1K8KB

Crystal structure of arp2/3 complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
190
structure length
190
Chain Sequence
GVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN-LIKE PROTEIN 3
publication title Crystal Structure of Arp2/3 Complex
pubmed doi rcsb
molecule tags Structural protein
total genus 51
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1k8kB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1k8kB02
4BGAA 3VEOA 2YI1A 5E84A 3DAWA 1NGCA 5CE3A 5F1XA 1JCEA 3VEWA 5KQ8A 3LDNA 3QFUA 4NB4A 4CBUA 4BQZA 4IJAA 4BROA 1T6DA 1XUPO 3WQUA 4GY2B 1GLFO 3WQTA 5E26A 1NGFA 4H0PA 2CGJA 4I6MA 2P9SA 4HWIA 4B1XB 2FXUA 3JXUA 4CZMA 3S41A 3RSEB 1V4SA 4IZ9A 1DKGD 4B1WB 3FFKB 4H5NA 4E1JA 2ZGYA 3H45C 4YDUA 4CD3A 3H3NO 4BR0A 3D2EA 4B1VA 1NM1A 1TUUA 2ZF5O 4FWKA 4XH5A 1ZBSA 1NGEA 4IXCA 3LDPA 5BRFA 2QWOA 2A6AA 5ELZA 4CZJA 1SAZA 4BRAA 1GLEG 2DPNA 3O8MA 4ISGA 2YHXA 4CZHA 4DCHA 1G99A 3UE5A 1MA9B 5LJVA 2Q0RA 4PL7A 4CZEA 5JICA 2QWLA 4H0XB 4BG9A 3FR0A 3VEVA 2P9KB 1ATSA 3UB5A 4WQ4C 4K41A 5B8HA 3CQYA 3TU5A 5F0XA 4WQ5C 4A61A 4Z94A 4FWNA 3U4LA 3F9MA 3CJCA 3WXIA 3CI5A 4PKIA 3I8BA 4DHYA 3WEEB 1T44A 3O80A 1TUYA 1TYQB 2E20A 2GWKA 4DQ8A 1NGJA 4JD2A 3O08A 4H5VA 4QS9A 2NZTA 1BA1A 3HBTA 4JHDB 4IWVA 3DJCA 1LCUA 3VEYA 4IJNA 2CH5A 4C23A 4JN4A 2QW9A 1QQNA 2Q2RA 3QBWA 5AQPA 1KAXA 3L4IA 2P9LA 1MDUB 2I7PA 1HPMA 3EO3A 3O4WA 3ATVA 4GNIA 4BRNA 3ULEB 4QS7A 2Q97A 2QWPA 3EKSA 3GG4A 5TKYA 2Q1NA 5AFUH 1GLLO 5AQMA 3VPZA 1NGGA 5AQQA 4K43A 2J4RA 3SK3A 2E2OA 3C7NA 3HSCA 3SLCA 3ATUA 2FSKA 5AZJA 2YCHA 3UKUA 3LDOA 4FPAA 4XEIA 5AFUA 3DXKA 3L0QA 5AQVA 3QB0A 3ZX2A 3OHRA 5JLHA 1Z05A 2I7NA 4CZLA 4HTLA 3JS6A 3MN5A 3WXJA 3ZEUA 1ATRA 3WXLA 1X9JA 4WQ4A 1K8KA 3DXMB 3M3ZA 2E2QA 2BTFA 3H46O 5KPTA 3M1FA 4WQ5A 3FZLA 4BR5A 5AR0A 2EWSA 2UYTA 3MN9A 3VENA 1P8ZA 3VESA 4B1ZA 1BG3A 4BRCA 3BF3A 4AM7A 2ZGZA 3KZBA 4O8KA 2IVOA 4EHUA 3VGLA 1KAZA 1HKCA 2PAVA 1SQKA 3LDQA 1MWMA 3AAQA 3EKUA 1HKBA 4RCHA 4A62A 4CZIA 1U2VB 3A0IX 3UKRB 5BPLA 2HF4A 2FSJA 4F9OA 4QS8A 1BWFO 3ZETB 1U6ZA 3BUZB 4B9QA 3FZFA 3BEXA 1OKJA 3M6GA 4IO8A 4NO7A 2BUPA 2QXLA 1R59O 3RSEA 4BG8A 4BR2A 2P9PA 3VGMA 2NRHA 2F9TA 5FPMA 2HF3A 3ID8A 2A40A 3CERA 4MO5A 1QZ5A 5FPNA 3SJHA 4H0YB 1WUAA 4J8FA 4BGBA 2IIRA 1HX1A 5EOYA 4BRDA 4FO0A 1BO5O 3J8AA 4XH4A 1GLCG 3D2EB 5AQRA 3U9ZA 2P9IB 3CETA 4CZFA 2GEMA 2HMPA 5KQDA 1BA0A 4FOIA 3FGUA 3A5NC 4Y0WA 3GBTA 5AQJA 1QQOA 4EIAA 3GE1A 3CJ9A 3O1BA 2FF3B 2ITMA 4EAHD 3HZ6A 3H1QA 1NLVA 3VEXA 3D2FA 1H1VA 2CH6A 4FWQA 5EXWA 4BR9A 4FWMA 4ISFA 2VCPA 4CZKA 4JNEA 4BC4A 5AQNA 4FPBA 4K25A 3EZWA 5AQOA 2ASOA 5LY3A 2GWJA 3VF6A 4A2AA 3A8YA 3ZETA 4BQLA 4FL9A 3BF1A 1E4FT 3A5OC 3AY9A 1T6CA 3ZX0A 4B1YB 1NGAA 3LM9A 4JD2B 5JMVA 2IVPA 4BRQA 1YUWA 4H03B 3VEZA 3O5BA 2Q31A 3CHWA 3SMSA 3KVGA 2E88A 3U9DA 4FWOA 3LM2A 4H5TA 1GLJO 3WXKA 4L3QA 2P9LB 2D1KA 4CBWA 1C0FA 1BDGA 5AQGA 5EY4A 4BREA 5BREA 3A5LC 5AQLA 4H0VB 4PL8A 3G25A 1SZ2A 4DB3A 5AQXA 3SMPA 3GDQA 2P9NB 5EX5A 3CIPA 4M7YA 1HLUA 3ENOA 1GLDG 2NLXA 4RWTA 3P4IA 4RTFD 3CQXA 3KHYA 5AQUA 1BUPA 4CD1A 3MMVA 2PBDA 4CZGA 1DEJA 5AQHA 5AZJB 3QDKA 2HOEA 3CJAA 2W41A 3FLCO 1S22A 3TPQA 4BR7A 2P9UA 3BP8A 4JAXA 3CJBA 3D7EO 3IFRA 5F2RA 2D0OA 3ENHA 2A41A 3ZEUB 2VWBA 2AP1A 3DWLA 5AZIB 4FOEA 1MWKA 1K8KB 1NGDA 2QM1A 5AQSA 4K42A 3R8EA 3WT0A 2V7YA 4XH1A 2GTDA 4BRMA 1E4GT 1ZC6A 1U2VA 3QBXA 3UKRA 4B1UB 2CGLA 1QZ6A 3A5MC 3WUHA 4FWPA 1EQYA 2GUPA 4PKHA 3W0LA 3EN9A 3MDQA 4CBXA 3LL3A 1Q18A 4BRGA 4I6MB 1KXPA 2P9SB 2A42A 2GELA 4FWRA 1XQSC 3HTVA 1RDWX 2IVNA 1HUXA 2YHWA 5AQIA 3IUCA 2CGKA 4KBOA 4BRPA 2P9PB 3H6EA 2V7ZA 1NGBA 2W40A 4ISEA 2D4WA 2OANA 5I9EB 4BRHA 2QWQA 2FLOA 3HM8A 2P9IA 2A5XA 4H0OA 3ZX3A 3U8XA 2P9KA 5FPDA 2ASPA 1J6ZA 2QWNA 1RFQA 1HKGA 4EHTA 4H5WA 5AQYA 5ADXH 1YVNA 1NMDA 5BPMA 3H1VX 3IMXA 2FSNA 2YHYA 3R6MA 3CJ7A 4BVPA 5AQWA 1ESVA 3MCPA 3FE1A 2Q36A 3WEEA 4MO4A 1NWKA 1TYQA 1IG8A 2E1YA 2F9WA 5ADXA 2H3GX 1JCGA 2ZWHA 1IJJA 3EL2A 3FZHA 3VGKA 3AARA 4M63C 4JHDA 1X3MA 4LC9B 3D2FB 4M7XA 1NGIA 3O6WA 1KAYA 1JCFA 4BRLA 1Z6RA 2V52B 2E1ZA 2FF6A 5BRHA 1BOTO 1LOTB 4BC3A 4BVOA 4BC2A 1Y64A 3H3OB 1CZAN 3IDHA 3O1WA 4MLHA 3VF2A 2E2PA 3ULEA 3VERA 1ATNA 4CI6A 3FZKA 3B8AX 2A3ZA 2QWMA 4AM6A 4BR4A 2YJFA 1C0GA 5BN8A 4BC5A 1ZXOA 3QFPA 5BPNA 5FPEA 2YJEA 1GLAG 1DGKN 1HJOA 3AAPA 5AQTA 3C0BA 3R9PA 1WOQA 1NBWA 1GLBG 1QQMA 2E2NA 3MK6A 4YDUC 5LJWA 5BR9A 3MN7A 2AA4A 5KPRA 3VOVA 4FWSA 4BRKA 3QICA 4A2BA 5KPZA 3CJ1A 2P9NA 3MN6A 3C7NB 2Q0UA 5AQKA 3LDLA 3QMLA 1X3NA 4MLEA 1RGIA 1QHAA 3DXMA 5BRDA 3UKUB 4PKGA 3L6QA 3DXKB 2E8AA 5AQZA 5JLFA 2WUSA 3I33A 3VF4A 1S3XA 3W3DA 1BU6O 2KHOA 4BRFA 4CJ7A 2ASMA 2VYPA 3FZMA 3GL1A 1XC3A 4FSVA 4BRIA 4H0TB 3GOIA 1D4XA 5AZIA 3HI0A 5AQFA 1YXQA 3VETA 1V4TA 4H5RA 2V51B 4EFHA 2QWRA 2P9UB 1NGHA 4WYBA 2D0PA 4FWLA 5EVZA 1YAGA 4O5FA 5BN9A
chains in the Genus database with same CATH superfamily
4CHNA 4M3WA 4CJUA 2G8HA 4KI4A 1WBDA 4OJRA 3DAWA 2ITGA 1LW2A 1B9FA 3IG1A 4JI0K 2C1GA 3KIOA 4Z4HA 4GY2B 4M3UA 1SL2A 4H0PA 4FM1A 2RKIA 4B1XB 2Y1IA 4LF7K 1LV5A 3JXUA 4IOAL 4J2DA 2XY8A 1V4SA 4IZ9A 1TAUA 4FJNA 4H8KA 4O0IA 1QS4A 1NJIO 1TUUA 4FWKA 4XH5A 4IXCA 3LDPA 4W5RA 1N8RO 3DM2A 3EEQA 2W6LA 3O8MA 1RTDA 2XO7A 2YHXA 3M5RA 3HXMA 4PL7A 4CZEA 4JK7A 4CGDA 4H0XB 2OZMA 4ID5A 4W5TA 3QO9A 3VEVA 3JSMA 3MWPA 4AILC 1YI2N 4FJHA 2OPPA 4A61A 4CEBA 4Z94A 4JI2K 4J2BA 3THYA 4JS4A 3PSFA 4F3TA 1BL3A 2QXFA 2X6SA 2QKBA 1NGJA 1YVUA 4JD2A 2X74A 2G8FA 4A5BA 2NZTA 2NRRA 2HNZA 2WONA 3C6HA 1Q8IA 2G8WA 1LCUA 3VEYA 1W97L 3QEXA 3LP2A 3SJJA 1NOYA 3VQQA 4IJNA 3OYFA 4C23A 2QW9A 1QQNA 3QBWA 1UA1A 1KAXA 2I7PA 3O4WA 3ATVA 4BRNA 4PQUA 5TKYA 3GG4A 3VPZA 3HPOA 3SK3A 3NVMA 2G8VA 4CJSA 1W2BM 3DLLL 4JRQA 4FM2A 1X9WA 3TWHA 5AFUA 4W5NA 3LAMA 3L0QA 3V9WA 3ULDA 3ZX2A 3OHRA 4E7HA 3MXJA 3CPWM 4HTLA 3MN5A 3E9LA 3WXJA 4AHRA 4CJEA 5FROA 3DXMB 4KI6A 3RRGA 2Z1GA 3FZLA 4FM0A 1NOZA 2YNHA 4DKWA 1YJNN 3R1XA 1VSEA 4AM7A 5C12A 4JK8A 1WLJA 4O8KA 1TKTA 5GAGP 1KAZA 4O4GA 1ASVA 5T7BA 1MWMA 4FZZA 3AAQA 1HYSA 1HKBA 4A62A 3SUNA 3K5LA 3B6OA 3KK3A 3PO4A 3O9SA 3A0IX 3EE8A 5BPLA 2HF4A 2FSJA 1BWFO 5GAEP 2VG5A 2OZSA 4GVMA 1X1PA 3QERA 3H08A 3SI6A 4IO8A 3AVNA 1W7AA 4NO7A 2QXLA 3V81A 1R59O 4BR2A 4NLCA 1EETA 3VGMA 2OA8A 4NCGA 2F9TA 1IBMK 3OS1A 3SJHA 4DTNA 4BGBA 3OYIA 2ETJA 1L3SA 4DTRA 1BGXT 3SCXA 3VQ7A 2YKNA 1Z26A 4MQ3A 1TK5A 1VQ9N 2O8DA 4H4OA 4FO0A 3J8AA 3CETA 3LP0A 4UY8O 4Q5VA 1I39A 1K73O 5JVHL 1ASUA 5KQDA 4DV4K 4KO0A 4ZHRA 4FLWA 4CFCA 3O1BA 4FJ9A 3HP6A 1DTTA 3U3YA 3HZ6A 3H1QA 1NLVA 4F4KA 1H1VA 1IG9A 1HNWK 4W5OA 3TAQA 1ZBHA 2QK9A 5EXWA 1G15A 4BR9A 4FWMA 3T1AA 3VQPA 4OO1J 4JNEA 2P5GA 4BC4A 3I0RA 3TTCA 4OLAA 4H4MA 2ASOA 3RTVA 4FLXA 1RBSA 3OYKA 3SUOA 4JYAK 4A2AA 1QTMA 3OYHA 4JKDA 2X78A 1E4FT 3A5OC 3AY9A 1S6PA 3CXCM 4TSXA 3MCAB 3LM9A 4E7IA 4HUEA 3KLFA 1JJ2M 2GBZA 3KVGA 1WSEA 3MX2A 1CXUA 2Z1HA 3U9DA 2GX9A 2PFUA 4H5TA 3DLEA 1N6QA 4L3QA 2P9LB 1RDUA 3G0ZA 3S3OA 1DLOA 3Q7BA 4IEIA 3A5LC 5AQLA 3ZT4A 5BREA 1T05A 2NRWA 3ZSWA 4M3RA 2ZJPL 3G25A 4Z4GA 2IDOA 1SZ2A 3CIPA 4EZ9A 1JKHA 2NLXA 3P4IA 4RTFD 4CD1A 2W00A 1DEJA 3ZT3A 1KD1O 3TPQA 3CFPA 3CCQN 3CJBA 1TK0A 3CCLN 2A41A 3ZEUB 1KLNA 3L2UA 3OBYA 2AP1A 3DWLA 2HHVA 4DR1K 1VSHA 3LP1A 3WXMB 3LPUA 3P31A 4K42A 5LL6Z 1FK9A 4XH1A 2NRZA 4DF4A 3E66A 3NGYA 1JL2A 3C6TA 3WUHA 3B6PA 1EQYA 2GUPA 2ZE2A 1B9DA 4CESA 4CJWA 2HHQA 2P9SB 4KH4A 4JLHA 2WC9A 3QEWA 3OYNA 4KBOA 4K8XA 3H6EA 3ZSQA 2Z1JA 4ISEA 3SUPA 5HP1A 1C0TA 3HP9A 2QWQA 4FLZA 2DFEA 2VQEK 4H0OA 4DU4A 3EY1A 3I8DA 3U8XA 5FPDA 3M8PA 1J6ZA 4CJ5A 4AHTA 4IKFA 4BDZA 4EHTA 4H5WA 5AQYA 4CF2A 2LSNA 1Q9XA 3ZSYA 3IMXA 2HNDA 3CJ7A 4BVPA 1YITN 3MAQA 1RT5A 2HHUA 2Q36A 1HYVA 3WEEA 1S1UA 4K0KK 1NWKA 1RT4A 4DUZK 4IO9L 3OY9A 1IG8A 5J2QA 3VGKA 3N4PA 4JKHA 3IS9A 3TSUA 4BEBA 4JHDA 1X3MA 5E41A 3D2FB 3KLHA 2R7YA 4YNQA 2E1ZA 4DSJA 1IO2A 3KLEA 3NF7A 4CGJA 4BC3A 1K6YA 2FBXA 3H3OB 1N5YA 2E2PA 