1YVNA

The yeast actin val 159 asn mutant complex with human gelsolin segment 1.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
372
structure length
372
Chain Sequence
b'EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGNTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ACTIN)
molecule tags Structural protein
source organism Homo sapiens
publication title Crystal structure of yeast actin V159N mutant
rcsb
total genus 114
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 1999-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1yvnA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yvnA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yvnA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1yvnA04
5E84A 4IJAA 3U9DA 1GLAG 4CD3A 2A5XA 1IJJA 1YVNA 5FPNA 1Z6RA 4CZMA 5AZIB 4BC4A 1X9JA 3SLCA 4BR9A 1DKGD 4CJ7A 4BR4A 4H0PA 3VGKA 1RDWX 3H6EA 4FWRA 5EX5A 3CI5A 3AAPA 4K43A 4QS9A 2VYPA 2ITMA 5BN9A 1YAGA 3VEWA 2GELA 3DJCA 2YHYA 1NGDA 3CHWA 4H5VA 1KAZA 1Y64A 3SK3A 3QBWA 5F2RA 3VGMA 1HKBA 2CH6A 3ENOA 1SZ2A 3L0QA 3WXJA 4MO4A 3CJAA 3BUZB 1NGJA 1ZXOA 4CZHA 3DXKA 5BPMA 5CE3A 1TYQB 3CETA 3D2EA 2E1ZA 3CJ9A 5AQTA 3UKRB 1HKCA 5AQIA 3HM8A 3RSEB 4H5WA 4JAXA 4BVPA 3LDPA 2IVPA 2P9IA 3L6QA 2Q36A 1GLEG 4KBOA 3UB5A 5JLHA 4XH1A 1GLFO 3DXMA 2I7PA 3LDOA 4H5RA 3W0LA 4CD1A 5LJVA 3ZETB 3MCPA 1QQMA 4BROA 4JN4A 3CJ7A 2P9PB 4BRGA 3A5LC 4BRAA 4DCHA 1JCEA 1WOQA 4CZJA 2BUPA 1ATNA 2P9KB 4BR2A 2YJFA 4CBUA 3VETA 4MLHA 2QWPA 1RFQA 3CQXA 2QWOA 2P9UB 5BPNA 2FSJA 3ZEUB 4JNEA 3G25A 4BGAA 4CZLA 2AP1A 2QXLA 3D7EO 4H0XB 4B1UB 4BC3A 4DQ8A 2GEMA 1HX1A 1KXPA 3DWLA 3QBXA 1TUUA 4XEIA 5F1XA 3BF1A 1V4TA 3WEEA 2UYTA 2QW9A 3AARA 3DXMB 2QWRA 1WUAA 1XQSC 3HI0A 4Y0WA 5F0XA 4EHUA 4BRPA 4RCHA 1LCUA 3IDHA 2E2PA 3CQYA 4FWQA 3I33A 3A5NC 5AQKA 2YCHA 2I7NA 2P9SB 5KPZA 3ULEB 3WQUA 2E8AA 2BTFA 3R6MA 2IVNA 2IIRA 3IFRA 2VWBA 2ASMA 2Q31A 3ATUA 2PBDA 4FL9A 3ZEUA 1RGIA 2QM1A 2DPNA 4IJNA 3QDKA 3LDLA 1Q18A 4H5TA 3EKSA 4MO5A 2Q0RA 4FOIA 3VESA 3O80A 4FWLA 4BRDA 2FF3B 5AZIA 1NGHA 3RSEA 2E2NA 3J8AA 1HUXA 3TPQA 1U6ZA 4QS8A 4H0TB 4XH5A 3HTVA 2HOEA 3EKUA 4EFHA 5AFUA 4BRKA 4A62A 5AZJB 3FZKA 3GG4A 3FZHA 4FWPA 3A5MC 4IO8A 3GDQA 4BC5A 4BRMA 4CBXA 4BQLA 3LM9A 2F9TA 3KVGA 4JHDB 4CZFA 4PKHA 2E1YA 4H0VB 2ASOA 4B1WB 4BR0A 4RWTA 3ID8A 2P9NB 5AQVA 1S22A 2VCPA 3JS6A 2F9WA 3C7NB 4CZGA 4I6MB 4WYBA 1C0GA 3WXLA 1K8KA 4FPAA 2QWNA 4B9QA 1R59O 4ISFA 4A2AA 4FPBA 1GLDG 4FWMA 4FOEA 5TKYA 1YUWA 1IG8A 5AQHA 3UE5A 2YI1A 3KZBA 1P8ZA 2P9LB 5AR0A 2A6AA 2GTDA 1HJOA 1ATSA 1OKJA 3R9PA 5BR9A 3U4LA 2ZWHA 4BRNA 3AAQA 1XC3A 4BRHA 3O6WA 3FE1A 4A2BA 3SMPA 2NZTA 5E26A 3F9MA 3D2FA 3LL3A 2W40A 4HTLA 1NGBA 4BRFA 5B8HA 4WQ5A 2FXUA 3M1FA 5EVZA 3MN7A 1BG3A 1BUPA 2V52B 5BRHA 1HLUA 2CGKA 2WUSA 3BP8A 2QWQA 1BU6O 3GBTA 4MLEA 5AQOA 4Z94A 4B1YB 5LY3A 3WUHA 3VEZA 3VERA 3HBTA 3MN5A 5JICA 1T6CA 3VPZA 2P9SA 4EAHD 2V7YA 3QB0A 4M63C 2ASPA 2GWJA 3C0BA 3KHYA 4GY2B 4AM6A 5ADXH 3DXKB 1ESVA 3H46O 4WQ4A 4C23A 4B1XB 3CJCA 3HSCA 3IMXA 3ZX0A 1NGAA 3CIPA 4JD2A 4J8FA 2V7ZA 5FPEA 3ATVA 4BGBA 3VEOA 3D2FB 2Q1NA 3QFPA 5AQLA 5AQPA 1D4XA 2QWMA 4DB3A 1NGEA 2YHWA 4IWVA 2Q97A 1T6DA 1S3XA 4O5FA 4BRCA 5AZJA 2E2QA 3ZX2A 1V4SA 1KAYA 2OANA 4BR5A 2H3GX 1LOTB 4FO0A 3WXKA 4HWIA 2A42A 3H1VX 3MMVA 3CJBA 3O08A 2D0OA 3AY9A 2V51B 5ADXA 3WXIA 4FWOA 3C7NA 3S41A 1JCFA 3VEYA 3H45C 4ISGA 4B1VA 2A3ZA 4JD2B 3VENA 1SQKA 3W3DA 1BWFO 1GLLO 3A5OC 3EL2A 4H5NA 4L3QA 2P9LA 5FPMA 1YXQA 4B1ZA 5JMVA 1MWKA 3FZFA 4F9OA 1Z05A 4YDUC 3VEVA 3A0IX 3OHRA 1NWKA 3P4IA 4H0YB 2Q2RA 3LM2A 3ZX3A 3H3OB 2A41A 3FLCO 1EQYA 4BQZA 4RTFD 2PAVA 5EOYA 1QQOA 2FSNA 1NGGA 4I6MA 4NO7A 5AQXA 1KAXA 3QICA 4BRIA 4AM7A 4FWNA 2NLXA 3ULEA 4EHTA 3FGUA 5AQNA 3FZMA 4LC9B 2ZF5O 3M6GA 5JLFA 2QWLA 2NRHA 3CJ1A 4H0OA 1U2VB 5KQ8A 1NMDA 3VF2A 5AQQA 3VGLA 2ZGYA 3LDQA 2P9IB 2KHOA 1J6ZA 2GUPA 2HF3A 4O8KA 3WQTA 5BRFA 3EZWA 4XH4A 2YJEA 3A8YA 3HZ6A 4WQ5C 3R8EA 4CI6A 1GLCG 3O1WA 2FLOA 3FFKB 4IXCA 1G99A 3WT0A 5BREA 4E1JA 2E2OA 2P9PA 1E4GT 2HF4A 3BF3A 1BA1A 3JXUA 5ELZA 5AQMA 2ZGZA 4PL8A 5AQFA 4M7YA 4BRLA 2EWSA 3FR0A 4CZEA 5KQDA 1X3MA 4EIAA 4JHDA 2FF6A 4K41A 1CZAN 1QQNA 2CGJA 3O8MA 4WQ4C 4BRQA 3B8AX 1HPMA 2AA4A 3O5BA 1NBWA 3MK6A 3U9ZA 1HKGA 3MDQA 3QFUA 3QMLA 3VEXA 5BN8A 3H3NO 4IZ9A 3VF4A 1X3NA 1QHAA 3UKRA 3BEXA 4PL7A 4K25A 3L4IA 2E20A 4PKGA 2W41A 1NGIA 1ZBSA 3ENHA 5EXWA 2J4RA 1BDGA 1E4FT 5AQZA 5AQWA 2D4WA 1NM1A 2HMPA 3I8BA 4ISEA 5FPDA 3TU5A 3ZETA 2GWKA 4PKIA 1BO5O 3CERA 1GLJO 1BA0A 3VF6A 4BVOA 2FSKA 5BPLA 5AFUH 3U8XA 1TYQA 5AQUA 1BOTO 1ZC6A 4QS7A 1MA9B 2P9KA 4FSVA 1TUYA 1GLBG 1ATRA 5AQSA 3SJHA 4DHYA 1MWMA 1DEJA 2CGLA 2P9UA 2YHXA 4YDUA 2IVOA 3EN9A 1U2VA 4NB4A 1QZ6A 4BG8A 5KPRA 3UKUB 3O1BA 4H03B 1SAZA 4M7XA 3FZLA 1H1VA 3WEEB 1NLVA 2CH5A 3GOIA 4BR7A 1QZ5A 5AQGA 5BRDA 4A61A 3LDNA 3VOVA 1DGKN 4BG9A 1C0FA 3H1QA 2P9NA 1JCGA 4CBWA 3GE1A 1T44A 4CZKA 2Q0UA 2A40A 4GNIA 3MN9A 1XUPO 1K8KB 5EY4A 2E88A 4K42A 5LJWA 5AQYA 3EO3A 3M3ZA 3DAWA 5AQRA 4BREA 1NGCA 4FWSA 5AQJA 1NGFA 2D0PA 3O4WA 1MDUB 3D2EB 3GL1A 5KPTA 2D1KA 3SMSA 3UKUA 4CZIA 4BC2A 4FWKA 3IUCA 3MN6A 5I9EB
chains in the Genus database with same CATH superfamily
3S3NA 3U9DA 4DR3K 3VQBA 3V4IA 4O0JA 5FPNA 1C0UA 4BC4A 4NXNK 4JI8K 4FJMA 5KGWA 2DTUA 2DFEA 2ITGA 4BR4A 4FWRA 5EX5A 4QS9A 3SJJA 1SV5A 2VYPA 1YAGA 1J5OA 2NRWA 1Z25A 3KLGA 2GELA 4H4MA 4DU4A 1NNEA 3CMEN 3DJCA 4W5TA 3CHWA 4NCAA 4H5VA 2XRIA 4IG0A 2YNIA 5IT9O 1RBTA 3L3VA 3L0QA 2FBTA 4MO4A 1SKSA 4CIGA 5H1SQ 1RT4A 3HP9A 1ZXOA 4CZHA 4F3OA 4DR2K 2E1ZA 1YITN 1RT3A 3WNEA 3RSEB 3QESA 4JAXA 1Q9XA 1S1TA 1VQON 2P9IA 3L6QA 5JLHA 4CEDA 4ICLA 1GLFO 2GX9A 3ZT2A 3SYZA 2I7PA 3LDOA 4H5RA 4CD1A 5TKWA 4CJRA 3ZETB 2G8VA 5HRSA 3V9ZA 3SV3A 4AHVA 4B9SA 1O13A 1QQMA 4JN4A 4CEOA 1S9GA 1VHXA 3K58A 3CJ7A 4DR1K 2P9PB 3QLHA 2P5GA 4BRAA 4DCHA 4YNQA 4DR7K 3KLEA 4BE1A 1KVCA 1S1UA 1RT1A 1W9HA 4JKAA 1RTJA 4FJHA 2BUPA 3G10A 1ATNA 4BR2A 3O3FA 1NMNA 4C8MA 3C94A 2YJFA 4RW7A 1ZBHA 3AVKA 4FVUA 3RWUA 2QWOA 3TTFA 1NJWA 3AA3A 1CZBA 3VTIA 1VQ5N 3E9PA 3P1GA 4FJJA 3D7EO 4B1UB 3ZSYA 3TI0A 1KXPA 1HRHA 3TAPA 3QBXA 3K0SA 4H4OA 3BF1A 3WEEA 2VGNA 1WUAA 2UUAK 4EHUA 3RMBA 4AHUA 2WOMA 1XC9A 3IDHA 1NOYA 2QEXN 4YOWA 3A5NC 3L4QA 3SBGA 4KHUA 3M8QA 4Z4CA 1JLAA 5JS2A 3VA0A 3T3FA 3PX0A 5KPZA 3ULEB 2E8AA 2BTFA 2JGUA 2IIRA 3LDSA 4DS4A 3IFRA 4JKFA 2ASMA 2Q31A 2O8FB 1ASUA 2UXDK 3MXIA 2QM1A 4Z4FA 2R7YA 1FK9A 2XO7A 2YV0X 3VN5A 4CJTA 3NH2A 5HROA 3NH0A 1VSEA 4CIEA 1M1KO 3RSEA 3QIOA 4FJKA 4JKEA 1HUXA 2Y1JA 3EKUA 3CQ8A 4U67L 5J2MA 1W7AA 4CJPA 1JXBA 1RDBA 4CBXA 3MXJA 4CEEA 4JHDB 4JI1K 2G8UA 2E1YA 4BR0A 4HVJA 4OJRA 3ID8A 4KRFA 1N6QA 4CEQA 3ZSWA 1CXQA 5FROA 4O4GA 4CZGA 1JLFA 4I6MB 4WYBA 4CCHA 1IBKK 4DQPA 4ELUA 4LH5A 4AHCA 4FPBA 1XHZA 3CFPA 4DUZK 5TKYA 2F8SA 2KZZA 1YUWA 3UE5A 4DR6K 3L3UA 3KZBA 2P9LB 1B9DA 5AR0A 2A6AA 1HJOA 1ATSA 2YNHA 4BE0A 2BDPA 5BR9A 3U4LA 3U3YA 3NVKA 3AAQA 3HRGA 1XC3A 4GVEA 3SV4A 5HRPA 4IKFA 3O6WA 1BCOA 4E19A 3T1HK 1VSMA 2O8BA 3WNGA 1C1AA 3SMPA 2JWLA 4JKCA 4C1NI 5C0YA 4A5AA 2FXUA 3LAKA 4ELVA 1RDCA 3V1OA 2V52B 4MLEA 3BP8A 2QWQA 3GBTA 4Z94A 3WUHA 3HBTA 3I8DA 3O9UA 1T6CA 1DTTA 3CC2N 1NK9A 1BISA 2HNZA 2ASPA 1U47A 4B9VA 2NRVA 1OVQA 1VRUA 5MLCQ 1IKWA 3LZJA 3PIPL 4B1XB 3NF8A 3CIPA 2RE2A 2V7ZA 4E3SA 4B9NA 3ATVA 3IAYA 3G4SN 3CYGA 3S5TA 3VEOA 3OTOK 5KTQA 5AQLA 5AQPA 5C2DA 3TWHA 1HJRA 4AQYK 2O8DB 4DB3A 1J53A 4CGIA 4JKHA 1VSIA 1HQEA 2F8TA 4DLGA 2E2QA 4CK1A 2OANA 3QEIA 3OYKA 4M41A 3UIQA 3NBPA 3D45A 3O9TA 3EY1A 3SUNA 3PY8A 2A42A 4FWOA 3CCVN 5LMNK 4JS5A 5KRTA 4CJWA 2A3ZA 2PYJA 1GLLO 3EL2A 3M8SA 2RPIA 3ALYA 1BI4A 2OTLN 4GW6A 4JV5K 2GV9A 4ID5A 3H3OB 3FLCO 1WSFA 4BQZA 4RTFD 2FSNA 5KGXA 1LWEA 2Q3SA 2B5JA 5AQXA 3E1YA 1QHTA 1C6VA 1K9MO 1EXQA 3DLLL 4CEBA 3KK7A 3N4PA 4FWNA 3HXMA 1QSYA 4IOAL 4DTRA 5AQNA 4N76A 3M6GA 5JLFA 5HRNA 2QWLA 2OA8A 5M1PA 5FLXO 3CJ1A 4H0OA 3K5NA 4M45A 5AQQA 1J6ZA 2GUPA 