1NLVA

Crystal structure of dictyostelium discoideum actin complexed with ca atp and human gelsolin segment 1
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
372
structure length
364
Chain Sequence
DVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin
publication title The Structure of Non-Vertebrate Actin: Implications For The ATP Hydrolytic Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 115
structure length 364
sequence length 372
ec nomenclature
pdb deposition date 2003-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nlvA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nlvA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1nlvA03
3ULEB 3CETA 3VESA 4C23A 1ZBSA 4WYBA 1NBWA 2P9UA 3CQYA 2HMPA 3ATVA 4BRQA 3B8AX 5BR9A 4CI6A 1GLJO 4K42A 3EO3A 4FPBA 3MN5A 3QBWA 4MO4A 3IDHA 1Y64A 4CBUA 3VEYA 3ULEA 3W0LA 4WQ4C 3VETA 5AZJB 4O8KA 4FWSA 4NB4A 5AQHA 4AM7A 2E2NA 5BPLA 5AQKA 1KAXA 4CD1A 1NMDA 3DXMB 3VF2A 4EHTA 3I33A 1LOTB 5AQZA 5AQPA 2IVPA 1NLVA 4QS7A 4BRDA 5LY3A 3MK6A 4JD2B 2E2OA 4H0VB 1MWMA 3CIPA 4FOEA 3H1VX 4QS8A 3WT0A 5AZJA 2QWQA 4CD3A 1BDGA 2NRHA 1HX1A 3DXMA 4BQLA 4BR5A 2A5XA 3H6EA 2QW9A 2BUPA 1QZ5A 1E4FT 4I6MA 3P4IA 4JD2A 3GL1A 1X3MA 5F1XA 2YJFA 3GE1A 1KAYA 5AQFA 4PKIA 1CZAN 2HF4A 1DKGD 4BGAA 2Q36A 2PBDA 5AQGA 1YVNA 3U4LA 1Z6RA 4BRAA 1BA0A 2FSKA 3FGUA 4B9QA 4CZFA 2ZF5O 2OANA 1WUAA 3I8BA 3BF1A 2QWLA 3A5NC 4A61A 4FOIA 4CZKA 3EL2A 3ENHA 4RCHA 4BRFA 4L3QA 3SMPA 4RTFD 2A41A 3LM2A 1BUPA 3J8AA 3UE5A 4H5VA 3H3NO 3QDKA 1C0FA 3WQTA 5E84A 2P9LB 1RFQA 5AQOA 2ASMA 4H5RA 5EVZA 3O1WA 5AQTA 2ITMA 2A40A 3O1BA 2ASPA 1ATNA 3BEXA 3ZEUB 2P9IB 5ELZA 2YJEA 2FSJA 1G99A 4A2BA 2A42A 1MDUB 2P9LA 2QM1A 3VERA 3WEEB 4H03B 2YHXA 4MLHA 3MMVA 1NGHA 4EIAA 2P9PB 3ZEUA 1P8ZA 2E1ZA 3IUCA 3U9ZA 4FWPA 1NGEA 1D4XA 2VCPA 4ISGA 4MO5A 4FWMA 4B1YB 1RDWX 4IJAA 1NGIA 1BG3A 3SJHA 3VGMA 1JCGA 4H0XB 4B1UB 3HM8A 4BC5A 5AQUA 3HTVA 4DB3A 5JLHA 4FL9A 1QZ6A 1NGDA 3G25A 5EX5A 4BG9A 3TU5A 3MN6A 5BREA 4IXCA 3LL3A 2A6AA 4WQ5A 4A62A 3L6QA 2D0OA 4K41A 3QMLA 4K43A 4GY2B 3EN9A 4ISEA 2V7YA 5KPZA 2Q31A 4CBWA 1NGJA 4BR9A 3A5OC 4CZGA 1BOTO 2CH5A 1U2VB 5FPDA 3GDQA 1T6DA 4HTLA 2FSNA 3O08A 3JS6A 5KPTA 3KHYA 2YHYA 2GELA 4BR2A 1SQKA 4XEIA 1DGKN 3D2FB 3W3DA 4CZHA 3MCPA 3OHRA 4BR0A 4FWQA 1S3XA 4PL7A 4IZ9A 1QQNA 5JICA 3D7EO 4H0TB 2Q97A 3CHWA 4JNEA 2CGJA 4YDUA 5AQJA 4B1ZA 3CJ1A 1ZC6A 4XH5A 3U9DA 1HLUA 3D2FA 4BRGA 2FF3B 1HKCA 3VF6A 1V4SA 4BR4A 5I9EB 4BG8A 2IIRA 1T6CA 3EKUA 3HI0A 4BRHA 1J6ZA 1SZ2A 5EXWA 2Q0UA 3ZX3A 3FFKB 4DCHA 3FR0A 4QS9A 4XH4A 5AQRA 4CZMA 4FWOA 2FLOA 4IWVA 3CERA 2D1KA 3FZMA 1NM1A 3CJAA 4Z94A 3VEXA 1TYQB 4B1XB 3C7NB 4DHYA 5BRFA 2Q1NA 3UKRB 1DEJA 3ENOA 2V52B 4E1JA 5B8HA 1SAZA 5AQQA 3EKSA 4FSVA 3AY9A 4XH1A 4BRLA 3GOIA 4AM6A 3C0BA 5FPEA 1TYQA 3LDLA 3U8XA 4ISFA 3C7NA 3VPZA 3UB5A 3UKRA 1Q18A 3BUZB 2QWRA 5AR0A 1XQSC 3IMXA 4M7XA 4FWRA 3TPQA 2WUSA 5AZIB 1JCEA 2VWBA 3O80A 3LDOA 4BROA 2HOEA 1QQOA 4BRPA 3AARA 1ATRA 4WQ4A 3SK3A 5CE3A 2QWPA 3R9PA 2IVOA 4CJ7A 2H3GX 2VYPA 3FZKA 5AQNA 5JLFA 3F9MA 4CZLA 4CZJA 3UKUB 3JXUA 2F9WA 4BC4A 5KQDA 2GTDA 4BQZA 3ZX2A 3A5LC 5AZIA 3KVGA 2P9IA 2IVNA 5KQ8A 4H5NA 2CH6A 2FXUA 3ZETB 4HWIA 1NGAA 3BP8A 2AA4A 3M3ZA 2E20A 3O4WA 4NO7A 3SLCA 5KPRA 2PAVA 3WEEA 4MLEA 4LC9B 3UKUA 3HZ6A 4O5FA 3LM9A 1HKBA 1XUPO 3CI5A 2E1YA 2P9PA 4H5TA 2I7NA 2KHOA 3QFUA 3AAQA 4BRIA 3VGKA 2V7ZA 3CJBA 3FLCO 3ZETA 4M63C 3DXKB 4M7YA 2D4WA 3ID8A 2NLXA 3H45C 1KXPA 1GLLO 1XC3A 3O6WA 5BN8A 1NGGA 2E8AA 2A3ZA 2AP1A 5AQSA 3D2EB 1ESVA 4BR7A 3VEOA 2NZTA 2P9NB 4Y0WA 5AQVA 4KBOA 4FPAA 4EAHD 1OKJA 5ADXH 2QWNA 3DXKA 4CZIA 1HJOA 4BRMA 4BVOA 4EHUA 2GEMA 5AQMA 4B1WB 2UYTA 4IO8A 3SMSA 3FZFA 3D2EA 2ZGYA 3MN7A 1E4GT 1GLEG 3H3OB 2P9NA 1JCFA 2P9KB 3VOVA 1H1VA 1C0GA 5BPNA 2FF6A 5BRHA 2D0PA 2CGLA 3L0QA 3EZWA 1U2VA 3ZX0A 1V4TA 2V51B 3DAWA 2W41A 5EOYA 4CBXA 1GLFO 1GLCG 5AFUH 1IG8A 3CJCA 3WXKA 3HSCA 4FO0A 4I6MB 2P9KA 1IJJA 2ASOA 2QXLA 3FE1A 3DJCA 2Q0RA 2E88A 4PKHA 3L4IA 4FWNA 1ATSA 1MA9B 3H1QA 3WUHA 3DWLA 1BU6O 3GG4A 1GLBG 3R8EA 3A0IX 5AQLA 5BPMA 4H5WA 2J4RA 2GWKA 4PL8A 1WOQA 3LDPA 3FZHA 1HUXA 1GLAG 4GNIA 3LDNA 5LJWA 1BWFO 4BREA 5BRDA 2I7PA 4J8FA 2DPNA 4H0YB 4WQ5C 1K8KB 1RGIA 3VENA 3WQUA 3QB0A 4FWKA 2ZWHA 4JN4A 5LJVA 1HKGA 4CZEA 1MWKA 2GUPA 4BRKA 3MN9A 3HBTA 2P9SB 3QFPA 1LCUA 4JAXA 5AQWA 5AQIA 1ZXOA 3VEWA 2QWOA 1K8KA 3RSEB 3WXIA 3MDQA 2BTFA 3A5MC 2YI1A 4BC2A 4BRCA 1YXQA 4BC3A 1S22A 1U6ZA 1NWKA 5ADXA 3O5BA 1YAGA 3CJ9A 3S41A 1QQMA 3FZLA 5JMVA 2P9SA 1GLDG 4F9OA 2F9TA 3IFRA 3ATUA 3QBXA 1NGBA 3VF4A 3LDQA 3RSEA 4JHDB 2QWMA 4EFHA 1NGCA 4A2AA 3A8YA 4H0OA 3WXLA 5FPMA 3QICA 4YDUC 4RWTA 2YCHA 2EWSA 5AQXA 1X9JA 3M6GA 4BRNA 1KAZA 1TUUA 4B1VA 1TUYA 4IJNA 4DQ8A 3AAPA 2GWJA 3VGLA 5AFUA 3WXJA 1BA1A 2Q2RA 3GBTA 1X3NA 3BF3A 4JHDA 5TKYA 2E2QA 4K25A 3CQXA 3O8MA 4BVPA 3KZBA 2HF3A 3VEZA 1NGFA 3CJ7A 3H46O 2W40A 1YUWA 5F2RA 5FPNA 5AQYA 5F0XA 2P9UB 1T44A 4FWLA 2E2PA 2YHWA 1BO5O 4H0PA 1EQYA 1Z05A 3R6MA 2CGKA 5E26A 1HPMA 3VEVA 4BGBA 1QHAA 5BN9A 5EY4A 2ZGZA 4PKGA 3M1FA 1R59O
chains in the Genus database with same CATH superfamily
3VESA 1HNVA 1S9EA 1ZBFA 2XRIA 4ZTJA 4YOTA 4DV1K 3PV8A 3NBPA 1C1BA 1RDUA 3T1YK 3DLGA 4OGEA 4MO4A 1IH7A 3TTCA 1Y64A 3AA3A 3VEYA 3W0LA 1FKOA 3J7YP 3MEDA 4O8KA 4IBNA 5GADP 4FWSA 3CQ8A 2VG5A 1KAXA 1NMDA 1BISA 1OH7A 3B6PA 1LOTB 1NLVA 4LF4K 4JD2B 4H0VB 3LP1A 3I55N 3CIPA 2OA8A 3RRHA 4QS8A 4DKWA 3WT0A 2QWQA 1VQON 1BI4A 3B6OA 2NRHA 3V9WA 4FJIA 4DV0K 1CXQA 2E4LA 3H6EA 1VQNN 2OPQA 4IOAL 3P4IA 1Q8IA 2RHKA 2O8CA 5SWMA 2KZZA 3GL1A 1KAYA 4DTJA 1CZAN 3MXJA 4EP4A 1XNQK 1Z6RA 1BA0A 2NRWA 5I3UA 3AO1A 1UWBA 1DTQA 1SKRA 1YJWN 4U67L 2HHIA 3VQ4A 1VQ6N 1KLMA 3U3GA 4FLYA 2OANA 4FM2A 3QERA 1WUAA 4OLAA 4JI4K 1SUQA 5HROA 3PUFA 4FOIA 1WSHA 1WSFA 3VQ6A 4CZKA 2QKBA 1VAZA 2Z1IA 4O5BA 4O8UA 2E6LA 3HYFA 4DSIA 4CW7B 1C0FA 3WQTA 3HRGA 4KHQA 4BECA 4DV2K 4HHTA 3S3OA 2WOMA 2P9LB 3EZ5A 5CYMA 2WONA 5AQTA 3OYFA 5FRNA 2YX6A 3TWHA 1VK0A 2YHAA 1TK5A 2A1RA 5GIPA 1MDUB 3EE9A 3VERA 4UQGA 4CIFA 2O8BA 4I9QA 3WEEB 3CPEA 2NRZA 4EIAA 4CF2A 3L2QA 3ZEUA 3OYCA 1NGEA 1RCHA 4MO5A 4XIUA 4Z4EA 3C6AA 1T8EA 3CMEN 4PY5A 4IJAA 4Y1DA 4KHWA 3L2UA 2OYQA 3HVRA 5JLHA 4K8XA 5HBMA 3G25A 3CFPA 3LP0A 3HSTB 3CC4N 4BG9A 2YNIA 3TU5A 3V4IA 3AVNA 3CPWM 4W5NA 4A62A 1KQSM 3L6QA 3WNEA 3OYJA 4K43A 1W7AA 4H4OA 1OH5A 3ZYYX 4JI7K 3VQEA 4C1NK 2QA4N 3TAFA 1L3SA 4Z4FA 4IO9L 3LPTA 4CZGA 4RW4A 4NXNK 1YJNN 1WB9A 5FPDA 4IOCL 1L3VA 1RBVA 3IAYA 1NNEA 2O8EA 1ZBIA 4BR2A 3D0PA 3W3DA 4CZHA 3MCPA 3KLIA 4GMJB 3KD1E 4FWQA 5DM7L 4EZ6A 1K9MO 4FZXC 4XJXA 1BCOA 1Q82O 3CHWA 3THYA 1LWFA 5CYQA 3LDSA 1ZC6A 3OTOK 1HLUA 2FF3B 1HKCA 1V4SA 5I9EB 4BG8A 3CM6A 4BRHA 4M3YA 2JGUA 2X78A 1SZ2A 1HNZK 4IG0A 3HM9A 3MCAB 3P83D 3FR0A 2UXCK 5AQRA 3P39A 3KLEA 2QTDA 1NM1A 1JLGA 4J2AA 1OVYA 3VEXA 3AVFA 3HPHA 3AGRA 2Q1NA 1SS6A 2Y1JA 1SL1A 1YTAA 3ENOA 4YOXA 2OPRA 1WAFA 5KRSA 4I2QA 3AY9A 3GOIA 4KTWA 4AM6A 4DFKA 3C0BA 1TYQA 1NMNA 4DU3A 2HB5A 3UB5A 3UKRA 1JL2A 3CCLN 2QWRA 4KAZA 5AR0A 1XQSC 5DMRA 4NCGA 2FBTA 3TPQA 2YNHA 3RMBA 3O80A 2DFEA 4X62K 2HOEA 4O55A 3VA0A 3ZLJA 5KI6A 2H3GX 3F9MA 1EKEA 1RTIA 3ZSWA 4B9TA 2GTDA 1N8RO 3CMAN 1FKPA 5JVHL 5AZIA 4B9SA 3AVKA 1T03A 4F2SA 4B3OA 1YIJN 4CHZA 1NGAA 3ASMA 5KPRA 3MAQA 3V9XA 3RWUA 1UA0A 4PA1A 3UKUA 4O5FA 3LM9A 4CEBA 4X65K 3NDKA 2D0BA 2X6SA 3HOSA 4H5TA 2I7NA 2KHOA 3AVMA 3AAQA 3HOTA 3K5MA 2D4WA 3H45C 3ZSVA 4FK2A 5C0YA 5SZTA 4GV3A 5AQSA 2C1GA 1U48A 3D2EB 4OX9K 2NZTA 1M90O 4FPAA 4WFBL 5ADXH 3KWIA 3DXKA 1IBMK 1YVUA 4CZIA 4EHUA 5C10A 2YNGA 4FLTA 4KO0A 3O9UA 3FZFA 2KQ2A 3MN7A 2QEXN 4M3WA 1WAJA 2P9NA 1JCFA 2P9KB 4CK1A 3CCUN 1NU0A 1C0GA 5BPNA 5BRHA 2D0PA 2ZQBA 2CGLA 3L0QA 3EZWA 3LAKA 4LSLA 2V51B 1J5EK 4KI6A 4N56A 4CBXA 1UAXA 1GLCG 4OJRA 3OYIA 4DTRA 3VA3A 3KK7A 4AHUA 1DLOA 2O8CB 2NRXA 4E7JA 3L8BA 1OVQA 3L4IA 3C94A 2YNFA 1NK6A 1U47A 1BU6O 1RDBA 1L3UA 1GLBG 4O4GA 3A0IX 