1YVNA

The yeast actin val 159 asn mutant complex with human gelsolin segment 1.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
372
structure length
372
Chain Sequence
EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGNTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast actin V159N mutant
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords PROTEIN (ACTIN)
total genus 114
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 1999-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1yvnA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yvnA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1yvnA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1yvnA04
1WOQA 4M63C 2HOEA 5AQSA 4FL9A 4CZKA 3H3OB 4CZGA 3UKUA 3WEEA 3A5LC 2CGJA 4GY2B 1JCEA 3J8AA 4BRPA 2NRHA 2YJEA 4CI6A 2E2QA 2IIRA 3CJ7A 1SAZA 3VF2A 3FZFA 4QS9A 3D2EA 1ZBSA 2ASPA 1Z6RA 1QQMA 4MLEA 4Y0WA 5AQIA 1NGHA 4BGBA 1HPMA 4FOIA 5AQXA 1GLJO 3VF6A 4IXCA 3VF4A 4BRFA 3A5MC 4PKHA 1YUWA 3FLCO 4CZLA 1BOTO 4BRCA 3ZX3A 3IFRA 4K42A 3QICA 1BU6O 1DKGD 4H0OA 1SQKA 2DPNA 1JCGA 4BRHA 5AZJB 1J6ZA 3O1BA 2V7ZA 4BR2A 2QWNA 3H46O 3M1FA 3FFKB 4WQ4A 4BGAA 2QWPA 4BC5A 4B1VA 2D4WA 2FSJA 3CJ9A 1U2VA 3F9MA 5AQPA 5AZIA 5TKYA 2QW9A 4JHDA 3D2EB 1GLCG 4O5FA 1T44A 1T6CA 5AQZA 2E1YA 1K8KA 3AAQA 3VEYA 5F1XA 1E4FT 1DEJA 3FZKA 3EL2A 4B1XB 2ASMA 3ATVA 2P9IB 3I8BA 4IWVA 3D7EO 1XC3A 2P9KB 1P8ZA 1RFQA 3LM2A 3A5OC 1NGCA 3U9ZA 3QBWA 3EZWA 3IDHA 2VWBA 1SZ2A 3DXKB 3BEXA 3HBTA 3A0IX 3M6GA 3WXLA 4CD1A 3RSEA 5AQFA 3ZX2A 5KQDA 3CIPA 4H0YB 3VEXA 5AQNA 1U2VB 5FPEA 5KQ8A 5ADXH 2A41A 1KAYA 5JMVA 2I7PA 3FZMA 3O8MA 5BRDA 3BF1A 5AQYA 4DB3A 5AQTA 4QS7A 5JICA 3SMPA 4K41A 4BRAA 2HMPA 3WXIA 3LDLA 2QWOA 4B1UB 4BRIA 4CD3A 5EOYA 3DXMA 3ZEUB 3H1QA 1RDWX 1X3NA 2V7YA 3LM9A 3DWLA 5BRHA 1KXPA 4CZFA 3P4IA 4ISFA 5ELZA 3CETA 2E20A 2PBDA 4IJAA 5LJVA 4EHTA 3B8AX 3EKSA 4Z94A 2Q1NA 4FWLA 2QXLA 2P9PA 3VPZA 3W0LA 3H3NO 4H0TB 3MMVA 3IUCA 3GBTA 1TYQA 3WXJA 4BR0A 4BC3A 4BVPA 1NGGA 4H5TA 2E2NA 3BF3A 2D0PA 4WQ4C 5EX5A 4CZHA 1ZXOA 4BQLA 3VEVA 3CQXA 2ASOA 5EXWA 3U9DA 5BPMA 5JLFA 3O4WA 4WYBA 4MLHA 4B1WB 1E4GT 3LDNA 4FWMA 2CGKA 4FOEA 2AP1A 3O6WA 1GLFO 2CH5A 4JHDB 5AQOA 4A2BA 3LDPA 2ZWHA 1NMDA 5EVZA 3AAPA 1T6DA 3D2FB 5BRFA 2YJFA 5E26A 4BQZA 2W40A 1QQNA 3ID8A 3ZX0A 2EWSA 3FZLA 2P9UB 4FPAA 4BRNA 4CZJA 4BRKA 4J8FA 2J4RA 1ESVA 4ISGA 3GOIA 2P9KA 3QMLA 3DAWA 1KAXA 1MWKA 4GNIA 3I33A 1NWKA 4BR4A 1HKCA 1MDUB 1ATRA 2UYTA 4NO7A 1HKBA 2HF4A 3TPQA 3O08A 5CE3A 2YCHA 5FPNA 2V51B 3R9PA 1GLEG 4CBWA 3QBXA 4FSVA 4LC9B 3UB5A 3G25A 3FE1A 5F2RA 2IVNA 4IO8A 1NGDA 3VGLA 5B8HA 3S41A 3OHRA 4MO4A 4H0XB 1BA1A 2FLOA 4PKGA 4CBUA 1C0FA 2D1KA 4BRGA 2A40A 2OANA 4EIAA 4HTLA 1NGBA 4JN4A 4AM7A 2IVPA 3CQYA 1Y64A 3W3DA 4PKIA 4BROA 2FF3B 2P9SB 4A2AA 5AQGA 2GELA 3UKRA 4DQ8A 1GLLO 3VEOA 4O8KA 1NGJA 3VEWA 4AM6A 1KAZA 3O1WA 2A3ZA 3AY9A 5AQVA 3VEZA 1BUPA 2Q0RA 1DGKN 5AQKA 1C0GA 3H45C 5AZIB 1NGFA 2V52B 3U4LA 2GEMA 3ZETA 5EY4A 2Q31A 3ULEB 1QZ6A 5BN8A 4RTFD 2E1ZA 2P9LB 3DXMB 3WUHA 3ZEUA 2E2OA 1MA9B 2FSKA 2F9TA 3O5BA 2GWJA 5AFUA 3KHYA 3GL1A 3R8EA 5FPMA 2QM1A 3MN5A 3LDOA 4K43A 2NZTA 4BVOA 3M3ZA 3WQTA 4HWIA 4A61A 2YI1A 3GG4A 4JD2B 2ITMA 5LJWA 2P9PB 4PL8A 4L3QA 5BN9A 4BG9A 3CJBA 4H03B 4FWQA 4WQ5A 3UKRB 2E8AA 1R59O 1D4XA 1XUPO 4YDUA 2BUPA 5KPZA 1IG8A 3C0BA 5KPTA 1NGEA 3DJCA 2E88A 4FWNA 1G99A 1ATNA 3L6QA 2P9LA 1RGIA 3GE1A 1QZ5A 4C23A 1WUAA 2Q97A 3ZETB 3ULEA 4BR9A 4B9QA 3IMXA 4FWSA 1YVNA 3VETA 1LCUA 4YDUC 3HSCA 1BO5O 4ISEA 5AQMA 2HF3A 4NB4A 1X3MA 1YXQA 2CH6A 3MN9A 4WQ5C 3CJAA 1QQOA 4H5WA 1LOTB 3ENOA 3JS6A 5AQUA 3SMSA 2P9SA 2P9NB 4H0VB 3UE5A 2Q0UA 4BRDA 3VGMA 3DXKA 5AR0A 4EHUA 3TU5A 5AQRA 5AQLA 2F9WA 2D0OA 3H1VX 1GLBG 5BPLA 2BTFA 2QWMA 3VOVA 4E1JA 3JXUA 4FWKA 3KVGA 3CJCA 1CZAN 2AA4A 1BDGA 2GTDA 3MDQA 2QWLA 2YHYA 1S3XA 1K8KB 2CGLA 2I7NA 3H6EA 3CERA 3MCPA 3O80A 3HM8A 1HX1A 4CJ7A 1GLDG 1OKJA 1H1VA 1XQSC 2W41A 3D2FA 5ADXA 3R6MA 4FWRA 3HTVA 4A62A 4IJNA 4IZ9A 2YHXA 1JCFA 4B1ZA 5BREA 1NGIA 2E2PA 2H3GX 3WXKA 1X9JA 1HUXA 1V4TA 5LY3A 3L4IA 5AQHA 4RCHA 4BR7A 4JAXA 3BP8A 4H0PA 2GWKA 1BA0A 4KBOA 2QWQA 3MN7A 4DHYA 3RSEB 4CZMA 1IJJA 3FZHA 2FSNA 1EQYA 5KPRA 4K25A 4CZEA 1NBWA 5JLHA 3CI5A 3MN6A 3GDQA 1HLUA 1BWFO 4JNEA 4H5VA 3WQUA 5E84A 4BG8A 4B1YB 3CJ1A 2ZF5O 1U6ZA 4FWPA 4XH5A 4XEIA 3QFPA 3QB0A 1YAGA 2WUSA 2FF6A 1ATSA 2FXUA 2P9IA 1NLVA 4XH4A 1TUYA 3LL3A 1TYQB 4RWTA 1Z05A 2ZGZA 3SJHA 3VERA 2P9NA 2PAVA 1HKGA 4BREA 3WT0A 3BUZB 4BC4A 3FGUA 2A6AA 5AFUH 3EKUA 3KZBA 5BR9A 2A42A 1Q18A 2VYPA 3MK6A 2IVOA 5BPNA 3C7NA 1NM1A 3HI0A 3QDKA 3VENA 4CZIA 2QWRA 3A5NC 3VESA 1MWMA 5F0XA 4EAHD 3AARA 3ENHA 4BR5A 1TUUA 3EO3A 3SLCA 3ATUA 2KHOA 4FO0A 5AQWA 4CBXA 5FPDA 2Q36A 4FWOA 3UKUB 3WEEB 3LDQA 4MO5A 2YHWA 1S22A 4EFHA 1V4SA 3HZ6A 1NGAA 4BRMA 5AQJA 2A5XA 5AQQA 3EN9A 4PL7A 3FR0A 3QFUA 1HJOA 2P9UA 4BRQA 4F9OA 2NLXA 2ZGYA 4M7YA 5I9EB 4FPBA 4I6MA 1GLAG 4H5RA 4QS8A 3SK3A 4JD2A 3U8XA 4BC2A 4H5NA 1ZC6A 4I6MB 3C7NB 4M7XA 2Q2RA 3VGKA 1BG3A 1QHAA 3L0QA 4XH1A 4BRLA 2VCPA 3A8YA 4DCHA 5AZJA 2GUPA 3CHWA
chains in the Genus database with same CATH superfamily
4WFAL 3E1YA 1WOQA 2IC3A 2O8CA 4FL9A 3LAMA 4CZGA 4GY2B 1SKRA 2E2QA 3TSQA 4DV6K 2QKBA 3AA3A 1SAZA 5M1KA 2OA8A 1N36K 4QS9A 5I42A 4C1NI 4ILJA 4FJ8A 1T8EA 4CEQA 4MLEA 5K14A 4Y0WA 4CK2A 1RCHA 5C15A 2YNFA 4FOIA 4BE2A 2O8EA 1IBKK 4FYDA 4IXCA 3OY9A 3ULDA 4BRFA 1BOTO 3P5JA 3MX5A 3DRPA 5J2MA 4FJ7A 1WBDA 4K8ZA 3PX4A 5BR8K 2QWNA 3AA5X 4ID5A 3H46O 3M1FA 3HK2A 3FFKB 4WQ4A 4OKKA 4B3SK 4BC5A 1U2VA 2HHXA 3F9KA 4E3SA 1WBBA 2QW9A 4DV5K 3D2EB 3CPEA 3NF8A 5SZTA 5AQZA 2E1YA 3TTFA 1DEJA 4C8NA 4DR5K 3I8BA 3KLIA 3KWGA 1S1VA 3VQDA 3LM2A 1RDBA 3A5OC 4BEBA 3U9ZA 3QBWA 1SZ2A 3DXKB 4B9VA 3BEXA 3HBTA 4DSKA 5KQDA 3ZT2A 4H0YB 3LDSA 5ADXH 2O8FB 4OPAA 4MDAA 3O8MA 4FCYA 4R5PA 3C65A 5HL7L 4QS7A 3L8BA 5GAEP 5JICA 2C1IA 2HMPA 2QWOA 2OTJN 4BRIA 1EWQA 3H1QA 1RDWX 3DWLA 1KXPA 4IOCL 3F2KA 3P4IA 1A5VA 2B5JA 3CETA 3ZLJA 3OYBA 2PBDA 5GIPA 4Z94A 2Q1NA 2QXLA 1LV5A 4OX9K 3W0LA 4PY5A 4KHUA 3IUCA 3GBTA 1JL2A 4BC3A 4CJQA 4H5TA 4RW4A 2RKIA 4BQLA 1VQ5N 4KTQA 3MAQA 1UAXA 5EXWA 2HB5A 2WTUA 4MLHA 3LAKA 1E3MA 4LSLA 2PYJA 4FWMA 2CGKA 3V9UA 3VQQA 2AP1A 3N4PA 5AQOA 3SCXA 4A2BA 4CF0A 1N34K 3DLKA 3K5OA 3TSUA 1T6DA 3L4QA 3D2FB 4HUFA 4DR2K 4DTOA 2YJFA 2W40A 3ZX0A 4YHHK 1OH8A 3PY8A 3FZLA 2P9UB 4CEBA 3ZYYX 4BRNA 3SBTA 4CHOA 3AVNA 4ISGA 3GOIA 3QO9A 1NWKA 4BR4A 1SKSA 1ATRA 2Y1IA 5HBMA 4AHUA 3AVFA 3RRHA 1HKBA 4JI8K 1RDDA 2YCHA 2WFBA 2XHBA 3R9PA 3VMFB 3OYGA 3KTQA 1GLEG 4E72A 4A5BA 3FE1A 1T7PA 1LWEA 2IVNA 2HHQA 3TAEA 3MEDA 4CERA 3NGIA 3AVGA 4CFCA 2FLOA 4ZTJA 4PKGA 4DQPA 1QVGM 4X64K 4BE1A 1NK0A 1QS4A 3THYB 4FJ9A 4CJTA 4CHPA 1NGBA 4OPHA 1YJWN 2F7TA 2IVPA 3CQYA 4PKIA 3HRGA 2FF3B 4BROA 1N6QA 4CECA 3CCJN 1KTQA 4A2AA 5AQGA 5MLCQ 4JI4K 1NK7A 2VGMA 3I56N 1JLQA 3PUFA 1GLLO 3VEOA 5DM6L 4O8KA 1NK6A 3F5TA 4KRFA 4CF2A 3VN5A 3CQ8A 3PLAA 4X66K 1XHZA 1VQMN 2Q0RA 4BACA 3HOTA 2KQ2A 3TAQA 1JJ2M 5EY4A 1HQEA 2HNYA 2Q31A 1QZ6A 1FJGK 2O4IA 3FFIA 1TKTA 4Z4IA 5JVGL 2E2OA 1DTQA 4CHQA 1TKZA 3D45A 1Q7YO 3EE9A 3GL1A 1GOAA 3K57A 4K43A 3SBGA 4BVOA 1HMVA 3M3ZA 4Y1DA 3GG4A 2ITMA 2ZQBA 4PHTX 4DWIA 1VSJA 4QAGA 3G4SN 3UKRB 1R59O 1VSHA 3NMUA 3C6AA 4KV8A 2BUPA 2B6AA 4FLYA 3MWTA 3NFAA 5KPTA 4F2RA 3OYLA 3TAGA 4LF9K 1N8RO 4MDBA 4F8RA 4JEPA 3IMXA 4B9QA 4M3YA 1HJRA 4YDUC 5HOOA 3LWMA 1ITGA 4RG8A 3OYAA 5HROA 1X3MA 3A2FA 3AO4A 3CYMA 3CJAA 4XJXA 1QQOA 4H5WA 4RW9A 3AVIA 4H0VB 4BRDA 3PIPL 1HYSA 3DXKA 4E0DA 5KGWA 5HRNA 4TSXA 5AQRA 4DTUA 2D0OA 1IBLK 4Q5VA 4JKEA 3C94A 4JI7K 4GVMA 4C8LA 4Z0UA 3JXUA 3QEWA 4FWKA 3NF7A 5J2QA 1CZAN 5HRRA 3WNGA 2GTDA 2OZMA 5J2NA 2QWLA 2YHYA 2CGLA 2I7NA 1BQNA 3OS2A 3L2UA 3MCPA 5KRTA 1C0MA 2XY7A 1U48A 4KHNA 5A2QO 3CCVN 1XQSC 3D2FA 3UIQA 4JYAK 3J81O 4DFKA 4IJNA 4FLWA 3J80O 3WXKA 2ETJA 4IOXA 3AVHA 1HUXA 1V4TA 4M45A 2G8WA 1T05A 4LY7A 4JAXA 3HOSA 