1K8KB

Crystal structure of arp2/3 complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
190
structure length
190
Chain Sequence
GVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Arp2/3 Complex
pubmed doi rcsb
molecule tags Structural protein
molecule keywords ACTIN-LIKE PROTEIN 3
total genus 51
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1k8kB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1k8kB02
2KHOA 1H1VA 4BROA 2E8AA 3D2FA 3MN6A 4FPAA 4CZMA 4FWPA 3L4IA 3M3ZA 5TKYA 4BR2A 3FR0A 3QFPA 4M7YA 4K43A 3EO3A 3R9PA 3UKUA 4M63C 3EKUA 1NGCA 4BRLA 1X9JA 3GL1A 3M1FA 5AZJA 2I7NA 3MDQA 1QQMA 4CZGA 4DB3A 1NMDA 4J8FA 2FLOA 5BR9A 3BF1A 3UB5A 1BU6O 3KVGA 2P9IA 5ADXH 4B1WB 1RGIA 2J4RA 3VEOA 3UE5A 2YHWA 1DEJA 4WQ5C 3ZEUB 1GLLO 1E4FT 3IDHA 5CE3A 2W41A 5ADXA 3CIPA 4A62A 2W40A 3VEVA 4BRMA 4BR0A 5BREA 3FZHA 3QBWA 1YUWA 4B1XB 4IJAA 5AQVA 3IFRA 2BUPA 1RDWX 1JCEA 2QW9A 3HTVA 4IJNA 3VF6A 4Y0WA 1QZ6A 3A5NC 4H0TB 4H0VB 3DJCA 3ZX3A 2V51B 1NGHA 1T6CA 2UYTA 1MWMA 5AQKA 3I33A 4H0OA 2QWRA 1BOTO 2GEMA 5FPNA 4NB4A 1KAYA 1TUYA 3FZKA 3VGKA 4IWVA 3ZETB 2FF3B 3LDQA 4LC9B 4IZ9A 1GLEG 1V4SA 4A2AA 2P9KA 3QBXA 4HTLA 2Q0UA 4I6MA 5AFUA 4JD2B 2FSJA 3ZETA 3CJAA 3GOIA 2ZF5O 2P9NB 1SZ2A 2I7PA 3DWLA 1MDUB 3VF4A 3UKRA 2A5XA 4CBWA 4BR5A 2E2PA 1ZBSA 1HPMA 3VETA 3WXJA 4CZKA 3C7NB 2E2OA 3CJCA 1BA1A 5BN9A 4XH5A 4H0YB 4B1YB 4BC5A 5F1XA 3FLCO 3H3OB 4BG8A 4CZIA 4FOEA 3ZX2A 5JLFA 1GLCG 5AQUA 3C0BA 5BRDA 5JICA 3A0IX 2YJFA 4FO0A 2CH5A 1U2VA 3BEXA 3MK6A 4GNIA 1Z05A 2QWLA 5E84A 1OKJA 5KPZA 3ATVA 2P9KB 4H0XB 4QS8A 3QMLA 1ATRA 2F9WA 1LCUA 3VPZA 3D2EB 4XEIA 3WEEB 2E2NA 5AQPA 3IUCA 5AZJB 4BRFA 2YHXA 1Y64A 4AM6A 4IO8A 2P9LB 2E20A 3EZWA 3I8BA 1EQYA 3FFKB 1BUPA 4ISFA 5JMVA 2Q31A 2QWMA 3HBTA 1XQSC 1D4XA 5F2RA 4B1VA 3EKSA 5AQSA 2Q97A 3A8YA 4H03B 1BWFO 1KAXA 4BC3A 1X3NA 1YXQA 5AQFA 5B8HA 2GWKA 3A5LC 2E2QA 1X3MA 4F9OA 1SAZA 3CQXA 5AQOA 3SK3A 3DXKA 1ZC6A 4K25A 4K42A 4B1ZA 1U2VB 3R6MA 4BRPA 5BPNA 2GTDA 1NGBA 5FPDA 2P9LA 5EY4A 4H5NA 1NGAA 2HOEA 1S22A 3CHWA 1WOQA 3G25A 4JHDA 4BRDA 4EIAA 3H46O 3QDKA 2P9PA 1GLBG 2ZGZA 2QM1A 3EN9A 5LY3A 4FWMA 1R59O 4PL7A 3VENA 5AZIA 2P9SB 1ATSA 3ATUA 1BG3A 3H3NO 3LM9A 4EHUA 1SQKA 1K8KB 3D2FB 5KPRA 4BGBA 2IVOA 3CETA 3RSEA 5EXWA 5AQIA 3MMVA 4YDUC 4BC2A 2Q1NA 1GLDG 4K41A 4MLEA 4GY2B 2P9UB 3CERA 4RCHA 3VEXA 4CZHA 1P8ZA 2ZGYA 1KAZA 2CGLA 3TPQA 4FPBA 2P9UA 1NGIA 4PL8A 4M7XA 4MO4A 4BGAA 1Q18A 1TYQB 3F9MA 4BQLA 4A61A 3FZMA 1NGJA 4FWSA 5EX5A 4EHTA 1TUUA 3GE1A 3LDLA 3O08A 2V52B 3SLCA 3KZBA 4WYBA 5BN8A 3VEZA 1GLFO 2D0PA 3GBTA 3C7NA 4BVOA 2VWBA 4FWLA 2EWSA 3L6QA 4BVPA 1QQNA 3M6GA 2OANA 2NRHA 1WUAA 2D4WA 4H5TA 5EOYA 1TYQA 1BA0A 3HSCA 3WEEA 3DXMB 2Q0RA 2FXUA 3FZLA 2YHYA 2V7YA 3VGMA 1V4TA 2HMPA 4BR4A 2V7ZA 1NLVA 3FGUA 4FWKA 4H5VA 2VCPA 2WUSA 4Z94A 4EFHA 3IMXA 2E1YA 1GLJO 2PBDA 1QQOA 1Z6RA 3CQYA 5AQTA 1NGFA 2P9PB 3UKUB 1HKBA 3R8EA 2QWNA 5AQZA 1ESVA 1IJJA 5BRFA 3A5MC 2FSNA 4E1JA 2FF6A 3O4WA 4EAHD 4BRKA 4PKIA 2QWQA 2ITMA 3WUHA 3QB0A 2P9SA 4CZLA 4BRQA 4DQ8A 3AARA 3W3DA 4A2BA 3AAPA 1LOTB 4BRIA 4PKHA 4CI6A 3GDQA 4I6MB 2AP1A 3ULEB 2A41A 2HF4A 5KQ8A 2CGJA 4ISEA 3FE1A 1J6ZA 3HI0A 5BRHA 3CJBA 4H5RA 2Q2RA 3HM8A 3WQUA 2E88A 2P9IB 3VGLA 2GWJA 5ELZA 4FSVA 4H5WA 2IVNA 2P9NA 1C0GA 1T44A 3O5BA 1MWKA 3CI5A 4YDUA 3U9DA 3WXLA 4B1UB 4FWOA 5AQXA 3GG4A 3W0LA 3O8MA 4BC4A 3WQTA 2YCHA 4JN4A 1HLUA 4CD3A 3B8AX 5E26A 3S41A 4CJ7A 3QFUA 3AAQA 4RTFD 4L3QA 3H45C 1GLAG 2YJEA 3D7EO 3LM2A 4H0PA 2F9TA 3H6EA 3D2EA 4MO5A 4BRGA 4BR7A 4CZEA 4DCHA 2A40A 3LDNA 4WQ4C 1ZXOA 4JD2A 3MCPA 3U4LA 3TU5A 4IXCA 2BTFA 2CH6A 4FOIA 3JS6A 5AQGA 2GELA 1C0FA 3A5OC 5BPLA 3ULEA 4QS9A 2FSKA 1HJOA 4CBXA 1S3XA 4WQ5A 2AA4A 3VEWA 3SMPA 3VEYA 2HF3A 3EL2A 3AY9A 4JHDB 5FPMA 5F0XA 3ZEUA 4BRNA 5AQYA 2ZWHA 3WXKA 4BG9A 3DXMA 1G99A 4BQZA 1HUXA 5AZIB 3JXUA 2H3GX 4NO7A 4XH1A 5AQRA 3WT0A 4CD1A 4BRAA 4RWTA 1RFQA 3HZ6A 3MN5A 5BPMA 5JLHA 5AQWA 2IVPA 4FWRA 5KPTA 5I9EB 4B9QA 5AQHA 1YAGA 5AR0A 5EVZA 1HKGA 1NGEA 5LJWA 1ATNA 1NGDA 1MA9B 3CJ7A 3LL3A 2ASPA 2A42A 1NGGA 3SMSA 1BDGA 2DPNA 4PKGA 3BP8A 3O1BA 2YI1A 3O1WA 3SJHA 4ISGA 2IIRA 4O5FA 2NLXA 3OHRA 2ASMA 1CZAN 5AQJA 1IG8A 2QWOA 5AQLA 3BF3A 2D1KA 3VOVA 5AQMA 3O80A 4BRHA 1NM1A 4JAXA 3RSEB 3P4IA 4QS7A 3U8XA 1JCGA 4FL9A 2D0OA 3O6WA 4BRCA 2A3ZA 3CJ1A 1QHAA 5FPEA 3J8AA 2VYPA 1JCFA 1T6DA 4AM7A 4FWNA 1YVNA 5AQNA 3LDOA 3MN9A 4KBOA 1DKGD 2E1ZA 2NZTA 4HWIA 4JNEA 1DGKN 3ENOA 2QWPA 1K8KA 4MLHA 3VESA 3KHYA 1XUPO 3H1VX 2A6AA 1HKCA 4BREA 4BR9A 3U9ZA 2Q36A 2QXLA 3UKRB 1HX1A 3CJ9A 4DHYA 2CGKA 3H1QA 3ZX0A 3LDPA 3FZFA 3DAWA 3VF2A 2GUPA 1NWKA 4CZFA 4FWQA 1BO5O 1KXPA 1U6ZA 3L0QA 4O8KA 3MN7A 3BUZB 1E4GT 3ID8A 2ASOA 3ENHA 4CBUA 3WXIA 5AFUH 4WQ4A 4XH4A 3DXKB 5AQQA 3QICA 3VERA 4CZJA 5LJVA 1XC3A 4C23A 5KQDA 2PAVA 1QZ5A 1NBWA
chains in the Genus database with same CATH superfamily
4BE0A 4IOAL 4ILHA 1S9EA 4C8MA 4CGHA 1P90A 4BR2A 2VG7A 2NRZA 3HOSA 3RRHA 3FR0A 3QFPA 4CFBA 4IDHA 3R1XA 1IKYA 1X9JA 3GL1A 4E7KA 2I7NA 4CJSA 4CZGA 2XY7A 4BWMA 2FLOA 3G0ZA 2ZJPL 3BF1A 1XC9A 3OYDA 4E72A 1KQSM 3UB5A 3AO2A 3CMEN 4QOZB 2PY5A 1YTUA 4NCBA 4LF4K 4NLCA 1HQEA 3D0PA 4Z4EA 3KLEA 5CE3A 2W41A 3BGRA 3CIPA 4RG8A 2KFZA 3VEVA 4DTXA 3V9UA 3TAGA 5BREA 5AJ3K 3P1GA 4OPHA 4OPAA 4B1XB 5AQVA 4Z4CA 3L2UA 2XY6A 4CK3A 3F9KA 1JCEA 4GV3A 1U47A 1S1TA 1SL0A 3A5NC 3VQDA 1NGHA 1T6CA 1JLAA 4FM1A 5M1NA 4H0OA 2QWRA 3PO5A 4CIEA 1BOTO 2HBMA 3FZKA 3ID6A 3V9WA 3SUPA 5KRTA 1ZBIA 2FF3B 2KLAA 4IZ9A 4LC9B 1V4SA 3J81O 1UWBA 3QBXA 2VQEK 4DWIA 3HYFA 4HTLA 4JD2B 1TKXA 1XNQK 1NU0A 3L2WA 4JI8K 2XO7A 3AVLA 3VF4A 1NJXA 3NCIA 3F5TA 4FJLA 3NVKA 1HPMA 3VETA 1LW0A 3ZSRA 3OYAA 3OYGA 2RF2A 4Y1DA 4KTZA 5BN9A 1HRHA 2E5LK 3BY5A 4OPJA 4BC5A 4DTNA 3FLCO 4AHRA 4FJGA 4CEQA 1FKPA 2HNDA 3JSMA 5BRDA 4CJVA 4JKDA 4O4GA 4OKKA 4F2SA 1W97L 1TKTA 4GNIA 1OKJA 5KPZA 1QVGM 3OA9A 5MLCQ 2P9KB 2GUIA 4H0XB 1KFSA 1LCUA 3VPZA 3E9LA 2GX9A 1UA0A 4CFAA 2Q3SA 4FW2A 2KTQA 4YY3K 5C10A 2FBXA 1EQYA 5JMVA 1RT3A 2QXFA 1XQSC 3NH1A 2PZSA 5AQSA 3LAMA 3T1HK 1GOAA 1VQPN 4H03B 1U48A 3CD6N 1VSLA 1JXEA 3CXCM 3TARA 1KFDA 4FLZA 1MU2A 4AHVA 1SAZA 3CQXA 1JLBA 5AQOA 3SK3A 4CEOA 2HB5A 4LH4A 3MXMA 1U2VB 1F21A 1NGBA 5EY4A 1HYZA 4M3YA 4H5NA 3SZ2A 4JHDA 4FJKA 1RT4A 4MDAA 1OVYA 1XWLA 3HRGA 1VAZA 3OYKA 1TAUA 1ZBUA 1XNRK 1DT9A 5M1KA 1BGXT 4DU1A 1ATSA 3U3YA 3LM9A 4FCYA 4EHUA 4F8RA 1K8KB 4XJXA 3KJVA 1REVA 4CHNA 4YOVA 3QNOA 1WAJA 4YDUC 1GLDG 3K59A 1R0AA 2PYJA 1WSHA 4FXDA 4ICLA 2B6AA 1HYVA 1Q7YO 1OH7A 1E3MA 1NGIA 4PL8A 1Q18A 4JEPA 4AQYK 4DSLA 3SUOA 4WYBA 2G8HA 4B8AB 3BDPA 4X62K 2NNWA 4Z4IA 4WF9L 4BVOA 2OCEA 4FWLA 3CCVN 1C0TA 3ZSYA 1IKVA 2ZM6K 3AVBA 2Z1JA 4E1MA 3M6GA 2OANA 1JLCA 5EOYA 4UY8O 1BA0A 4O5BA 3ENBA 3KK2A 2Q0RA 1WNSA 2FXUA 4LY7A 4NLBA 4M41A 1YJNN 3IG1A 1Q86O 1V4TA 5M1PA 3SQ1A 1EX4A 2P5OA 3FGUA 3OJUA 4A5BA 2OZMA 2KZMA 3IRXA 4Z94A 3IMXA 2E1YA 5AQTA 3CQYA 4DQPA 1ASWA 3CCLN 4TSXA 4ELTA 5AQZA 1IJJA 4JKGA 4E1JA 2UXDK 4C8KA 2QWQA 2ITMA 1L3TA 4CZLA 4LFBK 2O8FB 3TAMA 3AARA 1LOTB 1RDDA 3ULEB 2YNIA 3NE6A 1VQ9N 2A41A 2G8VA 4B9VA 5KQ8A 5CHIA 1OVQA 3FE1A 1JXBA 2IOCA 4CJ5A 4DF4A 4CHPA 3QEPA 2E88A 4IFYA 3OYHA 1BL3A 2QTDA 2W6LA 4FSVA 4H5WA 4OO1J 4I2QA 2IVNA 3P31A 3LDSA 3J7ZO 2P9NA 1NG9A 3O3GA 4QCLA 1KTQA 3QIPA 1C0GA 4YDUA 1MWKA 3OYMA 4RW9A 3CG7A 3T19A 5SZTA 4FWOA 2WBNA 3W0LA 4BE7B 3C95A 4IKFA 4KHPK 1DTTA 2UUBK 1S9GA 3RVCA 3TI0A 2O8EB 1GLAG 3HPOA 2HHXA 4H0PA 4BRGA 4WQ4C 4JD2A 3N4PA 3PLAA 1EWQA 3U4LA 4CF1A 2BANA 2B5JA 2HHVA 2P51A 3CCSN 3JS6A 1I94K 2XHBA 4DV0K 3PV8A 3PX0A 2FBYA 1C0FA 3T69A 3A5OC 5JVHL 1N33K 3THXB 3RMDA 1RBTA 3VEWA 2HF3A 4DSKA 4JHDB 3CCQN 1VSEA 4DTUA 1TL1A 1O1WA 3ZT2A 4DKWA 5AZIB 3AO3A 4GVEA 4C8OA 3VQ7A 3TSUA 1RFQA 3HK2A 3MN5A 5BPMA 3KK1A 4IO9L 1U49A 1RCHA 4N41A 2UUAK 4UQGA 1YAGA 5EVZA 1ZBLA 1WSEA 4NYFA 4HTUA 3PSIA 3S9HA 1MA9B 1KCFA 3LL3A 3K58A 4OPKA 4JYAK 2GV9A 4CGGA 