1K8KB

Crystal structure of arp2/3 complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
190
structure length
190
Chain Sequence
GVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords ACTIN-LIKE PROTEIN 3
publication title Crystal Structure of Arp2/3 Complex
pubmed doi rcsb
total genus 51
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1k8kB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1k8kB02
1RFQA 2V7ZA 3GOIA 2CH6A 2E88A 3H1QA 4E1JA 5AZJB 4BRCA 1S22A 3ULEA 4QS8A 4JNEA 4JD2B 4BRIA 1HJOA 1BU6O 3UB5A 3O80A 4FWQA 3CJCA 4EAHD 3MN6A 1NGFA 3FGUA 1U2VB 2IVNA 1TYQB 4A61A 2UYTA 5BN8A 2AA4A 1E4GT 3HTVA 2P9UB 1KXPA 3F9MA 1JCGA 3DJCA 3L6QA 4FWMA 4HWIA 1BO5O 2VWBA 1NGDA 4RTFD 3MCPA 2Q97A 3M3ZA 1NM1A 3MK6A 5BPLA 3CI5A 1BG3A 2A5XA 4CZIA 4RCHA 3VENA 3H46O 2ASMA 3C7NA 4BRQA 2Q0RA 4WQ4C 4BVOA 3VEXA 4NO7A 2QM1A 4PL7A 3I33A 5JICA 3LM9A 1GLAG 1U6ZA 3AAQA 2J4RA 2YJEA 1KAYA 2V51B 4H0YB 1ZC6A 3WQUA 5KQ8A 3GDQA 4B1WB 3R8EA 3QBWA 3ZETA 1MWMA 4KBOA 3A5MC 4A2BA 4F9OA 4BR7A 4XH1A 5AQIA 4H5RA 2CGKA 1GLLO 3D2FA 4FWKA 2FSNA 4HTLA 5AZIB 1BOTO 3M6GA 1ATSA 3LDNA 4BREA 1LOTB 3D2EB 4FWSA 4GY2B 5JLFA 3CJAA 4A62A 2QW9A 2QWLA 4FOEA 1HPMA 1NMDA 2D0PA 3FFKB 4B1XB 4BRDA 3FZHA 3ULEB 3FZMA 2NZTA 5AQTA 4ISEA 3H45C 3QDKA 1GLBG 5AQKA 2QWOA 1XQSC 4EFHA 2KHOA 1YXQA 2P9NB 3QFPA 1X9JA 3S41A 1Y64A 2A42A 3EL2A 3RSEA 2YCHA 3HI0A 1SQKA 2A41A 4B1VA 2FF6A 1H1VA 2D0OA 3FZFA 5JLHA 5F1XA 4B1YB 4H5NA 2QWQA 5AQQA 2QWNA 2P9SB 1EQYA 4FL9A 1MDUB 4FWOA 5E84A 3DAWA 4H0XB 2QWPA 4DCHA 2P9LA 4I6MA 3VESA 4BRLA 2ZF5O 3UKRB 3VPZA 4FWLA 2ZGZA 2F9WA 4CJ7A 4CZKA 3DXMA 3LDOA 3W0LA 4BRNA 1NWKA 1MWKA 3LDPA 1ATNA 4PKGA 3C7NB 1GLJO 2PAVA 1T6DA 3TU5A 1BDGA 3U8XA 4BRFA 1TUUA 3VGKA 1DKGD 2WUSA 4MLHA 1NGCA 4BRPA 5BRHA 1BWFO 3U9ZA 5AFUA 1BA0A 2YHWA 4WQ5A 5I9EB 1NGHA 4WYBA 1XUPO 1Q18A 1DGKN 1X3NA 4A2AA 2EWSA 1T6CA 4BGAA 4K43A 3U9DA 3ZEUB 5LJVA 4CZJA 2YI1A 4CBXA 3EKUA 3FE1A 3A0IX 4BR5A 3O8MA 3QB0A 3SK3A 2E2PA 2F9TA 3VETA 4FWRA 2P9KA 4Z94A 3C0BA 4RWTA 5AQNA 1T44A 2YJFA 4H0PA 3WEEB 2AP1A 3BEXA 2ZGYA 3LDLA 2CGLA 3OHRA 3VGMA 2DPNA 2P9PB 4M7YA 2BTFA 4CI6A 4ISFA 1X3MA 1XC3A 5AQUA 1ATRA 3IMXA 4FOIA 5LJWA 5AQXA 5EXWA 5LY3A 1JCFA 1SAZA 3JS6A 3UKUA 3VF4A 2GELA 2E20A 5AQSA 4JHDB 4MLEA 2GEMA 1GLEG 2P9IA 2QWRA 1K8KB 3CJ7A 3FZKA 3UE5A 3FR0A 1GLFO 5EOYA 3ZX2A 3LL3A 5F0XA 4LC9B 2I7NA 5AQFA 1QQMA 4BGBA 5AQZA 2A3ZA 5EY4A 2FF3B 3HSCA 3MDQA 1BA1A 3A8YA 3R6MA 1QZ5A 3VF6A 4CZFA 3GE1A 3U4LA 2FSKA 5BPNA 3L4IA 4XH4A 2OANA 2HOEA 3BF1A 4K41A 3MMVA 4IZ9A 5AZJA 1HKGA 3O4WA 1NGEA 4M7XA 3GL1A 1NLVA 3MN7A 4FWPA 4JD2A 2E1ZA 5AQHA 5AQLA 4BC3A 5BRDA 4H5TA 3QBXA 4CBUA 4DB3A 3SJHA 4J8FA 2CH5A 1U2VA 1TYQA 5BN9A 1P8ZA 4BQZA 4BC5A 4CZGA 3VEOA 3CJ9A 2V52B 5BPMA 1IG8A 2P9UA 3WXIA 5FPNA 2Q2RA 2P9KB 3ATVA 3EN9A 3CIPA 3J8AA 5AFUH 5AQWA 3A5NC 3VEWA 3O1WA 1NGIA 4CD3A 4PL8A 3WXKA 2GWJA 1NGJA 4IWVA 2D1KA 5AQPA 1YVNA 4H5VA 2PBDA 4BQLA 3LDQA 2FSJA 3SMSA 2YHXA 5F2RA 2E8AA 3SLCA 3O08A 3HBTA 3CERA 2ASPA 3JXUA 3FZLA 3UKUB 2A6AA 3QMLA 3G25A 3A5OC 3EO3A 1G99A 5BRFA 2A40A 3M1FA 4Y0WA 3I8BA 2V7YA 5AQRA 3ZETB 4EIAA 4WQ4A 2GUPA 4B1UB 2CGJA 5AQMA 5KPRA 5ADXA 1SZ2A 5JMVA 5AZIA 4BRKA 3VEZA 1DEJA 3D7EO 4AM7A 3D2FB 3O5BA 3QFUA 4QS7A 3D2EA 2YHYA 4H0VB 1ZBSA 2D4WA 3ATUA 3BF3A 1QHAA 4BVPA 3H3OB 4DQ8A 1OKJA 1ZXOA 4GNIA 3P4IA 1NBWA 2ASOA 2QWMA 1D4XA 2VYPA 5KPTA 1WUAA 3WT0A 3DXKA 1E4FT 3KHYA 5KPZA 4BR2A 3VF2A 1HUXA 3MN5A 4QS9A 4K25A 2P9NA 2Q0UA 2HF3A 4L3QA 5B8HA 2IIRA 3BP8A 2FLOA 1KAXA 5AR0A 3IDHA 1S3XA 1R59O 3MN9A 2Q36A 3IFRA 1BUPA 1J6ZA 3RSEB 2Q31A 1MA9B 4PKHA 2IVOA 2Q1NA 2W41A 3ZX0A 4FPAA 4YDUC 4BR9A 3W3DA 4CZHA 4BC2A 5E26A 5FPEA 2E2OA 4CZLA 4FPBA 4IJNA 2P9SA 1GLDG 3A5LC 1V4TA 1JCEA 4FSVA 4JN4A 5AQOA 3O1BA 4BRGA 5BR9A 1IJJA 3ENHA 3AAPA 1HX1A 3UKRA 4AM6A 1GLCG 2P9LB 1C0FA 1NGBA 4I6MB 4BRAA 5AQGA 4CZEA 5KQDA 4WQ5C 2VCPA 3TPQA 2GTDA 3DXMB 2IVPA 3CQXA 2E1YA 1C0GA 4NB4A 4CZMA 4B1ZA 2E2NA 4IO8A 4JAXA 5AQYA 3CJ1A 4EHTA 1QQNA 3CJBA 3GG4A 5BREA 4XEIA 1Z6RA 1HLUA 3ZX3A 1YUWA 3B8AX 3GBTA 3WUHA 5CE3A 2GWKA 3VEVA 5AQVA 4BG9A 1CZAN 3FLCO 5TKYA 3O6WA 1ESVA 4MO4A 3SMPA 3H1VX 3AARA 3HM8A 5EVZA 3ZEUA 5FPDA 1NGGA 2HF4A 3ID8A 3ENOA 3H6EA 4K42A 5FPMA 3VOVA 4C23A 3CETA 4O8KA 3H3NO 3WXLA 2E2QA 1KAZA 2FXUA 4ISGA 1TUYA 4H5WA 4H03B 2I7PA 2NLXA 4O5FA 3R9PA 2NRHA 3HZ6A 3L0QA 3CHWA 2ZWHA 4BROA 4H0TB 3WEEA 3DXKB 4BG8A 5EX5A 3WXJA 3KVGA 3AY9A 1HKBA 1NGAA 3VGLA 4H0OA 4CD1A 3CQYA 5ADXH 3VERA 2P9PA 1QQOA 2W40A 1WOQA 4IJAA 4CBWA 4BC4A 3IUCA 3QICA 2ITMA 3LM2A 1V4SA 3WQTA 4B9QA 1HKCA 4JHDA 1Z05A 4XH5A 4IXCA 1K8KA 2H3GX 2HMPA 2P9IB 4BRMA 4PKIA 5ELZA 4YDUA 4DHYA 2QXLA 3DWLA 3BUZB 4MO5A 5AQJA 4BR0A 4M63C 4FWNA 1YAGA 3KZBA 2BUPA 1RGIA 1LCUA 4BR4A 1RDWX 3EZWA 3EKSA 4EHUA 3VEYA 4FO0A 4BRHA 1QZ6A
chains in the Genus database with same CATH superfamily
4O8UA 1BI4B 1RFQA 2CH6A 3H1QA 1M1KO 4FW1A 1S22A 1J53A 1NOZA 3OYMA 1IBLK 1OH5A 3UB5A 3DLBA 3G4SN 1NJZA 3L8BA 1YF5L 1NGFA 3FGUA 4DQSA 1WNSA 1U2VB 4OGCA 2IVNA 5C12A 1HNXK 4B8CA 1KQSM 3DJCA 4HWIA 3OYDA 4FVMA 3MK6A 3CI5A 3K58A 4RW9A 3H46O 4K8ZA 2Q0RA 5HRRA 3HOTA 4BVOA 3AGKA 1TK8A 3EE9A 4NO7A 4B08A 1U6ZA 4F2SA 2YKMA 1KAYA 4N5SA 3KJVA 1EO1A 5KQ8A 4DR7K 2B5JA 3NH2A 3GDQA 3HJFA 4CF1A 1NKCA 3TTDA 3MEGA 1FW6A 4JKGB 4MFBA 4AHUA 4FCYA 5HOOA 3L2QA 1GLLO 1W9HA 2YHAA 5AZIB 4Y1CA 3V1RA 2O8BB 3LDNA 4IOAL 1LOTB 3D2EB 2HMIA 1HJRA 1VQ5N 4GV3A 1TV6A 4CHZA 5EU7A 2Y1IA 3CFOA 4YHHK 2AJQA 5IWAK 1I3AA 4M3TA 4B1XB 4CGHA 1EXQA 3FZHA 2NZTA 5AQTA 1JKHA 4BWJA 4DTRA 4CESA 1VQ6N 5I42A 2D5RA 1B92A 4EFHA 2P9NB 4N56A 3EL2A 4CK2A 4BE7B 1U47A 1WN7A 3O9QA 4LY7A 4DR3K 4IO9L 3FZFA 1ILYA 3A2FA 4GVEA 2KZMA 2QWQA 4CGGA 1P90A 4U7BA 2P9SB 3SYZA 4DLGA 4DTXA 3ZSQA 3BDPA 1OH8A 3CQ8A 4M42A 4BRLA 2D0AA 2ZGZA 1O13A 4CJ7A 4CGDA 3LDOA 2FBTA 4CJSA 1WB9A 3LDPA 4PKGA 1Y97A 3QNNA 4KHNA 3PSFA 3C94A 1BDGA 2VG6A 3QINA 5C24A 4BRFA 1TUUA 1BGXT 4B9NA 4MLHA 4RW4A 1NGCA 4CHPA 4GKJK 3J7AP 4DV6K 2HHTA 3IAYA 1NGHA 3OY9A 3K5LA 1XUPO 1DGKN 2WTUA 4O5BA 4JKFA 3ZSVA 4DU4A 4BGAA 3LP0A 2KQ2A 2RE2A 4JKBA 1OVYA 1HRHA 3O8MA 1NJIO 1CZ9A 5J2MA 1HPZA 3V81A 3V9SA 4E7LA 2P5GA 1TKTA 4Z94A 3C0BA 1TKDA 1DT9A 1RBRA 4RWTA 1T44A 3U3YA 3KK7A 4J2EA 3OTOK 3PX6A 4OVLA 2HHWA 2FBYA 4Q5VA 4M7YA 4FLWA 4JKHA 1IG9A 5AQUA 2OPRA 2HHUA 2WOMA 1RBUA 5LY3A 5M1PA 1SAZA 4DSKA 3JS6A 2G8FA 1LV5A 4HUGA 3ISNC 3N4QA 3AVLA 4MLEA 2GEMA 1GLEG 1K8KB 3CJ7A 4JKAA 5EOYA 4ILGB 5F0XA 4ID5A 1JLGA 2I7NA 5AQFA 3HVTA 3OYKA 3LWLA 1BISA 3KLHA 5AQZA 2A3ZA 4LH4A 3V1QA 4JI8K 3R6MA 1K73O 3VF6A 3G10A 3U4LA 1WSGA 5C2FA 4EP5A 1BI4A 3AVMA 2W00A 4OX9K 3ZSRA 1J5OA 4Z4FA 1O1WA 2IDOA 3RMAA 3ULDA 4B9TA 4DR5K 2Z1IA 2D0CA 3SBGA 2Z1GA 4X64K 3K2PA 4CBUA 4DB3A 3P5JA 3SJHA 1U2VA 4O0IA 3AGRA 5BN9A 1P8ZA 4CZGA 3CJ9A 5BPMA 3WXIA 1X9WA 2Q2RA 3ATVA 2O8FB 2HW3A 5AFUH 1S1XA 1HNVA 5AQWA 4DUYK 3VEWA 1NK4A 4JI7K 4NCAA 4I9QA 4CJVA 2OYQA 1DTTA 5M1FA 4FK2A 4AHVA 2VG7A 3LALA 1LWCA 5KI6A 4KH5A 2PBDA 4BQLA 3SAFA 2FSJA 1HR0K 4HCCA 1HNWK 3MECA 3HBTA 3CERA 3JXUA 3PY8A 3AA4A 1NNEA 4CCHA 4PQUA 3EO3A 3M1FA 2RHKA 4JK8A 3WNGA 4EIAA 4WQ4A 4J2BA 1UWBA 4JKGA 3JSMA 2CGJA 5AQMA 5KPRA 4FLUA 4V19S 5AZIA 4DTMA 2O8BA 4LSNA 3D2FB 3D2EA 1YT3A 1NK8A 1ZBSA 2D4WA 1QHAA 4BVPA 3H3OB 4B3SK 3Q7CA 1OKJA 1IKXA 4YORA 4GNIA 2XY5A 2ASOA 3F2KA 4NYFA 2VYPA 1HYVA 4CJUA 4C1NK 3KHYA 5C25A 1L3TA 1UOCA 1QSLA 1C6VA 3VF2A 3F9KA 4CVNE 1NG9A 4QS9A 2P9NA 1R0AA 4LFBK 5B8HA 4UQGA 1KAXA 4RW8A 1SKWA 3V9UA 5CZ1A 3RSEB 4KKOA 4PKHA 4BR9A 1U45A 4Z4IA 3W3DA 4CZHA 3RR8A 5E26A 5FPEA 1BIZA 4CZLA 4IJNA 3O3FA 2P9SA 4ILJA 4Z4HA 3TARA 2UUCK 1IO2A 4E7IA 4IEIA 5BR9A 3ENHA 4AM6A 1GLCG 1S9GA 2IAJA 1RDBA 1RILA 1WBBA 5AQGA 4CZEA 2VCPA 5K14A 3DXMB 4KHUA 3NF9A 4CZMA 4W5QA 4CFDA 3SQ2A 1VAZA 1VRUA 3GG4A 1Z6RA 4CEAA 1HLUA 4W5NA 4JKCA 3WUHA 2OPSA 5CE3A 4AHRA 1REVA 2GWKA 3DM2A 3VEVA 5AQVA 4NYNA 5TKYA 4N47A 