;  3IKM A;  3HOT A;  3TAQ A;  4DV2 K;  3HOS A;  1EWQ A;  1NMN A;  3ZX0 A;  3HT3 A;  2P9S B;  3O3F A;  3TPQ A;  5J2Q A;  3ZET A;  2OZM A;  1BIU A;  1TK8 A;  3U8X A;  4H8K A;  4CJS A;  4AM7 A;  5M1F A;  1RCH A;  4H5T A;  1IG9 A;  4JKB A;  1S3X A;  3NBP A;  1LV5 A;  3GL1 A;  3HM9 A;  2HHS A;  4CEF A;  4FWN A;  3O9S A;  3DJC A;  2CH6 A;  1VQN N;  1D9D A;  4BEB A;  3MXI A;  4DV3 K;  3LP3 A;  2C1G A;  1SL0 A;  4A2A A;  4L3Q A;  4NYN A;  2YX6 A;  3ZSX A;  3HO1 A;  5M1N A;  4WYB A;  3SPY A;  4B9M A;  4O5B A;  1NWK A;  1C0G A;  2RN2 A;  3HVT A;  1S1T A;  1A5W A;  4WQ5 A;  2OPQ A;  4BR0 A;  1BIS A;  1B9D A;  4BR7 A;  2HHV A;  4W5T A;  5HL7 L;  3EE9 A;  1LWE A;  4DTS A;  4KB1 A;  4CBU A;  4CD1 A;  4HUG A;  4CGG A;  4ELU A;  2YHB A;  4E0D A;  3SYZ A;  3IS9 A;  1HNV A;  2QEX N;  5H1S Q;  3ZX3 A;  3LDP A;  4AH9 A;  3SUN A;  3VEW A;  4WFA L;  1EX4 A;  2UXD K;  4JKD A;  4CJW A;  4MFB A;  3IAY A;  3RWU A;  4C23 A;  5DM7 L;  3CM5 A;  4HTL A;  3VGK A;  2X78 A;  4CEC A;  4U67 L;  2OZS A;  1CXU A;  3FFK B;  3IRX A;  1U2V B;  3CIP A;  4FW2 A;  3KWG A;  4WQ4 C;  4DSE A;  4BDY A;  1NNE A;  4JKH A;  3U6F A;  3HSC A;  5KPT A;  1JXB A;  2D4W A;  2NNW A;  4BC3 A;  5JVH L;  5KTQ A;  3HST B;  4C1N I;  4CIE A;  4KH5 A;  2VQF K;  3LPT A;  1HNI A;  2ASO A;  3S3O A;  3HM8 A;  3LP2 A;  3DLR A;  3SNN A;  3NMU A;  1RT7 A;  1BQM A;  3M8S A;  1S6Q A;  1TUY A;  3AAP A;  5HBM A;  1U4B A;  4FVM A;  2WTU A;  4X66 K;  4O4G A;  4LSN A;  4FLX A;  1H1V A;  3AA5 X;  1U47 A;  3G4S N;  3DAW A;  4Q0B A;  3J7Y P;  5FPM A;  3UKU B;  3TSP A;  5KI6 A;  4FLT A;  1ZBS A;  4N41 A;  2QWL A;  2D0O A;  3C6U A;  4BRC A;  1A5X A;  1S6P A;  3LDS A;  4LF4 K;  3SLC A;  4IFY A;  3TAB A;  4DTP A;  2O8D B;  2XHB A;  1S22 A;  2QXF A;  4CEB A;  4IDH A;  1XNR K;  4BE1 A;  5C25 A;  1Y97 A;  3QNO A;  3B6O A;  1NJW A;  4BQL A;  4CK2 A;  4FWM A;  3BY5 A;  1NK6 A;  3CC2 N;  3DMJ A;  5AQR A;  4B9U A;  1HMV A;  4JI0 K;  4YDU A;  3O5B A;  1BDG A;  4FWL A;  5FLX O;  4RW7 A;  5CYM A;  4B9L A;  4HWI A;  2GWK A;  1SKS A;  4KTQ A;  3WEE A;  4CE9 