3DXMB

Structure of bos taurus arp2/3 complex with bound inhibitor ck0993548
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
196
structure length
196
Chain Sequence
GVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-related protein 3
publication title Characterization of two classes of small molecule inhibitors of Arp2/3 complex
pubmed doi rcsb
total genus 51
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxmB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3dxmB02
3LM2A 3WEEA 3ULEB 4CD3A 4LC9B 3CJAA 1JCEA 4YDUC 2P9SA 4EHTA 1NGGA 1U6ZA 3FZMA 3MDQA 4K43A 2QWQA 2PBDA 4O5FA 5AFUA 2GELA 2P9UB 2VWBA 2GEMA 3QBWA 2J4RA 2QWRA 3U4LA 3R8EA 1NM1A 4JHDB 1HJOA 4C23A 3O8MA 4ISFA 4O8KA 4RWTA 2WUSA 3QMLA 4K42A 2CGJA 3VERA 1RDWX 5AQYA 4H5WA 2HOEA 2P9NA 1ESVA 3FR0A 1BOTO 4BC2A 3TPQA 2YCHA 2QWLA 4IO8A 3HBTA 4FWNA 5AQZA 3ZX0A 2A40A 2E2QA 5AQMA 5LJVA 3DXMB 5F1XA 3JXUA 4CD1A 2YHXA 3QB0A 3ZX3A 4BC3A 3OHRA 1MA9B 1JCFA 4MO4A 5AQFA 3GOIA 2FSKA 3D2EB 3H1QA 2KHOA 3H45C 4DCHA 2V7ZA 3L4IA 5AQRA 3VEVA 3U9DA 1ATSA 2E1ZA 2FLOA 3IDHA 4FOEA 2FXUA 5AQHA 2A41A 1LOTB 1S3XA 4FPBA 1H1VA 3EL2A 1Z6RA 2P9IB 3BP8A 1SZ2A 3C0BA 2Q0RA 3WT0A 3SLCA 1JCGA 2E1YA 4BRGA 4GY2B 4CZFA 3EO3A 4L3QA 1QQNA 3DWLA 2YI1A 3BF3A 3ZETB 1GLAG 1BUPA 1HPMA 1NWKA 3AAQA 3C7NB 2HMPA 3FZHA 3GDQA 3O08A 5ADXH 1Z05A 2VCPA 3QFPA 3R9PA 3UKUA 3CJ7A 3QFUA 3H6EA 1NGDA 3CHWA 4K41A 4PL8A 2QWPA 3MCPA 5AQKA 5AQXA 2FF3B 4CZMA 2V51B 3WQUA 2CH5A 1QQOA 5AQTA 5AQSA 1BU6O 2DPNA 1GLLO 1BG3A 3LL3A 4FWRA 5AZJA 2NZTA 1BWFO 3WXJA 2E20A 3SMSA 1ZC6A 1DKGD 5EOYA 2QM1A 2ASOA 5AQUA 2GWJA 1ATRA 2IVOA 3FLCO 2A3ZA 3VEWA 5ADXA 1TYQB 4HTLA 3HSCA 3HM8A 1QHAA 3I8BA 3M3ZA 4BGAA 2YJFA 1SQKA 3VF6A 1Q18A 5KPTA 3HTVA 5KQDA 2P9KB 4H5VA 1V4SA 3G25A 3LM9A 4H0TB 5AR0A 1G99A 5BN9A 4FO0A 4HWIA 4H0YB 3ULEA 3VEZA 1U2VB 2AP1A 1BA0A 3P4IA 3MMVA 5I9EB 4IWVA 2V52B 1TUUA 4CZLA 1GLCG 5AQJA 2P9UA 3M1FA 4IJNA 3ZX2A 3CJCA 1HKGA 1IJJA 4MLHA 3WXKA 2ZGZA 3LDOA 4CZIA 3EKSA 2ZWHA 1GLEG 3F9MA 3ID8A 4BRFA 4WQ4A 4EIAA 4BC5A 3DJCA 2A42A 1ZBSA 1GLFO 2PAVA 2Q97A 1SAZA 3DXMA 1YAGA 3VPZA 4BR7A 4CBUA 5AZIA 5JMVA 2D4WA 1OKJA 4FOIA 4H5NA 2P9LA 3RSEB 4BROA 3MN5A 2NRHA 3CJ1A 4B1YB 4FL9A 4BREA 2CGLA 2FSJA 1YXQA 4FWMA 4BRKA 1R59O 3FZFA 3O6WA 3QICA 3SMPA 2F9WA 4CBXA 4M7XA 4B9QA 5F0XA 4BRAA 4B1UB 5BPLA 4FSVA 3WEEB 2P9IA 2E2OA 2VYPA 2P9SB 2ZGYA 4BQLA 1NGAA 3IMXA 4B1XB 4A62A 1K8KA 5FPNA 1C0FA 3LDQA 3O1WA 3QDKA 3UB5A 3DXKB 4ISEA 3VGKA 3VF2A 4AM7A 3I33A 4H0PA 3C7NA 4IJAA 5AQGA 5BRDA 3J8AA 1BDGA 5AQNA 4BRNA 3BUZB 3WUHA 3ZEUA 5LJWA 1ATNA 2ASPA 2ITMA 3IUCA 4DHYA 4B1WB 3H3NO 2Q31A 3LDPA 3A5MC 4BRPA 5BREA 2GUPA 3D2FA 5AQVA 3VEYA 2ASMA 2FSNA 4BR2A 3H3OB 4GNIA 3EZWA 4FWOA 2E88A 3W0LA 4PKIA 1HUXA 2A6AA 1EQYA 3ATVA 3VGMA 4BRQA 2D0OA 3FGUA 1GLBG 1NMDA 1D4XA 5TKYA 3VETA 2E8AA 4BRLA 5BR9A 2YHWA 3HZ6A 3KVGA 4BRDA 1X9JA 3HI0A 4Z94A 3FZKA 3JS6A 3H1VX 5FPDA 1IG8A 2V7YA 1S22A 4K25A 1GLJO 1T6DA 1NGJA 1MDUB 1WUAA 1RGIA 2H3GX 2P9PB 3LDLA 5EX5A 2P9KA 1NGFA 4PL7A 4DQ8A 5ELZA 3UKRA 1KAZA 4WQ5A 1Y64A 4CBWA 4A2AA 3DAWA 4DB3A 3U8XA 4EAHD 2Q2RA 3CERA 1XQSC 3A5OC 4BC4A 3CIPA 1QZ5A 2W41A 4FWLA 1NBWA 4H0XB 3AY9A 3WXIA 3M6GA 3A5NC 4I6MB 4RTFD 3BEXA 4QS7A 4H0VB 2GWKA 4XH4A 5KPRA 3GG4A 4F9OA 5CE3A 1NGBA 2HF3A 2QWOA 4QS9A 1V4TA 3GL1A 5AQOA 4B1ZA 4BRMA 4AM6A 2E2PA 2IIRA 1MWMA 1YUWA 3O5BA 2ZF5O 3FE1A 4BRCA 4JHDA 3VGLA 4IXCA 4PKHA 3GBTA 1HKBA 2E2NA 3KZBA 4JNEA 2A5XA 2W40A 4A2BA 4J8FA 3VENA 3RSEA 1KAYA 3CQYA 4BR0A 2YJEA 4H5TA 4Y0WA 3MN7A 5E26A 3ATUA 1NGHA 3A5LC 4FPAA 4MO5A 5KQ8A 3EKUA 5KPZA 3CI5A 1KAXA 1HX1A 4PKGA 2CH6A 1YVNA 1C0GA 2F9TA 2D0PA 3AAPA 3ENHA 5JLFA 5FPEA 3D2EA 3CJBA 1DEJA 4BRIA 3VOVA 2BUPA 4JD2B 3DXKA 1LCUA 1T6CA 2IVNA 4EFHA 3AARA 4CZJA 1NGEA 3MK6A 1XC3A 3A8YA 3MN6A 4QS8A 4A61A 4E1JA 2OANA 5BN8A 4NB4A 5B8HA 3SK3A 4B1VA 4XH5A 1DGKN 1MWKA 5E84A 5JICA 3L6QA 4FWQA 5BRFA 1NGCA 4YDUA 3VF4A 3ZETA 3O80A 3O4WA 5AQQA 4JAXA 1J6ZA 2EWSA 5BRHA 2QWNA 2I7PA 5EVZA 5AZIB 2Q0UA 2QWMA 3QBXA 1X3MA 2P9LB 3S41A 2YHYA 5AQPA 2P9NB 4H5RA 5F2RA 4WQ5C 5AQWA 3H46O 4XEIA 3A0IX 2P9PA 4BR5A 3MN9A 4JN4A 1QQMA 3CETA 3W3DA 3EN9A 3LDNA 3TU5A 5BPMA 4BVPA 2HF4A 2GTDA 5EXWA 2QW9A 5LY3A 1ZXOA 1RFQA 1TYQA 1E4FT 1K8KB 4ISGA 2AA4A 4MLEA 2CGKA 3WQTA 4KBOA 1XUPO 4I6MA 3B8AX 3ENOA 2FF6A 3BF1A 4CI6A 4BR9A 3FZLA 5BPNA 3ZEUB 4M63C 3KHYA 5AQIA 2D1KA 4BVOA 1BA1A 1U2VA 4CZKA 2Q36A 3D2FB 4BR4A 4BQZA 1CZAN 4EHUA 1BO5O 1X3NA 4CZHA 2QXLA 1WOQA 1KXPA 4CJ7A 1P8ZA 3VEXA 3U9ZA 4CZGA 3IFRA 4NO7A 4WQ4C 4XH1A 3UKUB 3CQXA 3FFKB 4H0OA 5AQLA 3L0QA 4BG9A 3VESA 4IZ9A 3WXLA 2BTFA 3UE5A 3O1BA 4RCHA 4H03B 1QZ6A 3UKRB 5AZJB 3CJ9A 4BG8A 5AFUH 3D7EO 4FWKA 5JLHA 2IVPA 1E4GT 1HKCA 1NGIA 4FWPA 2UYTA 1GLDG 2NLXA 4M7YA 4CZEA 1NLVA 2I7NA 4FWSA 4WYBA 1TUYA 4BRHA 2Q1NA 4JD2A 3R6MA 5FPMA 3SJHA 5EY4A 1T44A 3VEOA 3GE1A 4BGBA 1HLUA
chains in the Genus database with same CATH superfamily
4GVEA 4LSNA 3WEEA 1K73O 3ULEB 3PO4A 2OTJN 4LC9B 2KZZA 3ZT0A 4I2QA 1NGGA 3AGKA 1HNWK 4NCAA 4K43A 4O5FA 3KLIA 2O8BB 4I7FA 4DU3A 2VWBA 1W0HA 2J4RA 2VQEK 4JHDB 3O8MA 1ASUA 3CCRN 4LFCK 3LP3A 3QMLA 4B3RK 1QS4A 2CGJA 1RDWX 3VERA 4M3XA 4H5WA 3BZCA 2HOEA 4AH9A 1VQON 4QOZB 1WSHA 3TPQA 2YCHA 1UA1A 4FWNA 5AQZA 3ZX0A 4FJKA 3FFIA 3JXUA 2ZD1A 4I9LA 2HHHK 3QB0A 4LH4A 3ZX3A 3OHRA 4BC3A 1XHXA 2OCEA 4JKEA 3PV8A 1VQMN 2FSKA 3D2EB 2UU9K 4FLXA 4CFDA 2O8EA 2V7ZA 2JLEA 1LWFA 3VEVA 1OVQA 1ATSA 2E1ZA 3IDHA 4DU1A 2A41A 4X65K 1C0MA 1H1VA 3SAHA 1SZ2A 3WT0A 3DLEA 3OS1A 5CZ1A 1JCGA 2E1YA 1UAXA 4DSFA 3EO3A 2NRTA 1N34K 4FK4A 2VG6A 3SBTA 1FXXA 5KRSA 1XMQK 3C7NB 1KCFA 3FZHA 4IOAL 2E6LA 4HVJA 1SL2A 4PUOA 2VCPA 4M45A 3D45A 3C6TA 3QFPA 5TKWA 3AVJA 5D3GA 4CJ4A 3K5NA 4CFCA 4K41A 4FCYA 2NRXA 1K9MO 4KAZA 3DYAA 3WQUA 1QQOA 3K59A 4CF2A 2E20A 3HVRA 1ZC6A 5CR4A 1JXEA 4FXDA 5EOYA 1C6VA 3MXMA 4CGFA 5AQUA 1VQ4N 2GWJA 4W5RA 1ATRA 4N76A 2IVOA 3M8QA 3OA9A 3C95A 1VQ5N 1K6YA 3F9KA 1O13A 2HHSA 3M3ZA 3KD1E 5KPTA 1BCOA 5KQDA 4H5VA 1RT4A 4LF4K 4H0TB 5AR0A 1N36K 4FO0A 3WNFA 1U2VB 3P4IA 4BE0A 3M5RA 4KB0A 3DRPA 4CZLA 3ZT3A 1RTJA 2YV0X 3VQPA 3ZX2A 5DM7L 4CHZA 2HHTA 1M90O 3QINA 1IJJA 4MLHA 4ZTFA 1X1PA 4JI5K 4CZIA 3J7ZO 4CESA 2E6MA 3SPYA 1SKSA 1WNSA 4EIAA 1FK9A 3KLFA 4JI0K 4JKHA 5JS2A 3DXMA 3VPZA 4CEEA 5KTQA 1ASVA 4HCBA 3RRHA 3SUPA 4TSXA 1ASWA 3HRGA 5HL7L 4JKAA 4BROA 2NRHA 4FJGA 4JS4A 1QSLA 3PO5A 4BREA 1NK8A 2FSJA 1YXQA 3DLRA 4ILGB 3SMPA 4CBXA 4M7XA 1KVBA 3BZKA 1WBBA 4B1UB 3QO9A 4FSVA 5HROA 2KW4A 1TL1A 3RR8A 3CPEA 2P9SB 2ZGYA 4AHVA 3KLEA 4OLBA 4CIFA 1K8KA 5FPNA 3D0PA 1C0FA 2ATQA 3VGKA 2KTQA 3I33A 3AV9A 1U45A 2HHQA 3SAGA 2C1IA 3BUZB 2ASPA 2ITMA 3IUCA 4CF1A 4B1WB 2RF2A 4RG8A 4OX9K 2W00A 3D2FA 2HHVA 4BY9C 2NRWA 4DQPA 1EQYA 3ATVA 2D0AA 2HHIA 1D4XA 4BECA 4BRLA 4E72A 2YHWA 3CD6N 4BRDA 4LH5A 3H1VX 3L3UA 3L2WA 2ZQBA 4ID1A 2UXDK 1S22A 2IOCA 1NGJA 1MDUB 1WUAA 2VQFK 2P9PB 3LDLA 1KAZA 3CF5L 4A2AA 4J2AA 3DAWA 4M42A 5HLFA 4CF9A 4CIGA 4GMJB 4FWLA 1NK6A 4WFBL 1O1WA 1GOAA 3E66A 4LY7A 4QS7A 1L3TA 2VWKA 3LWLA 5C12A 5KPRA 1D5AA 3AVFA 2HF3A 2IC3A 4QS9A 3ZSOA 2HW3A 5J2MA 1D8YA 1Q82O 4B1ZA 3B6PA 2WONA 2E2PA 4KO0A 4AM6A 3V6DA 4DR5K 4M3WA 3SQ4A 3ENBA 3PSFA 4BE2A 1CXQA 4BRCA 1VK0A 3VGLA 3GBTA 4JKGA 2A5XA 4J8FA 2D0CA 2QTDA 1WSGA 4BR0A 4H5TA 4FVUA 5I42A 3RMAA 3I56N 2WBNA 4FPAA 3A5LC 5KQ8A 4MO5A 3MCAB 3EKUA 3MECA 4PKGA 2FC0A 5BR8K 2D0PA 3AAPA 1L3SA 5FPEA 4JI8K 3LP1A 4BRIA 3VOVA 4ELVA 2D5RA 1UOCA 4RW4A 4KV8A 2X74A 2IVNA 4EFHA 3AA3A 1RDDA 3A8YA 3L2UA 1NK7A 4NB4A 4N56A 4B1VA 3TWHA 1DGKN 4CK2A 3TABA 2PZSA 5E84A 5JICA 4AQYK 1TK5A 1DLOA 1VQKN 3NGYA 3ZETA 1S1UA 4E7HA 3SAFA 3KK1A 4B9VA 5EVZA 2QWMA 1X3MA 1DTTA 3E9PA 2UUCK 2YKMA 3TARA 1HYSA 4CEFA 4HUGA 1HRHA 3SI6A 2O8FB 3MN9A 1QQMA 2HNDA 2QK9A 3EN9A 1J54A 5C2FA 5KGXA 4JK8A 2GTDA 1QE1A 1TYQA 3CCSN 4E7LA 1WSIA 4DQIA 2F4VK 1T8EA 1U47A 3BDPA 1EETA 4KBOA 3B8AX 3ENOA 1W9HA 