3PX6A 2GWKA 4JYAK 4CJ4A 1GLAG 5KGXA 3NGZA 4AILC 3K59A 3LDNA 2QXFA 1BWFO 1JJ2M 2O8FA 3PO5A 5EU7A 3VENA 2HNYA 3QB0A 4FWKA 4KB1A 2O8DB 5LJVA 1HKGA 3U6FA 4DSKA 3HBTA 5FLXO 4LY7A 2VWJA 4JAXA 1WSJA 1WSEA 4JKAA 3AVJA 3ALYA 4LF7K 1K8KA 1Q7YO 3WXIA 1XNRK 3A5MC 3P31A 3CCRN 4E19A 1I3AA 1U6ZA 1RT7A 3S41A 1TKXA 2P9SA 3HT3A 1TKTA 2F9TA 1S6QA 3V9UA 4DV4K 1TAUA 1W9HA 3RSEA 2HNDA 1CZBA 4A2AA 3A8YA 3QIPA 3OYLA 2O8BB 4H0OA 5FPMA 3OYHA 2X74A 4KFBA 2EWSA 1KC8O 3M6GA 2RKIA 4M3ZA 4ZHRA 4B1VA 1SKSA 4YNQA 3C6TA 3M8RA 3KTQA 3GBTA 3PSFA 3M8SA 4IKFA 4BVPA 3KZBA 3LPUA 3CJ7A 1YUWA 4DLGA 2HSTA 3ZSRA 5AQYA 4LF8K 4B08A 2P9UB 3Q7BA 4FWLA 4BE0A 4LD0A 1N32K 1TVRA 1JLAA 2CGKA 2NRRA 5HLFA 3VEVA 4CFCA 2FBVA 2ZGZA 3ULEB 1W2BM 4C23A 3J80O 1LWEA 3OYBA 1NBWA 3THVA 2HMPA 2ZD1A 4BRQA 3B8AX 3RMAA 4DTNA 3EO3A 4JLHA 3QBWA 2D0AA 1VQMN 4DUYK 3RVCA 4CEAA 2KKZA 3LALA 5AZJB 3MX5A 4CJPA 2LSNA 3S5TA 2Q3SA 3G10A 3G4SN 5BPLA 2D0CA 3QEXA 2E2NA 3DXMB 3VF2A 1BL3A 4Y1CA 5AQZA 3BZCA 1RT2A 1VRTA 5LY3A 4NYFA 1MWMA 4JI5K 3P5JA 3HVTA 1W97L 3I0SA 4FW1A 3T3FA 2HBMA 4BQLA 4DFMA 2PZSA 4Z4CA 3RR7A 5KTQA 3WNFA 3M8QA 4M3XA 1VQ4N 3OA9A 4E7HA 3C95A 5F1XA 3SZ2A 3BZKA 3GE1A 3SQ4A 4PKIA 1ZBLA 2HF4A 2PY5A 3MEEA 4DLEA 4LFBK 5AQGA 4CJRA 3V9SA 1B9FA 4DQIA 3V1QA 3O3GA 4BRAA 4YOVA 1X9SA 4ILJA 1VHXA 4YHHK 1BCMA 3AO2A 3V81A 4HCCA 1XI1A 1UA1A 1LAVA 2PYJA 3A5NC 4A61A 5HRNA 1TAQA 2IGIA 3T69A 1TKDA 2RF2A 3SMPA 3CCEN 4KKOA 1NKBA 4E1NA 2HHWA 1S72N 4FVUA 2ASMA 4H5RA 4CECA 1NJYA 1C1CA 1HQEA 2W42A 1ATNA 3BEXA 1C0TA 3EE8A 5ELZA 4CIGA 3NH2A 1O13A 2A42A 4C8KA 4KPYA 2YHXA 3QETA 3QO9A 2R7YA 4DV3K 4DTOA 3SNNA 4O44A 3C65A 3ZCMA 1VQLN 1P8ZA 3E1YA 3WXMB 3IUCA 3OYMA 1X9WA 1VQ7N 4FWPA 4FJHA 1NK7A 3OYGA 1JLFA 3TSUA 1XC9A 3SBGA 4KTQA 1EP4A 4B9VA 1BG3A 1JLBA 3HP9A 3VGMA 4H0XB 4NYNA 4BC5A 3SV4A 3DRSA 3HTVA 4DB3A 4FL9A 2KZMA 4FZZA 3AVLA 4IEEA 4DQSA 4FLWA 5HRSA 3O4NA 3L4QA 1QSSA 4B3RK 4WF9L 2A6AA 4WQ5A 2IAJA 4DV7K 5DM6L 4K41A 3CCMN 1HMVA 4GY2B 3EN9A 1NKEA 2V7YA 1RT4A 5KPZA 3JAMO 4DSFA 1NGJA 2W00A 4KTZA 3A5OC 2BDPA 5M1NA 1BOTO 1A5XA 2CH5A 3V9ZA 1RTJA 5GAGP 1T6DA 1HRHA 4HTLA 4BE2A 4LF5K 3KHYA 3DM2A 3TR8A 3VQ7A 1SQKA 1DGKN 3D2FB 3QINA 4CFDA 4BR0A 4JV5K 1VSLA 3OYDA 2B5JA 1JLEA 4FJ8A 4IZ9A 1QQNA 3D7EO 4H0TB 3SUNA 1WLJA 2CGJA 3CJ1A 3ZT3A 4XH5A 3AV9A 2P51A 4KHYA 3VF6A 2ZE2A 4JKGA 5C42A 5J1EA 1N5YA 1T6CA 2BANA 1T3VA 3EEQA 3QEVA 4OKJA 2G8VA 3FFKB 4CJQA 4QS9A 4CZMA 1S1WA 1L3TA 4IWVA 2D1KA 3NVMA 1TK8A 2Y1IA 4Z94A 1U45A 2HBJA 4B1XB 3C7NB 2ETJA 4DHYA 5BRFA 1R0AA 3I56N 2F96A 2V52B 5B8HA 4FJXA 1SAZA 1IKVA 4Q5VA 4OO1J 2G8KA 4DV6K 3FFIA 4B3TK 1VQ9N 1DTTA 3AVBA 3VPZA 3BUZB 3NH1A 1D9FA 4M7XA 3K2PA 4GVEA 4YFUA 4B9UA 3PIOL 2OZMA 1Z25A 1JCEA 4CJLA 5LMUK 1VRUA 4DV5K 2HBKA 4GV9A 3AA4A 4WQ4A 3CM5A 2ZJPL 2QWPA 3R9PA 1S5JA 1KFDA 4PHTX 2F9WA 4BC4A 5KQDA 3L2WA 1NKCA 3A5LC 3KVGA 4FM1A 3S3NA 5KQ8A 4H5NA 2VG6A 1RBUA 3ZETB 5H1SQ 3DLHA 5AJ3K 1NJWA 2AA4A 4M45A 3O4WA 2PAVA 3THXA 2ZJRL 4MLEA 1YTUA 1TV6A 1QTMA 1HKBA 5GINA 3OY9A 5JS1A 4CJTA 4X66K 2HHQA 4DTSA 4E89A 3I0RA 3VGKA 3O9SA 4CFBA 2NLXA 4GKJK 2HHXA 4CK3A 1CZ9A 2E8AA 4C8LA 3ZT4A 1C0UA 5FDLA 4A57A 1ESVA 2HVIA 4Y0WA 3TAPA 2F4VK 1HYVA 1S1VA 1YHQN 4BE7B 4MDBA 4BVOA 1VSFA 4OPAA 3C6HA 3SCXA 4Q0BA 3QEIA 1X1PA 1D9DA 4LF6K 3H3OB 3WNGA 4BDZA 3D6RA 4BE1A 2G8UA 4CF1A 4OGCA 4JRPA 4HUEA 1L5UA 4MQ3A 3DI6A 3THWB 3CYGA 4HCBA 3T1AA 4E7IA 3VQ8A 5AFUH 3VQ5A 5C12A 2O4GA 3N4PA 4H4MA 4E7LA 4CJVA 1QHTA 3AA5X 3H1QA 1WBDA 1P90A 2W6LA 4KHPK 4W5TA 1WOQA 3O9QA 4E1MA 3FZHA 4J2BA 5LJWA 3VTIA 4J2DA 4BREA 5BRDA 3MXMA 4LFAK 3L2RA 1GOCA 2XY6A 3CD6N 4K8ZA 4CZEA 1MWKA 1NJXA 2GUPA 4BRKA 4FZYA 2FBXA 4IOXA 3IS9A 3DLKA 3VEWA 2IS3A 2QWOA 4EP5A 3MDQA 2YI1A 4MFBA 2HNZA 4BC2A 4M3RA 3LZJA 4BC3A 1S22A 3CJ9A 3DLLL 1U4BA 4X64K 3TABA 3PSIA 1XMOK 1RILA 1GLDG 4F9OA 2HHHK 4DS5A 4JHDB 2QWMA 4CK2A 2QI2A 3NGIA 1BQMA 1TL1A 3SAFA 2YCHA 4N76A 3KLHA 4RW7A 3WNHA 1TUYA 4IJNA 4DR5K 2KTQA 1ITGA 3JSMA 4DG1A 5M1PA 1BA1A 1KD1O 1X3NA 3BF3A 2B6AA 3E66A 2E2QA 3VQ9A 1B92A 4K25A 3PIPL 4DU1A 3SUOA 3O8MA 4JK8A 4AHCA 4C8OA 3C6UA 2HF3A 3VEZA 4WCEL 5M1FA 4E0DA 4DWIA 4F2RA 5HP1A 5KGWA 3PX0A 3KK1A 1KVAA 5F0XA 1ZBHA 4M3TA 2YHWA 1EQYA 1LW0A 2HHTA 4BWMA 5EY4A 3M1FA 1TKZA 2RN2A 4OLBA 3VQBA 4IFYA 4U7BA 3ATVA 2FBYA 4CGIA 2OZSA 1GLJO 4FPBA 4NCAA 4Z4HA 3D45A 4DS4A 3IDHA 1ASWA 4ILHA 4CF9A 5KRTA 4CGHA 4CFAA 5IWAK 1BI4B 3K5OA 2D5RA 2Z1JA 5GAEP 4EHTA 3I33A 1QSLA 5AQPA 2IVPA 5TKWA 4BRDA 3OS0A 1IO2A 3MK6A 3KLFA 2ATQA 4FJLA 4OKKA 2E2OA 4DQRA 3KIOA 3H1VX 1RBSA 2XY8A 4J2EA 2B4JA 2NNWA 4CF0A 4DU4A 1QVFM 1BGXT 4BR5A 3V1RA 4QOZB 3F73A 1E4FT 1VSIA 4I6MA 1D8YA 1J53A 3PO4A 4CJSA 4JD2A 3DOKA 2YJFA 3P38A 1REVA 4DF4A 4FYDA 3K57A 4V19S 3NGYA 1DKGD 3QLHA 3CYMA 5C2FA 4AHSA 4DQQA 3U4LA 5BR8K 4PQUA 1QVGM 4IDKA 5HL7L 5CZ1A 2FC0A 1HYZA 1FW6A 2DFFA 1NK5A 3E9LA 4B9QA 4WE1A 1SV5A 2UU9K 4DTXA 2ZF5O 2JLEA 3OYNA 4DFJA 2QWLA 4HVJA 1ASUA 4JKFA 2VGNA 2I5JA 4BDYA 1XMQK 4BRFA 3F2KA 4RTFD 5DK5A 5FROA 1VSJA 3LM2A 4DTPA 1BUPA 3QEPA 2HMIA 3J8AA 4H5VA 1ZBUA 3VQPA 3QDKA 1RFQA 3J7ZO 5EVZA 3O1WA 4KH5A 2ITMA 4ID5A 3OVNA 3ZEUB 1OH8A 3CFOA 3TTFA 3TAQA 4ELUA 1NK4A 2YJEA 4CJFA 1G99A 2FSJA 1TGOA 2P9LA 3PX4A 2RPIA 1KCFA 3Q7CA 1BIUA 5CY4A 4MLHA 5LMNK 4W5QA 2VQEK 3SPZA 4ISGA 4FWMA 4N5SA 1Q9XA 3O9RA 1RDWX 1BHLA 3M5RA 3SJHA 3KWGA 4FCYA 3HM8A 5AQUA 4AH9A 4DTUA 1QZ6A 1NGDA 3SI6A 1KFSA 5BREA 4IXCA 1ZYQA 1HQUA 1MU2A 3KKSA 1VSHA 3QMLA 4CJEA 3CG7A 3H08A 4ISEA 3NE6A 2O8EB 3L2VA 3SQ1A 5CZ2A 4FJ5A 1KTQA 2Q31A 4CBWA 4G9ZA 1Q9YA 4BR9A 4CEOA 1K73O 2WC9A 3SBTA 3AA2A 2FSNA 3O08A 3JS6A 1XWLA 3ZSOA 3THYB 4DR1K 3TSPA 3NF8A 3LANA 5C15A 2F7TA 4DFPA 4XEIA 1IBLK 2KW4A 1S3XA 4G1QA 4PL7A 1Z26A 3OJUA 3F9KA 3CXCM 3AGKA 2WBNA 4YDUA 5MLCQ 2A1SA 5D3GA 3EKUA 3HI0A 5A2QO 3K0SA 5LL6Z 2NRVA 4ICLA 3S9HA 2Q0UA 1NG9A 4AF1A 4AQYK 2YKNA 5J2MA 3QESA 4FWOA 3CERA 4JKHA 3V6DA 3F5TA 4DR3K 1TYQB 3PLAA 4BDPA 3RRGA 1S1UA 1LW2A 4GV6A 3UKRB 3HK2A 4R5PA 3K9KA 2RE2A 3VTHA 5AQQA 3EKSA 3AVHA 4FSVA 4KV8A 2QKKA 2KFNA 3OYKA 4XH1A 3TTDA 4JKCA 4OKEA 3AO3A 3TSQA 5FPEA 2GV9A 2IDOA 3U8XA 4ISFA 1XHZA 1Q18A 3T19A 1VSKA 3IRXA 2EHGA 4FWRA 5JS2A 5AZIB 1NOZA 5C25A 2VWBA 4LH5A 4BROA 1W0HA 1QQOA 3TAGA 3AARA 1ATRA 4FLVA 4CGDA 2VYPA 5AQNA 4CZJA 2OPPA 3CCJN 3UKUB 4N41A 3JXUA 4ILGB 3K5NA 1CLQA 4JI6K 3E9OA 1S9GA 4JK9A 2XO7A 2G8WA 2XY7A 2P9IA 2IVNA 1JXEA 2CH6A 2C1IA 5JENA 1NJZA 2ZM6K 2E20A 5HOOA 4NO7A 1Y97A 3AVGA 1HJRA 4KRFA 3HZ6A 3OBYA 4Z4IA 1K8AO 3CF5L 1EXQA 2IOCA 2P9PA 3NHGA 1Q81O 2VQFK 3QFUA 4BRIA 3FLCO 4M63C 3DXKB 1C0MA 3ID8A 1KXPA 4OPHA 4TSXA 1XC3A 3O6WA 5GAHP 3OW2M 5BN8A 4M3UA 2X6NA 2AP1A 4R79A 4OPJA 3ZT2A 1RT3A 4BR7A 2P9NB 3M8PA 4CESA 4KBOA 4EAHD 1OKJA 3RMCA 1IKYA 4CVNE 2GEMA 4C8MA 1YJ9N 5AQMA 3OBWA 2UYTA 3SMSA 4FM0A 3D2EA 1F21A 4CGGA 1E4GT 1YF5L 1GLEG 5E41A 1N6QA 4JI0K 3VOVA 2VWKA 3NF7A 1H1VA 4C8NA 2G8HA 3VQQA 2FF6A 3HO1A 1U2VA 3ZX0A 3DAWA 2OCEA 5C2DA 4W5OA 1KVBA 2UXBK 3ZT0A 3WXKA 4YOWA 4B9MA 4I6MB 2P9KA 3I8DA 2ASOA 1K6YA 1RNHA 3FE1A 3DJCA 2E88A 2HVHA 4PKHA 1SKWA 4KREA 1MA9B 1M1KO 1KVCA 3MXIA 2O8FB 4CCHA 1N33K 3AVAA 2JWKA 5AQLA 3KLGA 5BPMA 3R1XA 3LDPA 4IFVA 3K9JA 1HUXA 3N4QA 4GNIA 1O1WA 4MDAA 3TANA 1FJGK 2I7PA 2IC3A 4J8FA 2P5GA 4WQ5C 1K8KB 4RW6A 1RGIA 1YITN 3WQUA 4EZ9A 1WBBA 4JN4A 1OH6A 2BGGA 4H8KA 3QIOA 4CHQA 4O0IA 4HUGA 2P9SB 1LCUA 1RDDA 4FK4A 5AQWA 4IDHA 4PWDA 3O9TA 3MX2A 3RSEB 4RW9A 3K58A 3NCIA 4BRCA 1YXQA 3VMFB 1IKWA 2O8DA 5ADXA 3O5BA 1YAGA 4PUOA 1QQMA 3FZLA 5JMVA 1FK9A 2HHSA 4DSLA 3ATUA 3QBXA 3TAEA 5GIOA 3LDQA 3ZSXA 4LSNA 2OTLN 2AJQA 5AQXA 1X9JA 4FXDA 1EETA 2ZJQL 1TUUA 3AAPA 2GWJA 3VGLA 1WSIA 4BEBA 3WXJA 4DTMA 4FJ7A 4Z0UA 2VGMA 3BDPA 5J2PA 3CQXA 3DRPA 3DYAA 3L3UA 3SJJA 4E3SA 4ZTFA 4FJJA 3BGRA 5F2RA 4FJGA 3LAMA 3J7AP 3OYAA 3TARA 3DOLA 2E5LK 4JI2K 4JEPA 4CHOA 2OPSA 1BO5O 4H0PA 4F8RA 1Z05A 3V1OA 4KH6A 1TK0A 2XY5A 1QHAA 4FLXA 1EWQA 4BWJA 2UUBK 1R59O 3DLEA 4CD3A 1RDCA 