3DXMB

Structure of bos taurus arp2/3 complex with bound inhibitor ck0993548
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
196
structure length
196
Chain Sequence
GVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Characterization of two classes of small molecule inhibitors of Arp2/3 complex
pubmed doi rcsb
molecule tags Structural protein
total genus 51
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxmB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3dxmB02
4CD1A 3BP8A 3FFKB 2F9TA 3WUHA 4AM6A 4H5TA 3F9MA 1J6ZA 4EHUA 3FZMA 2P9IA 5JLFA 5AQXA 1WOQA 4ISGA 4H0TB 5JLHA 3DAWA 3VGMA 2ZF5O 4BC2A 4FO0A 3ENOA 3SMPA 3EO3A 2A3ZA 3U8XA 2W41A 3HTVA 3LDOA 4FWRA 4BRDA 3S41A 3FGUA 2P9SA 3BF3A 3CJAA 4FPAA 3VEVA 3CJ1A 4BRQA 2P9IB 3FZHA 3I8BA 5AQLA 5AQSA 3TU5A 1JCEA 4A61A 1NGAA 4DCHA 1MWKA 4FWNA 1TYQA 4BG9A 4XEIA 2Q97A 3GOIA 1Y64A 4BRMA 1GLBG 4BC4A 5EVZA 4H0PA 2P9SB 4CZFA 2E2PA 4BR0A 4RWTA 2E2QA 3LDNA 3VGKA 3L4IA 4BRHA 4EAHD 4DQ8A 1GLLO 3MN6A 3QB0A 3ZETA 2IIRA 3AAQA 5AQJA 1QHAA 4B1WB 5AQPA 2J4RA 4IZ9A 3QICA 4JD2B 4BROA 3HBTA 3R8EA 3WXKA 4YDUA 1XC3A 1TYQB 4XH1A 5AQZA 4CBXA 1NBWA 1XUPO 2YHWA 1NMDA 4JNEA 5AQQA 4QS9A 2A42A 3QBXA 4CZEA 3O8MA 3KZBA 4WQ5A 4DHYA 3FLCO 4O5FA 1NGJA 5KPRA 2BTFA 4B9QA 5ADXA 3M1FA 2P9PA 3DXKA 3VESA 2HF4A 3VEOA 2AP1A 3ZETB 2HOEA 4CI6A 4ISEA 5FPNA 3ULEB 3UKUB 4PL8A 4M7YA 3VF2A 2FF3B 1RGIA 5BREA 3MMVA 1LCUA 3CHWA 3A5MC 3FR0A 4FWSA 3IDHA 4BRFA 1YUWA 1NWKA 2Q36A 3D2FA 1E4GT 5AQVA 2GWKA 3SLCA 3LDQA 1YAGA 3W0LA 4H03B 5AQYA 2DPNA 4K42A 3VERA 4HTLA 4BRKA 3HZ6A 5F2RA 2P9PB 3DXKB 3JS6A 3R9PA 1BOTO 5EX5A 3SJHA 1MDUB 2HMPA 4O8KA 1IG8A 3CJCA 5EXWA 4CZIA 3WXIA 2D4WA 3G25A 1P8ZA 3AY9A 1NM1A 3D2FB 3EZWA 4CZLA 3P4IA 4MLEA 5BN8A 3VETA 4H0YB 4BRCA 1GLJO 2QWQA 3FZLA 4CD3A 4JAXA 4H5RA 3VF6A 3QFPA 4BREA 1HUXA 3AAPA 1NGBA 2ASPA 1ATNA 3VEWA 1R59O 3ZX0A 5BPMA 4BVPA 3TPQA 5BR9A 3HSCA 3CI5A 3CIPA 3MK6A 4GY2B 2P9UA 2D0OA 5BRHA 1C0FA 2NRHA 4B1UB 3BF1A 4LC9B 5AQRA 4BQZA 1YVNA 2IVNA 3MN9A 3O08A 5BN9A 1NGCA 4K41A 1HKCA 2YJFA 2I7NA 2QWLA 2NLXA 2P9LA 3FZKA 4Z94A 5BRFA 1DKGD 5AR0A 2Q31A 4F9OA 1Q18A 4C23A 4H5NA 3BUZB 4Y0WA 3MN5A 2QWOA 3OHRA 2P9NB 3H6EA 3LM2A 3EN9A 1Z05A 4BRAA 1D4XA 1H1VA 2H3GX 3FE1A 4JD2A 1ZXOA 4FOIA 2F9WA 2P9UB 4BGBA 3CJ7A 5AQMA 4BR4A 1KAXA 1ZC6A 4RTFD 3H1QA 3UB5A 1RDWX 3UE5A 5AQTA 1DGKN 4KBOA 5F1XA 4WQ4C 5BPLA 2P9LB 3M6GA 5B8HA 2ZGZA 1TUUA 4BRIA 1BG3A 2FF6A 3MDQA 2FSKA 3ZEUA 5AQOA 2GUPA 2YHYA 4M63C 1NLVA 1S3XA 3ULEA 2CH5A 3UKUA 5ADXH 2E2OA 2QWPA 4PKGA 5KQ8A 3C7NA 1U6ZA 2GELA 4NB4A 5TKYA 2CGJA 3U9ZA 5FPMA 3A0IX 5AQGA 2UYTA 3VF4A 2FXUA 1NGEA 4IXCA 4H0VB 2NZTA 1MA9B 2GTDA 3R6MA 3ZEUB 3QDKA 3A5LC 1YXQA 2ASMA 1T44A 4PKHA 5AQUA 3IMXA 3VEYA 5ELZA 5AQNA 4BGAA 5LY3A 4FPBA 3SMSA 2QWMA 4XH4A 3JXUA 3QMLA 3C7NB 1KAYA 5KQDA 1SQKA 1GLFO 1SAZA 5AZIA 1NGIA 1OKJA 5LJVA 1NGFA 4PL7A 1X3NA 1JCFA 2CGLA 1T6CA 2E1ZA 4CZHA 1Z6RA 2E20A 4GNIA 3GBTA 5BPNA 4QS8A 4H5WA 3CQXA 3VPZA 3MCPA 1X3MA 2CH6A 1JCGA 4RCHA 1ESVA 2E8AA 3EKSA 2PBDA 2YJEA 1QQOA 3H45C 4QS7A 1EQYA 1QZ5A 3ZX2A 3H3NO 1T6DA 5AZIB 5AQIA 2HF3A 4HWIA 4CJ7A 2QXLA 4FWPA 4M7XA 3QFUA 3WEEB 2AA4A 3A5NC 4A2BA 2Q0UA 4A2AA 4BR5A 4MO5A 3CETA 2A40A 1QQNA 4BR2A 3L0QA 4FSVA 2P9NA 2FSNA 4ISFA 1BO5O 3WQUA 4FWLA 4IJNA 2CGKA 1BA0A 3VEZA 3GE1A 3O1WA 4YDUC 2Q0RA 3LM9A 2V7ZA 2V7YA 3ATVA 2A41A 4JHDA 2ZGYA 5FPEA 3H46O 3VENA 3HM8A 4WQ5C 4CZKA 3MN7A 2QM1A 2W40A 1LOTB 3VEXA 4CZJA 5KPZA 2YCHA 2ASOA 4NO7A 4K43A 3FZFA 2FLOA 3BEXA 3HI0A 1GLEG 2IVPA 3GG4A 4BRPA 3A8YA 5EY4A 4BQLA 3O80A 5BRDA 2P9KA 4BRNA 1BDGA 4JHDB 4BC3A 3CERA 2A5XA 3SK3A 2ZWHA 2VCPA 3RSEB 2IVOA 4AM7A 3GL1A 1CZAN 4PKIA 1V4TA 5JMVA 4CBUA 4IWVA 2V51B 1BA1A 2EWSA 2GWJA 2GEMA 2OANA 4MO4A 1ATRA 3IUCA 1KXPA 3DXMA 1GLDG 3CQYA 4B1ZA 1KAZA 3DJCA 3WT0A 2P9KB 2A6AA 3QBWA 4BR9A 1HKBA 3CJ9A 1U2VA 1C0GA 1XQSC 3O5BA 1WUAA 4H5VA 3ZX3A 2VYPA 1NGHA 3UKRA 4XH5A 5AQFA 1E4FT 1HLUA 5AZJA 1SZ2A 2Q1NA 3D2EA 3H1VX 4B1XB 1RFQA 5CE3A 1DEJA 3EL2A 1IJJA 3LDLA 4FL9A 5JICA 3D7EO 4EFHA 1NGGA 5E84A 3DXMB 3AARA 3ATUA 4FWMA 2D1KA 4L3QA 2QW9A 4FWQA 1HKGA 3LL3A 4WYBA 1V4SA 1HX1A 3EKUA 1U2VB 4I6MA 4IJAA 4H0XB 3W3DA 2E1YA 3UKRB 3U9DA 4B1YB 1K8KA 1QQMA 3DWLA 5AFUH 3CJBA 1S22A 2VWBA 3O4WA 4FOEA 3WEEA 5AZJB 4FWOA 1QZ6A 3D2EB 1GLCG 2I7PA 2KHOA 5AQWA 2ITMA 4BC5A 4EIAA 1GLAG 4BVOA 2E88A 1X9JA 4IO8A 4BRLA 3J8AA 5F0XA 5AQKA 3A5OC 4B1VA 3L6QA 1ZBSA 4MLHA 3C0BA 3I33A 5AFUA 1BUPA 3GDQA 4DB3A 4H0OA 3M3ZA 4I6MB 3O1BA 3LDPA 2PAVA 5E26A 4BG8A 3WQTA 3WXJA 1NGDA 4K25A 1K8KB 3IFRA 4WQ4A 4JN4A 4J8FA 2BUPA 2QWNA 3U4LA 3KHYA 5KPTA 1G99A 5AQHA 4A62A 2YHXA 3H3OB 1BWFO 3KVGA 3ENHA 1TUYA 3ID8A 1HJOA 2FSJA 2QWRA 3VGLA 4E1JA 5I9EB 1BU6O 1HPMA 3O6WA 2YI1A 5EOYA 3WXLA 2Q2RA 4FWKA 4CZMA 1ATSA 3VOVA 3B8AX 2V52B 5FPDA 2E2NA 3RSEA 4CBWA 4BRGA 4BR7A 4EHTA 1MWMA 4CZGA 5LJWA 2WUSA 2D0PA
chains in the Genus database with same CATH superfamily
4CD1A 3BP8A 1A5WA 4IFEA 3LAMA 4DSIA 3CYGA 4E72A 2F9TA 3WUHA 3THXB 1RDBA 3L2UA 3FZMA 5JLFA 5AQXA 1T8EA 1WOQA 3VQ5A 5M1PA 2P5GA 4B9VA 1LV5A 4DU1A 4FW2A 5C10A 2W41A 2O8EB 3ZYYX 3L2QA 2Z1IA 4ELVA 4C8LA 1NMNA 4FPAA 3CJAA 4BWJA 4KHWA 3FZHA 1QHTA 5HLFA 5AQLA 4O0IA 3F73A 4LSNA 4RW8A 1NJWA 4ILHA 1NGAA 2IOCA 2YX6A 1TYQA 3HP9A 3TAMA 3NAEA 4XEIA 2OPQA 1Y64A 1GLBG 4DU3A 4DMNA 4RWTA 3DRSA 2GX9A 3MWTA 4OLBA 3L4IA 5FRNA 4ELTA 2IIRA 3LZJA 2HHVA 2HHSA 3VQBA 2J4RA 4IZ9A 3SNNA 4J2EA 4Y1CA 4BROA 1GOAA 3CC4N 1XC3A 1TYQB 3SV4A 3HPOA 3MCAB 5M1NA 1HJRA 2A42A 4CZEA 4OKEA 3G6EN 3KZBA 4DHYA 5KPRA 3OYJA 2BTFA 2NRXA 2PZSA 4B9QA 4DFJA 3QNOA 4CIGA 3PO5A 3UKUB 4M7YA 1EP4A 3I56N 4Z4CA 3PY8A 5BREA 1K6YA 1LCUA 3CHWA 3NF9A 3A5MC 1LWCA 3IDHA 4E19A 2Q36A 5C2DA 4OPJA 4Z4IA 5HRRA 5CHIA 4CF0A 4H03B 3SQ4A 3L3VA 1GOCA 4HTLA 3I0RA 3HJFA 3NF7A 1KC8O 3R9PA 3TARA 2VWJA 1BOTO 3AVKA 4FXDA 3OYKA 3HYFA 3KWGA 3SJHA 1N5YA 5T7BA 3CJCA 1DTQA 1B9DA 4DTJA 1SUQA 2G8UA 2D4WA 1P8ZA 3AY9A 3EZWA 3D0PA 4IOXA 3VTIA 2UXCK 1QE1A 3VETA 4A5BA 3O3HA 5TKWA 4ICLA 4AQYK 4O5BA 1EXQA 2ZJPL 1VQ5N 1D5AA 3HK2A 1BGXT 1IKVA 3TABA 3AAPA 4YOVA 4BVPA 4HCCA 3TPQA 4OPKA 3CIPA 5C25A 3M8PA 2YKMA 4YFUA 5AQRA 4BQZA 1HYVA 4N76A 4FK2A 2WONA 5BN9A 3PSIA 1HKCA 3K5LA 1KVBA 5HBMA 3VQDA 2I7NA 2P9LA 3DYAA 4H4OA 1DKGD 5AR0A 2Q31A 1VRUA 4H5NA 3H6EA 4B9TA 4DR7K 4NYNA 4FYDA 3EZ5A 3L8BA 3BZKA 5GAHP 3ITHA 2E4LA 1C0UA 4BRAA 1H1VA 2YNHA 1JKHA 3AVAA 3FE1A 4KHUA 3WNEA 4CHPA 2YHBA 3ZT3A 1KAXA 4RTFD 3H1QA 4F3TA 1KQSM 4KBOA 4RW4A 5BPLA 2P9LB 3M6GA 4DV7K 4BRIA 4LH5A 3E9PA 2XY6A 4ZHRA 1YITN 4CHOA 4ZTJA 1KCFA 1S1VA 3ULEA 1S1TA 3F5TA 5KQ8A 1U6ZA 2R7YA 1KLNA 2CGJA 1RTDA 1C1CA 1VQ4N 4FW1A 3BGRA 1WSHA 3IRXA 1NGEA 1S72N 3AO1A 2F8SA 5C2FA 2D0BA 1MA9B 4DFPA 2G8FA 3VMFB 1FKPA 3QDKA 3A5LC 1RCHA 1ASVA 4PKHA 1L5UA 3CQ8A 3IMXA 5ELZA 1WAJA 1S9EA 4FLWA 3JXUA 3QMLA 1VK0A 4K8ZA 4E1NA 1SKRA 1NGIA 5LJVA 4JKCA 1NGFA 4PL7A 1XNRK 4E1MA 1OH7A 3EYZA 3RRGA 4ILJA 4I2PA 1Z6RA 5GADP 3QLHA 4B3OA 1T7PA 4CFBA 1LWEA 2CH6A 4EP4A 2X74A 3CCVN 1QQOA 3H45C 4QS7A 3S5TA 4W5NA 1T6DA 4KB1A 4FLTA 2HF3A 2HHTA 4CJ7A 2QXLA 4J2AA 4M7XA 3WEEB 2QEXN 3A5NC 2Q0UA 3CETA 2A40A 3JAMO 4BR2A 1HPZA 1N6QA 4ISFA 4M42A 3WQUA 4IJNA 3ZSVA 3RMAA 3VEZA 3NCIA 5JVGL 3TTFA 4CEFA 1NJIO 2V7ZA 3HVRA 3EY1A 4JHDA 5GINA 1TL3A 3P1GA 3VENA 1VQLN 3QNNA 1S1WA 2W40A 4I2QA 4DUZK 4CZJA 1N32K 4K43A 3DLHA 2FLOA 4ZTFA 3DLRA 3HI0A 2W42A 2X6NA 1JXBA 5BRDA 3AVHA 4RG8A 1BDGA 4JHDB 1A5XA 1JXEA 2RN2A 5JENA 1WN7A 3THVA 3VQ4A 5JMVA 3OJSA 3HOSA 2Y1IA 4IWVA 3TAQA 4LF4K 4MDAA 4ELUA 2EWSA 2GWJA 3AVNA 3WNGA 2GEMA 1I3AA 1CLQA 1TGOA 3PX6A 1VSMA 1I39A 5I42A 3OYMA 4DV3K 2OZMA 4PY5A 1XQSC 3O5BA 4KKOA 1L3VA 1TK5A 4FCYA 5C24A 1HLUA 4KH5A 5AZJA 3H1VX 4DSLA 3CCUN 2VQFK 1N33K 1NK8A 4PWDA 4FL9A 4OKJA 3D7EO 2HW3A 3SV3A 2O8BA 5HRSA 4FWMA 1U04A 1HNIA 2FC0A 4WYBA 4DSFA 4IJAA 1J54A 4FJLA 1OVQA 4OX9K 1K8KA 1QQMA 2VGMA 3CJBA 1S22A 2OTJN 