1BI4A 1L3SA 1DT9A 4DHYA 3L3VA 1IG9A 2O8BB 3QERA 2NUBA 4K25A 3V1QA 1VHXA 3OTOK 1X9SA 1HLUA 4DTJA 5C2DA 4W5TA 3WQUA 4KPYA 4DFMA 3CJ1A 2VG6A 3HSTB 4FWPA 1QHTA 4XH5A 4IG3A 2VQEK 4BWMA 1YI2N 2FF6A 2NNWA 4LF6K 1X9WA 1QTMA 1TUYA 1TYQB 4DV1K 4N47A 3IRXA 1HNWK 1QQCA 4EZ6A 2QI2A 3BUZB 4BC4A 2BH1A 1KVBA 2A42A 1Q18A 4AHRA 4F3OA 3ISNC 1B9DA 3TANA 1NM1A 1T03A 4CZIA 1RILA 4JKGA 4CJVA 3JAMO 4B3OA 5F0XA 2YKMA 3HP6A 3AARA 5DMRA 3LPUA 1X1PA 4BR5A 4KO0A 3EO3A 3J7YP 4FM0A 3KKRA 4CBXA 3KWIA 1O1WA 4FWOA 3UKUB 3WEEB 1S1WA 2X78A 4J2DA 4QCLA 4FJHA 4MO5A 1QVFM 3HZ6A 4LF5K 2G8FA 4BRMA 3SNNA 5AQJA 3LALA 3V9ZA 3AA2A 2HVIA 3FR0A 5LMUK 2HHSA 5C25A 4FLUA 4BRQA 3MX2A 2NLXA 4LFAK 3P1GA 4FPBA 3T1AA 1GLAG 3U8XA 4JD2A 2IDOA 3JSMA 3C7NB 4CF1A 3HVTA 3VGKA 1BHLA 3HYFA 3L0QA 4BRLA 1REVA 3A8YA 3AVMA 1RT1A 2GUPA 4M63C 3THWB 2HOEA 1D8YA 3H3OB 4FJKA 1TL1A 3E9PA 3J8AA 1DTTA 2NRHA 2YJEA 4BRPA 5I3UA 2W6KA 1QSSA 2A1RA 4DF4A 5HRPA 1ZBSA 2HHTA 1J9AA 4ILHA 1TKXA 3AVLA 3V1OA 4BGBA 3K59A 2BANA 2XY8A 1HPMA 4YORA 5AQXA 1GLJO 3O3GA 1KQSM 4DSJA 4DSIA 1KD1O 1B92A 1KCFA 1SUQA 3A5MC 4HVJA 5T7BA 3Q7BA 3FLCO 4CZLA 4HUEA 4V19S 3N4QA 4K42A 4LF4K 4JI3K 3QICA 2O8CB 4CGJA 4OPKA 3THVA 4BRHA 2KW4A 1J6ZA 3MXMA 4KFBA 3O3HA 2V7ZA 3E01A 4ELTA 1VQLN 3CCRN 3QEVA 2BE2A 3CJ9A 5AZIA 5CYMA 1ASUA 3DMJA 2OCEA 3TARA 4G9ZA 4C8MA 1T44A 3QEXA 4CK1A 1OVQA 3FZKA 5HRSA 2Z1IA 1WN7A 2Y1JA 3SI6A 3AGKA 1RFQA 3OVNA 4QOZB 4DS4A 4ILGB 4JI1K 3M6GA 3WXLA 3RSEA 3CIPA 2HHUA 1IH7A 1U2VB 3ZT4A 5KQ8A 4DR6K 3BZKA 4DLEA 1Q81O 2I7PA 3FZMA 1VQNN 2O8BA 3RMDA 4DB3A 1ZBHA 4K41A 2UXDK 2Z1HA 2GX9A 3CFOA 4A5AA 3DXMA 1X3NA 3K5MA 2V7YA 3CG7A 4ISFA 4IG0A 5ELZA 2E20A 3K2PA 1U49A 4N5SA 4KTZA 4W5OA 1IO2A 4EHTA 3EKSA 4J2EA 3H3NO 3MMVA 3VQ6A 1TYQA 2HNZA 1LAVA 1NGGA 2QTDA 3NHGA 5EX5A 2O8DA 3ZSRA 1ZXOA 5GAHP 4F3TA 3BZCA 1WSIA 2ASOA 4E89A 4E7JA 2PZSA 3DLBA 1RDCA 4B1WB 4YOVA 3Q7CA 3HP9A 2YHBA 4J2AA 2ZWHA 1NMDA 5BRFA 5E26A 4KHPK 3S9HA 1QQNA 2QKKA 3ID8A 4KAZA 1VSMA 3HVRA 3SQ4A 4FPAA 4CZJA 4BRKA 2UXCK 4AHTA 3OJUA 2J4RA 1ESVA 1Q9XA 4NCBA 3O9QA 3QMLA 1MWKA 3D0PA 4FJJA 1HKCA 2HHVA 4K0KK 3TTDA 4PUOA 3AA4A 1BISA 2KZMA 4B3TK 1Q86O 4CFAA 1J53A 4YOUA 2ZD1A 4FSVA 5M1FA 4IFEA 4CHYA 3NH2A 4IO8A 1VAZA 3SPZA 3VGLA 4FK4A 3OHRA 1BQMA 4MO4A 4M41A 4LF8K 3DLEA 1ZBIA 3ZSZA 3DM2A 1S9EA 4KHQA 2F4VK 3V1RA 4MFBA 5SWMA 1OH6A 3TAFA 4FM2A 1YIJN 3G71N 4DU4A 4M3XA 4JN4A 1Y64A 3W3DA 4KB0A 5CHIA 4JK9A 4CVNE 4BDYA 3ZT3A 1YITN 1JLCA 3AGRA 3O9SA 4CJLA 4DQ8A 4KI6A 4DU1A 2O8DB 3NGZA 3AO1A 2A3ZA 2VGNA 3O1WA 1RBTA 1M90O 3AY9A 4O8UA 1BUPA 1DGKN 2W42A 5GAGP 3H45C 3CXCM 4YY3K 3ZETA 1KRPA 4GKKK 4JI0K 1KFSA 5DM7L 3SUOA 4RTFD 2P9LB 1K9MO 3MEEA 1XHXA 3WUHA 3ZEUA 1RTDA 3ITHA 2FSKA 3IG1A 3ID6A 1YF5L 5FPMA 3MN5A 3R1XA 3CFPA 2HSTA 4A61A 1HRHA 4CJ5A 4O0IA 4NCAA 1HNIA 2P9PB 1C1BA 1XMOK 4AQYK 1S1XA 2E8AA 2I5JA 4JI6K 3S3OA 3VQCA 4CGGA 4YDUA 4OO1J 4DMNA 3B6PA 3ENBA 4W5QA 1Q82O 1N33K 1KC8O 3U3YA 1UWBA 1ATNA 5C0YA 3GE1A 3DLGA 4IDHA 3K5LA 2RPIA 3QIOA 3T19A 4FWSA 3VETA 3M8PA 4FW1A 3NH0A 1BO5O 4I2QA 4ISEA 4CJKA 4CIEA 2CH6A 3T7ZA 3CC2N 2B4JA 1LW2A 3ASMA 5AQUA 3UE5A 2Q0UA 3O4QA 5AR0A 1FKPA 4EHUA 2F9WA 5LMNK 3C95A 2DFHA 3HPHA 3OS0A 3OBYA 3KVGA 1BDGA 4DR3K 1N32K 3VQ9A 5IT9O 1K8KB 4JK8A 4JLHA 2YNGA 4IEIA 5D3GA 1EX4A 3S3NA 4CJ7A 1GLDG 4DLGA 1OKJA 2OPSA 4H8KA 5ADXA 2E6MA 3RMAA 3R6MA 3LP2A 3HTVA 4Q0BA 3CM5A 4RW8A 2H3GX 3PO4A 4OPJA 4NYNA 4M3UA 4KH5A 3DOLA 4BR7A 4OLBA 3ALYA 1KVAA 2GWKA 1BA0A 4KBOA 3OYEA 3DLRA 4F2SA 3T1HK 1JKHA 3J7ZO 1IJJA 3FZHA 4CZEA 3PIOL 4DFPA 3MECA 5JLHA 5C10A 3CI5A 3GDQA 5M1QA 2E4LA 2R7YA 2QA4N 4DV4K 4Z4CA 5E84A 1Q9YA 1K6YA 1FW6A 2WC9A 3EZ5A 3CD6N 1ASWA 2WUSA 1L5UA 3O4NA 1ATSA 3SPYA 4CESA 4KKOA 4XH4A 3LL3A 4RWTA 2ZGZA 3VERA 1VQKN 4BWJA 4FJXA 1W2BM 1B9FA 3WT0A 2UUBK 2A6AA 2HBKA 3EKUA 1D9FA 2HBMA 3NVMA 4IBNA 3MK6A 2IVOA 3CCQN 3QDKA 2HHIA 2XRIA 2HHHK 3A5NC 2DFFA 1MWMA 1IKWA 1LWCA 4NXNK 1NKCA 1SS6A 1TUUA 3VQEA 1HNVA 2JWLA 3RRGA 1VQPN 2KHOA 4CJSA 3LDQA 3L3UA 1NJZA 4OGEA 2DTUA 1S22A 4BE7B 1GOBA 1JXEA 2XY6A 1ZBFA 4I2PA 1GOCA 1NK9A 2P5OA 3HJFA 4F9OA 4M7YA 5I9EB 4CJEA 3BGRA 4H5RA 4QS8A 4BC2A 4JKBA 2FBXA 4I6MB 1JLBA 2Q2RA 2HNDA 3ZSOA 4XH1A 2OZSA 5AZJA 4DCHA 2QXFA 4CGFA 1RT6A 3CHWA 3TABA 4UQGA 3EY1A 3AO2A 4CZKA 3UKUA 3WEEA 3A5LC 2CGJA 5J2PA 3WNFA 1WNSA 2IIRA 3CJ7A 1DLOA 4JI5K 1I39A 3L2WA 4GV3A 4BECA 2G8UA 3LP3A 3V81A 3FZFA 2OPPA 3CCEN 4M3ZA 3SUNA 2Q3SA 4C8OA 1YVUA 4CK3A 4JI2K 3T69A 1SKWA 5AQIA 3ZT1A 3AVBA 4KB1A 3CC4N 3VTHA 2XY5A 1I3AA 1J5EK 3VF6A 3K9JA 3SV3A 5IWAK 2BDPA 2EHGA 5CZ1A 3KJVA 1FKOA 3CF5L 4PKHA 2NRTA 3NF9A 4BRCA 3HO1A 1VQ4N 3IFRA 1BU6O 3DOKA 3P31A 4H0OA 4L8RB 2DPNA 1JCGA 4JS5A 3O3FA 4BR2A 4CGHA 2QWPA 4JKHA 4N41A 3KD5E 2KLAA 4B1VA 4DQSA 3J7AP 5AQPA 3F9MA 5JS1A 4KH6A 5TKYA 5GINA 4AF1A 5JVHL 4O5FA 1KSPA 1K8KA 3AAQA 4CJPA 2Z1GA 5F1XA 4DV3K 4B1XB 4DF8A 4A57A 1CZ9A 3ATVA 3VTIA 2P9IB 2FC0A 3RTVA 5GIOA 5CR4A 2FBVA 4IWVA 4B9LA 1JL1A 2P9KB 1P8ZA 4B9TA 5E41A 3QINA 3L2VA 4CCHA 3ZSYA 1NJYA 3OYNA 3AVAA 3IDHA 2VWBA 4B08A 5JENA 2RN2A 3I8DA 4X62K 1TL3A 3NF6A 5AQFA 3ZX2A 1A5XA 4DQIA 2HBJA 5FPEA 3T3FA 3MWPA 1KAYA 2KKZA 5HP1A 3THXA 4FLTA 1HYZA 2NRZA 5AQYA 5AQTA 4AHVA 1W97L 3WXIA 3LDLA 4C8KA 4B1UB 4CD3A 5EOYA 2FBTA 3VQ8A 4FJIA 5BRHA 3NGYA 3ZSWA 3L2RA 5KI6A 4CZFA 4B9NA 4B9UA 3CCMN 1HYVA 4IJAA 5LJVA 3LWLA 3CMAN 4FWLA 1EWRA 3VPZA 1MU2A 4U7BA 4KHWA 5KRSA 4O4GA 3EYZA 1RNHA 4BVPA 2D0PA 5KTQA 1NG9A 3K58A 3KK7A 4MQ3A 1C0TA 5BPMA 3O4WA 5EU7A 4WYBA 1UA0A 1JLFA 1TK5A 1NOYA 3OJSA 3LPTA 3SUPA 3I0SA 2CH5A 2OPRA 3LDPA 1RT4A 4CJRA 3CPWM 4DUYK 4CJ3A 2EWSA 2D0BA 3TSPA 4HHTA 5C12A 1TK0A 3M8QA 4LD0A 2P9KA 3DYAA 2F96A 4GNIA 2KFZA 1S1TA 2UYTA 4DTMA 4N76A 4NO7A 4FXDA 1EP4A 3O08A 4CF9A 5CE3A 2V51B 4E1MA 3SAHA 2O4GA 4CBWA 3QBXA 4LC9B 3UB5A 3CCLN 3SZ2A 1SL0A 3NBPA 1I94K 3NVKA 2LSNA 4ZHRA 5B8HA 3S41A 2OYQA 2HHWA 1VSEA 4N56A 2D1KA 4DTRA 4IKFA 4FLVA 1XC9A 4WFBL 1S6PA 2WBNA 2OANA 4EIAA 2WOMA 3THYA 4FW2A 1WLJA 4K8XA 2JWKA 1HNXK 4OGCA 1NGJA 4W5NA 4AM6A 1KAZA 4PA1A 3VEZA 2UXBK 2O8FA 4DSLA 3G10A 5AZIB 1NGFA 1RT2A 2V52B 3U4LA 2YX6A 2GEMA 3DLHA 2X6SA 3ULEB 3ZSXA 3HPOA 2VWKA 4Z4EA 4CIFA 4M3RA 3T1YK 1CLQA 5TKWA 3KHYA 3PX0A 3RMCA 3R8EA 3LDOA 4GVEA 2NZTA 3ZT0A 4LH4A 3WQTA 4BY9C 4O0JA 1IKVA 4LSNA 3OYMA 4BG9A 4FVMA 1D4XA 4NYFA 1QSYA 4CEDA 4M3WA 3CM6A 1XUPO 4H4OA 5KPZA 1FXXA 4FM1A 3KLGA 1IG8A 3DJCA 4FWNA 2G8IA 1G99A 1LWFA 2P9LA 1RGIA 1WAFA 3OS1A 3PV8A 2Q97A 3THXB 3ZETB 1J5OA 1RBSA 3MEGA 3TWHA 2NRVA 1YVNA 2P1JA 5H1SQ 3PSFA 5AQMA 2HF3A 1EO1A 2GV9A 4NB4A 1L3TA 1U4BA 3MN9A 5DK5A 4WQ5C 3NH1A 2ZJQL 3MCAB 1LOTB 3JS6A 5C24A 1S72N 2P9NB 1OH7A 4CE9A 2EX3A 3AO3A 3VGMA 3OBWA 2DY4A 4Y1CA 2ITGA 4X65K 3H1VX 1XMQK 4DSFA 1F21A 3ZSVA 3VOVA 3CJCA 2AA4A 3MDQA 4IDKA 2RHKA 1NMNA 1XWLA 3H6EA 2PFUA 1KVCA 1S9GA 3LZJA 1RTIA 4YOYA 3O80A 3I55N 4OVLA 4JKCA 1J54A 2W41A 2P51A 4DR1K 2HBLA 3DI6A 3VQ4A 4IZ9A 4A62A 5HLFA 1CZBA 1NGIA 1Q8IA 2E2PA 5AJ3K 1NK5A 4KTWA 3L4IA 1BI4B 5AQHA 4CJFA 4RCHA 1U45A 4KH4A 2ZJRL 3BP8A 2QWQA 3VA0A 5GADP 4YFUA 2FSNA 1T3VA 1EQYA 1NBWA 4KREA 2QEXN 2KZZA 4LF7K 4G1QA 4CF8A 3MN6A 1VSIA 3PX6A 2W00A 1NU0A 3QESA 4GV9A 4B1YB 1U6ZA 1ILYA 4I7FA 3RMBA 3VQPA 1JLAA 3WNEA 4HCBA 3QFPA 3QB0A 4E7KA 2FBYA 1CXQA 3IAYA 2X74A 1BIUA 1NLVA 1IKYA 1Z05A 2G8VA 2P9NA 2ATQA 2PAVA 1HKGA 1VK0A 1S5JA 1NKEA 4BREA 3FGUA 4OLAA 3KZBA 5BR9A 1CXUA 1BL3A 4JKGB 4NLCA 4YNQA 3VENA 2YKNA 1D5AA 1NK4A 3VESA 1VQ9N 2YV0X 4EAHD 3EEQA 2HW3A 1RTJA 3AV9A 3B6OA 1NJWA 3E9LA 4GW6A 5FPDA 4FJMA 2YHWA 2NRWA 1V4SA 4EZ9A 4CEOA 5AQQA 4PL7A 3EN9A 3TAMA 3QFUA 3OA9A 3M8SA 5FRNA 3LANA 1SL1A 2P9UA 1X9MA 2ZGYA 1EETA 3KKSA 1VRUA 1KLNA 2IAJA 1O13A 4H5NA 1ZC6A 4GMJB 4M7XA 3KLEA 5FRMA 4I9QA 3M8RA 2UU9K 4FLZA 1Y97A 2IS3A 3OYFA 2VCPA 4HTUA 1VRTA 3V9XA 3QNNA 4FJ5A 4BE0A 5AQSA 4R79A 4O5BA 1JCEA 5FROA 2D0AA 4CI6A 4DUZK 4JK7A 3VF2A 4AH9A 1S1UA 3DRSA 4JKFA 3D2EA 3CMEN 3PO5A 3SV4A 2ASPA 4NCGA 4NLBA 