A;  3QDK A;  4JI6 K;  3NDK A;  1Q9X A;  4KO0 A;  2OPR A;  3K9J A;  2DY4 A;  3H3N O;  4DQS A;  3D2E B;  4CJL A;  4OJR A;  1BL3 A;  4IDK A;  5EY4 A;  4MO4 A;  5T7B A;  4DHY A;  2ZGY A;  3WXL A;  3U9Z A;  1B92 A;  3PY8 A;  1RDC A;  2W41 A;  3C94 A;  4F2R A;  3FZH A;  4KB0 A;  1SAZ A;  2KFZ A;  1OH5 A;  3DWL A;  2Q97 A;  5C10 A;  1SKR A;  1N33 K;  3ZSY A;  4X62 K;  5FPN A;  2A5X A;  3DLE A;  3THX B;  4H0P A;  3J8A A;  3E9L A;  1NGC A;  5KPR A;  3EN9 A;  1Q7Y O;  1U48 A;  5MLC Q;  3S5T A;  3AGK A;  3DRS A;  4CI6 A;  3NVK A;  4CZK A;  4JKE A;  1P90 A;  4FJN A;  2YNF A;  4E72 A;  3THY B;  3AVG A;  1Q8I A;  1WSI A;  2UYT A;  5AFU A;  1RTD A;  2HHQ A;  4JN4 A;  4DB3 A;  3UKR B;  1YIT N;  4I2Q A;  4FLW A;  4DSL A;  5BRF A;  4EP5 A;  1RDB A;  1OKJ A;  3VQC A;  3V9U A;  3MXM A;  3E9P A;  4EZ6 A;  3L6Q A;  1RGI A;  3AA2 A;  5E84 A;  5ADX A;  4Z4G A;  1ZBF A;  3KLH A;  4WF9 L;  2JGU A;  1D5A A;  4KH4 A;  3VES A;  3NAE A;  4KRE A;  1J53 A;  2AP1 A;  4ID1 A;  3BF1 A;  3TAM A;  1JXE A;  3WT0 A;  1D9F A;  4IEE A;  1T7P A;  5C42 A;  2A41 A;  4OPJ A;  4BRA A;  1NGD A;  1RBV A;  1XMQ K;  2HVI A;  3TSQ A;  4H5V A;  1J5E K;  2ZGZ A;  3JS6 A;  4KTW A;  2P9L A;  1HQU A;  1A5V A;  2Z1J A;  3OY9 A;  3DLB A;  3AA4 A;  4FO0 A;  3ZSV A;  4N56 A;  4CJK A;  2YKM A;  3OYK A;  1TKD A;  1YIJ N;  2HHX A;  4KKO A;  1TYQ A;  3ENB A;  4BRL A;  4ILJ A;  4FYD A;  4FLU A;  3V1R A;  4OKK A;  2KTQ A;  4Z4F A;  3U3Y A;  4Z0U A;  4DR2 K;  1HNZ K;  5KRT A;  3VEY A;  3H1Q A;  5LL6 Z;  3QIC A;  3PLA A;  2IDO A;  1IKW A;  2NRW A;  3G0Z A;  4DV1 K;  1E4G T;  1DEJ A;  4F9O A;  1ASU A;  4BRE A;  4BAC A;  4K8Z A;  1NGA A;  3SJH A;  3EKS A;  4Y1D A;  5F1X A;  3QIO A;  1WUA A;  4CVN E;  5JEN A;  4CGD A;  3DOL A;  2G8V A;  4GY2 B;  4JRQ A;  4B9N A;  3KLE A;  3M8R A;  4FZY A;  4N5S A;  3FGU A;  3M3Z A;  4CHP A;  2PY5 A;  3NH1 A;  2RKI A;  4E19 A;  2UUB K;  4JKC A;  3UKU A;  4JKF A;  2IGI A;  3LDL A;  1K6Y A;  1X9S A;  3OJU A;  1TGO A;  3N4Q A;  5BN9 A;  4BR5 A;  1KAZ A;  1KLM A;  3KD5 E;  5AZI B;  3CCQ N;  3IFR A;  4ISG