1YVNA

The yeast actin val 159 asn mutant complex with human gelsolin segment 1.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
372
structure length
372
Chain Sequence
EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGNTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ACTIN)
publication title Crystal structure of yeast actin V159N mutant
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 114
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 1999-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1yvnA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yvnA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yvnA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1yvnA04
2YJEA 5FPNA 5JICA 5KQ8A 1D4XA 2YJFA 4I6MB 1RFQA 5F1XA 5AQTA 4ISGA 4BQLA 4CBXA 3LDOA 3IFRA 2HF4A 4PKIA 1G99A 4HTLA 2P9UB 3VERA 3AAQA 3ULEA 2QWMA 2J4RA 3WQUA 3MDQA 2Q31A 3G25A 4WQ5A 3FZHA 2YHWA 5AQOA 5BPLA 2UYTA 2Q2RA 3TPQA 4CZJA 1HUXA 5I9EB 4CBWA 2P9PB 1NM1A 3CQYA 3H1QA 4CJ7A 3ID8A 2QM1A 1J6ZA 4BRLA 2QWQA 4BRDA 3VOVA 3U9DA 3FFKB 1IG8A 2DPNA 2F9TA 2P9KB 1NBWA 3ZETA 3QFUA 3C7NB 1X9JA 4LC9B 3SLCA 1Y64A 4FWOA 2YI1A 4H5VA 5BRDA 1LOTB 1TYQA 1ESVA 2NLXA 2E8AA 5AQQA 3R8EA 4RTFD 5LY3A 5AQXA 4BR0A 2IIRA 2A40A 5AQZA 1ATRA 5BR9A 1BA0A 5JLHA 4PL8A 4A2BA 5ADXH 1HX1A 4BREA 5JMVA 4CZHA 3GE1A 1MDUB 3ATVA 2A6AA 2YHXA 4B1WB 5ELZA 5AQLA 2FF3B 4BC5A 4FOEA 4BR4A 3RSEA 4CD3A 4CZLA 4GY2B 3CJAA 4CZKA 2HF3A 3R6MA 5EVZA 2E88A 5AZIB 5AQVA 4BRGA 2E2OA 3CJ1A 3CETA 4IXCA 1NGJA 3S41A 1S22A 4FWPA 5EXWA 4BC2A 1JCGA 5AQIA 3VF6A 1Z6RA 3W0LA 2GTDA 2OANA 3EO3A 4CBUA 1RGIA 3EN9A 1QQOA 5AQSA 1IJJA 4H5RA 1NMDA 5AQKA 2E20A 3WUHA 2D0PA 3IDHA 2PBDA 1NGDA 4XH1A 2P9IB 3GOIA 5BN8A 4BG8A 3U4LA 3A5NC 3U8XA 3ZETB 4CZFA 1NLVA 2P9PA 1GLEG 1GLCG 1QQMA 2IVNA 4K43A 4BRAA 2P9NA 4QS7A 1ZBSA 2I7NA 3VESA 4BRFA 2F9WA 2IVPA 2ZWHA 1TYQB 1YUWA 1GLFO 2P9KA 1QHAA 3H45C 2E2NA 3C7NA 3JXUA 5BPNA 2FSKA 3ZEUB 4MLHA 1NGBA 4FOIA 3BUZB 2W41A 4EHTA 1HKCA 3CJCA 1NGGA 1DEJA 4IJNA 1NGHA 5ADXA 4GNIA 1GLAG 4WYBA 3D7EO 3FE1A 4BGAA 4BRNA 4FWSA 2CGJA 1T6DA 4E1JA 3L4IA 2ASMA 3L0QA 3UKRA 4H0TB 4B9QA 1BA1A 3MK6A 1WUAA 1BO5O 4QS8A 2EWSA 2BTFA 3HM8A 4BRCA 5FPDA 5KPRA 3TU5A 4H03B 1BUPA 5AQRA 2VCPA 4A61A 5E26A 5AZJA 2GUPA 1GLLO 3VF2A 2AP1A 1WOQA 1GLDG 5AZIA 3BF3A 4YDUC 1NGEA 2FLOA 3D2EB 5KPTA 3FLCO 3I8BA 3VETA 5JLFA 1NGIA 3A5MC 1GLJO 3WT0A 3WQTA 1OKJA 4PKGA 2E2QA 3ZX3A 1YVNA 1XQSC 1SAZA 2E1YA 5BRHA 2P9NB 3UKUB 1Q18A 3A0IX 4H0OA 4BRHA 3VEOA 2CH6A 3F9MA 2P9IA 4H5TA 5TKYA 2ZGYA 1ATNA 4IO8A 3WXLA 4AM6A 1BDGA 2Q36A 4FO0A 3WXJA 2GWKA 5LJVA 3FZMA 4BC4A 3HBTA 5AQYA 3LDPA 2E1ZA 4JHDB 4KBOA 2Q0RA 3FZFA 3VEXA 4EAHD 4O5FA 2GWJA 3W3DA 4Z94A 3ZEUA 5AQMA 1JCEA 3FR0A 4B1YB 2D1KA 3UB5A 4A62A 4BROA 5KPZA 2WUSA 3LL3A 1E4FT 3LDNA 1KAZA 2AA4A 3O5BA 3UKRB 2HMPA 2GELA 3HTVA 1YAGA 2FF6A 4QS9A 1JCFA 3HZ6A 3DXKB 3P4IA 4FL9A 4FPBA 3ZX2A 4MO5A 4CZGA 1HKGA 4ISFA 3UE5A 4H5WA 4DCHA 4PL7A 3CJBA 3H3OB 1X3MA 5AZJB 4ISEA 3CIPA 4BVOA 1TUUA 1BOTO 5EY4A 4FWRA 2A41A 4A2AA 3GBTA 4M63C 3MN7A 2PAVA 3O6WA 5BN9A 1BWFO 1ZC6A 2Q97A 1Z05A 3AY9A 1TUYA 3VGMA 3H3NO 3IUCA 3SJHA 3VGLA 5BREA 1BG3A 4B1VA 3D2EA 4FPAA 4XH4A 2KHOA 2V52B 3SMPA 3KHYA 2FXUA 3EKUA 4HWIA 1BU6O 3BEXA 4JNEA 2CGLA 4JD2A 4CZMA 4WQ4C 1SQKA 1MWMA 3VEYA 3R9PA 1T6CA 3UKUA 4H5NA 3VEZA 4BRIA 1NWKA 5AFUH 4H0VB 4PKHA 3CI5A 1HJOA 1SZ2A 3AAPA 2ASPA 1KAXA 2GEMA 4JHDA 4Y0WA 5F0XA 2QWOA 1KAYA 4K41A 2ZGZA 3O1BA 3WXKA 4BRKA 3I33A 3VEWA 2ZF5O 1MWKA 4JN4A 2A3ZA 3M1FA 4DB3A 3O08A 3JS6A 3ZX0A 3VENA 4FWQA 4WQ5C 4BQZA 2YHYA 3AARA 1HLUA 4B1UB 1LCUA 1NGFA 3DXKA 3VPZA 1U2VB 5AR0A 4FSVA 2V51B 5AQPA 3C0BA 3LM9A 1QQNA 4M7XA 2P9SB 3DXMA 4FWMA 4EHUA 2BUPA 3MCPA 4F9OA 3WEEA 3L6QA 4CZIA 4MLEA 5EX5A 1P8ZA 3HI0A 1C0GA 3FGUA 2P9LB 1EQYA 4IWVA 4EFHA 3ENHA 3J8AA 1H1VA 4JD2B 1NGCA 4J8FA 2QWPA 4BG9A 1U6ZA 4FWLA 4JAXA 2W40A 4IZ9A 3KVGA 3VGKA 3M6GA 3O4WA 1K8KA 4EIAA 1XUPO 5AQFA 3QBXA 5AFUA 4H0YB 3SMSA 3VEVA 1XC3A 3A5LC 3GL1A 3A8YA 4CI6A 2D4WA 4BVPA 3O8MA 1HKBA 2QWNA 1E4GT 3IMXA 4YDUA 4H0XB 2NZTA 4BR2A 4FWNA 3CERA 3CJ7A 3ENOA 3DAWA 3CHWA 4BRQA 3EZWA 3B8AX 3SK3A 3BF1A 1YXQA 5FPMA 4NB4A 1QZ5A 3DXMB 1V4SA 3A5OC 3D2FB 3WEEB 3KZBA 3DJCA 1ATSA 4O8KA 3H46O 1U2VA 4L3QA 2QW9A 4BRMA 2P9SA 5AQNA 4IJAA 1R59O 4B1XB 1ZXOA 2QWLA 1T44A 5LJWA 2HOEA 4MO4A 5B8HA 3WXIA 5F2RA 4M7YA 3MMVA 3CJ9A 4XEIA 1HPMA 3O80A 3CQXA 3QDKA 3MN9A 2ASOA 4CZEA 2P9LA 2Q0UA 5AQUA 3ULEB 4I6MA 1K8KB 5E84A 4BR9A 3VF4A 1DGKN 3ATUA 2IVOA 2CH5A 3EL2A 3MN5A 3QBWA 4BR5A 1RDWX 3GDQA 2Q1NA 4NO7A 4H0PA 1GLBG 2P9UA 4BR7A 1NGAA 2FSJA 1CZAN 3QB0A 1QZ6A 1DKGD 2I7PA 2FSNA 3H6EA 4K25A 3QICA 5AQHA 3H1VX 3QFPA 4RCHA 5KQDA 2V7YA 3GG4A 5CE3A 1X3NA 3LDQA 1V4TA 2H3GX 2NRHA 4BGBA 3DWLA 3QMLA 4CD1A 3O1WA 5AQGA 2D0OA 4XH5A 3EKSA 4DHYA 4B1ZA 1S3XA 2E2PA 4BRPA 4K42A 3BP8A 3OHRA 2QWRA 2CGKA 3FZKA 3FZLA 3HSCA 3U9ZA 5FPEA 4C23A 3MN6A 4BC3A 5AQWA 4FWKA 2A5XA 4RWTA 2A42A 5BRFA 1C0FA 1MA9B 3LDLA 3M3ZA 4WQ4A 2V7ZA 5AQJA 2VYPA 3D2FA 4DQ8A 3LM2A 2YCHA 5EOYA 5BPMA 1KXPA 3RSEB 4AM7A 2VWBA 2ITMA 2QXLA
chains in the Genus database with same CATH superfamily
2YJEA 4OKJA 3ID6A 3CCVN 2QEXN 3VQQA 4B9MA 4I6MB 4IDHA 5AQTA 1VK0A 3TTFA 4HVJA 1TKXA 4JS5A 3LDOA 2HF4A 4PKIA 3OYIA 3VERA 4DWIA 3OYFA 3LALA 5AQOA 2HHWA 3KKRA 2D0BA 1VQ8N 2G8KA 1N32K 3NGYA 2P9PB 4CEAA 3H1QA 3RR8A 2QM1A 3OYEA 2QWQA 3FFKB 4CJWA 2DPNA 2HVIA 5C24A 3QFUA 1X9JA 1EETA 4M3ZA 3U3GA 1N6QA 3SCXA 3PSIA 4BE0A 1TYQA 1WB9A 3KLIA 3L2RA 2QK9A 5AQZA 5BR9A 4CHNA 1K73O 4PL8A 4A2BA 5M1PA 3TAMA 2YHXA 5ELZA 2FF3B 3T3FA 1JLEA 4BR4A 1REVA 4LFCK 1JXBA 1KRPA 4FLYA 1N5YA 5M1QA 4DR1K 3R6MA 5SZTA 5EVZA 3K0SA 2E88A 4FJGA 2E2OA 3WXMB 3CETA 4X62K 1RBVA 4BEBA 2GTDA 1NJYA 5FRNA 2WC9A 2UUCK 5AQSA 3AA4A 3JAMO 3VQDA 3KD5E 2KFZA 1RBTA 4IOXA 4GW6A 3IDHA 2BE2A 4DV3K 1NOZA 4WFAL 5FDLA 4BG8A 3U8XA 4CEOA 2P9PA 5GAGP 2P9NA 1ZBSA 2ZWHA 3NFAA 1GLFO 1QHAA 3H45C 3SPZA 1IKWA 4PA1A 2GBZA 2YNGA 1HQEA 3AO3A 4HTUA 4IJNA 3NHGA 1WLJA 3TSQA 3QLHA 4GNIA 1GLAG 1O1WA 4OLBA 2PYLA 3VTHA 3D7EO 3FE1A 3OBYA 3L4IA 3L0QA 3ASMA 3B6PA 3TABA 1NK7A 5HOOA 1VHXA 1BA1A 2WONA 2NNWA 2YX6A 2IOCA 3HM8A 5KPRA 3V1RA 1BUPA 4RW9A 4DR3K 5C10A 5GIPA 2F8TA 2GUPA 4Y1DA 4C8NA 3VF2A 3HL8A 3BF3A 4YDUC 4C1NK 2FLOA 1T8EA 3O4NA 2LSNA 3K9KA 4O4GA 4NCBA 2O8FB 1HYVA 3VN5A 1NGIA 5JENA 3AVFA 1VSIA 1TAQA 1WNSA 3WQTA 2E2QA 1IV0A 3DLEA 1U4BA 1S1XA 1YVNA 1KFSA 2HMIA 3OYJA 3A0IX 5M1FA 4DTJA 4KHUA 2QI2A 4CIFA 4O0IA 2GWKA 3T1HK 4CIEA 4KBOA 2Q0RA 2C1IA 4DG1A 5DMRA 3AVLA 4Z94A 2D1KA 3UB5A 3CCUN 4BROA 5IWAK 1W2BM 3LDNA 4BDPA 3G10A 2AA4A 1MU2A 3O5BA 4IEIA 3UKRB 3SUNA 1L3SA 4Z4EA 2GELA 1Q8IA 3LP1A 1YAGA 2FF6A 4HCCA 1JCFA 1WSIA 3HZ6A 5CY4A 1L3VA 4FPBA 3PO5A 1S6QA 2W00A 4FJXA 1SV5A 4DTPA 4MO5A 4CZGA 4DSKA 4CVNE 4PL7A 3H3OB 3O9SA 3OS2A 1O13A 3B6OA 5EY4A 1ASUA 3SQ0A 4NYNA 2VGNA 1ZC6A 2Q97A 1Z05A 1TK8A 2GUIA 1NJZA 4CFAA 1BG3A 4B1VA 4JI2K 2KTQA 3LWLA 4LF5K 1FKOA 1S9EA 3NF6A 3L2WA 4FM0A 3ENBA 4FJNA 4YOWA 5M1NA 4YOTA 3THYB 2Y1JA 4FZXC 2P5GA 3ISNC 4DFJA 1YJWN 2OZSA 4V19S 4F4KA 1NWKA 5AFUH 4H0VB 1QVFM 4PKHA 4R5PA 3AAPA 1KAXA 4QCLA 3KLGA 4ID1A 3P39A 2PYJA 1N36K 3DLBA 3SV3A 1N33K 4JN4A 3M1FA 4AH9A 4KTQA 4AQYK 4CJRA 4FWQA 4BQZA 2YHYA 3J80O 1HLUA 5CHIA 4B1UB 3MXMA 4CJ4A 3ALYA 1U2VB 2WBNA 4FSVA 1CLQA 4OO1J 4JKCA 3AO2A 4E7KA 1QQNA 4M7XA 4B3OA 3HT3A 4HHTA 4RW6A 3SQ4A 3OS1A 2YNHA 1T3VA 1X9WA 5DM6L 4CK1A 2NRVA 4F3TA 3HI0A 1EQYA 4IWVA 3THXB 3NGIA 3CXCM 2QWPA 2OTLN 3I8DA 1U6ZA 3TAQA 4IZ9A 3C6TA 1IBKK 4N76A 3ZSYA 1U47A 1QHTA 2FBYA 2O8CB 1K8KA 4Y1CA 3CCEN 2ZD1A 3KK7A 1HPZA 2BGGA 3GL1A 3CC4N 5HRRA 4C8OA 2ZM6K 1XNQK 3SUOA 2D4WA 2QWNA 1XMOK 2XY5A 2G8IA 3IMXA 4YDUA 1HYSA 1HMVA 1BIZA 3CCQN 5J2MA 3B8AX 4KHNA 2O4IA 3J7ZO 3PIOL 4YOVA 2W6LA 1YXQA 5FPMA 4DF4A 4NB4A 3DXMB 2RHKA 2HBJA 5HBMA 3WEEB 2ZJPL 3DJCA 1U2VA 4L3QA 4B9NA 1F21A 4CJKA 1TKZA 4BRMA 1IBMK 