5DM6L 3BF1A 3NAEA 4FLVA 1A5WA 1GOBA 4N47A 2YNIA 4BVOA 3O9TA 3E01A 1Z26A 1CZAN 2IDOA 5M1QA 4EHUA 1X3NA 3AO2A 3LPUA 3TAQA 1U49A 4KHPK 4JI3K 1WOQA 1KXPA 4CJ7A 3U9ZA 2YKNA 3WNEA 2WTUA 2Q3SA 4Z4FA 3P39A 4XH1A 4GV6A 2OZMA 2X6NA 4E7IA 3FFKB 3OYJA 4G9ZA 5I3UA 5AQLA 3VESA 2G8KA 5C25A 4AILC 4CJ3A 4RCHA 4E1NA 2KLAA 1TK0A 3UKRB 4DR3K 4KHSA 4FWKA 5C42A 1WLJA 3N4PA 1CLQA 4HUFA 1JL1A 4B9UA 3AVBA 3NGIA 2DY4A 1JLCA 3K5LA 2RKIA 1BQMA 3KK3A 3PX6A 3SV4A 1TKTA 2O8CA 4J2DA 3R6MA 5FPMA 5EY4A 1T44A 5K14A 4BWMA 2HVIA 2OTLN 4NLBA 1JLBA 4FJNA 3V1RA 3VA0A 4DR6K 1JCEA 3MEEA 4EHTA 4JYAK 3UIQA 3FZMA 3MDQA 3VQ6A 4CHQA 3ZSZA 1HMVA 4KHUA 2GELA 4B9TA 4A5AA 3QBWA 1JLEA 3MXJA 3U4LA 4GV3A 4J2EA 4ISFA 4HCCA 4B3TK 4Q0BA 2NRRA 2B6AA 2WUSA 4X64K 4CERA 4K42A 5AQYA 4IOXA 2P9NA 2RPIA 4BC2A 4OPKA 4LF6K 2QWLA 1S9EA 5EU7A 4WFNL 2VG7A 4DTJA 4DR4K 3EYZA 4MQ3A 2Y1JA 2YHXA 3KK2A 3PSIA 4JKBA 2FBYA 3GOIA 2KHOA 3SCXA 3PY8A 4JKCA 4C1NK 3NF9A 3TTCA 2W6KA 4DS5A 3U9DA 5CYMA 2P5OA 2FLOA 2WOMA 4FOEA 5AQHA 1NJZA 1VSIA 1S3XA 1S5JA 3EL2A 4NCBA 3BP8A 1NMNA 3QNOA 1LWCA 1KVAA 4GY2B 2KKZA 1TGOA 1Q9XA 4FLUA 5KGWA 2YI1A 5CHIA 4LD0A 4U67L 1BUPA 1NWKA 2IS3A 4ZHRA 3NDKA 2HMPA 1VQ6N 5GIPA 3O08A 1Z05A 3N4QA 3OBYA 4B9LA 3R9PA 4DV4K 3UKUA 4DV3K 1S1VA 3CYGA 1NGDA 3HYFA 4DQSA 1C1AA 3MCPA 2JWLA 1QHTA 1FW6A 1BHLA 4B8CA 4IOCL 3QESA 5AQTA 4OLAA 1RDCA 3LL3A 1XMOK 1A5XA 3CCJN 1BWFO 3NVKA 2ZE2A 3O9RA 3THXB 4JI7K 5HRPA 1NOYA 3KWGA 1N5YA 3OW2M 1BI4B 2Y1IA 1JLAA 1QHAA 4BGAA 3KD5E 4OVLA 1Q18A 5M1OA 3HTVA 2P9KB 3AVHA 4CE9A 3H08A 1VSLA 3IKMA 1V4SA 3LM9A 1W2BM 4FM1A 1G99A 5BN9A 4MFBA 1YHQN 4UQGA 4HWIA 4H0YB 3ULEA 3SV3A 1IBLK 2EX3A 3M8RA 2ZM6K 5I9EB 3THYB 4IWVA 3AA2A 4JRQA 3KIOA 1EP4A 3M1FA 4FLTA 3THVA 2IAJA 2NRZA 3CJCA 1HKGA 1S6QA 4OKEA 1OVYA 1C1CA 3WXKA 3MWTA 1WSJA 4IDKA 2ZGZA 3V9XA 1WN7A 1HNXK 1GLEG 3F9MA 3QIPA 3ID8A 1WAJA 3G10A 3ITHA 4BRFA 1U4BA 4BC5A 3RWUA 4Z4IA 2PYLA 2PAVA 2Q97A 2D0BA 4CGIA 5AZIA 5JMVA 2D4WA 3SPZA 3NH0A 4A59A 2BDPA 4Z4EA 3G71N 4CJSA 3CJ1A 4OGCA 4Z0UA 4B1YB 2EHGA 4WF9L 4FL9A 4KI4A 4FWMA 1R59O 3FZFA 3MX5A 3O6WA 3QICA 2F9WA 1KRPA 3IG1A 1TKZA 4B9QA 4BRAA 3WEEB 2QEXN 4N5SA 2E2OA 4IEEA 2VYPA 2A1RA 3IMXA 4B1XB 4A62A 2HHXA 1OH7A 2F8SA 3K0SA 1S1WA 3DXKB 4ISEA 3NE6A 4H0PA 3DLGA 2FBVA 1RBSA 2PFUA 3C7NA 4BRNA 3ZEUA 1DTQA 1NJIO 5JVHL 3A5MC 5FROA 4BRPA 5M1NA 5AQVA 3VEYA 4O44A 4BR2A 3RMDA 3C6HA 4IG0A 4Y1DA 2E5LK 1LWEA 3VGMA 4BRQA 2D0OA 4CEAA 3KK7A 4DLGA 1RBTA 5TKYA 5FRMA 3HZ6A 3KVGA 1X9JA 3FZKA 2O8EB 3JS6A 1VHXA 1IG8A 1VSMA 4CHPA 4E7KA 1Q86O 3CC4N 2OZSA 4UY8O 1NGFA 2G8WA 3P38A 3VQ7A 3LP0A 4B3SK 5ELZA 4B3MK 4JI6K 4E7JA 5CY4A 4DV2K 3A5OC 4BC4A 2UUAK 1BL3A 5HP1A 3DLHA 1VSFA 4H0XB 1FKOA 4YOVA 3BGRA 4B9SA 1NJXA 4DV7K 3ZLJA 3PIPL 3DRRA 4XJXA 3BEXA 4H0VB 2GWKA 4XH4A 2HBLA 1NKCA 1EWRA 2HBJA 3K9KA 4FLYA 3DRSA 5CE3A 1ZBLA 4YOTA 3OYBA 3HOSA 3O4QA 1RCHA 1V4TA 4WCEL 3CPWM 2IIRA 4DTRA 4ELTA 1YUWA 3O5BA 3VQAA 3OYLA 1F21A 4E89A 1VRTA 4LF7K 3V4IA 2HNYA 1RTDA 2OPSA 3CMEN 3F2KA 1TAUA 1HKBA 2E2NA 4RW7A 4JV5K 4CECA 5IT9O 4KH4A 5JVGL 4DSIA 2B4JA 1BQNA 2DFEA 2RE2A 1KAYA 2WFBA 3CQYA 3L8BA 5C2DA 1LW0A 2YJEA 5E26A 1IV0A 3MN7A 3SJJA 3ATUA 3ZT4A 2O8DA 1Q7YO 3OVNA 1RT5A 4Z4GA 2E4LA 2BGGA 3QLHA 3VMFB 2F9TA 4CK3A 4CJEA 1IBMK 3CJBA 1L3UA 4DQRA 4C8MA 2YNGA 1DEJA 3AVIA 4JD2B 1B9FA 3ALYA 1NK0A 5GAGP 3S5TA 4ILHA 3HM9A 1XC3A 1YJ9N 5BN8A 5LL6Z 1BCMA 5C24A 5B8HA 4E19A 3HXMA 4KKOA 1I39A 1HYVA 1MWKA 1SL0A 3L6QA 4CHNA 3VQ9A 3CFPA 4H4MA 2YNFA 4YDUA 4JAXA 4G1QA 2XO7A 1UWBA 3T7ZA 5H1SQ 2Q0UA 3NMUA 5CYQA 4ILJA 3AO3A 5KI6A 3T1YK 3ULDA 3OYMA 4DV1K 2DTUA 5F2RA 2G8FA 4ID5A 4JI1K 4XEIA 4EZ6A 2P9PA 4JKDA 2RN2A 1HNZK 4YFUA 2ZJQL 3LDNA 3TU5A 4OGEA 3KJVA 1NOZA 4GV9A 1BIZA 1ZXOA 5LMNK 1VQNN 3AVLA 4DFJA 1K8KB 2AA4A 2X78A 1CXUA 1IKYA 3NCIA 1XUPO 4FVMA 1KD1O 1JLGA 1XI1A 3FZLA 5JS1A 4LF9K 3KHYA 4PQUA 1BA1A 1IH7A 4CZKA 2R7YA 3D2FB 2PYJA 4CJ5A 4OO1J 4KI6A 1HJRA 3LAMA 1LAVA 1KFSA 3IFRA 1YVUA 1R0AA 1KQSM 1L3VA 1S9GA 3KTQA 2RHKA 5HRNA 3WXLA 4CJTA 3ZT1A 1EXQA 4DTPA 1QZ6A 5AZJB 3QEIA 1MU2A 4GKKK 1TKDA 4BG8A 3LP2A 3D7EO 3VA3A 3TSPA 2I5JA 1GLDG 3V81A 4JI2K 4LF8K 3U3YA 3G0ZA 2I7NA 4FWSA 4WYBA 1HQUA 3CCUN 3VEOA 4BGBA 4RW9A 3VQ4A 2OPQA 3VQ8A 1ZBFA 3LM2A 4L8RB 1KVCA 3IRXA 2NRVA 3CJAA 4CGJA 4YDUC 4CGGA 1U6ZA 2QWQA 2PBDA 3HPGA 3HT3A 1M1KO 2P9UB 3AGRA 1RTIA 2QWRA 3R8EA 1NM1A 1HJOA 4K8ZA 4NXNK 4JKGB 3VTHA 2B5JA 3KWIA 1ZBIA 5SWMA 2HHWA 3CYMA 2IGIA 1ESVA 4NYFA 1VSDA 3FR0A 1HQEA 3C6UA 3T1AA 2Z1GA 2A40A 2E2QA 2OPPA 2O8FA 3S3NA 3KLGA 3S9HA 1J5EK 3L2VA 5FLXO 4U7BA 4NCGA 1S72N 4OPHA 4CW7B 3H1QA 2ZJRL 3CCVN 1RT2A 1WSEA 4FJMA 3L4IA 4CJRA 3O3FA 3G4SN 2XHBA 4KRFA 4YOYA 3O3GA 3TR8A 1TV6A 3TAGA 4E1MA 4IG3A 2P9IB 3E1YA 3LANA 4PWDA 3C0BA 2Q0RA 2G8VA 3SLCA 3V9ZA 4BRGA 4CZFA 3T19A 4L3QA 3D6RA 1WAFA 3F5TA 2Z1JA 1NJWA 3ZETB 1GLAG 1ZBUA 1C0TA 4O5BA 1IO2A 1SKRA 4OKKA 1ILYA 3NBPA 3VQQA 4WFAL 1CZBA 3VQ5A 3ZCMA 3CJ7A 2QA4N 2PY5A 1LAWA 4FJ8A 3SZ2A 2AJQA 3ZSWA 1RBVA 1QSYA 4DQQA 1VQ7N 1BGXT 2FF3B 4M3ZA 2CH5A 4DTMA 5AQSA 1BU6O 1GLLO 1BG3A 4FWRA 3WXJA 3AVMA 3DI6A 3SMSA 1DKGD 2F8TA 3AO5A 2QM1A 2ASOA 2OPRA 1IBKK 1NKEA 3TAFA 4FJHA 3VN5A 3VEWA 5ADXA 3THWA 1TYQB 3CCLN 3HSCA 3HM8A 3I8BA 3I0RA 2YJFA 1SQKA 2Z1HA 3E9OA 4IDHA 1JKHA 3AVCA 3LALA 4O8UA 3IS9A 4CJKA 3P31A 3L3VA 3RVCA 1BA0A 4BACA 2V52B 1TUUA 5HBMA 1GLCG 3LAKA 3SYZA 5AJ3K 3ID6A 2XY7A 3I0SA 1Z25A 3L2RA 4DUYK 3V9WA 1SKWA 4DTUA 3OJSA 3LDOA 1XWLA 1G15A 3RR7A 4FJXA 4CF8A 3EKSA 2ZWHA 3WNGA 4AHRA 4M3RA 4YOWA 4ICLA 4QCLA 4WQ4A 1YJNN 4FJIA 3DJCA 4FYDA 5JENA 1ZBSA 3MX2A 3NH1A 3HP9A 4BR7A 4R79A 1OKJA 2P9LA 1NNEA 1S1XA 3RSEB 2KFNA 4YORA 3HSTB 2YHAA 3TI0A 2CGLA 1IG9A 4EP4A 4OPJA 1IKVA 4BEBA 5BPLA 3P5JA 1NK5A 4PY5A 4FZYA 2FBTA 3DLBA 1JLFA 1NGAA 3LZIA 3LDQA 4Q5VA 3CQ8A 3SQ1A 3VF2A 1SL1A 4BWJA 4IJAA 3MEGA 4B9NA 3J8AA 4YNQA 4FW2A 5LJWA 1HYZA 1ATNA 4DHYA 3K57A 3J81O 3H3NO 3PX4A 2G8UA 3LDPA 5BREA 2GUPA 3OY9A 1VSHA 3OYEA 2FSNA 3H3OB 3EZWA 4FWOA 3W0LA 4FJ7A 4PKIA 1HUXA 5FRNA 2JWKA 3OYAA 2KFZA 4AHCA 1GLBG 3HOTA 2HNZA 4M41A 1P90A 3VETA 2E8AA 5BR9A 4ZTJA 1D9FA 1JL2A 3THXA 3ISNC 3LZJA 4FLZA 2VGMA 1Q8IA 3M8PA 2V7YA 1JLQA 3OS2A 4K25A 1T6DA 4C8KA 1OH5A 2O4IA 2P9KA 4JK9A 3U3GA 1SS6A 4PL7A 4DQ8A 5DMRA 4WQ5A 1Y64A 4F3TA 3NH2A 2Q2RA 3CXCM 1T3VA 3CERA 3HO1A 3AVKA 4CJUA 2OA8A 1QZ5A 2W41A 4KTZA 1KC8O 3WXIA 3QIOA 3OYGA 4I6MB 2W42A 1VAZA 2DFFA 1REVA 4BDZA 4DWIA 3GG4A 4DS4A 4V19S 2QKBA 2QWOA 3BY5A 4FZZA 3I8DA 4F8RA 4JLHA 3Q7CA 1LW2A 3V9UA 1YTAA 2O8BA 1EX4A 5J2PA 1XHZA 3VQDA 3PX0A 4OKJA 4JHDA 2JGUA 3TTDA 4IXCA 3KZBA 1IKWA 2Z1IA 4JNEA 3TAPA 2W40A 3QEPA 2P5GA 3VENA 4A57A 5SZTA 1RDUA 3ZSXA 1NGHA 4FJLA 5LMUK 3J7YP 3TAMA 4NYNA 1YT3A 5KPZA 4HTUA 3J7AP 4CGHA 4H8KA 1YVNA 1C0GA 3CCQN 4K8XA 3ENHA 1OH6A 4YY3K 3D2EA 3DLKA 4KHNA 3OYIA 2BUPA 3EEQA 3LWMA 3DXKA 4GW6A 1HNIA 4FJ5A 1TKXA 3ZYYX 4DR1K 3F73A 5C15A 4QS8A 3CFRA 1RT1A 2OANA 3S3OA 3SK3A 3K5MA 1HPZA 4W5TA 4DFMA 4Y1CA 1NU0A 1NGCA 4DSLA 3K9JA 3O9SA 2F96A 3O80A 3P1GA 5AQQA 3QNNA 2WC9A 2QWNA 3B6OA 4KREA 3HVTA 5AZIB 4XIUA 3QBXA 2O4GA 2YHYA 1C0UA 3JYTA 3K58A 1NG9A 4H5RA 3NVMA 2GV9A 3DOKA 4WQ5C 3HPOA 4B8AB 2BH1A 3RMCA 4H4OA 4BR5A 4CK1A 4JN4A 3R3LA 3KKRA 5BPMA 4BVPA 4DMNA 2HF4A 4I2PA 1QQCA 3O9QA 1E4FT 4ISGA 2CGKA 2HBKA 2FF6A 4CI6A 1XNRK 3ZEUB 3T69A 2VWJA 4M63C 2D1KA 1U2VA 4I9QA 4C1NI 1OH8A 4BQZA 1BIUA 3MXIA 4JS5A 4CHOA 4IEIA 4CEBA 4CZHA 2XY6A 2QXLA 3G6EN 1ZBHA 1P8ZA 3HL8A 3VEXA 1JJ2M 1EWQA 4CZGA 4E3SA 5HOOA 1VQPN 1L5UA 4CJWA 4M3TA 3CQXA 1U48A 3AA4A 1RBRA 3DM2A 4AHUA 2BTFA 3UE5A 2X6SA 3ZSRA 3T1HK 2QXFA 1D9DA 1TAQA 4CEQA 4H03B 4M3UA 4RW8A 3DLLL 3NFAA 4IFYA 2IVPA 2YNHA 1W7AA 1HKCA 2NNWA 4FWPA 4LF5K 4CZEA 5C10A 1NLVA 3RMBA 4JK7A 1TUYA 4GVMA 4BRHA 4JD2A 3SJHA 1ITGA 3ASMA 1HLUA 1Q81O 4CD3A 1WBDA 2A1SA 2HSTA 3SUNA 2P9SA 1WB9A 1XC9A 4E0DA 1RNHA 3AO4A 3CMAN 5AFUA 3ZSVA 1T7PA 2GEMA 3RRGA 4C23A 2G8HA 2XY8A 3OYNA 