1YVNA

The yeast actin val 159 asn mutant complex with human gelsolin segment 1.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
372
structure length
372
Chain Sequence
b'EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGNTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ACTIN)
publication title Crystal structure of yeast actin V159N mutant
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 114
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 1999-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1yvnA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yvnA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yvnA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1yvnA04
4PKIA 5AQOA 4A2BA 4GY2B 3HZ6A 5AQGA 3VF6A 1DKGD 4B1ZA 1WOQA 1S3XA 3L4IA 4FWSA 5AQSA 4FWQA 1NGCA 3O5BA 4M7XA 4BRHA 5AQMA 3CJCA 3FZHA 3LDOA 2P9NA 3DJCA 3U9DA 5EXWA 1NBWA 5AFUA 3QB0A 4BGBA 1JCFA 2V51B 3DAWA 3D2FA 3GBTA 1T6CA 3ENHA 3HBTA 5FPMA 2P9SB 4BROA 2FSNA 3AARA 2QWNA 4BRPA 2E1YA 2QWQA 2E20A 2P9IA 2Q97A 2E2PA 3VEOA 5AQPA 5AQNA 3O08A 2AP1A 2P9UB 3VENA 5E26A 3HI0A 3QFPA 2ASPA 1KAYA 5EOYA 5BRHA 3VEXA 4H5WA 2QM1A 1HJOA 1P8ZA 2ASOA 3EN9A 2YJFA 3EO3A 3GG4A 4FWPA 3VGMA 3ZX3A 3L6QA 1NGFA 1ZBSA 5LJWA 4WQ5C 5AQQA 1BWFO 3CERA 2A3ZA 4FWKA 3CQYA 4XH1A 3FZFA 1Y64A 4H5VA 4H0OA 3BEXA 4BVOA 2A42A 2NRHA 1XC3A 2UYTA 1HLUA 2QXLA 2Q2RA 1LOTB 5BRFA 5F0XA 1C0GA 3VEVA 3HSCA 1MWKA 4BR4A 4WQ4C 2Q31A 1KAZA 4FWLA 2OANA 1K8KB 4BRGA 4C23A 4K25A 2F9TA 3EZWA 1NGEA 2EWSA 4RCHA 3W3DA 2FSKA 5JMVA 4IXCA 4M63C 1HX1A 3M6GA 3DXKB 1E4GT 4IZ9A 1T44A 1TUUA 4XH4A 1QQOA 2ZGZA 3LDPA 4AM7A 4CBUA 2D0OA 2YI1A 2AA4A 2W40A 3CHWA 3H3OB 1SAZA 2P9SA 3DXMB 5F1XA 3A5LC 3GDQA 5AQVA 4A2AA 5BPLA 5EX5A 3VEZA 1DGKN 4CZGA 1BG3A 4Z94A 3ZEUB 5TKYA 4QS9A 3GE1A 3HM8A 3WXIA 3I8BA 4K42A 4BC5A 3UB5A 5JICA 4QS8A 2P9UA 3C0BA 3A5OC 3WXKA 3J8AA 1XUPO 3MMVA 3WEEB 1X9JA 3FLCO 1QZ5A 1H1VA 2Q0RA 1YUWA 3MN9A 4IJAA 3JXUA 1RFQA 1NM1A 1HKBA 2J4RA 4DHYA 4BRAA 4CBWA 3AY9A 3GOIA 5B8HA 3WQTA 5LY3A 5KPZA 4KBOA 4B9QA 1EQYA 3RSEB 4ISGA 3UKRB 2ASMA 3FZMA 1K8KA 1NMDA 2A40A 1SQKA 3VF2A 3O8MA 2E2NA 3F9MA 1GLFO 1LCUA 4BRIA 2ITMA 3G25A 1MA9B 3DXKA 1NGDA 3O1BA 3IDHA 1CZAN 3CETA 4BRLA 5EY4A 3W0LA 3U4LA 4BRCA 2NZTA 1XQSC 3UKUB 1YVNA 3QICA 3D2EB 3O1WA 4H5RA 3EKUA 5ADXH 1X3MA 3ZEUA 4YDUC 4PL8A 2YHXA 4FWOA 5AQIA 2I7PA 3ULEB 3EL2A 1RDWX 1GLJO 1V4SA 4BR0A 3C7NB 3U9ZA 3LDQA 2D4WA 4FSVA 2GELA 1BDGA 1BUPA 1NGAA 5AQFA 4QS7A 4XH5A 4GNIA 3WEEA 2FSJA 2P9PB 4CZFA 3MCPA 5FPNA 2GTDA 4BG8A 4B1VA 4FPAA 1ZXOA 2CGLA 2BTFA 4DCHA 2CH5A 3JS6A 3L0QA 4LC9B 3KHYA 2VYPA 3DWLA 3R6MA 1QQNA 3ATUA 4CD1A 3RSEA 1U2VB 3UKRA 3R8EA 3BP8A 4A61A 2D0PA 2V52B 3SMPA 4JD2B 5FPDA 1V4TA 4BRKA 4FPBA 4H5TA 1GLLO 1KXPA 4MLEA 3VEYA 1YAGA 1BA1A 2YCHA 1ATNA 5KQDA 4CZMA 3ZETB 3H45C 2HMPA 4H03B 2HOEA 5FPEA 1TUYA 5JLFA 3VOVA 5CE3A 3UKUA 1QHAA 1QQMA 4JN4A 4IWVA 4EHUA 3D2EA 3MN6A 2P9LB 5KPTA 2GEMA 3CI5A 4PKGA 2IVNA 4BR7A 3HTVA 4H0YB 3R9PA 4BRFA 1BA0A 2E2OA 3CJAA 4CBXA 2VWBA 3ULEA 2KHOA 2D1KA 2QWLA 4AM6A 4E1JA 5AQKA 3QFUA 5AFUH 4MO4A 2Q0UA 4EHTA 3C7NA 5AQYA 2WUSA 3LL3A 4BQLA 4O8KA 5AZJB 3WT0A 2Q36A 2E8AA 2IVOA 3A5MC 4JAXA 3VF4A 2P9PA 5BRDA 2QWMA 4BREA 3OHRA 3VERA 2E1ZA 1OKJA 4BRQA 5BPNA 4WQ5A 5AZIB 3MDQA 3ID8A 4FWNA 4EFHA 2CH6A 3AAQA 4BR2A 4CZJA 2FXUA 3CIPA 5BR9A 1T6DA 4HWIA 4B1WB 3BUZB 2QWOA 4FL9A 4I6MB 4ISEA 2E88A 2V7ZA 3QMLA 1U2VA 2ZF5O 5BPMA 1NGBA 1JCEA 2ZWHA 4WQ4A 2P9KB 3QBWA 3FE1A 2GUPA 4JD2A 3CJBA 1GLBG 1U6ZA 4PKHA 1Z05A 1Q18A 3MN5A 3H1QA 3SJHA 2IVPA 3U8XA 4H0PA 1KAXA 3B8AX 2CGJA 1GLAG 3LDNA 3ZETA 3LM2A 3SK3A 3H46O 4FOEA 3LM9A 5BN9A 4K43A 5AQWA 3A5NC 3VPZA 5KQ8A 2P9LA 3M3ZA 5AQZA 3LDLA 4DQ8A 1ZC6A 3DXMA 5AQTA 4CZKA 4A62A 4RTFD 3A8YA 4J8FA 1BO5O 4Y0WA 5AR0A 3UE5A 1RGIA 1HUXA 4JHDB 1GLEG 2FF6A 1YXQA 4BVPA 3CJ9A 5LJVA 1NGGA 5AZJA 2Q1NA 5AQLA 4WYBA 1NGHA 4CI6A 4XEIA 2H3GX 1C0FA 4BG9A 3I33A 5AZIA 3FZKA 2F9WA 4RWTA 4FO0A 4BRNA 1BU6O 4BR5A 4O5FA 4H0VB 5JLHA 1DEJA 1ESVA 4DB3A 2A5XA 2GWJA 2HF3A 4H0XB 5AQXA 4I6MA 3VGKA 4MLHA 2PAVA 3TPQA 4BGAA 3FR0A 3ENOA 4FWRA 4K41A 3H6EA 2P9KA 3WXJA 3FZLA 4IJNA 1WUAA 2V7YA 4BR9A 2YHYA 1Z6RA 3S41A 4HTLA 2YHWA 4EIAA 3H1VX 2IIRA 3AAPA 3M1FA 2ZGYA 5EVZA 1SZ2A 5AQJA 3D7EO 5KPRA 3ATVA 1JCGA 5E84A 3O6WA 2QWRA 4CD3A 1IG8A 2QW9A 3BF3A 2HF4A 4CZIA 3EKSA 3TU5A 4NB4A 3VEWA 5BREA 4M7YA 2PBDA 5AQRA 3ZX0A 1HKCA 4L3QA 1E4FT 4YDUA 1QZ6A 3MN7A 3O80A 4BRDA 4H5NA 4CZHA 2GWKA 1TYQB 4JHDA 4CZLA 4NO7A 4ISFA 3VETA 3IMXA 2FLOA 1S22A 4JNEA 3BF1A 3CJ7A 3IFRA 5F2RA 3WXLA 3QDKA 2BUPA 5ELZA 3VGLA 5ADXA 3MK6A 1R59O 3ZX2A 1J6ZA 4EAHD 4BRMA 2P9NB 1MWMA 3A0IX 4IO8A 2A41A 4B1XB 2CGKA 2E2QA 2A6AA 3D2FB 3FGUA 1NGIA 3KZBA 2I7NA 1NLVA 3VESA 1HPMA 2P9IB 5BN8A 4CJ7A 3O4WA 3FFKB 2FF3B 4FWMA 4CZEA 1X3NA 1IJJA 3CQXA 5I9EB 1NWKA 1D4XA 4PL7A 4BC3A 4H0TB 3H3NO 4FOIA 3WUHA 3KVGA 4BC4A 1G99A 3GL1A 1GLDG 1ATRA 2W41A 5AQHA 1MDUB 2NLXA 3P4IA 1BOTO 1HKGA 4BQZA 3QBXA 2QWPA 4F9OA 3SMSA 2YJEA 2VCPA 1ATSA 5AQUA 4B1UB 2DPNA 4B1YB 1GLCG 3SLCA 3WQUA 1TYQA 4BC2A 1NGJA 3IUCA 4MO5A 3CJ1A
chains in the Genus database with same CATH superfamily
1L3VA 4DFJA 3CD6N 5AQGA 2GUIA 1RBVA 4B1ZA 1S3XA 3KJVA 4FWSA 1NGCA 3NH2A 3KK1A 3LDOA 4B3RK 3U9DA 1JLFA 1NBWA 2IC3A 3DAWA 2ZJPL 3D2FA 3ENHA 1WSHA 4FK4A 3O4NA 1Q9XA 2P9IA 3AVJA 3VEOA 5GADP 2P5GA 3CXCM 2OTLN 3QFPA 1BI4A 3R3LA 3CM6A 2ASPA 3TSQA 5BRHA 5FROA 1ZYQA 4H5WA 4O0JA 3EO3A 3SQ2A 4JK8A 4X65K 3OYEA 2A3ZA 4LFCK 3CQYA 3FZFA 4H5VA 5FLXO 3U3GA 1JLBA 3NE6A 2UXCK 4H4MA 2OTJN 1RNHA 3K5OA 1LW0A 2VWJA 1NNEA 2OANA 1NJIO 3V9WA 4BRGA 1VHXA 3PIPL 2F9TA 3EZWA 2W00A 2EWSA 1ZBUA 5JMVA 4HVJA 1HX1A 2KFNA 4X62K 1E3MA 4WFBL 3NF6A 1E4GT 1T44A 4CFCA 4XH4A 4IEEA 4CBUA 3V9SA 4O4GA 1HNXK 4DQQA 5EX5A 3VEZA 4Z4GA 4Z94A 3LDSA 3RR7A 3ALYA 3F5TA 3HM8A 3WXIA 4CIGA 2ITGA 4M3RA 4RW6A 3UB5A 3NH1A 4QS8A 3SUPA 4DTRA 4IFVA 1RDDA 4HUEA 1J5OA 1VSMA 3WEEB 3HXMA 3T7ZA 4ZTJA 3TAMA 3C6HA 3F2KA 4B9UA 4WF9L 1HKBA 4ILJA 4DHYA 1UA1A 3DOKA 3LP1A 4CBWA 3GOIA 1JLCA 3QESA 1KRPA 5B8HA 1TKXA 2D5RA 5LY3A 4KBOA 1UAXA 4ISGA 2GX9A 1Q86O 5JVGL 1SQKA 3VF2A 4OJRA 4AH9A 3EEQA 1BQMA 1VQ9N 4DV1K 4CHPA 3HRGA 4J2AA 3NHGA 1U4BA 2Y1IA 3W0LA 5C2DA 3F9KA 3UKUB 5KTQA 3DLBA 3CCVN 1LWEA 2DTUA 3QICA 4LF4K 4QCLA 5HRRA 1X3MA 4V19S 1T8EA 4FWOA 5AQIA 5KRTA 4AF1A 3CF5L 4F2SA 4BR0A 1EETA 2B5JA 1TVRA 4CECA 3HL8A 2G8UA 1BDGA 3DRSA 1NGAA 3L3VA 3ZSRA 5AQFA 5TKWA 2PZSA 3WEEA 4CVNE 2P9PB 4DTNA 4BG8A 2R7YA 4M3UA 1TAUA 1RT6A 1ZXOA 4OLBA 3AVIA 2CH5A 4FJ7A 4LC9B 3HOTA 3KHYA 3DWLA 1YITN 1JLEA 4J2DA 1TKZA 1FW6A 1U2VB 1EX4A 4A61A 4CJSA 1RDAA 3SMPA 2EHGA 5HOOA 1V4TA 4FPBA 2HVHA 3T3FA 3VTHA 4ILHA 1RCHA 1ATNA 1C1BA 4DR4K 4H03B 1W9HA 5FPEA 4KFBA 4CF2A 4JI4K 3OBWA 3QNNA 3UKUA 1QHAA 4CIFA 3CFOA 5KPTA 1NU0A 2GEMA 2BGGA 2I5JA 3TWHA 1CXUA 4BRFA 3R9PA 1BA0A 3CJAA 3THWA 1EO1A 4CBXA 2KHOA 1VAZA 2F4VK 4N47A 1RTJA 4H4OA 3MEEA 5LMUK 5AQYA 3OYLA 4KH5A 1QTMA 2HMIA 3LL3A 2XY7A 3WT0A 4WCEL 2E8AA 2QTDA 1VSJA 2P9PA 1Q81O 5BRDA 1NOYA 4CF9A 3AA2A 1XC9A 4FJMA 1N32K 2B4JA 3VERA 4CK1A 1OH6A 1SL0A 4M3XA 5AZIB 1I3AA 3Q7CA 2XRIA 3S5TA 2HSTA 3KK7A 4CZJA 2E4LA 3AA3A 4HWIA 3BUZB 1VSFA 2V7ZA 1U2VA 2ZF5O 3AVAA 5BPMA 4DWIA 2ZWHA 3SBTA 3FE1A 4AHVA 2ZQBA 1RT5A 4X64K 1U6ZA 3MN5A 3H1QA 4NCGA 3SJHA 4PUOA 3OJSA 4CHQA 4YOYA 3K57A 2NRXA 3TAQA 3G0ZA 1KTQA 4FOEA 3J80O 3VQ4A 3QETA 4MDAA 3NVMA 3OYIA 5KQ8A 5C24A 3CG7A 1O13A 3TANA 3M3ZA 4DQ8A 4DSEA 1ZC6A 3TTDA 5AQTA 3LAKA 4RTFD 3EYZA 3A8YA 2OYQA 2YV0X 3JAMO 1HUXA 4JHDB 1BCMA 1XHXA 4HUGA 3ZCMA 5HRSA 4GKJK 4KO0A 1YXQA 1NGGA 5H1SQ 5AQLA 1KFDA 1Q7YO 3CCSN 4FM0A 4BE0A 1YJNN 1VQ4N 5M1KA 4IDKA 5DK5A 5AZIA 4CHNA 3FZKA 4BR5A 3TI0A 4O5FA 5JLHA 1DEJA 4E7KA 4DB3A 2A5XA 4OKEA 1Z25A 4OPKA 2FBXA 1RDCA 2PAVA 3OYMA 3M5RA 1XHZA 4ELVA 3CMAN 1VQ8N 2YHBA 3E01A 4M41A 4N5SA 1SKRA 2VQEK 4HTLA 3AAPA 4LSNA 3ATVA 1JCGA 4DR2K 4DV7K 2QWRA 4B3TK 