2VGMA 3O1BA 1N32K 1CXUA 4Y1CA 4ILGB 5M1FA 2IIRA 4O5FA 4CESA 2NLXA 3DOKA 5AQLA 3LWMA 1JLEA 3PY8A 5LL6Z 2UUCK 4JAXA 3VQ9A 2HHSA 3P4IA 3PIOL 1K6YA 4B9TA 4B3OA 1ZYQA 4C1NK 3J8AA 4KH4A 1JCFA 1T6DA 4DSIA 4DU4A 3CM5A 3DLBA 2QKBA 4I2PA 2E6LA 4B9UA 5AQNA 4KBOA 1DKGD 5CZ2A 2NZTA 4HWIA 1IV0A 1TK5A 4O8UA 1DGKN 3MX2A 3VESA 1DLOA 2O8BB 4JI6K 4BREA 1FJGK 2WOMA 5C2FA 4Z4HA 2CGKA 3H1QA 2BGGA 3THWA 3QERA 2GUPA 4CZFA 3MAQA 4O8KA 3KLGA 2ZJQL 3ZYYX 3ID8A 2EHGA 4XH4A 1CZBA 3VERA 5D3GA 4HHTA 4CEAA 4AF1A 1QZ5A 3AO1A 2KHOA 2W42A 4JI3K 1A5WA 4KB1A 4BROA 4FPAA 4CZMA 4F3TA 3M3ZA 4CJKA 5HOOA 3PUFA 1RT2A 3KWGA 4M7YA 3LP1A 1BIZA 3EO3A 1KVCA 3R9PA 3UKUA 2DFHA 5K14A 2DFFA 1EXQA 5C25A 3M1FA 2NRTA 1EKEA 3MDQA 1QQMA 4DR5K 1Q81O 4JI2K 2HBLA 4LF6K 2NUBA 4MDBA 5ADXH 4K0KK 4B1WB 1RGIA 3VEOA 2D0CA 1D8YA 2RPIA 3ZEUB 1GLLO 1E4FT 3IDHA 3VQAA 3NGZA 5IWAK 4BR0A 1HNWK 2OTJN 4GMJB 5DM6L 2WTUA 4IJAA 1WBBA 1RDWX 3HTVA 4AHCA 1NNEA 4Y0WA 3C6AA 3E9OA 3DJCA 4FJHA 5CYMA 1N8RO 3AVAA 4KPYA 4F4KA 1MWMA 1HYSA 3LWLA 1K9MO 2G8WA 3QEXA 3LP0A 5FPNA 3O9TA 4CERA 1KAYA 4YFUA 4WFBL 2JWLA 1TAQA 5I42A 2VG5A 4I6MA 5AFUA 4ELUA 3KWIA 5HRSA 4PA1A 1EETA 3OVNA 4FZZA 1KLNA 3DLEA 4A57A 3THVA 4BE1A 5T7BA 3OJSA 4DTJA 3WXJA 5EU7A 4XH5A 4H0YB 4B1YB 5F1XA 4DG1A 3H3OB 4BG8A 2HVHA 4FOEA 3TSPA 3MCAB 4HUFA 1GLCG 5AQUA 4GW6A 3ITHA 3E01A 1Z05A 2QWLA 3ATVA 5C12A 4QS8A 3ZT1A 5I3UA 1M1KO 3CFOA 3IUCA 4BRFA 1WBDA 2P9LB 2E20A 4X64K 3FFKB 4ISFA 2HHTA 5FRMA 4BDZA 3MEEA 1D4XA 3E1YA 3L2VA 4DV4K 2Z1IA 4OGCA 4LFCK 1BWFO 4BC3A 5E41A 3AA5X 1X3NA 5AQFA 5B8HA 2OTLN 3WXMB 1X3MA 4FK0A 1JL2A 3DXKA 5J2QA 3R6MA 4BRPA 3P83D 2YNFA 3O9QA 2P9LA 3S3NA 4FLWA 4DQRA 1S22A 3FFIA 3QDKA 1GLBG 2ZGZA 4CEDA 3I0SA 5LY3A 2HHWA 2F96A 1TK8A 3O3FA 1VSMA 3VENA 5AZIA 4NCGA 2P9SB 3ATUA 3H3NO 2GBZA 1W9HA 3D2FB 3TWHA 2IVOA 1BI4A 4X66K 1NK8A 4L8RB 5EXWA 1S5JA 2G8UA 4ZHRA 4BC2A 1QTMA 1VQLN 2X78A 2VWJA 4LFAK 4CE9A 3RMAA 1BQMA 4GY2B 3DYAA 2P9UB 4RCHA 2OPSA 4OX9K 1LWFA 3TPQA 4CEFA 4FPBA 2P9UA 4GV6A 4LF5K 3MXJA 2G8FA 1WSIA 1VHXA 1BI4B 4DR2K 4JKCA 4Z4GA 3U3GA 2YHBA 4FWSA 1YHQN 2UU9K 4EHTA 1KVAA 1U45A 3LDLA 5GADP 3THYA 1LWCA 3UIQA 1GLFO 4WCEL 3C7NA 1J5EK 1U04A 2OZSA 3CFPA 3HJFA 4CHYA 3L6QA 3V1QA 1QQNA 3DRSA 1C0MA 2D4WA 1I3AA 3MECA 3MXIA 1D5AA 3SCXA 3JAMO 2YHYA 3VGMA 4C8LA 2F8TA 2WC9A 1NKEA 1NLVA 1D9DA 1GLJO 3M5RA 5HLFA 2YNGA 3VQEA 1HNVA 3WNFA 1N34K 1NGFA 3UKUB 1HKBA 1ESVA 1Y97A 5BRFA 4U7BA 3A5MC 2FSNA 3O4WA 4BRKA 4EZ6A 3SUQA 4OLBA 4BE2A 4IEEA 2P9SA 3OS0A 2OA8A 3AA2A 3AAPA 3EY1A 4BRIA 1NJIO 3GDQA 3VQ4A 3EE8A 4CGFA 4YOXA 3G10A 3S5TA 4B9NA 3KKRA 3ZT0A 1KRPA 2HVIA 1VQMN 3D6RA 5KTQA 4AHTA 4RW7A 3DI6A 2O8CB 2P9IB 3K9KA 1C1BA 4F2RA 2GWJA 5ELZA 5JS1A 4DUZK 2QEXN 4CJEA 2I5JA 3TSQA 2ZE2A 3LZIA 3CI5A 3WXLA 3U9DA 4HCCA 4B1UB 4WE1A 3CC2N 4B9MA 4BC4A 2YCHA 4GKKK 3VQ5A 4YOUA 3DLGA 4CIGA 4NYNA 3ZSQA 4L3QA 3H45C 4LH5A 5BR8K 2OYQA 4MO5A 4BR7A 4DCHA 2P1JA 3LDNA 1ZXOA 3MCPA 3C6TA 3NGYA 3TABA 1LV5A 2B4JA 4H4OA 2BTFA 1WSFA 4FOIA 1BCOA 1L3UA 3OYBA 4FJ9A 1HQUA 1I39A 3ULEA 3KTQA 3DLRA 4CBXA 5M1QA 3A2FA 5GAHP 3SMPA 1IKWA 3EL2A 3SQ0A 3AV9A 4JV5K 4FM2A 3HP6A 4CEZA 3ULDA 5JVGL 1VSIA 1QE1A 3WXKA 4FJXA 3ISNC 4JI7K 4DFJA 4KREA 2KZZA 2H3GX 3WT0A 3PO4A 4I7FA 4IEIA 1YVUA 5KPTA 5GIPA 1S6QA 4FVUA 5HRNA 2C1GA 1HKGA 2G8IA 3N4QA 3QIOA 1ZBHA 1WSJA 3OS1A 4DQSA 1ATNA 1NGDA 3CJ7A 3P38A 1NKCA 2A42A 3SMSA 1BDGA 2QI2A 2DPNA 3K5NA 5A2QO 4ISGA 2YV0X 4JLHA 4G1QA 2UXCK 4CHZA 2Y1IA 2ASMA 4RW4A 5AQJA 3BF3A 3VOVA 3O80A 3ZT3A 4BRHA 1S1XA 5C24A 1SKWA 4FLUA 3T1YK 4FL9A 1RILA 1YI2N 4CJQA 2LSNA 2A3ZA 1QHAA 5FPEA 2VYPA 1LW2A 4V19S 1K73O 5HL7L 1UA1A 1T03A 4DQIA 2HBKA 2QA4N 1FXXA 2O8DB 1ITGA 4JNEA 4BWJA 1W2BM 4IFVA 1VSDA 2QWPA 4MLHA 1HMVA 2JWKA 1XUPO 3H1VX 4M45A 3IKMA 3KHYA 3M8RA 3HPHA 4ELVA 3TTDA 1HKCA 4JI4K 1RT5A 4JKBA 2Q36A 4U67L 3CJ9A 3DLHA 4DHYA 3ZX0A 3LDPA 3DAWA 3EZ5A 2JGUA 3VF2A 4YORA 3NGIA 4FWQA 3LAKA 3ZSOA 4FVMA 3T3FA 3MN7A 1JLGA 1NJYA 4CVNE 1RDUA 2O8FA 1E4GT 4CBUA 3WXIA 2HSTA 4CF0A 1OH6A 1RTJA 3QEIA 4HCBA 4B9SA 5AQQA 1XHZA 3QICA 4CZJA 5KI6A 3LPUA 5LJVA 1VSFA 1XC3A 4RW6A 5GIOA 1NBWA 1Q9YA 3VN5A 5J2PA 3P5JA 4R79A 2E8AA 3D2FA 4KHUA 3MN6A 3CCUN 3L4IA 5TKYA 1VSJA 4KTWA 2A1SA 1LAWA 4K43A 3NVMA 4CK1A 2NRVA 4M63C 3EKUA 1NGCA 5DMRA 4A59A 2BH1A 1VQKN 3J7YP 4DB3A 1LWEA 1NMDA 4J8FA 5GAGP 1UOCA 1VSKA 3E9PA 4YOTA 1BU6O 3KVGA 2IAJA 4IOXA 2P9IA 4M3XA 2IS3A 2JLEA 3UE5A 1DEJA 1YITN 1YIJN 1C1CA 4CGIA 3B6OA 1KD1O 3AVCA 4A62A 2W40A 3VA3A 4BRMA 5JENA 1X9WA 3JYTA 3FZHA 1QSLA 5FRNA 1QHTA 3K5MA 4DLGA 1WAFA 1N36K 4KTQA 3R3LA 4FJ7A 4IJNA 3THXA 1L3SA 3KLIA 3HL8A 4H0VB 3O4NA 4B3MK 3CCEN 3AVIA 3ZX3A 2V51B 2FBVA 3NFAA 2UYTA 2QKKA 5AQKA 3DRRA 3RMBA 2YHAA 2GEMA 4KHSA 3CF5L 5KGWA 2BE2A 4NB4A 1XMQK 1TUYA 3VGKA 2YX6A 3LDQA 1GLEG 4A2AA 3KK7A 4PHTX 3CJAA 5HP1A 3GOIA 3RTVA 1SZ2A 2HHUA 3K9JA 3DWLA 1OH5A 2XY8A 2A5XA 3HVRA 4CBWA 4CJUA 4DFKA 2E2PA 1A5XA 1ZBSA 3LPTA 1SL1A 1NJWA 4BEBA 2O8CA 4IBNA 3AVNA 1S1VA 4CJRA 5GINA 3MEDA 3PX4A 5HBMA 4JKFA 4CZIA 4KI6A 4CK2A 1XMOK 3I56N 3V1RA 1TGOA 1A5VA 3C0BA 3A0IX 4M3WA 2YJFA 1U2VA 3BEXA 3TAFA 3HPGA 4DTOA 3QMLA 1ATRA 4LD0A 2F9WA 3SQ2A 4XEIA 2UXBK 1FK9A 2HHQA 2E2NA 4O0IA 4KHNA 5AZJB 3DMJA 3SYZA 2YHXA 1Y64A 4EP5A 4MFBA 3SPZA 1HJRA 3EZWA 3OYCA 3I8BA 3VTHA 2A1RA 3L2QA 2Q31A 3F2KA 5F2RA 3SAFA 3ZSZA 2QK9A 4KH6A 4KHYA 2Q97A 3C6HA 3HM9A 2KQ2A 2GWKA 1C6VA 2E2QA 4F9OA 2O4IA 4IG0A 4XIUA 4DQQA 3L3VA 4K25A 4K42A 4B1ZA 4CJTA 2YKNA 1FW6A 4JK9A 5BPNA 2GTDA 3SJJA 1TK0A 1OH8A 1NGAA 4B3TK 3G25A 3CHWA 1WOQA 4BRDA 4EP4A 4EIAA 3H46O 2VG6A 3L4QA 4CW7B 3EN9A 4F3OA 1RT1A 1R59O 1RBVA 3LZJA 4KFBA 4PL7A 3OS2A 4QAGA 1NKBA 5J1EA 2PYLA 4LF8K 4DV5K 2OPQA 1BG3A 1Z25A 1S1WA 3EEQA 1IBLK 2IDOA 5KPRA 3S3OA 4BGBA 3OBYA 3VQPA 5AQIA 2O8EA 2Q1NA 1VQ5N 3T7ZA 4R5PA 4K41A 1Q9XA 1IG9A 4DR4K 4JK7A 3VQCA 3I0RA 3SQ4A 3CERA 1JL1A 1P8ZA 1KAZA 4CIFA 4CCHA 4B9LA 4MO4A 1KC8O 4DFMA 1FKOA 1TYQB 3AGRA 3V81A 4YHHK 4BY9C 4BQLA 3S3MA 3FZMA 4PWDA 3CCJN 1NGJA 3NDKA 3VA0A 2KW4A 1TUUA 3AVKA 4G9ZA 1RTHA 3GE1A 1JKHA 2V52B 3SLCA 4AILC 2VGNA 5BN8A 3VEZA 4PQUA 3O9RA 4BDYA 4CHQA 3GBTA 1C0UA 4AH9A 1X1PA 3J7AP 4FLXA 5J2NA 4Z0UA 4FLTA 3OBWA 4BVPA 3K5LA 3QNNA 3KK3A 1WUAA 4H5TA 1TYQA 3WEEA 3MWTA 4GKJK 3QESA 1IH7A 3WNEA 2V7YA 3HP9A 3KD1E 4KB0A 2V7ZA 4B3SK 1YTAA 4FWKA 4H5VA 3V9XA 2VCPA 2WUSA 2NRRA 1SV5A 4EFHA 2PBDA 1XI1A 4CJPA 3ALYA 1EP4A 1Q82O 3QETA 3L3UA 1S72N 2FF6A 2Y1JA 3TTCA 3VQ8A 3KD5E 4PKIA 5KRSA 4ZTJA 5TKWA 5FLXO 4O44A 4BRQA 4A2BA 3NF6A 3AVGA 4PKHA 4CI6A 3TAPA 2AP1A 1J54A 3BZKA 4DV2K 3O4QA 4YOYA 3BZCA 2CGJA 3CCRN 5LMUK 4ISEA 2FBTA 2O8BA 4H4MA 4CECA 1J6ZA 3HI0A 4CHOA 5BRHA 3THYB 4H5RA 2Q2RA 3CCMN 3HM8A 3SV4A 4DF8A 1YF5L 4J2DA 3VGLA 3PIPL 3NMUA 4N56A 4DSFA 2ATQA 1BISA 3O5BA 1TKZA 1W0HA 3WNHA 3OYIA 1NOZA 1RT6A 3I55N 5AQXA 4WFNL 3GG4A 5CZ1A 5KGXA 4GV9A 2P5GA 1HLUA 4E7HA 4CD3A 3ZCMA 3B8AX 4MQ3A 3THWB 3QFUA 4RTFD 4CF9A 1TVRA 2YJEA 5H1SQ 3V4IA 4GVMA 2X6SA 1XHXA 2F9TA 4CJ3A 3D2EA 4CZEA 2VWKA 5GAEP 3TU5A 4OJRA 1NK5A 4CGJA 2CH6A 4DTMA 4FJIA 4J2EA 5AQGA 1LAVA 5J2MA 5BPLA 3SUNA 4OGEA 2AA4A 3C6UA 3AY9A 1X9SA 3ZSVA 3CMAN 5FPMA 3ZEUA 4BRNA 4NXNK 5AQYA 2E6MA 4BG9A 4FYDA 3RR7A 3DXMA 1G99A 4FJNA 4DLEA 4BQZA 1BQNA 1T05A 4BDPA 4XH1A 5AQRA 4E3SA 4CD1A 4BRAA 3PSFA 5JLHA 2IVPA 3OW2M 3QINA 5JS2A 5I9EB 4B9QA 5AR0A 1SL2A 1VK0A 4CJ4A 2HNZA 2HBJA 5C42A 1IBKK 4JRQA 1CLQA 4JKGB 1NMNA 1YJ9N 3J80O 2ASPA 1NGGA 4CF8A 1Z26A 3BP8A 3M8PA 2YI1A 3O1WA 1CZAN 1IG8A 2QWOA 5DM7L 3RSEB 1NM1A 3B6PA 4KH5A 3DRPA 3P39A 1JCGA 4E7JA 1QVFM 3TTFA 2D0OA 3CJ1A 3RMCA 3LP3A 3G4SN 4AM7A 2NRXA 4DTPA 3H08A 3NF8A 4FWNA 4DMNA 1D9FA 1YVNA 4OKJA 3MN9A 2RHKA 3Q7BA 4OVLA 3TANA 4CJLA 3ENOA 1K8KA 2E4LA 3KIOA 3ZSWA 4OLAA 1NK7A 2D0BA 4N47A 1JJ2M 1IBMK 3CC7N 4BR9A 3EYZA 2KKZA 1BIUA 3U9ZA 2NRWA 4Z4FA 3ZSXA 1CXQA 1GOCA 4BACA 1TL3A 1NWKA 3L0QA 1U6ZA 4DS5A 3V9SA 1SKSA 3AA3A 4EZ9A 