4CJ3A 5DM6L 1BIZA 5AZJB 4M3TA 1QZ6A 3ZSWA 3ZSZA 2C1IA 5CZ1A 5AQWA 4CJKA 4DV6K 4EIAA 3HRGA 4BVOA 1YJNN 1BL3A 4BRLA 3NGIA 3F9KA 3NVMA 2O8BB 4JI4K 3HVTA 4B1VA 3L6QA 3SQ1A 4DS5A 1ZBSA 4CERA 3C0BA 5AFUA 3J7YP 2KZZA 3GDQA 1YTUA 3SAHA 3M3ZA 3O1BA 1SKSA 3MXJA 4U67L 2O8CB 4BG8A 3KLFA 1K8KB 4J8FA 4IDHA 5KPTA 3BY5A 5AQHA 1RT2A 2DFEA 3C6HA 4A62A 4BWMA 3VTHA 2YHXA 3H3OB 1RT3A 5LMUK 3P83D 1YHQN 4DWIA 1HJOA 4IFYA 3VQ8A 4JI1K 3HT3A 3SPZA 4NXNK 3CMAN 2XY5A 1RT5A 3VOVA 3B8AX 2V52B 3DLKA 4JK7A 1IG9A 2QK9A 4W5TA 4F2SA 1J9AA 4BRGA 4BR7A 4F2RA 1MWMA 4CZGA 3AVMA 5LJWA 2JLEA 2WUSA 4CHZA 3FFKB 4QAGA 1JLQA 3AA2A 4AM6A 1RBSA 1YI2N 4QCLA 4ISGA 5JLHA 3V9SA 3NH1A 3VGMA 1JLCA 3OS0A 5CZ2A 3ENOA 3SMPA 3EO3A 3U8XA 3V6DA 2HVIA 1NK0A 1C6VA 3FGUA 2P9SA 3OYNA 3L2VA 3AA4A 4DUYK 3CJ1A 3TTCA 4FZXC 1QTMA 3I8BA 5AQSA 3TU5A 3LDSA 3C6TA 4E3SA 1EETA 2PYJA 1TL1A 3VQQA 3QEWA 3KLHA 4RW7A 4CJVA 4YOTA 1IKWA 4BC4A 1NK6A 4KH6A 3P39A 4JS5A 2P9SB 4CF1A 4CGDA 4CZFA 5CYQA 2E2QA 3LDNA 3E1YA 5CR4A 1J5OA 4N41A 1BQMA 2G8IA 3MN6A 1REVA 2QI2A 3O9QA 5AQJA 3WNHA 5M1KA 4CGHA 4B1WB 5AQPA 4DV1K 3ZT4A 3QICA 2UXDK 3HBTA 3WXKA 1Q7YO 5AQZA 1S6PA 1NBWA 2A1SA 2YHWA 4WCEL 4QS9A 1HR0K 3QBXA 3KK7A 3O8MA 3RR7A 3K2PA 1C1AA 1NGJA 1WAFA 4LD0A 4DR5K 3ID6A 1XMQK 1X9WA 1VHXA 1TK8A 3M1FA 4DQRA 4CJEA 4NCBA 4CI6A 4ISEA 2ZD1A 1UA1A 4BECA 2HVHA 3MMVA 4NCGA 5J1EA 4BDZA 5AQVA 2GWKA 1ZBIA 3SLCA 3W0LA 3CC2N 4H4MA 4CEZA 5AQYA 4FJ8A 1VSHA 2QTDA 2QXFA 1W7AA 4K42A 3VERA 1HYZA 2E6MA 4BACA 4F8RA 3LWLA 5EX5A 4O8KA 5EXWA 5LL6Z 1QQCA 1Q81O 2O8EA 4I7FA 5BN8A 2HHUA 4AHUA 3E9LA 4CD3A 2D0AA 4JAXA 4H5RA 3ZT2A 1HUXA 3OYAA 1RBTA 2ASPA 4CJRA 3ZSRA 1R59O 2HBJA 1ASWA 2DY4A 3CCRN 3HSCA 4FM2A 4C1NK 3THWA 3TSUA 2P9UA 4FJHA 1C0FA 1TKZA 2XRIA 3BF1A 2I5JA 1YVNA 1KD1O 3O08A 1CZ9A 4Z0UA 2NLXA 5BRFA 2WC9A 1DT9A 2FBYA 4KHPK 4F9OA 4A59A 1HNVA 4CEQA 2QWOA 3OHRA 2P9NB 4DTRA 3LWMA 4CHYA 2JWKA 4LSLA 4YOUA 3BZCA 1UA0A 1Z05A 2KFNA 4E7IA 3THWB 1X1PA 4CEBA 3VQAA 1ZXOA 4I9QA 4FOIA 2P9UB 4NYFA 4BGBA 4BR4A 1YTAA 3UB5A 1M1KO 1RBVA 4IBNA 5AQTA 1XWLA 5B8HA 1BG3A 4XJXA 1CXQA 3MDQA 1IBLK 4E7LA 1VSIA 3ZEUA 3V9WA 4KREA 4FJKA 4BY9C 1RT4A 4KO0A 1IKXA 1QSYA 1RDDA 1S3XA 3HSTB 2CH5A 3UKUA 2QWPA 1NK4A 3C7NA 2DTUA 5TKYA 5J2MA 3U9ZA 4DTNA 3A0IX 5AQGA 4FLYA 3VF4A 1LWFA 2D5RA 4IXCA 4DQPA 4H0VB 5GAGP 2NZTA 2G8VA 3O9UA 5KGWA 2ITGA 4PQUA 3ZEUB 1T44A 2G8KA 3MEGA 5AQUA 2BGGA 2W00A 3VEYA 5A2QO 5AQNA 4BGAA 1XHZA 4J2DA 2QWMA 3TSPA 4B3SK 3MAQA 3C7NB 1GLFO 2NNWA 3OW2M 1EKEA 4A57A 2RPIA 1JCFA 2CGLA 1T6CA 3TANA 4QOZB 2BANA 5J2QA 3O9RA 5AJ3K 3M8SA 3CQXA 2O8DA 3TR8A 5LMNK 1JCGA 2Q3SA 3HP6A 2VGNA 2PBDA 2YJEA 3ZX2A 1EQYA 3CCJN 4M3UA 3H3NO 3RR8A 3OYCA 5AQIA 4C8OA 4DQQA 2GV9A 4EZ6A 4FWPA 4LF8K 4Z4GA 3NBPA 4ILGB 4MO5A 3U3GA 3AVFA 3D6RA 2PFUA 3L0QA 5HL7L 2F4VK 1BO5O 3VA0A 2BE2A 1J53A 4GV3A 2O8DB 2YNGA 2OCEA 3QO9A 5E41A 1TKDA 1QVFM 1ASUA 3GE1A 3O1WA 4YDUC 3LM9A 1FW6A 2B5JA 2V7YA 4DFKA 4FVMA 3AO5A 5FPEA 3HM8A 2WBNA 4WQ5C 4CZKA 4JV5K 4DTMA 2O4GA 3HO1A 1RBUA 1HQUA 5KPZA 3HOTA 1U48A 4DQSA 3FZFA 1HNXK 1SKWA 1GLEG 2IVPA 2LSNA 3TTDA 4OJRA 4PUOA 3GG4A 4AH9A 4DV4K 4AHSA 2P9KA 4BRNA 2A5XA 3RSEB 4DR3K 5KI6A 1YT3A 3QIPA 5FRMA 4Q5VA 4HUFA 4AM7A 4GVEA 3WNFA 3T19A 4CBUA 2V51B 2HBKA 1ATRA 1KXPA 3DXMA 3S3NA 1IV0A 2HHWA 2P9KB 4BR9A 3CJ9A 1U2VA 3ZX3A 1NGHA 4JS4A 3RMDA 3UKRA 2OA8A 1KLMA 4XH5A 4B9SA 1E4FT 2EHGA 3D2EA 3P31A 2F8TA 3KWIA 1DEJA 3ZSOA 4JEPA 3AVBA 3SAFA 3NVKA 4B8CA 1P90A 3DXMB 5H1SQ 1LAWA 4L3QA 3IKMA 1ZBFA 3LPUA 1D9DA 3S9HA 2QW9A 3V1OA 3MXMA 1HKGA 3LL3A 3QIOA 3EKUA 4A5AA 1U2VB 3ENBA 4CESA 2E1YA 3UKRB 3U9DA 4CEEA 4GMJB 3DLLL 3DWLA 3WEEA 3V9XA 2O8FB 4FWOA 3D2EB 5JS1A 3MEDA 1GLCG 3QEPA 2ITMA 1GLAG 2DFHA 2PY5A 4IO8A 3J8AA 4CW7B 4HHTA 4GVMA 5AQKA 3A5OC 4R79A 1WBDA 1JL1A 4JI0K 3DRPA 1BUPA 3C94A 4DB3A 4DV5K 3ZSXA 4LF7K 3E66A 2OPSA 2PAVA 3LDPA 2UUBK 1UWBA 3WXJA 1BCOA 1NGDA 4WFAL 4K25A 3IFRA 3HM9A 2YNFA 2BUPA 2QWNA 3KHYA 3K59A 1W9HA 4IOCL 1NOYA 3CD6N 1BWFO 3SYZA 1FJGK 3DLEA 4E7JA 2QWRA 2YNIA 3VGLA 4F3OA 1BU6O 3ISNC 1F21A 2EX3A 3WXLA 1S6QA 1W2BM 1IH7A 4FWKA 4CZMA 3C95A 1JL2A 1QVGM 4CJQA 2E2NA 1YJ9N 4CBWA 3ZCMA 4CFDA 1VSDA 3O9TA 3C6AA 4UQGA 5IWAK 3OS2A 1TV6A 3E01A 4H5TA 3K57A 4UY8O 4Y1DA 4E89A 2P9IA 4H0TB 3V9UA 4WFNL 1YF5L 3DAWA 3AGKA 2ZF5O 3OJUA 3QEIA 4JKBA 4IKFA 1DLOA 5D3GA 2NRRA 4JKDA 3ALYA 3CG7A 1L3TA 2FBTA 1KSPA 1RDCA 4BRDA 2ATQA 3SUQA 2B6AA 3C6UA 1VQ7N 4PHTX 5GIOA 4WE1A 4FZYA 1Z25A 1WLJA 3VEVA 4FJNA 4HUGA 2NRWA 2P9IB 4G1QA 3SBTA 4IG0A 1M90O 2OZSA 4L8RB 4A61A 4YOXA 4DCHA 2FBXA 1MWKA 4FWNA 3AVLA 2XO7A 4FJIA 3AO3A 4KI6A 4CJTA 3MECA 4KH4A 4JI2K 4BRMA 1KRPA 1EO1A 4B9UA 4BE1A 4YOWA 4H0PA 4OKKA 1NU0A 2E2PA 4BR0A 4DLGA 2KTQA 4BRHA 3JSMA 2ZJQL 1GLLO 3PUFA 3QB0A 2GBZA 2G8HA 1VSEA 4LF9K 4CIFA 4HVJA 1N36K 1EWRA 4BDPA 3HPGA 2X6SA 4JD2B 1X9MA 3R8EA 1C0TA 4XH1A 3VN5A 4CBXA 1XUPO 5AQQA 3D45A 4JLHA 1W97L 2O8CA 1TVRA 3AGRA 4I9LA 5ADXA 3FFIA 3CF5L 1NJZA 2P9PA 3DXKA 3VEOA 2AP1A 2HOEA 5FPNA 3LPTA 3K5MA 4AHTA 1Z26A 3VF2A 3TWHA 1RGIA 1WSJA 3CM5A 3T7ZA 4H8KA 3FR0A 4FWSA 4BRFA 1NWKA 4DTUA 3D2FA 3QEXA 1E4GT 3TAGA 4FZZA 4KHQA 4Z4FA 2IAJA 3LDQA 1YAGA 4KAZA 3AVCA 3SUNA 1N34K 3OY9A 3G4SN 2DPNA 4NLBA 3TAPA 4FK4A 3HZ6A 4HUEA 5F2RA 2P9PB 3DXKB 3JS6A 1NKEA 1MDUB 4CJSA 2HMPA 1NJYA 4MQ3A 4JYAK 4CZIA 3KLGA 2VG5A 2YHAA 3WXIA 3G25A 3D2FB 1NM1A 4CZLA 3KKSA 1ILYA 3CC7N 4H0YB 3MX5A 1GLJO 4FM0A 3FZLA 3KLIA 4MDBA 3VQPA 1NGBA 1SL0A 5KRSA 1SL2A 1BI4A 4AILC 1N8RO 2PYLA 3RTVA 3MK6A 4GY2B 3N4PA 4G9ZA 2Z1HA 4CHQA 3MN9A 1NGCA 4K41A 3DMJA 1ZBHA 2YJFA 3ZT0A 3F2KA 3FZKA 3NF6A 5J2PA 4HCBA 3BUZB 4IEEA 3KIOA 4KFBA 4B8AB 1NKBA 3EN9A 1VQ6N 2A1RA 1BI4B 1HQEA 2H3GX 4OLAA 3I0SA 2F9WA 5AQMA 1NJXA 3O3GA 1RDWX 3OS1A 1WNSA 1DGKN 4WQ4C 4CE9A 2D0CA 4KHSA 1VAZA 3QINA 1WSEA 2GUPA 3QETA 2YHYA 4CK1A 3DOLA 1WSFA 1NLVA 4M63C 5ADXH 2E2OA 1Q8IA 1CXUA 4KTZA 4M41A 3R1XA 1VSFA 3M5RA 4CEOA 3LP2A 3HXMA 2F7TA 2GTDA 4OGEA 5M1OA 3ZLJA 3EEQA 4DSEA 4C8KA 4O4GA 4DF4A 4JK8A 2ASMA 1VQKN 2AJQA 5LY3A 2VWKA 4XH4A 1JLBA 4GV6A 2HHXA 1KAYA 5KQDA 1SQKA 4DSKA 1IKYA 3LP3A 1OKJA 2KZMA 4M3RA 1X3NA 3HL8A 4WFBL 2KLAA 4AF1A 2E1ZA 4CZHA 2BDPA 3BDPA 4N56A 2NRVA 5BPNA 4KHNA 5JVHL 5HROA 3MCPA 3AVIA 3V1QA 1NK9A 2KFZA 4X62K 3B6PA 5I3UA 3RMBA 3PX4A 1T3VA 1RT1A 2OPRA 1JJ2M 1BQNA 5GIPA 3QFUA 2ZM6K 2AA4A 2ZQBA 4A2BA 4OVLA 5FLXO 4E7HA 1Q9XA 4FSVA 2P9NA 2FSNA 4CF9A 1B92A 3AV9A 1KFDA 4FWLA 2QKBA 3SZ2A 4HTUA 2KW4A 3N4QA 4GKJK 4CJUA 4NLCA 3CFRA 4DR6K 3SQ0A 5KRTA 2W6KA 1VQPN 2A41A 3Q7BA 4F4KA 4KB0A 1XHXA 2ZGYA 3O3FA 3S3MA 4FJ7A 4LF6K 4JI6K 1RBRA 3MN7A 2QM1A 3LAKA 1LOTB 3KD5E 5FDLA 3KJVA 3NFAA 2ASOA 1BISA 4NO7A 2ZE2A 3BEXA 2P1JA 1L3UA 1X9SA 4DTSA 1OH5A 3EE9A 4BRPA 1YVUA 3A8YA 4BQLA 3SAGA 1JLAA 2P5OA 3G10A 4BC3A 2ZWHA 2VCPA 4DTXA 3NE6A 1TK0A 1D9FA 1RT7A 3KD1E 3WXMB 1YIJN 3GL1A 4PKIA 4DFMA 1BA1A 4Z4HA 2OANA 5K14A 3T69A 4DKWA 2W6LA 3IUCA 3PV8A 3LANA 4CGIA 1KVAA 3L3UA 1TAUA 1OH6A 5M1QA 3DJCA 3WT0A 3PO4A 2A6AA 1ITGA 1HKBA 4H5VA 4KI4A 2VYPA 1Q9YA 2GUIA 2KKZA 3MX2A 4FJ9A 1QS4A 4JI8K 3OYIA 2Q1NA 4CHNA 4B1XB 1RFQA 2VG7A 3NF8A 4YORA 2HNYA 1U47A 5M1FA 3OYEA 1SV5A 1LAVA 1NGGA 3OTOK 1NOZA 3AARA 4YY3K 3NGZA 2D1KA 2VG6A 4K8XA 4IFVA 4CJPA 3U6FA 1RDUA 3M8RA 4I6MA 4H0XB 3IAYA 1WB9A 3L4QA 4E7KA 1NNEA 3HPHA 2VWBA 3CCQN 1T05A 4JI7K 2KHOA 3K0SA 4JI3K 3LP1A 1UOCA 3VQ9A 3SQ2A 4CGGA 4FLVA 1CZBA 5SWMA 4TSXA 4MLHA 4YNQA 3B6OA 1E3MA 4I6MB 3T1YK 3QESA 4X64K 2UUAK 3WQTA 3OYFA 4CIEA 3U4LA 1KFSA 2KQ2A 3KK1A 2HBLA 4EZ9A 4CEDA 1XMOK 4X66K 4CF8A 4FJJA 2UXBK 3KVGA 3ENHA 1TUYA 3ID8A 5I9EB 5DM7L 4JKHA 3RVCA 1HPMA 2OPPA 3O6WA 4C8NA 2YI1A 5EOYA 3CM6A 3K5NA 4FLUA 2Q2RA 4FM1A 4JKFA 1XC9A 3IG1A 5FPDA 3RSEA 1SL1A 1RDAA 4LFCK 3LALA 4JK9A 2F96A 4C8MA 2D0PA 1RTIA 2IC3A 4KRFA 3F9MA 1J6ZA 4EHUA 5SZTA 3E9OA 4AHCA 3OBYA 4OGCA 4BC2A 4FO0A 4GW6A 2A3ZA 2QKKA 4DTPA 5KTQA 3HTVA 3LDOA 4FWRA 4GKKK 4KV8A 3S41A 4B08A 