1LWEA 1QVGM 4IJAA 1LWCA 4B1XB 3ZT3A 1ZXOA 1T44A 4KPYA 4JI5K 3WXIA 4XEIA 1TL3A 4E3SA 5M1OA 5HRPA 2F96A 4M3UA 2Q0UA 4CEBA 1BHLA 3THXA 3BZCA 4BR9A 1IKVA 4DTUA 3LP3A 3AVHA 1DGKN 3ATUA 2OPSA 1NNEA 1TK0A 1RDWX 3AA3A 2Q1NA 2P9UA 5A2QO 2BDPA 2OA8A 2FSJA 1CZAN 4XJXA 2O8CA 1QZ6A 1DKGD 1XHZA 2FSNA 4WFNL 1Q7YO 3QFPA 1NMNA 2XY8A 2HSTA 4I2PA 5CE3A 3LDQA 3ZSRA 3VTIA 2H3GX 3PX4A 1VRUA 3T19A 2D0OA 5AQGA 3L8BA 4JI3K 1XWLA 3MX2A 2FBVA 2E2PA 3DMJA 1UA1A 3ZT2A 1RBUA 3MEEA 5C15A 4DR5K 1VSEA 3U9ZA 3O9RA 4DFKA 4CK3A 3MN6A 4BC3A 4DSFA 1XNRK 4DV1K 3AVCA 1TV6A 4OPKA 3JYTA 2A42A 3O3FA 2W42A 3TTDA 1QSSA 1MA9B 3LDLA 3LM2A 1YIJN 4JK8A 2KZMA 1ILYA 5EOYA 5BPMA 4AM7A 2VWBA 2ITMA 3MCAB 3SI6A 3RMDA 4OVLA 3THWB 3FFIA 4CJEA 4ID5A 4OLAA 1RFQA 4Z4HA 1SKRA 5E41A 1JLCA 4YY3K 1NK8A 4CBXA 3ZT1A 3E9OA 4DTNA 1QE1A 1UAXA 3QNOA 3MDQA 5SWMA 3Q7BA 2YHWA 2WOMA 4DSIA 3TPQA 4OPHA 1VQON 1HUXA 5I9EB 3KLHA 3OYHA 4KTZA 1NM1A 4JKGB 3CQYA 4CJ7A 1J6ZA 2VWKA 5HP1A 2F9TA 2P9KB 4DKWA 3ZETA 4JRPA 3C7NB 3SQ2A 3KK1A 3T1AA 4JKFA 3H08A 1OH6A 2YI1A 2WTUA 4H5VA 4JI4K 1ESVA 2NLXA 2E8AA 5AQQA 3J7AP 3R8EA 2BANA 3RRHA 4RTFD 4GKJK 2FBTA 5CZ2A 2A40A 1ATRA 4CJUA 2GX9A 4CEFA 1HX1A 3DRSA 4BREA 5JMVA 1JL2A 1NKCA 4CZHA 4HCBA 4Q0BA 3TSUA 5AQLA 4BC5A 4FOEA 2HBMA 4WE1A 4CD3A 2VWJA 4GY2B 4OKKA 2HF3A 4DUYK 3SUQA 3CCLN 2OPRA 1FK9A 3CD6N 3NMUA 1VSFA 2BH1A 4IXCA 3ZSXA 4Z4IA 3I0SA 4BC2A 2IC3A 2X6NA 3VF6A 1Z6RA 2KLAA 4CBUA 3G4SN 1B92A 1RGIA 5BR8K 4H5RA 4FLTA 1JLQA 1NMDA 2RKIA 2E6LA 3OYLA 1KTQA 2PBDA 4XH1A 3GOIA 3K9JA 2YHAA 5BN8A 4DU4A 4JKGA 1QQMA 4BRAA 1WAFA 2I7NA 3DLLL 2F9WA 2IVPA 3VQEA 1TYQB 3PY8A 4FJHA 1YUWA 2P9KA 4CW7B 5BPNA 3C7NA 5KGWA 2FSKA 4MLHA 4KO0A 1NGGA 1NGHA 5ADXA 3TSPA 1TGOA 1SS6A 3KK2A 3LP0A 4CF1A 1KLMA 1S1TA 4FWSA 4YORA 4E89A 1W7AA 3NVKA 4N5SA 4B3RK 4H0TB 4B9QA 5FRMA 4LY7A 2ETJA 1D5AA 2EWSA 2XY7A 2A1RA 4BRCA 4CE9A 4H03B 4JKDA 3RRGA 5LL6Z 1LWFA 4DTMA 5AQRA 2B4JA 4CCHA 2AP1A 4A5AA 4YNQA 3TARA 3C65A 3NF8A 1YI2N 1VQLN 5KPTA 3FLCO 4F3OA 1WSJA 3VETA 3A5MC 3G0ZA 4C8LA 4KKOA 1N34K 3LPTA 4FLVA 4JI6K 3WT0A 5C2DA 2UUBK 5CYMA 1OKJA 3AVBA 4JLHA 4AF1A 1L3UA 4KHWA 1QQCA 4CK2A 2P9NB 4FW2A 4H0OA 1ITGA 4JKHA 3F9MA 4H5TA 2ZGYA 4AM6A 4CJVA 2O8BB 3HPGA 1YF5L 4LH4A 3FZMA 4QAGA 4DSLA 3LDPA 4W5NA 1IKYA 1C1CA 4E7LA 3WNHA 1S9GA 1WSGA 4GKKK 3RMBA 1K6YA 4CEEA 3O3HA 1ZYQA 4Z0UA 5HL7L 4H8KA 3HTVA 4KH6A 4QS9A 3DLHA 1I39A 4DQSA 4EZ6A 4DV7K 3DXKB 3LANA 3OYCA 1HKGA 4ISFA 4H5WA 4KTWA 3CJBA 3LWMA 3P1GA 2KZZA 3KK3A 1NJWA 5GADP 2HHTA 3BY5A 5GAHP 4A2AA 3O6WA 1X9MA 1BWFO 1C1BA 1VSLA 3AY9A 3VGMA 1WSHA 3NH0A 3S9HA 3H3NO 3ZCMA 4FPAA 3BGRA 3LZIA 1NKEA 4EP4A 3QEWA 2Z1IA 2IGIA 4HWIA 4JNEA 5FROA 4JD2A 4F2RA 4KV8A 1SQKA 3R9PA 3IG1A 1C0TA 3VEZA 3OJUA 3BZKA 2O8BA 1S1UA 1TKTA 5GAEP 3D45A 1A5XA 3NGZA 3OYDA 4WFBL 2P5OA 4W5OA 2QWOA 2NRXA 1KAYA 1RDAA 4CGGA 2ZGZA 3WXKA 1VAZA 3C6UA 3S3OA 1MWKA 3ZT4A 1KVCA 4HUEA 3JS6A 3VENA 1YJ9N 4WQ5C 3MWTA 2DY4A 3SQ1A 3P31A 2XY6A 4E7IA 1BL3A 3DXKA 3VPZA 2KFNA 5AR0A 4B3SK 2P9SB 4ICLA 2BUPA 5FLXO 1C0UA 1ZBIA 3L6QA 4LF9K 5TKWA 4RW4A 4YOUA 1OVYA 4UQGA 3OJSA 1ZBFA 1P8ZA 1YTUA 3V4IA 2QKKA 3NVMA 4CJ3A 5DM7L 1SKWA 3L3UA 1A5WA 4FWLA 3CCRN 2W40A 3RMCA 2YHBA 3M6GA 4E1NA 1FXXA 4N47A 2X6SA 2XHBA 4CJPA 3RR7A 1NU0A 3UIQA 3A5LC 1BISA 5J2QA 4FCYA 1WSFA 4KREA 4KFBA 3O8MA 4IG0A 4KHQA 4G9ZA 1HKBA 3ULDA 3K5NA 4DLGA 2E4LA 3R3LA 2Y1IA 4BACA 3CFOA 4JK9A 4HUFA 1LAVA 4FWNA 3ENOA 2E6MA 1RT3A 1SUQA 4BRQA 3EZWA 4H4MA 3SK3A 3O4QA 1ZBHA 3CYMA 5KRTA 4BECA 3AVMA 3L2VA 1ZBUA 1RTDA 4IOCL 1NK6A 1YT3A 1V4SA 3HSTB 3H46O 1GOAA 3SAGA 3OYKA 2G8UA 2P9SA 1R0AA 4BDZA 3OBWA 3MEDA 1QSLA 1R59O 2QWLA 5LJWA 2HOEA 1L3TA 4K8ZA 3CJ9A 4AHCA 3DLGA 4FLWA 3CQXA 3VQPA 3OW2M 2ASOA 1RCHA 3KLFA 2KQ2A 1RDCA 1K8KB 3RVCA 4AHRA 1LW2A 4IO9L 2IVOA 2CH5A 2UXCK 3MN5A 4J2DA 4FJ9A 2R7YA 4H0PA 3NE6A 1DLOA 4U7BA 4A57A 3QB0A 3I56N 1DTQA 2VG6A 4K25A 4OGCA 5AQHA 3KWGA 1C0MA 2VG5A 3QIPA 1JXEA 1V4TA 4B8AB 4LSNA 4LSLA 4RW8A 4DHYA 3CPWM 1UOCA 4B1ZA 1S3XA 1RTIA 4K42A 3K5LA 4DTXA 2CGKA 3CG7A 3HSCA 3F73A 4EP5A 3V9XA 2X78A 4GV6A 5AQWA 1KFDA 2A5XA 4FWKA 4DSEA 2NRWA 3PIPL 4DR6K 3EEQA 4B8CA 3EZ5A 2V7ZA 2ZJQL 1VQ9N 4DQ8A 3QETA 1J5OA 3MXJA 3SV4A 4DU3A 1OH8A 3RSEB 1CXUA 2QXLA 3HVRA 1Z26A 1BQNA 1JLBA 4YOYA 4NXMK 5JICA 1U48A 4M3TA 4CEZA 5KQ8A 2YJFA 1KCFA 4ELTA 1RNHA 5F1XA 3TR8A 1BQMA 4BQLA 1S5JA 2VGMA 1SKSA 4HUGA 3P83D 1T7PA 2P9UB 3CQ8A 2QWMA 4K0KK 3WQUA 1W0HA 2HBLA 4WQ5A 3FZHA 2JGUA 2EHGA 4DV0K 2Q2RA 4CZJA 3OS0A 2HHSA 4BY9C 2O8EB 4J2BA 3PX6A 5KI6A 3DM2A 3ID8A 2IAJA 1WSEA 2RE2A 4BRLA 4BRDA 2YKMA 1JL1A 3HVTA 4LC9B 2FBXA 4W5QA 3SLCA 3ITHA 3NH1A 1Y64A 4GVMA 1LOTB 5LY3A 3M8PA 3VQ4A 4FJ5A 5AJ3K 1BA0A 1JLGA 5JLHA 3V9SA 3S5TA 4QOZB 3C94A 3O3GA 4CHOA 2Z1HA 1B9FA 1ZBLA 5D3GA 3TTCA 3DYAA 1I94K 4CJQA 3RSEA 2RN2A 1QS4A 4DF8A 4F8RA 2JLEA 1VSJA 4KHPK 5HLFA 1VQPN 4CGHA 3CJ1A 4FYDA 3QESA 1S22A 4FWPA 1JCGA 5AQIA 3C6AA 3MX5A 3W0LA 3ZSZA 2OANA 3EO3A 3EN9A 3QIOA 1KC8O 4BE2A 3L2QA 4CF2A 1IJJA 5AQKA 4FJ7A 3WUHA 4CHQA 4FK0A 3U4LA 3AA5X 2O8EA 3ZETB 1RT5A 2B5JA 2EX3A 3CC7N 1TAUA 1NLVA 1GLEG 1GLCG 2IVNA 1TL1A 4K43A 2PY5A 3VESA 3QERA 3NAEA 3CFPA 4CHYA 2E2NA 3JXUA 4MFBA 3K57A 3Q7CA 4FOIA 3A2FA 1RDDA 2W41A 1HKCA 3VQ5A 2HHUA 3CJCA 4MDAA 1UA0A 4DQPA 1HQUA 4BWMA 4CERA 4WYBA 4BGAA 3DLRA 4BRNA 2UU9K 2CGJA 1T6DA 4E1JA 3CC2N 2ASMA 3M8RA 4GMJB 4N56A 2E5LK 4NCAA 4KHYA 2RPIA 1D8YA 1WUAA 1X1PA 1ASWA 1RBSA 5FPDA 4OPAA 3PLAA 4XIUA 1IBLK 5AZJA 4FZZA 1GLLO 2UUAK 4DSJA 4KB1A 1A5VA 1KD1O 3I8BA 3F9KA 3M5RA 4FZYA 1XQSC 4DMNA 3HXMA 4CF9A 2E1YA 3IS9A 5BRHA 2KW4A 1Q18A 5TKYA 3HP6A 4DV4K 1ATNA 4IO8A 1M90O 1RTHA 1RTJA 1TK5A 3U3YA 4FO0A 2B6AA 1NOYA 4AHVA 5LJVA 4BC4A 1VQKN 5AQYA 3CCJN 3O9UA 4A5BA 3QEPA 3VEXA 5CYQA 3SPYA 3NH2A 2GWJA 3W3DA 2OPQA 2UXBK 1JCEA 3C95A 3VA0A 4A62A 2WUSA 1HJRA 4IG3A 4JKBA 1E4FT 5C12A 3QEVA 4I9QA 4Z4CA 1Q9YA 4FJLA 4L8RB 1VSKA 3P4IA 5HRNA 5JVGL 3G6EN 1YTAA 3VQ8A 4N41A 3UE5A 5IT9O 4Z4FA 3F5TA 4ISEA 3CIPA 3TANA 5J2PA 4BVOA 1TUUA 1BOTO 3K5MA 3TAPA 4FWRA 2A41A 1XMQK 2A1SA 3GBTA 1J9AA 2PAVA 5BN9A 3OYNA 2D0CA 4X65K 3TI0A 4W5TA 4LF4K 3VA3A 2X74A 1CXQA 3SJHA 3VGLA 2Z1GA 1WAJA 2DFFA 3PSFA 1OH5A 3SMPA 3KHYA 1HR0K 2FXUA 5KTQA 1Q82O 1BU6O 3BEXA 4DTRA 3CFRA 1EWQA 4CZMA 4WQ4C 4DUZK 3AV9A 4OGEA 1MWMA 3VEYA 4M3XA 1T6CA 2HNYA 3AGRA 2F8SA 3NCIA 1YITN 4ILGB 1YHQN 3OA9A 1HNIA 4JKAA 1IH7A 4EZ9A 2HHIA 2OYQA 4ELUA 3CI5A 1HJOA 1SZ2A 2ASPA 2GEMA 4Y0WA 3CM5A 4I9LA 1S1WA 4K41A 3O1BA 4NLCA 4BRKA 4YOXA 1DTTA 3VEWA 2ZF5O 4DB3A 5C2FA 1JLFA 4B9LA 1NK9A 1KQSM 3AARA 1RT7A 1BCMA 3IKMA 1NGFA 3NDKA 2QXFA 4M41A 3AVKA 4DFMA 2V51B 3AGKA 4M45A 5AQPA 3LM9A 4NCGA 3RWUA 3VQ9A 3NF9A 4F9OA 4DFPA 1LW0A 4IFVA 3AO5A 4E7HA 4CZIA 1HYZA 1HNXK 3FGUA 4FM2A 4EFHA 1EO1A 3ENHA 4GV3A 3J8AA 4PWDA 1Z25A 2FC0A 4JD2B 4FK4A 4J8FA 4LD0A 3DOLA 3KIOA 2HHHK 4BG9A 4DU1A 2QTDA 3AO4A 3AVNA 1OH7A 1G15A 3VGKA 3O4WA 3P5JA 4WF9L 4EIAA 5AFUA 3V1QA 3SMSA 1XC3A 1FJGK 3A8YA 5K14A 1OVQA 3NF7A 4M3RA 4FVUA 3DI6A 4E0DA 1Q86O 3CPEA 1RT6A 4M42A 4UY8O 1E4GT 3HPOA 4FLXA 4BR2A 4FJJA 4TSXA 3K5OA 3CERA 4FVMA 4DLEA 3RMAA 5DK5A 3BF1A 5J1EA 3PV8A 4NLBA 1HRHA 1Q9XA 2G8HA 3K59A 1QZ5A 1BCOA 3E9LA 1DT9A 3L4QA 3A5OC 3HOSA 4JV5K 2AJQA 3KZBA 1EX4A 4O8KA 3SZ2A 2QW9A 4C1NI 2JWKA 4PUOA 4IFEA 5AQNA 1LV5A 3V1OA 2C1GA 4IDKA 3V81A 5B8HA 2HHVA 5F2RA 5KGXA 4M7YA 1LAWA 4Q5VA 3PUFA 4CJLA 3MN9A 4BWJA 4CZEA 1VRTA 5AQUA 4CIGA 1WBDA 4JI7K 3ULEB 3ZYYX 2HBKA 4ZTFA 4C8KA 4I6MA 5KRSA 5MLCQ 4LFAK 3VF4A 3OYMA 3BDPA 1BI4B 1NK5A 3T69A 4X66K 3EL2A 3QBWA 3V9WA 4BR5A 4NO7A 3SJJA 5I42A 1NKBA 2ZJRL 4BR7A 4CESA 4DR4K 3KWIA 4ZTJA 1W9HA 3R1XA 3QICA 4DV6K 3H1VX 4RCHA 4DR2K 2V7YA 1NK0A 3GG4A 1HNWK 2YNFA 2NRZA 3K58A 4BGBA 3DWLA 4XH5A 3V9UA 4AHUA 3OHRA 2QWRA 3FZKA 1S6PA 5FPEA 4ILJA 3F2KA 4JI1K 4C23A 1B9DA 4JI8K 5M1KA 4RWTA 5BRFA 4CFBA 4NYFA 1C0FA 4WQ4A 4KH5A 5AQJA 2VYPA 4CF8A 4E19A 4FJMA 4DR7K 2ZQBA 1D9DA 3KJVA 3AA2A 3EYZA 5FPNA 2UXDK 