1KLMA 2ASOA 2X6NA 3ENHA 1JLFA 3VQBA 5AFUH 4DSEA 1S6PA 4YNQA 4JK8A 3CYGA 4PUOA 4HUEA 1L3VA 4JS5A 2C1IA 1H1VA 4KV8A 4E7LA 3HO1A 4FWPA 3CPWM 3QO9A 4X65K 4DV6K 3TAQA 4BRLA 2HHHK 2X74A 4I9QA 5AZJA 4DR3K 2DTUA 2HNYA 3LP2A 5BR9A 3U6FA 1QSSA 1KVBA 2RN2A 1RTIA 3AVFA 3HT3A 2J4RA 3AGKA 1ASVA 2YHWA 4WQ5C 5HROA 4M3TA 5ADXA 4N76A 4DR7K 3V1OA 3IAYA 3QBWA 4FZYA 3TR8A 1W7AA 4KAZA 1SUQA 1YUWA 3IFRA 2BUPA 2QW9A 1HNIA 3LALA 2HHIA 3NH2A 3VF6A 2HMIA 1QZ6A 3SAGA 4H0TB 3DLKA 2OPPA 3SBGA 1HNXK 1BCMA 4IOCL 3ASMA 3MEGA 3I33A 1QSYA 3QLHA 3K0SA 5LMNK 4DTSA 2HW3A 4KRFA 1JLQA 4IWVA 3ZETB 3CPEA 3K57A 2P9KA 3D45A 2BDPA 2Q0UA 4LF9K 3G71N 2FSJA 3ZETA 1VQ7N 1Q8IA 2ZF5O 2P9NB 3E66A 2I7PA 3NF9A 4B08A 1MDUB 4KO0A 3UKRA 2ITGA 2YKMA 3K2PA 4BR5A 2W00A 4FJ5A 4CZKA 4BECA 4A5AA 3C7NB 4CJFA 4FLVA 4ZTFA 2E2OA 3CJCA 1BA1A 1BHLA 4O55A 2ZD1A 5C2DA 3ZX2A 3IS9A 1J9AA 5JLFA 1N5YA 3SNNA 5JICA 4FO0A 1UAXA 2CH5A 3MK6A 3I8DA 3K5OA 5E84A 2F4VK 3SAHA 4FJMA 3RRGA 2IGIA 4H8KA 3D2EB 3WEEB 5AQPA 1VSHA 4DUYK 5M1OA 4Q0BA 4N5SA 1VQ4N 4AM6A 4IO8A 3KLHA 4CGDA 2Z1HA 1BUPA 2QWMA 3HBTA 4B1VA 3EKSA 4W5NA 4JKHA 3A8YA 4O0JA 3OYLA 1KAXA 1WSGA 3QEVA 1YXQA 3A5LC 1NJZA 1VRTA 4JI1K 1KSPA 4JI5K 1ZC6A 1TV6A 3SBTA 3OY9A 4FLYA 3Q7CA 4E0DA 4M42A 3O9SA 5FPDA 1WB9A 4E89A 2HOEA 2P9PA 2DY4A 2QM1A 4FWMA 1WN7A 1T8EA 1IKXA 3OTOK 4KKOA 3AVMA 5CY4A 1DTQA 1SQKA 4FZXC 2F7TA 3CETA 1ILYA 3NH0A 3V9ZA 1NK6A 3RSEA 2YNHA 3MMVA 3NF7A 4W5TA 4DFPA 1QS4A 2R7YA 1NOYA 1RDBA 4MLEA 3WNGA 3RWUA 4C8NA 1NK0A 1J5OA 4CEEA 3VEXA 4CZHA 2ZGYA 3OYEA 1B9DA 1B9FA 2CGLA 4DSJA 1EWRA 3EE9A 4M7XA 4BGAA 1N6QA 2O8DA 3F9MA 4JRPA 4RW8A 4A61A 5HRPA 1SS6A 2AJQA 3HSTB 4C1NI 2D5RA 2RKIA 2ZQBA 5EX5A 3O08A 3DLLL 3KZBA 4KHQA 1C1AA 4E19A 5IT9O 4DU3A 2D0PA 3AO4A 3DOLA 4J2BA 1RNHA 3SPYA 4NXMK 1RT7A 2VWBA 3L8BA 2EWSA 1GOBA 1VQON 3VMFB 2NRHA 2XRIA 3HSCA 3DXMB 3ZT4A 3CQ8A 1SKRA 3FZLA 4DTRA 2KFNA 3M8SA 2HMPA 4BR4A 3NAEA 3CFRA 1G15A 2D0AA 3MWPA 1QQOA 1Z6RA 4Q5VA 4HVJA 4IFEA 4ID1A 2P9PB 4WFAL 4W5OA 4M3ZA 3R8EA 2QWNA 4JI0K 3HOTA 1B92A 4EAHD 4LF7K 3HVTA 4DS4A 1VRUA 3AVJA 3WUHA 3QB0A 4DQ8A 3W3DA 3O3HA 4I6MB 3NBPA 3L2RA 1T3VA 3CC4N 1U4BA 2HF4A 1K8AO 1ZBFA 2F8SA 2IC3A 1L5UA 4W5RA 4FM0A 4CFDA 3OYFA 3AA4A 3CJBA 3AVHA 3F73A 3WQUA 1RTDA 4AHSA 2PFUA 4M3UA 1T44A 5FROA 5FDLA 4JKEA 3MX5A 1EO1A 4DV3K 4NCAA 3O8MA 3C94A 4DV1K 3WQTA 4JN4A 5C0YA 5E26A 3S41A 4CJ7A 1S1UA 5CYQA 1T7PA 3AAQA 3V6DA 4FK4A 3VQQA 3D7EO 4LSNA 3LM2A 3SI6A 1YT3A 4CJWA 3H6EA 1YJWN 4FW1A 2RE2A 4E1NA 4JS4A 2A40A 1HR0K 2G8KA 1VQNN 1M90O 4IXCA 3KKSA 2XY5A 4AHUA 3HXMA 2GELA 4K8XA 1RBSA 1VQ8N 4IDKA 5C15A 4QS9A 2FSKA 1HJOA 3PX6A 3SV3A 1S3XA 4WQ5A 4KHWA 1ASUA 3VEYA 3OYNA 3M8QA 5F0XA 2ZJRL 4PY5A 2ZWHA 1CZ9A 2W6KA 1HUXA 4I9LA 3LANA 3JXUA 4NO7A 1J53A 4RWTA 3KLFA 2Z1GA 4DR6K 3HZ6A 4M3RA 5HRRA 5AQWA 4FWRA 5AQHA 2VQFK 4KI4A 3T1AA 1NGEA 3G6EN 5LJWA 1IO2A 3QEWA 4DR1K 4CFCA 2DFEA 4IG3A 4PKGA 1TKDA 4J2AA 4JKAA 3SJHA 2FC0A 3OHRA 5SWMA 1NK9A 2D1KA 5AQMA 3ZLJA 3C65A 4LSLA 4QS7A 3U8XA 3VQ6A 3O9UA 3AO5A 3O6WA 4BRCA 4K8ZA 1WLJA 3TAEA 3LDOA 2EX3A 2E1ZA 4B8CA 4E7IA 4HUGA 3VTIA 1RDAA 3NHGA 1RDCA 1HPZA 4B3RK 2OPRA 2O4GA 5CR4A 3DM2A 3OYJA 2A6AA 1VQ6N 4FJ8A 1RBUA 3UKRB 2QXLA 1HX1A 4ILJA 5DK5A 4W5QA 4OKEA 1X9MA 3FZFA 1QQCA 1RBRA 4CEBA 1BO5O 1KXPA 4ID5A 2WFBA 3BUZB 4CF2A 4FK2A 4FJJA 4WQ4A 3RR8A 3DXKB 4YOWA 4DV7K 3CYMA 4C23A 5KQDA 2PAVA 2ETJA 3CM6A 1NK4A 1O13A 1HNZK 2WONA
chains in the Genus database with same CATH topology
2KHOA 1H1VA 4BROA 4R79A 4IOAL 2E8AA 3D2FA 4ILHA 3MN6A 4FPAA 4CZMA 3CCUN 4FWPA 3L4IA 3CPWM 3M3ZA 1P90A 5TKYA 4BR2A 5HOOA 2NRZA 3HOSA 3FR0A 3KWGA 3QFPA 4K43A 4M7YA 3EO3A 3NVMA 2NRVA 4IDHA 3R9PA 3R1XA 3UKUA 4M63C 3EKUA 1NGCA 4BRLA 1X9JA 3GL1A 2NRTA 3M1FA 4A59A 2BH1A 2I7NA 5AZJA 1VQKN 3MDQA 1QQMA 4CZGA 4DB3A 1NMDA 1Q81O 4J8FA 5GAGP 2HBLA 2FLOA 5BR9A 2ZJPL 3BF1A 1KQSM 3UB5A 3E9PA 1BU6O 4YOTA 3KVGA 4IOXA 2P9IA 4MDBA 5ADXH 3CMEN 4B1WB 1RGIA 2J4RA 3VEOA 3AGKA 3UE5A 2YHWA 1DEJA 4WQ5C 3ZEUB 1YITN 1GLLO 4NLCA 1YIJN 1E4FT 3IDHA 5CE3A 2W41A 5ADXA 3CIPA 1KD1O 4A62A 2W40A 3VEVA 4BRMA 4BR0A 2OTJN 5BREA 3FZHA 3QBWA 5DM6L 4OPHA 4OPAA 1YUWA 4B1XB 4IJAA 5AQVA 3IFRA 2BUPA 1RDWX 4GV3A 1JCEA 3R3LA 2QW9A 3HTVA 4IJNA 3VF6A 4Y0WA 1QZ6A 3A5NC 3SAGA 3C6AA 4H0TB 3E9OA 4H0VB 3DJCA 3SBGA 3CCEN 3ZX3A 1N8RO 2V51B 1NGHA 1T6CA 4IOCL 2UYTA 1MWMA 5AQKA 1K9MO 3I33A 5M1NA 4H0OA 2QWRA 1BOTO 2GEMA 2HBMA 5FPNA 3CF5L 3O9TA 4NB4A 1KAYA 1TUYA 3FZKA 3ID6A 3VGKA 4IWVA 4WFBL 3ZETB 2FF3B 2JWLA 2YX6A 3LDQA 2KLAA 3CPEA 4IZ9A 4LC9B 1GLEG 1V4SA 4A2AA 2P9KA 3QBXA 4HTLA 2Q0UA 4I6MA 3KK7A 5AFUA 4JD2B 2FSJA 3KWIA 4PHTX 3ZETA 3G71N 3CJAA 1VQ7N 3GOIA 2ZF5O 2P9NB 3E66A 1SZ2A 2I7PA 3K9JA 3DWLA 1MDUB 3VF4A 3UKRA 2A5XA 4A57A 4CBWA 4BR5A 2E2PA 1ZBSA 3F5TA 2W00A 4BEBA 3NVKA 1HPMA 3VETA 3WXJA 4CZKA 4BECA 4A5AA 5GINA 3C7NB 2E2OA 3CJCA 1BA1A 5BN9A 4XH5A 4H0YB 4B1YB 4BC5A 5F1XA 3FLCO 3H3OB 4JKFA 4BG8A 4CZIA 5C2DA 4FOEA 3TSPA 3ZX2A 3MCAB 5JLFA 3I56N 1GLCG 5AQUA 3C0BA 5BRDA 5JICA 3A0IX 4JKDA 2YJFA 4FO0A 2CH5A 1W97L 1U2VA 3BEXA 3MK6A 4GNIA 1Z05A 2QWLA 5E84A 1OKJA 5KPZA 3ATVA 1QVGM 3SAHA 3OA9A 5MLCQ 2P9KB 4H0XB 5C12A 4QS8A 3QMLA 1ATRA 2F9WA 1LCUA 3VPZA 3D2EB 4XEIA 3E9LA 3WEEB 2GX9A 2E2NA 5AQPA 1M1KO 3IUCA 5AZJB 4BRFA 5M1OA 2YHXA 1Y64A 5C10A 4AM6A 1VQ4N 4IO8A 2P9LB 2E20A 3EZWA 3I8BA 3VTHA 1EQYA 3FFKB 1BUPA 4ISFA 5JMVA 2Q31A 2QWMA 3F2KA 1XQSC 1D4XA 3E1YA 3HBTA 3EKSA 5F2RA 4B1VA 3SAFA 5AQSA 4KH6A 1VQPN 4JKHA 2Q97A 3A8YA 3C6HA 4H03B 3CD6N 1BWFO 3CXCM 1KAXA 4BC3A 1X3NA 1YXQA 5AQFA 5B8HA 2GWKA 2OTLN 3A5LC 3WXMB 2E2QA 1X3MA 4F9OA 1SAZA 3CQXA 5AQOA 3SK3A 3DXKA 1ZC6A 4K25A 4K42A 3SBTA 4B1ZA 1U2VB 3R6MA 4BRPA 3Q7CA 4JK9A 5BPNA 2GTDA 1NGBA 3O9SA 3O9QA 2P9LA 5FPDA 5EY4A 4H5NA 1NGAA 2HOEA 1S22A 3CHWA 1WOQA 3G25A 4JHDA 4BRDA 4EIAA 3H46O 4MDAA 1OVYA 2P9PA 1GLBG 3HRGA 3L4QA 3QDKA 2ZGZA 2QM1A 1VAZA 3EN9A 5LY3A 4FWMA 1R59O 4PL7A 1DT9A 3VENA 5AZIA 5M1KA 2P9SB 1ATSA 3ATUA 1BG3A 3H3NO 3LM9A 4EHUA 1SQKA 1K8KB 4XJXA 3D2FB 5KPRA 2F7TA 4BGBA 2IVOA 3CETA 1ILYA 3OBYA 3RSEA 4YOVA 5EXWA 5AQIA 3MMVA 4YDUC 4BC2A 2Q1NA 1VQ5N 1GLDG 1VQLN 3T7ZA 4K41A 4MLEA 4JK7A 4GY2B 2P9UB 3CERA 4RCHA 3VEXA 4CZHA 1Q7YO 1P8ZA 2ZGYA 1KAZA 2CGLA 3TPQA 4FPBA 2P9UA 3EE9A 1NGIA 4PL8A 4GV6A 4M7XA 4MO4A 4BGAA 1KC8O 1Q18A 1TYQB 3AGRA 3F9MA 4BY9C 4BQLA 4A61A 4JEPA 1SS6A 3FZMA 4JKCA 4C1NI 3CCJN 1NGJA 4FWSA 1YHQN 5EX5A 4EHTA 1TUUA 4G9ZA 3GE1A 3LDLA 3O08A 3DLLL 2V52B 3SLCA 3KZBA 4WYBA 5GADP 2VGNA 5BN8A 3VEZA 3O9RA 1GLFO 2D0PA 3GBTA 4WCEL 3C7NA 2NNWA 4WF9L 4BVOA 2VWBA 4FWLA 3CCVN 2EWSA 3OBWA 3L6QA 4BVPA 1VQON 1QQNA 3M6GA 3VMFB 2OANA 2NRHA 1WUAA 2D4WA 4H5TA 5EOYA 1TYQA 4UY8O 1BA0A 3HSCA 3WEEA 3DXMB 3ENBA 2Q0RA 3MWTA 2FXUA 3FZLA 4NLBA 1YJNN 2YHYA 2V7YA 3VGMA 1Q86O 1V4TA 2WC9A 5M1PA 2HMPA 4BR4A 2V7ZA 1NLVA 3FGUA 4A5BA 4FWKA 4H5VA 2VCPA 2WUSA 2NRRA 4Z94A 4EFHA 3IMXA 2E1YA 1GLJO 2PBDA 1QQOA 1Z6RA 3CQYA 3M5RA 3MWPA 5AQTA 2C1IA 3CCLN 1NGFA 4IFEA 1Q82O 2P9PB 4WFAL 3UKUB 1HKBA 3R8EA 2QWNA 5AQZA 1ESVA 1IJJA 4JKGA 5BRFA 3A5MC 2FSNA 4E1JA 4U7BA 2FF6A 3O4WA 3TTCA 4EAHD 3HOTA 1S72N 4BRKA 4PKIA 2QWQA 2ITMA 5TKWA 3WUHA 3QB0A 2P9SA 4IEEA 4CZLA 4BRQA 4DQ8A 3AARA 3W3DA 4A2BA 3AAPA 1LOTB 4BRIA 4PKHA 4CI6A 1NJIO 3GDQA 4I6MB 2AP1A 3EE8A 3ULEB 1T3VA 4YOXA 3CC4N 1VQ9N 2A41A 2HF4A 1K8AO 4YOYA 5KQ8A 5CHIA 2CGJA 3CCRN 4ISEA 3FE1A 1J6ZA 3HI0A 5BRHA 1VQMN 3D6RA 3CJBA 4H5RA 2Q2RA 3CCMN 3HM8A 3WQUA 1YF5L 2E88A 2P9IB 3K9KA 3VGLA 2GWJA 5ELZA 3PIPL 2QTDA 4FSVA 3NMUA 4H5WA 4OO1J 2IVNA 3P31A 2QEXN 3J7ZO 2P9NA 2PFUA 3TSQA 1C0GA 1T44A 3O5BA 1MWKA 3CI5A 4YDUA 4JKEA 3U9DA 3WXLA 3MX5A 4B1UB 3I55N 4FWOA 2WBNA 5AQXA 4WFNL 3GG4A 1EO1A 3W0LA 3O8MA 3CC2N 4BC4A 4BE7B 3WQTA 4GV9A 2YCHA 4JN4A 1HLUA 5C0YA 4CD3A 3B8AX 5E26A 3S41A 4CJ7A 4YOUA 3QFUA 3AAQA 3RVCA 4RTFD 4L3QA 3H45C 1GLAG 2YJEA 3D7EO 5H1SQ 3LM2A 4H0PA 2F9TA 3H6EA 3D2EA 4MO5A 