1J9AA 3L2VA 1QVFM 3EZWA 4YOTA 4KHNA 2PYLA 3HZ6A 1C1BA 3O1WA 5LMUK 3AVCA 4R79A 4FJXA 3CM6A 4E1JA 4DFKA 2P9PA 3JXUA 3JSMA 4BRLA 5AQFA 4M7YA 4CGJA 3NVMA 3NF9A 4CHPA 3L2RA 2YKNA 3FR0A 1YJWN 4CZEA 4JI5K 3OYDA 1X3MA 4DTJA 4YOVA 4JHDA 1S6QA 3KLFA 3L8BA 2F96A 5KI6A 3OYLA 5AJ3K 1RTIA 3LP0A 3O5BA 1NBWA 1SKWA 1Y97A 4HHTA 3D6RA 4IEIA 4CESA 5BN8A 3V1QA 3OYNA 2X6SA 1YJ9N 4BY9C 4K25A 4J2BA 4CJEA 1EETA 1NGIA 1ZBSA 3ENHA 4CJUA 4PHTX 2J4RA 4QAGA 4JRQA 1RILA 4B3OA 1X9MA 5AQWA 4CJLA 1NM1A 4CHNA 3AGKA 1VSJA 3I8BA 1VRTA 3THWB 2GWKA 3PSIA 5DK5A 4PKIA 2D0AA 1BA0A 4XIUA 3VF6A 2FSKA 3J7AP 3U8XA 4PY5A 1OVYA 4W5RA 5HBMA 2Z1IA 1Q9YA 3OA9A 2P9KA 1TUYA 1GLBG 3SCXA 1ATRA 1W97L 4DHYA 2UUBK 2CGLA 2YHXA 3J80O 2XY5A 3WXMB 5HRRA 1U2VA 5GADP 4BG8A 3UKUB 2HW3A 3LP3A 3O1BA 4M7XA 1NLVA 4B9UA 4OPJA 4BR7A 2OPRA 1ZBIA 5AQGA 1VQKN 4TSXA 3VQAA 3VOVA 3DOLA 1C0FA 1N34K 4LF9K 3GE1A 4KHYA 2A40A 3HK2A 1XUPO 3DLHA 4KAZA 3CPWM 3EO3A 1NG9A 4BREA 4LD0A 2UUCK 1UAXA 3KKRA 3TANA 3UKUA 3CCJN 3C6HA 5C24A 2HVHA 3OVNA 3MN6A 3AA5X 3K2PA 3PUFA 4DSIA 4I2PA 4CJSA 2A5XA 3OBYA 1YVNA 1Z6RA 4CZMA 3LAMA 5AZIB 3CCEN 3SLCA 3LWLA 4BR9A 1DKGD 3PX6A 2IOCA 2HSTA 3VGKA 4H0PA 3CI5A 3AAPA 3IRXA 2HBKA 5BN9A 3RR8A 4DS5A 2KW4A 3BDPA 4KH6A 1Y64A 4V19S 4PWDA 5C12A 3VGMA 3CYMA 4ILHA 1HKBA 2CH6A 3ENOA 4K8ZA 4G9ZA 1D5AA 3CJAA 3I56N 4HCBA 3CFRA 2W42A 3DXKA 1UWBA 5BPMA 4CFCA 3HO1A 3CETA 5AQTA 3Q7CA 1SS6A 3SUOA 4K8XA 1HKCA 5AQIA 2C1GA 3RTVA 1RT7A 3DYAA 3KKSA 4CJ5A 3NAEA 4FLZA 2YX6A 1NK8A 2IVPA 4KI6A 3UB5A 3QIPA 3HJFA 5D3GA 1RNHA 3DXMA 2RHKA 3NHGA 3MCPA 1TKXA 4CF2A 3KD5E 4CEAA 1T8EA 3A5LC 1T03A 5HLFA 1WOQA 1JCEA 4KTZA 1XNRK 5HOOA 4KO0A 5HL7L 4Q0BA 1RFQA 3IS9A 2VG5A 2P9UB 3NFAA 4LH4A 1E3MA 4MFBA 4E7JA 2IC3A 4CZLA 2QXLA 3OYIA 4CJVA 2PFUA 4DQ8A 3OYBA 1QSSA 2G8HA 3DWLA 3H08A 1TUUA 1WBBA 1QQCA 4E7KA 2UYTA 2QW9A 3AARA 3DMJA 3HI0A 5F0XA 2HMIA 3VQ7A 4X66K 4BRPA 5SZTA 4CHZA 3CQYA 4FWQA 2YCHA 2JWKA 4XJXA 2I7NA 2P9SB 3WQUA 4X65K 2ZJQL 1F21A 4FZXC 5M1NA 1TVRA 2WC9A 3ATUA 5JVHL 2OYQA 4JI3K 3ZEUA 4KV8A 1RGIA 5DM6L 1U48A 3LDLA 1IO2A 4M3ZA 4DTNA 3L2QA 4UY8O 2IS3A 1UA1A 3SQ1A 1L3TA 2Q0RA 4FOIA 3VESA 3O80A 4FWLA 2E2NA 4CW7B 3TPQA 3DRSA 4QS8A 4DG1A 3OS0A 4H0TB 3ULDA 4CGFA 1RBSA 1Q8IA 5AFUA 4BRKA 4GV6A 4E7HA 3MCAB 1VQMN 3Q7BA 4NCBA 2P1JA 3THYB 3FZHA 4FWPA 4BC5A 3GDQA 3G0ZA 2A1SA 1L3SA 1HNIA 2O4GA 3LP2A 2F9TA 3KVGA 2KQ2A 4CZFA 2ASOA 4B1WB 5AQVA 1S22A 3VQDA 1C0GA 4DMNA 1ITGA 1K8KA 4FPAA 4KB0A 1IH7A 4E0DA 3P31A 1P8ZA 4DV3K 2ZM6K 3CCUN 1OKJA 3R9PA 4IFEA 1C1CA 1OH7A 5CYMA 4LF8K 1L3VA 1NJYA 2HHXA 3FE1A 5M1FA 1S9EA 3L2UA 4JKGB 3E66A 3ZT1A 5E26A 4ILGB 3F9MA 3K9JA 3LL3A 2W40A 4HTLA 4BRFA 4WQ5A 3OS1A 5E41A 3CCLN 4FJIA 5BRHA 4LFAK 2WUSA 1TL3A 3N4QA 5LY3A 1BU6O 1KSPA 3K9KA 1FW6A 1UA0A 4O5BA 1XHXA 4DQIA 4M63C 4AM6A 3DXKB 1ESVA 1NKEA 4B3RK 1RBUA 5I3UA 1LAWA 4WQ4A 4M3TA 3KK2A 3HSCA 1BCMA 3CF5L 1NGAA 3VQ5A 3QO9A 5FPEA 1VQ8N 4BGBA 4BECA 2W6LA 4KI4A 4B3MK 1L5UA 2OTJN 1K8AO 1KFSA 1NGEA 2YHWA 4IWVA 2Q97A 1T6DA 3G71N 4YOUA 2HHVA 5AZJA 1KAYA 4JI0K 4BR5A 4DTXA 4UQGA 1LOTB 1XI1A 4BACA 4A57A 3H1VX 4CEZA 3AY9A 1KTQA 3CD6N 2C1IA 2V51B 4MQ3A 5ADXA 4KH4A 1SL0A 3S41A 1JLQA 3CC7N 4ILJA 3KLHA 5DMRA 4CGGA 1JL2A 4B9LA 3A5OC 3CC4N 2BE2A 4H5NA 4L3QA 5JMVA 1YXQA 4C1NK 1QE1A 4OVLA 2G8FA 2BANA 2ZJRL 4X64K 3NE6A 2QKKA 3LZIA 2Z1JA 3TSPA 1WSIA 2A41A 1N36K 4R5PA 2O8BB 2KFZA 1JKHA 3MEGA 4E89A 4N47A 3CM5A 1VQ6N 5GAHP 4CK3A 1NGGA 4NO7A 4I6MA 4IG3A 3QICA 1KQSM 4OKEA 2HHTA 3ULEA 3R3LA 1RT6A 1BL3A 3FZMA 4OLAA 1N5YA 2O8EA 2NRHA 1OH6A 2HNDA 1A5XA 4ZTJA 1U2VB 2E4LA 4BDZA 4YOYA 4RW6A 2QKBA 1NMDA 4B08A 3VF2A 1RDUA 3VGLA 4DSLA 3OYEA 2Z1GA 2P9IB 5BRFA 2F4VK 4JYAK 2HHWA 3A8YA 4WQ5C 1KC8O 1XMQK 4CI6A 1GLCG 2ETJA 4WFNL 3NF6A 1GOAA 3K5MA 1HNWK 4JKDA 3WT0A 2E2OA 3K5LA 3AO1A 3BF3A 5AQMA 1K6YA 5J2QA 4OGEA 1W2BM 4AF1A 1NK0A 4EIAA 4W5NA 4K41A 1JL1A 1NU0A 4ID1A 1QQNA 3RMAA 2CGJA 3HM9A 4N56A 3LP1A 1VQLN 3QFUA 3QMLA 1D9DA 3VF4A 3OJSA 3I0RA 3UKRA 2OZMA 3EEQA 1TKDA 4CEFA 1JLCA 2E20A 4JI2K 3TAMA 4PKGA 2BGGA 4IOXA 4Q5VA 5EXWA 5SWMA 1BDGA 1E4FT 5AQZA 3B6PA 4I9QA 2YNFA 5FRNA 4HCCA 5BR8K 1ZYQA 3TU5A 4AHRA 3A2FA 4WCEL 3O9RA 2QI2A 3ZT3A 2O8FA 5AFUH 1TYQA 1BOTO 4QS7A 1ZBFA 4FCYA 1I39A 3O4QA 2KKZA 1BQMA 1O1WA 4NYFA 1HR0K 4DV4K 3AVLA 2IVOA 4JEPA 4QCLA 4GKKK 2FBXA 2OPQA 4H03B 4J2EA 1SAZA 5HP1A 3GOIA 1QZ5A 5BRDA 1JXEA 3P5JA 1U45A 4DTMA 1JCGA 4CZKA 2Z1HA 2PZSA 3MN9A 1NK7A 3AGRA 4IOCL 3THVA 2UXCK 5KRSA 5CR4A 1IKYA 4OPHA 3M3ZA 3NDKA 3DAWA 3U3GA 3HPOA 4AHTA 4YOXA 1NGCA 3SAHA 5AQJA 1KVAA 1NGFA 2D0PA 3AVMA 4FM2A 1MDUB 3D2EB 5KPTA 4CJQA 1U4BA 4FWKA 4IJAA 1GLAG 3ITHA 4FW1A 2WFBA 4CK2A 3M8RA 5J2PA 1IJJA 3MXMA 1X9JA 4DTPA 2HHHK 4CJ7A 4J2AA 1RDWX 2D0BA 3H6EA 4K43A 1G15A 2ITMA 3OBWA 2QTDA 2YHYA 1NGDA 1EKEA 4CGHA 3ZT4A 3MWPA 4FJ9A 3WXJA 3KIOA 4NXMK 3BUZB 1LW0A 1NGJA 1KLMA 4BDYA 4KH5A 1KVBA 4JKBA 4LF7K 1TYQB 1JJ2M 3D2EA 3CJ9A 4YFUA 1ILYA 3UKRB 3HM8A 3L2WA 1LWCA 4H5WA 3QERA 2VWJA 4BVPA 4FJLA 3LDPA 3EE8A 3MX2A 1GLEG 4XH1A 3DLGA 1TAQA 4X62K 3JYTA 4CJ4A 2FBVA 3W0LA 4Z4IA 3DLKA 4BROA 2EHGA 1Q7YO 3ENBA 2VQEK 2HHIA 3MWTA 3NGZA 2P9KB 1XWLA 3ASMA 3SUPA 4MLHA 3CQXA 2VWKA 5BPNA 1EP4A 1GOCA 2FSJA 5JVGL 3ZEUB 4JNEA 3G25A 2HB5A 3QEXA 5C25A 1HMVA 2GEMA 4L8RB 1HX1A 3AO3A 1QSLA 1TGOA 4CJ3A 3CPEA 3CMAN 3SAFA 1V4TA 3TARA 5JENA 2QWRA 4Y0WA 1XQSC 1T3VA 2KFNA 4RCHA 4PUOA 1LCUA 2E2PA 2UXBK 3I33A 3AVBA 4KTWA 4DSKA 4E7LA 2KTQA 1EWRA 5M1QA 2YHBA 4KREA 1OH8A 2XY7A 3DRPA 4BEBA 4PA1A 3QEPA 3SBTA 2VWBA 4WFAL 3BGRA 4DFJA 4FL9A 4CF0A 1NKBA 2DPNA 2ZQBA 3QDKA 4H5TA 4I2QA 3EKSA 4DV7K 1LWFA 4B3SK 4BRDA 3BZCA 5AZIA 3AA4A 4FM1A 3J8AA 3SQ4A 4GVMA 4JK8A 3THXB 3T1YK 3S3MA 3NMUA 4EFHA 4CVNE 3TR8A 4HUFA 3IG1A 4A62A 1VSDA 2DFFA 2RN2A 2B4JA 3AO5A 1P90A 1T7PA 4DQQA 1R0AA 2IGIA 5GAEP 4FK0A 1REVA 3DI6A 3IKMA 4IO9L 4DFPA 4PKHA 1C0TA 3VQ8A 2VCPA 3JS6A 2F9WA 2ATQA 4YORA 3C7NB 1QVGM 1KD1O 1YHQN 3WXLA 1YT3A 1XMOK 1R59O 1K73O 4ISFA 3F9KA 1EWQA 2FBYA 2WONA 2FC0A 1WB9A 2VG6A 3O3GA 1IG8A 1I94K 1N8RO 2YI1A 3T69A 2GTDA 5GIPA 2ZWHA 4IBNA 3T1AA 3ZSRA 2D0CA 4BRNA 1NK4A 3KTQA 2P5OA 4A5BA 4BRHA 3F2KA 5GINA 4FJ8A 4NCGA 5T7BA 4H8KA 1DLOA 3RMDA 4NLBA 2YNGA 3RR7A 2B6AA 4CF1A 2IAJA 3D2FA 3LWMA 3THWA 1JLEA 3HPGA 3T19A 4W5QA 4KHWA 4IEEA 2KLAA 3MN7A 1BUPA 1MU2A 4I7FA 4B1YB 1Q82O 1VQPN 3VERA 4FYDA 1RCHA 2O8EB 3SPZA 1QS4A 3PO5A 3RRHA 4AHSA 4DSEA 3VPZA 2P9SA 4WFBL 3V9UA 2X6NA 2HBMA 1N33K 2OZSA 3QB0A 3R1XA 3C0BA 3KHYA 1EO1A 3K59A 5ADXH 1D8YA 3H46O 1W0HA 4DLEA 1VSKA 1Z26A 4C23A 3DLEA 2VQFK 4FK4A 4JD2A 4B9TA 4CFDA 3J81O 4HUEA 2O4IA 3K5OA 2Q1NA 3CG7A 5EU7A 1NK6A 2F7TA 1WLJA 2NUBA 1CXUA 4O5FA 5FDLA 3ZT0A 4N41A 3J7YP 3HOSA 3HP6A 3THYA 3OYHA 2H3GX 4FO0A 3WXKA 1WNSA 3MMVA 3CJBA 3O08A 1NKCA 4F2RA 3WXIA 4C8OA 3MX5A 4GKJK 1JCFA 4M3RA 3KD1E 4FLUA 3J7ZO 4DSJA 2W6KA 3EE9A 3VENA 3W3DA 1BWFO 2G8WA 3M8PA 4B1ZA 1MWKA 3FZFA 3VQPA 1Z05A 4AH9A 1BIUA 4YDUC 5J1EA 3A0IX 1NWKA 4DU1A 1WSJA 3TTCA 4DUYK 2XY6A 2Q2RA 3K57A 1CLQA 4KKOA 1EQYA 3NF7A 3S3OA 2PAVA 2W00A 4Z4HA 1QQOA 4CF8A 2E5LK 4BRIA 1HNXK 4FK2A 1LW2A 3ZSOA 4AM7A 3ZCMA 2HBJA 4OKJA 4DV0K 1M90O 3ID6A 3FGUA 4LC9B 1X9WA 2HHQA 2ZF5O 3MECA 4LFCK 3B6OA 3LANA 5A2QO 4W5OA 1TK0A 3M5RA 3PSFA 4CERA 1TK8A 3LDQA 4B9MA 3CCSN 1IBMK 2KHOA 4O8KA 2HF3A 3WQTA 3V9SA 3V9WA 5C15A 4MDBA 5M1OA 2YJEA 1TAUA 5I42A 2FLOA 3OJUA 5CZ1A 1WAJA 3BZKA 3ISNC 1QTMA 3F5TA 3LPUA 5BREA 1E4GT 4O8UA 2HF4A 5ELZA 3EYZA 1X9SA 4PL8A 2NRZA 2O8DA 4DTOA 3KJVA 3V81A 5GAGP 4FLWA 1SL1A 3ZSZA 1CZAN 1XNQK 3O8MA 4WQ4C 4BRQA 2QXFA 2O8CA 1HPMA 4U7BA 1WN7A 3MK6A 2D5RA 4CHYA 1HKGA 3MDQA 3AVJA 3VEXA 3H3NO 4IZ9A 1X3NA 1QHAA 3P39A 3L4IA 2W41A 1KLNA 2DY4A 4B8AB 2D4WA 4ISEA 1TK5A 4CECA 5IWAK 4CJFA 1TV6A 3ZSVA 4E1NA 3JAMO 1BO5O 4O55A 2XHBA 1GLJO 4LSNA 1HQUA 5BPLA 1VK0A 1RBVA 3OY9A 1HNZK 3DOKA 3KWIA 1ZC6A 3HL8A 1MA9B 4WF9L 4E7IA 4NYNA 4OX9K 5AQSA 4F4KA 2P9UA 1SUQA 1KCFA 4LF6K 2WBNA 5GIOA 3EN9A 4B3TK 