3CETA 4CHYA 1NK8A 3NF6A 1ZBSA 1RT5A 4JS5A 4WYBA 4KI4A 2P9UA 3CQYA 3NH0A 3A2FA 3E01A 4DR2K 1RT6A 5BR9A 4CI6A 4K42A 3MN5A 1BIZA 4DR6K 4LF9K 4CBUA 3ZSYA 3ULEA 4WQ4C 4YY3K 3RR8A 3E9PA 2ITGA 3VETA 4CJWA 4LFCK 3LWMA 3ZSZA 4NB4A 3LP3A 5AQHA 4AM7A 5AQKA 4CJKA 4CD1A 2XHBA 3OJSA 1JXBA 3NF9A 4QS7A 4KH4A 4K0KK 4F3OA 4FOEA 5AZJA 2UXDK 1BDGA 4DR4K 1HX1A 3DXMA 2A5XA 2QW9A 2BUPA 1QZ5A 1KLNA 3HP6A 4JI8K 4WFAL 2KFZA 1X3MA 1RBRA 1C1AA 4FVMA 5J2NA 1D5AA 1VQKN 5AQFA 5K14A 2Z1HA 4JKDA 1BQNA 4BGAA 2Q36A 4JK7A 2PBDA 1YVNA 2P1JA 1B9DA 3LZIA 2JWLA 4E7KA 3G0ZA 3FGUA 2FSKA 5FRMA 4DQPA 3SQ0A 2F8SA 2HBLA 1QQCA 3J81O 4CZFA 3O4QA 4YORA 4A5AA 3AVCA 3CCQN 1T05A 3KJVA 4O0JA 3VN5A 5I42A 3I8BA 3BF1A 3ITHA 1VSDA 3O3HA 1J9AA 3EL2A 3ENHA 4RCHA 5CHIA 4L3QA 4GKKK 1EO1A 2A41A 4CEZA 3UE5A 3H3NO 3MWPA 3IG1A 1T7PA 5E84A 4E72A 4JRQA 5AQOA 3EY1A 2A40A 3O1BA 4FW2A 4A5BA 4WFNL 2ASPA 2P9IB 5JVGL 1EX4A 4BY9C 1HPZA 4A2BA 3CFRA 2YV0X 3DLRA 2QM1A 3SQ2A 5IT9O 1KRPA 4CERA 4CJ3A 4H03B 2HHVA 3MMVA 1NGHA 1N34K 4GW6A 1LAWA 2P9PB 1JLCA 1IBKK 2E1ZA 3U9ZA 1D4XA 2VCPA 3P1GA 1UOCA 4FK0A 4B1YB 3ZSQA 1NGIA 3LP2A 4B9NA 2YHBA 1VQ5N 1JCGA 3TI0A 4B1UB 1JKHA 1LV5A 4CE9A 3NAEA 5EX5A 4HUFA 1GOAA 3MN6A 3NFAA 1KSPA 3LL3A 2D0OA 4DMNA 1C6VA 1U04A 1WNSA 2WTUA 2G8IA 3R3LA 3VQDA 3DLBA 3VQAA 1U2VB 3KD5E 3KK3A 4N47A 3GDQA 3G71N 5KPTA 3K5LA 2YHYA 2OTJN 2GELA 4UY8O 2YKMA 1SL0A 3CCSN 1I94K 1ILYA 3OHRA 4JKGB 5M1OA 2HW3A 1FXXA 3ISNC 5JICA 1S1XA 2Q97A 4JNEA 4B1ZA 5AQJA 4IG3A 3HJFA 3U9DA 1JLQA 1S1TA 3D2FA 4BRGA 4CIEA 3O3FA 4DSEA 4BR4A 2IIRA 1RTHA 4HTUA 1HNXK 1J6ZA 5EXWA 3ZX3A 4DCHA 4W5RA 3HL8A 4XH4A 4I2PA 4B8CA 1TL3A 4JS4A 2FLOA 4JI1K 3FZMA 3CJAA 4JKEA 4CEFA 4B3MK 1DEJA 3MWTA 3PY8A 3VQCA 4E1JA 3OS2A 1HYSA 4M41A 3QNOA 4ELVA 2PYLA 4QCLA 4BRLA 4KHUA 3LDLA 3RTVA 3C7NA 3ULDA 3UIQA 4CJUA 4FLZA 4ELTA 2DTUA 4I7FA 3IMXA 3KKRA 4CF8A 5J2QA 5CR4A 2UUAK 1NK9A 4DSJA 2WUSA 1A5WA 3LDOA 3HPGA 4BRPA 3ENBA 4IEIA 4RG8A 3SK3A 3OS1A 4DF8A 5CE3A 2IVOA 4CJ7A 5JLFA 3FZKA 3MECA 4CZLA 3THXB 4FJ9A 4ID1A 1N36K 2DY4A 3ZT1A 4BQZA 3ZX2A 3AO5A 5C24A 2BH1A 4IFEA 4AHTA 3LWLA 3HPOA 2FXUA 2W6KA 4HWIA 3BP8A 4AHVA 3M3ZA 3SLCA 4DUZK 3WEEA 1XHXA 3KK2A 1J54A 4LC9B 3T7ZA 1EWRA 1XUPO 3CI5A 2E1YA 3T1HK 3SUQA 1SL2A 3JYTA 2KLAA 1DT9A 2V7ZA 2Z1GA 3CJBA 3ZETA 2F8TA 4M7YA 4JKBA 5M1QA 3G6EN 2E6MA 2VG7A 1GLLO 4BACA 5M1KA 1NGGA 1NOYA 3S3MA 2A3ZA 4OPKA 3VEOA 4KHNA 1VSEA 3ID6A 5AQVA 5T7BA 1J5OA 2O4IA 2QWNA 1HNWK 1HJOA 1HNIA 4BRMA 4CEEA 3L3VA 2EX3A 4B1WB 4CEDA 3SAHA 4IO8A 2NUBA 4B9LA 2ZGYA 1HR0K 4C1NI 4F4KA 1GOBA 3DMJA 1VQPN 3SV3A 4JI3K 1YT3A 1V4TA 2W41A 2BE2A 5EOYA 2HHUA 1GLFO 1IG8A 1VSMA 4KHSA 3CJCA 4B3SK 2PFUA 3HSCA 4FO0A 1IJJA 4L8RB 1U49A 2QXLA 1RT1A 2Q0RA 3THWA 4F3TA 1QSYA 4FWNA 1ATSA 3SYZA 3WUHA 3DWLA 3GG4A 1RBTA 2P5OA 4KB0A 3R8EA 1YI2N 4H5WA 2J4RA 4PL8A 3U3YA 4CEQA 4GVMA 2GBZA 1QS4A 2DPNA 4H0YB 3OYEA 3HXMA 3BY5A 1RDAA 2GX9A 3EYZA 4NCBA 1S6PA 1E3MA 2ZWHA 4CHNA 1ASVA 1QE1A 4A59A 1IV0A 1WN7A 3MN9A 4YOUA 1X9MA 3QFPA 1IKXA 2G8FA 1VQ8N 4DR7K 3AVIA 4FLUA 5AQIA 3RMDA 2UUCK 3SPYA 1ZXOA 4CHPA 4AHRA 4CGJA 1CXUA 2BTFA 1G15A 3DRRA 2GUIA 4QAGA 1NWKA 5HRRA 3CC2N 3IKMA 3IFRA 4FJMA 1NGBA 3VF4A 4M42A 4EFHA 4B8AB 1NGCA 3TAMA 3NVKA 3WXLA 3SUPA 3MEGA 3QICA 4YDUC 5HRPA 2WFBA 4OVLA 4RWTA 4FJKA 4BRNA 1KAZA 4DQ8A 3SAGA 1LWCA 3AO4A 1JL1A 5AFUA 1RTDA 3QEWA 2Q2RA 2DFHA 4JHDA 4RW8A 5TKYA 3CCVN 4YOYA 4NLBA 1NGFA 3H46O 2W40A 4Z4GA 1IG9A 1I39A 4CJ5A 5FPNA 1A5VA 4NXMK 4NLCA 1T44A 1Q86O 2E2PA 4CGFA 4LH4A 3R6MA 3NMUA 2QK9A 5E26A 1NJIO 4FJNA 1HPMA 3CC7N 4BGBA 3QNNA 1WSGA 4I9LA 1NK0A 4PKGA 2NRTA 5BN9A
chains in the Genus database with same CATH topology
3ULEB 3CETA 1W2BM 3VESA 4C23A 1ZBSA 4YOTA 4WYBA 1NBWA 2P9UA 3CQYA 4U7BA 2HMPA 3ATVA 4BRQA 3B8AX 5BR9A 4CI6A 1GLJO 1RDUA 4K42A 3EO3A 4FPBA 3MN5A 3QBWA 1VQMN 4MO4A 3IDHA 3TTCA 1Y64A 4ILHA 4CBUA 3VEYA 3RVCA 3ULEA 3W0LA 4WQ4C 3E9PA 3VETA 2KKZA 5AZJB 3MX5A 4O8KA 5GADP 3G4SN 4FWSA 4NB4A 5AQHA 4AM7A 2E2NA 5BPLA 5AQKA 1KAXA 4CD1A 1NMDA 3DXMB 3VF2A 5GAEP 4EHTA 3I33A 1LOTB 5AQZA 5AQPA 2IVPA 1NLVA 4QS7A 5TKWA 4KH4A 3MK6A 4BRDA 5LY3A 4JD2B 2E2OA 4H0VB 1MWMA 3I55N 3CIPA 4FOEA 3H1VX 4QS8A 4DKWA 3WT0A 5AZJA 2QWQA 1VQON 4CD3A 1W97L 2NNWA 1BDGA 2NRHA 1HX1A 1QVFM 2HBMA 3DXMA 4BQLA 4BR5A 2A5XA 3H6EA 1VQNN 2QW9A 2BUPA 1QZ5A 1E4FT 1VQ4N 4I6MA 4IOAL 3OA9A 3P4IA 4JD2A 2RHKA 4WFAL 3GL1A 1X3MA 5F1XA 2YJFA 3GE1A 1KAYA 1VQKN 5AQFA 3P38A 4PKIA 1CZAN 2HF4A 1DKGD 4JKDA 4BGAA 2Q36A 4JK7A 5C2FA 2PBDA 5AQGA 1YVNA 3U4LA 2JWLA 1Z6RA 4BRAA 4YOVA 1BA0A 2FSKA 2NRWA 3FGUA 1QVGM 5HL7L 2HBLA 4ILJA 3E9LA 4B9QA 1YJWN 4U67L 4CZFA 4YORA 4A5AA 1VQ6N 2ZF5O 3CCQN 2OANA 1WUAA 3I8BA 3BF1A 2QWLA 3A5NC 4A61A 4FOIA 4JKFA 4CZKA 2VGNA 1VAZA 3EL2A 3ENHA 4RCHA 5CHIA 4BRFA 4L3QA 4O8UA 3F2KA 3T69A 1EO1A 3SMPA 4RTFD 2A41A 3LM2A 1BUPA 3J8AA 3UE5A 4H5VA 3H3NO 3QDKA 3MWPA 3CCEN 1C0FA 3WQTA 3HRGA 5E84A 4BECA 1S72N 4FVUA 2P9LB 1RFQA 5AQOA 2ASMA 3J7ZO 4H5RA 5EVZA 3O1WA 5AQTA 4KH5A 2ITMA 2A40A 3O1BA 4A5BA 4WFNL 2YX6A 2ASPA 1ATNA 3BEXA 3ZEUB 3TTFA 2P9IB 3EE8A 2YJEA 5ELZA 5JVGL 2FSJA 1G99A 4BY9C 4A2BA 1O13A 5GIPA 2A42A 1MDUB 2P9LA 2QM1A 3EE9A 3VERA 3WEEB 4H03B 2YHXA 3CPEA 3Q7CA 4MLHA 2NRZA 3C65A 1NGHA 3MMVA 4EIAA 1VQLN 2P9PB 3ZEUA 1P8ZA 3E1YA 3WXMB 2E1ZA 3IUCA 3U9ZA 1VQ7N 4FWPA 1NGEA 1D4XA 2VCPA 4ISGA 4MO5A 4FWMA 3C6AA 3TSUA 3O9RA 3SBGA 4B1YB 1RDWX 3CMEN 4IJAA 1NGIA 3M5RA 1BG3A 3SJHA 3VGMA 1VQ5N 3KWGA 1JCGA 4H0XB 4B1UB 3HM8A 4BC5A 5AQUA 3HTVA 4DB3A 5JLHA 4FL9A 1QZ6A 1NGDA 3G25A 5EX5A 3CC4N 4IEEA 4BG9A 3TU5A 3MN6A 3L4QA 5BREA 4IXCA 3CPWM 3LL3A 4WF9L 2A6AA 4WQ5A 4A62A 1KQSM 3L6QA 2D0OA 5DM6L 4K41A 3CCMN 3QMLA 4K43A 4GY2B 3EN9A 3ZYYX 4ISEA 4C1NK 2V7YA 2QA4N 5KPZA 2Q31A 4CBWA 4IO9L 4G9ZA 1NGJA 3R3LA 4BR9A 2W00A 3A5OC 4CZGA 1BOTO 5M1NA 1K73O 2CH5A 2WC9A 1U2VB 5GAGP 1YJNN 3SBTA 5FPDA 3GDQA 1T6DA 4IOCL 4HTLA 2FSNA 3O08A 3G71N 3JS6A 5KPTA 3KHYA 3TSPA 2YHYA 2OTJN 2GELA 4BR2A 5C15A 4UY8O 1SQKA 2F7TA 4XEIA 1DGKN 3D2FB 3W3DA 4CZHA 3CCSN 3MCPA 3OHRA 4JKGB 4BR0A 5M1OA 1ILYA 4FWQA 1S3XA 4PL7A 5DM7L 4IZ9A 1QQNA 5JICA 1K9MO 3D7EO 4XJXA 3CXCM 3AGKA 2Q97A 3CHWA 4H0TB 1Q82O 4JNEA 2WBNA 2CGJA 4YDUA 5AQJA 4B1ZA 3CJ1A 5MLCQ 1ZC6A 4XH5A 3U9DA 1HLUA 3D2FA 4BRGA 2FF3B 1HKCA 3VF6A 1V4SA 4JKGA 4BR4A 5I9EB 4BG8A 2IIRA 1T6CA 3EKUA 3HI0A 4BRHA 1T3VA 1J6ZA 1SZ2A 2NRVA 5EXWA 2Q0UA 3MCAB 3ZX3A 4AF1A 3FFKB 4DCHA 3FR0A 4QS9A 4XH4A 5AQRA 3P39A 4CZMA 4FWOA 2FLOA 2QTDA 3CERA 4IWVA 2D1KA 3NVMA 3FZMA 1NM1A 3CJAA 4JKHA 4JKEA 4Z94A 1OVYA 3F5TA 3VEXA 2HBJA 1TYQB 3PLAA 4B1XB 3AGRA 3C7NB 4GV6A 4DHYA 5BRFA 2Q1NA 3UKRB 1DEJA 1SS6A 3MWTA 3I56N 3ENOA 4YOXA 2V52B 4E1JA 5B8HA 3K9KA 2RE2A 3VTHA 1SAZA 5AQQA 3EKSA 4FSVA 4OO1J 3AY9A 4XH1A 3TTDA 4BRLA 3GOIA 4JKCA 4AM6A 1VQ9N 3TSQA 3C0BA 5FPEA 1TYQA 3LDLA 3U8XA 4ISFA 3C7NA 3VPZA 3UB5A 3UKRA 3CCLN 1Q18A 3BUZB 2QWRA 5AR0A 1XQSC 3IMXA 4M7XA 4GVEA 5CR4A 4FWRA 3TPQA 3PIOL 2WUSA 5AZIB 1JCEA 2VWBA 3O80A 3LDOA 4BROA 2HOEA 1QQOA 2HBKA 4BRPA 3AARA 3ENBA 4GV9A 1ATRA 4WQ4A 4IEIA 3SK3A 5CE3A 2ZJPL 2QWPA 3R9PA 2IVOA 4CJ7A 2H3GX 2VYPA 3FZKA 5AQNA 5JLFA 3F9MA 4CZLA 4CZJA 3CCJN 3UKUB 3JXUA 4ILGB 4PHTX 2F9WA 4BC4A 5KQDA 2GTDA 3E9OA 4BQZA 1N8RO 3ZX2A 3CMAN 3A5LC 4JK9A 5JVHL 5AZIA 3KVGA 2P9IA 2BH1A 2IVNA 5KQ8A 4H5NA 4IFEA 2CH6A 2FXUA 1YIJN 2C1IA 3ZETB 5H1SQ 4HWIA 1NGAA 3BP8A 2AA4A 3M3ZA 2E20A 3O4WA 4NO7A 3SLCA 5KPRA 2PAVA 5HOOA 3WEEA 2ZJRL 4MLEA 4LC9B 3UKUA 3T7ZA 3HZ6A 3OBYA 4O5FA 3LM9A 1HKBA 1XUPO 3CI5A 2E1YA 5GINA 3CF5L 1K8AO 2P9PA 3HOSA 1Q81O 4H5TA 2I7NA 2KHOA 2KLAA 3QFUA 3AAQA 1DT9A 3VGKA 4BRIA 3HOTA 2V7ZA 3CJBA 3FLCO 3ZETA 4M63C 3DXKB 4M7YA 3O9SA 4JKBA 5M1QA 3G6EN 2D4WA 3ID8A 2NLXA 3H45C 1KXPA 4OPHA 1GLLO 1XC3A 3O6WA 5GAHP 3OW2M 5BN8A 5M1KA 1NGGA 5C0YA 2E8AA 2A3ZA 2AP1A 5AQSA 4GV3A 4R79A 2C1GA 3D2EB 4A57A 1ESVA 4BR7A 3VEOA 2NZTA 1M90O 2P9NB 4Y0WA 3ID6A 5AQVA 4KBOA 4FPAA 4WFBL 4EAHD 1OKJA 5ADXH 