4BRGA 1YJWN 2RE2A 4BR7A 4CZEA 4DCHA 2A40A 3LDNA 4WQ4C 1ZXOA 3N4PA 4JD2A 3MCPA 5GAEP 3U4LA 1VQNN 3PLAA 3TU5A 1M90O 4IXCA 2BTFA 2CH6A 3CCSN 4FOIA 3JS6A 5AQGA 2GELA 1VQ8N 1C0FA 3T69A 3A5OC 5BPLA 5C15A 3ULEA 4QS9A 2FSKA 5JVHL 1HJOA 4CBXA 1S3XA 4WQ5A 5M1QA 5GAHP 2AA4A 3VEWA 3SMPA 3VEYA 2HF3A 3EL2A 3AY9A 4JHDB 3CCQN 3CMAN 5FPMA 5F0XA 2ZJRL 3ZEUA 4BRNA 5JVGL 5AQYA 2ZWHA 3WXKA 4BG9A 4DKWA 3DXMA 1G99A 4BQZA 1HUXA 5AZIB 4GVEA 3JXUA 2H3GX 4NO7A 4XH1A 5AQRA 3WT0A 4CD1A 4BRAA 4RWTA 3TSUA 1RFQA 3HZ6A 3MN5A 4IEIA 5BPMA 5JLHA 4IO9L 5AQWA 2IVPA 4FWRA 3OW2M 5KPTA 5GIPA 5I9EB 4B9QA 5AQHA 1YAGA 5AR0A 5EVZA 4FVUA 2C1GA 1HKGA 2HBJA 1NGEA 3N4QA 3G6EN 5LJWA 4JKGB 1ATNA 1NGDA 1MA9B 3CJ7A 3LL3A 3P38A 2ASPA 1YJ9N 2A42A 1NGGA 3SMSA 1BDGA 2QI2A 2DPNA 4PKGA 2VGMA 3BP8A 2YI1A 3O1BA 4JKAA 3O1WA 3SJHA 4ISGA 5M1FA 4ILGB 2IIRA 4O5FA 2NLXA 3OHRA 2ASMA 1CZAN 5AQJA 1IG8A 2QWOA 5AQLA 3BF3A 2D1KA 3VOVA 5AQMA 3O80A 4BRHA 5DM7L 1NM1A 3C65A 4JAXA 3RSEB 3P4IA 4KH5A 4QS7A 3U8XA 3PIOL 3P39A 1JCGA 4FL9A 3O9UA 1YI2N 1QVFM 3TTFA 2D0OA 3O6WA 4BRCA 2A3ZA 3CJ1A 1QHAA 4C1NK 5FPEA 3J8AA 2VYPA 1JCFA 1T6DA 4KH4A 3G4SN 4AM7A 2NRXA 1K73O 5HL7L 4FWNA 1YVNA 5AQNA 3LDOA 2HBKA 3MN9A 4KBOA 1DKGD 2QA4N 2E1ZA 2NZTA 2RHKA 3Q7BA 4HWIA 4JNEA 1W2BM 3VTIA 1DGKN 3ENOA 4O8UA 2QWPA 1K8KA 4MLHA 3MX2A 3VESA 1JJ2M 2JWKA 1XUPO 3H1VX 3IKMA 3KHYA 5CR4A 2A6AA 3TTDA 1HKCA 4BREA 3CC7N 4BR9A 2KKZA 1VQ6N 3U9ZA 2NRWA 4JKBA 2Q36A 2QXLA 3UKRB 1HX1A 4ILJA 4U67L 5C2FA 3CJ9A 4DHYA 2CGKA 3H1QA 3ZX0A 3LDPA 3FZFA 3DAWA 3VF2A 4YORA 2GUPA 1NWKA 4CZFA 4FWQA 1BO5O 1KXPA 1U6ZA 3L0QA 4O8KA 2ZJQL 3MN7A 3ZYYX 2WFBA 1RDUA 3BUZB 1E4GT 3ID8A 2ASOA 3ENHA 4CBUA 3WXIA 2HSTA 5AFUH 4WQ4A 4XH4A 3DXKB 4YOWA 5AQQA 3QICA 3VERA 4JK8A 4CZJA 5LJVA 1XC3A 4C23A 5KQDA 2PAVA 4AF1A 1QZ5A 5GIOA 1O13A 1NBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHO A;  1H1V A;  4BRO A;  2E8A A;  3D2F A;  3MN6 A;  4FPA A;  4CZM A;  4FWP A;  3L4I A;  3M3Z A;  5TKY A;  4BR2 A;  3FR0 A;  3QFP A;  4M7Y A;  4K43 A;  3EO3 A;  3R9P A;  3UKU A;  4M63 C;  3EKU A;  1NGC A;  4BRL A;  1X9J A;  3GL1 A;  3M1F A;  5AZJ A;  2I7N A;  3MDQ A;  1QQM A;  4CZG A;  4DB3 A;  1NMD A;  4J8F A;  2FLO A;  5BR9 A;  3BF1 A;  3UB5 A;  1BU6 O;  3KVG A;  2P9I A;  5ADX H;  4B1W B;  1RGI A;  2J4R A;  3VEO A;  3UE5 A;  2YHW A;  1DEJ A;  4WQ5 C;  3ZEU B;  1GLL O;  1E4F T;  3IDH A;  5CE3 A;  2W41 A;  5ADX A;  3CIP A;  4A62 A;  2W40 A;  3VEV A;  4BRM A;  4BR0 A;  5BRE A;  3FZH A;  3QBW A;  1YUW A;  4B1X B;  4IJA A;  5AQV A;  3IFR A;  2BUP A;  1RDW X;  1JCE A;  2QW9 A;  3HTV A;  4IJN A;  3VF6 A;  4Y0W A;  1QZ6 A;  3A5N C;  4H0T B;  4H0V B;  3DJC A;  3ZX3 A;  2V51 B;  1NGH A;  1T6C A;  2UYT A;  1MWM A;  5AQK A;  3I33 A;  4H0O A;  2QWR A;  1BOT O;  2GEM A;  5FPN A;  4NB4 A;  1KAY A;  1TUY A;  3FZK A;  3VGK A;  4IWV A;  3ZET B;  2FF3 B;  3LDQ A;  4LC9 B;  4IZ9 A;  1GLE G;  1V4S A;  4A2A A;  2P9K A;  3QBX A;  4HTL A;  2Q0U A;  4I6M A;  5AFU A;  4JD2 B;  2FSJ A;  3ZET A;  3CJA A;  3GOI A;  2ZF5 O;  2P9N B;  1SZ2 A;  2I7P A;  3DWL A;  1MDU B;  3VF4 A;  3UKR A;  2A5X A;  4CBW A;  4BR5 A;  2E2P A;  1ZBS A;  1HPM A;  3VET A;  3WXJ A;  4CZK A;  3C7N B;  2E2O A;  3CJC A;  1BA1 A;  5BN9 A;  4XH5 A;  4H0Y B;  4B1Y B;  4BC5 A;  5F1X A;  3FLC O;  3H3O B;  4BG8 A;  4CZI A;  4FOE A;  3ZX2 A;  5JLF A;  1GLC G;  5AQU A;  3C0B A;  5BRD A;  5JIC A;  3A0I X;  2YJF A;  4FO0 A;  2CH5 A;  1U2V A;  3BEX A;  3MK6 A;  4GNI A;  1Z05 A;  2QWL A;  5E84 A;  1OKJ A;  5KPZ A;  3ATV A;  2P9K B;  4H0X B;  4QS8 A;  3QML A;  1ATR A;  2F9W A;  1LCU A;  3VPZ A;  3D2E B;  4XEI A;  3WEE B;  2E2N A;  5AQP A;  3IUC A;  5AZJ B;  4BRF A;  2YHX A;  1Y64 A;  4AM6 A;  4IO8 A;  2P9L B;  2E20 A;  3EZW A;  3I8B A;  1EQY A;  3FFK B;  1BUP A;  4ISF A;  5JMV A;  2Q31 A;  2QWM A;  3HBT A;  1XQS C;  1D4X A;  5F2R A;  4B1V A;  3EKS A;  5AQS A;  2Q97 A;  3A8Y A;  4H03 B;  1BWF O;  1KAX A;  4BC3 A;  1X3N A;  1YXQ A;  5AQF A;  5B8H A;  2GWK A;  3A5L C;  2E2Q A;  1X3M A;  4F9O A;  1SAZ A;  3CQX A;  5AQO A;  3SK3 A;  3DXK A;  1ZC6 A;  4K25 A;  4K42 A;  4B1Z A;  1U2V B;  3R6M A;  4BRP A;  5BPN A;  2GTD A;  1NGB A;  5FPD A;  2P9L A;  5EY4 A;  4H5N A;  1NGA A;  2HOE A;  1S22 A;  3CHW A;  1WOQ A;  3G25 A;  4JHD A;  4BRD A;  4EIA A;  3H46 O;  3QDK A;  2P9P A;  1GLB G;  2ZGZ A;  2QM1 A;  3EN9 A;  5LY3 A;  4FWM A;  1R59 O;  4PL7 A;  3VEN A;  5AZI A;  2P9S B;  1ATS A;  3ATU A;  1BG3 A;  3H3N O;  3LM9 A;  4EHU A;  1SQK A;  1K8K B;  3D2F B;  5KPR A;  4BGB A;  2IVO A;  3CET A;  3RSE A;  5EXW A;  5AQI A;  3MMV A;  4YDU C;  4BC2 A;  2Q1N A;  1GLD G;  4K41 A;  4MLE A;  4GY2 B;  2P9U B;  3CER A;  4RCH A;  3VEX A;  4CZH A;  1P8Z A;  2ZGY A;  1KAZ A;  2CGL A;  3TPQ A;  4FPB A;  2P9U A;  1NGI A;  4PL8 A;  4M7X A;  4MO4 A;  4BGA A;  1Q18 A;  1TYQ B;  3F9M A;  4BQL A;  4A61 A;  3FZM A;  1NGJ A;  4FWS A;  5EX5 A;  4EHT A;  1TUU A;  3GE1 A;  3LDL A;  3O08 A;  2V52 B;  3SLC A;  3KZB A;  4WYB A;  5BN8 A;  3VEZ A;  1GLF O;  2D0P A;  3GBT A;  3C7N A;  4BVO A;  2VWB A;  4FWL A;  2EWS A;  3L6Q A;  4BVP A;  1QQN A;  3M6G A;  2OAN A;  2NRH A;  1WUA A;  2D4W A;  4H5T A;  5EOY A;  1TYQ A;  1BA0 A;  3HSC A;  3WEE A;  3DXM B;  2Q0R A;  2FXU A;  3FZL A;  2YHY A;  2V7Y A;  3VGM A;  1V4T A;  2HMP A;  4BR4 A;  2V7Z A;  1NLV A;  3FGU A;  4FWK A;  4H5V A;  2VCP A;  2WUS A;  4Z94 A;  4EFH A;  3IMX A;  2E1Y A;  1GLJ O;  2PBD A;  1QQO A;  1Z6R A;  3CQY A;  5AQT A;  1NGF A;  2P9P B;  3UKU B;  1HKB A;  3R8E A;  2QWN A;  5AQZ A;  1ESV A;  1IJJ A;  5BRF A;  3A5M C;  2FSN A;  4E1J A;  2FF6 A;  3O4W A;  4EAH D;  4BRK A;  4PKI A;  2QWQ A;  2ITM A;  3WUH A;  3QB0 A;  2P9S A;  4CZL A;  4BRQ A;  4DQ8 A;  3AAR A;  3W3D A;  4A2B A;  3AAP A;  1LOT B;  4BRI A;  4PKH A;  4CI6 A;  3GDQ A;  4I6M B;  2AP1 A;  3ULE B;  2A41 A;  2HF4 A;  5KQ8 A;  2CGJ A;  4ISE A;  3FE1 A;  1J6Z A;  3HI0 A;  5BRH A;  3CJB A;  4H5R A;  2Q2R A;  3HM8 A;  3WQU A;  2E88 A;  2P9I B;  3VGL A;  2GWJ A;  5ELZ A;  4FSV A;  4H5W A;  2IVN A;  2P9N A;  1C0G A;  1T44 A;  3O5B A;  1MWK A;  3CI5 A;  4YDU A;  3U9D A;  3WXL A;  4B1U B;  4FWO A;  5AQX A;  3GG4 A;  3W0L A;  3O8M A;  4BC4 A;  3WQT A;  2YCH A;  4JN4 A;  1HLU A;  4CD3 A;  3B8A X;  5E26 A;  3S41 A;  4CJ7 A;  3QFU A;  3AAQ A;  4RTF D;  4L3Q A;  3H45 C;  1GLA G;  2YJE A;  3D7E O;  3LM2 A;  4H0P A;  2F9T A;  3H6E A;  3D2E A;  4MO5 A;  4BRG A;  4BR7 A;  4CZE A;  4DCH A;  2A40 A;  3LDN A;  4WQ4 C;  1ZXO A;  4JD2 A;  3MCP A;  3U4L A;  3TU5 A;  4IXC A;  2BTF A;  2CH6 A;  4FOI A;  3JS6 A;  5AQG A;  2GEL A;  1C0F A;  3A5O C;  5BPL A;  3ULE A;  4QS9 A;  2FSK A;  1HJO A;  4CBX A;  1S3X A;  4WQ5 A;  2AA4 A;  3VEW A;  3SMP A;  3VEY A;  2HF3 A;  3EL2 A;  3AY9 A;  4JHD B;  5FPM A;  5F0X A;  3ZEU A;  4BRN A;  5AQY A;  2ZWH A;  3WXK A;  4BG9 A;  3DXM A;  1G99 A;  4BQZ A;  1HUX A;  5AZI B;  3JXU A;  2H3G X;  4NO7 A;  4XH1 A;  5AQR A;  3WT0 A;  4CD1 A;  4BRA A;  4RWT A;  1RFQ A;  3HZ6 A;  3MN5 A;  5BPM A;  5JLH A;  5AQW A;  2IVP A;  4FWR A;  5KPT A;  5I9E B;  4B9Q A;  5AQH A;  1YAG A;  5AR0 A;  5EVZ A;  1HKG A;  1NGE A;  5LJW A;  1ATN A;  1NGD A;  1MA9 B;  3CJ7 A;  3LL3 A;  2ASP A;  2A42 A;  1NGG A;  3SMS A;  1BDG A;  2DPN A;  4PKG A;  3BP8 A;  3O1B A;  2YI1 A;  3O1W A;  3SJH A;  4ISG A;  2IIR A;  4O5F A;  2NLX A;  3OHR A;  2ASM A;  1CZA N;  5AQJ A;  1IG8 A;  2QWO A;  5AQL A;  3BF3 A;  2D1K A;  3VOV A;  5AQM A;  3O80 A;  4BRH A;  1NM1 A;  4JAX A;  3RSE B;  3P4I A;  4QS7 A;  3U8X A;  1JCG A;  4FL9 A;  2D0O A;  3O6W A;  4BRC A;  2A3Z A;  3CJ1 A;  1QHA A;  5FPE A;  3J8A A;  2VYP A;  1JCF A;  1T6D A;  4AM7 A;  4FWN A;  1YVN A;  5AQN A;  3LDO A;  3MN9 A;  4KBO A;  1DKG D;  2E1Z A;  2NZT A;  4HWI A;  4JNE A;  1DGK N;  3ENO A;  2QWP A;  1K8K A;  4MLH A;  3VES A;  3KHY A;  1XUP O;  3H1V X;  2A6A A;  1HKC A;  4BRE A;  4BR9 A;  3U9Z A;  2Q36 A;  2QXL A;  3UKR B;  1HX1 A;  3CJ9 A;  4DHY A;  2CGK A;  3H1Q A;  3ZX0 A;  3LDP A;  3FZF A;  3DAW A;  3VF2 A;  2GUP A;  1NWK A;  4CZF A;  4FWQ A;  1BO5 O;  1KXP A;  1U6Z A;  3L0Q A;  4O8K A;  3MN7 A;  3BUZ B;  1E4G T;  3ID8 A;  2ASO A;  3ENH A;  4CBU A;  3WXI A;  5AFU H;  4WQ4 A;  4XH4 A;  3DXK B;  5AQQ A;  3QIC A;  3VER A;  4CZJ A;  5LJV A;  1XC3 A;  4C23 A;  5KQD A;  2PAV A;  1QZ5 A;  1NBW A; 