4PQUA 3OYFA 1QZ6A 5KPRA 1NK5A 1BQNA 2OPPA 3V1RA 3FZLA 4CE9A 3WEEB 3KWGA 3HVRA 4A61A 1BHLA 1DGKN 3VQ4A 1HYSA 4Y1CA 2NRRA 4BG9A 3SNNA 1S1WA 1WSGA 3KLIA 2P9NA 4I9LA 1T44A 2Q0UA 4AILC 4OPAA 1DT9A 5LJWA 5AQYA 2E6MA 4YY3K 5AQRA 3QNOA 4OO1J 3EZ5A 4A59A 1KFDA 2HNYA 4FWSA 3O4WA 4FLTA 4JK9A 3CCMN 3GL1A 1TKTA 2PY5A 2QK9A 2D1KA 3DM2A 1NJIO 1IV0A 4HTUA 4BC2A 3HOTA 1NOZA 3VMFB 1RBRA 4JKGA 5I9EB 5E84A 1YTUA 1YF5L 4CD3A 3OYGA 5CY4A 4IFYA 3WNFA 1BGXT 2ZE2A 1EX4A 5DM7L 3VEWA 4DR5K 4LF4K 4BWMA 2HHSA 1KAZA 4BE7B 3SK3A 4E1MA 4FZZA 3QBWA 5F2RA 4KHQA 4B8CA 1SZ2A 2RKIA 2YKMA 3BY5A 5K14A 3SUQA 5CE3A 3SPYA 3T7ZA 1CZ9A 1Q81O 4Y1DA 4GV3A 3OYMA 1NJZA 4FJGA 4CGDA 2X74A 3C6UA 4IDKA 2Q36A 4KBOA 3O9SA 2IDOA 4J2DA 1T05A 3DRRA 5LJVA 1JLBA 2P51A 3RMCA 1S6PA 3NCIA 4BRGA 4DKWA 2Y1IA 1OH5A 3I55N 3ZSQA 3PLAA 4CZJA 2OCEA 3MEEA 3F73A 5JS1A 4CJKA 1J5EK 4M3YA 4CBUA 1B92A 3VETA 4Z4EA 2QWPA 3CFOA 3AVIA 3G6EN 4JI6K 1VSFA 4BGAA 4FLXA 4EP5A 2AP1A 4FJ5A 1RTHA 4H0XB 2I5JA 4BC3A 2OPSA 3QETA 3AVHA 3O9QA 4XEIA 5F1XA 3V6DA 1D9FA 2JLEA 3DXMB 3VA3A 3O4NA 3PO4A 4ZTFA 4DF4A 4O44A 4GV9A 4M42A 3KK3A 5AQKA 3AV9A 3OW2M 3ZYYX 3TAGA 3R6MA 2IVNA 4G1QA 4CFBA 3O3HA 2XY8A 5CZ2A 4DU3A 4DWIA 4DV6K 3CCRN 2PBDA 3U6FA 1WBDA 4FZYA 1IKXA 4IJNA 4CIFA 1FKOA 2UU9K 1Q18A 4MO5A 4KHPK 1L3UA 3TAQA 1S1XA 1S5JA 2FF3B 1NGHA 3RVCA 1VQNN 1U6ZA 3VQEA 4XH5A 3HTVA 3AO2A 2HOEA 3VQ6A 3QEVA 4IFVA 3WNHA 2EX3A 3OS2A 5AZJB 1KRPA 3FZKA 1TL1A 3GG4A 4IO8A 3A5MC 4BRMA 4BQLA 1IKVA 3HYFA 3SQ2A 3HT3A 3LM9A 4KFBA 1N32K 1SL2A 4RG8A 4H0VB 2NRTA 3AVFA 4RWTA 2HBLA 2P9NB 3SI6A 1VSLA 4WE1A 4DV5K 4LY7A 3P38A 2QWNA 4B9QA 1VQ4N 4A2AA 5FRMA 1GLDG 4FWMA 4FOEA 5AQHA 3OYAA 3MAQA 3CXCM 1FXXA 4F8RA 4KB1A 4CFAA 4RW4A 2BH1A 2NRXA 4A2BA 2NZTA 2G8KA 3TTDA 3SQ0A 1NGBA 5B8HA 1BIZA 3NH1A 1RTDA 3M1FA 3QINA 5EVZA 1HYZA 1BG3A 4DFMA 1FKPA 3E9LA 4Z0UA 1HLUA 2CGKA 5AQOA 5C10A 1VQ9N 3AA2A 3VEZA 1WSEA 2VGMA 3MN5A 4JLHA 2QA4N 4BDPA 5JICA 1Q86O 1YIJN 4EAHD 4O0IA 1LAVA 2V7YA 2GWJA 4GY2B 3FFIA 3TAEA 3TSUA 2O8CB 3S9HA 4M3UA 5C2FA 3CJCA 3IMXA 3ZX0A 4DQRA 1YI2N 4J8FA 3PV8A 4OGCA 4Z4GA 3CCQN 3D2FB 3QFPA 4FW2A 5M1KA 3AVAA 3C6TA 4C8KA 1D4XA 3LPTA 2QWMA 4RW8A 4ELTA 1S3XA 2YHAA 4BRCA 3SZ2A 3E01A 3HPHA 3ZX2A 1V4SA 4N5SA 2HVIA 4OKKA 1RDAA 4HUGA 1RT2A 2AJQA 3DLRA 3HSTB 4HWIA 1VSHA 3LALA 2D0OA 2ZD1A 1U49A 3C95A 2DFHA 3C7NA 3MEDA 4FXDA 1VQ7N 3VEYA 3H45C 4ISGA 4B1VA 3RRGA 4JD2B 3THXA 3KK1A 2NNWA 1ZBLA 1SQKA 4JRPA 2P9LA 5FPMA 1U04A 4F9OA 3NGIA 3ZSXA 3VEVA 2GBZA 1VAZA 3OHRA 3P4IA 4H0YB 3LM2A 2A1RA 3ZX3A 4EZ9A 1GOBA 4RW9A 1X1PA 1ZBUA 5EOYA 1HNVA 5CYQA 4EP4A 3D0PA 4DQSA 2VG7A 5LL6Z 2RF2A 4NLCA 1KAXA 4E72A 3C65A 1JLGA 3I0SA 1I3AA 3VQQA 3AVGA 2WTUA 2NLXA 1S72N 4EHTA 3QNNA 4C8LA 4LFBK 3QEWA 4ZHRA 4MDAA 3AO4A 4C8NA 5KQ8A 1C0MA 2ZGYA 4XH4A 2KZMA 4FVMA 4OPKA 3P83D 3R8EA 4FJ7A 4FJNA 3FFKB 1YJNN 4IXCA 4FLYA 1G99A 2G8IA 1BA1A 1YTAA 3AVNA 4M3XA 2ZGZA 2EWSA 4DR4K 3NGYA 5KQDA 4JS4A 4JI7K 1LV5A 3OYCA 3TAFA 2FF6A 1FJGK 1S1VA 3ZLJA 4CHQA 1IG9A 3B8AX 4F3TA 3C6AA 1A5WA 2AA4A 4DTSA 1SKRA 4JI4K 3U9ZA 1DTQA 3SAGA 2E6LA 3VQCA 4DV2K 3BEXA 4PL7A 1ASWA 4LF5K 4QOZB 4CF9A 2HMPA 5FPDA 3VQ9A 2X78A 2LSNA 4BE2A 3ZETA 4DSFA 3DLBA 5J2NA 4M3WA 4EZ6A 3CERA 4BVOA 3OYJA 5AQUA 3PIOL 4CHOA 4F2SA 1RDDA 4LSLA 4FSVA 3SJHA 1MWMA 1DEJA 4DTUA 1BI4B 1B9FA 4YDUA 4BWJA 3E9OA 4NB4A 4FM0A 2ZJPL 5C42A 4KPYA 1IBLK 1WSHA 4K0KK 3PX4A 3V9XA 1H1VA 4GMJB 1HYVA 3TSQA 2CH5A 4YHHK 1HPZA 4JK7A 1A5VA 3LDNA 4DF8A 3H1QA 5CHIA 1UOCA 4DV1K 1ASVA 3TABA 4CBWA 2HHUA 4OLBA 4GNIA 1WAFA 1K8KB 5EY4A 2E88A 4FLVA 4K42A 4KHSA 1YVUA 2GUIA 1J54A 4IDHA 1RT5A 1NJXA 4KTQA 3SMSA 3VTHA 4CZIA 1TKZA 3HVTA 3IUCA
chains in the Genus database with same CATH topology
5E84A 4IJAA 3U9DA 1GLAG 1YF5L 4CD3A 2WFBA 2A5XA 3OBYA 1IJJA 1YVNA 5FPNA 1Z6RA 4CZMA 5AZIB 4BC4A 1X9JA 3CCEN 3SLCA 4BR9A 1DKGD 4CJ7A 4BR4A 4H0PA 2HSTA 1RDWX 3H6EA 4FWRA 5EX5A 3VGKA 3CI5A 3AAPA 4K43A 4QS9A 2VYPA 5DM7L 2HBKA 5BN9A 1YAGA 2ITMA 3OBWA 2NRWA 3VEWA 2GELA 3CMEN 2QTDA 3DJCA 2YHYA 1NGDA 3CHWA 4H5VA 1KAZA 1Y64A 4KH6A 3SK3A 4BE7B 5C12A 3QBWA 5F2RA 3VGMA 4ILHA 3MWPA 1HKBA 2CH6A 3ENOA 1SZ2A 3L0QA 3WXJA 4G9ZA 4MO4A 3CJAA 3BUZB 5H1SQ 3I56N 1NGJA 1ZXOA 4CZHA 4KH5A 3DXKA 4JKBA 5BPMA 5CE3A 1TYQB 1JJ2M 3CETA 3D2EA 2E1ZA 1SS6A 3CJ9A 3Q7CA 5AQTA 1YITN 1ILYA 3T7ZA 3UKRB 1HKCA 5AQIA 2C1GA 3HM8A 3RSEB 4H5WA 1Q81O 4GV3A 2YX6A 4JAXA 4BVPA 3LDPA 2IVPA 1VQON 3EE8A 3MX2A 2P9IA 3L6QA 2Q36A 1GLEG 4KBOA 3UB5A 5JLHA 4XH1A 1GLFO 2GX9A 3O9SA 3DXMA 2I7PA 3LDOA 4H5RA 3W0LA 5TKWA 4CD1A 3ZETB 2RHKA 5LJVA 3MCPA 1O13A 1QQMA 4BROA 4JN4A 1Q7YO 3ENBA 3CJ7A 2P9PB 4BRGA 3A5LC 4BRAA 4DCHA 4DKWA 3I55N 1JCEA 1WOQA 3PLAA 4JKAA 4CZJA 3MWTA 2BUPA 5HOOA 1ATNA 2P9KB 4BR2A 5HL7L 2YJFA 4CBUA 3VETA 4FVUA 4MLHA 2QWPA 1RFQA 3CQXA 2QWOA 3TTFA 2P9UB 5BPNA 3G6EN 2FSJA 5JVGL 3VTIA 3ZEUB 1VQ5N 3E9PA 3G25A 4JNEA 4BGAA 4CZLA 2AP1A 2QXLA 3D7EO 4H0XB 4B1UB 4BC3A 2PFUA 4DQ8A 2GEMA 1HX1A 1KXPA 3DWLA 3QBXA 3CPEA 3CMAN 3O9QA 1TUUA 4XEIA 5F1XA 3BF1A 3SAFA 1V4TA 3WEEA 2UYTA 2QW9A 3AARA 3DXMB 2VGNA 2QWRA 1WUAA 1XQSC 3HI0A 4Y0WA 5F0XA 4EHUA 4BRPA 1T3VA 4RCHA 1LCUA 3IDHA 2E2PA 3CQYA 4FWQA 2QEXN 3I33A 4YOWA 3A5NC 3L4QA 4GV9A 3SBGA 5AQKA 5M1QA 2YCHA 3OW2M 2JWKA 4XJXA 2I7NA 2P9SB 3ZYYX 5KPZA 3ULEB 3WQUA 2E8AA 2BTFA 4BEBA 3R6MA 2IVNA 2IIRA 3SBTA 2ZJQL 3IFRA 2VWBA 4JKFA 2ASMA 2Q31A 5M1NA 2WC9A 3ATUA 4WFAL 2PBDA 3CCRN 4FL9A 5JVHL 3ZEUA 1RGIA 2QM1A 2DPNA 4IJNA 5DM6L 3QDKA 3LDLA 1Q18A 4H5TA 4UY8O 3EKSA 4MO5A 2Q0RA 4FOIA 3VESA 3O80A 4FWLA 4BRDA 1M1KO 2FF3B 5AZIA 1NGHA 3RSEA 2E2NA 3RVCA 4JKEA 1VQNN 3J8AA 1HUXA 4JK8A 1U6ZA 4QS8A 3TPQA 3NMUA 4H0TB 4XH5A 3HTVA 2HOEA 3EKUA 4EFHA 5AFUA 4BRKA 4GV6A 4A62A 4U67L 3MCAB 5AZJB 3FZKA 3Q7BA 1VQMN 1P90A 3GG4A 3FZHA 4FWPA 3A5MC 4IO8A 3GDQA 4BC5A 4BRMA 4CBXA 4BQLA 5GAEP 3LM9A 2F9TA 3KVGA 3IKMA 4JHDB 4CZFA 4IO9L 4PKHA 2E1YA 2NRTA 2ASOA 4H0VB 4B1WB 4BR0A 3ID8A 4RWTA 2HBLA 2P9NB 5AQVA 1S22A 2VCPA 3JS6A 2F9WA 4YORA 1QVGM 3C7NB 4CZGA 1KD1O 4I6MB 4WYBA 1C0GA 3WXLA 1YHQN 1K8KA 3P38A 4FPAA 2QWNA 4B9QA 1VQ4N 1R59O 1K73O 4ISFA 4A2AA 4FPBA 1GLDG 4FWMA 4FOEA 5TKYA 1YUWA 1IG8A 5AQHA 3UE5A 3P31A 2YI1A 3KZBA 1P8ZA 2P9LB 5AR0A 3T69A 3CXCM 2A6AA 2GTDA 1HJOA 1ATSA 3CCUN 1OKJA 3R9PA 5BR9A 5GIPA 3U4LA 4IFEA 2ZWHA 4BRNA 3NVKA 3AAQA 3HRGA 1XC3A 4A5BA 4BRHA 4GVEA 3O6WA 3F2KA 5GINA 2BH1A 3FE1A 2NRXA 5M1FA 4A2BA 4JKGB 3E66A 3SMPA 2NZTA 2JWLA 4JKCA 5E26A 4ILGB 4NLBA 3F9MA 3D2FA 3K9JA 3TTDA 3LL3A 2W40A 4C1NI 4HTLA 1NGBA 4A5AA 4BRFA 5B8HA 5C0YA 4WQ5A 2FXUA 4IEEA 3M1FA 5EVZA 2KLAA 3CCLN 3MN7A 1BG3A 1BUPA 2V52B 5BRHA 3E9LA 1HLUA 2CGKA 2WUSA 3BP8A 2QWQA 1BU6O 3GBTA 3N4QA 4MLEA 4Z94A 5AQOA 4B1YB 5C10A 1Q82O 1VQ9N 3WUHA 1VQPN 3VEZA 3VERA 3HBTA 2VGMA 3MN5A 2QA4N 3O9UA 5JICA 1Q86O 3K9KA 1T6CA 3VPZA 2P9SA 4WFBL 4EAHD 1YIJN 2HBMA 2V7YA 3CC2N 3QB0A 3R1XA 4M63C 2ASPA 2GWJA 3C0BA 3KHYA 1EO1A 2NRVA 4GY2B 4AM6A 5ADXH 3DXKB 5MLCQ 1ESVA 3H46O 3PIPL 3TSUA 4WQ4A 4C23A 5C2FA 4B1XB 3CJCA 3HSCA 3IMXA 3ZX0A 3CF5L 1NGAA 1YI2N 3CIPA 4JD2A 2RE2A 4J8FA 2V7ZA 5FPEA 1VQ8N 3CCQN 3ATVA 3G4SN 4BGBA 4BECA 3VEOA 3D2FB 2Q1NA 3QFPA 5M1KA 5AQLA 5AQPA 5C2DA 1K8AO 2OTJN 1D4XA 2QWMA 4DB3A 1NGEA 2YHWA 4IWVA 2Q97A 2F7TA 1T6DA 4JKHA 1S3XA 3G71N 4YOUA 4O5FA 4BRCA 5AZJA 2E2QA 3ZX2A 1V4SA 3HOSA 1KAYA 2OANA 3O9TA 4BR5A 2H3GX 1LOTB 4FO0A 3WXKA 4HWIA 2A42A 3H1VX 4A57A 3MMVA 3CJBA 3O08A 2D0OA 3AY9A 3CD6N 2C1IA 2V51B 5ADXA 3WXIA 4FWOA 4KH4A 3CCVN 3C7NA 3MX5A 3S41A 1JCFA 3CC7N 4ILJA 1VQ7N 3VEYA 3H45C 4ISGA 4B1VA 3J7ZO 3VMFB 2A3ZA 4JD2B 3EE9A 3VENA 2NNWA 1SQKA 3W3DA 1BWFO 1GLLO 3A5OC 3CC4N 3EL2A 4H5NA 4L3QA 2P9LA 5FPMA 1YXQA 4B1ZA 5JMVA 1MWKA 3FZFA 4F9OA 1Z05A 2OTLN 4YDUC 3VEVA 4C1NK 1VAZA 3A0IX 3OHRA 1NWKA 3P4IA 4H0YB 2ZJRL 3TTCA 2Q2RA 3LM2A 3TSPA 3ZX3A 3H3OB 2A41A 3FLCO 1EQYA 4BQZA 4RTFD 2PAVA 5EOYA 2W00A 1VQ6N 5GAHP 1QQOA 2FSNA 1NGGA 4I6MA 3E1YA 4NLCA 1KAXA 3QICA 4NO7A 5AQXA 