1YVNA

The yeast actin val 159 asn mutant complex with human gelsolin segment 1.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
372
structure length
372
Chain Sequence
EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGNTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast actin V159N mutant
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords PROTEIN (ACTIN)
total genus 114
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 1999-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1yvnA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yvnA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yvnA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1yvnA04
5EOYA 1DGKN 3D2EB 2Q2RA 1NGHA 2E1YA 4I6MB 4FWSA 1WUAA 4FWOA 1XQSC 5AQNA 3WQTA 4CBUA 3AAQA 3FGUA 4CZEA 3U8XA 3DAWA 4LC9B 3DXMA 3EL2A 3CERA 1Y64A 3ULEA 1XUPO 3R6MA 4CZJA 2IVOA 3IFRA 2FF3B 4K25A 2GWJA 3MDQA 3MN5A 3LL3A 4H0TB 4EAHD 5KPTA 4WQ5A 1BA1A 4MO4A 4FO0A 5EVZA 1C0FA 2QWPA 3VERA 3LDOA 1SQKA 2NZTA 2NRHA 5F2RA 3VPZA 1KAZA 4B1ZA 3ID8A 1U2VA 4AM7A 5BN8A 4GY2B 3BUZB 3QBWA 2FSKA 3BF3A 2AP1A 3FZLA 4H0YB 3TU5A 1IJJA 3CETA 3GE1A 1OKJA 2P9PA 5FPMA 4JHDB 1NGIA 4GNIA 4C23A 1U6ZA 2A41A 1E4GT 1BG3A 4JN4A 5AQPA 4BQLA 3VGMA 4J8FA 4FOEA 4DQ8A 4PL8A 3GBTA 4BRPA 1GLJO 1TUUA 4M63C 4H0OA 4QS8A 5AZJA 2YJFA 4HTLA 2E2PA 2H3GX 3H1QA 2P9KB 4JD2A 2YCHA 3M1FA 1GLCG 4CD1A 5AQUA 5EY4A 1H1VA 2P9IB 5FPEA 1C0GA 2VYPA 5FPNA 1NGBA 4XEIA 1NGAA 5AQQA 5B8HA 2A3ZA 1T6CA 1NWKA 2E2QA 3MN6A 3VEXA 4F9OA 4H5VA 3CHWA 3SK3A 2D0OA 1BWFO 3AY9A 4K42A 2W41A 2E8AA 4BROA 2ASOA 2OANA 5AQRA 1EQYA 2P9SA 1HJOA 2VWBA 2Q1NA 3FZHA 3VF4A 3VEZA 4ISFA 5TKYA 4H5RA 4BRIA 3AARA 2D1KA 3M6GA 3MK6A 3R9PA 1NGCA 2ZF5O 5BPNA 3VF6A 1V4SA 4FWQA 1ESVA 3IUCA 2J4RA 4EHUA 4BR5A 3O6WA 1MA9B 2GUPA 1ATRA 4JNEA 3CJBA 4FWNA 1QQMA 4IJAA 1X3NA 5AQKA 3ENOA 2F9TA 5BRFA 4PKGA 1NGDA 4EHTA 1BOTO 2P9LA 3U9ZA 3UKRA 4IO8A 3OHRA 5LJWA 4XH1A 4QS7A 2QWNA 2I7NA 4BG9A 3CIPA 2P9PB 3H3OB 3C7NA 1RGIA 5E84A 3O1BA 2DPNA 2A6AA 3ZX2A 4ISGA 3ENHA 1J6ZA 4H03B 3ZX0A 4BVPA 1GLDG 3UKRB 4A61A 4Y0WA 3DXMB 3H45C 3H1VX 2HOEA 4O8KA 1ZXOA 4CZLA 3EKSA 2I7PA 4BGAA 1BUPA 1T44A 4H5TA 4H5NA 1QHAA 4WQ5C 3SJHA 1RDWX 1NGGA 1X9JA 2D4WA 1BA0A 4RTFD 3DWLA 3BP8A 4FPBA 3VENA 3FZKA 5ADXH 4BREA 5JMVA 1JCGA 4IXCA 2PBDA 2P9IA 1MDUB 1NGJA 3LDQA 4FL9A 1BDGA 1HKGA 1ZBSA 3UB5A 4O5FA 1QQOA 3ATUA 3VEWA 3WXJA 1U2VB 4I6MA 4JD2B 3EN9A 3VEVA 3O80A 5BRHA 4BRCA 4K41A 3O5BA 5KQ8A 4FPAA 5I9EB 1RFQA 4YDUA 3VOVA 4H0VB 5EX5A 4DHYA 3ATVA 2A40A 4M7XA 4BQZA 2P9UA 1ATSA 4BRAA 3DXKA 3A5MC 3L4IA 3QBXA 3FZMA 4FWRA 1E4FT 3O4WA 2QWRA 2GELA 3CQYA 4NB4A 3G25A 3O8MA 4B1VA 3LM9A 1GLBG 3ZETB 1KXPA 3KVGA 3WXKA 2Q0RA 1S22A 2WUSA 3DXKB 5AQHA 5AQIA 4IJNA 4FOIA 3LM2A 5KPRA 2NLXA 3WQUA 3A5NC 3C0BA 4MLHA 4YDUC 5AQFA 4EIAA 5BR9A 4JHDA 2CH6A 3I8BA 3HSCA 1R59O 3HI0A 3LDPA 5AZIA 3BEXA 1GLFO 1JCFA 3QMLA 4A62A 5JLFA 2ITMA 1HLUA 1GLEG 4ISEA 3FLCO 4QS9A 1BU6O 4B1YB 3QDKA 4BR7A 4BR2A 3VGLA 4BRGA 3H46O 2E2OA 1JCEA 5F0XA 1MWMA 4B1UB 1DEJA 3EO3A 4CZGA 5BPLA 3WXLA 1P8ZA 4HWIA 1ATNA 4IZ9A 4FWKA 2CGJA 4MO5A 5FPDA 4BG8A 2GEMA 3C7NB 2P9KA 1HPMA 1HUXA 3EZWA 4XH4A 3WEEB 2A42A 3QICA 3A0IX 5BRDA 5AQJA 4EFHA 5AQLA 4CD3A 3ZX3A 3QFUA 2HMPA 3HBTA 3SMPA 2BTFA 3RSEA 1G99A 2VCPA 1TUYA 5AQGA 4PKIA 2YI1A 3VEOA 3UE5A 3D7EO 1D4XA 2E20A 5AQZA 1HKCA 5CE3A 1LCUA 3ULEB 3UKUA 2P9NB 1WOQA 2PAVA 4RCHA 4BRHA 3R8EA 4CBWA 3CJCA 5JICA 3KZBA 4BRDA 3F9MA 3VGKA 4B1XB 4FSVA 2AA4A 4CI6A 5AZIB 1NLVA 2D0PA 3D2EA 3CJ9A 2ZGYA 2QW9A 2BUPA 1GLAG 1TYQB 3L6QA 2CGKA 2CH5A 5AQSA 1T6DA 3KHYA 1QQNA 4K43A 1NMDA 4BR9A 5F1XA 3MCPA 5AQMA 2F9WA 3SLCA 1K8KA 2YHYA 2FXUA 4FWMA 5ADXA 4B9QA 4Z94A 2YHXA 3MN7A 4BRKA 2Q97A 1SAZA 3HZ6A 1NBWA 1CZAN 4H5WA 3QB0A 5AFUA 5ELZA 4PL7A 2HF4A 3MN9A 2FLOA 3CJ1A 4WQ4A 3IMXA 2ASPA 5AFUH 4BRQA 1QZ6A 2IIRA 4A2BA 3ZEUB 4JAXA 1ZC6A 2FSNA 3FR0A 5AQVA 3MMVA 2W40A 1K8KB 2YHWA 3HTVA 3UKUB 5JLHA 4L3QA 5AZJB 4MLEA 3HM8A 3O08A 1LOTB 5E26A 3M3ZA 1BO5O 4M7YA 3H6EA 2ZWHA 2E1ZA 4CZIA 1MWKA 1KAYA 3VESA 1GLLO 4E1JA 1YVNA 1HKBA 1Z05A 2Q36A 3CJ7A 5AQXA 2E2NA 2QWOA 4H0PA 4RWTA 3EKUA 2CGLA 3A8YA 3JXUA 4NO7A 1IG8A 3SMSA 2ZGZA 3LDNA 5EXWA 3ZEUA 5BPMA 3AAPA 4CZKA 3I33A 3WEEA 5AQWA 2QWQA 5AR0A 2KHOA 1YUWA 3CJAA 4XH5A 3VETA 4B1WB 5KQDA 4PKHA 1DKGD 4BRMA 3LDLA 4DB3A 4CZMA 1V4TA 4KBOA 3RSEB 3FZFA 5LY3A 2QXLA 3D2FA 2QWMA 1NGFA 1HX1A 3L0QA 3BF1A 3A5LC 4BC2A 2GTDA 2P9NA 3CI5A 4BVOA 1NGEA 3B8AX 2QM1A 4WYBA 4BC5A 4FWLA 3VF2A 2GWKA 1Z6RA 3GOIA 2FSJA 2P9LB 4BRNA 2UYTA 5BN9A 3GL1A 2A5XA 1QZ5A 3A5OC 2YJEA 4AM6A 4BRLA 3WT0A 4BGBA 5AQYA 3W3DA 2ASMA 3CQXA 1S3XA 4BR0A 2QWLA 4BC4A 2EWSA 3IDHA 2IVNA 3J8AA 2P9UB 3GDQA 3TPQA 1SZ2A 3W0LA 2V52B 4CBXA 3VEYA 4DCHA 4BR4A 2HF3A 4H0XB 4WQ4C 1YAGA 1Q18A 3WXIA 3GG4A 1KAXA 3P4IA 2FF6A 2Q0UA 5BREA 3JS6A 3WUHA 1X3MA 2IVPA 3ZETA 4CZHA 2Q31A 1XC3A 3FFKB 4FWPA 3DJCA 2E88A 3QFPA 4BRFA 4CZFA 5KPZA 2V7ZA 1YXQA 4IWVA 3S41A 5AQTA 4BC3A 5LJVA 4A2AA 3O1WA 3U4LA 4CJ7A 2P9SB 5AQOA 3H3NO 3U9DA 2V7YA 1TYQA 3D2FB 3FE1A 2V51B 1NM1A
chains in the Genus database with same CATH superfamily
3D2EB 2Q2RA 2X6NA 3K9KA 1KQSM 1LWFA 3R1XA 4CBUA 2QKBA 4C8OA 5HL7L 3VQEA 3HOTA 3EY1A 2F7TA 1NK0A 3QEIA 3DAWA 3T7ZA 3LZJA 3ZSOA 4IDKA 3R6MA 1Q9XA 1BIZA 4O5BA 3F2KA 4A5BA 3HP9A 1JXEA 4IFEA 3C95A 4KTQA 1RTDA 3CYGA 4MO4A 3VPZA 2NRHA 4X62K 3V1RA 2YNHA 4AM7A 5BN8A 2P1JA 4E0DA 2XO7A 5LL6Z 3V6DA 1IKXA 4H0YB 4I2QA 3CETA 1VSJA 2YV0X 1ASVA 3AO4A 4RW4A 3V4IA 4KRFA 1HYSA 3M5RA 4FZYA 1E4GT 4G9ZA 5AQPA 4FK4A 2NUBA 4DSKA 4J8FA 3GBTA 3CC2N 1GLJO 3DM2A 4CK2A 1N6QA 2YJFA 3SCXA 2ITGA 2B6AA 4JI2K 1RILA 4DV2K 1TK8A 2H3GX 3KLEA 1VQKN 2P9KB 4IKFA 5CZ2A 4FLUA 1WSEA 1HJRA 5FROA 3NCIA 4CD1A 3IAYA 3DMJA 5AQUA 4FLWA 5EY4A 4CGJA 3LZIA 2P9IB 2P5GA 5FPNA 1NGBA 3AGKA 4XEIA 1NGAA 2DTUA 1T6CA 1SL1A 2E2QA 3E01A 3TTFA 3CHWA 3IG1A 2D0OA 4FW2A 2E8AA 1OVYA 5AQRA 4CF8A 3FZHA 2HBKA 3AVGA 4ISFA 3LAMA 1B92A 1YHQN 2W6LA 2PYLA 3M6GA 1IBLK 5H1SQ 4PA1A 4FWQA 4DLEA 4BR5A 1ATRA 1KVBA 3HK2A 5IT9O 3CJBA 4DTPA 1JXBA 3DOKA 1QQMA 4FJ7A 1ITGA 3ENOA 2F9TA 4B3MK 3NH0A 1HNIA 1YVUA 4O55A 2A1RA 1BOTO 4DFMA 3V9UA 4DLGA 1YJNN 3HXMA 2QEXN 3LDSA 4JI0K 1Q8IA 1BIUA 2RHKA 1J9AA 5LJWA 1Y97A 2I7NA 3T1AA 3SQ0A 1XMOK 1RGIA 3ZX2A 4ISGA 4BVPA 4H03B 4W5OA 1ZBHA 4C8KA 2HOEA 2HW3A 5E41A 1SKRA 4CIFA 3OW2M 1RCHA 2C1GA 4OLAA 4M3TA 3HSTB 3SJHA 3BP8A 4ILJA 4WFNL 5ADXH 5C2FA 3VQQA 2RF2A 1JCGA 2P9IA 4FL9A 1HKGA 3UB5A 3SV3A 4I6MA 4FJIA 1RDUA 3HOSA 2QA4N 1JLAA 1WNSA 4DR4K 2B5JA 2OTJN 1HMVA 3P31A 4FPAA 1RFQA 3SQ1A 3VOVA 1HR0K 2PZSA 4H0VB 1Z26A 5EX5A 2IGIA 1REVA 4DV3K 2NNWA 1U4BA 4B9MA 1XNQK 1ATSA 4DQPA 3JYTA 1YI2N 1TGOA 3DXKA 3NE6A 3QBXA 2WONA 4DQSA 3FZMA 1TKXA 1C1AA 2QWRA 2GELA 1N5YA 4KO0A 1JLCA 3K0SA 4JKFA 4CF1A 3KVGA 4LFAK 2O8FA 4QAGA 3CCMN 4Z4FA 1TV6A 3V9WA 5AQIA 1C1CA 1DLOA 1BISA 1IH7A 3OYHA 4MLHA 5HOOA 4EIAA 3DRSA 4E1MA 3THWB 1NJZA 3HI0A 3CFRA 4KB1A 4QS9A 4BR2A 4BRGA 4B1YB 3QDKA 4BR7A 2E2OA 3H46O 4CZGA 4KI6A 5T7BA 2Y1IA 3O9UA 1ATNA 3HJFA 4JS5A 4MO5A 5FPDA 1ASUA 3TARA 1HPMA 1HUXA 3A2FA 2G8VA 4XH4A 1EKEA 4JV5K 2A42A 3M8PA 3A0IX 3OYJA 4Q0BA 2IS3A 4BDZA 5HRNA 1LW2A 3ZX3A 3SMPA 3SUNA 4IG3A 3OVNA 3AA3A 4B08A 3RSEA 2VCPA 2G8WA 4KTWA 5AQGA 3SAHA 4PKIA 3VEOA 2Z1IA 4LH5A 1LWCA 3E66A 1JKHA 1VQ9N 1LAVA 4CJ4A 3NGYA 2O8CA 3O9QA 4RCHA 3R8EA 1X9SA 3LANA 5JICA 1YIJN 3C6HA 3F9MA 4CFBA 3PIOL 2YKMA 2VGNA 5HRRA 2HHIA 4YOUA 3G4SN 5CHIA 3D2EA 3SAGA 3PY8A 2QW9A 4OPAA 3L6QA 2OCEA 3L2RA 1QE1A 1UWBA 1K6YA 1NMDA 2ZM6K 1A5XA 4KHQA 3PSIA 4KHWA 5CYQA 1B9DA 3SLCA 2YHYA 5ADXA 2HVIA 3HL8A 1WAFA 4HCCA 4PHTX 2Q97A 1IKWA 1BHLA 1VHXA 5J1EA 4CJSA 3TAMA 1XHXA 4CHPA 3RMCA 1BCOA 4B8CA 2FLOA 2G8IA 4Q5VA 4V19S 4WQ4A 3IMXA 1RT6A 3PIPL 3SPZA 4CJLA 3CF5L 3ZEUB 2FSNA 2JWKA 2BANA 5AQVA 3O4QA 4K8ZA 3CD6N 3P1GA 3THXB 2YHWA 2XRIA 3ZCMA 1FJGK 1YT3A 5GIOA 4MLEA 3HM8A 1WAJA 4YORA 