1BHLA 3BF3A 1J5EK 3THXB 3PX0A 1M90O 4ID1A 3OS0A 5BREA 4FJHA 1VSEA 5AQRA 4N76A 1HKCA 4W5TA 4CEFA 4YDUA 2W6LA 4PY5A 4ZTFA 4CZHA 2GWKA 4JHDA 4CZLA 1UOCA 4LF6K 3VETA 4NYFA 3BF1A 5F2RA 4CF8A 1D8YA 1I39A 5KI6A 3K0SA 2HHIA 1EWRA 3OYCA 1VQLN 4DQPA 1MWMA 3A0IX 4R79A 4B1XB 3AV9A 3SUNA 2A1SA 4WFAL 1RBRA 5CR4A 5D3GA 1JL1A 4A57A 3DI6A 3BGRA 3L2VA 4NCBA 4RW9A 1BIZA 3O4WA 1IG9A 4FVUA 2FF3B 4LFBK 4CZEA 1IJJA 1C0UA 3CM5A 4B08A 4BC3A 3K9KA 4BY9C 3CPWM 4B9TA 4BC4A 5KGWA 4FJ5A 2OZSA 1GLDG 3THXA 3QEVA 2NLXA 4WE1A 1HKGA 1RT7A 3QBXA 5J2QA 4F9OA 2YJEA 2B6AA 5AQUA 1JLAA 4B1YB 4DFPA 2RKIA 1JLQA 2PYLA 3WQUA 4MFBA 1ZBFA 3MEDA 3CJ1A 2NRTA 2OPRA 4A2BA 4GY2B 3L3UA 4RW7A 4OO1J 3L2RA 1NKBA 2FBTA 1WOQA 2HBLA 4DR5K 1O1WA 1R0AA 4FWQA 4ICLA 4I2QA 3TTFA 2VG7A 4DTXA 5AQMA 2F8TA 2G8FA 3V81A 5EXWA 4GV6A 4RG8A 4O8UA 2V51B 2IGIA 3GBTA 3C6TA 3TAFA 4E1MA 3RTVA 1X9WA 5FDLA 1TGOA 3I0RA 5HROA 4BRPA 4W5NA 2QWQA 4KHNA 5AQPA 4CFDA 4CK3A 3O08A 4IKFA 2NUBA 3IS9A 4FLVA 5E26A 4KHWA 3HI0A 1N5YA 3T19A 3C6UA 3EY1A 5CYMA 3TSUA 3VEXA 1HJOA 4CGIA 3K9JA 2ASOA 3VA3A 2KQ2A 1IKVA 1TV6A 4I7FA 1NGFA 5LJWA 4PQUA 4WQ5C 4DFMA 1VSLA 4R5PA 4XIUA 1Y64A 3CPEA 3NGZA 3U6FA 5KGXA 4ID5A 4JYAK 2F8SA 4BVOA 3S3OA 2A42A 3FFIA 3MXIA 1Y97A 4C8LA 2UYTA 1HLUA 4OVLA 1LOTB 4TSXA 1C0GA 1I94K 2WONA 2JGUA 2KZZA 3AO5A 4RW4A 4W5OA 3KLGA 3N4QA 2FBYA 3HPGA 1NGEA 3ZT0A 1S6PA 3NDKA 2OPSA 4RCHA 2FSKA 4DS5A 1HJRA 4IXCA 3O9SA 4DMNA 1U48A 4IZ9A 1RT3A 1QQOA 3QEPA 2DFEA 2YI1A 3VQ5A 4FM1A 1GOCA 3H3OB 3DXMB 5F1XA 3A5LC 3G6EN 1WSFA 4F3TA 1QVFM 1BG3A 4C1NI 3CC4N 3O9UA 4JLHA 3BZKA 3VQPA 4J2BA 4GVMA 1D5AA 4KHPK 3C0BA 2OZMA 4DSKA 4IO9L 3MMVA 4DV5K 3FLCO 1H1VA 4FJGA 3CYMA 1RTHA 3JXUA 1NJXA 4DU1A 1NM1A 1L3SA 1JLGA 4BRAA 3P31A 3RMBA 3KK3A 2O4IA 4KH6A 1IO2A 1OH8A 4BDYA 3E9OA 5KPZA 4B9QA 1EQYA 2ASMA 3FZMA 3KIOA 1QHTA 1HQUA 1GLFO 2D0CA 3F9MA 3LP0A 1K8AO 4IOCL 3WNFA 4DLEA 4IG3A 3KLEA 3HO1A 4CHYA 3VQ9A 1N33K 1QE1A 1XNQK 3NBPA 2XHBA 1NGDA 1S5JA 3O1BA 2Z1IA 1JJ2M 4BRLA 5EY4A 3AO4A 1SV5A 3D2EB 1ILYA 4H5RA 2DFHA 3V6DA 3NMUA 1A5XA 4KHQA 5GIOA 1S6QA 1KC8O 3OYHA 1NJWA 1K73O 3KWGA 2O8BB 3OJUA 1RDWX 3C7NB 5EU7A 2D4WA 1YTAA 3HP9A 3O3HA 1VQKN 1WLJA 1RT2A 2YHAA 4KI4A 3WNEA 1OH5A 3WXMB 3VQAA 3ZT4A 4ELTA 4KKOA 1YI2N 1JXEA 2BE2A 4DCHA 5GIPA 4JRPA 1JXBA 3JS6A 1QQCA 5C25A 4DU3A 2VYPA 3RMAA 1RT1A 3AVFA 4JK7A 4DV6K 5J2MA 1WSGA 2VGNA 3QEXA 3AVGA 2KTQA 1DLOA 5FPDA 1UWBA 2Z1JA 2WFBA 1GLLO 4JI8K 3K59A 1BA1A 1YIJN 5KQDA 4WFNL 3ZETB 4W5RA 2IS3A 2JWKA 4CEQA 5I42A 2HOEA 3MEGA 1S1VA 4CJVA 2YX6A 4JKHA 5CE3A 3D2EA 3ZT2A 2P9LB 4O5BA 3CI5A 4PKGA 2IVNA 4BR7A 1J54A 2VGMA 4CJFA 4CIEA 1VQNN 1EKEA 2O8BA 4IFEA 4AM6A 2QWLA 2UUBK 4JK9A 2G8VA 3TSPA 4MO4A 2Q0UA 3M8QA 3C7NA 1X9SA 5CYQA 5M1NA 3OY9A 4LF9K 2WUSA 5LMNK 4B3SK 2Q36A 1J53A 4JAXA 4JI5K 3VF4A 3ZT1A 4ELUA 4NXNK 4KV8A 3AVLA 2QWMA 5JENA 4DQIA 3OHRA 1OKJA 2X6NA 5BPNA 5C42A 3ID8A 3P1GA 4OPHA 4EFHA 3CIPA 4W5QA 2XY8A 4ZHRA 4ISEA 2E88A 4CJTA 1WSJA 4DSIA 4WQ4A 1U49A 1SKWA 3QBWA 3OTOK 4PKHA 3S9HA 3C6AA 3QINA 4HUFA 3SCXA 2PFUA 2IVPA 4FLXA 2HNZA 2CGJA 3IAYA 3ZSOA 1N36K 1GLAG 1QSYA 3ZETA 2XY6A 3H46O 5SZTA 3WNHA 2P9LA 3LDLA 3SV4A 4Q0BA 4CJPA 2AJQA 4JEPA 4A62A 3HPOA 4CK2A 4YFUA 5AR0A 3PO4A 3UE5A 2NRWA 4B9SA 3SNNA 4FJKA 4C8MA 5J2PA 2FF6A 2ZJQL 4BVPA 1YJ9N 3CJ9A 5LJVA 1N34K 4C8OA 5JS1A 1BQNA 4PHTX 2Q1NA 5JVHL 3MAQA 4FYDA 1NK7A 3AO2A 3DRRA 3O3GA 3OBYA 4XEIA 1C0FA 1W97L 4KTQA 3NGYA 3VA0A 3I33A 4FO0A 4BRNA 2UXBK 3OW2M 3C65A 1M1KO 4B9VA 5AQXA 1HYVA 5A2QO 4BGAA 1QSSA 1KSPA 3OYBA 1EXQA 3H6EA 4CJEA 3FZLA 1TK0A 1WUAA 2HBMA 2OCEA 1HR0K 3S41A 2YHWA 2ATQA 2YNGA 2GBZA 3VTIA 5EVZA 3D7EO 5KPRA 4B3MK 5E84A 4OPJA 4YOTA 1HRHA 2QW9A 3KKRA 4CZIA 4M3ZA 3KLHA 3PO5A 4FJIA 3TU5A 4NB4A 4E1NA 3VEWA 2Y1JA 2OPQA 3V9UA 4CJWA 4L3QA 1E4FT 2VWKA 1C0MA 4CEAA 4DTUA 4H5NA 4CHOA 4E3SA 3M8SA 3NF9A 4FLZA 4JNEA 1OVQA 4LH4A 2RHKA 3JSMA 3QDKA 3UIQA 2BUPA 5ELZA 2JWLA 5ADXA 3ZX2A 4GKKK 3HK2A 3M8PA 2P9NB 3HP6A 2XY5A 1OH7A 3LZJA 4IO8A 3I56N 1T03A 2A6AA 4YHHK 4FJLA 3CCEN 3SQ4A 5IT9O 4ILGB 4F8RA 1DTQA 4GV3A 5BN8A 4CJ7A 4FWMA 4IG0A 2HB5A 4I9QA 4CEOA 5I9EB 3JYTA 3DLHA 4EZ6A 4DQSA 2KZMA 4CGHA 3GL1A 3MWPA 1ATRA 2E6LA 1MDUB 3MXMA 3T69A 4BE7B 3P4IA 4FLUA 3V1RA 3G4SN 4JKEA 4BQZA 4FZXC 5DMRA 3QIPA 2YNIA 3F73A 4K0KK 2VCPA 3PIOL 1KLNA 4M42A 3O4QA 3OYDA 2KLAA 4DSLA 4BC2A 3ISNC 1NGJA 1RILA 4FK2A 4DV4K 1Z26A 3S3NA 1HYSA 1IKYA 1TK5A 5HP1A 4PKIA 2DFFA 4AQYK 2P1JA 4NXMK 3HZ6A 3WNGA 1SKSA 3VF6A 4E0DA 2P5OA 1DTTA 5AQSA 2RN2A 1FKOA 3O5BA 4CGDA 3SBGA 3CJCA 2P9NA 3DJCA 3MWTA 5CHIA 5GINA 4BGBA 1JCFA 3NFAA 3ZT3A 1T6CA 3HBTA 3ZYYX 5FPMA 2P9SB 1UA0A 4DV2K 3HM9A 4CEBA 4BROA 4M45A 2FBVA 3PLAA 4HTUA 2E20A 4Z4HA 4KHSA 3ZSVA 3TABA 5AQNA 1XMOK 3OA9A 3SPZA 2AP1A 4CCHA 3VENA 1DT9A 4EP5A 4K8XA 4OX9K 2YJFA 3DYAA 3GG4A 4FWPA 3ULDA 3AVKA 1NK9A 3L6QA 1VK0A 4MQ3A 5AQQA 4CE9A 4MDBA 4FWKA 3VQ8A 2NRVA 1J9AA 4XH1A 4E7IA 1IBMK 5FRNA 4KPYA 3BEXA 4XJXA 3KWIA 2NRHA 1XC3A 1KQSM 1NK4A 2QXLA 1CXQA 2Q2RA 5BRFA 3VEVA 1MWKA 2W6KA 4BR4A 4FCYA 1WBDA 1KAZA 1YT3A 1K8KB 4FVMA 1NG9A 4K25A 3AVBA 3C94A 5CY4A 4JI1K 4BDZA 4AHSA 5C2FA 3W3DA 1HNZK 3DRPA 1B92A 1NK5A 3M6GA 3AVCA 3VQCA 3DLEA 2QA4N 4JS5A 4AM7A 3AVHA 4QAGA 2D0OA 2PYJA 2AA4A 3CCUN 3K5MA 3TAGA 2P9SA 5AQVA 4A2AA 5BPLA 4YOWA 2ZD1A 4PA1A 4CZGA 2KW4A 4FM2A 2RPIA 5TKYA 4QS9A 3GE1A 4CF0A 3I8BA 4K42A 1L3TA 3RWUA 3LP3A 1IV0A 3WXKA 3J8AA 1XUPO 4EZ9A 3T1HK 3OYJA 4IJAA 4E7LA 2G8KA 1RDUA 1T7PA 2IDOA 2J4RA 1S9GA 3AY9A 3HSTB 4I2PA 4Z0UA 5KRSA 4LF8K 5J2NA 3RSEB 2P51A 4CF1A 4CGFA 4DR3K 4CJQA 3DM2A 5J1EA 4DLGA 1K8KA 1CZ9A 1HYZA 4CJ3A 3S3MA 4HCBA 4N41A 3O8MA 2E2NA 3KD5E 4JKCA 3ZSXA 4DTOA 3EE8A 3M8RA 3DLKA 3IDHA 4NLBA 3CETA 3AGKA 4Z4CA 4KREA 3HT3A 5M1PA 1XQSC 3ITHA 3Q7BA 1YVNA 4FLWA 3O1WA 3LWMA 3EKUA 4NCAA 5ADXH 3RMDA 1NOZA 3HOSA 4YDUC 4FJXA 2YHXA 2VQFK 1NK8A 2I7PA 4BACA 3HVTA 3SI6A 2XO7A 3U9ZA 3ZSYA 2GELA 1W2BM 3D45A 1BUPA 2HHTA 1HNIA 1S72N 4QS7A 1KVAA 1L3UA 5I3UA 1KCFA 4XH5A 3PUFA 2FSJA 4CZFA 5FPNA 4B1VA 2ZE2A 2QI2A 2CGLA 2BTFA 3L0QA 4DTMA 2F96A 3CFRA 1HNVA 2LSNA 1QQNA 3P5JA 2E5LK 3ATUA 4CD1A 3RSEA 4Q5VA 5GAGP 3MX5A 3BP8A 5M1OA 3VQ7A 2V52B 3ASMA 1S1TA 4JKGB 3V4IA 1L5UA 4BRKA 3L2QA 3TARA 4H5TA 1NK6A 4FJ9A 1S1WA 4MLEA 1YAGA 4M3YA 3TR8A 4GV9A 1VRUA 4CZMA 3SYZA 3H45C 2HMPA 1U45A 1CZBA 4LY7A 5GAHP 4JN4A 1QQMA 1KD1O 5JS2A 4B9LA 1ZBLA 3KK2A 4JI3K 4A5BA 3B6OA 4GVEA 3J7ZO 3E9LA 2VWBA 3OVNA 3ID6A 3RR8A 4EHTA 4B9MA 2C1GA 1WSIA 3ZSWA 4BQLA 4O8KA 3PY8A 2HBKA 3VQBA 4BREA 4DUZK 1WB9A 3AGRA 2E1ZA 2RE2A 4BRQA 4NYNA 1LWCA 1ZBHA 1T3VA 3MDQA 3P83D 4FWNA 1Q9YA 3AAQA 1BISA 4AHCA 1T6DA 3PV8A 2QKKA 1NK0A 4B1WB 4U67L 2QWOA 4I6MB 4AHTA 1C0TA 1JCEA 3PX4A 2IOCA 2P9KB 2YKNA 4LF7K 4JKGA 5DM6L 4CEDA 1Q18A 1EP4A 3B6PA 1KAXA 3B8AX 2OPPA 1IKWA 4DFKA 3CCLN 3O3FA 4K43A 3A5NC 3VPZA 2HHQA 1CLQA 3MCAB 3O9RA 4E19A 3V9ZA 5HRNA 5AQZA 1WSEA 1A5WA 3DXMA 5C0YA 3O9QA 4J8FA 4FK0A 3R1XA 4CGGA 1RGIA 4B3OA 1YVUA 3O9TA 4WYBA 4CI6A 3T1YK 1N8RO 2HNDA 4FJ8A 3QO9A 2F9WA 4RWTA 3QEIA 4KTWA 1ESVA 2UU9K 2GWJA 2HF3A 3SV3A 4H0XB 3VGKA 4I6MA 2HBJA 4KHUA 3TPQA 3NH0A 2GV9A 1IH7A 5DM7L 4DR7K 2HHUA 1HMVA 2P9KA 3WXJA 1YJWN 4IJNA 4BWJA 2V7YA 3D6RA 4BR9A 4OLAA 1Z6RA 4DSJA 3OYKA 3VQ6A 2UUCK 3H1VX 2IIRA 3QIOA 2Q3SA 3TTCA 1SZ2A 5AQJA 1W7AA 1P90A 1LV5A 3O6WA 2HVIA 2QEXN 1IG8A 4Z4IA 2F7TA 1K6YA 1QS4A 1VRTA 2HF4A 5HBMA 3EKSA 4DR1K 4OKKA 3OYFA 3ZX0A 4F3OA 3J7AP 4OGEA 1QZ6A 3CFPA 4ISFA 2FLOA 3PSIA 1TKDA 1LAVA 4BECA 5HL7L 4B8AB 3MK6A 3LAMA 4GMJB 1J6ZA 4BRMA 1LAWA 1BIUA 3MECA 4UQGA 3TAEA 3FGUA 5T7BA 4X66K 3AVNA 1RBSA 1NGIA 4O55A 3CYGA 3EE9A 1NLVA 1VQ7N 1LWFA 1HPMA 3VESA 3SQ1A 2D0AA 3K5NA 3SQ0A 2QKBA 1WNSA 3CQXA 1NWKA 4PL7A 3OYNA 4H0TB 3HVRA 3H3NO 4JKFA 4FOIA 3WUHA 1G99A 4IBNA 3U3YA 1IBKK 2ZJRL 1RTDA 4O0IA 4KTZA 5GAEP 3RRGA 2BDPA 4JV5K 1ATSA 4B1UB 2YNHA 2FC0A 4AILC 1G15A 2NNWA 3IUCA 4BWMA 4K8ZA 2ETJA 1WAJA 5AQOA 2HHSA 1DKGD 1A5VA 4N56A 1RDBA 