3C65A 4BRIA 1KQSM 1K9MO 3DLLL 3KK7A 4AM7A 3N4PA 4FWNA 4IOAL 2HBJA 2NLXA 1S72N 3ULEA 3R3LA 1M90O 3ID6A 4EHTA 3FGUA 5AQNA 3FZMA 4LC9B 2ZF5O 3M6GA 5JLFA 2QWLA 5M1PA 2NRHA 3CJ1A 4MDAA 4H0OA 1U2VB 3M5RA 5KQ8A 4YOYA 1NMDA 3VF2A 5AQQA 1RDUA 3VGLA 2ZGYA 3LDQA 3CCSN 2P9IB 2KHOA 1J6ZA 2GUPA 2HF3A 4O8KA 3WQTA 5BRFA 1QVFM 5C15A 4MDBA 3EZWA 4XH4A 5M1OA 4YOTA 2YJEA 3A8YA 3HZ6A 4WQ5C 3R8EA 1KC8O 4CI6A 1GLCG 4WFNL 3O1WA 2FLOA 3FFKB 1YJNN 4R79A 4IXCA 5I9EB 4JKDA 1G99A 3F5TA 3WT0A 5BREA 4E1JA 2E2OA 1N8RO 2P9PA 1E4GT 4O8UA 2HF4A 3BF3A 1BA1A 3JXUA 5ELZA 5AQMA 2ZGZA 4PL8A 5AQFA 4M7YA 4BRLA 2NRZA 3NVMA 2EWSA 3FR0A 1YJWN 1W2BM 4AF1A 5LY3A 4CZEA 5GAGP 5KQDA 1X3MA 4EIAA 4YOVA 4JHDA 2FF6A 4K41A 1CZAN 1QQNA 2CGJA 3O8MA 4WQ4C 4BRQA 3B8AX 3C6AA 1HPMA 4U7BA 2AA4A 3O5BA 1NBWA 3MK6A 1VQLN 3U9ZA 3D6RA 1HKGA 3MDQA 4IEIA 3QFUA 3QMLA 3VEXA 5BN8A 3H3NO 4IZ9A 3VF4A 3SAGA 1X3NA 1QHAA 3UKRA 3BEXA 1YJ9N 4PL7A 4K25A 3P39A 4BY9C 3L4IA 2E20A 4PKGA 2W41A 4IOXA 1NGIA 1ZBSA 3ENHA 5EXWA 4PHTX 2J4RA 1BDGA 1E4FT 5AQZA 5AQWA 2D4WA 1NM1A 3AGKA 2HMPA 3I8BA 4ISEA 5FPDA 3TU5A 3ZETA 2GWKA 4PKIA 1BO5O 4WCEL 3CERA 1GLJO 1BA0A 3VF6A 3O9RA 4BVOA 2QI2A 2FSKA 5BPLA 5AFUH 3U8XA 1TYQA 5AQUA 1BOTO 1OVYA 3KWIA 1ZC6A 4QS7A 1MA9B 3OA9A 3PIOL 4WF9L 2P9KA 4FSVA 1TUYA 1GLBG 1ATRA 2KKZA 1W97L 5AQSA 3SJHA 4DHYA 1MWMA 1DEJA 2CGLA 2P9UA 2YHXA 4YDUA 3WXMB 2WBNA 2IVOA 3EN9A 3E9OA 5GIOA 1U2VA 4NB4A 4JEPA 5GADP 2ZJPL 1QZ6A 4BG8A 5KPRA 3UKUB 3O1BA 4H03B 1SAZA 4M7XA 3FZLA 1H1VA 3WEEB 1NLVA 3KWGA 3TSQA 2CH5A 3GOIA 4BR7A 1QZ5A 4JK7A 5AQGA 5BRDA 4A61A 1VQKN 3LDNA 3VOVA 1DGKN 4BG9A 2NRRA 1C0FA 3H1QA 5CHIA 2P9NA 1JCGA 4CBWA 3GE1A 1T44A 4CZKA 2Q0UA 2A40A 4GNIA 3MN9A 1XUPO 4OPAA 1DT9A 1K8KB 3AGRA 4IOCL 5CR4A 5EY4A 2E88A 4K42A 3CPWM 5LJWA 5AQYA 3EO3A 4OPHA 3M3ZA 3DAWA 5AQRA 4OO1J 4YOXA 4BREA 1NGCA 4A59A 4FWSA 3SAHA 4IDHA 5AQJA 1NGFA 2D0PA 3O4WA 1MDUB 4JK9A 3D2EB 3CCMN 3GL1A 5KPTA 2D1KA 1NJIO 3SMSA 3UKUA 3VTHA 4CZIA 4BC2A 3HOTA 3C6HA 4FWKA 3CCJN 3IUCA 3MN6A 4JKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E84 A;  4IJA A;  3U9D A;  1GLA G;  4CD3 A;  2A5X A;  1IJJ A;  1YVN A;  5FPN A;  1Z6R A;  4CZM A;  5AZI B;  4BC4 A;  1X9J A;  3SLC A;  4BR9 A;  1DKG D;  4CJ7 A;  4BR4 A;  4H0P A;  3VGK A;  1RDW X;  3H6E A;  4FWR A;  5EX5 A;  3CI5 A;  3AAP A;  4K43 A;  4QS9 A;  2VYP A;  2ITM A;  5BN9 A;  1YAG A;  3VEW A;  2GEL A;  3DJC A;  2YHY A;  1NGD A;  3CHW A;  4H5V A;  1KAZ A;  1Y64 A;  3SK3 A;  3QBW A;  5F2R A;  3VGM A;  1HKB A;  2CH6 A;  3ENO A;  1SZ2 A;  3L0Q A;  3WXJ A;  4MO4 A;  3CJA A;  3BUZ B;  1NGJ A;  1ZXO A;  4CZH A;  3DXK A;  5BPM A;  5CE3 A;  1TYQ B;  3CET A;  3D2E A;  2E1Z A;  3CJ9 A;  5AQT A;  3UKR B;  1HKC A;  5AQI A;  3HM8 A;  3RSE B;  4H5W A;  4JAX A;  4BVP A;  3LDP A;  2IVP A;  2P9I A;  3L6Q A;  2Q36 A;  1GLE G;  4KBO A;  3UB5 A;  5JLH A;  4XH1 A;  1GLF O;  3DXM A;  2I7P A;  3LDO A;  4H5R A;  3W0L A;  4CD1 A;  5LJV A;  3ZET B;  3MCP A;  1QQM A;  4BRO A;  4JN4 A;  3CJ7 A;  2P9P B;  4BRG A;  3A5L C;  4BRA A;  4DCH A;  1JCE A;  1WOQ A;  4CZJ A;  2BUP A;  1ATN A;  2P9K B;  4BR2 A;  2YJF A;  4CBU A;  3VET A;  4MLH A;  2QWP A;  1RFQ A;  3CQX A;  2QWO A;  2P9U B;  5BPN A;  2FSJ A;  3ZEU B;  4JNE A;  3G25 A;  4BGA A;  4CZL A;  2AP1 A;  2QXL A;  3D7E O;  4H0X B;  4B1U B;  4BC3 A;  4DQ8 A;  2GEM A;  1HX1 A;  1KXP A;  3DWL A;  3QBX A;  1TUU A;  4XEI A;  5F1X A;  3BF1 A;  1V4T A;  3WEE A;  2UYT A;  2QW9 A;  3AAR A;  3DXM B;  2QWR A;  1WUA A;  1XQS C;  3HI0 A;  4Y0W A;  5F0X A;  4EHU A;  4BRP A;  4RCH A;  1LCU A;  3IDH A;  2E2P A;  3CQY A;  4FWQ A;  3I33 A;  3A5N C;  5AQK A;  2YCH A;  2I7N A;  2P9S B;  5KPZ A;  3ULE B;  3WQU A;  2E8A A;  2BTF A;  3R6M A;  2IVN A;  2IIR A;  3IFR A;  2VWB A;  2ASM A;  2Q31 A;  3ATU A;  2PBD A;  4FL9 A;  3ZEU A;  1RGI A;  2QM1 A;  2DPN A;  4IJN A;  3QDK A;  3LDL A;  1Q18 A;  4H5T A;  3EKS A;  4MO5 A;  2Q0R A;  4FOI A;  3VES A;  3O80 A;  4FWL A;  4BRD A;  2FF3 B;  5AZI A;  1NGH A;  3RSE A;  2E2N A;  3J8A A;  1HUX A;  3TPQ A;  1U6Z A;  4QS8 A;  4H0T B;  4XH5 A;  3HTV A;  2HOE A;  3EKU A;  4EFH A;  5AFU A;  4BRK A;  4A62 A;  5AZJ B;  3FZK A;  3GG4 A;  3FZH A;  4FWP A;  3A5M C;  4IO8 A;  3GDQ A;  4BC5 A;  4BRM A;  4CBX A;  4BQL A;  3LM9 A;  2F9T A;  3KVG A;  4JHD B;  4CZF A;  4PKH A;  2E1Y A;  4H0V B;  2ASO A;  4B1W B;  4BR0 A;  4RWT A;  3ID8 A;  2P9N B;  5AQV A;  1S22 A;  2VCP A;  3JS6 A;  2F9W A;  3C7N B;  4CZG A;  4I6M B;  4WYB A;  1C0G A;  3WXL A;  1K8K A;  4FPA A;  2QWN A;  4B9Q A;  1R59 O;  4ISF A;  4A2A A;  4FPB A;  1GLD G;  4FWM A;  4FOE A;  5TKY A;  1YUW A;  1IG8 A;  5AQH A;  3UE5 A;  2YI1 A;  3KZB A;  1P8Z A;  2P9L B;  5AR0 A;  2A6A A;  2GTD A;  1HJO A;  1ATS A;  1OKJ A;  3R9P A;  5BR9 A;  3U4L A;  2ZWH A;  4BRN A;  3AAQ A;  1XC3 A;  4BRH A;  3O6W A;  3FE1 A;  4A2B A;  3SMP A;  2NZT A;  5E26 A;  3F9M A;  3D2F A;  3LL3 A;  2W40 A;  4HTL A;  1NGB A;  4BRF A;  5B8H A;  4WQ5 A;  2FXU A;  3M1F A;  5EVZ A;  3MN7 A;  1BG3 A;  1BUP A;  2V52 B;  5BRH A;  1HLU A;  2CGK A;  2WUS A;  3BP8 A;  2QWQ A;  1BU6 O;  3GBT A;  4MLE A;  5AQO A;  4Z94 A;  4B1Y B;  5LY3 A;  3WUH A;  3VEZ A;  3VER A;  3HBT A;  3MN5 A;  5JIC A;  1T6C A;  3VPZ A;  2P9S A;  4EAH D;  2V7Y A;  3QB0 A;  4M63 C;  2ASP A;  2GWJ A;  3C0B A;  3KHY A;  4GY2 B;  4AM6 A;  5ADX H;  3DXK B;  1ESV A;  3H46 O;  4WQ4 A;  4C23 A;  4B1X B;  3CJC A;  3HSC A;  3IMX A;  3ZX0 A;  1NGA A;  3CIP A;  4JD2 A;  4J8F A;  2V7Z A;  5FPE A;  3ATV A;  4BGB A;  3VEO A;  3D2F B;  2Q1N A;  3QFP A;  5AQL A;  5AQP A;  1D4X A;  2QWM A;  4DB3 A;  1NGE A;  2YHW A;  4IWV A;  2Q97 A;  1T6D A;  1S3X A;  4O5F A;  4BRC A;  5AZJ A;  2E2Q A;  3ZX2 A;  1V4S A;  1KAY A;  2OAN A;  4BR5 A;  2H3G X;  1LOT B;  4FO0 A;  3WXK A;  4HWI A;  2A42 A;  3H1V X;  3MMV A;  3CJB A;  3O08 A;  2D0O A;  3AY9 A;  2V51 B;  5ADX A;  3WXI A;  4FWO A;  3C7N A;  3S41 A;  1JCF A;  3VEY A;  3H45 C;  4ISG A;  4B1V A;  2A3Z A;  4JD2 B;  3VEN A;  1SQK A;  3W3D A;  1BWF O;  1GLL O;  3A5O C;  3EL2 A;  4H5N A;  4L3Q A;  2P9L A;  5FPM A;  1YXQ A;  4B1Z A;  5JMV A;  1MWK A;  3FZF A;  4F9O A;  1Z05 A;  4YDU C;  3VEV A;  3A0I X;  3OHR A;  1NWK A;  3P4I A;  4H0Y B;  2Q2R A;  3LM2 A;  3ZX3 A;  3H3O B;  2A41 A;  3FLC O;  1EQY A;  4BQZ A;  4RTF D;  2PAV A;  5EOY A;  1QQO A;  2FSN A;  1NGG A;  4I6M A;  4NO7 A;  5AQX A;  1KAX A;  3QIC A;  4BRI A;  4AM7 A;  4FWN A;  2NLX A;  3ULE A;  4EHT A;  3FGU A;  5AQN A;  3FZM A;  4LC9 B;  2ZF5 O;  3M6G A;  5JLF A;  2QWL A;  2NRH A;  3CJ1 A;  4H0O A;  1U2V B;  5KQ8 A;  1NMD A;  3VF2 A;  5AQQ A;  3VGL A;  2ZGY A;  3LDQ A;  2P9I B;  2KHO A;  1J6Z A;  2GUP A;  2HF3 A;  4O8K A;  3WQT A;  5BRF A;  3EZW A;  4XH4 A;  2YJE A;  3A8Y A;  3HZ6 A;  4WQ5 C;  3R8E A;  4CI6 A;  1GLC G;  3O1W A;  2FLO A;  3FFK B;  4IXC A;  1G99 A;  3WT0 A;  5BRE A;  4E1J A;  2E2O A;  2P9P A;  1E4G T;  2HF4 A;  3BF3 A;  1BA1 A;  3JXU A;  5ELZ A;  5AQM A;  2ZGZ A;  4PL8 A;  5AQF A;  4M7Y A;  4BRL A;  2EWS A;  3FR0 A;  4CZE A;  5KQD A;  1X3M A;  4EIA A;  4JHD A;  2FF6 A;  4K41 A;  1CZA N;  1QQN A;  2CGJ A;  3O8M A;  4WQ4 C;  4BRQ A;  3B8A X;  1HPM A;  2AA4 A;  3O5B A;  1NBW A;  3MK6 A;  3U9Z A;  1HKG A;  3MDQ A;  3QFU A;  3QML A;  3VEX A;  5BN8 A;  3H3N O;  4IZ9 A;  3VF4 A;  1X3N A;  1QHA A;  3UKR A;  3BEX A;  4PL7 A;  4K25 A;  3L4I A;  2E20 A;  4PKG A;  2W41 A;  1NGI A;  1ZBS A;  3ENH A;  5EXW A;  2J4R A;  1BDG A;  1E4F T;  5AQZ A;  5AQW A;  2D4W A;  1NM1 A;  2HMP A;  3I8B A;  4ISE A;  5FPD A;  3TU5 A;  3ZET A;  2GWK A;  4PKI A;  1BO5 O;  3CER A;  1GLJ O;  1BA0 A;  3VF6 A;  4BVO A;  2FSK A;  5BPL A;  5AFU H;  3U8X A;  1TYQ A;  5AQU A;  1BOT O;  1ZC6 A;  4QS7 A;  1MA9 B;  2P9K A;  4FSV A;  1TUY A;  1GLB G;  1ATR A;  5AQS A;  3SJH A;  4DHY A;  1MWM A;  1DEJ A;  2CGL A;  2P9U A;  2YHX A;  4YDU A;  2IVO A;  3EN9 A;  1U2V A;  4NB4 A;  1QZ6 A;  4BG8 A;  5KPR A;  3UKU B;  3O1B A;  4H03 B;  1SAZ A;  4M7X A;  3FZL A;  1H1V A;  3WEE B;  1NLV A;  2CH5 A;  3GOI A;  4BR7 A;  1QZ5 A;  5AQG A;  5BRD A;  4A61 A;  3LDN A;  3VOV A;  1DGK N;  4BG9 A;  1C0F A;  3H1Q A;  2P9N A;  1JCG A;  4CBW A;  3GE1 A;  1T44 A;  4CZK A;  2Q0U A;  2A40 A;  4GNI A;  3MN9 A;  1XUP O;  1K8K B;  5EY4 A;  2E88 A;  4K42 A;  5LJW A;  5AQY A;  3EO3 A;  3M3Z A;  3DAW A;  5AQR A;  4BRE A;  1NGC A;  4FWS A;  5AQJ A;  1NGF A;  2D0P A;  3O4W A;  1MDU B;  3D2E B;  3GL1 A;  5KPT A;  2D1K A;  3SMS A;  3UKU A;  4CZI A;  4BC2 A;  4FWK A;  3IUC A;  3MN6 A;  5I9E B; 