3TANA 3S3MA 4O8KA 4YHHK 4RWTA 2UUBK 3A2FA 5M1KA 3CC2N 3LDSA 1VSEA 1KFDA 1BOTO 2O8DB 5M1FA 4IO8A 3HBTA 5AQMA 1RT7A 5LJVA 3NF6A 3DXMB 4RW6A 5F1XA 4CD1A 4F2SA 1KLNA 3CFOA 1MA9B 1JCFA 4MO4A 5AQFA 4W5OA 3H45C 1SV5A 4DCHA 4DFPA 1YI2N 4DSEA 1DT9A 4MDAA 5AQRA 5J1EA 4KFBA 4B08A 1NK9A 5FDLA 2OYQA 1VRUA 2FXUA 1LOTB 4FPBA 1VQLN 1RDBA 3QERA 1Z6RA 2F7TA 2W6LA 4OPAA 3M8SA 4CFBA 1YTUA 3LPTA 4NLCA 4DF4A 1GOCA 1QQNA 4IKFA 1RT3A 3DWLA 4CVNE 3BF3A 4DTXA 3QEVA 1QVFM 1HPMA 3AAQA 3V1QA 3GDQA 4GKJK 5ADXH 4CGDA 3SNNA 4DR7K 1QSSA 3HP6A 1VSKA 3OTOK 5KRTA 1C1BA 3QFUA 1Q9YA 3H6EA 4BDYA 4FW1A 4CCHA 3CHWA 4JEPA 4PL8A 2QWPA 4DTOA 1N8RO 5AQXA 5AQKA 2KQ2A 1VSJA 3IAYA 4CZMA 2V51B 1RT6A 3KKSA 2DPNA 5AZJA 2GBZA 2NZTA 5DK5A 5GINA 1E3MA 4FM2A 4AHSA 3FLCO 2A3ZA 5A2QO 4FLWA 4HTLA 3Q7BA 3VF6A 1VQ8N 5GAEP 1QVGM 4J2BA 2ETJA 3G25A 4R5PA 1BISA 1N32K 4BE7B 1YF5L 1I3AA 4W5QA 2UXBK 3VEZA 2AP1A 3MMVA 4O0JA 3OYFA 1JXBA 4KTWA 3TSUA 3AA5X 4B9MA 1N6QA 4QAGA 5AQJA 2P9UA 3MWPA 4DV0K 4IJNA 1NJYA 4LFAK 3OYDA 4KHYA 4BDPA 4NXMK 1TVRA 1ZYQA 4CJVA 3AVNA 3AVGA 4IFEA 3TAEA 4CJLA 2A42A 1J53A 4JRPA 3K5OA 1GLFO 4DSKA 1SAZA 4CBUA 1RDAA 1YAGA 4CEZA 4C8NA 1NK4A 1RILA 4FOIA 4H5NA 2GUIA 3OYHA 3MN5A 3C94A 3C65A 3MEDA 1KLMA 4BRKA 4DTNA 3VQEA 1IKXA 4DSJA 1T05A 3JAMO 4WE1A 5F0XA 3HPHA 4CF0A 2QI2A 2P9IA 4CJPA 4AF1A 4CIEA 1CZ9A 4BQLA 4DV5K 3T3FA 4DU4A 1RTHA 1UA0A 3U6FA 5T7BA 3O1WA 1T03A 3QDKA 3UB5A 1QTMA 4AM7A 3L4QA 4C8OA 2VG5A 5AQGA 5BRDA 1BDGA 5AQNA 4FM0A 3WUHA 4DF8A 2XY5A 2Q31A 3DMJA 2ASMA 2P1JA 3QEXA 4GNIA 4DKWA 2E88A 4O55A 2A6AA 3FGUA 3WNHA 1NMDA 1KSPA 3O9UA 3NF8A 3EZ5A 5HRSA 3ZSYA 3K2PA 2P51A 4DUZK 1J9AA 3C6AA 3HI0A 4Z94A 1J5OA 5FPDA 1EKEA 3AVAA 4MDBA 4FZXC 1GLJO 3O4NA 1RGIA 2H3GX 5EX5A 1A5VA 1YIJN 4PA1A 1HNVA 1SUQA 3P83D 3UKRA 4DG1A 1YITN 4KB1A 4CBWA 2HMIA 4DB3A 4A5BA 3U8XA 4EAHD 3R1XA 1XQSC 1K8AO 3NHGA 3CIPA 4CEDA 3KLHA 4F3OA 4KTQA 4DLEA 1FKPA 3L2QA 1NBWA 3AY9A 2ZJPL 3M6GA 3A5NC 4RTFD 4CFAA 5GADP 1EO1A 4JI4K 4EP5A 1W97L 4X62K 4F9OA 3SUQA 3SQ0A 5IWAK 1KTQA 3RTVA 1NGBA 4CJFA 5CZ2A 3VTIA 3SQ2A 3GL1A 5AQOA 4BRMA 3DOLA 1MWMA 3OYKA 4BE1A 4CHYA 1TK8A 2ZF5O 3FE1A 3OBWA 3MAQA 4N41A 1B9DA 1I94K 4PKHA 3E9LA 4IFVA 3J80O 1S1TA 4KHQA 3HK2A 4A2BA 2VGNA 3RSEA 1FJGK 3HJFA 2FBXA 4K0KK 4FJ9A 3TTFA 4Y0WA 3THWB 3QEWA 3PIOL 2KZMA 3CI5A 3EE8A 1KAXA 1HX1A 4OJRA 2CH6A 1B92A 3CCEN 4F2RA 4IBNA 3PLAA 3PUFA 3ZSQA 5JLFA 4KH5A 3O3HA 3I55N 1HR0K 2O8CB 4PHTX 1T6CA 1LCUA 3AARA 4CZJA 1NGEA 2YX6A 3MK6A 5GAHP 3MN6A 4A61A 2YHBA 4E1JA 2C1GA 3ZT2A 3VQBA 4IO9L 4KPYA 4XH5A 3EY1A 3OYCA 4FWQA 5BRFA 3VF4A 3O4WA 4HHTA 3V9SA 1J6ZA 2EWSA 2LSNA 5BRHA 2UXCK 3CM5A 2I7PA 2HVHA 2QKKA 4HUEA 3CG7A 2P9LB 3S41A 2ITGA 5J2NA 5AQPA 2P9NB 3SUOA 3SBGA 5C0YA 5AQWA 3H46O 3QETA 2BE2A 4F4KA 4FJJA 3NGZA 4Z4CA 4O4GA 4W5NA 2G8IA 3A0IX 3JSMA 5M1PA 3CETA 5GIOA 4YOUA 1U04A 1LV5A 3W3DA 4EZ9A 5EXWA 2QW9A 4M3YA 5LY3A 2NUBA 4FK0A 1RFQA 4O0IA 1BI4A 4DTSA 5HRRA 1RBUA 4MLEA 3CCMN 4C8LA 3VQCA 3WQTA 4I6MA 1Y97A 1VQ9N 1N33K 4BR9A 1WSFA 5BPNA 4FK2A 4DR2K 5AQIA 1X9MA 2HBMA 2Q36A 3TSQA 1TL3A 4BR4A 4LFBK 3THYA 2HHUA 3CC7N 5E41A 3NF7A 1BO5O 2BANA 1XNQK 2XRIA 4NO7A 4WQ4C 3OS0A 1X9SA 3WXMB 3UKUB 4YOXA 4H0OA 4LSLA 3L0QA 4BG9A 4CJQA 4IZ9A 5MLCQ 2HB5A 3CM6A 3O1BA 3EE9A 1YJWN 1NKBA 4B3OA 2GX9A 3AO1A 4ELUA 3CJ9A 3OJUA 4KHWA 5AFUH 4X66K 4DFKA 4Z4HA 5JLHA 4CEOA 2DFHA 1X9WA 1E4GT 1NGIA 2UYTA 4AHTA 4M7YA 2NLXA 4KH6A 3V1OA 2Q1NA 4JKFA 3GE1A 5J2QA 4DV6K 1S6PA
chains in the Genus database with same CATH topology
3LM2A 4GVEA 3WEEA 1Q81O 1K73O 3ULEB 4CD3A 2OTJN 4LC9B 2NRVA 3CJAA 1JCEA 2HSTA 2P9SA 4YDUC 4EHTA 1NGGA 1U6ZA 3AGKA 3FZMA 3MDQA 4K43A 2QWQA 2PBDA 4O5FA 3CMAN 5AFUA 1M1KO 2GELA 2P9UB 2VWBA 2GEMA 3AGRA 4A5AA 3QBWA 2J4RA 2QWRA 3U4LA 3R8EA 1NM1A 4JHDB 1HJOA 4C23A 3O8MA 4GV3A 4ISFA 3CCRN 4O8KA 4JKGB 3VTHA 2NRRA 2WUSA 4RWTA 3KWIA 3QMLA 4K42A 2CGJA 3VERA 1RDWX 5M1KA 5AQYA 4H5WA 3CC2N 4IOXA 2HOEA 2P9NA 1ESVA 3FR0A 1VQON 1BOTO 4BC2A 3TPQA 2YCHA 5M1FA 2QWLA 4IO8A 4WFNL 3HBTA 4FWNA 5AQZA 3ZX0A 2A40A 2E2QA 5AQMA 5LJVA 3DXMB 5F1XA 3JXUA 4CD1A 2YHXA 4JKBA 3QB0A 3ZX3A 4BC3A 3OHRA 4U7BA 4JKEA 1VQMN 1MA9B 1JCFA 1S72N 4OPHA 4MO4A 5AQFA 3GOIA 2FSKA 3D2EB 3H1QA 2KHOA 3H45C 4DCHA 2ZJRL 3CCVN 1YI2N 4JKCA 1DT9A 4C1NK 4MDAA 2V7ZA 3L4IA 5AQRA 3TTCA 3VEVA 3G4SN 3U9DA 1ATSA 2E1ZA 2FLOA 3IDHA 4FOEA 4YOYA 2FXUA 5AQHA 2A41A 1LOTB 1S3XA 4FPBA 1VQLN 1H1VA 3EL2A 1Z6RA 2P9IB 3E1YA 3SAHA 3BP8A 1SZ2A 3C0BA 2F7TA 2Q0RA 3WT0A 4OPAA 3SLCA 1JCGA 2E1YA 4BRGA 4GY2B 4CZFA 2KKZA 4NLCA 3EO3A 2NRTA 4L3QA 3D6RA 3F5TA 1QQNA 3DWLA 2YI1A 3SBTA 5CHIA 3BF3A 3ZETB 1GLAG 1BUPA 1HPMA 1NWKA 4U67L 1QVFM 3AAQA 3C7NB 2HMPA 3FZHA 3GDQA 1VQ6N 4IOAL 5GIPA 3O08A 5ADXH 1Z05A 1ILYA 2VCPA 3N4QA 3OBYA 4WFAL 3QFPA 3R9PA 3UKUA 5TKWA 3CJ7A 3QFUA 2QA4N 3H6EA 1NGDA 3CHWA 4JEPA 4K41A 4PL8A 2QWPA 1N8RO 3MCPA 5AQKA 2NRXA 5AQXA 2JWLA 1K9MO 1VQ7N 2FF3B 4CZMA 2V51B 3WQUA 2CH5A 4IOCL 1QQOA 5AQTA 5AQSA 1BU6O 2DPNA 1GLLO 1BG3A 3LL3A 4FWRA 5AZJA 2NZTA 3CCJN 1BWFO 3WXJA 5GINA 3NVKA 3O9RA 2E20A 3SMSA 1ZC6A 5CR4A 1DKGD 5EOYA 2QM1A 3KWGA 2ASOA 5AQUA 2GWJA 1VQ4N 1ATRA 3OW2M 2IVOA 3FLCO 2A3ZA 3OA9A 3VEWA 5ADXA 3CCLN 1TYQB 4HTLA 3HSCA 1VQ5N 1O13A 3HM8A 3Q7BA 1QHAA 3I8BA 3M3ZA 4BGAA 2YJFA 1SQKA 3E9OA 1Q18A 5M1OA 3HTVA 3VF6A 5GAEP 2P9KB 4IDHA 5KPTA 4H5VA 5KQDA 3IKMA 1QVGM 1V4SA 3G25A 3LM9A 4H0TB 5AR0A 1W2BM 1G99A 5BN9A 1YHQN 4FO0A 4BE7B 1YF5L 4O8UA 4HWIA 4H0YB 3P31A 3ULEA 3RVCA 3VEZA 1U2VB 2AP1A 1BA0A 3P4IA 3MMVA 3TSUA 3M5RA 5I9EB 4IWVA 2V52B 1TUUA 4CZLA 1GLCG 5AQJA 2P9UA 3M1FA 3MWPA 3ID6A 4IJNA 3ZX2A 5DM7L 2NRZA 3CJCA 1HKGA 1M90O 1OVYA 1IJJA 4MLHA 3WXKA 3MWTA 2ZGZA 3LDOA 4CZIA 3EKSA 2ZWHA 3J7ZO 1GLEG 3F9MA 3ID8A 4YOWA 4BRFA 4IFEA 4WQ4A 1YJNN 4EIAA 4BC5A 3DJCA 2A42A 1ZBSA 3MX2A 4JKHA 1GLFO 2PAVA 2Q97A 1SAZA 3DXMA 1YAGA 3VPZA 4BR7A 4CBUA 5AZIA 4R79A 5JMVA 2D4WA 1OKJA 4FOIA 4H5NA 2P9LA 3HRGA 3RSEB 4JKAA 4A59A 4BROA 5HL7L 4YORA 3MN5A 3G71N 2NRHA 3C65A 3CJ1A 4B1YB 4WF9L 4FL9A 4BREA 2CGLA 2FSJA 1YXQA 4FWMA 4BRKA 4ILGB 1R59O 3FZFA 3MX5A 3O6WA 3QICA 3SMPA 2F9WA 4CBXA 4M7XA 4B9QA 5F0XA 4BRAA 4BEBA 4B1UB 5BPLA 4FSVA 2QI2A 3WEEB 2QEXN 2P9IA 2E2OA 4AF1A 4IEEA 2VYPA 3CPEA 2P9SB 2ZGYA 4BQLA 1NGAA 3IMXA 4B1XB 4A62A 1K8KA 5FPNA 1C0FA 3LDQA 3O1WA 3QDKA 3UB5A 3DXKB 4ISEA 3VGKA 3VF2A 4AM7A 3I33A 3L4QA 4H0PA 2PFUA 3C7NA 4IJAA 3SAGA 2C1IA 5AQGA 5BRDA 3J8AA 1BDGA 5AQNA 4BRNA 3BUZB 3WUHA 3ZEUA 5LJWA 1ATNA 2ASPA 2ITMA 3IUCA 4DHYA 4B1WB 3H3NO 2Q31A 1NJIO 2W00A 3LDPA 3A5MC 5JVHL 4BRPA 5M1NA 5BREA 2GUPA 3D2FA 5AQVA 3VEYA 2ASMA 2FSNA 4BR2A 3H3OB 3C6HA 4GNIA 3EZWA 4FWOA 4DKWA 2E88A 3W0LA 4BY9C 2NRWA 4PKIA 1HUXA 2A6AA 2JWKA 1EQYA 3ATVA 3VGMA 4BRQA 2D0OA 3FGUA 1GLBG 3KK7A 3HOTA 1NMDA 1D4XA 4BECA 1P90A 5TKYA 3O9UA 3VETA 2E8AA 4BRLA 5BR9A 2YHWA 3HZ6A 3CD6N 3KVGA 4BRDA 1X9JA 3C6AA 3HI0A 4Z94A 3FZKA 2VGMA 3H1VX 3JS6A 5FPDA 1IG8A 4MDBA 2V7YA 1S22A 1Q86O 4K25A 1GLJO 1T6DA 3CC4N 1NGJA 1MDUB 1WUAA 1RGIA 2H3GX 2P9PB 3LDLA 5EX5A 1YIJN 4UY8O 2P9KA 1NGFA 4JK9A 1SS6A 3P38A 4PL7A 4DQ8A 5ELZA 3UKRA 1YITN 1KAZA 4WQ5A 1Y64A 4CBWA 4A2AA 3CF5L 3DAWA 4DB3A 4A5BA 3U8XA 4EAHD 2Q2RA 3R1XA 3CXCM 1T3VA 3CERA 1XQSC 1K8AO 3A5OC 4BC4A 3CIPA 1QZ5A 2W41A 4FWLA 1NBWA 4H0XB 3AY9A 4WFBL 3WXIA 1KC8O 2ZJPL 4YOVA 3M6GA 3A5NC 3E66A 4I6MB 4RTFD 3PIPL 5GADP 4XJXA 1VAZA 3BEXA 4QS7A 4H0VB 2GWKA 5C12A 4XH4A 2HBLA 5KPRA 1EO1A 1W97L 3GG4A 2HBJA 3K9KA 4F9OA 5CE3A 4YOTA 1NGBA 2HF3A 3HOSA 2QWOA 4QS9A 1V4TA 3VTIA 4WCEL 1Q82O 3GL1A 5AQOA 4B1ZA 3CPWM 4BRMA 4AM6A 2E2PA 2IIRA 1MWMA 3Q7CA 1YUWA 3ENBA 3O5BA 2ZF5O 3FE1A 4BRCA 3OBWA 4JHDA 3TTDA 3VGLA 4IXCA 4PKHA 3CMEN 3E9LA 3F2KA 3GBTA 1HKBA 2E2NA 3KZBA 4JKGA 4JNEA 4KH4A 2A5XA 5JVGL 2W40A 4A2BA 2VGNA 4J8FA 2RE2A 3VENA 3RSEA 1KAYA 2QTDA 4A57A 2WFBA 3CQYA 5C2DA 4BR0A 2YJEA 4H5TA 4Y0WA 3MN7A 5E26A 3TTFA 3ATUA 4FVUA 1RDUA 3I56N 1Q7YO 2WBNA 