A;  4OGC A;  4DR7 K;  4FZX C;  3KK1 A;  3N4P A;  4BR4 A;  1K73 O;  3DLL L;  4DSF A;  4LF9 K;  4AF1 A;  2Q0R A;  3O4Q A;  3CCE N;  2P5G A;  5C2F A;  3KKR A;  4A2B A;  1CZB A;  4BC4 A;  3OHR A;  4DFJ A;  3TAN A;  2P5O A;  2JWK A;  3J7Z O;  3LM9 A;  1W7A A;  1HJO A;  1HR0 K;  1G99 A;  2FF3 B;  1IKV A;  4JS4 A;  3PX0 A;  4DLE A;  4FLY A;  3TTF A;  4A57 A;  2A42 A;  1QTM A;  1TV6 A;  4FJI A;  4OLB A;  4M3T A;  5M1K A;  5LMN K;  3AO1 A;  3HK2 A;  2GTD A;  1IG8 A;  2KKZ A;  3V9W A;  4N76 A;  3EE8 A;  1RTH A;  2VGM A;  1JLC A;  1IKX A;  3ALY A;  4JKG B;  3K2P A;  5AR0 A;  3IDH A;  4BG8 A;  1WB9 A;  4FJM A;  4ZTJ A;  4C8L A;  1OH8 A;  4BE2 A;  4AIL C;  3OW2 M;  5C24 A;  2W6L A;  3H1V X;  5HRS A;  1Z6R A;  4BRI A;  1N34 K;  3V9Z A;  3ID6 A;  5AQN A;  4HTU A;  2FSJ A;  4ELV A;  1NK8 A;  3C6H A;  2A1S A;  3OS1 A;  1R0A A;  4B8A B;  5GAG P;  2HNZ A;  3I8B A;  4QS7 A;  1VQ9 N;  3ZSZ A;  4E7K A;  4CJE A;  1KFD A;  1QE1 A;  4ILG B;  3ZEU B;  3AVK A;  1O13 A;  3HYF A;  3A2F A;  3CC7 N;  2YHW A;  3WUH A;  1LWF A;  5AQU A;  2NRR A;  1XUP O;  2HB5 A;  2GBZ A;  1WSG A;  3VER A;  3EKU A;  4H5R A;  3DI6 A;  1EP4 A;  4DTM A;  1HKC A;  1WSE A;  4H0Y B;  4ISE A;  4BRG A;  3TAE A;  4C8M A;  2W40 A;  4LH4 A;  4CZI A;  1NGG A;  1W0H A;  3SAH A;  4B8C A;  3LDQ A;  4DG1 A;  4DS4 A;  1U49 A;  3ZX2 A;  3AVL A;  3KK7 A;  4JKA A;  5JIC A;  1QQN A;  2P9K B;  3ULE A;  2CGK A;  3HPH A;  4CZE A;  4B1V A;  3MCA B;  4CF9 A;  1RDW X;  4OO1 J;  1NGJ A;  4PL7 A;  1SV5 A;  3WXM B;  4BDP A;  4H03 B;  3ENH A;  1KXP A;  1L3S A;  2YI1 A;  2EX3 A;  4LF7 K;  4BWJ A;  1N8R O;  2QA4 N;  1HYV A;  3SMP A;  4IO9 L;  5HP1 A;  4CZH A;  1W2B M;  3ITH A;  3KKS A;  4B3R K;  2HVH A;  3MEG A;  3NF9 A;  3OYE A;  4NXN K;  3DYA A;  1S1X A;  4FPA A;  2VWJ A;  3SBG A;  1YJ9 N;  1HYS A;  4BY9 C;  4KV8 A;  4DTX A;  4BRH A;  1R59 O;  3JYT A;  3RMD A;  3CQY A;  2W00 A;  4I9Q A;  3O6W A;  4FL9 A;  4K43 A;  4F4K A;  3LZI A;  3TAP A;  1Q82 O;  1VQ6 N;  3OYF A;  1U45 A;  5DM6 L;  1WSH A;  2VG6 A;  4RW9 A;  2GUP A;  3ZLJ A;  4FWK A;  2O8C