1Q7YO 3ULEA 1HNIA 1ATNA 3TAMA 3FZKA 1N33K 1KQSM 4BR4A 1I94K 3QFPA 2FBTA 1C6VA 4X66K 4DQPA 1GLAG 1S9GA 4CJQA 1IKVA 1HJOA 5AQTA 1EWRA 3C0BA 4DTOA 1WOQA 1NBWA 4KAZA 3E1YA 2O8CB 3AVGA 3MN7A 3J7ZO 3V9ZA 1QVGM 4QOZB 1VSKA 2KQ2A 4BRKA 4LF5K 5HRPA 3CJ1A 3QETA 1WSHA 5HOOA 1X3NA 1YT3A 4G1QA 3V4IA 4PKGA 3VTIA 4IFYA 3K9KA 2E8AA 4FJ8A 5JLFA 4PWDA 3VF4A 3TABA 4CJ4A 3RMDA 4B3SK 1XC3A 4FSVA 1JLCA 1E3MA 3GOIA 1D4XA 3P1GA 4ICLA 4J2AA 1YXQA 3VETA 2E6LA 2XY6A 4JI4K 2P9UB 1J53A 5D3GA 3ZETA 4WE1A 4DV5K 3RWUA 1KCFA 1NGCA 4CJVA 1JCEA 5HL7L 3LDNA 4CK2A 4BQZA 4BROA 4JKFA 1NGFA 2CGJA 2P9SA 2DFHA 4CZMA 3S41A 4DSIA 4B1WB 4OKJA 3P39A 3FFKB 3V9UA 4E1JA 1REVA 4CD3A 3H3NO 3LANA 1TGOA 1C1AA 1S72N 4R79A 2A6AA 1XMOK 1SAZA 4HVJA 3NF9A 3IRXA 4CZHA 1ZYQA 1KVAA 1U47A 1G99A 3UE5A 4DWIA 2D0AA 2HSTA 4OPHA 4BG9A 3FR0A 3ALYA 1RILA 5JENA 2KZZA 5B8HA 4L8RB 4K41A 4BE7B 2UUBK 4FJJA 3VA3A 4N5SA 2O4GA 4FK0A 4FWNA 1Q81O 3F9MA 1VRUA 3WXIA 1HJRA 4DHYA 4CJKA 1TYQB 4B3OA 4OKKA 1VSJA 4FW1A 4QS9A 3CCUN 3TAEA 4Z4EA 3HBTA 4FLTA 3LWLA 3HPHA 1BHLA 4JN4A 2RHKA 4CGIA 5HRSA 1N36K 3VA0A 1HMVA 5AQPA 3E01A 3L2RA 1HPMA 4ELUA 5CZ2A 3VQ9A 4ELTA 2RE2A 1U45A 4CJFA 2Q97A 2QWPA 3RMAA 5AFUH 2HVIA 3AO5A 1VRTA 1NGGA 2A1RA 5AQQA 4JI3K 3MEEA 3HSCA 3SLCA 1YIJN 1VSDA 1YTAA 3LDOA 4OPAA 1J5EK 3EYZA 4E1NA 5DMRA 3F2KA 1XHXA 3ZLJA 5JLHA 1HRHA 3D45A 1ATRA 1X9JA 1K8KA 1VAZA 1SL1A 2BTFA 3H46O 5KPTA 5KTQA 4DTXA 3VESA 2YKMA 4B3TK 1VSFA 3OYMA 1HKCA 3KTQA 2PAVA 3ZSVA 4BECA 1FKPA 3K5OA 4YORA 1FKOA 5C24A 3AVLA 1TKDA 5KI6A 3UKRB 4YOXA 4M3TA 3SBTA 1U6ZA 4A59A 3KD1E 2PYLA 1LWEA 3QIPA 2P9PA 1RBVA 3VQCA 5FPMA 3ID8A 2A40A 4CIGA 5FPNA 1A5WA 4H0YB 3V9SA 1U04A 1TKZA 2IIRA 4DR4K 3DRPA 3ZSOA 2DFFA 3D6RA 3QLHA 4GW6A 4DFKA 3D2EB 3NVKA 3CCEN 4CZFA 1WNSA 4CFBA 2ATQA 3VN5A 2HBLA 4HCBA 3HL8A 3GBTA 3M8QA 1QQOA 3CFOA 4EIAA 1BQMA 1LWFA 4N41A 2FF3B 4JKGB 1RT2A 4CEQA 5M1PA 4E89A 2GUIA 4B9MA 3LDSA 2FC0A 4FJMA 4MFBA 4FWQA 1Q82O 2VCPA 4BDPA 1T3VA 4JI6K 4JKEA 1JLGA 3QNNA 5AQNA 5AQOA 3EZWA 3NE6A 4Z4IA 2HHSA 1N34K 4RW7A 3T3FA 4BQLA 3AGKA 3PV8A 1BI4B 1RBTA 1RT1A 3G71N 4DSFA 1IV0A 1T6CA 2QI2A 3ZX0A 3PUFA 1TL3A 5J2PA 2IVPA 4BRQA 4H03B 3VEZA 3JYTA 2Q31A 3CHWA 1QSYA 3OYAA 1NJYA 4CJTA 4ZTJA 2E88A 4CJPA 3NF8A 1KRPA 3LM2A 5C2DA 1GLJO 3K0SA 4DV6K 1KC8O 3OYDA 3QEVA 3OYEA 3SPYA 2D1KA 4CBWA 2JGUA 5EY4A 1WAFA 2WTUA 4JKCA 4DB3A 4AQYK 1QHTA 1RBUA 3FFIA 3VQAA 3ENOA 3T69A 4RWTA 3MMVA 2PBDA 4CZGA 1ASWA 5AQHA 1X9MA 5AZJB 1NNEA 2HOEA 3AA4A 3MX5A 3CJAA 4DLEA 1VQ8N 2KZMA 2W41A 4N76A 1NK9A 4BR7A 3OBWA 4CEDA 4JAXA 3D7EO 3IFRA 1CXQA 5F2RA 3O3FA 1YTUA 2O8EB 4XJXA 1S1VA 2Q3SA 5AZIB 1J54A 1MWKA 3TTDA 4Z4FA 3LWMA 3NCIA 1D5AA 2V7YA 3EZ5A 4BRMA 3KJVA 1ZC6A 2BH1A 3UKRA 4B1UB 4DS5A 2D5RA 2PY5A 2KFNA 4C8OA 4YOUA 4B9NA 3ZT0A 4DFMA 2E6MA 1RDCA 1W0HA 1EWQA 5MLCQ 4FK2A 3WNHA 3EN9A 3C94A 4DV1K 3QINA 5JVGL 2W6KA 5HRRA 1VQ4N 1ZBUA 4FWRA 2A42A 1XQSC 3RRHA 4DV2K 4FYDA 1RDWX 1HUXA 3TAGA 2YHWA 5AQIA 4DSLA 4E7KA 2OANA 4F3OA 5I9EB 3ZX3A 3CPEA 2ASPA 3MXIA 1L3TA 3PY8A 1VQ6N 4JKGA 1NMDA 3KKSA 4HHTA 4IFVA 3MCPA 4M45A 3FE1A 4MO4A 5CZ1A 2UXBK 2XRIA 5IWAK 2O8FB 3O4QA 4CECA 1XNRK 2H3GX 1JCGA 2ZWHA 1IJJA 4M63C 4B3MK 3SPZA 3ZSXA 3TAPA 4KH6A 4M7XA 3TARA 1IH7A 3PO5A 4NLBA 2YV0X 3F9KA 4LF9K 4B9SA 4OKEA 3NGZA 4BVOA 5IT9O 1Y64A 2NUBA 3O1WA 1OH5A 3NH1A 3VF2A 4R5PA 4CI6A 1C0GA 1ZXOA 2FBYA 4JI5K 5BPNA 2DY4A 1OVYA 5FPEA 2YJEA 1U4BA 1TKXA 3OS0A 4Q0BA 3DI6A 3AAPA 1GLBG 4YDUC 2E2NA 4M3ZA 3NGIA 3VOVA 4CGGA 3V1RA 3QICA 5KPZA 3BY5A 1HYZA 3CC4N 3C7NB 2QA4N 1D9FA 5AQKA 2E4LA 2ZQBA 4GKKK 4MLEA 4X64K 1QHAA 3DXMA 1RT7A 2BGGA 1C1CA 3L6QA 3DXKB 3PLAA 2W42A 2WUSA 5K14A 3NH0A 1S3XA 2UU9K 4OPKA 4GV6A 2KHOA 2HBKA 4BRFA 4QCLA 4CJ7A 2VYPA 3FZMA 4EP5A 2KLAA 5AZIA 1EKEA 1JLBA 5CY4A 4H5RA 3WNEA 3ASMA 4A57A 1T7PA 3CM5A 1SKSA 1BCOA 1NK7A 4M42A 3HSTB 1WSIA 1CZBA 3U3GA 5E84A 3C6AA 5F1XA 3QFUA 2AJQA 3OYBA 4NB4A 4IJAA 1T6DA 1XUPO 1XWLA 3SYZA 4DQSA 3T1HK 3K5NA 1NKCA 3P5JA 3AVFA 3TSQA 1TL1A 4RG8A 4DTUA 4DV0K 1VSLA 3MWTA 4I9QA 4IDHA 3H45C 4YDUA 4DSKA 4DR3K 1ZBSA 1NGEA 5BRFA 3K9JA 2QWOA 1YJWN 3CMEN 5ELZA 1M90O 4CZJA 3ZSRA 1GLEG 5C25A 4CGHA 5CYQA 3ITHA 4DCHA 1HQUA 4DFPA 3LALA 3SAGA 4HUFA 1MA9B 3TSPA 3EE9A 4OVLA 1BCMA 1DT9A 3DYAA 2Y1JA 1VQ5N 1Q86O 5FRMA 1KVBA 4LFAK 4DV7K 4LFBK 2P9KB 1ATSA 1EP4A 4WQ4C 3CQYA 2O8FA 5J2NA 1UAXA 2ZJQL 4PA1A 4BE2A 4CEEA 3CJCA 4PKIA 3I8BA 3QEIA 2WBNA 3O80A 5CYMA 2E20A 1RTHA 4JKAA 4CFAA 1TAQA 3O08A 4F8RA 3L2VA 1HR0K 4CEFA 3ZCMA 3SQ2A 1BA1A 4CHYA 3DJCA 1NJXA 2CH5A 3TI0A 2Q2RA 4JI1K 4Z4CA 1L3VA 2OPQA 2P9LA 1MDUB 3OTOK 2QKKA 2F8SA 3EO3A 3VQ5A 3VQBA 4CF0A 2F7TA 4GNIA 3NAEA 3J7AP 4QS7A 2B4JA 3SQ1A 2Q1NA 4O55A 1GLLO 5M1FA 2NRVA 5AQMA 1JXBA 4IOXA 5GINA 4F2RA 3HT3A 3BZKA 3CYGA 3C7NA 1JLQA 4CJ3A 2KW4A 2FSKA 1RTJA 1MU2A 1XI1A 1OH6A 3DXKA 3LAKA 5GAHP 5AQVA 3QB0A 1R0AA 3NBPA 4I2PA 3L4QA 4DLGA 1VHXA 3V9XA 5M1KA 1Z05A 1JLAA 3ZEUA 3JS6A 3OJUA 3CCVN 3WXLA 4WQ4A 1S6QA 2E2QA 4UQGA 4BWJA 1WSJA 1J5OA 4BY9C 4BR5A 2EWSA 2UYTA 4ELVA 4CCHA 3MN9A 4ZTFA 4IEEA 1BISA 1P8ZA 3E9OA 4B1ZA 1X9SA 2ZGZA 2HHHK 4EHUA 4C8NA 5J2MA 2B5JA 1NG9A 1SQKA 4CZIA 4LD0A 1U2VB 3ENBA 1FJGK 3CCSN 4QS8A 2IGIA 2ZD1A 3BEXA 1NK0A 2IAJA 2BUPA 4BE0A 4DV3K 4BG8A 5C42A 2HF3A 3CERA 4MO5A 1QZ5A 1Q9YA 3J80O 1Z25A 1WUAA 4J8FA 2HVHA 2A1SA 4PY5A 1VQKN 2G8IA 3TAFA 3RR7A 5EOYA 5FDLA 4BRDA 4LH4A 1RT3A 5AQRA 1TVRA 2P9IB 3VQ4A 2KKZA 4E1MA 2GEMA 3KK7A 1K9MO 1BA0A 3FGUA 3A5NC 4JI7K 3DLKA 4KV8A 3GE1A 3PIPL 3CJ9A 3WNFA 4EAHD 5C2FA 2OPSA 4IDKA 3VEXA 3D2FA 5FLXO 2CH6A 1NKEA 4X62K 4CZKA 3KD5E 5KRTA 3K2PA 3IKMA 1NK8A 4FPBA 4K25A 1WB9A 3THYB 2GWJA 3MECA 3V1OA 3OYCA 5KGWA 2YHAA 4FL9A 3BF1A 3ID6A 4N56A 3P38A 4J2EA 5C0YA 4B1YB 1JLFA 1Y97A 4JD2B 1SL0A 3WNGA 4DQIA 3LZIA 4E7LA 3KKRA 3HM9A 4RW8A 4IOCL 2O8CA 4KTZA 1QQCA 1RBRA 3SUQA 4M3XA 1RDDA 1FXXA 1DTQA 1ZBFA 4LFCK 3K59A 4KFBA 3L8BA 3SZ2A 3RR8A 1TV6A 4ILHA 2BDPA 4BREA 2P51A 4E72A 3AO1A 2ZM6K 1IKYA 1GOBA 1KFDA 4CGFA 4H0VB 4JI8K 1UOCA 3ISNC 3LP3A 1T03A 4FJXA 3GDQA 2P9NB 4M7YA 4DS4A 4WCEL 3THVA 5AQUA 3CQXA 4LF6K 3O9RA 1BUPA 5TKWA 4E19A 1L5UA 1VQNN 1KLMA 4CHPA 1SKWA 4FK4A 3KWGA 3S3NA 3FLCO 1K8AO 1S22A 5EU7A 4B9UA 4PUOA 4O0JA 2P9UA 4DR5K 2XHBA 1B92A 1WAJA 4KHSA 4CVNE 3LZJA 1QVFM 3A2FA 3M8RA 3VTHA 4CIFA 2QM1A 5GADP 5HROA 2D0CA 2G8UA 5AQSA 4FLYA 3MXMA 3WT0A 4V19S 1XC9A 2GTDA 1E4GT 4I7FA 1S1WA 1U2VA 3LPTA 3QBXA 3U6FA 1NK6A 2OTJN 2JWLA 3OVNA 2VG6A 5M1NA 1O13A 1OH8A 4FJGA 2VWJA 3THXB 5LMUK 1W9HA 3THWB 5A2QO 4ID1A 4KHUA 3CCRN 1VSIA 4CEAA 2JWKA 3VQDA 4FWPA 1UWBA 4WFBL 2E5LK 5M1QA 4PKHA 1P90A 3QEPA 3NF6A 2RPIA 1Q18A 4I6MB 1KXPA 4CK3A 3SQ0A 1KVCA 2VG7A 2F8TA 3L3UA 4WFNL 3O9TA 3AVAA 2CGKA 4BRPA 4WF9L 4KTWA 2W40A 4CEZA 1C0MA 2D4WA 4HUGA 4KHYA 5DM6L 4BRHA 1NK5A 1NMNA 3L2WA 3HM8A 4DTPA 2P9IA 5H1SQ 1L3UA 3DLHA 2QWNA 1RFQA 3C6UA 3CF5L 1HKGA 2HNYA 1JLEA 3AV9A 4O5BA 1HNVA 2KTQA 5BPMA 3H1VX 2O8DB 3R6MA 3AVBA 5AQWA 1ESVA 4GV9A 4AHVA 3HK2A 1TYQA 4FLUA 4DMNA 5AJ3K 3O3GA 4YOWA 2E1YA 2WFBA 5ADXA 2ZJRL 1EO1A 3EL2A 2I5JA 3FZHA 3AARA 3KLIA 3T1YK 3AO3A 4LC9B 3CG7A 1C1BA 1KFSA 3O6WA 4RW4A 4M3YA 4BRLA 1Z6RA 2V52B 3MEGA 1EX4A 2FF6A 5BRHA 1LOTB 3G4SN 4QAGA 1GOAA 3I55N 3SNNA 3IDHA 4AHCA 1CZAN 4MLHA 4O8UA 2PYJA 4CE9A 3B8AX 3O3HA 2OTLN 4DG1A 4B8CA 1J9AA 2YJFA 1HPZA 1UA0A 3F73A 1YJ9N 1DGKN 3SBGA 4LF8K 1QQMA 4GMJB 2F4VK 5KPRA 4CJRA 3AVKA 5KRSA 2P9NA 3MN6A 4GV3A 3DOLA 3DRRA 3OYJA 3QMLA 4FJIA 4LSNA 3UKUB 4YY3K 3O9UA 5AQZA 4DUYK 4DR7K 3CCMN 3I33A 3V6DA 1YHQN 4ILJA 3W3DA 4AHUA 1BU6O 4IG0A 4U7BA 4C1NI 1D8YA 4OGCA 2ASMA 3L3VA 4JKBA 5DK5A 2VWKA 2IOCA 4O44A 3TANA 4BRIA 2OCEA 4JV5K 4H0TB 3HI0A 1WBBA 5AQFA 2WOMA 3K58A 4FJ5A 2HHIA 1V4TA 2V51B 4EFHA 1YF5L 2UUAK 1TK8A 2EHGA 2D0PA 5EVZA 4A5AA 1YAGA 4O5FA 5BN9A 4BGAA 3VEOA 3THXA 1SUQA 2YI1A 3THWA 3KWIA 5CE3A 5SZTA 3IAYA 3VEWA 5KQ8A 3NH2A 3S5TA 4CBUA 4KB1A 4GKJK 3WQUA 3PSIA 4MDAA 