2QKKA 4FJLA 3H1VX 4CGFA 4JI6K 3OVNA 1XC9A 2KTQA 2HHQA 1NGGA 3ID8A 2QA4N 2OPPA 3KLGA 1L5UA 3ZSZA 2ZQBA 3TAGA 2NRTA 3VOVA 4C23A 1G15A 3CETA 2FXUA 3SUNA 2O4IA 1NK6A 1LW2A 1WBDA 5GADP 3TWHA 3R9PA 2YV0X 1JJ2M 1J5EK 4FJ8A 2RN2A 1Q86O 5ADXH 5LL6Z 3VERA 3SAHA 1I39A 3U6FA 1GOAA 1QQOA 4CBWA 3IUCA 5FRMA 1W7AA 1VQNN 3O9RA 4IOXA 4C8KA 1T03A 4PY5A 1HKCA 2D0BA 1N33K 4CEEA 1FXXA 4CFBA 3MXMA 2HHXA 1K8KA 1VSFA 2P9IB 4M3WA 3DOKA 1JLFA 4PKIA 3SJJA 3SBTA 4DHYA 4BE1A 4FWNA 1YAGA 4AHCA 3MWTA 2NUBA 5KGWA 4CGIA 3E1YA 3VEYA 4KAZA 3BGRA 4CF8A 4CHOA 3VA3A 2HBJA 1S5JA 4B9MA 2E88A 4E1JA 5KGXA 4BRCA 3ULEA 4QS8A 4JNEA 1HJOA 4DFKA 5JENA 4FWQA 2X6NA 3K5MA 4EAHD 4OKKA 1QTMA 3MN6A 1T05A 4A61A 3NHGA 2O8FA 5BN8A 2WFBA 2AA4A 1VSDA 3H08A 3THYB 1KD1O 4H4OA 2VG5A 2Z1JA 1BO5O 3DMJA 3HYFA 4PHTX 1BQMA 3TAFA 1D5AA 4DV1K 4HUEA 4X66K 1NM1A 4L8RB 1X9MA 4O0JA 1ZBIA 2F8TA 3NDKA 2ASMA 1RTIA 4ICLA 3AA2A 5DK5A 1VQ9N 4FJHA 4WQ4C 3ZT0A 1UA1A 1HQUA 4Z4CA 2QM1A 3KK1A 3I33A 4NXNK 4C8OA 1GLAG 3P38A 2YJEA 2V51B 3WNEA 4IFYA 1XMQK 2HVHA 3LANA 3QBWA 3R8EA 4KBOA 4A2BA 4CGJA 4ID1A 4H5RA 3D2FA 4JEPA 3M6GA 4CEQA 3OYHA 1Q82O 5J2QA 3MCAB 1RT5A 3NF8A 4ELUA 4MQ3A 4FOEA 1NMDA 3HT3A 1YTAA 4KI4A 1QHTA 1VSLA 2D0PA 4BRDA 1NKEA 2HHIA 3FZMA 1VRTA 5M1QA 3H45C 3QDKA 5AQKA 5HL7L 5M1NA 4CIGA 3QFPA 1X9JA 3RSEA 3OYNA 3HI0A 2A41A 2HHVA 2FF6A 1H1VA 4YNQA 5F1XA 3KD5E 4I2QA 4BDZA 3LDSA 1EQYA 4FL9A 4ZTJA 1KVAA 2QWPA 1J54A 3AO2A 2P1JA 2QKBA 4CJRA 1VSMA 3OBYA 4FWLA 3WNFA 3DXMA 3NBPA 4WF9L 1ATNA 1QE1A 3C7NB 1GLJO 2PAVA 4KV8A 4WFAL 1T6DA 4A59A 4PUOA 3OW2M 4BRPA 1TL1A 3U9ZA 3DLLL 2YHWA 5I9EB 2FBVA 2KFNA 1N32K 4A2AA 2EWSA 3TABA 3NAEA 4M3UA 1T6CA 3I55N 4K43A 4FYDA 1L3SA 3EKUA 5GINA 3FE1A 3NH1A 4FJ7A 2RF2A 1XHZA 4DS4A 3QEXA 2F9TA 4CHYA 1K9MO 4M3ZA 4FWRA 2GUIA 2E6MA 1BHLA 4KH4A 3OYJA 4FM0A 4O4GA 3P1GA 4E7KA 2YJFA 5CZ2A 3V9ZA 4CK3A 1W0HA 2RPIA 3VQPA 2B6AA 2HHHK 4ILHA 1S1TA 3I0SA 3HM9A 4E3SA 4FOIA 2BANA 1JCFA 3SV3A 4JI2K 2VGMA 3UKUA 3VF4A 2GELA 2YNFA 1RT3A 1XWLA 5AQSA 4JHDB 5HBMA 2P9IA 4EP4A 1KVCA 3ZT1A 4DSJA 2QWRA 4GVMA 2OA8A 4JK7A 3UE5A 3SQ1A 5GIPA 1YHQN 4E7JA 1VQKN 1Q81O 3L2UA 1CXUA 3RMDA 1QQMA 4BECA 3QEPA 3VQ4A 5A2QO 3ZT2A 3HSCA 5LMUK 3LP3A 3MDQA 1BA1A 3CG7A 4DV5K 4CZFA 5HLFA 2FSKA 1JLCA 4BEBA 2OANA 3KKRA 4K41A 4DS5A 3MMVA 4IZ9A 3WNHA 3J80O 4OPHA 4LFAK 4KB1A 4W5TA 3K0SA 1XI1A 3ZSOA 4KFBA 4FLVA 2O8EA 3NFAA 3J81O 2E1ZA 1NJYA 5BRDA 4H5TA 3TAEA 2O8CB 2JWKA 5J1EA 3B6OA 4J8FA 1XNRK 1VSEA 3THYA 2P9KB 4Y1DA 4O55A 3O1WA 4CJ3A 2BDPA 3OS1A 4CJKA 3WXKA 2Y1JA 4IWVA 2G8IA 3OYGA 1BL3A 3QIPA 4IDKA 4CHNA 2HNZA 1EWRA 1LAWA 3G71N 1YVNA 4H5VA 3SZ2A 4HCBA 1SL0A 1KFDA 3K5OA 4K8XA 3LDQA 4BWMA 3SMSA 2YHXA 5F2RA 1XMOK 3O08A 3LPUA 2PFUA 4BY9C 1HQEA 1WSJA 4CECA 2A6AA 4M45A 3QMLA 3G25A 1G99A 5BRFA 2A40A 2WBNA 4FXDA 4Y0WA 1Z25A 4X65K 3SCXA 3OBWA 4AQYK 3VQBA 2OTJN 5JMVA 4AM7A 3KWGA 3QFUA 4N41A 1RT7A 4DQRA 1IBKK 1S6QA 1ZXOA 4CEFA 1D4XA 2IGIA 5KPTA 3CYMA 3WT0A 1S1VA 3MEEA 1E4FT 3TAMA 5KPZA 2BE2A 1KRPA 2DFFA 3S3MA 5FRNA 3SUQA 1HUXA 2Q0UA 4L3QA 5AR0A 3RMBA 1EP4A 1BUPA 2ZJQL 4A57A 2Q31A 3CM6A 4NCBA 1EKEA 2IVOA 4DKWA 2W41A 3ZX0A 4DSIA 4YDUC 4CJWA 2E4LA 4FPBA 2C1IA 4WFBL 1RDCA 3O1BA 4BRGA 3AAPA 1HX1A 2DFEA 2P9LB 1ASWA 3AVFA 4I6MB 1JLQA 3PX4A 5KQDA 2PYJA 4KHYA 4B9LA 2A1RA 3TPQA 4OPAA 3CQXA 2XO7A 2E2NA 4HUFA 3L4QA 2HNYA 4OGEA 1S72N 3ZX3A 3GBTA 3M8QA 5M1KA 1WSIA 3LAMA 2NRWA 2BH1A 3SPZA 1ESVA 3QEVA 1VSHA 3AARA 4LF4K 4FLZA 4JI1K 3HP9A 4CERA 4Q0BA 3ENOA 1BCOA 1C1CA 3O9SA 5C42A 3S5TA 4O8KA 3H3NO 3WXLA 4IDHA 1KAZA 3D45A 4ISGA 3PSIA 3ZSYA 3TSUA 4A5BA 3HK2A 5FDLA 1WSEA 4CW7B 2ZWHA 4BROA 5GAHP 3DXKB 4BG8A 4I9LA 2UUAK 3AY9A 1HKBA 1KTQA 3KTQA 3T7ZA 1EETA 3CQYA 1EX4A 4DV4K 1DLOA 1IBMK 4IJAA 3AA5X 2PZSA 3QICA 4KRFA 3N4PA 1TAUA 4B9QA 4DF4A 4JHDA 1Z05A 1UAXA 4XH5A 4YOVA 3J7YP 3HOSA 5JVGL 1WAFA 2H3GX 2NRZA 4BRMA 3CCRN 1RTDA 2JLEA 1IH7A 1BQNA 4RW6A 3CPEA 1HNZK 1FKPA 4DTUA 1HMVA 3LP1A 1BIUA 3MX5A 5C2DA 4LF5K 4M63C 1E3MA 2BUPA 1LCUA 4BR4A 4FJXA 3EZWA 4NLCA 4YOYA 3LP2A 3EKSA 3F73A 4FO0A 2XY8A 3RWUA 4LFCK 3G6EN 2HB5A 3CF5L 3KK3A 5AZJB 1XHXA 5C15A 4KHPK 1JXEA 1RDAA 3E66A 1NJXA 1L3UA 3SUPA 3L2RA 4JD2B 4BRIA 2O8CA 4DQQA 2Z1HA 3O80A 1ZBLA 1EWQA 4CJQA 3CPWM 4DU1A 2UYTA 3VTIA 3OYCA 1E4GT 3HTVA 4DUZK 2P9UB 3F9MA 3JYTA 4FWMA 4FJ9A 2UUBK 2VWBA 3MCPA 2G8UA 2Q3SA 3OYBA 3LZJA 2Q97A 5C0YA 3M3ZA 3THXB 5BPLA 4UY8O 1BG3A 4CZIA 1JLAA 2F96A 4BRQA 1JL1A 5CYQA 1KVBA 2C1GA 3VEXA 1NK9A 3V4IA 2HBKA 2J4RA 3AVBA 2IOCA 1ITGA 4H0YB 1ZC6A 3V6DA 1A5XA 3A5MC 4F9OA 4BR7A 3DLHA 4XH1A 5AQIA 1SKRA 2CGKA 4FLTA 2X6SA 3BZCA 2FSNA 4HTLA 3ZT4A 3DRRA 3KIOA 5JLFA 3CJAA 4BDPA 4DSEA 4FZYA 2QW9A 1J9AA 4LF6K 4B3RK 4DFMA 4CIEA 1T7PA 3DLRA 1RTJA 4OO1J 3SNNA 4DFJA 4ISEA 1GOBA 4DV7K 3D6RA 3PV8A 1XQSC 3QNOA 4FJ5A 2KHOA 1YXQA 5GAGP 1WSFA 3HL8A 3KLFA 1SQKA 2HBLA 3HPHA 2KKZA 1YVUA 4RW7A 2FBXA 4B1YB 3HPOA 4H5NA 1C0UA 5E84A 4CJTA 1MDUB 4K0KK 3DAWA 4H0XB 3KKSA 4DCHA 3CCMN 4J2AA 1HYSA 2VWKA 2KW4A 2P9LA 3HP6A 4I6MA 3VESA 3K59A 3OYLA 3VPZA 4H8KA 5DM7L 4QOZB 2F9WA 1U48A 4F4KA 4BRNA 1B9DA 4CF2A 3SI6A 1MWKA 3NE6A 2OZSA 3EEQA 3U8XA 4HTUA 3ASMA 1DKGD 4YOTA 2WUSA 3G0ZA 1TGOA 3D0PA 2I5JA 5BRHA 4OKEA 1L3VA 4CK1A 1BWFO 1CLQA 5AFUA 1BA0A 2QXFA 3ZYYX 4Z4EA 3CMAN 1IKWA 3U9DA 1QQCA 3ZEUB 5LJVA 1YIJN 2YI1A 4CBXA 1SS6A 4BR5A 3CCEN 3MXIA 1VSIA 1RDDA 3QB0A 3SK3A 3OYFA 4LF8K 4KHSA 4C8LA 1CXQA 2QEXN 4GV6A 3QEWA 4JK9A 1RT6A 4CHQA 4JYAK 4BE0A 1WAJA 4ZTFA 4DTNA 4QCLA 3WEEB 3BEXA 2ZGYA 3LDLA 2CGLA 3P39A 1OVQA 3VGMA 1D9DA 2DPNA 3B6PA 2P9PB 4G1QA 3TAPA 2BTFA 4B8AB 1X3MA 3EE8A 2FC0A 5LJWA 5AQXA 4JS4A 2DY4A 4E19A 4GW6A 1NMNA 5SWMA 2KFZA 2E20A 4C1NI 2G8KA 2VWJA 3TSQA 1RTHA 4MDBA 3FR0A 3ZX2A 3LL3A 3E9PA 4LC9B 3C6UA 3K5NA 1RBSA 2XY6A 4FJMA 2QTDA 5EY4A 2FF3B 4M41A 3PO4A 4DQPA 4CIFA 5HRNA 3KLIA 4LF7K 3LZIA 1QZ5A 3DRSA 2X78A 5BPNA 4XH4A 3L2VA 2HOEA 4XIUA 3O3HA 4HHTA 3HRGA 5AZJA 2G8VA 4FM2A 1FKOA 3I56N 1KSPA 1NGEA 3ZCMA 3NMUA 4M7XA 3GL1A 3ALYA 3MN7A 4JD2A 4BC3A 4Z4GA 1SL1A 4FK4A 1YJ9N 3FFIA 3QBXA 4DG1A 5JS2A 4KTZA 1VSKA 2CH5A 1JLEA 1RT1A 3VEOA 3ZSWA 2P9UA 2OZMA 5FPNA 3EN9A 5FLXO 3OJUA 4YFUA 4CD3A 4DTSA 5TKWA 3DLEA 3O4QA 1RBTA 3VQAA 3MXJA 4C8NA 3THXA 4FJJA 4R79A 1TKZA 2D1KA 4B3TK 3BZKA 1C1AA 3AVNA 1KCFA 5JVHL 1W97L 4RG8A 1OH6A 4KI6A 1VSJA 4KB0A 4CEZA 2E8AA 5DM6L 1QSYA 4YOWA 3FZLA 3VQDA 2NNWA 3RMCA 5CYMA 4GKKK 3A5OC 2YNGA 1RDUA 5AJ3K 4FJIA 2V7YA 5AQRA 3ZETB 3RR7A 4DF8A 4DU3A 2GUPA 1IKYA 4B1UB 2BGGA 5ADXA 1ZBHA 4BRKA 3T3FA 1DEJA 3D7EO 1QS4A 3M8RA 4IKFA 4QS7A 4OLAA 4DQ8A 1D8YA 1RT2A 2XHBA 3SQ0A 3CCUN 4W5OA 3RRGA 3P4IA 1X9SA 1KFSA 1WUAA 2VQEK 3C6TA 5KTQA 4JI4K 5IT9O 1QVGM 1VQMN 4BR2A 3DLGA 3MN5A 1M90O 3T1AA 2HF3A 2FLOA 3MAQA 4OLBA 1S3XA 3IFRA 3THWB 2Q1NA 1T3VA 3C95A 4CJ5A 4H4MA 3L2WA 1GLDG 3A5LC 1V4TA 4FSVA 1VHXA 2VQFK 5AQOA 1NK5A 3AVAA 4DQIA 3CFPA 3CMEN 5CY4A 5HP1A 4ZHRA 4EZ9A 2GTDA 2IVPA 3OYEA 4B1ZA 1QSSA 4F2RA 3TANA 5MLCQ 1Q8IA 3IG1A 3CC4N 1RNHA 3CJ1A 4EHTA 2QK9A 3CJBA 1TK0A 1TAQA 4XEIA 4GMJB 1YUWA 3B8AX 5KRSA 1VQ8N 3ITHA 1W2BM 4BG9A 3FLCO 1ZBUA 2UXBK 4MO4A 3AV9A 4DMNA 3SMPA 4LH5A 3ZEUA 1TL3A 2VGNA 2WONA 5FPDA 4JRPA 1QVFM 3H6EA 4K42A 4TSXA 3AVGA 3RRHA 1S6PA 2HSTA 4OKJA 4WFNL 2E2QA 3AA3A 4KTQA 3EY1A 3TSPA 1TUYA 4FZXC 4FW2A 1RBVA 4NXMK 2ITGA 4DV0K 4JKEA 1VQON 2I7PA 2NLXA 2UU9K 3HZ6A 5D3GA 3HPGA 3L0QA 3PIOL 3C6AA 4H0TB 3WEEA 4KTWA 1WLJA 5EX5A 3WXJA 4AHSA 1N34K 1NGAA 1MU2A 1S9EA 4CD1A 2OPQA 3CD6N 2P9PA 4U67L 3T1HK 3C6HA 2W40A 4BC4A 3V9WA 4DSFA 3LAKA 2ITMA 3LM2A 3AVKA 2EHGA 3T1YK 1NJWA 4B3MK 3P31A 3R1XA 2PYLA 2HMPA 3DLKA 1NOYA 2YKNA 5ELZA 2KZZA 3ID6A 2O8DB 1S1UA 3KWIA 3TAQA 3DWLA 3BUZB 2YX6A 4BR0A 3KZBA 1RGIA 5E41A 2DTUA 2HVIA 4KHQA 4EHUA 2RKIA 3OYAA 2IS3A 1SUQA 4N76A 4BRHA 1QZ6A 3WXMB 2GV9A 2LSNA 1LAVA 3IKMA 3VQ8A 2V7ZA 3CC2N 3GOIA 5J2NA 4GV9A 5H1SQ 5M1OA 2YNIA 4O44A 4J2DA 3F5TA 1K6YA 4FJNA 4KHWA 