1LAWA 3SAGA 1Z6RA 3DRRA 1QQMA 1IV0A 1NGHA 3VA3A 4O44A 3OYJA 3ZSQA 5C2FA 3VF4A 1A5WA 1ZBLA 1YUWA 1ZYQA 3ZX3A 2IGIA 1WAJA 3WNHA 4Z4HA 2ZM6K 1DKGD 1HPZA 1XNQK 2G8HA 3KK1A 1SQKA 2KFNA 4BDPA 1XNRK 5AZJB 3QIPA 3O1BA 3SAFA 3RR7A 3I0RA 4BGAA 2D4WA 2FSJA 4EP4A 1ASVA 1ZBUA 3CFRA 3KLFA 2Z1JA 3C6UA 4JKAA 4JHDA 1GLCG 1T6CA 1RBRA 3VEYA 4CGIA 1E4FT 4JRPA 3EL2A 3SJJA 2ASMA 3JYTA 4Z4GA 4C1NK 3D7EO 2RF2A 1XC3A 2F8TA 1VSDA 2ZE2A 5CZ2A 1NGCA 1WSEA 3EZWA 4LFBK 4U67L 1L3VA 3A0IX 4CD1A 4UY8O 3VEXA 5AQNA 4RW7A 2A41A 5JMVA 1QE1A 5M1NA 5BRDA 3BF1A 4DTPA 4FZYA 3S5TA 1IKXA 3SMPA 4BRAA 3VQAA 1TKDA 4WF9L 3ZEUB 1C1AA 3M5RA 4CFDA 4DR4K 3LM9A 3AVCA 2AJQA 5KGXA 1NKBA 1WSHA 2KTQA 4DG1A 3OYKA 3OYDA 3NAEA 4DKWA 3B8AX 4A59A 1WSGA 3VQ5A 1N5YA 2P9PA 4H0TB 4B3RK 4FJLA 4FJGA 3WXMB 3WXJA 4BR0A 5FDLA 2D5RA 2E2NA 3BF3A 4CEFA 4OJRA 4WQ4C 4CZHA 3VEVA 4JRQA 3CQXA 3H08A 2E5LK 4O55A 4FJNA 3V6DA 3U9DA 5JLFA 2IOCA 1E4GT 3LDNA 3LZIA 4HUGA 1M1KO 3O9TA 3LP0A 4FOEA 3O6WA 1GLFO 1QSLA 3IS9A 4JHDB 3K5NA 4IOAL 3TAPA 5EVZA 3AAPA 4KHSA 1VQ7N 2DFEA 4BQZA 2NRRA 1WB9A 1TVRA 4GV6A 4J8FA 1VSKA 5J1EA 4DFJA 4ZTFA 2HMIA 4LH5A 3DAWA 1KAXA 4B8CA 3I33A 1NK8A 1MDUB 1U04A 2HF4A 3RR8A 3TPQA 4CEEA 5FPNA 4AHSA 4M42A 5JS2A 3L2QA 2VWJA 3G25A 1NOZA 4WE1A 5F2RA 3OYHA 1YJ9N 4NXMK 4KHYA 1NGDA 4ELVA 4LFCK 4H0XB 4M3TA 1BA1A 1C0UA 1TGOA 3E9OA 4CBUA 4E1NA 1C0FA 1HNZK 4BRGA 4DV2K 3S3MA 4FK2A 2A40A 2JLEA 1C6VA 2WONA 1NJXA 4HTLA 2PYLA 3EE8A 3MXIA 2D0CA 4AM7A 2JGUA 3KD1E 2YHAA 3TI0A 3OW2M 1G15A 2P9SB 1C1CA 3DLLL 3U3GA 1NNEA 2GELA 3UKRA 3U6FA 1KFDA 4ELUA 3RVCA 3QLHA 3KK3A 4DTXA 1HR0K 4JV5K 3VEWA 2UUAK 4YOWA 1WSJA 1YTAA 3HM9A 1KLMA 4GKJK 5AQVA 2RE2A 1TAUA 1Z25A 5AQKA 1C0GA 1VQ6N 1VSFA 3QETA 3F73A 4CW7B 1W0HA 2ZJPL 1D9DA 4E7IA 5BN8A 4E7HA 3CCSN 4CEAA 2E1ZA 3O9RA 3DXMB 1S6QA 2OTLN 1MA9B 2X6NA 3V9WA 2F9TA 4W5RA 3O5BA 2GWJA 5AFUA 4DTNA 3KK2A 3CCUN 2QM1A 1RT3A 1OVYA 1R0AA 4HWIA 5M1PA 4DV7K 2YI1A 4JD2B 5LJWA 2F8SA 1W7AA 4PL8A 4L3QA 3P38A 5BN9A 3HXMA 3CJBA 4H03B 3SQ0A 4FWQA 1LW0A 4WQ5A 3PSIA 3NE6A 1L3UA 2NRXA 2OPQA 4IEEA 1RDAA 1HQUA 4DSEA 1YT3A 3AVKA 4EP5A 3HT3A 3C0BA 2E6LA 1NGEA 2E88A 1JXBA 3L6QA 1QZ5A 4C23A 1WUAA 4FK0A 1OH5A 4JKDA 3ULEA 4BR9A 4CHZA 5M1OA 3QEIA 4PQUA 1LCUA 3HSCA 3TR8A 2A1SA 4B9SA 1BIZA 4DR7K 1YXQA 4J2BA 2P5GA 3SYZA 4IO9L 1JLGA 3K9KA 3ENOA 3C6HA 3SMSA 2P9SA 1RBVA 3KLHA 1P90A 1RTHA 3D6RA 4IFVA 4CEZA 4DS5A 3TU5A 4DQQA 3RWUA 5AQLA 4YOXA 3SQ2A 2YNIA 2GUIA 1GLBG 5BPLA 5C42A 1U47A 2BTFA 2QWMA 4E1JA 1TV6A 2W6LA 3QNOA 3IKMA 2QK9A 4JS4A 3CYGA 4AILC 1S3XA 2YNHA 4CJUA 4CHNA 3CERA 3P39A 4B9MA 3V4IA 3HM8A 1RT7A 1HX1A 3R3LA 1NJIO 4WCEL 4HCCA 3C6TA 1XI1A 1H1VA 2VQFK 3SQ1A 4FWRA 4OKJA 4YOTA 4F4KA 3E66A 2YHXA 1JCFA 3K0SA 4B1ZA 5BREA 4I9LA 1RBUA 5FLXO 1RT5A 1X9JA 5LY3A 3NCIA 4Z4FA 4H0PA 1YTUA 1BGXT 4DQRA 3VQBA 3P83D 4CIGA 3MN7A 4CJWA 3BDPA 4CFBA 3RSEB 4CZMA 3OYCA 4DTSA 1FK9A 1BCOA 5KPRA 4ICLA 1YJNN 1UOCA 4FLXA 3ZCMA 4WFNL 2XO7A 1YHQN 1BWFO 4JNEA 4H5VA 4B3MK 1VSLA 4BG8A 1RDUA 2ZF5O 2VG7A 3VQ7A 3OYIA 4XEIA 1W9HA 1EKEA 1YAGA 4CJ4A 3SUQA 1K73O 3AVJA 3HPGA 1TK8A 4ID1A 2UUCK 2FXUA 2P9IA 3NDKA 4AHCA 4OKEA 2O8EB 3CC7N 2G8KA 3SJHA 1TAQA 1SV5A 3V9SA 5AFUH 2VYPA 4BDZA 5BPNA 3C7NA 2C1GA 3HI0A 1VQ8N 1EXQA 2QWRA 4IFYA 4RW6A 4H4MA 3LP1A 1IBMK 4PWDA 3G6EN 3ENHA 3MXJA 3G0ZA 3THWA 1JLEA 3SLCA 1K8AO 4KI4A 4FZXC 3ATUA 1UA1A 4FO0A 5AQWA 2Q36A 3BY5A 3QEPA 3AO5A 5CYQA 4EFHA 5CY4A 4FZZA 4FVUA 1NGAA 3HL8A 2A5XA 4B8AB 3TTCA 1HJOA 4E19A 4DU3A 2BGGA 4I6MA 4XIUA 5LL6Z 3SK3A 4DV0K 2GBZA 1VQON 1SL2A 1WSFA 1Z26A 1BCMA 1BG3A 4CGDA 1QHAA 2VG5A 2HVHA 3O9UA 2PY5A 4E7LA 3KIOA
chains in the Genus database with same CATH topology
4WFAL 3E1YA 1WOQA 4M63C 2HOEA 5AQSA 4FL9A 4CZKA 4R79A 3H3OB 4CZGA 3UKUA 3WEEA 3A5LC 2CGJA 4GY2B 1JCEA 3E9PA 3J8AA 4BRPA 2NRHA 2YJEA 4CI6A 4JK7A 2E2QA 2IIRA 3CJ7A 3TSQA 4GV3A 4BECA 1SAZA 3VF2A 5M1KA 3FZFA 4QS9A 4JKFA 3D2EA 3CCEN 3CMEN 4C1NI 4ILJA 1ZBSA 2ASPA 4NLBA 3T69A 4ILHA 3SAGA 1Z6RA 1QQMA 4MLEA 4Y0WA 5AQIA 1NGHA 4BGBA 3CC4N 5C15A 1HPMA 4FOIA 3VTHA 4YORA 5AQXA 1GLJO 3VF6A 3K9JA 1KQSM 5C2FA 4IXCA 3VF4A 1KD1O 4BRFA 3A5MC 3CF5L 4PKHA 1YUWA 2NRTA 3FLCO 3Q7BA 1BOTO 4BRCA 3ZX3A 3N4QA 4CZLA 3MX5A 1VQ4N 3IFRA 4K42A 3QICA 1BU6O 1DKGD 3P31A 4H0OA 1SQKA 2DPNA 1JCGA 4BRHA 5AZJB 1J6ZA 3O1BA 3SAFA 2V7ZA 4BR2A 2QWNA 3H46O 3M1FA 3FFKB 4WQ4A 4BGAA 2QWPA 3CCRN 4JKHA 1VQLN 2KLAA 4B1VA 2D4WA 2FSJA 3CJ9A 1U2VA 3F9MA 5AQPA 4BC5A 5AZIA 4KH6A 5TKYA 2QW9A 4AF1A 5GINA 4JKAA 4JHDA 3D2EB 1GLCG 4O5FA 5JVHL 1T44A 4G9ZA 1T6CA 3CPEA 5AQZA 2E1YA 1K8KA 3AAQA 3VEYA 3TTFA 5F1XA 1E4FT 1DEJA 3FZKA 3EL2A 4B1XB 2ASMA 4A57A 3ATVA 3VTIA 2P9IB 5GIOA 5CR4A 3I8BA 4IWVA 4C1NK 3D7EO 1XC3A 2P9KB 3AGKA 1P8ZA 3KWGA 1RFQA 3LM2A 3A5OC 1NGCA 4BEBA 3U9ZA 4ILGB 3QBWA 3EZWA 3IDHA 2VWBA 4U67L 1SZ2A 3DXKB 3BEXA 3HBTA 3A0IX 3M6GA 3WXLA 4CD1A 3RSEA 4UY8O 5AQFA 3ZX2A 5KQDA 3CIPA 2HBJA 4H0YB 3VEXA 5AQNA 1U2VB 5FPEA 5KQ8A 5ADXH 2A41A 3MWPA 1Q81O 1KAYA 2KKZA 5JMVA 2I7PA 3FZMA 4MDAA 3O8MA 4OPAA 5M1NA 5BRDA 1VQNN 2NRZA 3BF1A 5AQYA 3C65A 4DB3A 5AQTA 4QS7A 5HL7L 5GAEP 5JICA 3SMPA 4K41A 1W97L 4BRAA 2HMPA 2C1IA 3WXIA 3LDLA 2QWOA 4B1UB 4BRIA 2OTJN 2GX9A 4WF9L 4CD3A 5EOYA 4A5AA 3DXMA 3ZEUB 3H1QA 1RDWX 1X3NA 3M5RA 2V7YA 3LM9A 3DWLA 5BRHA 1KXPA 4IOCL 4CZFA 3F2KA 3P4IA 4ISFA 5ELZA 3CETA 3CCMN 2E20A 2PBDA 4IJAA 5LJVA 4EHTA 5GIPA 4DKWA 3B8AX 3EKSA 4Z94A 2Q1NA 4FWLA 4A59A 3CMAN 2QXLA 2P9PA 3VPZA 3W0LA 3H3NO 4H0TB 4U7BA 3MMVA 3IUCA 3GBTA 1TYQA 3WXMB 3WXJA 4BR0A 4BC3A 4BVPA 1NGGA 2QTDA 2E2NA 3BF3A 4H5TA 2D0PA 4WQ4C 5EX5A 4CZHA 1ZXOA 4BQLA 5GAHP 3VEVA 1VQ5N 3KK7A 3CQXA 2ASOA 5EXWA 3U9DA 5BPMA 5JLFA 3O4WA 4WYBA 4MLHA 4B1WB 4YOVA 1E4GT 3LDNA 3Q7CA 1M1KO 3O9TA 4FWMA 2CGKA 4FOEA 2AP1A 3O6WA 1GLFO 3N4PA 2CH5A 4JHDB 5AQOA 4IOAL 4A2BA 3LDPA 2ZWHA 1NMDA 5EVZA 3AAPA 3TSUA 1T6DA 3L4QA 3D2FB 5BRFA 1VQ7N 2YJFA 5E26A 4BQZA 2NRRA 2W40A 1QQNA 3CPWM 3ID8A 3ZX0A 2EWSA 3FZLA 4GV6A 2P9UB 3TSPA 4FPAA 3ZYYX 4BRNA 4CZJA 4BRKA 4J8FA 3SBTA 5C12A 2J4RA 1ESVA 4ISGA 3GOIA 2P9KA 3O9QA 3QMLA 3DAWA 1KAXA 1MWKA 4GNIA 3I33A 1NWKA 4BR4A 1HKCA 1MDUB 1ATRA 2UYTA 4NO7A 3TTDA 1HKBA 2HF4A 3TPQA 3O08A 1Q86O 5CE3A 2YCHA 5FPNA 2V51B 2WFBA 4YOUA 3R9PA 3VMFB 3SAHA 1GLEG 4CBWA 3QBXA 4FSVA 5M1FA 4A5BA 4LC9B 3UB5A 3CCLN 3G25A 3FE1A 4IFEA 5F2RA 3NVKA 2IVNA 4IO8A 1VAZA 1YJ9N 1NGDA 3VGLA 5B8HA 3S41A 3OHRA 4MO4A 4H0XB 1BA1A 2FLOA 3E9OA 4PKGA 4CBUA 1C0FA 2D1KA 4BRGA 1QVGM 2A40A 4WFBL 2WBNA 2OANA 4EIAA 4HTLA 1NGBA 1YIJN 4OPHA 3EE8A 3G71N 1YJWN 2F7TA 4JN4A 4AM7A 2IVPA 3CQYA 1Y64A 3W3DA 4PKIA 3HRGA 2FF3B 4BROA 5CHIA 3OW2M 4JK9A 2P9SB 3CCJN 4A2AA 1YITN 5AQGA 5MLCQ 3DLLL 2JWKA 2GELA 2VGMA 3I56N 3UKRA 3AGRA 3O9SA 4DQ8A 3RVCA 1GLLO 3VEOA 5DM6L 4O8KA 1NGJA 3F5TA 3VEWA 4AM6A 4YOWA 1KAZA 3O1WA 2A3ZA 2VGNA 1M90O 3AY9A 5AQVA 2RE2A 4O8UA 3VEZA 3PLAA 1BUPA 1VQMN 2Q0RA 1DGKN 5AQKA 1C0GA 1VQ6N 3HOTA 5GAGP 3H45C 5AZIB 1NGFA 3CXCM 2V52B 3U4LA 1JJ2M 2YX6A 2GEMA 3ZETA 5EY4A 2ZJPL 2Q31A 3ULEB 1QZ6A 5BN8A 5DM7L 4RTFD 3CCSN 2E1ZA 2P9LB 1K9MO 3O9RA 3DXMB 3WUHA 3ZEUA 2OTLN 5JVGL 2E2OA 1MA9B 2FSKA 1Q7YO 2F9TA 3O5BA 2GWJA 5AFUA 3ID6A 5TKWA 1YF5L 3EE9A 3KHYA 3CCUN 3GL1A 3R8EA 5FPMA 2QM1A 3MN5A 3LDOA 3R1XA 4GVEA 4K43A 2HSTA 1OVYA 2NZTA 3SBGA 4BVOA 3M3ZA 3WQTA 4HWIA 5M1PA 4A61A 2YI1A 3GG4A 4JD2B 2ITMA 5LJWA 2P9PB 4PHTX 4BY9C 4PL8A 4L3QA 3P38A 5BN9A 3G4SN 4BG9A 3CJBA 4H03B 4FWQA 4WQ5A 3UKRB 2E8AA 1R59O 2NRXA 4IEEA 1D4XA 3NMUA 3C6AA 1XUPO 4YDUA 4OO1J 2BUPA 3ENBA 5KPZA 1IG8A 3C0BA 3MWTA 5KPTA 1NGEA 3DJCA 1Q82O 2E88A 4FWNA 1KC8O 1G99A 1ATNA 3L6QA 2P9LA 1RGIA 3GE1A 1QZ5A 5C0YA 4C23A 1WUAA 4IDHA 2Q97A 3ZETB 1N8RO 4JKDA 3ULEA 4MDBA 4BR9A 4JEPA 3IMXA 4FWSA 5M1OA 4B9QA 2NRVA 1YVNA 3VETA 1LCUA 4YDUC 5HOOA 3HSCA 1BO5O 5H1SQ 4ISEA 5AQMA 2HF3A 1EO1A 4NB4A 1X3MA 1YXQA 2CH6A 3T7ZA 3CC2N 3MN9A 4WQ5C 3CJAA 4IO9L 4XJXA 1QQOA 4H5WA 2ZJQL 3MCAB 1LOTB 3ENOA 3C6HA 3JS6A 