3OA9A 3CFPA 4DS4A 3J80O 4JRQA 2HB5A 3BF3A 4CJFA 4BRQA 3U3YA 3EE8A 4K0KK 4CEAA 3KK3A 3M8QA 1JCEA 1VRTA 3OYDA 1VQMN 3CXCM 4BG9A 3CMEN 4BE0A 2Q97A 3GOIA 1RT6A 2C1GA 5EVZA 3VQEA 2HSTA 4W5RA 2HHIA 2O8FA 1KTQA 2YV0X 3VGKA 4EAHD 4DQ8A 3CPEA 5CYMA 3ZETA 2Z1GA 3AAQA 1QHAA 3CCSN 5CY4A 4YDUA 1U49A 4M3ZA 2ZJRL 4JNEA 1NMDA 3K5OA 1VSKA 4O8UA 1RNHA 2HNZA 3OYHA 3I55N 4WQ5A 3CPWM 3FLCO 4O5FA 1VQ8N 2RE2A 4RW9A 4CF2A 1HNZK 5KGXA 2X78A 1S9GA 1RTJA 3VESA 2HF4A 3ZETB 1ZBLA 3ULEB 4PL8A 2FF3B 1IO2A 1DTTA 4FK0A 3MEEA 4CK2A 1GOBA 1A5VA 3T3FA 4CVNE 1YUWA 4CJLA 3DOKA 3V4IA 4KHYA 3SCXA 1K8AO 2HNDA 3TSQA 4OPAA 1G15A 4O44A 3T1HK 4BRKA 2HMIA 3C65A 4OO1J 4J2BA 1K73O 1XI1A 3VA3A 5HP1A 4DR1K 4CCHA 4MFBA 2NRTA 3A2FA 1U45A 1IG8A 4BDYA 2FBVA 2NUBA 2XHBA 4M3WA 3TI0A 4Z4EA 3P4IA 4MLEA 1HYSA 3DRRA 1NK5A 4BRCA 2QWQA 1MU2A 3VF6A 3QFPA 3ZT1A 4FLXA 4BREA 1EWQA 5BPMA 1ATNA 3VEWA 3ZX0A 4IG3A 5EU7A 4CGJA 2UU9K 2JGUA 5BR9A 3H08A 2IS3A 3CI5A 3AA5X 2D0OA 5BRHA 2NRHA 4YOYA 4B1UB 1VQON 4LC9B 2IDOA 2Y1JA 2IVNA 2WFBA 1K9MO 3V9ZA 3L2WA 2QWLA 4Z94A 1FKOA 4DQIA 2VQEK 4WF9L 2ETJA 1Q18A 4C23A 2RHKA 4Y0WA 3MN5A 3LM2A 3O4QA 3ZSQA 3ULDA 1RILA 1T03A 4IEIA 4Q0BA 1OVYA 1D4XA 2Z1JA 1VQNN 4M3YA 4IOAL 1RTHA 4JD2A 3CJ7A 2NRZA 3TAFA 4ID5A 1ZC6A 1NKCA 3UE5A 5F1XA 1LW0A 3K58A 4M3XA 4EP5A 4CECA 4FVUA 2ZGZA 1TUUA 3KK2A 2YKNA 2FF6A 3IS9A 1W0HA 1VSJA 2FSKA 4E0DA 5AQOA 2WTUA 3VQ7A 1WSGA 4N47A 1UAXA 1TKTA 3S3OA 4PKGA 4DR4K 2DFFA 2OYQA 2GELA 4NB4A 2E5LK 3AA3A 4LFAK 1LW2A 3NDKA 3AVJA 4V19S 5FPMA 4M45A 3DLGA 5JS2A 4DG1A 1FK9A 2UYTA 4JI5K 1QSSA 4B3RK 2FXUA 4DV0K 5HRPA 4CJWA 3OVNA 4XIUA 4DTOA 2RF2A 1D8YA 1IBKK 3NMUA 2RKIA 3SPYA 3R6MA 3V1RA 5C42A 1OH8A 1YXQA 3R3LA 4FPBA 3SMSA 5IT9O 4KPYA 4YHHK 3AVGA 1SAZA 5AZIA 4BE2A 3RMCA 1WBBA 3RWUA 3O4NA 4B9NA 2WOMA 1O13A 5HRNA 2XY7A 1NK7A 3VQCA 4BEBA 2BH1A 2E20A 4JRPA 4GNIA 3GBTA 1HRHA 4QS8A 4H5WA 2B4JA 3VPZA 4O55A 1X3MA 3ZSYA 4RCHA 3QEVA 1ESVA 3RRHA 1S1UA 2E8AA 3EKSA 4JKAA 5DK5A 1S5JA 1QZ5A 3L2RA 1XNQK 5AZIB 4NCAA 4HWIA 4LFBK 4A2AA 1BIUA 4BR5A 2OTLN 4OPHA 2XY8A 1YJWN 1QQNA 2O4IA 1NG9A 4GV9A 3P5JA 2CGKA 4ID1A 4DV2K 1BA0A 1Y97A 4IO9L 1JLFA 2Q0RA 3SUPA 4O0JA 1C0MA 1WSIA 3ATVA 2HBMA 3PIPL 4DF8A 1Q86O 1VSLA 3H46O 1TAQA 4JKGA 1HMVA 3MWPA 5HOOA 1Q82O 3VQ6A 3VEXA 3G71N 4DU4A 2YCHA 4AHVA 3OYGA 2E6LA 4R5PA 1KVCA 4N5SA 3CYMA 3K9JA 3ASMA 4X65K 3NH0A 1FXXA 4W5QA 5EY4A 3O80A 1L3SA 3DLBA 3CERA 1BHLA 3SK3A 5C0YA 4IDKA 3LZIA 4B9MA 3CCEN 3K9KA 4JKGB 4CJ4A 3J81O 1C1BA 2IVOA 1CZAN 3V81A 5GAEP 3J7ZO 3JYTA 1V4TA 3I8DA 1IBMK 1ZBUA 4DSJA 4FLZA 3OYLA 2UUCK 4B3MK 4MO4A 5C15A 3SBGA 4C1NI 1JLEA 1GLDG 1BCMA 3CQYA 3KLEA 4B1ZA 1KAZA 4B9LA 4NXMK 5C12A 1U4BA 3CCLN 3O9SA 3QBWA 3THYA 1C0GA 1WUAA 1I94K 4RW6A 4FJMA 5AQFA 1QSLA 2G8WA 3Q7CA 1B9FA 4LY7A 4CFAA 1SZ2A 3LP0A 5CE3A 4JKEA 3NHGA 3EL2A 1S1XA 3SI6A 1IJJA 3LDLA 1R0AA 4AHRA 5JICA 3DM2A 4EFHA 1J5EK 3AO4A 5E84A 1VQ9N 3ATUA 5FROA 3NH2A 1TKXA 4FWQA 1V4SA 1HX1A 3NGYA 4CJ5A 3THYB 3W3DA 5MLCQ 4B1YB 3CFOA 2P51A 5AFUH 3O4WA 4FOEA 4KTWA 3OYBA 2I7PA 4BC5A 1EX4A 4CK3A 2E88A 1X9JA 3MXIA 3SJJA 5F0XA 4W5OA 3G0ZA 4PA1A 2JWLA 3UIQA 4FJXA 3I33A 4U7BA 1O1WA 4CFCA 1SS6A 4H0OA 2QA4N 3PSFA 4DR2K 4KTQA 3PIOL 3KTQA 5E26A 3P38A 4WQ4A 4JN4A 1HNWK 1G99A 1ZYQA 3THXA 2HHQA 4DLEA 3J7AP 3PX0A 1JLGA 5BR8K 4LH4A 4E1JA 2FSJA 3QERA 4FJ5A 3PLAA 4BE7B 4B3TK 5DMRA 4LF5K 5J2NA 3AO2A 3KKRA 2HHHK 4CGFA 4FJGA 2IGIA 3OBWA 1ATSA 3TAEA 3SUOA 4EHTA 3CCMN 3DI6A 3T1AA
chains in the Genus database with same CATH topology
4CD1A 3BP8A 3FFKB 4IFEA 2F9TA 3WUHA 4AM6A 4H5TA 3F9MA 1J6ZA 4EHUA 4UY8O 3FZMA 2P9IA 3E9OA 5AQXA 5JLFA 1WOQA 4ISGA 4H0TB 5JLHA 1YI2N 3OBYA 4WFNL 1YF5L 5M1PA 3DAWA 3VGMA 3AGKA 2ZF5O 4BC2A 4JKBA 4FO0A 2NRRA 5C10A 3ENOA 4JKDA 3EO3A 3SMPA 2A3ZA 3U8XA 2W41A 3HTVA 3LDOA 4FWRA 3ZYYX 4BRDA 3S41A 3FGUA 3O9TA 2P9SA 1VQ7N 3OA9A 4PHTX 5GIOA 3BF3A 3CJAA 4FPAA 3VEVA 3CJ1A 4BRQA 2NRWA 2P9IB 3TTCA 3FZHA 3SBTA 3EE8A 3I8BA 5AQLA 5AQSA 3TU5A 1M90O 1JCEA 4A61A 4ILHA 1NGAA 4YOXA 1VQMN 4DCHA 2YX6A 1MWKA 4FWNA 1TYQA 4BG9A 3CXCM 3CMEN 4XEIA 2Q97A 3GOIA 2C1GA 1Y64A 4KH4A 4YOTA 4BRMA 1GLBG 4BC4A 1EO1A 4KH6A 3P39A 5EVZA 2HSTA 4H0PA 2P9SB 4CZFA 2E2PA 4BR0A 4RWTA 4YOWA 2GX9A 3MWTA 2E2QA 3LDNA 3E1YA 3L4IA 5CR4A 3VGKA 4BRHA 4DQ8A 4EAHD 1GLLO 2ZJQL 3CPEA 3MN6A 3QB0A 3ZETA 2IIRA 3AAQA 2QI2A 3O9QA 5AQJA 5M1KA 1QHAA 4B1WB 5AQPA 2J4RA 4IZ9A 3QICA 3CCSN 4JD2B 4BROA 3HBTA 3R8EA 3WXKA 4YDUA 3CC4N 1XC3A 1TYQB 4XH1A 5AQZA 4CBXA 2ZJRL 1Q7YO 1NBWA 3MCAB 1XUPO 2YHWA 1NMDA 4JNEA 5AQQA 4WCEL 5M1NA 4QS9A 2A42A 3QBXA 4O8UA 4CZEA 3KK7A 3O8MA 3G6EN 1W97L 3KZBA 3I55N 4WQ5A 3AGRA 4DHYA 3FLCO 4O5FA 3CPWM 1NGJA 2RE2A 5KPRA 1VQ8N 2BTFA 2NRXA 4B9QA 3ID6A 5ADXA 3CF5L 3M1FA 2P9PA 3DXKA 3VESA 2HF4A 3VEOA 2AP1A 3ZETB 2HOEA 4CI6A 4ISEA 5FPNA 3ULEB 3UKUB 4PL8A 4M7YA 3VF2A 2FF3B 1RGIA 3I56N 4BECA 5BREA 3MMVA 1LCUA 3T7ZA 3CHWA 3A5MC 3FR0A 4FWSA 3IDHA 4BRFA 1YUWA 1NWKA 2Q36A 5C2DA 3D2FA 1E4GT 5AQVA 2GWKA 3SLCA 3LDQA 5CHIA 1YAGA 3W0LA 4H03B 3CC2N 5AQYA 1K8AO 3TSQA 4OPAA 3G4SN 2QTDA 2DPNA 4NLBA 4K42A 3VERA 4HTLA 4BRKA 3HZ6A 3C65A 4OO1J 1KC8O 5F2RA 2P9PB 3DXKB 3JS6A 3R9PA 1K73O 1BOTO 2NRTA 5EX5A 3KWGA 3SJHA 1MDUB 2HMPA 4O8KA 1IG8A 3CJCA 5EXWA 4CZIA 3WXIA 2D4WA 3G25A 1P8ZA 3AY9A 1NM1A 3D2FB 3EZWA 4CZLA 1Q81O 3P4IA 4MLEA 5BN8A 4IOXA 3VTIA 1ILYA 3VETA 4A5BA 3CC7N 4H0YB 5TKWA 4BRCA 3MX5A 2ZJPL 1GLJO 2QWQA 1VQ5N 3E9LA 3FZLA 4CD3A 4JAXA 4H5RA 4MDBA 3VF6A 3QFPA 4BREA 1HUXA 3AAPA 1NGBA 2ASPA 1ATNA 3VEWA 1R59O 3ZX0A 5BPMA 4YOVA 2HBJA 4BVPA 3TPQA 1N8RO 5BR9A 3CCRN 2D0PA 3CI5A 3HSCA 4C1NK 3CIPA 3MK6A 4GY2B 3N4PA 2P9UA 2D0OA 3TSUA 1C0FA 2NRHA 5BRHA 4YOYA 4B1UB 4G9ZA 1VQON 3BF1A 4LC9B 5AQRA 4BQZA 1YVNA 2IVNA 2WFBA 1KD1O 3MN9A 3O08A 5BN9A 1NGCA 4K41A 1HKCA 1K9MO 2YJFA 2I7NA 2QWLA 2NLXA 2P9LA 2WC9A 3F2KA 1DT9A 3FZKA 4Z94A 5BRFA 1DKGD 4WF9L 5AR0A 2Q31A 4F9OA 1Q18A 4A59A 4C23A 4H5NA 2RHKA 3BUZB 4Y0WA 3MN5A 2QWOA 3OHRA 2P9NB 4IEEA 3H6EA 3LM2A 2JWKA 3EN9A 1VQ6N 5GAHP 4YOUA 1Z05A 4IEIA 4BRAA 1OVYA 1D4XA 1H1VA 2H3GX 1VQNN 4IOAL 3FE1A 4JD2A 1ZXOA 4FOIA 2F9WA 2P9UB 4BGBA 3CJ7A 5AQMA 2NRZA 4BR4A 1KAXA 1ZC6A 4RTFD 3H1QA 3UB5A 1M1KO 1RDWX 3UE5A 5AQTA 1DGKN 4KBOA 5F1XA 4WQ4C 1KQSM 5BPLA 2P9LB 4FVUA 3M6GA 5B8HA 2ZGZA 1TUUA 4BRIA 1BG3A 2FF6A 4XJXA 3MDQA 1VAZA 2FSKA 3E9PA 3ZEUA 5AQOA 2GUPA 1YITN 2YHYA 4BY9C 4M63C 1NLVA 1S3XA 3ULEA 2CH5A 3UKUA 5ADXH 2E2OA 2QWPA 3F5TA 4PKGA 3C7NA 5KQ8A 1U6ZA 2GELA 4NB4A 5TKYA 2CGJA 1VQ4N 3U9ZA 5FPMA 3A0IX 5AQGA 3R1XA 2UYTA 3VF4A 2FXUA 3M5RA 1NGEA 4IXCA 1S72N 4H0VB 5GAGP 2F7TA 5C2FA 2NZTA 1MA9B 2GTDA 3O9UA 5M1OA 3NMUA 3VMFB 3R6MA 3ZEUB 3QDKA 3A5LC 1YXQA 4JK8A 2ASMA 1T44A 4PKHA 1VQKN 3R3LA 5AQUA 3IMXA 3VEYA 2W00A 5ELZA 5AQNA 4BGAA 5LY3A 4FPBA 3SMSA 2QWMA 3TSPA 4XH4A 4GV6A 3JXUA 3QMLA 3C7NB 1KAYA 5KQDA 1SQKA 1GLFO 2NNWA 1SAZA 3OW2M 5AZIA 1NGIA 1OKJA 4JKCA 1NGFA 4A57A 5LJVA 4PL7A 1X3NA 1O13A 1JCFA 4WFBL 2CGLA 1T6CA 2KLAA 4AF1A 4ILJA 2E1ZA 4CZHA 2BH1A 4BEBA 1Z6RA 2E20A 2NRVA 3O9RA 4GNIA 3GBTA 5BPNA 4QS8A 4H5WA 5GADP 5JVHL 3CQXA 3VPZA 3MCPA 1X3MA 2CH6A 1JCGA 4RCHA 1ESVA 2E8AA 3EKSA 4JKAA 2VGNA 2PBDA 3CCVN 2YJEA 1QQOA 3H45C 4QS7A 1EQYA 1QZ5A 3ZX2A 3CCJN 3H3NO 1T6DA 5AZIB 1T3VA 5AQIA 2HF3A 1JJ2M 4HWIA 4CJ7A 2QXLA 4FWPA 4M7XA 3QFUA 3WEEB 5GIPA 2QEXN 2AA4A 3A5NC 4A2BA 2Q0UA 4A2AA 4BR5A 4ILGB 2OTLN 4MO5A 3CETA 2A40A 4OPHA 3D6RA 1YJWN 1QQNA 4BR2A 2PFUA 3L0QA 4FSVA 5HL7L 2P9NA 2FSNA 4ISFA 1BO5O 4GV9A 3WQUA 4FWLA 4GV3A 4IJNA 2CGKA 3N4QA 1BA0A 4NLCA 3VEZA 5JVGL 1QVFM 3TTFA 3GE1A 3O1WA 4IO9L 4YDUC 2Q0RA 3LM9A 1NJIO 2V7ZA 2V7YA 3ATVA 1VQPN 2A41A 3Q7BA 2HBMA 4JHDA 5GINA 2ZGYA 5FPEA 3PIPL 1Q86O 3H46O 3VENA 4JKGA 1VQLN 3HM8A 2WBNA 4WQ5C 4CZKA 3MN7A 3MWPA 2QM1A 2W40A 5HOOA 1Q82O 1LOTB 3VEXA 4CZJA 3G71N 3HOTA 5KPZA 2YCHA 2ASOA 4NO7A 4K43A 3FZFA 2FLOA 3BEXA 3HI0A 1GLEG 2IVPA 3K9JA 3TTDA 3GG4A 3EE9A 4BRPA 