5T7BA 1NKBA 3QEIA 3J7ZO 4JI3K 2IC3A 1BU6O 1I94K 3CJCA 4PA1A 4KO0A 3HXMA 1TYQB 5HROA 1KXPA 4B9SA 1JCGA 3NGZA 3L6QA 4JS5A 2W6KA 2X74A 1NGDA 3CCQN 4RTFD 4DV3K 4FLYA 3VQEA 3VTHA 3PLAA 4BACA 2A5XA 4RCHA 3VENA 3C7NA 3CYGA 4E89A 1VK0A 4OJRA 3AO5A 4OPKA 3AVIA 3AVHA 4PL7A 3CFRA 3VQ7A 1TVRA 3AO4A 5JICA 3LM9A 3AAQA 1KLNA 4I2PA 4YOXA 3WQUA 3CCSN 4B1WB 1VQ7N 3ZETA 4LF9K 1MWMA 4CJ4A 1SKSA 3OJSA 4ELVA 4FWKA 2HHSA 4YOUA 3OS2A 1BOTO 1S1WA 2NRXA 1Q9YA 1ATSA 1JL2A 4BREA 4FWSA 4GY2B 1CZBA 4IG3A 4A62A 4FK0A 4AILC 2QWLA 3KD1E 1HPMA 1SL2A 1YITN 3O9UA 4B3OA 1ASUA 3M8SA 4CF0A 3FFKB 3V9XA 3HO1A 3ULEB 2ZJRL 4E1MA 4NCGA 1A5VA 3AO3A 1GLBG 4KPYA 2QWOA 3SUOA 3AVCA 4I7FA 3AVJA 2ETJA 3THWA 1IKVA 1Y64A 3S41A 2A42A 2YCHA 4B1VA 3THVA 2D0OA 5FROA 1KC8O 5JLHA 3MWPA 2E6LA 5AQQA 3M8PA 2QWNA 5CHIA 4FWOA 4YY3K 4ELTA 3VMFB 4CE9A 4PWDA 1LWEA 1SV5A 2ZF5O 3UKRB 4CZKA 3VQ9A 3HVRA 3W0LA 3PUFA 4E7HA 4DR1K 1NWKA 4MDAA 3ZT3A 3TU5A 1JXBA 3HSTB 1YJWN 3VGKA 3CXCM 2P5OA 5GAEP 1VQLN 4WQ5A 4DLEA 1N5YA 1K8AO 1C0TA 2F4VK 5CR4A 4WYBA 3I0RA 2G8HA 4B9VA 4G9ZA 1Q18A 1LW0A 1X3NA 2ZD1A 3LPTA 1TK5A 2B4JA 5HRSA 3MEDA 4CZJA 4EZ6A 4M3RA 2YHBA 3A0IX 4QAGA 4FZZA 3O4NA 3NGIA 2E2PA 3VETA 5GIOA 3CM5A 3SAGA 4DSLA 2P9KA 1DTQA 3NGYA 4KREA 5AQNA 4LSLA 4CEDA 4IFEA 4H0PA 5SZTA 3S3NA 2AP1A 3SV4A 3OHRA 4CJPA 1IV0A 1ZYQA 4CI6A 4ISFA 3P83D 1XC3A 1TKXA 3VQ6A 1ATRA 3IMXA 5EXWA 3EZ5A 4DTPA 1N8RO 1RT4A 2F7TA 3DI6A 3QETA 1U49A 4OPJA 3FZKA 5J2PA 1GLFO 2GBZA 2O8DA 1C0MA 3TI0A 4BGBA 2YNHA 4BE2A 2O4GA 3R3LA 3TTCA 3A8YA 3PO5A 5KRTA 4IG0A 3ZLJA 1FJGK 3E9LA 3GE1A 4E0DA 2XY7A 3L4IA 4CJFA 3BF1A 1N6QA 4DWIA 4CEOA 1HKGA 3O4WA 1NLVA 4FWPA 4XJXA 5AQHA 5AQLA 1HNIA 4F3OA 5I3UA 1BCMA 3O9TA 3L3VA 1TYQA 2G8WA 4BQZA 4BC5A 3S9HA 2V52B 2KLAA 1IG8A 4DTJA 3M5RA 2OCEA 3CIPA 3J8AA 4WE1A 3QLHA 1NK0A 3A5NC 1NGIA 4PL8A 4HVJA 4AHTA 4AF1A 4FJGA 4R5PA 4B9UA 2GWJA 1NGJA 3RVCA 3VN5A 1NU0A 3TTFA 5AQPA 5C10A 1YTUA 2JGUA 3QESA 2OTLN 3SLCA 2ASPA 3SPYA 3UKUB 4F3TA 1F21A 4NLBA 4IEEA 2F8SA 3E01A 1ASVA 3BY5A 3TR8A 5DMRA 1WSHA 3I8BA 2R7YA 1JLBA 1SZ2A 3DOLA 3K9JA 1NK7A 3VEZA 3CCVN 3UIQA 3O5BA 4LD0A 4FM1A 3PIPL 2YHYA 4H0VB 3BF3A 3ATUA 1N36K 3KLEA 3VQCA 3VA0A 4CFAA 3ENBA 4JI5K 2HBMA 2PY5A 3VQ5A 1NBWA 3LWMA 3EYZA 4CEBA 4CJEA 2QWMA 2DFHA 3I8DA 2NRRA 1U04A 3V1OA 3CCJN 2ATQA 3DXKA 2EX3A 2P51A 2UXDK 2W42A 3S3OA 2O8EB 1Q7YO 3T19A 3NVKA 4K25A 2ZE2A 2IIRA 3BP8A 3OA9A 3IDHA 2ZJPL 4JKDA 1R59O 2QI2A 3L3UA 3MN9A 4IBNA 2Q36A 3K57A 4IFVA 1RCHA 1J6ZA 1MA9B 4E1NA 4DR6K 3NVMA 4FPAA 4FJKA 1A5WA 3O3GA 4BC2A 2E2OA 3E9OA 4JI0K 2XRIA 1JCEA 2WC9A 4JLHA 4JN4A 3MX2A 4CJLA 1VQPN 1IJJA 3QO9A 3UKRA 1C0FA 1NGBA 4BRAA 4DV2K 4WQ5C 3K9KA 2E1YA 1C0GA 4NB4A 3KK2A 4IO8A 4JAXA 3DYAA 5AQYA 3NCIA 2W6LA 1KLMA 4JV5K 4M3YA 4Z0UA 4M3XA 1QQNA 4BDYA 5LMNK 5BREA 5JS1A 1U4BA 1C1BA 1YI2N 1CZAN 3U3GA 3O6WA 3NH0A 3HM8A 5EVZA 3Q7BA 1FK9A 1X1PA 3NF7A 2HF4A 4DR2K 5FPMA 1YJNN 3IS9A 3QIOA 1HYZA 4DTOA 4CFCA 3OS0A 1LWFA 2UXCK 1OH7A 2HNDA 2A1SA 4H5WA 4DFPA 4H03B 4O5FA 2NRHA 3CHWA 4JRQA 3RTVA 3KVGA 3ZSXA 3SQ4A 4F8RA 1ZBFA 3VGLA 4WCEL 1T8EA 4H0OA 3JAMO 2GX9A 4C8MA 4DR4K 2ZM6K 3DRPA 2JWLA 4CF9A 5BR8K 1WOQA 4AH9A 1XNQK 1UA0A 3CCLN 1V4SA 3WQTA 1GOCA 4X62K 3C65A 3QERA 4E72A 4IXCA 2E5LK 3AO1A 4W5RA 4FVUA 3CC7N 2NRVA 3VQQA 1Q9XA 4YDUA 4A5AA 4KH6A 3OYIA 3IRXA 1D9FA 1Z26A 3T69A 2QXLA 1VQ4N 4MO5A 5AQJA 4FLXA 1RDWX 1B9FA 4IOCL 5HRPA 3NF6A 3PX0A
chains in the Genus database with same CATH topology
3G6EN 3IKMA 4O8UA 1RFQA 2V7ZA 3GOIA 3CF5L 3CC2N 4GV9A 2CH6A 2E88A 3H1QA 1M1KO 4E1JA 5AZJB 5C15A 5H1SQ 5M1OA 1S22A 3ULEA 4BRCA 4QS8A 3E66A 3F5TA 4JNEA 4JD2B 4BRIA 1HJOA 3J7ZO 1BU6O 3UB5A 3O80A 4FWQA 3G4SN 3CJCA 4EAHD 1YF5L 1NGFA 3FGUA 3MN6A 1U2VB 2IVNA 1TYQB 4A61A 5C12A 3CPWM 2UYTA 3VTIA 5BN8A 2WFBA 2AA4A 1E4GT 3HTVA 2P9UB 1KXPA 3F9MA 1KQSM 1KD1O 1JCGA 3DJCA 3L6QA 4FWMA 4HWIA 1BO5O 2VWBA 1NGDA 3CCQN 4PHTX 4RTFD 3MCPA 5C0YA 2Q97A 3M3ZA 3VTHA 1NM1A 3MK6A 5BPLA 4UY8O 3PLAA 3CI5A 1BG3A 2A5XA 4CZIA 4RCHA 3VENA 3H46O 2ASMA 3C7NA 4BRQA 2Q0RA 1VQ9N 3HOTA 4WQ4C 4BVOA 3AGKA 2C1GA 3EE9A 3VEXA 4NO7A 2QM1A 4PL7A 3I33A 5JICA 3LM9A 1GLAG 1U6ZA 2HBKA 3AAQA 2J4RA 3P38A 2YJEA 1KAYA 4YOXA 2V51B 4H0YB 1EO1A 1ZC6A 3WQUA 5KQ8A 3CCSN 3GDQA 4B1WB 1VQ7N 3R8EA 3QBWA 3ZETA 1MWMA 4KBOA 3A5MC 3TTDA 4A2BA 4F9OA 4BR7A 4XH1A 4JKGB 5AQIA 4H5RA 2CGKA 5HOOA 1GLLO 3D2FA 4FWKA 2FSNA 4HTLA 5AZIB 4YOUA 1BOTO 2NRXA 3M6GA 4JEPA 1ATSA 3LDNA 1Q82O 4BREA 4IOAL 1LOTB 3D2EB 4FWSA 4GY2B 5JLFA 3CJAA 3MCAB 1VQ5N 4GV3A 4A62A 2QW9A 2QWLA 4FOEA 1HPMA 1NMDA 1YITN 3O9UA 2D0PA 3FFKB 4B1XB 4BRDA 4OO1J 3FZHA 3ULEB 2ZJRL 3FZMA 2NZTA 5AQTA 4ISEA 5M1QA 3H45C 3D6RA 3QDKA 1GLBG 5AQKA 5HL7L 2QWOA 1VQ6N 1XQSC 5M1NA 4EFHA 2KHOA 1YXQA 5GAGP 2P9NB 3QFPA 1X9JA 3S41A 1Y64A 2A42A 3EL2A 3RSEA 2YCHA 3HI0A 1SQKA 2A41A 2HBLA 4B1VA 3O9QA 4BE7B 2FF6A 1H1VA 2D0OA 2KKZA 4IO9L 3FZFA 1KC8O 1ILYA 5JLHA 3MWPA 5F1XA 4GVEA 4B1YB 4H5NA 2QWQA 5AQQA 1P90A 2QWNA 4U7BA 2P9SB 1EQYA 4FL9A 1MDUB 4FWOA 5E84A 5CHIA 3DAWA 4H0XB 3VMFB 2QWPA 4DCHA 3CCMN 2P9LA 4I6MA 3VESA 4BRLA 2ZF5O 3OBYA 3UKRB 3VPZA 4FWLA 5DM7L 2ZGZA 1O13A 2F9WA 4CJ7A 4CZKA 3DXMA 3LDOA 3W0LA 4BRNA 1NWKA 4MDAA 1MWKA 4WF9L 3LDPA 1ATNA 4PKGA 3C7NB 1GLJO 2PAVA 4WFAL 1T6DA 3TU5A 1BDGA 3U8XA 4A59A 1YJWN 4BRFA 1TUUA 3VGKA 3CXCM 1DKGD 4YOTA 2WUSA 4MLHA 3OW2M 1NGCA 4BRPA 5BRHA 1BWFO 3U9ZA 5AFUA 5GAEP 1BA0A 3DLLL 2YHWA 4WQ5A 5I9EB 1K8AO 1VQLN 1NGHA 5CR4A 4WYBA 3ZYYX 1XUPO 1Q18A 4G9ZA 1DGKN 1X3NA 4A2AA 4JKFA 2EWSA 3CMAN 1T6CA 4BGAA 3I55N 4K43A 3U9DA 3ZEUB 5LJVA 2RE2A 4CZJA 1YIJN 2YI1A 4CBXA 3EKUA 4JKBA 1SS6A 3FE1A 3A0IX 5GINA 4BR5A 1OVYA 3CCEN 3O8MA 1NJIO 3QB0A 3SK3A 2E2PA 2F9TA 3VETA 1K9MO 5GIOA 3SAGA 4FWRA 2P9KA 2QEXN 4GV6A 4KH4A 4Z94A 3C0BA 4JK9A 1DT9A 4RWTA 5AQNA 1T44A 4IFEA 3KK7A 2YJFA 4H0PA 3WEEB 2AP1A 3BEXA 2ZGYA 3LDLA 2CGLA 3OHRA 3P39A 3VGMA 2DPNA 4ILHA 2P9PB 4M7YA 2BTFA 4CI6A 4ISFA 1X3MA 1XC3A 3EE8A 4JKHA 5AQUA 1ATRA 3IMXA 4FOIA 5LJWA 5AQXA 5EXWA 5M1PA 1JCFA 1SAZA 3JS6A 2VGMA 3UKUA 3VF4A 5LY3A 1N8RO 2F7TA 2GELA 2E20A 3N4QA 5AQSA 4JHDB 4C1NI 4MLEA 2GEMA 1GLEG 2P9IA 3TSQA 2QWRA 1K8KB 3CJ7A 4JKAA 3FZKA 4JK7A 3UE5A 4MDBA 3FR0A 1GLFO 5EOYA 4ILGB 3LL3A 3ZX2A 3E9PA 5F0XA 4LC9B 5GIPA 1YHQN 1VQKN 2I7NA 1Q81O 5AQFA 1QQMA 4BGBA 4BECA 2QTDA 5AQZA 2A3ZA 5EY4A 2FF3B 3HSCA 3MDQA 3R3LA 3TTCA 1BA1A 3A8YA 3R6MA 1K73O 1QZ5A 3VF6A 4CZFA 3E9LA 3GE1A 3U4LA 2FSKA 5BPNA 3L4IA 4XH4A 2OANA 5C2FA 4BEBA 2HOEA 3BF1A 4K41A 3HRGA 2W00A 3MMVA 4IZ9A 5AZJA 3I56N 4OPHA 1HKGA 3O4WA 1NGEA 3NMUA 4M7XA 3GL1A 1NLVA 3MN7A 4FWPA 4JD2A 4XJXA 2E1ZA 5AQHA 5AQLA 4BC3A 3SBGA 5BRDA 4H5TA 3O9TA 1YJ9N 3QBXA 2JWKA 4CBUA 4DB3A 3SJHA 4J8FA 2CH5A 1U2VA 3AGRA 1TYQA 5BN9A 1P8ZA 4BQZA 4BC5A 4CZGA 3VEOA 3CJ9A 2V52B 2KLAA 5BPMA 1IG8A 2P9UA 3WXIA 5FPNA 2Q2RA 2P9KB 3ATVA 3EN9A 3M5RA 3CIPA 3J8AA 5AFUH 5AQWA 3A5NC 3VEWA 3O1WA 1NGIA 4CD3A 4PL8A 4AF1A 5TKWA 3WXKA 5M1FA 2GWJA 1NGJA 4IWVA 3RVCA 4R79A 2D1KA 3TTFA 5AQPA 5C10A 5JVHL 1W97L 3G71N 1YVNA 4H5VA 4KH5A 2PBDA 4BQLA 3SAFA 3LDQA 2FSJA 2OTLN 3SMSA 2YHXA 5F2RA 2E8AA 3SLCA 3O08A 5DM6L 2PFUA 4BY9C 3HBTA 3CERA 2ASPA 3JXUA 4YOWA 3FZLA 3UKUB 2NNWA 2A6AA 4NLBA 4IEEA 3QMLA 3G25A 3A5OC 3EO3A 1G99A 5BRFA 2A40A 2WBNA 1RDUA 3M1FA 4Y0WA 2RHKA 3I8BA 2V7YA 5AQRA 4JK8A 3ZETB 4EIAA 4WQ4A 3OBWA 2GUPA 4JKGA 4B1UB 2CGJA 5AQMA 5KPRA 5ADXA 1SZ2A 2OTJN 3K9JA 5JMVA 5AZIA 4BRKA 3VEZA 1DEJA 3D7EO 4AM7A 3CCVN 3D2FB 3O5BA 3KWGA 3QFUA 4QS7A 3D2EA 2YHYA 4H0VB 1ZBSA 2D4WA 3ATUA 3BF3A 3PIPL 1QHAA 4BVPA 3H3OB 4DQ8A 3ENBA 3Q7CA 1OKJA 3CCUN 4YORA 2HBMA 1ZXOA 4GNIA 3P4IA 1NBWA 2ASOA 3F2KA 2QWMA 1D4XA 2VYPA 5KPTA 2NRRA 1WUAA 3CCJN 3WT0A 3DXKA 4C1NK 1E4FT 3KHYA 5KPZA 1QVGM 1VQMN 4BR2A 3VF2A 1HUXA 1Q7YO 3MN5A 1M90O 3NVKA 4QS9A 4K25A 2P9NA 2Q0UA 2HF3A 4L3QA 5B8HA 2IIRA 3BP8A 2FLOA 1KAXA 3OA9A 3IDHA 5AR0A 1S3XA 1R59O 4JKDA 2ZJPL 2QI2A 3MN9A 