5E26A 3C6TA 1BO5O 3NGIA 3H6EA 3ZSWA 3QNNA 2E1ZA 4HUFA 4CZIA 2BGGA 3VESA 3K59A 1YVNA 1Z05A 4NCAA 2HBMA 4DV7K 2QWOA 4DQRA 3MEGA 1IG8A 2ZQBA 1NNEA 1A5VA 4ELTA 4M45A 4CHOA 5HP1A 4DU4A 4NCGA 2RE2A 3CCVN 4JRPA 2G8HA 1VRTA 4I2PA 4B9TA 3WNGA 1IO2A 1S9GA 4RW6A 3NF8A 5AR0A 5CYMA 2O8BA 2KHOA 4XH5A 2DY4A 3VETA 1Q81O 4PKHA 1DKGD 4BRMA 3PX0A 1KVCA 4JKBA 2QTDA 3TI0A 3D2FA 3TSPA 5KGXA 2Z1GA 1R0AA 3LP1A 3KK3A 3CQ8A 2GV9A 1S1UA 3AVIA 1NG9A 4JI5K 4BC5A 3VF2A 4FWLA 2GWKA 1NU0A 3WNHA 3GOIA 3AVAA 1FKPA 2QXFA 4B9SA 2O8DB 3G71N 3V9XA 2A5XA 1QZ5A 3DOLA 2FBTA 4BACA 4BRLA 2HNDA 3DLEA 3LP0A 1VQ7N 1FW6A 3CQXA 5DM6L 2QWLA 3HRGA 3IDHA 2F4VK 3CYMA 5J2MA 3TWHA 3J8AA 3GDQA 4JKCA 3VEYA 3CCJN 3OYDA 4H0XB 4LF9K 3TAPA 3GG4A 3VTHA 4RW9A 3P4IA 5BREA 3QIOA 3WUHA 1X3MA 2IVPA 3ZETA 4CZHA 3O9TA 3FFKB 3VQCA 4W5TA 5AQTA 5LJVA 3U4LA 4CJ7A 3QIPA 5AQOA 3H3NO 3U9DA 3N4PA 5EOYA 4CGGA 4FWOA 1UA1A 3WQTA 5EU7A 4C8MA 3T1YK 3EL2A 3CERA 1HNWK 3VQBA 4HCBA 4WCEL 1XUPO 2FBXA 4CHYA 2OZSA 2GWJA 4DTXA 4MDBA 3ZYYX 4WQ5A 3ITHA 5KPTA 3D45A 3LP2A 3NBPA 5M1KA 3PO4A 3SQ4A 5EVZA 3LDOA 1SQKA 5F2RA 5GAHP 1KFSA 4FW1A 2OTLN 4E89A 4YHHK 4JKGA 3QBWA 2G8FA 2D0CA 3FZLA 4A57A 3TU5A 4JRQA 1IJJA 3HVTA 4EZ9A 3GE1A 3TAEA 3ZT4A 1OKJA 2P9PA 1BL3A 5FPMA 4BE7B 5C15A 4JHDB 4CE9A 1XWLA 4GMJB 1UAXA 1NGIA 4DR5K 1HNXK 4C23A 2VQFK 5LMUK 1BG3A 1HNZK 4DQ8A 3VQPA 2XHBA 4M63C 4RW8A 5DMRA 1W9HA 3OYGA 3I56N 2KTQA 4DQIA 5C12A 4N41A 3J7YP 3MXIA 1WBDA 1C0GA 1XMQK 2VYPA 3TR8A 2DFFA 4L8RB 3UIQA 3PSFA 5D3GA 3EE9A 1NWKA 4Z4CA 4UQGA 3VEXA 4F9OA 2W42A 1GOAA 1WSHA 1BWFO 4E7JA 2ASOA 4CJ5A 1EQYA 4A5AA 3OYNA 3TSUA 3VEZA 5TKYA 4K0KK 4H5RA 4LFBK 1KLMA 3AARA 5HRSA 1C0MA 4CK3A 1MA9B 2GUPA 4FWNA 4CFCA 1OH8A 4IJAA 4LH4A 1GOCA 4M3YA 2WBNA 4ID1A 4NYFA 4LF7K 2KZZA 4DTSA 4ID5A 1KLNA 4B9LA 4Z4GA 3OYFA 3NH1A 1D5AA 5DM7L 2NRRA 3NGZA 1L3VA 4QS7A 4E19A 2QWNA 2ZE2A 1TKTA 3H3OB 2A6AA 3ZX0A 4GVMA 4Y0WA 3DXMB 3H45C 4JI7K 4FLZA 3E9OA 2UXCK 3EKSA 4AHRA 3L2VA 1BUPA 4H5TA 4H5NA 1Z25A 3RRGA 1QHAA 1WBBA 1NGGA 1X9JA 2D4WA 2PY5A 4YOTA 4C1NI 1VSKA 1GOBA 4FPBA 3HT3A 3V9SA 3SBTA 3RVCA 5C10A 1S6PA 2IOCA 3V9ZA 4OX9K 1X1PA 1EX4A 3NVMA 4KAZA 3PUFA 4IXCA 5HBMA 1RTJA 3HO1A 4Z4HA 1BDGA 1VQON 4CFDA 1U2VB 4JD2B 4X64K 4DFPA 4BRCA 1D8YA 4K41A 3QINA 1ZBFA 5I9EB 4AHUA 2UUAK 2G8KA 3VQ5A 4LF8K 2A40A 4BQZA 3OYCA 3KD5E 3QLHA 1W97L 3L4IA 4HVJA 1T03A 4FWRA 1E4FT 3O4WA 4AH9A 1K73O 4KH6A 3U3YA 4B1VA 4KHSA 3MCAB 3LM9A 4KREA 4FJLA 2UXBK 2Q0RA 1S22A 4E3SA 3DXKB 1S1TA 2HSTA 3TTDA 4YDUC 1VQ6N 4JHDA 5J2PA 1RTIA 2FC0A 4DSEA 2ZJQL 4WFAL 3LDPA 1JCFA 3QMLA 4RW7A 3T69A 5JLFA 1VSLA 4ISEA 2IC3A 2OPRA 1MWMA 4B1UB 2F8TA 1DEJA 2KW4A 4OJRA 1P8ZA 4U7BA 2GEMA 2P9KA 3QICA 1QSLA 4DV0K 2HBLA 5AQJA 5AQLA 2O8BB 1I94K 3ENBA 1SKWA 2WC9A 1NJIO 4FJHA 4CECA 3QFUA 2HMPA 1RT5A 3HBTA 4WF9L 3BGRA 5BR8K 2BTFA 4CJTA 4FM0A 3CFPA 4H4OA 1SUQA 1T8EA 3NF6A 3S9HA 4C8LA 4CJ3A 3M8SA 3L8BA 1U48A 1QS4A 1QHTA 4E7LA 5GIPA 3WXMB 4HHTA 4BDPA 5I3UA 5GADP 2X6SA 3ULEB 2P9NB 3OA9A 4C8NA 3B6OA 4AF1A 3CMEN 3BDPA 4OPKA 4ZHRA 3CCUN 1RDCA 4WE1A 3DLKA 3KKSA 4X65K 4FYDA 1IG9A 2ZGYA 1GLAG 1TYQB 4IOCL 3ZSVA 1KRPA 1T6DA 1C0UA 3KHYA 4K43A 1ZBIA 5CZ1A 4DUZK 5KI6A 4BR9A 1XHZA 3MCPA 3K5MA 4CJKA 4PQUA 5AQMA 2W00A 4O0IA 3L2UA 1S1WA 2FXUA 4FWMA 4OGCA 4B9QA 2YHXA 3MN7A 4CJVA 2D0AA 4CGIA 4IDHA 4DFJA 1SAZA 3SJJA 3HZ6A 1NBWA 3JSMA 5ELZA 4PL7A 3NAEA 4HUEA 3MN9A 2YX6A 1QZ6A 3CFOA 3J80O 3OJUA 3NFAA 1KC8O 2HHUA 4JAXA 1KFDA 3K58A 5JVGL 4DUYK 3MMVA 2W40A 1S5JA 1K8KB 3UKUB 3KLGA 4DKWA 3F5TA 1CLQA 1HYVA 1NKCA 1QTMA 4KH4A 3SUQA 1BCMA 3EE8A 3M3ZA 4DS5A 4M7YA 1SS6A 2ZWHA 1KAYA 1JLFA 4ILGB 4CEEA 1GLLO 1KSPA 2HB5A 4RWTA 4LSLA 3V1OA 3JXUA 4FLYA 4NO7A 4LF6K 5HRPA 5BPMA 1QSYA 3AAPA 4CZKA 4CCHA 3I33A 3WEEA 3EYZA 2OYQA 1YUWA 3CJAA 1EWRA 3M8QA 4B1WB 5KQDA 4YOXA 3VMFB 4KBOA 3VQ9A 5LY3A 4DR3K 1HX1A 1RTHA 3L0QA 1D9DA 5J2NA 3A5LC 2P9NA 1M90O 1NGEA 3IRXA 4JKAA 2HMIA 2YNFA 1CZBA 4PY5A 4DQQA 3RR8A 1RBRA 3I55N 2P9LB 4PUOA 5SWMA 4KFBA 4DF8A 4H8KA 3AV9A 1Q86O 3GL1A 2YJEA 3D0PA 4MQ3A 4JS4A 3WT0A 3W3DA 1YJWN 2G8UA 1N33K 2ASMA 1XC9A 4CVNE 4BR0A 3DRRA 3NF9A 1KCFA 3L2WA 2DFHA 1RDAA 2BH1A 2V52B 1NK6A 4FXDA 4BR4A 1Q18A 4JLHA 4JKHA 3PV8A 1QSSA 4GKJK 1K9MO 2Q0UA 4W5NA 3TAGA 2HHTA 3CCLN 4CFAA 4DR2K 2Q31A 4BRFA 1XC3A 4FWPA 3MX2A 2E88A 3AVNA 3QFPA 5KPZA 3S41A 3O1WA 4FJ5A 2DFEA 2V7YA 4FM1A 1A5WA 1TK5A 3QERA 1L5UA 1NGHA 2E1YA 4JYAK 4I6MB 4FWSA 3TAFA 1XQSC 4IFYA 3HPOA 1TAUA 1N34K 4OGEA 3T19A 4CZEA 4B9VA 1JL1A 4O8UA 1U45A 3U8XA 3SQ2A 3ISNC 2NRWA 3DXMA 4LC9B 1Y64A 4BE1A 1RDBA 3SI6A 4DSLA 1U04A 4FLVA 2IVOA 1WSIA 4K25A 5C2DA 3MDQA 3FFIA 3MN5A 1WLJA 3AVBA 4TSXA 3LL3A 4H0TB 4EAHD 2A1SA 3C65A 3KKRA 1YF5L 4FO0A 3S3OA 1C0FA 1U2VA 4GY2B 4FVMA 4KV8A 1K8AO 3HP6A 4JI1K 4QCLA 4CJWA 2D5RA 3Q7CA 3RWUA 4IOXA 4GNIA 1RBVA 2A41A 2KQ2A 4X66K 3QETA 5M1OA 2FBYA 4JN4A 4BQLA 3HPGA 3QEPA 4DWIA 4BRPA 4FJNA 4AHCA 3M8RA 1J54A 4YOYA 4FJJA 1TUUA 3VTIA 3LWLA 4E7KA 3QEWA 3TAQA 1TAQA 4H0OA 4DU1A 3NVKA 5C42A 4HTLA 3E9LA 4YFUA 2E2PA 4YOVA 3H1QA 1N36K 2YCHA 1GLCG 2B4JA 2O4GA 3P83D 4JK8A 4DG1A 5FPEA 3TSQA 3LP3A 4GKKK 4DTMA 1N8RO 1M1KO 2VWKA 5B8HA 4B3OA 4GV9A 4H5VA 3SK3A 4K42A 2W41A 2P9SA 1HJOA 2Q1NA 2XY8A 4FLXA 3VF4A 3ZT0A 5JENA 4BRIA 4YY3K 5CR4A 3R9PA 4B9NA 3CCEN 1S1XA 3VF6A 4OO1J 2J4RA 3D6RA 2FBVA 3O3FA 4E7IA 4FJKA 4JNEA 3VQ7A 1N32K 5BRFA 4PKGA 3OBYA 1NGDA 4CW7B 3SAFA 4EHTA 3VQ6A 3U9ZA 3OY9A 3UKRA 3OHRA 1BI4B 4BWJA 1W0HA 1VSFA 3OS2A 3CCRN 4F3TA 3CIPA 2P9PB 3J7AP 4CERA 1VSHA 4FCYA 2NRVA 4IBNA 4M3ZA 3UKRB 1G15A 2Q3SA 3H1VX 4O8KA 1BI4A 5C24A 2YNIA 4CZLA 4CEAA 3O9RA 1HNVA 4F8RA 2I7PA 1T44A 2QKKA 3V81A 5JS2A 1BA0A 4CEOA 3J81O 3DWLA 4KI4A 4DMNA 4BWMA 3VENA 4KB0A 2X74A 4BREA 3MECA 3HYFA 5JMVA 3CCQN 4JI8K 3CG7A 1IBKK 3C6UA 1Q82O 1NGJA 4OLBA 5K14A 1QQOA 3WXJA 3MAQA 1VSMA 3EN9A 1NK4A 3KTQA 5BRHA 5TKWA 2O8FB 2JLEA 2Z1JA 3O5BA 3O9SA 4CF9A 4F4KA 2GX9A 5A2QO 4GW6A 4M7XA 1EP4A 4BRAA 1DTTA 2HNYA 3R3LA 1KD1O 3S5TA 3AA5X 4NB4A 3G25A 3HPHA 4ELVA 3DI6A 1GLBG 3LAKA 1I3AA 2PFUA 3ZETB 2R7YA 4ILHA 3WXKA 4KPYA 2HHWA 3P38A 5J2QA 5DK5A 4IJNA 1W7AA 4DSFA 3LM2A 5KPRA 2ETJA 3ZSXA 2NLXA 1VK0A 4W5QA 3C0BA 4FZZA 5AQFA 3DLLL 1TKZA 3DLHA 3U3GA 1OVQA 4DS4A 1QVFM 4CJUA 3MWTA 4DTRA 3I0RA 5AZIA 3DYAA 3L3VA 1E3MA 3G6EN 2O8EB 1WSJA 3AO3A 3AO5A 3SNNA 1DT9A 1HLUA 3DLRA 3FLCO 1BU6O 3VGLA 4ZTJA 2YHAA 4DR6K 3EO3A 5BPLA 3K2PA 3WXLA 3ULDA 4M3XA 4IZ9A 4I9QA 3V1QA 2CGJA 3OBWA 3EZWA 3OYLA 4R5PA 5BRDA 4CJEA 4DR7K 1RT2A 2ZJPL 1JLBA 1CXUA 2XY7A 1TUYA 1NKEA 4QOZB 1EXQA 3UE5A 3D7EO 4CJFA 4ELUA 2E20A 5AQZA 2XY6A 1HKCA 1VQ4N 2ZJRL 1WOQA 3RMBA 1C6VA 1O13A 3THWA 1RT7A 3VGKA 1RT3A 2HHVA 2AA4A 4CIEA 1YTAA 5AZIB 1J5EK 1EETA 4NXNK 2BUPA 2CH5A 5AQSA 4IOAL 4CHZA 5GAEP 1TK0A 3MXJA 2F8SA 4FJ8A 3P5JA 2BDPA 4B3SK 3E9PA 2QI2A 4MDAA 2F9WA 3QEXA 1KVAA 1FKOA 4G1QA 2VWJA 2NRZA 4EZ6A 4YNQA 4KH5A 1YJ9N 3T3FA 4JI6K 2ZD1A 4H4MA 2YHBA 2D0BA 1CZAN 3KWGA 3QB0A 1VQPN 1J53A 3KK7A 2HF4A 1VSEA 5GAGP 1KTQA 4N47A 1NOZA 4C1NK 3KK2A 5JVHL 4DV5K 4XJXA 4LF4K 1RBUA 2ASPA 5AFUH 2IIRA 4GVEA 4A2BA 5MLCQ 1ZC6A 3FR0A 4WFBL 1ZBLA 3HTVA 5AZJB 3K5NA 1SV5A 1VQLN 1NMNA 3OYEA 1FXXA 2I5JA 4YOWA 1MWKA 1IKVA 3SUPA 3RMAA 4LSNA 4E1JA 1HKBA 3CJ7A 1QQCA 5M1PA 3ASMA 1RBTA 3EKUA 2CGLA 3SMSA 5HROA 3LDNA 5EXWA 3ZEUA 1BQMA 3ZLJA 1HPZA 2QWQA 1NK8A 5FRMA 1HQEA 2KLAA 4DB3A 3LDLA 3QEVA 4CZMA 1V4TA 3RSEB 1X9MA 4OKKA 3SV4A 3FZFA 2W6KA 2QXLA 1NGFA 3O3HA 3HVRA 4BC2A 2GTDA 4O4GA 3SZ2A 3B8AX 4WYBA 5M1QA 1L3SA 1Z6RA 1B9FA 5M1FA 3MWPA 3DRPA 1JLQA 2P51A 4DR1K 1VSDA 3ID6A 3TANA 1W2BM 2IDOA 4FJ9A 3SBGA 4CEFA 4M3UA 4GV6A 4CESA 5KRTA 1HQUA 1OH5A 4RG8A 5LMNK 1TL1A 4FM2A 1SZ2A 1S1VA 4CBXA 4DCHA 2X78A 2HF3A 3ZT2A 2YNGA 1YAGA 3WXIA 1VQ8N 1KAXA 3PX6A 3NF7A 4OVLA 4AILC 1NJWA 2UUBK 1YXQA 4IWVA 2UXDK 5JS1A 3OS0A 4KHYA 4JI4K 3NMUA 1TYQA 3D2FB 3FE1A 3VERA 3WNFA 1RNHA 1DGKN 4FK2A 1WUAA 3BZCA 1L3TA 3MEEA 4BECA 5AQNA 3ZSYA 3AAQA 3FGUA 