3KWIA 2QWNA 3DXKA 1YHQN 4CZIA 4BE7B 1HJOA 4MDBA 4BRMA 4BVOA 4EHUA 5C10A 2GEMA 1YJ9N 5AQMA 3OBWA 4B1WB 3SAHA 3O9UA 2UYTA 4OPAA 3C6HA 4IO8A 3SMSA 3FZFA 3D2EA 2ZGYA 3MN7A 1E4GT 1YF5L 1GLEG 4C1NI 2QEXN 3H3OB 2P9NA 3D6RA 1JCFA 2P9KB 3VOVA 1H1VA 1VQPN 3CCUN 1C0GA 5BPNA 2FF6A 5BRHA 2D0PA 2CGLA 3L0QA 3EZWA 1U2VA 3ZX0A 1V4TA 2V51B 3DAWA 2W41A 5EOYA 4CBXA 5C2DA 1GLFO 1GLCG 5AFUH 1IG8A 3CJCA 5C12A 3WXKA 4YOWA 2PFUA 3HSCA 3KK7A 2P9KA 3N4PA 1IJJA 4FO0A 4I6MB 2ASOA 2QXLA 3FE1A 3DJCA 2Q0RA 2NRXA 2E88A 4PKHA 3L4IA 4FWNA 1ATSA 1MA9B 3H1QA 1M1KO 3WUHA 3DWLA 1BU6O 3GG4A 1GLBG 2JWKA 1P90A 3A0IX 3R8EA 1YI2N 5AQLA 5BPMA 4H5WA 2J4RA 2GWKA 3R1XA 1WOQA 3LDPA 4PL8A 3O9QA 3FZHA 3K9JA 1HUXA 1GLAG 3N4QA 4GNIA 4MDAA 3LDNA 5LJWA 3VTIA 1BWFO 4BREA 5BRDA 2I7PA 4J8FA 2DPNA 4H0YB 1JJ2M 4WQ5C 1K8KB 1RGIA 3VENA 1YITN 3WQUA 2GX9A 3QB0A 4FWKA 3CD6N 2ZWHA 4JN4A 5LJVA 1HKGA 4CZEA 1MWKA 4A59A 2GUPA 4BRKA 3MN9A 3HBTA 4YOUA 2P9SB 3QFPA 1LCUA 4JAXA 1VQ8N 5AQWA 4IDHA 4IOXA 5AQIA 4JKAA 1ZXOA 3O9TA 3VEWA 2QWOA 3MX2A 1K8KA 1Q7YO 3RSEB 3WXIA 3MDQA 2BTFA 3A5MC 2YI1A 4BC2A 4BRCA 1YXQA 3P31A 3CCRN 3VMFB 4BC3A 1S22A 1U6ZA 1NWKA 5ADXA 3O5BA 1YAGA 3CJ9A 3S41A 3DLLL 3CC2N 1QQMA 3FZLA 5JMVA 2P9SA 3IKMA 1GLDG 4F9OA 2F9TA 3IFRA 3ATUA 3QBXA 1NGBA 5GIOA 3VF4A 3LDQA 3RSEA 4JHDB 2QWMA 4EFHA 1NGCA 4A2AA 2QI2A 3A8YA 3NVKA 4H0OA 3WXLA 2OTLN 5FPMA 3QICA 4YDUC 3SAFA 2WFBA 4RWTA 2YCHA 2EWSA 5AQXA 1X9JA 1KC8O 3M6GA 4BRNA 2ZJQL 1KAZA 1TUUA 4B1VA 1TUYA 4IJNA 4DQ8A 3AAPA 2GWJA 3M1FA 3VGLA 3SAGA 5AFUA 3WXJA 4BEBA 5M1PA 1BA1A 2Q2RA 1KD1O 3GBTA 1X3NA 3BF3A 4JHDA 5TKYA 3E66A 2E2QA 3CCVN 4K25A 2VGMA 4YOYA 3PIPL 3CQXA 3O8MA 4NLBA 4BVPA 4JK8A 3KZBA 2HF3A 3VEZA 4WCEL 1NGFA 3CJ7A 5M1FA 3H46O 2W40A 1YUWA 5F2RA 5FPNA 2HSTA 5AQYA 5F0XA 4NLCA 2P9UB 3Q7BA 4JEPA 1T44A 1Q86O 4FWLA 2E2PA 2YHWA 1BO5O 4H0PA 1EQYA 1Z05A 2NRRA 2CGKA 3R6MA 4KH6A 5E26A 1NJIO 3NMUA 1HPMA 3VEVA 3CC7N 4BGBA 1QHAA 5BN9A 5EY4A 2ZGZA 4PKGA 2NRTA 1R59O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULE B;  3CET A;  3VES A;  4C23 A;  1ZBS A;  4WYB A;  1NBW A;  2P9U A;  3CQY A;  2HMP A;  3ATV A;  4BRQ A;  3B8A X;  5BR9 A;  4CI6 A;  1GLJ O;  4K42 A;  3EO3 A;  4FPB A;  3MN5 A;  3QBW A;  4MO4 A;  3IDH A;  1Y64 A;  4CBU A;  3VEY A;  3ULE A;  3W0L A;  4WQ4 C;  3VET A;  5AZJ B;  4O8K A;  4FWS A;  4NB4 A;  5AQH A;  4AM7 A;  2E2N A;  5BPL A;  5AQK A;  1KAX A;  4CD1 A;  1NMD A;  3DXM B;  3VF2 A;  4EHT A;  3I33 A;  1LOT B;  5AQZ A;  5AQP A;  2IVP A;  1NLV A;  4QS7 A;  4BRD A;  5LY3 A;  3MK6 A;  4JD2 B;  2E2O A;  4H0V B;  1MWM A;  3CIP A;  4FOE A;  3H1V X;  4QS8 A;  3WT0 A;  5AZJ A;  2QWQ A;  4CD3 A;  1BDG A;  2NRH A;  1HX1 A;  3DXM A;  4BQL A;  4BR5 A;  2A5X A;  3H6E A;  2QW9 A;  2BUP A;  1QZ5 A;  1E4F T;  4I6M A;  3P4I A;  4JD2 A;  3GL1 A;  1X3M A;  5F1X A;  2YJF A;  3GE1 A;  1KAY A;  5AQF A;  4PKI A;  1CZA N;  2HF4 A;  1DKG D;  4BGA A;  2Q36 A;  2PBD A;  5AQG A;  1YVN A;  3U4L A;  1Z6R A;  4BRA A;  1BA0 A;  2FSK A;  3FGU A;  4B9Q A;  4CZF A;  2ZF5 O;  2OAN A;  1WUA A;  3I8B A;  3BF1 A;  2QWL A;  3A5N C;  4A61 A;  4FOI A;  4CZK A;  3EL2 A;  3ENH A;  4RCH A;  4BRF A;  4L3Q A;  3SMP A;  4RTF D;  2A41 A;  3LM2 A;  1BUP A;  3J8A A;  3UE5 A;  4H5V A;  3H3N O;  3QDK A;  1C0F A;  3WQT A;  5E84 A;  2P9L B;  1RFQ A;  5AQO A;  2ASM A;  4H5R A;  5EVZ A;  3O1W A;  5AQT A;  2ITM A;  2A40 A;  3O1B A;  2ASP A;  1ATN A;  3BEX A;  3ZEU B;  2P9I B;  5ELZ A;  2YJE A;  2FSJ A;  1G99 A;  4A2B A;  2A42 A;  1MDU B;  2P9L A;  2QM1 A;  3VER A;  3WEE B;  4H03 B;  2YHX A;  4MLH A;  3MMV A;  1NGH A;  4EIA A;  2P9P B;  3ZEU A;  1P8Z A;  2E1Z A;  3IUC A;  3U9Z A;  4FWP A;  1NGE A;  1D4X A;  2VCP A;  4ISG A;  4MO5 A;  4FWM A;  4B1Y B;  1RDW X;  4IJA A;  1NGI A;  1BG3 A;  3SJH A;  3VGM A;  1JCG A;  4H0X B;  4B1U B;  3HM8 A;  4BC5 A;  5AQU A;  3HTV A;  4DB3 A;  5JLH A;  4FL9 A;  1QZ6 A;  1NGD A;  3G25 A;  5EX5 A;  4BG9 A;  3TU5 A;  3MN6 A;  5BRE A;  4IXC A;  3LL3 A;  2A6A A;  4WQ5 A;  4A62 A;  3L6Q A;  2D0O A;  4K41 A;  3QML A;  4K43 A;  4GY2 B;  3EN9 A;  4ISE A;  2V7Y A;  5KPZ A;  2Q31 A;  4CBW A;  1NGJ A;  4BR9 A;  3A5O C;  4CZG A;  1BOT O;  2CH5 A;  1U2V B;  5FPD A;  3GDQ A;  1T6D A;  4HTL A;  2FSN A;  3O08 A;  3JS6 A;  5KPT A;  3KHY A;  2YHY A;  2GEL A;  4BR2 A;  1SQK A;  4XEI A;  1DGK N;  3D2F B;  3W3D A;  4CZH A;  3MCP A;  3OHR A;  4BR0 A;  4FWQ A;  1S3X A;  4PL7 A;  4IZ9 A;  1QQN A;  5JIC A;  3D7E O;  4H0T B;  2Q97 A;  3CHW A;  4JNE A;  2CGJ A;  4YDU A;  5AQJ A;  4B1Z A;  3CJ1 A;  1ZC6 A;  4XH5 A;  3U9D A;  1HLU A;  3D2F A;  4BRG A;  2FF3 B;  1HKC A;  3VF6 A;  1V4S A;  4BR4 A;  5I9E B;  4BG8 A;  2IIR A;  1T6C A;  3EKU A;  3HI0 A;  4BRH A;  1J6Z A;  1SZ2 A;  5EXW A;  2Q0U A;  3ZX3 A;  3FFK B;  4DCH A;  3FR0 A;  4QS9 A;  4XH4 A;  5AQR A;  4CZM A;  4FWO A;  2FLO A;  4IWV A;  3CER A;  2D1K A;  3FZM A;  1NM1 A;  3CJA A;  4Z94 A;  3VEX A;  1TYQ B;  4B1X B;  3C7N B;  4DHY A;  5BRF A;  2Q1N A;  3UKR B;  1DEJ A;  3ENO A;  2V52 B;  4E1J A;  5B8H A;  1SAZ A;  5AQQ A;  3EKS A;  4FSV A;  3AY9 A;  4XH1 A;  4BRL A;  3GOI A;  4AM6 A;  3C0B A;  5FPE A;  1TYQ A;  3LDL A;  3U8X A;  4ISF A;  3C7N A;  3VPZ A;  3UB5 A;  3UKR A;  1Q18 A;  3BUZ B;  2QWR A;  5AR0 A;  1XQS C;  3IMX A;  4M7X A;  4FWR A;  3TPQ A;  2WUS A;  5AZI B;  1JCE A;  2VWB A;  3O80 A;  3LDO A;  4BRO A;  2HOE A;  1QQO A;  4BRP A;  3AAR A;  1ATR A;  4WQ4 A;  3SK3 A;  5CE3 A;  2QWP A;  3R9P A;  2IVO A;  4CJ7 A;  2H3G X;  2VYP A;  3FZK A;  5AQN A;  5JLF A;  3F9M A;  4CZL A;  4CZJ A;  3UKU B;  3JXU A;  2F9W A;  4BC4 A;  5KQD A;  2GTD A;  4BQZ A;  3ZX2 A;  3A5L C;  5AZI A;  3KVG A;  2P9I A;  2IVN A;  5KQ8 A;  4H5N A;  2CH6 A;  2FXU A;  3ZET B;  4HWI A;  1NGA A;  3BP8 A;  2AA4 A;  3M3Z A;  2E20 A;  3O4W A;  4NO7 A;  3SLC A;  5KPR A;  2PAV A;  3WEE A;  4MLE A;  4LC9 B;  3UKU A;  3HZ6 A;  4O5F A;  3LM9 A;  1HKB A;  1XUP O;  3CI5 A;  2E1Y A;  2P9P A;  4H5T A;  2I7N A;  2KHO A;  3QFU A;  3AAQ A;  4BRI A;  3VGK A;  2V7Z A;  3CJB A;  3FLC O;  3ZET A;  4M63 C;  3DXK B;  4M7Y A;  2D4W A;  3ID8 A;  2NLX A;  3H45 C;  1KXP A;  1GLL O;  1XC3 A;  3O6W A;  5BN8 A;  1NGG A;  2E8A A;  2A3Z A;  2AP1 A;  5AQS A;  3D2E B;  1ESV A;  4BR7 A;  3VEO A;  2NZT A;  2P9N B;  4Y0W A;  5AQV A;  4KBO A;  4FPA A;  4EAH D;  1OKJ A;  5ADX H;  2QWN A;  3DXK A;  4CZI A;  1HJO A;  4BRM A;  4BVO A;  4EHU A;  2GEM A;  5AQM A;  4B1W B;  2UYT A;  4IO8 A;  3SMS A;  3FZF A;  3D2E A;  2ZGY A;  3MN7 A;  1E4G T;  1GLE G;  3H3O B;  2P9N A;  1JCF A;  2P9K B;  3VOV A;  1H1V A;  1C0G A;  5BPN A;  2FF6 A;  5BRH A;  2D0P A;  2CGL A;  3L0Q A;  3EZW A;  1U2V A;  3ZX0 A;  1V4T A;  2V51 B;  3DAW A;  2W41 A;  5EOY A;  4CBX A;  1GLF O;  1GLC G;  5AFU H;  1IG8 A;  3CJC A;  3WXK A;  3HSC A;  4FO0 A;  4I6M B;  2P9K A;  1IJJ A;  2ASO A;  2QXL A;  3FE1 A;  3DJC A;  2Q0R A;  2E88 A;  4PKH A;  3L4I A;  4FWN A;  1ATS A;  1MA9 B;  3H1Q A;  3WUH A;  3DWL A;  1BU6 O;  3GG4 A;  1GLB G;  3R8E A;  3A0I X;  5AQL A;  5BPM A;  4H5W A;  2J4R A;  2GWK A;  4PL8 A;  1WOQ A;  3LDP A;  3FZH A;  1HUX A;  1GLA G;  4GNI A;  3LDN A;  5LJW A;  1BWF O;  4BRE A;  5BRD A;  2I7P A;  4J8F A;  2DPN A;  4H0Y B;  4WQ5 C;  1K8K B;  1RGI A;  3VEN A;  3WQU A;  3QB0 A;  4FWK A;  2ZWH A;  4JN4 A;  5LJV A;  1HKG A;  4CZE A;  1MWK A;  2GUP A;  4BRK A;  3MN9 A;  3HBT A;  2P9S B;  3QFP A;  1LCU A;  4JAX A;  5AQW A;  5AQI A;  1ZXO A;  3VEW A;  2QWO A;  1K8K A;  3RSE B;  3WXI A;  3MDQ A;  2BTF A;  3A5M C;  2YI1 A;  4BC2 A;  4BRC A;  1YXQ A;  4BC3 A;  1S22 A;  1U6Z A;  1NWK A;  5ADX A;  3O5B A;  1YAG A;  3CJ9 A;  3S41 A;  1QQM A;  3FZL A;  5JMV A;  2P9S A;  1GLD G;  4F9O A;  2F9T A;  3IFR A;  3ATU A;  3QBX A;  1NGB A;  3VF4 A;  3LDQ A;  3RSE A;  4JHD B;  2QWM A;  4EFH A;  1NGC A;  4A2A A;  3A8Y A;  4H0O A;  3WXL A;  5FPM A;  3QIC A;  4YDU C;  4RWT A;  2YCH A;  2EWS A;  5AQX A;  1X9J A;  3M6G A;  4BRN A;  1KAZ A;  1TUU A;  4B1V A;  1TUY A;  4IJN A;  4DQ8 A;  3AAP A;  2GWJ A;  3VGL A;  5AFU A;  3WXJ A;  1BA1 A;  2Q2R A;  3GBT A;  1X3N A;  3BF3 A;  4JHD A;  5TKY A;  2E2Q A;  4K25 A;  3CQX A;  3O8M A;  4BVP A;  3KZB A;  2HF3 A;  3VEZ A;  1NGF A;  3CJ7 A;  3H46 O;  2W40 A;  1YUW A;  5F2R A;  5FPN A;  5AQY A;  5F0X A;  2P9U B;  1T44 A;  4FWL A;  2E2P A;  2YHW A;  1BO5 O;  4H0P A;  1EQY A;  1Z05 A;  3R6M A;  2CGK A;  5E26 A;  1HPM A;  3VEV A;  4BGB A;  1QHA A;  5BN9 A;  5EY4 A;  2ZGZ A;  4PKG A;  3M1F A;  1R59 O; 