3A8YA 5EY4A 4BQLA 3O80A 5BRDA 2P9KA 4BRNA 3SAGA 1BDGA 4JHDB 4BC3A 3CERA 2A5XA 3SK3A 2ZWHA 5C0YA 2VCPA 3RSEB 3CCEN 3K9KA 4JKGB 3WXMB 1YIJN 2IVOA 4AM7A 3GL1A 1CZAN 4GVEA 4PKIA 5GAEP 3J7ZO 1V4TA 5JMVA 3HOSA 4CBUA 4IWVA 4MDAA 2V51B 1BA1A 2EWSA 2GWJA 2GEMA 2OANA 2HBKA 4MO4A 3T69A 4DKWA 5C15A 1ATRA 3IUCA 1KXPA 3SBGA 4C1NI 3DXMA 1GLDG 3CQYA 5M1QA 4B1ZA 1KAZA 3DJCA 3WT0A 5C12A 2P9KB 3CCLN 2A6AA 3O9SA 3QBWA 1HKBA 3CJ9A 4BR9A 1U2VA 1C0GA 1XQSC 3O5BA 1WUAA 4H5VA 3ZX3A 2VYPA 1NGHA 2KKZA 3MX2A 3UKRA 4XH5A 5AQFA 1E4FT 3Q7CA 1HLUA 4KH5A 5AZJA 1SZ2A 2Q1NA 3D2EA 3H1VX 4B1XB 1RFQA 3P31A 4JKEA 5CE3A 4YORA 3CCUN 3KWIA 1DEJA 3EL2A 4JEPA 1IJJA 3LDLA 4FL9A 5M1FA 5JICA 3D7EO 3SAFA 4EFHA 3NVKA 1NGGA 5E84A 5H1SQ 1P90A 3AARA 3DXMB 3ATUA 1VQ9N 4FWMA 2D1KA 4L3QA 3IKMA 2QW9A 4FWQA 1HKGA 3LL3A 4WYBA 1V4SA 1HX1A 1RDUA 3EKUA 4A5AA 1U2VB 4I6MA 4IJAA 4H0XB 3ENBA 3W3DA 3L4QA 5MLCQ 2E1YA 3UKRB 3U9DA 4B1YB 1K8KA 1QQMA 2VGMA 3DWLA 3CJBA 1S22A 2VWBA 3O4WA 4FOEA 5AFUH 3WEEA 5DM6L 2OTJN 5AZJB 4FWOA 1QZ6A 3D2EB 3CCQN 2C1IA 1GLCG 2I7PA 2KHOA 5AQWA 2ITMA 4BC5A 4EIAA 1GLAG 3HRGA 4BVOA 1YJNN 2E88A 1X9JA 4IO8A 4BRLA 3J8AA 5F0XA 3NVMA 3A5OC 5AQKA 2JWLA 3L6QA 4B1VA 3DLLL 4R79A 1ZBSA 4MLHA 3C0BA 3I33A 5AFUA 4U7BA 1BUPA 1SS6A 3GDQA 4DB3A 3SAHA 4H0OA 3M3ZA 4I6MB 2QA4N 3O1BA 3E66A 3PIOL 3LDPA 2PAVA 5E26A 4U67L 4BG8A 3WQTA 3WXJA 1NGDA 3P38A 4K25A 1K8KB 4WFAL 3IFRA 4WQ4A 4JN4A 4J8FA 2BUPA 2QWNA 4IDHA 3U4LA 3KHYA 5KPTA 1G99A 5AQHA 3C6HA 4IOCL 2HBLA 4A62A 3VTHA 3CD6N 2YHXA 3H3OB 1YHQN 1BWFO 3KVGA 3ENHA 1TUYA 3ID8A 1HJOA 2FSJA 2QWRA 3VGLA 4E1JA 5I9EB 5DM7L 3PLAA 4BE7B 1BU6O 4JKHA 1HPMA 3O6WA 3RVCA 2YI1A 5EOYA 3WXLA 1W2BM 2Q2RA 4FWKA 4CZMA 3CMAN 3OBWA 4JKFA 1ATSA 3VOVA 3B8AX 2V52B 1QVGM 5FPDA 2E2NA 4JK7A 3RSEA 4CBWA 1YJ9N 4BRGA 4BR7A 4EHTA 1MWMA 4CZGA 3CCMN 4JK9A 5LJWA 2WUSA 3C6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CD1 A;  3BP8 A;  3FFK B;  2F9T A;  3WUH A;  4AM6 A;  4H5T A;  3F9M A;  1J6Z A;  4EHU A;  3FZM A;  2P9I A;  5JLF A;  5AQX A;  1WOQ A;  4ISG A;  4H0T B;  5JLH A;  3DAW A;  3VGM A;  2ZF5 O;  4BC2 A;  4FO0 A;  3ENO A;  3SMP A;  3EO3 A;  2A3Z A;  3U8X A;  2W41 A;  3HTV A;  3LDO A;  4FWR A;  4BRD A;  3S41 A;  3FGU A;  2P9S A;  3BF3 A;  3CJA A;  4FPA A;  3VEV A;  3CJ1 A;  4BRQ A;  2P9I B;  3FZH A;  3I8B A;  5AQL A;  5AQS A;  3TU5 A;  1JCE A;  4A61 A;  1NGA A;  4DCH A;  1MWK A;  4FWN A;  1TYQ A;  4BG9 A;  4XEI A;  2Q97 A;  3GOI A;  1Y64 A;  4BRM A;  1GLB G;  4BC4 A;  5EVZ A;  4H0P A;  2P9S B;  4CZF A;  2E2P A;  4BR0 A;  4RWT A;  2E2Q A;  3LDN A;  3VGK A;  3L4I A;  4BRH A;  4EAH D;  4DQ8 A;  1GLL O;  3MN6 A;  3QB0 A;  3ZET A;  2IIR A;  3AAQ A;  5AQJ A;  1QHA A;  4B1W B;  5AQP A;  2J4R A;  4IZ9 A;  3QIC A;  4JD2 B;  4BRO A;  3HBT A;  3R8E A;  3WXK A;  4YDU A;  1XC3 A;  1TYQ B;  4XH1 A;  5AQZ A;  4CBX A;  1NBW A;  1XUP O;  2YHW A;  1NMD A;  4JNE A;  5AQQ A;  4QS9 A;  2A42 A;  3QBX A;  4CZE A;  3O8M A;  3KZB A;  4WQ5 A;  4DHY A;  3FLC O;  4O5F A;  1NGJ A;  5KPR A;  2BTF A;  4B9Q A;  5ADX A;  3M1F A;  2P9P A;  3DXK A;  3VES A;  2HF4 A;  3VEO A;  2AP1 A;  3ZET B;  2HOE A;  4CI6 A;  4ISE A;  5FPN A;  3ULE B;  3UKU B;  4PL8 A;  4M7Y A;  3VF2 A;  2FF3 B;  1RGI A;  5BRE A;  3MMV A;  1LCU A;  3CHW A;  3A5M C;  3FR0 A;  4FWS A;  3IDH A;  4BRF A;  1YUW A;  1NWK A;  2Q36 A;  3D2F A;  1E4G T;  5AQV A;  2GWK A;  3SLC A;  3LDQ A;  1YAG A;  3W0L A;  4H03 B;  5AQY A;  2DPN A;  4K42 A;  3VER A;  4HTL A;  4BRK A;  3HZ6 A;  5F2R A;  2P9P B;  3DXK B;  3JS6 A;  3R9P A;  1BOT O;  5EX5 A;  3SJH A;  1MDU B;  2HMP A;  4O8K A;  1IG8 A;  3CJC A;  5EXW A;  4CZI A;  3WXI A;  2D4W A;  3G25 A;  1P8Z A;  3AY9 A;  1NM1 A;  3D2F B;  3EZW A;  4CZL A;  3P4I A;  4MLE A;  5BN8 A;  3VET A;  4H0Y B;  4BRC A;  1GLJ O;  2QWQ A;  3FZL A;  4CD3 A;  4JAX A;  4H5R A;  3VF6 A;  3QFP A;  4BRE A;  1HUX A;  3AAP A;  1NGB A;  2ASP A;  1ATN A;  3VEW A;  1R59 O;  3ZX0 A;  5BPM A;  4BVP A;  3TPQ A;  5BR9 A;  3HSC A;  3CI5 A;  3CIP A;  3MK6 A;  4GY2 B;  2P9U A;  2D0O A;  5BRH A;  1C0F A;  2NRH A;  4B1U B;  3BF1 A;  4LC9 B;  5AQR A;  4BQZ A;  1YVN A;  2IVN A;  3MN9 A;  3O08 A;  5BN9 A;  1NGC A;  4K41 A;  1HKC A;  2YJF A;  2I7N A;  2QWL A;  2NLX A;  2P9L A;  3FZK A;  4Z94 A;  5BRF A;  1DKG D;  5AR0 A;  2Q31 A;  4F9O A;  1Q18 A;  4C23 A;  4H5N A;  3BUZ B;  4Y0W A;  3MN5 A;  2QWO A;  3OHR A;  2P9N B;  3H6E A;  3LM2 A;  3EN9 A;  1Z05 A;  4BRA A;  1D4X A;  1H1V A;  2H3G X;  3FE1 A;  4JD2 A;  1ZXO A;  4FOI A;  2F9W A;  2P9U B;  4BGB A;  3CJ7 A;  5AQM A;  4BR4 A;  1KAX A;  1ZC6 A;  4RTF D;  3H1Q A;  3UB5 A;  1RDW X;  3UE5 A;  5AQT A;  1DGK N;  4KBO A;  5F1X A;  4WQ4 C;  5BPL A;  2P9L B;  3M6G A;  5B8H A;  2ZGZ A;  1TUU A;  4BRI A;  1BG3 A;  2FF6 A;  3MDQ A;  2FSK A;  3ZEU A;  5AQO A;  2GUP A;  2YHY A;  4M63 C;  1NLV A;  1S3X A;  3ULE A;  2CH5 A;  3UKU A;  5ADX H;  2E2O A;  2QWP A;  4PKG A;  5KQ8 A;  3C7N A;  1U6Z A;  2GEL A;  4NB4 A;  5TKY A;  2CGJ A;  3U9Z A;  5FPM A;  3A0I X;  5AQG A;  2UYT A;  3VF4 A;  2FXU A;  1NGE A;  4IXC A;  4H0V B;  2NZT A;  1MA9 B;  2GTD A;  3R6M A;  3ZEU B;  3QDK A;  3A5L C;  1YXQ A;  2ASM A;  1T44 A;  4PKH A;  5AQU A;  3IMX A;  3VEY A;  5ELZ A;  5AQN A;  4BGA A;  5LY3 A;  4FPB A;  3SMS A;  2QWM A;  4XH4 A;  3JXU A;  3QML A;  3C7N B;  1KAY A;  5KQD A;  1SQK A;  1GLF O;  1SAZ A;  5AZI A;  1NGI A;  1OKJ A;  5LJV A;  1NGF A;  4PL7 A;  1X3N A;  1JCF A;  2CGL A;  1T6C A;  2E1Z A;  4CZH A;  1Z6R A;  2E20 A;  4GNI A;  3GBT A;  5BPN A;  4QS8 A;  4H5W A;  3CQX A;  3VPZ A;  3MCP A;  1X3M A;  2CH6 A;  1JCG A;  4RCH A;  1ESV A;  2E8A A;  3EKS A;  2PBD A;  2YJE A;  1QQO A;  3H45 C;  4QS7 A;  1EQY A;  1QZ5 A;  3ZX2 A;  3H3N O;  1T6D A;  5AZI B;  5AQI A;  2HF3 A;  4HWI A;  4CJ7 A;  2QXL A;  4FWP A;  4M7X A;  3QFU A;  3WEE B;  2AA4 A;  3A5N C;  4A2B A;  2Q0U A;  4A2A A;  4BR5 A;  4MO5 A;  3CET A;  2A40 A;  1QQN A;  4BR2 A;  3L0Q A;  4FSV A;  2P9N A;  2FSN A;  4ISF A;  1BO5 O;  3WQU A;  4FWL A;  4IJN A;  2CGK A;  1BA0 A;  3VEZ A;  3GE1 A;  3O1W A;  4YDU C;  2Q0R A;  3LM9 A;  2V7Z A;  2V7Y A;  3ATV A;  2A41 A;  4JHD A;  2ZGY A;  5FPE A;  3H46 O;  3VEN A;  3HM8 A;  4WQ5 C;  4CZK A;  3MN7 A;  2QM1 A;  2W40 A;  1LOT B;  3VEX A;  4CZJ A;  5KPZ A;  2YCH A;  2ASO A;  4NO7 A;  4K43 A;  3FZF A;  2FLO A;  3BEX A;  3HI0 A;  1GLE G;  2IVP A;  3GG4 A;  4BRP A;  3A8Y A;  5EY4 A;  4BQL A;  3O80 A;  5BRD A;  2P9K A;  4BRN A;  1BDG A;  4JHD B;  4BC3 A;  3CER A;  2A5X A;  3SK3 A;  2ZWH A;  2VCP A;  3RSE B;  2IVO A;  4AM7 A;  3GL1 A;  1CZA N;  4PKI A;  1V4T A;  5JMV A;  4CBU A;  4IWV A;  2V51 B;  1BA1 A;  2EWS A;  2GWJ A;  2GEM A;  2OAN A;  4MO4 A;  1ATR A;  3IUC A;  1KXP A;  3DXM A;  1GLD G;  3CQY A;  4B1Z A;  1KAZ A;  3DJC A;  3WT0 A;  2P9K B;  2A6A A;  3QBW A;  4BR9 A;  1HKB A;  3CJ9 A;  1U2V A;  1C0G A;  1XQS C;  3O5B A;  1WUA A;  4H5V A;  3ZX3 A;  2VYP A;  1NGH A;  3UKR A;  4XH5 A;  5AQF A;  1E4F T;  1HLU A;  5AZJ A;  1SZ2 A;  2Q1N A;  3D2E A;  3H1V X;  4B1X B;  1RFQ A;  5CE3 A;  1DEJ A;  3EL2 A;  1IJJ A;  3LDL A;  4FL9 A;  5JIC A;  3D7E O;  4EFH A;  1NGG A;  5E84 A;  3DXM B;  3AAR A;  3ATU A;  4FWM A;  2D1K A;  4L3Q A;  2QW9 A;  4FWQ A;  1HKG A;  3LL3 A;  4WYB A;  1V4S A;  1HX1 A;  3EKU A;  1U2V B;  4I6M A;  4IJA A;  4H0X B;  3W3D A;  2E1Y A;  3UKR B;  3U9D A;  4B1Y B;  1K8K A;  1QQM A;  3DWL A;  5AFU H;  3CJB A;  1S22 A;  2VWB A;  3O4W A;  4FOE A;  3WEE A;  5AZJ B;  4FWO A;  1QZ6 A;  3D2E B;  1GLC G;  2I7P A;  2KHO A;  5AQW A;  2ITM A;  4BC5 A;  4EIA A;  1GLA G;  4BVO A;  2E88 A;  1X9J A;  4IO8 A;  4BRL A;  3J8A A;  5F0X A;  5AQK A;  3A5O C;  4B1V A;  3L6Q A;  1ZBS A;  4MLH A;  3C0B A;  3I33 A;  5AFU A;  1BUP A;  3GDQ A;  4DB3 A;  4H0O A;  3M3Z A;  4I6M B;  3O1B A;  3LDP A;  2PAV A;  5E26 A;  4BG8 A;  3WQT A;  3WXJ A;  1NGD A;  4K25 A;  1K8K B;  3IFR A;  4WQ4 A;  4JN4 A;  4J8F A;  2BUP A;  2QWN A;  3U4L A;  3KHY A;  5KPT A;  1G99 A;  5AQH A;  4A62 A;  2YHX A;  3H3O B;  1BWF O;  3KVG A;  3ENH A;  1TUY A;  3ID8 A;  1HJO A;  2FSJ A;  2QWR A;  3VGL A;  4E1J A;  5I9E B;  1BU6 O;  1HPM A;  3O6W A;  2YI1 A;  5EOY A;  3WXL A;  2Q2R A;  4FWK A;  4CZM A;  1ATS A;  3VOV A;  3B8A X;  2V52 B;  5FPD A;  2E2N A;  3RSE A;  4CBW A;  4BRG A;  4BR7 A;  4EHT A;  1MWM A;  4CZG A;  5LJW A;  2WUS A;  2D0P A; 