#chains in the Genus database with same CATH topology
 4BE0 A;  4IOA L;  4ILH A;  1S9E A;  4C8M A;  4CGH A;  1P90 A;  4BR2 A;  2VG7 A;  2NRZ A;  3HOS A;  3RRH A;  3FR0 A;  3QFP A;  4CFB A;  4IDH A;  3R1X A;  1IKY A;  1X9J A;  3GL1 A;  4E7K A;  2I7N A;  4CJS A;  4CZG A;  2XY7 A;  4BWM A;  2FLO A;  3G0Z A;  2ZJP L;  3BF1 A;  1XC9 A;  3OYD A;  4E72 A;  1KQS M;  3UB5 A;  3AO2 A;  3CME N;  4QOZ B;  2PY5 A;  1YTU A;  4NCB A;  4LF4 K;  4NLC A;  1HQE A;  3D0P A;  4Z4E A;  3KLE A;  5CE3 A;  2W41 A;  3BGR A;  3CIP A;  4RG8 A;  2KFZ A;  3VEV A;  4DTX A;  3V9U A;  3TAG A;  5BRE A;  5AJ3 K;  3P1G A;  4OPH A;  4OPA A;  4B1X B;  5AQV A;  4Z4C A;  3L2U A;  2XY6 A;  4CK3 A;  3F9K A;  1JCE A;  4GV3 A;  1U47 A;  1S1T A;  1SL0 A;  3A5N C;  3VQD A;  1NGH A;  1T6C A;  1JLA A;  4FM1 A;  5M1N A;  4H0O A;  2QWR A;  3PO5 A;  4CIE A;  1BOT O;  2HBM A;  3FZK A;  3ID6 A;  3V9W A;  3SUP A;  5KRT A;  1ZBI A;  2FF3 B;  2KLA A;  4IZ9 A;  4LC9 B;  1V4S A;  3J81 O;  1UWB A;  3QBX A;  2VQE K;  4DWI A;  3HYF A;  4HTL A;  4JD2 B;  1TKX A;  1XNQ K;  1NU0 A;  3L2W A;  4JI8 K;  2XO7 A;  3AVL A;  3VF4 A;  1NJX A;  3NCI A;  3F5T A;  4FJL A;  3NVK A;  1HPM A;  3VET A;  1LW0 A;  3ZSR A;  3OYA A;  3OYG A;  2RF2 A;  4Y1D A;  4KTZ A;  5BN9 A;  1HRH A;  2E5L K;  3BY5 A;  4OPJ A;  4BC5 A;  4DTN A;  3FLC O;  4AHR A;  4FJG A;  4CEQ A;  1FKP A;  2HND A;  3JSM A;  5BRD A;  4CJV A;  4JKD A;  4O4G A;  4OKK A;  4F2S A;  1W97 L;  1TKT A;  4GNI A;  1OKJ A;  5KPZ A;  1QVG M;  3OA9 A;  5MLC Q;  2P9K B;  2GUI A;  4H0X B;  1KFS A;  1LCU A;  3VPZ A;  3E9L A;  2GX9 A;  1UA0 A;  4CFA A;  2Q3S A;  4FW2 A;  2KTQ A;  4YY3 K;  5C10 A;  2FBX A;  1EQY A;  5JMV A;  1RT3 A;  2QXF A;  1XQS C;  3NH1 A;  2PZS A;  5AQS A;  3LAM A;  3T1H K;  1GOA A;  1VQP N;  4H03 B;  1U48 A;  3CD6 N;  1VSL A;  1JXE A;  3CXC M;  3TAR A;  1KFD A;  4FLZ A;  1MU2 A;  4AHV A;  1SAZ A;  3CQX A;  1JLB A;  5AQO A;  3SK3 A;  4CEO A;  2HB5 A;  4LH4 A;  3MXM A;  1U2V B;  1F21 A;  1NGB A;  5EY4 A;  1HYZ A;  4M3Y A;  4H5N A;  3SZ2 A;  4JHD A;  4FJK A;  1RT4 A;  4MDA A;  1OVY A;  1XWL A;  3HRG A;  1VAZ A;  3OYK A;  1TAU A;  1ZBU A;  1XNR K;  1DT9 A;  5M1K A;  1BGX T;  4DU1 A;  1ATS A;  3U3Y A;  3LM9 A;  4FCY A;  4EHU A;  4F8R A;  1K8K B;  4XJX A;  3KJV A;  1REV A;  4CHN A;  4YOV A;  3QNO A;  1WAJ A;  4YDU C;  1GLD G;  3K59 A;  1R0A A;  2PYJ A;  1WSH A;  4FXD A;  4ICL A;  2B6A A;  1HYV A;  1Q7Y O;  1OH7 A;  1E3M A;  1NGI A;  4PL8 A;  1Q18 A;  4JEP A;  4AQY K;  4DSL A;  3SUO A;  4WYB A;  2G8H A;  4B8A B;  3BDP A;  4X62 K;  2NNW A;  4Z4I A;  4WF9 L;  4BVO A;  2OCE A;  4FWL A;  3CCV N;  1C0T A;  3ZSY A;  1IKV A;  2ZM6 K;  3AVB A;  2Z1J A;  4E1M A;  3M6G A;  2OAN A;  1JLC A;  5EOY A;  4UY8 O;  1BA0 A;  4O5B A;  3ENB A;  3KK2 A;  2Q0R A;  1WNS A;  2FXU A;  4LY7 A;  4NLB A;  4M41 A;  1YJN N;  3IG1 A;  1Q86 O;  1V4T A;  5M1P A;  3SQ1 A;  1EX4 A;  2P5O A;  3FGU A;  3OJU A;  4A5B A;  2OZM A;  2KZM A;  3IRX A;  4Z94 A;  3IMX A;  2E1Y A;  5AQT A;  3CQY A;  4DQP A;  1ASW A;  3CCL N;  4TSX A;  4ELT A;  5AQZ A;  1IJJ A;  4JKG A;  4E1J A;  2UXD K;  4C8K A;  2QWQ A;  2ITM A;  1L3T A;  4CZL A;  4LFB K;  2O8F B;  3TAM A;  3AAR A;  1LOT B;  1RDD A;  3ULE B;  2YNI A;  3NE6 A;  1VQ9 N;  2A41 A;  2G8V A;  4B9V A;  5KQ8 A;  5CHI A;  1OVQ A;  3FE1 A;  1JXB A;  2IOC A;  4CJ5 A;  4DF4 A;  4CHP A;  3QEP A;  2E88 A;  4IFY A;  3OYH A;  1BL3 A;  2QTD A;  2W6L A;  4FSV A;  4H5W A;  4OO1 J;  4I2Q A;  2IVN A;  3P31 A;  3LDS A;  3J7Z O;  2P9N A;  1NG9 A;  3O3G A;  4QCL A;  1KTQ A;  3QIP A;  1C0G A;  4YDU A;  1MWK A;  3OYM A;  4RW9 A;  3CG7 A;  3T19 A;  5SZT A;  4FWO A;  2WBN A;  3W0L A;  4BE7 B;  3C95 A;  4IKF A;  4KHP K;  1DTT A;  2UUB K;  1S9G A;  3RVC A;  3TI0 A;  2O8E B;  1GLA G;  3HPO A;  2HHX A;  4H0P A;  4BRG A;  4WQ4 C;  4JD2 A;  3N4P A;  3PLA A;  1EWQ A;  3U4L A;  4CF1 A;  2BAN A;  2B5J A;  2HHV A;  2P51 A;  3CCS N;  3JS6 A;  1I94 K;  2XHB A;  4DV0 K;  3PV8 A;  3PX0 A;  2FBY A;  1C0F A;  3T69 A;  3A5O C;  5JVH L;  1N33 K;  3THX B;  3RMD A;  1RBT A;  3VEW A;  2HF3 A;  4DSK A;  4JHD B;  3CCQ N;  1VSE A;  4DTU A;  1TL1 A;  1O1W A;  3ZT2 A;  4DKW A;  5AZI B;  3AO3 A;  4GVE A;  4C8O A;  3VQ7 A;  3TSU A;  1RFQ A;  3HK2 A;  3MN5 A;  5BPM A;  3KK1 A;  4IO9 L;  1U49 A;  1RCH A;  4N41 A;  2UUA K;  4UQG A;  1YAG A;  5EVZ A;  1ZBL A;  1WSE A;  4NYF A;  4HTU A;  3PSI A;  3S9H A;  1MA9 B;  1KCF A;  3LL3 A;  3K58 A;  4OPK A;  4JYA K;  2GV9 A;  4CGG A;  2VGM A;  3O1B A;  1N32 K;  1CXU A;  4Y1C A;  4ILG B;  5M1F A;  2IIR A;  4O5F A;  4CES A;  2NLX A;  3DOK A;  5AQL A;  3LWM A;  1JLE A;  3PY8 A;  5LL6 Z;  2UUC K;  4JAX A;  3VQ9 A;  2HHS A;  3P4I A;  3PIO L;  1K6Y A;  4B9T A;  4B3O A;  1ZYQ A;  4C1N K;  3J8A A;  4KH4 A;  1JCF A;  1T6D A;  4DSI A;  4DU4 A;  3CM5 A;  3DLB A;  2QKB A;  4I2P A;  2E6L A;  4B9U A;  5AQN A;  4KBO A;  1DKG D;  5CZ2 A;  2NZT A;  4HWI A;  1IV0 A;  1TK5 A;  4O8U A;  1DGK N;  3MX2 A;  3VES A;  1DLO A;  2O8B B;  4JI6 K;  4BRE A;  1FJG K;  2WOM A;  5C2F A;  4Z4H A;  2CGK A;  3H1Q A;  2BGG A;  3THW A;  3QER A;  2GUP A;  4CZF A;  3MAQ A;  4O8K A;  3KLG A;  2ZJQ L;  3ZYY X;  3ID8 A;  2EHG A;  4XH4 A;  1CZB A;  3VER A;  5D3G A;  4HHT A;  4CEA A;  4AF1 A;  1QZ5 A;  3AO1 A;  2KHO A;  2W42 A;  4JI3 K;  1A5W A;  4KB1 A;  4BRO A;  4FPA A;  4CZM A;  4F3T A;  3M3Z A;  4CJK A;  5HOO A;  3PUF A;  1RT2 A;  3KWG A;  4M7Y A;  3LP1 A;  1BIZ A;  3EO3 A;  1KVC A;  3R9P A;  3UKU A;  2DFH A;  5K14 A;  2DFF A;  1EXQ A;  5C25 A;  3M1F A;  2NRT A;  1EKE A;  3MDQ A;  1QQM A;  4DR5 K;  1Q81 O;  4JI2 K;  2HBL A;  4LF6 K;  2NUB A;  4MDB A;  5ADX H;  4K0K K;  4B1W B;  1RGI A;  3VEO A;  2D0C A;  1D8Y A;  2RPI A;  3ZEU B;  1GLL O;  1E4F T;  3IDH A;  3VQA A;  3NGZ A;  5IWA K;  4BR0 A;  1HNW K;  2OTJ N;  4GMJ B;  5DM6 L;  2WTU A;  4IJA A;  1WBB A;  1RDW X;  3HTV A;  4AHC A;  1NNE A;  4Y0W A;  3C6A A;  3E9O A;  3DJC A;  4FJH A;  5CYM A;  1N8R O;  3AVA A;  4KPY A;  4F4K A;  1MWM A;  1HYS A;  3LWL A;  1K9M O;  2G8W A;  3QEX A;  3LP0 A;  5FPN A;  3O9T A;  4CER A;  1KAY A;  4YFU A;  4WFB L;  2JWL A;  1TAQ A;  5I42 A;  2VG5 A;  4I6M A;  5AFU A;  4ELU A;  3KWI A;  5HRS A;  4PA1 A;  1EET A;  3OVN A;  4FZZ A;  1KLN A;  3DLE A;  4A57 A;  3THV A;  4BE1 A;  5T7B A;  3OJS A;  4DTJ A;  3WXJ A;  5EU7 A;  4XH5 A;  4H0Y B;  4B1Y B;  5F1X A;  4DG1 A;  3H3O B;  4BG8 A;  2HVH A;  4FOE A;  3TSP A;  3MCA B;  4HUF A;  1GLC G;  5AQU A;  4GW6 A;  3ITH A;  3E01 A;  1Z05 A;  2QWL A;  3ATV A;  5C12 A;  4QS8 A;  3ZT1 A;  5I3U A;  1M1K O;  3CFO A;  3IUC A;  4BRF A;  1WBD A;  2P9L B;  2E20 A;  4X64 K;  3FFK B;  4ISF A;  2HHT A;  5FRM A;  4BDZ A;  3MEE A;  1D4X A;  3E1Y A;  3L2V A;  4DV4 K;  2Z1I A;  4OGC A;  4LFC K;  1BWF O;  4BC3 A;  5E41 A;  3AA5 X;  1X3N A;  5AQF A;  5B8H A;  2OTL N;  3WXM B;  1X3M A;  4FK0 A;  1JL2 A;  3DXK A;  5J2Q A;  3R6M A;  4BRP A;  3P83 D;  2YNF A;  3O9Q A;  2P9L A;  3S3N A;  4FLW A;  4DQR A;  1S22 A;  3FFI A;  3QDK A;  1GLB G;  2ZGZ A;  4CED A;  3I0S A;  5LY3 A;  2HHW A;  2F96 A;  1TK8 A;  3O3F A;  1VSM A;  3VEN A;  5AZI A;  4NCG A;  2P9S B;  3ATU A;  3H3N O;  2GBZ A;  1W9H A;  3D2F B;  3TWH A;  2IVO A;  1BI4 A;  4X66 K;  