3MXIA 4F2SA 1D4XA 2OCEA 1YJNN 4KAZA 1P90A 3AVAA 3DLKA 4ISGA 4BE1A 4B3TK 3IFRA 4HTLA 1G99A 4H4OA 4O5BA 3AAQA 3ULEA 3OYGA 2J4RA 4CF0A 2Q31A 3N4QA 3G25A 1BI4A 5BPLA 2DTUA 2UYTA 1S1VA 5EU7A 4OKEA 3QNNA 4CBWA 1XHXA 2NRTA 2ATQA 3TAFA 2OTJN 3HM9A 2Z1JA 3VOVA 4PQUA 3U9DA 2YNIA 1IG8A 1NBWA 1ASVA 3AVJA 4FWOA 2HVHA 3KD1E 2P1JA 3K2PA 5BRDA 2NRRA 4JK7A 1E3MA 4J2AA 5AQXA 4BR0A 5I3UA 4ELVA 2I5JA 2IIRA 3P38A 5T7BA 4CFCA 5ADXH 3CMEN 1HNZK 4CFDA 3GE1A 1MDUB 3ATVA 3LZJA 2A6AA 4B1WB 4CGDA 3WNFA 4DV2K 4I2QA 1VQNN 4CZLA 3HOTA 3CJAA 4WCEL 4IOAL 5CZ1A 1VSDA 4CZKA 3OTOK 2OPPA 3J7YP 3HPHA 5AZIB 5AQVA 4BRGA 4IFYA 2XRIA 3HK2A 3I0RA 1Q81O 4OX9K 1FKPA 1NGJA 2IDOA 3S41A 1XC9A 1U45A 5EXWA 1JLAA 4KRFA 1QQOA 3J81O 1NJIO 4B9SA 3VQAA 4B08A 3TAEA 2HNDA 2E20A 2O8FA 2D0PA 2HNZA 1NGDA 1RT4A 2P9IB 3ZLJA 4A59A 1K9MO 3A5NC 2HB5A 4CZFA 2WFBA 3E1YA 4QS7A 5LMNK 3IRXA 1U49A 4BRFA 2O8DB 3QO9A 3V9ZA 3ZEUB 1NGBA 1Y97A 3TWHA 3AVGA 3BUZB 4EHTA 2G8WA 3VQ7A 1DEJA 4R79A 3S3NA 3LP2A 1KVBA 3ZSQA 1NJXA 4NXNK 3ZSOA 4JEPA 3KLEA 1C6VA 3CCMN 4RW7A 4B9TA 3UKRA 4CGFA 3MK6A 4KI6A 4QS8A 1BO5O 4JKEA 3AVIA 2BTFA 4CJTA 4IKFA 3TU5A 4KH4A 2G8FA 1N8RO 1WBBA 4CHPA 2PZSA 2VCPA 4DS4A 4A61A 5E26A 4CGJA 1WOQA 1EP4A 1GLDG 5AZIA 4FK2A 3V6DA 3ZSVA 1X9SA 1NGEA 3D2EB 3LAKA 3JSMA 3M8SA 1TKDA 4CECA 3QINA 2GV9A 1J53A 3RTVA 5JLFA 1J5EK 1KSPA 4GV9A 1GLJO 4E1MA 4IEEA 4PKGA 3ZX3A 3M8QA 1KVAA 1SAZA 3E9PA 3UKUB 4AHSA 4BRHA 1HNVA 2D0AA 3VEOA 2CH6A 2P9IA 3LPUA 4IBNA 3WXLA 1BDGA 2Q36A 3WXJA 5GINA 4CEDA 3E01A 3HBTA 3CMAN 4O55A 1D9FA 4ZHRA 2E1ZA 4JHDB 3THYA 3EE8A 4W5RA 3IAYA 3FZFA 4PHTX 4EAHD 2O8DA 2VG7A 4O5FA 4DQIA 1JKHA 2DFHA 3TAGA 3ZEUA 5AQMA 1KLNA 3FR0A 4B1YB 1S72N 4OJRA 3WNEA 5KPZA 3MAQA 1EWRA 3LL3A 4M3WA 1KAZA 2HMPA 4C8MA 5CR4A 3PX0A 2KKZA 1VSHA 3THVA 1XI1A 4FL9A 3ZX2A 4DTSA 4RG8A 3OYAA 4DCHA 1X3MA 5AZJB 4Z4GA 1UWBA 3O9TA 4KB0A 3MECA 2HHXA 3T1YK 4G1QA 5JS1A 5JS2A 4M63C 3MN7A 4AHTA 2IS3A 4LF8K 1GOBA 1TVRA 5LMUK 1TUYA 3SAFA 4FM1A 3IUCA 5BREA 4FLUA 3HO1A 3D2EA 1BIUA 4XH4A 2KHOA 2V52B 2JWLA 3SUPA 1QSYA 2O4GA 3EKUA 4DQRA 4LFBK 2VQEK 2CGLA 1W97L 4YFUA 1QTMA 1WN7A 1VQMN 3SNNA 3MWPA 1SL0A 3CM6A 3UKUA 4H5NA 4LH5A 2F7TA 1J54A 4ILHA 4BRIA 3QEXA 5J2NA 1T05A 3HYFA 1EKEA 3CYGA 3HRGA 3HP9A 3HJFA 1RILA 4FJIA 4PY5A 3LDSA 4JHDA 1IO2A 5F0XA 3DRRA 3N4PA 4JYAK 3I33A 3KTQA 2DFEA 2A3ZA 2W6KA 3O08A 3SBGA 3ZX0A 4LF7K 3VQBA 1LCUA 1C1AA 1U04A 2P51A 1T03A 2G8VA 2QA4N 4CGIA 4X64K 3C0BA 2D5RA 1CZBA 1RBRA 3QEIA 2F4VK 3DXMA 4FWMA 4EHUA 2HW3A 4B9VA 2XO7A 4M3YA 1VQ5N 3MCPA 3WEEA 1SL1A 1FW6A 1VSMA 4CJSA 4MLEA 5EX5A 5C25A 2YKNA 1C0GA 1VQ7N 2P9LB 4J2EA 1RDBA 3SYZA 5H1SQ 1H1VA 1SL2A 1NGCA 3U6FA 4B9UA 3S3MA 2HHQA 2QKBA 4JAXA 1IKXA 3KVGA 3L2UA 1IG9A 5C0YA 1JJ2M 1XUPO 5AQFA 3QBXA 4FW1A 4H0YB 4U67L 2NUBA 3VEVA 4KI4A 4O8UA 4MDBA 4DQQA 1VQ4N 4CI6A 4OPJA 4I7FA 3CCSN 4O44A 4MQ3A 4BVPA 1VQ6N 2VQFK 3DOKA 1YVUA 3EY1A 4E72A 4H0XB 2NZTA 3CJ7A 4E7JA 3DAWA 3CHWA 3C6HA 5HROA 3E66A 2Q3SA 2YV0X 1RT2A 3D2FB 1ATSA 4DV5K 4CHZA 3I55N 5GIOA 3ZSWA 5C42A 4JRQA 2PFUA 4YHHK 4K8XA 3OVNA 3NBPA 4MO4A 2RF2A 3MMVA 1HPMA 3O80A 3QDKA 3THWA 5HRSA 3AO1A 2P9LA 1EXQA 3CF5L 3VQCA 5E84A 1M1KO 4CJFA 3EE9A 5JVHL 4FLZA 4DTOA 3GDQA 1GLBG 1K8AO 1NGAA 2ZE2A 2I7PA 3L3VA 1L5UA 3H6EA 3ZT0A 1I3AA 3D0PA 5KQDA 1X3NA 1CZ9A 4KHSA 1RDUA 3DRPA 4JI0K 2NRHA 3QMLA 4CD1A 3O1WA 3T7ZA 1BGXT 3SBTA 3WNGA 3EKSA 2OZMA 4BRPA 3BP8A 2ITGA 4JS4A 4FJ8A 3SAHA 3O9QA 4AILC 3FZLA 3D6RA 4LF6K 3PO4A 3OY9A 4CEQA 1RT1A 3LAMA 1NK4A 4GVEA 4DS5A 4O0JA 3MEGA 3OYBA 3M3ZA 3VQ6A 4B3MK 4BDYA 3G71N 3D2FA 3VMFB 1NG9A 4FXDA 2YCHA 1KXPA 3KKSA 4BE7B 1GOCA 4CJ5A 4FJKA
chains in the Genus database with same CATH topology
2YJEA 5FPNA 3ID6A 5JICA 4YOYA 3CCVN 5KQ8A 1D4XA 2YJFA 1YJNN 2QEXN 4I6MB 4IDHA 1RFQA 5F1XA 5AQTA 1P90A 3TTFA 4ISGA 4BQLA 4CBXA 2VGMA 3E9OA 3LDOA 3IFRA 2HF4A 4PKIA 1G99A 4HTLA 2P9UB 3VERA 3AAQA 3ULEA 2QWMA 2J4RA 3WQUA 3MDQA 2HBLA 2Q31A 3Q7BA 3N4QA 3G25A 1VQKN 4WQ5A 3FZHA 2YHWA 5AQOA 5BPLA 2UYTA 2Q2RA 3TPQA 4CZJA 4OPHA 1VQON 4BY9C 1HUXA 5I9EB 1VQ8N 4CBWA 2P9PB 1NM1A 4JKGB 2NRTA 3CQYA 3H1QA 4CJ7A 3ID8A 2OTJN 2QM1A 1J6ZA 2RE2A 4BRLA 2QWQA 4BRDA 3VOVA 3U9DA 3FFKB 1IG8A 2DPNA 2F9TA 2P9KB 4DKWA 1NBWA 3ZETA 3QFUA 3C7NB 1X9JA 4LC9B 3SLCA 4JKFA 1Y64A 4FWOA 2YI1A 4H5VA 5BRDA 1LOTB 1TYQA 1ESVA 2NLXA 2E8AA 5AQQA 2NRRA 3R8EA 4JK7A 4RTFD 5LY3A 5AQXA 4BR0A 2IIRA 2A40A 3P38A 1ATRA 5AQZA 1BA0A 5BR9A 5JLHA 1K73O 2GX9A 4PL8A 4A2BA 5ADXH 1HX1A 4BREA 5M1PA 3CMEN 5JMVA 4CZHA 3GE1A 1MDUB 3ATVA 2A6AA 3TSUA 2YHXA 4B1WB 5ELZA 5AQLA 2FF3B 3TTCA 4BC5A 1VQNN 4FOEA 2HBMA 4BR4A 3RSEA 4CD3A 4CZLA 3HOTA 4GY2B 3CJAA 4WCEL 4IOAL 5M1QA 4CZKA 2HF3A 3R6MA 5EVZA 3CCLN 1VQPN 2E88A 5AZIB 5AQVA 4BRGA 3CD6N 2E2OA 3WXMB 3NMUA 3CJ1A 2BH1A 3CETA 4IXCA 1Q81O 1NGJA 3S41A 1S22A 4FWPA 5EXWA 4BC2A 1JCGA 5AQIA 3VF6A 3C6AA 3MX5A 4BEBA 1Z6RA 3W0LA 2GTDA 2KLAA 2OANA 3EO3A 4CBUA 3G4SN 1RGIA 3EN9A 1QQOA 2WC9A 1KC8O 5AQSA 1NJIO 1IJJA 4H5RA 4IOXA 1NMDA 5AQKA 2E20A 3WUHA 2D0PA 3IDHA 2PBDA 1NGDA 4XH1A 2P9IB 3GOIA 3K9JA 4WFAL 4A59A 5BN8A 4BG8A 3U4LA 3A5NC 3U8XA 1K9MO 3ZETB 4CZFA 3CC7N 1NLVA 2P9PA 1GLEG 1GLCG 4JKGA 1QQMA 2IVNA 4K43A 4BRAA 5GAGP 2P9NA 2WFBA 3E1YA 1ZBSA 2I7NA 4QS7A 3VESA 4BRFA 2F9WA 2IVPA 3DLLL 2ZWHA 1TYQB 1YUWA 1GLFO 2P9KA 1QHAA 3H45C 2E2NA 3C7NA 3JXUA 5BPNA 2FSKA 3ZEUB 4MLHA 1NGBA 3Q7CA 3BUZB 4FOIA 2W41A 4EHTA 1HKCA 3CJCA 1NGGA 4MDAA 1DEJA 4R79A 4IJNA 1NGHA 3TSQA 4GNIA 5ADXA 1GLAG 3TSPA 4WYBA 1SS6A 3VTHA 3D7EO 3FE1A 4JEPA 4BGAA 3OBYA 4BRNA 4FWSA 2CGJA 4YORA 3CCMN 1T6DA 4E1JA 3L4IA 3CC2N 2ASMA 3L0QA 3NVKA 3UKRA 4H0TB 4B9QA 5HOOA 1BA1A 3MK6A 1WUAA 1BO5O 4JKEA 4QS8A 2NNWA 2EWSA 2YX6A 2BTFA 3HM8A 4BRCA 5FPDA 5KPRA 3TU5A 4H03B 4JKDA 1BUPA 4KH4A 4OPAA 1N8RO 5AQRA 5C10A 2VCPA 5GIPA 3PLAA 4A61A 5E26A 5AZJA 2GUPA 1GLLO 3VF2A 2AP1A 1WOQA 1GLDG 5AZIA 3BF3A 4A5AA 4YDUC 4C1NK 1KD1O 3C65A 1YI2N 1NGEA 2FLOA 3D2EB 1VQLN 5KPTA 3FLCO 3K9KA 3I8BA 3VETA 4GV9A 5JLFA 1NGIA 3A5MC 1GLJO 4IEEA 3WT0A 3M5RA 5C2DA 3WQTA 1OKJA 4PKGA 2E2QA 3ZX3A 4AF1A 1YVNA 1XQSC 1SAZA 2E1YA 5BRHA 2P9NB 3E9PA 3UKUB 1Q18A 3A0IX 5M1FA 4H0OA 4BRHA 4JKHA 2CH6A 3VEOA 3F9MA 2P9IA 4H5TA 5TKYA 2ZGYA 1ATNA 4IO8A 3WXLA 2QI2A 4AM6A 1M90O 1BDGA 2Q36A 1YF5L 4FO0A 3WXJA 5GINA 2GWKA 5LJVA 3FZMA 4BC4A 3HBTA 5AQYA 3CMAN 3CCJN 3O9UA 3LDPA 2E1ZA 4JHDB 4KBOA 3EE8A 2Q0RA 4A5BA 2C1IA 1Q7YO 3FZFA 3VEXA 4PHTX 4EAHD 4O5FA 2GWJA 3W3DA 4Z94A 3ZEUA 5AQMA 1JCEA 3FR0A 4B1YB 1S72N 2D1KA 3UB5A 3CCUN 4A62A 4BROA 5KPZA 1W2BM 2WUSA 3LL3A 4JKBA 1E4FT 3LDNA 5C12A 5HL7L 1KAZA 2AA4A 3O5BA 4IEIA 2HMPA 3UKRB 2GELA 3HTVA 4KH6A 1YAGA 2FF6A 4QS9A 1JCFA 3HZ6A 5CR4A 2KKZA 3DXKB 3P4IA 4FL9A 4FPBA 3ZX2A 2W00A 5JVGL 3G6EN 4MO5A 4CZGA 1HKGA 4ISFA 3UE5A 4H5WA 4DCHA 4PL7A 3CJBA 3H3OB 1X3MA 3O9SA 3F5TA 5AZJB 4ISEA 3CIPA 3O9TA 5GADP 1O13A 4BVOA 5GAHP 1TUUA 1BOTO 5EY4A 4FWRA 2A41A 4A2AA 3GBTA 4M63C 3MN7A 2PAVA 2VGNA 3O6WA 5BN9A 1BWFO 1ZC6A 2Q97A 1Z05A 3AY9A 1TUYA 3VGMA 3SAFA 3H3NO 3IUCA 3SJHA 3VGLA 5BREA 1BG3A 4B1VA 3D2EA 4FPAA 4XH4A 2KHOA 2V52B 2JWLA 3SMPA 3KHYA 2FXUA 3EKUA 4HWIA 1Q82O 1BU6O 3BEXA 4JNEA 2CGLA 1W97L 4JD2A 4CZMA 3ENBA 4WQ4C 4WFNL 1VQMN 4YOWA 3MWPA 1SQKA 1MWMA 5M1NA 4YOTA 3R9PA 3VEYA 1T6CA 3UKUA 3AGRA 4H5NA 2F7TA 4ILHA 3VEZA 4BRIA 1YJWN 1YITN 1NWKA 4ILGB 1YHQN 3OA9A 5AFUH 4JKAA 3HRGA 4H0VB 1QVFM 4PKHA 5GAEP 3CI5A 1HJOA 1SZ2A 3AAPA 2ASPA 1KAXA 2GEMA 4JHDA 4Y0WA 4WFBL 3P39A 2QWOA 2NRXA 5F0XA 1KAYA 3N4PA 4K41A 2ZGZA 3O1BA 3WXKA 1VAZA 4NLCA 4BRKA 3I33A 4YOXA 3VEWA 2ZF5O 1MWKA 4JN4A 2A3ZA 3M1FA 4DB3A 3O08A 3JS6A 3SBGA 3VENA 3ZX0A 5C2FA 1YJ9N 4FWQA 3MWTA 4WQ5C 4BQZA 2YHYA 3AARA 1HLUA 3P31A 1KQSM 5CHIA 4B1UB 1LCUA 3IKMA 1NGFA 3DXKA 3VPZA 1U2VB 2QA4N 2WBNA 4FSVA 2V51B 3AGKA 5AR0A 4OO1J 4JKCA 5AQPA 3C0BA 3LM9A 1QQNA 4M7XA 2P9SB 3DXMA 4FWMA 4EHUA 2BUPA 1VQ5N 3MCPA 4F9OA 3WEEA 3L6QA 1T3VA 5TKWA 5DM6L 2NRVA 4YOUA 1OVYA 4CZIA 