3K9KA 5AQUA 2P9SA 3SMSA 1S72N 2P9NB 4H0VB 3UE5A 2Q0UA 4BRDA 3PIPL 1P90A 3DXKA 3VGMA 3OBWA 3D6RA 5AR0A 4EHUA 3TU5A 5AQRA 5AQLA 2F9WA 2D0OA 4YOXA 3H1VX 1GLBG 5BPLA 4JKEA 2BTFA 2QWMA 3VOVA 4E1JA 3JXUA 4FWKA 3IKMA 3OBYA 3KVGA 3CJCA 1CZAN 2AA4A 1BDGA 2GTDA 3MDQA 2RHKA 2QWLA 2YHYA 1S3XA 1K8KB 2CGLA 2I7NA 3H6EA 4JK8A 2PFUA 3CERA 4IEIA 4YOYA 3MCPA 3P39A 3O80A 3HM8A 3I55N 1HX1A 3R3LA 4CJ7A 1GLDG 4JKCA 1NJIO 4WCEL 1OKJA 1H1VA 3CCVN 1XQSC 2W41A 3D2FA 5ADXA 3R6MA 4FWRA 2HBLA 3HTVA 4A62A 4IJNA 4IZ9A 4YOTA 3E66A 2YHXA 1JCFA 4B1ZA 5BREA 1NGIA 2E2PA 2H3GX 4IOXA 3WXKA 1X9JA 1HUXA 1V4TA 5LY3A 3L4IA 4KH5A 5AQHA 4RCHA 4KH4A 4BR7A 4JAXA 3BP8A 2ZJRL 4H0PA 3HOSA 2GWKA 1BA0A 4KBOA 2QWQA 3MN7A 1DT9A 4DHYA 5GADP 3RSEB 4CZMA 3J7ZO 1IJJA 3FZHA 2FSNA 1T3VA 1EQYA 5KPRA 4K25A 4CZEA 1NBWA 3PIOL 1YJNN 2QEXN 5JLHA 5C10A 3CI5A 4WFNL 3MN6A 3GDQA 5M1QA 1HLUA 2QA4N 5C2DA 2W00A 1YHQN 1BWFO 4JNEA 4H5VA 3WQUA 5E84A 4BG8A 1RDUA 4GV9A 4B1YB 3CJ1A 2ZF5O 1U6ZA 1ILYA 4FWPA 4XH5A 2WC9A 4XEIA 3CD6N 3QFPA 3QB0A 1YAGA 2WUSA 1K73O 1YI2N 2FF6A 2NNWA 1ATSA 2FXUA 2P9IA 1NLVA 4XH4A 1TUYA 3LL3A 1TYQB 4RWTA 1Z05A 3CC7N 2ZGZA 3SJHA 3VERA 1VQKN 2P9NA 2PAVA 1HKGA 1W2BM 4BREA 3WT0A 2QI2A 3BUZB 4BC4A 3FGUA 2A6AA 2HBKA 3EKUA 2BH1A 3KZBA 5AFUH 5BR9A 2HBMA 3NVMA 2A42A 1Q18A 2VYPA 3MK6A 2IVOA 3CCQN 4JKGB 3C7NA 1NM1A 4NLCA 3HI0A 3QDKA 3VENA 5BPNA 2C1GA 4CZIA 1VQ8N 2QWRA 4JKGA 3A5NC 3VESA 1MWMA 1VQ9N 5F0XA 4EAHD 3AARA 3G6EN 3ENHA 1SS6A 4BR5A 1TUUA 2JWLA 3EO3A 3SLCA 1K8AO 3E9LA 3ATUA 1VQPN 2KHOA 4FO0A 5AQWA 3KWIA 4CBXA 2Q36A 4FWOA 3UKUB 3WEEB 5FPDA 3LDQA 4MO5A 2YHWA 1S22A 4EFHA 2NRWA 1V4SA 1QVFM 3HZ6A 4BE7B 4FVUA 1NGAA 4BRMA 5AQJA 2A5XA 5AQQA 3EN9A 4PL7A 3FR0A 3QFUA 3OA9A 3TTCA 1HJOA 2P9UA 4BRQA 3MX2A 2NLXA 2ZGYA 4M7YA 4F9OA 5I9EB 4FPBA 4I6MA 1GLAG 4H5RA 4QS8A 3SK3A 4JD2A 3U8XA 4BC2A 4JKBA 1O13A 4H5NA 1ZC6A 4I6MB 3C7NB 4M7XA 1VQON 2Q2RA 3VGKA 1BG3A 1QHAA 3L0QA 4XH1A 3O9UA 4BRLA 2VCPA 3A8YA 4DCHA 5AZJA 2GUPA 3CHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WOQ A;  4M63 C;  2HOE A;  5AQS A;  4FL9 A;  4CZK A;  3H3O B;  4CZG A;  3UKU A;  3WEE A;  3A5L C;  2CGJ A;  4GY2 B;  1JCE A;  3J8A A;  4BRP A;  2NRH A;  2YJE A;  4CI6 A;  2E2Q A;  2IIR A;  3CJ7 A;  1SAZ A;  3VF2 A;  3FZF A;  4QS9 A;  3D2E A;  1ZBS A;  2ASP A;  1Z6R A;  1QQM A;  4MLE A;  4Y0W A;  5AQI A;  1NGH A;  4BGB A;  1HPM A;  4FOI A;  5AQX A;  1GLJ O;  3VF6 A;  4IXC A;  3VF4 A;  4BRF A;  3A5M C;  4PKH A;  1YUW A;  3FLC O;  4CZL A;  1BOT O;  4BRC A;  3ZX3 A;  3IFR A;  4K42 A;  3QIC A;  1BU6 O;  1DKG D;  4H0O A;  1SQK A;  2DPN A;  1JCG A;  4BRH A;  5AZJ B;  1J6Z A;  3O1B A;  2V7Z A;  4BR2 A;  2QWN A;  3H46 O;  3M1F A;  3FFK B;  4WQ4 A;  4BGA A;  2QWP A;  4BC5 A;  4B1V A;  2D4W A;  2FSJ A;  3CJ9 A;  1U2V A;  3F9M A;  5AQP A;  5AZI A;  5TKY A;  2QW9 A;  4JHD A;  3D2E B;  1GLC G;  4O5F A;  1T44 A;  1T6C A;  5AQZ A;  2E1Y A;  1K8K A;  3AAQ A;  3VEY A;  5F1X A;  1E4F T;  1DEJ A;  3FZK A;  3EL2 A;  4B1X B;  2ASM A;  3ATV A;  2P9I B;  3I8B A;  4IWV A;  3D7E O;  1XC3 A;  2P9K B;  1P8Z A;  1RFQ A;  3LM2 A;  3A5O C;  1NGC A;  3U9Z A;  3QBW A;  3EZW A;  3IDH A;  2VWB A;  1SZ2 A;  3DXK B;  3BEX A;  3HBT A;  3A0I X;  3M6G A;  3WXL A;  4CD1 A;  3RSE A;  5AQF A;  3ZX2 A;  5KQD A;  3CIP A;  4H0Y B;  3VEX A;  5AQN A;  1U2V B;  5FPE A;  5KQ8 A;  5ADX H;  2A41 A;  1KAY A;  5JMV A;  2I7P A;  3FZM A;  3O8M A;  5BRD A;  3BF1 A;  5AQY A;  4DB3 A;  5AQT A;  4QS7 A;  5JIC A;  3SMP A;  4K41 A;  4BRA A;  2HMP A;  3WXI A;  3LDL A;  2QWO A;  4B1U B;  4BRI A;  4CD3 A;  5EOY A;  3DXM A;  3ZEU B;  3H1Q A;  1RDW X;  1X3N A;  2V7Y A;  3LM9 A;  3DWL A;  5BRH A;  1KXP A;  4CZF A;  3P4I A;  4ISF A;  5ELZ A;  3CET A;  2E20 A;  2PBD A;  4IJA A;  5LJV A;  4EHT A;  3B8A X;  3EKS A;  4Z94 A;  2Q1N A;  4FWL A;  2QXL A;  2P9P A;  3VPZ A;  3W0L A;  3H3N O;  4H0T B;  3MMV A;  3IUC A;  3GBT A;  1TYQ A;  3WXJ A;  4BR0 A;  4BC3 A;  4BVP A;  1NGG A;  4H5T A;  2E2N A;  3BF3 A;  2D0P A;  4WQ4 C;  5EX5 A;  4CZH A;  1ZXO A;  4BQL A;  3VEV A;  3CQX A;  2ASO A;  5EXW A;  3U9D A;  5BPM A;  5JLF A;  3O4W A;  4WYB A;  4MLH A;  4B1W B;  1E4G T;  3LDN A;  4FWM A;  2CGK A;  4FOE A;  2AP1 A;  3O6W A;  1GLF O;  2CH5 A;  4JHD B;  5AQO A;  4A2B A;  3LDP A;  2ZWH A;  1NMD A;  5EVZ A;  3AAP A;  1T6D A;  3D2F B;  5BRF A;  2YJF A;  5E26 A;  4BQZ A;  2W40 A;  1QQN A;  3ID8 A;  3ZX0 A;  2EWS A;  3FZL A;  2P9U B;  4FPA A;  4BRN A;  4CZJ A;  4BRK A;  4J8F A;  2J4R A;  1ESV A;  4ISG A;  3GOI A;  2P9K A;  3QML A;  3DAW A;  1KAX A;  1MWK A;  4GNI A;  3I33 A;  1NWK A;  4BR4 A;  1HKC A;  1MDU B;  1ATR A;  2UYT A;  4NO7 A;  1HKB A;  2HF4 A;  3TPQ A;  3O08 A;  5CE3 A;  2YCH A;  5FPN A;  2V51 B;  3R9P A;  1GLE G;  4CBW A;  3QBX A;  4FSV A;  4LC9 B;  3UB5 A;  3G25 A;  3FE1 A;  5F2R A;  2IVN A;  4IO8 A;  1NGD A;  3VGL A;  5B8H A;  3S41 A;  3OHR A;  4MO4 A;  4H0X B;  1BA1 A;  2FLO A;  4PKG A;  4CBU A;  1C0F A;  2D1K A;  4BRG A;  2A40 A;  2OAN A;  4EIA A;  4HTL A;  1NGB A;  4JN4 A;  4AM7 A;  2IVP A;  3CQY A;  1Y64 A;  3W3D A;  4PKI A;  4BRO A;  2FF3 B;  2P9S B;  4A2A A;  5AQG A;  2GEL A;  3UKR A;  4DQ8 A;  1GLL O;  3VEO A;  4O8K A;  1NGJ A;  3VEW A;  4AM6 A;  1KAZ A;  3O1W A;  2A3Z A;  3AY9 A;  5AQV A;  3VEZ A;  1BUP A;  2Q0R A;  1DGK N;  5AQK A;  1C0G A;  3H45 C;  5AZI B;  1NGF A;  2V52 B;  3U4L A;  2GEM A;  3ZET A;  5EY4 A;  2Q31 A;  3ULE B;  1QZ6 A;  5BN8 A;  4RTF D;  2E1Z A;  2P9L B;  3DXM B;  3WUH A;  3ZEU A;  2E2O A;  1MA9 B;  2FSK A;  2F9T A;  3O5B A;  2GWJ A;  5AFU A;  3KHY A;  3GL1 A;  3R8E A;  5FPM A;  2QM1 A;  3MN5 A;  3LDO A;  4K43 A;  2NZT A;  4BVO A;  3M3Z A;  3WQT A;  4HWI A;  4A61 A;  2YI1 A;  3GG4 A;  4JD2 B;  2ITM A;  5LJW A;  2P9P B;  4PL8 A;  4L3Q A;  5BN9 A;  4BG9 A;  3CJB A;  4H03 B;  4FWQ A;  4WQ5 A;  3UKR B;  2E8A A;  1R59 O;  1D4X A;  1XUP O;  4YDU A;  2BUP A;  5KPZ A;  1IG8 A;  3C0B A;  5KPT A;  1NGE A;  3DJC A;  2E88 A;  4FWN A;  1G99 A;  1ATN A;  3L6Q A;  2P9L A;  1RGI A;  3GE1 A;  1QZ5 A;  4C23 A;  1WUA A;  2Q97 A;  3ZET B;  3ULE A;  4BR9 A;  4B9Q A;  3IMX A;  4FWS A;  1YVN A;  3VET A;  1LCU A;  4YDU C;  3HSC A;  1BO5 O;  4ISE A;  5AQM A;  2HF3 A;  4NB4 A;  1X3M A;  1YXQ A;  2CH6 A;  3MN9 A;  4WQ5 C;  3CJA A;  1QQO A;  4H5W A;  1LOT B;  3ENO A;  3JS6 A;  5AQU A;  3SMS A;  2P9S A;  2P9N B;  4H0V B;  3UE5 A;  2Q0U A;  4BRD A;  3VGM A;  3DXK A;  5AR0 A;  4EHU A;  3TU5 A;  5AQR A;  5AQL A;  2F9W A;  2D0O A;  3H1V X;  1GLB G;  5BPL A;  2BTF A;  2QWM A;  3VOV A;  4E1J A;  3JXU A;  4FWK A;  3KVG A;  3CJC A;  1CZA N;  2AA4 A;  1BDG A;  2GTD A;  3MDQ A;  2QWL A;  2YHY A;  1S3X A;  1K8K B;  2CGL A;  2I7N A;  3H6E A;  3CER A;  3MCP A;  3O80 A;  3HM8 A;  1HX1 A;  4CJ7 A;  1GLD G;  1OKJ A;  1H1V A;  1XQS C;  2W41 A;  3D2F A;  5ADX A;  3R6M A;  4FWR A;  3HTV A;  4A62 A;  4IJN A;  4IZ9 A;  2YHX A;  1JCF A;  4B1Z A;  5BRE A;  1NGI A;  2E2P A;  2H3G X;  3WXK A;  1X9J A;  1HUX A;  1V4T A;  5LY3 A;  3L4I A;  5AQH A;  4RCH A;  4BR7 A;  4JAX A;  3BP8 A;  4H0P A;  2GWK A;  1BA0 A;  4KBO A;  2QWQ A;  3MN7 A;  4DHY A;  3RSE B;  4CZM A;  1IJJ A;  3FZH A;  2FSN A;  1EQY A;  5KPR A;  4K25 A;  4CZE A;  1NBW A;  5JLH A;  3CI5 A;  3MN6 A;  3GDQ A;  1HLU A;  1BWF O;  4JNE A;  4H5V A;  3WQU A;  5E84 A;  4BG8 A;  4B1Y B;  3CJ1 A;  2ZF5 O;  1U6Z A;  4FWP A;  4XH5 A;  4XEI A;  3QFP A;  3QB0 A;  1YAG A;  2WUS A;  2FF6 A;  1ATS A;  2FXU A;  2P9I A;  1NLV A;  4XH4 A;  1TUY A;  3LL3 A;  1TYQ B;  4RWT A;  1Z05 A;  2ZGZ A;  3SJH A;  3VER A;  2P9N A;  2PAV A;  1HKG A;  4BRE A;  3WT0 A;  3BUZ B;  4BC4 A;  3FGU A;  2A6A A;  5AFU H;  3EKU A;  3KZB A;  5BR9 A;  2A42 A;  1Q18 A;  2VYP A;  3MK6 A;  2IVO A;  5BPN A;  3C7N A;  1NM1 A;  3HI0 A;  3QDK A;  3VEN A;  4CZI A;  2QWR A;  3A5N C;  3VES A;  1MWM A;  5F0X A;  4EAH D;  3AAR A;  3ENH A;  4BR5 A;  1TUU A;  3EO3 A;  3SLC A;  3ATU A;  2KHO A;  4FO0 A;  5AQW A;  4CBX A;  5FPD A;  2Q36 A;  4FWO A;  3UKU B;  3WEE B;  3LDQ A;  4MO5 A;  2YHW A;  1S22 A;  4EFH A;  1V4S A;  3HZ6 A;  1NGA A;  4BRM A;  5AQJ A;  2A5X A;  5AQQ A;  3EN9 A;  4PL7 A;  3FR0 A;  3QFU A;  1HJO A;  2P9U A;  4BRQ A;  4F9O A;  2NLX A;  2ZGY A;  4M7Y A;  5I9E B;  4FPB A;  4I6M A;  1GLA G;  4H5R A;  4QS8 A;  3SK3 A;  4JD2 A;  3U8X A;  4BC2 A;  4H5N A;  1ZC6 A;  4I6M B;  3C7N B;  4M7X A;  2Q2R A;  3VGK A;  1BG3 A;  1QHA A;  3L0Q A;  4XH1 A;  4BRL A;  2VCP A;  3A8Y A;  4DCH A;  5AZJ A;  2GUP A;  3CHW A; 