2Q36A 3IFRA 1BUPA 1J6ZA 2ZJQL 3RSEB 2Q31A 1MA9B 4PKHA 2Q1NA 2IVOA 3NVMA 4A57A 1T3VA 2W41A 3ZX0A 4FPAA 4YDUC 4BR9A 4DKWA 3W3DA 4CZHA 4BC2A 5E26A 5FPEA 2E2OA 4CZLA 4FPBA 4IJNA 3E9OA 2P9SA 1GLDG 3A5LC 2C1IA 1V4TA 1JCEA 4ILJA 2WC9A 4FSVA 4WFBL 4JN4A 5AQOA 3MX2A 3O1BA 4IEIA 4BRGA 5BR9A 1VQPN 1IJJA 3ENHA 3AAPA 1HX1A 3UKRA 4AM6A 1GLCG 2P9LB 1C0FA 1NGBA 4I6MB 4BRAA 3CMEN 5AQGA 4CZEA 5KQDA 4WQ5C 2VCPA 3TPQA 2GTDA 3K9KA 3DXMB 2IVPA 4OPAA 3CQXA 2E1YA 1C0GA 4NB4A 4CZMA 4B1ZA 2E2NA 5MLCQ 4IO8A 4JAXA 5AQYA 3CC4N 3CJ1A 1VAZA 3L4QA 4EHTA 1QQNA 3CJBA 3GG4A 5BREA 1S72N 4XEIA 1Z6RA 1HLUA 3ZX3A 4JKCA 1YUWA 3B8AX 3GBTA 3WUHA 5CE3A 2GWKA 3VEVA 1YI2N 5M1KA 1W2BM 5AQVA 4BG9A 1VQ8N 2NRWA 1CZAN 2BH1A 3FLCO 5TKYA 3O6WA 1ESVA 4MO4A 3SMPA 3H1VX 3AARA 3HM8A 5EVZA 3Q7BA 3ZEUA 2VGNA 5FPDA 1QVFM 1NGGA 2HF4A 3ID8A 2QA4N 3ENOA 3H6EA 4K42A 5FPMA 1YJNN 2NRTA 2HSTA 3O9SA 3VOVA 4C23A 4WFNL 3CETA 4O8KA 3H3NO 3WXLA 2E2QA 4IDHA 1KAZA 2FXUA 4ISGA 3TSPA 1TUYA 3TSUA 4A5BA 4H5WA 4JKEA 5GADP 4H03B 1VQON 2I7PA 2NLXA 4O5FA 3R9PA 2NRHA 3HZ6A 3L0QA 3CHWA 2ZWHA 4BROA 3PIOL 3C6AA 4H0TB 5GAHP 3WEEA 1JJ2M 3DXKB 4BG8A 5EX5A 3WXJA 3KVGA 3AY9A 1HKBA 1NGAA 1Q86O 3VGLA 3T7ZA 4WCEL 4H0OA 4CD1A 3CQYA 2GX9A 5ADXH 3CD6N 3VERA 2P9PA 4U67L 3SAHA 2JWLA 1QQOA 2W40A 1WOQA 3C6HA 4IJAA 4BC4A 3IUCA 4CBWA 1VQNN 3O9RA 4IOXA 3QICA 3CCLN 2ITMA 3N4PA 3LM2A 1V4SA 3WQTA 4B9QA 1HKCA 3C65A 4JHDA 1Z05A 4XH5A 4YOVA 4IXCA 3P31A 3R1XA 3HOSA 5JVGL 1K8KA 2H3GX 2HMPA 2NRZA 4FVUA 2P9IB 4BRMA 3CCRN 3CC7N 2NRVA 4PKIA 5ELZA 3ID6A 4YDUA 4A5AA 3CPEA 4KH6A 3KWIA 3SBTA 4DHYA 3T69A 2QXLA 3MX5A 5C2DA 3DWLA 3BUZB 2YX6A 4MO5A 5AQJA 4BR0A 1VQ4N 4M63C 4FWNA 1YAGA 3KZBA 2BUPA 1RGIA 1LCUA 4BR4A 1RDWX 3EZWA 4NLCA 4YOYA 3EKSA 3MWTA 4EHUA 3E1YA 3VEYA 4FO0A 4IOCL 4BRHA 1QZ6A 3WXMB 2HBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RFQ A;  2V7Z A;  3GOI A;  2CH6 A;  2E88 A;  3H1Q A;  4E1J A;  5AZJ B;  4BRC A;  1S22 A;  3ULE A;  4QS8 A;  4JNE A;  4JD2 B;  4BRI A;  1HJO A;  1BU6 O;  3UB5 A;  3O80 A;  4FWQ A;  3CJC A;  4EAH D;  3MN6 A;  1NGF A;  3FGU A;  1U2V B;  2IVN A;  1TYQ B;  4A61 A;  2UYT A;  5BN8 A;  2AA4 A;  1E4G T;  3HTV A;  2P9U B;  1KXP A;  3F9M A;  1JCG A;  3DJC A;  3L6Q A;  4FWM A;  4HWI A;  1BO5 O;  2VWB A;  1NGD A;  4RTF D;  3MCP A;  2Q97 A;  3M3Z A;  1NM1 A;  3MK6 A;  5BPL A;  3CI5 A;  1BG3 A;  2A5X A;  4CZI A;  4RCH A;  3VEN A;  3H46 O;  2ASM A;  3C7N A;  4BRQ A;  2Q0R A;  4WQ4 C;  4BVO A;  3VEX A;  4NO7 A;  2QM1 A;  4PL7 A;  3I33 A;  5JIC A;  3LM9 A;  1GLA G;  1U6Z A;  3AAQ A;  2J4R A;  2YJE A;  1KAY A;  2V51 B;  4H0Y B;  1ZC6 A;  3WQU A;  5KQ8 A;  3GDQ A;  4B1W B;  3R8E A;  3QBW A;  3ZET A;  1MWM A;  4KBO A;  3A5M C;  4A2B A;  4F9O A;  4BR7 A;  4XH1 A;  5AQI A;  4H5R A;  2CGK A;  1GLL O;  3D2F A;  4FWK A;  2FSN A;  4HTL A;  5AZI B;  1BOT O;  3M6G A;  1ATS A;  3LDN A;  4BRE A;  1LOT B;  3D2E B;  4FWS A;  4GY2 B;  5JLF A;  3CJA A;  4A62 A;  2QW9 A;  2QWL A;  4FOE A;  1HPM A;  1NMD A;  2D0P A;  3FFK B;  4B1X B;  4BRD A;  3FZH A;  3ULE B;  3FZM A;  2NZT A;  5AQT A;  4ISE A;  3H45 C;  3QDK A;  1GLB G;  5AQK A;  2QWO A;  1XQS C;  4EFH A;  2KHO A;  1YXQ A;  2P9N B;  3QFP A;  1X9J A;  3S41 A;  1Y64 A;  2A42 A;  3EL2 A;  3RSE A;  2YCH A;  3HI0 A;  1SQK A;  2A41 A;  4B1V A;  2FF6 A;  1H1V A;  2D0O A;  3FZF A;  5JLH A;  5F1X A;  4B1Y B;  4H5N A;  2QWQ A;  5AQQ A;  2QWN A;  2P9S B;  1EQY A;  4FL9 A;  1MDU B;  4FWO A;  5E84 A;  3DAW A;  4H0X B;  2QWP A;  4DCH A;  2P9L A;  4I6M A;  3VES A;  4BRL A;  2ZF5 O;  3UKR B;  3VPZ A;  4FWL A;  2ZGZ A;  2F9W A;  4CJ7 A;  4CZK A;  3DXM A;  3LDO A;  3W0L A;  4BRN A;  1NWK A;  1MWK A;  3LDP A;  1ATN A;  4PKG A;  3C7N B;  1GLJ O;  2PAV A;  1T6D A;  3TU5 A;  1BDG A;  3U8X A;  4BRF A;  1TUU A;  3VGK A;  1DKG D;  2WUS A;  4MLH A;  1NGC A;  4BRP A;  5BRH A;  1BWF O;  3U9Z A;  5AFU A;  1BA0 A;  2YHW A;  4WQ5 A;  5I9E B;  1NGH A;  4WYB A;  1XUP O;  1Q18 A;  1DGK N;  1X3N A;  4A2A A;  2EWS A;  1T6C A;  4BGA A;  4K43 A;  3U9D A;  3ZEU B;  5LJV A;  4CZJ A;  2YI1 A;  4CBX A;  3EKU A;  3FE1 A;  3A0I X;  4BR5 A;  3O8M A;  3QB0 A;  3SK3 A;  2E2P A;  2F9T A;  3VET A;  4FWR A;  2P9K A;  4Z94 A;  3C0B A;  4RWT A;  5AQN A;  1T44 A;  2YJF A;  4H0P A;  3WEE B;  2AP1 A;  3BEX A;  2ZGY A;  3LDL A;  2CGL A;  3OHR A;  3VGM A;  2DPN A;  2P9P B;  4M7Y A;  2BTF A;  4CI6 A;  4ISF A;  1X3M A;  1XC3 A;  5AQU A;  1ATR A;  3IMX A;  4FOI A;  5LJW A;  5AQX A;  5EXW A;  5LY3 A;  1JCF A;  1SAZ A;  3JS6 A;  3UKU A;  3VF4 A;  2GEL A;  2E20 A;  5AQS A;  4JHD B;  4MLE A;  2GEM A;  1GLE G;  2P9I A;  2QWR A;  1K8K B;  3CJ7 A;  3FZK A;  3UE5 A;  3FR0 A;  1GLF O;  5EOY A;  3ZX2 A;  3LL3 A;  5F0X A;  4LC9 B;  2I7N A;  5AQF A;  1QQM A;  4BGB A;  5AQZ A;  2A3Z A;  5EY4 A;  2FF3 B;  3HSC A;  3MDQ A;  1BA1 A;  3A8Y A;  3R6M A;  1QZ5 A;  3VF6 A;  4CZF A;  3GE1 A;  3U4L A;  2FSK A;  5BPN A;  3L4I A;  4XH4 A;  2OAN A;  2HOE A;  3BF1 A;  4K41 A;  3MMV A;  4IZ9 A;  5AZJ A;  1HKG A;  3O4W A;  1NGE A;  4M7X A;  3GL1 A;  1NLV A;  3MN7 A;  4FWP A;  4JD2 A;  2E1Z A;  5AQH A;  5AQL A;  4BC3 A;  5BRD A;  4H5T A;  3QBX A;  4CBU A;  4DB3 A;  3SJH A;  4J8F A;  2CH5 A;  1U2V A;  1TYQ A;  5BN9 A;  1P8Z A;  4BQZ A;  4BC5 A;  4CZG A;  3VEO A;  3CJ9 A;  2V52 B;  5BPM A;  1IG8 A;  2P9U A;  3WXI A;  5FPN A;  2Q2R A;  2P9K B;  3ATV A;  3EN9 A;  3CIP A;  3J8A A;  5AFU H;  5AQW A;  3A5N C;  3VEW A;  3O1W A;  1NGI A;  4CD3 A;  4PL8 A;  3WXK A;  2GWJ A;  1NGJ A;  4IWV A;  2D1K A;  5AQP A;  1YVN A;  4H5V A;  2PBD A;  4BQL A;  3LDQ A;  2FSJ A;  3SMS A;  2YHX A;  5F2R A;  2E8A A;  3SLC A;  3O08 A;  3HBT A;  3CER A;  2ASP A;  3JXU A;  3FZL A;  3UKU B;  2A6A A;  3QML A;  3G25 A;  3A5O C;  3EO3 A;  1G99 A;  5BRF A;  2A40 A;  3M1F A;  4Y0W A;  3I8B A;  2V7Y A;  5AQR A;  3ZET B;  4EIA A;  4WQ4 A;  2GUP A;  4B1U B;  2CGJ A;  5AQM A;  5KPR A;  5ADX A;  1SZ2 A;  5JMV A;  5AZI A;  4BRK A;  3VEZ A;  1DEJ A;  3D7E O;  4AM7 A;  3D2F B;  3O5B A;  3QFU A;  4QS7 A;  3D2E A;  2YHY A;  4H0V B;  1ZBS A;  2D4W A;  3ATU A;  3BF3 A;  1QHA A;  4BVP A;  3H3O B;  4DQ8 A;  1OKJ A;  1ZXO A;  4GNI A;  3P4I A;  1NBW A;  2ASO A;  2QWM A;  1D4X A;  2VYP A;  5KPT A;  1WUA A;  3WT0 A;  3DXK A;  1E4F T;  3KHY A;  5KPZ A;  4BR2 A;  3VF2 A;  1HUX A;  3MN5 A;  4QS9 A;  4K25 A;  2P9N A;  2Q0U A;  2HF3 A;  4L3Q A;  5B8H A;  2IIR A;  3BP8 A;  2FLO A;  1KAX A;  5AR0 A;  3IDH A;  1S3X A;  1R59 O;  3MN9 A;  2Q36 A;  3IFR A;  1BUP A;  1J6Z A;  3RSE B;  2Q31 A;  1MA9 B;  4PKH A;  2IVO A;  2Q1N A;  2W41 A;  3ZX0 A;  4FPA A;  4YDU C;  4BR9 A;  3W3D A;  4CZH A;  4BC2 A;  5E26 A;  5FPE A;  2E2O A;  4CZL A;  4FPB A;  4IJN A;  2P9S A;  1GLD G;  3A5L C;  1V4T A;  1JCE A;  4FSV A;  4JN4 A;  5AQO A;  3O1B A;  4BRG A;  5BR9 A;  1IJJ A;  3ENH A;  3AAP A;  1HX1 A;  3UKR A;  4AM6 A;  1GLC G;  2P9L B;  1C0F A;  1NGB A;  4I6M B;  4BRA A;  5AQG A;  4CZE A;  5KQD A;  4WQ5 C;  2VCP A;  3TPQ A;  2GTD A;  3DXM B;  2IVP A;  3CQX A;  2E1Y A;  1C0G A;  4NB4 A;  4CZM A;  4B1Z A;  2E2N A;  4IO8 A;  4JAX A;  5AQY A;  3CJ1 A;  4EHT A;  1QQN A;  3CJB A;  3GG4 A;  5BRE A;  4XEI A;  1Z6R A;  1HLU A;  3ZX3 A;  1YUW A;  3B8A X;  3GBT A;  3WUH A;  5CE3 A;  2GWK A;  3VEV A;  5AQV A;  4BG9 A;  1CZA N;  3FLC O;  5TKY A;  3O6W A;  1ESV A;  4MO4 A;  3SMP A;  3H1V X;  3AAR A;  3HM8 A;  5EVZ A;  3ZEU A;  5FPD A;  1NGG A;  2HF4 A;  3ID8 A;  3ENO A;  3H6E A;  4K42 A;  5FPM A;  3VOV A;  4C23 A;  3CET A;  4O8K A;  3H3N O;  3WXL A;  2E2Q A;  1KAZ A;  2FXU A;  4ISG A;  1TUY A;  4H5W A;  4H03 B;  2I7P A;  2NLX A;  4O5F A;  3R9P A;  2NRH A;  3HZ6 A;  3L0Q A;  3CHW A;  2ZWH A;  4BRO A;  4H0T B;  3WEE A;  3DXK B;  4BG8 A;  5EX5 A;  3WXJ A;  3KVG A;  3AY9 A;  1HKB A;  1NGA A;  3VGL A;  4H0O A;  4CD1 A;  3CQY A;  5ADX H;  3VER A;  2P9P A;  1QQO A;  2W40 A;  1WOQ A;  4IJA A;  4CBW A;  4BC4 A;  3IUC A;  3QIC A;  2ITM A;  3LM2 A;  1V4S A;  3WQT A;  4B9Q A;  1HKC A;  4JHD A;  1Z05 A;  4XH5 A;  4IXC A;  1K8K A;  2H3G X;  2HMP A;  2P9I B;  4BRM A;  4PKI A;  5ELZ A;  4YDU A;  4DHY A;  2QXL A;  3DWL A;  3BUZ B;  4MO5 A;  5AQJ A;  4BR0 A;  4M63 C;  4FWN A;  1YAG A;  3KZB A;  2BUP A;  1RGI A;  1LCU A;  4BR4 A;  1RDW X;  3EZW A;  3EKS A;  4EHU A;  3VEY A;  4FO0 A;  4BRH A;  1QZ6 A; 