B;  3VPZ A;  4AHV A;  3CPE A;  5AQW A;  2YJF A;  3G71 N;  1KVB A;  2H3G X;  3S41 A;  4DR4 K;  3QLH A;  4DR5 K;  1CZA N;  4O5F A;  3T3F A;  1DKG D;  5HRP A;  1ZBL A;  4GNI A;  4DTU A;  1RDD A;  1QQO A;  3I55 N;  4IXC A;  4KHY A;  3ZSW A;  3RSE B;  4BE7 B;  5C0Y A;  4BRK A;  2YJE A;  3HTV A;  4KH6 A;  3BZC A;  4RG8 A;  4CGF A;  1KRP A;  4DV5 K;  4CJP A;  2IS3 A;  1QVF M;  4H5N A;  1RT6 A;  2KHO A;  3PSI A;  2QTD A;  1TK0 A;  5HOO A;  3KK2 A;  2HHT A;  4DWI A;  2YHA A;  1VQ7 N;  4FWR A;  3HXM A;  2HMI A;  3OS2 A;  3CYG A;  3SAG A;  4JI7 K;  2FC0 A;  1RBR A;  4CGH A;  4FJ8 A;  3DRR A;  3FR0 A;  4JHD A;  4K42 A;  3CMA N;  3R3L A;  1NOY A;  1Q81 O;  3I0S A;  1UA1 A;  5GAD P;  2OYQ A;  4FVU A;  1X9W A;  2HHU A;  2GWJ A;  1NK0 A;  2P9P B;  4DQ8 A;  2HBK A;  1J6Z A;  1TL3 A;  4CBX A;  4AHR A;  3RMC A;  3HVR A;  4NCG A;  1YUW A;  4E89 A;  4OVL A;  1BA1 A;  3OYM A;  2NLX A;  4V19 S;  4KI4 A;  2G8U A;  3QFP A;  3TU5 A;  1I3A A;  5BR8 K;  3UB5 A;  1QZ6 A;  4I6M A;  1S9E A;  4BRM A;  5GAH P;  1YT3 A;  5J1E A;  1WSF A;  3VQE A;  3RMB A;  1N5Y A;  2CH5 A;  4I9L A;  4KAZ A;  1HPM A;  3V1O A;  4BC2 A;  4CF1 A; 
#chains in the Genus database with same CATH homology
 3H3N O;  3WQT A;  4GV3 A;  3MK6 A;  3R8E A;  2P9I A;  1M90 O;  1JCG A;  3D2E B;  3VET A;  2NRH A;  5M1Q A;  2RE2 A;  2IVO A;  3U4L A;  4EHU A;  5F2R A;  2E1Y A;  4MO4 A;  5EY4 A;  3VTI A;  4BRN A;  4DHY A;  4KBO A;  2ZGY A;  4NB4 A;  4BRD A;  3ENO A;  4H0V B;  3D2F B;  1T44 A;  3O80 A;  4JK7 A;  3WXL A;  3U9Z A;  5CE3 A;  2W41 A;  4DCH A;  4CBW A;  3CCV N;  2V51 B;  2YHY A;  5JLF A;  3SK3 A;  1GLJ O;  3FZH A;  4FOE A;  1SAZ A;  3AAQ A;  3DWL A;  2Q97 A;  5C10 A;  5AQF A;  2Q1N A;  2QWR A;  3W0L A;  3M1F A;  3Q7C A;  3O8M A;  3SAF A;  3L0Q A;  2A5X A;  3DXM B;  3KVG A;  3NVM A;  4FOI A;  3HBT A;  3CJA A;  4K25 A;  4H0P A;  4OPH A;  3J8A A;  4PKH A;  5JLH A;  2GEL A;  3E9L A;  5AZJ A;  1NGH A;  1NGC A;  4JD2 A;  5KPR A;  2P9N A;  2Q31 A;  1KD1 O;  3EN9 A;  1Q7Y O;  1BA0 A;  5MLC Q;  2BUP A;  1XQS C;  3AGK A;  1VQP N;  