#chains in the Genus database with same CATH topology
 4CD1 A;  3BP8 A;  1A5W A;  4IFE A;  3LAM A;  4DSI A;  3CYG A;  4E72 A;  2F9T A;  3WUH A;  3THX B;  1RDB A;  3L2U A;  3FZM A;  5JLF A;  5AQX A;  1T8E A;  1WOQ A;  3VQ5 A;  5M1P A;  2P5G A;  4B9V A;  1LV5 A;  4DU1 A;  4FW2 A;  5C10 A;  2W41 A;  2O8E B;  3ZYY X;  3L2Q A;  2Z1I A;  4ELV A;  4C8L A;  1NMN A;  4FPA A;  3CJA A;  4BWJ A;  4KHW A;  3FZH A;  1QHT A;  5HLF A;  5AQL A;  4O0I A;  3F73 A;  4LSN A;  4RW8 A;  1NJW A;  4ILH A;  1NGA A;  2IOC A;  2YX6 A;  1TYQ A;  3HP9 A;  3TAM A;  3NAE A;  4XEI A;  2OPQ A;  1Y64 A;  1GLB G;  4DU3 A;  4DMN A;  4RWT A;  3DRS A;  2GX9 A;  3MWT A;  4OLB A;  3L4I A;  5FRN A;  4ELT A;  2IIR A;  3LZJ A;  2HHV A;  2HHS A;  3VQB A;  2J4R A;  4IZ9 A;  3SNN A;  4J2E A;  4Y1C A;  4BRO A;  1GOA A;  3CC4 N;  1XC3 A;  1TYQ B;  3SV4 A;  3HPO A;  3MCA B;  5M1N A;  1HJR A;  2A42 A;  4CZE A;  4OKE A;  3G6E N;  3KZB A;  4DHY A;  5KPR A;  3OYJ A;  2BTF A;  2NRX A;  2PZS A;  4B9Q A;  4DFJ A;  3QNO A;  4CIG A;  3PO5 A;  3UKU B;  4M7Y A;  1EP4 A;  3I56 N;  4Z4C A;  3PY8 A;  5BRE A;  1K6Y A;  1LCU A;  3CHW A;  3NF9 A;  3A5M C;  1LWC A;  3IDH A;  4E19 A;  2Q36 A;  5C2D A;  4OPJ A;  4Z4I A;  5HRR A;  5CHI A;  4CF0 A;  4H03 B;  3SQ4 A;  3L3V A;  1GOC A;  4HTL A;  3I0R A;  3HJF A;  3NF7 A;  1KC8 O;  3R9P A;  3TAR A;  2VWJ A;  1BOT O;  3AVK A;  4FXD A;  3OYK A;  3HYF A;  3KWG A;  3SJH A;  1N5Y A;  5T7B A;  3CJC A;  1DTQ A;  1B9D A;  4DTJ A;  1SUQ A;  2G8U A;  2D4W A;  1P8Z A;  3AY9 A;  3EZW A;  3D0P A;  4IOX A;  3VTI A;  2UXC K;  1QE1 A;  3VET A;  4A5B A;  3O3H A;  5TKW A;  4ICL A;  4AQY K;  4O5B A;  1EXQ A;  2ZJP L;  1VQ5 N;  1D5A A;  3HK2 A;  1BGX T;  1IKV A;  3TAB A;  3AAP A;  4YOV A;  4BVP A;  4HCC A;  3TPQ A;  4OPK A;  3CIP A;  5C25 A;  3M8P A;  2YKM A;  4YFU A;  5AQR A;  4BQZ A;  1HYV A;  4N76 A;  4FK2 A;  2WON A;  5BN9 A;  3PSI A;  1HKC A;  3K5L A;  1KVB A;  5HBM A;  3VQD A;  2I7N A;  2P9L A;  3DYA A;  4H4O A;  1DKG D;  5AR0 A;  2Q31 A;  1VRU A;  4H5N A;  3H6E A;  4B9T A;  4DR7 K;  4NYN A;  4FYD A;  3EZ5 A;  3L8B A;  3BZK A;  5GAH P;  3ITH A;  2E4L A;  1C0U A;  4BRA A;  1H1V A;  2YNH A;  1JKH A;  3AVA A;  3FE1 A;  4KHU A;  3WNE A;  4CHP A;  2YHB A;  3ZT3 A;  1KAX A;  4RTF D;  3H1Q A;  4F3T A;  1KQS M;  4KBO A;  4RW4 A;  5BPL A;  2P9L B;  3M6G A;  4DV7 K;  4BRI A;  4LH5 A;  3E9P A;  2XY6 A;  4ZHR A;  1YIT N;  4CHO A;  4ZTJ A;  1KCF A;  1S1V A;  3ULE A;  1S1T A;  3F5T A;  5KQ8 A;  1U6Z A;  2R7Y A;  1KLN A;  2CGJ A;  1RTD A;  1C1C A;  1VQ4 N;  4FW1 A;  3BGR A;  1WSH A;  3IRX A;  1NGE A;  1S72 N;  3AO1 A;  2F8S A;  5C2F A;  2D0B A;  1MA9 B;  4DFP A;  2G8F A;  3VMF B;  1FKP A;  3QDK A;  3A5L C;  1RCH A;  1ASV A;  4PKH A;  1L5U A;  3CQ8 A;  3IMX A;  5ELZ A;  1WAJ A;  1S9E A;  4FLW A;  3JXU A;  3QML A;  1VK0 A;  4K8Z A;  4E1N A;  1SKR A;  1NGI A;  5LJV A;  4JKC A;  1NGF A;  4PL7 A;  1XNR K;  4E1M A;  1OH7 A;  3EYZ A;  3RRG A;  4ILJ A;  4I2P A;  1Z6R A;  5GAD P;  3QLH A;  4B3O A;  1T7P A;  4CFB A;  1LWE A;  2CH6 A;  4EP4 A;  2X74 A;  3CCV N;  1QQO A;  3H45 C;  4QS7 A;  3S5T A;  4W5N A;  1T6D A;  4KB1 A;  4FLT A;  2HF3 A;  2HHT A;  4CJ7 A;  2QXL A;  4J2A A;  4M7X A;  3WEE B;  2QEX N;  3A5N C;  2Q0U A;  3CET A;  2A40 A;  3JAM O;  4BR2 A;  1HPZ A;  1N6Q A;  4ISF A;  4M42 A;  3WQU A;  4IJN A;  3ZSV A;  3RMA A;  3VEZ A;  3NCI A;  5JVG L;  3TTF A;  4CEF A;  1NJI O;  2V7Z A;  3HVR A;  3EY1 A;  4JHD A;  5GIN A;  1TL3 A;  3P1G A;  3VEN A;  1VQL N;  3QNN A;  1S1W A;  2W40 A;  4I2Q A;  4DUZ K;  4CZJ A;  1N32 K;  4K43 A;  3DLH A;  2FLO A;  4ZTF A;  3DLR A;  3HI0 A;  2W42 A;  2X6N A;  1JXB A;  5BRD A;  3AVH A;  4RG8 A;  1BDG A;  4JHD B;  1A5X A;  1JXE A;  2RN2 A;  5JEN A;  1WN7 A;  3THV A;  3VQ4 A;  5JMV A;  3OJS A;  3HOS A;  2Y1I A;  4IWV A;  3TAQ A;  4LF4 K;  4MDA A;  4ELU A;  2EWS A;  2GWJ A;  3AVN A;  3WNG A;  2GEM A;  1I3A A;  1CLQ A;  1TGO A;  3PX6 A;  1VSM A;  1I39 A;  5I42 A;  3OYM A;  4DV3 K;  2OZM A;  4PY5 A;  1XQS C;  3O5B A;  4KKO A;  1L3V A;  1TK5 A;  4FCY A;  5C24 A;  1HLU A;  4KH5 A;  5AZJ A;  3H1V X;  4DSL A;  3CCU N;  2VQF K;  1N33 K;  1NK8 A;  4PWD A;  4FL9 A;  4OKJ A;  3D7E O;  2HW3 A;  3SV3 A;  2O8B A;  5HRS A;  4FWM A;  1U04 A;  1HNI A;  2FC0 A;  4WYB A;  4DSF A;  4IJA A;  1J54 A;  4FJL A;  1OVQ A;  4OX9 K;  1K8K A;  1QQM A;  2VGM A;  3CJB A;  1S22 A;  2OTJ N;  4CJ3 A;  5DM6 L;  1BIZ A;  5AZJ B;  4M3T A;  1QZ6 A;  3ZSW A;  3ZSZ A;  2C1I A;  5CZ1 A;  5AQW A;  4CJK A;  4DV6 K;  4EIA A;  3HRG A;  4BVO A;  1YJN N;  1BL3 A;  4BRL A;  3NGI A;  3F9K A;  3NVM A;  2O8B B;  4JI4 K;  3HVT A;  4B1V A;  3L6Q A;  3SQ1 A;  4DS5 A;  1ZBS A;  4CER A;  3C0B A;  5AFU A;  3J7Y P;  2KZZ A;  3GDQ A;  1YTU A;  3SAH A;  3M3Z A;  3O1B A;  1SKS A;  3MXJ A;  4U67 L;  2O8C B;  4BG8 A;  3KLF A;  1K8K B;  4J8F A;  4IDH A;  5KPT A;  3BY5 A;  5AQH A;  1RT2 A;  2DFE A;  3C6H A;  4A62 A;  4BWM A;  3VTH A;  2YHX A;  3H3O B;  1RT3 A;  5LMU K;  3P83 D;  1YHQ N;  4DWI A;  1HJO A;  4IFY A;  3VQ8 A;  4JI1 K;  3HT3 A;  3SPZ A;  4NXN K;  3CMA N;  2XY5 A;  1RT5 A;  3VOV A;  3B8A X;  2V52 B;  3DLK A;  4JK7 A;  1IG9 A;  2QK9 A;  4W5T A;  4F2S A;  1J9A A;  4BRG A;  4BR7 A;  4F2R A;  1MWM A;  4CZG A;  3AVM A;  5LJW A;  2JLE A;  2WUS A;  4CHZ A;  3FFK B;  4QAG A;  1JLQ A;  3AA2 A;  4AM6 A;  1RBS A;  1YI2 N;  4QCL A;  4ISG A;  5JLH A;  3V9S A;  3NH1 A;  3VGM A;  1JLC A;  3OS0 A;  5CZ2 A;  3ENO A;  3SMP A;  3EO3 A;  3U8X A;  3V6D A;  2HVI A;  1NK0 A;  1C6V A;  3FGU A;  2P9S A;  3OYN A;  3L2V A;  3AA4 A;  4DUY K;  3CJ1 A;  3TTC A;  4FZX C;  1QTM A;  3I8B A;  5AQS A;  3TU5 A;  3LDS A;  3C6T A;  4E3S A;  1EET A;  2PYJ A;  1TL1 A;  3VQQ A;  3QEW A;  3KLH A;  4RW7 A;  4CJV A;  4YOT A;  1IKW A;  4BC4 A;  1NK6 A;  4KH6 A;  3P39 A;  4JS5 A;  2P9S B;  4CF1 A;  4CGD A;  4CZF A;  5CYQ A;  2E2Q A;  3LDN A;  3E1Y A;  5CR4 A;  1J5O A;  4N41 A;  1BQM A;  2G8I A;  3MN6 A;  1REV A;  2QI2 A;  3O9Q A;  5AQJ A;  3WNH A;  5M1K A;  4CGH A;  4B1W B;  5AQP A;  4DV1 K;  3ZT4 A;  3QIC A;  2UXD K;  3HBT A;  3WXK A;  1Q7Y O;  5AQZ A;  1S6P A;  1NBW A;  2A1S A;  2YHW A;  4WCE L;  4QS9 A;  1HR0 K;  3QBX A;  3KK7 A;  3O8M A;  3RR7 A;  3K2P A;  1C1A A;  1NGJ A;  1WAF A;  4LD0 A;  4DR5 K;  3ID6 A;  1XMQ K;  1X9W A;  1VHX A;  1TK8 A;  3M1F A;  4DQR A;  4CJE A;  4NCB A;  4CI6 A;  4ISE A;  2ZD1 A;  1UA1 A;  4BEC A;  2HVH A;  3MMV A;  4NCG A;  5J1E A;  4BDZ A;  5AQV A;  2GWK A;  1ZBI A;  3SLC A;  3W0L A;  3CC2 N;  4H4M A;  4CEZ A;  5AQY A;  4FJ8 A;  1VSH A;  2QTD A;  2QXF A;  1W7A A;  4K42 A;  3VER A;  1HYZ A;  2E6M A;  4BAC A;  4F8R A;  3LWL A;  5EX5 A;  4O8K A;  5EXW A;  5LL6 Z;  1QQC A;  1Q81 O;  2O8E A;  4I7F A;  5BN8 A;  2HHU A;  4AHU A;  3E9L A;  4CD3 A;  2D0A A;  4JAX A;  4H5R A;  3ZT2 A;  1HUX A;  3OYA A;  1RBT A;  2ASP A;  4CJR A;  3ZSR A;  1R59 O;  2HBJ A;  1ASW A;  2DY4 A;  3CCR N;  3HSC A;  4FM2 A;  4C1N K;  3THW A;  3TSU A;  2P9U A;  4FJH A;  1C0F A;  1TKZ A;  2XRI A;  3BF1 A;  2I5J A;  1YVN A;  1KD1 O;  3O08 A;  1CZ9 A;  4Z0U A;  2NLX A;  5BRF A;  2WC9 A;  1DT9 A;  2FBY A;  4KHP K;  4F9O A;  4A59 A;  1HNV A;  4CEQ A;  2QWO A;  3OHR A;  2P9N