3L4IA 1WAFA 1FK9A 3KD1E 4M7XA 5BR8K 2O8CB 4BE1A 1BL3A 4BRHA 1SUQA 2NRZA 1RBTA 3FZHA 3QNOA 3LALA 3VQDA 5AFUA 3QB0A 4E89A 2O8DB 3SJJA 2WOMA 4CFBA 4OGCA 1LW2A 3BY5A 2O8EB 3THWB 3ZLJA 4C8NA 4JS4A 2FSNA 3AARA 4CJUA 2PY5A 3CCJN 3HYFA 2QWNA 2E1YA 1VSIA 2Q97A 2E2PA 1VSHA 3TAPA 1ASUA 1T05A 2P9UB 4CJKA 3K58A 3CC7N 4H8KA 1KAYA 5EOYA 4IOXA 3DLLL 2QM1A 3ENBA 1P8ZA 2KKZA 3EN9A 2Z1HA 3VGMA 3ZX3A 3AO1A 1ZBSA 4KHYA 3KLIA 1XWLA 1BWFO 3A2FA 3CERA 2A1RA 1GOAA 4CERA 2IAJA 4DF4A 4H0OA 3OS1A 2Z1GA 3CCQN 4LH5A 4FXDA 5M1QA 5F0XA 3IRXA 3HSCA 4WQ4C 2Q31A 4FWLA 5IWAK 4C23A 3HPHA 5AJ3K 4Z4EA 3NF7A 2O8CA 4E72A 3V9XA 4M63C 1NMNA 3DLRA 3DXKB 4JKAA 1NKEA 2JLEA 2ZM6K 1TUUA 3P39A 2ZGZA 3LDPA 4EP4A 3CQ8A 2O8DA 1GOBA 3OS2A 3QEWA 2W40A 2VG6A 3CHWA 1SAZA 4CEZA 1D9DA 4FW1A 2KFZA 3GDQA 4DQRA 3DLGA 2O8EA 4DTJA 2VG5A 3KTQA 1DGKN 3L8BA 3ZEUB 1U04A 3RRHA 4BC5A 4JKBA 4RW8A 4CEEA 4CJLA 5JICA 3NAEA 2HW3A 4C1NK 2P9UA 4CW7B 3A5OC 4L8RB 3VN5A 3SZ2A 3MXJA 4KH4A 5C12A 1C6VA 1X9JA 3E9PA 1QZ5A 2Q0RA 1YUWA 3MN9A 1BGXT 3E66A 4DG1A 1RFQA 1HQEA 3AA4A 4BE2A 3P38A 4FW2A 1KFSA 1YF5L 3QLHA 3LZIA 3WQTA 1FJGK 2RF2A 4LF5K 1X1PA 1B9DA 3UKRB 2WC9A 4DSFA 1NMDA 2A40A 3EZ5A 1S1XA 3RVCA 1LCUA 4BRIA 5HLFA 1ITGA 3IG1A 3IKMA 5MLCQ 2UUAK 2ITMA 3CC2N 3G25A 3AVMA 1MA9B 3DXKA 1CZAN 1VSDA 3H08A 4DV0K 1IKXA 3N4PA 3C95A 5CZ2A 3U4LA 4BRCA 2NZTA 4JI0K 3HJFA 5CZ1A 3QERA 3CCRN 4M3TA 1JL2A 4FJNA 3ZEUA 4PL8A 4IEIA 3SAGA 3ULEB 4BDPA 3EL2A 1SL1A 1B9FA 2X78A 3I55N 4JI7K 1GLJO 4FZYA 1V4SA 3LPTA 4FLYA 3LDQA 4B9NA 4FSVA 4LFAK 1XI1A 1EWQA 3L2UA 2D0BA 4GNIA 4FLTA 4JRQA 5K14A 4YOUA 3MCPA 5C15A 2GTDA 4F2RA 3I0SA 4FPAA 1F21A 1QVGM 4UY8O 4A5AA 1C1CA 1TL1A 3ZSQA 3SAHA 1XMQK 3L4QA 4AHRA 2HHHK 3R6MA 1TK8A 1VQMN 3T1AA 2O8FB 2HNYA 4M3WA 4CHZA 3UKRA 3R8EA 4YNQA 2D0PA 4JD2B 2YKMA 5M1FA 4JI2K 4OPAA 1TKTA 4CGJA 1KXPA 1ASWA 3VEYA 2YCHA 2E6MA 4PWDA 1W0HA 1TUYA 5JLFA 3PSFA 4DUYK 3VOVA 1QSLA 4IWVA 4EHUA 3MN6A 1C1AA 3HTVA 1HPZA 4H0YB 2E2OA 4IDHA 1FKPA 1VSKA 1TAQA 1KVCA 3ULEA 2D1KA 4E1JA 5AQKA 3QFUA 5AFUH 4Y1DA 4CJ4A 1Q82O 2W42A 3NF8A 5AZJB 4JI6K 4JKDA 4IFYA 3A5MC 2IVOA 3AO3A 1NKCA 2X6SA 3J7YP 3NGIA 4Y1CA 4WQ5A 1VQON 3SPYA 1SL2A 3VMFB 2CH6A 2EX3A 3DOLA 4KB0A 4BR2A 3CCMN 3SUOA 2FXUA 5BR9A 4E7JA 3L2WA 4DR6K 4FL9A 2O8FA 1VQ6N 4E7HA 3QMLA 4CJRA 1NGBA 1REVA 1U47A 2GUPA 4JD2A 3CJBA 1GLBG 3V1QA 1Z05A 2BANA 2G8HA 1YHQN 4B8CA 3D0PA 3U8XA 1TL3A 5LL6Z 4H0PA 1ASVA 3KLFA 3LDNA 4Z4FA 3LM2A 3SK3A 3V1OA 4I9LA 3KKSA 1XNRK 2DY4A 3LM9A 5BN9A 5AQWA 3LANA 4LD0A 3SUQA 3CMEN 3OYAA 4YY3K 2WBNA 4QOZB 3I8DA 4NLCA 3K5LA 4CZKA 4G9ZA 1BO5O 4O44A 4Y0WA 1S9EA 5E41A 1NJZA 1MU2A 1K9MO 1GLEG 1SS6A 5AZJA 5C10A 2NRRA 2O4GA 1FXXA 4YOVA 2WTUA 1NGHA 4YOXA 2H3GX 4BG9A 1BCOA 1IBLK 3LP2A 4KI6A 3THYB 1BU6O 2YNFA 2HHWA 1Q8IA 4DU4A 4H0VB 4HHTA 2HHVA 4AHUA 4BEBA 4MLHA 3AA5X 3BZCA 3FR0A 1OVYA 3ENOA 4FWRA 4K41A 4DS4A 3NCIA 2G8WA 3VQEA 4GW6A 2YHYA 3OYGA 4DF8A 4EIAA 5FRMA 3M1FA 1ZBIA 2ZGYA 4IOAL 5SWMA 3BDPA 4CD3A 1HNWK 1VQPN 2HHXA 3MX2A 4DTPA 4DV3K 2X74A 4DKWA 4M7YA 2PBDA 3THVA 3MN7A 1VQ5N 3O80A 4BRDA 3K2PA 1TYQB 4KB1A 4NO7A 3PX6A 4J2EA 3IMXA 1D9FA 1S22A 4CJ5A 3LPUA 3CJ7A 3ZSZA 3LWLA 3J81O 3IFRA 3WXLA 4CESA 5HRPA 2QXFA 3VGLA 4G1QA 1R59O 3G71N 4EAHD 1N6QA 3THYA 1NJYA 2A41A 2CGKA 2E2QA 4FJJA 4FZZA 1YTUA 3D2FB 4HCCA 3DMJA 1RTIA 3KZBA 3E1YA 4F4KA 1WBBA 4KRFA 2I7NA 4OKJA 4CFAA 1X9MA 2P9IB 3VQQA 3FFKB 1S1UA 1X3NA 4U7BA 4C8KA 1D4XA 2UXDK 1BI4B 1WN7A 4LSLA 3NVKA 3RMCA 3KVGA 2QK9A 4A59A 2C1IA 4KAZA 3SAFA 1JKHA 2W41A 5AQHA 3G10A 2BH1A 2G8IA 1BOTO 2QWPA 4DTSA 3SMSA 1RBUA 1RT4A 2DPNA 4YORA 1KLMA 2OA8A 1GLCG 3SLCA 1TYQA 1KVBA 4MO5A
chains in the Genus database with same CATH topology
4PKIA 2NRTA 5AQOA 4A2BA 3CD6N 4GY2B 3HZ6A 5AQGA 3VF6A 4OO1J 1DKGD 2HBLA 1WOQA 4B1ZA 1S3XA 3L4IA 4FWSA 5AQSA 4FWQA 1NGCA 3O5BA 4M7XA 3SBGA 3TTFA 4BRHA 5AQMA 3CJCA 2NRZA 3FZHA 3LDOA 2P9NA 3DJCA 3MWTA 3U9DA 5CHIA 5EXWA 5GINA 4GV6A 1NBWA 5AFUA 3QB0A 4O8UA 1JCFA 2V51B 4BGBA 3DAWA 2ZJPL 3D2FA 3GBTA 1T6CA 3ENHA 3HBTA 5FPMA 3ZYYX 2P9SB 4BROA 2FSNA 3AARA 3CCJN 2QWNA 4BRPA 2E1YA 2QWQA 3PLAA 2E20A 2P9IA 2Q97A 2E2PA 3VEOA 5AQPA 5AQNA 5GADP 3O08A 3OA9A 3CXCM 2AP1A 2OTLN 2P9UB 3VENA 5E26A 3CC7N 3HI0A 1DT9A 3QFPA 3R3LA 2ASPA 1KAYA 5EOYA 3TSQA 5BRHA 4IOXA 3TSUA 4H5WA 3VEXA 3DLLL 2QM1A 1HJOA 3ENBA 3K9JA 1P8ZA 2ASOA 2KKZA 3EN9A 2YJFA 3EO3A 3GG4A 4FWPA 3VGMA 3ZX3A 3L6QA 1NGFA 1ZBSA 4JK8A 5LJWA 4WQ5C 5AQQA 1BWFO 3CERA 4MDBA 2A3ZA 4FWKA 2NRVA 3CQYA 4XH1A 3FZFA 1Y64A 3CPEA 4H0OA 4H5VA 3CCQN 3BEXA 4BVOA 4XJXA 2A42A 2NRHA 3KWIA 1XC3A 1KQSM 2UYTA 1HLUA 5M1QA 2QXLA 2OTJN 2Q2RA 1LOTB 5BRFA 5F0XA 1C0GA 3VEVA 3HSCA 1MWKA 4BR4A 4WQ4C 2Q31A 1KAZA 4FWLA 2OANA 1NJIO 1K8KB 4BRGA 4C23A 4K25A 3PIPL 2F9TA 3N4QA 3EZWA 1NGEA 2W00A 2EWSA 5C2FA 4RCHA 3W3DA 2FSKA 5JMVA 4IXCA 4M63C 1HX1A 3M6GA 3O9SA 3DXKB 4WFBL 1E4GT 4IZ9A 4JKAA 1T44A 1TUUA 3P39A 1QQOA 4IEEA 2ZGZA 3LDPA 4XH4A 4AM7A 4CBUA 2QA4N 2D0OA 2YI1A 2AA4A 3CCUN 2W40A 3CHWA 3H3OB 1SAZA 2P9SA 3DXMB 5F1XA 3A5LC 3GDQA 5AQVA 4A2AA 5BPLA 3G6EN 4YOWA 5EX5A 3VEZA 1QVFM 1DGKN 4CZGA 1BG3A 4Z94A 3ZEUB 4C1NI 3F5TA 3CC4N 5TKYA 4QS9A 3GE1A 3HM8A 3WXIA 3O9UA 3I8BA 4K42A 4BC5A 4JKBA 3UB5A 5JICA 4QS8A 4C1NK 2P9UA 3C0BA 3A5OC 3WXKA 3J8AA 4IO9L 1XUPO 4KH4A 3MMVA 5C12A 3WEEB 1X9JA 3FLCO 3T7ZA 3E9PA 1QZ5A 1H1VA 2Q0RA 1YUWA 3MN9A 3E66A 4IJAA 3C6HA 3F2KA 3JXUA 1RFQA 4WF9L 1NM1A 1HKBA 1RDUA 2J4RA 4ILJA 4DHYA 4BRAA 4CBWA 3AY9A 3P38A 3GOIA 3P31A 4KH6A 1YF5L 5B8HA 3WQTA 5LY3A 3E9OA 5KPZA 4KBOA 4B9QA 1EQYA 3RSEB 4ISGA 3UKRB 2ASMA 2WC9A 3FZMA 2GX9A 1K8KA 1NMDA 5JVGL 2A40A 1Q86O 1SQKA 3VF2A 3O8MA 2E2NA 3F9MA 1GLFO 3RVCA 1K8AO 4IOCL 1LCUA 4BRIA 3IKMA 5MLCQ 4JKCA 2ITMA 3EE8A 1VQ9N 3CC2N 3HRGA 3G25A 1MA9B 3DXKA 1NGDA 3O1BA 3IDHA 1CZAN 1JJ2M 4NLBA 3CETA 3AGKA 4BRLA 3N4PA 5EY4A 5M1PA 3W0LA 3U4LA 4BRCA 2NZTA 1XQSC 5C2DA 3UKUB 3Q7BA 1YVNA 3CCVN 3QICA 3D2EB 3O1WA 1ILYA 4H5RA 3CCRN 3EKUA 3NMUA 5ADXH 1X3MA 3ZEUA 3HOSA 4YDUC 5GIOA 4PL8A 2YHXA 1KC8O 4IEIA 3SAGA 1K73O 4FWOA 3KWGA 2I7PA 5AQIA 3EL2A 3ULEB 3I55N 1RDWX 1GLJO 4AF1A 3CF5L 1V4SA 4BR0A 3C7NB 3U9ZA 3LDQA 2D4WA 4FSVA 2GELA 1W2BM 1BDGA 1BUPA 1NGAA 1S72N 5AQFA 5TKWA 4QS7A 4XH5A 4GNIA 3WEEA 2FSJA 1VQKN 2P9PB 4YOUA 3MCPA 5FPNA 4CZFA 5C15A 2GTDA 3WXMB 4BG8A 4B1VA 4FPAA 1ZXOA 2QI2A 1YI2N 2CGLA 1QVGM 2BTFA 4UY8O 4A5AA 4DCHA 2CH5A 5GIPA 3SAHA 3JS6A 3L4QA 3L0QA 4LC9B 3HOTA 3KHYA 2VYPA 3DWLA 3R6MA 1QQNA 1VQMN 1YITN 4JK7A 3ATUA 4CD1A 3RSEA 1U2VB 3UKRA 3R8EA 2VGNA 5GAGP 3MX5A 3BP8A 5M1OA 4A61A 2D0PA 2V52B 3SMPA 4JD2B 4JKGB 5M1FA 5HOOA 5FPDA 1V4TA 4OPAA 4BRKA 4FPBA 2WFBA 4H5TA 1GLLO 1KXPA 4MLEA 3VEYA 3VTHA 1YAGA 1BA1A 2YCHA 4ILHA 1ATNA 1YIJN 5KQDA 4GV9A 4WFNL 4CZMA 3ZETB 3H45C 2HMPA 2JWKA 4H03B 2HOEA 5FPEA 1TUYA 5JLFA 2YX6A 3OBWA 4JKHA 3VOVA 5CE3A 5GAHP 3UKUA 1QHAA 1QQMA 4JN4A 1KD1O 4IWVA 4EHUA 3D2EA 3MN6A 2P9LB 5KPTA 2GEMA 3CI5A 4PKGA 2IVNA 4BR7A 3HTVA 2VGMA 4H0YB 3R9PA 4BRFA 1BA0A 2E2OA 3CJAA 4GVEA 4IDHA 4A5BA 3J7ZO 1VQNN 4CBXA 1EO1A 3E9LA 2VWBA 3ULEA 2KHOA 2D1KA 1VAZA 2QWLA 4IFEA 4AM6A 5AQKA 4E1JA 4JK9A 3QFUA 5AFUH 3ID6A 3TSPA 4MO4A 2Q0UA 4EHTA 3C7NA 5AQYA 5M1NA 2WUSA 1Q82O 2C1GA 4KH5A 3LL3A 4BQLA 4O8KA 5AZJB 2HBKA 3WT0A 2Q36A 4JKDA 4WCEL 2E8AA 2IVOA 3A5MC 4JAXA 2QTDA 3VF4A 2P9PA 1Q81O 5BRDA 2QWMA 4BREA 3OHRA 3AGRA 2E1ZA 3VERA 1OKJA 2RE2A 4BRQA 5BPNA 4WQ5A 1VQON 1T3VA 5AZIB 3MDQA 3Q7CA 3ID8A 4FWNA 4OPHA 3VMFB 4EFHA 2CH6A 3AAQA 2HSTA 4BR2A 3KK7A 4CZJA 3CCMN 2FXUA 3CIPA 5BR9A 1T6DA 4HWIA 4B1WB 3BUZB 4U67L 2QWOA 4FL9A 4I6MB 4ISEA 1VQ6N 2E88A 2V7ZA 3QMLA 1U2VA 2ZF5O 5BPMA 1NGBA 1JCEA 2ZWHA 4WQ4A 2P9KB 3QBWA 3FE1A 2GUPA 4JD2A 3CJBA 1GLBG 1U6ZA 4JKGA 4PKHA 3SBTA 5DM6L 1Z05A 3C6AA 1Q18A 1YHQN 3MN5A 3H1QA 2PFUA 2IVPA 3SJHA 3U8XA 4H0PA 1KAXA 3B8AX 2CGJA 4YOYA 2NRXA 1GLAG 3LDNA 3ZETA 3LM2A 3SK3A 3CCLN 3H46O 4FOEA 3LM9A 5BN9A 4K43A 4MDAA 5AQWA 3NVMA 3A5NC 3VPZA 5KQ8A 3CMEN 