#chains in the Genus database with same CATH topology
 4O8U A;  1BI4 B;  1RFQ A;  2CH6 A;  3H1Q A;  1M1K O;  4FW1 A;  1S22 A;  1J53 A;  1NOZ A;  3OYM A;  1IBL K;  1OH5 A;  3UB5 A;  3DLB A;  3G4S N;  1NJZ A;  3L8B A;  1YF5 L;  1NGF A;  3FGU A;  4DQS A;  1WNS A;  1U2V B;  4OGC A;  2IVN A;  5C12 A;  1HNX K;  4B8C A;  1KQS M;  3DJC A;  4HWI A;  3OYD A;  4FVM A;  3MK6 A;  3CI5 A;  3K58 A;  4RW9 A;  3H46 O;  4K8Z A;  2Q0R A;  5HRR A;  3HOT A;  4BVO A;  3AGK A;  1TK8 A;  3EE9 A;  4NO7 A;  4B08 A;  1U6Z A;  4F2S A;  2YKM A;  1KAY A;  4N5S A;  3KJV A;  1EO1 A;  5KQ8 A;  4DR7 K;  2B5J A;  3NH2 A;  3GDQ A;  3HJF A;  4CF1 A;  1NKC A;  3TTD A;  3MEG A;  1FW6 A;  4JKG B;  4MFB A;  4AHU A;  4FCY A;  5HOO A;  3L2Q A;  1GLL O;  1W9H A;  2YHA A;  5AZI B;  4Y1C A;  3V1R A;  2O8B B;  3LDN A;  4IOA L;  1LOT B;  3D2E B;  2HMI A;  1HJR A;  1VQ5 N;  4GV3 A;  1TV6 A;  4CHZ A;  5EU7 A;  2Y1I A;  3CFO A;  4YHH K;  2AJQ A;  5IWA K;  1I3A A;  4M3T A;  4B1X B;  4CGH A;  1EXQ A;  3FZH A;  2NZT A;  5AQT A;  1JKH A;  4BWJ A;  4DTR A;  4CES A;  1VQ6 N;  5I42 A;  2D5R A;  1B92 A;  4EFH A;  2P9N B;  4N56 A;  3EL2 A;  4CK2 A;  4BE7 B;  1U47 A;  1WN7 A;  3O9Q A;  4LY7 A;  4DR3 K;  4IO9 L;  3FZF A;  1ILY A;  3A2F A;  4GVE A;  2KZM A;  2QWQ A;  4CGG A;  1P90 A;  4U7B A;  2P9S B;  3SYZ A;  4DLG A;  4DTX A;  3ZSQ A;  3BDP A;  1OH8 A;  3CQ8 A;  4M42 A;  4BRL A;  2D0A A;  2ZGZ A;  1O13 A;  4CJ7 A;  4CGD A;  3LDO A;  2FBT A;  4CJS A;  1WB9 A;  3LDP A;  4PKG A;  1Y97 A;  3QNN A;  4KHN A;  3PSF A;  3C94 A;  1BDG A;  2VG6 A;  3QIN A;  5C24 A;  4BRF A;  1TUU A;  1BGX T;  4B9N A;  4MLH A;  4RW4 A;  1NGC A;  4CHP A;  4GKJ K;  3J7A P;  4DV6 K;  2HHT A;  3IAY A;  1NGH A;  3OY9 A;  3K5L A;  1XUP O;  1DGK N;  2WTU A;  4O5B A;  4JKF A;  3ZSV A;  4DU4 A;  4BGA A;  3LP0 A;  2KQ2 A;  2RE2 A;  4JKB A;  1OVY A;  1HRH A;  3O8M A;  1NJI O;  1CZ9 A;  5J2M A;  1HPZ A;  3V81 A;  3V9S A;  4E7L A;  2P5G A;  1TKT A;  4Z94 A;  3C0B A;  1TKD A;  1DT9 A;  1RBR A;  4RWT A;  1T44 A;  3U3Y A;  3KK7 A;  4J2E A;  3OTO K;  3PX6 A;  4OVL A;  2HHW A;  2FBY A;  4Q5V A;  4M7Y A;  4FLW A;  4JKH A;  1IG9 A;  5AQU A;  2OPR A;  2HHU A;  2WOM A;  1RBU A;  5LY3 A;  5M1P A;  1SAZ A;  4DSK A;  3JS6 A;  2G8F A;  1LV5 A;  4HUG A;  3ISN C;  3N4Q A;  3AVL A;  4MLE A;  2GEM A;  1GLE G;  1K8K B;  3CJ7 A;  4JKA A;  5EOY A;  4ILG B;  5F0X A;  4ID5 A;  1JLG A;  2I7N A;  5AQF A;  3HVT A;  3OYK A;  3LWL A;  1BIS A;  3KLH A;  5AQZ A;  2A3Z A;  4LH4 A;  3V1Q A;  4JI8 K;  3R6M A;  1K73 O;  3VF6 A;  3G10 A;  3U4L A;  1WSG A;  5C2F A;  4EP5 A;  1BI4 A;  3AVM A;  2W00 A;  4OX9 K;  3ZSR A;  1J5O A;  4Z4F A;  1O1W A;  2IDO A;  3RMA A;  3ULD A;  4B9T A;  4DR5 K;  2Z1I A;  2D0C A;  3SBG A;  2Z1G A;  4X64 K;  3K2P A;  4CBU A;  4DB3 A;  3P5J A;  3SJH A;  1U2V A;  4O0I A;  3AGR A;  5BN9 A;  1P8Z A;  4CZG A;  3CJ9 A;  5BPM A;  3WXI A;  1X9W A;  2Q2R A;  3ATV A;  2O8F B;  2HW3 A;  5AFU H;  1S1X A;  1HNV A;  5AQW A;  4DUY K;  3VEW A;  1NK4 A;  4JI7 K;  4NCA A;  4I9Q A;  4CJV A;  2OYQ A;  1DTT A;  5M1F A;  4FK2 A;  4AHV A;  2VG7 A;  3LAL A;  1LWC A;  5KI6 A;  4KH5 A;  2PBD A;  4BQL A;  3SAF A;  2FSJ A;  1HR0 K;  4HCC A;  1HNW K;  3MEC A;  3HBT A;  3CER A;  3JXU A;  3PY8 A;  3AA4 A;  1NNE A;  4CCH A;  4PQU A;  3EO3 A;  3M1F A;  2RHK A;  4JK8 A;  3WNG A;  4EIA A;  4WQ4 A;  4J2B A;  1UWB A;  4JKG A;  3JSM A;  2CGJ A;  5AQM A;  5KPR A;  4FLU A;  4V19 S;  5AZI A;  4DTM A;  2O8B A;  4LSN A;  3D2F B;  3D2E A;  1YT3 A;  1NK8 A;  1ZBS A;  2D4W A;  1QHA A;  4BVP A;  3H3O B;  4B3S K;  3Q7C A;  1OKJ A;  1IKX A;  4YOR A;  4GNI A;  2XY5 A;  2ASO A;  3F2K A;  4NYF A;  2VYP A;  1HYV A;  4CJU A;  4C1N K;  3KHY A;  5C25 A;  1L3T A;  1UOC A;  1QSL A;  1C6V A;  3VF2 A;  3F9K A;  4CVN E;  1NG9 A;  4QS9 A;  2P9N A;  1R0A A;  4LFB K;  5B8H A;  4UQG A;  1KAX A;  4RW8 A;  1SKW A;  3V9U A;  5CZ1 A;  3RSE B;  4KKO A;  4PKH A;  4BR9 A;  1U45 A;  4Z4I A;  3W3D A;  4CZH A;  3RR8 A;  5E26 A;  5FPE A;  1BIZ A;  4CZL A;  4IJN A;  3O3F A;  2P9S A;  4ILJ A;  4Z4H A;  3TAR A;  2UUC K;  1IO2 A;  4E7I A;  4IEI A;  5BR9 A;  3ENH A;  4AM6 A;  1GLC G;  1S9G A;  2IAJ A;  1RDB A;  1RIL A;  1WBB A;  5AQG A;  4CZE A;  2VCP A;  5K14 A;  3DXM B;  4KHU A;  3NF9 A;  4CZM A;  4W5Q A;  4CFD A;  3SQ2 A;  1VAZ A;  1VRU A;  3GG4 A;  1Z6R A;  4CEA A;  1HLU A;  4W5N A;  4JKC A;  3WUH A;  2OPS A;  5CE3 A;  4AHR A;  1REV A;  2GWK A;  3DM2 A;  3VEV A;  5AQV A;  4NYN A;  5TKY A;  4N47 A;  2QKK A;  4FJL A;  3H1V X;  4CGF A;  4JI6 K;  3OVN A;  1XC9 A;  2KTQ A;  2HHQ A;  1NGG A;  3ID8 A;  2QA4 N;  2OPP A;  3KLG A;  1L5U A;  3ZSZ A;  2ZQB A;  3TAG A;  2NRT A;  3VOV A;  4C23 A;  1G15 A;  3CET A;  2FXU A;  3SUN A;  2O4I A;  1NK6 A;  1LW2 A;  1WBD A;  5GAD P;  3TWH A;  3R9P A;  2YV0 X;  1JJ2 M;  1J5E K;  4FJ8 A;  2RN2 A;  1Q86 O;  5ADX H;  5LL6 Z;  3VER A;  3SAH A;  1I39 A;  3U6F A;  1GOA A;  1QQO A;  4CBW A;  3IUC A;  5FRM A;  1W7A A;  1VQN N;  3O9R A;  4IOX A;  4C8K A;  1T03 A;  4PY5 A;  1HKC A;  2D0B A;  1N33 K;  4CEE A;  1FXX A;  4CFB A;  3MXM A;  2HHX A;  1K8K A;  1VSF A;  2P9I B;  4M3W A;  3DOK A;  1JLF A;  4PKI A;  3SJJ A;  3SBT A;  4DHY A;  4BE1 A;  4FWN A;  1YAG A;  4AHC A;  3MWT A;  2NUB A;  5KGW A;  4CGI A;  3E1Y A;  3VEY A;  4KAZ A;  3BGR A;  4CF8 A;  4CHO A;  3VA3 A;  2HBJ A;  1S5J A;  4B9M A;  2E88 A;  4E1J A;  5KGX A;  4BRC A;  3ULE A;  4QS8 A;  4JNE A;  1HJO A;  4DFK A;  5JEN A;  4FWQ A;  2X6N A;  3K5M A;  4EAH D;  4OKK A;  1QTM A;  3MN6 A;  1T05 A;  4A61 A;  3NHG A;  2O8F A;  5BN8 A;  2WFB A;  2AA4 A;  1VSD A;  3H08 A;  3THY B;  1KD1 O;  4H4O A;  2VG5 A;  2Z1J A;  1BO5 O;  3DMJ A;  3HYF A;  4PHT X;  1BQM A;  3TAF A;  1D5A A;  4DV1 K;  4HUE A;  4X66 K;  1NM1 A;  4L8R B;  1X9M A;  4O0J A;  1ZBI A;  2F8T A;  3NDK A;  2ASM A;  1RTI A;  4ICL A;  3AA2 A;  5DK5 A;  1VQ9 N;  4FJH A;  4WQ4 C;  3ZT0 A;  1UA1 A;  1HQU A;  4Z4C A;  2QM1 A;  3KK1 A;  3I33 A;  4NXN K;  4C8O A;  1GLA G;  3P38 A;  2YJE A;  2V51 B;  3WNE A;  4IFY A;  1XMQ K;  2HVH A;  3LAN A;  3QBW A;  3R8E A;  4KBO A;  4A2B A;  4CGJ A;  4ID1 A;  4H5R A;  3D2F A;  4JEP A;  3M6G A;  4CEQ A;  3OYH A;  1Q82 O;  5J2Q A;  3MCA B;  1RT5 A;  3NF8 A;  4ELU A;  4MQ3 A;  4FOE A;  1NMD A;  3HT3 A;  1YTA A;  4KI4 A;  1QHT A;  1VSL A;  2D0P A;  4BRD A;  1NKE A;  2HHI A;  3FZM A;  1VRT A;  5M1Q A;  3H45 C;  3QDK A;  5AQK A;  5HL7 L;  5M1N A;  4CIG A;  3QFP A;  1X9J A;  3RSE A;  3OYN A;  3HI0 A;  2A41 A;  2HHV A;  2FF6 A;  1H1V A;  4YNQ A;  5F1X A;  3KD5 E;  4I2Q A;  4BDZ A;  3LDS A;  1EQY A;  4FL9 A;  4ZTJ A;  1KVA A;  2QWP A;  1J54 A;  3AO2 A;  2P1J A;  2QKB A;  4CJR A;  1VSM A;  3OBY A;  4FWL A;  3WNF A;  3DXM A;  3NBP A;  4WF9 L;  1ATN A;  1QE1 A;  3C7N B;  1GLJ O;  2PAV A;  4KV8 A;  4WFA L;  1T6D A;  4A59 A;  4PUO A;  3OW2 M;  4BRP A;  1TL1 A;  3U9Z A;  3DLL L;  2YHW A;  5I9E B;  2FBV A;  2KFN A;  1N32 K;  4A2A A;  2EWS A;  3TAB A;  3NAE A;  4M3U A;  1T6C A;  3I55 N;  4K43 A;  4FYD A;  1L3S A;  3EKU A;  5GIN A;  3FE1 A;  3NH1 A;  4FJ7 A;  2RF2 A;  1XHZ A;  4DS4 A;  3QEX A;  2F9T A;  4CHY A;  1K9M O;  4M3Z A;  4FWR A;  2GUI A;  2E6M A;  1BHL A;  4KH4 A;  3OYJ A;  4FM0 A;  4O4G A;  