1NLVA

Crystal structure of dictyostelium discoideum actin complexed with ca atp and human gelsolin segment 1
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
372
structure length
364
Chain Sequence
DVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin
publication title The Structure of Non-Vertebrate Actin: Implications For The ATP Hydrolytic Mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 364
sequence length 372
ec nomenclature
pdb deposition date 2003-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nlvA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1nlvA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1nlvA03
3EZWA 2IVPA 4FWLA 3GDQA 3VESA 1R59O 4CD3A 5FPNA 3UKRA 3H6EA 3HTVA 2GUPA 1YAGA 3WUHA 2YHXA 1DKGD 1RGIA 4B1UB 4BC4A 2QWQA 3FZHA 2Q1NA 4IJAA 2YCHA 3L6QA 4FWKA 2QM1A 4H5TA 2HOEA 3UKRB 4XH5A 3VEOA 2E2OA 3IMXA 3J8AA 4CBUA 4K41A 2NLXA 4FL9A 4B1WB 3KVGA 4A62A 3TU5A 3ZX0A 1Z6RA 5AQPA 2IIRA 3D2EB 1JCGA 1Y64A 2GTDA 2YJFA 4BGAA 1LOTB 5BPMA 2Q0UA 1D4XA 1NGHA 1U2VA 3RSEA 1QQMA 2D0PA 4K43A 2W41A 5AQWA 4CZGA 3I8BA 3MN5A 1BG3A 2P9NA 3R9PA 3DXKA 3W0LA 5JLFA 3ATVA 1BA1A 1K8KB 4PKIA 3MCPA 3AAPA 4FWRA 4CI6A 1HJOA 3CJBA 2A3ZA 4BR9A 2V51B 3GOIA 4Z94A 2A6AA 2P9NB 1QQNA 5EX5A 3IFRA 4BC3A 4BRCA 2QXLA 3VGKA 4DQ8A 3LM9A 2E2QA 3UE5A 3DJCA 4B1ZA 4ISFA 5AQUA 3C0BA 3MK6A 3HZ6A 4EHTA 5B8HA 5JICA 1NBWA 4XH1A 1C0FA 2FF6A 3HM8A 4BG9A 4JD2B 4I6MA 1SQKA 3UKUA 5F2RA 5TKYA 2BTFA 2V7YA 1DEJA 5EOYA 1NGGA 1X3NA 3A5OC 3S41A 2NZTA 3UB5A 4B9QA 1IJJA 3BF1A 4H0OA 4BRMA 4FWNA 5E84A 2P9IB 1J6ZA 3CJCA 5AQTA 3H45C 3SLCA 3LM2A 3H46O 3QDKA 3O8MA 4BRLA 4BR2A 3L0QA 5BRHA 4AM6A 1BU6O 4B1XB 4WYBA 1P8ZA 3U8XA 3LDNA 5AFUA 4CZIA 4WQ4A 1SZ2A 4WQ5C 5AQJA 3VETA 3LDQA 3VGLA 1X3MA 2AA4A 2UYTA 3VEWA 4BC2A 4DHYA 3FFKB 4O8KA 3VF2A 3GL1A 2GELA 4RTFD 1WUAA 5ADXA 1NWKA 3FZFA 1ATSA 2W40A 3A0IX 3QICA 5F0XA 2E88A 2P9KB 1BA0A 3EKUA 5KPZA 4E1JA 2I7PA 3AARA 3H1VX 5BPNA 2V52B 3EN9A 2FXUA 4L3QA 4WQ4C 4BRFA 4CZHA 5AQGA 4CZJA 5BN9A 2QWOA 3ULEB 1GLFO 5AQHA 5EY4A 3CIPA 1C0GA 5AQOA 4BR0A 3CETA 4O5FA 1QZ5A 4BGBA 3ZX2A 4ISEA 4BRPA 3D2EA 1BWFO 3SJHA 4GNIA 5AQQA 5JMVA 4H0XB 5F1XA 3F9MA 5FPEA 4BR7A 2VCPA 3ZETB 5EVZA 3FZMA 4ISGA 4GY2B 3A5MC 5AFUH 1S3XA 1GLEG 4MLEA 4EFHA 3LDOA 3QFUA 3QBXA 3GG4A 2A40A 1NM1A 3CJ1A 4JNEA 4CJ7A 4EAHD 2YHWA 2ITMA 1K8KA 1WOQA 1KAXA 3QBWA 1ATRA 5CE3A 1S22A 5AQZA 4PKGA 4CD1A 4H0VB 2WUSA 4JAXA 3O6WA 2I7NA 2E8AA 5ADXH 1GLCG 4MLHA 4FWOA 5AQIA 2ASOA 3HI0A 4BC5A 1T6CA 5JLHA 4H5WA 3D2FA 4CZEA 3A5NC 3L4IA 1ZC6A 2ZGYA 3DXMB 3EL2A 3CI5A 4JD2A 3ID8A 4IWVA 3O08A 3ENOA 3D2FB 3M3ZA 2D0OA 4CZMA 3D7EO 1OKJA 5AQKA 1GLDG 2D4WA 4RCHA 5LJVA 4BRHA 1NGDA 4CBWA 5AQXA 2P9PB 2YHYA 4NO7A 1X9JA 2P9IA 2E1YA 3CJ9A 3GE1A 4BRDA 1XUPO 3MN6A 4BR5A 5AQYA 4Y0WA 2IVOA 3U9ZA 3H3NO 4FSVA 5AQSA 4BVPA 3BEXA 1ZBSA 3VF4A 2E2NA 4A2AA 3VENA 4CZKA 5BPLA 3TPQA 1V4SA 4K25A 1DGKN 4HWIA 4A2BA 1QHAA 3VEYA 3CERA 1HPMA 1QQOA 3LL3A 5KPTA 2Q2RA 1SAZA 1EQYA 5E26A 4KBOA 2ASMA 5FPDA 1MWKA 3ATUA 4JN4A 1HKCA 3C7NB 3WXJA 3WXIA 5LJWA 4FWSA 1NGJA 1YVNA 1NGBA 1QZ6A 4NB4A 1HX1A 3CJ7A 2F9WA 1TYQA 4FWQA 4C23A 4H0TB 4H5VA 2EWSA 4FWPA 2CGKA 3B8AX 2P9KA 1KAZA 2QWRA 2ZWHA 3ZEUA 3BF3A 1TYQB 3EKSA 4BRQA 3R8EA 3AY9A 1GLJO 1HLUA 2DPNA 2ZF5O 4MO5A 2AP1A 2QWMA 3AAQA 2Q97A 3ZX3A 3H3OB 3BUZB 3ZEUB 4QS7A 3ULEA 3VPZA 4RWTA 1H1VA 3VF6A 2VYPA 3VGMA 2QW9A 3QFPA 2E2PA 3MN9A 5KQDA 2FSNA 1G99A 4PL8A 1GLLO 4MO4A 4FOIA 4BG8A 3FZKA 4BQZA 3HSCA 3ZETA 2HF3A 2FLOA 4FO0A 4JHDA 5AQMA 2CGJA 3WQTA 2E1ZA 1RFQA 1JCEA 5FPMA 2HMPA 2E20A 1T6DA 2P9LB 5BRDA 2J4RA 5BRFA 4BR4A 3WXLA 3WEEB 2CH6A 3MMVA 4JHDB 2GWJA 2FF3B 4M7XA 1E4FT 1NGCA 3O80A 3VOVA 1ZXOA 1V4TA 2P9SB 4BREA 2VWBA 2H3GX 3VERA 5AZJA 3I33A 3FZLA 1T44A 3DAWA 3ENHA 3U9DA 1NGIA 2CH5A 4BROA 1NLVA 2D1KA 1LCUA 3CHWA 3O5BA 4QS9A 4FPBA 5AZJB 3JXUA 3DXMA 3LDPA 4CBXA 2IVNA 1ATNA 1BDGA 2QWPA 3CQYA 1JCFA 3MDQA 3VEVA 3OHRA 2Q31A 4BRKA 3CJAA 5KPRA 5I9EB 3DWLA 3SK3A 2KHOA 4CZLA 3FGUA 4H0YB 5AQFA 4EHUA 4PKHA 4F9OA 2HF4A 3WT0A 2P9PA 1MWMA 2QWNA 4FOEA 2PAVA 2YJEA 2GEMA 3O1BA 1IG8A 3WQUA 1MA9B 3KZBA 5AQLA 4CZFA 1U2VB 3RSEB 4K42A 4A61A 4DB3A 2F9TA 2QWLA 4M63C 1GLBG 4H03B 4H0PA 1BOTO 4LC9B 3VEZA 3LDLA 1NMDA 3DXKB 5AQRA 3GBTA 2A41A 1KXPA 5EXWA 2ASPA 4AM7A 4H5RA 5BREA 5AR0A 3IDHA 3FE1A 2FSKA 4YDUA 4BRAA 1HUXA 1BUPA 3QB0A 2YI1A 5AQNA 4B1YB 1Q18A 2Q0RA 3C7NA 4XEIA 4H5NA 3MN7A 1XC3A 2BUPA 4XH4A 3SMSA 1NGAA 4IO8A 1MDUB 3U4LA 5KQ8A 4B1VA 4WQ5A 1YUWA 2PBDA 4M7YA 2OANA 4HTLA 2CGLA 2FSJA 5AZIA 3O4WA 1CZAN 4I6MB 1YXQA 3UKUB 1RDWX 3O1WA 4PL7A 3P4IA 3IUCA 3A5LC 3FR0A 5AQVA 2A42A 4BRIA 3W3DA 4BRNA 5LY3A 4YDUC 5AZIB 4FPAA 1XQSC 2GWKA 2V7ZA 3M6GA 1GLAG 3SMPA 4BQLA 5BR9A 5ELZA 3R6MA 1E4GT 3CQXA 3VEXA 3FLCO 2ZGZA 4IXCA 4BRGA 1TUYA 5BN8A 3QMLA 1HKGA 2NRHA 3JS6A 1NGEA 2A5XA 4BVOA 2P9UA 4IZ9A 3A8YA 1ESVA 1HKBA 2P9LA 3KHYA 3HBTA 3WEEA 4DCHA 4QS8A 1TUUA 2P9UB 3BP8A 2Q36A 3WXKA 1NGFA 1U6ZA 1KAYA 2P9SA 4EIAA 4IJNA 3M1FA 3EO3A 3G25A 4FWMA 3H1QA 1BO5O 4J8FA 1Z05A
chains in the Genus database with same CATH superfamily
2WFBA 3NHGA 2HHIA 5HROA 1LWFA 3BY5A 3UKRA 2GUPA 1F21A 4GV3A 3WUHA 1DKGD 4B1UB 3PX0A 3RWUA 1EWRA 4ILJA 2W6KA 1S6QA 2QWQA 3HL8A 3L3VA 5C2FA 4IJAA 3SCXA 2HOEA 3QEXA 2E2OA 3J8AA 4DR1K 3C6TA 1K9MO 4FYDA 5I3UA 1ZBUA 4JEPA 3LAKA 4DTJA 3I0SA 1Z6RA 3AVIA 5AQPA 3WNFA 4F8RA 3D2EB 1Z26A 3P83D 4CJQA 4KHSA 1LOTB 3K59A 1NGHA 5TKWA 4K43A 5AQWA 4EP5A 2P9NA 3R9PA 3VQCA 4DS4A 3SI6A 3W0LA 4Y1CA 1NK7A 3ZSXA 1BA1A 1K8KB 3SPYA 4DSKA 3THWB 3NAEA 3PV8A 3CJBA 2XO7A 3LDSA 2DFFA 4DR3K 1D9FA 1HNIA 5M1OA 2XY8A 3VGKA 3O3HA 3CFRA 2E2QA 3DJCA 4B1ZA 4ISFA 4Z0UA 3I8DA 4M3WA 3CCRN 4YOYA 1NBWA 4JRPA 1C0FA 1VSDA 3RRHA 1SKRA 1YITN 4AHRA 4CJUA 5H1SQ 4M3YA 3HVTA 2OPPA 2XRIA 1BIZA 1TL1A 3V4IA 1EX4A 3SAFA 4CJTA 4BY9C 1SL1A 5EOYA 3RVCA 4TSXA 1X3NA 3A5OC 3CM5A 4DU4A 2NZTA 4GVMA 3BF1A 1X9MA 1IV0A 3QEVA 3PY8A 3CJCA 1NMNA 4FZZA 3LM2A 4IKFA 3QDKA 2OPSA 1O1WA 3KTQA 3DRRA 1I94K 4B1XB 4JK9A 5GIOA 1FW6A 5AFUA 4KTWA 2O8FB 4E89A 2IC3A 3E9PA 3VETA 4GKJK 3P38A 3LDQA 3OYGA 2ZJRL 1QTMA 3HPHA 4WE1A 1TV6A 3Q7CA 4ZTFA 4NXNK 2O8BA 5IT9O 3VF2A 1FKPA 4CJKA 5JVGL 1WUAA 4OKEA 1D9DA 4FJ8A 2IGIA 3FZFA 3L2VA 2G8UA 4JI2K 3L3UA 2E88A 5C42A 3ENBA 2WC9A 3EKUA 4A5BA 4DFMA 3O4QA 4JKAA 4A5AA 4KREA 2I7PA 3AVKA 3OS0A 4BRFA 5BN9A 5EY4A 5AQHA 2F96A 3MECA 4OGCA 4IEEA 3CETA 4O5FA 4BGBA 3ZX2A 4DTSA 3THYA 4Z4GA 1S1TA 4BRPA 1JLQA 4BDZA 3FZMA 4CGDA 4GY2B 4E3SA 2FBYA 5AFUH 1S3XA 2PFUA 3QFUA 3QBXA 3GG4A 1NM1A 4JNEA 5J2PA 4FK4A 4E1NA 3ZSVA 4CD1A 1VSMA 4H0VB 4FLXA 1GLCG 4MLHA 2FBTA 3CPWM 4I7FA 3TTFA 1TKTA 4GV9A 3AVLA 4JI3K 2O8EB 3ZSRA 1DTTA 3A5NC 1KFDA 5FDLA 1ZC6A 4BE1A 4BECA 4JD2A 3K2PA 4IWVA 1NKCA 4WFAL 1UWBA 2HBLA 3M3ZA 4LFAK 5AQKA 2NRVA 1NGDA 2YHYA 2YKNA 3CCQN 1X9JA 2P9IA 3CPEA 1JLAA 3AVNA 4BR5A 5AQYA 1N36K 1BCMA 1YJ9N 3B6OA 3U9ZA 2ETJA 3CD6N 1RT6A 3HM9A 1JJ2M 4CZKA 4DV2K 4FK2A 4BE7B 2VGMA 1L3UA 3TI0A 1DGKN 4HWIA 4JKDA 3CERA 4DTPA 1VSEA 2Q2RA 1SAZA 3AO3A 1EQYA 3NVKA 3NGYA 4DU1A 1HKCA 4CGFA 4LF8K 2HBMA 4NB4A 1YVNA 1NGBA 1LW0A 4CEQA 1TYQA 4O4GA 3U3GA 1NOYA 4M41A 4JI7K 3E9OA 1ASVA 2QWRA 1C0UA 3VQAA 2HNDA 1KQSM 4FK0A 3R8EA 2DPNA 3MXIA 2ZF5O 4KO0A 2PY5A 1TAUA 3AAQA 3ZX3A 1JLGA 4C1NI 4QS7A 4JS4A 3VF6A 2VYPA 1IKYA 3BZKA 3G0ZA 4JK7A 2E2PA 4EZ6A 1QS4A 2PZSA 2FLOA 1M1KO 2JGUA 3M8SA 2CGJA 2HMIA 1JCEA 4DV7K 2HMPA 3KK7A 4DV3K 2UXCK 5BRDA 2J4RA 3A2FA 4C8MA 4DR5K 3MEEA 3MMVA 2GWJA 2FF3B 1ASUA 3VOVA 1ZXOA 4BREA 4KAZA 3OYIA 3I33A 3NE6A 3U9DA 3OYNA 1UOCA 1L3TA 2NRRA 1L3SA 1SS6A 3O5BA 4IG3A 3R1XA 4QS9A 4FPBA 1T8EA 3OYKA 2IDOA 1ATNA 3CCSN 3RMCA 4FJLA 3B6PA 4FM2A 3S5TA 1VQ4N 3MCAB 2Z1JA 1VSHA 4EHUA 3F2KA 4PKHA 3KD1E 3U3YA 4OLBA 2BH1A 1IG8A 4JKBA 3KK3A 4K42A 4A61A 3HO1A 1GLBG 1O13A 4N76A 3HP9A 3DXKB 5AQRA 4N56A 1KXPA 4LY7A 3LP3A 3E1YA 4H5RA 1VSFA 1BUPA 3E9LA 3QIOA 3HRGA 1OVQA 3VA3A 