#chains in the Genus database with same CATH topology
 4WFA L;  3E1Y A;  1WOQ A;  2IC3 A;  2O8C A;  4FL9 A;  3LAM A;  4CZG A;  4GY2 B;  1SKR A;  2E2Q A;  3TSQ A;  4DV6 K;  2QKB A;  3AA3 A;  1SAZ A;  5M1K A;  2OA8 A;  1N36 K;  4QS9 A;  5I42 A;  4C1N I;  4ILJ A;  4FJ8 A;  1T8E A;  4CEQ A;  4MLE A;  5K14 A;  4Y0W A;  4CK2 A;  1RCH A;  5C15 A;  2YNF A;  4FOI A;  4BE2 A;  2O8E A;  1IBK K;  4FYD A;  4IXC A;  3OY9 A;  3ULD A;  4BRF A;  1BOT O;  3P5J A;  3MX5 A;  3DRP A;  5J2M A;  4FJ7 A;  1WBD A;  4K8Z A;  3PX4 A;  5BR8 K;  2QWN A;  3AA5 X;  4ID5 A;  3H46 O;  3M1F A;  3HK2 A;  3FFK B;  4WQ4 A;  4OKK A;  4B3S K;  4BC5 A;  1U2V A;  2HHX A;  3F9K A;  4E3S A;  1WBB A;  2QW9 A;  4DV5 K;  3D2E B;  3CPE A;  3NF8 A;  5SZT A;  5AQZ A;  2E1Y A;  3TTF A;  1DEJ A;  4C8N A;  4DR5 K;  3I8B A;  3KLI A;  3KWG A;  1S1V A;  3VQD A;  3LM2 A;  1RDB A;  3A5O C;  4BEB A;  3U9Z A;  3QBW A;  1SZ2 A;  3DXK B;  4B9V A;  3BEX A;  3HBT A;  4DSK A;  5KQD A;  3ZT2 A;  4H0Y B;  3LDS A;  5ADX H;  2O8F B;  4OPA A;  4MDA A;  3O8M A;  4FCY A;  4R5P A;  3C65 A;  5HL7 L;  4QS7 A;  3L8B A;  5GAE P;  5JIC A;  2C1I A;  2HMP A;  2QWO A;  2OTJ N;  4BRI A;  1EWQ A;  3H1Q A;  1RDW X;  3DWL A;  1KXP A;  4IOC L;  3F2K A;  3P4I A;  1A5V A;  2B5J A;  3CET A;  3ZLJ A;  3OYB A;  2PBD A;  5GIP A;  4Z94 A;  2Q1N A;  2QXL A;  1LV5 A;  4OX9 K;  3W0L A;  4PY5 A;  4KHU A;  3IUC A;  3GBT A;  1JL2 A;  4BC3 A;  4CJQ A;  4H5T A;  4RW4 A;  2RKI A;  4BQL A;  1VQ5 N;  4KTQ A;  3MAQ A;  1UAX A;  5EXW A;  2HB5 A;  2WTU A;  4MLH A;  3LAK A;  1E3M A;  4LSL A;  2PYJ A;  4FWM A;  2CGK A;  3V9U A;  3VQQ A;  2AP1 A;  3N4P A;  5AQO A;  3SCX A;  4A2B A;  4CF0 A;  1N34 K;  3DLK A;  3K5O A;  3TSU A;  1T6D A;  3L4Q A;  3D2F B;  4HUF A;  4DR2 K;  4DTO A;  2YJF A;  2W40 A;  3ZX0 A;  4YHH K;  1OH8 A;  3PY8 A;  3FZL A;  2P9U B;  4CEB A;  3ZYY X;  4BRN A;  3SBT A;  4CHO A;  3AVN A;  4ISG A;  3GOI A;  3QO9 A;  1NWK A;  4BR4 A;  1SKS A;  1ATR A;  2Y1I A;  5HBM A;  4AHU A;  3AVF A;  3RRH A;  1HKB A;  4JI8 K;  1RDD A;  2YCH A;  2WFB A;  2XHB A;  3R9P A;  3VMF B;  3OYG A;  3KTQ A;  1GLE G;  4E72 A;  4A5B A;  3FE1 A;  1T7P A;  1LWE A;  2IVN A;  2HHQ A;  3TAE A;  3MED A;  4CER A;  3NGI A;  3AVG A;  4CFC A;  2FLO A;  4ZTJ A;  4PKG A;  4DQP A;  1QVG M;  4X64 K;  4BE1 A;  1NK0 A;  1QS4 A;  3THY B;  4FJ9 A;  4CJT A;  4CHP A;  1NGB A;  4OPH A;  1YJW N;  2F7T A;  2IVP A;  3CQY A;  4PKI A;  3HRG A;  2FF3 B;  4BRO A;  1N6Q A;  4CEC A;  3CCJ N;  1KTQ A;  4A2A A;  5AQG A;  5MLC Q;  4JI4 K;  1NK7 A;  2VGM A;  3I56 N;  1JLQ A;  3PUF A;  1GLL O;  3VEO A;  5DM6 L;  4O8K A;  1NK6 A;  3F5T A;  4KRF A;  4CF2 A;  3VN5 A;  3CQ8 A;  3PLA A;  4X66 K;  1XHZ A;  1VQM N;  2Q0R A;  4BAC A;  3HOT A;  2KQ2 A;  3TAQ A;  1JJ2 M;  5EY4 A;  1HQE A;  2HNY A;  2Q31 A;  1QZ6 A;  1FJG K;  2O4I A;  3FFI A;  1TKT A;  4Z4I A;  5JVG L;  2E2O A;  1DTQ A;  4CHQ A;  1TKZ A;  3D45 A;  1Q7Y O;  3EE9 A;  3GL1 A;  1GOA A;  3K57 A;  4K43 A;  3SBG A;  4BVO A;  1HMV A;  3M3Z A;  4Y1D A;  3GG4 A;  2ITM A;  2ZQB A;  4PHT X;  4DWI A;  1VSJ A;  4QAG A;  3G4S N;  3UKR B;  1R59 O;  1VSH A;  3NMU A;  3C6A A;  4KV8 A;  2BUP A;  2B6A A;  4FLY A;  3MWT A;  3NFA A;  5KPT A;  4F2R A;  3OYL A;  3TAG A;  4LF9 K;  1N8R O;  4MDB A;  4F8R A;  4JEP A;  3IMX A;  4B9Q A;  4M3Y A;  1HJR A;  4YDU C;  5HOO A;  3LWM A;  1ITG A;  4RG8 A;  3OYA A;  5HRO A;  1X3M A;  3A2F A;  3AO4 A;  3CYM A;  3CJA A;  4XJX A;  1QQO A;  4H5W A;  4RW9 A;  3AVI A;  4H0V B;  4BRD A;  3PIP L;  1HYS A;  3DXK A;  4E0D A;  5KGW A;  5HRN A;  4TSX A;  5AQR A;  4DTU A;  2D0O A;  1IBL K;  4Q5V A;  4JKE A;  3C94 A;  4JI7 K;  4GVM A;  4C8L A;  4Z0U A;  3JXU A;  3QEW A;  4FWK A;  3NF7 A;  5J2Q A;  1CZA N;  5HRR A;  3WNG A;  2GTD A;  2OZM A;  5J2N A;  2QWL A;  2YHY A;  2CGL A;  2I7N A;  1BQN A;  3OS2 A;  3L2U A;  3MCP A;  5KRT A;  1C0M A;  2XY7 A;  1U48 A;  4KHN A;  5A2Q O;  3CCV N;  1XQS C;  3D2F A;  3UIQ A;  4JYA K;  3J81 O;  4DFK A;  4IJN A;  4FLW A;  3J80 O;  3WXK A;  2ETJ A;  4IOX A;  3AVH A;  1HUX A;  1V4T A;  4M45 A;  2G8W A;  1T05 A;  4LY7 A;  4JAX A;  3HOS A;  1BI4 A;  1L3S A;  1DT9 A;  4DHY A;  3L3V A;  1IG9 A;  2O8B B;  3QER A;  2NUB A;  4K25 A;  3V1Q A;  1VHX A;  3OTO K;  1X9S A;  1HLU A;  4DTJ A;  5C2D A;  4W5T A;  3WQU A;  4KPY A;  4DFM A;  3CJ1 A;  2VG6 A;  3HST B;  4FWP A;  1QHT A;  4XH5 A;  4IG3 A;  2VQE K;  4BWM A;  1YI2 N;  2FF6 A;  2NNW A;  4LF6 K;  1X9W A;  1QTM A;  1TUY A;  1TYQ B;  4DV1 K;  4N47 A;  3IRX A;  1HNW K;  1QQC A;  4EZ6 A;  2QI2 A;  3BUZ B;  4BC4 A;  2BH1 A;  1KVB A;  2A42 A;  1Q18 A;  4AHR A;  4F3O A;  3ISN C;  1B9D A;  3TAN A;  1NM1 A;  1T03 A;  4CZI A;  1RIL A;  4JKG A;  4CJV A;  3JAM O;  4B3O A;  5F0X A;  2YKM A;  3HP6 A;  3AAR A;  5DMR A;  3LPU A;  1X1P A;  4BR5 A;  4KO0 A;  3EO3 A;  3J7Y P;  4FM0 A;  3KKR A;  4CBX A;  3KWI A;  1O1W A;  4FWO A;  3UKU B;  3WEE B;  1S1W A;  2X78 A;  4J2D A;  4QCL A;  4FJH A;  4MO5 A;  1QVF M;  3HZ6 A;  4LF5 K;  2G8F A;  4BRM A;  3SNN A;  5AQJ A;  3LAL A;  3V9Z A;  3AA2 A;  2HVI A;  3FR0 A;  5LMU K;  2HHS A;  5C25 A;  4FLU A;  4BRQ A;  3MX2 A;  2NLX A;  4LFA K;  3P1G A;  4FPB A;  3T1A A;  1GLA G;  3U8X A;  4JD2 A;  2IDO A;  3JSM A;  3C7N B;  4CF1 A;  3HVT A;  3VGK A;  1BHL A;  3HYF A;  3L0Q A;  4BRL A;  1REV A;  3A8Y A;  3AVM A;  1RT1 A;  2GUP A;  4M63 C;  3THW B;  2HOE A;  1D8Y A;  3H3O B;  4FJK A;  1TL1 A;  3E9P A;  3J8A A;  1DTT A;  2NRH A;  2YJE A;  4BRP A;  5I3U A;  2W6K A;  1QSS A;  2A1R A;  4DF4 A;  5HRP A;  1ZBS A;  2HHT A;  1J9A A;  4ILH A;  1TKX A;  3AVL A;  3V1O A;  4BGB A;  3K59 A;  2BAN A;  2XY8 A;  1HPM A;  4YOR A;  5AQX A;  1GLJ O;  3O3G A;  1KQS M;  4DSJ A;  4DSI A;  1KD1 O;  1B92 A;  1KCF A;  1SUQ A;  3A5M C;  4HVJ A;  5T7B A;  3Q7B A;  3FLC O;  4CZL A;  4HUE A;  4V19 S;  3N4Q A;  4K42 A;  4LF4 K;  4JI3 K;  3QIC A;  2O8C B;  4CGJ A;  4OPK A;  3THV A;  4BRH A;  2KW4 A;  1J6Z A;  3MXM A;  4KFB A;  3O3H A;  2V7Z A;  3E01 A;  4ELT A;  1VQL N;  3CCR N;  3QEV A;  2BE2 A;  3CJ9 A;  5AZI A;  5CYM A;  1ASU A;  3DMJ A;  2OCE A;  3TAR A;  4G9Z A;  4C8M A;  1T44 A;  3QEX A;  4CK1 A;  1OVQ A;  3FZK A;  5HRS A;  2Z1I A;  1WN7 A;  2Y1J A;  3SI6 A;  3AGK A;  1RFQ A;  3OVN A;  4QOZ B;  4DS4 A;  4ILG B;  4JI1 K;  3M6G A;  3WXL A;  3RSE A;  3CIP A;  2HHU A;  1IH7 A;  1U2V B;  3ZT4 A;  5KQ8 A;  4DR6 K;  3BZK A;  4DLE A;  1Q81 O;  2I7P A;  3FZM A;  1VQN N;  2O8B A;  3RMD A;  4DB3 A;  1ZBH A;  4K41 A;  2UXD K;  2Z1H A;  2GX9 A;  3CFO A;  4A5A A;  3DXM A;  1X3N A;  3K5M A;  2V7Y A;  3CG7 A;  4ISF A;  4IG0 A;  5ELZ A;  2E20 A;  3K2P A;  1U49 A;  4N5S A;  4KTZ A;  4W5O A;  1IO2 A;  4EHT A;  3EKS A;  4J2E A;  3H3N O;  3MMV A;  3VQ6 A;  1TYQ A;  2HNZ A;  1LAV A;  1NGG A;  2QTD A;  3NHG A;  5EX5 A;  2O8D A;  3ZSR A;  1ZXO A;  5GAH P;  4F3T A;  3BZC A;  1WSI A;  2ASO A;  4E89 A;  4E7J A;  2PZS A;  3DLB A;  1RDC A;  4B1W B;  4YOV A;  3Q7C A;  3HP9 A;  2YHB A;  4J2A A;  2ZWH A;  1NMD A;  5BRF A;  5E26 A;  4KHP K;  3S9H A;  1QQN A;  2QKK A;  3ID8 A;  4KAZ A;  1VSM A;  3HVR A;  3SQ4 A;  4FPA A;  4CZJ A;  