#chains in the Genus database with same CATH topology
 3VES A;  1HNV A;  1S9E A;  1ZBF A;  2XRI A;  4ZTJ A;  4YOT A;  4DV1 K;  3PV8 A;  3NBP A;  1C1B A;  1RDU A;  3T1Y K;  3DLG A;  4OGE A;  4MO4 A;  1IH7 A;  3TTC A;  1Y64 A;  3AA3 A;  3VEY A;  3W0L A;  1FKO A;  3J7Y P;  3MED A;  4O8K A;  4IBN A;  5GAD P;  4FWS A;  3CQ8 A;  2VG5 A;  1KAX A;  1NMD A;  1BIS A;  1OH7 A;  3B6P A;  1LOT B;  1NLV A;  4LF4 K;  4JD2 B;  4H0V B;  3LP1 A;  3I55 N;  3CIP A;  2OA8 A;  3RRH A;  4QS8 A;  4DKW A;  3WT0 A;  2QWQ A;  1VQO N;  1BI4 A;  3B6O A;  2NRH A;  3V9W A;  4FJI A;  4DV0 K;  1CXQ A;  2E4L A;  3H6E A;  1VQN N;  2OPQ A;  4IOA L;  3P4I A;  1Q8I A;  2RHK A;  2O8C A;  5SWM A;  2KZZ A;  3GL1 A;  1KAY A;  4DTJ A;  1CZA N;  3MXJ A;  4EP4 A;  1XNQ K;  1Z6R A;  1BA0 A;  2NRW A;  5I3U A;  3AO1 A;  1UWB A;  1DTQ A;  1SKR A;  1YJW N;  4U67 L;  2HHI A;  3VQ4 A;  1VQ6 N;  1KLM A;  3U3G A;  4FLY A;  2OAN A;  4FM2 A;  3QER A;  1WUA A;  4OLA A;  4JI4 K;  1SUQ A;  5HRO A;  3PUF A;  4FOI A;  1WSH A;  1WSF A;  3VQ6 A;  4CZK A;  2QKB A;  1VAZ A;  2Z1I A;  4O5B A;  4O8U A;  2E6L A;  3HYF A;  4DSI A;  4CW7 B;  1C0F A;  3WQT A;  3HRG A;  4KHQ A;  4BEC A;  4DV2 K;  4HHT A;  3S3O A;  2WOM A;  2P9L B;  3EZ5 A;  5CYM A;  2WON A;  5AQT A;  3OYF A;  5FRN A;  2YX6 A;  3TWH A;  1VK0 A;  2YHA A;  1TK5 A;  2A1R A;  5GIP A;  1MDU B;  3EE9 A;  3VER A;  4UQG A;  4CIF A;  2O8B A;  4I9Q A;  3WEE B;  3CPE A;  2NRZ A;  4EIA A;  4CF2 A;  3L2Q A;  3ZEU A;  3OYC A;  1NGE A;  1RCH A;  4MO5 A;  4XIU A;  4Z4E A;  3C6A A;  1T8E A;  3CME N;  4PY5 A;  4IJA A;  4Y1D A;  4KHW A;  3L2U A;  2OYQ A;  3HVR A;  5JLH A;  4K8X A;  5HBM A;  3G25 A;  3CFP A;  3LP0 A;  3HST B;  3CC4 N;  4BG9 A;  2YNI A;  3TU5 A;  3V4I A;  3AVN A;  3CPW M;  4W5N A;  4A62 A;  1KQS M;  3L6Q A;  3WNE A;  3OYJ A;  4K43 A;  1W7A A;  4H4O A;  1OH5 A;  3ZYY X;  4JI7 K;  3VQE A;  4C1N K;  2QA4 N;  3TAF A;  1L3S A;  4Z4F A;  4IO9 L;  3LPT A;  4CZG A;  4RW4 A;  4NXN K;  1YJN N;  1WB9 A;  5FPD A;  4IOC L;  1L3V A;  1RBV A;  3IAY A;  1NNE A;  2O8E A;  1ZBI A;  4BR2 A;  3D0P A;  3W3D A;  4CZH A;  3MCP A;  3KLI A;  4GMJ B;  3KD1 E;  4FWQ A;  5DM7 L;  4EZ6 A;  1K9M O;  4FZX C;  4XJX A;  1BCO A;  1Q82 O;  3CHW A;  3THY A;  1LWF A;  5CYQ A;  3LDS A;  1ZC6 A;  3OTO K;  1HLU A;  2FF3 B;  1HKC A;  1V4S A;  5I9E B;  4BG8 A;  3CM6 A;  4BRH A;  4M3Y A;  2JGU A;  2X78 A;  1SZ2 A;  1HNZ K;  4IG0 A;  3HM9 A;  3MCA B;  3P83 D;  3FR0 A;  2UXC K;  5AQR A;  3P39 A;  3KLE A;  2QTD A;  1NM1 A;  1JLG A;  4J2A A;  1OVY A;  3VEX A;  3AVF A;  3HPH A;  3AGR A;  2Q1N A;  1SS6 A;  2Y1J A;  1SL1 A;  1YTA A;  3ENO A;  4YOX A;  2OPR A;  1WAF A;  5KRS A;  4I2Q A;  3AY9 A;  3GOI A;  4KTW A;  4AM6 A;  4DFK A;  3C0B A;  1TYQ A;  1NMN A;  4DU3 A;  2HB5 A;  3UB5 A;  3UKR A;  1JL2 A;  3CCL N;  2QWR A;  4KAZ A;  5AR0 A;  1XQS C;  5DMR A;  4NCG A;  2FBT A;  3TPQ A;  2YNH A;  3RMB A;  3O80 A;  2DFE A;  4X62 K;  2HOE A;  4O55 A;  3VA0 A;  3ZLJ A;  5KI6 A;  2H3G X;  3F9M A;  1EKE A;  1RTI A;  3ZSW A;  4B9T A;  2GTD A;  1N8R O;  3CMA N;  1FKP A;  5JVH L;  5AZI A;  4B9S A;  3AVK A;  1T03 A;  4F2S A;  4B3O A;  1YIJ N;  4CHZ A;  1NGA A;  3ASM A;  5KPR A;  3MAQ A;  3V9X A;  3RWU A;  1UA0 A;  4PA1 A;  3UKU A;  4O5F A;  3LM9 A;  4CEB A;  4X65 K;  3NDK A;  2D0B A;  2X6S A;  3HOS A;  4H5T A;  2I7N A;  2KHO A;  3AVM A;  3AAQ A;  3HOT A;  3K5M A;  2D4W A;  3H45 C;  3ZSV A;  4FK2 A;  5C0Y A;  5SZT A;  4GV3 A;  5AQS A;  2C1G A;  1U48 A;  3D2E B;  4OX9 K;  2NZT A;  1M90 O;  4FPA A;  4WFB L;  5ADX H;  3KWI A;  3DXK A;  1IBM K;  1YVU A;  4CZI A;  4EHU A;  5C10 A;  2YNG A;  4FLT A;  4KO0 A;  3O9U A;  3FZF A;  2KQ2 A;  3MN7 A;  2QEX N;  4M3W A;  1WAJ A;  2P9N A;  1JCF A;  2P9K B;  4CK1 A;  3CCU N;  1NU0 A;  1C0G A;  5BPN A;  5BRH A;  2D0P A;  2ZQB A;  2CGL A;  3L0Q A;  3EZW A;  3LAK A;  4LSL A;  2V51 B;  1J5E K;  4KI6 A;  4N56 A;  4CBX A;  1UAX A;  1GLC G;  4OJR A;  3OYI A;  4DTR A;  3VA3 A;  3KK7 A;  4AHU A;  1DLO A;  2O8C B;  2NRX A;  4E7J A;  3L8B A;  1OVQ A;  3L4I A;  3C94 A;  2YNF A;  1NK6 A;  1U47 A;  1BU6 O;  1RDB A;  1L3U A;  1GLB G;  4O4G A;  3A0I X;  3PX6 A;  2GWK A;  4JYA K;  4CJ4 A;  1GLA G;  5KGX A;  3NGZ A;  4AIL C;  3K59 A;  3LDN A;  2QXF A;  1BWF O;  1JJ2 M;  2O8F A;  3PO5 A;  5EU7 A;  3VEN A;  2HNY A;  3QB0 A;  4FWK A;  4KB1 A;  2O8D B;  5LJV A;  1HKG A;  3U6F A;  4DSK A;  3HBT A;  5FLX O;  4LY7 A;  2VWJ A;  4JAX A;  1WSJ A;  1WSE A;  4JKA A;  3AVJ A;  3ALY A;  4LF7 K;  1K8K A;  1Q7Y O;  3WXI A;  1XNR K;  3A5M C;  3P31 A;  3CCR N;  4E19 A;  1I3A A;  1U6Z A;  1RT7 A;  3S41 A;  1TKX A;  2P9S A;  3HT3 A;  1TKT A;  2F9T A;  1S6Q A;  3V9U A;  4DV4 K;  1TAU A;  1W9H A;  3RSE A;  2HND A;  1CZB A;  4A2A A;  3A8Y A;  3QIP A;  3OYL A;  2O8B B;  4H0O A;  5FPM A;  3OYH A;  2X74 A;  4KFB A;  2EWS A;  1KC8 O;  3M6G A;  2RKI A;  4M3Z A;  4ZHR A;  4B1V A;  1SKS A;  4YNQ A;  3C6T A;  3M8R A;  3KTQ A;  3GBT A;  3PSF A;  3M8S A;  4IKF A;  4BVP A;  3KZB A;  3LPU A;  3CJ7 A;  1YUW A;  4DLG A;  2HST A;  3ZSR A;  5AQY A;  4LF8 K;  4B08 A;  2P9U B;  3Q7B A;  4FWL A;  4BE0 A;  4LD0 A;  1N32 K;  1TVR A;  1JLA A;  2CGK A;  2NRR A;  5HLF A;  3VEV A;  4CFC A;  2FBV A;  2ZGZ A;  3ULE B;  1W2B M;  4C23 A;  3J80 O;  1LWE A;  3OYB A;  1NBW A;  3THV A;  2HMP A;  2ZD1 A;  4BRQ A;  3B8A X;  3RMA A;  4DTN A;  3EO3 A;  4JLH A;  3QBW A;  2D0A A;  1VQM N;  4DUY K;  3RVC A;  4CEA A;  2KKZ A;  3LAL A;  5AZJ B;  3MX5 A;  4CJP A;  2LSN A;  3S5T A;  2Q3S A;  3G10 A;  3G4S N;  5BPL A;  2D0C A;  3QEX A;  2E2N A;  3DXM B;  3VF2 A;  1BL3 A;  4Y1C A;  5AQZ A;  3BZC A;  1RT2 A;  1VRT A;  5LY3 A;  4NYF A;  1MWM A;  4JI5 K;  3P5J A;  3HVT A;  1W97 L;  3I0S A;  4FW1 A;  3T3F A;  2HBM A;  4BQL A;  4DFM A;  2PZS A;  4Z4C A;  3RR7 A;  5KTQ A;  3WNF A;  3M8Q A;  4M3X A;  1VQ4 N;  3OA9 A;  4E7H A;  3C95 A;  5F1X A;  3SZ2 A;  3BZK A;  3GE1 A;  3SQ4 A;  4PKI A;  1ZBL A;  2HF4 A;  2PY5 A;  3MEE A;  4DLE A;  4LFB K;  5AQG A;  4CJR A;  3V9S A;  1B9F A;  4DQI A;  3V1Q A;  3O3G A;  4BRA A;  4YOV A;  1X9S A;  4ILJ A;  1VHX A;  4YHH K;  1BCM A;  3AO2 A;  3V81 A;  4HCC A;  1XI1 A;  1UA1 A;  1LAV A;  2PYJ A;  3A5N C;  4A61 A;  5HRN A;  1TAQ A;  2IGI A;  3T69 A;  1TKD A;  2RF2 A;  3SMP A;  3CCE N;  4KKO A;  1NKB A;  4E1N A;  2HHW A;  1S72 N;  4FVU A;  2ASM A;  4H5R A;  4CEC A;  1NJY A;  1C1C A;  1HQE A;  2W42 A;  1ATN A;  3BEX A;  1C0T A;  3EE8 A;  5ELZ A;  4CIG A;  3NH2 A;  1O13 A;  2A42 A;  4C8K A;  4KPY A;  2YHX A;  3QET A;  3QO9 A;  2R7Y A;  4DV3 K;  4DTO A;  3SNN A;  4O44 A;  3C65 A;  3ZCM A;  1VQL N;  1P8Z A;  3E1Y A;  3WXM B;  3IUC A;  3OYM A;  1X9W A;  1VQ7 N;  4FWP A;  4FJH A;  1NK7 A;  3OYG A;  1JLF A;  3TSU A;  1XC9 A;  3SBG A;  4KTQ A;  1EP4 A;  4B9V A;  1BG3 A;  1JLB A;  3HP9 A;  3VGM A;  4H0X B;  4NYN A;  4BC5 A;  3SV4 A;  3DRS A;  3HTV A;  4DB3 A;  4FL9 A;  2KZM A;  4FZZ A;  3AVL A;  4IEE A;  4DQS A;  4FLW A;  5HRS A;  3O4N A;  3L4Q A;  1QSS A;  4B3R K;  4WF9 L;  2A6A A;  4WQ5 A;  2IAJ A;  4DV7 K;  5DM6 L;  4K41 A;  3CCM N;  1HMV A;  4GY2 B;  3EN9 A;  1NKE A;  2V7Y