4MLEA 5EX5A 1P8ZA 3HI0A 1C0GA 1VQ7N 3NVMA 3FGUA 2P9LB 5DM7L 1EQYA 4IWVA 4EFHA 3ENHA 1EO1A 4GV3A 3J8AA 5H1SQ 3CXCM 1H1VA 4JD2B 1NGCA 4J8FA 2QWPA 2OTLN 4BG9A 1U6ZA 2QTDA 4FWLA 3CCRN 4JAXA 2W40A 4IZ9A 3KVGA 3VGKA 3M6GA 3O4WA 5C0YA 1K8KA 4WF9L 1JJ2M 4EIAA 1XUPO 5AQFA 3QBXA 5AFUA 3CCEN 3KK7A 4H0YB 4U67L 3SMSA 3VEVA 4O8UA 4MDBA 1XC3A 3A5LC 3GL1A 3A8YA 3CC4N 1VQ4N 4CI6A 3CCSN 4FVUA 2D4WA 1Q86O 4BVPA 1VQ6N 3O8MA 4G9ZA 3CPEA 1HKBA 2QWNA 4UY8O 1E4GT 3IMXA 3R3LA 4YDUA 4H0XB 2NZTA 4JK9A 4BR2A 4FWNA 3CERA 3CCQN 3CJ7A 3ENOA 3DAWA 3CHWA 4BRQA 3C6HA 3EZWA 3B8AX 3SK3A 3J7ZO 3BF1A 3PIOL 4YOVA 4NLBA 4BECA 1YXQA 3E66A 5FPMA 4NB4A 1QZ5A 3DXMB 2RHKA 4IOCL 3E9LA 2HBJA 1DT9A 3L4QA 1V4SA 3A5OC 3D2FB 3WEEB 3HOSA 3KZBA 3DJCA 1ATSA 4O8KA 2ZJPL 3H46O 1U2VA 4L3QA 2QW9A 3SAGA 3I55N 4C1NI 2JWKA 4BRMA 2P9SA 4IFEA 5GIOA 1QVGM 5AQNA 4IJAA 3OBWA 1R59O 2PFUA 4B1XB 2C1GA 1ZXOA 2QWLA 1T44A 5LJWA 2HOEA 4MO4A 5B8HA 3WXIA 5F2RA 4M7YA 3MMVA 3CJ9A 4XEIA 1HPMA 3O80A 5M1OA 3CQXA 3QDKA 3MN9A 3OW2M 2ASOA 4CZEA 2P9LA 2Q0UA 5AQUA 3ULEB 3ZYYX 3CF5L 2HBKA 4I6MA 5MLCQ 1K8KB 5E84A 4BR9A 1M1KO 3RVCA 3VF4A 1DGKN 3ATUA 3EE9A 5JVHL 4IO9L 2IVOA 2CH5A 3T69A 3EL2A 3MN5A 3QBWA 4BR5A 1RDWX 3GDQA 2Q1NA 4NO7A 4H0PA 1GLBG 2P9UA 4U7BA 1K8AO 2ZJRL 4A57A 4BR7A 1NGAA 2FSJA 1CZAN 3QB0A 4XJXA 3KWIA 3I56N 1QZ6A 1DKGD 2I7PA 2FSNA 3H6EA 3R1XA 3QICA 4K25A 3H1VX 3KWGA 3QFPA 5AQHA 4RCHA 5KQDA 2V7YA 3GG4A 2HSTA 5CE3A 1X3NA 3LDQA 1RDUA 1V4TA 2NRZA 3VTIA 2H3GX 2NRHA 4BGBA 3DWLA 3QMLA 4CD1A 3O1WA 5AQGA 2D0OA 3T7ZA 3SBTA 4XH5A 3EKSA 4DHYA 3CPWM 3MX2A 4B1ZA 1S3XA 2E2PA 4BRPA 4K42A 3BP8A 3OHRA 2QWRA 2CGKA 3FZKA 3O9QA 5C15A 3SAHA 3FZLA 3D6RA 3HSCA 3U9ZA 5FPEA 3O9RA 4ILJA 3F2KA 4C23A 3MN6A 4BC3A 4GV6A 5AQWA 4FWKA 2A5XA 5M1KA 4RWTA 2NRWA 3PIPL 2A42A 4GVEA 5BRFA 3TTDA 1C0FA 1MA9B 3LDLA 3M3ZA 4KH5A 4WQ4A 2V7ZA 5AQJA 2ZJQL 2VYPA 3G71N 3D2FA 1VQ9N 4DQ8A 3LM2A 3VMFB 1YIJN 4JK8A 2YCHA 1ILYA 5EOYA 5BPMA 1KXPA 3RSEB 4AM7A 2VWBA 2ITMA 2QXLA 3MCAB 4BE7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJE A;  5FPN A;  5JIC A;  5KQ8 A;  1D4X A;  2YJF A;  4I6M B;  1RFQ A;  5F1X A;  5AQT A;  4ISG A;  4BQL A;  4CBX A;  3LDO A;  3IFR A;  2HF4 A;  4PKI A;  1G99 A;  4HTL A;  2P9U B;  3VER A;  3AAQ A;  3ULE A;  2QWM A;  2J4R A;  3WQU A;  3MDQ A;  2Q31 A;  3G25 A;  4WQ5 A;  3FZH A;  2YHW A;  5AQO A;  5BPL A;  2UYT A;  2Q2R A;  3TPQ A;  4CZJ A;  1HUX A;  5I9E B;  4CBW A;  2P9P B;  1NM1 A;  3CQY A;  3H1Q A;  4CJ7 A;  3ID8 A;  2QM1 A;  1J6Z A;  4BRL A;  2QWQ A;  4BRD A;  3VOV A;  3U9D A;  3FFK B;  1IG8 A;  2DPN A;  2F9T A;  2P9K B;  1NBW A;  3ZET A;  3QFU A;  3C7N B;  1X9J A;  4LC9 B;  3SLC A;  1Y64 A;  4FWO A;  2YI1 A;  4H5V A;  5BRD A;  1LOT B;  1TYQ A;  1ESV A;  2NLX A;  2E8A A;  5AQQ A;  3R8E A;  4RTF D;  5LY3 A;  5AQX A;  4BR0 A;  2IIR A;  2A40 A;  5AQZ A;  1ATR A;  5BR9 A;  1BA0 A;  5JLH A;  4PL8 A;  4A2B A;  5ADX H;  1HX1 A;  4BRE A;  5JMV A;  4CZH A;  3GE1 A;  1MDU B;  3ATV A;  2A6A A;  2YHX A;  4B1W B;  5ELZ A;  5AQL A;  2FF3 B;  4BC5 A;  4FOE A;  4BR4 A;  3RSE A;  4CD3 A;  4CZL A;  4GY2 B;  3CJA A;  4CZK A;  2HF3 A;  3R6M A;  5EVZ A;  2E88 A;  5AZI B;  5AQV A;  4BRG A;  2E2O A;  3CJ1 A;  3CET A;  4IXC A;  1NGJ A;  3S41 A;  1S22 A;  4FWP A;  5EXW A;  4BC2 A;  1JCG A;  5AQI A;  3VF6 A;  1Z6R A;  3W0L A;  2GTD A;  2OAN A;  3EO3 A;  4CBU A;  1RGI A;  3EN9 A;  1QQO A;  5AQS A;  1IJJ A;  4H5R A;  1NMD A;  5AQK A;  2E20 A;  3WUH A;  2D0P A;  3IDH A;  2PBD A;  1NGD A;  4XH1 A;  2P9I B;  3GOI A;  5BN8 A;  4BG8 A;  3U4L A;  3A5N C;  3U8X A;  3ZET B;  4CZF A;  1NLV A;  2P9P A;  1GLE G;  1GLC G;  1QQM A;  2IVN A;  4K43 A;  4BRA A;  2P9N A;  4QS7 A;  1ZBS A;  2I7N A;  3VES A;  4BRF A;  2F9W A;  2IVP A;  2ZWH A;  1TYQ B;  1YUW A;  1GLF O;  2P9K A;  1QHA A;  3H45 C;  2E2N A;  3C7N A;  3JXU A;  5BPN A;  2FSK A;  3ZEU B;  4MLH A;  1NGB A;  4FOI A;  3BUZ B;  2W41 A;  4EHT A;  1HKC A;  3CJC A;  1NGG A;  1DEJ A;  4IJN A;  1NGH A;  5ADX A;  4GNI A;  1GLA G;  4WYB A;  3D7E O;  3FE1 A;  4BGA A;  4BRN A;  4FWS A;  2CGJ A;  1T6D A;  4E1J A;  3L4I A;  2ASM A;  3L0Q A;  3UKR A;  4H0T B;  4B9Q A;  1BA1 A;  3MK6 A;  1WUA A;  1BO5 O;  4QS8 A;  2EWS A;  2BTF A;  3HM8 A;  4BRC A;  5FPD A;  5KPR A;  3TU5 A;  4H03 B;  1BUP A;  5AQR A;  2VCP A;  4A61 A;  5E26 A;  5AZJ A;  2GUP A;  1GLL O;  3VF2 A;  2AP1 A;  1WOQ A;  1GLD G;  5AZI A;  3BF3 A;  4YDU C;  1NGE A;  2FLO A;  3D2E B;  5KPT A;  3FLC O;  3I8B A;  3VET A;  5JLF A;  1NGI A;  3A5M C;  1GLJ O;  3WT0 A;  3WQT A;  1OKJ A;  4PKG A;  2E2Q A;  3ZX3 A;  1YVN A;  1XQS C;  1SAZ A;  2E1Y A;  5BRH A;  2P9N B;  3UKU B;  1Q18 A;  3A0I X;  4H0O A;  4BRH A;  3VEO A;  2CH6 A;  3F9M A;  2P9I A;  4H5T A;  5TKY A;  2ZGY A;  1ATN A;  4IO8 A;  3WXL A;  4AM6 A;  1BDG A;  2Q36 A;  4FO0 A;  3WXJ A;  2GWK A;  5LJV A;  3FZM A;  4BC4 A;  3HBT A;  5AQY A;  3LDP A;  2E1Z A;  4JHD B;  4KBO A;  2Q0R A;  3FZF A;  3VEX A;  4EAH D;  4O5F A;  2GWJ A;  3W3D A;  4Z94 A;  3ZEU A;  5AQM A;  1JCE A;  3FR0 A;  4B1Y B;  2D1K A;  3UB5 A;  4A62 A;  4BRO A;  5KPZ A;  2WUS A;  3LL3 A;  1E4F T;  3LDN A;  1KAZ A;  2AA4 A;  3O5B A;  3UKR B;  2HMP A;  2GEL A;  3HTV A;  1YAG A;  2FF6 A;  4QS9 A;  1JCF A;  3HZ6 A;  3DXK B;  3P4I A;  4FL9 A;  4FPB A;  3ZX2 A;  4MO5 A;  4CZG A;  1HKG A;  4ISF A;  3UE5 A;  4H5W A;  4DCH A;  4PL7 A;  3CJB A;  3H3O B;  1X3M A;  5AZJ B;  4ISE A;  3CIP A;  4BVO A;  1TUU A;  1BOT O;  5EY4 A;  4FWR A;  2A41 A;  4A2A A;  3GBT A;  4M63 C;  3MN7 A;  2PAV A;  3O6W A;  5BN9 A;  1BWF O;  1ZC6 A;  2Q97 A;  1Z05 A;  3AY9 A;  1TUY A;  3VGM A;  3H3N O;  3IUC A;  3SJH A;  3VGL A;  5BRE A;  1BG3 A;  4B1V A;  3D2E A;  4FPA A;  4XH4 A;  2KHO A;  2V52 B;  3SMP A;  3KHY A;  2FXU A;  3EKU A;  4HWI A;  1BU6 O;  3BEX A;  4JNE A;  2CGL A;  4JD2 A;  4CZM A;  4WQ4 C;  1SQK A;  1MWM A;  3VEY A;  3R9P A;  1T6C A;  3UKU A;  4H5N A;  3VEZ A;  4BRI A;  1NWK A;  5AFU H;  4H0V B;  4PKH A;  3CI5 A;  1HJO A;  1SZ2 A;  3AAP A;  2ASP A;  1KAX A;  2GEM A;  4JHD A;  4Y0W A;  5F0X A;  2QWO A;  1KAY A;  4K41 A;  2ZGZ A;  3O1B A;  3WXK A;  4BRK A;  3I33 A;  3VEW A;  2ZF5 O;  1MWK A;  4JN4 A;  2A3Z A;  3M1F A;  4DB3 A;  3O08 A;  3JS6 A;  3ZX0 A;  3VEN A;  4FWQ A;  4WQ5 C;  4BQZ A;  2YHY A;  3AAR A;  1HLU A;  4B1U B;  1LCU A;  1NGF A;  3DXK A;  3VPZ A;  1U2V B;  5AR0 A;  4FSV A;  2V51 B;  5AQP A;  3C0B A;  3LM9 A;  1QQN A;  4M7X A;  2P9S B;  3DXM A;  4FWM A;  4EHU A;  2BUP A;  3MCP A;  4F9O A;  3WEE A;  3L6Q A;  4CZI A;  4MLE A;  5EX5 A;  1P8Z A;  3HI0 A;  1C0G A;  3FGU A;  2P9L B;  1EQY A;  4IWV A;  4EFH A;  3ENH A;  3J8A A;  1H1V A;  4JD2 B;  1NGC A;  4J8F A;  2QWP A;  4BG9 A;  1U6Z A;  4FWL A;  4JAX A;  2W40 A;  4IZ9 A;  3KVG A;  3VGK A;  3M6G A;  3O4W A;  1K8K A;  4EIA A;  1XUP O;  5AQF A;  3QBX A;  5AFU A;  4H0Y B;  3SMS A;  3VEV A;  1XC3 A;  3A5L C;  3GL1 A;  3A8Y A;  4CI6 A;  2D4W A;  4BVP A;  3O8M A;  1HKB A;  2QWN A;  1E4G T;  3IMX A;  4YDU A;  4H0X B;  2NZT A;  4BR2 A;  4FWN A;  3CER A;  3CJ7 A;  3ENO A;  3DAW A;  3CHW A;  4BRQ A;  3EZW A;  3B8A X;  3SK3 A;  3BF1 A;  1YXQ A;  5FPM A;  4NB4 A;  1QZ5 A;  3DXM B;  1V4S A;  3A5O C;  3D2F B;  3WEE B;  3KZB A;  3DJC A;  1ATS A;  4O8K A;  3H46 O;  1U2V A;  4L3Q A;  2QW9 A;  4BRM A;  2P9S A;  5AQN A;  4IJA A;  1R59 O;  4B1X B;  1ZXO A;  2QWL A;  1T44 A;  5LJW A;  2HOE A;  4MO4 A;  5B8H A;  3WXI A;  5F2R A;  4M7Y A;  3MMV A;  3CJ9 A;  4XEI A;  1HPM A;  3O80 A;  3CQX A;  3QDK A;  3MN9 A;  2ASO A;  4CZE A;  2P9L A;  2Q0U A;  5AQU A;  3ULE B;  4I6M A;  1K8K B;  5E84 A;  4BR9 A;  3VF4 A;  1DGK N;  3ATU A;  2IVO A;  2CH5 A;  3EL2 A;  3MN5 A;  3QBW A;  4BR5 A;  1RDW X;  3GDQ A;  2Q1N A;  4NO7 A;  4H0P A;  1GLB G;  2P9U A;  4BR7 A;  1NGA A;  2FSJ A;  1CZA N;  3QB0 A;  1QZ6 A;  1DKG D;  2I7P A;  2FSN A;  3H6E A;  4K25 A;  3QIC A;  5AQH A;  3H1V X;  3QFP A;  4RCH A;  5KQD A;  2V7Y A;  3GG4 A;  5CE3 A;  1X3N A;  3LDQ A;  1V4T A;  2H3G X;  2NRH A;  4BGB A;  3DWL A;  3QML A;  4CD1 A;  3O1W A;  5AQG A;  2D0O A;  4XH5 A;  3EKS A;  4DHY A;  4B1Z A;  1S3X A;  2E2P A;  4BRP A;  4K42 A;  3BP8 A;  3OHR A;  2QWR A;  2CGK A;  3FZK A;  3FZL A;  3HSC A;  3U9Z A;  5FPE A;  4C23 A;  3MN6 A;  4BC3 A;  5AQW A;  4FWK A;  2A5X A;  4RWT A;  2A42 A;  5BRF A;  1C0F A;  1MA9 B;  3LDL A;  3M3Z A;  4WQ4 A;  2V7Z A;  5AQJ A;  2VYP A;  3D2F A;  4DQ8 A;  3LM2 A;  2YCH A;  5EOY A;  5BPM A;  1KXP A;  3RSE B;  4AM7 A;  2VWB A;  2ITM A;  2QXL A; 