4BRK A;  2UXC K;  4AHT A;  3OJU A;  2J4R A;  1ESV A;  1Q9X A;  4NCB A;  3O9Q A;  3QML A;  1MWK A;  3D0P A;  4FJJ A;  1HKC A;  2HHV A;  4K0K K;  3TTD A;  4PUO A;  3AA4 A;  1BIS A;  2KZM A;  4B3T K;  1Q86 O;  4CFA A;  1J53 A;  4YOU A;  2ZD1 A;  4FSV A;  5M1F A;  4IFE A;  4CHY A;  3NH2 A;  4IO8 A;  1VAZ A;  3SPZ A;  3VGL A;  4FK4 A;  3OHR A;  1BQM A;  4MO4 A;  4M41 A;  4LF8 K;  3DLE A;  1ZBI A;  3ZSZ A;  3DM2 A;  1S9E A;  4KHQ A;  2F4V K;  3V1R A;  4MFB A;  5SWM A;  1OH6 A;  3TAF A;  4FM2 A;  1YIJ N;  3G71 N;  4DU4 A;  4M3X A;  4JN4 A;  1Y64 A;  3W3D A;  4KB0 A;  5CHI A;  4JK9 A;  4CVN E;  4BDY A;  3ZT3 A;  1YIT N;  1JLC A;  3AGR A;  3O9S A;  4CJL A;  4DQ8 A;  4KI6 A;  4DU1 A;  2O8D B;  3NGZ A;  3AO1 A;  2A3Z A;  2VGN A;  3O1W A;  1RBT A;  1M90 O;  3AY9 A;  4O8U A;  1BUP A;  1DGK N;  2W42 A;  5GAG P;  3H45 C;  3CXC M;  4YY3 K;  3ZET A;  1KRP A;  4GKK K;  4JI0 K;  1KFS A;  5DM7 L;  3SUO A;  4RTF D;  2P9L B;  1K9M O;  3MEE A;  1XHX A;  3WUH A;  3ZEU A;  1RTD A;  3ITH A;  2FSK A;  3IG1 A;  3ID6 A;  1YF5 L;  5FPM A;  3MN5 A;  3R1X A;  3CFP A;  2HST A;  4A61 A;  1HRH A;  4CJ5 A;  4O0I A;  4NCA A;  1HNI A;  2P9P B;  1C1B A;  1XMO K;  4AQY K;  1S1X A;  2E8A A;  2I5J A;  4JI6 K;  3S3O A;  3VQC A;  4CGG A;  4YDU A;  4OO1 J;  4DMN A;  3B6P A;  3ENB A;  4W5Q A;  1Q82 O;  1N33 K;  1KC8 O;  3U3Y A;  1UWB A;  1ATN A;  5C0Y A;  3GE1 A;  3DLG A;  4IDH A;  3K5L A;  2RPI A;  3QIO A;  3T19 A;  4FWS A;  3VET A;  3M8P A;  4FW1 A;  3NH0 A;  1BO5 O;  4I2Q A;  4ISE A;  4CJK A;  4CIE A;  2CH6 A;  3T7Z A;  3CC2 N;  2B4J A;  1LW2 A;  3ASM A;  5AQU A;  3UE5 A;  2Q0U A;  3O4Q A;  5AR0 A;  1FKP A;  4EHU A;  2F9W A;  5LMN K;  3C95 A;  2DFH A;  3HPH A;  3OS0 A;  3OBY A;  3KVG A;  1BDG A;  4DR3 K;  1N32 K;  3VQ9 A;  5IT9 O;  1K8K B;  4JK8 A;  4JLH A;  2YNG A;  4IEI A;  5D3G A;  1EX4 A;  3S3N A;  4CJ7 A;  1GLD G;  4DLG A;  1OKJ A;  2OPS A;  4H8K A;  5ADX A;  2E6M A;  3RMA A;  3R6M A;  3LP2 A;  3HTV A;  4Q0B A;  3CM5 A;  4RW8 A;  2H3G X;  3PO4 A;  4OPJ A;  4NYN A;  4M3U A;  4KH5 A;  3DOL A;  4BR7 A;  4OLB A;  3ALY A;  1KVA A;  2GWK A;  1BA0 A;  4KBO A;  3OYE A;  3DLR A;  4F2S A;  3T1H K;  1JKH A;  3J7Z O;  1IJJ A;  3FZH A;  4CZE A;  3PIO L;  4DFP A;  3MEC A;  5JLH A;  5C10 A;  3CI5 A;  3GDQ A;  5M1Q A;  2E4L A;  2R7Y A;  2QA4 N;  4DV4 K;  4Z4C A;  5E84 A;  1Q9Y A;  1K6Y A;  1FW6 A;  2WC9 A;  3EZ5 A;  3CD6 N;  1ASW A;  2WUS A;  1L5U A;  3O4N A;  1ATS A;  3SPY A;  4CES A;  4KKO A;  4XH4 A;  3LL3 A;  4RWT A;  2ZGZ A;  3VER A;  1VQK N;  4BWJ A;  4FJX A;  1W2B M;  1B9F A;  3WT0 A;  2UUB K;  2A6A A;  2HBK A;  3EKU A;  1D9F A;  2HBM A;  3NVM A;  4IBN A;  3MK6 A;  2IVO A;  3CCQ N;  3QDK A;  2HHI A;  2XRI A;  2HHH K;  3A5N C;  2DFF A;  1MWM A;  1IKW A;  1LWC A;  4NXN K;  1NKC A;  1SS6 A;  1TUU A;  3VQE A;  1HNV A;  2JWL A;  3RRG A;  1VQP N;  2KHO A;  4CJS A;  3LDQ A;  3L3U A;  1NJZ A;  4OGE A;  2DTU A;  1S22 A;  4BE7 B;  1GOB A;  1JXE A;  2XY6 A;  1ZBF A;  4I2P A;  1GOC A;  1NK9 A;  2P5O A;  3HJF A;  4F9O A;  4M7Y A;  5I9E B;  4CJE A;  3BGR A;  4H5R A;  4QS8 A;  4BC2 A;  4JKB A;  2FBX A;  4I6M B;  1JLB A;  2Q2R A;  2HND A;  3ZSO A;  4XH1 A;  2OZS A;  5AZJ A;  4DCH A;  2QXF A;  4CGF A;  1RT6 A;  3CHW A;  3TAB A;  4UQG A;  3EY1 A;  3AO2 A;  4CZK A;  3UKU A;  3WEE A;  3A5L C;  2CGJ A;  5J2P A;  3WNF A;  1WNS A;  2IIR A;  3CJ7 A;  1DLO A;  4JI5 K;  1I39 A;  3L2W A;  4GV3 A;  4BEC A;  2G8U A;  3LP3 A;  3V81 A;  3FZF A;  2OPP A;  3CCE N;  4M3Z A;  3SUN A;  2Q3S A;  4C8O A;  1YVU A;  4CK3 A;  4JI2 K;  3T69 A;  1SKW A;  5AQI A;  3ZT1 A;  3AVB A;  4KB1 A;  3CC4 N;  3VTH A;  2XY5 A;  1I3A A;  1J5E K;  3VF6 A;  3K9J A;  3SV3 A;  5IWA K;  2BDP A;  2EHG A;  5CZ1 A;  3KJV A;  1FKO A;  3CF5 L;  4PKH A;  2NRT A;  3NF9 A;  4BRC A;  3HO1 A;  1VQ4 N;  3IFR A;  1BU6 O;  3DOK A;  3P31 A;  4H0O A;  4L8R B;  2DPN A;  1JCG A;  4JS5 A;  3O3F A;  4BR2 A;  4CGH A;  2QWP A;  4JKH A;  4N41 A;  3KD5 E;  2KLA A;  4B1V A;  4DQS A;  3J7A P;  5AQP A;  3F9M A;  5JS1 A;  4KH6 A;  5TKY A;  5GIN A;  4AF1 A;  5JVH L;  4O5F A;  1KSP A;  1K8K A;  3AAQ A;  4CJP A;  2Z1G A;  5F1X A;  4DV3 K;  4B1X B;  4DF8 A;  4A57 A;  1CZ9 A;  3ATV A;  3VTI A;  2P9I B;  2FC0 A;  3RTV A;  5GIO A;  5CR4 A;  2FBV A;  4IWV A;  4B9L A;  1JL1 A;  2P9K B;  1P8Z A;  4B9T A;  5E41 A;  3QIN A;  3L2V A;  4CCH A;  3ZSY A;  1NJY A;  3OYN A;  3AVA A;  3IDH A;  2VWB A;  4B08 A;  5JEN A;  2RN2 A;  3I8D A;  4X62 K;  1TL3 A;  3NF6 A;  5AQF A;  3ZX2 A;  1A5X A;  4DQI A;  2HBJ A;  5FPE A;  3T3F A;  3MWP A;  1KAY A;  2KKZ A;  5HP1 A;  3THX A;  4FLT A;  1HYZ A;  2NRZ A;  5AQY A;  5AQT A;  4AHV A;  1W97 L;  3WXI A;  3LDL A;  4C8K A;  4B1U B;  4CD3 A;  5EOY A;  2FBT A;  3VQ8 A;  4FJI A;  5BRH A;  3NGY A;  3ZSW A;  3L2R A;  5KI6 A;  4CZF A;  4B9N A;  4B9U A;  3CCM N;  1HYV A;  4IJA A;  5LJV A;  3LWL A;  3CMA N;  4FWL A;  1EWR A;  3VPZ A;  1MU2 A;  4U7B A;  4KHW A;  5KRS A;  4O4G A;  3EYZ A;  1RNH A;  4BVP A;  2D0P A;  5KTQ A;  1NG9 A;  3K58 A;  3KK7 A;  4MQ3 A;  1C0T A;  5BPM A;  3O4W A;  5EU7 A;  4WYB A;  1UA0 A;  1JLF A;  1TK5 A;  1NOY A;  3OJS A;  3LPT A;  3SUP A;  3I0S A;  2CH5 A;  2OPR A;  3LDP A;  1RT4 A;  4CJR A;  3CPW M;  4DUY K;  4CJ3 A;  2EWS A;  2D0B A;  3TSP A;  4HHT A;  5C12 A;  1TK0 A;  3M8Q A;  4LD0 A;  2P9K A;  3DYA A;  2F96 A;  4GNI A;  2KFZ A;  1S1T A;  2UYT A;  4DTM A;  4N76 A;  4NO7 A;  4FXD A;  1EP4 A;  3O08 A;  4CF9 A;  5CE3 A;  2V51 B;  4E1M A;  3SAH A;  2O4G A;  4CBW A;  3QBX A;  4LC9 B;  3UB5 A;  3CCL N;  3SZ2 A;  1SL0 A;  3NBP A;  1I94 K;  3NVK A;  2LSN A;  4ZHR A;  5B8H A;  3S41 A;  2OYQ A;  2HHW A;  1VSE A;  4N56 A;  2D1K A;  4DTR A;  4IKF A;  4FLV A;  1XC9 A;  4WFB L;  1S6P A;  2WBN A;  2OAN A;  4EIA A;  2WOM A;  3THY A;  4FW2 A;  1WLJ A;  4K8X A;  2JWK A;  1HNX K;  4OGC A;  1NGJ A;  4W5N A;  4AM6 A;  1KAZ A;  4PA1 A;  3VEZ A;  2UXB K;  2O8F A;  4DSL A;  3G10 A;  5AZI B;  1NGF A;  1RT2 A;  2V52 B;  3U4L A;  2YX6 A;  2GEM A;  3DLH A;  2X6S A;  3ULE B;  3ZSX A;  3HPO A;  2VWK A;  4Z4E A;  4CIF A;  4M3R A;  3T1Y K;  1CLQ A;  5TKW A;  3KHY A;  3PX0 A;  3RMC A;  3R8E A;  3LDO A;  4GVE A;  2NZT A;  3ZT0 A;  4LH4 A;  3WQT A;  4BY9 C;  4O0J A;  1IKV A;  4LSN A;  3OYM A;  4BG9 A;  4FVM A;  1D4X A;  4NYF A;  1QSY A;  4CED A;  4M3W A;  3CM6 A;  1XUP O;  4H4O A;  5KPZ A;  1FXX A;  4FM1 A;  3KLG A;  1IG8 A;  3DJC A;  4FWN A;  2G8I A;  1G99 A;  1LWF A;  2P9L A;  1RGI A;  1WAF A;  3OS1 A;  3PV8 A;  2Q97 A;  3THX B;  3ZET B;  1J5O A;  1RBS A;  3MEG A;  3TWH A;  2NRV A;  1YVN A;  2P1J A;  5H1S Q;  3PSF A;  5AQM A;  2HF3 A;  1EO1 A;  2GV9 A;  4NB4 A;  1L3T A;  1U4B A;  3MN9 A;  5DK5 A;  4WQ5 C;  3NH1 A;  2ZJQ L;  3MCA B;  1LOT B;  3JS6 A;  5C24 A;  1S72 N;  2P9N B;  1OH7 A;  4CE9 A;  2EX3 A;  3AO3 A;  3VGM A;  3OBW A;  2DY4 A;  4Y1C A;  2ITG A;  4X65 K;  3H1V X;  1XMQ K;  4DSF A;  1F21 A;  3ZSV A;  3VOV A;  3CJC A;  2AA4 A;  3MDQ A;  4IDK A;  2RHK A;  1NMN A;  1XWL A;  3H6E A;  2PFU A;  1KVC A;  1S9G A;  3LZJ A;  1RTI A;  4YOY A;  3O80 A;  3I55 N;  4OVL A;  4JKC A;  1J54 A;  2W41 A;  2P51 A;  4DR1 K;  2HBL A;  3DI6 A;  3VQ4 A;  4IZ9 A;  4A62 A;  5HLF A;  1CZB A;  1NGI A;  1Q8I A;  2E2P A;  5AJ3 K;  1NK5 A;  4KTW A;  3L4I A;  1BI4 B;  5AQH A;  4CJF A;  4RCH A;  1U45 A;  4KH4 A;  2ZJR L;  3BP8 A;  2QWQ A;  3VA0 A;  5GAD P;  4YFU A;  2FSN A;  1T3V A;  1EQY A;  1NBW A;  4KRE A;  2QEX N;  2KZZ A;  4LF7 K;  4G1Q A;  4CF8 A;  3MN6 A;  1VSI A;  3PX6 A;  2W00 A;  1NU0 A;  3QES A;  4GV9 A;  4B1Y B;  1U6Z A;  1ILY A;  4I7F A;  3RMB A;  3VQP A;  1JLA A;  3WNE A;  4HCB A;  3QFP A;  3QB0 A;  4E7K A;  2FBY A;  1CXQ A;  3IAY A;  2X74 A;  1BIU A;  1NLV A;  1IKY A;  1Z05 A;  2G8V A;  2P9N A;  2ATQ A;  2PAV A;  1HKG