A;  1RT4 A;  5KPZ A;  3JAM O;  4DSF A;  1NGJ A;  2W00 A;  4KTZ A;  3A5O C;  2BDP A;  5M1N A;  1BOT O;  1A5X A;  2CH5 A;  3V9Z A;  1RTJ A;  5GAG P;  1T6D A;  1HRH A;  4HTL A;  4BE2 A;  4LF5 K;  3KHY A;  3DM2 A;  3TR8 A;  3VQ7 A;  1SQK A;  1DGK N;  3D2F B;  3QIN A;  4CFD A;  4BR0 A;  4JV5 K;  1VSL A;  3OYD A;  2B5J A;  1JLE A;  4FJ8 A;  4IZ9 A;  1QQN A;  3D7E O;  4H0T B;  3SUN A;  1WLJ A;  2CGJ A;  3CJ1 A;  3ZT3 A;  4XH5 A;  3AV9 A;  2P51 A;  4KHY A;  3VF6 A;  2ZE2 A;  4JKG A;  5C42 A;  5J1E A;  1N5Y A;  1T6C A;  2BAN A;  1T3V A;  3EEQ A;  3QEV A;  4OKJ A;  2G8V A;  3FFK B;  4CJQ A;  4QS9 A;  4CZM A;  1S1W A;  1L3T A;  4IWV A;  2D1K A;  3NVM A;  1TK8 A;  2Y1I A;  4Z94 A;  1U45 A;  2HBJ A;  4B1X B;  3C7N B;  2ETJ A;  4DHY A;  5BRF A;  1R0A A;  3I56 N;  2F96 A;  2V52 B;  5B8H A;  4FJX A;  1SAZ A;  1IKV A;  4Q5V A;  4OO1 J;  2G8K A;  4DV6 K;  3FFI A;  4B3T K;  1VQ9 N;  1DTT A;  3AVB A;  3VPZ A;  3BUZ B;  3NH1 A;  1D9F A;  4M7X A;  3K2P A;  4GVE A;  4YFU A;  4B9U A;  3PIO L;  2OZM A;  1Z25 A;  1JCE A;  4CJL A;  5LMU K;  1VRU A;  4DV5 K;  2HBK A;  4GV9 A;  3AA4 A;  4WQ4 A;  3CM5 A;  2ZJP L;  2QWP A;  3R9P A;  1S5J A;  1KFD A;  4PHT X;  2F9W A;  4BC4 A;  5KQD A;  3L2W A;  1NKC A;  3A5L C;  3KVG A;  4FM1 A;  3S3N A;  5KQ8 A;  4H5N A;  2VG6 A;  1RBU A;  3ZET B;  5H1S Q;  3DLH A;  5AJ3 K;  1NJW A;  2AA4 A;  4M45 A;  3O4W A;  2PAV A;  3THX A;  2ZJR L;  4MLE A;  1YTU A;  1TV6 A;  1QTM A;  1HKB A;  5GIN A;  3OY9 A;  5JS1 A;  4CJT A;  4X66 K;  2HHQ A;  4DTS A;  4E89 A;  3I0R A;  3VGK A;  3O9S A;  4CFB A;  2NLX A;  4GKJ K;  2HHX A;  4CK3 A;  1CZ9 A;  2E8A A;  4C8L A;  3ZT4 A;  1C0U A;  5FDL A;  4A57 A;  1ESV A;  2HVI A;  4Y0W A;  3TAP A;  2F4V K;  1HYV A;  1S1V A;  1YHQ N;  4BE7 B;  4MDB A;  4BVO A;  1VSF A;  4OPA A;  3C6H A;  3SCX A;  4Q0B A;  3QEI A;  1X1P A;  1D9D A;  4LF6 K;  3H3O B;  3WNG A;  4BDZ A;  3D6R A;  4BE1 A;  2G8U A;  4CF1 A;  4OGC A;  4JRP A;  4HUE A;  1L5U A;  4MQ3 A;  3DI6 A;  3THW B;  3CYG A;  4HCB A;  3T1A A;  4E7I A;  3VQ8 A;  5AFU H;  3VQ5 A;  5C12 A;  2O4G A;  3N4P A;  4H4M A;  4E7L A;  4CJV A;  1QHT A;  3AA5 X;  3H1Q A;  1WBD A;  1P90 A;  2W6L A;  4KHP K;  4W5T A;  1WOQ A;  3O9Q A;  4E1M A;  3FZH A;  4J2B A;  5LJW A;  3VTI A;  4J2D A;  4BRE A;  5BRD A;  3MXM A;  4LFA K;  3L2R A;  1GOC A;  2XY6 A;  3CD6 N;  4K8Z A;  4CZE A;  1MWK A;  1NJX A;  2GUP A;  4BRK A;  4FZY A;  2FBX A;  4IOX A;  3IS9 A;  3DLK A;  3VEW A;  2IS3 A;  2QWO A;  4EP5 A;  3MDQ A;  2YI1 A;  4MFB A;  2HNZ A;  4BC2 A;  4M3R A;  3LZJ A;  4BC3 A;  1S22 A;  3CJ9 A;  3DLL L;  1U4B A;  4X64 K;  3TAB A;  3PSI A;  1XMO K;  1RIL A;  1GLD G;  4F9O A;  2HHH K;  4DS5 A;  4JHD B;  2QWM A;  4CK2 A;  2QI2 A;  3NGI A;  1BQM A;  1TL1 A;  3SAF A;  2YCH A;  4N76 A;  3KLH A;  4RW7 A;  3WNH A;  1TUY A;  4IJN A;  4DR5 K;  2KTQ A;  1ITG A;  3JSM A;  4DG1 A;  5M1P A;  1BA1 A;  1KD1 O;  1X3N A;  3BF3 A;  2B6A A;  3E66 A;  2E2Q A;  3VQ9 A;  1B92 A;  4K25 A;  3PIP L;  4DU1 A;  3SUO A;  3O8M A;  4JK8 A;  4AHC A;  4C8O A;  3C6U A;  2HF3 A;  3VEZ A;  4WCE L;  5M1F A;  4E0D A;  4DWI A;  4F2R A;  5HP1 A;  5KGW A;  3PX0 A;  3KK1 A;  1KVA A;  5F0X A;  1ZBH A;  4M3T A;  2YHW A;  1EQY A;  1LW0 A;  2HHT A;  4BWM A;  5EY4 A;  3M1F A;  1TKZ A;  2RN2 A;  4OLB A;  3VQB A;  4IFY A;  4U7B A;  3ATV A;  2FBY A;  4CGI A;  2OZS A;  1GLJ O;  4FPB A;  4NCA A;  4Z4H A;  3D45 A;  4DS4 A;  3IDH A;  1ASW A;  4ILH A;  4CF9 A;  5KRT A;  4CGH A;  4CFA A;  5IWA K;  1BI4 B;  3K5O A;  2D5R A;  2Z1J A;  5GAE P;  4EHT A;  3I33 A;  1QSL A;  5AQP A;  2IVP A;  5TKW A;  4BRD A;  3OS0 A;  1IO2 A;  3MK6 A;  3KLF A;  2ATQ A;  4FJL A;  4OKK A;  2E2O A;  4DQR A;  3KIO A;  3H1V X;  1RBS A;  2XY8 A;  4J2E A;  2B4J A;  2NNW A;  4CF0 A;  4DU4 A;  1QVF M;  1BGX T;  4BR5 A;  3V1R A;  4QOZ B;  3F73 A;  1E4F T;  1VSI A;  4I6M A;  1D8Y A;  1J53 A;  3PO4 A;  4CJS A;  4JD2 A;  3DOK A;  2YJF A;  3P38 A;  1REV A;  4DF4 A;  4FYD A;  3K57 A;  4V19 S;  3NGY A;  1DKG D;  3QLH A;  3CYM A;  5C2F A;  4AHS A;  4DQQ A;  3U4L A;  5BR8 K;  4PQU A;  1QVG M;  4IDK A;  5HL7 L;  5CZ1 A;  2FC0 A;  1HYZ A;  1FW6 A;  2DFF A;  1NK5 A;  3E9L A;  4B9Q A;  4WE1 A;  1SV5 A;  2UU9 K;  4DTX A;  2ZF5 O;  2JLE A;  3OYN A;  4DFJ A;  2QWL A;  4HVJ A;  1ASU A;  4JKF A;  2VGN A;  2I5J A;  4BDY A;  1XMQ K;  4BRF A;  3F2K A;  4RTF D;  5DK5 A;  5FRO A;  1VSJ A;  3LM2 A;  4DTP A;  1BUP A;  3QEP A;  2HMI A;  3J8A A;  4H5V A;  1ZBU A;  3VQP A;  3QDK A;  1RFQ A;  3J7Z O;  5EVZ A;  3O1W A;  4KH5 A;  2ITM A;  4ID5 A;  3OVN A;  3ZEU B;  1OH8 A;  3CFO A;  3TTF A;  3TAQ A;  4ELU A;  1NK4 A;  2YJE A;  4CJF A;  1G99 A;  2FSJ A;  1TGO A;  2P9L A;  3PX4 A;  2RPI A;  1KCF A;  3Q7C A;  1BIU A;  5CY4 A;  4MLH A;  5LMN K;  4W5Q A;  2VQE K;  3SPZ A;  4ISG A;  4FWM A;  4N5S A;  1Q9X A;  3O9R A;  1RDW X;  1BHL A;  3M5R A;  3SJH A;  3KWG A;  4FCY A;  3HM8 A;  5AQU A;  4AH9 A;  4DTU A;  1QZ6 A;  1NGD A;  3SI6 A;  1KFS A;  5BRE A;  4IXC A;  1ZYQ A;  1HQU A;  1MU2 A;  3KKS A;  1VSH A;  3QML A;  4CJE A;  3CG7 A;  3H08 A;  4ISE A;  3NE6 A;  2O8E B;  3L2V A;  3SQ1 A;  5CZ2 A;  4FJ5 A;  1KTQ A;  2Q31 A;  4CBW A;  4G9Z A;  1Q9Y A;  4BR9 A;  4CEO A;  1K73 O;  2WC9 A;  3SBT A;  3AA2 A;  2FSN A;  3O08 A;  3JS6 A;  1XWL A;  3ZSO A;  3THY B;  4DR1 K;  3TSP A;  3NF8 A;  3LAN A;  5C15 A;  2F7T A;  4DFP A;  4XEI A;  1IBL K;  2KW4 A;  1S3X A;  4G1Q A;  4PL7 A;  1Z26 A;  3OJU A;  3F9K A;  3CXC M;  3AGK A;  2WBN A;  4YDU A;  5MLC Q;  2A1S A;  5D3G A;  3EKU A;  3HI0 A;  5A2Q O;  3K0S A;  5LL6 Z;  2NRV A;  4ICL A;  3S9H A;  2Q0U A;  1NG9 A;  4AF1 A;  4AQY K;  2YKN A;  5J2M A;  3QES A;  4FWO A;  3CER A;  4JKH A;  3V6D A;  3F5T A;  4DR3 K;  1TYQ B;  3PLA A;  4BDP A;  3RRG A;  1S1U A;  1LW2 A;  4GV6 A;  3UKR B;  3HK2 A;  4R5P A;  3K9K A;  2RE2 A;  3VTH A;  5AQQ A;  3EKS A;  3AVH A;  4FSV A;  4KV8 A;  2QKK A;  2KFN A;  3OYK A;  4XH1 A;  3TTD A;  4JKC A;  4OKE A;  3AO3 A;  3TSQ A;  5FPE A;  2GV9 A;  2IDO A;  3U8X A;  4ISF A;  1XHZ A;  1Q18 A;  3T19 A;  1VSK A;  3IRX A;  2EHG A;  4FWR A;  5JS2 A;  5AZI B;  1NOZ A;  5C25 A;  2VWB A;  4LH5 A;  4BRO A;  1W0H A;  1QQO A;  3TAG A;  3AAR A;  1ATR A;  4FLV A;  4CGD A;  2VYP A;  5AQN A;  4CZJ A;  2OPP A;  3CCJ N;  3UKU B;  4N41 A;  3JXU A;  4ILG B;  3K5N A;  1CLQ A;  4JI6 K;  3E9O A;  1S9G A;  4JK9 A;  2XO7 A;  2G8W A;  2XY7 A;  2P9I A;  2IVN A;  1JXE A;  2CH6 A;  2C1I A;  5JEN A;  1NJZ A;  2ZM6 K;  2E20 A;  5HOO A;  4NO7 A;  1Y97 A;  3AVG A;  1HJR A;  4KRF A;  3HZ6 A;  3OBY A;  4Z4I A;  1K8A O;  3CF5 L;  1EXQ A;  2IOC A;  2P9P A;  3NHG A;  1Q81 O;  2VQF K;  3QFU A;  4BRI A;  3FLC O;  4M63 C;  3DXK B;  1C0M A;  3ID8 A;  1KXP A;  4OPH A;  4TSX A;  1XC3 A;  3O6W A;  5GAH P;  3OW2 M;  5BN8 A;  4M3U A;  2X6N A;  2AP1 A;  4R79 A;  4OPJ A;  3ZT2 A;  1RT3 A;  4BR7 A;  2P9N B;  3M8P A;  4CES A;  4KBO A;  4EAH D;  1OKJ A;  3RMC A;  1IKY A;  4CVN E;  2GEM A;  4C8M A;  1YJ9 N;  5AQM A;  3OBW A;  2UYT A;  3SMS A;  4FM0 A;  3D2E A;  1F21 A;  4CGG A;  1E4G T;  1YF5 L;  1GLE G;  5E41 A;  1N6Q A;  4JI0 K;  3VOV A;  2VWK A;  3NF7 A;  1H1V A;  4C8N A;  2G8H A;  3VQQ A;  2FF6 A;  3HO1 A;  1U2V A;  3ZX0 A;  3DAW A;  2OCE A;  5C2D A;  4W5O A;  1KVB A;  2UXB K;  3ZT0 A;  3WXK A;  4YOW A;  4B9M A;  4I6M B;  2P9K A;  3I8D A;  2ASO A;  1K6Y A;  1RNH A;  3FE1 A;  3DJC A;  2E88 A;  2HVH A;  4PKH A;  1SKW A;  4KRE A;  1MA9 B;  1M1K O;  1KVC A;  3MXI A;  2O8F B;  4CCH A;  1N33 K;  3AVA A;  2JWK A;  5AQL A;  3KLG A;  5BPM A;  3R1X A;  3LDP A;  4IFV A;  3K9J A;  1HUX A;  3N4Q A;  4GNI A;  1O1W A;  4MDA A;  3TAN A;  1FJG K;  2I7P A;  2IC3 A;  4J8F A;  2P5G A;  4WQ5 C;  1K8K B;  4RW6 A;  1RGI A;  1YIT N;  3WQU A;  4EZ9 A;  1WBB A;  4JN4 A;  1OH6 A;  2BGG A;  