1NGHA 3A5LC 4FPAA 4MO5A 5KQ8A 3MCAB 3PIOL 3EKUA 5KPZA 3CI5A 3EE8A 1KAXA 1HX1A 4PKGA 2CH6A 3VMFB 3CCEN 1YVNA 1C0GA 2F9TA 3CCQN 3PLAA 2D0PA 3AAPA 3ENHA 5JLFA 4KH5A 5FPEA 3D2EA 3CJBA 1DEJA 4BRIA 3VOVA 2BUPA 3I55N 4JD2B 3DXKA 4PHTX 1LCUA 1T6CA 2IVNA 4EFHA 5GAGP 3AARA 4CZJA 3ZYYX 1NGEA 4ILHA 2YX6A 1XC3A 3A8YA 3MK6A 3MN6A 4QS8A 4A61A 4E1JA 5C15A 5GAHP 1YJ9N 2OANA 2C1GA 5BN8A 4NB4A 5B8HA 3SK3A 4B1VA 4IO9L 4XH5A 1DGKN 1MWKA 5E84A 5JICA 3L6QA 4FWQA 1VQKN 5BRFA 1NGCA 4YDUA 3VF4A 3K9JA 3O9SA 3O80A 3O4WA 5AQQA 3ZETA 4JAXA 1J6ZA 2EWSA 5BRHA 3SAFA 2WC9A 2QWNA 3T7ZA 5H1SQ 2I7PA 5EVZA 5AZIB 2Q0UA 3NMUA 2QWMA 3QBXA 1X3MA 4ILJA 2P9LB 3S41A 2YHYA 5AQPA 2P9NB 3E9PA 3SBGA 4H5RA 3NVMA 5F2RA 4WQ5C 5C0YA 5AQWA 3H46O 2BH1A 4XEIA 3A0IX 2P9PA 4BR5A 4JKDA 5M1PA 3MN9A 4JN4A 1QQMA 3R3LA 3CETA 5GIOA 4YOUA 2ZJQL 3W3DA 3EN9A 3LDNA 3TU5A 5BPMA 5C2FA 4BVPA 2HF4A 4GV9A 4JK8A 2GTDA 5EXWA 2QW9A 5LY3A 1ZXOA 1VQNN 3O9QA 1RFQA 1TYQA 1E4FT 1K8KB 4ISGA 2AA4A 4MLEA 3CCMN 2CGKA 3CCSN 3WQTA 2HBKA 4KBOA 1XUPO 4I6MA 3B8AX 1VQ9N 3ENOA 2FF6A 5DM6L 3BF1A 1KD1O 4CI6A 4BR9A 3FZLA 5BPNA 3ZEUB 3T69A 4M63C 3KHYA 5AQIA 2D1KA 2HBMA 1BA1A 1U2VA 4BVOA 4CZKA 2Q36A 3TSQA 3D2FB 4C1NI 4BR4A 4BQZA 3O9TA 1CZAN 3CC7N 5M1QA 1VQ8N 4EHUA 4OO1J 1BO5O 1X3NA 4IEIA 4CZHA 2QXLA 1WOQA 1KXPA 4CJ7A 1P8ZA 3G6EN 3VEXA 3U9ZA 1JJ2M 4CZGA 3IFRA 5HOOA 4NO7A 4WQ4C 1VQPN 1KQSM 3P39A 4XH1A 3UKUB 3WXMB 4GV6A 4YOXA 3CQXA 3FFKB 4H0OA 4G9ZA 5AQLA 3L0QA 4BG9A 2RHKA 3VESA 4IZ9A 5MLCQ 3WXLA 2BTFA 3UE5A 3O1BA 3EE9A 1YJWN 4RCHA 2KLAA 4H03B 1QZ6A 3UKRB 5AZJB 2GX9A 3DLLL 3CJ9A 4BG8A 5AFUH 3D7EO 4FWKA 5JLHA 3TSPA 2IVPA 3N4PA 1E4GT 1HKCA 2NNWA 1NGIA 4FWPA 2UYTA 1GLDG 2NLXA 4KH6A 4M7YA 4CZEA 5C10A 1NLVA 2I7NA 4FWSA 4WYBA 4JK7A 1TUYA 3CCUN 4BRHA 2Q1NA 4JD2A 3R6MA 4JKFA 5FPMA 5EY4A 1T44A 3SJHA 3VEOA 3GE1A 4BGBA 1HLUA 2OTLN 4NLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LM2 A;  3WEE A;  3ULE B;  4CD3 A;  4LC9 B;  3CJA A;  1JCE A;  4YDU C;  2P9S A;  4EHT A;  1NGG A;  1U6Z A;  3FZM A;  3MDQ A;  4K43 A;  2QWQ A;  2PBD A;  4O5F A;  5AFU A;  2GEL A;  2P9U B;  2VWB A;  2GEM A;  3QBW A;  2J4R A;  2QWR A;  3U4L A;  3R8E A;  1NM1 A;  4JHD B;  1HJO A;  4C23 A;  3O8M A;  4ISF A;  4O8K A;  4RWT A;  2WUS A;  3QML A;  4K42 A;  2CGJ A;  3VER A;  1RDW X;  5AQY A;  4H5W A;  2HOE A;  2P9N A;  1ESV A;  3FR0 A;  1BOT O;  4BC2 A;  3TPQ A;  2YCH A;  2QWL A;  4IO8 A;  3HBT A;  4FWN A;  5AQZ A;  3ZX0 A;  2A40 A;  2E2Q A;  5AQM A;  5LJV A;  3DXM B;  5F1X A;  3JXU A;  4CD1 A;  2YHX A;  3QB0 A;  3ZX3 A;  4BC3 A;  3OHR A;  1MA9 B;  1JCF A;  4MO4 A;  5AQF A;  3GOI A;  2FSK A;  3D2E B;  3H1Q A;  2KHO A;  3H45 C;  4DCH A;  2V7Z A;  3L4I A;  5AQR A;  3VEV A;  3U9D A;  1ATS A;  2E1Z A;  2FLO A;  3IDH A;  4FOE A;  2FXU A;  5AQH A;  2A41 A;  1LOT B;  1S3X A;  4FPB A;  1H1V A;  3EL2 A;  1Z6R A;  2P9I B;  3BP8 A;  1SZ2 A;  3C0B A;  2Q0R A;  3WT0 A;  3SLC A;  1JCG A;  2E1Y A;  4BRG A;  4GY2 B;  4CZF A;  3EO3 A;  4L3Q A;  1QQN A;  3DWL A;  2YI1 A;  3BF3 A;  3ZET B;  1GLA G;  1BUP A;  1HPM A;  1NWK A;  3AAQ A;  3C7N B;  2HMP A;  3FZH A;  3GDQ A;  3O08 A;  5ADX H;  1Z05 A;  2VCP A;  3QFP A;  3R9P A;  3UKU A;  3CJ7 A;  3QFU A;  3H6E A;  1NGD A;  3CHW A;  4K41 A;  4PL8 A;  2QWP A;  3MCP A;  5AQK A;  5AQX A;  2FF3 B;  4CZM A;  2V51 B;  3WQU A;  2CH5 A;  1QQO A;  5AQT A;  5AQS A;  1BU6 O;  2DPN A;  1GLL O;  1BG3 A;  3LL3 A;  4FWR A;  5AZJ A;  2NZT A;  1BWF O;  3WXJ A;  2E20 A;  3SMS A;  1ZC6 A;  1DKG D;  5EOY A;  2QM1 A;  2ASO A;  5AQU A;  2GWJ A;  1ATR A;  2IVO A;  3FLC O;  2A3Z A;  3VEW A;  5ADX A;  1TYQ B;  4HTL A;  3HSC A;  3HM8 A;  1QHA A;  3I8B A;  3M3Z A;  4BGA A;  2YJF A;  1SQK A;  3VF6 A;  1Q18 A;  5KPT A;  3HTV A;  5KQD A;  2P9K B;  4H5V A;  1V4S A;  3G25 A;  3LM9 A;  4H0T B;  5AR0 A;  1G99 A;  5BN9 A;  4FO0 A;  4HWI A;  4H0Y B;  3ULE A;  3VEZ A;  1U2V B;  2AP1 A;  1BA0 A;  3P4I A;  3MMV A;  5I9E B;  4IWV A;  2V52 B;  1TUU A;  4CZL A;  1GLC G;  5AQJ A;  2P9U A;  3M1F A;  4IJN A;  3ZX2 A;  3CJC A;  1HKG A;  1IJJ A;  4MLH A;  3WXK A;  2ZGZ A;  3LDO A;  4CZI A;  3EKS A;  2ZWH A;  1GLE G;  3F9M A;  3ID8 A;  4BRF A;  4WQ4 A;  4EIA A;  4BC5 A;  3DJC A;  2A42 A;  1ZBS A;  1GLF O;  2PAV A;  2Q97 A;  1SAZ A;  3DXM A;  1YAG A;  3VPZ A;  4BR7 A;  4CBU A;  5AZI A;  5JMV A;  2D4W A;  1OKJ A;  4FOI A;  4H5N A;  2P9L A;  3RSE B;  4BRO A;  3MN5 A;  2NRH A;  3CJ1 A;  4B1Y B;  4FL9 A;  4BRE A;  2CGL A;  2FSJ A;  1YXQ A;  4FWM A;  4BRK A;  1R59 O;  3FZF A;  3O6W A;  3QIC A;  3SMP A;  2F9W A;  4CBX A;  4M7X A;  4B9Q A;  5F0X A;  4BRA A;  4B1U B;  5BPL A;  4FSV A;  3WEE B;  2P9I A;  2E2O A;  2VYP A;  2P9S B;  2ZGY A;  4BQL A;  1NGA A;  3IMX A;  4B1X B;  4A62 A;  1K8K A;  5FPN A;  1C0F A;  3LDQ A;  3O1W A;  3QDK A;  3UB5 A;  3DXK B;  4ISE A;  3VGK A;  3VF2 A;  4AM7 A;  3I33 A;  4H0P A;  3C7N A;  4IJA A;  5AQG A;  5BRD A;  3J8A A;  1BDG A;  5AQN A;  4BRN A;  3BUZ B;  3WUH A;  3ZEU A;  5LJW A;  1ATN A;  2ASP A;  2ITM A;  3IUC A;  4DHY A;  4B1W B;  3H3N O;  2Q31 A;  3LDP A;  3A5M C;  4BRP A;  5BRE A;  2GUP A;  3D2F A;  5AQV A;  3VEY A;  2ASM A;  2FSN A;  4BR2 A;  3H3O B;  4GNI A;  3EZW A;  4FWO A;  2E88 A;  3W0L A;  4PKI A;  1HUX A;  2A6A A;  1EQY A;  3ATV A;  3VGM A;  4BRQ A;  2D0O A;  3FGU A;  1GLB G;  1NMD A;  1D4X A;  5TKY A;  3VET A;  2E8A A;  4BRL A;  5BR9 A;  2YHW A;  3HZ6 A;  3KVG A;  4BRD A;  1X9J A;  3HI0 A;  4Z94 A;  3FZK A;  3JS6 A;  3H1V X;  5FPD A;  1IG8 A;  2V7Y A;  1S22 A;  4K25 A;  1GLJ O;  1T6D A;  1NGJ A;  1MDU B;  1WUA A;  1RGI A;  2H3G X;  2P9P B;  3LDL A;  5EX5 A;  2P9K A;  1NGF A;  4PL7 A;  4DQ8 A;  5ELZ A;  3UKR A;  1KAZ A;  4WQ5 A;  1Y64 A;  4CBW A;  4A2A A;  3DAW A;  4DB3 A;  3U8X A;  4EAH D;  2Q2R A;  3CER A;  1XQS C;  3A5O C;  4BC4 A;  3CIP A;  1QZ5 A;  2W41 A;  4FWL A;  1NBW A;  4H0X B;  3AY9 A;  3WXI A;  3M6G A;  3A5N C;  4I6M B;  4RTF D;  3BEX A;  4QS7 A;  4H0V B;  2GWK A;  4XH4 A;  5KPR A;  3GG4 A;  4F9O A;  5CE3 A;  1NGB A;  2HF3 A;  2QWO A;  4QS9 A;  1V4T A;  3GL1 A;  5AQO A;  4B1Z A;  4BRM A;  4AM6 A;  2E2P A;  2IIR A;  1MWM A;  1YUW A;  3O5B A;  2ZF5 O;  3FE1 A;  4BRC A;  4JHD A;  3VGL A;  4IXC A;  4PKH A;  3GBT A;  1HKB A;  2E2N A;  3KZB A;  4JNE A;  2A5X A;  2W40 A;  4A2B A;  4J8F A;  3VEN A;  3RSE A;  1KAY A;  3CQY A;  4BR0 A;  2YJE A;  4H5T A;  4Y0W A;  3MN7 A;  5E26 A;  3ATU A;  1NGH A;  3A5L C;  4FPA A;  4MO5 A;  5KQ8 A;  3EKU A;  5KPZ A;  3CI5 A;  1KAX A;  1HX1 A;  4PKG A;  2CH6 A;  1YVN A;  1C0G A;  2F9T A;  2D0P A;  3AAP A;  3ENH A;  5JLF A;  5FPE A;  3D2E A;  3CJB A;  1DEJ A;  4BRI A;  3VOV A;  2BUP A;  4JD2 B;  3DXK A;  1LCU A;  1T6C A;  2IVN A;  4EFH A;  3AAR A;  4CZJ A;  1NGE A;  3MK6 A;  1XC3 A;  3A8Y A;  3MN6 A;  4QS8 A;  4A61 A;  4E1J A;  2OAN A;  5BN8 A;  4NB4 A;  5B8H A;  3SK3 A;  4B1V A;  4XH5 A;  1DGK N;  1MWK A;  5E84 A;  5JIC A;  3L6Q A;  4FWQ A;  5BRF A;  1NGC A;  4YDU A;  3VF4 A;  3ZET A;  3O80 A;  3O4W A;  5AQQ A;  4JAX A;  1J6Z A;  2EWS A;  5BRH A;  2QWN A;  2I7P A;  5EVZ A;  5AZI B;  2Q0U A;  2QWM A;  3QBX A;  1X3M A;  2P9L B;  3S41 A;  2YHY A;  5AQP A;  2P9N B;  4H5R A;  5F2R A;  4WQ5 C;  5AQW A;  3H46 O;  4XEI A;  3A0I X;  2P9P A;  4BR5 A;  3MN9 A;  4JN4 A;  1QQM A;  3CET A;  3W3D A;  3EN9 A;  3LDN A;  3TU5 A;  5BPM A;  4BVP A;  2HF4 A;  2GTD A;  5EXW A;  2QW9 A;  5LY3 A;  1ZXO A;  1RFQ A;  1TYQ A;  1E4F T;  1K8K B;  4ISG A;  2AA4 A;  4MLE A;  2CGK A;  3WQT A;  4KBO A;  1XUP O;  4I6M A;  3B8A X;  3ENO A;  2FF6 A;  3BF1 A;  4CI6 A;  4BR9 A;  3FZL A;  5BPN A;  3ZEU B;  4M63 C;  3KHY A;  5AQI A;  2D1K A;  4BVO A;  1BA1 A;  1U2V A;  4CZK A;  2Q36 A;  3D2F B;  4BR4 A;  4BQZ A;  1CZA N;  4EHU A;  1BO5 O;  1X3N A;  4CZH A;  2QXL A;  1WOQ A;  1KXP A;  4CJ7 A;  1P8Z A;  3VEX A;  3U9Z A;  4CZG A;  3IFR A;  4NO7 A;  4WQ4 C;  4XH1 A;  3UKU B;  3CQX A;  3FFK B;  4H0O A;  5AQL A;  3L0Q A;  4BG9 A;  3VES A;  4IZ9 A;  3WXL A;  2BTF A;  3UE5 A;  3O1B A;  4RCH A;  4H03 B;  1QZ6 A;  3UKR B;  5AZJ B;  3CJ9 A;  4BG8 A;  5AFU H;  3D7E O;  4FWK A;  5JLH A;  2IVP A;  1E4G T;  1HKC A;  1NGI A;  4FWP A;  2UYT A;  1GLD G;  2NLX A;  4M7Y A;  4CZE A;  1NLV A;  2I7N A;  4FWS A;  4WYB A;  1TUY A;  4BRH A;  2Q1N A;  4JD2 A;  3R6M A;  5FPM A;  3SJH A;  5EY4 A;  1T44 A;  3VEO A;  3GE1 A;  4BGB A;  1HLU A; 