#chains in the Genus database with same CATH topology
 3S3N A;  3U9D A;  4DR3 K;  3VQB A;  3V4I A;  4O0J A;  5FPN A;  1C0U A;  4BC4 A;  4NXN K;  4JI8 K;  4FJM A;  5KGW A;  2DTU A;  2DFE A;  2ITG A;  4BR4 A;  4FWR A;  5EX5 A;  4QS9 A;  3SJJ A;  1SV5 A;  2VYP A;  1YAG A;  1J5O A;  2NRW A;  1Z25 A;  3KLG A;  2GEL A;  4H4M A;  4DU4 A;  1NNE A;  3CME N;  3DJC A;  4W5T A;  3CHW A;  4NCA A;  4H5V A;  2XRI A;  4IG0 A;  2YNI A;  5IT9 O;  1RBT A;  3L3V A;  3L0Q A;  2FBT A;  4MO4 A;  1SKS A;  4CIG A;  5H1S Q;  1RT4 A;  3HP9 A;  1ZXO A;  4CZH A;  4F3O A;  4DR2 K;  2E1Z A;  1YIT N;  1RT3 A;  3WNE A;  3RSE B;  3QES A;  4JAX A;  1Q9X A;  1S1T A;  1VQO N;  2P9I A;  3L6Q A;  5JLH A;  4CED A;  4ICL A;  1GLF O;  2GX9 A;  3ZT2 A;  3SYZ A;  2I7P A;  3LDO A;  4H5R A;  4CD1 A;  5TKW A;  4CJR A;  3ZET B;  2G8V A;  5HRS A;  3V9Z A;  3SV3 A;  4AHV A;  4B9S A;  1O13 A;  1QQM A;  4JN4 A;  4CEO A;  1S9G A;  1VHX A;  3K58 A;  3CJ7 A;  4DR1 K;  2P9P B;  3QLH A;  2P5G A;  4BRA A;  4DCH A;  4YNQ A;  4DR7 K;  3KLE A;  4BE1 A;  1KVC A;  1S1U A;  1RT1 A;  1W9H A;  4JKA A;  1RTJ A;  4FJH A;  2BUP A;  3G10 A;  1ATN A;  4BR2 A;  3O3F A;  1NMN A;  4C8M A;  3C94 A;  2YJF A;  4RW7 A;  1ZBH A;  3AVK A;  4FVU A;  3RWU A;  2QWO A;  3TTF A;  1NJW A;  3AA3 A;  1CZB A;  3VTI A;  1VQ5 N;  3E9P A;  3P1G A;  4FJJ A;  3D7E O;  4B1U B;  3ZSY A;  3TI0 A;  1KXP A;  1HRH A;  3TAP A;  3QBX A;  3K0S A;  4H4O A;  3BF1 A;  3WEE A;  2VGN A;  1WUA A;  2UUA K;  4EHU A;  3RMB A;  4AHU A;  2WOM A;  1XC9 A;  3IDH A;  1NOY A;  2QEX N;  4YOW A;  3A5N C;  3L4Q A;  3SBG A;  4KHU A;  3M8Q A;  4Z4C A;  1JLA A;  5JS2 A;  3VA0 A;  3T3F A;  3PX0 A;  5KPZ A;  3ULE B;  2E8A A;  2BTF A;  2JGU A;  2IIR A;  3LDS A;  4DS4 A;  3IFR A;  4JKF A;  2ASM A;  2Q31 A;  2O8F B;  1ASU A;  2UXD K;  3MXI A;  2QM1 A;  4Z4F A;  2R7Y A;  1FK9 A;  2XO7 A;  2YV0 X;  3VN5 A;  4CJT A;  3NH2 A;  5HRO A;  3NH0 A;  1VSE A;  4CIE A;  1M1K O;  3RSE A;  3QIO A;  4FJK A;  4JKE A;  1HUX A;  2Y1J A;  3EKU A;  3CQ8 A;  4U67 L;  5J2M A;  1W7A A;  4CJP A;  1JXB A;  1RDB A;  4CBX A;  3MXJ A;  4CEE A;  4JHD B;  4JI1 K;  2G8U A;  2E1Y A;  4BR0 A;  4HVJ A;  4OJR A;  3ID8 A;  4KRF A;  1N6Q A;  4CEQ A;  3ZSW A;  1CXQ A;  5FRO A;  4O4G A;  4CZG A;  1JLF A;  4I6M B;  4WYB A;  4CCH A;  1IBK K;  4DQP A;  4ELU A;  4LH5 A;  4AHC A;  4FPB A;  1XHZ A;  3CFP A;  4DUZ K;  5TKY A;  2F8S A;  2KZZ A;  1YUW A;  3UE5 A;  4DR6 K;  3L3U A;  3KZB A;  2P9L B;  1B9D A;  5AR0 A;  2A6A A;  1HJO A;  1ATS A;  2YNH A;  4BE0 A;  2BDP A;  5BR9 A;  3U4L A;  3U3Y A;  3NVK A;  3AAQ A;  3HRG A;  1XC3 A;  4GVE A;  3SV4 A;  5HRP A;  4IKF A;  3O6W A;  1BCO A;  4E19 A;  3T1H K;  1VSM A;  2O8B A;  3WNG A;  1C1A A;  3SMP A;  2JWL A;  4JKC A;  4C1N I;  5C0Y A;  4A5A A;  2FXU A;  3LAK A;  4ELV A;  1RDC A;  3V1O A;  2V52 B;  4MLE A;  3BP8 A;  2QWQ A;  3GBT A;  4Z94 A;  3WUH A;  3HBT A;  3I8D A;  3O9U A;  1T6C A;  1DTT A;  3CC2 N;  1NK9 A;  1BIS A;  2HNZ A;  2ASP A;  1U47 A;  4B9V A;  2NRV A;  1OVQ A;  1VRU A;  5MLC Q;  1IKW A;  3LZJ A;  3PIP L;  4B1X B;  3NF8 A;  3CIP A;  2RE2 A;  2V7Z A;  4E3S A;  4B9N A;  3ATV A;  3IAY A;  3G4S N;  3CYG A;  3S5T A;  3VEO A;  3OTO K;  5KTQ A;  5AQL A;  5AQP A;  5C2D A;  3TWH A;  1HJR A;  4AQY K;  2O8D B;  4DB3 A;  1J53 A;  4CGI A;  4JKH A;  1VSI A;  1HQE A;  2F8T A;  4DLG A;  2E2Q A;  4CK1 A;  2OAN A;  3QEI A;  3OYK A;  4M41 A;  3UIQ A;  3NBP A;  3D45 A;  3O9T A;  3EY1 A;  3SUN A;  3PY8 A;  2A42 A;  4FWO A;  3CCV N;  5LMN K;  4JS5 A;  5KRT A;  4CJW A;  2A3Z A;  2PYJ A;  1GLL O;  3EL2 A;  3M8S A;  2RPI A;  3ALY A;  1BI4 A;  2OTL N;  4GW6 A;  4JV5 K;  2GV9 A;  4ID5 A;  3H3O B;  3FLC O;  1WSF A;  4BQZ A;  4RTF D;  2FSN A;  5KGX A;  1LWE A;  2Q3S A;  2B5J A;  5AQX A;  3E1Y A;  1QHT A;  1C6V A;  1K9M O;  1EXQ A;  3DLL L;  4CEB A;  3KK7 A;  3N4P A;  4FWN A;  3HXM A;  1QSY A;  4IOA L;  4DTR A;  5AQN A;  4N76 A;  3M6G A;  5JLF A;  5HRN A;  2QWL A;  2OA8 A;  5M1P A;  5FLX O;  3CJ1 A;  4H0O A;  3K5N A;  4M45 A;  5AQQ A;  1J6Z A;  2GUP A;  1J9A A;  3L2V A;  1QVF M;  3EZW A;  4YOT A;  4KHN A;  2PYL A;  3HZ6 A;  1C1B A;  3O1W A;  5LMU K;  3AVC A;  4R79 A;  4FJX A;  3CM6 A;  4E1J A;  4DFK A;  2P9P A;  3JXU A;  3JSM A;  4BRL A;  5AQF A;  4M7Y A;  4CGJ A;  3NVM A;  3NF9 A;  4CHP A;  3L2R A;  2YKN A;  3FR0 A;  1YJW N;  4CZE A;  4JI5 K;  3OYD A;  1X3M A;  4DTJ A;  4YOV A;  4JHD A;  1S6Q A;  3KLF A;  3L8B A;  2F96 A;  5KI6 A;  3OYL A;  5AJ3 K;  1RTI A;  3LP0 A;  3O5B A;  1NBW A;  1SKW A;  1Y97 A;  4HHT A;  3D6R A;  4IEI A;  4CES A;  5BN8 A;  3V1Q A;  3OYN A;  2X6S A;  1YJ9 N;  4BY9 C;  4K25 A;  4J2B A;  4CJE A;  1EET A;  1NGI A;  1ZBS A;  3ENH A;  4CJU A;  4PHT X;  2J4R A;  4QAG A;  4JRQ A;  1RIL A;  4B3O A;  1X9M A;  5AQW A;  4CJL A;  1NM1 A;  4CHN A;  3AGK A;  1VSJ A;  3I8B A;  1VRT A;  3THW B;  2GWK A;  3PSI A;  5DK5 A;  4PKI A;  2D0A A;  1BA0 A;  4XIU A;  3VF6 A;  2FSK A;  3J7A P;  3U8X A;  4PY5 A;  1OVY A;  4W5R A;  5HBM A;  2Z1I A;  1Q9Y A;  3OA9 A;  2P9K A;  1TUY A;  1GLB G;  3SCX A;  1ATR A;  1W97 L;  4DHY A;  2UUB K;  2CGL A;  2YHX A;  3J80 O;  2XY5 A;  3WXM B;  5HRR A;  1U2V A;  5GAD P;  4BG8 A;  3UKU B;  2HW3 A;  3LP3 A;  3O1B A;  4M7X A;  1NLV A;  4B9U A;  4OPJ A;  4BR7 A;  2OPR A;  1ZBI A;  5AQG A;  1VQK N;  4TSX A;  3VQA A;  3VOV A;  3DOL A;  1C0F A;  1N34 K;  4LF9 K;  3GE1 A;  4KHY A;  2A40 A;  3HK2 A;  1XUP O;  3DLH A;  4KAZ A;  3CPW M;  3EO3 A;  1NG9 A;  4BRE A;  4LD0 A;  2UUC K;  1UAX A;  3KKR A;  3TAN A;  3UKU A;  3CCJ N;  3C6H A;  5C24 A;  2HVH A;  3OVN A;  3MN6 A;  3AA5 X;  3K2P A;  3PUF A;  4DSI A;  4I2P A;  4CJS A;  2A5X A;  3OBY A;  1YVN A;  1Z6R A;  4CZM A;  3LAM A;  5AZI B;  3CCE N;  3SLC A;  3LWL A;  4BR9 A;  1DKG D;  3PX6 A;  2IOC A;  2HST A;  3VGK A;  4H0P A;  3CI5 A;  3AAP A;  3IRX A;  2HBK A;  5BN9 A;  3RR8 A;  4DS5 A;  2KW4 A;  3BDP A;  4KH6 A;  1Y64 A;  4V19 S;  4PWD A;  5C12 A;  3VGM A;  3CYM A;  4ILH A;  1HKB A;  2CH6 A;  3ENO A;  4K8Z A;  4G9Z A;  1D5A A;  3CJA A;  3I56 N;  4HCB A;  3CFR A;  2W42 A;  3DXK A;  1UWB A;  5BPM A;  4CFC A;  3HO1 A;  3CET A;  5AQT A;  3Q7C A;  1SS6 A;  3SUO A;  4K8X A;  1HKC A;  5AQI A;  2C1G A;  3RTV A;  1RT7 A;  3DYA A;  3KKS A;  4CJ5 A;  3NAE A;  4FLZ A;  2YX6 A;  1NK8 A;  2IVP A;  4KI6 A;  3UB5 A;  3QIP A;  3HJF A;  5D3G A;  1RNH A;  3DXM A;  2RHK A;  3NHG A;  3MCP A;  1TKX A;  4CF2 A;  3KD5 E;  4CEA A;  1T8E A;  3A5L C;  1T03 A;  5HLF A;  1WOQ A;  1JCE A;  4KTZ A;  1XNR K;  5HOO A;  4KO0 A;  5HL7 L;  4Q0B A;  1RFQ A;  3IS9 A;  2VG5 A;  2P9U B;  3NFA A;  4LH4 A;  1E3M A;  4MFB A;  4E7J A;  2IC3 A;  4CZL A;  2QXL A;  3OYI A;  4CJV A;  2PFU A;  4DQ8 A;  3OYB A;  1QSS A;  2G8H A;  3DWL A;  3H08 A;  1TUU A;  1WBB A;  1QQC A;  4E7K A;  2UYT A;  2QW9 A;  3AAR A;  3DMJ A;  3HI0 A;  5F0X A;  2HMI A;  3VQ7 A;  4X66 K;  4BRP A;  5SZT A;  4CHZ A;  3CQY A;  4FWQ A;  2YCH A;  2JWK A;  4XJX A;  2I7N A;  2P9S B;  3WQU A;  4X65 K;  2ZJQ L;  1F21 A;  4FZX C;  5M1N A;  1TVR A;  2WC9 A;  3ATU A;  5JVH L;  2OYQ A;  4JI3 K;  3ZEU A;  