2HHUA 1VQPN 3C7NA 5GAGP 4CEOA 3HT3A 4J2DA 1KLMA 1LW2A 1XC3A 3MEDA 3ID6A 4FLTA 4B9UA 3RMDA 3U4LA 2VGNA 1MDUB 5KQ8A 4CJ4A 4H4MA 1EETA 3OW2M 2PBDA 1REVA 4CERA 4M7YA 3VN5A 4K0KK 1UAXA 2O8DB 1U45A 3O4WA 3QEWA 3UKUB 3K5NA 1RDWX 3QERA 1VQ7N 4KI4A 4C8NA 3A5LC 1FKOA 3FR0A 2A42A 1SKWA 3ZT0A 5LY3A 1ZBLA 4HTUA 1WB9A 1XQSC 2A1RA 4LSNA 5LMUK 2ZE2A 3CQXA 3VEXA 3FLCO 2G8WA 1HKGA 3M8QA 3O9UA 5M1KA 3JS6A 1NGEA 1NOZA 3AVGA 3KKRA 4DV6K 2JLEA 4IZ9A 2HHWA 3OYJA 1HKBA 4N5SA 2QEXN 2R7YA 3HBTA 3WEEA 4DQPA 3DLRA 1TUUA 5FRNA 1TKDA 4EIAA 3CCVN 1W0HA 3M1FA 2ZJPL 2HVIA 1TGOA 4FWMA 1BO5O 1QQCA 4B9MA 1VQMN 2ITGA 3EZWA 5LMNK 3GDQA 1K6YA 3TAGA 3NH0A 3HP6A 3H6EA 3PIOL 3V81A 1XMQK 1GOAA 2E6MA 2WONA 4CHQA 5KRSA 2YNHA 2AJQA 2ZD1A 2X6NA 4Z4FA 2QM1A 1LWEA 2VG7A 3QNOA 3IMXA 4CFDA 4CBUA 2E4LA 1VQ9N 2E5LK 4L8RB 3ZX0A 3MXMA 4FJNA 1EXQA 2IIRA 4RG8A 4FM1A 2GTDA 5BR8K 1BIUA 2Q0UA 4DLGA 4RW7A 1U2VA 4F2RA 1QQMA 3EEQA 2W41A 4LD0A 3MN5A 1BG3A 5JLFA 1KSPA 3DOLA 3BDPA 1VRUA 1RT3A 3VTIA 3AAPA 1HJOA 4Z94A 4H4OA 2A6AA 4C8KA 1QQNA 4CEDA 4BC3A 5HRNA 4BRCA 2QXLA 4E7JA 4DUYK 5JS2A 1Z25A 4BE0A 1A5WA 1WSGA 3T1YK 4PQUA 4NXMK 3LM9A 3UE5A 1RCHA 4AH9A 2ZM6K 4GVEA 5AQUA 1XNQK 1LWCA 3C0BA 1L5UA 2OCEA 4XH1A 5HRRA 2FBXA 4BG9A 1OH7A 5F2RA 2A1SA 5TKYA 3OYDA 2YNGA 2DY4A 3AA4A 5MLCQ 2V7YA 4IEIA 3HPGA 4CGGA 4CEBA 3UB5A 3NH1A 3WNGA 3TAFA 4BRMA 3TWHA 2BE2A 5AQTA 1RBTA 3AVJA 4O44A 3NF9A 5C24A 1IG9A 3NCIA 1TK5A 3L0QA 3ISNC 1S9EA 4E1MA 4KHUA 4AM6A 3AVHA 4CGJA 3U8XA 1B9DA 3H08A 5KRTA 3SUQA 1ZBHA 4WQ5C 5AQJA 2HNZA 1BI4A 1X3MA 4M3XA 2Z1HA 2UYTA 3VEWA 3NFAA 4B8AB 4DHYA 4B3TK 4IOAL 3VQPA 3I0RA 4EP4A 1JLFA 4RTFD 3MX5A 1VQLN 4JS5A 1BCOA 2KW4A 4N47A 1NWKA 5ADXA 1RT1A 1YVUA 3VQBA 1ATSA 4DQIA 3VQ4A 3DRSA 5F0XA 2P9KB 1BHLA 4ICLA 1BQNA 1RBUA 5FLXO 4JI8K 3AO5A 3H1VX 4L3QA 4CZHA 1Q7YO 4PY5A 5AQGA 2OTJN 3ULEB 4DSLA 3CIPA 1C0GA 3OYEA 3KIOA 1QVFM 4JI4K 3SJHA 4GNIA 5AQQA 4QCLA 5FPEA 5F1XA 5KGXA 3ZETB 1NJWA 4FJGA 1JKHA 4CVNE 4I9LA 4O8UA 1VSKA 2ITMA 3HJFA 4RW6A 2IOCA 4B9LA 1KAXA 3C6AA 1SL0A 3L4QA 1KTQA 1S22A 2O8EA 3KWIA 5E41A 5J2QA 3MAQA 4O0IA 4I2PA 5ADXH 3NMUA 3VQDA 4QOZB 4FWOA 4CHZA 1RDBA 4BC5A 1JXBA 1YHQN 4BWJA 2FC0A 4CHNA 4CJPA 1NJIO 3ASMA 4UY8O 3CFPA 2ZGYA 4OPHA 2KFZA 3EL2A 3CI5A 4HUGA 5I42A 4B3OA 3D2FB 4OX9K 1IKXA 4W5TA 4FJJA 2YHBA 1OKJA 5LJVA 2P9PB 4CK1A 4NO7A 3S3MA 4JK8A 3SUPA 5SZTA 3GE1A 3J80O 2OTLN 1XUPO 2BANA 3MN6A 3KLGA 4OGEA 4KHPK 1IKWA 4RW9A 5AQSA 4FJXA 3BEXA 5DMRA 1RBSA 3VENA 4HCBA 4A2BA 4WFNL 3VQ7A 3MX2A 3C95A 4CFCA 3VEYA 1HPMA 3LL3A 5KPTA 4IG0A 3SAHA 3TABA 4E7LA 3ATUA 4XIUA 3V1RA 3WXJA 5LJWA 4FWSA 3NDKA 2DTUA 2RPIA 3IRXA 2F4VK 5K14A 1HRHA 2F9WA 2C1IA 5GAEP 5HOOA 4B9SA 4FWPA 1S1WA 4YOTA 2IAJA 5DM6L 1TVRA 4V19S 2G8KA 3SBTA 1QHTA 3OYLA 4FLYA 3QETA 3EYZA 5EU7A 1CLQA 1GLJO 4DR6K 2YV0X 2GX9A 4MO5A 2AP1A 3U6FA 3CCEN 2Q97A 3LPTA 3AVBA 4GKKK 3ZEUB 1B9FA 2XY7A 2QW9A 3QFPA 4GW6A 2FSNA 1QSLA 2PYLA 1Q86O 3PUFA 1WNSA 5FRMA 3PSFA 3MXJA 4MO4A 3RMBA 4DFJA 2EHGA 4BG8A 4LH4A 1HYSA 4LH5A 4ZTJA 4HHTA 1K73O 4FLWA 1VQKN 1T6DA 2P9LB 4Z4EA 3DLKA 3T3FA 4JHDB 1NJXA 3RMAA 3O80A 4LF6K 2P9SB 3QEIA 3EZ5A 1WBDA 3JYTA 4BWMA 3CCMN 3THXB 2P5GA 2C1GA 5GAHP 3DAWA 3ENHA 3ZSWA 3V6DA 3IAYA 1RDUA 1C6VA 4B9VA 2D1KA 4JKGB 1LCUA 3CHWA 2D5RA 1N33K 4MDBA 4DG1A 3JXUA 3ALYA 3DXMA 3LDPA 1TL3A 3CQYA 3J81O 4CECA 3MDQA 1B92A 3OHRA 3CJAA 5KGWA 3EE8A 5I9EB 1N8RO 2F8SA 4DFKA 1T3VA 4CZLA 2KHOA 2F8TA 4F9OA 1NG9A 2HF4A 3WT0A 4AILC 1XHZA 2YJEA 3O1BA 3ZT1A 5CZ1A 3WQUA 3PX6A 3L2WA 1S1XA 2UUBK 1MA9B 2OYQA 4CZFA 3SQ0A 3NF8A 2F9TA 3T1HK 1BOTO 3CCJN 1BGXT 3LDLA 1NMDA 5GIPA 1S9GA 5EXWA 2ASPA 4RW4A 3ZYYX 1NK4A 3LALA 3CYGA 4BDYA 2FSKA 4BRAA 4NCBA 3PSIA 1HUXA 3C6UA 3QB0A 3TSQA 3IS9A 3MN7A 3LPUA 2X6SA 2BUPA 4XH4A 3SMSA 4PWDA 4IO8A 1OVYA 1HNWK 3OY9A 5CR4A 2CGLA 4KB0A 1TKZA 1CZAN 1YXQA 4DTOA 1KVCA 4BEBA 3P4IA 3IUCA 3W3DA 2QTDA 1S1UA 4X64K 4FPAA 2VQFK 3M6GA 4KV8A 5BR9A 1EKEA 3ZT2A 1E4GT 2GBZA 3HPOA 4DLEA 4IXCA 1TUYA 1SUQA 3TTCA 4FZYA 2G8FA 3V1QA 3ZLJA 1W97L 4BVOA 4WFBL 3V9UA 1RDAA 4B3SK 3BZCA 2EX3A 4Q0BA 4A57A 2BDPA 3M8RA 1TK8A 4QS8A 1Q8IA 2YX6A 2WOMA 1NGFA 1U6ZA 3AGKA 1KAYA 3O4NA 1HQUA 3WXKA 4IJNA 3K5OA 3P31A 4CIFA 3G71N 3G25A 2O8BB 3H1QA 2D0AA 1Z05A 4AHCA 3TR8A 3V9XA 4M42A 2KQ2A 4CD3A 1RBVA 3DLBA 3DI6A 4ILHA 5FROA 2QKKA 3KK1A 3VQ8A 3VQ5A 2Q1NA 4NLBA 2YCHA 4JI6K 4FWKA 1OH5A 3OS1A 4H5TA 2UUCK 3VEOA 3DOKA 4OPAA 2NLXA 4BDPA 4B1WB 4OKJA 3KVGA 4K8ZA 4OPJA 3TU5A 1XHXA 3THYB 1RDCA 1U47A 4CJRA 3WXMB 1Y64A 5C25A 5BPMA 2Y1IA 1IH7A 1D4XA 3AVFA 3Q7BA 3RSEA 4CIGA 3M5RA 2HSTA 2B5JA 1GOCA 4EZ9A 5KTQA 3LZIA 4AHSA 3SQ1A 4PKIA 4FWRA 4DR7K 4BR9A 2V51B 4NYFA 3IFRA 3G6EN 2ZQBA 5KI6A 2HHXA 1RTJA 4PA1A 3SAGA 3QNNA 3LZJA 3HZ6A 4EHTA 5DK5A 1YIJN 3HM8A 4JD2B 4I6MA 4F2SA 3PIPL 4Z4IA 4CEEA 5M1FA 4BE2A 3EE9A 3O9RA 1KCFA 3S41A 3P39A 4B9QA 3ZT4A 4HUEA 5E84A 4BACA 3PO5A 4ID1A 2P9IB 5J2MA 4JKHA 1XMOK 4PUOA 2HW3A 3OTOK 2HHSA 2G8IA 3SLCA 4BRLA 4BR2A 4X65K 3NVMA 5BRHA 2HBJA 4WYBA 1P8ZA 3LDNA 1U48A 1WSFA 3CF5L 4F4KA 1WAJA 4CJ3A 3OYAA 4F3OA 2AA4A 3JAMO 4E19A 3O9TA 3CMAN 2GELA 3OYBA 3D45A 3KJVA 1HJRA 2W40A 3A0IX 4DV4K 2KFNA 3QICA 1XI1A 4CJLA 4C8LA 2VG6A 4CJ5A 4CFBA 3ZSYA 4ID5A 4CE9A 4E1JA 5KPZA 4DQQA 4DUZK 5BPNA 4KHYA 1CZBA 4IOXA 2V52B 3EN9A 1KRPA 1Q9YA 1CXUA 4CF0A 4CZJA 1GLFO 2YNIA 2YKMA 4BR0A 1HPZA 1QZ5A 4ISEA 5LL6Z 1ASWA 1Y97A 3D2EA 4B08A 3L8BA 4H0XB 3F9MA 4BR7A 2P51A 2VCPA 3S3OA 4FJMA 3ZSQA 3SBGA 2A40A 4CJ7A 1NU0A 4EAHD 2W6LA 2YHWA 1TAQA 3VQ9A 4KB1A 1K8KA 4DSEA 3THWA 1WOQA 2VWJA 4I9QA 4W5OA 5CE3A 1OH8A 4LF9K 5AQZA 3OJSA 4PKGA 2WUSA 4JAXA 3O6WA 4JYAK 1X1PA 2I7NA 2RN2A 1LAWA 2E8AA 1WSJA 3K58A 4M3UA 3HI0A 2ZJQL 3L2RA 4OKKA 3MWPA 5JLHA 3CFOA 5CHIA 4H5WA 3D2FA 4CFAA 3KLFA 3F9KA 4DQRA 4J2AA 3K0SA 2OZMA 2OA8A 3O08A 3KLIA 3ENOA 1Q81O 1KVAA 2VWKA 3TSUA 2D0OA 3R3LA 1GLDG 4RCHA 2PYJA 2P5OA 4BRHA 1X9WA 4CBWA 2VG5A 5AQXA 2W00A 3OJUA 2NRXA 3VQQA 3NGZA 1VSLA 4Y0WA 1U04A 3KKSA 2IVOA 3T1AA 4DV0K 3D6RA 3H3NO 2Q3SA 4FJ9A 1ZBSA 3LWLA 4A2AA 5BPLA 1LAVA 4K25A 3AO4A 1C1AA 1QHAA 2O8FA 1QQOA 1SKSA 3IG1A 3L2UA 3G4SN 5E26A 4KBOA 5A2QO 5FPDA 1IBKK 4JN4A 3QESA 3C7NB 3WXIA 2GUIA 1NGJA 3AGRA 3DLEA 3TAQA 1EP4A 4CJEA 4KRFA 3CJ7A 4FJKA 5J1EA 1VQ5N 4CGHA 5M1PA 4H0TB 4HVJA 2EWSA 3LP0A 3B8AX 1VRTA 5DM7L 2O8CB 3DM2A 2ZWHA 3ZEUA 3VA0A 1UA1A 4CW7B 1C0TA 4NCGA 2Y1JA 3MWTA 1HMVA 2QWMA 3H3OB 4RWTA 1H1VA 3VGMA 4H8KA 3T69A 2YNFA 3O3FA 5CYQA 5KQDA 3SJJA 4FJ7A 1GLLO 1KFSA 4JI0K 1RT4A 1T03A 1KC8O 3J7ZO 4C8OA 1ILYA 1KD1O 4BQZA 3HSCA 3UIQA 2HF3A 2RHKA 4JHDA 3CCUN 5GADP 3DYAA 3OYMA 3QO9A 1RFQA 5FPMA 1IBLK 2E20A 2X78A 5BRFA 1DTQA 4BR4A 4M3RA 4DKWA 3TSPA 3WEEB 2CH6A 4FM0A 3KLEA 4FZXC 3PX4A 1D8YA 3AVAA 1E3MA 4JKGA 1V4TA 1FK9A 2VWBA 3VERA 4WCEL 4FLVA 2RF2A 2IS3A 3FZLA 1T44A 4KTQA 1RBRA 1NGIA 4YFUA 4W5RA 2CH5A 4BROA 1YJWN 1NLVA 5D3GA 5AZJB 4FJHA 4DMNA 1NK9A 3HVRA 4CEZA 2IVNA 2QWPA 3TAMA 3SV3A 4KHNA 4LFBK 1JCFA 3LAMA 3M8PA 3VEVA 2Q31A 3K57A 3DWLA 3HSTB 4Y1DA 3SK3A 2HNYA 3FGUA 4B8CA 5AQFA 4CJWA 5CZ2A 4MFBA 2OPQA 4ELVA 1RTIA 4C1NK 3SUOA 2QI2A 2PAVA 4B9TA 2GEMA 3I56N 4CJSA 3ZSOA 3KZBA 1U2VB 4M63C 4H0PA 3VEZA 2HHVA 3GBTA 1JXEA 3SPZA 4M3TA 2A41A 4AM7A 3LP1A 3J7AP 5BREA 3O3GA 4G1QA 3PO4A 4MDAA 4YDUA 1YJNN 3HOSA 2YI1A 5AQNA 4B1YB 4DSJA 1KVBA 1Q18A 1VQ8N 4CJVA 2O4GA 4H5NA 2BGGA 1VAZA 4FLZA 1ZYQA 1N6QA 5IWAK 1YT3A 4DV5K 1NGAA 4Z4CA 4FW1A 4KHWA 4DTUA 2NUBA 2OANA 3NBPA 2FSJA 1I39A 3O1WA 4CJFA 4PL7A 2JWKA 5AQVA 4BRIA 4DSIA 4IDKA 4BRNA 3RTVA 3TANA 4YDUC 4CK2A 5AZIB 2GWKA 5AJ3K 3L2QA 3K5MA 4O5BA 1RT7A 3SMPA 4BQLA 5ELZA 1G15A 4CHOA 1N32K 4KKOA 5M1NA 3R6MA 2ZGZA 5C2DA 4PHTX 3CMEN 4BRGA 3AVCA 2G8VA 1NK8A 3E66A 2NRHA 1U49A 1ESVA 2Z1IA 1VHXA 4YOVA 2QA4N 3SYZA 3OA9A 4DTNA 4AHVA 3AA2A 2HHTA 3BGRA 4DCHA 1QVGM 5HRPA 3QIPA 1KLNA 2P9UB 1BI4B 3BP8A 3CYMA 2Q36A 3LWMA 1CZ9A 3FFIA 3TAEA 1LV5A 5C10A 4J8FA 4FVMA 2XHBA 1JLCA 1EWQA 5M1QA 2IVPA 3DLGA 