3MCAB 3O9RA 2P9LA 1O13A 2WBNA 3M3ZA 5AQZA 3LDLA 4DQ8A 4NLCA 1ZC6A 3TTDA 3DXMA 5C0YA 5AQTA 4JEPA 4A62A 4CZKA 4G9ZA 4RTFD 3A8YA 3O9QA 4J8FA 1BO5O 3R1XA 4Y0WA 5AR0A 3UE5A 2NRWA 1RGIA 1HUXA 4JHDB 1K9MO 1GLEG 2FF6A 3O9TA 1YXQA 4BVPA 1SS6A 3CJ9A 1NGGA 5LJVA 2ZJQL 1YJ9N 5AZJA 5C10A 2NRRA 4PHTX 2Q1NA 5JVHL 5H1SQ 5AQLA 4YOVA 4WYBA 1NGHA 4YOXA 1Q7YO 3OBYA 4CI6A 3CCSN 4XEIA 2H3GX 1N8RO 1C0FA 1W97L 4BG9A 1YJNN 1VQ4N 5M1KA 3I33A 5AZIA 3FZKA 2F9WA 4RWTA 4FO0A 4BRNA 1BU6O 4BR5A 3OW2M 4O5FA 4H0VB 3C65A 5JLHA 1DEJA 1M1KO 1ESVA 4DB3A 2A5XA 2GWJA 2HF3A 4H0XB 5AQXA 4I6MA 3VGKA 2HBJA 4BEBA 4MLHA 2PAVA 3TPQA 4BGAA 3FR0A 1OVYA 5DM7L 3M5RA 3ENOA 4FWRA 4K41A 3H6EA 2P9KA 3WXJA 3CMAN 3FZLA 1YJWN 1VQ8N 4IJNA 1WUAA 2HBMA 2V7YA 3D6RA 4BR9A 2YHYA 1Z6RA 3S41A 4HTLA 2YHWA 4EIAA 3VTIA 3H1VX 2IIRA 3AAPA 3M1FA 2ZGYA 5EVZA 1SZ2A 3TTCA 5AQJA 3D7EO 5KPRA 3ATVA 4IOAL 1P90A 1JCGA 5E84A 3O6WA 2QWRA 2QEXN 4CD3A 4YOTA 1IG8A 2QW9A 1VQPN 3MX2A 2F7TA 3BF3A 2HF4A 4CZIA 1M90O 3EKSA 3TU5A 4NB4A 4DKWA 3VEWA 5BREA 4M7YA 2PBDA 5AQRA 3ZX0A 1HKCA 4L3QA 1E4FT 4YDUA 1QZ6A 3MN7A 1VQ5N 3O80A 4BRDA 4H5NA 4CZHA 2GWKA 1TYQB 4JHDA 4CZLA 4NO7A 4ISFA 3VETA 3IMXA 2FLOA 1S22A 4JNEA 3BF1A 3CJ7A 2RHKA 3IFRA 5F2RA 3WXLA 3QDKA 5HL7L 4BECA 2BUPA 5ELZA 3VGLA 2JWLA 5ADXA 3MK6A 1R59O 3ZX2A 3G71N 1J6ZA 4EAHD 4BRMA 2P9NB 1VQLN 1MWMA 3A0IX 4IO8A 3I56N 4R79A 2A41A 4B1XB 2CGKA 2E2QA 2A6AA 4WFAL 3D2FB 3FGUA 3CCEN 5CR4A 1NGIA 3KZBA 4A57A 3E1YA 4ILGB 2I7NA 3EE9A 1NLVA 1VQ7N 4GV3A 3VESA 1HPMA 2P9IB 5BN8A 4CJ7A 3O4WA 4FVUA 3FFKB 2FF3B 4FWMA 4CZEA 1X3NA 4U7BA 1IJJA 3CQXA 5I9EB 1NWKA 1D4XA 4PL7A 4BC3A 3K9KA 4H0TB 4BY9C 3H3NO 4JKFA 3NVKA 4FOIA 3WUHA 3CPWM 3KVGA 4BC4A 1G99A 3GL1A 4A59A 3MWPA 2C1IA 3SAFA 1GLDG 1ATRA 2W41A 5AQHA 1MDUB 2BH1A 3T69A 4BE7B 2NLXA 3P4IA 2ZJRL 1BOTO 3G4SN 1HKGA 4JKEA 4BQZA 3QBXA 5GAEP 2QWPA 4F9OA 3SMSA 2YJEA 2VCPA 3PIOL 1ATSA 5AQUA 4B1UB 4YORA 2DPNA 4B1YB 1GLCG 2KLAA 3SLCA 3WQUA 1TYQA 4BC2A 1NGJA 2NNWA 3IUCA 4MO5A 3CJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKI A;  5AQO A;  4A2B A;  4GY2 B;  3HZ6 A;  5AQG A;  3VF6 A;  1DKG D;  4B1Z A;  1WOQ A;  1S3X A;  3L4I A;  4FWS A;  5AQS A;  4FWQ A;  1NGC A;  3O5B A;  4M7X A;  4BRH A;  5AQM A;  3CJC A;  3FZH A;  3LDO A;  2P9N A;  3DJC A;  3U9D A;  5EXW A;  1NBW A;  5AFU A;  3QB0 A;  4BGB A;  1JCF A;  2V51 B;  3DAW A;  3D2F A;  3GBT A;  1T6C A;  3ENH A;  3HBT A;  5FPM A;  2P9S B;  4BRO A;  2FSN A;  3AAR A;  2QWN A;  4BRP A;  2E1Y A;  2QWQ A;  2E20 A;  2P9I A;  2Q97 A;  2E2P A;  3VEO A;  5AQP A;  5AQN A;  3O08 A;  2AP1 A;  2P9U B;  3VEN A;  5E26 A;  3HI0 A;  3QFP A;  2ASP A;  1KAY A;  5EOY A;  5BRH A;  3VEX A;  4H5W A;  2QM1 A;  1HJO A;  1P8Z A;  2ASO A;  3EN9 A;  2YJF A;  3EO3 A;  3GG4 A;  4FWP A;  3VGM A;  3ZX3 A;  3L6Q A;  1NGF A;  1ZBS A;  5LJW A;  4WQ5 C;  5AQQ A;  1BWF O;  3CER A;  2A3Z A;  4FWK A;  3CQY A;  4XH1 A;  3FZF A;  1Y64 A;  4H5V A;  4H0O A;  3BEX A;  4BVO A;  2A42 A;  2NRH A;  1XC3 A;  2UYT A;  1HLU A;  2QXL A;  2Q2R A;  1LOT B;  5BRF A;  5F0X A;  1C0G A;  3VEV A;  3HSC A;  1MWK A;  4BR4 A;  4WQ4 C;  2Q31 A;  1KAZ A;  4FWL A;  2OAN A;  1K8K B;  4BRG A;  4C23 A;  4K25 A;  2F9T A;  3EZW A;  1NGE A;  2EWS A;  4RCH A;  3W3D A;  2FSK A;  5JMV A;  4IXC A;  4M63 C;  1HX1 A;  3M6G A;  3DXK B;  1E4G T;  4IZ9 A;  1T44 A;  1TUU A;  4XH4 A;  1QQO A;  2ZGZ A;  3LDP A;  4AM7 A;  4CBU A;  2D0O A;  2YI1 A;  2AA4 A;  2W40 A;  3CHW A;  3H3O B;  1SAZ A;  2P9S A;  3DXM B;  5F1X A;  3A5L C;  3GDQ A;  5AQV A;  4A2A A;  5BPL A;  5EX5 A;  3VEZ A;  1DGK N;  4CZG A;  1BG3 A;  4Z94 A;  3ZEU B;  5TKY A;  4QS9 A;  3GE1 A;  3HM8 A;  3WXI A;  3I8B A;  4K42 A;  4BC5 A;  3UB5 A;  5JIC A;  4QS8 A;  2P9U A;  3C0B A;  3A5O C;  3WXK A;  3J8A A;  1XUP O;  3MMV A;  3WEE B;  1X9J A;  3FLC O;  1QZ5 A;  1H1V A;  2Q0R A;  1YUW A;  3MN9 A;  4IJA A;  3JXU A;  1RFQ A;  1NM1 A;  1HKB A;  2J4R A;  4DHY A;  4BRA A;  4CBW A;  3AY9 A;  3GOI A;  5B8H A;  3WQT A;  5LY3 A;  5KPZ A;  4KBO A;  4B9Q A;  1EQY A;  3RSE B;  4ISG A;  3UKR B;  2ASM A;  3FZM A;  1K8K A;  1NMD A;  2A40 A;  1SQK A;  3VF2 A;  3O8M A;  2E2N A;  3F9M A;  1GLF O;  1LCU A;  4BRI A;  2ITM A;  3G25 A;  1MA9 B;  3DXK A;  1NGD A;  3O1B A;  3IDH A;  1CZA N;  3CET A;  4BRL A;  5EY4 A;  3W0L A;  3U4L A;  4BRC A;  2NZT A;  1XQS C;  3UKU B;  1YVN A;  3QIC A;  3D2E B;  3O1W A;  4H5R A;  3EKU A;  5ADX H;  1X3M A;  3ZEU A;  4YDU C;  4PL8 A;  2YHX A;  4FWO A;  5AQI A;  2I7P A;  3ULE B;  3EL2 A;  1RDW X;  1GLJ O;  1V4S A;  4BR0 A;  3C7N B;  3U9Z A;  3LDQ A;  2D4W A;  4FSV A;  2GEL A;  1BDG A;  1BUP A;  1NGA A;  5AQF A;  4QS7 A;  4XH5 A;  4GNI A;  3WEE A;  2FSJ A;  2P9P B;  4CZF A;  3MCP A;  5FPN A;  2GTD A;  4BG8 A;  4B1V A;  4FPA A;  1ZXO A;  2CGL A;  2BTF A;  4DCH A;  2CH5 A;  3JS6 A;  3L0Q A;  4LC9 B;  3KHY A;  2VYP A;  3DWL A;  3R6M A;  1QQN A;  3ATU A;  4CD1 A;  3RSE A;  1U2V B;  3UKR A;  3R8E A;  3BP8 A;  4A61 A;  2D0P A;  2V52 B;  3SMP A;  4JD2 B;  5FPD A;  1V4T A;  4BRK A;  4FPB A;  4H5T A;  1GLL O;  1KXP A;  4MLE A;  3VEY A;  1YAG A;  1BA1 A;  2YCH A;  1ATN A;  5KQD A;  4CZM A;  3ZET B;  3H45 C;  2HMP A;  4H03 B;  2HOE A;  5FPE A;  1TUY A;  5JLF A;  3VOV A;  5CE3 A;  3UKU A;  1QHA A;  1QQM A;  4JN4 A;  4IWV A;  4EHU A;  3D2E A;  3MN6 A;  2P9L B;  5KPT A;  2GEM A;  3CI5 A;  4PKG A;  2IVN A;  4BR7 A;  3HTV A;  4H0Y B;  3R9P A;  4BRF A;  1BA0 A;  2E2O A;  3CJA A;  4CBX A;  2VWB A;  3ULE A;  2KHO A;  2D1K A;  2QWL A;  4AM6 A;  4E1J A;  5AQK A;  3QFU A;  5AFU H;  4MO4 A;  2Q0U A;  4EHT A;  3C7N A;  5AQY A;  2WUS A;  3LL3 A;  4BQL A;  4O8K A;  5AZJ B;  3WT0 A;  2Q36 A;  2E8A A;  2IVO A;  3A5M C;  4JAX A;  3VF4 A;  2P9P A;  5BRD A;  2QWM A;  4BRE A;  3OHR A;  3VER A;  2E1Z A;  1OKJ A;  4BRQ A;  5BPN A;  4WQ5 A;  5AZI B;  3MDQ A;  3ID8 A;  4FWN A;  4EFH A;  2CH6 A;  3AAQ A;  4BR2 A;  4CZJ A;  2FXU A;  3CIP A;  5BR9 A;  1T6D A;  4HWI A;  4B1W B;  3BUZ B;  2QWO A;  4FL9 A;  4I6M B;  4ISE A;  2E88 A;  2V7Z A;  3QML A;  1U2V A;  2ZF5 O;  5BPM A;  1NGB A;  1JCE A;  2ZWH A;  4WQ4 A;  2P9K B;  3QBW A;  3FE1 A;  2GUP A;  4JD2 A;  3CJB A;  1GLB G;  1U6Z A;  4PKH A;  1Z05 A;  1Q18 A;  3MN5 A;  3H1Q A;  3SJH A;  2IVP A;  3U8X A;  4H0P A;  1KAX A;  3B8A X;  2CGJ A;  1GLA G;  3LDN A;  3ZET A;  3LM2 A;  3SK3 A;  3H46 O;  4FOE A;  3LM9 A;  5BN9 A;  4K43 A;  5AQW A;  3A5N C;  3VPZ A;  5KQ8 A;  2P9L A;  3M3Z A;  5AQZ A;  3LDL A;  4DQ8 A;  1ZC6 A;  3DXM A;  5AQT A;  4CZK A;  4A62 A;  4RTF D;  3A8Y A;  4J8F A;  1BO5 O;  4Y0W A;  5AR0 A;  3UE5 A;  1RGI A;  1HUX A;  4JHD B;  1GLE G;  2FF6 A;  1YXQ A;  4BVP A;  3CJ9 A;  5LJV A;  1NGG A;  5AZJ A;  2Q1N A;  5AQL A;  4WYB A;  1NGH A;  4CI6 A;  4XEI A;  2H3G X;  1C0F A;  4BG9 A;  3I33 A;  5AZI A;  3FZK A;  2F9W A;  4RWT A;  4FO0 A;  4BRN A;  1BU6 O;  4BR5 A;  4O5F A;  4H0V B;  5JLH A;  1DEJ A;  1ESV A;  4DB3 A;  2A5X A;  2GWJ A;  2HF3 A;  4H0X B;  5AQX A;  4I6M A;  3VGK A;  4MLH A;  2PAV A;  3TPQ A;  4BGA A;  3FR0 A;  3ENO A;  4FWR A;  4K41 A;  3H6E A;  2P9K A;  3WXJ A;  3FZL A;  4IJN A;  1WUA A;  2V7Y A;  4BR9 A;  2YHY A;  1Z6R A;  3S41 A;  4HTL A;  2YHW A;  4EIA A;  3H1V X;  2IIR A;  3AAP A;  3M1F A;  2ZGY A;  5EVZ A;  1SZ2 A;  5AQJ A;  3D7E O;  5KPR A;  3ATV A;  1JCG A;  5E84 A;  3O6W A;  2QWR A;  4CD3 A;  1IG8 A;  2QW9 A;  3BF3 A;  2HF4 A;  4CZI A;  3EKS A;  3TU5 A;  4NB4 A;  3VEW A;  5BRE A;  4M7Y A;  2PBD A;  5AQR A;  3ZX0 A;  1HKC A;  4L3Q A;  1E4F T;  4YDU A;  1QZ6 A;  3MN7 A;  3O80 A;  4BRD A;  4H5N A;  4CZH A;  2GWK A;  1TYQ B;  4JHD A;  4CZL A;  4NO7 A;  4ISF A;  3VET A;  3IMX A;  2FLO A;  1S22 A;  4JNE A;  3BF1 A;  3CJ7 A;  3IFR A;  5F2R A;  3WXL A;  3QDK A;  2BUP A;  5ELZ A;  3VGL A;  5ADX A;  3MK6 A;  1R59 O;  3ZX2 A;  1J6Z A;  4EAH D;  4BRM A;  2P9N B;  1MWM A;  3A0I X;  4IO8 A;  2A41 A;  4B1X B;  2CGK A;  2E2Q A;  2A6A A;  3D2F B;  3FGU A;  1NGI A;  3KZB A;  2I7N A;  1NLV A;  3VES A;  1HPM A;  2P9I B;  5BN8 A;  4CJ7 A;  3O4W A;  3FFK B;  2FF3 B;  4FWM A;  4CZE A;  1X3N A;  1IJJ A;  3CQX A;  5I9E B;  1NWK A;  1D4X A;  4PL7 A;  4BC3 A;  4H0T B;  3H3N O;  4FOI A;  3WUH A;  3KVG A;  4BC4 A;  1G99 A;  3GL1 A;  1GLD G;  1ATR A;  2W41 A;  5AQH A;  1MDU B;  2NLX A;  3P4I A;  1BOT O;  1HKG A;  4BQZ A;  3QBX A;  2QWP A;  4F9O A;  3SMS A;  2YJE A;  2VCP A;  1ATS A;  5AQU A;  4B1U B;  2DPN A;  4B1Y B;  1GLC G;  3SLC A;  3WQU A;  1TYQ A;  4BC2 A;  1NGJ A;  3IUC A;  4MO5 A;  3CJ1 A; 