4KV8 A;  1RGI A;  5DM6 L;  1U48 A;  3LDL A;  1IO2 A;  4M3Z A;  4DTN A;  3L2Q A;  4UY8 O;  2IS3 A;  1UA1 A;  3SQ1 A;  1L3T A;  2Q0R A;  4FOI A;  3VES A;  3O80 A;  4FWL A;  2E2N A;  4CW7 B;  3TPQ A;  3DRS A;  4QS8 A;  4DG1 A;  3OS0 A;  4H0T B;  3ULD A;  4CGF A;  1RBS A;  1Q8I A;  5AFU A;  4BRK A;  4GV6 A;  4E7H A;  3MCA B;  1VQM N;  3Q7B A;  4NCB A;  2P1J A;  3THY B;  3FZH A;  4FWP A;  4BC5 A;  3GDQ A;  3G0Z A;  2A1S A;  1L3S A;  1HNI A;  2O4G A;  3LP2 A;  2F9T A;  3KVG A;  2KQ2 A;  4CZF A;  2ASO A;  4B1W B;  5AQV A;  1S22 A;  3VQD A;  1C0G A;  4DMN A;  1ITG A;  1K8K A;  4FPA A;  4KB0 A;  1IH7 A;  4E0D A;  3P31 A;  1P8Z A;  4DV3 K;  2ZM6 K;  3CCU N;  1OKJ A;  3R9P A;  4IFE A;  1C1C A;  1OH7 A;  5CYM A;  4LF8 K;  1L3V A;  1NJY A;  2HHX A;  3FE1 A;  5M1F A;  1S9E A;  3L2U A;  4JKG B;  3E66 A;  3ZT1 A;  5E26 A;  4ILG B;  3F9M A;  3K9J A;  3LL3 A;  2W40 A;  4HTL A;  4BRF A;  4WQ5 A;  3OS1 A;  5E41 A;  3CCL N;  4FJI A;  5BRH A;  4LFA K;  2WUS A;  1TL3 A;  3N4Q A;  5LY3 A;  1BU6 O;  1KSP A;  3K9K A;  1FW6 A;  1UA0 A;  4O5B A;  1XHX A;  4DQI A;  4M63 C;  4AM6 A;  3DXK B;  1ESV A;  1NKE A;  4B3R K;  1RBU A;  5I3U A;  1LAW A;  4WQ4 A;  4M3T A;  3KK2 A;  3HSC A;  1BCM A;  3CF5 L;  1NGA A;  3VQ5 A;  3QO9 A;  5FPE A;  1VQ8 N;  4BGB A;  4BEC A;  2W6L A;  4KI4 A;  4B3M K;  1L5U A;  2OTJ N;  1K8A O;  1KFS A;  1NGE A;  2YHW A;  4IWV A;  2Q97 A;  1T6D A;  3G71 N;  4YOU A;  2HHV A;  5AZJ A;  1KAY A;  4JI0 K;  4BR5 A;  4DTX A;  4UQG A;  1LOT B;  1XI1 A;  4BAC A;  4A57 A;  3H1V X;  4CEZ A;  3AY9 A;  1KTQ A;  3CD6 N;  2C1I A;  2V51 B;  4MQ3 A;  5ADX A;  4KH4 A;  1SL0 A;  3S41 A;  1JLQ A;  3CC7 N;  4ILJ A;  3KLH A;  5DMR A;  4CGG A;  1JL2 A;  4B9L A;  3A5O C;  3CC4 N;  2BE2 A;  4H5N A;  4L3Q A;  5JMV A;  1YXQ A;  4C1N K;  1QE1 A;  4OVL A;  2G8F A;  2BAN A;  2ZJR L;  4X64 K;  3NE6 A;  2QKK A;  3LZI A;  2Z1J A;  3TSP A;  1WSI A;  2A41 A;  1N36 K;  4R5P A;  2O8B B;  2KFZ A;  1JKH A;  3MEG A;  4E89 A;  4N47 A;  3CM5 A;  1VQ6 N;  5GAH P;  4CK3 A;  1NGG A;  4NO7 A;  4I6M A;  4IG3 A;  3QIC A;  1KQS M;  4OKE A;  2HHT A;  3ULE A;  3R3L A;  1RT6 A;  1BL3 A;  3FZM A;  4OLA A;  1N5Y A;  2O8E A;  2NRH A;  1OH6 A;  2HND A;  1A5X A;  4ZTJ A;  1U2V B;  2E4L A;  4BDZ A;  4YOY A;  4RW6 A;  2QKB A;  1NMD A;  4B08 A;  3VF2 A;  1RDU A;  3VGL A;  4DSL A;  3OYE A;  2Z1G A;  2P9I B;  5BRF A;  2F4V K;  4JYA K;  2HHW A;  3A8Y A;  4WQ5 C;  1KC8 O;  1XMQ K;  4CI6 A;  1GLC G;  2ETJ A;  4WFN L;  3NF6 A;  1GOA A;  3K5M A;  1HNW K;  4JKD A;  3WT0 A;  2E2O A;  3K5L A;  3AO1 A;  3BF3 A;  5AQM A;  1K6Y A;  5J2Q A;  4OGE A;  1W2B M;  4AF1 A;  1NK0 A;  4EIA A;  4W5N A;  4K41 A;  1JL1 A;  1NU0 A;  4ID1 A;  1QQN A;  3RMA A;  2CGJ A;  3HM9 A;  4N56 A;  3LP1 A;  1VQL N;  3QFU A;  3QML A;  1D9D A;  3VF4 A;  3OJS A;  3I0R A;  3UKR A;  2OZM A;  3EEQ A;  1TKD A;  4CEF A;  1JLC A;  2E20 A;  4JI2 K;  3TAM A;  4PKG A;  2BGG A;  4IOX A;  4Q5V A;  5EXW A;  5SWM A;  1BDG A;  1E4F T;  5AQZ A;  3B6P A;  4I9Q A;  2YNF A;  5FRN A;  4HCC A;  5BR8 K;  1ZYQ A;  3TU5 A;  4AHR A;  3A2F A;  4WCE L;  3O9R A;  2QI2 A;  3ZT3 A;  2O8F A;  5AFU H;  1TYQ A;  1BOT O;  4QS7 A;  1ZBF A;  4FCY A;  1I39 A;  3O4Q A;  2KKZ A;  1BQM A;  1O1W A;  4NYF A;  1HR0 K;  4DV4 K;  3AVL A;  2IVO A;  4JEP A;  4QCL A;  4GKK K;  2FBX A;  2OPQ A;  4H03 B;  4J2E A;  1SAZ A;  5HP1 A;  3GOI A;  1QZ5 A;  5BRD A;  1JXE A;  3P5J A;  1U45 A;  4DTM A;  1JCG A;  4CZK A;  2Z1H A;  2PZS A;  3MN9 A;  1NK7 A;  3AGR A;  4IOC L;  3THV A;  2UXC K;  5KRS A;  5CR4 A;  1IKY A;  4OPH A;  3M3Z A;  3NDK A;  3DAW A;  3U3G A;  3HPO A;  4AHT A;  4YOX A;  1NGC A;  3SAH A;  5AQJ A;  1KVA A;  1NGF A;  2D0P A;  3AVM A;  4FM2 A;  1MDU B;  3D2E B;  5KPT A;  4CJQ A;  1U4B A;  4FWK A;  4IJA A;  1GLA G;  3ITH A;  4FW1 A;  2WFB A;  4CK2 A;  3M8R A;  5J2P A;  1IJJ A;  3MXM A;  1X9J A;  4DTP A;  2HHH K;  4CJ7 A;  4J2A A;  1RDW X;  2D0B A;  3H6E A;  4K43 A;  1G15 A;  2ITM A;  3OBW A;  2QTD A;  2YHY A;  1NGD A;  1EKE A;  4CGH A;  3ZT4 A;  3MWP A;  4FJ9 A;  3WXJ A;  3KIO A;  4NXM K;  3BUZ B;  1LW0 A;  1NGJ A;  1KLM A;  4BDY A;  4KH5 A;  1KVB A;  4JKB A;  4LF7 K;  1TYQ B;  1JJ2 M;  3D2E A;  3CJ9 A;  4YFU A;  1ILY A;  3UKR B;  3HM8 A;  3L2W A;  1LWC A;  4H5W A;  3QER A;  2VWJ A;  4BVP A;  4FJL A;  3LDP A;  3EE8 A;  3MX2 A;  1GLE G;  4XH1 A;  3DLG A;  1TAQ A;  4X62 K;  3JYT A;  4CJ4 A;  2FBV A;  3W0L A;  4Z4I A;  3DLK A;  4BRO A;  2EHG A;  1Q7Y O;  3ENB A;  2VQE K;  2HHI A;  3MWT A;  3NGZ A;  2P9K B;  1XWL A;  3ASM A;  3SUP A;  4MLH A;  3CQX A;  2VWK A;  5BPN A;  1EP4 A;  1GOC A;  2FSJ A;  5JVG L;  3ZEU B;  4JNE A;  3G25 A;  2HB5 A;  3QEX A;  5C25 A;  1HMV A;  2GEM A;  4L8R B;  1HX1 A;  3AO3 A;  1QSL A;  1TGO A;  4CJ3 A;  3CPE A;  3CMA N;  3SAF A;  1V4T A;  3TAR A;  5JEN A;  2QWR A;  4Y0W A;  1XQS C;  1T3V A;  2KFN A;  4RCH A;  4PUO A;  1LCU A;  2E2P A;  2UXB K;  3I33 A;  3AVB A;  4KTW A;  4DSK A;  4E7L A;  2KTQ A;  1EWR A;  5M1Q A;  2YHB A;  4KRE A;  1OH8 A;  2XY7 A;  3DRP A;  4BEB A;  4PA1 A;  3QEP A;  3SBT A;  2VWB A;  4WFA L;  3BGR A;  4DFJ A;  4FL9 A;  4CF0 A;  1NKB A;  2DPN A;  2ZQB A;  3QDK A;  4H5T A;  4I2Q A;  3EKS A;  4DV7 K;  1LWF A;  4B3S K;  4BRD A;  3BZC A;  5AZI A;  3AA4 A;  4FM1 A;  3J8A A;  3SQ4 A;  4GVM A;  4JK8 A;  3THX B;  3T1Y K;  3S3M A;  3NMU A;  4EFH A;  4CVN E;  3TR8 A;  4HUF A;  3IG1 A;  4A62 A;  1VSD A;  2DFF A;  2RN2 A;  2B4J A;  3AO5 A;  1P90 A;  1T7P A;  4DQQ A;  1R0A A;  2IGI A;  5GAE P;  4FK0 A;  1REV A;  3DI6 A;  3IKM A;  4IO9 L;  4DFP A;  4PKH A;  1C0T A;  3VQ8 A;  2VCP A;  3JS6 A;  2F9W A;  2ATQ A;  4YOR A;  3C7N B;  1QVG M;  1KD1 O;  1YHQ N;  3WXL A;  1YT3 A;  1XMO K;  1R59 O;  1K73 O;  4ISF A;  3F9K A;  1EWQ A;  2FBY A;  2WON A;  2FC0 A;  1WB9 A;  2VG6 A;  3O3G A;  1IG8 A;  1I94 K;  1N8R O;  2YI1 A;  3T69 A;  2GTD A;  5GIP A;  2ZWH A;  4IBN A;  3T1A A;  3ZSR A;  2D0C A;  4BRN A;  1NK4 A;  3KTQ A;  2P5O A;  4A5B A;  4BRH A;  3F2K A;  5GIN A;  4FJ8 A;  4NCG A;  5T7B A;  4H8K A;  1DLO A;  3RMD A;  4NLB A;  2YNG A;  3RR7 A;  2B6A A;  4CF1 A;  2IAJ A;  3D2F A;  3LWM A;  3THW A;  1JLE A;  3HPG A;  3T19 A;  4W5Q A;  4KHW A;  4IEE A;  2KLA A;  3MN7 A;  1BUP A;  1MU2 A;  4I7F A;  4B1Y B;  1Q82 O;  1VQP N;  3VER A;  4FYD A;  1RCH A;  2O8E B;  3SPZ A;  1QS4 A;  3PO5 A;  3RRH A;  4AHS A;  4DSE A;  3VPZ A;  2P9S A;  4WFB L;  3V9U A;  2X6N A;  2HBM A;  1N33 K;  2OZS A;  3QB0 A;  3R1X A;  3C0B A;  3KHY A;  1EO1 A;  3K59 A;  5ADX H;  1D8Y A;  3H46 O;  1W0H A;  4DLE A;  1VSK A;  1Z26 A;  4C23 A;  3DLE A;  2VQF K;  4FK4 A;  4JD2 A;  4B9T A;  4CFD A;  3J81 O;  4HUE A;  2O4I A;  3K5O A;  2Q1N A;  3CG7 A;  5EU7 A;  1NK6 A;  2F7T A;  1WLJ A;  2NUB A;  1CXU A;  4O5F A;  5FDL A;  3ZT0 A;  4N41 A;  3J7Y P;  3HOS A;  3HP6 A;  3THY A;  3OYH A;  2H3G X;  4FO0 A;  3WXK A;  1WNS A;  3MMV A;  3CJB A;  3O08 A;  1NKC A;  4F2R A;  3WXI A;  4C8O A;  3MX5 A;  4GKJ K;  1JCF A;  4M3R A;  3KD1 E;  4FLU A;  3J7Z O;  4DSJ A;  2W6K A;  3EE9 A;  3VEN A;  3W3D A;  1BWF O;  2G8W A;  3M8P A;  4B1Z A;  1MWK A;  3FZF A;  3VQP A;  1Z05 A;  4AH9 A;  1BIU A;  4YDU C;  5J1E A;  3A0I X;  1NWK A;  4DU1 A;  1WSJ A;  3TTC A;  4DUY K;  2XY6 A;  2Q2R A;  3K57 A;  1CLQ A;  4KKO A;  1EQY A;  3NF7 A;  3S3O A;  2PAV A;  2W00 A;  4Z4H A;  1QQO A;  4CF8 A;  2E5L K;  4BRI A;  1HNX K;  4FK2 A;  1LW2 A;  3ZSO A;  4AM7 A;  3ZCM A;  2HBJ A;  4OKJ A;  4DV0 K;  1M90 O;  3ID6 A;  3FGU A;  4LC9 B;  1X9W A;  2HHQ A;  2ZF5 O;  3MEC A;  4LFC K;  3B6O A;  3LAN A;  5A2Q O;  4W5O A;  1TK0 A;  3M5R A;  3PSF A;  4CER A;  1TK8 A;  3LDQ A;  4B9M A;  3CCS N;  1IBM K;  2KHO A;  4O8K A;  2HF3 A;  3WQT A;  3V9S A;  3V9W A;  5C15 A;  4MDB A;  5M1O A;  2YJE A;  1TAU A;  5I42 A;  2FLO A;  