4FWLA 1ZBFA 3VESA 3D0PA 1R59O 3C6HA 5FPNA 4CF2A 4MQ3A 5CY4A 3HTVA 3AA3A 1YAGA 1WLJA 3T7ZA 2YHXA 1RGIA 3AO1A 4G9ZA 2RKIA 4BC4A 2OZSA 5SWMA 3OYCA 3FZHA 1IO2A 4YNQA 1W2BM 3L6QA 4U7BA 4E7KA 3UKRB 1W7AA 3KD5E 2Z1GA 4XH5A 4K41A 3K9KA 4LSLA 4IFVA 4FL9A 2D0BA 1RDDA 4X62K 1WAFA 3CM6A 5CYMA 4A62A 1WBBA 2XY6A 1XC9A 3N4PA 1JCGA 1HYZA 3IKMA 3SUNA 3AA5X 4LF7K 2YJFA 4BGAA 2WBNA 4E72A 4AF1A 2D0PA 3CC2N 4CZGA 1HYVA 3I8BA 3DXKA 3KWGA 4CCHA 3V9ZA 3P1GA 3ATVA 4U67L 3MCPA 4UQGA 4CEFA 3C94A 4CI6A 1M90O 2A3ZA 3ITHA 3AO2A 3GOIA 3K5LA 3CC7N 1HQEA 2P9NB 1X9SA 4LF5K 2P1JA 5EX5A 3NGIA 4KH4A 4CESA 2HBKA 2WTUA 4DQ8A 3P5JA 4YY3K 1RTHA 4FCYA 2UUAK 2E6LA 4O0JA 4KH6A 3MK6A 5B8HA 5JICA 2FF6A 5HBMA 4WF9L 5J2NA 1C1BA 4DR2K 2O8DA 3CXCM 3V9SA 4W5NA 1SQKA 3UKUA 4DTMA 2BTFA 1QE1A 1DEJA 1NGGA 1IJJA 4H0OA 2FBVA 4FWNA 4CGIA 1J6ZA 1ITGA 1VK0A 1YTAA 2B4JA 3H45C 2KLAA 4KFBA 1U4BA 3H46O 3O8MA 4J2EA 3NF7A 5C0YA 1NJYA 4IFYA 1BU6O 4DV1K 4OJRA 2DFHA 4CZIA 4WQ4A 1A5VA 1SZ2A 1FJGK 5HP1A 2ATQA 3SQ4A 3DRPA 3E01A 4ILGB 1WSHA 3VGLA 1TK0A 2KTQA 4BC2A 3FFKB 3K9JA 4O8KA 4JV5K 3GL1A 1NKBA 2UU9K 2F7TA 1SL2A 4NYNA 4YOXA 1RILA 4JKCA 1BL3A 1BA0A 4GMJB 3AARA 4CEAA 1P90A 5HRSA 1J9AA 2FXUA 4WQ4C 3HXMA 1J5OA 1YTUA 2QWOA 1WN7A 3MEGA 5AQOA 3F73A 2D0CA 3AV9A 3LANA 3KLHA 4JRQA 1BWFO 1S6PA 4IDHA 5JMVA 4IO9L 5EVZA 4AHUA 4AHTA 4CF8A 4ISGA 1N34K 1HR0K 3A5MC 1GLEG 4MLEA 4EFHA 3LDOA 1XNRK 4YOWA 3CJ1A 2JWLA 2UXBK 1DLOA 2QXFA 1S5JA 4B3RK 3NF6A 4QAGA 1JL1A 3QBWA 1ATRA 3PLAA 3S3NA 3NH2A 2DFEA 5JENA 1T7PA 4DTXA 4B3MK 5AQIA 2ASOA 3DMJA 3TAPA 1T6CA 3JSMA 4DSFA 1IKVA 4CZEA 3T19A 3L4IA 3DXMB 4KHQA 4JLHA 1TKXA 3RR7A 3ID8A 3OBYA 2NRWA 3V9WA 4DWIA 1WSIA 1NK0A 1Q82O 2XY5A 4CZMA 3D7EO 4FXDA 2D4WA 1IBMK 1XWLA 3WNEA 4KH5A 3OS2A 2O4IA 2E1YA 1BISA 3CJ9A 4YOUA 3VTHA 3THVA 4BRDA 4R5PA 4CK3A 3SQ2A 4FSVA 4FW2A 4BVPA 1C0MA 3VF4A 2E2NA 1FXXA 3TPQA 1V4SA 5HL7L 2QK9A 3N4QA 4ELTA 3V1OA 2QKBA 4IOCL 1NNEA 4DF8A 3C65A 2ASMA 1MWKA 1I3AA 1L3VA 2O8CA 1QZ6A 1S1VA 1C1CA 1HX1A 3CC4N 4W5QA 3SZ2A 4FWQA 4C23A 3OYHA 1Q9XA 1RT5A 2KKZA 4H5VA 1NKEA 2CGKA 2RE2A 1S72N 3QLHA 4OPKA 2P9KA 4Z4HA 1KAZA 5C12A 4J2BA 3BF3A 1TYQB 3EKSA 1HNVA 4BRQA 4K8XA 3AY9A 2HVHA 1HLUA 4DS5A 1QSYA 4DF4A 4DR4K 1NJZA 4F3TA 2UXDK 3BUZB 3VPZA 3ULEA 4X66K 3OBWA 4NLCA 1HNXK 3MN9A 1G99A 4PL8A 4YHHK 2KZMA 3OVNA 4FOIA 2W42A 4ZHRA 3FZKA 2G8HA 1VQ6N 3ZETA 4FO0A 5AQMA 3WQTA 1JLBA 2E1ZA 4FVUA 3HK2A 3OYFA 4LFCK 2OPRA 4CHPA 4CHYA 3WXLA 1RTDA 4HUFA 3HOTA 4JI1K 4M7XA 1E4FT 1NGCA 1QSSA 3J7YP 1SV5A 2H3GX 5AZJA 1GOBA 3AVMA 3S9HA 5T7BA 4DFPA 2NRZA 2HHQA 2YHAA 4O55A 2KZZA 1VQON 1J5EK 4CBXA 3I55N 3ZSZA 3SV4A 1JLEA 1BDGA 4M45A 1UA0A 3SNNA 4BRKA 5KPRA 1R0AA 5HLFA 4CF1A 2B6AA 4H0YB 1BQMA 2HHHK 3DLLL 2P9PA 1MWMA 2QWNA 4FOEA 4OLAA 2LSNA 4E7HA 4IBNA 4LF4K 3VQ6A 4DU3A 1J54A 4I2QA 4JKFA 5AQLA 1HNZK 3RSEB 3O9QA 4DB3A 2QWLA 1CXQA 4H03B 3EY1A 4LC9B 1RNHA 4NCAA 1VQNN 4FLUA 3VQEA 4A59A 2X74A 2HB5A 1EO1A 4Q5VA 5GINA 4DQSA 1MU2A 4FJ5A 5AR0A 4KI6A 4AQYK 3ZT3A 3IDHA 3FE1A 3QEPA 2GV9A 2NRTA 2Q0RA 4XEIA 4E7IA 1RT2A 3RRGA 1T05A 1YF5L 3TTDA 2NNWA 4B1VA 4WQ5A 1YUWA 3F5TA 4ELUA 3CCLN 4HTLA 5AZIA 4IFEA 1W9HA 3DLHA 3ZCMA 4I6MB 1YI2N 1ZBIA 4HCCA 3ULDA 1D5AA 2I5JA 3G10A 1WSEA 3O9SA 5C15A 1VSJA 2V7ZA 1GLAG 4GV6A 4JI5K 3TARA 5JVHL 1JL2A 4M3ZA 4KPYA 3LP2A 5BN8A 4KTZA 3QMLA 1NK6A 1VSIA 3WNHA 5JS1A 2A5XA 3CQ8A 4DTRA 2P9UA 3RR8A 1A5XA 3A8YA 1DT9A 2P9LA 3CG7A 4XJXA 3HYFA 4CF9A 4N41A 4RW8A 3KHYA 4CIEA 4OVLA 1K8AO 3QINA 4OO1J 3KK2A 4E0DA 3VMFB 1N5YA 1NK5A 2VQEK 2P9SA 4R79A 4YORA 3EO3A 4JKEA 4FJIA 3THXA 1OH6A 1J53A 4B9NA
chains in the Genus database with same CATH topology
1VQMN 2WFBA 3EZWA 5M1QA 2IVPA 4FWLA 3GDQA 3VESA 1R59O 4CD3A 3C6HA 5FPNA 3UKRA 3H6EA 3PIOL 3HTVA 2GUPA 1YAGA 3T7ZA 4GV3A 3WUHA 2YHXA 1DKGD 1RGIA 4B1UB 4ILHA 4ILJA 4G9ZA 4BC4A 2QWQA 3FZHA 5C2FA 2Q1NA 4IJAA 2YCHA 4NLBA 1W2BM 3L6QA 4FWKA 2QM1A 4U7BA 4H5TA 2HOEA 3UKRB 3CC2N 4XH5A 3VEOA 4OPAA 2E2OA 3IMXA 3J8AA 4CBUA 4K41A 3K9KA 2NLXA 1K9MO 4FL9A 4B1WB 1VQ9N 3KVGA 4JEPA 4A62A 3TU5A 3ZX0A 1Z6RA 5AQPA 2IIRA 3N4PA 3WXMB 3D2EB 1JCGA 3IKMA 1Y64A 2GTDA 2YJFA 4BGAA 1LOTB 5BPMA 2Q0UA 1D4XA 2WBNA 1NGHA 1U2VA 3Q7BA 3RSEA 1QQMA 4AF1A 2D0PA 4K43A 2W41A 3M5RA 5AQWA 2HSTA 5TKWA 3I8BA 3MN5A 1BG3A 2P9NA 3R9PA 4CZGA 3DXKA 3KWGA 3W0LA 5JLFA 3ATVA 1BA1A 1K8KB 4PKIA 4U67L 3MCPA 3VTIA 3AAPA 4FWRA 1M90O 4CI6A 1HJOA 3CJBA 2A3ZA 4BR9A 2V51B 3GOIA 4Z94A 2A6AA 2P9NB 3CC7N 1QQNA 5EX5A 3IFRA 4BC3A 3G6EN 4KH4A 2HBKA 2QXLA 4BRCA 5M1OA 3VGKA 4DQ8A 3LM9A 2E2QA 3UE5A 3DJCA 4B1ZA 4GVEA 4ISFA 4KH6A 5AQUA 3SAGA 3C0BA 3CCRN 4YOYA 3MK6A 3HZ6A 4EHTA 5B8HA 5JICA 1NBWA 4XH1A 1C0FA 2FF6A 1YIJN 3HM8A 4WF9L 4BG9A 1YITN 5H1SQ 4JD2B 3CXCM 4I6MA 1SQKA 3UKUA 5F2RA 5TKYA 3PIPL 5M1FA 2BTFA 5MLCQ 3SAFA 2V7YA 3EE9A 1DEJA 4IEIA 4BY9C 5EOYA 3RVCA 3O9RA 1NGGA 1X3NA 3A5OC 3S41A 2NZTA 3P39A 3UB5A 4B9QA 1IJJA 3BF1A 4H0OA 4BRMA 4FWNA 5E84A 2P9IB 4JKHA 1J6ZA 3CJCA 5AQTA 3H45C 2KLAA 3SLCA 3LM2A 3H46O 3QDKA 3O8MA 4BRLA 4BR2A 3L0QA 5C0YA 3NVMA 5BRHA 4AM6A 1BU6O 2HBJA 4B1XB 4WYBA 1P8ZA 3U8XA 4JK9A 5GIOA 3LDNA 5AFUA 4CZIA 4WQ4A 1SZ2A 3CF5L 4WQ5C 3E9PA 5AQJA 3VETA 3P38A 3LDQA 2ZJRL 4ILGB 3VGLA 1X3MA 2AA4A 2UYTA 3VEWA 4BC2A 4DHYA 3FFKB 3K9JA 3Q7CA 4IOAL 4O8KA 3VF2A 3GL1A 3O9TA 3CMAN 2GELA 4RTFD 5JVGL 3MX5A 1WUAA 1VQLN 2F7TA 5ADXA 1NWKA 3FZFA 1ATSA 4YOXA 2W40A 3A0IX 3QICA 5F0XA 2E88A 2P9KB 3ENBA 2WC9A 4JKCA 1BA0A 3EKUA 4A5BA 4JKAA 4A5AA 5KPZA 4E1JA 2I7PA 3AARA 3H1VX 5BPNA 1P90A 4IOXA 2V52B 3EN9A 2FXUA 4L3QA 4WQ4C 4BRFA 4CZHA 1Q7YO 5AQGA 2OTJN 4CZJA 5BN9A 2QWOA 3ULEB 1GLFO 5AQHA 5EY4A 3CIPA 1C0GA 5AQOA 4IEEA 4BR0A 3CETA 4O5FA 1QZ5A 4BGBA 3ZX2A 4ISEA 1QVFM 4BRPA 3D2EA 1BWFO 3SJHA 4GNIA 5AQQA 4IDHA 5JMVA 4H0XB 5F1XA 3F9MA 5FPEA 4BR7A 2VCPA 4IO9L 3ZETB 5EVZA 3FZMA 4ISGA 4GY2B 3A5MC 5AFUH 1S3XA 2PFUA 1GLEG 4MLEA 3SBGA 3LDOA 4EFHA 3QFUA 3QBXA 4YOWA 3GG4A 2A40A 1NM1A 3CJ1A 4JNEA 4O8UA 4CJ7A 2JWLA 4EAHD 2YHWA 2ITMA 1K8KA 1WOQA 1KAXA 3C6AA 3QBWA 1ATRA 3L4QA 5CE3A 3PLAA 1S22A 5AQZA 4PKGA 4CD1A 3KWIA 4H0VB 2WUSA 4JAXA 3O6WA 2I7NA 2E8AA 5ADXH 3NMUA 1GLCG 4MLHA 4FWOA 3CPWM 5AQIA 2ASOA 3HI0A 3TTFA 4BC5A 1T6CA 2ZJQL 4GV9A 3MWPA 1YHQN 5JLHA 5CHIA 4H5WA 3D2FA 4CZEA 1NJIO 3A5NC 3L4IA 4UY8O 1ZC6A 2ZGYA 3DXMB 4OPHA 3EL2A 3CI5A 4BECA 4JD2A 3ID8A 3OBYA 2NRWA 4IWVA 3O08A 4WFAL 3ENOA 2HBLA 1Q81O 3D2FB 3M3ZA 1Q82O 3TSUA 2D0OA 4CZMA 3R3LA 3D7EO 1OKJA 5AQKA 1GLDG 2D4WA 4RCHA 5LJVA 2NRVA 4BRHA 1NGDA 4CBWA 5AQXA 2P9PB 2YHYA 4NO7A 4KH5A 3CCQN 4JK8A 1X9JA 2W00A 2P9IA 2E1YA 3VTHA 3CJ9A 4YOUA 2NRXA 3GE1A 3CPEA 4BRDA 1XUPO 3MN6A 2OTLN 4BR5A 5AQYA 4Y0WA 2IVOA 1YJ9N 3U9ZA 3D6RA 3H3NO 4FSVA 5AQSA 4BVPA 3BEXA 1ZBSA 3CD6N 3VF4A 2E2NA 4A2AA 1JJ2M 3VENA 4CZKA 5BPLA 4BE7B 2VGMA 3TPQA 1V4SA 4K25A 5HL7L 1DGKN 4HWIA 4A2BA 1QHAA 4WFNL 3N4QA 3MX2A 4JKDA 3VEYA 3CERA 4IOCL 1HPMA 1QQOA 3LL3A 5KPTA 2Q2RA 1SAZA 3SAHA 1EQYA 3G4SN 3NVKA 3C65A 5E26A 4KBOA 2ASMA 5FPDA 1MWKA 3ATUA 4JN4A 1HKCA 3C7NB 3WXJA 3WXIA 5LJWA 2HBMA 4FWSA 1NGJA 1YVNA 1NGBA 1QZ6A 3AGRA 4NB4A 1HX1A 3CJ7A 3CC4N 2F9WA 1TYQA 1VQ5N 2C1IA 5GAEP 4FWQA 5HOOA 4C23A 5M1PA 4H0TB 2KKZA 4H5VA 2EWSA 4FWPA 2CGKA 3B8AX 2RE2A 1S72N 3E9OA 5DM7L 2P9KA 1KAZA 2QWRA 4YOTA 5C12A 2ZWHA 3ZEUA 5DM6L 3BF3A 1TYQB 3EKSA 3SBTA 1KQSM 4BRQA 3R8EA 3AY9A 1GLJO 1HLUA 3MWTA 2DPNA 2ZF5O 2GX9A 4MO5A 2AP1A 2QWMA 3AAQA 3CCEN 2Q97A 3ZX3A 3H3OB 4C1NI 3BUZB 3ZEUB 4QS7A 3ULEA 3VPZA 4RWTA 1H1VA 3VF6A 2VYPA 3OBWA 3VGMA 2QW9A 3QFPA 4NLCA 3T69A 4JK7A 2E2PA 3MN9A 5KQDA 2FSNA 1G99A 4PL8A 1Q86O 1GLLO 4MO4A 4FOIA 1KC8O 3J7ZO 4BG8A 1ILYA 1KD1O 3FZKA 4BQZA 3HSCA 3ZETA 2HF3A 2FLOA 4FO0A 2RHKA 4JHDA 1M1KO 1VQ6N 3CCUN 5AQMA 5GADP 2CGJA 3WQTA 2E1ZA 1K73O 4FVUA 1RFQA 1JCEA 5FPMA 1VQKN 2HMPA 2E20A 1T6DA 2P9LB 3KK7A 5BRDA 2J4RA 5BRFA 4BR4A 4DKWA 3WXLA 3TSPA 3WEEB 2CH6A 3MMVA 4JHDB 3HOTA 2GWJA 2FF3B 4M7XA 1E4FT 1NGCA 3O80A 4JKGA 3VOVA 