1NK8 A;  4L8R B;  5EXW A;  1S5J A;  2G8U A;  4ZHR A;  4BC2 A;  1QTM A;  1VQL N;  2X78 A;  2VWJ A;  4LFA K;  4CE9 A;  3RMA A;  1BQM A;  4GY2 B;  3DYA A;  2P9U B;  4RCH A;  2OPS A;  4OX9 K;  1LWF A;  3TPQ A;  4CEF A;  4FPB A;  2P9U A;  4GV6 A;  4LF5 K;  3MXJ A;  2G8F A;  1WSI A;  1VHX A;  1BI4 B;  4DR2 K;  4JKC A;  4Z4G A;  3U3G A;  2YHB A;  4FWS A;  1YHQ N;  2UU9 K;  4EHT A;  1KVA A;  1U45 A;  3LDL A;  5GAD P;  3THY A;  1LWC A;  3UIQ A;  1GLF O;  4WCE L;  3C7N A;  1J5E K;  1U04 A;  2OZS A;  3CFP A;  3HJF A;  4CHY A;  3L6Q A;  3V1Q A;  1QQN A;  3DRS A;  1C0M A;  2D4W A;  1I3A A;  3MEC A;  3MXI A;  1D5A A;  3SCX A;  3JAM O;  2YHY A;  3VGM A;  4C8L A;  2F8T A;  2WC9 A;  1NKE A;  1NLV A;  1D9D A;  1GLJ O;  3M5R A;  5HLF A;  2YNG A;  3VQE A;  1HNV A;  3WNF A;  1N34 K;  1NGF A;  3UKU B;  1HKB A;  1ESV A;  1Y97 A;  5BRF A;  4U7B A;  3A5M C;  2FSN A;  3O4W A;  4BRK A;  4EZ6 A;  3SUQ A;  4OLB A;  4BE2 A;  4IEE A;  2P9S A;  3OS0 A;  2OA8 A;  3AA2 A;  3AAP A;  3EY1 A;  4BRI A;  1NJI O;  3GDQ A;  3VQ4 A;  3EE8 A;  4CGF A;  4YOX A;  3G10 A;  3S5T A;  4B9N A;  3KKR A;  3ZT0 A;  1KRP A;  2HVI A;  1VQM N;  3D6R A;  5KTQ A;  4AHT A;  4RW7 A;  3DI6 A;  2O8C B;  2P9I B;  3K9K A;  1C1B A;  4F2R A;  2GWJ A;  5ELZ A;  5JS1 A;  4DUZ K;  2QEX N;  4CJE A;  2I5J A;  3TSQ A;  2ZE2 A;  3LZI A;  3CI5 A;  3WXL A;  3U9D A;  4HCC A;  4B1U B;  4WE1 A;  3CC2 N;  4B9M A;  4BC4 A;  2YCH A;  4GKK K;  3VQ5 A;  4YOU A;  3DLG A;  4CIG A;  4NYN A;  3ZSQ A;  4L3Q A;  3H45 C;  4LH5 A;  5BR8 K;  2OYQ A;  4MO5 A;  4BR7 A;  4DCH A;  2P1J A;  3LDN A;  1ZXO A;  3MCP A;  3C6T A;  3NGY A;  3TAB A;  1LV5 A;  2B4J A;  4H4O A;  2BTF A;  1WSF A;  4FOI A;  1BCO A;  1L3U A;  3OYB A;  4FJ9 A;  1HQU A;  1I39 A;  3ULE A;  3KTQ A;  3DLR A;  4CBX A;  5M1Q A;  3A2F A;  5GAH P;  3SMP A;  1IKW A;  3EL2 A;  3SQ0 A;  3AV9 A;  4JV5 K;  4FM2 A;  3HP6 A;  4CEZ A;  3ULD A;  5JVG L;  1VSI A;  1QE1 A;  3WXK A;  4FJX A;  3ISN C;  4JI7 K;  4DFJ A;  4KRE A;  2KZZ A;  2H3G X;  3WT0 A;  3PO4 A;  4I7F A;  4IEI A;  1YVU A;  5KPT A;  5GIP A;  1S6Q A;  4FVU A;  5HRN A;  2C1G A;  1HKG A;  2G8I A;  3N4Q A;  3QIO A;  1ZBH A;  1WSJ A;  3OS1 A;  4DQS A;  1ATN A;  1NGD A;  3CJ7 A;  3P38 A;  1NKC A;  2A42 A;  3SMS A;  1BDG A;  2QI2 A;  2DPN A;  3K5N A;  5A2Q O;  4ISG A;  2YV0 X;  4JLH A;  4G1Q A;  2UXC K;  4CHZ A;  2Y1I A;  2ASM A;  4RW4 A;  5AQJ A;  3BF3 A;  3VOV A;  3O80 A;  3ZT3 A;  4BRH A;  1S1X A;  5C24 A;  1SKW A;  4FLU A;  3T1Y K;  4FL9 A;  1RIL A;  1YI2 N;  4CJQ A;  2LSN A;  2A3Z A;  1QHA A;  5FPE A;  2VYP A;  1LW2 A;  4V19 S;  1K73 O;  5HL7 L;  1UA1 A;  1T03 A;  4DQI A;  2HBK A;  2QA4 N;  1FXX A;  2O8D B;  1ITG A;  4JNE A;  4BWJ A;  1W2B M;  4IFV A;  1VSD A;  2QWP A;  4MLH A;  1HMV A;  2JWK A;  1XUP O;  3H1V X;  4M45 A;  3IKM A;  3KHY A;  3M8R A;  3HPH A;  4ELV A;  3TTD A;  1HKC A;  4JI4 K;  1RT5 A;  4JKB A;  2Q36 A;  4U67 L;  3CJ9 A;  3DLH A;  4DHY A;  3ZX0 A;  3LDP A;  3DAW A;  3EZ5 A;  2JGU A;  3VF2 A;  4YOR A;  3NGI A;  4FWQ A;  3LAK A;  3ZSO A;  4FVM A;  3T3F A;  3MN7 A;  1JLG A;  1NJY A;  4CVN E;  1RDU A;  2O8F A;  1E4G T;  4CBU A;  3WXI A;  2HST A;  4CF0 A;  1OH6 A;  1RTJ A;  3QEI A;  4HCB A;  4B9S A;  5AQQ A;  1XHZ A;  3QIC A;  4CZJ A;  5KI6 A;  3LPU A;  5LJV A;  1VSF A;  1XC3 A;  4RW6 A;  5GIO A;  1NBW A;  1Q9Y A;  3VN5 A;  5J2P A;  3P5J A;  4R79 A;  2E8A A;  3D2F A;  4KHU A;  3MN6 A;  3CCU N;  3L4I A;  5TKY A;  1VSJ A;  4KTW A;  2A1S A;  1LAW A;  4K43 A;  3NVM A;  4CK1 A;  2NRV A;  4M63 C;  3EKU A;  1NGC A;  5DMR A;  4A59 A;  2BH1 A;  1VQK N;  3J7Y P;  4DB3 A;  1LWE A;  1NMD A;  4J8F A;  5GAG P;  1UOC A;  1VSK A;  3E9P A;  4YOT A;  1BU6 O;  3KVG A;  2IAJ A;  4IOX A;  2P9I A;  4M3X A;  2IS3 A;  2JLE A;  3UE5 A;  1DEJ A;  1YIT N;  1YIJ N;  1C1C A;  4CGI A;  3B6O A;  1KD1 O;  3AVC A;  4A62 A;  2W40 A;  3VA3 A;  4BRM A;  5JEN A;  1X9W A;  3JYT A;  3FZH A;  1QSL A;  5FRN A;  1QHT A;  3K5M A;  4DLG A;  1WAF A;  1N36 K;  4KTQ A;  3R3L A;  4FJ7 A;  4IJN A;  3THX A;  1L3S A;  3KLI A;  3HL8 A;  4H0V B;  3O4N A;  4B3M K;  3CCE N;  3AVI A;  3ZX3 A;  2V51 B;  2FBV A;  3NFA A;  2UYT A;  2QKK A;  5AQK A;  3DRR A;  3RMB A;  2YHA A;  2GEM A;  4KHS A;  3CF5 L;  5KGW A;  2BE2 A;  4NB4 A;  1XMQ K;  1TUY A;  3VGK A;  2YX6 A;  3LDQ A;  1GLE G;  4A2A A;  3KK7 A;  4PHT X;  3CJA A;  5HP1 A;  3GOI A;  3RTV A;  1SZ2 A;  2HHU A;  3K9J A;  3DWL A;  1OH5 A;  2XY8 A;  2A5X A;  3HVR A;  4CBW A;  4CJU A;  4DFK A;  2E2P A;  1A5X A;  1ZBS A;  3LPT A;  1SL1 A;  1NJW A;  4BEB A;  2O8C A;  4IBN A;  3AVN A;  1S1V A;  4CJR A;  5GIN A;  3MED A;  3PX4 A;  5HBM A;  4JKF A;  4CZI A;  4KI6 A;  4CK2 A;  1XMO K;  3I56 N;  3V1R A;  1TGO A;  1A5V A;  3C0B A;  3A0I X;  4M3W A;  2YJF A;  1U2V A;  3BEX A;  3TAF A;  3HPG A;  4DTO A;  3QML A;  1ATR A;  4LD0 A;  2F9W A;  3SQ2 A;  4XEI A;  2UXB K;  1FK9 A;  2HHQ A;  2E2N A;  4O0I A;  4KHN A;  5AZJ B;  3DMJ A;  3SYZ A;  2YHX A;  1Y64 A;  4EP5 A;  4MFB A;  3SPZ A;  1HJR A;  3EZW A;  3OYC A;  3I8B A;  3VTH A;  2A1R A;  3L2Q A;  2Q31 A;  3F2K A;  5F2R A;  3SAF A;  3ZSZ A;  2QK9 A;  4KH6 A;  4KHY A;  2Q97 A;  3C6H A;  3HM9 A;  2KQ2 A;  2GWK A;  1C6V A;  2E2Q A;  4F9O A;  2O4I A;  4IG0 A;  4XIU A;  4DQQ A;  3L3V A;  4K25 A;  4K42 A;  4B1Z A;  4CJT A;  2YKN A;  1FW6 A;  4JK9 A;  5BPN A;  2GTD A;  3SJJ A;  1TK0 A;  1OH8 A;  1NGA A;  4B3T K;  3G25 A;  3CHW A;  1WOQ A;  4BRD A;  4EP4 A;  4EIA A;  3H46 O;  2VG6 A;  3L4Q A;  4CW7 B;  3EN9 A;  4F3O A;  1RT1 A;  1R59 O;  1RBV A;  3LZJ A;  4KFB A;  4PL7 A;  3OS2 A;  4QAG A;  1NKB A;  5J1E A;  2PYL A;  4LF8 K;  4DV5 K;  2OPQ A;  1BG3 A;  1Z25 A;  1S1W A;  3EEQ A;  1IBL K;  2IDO A;  5KPR A;  3S3O A;  4BGB A;  3OBY A;  3VQP A;  5AQI A;  2O8E A;  2Q1N A;  1VQ5 N;  3T7Z A;  4R5P A;  4K41 A;  1Q9X A;  1IG9 A;  4DR4 K;  4JK7 A;  3VQC A;  3I0R A;  3SQ4 A;  3CER A;  1JL1 A;  1P8Z A;  1KAZ A;  4CIF A;  4CCH A;  4B9L A;  4MO4 A;  1KC8 O;  4DFM A;  1FKO A;  1TYQ B;  3AGR A;  3V81 A;  4YHH K;  4BY9 C;  4BQL A;  3S3M A;  3FZM A;  4PWD A;  3CCJ N;  1NGJ A;  3NDK A;  3VA0 A;  2KW4 A;  1TUU A;  3AVK A;  4G9Z A;  1RTH A;  3GE1 A;  1JKH A;  2V52 B;  3SLC A;  4AIL C;  2VGN A;  5BN8 A;  3VEZ A;  4PQU A;  3O9R A;  4BDY A;  4CHQ A;  3GBT A;  1C0U A;  4AH9 A;  1X1P A;  3J7A P;  4FLX A;  5J2N A;  4Z0U A;  4FLT A;  3OBW A;  4BVP A;  3K5L A;  3QNN A;  3KK3 A;  1WUA A;  4H5T A;  1TYQ A;  3WEE A;  3MWT A;  4GKJ K;  3QES A;  1IH7 A;  3WNE A;  2V7Y A;  3HP9 A;  3KD1 E;  4KB0 A;  2V7Z A;  4B3S K;  1YTA A;  4FWK A;  4H5V A;  3V9X A;  2VCP A;  2WUS A;  2NRR A;  1SV5 A;  4EFH A;  2PBD A;  1XI1 A;  4CJP A;  3ALY A;  1EP4 A;  1Q82 O;  3QET A;  3L3U A;  1S72 N;  2FF6 A;  2Y1J A;  3TTC A;  3VQ8 A;  3KD5 E;  4PKI A;  5KRS A;  4ZTJ A;  5TKW A;  5FLX O;  4O44 A;  4BRQ A;  4A2B A;  3NF6 A;  3AVG A;  4PKH A;  4CI6 A;  3TAP A;  2AP1 A;  1J54 A;  3BZK A;  4DV2 K;  3O4Q A;  4YOY A;  3BZC A;  2CGJ A;  3CCR N;  5LMU K;  4ISE A;  2FBT A;  2O8B A;  4H4M A;  4CEC A;  1J6Z A;  3HI0 A;  4CHO A;  5BRH A;  3THY B;  4H5R A;  2Q2R A;  3CCM N;  3HM8 A;  3SV4 A;  4DF8 A;  1YF5 L;  4J2D A;  3VGL A;  3PIP L;  3NMU A;  4N56 A;  4DSF A;  2ATQ A;  1BIS A;  3O5B A;  1TKZ A;  1W0H A;  3WNH A;  3OYI A;  1NOZ A;  1RT6 A;  3I55 N;  5AQX A;  4WFN L;  3GG4 A;  5CZ1 A;  5KGX A;  4GV9 A;  2P5G A;  1HLU A;  4E7H A;  4CD3 A;  3ZCM A;  3B8A X;  4MQ3 A;  3THW B;  3QFU A;  4RTF D;  4CF9 A;  1TVR A;  2YJE A;  5H1S Q;  3V4I A;  4GVM A;  2X6S A;  1XHX A;  2F9T A;  4CJ3 A;  3D2E A;  4CZE A;  2VWK A;  5GAE P;  3TU5 A;  4OJR A;  1NK5 A;  4CGJ A;  2CH6 A;  4DTM A;  4FJI A;  4J2E A;  5AQG A;  1LAV A;  5J2M A;  5BPL A;  3SUN A;  4OGE A;  2AA4 A;  3C6U A;  3AY9 A;  1X9S A;  3ZSV A;  3CMA N;  5FPM A;  3ZEU A;  4BRN A;  4NXN K;  5AQY A;  2E6M A;  4BG9 A;  4FYD A;  3RR7 A;  3DXM A;  1G99 A;  4FJN A;  4DLE A;  4BQZ A;  1BQN A;  1T05 A;  4BDP A;  4XH1 A;  5AQR A;  4E3S A;  4CD1 A;  4BRA A;  3PSF A;  5JLH A;  2IVP A;  3OW2 M;  3QIN A;  5JS2 A;  5I9E B;  4B9Q A;  5AR0 A;  1SL2 A;  1VK0 A;  4CJ4 A;  2HNZ A;  2HBJ A;  5C42 A;  1IBK K;  4JRQ A;  1CLQ A;  4JKG B;  1NMN A;  1YJ9 N;  3J80 O;  2ASP A;  1NGG A;  4CF8 A;  1Z26 A;  3BP8 A;  3M8P A;  2YI1 A;  3O1W A;  1CZA N;  1IG8 A;  2QWO A;  5DM7 L;  3RSE B;  1NM1 A;  3B6P A;  4KH5 A;  3DRP A;  3P39 A;  1JCG A;  4E7J A;  1QVF M;  3TTF A;  2D0O A;  3CJ1 A;  3RMC A;  3LP3 A;  3G4S N;  4AM7 A;  2NRX A;  4DTP A;  3H08 A;  3NF8 A;  4FWN A;  4DMN A;  1D9F A;  1YVN A;  4OKJ A;  3MN9 A;  2RHK A;  3Q7B A;  4OVL A;  3TAN A;  4CJL A;  3ENO A;  1K8K A;  2E4L A;  3KIO A;  3ZSW A;  4OLA A;  1NK7 A;  2D0B A;  4N47 A;  1JJ2 M;  1IBM K;  3CC7 N;  4BR9 A;  3EYZ A;  2KKZ A;  1BIU A;  3U9Z A;  2NRW A;  4Z4F A;  3ZSX A;  1CXQ A;  1GOC A;  4BAC A;  1TL3 A;  1NWK A;  3L0Q A;  1U6Z A;  4DS5 A;  3V9S A;  1SKS A;  3AA3 A;  4EZ9 A;  1KLM A;  2ASO A;  2X6N A;  3ENH A;  1JLF A;  3VQB A;  5AFU H;  4DSE A;  1S6P A;  4YNQ A;  4JK8 A;  3CYG A;  4PUO A;  4HUE A;  1L3V A;  4JS5 A;  2C1I A;  1H1V A;  4KV8 A;  4E7L A;  3HO1 A;  4FWP A;  3CPW M;  3QO9 A;  4X65 K;  4DV6 K;  3TAQ A;  4BRL A;  2HHH K;  2X74 A;  4I9Q A;  5AZJ A;  4DR3 K;  2DTU A;  2HNY A;  3LP2 A;  5BR9 A;  3U6F A;  1QSS A;  1KVB A;  2RN2 A;  1RTI A;  3AVF A;  3HT3 A;  2J4R A;  3AGK A;  1ASV A;  2YHW A;  4WQ5 C;  5HRO A;  4M3T A;  5ADX A;  4N76 A;  4DR7 K;  3V1O A;  3IAY A;  3QBW A;  4FZY A;  3TR8 A;  1W7A A;  4KAZ A;  1SUQ A;  1YUW A;  3IFR A;  2BUP A;  2QW9 A;  1HNI A;  3LAL A;  2HHI A;  3NH2 A;  3VF6 A;  2HMI A;  1QZ6 A;  3SAG A;  4H0T B;  3DLK A;  2OPP A;  3SBG A;  1HNX K;  1BCM A;  4IOC L;  3ASM A;  3MEG A;  3I33 A;  1QSY A;  3QLH A;  3K0S A;  5LMN K;  4DTS A;  2HW3 A;  4KRF A;  1JLQ A;  4IWV A;  3ZET B;  3CPE A;  3K57 A;  2P9K A;  3D45 A;  2BDP A;  2Q0U A;  4LF9 K;  3G71 N;  2FSJ A;  3ZET A;  1VQ7 N;  1Q8I A;  2ZF5 O;  2P9N B;  3E66 A;  2I7P A;  3NF9 A;  4B08 A;  1MDU B;  4KO0 A;  3UKR A;  2ITG A;  2YKM A;  3K2P A;  4BR5 A;  2W00 A;  4FJ5 A;  4CZK A;  4BEC A;  4A5A A;  3C7N B;  4CJF A;  4FLV A;  4ZTF A;  2E2O A;  3CJC A;  1BA1 A;  1BHL A;  4O55 A;  2ZD1 A;  5C2D A;  3ZX2 A;  3IS9 A;  1J9A A;  5JLF A;  1N5Y A;  3SNN A;  5JIC A;  4FO0 A;  1UAX A;  2CH5 A;  3MK6 A;  3I8D A;  3K5O A;  5E84 A;  2F4V K;  3SAH A;  4FJM A;  3RRG A;  2IGI A;  4H8K A;  3D2E B;  3WEE B;  5AQP A;  1VSH A;  4DUY K;  5M1O A;  4Q0B A;  4N5S A;  1VQ4 N;  4AM6 A;  4IO8 A;  3KLH A;  4CGD A;  2Z1H A;  1BUP A;  2QWM A;  3HBT A;  4B1V A;  3EKS A;  4W5N A;  4JKH A;  3A8Y A;  4O0J A;  3OYL A;  1KAX A;  1WSG A;  3QEV A;  1YXQ A;  3A5L C;  1NJZ A;  1VRT A;  4JI1 K;  1KSP A;  4JI5 K;  1ZC6 A;  1TV6 A;  3SBT A;  3OY9 A;  4FLY A;  3Q7C A;  4E0D A;  4M42 A;  3O9S A;  5FPD A;  1WB9 A;  4E89 A;  2HOE A;  2P9P A;  2DY4 A;  2QM1 A;  4FWM A;  1WN7 A;  1T8E A;  1IKX A;  3OTO K;  4KKO A;  3AVM A;  5CY4 A;  1DTQ A;  1SQK A;  4FZX C;  2F7T A;  3CET A;  1ILY A;  3NH0 A;  3V9Z A;  1NK6 A;  3RSE A;  2YNH A;  3MMV A;  3NF7 A;  4W5T A;  4DFP A;  1QS4 A;  2R7Y A;  1NOY A;  1RDB A;  4MLE A;  3WNG A;  3RWU A;  4C8N A;  1NK0 A;  1J5O A;  4CEE A;  3VEX A;  4CZH A;  2ZGY A;  3OYE A;  1B9D A;  1B9F A;  2CGL A;  4DSJ A;  1EWR A;  3EE9 A;  4M7X A;  4BGA A;  1N6Q A;  2O8D A;  3F9M A;  4JRP A;  4RW8 A;  4A61 A;  5HRP A;  1SS6 A;  2AJQ A;  3HST B;  4C1N I;  2D5R A;  2RKI A;  2ZQB A;  5EX5 A;  3O08 A;  3DLL L;  3KZB A;  4KHQ A;  1C1A A;  4E19 A;  5IT9 O;  4DU3 A;  2D0P A;  3AO4 A;  3DOL A;  4J2B A;  1RNH A;  3SPY A;  4NXM K;  1RT7 A;  2VWB A;  3L8B A;  2EWS A;  1GOB A;  1VQO N;  3VMF B;  2NRH A;  2XRI A;  3HSC A;  3DXM B;  3ZT4 A;  3CQ8 A;  1SKR A;  3FZL A;  4DTR A;  2KFN A;  3M8S A;  2HMP A;  4BR4 A;  3NAE A;  3CFR A;  1G15 A;  2D0A A;  3MWP A;  1QQO A;  1Z6R A;  4Q5V A;  4HVJ A;  4IFE A;  4ID1 A;  2P9P B;  4WFA L;  4W5O A;  4M3Z A;  3R8E A;  2QWN A;  4JI0 K;  3HOT A;  1B92 A;  4EAH D;  4LF7 K;  3HVT A;  4DS4 A;  1VRU A;  3AVJ A;  3WUH A;  3QB0 A;  4DQ8 A;  3W3D A;  3O3H A;  4I6M B;  3NBP A;  3L2R A;  1T3V A;  3CC4 N;  1U4B A;  2HF4 A;  1K8A O;  1ZBF A;  2F8S A;  2IC3 A;  1L5U A;  4W5R A;  4FM0 A;  4CFD A;  3OYF A;  3AA4 A;  3CJB A;  3AVH A;  3F73 A;  3WQU A;  1RTD A;  4AHS A;  2PFU A;  4M3U A;  1T44 A;  5FRO A;  5FDL A;  4JKE A;  3MX5 A;  1EO1 A;  4DV3 K;  4NCA A;  3O8M A;  3C94 A;  4DV1 K;  3WQT A;  4JN4 A;  5C0Y A;  5E26 A;  3S41 A;  4CJ7 A;  1S1U A;  5CYQ A;  1T7P A;  3AAQ A;  3V6D A;  4FK4 A;  3VQQ A;  3D7E O;  4LSN A;  3LM2 A;  3SI6 A;  1YT3 A;  4CJW A;  3H6E A;  1YJW N;  4FW1 A;  2RE2 A;  4E1N A;  4JS4 A;  2A40 A;  1HR0 K;  2G8K A;  1VQN N;  1M90 O;  4IXC A;  3KKS A;  2XY5 A;  4AHU A;  3HXM A;  2GEL A;  4K8X A;  1RBS A;  1VQ8 N;  4IDK A;  5C15 A;  4QS9 A;  2FSK A;  1HJO A;  3PX6 A;  3SV3 A;  1S3X A;  4WQ5 A;  4KHW A;  1ASU A;  3VEY A;  3OYN A;  3M8Q A;  5F0X A;  2ZJR L;  4PY5 A;  2ZWH A;  1CZ9 A;  2W6K A;  1HUX A;  4I9L A;  3LAN A;  3JXU A;  4NO7 A;  1J53 A;  4RWT A;  3KLF A;  2Z1G A;  4DR6 K;  3HZ6 A;  4M3R A;  5HRR A;  5AQW A;  4FWR A;  5AQH A;  2VQF K;  4KI4 A;  3T1A A;  1NGE A;  3G6E N;  5LJW A;  1IO2 A;  3QEW A;  4DR1 K;  4CFC A;  2DFE A;  4IG3 A;  4PKG A;  1TKD A;  4J2A A;  4JKA A;  3SJH A;  2FC0 A;  3OHR A;  5SWM A;  1NK9 A;  2D1K A;  5AQM A;  3ZLJ A;  3C65 A;  4LSL A;  4QS7 A;  3U8X A;  3VQ6 A;  3O9U A;  3AO5 A;  3O6W A;  4BRC A;  4K8Z A;  1WLJ A;  3TAE A;  3LDO A;  2EX3 A;  2E1Z A;  4B8C A;  4E7I A;  4HUG A;  3VTI A;  1RDA A;  3NHG A;  1RDC A;  1HPZ A;  4B3R K;  2OPR A;  2O4G A;  5CR4 A;  3DM2 A;  3OYJ A;  2A6A A;  1VQ6 N;  4FJ8 A;  1RBU A;  3UKR B;  2QXL A;  1HX1 A;  4ILJ A;  5DK5 A;  4W5Q A;  4OKE A;  1X9M A;  3FZF A;  1QQC A;  1RBR A;  4CEB A;  1BO5 O;  1KXP A;  4ID5 A;  2WFB A;  3BUZ B;  4CF2 A;  4FK2 A;  4FJJ A;  4WQ4 A;  3RR8 A;  3DXK B;  4YOW A;  4DV7 K;  3CYM A;  4C23 A;  5KQD A;  2PAV A;  2ETJ A;  3CM6 A;  1NK4 A;  1O13 A;  1HNZ K;  2WON A; 
#chains in the Genus database with same CATH homology
 2KHO A;  1H1V A;  4BRO A;  4R79 A;  4IOA L;  2E8A A;  3D2F A;  4ILH A;  3MN6 A;  4FPA A;  4CZM A;  3CCU N;  4FWP A;  3L4I A;  3CPW M;  3M3Z A;  1P90 A;  5TKY A;  4BR2 A;  5HOO A;  2NRZ A;  3HOS A;  3FR0 A;  3KWG A;  3QFP A;  4K43 A;  4M7Y A;  3EO3 A;  3NVM A;  2NRV A;  4IDH A;  3R9P A;  3R1X A;  3UKU A;  4M63 C;  3EKU A;  1NGC A;  4BRL A;  1X9J A;  3GL1 A;  2NRT A;  3M1F A;  4A59 A;  2BH1 A;  2I7N A;  5AZJ A;  1VQK N;  3MDQ A;  1QQM A;  4CZG A;  4DB3 A;  1NMD A;  1Q81 O;  4J8F A;  5GAG P;  2HBL A;  2FLO A;  5BR9 A;  2ZJP L;  3BF1 A;  1KQS M;  3UB5 A;  3E9P A;  1BU6 O;  4YOT A;  3KVG A;  4IOX A;  2P9I A;  4MDB A;  5ADX H;  3CME N;  4B1W B;  1RGI A;  2J4R A;  3VEO A;  3AGK A;  3UE5 A;  2YHW A;  1DEJ A;  4WQ5 C;  3ZEU B;  1YIT N;  1GLL O;  4NLC A;  1YIJ N;  1E4F T;  3IDH A;  5CE3 A;  2W41 A;  5ADX A;  3CIP A;  1KD1 O;  4A62 A;  2W40 A;  3VEV A;  4BRM A;  4BR0 A;  2OTJ N;  5BRE A;  3FZH A;  3QBW A;  5DM6 L;  4OPH A;  4OPA A;  1YUW A;  4B1X B;  4IJA A;  5AQV A;  3IFR A;  2BUP A;  1RDW X;  4GV3 A;  1JCE A;  3R3L A;  2QW9 A;  3HTV A;  4IJN A;  3VF6 A;  4Y0W A;  1QZ6 A;  3A5N C;  3SAG A;  3C6A A;  4H0T B;  3E9O A;  4H0V B;  3DJC A;  3SBG A;  3CCE N;  3ZX3 A;  1N8R O;  2V51 B;  1NGH A;  1T6C A;  4IOC L;  2UYT A;  1MWM A;  5AQK A;  1K9M O;  3I33 A;  5M1N A;  4H0O A;  2QWR A;  1BOT O;  2GEM A;  2HBM A;  5FPN A;  3CF5 L;  3O9T A;  4NB4 A;  1KAY A;  1TUY A;  3FZK A;  3ID6 A;  3VGK A;  4IWV A;  4WFB L;  3ZET B;  2FF3 