B;  4DTR A;  3LWM A;  4CHY A;  2JWK A;  4LSL A;  4YOU A;  3BZC A;  1UA0 A;  1Z05 A;  2KFN A;  4E7I A;  3THW B;  1X1P A;  4CEB A;  3VQA A;  1ZXO A;  4I9Q A;  4FOI A;  2P9U B;  4NYF A;  4BGB A;  4BR4 A;  1YTA A;  3UB5 A;  1M1K O;  1RBV A;  4IBN A;  5AQT A;  1XWL A;  5B8H A;  1BG3 A;  4XJX A;  1CXQ A;  3MDQ A;  1IBL K;  4E7L A;  1VSI A;  3ZEU A;  3V9W A;  4KRE A;  4FJK A;  4BY9 C;  1RT4 A;  4KO0 A;  1IKX A;  1QSY A;  1RDD A;  1S3X A;  3HST B;  2CH5 A;  3UKU A;  2QWP A;  1NK4 A;  3C7N A;  2DTU A;  5TKY A;  5J2M A;  3U9Z A;  4DTN A;  3A0I X;  5AQG A;  4FLY A;  3VF4 A;  1LWF A;  2D5R A;  4IXC A;  4DQP A;  4H0V B;  5GAG P;  2NZT A;  2G8V A;  3O9U A;  5KGW A;  2ITG A;  4PQU A;  3ZEU B;  1T44 A;  2G8K A;  3MEG A;  5AQU A;  2BGG A;  2W00 A;  3VEY A;  5A2Q O;  5AQN A;  4BGA A;  1XHZ A;  4J2D A;  2QWM A;  3TSP A;  4B3S K;  3MAQ A;  3C7N B;  1GLF O;  2NNW A;  3OW2 M;  1EKE A;  4A57 A;  2RPI A;  1JCF A;  2CGL A;  1T6C A;  3TAN A;  4QOZ B;  2BAN A;  5J2Q A;  3O9R A;  5AJ3 K;  3M8S A;  3CQX A;  2O8D A;  3TR8 A;  5LMN K;  1JCG A;  2Q3S A;  3HP6 A;  2VGN A;  2PBD A;  2YJE A;  3ZX2 A;  1EQY A;  3CCJ N;  4M3U A;  3H3N O;  3RR8 A;  3OYC A;  5AQI A;  4C8O A;  4DQQ A;  2GV9 A;  4EZ6 A;  4FWP A;  4LF8 K;  4Z4G A;  3NBP A;  4ILG B;  4MO5 A;  3U3G A;  3AVF A;  3D6R A;  2PFU A;  3L0Q A;  5HL7 L;  2F4V K;  1BO5 O;  3VA0 A;  2BE2 A;  1J53 A;  4GV3 A;  2O8D B;  2YNG A;  2OCE A;  3QO9 A;  5E41 A;  1TKD A;  1QVF M;  1ASU A;  3GE1 A;  3O1W A;  4YDU C;  3LM9 A;  1FW6 A;  2B5J A;  2V7Y A;  4DFK A;  4FVM A;  3AO5 A;  5FPE A;  3HM8 A;  2WBN A;  4WQ5 C;  4CZK A;  4JV5 K;  4DTM A;  2O4G A;  3HO1 A;  1RBU A;  1HQU A;  5KPZ A;  3HOT A;  1U48 A;  4DQS A;  3FZF A;  1HNX K;  1SKW A;  1GLE G;  2IVP A;  2LSN A;  3TTD A;  4OJR A;  4PUO A;  3GG4 A;  4AH9 A;  4DV4 K;  4AHS A;  2P9K A;  4BRN A;  2A5X A;  3RSE B;  4DR3 K;  5KI6 A;  1YT3 A;  3QIP A;  5FRM A;  4Q5V A;  4HUF A;  4AM7 A;  4GVE A;  3WNF A;  3T19 A;  4CBU A;  2V51 B;  2HBK A;  1ATR A;  1KXP A;  3DXM A;  3S3N A;  1IV0 A;  2HHW A;  2P9K B;  4BR9 A;  3CJ9 A;  1U2V A;  3ZX3 A;  1NGH A;  4JS4 A;  3RMD A;  3UKR A;  2OA8 A;  1KLM A;  4XH5 A;  4B9S A;  1E4F T;  2EHG A;  3D2E A;  3P31 A;  2F8T A;  3KWI A;  1DEJ A;  3ZSO A;  4JEP A;  3AVB A;  3SAF A;  3NVK A;  4B8C A;  1P90 A;  3DXM B;  5H1S Q;  1LAW A;  4L3Q A;  3IKM A;  1ZBF A;  3LPU A;  1D9D A;  3S9H A;  2QW9 A;  3V1O A;  3MXM A;  1HKG A;  3LL3 A;  3QIO A;  3EKU A;  4A5A A;  1U2V B;  3ENB A;  4CES A;  2E1Y A;  3UKR B;  3U9D A;  4CEE A;  4GMJ B;  3DLL L;  3DWL A;  3WEE A;  3V9X A;  2O8F B;  4FWO A;  3D2E B;  5JS1 A;  3MED A;  1GLC G;  3QEP A;  2ITM A;  1GLA G;  2DFH A;  2PY5 A;  4IO8 A;  3J8A A;  4CW7 B;  4HHT A;  4GVM A;  5AQK A;  3A5O C;  4R79 A;  1WBD A;  1JL1 A;  4JI0 K;  3DRP A;  1BUP A;  3C94 A;  4DB3 A;  4DV5 K;  3ZSX A;  4LF7 K;  3E66 A;  2OPS A;  2PAV A;  3LDP A;  2UUB K;  1UWB A;  3WXJ A;  1BCO A;  1NGD A;  4WFA L;  4K25 A;  3IFR A;  3HM9 A;  2YNF A;  2BUP A;  2QWN A;  3KHY A;  3K59 A;  1W9H A;  4IOC L;  1NOY A;  3CD6 N;  1BWF O;  3SYZ A;  1FJG K;  3DLE A;  4E7J A;  2QWR A;  2YNI A;  3VGL A;  4F3O A;  1BU6 O;  3ISN C;  1F21 A;  2EX3 A;  3WXL A;  1S6Q A;  1W2B M;  1IH7 A;  4FWK A;  4CZM A;  3C95 A;  1JL2 A;  1QVG M;  4CJQ A;  2E2N A;  1YJ9 N;  4CBW A;  3ZCM A;  4CFD A;  1VSD A;  3O9T A;  3C6A A;  4UQG A;  5IWA K;  3OS2 A;  1TV6 A;  3E01 A;  4H5T A;  3K57 A;  4UY8 O;  4Y1D A;  4E89 A;  2P9I A;  4H0T B;  3V9U A;  4WFN L;  1YF5 L;  3DAW A;  3AGK A;  2ZF5 O;  3OJU A;  3QEI A;  4JKB A;  4IKF A;  1DLO A;  5D3G A;  2NRR A;  4JKD A;  3ALY A;  3CG7 A;  1L3T A;  2FBT A;  1KSP A;  1RDC A;  4BRD A;  2ATQ A;  3SUQ A;  2B6A A;  3C6U A;  1VQ7 N;  4PHT X;  5GIO A;  4WE1 A;  4FZY A;  1Z25 A;  1WLJ A;  3VEV A;  4FJN A;  4HUG A;  2NRW A;  2P9I B;  4G1Q A;  3SBT A;  4IG0 A;  1M90 O;  2OZS A;  4L8R B;  4A61 A;  4YOX A;  4DCH A;  2FBX A;  1MWK A;  4FWN A;  3AVL A;  2XO7 A;  4FJI A;  3AO3 A;  4KI6 A;  4CJT A;  3MEC A;  4KH4 A;  4JI2 K;  4BRM A;  1KRP A;  1EO1 A;  4B9U A;  4BE1 A;  4YOW A;  4H0P A;  4OKK A;  1NU0 A;  2E2P A;  4BR0 A;  4DLG A;  2KTQ A;  4BRH A;  3JSM A;  2ZJQ L;  1GLL O;  3PUF A;  3QB0 A;  2GBZ A;  2G8H A;  1VSE A;  4LF9 K;  4CIF A;  4HVJ A;  1N36 K;  1EWR A;  4BDP A;  3HPG A;  2X6S A;  4JD2 B;  1X9M A;  3R8E A;  1C0T A;  4XH1 A;  3VN5 A;  4CBX A;  1XUP O;  5AQQ A;  3D45 A;  4JLH A;  1W97 L;  2O8C A;  1TVR A;  3AGR A;  4I9L A;  5ADX A;  3FFI A;  3CF5 L;  1NJZ A;  2P9P A;  3DXK A;  3VEO A;  2AP1 A;  2HOE A;  5FPN A;  3LPT A;  3K5M A;  4AHT A;  1Z26 A;  3VF2 A;  3TWH A;  1RGI A;  1WSJ A;  3CM5 A;  3T7Z A;  4H8K A;  3FR0 A;  4FWS A;  4BRF A;  1NWK A;  4DTU A;  3D2F A;  3QEX A;  1E4G T;  3TAG A;  4FZZ A;  4KHQ A;  4Z4F A;  2IAJ A;  3LDQ A;  1YAG A;  4KAZ A;  3AVC A;  3SUN A;  1N34 K;  3OY9 A;  3G4S N;  2DPN A;  4NLB A;  3TAP A;  4FK4 A;  3HZ6 A;  4HUE A;  5F2R A;  2P9P B;  3DXK B;  3JS6 A;  1NKE A;  1MDU B;  4CJS A;  2HMP A;  1NJY A;  4MQ3 A;  4JYA K;  4CZI A;  3KLG A;  2VG5 A;  2YHA A;  3WXI A;  3G25 A;  3D2F B;  1NM1 A;  4CZL A;  3KKS A;  1ILY A;  3CC7 N;  4H0Y B;  3MX5 A;  1GLJ O;  4FM0 A;  3FZL A;  3KLI A;  4MDB A;  3VQP A;  1NGB A;  1SL0 A;  5KRS A;  1SL2 A;  1BI4 A;  4AIL C;  1N8R O;  2PYL A;  3RTV A;  3MK6 A;  4GY2 B;  3N4P A;  4G9Z A;  2Z1H A;  4CHQ A;  3MN9 A;  1NGC A;  4K41 A;  3DMJ A;  1ZBH A;  2YJF A;  3ZT0 A;  3F2K A;  3FZK A;  3NF6 A;  5J2P A;  4HCB A;  3BUZ B;  4IEE A;  3KIO A;  4KFB A;  4B8A B;  1NKB A;  3EN9 A;  1VQ6 N;  2A1R A;  1BI4 B;  1HQE A;  2H3G X;  4OLA A;  3I0S A;  2F9W A;  5AQM A;  1NJX A;  3O3G A;  1RDW X;  3OS1 A;  1WNS A;  1DGK N;  4WQ4 C;  4CE9 A;  2D0C A;  4KHS A;  1VAZ A;  3QIN A;  1WSE A;  2GUP A;  3QET A;  2YHY A;  4CK1 A;  3DOL A;  1WSF A;  1NLV A;  4M63 C;  5ADX H;  2E2O A;  1Q8I A;  1CXU A;  4KTZ A;  4M41 A;  3R1X A;  1VSF A;  3M5R A;  4CEO A;  3LP2 A;  3HXM A;  2F7T A;  2GTD A;  4OGE A;  5M1O A;  3ZLJ A;  3EEQ A;  4DSE A;  4C8K A;  4O4G A;  4DF4 A;  4JK8 A;  2ASM A;  1VQK N;  2AJQ A;  5LY3 A;  2VWK A;  4XH4 A;  1JLB A;  4GV6 A;  2HHX A;  1KAY A;  5KQD A;  1SQK A;  4DSK A;  1IKY A;  3LP3 A;  1OKJ A;  2KZM A;  4M3R A;  1X3N A;  3HL8 A;  4WFB L;  2KLA A;  4AF1 A;  2E1Z A;  4CZH A;  2BDP A;  3BDP A;  4N56 A;  2NRV A;  5BPN A;  4KHN A;  5JVH L;  5HRO A;  3MCP A;  3AVI A;  3V1Q A;  1NK9 A;  2KFZ A;  4X62 K;  3B6P A;  5I3U A;  3RMB A;  3PX4 A;  1T3V A;  1RT1 A;  2OPR A;  1JJ2 M;  1BQN A;  5GIP A;  3QFU A;  2ZM6 K;  2AA4 A;  2ZQB A;  4A2B A;  4OVL A;  5FLX O;  4E7H A;  1Q9X A;  4FSV A;  2P9N A;  2FSN A;  4CF9 A;  1B92 A;  3AV9 A;  1KFD A;  4FWL A;  2QKB A;  3SZ2 A;  4HTU A;  2KW4 A;  3N4Q A;  4GKJ K;  4CJU A;  4NLC A;  3CFR A;  4DR6 K;  3SQ0 A;  5KRT A;  2W6K A;  1VQP N;  2A41 A;  3Q7B A;  4F4K A;  4KB0 A;  1XHX A;  2ZGY A;  3O3F A;  3S3M A;  4FJ7 A;  4LF6 K;  4JI6 K;  1RBR A;  3MN7 A;  2QM1 A;  3LAK A;  1LOT B;  3KD5 E;  5FDL A;  3KJV A;  3NFA A;  2ASO A;  1BIS A;  4NO7 A;  2ZE2 A;  3BEX A;  2P1J A;  1L3U A;  1X9S A;  4DTS A;  1OH5 A;  3EE9 A;  4BRP A;  1YVU A;  3A8Y A;  4BQL A;  3SAG A;  1JLA A;  2P5O A;  3G10 A;  4BC3 A;  2ZWH A;  2VCP A;  4DTX A;  3NE6 A;  1TK0 A;  1D9F A;  1RT7 A;  3KD1 E;  3WXM B;  1YIJ N;  3GL1 A;  4PKI A;  4DFM A;  1BA1 A;  4Z4H A;  2OAN A;  5K14 A;  3T69 A;  4DKW A;  2W6L A;  3IUC A;  3PV8 A;  3LAN A;  4CGI A;  1KVA A;  3L3U A;  1TAU A;  1OH6 A;  5M1Q A;  3DJC A;  3WT0 A;  3PO4 A;  2A6A A;  1ITG A;  1HKB A;  4H5V A;  4KI4 A;  2VYP A;  1Q9Y A;  2GUI A;  2KKZ A;  3MX2 A;  4FJ9 A;  1QS4 A;  4JI8 K;  3OYI A;  2Q1N A;  4CHN A;  4B1X B;  1RFQ A;  2VG7 A;  3NF8 A;  4YOR A;  2HNY A;  1U47 A;  5M1F A;  3OYE A;  1SV5 A;  1LAV A;  1NGG A;  3OTO K;  1NOZ A;  