1ZXOA 1V4TA 2P9SB 4BREA 2VWBA 2H3GX 3VERA 4WCEL 5AZJA 3CCMN 2C1GA 3I33A 5GAHP 3FZLA 1T44A 3DAWA 3ENHA 3U9DA 2NRRA 1NGIA 1RDUA 2CH5A 4BROA 1YJWN 2NRZA 1NLVA 1SS6A 2D1KA 4JKGB 1LCUA 3CHWA 3O5BA 3R1XA 4MDBA 1VQON 4QS9A 4FPBA 5AZJB 3JXUA 3DXMA 3LDPA 4CBXA 3I55N 2IVNA 1ATNA 1BDGA 2QWPA 3CQYA 3CCSN 1JCFA 3MDQA 3VEVA 3OHRA 2Q31A 4BRKA 3CJAA 5KPRA 3EE8A 5I9EB 1N8RO 1VQ4N 1T3VA 3DWLA 3MCAB 3SK3A 2KHOA 4CZLA 3FGUA 4H0YB 5AQFA 4EHUA 3F2KA 4PKHA 4F9OA 3DLLL 2HF4A 3WT0A 2P9PA 1MWMA 2QWNA 4FOEA 4C1NK 2BH1A 2QI2A 2PAVA 2YJEA 2GEMA 3O1BA 1IG8A 3WQUA 3I56N 4JKBA 1MA9B 4JKFA 3KZBA 5AQLA 4CZFA 1U2VB 3RSEB 3O9QA 4K42A 4A61A 2F9TA 4DB3A 2QWLA 4M63C 1GLBG 1O13A 4H03B 4H0PA 1BOTO 4LC9B 3CCJN 3VEZA 3LDLA 1NMDA 3DXKB 5AQRA 5GIPA 1VQNN 3GBTA 4A59A 1EO1A 2A41A 1KXPA 5EXWA 5GINA 2ASPA 4AM7A 3E1YA 4H5RA 3ZYYX 5BREA 5AR0A 3IDHA 4MDAA 3FE1A 2FSKA 4YDUA 4BRAA 1YJNN 1HUXA 1BUPA 3E9LA 2YI1A 3QB0A 5AQNA 4B1YB 3HOSA 1Q18A 3HRGA 2NRTA 3TSQA 1VQ8N 2Q0RA 3C7NA 1VQPN 5GAGP 4XEIA 4H5NA 3MN7A 1VAZA 1XC3A 1YF5L 3ID6A 3TTDA 2BUPA 2NNWA 4XH4A 3SMSA 1NGAA 2VGNA 1MDUB 1OVYA 4IO8A 3U4LA 5KQ8A 4B1VA 4WQ5A 1YUWA 3OW2M 2PBDA 3F5TA 4M7YA 3CCLN 2OANA 4HTLA 2CGLA 2FSJA 4IFEA 5CR4A 5AZIA 3O4WA 1CZAN 4I6MB 1YXQA 3UKUB 1RDWX 1VQ7N 1YI2N 3O1WA 4PL7A 4BEBA 3P4IA 2JWKA 3A5LC 3FR0A 3IUCA 2A42A 5AQVA 4BRIA 3W3DA 3O9SA 2QTDA 4BRNA 5LY3A 5C15A 4YDUC 5AZIB 4FPAA 1XQSC 2GWKA 2V7ZA 3M6GA 1GLAG 3SMPA 4BQLA 4GV6A 5BR9A 5ELZA 5M1NA 3R6MA 1E4GT 5JVHL 3CQXA 3VEXA 3FLCO 2ZGZA 5C2DA 4PHTX 4IXCA 4BRGA 1TUYA 5BN8A 3CMEN 3TTCA 3QMLA 1HKGA 3E66A 3O9UA 5M1KA 2NRHA 3JS6A 1W97L 1NGEA 2A5XA 4BVOA 2P9UA 4IZ9A 4WFBL 3A8YA 1DT9A 1ESVA 1HKBA 2P9LA 4XJXA 4YOVA 2QA4N 3OA9A 2QEXN 4A57A 3KHYA 3HBTA 3WEEA 1K8AO 4DCHA 4QS8A 1QVGM 4OO1J 1TUUA 3VMFB 2P9UB 3BP8A 2YX6A 2Q36A 3WXKA 1NGFA 1U6ZA 3AGKA 1KAYA 2P9SA 4EIAA 4IJNA 3P31A 4R79A 3G71N 3M1FA 3EO3A 4YORA 2ZJPL 4JKEA 3CCVN 3G25A 4FWMA 3H1QA 5C10A 1BO5O 4J8FA 1Z05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EZW A;  2IVP A;  4FWL A;  3GDQ A;  3VES A;  1R59 O;  4CD3 A;  5FPN A;  3UKR A;  3H6E A;  3HTV A;  2GUP A;  1YAG A;  3WUH A;  2YHX A;  1DKG D;  1RGI A;  4B1U B;  4BC4 A;  2QWQ A;  3FZH A;  2Q1N A;  4IJA A;  2YCH A;  3L6Q A;  4FWK A;  2QM1 A;  4H5T A;  2HOE A;  3UKR B;  4XH5 A;  3VEO A;  2E2O A;  3IMX A;  3J8A A;  4CBU A;  4K41 A;  2NLX A;  4FL9 A;  4B1W B;  3KVG A;  4A62 A;  3TU5 A;  3ZX0 A;  1Z6R A;  5AQP A;  2IIR A;  3D2E B;  1JCG A;  1Y64 A;  2GTD A;  2YJF A;  4BGA A;  1LOT B;  5BPM A;  2Q0U A;  1D4X A;  1NGH A;  1U2V A;  3RSE A;  1QQM A;  2D0P A;  4K43 A;  2W41 A;  5AQW A;  4CZG A;  3I8B A;  3MN5 A;  1BG3 A;  2P9N A;  3R9P A;  3DXK A;  3W0L A;  5JLF A;  3ATV A;  1BA1 A;  1K8K B;  4PKI A;  3MCP A;  3AAP A;  4FWR A;  4CI6 A;  1HJO A;  3CJB A;  2A3Z A;  4BR9 A;  2V51 B;  3GOI A;  4Z94 A;  2A6A A;  2P9N B;  1QQN A;  5EX5 A;  3IFR A;  4BC3 A;  4BRC A;  2QXL A;  3VGK A;  4DQ8 A;  3LM9 A;  2E2Q A;  3UE5 A;  3DJC A;  4B1Z A;  4ISF A;  5AQU A;  3C0B A;  3MK6 A;  3HZ6 A;  4EHT A;  5B8H A;  5JIC A;  1NBW A;  4XH1 A;  1C0F A;  2FF6 A;  3HM8 A;  4BG9 A;  4JD2 B;  4I6M A;  1SQK A;  3UKU A;  5F2R A;  5TKY A;  2BTF A;  2V7Y A;  1DEJ A;  5EOY A;  1NGG A;  1X3N A;  3A5O C;  3S41 A;  2NZT A;  3UB5 A;  4B9Q A;  1IJJ A;  3BF1 A;  4H0O A;  4BRM A;  4FWN A;  5E84 A;  2P9I B;  1J6Z A;  3CJC A;  5AQT A;  3H45 C;  3SLC A;  3LM2 A;  3H46 O;  3QDK A;  3O8M A;  4BRL A;  4BR2 A;  3L0Q A;  5BRH A;  4AM6 A;  1BU6 O;  4B1X B;  4WYB A;  1P8Z A;  3U8X A;  3LDN A;  5AFU A;  4CZI A;  4WQ4 A;  1SZ2 A;  4WQ5 C;  5AQJ A;  3VET A;  3LDQ A;  3VGL A;  1X3M A;  2AA4 A;  2UYT A;  3VEW A;  4BC2 A;  4DHY A;  3FFK B;  4O8K A;  3VF2 A;  3GL1 A;  2GEL A;  4RTF D;  1WUA A;  5ADX A;  1NWK A;  3FZF A;  1ATS A;  2W40 A;  3A0I X;  3QIC A;  5F0X A;  2E88 A;  2P9K B;  1BA0 A;  3EKU A;  5KPZ A;  4E1J A;  2I7P A;  3AAR A;  3H1V X;  5BPN A;  2V52 B;  3EN9 A;  2FXU A;  4L3Q A;  4WQ4 C;  4BRF A;  4CZH A;  5AQG A;  4CZJ A;  5BN9 A;  2QWO A;  3ULE B;  1GLF O;  5AQH A;  5EY4 A;  3CIP A;  1C0G A;  5AQO A;  4BR0 A;  3CET A;  4O5F A;  1QZ5 A;  4BGB A;  3ZX2 A;  4ISE A;  4BRP A;  3D2E A;  1BWF O;  3SJH A;  4GNI A;  5AQQ A;  5JMV A;  4H0X B;  5F1X A;  3F9M A;  5FPE A;  4BR7 A;  2VCP A;  3ZET B;  5EVZ A;  3FZM A;  4ISG A;  4GY2 B;  3A5M C;  5AFU H;  1S3X A;  1GLE G;  4MLE A;  4EFH A;  3LDO A;  3QFU A;  3QBX A;  3GG4 A;  2A40 A;  1NM1 A;  3CJ1 A;  4JNE A;  4CJ7 A;  4EAH D;  2YHW A;  2ITM A;  1K8K A;  1WOQ A;  1KAX A;  3QBW A;  1ATR A;  5CE3 A;  1S22 A;  5AQZ A;  4PKG A;  4CD1 A;  4H0V B;  2WUS A;  4JAX A;  3O6W A;  2I7N A;  2E8A A;  5ADX H;  1GLC G;  4MLH A;  4FWO A;  5AQI A;  2ASO A;  3HI0 A;  4BC5 A;  1T6C A;  5JLH A;  4H5W A;  3D2F A;  4CZE A;  3A5N C;  3L4I A;  1ZC6 A;  2ZGY A;  3DXM B;  3EL2 A;  3CI5 A;  4JD2 A;  3ID8 A;  4IWV A;  3O08 A;  3ENO A;  3D2F B;  3M3Z A;  2D0O A;  4CZM A;  3D7E O;  1OKJ A;  5AQK A;  1GLD G;  2D4W A;  4RCH A;  5LJV A;  4BRH A;  1NGD A;  4CBW A;  5AQX A;  2P9P B;  2YHY A;  4NO7 A;  1X9J A;  2P9I A;  2E1Y A;  3CJ9 A;  3GE1 A;  4BRD A;  1XUP O;  3MN6 A;  4BR5 A;  5AQY A;  4Y0W A;  2IVO A;  3U9Z A;  3H3N O;  4FSV A;  5AQS A;  4BVP A;  3BEX A;  1ZBS A;  3VF4 A;  2E2N A;  4A2A A;  3VEN A;  4CZK A;  5BPL A;  3TPQ A;  1V4S A;  4K25 A;  1DGK N;  4HWI A;  4A2B A;  1QHA A;  3VEY A;  3CER A;  1HPM A;  1QQO A;  3LL3 A;  5KPT A;  2Q2R A;  1SAZ A;  1EQY A;  5E26 A;  4KBO A;  2ASM A;  5FPD A;  1MWK A;  3ATU A;  4JN4 A;  1HKC A;  3C7N B;  3WXJ A;  3WXI A;  5LJW A;  4FWS A;  1NGJ A;  1YVN A;  1NGB A;  1QZ6 A;  4NB4 A;  1HX1 A;  3CJ7 A;  2F9W A;  1TYQ A;  4FWQ A;  4C23 A;  4H0T B;  4H5V A;  2EWS A;  4FWP A;  2CGK A;  3B8A X;  2P9K A;  1KAZ A;  2QWR A;  2ZWH A;  3ZEU A;  3BF3 A;  1TYQ B;  3EKS A;  4BRQ A;  3R8E A;  3AY9 A;  1GLJ O;  1HLU A;  2DPN A;  2ZF5 O;  4MO5 A;  2AP1 A;  2QWM A;  3AAQ A;  2Q97 A;  3ZX3 A;  3H3O B;  3BUZ B;  3ZEU B;  4QS7 A;  3ULE A;  3VPZ A;  4RWT A;  1H1V A;  3VF6 A;  2VYP A;  3VGM A;  2QW9 A;  3QFP A;  2E2P A;  3MN9 A;  5KQD A;  2FSN A;  1G99 A;  4PL8 A;  1GLL O;  4MO4 A;  4FOI A;  4BG8 A;  3FZK A;  4BQZ A;  3HSC A;  3ZET A;  2HF3 A;  2FLO A;  4FO0 A;  4JHD A;  5AQM A;  2CGJ A;  3WQT A;  2E1Z A;  1RFQ A;  1JCE A;  5FPM A;  2HMP A;  2E20 A;  1T6D A;  2P9L B;  5BRD A;  2J4R A;  5BRF A;  4BR4 A;  3WXL A;  3WEE B;  2CH6 A;  3MMV A;  4JHD B;  2GWJ A;  2FF3 B;  4M7X A;  1E4F T;  1NGC A;  3O80 A;  3VOV A;  1ZXO A;  1V4T A;  2P9S B;  4BRE A;  2VWB A;  2H3G X;  3VER A;  5AZJ A;  3I33 A;  3FZL A;  1T44 A;  3DAW A;  3ENH A;  3U9D A;  1NGI A;  2CH5 A;  4BRO A;  1NLV A;  2D1K A;  1LCU A;  3CHW A;  3O5B A;  4QS9 A;  4FPB A;  5AZJ B;  3JXU A;  3DXM A;  3LDP A;  4CBX A;  2IVN A;  1ATN A;  1BDG A;  2QWP A;  3CQY A;  1JCF A;  3MDQ A;  3VEV A;  3OHR A;  2Q31 A;  4BRK A;  3CJA A;  5KPR A;  5I9E B;  3DWL A;  3SK3 A;  2KHO A;  4CZL A;  3FGU A;  4H0Y B;  5AQF A;  4EHU A;  4PKH A;  4F9O A;  2HF4 A;  3WT0 A;  2P9P A;  1MWM A;  2QWN A;  4FOE A;  2PAV A;  2YJE A;  2GEM A;  3O1B A;  1IG8 A;  3WQU A;  1MA9 B;  3KZB A;  5AQL A;  4CZF A;  1U2V B;  3RSE B;  4K42 A;  4A61 A;  4DB3 A;  2F9T A;  2QWL A;  4M63 C;  1GLB G;  4H03 B;  4H0P A;  1BOT O;  4LC9 B;  3VEZ A;  3LDL A;  1NMD A;  3DXK B;  5AQR A;  3GBT A;  2A41 A;  1KXP A;  5EXW A;  2ASP A;  4AM7 A;  4H5R A;  5BRE A;  5AR0 A;  3IDH A;  3FE1 A;  2FSK A;  4YDU A;  4BRA A;  1HUX A;  1BUP A;  3QB0 A;  2YI1 A;  5AQN A;  4B1Y B;  1Q18 A;  2Q0R A;  3C7N A;  4XEI A;  4H5N A;  3MN7 A;  1XC3 A;  2BUP A;  4XH4 A;  3SMS A;  1NGA A;  4IO8 A;  1MDU B;  3U4L A;  5KQ8 A;  4B1V A;  4WQ5 A;  1YUW A;  2PBD A;  4M7Y A;  2OAN A;  4HTL A;  2CGL A;  2FSJ A;  5AZI A;  3O4W A;  1CZA N;  4I6M B;  1YXQ A;  3UKU B;  1RDW X;  3O1W A;  4PL7 A;  3P4I A;  3IUC A;  3A5L C;  3FR0 A;  5AQV A;  2A42 A;  4BRI A;  3W3D A;  4BRN A;  5LY3 A;  4YDU C;  5AZI B;  4FPA A;  1XQS C;  2GWK A;  2V7Z A;  3M6G A;  1GLA G;  3SMP A;  4BQL A;  5BR9 A;  5ELZ A;  3R6M A;  1E4G T;  3CQX A;  3VEX A;  3FLC O;  2ZGZ A;  4IXC A;  4BRG A;  1TUY A;  5BN8 A;  3QML A;  1HKG A;  2NRH A;  3JS6 A;  1NGE A;  2A5X A;  4BVO A;  2P9U A;  4IZ9 A;  3A8Y A;  1ESV A;  1HKB A;  2P9L A;  3KHY A;  3HBT A;  3WEE A;  4DCH A;  4QS8 A;  1TUU A;  2P9U B;  3BP8 A;  2Q36 A;  3WXK A;  1NGF A;  1U6Z A;  1KAY A;  2P9S A;  4EIA A;  4IJN A;  3M1F A;  3EO3 A;  3G25 A;  4FWM A;  3H1Q A;  1BO5 O;  4J8F A;  1Z05 A; 