1RT1A 2O8DA 1WN7A 1D9FA 3KWIA 3S3MA 1XI1A 1IBMK 4EP4A 4FJMA 4N5SA 4JEPA 4HTUA 3ULEA 4F2SA 2LSNA 2GUIA 3QO9A 4I7FA 4CZJA 3VQDA 4JKDA 4CEBA 3IFRA 2FF3B 4N56A 3PO5A 3LPTA 4KHNA 2RKIA 3O4NA 1BA1A 1Q7YO 2QWPA 1LW0A 2RPIA 4CEDA 2NZTA 4B1ZA 1KAZA 3ID8A 5KTQA 1WSFA 3BUZB 3QNOA 2FSKA 3BF3A 2AP1A 1CZ9A 1LV5A 2E5LK 4NYNA 2O4IA 3NDKA 1ZYQA 2KFZA 4MFBA 4NLCA 3EEQA 1C1BA 1U6ZA 3CPEA 5C25A 4U67L 2GBZA 3LWMA 5I42A 3S3NA 1SL0A 2ATQA 5IWAK 3AVLA 3G10A 3VGMA 4FOEA 4KTZA 4AHTA 3KLFA 1I39A 4PL8A 3AA2A 3ZSZA 1VSIA 3K9JA 1SL2A 4DTJA 4QS8A 5AZJA 1VQ5N 3BZKA 3ZT1A 4JD2A 3CPWM 4OPHA 3M1FA 4DTNA 2WOMA 3KK1A 3DLBA 4N76A 2UU9K 1P90A 1H1VA 4EP5A 4JI3K 5AQQA 2E6LA 2A3ZA 4Y1CA 3OYKA 3K5LA 3CMAN 3RR7A 2O8EA 3MN6A 3LALA 1WSGA 1U49A 1SKSA 3AY9A 3ZT3A 4BROA 2OANA 5HLFA 1VQNN 2VWBA 4Z4EA 1RBSA 3AGRA 2E6MA 2HHQA 4CHQA 3P39A 2D1KA 3MK6A 1QVGM 1NGCA 2ZF5O 5BPNA 1T05A 2VG6A 3AVCA 3OYIA 1V4SA 4Z4IA 3E1YA 3PX4A 1ESVA 3IUCA 4OKJA 4EHUA 2OPPA 3O6WA 4B8AB 4DF4A 1O1WA 4E1NA 4E7HA 1X3NA 1DTQA 3EZ5A 5AQKA 3U6FA 3Q7BA 3AA4A 3AVHA 2P9LA 3CC4N 4IO8A 3CCSN 3KLHA 4XH1A 3B6PA 4K8XA 4PWDA 4BG9A 3RRHA 3C7NA 5E84A 3O1BA 2DPNA 3ENHA 1J6ZA 3G0ZA 3THYA 1NKBA 1GLDG 4A61A 3VQAA 2YKNA 3MEDA 4BE0A 1ZXOA 3CC7N 4I9LA 5KGWA 2HNZA 1JLGA 4Z0UA 2EHGA 4NXMK 4BGAA 2QK9A 4KKOA 4O0JA 3AVJA 4WQ5C 1T3VA 1RDWX 5M1NA 4RTFD 3FZKA 3VA3A 4FJXA 2JGUA 4JKEA 3KJVA 3I8DA 3NH2A 5GINA 1S9EA 4AHSA 5FLXO 2UUCK 2PBDA 2VG5A 1MDUB 3LDQA 1ZBSA 4O5FA 4IFVA 3ATUA 3VEWA 1JJ2M 3VQ8A 3VEVA 4BY9C 5FRNA 3MX5A 3O80A 5KRSA 3SUOA 5KQ8A 1Q9YA 1BQNA 4YDUA 1HRHA 3IS9A 4DHYA 3ATVA 1NJXA 3SPYA 3WNEA 2P9UA 5AJ3K 3ALYA 3A5MC 3HM9A 1TVRA 4NCBA 4OKEA 3CQYA 4F3OA 3O8MA 2VQEK 4J2BA 3OYBA 1NK7A 1KXPA 4JK9A 3F73A 3KLIA 2WUSA 3RMDA 5AQHA 4CGHA 4FK0A 4FOIA 4FVUA 2OA8A 1TKDA 2BE2A 1T7PA 3WQUA 4CJRA 1FK9A 3A5NC 5BR9A 4BE2A 4DU3A 2CH6A 3BY5A 4IEEA 3I8BA 4IG0A 4BDYA 3HSCA 1R59O 2F96A 2KKZA 3BEXA 1GLFO 1ASWA 4A59A 2WFBA 4A62A 1UA0A 3H08A 2ITMA 1GLEG 4Y1DA 4DFKA 4FLTA 3QESA 4LF5K 3TTCA 3J7ZO 5F0XA 1JCEA 3OTOK 2AJQA 1IV0A 3OJSA 4HWIA 4DV4K 4DTUA 4FWKA 4BG8A 3C7NB 4CF0A 3CM5A 1VAZA 4B3TK 3WEEB 4JKGB 3AO1A 4EFHA 4CD3A 3IKMA 1U47A 2NRTA 2HHXA 3PLAA 4DV1K 4DSIA 1ILYA 1G99A 4CK1A 1OH7A 4KHPK 3JAMO 3OYMA 2YI1A 2JWLA 1D4XA 4M3WA 2Z1HA 5CE3A 4CJPA 2KZMA 1LCUA 4HUGA 4CHNA 3UKUA 2PAVA 1CXQA 4BRHA 4CBWA 3CJCA 2HHHK 3KZBA 4M3RA 4BRDA 3K57A 1RDDA 4B1XB 3ZSQA 4M41A 4AQYK 4FSVA 3L3UA 1RT4A 3C94A 4CI6A 1LAWA 1NLVA 4LY7A 4W5RA 3CXCM 1X9WA 3OYAA 3MXMA 2D0PA 3CJ9A 4CF2A 2CGKA 1QQNA 4DTOA 2HHSA 4IEIA 5F1XA 1YTUA 2WTUA 1K8KA 3T1HK 3VA0A 4Z94A 2HVHA 4J2EA 2XY5A 4AHVA 4BRKA 1HYZA 3SYZA 2OZMA 4H5WA 3DLGA 3VQ4A 5AFUA 2RN2A 4KHUA 4OPJA 1NK5A 3CJ1A 2OPQA 4R79A 4BRQA 3AVKA 1NJYA 2C1IA 4O44A 4F2RA 2E4LA 1EWQA 2NRXA 1L3UA 4IO9L 4DSJA 5JLHA 1J5OA 4L3QA 4CEZA 3KIOA 2VGMA 3O08A 1LOTB 4CIGA 3O3GA 4FZXC 2VG7A 4GV3A 2Q36A 5AQXA 2E2NA 4XIUA 1TL3A 4H0PA 1LWEA 3A8YA 4B3RK 3F9KA 2ZGZA 4CGFA 1NOYA 2IAJA 3AVMA 5AQWA 3THXA 3THYB 4ICLA 2PYJA 1ZBUA 5SZTA 1EO1A 1S72N 3AVFA 3VN5A 4BEBA 2QWMA 1S6QA 4CEQA 3ZSRA 3BF1A 3OS1A 3CI5A 4BVOA 4CGDA 2QM1A 3L2QA 4LFCK 5FDLA 1BGXT 3AO2A 2KFNA 2FSJA 3L4QA 3CM6A 4BRNA 3RTVA 1VRUA 2UYTA 5BN9A 3TABA 1UOCA 3A5OC 2Y1JA 1JLEA 4AM6A 4B9UA 4JK7A 4BGBA 5AQYA 3THVA 4NLBA 4DV6K 3I0SA 1S3XA 3C6AA 5CY4A 5C0YA 4BC4A 2EWSA 2IVNA 3KD1E 2P5OA 2P9UB 3TPQA 4M42A 4J2AA 3N4QA 2HBJA 3W0LA 4ZTFA 4WQ4C 3K5OA 1F21A 2FF6A 4LD0A 1JL2A 2EX3A 1NK9A 1IKYA 3JS6A 2O8CB 4E72A 3NHGA 1VQMN 1C0TA 4FJGA 3DJCA 4CZFA 2OPSA 1XNRK 2V7ZA 4BC3A 1YITN 1WB9A 4A2AA 4CJQA 4UY8O 3LPUA 4J2DA 2P9SB 1OH6A 1MU2A 2V51B 1NM1A
chains in the Genus database with same CATH topology
3N4PA 5EOYA 1DGKN 3D2EB 2Q2RA 3K9KA 1KQSM 1NGHA 2E1YA 4I6MB 4FWSA 1WUAA 4FWOA 1XQSC 3R1XA 4BECA 5AQNA 3WQTA 4CBUA 3AAQA 3FGUA 4CZEA 5HL7L 4O8UA 3HOTA 3KWIA 2F7TA 3U8XA 3DAWA 2NRWA 3DXMA 3EL2A 4LC9B 3CERA 1Y64A 4JEPA 3ULEA 3T7ZA 4WCEL 1XUPO 3R6MA 4CZJA 2IVOA 4JKDA 3IFRA 2FF3B 4K25A 3F2KA 4A5BA 5C2DA 2GWJA 3MDQA 3MN5A 3LL3A 4H0TB 4IFEA 4EAHD 3C65A 4MDBA 4WQ5A 3ZYYX 5KPTA 1YF5L 1BA1A 4MO4A 5M1KA 4FO0A 5EVZA 1C0FA 2QWPA 3VERA 1Q7YO 3LDOA 1SQKA 2NZTA 2NRHA 5F2RA 3VPZA 1KAZA 4B1ZA 3ID8A 5GAHP 1U2VA 2OTLN 4AM7A 5BN8A 4JKGA 4GY2B 3BUZB 3QBWA 2FSKA 3BF3A 2AP1A 3FZLA 4H0YB 4A57A 3TU5A 1IJJA 3CETA 3GE1A 1K8AO 1OKJA 2P9PA 5FPMA 4BE7B 5C15A 4JHDB 3Q7CA 4IOXA 1NGIA 4GNIA 4NLCA 3M5RA 4C23A 1U6ZA 3CPEA 2A41A 1E4GT 4U67L 1BG3A 5M1OA 4G9ZA 4JN4A 5AQPA 4BQLA 3VGMA 4J8FA 4FOEA 4DQ8A 4PL8A 3GBTA 4BRPA 3CC2N 1GLJO 4YOYA 1TUUA 3VTIA 3K9JA 4M63C 4H0OA 4QS8A 3I56N 5AZJA 1VQ5N 3NVKA 2YJFA 4HTLA 3E9LA 2E2PA 2H3GX 4YOVA 3H1QA 1VQKN 2P9KB 4JD2A 3CPWM 4OPHA 5C12A 2YCHA 3M1FA 1GLCG 4CD1A 5AQUA 5EY4A 1P90A 4JK8A 1H1VA 2P9IB 5FPEA 1C0GA 3TSQA 2VYPA 5FPNA 1NGBA 3AGKA 4XEIA 1NGAA 5AQQA 1N8RO 1M1KO 3EE9A 5B8HA 2A3ZA 1T6CA 1NWKA 4GV9A 3CMAN 2E2QA 3MN6A 3VEXA 3TTFA 4H5VA 3CHWA 3SK3A 4F9OA 2D0OA 1BWFO 3AY9A 4K42A 2W41A 2E8AA 4BROA 2ASOA 1OVYA 2OANA 5AQRA 1EQYA 2P9SA 1HJOA 1VQNN 2VWBA 2Q1NA 4A5AA 3FZHA 2HBKA 3AGRA 3TSUA 4ISFA 5TKYA 3VEZA 4H5RA 3VF4A 4BRIA 3AARA 5CR4A 3P39A 1YHQN 2D1KA 3M6GA 3MK6A 3R9PA 1QVGM 1NGCA 2ZF5O 5BPNA 3CCEN 3VF6A 5H1SQ 1V4SA 4FWQA 3E1YA 4OO1J 1ESVA 3IUCA 2J4RA 3D6RA 4EHUA 4BR5A 3O6WA 1MA9B 2GUPA 1ATRA 4JNEA 3CJBA 4FWNA 1QQMA 4IJAA 1X3NA 2WBNA 5AQKA 3ENOA 2F9TA 5BRFA 4PKGA 3OBYA 1NGDA 3SAFA 3Q7BA 4EHTA 1BOTO 2P9LA 3U9ZA 3UKRA 3CC4N 1YJNN 2QEXN 4IO8A 3OHRA 5DM7L 2NRRA 3CCSN 2RHKA 5LJWA 4XH1A 4QS7A 3CCRN 2QWNA 2I7NA 4BG9A 3CIPA 2P9PB 3H3OB 3C7NA 1RGIA 2NRVA 3O1BA 2DPNA 2A6AA 5E84A 4ISGA 3ENHA 1J6ZA 4H03B 3ZX0A 3ZX2A 1GLDG 3UKRB 4BVPA 4A61A 4Y0WA 3DXMB 3H45C 3H1VX 2HOEA 4O8KA 1ZXOA 3OW2M 3CC7N 2C1GA 4CZLA 3E9OA 3O9RA 3EKSA 2I7PA 4BGAA 1BUPA 1T44A 4H5TA 4H5NA 1QHAA 4WQ5C 1T3VA 3SJHA 1RDWX 1NGGA 1X9JA 2D4WA 1BA0A 4RTFD 5M1NA 4YOTA 3DWLA 4C1NI 3BP8A 4ILJA 4WFNL 4FPBA 3VENA 3FZKA 5ADXH 3SBTA 3RVCA 5C2FA 5C10A 4JKEA 4BREA 3CCQN 3NVMA 5JMVA 5GINA 1JCGA 4IXCA 2PBDA 2P9IA 1Q82O 1MDUB 1NGJA 3LDQA 4FL9A 1BDGA 1HKGA 1ZBSA 3UB5A 1VQON 4O5FA 1QQOA 3ATUA 3VEWA 3WXJA 1JJ2M 1U2VB 4I6MA 4JD2B 3EN9A 1RDUA 3MX5A 3O80A 3VEVA 5BRHA 3HOSA 2QA4N 4BY9C 5TKWA 4BRCA 2OTJN 4K41A 3O5BA 3O9SA 5KQ8A 3P31A 4FPAA 5I9EB 1RFQA 4YDUA 3VOVA 4H0VB 5EX5A 2GX9A 4DHYA 2NNWA 3ATVA 2A40A 4M7XA 4BQZA 2P9UA 1ATSA 4BRAA 1YI2N 3R3LA 3DXKA 3A5MC 1W97L 3L4IA 3QBXA 1KD1O 3FZMA 4FWRA 1E4FT 3O4WA 1K73O 2QWRA 2GELA 4KH6A 3CQYA 4NB4A 3G25A 3O8MA 4B1VA 3MCAB 3LM9A 1GLBG 4JKFA 2PFUA 3ZETB 1KXPA 4JK9A 3KVGA 4ILHA 3WXKA 2Q0RA 1S22A 3CCMN 2WUSA 3DXKB 3P38A 5AQHA 5AQIA 4IJNA 2HSTA 4FOIA 3LM2A 4FVUA 5KPRA 2NLXA 3TTDA 3WQUA 3A5NC 3C0BA 4MLHA 4YDUC 5AQFA 4EIAA 5BR9A 5HOOA 3DLLL 1VQ6N 4JHDA 1QVFM 2CH6A 4IEEA 3MWTA 3I8BA 2ZJQL 4WFAL 3HSCA 1R59O 3HI0A 3LDPA 2KKZA 5AZIA 3BEXA 1GLFO 4A59A 2WFBA 3G6EN 1JCFA 3QMLA 3T69A 4A62A 5JLFA 2ITMA 1DT9A 1GLEG 1HLUA 4ISEA 3FLCO 4QS9A 1BU6O 4B1YB 3QDKA 4BR7A 4BR2A 3VGLA 4BRGA 3TTCA 2E2OA 3H46O 1JCEA 5F0XA 3J7ZO 1MWMA 4B1UB 1DEJA 3EO3A 4CZGA 5BPLA 3WXLA 1P8ZA 3O9UA 4HWIA 1ATNA 4IZ9A 4FWKA 2CGJA 4MO5A 5FPDA 4BG8A 2GEMA 3C7NB 4U7BA 3OBWA 2P9KA 1HPMA 1HUXA 1VAZA 3EZWA 4XH4A 3WEEB 4JKGB 2A42A 3QICA 3A0IX 5BRDA 2HBLA 5AQJA 4EFHA 5AQLA 3IKMA 4CD3A 3ENBA 1NJIO 2WC9A 3ZX3A 2NRTA 2ZJPL 3PLAA 3QFUA 2HMPA 3HBTA 4WF9L 3SMPA 1ILYA 2BTFA 3RSEA 1G99A 2VCPA 1TUYA 5AQGA 3SAHA 4PKIA 2JWLA 2YI1A 3VEOA 3UE5A 3D7EO 1D4XA 5GIPA 2E20A 5AQZA 3WXMB 3E66A 1HKCA 5CE3A 1VQ4N 1VQ9N 1LCUA 5GADP 3ULEB 3UKUA 2P9NB 3OA9A 2ZJRL 1WOQA 2PAVA 3O9QA 4RCHA 4BRHA 3R8EA 4AF1A 4CBWA 3CMEN 3CJCA 5JICA 3KZBA 1O13A 4BRDA 1YIJN 3C6HA 3F9MA 3VGKA 3CCUN 4B1XB 4FSVA 3PIOL 2AA4A 4CI6A 2VGNA 5AZIB 1NLVA 3CXCM 4YOUA 3G4SN 5CHIA 2D0PA 3D2EA 3SAGA 3CJ9A 2ZGYA 2QW9A 2BUPA 4OPAA 1GLAG 1TYQB 3L6QA 2CGKA 2CH5A 4IOCL 5AQSA 4IOAL 1T6DA 3KHYA 1QQNA 5GAEP 4K43A 1NMDA 4IEIA 4BR9A 5F1XA 3MCPA 3E9PA 5AQMA 