1GLFO 3WQTA 5E26A 4I6MA 2BANA 4CF9A 4HWIA 4Y1DA 2FXUA 4YFUA 3RSEB 5FRNA 1DKGD 5I3UA 4H5NA 2YX6A 5SWMA 4DR6K 2ZGYA 4KREA 4BR0A 3D2EA 4FXDA 4B1VA 1NM1A 3QIOA 1LAVA 2ZF5O 4IBNA 2OYQA 1IKWA 2UUCK 4BRAA 2OPRA 2DPNA 4ISGA 3VQEA 4YOTA 4HTUA 1FW6A 3VMFB 5LJVA 4FCYA 2Q0RA 5JICA 4M41A 2QWLA 4DTJA 3UB5A 3DRSA 5BR8K 2XY5A 3TU5A 5F0XA 4K8ZA 4WQ5C 3KK2A 2HBJA 1BIUA 3RMBA 3U4LA 2IS3A 2HBMA 3CI5A 4IFEA 3L2QA 1BI4A 1I3AA 3WEEB 1T44A 3AVMA 1TUYA 2GWKA 1SV5A 4DQ8A 4CEOA 3PX0A 1XNQK 4H5VA 1VQMN 2FBVA 4MDBA 3BDPA 1HQEA 4JHDB 4IWVA 3D0PA 3NDKA 1CZ9A 1ILYA 4CFDA 3L4IA 4E0DA 4KTQA 1WSGA 4RW9A 3ULEB 4U67L 3EKSA 2IC3A 1ITGA 2UXCK 2VGMA 3VQ8A 4K43A 2J4RA 3MEDA 4OGEA 2E2OA 4W5QA 3ATUA 3S9HA 5AZJA 2YCHA 3UKUA 2HHWA 1M1KO 4FPAA 4XEIA 1HNZK 1VK0A 3O4NA 4JEPA 3CCJN 1NKBA 2YNGA 3AA3A 3I56N 1NJZA 2I7NA 5KGXA 2O8EA 3DLRA 4CZLA 3K5MA 3Q7CA 4C8LA 3N4QA 5C15A 3M3ZA 1NK4A 3SAHA 3HRGA 3M1FA 4WQ5A 5AR0A 4B3RK 5J1EA 3VENA 1CLQA 4DSEA 3HVRA 3HJFA 3E9PA 3RMCA 4B9VA 1BG3A 4BRCA 3BF3A 3M8SA 3KZBA 2VQFK 2IVOA 4LSLA 3VGLA 3G6EN 4DTMA 2C1IA 3LDQA 1WN7A 3SV3A 2PZSA 3CYMA 3EKUA 3DLGA 4DQQA 4YOVA 4RCHA 1RDAA 4KH5A 4F9OA 4CHQA 3ZETB 3BUZB 4B9QA 3FZFA 1OKJA 3M6GA 1S1XA 1VSMA 4KHNA 3AA5X 3RSEA 1GOCA 2B6AA 3AO2A 2NRHA 3I0SA 3CC2N 4ILGB 2HHXA 5HRNA 2YNFA 1LAWA 4I9LA 4CW7B 3CQ8A 3QNOA 4OLBA 1BQNA 4DU3A 4KRFA 1HX1A 1ZBIA 2QEXN 3OA9A 1IBLK 3CD6N 1OVQA 4E7JA 4KKOA 1BO5O 2D0BA 4XH4A 1GLCG 1LW0A 3AO4A 3U9ZA 4AH9A 3ZYYX 3KK1A 1QE1A 3BZCA 4N47A 3TR8A 3UIQA 2NNWA 4FVUA 2HMPA 4FOIA 4Y0WA 4NXMK 5AQJA 4JS5A 4HCCA 4LH5A 4LY7A 4DFJA 4CHOA 2ITMA 2O4IA 2YNIA 1C0UA 3ZT2A 1O1WA 4JK9A 3KLGA 1S1TA 4ISFA 3QESA 3CFRA 4AF1A 3HVTA 1A5VA 5LY3A 1RNHA 3DOKA 3R3LA 3VF6A 2NRXA 4PHTX 3A8YA 1QSLA 4LF4K 1VQPN 3OJSA 1NGAA 3AVIA 5JMVA 4XIUA 1YUWA 4B9LA 4I2QA 1A5XA 3O5BA 3SMSA 1QSSA 1U49A 4CJLA 3PIOL 4BE1A 4FWOA 2O8BB 3AVCA 3WXKA 1JXEA 5I42A 1C0FA 1BDGA 5AQGA 4C8KA 4PL8A 4Y1CA 4FJ7A 4FJLA 5AQXA 3SMPA 5EX5A 1IBKK 4RW6A 1HLUA 3OW2M 1GLDG 4JRPA 4FJKA 3KHYA 3SV4A 1XHZA 3QDKA 3V1QA 3HOSA 5HLFA 1RDBA 3BP8A 4E3SA 4X65K 2D0OA 5LMNK 2GV9A 3ENHA 1WSFA 3NHGA 1IKXA 4BDYA 2VWBA 4FOEA 1K8KB 1NGDA 4NYFA 4DR2K 2F96A 1SKRA 1VQLN 2UXDK 2BE2A 3O9QA 3J81O 3R8EA 4BWMA 3PX4A 4B08A 4NCAA 4DF8A 3T19A 4BACA 2CGLA 3K57A 1QZ6A 3SQ4A 3A5MC 3JAMO 1T8EA 2HB5A 3AVJA 3W0LA 3MDQA 4CBXA 1SS6A 2DTUA 3BGRA 1KSPA 4FVMA 3LL3A 1NU0A 3HYFA 1EXQA 4BRGA 2NRTA 2GELA 2HMIA 3AVHA 3HTVA 4FZXC 1S5JA 2IVNA 4CERA 4CF1A 4B8AB 3IUCA 4NYNA 2P9PB 2V7ZA 4EP4A 1NGBA 2VGNA 2G8KA 2FLOA 2A5XA 1ZBLA 2RF2A 1VQON 2P9KA 4DQRA 4NCBA 4KHQA 3J7YP 1HNXK 5ADXH 3F5TA 5C10A 1YVNA 5GIPA 2FSNA 2YHYA 1RTIA 2RN2A 1N32K 3G10A 5CR4A 3CM6A 3OYGA 2XY7A 3CC7N 3T7ZA 2HHTA 2F9WA 4CIEA 2P5OA 2QTDA 2KFZA 4EZ6A 2YHBA 2P1JA 2X6NA 3NMUA 2Z1IA 4YHHK 1NGIA 3ZSZA 5JS2A 3P83D 1KAYA 1JCFA 3TTFA 5GIOA 4YOYA 1BOTO 3OS2A 4OPJA 1U48A 4AHSA 4BC2A 4C1NK 5JS1A 4KPYA 4CF8A 3HOTA 4CHZA 1JL1A 3VERA 4DTSA 4F2SA 3AGRA 1D9DA 3DMJA 4KB0A 4NXNK 2A3ZA 2QWMA 4DU1A 3DLBA 1F21A 4AM6A 4G9ZA 5BN8A 4BC5A 3S3MA 2O8BA 2JLEA 4IG3A 3C65A 4WFAL 4OX9K 1RT6A 4FZYA 3ZT1A 3R9PA 5LJWA 5M1OA 3MK6A 5HBMA 5BR9A 2AA4A 4Z0UA 4B9TA 4FWSA 3NFAA 2EX3A 2HW3A 3CMAN 4CK1A 4A2BA 1LWCA 2Q0UA 3LDLA 5CHIA 1VQ7N 1RGIA 1RCHA 4KHPK 4FW2A 5BRDA 1S9EA 4FLVA 5DM7L 1BIZA 1XMQK 3VQ6A 3HPGA 1OH7A 3PX6A 3AA2A 4KHWA 3OYLA 3GL1A 3HO1A 3RVCA 1KTQA 2QWRA 4GVEA 4C8MA 1NGHA 3C95A 4WYBA 4FWLA 3SAFA 1NJWA
chains in the Genus database with same CATH topology
4BGAA 3VEOA 2YI1A 5E84A 3KWIA 3DAWA 1NGCA 5CE3A 3C6AA 5F1XA 1JCEA 3VEWA 5KQ8A 3LDNA 3QFUA 5HL7L 4NB4A 2C1GA 4CBUA 4BQZA 4IJAA 4BROA 1T6DA 1XUPO 3WQUA 4GY2B 4MDAA 1GLFO 3WQTA 4JKFA 5E26A 1NGFA 4H0PA 2CGJA 4I6MA 2P9SA 3TSQA 4HWIA 4B1XB 2FXUA 3JXUA 4IOAL 4CZMA 3S41A 3RSEB 1V4SA 4IZ9A 1DKGD 4B1WB 3MWTA 3P39A 3FFKB 2YX6A 4H5NA 4IDHA 4E1JA 2ZGYA 3H45C 4YDUA 4CD3A 3H3NO 4BR0A 1NJIO 3D2EA 4B1VA 1NM1A 1TUUA 2ZF5O 4FWKA 4XH5A 1ZBSA 1NGEA 4IXCA 3LDPA 3K9JA 2QWOA 5BRFA 4R79A 2A6AA 5ELZA 4CZJA 1YJWN 1S72N 1SAZA 4BRAA 1GLEG 1N8RO 2DPNA 3O8MA 4ISGA 2YHXA 4CZHA 4YOTA 3M5RA 4DCHA 3VMFB 1G99A 3UE5A 3SAGA 1MA9B 5LJVA 2Q0RA 4PL7A 4CZEA 3TSPA 3EE9A 5JICA 4JK7A 2HSTA 1DT9A 2QWLA 4H0XB 4OPHA 4BG9A 3FR0A 1Q86O 1VQ5N 3VEVA 2P9KB 1ATSA 3MWPA 4WQ4C 4K41A 3UB5A 3CQYA 3TU5A 5B8HA 1YI2N 4BE7B 5F0XA 4WQ5C 4A61A 2ZJQL 4Z94A 2HBJA 4FWNA 3U4LA 3F9MA 1Q81O 3CJCA 2HBMA 3CI5A 4PKIA 3WXIA 3I8BA 4DHYA 4IFEA 2WBNA 3WEEB 1T44A 3O80A 1TUYA 1TYQB 2E20A 2GWKA 4DQ8A 4JKAA 1NGJA 4JD2A 3O08A 4H5VA 4QS9A 2W00A 4A5BA 2NZTA 3CCUN 1VQMN 4MDBA 1BA1A 3HBTA 2NRRA 4JHDB 3C6HA 4IWVA 3DJCA 1LCUA 3VEYA 1W97L 4IJNA 2CH5A 4C23A 1ILYA 4JN4A 2RHKA 2QW9A 1QQNA 2Q2RA 3QBWA 5AQPA 1KAXA 3L4IA 2P9LA 1MDUB 2I7PA 1HPMA 3EO3A 2F7TA 3O4WA 3ATVA 4GNIA 2RE2A 4BRNA 3ULEB 4QS7A 2Q97A 2QWPA 3EKSA 3GG4A 5TKYA 2Q1NA 5AFUH 4U67L 1GLLO 5M1FA 2NRVA 5AQMA 3VPZA 1NGGA 5AQQA 2VGMA 4IOXA 5GINA 4K43A 2J4RA 3SK3A 2E2OA 3NVMA 3C7NA 3HSCA 3SLCA 3ATUA 1W2BM 1YIJN 3DLLL 2FSKA 5AZJA 2YCHA 3UKUA 3LDOA 4OPAA 4FPAA 4XEIA 5AFUA 1M1KO 3DXKA 3L0QA 5GAHP 4JEPA 5AQVA 3QB0A 3F2KA 3ZX2A 3L4QA 3CCJN 3OHRA 5JLHA 5M1KA 3I56N 1Z05A 2I7NA 3CPWM 4CZLA 4HTLA 3JS6A 3E9LA 3MN5A 3WXJA 3ZEUA 1ATRA 3Q7CA 3N4QA 3CCVN 5C15A 3WXLA 1X9JA 4WQ4A 1K8KA 1VAZA 3DXMB 2E2QA 2BTFA 3M3ZA 3SAHA 3HRGA 3H46O 5KPTA 3M1FA 4WQ5A 3FZLA 4BY9C 4BR5A 5AR0A 2EWSA 2UYTA 4DKWA 3MN9A 1YJNN 4IEEA 3VENA 3R1XA 1P8ZA 3E9PA 3E9OA 3VESA 4B1ZA 1BG3A 4BRCA 3BF3A 4AM7A 2ZGZA 3KZBA 4JK8A 5C12A 4O8KA 5GAGP 2IVOA 4EHUA 3G6EN 3VGLA 1KAZA 1HKCA 2C1IA 2PAVA 1SQKA 3LDQA 4BECA 1MWMA 3AAQA 3EKUA 4YORA 1HKBA 4YOVA 4RCHA 4A62A 4CZIA 1U2VB 3ENBA 3O9SA 3A0IX 3EE8A 3UKRB 3CCSN 3CMEN 4KH5A 5BPLA 4YOXA 2HF4A 2FSJA 3SBTA 4QS8A 1BWFO 3ZETB 1U6ZA 3BUZB 4A59A 4B9QA 3FZFA 5GAEP 3BEXA 1OKJA 3M6GA 4IO8A 4NO7A 2BUPA 2QXLA 1R59O 3RSEA 4BG8A 4BR2A 4NLCA 2P9PA 3VGMA 3CC2N 2NRHA 4ILGB 2F9TA 5FPMA 2HF3A 3ID8A 2A40A 3CERA 4MO5A 1QZ5A 5FPNA 3SJHA 4H0YB 1WUAA 4J8FA 4BGBA 1VQKN 2IIRA 1HX1A 2QEXN 3OA9A 5EOYA 3D6RA 3CD6N 1VQ9N 4BRDA 4FO0A 1BO5O 3J8AA 4XH4A 1GLCG 3D2EB 5AQRA 3U9ZA 2P9IB 3CETA 3CCEN 3ZYYX 4CZFA 4UY8O 2KKZA 1K73O 4FVUA 2GEMA 3KK7A 2NNWA 5JVHL 2HMPA 5KQDA 2HBLA 1K9MO 1BA0A 4FOIA 3FGUA 3A5NC 4Y0WA 3GBTA 5AQJA 1QQOA 4EIAA 3GE1A 3PIPL 3CJ9A 3O1BA 2FF3B 4JKGB 2ITMA 4EAHD 5C2FA 3HZ6A 3H1QA 1NLVA 3VEXA 3D2FA 1H1VA 5M1PA 2CH6A 4FWQA 4JK9A 5EXWA 4BR9A 1Q82O 4FWMA 4ISFA 2VCPA 4OO1J 4CZKA 4JNEA 1T3VA 4BC4A 4AF1A 3IKMA 3TTCA 4JKEA 5AQNA 4FPBA 4K25A 3EZWA 5AQOA 2ASOA 5LY3A 2GWJA 3R3LA 3VF6A 2NRXA 4PHTX 4A2AA 3A8YA 4JKDA 3ZETA 4BQLA 3AGKA 4FL9A 3BF1A 3ID6A 1E4FT 3A5OC 3P38A 3G71N 3AY9A 1T6CA 5C0YA 2QI2A 3ZX0A 1VQPN 4B1YB 3CXCM 3MCAB 1NGAA 3LM9A 4JD2B 5JMVA 2IVPA 4BRQA 1YUWA 4H03B 3VEZA 3O5BA 1JJ2M 2Q31A 3CHWA 3SMSA 3KVGA 3MX2A 4IOCL 2E88A 3U9DA 2GX9A 2PFUA 3PIOL 4FWOA 3LM2A 4H5TA 5C2DA 1GLJO 1KC8O 3WXKA 4L3QA 2P9LB 1RDUA 2D1KA 4ILHA 4CBWA 1C0FA 1BDGA 5AQGA 5EY4A 4BREA 4IEIA 3Q7BA 5BREA 3A5LC 5AQLA 2NRWA 4H0VB 4JKCA 4PL8A 2ZJPL 3G25A 1SZ2A 4DB3A 5AQXA 3SMPA 3GDQA 2P9NB 5EX5A 3CIPA 4M7YA 1HLUA 3ENOA 4WCEL 3OW2M 1GLDG 3T69A 2NLXA 4RWTA 3P4IA 4RTFD 3CQXA 3KHYA 3O9RA 1BUPA 5AQUA 3MMVA 5TKWA 4CD1A 2PBDA 4CZGA 1M90O 1DEJA 1VQNN 5AQHA 5AZJB 3QDKA 2HOEA 1KD1O 3MX5A 3CJAA 1VQ8N 3KWGA 3HOSA 2W41A 3FLCO 1K8AO 1S22A 3TPQA 4BR7A 3CCQN 3OBWA 4F9OA 2P9UA 3BP8A 4JAXA 3CJBA 3D7EO 3IFRA 5F2RA 2D0OA 3CCLN 3ENHA 4XJXA 2A41A 1QVFM 3ZEUB 2VWBA 3OBYA 2AP1A 3DWLA 5AZIB 4FOEA 1MWKA 1K8KB 1NGDA 3TTDA 2QM1A 3VTHA 5GADP 1VQLN 3O9QA 5AQSA 3WXMB 3P31A 4K42A 3R8EA 3WT0A 2V7YA 4XH1A 2GTDA 4BRMA 1E4GT 2NRZA 1ZC6A 2OTJN 1U2VA 3QBXA 2JWLA 2BH1A 3UKRA 1O13A 4B1UB 5M1NA 3E66A 2CGLA 1QZ6A 3A5MC 3CCRN 2JWKA 3WUHA 4YOUA 4FWPA 3NVKA 1EQYA 4WFBL 2GUPA 5M1QA 4PKHA 5MLCQ 3W0LA 1P90A 3EN9A 3MDQA 4CBXA 1SS6A 5JVGL 3LL3A 1Q18A 1VQ4N 4BRGA 4I6MB 1KXPA 2NRTA 2A42A 2GELA 