3OJU A;  5CZ1 A;  1WAJ A;  3BZK A;  3ISN C;  1QTM A;  3F5T A;  3LPU A;  5BRE A;  1E4G T;  4O8U A;  2HF4 A;  5ELZ A;  3EYZ A;  1X9S A;  4PL8 A;  2NRZ A;  2O8D A;  4DTO A;  3KJV A;  3V81 A;  5GAG P;  4FLW A;  1SL1 A;  3ZSZ A;  1CZA N;  1XNQ K;  3O8M A;  4WQ4 C;  4BRQ A;  2QXF A;  2O8C A;  1HPM A;  4U7B A;  1WN7 A;  3MK6 A;  2D5R A;  4CHY A;  1HKG A;  3MDQ A;  3AVJ A;  3VEX A;  3H3N O;  4IZ9 A;  1X3N A;  1QHA A;  3P39 A;  3L4I A;  2W41 A;  1KLN A;  2DY4 A;  4B8A B;  2D4W A;  4ISE A;  1TK5 A;  4CEC A;  5IWA K;  4CJF A;  1TV6 A;  3ZSV A;  4E1N A;  3JAM O;  1BO5 O;  4O55 A;  2XHB A;  1GLJ O;  4LSN A;  1HQU A;  5BPL A;  1VK0 A;  1RBV A;  3OY9 A;  1HNZ K;  3DOK A;  3KWI A;  1ZC6 A;  3HL8 A;  1MA9 B;  4WF9 L;  4E7I A;  4NYN A;  4OX9 K;  5AQS A;  4F4K A;  2P9U A;  1SUQ A;  1KCF A;  4LF6 K;  2WBN A;  5GIO A;  3EN9 A;  4B3T K;  4PQU A;  3OYF A;  1QZ6 A;  5KPR A;  1NK5 A;  1BQN A;  2OPP A;  3V1R A;  3FZL A;  4CE9 A;  3WEE B;  3KWG A;  3HVR A;  4A61 A;  1BHL A;  1DGK N;  3VQ4 A;  1HYS A;  4Y1C A;  2NRR A;  4BG9 A;  3SNN A;  1S1W A;  1WSG A;  3KLI A;  2P9N A;  4I9L A;  1T44 A;  2Q0U A;  4AIL C;  4OPA A;  1DT9 A;  5LJW A;  5AQY A;  2E6M A;  4YY3 K;  5AQR A;  3QNO A;  4OO1 J;  3EZ5 A;  4A59 A;  1KFD A;  2HNY A;  4FWS A;  3O4W A;  4FLT A;  4JK9 A;  3CCM N;  3GL1 A;  1TKT A;  2PY5 A;  2QK9 A;  2D1K A;  3DM2 A;  1NJI O;  1IV0 A;  4HTU A;  4BC2 A;  3HOT A;  1NOZ A;  3VMF B;  1RBR A;  4JKG A;  5I9E B;  5E84 A;  1YTU A;  1YF5 L;  4CD3 A;  3OYG A;  5CY4 A;  4IFY A;  3WNF A;  1BGX T;  2ZE2 A;  1EX4 A;  5DM7 L;  3VEW A;  4DR5 K;  4LF4 K;  4BWM A;  2HHS A;  1KAZ A;  4BE7 B;  3SK3 A;  4E1M A;  4FZZ A;  3QBW A;  5F2R A;  4KHQ A;  4B8C A;  1SZ2 A;  2RKI A;  2YKM A;  3BY5 A;  5K14 A;  3SUQ A;  5CE3 A;  3SPY A;  3T7Z A;  1CZ9 A;  1Q81 O;  4Y1D A;  4GV3 A;  3OYM A;  1NJZ A;  4FJG A;  4CGD A;  2X74 A;  3C6U A;  4IDK A;  2Q36 A;  4KBO A;  3O9S A;  2IDO A;  4J2D A;  1T05 A;  3DRR A;  5LJV A;  1JLB A;  2P51 A;  3RMC A;  1S6P A;  3NCI A;  4BRG A;  4DKW A;  2Y1I A;  1OH5 A;  3I55 N;  3ZSQ A;  3PLA A;  4CZJ A;  2OCE A;  3MEE A;  3F73 A;  5JS1 A;  4CJK A;  1J5E K;  4M3Y A;  4CBU A;  1B92 A;  3VET A;  4Z4E A;  2QWP A;  3CFO A;  3AVI A;  3G6E N;  4JI6 K;  1VSF A;  4BGA A;  4FLX A;  4EP5 A;  2AP1 A;  4FJ5 A;  1RTH A;  4H0X B;  2I5J A;  4BC3 A;  2OPS A;  3QET A;  3AVH A;  3O9Q A;  4XEI A;  5F1X A;  3V6D A;  1D9F A;  2JLE A;  3DXM B;  3VA3 A;  3O4N A;  3PO4 A;  4ZTF A;  4DF4 A;  4O44 A;  4GV9 A;  4M42 A;  3KK3 A;  5AQK A;  3AV9 A;  3OW2 M;  3ZYY X;  3TAG A;  3R6M A;  2IVN A;  4G1Q A;  4CFB A;  3O3H A;  2XY8 A;  5CZ2 A;  4DU3 A;  4DWI A;  4DV6 K;  3CCR N;  2PBD A;  3U6F A;  1WBD A;  4FZY A;  1IKX A;  4IJN A;  4CIF A;  1FKO A;  2UU9 K;  1Q18 A;  4MO5 A;  4KHP K;  1L3U A;  3TAQ A;  1S1X A;  1S5J A;  2FF3 B;  1NGH A;  3RVC A;  1VQN N;  1U6Z A;  3VQE A;  4XH5 A;  3HTV A;  3AO2 A;  2HOE A;  3VQ6 A;  3QEV A;  4IFV A;  3WNH A;  2EX3 A;  3OS2 A;  5AZJ B;  1KRP A;  3FZK A;  1TL1 A;  3GG4 A;  4IO8 A;  3A5M C;  4BRM A;  4BQL A;  1IKV A;  3HYF A;  3SQ2 A;  3HT3 A;  3LM9 A;  4KFB A;  1N32 K;  1SL2 A;  4RG8 A;  4H0V B;  2NRT A;  3AVF A;  4RWT A;  2HBL A;  2P9N B;  3SI6 A;  1VSL A;  4WE1 A;  4DV5 K;  4LY7 A;  3P38 A;  2QWN A;  4B9Q A;  1VQ4 N;  4A2A A;  5FRM A;  1GLD G;  4FWM A;  4FOE A;  5AQH A;  3OYA A;  3MAQ A;  3CXC M;  1FXX A;  4F8R A;  4KB1 A;  4CFA A;  4RW4 A;  2BH1 A;  2NRX A;  4A2B A;  2NZT A;  2G8K A;  3TTD A;  3SQ0 A;  1NGB A;  5B8H A;  1BIZ A;  3NH1 A;  1RTD A;  3M1F A;  3QIN A;  5EVZ A;  1HYZ A;  1BG3 A;  4DFM A;  1FKP A;  3E9L A;  4Z0U A;  1HLU A;  2CGK A;  5AQO A;  5C10 A;  1VQ9 N;  3AA2 A;  3VEZ A;  1WSE A;  2VGM A;  3MN5 A;  4JLH A;  2QA4 N;  4BDP A;  5JIC A;  1Q86 O;  1YIJ N;  4EAH D;  4O0I A;  1LAV A;  2V7Y A;  2GWJ A;  4GY2 B;  3FFI A;  3TAE A;  3TSU A;  2O8C B;  3S9H A;  4M3U A;  5C2F A;  3CJC A;  3IMX A;  3ZX0 A;  4DQR A;  1YI2 N;  4J8F A;  3PV8 A;  4OGC A;  4Z4G A;  3CCQ N;  3D2F B;  3QFP A;  4FW2 A;  5M1K A;  3AVA A;  3C6T A;  4C8K A;  1D4X A;  3LPT A;  2QWM A;  4RW8 A;  4ELT A;  1S3X A;  2YHA A;  4BRC A;  3SZ2 A;  3E01 A;  3HPH A;  3ZX2 A;  1V4S A;  4N5S A;  2HVI A;  4OKK A;  1RDA A;  4HUG A;  1RT2 A;  2AJQ A;  3DLR A;  3HST B;  4HWI A;  1VSH A;  3LAL A;  2D0O A;  2ZD1 A;  1U49 A;  3C95 A;  2DFH A;  3C7N A;  3MED A;  4FXD A;  1VQ7 N;  3VEY A;  3H45 C;  4ISG A;  4B1V A;  3RRG A;  4JD2 B;  3THX A;  3KK1 A;  2NNW A;  1ZBL A;  1SQK A;  4JRP A;  2P9L A;  5FPM A;  1U04 A;  4F9O A;  3NGI A;  3ZSX A;  3VEV A;  2GBZ A;  1VAZ A;  3OHR A;  3P4I A;  4H0Y B;  3LM2 A;  2A1R A;  3ZX3 A;  4EZ9 A;  1GOB A;  4RW9 A;  1X1P A;  1ZBU A;  5EOY A;  1HNV A;  5CYQ A;  4EP4 A;  3D0P A;  4DQS A;  2VG7 A;  5LL6 Z;  2RF2 A;  4NLC A;  1KAX A;  4E72 A;  3C65 A;  1JLG A;  3I0S A;  1I3A A;  3VQQ A;  3AVG A;  2WTU A;  2NLX A;  1S72 N;  4EHT A;  3QNN A;  4C8L A;  4LFB K;  3QEW A;  4ZHR A;  4MDA A;  3AO4 A;  4C8N A;  5KQ8 A;  1C0M A;  2ZGY A;  4XH4 A;  2KZM A;  4FVM A;  4OPK A;  3P83 D;  3R8E A;  4FJ7 A;  4FJN A;  3FFK B;  1YJN N;  4IXC A;  4FLY A;  1G99 A;  2G8I A;  1BA1 A;  1YTA A;  3AVN A;  4M3X A;  2ZGZ A;  2EWS A;  4DR4 K;  3NGY A;  5KQD A;  4JS4 A;  4JI7 K;  1LV5 A;  3OYC A;  3TAF A;  2FF6 A;  1FJG K;  1S1V A;  3ZLJ A;  4CHQ A;  1IG9 A;  3B8A X;  4F3T A;  3C6A A;  1A5W A;  2AA4 A;  4DTS A;  1SKR A;  4JI4 K;  3U9Z A;  1DTQ A;  3SAG A;  2E6L A;  3VQC A;  4DV2 K;  3BEX A;  4PL7 A;  1ASW A;  4LF5 K;  4QOZ B;  4CF9 A;  2HMP A;  5FPD A;  3VQ9 A;  2X78 A;  2LSN A;  4BE2 A;  3ZET A;  4DSF A;  3DLB A;  5J2N A;  4M3W A;  4EZ6 A;  3CER A;  4BVO A;  3OYJ A;  5AQU A;  3PIO L;  4CHO A;  4F2S A;  1RDD A;  4LSL A;  4FSV A;  3SJH A;  1MWM A;  1DEJ A;  4DTU A;  1BI4 B;  1B9F A;  4YDU A;  4BWJ A;  3E9O A;  4NB4 A;  4FM0 A;  2ZJP L;  5C42 A;  4KPY A;  1IBL K;  1WSH A;  4K0K K;  3PX4 A;  3V9X A;  1H1V A;  4GMJ B;  1HYV A;  3TSQ A;  2CH5 A;  4YHH K;  1HPZ A;  4JK7 A;  1A5V A;  3LDN A;  4DF8 A;  3H1Q A;  5CHI A;  1UOC A;  4DV1 K;  1ASV A;  3TAB A;  4CBW A;  2HHU A;  4OLB A;  4GNI A;  1WAF A;  1K8K B;  5EY4 A;  2E88 A;  4FLV A;  4K42 A;  4KHS A;  1YVU A;  2GUI A;  1J54 A;  4IDH A;  1RT5 A;  1NJX A;  4KTQ A;  3SMS A;  3VTH A;  4CZI A;  1TKZ A;  3HVT A;  3IUC A; 
#chains in the Genus database with same CATH homology
 5E84 A;  4IJA A;  3U9D A;  1GLA G;  1YF5 L;  4CD3 A;  2WFB A;  2A5X A;  3OBY A;  1IJJ A;  1YVN A;  5FPN A;  1Z6R A;  4CZM A;  5AZI B;  4BC4 A;  1X9J A;  3CCE N;  3SLC A;  4BR9 A;  1DKG D;  4CJ7 A;  4BR4 A;  4H0P A;  2HST A;  1RDW X;  3H6E A;  4FWR A;  5EX5 A;  3VGK A;  3CI5 A;  3AAP A;  4K43 A;  4QS9 A;  2VYP A;  5DM7 L;  2HBK A;  5BN9 A;  1YAG A;  2ITM A;  3OBW A;  2NRW A;  3VEW A;  2GEL A;  3CME N;  2QTD A;  3DJC A;  2YHY A;  1NGD A;  3CHW A;  4H5V A;  1KAZ A;  1Y64 A;  4KH6 A;  3SK3 A;  4BE7 B;  5C12 A;  3QBW A;  5F2R A;  3VGM A;  4ILH A;  3MWP A;  1HKB A;  2CH6 A;  3ENO A;  1SZ2 A;  3L0Q A;  3WXJ A;  4G9Z A;  4MO4 A;  3CJA A;  3BUZ B;  5H1S Q;  3I56 N;  1NGJ A;  1ZXO A;  4CZH A;  4KH5 A;  3DXK A;  4JKB A;  5BPM A;  5CE3 A;  1TYQ B;  1JJ2 M;  3CET A;  3D2E A;  2E1Z A;  1SS6 A;  3CJ9 A;  3Q7C A;  5AQT A;  1YIT N;  1ILY A;  3T7Z A;  3UKR B;  1HKC A;  5AQI A;  2C1G A;  3HM8 A;  3RSE B;  4H5W A;  1Q81 O;  4GV3 A;  2YX6 A;  4JAX A;  4BVP A;  3LDP A;  2IVP A;  1VQO N;  3EE8 A;  3MX2 A;  2P9I A;  3L6Q A;  2Q36 A;  1GLE G;  4KBO A;  3UB5 A;  5JLH A;  4XH1 A;  1GLF O;  2GX9 A;  3O9S A;  3DXM A;  2I7P A;  3LDO A;  4H5R A;  3W0L A;  5TKW A;  4CD1 A;  3ZET B;  2RHK A;  5LJV A;  3MCP A;  1O13 A;  1QQM A;  4BRO A;  4JN4 A;  1Q7Y O;  3ENB A;  3CJ7 A;  2P9P B;  4BRG A;  3A5L C;  4BRA A;  4DCH A;  4DKW A;  3I55 N;  1JCE A;  1WOQ A;  3PLA A;  4JKA A;  4CZJ A;  3MWT A;  2BUP A;  5HOO A;  1ATN A;  2P9K B;  4BR2 A;  5HL7 L;  2YJF A;  4CBU A;  3VET A;  4FVU A;  4MLH A;  2QWP A;  1RFQ A;  3CQX A;  2QWO A;  3TTF A;  2P9U B;  5BPN A;  3G6E N;  2FSJ A;  5JVG L;  3VTI A;  3ZEU B;  1VQ5 N;  3E9P A;  3G25 A;  4JNE A;  4BGA A;  4CZL A;  2AP1 A;  2QXL A;  3D7E O;  4H0X B;  4B1U B;  4BC3 A;  2PFU A;  4DQ8 A;  2GEM A;  1HX1 A;  1KXP A;  3DWL A;  3QBX A;  3CPE A;  3CMA N;  3O9Q A;  1TUU A;  4XEI A;  5F1X A;  3BF1 A;  3SAF A;  1V4T A;  3WEE A;  2UYT A;  2QW9 A;  3AAR A;  3DXM B;  2VGN A;  2QWR A;  1WUA A;  1XQS C;  3HI0 A;  4Y0W A;  5F0X A;  4EHU A;  4BRP A;  1T3V A;  4RCH A;  1LCU A;  3IDH A;  2E2P A;  3CQY A;  4FWQ A;  2QEX N;  3I33 A;  4YOW A;  3A5N C;  3L4Q A;  4GV9 A;  3SBG A;  5AQK A;  5M1Q A;  2YCH A;  3OW2 M;  2JWK A;  4XJX A;  2I7N A;  2P9S B;  3ZYY X;  5KPZ A;  3ULE B;  3WQU A;  2E8A A;  2BTF A;  4BEB A;  3R6M A;  2IVN A;  2IIR A;  3SBT A;  2ZJQ L;  3IFR A;  2VWB A;  4JKF A;  2ASM A;  2Q31 A;  5M1N A;  2WC9 A;  3ATU A;  4WFA L;  2PBD A;  3CCR N;  4FL9 A;  5JVH L;  3ZEU A;  1RGI A;  2QM1 A;  2DPN A;  4IJN A;  5DM6 L;  3QDK A;  3LDL A;  1Q18 A;  4H5T A;  4UY8 O;  3EKS A;  4MO5 A;  2Q0R A;  4FOI A;  3VES A;  3O80 A;  4FWL A;  4BRD A;  1M1K O;  2FF3 B;  5AZI A;  1NGH A;  3RSE A;  2E2N A;  3RVC A;  4JKE A;  1VQN N;  3J8A A;  1HUX A;  4JK8 A;  1U6Z A;  4QS8 A;  3TPQ A;  3NMU A;  4H0T B;  4XH5 A;  3HTV A;  2HOE A;  3EKU A;  4EFH A;  5AFU A;  4BRK A;  4GV6 A;  4A62 A;  4U67 L;  3MCA B;  5AZJ B;  3FZK A;  3Q7B A;  1VQM N;  1P90 A;  3GG4 A;  3FZH A;  4FWP A;  3A5M C;  4IO8 A;  3GDQ A;  4BC5 A;  4BRM A;  4CBX A;  4BQL A;  5GAE P;  3LM9 A;  2F9T A;  3KVG A;  3IKM A;  4JHD B;  4CZF A;  4IO9 L;  4PKH A;  2E1Y A;  2NRT A;  2ASO A;  4H0V B;  4B1W B;  4BR0 A;  3ID8 A;  4RWT A;  2HBL A;  2P9N B;  5AQV A;  1S22 A;  2VCP A;  3JS6 A;  2F9W A;  4YOR A;  1QVG M;  3C7N B;  4CZG A;  1KD1 O;  4I6M B;  4WYB A;  1C0G A;  3WXL A;  1YHQ N;  1K8K A;  3P38 A;  4FPA A;  2QWN A;  4B9Q A;  1VQ4 N;  1R59 O;  1K73 O;  4ISF A;  4A2A A;  4FPB A;  1GLD G;  4FWM A;  4FOE A;  5TKY A;  1YUW A;  1IG8 A;  5AQH A;  3UE5 A;  3P31 A;  2YI1 A;  3KZB A;  1P8Z A;  2P9L B;  5AR0 A;  3T69 A;  3CXC M;  2A6A A;  2GTD A;  1HJO A;  1ATS A;  3CCU N;  1OKJ A;  3R9P A;  5BR9 A;  5GIP A;  3U4L A;  4IFE A;  2ZWH A;  4BRN A;  3NVK A;  3AAQ A;  3HRG A;  1XC3 A;  4A5B A;  4BRH A;  4GVE A;  3O6W A;  3F2K A;  5GIN A;  2BH1 A;  3FE1 A;  2NRX A;  5M1F A;  4A2B A;  4JKG B;  3E66 A;  3SMP A;  2NZT A;  2JWL A;  4JKC A;  5E26 A;  4ILG B;  4NLB A;  3F9M A;  3D2F A;  3K9J A;  3TTD A;  3LL3 A;  2W40 A;  4C1N I;  4HTL A;  1NGB A;  4A5A A;  4BRF A;  5B8H A;  5C0Y A;  4WQ5 A;  2FXU A;  4IEE A;  3M1F A;  5EVZ A;  2KLA A;  3CCL N;  3MN7 A;  1BG3 A;  1BUP A;  2V52 B;  5BRH A;  3E9L A;  1HLU A;  2CGK A;  2WUS A;  3BP8 A;  2QWQ A;  1BU6 O;  3GBT A;  3N4Q A;  4MLE A;  4Z94 A;  5AQO A;  4B1Y B;  5C10 A;  1Q82 O;  1VQ9 N;  3WUH A;  1VQP N;  3VEZ A;  3VER A;  3HBT A;  2VGM A;  3MN5 A;  2QA4 N;  3O9U A;  5JIC A;  1Q86 O;  3K9K A;  1T6C A;  3VPZ A;  2P9S A;  4WFB L;  4EAH D;  1YIJ N;  2HBM A;  2V7Y A;  3CC2 N;  3QB0 A;  3R1X A;  4M63 C;  2ASP A;  2GWJ A;  3C0B A;  3KHY A;  1EO1 A;  2NRV A;  4GY2 B;  4AM6 A;  5ADX H;  3DXK B;  5MLC Q;  1ESV A;  3H46 O;  3PIP L;  3TSU A;  4WQ4 A;  4C23 A;  5C2F A;  4B1X B;  3CJC A;  3HSC A;  3IMX A;  3ZX0 A;  3CF5 L;  1NGA A;  1YI2 N;  3CIP A;  4JD2 A;  2RE2 A;  4J8F A;  2V7Z A;  5FPE A;  1VQ8 N;  3CCQ N;  3ATV A;  3G4S N;  4BGB A;  4BEC A;  3VEO A;  3D2F B;  2Q1N A;  3QFP A;  5M1K A;  5AQL A;  5AQP A;  5C2D A;  1K8A O;  2OTJ N;  1D4X A;  2QWM A;  4DB3 A;  1NGE A;  2YHW A;  4IWV A;  2Q97 A;  2F7T A;  1T6D A;  4JKH A;  1S3X A;  3G71 N;  4YOU A;  4O5F A;  4BRC A;  5AZJ A;  2E2Q A;  3ZX2 A;  1V4S A;  3HOS A;  1KAY A;  2OAN A;  3O9T A;  4BR5 A;  2H3G X;  1LOT B;  4FO0 A;  3WXK A;  4HWI A;  2A42 A;  3H1V X;  4A57 A;  3MMV A;  3CJB A;  3O08 A;  2D0O A;  3AY9 A;  3CD6 N;  2C1I A;  2V51 B;  5ADX A;  3WXI A;  4FWO A;  4KH4 A;  3CCV N;  3C7N A;  3MX5 A;  3S41 A;  1JCF A;  3CC7 N;  4ILJ A;  1VQ7 N;  3VEY A;  3H45 C;  4ISG A;  4B1V A;  3J7Z O;  3VMF B;  2A3Z A;  4JD2 B;  3EE9 A;  3VEN A;  2NNW A;  1SQK A;  3W3D A;  1BWF O;  1GLL O;  3A5O C;  3CC4 N;  3EL2 A;  4H5N A;  4L3Q A;  2P9L A;  5FPM A;  1YXQ A;  4B1Z A;  5JMV A;  1MWK A;  3FZF A;  4F9O A;  1Z05 A;  2OTL N;  4YDU C;  3VEV A;  4C1N K;  1VAZ A;  3A0I X;  3OHR A;  1NWK A;  3P4I A;  4H0Y B;  2ZJR L;  3TTC A;  2Q2R A;  3LM2 A;  3TSP A;  3ZX3 A;  3H3O B;  2A41 A;  3FLC O;  1EQY A;  4BQZ A;  4RTF D;  2PAV A;  5EOY A;  2W00 A;  1VQ6 N;  5GAH P;  1QQO A;  2FSN A;  1NGG A;  4I6M A;  3E1Y A;  4NLC A;  1KAX A;  3QIC A;  4NO7 A;  5AQX A;  3C65 A;  4BRI A;  1KQS M;  1K9M O;  3DLL L;  3KK7 A;  4AM7 A;  3N4P A;  4FWN A;  4IOA L;  2HBJ A;  2NLX A;  1S72 N;  3ULE A;  3R3L A;  1M90 O;  3ID6 A;  4EHT A;  3FGU A;  5AQN A;  3FZM A;  4LC9 B;  2ZF5 O;  3M6G A;  5JLF A;  2QWL A;  5M1P A;  2NRH A;  3CJ1 A;  4MDA A;  4H0O A;  1U2V B;  3M5R A;  5KQ8 A;  4YOY A;  1NMD A;  3VF2 A;  5AQQ A;  1RDU A;  3VGL A;  2ZGY A;  3LDQ A;  3CCS N;  2P9I B;  2KHO A;  1J6Z A;  2GUP A;  2HF3 A;  4O8K A;  3WQT A;  5BRF A;  1QVF M;  5C15 A;  4MDB A;  3EZW A;  4XH4 A;  5M1O A;  4YOT A;  2YJE A;  3A8Y A;  3HZ6 A;  4WQ5 C;  3R8E A;  1KC8 O;  4CI6 A;  1GLC G;  4WFN L;  3O1W A;  2FLO A;  3FFK B;  1YJN N;  4R79 A;  4IXC A;  5I9E B;  4JKD A;  1G99 A;  3F5T A;  3WT0 A;  5BRE A;  4E1J A;  2E2O A;  1N8R O;  2P9P A;  1E4G T;  4O8U A;  2HF4 A;  3BF3 A;  1BA1 A;  3JXU A;  5ELZ A;  5AQM A;  2ZGZ A;  4PL8 A;  5AQF A;  4M7Y A;  4BRL A;  2NRZ A;  3NVM A;  2EWS A;  3FR0 A;  1YJW N;  1W2B M;  4AF1 A;  5LY3 A;  4CZE A;  5GAG P;  5KQD A;  1X3M A;  4EIA A;  4YOV A;  4JHD A;  2FF6 A;  4K41 A;  1CZA N;  1QQN A;  2CGJ A;  3O8M A;  4WQ4 C;  4BRQ A;  3B8A X;  3C6A A;  1HPM A;  4U7B A;  2AA4 A;  3O5B A;  1NBW A;  3MK6 A;  1VQL N;  3U9Z A;  3D6R A;  1HKG A;  3MDQ A;  4IEI A;  3QFU A;  3QML A;  3VEX A;  5BN8 A;  3H3N O;  4IZ9 A;  3VF4 A;  3SAG A;  1X3N A;  1QHA A;  3UKR A;  3BEX A;  1YJ9 N;  4PL7 A;  4K25 A;  3P39 A;  4BY9 C;  3L4I A;  2E20 A;  4PKG A;  2W41 A;  4IOX A;  1NGI A;  1ZBS A;  3ENH A;  5EXW A;  4PHT X;  2J4R A;  1BDG A;  1E4F T;  5AQZ A;  5AQW A;  2D4W A;  1NM1 A;  3AGK A;  2HMP A;  3I8B A;  4ISE A;  5FPD A;  3TU5 A;  3ZET A;  2GWK A;  4PKI A;  1BO5 O;  4WCE L;  3CER A;  1GLJ O;  1BA0 A;  3VF6 A;  3O9R A;  4BVO A;  2QI2 A;  2FSK A;  5BPL A;  5AFU H;  3U8X A;  1TYQ A;  5AQU A;  1BOT O;  1OVY A;  3KWI A;  1ZC6 A;  4QS7 A;  1MA9 B;  3OA9 A;  3PIO L;  4WF9 L;  2P9K A;  4FSV A;  1TUY A;  1GLB G;  1ATR A;  2KKZ A;  1W97 L;  5AQS A;  3SJH A;  4DHY A;  1MWM A;  1DEJ A;  2CGL A;  2P9U A;  2YHX A;  4YDU A;  3WXM B;  2WBN A;  2IVO A;  3EN9 A;  3E9O A;  5GIO A;  1U2V A;  4NB4 A;  4JEP A;  5GAD P;  2ZJP L;  1QZ6 A;  4BG8 A;  5KPR A;  3UKU B;  3O1B A;  4H03 B;  1SAZ A;  4M7X A;  3FZL A;  1H1V A;  3WEE B;  1NLV A;  3KWG A;  3TSQ A;  2CH5 A;  3GOI A;  4BR7 A;  1QZ5 A;  4JK7 A;  5AQG A;  5BRD A;  4A61 A;  1VQK N;  3LDN A;  3VOV A;  1DGK N;  4BG9 A;  2NRR A;  1C0F A;  3H1Q A;  5CHI A;  2P9N A;  1JCG A;  4CBW A;  3GE1 A;  1T44 A;  4CZK A;  2Q0U A;  2A40 A;  4GNI A;  3MN9 A;  1XUP O;  4OPA A;  1DT9 A;  1K8K B;  3AGR A;  4IOC L;  5CR4 A;  5EY4 A;  2E88 A;  4K42 A;  3CPW M;  5LJW A;  5AQY A;  3EO3 A;  4OPH A;  3M3Z A;  3DAW A;  5AQR A;  4OO1 J;  4YOX A;  4BRE A;  1NGC A;  4A59 A;  4FWS A;  3SAH A;  4IDH A;  5AQJ A;  1NGF A;  2D0P A;  3O4W A;  1MDU B;  4JK9 A;  3D2E B;  3CCM N;  3GL1 A;  5KPT A;  2D1K A;  1NJI O;  3SMS A;  3UKU A;  3VTH A;  4CZI A;  4BC2 A;  3HOT A;  3C6H A;  4FWK A;  3CCJ N;  3IUC A;  3MN6 A;  4JKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...