2W00A 2QI2A 4MDAA 2F9WA 3SLCA 1K8KA 2YHYA 2FXUA 4FWMA 5ADXA 4B9QA 4Z94A 2NRZA 2YHXA 3MN7A 4KH5A 1YJ9N 4BRKA 4PHTX 2Q97A 4IDHA 1SAZA 3HZ6A 1NBWA 1CZAN 3KWGA 4H5WA 3QB0A 5AFUA 1VQPN 3KK7A 5ELZA 4PL7A 2HF4A 5GAGP 3MN9A 2FLOA 4C1NK 5JVHL 4XJXA 3CJ1A 2YX6A 3IMXA 4WQ4A 4R79A 2ASPA 5AFUH 4BRQA 1QZ6A 3PIPL 2IIRA 4GVEA 4A2BA 2C1IA 3CF5L 3ZEUB 5MLCQ 1KC8O 4JAXA 1ZC6A 2FSNA 2JWKA 2NRXA 3FR0A 4WFBL 5JVGL 5AQVA 3MMVA 2W40A 3CD6N 4IO9L 1K8KB 2YHWA 3HTVA 3UKUB 5JLHA 4DKWA 4L3QA 5GIOA 3F5TA 5AZJB 4MLEA 3HM8A 1VQLN 2VGMA 3O08A 4KH4A 4YORA 1LOTB 5E26A 3EE8A 3M3ZA 1BO5O 4M7YA 1SS6A 3H6EA 2ZWHA 2E1ZA 4CZIA 1MWKA 4YOWA 1KAYA 4ILGB 3VESA 1GLLO 4E1JA 1YVNA 1HKBA 1Z05A 2Q36A 3CJ7A 5AQXA 4GV3A 2E2NA 2HBMA 2QWOA 5M1PA 4H0PA 4RWTA 3EKUA 2CGLA 3A8YA 3JXUA 4NO7A 1IG8A 3SMSA 2ZGZA 3LDNA 5EXWA 3ZEUA 5BPMA 3AAPA 2RE2A 3CCVN 4CZKA 3I33A 3WEEA 5AQWA 2QWQA 5AR0A 2KHOA 1YUWA 3CJAA 4XH5A 3VETA 4B1WB 1EO1A 2KLAA 5KQDA 4PKHA 1DKGD 4YOXA 1Q81O 3VMFB 3LDLA 4BRMA 4CZMA 1V4TA 4KBOA 3RSEB 4DB3A 1S72N 3FZFA 5LY3A 4BEBA 4JKBA 2QTDA 2QXLA 3D2FA 2QWMA 1NGFA 3TSPA 1HX1A 3L0QA 3BF1A 3A5LC 4BC2A 2GTDA 2P9NA 1M90O 3CI5A 4BVOA 1NGEA 3B8AX 2QM1A 4WYBA 5M1QA 4BC5A 4FWLA 4JKAA 2GWKA 3VF2A 1Z6RA 5M1FA 3GOIA 2FSJA 3L4QA 3MWPA 3I55N 2P9LB 3ID6A 4BRNA 1W2BM 2UYTA 5BN9A 3G71N 3SBGA 1Q86O 3GL1A 2A5XA 1QZ5A 3A5OC 2YJEA 4AM6A 4BRLA 4JK7A 3WT0A 4GV6A 4BGBA 5AQYA 3W3DA 1YJWN 2ASMA 4NLBA 1VQ7N 3CQXA 1S3XA 3C6AA 4BR0A 2QWLA 3HRGA 5DM6L 4BC4A 2EWSA 3IDHA 5C0YA 2IVNA 3J8AA 2P9UB 3GDQA 3TPQA 2BH1A 1SZ2A 3N4QA 2HBJA 2V52B 3W0LA 4CBXA 4JKCA 3VEYA 4DCHA 4BR4A 3CCJN 2HF3A 4H0XB 4WQ4C 1YAGA 1Q18A 3WXIA 4JKHA 3GG4A 1VQ8N 1KAXA 3VTHA 3P4IA 1K9MO 2FF6A 2Q0UA 5BREA 3JS6A 3WUHA 1X3MA 2IVPA 3ZETA 3CCLN 1VQMN 4CZHA 3O9TA 2Q31A 1XC3A 3FFKB 4FWPA 3DJCA 2E88A 3MX2A 3QFPA 4BRFA 4CZFA 2V7ZA 5KPZA 1YXQA 4IWVA 3S41A 5AQTA 4BC3A 5LJVA 1YITN 4A2AA 3O1WA 3U4LA 4CJ7A 4UY8O 2P9SB 5AQOA 3H3NO 3U9DA 2V7YA 1TYQA 3D2FB 3FE1A 3NMUA 2V51B 1NM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EOY A;  1DGK N;  3D2E B;  2Q2R A;  1NGH A;  2E1Y A;  4I6M B;  4FWS A;  1WUA A;  4FWO A;  1XQS C;  5AQN A;  3WQT A;  4CBU A;  3AAQ A;  3FGU A;  4CZE A;  3U8X A;  3DAW A;  4LC9 B;  3DXM A;  3EL2 A;  3CER A;  1Y64 A;  3ULE A;  1XUP O;  3R6M A;  4CZJ A;  2IVO A;  3IFR A;  2FF3 B;  4K25 A;  2GWJ A;  3MDQ A;  3MN5 A;  3LL3 A;  4H0T B;  4EAH D;  5KPT A;  4WQ5 A;  1BA1 A;  4MO4 A;  4FO0 A;  5EVZ A;  1C0F A;  2QWP A;  3VER A;  3LDO A;  1SQK A;  2NZT A;  2NRH A;  5F2R A;  3VPZ A;  1KAZ A;  4B1Z A;  3ID8 A;  1U2V A;  4AM7 A;  5BN8 A;  4GY2 B;  3BUZ B;  3QBW A;  2FSK A;  3BF3 A;  2AP1 A;  3FZL A;  4H0Y B;  3TU5 A;  1IJJ A;  3CET A;  3GE1 A;  1OKJ A;  2P9P A;  5FPM A;  4JHD B;  1NGI A;  4GNI A;  4C23 A;  1U6Z A;  2A41 A;  1E4G T;  1BG3 A;  4JN4 A;  5AQP A;  4BQL A;  3VGM A;  4J8F A;  4FOE A;  4DQ8 A;  4PL8 A;  3GBT A;  4BRP A;  1GLJ O;  1TUU A;  4M63 C;  4H0O A;  4QS8 A;  5AZJ A;  2YJF A;  4HTL A;  2E2P A;  2H3G X;  3H1Q A;  2P9K B;  4JD2 A;  2YCH A;  3M1F A;  1GLC G;  4CD1 A;  5AQU A;  5EY4 A;  1H1V A;  2P9I B;  5FPE A;  1C0G A;  2VYP A;  5FPN A;  1NGB A;  4XEI A;  1NGA A;  5AQQ A;  5B8H A;  2A3Z A;  1T6C A;  1NWK A;  2E2Q A;  3MN6 A;  3VEX A;  4F9O A;  4H5V A;  3CHW A;  3SK3 A;  2D0O A;  1BWF O;  3AY9 A;  4K42 A;  2W41 A;  2E8A A;  4BRO A;  2ASO A;  2OAN A;  5AQR A;  1EQY A;  2P9S A;  1HJO A;  2VWB A;  2Q1N A;  3FZH A;  3VF4 A;  3VEZ A;  4ISF A;  5TKY A;  4H5R A;  4BRI A;  3AAR A;  2D1K A;  3M6G A;  3MK6 A;  3R9P A;  1NGC A;  2ZF5 O;  5BPN A;  3VF6 A;  1V4S A;  4FWQ A;  1ESV A;  3IUC A;  2J4R A;  4EHU A;  4BR5 A;  3O6W A;  1MA9 B;  2GUP A;  1ATR A;  4JNE A;  3CJB A;  4FWN A;  1QQM A;  4IJA A;  1X3N A;  5AQK A;  3ENO A;  2F9T A;  5BRF A;  4PKG A;  1NGD A;  4EHT A;  1BOT O;  2P9L A;  3U9Z A;  3UKR A;  4IO8 A;  3OHR A;  5LJW A;  4XH1 A;  4QS7 A;  2QWN A;  2I7N A;  4BG9 A;  3CIP A;  2P9P B;  3H3O B;  3C7N A;  1RGI A;  5E84 A;  3O1B A;  2DPN A;  2A6A A;  3ZX2 A;  4ISG A;  3ENH A;  1J6Z A;  4H03 B;  3ZX0 A;  4BVP A;  1GLD G;  3UKR B;  4A61 A;  4Y0W A;  3DXM B;  3H45 C;  3H1V X;  2HOE A;  4O8K A;  1ZXO A;  4CZL A;  3EKS A;  2I7P A;  4BGA A;  1BUP A;  1T44 A;  4H5T A;  4H5N A;  1QHA A;  4WQ5 C;  3SJH A;  1RDW X;  1NGG A;  1X9J A;  2D4W A;  1BA0 A;  4RTF D;  3DWL A;  3BP8 A;  4FPB A;  3VEN A;  3FZK A;  5ADX H;  4BRE A;  5JMV A;  1JCG A;  4IXC A;  2PBD A;  2P9I A;  1MDU B;  1NGJ A;  3LDQ A;  4FL9 A;  1BDG A;  1HKG A;  1ZBS A;  3UB5 A;  4O5F A;  1QQO A;  3ATU A;  3VEW A;  3WXJ A;  1U2V B;  4I6M A;  4JD2 B;  3EN9 A;  3VEV A;  3O80 A;  5BRH A;  4BRC A;  4K41 A;  3O5B A;  5KQ8 A;  4FPA A;  5I9E B;  1RFQ A;  4YDU A;  3VOV A;  4H0V B;  5EX5 A;  4DHY A;  3ATV A;  2A40 A;  4M7X A;  4BQZ A;  2P9U A;  1ATS A;  4BRA A;  3DXK A;  3A5M C;  3L4I A;  3QBX A;  3FZM A;  4FWR A;  1E4F T;  3O4W A;  2QWR A;  2GEL A;  3CQY A;  4NB4 A;  3G25 A;  3O8M A;  4B1V A;  3LM9 A;  1GLB G;  3ZET B;  1KXP A;  3KVG A;  3WXK A;  2Q0R A;  1S22 A;  2WUS A;  3DXK B;  5AQH A;  5AQI A;  4IJN A;  4FOI A;  3LM2 A;  5KPR A;  2NLX A;  3WQU A;  3A5N C;  3C0B A;  4MLH A;  4YDU C;  5AQF A;  4EIA A;  5BR9 A;  4JHD A;  2CH6 A;  3I8B A;  3HSC A;  1R59 O;  3HI0 A;  3LDP A;  5AZI A;  3BEX A;  1GLF O;  1JCF A;  3QML A;  4A62 A;  5JLF A;  2ITM A;  1HLU A;  1GLE G;  4ISE A;  3FLC O;  4QS9 A;  1BU6 O;  4B1Y B;  3QDK A;  4BR7 A;  4BR2 A;  3VGL A;  4BRG A;  3H46 O;  2E2O A;  1JCE A;  5F0X A;  1MWM A;  4B1U B;  1DEJ A;  3EO3 A;  4CZG A;  5BPL A;  3WXL A;  1P8Z A;  4HWI A;  1ATN A;  4IZ9 A;  4FWK A;  2CGJ A;  4MO5 A;  5FPD A;  4BG8 A;  2GEM A;  3C7N B;  2P9K A;  1HPM A;  1HUX A;  3EZW A;  4XH4 A;  3WEE B;  2A42 A;  3QIC A;  3A0I X;  5BRD A;  5AQJ A;  4EFH A;  5AQL A;  4CD3 A;  3ZX3 A;  3QFU A;  2HMP A;  3HBT A;  3SMP A;  2BTF A;  3RSE A;  1G99 A;  2VCP A;  1TUY A;  5AQG A;  4PKI A;  2YI1 A;  3VEO A;  3UE5 A;  3D7E O;  1D4X A;  2E20 A;  5AQZ A;  1HKC A;  5CE3 A;  1LCU A;  3ULE B;  3UKU A;  2P9N B;  1WOQ A;  2PAV A;  4RCH A;  4BRH A;  3R8E A;  4CBW A;  3CJC A;  5JIC A;  3KZB A;  4BRD A;  3F9M A;  3VGK A;  4B1X B;  4FSV A;  2AA4 A;  4CI6 A;  5AZI B;  1NLV A;  2D0P A;  3D2E A;  3CJ9 A;  2ZGY A;  2QW9 A;  2BUP A;  1GLA G;  1TYQ B;  3L6Q A;  2CGK A;  2CH5 A;  5AQS A;  1T6D A;  3KHY A;  1QQN A;  4K43 A;  1NMD A;  4BR9 A;  5F1X A;  3MCP A;  5AQM A;  2F9W A;  3SLC A;  1K8K A;  2YHY A;  2FXU A;  4FWM A;  5ADX A;  4B9Q A;  4Z94 A;  2YHX A;  3MN7 A;  4BRK A;  2Q97 A;  1SAZ A;  3HZ6 A;  1NBW A;  1CZA N;  4H5W A;  3QB0 A;  5AFU A;  5ELZ A;  4PL7 A;  2HF4 A;  3MN9 A;  2FLO A;  3CJ1 A;  4WQ4 A;  3IMX A;  2ASP A;  5AFU H;  4BRQ A;  1QZ6 A;  2IIR A;  4A2B A;  3ZEU B;  4JAX A;  1ZC6 A;  2FSN A;  3FR0 A;  5AQV A;  3MMV A;  2W40 A;  1K8K B;  2YHW A;  3HTV A;  3UKU B;  5JLH A;  4L3Q A;  5AZJ B;  4MLE A;  3HM8 A;  3O08 A;  1LOT B;  5E26 A;  3M3Z A;  1BO5 O;  4M7Y A;  3H6E A;  2ZWH A;  2E1Z A;  4CZI A;  1MWK A;  1KAY A;  3VES A;  1GLL O;  4E1J A;  1YVN A;  1HKB A;  1Z05 A;  2Q36 A;  3CJ7 A;  5AQX A;  2E2N A;  2QWO A;  4H0P A;  4RWT A;  3EKU A;  2CGL A;  3A8Y A;  3JXU A;  4NO7 A;  1IG8 A;  3SMS A;  2ZGZ A;  3LDN A;  5EXW A;  3ZEU A;  5BPM A;  3AAP A;  4CZK A;  3I33 A;  3WEE A;  5AQW A;  2QWQ A;  5AR0 A;  2KHO A;  1YUW A;  3CJA A;  4XH5 A;  3VET A;  4B1W B;  5KQD A;  4PKH A;  1DKG D;  4BRM A;  3LDL A;  4DB3 A;  4CZM A;  1V4T A;  4KBO A;  3RSE B;  3FZF A;  5LY3 A;  2QXL A;  3D2F A;  2QWM A;  1NGF A;  1HX1 A;  3L0Q A;  3BF1 A;  3A5L C;  4BC2 A;  2GTD A;  2P9N A;  3CI5 A;  4BVO A;  1NGE A;  3B8A X;  2QM1 A;  4WYB A;  4BC5 A;  4FWL A;  3VF2 A;  2GWK A;  1Z6R A;  3GOI A;  2FSJ A;  2P9L B;  4BRN A;  2UYT A;  5BN9 A;  3GL1 A;  2A5X A;  1QZ5 A;  3A5O C;  2YJE A;  4AM6 A;  4BRL A;  3WT0 A;  4BGB A;  5AQY A;  3W3D A;  2ASM A;  3CQX A;  1S3X A;  4BR0 A;  2QWL A;  4BC4 A;  2EWS A;  3IDH A;  2IVN A;  3J8A A;  2P9U B;  3GDQ A;  3TPQ A;  1SZ2 A;  3W0L A;  2V52 B;  4CBX A;  3VEY A;  4DCH A;  4BR4 A;  2HF3 A;  4H0X B;  4WQ4 C;  1YAG A;  1Q18 A;  3WXI A;  3GG4 A;  1KAX A;  3P4I A;  2FF6 A;  2Q0U A;  5BRE A;  3JS6 A;  3WUH A;  1X3M A;  2IVP A;  3ZET A;  4CZH A;  2Q31 A;  1XC3 A;  3FFK B;  4FWP A;  3DJC A;  2E88 A;  3QFP A;  4BRF A;  4CZF A;  5KPZ A;  2V7Z A;  1YXQ A;  4IWV A;  3S41 A;  5AQT A;  4BC3 A;  5LJV A;  4A2A A;  3O1W A;  3U4L A;  4CJ7 A;  2P9S B;  5AQO A;  3H3N O;  3U9D A;  2V7Y A;  1TYQ A;  3D2F B;  3FE1 A;  2V51 B;  1NM1 A; 