2P9SB 4FWRA 1XQSC 4KH4A 3HTVA 1RDWX 2WC9A 2IVNA 1HUXA 4WFNL 2YHWA 3O9TA 5AQIA 3IUCA 2CGKA 4KBOA 4BRPA 2P9PB 3H6EA 4WF9L 2V7ZA 5LJWA 1NGBA 2W40A 4ISEA 2D4WA 2OANA 2VGNA 5DM6L 5I9EB 4BRHA 2QWQA 2FLOA 3HM8A 2P9IA 2A5XA 5H1SQ 4H0OA 3ZX3A 1VQON 3U8XA 2P9KA 3CPEA 2ASPA 5FPDA 1J6ZA 2QWNA 1RFQA 3CF5L 1HKGA 4EHTA 4H5WA 5AQYA 5ADXH 3F5TA 5C10A 1YVNA 1VQ6N 4JKGA 1NMDA 5GIPA 5BPMA 3H1VX 3IMXA 2FSNA 2YHYA 3R6MA 3CJ7A 1YITN 4BVPA 5AQWA 1ESVA 3MCPA 4GV9A 3FE1A 2Q36A 5CR4A 3WEEA 4MO4A 1NWKA 1TYQA 4IO9L 3CC7N 1IG8A 3T7ZA 4YOWA 2E1YA 2F9WA 2WFBA 5ADXA 2H3GX 2ZJRL 1EO1A 1JCGA 2QTDA 1IJJA 2ZWHA 3EL2A 3FZHA 3VGKA 3N4PA 4JKHA 3AARA 4M63C 3TSUA 4BEBA 4JHDA 1X3MA 4LC9B 3NMUA 3D2FB 4KH6A 1NGIA 4M7XA 3O6WA 1KAYA 1JCFA 4NLBA 4BRLA 1Z6RA 2V52B 3TTFA 2E1ZA 2FF6A 5BRHA 1BOTO 1LOTB 5GIOA 4YOYA 3G4SN 4BC3A 4BVOA 3I55N 4BC2A 4C1NK 1Y64A 3H3OB 1CZAN 3IDHA 3O1WA 4MLHA 4O8UA 3HOTA 3VF2A 2E2PA 1Q7YO 3ULEA 3VERA 1ATNA 3AGRA 4CI6A 3FZKA 3B8AX 2OTLN 2A3ZA 2QWMA 1KQSM 4AM6A 4BR4A 2YJFA 4G9ZA 1C0GA 5BN8A 4BC5A 1ZXOA 3QFPA 5BPNA 1OVYA 3C65A 5FPEA 2YJEA 4WFAL 1GLAG 1YJ9N 1DGKN 1HJOA 3AAPA 5AQTA 3SBGA 3C0BA 3R9PA 1WOQA 1NBWA 1GLBG 1QQMA 2E2NA 3MK6A 4YDUC 5M1OA 3E1YA 5BR9A 3MN7A 2AA4A 5KPRA 3J7ZO 3VOVA 1QVGM 4FWSA 3CMAN 4BRKA 3QICA 4A2BA 5KPZA 3CJ1A 2P9NA 3MN6A 3CC4N 4GV3A 3C7NB 2Q0UA 2QA4N 5AQKA 3LDLA 5CHIA 3QMLA 5HOOA 1X3NA 1VQ7N 4MLEA 1RGIA 1QHAA 3DXMA 5BRDA 3UKUB 4PKGA 3VTIA 3K9KA 3L6QA 3DXKB 3PLAA 3O9UA 5DM7L 2E8AA 5AQZA 5JLFA 2WUSA 3CCMN 3I33A 1YHQN 4ILJA 3VF4A 1S3XA 3W3DA 1BU6O 4U7BA 4GV6A 4C1NI 2KHOA 2HBKA 4BRFA 4CJ7A 2ASMA 2VYPA 3FZMA 4JKBA 3GL1A 1XC3A 4FSVA 4BRIA 2KLAA 4H0TB 3GOIA 1D4XA 5AZIA 3RVCA 3HI0A 5AQFA 1YXQA 3VETA 1V4TA 4H5RA 2V51B 4EFHA 1YF5L 4A57A 2QWRA 4GVEA 2P9UB 1NGHA 4WYBA 2D0PA 4FWLA 5EVZA 3SAFA 4A5AA 1YAGA 4O5FA 5BN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BGA A;  3VEO A;  2YI1 A;  5E84 A;  3DAW A;  1NGC A;  5CE3 A;  5F1X A;  1JCE A;  3VEW A;  5KQ8 A;  3LDN A;  3QFU A;  4NB4 A;  4CBU A;  4BQZ A;  4IJA A;  4BRO A;  1T6D A;  1XUP O;  3WQU A;  4GY2 B;  1GLF O;  3WQT A;  5E26 A;  1NGF A;  4H0P A;  2CGJ A;  4I6M A;  2P9S A;  4HWI A;  4B1X B;  2FXU A;  3JXU A;  4CZM A;  3S41 A;  3RSE B;  1V4S A;  4IZ9 A;  1DKG D;  4B1W B;  3FFK B;  4H5N A;  4E1J A;  2ZGY A;  3H45 C;  4YDU A;  4CD3 A;  3H3N O;  4BR0 A;  3D2E A;  4B1V A;  1NM1 A;  1TUU A;  2ZF5 O;  4FWK A;  4XH5 A;  1ZBS A;  1NGE A;  4IXC A;  3LDP A;  5BRF A;  2QWO A;  2A6A A;  5ELZ A;  4CZJ A;  1SAZ A;  4BRA A;  1GLE G;  2DPN A;  3O8M A;  4ISG A;  2YHX A;  4CZH A;  4DCH A;  1G99 A;  3UE5 A;  1MA9 B;  5LJV A;  2Q0R A;  4PL7 A;  4CZE A;  5JIC A;  2QWL A;  4H0X B;  4BG9 A;  3FR0 A;  3VEV A;  2P9K B;  1ATS A;  3UB5 A;  4WQ4 C;  4K41 A;  5B8H A;  3CQY A;  3TU5 A;  5F0X A;  4WQ5 C;  4A61 A;  4Z94 A;  4FWN A;  3U4L A;  3F9M A;  3CJC A;  3WXI A;  3CI5 A;  4PKI A;  3I8B A;  4DHY A;  3WEE B;  1T44 A;  3O80 A;  1TUY A;  1TYQ B;  2E20 A;  2GWK A;  4DQ8 A;  1NGJ A;  4JD2 A;  3O08 A;  4H5V A;  4QS9 A;  2NZT A;  1BA1 A;  3HBT A;  4JHD B;  4IWV A;  3DJC A;  1LCU A;  3VEY A;  4IJN A;  2CH5 A;  4C23 A;  4JN4 A;  2QW9 A;  1QQN A;  2Q2R A;  3QBW A;  5AQP A;  1KAX A;  3L4I A;  2P9L A;  1MDU B;  2I7P A;  1HPM A;  3EO3 A;  3O4W A;  3ATV A;  4GNI A;  4BRN A;  3ULE B;  4QS7 A;  2Q97 A;  2QWP A;  3EKS A;  3GG4 A;  5TKY A;  2Q1N A;  5AFU H;  1GLL O;  5AQM A;  3VPZ A;  1NGG A;  5AQQ A;  4K43 A;  2J4R A;  3SK3 A;  2E2O A;  3C7N A;  3HSC A;  3SLC A;  3ATU A;  2FSK A;  5AZJ A;  2YCH A;  3UKU A;  3LDO A;  4FPA A;  4XEI A;  5AFU A;  3DXK A;  3L0Q A;  5AQV A;  3QB0 A;  3ZX2 A;  3OHR A;  5JLH A;  1Z05 A;  2I7N A;  4CZL A;  4HTL A;  3JS6 A;  3MN5 A;  3WXJ A;  3ZEU A;  1ATR A;  3WXL A;  1X9J A;  4WQ4 A;  1K8K A;  3DXM B;  3M3Z A;  2E2Q A;  2BTF A;  3H46 O;  5KPT A;  3M1F A;  4WQ5 A;  3FZL A;  4BR5 A;  5AR0 A;  2EWS A;  2UYT A;  3MN9 A;  3VEN A;  1P8Z A;  3VES A;  4B1Z A;  1BG3 A;  4BRC A;  3BF3 A;  4AM7 A;  2ZGZ A;  3KZB A;  4O8K A;  2IVO A;  4EHU A;  3VGL A;  1KAZ A;  1HKC A;  2PAV A;  1SQK A;  3LDQ A;  1MWM A;  3AAQ A;  3EKU A;  1HKB A;  4RCH A;  4A62 A;  4CZI A;  1U2V B;  3A0I X;  3UKR B;  5BPL A;  2HF4 A;  2FSJ A;  4F9O A;  4QS8 A;  1BWF O;  3ZET B;  1U6Z A;  3BUZ B;  4B9Q A;  3FZF A;  3BEX A;  1OKJ A;  3M6G A;  4IO8 A;  4NO7 A;  2BUP A;  2QXL A;  1R59 O;  3RSE A;  4BG8 A;  4BR2 A;  2P9P A;  3VGM A;  2NRH A;  2F9T A;  5FPM A;  2HF3 A;  3ID8 A;  2A40 A;  3CER A;  4MO5 A;  1QZ5 A;  5FPN A;  3SJH A;  4H0Y B;  1WUA A;  4J8F A;  4BGB A;  2IIR A;  1HX1 A;  5EOY A;  4BRD A;  4FO0 A;  1BO5 O;  3J8A A;  4XH4 A;  1GLC G;  3D2E B;  5AQR A;  3U9Z A;  2P9I B;  3CET A;  4CZF A;  2GEM A;  2HMP A;  5KQD A;  1BA0 A;  4FOI A;  3FGU A;  3A5N C;  4Y0W A;  3GBT A;  5AQJ A;  1QQO A;  4EIA A;  3GE1 A;  3CJ9 A;  3O1B A;  2FF3 B;  2ITM A;  4EAH D;  3HZ6 A;  3H1Q A;  1NLV A;  3VEX A;  3D2F A;  1H1V A;  2CH6 A;  4FWQ A;  5EXW A;  4BR9 A;  4FWM A;  4ISF A;  2VCP A;  4CZK A;  4JNE A;  4BC4 A;  5AQN A;  4FPB A;  4K25 A;  3EZW A;  5AQO A;  2ASO A;  5LY3 A;  2GWJ A;  3VF6 A;  4A2A A;  3A8Y A;  3ZET A;  4BQL A;  4FL9 A;  3BF1 A;  1E4F T;  3A5O C;  3AY9 A;  1T6C A;  3ZX0 A;  4B1Y B;  1NGA A;  3LM9 A;  4JD2 B;  5JMV A;  2IVP A;  4BRQ A;  1YUW A;  4H03 B;  3VEZ A;  3O5B A;  2Q31 A;  3CHW A;  3SMS A;  3KVG A;  2E88 A;  3U9D A;  4FWO A;  3LM2 A;  4H5T A;  1GLJ O;  3WXK A;  4L3Q A;  2P9L B;  2D1K A;  4CBW A;  1C0F A;  1BDG A;  5AQG A;  5EY4 A;  4BRE A;  5BRE A;  3A5L C;  5AQL A;  4H0V B;  4PL8 A;  3G25 A;  1SZ2 A;  4DB3 A;  5AQX A;  3SMP A;  3GDQ A;  2P9N B;  5EX5 A;  3CIP A;  4M7Y A;  1HLU A;  3ENO A;  1GLD G;  2NLX A;  4RWT A;  3P4I A;  4RTF D;  3CQX A;  3KHY A;  5AQU A;  1BUP A;  4CD1 A;  3MMV A;  2PBD A;  4CZG A;  1DEJ A;  5AQH A;  5AZJ B;  3QDK A;  2HOE A;  3CJA A;  2W41 A;  3FLC O;  1S22 A;  3TPQ A;  4BR7 A;  2P9U A;  3BP8 A;  4JAX A;  3CJB A;  3D7E O;  3IFR A;  5F2R A;  2D0O A;  3ENH A;  2A41 A;  3ZEU B;  2VWB A;  2AP1 A;  3DWL A;  5AZI B;  4FOE A;  1MWK A;  1K8K B;  1NGD A;  2QM1 A;  5AQS A;  4K42 A;  3R8E A;  3WT0 A;  2V7Y A;  4XH1 A;  2GTD A;  4BRM A;  1E4G T;  1ZC6 A;  1U2V A;  3QBX A;  3UKR A;  4B1U B;  2CGL A;  1QZ6 A;  3A5M C;  3WUH A;  4FWP A;  1EQY A;  2GUP A;  4PKH A;  3W0L A;  3EN9 A;  3MDQ A;  4CBX A;  3LL3 A;  1Q18 A;  4BRG A;  4I6M B;  1KXP A;  2P9S B;  2A42 A;  2GEL A;  4FWR A;  1XQS C;  3HTV A;  1RDW X;  2IVN A;  1HUX A;  2YHW A;  5AQI A;  3IUC A;  2CGK A;  4KBO A;  4BRP A;  2P9P B;  3H6E A;  2V7Z A;  1NGB A;  2W40 A;  4ISE A;  2D4W A;  2OAN A;  5I9E B;  4BRH A;  2QWQ A;  2FLO A;  3HM8 A;  2P9I A;  2A5X A;  4H0O A;  3ZX3 A;  3U8X A;  2P9K A;  5FPD A;  2ASP A;  1J6Z A;  2QWN A;  1RFQ A;  1HKG A;  4EHT A;  4H5W A;  5AQY A;  5ADX H;  1YVN A;  1NMD A;  5BPM A;  3H1V X;  3IMX A;  2FSN A;  2YHY A;  3R6M A;  3CJ7 A;  4BVP A;  5AQW A;  1ESV A;  3MCP A;  3FE1 A;  2Q36 A;  3WEE A;  4MO4 A;  1NWK A;  1TYQ A;  1IG8 A;  2E1Y A;  2F9W A;  5ADX A;  2H3G X;  1JCG A;  2ZWH A;  1IJJ A;  3EL2 A;  3FZH A;  3VGK A;  3AAR A;  4M63 C;  4JHD A;  1X3M A;  4LC9 B;  3D2F B;  4M7X A;  1NGI A;  3O6W A;  1KAY A;  1JCF A;  4BRL A;  1Z6R A;  2V52 B;  2E1Z A;  2FF6 A;  5BRH A;  1BOT O;  1LOT B;  4BC3 A;  4BVO A;  4BC2 A;  1Y64 A;  3H3O B;  1CZA N;  3IDH A;  3O1W A;  4MLH A;  3VF2 A;  2E2P A;  3ULE A;  3VER A;  1ATN A;  4CI6 A;  3FZK A;  3B8A X;  2A3Z A;  2QWM A;  4AM6 A;  4BR4 A;  2YJF A;  1C0G A;  5BN8 A;  4BC5 A;  1ZXO A;  3QFP A;  5BPN A;  5FPE A;  2YJE A;  1GLA G;  1DGK N;  1HJO A;  3AAP A;  5AQT A;  3C0B A;  3R9P A;  1WOQ A;  1NBW A;  1GLB G;  1QQM A;  2E2N A;  3MK6 A;  4YDU C;  5LJW A;  5BR9 A;  3MN7 A;  2AA4 A;  5KPR A;  3VOV A;  4FWS A;  4BRK A;  3QIC A;  4A2B A;  5KPZ A;  3CJ1 A;  2P9N A;  3MN6 A;  3C7N B;  2Q0U A;  5AQK A;  3LDL A;  3QML A;  1X3N A;  4MLE A;  1RGI A;  1QHA A;  3DXM A;  5BRD A;  3UKU B;  4PKG A;  3L6Q A;  3DXK B;  2E8A A;  5AQZ A;  5JLF A;  2WUS A;  3I33 A;  3VF4 A;  1S3X A;  3W3D A;  1BU6 O;  2KHO A;  4BRF A;  4CJ7 A;  2ASM A;  2VYP A;  3FZM A;  3GL1 A;  1XC3 A;  4FSV A;  4BRI A;  4H0T B;  3GOI A;  1D4X A;  5AZI A;  3HI0 A;  5AQF A;  1YXQ A;  3VET A;  1V4T A;  4H5R A;  2V51 B;  4EFH A;  2QWR A;  2P9U B;  1NGH A;  4WYB A;  2D0P A;  4FWL A;  5EVZ A;  1YAG A;  4O5F A;  5BN9 A; 