#chains in the Genus database with same CATH topology
 1L3V A;  4DFJ A;  3CD6 N;  5AQG A;  2GUI A;  1RBV A;  4B1Z A;  1S3X A;  3KJV A;  4FWS A;  1NGC A;  3NH2 A;  3KK1 A;  3LDO A;  4B3R K;  3U9D A;  1JLF A;  1NBW A;  2IC3 A;  3DAW A;  2ZJP L;  3D2F A;  3ENH A;  1WSH A;  4FK4 A;  3O4N A;  1Q9X A;  2P9I A;  3AVJ A;  3VEO A;  5GAD P;  2P5G A;  3CXC M;  2OTL N;  3QFP A;  1BI4 A;  3R3L A;  3CM6 A;  2ASP A;  3TSQ A;  5BRH A;  5FRO A;  1ZYQ A;  4H5W A;  4O0J A;  3EO3 A;  3SQ2 A;  4JK8 A;  4X65 K;  3OYE A;  2A3Z A;  4LFC K;  3CQY A;  3FZF A;  4H5V A;  5FLX O;  3U3G A;  1JLB A;  3NE6 A;  2UXC K;  4H4M A;  2OTJ N;  1RNH A;  3K5O A;  1LW0 A;  2VWJ A;  1NNE A;  2OAN A;  1NJI O;  3V9W A;  4BRG A;  1VHX A;  3PIP L;  2F9T A;  3EZW A;  2W00 A;  2EWS A;  1ZBU A;  5JMV A;  4HVJ A;  1HX1 A;  2KFN A;  4X62 K;  1E3M A;  4WFB L;  3NF6 A;  1E4G T;  1T44 A;  4CFC A;  4XH4 A;  4IEE A;  4CBU A;  3V9S A;  4O4G A;  1HNX K;  4DQQ A;  5EX5 A;  3VEZ A;  4Z4G A;  4Z94 A;  3LDS A;  3RR7 A;  3ALY A;  3F5T A;  3HM8 A;  3WXI A;  4CIG A;  2ITG A;  4M3R A;  4RW6 A;  3UB5 A;  3NH1 A;  4QS8 A;  3SUP A;  4DTR A;  4IFV A;  1RDD A;  4HUE A;  1J5O A;  1VSM A;  3WEE B;  3HXM A;  3T7Z A;  4ZTJ A;  3TAM A;  3C6H A;  3F2K A;  4B9U A;  4WF9 L;  1HKB A;  4ILJ A;  4DHY A;  1UA1 A;  3DOK A;  3LP1 A;  4CBW A;  3GOI A;  1JLC A;  3QES A;  1KRP A;  5B8H A;  1TKX A;  2D5R A;  5LY3 A;  4KBO A;  1UAX A;  4ISG A;  2GX9 A;  1Q86 O;  5JVG L;  1SQK A;  3VF2 A;  4OJR A;  4AH9 A;  3EEQ A;  1BQM A;  1VQ9 N;  4DV1 K;  4CHP A;  3HRG A;  4J2A A;  3NHG A;  1U4B A;  2Y1I A;  3W0L A;  5C2D A;  3F9K A;  3UKU B;  5KTQ A;  3DLB A;  3CCV N;  1LWE A;  2DTU A;  3QIC A;  4LF4 K;  4QCL A;  5HRR A;  1X3M A;  4V19 S;  1T8E A;  4FWO A;  5AQI A;  5KRT A;  4AF1 A;  3CF5 L;  4F2S A;  4BR0 A;  1EET A;  2B5J A;  1TVR A;  4CEC A;  3HL8 A;  2G8U A;  1BDG A;  3DRS A;  1NGA A;  3L3V A;  3ZSR A;  5AQF A;  5TKW A;  2PZS A;  3WEE A;  4CVN E;  2P9P B;  4DTN A;  4BG8 A;  2R7Y A;  4M3U A;  1TAU A;  1RT6 A;  1ZXO A;  4OLB A;  3AVI A;  2CH5 A;  4FJ7 A;  4LC9 B;  3HOT A;  3KHY A;  3DWL A;  1YIT N;  1JLE A;  4J2D A;  1TKZ A;  1FW6 A;  1U2V B;  1EX4 A;  4A61 A;  4CJS A;  1RDA A;  3SMP A;  2EHG A;  5HOO A;  1V4T A;  4FPB A;  2HVH A;  3T3F A;  3VTH A;  4ILH A;  1RCH A;  1ATN A;  1C1B A;  4DR4 K;  4H03 B;  1W9H A;  5FPE A;  4KFB A;  4CF2 A;  4JI4 K;  3OBW A;  3QNN A;  3UKU A;  1QHA A;  4CIF A;  3CFO A;  5KPT A;  1NU0 A;  2GEM A;  2BGG A;  2I5J A;  3TWH A;  1CXU A;  4BRF A;  3R9P A;  1BA0 A;  3CJA A;  3THW A;  1EO1 A;  4CBX A;  2KHO A;  1VAZ A;  2F4V K;  4N47 A;  1RTJ A;  4H4O A;  3MEE A;  5LMU K;  5AQY A;  3OYL A;  4KH5 A;  1QTM A;  2HMI A;  3LL3 A;  2XY7 A;  3WT0 A;  4WCE L;  2E8A A;  2QTD A;  1VSJ A;  2P9P A;  1Q81 O;  5BRD A;  1NOY A;  4CF9 A;  3AA2 A;  1XC9 A;  4FJM A;  1N32 K;  2B4J A;  3VER A;  4CK1 A;  1OH6 A;  1SL0 A;  4M3X A;  5AZI B;  1I3A A;  3Q7C A;  2XRI A;  3S5T A;  2HST A;  3KK7 A;  4CZJ A;  2E4L A;  3AA3 A;  4HWI A;  3BUZ B;  1VSF A;  2V7Z A;  1U2V A;  2ZF5 O;  3AVA A;  5BPM A;  4DWI A;  2ZWH A;  3SBT A;  3FE1 A;  4AHV A;  2ZQB A;  1RT5 A;  4X64 K;  1U6Z A;  3MN5 A;  3H1Q A;  4NCG A;  3SJH A;  4PUO A;  3OJS A;  4CHQ A;  4YOY A;  3K57 A;  2NRX A;  3TAQ A;  3G0Z A;  1KTQ A;  4FOE A;  3J80 O;  3VQ4 A;  3QET A;  4MDA A;  3NVM A;  3OYI A;  5KQ8 A;  5C24 A;  3CG7 A;  1O13 A;  3TAN A;  3M3Z A;  4DQ8 A;  4DSE A;  1ZC6 A;  3TTD A;  5AQT A;  3LAK A;  4RTF D;  3EYZ A;  3A8Y A;  2OYQ A;  2YV0 X;  3JAM O;  1HUX A;  4JHD B;  1BCM A;  1XHX A;  4HUG A;  3ZCM A;  5HRS A;  4GKJ K;  4KO0 A;  1YXQ A;  1NGG A;  5H1S Q;  5AQL A;  1KFD A;  1Q7Y O;  3CCS N;  4FM0 A;  4BE0 A;  1YJN N;  1VQ4 N;  5M1K A;  4IDK A;  5DK5 A;  5AZI A;  4CHN A;  3FZK A;  4BR5 A;  3TI0 A;  4O5F A;  5JLH A;  1DEJ A;  4E7K A;  4DB3 A;  2A5X A;  4OKE A;  1Z25 A;  4OPK A;  2FBX A;  1RDC A;  2PAV A;  3OYM A;  3M5R A;  1XHZ A;  4ELV A;  3CMA N;  1VQ8 N;  2YHB A;  3E01 A;  4M41 A;  4N5S A;  1SKR A;  2VQE K;  4HTL A;  3AAP A;  4LSN A;  3ATV A;  1JCG A;  4DR2 K;  4DV7 K;  2QWR A;  4B3T K;  1BHL A;  3BF3 A;  1J5E K;  3THX B;  3PX0 A;  1M90 O;  4ID1 A;  3OS0 A;  5BRE A;  4FJH A;  1VSE A;  5AQR A;  4N76 A;  1HKC A;  4W5T A;  4CEF A;  4YDU A;  2W6L A;  4PY5 A;  4ZTF A;  4CZH A;  2GWK A;  4JHD A;  4CZL A;  1UOC A;  4LF6 K;  3VET A;  4NYF A;  3BF1 A;  5F2R A;  4CF8 A;  1D8Y A;  1I39 A;  5KI6 A;  3K0S A;  2HHI A;  1EWR A;  3OYC A;  1VQL N;  4DQP A;  1MWM A;  3A0I X;  4R79 A;  4B1X B;  3AV9 A;  3SUN A;  2A1S A;  4WFA L;  1RBR A;  5CR4 A;  5D3G A;  1JL1 A;  4A57 A;  3DI6 A;  3BGR A;  3L2V A;  4NCB A;  4RW9 A;  1BIZ A;  3O4W A;  1IG9 A;  4FVU A;  2FF3 B;  4LFB K;  4CZE A;  1IJJ A;  1C0U A;  3CM5 A;  4B08 A;  4BC3 A;  3K9K A;  4BY9 C;  3CPW M;  4B9T A;  4BC4 A;  5KGW A;  4FJ5 A;  2OZS A;  1GLD G;  3THX A;  3QEV A;  2NLX A;  4WE1 A;  1HKG A;  1RT7 A;  3QBX A;  5J2Q A;  4F9O A;  2YJE A;  2B6A A;  5AQU A;  1JLA A;  4B1Y B;  4DFP A;  2RKI A;  1JLQ A;  2PYL A;  3WQU A;  4MFB A;  1ZBF A;  3MED A;  3CJ1 A;  2NRT A;  2OPR A;  4A2B A;  4GY2 B;  3L3U A;  4RW7 A;  4OO1 J;  3L2R A;  1NKB A;  2FBT A;  1WOQ A;  2HBL A;  4DR5 K;  1O1W A;  1R0A A;  4FWQ A;  4ICL A;  4I2Q A;  3TTF A;  2VG7 A;  4DTX A;  5AQM A;  2F8T A;  2G8F A;  3V81 A;  5EXW A;  4GV6 A;  4RG8 A;  4O8U A;  2V51 B;  2IGI A;  3GBT A;  3C6T A;  3TAF A;  4E1M A;  3RTV A;  1X9W A;  5FDL A;  1TGO A;  3I0R A;  5HRO A;  4BRP A;  4W5N A;  2QWQ A;  4KHN A;  5AQP A;  4CFD A;  4CK3 A;  3O08 A;  4IKF A;  2NUB A;  3IS9 A;  4FLV A;  5E26 A;  4KHW A;  3HI0 A;  1N5Y A;  3T19 A;  3C6U A;  3EY1 A;  5CYM A;  3TSU A;  3VEX A;  1HJO A;  4CGI A;  3K9J A;  2ASO A;  3VA3 A;  2KQ2 A;  1IKV A;  1TV6 A;  4I7F A;  1NGF A;  5LJW A;  4PQU A;  4WQ5 C;  4DFM A;  1VSL A;  4R5P A;  4XIU A;  1Y64 A;  3CPE A;  3NGZ A;  3U6F A;  5KGX A;  4ID5 A;  4JYA K;  2F8S A;  4BVO A;  3S3O A;  2A42 A;  3FFI A;  3MXI A;  1Y97 A;  4C8L A;  2UYT A;  1HLU A;  4OVL A;  1LOT B;  4TSX A;  1C0G A;  1I94 K;  2WON A;  2JGU A;  2KZZ A;  3AO5 A;  4RW4 A;  4W5O A;  3KLG A;  3N4Q A;  2FBY A;  3HPG A;  1NGE A;  3ZT0 A;  1S6P A;  3NDK A;  2OPS A;  4RCH A;  2FSK A;  4DS5 A;  1HJR A;  4IXC A;  3O9S A;  4DMN A;  1U48 A;  4IZ9 A;  1RT3 A;  1QQO A;  3QEP A;  2DFE A;  2YI1 A;  3VQ5 A;  4FM1 A;  1GOC A;  3H3O B;  3DXM B;  5F1X A;  3A5L C;  3G6E N;  1WSF A;  4F3T A;  1QVF M;  1BG3 A;  4C1N I;  3CC4 N;  3O9U A;  4JLH A;  3BZK A;  3VQP A;  4J2B A;  4GVM A;  1D5A A;  4KHP K;  3C0B A;  2OZM A;  4DSK A;  4IO9 L;  3MMV A;  4DV5 K;  3FLC O;  1H1V A;  4FJG A;  3CYM A;  1RTH A;  3JXU A;  1NJX A;  4DU1 A;  1NM1 A;  1L3S A;  1JLG A;  4BRA A;  3P31 A;  3RMB A;  3KK3 A;  2O4I A;  4KH6 A;  1IO2 A;  1OH8 A;  4BDY A;  3E9O A;  5KPZ A;  4B9Q A;  1EQY A;  2ASM A;  3FZM A;  3KIO A;  1QHT A;  1HQU A;  1GLF O;  2D0C A;  3F9M A;  3LP0 A;  1K8A O;  4IOC L;  3WNF A;  4DLE A;  4IG3 A;  3KLE A;  3HO1 A;  4CHY A;  3VQ9 A;  1N33 K;  1QE1 A;  1XNQ K;  3NBP A;  2XHB A;  1NGD A;  1S5J A;  3O1B A;  2Z1I A;  1JJ2 M;  4BRL A;  5EY4 A;  3AO4 A;  1SV5 A;  3D2E B;  