#chains in the Genus database with same CATH topology
 2WFB A;  3NHG A;  2HHI A;  5HRO A;  1LWF A;  3BY5 A;  3UKR A;  2GUP A;  1F21 A;  4GV3 A;  3WUH A;  1DKG D;  4B1U B;  3PX0 A;  3RWU A;  1EWR A;  4ILJ A;  2W6K A;  1S6Q A;  2QWQ A;  3HL8 A;  3L3V A;  5C2F A;  4IJA A;  3SCX A;  2HOE A;  3QEX A;  2E2O A;  3J8A A;  4DR1 K;  3C6T A;  1K9M O;  4FYD A;  5I3U A;  1ZBU A;  4JEP A;  3LAK A;  4DTJ A;  3I0S A;  1Z6R A;  3AVI A;  5AQP A;  3WNF A;  4F8R A;  3D2E B;  1Z26 A;  3P83 D;  4CJQ A;  4KHS A;  1LOT B;  3K59 A;  1NGH A;  5TKW A;  4K43 A;  5AQW A;  4EP5 A;  2P9N A;  3R9P A;  3VQC A;  4DS4 A;  3SI6 A;  3W0L A;  4Y1C A;  1NK7 A;  3ZSX A;  1BA1 A;  1K8K B;  3SPY A;  4DSK A;  3THW B;  3NAE A;  3PV8 A;  3CJB A;  2XO7 A;  3LDS A;  2DFF A;  4DR3 K;  1D9F A;  1HNI A;  5M1O A;  2XY8 A;  3VGK A;  3O3H A;  3CFR A;  2E2Q A;  3DJC A;  4B1Z A;  4ISF A;  4Z0U A;  3I8D A;  4M3W A;  3CCR N;  4YOY A;  1NBW A;  4JRP A;  1C0F A;  1VSD A;  3RRH A;  1SKR A;  1YIT N;  4AHR A;  4CJU A;  5H1S Q;  4M3Y A;  3HVT A;  2OPP A;  2XRI A;  1BIZ A;  1TL1 A;  3V4I A;  1EX4 A;  3SAF A;  4CJT A;  4BY9 C;  1SL1 A;  5EOY A;  3RVC A;  4TSX A;  1X3N A;  3A5O C;  3CM5 A;  4DU4 A;  2NZT A;  4GVM A;  3BF1 A;  1X9M A;  1IV0 A;  3QEV A;  3PY8 A;  3CJC A;  1NMN A;  4FZZ A;  3LM2 A;  4IKF A;  3QDK A;  2OPS A;  1O1W A;  3KTQ A;  3DRR A;  1I94 K;  4B1X B;  4JK9 A;  5GIO A;  1FW6 A;  5AFU A;  4KTW A;  2O8F B;  4E89 A;  2IC3 A;  3E9P A;  3VET A;  4GKJ K;  3P38 A;  3LDQ A;  3OYG A;  2ZJR L;  1QTM A;  3HPH A;  4WE1 A;  1TV6 A;  3Q7C A;  4ZTF A;  4NXN K;  2O8B A;  5IT9 O;  3VF2 A;  1FKP A;  4CJK A;  5JVG L;  1WUA A;  4OKE A;  1D9D A;  4FJ8 A;  2IGI A;  3FZF A;  3L2V A;  2G8U A;  4JI2 K;  3L3U A;  2E88 A;  5C42 A;  3ENB A;  2WC9 A;  3EKU A;  4A5B A;  4DFM A;  3O4Q A;  4JKA A;  4A5A A;  4KRE A;  2I7P A;  3AVK A;  3OS0 A;  4BRF A;  5BN9 A;  5EY4 A;  5AQH A;  2F96 A;  3MEC A;  4OGC A;  4IEE A;  3CET A;  4O5F A;  4BGB A;  3ZX2 A;  4DTS A;  3THY A;  4Z4G A;  1S1T A;  4BRP A;  1JLQ A;  4BDZ A;  3FZM A;  4CGD A;  4GY2 B;  4E3S A;  2FBY A;  5AFU H;  1S3X A;  2PFU A;  3QFU A;  3QBX A;  3GG4 A;  1NM1 A;  4JNE A;  5J2P A;  4FK4 A;  4E1N A;  3ZSV A;  4CD1 A;  1VSM A;  4H0V B;  4FLX A;  1GLC G;  4MLH A;  2FBT A;  3CPW M;  4I7F A;  3TTF A;  1TKT A;  4GV9 A;  3AVL A;  4JI3 K;  2O8E B;  3ZSR A;  1DTT A;  3A5N C;  1KFD A;  5FDL A;  1ZC6 A;  4BE1 A;  4BEC A;  4JD2 A;  3K2P A;  4IWV A;  1NKC A;  4WFA L;  1UWB A;  2HBL A;  3M3Z A;  4LFA K;  5AQK A;  2NRV A;  1NGD A;  2YHY A;  2YKN A;  3CCQ N;  1X9J A;  2P9I A;  3CPE A;  1JLA A;  3AVN A;  4BR5 A;  5AQY A;  1N36 K;  1BCM A;  1YJ9 N;  3B6O A;  3U9Z A;  2ETJ A;  3CD6 N;  1RT6 A;  3HM9 A;  1JJ2 M;  4CZK A;  4DV2 K;  4FK2 A;  4BE7 B;  2VGM A;  1L3U A;  3TI0 A;  1DGK N;  4HWI A;  4JKD A;  3CER A;  4DTP A;  1VSE A;  2Q2R A;  1SAZ A;  3AO3 A;  1EQY A;  3NVK A;  3NGY A;  4DU1 A;  1HKC A;  4CGF A;  4LF8 K;  2HBM A;  4NB4 A;  1YVN A;  1NGB A;  1LW0 A;  4CEQ A;  1TYQ A;  4O4G A;  3U3G A;  1NOY A;  4M41 A;  4JI7 K;  3E9O A;  1ASV A;  2QWR A;  1C0U A;  3VQA A;  2HND A;  1KQS M;  4FK0 A;  3R8E A;  2DPN A;  3MXI A;  2ZF5 O;  4KO0 A;  2PY5 A;  1TAU A;  3AAQ A;  3ZX3 A;  1JLG A;  4C1N I;  4QS7 A;  4JS4 A;  3VF6 A;  2VYP A;  1IKY A;  3BZK A;  3G0Z A;  4JK7 A;  2E2P A;  4EZ6 A;  1QS4 A;  2PZS A;  2FLO A;  1M1K O;  2JGU A;  3M8S A;  2CGJ A;  2HMI A;  1JCE A;  4DV7 K;  2HMP A;  3KK7 A;  4DV3 K;  2UXC K;  5BRD A;  2J4R A;  3A2F A;  4C8M A;  4DR5 K;  3MEE A;  3MMV A;  2GWJ A;  2FF3 B;  1ASU A;  3VOV A;  1ZXO A;  4BRE A;  4KAZ A;  3OYI A;  3I33 A;  3NE6 A;  3U9D A;  3OYN A;  1UOC A;  1L3T A;  2NRR A;  1L3S A;  1SS6 A;  3O5B A;  4IG3 A;  3R1X A;  4QS9 A;  4FPB A;  1T8E A;  3OYK A;  2IDO A;  1ATN A;  3CCS N;  3RMC A;  4FJL A;  3B6P A;  4FM2 A;  3S5T A;  1VQ4 N;  3MCA B;  2Z1J A;  1VSH A;  4EHU A;  3F2K A;  4PKH A;  3KD1 E;  3U3Y A;  4OLB A;  2BH1 A;  1IG8 A;  4JKB A;  3KK3 A;  4K42 A;  4A61 A;  3HO1 A;  1GLB G;  1O13 A;  4N76 A;  3HP9 A;  3DXK B;  5AQR A;  4N56 A;  1KXP A;  4LY7 A;  3LP3 A;  3E1Y A;  4H5R A;  1VSF A;  1BUP A;  3E9L A;  3QIO A;  3HRG A;  1OVQ A;  3VA3 A;  2HHU A;  1VQP N;  3C7N A;  5GAG P;  4CEO A;  3HT3 A;  4J2D A;  1KLM A;  1LW2 A;  1XC3 A;  3MED A;  3ID6 A;  4FLT A;  4B9U A;  3RMD A;  3U4L A;  2VGN A;  1MDU B;  5KQ8 A;  4CJ4 A;  4H4M A;  1EET A;  3OW2 M;  2PBD A;  1REV A;  4CER A;  4M7Y A;  3VN5 A;  4K0K K;  1UAX A;  2O8D B;  1U45 A;  3O4W A;  3QEW A;  3UKU B;  3K5N A;  1RDW X;  3QER A;  1VQ7 N;  4KI4 A;  4C8N A;  3A5L C;  1FKO A;  3FR0 A;  2A42 A;  1SKW A;  3ZT0 A;  5LY3 A;  1ZBL A;  4HTU A;  1WB9 A;  1XQS C;  2A1R A;  4LSN A;  5LMU K;  2ZE2 A;  3CQX A;  3VEX A;  3FLC O;  2G8W A;  1HKG A;  3M8Q A;  3O9U A;  5M1K A;  3JS6 A;  1NGE A;  1NOZ A;  3AVG A;  3KKR A;  4DV6 K;  2JLE A;  4IZ9 A;  2HHW A;  3OYJ A;  1HKB A;  4N5S A;  2QEX N;  2R7Y A;  3HBT A;  3WEE A;  4DQP A;  3DLR A;  1TUU A;  5FRN A;  1TKD A;  4EIA A;  3CCV N;  1W0H A;  3M1F A;  2ZJP L;  2HVI A;  1TGO A;  4FWM A;  1BO5 O;  1QQC A;  4B9M A;  1VQM N;  2ITG A;  3EZW A;  5LMN K;  3GDQ A;  1K6Y A;  3TAG A;  3NH0 A;  3HP6 A;  3H6E A;  3PIO L;  3V81 A;  1XMQ K;  1GOA A;  2E6M A;  2WON A;  4CHQ A;  5KRS A;  2YNH A;  2AJQ A;  2ZD1 A;  2X6N A;  4Z4F A;  2QM1 A;  1LWE A;  2VG7 A;  3QNO A;  3IMX A;  4CFD A;  4CBU A;  2E4L A;  1VQ9 N;  2E5L K;  4L8R B;  3ZX0 A;  3MXM A;  4FJN A;  1EXQ A;  2IIR A;  4RG8 A;  4FM1 A;  2GTD A;  5BR8 K;  1BIU A;  2Q0U A;  4DLG A;  4RW7 A;  1U2V A;  4F2R A;  1QQM A;  3EEQ A;  2W41 A;  4LD0 A;  3MN5 A;  1BG3 A;  5JLF A;  1KSP A;  3DOL A;  3BDP A;  1VRU A;  1RT3 A;  3VTI A;  3AAP A;  1HJO A;  4Z94 A;  4H4O A;  2A6A A;  4C8K A;  1QQN A;  4CED A;  4BC3 A;  5HRN A;  4BRC A;  2QXL A;  4E7J A;  4DUY K;  5JS2 A;  1Z25 A;  4BE0 A;  1A5W A;  1WSG A;  3T1Y K;  4PQU A;  4NXM K;  3LM9 A;  3UE5 A;  1RCH A;  4AH9 A;  2ZM6 K;  4GVE A;  5AQU A;  1XNQ K;  1LWC A;  3C0B A;  1L5U A;  2OCE A;  4XH1 A;  5HRR A;  2FBX A;  4BG9 A;  1OH7 A;  5F2R A;  2A1S A;  5TKY A;  3OYD A;  2YNG A;  2DY4 A;  3AA4 A;  5MLC Q;  2V7Y A;  4IEI A;  3HPG A;  4CGG A;  4CEB A;  3UB5 A;  3NH1 A;  3WNG A;  3TAF A;  4BRM A;  3TWH A;  2BE2 A;  5AQT A;  1RBT A;  3AVJ A;  4O44 A;  3NF9 A;  5C24 A;  1IG9 A;  3NCI A;  1TK5 A;  3L0Q A;  3ISN C;  1S9E A;  4E1M A;  4KHU A;  4AM6 A;  3AVH A;  4CGJ A;  3U8X A;  1B9D A;  3H08 A;  5KRT A;  3SUQ A;  1ZBH A;  4WQ5 C;  5AQJ A;  2HNZ A;  1BI4 A;  1X3M A;  4M3X A;  2Z1H A;  2UYT A;  3VEW A;  3NFA A;  4B8A B;  4DHY A;  4B3T K;  4IOA L;  3VQP A;  3I0R A;  4EP4 A;  1JLF A;  4RTF D;  3MX5 A;  1VQL N;  4JS5 A;  1BCO A;  2KW4 A;  4N47 A;  1NWK A;  5ADX A;  1RT1 A;  1YVU A;  3VQB A;  1ATS A;  4DQI A;  3VQ4 A;  3DRS A;  5F0X A;  2P9K B;  1BHL A;  4ICL A;  1BQN A;  1RBU A;  5FLX O;  4JI8 K;  3AO5 A;  3H1V X;  4L3Q A;  4CZH A;  1Q7Y O;  4PY5 A;  5AQG A;  2OTJ N;  3ULE B;  4DSL A;  3CIP A;  1C0G A;  3OYE A;  3KIO A;  1QVF M;  4JI4 K;  3SJH A;  4GNI A;  5AQQ A;  4QCL A;  5FPE A;  5F1X A;  5KGX A;  3ZET B;  1NJW A;  4FJG A;  1JKH A;  4CVN E;  4I9L A;  4O8U A;  1VSK