#chains in the Genus database with same CATH topology
 4CHN A;  4M3W A;  4CJU A;  2G8H A;  4KI4 A;  1WBD A;  4OJR A;  3DAW A;  2ITG A;  1LW2 A;  1B9F A;  3IG1 A;  4JI0 K;  2C1G A;  3KIO A;  4Z4H A;  4GY2 B;  4M3U A;  1SL2 A;  4H0P A;  4FM1 A;  2RKI A;  4B1X B;  2Y1I A;  4LF7 K;  1LV5 A;  3JXU A;  4IOA L;  4J2D A;  2XY8 A;  1V4S A;  4IZ9 A;  1TAU A;  4FJN A;  4H8K A;  4O0I A;  1QS4 A;  1NJI O;  1TUU A;  4FWK A;  4XH5 A;  4IXC A;  3LDP A;  4W5R A;  1N8R O;  3DM2 A;  3EEQ A;  2W6L A;  3O8M A;  1RTD A;  2XO7 A;  2YHX A;  3M5R A;  3HXM A;  4PL7 A;  4CZE A;  4JK7 A;  4CGD A;  4H0X B;  2OZM A;  4ID5 A;  4W5T A;  3QO9 A;  3VEV A;  3JSM A;  3MWP A;  4AIL C;  1YI2 N;  4FJH A;  2OPP A;  4A61 A;  4CEB A;  4Z94 A;  4JI2 K;  4J2B A;  3THY A;  4JS4 A;  3PSF A;  4F3T A;  1BL3 A;  2QXF A;  2X6S A;  2QKB A;  1NGJ A;  1YVU A;  4JD2 A;  2X74 A;  2G8F A;  4A5B A;  2NZT A;  2NRR A;  2HNZ A;  2WON A;  3C6H A;  1Q8I A;  2G8W A;  1LCU A;  3VEY A;  1W97 L;  3QEX A;  3LP2 A;  3SJJ A;  1NOY A;  3VQQ A;  4IJN A;  3OYF A;  4C23 A;  2QW9 A;  1QQN A;  3QBW A;  1UA1 A;  1KAX A;  2I7P A;  3O4W A;  3ATV A;  4BRN A;  4PQU A;  5TKY A;  3GG4 A;  3VPZ A;  3HPO A;  3SK3 A;  3NVM A;  2G8V A;  4CJS A;  1W2B M;  3DLL L;  4JRQ A;  4FM2 A;  1X9W A;  3TWH A;  5AFU A;  4W5N A;  3LAM A;  3L0Q A;  3V9W A;  3ULD A;  3ZX2 A;  3OHR A;  4E7H A;  3MXJ A;  3CPW M;  4HTL A;  3MN5 A;  3E9L A;  3WXJ A;  4AHR A;  4CJE A;  5FRO A;  3DXM B;  4KI6 A;  3RRG A;  2Z1G A;  3FZL A;  4FM0 A;  1NOZ A;  2YNH A;  4DKW A;  1YJN N;  3R1X A;  1VSE A;  4AM7 A;  5C12 A;  4JK8 A;  1WLJ A;  4O8K A;  1TKT A;  5GAG P;  1KAZ A;  4O4G A;  1ASV A;  5T7B A;  1MWM A;  4FZZ A;  3AAQ A;  1HYS A;  1HKB A;  4A62 A;  3SUN A;  3K5L A;  3B6O A;  3KK3 A;  3PO4 A;  3O9S A;  3A0I X;  3EE8 A;  5BPL A;  2HF4 A;  2FSJ A;  1BWF O;  5GAE P;  2VG5 A;  2OZS A;  4GVM A;  1X1P A;  3QER A;  3H08 A;  3SI6 A;  4IO8 A;  3AVN A;  1W7A A;  4NO7 A;  2QXL A;  3V81 A;  1R59 O;  4BR2 A;  4NLC A;  1EET A;  3VGM A;  2OA8 A;  4NCG A;  2F9T A;  1IBM K;  3OS1 A;  3SJH A;  4DTN A;  4BGB A;  3OYI A;  2ETJ A;  1L3S A;  4DTR A;  1BGX T;  3SCX A;  3VQ7 A;  2YKN A;  1Z26 A;  4MQ3 A;  1TK5 A;  1VQ9 N;  2O8D A;  4H4O A;  4FO0 A;  3J8A A;  3CET A;  3LP0 A;  4UY8 O;  4Q5V A;  1I39 A;  1K73 O;  5JVH L;  1ASU A;  5KQD A;  4DV4 K;  4KO0 A;  4ZHR A;  4FLW A;  4CFC A;  3O1B A;  4FJ9 A;  3HP6 A;  1DTT A;  3U3Y A;  3HZ6 A;  3H1Q A;  1NLV A;  4F4K A;  1H1V A;  1IG9 A;  1HNW K;  4W5O A;  3TAQ A;  1ZBH A;  2QK9 A;  5EXW A;  1G15 A;  4BR9 A;  4FWM A;  3T1A A;  3VQP A;  4OO1 J;  4JNE A;  2P5G A;  4BC4 A;  3I0R A;  3TTC A;  4OLA A;  4H4M A;  2ASO A;  3RTV A;  4FLX A;  1RBS A;  3OYK A;  3SUO A;  4JYA K;  4A2A A;  1QTM A;  3OYH A;  4JKD A;  2X78 A;  1E4F T;  3A5O C;  3AY9 A;  1S6P A;  3CXC M;  4TSX A;  3MCA B;  3LM9 A;  4E7I A;  4HUE A;  3KLF A;  1JJ2 M;  2GBZ A;  3KVG A;  1WSE A;  3MX2 A;  1CXU A;  2Z1H A;  3U9D A;  2GX9 A;  2PFU A;  4H5T A;  3DLE A;  1N6Q A;  4L3Q A;  2P9L B;  1RDU A;  3G0Z A;  3S3O A;  1DLO A;  3Q7B A;  4IEI A;  3A5L C;  5AQL A;  3ZT4 A;  5BRE A;  1T05 A;  2NRW A;  3ZSW A;  4M3R A;  2ZJP L;  3G25 A;  4Z4G A;  2IDO A;  1SZ2 A;  3CIP A;  4EZ9 A;  1JKH A;  2NLX A;  3P4I A;  4RTF D;  4CD1 A;  2W00 A;  1DEJ A;  3ZT3 A;  1KD1 O;  3TPQ A;  3CFP A;  3CCQ N;  3CJB A;  1TK0 A;  3CCL N;  2A41 A;  3ZEU B;  1KLN A;  3L2U A;  3OBY A;  2AP1 A;  3DWL A;  2HHV A;  4DR1 K;  1VSH A;  3LP1 A;  3WXM B;  3LPU A;  3P31 A;  4K42 A;  5LL6 Z;  1FK9 A;  4XH1 A;  2NRZ A;  4DF4 A;  3E66 A;  3NGY A;  1JL2 A;  3C6T A;  3WUH A;  3B6P A;  1EQY A;  2GUP A;  2ZE2 A;  1B9D A;  4CES A;  4CJW A;  2HHQ A;  2P9S B;  4KH4 A;  4JLH A;  2WC9 A;  3QEW A;  3OYN A;  4KBO A;  4K8X A;  3H6E A;  3ZSQ A;  2Z1J A;  4ISE A;  3SUP A;  5HP1 A;  1C0T A;  3HP9 A;  2QWQ A;  4FLZ A;  2DFE A;  2VQE K;  4H0O A;  4DU4 A;  3EY1 A;  3I8D A;  3U8X A;  5FPD A;  3M8P A;  1J6Z A;  4CJ5 A;  4AHT A;  4IKF A;  4BDZ A;  4EHT A;  4H5W A;  5AQY A;  4CF2 A;  2LSN A;  1Q9X A;  3ZSY A;  3IMX A;  2HND A;  3CJ7 A;  4BVP A;  1YIT N;  3MAQ A;  1RT5 A;  2HHU A;  2Q36 A;  1HYV A;  3WEE A;  1S1U A;  4K0K K;  1NWK A;  1RT4 A;  4DUZ K;  4IO9 L;  3OY9 A;  1IG8 A;  5J2Q A;  3VGK A;  3N4P A;  4JKH A;  3IS9 A;  3TSU A;  4BEB A;  4JHD A;  1X3M A;  5E41 A;  3D2F B;  3KLH A;  2R7Y A;  4YNQ A;  2E1Z A;  4DSJ A;  1IO2 A;  3KLE A;  3NF7 A;  4CGJ A;  4BC3 A;  1K6Y A;  2FBX A;  3H3O B;  1N5Y A;  2E2P A;  1Q7Y O;  3ULE A;  1HNI A;  1ATN A;  3TAM A;  3FZK A;  1N33 K;  1KQS M;  4BR4 A;  1I94 K;  3QFP A;  2FBT A;  1C6V A;  4X66 K;  4DQP A;  1GLA G;  1S9G A;  4CJQ A;  1IKV A;  1HJO A;  5AQT A;  1EWR A;  3C0B A;  4DTO A;  1WOQ A;  1NBW A;  4KAZ A;  3E1Y A;  2O8C B;  3AVG A;  3MN7 A;  3J7Z O;  3V9Z A;  1QVG M;  4QOZ B;  1VSK A;  2KQ2 A;  4BRK A;  4LF5 K;  5HRP A;  3CJ1 A;  3QET A;  1WSH A;  5HOO A;  1X3N A;  1YT3 A;  4G1Q A;  3V4I A;  4PKG A;  3VTI A;  4IFY A;  3K9K A;  2E8A A;  4FJ8 A;  5JLF A;  4PWD A;  3VF4 A;  3TAB A;  4CJ4 A;  3RMD A;  4B3S K;  1XC3 A;  4FSV A;  1JLC A;  1E3M A;  3GOI A;  1D4X A;  3P1G A;  4ICL A;  4J2A A;  1YXQ A;  3VET A;  2E6L A;  2XY6 A;  4JI4 K;  2P9U B;  1J53 A;  5D3G A;  3ZET A;  4WE1 A;  4DV5 K;  3RWU A;  1KCF A;  1NGC A;  4CJV A;  1JCE A;  5HL7 L;  3LDN A;  4CK2 A;  4BQZ A;  4BRO A;  4JKF A;  1NGF A;  2CGJ A;  2P9S A;  2DFH A;  4CZM A;  3S41 A;  4DSI A;  4B1W B;  4OKJ A;  3P39 A;  3FFK B;  3V9U A;  4E1J A;  1REV A;  4CD3 A;  3H3N O;  3LAN A;  1TGO A;  1C1A A;  1S72 N;  4R79 A;  2A6A A;  1XMO K;  1SAZ A;  4HVJ A;  3NF9 A;  3IRX A;  4CZH A;  1ZYQ A;  1KVA A;  1U47 A;  1G99 A;  3UE5 A;  4DWI A;  2D0A A;  2HST A;  4OPH A;  4BG9 A;  3FR0 A;  3ALY A;  1RIL A;  5JEN A;  2KZZ A;  5B8H A;  4L8R B;  4K41 A;  4BE7 B;  2UUB K;  4FJJ A;  3VA3 A;  4N5S A;  2O4G A;  4FK0 A;  4FWN A;  1Q81 O;  3F9M A;  1VRU A;  3WXI A;  1HJR A;  4DHY A;  4CJK A;  1TYQ B;  4B3O A;  4OKK A;  1VSJ A;  4FW1 A;  4QS9 A;  3CCU N;  3TAE A;  4Z4E A;  3HBT A;  4FLT A;  3LWL A;  3HPH A;  1BHL A;  4JN4 A;  2RHK A;  4CGI A;  5HRS A;  1N36 K;  3VA0 A;  1HMV A;  5AQP A;  3E01 A;  3L2R A;  1HPM A;  4ELU A;  5CZ2 A;  3VQ9 A;  4ELT A;  2RE2 A;  1U45 A;  4CJF A;  2Q97 A;  2QWP A;  3RMA A;  5AFU H;  2HVI A;  3AO5 A;  1VRT A;  1NGG A;  2A1R A;  5AQQ A;  4JI3 K;  3MEE A;  3HSC A;  3SLC A;  1YIJ N;  1VSD A;  1YTA A;  3LDO A;  4OPA A;  1J5E K;  3EYZ A;  4E1N A;  5DMR A;  3F2K A;  1XHX A;  3ZLJ A;  5JLH A;  1HRH A;  3D45 A;  1ATR A;  1X9J A;  1K8K A;  1VAZ A;  1SL1 A;  2BTF A;  3H46 O;  5KPT A;  5KTQ A;  4DTX A;  3VES A;  2YKM A;  4B3T K;  1VSF A;  3OYM A;  1HKC A;  3KTQ A;  2PAV A;  3ZSV A;  4BEC A;  1FKP A;  3K5O A;  4YOR A;  1FKO A;  5C24 A;  3AVL A;  1TKD A;  5KI6 A;  3UKR B;  4YOX A;  4M3T A;  3SBT A;  1U6Z A;  4A59 A;  3KD1 E;  2PYL A;  1LWE A;  3QIP A;  2P9P A;  1RBV A;  3VQC A;  5FPM A;  3ID8 A;  2A40 A;  4CIG A;  5FPN A;  1A5W A;  4H0Y B;  3V9S A;  1U04 A;  1TKZ A;  2IIR A;  4DR4 K;  3DRP A;  3ZSO A;  2DFF A;  3D6R A;  3QLH A;  4GW6 A;  4DFK A;  3D2E B;  3NVK A;  3CCE N;  4CZF A;  1WNS A;  4CFB A;  2ATQ A;  3VN5 A;  2HBL A;  4HCB A;  3HL8 A;  3GBT A;  3M8Q A;  1QQO A;  3CFO A;  4EIA A;  