4H8K A;  3QIO A;  4CHQ A;  4O0I A;  4HUG A;  2P9S B;  1LCU A;  1RDD A;  4FK4 A;  5AQW A;  4IDH A;  4PWD A;  3O9T A;  3MX2 A;  3RSE B;  4RW9 A;  3K58 A;  3NCI A;  4BRC A;  1YXQ A;  3VMF B;  1IKW A;  2O8D A;  5ADX A;  3O5B A;  1YAG A;  4PUO A;  1QQM A;  3FZL A;  5JMV A;  1FK9 A;  2HHS A;  4DSL A;  3ATU A;  3QBX A;  3TAE A;  5GIO A;  3LDQ A;  3ZSX A;  4LSN A;  2OTL N;  2AJQ A;  5AQX A;  1X9J A;  4FXD A;  1EET A;  2ZJQ L;  1TUU A;  3AAP A;  2GWJ A;  3VGL A;  1WSI A;  4BEB A;  3WXJ A;  4DTM A;  4FJ7 A;  4Z0U A;  2VGM A;  3BDP A;  5J2P A;  3CQX A;  3DRP A;  3DYA A;  3L3U A;  3SJJ A;  4E3S A;  4ZTF A;  4FJJ A;  3BGR A;  5F2R A;  4FJG A;  3LAM A;  3J7A P;  3OYA A;  3TAR A;  3DOL A;  2E5L K;  4JI2 K;  4JEP A;  4CHO A;  2OPS A;  1BO5 O;  4H0P A;  4F8R A;  1Z05 A;  3V1O A;  4KH6 A;  1TK0 A;  2XY5 A;  1QHA A;  4FLX A;  1EWQ A;  4BWJ A;  2UUB K;  1R59 O;  3DLE A;  4CD3 A;  1RDC A;  3CET A;  4CHY A;  1NK8 A;  3NF6 A;  1ZBS A;  1RT5 A;  4JS5 A;  4WYB A;  4KI4 A;  2P9U A;  3CQY A;  3NH0 A;  3A2F A;  3E01 A;  4DR2 K;  1RT6 A;  5BR9 A;  4CI6 A;  4K42 A;  3MN5 A;  1BIZ A;  4DR6 K;  4LF9 K;  4CBU A;  3ZSY A;  3ULE A;  4WQ4 C;  4YY3 K;  3RR8 A;  3E9P A;  2ITG A;  3VET A;  4CJW A;  4LFC K;  3LWM A;  3ZSZ A;  4NB4 A;  3LP3 A;  5AQH A;  4AM7 A;  5AQK A;  4CJK A;  4CD1 A;  2XHB A;  3OJS A;  1JXB A;  3NF9 A;  4QS7 A;  4KH4 A;  4K0K K;  4F3O A;  4FOE A;  5AZJ A;  2UXD K;  1BDG A;  4DR4 K;  1HX1 A;  3DXM A;  2A5X A;  2QW9 A;  2BUP A;  1QZ5 A;  1KLN A;  3HP6 A;  4JI8 K;  4WFA L;  2KFZ A;  1X3M A;  1RBR A;  1C1A A;  4FVM A;  5J2N A;  1D5A A;  1VQK N;  5AQF A;  5K14 A;  2Z1H A;  4JKD A;  1BQN A;  4BGA A;  2Q36 A;  4JK7 A;  2PBD A;  1YVN A;  2P1J A;  1B9D A;  3LZI A;  2JWL A;  4E7K A;  3G0Z A;  3FGU A;  2FSK A;  5FRM A;  4DQP A;  3SQ0 A;  2F8S A;  2HBL A;  1QQC A;  3J81 O;  4CZF A;  3O4Q A;  4YOR A;  4A5A A;  3AVC A;  3CCQ N;  1T05 A;  3KJV A;  4O0J A;  3VN5 A;  5I42 A;  3I8B A;  3BF1 A;  3ITH A;  1VSD A;  3O3H A;  1J9A A;  3EL2 A;  3ENH A;  4RCH A;  5CHI A;  4L3Q A;  4GKK K;  1EO1 A;  2A41 A;  4CEZ A;  3UE5 A;  3H3N O;  3MWP A;  3IG1 A;  1T7P A;  5E84 A;  4E72 A;  4JRQ A;  5AQO A;  3EY1 A;  2A40 A;  3O1B A;  4FW2 A;  4A5B A;  4WFN L;  2ASP A;  2P9I B;  5JVG L;  1EX4 A;  4BY9 C;  1HPZ A;  4A2B A;  3CFR A;  2YV0 X;  3DLR A;  2QM1 A;  3SQ2 A;  5IT9 O;  1KRP A;  4CER A;  4CJ3 A;  4H03 B;  2HHV A;  3MMV A;  1NGH A;  1N34 K;  4GW6 A;  1LAW A;  2P9P B;  1JLC A;  1IBK K;  2E1Z A;  3U9Z A;  1D4X A;  2VCP A;  3P1G A;  1UOC A;  4FK0 A;  4B1Y B;  3ZSQ A;  1NGI A;  3LP2 A;  4B9N A;  2YHB A;  1VQ5 N;  1JCG A;  3TI0 A;  4B1U B;  1JKH A;  1LV5 A;  4CE9 A;  3NAE A;  5EX5 A;  4HUF A;  1GOA A;  3MN6 A;  3NFA A;  1KSP A;  3LL3 A;  2D0O A;  4DMN A;  1C6V A;  1U04 A;  1WNS A;  2WTU A;  2G8I A;  3R3L A;  3VQD A;  3DLB A;  3VQA A;  1U2V B;  3KD5 E;  3KK3 A;  4N47 A;  3GDQ A;  3G71 N;  5KPT A;  3K5L A;  2YHY A;  2OTJ N;  2GEL A;  4UY8 O;  2YKM A;  1SL0 A;  3CCS N;  1I94 K;  1ILY A;  3OHR A;  4JKG B;  5M1O A;  2HW3 A;  1FXX A;  3ISN C;  5JIC A;  1S1X A;  2Q97 A;  4JNE A;  4B1Z A;  5AQJ A;  4IG3 A;  3HJF A;  3U9D A;  1JLQ A;  1S1T A;  3D2F A;  4BRG A;  4CIE A;  3O3F A;  4DSE A;  4BR4 A;  2IIR A;  1RTH A;  4HTU A;  1HNX K;  1J6Z A;  5EXW A;  3ZX3 A;  4DCH A;  4W5R A;  3HL8 A;  4XH4 A;  4I2P A;  4B8C A;  1TL3 A;  4JS4 A;  2FLO A;  4JI1 K;  3FZM A;  3CJA A;  4JKE A;  4CEF A;  4B3M K;  1DEJ A;  3MWT A;  3PY8 A;  3VQC A;  4E1J A;  3OS2 A;  1HYS A;  4M41 A;  3QNO A;  4ELV A;  2PYL A;  4QCL A;  4BRL A;  4KHU A;  3LDL A;  3RTV A;  3C7N A;  3ULD A;  3UIQ A;  4CJU A;  4FLZ A;  4ELT A;  2DTU A;  4I7F A;  3IMX A;  3KKR A;  4CF8 A;  5J2Q A;  5CR4 A;  2UUA K;  1NK9 A;  4DSJ A;  2WUS A;  1A5W A;  3LDO A;  3HPG A;  4BRP A;  3ENB A;  4IEI A;  4RG8 A;  3SK3 A;  3OS1 A;  4DF8 A;  5CE3 A;  2IVO A;  4CJ7 A;  5JLF A;  3FZK A;  3MEC A;  4CZL A;  3THX B;  4FJ9 A;  4ID1 A;  1N36 K;  2DY4 A;  3ZT1 A;  4BQZ A;  3ZX2 A;  3AO5 A;  5C24 A;  2BH1 A;  4IFE A;  4AHT A;  3LWL A;  3HPO A;  2FXU A;  2W6K A;  4HWI A;  3BP8 A;  4AHV A;  3M3Z A;  3SLC A;  4DUZ K;  3WEE A;  1XHX A;  3KK2 A;  1J54 A;  4LC9 B;  3T7Z A;  1EWR A;  1XUP O;  3CI5 A;  2E1Y A;  3T1H K;  3SUQ A;  1SL2 A;  3JYT A;  2KLA A;  1DT9 A;  2V7Z A;  2Z1G A;  3CJB A;  3ZET A;  2F8T A;  4M7Y A;  4JKB A;  5M1Q A;  3G6E N;  2E6M A;  2VG7 A;  1GLL O;  4BAC A;  5M1K A;  1NGG A;  1NOY A;  3S3M A;  2A3Z A;  4OPK A;  3VEO A;  4KHN A;  1VSE A;  3ID6 A;  5AQV A;  5T7B A;  1J5O A;  2O4I A;  2QWN A;  1HNW K;  1HJO A;  1HNI A;  4BRM A;  4CEE A;  3L3V A;  2EX3 A;  4B1W B;  4CED A;  3SAH A;  4IO8 A;  2NUB A;  4B9L A;  2ZGY A;  1HR0 K;  4C1N I;  4F4K A;  1GOB A;  3DMJ A;  1VQP N;  3SV3 A;  4JI3 K;  1YT3 A;  1V4T A;  2W41 A;  2BE2 A;  5EOY A;  2HHU A;  1GLF O;  1IG8 A;  1VSM A;  4KHS A;  3CJC A;  4B3S K;  2PFU A;  3HSC A;  4FO0 A;  1IJJ A;  4L8R B;  1U49 A;  2QXL A;  1RT1 A;  2Q0R A;  3THW A;  4F3T A;  1QSY A;  4FWN A;  1ATS A;  3SYZ A;  3WUH A;  3DWL A;  3GG4 A;  1RBT A;  2P5O A;  4KB0 A;  3R8E A;  1YI2 N;  4H5W A;  2J4R A;  4PL8 A;  3U3Y A;  4CEQ A;  4GVM A;  2GBZ A;  1QS4 A;  2DPN A;  4H0Y B;  3OYE A;  3HXM A;  3BY5 A;  1RDA A;  2GX9 A;  3EYZ A;  4NCB A;  1S6P A;  1E3M A;  2ZWH A;  4CHN A;  1ASV A;  1QE1 A;  4A59 A;  1IV0 A;  1WN7 A;  3MN9 A;  4YOU A;  1X9M A;  3QFP A;  1IKX A;  2G8F A;  1VQ8 N;  4DR7 K;  3AVI A;  4FLU A;  5AQI A;  3RMD A;  2UUC K;  3SPY A;  1ZXO A;  4CHP A;  4AHR A;  4CGJ A;  1CXU A;  2BTF A;  1G15 A;  3DRR A;  2GUI A;  4QAG A;  1NWK A;  5HRR A;  3CC2 N;  3IKM A;  3IFR A;  4FJM A;  1NGB A;  3VF4 A;  4M42 A;  4EFH A;  4B8A B;  1NGC A;  3TAM A;  3NVK A;  3WXL A;  3SUP A;  3MEG A;  3QIC A;  4YDU C;  5HRP A;  2WFB A;  4OVL A;  4RWT A;  4FJK A;  4BRN A;  1KAZ A;  4DQ8 A;  3SAG A;  1LWC A;  3AO4 A;  1JL1 A;  5AFU A;  1RTD A;  3QEW A;  2Q2R A;  2DFH A;  4JHD A;  4RW8 A;  5TKY A;  3CCV N;  4YOY A;  4NLB A;  1NGF A;  3H46 O;  2W40 A;  4Z4G A;  1IG9 A;  1I39 A;  4CJ5 A;  5FPN A;  1A5V A;  4NXM K;  4NLC A;  1T44 A;  1Q86 O;  2E2P A;  4CGF A;  4LH4 A;  3R6M A;  3NMU A;  2QK9 A;  5E26 A;  1NJI O;  4FJN A;  1HPM A;  3CC7 N;  4BGB A;  3QNN A;  1WSG A;  4I9L A;  1NK0 A;  4PKG A;  2NRT A;  5BN9 A; 
#chains in the Genus database with same CATH homology
 3ULE B;  3CET A;  1W2B M;  3VES A;  4C23 A;  1ZBS A;  4YOT A;  4WYB A;  1NBW A;  2P9U A;  3CQY A;  4U7B A;  2HMP A;  3ATV A;  4BRQ A;  3B8A X;  5BR9 A;  4CI6 A;  1GLJ O;  1RDU A;  4K42 A;  3EO3 A;  4FPB A;  3MN5 A;  3QBW A;  1VQM N;  4MO4 A;  3IDH A;  3TTC A;  1Y64 A;  4ILH A;  4CBU A;  3VEY A;  3RVC A;  3ULE A;  3W0L A;  4WQ4 C;  3E9P A;  3VET A;  2KKZ A;  5AZJ B;  3MX5 A;  4O8K A;  5GAD P;  3G4S N;  4FWS A;  4NB4 A;  5AQH A;  4AM7 A;  2E2N A;  5BPL A;  5AQK A;  1KAX A;  4CD1 A;  1NMD A;  3DXM B;  3VF2 A;  5GAE P;  4EHT A;  3I33 A;  1LOT B;  5AQZ A;  5AQP A;  2IVP A;  1NLV A;  4QS7 A;  5TKW A;  4KH4 A;  3MK6 A;  4BRD A;  5LY3 A;  4JD2 B;  2E2O A;  4H0V B;  1MWM A;  3I55 N;  3CIP A;  4FOE A;  3H1V X;  4QS8 A;  4DKW A;  3WT0 A;  5AZJ A;  2QWQ A;  1VQO N;  4CD3 A;  1W97 L;  2NNW A;  1BDG A;  2NRH A;  1HX1 A;  1QVF M;  2HBM A;  3DXM A;  4BQL A;  4BR5 A;  2A5X A;  3H6E A;  1VQN N;  2QW9 A;  2BUP A;  1QZ5 A;  1E4F T;  1VQ4 N;  4I6M A;  4IOA L;  3OA9 A;  3P4I A;  4JD2 A;  2RHK A;  4WFA L;  3GL1 A;  1X3M A;  5F1X A;  2YJF A;  3GE1 A;  1KAY A;  1VQK N;  5AQF A;  3P38 A;  4PKI A;  1CZA N;  2HF4 A;  1DKG D;  4JKD A;  4BGA A;  2Q36 A;  4JK7 A;  5C2F A;  2PBD A;  5AQG A;  1YVN A;  3U4L A;  2JWL A;  1Z6R A;  4BRA A;  4YOV A;  1BA0 A;  2FSK A;  2NRW A;  3FGU A;  1QVG M;  5HL7 L;  2HBL A;  4ILJ A;  3E9L A;  4B9Q A;  1YJW N;  4U67 L;  4CZF A;  4YOR A;  4A5A A;  1VQ6 N;  2ZF5 O;  3CCQ N;  2OAN