A;  1VK0 A;  1S5J A;  1NKE A;  4BRE A;  3FGU A;  4OLA A;  3KZB A;  5BR9 A;  1CXU A;  1BL3 A;  4JKG B;  4NLC A;  4YNQ A;  3VEN A;  2YKN A;  1D5A A;  1NK4 A;  3VES A;  1VQ9 N;  2YV0 X;  4EAH D;  3EEQ A;  2HW3 A;  1RTJ A;  3AV9 A;  3B6O A;  1NJW A;  3E9L A;  4GW6 A;  5FPD A;  4FJM A;  2YHW A;  2NRW A;  1V4S A;  4EZ9 A;  4CEO A;  5AQQ A;  4PL7 A;  3EN9 A;  3TAM A;  3QFU A;  3OA9 A;  3M8S A;  5FRN A;  3LAN A;  1SL1 A;  2P9U A;  1X9M A;  2ZGY A;  1EET A;  3KKS A;  1VRU A;  1KLN A;  2IAJ A;  1O13 A;  4H5N A;  1ZC6 A;  4GMJ B;  4M7X A;  3KLE A;  5FRM A;  4I9Q A;  3M8R A;  2UU9 K;  4FLZ A;  1Y97 A;  2IS3 A;  3OYF A;  2VCP A;  4HTU A;  1VRT A;  3V9X A;  3QNN A;  4FJ5 A;  4BE0 A;  5AQS A;  4R79 A;  4O5B A;  1JCE A;  5FRO A;  2D0A A;  4CI6 A;  4DUZ K;  4JK7 A;  3VF2 A;  4AH9 A;  1S1U A;  3DRS A;  4JKF A;  3D2E A;  3CME N;  3PO5 A;  3SV4 A;  2ASP A;  4NCG A;  4NLB A;  1LAW A;  3SAG A;  1Z6R A;  3DRR A;  1QQM A;  1IV0 A;  1NGH A;  3VA3 A;  4O44 A;  3OYJ A;  3ZSQ A;  5C2F A;  3VF4 A;  1A5W A;  1ZBL A;  1YUW A;  1ZYQ A;  3ZX3 A;  2IGI A;  1WAJ A;  3WNH A;  4Z4H A;  2ZM6 K;  1DKG D;  1HPZ A;  1XNQ K;  2G8H A;  3KK1 A;  1SQK A;  2KFN A;  4BDP A;  1XNR K;  5AZJ B;  3QIP A;  3O1B A;  3SAF A;  3RR7 A;  3I0R A;  4BGA A;  2D4W A;  2FSJ A;  4EP4 A;  1ASV A;  1ZBU A;  3CFR A;  3KLF A;  2Z1J A;  3C6U A;  4JKA A;  4JHD A;  1GLC G;  1T6C A;  1RBR A;  3VEY A;  4CGI A;  1E4F T;  4JRP A;  3EL2 A;  3SJJ A;  2ASM A;  3JYT A;  4Z4G A;  4C1N K;  3D7E O;  2RF2 A;  1XC3 A;  2F8T A;  1VSD A;  2ZE2 A;  5CZ2 A;  1NGC A;  1WSE A;  3EZW A;  4LFB K;  4U67 L;  1L3V A;  3A0I X;  4CD1 A;  4UY8 O;  3VEX A;  5AQN A;  4RW7 A;  2A41 A;  5JMV A;  1QE1 A;  5M1N A;  5BRD A;  3BF1 A;  4DTP A;  4FZY A;  3S5T A;  1IKX A;  3SMP A;  4BRA A;  3VQA A;  1TKD A;  4WF9 L;  3ZEU B;  1C1A A;  3M5R A;  4CFD A;  4DR4 K;  3LM9 A;  3AVC A;  2AJQ A;  5KGX A;  1NKB A;  1WSH A;  2KTQ A;  4DG1 A;  3OYK A;  3OYD A;  3NAE A;  4DKW A;  3B8A X;  4A59 A;  1WSG A;  3VQ5 A;  1N5Y A;  2P9P A;  4H0T B;  4B3R K;  4FJL A;  4FJG A;  3WXM B;  3WXJ A;  4BR0 A;  5FDL A;  2D5R A;  2E2N A;  3BF3 A;  4CEF A;  4OJR A;  4WQ4 C;  4CZH A;  3VEV A;  4JRQ A;  3CQX A;  3H08 A;  2E5L K;  4O55 A;  4FJN A;  3V6D A;  3U9D A;  5JLF A;  2IOC A;  1E4G T;  3LDN A;  3LZI A;  4HUG A;  1M1K O;  3O9T A;  3LP0 A;  4FOE A;  3O6W A;  1GLF O;  1QSL A;  3IS9 A;  4JHD B;  3K5N A;  4IOA L;  3TAP A;  5EVZ A;  3AAP A;  4KHS A;  1VQ7 N;  2DFE A;  4BQZ A;  2NRR A;  1WB9 A;  1TVR A;  4GV6 A;  4J8F A;  1VSK A;  5J1E A;  4DFJ A;  4ZTF A;  2HMI A;  4LH5 A;  3DAW A;  1KAX A;  4B8C A;  3I33 A;  1NK8 A;  1MDU B;  1U04 A;  2HF4 A;  3RR8 A;  3TPQ A;  4CEE A;  5FPN A;  4AHS A;  4M42 A;  5JS2 A;  3L2Q A;  2VWJ A;  3G25 A;  1NOZ A;  4WE1 A;  5F2R A;  3OYH A;  1YJ9 N;  4NXM K;  4KHY A;  1NGD A;  4ELV A;  4LFC K;  4H0X B;  4M3T A;  1BA1 A;  1C0U A;  1TGO A;  3E9O A;  4CBU A;  4E1N A;  1C0F A;  1HNZ K;  4BRG A;  4DV2 K;  3S3M A;  4FK2 A;  2A40 A;  2JLE A;  1C6V A;  2WON A;  1NJX A;  4HTL A;  2PYL A;  3EE8 A;  3MXI A;  2D0C A;  4AM7 A;  2JGU A;  3KD1 E;  2YHA A;  3TI0 A;  3OW2 M;  1G15 A;  2P9S B;  1C1C A;  3DLL L;  3U3G A;  1NNE A;  2GEL A;  3UKR A;  3U6F A;  1KFD A;  4ELU A;  3RVC A;  3QLH A;  3KK3 A;  4DTX A;  1HR0 K;  4JV5 K;  3VEW A;  2UUA K;  4YOW A;  1WSJ A;  1YTA A;  3HM9 A;  1KLM A;  4GKJ K;  5AQV A;  2RE2 A;  1TAU A;  1Z25 A;  5AQK A;  1C0G A;  1VQ6 N;  1VSF A;  3QET A;  3F73 A;  4CW7 B;  1W0H A;  2ZJP L;  1D9D A;  4E7I A;  5BN8 A;  4E7H A;  3CCS N;  4CEA A;  2E1Z A;  3O9R A;  3DXM B;  1S6Q A;  2OTL N;  1MA9 B;  2X6N A;  3V9W A;  2F9T A;  4W5R A;  3O5B A;  2GWJ A;  5AFU A;  4DTN A;  3KK2 A;  3CCU N;  2QM1 A;  1RT3 A;  1OVY A;  1R0A A;  4HWI A;  5M1P A;  4DV7 K;  2YI1 A;  4JD2 B;  5LJW A;  2F8S A;  1W7A A;  4PL8 A;  4L3Q A;  3P38 A;  5BN9 A;  3HXM A;  3CJB A;  4H03 B;  3SQ0 A;  4FWQ A;  1LW0 A;  4WQ5 A;  3PSI A;  3NE6 A;  1L3U A;  2NRX A;  2OPQ A;  4IEE A;  1RDA A;  1HQU A;  4DSE A;  1YT3 A;  3AVK A;  4EP5 A;  3HT3 A;  3C0B A;  2E6L A;  1NGE A;  2E88 A;  1JXB A;  3L6Q A;  1QZ5 A;  4C23 A;  1WUA A;  4FK0 A;  1OH5 A;  4JKD A;  3ULE A;  4BR9 A;  4CHZ A;  5M1O A;  3QEI A;  4PQU A;  1LCU A;  3HSC A;  3TR8 A;  2A1S A;  4B9S A;  1BIZ A;  4DR7 K;  1YXQ A;  4J2B A;  2P5G A;  3SYZ A;  4IO9 L;  1JLG A;  3K9K A;  3ENO A;  3C6H A;  3SMS A;  2P9S A;  1RBV A;  3KLH A;  1P90 A;  1RTH A;  3D6R A;  4IFV A;  4CEZ A;  4DS5 A;  3TU5 A;  4DQQ A;  3RWU A;  5AQL A;  4YOX A;  3SQ2 A;  2YNI A;  2GUI A;  1GLB G;  5BPL A;  5C42 A;  1U47 A;  2BTF A;  2QWM A;  4E1J A;  1TV6 A;  2W6L A;  3QNO A;  3IKM A;  2QK9 A;  4JS4 A;  3CYG A;  4AIL C;  1S3X A;  2YNH A;  4CJU A;  4CHN A;  3CER A;  3P39 A;  4B9M A;  3V4I A;  3HM8 A;  1RT7 A;  1HX1 A;  3R3L A;  1NJI O;  4WCE L;  4HCC A;  3C6T A;  1XI1 A;  1H1V A;  2VQF K;  3SQ1 A;  4FWR A;  4OKJ A;  4YOT A;  4F4K A;  3E66 A;  2YHX A;  1JCF A;  3K0S A;  4B1Z A;  5BRE A;  4I9L A;  1RBU A;  5FLX O;  1RT5 A;  1X9J A;  5LY3 A;  3NCI A;  4Z4F A;  4H0P A;  1YTU A;  1BGX T;  4DQR A;  3VQB A;  3P83 D;  4CIG A;  3MN7 A;  4CJW A;  3BDP A;  4CFB A;  3RSE B;  4CZM A;  3OYC A;  4DTS A;  1FK9 A;  1BCO A;  5KPR A;  4ICL A;  1YJN N;  1UOC A;  4FLX A;  3ZCM A;  4WFN L;  2XO7 A;  1YHQ N;  1BWF O;  4JNE A;  4H5V A;  4B3M K;  1VSL A;  4BG8 A;  1RDU A;  2ZF5 O;  2VG7 A;  3VQ7 A;  3OYI A;  4XEI A;  1W9H A;  1EKE A;  1YAG A;  4CJ4 A;  3SUQ A;  1K73 O;  3AVJ A;  3HPG A;  1TK8 A;  4ID1 A;  2UUC K;  2FXU A;  2P9I A;  3NDK A;  4AHC A;  4OKE A;  2O8E B;  3CC7 N;  2G8K A;  3SJH A;  1TAQ A;  1SV5 A;  3V9S A;  5AFU H;  2VYP A;  4BDZ A;  5BPN A;  3C7N A;  2C1G A;  3HI0 A;  1VQ8 N;  1EXQ A;  2QWR A;  4IFY A;  4RW6 A;  4H4M A;  3LP1 A;  1IBM K;  4PWD A;  3G6E N;  3ENH A;  3MXJ A;  3G0Z A;  3THW A;  1JLE A;  3SLC A;  1K8A O;  4KI4 A;  4FZX C;  3ATU A;  1UA1 A;  4FO0 A;  5AQW A;  2Q36 A;  3BY5 A;  3QEP A;  3AO5 A;  5CYQ A;  4EFH A;  5CY4 A;  4FZZ A;  4FVU A;  1NGA A;  3HL8 A;  2A5X A;  4B8A B;  3TTC A;  1HJO A;  4E19 A;  4DU3 A;  2BGG A;  4I6M A;  4XIU A;  5LL6 Z;  3SK3 A;  4DV0 K;  2GBZ A;  1VQO N;  1SL2 A;  1WSF A;  1Z26 A;  1BCM A;  1BG3 A;  4CGD A;  1QHA A;  2VG5 A;  2HVH A;  3O9U A;  2PY5 A;  4E7L A;  3KIO A; 
#chains in the Genus database with same CATH homology
 4WFA L;  3E1Y A;  1WOQ A;  4M63 C;  2HOE A;  5AQS A;  4FL9 A;  4CZK A;  4R79 A;  3H3O B;  4CZG A;  3UKU A;  3WEE A;  3A5L C;  2CGJ A;  4GY2 B;  1JCE A;  3E9P A;  3J8A A;  4BRP A;  2NRH A;  2YJE A;  4CI6 A;  4JK7 A;  2E2Q A;  2IIR A;  3CJ7 A;  3TSQ A;  4GV3 A;  4BEC A;  1SAZ A;  3VF2 A;  5M1K A;  3FZF A;  4QS9 A;  4JKF A;  3D2E A;  3CCE N;  3CME N;  4C1N I;  4ILJ A;  1ZBS A;  2ASP A;  4NLB A;  3T69 A;  4ILH A;  3SAG A;  1Z6R A;  1QQM A;  4MLE A;  4Y0W A;  5AQI A;  1NGH A;  4BGB A;  3CC4 N;  5C15 A;  1HPM A;  4FOI A;  3VTH A;  4YOR A;  5AQX A;  1GLJ O;  3VF6 A;  3K9J A;  1KQS M;  5C2F A;  4IXC A;  3VF4 A;  1KD1 O;  4BRF A;  3A5M C;  3CF5 L;  4PKH A;  1YUW A;  2NRT A;  3FLC O;  3Q7B A;  1BOT O;  4BRC A;  3ZX3 A;  3N4Q A;  4CZL A;  3MX5 A;  1VQ4 N;  3IFR A;  4K42 A;  3QIC A;  1BU6 O;  1DKG D;  3P31 A;  4H0O A;  1SQK A;  2DPN A;  1JCG A;  4BRH A;  5AZJ B;  1J6Z A;  3O1B A;  3SAF A;  2V7Z A;  4BR2 A;  2QWN A;  3H46 O;  3M1F A;  3FFK B;  4WQ4 A;  4BGA A;  2QWP A;  3CCR N;  4JKH A;  1VQL N;  2KLA A;  4B1V A;  2D4W A;  2FSJ A;  3CJ9 A;  1U2V A;  3F9M A;  5AQP A;  4BC5 A;  5AZI A;  4KH6 A;  5TKY A;  2QW9 A;  4AF1 A;  5GIN A;  4JKA A;  4JHD A;  3D2E B;  1GLC G;  4O5F A;  5JVH L;  1T44 A;  4G9Z A;  1T6C A;  3CPE A;  5AQZ A;  2E1Y A;  1K8K A;  3AAQ A;  3VEY A;  3TTF A;  5F1X A;  1E4F T;  1DEJ A;  3FZK A;  3EL2 A;  4B1X B;  2ASM A;  4A57 A;  3ATV A;  3VTI A;  2P9I B;  5GIO A;  5CR4 A;  