1BQM A;  1LWF A;  4N41 A;  2FF3 B;  4JKG B;  1RT2 A;  4CEQ A;  5M1P A;  4E89 A;  2GUI A;  4B9M A;  3LDS A;  2FC0 A;  4FJM A;  4MFB A;  4FWQ A;  1Q82 O;  2VCP A;  4BDP A;  1T3V A;  4JI6 K;  4JKE A;  1JLG A;  3QNN A;  5AQN A;  5AQO A;  3EZW A;  3NE6 A;  4Z4I A;  2HHS A;  1N34 K;  4RW7 A;  3T3F A;  4BQL A;  3AGK A;  3PV8 A;  1BI4 B;  1RBT A;  1RT1 A;  3G71 N;  4DSF A;  1IV0 A;  1T6C A;  2QI2 A;  3ZX0 A;  3PUF A;  1TL3 A;  5J2P A;  2IVP A;  4BRQ A;  4H03 B;  3VEZ A;  3JYT A;  2Q31 A;  3CHW A;  1QSY A;  3OYA A;  1NJY A;  4CJT A;  4ZTJ A;  2E88 A;  4CJP A;  3NF8 A;  1KRP A;  3LM2 A;  5C2D A;  1GLJ O;  3K0S A;  4DV6 K;  1KC8 O;  3OYD A;  3QEV A;  3OYE A;  3SPY A;  2D1K A;  4CBW A;  2JGU A;  5EY4 A;  1WAF A;  2WTU A;  4JKC A;  4DB3 A;  4AQY K;  1QHT A;  1RBU A;  3FFI A;  3VQA A;  3ENO A;  3T69 A;  4RWT A;  3MMV A;  2PBD A;  4CZG A;  1ASW A;  5AQH A;  1X9M A;  5AZJ B;  1NNE A;  2HOE A;  3AA4 A;  3MX5 A;  3CJA A;  4DLE A;  1VQ8 N;  2KZM A;  2W41 A;  4N76 A;  1NK9 A;  4BR7 A;  3OBW A;  4CED A;  4JAX A;  3D7E O;  3IFR A;  1CXQ A;  5F2R A;  3O3F A;  1YTU A;  2O8E B;  4XJX A;  1S1V A;  2Q3S A;  5AZI B;  1J54 A;  1MWK A;  3TTD A;  4Z4F A;  3LWM A;  3NCI A;  1D5A A;  2V7Y A;  3EZ5 A;  4BRM A;  3KJV A;  1ZC6 A;  2BH1 A;  3UKR A;  4B1U B;  4DS5 A;  2D5R A;  2PY5 A;  2KFN A;  4C8O A;  4YOU A;  4B9N A;  3ZT0 A;  4DFM A;  2E6M A;  1RDC A;  1W0H A;  1EWQ A;  5MLC Q;  4FK2 A;  3WNH A;  3EN9 A;  3C94 A;  4DV1 K;  3QIN A;  5JVG L;  2W6K A;  5HRR A;  1VQ4 N;  1ZBU A;  4FWR A;  2A42 A;  1XQS C;  3RRH A;  4DV2 K;  4FYD A;  1RDW X;  1HUX A;  3TAG A;  2YHW A;  5AQI A;  4DSL A;  4E7K A;  2OAN A;  4F3O A;  5I9E B;  3ZX3 A;  3CPE A;  2ASP A;  3MXI A;  1L3T A;  3PY8 A;  1VQ6 N;  4JKG A;  1NMD A;  3KKS A;  4HHT A;  4IFV A;  3MCP A;  4M45 A;  3FE1 A;  4MO4 A;  5CZ1 A;  2UXB K;  2XRI A;  5IWA K;  2O8F B;  3O4Q A;  4CEC A;  1XNR K;  2H3G X;  1JCG A;  2ZWH A;  1IJJ A;  4M63 C;  4B3M K;  3SPZ A;  3ZSX A;  3TAP A;  4KH6 A;  4M7X A;  3TAR A;  1IH7 A;  3PO5 A;  4NLB A;  2YV0 X;  3F9K A;  4LF9 K;  4B9S A;  4OKE A;  3NGZ A;  4BVO A;  5IT9 O;  1Y64 A;  2NUB A;  3O1W A;  1OH5 A;  3NH1 A;  3VF2 A;  4R5P A;  4CI6 A;  1C0G A;  1ZXO A;  2FBY A;  4JI5 K;  5BPN A;  2DY4 A;  1OVY A;  5FPE A;  2YJE A;  1U4B A;  1TKX A;  3OS0 A;  4Q0B A;  3DI6 A;  3AAP A;  1GLB G;  4YDU C;  2E2N A;  4M3Z A;  3NGI A;  3VOV A;  4CGG A;  3V1R A;  3QIC A;  5KPZ A;  3BY5 A;  1HYZ A;  3CC4 N;  3C7N B;  2QA4 N;  1D9F A;  5AQK A;  2E4L A;  2ZQB A;  4GKK K;  4MLE A;  4X64 K;  1QHA A;  3DXM A;  1RT7 A;  2BGG A;  1C1C A;  3L6Q A;  3DXK B;  3PLA A;  2W42 A;  2WUS A;  5K14 A;  3NH0 A;  1S3X A;  2UU9 K;  4OPK A;  4GV6 A;  2KHO A;  2HBK A;  4BRF A;  4QCL A;  4CJ7 A;  2VYP A;  3FZM A;  4EP5 A;  2KLA A;  5AZI A;  1EKE A;  1JLB A;  5CY4 A;  4H5R A;  3WNE A;  3ASM A;  4A57 A;  1T7P A;  3CM5 A;  1SKS A;  1BCO A;  1NK7 A;  4M42 A;  3HST B;  1WSI A;  1CZB A;  3U3G A;  5E84 A;  3C6A A;  5F1X A;  3QFU A;  2AJQ A;  3OYB A;  4NB4 A;  4IJA A;  1T6D A;  1XUP O;  1XWL A;  3SYZ A;  4DQS A;  3T1H K;  3K5N A;  1NKC A;  3P5J A;  3AVF A;  3TSQ A;  1TL1 A;  4RG8 A;  4DTU A;  4DV0 K;  1VSL A;  3MWT A;  4I9Q A;  4IDH A;  3H45 C;  4YDU A;  4DSK A;  4DR3 K;  1ZBS A;  1NGE A;  5BRF A;  3K9J A;  2QWO A;  1YJW N;  3CME N;  5ELZ A;  1M90 O;  4CZJ A;  3ZSR A;  1GLE G;  5C25 A;  4CGH A;  5CYQ A;  3ITH A;  4DCH A;  1HQU A;  4DFP A;  3LAL A;  3SAG A;  4HUF A;  1MA9 B;  3TSP A;  3EE9 A;  4OVL A;  1BCM A;  1DT9 A;  3DYA A;  2Y1J A;  1VQ5 N;  1Q86 O;  5FRM A;  1KVB A;  4LFA K;  4DV7 K;  4LFB K;  2P9K B;  1ATS A;  1EP4 A;  4WQ4 C;  3CQY A;  2O8F A;  5J2N A;  1UAX A;  2ZJQ L;  4PA1 A;  4BE2 A;  4CEE A;  3CJC A;  4PKI A;  3I8B A;  3QEI A;  2WBN A;  3O80 A;  5CYM A;  2E20 A;  1RTH A;  4JKA A;  4CFA A;  1TAQ A;  3O08 A;  4F8R A;  3L2V A;  1HR0 K;  4CEF A;  3ZCM A;  3SQ2 A;  1BA1 A;  4CHY A;  3DJC A;  1NJX A;  2CH5 A;  3TI0 A;  2Q2R A;  4JI1 K;  4Z4C A;  1L3V A;  2OPQ A;  2P9L A;  1MDU B;  3OTO K;  2QKK A;  2F8S A;  3EO3 A;  3VQ5 A;  3VQB A;  4CF0 A;  2F7T A;  4GNI A;  3NAE A;  3J7A P;  4QS7 A;  2B4J A;  3SQ1 A;  2Q1N A;  4O55 A;  1GLL O;  5M1F A;  2NRV A;  5AQM A;  1JXB A;  4IOX A;  5GIN A;  4F2R A;  3HT3 A;  3BZK A;  3CYG A;  3C7N A;  1JLQ A;  4CJ3 A;  2KW4 A;  2FSK A;  1RTJ A;  1MU2 A;  1XI1 A;  1OH6 A;  3DXK A;  3LAK A;  5GAH P;  5AQV A;  3QB0 A;  1R0A A;  3NBP A;  4I2P A;  3L4Q A;  4DLG A;  1VHX A;  3V9X A;  5M1K A;  1Z05 A;  1JLA A;  3ZEU A;  3JS6 A;  3OJU A;  3CCV N;  3WXL A;  4WQ4 A;  1S6Q A;  2E2Q A;  4UQG A;  4BWJ A;  1WSJ A;  1J5O A;  4BY9 C;  4BR5 A;  2EWS A;  2UYT A;  4ELV A;  4CCH A;  3MN9 A;  4ZTF A;  4IEE A;  1BIS A;  1P8Z A;  3E9O A;  4B1Z A;  1X9S A;  2ZGZ A;  2HHH K;  4EHU A;  4C8N A;  5J2M A;  2B5J A;  1NG9 A;  1SQK A;  4CZI A;  4LD0 A;  1U2V B;  3ENB A;  1FJG K;  3CCS N;  4QS8 A;  2IGI A;  2ZD1 A;  3BEX A;  1NK0 A;  2IAJ A;  2BUP A;  4BE0 A;  4DV3 K;  4BG8 A;  5C42 A;  2HF3 A;  3CER A;  4MO5 A;  1QZ5 A;  1Q9Y A;  3J80 O;  1Z25 A;  1WUA A;  4J8F A;  2HVH A;  2A1S A;  4PY5 A;  1VQK N;  2G8I A;  3TAF A;  3RR7 A;  5EOY A;  5FDL A;  4BRD A;  4LH4 A;  1RT3 A;  5AQR A;  1TVR A;  2P9I B;  3VQ4 A;  2KKZ A;  4E1M A;  2GEM A;  3KK7 A;  1K9M O;  1BA0 A;  3FGU A;  3A5N C;  4JI7 K;  3DLK A;  4KV8 A;  3GE1 A;  3PIP L;  3CJ9 A;  3WNF A;  4EAH D;  5C2F A;  2OPS A;  4IDK A;  3VEX A;  3D2F A;  5FLX O;  2CH6 A;  1NKE A;  4X62 K;  4CZK A;  3KD5 E;  5KRT A;  3K2P A;  3IKM A;  1NK8 A;  4FPB A;  4K25 A;  1WB9 A;  3THY B;  2GWJ A;  3MEC A;  3V1O A;  3OYC A;  5KGW A;  2YHA A;  4FL9 A;  3BF1 A;  3ID6 A;  4N56 A;  3P38 A;  4J2E A;  5C0Y A;  4B1Y B;  1JLF A;  1Y97 A;  4JD2 B;  1SL0 A;  3WNG A;  4DQI A;  3LZI A;  4E7L A;  3KKR A;  3HM9 A;  4RW8 A;  4IOC L;  2O8C A;  4KTZ A;  1QQC A;  1RBR A;  3SUQ A;  4M3X A;  1RDD A;  1FXX A;  1DTQ A;  1ZBF A;  4LFC K;  3K59 A;  4KFB A;  3L8B A;  3SZ2 A;  3RR8 A;  1TV6 A;  4ILH A;  2BDP A;  4BRE A;  2P51 A;  4E72 A;  3AO1 A;  2ZM6 K;  1IKY A;  1GOB A;  1KFD A;  4CGF A;  4H0V B;  4JI8 K;  1UOC A;  3ISN C;  3LP3 A;  1T03 A;  4FJX A;  3GDQ A;  2P9N B;  4M7Y A;  4DS4 A;  4WCE L;  3THV A;  5AQU A;  3CQX A;  4LF6 K;  3O9R A;  1BUP A;  5TKW A;  4E19 A;  1L5U A;  1VQN N;  1KLM A;  4CHP A;  1SKW A;  4FK4 A;  3KWG A;  3S3N A;  3FLC O;  1K8A O;  1S22 A;  5EU7 A;  4B9U A;  4PUO A;  4O0J A;  2P9U A;  4DR5 K;  2XHB A;  1B92 A;  1WAJ A;  4KHS A;  4CVN E;  3LZJ A;  1QVF M;  3A2F A;  3M8R A;  3VTH A;  4CIF A;  2QM1 A;  5GAD P;  5HRO A;  2D0C A;  2G8U A;  5AQS A;  4FLY A;  3MXM A;  3WT0 A;  4V19 S;  1XC9 A;  2GTD A;  1E4G T;  4I7F A;  1S1W A;  1U2V A;  3LPT A;  3QBX A;  3U6F A;  1NK6 A;  2OTJ N;  2JWL A;  3OVN A;  2VG6 A;  5M1N A;  1O13 A;  1OH8 A;  4FJG A;  2VWJ A;  3THX B;  5LMU K;  1W9H A;  3THW B;  5A2Q O;  4ID1 A;  4KHU A;  3CCR N;  1VSI A;  4CEA A;  2JWK A;  3VQD A;  4FWP A;  1UWB A;  4WFB L;  2E5L K;  5M1Q A;  4PKH A;  1P90 A;  3QEP A;  3NF6 A;  2RPI A;  1Q18 A;  4I6M B;  1KXP A;  4CK3 A;  3SQ0 A;  1KVC A;  2VG7 A;  2F8T A;  3L3U A;  4WFN L;  3O9T A;  3AVA A;  2CGK A;  4BRP A;  4WF9 L;  4KTW A;  2W40 A;  4CEZ A;  1C0M A;  2D4W A;  4HUG A;  4KHY A;  5DM6 L;  4BRH A;  1NK5 A;  1NMN A;  3L2W A;  3HM8 A;  4DTP A;  2P9I A;  5H1S Q;  1L3U A;  3DLH A;  2QWN A;  1RFQ A;  3C6U A;  3CF5 L;  1HKG A;  2HNY A;  1JLE A;  3AV9 A;  4O5B A;  1HNV A;  2KTQ A;  5BPM A;  3H1V X;  2O8D B;  3R6M A;  3AVB A;  5AQW A;  1ESV A;  4GV9 A;  4AHV A;  3HK2 A;  1TYQ A;  4FLU A;  4DMN A;  5AJ3 K;  3O3G A;  4YOW A;  2E1Y A;  2WFB A;  5ADX A;  2ZJR L;  1EO1 A;  3EL2 A;  2I5J A;  3FZH A;  3AAR A;  3KLI A;  3T1Y K;  3AO3 A;  4LC9 B;  3CG7 A;  1C1B A;  1KFS A;  3O6W A;  4RW4 A;  4M3Y A;  4BRL A;  