#chains in the Genus database with same CATH topology
 4GVE A;  4LSN A;  3WEE A;  1K73 O;  3ULE B;  3PO4 A;  2OTJ N;  4LC9 B;  2KZZ A;  3ZT0 A;  4I2Q A;  1NGG A;  3AGK A;  1HNW K;  4NCA A;  4K43 A;  4O5F A;  3KLI A;  2O8B B;  4I7F A;  4DU3 A;  2VWB A;  1W0H A;  2J4R A;  2VQE K;  4JHD B;  3O8M A;  1ASU A;  3CCR N;  4LFC K;  3LP3 A;  3QML A;  4B3R K;  1QS4 A;  2CGJ A;  1RDW X;  3VER A;  4M3X A;  4H5W A;  3BZC A;  2HOE A;  4AH9 A;  1VQO N;  4QOZ B;  1WSH A;  3TPQ A;  2YCH A;  1UA1 A;  4FWN A;  5AQZ A;  3ZX0 A;  4FJK A;  3FFI A;  3JXU A;  2ZD1 A;  4I9L A;  2HHH K;  3QB0 A;  4LH4 A;  3ZX3 A;  3OHR A;  4BC3 A;  1XHX A;  2OCE A;  4JKE A;  3PV8 A;  1VQM N;  2FSK A;  3D2E B;  2UU9 K;  4FLX A;  4CFD A;  2O8E A;  2V7Z A;  2JLE A;  1LWF A;  3VEV A;  1OVQ A;  1ATS A;  2E1Z A;  3IDH A;  4DU1 A;  2A41 A;  4X65 K;  1C0M A;  1H1V A;  3SAH A;  1SZ2 A;  3WT0 A;  3DLE A;  3OS1 A;  5CZ1 A;  1JCG A;  2E1Y A;  1UAX A;  4DSF A;  3EO3 A;  2NRT A;  1N34 K;  4FK4 A;  2VG6 A;  3SBT A;  1FXX A;  5KRS A;  1XMQ K;  3C7N B;  1KCF A;  3FZH A;  4IOA L;  2E6L A;  4HVJ A;  1SL2 A;  4PUO A;  2VCP A;  4M45 A;  3D45 A;  3C6T A;  3QFP A;  5TKW A;  3AVJ A;  5D3G A;  4CJ4 A;  3K5N A;  4CFC A;  4K41 A;  4FCY A;  2NRX A;  1K9M O;  4KAZ A;  3DYA A;  3WQU A;  1QQO A;  3K59 A;  4CF2 A;  2E20 A;  3HVR A;  1ZC6 A;  5CR4 A;  1JXE A;  4FXD A;  5EOY A;  1C6V A;  3MXM A;  4CGF A;  5AQU A;  1VQ4 N;  2GWJ A;  4W5R A;  1ATR A;  4N76 A;  2IVO A;  3M8Q A;  3OA9 A;  3C95 A;  1VQ5 N;  1K6Y A;  3F9K A;  1O13 A;  2HHS A;  3M3Z A;  3KD1 E;  5KPT A;  1BCO A;  5KQD A;  4H5V A;  1RT4 A;  4LF4 K;  4H0T B;  5AR0 A;  1N36 K;  4FO0 A;  3WNF A;  1U2V B;  3P4I A;  4BE0 A;  3M5R A;  4KB0 A;  3DRP A;  4CZL A;  3ZT3 A;  1RTJ A;  2YV0 X;  3VQP A;  3ZX2 A;  5DM7 L;  4CHZ A;  2HHT A;  1M90 O;  3QIN A;  1IJJ A;  4MLH A;  4ZTF A;  1X1P A;  4JI5 K;  4CZI A;  3J7Z O;  4CES A;  2E6M A;  3SPY A;  1SKS A;  1WNS A;  4EIA A;  1FK9 A;  3KLF A;  4JI0 K;  4JKH A;  5JS2 A;  3DXM A;  3VPZ A;  4CEE A;  5KTQ A;  1ASV A;  4HCB A;  3RRH A;  3SUP A;  4TSX A;  1ASW A;  3HRG A;  5HL7 L;  4JKA A;  4BRO A;  2NRH A;  4FJG A;  4JS4 A;  1QSL A;  3PO5 A;  4BRE A;  1NK8 A;  2FSJ A;  1YXQ A;  3DLR A;  4ILG B;  3SMP A;  4CBX A;  4M7X A;  1KVB A;  3BZK A;  1WBB A;  4B1U B;  3QO9 A;  4FSV A;  5HRO A;  2KW4 A;  1TL1 A;  3RR8 A;  3CPE A;  2P9S B;  2ZGY A;  4AHV A;  3KLE A;  4OLB A;  4CIF A;  1K8K A;  5FPN A;  3D0P A;  1C0F A;  2ATQ A;  3VGK A;  2KTQ A;  3I33 A;  3AV9 A;  1U45 A;  2HHQ A;  3SAG A;  2C1I A;  3BUZ B;  2ASP A;  2ITM A;  3IUC A;  4CF1 A;  4B1W B;  2RF2 A;  4RG8 A;  4OX9 K;  2W00 A;  3D2F A;  2HHV A;  4BY9 C;  2NRW A;  4DQP A;  1EQY A;  3ATV A;  2D0A A;  2HHI A;  1D4X A;  4BEC A;  4BRL A;  4E72 A;  2YHW A;  3CD6 N;  4BRD A;  4LH5 A;  3H1V X;  3L3U A;  3L2W A;  2ZQB A;  4ID1 A;  2UXD K;  1S22 A;  2IOC A;  1NGJ A;  1MDU B;  1WUA A;  2VQF K;  2P9P B;  3LDL A;  1KAZ A;  3CF5 L;  4A2A A;  4J2A A;  3DAW A;  4M42 A;  5HLF A;  4CF9 A;  4CIG A;  4GMJ B;  4FWL A;  1NK6 A;  4WFB L;  1O1W A;  1GOA A;  3E66 A;  4LY7 A;  4QS7 A;  1L3T A;  2VWK A;  3LWL A;  5C12 A;  5KPR A;  1D5A A;  3AVF A;  2HF3 A;  2IC3 A;  4QS9 A;  3ZSO A;  2HW3 A;  5J2M A;  1D8Y A;  1Q82 O;  4B1Z A;  3B6P A;  2WON A;  2E2P A;  4KO0 A;  4AM6 A;  3V6D A;  4DR5 K;  4M3W A;  3SQ4 A;  3ENB A;  3PSF A;  4BE2 A;  1CXQ A;  4BRC A;  1VK0 A;  3VGL A;  3GBT A;  4JKG A;  2A5X A;  4J8F A;  2D0C A;  2QTD A;  1WSG A;  4BR0 A;  4H5T A;  4FVU A;  5I42 A;  3RMA A;  3I56 N;  2WBN A;  4FPA A;  3A5L C;  5KQ8 A;  4MO5 A;  3MCA B;  3EKU A;  3MEC A;  4PKG A;  2FC0 A;  5BR8 K;  2D0P A;  3AAP A;  1L3S A;  5FPE A;  4JI8 K;  3LP1 A;  4BRI A;  3VOV A;  4ELV A;  2D5R A;  1UOC A;  4RW4 A;  4KV8 A;  2X74 A;  2IVN A;  4EFH A;  3AA3 A;  1RDD A;  3A8Y A;  3L2U A;  1NK7 A;  4NB4 A;  4N56 A;  4B1V A;  3TWH A;  1DGK N;  4CK2 A;  3TAB A;  2PZS A;  5E84 A;  5JIC A;  4AQY K;  1TK5 A;  1DLO A;  1VQK N;  3NGY A;  3ZET A;  1S1U A;  4E7H A;  3SAF A;  3KK1 A;  4B9V A;  5EVZ A;  2QWM A;  1X3M A;  1DTT A;  3E9P A;  2UUC K;  2YKM A;  3TAR A;  1HYS A;  4CEF A;  4HUG A;  1HRH A;  3SI6 A;  2O8F B;  3MN9 A;  1QQM A;  2HND A;  2QK9 A;  3EN9 A;  1J54 A;  5C2F A;  5KGX A;  4JK8 A;  2GTD A;  1QE1 A;  1TYQ A;  3CCS N;  4E7L A;  1WSI A;  4DQI A;  2F4V K;  1T8E A;  1U47 A;  3BDP A;  1EET A;  4KBO A;  3B8A X;  3ENO A;  1W9H A;  5DM6 L;  3BF1 A;  3NAE A;  4FLV A;  1A5W A;  1GOB A;  4N47 A;  2YNI A;  4BVO A;  3O9T A;  3E01 A;  1Z26 A;  1CZA N;  2IDO A;  5M1Q A;  4EHU A;  1X3N A;  3AO2 A;  3LPU A;  3TAQ A;  1U49 A;  4KHP K;  4JI3 K;  1WOQ A;  1KXP A;  4CJ7 A;  3U9Z A;  2YKN A;  3WNE A;  2WTU A;  2Q3S A;  4Z4F A;  3P39 A;  4XH1 A;  4GV6 A;  2OZM A;  2X6N A;  4E7I A;  3FFK B;  3OYJ A;  4G9Z A;  5I3U A;  5AQL A;  3VES A;  2G8K A;  5C25 A;  4AIL C;  4CJ3 A;  4RCH A;  4E1N A;  2KLA A;  1TK0 A;  3UKR B;  4DR3 K;  4KHS A;  4FWK A;  5C42 A;  1WLJ A;  3N4P A;  1CLQ A;  4HUF A;  1JL1 A;  4B9U A;  3AVB A;  3NGI A;  2DY4 A;  1JLC A;  3K5L A;  2RKI A;  1BQM A;  3KK3 A;  3PX6 A;  3SV4 A;  1TKT A;  2O8C A;  4J2D A;  3R6M A;  5FPM A;  5EY4 A;  1T44 A;  5K14 A;  4BWM A;  2HVI A;  2OTL N;  4NLB A;  1JLB A;  4FJN A;  3V1R A;  3VA0 A;  4DR6 K;  1JCE A;  3MEE A;  4EHT A;  4JYA K;  3UIQ A;  3FZM A;  3MDQ A;  3VQ6 A;  4CHQ A;  3ZSZ A;  1HMV A;  4KHU A;  2GEL A;  4B9T A;  4A5A A;  3QBW A;  1JLE A;  3MXJ A;  3U4L A;  4GV3 A;  4J2E A;  4ISF A;  4HCC A;  4B3T K;  4Q0B A;  2NRR A;  2B6A A;  2WUS A;  4X64 K;  4CER A;  4K42 A;  5AQY A;  4IOX A;  2P9N A;  2RPI A;  4BC2 A;  4OPK A;  4LF6 K;  2QWL A;  1S9E A;  5EU7 A;  4WFN L;  2VG7 A;  4DTJ A;  4DR4 K;  3EYZ A;  4MQ3 A;  2Y1J A;  2YHX A;  3KK2 A;  3PSI A;  4JKB A;  2FBY A;  3GOI A;  2KHO A;  3SCX A;  3PY8 A;  4JKC A;  4C1N K;  3NF9 A;  3TTC A;  2W6K A;  4DS5 A;  3U9D A;  5CYM A;  2P5O A;  2FLO A;  2WOM A;  4FOE A;  5AQH A;  1NJZ A;  1VSI A;  1S3X A;  1S5J A;  3EL2 A;  4NCB A;  3BP8 A;  1NMN A;  3QNO A;  1LWC A;  1KVA A;  4GY2 B;  2KKZ A;  1TGO A;  1Q9X A;  4FLU A;  5KGW A;  2YI1 A;  5CHI A;  4LD0 A;  4U67 L;  1BUP A;  1NWK A;  2IS3 A;  4ZHR A;  3NDK A;  2HMP A;  1VQ6 N;  5GIP A;  3O08 A;  1Z05 A;  3N4Q A;  3OBY A;  4B9L A;  3R9P A;  4DV4 K;  3UKU A;  4DV3 K;  1S1V A;  3CYG A;  1NGD A;  3HYF A;  4DQS A;  1C1A A;  3MCP A;  2JWL A;  1QHT A;  1FW6 A;  1BHL A;  4B8C A;  4IOC L;  3QES A;  5AQT A;  4OLA A;  1RDC A;  3LL3 A;  1XMO K;  1A5X A;  3CCJ N;  1BWF O;  3NVK A;  2ZE2 A;  3O9R A;  3THX B;  4JI7 K;  5HRP A;  1NOY A;  3KWG A;  1N5Y A;  3OW2 M;  1BI4 B;  2Y1I A;  1JLA A;  1QHA A;  4BGA A;  3KD5 E;  4OVL A;  1Q18 A;  5M1O A;  3HTV A;  2P9K B;  3AVH A;  4CE9 A;  3H08 A;  1VSL A;  3IKM A;  1V4S A;  3LM9 A;  1W2B M;  4FM1 A;  1G99 A;  5BN9 A;  4MFB A;  1YHQ N;  4UQG A;  4HWI A;  4H0Y B;  3ULE A;  3SV3 A;  1IBL K;  2EX3 A;  3M8R A;  2ZM6 K;  5I9E B;  3THY B;  4IWV A;  3AA2 A;  4JRQ A;  3KIO A;  1EP4 A;  3M1F A;  4FLT A;  3THV A;  2IAJ A;  2NRZ A;  3CJC A;  1HKG A;  1S6Q A;  4OKE A;  1OVY A;  1C1C A;  3WXK A;  3MWT A;  1WSJ A;  4IDK A;  2ZGZ A;  3V9X A;  1WN7 A;  1HNX K;  1GLE G;  3F9M A;  3QIP A;  3ID8 A;  1WAJ A;  3G10 A;  