3P1G A;  4E7K A;  2YJF A;  5CZ2 A;  3V9Z A;  4CK3 A;  1W0H A;  2RPI A;  3VQP A;  2B6A A;  2HHH K;  4ILH A;  1S1T A;  3I0S A;  3HM9 A;  4E3S A;  4FOI A;  2BAN A;  1JCF A;  3SV3 A;  4JI2 K;  2VGM A;  3UKU A;  3VF4 A;  2GEL A;  2YNF A;  1RT3 A;  1XWL A;  5AQS A;  4JHD B;  5HBM A;  2P9I A;  4EP4 A;  1KVC A;  3ZT1 A;  4DSJ A;  2QWR A;  4GVM A;  2OA8 A;  4JK7 A;  3UE5 A;  3SQ1 A;  5GIP A;  1YHQ N;  4E7J A;  1VQK N;  1Q81 O;  3L2U A;  1CXU A;  3RMD A;  1QQM A;  4BEC A;  3QEP A;  3VQ4 A;  5A2Q O;  3ZT2 A;  3HSC A;  5LMU K;  3LP3 A;  3MDQ A;  1BA1 A;  3CG7 A;  4DV5 K;  4CZF A;  5HLF A;  2FSK A;  1JLC A;  4BEB A;  2OAN A;  3KKR A;  4K41 A;  4DS5 A;  3MMV A;  4IZ9 A;  3WNH A;  3J80 O;  4OPH A;  4LFA K;  4KB1 A;  4W5T A;  3K0S A;  1XI1 A;  3ZSO A;  4KFB A;  4FLV A;  2O8E A;  3NFA A;  3J81 O;  2E1Z A;  1NJY A;  5BRD A;  4H5T A;  3TAE A;  2O8C B;  2JWK A;  5J1E A;  3B6O A;  4J8F A;  1XNR K;  1VSE A;  3THY A;  2P9K B;  4Y1D A;  4O55 A;  3O1W A;  4CJ3 A;  2BDP A;  3OS1 A;  4CJK A;  3WXK A;  2Y1J A;  4IWV A;  2G8I A;  3OYG A;  1BL3 A;  3QIP A;  4IDK A;  4CHN A;  2HNZ A;  1EWR A;  1LAW A;  3G71 N;  1YVN A;  4H5V A;  3SZ2 A;  4HCB A;  1SL0 A;  1KFD A;  3K5O A;  4K8X A;  3LDQ A;  4BWM A;  3SMS A;  2YHX A;  5F2R A;  1XMO K;  3O08 A;  3LPU A;  2PFU A;  4BY9 C;  1HQE A;  1WSJ A;  4CEC A;  2A6A A;  4M45 A;  3QML A;  3G25 A;  1G99 A;  5BRF A;  2A40 A;  2WBN A;  4FXD A;  4Y0W A;  1Z25 A;  4X65 K;  3SCX A;  3OBW A;  4AQY K;  3VQB A;  2OTJ N;  5JMV A;  4AM7 A;  3KWG A;  3QFU A;  4N41 A;  1RT7 A;  4DQR A;  1IBK K;  1S6Q A;  1ZXO A;  4CEF A;  1D4X A;  2IGI A;  5KPT A;  3CYM A;  3WT0 A;  1S1V A;  3MEE A;  1E4F T;  3TAM A;  5KPZ A;  2BE2 A;  1KRP A;  2DFF A;  3S3M A;  5FRN A;  3SUQ A;  1HUX A;  2Q0U A;  4L3Q A;  5AR0 A;  3RMB A;  1EP4 A;  1BUP A;  2ZJQ L;  4A57 A;  2Q31 A;  3CM6 A;  4NCB A;  1EKE A;  2IVO A;  4DKW A;  2W41 A;  3ZX0 A;  4DSI A;  4YDU C;  4CJW A;  2E4L A;  4FPB A;  2C1I A;  4WFB L;  1RDC A;  3O1B A;  4BRG A;  3AAP A;  1HX1 A;  2DFE A;  2P9L B;  1ASW A;  3AVF A;  4I6M B;  1JLQ A;  3PX4 A;  5KQD A;  2PYJ A;  4KHY A;  4B9L A;  2A1R A;  3TPQ A;  4OPA A;  3CQX A;  2XO7 A;  2E2N A;  4HUF A;  3L4Q A;  2HNY A;  4OGE A;  1S72 N;  3ZX3 A;  3GBT A;  3M8Q A;  5M1K A;  1WSI A;  3LAM A;  2NRW A;  2BH1 A;  3SPZ A;  1ESV A;  3QEV A;  1VSH A;  3AAR A;  4LF4 K;  4FLZ A;  4JI1 K;  3HP9 A;  4CER A;  4Q0B A;  3ENO A;  1BCO A;  1C1C A;  3O9S A;  5C42 A;  3S5T A;  4O8K A;  3H3N O;  3WXL A;  4IDH A;  1KAZ A;  3D45 A;  4ISG A;  3PSI A;  3ZSY A;  3TSU A;  4A5B A;  3HK2 A;  5FDL A;  1WSE A;  4CW7 B;  2ZWH A;  4BRO A;  5GAH P;  3DXK B;  4BG8 A;  4I9L A;  2UUA K;  3AY9 A;  1HKB A;  1KTQ A;  3KTQ A;  3T7Z A;  1EET A;  3CQY A;  1EX4 A;  4DV4 K;  1DLO A;  1IBM K;  4IJA A;  3AA5 X;  2PZS A;  3QIC A;  4KRF A;  3N4P A;  1TAU A;  4B9Q A;  4DF4 A;  4JHD A;  1Z05 A;  1UAX A;  4XH5 A;  4YOV A;  3J7Y P;  3HOS A;  5JVG L;  1WAF A;  2H3G X;  2NRZ A;  4BRM A;  3CCR N;  1RTD A;  2JLE A;  1IH7 A;  1BQN A;  4RW6 A;  3CPE A;  1HNZ K;  1FKP A;  4DTU A;  1HMV A;  3LP1 A;  1BIU A;  3MX5 A;  5C2D A;  4LF5 K;  4M63 C;  1E3M A;  2BUP A;  1LCU A;  4BR4 A;  4FJX A;  3EZW A;  4NLC A;  4YOY A;  3LP2 A;  3EKS A;  3F73 A;  4FO0 A;  2XY8 A;  3RWU A;  4LFC K;  3G6E N;  2HB5 A;  3CF5 L;  3KK3 A;  5AZJ B;  1XHX A;  5C15 A;  4KHP K;  1JXE A;  1RDA A;  3E66 A;  1NJX A;  1L3U A;  3SUP A;  3L2R A;  4JD2 B;  4BRI A;  2O8C A;  4DQQ A;  2Z1H A;  3O80 A;  1ZBL A;  1EWQ A;  4CJQ A;  3CPW M;  4DU1 A;  2UYT A;  3VTI A;  3OYC A;  1E4G T;  3HTV A;  4DUZ K;  2P9U B;  3F9M A;  3JYT A;  4FWM A;  4FJ9 A;  2UUB K;  2VWB A;  3MCP A;  2G8U A;  2Q3S A;  3OYB A;  3LZJ A;  2Q97 A;  5C0Y A;  3M3Z A;  3THX B;  5BPL A;  4UY8 O;  1BG3 A;  4CZI A;  1JLA A;  2F96 A;  4BRQ A;  1JL1 A;  5CYQ A;  1KVB A;  2C1G A;  3VEX A;  1NK9 A;  3V4I A;  2HBK A;  2J4R A;  3AVB A;  2IOC A;  1ITG A;  4H0Y B;  1ZC6 A;  3V6D A;  1A5X A;  3A5M C;  4F9O A;  4BR7 A;  3DLH A;  4XH1 A;  5AQI A;  1SKR A;  2CGK A;  4FLT A;  2X6S A;  3BZC A;  2FSN A;  4HTL A;  3ZT4 A;  3DRR A;  3KIO A;  5JLF A;  3CJA A;  4BDP A;  4DSE A;  4FZY A;  2QW9 A;  1J9A A;  4LF6 K;  4B3R K;  4DFM A;  4CIE A;  1T7P A;  3DLR A;  1RTJ A;  4OO1 J;  3SNN A;  4DFJ A;  4ISE A;  1GOB A;  4DV7 K;  3D6R A;  3PV8 A;  1XQS C;  3QNO A;  4FJ5 A;  2KHO A;  1YXQ A;  5GAG P;  1WSF A;  3HL8 A;  3KLF A;  1SQK A;  2HBL A;  3HPH A;  2KKZ A;  1YVU A;  4RW7 A;  2FBX A;  4B1Y B;  3HPO A;  4H5N A;  1C0U A;  5E84 A;  4CJT A;  1MDU B;  4K0K K;  3DAW A;  4H0X B;  3KKS A;  4DCH A;  3CCM N;  4J2A A;  1HYS A;  2VWK A;  2KW4 A;  2P9L A;  3HP6 A;  4I6M A;  3VES A;  3K59 A;  3OYL A;  3VPZ A;  4H8K A;  5DM7 L;  4QOZ B;  2F9W A;  1U48 A;  4F4K A;  4BRN A;  1B9D A;  4CF2 A;  3SI6 A;  1MWK A;  3NE6 A;  2OZS A;  3EEQ A;  3U8X A;  4HTU A;  3ASM A;  1DKG D;  4YOT A;  2WUS A;  3G0Z A;  1TGO A;  3D0P A;  2I5J A;  5BRH A;  4OKE A;  1L3V A;  4CK1 A;  1BWF O;  1CLQ A;  5AFU A;  1BA0 A;  2QXF A;  3ZYY X;  4Z4E A;  3CMA N;  1IKW A;  3U9D A;  1QQC A;  3ZEU B;  5LJV A;  1YIJ N;  2YI1 A;  4CBX A;  1SS6 A;  4BR5 A;  3CCE N;  3MXI A;  1VSI A;  1RDD A;  3QB0 A;  3SK3 A;  3OYF A;  4LF8 K;  4KHS A;  4C8L A;  1CXQ A;  2QEX N;  4GV6 A;  3QEW A;  4JK9 A;  1RT6 A;  4CHQ A;  4JYA K;  4BE0 A;  1WAJ A;  4ZTF A;  4DTN A;  4QCL A;  3WEE B;  3BEX A;  2ZGY A;  3LDL A;  2CGL A;  3P39 A;  1OVQ A;  3VGM A;  1D9D A;  2DPN A;  3B6P A;  2P9P B;  4G1Q A;  3TAP A;  2BTF A;  4B8A B;  1X3M A;  3EE8 A;  2FC0 A;  5LJW A;  5AQX A;  4JS4 A;  2DY4 A;  4E19 A;  4GW6 A;  1NMN A;  5SWM A;  2KFZ A;  2E20 A;  4C1N I;  2G8K A;  2VWJ A;  3TSQ A;  1RTH A;  4MDB A;  3FR0 A;  3ZX2 A;  3LL3 A;  3E9P A;  4LC9 B;  3C6U A;  3K5N A;  1RBS A;  2XY6 A;  4FJM A;  2QTD A;  5EY4 A;  2FF3 B;  4M41 A;  3PO4 A;  4DQP A;  4CIF A;  5HRN A;  3KLI A;  4LF7 K;  3LZI A;  1QZ5 A;  3DRS A;  2X78 A;  5BPN A;  4XH4 A;  3L2V A;  2HOE A;  4XIU A;  3O3H A;  4HHT A;  3HRG A;  5AZJ A;  2G8V A;  4FM2 A;  1FKO A;  3I56 N;  1KSP A;  1NGE A;  3ZCM A;  3NMU A;  4M7X A;  3GL1 A;  3ALY A;  3MN7 A;  4JD2 A;  4BC3 A;  4Z4G A;  1SL1 A;  4FK4 A;  1YJ9 N;  3FFI A;  3QBX A;  4DG1 A;  5JS2 A;  4KTZ A;  1VSK A;  2CH5 A;  1JLE A;  1RT1 A;  3VEO A;  3ZSW A;  2P9U A;  2OZM A;  5FPN A;  3EN9 A;  5FLX O;  3OJU A;  4YFU A;  4CD3 A;  4DTS A;  5TKW A;  3DLE A;  3O4Q A;  1RBT A;  3VQA A;  3MXJ A;  4C8N A;  3THX A;  4FJJ A;  4R79 A;  1TKZ A;  2D1K A;  4B3T K;  3BZK A;  1C1A A;  3AVN A;  1KCF A;  5JVH L;  1W97 L;  4RG8 A;  1OH6 A;  4KI6 A;  1VSJ A;  4KB0 A;  4CEZ A;  2E8A A;  5DM6 L;  1QSY A;  4YOW A;  3FZL A;  3VQD A;  2NNW A;  3RMC A;  5CYM A;  4GKK K;  3A5O C;  2YNG A;  1RDU A;  5AJ3 K;  4FJI A;  2V7Y A;  5AQR A;  3ZET B;  3RR7 A;  4DF8 A;  4DU3 A;  2GUP A;  1IKY A;  4B1U B;  2BGG A;  5ADX A;  1ZBH A;  4BRK A;  3T3F A;  1DEJ A;  3D7E O;  1QS4 A;  3M8R A;  4IKF A;  4QS7 A;  4OLA A;  4DQ8 A;  1D8Y A;  1RT2 A;  2XHB A;  3SQ0 A;  3CCU N;  4W5O A;  3RRG A;  3P4I A;  1X9S A;  1KFS A;  1WUA A;  2VQE K;  3C6T A;  5KTQ A;  4JI4 K;  5IT9 O;  1QVG M;  1VQM N;  4BR2 A;  3DLG A;  3MN5 A;  1M90 O;  3T1A A;  2HF3 A;  2FLO A;  3MAQ A;  4OLB A;  1S3X A;  3IFR A;  3THW B;  2Q1N A;  1T3V A;  3C95 A;  4CJ5 A;  4H4M A;  3L2W A;  1GLD G;  3A5L C;  1V4T A;  4FSV A;  1VHX A;  2VQF K;  5AQO A;  1NK5 A;  3AVA A;  4DQI A;  3CFP A;  3CME N;  5CY4 A;  5HP1 A;  4ZHR A;  4EZ9 A;  2GTD A;  2IVP A;  3OYE A;  4B1Z A;  1QSS A;  4F2R A;  3TAN A;  5MLC Q;  1Q8I A;  3IG1 A;  3CC4 N;  1RNH A;  3CJ1 A;  4EHT A;  2QK9 A;  3CJB A;  1TK0 A;  1TAQ A;  4XEI A;  4GMJ B;  1YUW A;  3B8A X;  5KRS A;  1VQ8 N;  3ITH A;  1W2B M;  4BG9 A;  3FLC O;  1ZBU A;  2UXB K;  4MO4 A;  3AV9 A;  4DMN A;  3SMP A;  