1Z6R A;  2V52 B;  3MEG A;  1EX4 A;  2FF6 A;  5BRH A;  1LOT B;  3G4S N;  4QAG A;  1GOA A;  3I55 N;  3SNN A;  3IDH A;  4AHC A;  1CZA N;  4MLH A;  4O8U A;  2PYJ A;  4CE9 A;  3B8A X;  3O3H A;  2OTL N;  4DG1 A;  4B8C A;  1J9A A;  2YJF A;  1HPZ A;  1UA0 A;  3F73 A;  1YJ9 N;  1DGK N;  3SBG A;  4LF8 K;  1QQM A;  4GMJ B;  2F4V K;  5KPR A;  4CJR A;  3AVK A;  5KRS A;  2P9N A;  3MN6 A;  4GV3 A;  3DOL A;  3DRR A;  3OYJ A;  3QML A;  4FJI A;  4LSN A;  3UKU B;  4YY3 K;  3O9U A;  5AQZ A;  4DUY K;  4DR7 K;  3CCM N;  3I33 A;  3V6D A;  1YHQ N;  4ILJ A;  3W3D A;  4AHU A;  1BU6 O;  4IG0 A;  4U7B A;  4C1N I;  1D8Y A;  4OGC A;  2ASM A;  3L3V A;  4JKB A;  5DK5 A;  2VWK A;  2IOC A;  4O44 A;  3TAN A;  4BRI A;  2OCE A;  4JV5 K;  4H0T B;  3HI0 A;  1WBB A;  5AQF A;  2WOM A;  3K58 A;  4FJ5 A;  2HHI A;  1V4T A;  2V51 B;  4EFH A;  1YF5 L;  2UUA K;  1TK8 A;  2EHG A;  2D0P A;  5EVZ A;  4A5A A;  1YAG A;  4O5F A;  5BN9 A;  4BGA A;  3VEO A;  3THX A;  1SUQ A;  2YI1 A;  3THW A;  3KWI A;  5CE3 A;  5SZT A;  3IAY A;  3VEW A;  5KQ8 A;  3NH2 A;  3S5T A;  4CBU A;  4KB1 A;  4GKJ K;  3WQU A;  3PSI A;  4MDA A;  1GLF O;  3WQT A;  5E26 A;  4I6M A;  2BAN A;  4CF9 A;  4HWI A;  4Y1D A;  2FXU A;  4YFU A;  3RSE B;  5FRN A;  1DKG D;  5I3U A;  4H5N A;  2YX6 A;  5SWM A;  4DR6 K;  2ZGY A;  4KRE A;  4BR0 A;  3D2E A;  4FXD A;  4B1V A;  1NM1 A;  3QIO A;  1LAV A;  2ZF5 O;  4IBN A;  2OYQ A;  1IKW A;  2UUC K;  4BRA A;  2OPR A;  2DPN A;  4ISG A;  3VQE A;  4YOT A;  4HTU A;  1FW6 A;  3VMF B;  5LJV A;  4FCY A;  2Q0R A;  5JIC A;  4M41 A;  2QWL A;  4DTJ A;  3UB5 A;  3DRS A;  5BR8 K;  2XY5 A;  3TU5 A;  5F0X A;  4K8Z A;  4WQ5 C;  3KK2 A;  2HBJ A;  1BIU A;  3RMB A;  3U4L A;  2IS3 A;  2HBM A;  3CI5 A;  4IFE A;  3L2Q A;  1BI4 A;  1I3A A;  3WEE B;  1T44 A;  3AVM A;  1TUY A;  2GWK A;  1SV5 A;  4DQ8 A;  4CEO A;  3PX0 A;  1XNQ K;  4H5V A;  1VQM N;  2FBV A;  4MDB A;  3BDP A;  1HQE A;  4JHD B;  4IWV A;  3D0P A;  3NDK A;  1CZ9 A;  1ILY A;  4CFD A;  3L4I A;  4E0D A;  4KTQ A;  1WSG A;  4RW9 A;  3ULE B;  4U67 L;  3EKS A;  2IC3 A;  1ITG A;  2UXC K;  2VGM A;  3VQ8 A;  4K43 A;  2J4R A;  3MED A;  4OGE A;  2E2O A;  4W5Q A;  3ATU A;  3S9H A;  5AZJ A;  2YCH A;  3UKU A;  2HHW A;  1M1K O;  4FPA A;  4XEI A;  1HNZ K;  1VK0 A;  3O4N A;  4JEP A;  3CCJ N;  1NKB A;  2YNG A;  3AA3 A;  3I56 N;  1NJZ A;  2I7N A;  5KGX A;  2O8E A;  3DLR A;  4CZL A;  3K5M A;  3Q7C A;  4C8L A;  3N4Q A;  5C15 A;  3M3Z A;  1NK4 A;  3SAH A;  3HRG A;  3M1F A;  4WQ5 A;  5AR0 A;  4B3R K;  5J1E A;  3VEN A;  1CLQ A;  4DSE A;  3HVR A;  3HJF A;  3E9P A;  3RMC A;  4B9V A;  1BG3 A;  4BRC A;  3BF3 A;  3M8S A;  3KZB A;  2VQF K;  2IVO A;  4LSL A;  3VGL A;  3G6E N;  4DTM A;  2C1I A;  3LDQ A;  1WN7 A;  3SV3 A;  2PZS A;  3CYM A;  3EKU A;  3DLG A;  4DQQ A;  4YOV A;  4RCH A;  1RDA A;  4KH5 A;  4F9O A;  4CHQ A;  3ZET B;  3BUZ B;  4B9Q A;  3FZF A;  1OKJ A;  3M6G A;  1S1X A;  1VSM A;  4KHN A;  3AA5 X;  3RSE A;  1GOC A;  2B6A A;  3AO2 A;  2NRH A;  3I0S A;  3CC2 N;  4ILG B;  2HHX A;  5HRN A;  2YNF A;  1LAW A;  4I9L A;  4CW7 B;  3CQ8 A;  3QNO A;  4OLB A;  1BQN A;  4DU3 A;  4KRF A;  1HX1 A;  1ZBI A;  2QEX N;  3OA9 A;  1IBL K;  3CD6 N;  1OVQ A;  4E7J A;  4KKO A;  1BO5 O;  2D0B A;  4XH4 A;  1GLC G;  1LW0 A;  3AO4 A;  3U9Z A;  4AH9 A;  3ZYY X;  3KK1 A;  1QE1 A;  3BZC A;  4N47 A;  3TR8 A;  3UIQ A;  2NNW A;  4FVU A;  2HMP A;  4FOI A;  4Y0W A;  4NXM K;  5AQJ A;  4JS5 A;  4HCC A;  4LH5 A;  4LY7 A;  4DFJ A;  4CHO A;  2ITM A;  2O4I A;  2YNI A;  1C0U A;  3ZT2 A;  1O1W A;  4JK9 A;  3KLG A;  1S1T A;  4ISF A;  3QES A;  3CFR A;  4AF1 A;  3HVT A;  1A5V A;  5LY3 A;  1RNH A;  3DOK A;  3R3L A;  3VF6 A;  2NRX A;  4PHT X;  3A8Y A;  1QSL A;  4LF4 K;  1VQP N;  3OJS A;  1NGA A;  3AVI A;  5JMV A;  4XIU A;  1YUW A;  4B9L A;  4I2Q A;  1A5X A;  3O5B A;  3SMS A;  1QSS A;  1U49 A;  4CJL A;  3PIO L;  4BE1 A;  4FWO A;  2O8B B;  3AVC A;  3WXK A;  1JXE A;  5I42 A;  1C0F A;  1BDG A;  5AQG A;  4C8K A;  4PL8 A;  4Y1C A;  4FJ7 A;  4FJL A;  5AQX A;  3SMP A;  5EX5 A;  1IBK K;  4RW6 A;  1HLU A;  3OW2 M;  1GLD G;  4JRP A;  4FJK A;  3KHY A;  3SV4 A;  1XHZ A;  3QDK A;  3V1Q A;  3HOS A;  5HLF A;  1RDB A;  3BP8 A;  4E3S A;  4X65 K;  2D0O A;  5LMN K;  2GV9 A;  3ENH A;  1WSF A;  3NHG A;  1IKX A;  4BDY A;  2VWB A;  4FOE A;  1K8K B;  1NGD A;  4NYF A;  4DR2 K;  2F96 A;  1SKR A;  1VQL N;  2UXD K;  2BE2 A;  3O9Q A;  3J81 O;  3R8E A;  4BWM A;  3PX4 A;  4B08 A;  4NCA A;  4DF8 A;  3T19 A;  4BAC A;  2CGL A;  3K57 A;  1QZ6 A;  3SQ4 A;  3A5M C;  3JAM O;  1T8E A;  2HB5 A;  3AVJ A;  3W0L A;  3MDQ A;  4CBX A;  1SS6 A;  2DTU A;  3BGR A;  1KSP A;  4FVM A;  3LL3 A;  1NU0 A;  3HYF A;  1EXQ A;  4BRG A;  2NRT A;  2GEL A;  2HMI A;  3AVH A;  3HTV A;  4FZX C;  1S5J A;  2IVN A;  4CER A;  4CF1 A;  4B8A B;  3IUC A;  4NYN A;  2P9P B;  2V7Z A;  4EP4 A;  1NGB A;  2VGN A;  2G8K A;  2FLO A;  2A5X A;  1ZBL A;  2RF2 A;  1VQO N;  2P9K A;  4DQR A;  4NCB A;  4KHQ A;  3J7Y P;  1HNX K;  5ADX H;  3F5T A;  5C10 A;  1YVN A;  5GIP A;  2FSN A;  2YHY A;  1RTI A;  2RN2 A;  1N32 K;  3G10 A;  5CR4 A;  3CM6 A;  3OYG A;  2XY7 A;  3CC7 N;  3T7Z A;  2HHT A;  2F9W A;  4CIE A;  2P5O A;  2QTD A;  2KFZ A;  4EZ6 A;  2YHB A;  2P1J A;  2X6N A;  3NMU A;  2Z1I A;  4YHH K;  1NGI A;  3ZSZ A;  5JS2 A;  3P83 D;  1KAY A;  1JCF A;  3TTF A;  5GIO A;  4YOY A;  1BOT O;  3OS2 A;  4OPJ A;  1U48 A;  4AHS A;  4BC2 A;  4C1N K;  5JS1 A;  4KPY A;  4CF8 A;  3HOT A;  4CHZ A;  1JL1 A;  3VER A;  4DTS A;  4F2S A;  3AGR A;  1D9D A;  3DMJ A;  4KB0 A;  4NXN K;  2A3Z A;  2QWM A;  4DU1 A;  3DLB A;  1F21 A;  4AM6 A;  4G9Z A;  5BN8 A;  4BC5 A;  3S3M A;  2O8B A;  2JLE A;  4IG3 A;  3C65 A;  4WFA L;  4OX9 K;  1RT6 A;  4FZY A;  3ZT1 A;  3R9P A;  5LJW A;  5M1O A;  3MK6 A;  5HBM A;  5BR9 A;  2AA4 A;  4Z0U A;  4B9T A;  4FWS A;  3NFA A;  2EX3 A;  2HW3 A;  3CMA N;  4CK1 A;  4A2B A;  1LWC A;  2Q0U A;  3LDL A;  5CHI A;  1VQ7 N;  1RGI A;  1RCH A;  4KHP K;  4FW2 A;  5BRD A;  1S9E A;  4FLV A;  5DM7 L;  1BIZ A;  1XMQ K;  3VQ6 A;  3HPG A;  1OH7 A;  3PX6 A;  3AA2 A;  4KHW A;  3OYL A;  3GL1 A;  3HO1 A;  3RVC A;  1KTQ A;  2QWR A;  4GVE A;  4C8M A;  1NGH A;  3C95 A;  4WYB A;  4FWL A;  3SAF A;  1NJW A; 
#chains in the Genus database with same CATH homology
 4BGA A;  3VEO A;  2YI1 A;  5E84 A;  3KWI A;  3DAW A;  1NGC A;  5CE3 A;  3C6A A;  5F1X A;  1JCE A;  3VEW A;  5KQ8 A;  3LDN A;  3QFU A;  5HL7 L;  4NB4 A;  2C1G A;  4CBU A;  4BQZ A;  4IJA A;  4BRO A;  1T6D A;  1XUP O;  3WQU A;  4GY2 B;  4MDA A;  1GLF O;  3WQT A;  4JKF A;  5E26 A;  1NGF A;  4H0P A;  2CGJ A;  4I6M A;  2P9S A;  3TSQ A;  4HWI A;  4B1X B;  2FXU A;  3JXU A;  4IOA L;  4CZM A;  3S41 A;  3RSE B;  1V4S A;  4IZ9 A;  1DKG D;  4B1W B;  3MWT A;  3P39 A;  3FFK B;  2YX6 A;  4H5N A;  4IDH A;  4E1J A;  2ZGY A;  3H45 C;  4YDU A;  4CD3 A;  3H3N O;  4BR0 A;  1NJI O;  3D2E A;  4B1V A;  1NM1 A;  1TUU A;  2ZF5 O;  4FWK A;  4XH5 A;  1ZBS A;  1NGE A;  4IXC A;  3LDP A;  3K9J A;  2QWO A;  5BRF A;  4R79 A;  2A6A A;  5ELZ A;  4CZJ A;  1YJW N;  1S72 N;  1SAZ A;  4BRA A;  1GLE G;  1N8R O;  2DPN A;  3O8M A;  4ISG A;  2YHX A;  4CZH A;  4YOT A;  3M5R A;  4DCH A;  3VMF B;  1G99 A;  3UE5 A;  3SAG A;  1MA9 B;  5LJV A;  2Q0R A;  4PL7 A;  4CZE A;  3TSP A;  3EE9 A;  5JIC A;  4JK7 A;  2HST A;  1DT9 A;  2QWL A;  4H0X B;  4OPH A;  4BG9 A;  3FR0 A;  1Q86 O;  1VQ5 N;  3VEV A;  2P9K B;  1ATS A;  3MWP A;  4WQ4 C;  4K41 A;  3UB5 A;  3CQY A;  3TU5 A;  5B8H A;  1YI2 N;  4BE7 B;  5F0X A;  4WQ5 C;  4A61 A;  2ZJQ L;  4Z94 A;  2HBJ A;  4FWN A;  3U4L A;  3F9M A;  1Q81 O;  3CJC A;  2HBM A;  3CI5 A;  4PKI A;  3WXI A;  3I8B A;  4DHY A;  4IFE A;  2WBN A;  3WEE B;  1T44 A;  3O80 A;  1TUY A;  1TYQ B;  2E20 A;  2GWK A;  4DQ8 A;  4JKA A;  1NGJ A;  4JD2 