#chains in the Genus database with same CATH topology
 2YJE A;  4OKJ A;  3ID6 A;  3CCV N;  2QEX N;  3VQQ A;  4B9M A;  4I6M B;  4IDH A;  5AQT A;  1VK0 A;  3TTF A;  4HVJ A;  1TKX A;  4JS5 A;  3LDO A;  2HF4 A;  4PKI A;  3OYI A;  3VER A;  4DWI A;  3OYF A;  3LAL A;  5AQO A;  2HHW A;  3KKR A;  2D0B A;  1VQ8 N;  2G8K A;  1N32 K;  3NGY A;  2P9P B;  4CEA A;  3H1Q A;  3RR8 A;  2QM1 A;  3OYE A;  2QWQ A;  3FFK B;  4CJW A;  2DPN A;  2HVI A;  5C24 A;  3QFU A;  1X9J A;  1EET A;  4M3Z A;  3U3G A;  1N6Q A;  3SCX A;  3PSI A;  4BE0 A;  1TYQ A;  1WB9 A;  3KLI A;  3L2R A;  2QK9 A;  5AQZ A;  5BR9 A;  4CHN A;  1K73 O;  4PL8 A;  4A2B A;  5M1P A;  3TAM A;  2YHX A;  5ELZ A;  2FF3 B;  3T3F A;  1JLE A;  4BR4 A;  1REV A;  4LFC K;  1JXB A;  1KRP A;  4FLY A;  1N5Y A;  5M1Q A;  4DR1 K;  3R6M A;  5SZT A;  5EVZ A;  3K0S A;  2E88 A;  4FJG A;  2E2O A;  3WXM B;  3CET A;  4X62 K;  1RBV A;  4BEB A;  2GTD A;  1NJY A;  5FRN A;  2WC9 A;  2UUC K;  5AQS A;  3AA4 A;  3JAM O;  3VQD A;  3KD5 E;  2KFZ A;  1RBT A;  4IOX A;  4GW6 A;  3IDH A;  2BE2 A;  4DV3 K;  1NOZ A;  4WFA L;  5FDL A;  4BG8 A;  3U8X A;  4CEO A;  2P9P A;  5GAG P;  2P9N A;  1ZBS A;  2ZWH A;  3NFA A;  1GLF O;  1QHA A;  3H45 C;  3SPZ A;  1IKW A;  4PA1 A;  2GBZ A;  2YNG A;  1HQE A;  3AO3 A;  4HTU A;  4IJN A;  3NHG A;  1WLJ A;  3TSQ A;  3QLH A;  4GNI A;  1GLA G;  1O1W A;  4OLB A;  2PYL A;  3VTH A;  3D7E O;  3FE1 A;  3OBY A;  3L4I A;  3L0Q A;  3ASM A;  3B6P A;  3TAB A;  1NK7 A;  5HOO A;  1VHX A;  1BA1 A;  2WON A;  2NNW A;  2YX6 A;  2IOC A;  3HM8 A;  5KPR A;  3V1R A;  1BUP A;  4RW9 A;  4DR3 K;  5C10 A;  5GIP A;  2F8T A;  2GUP A;  4Y1D A;  4C8N A;  3VF2 A;  3HL8 A;  3BF3 A;  4YDU C;  4C1N K;  2FLO A;  1T8E A;  3O4N A;  2LSN A;  3K9K A;  4O4G A;  4NCB A;  2O8F B;  1HYV A;  3VN5 A;  1NGI A;  5JEN A;  3AVF A;  1VSI A;  1TAQ A;  1WNS A;  3WQT A;  2E2Q A;  1IV0 A;  3DLE A;  1U4B A;  1S1X A;  1YVN A;  1KFS A;  2HMI A;  3OYJ A;  3A0I X;  5M1F A;  4DTJ A;  4KHU A;  2QI2 A;  4CIF A;  4O0I A;  2GWK A;  3T1H K;  4CIE A;  4KBO A;  2Q0R A;  2C1I A;  4DG1 A;  5DMR A;  3AVL A;  4Z94 A;  2D1K A;  3UB5 A;  3CCU N;  4BRO A;  5IWA K;  1W2B M;  3LDN A;  4BDP A;  3G10 A;  2AA4 A;  1MU2 A;  3O5B A;  4IEI A;  3UKR B;  3SUN A;  1L3S A;  4Z4E A;  2GEL A;  1Q8I A;  3LP1 A;  1YAG A;  2FF6 A;  4HCC A;  1JCF A;  1WSI A;  3HZ6 A;  5CY4 A;  1L3V A;  4FPB A;  3PO5 A;  1S6Q A;  2W00 A;  4FJX A;  1SV5 A;  4DTP A;  4MO5 A;  4CZG A;  4DSK A;  4CVN E;  4PL7 A;  3H3O B;  3O9S A;  3OS2 A;  1O13 A;  3B6O A;  5EY4 A;  1ASU A;  3SQ0 A;  4NYN A;  2VGN A;  1ZC6 A;  2Q97 A;  1Z05 A;  1TK8 A;  2GUI A;  1NJZ A;  4CFA A;  1BG3 A;  4B1V A;  4JI2 K;  2KTQ A;  3LWL A;  4LF5 K;  1FKO A;  1S9E A;  3NF6 A;  3L2W A;  4FM0 A;  3ENB A;  4FJN A;  4YOW A;  5M1N A;  4YOT A;  3THY B;  2Y1J A;  4FZX C;  2P5G A;  3ISN C;  4DFJ A;  1YJW N;  2OZS A;  4V19 S;  4F4K A;  1NWK A;  5AFU H;  4H0V B;  1QVF M;  4PKH A;  4R5P A;  3AAP A;  1KAX A;  4QCL A;  3KLG A;  4ID1 A;  3P39 A;  2PYJ A;  1N36 K;  3DLB A;  3SV3 A;  1N33 K;  4JN4 A;  3M1F A;  4AH9 A;  4KTQ A;  4AQY K;  4CJR A;  4FWQ A;  4BQZ A;  2YHY A;  3J80 O;  1HLU A;  5CHI A;  4B1U B;  3MXM A;  4CJ4 A;  3ALY A;  1U2V B;  2WBN A;  4FSV A;  1CLQ A;  4OO1 J;  4JKC A;  3AO2 A;  4E7K A;  1QQN A;  4M7X A;  4B3O A;  3HT3 A;  4HHT A;  4RW6 A;  3SQ4 A;  3OS1 A;  2YNH A;  1T3V A;  1X9W A;  5DM6 L;  4CK1 A;  2NRV A;  4F3T A;  3HI0 A;  1EQY A;  4IWV A;  3THX B;  3NGI A;  3CXC M;  2QWP A;  2OTL N;  3I8D A;  1U6Z A;  3TAQ A;  4IZ9 A;  3C6T A;  1IBK K;  4N76 A;  3ZSY A;  1U47 A;  1QHT A;  2FBY A;  2O8C B;  1K8K A;  4Y1C A;  3CCE N;  2ZD1 A;  3KK7 A;  1HPZ A;  2BGG A;  3GL1 A;  3CC4 N;  5HRR A;  4C8O A;  2ZM6 K;  1XNQ K;  3SUO A;  2D4W A;  2QWN A;  1XMO K;  2XY5 A;  2G8I A;  3IMX A;  4YDU A;  1HYS A;  1HMV A;  1BIZ A;  3CCQ N;  5J2M A;  3B8A X;  4KHN A;  2O4I A;  3J7Z O;  3PIO L;  4YOV A;  2W6L A;  1YXQ A;  5FPM A;  4DF4 A;  4NB4 A;  3DXM B;  2RHK A;  2HBJ A;  5HBM A;  3WEE B;  2ZJP L;  3DJC A;  1U2V A;  4L3Q A;  4B9N A;  1F21 A;  4CJK A;  1TKZ A;  4BRM A;  1IBM K;  1LWE A;  1QVG M;  4IJA A;  1LWC A;  4B1X B;  3ZT3 A;  1ZXO A;  1T44 A;  4KPY A;  4JI5 K;  3WXI A;  4XEI A;  1TL3 A;  4E3S A;  5M1O A;  5HRP A;  2F96 A;  4M3U A;  2Q0U A;  4CEB A;  1BHL A;  3THX A;  3BZC A;  4BR9 A;  1IKV A;  4DTU A;  3LP3 A;  3AVH A;  1DGK N;  3ATU A;  2OPS A;  1NNE A;  1TK0 A;  1RDW X;  3AA3 A;  2Q1N A;  2P9U A;  5A2Q O;  2BDP A;  2OA8 A;  2FSJ A;  1CZA N;  4XJX A;  2O8C A;  1QZ6 A;  1DKG D;  1XHZ A;  2FSN A;  4WFN L;  1Q7Y O;  3QFP A;  1NMN A;  2XY8 A;  2HST A;  4I2P A;  5CE3 A;  3LDQ A;  3ZSR A;  3VTI A;  2H3G X;  3PX4 A;  1VRU A;  3T19 A;  2D0O A;  5AQG A;  3L8B A;  4JI3 K;  1XWL A;  3MX2 A;  2FBV A;  2E2P A;  3DMJ A;  1UA1 A;  3ZT2 A;  1RBU A;  3MEE A;  5C15 A;  4DR5 K;  1VSE A;  3U9Z A;  3O9R A;  4DFK A;  4CK3 A;  3MN6 A;  4BC3 A;  4DSF A;  1XNR K;  4DV1 K;  3AVC A;  1TV6 A;  4OPK A;  3JYT A;  2A42 A;  3O3F A;  2W42 A;  3TTD A;  1QSS A;  1MA9 B;  3LDL A;  3LM2 A;  1YIJ N;  4JK8 A;  2KZM A;  1ILY A;  5EOY A;  5BPM A;  4AM7 A;  2VWB A;  2ITM A;  3MCA B;  3SI6 A;  3RMD A;  4OVL A;  3THW B;  3FFI A;  4CJE A;  4ID5 A;  4OLA A;  1RFQ A;  4Z4H A;  1SKR A;  5E41 A;  1JLC A;  4YY3 K;  1NK8 A;  4CBX A;  3ZT1 A;  3E9O A;  4DTN A;  1QE1 A;  1UAX A;  3QNO A;  3MDQ A;  5SWM A;  3Q7B A;  2YHW A;  2WOM A;  4DSI A;  3TPQ A;  4OPH A;  1VQO N;  1HUX A;  5I9E B;  3KLH A;  3OYH A;  4KTZ A;  1NM1 A;  4JKG B;  3CQY A;  4CJ7 A;  1J6Z A;  2VWK A;  5HP1 A;  2F9T A;  2P9K B;  4DKW A;  3ZET A;  4JRP A;  3C7N B;  3SQ2 A;  3KK1 A;  3T1A A;  4JKF A;  3H08 A;  1OH6 A;  2YI1 A;  2WTU A;  4H5V A;  4JI4 K;  1ESV A;  2NLX A;  2E8A A;  5AQQ A;  3J7A P;  3R8E A;  2BAN A;  3RRH A;  4RTF D;  4GKJ K;  2FBT A;  5CZ2 A;  2A40 A;  1ATR A;  4CJU A;  2GX9 A;  4CEF A;  1HX1 A;  3DRS A;  4BRE A;  5JMV A;  1JL2 A;  1NKC A;  4CZH A;  4HCB A;  4Q0B A;  3TSU A;  5AQL A;  4BC5 A;  4FOE A;  2HBM A;  4WE1 A;  4CD3 A;  2VWJ A;  4GY2 B;  4OKK A;  2HF3 A;  4DUY K;  3SUQ A;  3CCL N;  2OPR A;  1FK9 A;  3CD6 N;  3NMU A;  1VSF A;  2BH1 A;  4IXC A;  3ZSX A;  4Z4I A;  3I0S A;  4BC2 A;  2IC3 A;  2X6N A;  3VF6 A;  1Z6R A;  2KLA A;  4CBU A;  3G4S N;  1B92 A;  1RGI A;  5BR8 K;  4H5R A;  4FLT A;  1JLQ A;  1NMD A;  2RKI A;  2E6L A;  3OYL A;  1KTQ A;  2PBD A;  4XH1 A;  3GOI A;  3K9J A;  2YHA A;  5BN8 A;  4DU4 A;  4JKG A;  1QQM A;  4BRA A;  1WAF A;  2I7N A;  3DLL L;  2F9W A;  2IVP A;  3VQE A;  1TYQ B;  3PY8 A;  4FJH A;  1YUW A;  2P9K A;  4CW7 B;  5BPN A;  3C7N A;  5KGW A;  2FSK A;  4MLH A;  4KO0 A;  1NGG A;  1NGH A;  5ADX A;  3TSP A;  1TGO A;  1SS6 A;  3KK2 A;  3LP0 A;  4CF1 A;  1KLM A;  1S1T A;  4FWS A;  4YOR A;  4E89 A;  1W7A A;  3NVK A;  4N5S A;  4B3R K;  4H0T B;  4B9Q A;  5FRM A;  4LY7 A;  2ETJ A;  1D5A A;  2EWS A;  2XY7 A;  2A1R A;  4BRC A;  4CE9 A;  4H03 B;  4JKD A;  3RRG A;  5LL6 Z;  1LWF A;  4DTM A;  5AQR A;  2B4J A;  4CCH A;  2AP1 A;  4A5A A;  4YNQ A;  3TAR A;  3C65 A;  3NF8 A;  1YI2 N;  1VQL N;  5KPT A;  3FLC O;  4F3O A;  1WSJ A;  3VET A;  3A5M C;  