3ITH A;  4BRF A;  1U4B A;  4BC5 A;  3RWU A;  4Z4I A;  2PYL A;  2PAV A;  2Q97 A;  2D0B A;  4CGI A;  5AZI A;  5JMV A;  2D4W A;  3SPZ A;  3NH0 A;  4A59 A;  2BDP A;  4Z4E A;  3G71 N;  4CJS A;  3CJ1 A;  4OGC A;  4Z0U A;  4B1Y B;  2EHG A;  4WF9 L;  4FL9 A;  4KI4 A;  4FWM A;  1R59 O;  3FZF A;  3MX5 A;  3O6W A;  3QIC A;  2F9W A;  1KRP A;  3IG1 A;  1TKZ A;  4B9Q A;  4BRA A;  3WEE B;  2QEX N;  4N5S A;  2E2O A;  4IEE A;  2VYP A;  2A1R A;  3IMX A;  4B1X B;  4A62 A;  2HHX A;  1OH7 A;  2F8S A;  3K0S A;  1S1W A;  3DXK B;  4ISE A;  3NE6 A;  4H0P A;  3DLG A;  2FBV A;  1RBS A;  2PFU A;  3C7N A;  4BRN A;  3ZEU A;  1DTQ A;  1NJI O;  5JVH L;  3A5M C;  5FRO A;  4BRP A;  5M1N A;  5AQV A;  3VEY A;  4O44 A;  4BR2 A;  3RMD A;  3C6H A;  4IG0 A;  4Y1D A;  2E5L K;  1LWE A;  3VGM A;  4BRQ A;  2D0O A;  4CEA A;  3KK7 A;  4DLG A;  1RBT A;  5TKY A;  5FRM A;  3HZ6 A;  3KVG A;  1X9J A;  3FZK A;  2O8E B;  3JS6 A;  1VHX A;  1IG8 A;  1VSM A;  4CHP A;  4E7K A;  1Q86 O;  3CC4 N;  2OZS A;  4UY8 O;  1NGF A;  2G8W A;  3P38 A;  3VQ7 A;  3LP0 A;  4B3S K;  5ELZ A;  4B3M K;  4JI6 K;  4E7J A;  5CY4 A;  4DV2 K;  3A5O C;  4BC4 A;  2UUA K;  1BL3 A;  5HP1 A;  3DLH A;  1VSF A;  4H0X B;  1FKO A;  4YOV A;  3BGR A;  4B9S A;  1NJX A;  4DV7 K;  3ZLJ A;  3PIP L;  3DRR A;  4XJX A;  3BEX A;  4H0V B;  2GWK A;  4XH4 A;  2HBL A;  1NKC A;  1EWR A;  2HBJ A;  3K9K A;  4FLY A;  3DRS A;  5CE3 A;  1ZBL A;  4YOT A;  3OYB A;  3HOS A;  3O4Q A;  1RCH A;  1V4T A;  4WCE L;  3CPW M;  2IIR A;  4DTR A;  4ELT A;  1YUW A;  3O5B A;  3VQA A;  3OYL A;  1F21 A;  4E89 A;  1VRT A;  4LF7 K;  3V4I A;  2HNY A;  1RTD A;  2OPS A;  3CME N;  3F2K A;  1TAU A;  1HKB A;  2E2N A;  4RW7 A;  4JV5 K;  4CEC A;  5IT9 O;  4KH4 A;  5JVG L;  4DSI A;  2B4J A;  1BQN A;  2DFE A;  2RE2 A;  1KAY A;  2WFB A;  3CQY A;  3L8B A;  5C2D A;  1LW0 A;  2YJE A;  5E26 A;  1IV0 A;  3MN7 A;  3SJJ A;  3ATU A;  3ZT4 A;  2O8D A;  1Q7Y O;  3OVN A;  1RT5 A;  4Z4G A;  2E4L A;  2BGG A;  3QLH A;  3VMF B;  2F9T A;  4CK3 A;  4CJE A;  1IBM K;  3CJB A;  1L3U A;  4DQR A;  4C8M A;  2YNG A;  1DEJ A;  3AVI A;  4JD2 B;  1B9F A;  3ALY A;  1NK0 A;  5GAG P;  3S5T A;  4ILH A;  3HM9 A;  1XC3 A;  1YJ9 N;  5BN8 A;  5LL6 Z;  1BCM A;  5C24 A;  5B8H A;  4E19 A;  3HXM A;  4KKO A;  1I39 A;  1HYV A;  1MWK A;  1SL0 A;  3L6Q A;  4CHN A;  3VQ9 A;  3CFP A;  4H4M A;  2YNF A;  4YDU A;  4JAX A;  4G1Q A;  2XO7 A;  1UWB A;  3T7Z A;  5H1S Q;  2Q0U A;  3NMU A;  5CYQ A;  4ILJ A;  3AO3 A;  5KI6 A;  3T1Y K;  3ULD A;  3OYM A;  4DV1 K;  2DTU A;  5F2R A;  2G8F A;  4ID5 A;  4JI1 K;  4XEI A;  4EZ6 A;  2P9P A;  4JKD A;  2RN2 A;  1HNZ K;  4YFU A;  2ZJQ L;  3LDN A;  3TU5 A;  4OGE A;  3KJV A;  1NOZ A;  4GV9 A;  1BIZ A;  1ZXO A;  5LMN K;  1VQN N;  3AVL A;  4DFJ A;  1K8K B;  2AA4 A;  2X78 A;  1CXU A;  1IKY A;  3NCI A;  1XUP O;  4FVM A;  1KD1 O;  1JLG A;  1XI1 A;  3FZL A;  5JS1 A;  4LF9 K;  3KHY A;  4PQU A;  1BA1 A;  1IH7 A;  4CZK A;  2R7Y A;  3D2F B;  2PYJ A;  4CJ5 A;  4OO1 J;  4KI6 A;  1HJR A;  3LAM A;  1LAV A;  1KFS A;  3IFR A;  1YVU A;  1R0A A;  1KQS M;  1L3V A;  1S9G A;  3KTQ A;  2RHK A;  5HRN A;  3WXL A;  4CJT A;  3ZT1 A;  1EXQ A;  4DTP A;  1QZ6 A;  5AZJ B;  3QEI A;  1MU2 A;  4GKK K;  1TKD A;  4BG8 A;  3LP2 A;  3D7E O;  3VA3 A;  3TSP A;  2I5J A;  1GLD G;  3V81 A;  4JI2 K;  4LF8 K;  3U3Y A;  3G0Z A;  2I7N A;  4FWS A;  4WYB A;  1HQU A;  3CCU N;  3VEO A;  4BGB A;  4RW9 A;  3VQ4 A;  2OPQ A;  3VQ8 A;  1ZBF A;  3LM2 A;  4L8R B;  1KVC A;  3IRX A;  2NRV A;  3CJA A;  4CGJ A;  4YDU C;  4CGG A;  1U6Z A;  2QWQ A;  2PBD A;  3HPG A;  3HT3 A;  1M1K O;  2P9U B;  3AGR A;  1RTI A;  2QWR A;  3R8E A;  1NM1 A;  1HJO A;  4K8Z A;  4NXN K;  4JKG B;  3VTH A;  2B5J A;  3KWI A;  1ZBI A;  5SWM A;  2HHW A;  3CYM A;  2IGI A;  1ESV A;  4NYF A;  1VSD A;  3FR0 A;  1HQE A;  3C6U A;  3T1A A;  2Z1G A;  2A40 A;  2E2Q A;  2OPP A;  2O8F A;  3S3N A;  3KLG A;  3S9H A;  1J5E K;  3L2V A;  5FLX O;  4U7B A;  4NCG A;  1S72 N;  4OPH A;  4CW7 B;  3H1Q A;  2ZJR L;  3CCV N;  1RT2 A;  1WSE A;  4FJM A;  3L4I A;  4CJR A;  3O3F A;  3G4S N;  2XHB A;  4KRF A;  4YOY A;  3O3G A;  3TR8 A;  1TV6 A;  3TAG A;  4E1M A;  4IG3 A;  2P9I B;  3E1Y A;  3LAN A;  4PWD A;  3C0B A;  2Q0R A;  2G8V A;  3SLC A;  3V9Z A;  4BRG A;  4CZF A;  3T19 A;  4L3Q A;  3D6R A;  1WAF A;  3F5T A;  2Z1J A;  1NJW A;  3ZET B;  1GLA G;  1ZBU A;  1C0T A;  4O5B A;  1IO2 A;  1SKR A;  4OKK A;  1ILY A;  3NBP A;  3VQQ A;  4WFA L;  1CZB A;  3VQ5 A;  3ZCM A;  3CJ7 A;  2QA4 N;  2PY5 A;  1LAW A;  4FJ8 A;  3SZ2 A;  2AJQ A;  3ZSW A;  1RBV A;  1QSY A;  4DQQ A;  1VQ7 N;  1BGX T;  2FF3 B;  4M3Z A;  2CH5 A;  4DTM A;  5AQS A;  1BU6 O;  1GLL O;  1BG3 A;  4FWR A;  3WXJ A;  3AVM A;  3DI6 A;  3SMS A;  1DKG D;  2F8T A;  3AO5 A;  2QM1 A;  2ASO A;  2OPR A;  1IBK K;  1NKE A;  3TAF A;  4FJH A;  3VN5 A;  3VEW A;  5ADX A;  3THW A;  1TYQ B;  3CCL N;  3HSC A;  3HM8 A;  3I8B A;  3I0R A;  2YJF A;  1SQK A;  2Z1H A;  3E9O A;  4IDH A;  1JKH A;  3AVC A;  3LAL A;  4O8U A;  3IS9 A;  4CJK A;  3P31 A;  3L3V A;  3RVC A;  1BA0 A;  4BAC A;  2V52 B;  1TUU A;  5HBM A;  1GLC G;  3LAK A;  3SYZ A;  5AJ3 K;  3ID6 A;  2XY7 A;  3I0S A;  1Z25 A;  3L2R A;  4DUY K;  3V9W A;  1SKW A;  4DTU A;  3OJS A;  3LDO A;  1XWL A;  1G15 A;  3RR7 A;  4FJX A;  4CF8 A;  3EKS A;  2ZWH A;  3WNG A;  4AHR A;  4M3R A;  4YOW A;  4ICL A;  4QCL A;  4WQ4 A;  1YJN N;  4FJI A;  3DJC A;  4FYD A;  5JEN A;  1ZBS A;  3MX2 A;  3NH1 A;  3HP9 A;  4BR7 A;  4R79 A;  1OKJ A;  2P9L A;  1NNE A;  1S1X A;  3RSE B;  2KFN A;  4YOR A;  3HST B;  2YHA A;  3TI0 A;  2CGL A;  1IG9 A;  4EP4 A;  4OPJ A;  1IKV A;  4BEB A;  5BPL A;  3P5J A;  1NK5 A;  4PY5 A;  4FZY A;  2FBT A;  3DLB A;  1JLF A;  1NGA A;  3LZI A;  3LDQ A;  4Q5V A;  3CQ8 A;  3SQ1 A;  3VF2 A;  1SL1 A;  4BWJ A;  4IJA A;  3MEG A;  4B9N A;  3J8A A;  4YNQ A;  4FW2 A;  5LJW A;  1HYZ A;  1ATN A;  4DHY A;  3K57 A;  3J81 O;  3H3N O;  3PX4 A;  2G8U A;  3LDP A;  5BRE A;  2GUP A;  3OY9 A;  1VSH A;  3OYE A;  2FSN A;  3H3O B;  3EZW A;  4FWO A;  3W0L A;  4FJ7 A;  4PKI A;  1HUX A;  5FRN A;  2JWK A;  3OYA A;  2KFZ A;  4AHC A;  1GLB G;  3HOT A;  2HNZ A;  4M41 A;  1P90 A;  3VET A;  2E8A A;  5BR9 A;  4ZTJ A;  1D9F A;  1JL2 A;  3THX A;  3ISN C;  3LZJ A;  4FLZ A;  2VGM A;  1Q8I A;  3M8P A;  2V7Y A;  1JLQ A;  3OS2 A;  4K25 A;  1T6D A;  4C8K A;  1OH5 A;  2O4I A;  2P9K A;  4JK9 A;  3U3G A;  1SS6 A;  4PL7 A;  4DQ8 A;  5DMR A;  4WQ5 A;  1Y64 A;  4F3T A;  3NH2 A;  2Q2R A;  3CXC M;  1T3V A;  3CER A;  3HO1 A;  3AVK A;  4CJU A;  2OA8 A;  1QZ5 A;  2W41 A;  4KTZ A;  1KC8 O;  3WXI A;  3QIO A;  3OYG A;  4I6M B;  2W42 A;  1VAZ A;  2DFF A;  1REV A;  4BDZ A;  4DWI A;  3GG4 A;  4DS4 A;  4V19 S;  2QKB A;  2QWO A;  3BY5 A;  4FZZ A;  3I8D A;  4F8R A;  4JLH A;  3Q7C A;  1LW2 A;  3V9U A;  1YTA A;  2O8B A;  1EX4 A;  5J2P A;  1XHZ A;  3VQD A;  3PX0 A;  4OKJ A;  4JHD A;  2JGU A;  3TTD A;  4IXC A;  3KZB A;  1IKW A;  2Z1I A;  4JNE A;  3TAP A;  2W40 A;  3QEP A;  2P5G A;  3VEN A;  4A57 A;  5SZT A;  1RDU A;  3ZSX A;  1NGH A;  4FJL A;  5LMU K;  3J7Y P;  3TAM A;  4NYN A;  1YT3 A;  5KPZ A;  4HTU A;  3J7A P;  4CGH A;  4H8K A;  1YVN A;  1C0G A;  3CCQ N;  4K8X A;  3ENH A;  1OH6 A;  4YY3 K;  3D2E A;  3DLK A;  4KHN A;  3OYI A;  2BUP A;  3EEQ A;  3LWM A;  3DXK A;  4GW6 A;  1HNI A;  4FJ5 A;  1TKX A;  3ZYY X;  4DR1 K;  3F73 A;  5C15 A;  4QS8 A;  3CFR A;  1RT1 A;  2OAN A;  3S3O A;  3SK3 A;  3K5M A;  1HPZ A;  4W5T A;  4DFM A;  4Y1C A;  1NU0 A;  1NGC A;  4DSL A;  3K9J A;  3O9S A;  2F96 A;  3O80 A;  3P1G A;  5AQQ A;  3QNN A;  2WC9 A;  2QWN A;  3B6O A;  4KRE A;  3HVT A;  5AZI B;  4XIU A;  3QBX A;  2O4G A;  2YHY A;  1C0U A;  3JYT A;  3K58 A;  1NG9 A;  4H5R A;  3NVM A;  2GV9 A;  3DOK A;  4WQ5 C;  3HPO A;  4B8A B;  2BH1 A;  3RMC A;  