A;  3O08 A;  4H5V A;  4QS9 A;  2W00 A;  4A5B A;  2NZT A;  3CCU N;  1VQM N;  4MDB A;  1BA1 A;  3HBT A;  2NRR A;  4JHD B;  3C6H A;  4IWV A;  3DJC A;  1LCU A;  3VEY A;  1W97 L;  4IJN A;  2CH5 A;  4C23 A;  1ILY A;  4JN4 A;  2RHK A;  2QW9 A;  1QQN A;  2Q2R A;  3QBW A;  5AQP A;  1KAX A;  3L4I A;  2P9L A;  1MDU B;  2I7P A;  1HPM A;  3EO3 A;  2F7T A;  3O4W A;  3ATV A;  4GNI A;  2RE2 A;  4BRN A;  3ULE B;  4QS7 A;  2Q97 A;  2QWP A;  3EKS A;  3GG4 A;  5TKY A;  2Q1N A;  5AFU H;  4U67 L;  1GLL O;  5M1F A;  2NRV A;  5AQM A;  3VPZ A;  1NGG A;  5AQQ A;  2VGM A;  4IOX A;  5GIN A;  4K43 A;  2J4R A;  3SK3 A;  2E2O A;  3NVM A;  3C7N A;  3HSC A;  3SLC A;  3ATU A;  1W2B M;  1YIJ N;  3DLL L;  2FSK A;  5AZJ A;  2YCH A;  3UKU A;  3LDO A;  4OPA A;  4FPA A;  4XEI A;  5AFU A;  1M1K O;  3DXK A;  3L0Q A;  5GAH P;  4JEP A;  5AQV A;  3QB0 A;  3F2K A;  3ZX2 A;  3L4Q A;  3CCJ N;  3OHR A;  5JLH A;  5M1K A;  3I56 N;  1Z05 A;  2I7N A;  3CPW M;  4CZL A;  4HTL A;  3JS6 A;  3E9L A;  3MN5 A;  3WXJ A;  3ZEU A;  1ATR A;  3Q7C A;  3N4Q A;  3CCV N;  5C15 A;  3WXL A;  1X9J A;  4WQ4 A;  1K8K A;  1VAZ A;  3DXM B;  2E2Q A;  2BTF A;  3M3Z A;  3SAH A;  3HRG A;  3H46 O;  5KPT A;  3M1F A;  4WQ5 A;  3FZL A;  4BY9 C;  4BR5 A;  5AR0 A;  2EWS A;  2UYT A;  4DKW A;  3MN9 A;  1YJN N;  4IEE A;  3VEN A;  3R1X A;  1P8Z A;  3E9P A;  3E9O A;  3VES A;  4B1Z A;  1BG3 A;  4BRC A;  3BF3 A;  4AM7 A;  2ZGZ A;  3KZB A;  4JK8 A;  5C12 A;  4O8K A;  5GAG P;  2IVO A;  4EHU A;  3G6E N;  3VGL A;  1KAZ A;  1HKC A;  2C1I A;  2PAV A;  1SQK A;  3LDQ A;  4BEC A;  1MWM A;  3AAQ A;  3EKU A;  4YOR A;  1HKB A;  4YOV A;  4RCH A;  4A62 A;  4CZI A;  1U2V B;  3ENB A;  3O9S A;  3A0I X;  3EE8 A;  3UKR B;  3CCS N;  3CME N;  4KH5 A;  5BPL A;  4YOX A;  2HF4 A;  2FSJ A;  3SBT A;  4QS8 A;  1BWF O;  3ZET B;  1U6Z A;  3BUZ B;  4A59 A;  4B9Q A;  3FZF A;  5GAE P;  3BEX A;  1OKJ A;  3M6G A;  4IO8 A;  4NO7 A;  2BUP A;  2QXL A;  1R59 O;  3RSE A;  4BG8 A;  4BR2 A;  4NLC A;  2P9P A;  3VGM A;  3CC2 N;  2NRH A;  4ILG B;  2F9T A;  5FPM A;  2HF3 A;  3ID8 A;  2A40 A;  3CER A;  4MO5 A;  1QZ5 A;  5FPN A;  3SJH A;  4H0Y B;  1WUA A;  4J8F A;  4BGB A;  1VQK N;  2IIR A;  1HX1 A;  2QEX N;  3OA9 A;  5EOY A;  3D6R A;  3CD6 N;  1VQ9 N;  4BRD A;  4FO0 A;  1BO5 O;  3J8A A;  4XH4 A;  1GLC G;  3D2E B;  5AQR A;  3U9Z A;  2P9I B;  3CET A;  3CCE N;  3ZYY X;  4CZF A;  4UY8 O;  2KKZ A;  1K73 O;  4FVU A;  2GEM A;  3KK7 A;  2NNW A;  5JVH L;  2HMP A;  5KQD A;  2HBL A;  1K9M O;  1BA0 A;  4FOI A;  3FGU A;  3A5N C;  4Y0W A;  3GBT A;  5AQJ A;  1QQO A;  4EIA A;  3GE1 A;  3PIP L;  3CJ9 A;  3O1B A;  2FF3 B;  4JKG B;  2ITM A;  4EAH D;  5C2F A;  3HZ6 A;  3H1Q A;  1NLV A;  3VEX A;  3D2F A;  1H1V A;  5M1P A;  2CH6 A;  4FWQ A;  4JK9 A;  5EXW A;  4BR9 A;  1Q82 O;  4FWM A;  4ISF A;  2VCP A;  4OO1 J;  4CZK A;  4JNE A;  1T3V A;  4BC4 A;  4AF1 A;  3IKM A;  3TTC A;  4JKE A;  5AQN A;  4FPB A;  4K25 A;  3EZW A;  5AQO A;  2ASO A;  5LY3 A;  2GWJ A;  3R3L A;  3VF6 A;  2NRX A;  4PHT X;  4A2A A;  3A8Y A;  4JKD A;  3ZET A;  4BQL A;  3AGK A;  4FL9 A;  3BF1 A;  3ID6 A;  1E4F T;  3A5O C;  3P38 A;  3G71 N;  3AY9 A;  1T6C A;  5C0Y A;  2QI2 A;  3ZX0 A;  1VQP N;  4B1Y B;  3CXC M;  3MCA B;  1NGA A;  3LM9 A;  4JD2 B;  5JMV A;  2IVP A;  4BRQ A;  1YUW A;  4H03 B;  3VEZ A;  3O5B A;  1JJ2 M;  2Q31 A;  3CHW A;  3SMS A;  3KVG A;  3MX2 A;  4IOC L;  2E88 A;  3U9D A;  2GX9 A;  2PFU A;  3PIO L;  4FWO A;  3LM2 A;  4H5T A;  5C2D A;  1GLJ O;  1KC8 O;  3WXK A;  4L3Q A;  2P9L B;  1RDU A;  2D1K A;  4ILH A;  4CBW A;  1C0F A;  1BDG A;  5AQG A;  5EY4 A;  4BRE A;  4IEI A;  3Q7B A;  5BRE A;  3A5L C;  5AQL A;  2NRW A;  4H0V B;  4JKC A;  4PL8 A;  2ZJP L;  3G25 A;  1SZ2 A;  4DB3 A;  5AQX A;  3SMP A;  3GDQ A;  2P9N B;  5EX5 A;  3CIP A;  4M7Y A;  1HLU A;  3ENO A;  4WCE L;  3OW2 M;  1GLD G;  3T69 A;  2NLX A;  4RWT A;  3P4I A;  4RTF D;  3CQX A;  3KHY A;  3O9R A;  1BUP A;  5AQU A;  3MMV A;  5TKW A;  4CD1 A;  2PBD A;  4CZG A;  1M90 O;  1DEJ A;  1VQN N;  5AQH A;  5AZJ B;  3QDK A;  2HOE A;  1KD1 O;  3MX5 A;  3CJA A;  1VQ8 N;  3KWG A;  3HOS A;  2W41 A;  3FLC O;  1K8A O;  1S22 A;  3TPQ A;  4BR7 A;  3CCQ N;  3OBW A;  4F9O A;  2P9U A;  3BP8 A;  4JAX A;  3CJB A;  3D7E O;  3IFR A;  5F2R A;  2D0O A;  3CCL N;  3ENH A;  4XJX A;  2A41 A;  1QVF M;  3ZEU B;  2VWB A;  3OBY A;  2AP1 A;  3DWL A;  5AZI B;  4FOE A;  1MWK A;  1K8K B;  1NGD A;  3TTD A;  2QM1 A;  3VTH A;  5GAD P;  1VQL N;  3O9Q A;  5AQS A;  3WXM B;  3P31 A;  4K42 A;  3R8E A;  3WT0 A;  2V7Y A;  4XH1 A;  2GTD A;  4BRM A;  1E4G T;  2NRZ A;  1ZC6 A;  2OTJ N;  1U2V A;  3QBX A;  2JWL A;  2BH1 A;  3UKR A;  1O13 A;  4B1U B;  5M1N A;  3E66 A;  2CGL A;  1QZ6 A;  3A5M C;  3CCR N;  2JWK A;  3WUH A;  4YOU A;  4FWP A;  3NVK A;  1EQY A;  4WFB L;  2GUP A;  5M1Q A;  4PKH A;  5MLC Q;  3W0L A;  1P90 A;  3EN9 A;  3MDQ A;  4CBX A;  1SS6 A;  5JVG L;  3LL3 A;  1Q18 A;  1VQ4 N;  4BRG A;  4I6M B;  1KXP A;  2NRT A;  2A42 A;  2GEL A;  2P9S B;  4FWR A;  1XQS C;  4KH4 A;  3HTV A;  1RDW X;  2WC9 A;  2IVN A;  1HUX A;  4WFN L;  2YHW A;  3O9T A;  5AQI A;  3IUC A;  2CGK A;  4KBO A;  4BRP A;  2P9P B;  3H6E A;  4WF9 L;  2V7Z A;  5LJW A;  1NGB A;  2W40 A;  4ISE A;  2D4W A;  2OAN A;  2VGN A;  5DM6 L;  5I9E B;  4BRH A;  2QWQ A;  2FLO A;  3HM8 A;  2P9I A;  2A5X A;  5H1S Q;  4H0O A;  3ZX3 A;  1VQO N;  3U8X A;  2P9K A;  3CPE A;  2ASP A;  5FPD A;  1J6Z A;  2QWN A;  1RFQ A;  3CF5 L;  1HKG A;  4EHT A;  4H5W A;  5AQY A;  5ADX H;  3F5T A;  5C10 A;  1YVN A;  1VQ6 N;  4JKG A;  1NMD A;  5GIP A;  5BPM A;  3H1V X;  3IMX A;  2FSN A;  2YHY A;  3R6M A;  3CJ7 A;  1YIT N;  4BVP A;  5AQW A;  1ESV A;  3MCP A;  4GV9 A;  3FE1 A;  2Q36 A;  5CR4 A;  3WEE A;  4MO4 A;  1NWK A;  1TYQ A;  4IO9 L;  3CC7 N;  1IG8 A;  3T7Z A;  4YOW A;  2E1Y A;  2F9W A;  2WFB A;  5ADX A;  2H3G X;  2ZJR L;  1EO1 A;  1JCG A;  2QTD A;  1IJJ A;  2ZWH A;  3EL2 A;  3FZH A;  3VGK A;  3N4P A;  4JKH A;  3AAR A;  4M63 C;  3TSU A;  4BEB A;  4JHD A;  1X3M A;  4LC9 B;  3NMU A;  3D2F B;  4KH6 A;  1NGI A;  4M7X A;  3O6W A;  1KAY A;  1JCF A;  4NLB A;  4BRL A;  1Z6R A;  2V52 B;  3TTF A;  2E1Z A;  2FF6 A;  5BRH A;  1BOT O;  1LOT B;  5GIO A;  4YOY A;  3G4S N;  4BC3 A;  4BVO A;  3I55 N;  4BC2 A;  4C1N K;  1Y64 A;  3H3O B;  1CZA N;  3IDH A;  3O1W A;  4MLH A;  4O8U A;  3HOT A;  3VF2 A;  2E2P A;  1Q7Y O;  3ULE A;  3VER A;  1ATN A;  3AGR A;  4CI6 A;  3FZK A;  3B8A X;  2OTL N;  2A3Z A;  2QWM A;  1KQS M;  4AM6 A;  4BR4 A;  2YJF A;  4G9Z A;  1C0G A;  5BN8 A;  4BC5 A;  1ZXO A;  3QFP A;  5BPN A;  1OVY A;  3C65 A;  5FPE A;  2YJE A;  4WFA L;  1GLA G;  1YJ9 N;  1DGK N;  1HJO A;  3AAP A;  5AQT A;  3SBG A;  3C0B A;  3R9P A;  1WOQ A;  1NBW A;  1GLB G;  1QQM A;  2E2N A;  3MK6 A;  4YDU C;  5M1O A;  3E1Y A;  5BR9 A;  3MN7 A;  2AA4 A;  5KPR A;  3J7Z O;  3VOV A;  1QVG M;  4FWS A;  3CMA N;  4BRK A;  3QIC A;  4A2B A;  5KPZ A;  3CJ1 A;  2P9N A;  3MN6 A;  3CC4 N;  4GV3 A;  3C7N B;  2Q0U A;  2QA4 N;  5AQK A;  3LDL A;  5CHI A;  3QML A;  5HOO A;  1X3N A;  1VQ7 N;  4MLE A;  1RGI A;  1QHA A;  3DXM A;  5BRD A;  3UKU B;  4PKG A;  3VTI A;  3K9K A;  3L6Q A;  3DXK B;  3PLA A;  3O9U A;  5DM7 L;  2E8A A;  5AQZ A;  5JLF A;  2WUS A;  3CCM N;  3I33 A;  1YHQ N;  4ILJ A;  3VF4 A;  1S3X A;  3W3D A;  1BU6 O;  4U7B A;  4GV6 A;  4C1N I;  2KHO A;  2HBK A;  4BRF A;  4CJ7 A;  2ASM A;  2VYP A;  3FZM A;  4JKB A;  3GL1 A;  1XC3 A;  4FSV A;  4BRI A;  2KLA A;  4H0T B;  3GOI A;  1D4X A;  5AZI A;  3RVC A;  3HI0 A;  5AQF A;  1YXQ A;  3VET A;  1V4T A;  4H5R A;  2V51 B;  4EFH A;  1YF5 L;  4A57 A;  2QWR A;  4GVE A;  2P9U B;  1NGH A;  4WYB A;  2D0P A;  4FWL A;  5EVZ A;  3SAF A;  4A5A A;  1YAG A;  4O5F A;  5BN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...