3G0Z A;  4C8L A;  4KKO A;  1N34 K;  3LPT A;  4FLV A;  4JI6 K;  3WT0 A;  5C2D A;  2UUB K;  5CYM A;  1OKJ A;  3AVB A;  4JLH A;  4AF1 A;  1L3U A;  4KHW A;  1QQC A;  4CK2 A;  2P9N B;  4FW2 A;  4H0O A;  1ITG A;  4JKH A;  3F9M A;  4H5T A;  2ZGY A;  4AM6 A;  4CJV A;  2O8B B;  3HPG A;  1YF5 L;  4LH4 A;  3FZM A;  4QAG A;  4DSL A;  3LDP A;  4W5N A;  1IKY A;  1C1C A;  4E7L A;  3WNH A;  1S9G A;  1WSG A;  4GKK K;  3RMB A;  1K6Y A;  4CEE A;  3O3H A;  1ZYQ A;  4Z0U A;  5HL7 L;  4H8K A;  3HTV A;  4KH6 A;  4QS9 A;  3DLH A;  1I39 A;  4DQS A;  4EZ6 A;  4DV7 K;  3DXK B;  3LAN A;  3OYC A;  1HKG A;  4ISF A;  4H5W A;  4KTW A;  3CJB A;  3LWM A;  3P1G A;  2KZZ A;  3KK3 A;  1NJW A;  5GAD P;  2HHT A;  3BY5 A;  5GAH P;  4A2A A;  3O6W A;  1X9M A;  1BWF O;  1C1B A;  1VSL A;  3AY9 A;  3VGM A;  1WSH A;  3NH0 A;  3S9H A;  3H3N O;  3ZCM A;  4FPA A;  3BGR A;  3LZI A;  1NKE A;  4EP4 A;  3QEW A;  2Z1I A;  2IGI A;  4HWI A;  4JNE A;  5FRO A;  4JD2 A;  4F2R A;  4KV8 A;  1SQK A;  3R9P A;  3IG1 A;  1C0T A;  3VEZ A;  3OJU A;  3BZK A;  2O8B A;  1S1U A;  1TKT A;  5GAE P;  3D45 A;  1A5X A;  3NGZ A;  3OYD A;  4WFB L;  2P5O A;  4W5O A;  2QWO A;  2NRX A;  1KAY A;  1RDA A;  4CGG A;  2ZGZ A;  3WXK A;  1VAZ A;  3C6U A;  3S3O A;  1MWK A;  3ZT4 A;  1KVC A;  4HUE A;  3JS6 A;  3VEN A;  1YJ9 N;  4WQ5 C;  3MWT A;  2DY4 A;  3SQ1 A;  3P31 A;  2XY6 A;  4E7I A;  1BL3 A;  3DXK A;  3VPZ A;  2KFN A;  5AR0 A;  4B3S K;  2P9S B;  4ICL A;  2BUP A;  5FLX O;  1C0U A;  1ZBI A;  3L6Q A;  4LF9 K;  5TKW A;  4RW4 A;  4YOU A;  1OVY A;  4UQG A;  3OJS A;  1ZBF A;  1P8Z A;  1YTU A;  3V4I A;  2QKK A;  3NVM A;  4CJ3 A;  5DM7 L;  1SKW A;  3L3U A;  1A5W A;  4FWL A;  3CCR N;  2W40 A;  3RMC A;  2YHB A;  3M6G A;  4E1N A;  1FXX A;  4N47 A;  2X6S A;  2XHB A;  4CJP A;  3RR7 A;  1NU0 A;  3UIQ A;  3A5L C;  1BIS A;  5J2Q A;  4FCY A;  1WSF A;  4KRE A;  4KFB A;  3O8M A;  4IG0 A;  4KHQ A;  4G9Z A;  1HKB A;  3ULD A;  3K5N A;  4DLG A;  2E4L A;  3R3L A;  2Y1I A;  4BAC A;  3CFO A;  4JK9 A;  4HUF A;  1LAV A;  4FWN A;  3ENO A;  2E6M A;  1RT3 A;  1SUQ A;  4BRQ A;  3EZW A;  4H4M A;  3SK3 A;  3O4Q A;  1ZBH A;  3CYM A;  5KRT A;  4BEC A;  3AVM A;  3L2V A;  1ZBU A;  1RTD A;  4IOC L;  1NK6 A;  1YT3 A;  1V4S A;  3HST B;  3H46 O;  1GOA A;  3SAG A;  3OYK A;  2G8U A;  2P9S A;  1R0A A;  4BDZ A;  3OBW A;  3MED A;  1QSL A;  1R59 O;  2QWL A;  5LJW A;  2HOE A;  1L3T A;  4K8Z A;  3CJ9 A;  4AHC A;  3DLG A;  4FLW A;  3CQX A;  3VQP A;  3OW2 M;  2ASO A;  1RCH A;  3KLF A;  2KQ2 A;  1RDC A;  1K8K B;  3RVC A;  4AHR A;  1LW2 A;  4IO9 L;  2IVO A;  2CH5 A;  2UXC K;  3MN5 A;  4J2D A;  4FJ9 A;  2R7Y A;  4H0P A;  3NE6 A;  1DLO A;  4U7B A;  4A57 A;  3QB0 A;  3I56 N;  1DTQ A;  2VG6 A;  4K25 A;  4OGC A;  5AQH A;  3KWG A;  1C0M A;  2VG5 A;  3QIP A;  1JXE A;  1V4T A;  4B8A B;  4LSN A;  4LSL A;  4RW8 A;  4DHY A;  3CPW M;  1UOC A;  4B1Z A;  1S3X A;  1RTI A;  4K42 A;  3K5L A;  4DTX A;  2CGK A;  3CG7 A;  3HSC A;  3F73 A;  4EP5 A;  3V9X A;  2X78 A;  4GV6 A;  5AQW A;  1KFD A;  2A5X A;  4FWK A;  4DSE A;  2NRW A;  3PIP L;  4DR6 K;  3EEQ A;  4B8C A;  3EZ5 A;  2V7Z A;  2ZJQ L;  1VQ9 N;  4DQ8 A;  3QET A;  1J5O A;  3MXJ A;  3SV4 A;  4DU3 A;  1OH8 A;  3RSE B;  1CXU A;  2QXL A;  3HVR A;  1Z26 A;  1BQN A;  1JLB A;  4YOY A;  4NXM K;  5JIC A;  1U48 A;  4M3T A;  4CEZ A;  5KQ8 A;  2YJF A;  1KCF A;  4ELT A;  1RNH A;  5F1X A;  3TR8 A;  1BQM A;  4BQL A;  1S5J A;  2VGM A;  1SKS A;  4HUG A;  3P83 D;  1T7P A;  2P9U B;  3CQ8 A;  2QWM A;  4K0K K;  3WQU A;  1W0H A;  2HBL A;  4WQ5 A;  3FZH A;  2JGU A;  2EHG A;  4DV0 K;  2Q2R A;  4CZJ A;  3OS0 A;  2HHS A;  4BY9 C;  2O8E B;  4J2B A;  3PX6 A;  5KI6 A;  3DM2 A;  3ID8 A;  2IAJ A;  1WSE A;  2RE2 A;  4BRL A;  4BRD A;  2YKM A;  1JL1 A;  3HVT A;  4LC9 B;  2FBX A;  4W5Q A;  3SLC A;  3ITH A;  3NH1 A;  1Y64 A;  4GVM A;  1LOT B;  5LY3 A;  3M8P A;  3VQ4 A;  4FJ5 A;  5AJ3 K;  1BA0 A;  1JLG A;  5JLH A;  3V9S A;  3S5T A;  4QOZ B;  3C94 A;  3O3G A;  4CHO A;  2Z1H A;  1B9F A;  1ZBL A;  5D3G A;  3TTC A;  3DYA A;  1I94 K;  4CJQ A;  3RSE A;  2RN2 A;  1QS4 A;  4DF8 A;  4F8R A;  2JLE A;  1VSJ A;  4KHP K;  5HLF A;  1VQP N;  4CGH A;  3CJ1 A;  4FYD A;  3QES A;  1S22 A;  4FWP A;  1JCG A;  5AQI A;  3C6A A;  3MX5 A;  3W0L A;  3ZSZ A;  2OAN A;  3EO3 A;  3EN9 A;  3QIO A;  1KC8 O;  4BE2 A;  3L2Q A;  4CF2 A;  1IJJ A;  5AQK A;  4FJ7 A;  3WUH A;  4CHQ A;  4FK0 A;  3U4L A;  3AA5 X;  2O8E A;  3ZET B;  1RT5 A;  2B5J A;  2EX3 A;  3CC7 N;  1TAU A;  1NLV A;  1GLE G;  1GLC G;  2IVN A;  1TL1 A;  4K43 A;  2PY5 A;  3VES A;  3QER A;  3NAE A;  3CFP A;  4CHY A;  2E2N A;  3JXU A;  4MFB A;  3K57 A;  3Q7C A;  4FOI A;  3A2F A;  1RDD A;  2W41 A;  1HKC A;  3VQ5 A;  2HHU A;  3CJC A;  4MDA A;  1UA0 A;  4DQP A;  1HQU A;  4BWM A;  4CER A;  4WYB A;  4BGA A;  3DLR A;  4BRN A;  2UU9 K;  2CGJ A;  1T6D A;  4E1J A;  3CC2 N;  2ASM A;  3M8R A;  4GMJ B;  4N56 A;  2E5L K;  4NCA A;  4KHY A;  2RPI A;  1D8Y A;  1WUA A;  1X1P A;  1ASW A;  1RBS A;  5FPD A;  4OPA A;  3PLA A;  4XIU A;  1IBL K;  5AZJ A;  4FZZ A;  1GLL O;  2UUA K;  4DSJ A;  4KB1 A;  1A5V A;  1KD1 O;  3I8B A;  3F9K A;  3M5R A;  4FZY A;  1XQS C;  4DMN A;  3HXM A;  4CF9 A;  2E1Y A;  3IS9 A;  5BRH A;  2KW4 A;  1Q18 A;  5TKY A;  3HP6 A;  4DV4 K;  1ATN A;  4IO8 A;  1M90 O;  1RTH A;  1RTJ A;  1TK5 A;  3U3Y A;  4FO0 A;  2B6A A;  1NOY A;  4AHV A;  5LJV A;  4BC4 A;  1VQK N;  5AQY A;  3CCJ N;  3O9U A;  4A5B A;  3QEP A;  3VEX A;  5CYQ A;  3SPY A;  3NH2 A;  2GWJ A;  3W3D A;  2OPQ A;  2UXB K;  1JCE A;  3C95 A;  3VA0 A;  4A62 A;  2WUS A;  1HJR A;  4IG3 A;  4JKB A;  1E4F T;  5C12 A;  3QEV A;  4I9Q A;  4Z4C A;  1Q9Y A;  4FJL A;  4L8R B;  1VSK A;  3P4I A;  5HRN A;  5JVG L;  3G6E N;  1YTA A;  3VQ8 A;  4N41 A;  3UE5 A;  5IT9 O;  4Z4F A;  3F5T A;  4ISE A;  3CIP A;  3TAN A;  5J2P A;  4BVO A;  1TUU A;  1BOT O;  3K5M A;  3TAP A;  4FWR A;  2A41 A;  1XMQ K;  2A1S A;  3GBT A;  1J9A A;  2PAV A;  5BN9 A;  3OYN A;  2D0C A;  4X65 K;  3TI0 A;  4W5T A;  4LF4 K;  3VA3 A;  2X74 A;  1CXQ A;  3SJH A;  3VGL A;  2Z1G A;  1WAJ A;  2DFF A;  3PSF A;  1OH5 A;  3SMP A;  3KHY A;  1HR0 K;  2FXU A;  5KTQ A;  1Q82 O;  1BU6 O;  3BEX A;  4DTR A;  3CFR A;  1EWQ A;  4CZM A;  4WQ4 C;  4DUZ K;  3AV9 A;  4OGE A;  1MWM A;  3VEY A;  4M3X A;  1T6C A;  2HNY A;  3AGR A;  2F8S A;  3NCI A;  1YIT N;  4ILG B;  1YHQ N;  3OA9 A;  1HNI A;  4JKA A;  1IH7 A;  4EZ9 A;  2HHI A;  2OYQ A;  4ELU A;  3CI5 A;  1HJO A;  1SZ2 A;  2ASP A;  2GEM A;  4Y0W A;  3CM5 A;  4I9L A;  1S1W A;  4K41 A;  3O1B A;  4NLC A;  4BRK A;  4YOX A;  1DTT A;  3VEW A;  2ZF5 O;  4DB3 A;  5C2F A;  1JLF A;  4B9L A;  1NK9 A;  1KQS M;  3AAR A;  1RT7 A;  1BCM A;  3IKM A;  1NGF A;  3NDK A;  2QXF A;  4M41 A;  3AVK A;  4DFM A;  2V51 B;  3AGK A;  4M45 A;  5AQP A;  3LM9 A;  4NCG A;  3RWU A;  3VQ9 A;  3NF9 A;  4F9O A;  4DFP A;  1LW0 A;  4IFV A;  3AO5 A;  4E7H A;  4CZI A;  1HYZ A;  1HNX K;  3FGU A;  4FM2 A;  4EFH A;  1EO1 A;  3ENH A;  4GV3 A;  3J8A A;  4PWD A;  1Z25 A;  2FC0 A;  4JD2 B;  4FK4 A;  4J8F A;  4LD0 A;  3DOL A;  3KIO A;  2HHH K;  4BG9 A;  4DU1 A;  2QTD A;  3AO4 A;  3AVN A;  1OH7 A;  1G15 A;  3VGK A;  3O4W A;  3P5J A;  4WF9 L;  4EIA A;  5AFU A;  3V1Q A;  3SMS A;  1XC3 A;  1FJG K;  3A8Y A;  5K14 A;  1OVQ A;  3NF7 A;  4M3R A;  4FVU A;  3DI6 A;  4E0D A;  1Q86 O;  3CPE A;  1RT6 A;  4M42 A;  4UY8 O;  1E4G T;  3HPO A;  4FLX A;  4BR2 A;  4FJJ A;  4TSX A;  3K5O A;  3CER A;  4FVM A;  4DLE A;  3RMA A;  5DK5 A;  3BF1 A;  5J1E A;  3PV8 A;  4NLB A;  1HRH A;  1Q9X A;  2G8H A;  3K59 A;  1QZ5 A;  1BCO A;  3E9L A;  1DT9 A;  3L4Q A;  3A5O C;  3HOS A;  4JV5 K;  2AJQ A;  3KZB A;  1EX4 A;  4O8K A;  3SZ2 A;  2QW9 A;  4C1N I;  2JWK A;  4PUO A;  4IFE A;  5AQN A;  1LV5 A;  3V1O A;  2C1G A;  4IDK A;  3V81 A;  5B8H A;  2HHV A;  5F2R A;  