4CI6 A;  3NVK A;  4CZK A;  3GDQ A;  3QBX A;  4JKE A;  1P90 A;  2F9T A;  3DXK A;  5EX5 A;  2QWQ A;  1GLA G;  1SS6 A;  4WFN L;  2E20 A;  5BN8 A;  3QML A;  4JHD B;  1Q86 O;  4GV9 A;  5GAE P;  3CME N;  1HUX A;  4O8K A;  2C1I A;  2UYT A;  4YOX A;  3CJ9 A;  4XH4 A;  5AFU A;  2FF6 A;  2BTF A;  2QW9 A;  3CCJ N;  1QHA A;  1ATS A;  1Q18 A;  1NM1 A;  4JN4 A;  4DB3 A;  3UKR B;  1YIT N;  1C0F A;  5AQG A;  4M7Y A;  5BRF A;  1M1K O;  2IVN A;  1OKJ A;  2D1K A;  3E9P A;  3C0B A;  3GBT A;  3L6Q A;  1V4T A;  1NGF A;  2P9K A;  1RGI A;  4A5A A;  5E84 A;  5ADX A;  4BR9 A;  4MDB A;  4WF9 L;  3W3D A;  4KH4 A;  3VES A;  2E1Z A;  3AY9 A;  4Z94 A;  4JK8 A;  2AP1 A;  3EL2 A;  4IFE A;  3E1Y A;  3BF1 A;  3WEE B;  1VQ8 N;  3O9R A;  2OAN A;  4I6M B;  3WT0 A;  3R1X A;  4IEE A;  2OTL N;  2CGL A;  2A41 A;  3C7N B;  1X3M A;  3JXU A;  4IJN A;  3VGM A;  1HX1 A;  3B8A X;  3FZK A;  5EVZ A;  3TSU A;  1NGD A;  4NLB A;  4BRA A;  5BRH A;  5AZI A;  3TTD A;  2P9I B;  2HF3 A;  3L4I A;  3TSQ A;  4H5V A;  4CD3 A;  1WOQ A;  3ZYY X;  4MLH A;  4YOU A;  2ZGZ A;  3JS6 A;  1X9J A;  4IEI A;  5AQJ A;  2V7Z A;  4LC9 B;  1D4X A;  2P9L A;  5AQP A;  1YF5 L;  5AQK A;  4FO0 A;  2ASM A;  3KWI A;  2FSK A;  1YIJ N;  3WXK A;  1RFQ A;  4BRF A;  3E9O A;  5C2D A;  1TUU A;  3I56 N;  3MX5 A;  1TYQ A;  4BRP A;  4BR2 A;  3ENB A;  4PKG A;  5GIO A;  5AQS A;  4BRL A;  2GX9 A;  4YOV A;  3D6R A;  4K41 A;  2ZJR L;  4IOC L;  4ILJ A;  5BPN A;  1XC3 A;  4XH5 A;  1VQL N;  1NGB A;  2IVP A;  3D7E O;  3U9D A;  2F9W A;  1NMD A;  5AZJ B;  4BG9 A;  3O9Q A;  4JD2 B;  2P9N B;  4WQ4 A;  3MN7 A;  3BP8 A;  1BUP A;  3GOI A;  3LL3 A;  3VEY A;  1QQM A;  3H1Q A;  3VOV A;  2EWS A;  3QIC A;  5KQ8 A;  3FE1 A;  3CJC A;  3PLA A;  2NRW A;  5BRD A;  3DXK B;  1YI2 N;  1E4G T;  2HOE A;  1DEJ A;  2DPN A;  4IWV A;  4F9O A;  5BRE A;  3L4Q A;  1K8K A;  4BRE A;  2HBJ A;  5CHI A;  1NGA A;  3SJH A;  4JKG A;  3ATV A;  3C6A A;  3EKS A;  3GG4 A;  2E88 A;  3ID8 A;  5F1X A;  1YVN A;  4B1Y B;  5AQM A;  1WUA A;  5AFU H;  1VQO N;  5F0X A;  5AQO A;  2I7N A;  2QWN A;  3A8Y A;  4GY2 B;  