3I8B A;  4IWV A;  4C1N K;  3D7E O;  1XC3 A;  2P9K B;  3AGK A;  1P8Z A;  3KWG A;  1RFQ A;  3LM2 A;  3A5O C;  1NGC A;  4BEB A;  3U9Z A;  4ILG B;  3QBW A;  3EZW A;  3IDH A;  2VWB A;  4U67 L;  1SZ2 A;  3DXK B;  3BEX A;  3HBT A;  3A0I X;  3M6G A;  3WXL A;  4CD1 A;  3RSE A;  4UY8 O;  5AQF A;  3ZX2 A;  5KQD A;  3CIP A;  2HBJ A;  4H0Y B;  3VEX A;  5AQN A;  1U2V B;  5FPE A;  5KQ8 A;  5ADX H;  2A41 A;  3MWP A;  1Q81 O;  1KAY A;  2KKZ A;  5JMV A;  2I7P A;  3FZM A;  4MDA A;  3O8M A;  4OPA A;  5M1N A;  5BRD A;  1VQN N;  2NRZ A;  3BF1 A;  5AQY A;  3C65 A;  4DB3 A;  5AQT A;  4QS7 A;  5HL7 L;  5GAE P;  5JIC A;  3SMP A;  4K41 A;  1W97 L;  4BRA A;  2HMP A;  2C1I A;  3WXI A;  3LDL A;  2QWO A;  4B1U B;  4BRI A;  2OTJ N;  2GX9 A;  4WF9 L;  4CD3 A;  5EOY A;  4A5A A;  3DXM A;  3ZEU B;  3H1Q A;  1RDW X;  1X3N A;  3M5R A;  2V7Y A;  3LM9 A;  3DWL A;  5BRH A;  1KXP A;  4IOC L;  4CZF A;  3F2K A;  3P4I A;  4ISF A;  5ELZ A;  3CET A;  3CCM N;  2E20 A;  2PBD A;  4IJA A;  5LJV A;  4EHT A;  5GIP A;  4DKW A;  3B8A X;  3EKS A;  4Z94 A;  2Q1N A;  4FWL A;  4A59 A;  3CMA N;  2QXL A;  2P9P A;  3VPZ A;  3W0L A;  3H3N O;  4H0T B;  4U7B A;  3MMV A;  3IUC A;  3GBT A;  1TYQ A;  3WXM B;  3WXJ A;  4BR0 A;  4BC3 A;  4BVP A;  1NGG A;  2QTD A;  2E2N A;  3BF3 A;  4H5T A;  2D0P A;  4WQ4 C;  5EX5 A;  4CZH A;  1ZXO A;  4BQL A;  5GAH P;  3VEV A;  1VQ5 N;  3KK7 A;  3CQX A;  2ASO A;  5EXW A;  3U9D A;  5BPM A;  5JLF A;  3O4W A;  4WYB A;  4MLH A;  4B1W B;  4YOV A;  1E4G T;  3LDN A;  3Q7C A;  1M1K O;  3O9T A;  4FWM A;  2CGK A;  4FOE A;  2AP1 A;  3O6W A;  1GLF O;  3N4P A;  2CH5 A;  4JHD B;  5AQO A;  4IOA L;  4A2B A;  3LDP A;  2ZWH A;  1NMD A;  5EVZ A;  3AAP A;  3TSU A;  1T6D A;  3L4Q A;  3D2F B;  5BRF A;  1VQ7 N;  2YJF A;  5E26 A;  4BQZ A;  2NRR A;  2W40 A;  1QQN A;  3CPW M;  3ID8 A;  3ZX0 A;  2EWS A;  3FZL A;  4GV6 A;  2P9U B;  3TSP A;  4FPA A;  3ZYY X;  4BRN A;  4CZJ A;  4BRK A;  4J8F A;  3SBT A;  5C12 A;  2J4R A;  1ESV A;  4ISG A;  3GOI A;  2P9K A;  3O9Q A;  3QML A;  3DAW A;  1KAX A;  1MWK A;  4GNI A;  3I33 A;  1NWK A;  4BR4 A;  1HKC A;  1MDU B;  1ATR A;  2UYT A;  4NO7 A;  3TTD A;  1HKB A;  2HF4 A;  3TPQ A;  3O08 A;  1Q86 O;  5CE3 A;  2YCH A;  5FPN A;  2V51 B;  2WFB A;  4YOU A;  3R9P A;  3VMF B;  3SAH A;  1GLE G;  4CBW A;  3QBX A;  4FSV A;  5M1F A;  4A5B A;  4LC9 B;  3UB5 A;  3CCL N;  3G25 A;  3FE1 A;  4IFE A;  5F2R A;  3NVK A;  2IVN A;  4IO8 A;  1VAZ A;  1YJ9 N;  1NGD A;  3VGL A;  5B8H A;  3S41 A;  3OHR A;  4MO4 A;  4H0X B;  1BA1 A;  2FLO A;  3E9O A;  4PKG A;  4CBU A;  1C0F A;  2D1K A;  4BRG A;  1QVG M;  2A40 A;  4WFB L;  2WBN A;  2OAN A;  4EIA A;  4HTL A;  1NGB A;  1YIJ N;  4OPH A;  3EE8 A;  3G71 N;  1YJW N;  2F7T A;  4JN4 A;  4AM7 A;  2IVP A;  3CQY A;  1Y64 A;  3W3D A;  4PKI A;  3HRG A;  2FF3 B;  4BRO A;  5CHI A;  3OW2 M;  4JK9 A;  2P9S B;  3CCJ N;  4A2A A;  1YIT N;  5AQG A;  5MLC Q;  3DLL L;  2JWK A;  2GEL A;  2VGM A;  3I56 N;  3UKR A;  3AGR A;  3O9S A;  4DQ8 A;  3RVC A;  1GLL O;  3VEO A;  5DM6 L;  4O8K A;  1NGJ A;  3F5T A;  3VEW A;  4AM6 A;  4YOW A;  1KAZ A;  3O1W A;  2A3Z A;  2VGN A;  1M90 O;  3AY9 A;  5AQV A;  2RE2 A;  4O8U A;  3VEZ A;  3PLA A;  1BUP A;  1VQM N;  2Q0R A;  1DGK N;  5AQK A;  1C0G A;  1VQ6 N;  3HOT A;  5GAG P;  3H45 C;  5AZI B;  1NGF A;  3CXC M;  2V52 B;  3U4L A;  1JJ2 M;  2YX6 A;  2GEM A;  3ZET A;  5EY4 A;  2ZJP L;  2Q31 A;  3ULE B;  1QZ6 A;  5BN8 A;  5DM7 L;  4RTF D;  3CCS N;  2E1Z A;  2P9L B;  1K9M O;  3O9R A;  3DXM B;  3WUH A;  3ZEU A;  2OTL N;  5JVG L;  2E2O A;  1MA9 B;  2FSK A;  1Q7Y O;  2F9T A;  3O5B A;  2GWJ A;  5AFU A;  3ID6 A;  5TKW A;  1YF5 L;  3EE9 A;  3KHY A;  3CCU N;  3GL1 A;  3R8E A;  5FPM A;  2QM1 A;  3MN5 A;  3LDO A;  3R1X A;  4GVE A;  4K43 A;  2HST A;  1OVY A;  2NZT A;  3SBG A;  4BVO A;  3M3Z A;  3WQT A;  4HWI A;  5M1P A;  4A61 A;  2YI1 A;  3GG4 A;  4JD2 B;  2ITM A;  5LJW A;  2P9P B;  4PHT X;  4BY9 C;  4PL8 A;  4L3Q A;  3P38 A;  5BN9 A;  3G4S N;  4BG9 A;  3CJB A;  4H03 B;  4FWQ A;  4WQ5 A;  3UKR B;  2E8A A;  1R59 O;  2NRX A;  4IEE A;  1D4X A;  3NMU A;  3C6A A;  1XUP O;  4YDU A;  4OO1 J;  2BUP A;  3ENB A;  5KPZ A;  1IG8 A;  3C0B A;  3MWT A;  5KPT A;  1NGE A;  3DJC A;  1Q82 O;  2E88 A;  4FWN A;  1KC8 O;  1G99 A;  1ATN A;  3L6Q A;  2P9L A;  1RGI A;  3GE1 A;  1QZ5 A;  5C0Y A;  4C23 A;  1WUA A;  4IDH A;  2Q97 A;  3ZET B;  1N8R O;  4JKD A;  3ULE A;  4MDB A;  4BR9 A;  4JEP A;  3IMX A;  4FWS A;  5M1O A;  4B9Q A;  2NRV A;  1YVN A;  3VET A;  1LCU A;  4YDU C;  5HOO A;  3HSC A;  1BO5 O;  5H1S Q;  4ISE A;  5AQM A;  2HF3 A;  1EO1 A;  4NB4 A;  1X3M A;  1YXQ A;  2CH6 A;  3T7Z A;  3CC2 N;  3MN9 A;  4WQ5 C;  3CJA A;  4IO9 L;  4XJX A;  1QQO A;  4H5W A;  2ZJQ L;  3MCA B;  1LOT B;  3ENO A;  3C6H A;  3JS6 A;  3K9K A;  5AQU A;  2P9S A;  3SMS A;  1S72 N;  2P9N B;  4H0V B;  3UE5 A;  2Q0U A;  4BRD A;  3PIP L;  1P90 A;  3DXK A;  3VGM A;  3OBW A;  3D6R A;  5AR0 A;  4EHU A;  3TU5 A;  5AQR A;  5AQL A;  2F9W A;  2D0O A;  4YOX A;  3H1V X;  1GLB G;  5BPL A;  4JKE A;  2BTF A;  2QWM A;  3VOV A;  4E1J A;  3JXU A;  4FWK A;  3IKM A;  3OBY A;  3KVG A;  3CJC A;  1CZA N;  2AA4 A;  1BDG A;  2GTD A;  3MDQ A;  2RHK A;  2QWL A;  2YHY A;  1S3X A;  1K8K B;  2CGL A;  2I7N A;  3H6E A;  4JK8 A;  2PFU A;  3CER A;  4IEI A;  4YOY A;  3MCP A;  3P39 A;  3O80 A;  3HM8 A;  3I55 N;  1HX1 A;  3R3L A;  4CJ7 A;  1GLD G;  4JKC A;  1NJI O;  4WCE L;  1OKJ A;  1H1V A;  3CCV N;  1XQS C;  2W41 A;  3D2F A;  5ADX A;  3R6M A;  4FWR A;  2HBL A;  3HTV A;  4A62 A;  4IJN A;  4IZ9 A;  4YOT A;  3E66 A;  2YHX A;  1JCF A;  4B1Z A;  5BRE A;  1NGI A;  2E2P A;  2H3G X;  4IOX A;  3WXK A;  1X9J A;  1HUX A;  1V4T A;  5LY3 A;  3L4I A;  4KH5 A;  5AQH A;  4RCH A;  4KH4 A;  4BR7 A;  4JAX A;  3BP8 A;  2ZJR L;  4H0P A;  3HOS A;  2GWK A;  1BA0 A;  4KBO A;  2QWQ A;  3MN7 A;  1DT9 A;  4DHY A;  5GAD P;  3RSE B;  4CZM A;  3J7Z O;  1IJJ A;  3FZH A;  2FSN A;  1T3V A;  1EQY A;  5KPR A;  4K25 A;  4CZE A;  1NBW A;  3PIO L;  1YJN N;  2QEX N;  5JLH A;  5C10 A;  3CI5 A;  4WFN L;  3MN6 A;  3GDQ A;  5M1Q A;  1HLU A;  2QA4 N;  5C2D A;  2W00 A;  1YHQ N;  1BWF O;  4JNE A;  4H5V A;  3WQU A;  5E84 A;  4BG8 A;  1RDU A;  4GV9 A;  4B1Y B;  3CJ1 A;  2ZF5 O;  1U6Z A;  1ILY A;  4FWP A;  4XH5 A;  2WC9 A;  4XEI A;  3CD6 N;  3QFP A;  3QB0 A;  1YAG A;  2WUS A;  1K73 O;  1YI2 N;  2FF6 A;  2NNW A;  1ATS A;  2FXU A;  2P9I A;  1NLV A;  4XH4 A;  1TUY A;  3LL3 A;  1TYQ B;  4RWT A;  1Z05 A;  3CC7 N;  2ZGZ A;  3SJH A;  3VER A;  1VQK N;  2P9N A;  2PAV A;  1HKG A;  1W2B M;  4BRE A;  3WT0 A;  2QI2 A;  3BUZ B;  4BC4 A;  3FGU A;  2A6A A;  2HBK A;  3EKU A;  2BH1 A;  3KZB A;  5AFU H;  5BR9 A;  2HBM A;  3NVM A;  2A42 A;  1Q18 A;  2VYP A;  3MK6 A;  2IVO A;  3CCQ N;  4JKG B;  3C7N A;  1NM1 A;  4NLC A;  3HI0 A;  3QDK A;  3VEN A;  5BPN A;  2C1G A;  4CZI A;  1VQ8 N;  2QWR A;  4JKG A;  3A5N C;  3VES A;  1MWM A;  1VQ9 N;  5F0X A;  4EAH D;  3AAR A;  3G6E N;  3ENH A;  1SS6 A;  4BR5 A;  1TUU A;  2JWL A;  3EO3 A;  3SLC A;  1K8A O;  3E9L A;  3ATU A;  1VQP N;  2KHO A;  4FO0 A;  5AQW A;  3KWI A;  4CBX A;  2Q36 A;  4FWO A;  3UKU B;  3WEE B;  5FPD A;  3LDQ A;  4MO5 A;  2YHW A;  1S22 A;  4EFH A;  2NRW A;  1V4S A;  1QVF M;  3HZ6 A;  4BE7 B;  4FVU A;  1NGA A;  4BRM A;  5AQJ A;  2A5X A;  5AQQ A;  3EN9 A;  4PL7 A;  3FR0 A;  3QFU A;  3OA9 A;  3TTC A;  1HJO A;  2P9U A;  4BRQ A;  3MX2 A;  2NLX A;  2ZGY A;  4M7Y A;  4F9O A;  5I9E B;  4FPB A;  4I6M A;  1GLA G;  4H5R A;  4QS8 A;  3SK3 A;  4JD2 A;  3U8X A;  4BC2 A;  4JKB A;  1O13 A;  4H5N A;  1ZC6 A;  4I6M B;  3C7N B;  4M7X A;  1VQO N;  2Q2R A;  3VGK A;  1BG3 A;  1QHA A;  3L0Q A;  4XH1 A;  3O9U A;  4BRL A;  2VCP A;  3A8Y A;  4DCH A;  5AZJ A;  2GUP A;  3CHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...