5KGX A;  4M7Y A;  1LAW A;  4Q5V A;  3PUF A;  4CJL A;  3MN9 A;  4BWJ A;  4CZE A;  1VRT A;  5AQU A;  4CIG A;  1WBD A;  4JI7 K;  3ULE B;  3ZYY X;  2HBK A;  4ZTF A;  4C8K A;  4I6M A;  5KRS A;  5MLC Q;  4LFA K;  3VF4 A;  3OYM A;  3BDP A;  1BI4 B;  1NK5 A;  3T69 A;  4X66 K;  3EL2 A;  3QBW A;  3V9W A;  4BR5 A;  4NO7 A;  3SJJ A;  5I42 A;  1NKB A;  2ZJR L;  4BR7 A;  4CES A;  4DR4 K;  3KWI A;  4ZTJ A;  1W9H A;  3R1X A;  3QIC A;  4DV6 K;  3H1V X;  4RCH A;  4DR2 K;  2V7Y A;  1NK0 A;  3GG4 A;  1HNW K;  2YNF A;  2NRZ A;  3K58 A;  4BGB A;  3DWL A;  4XH5 A;  3V9U A;  4AHU A;  3OHR A;  2QWR A;  3FZK A;  1S6P A;  5FPE A;  4ILJ A;  3F2K A;  4JI1 K;  4C23 A;  1B9D A;  4JI8 K;  5M1K A;  4RWT A;  5BRF A;  4CFB A;  4NYF A;  1C0F A;  4WQ4 A;  4KH5 A;  5AQJ A;  2VYP A;  4CF8 A;  4E19 A;  4FJM A;  4DR7 K;  2ZQB A;  1D9D A;  3KJV A;  3AA2 A;  3EYZ A;  5FPN A;  2UXD K;  3MXI A;  4F2S A;  1D4X A;  2OCE A;  1YJN N;  4KAZ A;  1P90 A;  3AVA A;  3DLK A;  4ISG A;  4BE1 A;  4B3T K;  3IFR A;  4HTL A;  1G99 A;  4H4O A;  4O5B A;  3AAQ A;  3ULE A;  3OYG A;  2J4R A;  4CF0 A;  2Q31 A;  3N4Q A;  3G25 A;  1BI4 A;  5BPL A;  2DTU A;  2UYT A;  1S1V A;  5EU7 A;  4OKE A;  3QNN A;  4CBW A;  1XHX A;  2NRT A;  2ATQ A;  3TAF A;  2OTJ N;  3HM9 A;  2Z1J A;  3VOV A;  4PQU A;  3U9D A;  2YNI A;  1IG8 A;  1NBW A;  1ASV A;  3AVJ A;  4FWO A;  2HVH A;  3KD1 E;  2P1J A;  3K2P A;  5BRD A;  2NRR A;  4JK7 A;  1E3M A;  4J2A A;  5AQX A;  4BR0 A;  5I3U A;  4ELV A;  2I5J A;  2IIR A;  3P38 A;  5T7B A;  4CFC A;  5ADX H;  3CME N;  1HNZ K;  4CFD A;  3GE1 A;  1MDU B;  3ATV A;  3LZJ A;  2A6A A;  4B1W B;  4CGD A;  3WNF A;  4DV2 K;  4I2Q A;  1VQN N;  4CZL A;  3HOT A;  3CJA A;  4WCE L;  4IOA L;  5CZ1 A;  1VSD A;  4CZK A;  3OTO K;  2OPP A;  3J7Y P;  3HPH A;  5AZI B;  5AQV A;  4BRG A;  4IFY A;  2XRI A;  3HK2 A;  3I0R A;  1Q81 O;  4OX9 K;  1FKP A;  1NGJ A;  2IDO A;  3S41 A;  1XC9 A;  1U45 A;  5EXW A;  1JLA A;  4KRF A;  1QQO A;  3J81 O;  1NJI O;  4B9S A;  3VQA A;  4B08 A;  3TAE A;  2HND A;  2E20 A;  2O8F A;  2D0P A;  2HNZ A;  1NGD A;  1RT4 A;  2P9I B;  3ZLJ A;  4A59 A;  1K9M O;  3A5N C;  2HB5 A;  4CZF A;  2WFB A;  3E1Y A;  4QS7 A;  5LMN K;  3IRX A;  1U49 A;  4BRF A;  2O8D B;  3QO9 A;  3V9Z A;  3ZEU B;  1NGB A;  1Y97 A;  3TWH A;  3AVG A;  3BUZ B;  4EHT A;  2G8W A;  3VQ7 A;  1DEJ A;  4R79 A;  3S3N A;  3LP2 A;  1KVB A;  3ZSQ A;  1NJX A;  4NXN K;  3ZSO A;  4JEP A;  3KLE A;  1C6V A;  3CCM N;  4RW7 A;  4B9T A;  3UKR A;  4CGF A;  3MK6 A;  4KI6 A;  4QS8 A;  1BO5 O;  4JKE A;  3AVI A;  2BTF A;  4CJT A;  4IKF A;  3TU5 A;  4KH4 A;  2G8F A;  1N8R O;  1WBB A;  4CHP A;  2PZS A;  2VCP A;  4DS4 A;  4A61 A;  5E26 A;  4CGJ A;  1WOQ A;  1EP4 A;  1GLD G;  5AZI A;  4FK2 A;  3V6D A;  3ZSV A;  1X9S A;  1NGE A;  3D2E B;  3LAK A;  3JSM A;  3M8S A;  1TKD A;  4CEC A;  3QIN A;  2GV9 A;  1J53 A;  3RTV A;  5JLF A;  1J5E K;  1KSP A;  4GV9 A;  1GLJ O;  4E1M A;  4IEE A;  4PKG A;  3ZX3 A;  3M8Q A;  1KVA A;  1SAZ A;  3E9P A;  3UKU B;  4AHS A;  4BRH A;  1HNV A;  2D0A A;  3VEO A;  2CH6 A;  2P9I A;  3LPU A;  4IBN A;  3WXL A;  1BDG A;  2Q36 A;  3WXJ A;  5GIN A;  4CED A;  3E01 A;  3HBT A;  3CMA N;  4O55 A;  1D9F A;  4ZHR A;  2E1Z A;  4JHD B;  3THY A;  3EE8 A;  4W5R A;  3IAY A;  3FZF A;  4PHT X;  4EAH D;  2O8D A;  2VG7 A;  4O5F A;  4DQI A;  1JKH A;  2DFH A;  3TAG A;  3ZEU A;  5AQM A;  1KLN A;  3FR0 A;  4B1Y B;  1S72 N;  4OJR A;  3WNE A;  5KPZ A;  3MAQ A;  1EWR A;  3LL3 A;  4M3W A;  1KAZ A;  2HMP A;  4C8M A;  5CR4 A;  3PX0 A;  2KKZ A;  1VSH A;  3THV A;  1XI1 A;  4FL9 A;  3ZX2 A;  4DTS A;  4RG8 A;  3OYA A;  4DCH A;  1X3M A;  5AZJ B;  4Z4G A;  1UWB A;  3O9T A;  4KB0 A;  3MEC A;  2HHX A;  3T1Y K;  4G1Q A;  5JS1 A;  5JS2 A;  4M63 C;  3MN7 A;  4AHT A;  2IS3 A;  4LF8 K;  1GOB A;  1TVR A;  5LMU K;  1TUY A;  3SAF A;  4FM1 A;  3IUC A;  5BRE A;  4FLU A;  3HO1 A;  3D2E A;  1BIU A;  4XH4 A;  2KHO A;  2V52 B;  2JWL A;  3SUP A;  1QSY A;  2O4G A;  3EKU A;  4DQR A;  4LFB K;  2VQE K;  2CGL A;  1W97 L;  4YFU A;  1QTM A;  1WN7 A;  1VQM N;  3SNN A;  3MWP A;  1SL0 A;  3CM6 A;  3UKU A;  4H5N A;  4LH5 A;  2F7T A;  1J54 A;  4ILH A;  4BRI A;  3QEX A;  5J2N A;  1T05 A;  3HYF A;  1EKE A;  3CYG A;  3HRG A;  3HP9 A;  3HJF A;  1RIL A;  4FJI A;  4PY5 A;  3LDS A;  4JHD A;  1IO2 A;  5F0X A;  3DRR A;  3N4P A;  4JYA K;  3I33 A;  3KTQ A;  2DFE A;  2A3Z A;  2W6K A;  3O08 A;  3SBG A;  3ZX0 A;  4LF7 K;  3VQB A;  1LCU A;  1C1A A;  1U04 A;  2P51 A;  1T03 A;  2G8V A;  2QA4 N;  4CGI A;  4X64 K;  3C0B A;  2D5R A;  1CZB A;  1RBR A;  3QEI A;  2F4V K;  3DXM A;  4FWM A;  4EHU A;  2HW3 A;  4B9V A;  2XO7 A;  4M3Y A;  1VQ5 N;  3MCP A;  3WEE A;  1SL1 A;  1FW6 A;  1VSM A;  4CJS A;  4MLE A;  5EX5 A;  5C25 A;  2YKN A;  1C0G A;  1VQ7 N;  2P9L B;  4J2E A;  1RDB A;  3SYZ A;  5H1S Q;  1H1V A;  1SL2 A;  1NGC A;  3U6F A;  4B9U A;  3S3M A;  2HHQ A;  2QKB A;  4JAX A;  1IKX A;  3KVG A;  3L2U A;  1IG9 A;  5C0Y A;  1JJ2 M;  1XUP O;  5AQF A;  3QBX A;  4FW1 A;  4H0Y B;  4U67 L;  2NUB A;  3VEV A;  4KI4 A;  4O8U A;  4MDB A;  4DQQ A;  1VQ4 N;  4CI6 A;  4OPJ A;  4I7F A;  3CCS N;  4O44 A;  4MQ3 A;  4BVP A;  1VQ6 N;  2VQF K;  3DOK A;  1YVU A;  3EY1 A;  4E72 A;  4H0X B;  2NZT A;  3CJ7 A;  4E7J A;  3DAW A;  3CHW A;  3C6H A;  5HRO A;  3E66 A;  2Q3S A;  2YV0 X;  1RT2 A;  3D2F B;  1ATS A;  4DV5 K;  4CHZ A;  3I55 N;  5GIO A;  3ZSW A;  5C42 A;  4JRQ A;  2PFU A;  4YHH K;  4K8X A;  3OVN A;  3NBP A;  4MO4 A;  2RF2 A;  3MMV A;  1HPM A;  3O80 A;  3QDK A;  3THW A;  5HRS A;  3AO1 A;  2P9L A;  1EXQ A;  3CF5 L;  3VQC A;  5E84 A;  1M1K O;  4CJF A;  3EE9 A;  5JVH L;  4FLZ A;  4DTO A;  3GDQ A;  1GLB G;  1K8A O;  1NGA A;  2ZE2 A;  2I7P A;  3L3V A;  1L5U A;  3H6E A;  3ZT0 A;  1I3A A;  3D0P A;  5KQD A;  1X3N A;  1CZ9 A;  4KHS A;  1RDU A;  3DRP A;  4JI0 K;  2NRH A;  3QML A;  4CD1 A;  3O1W A;  3T7Z A;  1BGX T;  3SBT A;  3WNG A;  3EKS A;  2OZM A;  4BRP A;  3BP8 A;  2ITG A;  4JS4 A;  4FJ8 A;  3SAH A;  3O9Q A;  4AIL C;  3FZL A;  3D6R A;  4LF6 K;  3PO4 A;  3OY9 A;  4CEQ A;  1RT1 A;  3LAM A;  1NK4 A;  4GVE A;  4DS5 A;  4O0J A;  3MEG A;  3OYB A;  3M3Z A;  3VQ6 A;  4B3M K;  4BDY A;  3G71 N;  3D2F A;  3VMF B;  1NG9 A;  4FXD A;  2YCH A;  1KXP A;  3KKS A;  4BE7 B;  1GOC A;  4CJ5 A;  4FJK A; 
#chains in the Genus database with same CATH homology
 2YJE A;  5FPN A;  3ID6 A;  5JIC A;  4YOY A;  3CCV N;  5KQ8 A;  1D4X A;  2YJF A;  1YJN N;  2QEX N;  4I6M B;  4IDH A;  1RFQ A;  5F1X A;  5AQT A;  1P90 A;  3TTF A;  4ISG A;  4BQL A;  4CBX A;  2VGM A;  3E9O A;  3LDO A;  3IFR A;  2HF4 A;  4PKI A;  1G99 A;  4HTL A;  2P9U B;  3VER A;  3AAQ A;  3ULE A;  2QWM A;  2J4R A;  3WQU A;  3MDQ A;  2HBL A;  2Q31 A;  3Q7B A;  3N4Q A;  3G25 A;  1VQK N;  4WQ5 A;  3FZH A;  2YHW A;  5AQO A;  5BPL A;  2UYT A;  2Q2R A;  3TPQ A;  4CZJ A;  4OPH A;  1VQO N;  4BY9 C;  1HUX A;  5I9E B;  1VQ8 N;  4CBW A;  2P9P B;  1NM1 A;  4JKG B;  2NRT A;  3CQY A;  3H1Q A;  4CJ7 A;  3ID8 A;  2OTJ N;  2QM1 A;  1J6Z A;  2RE2 A;  4BRL A;  2QWQ A;  4BRD A;  3VOV A;  3U9D A;  3FFK B;  1IG8 A;  2DPN A;  2F9T A;  2P9K B;  4DKW A;  1NBW A;  3ZET A;  3QFU A;  3C7N B;  1X9J A;  4LC9 B;  3SLC A;  4JKF A;  1Y64 A;  4FWO A;  2YI1 A;  4H5V A;  5BRD A;  1LOT B;  1TYQ A;  1ESV A;  2NLX A;  2E8A A;  5AQQ A;  2NRR A;  3R8E A;  4JK7 A;  4RTF D;  5LY3 A;  5AQX A;  4BR0 A;  2IIR A;  2A40 A;  3P38 A;  1ATR A;  5AQZ A;  1BA0 A;  5BR9 A;  5JLH A;  1K73 O;  2GX9 A;  4PL8 A;  4A2B A;  5ADX H;  1HX1 A;  4BRE A;  5M1P A;  3CME N;  5JMV A;  4CZH A;  3GE1 A;  1MDU B;  3ATV A;  2A6A A;  3TSU A;  2YHX A;  4B1W B;  5ELZ A;  5AQL A;  2FF3 B;  3TTC A;  4BC5 A;  1VQN N;  4FOE A;  2HBM A;  4BR4 A;  3RSE A;  4CD3 A;  4CZL A;  3HOT A;  4GY2 B;  3CJA A;  4WCE L;  4IOA L;  5M1Q A;  4CZK A;  2HF3 A;  3R6M A;  