A;  2ITM A;  3HJF A;  4RW6 A;  2IOC A;  4B9L A;  1KAX A;  3C6A A;  1SL0 A;  3L4Q A;  1KTQ A;  1S22 A;  2O8E A;  3KWI A;  5E41 A;  5J2Q A;  3MAQ A;  4O0I A;  4I2P A;  5ADX H;  3NMU A;  3VQD A;  4QOZ B;  4FWO A;  4CHZ A;  1RDB A;  4BC5 A;  1JXB A;  1YHQ N;  4BWJ A;  2FC0 A;  4CHN A;  4CJP A;  1NJI O;  3ASM A;  4UY8 O;  3CFP A;  2ZGY A;  4OPH A;  2KFZ A;  3EL2 A;  3CI5 A;  4HUG A;  5I42 A;  4B3O A;  3D2F B;  4OX9 K;  1IKX A;  4W5T A;  4FJJ A;  2YHB A;  1OKJ A;  5LJV A;  2P9P B;  4CK1 A;  4NO7 A;  3S3M A;  4JK8 A;  3SUP A;  5SZT A;  3GE1 A;  3J80 O;  2OTL N;  1XUP O;  2BAN A;  3MN6 A;  3KLG A;  4OGE A;  4KHP K;  1IKW A;  4RW9 A;  5AQS A;  4FJX A;  3BEX A;  5DMR A;  1RBS A;  3VEN A;  4HCB A;  4A2B A;  4WFN L;  3VQ7 A;  3MX2 A;  3C95 A;  4CFC A;  3VEY A;  1HPM A;  3LL3 A;  5KPT A;  4IG0 A;  3SAH A;  3TAB A;  4E7L A;  3ATU A;  4XIU A;  3V1R A;  3WXJ A;  5LJW A;  4FWS A;  3NDK A;  2DTU A;  2RPI A;  3IRX A;  2F4V K;  5K14 A;  1HRH A;  2F9W A;  2C1I A;  5GAE P;  5HOO A;  4B9S A;  4FWP A;  1S1W A;  4YOT A;  2IAJ A;  5DM6 L;  1TVR A;  4V19 S;  2G8K A;  3SBT A;  1QHT A;  3OYL A;  4FLY A;  3QET A;  3EYZ A;  5EU7 A;  1CLQ A;  1GLJ O;  4DR6 K;  2YV0 X;  2GX9 A;  4MO5 A;  2AP1 A;  3U6F A;  3CCE N;  2Q97 A;  3LPT A;  3AVB A;  4GKK K;  3ZEU B;  1B9F A;  2XY7 A;  2QW9 A;  3QFP A;  4GW6 A;  2FSN A;  1QSL A;  2PYL A;  1Q86 O;  3PUF A;  1WNS A;  5FRM A;  3PSF A;  3MXJ A;  4MO4 A;  3RMB A;  4DFJ A;  2EHG A;  4BG8 A;  4LH4 A;  1HYS A;  4LH5 A;  4ZTJ A;  4HHT A;  1K73 O;  4FLW A;  1VQK N;  1T6D A;  2P9L B;  4Z4E A;  3DLK A;  3T3F A;  4JHD B;  1NJX A;  3RMA A;  3O80 A;  4LF6 K;  2P9S B;  3QEI A;  3EZ5 A;  1WBD A;  3JYT A;  4BWM A;  3CCM N;  3THX B;  2P5G A;  2C1G A;  5GAH P;  3DAW A;  3ENH A;  3ZSW A;  3V6D A;  3IAY A;  1RDU A;  1C6V A;  4B9V A;  2D1K A;  4JKG B;  1LCU A;  3CHW A;  2D5R A;  1N33 K;  4MDB A;  4DG1 A;  3JXU A;  3ALY A;  3DXM A;  3LDP A;  1TL3 A;  3CQY A;  3J81 O;  4CEC A;  3MDQ A;  1B92 A;  3OHR A;  3CJA A;  5KGW A;  3EE8 A;  5I9E B;  1N8R O;  2F8S A;  4DFK A;  1T3V A;  4CZL A;  2KHO A;  2F8T A;  4F9O A;  1NG9 A;  2HF4 A;  3WT0 A;  4AIL C;  1XHZ A;  2YJE A;  3O1B A;  3ZT1 A;  5CZ1 A;  3WQU A;  3PX6 A;  3L2W A;  1S1X A;  2UUB K;  1MA9 B;  2OYQ A;  4CZF A;  3SQ0 A;  3NF8 A;  2F9T A;  3T1H K;  1BOT O;  3CCJ N;  1BGX T;  3LDL A;  1NMD A;  5GIP A;  1S9G A;  5EXW A;  2ASP A;  4RW4 A;  3ZYY X;  1NK4 A;  3LAL A;  3CYG A;  4BDY A;  2FSK A;  4BRA A;  4NCB A;  3PSI A;  1HUX A;  3C6U A;  3QB0 A;  3TSQ A;  3IS9 A;  3MN7 A;  3LPU A;  2X6S A;  2BUP A;  4XH4 A;  3SMS A;  4PWD A;  4IO8 A;  1OVY A;  1HNW K;  3OY9 A;  5CR4 A;  2CGL A;  4KB0 A;  1TKZ A;  1CZA N;  1YXQ A;  4DTO A;  1KVC A;  4BEB A;  3P4I A;  3IUC A;  3W3D A;  2QTD A;  1S1U A;  4X64 K;  4FPA A;  2VQF K;  3M6G A;  4KV8 A;  5BR9 A;  1EKE A;  3ZT2 A;  1E4G T;  2GBZ A;  3HPO A;  4DLE A;  4IXC A;  1TUY A;  1SUQ A;  3TTC A;  4FZY A;  2G8F A;  3V1Q A;  3ZLJ A;  1W97 L;  4BVO A;  4WFB L;  3V9U A;  1RDA A;  4B3S K;  3BZC A;  2EX3 A;  4Q0B A;  4A57 A;  2BDP A;  3M8R A;  1TK8 A;  4QS8 A;  1Q8I A;  2YX6 A;  2WOM A;  1NGF A;  1U6Z A;  3AGK A;  1KAY A;  3O4N A;  1HQU A;  3WXK A;  4IJN A;  3K5O A;  3P31 A;  4CIF A;  3G71 N;  3G25 A;  2O8B B;  3H1Q A;  2D0A A;  1Z05 A;  4AHC A;  3TR8 A;  3V9X A;  4M42 A;  2KQ2 A;  4CD3 A;  1RBV A;  3DLB A;  3DI6 A;  4ILH A;  5FRO A;  2QKK A;  3KK1 A;  3VQ8 A;  3VQ5 A;  2Q1N A;  4NLB A;  2YCH A;  4JI6 K;  4FWK A;  1OH5 A;  3OS1 A;  4H5T A;  2UUC K;  3VEO A;  3DOK A;  4OPA A;  2NLX A;  4BDP A;  4B1W B;  4OKJ A;  3KVG A;  4K8Z A;  4OPJ A;  3TU5 A;  1XHX A;  3THY B;  1RDC A;  1U47 A;  4CJR A;  3WXM B;  1Y64 A;  5C25 A;  5BPM A;  2Y1I A;  1IH7 A;  1D4X A;  3AVF A;  3Q7B A;  3RSE A;  4CIG A;  3M5R A;  2HST A;  2B5J A;  1GOC A;  4EZ9 A;  5KTQ A;  3LZI A;  4AHS A;  3SQ1 A;  4PKI A;  4FWR A;  4DR7 K;  4BR9 A;  2V51 B;  4NYF A;  3IFR A;  3G6E N;  2ZQB A;  5KI6 A;  2HHX A;  1RTJ A;  4PA1 A;  3SAG A;  3QNN A;  3LZJ A;  3HZ6 A;  4EHT A;  5DK5 A;  1YIJ N;  3HM8 A;  4JD2 B;  4I6M A;  4F2S A;  3PIP L;  4Z4I A;  4CEE A;  5M1F A;  4BE2 A;  3EE9 A;  3O9R A;  1KCF A;  3S41 A;  3P39 A;  4B9Q A;  3ZT4 A;  4HUE A;  5E84 A;  4BAC A;  3PO5 A;  4ID1 A;  2P9I B;  5J2M A;  4JKH A;  1XMO K;  4PUO A;  2HW3 A;  3OTO K;  2HHS A;  2G8I A;  3SLC A;  4BRL A;  4BR2 A;  4X65 K;  3NVM A;  5BRH A;  2HBJ A;  4WYB A;  1P8Z A;  3LDN A;  1U48 A;  1WSF A;  3CF5 L;  4F4K A;  1WAJ A;  4CJ3 A;  3OYA A;  4F3O A;  2AA4 A;  3JAM O;  4E19 A;  3O9T A;  3CMA N;  2GEL A;  3OYB A;  3D45 A;  3KJV A;  1HJR A;  2W40 A;  3A0I X;  4DV4 K;  2KFN A;  3QIC A;  1XI1 A;  4CJL A;  4C8L A;  2VG6 A;  4CJ5 A;  4CFB A;  3ZSY A;  4ID5 A;  4CE9 A;  4E1J A;  5KPZ A;  4DQQ A;  4DUZ K;  5BPN A;  4KHY A;  1CZB A;  4IOX A;  2V52 B;  3EN9 A;  1KRP A;  1Q9Y A;  1CXU A;  4CF0 A;  4CZJ A;  1GLF O;  2YNI A;  2YKM A;  4BR0 A;  1HPZ A;  1QZ5 A;  4ISE A;  5LL6 Z;  1ASW A;  1Y97 A;  3D2E A;  4B08 A;  3L8B A;  4H0X B;  3F9M A;  4BR7 A;  2P51 A;  2VCP A;  3S3O A;  4FJM A;  3ZSQ A;  3SBG A;  2A40 A;  4CJ7 A;  1NU0 A;  4EAH D;  2W6L A;  2YHW A;  1TAQ A;  3VQ9 A;  4KB1 A;  1K8K A;  4DSE A;  3THW A;  1WOQ A;  2VWJ A;  4I9Q A;  4W5O A;  5CE3 A;  1OH8 A;  4LF9 K;  5AQZ A;  3OJS A;  4PKG A;  2WUS A;  4JAX A;  3O6W A;  4JYA K;  1X1P A;  2I7N A;  2RN2 A;  1LAW A;  2E8A A;  1WSJ A;  3K58 A;  4M3U A;  3HI0 A;  2ZJQ L;  3L2R A;  4OKK A;  3MWP A;  5JLH A;  3CFO A;  5CHI A;  4H5W A;  3D2F A;  4CFA A;  3KLF A;  3F9K A;  4DQR A;  4J2A A;  3K0S A;  2OZM A;  2OA8 A;  3O08 A;  3KLI A;  3ENO A;  1Q81 O;  1KVA A;  2VWK A;  3TSU A;  2D0O A;  3R3L A;  1GLD G;  4RCH A;  2PYJ A;  2P5O A;  4BRH A;  1X9W A;  4CBW A;  2VG5 A;  5AQX A;  2W00 A;  3OJU A;  2NRX A;  3VQQ A;  3NGZ A;  1VSL A;  4Y0W A;  1U04 A;  3KKS A;  2IVO A;  3T1A A;  4DV0 K;  3D6R A;  3H3N O;  2Q3S A;  4FJ9 A;  1ZBS A;  3LWL A;  4A2A A;  5BPL A;  1LAV A;  4K25 A;  3AO4 A;  1C1A A;  1QHA A;  2O8F A;  1QQO A;  1SKS A;  3IG1 A;  3L2U A;  3G4S N;  5E26 A;  4KBO A;  5A2Q O;  5FPD A;  1IBK K;  4JN4 A;  3QES A;  3C7N B;  3WXI A;  2GUI A;  1NGJ A;  3AGR A;  3DLE A;  3TAQ A;  1EP4 A;  4CJE A;  4KRF A;  3CJ7 A;  4FJK A;  5J1E A;  1VQ5 N;  4CGH A;  5M1P A;  4H0T B;  4HVJ A;  2EWS A;  3LP0 A;  3B8A X;  1VRT A;  5DM7 L;  2O8C B;  3DM2 A;  2ZWH A;  3ZEU A;  3VA0 A;  1UA1 A;  4CW7 B;  1C0T A;  4NCG A;  2Y1J A;  3MWT A;  1HMV A;  2QWM A;  3H3O B;  4RWT A;  1H1V A;  3VGM A;  4H8K A;  3T69 A;  2YNF A;  3O3F A;  5CYQ A;  5KQD A;  3SJJ A;  4FJ7 A;  1GLL O;  1KFS A;  4JI0 K;  1RT4 A;  1T03 A;  1KC8 O;  3J7Z O;  4C8O A;  1ILY A;  1KD1 O;  4BQZ A;  3HSC A;  3UIQ A;  2HF3 A;  2RHK A;  4JHD A;  3CCU N;  5GAD P;  3DYA A;  3OYM A;  3QO9 A;  1RFQ A;  5FPM A;  1IBL K;  2E20 A;  2X78 A;  5BRF A;  1DTQ A;  4BR4 A;  4M3R A;  4DKW A;  3TSP A;  3WEE B;  2CH6 A;  4FM0 A;  3KLE A;  4FZX C;  3PX4 A;  1D8Y A;  3AVA A;  1E3M A;  4JKG A;  1V4T A;  1FK9 A;  2VWB A;  3VER A;  4WCE L;  4FLV A;  2RF2 A;  2IS3 A;  3FZL A;  1T44 A;  4KTQ A;  1RBR A;  1NGI A;  4YFU A;  4W5R A;  2CH5 A;  4BRO A;  1YJW N;  1NLV A;  5D3G A;  5AZJ B;  4FJH A;  4DMN A;  1NK9 A;  3HVR A;  4CEZ A;  2IVN A;  2QWP A;  3TAM A;  3SV3 A;  4KHN A;  4LFB K;  1JCF A;  3LAM A;  3M8P A;  3VEV A;  2Q31 A;  3K57 A;  3DWL A;  3HST B;  4Y1D A;  3SK3 A;  2HNY A;  3FGU A;  4B8C A;  5AQF A;  4CJW A;  5CZ2 A;  4MFB A;  2OPQ A;  4ELV A;  1RTI A;  4C1N K;  3SUO A;  2QI2 A;  2PAV A;  4B9T A;  2GEM A;  3I56 N;  4CJS A;  3ZSO A;  3KZB A;  1U2V B;  4M63 C;  4H0P A;  3VEZ A;  2HHV A;  3GBT A;  1JXE A;  3SPZ A;  4M3T A;  2A41 A;  4AM7 A;  3LP1 A;  3J7A P;  5BRE A;  3O3G A;  4G1Q A;  3PO4 A;  4MDA A;  4YDU A;  1YJN N;  3HOS A;  2YI1 A;  5AQN A;  4B1Y B;  4DSJ A;  1KVB