#chains in the Genus database with same CATH topology
 3D2E B;  2Q2R A;  2X6N A;  3K9K A;  1KQS M;  1LWF A;  3R1X A;  4CBU A;  2QKB A;  4C8O A;  5HL7 L;  3VQE A;  3HOT A;  3EY1 A;  2F7T A;  1NK0 A;  3QEI A;  3DAW A;  3T7Z A;  3LZJ A;  3ZSO A;  4IDK A;  3R6M A;  1Q9X A;  1BIZ A;  4O5B A;  3F2K A;  4A5B A;  3HP9 A;  1JXE A;  4IFE A;  3C95 A;  4KTQ A;  1RTD A;  3CYG A;  4MO4 A;  3VPZ A;  2NRH A;  4X62 K;  3V1R A;  2YNH A;  4AM7 A;  5BN8 A;  2P1J A;  4E0D A;  2XO7 A;  5LL6 Z;  3V6D A;  1IKX A;  4H0Y B;  4I2Q A;  3CET A;  1VSJ A;  2YV0 X;  1ASV A;  3AO4 A;  4RW4 A;  3V4I A;  4KRF A;  1HYS A;  3M5R A;  4FZY A;  1E4G T;  4G9Z A;  5AQP A;  4FK4 A;  2NUB A;  4DSK A;  4J8F A;  3GBT A;  3CC2 N;  1GLJ O;  3DM2 A;  4CK2 A;  1N6Q A;  2YJF A;  3SCX A;  2ITG A;  2B6A A;  4JI2 K;  1RIL A;  4DV2 K;  1TK8 A;  2H3G X;  3KLE A;  1VQK N;  2P9K B;  4IKF A;  5CZ2 A;  4FLU A;  1WSE A;  1HJR A;  5FRO A;  3NCI A;  4CD1 A;  3IAY A;  3DMJ A;  5AQU A;  4FLW A;  5EY4 A;  4CGJ A;  3LZI A;  2P9I B;  2P5G A;  5FPN A;  1NGB A;  3AGK A;  4XEI A;  1NGA A;  2DTU A;  1T6C A;  1SL1 A;  2E2Q A;  3E01 A;  3TTF A;  3CHW A;  3IG1 A;  2D0O A;  4FW2 A;  2E8A A;  1OVY A;  5AQR A;  4CF8 A;  3FZH A;  2HBK A;  3AVG A;  4ISF A;  3LAM A;  1B92 A;  1YHQ N;  2W6L A;  2PYL A;  3M6G A;  1IBL K;  5H1S Q;  4PA1 A;  4FWQ A;  4DLE A;  4BR5 A;  1ATR A;  1KVB A;  3HK2 A;  5IT9 O;  3CJB A;  4DTP A;  1JXB A;  3DOK A;  1QQM A;  4FJ7 A;  1ITG A;  3ENO A;  2F9T A;  4B3M K;  3NH0 A;  1HNI A;  1YVU A;  4O55 A;  2A1R A;  1BOT O;  4DFM A;  3V9U A;  4DLG A;  1YJN N;  3HXM A;  2QEX N;  3LDS A;  4JI0 K;  1Q8I A;  1BIU A;  2RHK A;  1J9A A;  5LJW A;  1Y97 A;  2I7N A;  3T1A A;  3SQ0 A;  1XMO K;  1RGI A;  3ZX2 A;  4ISG A;  4BVP A;  4H03 B;  4W5O A;  1ZBH A;  4C8K A;  2HOE A;  2HW3 A;  5E41 A;  1SKR A;  4CIF A;  3OW2 M;  1RCH A;  2C1G A;  4OLA A;  4M3T A;  3HST B;  3SJH A;  3BP8 A;  4ILJ A;  4WFN L;  5ADX H;  5C2F A;  3VQQ A;  2RF2 A;  1JCG A;  2P9I A;  4FL9 A;  1HKG A;  3UB5 A;  3SV3 A;  4I6M A;  4FJI A;  1RDU A;  3HOS A;  2QA4 N;  1JLA A;  1WNS A;  4DR4 K;  2B5J A;  2OTJ N;  1HMV A;  3P31 A;  4FPA A;  1RFQ A;  3SQ1 A;  3VOV A;  1HR0 K;  2PZS A;  4H0V B;  1Z26 A;  5EX5 A;  2IGI A;  1REV A;  4DV3 K;  2NNW A;  1U4B A;  4B9M A;  1XNQ K;  1ATS A;  4DQP A;  3JYT A;  1YI2 N;  1TGO A;  3DXK A;  3NE6 A;  3QBX A;  2WON A;  4DQS A;  3FZM A;  1TKX A;  1C1A A;  2QWR A;  2GEL A;  1N5Y A;  4KO0 A;  1JLC A;  3K0S A;  4JKF A;  4CF1 A;  3KVG A;  4LFA K;  2O8F A;  4QAG A;  3CCM N;  4Z4F A;  1TV6 A;  3V9W A;  5AQI A;  1C1C A;  1DLO A;  1BIS A;  1IH7 A;  3OYH A;  4MLH A;  5HOO A;  4EIA A;  3DRS A;  4E1M A;  3THW B;  1NJZ A;  3HI0 A;  3CFR A;  4KB1 A;  4QS9 A;  4BR2 A;  4BRG A;  4B1Y B;  3QDK A;  4BR7 A;  2E2O A;  3H46 O;  4CZG A;  4KI6 A;  5T7B A;  2Y1I A;  3O9U A;  1ATN A;  3HJF A;  4JS5 A;  4MO5 A;  5FPD A;  1ASU A;  3TAR A;  1HPM A;  1HUX A;  3A2F A;  2G8V A;  4XH4 A;  1EKE A;  4JV5 K;  2A42 A;  3M8P A;  3A0I X;  3OYJ A;  4Q0B A;  2IS3 A;  4BDZ A;  5HRN A;  1LW2 A;  3ZX3 A;  3SMP A;  3SUN A;  4IG3 A;  3OVN A;  3AA3 A;  4B08 A;  3RSE A;  2VCP A;  2G8W A;  4KTW A;  5AQG A;  3SAH A;  4PKI A;  3VEO A;  2Z1I A;  4LH5 A;  1LWC A;  3E66 A;  1JKH A;  1VQ9 N;  1LAV A;  4CJ4 A;  3NGY A;  2O8C A;  3O9Q A;  4RCH A;  3R8E A;  1X9S A;  3LAN A;  5JIC A;  1YIJ N;  3C6H A;  3F9M A;  4CFB A;  3PIO L;  2YKM A;  2VGN A;  5HRR A;  2HHI A;  4YOU A;  3G4S N;  5CHI A;  3D2E A;  3SAG A;  3PY8 A;  2QW9 A;  4OPA A;  3L6Q A;  2OCE A;  3L2R A;  1QE1 A;  1UWB A;  1K6Y A;  1NMD A;  2ZM6 K;  1A5X A;  4KHQ A;  3PSI A;  4KHW A;  5CYQ A;  1B9D A;  3SLC A;  2YHY A;  5ADX A;  2HVI A;  3HL8 A;  1WAF A;  4HCC A;  4PHT X;  2Q97 A;  1IKW A;  1BHL A;  1VHX A;  5J1E A;  4CJS A;  3TAM A;  1XHX A;  4CHP A;  3RMC A;  1BCO A;  4B8C A;  2FLO A;  2G8I A;  4Q5V A;  4V19 S;  4WQ4 A;  3IMX A;  1RT6 A;  3PIP L;  3SPZ A;  4CJL A;  3CF5 L;  3ZEU B;  2FSN A;  2JWK A;  2BAN A;  5AQV A;  3O4Q A;  4K8Z A;  3CD6 N;  3P1G A;  3THX B;  2YHW A;  2XRI A;  3ZCM A;  1FJG K;  1YT3 A;  5GIO A;  4MLE A;  3HM8 A;  1WAJ A;  4YOR A;  5E26 A;  3C6T A;  1BO5 O;  3NGI A;  3H6E A;  3ZSW A;  3QNN A;  2E1Z A;  4HUF A;  4CZI A;  2BGG A;  3VES A;  3K59 A;  1YVN A;  1Z05 A;  4NCA A;  2HBM A;  4DV7 K;  2QWO A;  4DQR A;  3MEG A;  1IG8 A;  2ZQB A;  1NNE A;  1A5V A;  4ELT A;  4M45 A;  4CHO A;  5HP1 A;  4DU4 A;  4NCG A;  2RE2 A;  3CCV N;  4JRP A;  2G8H A;  1VRT A;  4I2P A;  4B9T A;  3WNG A;  1IO2 A;  1S9G A;  4RW6 A;  3NF8 A;  5AR0 A;  5CYM A;  2O8B A;  2KHO A;  4XH5 A;  2DY4 A;  3VET A;  1Q81 O;  4PKH A;  1DKG D;  4BRM A;  3PX0 A;  1KVC A;  4JKB A;  2QTD A;  3TI0 A;  3D2F A;  3TSP A;  5KGX A;  2Z1G A;  1R0A A;  3LP1 A;  3KK3 A;  3CQ8 A;  2GV9 A;  1S1U A;  3AVI A;  1NG9 A;  4JI5 K;  4BC5 A;  3VF2 A;  4FWL A;  2GWK A;  1NU0 A;  3WNH A;  3GOI A;  3AVA A;  1FKP A;  2QXF A;  4B9S A;  2O8D B;  3G71 N;  3V9X A;  2A5X A;  1QZ5 A;  3DOL A;  2FBT A;  4BAC A;  4BRL A;  2HND A;  3DLE A;  3LP0 A;  1VQ7 N;  1FW6 A;  3CQX A;  5DM6 L;  2QWL A;  3HRG A;  3IDH A;  2F4V K;  3CYM A;  5J2M A;  3TWH A;  3J8A A;  3GDQ A;  4JKC A;  3VEY A;  3CCJ N;  3OYD A;  4H0X B;  4LF9 K;  3TAP A;  3GG4 A;  3VTH A;  4RW9 A;  3P4I A;  5BRE A;  3QIO A;  3WUH A;  1X3M A;  2IVP A;  3ZET A;  4CZH A;  3O9T A;  3FFK B;  3VQC A;  4W5T A;  5AQT A;  5LJV A;  3U4L A;  4CJ7 A;  3QIP A;  5AQO A;  3H3N O;  3U9D A;  3N4P A;  5EOY A;  4CGG A;  4FWO A;  1UA1 A;  3WQT A;  5EU7 A;  4C8M A;  3T1Y K;  3EL2 A;  3CER A;  1HNW K;  3VQB A;  4HCB A;  4WCE L;  1XUP O;  2FBX A;  4CHY A;  2OZS A;  2GWJ A;  4DTX A;  4MDB A;  3ZYY X;  4WQ5 A;  3ITH A;  5KPT A;  3D45 A;  3LP2 A;  3NBP A;  5M1K A;  3PO4 A;  3SQ4 A;  5EVZ A;  3LDO A;  1SQK A;  5F2R A;  5GAH P;  1KFS A;  4FW1 A;  2OTL N;  4E89 A;  4YHH K;  4JKG A;  3QBW A;  2G8F A;  2D0C A;  3FZL A;  4A57 A;  3TU5 A;  4JRQ A;  1IJJ A;  3HVT A;  4EZ9 A;  3GE1 A;  3TAE A;  3ZT4 A;  1OKJ A;  2P9P A;  1BL3 A;  5FPM A;  4BE7 B;  5C15 A;  4JHD B;  4CE9 A;  1XWL A;  4GMJ B;  1UAX A;  1NGI A;  4DR5 K;  1HNX K;  4C23 A;  2VQF K;  5LMU K;  1BG3 A;  1HNZ K;  4DQ8 A;  3VQP A;  2XHB A;  4M63 C;  4RW8 A;  5DMR A;  1W9H A;  3OYG A;  3I56 N;  2KTQ A;  4DQI A;  5C12 A;  4N41 A;  3J7Y P;  3MXI A;  1WBD A;  1C0G A;  1XMQ K;  2VYP A;  3TR8 A;  2DFF A;  4L8R B;  3UIQ A;  3PSF A;  5D3G A;  3EE9 A;  1NWK A;  4Z4C A;  4UQG A;  3VEX A;  4F9O A;  2W42 A;  1GOA A;  1WSH A;  1BWF O;  4E7J A;  2ASO A;  4CJ5 A;  1EQY A;  4A5A A;  3OYN A;  3TSU A;  3VEZ A;  5TKY A;  4K0K K;  4H5R A;  4LFB K;  1KLM A;  3AAR A;  5HRS A;  1C0M A;  4CK3 A;  1MA9 B;  2GUP A;  4FWN A;  4CFC A;  1OH8 A;  4IJA A;  4LH4 A;  1GOC A;  4M3Y A;  2WBN A;  4ID1 A;  4NYF A;  4LF7 K;  2KZZ A;  4DTS A;  4ID5 A;  1KLN A;  4B9L A;  4Z4G A;  3OYF A;  3NH1 A;  1D5A A;  5DM7 L;  2NRR A;  3NGZ A;  1L3V A;  4QS7 A;  4E19 A;  2QWN A;  2ZE2 A;  1TKT A;  3H3O B;  2A6A A;  3ZX0 A;  4GVM A;  4Y0W A;  3DXM B;  3H45 C;  4JI7 K;  4FLZ A;  3E9O A;  2UXC K;  3EKS A;  4AHR A;  3L2V A;  1BUP A;  4H5T A;  4H5N A;  1Z25 A;  3RRG A;  1QHA A;  