4LH5 A;  3ZEU A;  1TL3 A;  2VGN A;  2WON A;  5FPD A;  4JRP A;  1QVF M;  3H6E A;  4K42 A;  4TSX A;  3AVG A;  3RRH A;  1S6P A;  2HST A;  4OKJ A;  4WFN L;  2E2Q A;  3AA3 A;  4KTQ A;  3EY1 A;  3TSP A;  1TUY A;  4FZX C;  4FW2 A;  1RBV A;  4NXM K;  2ITG A;  4DV0 K;  4JKE A;  1VQO N;  2I7P A;  2NLX A;  2UU9 K;  3HZ6 A;  5D3G A;  3HPG A;  3L0Q A;  3PIO L;  3C6A A;  4H0T B;  3WEE A;  4KTW A;  1WLJ A;  5EX5 A;  3WXJ A;  4AHS A;  1N34 K;  1NGA A;  1MU2 A;  1S9E A;  4CD1 A;  2OPQ A;  3CD6 N;  2P9P A;  4U67 L;  3T1H K;  3C6H A;  2W40 A;  4BC4 A;  3V9W A;  4DSF A;  3LAK A;  2ITM A;  3LM2 A;  3AVK A;  2EHG A;  3T1Y K;  1NJW A;  4B3M K;  3P31 A;  3R1X A;  2PYL A;  2HMP A;  3DLK A;  1NOY A;  2YKN A;  5ELZ A;  2KZZ A;  3ID6 A;  2O8D B;  1S1U A;  3KWI A;  3TAQ A;  3DWL A;  3BUZ B;  2YX6 A;  4BR0 A;  3KZB A;  1RGI A;  5E41 A;  2DTU A;  2HVI A;  4KHQ A;  4EHU A;  2RKI A;  3OYA A;  2IS3 A;  1SUQ A;  4N76 A;  4BRH A;  1QZ6 A;  3WXM B;  2GV9 A;  2LSN A;  1LAV A;  3IKM A;  3VQ8 A;  2V7Z A;  3CC2 N;  3GOI A;  5J2N A;  4GV9 A;  5H1S Q;  5M1O A;  2YNI A;  4O44 A;  4J2D A;  3F5T A;  1K6Y A;  4FJN A;  4KHW A;  5T7B A;  1NKB A;  3QEI A;  3J7Z O;  4JI3 K;  2IC3 A;  1BU6 O;  1I94 K;  3CJC A;  4PA1 A;  4KO0 A;  3HXM A;  1TYQ B;  5HRO A;  1KXP A;  4B9S A;  1JCG A;  3NGZ A;  3L6Q A;  4JS5 A;  2W6K A;  2X74 A;  1NGD A;  3CCQ N;  4RTF D;  4DV3 K;  4FLY A;  3VQE A;  3VTH A;  3PLA A;  4BAC A;  2A5X A;  4RCH A;  3VEN A;  3C7N A;  3CYG A;  4E89 A;  1VK0 A;  4OJR A;  3AO5 A;  4OPK A;  3AVI A;  3AVH A;  4PL7 A;  3CFR A;  3VQ7 A;  1TVR A;  3AO4 A;  5JIC A;  3LM9 A;  3AAQ A;  1KLN A;  4I2P A;  4YOX A;  3WQU A;  3CCS N;  4B1W B;  1VQ7 N;  3ZET A;  4LF9 K;  1MWM A;  4CJ4 A;  1SKS A;  3OJS A;  4ELV A;  4FWK A;  2HHS A;  4YOU A;  3OS2 A;  1BOT O;  1S1W A;  2NRX A;  1Q9Y A;  1ATS A;  1JL2 A;  4BRE A;  4FWS A;  4GY2 B;  1CZB A;  4IG3 A;  4A62 A;  4FK0 A;  4AIL C;  2QWL A;  3KD1 E;  1HPM A;  1SL2 A;  1YIT N;  3O9U A;  4B3O A;  1ASU A;  3M8S A;  4CF0 A;  3FFK B;  3V9X A;  3HO1 A;  3ULE B;  2ZJR L;  4E1M A;  4NCG A;  1A5V A;  3AO3 A;  1GLB G;  4KPY A;  2QWO A;  3SUO A;  3AVC A;  4I7F A;  3AVJ A;  2ETJ A;  3THW A;  1IKV A;  1Y64 A;  3S41 A;  2A42 A;  2YCH A;  4B1V A;  3THV A;  2D0O A;  5FRO A;  1KC8 O;  5JLH A;  3MWP A;  2E6L A;  5AQQ A;  3M8P A;  2QWN A;  5CHI A;  4FWO A;  4YY3 K;  4ELT A;  3VMF B;  4CE9 A;  4PWD A;  1LWE A;  1SV5 A;  2ZF5 O;  3UKR B;  4CZK A;  3VQ9 A;  3HVR A;  3W0L A;  3PUF A;  4E7H A;  4DR1 K;  1NWK A;  4MDA A;  3ZT3 A;  3TU5 A;  1JXB A;  3HST B;  1YJW N;  3VGK A;  3CXC M;  2P5O A;  5GAE P;  1VQL N;  4WQ5 A;  4DLE A;  1N5Y A;  1K8A O;  1C0T A;  2F4V K;  5CR4 A;  4WYB A;  3I0R A;  2G8H A;  4B9V A;  4G9Z A;  1Q18 A;  1LW0 A;  1X3N A;  2ZD1 A;  3LPT A;  1TK5 A;  2B4J A;  5HRS A;  3MED A;  4CZJ A;  4EZ6 A;  4M3R A;  2YHB A;  3A0I X;  4QAG A;  4FZZ A;  3O4N A;  3NGI A;  2E2P A;  3VET A;  5GIO A;  3CM5 A;  3SAG A;  4DSL A;  2P9K A;  1DTQ A;  3NGY A;  4KRE A;  5AQN A;  4LSL A;  4CED A;  4IFE A;  4H0P A;  5SZT A;  3S3N A;  2AP1 A;  3SV4 A;  3OHR A;  4CJP A;  1IV0 A;  1ZYQ A;  4CI6 A;  4ISF A;  3P83 D;  1XC3 A;  1TKX A;  3VQ6 A;  1ATR A;  3IMX A;  5EXW A;  3EZ5 A;  4DTP A;  1N8R O;  1RT4 A;  2F7T A;  3DI6 A;  3QET A;  1U49 A;  4OPJ A;  3FZK A;  5J2P A;  1GLF O;  2GBZ A;  2O8D A;  1C0M A;  3TI0 A;  4BGB A;  2YNH A;  4BE2 A;  2O4G A;  3R3L A;  3TTC A;  3A8Y A;  3PO5 A;  5KRT A;  4IG0 A;  3ZLJ A;  1FJG K;  3E9L A;  3GE1 A;  4E0D A;  2XY7 A;  3L4I A;  4CJF A;  3BF1 A;  1N6Q A;  4DWI A;  4CEO A;  1HKG A;  3O4W A;  1NLV A;  4FWP A;  4XJX A;  5AQH A;  5AQL A;  1HNI A;  4F3O A;  5I3U A;  1BCM A;  3O9T A;  3L3V A;  1TYQ A;  2G8W A;  4BQZ A;  4BC5 A;  3S9H A;  2V52 B;  2KLA A;  1IG8 A;  4DTJ A;  3M5R A;  2OCE A;  3CIP A;  3J8A A;  4WE1 A;  3QLH A;  1NK0 A;  3A5N C;  1NGI A;  4PL8 A;  4HVJ A;  4AHT A;  4AF1 A;  4FJG A;  4R5P A;  4B9U A;  2GWJ A;  1NGJ A;  3RVC A;  3VN5 A;  1NU0 A;  3TTF A;  5AQP A;  5C10 A;  1YTU A;  2JGU A;  3QES A;  2OTL N;  3SLC A;  2ASP A;  3SPY A;  3UKU B;  4F3T A;  1F21 A;  4NLB A;  4IEE A;  2F8S A;  3E01 A;  1ASV A;  3BY5 A;  3TR8 A;  5DMR A;  1WSH A;  3I8B A;  2R7Y A;  1JLB A;  1SZ2 A;  3DOL A;  3K9J A;  1NK7 A;  3VEZ A;  3CCV N;  3UIQ A;  3O5B A;  4LD0 A;  4FM1 A;  3PIP L;  2YHY A;  4H0V B;  3BF3 A;  3ATU A;  1N36 K;  3KLE A;  3VQC A;  3VA0 A;  4CFA A;  3ENB A;  4JI5 K;  2HBM A;  2PY5 A;  3VQ5 A;  1NBW A;  3LWM A;  3EYZ A;  4CEB A;  4CJE A;  2QWM A;  2DFH A;  3I8D A;  2NRR A;  1U04 A;  3V1O A;  3CCJ N;  2ATQ A;  3DXK A;  2EX3 A;  2P51 A;  2UXD K;  2W42 A;  3S3O A;  2O8E B;  1Q7Y O;  3T19 A;  3NVK A;  4K25 A;  2ZE2 A;  2IIR A;  3BP8 A;  3OA9 A;  3IDH A;  2ZJP L;  4JKD A;  1R59 O;  2QI2 A;  3L3U A;  3MN9 A;  4IBN A;  2Q36 A;  3K57 A;  4IFV A;  1RCH A;  1J6Z A;  1MA9 B;  4E1N A;  4DR6 K;  3NVM A;  4FPA A;  4FJK A;  1A5W A;  3O3G A;  4BC2 A;  2E2O A;  3E9O A;  4JI0 K;  2XRI A;  1JCE A;  2WC9 A;  4JLH A;  4JN4 A;  3MX2 A;  4CJL A;  1VQP N;  1IJJ A;  3QO9 A;  3UKR A;  1C0F A;  1NGB A;  4BRA A;  4DV2 K;  4WQ5 C;  3K9K A;  2E1Y A;  1C0G A;  4NB4 A;  3KK2 A;  4IO8 A;  4JAX A;  3DYA A;  5AQY A;  3NCI A;  2W6L A;  1KLM A;  4JV5 K;  4M3Y A;  4Z0U A;  4M3X A;  1QQN A;  4BDY A;  5LMN K;  5BRE A;  5JS1 A;  1U4B A;  1C1B A;  1YI2 N;  1CZA N;  3U3G A;  3O6W A;  3NH0 A;  3HM8 A;  5EVZ A;  3Q7B A;  1FK9 A;  1X1P A;  3NF7 A;  2HF4 A;  4DR2 K;  5FPM A;  1YJN N;  3IS9 A;  3QIO A;  1HYZ A;  4DTO A;  4CFC A;  3OS0 A;  1LWF A;  2UXC K;  1OH7 A;  2HND A;  2A1S A;  4H5W A;  4DFP A;  4H03 B;  4O5F A;  2NRH A;  3CHW A;  4JRQ A;  3RTV A;  3KVG A;  3ZSX A;  3SQ4 A;  4F8R A;  1ZBF A;  3VGL A;  4WCE L;  1T8E A;  4H0O A;  3JAM O;  2GX9 A;  4C8M A;  4DR4 K;  2ZM6 K;  3DRP A;  2JWL A;  4CF9 A;  5BR8 K;  1WOQ A;  4AH9 A;  1XNQ K;  1UA0 A;  3CCL N;  1V4S A;  3WQT A;  1GOC A;  4X62 K;  3C65 A;  3QER A;  4E72 A;  4IXC A;  2E5L K;  3AO1 A;  4W5R A;  4FVU A;  3CC7 N;  2NRV A;  3VQQ A;  1Q9X A;  4YDU A;  4A5A A;  4KH6 A;  3OYI A;  3IRX A;  1D9F A;  1Z26 A;  3T69 A;  2QXL A;  1VQ4 N;  4MO5 A;  5AQJ A;  4FLX A;  1RDW X;  1B9F A;  4IOC L;  5HRP A;  3NF6 A;  3PX0 A; 
#chains in the Genus database with same CATH homology
 3G6E N;  3IKM A;  4O8U A;  1RFQ A;  2V7Z A;  3GOI A;  3CF5 L;  3CC2 N;  4GV9 A;  2CH6 A;  2E88 A;  3H1Q A;  1M1K O;  4E1J A;  5AZJ B;  5C15 A;  5H1S Q;  5M1O A;  1S22 A;  3ULE A;  4BRC A;  4QS8 A;  3E66 A;  3F5T A;  4JNE A;  4JD2 B;  4BRI A;  1HJO A;  3J7Z O;  1BU6 O;  3UB5 A;  3O80 A;  4FWQ A;  3G4S N;  3CJC A;  4EAH D;  1YF5 L;  1NGF A;  3FGU A;  3MN6 A;  1U2V B;  2IVN A;  1TYQ B;  4A61 A;  5C12 A;  3CPW M;  2UYT A;  3VTI A;  5BN8 A;  2WFB A;  2AA4 A;  1E4G T;  3HTV A;  2P9U B;  1KXP A;  3F9M A;  1KQS M;  1KD1 O;  1JCG A;  3DJC A;  3L6Q A;  4FWM A;  4HWI A;  1BO5 O;  2VWB A;  1NGD A;  3CCQ N;  4PHT X;  4RTF D;  3MCP A;  5C0Y A;  2Q97 A;  3M3Z A;  3VTH A;  1NM1 A;  3MK6 A;  5BPL A;  4UY8 O;  3PLA A;  3CI5 A;  1BG3 A;  2A5X A;  4CZI A;  4RCH A;  3VEN A;  3H46 O;  2ASM A;  3C7N A;  4BRQ A;  2Q0R A;  1VQ9 N;  3HOT A;  4WQ4 C;  4BVO A;  3AGK A;  2C1G A;  3EE9 A;  3VEX A;  4NO7 A;  2QM1 A;  4PL7 A;  3I33 A;  5JIC A;  3LM9 A;  1GLA G;  1U6Z A;  2HBK A;  3AAQ A;  2J4R A;  3P38 A;  2YJE A;  1KAY A;  4YOX A;  2V51 B;  4H0Y B;  1EO1 A;  1ZC6 A;  3WQU A;  5KQ8 A;  3CCS N;  3GDQ A;  4B1W B;  1VQ7 N;  3R8E A;  3QBW A;  3ZET A;  1MWM A;  4KBO A;  3A5M C;  3TTD A;  4A2B A;  4F9O A;  4BR7 A;  4XH1 A;  4JKG B;  5AQI A;  4H5R A;  2CGK A;  5HOO A;  1GLL O;  3D2F A;  4FWK A;  2FSN A;  4HTL A;  5AZI B;  4YOU A;  1BOT O;  2NRX A;  3M6G A;  4JEP A;  1ATS A;  3LDN A;  1Q82 O;  4BRE A;  4IOA L;  1LOT B;  3D2E B;  4FWS A;  4GY2 B;  5JLF A;  3CJA A;  3MCA B;  1VQ5 N;  4GV3 A;  4A62 A;  2QW9 A;  2QWL A;  4FOE A;  1HPM A;  1NMD A;  1YIT N;  3O9U A;  2D0P A;  3FFK B;  4B1X B;  4BRD A;  4OO1 J;  3FZH A;  3ULE B;  2ZJR L;  3FZM A;  2NZT A;  5AQT A;  4ISE A;  5M1Q A;  3H45 C;  3D6R A;  3QDK A;  1GLB G;  5AQK A;  5HL7 L;  2QWO A;  1VQ6 N;  1XQS C;  5M1N A;  4EFH A;  2KHO A;  1YXQ A;  5GAG P;  2P9N B;  3QFP A;  1X9J A;  3S41 A;  1Y64 A;  2A42 A;  3EL2 A;  3RSE A;  2YCH A;  3HI0 A;  1SQK A;  2A41 A;  2HBL A;  4B1V A;  3O9Q A;  4BE7 B;  2FF6 A;  1H1V A;  2D0O A;  2KKZ A;  4IO9 L;  3FZF A;  1KC8 O;  1ILY A;  5JLH A;  3MWP A;  5F1X A;  4GVE A;  4B1Y B;  4H5N A;  2QWQ A;  5AQQ A;  1P90 A;  2QWN A;  4U7B A;  2P9S B;  1EQY A;  4FL9 A;  1MDU B;  4FWO A;  5E84 A;  5CHI A;  3DAW A;  4H0X B;  3VMF B;  2QWP A;  4DCH A;  3CCM N;  2P9L A;  4I6M A;  3VES A;  4BRL A;  2ZF5 O;  3OBY A;  3UKR B;  3VPZ A;  4FWL A;  5DM7 L;  2ZGZ A;  1O13 A;  2F9W A;  4CJ7 A;  4CZK A;  3DXM A;  3LDO A;  3W0L A;  4BRN A;  1NWK A;  4MDA A;  1MWK A;  4WF9 L;  3LDP A;  1ATN A;  4PKG A;  3C7N B;  1GLJ O;  2PAV A;  4WFA L;  1T6D A;  3TU5 A;  1BDG A;  3U8X A;  4A59 A;  1YJW N;  4BRF A;  1TUU A;  3VGK A;  3CXC M;  1DKG D;  4YOT A;  2WUS A;  4MLH A;  3OW2 M;  1NGC A;  4BRP A;  5BRH A;  1BWF O;  3U9Z A;  5AFU A;  5GAE P;  1BA0 A;  3DLL L;  2YHW A;  4WQ5 A;  5I9E B;  1K8A O;  1VQL N;  1NGH A;  5CR4 A;  4WYB A;  3ZYY X;  1XUP O;  1Q18 A;  4G9Z A;  1DGK N;  1X3N A;  4A2A A;  4JKF A;  2EWS A;  3CMA N;  1T6C A;  4BGA A;  3I55 N;  4K43 A;  3U9D A;  3ZEU B;  5LJV A;  2RE2 A;  4CZJ A;  1YIJ N;  2YI1 A;  4CBX A;  3EKU A;  4JKB A;  1SS6 A;  3FE1 A;  3A0I X;  5GIN A;  4BR5 A;  1OVY A;  3CCE N;  3O8M A;  1NJI O;  3QB0 A;  3SK3 A;  2E2P A;  2F9T A;  3VET A;  1K9M O;  5GIO A;  3SAG A;  4FWR A;  2P9K A;  2QEX N;  4GV6 A;  4KH4 A;  4Z94 A;  3C0B A;  4JK9 A;  1DT9 A;  4RWT A;  5AQN A;  1T44 A;  4IFE A;  3KK7 A;  2YJF A;  4H0P A;  3WEE B;  2AP1 A;  3BEX A;  2ZGY A;  3LDL A;  2CGL A;  3OHR A;  3P39 A;  3VGM A;  2DPN A;  4ILH A;  2P9P B;  4M7Y A;  2BTF A;  4CI6 A;  4ISF A;  1X3M A;  1XC3 A;  3EE8 A;  4JKH A;  5AQU A;  1ATR A;  3IMX A;  4FOI A;  5LJW A;  5AQX A;  5EXW A;  5M1P A;  1JCF A;  1SAZ A;  3JS6 A;  2VGM A;  3UKU A;  3VF4 A;  5LY3 A;  1N8R O;  2F7T A;  2GEL A;  2E20 A;  3N4Q A;  5AQS A;  4JHD B;  4C1N I;  4MLE A;  2GEM A;  1GLE G;  2P9I A;  3TSQ A;  2QWR A;  1K8K B;  3CJ7 A;  4JKA A;  3FZK A;  4JK7 A;  3UE5 A;  4MDB A;  3FR0 A;  1GLF O;  5EOY A;  4ILG B;  3LL3 A;  3ZX2 A;  3E9P A;  5F0X A;  4LC9 B;  5GIP A;  1YHQ N;  1VQK N;  2I7N A;  1Q81 O;  5AQF A;  1QQM A;  4BGB A;  4BEC A;  2QTD A;  5AQZ A;  2A3Z A;  5EY4 A;  2FF3 B;  3HSC A;  3MDQ A;  3R3L A;  3TTC A;  1BA1 A;  3A8Y A;  3R6M A;  1K73 O;  1QZ5 A;  3VF6 A;  4CZF A;  3E9L A;  3GE1 A;  3U4L A;  2FSK A;  5BPN A;  3L4I A;  4XH4 A;  2OAN A;  5C2F A;  4BEB A;  2HOE A;  3BF1 A;  4K41 A;  3HRG A;  2W00 A;  3MMV A;  4IZ9 A;  5AZJ A;  3I56 N;  4OPH A;  1HKG A;  3O4W A;  1NGE A;  3NMU A;  4M7X A;  3GL1 A;  1NLV A;  3MN7 A;  4FWP A;  4JD2 A;  4XJX A;  2E1Z A;  5AQH A;  5AQL A;  4BC3 A;  3SBG A;  5BRD A;  4H5T A;  3O9T A;  1YJ9 N;  3QBX A;  2JWK A;  4CBU A;  4DB3 A;  3SJH A;  4J8F A;  2CH5 A;  1U2V A;  3AGR A;  1TYQ A;  5BN9 A;  1P8Z A;  4BQZ A;  4BC5 A;  4CZG A;  3VEO A;  3CJ9 A;  2V52 B;  2KLA A;  5BPM A;  1IG8 A;  2P9U A;  3WXI A;  5FPN A;  2Q2R A;  2P9K B;  3ATV A;  3EN9 A;  3M5R A;  3CIP A;  3J8A A;  5AFU H;  5AQW A;  3A5N C;  3VEW A;  3O1W A;  1NGI A;  4CD3 A;  4PL8 A;  4AF1 A;  5TKW A;  3WXK A;  5M1F A;  2GWJ A;  1NGJ A;  4IWV A;  3RVC A;  4R79 A;  2D1K A;  3TTF A;  5AQP A;  5C10 A;  5JVH L;  1W97 L;  3G71 N;  1YVN A;  4H5V A;  4KH5 A;  2PBD A;  4BQL A;  3SAF A;  3LDQ A;  2FSJ A;  2OTL N;  3SMS A;  2YHX A;  5F2R A;  2E8A A;  3SLC A;  3O08 A;  5DM6 L;  2PFU A;  4BY9 C;  3HBT A;  3CER A;  2ASP A;  3JXU A;  4YOW A;  3FZL A;  3UKU B;  2NNW A;  2A6A A;  4NLB A;  4IEE A;  3QML A;  3G25 A;  3A5O C;  3EO3 A;  1G99 A;  5BRF A;  2A40 A;  2WBN A;  1RDU A;  3M1F A;  4Y0W A;  2RHK A;  3I8B A;  2V7Y A;  5AQR A;  4JK8 A;  3ZET B;  4EIA A;  4WQ4 A;  3OBW A;  2GUP A;  4JKG A;  4B1U B;  2CGJ A;  5AQM A;  5KPR A;  5ADX A;  1SZ2 A;  2OTJ N;  3K9J A;  5JMV A;  5AZI A;  4BRK A;  3VEZ A;  1DEJ A;  3D7E O;  4AM7 A;  3CCV N;  3D2F B;  3O5B A;  3KWG A;  3QFU A;  4QS7 A;  3D2E A;  2YHY A;  4H0V B;  1ZBS A;  2D4W A;  3ATU A;  3BF3 A;  3PIP L;  1QHA A;  4BVP A;  3H3O B;  4DQ8 A;  3ENB A;  3Q7C A;  1OKJ A;  3CCU N;  4YOR A;  2HBM A;  1ZXO A;  4GNI A;  3P4I A;  1NBW A;  2ASO A;  3F2K A;  2QWM A;  1D4X A;  2VYP A;  5KPT A;  2NRR A;  1WUA A;  3CCJ N;  3WT0 A;  3DXK A;  4C1N K;  1E4F T;  3KHY A;  5KPZ A;  1QVG M;  1VQM N;  4BR2 A;  3VF2 A;  1HUX A;  1Q7Y O;  3MN5 A;  1M90 O;  3NVK A;  4QS9 A;  4K25 A;  2P9N A;  2Q0U A;  2HF3 A;  4L3Q A;  5B8H A;  2IIR A;  3BP8 A;  2FLO A;  1KAX A;  3OA9 A;  3IDH A;  5AR0 A;  1S3X A;  1R59 O;  4JKD A;  2ZJP L;  2QI2 A;  3MN9 A;  2Q36 A;  3IFR A;  1BUP A;  1J6Z A;  2ZJQ L;  3RSE B;  2Q31 A;  1MA9 B;  4PKH A;  2Q1N A;  2IVO A;  3NVM A;  4A57 A;  1T3V A;  2W41 A;  3ZX0 A;  4FPA A;  4YDU C;  4BR9 A;  4DKW A;  3W3D A;  4CZH A;  4BC2 A;  5E26 A;  5FPE A;  2E2O A;  4CZL A;  4FPB A;  4IJN A;  3E9O A;  2P9S A;  1GLD G;  3A5L C;  2C1I A;  1V4T A;  1JCE A;  4ILJ A;  2WC9 A;  4FSV A;  4WFB L;  4JN4 A;  5AQO A;  3MX2 A;  3O1B A;  4IEI A;  4BRG A;  5BR9 A;  1VQP N;  1IJJ A;  3ENH A;  3AAP A;  1HX1 A;  3UKR A;  4AM6 A;  1GLC G;  2P9L B;  1C0F A;  1NGB A;  4I6M B;  4BRA A;  3CME N;  5AQG A;  4CZE A;  5KQD A;  4WQ5 C;  2VCP A;  3TPQ A;  2GTD A;  3K9K A;  3DXM B;  2IVP A;  4OPA A;  3CQX A;  2E1Y A;  1C0G A;  4NB4 A;  4CZM A;  4B1Z A;  2E2N A;  5MLC Q;  4IO8 A;  4JAX A;  5AQY A;  3CC4 N;  3CJ1 A;  1VAZ A;  3L4Q A;  4EHT A;  1QQN A;  3CJB A;  3GG4 A;  5BRE A;  1S72 N;  4XEI A;  1Z6R A;  1HLU A;  3ZX3 A;  4JKC A;  1YUW A;  3B8A X;  3GBT A;  3WUH A;  5CE3 A;  2GWK A;  3VEV A;  1YI2 N;  5M1K A;  1W2B M;  5AQV A;  4BG9 A;  1VQ8 N;  2NRW A;  1CZA N;  2BH1 A;  3FLC O;  5TKY A;  3O6W A;  1ESV A;  4MO4 A;  3SMP A;  3H1V X;  3AAR A;  3HM8 A;  5EVZ A;  3Q7B A;  3ZEU A;  2VGN A;  5FPD A;  1QVF M;  1NGG A;  2HF4 A;  3ID8 A;  2QA4 N;  3ENO A;  3H6E A;  4K42 A;  5FPM A;  1YJN N;  2NRT A;  2HST A;  3O9S A;  3VOV A;  4C23 A;  4WFN L;  3CET A;  4O8K A;  3H3N O;  3WXL A;  2E2Q A;  4IDH A;  1KAZ A;  2FXU A;  4ISG A;  3TSP A;  1TUY A;  3TSU A;  4A5B A;  4H5W A;  4JKE A;  5GAD P;  4H03 B;  1VQO N;  2I7P A;  2NLX A;  4O5F A;  3R9P A;  2NRH A;  3HZ6 A;  3L0Q A;  3CHW A;  2ZWH A;  4BRO A;  3PIO L;  3C6A A;  4H0T B;  5GAH P;  3WEE A;  1JJ2 M;  3DXK B;  4BG8 A;  5EX5 A;  3WXJ A;  3KVG A;  3AY9 A;  1HKB A;  1NGA A;  1Q86 O;  3VGL A;  3T7Z A;  4WCE L;  4H0O A;  4CD1 A;  3CQY A;  2GX9 A;  5ADX H;  3CD6 N;  3VER A;  2P9P A;  4U67 L;  3SAH A;  2JWL A;  1QQO A;  2W40 A;  1WOQ A;  3C6H A;  4IJA A;  4BC4 A;  3IUC A;  4CBW A;  1VQN N;  3O9R A;  4IOX A;  3QIC A;  3CCL N;  2ITM A;  3N4P A;  3LM2 A;  1V4S A;  3WQT A;  4B9Q A;  1HKC A;  3C65 A;  4JHD A;  1Z05 A;  4XH5 A;  4YOV A;  4IXC A;  3P31 A;  3R1X A;  3HOS A;  5JVG L;  1K8K A;  2H3G X;  2HMP A;  2NRZ A;  4FVU A;  2P9I B;  4BRM A;  3CCR N;  3CC7 N;  2NRV A;  4PKI A;  5ELZ A;  3ID6 A;  4YDU A;  4A5A A;  3CPE A;  4KH6 A;  3KWI A;  3SBT A;  4DHY A;  3T69 A;  2QXL A;  3MX5 A;  5C2D A;  3DWL A;  3BUZ B;  2YX6 A;  4MO5 A;  5AQJ A;  4BR0 A;  1VQ4 N;  4M63 C;  4FWN A;  1YAG A;  3KZB A;  2BUP A;  1RGI A;  1LCU A;  4BR4 A;  1RDW X;  3EZW A;  4NLC A;  4YOY A;  3EKS A;  3MWT A;  4EHU A;  3E1Y A;  3VEY A;  4FO0 A;  4IOC L;  4BRH A;  1QZ6 A;  3WXM B;  2HBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...