A;  1Q18 A;  1VQ8 N;  4CJV A;  2O4G A;  4H5N A;  2BGG A;  1VAZ A;  4FLZ A;  1ZYQ A;  1N6Q A;  5IWA K;  1YT3 A;  4DV5 K;  1NGA A;  4Z4C A;  4FW1 A;  4KHW A;  4DTU A;  2NUB A;  2OAN A;  3NBP A;  2FSJ A;  1I39 A;  3O1W A;  4CJF A;  4PL7 A;  2JWK A;  5AQV A;  4BRI A;  4DSI A;  4IDK A;  4BRN A;  3RTV A;  3TAN A;  4YDU C;  4CK2 A;  5AZI B;  2GWK A;  5AJ3 K;  3L2Q A;  3K5M A;  4O5B A;  1RT7 A;  3SMP A;  4BQL A;  5ELZ A;  1G15 A;  4CHO A;  1N32 K;  4KKO A;  5M1N A;  3R6M A;  2ZGZ A;  5C2D A;  4PHT X;  3CME N;  4BRG A;  3AVC A;  2G8V A;  1NK8 A;  3E66 A;  2NRH A;  1U49 A;  1ESV A;  2Z1I A;  1VHX A;  4YOV A;  2QA4 N;  3SYZ A;  3OA9 A;  4DTN A;  4AHV A;  3AA2 A;  2HHT A;  3BGR A;  4DCH A;  1QVG M;  5HRP A;  3QIP A;  1KLN A;  2P9U B;  1BI4 B;  3BP8 A;  3CYM A;  2Q36 A;  3LWM A;  1CZ9 A;  3FFI A;  3TAE A;  1LV5 A;  5C10 A;  4J8F A;  4FVM A;  2XHB A;  1JLC A;  1EWQ A;  5M1Q A;  2IVP A;  3DLG A;  4FWL A;  1ZBF A;  3VES A;  3D0P A;  1R59 O;  3C6H A;  5FPN A;  4CF2 A;  4MQ3 A;  5CY4 A;  3HTV A;  3AA3 A;  1YAG A;  1WLJ A;  3T7Z A;  2YHX A;  1RGI A;  3AO1 A;  4G9Z A;  2RKI A;  4BC4 A;  2OZS A;  5SWM A;  3OYC A;  3FZH A;  1IO2 A;  4YNQ A;  1W2B M;  3L6Q A;  4U7B A;  4E7K A;  3UKR B;  1W7A A;  3KD5 E;  2Z1G A;  4XH5 A;  4K41 A;  3K9K A;  4LSL A;  4IFV A;  4FL9 A;  2D0B A;  1RDD A;  4X62 K;  1WAF A;  3CM6 A;  5CYM A;  4A62 A;  1WBB A;  2XY6 A;  1XC9 A;  3N4P A;  1JCG A;  1HYZ A;  3IKM A;  3SUN A;  3AA5 X;  4LF7 K;  2YJF A;  4BGA A;  2WBN A;  4E72 A;  4AF1 A;  2D0P A;  3CC2 N;  4CZG A;  1HYV A;  3I8B A;  3DXK A;  3KWG A;  4CCH A;  3V9Z A;  3P1G A;  3ATV A;  4U67 L;  3MCP A;  4UQG A;  4CEF A;  3C94 A;  4CI6 A;  1M90 O;  2A3Z A;  3ITH A;  3AO2 A;  3GOI A;  3K5L A;  3CC7 N;  1HQE A;  2P9N B;  1X9S A;  4LF5 K;  2P1J A;  5EX5 A;  3NGI A;  4KH4 A;  4CES A;  2HBK A;  2WTU A;  4DQ8 A;  3P5J A;  4YY3 K;  1RTH A;  4FCY A;  2UUA K;  2E6L A;  4O0J A;  4KH6 A;  3MK6 A;  5B8H A;  5JIC A;  2FF6 A;  5HBM A;  4WF9 L;  5J2N A;  1C1B A;  4DR2 K;  2O8D A;  3CXC M;  3V9S A;  4W5N A;  1SQK A;  3UKU A;  4DTM A;  2BTF A;  1QE1 A;  1DEJ A;  1NGG A;  1IJJ A;  4H0O A;  2FBV A;  4FWN A;  4CGI A;  1J6Z A;  1ITG A;  1VK0 A;  1YTA A;  2B4J A;  3H45 C;  2KLA A;  4KFB A;  1U4B A;  3H46 O;  3O8M A;  4J2E A;  3NF7 A;  5C0Y A;  1NJY A;  4IFY A;  1BU6 O;  4DV1 K;  4OJR A;  2DFH A;  4CZI A;  4WQ4 A;  1A5V A;  1SZ2 A;  1FJG K;  5HP1 A;  2ATQ A;  3SQ4 A;  3DRP A;  3E01 A;  4ILG B;  1WSH A;  3VGL A;  1TK0 A;  2KTQ A;  4BC2 A;  3FFK B;  3K9J A;  4O8K A;  4JV5 K;  3GL1 A;  1NKB A;  2UU9 K;  2F7T A;  1SL2 A;  4NYN A;  4YOX A;  1RIL A;  4JKC A;  1BL3 A;  1BA0 A;  4GMJ B;  3AAR A;  4CEA A;  1P90 A;  5HRS A;  1J9A A;  2FXU A;  4WQ4 C;  3HXM A;  1J5O A;  1YTU A;  2QWO A;  1WN7 A;  3MEG A;  5AQO A;  3F73 A;  2D0C A;  3AV9 A;  3LAN A;  3KLH A;  4JRQ A;  1BWF O;  1S6P A;  4IDH A;  5JMV A;  4IO9 L;  5EVZ A;  4AHU A;  4AHT A;  4CF8 A;  4ISG A;  1N34 K;  1HR0 K;  3A5M C;  1GLE G;  4MLE A;  4EFH A;  3LDO A;  1XNR K;  4YOW A;  3CJ1 A;  2JWL A;  2UXB K;  1DLO A;  2QXF A;  1S5J A;  4B3R K;  3NF6 A;  4QAG A;  1JL1 A;  3QBW A;  1ATR A;  3PLA A;  3S3N A;  3NH2 A;  2DFE A;  5JEN A;  1T7P A;  4DTX A;  4B3M K;  5AQI A;  2ASO A;  3DMJ A;  3TAP A;  1T6C A;  3JSM A;  4DSF A;  1IKV A;  4CZE A;  3T19 A;  3L4I A;  3DXM B;  4KHQ A;  4JLH A;  1TKX A;  3RR7 A;  3ID8 A;  3OBY A;  2NRW A;  3V9W A;  4DWI A;  1WSI A;  1NK0 A;  1Q82 O;  2XY5 A;  4CZM A;  3D7E O;  4FXD A;  2D4W A;  1IBM K;  1XWL A;  3WNE A;  4KH5 A;  3OS2 A;  2O4I A;  2E1Y A;  1BIS A;  3CJ9 A;  4YOU A;  3VTH A;  3THV A;  4BRD A;  4R5P A;  4CK3 A;  3SQ2 A;  4FSV A;  4FW2 A;  4BVP A;  1C0M A;  3VF4 A;  2E2N A;  1FXX A;  3TPQ A;  1V4S A;  5HL7 L;  2QK9 A;  3N4Q A;  4ELT A;  3V1O A;  2QKB A;  4IOC L;  1NNE A;  4DF8 A;  3C65 A;  2ASM A;  1MWK A;  1I3A A;  1L3V A;  2O8C A;  1QZ6 A;  1S1V A;  1C1C A;  1HX1 A;  3CC4 N;  4W5Q A;  3SZ2 A;  4FWQ A;  4C23 A;  3OYH A;  1Q9X A;  1RT5 A;  2KKZ A;  4H5V A;  1NKE A;  2CGK A;  2RE2 A;  1S72 N;  3QLH A;  4OPK A;  2P9K A;  4Z4H A;  1KAZ A;  5C12 A;  4J2B A;  3BF3 A;  1TYQ B;  3EKS A;  1HNV A;  4BRQ A;  4K8X A;  3AY9 A;  2HVH A;  1HLU A;  4DS5 A;  1QSY A;  4DF4 A;  4DR4 K;  1NJZ A;  4F3T A;  2UXD K;  3BUZ B;  3VPZ A;  3ULE A;  4X66 K;  3OBW A;  4NLC A;  1HNX K;  3MN9 A;  1G99 A;  4PL8 A;  4YHH K;  2KZM A;  3OVN A;  4FOI A;  2W42 A;  4ZHR A;  3FZK A;  2G8H A;  1VQ6 N;  3ZET A;  4FO0 A;  5AQM A;  3WQT A;  1JLB A;  2E1Z A;  4FVU A;  3HK2 A;  3OYF A;  4LFC K;  2OPR A;  4CHP A;  4CHY A;  3WXL A;  1RTD A;  4HUF A;  3HOT A;  4JI1 K;  4M7X A;  1E4F T;  1NGC A;  1QSS A;  3J7Y P;  1SV5 A;  2H3G X;  5AZJ A;  1GOB A;  3AVM A;  3S9H A;  5T7B A;  4DFP A;  2NRZ A;  2HHQ A;  2YHA A;  4O55 A;  2KZZ A;  1VQO N;  1J5E K;  4CBX A;  3I55 N;  3ZSZ A;  3SV4 A;  1JLE A;  1BDG A;  4M45 A;  1UA0 A;  3SNN A;  4BRK A;  5KPR A;  1R0A A;  5HLF A;  4CF1 A;  2B6A A;  4H0Y B;  1BQM A;  2HHH K;  3DLL L;  2P9P A;  1MWM A;  2QWN A;  4FOE A;  4OLA A;  2LSN A;  4E7H A;  4IBN A;  4LF4 K;  3VQ6 A;  4DU3 A;  1J54 A;  4I2Q A;  4JKF A;  5AQL A;  1HNZ K;  3RSE B;  3O9Q A;  4DB3 A;  2QWL A;  1CXQ A;  4H03 B;  3EY1 A;  4LC9 B;  1RNH A;  4NCA A;  1VQN N;  4FLU A;  3VQE A;  4A59 A;  2X74 A;  2HB5 A;  1EO1 A;  4Q5V A;  5GIN A;  4DQS A;  1MU2 A;  4FJ5 A;  5AR0 A;  4KI6 A;  4AQY K;  3ZT3 A;  3IDH A;  3FE1 A;  3QEP A;  2GV9 A;  2NRT A;  2Q0R A;  4XEI A;  4E7I A;  1RT2 A;  3RRG A;  1T05 A;  1YF5 L;  3TTD A;  2NNW A;  4B1V A;  4WQ5 A;  1YUW A;  3F5T A;  4ELU A;  3CCL N;  4HTL A;  5AZI A;  4IFE A;  1W9H A;  3DLH A;  3ZCM A;  4I6M B;  1YI2 N;  1ZBI A;  4HCC A;  3ULD A;  1D5A A;  2I5J A;  3G10 A;  1WSE A;  3O9S A;  5C15 A;  1VSJ A;  2V7Z A;  1GLA G;  4GV6 A;  4JI5 K;  3TAR A;  5JVH L;  1JL2 A;  4M3Z A;  4KPY A;  3LP2 A;  5BN8 A;  4KTZ A;  3QML A;  1NK6 A;  1VSI A;  3WNH A;  5JS1 A;  2A5X A;  3CQ8 A;  4DTR A;  2P9U A;  3RR8 A;  1A5X A;  3A8Y A;  1DT9 A;  2P9L A;  3CG7 A;  4XJX A;  3HYF A;  4CF9 A;  4N41 A;  4RW8 A;  3KHY A;  4CIE A;  4OVL A;  1K8A O;  3QIN A;  4OO1 J;  3KK2 A;  4E0D A;  3VMF B;  1N5Y A;  1NK5 A;  2VQE K;  2P9S A;  4R79 A;  4YOR A;  3EO3 A;  4JKE A;  4FJI A;  3THX A;  1OH6 A;  1J53 A;  4B9N A; 
#chains in the Genus database with same CATH homology
 1VQM N;  2WFB A;  3EZW A;  5M1Q A;  2IVP A;  4FWL A;  3GDQ A;  3VES A;  1R59 O;  4CD3 A;  3C6H A;  5FPN A;  3UKR A;  3H6E A;  3PIO L;  3HTV A;  2GUP A;  1YAG A;  3T7Z A;  4GV3 A;  3WUH A;  2YHX A;  1DKG D;  1RGI A;  4B1U B;  4ILH A;  4ILJ A;  4G9Z A;  4BC4 A;  2QWQ A;  3FZH A;  5C2F A;  2Q1N A;  4IJA A;  2YCH A;  4NLB A;  1W2B M;  3L6Q A;  4FWK A;  2QM1 A;  4U7B A;  4H5T A;  2HOE A;  3UKR B;  3CC2 N;  4XH5 A;  3VEO A;  4OPA A;  2E2O A;  3IMX A;  3J8A A;  4CBU A;  4K41 A;  3K9K A;  2NLX A;  1K9M O;  4FL9 A;  4B1W B;  1VQ9 N;  3KVG A;  4JEP A;  4A62 A;  3TU5 A;  3ZX0 A;  1Z6R A;  5AQP A;  2IIR A;  3N4P A;  3WXM B;  3D2E B;  1JCG A;  3IKM A;  1Y64 A;  2GTD A;  2YJF A;  4BGA A;  1LOT B;  5BPM A;  2Q0U A;  1D4X A;  2WBN A;  1NGH A;  1U2V A;  3Q7B A;  3RSE A;  1QQM A;  4AF1 A;  2D0P A;  4K43 A;  2W41 A;  3M5R A;  5AQW A;  2HST A;  5TKW A;  3I8B A;  3MN5 A;  1BG3 A;  2P9N A;  3R9P A;  4CZG A;  3DXK A;  3KWG A;  3W0L A;  5JLF A;  3ATV A;  1BA1 A;  1K8K B;  4PKI A;  4U67 L;  3MCP A;  3VTI A;  3AAP A;  4FWR A;  1M90 O;  4CI6 A;  1HJO A;  3CJB A;  2A3Z A;  4BR9 A;  2V51 B;  3GOI A;  4Z94 A;  2A6A A;  2P9N B;  3CC7 N;  1QQN A;  5EX5 A;  3IFR A;  4BC3 A;  3G6E N;  4KH4 A;  2HBK A;  2QXL A;  4BRC A;  5M1O A;  3VGK A;  4DQ8 A;  3LM9 A;  2E2Q A;  3UE5 A;  3DJC A;  4B1Z A;  4GVE A;  4ISF A;  4KH6 A;  5AQU A;  3SAG A;  3C0B A;  3CCR N;  4YOY A;  3MK6 A;  3HZ6 A;  4EHT A;  5B8H A;  5JIC A;  1NBW