1WBB A;  1NGG A;  1X9J A;  2D4W A;  2PY5 A;  4YOT A;  4C1N I;  1VSK A;  1GOB A;  4FPB A;  3HT3 A;  3V9S A;  3SBT A;  3RVC A;  5C10 A;  1S6P A;  2IOC A;  3V9Z A;  4OX9 K;  1X1P A;  1EX4 A;  3NVM A;  4KAZ A;  3PUF A;  4IXC A;  5HBM A;  1RTJ A;  3HO1 A;  4Z4H A;  1BDG A;  1VQO N;  4CFD A;  1U2V B;  4JD2 B;  4X64 K;  4DFP A;  4BRC A;  1D8Y A;  4K41 A;  3QIN A;  1ZBF A;  5I9E B;  4AHU A;  2UUA K;  2G8K A;  3VQ5 A;  4LF8 K;  2A40 A;  4BQZ A;  3OYC A;  3KD5 E;  3QLH A;  1W97 L;  3L4I A;  4HVJ A;  1T03 A;  4FWR A;  1E4F T;  3O4W A;  4AH9 A;  1K73 O;  4KH6 A;  3U3Y A;  4B1V A;  4KHS A;  3MCA B;  3LM9 A;  4KRE A;  4FJL A;  2UXB K;  2Q0R A;  1S22 A;  4E3S A;  3DXK B;  1S1T A;  2HST A;  3TTD A;  4YDU C;  1VQ6 N;  4JHD A;  5J2P A;  1RTI A;  2FC0 A;  4DSE A;  2ZJQ L;  4WFA L;  3LDP A;  1JCF A;  3QML A;  4RW7 A;  3T69 A;  5JLF A;  1VSL A;  4ISE A;  2IC3 A;  2OPR A;  1MWM A;  4B1U B;  2F8T A;  1DEJ A;  2KW4 A;  4OJR A;  1P8Z A;  4U7B A;  2GEM A;  2P9K A;  3QIC A;  1QSL A;  4DV0 K;  2HBL A;  5AQJ A;  5AQL A;  2O8B B;  1I94 K;  3ENB A;  1SKW A;  2WC9 A;  1NJI O;  4FJH A;  4CEC A;  3QFU A;  2HMP A;  1RT5 A;  3HBT A;  4WF9 L;  3BGR A;  5BR8 K;  2BTF A;  4CJT A;  4FM0 A;  3CFP A;  4H4O A;  1SUQ A;  1T8E A;  3NF6 A;  3S9H A;  4C8L A;  4CJ3 A;  3M8S A;  3L8B A;  1U48 A;  1QS4 A;  1QHT A;  4E7L A;  5GIP A;  3WXM B;  4HHT A;  4BDP A;  5I3U A;  5GAD P;  2X6S A;  3ULE B;  2P9N B;  3OA9 A;  4C8N A;  3B6O A;  4AF1 A;  3CME N;  3BDP A;  4OPK A;  4ZHR A;  3CCU N;  1RDC A;  4WE1 A;  3DLK A;  3KKS A;  4X65 K;  4FYD A;  1IG9 A;  2ZGY A;  1GLA G;  1TYQ B;  4IOC L;  3ZSV A;  1KRP A;  1T6D A;  1C0U A;  3KHY A;  4K43 A;  1ZBI A;  5CZ1 A;  4DUZ K;  5KI6 A;  4BR9 A;  1XHZ A;  3MCP A;  3K5M A;  4CJK A;  4PQU A;  5AQM A;  2W00 A;  4O0I A;  3L2U A;  1S1W A;  2FXU A;  4FWM A;  4OGC A;  4B9Q A;  2YHX A;  3MN7 A;  4CJV A;  2D0A A;  4CGI A;  4IDH A;  4DFJ A;  1SAZ A;  3SJJ A;  3HZ6 A;  1NBW A;  3JSM A;  5ELZ A;  4PL7 A;  3NAE A;  4HUE A;  3MN9 A;  2YX6 A;  1QZ6 A;  3CFO A;  3J80 O;  3OJU A;  3NFA A;  1KC8 O;  2HHU A;  4JAX A;  1KFD A;  3K58 A;  5JVG L;  4DUY K;  3MMV A;  2W40 A;  1S5J A;  1K8K B;  3UKU B;  3KLG A;  4DKW A;  3F5T A;  1CLQ A;  1HYV A;  1NKC A;  1QTM A;  4KH4 A;  3SUQ A;  1BCM A;  3EE8 A;  3M3Z A;  4DS5 A;  4M7Y A;  1SS6 A;  2ZWH A;  1KAY A;  1JLF A;  4ILG B;  4CEE A;  1GLL O;  1KSP A;  2HB5 A;  4RWT A;  4LSL A;  3V1O A;  3JXU A;  4FLY A;  4NO7 A;  4LF6 K;  5HRP A;  5BPM A;  1QSY A;  3AAP A;  4CZK A;  4CCH A;  3I33 A;  3WEE A;  3EYZ A;  2OYQ A;  1YUW A;  3CJA A;  1EWR A;  3M8Q A;  4B1W B;  5KQD A;  4YOX A;  3VMF B;  4KBO A;  3VQ9 A;  5LY3 A;  4DR3 K;  1HX1 A;  1RTH A;  3L0Q A;  1D9D A;  5J2N A;  3A5L C;  2P9N A;  1M90 O;  1NGE A;  3IRX A;  4JKA A;  2HMI A;  2YNF A;  1CZB A;  4PY5 A;  4DQQ A;  3RR8 A;  1RBR A;  3I55 N;  2P9L B;  4PUO A;  5SWM A;  4KFB A;  4DF8 A;  4H8K A;  3AV9 A;  1Q86 O;  3GL1 A;  2YJE A;  3D0P A;  4MQ3 A;  4JS4 A;  3WT0 A;  3W3D A;  1YJW N;  2G8U A;  1N33 K;  2ASM A;  1XC9 A;  4CVN E;  4BR0 A;  3DRR A;  3NF9 A;  1KCF A;  3L2W A;  2DFH A;  1RDA A;  2BH1 A;  2V52 B;  1NK6 A;  4FXD A;  4BR4 A;  1Q18 A;  4JLH A;  4JKH A;  3PV8 A;  1QSS A;  4GKJ K;  1K9M O;  2Q0U A;  4W5N A;  3TAG A;  2HHT A;  3CCL N;  4CFA A;  4DR2 K;  2Q31 A;  4BRF A;  1XC3 A;  4FWP A;  3MX2 A;  2E88 A;  3AVN A;  3QFP A;  5KPZ A;  3S41 A;  3O1W A;  4FJ5 A;  2DFE A;  2V7Y A;  4FM1 A;  1A5W A;  1TK5 A;  3QER A;  1L5U A;  1NGH A;  2E1Y A;  4JYA K;  4I6M B;  4FWS A;  3TAF A;  1XQS C;  4IFY A;  3HPO A;  1TAU A;  1N34 K;  4OGE A;  3T19 A;  4CZE A;  4B9V A;  1JL1 A;  4O8U A;  1U45 A;  3U8X A;  3SQ2 A;  3ISN C;  2NRW A;  3DXM A;  4LC9 B;  1Y64 A;  4BE1 A;  1RDB A;  3SI6 A;  4DSL A;  1U04 A;  4FLV A;  2IVO A;  1WSI A;  4K25 A;  5C2D A;  3MDQ A;  3FFI A;  3MN5 A;  1WLJ A;  3AVB A;  4TSX A;  3LL3 A;  4H0T B;  4EAH D;  2A1S A;  3C65 A;  3KKR A;  1YF5 L;  4FO0 A;  3S3O A;  1C0F A;  1U2V A;  4GY2 B;  4FVM A;  4KV8 A;  1K8A O;  3HP6 A;  4JI1 K;  4QCL A;  4CJW A;  2D5R A;  3Q7C A;  3RWU A;  4IOX A;  4GNI A;  1RBV A;  2A41 A;  2KQ2 A;  4X66 K;  3QET A;  5M1O A;  2FBY A;  4JN4 A;  4BQL A;  3HPG A;  3QEP A;  4DWI A;  4BRP A;  4FJN A;  4AHC A;  3M8R A;  1J54 A;  4YOY A;  4FJJ A;  1TUU A;  3VTI A;  3LWL A;  4E7K A;  3QEW A;  3TAQ A;  1TAQ A;  4H0O A;  4DU1 A;  3NVK A;  5C42 A;  4HTL A;  3E9L A;  4YFU A;  2E2P A;  4YOV A;  3H1Q A;  1N36 K;  2YCH A;  1GLC G;  2B4J A;  2O4G A;  3P83 D;  4JK8 A;  4DG1 A;  5FPE A;  3TSQ A;  3LP3 A;  4GKK K;  4DTM A;  1N8R O;  1M1K O;  2VWK A;  5B8H A;  4B3O A;  4GV9 A;  4H5V A;  3SK3 A;  4K42 A;  2W41 A;  2P9S A;  1HJO A;  2Q1N A;  2XY8 A;  4FLX A;  3VF4 A;  3ZT0 A;  5JEN A;  4BRI A;  4YY3 K;  5CR4 A;  3R9P A;  4B9N A;  3CCE N;  1S1X A;  3VF6 A;  4OO1 J;  2J4R A;  3D6R A;  2FBV A;  3O3F A;  4E7I A;  4FJK A;  4JNE A;  3VQ7 A;  1N32 K;  5BRF A;  4PKG A;  3OBY A;  1NGD A;  4CW7 B;  3SAF A;  4EHT A;  3VQ6 A;  3U9Z A;  3OY9 A;  3UKR A;  3OHR A;  1BI4 B;  4BWJ A;  1W0H A;  1VSF A;  3OS2 A;  3CCR N;  4F3T A;  3CIP A;  2P9P B;  3J7A P;  4CER A;  1VSH A;  4FCY A;  2NRV A;  4IBN A;  4M3Z A;  3UKR B;  1G15 A;  2Q3S A;  3H1V X;  4O8K A;  1BI4 A;  5C24 A;  2YNI A;  4CZL A;  4CEA A;  3O9R A;  1HNV A;  4F8R A;  2I7P A;  1T44 A;  2QKK A;  3V81 A;  5JS2 A;  1BA0 A;  4CEO A;  3J81 O;  3DWL A;  4KI4 A;  4DMN A;  4BWM A;  3VEN A;  4KB0 A;  2X74 A;  4BRE A;  3MEC A;  3HYF A;  5JMV A;  3CCQ N;  4JI8 K;  3CG7 A;  1IBK K;  3C6U A;  1Q82 O;  1NGJ A;  4OLB A;  5K14 A;  1QQO A;  3WXJ A;  3MAQ A;  1VSM A;  3EN9 A;  1NK4 A;  3KTQ A;  5BRH A;  5TKW A;  2O8F B;  2JLE A;  2Z1J A;  3O5B A;  3O9S A;  4CF9 A;  4F4K A;  2GX9 A;  5A2Q O;  4GW6 A;  4M7X A;  1EP4 A;  4BRA A;  1DTT A;  2HNY A;  3R3L A;  1KD1 O;  3S5T A;  3AA5 X;  4NB4 A;  3G25 A;  3HPH A;  4ELV A;  3DI6 A;  1GLB G;  3LAK A;  1I3A A;  2PFU A;  3ZET B;  2R7Y A;  4ILH A;  3WXK A;  4KPY A;  2HHW A;  3P38 A;  5J2Q A;  5DK5 A;  4IJN A;  1W7A A;  4DSF A;  3LM2 A;  5KPR A;  2ETJ A;  3ZSX A;  2NLX A;  1VK0 A;  4W5Q A;  3C0B A;  4FZZ A;  5AQF A;  3DLL L;  1TKZ A;  3DLH A;  3U3G A;  1OVQ A;  4DS4 A;  1QVF M;  4CJU A;  3MWT A;  4DTR A;  3I0R A;  5AZI A;  3DYA A;  3L3V A;  1E3M A;  3G6E N;  2O8E B;  1WSJ A;  3AO3 A;  3AO5 A;  3SNN A;  1DT9 A;  1HLU A;  3DLR A;  3FLC O;  1BU6 O;  3VGL A;  4ZTJ A;  2YHA A;  4DR6 K;  3EO3 A;  5BPL A;  3K2P A;  3WXL A;  3ULD A;  4M3X A;  4IZ9 A;  4I9Q A;  3V1Q A;  2CGJ A;  3OBW A;  3EZW A;  3OYL A;  4R5P A;  5BRD A;  4CJE A;  4DR7 K;  1RT2 A;  2ZJP L;  1JLB A;  1CXU A;  2XY7 A;  1TUY A;  1NKE A;  4QOZ B;  1EXQ A;  3UE5 A;  3D7E O;  4CJF A;  4ELU A;  2E20 A;  5AQZ A;  2XY6 A;  1HKC A;  1VQ4 N;  2ZJR L;  1WOQ A;  3RMB A;  1C6V A;  1O13 A;  3THW A;  1RT7 A;  3VGK A;  1RT3 A;  2HHV A;  2AA4 A;  4CIE A;  1YTA A;  5AZI B;  1J5E K;  1EET A;  4NXN K;  2BUP A;  2CH5 A;  5AQS A;  4IOA L;  4CHZ A;  5GAE P;  1TK0 A;  3MXJ A;  2F8S A;  4FJ8 A;  3P5J A;  2BDP A;  4B3S K;  3E9P A;  2QI2 A;  4MDA A;  2F9W A;  3QEX A;  1KVA A;  1FKO A;  4G1Q A;  2VWJ A;  2NRZ A;  4EZ6 A;  4YNQ A;  4KH5 A;  1YJ9 N;  3T3F A;  4JI6 K;  2ZD1 A;  4H4M A;  2YHB A;  2D0B A;  1CZA N;  3KWG A;  3QB0 A;  1VQP N;  1J53 A;  3KK7 A;  2HF4 A;  1VSE A;  5GAG P;  1KTQ A;  4N47 A;  1NOZ A;  4C1N K;  3KK2 A;  5JVH L;  4DV5 K;  4XJX A;  4LF4 K;  1RBU A;  2ASP A;  5AFU H;  2IIR A;  4GVE A;  4A2B A;  5MLC Q;  1ZC6 A;  3FR0 A;  4WFB L;  1ZBL A;  3HTV A;  5AZJ B;  3K5N A;  1SV5 A;  1VQL N;  1NMN A;  3OYE A;  1FXX A;  2I5J A;  4YOW A;  1MWK A;  1IKV A;  3SUP A;  3RMA A;  4LSN A;  4E1J A;  1HKB A;  3CJ7 A;  1QQC A;  5M1P A;  3ASM A;  1RBT A;  3EKU A;  2CGL A;  3SMS A;  5HRO A;  3LDN A;  5EXW A;  3ZEU A;  1BQM A;  3ZLJ A;  1HPZ A;  2QWQ A;  1NK8 A;  5FRM A;  1HQE A;  2KLA A;  4DB3 A;  3LDL A;  3QEV A;  4CZM A;  1V4T A;  3RSE B;  1X9M A;  4OKK A;  3SV4 A;  3FZF A;  2W6K A;  2QXL A;  1NGF A;  3O3H A;  3HVR A;  4BC2 A;  2GTD A;  4O4G A;  3SZ2 A;  3B8A X;  4WYB A;  5M1Q A;  1L3S A;  1Z6R A;  1B9F A;  5M1F A;  3MWP A;  3DRP A;  1JLQ A;  2P51 A;  4DR1 K;  1VSD A;  3ID6 A;  3TAN A;  1W2B M;  2IDO A;  4FJ9 A;  3SBG A;  4CEF A;  4M3U A;  4GV6 A;  4CES A;  5KRT A;  1HQU A;  1OH5 A;  4RG8 A;  5LMN K;  1TL1 A;  4FM2 A;  1SZ2 A;  1S1V A;  4CBX A;  4DCH A;  2X78 A;  2HF3 A;  3ZT2 A;  2YNG A;  1YAG A;  3WXI A;  1VQ8 N;  1KAX A;  3PX6 A;  3NF7 A;  4OVL A;  4AIL C;  1NJW A;  2UUB K;  1YXQ A;  4IWV A;  2UXD K;  5JS1 A;  3OS0 A;  4KHY A;  4JI4 K;  3NMU A;  1TYQ A;  3D2F B;  3FE1 A;  3VER A;  3WNF A;  1RNH A;  1DGK N;  4FK2 A;  1WUA A;  3BZC A;  1L3T A;  3MEE A;  4BEC A;  5AQN A;  3ZSY A;  3AAQ A;  3FGU A;  1RT1 A;  2O8D A;  1WN7 A;  1D9F A;  3KWI A;  3S3M A;  1XI1 A;  1IBM K;  4EP4 A;  4FJM A;  4N5S A;  4JEP A;  4HTU A;  3ULE A;  4F2S A;  2LSN A;  2GUI A;  3QO9 A;  4I7F A;  4CZJ A;  3VQD A;  4JKD A;  4CEB A;  3IFR A;  2FF3 B;  4N56 A;  3PO5 A;  3LPT A;  4KHN A;  2RKI A;  3O4N A;  1BA1 A;  1Q7Y O;  2QWP A;  1LW0 A;  2RPI A;  4CED A;  2NZT A;  4B1Z A;  1KAZ A;  3ID8 A;  5KTQ A;  1WSF A;  3BUZ B;  3QNO A;  2FSK A;  3BF3 A;  2AP1 A;  1CZ9 A;  1LV5 A;  2E5L K;  4NYN A;  2O4I A;  3NDK A;  1ZYQ A;  2KFZ A;  4MFB A;  4NLC A;  3EEQ A;  1C1B A;  1U6Z A;  3CPE A;  5C25 A;  4U67 L;  2GBZ A;  3LWM A;  5I42 A;  3S3N A;  1SL0 A;  2ATQ A;  5IWA K;  3AVL A;  3G10 A;  3VGM A;  4FOE A;  4KTZ A;  4AHT A;  3KLF A;  1I39 A;  4PL8 A;  3AA2 A;  3ZSZ A;  1VSI A;  3K9J A;  1SL2 A;  4DTJ A;  4QS8 A;  5AZJ A;  1VQ5 N;  3BZK A;  3ZT1 A;  4JD2 A;  3CPW M;  4OPH A;  3M1F A;  4DTN A;  2WOM A;  3KK1 A;  3DLB A;  4N76 A;  2UU9 K;  1P90 A;  1H1V A;  4EP5 A;  4JI3 K;  5AQQ A;  2E6L A;  2A3Z A;  4Y1C A;  3OYK A;  3K5L A;  3CMA N;  3RR7 A;  2O8E A;  3MN6 A;  3LAL A;  1WSG A;  1U49 A;  1SKS A;  3AY9 A;  3ZT3 A;  4BRO A;  2OAN A;  5HLF A;  1VQN N;  2VWB A;  4Z4E A;  1RBS A;  3AGR A;  2E6M A;  2HHQ A;  4CHQ A;  3P39 A;  2D1K A;  3MK6 A;  1QVG M;  1NGC A;  2ZF5 O;  5BPN A;  1T05 A;  2VG6 A;  3AVC A;  3OYI A;  1V4S A;  4Z4I A;  3E1Y A;  3PX4 A;  1ESV A;  3IUC A;  4OKJ A;  4EHU A;  2OPP A;  3O6W A;  4B8A B;  4DF4 A;  1O1W A;  4E1N A;  4E7H A;  1X3N A;  1DTQ A;  3EZ5 A;  5AQK A;  3U6F A;  3Q7B A;  3AA4 A;  3AVH A;  2P9L A;  3CC4 N;  4IO8 A;  3CCS N;  3KLH A;  4XH1 A;  3B6P A;  4K8X A;  4PWD A;  4BG9 A;  3RRH A;  3C7N A;  5E84 A;  3O1B A;  2DPN A;  3ENH A;  1J6Z A;  3G0Z A;  3THY A;  1NKB A;  1GLD G;  4A61 A;  3VQA A;  2YKN A;  3MED A;  4BE0 A;  1ZXO A;  3CC7 N;  4I9L A;  5KGW A;  2HNZ A;  1JLG A;  4Z0U A;  2EHG A;  4NXM K;  4BGA A;  2QK9 A;  4KKO A;  4O0J A;  3AVJ A;  4WQ5 C;  1T3V A;  1RDW X;  5M1N A;  4RTF D;  3FZK A;  3VA3 A;  4FJX A;  2JGU A;  4JKE A;  3KJV A;  3I8D A;  3NH2 A;  5GIN A;  1S9E A;  4AHS A;  5FLX O;  2UUC K;  2PBD A;  2VG5 A;  1MDU B;  3LDQ A;  1ZBS A;  4O5F A;  4IFV A;  3ATU A;  3VEW A;  1JJ2 M;  3VQ8 A;  3VEV A;  4BY9 C;  5FRN A;  3MX5 A;  3O80 A;  5KRS A;  3SUO A;  5KQ8 A;  1Q9Y A;  1BQN A;  4YDU A;  1HRH A;  3IS9 A;  4DHY A;  3ATV A;  1NJX A;  3SPY A;  3WNE A;  2P9U A;  5AJ3 K;  3ALY A;  3A5M C;  3HM9 A;  1TVR A;  4NCB A;  4OKE A;  3CQY A;  4F3O A;  3O8M A;  2VQE K;  4J2B A;  3OYB A;  1NK7 A;  1KXP A;  4JK9 A;  3F73 A;  3KLI A;  2WUS A;  3RMD A;  5AQH A;  4CGH A;  4FK0 A;  4FOI A;  4FVU A;  2OA8 A;  1TKD A;  2BE2 A;  1T7P A;  3WQU A;  4CJR A;  1FK9 A;  3A5N C;  5BR9 A;  4BE2 A;  4DU3 A;  2CH6 A;  3BY5 A;  4IEE A;  3I8B A;  4IG0 A;  4BDY A;  3HSC A;  1R59 O;  2F96 A;  2KKZ A;  3BEX A;  1GLF O;  1ASW A;  4A59 A;  2WFB A;  4A62 A;  1UA0 A;  3H08 A;  2ITM A;  1GLE G;  4Y1D A;  4DFK A;  4FLT A;  3QES A;  4LF5 K;  3TTC A;  3J7Z O;  5F0X A;  1JCE A;  3OTO K;  2AJQ A;  1IV0 A;  3OJS A;  4HWI A;  4DV4 K;  4DTU A;  4FWK A;  4BG8 A;  3C7N B;  4CF0 A;  3CM5 A;  1VAZ A;  4B3T K;  3WEE B;  4JKG B;  3AO1 A;  4EFH A;  4CD3 A;  3IKM A;  1U47 A;  2NRT A;  2HHX A;  3PLA A;  4DV1 K;  4DSI A;  1ILY A;  1G99 A;  4CK1 A;  1OH7 A;  4KHP K;  3JAM O;  3OYM A;  2YI1 A;  2JWL A;  1D4X A;  4M3W A;  2Z1H A;  5CE3 A;  4CJP A;  2KZM A;  1LCU A;  4HUG A;  4CHN A;  3UKU A;  2PAV A;  1CXQ A;  4BRH A;  4CBW A;  3CJC A;  2HHH K;  3KZB A;  4M3R A;  4BRD A;  3K57 A;  1RDD A;  4B1X B;  3ZSQ A;  4M41 A;  4AQY K;  4FSV A;  3L3U A;  1RT4 A;  3C94 A;  4CI6 A;  1LAW A;  1NLV A;  4LY7 A;  4W5R A;  3CXC M;  1X9W A;  3OYA A;  3MXM A;  2D0P A;  3CJ9 A;  4CF2 A;  2CGK A;  1QQN A;  4DTO A;  2HHS A;  4IEI A;  5F1X A;  1YTU A;  2WTU A;  1K8K A;  3T1H K;  3VA0 A;  4Z94 A;  2HVH A;  4J2E A;  2XY5 A;  4AHV A;  4BRK A;  1HYZ A;  3SYZ A;  2OZM A;  4H5W A;  3DLG A;  3VQ4 A;  5AFU A;  2RN2 A;  4KHU A;  4OPJ A;  1NK5 A;  3CJ1 A;  2OPQ A;  4R79 A;  4BRQ A;  3AVK A;  1NJY A;  2C1I A;  4O44 A;  4F2R A;  2E4L A;  1EWQ A;  2NRX A;  1L3U A;  4IO9 L;  4DSJ A;  5JLH A;  1J5O A;  4L3Q A;  4CEZ A;  3KIO A;  2VGM A;  3O08 A;  1LOT B;  4CIG A;  3O3G A;  4FZX C;  2VG7 A;  4GV3 A;  2Q36 A;  5AQX A;  2E2N A;  4XIU A;  1TL3 A;  4H0P A;  1LWE A;  3A8Y A;  4B3R K;  3F9K A;  2ZGZ A;  4CGF A;  1NOY A;  2IAJ A;  3AVM A;  5AQW A;  3THX A;  3THY B;  4ICL A;  2PYJ A;  1ZBU A;  5SZT A;  1EO1 A;  1S72 N;  3AVF A;  3VN5 A;  4BEB A;  2QWM A;  1S6Q A;  4CEQ A;  3ZSR A;  3BF1 A;  3OS1 A;  3CI5 A;  4BVO A;  4CGD A;  2QM1 A;  3L2Q A;  4LFC K;  5FDL A;  1BGX T;  3AO2 A;  2KFN A;  2FSJ A;  3L4Q A;  3CM6 A;  4BRN A;  3RTV A;  1VRU A;  2UYT A;  5BN9 A;  3TAB A;  1UOC A;  3A5O C;  2Y1J A;  1JLE A;  4AM6 A;  4B9U A;  4JK7 A;  4BGB A;  5AQY A;  3THV A;  4NLB A;  4DV6 K;  3I0S A;  1S3X A;  3C6A A;  5CY4 A;  5C0Y A;  4BC4 A;  2EWS A;  2IVN A;  3KD1 E;  2P5O A;  2P9U B;  3TPQ A;  4M42 A;  4J2A A;  3N4Q A;  2HBJ A;  3W0L A;  4ZTF A;  4WQ4 C;  3K5O A;  1F21 A;  2FF6 A;  4LD0 A;  1JL2 A;  2EX3 A;  1NK9 A;  1IKY A;  3JS6 A;  2O8C B;  4E72 A;  3NHG A;  1VQM N;  1C0T A;  4FJG A;  3DJC A;  4CZF A;  2OPS A;  1XNR K;  2V7Z A;  4BC3 A;  1YIT N;  1WB9 A;  4A2A A;  4CJQ A;  4UY8 O;  3LPU A;  4J2D A;  2P9S B;  1OH6 A;  1MU2 A;  2V51 B;  1NM1 A; 
#chains in the Genus database with same CATH homology
 3N4P A;  5EOY A;  1DGK N;  3D2E B;  2Q2R A;  3K9K A;  1KQS M;  1NGH A;  2E1Y A;  4I6M B;  4FWS A;  1WUA A;  4FWO A;  1XQS C;  3R1X A;  4BEC A;  5AQN A;  3WQT A;  4CBU A;  3AAQ A;  3FGU A;  4CZE A;  5HL7 L;  4O8U A;  3HOT A;  3KWI A;  2F7T A;  3U8X A;  3DAW A;  2NRW A;  3DXM A;  3EL2 A;  4LC9 B;  3CER A;  1Y64 A;  4JEP A;  3ULE A;  3T7Z A;  4WCE L;  1XUP O;  3R6M A;  4CZJ A;  2IVO A;  4JKD A;  3IFR A;  2FF3 B;  4K25 A;  3F2K A;  4A5B A;  5C2D A;  2GWJ A;  3MDQ A;  3MN5 A;  3LL3 A;  4H0T B;  4IFE A;  4EAH D;  3C65 A;  4MDB A;  4WQ5 A;  3ZYY X;  5KPT A;  1YF5 L;  1BA1 A;  4MO4 A;  5M1K A;  4FO0 A;  5EVZ A;  1C0F A;  2QWP A;  3VER A;  1Q7Y O;  3LDO A;  1SQK A;  2NZT A;  2NRH A;  5F2R A;  3VPZ A;  1KAZ A;  4B1Z A;  3ID8 A;  5GAH P;  1U2V A;  2OTL N;  4AM7 A;  5BN8 A;  4JKG A;  4GY2 B;  3BUZ B;  3QBW A;  2FSK A;  3BF3 A;  2AP1 A;  3FZL A;  4H0Y B;  4A57 A;  3TU5 A;  1IJJ A;  3CET A;  3GE1 A;  1K8A O;  1OKJ A;  2P9P A;  5FPM A;  4BE7 B;  5C15 A;  4JHD B;  3Q7C A;  4IOX A;  1NGI A;  4GNI A;  4NLC A;  3M5R A;  4C23 A;  1U6Z A;  3CPE A;  2A41 A;  1E4G T;  4U67 L;  1BG3 A;  5M1O A;  4G9Z A;  4JN4 A;  5AQP A;  4BQL A;  3VGM A;  4J8F A;  4FOE A;  4DQ8 A;  4PL8 A;  3GBT A;  4BRP A;  3CC2 N;  1GLJ O;  4YOY A;  1TUU A;  3VTI A;  3K9J A;  4M63 C;  4H0O A;  4QS8 A;  3I56 N;  5AZJ A;  1VQ5 N;  3NVK A;  2YJF A;  4HTL A;  3E9L A;  2E2P A;  2H3G X;  4YOV A;  3H1Q A;  1VQK N;  2P9K B;  4JD2 A;  