A;  1WUA A;  3I8B A;  3BF1 A;  2QWL A;  3A5N C;  4A61 A;  4FOI A;  4JKF A;  4CZK A;  2VGN A;  1VAZ A;  3EL2 A;  3ENH A;  4RCH A;  5CHI A;  4BRF A;  4L3Q A;  4O8U A;  3F2K A;  3T69 A;  1EO1 A;  3SMP A;  4RTF D;  2A41 A;  3LM2 A;  1BUP A;  3J8A A;  3UE5 A;  4H5V A;  3H3N O;  3QDK A;  3MWP A;  3CCE N;  1C0F A;  3WQT A;  3HRG A;  5E84 A;  4BEC A;  1S72 N;  4FVU A;  2P9L B;  1RFQ A;  5AQO A;  2ASM A;  3J7Z O;  4H5R A;  5EVZ A;  3O1W A;  5AQT A;  4KH5 A;  2ITM A;  2A40 A;  3O1B A;  4A5B A;  4WFN L;  2YX6 A;  2ASP A;  1ATN A;  3BEX A;  3ZEU B;  3TTF A;  2P9I B;  3EE8 A;  2YJE A;  5ELZ A;  5JVG L;  2FSJ A;  1G99 A;  4BY9 C;  4A2B A;  1O13 A;  5GIP A;  2A42 A;  1MDU B;  2P9L A;  2QM1 A;  3EE9 A;  3VER A;  3WEE B;  4H03 B;  2YHX A;  3CPE A;  3Q7C A;  4MLH A;  2NRZ A;  3C65 A;  1NGH A;  3MMV A;  4EIA A;  1VQL N;  2P9P B;  3ZEU A;  1P8Z A;  3E1Y A;  3WXM B;  2E1Z A;  3IUC A;  3U9Z A;  1VQ7 N;  4FWP A;  1NGE A;  1D4X A;  2VCP A;  4ISG A;  4MO5 A;  4FWM A;  3C6A A;  3TSU A;  3O9R A;  3SBG A;  4B1Y B;  1RDW X;  3CME N;  4IJA A;  1NGI A;  3M5R A;  1BG3 A;  3SJH A;  3VGM A;  1VQ5 N;  3KWG A;  1JCG A;  4H0X B;  4B1U B;  3HM8 A;  4BC5 A;  5AQU A;  3HTV A;  4DB3 A;  5JLH A;  4FL9 A;  1QZ6 A;  1NGD A;  3G25 A;  5EX5 A;  3CC4 N;  4IEE A;  4BG9 A;  3TU5 A;  3MN6 A;  3L4Q A;  5BRE A;  4IXC A;  3CPW M;  3LL3 A;  4WF9 L;  2A6A A;  4WQ5 A;  4A62 A;  1KQS M;  3L6Q A;  2D0O A;  5DM6 L;  4K41 A;  3CCM N;  3QML A;  4K43 A;  4GY2 B;  3EN9 A;  3ZYY X;  4ISE A;  4C1N K;  2V7Y A;  2QA4 N;  5KPZ A;  2Q31 A;  4CBW A;  4IO9 L;  4G9Z A;  1NGJ A;  3R3L A;  4BR9 A;  2W00 A;  3A5O C;  4CZG A;  1BOT O;  5M1N A;  1K73 O;  2CH5 A;  2WC9 A;  1U2V B;  5GAG P;  1YJN N;  3SBT A;  5FPD A;  3GDQ A;  1T6D A;  4IOC L;  4HTL A;  2FSN A;  3O08 A;  3G71 N;  3JS6 A;  5KPT A;  3KHY A;  3TSP A;  2YHY A;  2OTJ N;  2GEL A;  4BR2 A;  5C15 A;  4UY8 O;  1SQK A;  2F7T A;  4XEI A;  1DGK N;  3D2F B;  3W3D A;  4CZH A;  3CCS N;  3MCP A;  3OHR A;  4JKG B;  4BR0 A;  5M1O A;  1ILY A;  4FWQ A;  1S3X A;  4PL7 A;  5DM7 L;  4IZ9 A;  1QQN A;  5JIC A;  1K9M O;  3D7E O;  4XJX A;  3CXC M;  3AGK A;  2Q97 A;  3CHW A;  4H0T B;  1Q82 O;  4JNE A;  2WBN A;  2CGJ A;  4YDU A;  5AQJ A;  4B1Z A;  3CJ1 A;  5MLC Q;  1ZC6 A;  4XH5 A;  3U9D A;  1HLU A;  3D2F A;  4BRG A;  2FF3 B;  1HKC A;  3VF6 A;  1V4S A;  4JKG A;  4BR4 A;  5I9E B;  4BG8 A;  2IIR A;  1T6C A;  3EKU A;  3HI0 A;  4BRH A;  1T3V A;  1J6Z A;  1SZ2 A;  2NRV A;  5EXW A;  2Q0U A;  3MCA B;  3ZX3 A;  4AF1 A;  3FFK B;  4DCH A;  3FR0 A;  4QS9 A;  4XH4 A;  5AQR A;  3P39 A;  4CZM A;  4FWO A;  2FLO A;  2QTD A;  3CER A;  4IWV A;  2D1K A;  3NVM A;  3FZM A;  1NM1 A;  3CJA A;  4JKH A;  4JKE A;  4Z94 A;  1OVY A;  3F5T A;  3VEX A;  2HBJ A;  1TYQ B;  3PLA A;  4B1X B;  3AGR A;  3C7N B;  4GV6 A;  4DHY A;  5BRF A;  2Q1N A;  3UKR B;  1DEJ A;  1SS6 A;  3MWT A;  3I56 N;  3ENO A;  4YOX A;  2V52 B;  4E1J A;  5B8H A;  3K9K A;  2RE2 A;  3VTH A;  1SAZ A;  5AQQ A;  3EKS A;  4FSV A;  4OO1 J;  3AY9 A;  4XH1 A;  3TTD A;  4BRL A;  3GOI A;  4JKC A;  4AM6 A;  1VQ9 N;  3TSQ A;  3C0B A;  5FPE A;  1TYQ A;  3LDL A;  3U8X A;  4ISF A;  3C7N A;  3VPZ A;  3UB5 A;  3UKR A;  3CCL N;  1Q18 A;  3BUZ B;  2QWR A;  5AR0 A;  1XQS C;  3IMX A;  4M7X A;  4GVE A;  5CR4 A;  4FWR A;  3TPQ A;  3PIO L;  2WUS A;  5AZI B;  1JCE A;  2VWB A;  3O80 A;  3LDO A;  4BRO A;  2HOE A;  1QQO A;  2HBK A;  4BRP A;  3AAR A;  3ENB A;  4GV9 A;  1ATR A;  4WQ4 A;  4IEI A;  3SK3 A;  5CE3 A;  2ZJP L;  2QWP A;  3R9P A;  2IVO A;  4CJ7 A;  2H3G X;  2VYP A;  3FZK A;  5AQN A;  5JLF A;  3F9M A;  4CZL A;  4CZJ A;  3CCJ N;  3UKU B;  3JXU A;  4ILG B;  4PHT X;  2F9W A;  4BC4 A;  5KQD A;  2GTD A;  3E9O A;  4BQZ A;  1N8R O;  3ZX2 A;  3CMA N;  3A5L C;  4JK9 A;  5JVH L;  5AZI A;  3KVG A;  2P9I A;  2BH1 A;  2IVN A;  5KQ8 A;  4H5N A;  4IFE A;  2CH6 A;  2FXU A;  1YIJ N;  2C1I A;  3ZET B;  5H1S Q;  4HWI A;  1NGA A;  3BP8 A;  2AA4 A;  3M3Z A;  2E20 A;  3O4W A;  4NO7 A;  3SLC A;  5KPR A;  2PAV A;  5HOO A;  3WEE A;  2ZJR L;  4MLE A;  4LC9 B;  3UKU A;  3T7Z A;  3HZ6 A;  3OBY A;  4O5F A;  3LM9 A;  1HKB A;  1XUP O;  3CI5 A;  2E1Y A;  5GIN A;  3CF5 L;  1K8A O;  2P9P A;  3HOS A;  1Q81 O;  4H5T A;  2I7N A;  2KHO A;  2KLA A;  3QFU A;  3AAQ A;  1DT9 A;  3VGK A;  4BRI A;  3HOT A;  2V7Z A;  3CJB A;  3FLC O;  3ZET A;  4M63 C;  3DXK B;  4M7Y A;  3O9S A;  4JKB A;  5M1Q A;  3G6E N;  2D4W A;  3ID8 A;  2NLX A;  3H45 C;  1KXP A;  4OPH A;  1GLL O;  1XC3 A;  3O6W A;  5GAH P;  3OW2 M;  5BN8 A;  5M1K A;  1NGG A;  5C0Y A;  2E8A A;  2A3Z A;  2AP1 A;  5AQS A;  4GV3 A;  4R79 A;  2C1G A;  3D2E B;  4A57 A;  1ESV A;  4BR7 A;  3VEO A;  2NZT A;  1M90 O;  2P9N B;  4Y0W A;  3ID6 A;  5AQV A;  4KBO A;  4FPA A;  4WFB L;  4EAH D;  1OKJ A;  5ADX H;  3KWI A;  2QWN A;  3DXK A;  1YHQ N;  4CZI A;  4BE7 B;  1HJO A;  4MDB A;  4BRM A;  4BVO A;  4EHU A;  5C10 A;  2GEM A;  1YJ9 N;  5AQM A;  3OBW A;  4B1W B;  3SAH A;  3O9U A;  2UYT A;  4OPA A;  3C6H A;  4IO8 A;  3SMS A;  3FZF A;  3D2E A;  2ZGY A;  3MN7 A;  1E4G T;  1YF5 L;  1GLE G;  4C1N I;  2QEX N;  3H3O B;  2P9N A;  3D6R A;  1JCF A;  2P9K B;  3VOV A;  1H1V A;  1VQP N;  3CCU N;  1C0G A;  5BPN A;  2FF6 A;  5BRH A;  2D0P A;  2CGL A;  3L0Q A;  3EZW A;  1U2V A;  3ZX0 A;  1V4T A;  2V51 B;  3DAW A;  2W41 A;  5EOY A;  4CBX A;  5C2D A;  1GLF O;  1GLC G;  5AFU H;  1IG8 A;  3CJC A;  5C12 A;  3WXK A;  4YOW A;  2PFU A;  3HSC A;  3KK7 A;  2P9K A;  3N4P A;  1IJJ A;  4FO0 A;  4I6M B;  2ASO A;  2QXL A;  3FE1 A;  3DJC A;  2Q0R A;  2NRX A;  2E88 A;  4PKH A;  3L4I A;  4FWN A;  1ATS A;  1MA9 B;  3H1Q A;  1M1K O;  3WUH A;  3DWL A;  1BU6 O;  3GG4 A;  1GLB G;  2JWK A;  1P90 A;  3A0I X;  3R8E A;  1YI2 N;  5AQL A;  5BPM A;  4H5W A;  2J4R A;  2GWK A;  3R1X A;  1WOQ A;  3LDP A;  4PL8 A;  3O9Q A;  3FZH A;  3K9J A;  1HUX A;  1GLA G;  3N4Q A;  4GNI A;  4MDA A;  3LDN A;  5LJW A;  3VTI A;  1BWF O;  4BRE A;  5BRD A;  2I7P A;  4J8F A;  2DPN A;  4H0Y B;  1JJ2 M;  4WQ5 C;  1K8K B;  1RGI A;  3VEN A;  1YIT N;  3WQU A;  2GX9 A;  3QB0 A;  4FWK A;  3CD6 N;  2ZWH A;  4JN4 A;  5LJV A;  1HKG A;  4CZE A;  1MWK A;  4A59 A;  2GUP A;  4BRK A;  3MN9 A;  3HBT A;  4YOU A;  2P9S B;  3QFP A;  1LCU A;  4JAX A;  1VQ8 N;  5AQW A;  4IDH A;  4IOX A;  5AQI A;  4JKA A;  1ZXO A;  3O9T A;  3VEW A;  2QWO A;  3MX2 A;  1K8K A;  1Q7Y O;  3RSE B;  3WXI A;  3MDQ A;  2BTF A;  3A5M C;  2YI1 A;  4BC2 A;  4BRC A;  1YXQ A;  3P31 A;  3CCR N;  3VMF B;  4BC3 A;  1S22 A;  1U6Z A;  1NWK A;  5ADX A;  3O5B A;  1YAG A;  3CJ9 A;  3S41 A;  3DLL L;  3CC2 N;  1QQM A;  3FZL A;  5JMV A;  2P9S A;  3IKM A;  1GLD G;  4F9O A;  2F9T A;  3IFR A;  3ATU A;  3QBX A;  1NGB A;  5GIO A;  3VF4 A;  3LDQ A;  3RSE A;  4JHD B;  2QWM A;  4EFH A;  1NGC A;  4A2A A;  2QI2 A;  3A8Y A;  3NVK A;  4H0O A;  3WXL A;  2OTL N;  5FPM A;  3QIC A;  4YDU C;  3SAF A;  2WFB A;  4RWT A;  2YCH A;  2EWS A;  5AQX A;  1X9J A;  1KC8 O;  3M6G A;  4BRN A;  2ZJQ L;  1KAZ A;  1TUU A;  4B1V A;  1TUY A;  4IJN A;  4DQ8 A;  3AAP A;  2GWJ A;  3M1F A;  3VGL A;  3SAG A;  5AFU A;  3WXJ A;  4BEB A;  5M1P A;  1BA1 A;  2Q2R A;  1KD1 O;  3GBT A;  1X3N A;  3BF3 A;  4JHD A;  5TKY A;  3E66 A;  2E2Q A;  3CCV N;  4K25 A;  2VGM A;  4YOY A;  3PIP L;  3CQX A;  3O8M A;  4NLB A;  4BVP A;  4JK8 A;  3KZB A;  2HF3 A;  3VEZ A;  4WCE L;  1NGF A;  3CJ7 A;  5M1F A;  3H46 O;  2W40 A;  1YUW A;  5F2R A;  5FPN A;  2HST A;  5AQY A;  5F0X A;  4NLC A;  2P9U B;  3Q7B A;  4JEP A;  1T44 A;  1Q86 O;  4FWL A;  2E2P A;  2YHW A;  1BO5 O;  4H0P A;  1EQY A;  1Z05 A;  2NRR A;  2CGK A;  3R6M A;  4KH6 A;  5E26 A;  1NJI O;  3NMU A;  1HPM A;  3VEV A;  3CC7 N;  4BGB A;  1QHA A;  5BN9 A;  5EY4 A;  2ZGZ A;  4PKG A;  2NRT A;  1R59 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...