3AAR A;  4YY3 K;  3NGZ A;  2D1K A;  2VG6 A;  4K8X A;  4IFV A;  4CJP A;  3U6F A;  1RDU A;  3M8R A;  4I6M A;  4H0X B;  3IAY A;  1WB9 A;  3L4Q A;  4E7K A;  1NNE A;  3HPH A;  2VWB A;  3CCQ N;  1T05 A;  4JI7 K;  2KHO A;  3K0S A;  4JI3 K;  3LP1 A;  1UOC A;  3VQ9 A;  3SQ2 A;  4CGG A;  4FLV A;  1CZB A;  5SWM A;  4TSX A;  4MLH A;  4YNQ A;  3B6O A;  1E3M A;  4I6M B;  3T1Y K;  3QES A;  4X64 K;  2UUA K;  3WQT A;  3OYF A;  4CIE A;  3U4L A;  1KFS A;  2KQ2 A;  3KK1 A;  2HBL A;  4EZ9 A;  4CED A;  1XMO K;  4X66 K;  4CF8 A;  4FJJ A;  2UXB K;  3KVG A;  3ENH A;  1TUY A;  3ID8 A;  5I9E B;  5DM7 L;  4JKH A;  3RVC A;  1HPM A;  2OPP A;  3O6W A;  4C8N A;  2YI1 A;  5EOY A;  3CM6 A;  3K5N A;  4FLU A;  2Q2R A;  4FM1 A;  4JKF A;  1XC9 A;  3IG1 A;  5FPD A;  3RSE A;  1SL1 A;  1RDA A;  4LFC K;  3LAL A;  4JK9 A;  2F96 A;  4C8M A;  2D0P A;  1RTI A;  2IC3 A;  4KRF A;  3F9M A;  1J6Z A;  4EHU A;  5SZT A;  3E9O A;  4AHC A;  3OBY A;  4OGC A;  4BC2 A;  4FO0 A;  4GW6 A;  2A3Z A;  2QKK A;  4DTP A;  5KTQ A;  3HTV A;  3LDO A;  4FWR A;  4GKK K;  4KV8 A;  3S41 A;  4B08 A;  3OA9 A;  3CFP A;  4DS4 A;  3J80 O;  4JRQ A;  2HB5 A;  3BF3 A;  4CJF A;  4BRQ A;  3U3Y A;  3EE8 A;  4K0K K;  4CEA A;  3KK3 A;  3M8Q A;  1JCE A;  1VRT A;  3OYD A;  1VQM N;  3CXC M;  4BG9 A;  3CME N;  4BE0 A;  2Q97 A;  3GOI A;  1RT6 A;  2C1G A;  5EVZ A;  3VQE A;  2HST A;  4W5R A;  2HHI A;  2O8F A;  1KTQ A;  2YV0 X;  3VGK A;  4EAH D;  4DQ8 A;  3CPE A;  5CYM A;  3ZET A;  2Z1G A;  3AAQ A;  1QHA A;  3CCS N;  5CY4 A;  4YDU A;  1U49 A;  4M3Z A;  2ZJR L;  4JNE A;  1NMD A;  3K5O A;  1VSK A;  4O8U A;  1RNH A;  2HNZ A;  3OYH A;  3I55 N;  4WQ5 A;  3CPW M;  3FLC O;  4O5F A;  1VQ8 N;  2RE2 A;  4RW9 A;  4CF2 A;  1HNZ K;  5KGX A;  2X78 A;  1S9G A;  1RTJ A;  3VES A;  2HF4 A;  3ZET B;  1ZBL A;  3ULE B;  4PL8 A;  2FF3 B;  1IO2 A;  1DTT A;  4FK0 A;  3MEE A;  4CK2 A;  1GOB A;  1A5V A;  3T3F A;  4CVN E;  1YUW A;  4CJL A;  3DOK A;  3V4I A;  4KHY A;  3SCX A;  1K8A O;  2HND A;  3TSQ A;  4OPA A;  1G15 A;  4O44 A;  3T1H K;  4BRK A;  2HMI A;  3C65 A;  4OO1 J;  4J2B A;  1K73 O;  1XI1 A;  3VA3 A;  5HP1 A;  4DR1 K;  4CCH A;  4MFB A;  2NRT A;  3A2F A;  1U45 A;  1IG8 A;  4BDY A;  2FBV A;  2NUB A;  2XHB A;  4M3W A;  3TI0 A;  4Z4E A;  3P4I A;  4MLE A;  1HYS A;  3DRR A;  1NK5 A;  4BRC A;  2QWQ A;  1MU2 A;  3VF6 A;  3QFP A;  3ZT1 A;  4FLX A;  4BRE A;  1EWQ A;  5BPM A;  1ATN A;  3VEW A;  3ZX0 A;  4IG3 A;  5EU7 A;  4CGJ A;  2UU9 K;  2JGU A;  5BR9 A;  3H08 A;  2IS3 A;  3CI5 A;  3AA5 X;  2D0O A;  5BRH A;  2NRH A;  4YOY A;  4B1U B;  1VQO N;  4LC9 B;  2IDO A;  2Y1J A;  2IVN A;  2WFB A;  1K9M O;  3V9Z A;  3L2W A;  2QWL A;  4Z94 A;  1FKO A;  4DQI A;  2VQE K;  4WF9 L;  2ETJ A;  1Q18 A;  4C23 A;  2RHK A;  4Y0W A;  3MN5 A;  3LM2 A;  3O4Q A;  3ZSQ A;  3ULD A;  1RIL A;  1T03 A;  4IEI A;  4Q0B A;  1OVY A;  1D4X A;  2Z1J A;  1VQN N;  4M3Y A;  4IOA L;  1RTH A;  4JD2 A;  3CJ7 A;  2NRZ A;  3TAF A;  4ID5 A;  1ZC6 A;  1NKC A;  3UE5 A;  5F1X A;  1LW0 A;  3K58 A;  4M3X A;  4EP5 A;  4CEC A;  4FVU A;  2ZGZ A;  1TUU A;  3KK2 A;  2YKN A;  2FF6 A;  3IS9 A;  1W0H A;  1VSJ A;  2FSK A;  4E0D A;  5AQO A;  2WTU A;  3VQ7 A;  1WSG A;  4N47 A;  1UAX A;  1TKT A;  3S3O A;  4PKG A;  4DR4 K;  2DFF A;  2OYQ A;  2GEL A;  4NB4 A;  2E5L K;  3AA3 A;  4LFA K;  1LW2 A;  3NDK A;  3AVJ A;  4V19 S;  5FPM A;  4M45 A;  3DLG A;  5JS2 A;  4DG1 A;  1FK9 A;  2UYT A;  4JI5 K;  1QSS A;  4B3R K;  2FXU A;  4DV0 K;  5HRP A;  4CJW A;  3OVN A;  4XIU A;  4DTO A;  2RF2 A;  1D8Y A;  1IBK K;  3NMU A;  2RKI A;  3SPY A;  3R6M A;  3V1R A;  5C42 A;  1OH8 A;  1YXQ A;  3R3L A;  4FPB A;  3SMS A;  5IT9 O;  4KPY A;  4YHH K;  3AVG A;  1SAZ A;  5AZI A;  4BE2 A;  3RMC A;  1WBB A;  3RWU A;  3O4N A;  4B9N A;  2WOM A;  1O13 A;  5HRN A;  2XY7 A;  1NK7 A;  3VQC A;  4BEB A;  2BH1 A;  2E20 A;  4JRP A;  4GNI A;  3GBT A;  1HRH A;  4QS8 A;  4H5W A;  2B4J A;  3VPZ A;  4O55 A;  1X3M A;  3ZSY A;  4RCH A;  3QEV A;  1ESV A;  3RRH A;  1S1U A;  2E8A A;  3EKS A;  4JKA A;  5DK5 A;  1S5J A;  1QZ5 A;  3L2R A;  1XNQ K;  5AZI B;  4NCA A;  4HWI A;  4LFB K;  4A2A A;  1BIU A;  4BR5 A;  2OTL N;  4OPH A;  2XY8 A;  1YJW N;  1QQN A;  2O4I A;  1NG9 A;  4GV9 A;  3P5J A;  2CGK A;  4ID1 A;  4DV2 K;  1BA0 A;  1Y97 A;  4IO9 L;  1JLF A;  2Q0R A;  3SUP A;  4O0J A;  1C0M A;  1WSI A;  3ATV A;  2HBM A;  3PIP L;  4DF8 A;  1Q86 O;  1VSL A;  3H46 O;  1TAQ A;  4JKG A;  1HMV A;  3MWP A;  5HOO A;  1Q82 O;  3VQ6 A;  3VEX A;  3G71 N;  4DU4 A;  2YCH A;  4AHV A;  3OYG A;  2E6L A;  4R5P A;  1KVC A;  4N5S A;  3CYM A;  3K9J A;  3ASM A;  4X65 K;  3NH0 A;  1FXX A;  4W5Q A;  5EY4 A;  3O80 A;  1L3S A;  3DLB A;  3CER A;  1BHL A;  3SK3 A;  5C0Y A;  4IDK A;  3LZI A;  4B9M A;  3CCE N;  3K9K A;  4JKG B;  4CJ4 A;  3J81 O;  1C1B A;  2IVO A;  1CZA N;  3V81 A;  5GAE P;  3J7Z O;  3JYT A;  1V4T A;  3I8D A;  1IBM K;  1ZBU A;  4DSJ A;  4FLZ A;  3OYL A;  2UUC K;  4B3M K;  4MO4 A;  5C15 A;  3SBG A;  4C1N I;  1JLE A;  1GLD G;  1BCM A;  3CQY A;  3KLE A;  4B1Z A;  1KAZ A;  4B9L A;  4NXM K;  5C12 A;  1U4B A;  3CCL N;  3O9S A;  3QBW A;  3THY A;  1C0G A;  1WUA A;  1I94 K;  4RW6 A;  4FJM A;  5AQF A;  1QSL A;  2G8W A;  3Q7C A;  1B9F A;  4LY7 A;  4CFA A;  1SZ2 A;  3LP0 A;  5CE3 A;  4JKE A;  3NHG A;  3EL2 A;  1S1X A;  3SI6 A;  1IJJ A;  3LDL A;  1R0A A;  4AHR A;  5JIC A;  3DM2 A;  4EFH A;  1J5E K;  3AO4 A;  5E84 A;  1VQ9 N;  3ATU A;  5FRO A;  3NH2 A;  1TKX A;  4FWQ A;  1V4S A;  1HX1 A;  3NGY A;  4CJ5 A;  3THY B;  3W3D A;  5MLC Q;  4B1Y B;  3CFO A;  2P51 A;  5AFU H;  3O4W A;  4FOE A;  4KTW A;  3OYB A;  2I7P A;  4BC5 A;  1EX4 A;  4CK3 A;  2E88 A;  1X9J A;  3MXI A;  3SJJ A;  5F0X A;  4W5O A;  3G0Z A;  4PA1 A;  2JWL A;  3UIQ A;  4FJX A;  3I33 A;  4U7B A;  1O1W A;  4CFC A;  1SS6 A;  4H0O A;  2QA4 N;  3PSF A;  4DR2 K;  4KTQ A;  3PIO L;  3KTQ A;  5E26 A;  3P38 A;  4WQ4 A;  4JN4 A;  1HNW K;  1G99 A;  1ZYQ A;  3THX A;  2HHQ A;  4DLE A;  3J7A P;  3PX0 A;  1JLG A;  5BR8 K;  4LH4 A;  4E1J A;  2FSJ A;  3QER A;  4FJ5 A;  3PLA A;  4BE7 B;  4B3T K;  5DMR A;  4LF5 K;  5J2N A;  3AO2 A;  3KKR A;  2HHH K;  4CGF A;  4FJG A;  2IGI A;  3OBW A;  1ATS A;  3TAE A;  3SUO A;  4EHT A;  3CCM N;  3DI6 A;  3T1A A; 
#chains in the Genus database with same CATH homology
 4CD1 A;  3BP8 A;  3FFK B;  4IFE A;  2F9T A;  3WUH A;  4AM6 A;  4H5T A;  3F9M A;  1J6Z A;  4EHU A;  4UY8 O;  3FZM A;  2P9I A;  3E9O A;  5AQX A;  5JLF A;  1WOQ A;  4ISG A;  4H0T B;  5JLH A;  1YI2 N;  3OBY A;  4WFN L;  1YF5 L;  5M1P A;  3DAW A;  3VGM A;  3AGK A;  2ZF5 O;  4BC2 A;  4JKB A;  4FO0 A;  2NRR A;  5C10 A;  3ENO A;  4JKD A;  3EO3 A;  3SMP A;  2A3Z A;  3U8X A;  2W41 A;  3HTV A;  3LDO A;  4FWR A;  3ZYY X;  4BRD A;  3S41 A;  3FGU A;  3O9T A;  2P9S A;  1VQ7 N;  3OA9 A;  4PHT X;  5GIO A;  3BF3 A;  3CJA A;  4FPA A;  3VEV A;  3CJ1 A;  4BRQ A;  2NRW A;  2P9I B;  3TTC A;  3FZH A;  3SBT A;  3EE8 A;  3I8B A;  5AQL A;  5AQS A;  3TU5 A;  1M90 O;  1JCE A;  4A61 A;  4ILH A;  1NGA A;  4YOX A;  1VQM N;  4DCH A;  2YX6 A;  1MWK A;  4FWN A;  1TYQ A;  4BG9 A;  3CXC M;  3CME N;  4XEI A;  2Q97 A;  3GOI A;  2C1G A;  1Y64 A;  4KH4 A;  4YOT A;  4BRM A;  1GLB G;  4BC4 A;  1EO1 A;  4KH6 A;  3P39 A;  5EVZ A;  2HST A;  4H0P A;  2P9S B;  4CZF A;  2E2P A;  4BR0 A;  4RWT A;  4YOW A;  2GX9 A;  3MWT A;  2E2Q A;  3LDN A;  3E1Y A;  3L4I A;  5CR4 A;  3VGK A;  4BRH A;  4DQ8 A;  4EAH D;  1GLL O;  2ZJQ L;  3CPE A;  3MN6 A;  3QB0 A;  3ZET A;  2IIR A;  3AAQ A;  2QI2 A;  3O9Q A;  5AQJ A;  5M1K A;  1QHA A;  4B1W B;  5AQP A;  2J4R A;  4IZ9 A;  3QIC A;  3CCS N;  4JD2 B;  4BRO A;  3HBT A;  3R8E A;  3WXK A;  4YDU A;  3CC4 N;  1XC3 A;  1TYQ B;  4XH1 A;  5AQZ A;  4CBX A;  2ZJR L;  1Q7Y O;  1NBW A;  3MCA B;  1XUP O;  2YHW A;  1NMD A;  4JNE