5GIP A;  2JWL A;  1GLD G;  1HKB A;  4WFB L;  4BQZ A;  2QWM A;  3A5M C;  2PFU A;  3FGU A;  3M3Z A;  2P9U A;  4B1Z A;  3F9M A;  4JKC A;  3H6E A;  4JKF A;  4M7X A;  3UKU A;  1VQM N;  5ADX H;  1ZC6 A;  4EHT A;  5KQD A;  2QM1 A;  3LDL A;  5FPE A;  3WXJ A;  2FLO A;  3BUZ B;  4C1N K;  4H0T B;  3K9K A;  3N4Q A;  5BN9 A;  4BR5 A;  2NZT A;  1DGK N;  3ZEU A;  1VQK N;  1MDU B;  4FPB A;  4OPA A;  1KAZ A;  1MWM A;  1OVY A;  1T6C A;  2F7T A;  3CET A;  2P9S A;  5AZI B;  4A61 A;  4PKI A;  3CCQ N;  3IFR A;  2HST A;  2Q2R A;  1ATN A;  4ISG A;  3F5T A;  3QBW A;  4NLC A;  3QFU A;  5KPZ A;  1U6Z A;  2E2N A;  2VWB A;  4XH1 A;  1NBW A;  1W97 L;  3MN5 A;  3N4P A;  2E2O A;  3CJB A;  2A6A A;  2ZWH A;  4BR4 A;  5LY3 A;  5C12 A;  3DLL L;  1K73 O;  4JK9 A;  4AF1 A;  1LOT B;  3G6E N;  1BOT O;  2P9L B;  2Q0R A;  4IOX A;  2P9P A;  4QS8 A;  5ELZ A;  1NJI O;  5I9E B;  3OBW A;  4CZL A;  2PAV A;  3CCE N;  2HMP A;  5C2F A;  4H5W A;  3O4W A;  3CD6 N;  3R9P A;  4A2B A;  4BC4 A;  3GE1 A;  3OHR A;  3ATU A;  1K9M O;  1TYQ B;  3EO3 A;  5LJV A;  2JWK A;  3QB0 A;  3J7Z O;  3LM9 A;  1HJO A;  1G99 A;  2FF3 B;  4YDU C;  1GLC G;  3FZM A;  1T6D A;  5M1O A;  3MWP A;  2GEM A;  3M5R A;  1V4S A;  4JEP A;  2A42 A;  1QZ5 A;  3TTF A;  4A57 A;  5FPD A;  4BEC A;  3O9U A;  4ISF A;  3G25 A;  4WCE L;  2WFB A;  5AQZ A;  2HBM A;  3MN6 A;  5M1K A;  3VF6 A;  1YHQ N;  3LM2 A;  3P31 A;  3OBY A;  4RCH A;  2GTD A;  1IG8 A;  4B1W B;  2KKZ A;  1E4F T;  2QI2 A;  5BR9 A;  1BU6 O;  1BWF O;  3EZW A;  4RWT A;  2VGN A;  1IJJ A;  2KLA A;  3EE8 A;  3O1W A;  3CC4 N;  4GV6 A;  4RTF D;  3LDN A;  2VGM A;  3MCP A;  1P8Z A;  2ZF5 O;  3CPW M;  1VQ5 N;  4JKG B;  5AR0 A;  5B8H A;  1NGE A;  1GLE G;  3CF5 L;  3IDH A;  4BG8 A;  2NRV A;  4CJ7 A;  4ILH A;  2NRZ A;  2NRT A;  3T7Z A;  4WQ5 C;  3VGL A;  4B1U B;  4PHT X;  3CXC M;  1NGI A;  2YHX A;  3OW2 M;  3A5L C;  1YXQ A;  2BH1 A;  1LCU A;  3VEV A;  1YJW N;  2ASP A;  4IOA L;  4MO5 A;  4XEI A;  3H1V X;  4FWO A;  3WQU A;  3TTC A;  3O1B A;  2ZJP L;  1MA9 B;  2P9U B;  1Z6R A;  2RHK A;  4BRI A;  1EQY A;  5AQL A;  