B;  2JWL A;  2YX6 A;  3LDQ A;  2KLA A;  3CPE A;  4IZ9 A;  4LC9 B;  1GLE G;  1V4S A;  4A2A A;  2P9K A;  3QBX A;  4HTL A;  2Q0U A;  4I6M A;  3KK7 A;  5AFU A;  4JD2 B;  2FSJ A;  3KWI A;  4PHT X;  3ZET A;  3G71 N;  3CJA A;  1VQ7 N;  3GOI A;  2ZF5 O;  2P9N B;  3E66 A;  1SZ2 A;  2I7P A;  3K9J A;  3DWL A;  1MDU B;  3VF4 A;  3UKR A;  2A5X A;  4A57 A;  4CBW A;  4BR5 A;  2E2P A;  1ZBS A;  3F5T A;  2W00 A;  4BEB A;  3NVK A;  1HPM A;  3VET A;  3WXJ A;  4CZK A;  4BEC A;  4A5A A;  5GIN A;  3C7N B;  2E2O A;  3CJC A;  1BA1 A;  5BN9 A;  4XH5 A;  4H0Y B;  4B1Y B;  4BC5 A;  5F1X A;  3FLC O;  3H3O B;  4JKF A;  4BG8 A;  4CZI A;  5C2D A;  4FOE A;  3TSP A;  3ZX2 A;  3MCA B;  5JLF A;  3I56 N;  1GLC G;  5AQU A;  3C0B A;  5BRD A;  5JIC A;  3A0I X;  4JKD A;  2YJF A;  4FO0 A;  2CH5 A;  1W97 L;  1U2V A;  3BEX A;  3MK6 A;  4GNI A;  1Z05 A;  2QWL A;  5E84 A;  1OKJ A;  5KPZ A;  3ATV A;  1QVG M;  3SAH A;  3OA9 A;  5MLC Q;  2P9K B;  4H0X B;  5C12 A;  4QS8 A;  3QML A;  1ATR A;  2F9W A;  1LCU A;  3VPZ A;  3D2E B;  4XEI A;  3E9L A;  3WEE B;  2GX9 A;  2E2N A;  5AQP A;  1M1K O;  3IUC A;  5AZJ B;  4BRF A;  5M1O A;  2YHX A;  1Y64 A;  5C10 A;  4AM6 A;  1VQ4 N;  4IO8 A;  2P9L B;  2E20 A;  3EZW A;  3I8B A;  3VTH A;  1EQY A;  3FFK B;  1BUP A;  4ISF A;  5JMV A;  2Q31 A;  2QWM A;  3F2K A;  1XQS C;  1D4X A;  3E1Y A;  3HBT A;  3EKS A;  5F2R A;  4B1V A;  3SAF A;  5AQS A;  4KH6 A;  1VQP N;  4JKH A;  2Q97 A;  3A8Y A;  3C6H A;  4H03 B;  3CD6 N;  1BWF O;  3CXC M;  1KAX A;  4BC3 A;  1X3N A;  1YXQ A;  5AQF A;  5B8H A;  2GWK A;  2OTL N;  3A5L C;  3WXM B;  2E2Q A;  1X3M A;  4F9O A;  1SAZ A;  3CQX A;  5AQO A;  3SK3 A;  3DXK A;  1ZC6 A;  4K25 A;  4K42 A;  3SBT A;  4B1Z A;  1U2V B;  3R6M A;  4BRP A;  3Q7C A;  4JK9 A;  5BPN A;  2GTD A;  1NGB A;  3O9S A;  3O9Q A;  2P9L A;  5FPD A;  5EY4 A;  4H5N A;  1NGA A;  2HOE A;  1S22 A;  3CHW A;  1WOQ A;  3G25 A;  4JHD A;  4BRD A;  4EIA A;  3H46 O;  4MDA A;  1OVY A;  2P9P A;  1GLB G;  3HRG A;  3L4Q A;  3QDK A;  2ZGZ A;  2QM1 A;  1VAZ A;  3EN9 A;  5LY3 A;  4FWM A;  1R59 O;  4PL7 A;  1DT9 A;  3VEN A;  5AZI A;  5M1K A;  2P9S B;  1ATS A;  3ATU A;  1BG3 A;  3H3N O;  3LM9 A;  4EHU A;  1SQK A;  1K8K B;  4XJX A;  3D2F B;  5KPR A;  2F7T A;  4BGB A;  2IVO A;  3CET A;  1ILY A;  3OBY A;  3RSE A;  4YOV A;  5EXW A;  5AQI A;  3MMV A;  4YDU C;  4BC2 A;  2Q1N A;  1VQ5 N;  1GLD G;  1VQL N;  3T7Z A;  4K41 A;  4MLE A;  4JK7 A;  4GY2 B;  2P9U B;  3CER A;  4RCH A;  3VEX A;  4CZH A;  1Q7Y O;  1P8Z A;  2ZGY A;  1KAZ A;  2CGL A;  3TPQ A;  4FPB A;  2P9U A;  3EE9 A;  1NGI A;  4PL8 A;  4GV6 A;  4M7X A;  4MO4 A;  4BGA A;  1KC8 O;  1Q18 A;  1TYQ B;  3AGR A;  3F9M A;  4BY9 C;  4BQL A;  4A61 A;  4JEP A;  1SS6 A;  3FZM A;  4JKC A;  4C1N I;  3CCJ N;  1NGJ A;  4FWS A;  1YHQ N;  5EX5 A;  4EHT A;  1TUU A;  4G9Z A;  3GE1 A;  3LDL A;  3O08 A;  3DLL L;  2V52 B;  3SLC A;  3KZB A;  4WYB A;  5GAD P;  2VGN A;  5BN8 A;  3VEZ A;  3O9R A;  1GLF O;  2D0P A;  3GBT A;  4WCE L;  3C7N A;  2NNW A;  4WF9 L;  4BVO A;  2VWB A;  4FWL A;  3CCV N;  2EWS A;  3OBW A;  3L6Q A;  4BVP A;  1VQO N;  1QQN A;  3M6G A;  3VMF B;  2OAN A;  2NRH A;  1WUA A;  2D4W A;  4H5T A;  5EOY A;  1TYQ A;  4UY8 O;  1BA0 A;  3HSC A;  3WEE A;  3DXM B;  3ENB A;  2Q0R A;  3MWT A;  2FXU A;  3FZL A;  4NLB A;  1YJN N;  2YHY A;  2V7Y A;  3VGM A;  1Q86 O;  1V4T A;  2WC9 A;  5M1P A;  2HMP A;  4BR4 A;  2V7Z A;  1NLV A;  3FGU A;  4A5B A;  4FWK A;  4H5V A;  2VCP A;  2WUS A;  2NRR A;  4Z94 A;  4EFH A;  3IMX A;  2E1Y A;  1GLJ O;  2PBD A;  1QQO A;  1Z6R A;  3CQY A;  3M5R A;  3MWP A;  5AQT A;  2C1I A;  3CCL N;  1NGF A;  4IFE A;  1Q82 O;  2P9P B;  4WFA L;  3UKU B;  1HKB A;  3R8E A;  2QWN A;  5AQZ A;  1ESV A;  1IJJ A;  4JKG A;  5BRF A;  3A5M C;  2FSN A;  4E1J A;  4U7B A;  2FF6 A;  3O4W A;  3TTC A;  4EAH D;  3HOT A;  1S72 N;  4BRK A;  4PKI A;  2QWQ A;  2ITM A;  5TKW A;  3WUH A;  3QB0 A;  2P9S A;  4IEE A;  4CZL A;  4BRQ A;  4DQ8 A;  3AAR A;  3W3D A;  4A2B A;  3AAP A;  1LOT B;  4BRI A;  4PKH A;  4CI6 A;  1NJI O;  3GDQ A;  4I6M B;  2AP1 A;  3EE8 A;  3ULE B;  1T3V A;  4YOX A;  3CC4 N;  1VQ9 N;  2A41 A;  2HF4 A;  1K8A O;  4YOY A;  5KQ8 A;  5CHI A;  2CGJ A;  3CCR N;  4ISE A;  3FE1 A;  1J6Z A;  3HI0 A;  5BRH A;  1VQM N;  3D6R A;  3CJB A;  4H5R A;  2Q2R A;  3CCM N;  3HM8 A;  3WQU A;  1YF5 L;  2E88 A;  2P9I B;  3K9K A;  3VGL A;  2GWJ A;  5ELZ A;  3PIP L;  2QTD A;  4FSV A;  3NMU A;  4H5W A;  4OO1 J;  2IVN A;  3P31 A;  2QEX N;  3J7Z O;  2P9N A;  2PFU A;  3TSQ A;  1C0G A;  1T44 A;  3O5B A;  1MWK A;  3CI5 A;  4YDU A;  4JKE A;  3U9D A;  3WXL A;  3MX5 A;  4B1U B;  3I55 N;  4FWO A;  2WBN A;  5AQX A;  4WFN L;  3GG4 A;  1EO1 A;  3W0L A;  3O8M A;  3CC2 N;  4BC4 A;  4BE7 B;  3WQT A;  4GV9 A;  2YCH A;  4JN4 A;  1HLU A;  5C0Y A;  4CD3 A;  3B8A X;  5E26 A;  3S41 A;  4CJ7 A;  4YOU A;  3QFU A;  3AAQ A;  3RVC A;  4RTF D;  4L3Q A;  3H45 C;  1GLA G;  2YJE A;  3D7E O;  5H1S Q;  3LM2 A;  4H0P A;  2F9T A;  3H6E A;  3D2E A;  4MO5 A;  4BRG A;  1YJW N;  2RE2 A;  4BR7 A;  4CZE A;  4DCH A;  2A40 A;  3LDN A;  4WQ4 C;  1ZXO A;  3N4P A;  4JD2 A;  3MCP A;  5GAE P;  3U4L A;  1VQN N;  3PLA A;  3TU5 A;  1M90 O;  4IXC A;  2BTF A;  2CH6 A;  3CCS N;  4FOI A;  3JS6 A;  5AQG A;  2GEL A;  1VQ8 N;  1C0F A;  3T69 A;  3A5O C;  5BPL A;  5C15 A;  3ULE A;  4QS9 A;  2FSK A;  5JVH L;  1HJO A;  4CBX A;  1S3X A;  4WQ5 A;  5M1Q A;  5GAH P;  2AA4 A;  3VEW A;  3SMP A;  3VEY A;  2HF3 A;  3EL2 A;  3AY9 A;  4JHD B;  3CCQ N;  3CMA N;  5FPM A;  5F0X A;  2ZJR L;  3ZEU A;  4BRN A;  5JVG L;  5AQY A;  2ZWH A;  3WXK A;  4BG9 A;  4DKW A;  3DXM A;  1G99 A;  4BQZ A;  1HUX A;  5AZI B;  4GVE A;  3JXU A;  2H3G X;  4NO7 A;  4XH1 A;  5AQR A;  3WT0 A;  4CD1 A;  4BRA A;  4RWT A;  3TSU A;  1RFQ A;  3HZ6 A;  3MN5 A;  4IEI A;  5BPM A;  5JLH A;  4IO9 L;  5AQW A;  2IVP A;  4FWR A;  3OW2 M;  5KPT A;  5GIP A;  5I9E B;  4B9Q A;  5AQH A;  1YAG A;  5AR0 A;  5EVZ A;  4FVU A;  2C1G A;  1HKG A;  2HBJ A;  1NGE A;  3N4Q A;  3G6E N;  5LJW A;  4JKG B;  1ATN A;  1NGD A;  1MA9 B;  3CJ7 A;  3LL3 A;  3P38 A;  2ASP A;  1YJ9 N;  2A42 A;  1NGG A;  3SMS A;  1BDG A;  2QI2 A;  2DPN A;  4PKG A;  2VGM A;  3BP8 A;  2YI1 A;  3O1B A;  4JKA A;  3O1W A;  3SJH A;  4ISG A;  5M1F A;  4ILG B;  2IIR A;  4O5F A;  2NLX A;  3OHR A;  2ASM A;  1CZA N;  5AQJ A;  1IG8 A;  2QWO A;  5AQL A;  3BF3 A;  2D1K A;  3VOV A;  5AQM A;  3O80 A;  4BRH A;  5DM7 L;  1NM1 A;  3C65 A;  4JAX A;  3RSE B;  3P4I A;  4KH5 A;  4QS7 A;  3U8X A;  3PIO L;  3P39 A;  1JCG A;  4FL9 A;  3O9U A;  1YI2 N;  1QVF M;  3TTF A;  2D0O A;  3O6W A;  4BRC A;  2A3Z A;  3CJ1 A;  1QHA A;  4C1N K;  5FPE A;  3J8A A;  2VYP A;  1JCF A;  1T6D A;  4KH4 A;  3G4S N;  4AM7 A;  2NRX A;  1K73 O;  5HL7 L;  4FWN A;  1YVN A;  5AQN A;  3LDO A;  2HBK A;  3MN9 A;  4KBO A;  1DKG D;  2QA4 N;  2E1Z A;  2NZT A;  2RHK A;  3Q7B A;  4HWI A;  4JNE A;  1W2B M;  3VTI A;  1DGK N;  3ENO A;  4O8U A;  2QWP A;  1K8K A;  4MLH A;  3MX2 A;  3VES A;  1JJ2 M;  2JWK A;  1XUP O;  3H1V X;  3IKM A;  3KHY A;  5CR4 A;  2A6A A;  3TTD A;  1HKC A;  4BRE A;  3CC7 N;  4BR9 A;  2KKZ A;  1VQ6 N;  3U9Z A;  2NRW A;  4JKB A;  2Q36 A;  2QXL A;  3UKR B;  1HX1 A;  4ILJ A;  4U67 L;  5C2F A;  3CJ9 A;  4DHY A;  2CGK A;  3H1Q A;  3ZX0 A;  3LDP A;  3FZF A;  3DAW A;  3VF2 A;  4YOR A;  2GUP A;  1NWK A;  4CZF A;  4FWQ A;  1BO5 O;  1KXP A;  1U6Z A;  3L0Q A;  4O8K A;  2ZJQ L;  3MN7 A;  3ZYY X;  2WFB A;  1RDU A;  3BUZ B;  1E4G T;  3ID8 A;  2ASO A;  3ENH A;  4CBU A;  3WXI A;  2HST A;  5AFU H;  4WQ4 A;  4XH4 A;  3DXK B;  4YOW A;  5AQQ A;  3QIC A;  3VER A;  4JK8 A;  4CZJ A;  5LJV A;  1XC3 A;  4C23 A;  5KQD A;  2PAV A;  4AF1 A;  1QZ5 A;  5GIO A;  1O13 A;  1NBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...