A;  5AQQ A;  4WCE L;  5M1N A;  4QS9 A;  2A42 A;  3QBX A;  4O8U A;  4CZE A;  3KK7 A;  3O8M A;  3G6E N;  1W97 L;  3KZB A;  3I55 N;  4WQ5 A;  3AGR A;  4DHY A;  3FLC O;  4O5F A;  3CPW M;  1NGJ A;  2RE2 A;  5KPR A;  1VQ8 N;  2BTF A;  2NRX A;  4B9Q A;  3ID6 A;  5ADX A;  3CF5 L;  3M1F A;  2P9P A;  3DXK A;  3VES A;  2HF4 A;  3VEO A;  2AP1 A;  3ZET B;  2HOE A;  4CI6 A;  4ISE A;  5FPN A;  3ULE B;  3UKU B;  4PL8 A;  4M7Y A;  3VF2 A;  2FF3 B;  1RGI A;  3I56 N;  4BEC A;  5BRE A;  3MMV A;  1LCU A;  3T7Z A;  3CHW A;  3A5M C;  3FR0 A;  4FWS A;  3IDH A;  4BRF A;  1YUW A;  1NWK A;  2Q36 A;  5C2D A;  3D2F A;  1E4G T;  5AQV A;  2GWK A;  3SLC A;  3LDQ A;  5CHI A;  1YAG A;  3W0L A;  4H03 B;  3CC2 N;  5AQY A;  1K8A O;  3TSQ A;  4OPA A;  3G4S N;  2QTD A;  2DPN A;  4NLB A;  4K42 A;  3VER A;  4HTL A;  4BRK A;  3HZ6 A;  3C65 A;  4OO1 J;  1KC8 O;  5F2R A;  2P9P B;  3DXK B;  3JS6 A;  3R9P A;  1K73 O;  1BOT O;  2NRT A;  5EX5 A;  3KWG A;  3SJH A;  1MDU B;  2HMP A;  4O8K A;  1IG8 A;  3CJC A;  5EXW A;  4CZI A;  3WXI A;  2D4W A;  3G25 A;  1P8Z A;  3AY9 A;  1NM1 A;  3D2F B;  3EZW A;  4CZL A;  1Q81 O;  3P4I A;  4MLE A;  5BN8 A;  4IOX A;  3VTI A;  1ILY A;  3VET A;  4A5B A;  3CC7 N;  4H0Y B;  5TKW A;  4BRC A;  3MX5 A;  2ZJP L;  1GLJ O;  2QWQ A;  1VQ5 N;  3E9L A;  3FZL A;  4CD3 A;  4JAX A;  4H5R A;  4MDB A;  3VF6 A;  3QFP A;  4BRE A;  1HUX A;  3AAP A;  1NGB A;  2ASP A;  1ATN A;  3VEW A;  1R59 O;  3ZX0 A;  5BPM A;  4YOV A;  2HBJ A;  4BVP A;  3TPQ A;  1N8R O;  5BR9 A;  3CCR N;  2D0P A;  3CI5 A;  3HSC A;  4C1N K;  3CIP A;  3MK6 A;  4GY2 B;  3N4P A;  2P9U A;  2D0O A;  3TSU A;  1C0F A;  2NRH A;  5BRH A;  4YOY A;  4B1U B;  4G9Z A;  1VQO N;  3BF1 A;  4LC9 B;  5AQR A;  4BQZ A;  1YVN A;  2IVN A;  2WFB A;  1KD1 O;  3MN9 A;  3O08 A;  5BN9 A;  1NGC A;  4K41 A;  1HKC A;  1K9M O;  2YJF A;  2I7N A;  2QWL A;  2NLX A;  2P9L A;  2WC9 A;  3F2K A;  1DT9 A;  3FZK A;  4Z94 A;  5BRF A;  1DKG D;  4WF9 L;  5AR0 A;  2Q31 A;  4F9O A;  1Q18 A;  4A59 A;  4C23 A;  4H5N A;  2RHK A;  3BUZ B;  4Y0W A;  3MN5 A;  2QWO A;  3OHR A;  2P9N B;  4IEE A;  3H6E A;  3LM2 A;  2JWK A;  3EN9 A;  1VQ6 N;  5GAH P;  4YOU A;  1Z05 A;  4IEI A;  4BRA A;  1OVY A;  1D4X A;  1H1V A;  2H3G X;  1VQN N;  4IOA L;  3FE1 A;  4JD2 A;  1ZXO A;  4FOI A;  2F9W A;  2P9U B;  4BGB A;  3CJ7 A;  5AQM A;  2NRZ A;  4BR4 A;  1KAX A;  1ZC6 A;  4RTF D;  3H1Q A;  3UB5 A;  1M1K O;  1RDW X;  3UE5 A;  5AQT A;  1DGK N;  4KBO A;  5F1X A;  4WQ4 C;  1KQS M;  5BPL A;  2P9L B;  4FVU A;  3M6G A;  5B8H A;  2ZGZ A;  1TUU A;  4BRI A;  1BG3 A;  2FF6 A;  4XJX A;  3MDQ A;  1VAZ A;  2FSK A;  3E9P A;  3ZEU A;  5AQO A;  2GUP A;  1YIT N;  2YHY A;  4BY9 C;  4M63 C;  1NLV A;  1S3X A;  3ULE A;  2CH5 A;  3UKU A;  5ADX H;  2E2O A;  2QWP A;  3F5T A;  4PKG A;  3C7N A;  5KQ8 A;  1U6Z A;  2GEL A;  4NB4 A;  5TKY A;  2CGJ A;  1VQ4 N;  3U9Z A;  5FPM A;  3A0I X;  5AQG A;  3R1X A;  2UYT A;  3VF4 A;  2FXU A;  3M5R A;  1NGE A;  4IXC A;  1S72 N;  4H0V B;  5GAG P;  2F7T A;  5C2F A;  2NZT A;  1MA9 B;  2GTD A;  3O9U A;  5M1O A;  3NMU A;  3VMF B;  3R6M A;  3ZEU B;  3QDK A;  3A5L C;  1YXQ A;  4JK8 A;  2ASM A;  1T44 A;  4PKH A;  1VQK N;  3R3L A;  5AQU A;  3IMX A;  3VEY A;  2W00 A;  5ELZ A;  5AQN A;  4BGA A;  5LY3 A;  4FPB A;  3SMS A;  2QWM A;  3TSP A;  4XH4 A;  4GV6 A;  3JXU A;  3QML A;  3C7N B;  1KAY A;  5KQD A;  1SQK A;  1GLF O;  2NNW A;  1SAZ A;  3OW2 M;  5AZI A;  1NGI A;  1OKJ A;  4JKC A;  1NGF A;  4A57 A;  5LJV A;  4PL7 A;  1X3N A;  1O13 A;  1JCF A;  4WFB L;  2CGL A;  1T6C A;  2KLA A;  4AF1 A;  4ILJ A;  2E1Z A;  4CZH A;  2BH1 A;  4BEB A;  1Z6R A;  2E20 A;  2NRV A;  3O9R A;  4GNI A;  3GBT A;  5BPN A;  4QS8 A;  4H5W A;  5GAD P;  5JVH L;  3CQX A;  3VPZ A;  3MCP A;  1X3M A;  2CH6 A;  1JCG A;  4RCH A;  1ESV A;  2E8A A;  3EKS A;  4JKA A;  2VGN A;  2PBD A;  3CCV N;  2YJE A;  1QQO A;  3H45 C;  4QS7 A;  1EQY A;  1QZ5 A;  3ZX2 A;  3CCJ N;  3H3N O;  1T6D A;  5AZI B;  1T3V A;  5AQI A;  2HF3 A;  1JJ2 M;  4HWI A;  4CJ7 A;  2QXL A;  4FWP A;  4M7X A;  3QFU A;  3WEE B;  5GIP A;  2QEX N;  2AA4 A;  3A5N C;  4A2B A;  2Q0U A;  4A2A A;  4BR5 A;  4ILG B;  2OTL N;  4MO5 A;  3CET A;  2A40 A;  4OPH A;  3D6R A;  1YJW N;  1QQN A;  4BR2 A;  2PFU A;  3L0Q A;  4FSV A;  5HL7 L;  2P9N A;  2FSN A;  4ISF A;  1BO5 O;  4GV9 A;  3WQU A;  4FWL A;  4GV3 A;  4IJN A;  2CGK A;  3N4Q A;  1BA0 A;  4NLC A;  3VEZ A;  5JVG L;  1QVF M;  3TTF A;  3GE1 A;  3O1W A;  4IO9 L;  4YDU C;  2Q0R A;  3LM9 A;  1NJI O;  2V7Z A;  2V7Y A;  3ATV A;  1VQP N;  2A41 A;  3Q7B A;  2HBM A;  4JHD A;  5GIN A;  2ZGY A;  5FPE A;  3PIP L;  1Q86 O;  3H46 O;  3VEN A;  4JKG A;  1VQL N;  3HM8 A;  2WBN A;  4WQ5 C;  4CZK A;  3MN7 A;  3MWP A;  2QM1 A;  2W40 A;  5HOO A;  1Q82 O;  1LOT B;  3VEX A;  4CZJ A;  3G71 N;  3HOT A;  5KPZ A;  2YCH A;  2ASO A;  4NO7 A;  4K43 A;  3FZF A;  2FLO A;  3BEX A;  3HI0 A;  1GLE G;  2IVP A;  3K9J A;  3TTD A;  3GG4 A;  3EE9 A;  4BRP A;  3A8Y A;  5EY4 A;  4BQL A;  3O80 A;  5BRD A;  2P9K A;  4BRN A;  3SAG A;  1BDG A;  4JHD B;  4BC3 A;  3CER A;  2A5X A;  3SK3 A;  2ZWH A;  5C0Y A;  2VCP A;  3RSE B;  3CCE N;  3K9K A;  4JKG B;  3WXM B;  1YIJ N;  2IVO A;  4AM7 A;  3GL1 A;  1CZA N;  4GVE A;  4PKI A;  5GAE P;  3J7Z O;  1V4T A;  5JMV A;  3HOS A;  4CBU A;  4IWV A;  4MDA A;  2V51 B;  1BA1 A;  2EWS A;  2GWJ A;  2GEM A;  2OAN A;  2HBK A;  4MO4 A;  3T69 A;  4DKW A;  5C15 A;  1ATR A;  3IUC A;  1KXP A;  3SBG A;  4C1N I;  3DXM A;  1GLD G;  3CQY A;  5M1Q A;  4B1Z A;  1KAZ A;  3DJC A;  3WT0 A;  5C12 A;  2P9K B;  3CCL N;  2A6A A;  3O9S A;  3QBW A;  1HKB A;  3CJ9 A;  4BR9 A;  1U2V A;  1C0G A;  1XQS C;  3O5B A;  1WUA A;  4H5V A;  3ZX3 A;  2VYP A;  1NGH A;  2KKZ A;  3MX2 A;  3UKR A;  4XH5 A;  5AQF A;  1E4F T;  3Q7C A;  1HLU A;  4KH5 A;  5AZJ A;  1SZ2 A;  2Q1N A;  3D2E A;  3H1V X;  4B1X B;  1RFQ A;  3P31 A;  4JKE A;  5CE3 A;  4YOR A;  3CCU N;  3KWI A;  1DEJ A;  3EL2 A;  4JEP A;  1IJJ A;  3LDL A;  4FL9 A;  5M1F A;  5JIC A;  3D7E O;  3SAF A;  4EFH A;  3NVK A;  1NGG A;  5E84 A;  5H1S Q;  1P90 A;  3AAR A;  3DXM B;  3ATU A;  1VQ9 N;  4FWM A;  2D1K A;  4L3Q A;  3IKM A;  2QW9 A;  4FWQ A;  1HKG A;  3LL3 A;  4WYB A;  1V4S A;  1HX1 A;  1RDU A;  3EKU A;  4A5A A;  1U2V B;  4I6M A;  4IJA A;  4H0X B;  3ENB A;  3W3D A;  3L4Q A;  5MLC Q;  2E1Y A;  3UKR B;  3U9D A;  4B1Y B;  1K8K A;  1QQM A;  2VGM A;  3DWL A;  3CJB A;  1S22 A;  2VWB A;  3O4W A;  4FOE A;  5AFU H;  3WEE A;  5DM6 L;  2OTJ N;  5AZJ B;  4FWO A;  1QZ6 A;  3D2E B;  3CCQ N;  2C1I A;  1GLC G;  2I7P A;  2KHO A;  5AQW A;  2ITM A;  4BC5 A;  4EIA A;  1GLA G;  3HRG A;  4BVO A;  1YJN N;  2E88 A;  1X9J A;  4IO8 A;  4BRL A;  3J8A A;  5F0X A;  3NVM A;  3A5O C;  5AQK A;  2JWL A;  3L6Q A;  4B1V A;  3DLL L;  4R79 A;  1ZBS A;  4MLH A;  3C0B A;  3I33 A;  5AFU A;  4U7B A;  1BUP A;  1SS6 A;  3GDQ A;  4DB3 A;  3SAH A;  4H0O A;  3M3Z A;  4I6M B;  2QA4 N;  3O1B A;  3E66 A;  3PIO L;  3LDP A;  2PAV A;  5E26 A;  4U67 L;  4BG8 A;  3WQT A;  3WXJ A;  1NGD A;  3P38 A;  4K25 A;  1K8K B;  4WFA L;  3IFR A;  4WQ4 A;  4JN4 A;  4J8F A;  2BUP A;  2QWN A;  4IDH A;  3U4L A;  3KHY A;  5KPT A;  1G99 A;  5AQH A;  3C6H A;  4IOC L;  2HBL A;  4A62 A;  3VTH A;  3CD6 N;  2YHX A;  3H3O B;  1YHQ N;  1BWF O;  3KVG A;  3ENH A;  1TUY A;  3ID8 A;  1HJO A;  2FSJ A;  2QWR A;  3VGL A;  4E1J A;  5I9E B;  5DM7 L;  3PLA A;  4BE7 B;  1BU6 O;  4JKH A;  1HPM A;  3O6W A;  3RVC A;  2YI1 A;  5EOY A;  3WXL A;  1W2B M;  2Q2R A;  4FWK A;  4CZM A;  3CMA N;  3OBW A;  4JKF A;  1ATS A;  3VOV A;  3B8A X;  2V52 B;  1QVG M;  5FPD A;  2E2N A;  4JK7 A;  3RSE A;  4CBW A;  1YJ9 N;  4BRG A;  4BR7 A;  4EHT A;  1MWM A;  4CZG A;  3CCM N;  4JK9 A;  5LJW A;  2WUS A;  3C6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...