A;  4XH1 A;  1C0F A;  2FF6 A;  1YIJ N;  3HM8 A;  4WF9 L;  4BG9 A;  1YIT N;  5H1S Q;  4JD2 B;  3CXC M;  4I6M A;  1SQK A;  3UKU A;  5F2R A;  5TKY A;  3PIP L;  5M1F A;  2BTF A;  5MLC Q;  3SAF A;  2V7Y A;  3EE9 A;  1DEJ A;  4IEI A;  4BY9 C;  5EOY A;  3RVC A;  3O9R A;  1NGG A;  1X3N A;  3A5O C;  3S41 A;  2NZT A;  3P39 A;  3UB5 A;  4B9Q A;  1IJJ A;  3BF1 A;  4H0O A;  4BRM A;  4FWN A;  5E84 A;  2P9I B;  4JKH A;  1J6Z A;  3CJC A;  5AQT A;  3H45 C;  2KLA A;  3SLC A;  3LM2 A;  3H46 O;  3QDK A;  3O8M A;  4BRL A;  4BR2 A;  3L0Q A;  5C0Y A;  3NVM A;  5BRH A;  4AM6 A;  1BU6 O;  2HBJ A;  4B1X B;  4WYB A;  1P8Z A;  3U8X A;  4JK9 A;  5GIO A;  3LDN A;  5AFU A;  4CZI A;  4WQ4 A;  1SZ2 A;  3CF5 L;  4WQ5 C;  3E9P A;  5AQJ A;  3VET A;  3P38 A;  3LDQ A;  2ZJR L;  4ILG B;  3VGL A;  1X3M A;  2AA4 A;  2UYT A;  3VEW A;  4BC2 A;  4DHY A;  3FFK B;  3K9J A;  3Q7C A;  4IOA L;  4O8K A;  3VF2 A;  3GL1 A;  3O9T A;  3CMA N;  2GEL A;  4RTF D;  5JVG L;  3MX5 A;  1WUA A;  1VQL N;  2F7T A;  5ADX A;  1NWK A;  3FZF A;  1ATS A;  4YOX A;  2W40 A;  3A0I X;  3QIC A;  5F0X A;  2E88 A;  2P9K B;  3ENB A;  2WC9 A;  4JKC A;  1BA0 A;  3EKU A;  4A5B A;  4JKA A;  4A5A A;  5KPZ A;  4E1J A;  2I7P A;  3AAR A;  3H1V X;  5BPN A;  1P90 A;  4IOX A;  2V52 B;  3EN9 A;  2FXU A;  4L3Q A;  4WQ4 C;  4BRF A;  4CZH A;  1Q7Y O;  5AQG A;  2OTJ N;  4CZJ A;  5BN9 A;  2QWO A;  3ULE B;  1GLF O;  5AQH A;  5EY4 A;  3CIP A;  1C0G A;  5AQO A;  4IEE A;  4BR0 A;  3CET A;  4O5F A;  1QZ5 A;  4BGB A;  3ZX2 A;  4ISE A;  1QVF M;  4BRP A;  3D2E A;  1BWF O;  3SJH A;  4GNI A;  5AQQ A;  4IDH A;  5JMV A;  4H0X B;  5F1X A;  3F9M A;  5FPE A;  4BR7 A;  2VCP A;  4IO9 L;  3ZET B;  5EVZ A;  3FZM A;  4ISG A;  4GY2 B;  3A5M C;  5AFU H;  1S3X A;  2PFU A;  1GLE G;  4MLE A;  3SBG A;  3LDO A;  4EFH A;  3QFU A;  3QBX A;  4YOW A;  3GG4 A;  2A40 A;  1NM1 A;  3CJ1 A;  4JNE A;  4O8U A;  4CJ7 A;  2JWL A;  4EAH D;  2YHW A;  2ITM A;  1K8K A;  1WOQ A;  1KAX A;  3C6A A;  3QBW A;  1ATR A;  3L4Q A;  5CE3 A;  3PLA A;  1S22 A;  5AQZ A;  4PKG A;  4CD1 A;  3KWI A;  4H0V B;  2WUS A;  4JAX A;  3O6W A;  2I7N A;  2E8A A;  5ADX H;  3NMU A;  1GLC G;  4MLH A;  4FWO A;  3CPW M;  5AQI A;  2ASO A;  3HI0 A;  3TTF A;  4BC5 A;  1T6C A;  2ZJQ L;  4GV9 A;  3MWP A;  1YHQ N;  5JLH A;  5CHI A;  4H5W A;  3D2F A;  4CZE A;  1NJI O;  3A5N C;  3L4I A;  4UY8 O;  1ZC6 A;  2ZGY A;  3DXM B;  4OPH A;  3EL2 A;  3CI5 A;  4BEC A;  4JD2 A;  3ID8 A;  3OBY A;  2NRW A;  4IWV A;  3O08 A;  4WFA L;  3ENO A;  2HBL A;  1Q81 O;  3D2F B;  3M3Z A;  1Q82 O;  3TSU A;  2D0O A;  4CZM A;  3R3L A;  3D7E O;  1OKJ A;  5AQK A;  1GLD G;  2D4W A;  4RCH A;  5LJV A;  2NRV A;  4BRH A;  1NGD A;  4CBW A;  5AQX A;  2P9P B;  2YHY A;  4NO7 A;  4KH5 A;  3CCQ N;  4JK8 A;  1X9J A;  2W00 A;  2P9I A;  2E1Y A;  3VTH A;  3CJ9 A;  4YOU A;  2NRX A;  3GE1 A;  3CPE A;  4BRD A;  1XUP O;  3MN6 A;  2OTL N;  4BR5 A;  5AQY A;  4Y0W A;  2IVO A;  1YJ9 N;  3U9Z A;  3D6R A;  3H3N O;  4FSV A;  5AQS A;  4BVP A;  3BEX A;  1ZBS A;  3CD6 N;  3VF4 A;  2E2N A;  4A2A A;  1JJ2 M;  3VEN A;  4CZK A;  5BPL A;  4BE7 B;  2VGM A;  3TPQ A;  1V4S A;  4K25 A;  5HL7 L;  1DGK N;  4HWI A;  4A2B A;  1QHA A;  4WFN L;  3N4Q A;  3MX2 A;  4JKD A;  3VEY A;  3CER A;  4IOC L;  1HPM A;  1QQO A;  3LL3 A;  5KPT A;  2Q2R A;  1SAZ A;  3SAH A;  1EQY A;  3G4S N;  3NVK A;  3C65 A;  5E26 A;  4KBO A;  2ASM A;  5FPD A;  1MWK A;  3ATU A;  4JN4 A;  1HKC A;  3C7N B;  3WXJ A;  3WXI A;  5LJW A;  2HBM A;  4FWS A;  1NGJ A;  1YVN A;  1NGB A;  1QZ6 A;  3AGR A;  4NB4 A;  1HX1 A;  3CJ7 A;  3CC4 N;  2F9W A;  1TYQ A;  1VQ5 N;  2C1I A;  5GAE P;  4FWQ A;  5HOO A;  4C23 A;  5M1P A;  4H0T B;  2KKZ A;  4H5V A;  2EWS A;  4FWP A;  2CGK A;  3B8A X;  2RE2 A;  1S72 N;  3E9O A;  5DM7 L;  2P9K A;  1KAZ A;  2QWR A;  4YOT A;  5C12 A;  2ZWH A;  3ZEU A;  5DM6 L;  3BF3 A;  1TYQ B;  3EKS A;  3SBT A;  1KQS M;  4BRQ A;  3R8E A;  3AY9 A;  1GLJ O;  1HLU A;  3MWT A;  2DPN A;  2ZF5 O;  2GX9 A;  4MO5 A;  2AP1 A;  2QWM A;  3AAQ A;  3CCE N;  2Q97 A;  3ZX3 A;  3H3O B;  4C1N I;  3BUZ B;  3ZEU B;  4QS7 A;  3ULE A;  3VPZ A;  4RWT A;  1H1V A;  3VF6 A;  2VYP A;  3OBW A;  3VGM A;  2QW9 A;  3QFP A;  4NLC A;  3T69 A;  4JK7 A;  2E2P A;  3MN9 A;  5KQD A;  2FSN A;  1G99 A;  4PL8 A;  1Q86 O;  1GLL O;  4MO4 A;  4FOI A;  1KC8 O;  3J7Z O;  4BG8 A;  1ILY A;  1KD1 O;  3FZK A;  4BQZ A;  3HSC A;  3ZET A;  2HF3 A;  2FLO A;  4FO0 A;  2RHK A;  4JHD A;  1M1K O;  1VQ6 N;  3CCU N;  5AQM A;  5GAD P;  2CGJ A;  3WQT A;  2E1Z A;  1K73 O;  4FVU A;  1RFQ A;  1JCE A;  5FPM A;  1VQK N;  2HMP A;  2E20 A;  1T6D A;  2P9L B;  3KK7 A;  5BRD A;  2J4R A;  5BRF A;  4BR4 A;  4DKW A;  3WXL A;  3TSP A;  3WEE B;  2CH6 A;  3MMV A;  4JHD B;  3HOT A;  2GWJ A;  2FF3 B;  4M7X A;  1E4F T;  1NGC A;  3O80 A;  4JKG A;  3VOV A;  1ZXO A;  1V4T A;  2P9S B;  4BRE A;  2VWB A;  2H3G X;  3VER A;  4WCE L;  5AZJ A;  3CCM N;  2C1G A;  3I33 A;  5GAH P;  3FZL A;  1T44 A;  3DAW A;  3ENH A;  3U9D A;  2NRR A;  1NGI A;  1RDU A;  2CH5 A;  4BRO A;  1YJW N;  2NRZ A;  1NLV A;  1SS6 A;  2D1K A;  4JKG B;  1LCU A;  3CHW A;  3O5B A;  3R1X A;  4MDB A;  1VQO N;  4QS9 A;  4FPB A;  5AZJ B;  3JXU A;  3DXM A;  3LDP A;  4CBX A;  3I55 N;  2IVN A;  1ATN A;  1BDG A;  2QWP A;  3CQY A;  3CCS N;  1JCF A;  3MDQ A;  3VEV A;  3OHR A;  2Q31 A;  4BRK A;  3CJA A;  5KPR A;  3EE8 A;  5I9E B;  1N8R O;  1VQ4 N;  1T3V A;  3DWL A;  3MCA B;  3SK3 A;  2KHO A;  4CZL A;  3FGU A;  4H0Y B;  5AQF A;  4EHU A;  3F2K A;  4PKH A;  4F9O A;  3DLL L;  2HF4 A;  3WT0 A;  2P9P A;  1MWM A;  2QWN A;  4FOE A;  4C1N K;  2BH1 A;  2QI2 A;  2PAV A;  2YJE A;  2GEM A;  3O1B A;  1IG8 A;  3WQU A;  3I56 N;  4JKB A;  1MA9 B;  4JKF A;  3KZB A;  5AQL A;  4CZF A;  1U2V B;  3RSE B;  3O9Q A;  4K42 A;  4A61 A;  2F9T A;  4DB3 A;  2QWL A;  4M63 C;  1GLB G;  1O13 A;  4H03 B;  4H0P A;  1BOT O;  4LC9 B;  3CCJ N;  3VEZ A;  3LDL A;  1NMD A;  3DXK B;  5AQR A;  5GIP A;  1VQN N;  3GBT A;  4A59 A;  1EO1 A;  2A41 A;  1KXP A;  5EXW A;  5GIN A;  2ASP A;  4AM7 A;  3E1Y A;  4H5R A;  3ZYY X;  5BRE A;  5AR0 A;  3IDH A;  4MDA A;  3FE1 A;  2FSK A;  4YDU A;  4BRA A;  1YJN N;  1HUX A;  1BUP A;  3E9L A;  2YI1 A;  3QB0 A;  5AQN A;  4B1Y B;  3HOS A;  1Q18 A;  3HRG A;  2NRT A;  3TSQ A;  1VQ8 N;  2Q0R A;  3C7N A;  1VQP N;  5GAG P;  4XEI A;  4H5N A;  3MN7 A;  1VAZ A;  1XC3 A;  1YF5 L;  3ID6 A;  3TTD A;  2BUP A;  2NNW A;  4XH4 A;  3SMS A;  1NGA A;  2VGN A;  1MDU B;  1OVY A;  4IO8 A;  3U4L A;  5KQ8 A;  4B1V A;  4WQ5 A;  1YUW A;  3OW2 M;  2PBD A;  3F5T A;  4M7Y A;  3CCL N;  2OAN A;  4HTL A;  2CGL A;  2FSJ A;  4IFE A;  5CR4 A;  5AZI A;  3O4W A;  1CZA N;  4I6M B;  1YXQ A;  3UKU B;  1RDW X;  1VQ7 N;  1YI2 N;  3O1W A;  4PL7 A;  4BEB A;  3P4I A;  2JWK A;  3A5L C;  3FR0 A;  3IUC A;  2A42 A;  5AQV A;  4BRI A;  3W3D A;  3O9S A;  2QTD A;  4BRN A;  5LY3 A;  5C15 A;  4YDU C;  5AZI B;  4FPA A;  1XQS C;  2GWK A;  2V7Z A;  3M6G A;  1GLA G;  3SMP A;  4BQL A;  4GV6 A;  5BR9 A;  5ELZ A;  5M1N A;  3R6M A;  1E4G T;  5JVH L;  3CQX A;  3VEX A;  3FLC O;  2ZGZ A;  5C2D A;  4PHT X;  4IXC A;  4BRG A;  1TUY A;  5BN8 A;  3CME N;  3TTC A;  3QML A;  1HKG A;  3E66 A;  3O9U A;  5M1K A;  2NRH A;  3JS6 A;  1W97 L;  1NGE A;  2A5X A;  4BVO A;  2P9U A;  4IZ9 A;  4WFB L;  3A8Y A;  1DT9 A;  1ESV A;  1HKB A;  2P9L A;  4XJX A;  4YOV A;  2QA4 N;  3OA9 A;  2QEX N;  4A57 A;  3KHY A;  3HBT A;  3WEE A;  1K8A O;  4DCH A;  4QS8 A;  1QVG M;  4OO1 J;  1TUU A;  3VMF B;  2P9U B;  3BP8 A;  2YX6 A;  2Q36 A;  3WXK A;  1NGF A;  1U6Z A;  3AGK A;  1KAY A;  2P9S A;  4EIA A;  4IJN A;  3P31 A;  4R79 A;  3G71 N;  3M1F A;  3EO3 A;  4YOR A;  2ZJP L;  4JKE A;  3CCV N;  3G25 A;  4FWM A;  3H1Q A;  5C10 A;  1BO5 O;  4J8F A;  1Z05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...