1ILY A;  4H5R A;  2DFH A;  3V6D A;  3NMU A;  1A5X A;  4KHQ A;  5GIO A;  1S6Q A;  1KC8 O;  3OYH A;  1NJW A;  1K73 O;  3KWG A;  2O8B B;  3OJU A;  1RDW X;  3C7N B;  5EU7 A;  2D4W A;  1YTA A;  3HP9 A;  3O3H A;  1VQK N;  1WLJ A;  1RT2 A;  2YHA A;  4KI4 A;  3WNE A;  1OH5 A;  3WXM B;  3VQA A;  3ZT4 A;  4ELT A;  4KKO A;  1YI2 N;  1JXE A;  2BE2 A;  4DCH A;  5GIP A;  4JRP A;  1JXB A;  3JS6 A;  1QQC A;  5C25 A;  4DU3 A;  2VYP A;  3RMA A;  1RT1 A;  3AVF A;  4JK7 A;  4DV6 K;  5J2M A;  1WSG A;  2VGN A;  3QEX A;  3AVG A;  2KTQ A;  1DLO A;  5FPD A;  1UWB A;  2Z1J A;  2WFB A;  1GLL O;  4JI8 K;  3K59 A;  1BA1 A;  1YIJ N;  5KQD A;  4WFN L;  3ZET B;  4W5R A;  2IS3 A;  2JWK A;  4CEQ A;  5I42 A;  2HOE A;  3MEG A;  1S1V A;  4CJV A;  2YX6 A;  4JKH A;  5CE3 A;  3D2E A;  3ZT2 A;  2P9L B;  4O5B A;  3CI5 A;  4PKG A;  2IVN A;  4BR7 A;  1J54 A;  2VGM A;  4CJF A;  4CIE A;  1VQN N;  1EKE A;  2O8B A;  4IFE A;  4AM6 A;  2QWL A;  2UUB K;  4JK9 A;  2G8V A;  3TSP A;  4MO4 A;  2Q0U A;  3M8Q A;  3C7N A;  1X9S A;  5CYQ A;  5M1N A;  3OY9 A;  4LF9 K;  2WUS A;  5LMN K;  4B3S K;  2Q36 A;  1J53 A;  4JAX A;  4JI5 K;  3VF4 A;  3ZT1 A;  4ELU A;  4NXN K;  4KV8 A;  3AVL A;  2QWM A;  5JEN A;  4DQI A;  3OHR A;  1OKJ A;  2X6N A;  5BPN A;  5C42 A;  3ID8 A;  3P1G A;  4OPH A;  4EFH A;  3CIP A;  4W5Q A;  2XY8 A;  4ZHR A;  4ISE A;  2E88 A;  4CJT A;  1WSJ A;  4DSI A;  4WQ4 A;  1U49 A;  1SKW A;  3QBW A;  3OTO K;  4PKH A;  3S9H A;  3C6A A;  3QIN A;  4HUF A;  3SCX A;  2PFU A;  2IVP A;  4FLX A;  2HNZ A;  2CGJ A;  3IAY A;  3ZSO A;  1N36 K;  1GLA G;  1QSY A;  3ZET A;  2XY6 A;  3H46 O;  5SZT A;  3WNH A;  2P9L A;  3LDL A;  3SV4 A;  4Q0B A;  4CJP A;  2AJQ A;  4JEP A;  4A62 A;  3HPO A;  4CK2 A;  4YFU A;  5AR0 A;  3PO4 A;  3UE5 A;  2NRW A;  4B9S A;  3SNN A;  4FJK A;  4C8M A;  5J2P A;  2FF6 A;  2ZJQ L;  4BVP A;  1YJ9 N;  3CJ9 A;  5LJV A;  1N34 K;  4C8O A;  5JS1 A;  1BQN A;  4PHT X;  2Q1N A;  5JVH L;  3MAQ A;  4FYD A;  1NK7 A;  3AO2 A;  3DRR A;  3O3G A;  3OBY A;  4XEI A;  1C0F A;  1W97 L;  4KTQ A;  3NGY A;  3VA0 A;  3I33 A;  4FO0 A;  4BRN A;  2UXB K;  3OW2 M;  3C65 A;  1M1K O;  4B9V A;  5AQX A;  1HYV A;  5A2Q O;  4BGA A;  1QSS A;  1KSP A;  3OYB A;  1EXQ A;  3H6E A;  4CJE A;  3FZL A;  1TK0 A;  1WUA A;  2HBM A;  2OCE A;  1HR0 K;  3S41 A;  2YHW A;  2ATQ A;  2YNG A;  2GBZ A;  3VTI A;  5EVZ A;  3D7E O;  5KPR A;  4B3M K;  5E84 A;  4OPJ A;  4YOT A;  1HRH A;  2QW9 A;  3KKR A;  4CZI A;  4M3Z A;  3KLH A;  3PO5 A;  4FJI A;  3TU5 A;  4NB4 A;  4E1N A;  3VEW A;  2Y1J A;  2OPQ A;  3V9U A;  4CJW A;  4L3Q A;  1E4F T;  2VWK A;  1C0M A;  4CEA A;  4DTU A;  4H5N A;  4CHO A;  4E3S A;  3M8S A;  3NF9 A;  4FLZ A;  4JNE A;  1OVQ A;  4LH4 A;  2RHK A;  3JSM A;  3QDK A;  3UIQ A;  2BUP A;  5ELZ A;  2JWL A;  5ADX A;  3ZX2 A;  4GKK K;  3HK2 A;  3M8P A;  2P9N B;  3HP6 A;  2XY5 A;  1OH7 A;  3LZJ A;  4IO8 A;  3I56 N;  1T03 A;  2A6A A;  4YHH K;  4FJL A;  3CCE N;  3SQ4 A;  5IT9 O;  4ILG B;  4F8R A;  1DTQ A;  4GV3 A;  5BN8 A;  4CJ7 A;  4FWM A;  4IG0 A;  2HB5 A;  4I9Q A;  4CEO A;  5I9E B;  3JYT A;  3DLH A;  4EZ6 A;  4DQS A;  2KZM A;  4CGH A;  3GL1 A;  3MWP A;  1ATR A;  2E6L A;  1MDU B;  3MXM A;  3T69 A;  4BE7 B;  3P4I A;  4FLU A;  3V1R A;  3G4S N;  4JKE A;  4BQZ A;  4FZX C;  5DMR A;  3QIP A;  2YNI A;  3F73 A;  4K0K K;  2VCP A;  3PIO L;  1KLN A;  4M42 A;  3O4Q A;  3OYD A;  2KLA A;  4DSL A;  4BC2 A;  3ISN C;  1NGJ A;  1RIL A;  4FK2 A;  4DV4 K;  1Z26 A;  3S3N A;  1HYS A;  1IKY A;  1TK5 A;  5HP1 A;  4PKI A;  2DFF A;  4AQY K;  2P1J A;  4NXM K;  3HZ6 A;  3WNG A;  1SKS A;  3VF6 A;  4E0D A;  2P5O A;  1DTT A;  5AQS A;  2RN2 A;  1FKO A;  3O5B A;  4CGD A;  3SBG A;  3CJC A;  2P9N A;  3DJC A;  3MWT A;  5CHI A;  5GIN A;  4BGB A;  1JCF A;  3NFA A;  3ZT3 A;  1T6C A;  3HBT A;  3ZYY X;  5FPM A;  2P9S B;  1UA0 A;  4DV2 K;  3HM9 A;  4CEB A;  4BRO A;  4M45 A;  2FBV A;  3PLA A;  4HTU A;  2E20 A;  4Z4H A;  4KHS A;  3ZSV A;  3TAB A;  5AQN A;  1XMO K;  3OA9 A;  3SPZ A;  2AP1 A;  4CCH A;  3VEN A;  1DT9 A;  4EP5 A;  4K8X A;  4OX9 K;  2YJF A;  3DYA A;  3GG4 A;  4FWP A;  3ULD A;  3AVK A;  1NK9 A;  3L6Q A;  1VK0 A;  4MQ3 A;  5AQQ A;  4CE9 A;  4MDB A;  4FWK A;  3VQ8 A;  2NRV A;  1J9A A;  4XH1 A;  4E7I A;  1IBM K;  5FRN A;  4KPY A;  3BEX A;  4XJX A;  3KWI A;  2NRH A;  1XC3 A;  1KQS M;  1NK4 A;  2QXL A;  1CXQ A;  2Q2R A;  5BRF A;  3VEV A;  1MWK A;  2W6K A;  4BR4 A;  4FCY A;  1WBD A;  1KAZ A;  1YT3 A;  1K8K B;  4FVM A;  1NG9 A;  4K25 A;  3AVB A;  3C94 A;  5CY4 A;  4JI1 K;  4BDZ A;  4AHS A;  5C2F A;  3W3D A;  1HNZ K;  3DRP A;  1B92 A;  1NK5 A;  3M6G A;  3AVC A;  3VQC A;  3DLE A;  2QA4 N;  4JS5 A;  4AM7 A;  3AVH A;  4QAG A;  2D0O A;  2PYJ A;  2AA4 A;  3CCU N;  3K5M A;  3TAG A;  2P9S A;  5AQV A;  4A2A A;  5BPL A;  4YOW A;  2ZD1 A;  4PA1 A;  4CZG A;  2KW4 A;  4FM2 A;  2RPI A;  5TKY A;  4QS9 A;  3GE1 A;  4CF0 A;  3I8B A;  4K42 A;  1L3T A;  3RWU A;  3LP3 A;  1IV0 A;  3WXK A;  3J8A A;  1XUP O;  4EZ9 A;  3T1H K;  3OYJ A;  4IJA A;  4E7L A;  2G8K A;  1RDU A;  1T7P A;  2IDO A;  2J4R A;  1S9G A;  3AY9 A;  3HST B;  4I2P A;  4Z0U A;  5KRS A;  4LF8 K;  5J2N A;  3RSE B;  2P51 A;  4CF1 A;  4CGF A;  4DR3 K;  4CJQ A;  3DM2 A;  5J1E A;  4DLG A;  1K8K A;  1CZ9 A;  1HYZ A;  4CJ3 A;  3S3M A;  4HCB A;  4N41 A;  3O8M A;  2E2N A;  3KD5 E;  4JKC A;  3ZSX A;  4DTO A;  3EE8 A;  3M8R A;  3DLK A;  3IDH A;  4NLB A;  3CET A;  3AGK A;  4Z4C A;  4KRE A;  3HT3 A;  5M1P A;  1XQS C;  3ITH A;  3Q7B A;  1YVN A;  4FLW A;  3O1W A;  3LWM A;  3EKU A;  4NCA A;  5ADX H;  3RMD A;  1NOZ A;  3HOS A;  4YDU C;  4FJX A;  2YHX A;  2VQF K;  1NK8 A;  2I7P A;  4BAC A;  3HVT A;  3SI6 A;  2XO7 A;  3U9Z A;  3ZSY A;  2GEL A;  1W2B M;  3D45 A;  1BUP A;  2HHT A;  1HNI A;  1S72 N;  4QS7 A;  1KVA A;  1L3U A;  5I3U A;  1KCF A;  4XH5 A;  3PUF A;  2FSJ A;  4CZF A;  5FPN A;  4B1V A;  2ZE2 A;  2QI2 A;  2CGL A;  2BTF A;  3L0Q A;  4DTM A;  2F96 A;  3CFR A;  1HNV A;  2LSN A;  1QQN A;  3P5J A;  2E5L K;  3ATU A;  4CD1 A;  3RSE A;  4Q5V A;  5GAG P;  3MX5 A;  3BP8 A;  5M1O A;  3VQ7 A;  2V52 B;  3ASM A;  1S1T A;  4JKG B;  3V4I A;  1L5U A;  4BRK A;  3L2Q A;  3TAR A;  4H5T A;  1NK6 A;  4FJ9 A;  1S1W A;  4MLE A;  1YAG A;  4M3Y A;  3TR8 A;  4GV9 A;  1VRU A;  4CZM A;  3SYZ A;  3H45 C;  2HMP A;  1U45 A;  1CZB A;  4LY7 A;  5GAH P;  4JN4 A;  1QQM A;  1KD1 O;  5JS2 A;  4B9L A;  1ZBL A;  3KK2 A;  4JI3 K;  4A5B A;  3B6O A;  4GVE A;  3J7Z O;  3E9L A;  2VWB A;  3OVN A;  3ID6 A;  3RR8 A;  4EHT A;  4B9M A;  2C1G A;  1WSI A;  3ZSW A;  4BQL A;  4O8K A;  3PY8 A;  2HBK A;  3VQB A;  4BRE A;  4DUZ K;  1WB9 A;  3AGR A;  2E1Z A;  2RE2 A;  4BRQ A;  4NYN A;  1LWC A;  1ZBH A;  1T3V A;  3MDQ A;  3P83 D;  4FWN A;  1Q9Y A;  3AAQ A;  1BIS A;  4AHC A;  1T6D A;  3PV8 A;  2QKK A;  1NK0 A;  4B1W B;  4U67 L;  2QWO A;  4I6M B;  4AHT A;  1C0T A;  1JCE A;  3PX4 A;  2IOC A;  2P9K B;  2YKN A;  4LF7 K;  4JKG A;  5DM6 L;  4CED A;  1Q18 A;  1EP4 A;  3B6P A;  1KAX A;  3B8A X;  2OPP A;  1IKW A;  4DFK A;  3CCL N;  3O3F A;  4K43 A;  3A5N C;  3VPZ A;  2HHQ A;  1CLQ A;  3MCA B;  3O9R A;  4E19 A;  3V9Z A;  5HRN A;  5AQZ A;  1WSE A;  1A5W A;  3DXM A;  5C0Y A;  3O9Q A;  4J8F A;  4FK0 A;  3R1X A;  4CGG A;  1RGI A;  4B3O A;  1YVU A;  3O9T A;  4WYB A;  4CI6 A;  3T1Y K;  1N8R O;  2HND A;  4FJ8 A;  3QO9 A;  2F9W A;  4RWT A;  3QEI A;  4KTW A;  1ESV A;  2UU9 K;  2GWJ A;  2HF3 A;  3SV3 A;  4H0X B;  3VGK A;  4I6M A;  2HBJ A;  4KHU A;  3TPQ A;  3NH0 A;  2GV9 A;  1IH7 A;  5DM7 L;  4DR7 K;  2HHU A;  1HMV A;  2P9K A;  3WXJ A;  1YJW N;  4IJN A;  4BWJ A;  2V7Y A;  3D6R A;  4BR9 A;  4OLA A;  1Z6R A;  4DSJ A;  3OYK A;  3VQ6 A;  2UUC K;  3H1V X;  2IIR A;  3QIO A;  2Q3S A;  3TTC A;  1SZ2 A;  5AQJ A;  1W7A A;  1P90 A;  1LV5 A;  3O6W A;  2HVI A;  2QEX N;  1IG8 A;  4Z4I A;  