4H4O A;  4BR5 A;  4CK1 A;  4JN4 A;  3R3L A;  3KKR A;  5BPM A;  4BVP A;  4DMN A;  2HF4 A;  4I2P A;  1QQC A;  3O9Q A;  1E4F T;  4ISG A;  2CGK A;  2HBK A;  2FF6 A;  4CI6 A;  1XNR K;  3ZEU B;  3T69 A;  2VWJ A;  4M63 C;  2D1K A;  1U2V A;  4I9Q A;  4C1N I;  1OH8 A;  4BQZ A;  1BIU A;  3MXI A;  4JS5 A;  4CHO A;  4IEI A;  4CEB A;  4CZH A;  2XY6 A;  2QXL A;  3G6E N;  1ZBH A;  1P8Z A;  3HL8 A;  3VEX A;  1JJ2 M;  1EWQ A;  4CZG A;  4E3S A;  5HOO A;  1VQP N;  1L5U A;  4CJW A;  4M3T A;  3CQX A;  1U48 A;  3AA4 A;  1RBR A;  3DM2 A;  4AHU A;  2BTF A;  3UE5 A;  2X6S A;  3ZSR A;  3T1H K;  2QXF A;  1D9D A;  1TAQ A;  4CEQ A;  4H03 B;  4M3U A;  4RW8 A;  3DLL L;  3NFA A;  4IFY A;  2IVP A;  2YNH A;  1W7A A;  1HKC A;  2NNW A;  4FWP A;  4LF5 K;  4CZE A;  5C10 A;  1NLV A;  3RMB A;  4JK7 A;  1TUY A;  4GVM A;  4BRH A;  4JD2 A;  3SJH A;  1ITG A;  3ASM A;  1HLU A;  1Q81 O;  4CD3 A;  1WBD A;  2A1S A;  2HST A;  3SUN A;  2P9S A;  1WB9 A;  1XC9 A;  4E0D A;  1RNH A;  3AO4 A;  3CMA N;  5AFU A;  3ZSV A;  1T7P A;  2GEM A;  3RRG A;  4C23 A;  2G8H A;  2XY8 A;  3OYN A;  3TAN A;  3S3M A;  4O8K A;  4YHH K;  4RWT A;  2UUB K;  3A2F A;  5M1K A;  3CC2 N;  3LDS A;  1VSE A;  1KFD A;  1BOT O;  2O8D B;  5M1F A;  4IO8 A;  3HBT A;  5AQM A;  1RT7 A;  5LJV A;  3NF6 A;  3DXM B;  4RW6 A;  5F1X A;  4CD1 A;  4F2S A;  1KLN A;  3CFO A;  1MA9 B;  1JCF A;  4MO4 A;  5AQF A;  4W5O A;  3H45 C;  1SV5 A;  4DCH A;  4DFP A;  1YI2 N;  4DSE A;  1DT9 A;  4MDA A;  5AQR A;  5J1E A;  4KFB A;  4B08 A;  1NK9 A;  5FDL A;  2OYQ A;  1VRU A;  2FXU A;  1LOT B;  4FPB A;  1VQL N;  1RDB A;  3QER A;  1Z6R A;  2F7T A;  2W6L A;  4OPA A;  3M8S A;  4CFB A;  1YTU A;  3LPT A;  4NLC A;  4DF4 A;  1GOC A;  1QQN A;  4IKF A;  1RT3 A;  3DWL A;  4CVN E;  3BF3 A;  4DTX A;  3QEV A;  1QVF M;  1HPM A;  3AAQ A;  3V1Q A;  3GDQ A;  4GKJ K;  5ADX H;  4CGD A;  3SNN A;  4DR7 K;  1QSS A;  3HP6 A;  1VSK A;  3OTO K;  5KRT A;  1C1B A;  3QFU A;  1Q9Y A;  3H6E A;  4BDY A;  4FW1 A;  4CCH A;  3CHW A;  4JEP A;  4PL8 A;  2QWP A;  4DTO A;  1N8R O;  5AQX A;  5AQK A;  2KQ2 A;  1VSJ A;  3IAY A;  4CZM A;  2V51 B;  1RT6 A;  3KKS A;  2DPN A;  5AZJ A;  2GBZ A;  2NZT A;  5DK5 A;  5GIN A;  1E3M A;  4FM2 A;  4AHS A;  3FLC O;  2A3Z A;  5A2Q O;  4FLW A;  4HTL A;  3Q7B A;  3VF6 A;  1VQ8 N;  5GAE P;  1QVG M;  4J2B A;  2ETJ A;  3G25 A;  4R5P A;  1BIS A;  1N32 K;  4BE7 B;  1YF5 L;  1I3A A;  4W5Q A;  2UXB K;  3VEZ A;  2AP1 A;  3MMV A;  4O0J A;  3OYF A;  1JXB A;  4KTW A;  3TSU A;  3AA5 X;  4B9M A;  1N6Q A;  4QAG A;  5AQJ A;  2P9U A;  3MWP A;  4DV0 K;  4IJN A;  1NJY A;  4LFA K;  3OYD A;  4KHY A;  4BDP A;  4NXM K;  1TVR A;  1ZYQ A;  4CJV A;  3AVN A;  3AVG A;  4IFE A;  3TAE A;  4CJL A;  2A42 A;  1J53 A;  4JRP A;  3K5O A;  1GLF O;  4DSK A;  1SAZ A;  4CBU A;  1RDA A;  1YAG A;  4CEZ A;  4C8N A;  1NK4 A;  1RIL A;  4FOI A;  4H5N A;  2GUI A;  3OYH A;  3MN5 A;  3C94 A;  3C65 A;  3MED A;  1KLM A;  4BRK A;  4DTN A;  3VQE A;  1IKX A;  4DSJ A;  1T05 A;  3JAM O;  4WE1 A;  5F0X A;  3HPH A;  4CF0 A;  2QI2 A;  2P9I A;  4CJP A;  4AF1 A;  4CIE A;  1CZ9 A;  4BQL A;  4DV5 K;  3T3F A;  4DU4 A;  1RTH A;  1UA0 A;  3U6F A;  5T7B A;  3O1W A;  1T03 A;  3QDK A;  3UB5 A;  1QTM A;  4AM7 A;  3L4Q A;  4C8O A;  2VG5 A;  5AQG A;  5BRD A;  1BDG A;  5AQN A;  4FM0 A;  3WUH A;  4DF8 A;  2XY5 A;  2Q31 A;  3DMJ A;  2ASM A;  2P1J A;  3QEX A;  4GNI A;  4DKW A;  2E88 A;  4O55 A;  2A6A A;  3FGU A;  3WNH A;  1NMD A;  1KSP A;  3O9U A;  3NF8 A;  3EZ5 A;  5HRS A;  3ZSY A;  3K2P A;  2P51 A;  4DUZ K;  1J9A A;  3C6A A;  3HI0 A;  4Z94 A;  1J5O A;  5FPD A;  1EKE A;  3AVA A;  4MDB A;  4FZX C;  1GLJ O;  3O4N A;  1RGI A;  2H3G X;  5EX5 A;  1A5V A;  1YIJ N;  4PA1 A;  1HNV A;  1SUQ A;  3P83 D;  3UKR A;  4DG1 A;  1YIT N;  4KB1 A;  4CBW A;  2HMI A;  4DB3 A;  4A5B A;  3U8X A;  4EAH D;  3R1X A;  1XQS C;  1K8A O;  3NHG A;  3CIP A;  4CED A;  3KLH A;  4F3O A;  4KTQ A;  4DLE A;  1FKP A;  3L2Q A;  1NBW A;  3AY9 A;  2ZJP L;  3M6G A;  3A5N C;  4RTF D;  4CFA A;  5GAD P;  1EO1 A;  4JI4 K;  4EP5 A;  1W97 L;  4X62 K;  4F9O A;  3SUQ A;  3SQ0 A;  5IWA K;  1KTQ A;  3RTV A;  1NGB A;  4CJF A;  5CZ2 A;  3VTI A;  3SQ2 A;  3GL1 A;  5AQO A;  4BRM A;  3DOL A;  1MWM A;  3OYK A;  4BE1 A;  4CHY A;  1TK8 A;  2ZF5 O;  3FE1 A;  3OBW A;  3MAQ A;  4N41 A;  1B9D A;  1I94 K;  4PKH A;  3E9L A;  4IFV A;  3J80 O;  1S1T A;  4KHQ A;  3HK2 A;  4A2B A;  2VGN A;  3RSE A;  1FJG K;  3HJF A;  2FBX A;  4K0K K;  4FJ9 A;  3TTF A;  4Y0W A;  3THW B;  3QEW A;  3PIO L;  2KZM A;  3CI5 A;  3EE8 A;  1KAX A;  1HX1 A;  4OJR A;  2CH6 A;  1B92 A;  3CCE N;  4F2R A;  4IBN A;  3PLA A;  3PUF A;  3ZSQ A;  5JLF A;  4KH5 A;  3O3H A;  3I55 N;  1HR0 K;  2O8C B;  4PHT X;  1T6C A;  1LCU A;  3AAR A;  4CZJ A;  1NGE A;  2YX6 A;  3MK6 A;  5GAH P;  3MN6 A;  4A61 A;  2YHB A;  4E1J A;  2C1G A;  3ZT2 A;  3VQB A;  4IO9 L;  4KPY A;  4XH5 A;  3EY1 A;  3OYC A;  4FWQ A;  5BRF A;  3VF4 A;  3O4W A;  4HHT A;  3V9S A;  1J6Z A;  2EWS A;  2LSN A;  5BRH A;  2UXC K;  3CM5 A;  2I7P A;  2HVH A;  2QKK A;  4HUE A;  3CG7 A;  2P9L B;  3S41 A;  2ITG A;  5J2N A;  5AQP A;  2P9N B;  3SUO A;  3SBG A;  5C0Y A;  5AQW A;  3H46 O;  3QET A;  2BE2 A;  4F4K A;  4FJJ A;  3NGZ A;  4Z4C A;  4O4G A;  4W5N A;  2G8I A;  3A0I X;  3JSM A;  5M1P A;  3CET A;  5GIO A;  4YOU A;  1U04 A;  1LV5 A;  3W3D A;  4EZ9 A;  5EXW A;  2QW9 A;  4M3Y A;  5LY3 A;  2NUB A;  4FK0 A;  1RFQ A;  4O0I A;  1BI4 A;  4DTS A;  5HRR A;  1RBU A;  4MLE A;  3CCM N;  4C8L A;  3VQC A;  3WQT A;  4I6M A;  1Y97 A;  1VQ9 N;  1N33 K;  4BR9 A;  1WSF A;  5BPN A;  4FK2 A;  4DR2 K;  5AQI A;  1X9M A;  2HBM A;  2Q36 A;  3TSQ A;  1TL3 A;  4BR4 A;  4LFB K;  3THY A;  2HHU A;  3CC7 N;  5E41 A;  3NF7 A;  1BO5 O;  2BAN A;  1XNQ K;  2XRI A;  4NO7 A;  4WQ4 C;  3OS0 A;  1X9S A;  3WXM B;  3UKU B;  4YOX A;  4H0O A;  4LSL A;  3L0Q A;  4BG9 A;  4CJQ A;  4IZ9 A;  5MLC Q;  2HB5 A;  3CM6 A;  3O1B A;  3EE9 A;  1YJW N;  1NKB A;  4B3O A;  2GX9 A;  3AO1 A;  4ELU A;  3CJ9 A;  3OJU A;  4KHW A;  5AFU H;  4X66 K;  4DFK A;  4Z4H A;  5JLH A;  4CEO A;  2DFH A;  1X9W A;  1E4G T;  1NGI A;  2UYT A;  4AHT A;  4M7Y A;  2NLX A;  4KH6 A;  3V1O A;  2Q1N A;  4JKF A;  3GE1 A;  5J2Q A;  4DV6 K;  1S6P A; 
#chains in the Genus database with same CATH homology
 3LM2 A;  4GVE A;  3WEE A;  1Q81 O;  1K73 O;  3ULE B;  4CD3 A;  2OTJ N;  4LC9 B;  2NRV A;  3CJA A;  1JCE A;  2HST A;  2P9S A;  4YDU C;  4EHT A;  1NGG A;  1U6Z A;  3AGK A;  3FZM A;  3MDQ A;  4K43 A;  2QWQ A;  2PBD A;  4O5F A;  3CMA N;  5AFU A;  1M1K O;  2GEL A;  2P9U B;  2VWB A;  2GEM A;  3AGR A;  4A5A A;  3QBW A;  2J4R A;  2QWR A;  3U4L A;  3R8E A;  1NM1 A;  4JHD B;  1HJO A;  4C23 A;  3O8M A;  4GV3 A;  4ISF A;  3CCR N;  4O8K A;  4JKG B;  3VTH A;  2NRR A;  2WUS A;  4RWT A;  3KWI A;  3QML A;  4K42 A;  2CGJ A;  3VER A;  1RDW X;  5M1K A;  5AQY A;  4H5W A;  3CC2 N;  4IOX A;  2HOE A;  2P9N A;  1ESV A;  3FR0 A;  1VQO N;  1BOT O;  4BC2 A;  3TPQ A;  2YCH A;  5M1F A;  2QWL A;  4IO8 A;  4WFN L;  3HBT A;  4FWN A;  5AQZ A;  3ZX0 A;  2A40 A;  2E2Q A;  5AQM A;  5LJV A;  3DXM B;  5F1X A;  3JXU A;  4CD1 A;  2YHX A;  4JKB A;  3QB0 A;  3ZX3 A;  4BC3 A;  3OHR A;  4U7B A;  4JKE A;  1VQM N;  1MA9 B;  1JCF A;  1S72 N;  4OPH A;  4MO4 A;  5AQF A;  3GOI A;  2FSK A;  3D2E B;  3H1Q A;  2KHO A;  3H45 C;  4DCH A;  2ZJR L;  3CCV N;  1YI2 N;  4JKC A;  1DT9 A;  4C1N K;  4MDA A;  2V7Z A;  3L4I A;  5AQR A;  3TTC A;  3VEV A;  3G4S N;  3U9D A;  1ATS A;  2E1Z A;  2FLO A;  3IDH A;  4FOE A;  4YOY A;  2FXU A;  5AQH A;  2A41 A;  1LOT B;  1S3X A;  4FPB A;  1VQL N;  1H1V A;  3EL2 A;  1Z6R A;  2P9I B;  3E1Y A;  3SAH A;  3BP8 A;  1SZ2 A;  3C0B A;  2F7T A;  2Q0R A;  3WT0 A;  4OPA A;  3SLC A;  1JCG A;  2E1Y A;  4BRG A;  4GY2 B;  4CZF A;  2KKZ A;  4NLC A;  3EO3 A;  2NRT A;  4L3Q A;  3D6R A;  3F5T A;  1QQN A;  3DWL A;  2YI1 A;  3SBT A;  5CHI A;  3BF3 A;  3ZET B;  1GLA G;  1BUP A;  1HPM A;  1NWK A;  4U67 L;  1QVF M;  3AAQ A;  3C7N B;  2HMP A;  3FZH A;  3GDQ A;  1VQ6 N;  4IOA L;  5GIP A;  3O08 A;  5ADX H;  1Z05 A;  1ILY A;  2VCP A;  3N4Q A;  3OBY A;  4WFA L;  3QFP A;  3R9P A;  3UKU A;  5TKW A;  3CJ7 A;  3QFU A;  2QA4 N;  3H6E A;  1NGD A;  3CHW A;  4JEP A;  4K41 A;  4PL8 A;  2QWP A;  1N8R O;  3MCP A;  5AQK A;  2NRX A;  5AQX A;  2JWL A;  1K9M O;  1VQ7 N;  2FF3 B;  4CZM A;  2V51 B;  3WQU A;  2CH5 A;  4IOC L;  1QQO A;  5AQT A;  5AQS A;  1BU6 O;  2DPN A;  1GLL O;  1BG3 A;  3LL3 A;  4FWR A;  5AZJ A;  2NZT A;  3CCJ N;  1BWF O;  3WXJ A;  5GIN A;  3NVK A;  3O9R A;  2E20 A;  3SMS A;  1ZC6 A;  5CR4 A;  1DKG D;  5EOY A;  2QM1 A;  3KWG A;  2ASO A;  5AQU A;  2GWJ A;  1VQ4 N;  1ATR A;  3OW2 M;  2IVO A;  3FLC O;  2A3Z A;  3OA9 A;  3VEW A;  5ADX A;  3CCL N;  1TYQ B;  4HTL A;  3HSC A;  1VQ5 N;  1O13 A;  3HM8 A;  3Q7B A;  1QHA A;  3I8B A;  3M3Z A;  4BGA A;  2YJF A;  1SQK A;  3E9O A;  1Q18 A;  5M1O A;  3HTV A;  3VF6 A;  5GAE P;  2P9K B;  4IDH A;  5KPT A;  4H5V A;  5KQD A;  3IKM A;  1QVG M;  1V4S A;  3G25 A;  3LM9 A;  4H0T B;  5AR0 A;  1W2B M;  1G99 A;  5BN9 A;  1YHQ N;  4FO0 A;  4BE7 B;  1YF5 L;  4O8U A;  4HWI A;  4H0Y B;  3P31 A;  3ULE A;  3RVC A;  3VEZ A;  1U2V B;  2AP1 A;  1BA0 A;  3P4I A;  3MMV A;  3TSU A;  3M5R A;  5I9E B;  4IWV A;  2V52 B;  1TUU A;  4CZL A;  1GLC G;  5AQJ A;  2P9U A;  3M1F A;  3MWP A;  3ID6 A;  4IJN A;  3ZX2 A;  5DM7 L;  2NRZ A;  3CJC A;  1HKG A;  1M90 O;  1OVY A;  1IJJ A;  4MLH A;  3WXK A;  3MWT A;  2ZGZ A;  3LDO A;  4CZI A;  3EKS A;  2ZWH A;  3J7Z O;  1GLE G;  3F9M A;  3ID8 A;  4YOW A;  4BRF A;  4IFE A;  4WQ4 A;  1YJN N;  4EIA A;  4BC5 A;  3DJC A;  2A42 A;  1ZBS A;  3MX2 A;  4JKH A;  1GLF O;  2PAV A;  2Q97 A;  1SAZ A;  3DXM A;  1YAG A;  3VPZ A;  4BR7 A;  4CBU A;  5AZI A;  4R79 A;  5JMV A;  2D4W A;  1OKJ A;  4FOI A;  4H5N A;  2P9L A;  3HRG A;  3RSE B;  4JKA A;  4A59 A;  4BRO A;  5HL7 L;  4YOR A;  3MN5 A;  3G71 N;  2NRH A;  3C65 A;  3CJ1 A;  4B1Y B;  4WF9 L;  4FL9 A;  4BRE A;  2CGL A;  2FSJ A;  1YXQ A;  4FWM A;  4BRK A;  4ILG B;  1R59 O;  3FZF A;  3MX5 A;  3O6W A;  3QIC A;  3SMP A;  2F9W A;  4CBX A;  4M7X A;  4B9Q A;  5F0X A;  4BRA A;  4BEB A;  4B1U B;  5BPL A;  4FSV A;  2QI2 A;  3WEE B;  2QEX N;  2P9I A;  2E2O A;  4AF1 A;  4IEE A;  2VYP A;  3CPE A;  2P9S B;  2ZGY A;  4BQL A;  1NGA A;  3IMX A;  4B1X B;  4A62 A;  1K8K A;  5FPN A;  1C0F A;  3LDQ A;  3O1W A;  3QDK A;  3UB5 A;  3DXK B;  4ISE A;  3VGK A;  3VF2 A;  4AM7 A;  3I33 A;  3L4Q A;  4H0P A;  2PFU A;  3C7N A;  4IJA A;  3SAG A;  2C1I A;  5AQG A;  5BRD A;  3J8A A;  1BDG A;  5AQN A;  4BRN A;  3BUZ B;  3WUH A;  3ZEU A;  5LJW A;  1ATN A;  2ASP A;  2ITM A;  3IUC A;  4DHY A;  4B1W B;  3H3N O;  2Q31 A;  1NJI O;  2W00 A;  3LDP A;  3A5M C;  5JVH L;  4BRP A;  5M1N A;  5BRE A;  2GUP A;  3D2F A;  5AQV A;  3VEY A;  2ASM A;  2FSN A;  4BR2 A;  3H3O B;  3C6H A;  4GNI A;  3EZW A;  4FWO A;  4DKW A;  2E88 A;  3W0L A;  4BY9 C;  2NRW A;  4PKI A;  1HUX A;  2A6A A;  2JWK A;  1EQY A;  3ATV A;  3VGM A;  4BRQ A;  2D0O A;  3FGU A;  1GLB G;  3KK7 A;  3HOT A;  1NMD A;  1D4X A;  4BEC A;  1P90 A;  5TKY A;  3O9U A;  3VET A;  2E8A A;  4BRL A;  5BR9 A;  2YHW A;  3HZ6 A;  3CD6 N;  3KVG A;  4BRD A;  1X9J A;  3C6A A;  3HI0 A;  4Z94 A;  3FZK A;  2VGM A;  3H1V X;  3JS6 A;  5FPD A;  1IG8 A;  4MDB A;  2V7Y A;  1S22 A;  1Q86 O;  4K25 A;  1GLJ O;  1T6D A;  3CC4 N;  1NGJ A;  1MDU B;  1WUA A;  1RGI A;  2H3G X;  2P9P B;  3LDL A;  5EX5 A;  1YIJ N;  4UY8 O;  2P9K A;  1NGF A;  4JK9 A;  1SS6 A;  3P38 A;  4PL7 A;  4DQ8 A;  5ELZ A;  3UKR A;  1YIT N;  1KAZ A;  4WQ5 A;  1Y64 A;  4CBW A;  4A2A A;  3CF5 L;  3DAW A;  4DB3 A;  4A5B A;  3U8X A;  4EAH D;  2Q2R A;  3R1X A;  3CXC M;  1T3V A;  3CER A;  1XQS C;  1K8A O;  3A5O C;  4BC4 A;  3CIP A;  1QZ5 A;  2W41 A;  4FWL A;  1NBW A;  4H0X B;  3AY9 A;  4WFB L;  3WXI A;  1KC8 O;  2ZJP L;  4YOV A;  3M6G A;  3A5N C;  3E66 A;  4I6M B;  4RTF D;  3PIP L;  5GAD P;  4XJX A;  1VAZ A;  3BEX A;  4QS7 A;  4H0V B;  2GWK A;  5C12 A;  4XH4 A;  2HBL A;  5KPR A;  1EO1 A;  1W97 L;  3GG4 A;  2HBJ A;  3K9K A;  4F9O A;  5CE3 A;  4YOT A;  1NGB A;  2HF3 A;  3HOS A;  2QWO A;  4QS9 A;  1V4T A;  3VTI A;  4WCE L;  1Q82 O;  3GL1 A;  5AQO A;  4B1Z A;  3CPW M;  4BRM A;  4AM6 A;  2E2P A;  2IIR A;  1MWM A;  3Q7C A;  1YUW A;  3ENB A;  3O5B A;  2ZF5 O;  3FE1 A;  4BRC A;  3OBW A;  4JHD A;  3TTD A;  3VGL A;  4IXC A;  4PKH A;  3CME N;  3E9L A;  3F2K A;  3GBT A;  1HKB A;  2E2N A;  3KZB A;  4JKG A;  4JNE A;  4KH4 A;  2A5X A;  5JVG L;  2W40 A;  4A2B A;  2VGN A;  4J8F A;  2RE2 A;  3VEN A;  3RSE A;  1KAY A;  2QTD A;  4A57 A;  2WFB A;  3CQY A;  5C2D A;  4BR0 A;  2YJE A;  4H5T A;  4Y0W A;  3MN7 A;  5E26 A;  3TTF A;  3ATU A;  4FVU A;  1RDU A;  3I56 N;  1Q7Y O;  2WBN A;  1NGH A;  3A5L C;  4FPA A;  4MO5 A;  5KQ8 A;  3MCA B;  3PIO L;  3EKU A;  5KPZ A;  3CI5 A;  3EE8 A;  1KAX A;  1HX1 A;  4PKG A;  2CH6 A;  3VMF B;  3CCE N;  1YVN A;  1C0G A;  2F9T A;  3CCQ N;  3PLA A;  2D0P A;  3AAP A;  3ENH A;  5JLF A;  4KH5 A;  5FPE A;  3D2E A;  3CJB A;  1DEJ A;  4BRI A;  3VOV A;  2BUP A;  3I55 N;  4JD2 B;  3DXK A;  4PHT X;  1LCU A;  1T6C A;  2IVN A;  4EFH A;  5GAG P;  3AAR A;  4CZJ A;  3ZYY X;  1NGE A;  4ILH A;  2YX6 A;  1XC3 A;  3A8Y A;  3MK6 A;  3MN6 A;  4QS8 A;  4A61 A;  4E1J A;  5C15 A;  5GAH P;  1YJ9 N;  2OAN A;  2C1G A;  5BN8 A;  4NB4 A;  5B8H A;  3SK3 A;  4B1V A;  4IO9 L;  4XH5 A;  1DGK N;  1MWK A;  5E84 A;  5JIC A;  3L6Q A;  4FWQ A;  1VQK N;  5BRF A;  1NGC A;  4YDU A;  3VF4 A;  3K9J A;  3O9S A;  3O80 A;  3O4W A;  5AQQ A;  3ZET A;  4JAX A;  1J6Z A;  2EWS A;  5BRH A;  3SAF A;  2WC9 A;  2QWN A;  3T7Z A;  5H1S Q;  2I7P A;  5EVZ A;  5AZI B;  2Q0U A;  3NMU A;  2QWM A;  3QBX A;  1X3M A;  4ILJ A;  2P9L B;  3S41 A;  2YHY A;  5AQP A;  2P9N B;  3E9P A;  3SBG A;  4H5R A;  3NVM A;  5F2R A;  4WQ5 C;  5C0Y A;  5AQW A;  3H46 O;  2BH1 A;  4XEI A;  3A0I X;  2P9P A;  4BR5 A;  4JKD A;  5M1P A;  3MN9 A;  4JN4 A;  1QQM A;  3R3L A;  3CET A;  5GIO A;  4YOU A;  2ZJQ L;  3W3D A;  3EN9 A;  3LDN A;  3TU5 A;  5BPM A;  5C2F A;  4BVP A;  2HF4 A;  4GV9 A;  4JK8 A;  2GTD A;  5EXW A;  2QW9 A;  5LY3 A;  1ZXO A;  1VQN N;  3O9Q A;  1RFQ A;  1TYQ A;  1E4F T;  1K8K B;  4ISG A;  2AA4 A;  4MLE A;  3CCM N;  2CGK A;  3CCS N;  3WQT A;  2HBK A;  4KBO A;  1XUP O;  4I6M A;  3B8A X;  1VQ9 N;  3ENO A;  2FF6 A;  5DM6 L;  3BF1 A;  1KD1 O;  4CI6 A;  4BR9 A;  3FZL A;  5BPN A;  3ZEU B;  3T69 A;  4M63 C;  3KHY A;  5AQI A;  2D1K A;  2HBM A;  1BA1 A;  1U2V A;  4BVO A;  4CZK A;  2Q36 A;  3TSQ A;  3D2F B;  4C1N I;  4BR4 A;  4BQZ A;  3O9T A;  1CZA N;  3CC7 N;  5M1Q A;  1VQ8 N;  4EHU A;  4OO1 J;  1BO5 O;  1X3N A;  4IEI A;  4CZH A;  2QXL A;  1WOQ A;  1KXP A;  4CJ7 A;  1P8Z A;  3G6E N;  3VEX A;  3U9Z A;  1JJ2 M;  4CZG A;  3IFR A;  5HOO A;  4NO7 A;  4WQ4 C;  1VQP N;  1KQS M;  3P39 A;  4XH1 A;  3UKU B;  3WXM B;  4GV6 A;  4YOX A;  3CQX A;  3FFK B;  4H0O A;  4G9Z A;  5AQL A;  3L0Q A;  4BG9 A;  2RHK A;  3VES A;  4IZ9 A;  5MLC Q;  3WXL A;  2BTF A;  3UE5 A;  3O1B A;  3EE9 A;  1YJW N;  4RCH A;  2KLA A;  4H03 B;  1QZ6 A;  3UKR B;  5AZJ B;  2GX9 A;  3DLL L;  3CJ9 A;  4BG8 A;  5AFU H;  3D7E O;  4FWK A;  5JLH A;  3TSP A;  2IVP A;  3N4P A;  1E4G T;  1HKC A;  2NNW A;  1NGI A;  4FWP A;  2UYT A;  1GLD G;  2NLX A;  4KH6 A;  4M7Y A;  4CZE A;  5C10 A;  1NLV A;  2I7N A;  4FWS A;  4WYB A;  4JK7 A;  1TUY A;  3CCU N;  4BRH A;  2Q1N A;  4JD2 A;  3R6M A;  4JKF A;  5FPM A;  5EY4 A;  1T44 A;  3SJH A;  3VEO A;  3GE1 A;  4BGB A;  1HLU A;  2OTL N;  4NLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...