1YJN N;  3ID6 A;  5AQN A;  5M1P A;  2FSJ A;  4UY8 O;  4GVE A;  5AQY A;  3WXI A;  3CCR N;  1JCF A;  3C6H A;  4YOR A;  1EO1 A;  3KHY A;  3A5O C;  3CCL N;  2I7P A;  4NO7 A;  4BVO A;  3CER A;  3F2K A;  5GAG P;  5JVG L;  1U2V A;  3I8B A;  1KAX A;  4QS7 A;  3M6G A;  1VQ9 N;  3IKM A;  3SMS A;  1Z05 A;  3FLC O;  4CZG A;  5GIN A;  4ILG B;  3HOT A;  1S72 N;  3ZEU B;  1HLU A;  3HOS A;  4FSV A;  3ZX0 A;  3HZ6 A;  5EOY A;  2P9S B;  1O13 A;  4YOT A;  1QVG M;  3HI0 A;  3CC7 N;  2Q0U A;  2YHW A;  1NLV A;  1Y64 A;  3TPQ A;  3VF4 A;  3WUH A;  4MLE A;  2QWP A;  3ZET A;  5AQU A;  4BGB A;  2NRR A;  3A0I X;  1ATR A;  5LJW A;  1KC8 O;  1XUP O;  1X3N A;  3SBT A;  3VER A;  3EKU A;  3MMV A;  4H5R A;  2IIR A;  5TKY A;  4G9Z A;  2HF4 A;  1HKC A;  3U8X A;  4H0Y B;  4ISE A;  5AQH A;  4BRG A;  4AM7 A;  4Y0W A;  2W40 A;  2ITM A;  4CZI A;  5M1F A;  1NGG A;  2VYP A;  4H5T A;  5C15 A;  3SAH A;  4JKB A;  1S3X A;  2QXL A;  3GL1 A;  4EAH D;  4FWN A;  1ESV A;  3O9S A;  3LDQ A;  3DJC A;  4CZF A;  3ZX2 A;  2CH6 A;  3RSE A;  3KK7 A;  1VQN N;  4BRO A;  1SQK A;  4BEB A;  4JKA A;  5JIC A;  1QQN A;  5E26 A;  4A62 A;  2P9K B;  1DT9 A;  2C1G A;  3ULE A;  2CGK A;  4A2A A;  1JJ2 M;  3P39 A;  4JNE A;  4L3Q A;  4CZE A;  4R79 A;  3C7N A;  4B1V A;  2YX6 A;  3KZB A;  4EFH A;  4E1J A;  4M63 C;  3MCA B;  3CJ7 A;  4J8F A;  4WYB A;  3O08 A;  1RDW X;  1NWK A;  5M1N A;  1C0G A;  1T3V A;  3CQX A;  4PL8 A;  4OO1 J;  1NGJ A;  5FPN A;  4PL7 A;  4BVP A;  4WQ5 A;  3WXM B;  2J4R A;  2CGJ A;  4H03 B;  3ENH A;  1JCE A;  4BR0 A;  1YAG A;  1KXP A;  4BR7 A;  2YI1 A;  5JMV A;  5HL7 L;  4BGA A;  5BPL A;  3EE9 A;  5TKW A;  4CBU A;  4CD1 A;  1N8R O;  2QA4 N;  2HBL A;  3SMP A;  4IO9 L;  1RDU A;  4CZH A;  4JAX A;  4B9Q A;  5AQV A;  2QEX N;  5H1S Q;  1W2B M;  3ZX3 A;  2QWO A;  3LDP A;  3VEW A;  2FSN A;  4WFA L;  3FZL A;  4JKD A;  2AA4 A;  3H3O B;  4C23 A;  5DM7 L;  4FPA A;  3VEN A;  4HTL A;  3VGK A;  3SBG A;  1YJ9 N;  2FXU A;  5AQI A;  4U67 L;  4BY9 C;  3BEX A;  3FFK B;  1U2V B;  4BRH A;  4BC5 A;  4H0O A;  3CIP A;  1R59 O;  2W00 A;  3CQY