2F7T A;  1K6Y A;  1QS4 A;  1VRT A;  2HF4 A;  5HBM A;  3EKS A;  4DR1 K;  4OKK A;  3OYF A;  3ZX0 A;  4F3O A;  3J7A P;  4OGE A;  1QZ6 A;  3CFP A;  4ISF A;  2FLO A;  3PSI A;  1TKD A;  1LAV A;  4BEC A;  5HL7 L;  4B8A B;  3MK6 A;  3LAM A;  4GMJ B;  1J6Z A;  4BRM A;  1LAW A;  1BIU A;  3MEC A;  4UQG A;  3TAE A;  3FGU A;  5T7B A;  4X66 K;  3AVN A;  1RBS A;  1NGI A;  4O55 A;  3CYG A;  3EE9 A;  1NLV A;  1VQ7 N;  1LWF A;  1HPM A;  3VES A;  3SQ1 A;  2D0A A;  3K5N A;  3SQ0 A;  2QKB A;  1WNS A;  3CQX A;  1NWK A;  4PL7 A;  3OYN A;  4H0T B;  3HVR A;  3H3N O;  4JKF A;  4FOI A;  3WUH A;  1G99 A;  4IBN A;  3U3Y A;  1IBK K;  2ZJR L;  1RTD A;  4O0I A;  4KTZ A;  5GAE P;  3RRG A;  2BDP A;  4JV5 K;  1ATS A;  4B1U B;  2YNH A;  2FC0 A;  4AIL C;  1G15 A;  2NNW A;  3IUC A;  4BWM A;  4K8Z A;  2ETJ A;  1WAJ A;  5AQO A;  2HHS A;  1DKG D;  1A5V A;  4N56 A;  1RDB A;  3L4I A;  1WAF A;  1FK9 A;  3KD1 E;  4M7X A;  5BR8 K;  2O8C B;  4BE1 A;  1BL3 A;  4BRH A;  1SUQ A;  2NRZ A;  1RBT A;  3FZH A;  3QNO A;  3LAL A;  3VQD A;  5AFU A;  3QB0 A;  4E89 A;  2O8D B;  3SJJ A;  2WOM A;  4CFB A;  4OGC A;  1LW2 A;  3BY5 A;  2O8E B;  3THW B;  3ZLJ A;  4C8N A;  4JS4 A;  2FSN A;  3AAR A;  4CJU A;  2PY5 A;  3CCJ N;  3HYF A;  2QWN A;  2E1Y A;  1VSI A;  2Q97 A;  2E2P A;  1VSH A;  3TAP A;  1ASU A;  1T05 A;  2P9U B;  4CJK A;  3K58 A;  3CC7 N;  4H8K A;  1KAY A;  5EOY A;  4IOX A;  3DLL L;  2QM1 A;  3ENB A;  1P8Z A;  2KKZ A;  3EN9 A;  2Z1H A;  3VGM A;  3ZX3 A;  3AO1 A;  1ZBS A;  4KHY A;  3KLI A;  1XWL A;  1BWF O;  3A2F A;  3CER A;  2A1R A;  1GOA A;  4CER A;  2IAJ A;  4DF4 A;  4H0O A;  3OS1 A;  2Z1G A;  3CCQ N;  4LH5 A;  4FXD A;  5M1Q A;  5F0X A;  3IRX A;  3HSC A;  4WQ4 C;  2Q31 A;  4FWL A;  5IWA K;  4C23 A;  3HPH A;  5AJ3 K;  4Z4E A;  3NF7 A;  2O8C A;  4E72 A;  3V9X A;  4M63 C;  1NMN A;  3DLR A;  3DXK B;  4JKA A;  1NKE A;  2JLE A;  2ZM6 K;  1TUU A;  3P39 A;  2ZGZ A;  3LDP A;  4EP4 A;  3CQ8 A;  2O8D A;  1GOB A;  3OS2 A;  3QEW A;  2W40 A;  2VG6 A;  3CHW A;  1SAZ A;  4CEZ A;  1D9D A;  4FW1 A;  2KFZ A;  3GDQ A;  4DQR A;  3DLG A;  2O8E A;  4DTJ A;  2VG5 A;  3KTQ A;  1DGK N;  3L8B A;  3ZEU B;  1U04 A;  3RRH A;  4BC5 A;  4JKB A;  4RW8 A;  4CEE A;  4CJL A;  5JIC A;  3NAE A;  2HW3 A;  4C1N K;  2P9U A;  4CW7 B;  3A5O C;  4L8R B;  3VN5 A;  3SZ2 A;  3MXJ A;  4KH4 A;  5C12 A;  1C6V A;  1X9J A;  3E9P A;  1QZ5 A;  2Q0R A;  1YUW A;  3MN9 A;  1BGX T;  3E66 A;  4DG1 A;  1RFQ A;  1HQE A;  3AA4 A;  4BE2 A;  3P38 A;  4FW2 A;  1KFS A;  1YF5 L;  3QLH A;  3LZI A;  3WQT A;  1FJG K;  2RF2 A;  4LF5 K;  1X1P A;  1B9D A;  3UKR B;  2WC9 A;  4DSF A;  1NMD A;  2A40 A;  3EZ5 A;  1S1X A;  3RVC A;  1LCU A;  4BRI A;  5HLF A;  1ITG A;  3IG1 A;  3IKM A;  5MLC Q;  2UUA K;  2ITM A;  3CC2 N;  3G25 A;  3AVM A;  1MA9 B;  3DXK A;  1CZA N;  1VSD A;  3H08 A;  4DV0 K;  1IKX A;  3N4P A;  3C95 A;  5CZ2 A;  3U4L A;  4BRC A;  2NZT A;  4JI0 K;  3HJF A;  5CZ1 A;  3QER A;  3CCR N;  4M3T A;  1JL2 A;  4FJN A;  3ZEU A;  4PL8 A;  4IEI A;  3SAG A;  3ULE B;  4BDP A;  3EL2 A;  1SL1 A;  1B9F A;  2X78 A;  3I55 N;  4JI7 K;  1GLJ O;  4FZY A;  1V4S A;  3LPT A;  4FLY A;  3LDQ A;  4B9N A;  4FSV A;  4LFA K;  1XI1 A;  1EWQ A;  3L2U A;  2D0B A;  4GNI A;  4FLT A;  4JRQ A;  5K14 A;  4YOU A;  3MCP A;  5C15 A;  2GTD A;  4F2R A;  3I0S A;  4FPA A;  1F21 A;  1QVG M;  4UY8 O;  4A5A A;  1C1C A;  1TL1 A;  3ZSQ A;  3SAH A;  1XMQ K;  3L4Q A;  4AHR A;  2HHH K;  3R6M A;  1TK8 A;  1VQM N;  3T1A A;  2O8F B;  2HNY A;  4M3W A;  4CHZ A;  3UKR A;  3R8E A;  4YNQ A;  2D0P A;  4JD2 B;  2YKM A;  5M1F A;  4JI2 K;  4OPA A;  1TKT A;  4CGJ A;  1KXP A;  1ASW A;  3VEY A;  2YCH A;  2E6M A;  4PWD A;  1W0H A;  1TUY A;  5JLF A;  3PSF A;  4DUY K;  3VOV A;  1QSL A;  4IWV A;  4EHU A;  3MN6 A;  1C1A A;  3HTV A;  1HPZ A;  4H0Y B;  2E2O A;  4IDH A;  1FKP A;  1VSK A;  1TAQ A;  1KVC A;  3ULE A;  2D1K A;  4E1J A;  5AQK A;  3QFU A;  5AFU H;  4Y1D A;  4CJ4 A;  1Q82 O;  2W42 A;  3NF8 A;  5AZJ B;  4JI6 K;  4JKD A;  4IFY A;  3A5M C;  2IVO A;  3AO3 A;  1NKC A;  2X6S A;  3J7Y P;  3NGI A;  4Y1C A;  4WQ5 A;  1VQO N;  3SPY A;  1SL2 A;  3VMF B;  2CH6 A;  2EX3 A;  3DOL A;  4KB0 A;  4BR2 A;  3CCM N;  3SUO A;  2FXU A;  5BR9 A;  4E7J A;  3L2W A;  4DR6 K;  4FL9 A;  2O8F A;  1VQ6 N;  4E7H A;  3QML A;  4CJR A;  1NGB A;  1REV A;  1U47 A;  2GUP A;  4JD2 A;  3CJB A;  1GLB G;  3V1Q A;  1Z05 A;  2BAN A;  2G8H A;  1YHQ N;  4B8C A;  3D0P A;  3U8X A;  1TL3 A;  5LL6 Z;  4H0P A;  1ASV A;  3KLF A;  3LDN A;  4Z4F A;  3LM2 A;  3SK3 A;  3V1O A;  4I9L A;  3KKS A;  1XNR K;  2DY4 A;  3LM9 A;  5BN9 A;  5AQW A;  3LAN A;  4LD0 A;  3SUQ A;  3CME N;  3OYA A;  4YY3 K;  2WBN A;  4QOZ B;  3I8D A;  4NLC A;  3K5L A;  4CZK A;  4G9Z A;  1BO5 O;  4O44 A;  4Y0W A;  1S9E A;  5E41 A;  1NJZ A;  1MU2 A;  1K9M O;  1GLE G;  1SS6 A;  5AZJ A;  5C10 A;  2NRR A;  2O4G A;  1FXX A;  4YOV A;  2WTU A;  1NGH A;  4YOX A;  2H3G X;  4BG9 A;  1BCO A;  1IBL K;  3LP2 A;  4KI6 A;  3THY B;  1BU6 O;  2YNF A;  2HHW A;  1Q8I A;  4DU4 A;  4H0V B;  4HHT A;  2HHV A;  4AHU A;  4BEB A;  4MLH A;  3AA5 X;  3BZC A;  3FR0 A;  1OVY A;  3ENO A;  4FWR A;  4K41 A;  4DS4 A;  3NCI A;  2G8W A;  3VQE A;  4GW6 A;  2YHY A;  3OYG A;  4DF8 A;  4EIA A;  5FRM A;  3M1F A;  1ZBI A;  2ZGY A;  4IOA L;  5SWM A;  3BDP A;  4CD3 A;  1HNW K;  1VQP N;  2HHX A;  3MX2 A;  4DTP A;  4DV3 K;  2X74 A;  4DKW A;  4M7Y A;  2PBD A;  3THV A;  3MN7 A;  1VQ5 N;  3O80 A;  4BRD A;  3K2P A;  1TYQ B;  4KB1 A;  4NO7 A;  3PX6 A;  4J2E A;  3IMX A;  1D9F A;  1S22 A;  4CJ5 A;  3LPU A;  3CJ7 A;  3ZSZ A;  3LWL A;  3J81 O;  3IFR A;  3WXL A;  4CES A;  5HRP A;  2QXF A;  3VGL A;  4G1Q A;  1R59 O;  3G71 N;  4EAH D;  1N6Q A;  3THY A;  1NJY A;  2A41 A;  2CGK A;  2E2Q A;  4FJJ A;  4FZZ A;  1YTU A;  3D2F B;  4HCC A;  3DMJ A;  1RTI A;  3KZB A;  3E1Y A;  4F4K A;  1WBB A;  4KRF A;  2I7N A;  4OKJ A;  4CFA A;  1X9M A;  2P9I B;  3VQQ A;  3FFK B;  1S1U A;  1X3N A;  4U7B A;  4C8K A;  1D4X A;  2UXD K;  1BI4 B;  1WN7 A;  4LSL A;  3NVK A;  3RMC A;  3KVG A;  2QK9 A;  4A59 A;  2C1I A;  4KAZ A;  3SAF A;  1JKH A;  2W41 A;  5AQH A;  3G10 A;  2BH1 A;  2G8I A;  1BOT O;  2QWP A;  4DTS A;  3SMS A;  1RBU A;  1RT4 A;  2DPN A;  4YOR A;  1KLM A;  2OA8 A;  1GLC G;  3SLC A;  1TYQ A;  1KVB A;  4MO5 A; 
#chains in the Genus database with same CATH homology
 4PKI A;  2NRT A;  5AQO A;  4A2B A;  3CD6 N;  4GY2 B;  3HZ6 A;  5AQG A;  3VF6 A;  4OO1 J;  1DKG D;  2HBL A;  1WOQ A;  4B1Z A;  1S3X A;  3L4I A;  4FWS A;  5AQS A;  4FWQ A;  1NGC A;  3O5B A;  4M7X A;  3SBG A;  3TTF A;  4BRH A;  5AQM A;  3CJC A;  2NRZ A;  3FZH A;  3LDO A;  2P9N A;  3DJC A;  3MWT A;  3U9D A;  5CHI A;  5EXW A;  5GIN A;  4GV6 A;  1NBW A;  5AFU A;  3QB0 A;  4O8U A;  1JCF A;  2V51 B;  4BGB A;  3DAW A;  2ZJP L;  3D2F A;  3GBT A;  1T6C A;  3ENH A;  3HBT A;  5FPM A;  3ZYY X;  2P9S B;  4BRO A;  2FSN A;  3AAR A;  3CCJ N;  2QWN A;  4BRP A;  2E1Y A;  2QWQ A;  3PLA A;  2E20 A;  2P9I A;  2Q97 A;  2E2P A;  3VEO A;  5AQP A;  5AQN A;  5GAD P;  3O08 A;  3OA9 A;  3CXC M;  2AP1 A;  2OTL N;  2P9U B;  3VEN A;  5E26 A;  3CC7 N;  3HI0 A;  1DT9 A;  3QFP A;  3R3L A;  2ASP A;  1KAY A;  5EOY A;  3TSQ A;  5BRH A;  4IOX A;  3TSU A;  4H5W A;  3VEX A;  3DLL L;  2QM1 A;  1HJO A;  3ENB A;  3K9J A;  1P8Z A;  2ASO A;  2KKZ A;  3EN9 A;  2YJF A;  3EO3 A;  3GG4 A;  4FWP A;  3VGM A;  3ZX3 A;  3L6Q A;  1NGF A;  1ZBS A;  4JK8 A;  5LJW A;  4WQ5 C;  5AQQ A;  1BWF O;  3CER A;  4MDB A;  2A3Z A;  4FWK A;  2NRV A;  3CQY A;  4XH1 A;  3FZF A;  1Y64 A;  3CPE A;  4H0O A;  4H5V A;  3CCQ N;  3BEX A;  4BVO A;  4XJX A;  2A42 A;  2NRH A;  3KWI A;  1XC3 A;  1KQS M;  2UYT A;  1HLU A;  5M1Q A;  2QXL A;  2OTJ N;  2Q2R A;  1LOT B;  5BRF A;  5F0X A;  1C0G A;  3VEV A;  3HSC A;  1MWK A;  4BR4 A;  4WQ4 C;  2Q31 A;  1KAZ A;  4FWL A;  2OAN A;  1NJI O;  1K8K B;  4BRG A;  4C23 A;  4K25 A;  3PIP L;  2F9T A;  3N4Q A;  3EZW A;  1NGE A;  2W00 A;  2EWS A;  5C2F A;  4RCH A;  3W3D A;  2FSK A;  5JMV A;  4IXC A;  4M63 C;  1HX1 A;  3M6G A;  3O9S A;  3DXK B;  4WFB L;  1E4G T;  4IZ9 A;  4JKA A;  1T44 A;  1TUU A;  3P39 A;  1QQO A;  4IEE A;  2ZGZ A;  3LDP A;  4XH4 A;  4AM7 A;  4CBU A;  2QA4 N;  2D0O A;  2YI1 A;  2AA4 A;  3CCU N;  2W40 A;  3CHW A;  3H3O B;  1SAZ A;  2P9S A;  3DXM B;  5F1X A;  3A5L C;  3GDQ A;  5AQV A;  4A2A A;  5BPL A;  3G6E N;  4YOW A;  5EX5 A;  3VEZ A;  1QVF M;  1DGK N;  4CZG A;  1BG3 A;  4Z94 A;  3ZEU B;  4C1N I;  3F5T A;  3CC4 N;  5TKY A;  4QS9 A;  3GE1 A;  3HM8 A;  3WXI A;  3O9U A;  3I8B A;  4K42 A;  4BC5 A;  4JKB A;  3UB5 A;  5JIC A;  4QS8 A;  4C1N K;  2P9U A;  3C0B A;  3A5O C;  3WXK A;  3J8A A;  4IO9 L;  1XUP O;  4KH4 A;  3MMV A;  5C12 A;  3WEE B;  1X9J A;  3FLC O;  3T7Z A;  3E9P A;  1QZ5 A;  1H1V A;  2Q0R A;  1YUW A;  3MN9 A;  3E66 A;  4IJA A;  3C6H A;  3F2K A;  3JXU A;  1RFQ A;  4WF9 L;  1NM1 A;  1HKB A;  1RDU A;  2J4R A;  4ILJ A;  4DHY A;  4BRA A;  4CBW A;  3AY9 A;  3P38 A;  3GOI A;  3P31 A;  4KH6 A;  1YF5 L;  5B8H A;  3WQT A;  5LY3 A;  3E9O A;  5KPZ A;  4KBO A;  4B9Q A;  1EQY A;  3RSE B;  4ISG A;  3UKR B;  2ASM A;  2WC9 A;  3FZM A;  2GX9 A;  1K8K A;  1NMD A;  5JVG L;  2A40 A;  1Q86 O;  1SQK A;  3VF2 A;  3O8M A;  2E2N A;  3F9M A;  1GLF O;  3RVC A;  1K8A O;  4IOC L;  1LCU A;  4BRI A;  3IKM A;  5MLC Q;  4JKC A;  2ITM A;  3EE8 A;  1VQ9 N;  3CC2 N;  3HRG A;  3G25 A;  1MA9 B;  3DXK A;  1NGD A;  3O1B A;  3IDH A;  1CZA N;  1JJ2 M;  4NLB A;  3CET A;  3AGK A;  4BRL A;  3N4P A;  5EY4 A;  5M1P A;  3W0L A;  3U4L A;  4BRC A;  2NZT A;  1XQS C;  5C2D A;  3UKU B;  3Q7B A;  1YVN A;  3CCV N;  3QIC A;  3D2E B;  3O1W A;  1ILY A;  4H5R A;  3CCR N;  3EKU A;  3NMU A;  5ADX H;  1X3M A;  3ZEU A;  3HOS A;  4YDU C;  5GIO A;  4PL8 A;  2YHX A;  1KC8 O;  4IEI A;  3SAG A;  1K73 O;  4FWO A;  3KWG A;  2I7P A;  5AQI A;  3EL2 A;  3ULE B;  3I55 N;  1RDW X;  1GLJ O;  4AF1 A;  3CF5 L;  1V4S A;  4BR0 A;  3C7N B;  3U9Z A;  3LDQ A;  2D4W A;  4FSV A;  2GEL A;  1W2B M;  1BDG A;  1BUP A;  1NGA A;  1S72 N;  5AQF A;  5TKW A;  4QS7 A;  4XH5 A;  4GNI A;  3WEE A;  2FSJ A;  1VQK N;  2P9P B;  4YOU A;  3MCP A;  5FPN A;  4CZF A;  5C15 A;  2GTD A;  3WXM B;  4BG8 A;  4B1V A;  4FPA A;  1ZXO A;  2QI2 A;  1YI2 N;  2CGL A;  1QVG M;  2BTF A;  4UY8 O;  4A5A A;  4DCH A;  2CH5 A;  5GIP A;  3SAH A;  3JS6 A;  3L4Q A;  3L0Q A;  4LC9 B;  3HOT A;  3KHY A;  2VYP A;  3DWL A;  3R6M A;  1QQN A;  1VQM N;  1YIT N;  4JK7 A;  3ATU A;  4CD1 A;  3RSE A;  1U2V B;  3UKR A;  3R8E A;  2VGN A;  5GAG P;  3MX5 A;  3BP8 A;  5M1O A;  4A61 A;  2D0P A;  2V52 B;  3SMP A;  4JD2 B;  4JKG B;  5M1F A;  5HOO A;  5FPD A;  1V4T A;  4OPA A;  4BRK A;  4FPB A;  2WFB A;  4H5T A;  1GLL O;  1KXP A;  4MLE A;  3VEY A;  3VTH A;  1YAG A;  1BA1 A;  2YCH A;  4ILH A;  1ATN A;  1YIJ N;  5KQD A;  4GV9 A;  4WFN L;  4CZM A;  3ZET B;  3H45 C;  2HMP A;  2JWK A;  4H03 B;  2HOE A;  5FPE A;  1TUY A;  5JLF A;  2YX6 A;  3OBW A;  4JKH A;  3VOV A;  5CE3 A;  5GAH P;  3UKU A;  1QHA A;  1QQM A;  4JN4 A;  1KD1 O;  4IWV A;  4EHU A;  3D2E A;  3MN6 A;  2P9L B;  5KPT A;  2GEM A;  3CI5 A;  4PKG A;  2IVN A;  4BR7 A;  3HTV A;  2VGM A;  4H0Y B;  3R9P A;  4BRF A;  1BA0 A;  2E2O A;  3CJA A;  4GVE A;  4IDH A;  4A5B A;  3J7Z O;  1VQN N;  4CBX A;  1EO1 A;  3E9L A;  2VWB A;  3ULE A;  2KHO A;  2D1K A;  1VAZ A;  2QWL A;  4IFE A;  4AM6 A;  5AQK A;  4E1J A;  4JK9 A;  3QFU A;  5AFU H;  3ID6 A;  3TSP A;  4MO4 A;  2Q0U A;  4EHT A;  3C7N A;  5AQY A;  5M1N A;  2WUS A;  1Q82 O;  2C1G A;  4KH5 A;  3LL3 A;  4BQL A;  4O8K A;  5AZJ B;  2HBK A;  3WT0 A;  2Q36 A;  4JKD A;  4WCE L;  2E8A A;  2IVO A;  3A5M C;  4JAX A;  2QTD A;  3VF4 A;  2P9P A;  1Q81 O;  5BRD A;  2QWM A;  4BRE A;  3OHR A;  3AGR A;  2E1Z A;  3VER A;  1OKJ A;  2RE2 A;  4BRQ A;  5BPN A;  4WQ5 A;  1VQO N;  1T3V A;  5AZI B;  3MDQ A;  3Q7C A;  3ID8 A;  4FWN A;  4OPH A;  3VMF B;  4EFH A;  2CH6 A;  3AAQ A;  2HST A;  4BR2 A;  3KK7 A;  4CZJ A;  3CCM N;  2FXU A;  3CIP A;  5BR9 A;  1T6D A;  4HWI A;  4B1W B;  3BUZ B;  4U67 L;  2QWO A;  4FL9 A;  4I6M B;  4ISE A;  1VQ6 N;  2E88 A;  2V7Z A;  3QML A;  1U2V A;  2ZF5 O;  5BPM A;  1NGB A;  1JCE A;  2ZWH A;  4WQ4 A;  2P9K B;  3QBW A;  3FE1 A;  2GUP A;  4JD2 A;  3CJB A;  1GLB G;  1U6Z A;  4JKG A;  4PKH A;  3SBT A;  5DM6 L;  1Z05 A;  3C6A A;  1Q18 A;  1YHQ N;  3MN5 A;  3H1Q A;  2PFU A;  2IVP A;  3SJH A;  3U8X A;  4H0P A;  1KAX A;  3B8A X;  2CGJ A;  4YOY A;  2NRX A;  1GLA G;  3LDN A;  3ZET A;  3LM2 A;  3SK3 A;  3CCL N;  3H46 O;  4FOE A;  3LM9 A;  5BN9 A;  4K43 A;  4MDA A;  5AQW A;  3NVM A;  3A5N C;  3VPZ A;  5KQ8 A;  3CME N;  3MCA B;  3O9R A;  2P9L A;  1O13 A;  2WBN A;  3M3Z A;  5AQZ A;  3LDL A;  4DQ8 A;  4NLC A;  1ZC6 A;  3TTD A;  3DXM A;  5C0Y A;  5AQT A;  4JEP A;  4A62 A;  4CZK A;  4G9Z A;  4RTF D;  3A8Y A;  3O9Q A;  4J8F A;  1BO5 O;  3R1X A;  4Y0W A;  5AR0 A;  3UE5 A;  2NRW A;  1RGI A;  1HUX A;  4JHD B;  1K9M O;  1GLE G;  2FF6 A;  3O9T A;  1YXQ A;  4BVP A;  1SS6 A;  3CJ9 A;  1NGG A;  5LJV A;  2ZJQ L;  1YJ9 N;  5AZJ A;  5C10 A;  2NRR A;  4PHT X;  2Q1N A;  5JVH L;  5H1S Q;  5AQL A;  4YOV A;  4WYB A;  1NGH A;  4YOX A;  1Q7Y O;  3OBY A;  4CI6 A;  3CCS N;  4XEI A;  2H3G X;  1N8R O;  1C0F A;  1W97 L;  4BG9 A;  1YJN N;  1VQ4 N;  5M1K A;  3I33 A;  5AZI A;  3FZK A;  2F9W A;  4RWT A;  4FO0 A;  4BRN A;  1BU6 O;  4BR5 A;  3OW2 M;  4O5F A;  4H0V B;  3C65 A;  5JLH A;  1DEJ A;  1M1K O;  1ESV A;  4DB3 A;  2A5X A;  2GWJ A;  2HF3 A;  4H0X B;  5AQX A;  4I6M A;  3VGK A;  2HBJ A;  4BEB A;  4MLH A;  2PAV A;  3TPQ A;  4BGA A;  3FR0 A;  1OVY A;  5DM7 L;  3M5R A;  3ENO A;  4FWR A;  4K41 A;  3H6E A;  2P9K A;  3WXJ A;  3CMA N;  3FZL A;  1YJW N;  1VQ8 N;  4IJN A;  1WUA A;  2HBM A;  2V7Y A;  3D6R A;  4BR9 A;  2YHY A;  1Z6R A;  3S41 A;  4HTL A;  2YHW A;  4EIA A;  3VTI A;  3H1V X;  2IIR A;  3AAP A;  3M1F A;  2ZGY A;  5EVZ A;  1SZ2 A;  3TTC A;  5AQJ A;  3D7E O;  5KPR A;  3ATV A;  4IOA L;  1P90 A;  1JCG A;  5E84 A;  3O6W A;  2QWR A;  2QEX N;  4CD3 A;  4YOT A;  1IG8 A;  2QW9 A;  1VQP N;  3MX2 A;  2F7T A;  3BF3 A;  2HF4 A;  4CZI A;  1M90 O;  3EKS A;  3TU5 A;  4NB4 A;  4DKW A;  3VEW A;  5BRE A;  4M7Y A;  2PBD A;  5AQR A;  3ZX0 A;  1HKC A;  4L3Q A;  1E4F T;  4YDU A;  1QZ6 A;  3MN7 A;  1VQ5 N;  3O80 A;  4BRD A;  4H5N A;  4CZH A;  2GWK A;  1TYQ B;  4JHD A;  4CZL A;  4NO7 A;  4ISF A;  3VET A;  3IMX A;  2FLO A;  1S22 A;  4JNE A;  3BF1 A;  3CJ7 A;  2RHK A;  3IFR A;  5F2R A;  3WXL A;  3QDK A;  5HL7 L;  4BEC A;  2BUP A;  5ELZ A;  3VGL A;  2JWL A;  5ADX A;  3MK6 A;  1R59 O;  3ZX2 A;  3G71 N;  1J6Z A;  4EAH D;  4BRM A;  2P9N B;  1VQL N;  1MWM A;  3A0I X;  4IO8 A;  3I56 N;  4R79 A;  2A41 A;  4B1X B;  2CGK A;  2E2Q A;  2A6A A;  4WFA L;  3D2F B;  3FGU A;  3CCE N;  5CR4 A;  1NGI A;  3KZB A;  4A57 A;  3E1Y A;  4ILG B;  2I7N A;  3EE9 A;  1NLV A;  1VQ7 N;  4GV3 A;  3VES A;  1HPM A;  2P9I B;  5BN8 A;  4CJ7 A;  3O4W A;  4FVU A;  3FFK B;  2FF3 B;  4FWM A;  4CZE A;  1X3N A;  4U7B A;  1IJJ A;  3CQX A;  5I9E B;  1NWK A;  1D4X A;  4PL7 A;  4BC3 A;  3K9K A;  4H0T B;  4BY9 C;  3H3N O;  4JKF A;  3NVK A;  4FOI A;  3WUH A;  3CPW M;  3KVG A;  4BC4 A;  1G99 A;  3GL1 A;  4A59 A;  3MWP A;  2C1I A;  3SAF A;  1GLD G;  1ATR A;  2W41 A;  5AQH A;  1MDU B;  2BH1 A;  3T69 A;  4BE7 B;  2NLX A;  3P4I A;  2ZJR L;  1BOT O;  3G4S N;  1HKG A;  4JKE A;  4BQZ A;  3QBX A;  5GAE P;  2QWP A;  4F9O A;  3SMS A;  2YJE A;  2VCP A;  3PIO L;  1ATS A;  5AQU A;  4B1U B;  4YOR A;  2DPN A;  4B1Y B;  1GLC G;  2KLA A;  3SLC A;  3WQU A;  1TYQ A;  4BC2 A;  1NGJ A;  2NNW A;  3IUC A;  4MO5 A;  3CJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...