3CPW M;  4OPH A;  5C12 A;  2YCH A;  3M1F A;  1GLC G;  4CD1 A;  5AQU A;  5EY4 A;  1P90 A;  4JK8 A;  1H1V A;  2P9I B;  5FPE A;  1C0G A;  3TSQ A;  2VYP A;  5FPN A;  1NGB A;  3AGK A;  4XEI A;  1NGA A;  5AQQ A;  1N8R O;  1M1K O;  3EE9 A;  5B8H A;  2A3Z A;  1T6C A;  1NWK A;  4GV9 A;  3CMA N;  2E2Q A;  3MN6 A;  3VEX A;  3TTF A;  4H5V A;  3CHW A;  3SK3 A;  4F9O A;  2D0O A;  1BWF O;  3AY9 A;  4K42 A;  2W41 A;  2E8A A;  4BRO A;  2ASO A;  1OVY A;  2OAN A;  5AQR A;  1EQY A;  2P9S A;  1HJO A;  1VQN N;  2VWB A;  2Q1N A;  4A5A A;  3FZH A;  2HBK A;  3AGR A;  3TSU A;  4ISF A;  5TKY A;  3VEZ A;  4H5R A;  3VF4 A;  4BRI A;  3AAR A;  5CR4 A;  3P39 A;  1YHQ N;  2D1K A;  3M6G A;  3MK6 A;  3R9P A;  1QVG M;  1NGC A;  2ZF5 O;  5BPN A;  3CCE N;  3VF6 A;  5H1S Q;  1V4S A;  4FWQ A;  3E1Y A;  4OO1 J;  1ESV A;  3IUC A;  2J4R A;  3D6R A;  4EHU A;  4BR5 A;  3O6W A;  1MA9 B;  2GUP A;  1ATR A;  4JNE A;  3CJB A;  4FWN A;  1QQM A;  4IJA A;  1X3N A;  2WBN A;  5AQK A;  3ENO A;  2F9T A;  5BRF A;  4PKG A;  3OBY A;  1NGD A;  3SAF A;  3Q7B A;  4EHT A;  1BOT O;  2P9L A;  3U9Z A;  3UKR A;  3CC4 N;  1YJN N;  2QEX N;  4IO8 A;  3OHR A;  5DM7 L;  2NRR A;  3CCS N;  2RHK A;  5LJW A;  4XH1 A;  4QS7 A;  3CCR N;  2QWN A;  2I7N A;  4BG9 A;  3CIP A;  2P9P B;  3H3O B;  3C7N A;  1RGI A;  2NRV A;  3O1B A;  2DPN A;  2A6A A;  5E84 A;  4ISG A;  3ENH A;  1J6Z A;  4H03 B;  3ZX0 A;  3ZX2 A;  1GLD G;  3UKR B;  4BVP A;  4A61 A;  4Y0W A;  3DXM B;  3H45 C;  3H1V X;  2HOE A;  4O8K A;  1ZXO A;  3OW2 M;  3CC7 N;  2C1G A;  4CZL A;  3E9O A;  3O9R A;  3EKS A;  2I7P A;  4BGA A;  1BUP A;  1T44 A;  4H5T A;  4H5N A;  1QHA A;  4WQ5 C;  1T3V A;  3SJH A;  1RDW X;  1NGG A;  1X9J A;  2D4W A;  1BA0 A;  4RTF D;  5M1N A;  4YOT A;  3DWL A;  4C1N I;  3BP8 A;  4ILJ A;  4WFN L;  4FPB A;  3VEN A;  3FZK A;  5ADX H;  3SBT A;  3RVC A;  5C2F A;  5C10 A;  4JKE A;  4BRE A;  3CCQ N;  3NVM A;  5JMV A;  5GIN A;  1JCG A;  4IXC A;  2PBD A;  2P9I A;  1Q82 O;  1MDU B;  1NGJ A;  3LDQ A;  4FL9 A;  1BDG A;  1HKG A;  1ZBS A;  3UB5 A;  1VQO N;  4O5F A;  1QQO A;  3ATU A;  3VEW A;  3WXJ A;  1JJ2 M;  1U2V B;  4I6M A;  4JD2 B;  3EN9 A;  1RDU A;  3MX5 A;  3O80 A;  3VEV A;  5BRH A;  3HOS A;  2QA4 N;  4BY9 C;  5TKW A;  4BRC A;  2OTJ N;  4K41 A;  3O5B A;  3O9S A;  5KQ8 A;  3P31 A;  4FPA A;  5I9E B;  1RFQ A;  4YDU A;  3VOV A;  4H0V B;  5EX5 A;  2GX9 A;  4DHY A;  2NNW A;  3ATV A;  2A40 A;  4M7X A;  4BQZ A;  2P9U A;  1ATS A;  4BRA A;  1YI2 N;  3R3L A;  3DXK A;  3A5M C;  1W97 L;  3L4I A;  3QBX A;  1KD1 O;  3FZM A;  4FWR A;  1E4F T;  3O4W A;  1K73 O;  2QWR A;  2GEL A;  4KH6 A;  3CQY A;  4NB4 A;  3G25 A;  3O8M A;  4B1V A;  3MCA B;  3LM9 A;  1GLB G;  4JKF A;  2PFU A;  3ZET B;  1KXP A;  4JK9 A;  3KVG A;  4ILH A;  3WXK A;  2Q0R A;  1S22 A;  3CCM N;  2WUS A;  3DXK B;  3P38 A;  5AQH A;  5AQI A;  4IJN A;  2HST A;  4FOI A;  3LM2 A;  4FVU A;  5KPR A;  2NLX A;  3TTD A;  3WQU A;  3A5N C;  3C0B A;  4MLH A;  4YDU C;  5AQF A;  4EIA A;  5BR9 A;  5HOO A;  3DLL L;  1VQ6 N;  4JHD A;  1QVF M;  2CH6 A;  4IEE A;  3MWT A;  3I8B A;  2ZJQ L;  4WFA L;  3HSC A;  1R59 O;  3HI0 A;  3LDP A;  2KKZ A;  5AZI A;  3BEX A;  1GLF O;  4A59 A;  2WFB A;  3G6E N;  1JCF A;  3QML A;  3T69 A;  4A62 A;  5JLF A;  2ITM A;  1DT9 A;  1GLE G;  1HLU A;  4ISE A;  3FLC O;  4QS9 A;  1BU6 O;  4B1Y B;  3QDK A;  4BR7 A;  4BR2 A;  3VGL A;  4BRG A;  3TTC A;  2E2O A;  3H46 O;  1JCE A;  5F0X A;  3J7Z O;  1MWM A;  4B1U B;  1DEJ A;  3EO3 A;  4CZG A;  5BPL A;  3WXL A;  1P8Z A;  3O9U A;  4HWI A;  1ATN A;  4IZ9 A;  4FWK A;  2CGJ A;  4MO5 A;  5FPD A;  4BG8 A;  2GEM A;  3C7N B;  4U7B A;  3OBW A;  2P9K A;  1HPM A;  1HUX A;  1VAZ A;  3EZW A;  4XH4 A;  3WEE B;  4JKG B;  2A42 A;  3QIC A;  3A0I X;  5BRD A;  2HBL A;  5AQJ A;  4EFH A;  5AQL A;  3IKM A;  4CD3 A;  3ENB A;  1NJI O;  2WC9 A;  3ZX3 A;  2NRT A;  2ZJP L;  3PLA A;  3QFU A;  2HMP A;  3HBT A;  4WF9 L;  3SMP A;  1ILY A;  2BTF A;  3RSE A;  1G99 A;  2VCP A;  1TUY A;  5AQG A;  3SAH A;  4PKI A;  2JWL A;  2YI1 A;  3VEO A;  3UE5 A;  3D7E O;  1D4X A;  5GIP A;  2E20 A;  5AQZ A;  3WXM B;  3E66 A;  1HKC A;  5CE3 A;  1VQ4 N;  1VQ9 N;  1LCU A;  5GAD P;  3ULE B;  3UKU A;  2P9N B;  3OA9 A;  2ZJR L;  1WOQ A;  2PAV A;  3O9Q A;  4RCH A;  4BRH A;  3R8E A;  4AF1 A;  4CBW A;  3CME N;  3CJC A;  5JIC A;  3KZB A;  1O13 A;  4BRD A;  1YIJ N;  3C6H A;  3F9M A;  3VGK A;  3CCU N;  4B1X B;  4FSV A;  3PIO L;  2AA4 A;  4CI6 A;  2VGN A;  5AZI B;  1NLV A;  3CXC M;  4YOU A;  3G4S N;  5CHI A;  2D0P A;  3D2E A;  3SAG A;  3CJ9 A;  2ZGY A;  2QW9 A;  2BUP A;  4OPA A;  1GLA G;  1TYQ B;  3L6Q A;  2CGK A;  2CH5 A;  4IOC L;  5AQS A;  4IOA L;  1T6D A;  3KHY A;  1QQN A;  5GAE P;  4K43 A;  1NMD A;  4IEI A;  4BR9 A;  5F1X A;  3MCP A;  3E9P A;  5AQM A;  2W00 A;  2QI2 A;  4MDA A;  2F9W A;  3SLC A;  1K8K A;  2YHY A;  2FXU A;  4FWM A;  5ADX A;  4B9Q A;  4Z94 A;  2NRZ A;  2YHX A;  3MN7 A;  4KH5 A;  1YJ9 N;  4BRK A;  4PHT X;  2Q97 A;  4IDH A;  1SAZ A;  3HZ6 A;  1NBW A;  1CZA N;  3KWG A;  4H5W A;  3QB0 A;  5AFU A;  1VQP N;  3KK7 A;  5ELZ A;  4PL7 A;  2HF4 A;  5GAG P;  3MN9 A;  2FLO A;  4C1N K;  5JVH L;  4XJX A;  3CJ1 A;  2YX6 A;  3IMX A;  4WQ4 A;  4R79 A;  2ASP A;  5AFU H;  4BRQ A;  1QZ6 A;  3PIP L;  2IIR A;  4GVE A;  4A2B A;  2C1I A;  3CF5 L;  3ZEU B;  5MLC Q;  1KC8 O;  4JAX A;  1ZC6 A;  2FSN A;  2JWK A;  2NRX A;  3FR0 A;  4WFB L;  5JVG L;  5AQV A;  3MMV A;  2W40 A;  3CD6 N;  4IO9 L;  1K8K B;  2YHW A;  3HTV A;  3UKU B;  5JLH A;  4DKW A;  4L3Q A;  5GIO A;  3F5T A;  5AZJ B;  4MLE A;  3HM8 A;  1VQL N;  2VGM A;  3O08 A;  4KH4 A;  4YOR A;  1LOT B;  5E26 A;  3EE8 A;  3M3Z A;  1BO5 O;  4M7Y A;  1SS6 A;  3H6E A;  2ZWH A;  2E1Z A;  4CZI A;  1MWK A;  4YOW A;  1KAY A;  4ILG B;  3VES A;  1GLL O;  4E1J A;  1YVN A;  1HKB A;  1Z05 A;  2Q36 A;  3CJ7 A;  5AQX A;  4GV3 A;  2E2N A;  2HBM A;  2QWO A;  5M1P A;  4H0P A;  4RWT A;  3EKU A;  2CGL A;  3A8Y A;  3JXU A;  4NO7 A;  1IG8 A;  3SMS A;  2ZGZ A;  3LDN A;  5EXW A;  3ZEU A;  5BPM A;  3AAP A;  2RE2 A;  3CCV N;  4CZK A;  3I33 A;  3WEE A;  5AQW A;  2QWQ A;  5AR0 A;  2KHO A;  1YUW A;  3CJA A;  4XH5 A;  3VET A;  4B1W B;  1EO1 A;  2KLA A;  5KQD A;  4PKH A;  1DKG D;  4YOX A;  1Q81 O;  3VMF B;  3LDL A;  4BRM A;  4CZM A;  1V4T A;  4KBO A;  3RSE B;  4DB3 A;  1S72 N;  3FZF A;  5LY3 A;  4BEB A;  4JKB A;  2QTD A;  2QXL A;  3D2F A;  2QWM A;  1NGF A;  3TSP A;  1HX1 A;  3L0Q A;  3BF1 A;  3A5L C;  4BC2 A;  2GTD A;  2P9N A;  1M90 O;  3CI5 A;  4BVO A;  1NGE A;  3B8A X;  2QM1 A;  4WYB A;  5M1Q A;  4BC5 A;  4FWL A;  4JKA A;  2GWK A;  3VF2 A;  1Z6R A;  5M1F A;  3GOI A;  2FSJ A;  3L4Q A;  3MWP A;  3I55 N;  2P9L B;  3ID6 A;  4BRN A;  1W2B M;  2UYT A;  5BN9 A;  3G71 N;  3SBG A;  1Q86 O;  3GL1 A;  2A5X A;  1QZ5 A;  3A5O C;  2YJE A;  4AM6 A;  4BRL A;  4JK7 A;  3WT0 A;  4GV6 A;  4BGB A;  5AQY A;  3W3D A;  1YJW N;  2ASM A;  4NLB A;  1VQ7 N;  3CQX A;  1S3X A;  3C6A A;  4BR0 A;  2QWL A;  3HRG A;  5DM6 L;  4BC4 A;  2EWS A;  3IDH A;  5C0Y A;  2IVN A;  3J8A A;  2P9U B;  3GDQ A;  3TPQ A;  2BH1 A;  1SZ2 A;  3N4Q A;  2HBJ A;  2V52 B;  3W0L A;  4CBX A;  4JKC A;  3VEY A;  4DCH A;  4BR4 A;  3CCJ N;  2HF3 A;  4H0X B;  4WQ4 C;  1YAG A;  1Q18 A;  3WXI A;  4JKH A;  3GG4 A;  1VQ8 N;  1KAX A;  3VTH A;  3P4I A;  1K9M O;  2FF6 A;  2Q0U A;  5BRE A;  3JS6 A;  3WUH A;  1X3M A;  2IVP A;  3ZET A;  3CCL N;  1VQM N;  4CZH A;  3O9T A;  2Q31 A;  1XC3 A;  3FFK B;  4FWP A;  3DJC A;  2E88 A;  3MX2 A;  3QFP A;  4BRF A;  4CZF A;  2V7Z A;  5KPZ A;  1YXQ A;  4IWV A;  3S41 A;  5AQT A;  4BC3 A;  5LJV A;  1YIT N;  4A2A A;  3O1W A;  3U4L A;  4CJ7 A;  4UY8 O;  2P9S B;  5AQO A;  3H3N O;  3U9D A;  2V7Y A;  1TYQ A;  3D2F B;  3FE1 A;  3NMU A;  2V51 B;  1NM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...