A;  4XJX A;  1BO5 O;  1MWK A;  3KWG A;  4WQ4 C;  2PBD A;  1BG3 A;  2A3Z A;  3O6W A;  3VEX A;  4FL9 A;  4JKH A;  4K43 A;  1ILY A;  3HSC A;  3MX2 A;  5KPT A;  1GLL O;  3MN9 A;  1Q82 O;  1VQ6 N;  3ZET B;  3OA9 A;  5DM6 L;  3R6M A;  2D4W A;  2NNW A;  4BC3 A;  5CR4 A;  5JVH L;  3CI5 A;  4C1N I;  2GUP A;  4KH5 A;  4FWK A;  3D2E A;  4FWQ A;  4EIA A;  4IO8 A;  3VPZ A;  2ASO A;  3CPE A;  1K8K B;  2YJF A;  5AQW A;  3HM8 A;  4AM6 A;  3G71 N;  3UE5 A;  3NMU A;  2H3G X;  3S41 A;  4A5B A;  1CZA N;  4O5F A;  1DKG D;  3IUC A;  4GNI A;  4BRQ A;  1TUY A;  5BPM A;  3AAP A;  1QQO A;  3H45 C;  3PIO L;  3I55 N;  3D2F A;  4IXC A;  3RSE B;  4BE7 B;  3VMF B;  5C0Y A;  4BRK A;  3PIP L;  4QS9 A;  1H1V A;  2YJE A;  3HTV A;  4KH6 A;  1GLB G;  3DAW A;  3G4S N;  3A5N C;  2V52 B;  3ULE B;  1ZXO A;  3CCM N;  3P4I A;  1QVF M;  5EXW A;  1GLF O;  2D0P A;  4H5N A;  5FPM A;  3T69 A;  3TSP A;  2KHO A;  2WUS A;  3UKU B;  2QTD A;  3VEZ A;  4YOY A;  1ZBS A;  3DXM A;  3H46 O;  1SZ2 A;  4CZJ A;  2QWL A;  3AAR A;  2D0O A;  2E8A A;  5HOO A;  2VCP A;  4BRC A;  3Q7B A;  5AQQ A;  3SLC A;  1VQ7 N;  3RVC A;  4FWR A;  3HRG A;  3I33 A;  2E2P A;  1S22 A;  4DKW A;  4IJA A;  3SAG A;  3FZF A;  4FWP A;  4IDH A;  3CCS N;  2OTJ N;  3BF3 A;  4YOW A;  2Q36 A;  1KQS M;  2E2Q A;  3FR0 A;  5AQX A;  4IZ9 A;  1VAZ A;  4JHD A;  4K42 A;  3CMA N;  2YCH A;  3C65 A;  3IMX A;  3R3L A;  3P38 A;  3AGR A;  4H0X B;  1KAY A;  3O9T A;  4CZM A;  3MWT A;  4BQL A;  3CHW A;  1Q81 O;  4FWM A;  3E66 A;  5GAD P;  4A59 A;  4FVU A;  2WBN A;  2GWJ A;  4FWS A;  3UKR A;  1HKG A;  3CC2 N;  2P9P B;  3VF2 A;  4DQ8 A;  4B1X B;  2HBK A;  5AQR A;  1J6Z A;  1K8A O;  4U7B A;  2V7Y A;  4CBX A;  4MDA A;  1VQ4 N;  5AQT A;  4YDU A;  1YUW A;  3O5B A;  1BA1 A;  1BDG A;  4FWL A;  2NLX A;  2WC9 A;  3CCU N;  4HWI A;  3QFP A;  3TU5 A;  2GWK A;  3UB5 A;  1QZ6 A;  3WEE A;  4I6M A;  3VTH A;  2A40 A;  3MDQ A;  3QDK A;  3CJ1 A;  4BRM A;  5GAH P;  4O8U A;  2ZJQ L;  3LDO A;  2CH5 A;  1HPM A;  4BC2 A;  2NRX A;  3K9J A;  3VEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...