5EVZ A;  3CCL N;  1VQP N;  2E88 A;  5AZI B;  5AQV A;  4BRG A;  3CD6 N;  2E2O A;  3WXM B;  3NMU A;  3CJ1 A;  2BH1 A;  3CET A;  4IXC A;  1Q81 O;  1NGJ A;  3S41 A;  1S22 A;  4FWP A;  5EXW A;  4BC2 A;  1JCG A;  5AQI A;  3VF6 A;  3C6A A;  3MX5 A;  4BEB A;  1Z6R A;  3W0L A;  2GTD A;  2KLA A;  2OAN A;  3EO3 A;  4CBU A;  3G4S N;  1RGI A;  3EN9 A;  1QQO A;  2WC9 A;  1KC8 O;  5AQS A;  1NJI O;  1IJJ A;  4H5R A;  4IOX A;  1NMD A;  5AQK A;  2E20 A;  3WUH A;  2D0P A;  3IDH A;  2PBD A;  1NGD A;  4XH1 A;  2P9I B;  3GOI A;  3K9J A;  4WFA L;  4A59 A;  5BN8 A;  4BG8 A;  3U4L A;  3A5N C;  3U8X A;  1K9M O;  3ZET B;  4CZF A;  3CC7 N;  1NLV A;  2P9P A;  1GLE G;  1GLC G;  4JKG A;  1QQM A;  2IVN A;  4K43 A;  4BRA A;  5GAG P;  2P9N A;  2WFB A;  3E1Y A;  1ZBS A;  2I7N A;  4QS7 A;  3VES A;  4BRF A;  2F9W A;  2IVP A;  3DLL L;  2ZWH A;  1TYQ B;  1YUW A;  1GLF O;  2P9K A;  1QHA A;  3H45 C;  2E2N A;  3C7N A;  3JXU A;  5BPN A;  2FSK A;  3ZEU B;  4MLH A;  1NGB A;  3Q7C A;  3BUZ B;  4FOI A;  2W41 A;  4EHT A;  1HKC A;  3CJC A;  1NGG A;  4MDA A;  1DEJ A;  4R79 A;  4IJN A;  1NGH A;  3TSQ A;  4GNI A;  5ADX A;  1GLA G;  3TSP A;  4WYB A;  1SS6 A;  3VTH A;  3D7E O;  3FE1 A;  4JEP A;  4BGA A;  3OBY A;  4BRN A;  4FWS A;  2CGJ A;  4YOR A;  3CCM N;  1T6D A;  4E1J A;  3L4I A;  3CC2 N;  2ASM A;  3L0Q A;  3NVK A;  3UKR A;  4H0T B;  4B9Q A;  5HOO A;  1BA1 A;  3MK6 A;  1WUA A;  1BO5 O;  4JKE A;  4QS8 A;  2NNW A;  2EWS A;  2YX6 A;  2BTF A;  3HM8 A;  4BRC A;  5FPD A;  5KPR A;  3TU5 A;  4H03 B;  4JKD A;  1BUP A;  4KH4 A;  4OPA A;  1N8R O;  5AQR A;  5C10 A;  2VCP A;  5GIP A;  3PLA A;  4A61 A;  5E26 A;  5AZJ A;  2GUP A;  1GLL O;  3VF2 A;  2AP1 A;  1WOQ A;  1GLD G;  5AZI A;  3BF3 A;  4A5A A;  4YDU C;  4C1N K;  1KD1 O;  3C65 A;  1YI2 N;  1NGE A;  2FLO A;  3D2E B;  1VQL N;  5KPT A;  3FLC O;  3K9K A;  3I8B A;  3VET A;  4GV9 A;  5JLF A;  1NGI A;  3A5M C;  1GLJ O;  4IEE A;  3WT0 A;  3M5R A;  5C2D A;  3WQT A;  1OKJ A;  4PKG A;  2E2Q A;  3ZX3 A;  4AF1 A;  1YVN A;  1XQS C;  1SAZ A;  2E1Y A;  5BRH A;  2P9N B;  3E9P A;  3UKU B;  1Q18 A;  3A0I X;  5M1F A;  4H0O A;  4BRH A;  4JKH A;  2CH6 A;  3VEO A;  3F9M A;  2P9I A;  4H5T A;  5TKY A;  2ZGY A;  1ATN A;  4IO8 A;  3WXL A;  2QI2 A;  4AM6 A;  1M90 O;  1BDG A;  2Q36 A;  1YF5 L;  4FO0 A;  3WXJ A;  5GIN A;  2GWK A;  5LJV A;  3FZM A;  4BC4 A;  3HBT A;  5AQY A;  3CMA N;  3CCJ N;  3O9U A;  3LDP A;  2E1Z A;  4JHD B;  4KBO A;  3EE8 A;  2Q0R A;  4A5B A;  2C1I A;  1Q7Y O;  3FZF A;  3VEX A;  4PHT X;  4EAH D;  4O5F A;  2GWJ A;  3W3D A;  4Z94 A;  3ZEU A;  5AQM A;  1JCE A;  3FR0 A;  4B1Y B;  1S72 N;  2D1K A;  3UB5 A;  3CCU N;  4A62 A;  4BRO A;  5KPZ A;  1W2B M;  2WUS A;  3LL3 A;  4JKB A;  1E4F T;  3LDN A;  5C12 A;  5HL7 L;  1KAZ A;  2AA4 A;  3O5B A;  4IEI A;  2HMP A;  3UKR B;  2GEL A;  3HTV A;  4KH6 A;  1YAG A;  2FF6 A;  4QS9 A;  1JCF A;  3HZ6 A;  5CR4 A;  2KKZ A;  3DXK B;  3P4I A;  4FL9 A;  4FPB A;  3ZX2 A;  2W00 A;  5JVG L;  3G6E N;  4MO5 A;  4CZG A;  1HKG A;  4ISF A;  3UE5 A;  4H5W A;  4DCH A;  4PL7 A;  3CJB A;  3H3O B;  1X3M A;  3O9S A;  3F5T A;  5AZJ B;  4ISE A;  3CIP A;  3O9T A;  5GAD P;  1O13 A;  4BVO A;  5GAH P;  1TUU A;  1BOT O;  5EY4 A;  4FWR A;  2A41 A;  4A2A A;  3GBT A;  4M63 C;  3MN7 A;  2PAV A;  2VGN A;  3O6W A;  5BN9 A;  1BWF O;  1ZC6 A;  2Q97 A;  1Z05 A;  3AY9 A;  1TUY A;  3VGM A;  3SAF A;  3H3N O;  3IUC A;  3SJH A;  3VGL A;  5BRE A;  1BG3 A;  4B1V A;  3D2E A;  4FPA A;  4XH4 A;  2KHO A;  2V52 B;  2JWL A;  3SMP A;  3KHY A;  2FXU A;  3EKU A;  4HWI A;  1Q82 O;  1BU6 O;  3BEX A;  4JNE A;  2CGL A;  1W97 L;  4JD2 A;  4CZM A;  3ENB A;  4WQ4 C;  4WFN L;  1VQM N;  4YOW A;  3MWP A;  1SQK A;  1MWM A;  5M1N A;  4YOT A;  3R9P A;  3VEY A;  1T6C A;  3UKU A;  3AGR A;  4H5N A;  2F7T A;  4ILH A;  3VEZ A;  4BRI A;  1YJW N;  1YIT N;  1NWK A;  4ILG B;  1YHQ N;  3OA9 A;  5AFU H;  4JKA A;  3HRG A;  4H0V B;  1QVF M;  4PKH A;  5GAE P;  3CI5 A;  1HJO A;  1SZ2 A;  3AAP A;  2ASP A;  1KAX A;  2GEM A;  4JHD A;  4Y0W A;  4WFB L;  3P39 A;  2QWO A;  2NRX A;  5F0X A;  1KAY A;  3N4P A;  4K41 A;  2ZGZ A;  3O1B A;  3WXK A;  1VAZ A;  4NLC A;  4BRK A;  3I33 A;  4YOX A;  3VEW A;  2ZF5 O;  1MWK A;  4JN4 A;  2A3Z A;  3M1F A;  4DB3 A;  3O08 A;  3JS6 A;  3SBG A;  3VEN A;  3ZX0 A;  5C2F A;  1YJ9 N;  4FWQ A;  3MWT A;  4WQ5 C;  4BQZ A;  2YHY A;  3AAR A;  1HLU A;  3P31 A;  1KQS M;  5CHI A;  4B1U B;  1LCU A;  3IKM A;  1NGF A;  3DXK A;  3VPZ A;  1U2V B;  2QA4 N;  2WBN A;  4FSV A;  2V51 B;  3AGK A;  5AR0 A;  4OO1 J;  4JKC A;  5AQP A;  3C0B A;  3LM9 A;  1QQN A;  4M7X A;  2P9S B;  3DXM A;  4FWM A;  4EHU A;  2BUP A;  1VQ5 N;  3MCP A;  4F9O A;  3WEE A;  3L6Q A;  1T3V A;  5TKW A;  5DM6 L;  2NRV A;  4YOU A;  1OVY A;  4CZI A;  4MLE A;  5EX5 A;  1P8Z A;  3HI0 A;  1C0G A;  1VQ7 N;  3NVM A;  3FGU A;  2P9L B;  5DM7 L;  1EQY A;  4IWV A;  4EFH A;  3ENH A;  1EO1 A;  4GV3 A;  3J8A A;  5H1S Q;  3CXC M;  1H1V A;  4JD2 B;  1NGC A;  4J8F A;  2QWP A;  2OTL N;  4BG9 A;  1U6Z A;  2QTD A;  4FWL A;  3CCR N;  4JAX A;  2W40 A;  4IZ9 A;  3KVG A;  3VGK A;  3M6G A;  3O4W A;  5C0Y A;  1K8K A;  4WF9 L;  1JJ2 M;  4EIA A;  1XUP O;  5AQF A;  3QBX A;  5AFU A;  3CCE N;  3KK7 A;  4H0Y B;  4U67 L;  3SMS A;  3VEV A;  4O8U A;  4MDB A;  1XC3 A;  3A5L C;  3GL1 A;  3A8Y A;  3CC4 N;  1VQ4 N;  4CI6 A;  3CCS N;  4FVU A;  2D4W A;  1Q86 O;  4BVP A;  1VQ6 N;  3O8M A;  4G9Z A;  3CPE A;  1HKB A;  2QWN A;  4UY8 O;  1E4G T;  3IMX A;  3R3L A;  4YDU A;  4H0X B;  2NZT A;  4JK9 A;  4BR2 A;  4FWN A;  3CER A;  3CCQ N;  3CJ7 A;  3ENO A;  3DAW A;  3CHW A;  4BRQ A;  3C6H A;  3EZW A;  3B8A X;  3SK3 A;  3J7Z O;  3BF1 A;  3PIO L;  4YOV A;  4NLB A;  4BEC A;  1YXQ A;  3E66 A;  5FPM A;  4NB4 A;  1QZ5 A;  3DXM B;  2RHK A;  4IOC L;  3E9L A;  2HBJ A;  1DT9 A;  3L4Q A;  1V4S A;  3A5O C;  3D2F B;  3WEE B;  3HOS A;  3KZB A;  3DJC A;  1ATS A;  4O8K A;  2ZJP L;  3H46 O;  1U2V A;  4L3Q A;  2QW9 A;  3SAG A;  3I55 N;  4C1N I;  2JWK A;  4BRM A;  2P9S A;  4IFE A;  5GIO A;  1QVG M;  5AQN A;  4IJA A;  3OBW A;  1R59 O;  2PFU A;  4B1X B;  2C1G A;  1ZXO A;  2QWL A;  1T44 A;  5LJW A;  2HOE A;  4MO4 A;  5B8H A;  3WXI A;  5F2R A;  4M7Y A;  3MMV A;  3CJ9 A;  4XEI A;  1HPM A;  3O80 A;  5M1O A;  3CQX A;  3QDK A;  3MN9 A;  3OW2 M;  2ASO A;  4CZE A;  2P9L A;  2Q0U A;  5AQU A;  3ULE B;  3ZYY X;  3CF5 L;  2HBK A;  4I6M A;  5MLC Q;  1K8K B;  5E84 A;  4BR9 A;  1M1K O;  3RVC A;  3VF4 A;  1DGK N;  3ATU A;  3EE9 A;  5JVH L;  4IO9 L;  2IVO A;  2CH5 A;  3T69 A;  3EL2 A;  3MN5 A;  3QBW A;  4BR5 A;  1RDW X;  3GDQ A;  2Q1N A;  4NO7 A;  4H0P A;  1GLB G;  2P9U A;  4U7B A;  1K8A O;  2ZJR L;  4A57 A;  4BR7 A;  1NGA A;  2FSJ A;  1CZA N;  3QB0 A;  4XJX A;  3KWI A;  3I56 N;  1QZ6 A;  1DKG D;  2I7P A;  2FSN A;  3H6E A;  3R1X A;  3QIC A;  4K25 A;  3H1V X;  3KWG A;  3QFP A;  5AQH A;  4RCH A;  5KQD A;  2V7Y A;  3GG4 A;  2HST A;  5CE3 A;  1X3N A;  3LDQ A;  1RDU A;  1V4T A;  2NRZ A;  3VTI A;  2H3G X;  2NRH A;  4BGB A;  3DWL A;  3QML A;  4CD1 A;  3O1W A;  5AQG A;  2D0O A;  3T7Z A;  3SBT A;  4XH5 A;  3EKS A;  4DHY A;  3CPW M;  3MX2 A;  4B1Z A;  1S3X A;  2E2P A;  4BRP A;  4K42 A;  3BP8 A;  3OHR A;  2QWR A;  2CGK A;  3FZK A;  3O9Q A;  5C15 A;  3SAH A;  3FZL A;  3D6R A;  3HSC A;  3U9Z A;  5FPE A;  3O9R A;  4ILJ A;  3F2K A;  4C23 A;  3MN6 A;  4BC3 A;  4GV6 A;  5AQW A;  4FWK A;  2A5X A;  5M1K A;  4RWT A;  2NRW A;  3PIP L;  2A42 A;  4GVE A;  5BRF A;  3TTD A;  1C0F A;  1MA9 B;  3LDL A;  3M3Z A;  4KH5 A;  4WQ4 A;  2V7Z A;  5AQJ A;  2ZJQ L;  2VYP A;  3G71 N;  3D2F A;  1VQ9 N;  4DQ8 A;  3LM2 A;  3VMF B;  1YIJ N;  4JK8 A;  2YCH A;  1ILY A;  5EOY A;  5BPM A;  1KXP A;  3RSE B;  4AM7 A;  2VWB A;  2ITM A;  2QXL A;  3MCA B;  4BE7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...