4I6MA

Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of swi/snf chromatin remodeler.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
465
structure length
399
Chain Sequence
b'TLNRKCVVIHNGSHRTVAGFSNVELPQCIIPSSYIKRTEAEFIFGTYNMIDAAAEKRNGDEVYTLVDSQGLPYNWDALEMQWRYLYDTQLKVSPEELPLVITMPATNGKPDMAILERYYELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIGASGCNVTPIIDGIVVKNAVVRSKFGGDFLDFQVHERLAPLIKEEQKRSTDVWYEASTWIQQFKSTMLQVSEKDLFELERYYKEQADIYAKQQENNPLVQKKNFLFKPLNKTLTLDLKECYQFAEYLFKPQLISDKFSPEDGLGPLMAKSVKKAGASISPEQVYSLLLTNVIITGSTSLIEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGWLGALTMANLPSWSLGKWYSKEDYETLKRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 7
publication title Structure of an actin-related subcomplex of the SWI/SNF chromatin remodeler.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
total genus 107
structure length 399
sequence length 465
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4i6mA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4i6mA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4i6mA03
2OANA 4CBUA 1KXPA 2A42A 2HF3A 4FWNA 3MMVA 4JNEA 4DCHA 1IG8A 4CZFA 2A40A 5I9EB 1KAYA 2IVOA 5AQTA 1JCFA 5LJVA 5AZIA 1HX1A 1HJOA 3G25A 3VEWA 3CQXA 4M63C 4EIAA 4KBOA 4NB4A 4HTLA 1BDGA 5AQYA 4B1YB 4E1JA 2HF4A 2A3ZA 2E2OA 4A62A 4JD2B 1X9JA 5AQZA 3QB0A 5KQ8A 2ZWHA 4BRNA 2E1YA 3IFRA 2P9LA 2E2QA 2V7ZA 4FO0A 3VOVA 5AZJA 1NGEA 5ADXA 4PL7A 2QW9A 2GWJA 3CJBA 3CERA 4FPAA 3JXUA 3U9DA 4CZMA 3A5OC 4EHTA 1QQMA 2GELA 2I7PA 4CZHA 1E4GT 2ASOA 2P9SB 2E20A 5BN8A 2GUPA 2W40A 3CETA 2D0PA 2P9PB 5AQFA 1CZAN 2YHXA 1NMDA 4BREA 4IWVA 3VESA 1DGKN 1LCUA 3UKUA 4B1VA 3H1VX 4C23A 3CJAA 2P9NA 2YCHA 3D2EA 3VF4A 3A0IX 4QS8A 3VEVA 1NGDA 3VGMA 3ULEB 4MO4A 3MN7A 2D0OA 1KAXA 1J6ZA 1ATNA 5AQPA 1DKGD 4JHDA 4BC4A 1HKBA 1SAZA 2I7NA 4ISFA 3I8BA 5BRFA 4EAHD 3MN9A 4IJNA 4BVPA 3U8XA 1TUUA 3VGKA 4BR7A 3O08A 5AR0A 2PBDA 2Q31A 3VGLA 2GEMA 1T6CA 3QMLA 1ZC6A 4IO8A 1BOTO 3EZWA 4WQ5A 3VF2A 5EY4A 3RSEA 1DEJA 2UYTA 3GE1A 5BPNA 1NM1A 4FWQA 3O1WA 4MO5A 5BPLA 3O8MA 2E88A 3ZX3A 5AQJA 2P9PA 3VERA 4H5TA 4H0VB 4WQ4C 5AZIB 2YJEA 2DPNA 2NRHA 1NGJA 3SMSA 1U6ZA 4EHUA 1NLVA 1NWKA 1NGAA 1SZ2A 2EWSA 4QS7A 3UKRA 5AQSA 3VENA 1BG3A 5JLFA 2P9LB 2QWNA 1ESVA 1LOTB 1NGBA 3R6MA 2ZGZA 2Q97A 3M6GA 4M7XA 5AZJB 4BRGA 1GLLO 4CZKA 1Q18A 4HWIA 4K43A 3TPQA 3A5NC 3DWLA 3IDHA 3SJHA 3FZKA 1BA0A 2QWLA 1X3NA 1XC3A 4BC3A 3A5LC 4BRDA 4BRCA 3O80A 1BUPA 3AAPA 2HMPA 2NZTA 4H0OA 5KPZA 1ATRA 4H5RA 3UKUB 2E2PA 1C0GA 3FZHA 5FPNA 1BWFO 2CH6A 2P9NB 4A2BA 3D2EB 3BF1A 3WXJA 3LL3A 3H3NO 4GNIA 4BRFA 1QQOA 1IJJA 3P4IA 3IMXA 4IXCA 2CGKA 3LDOA 4JHDB 4H5VA 2QM1A 5EXWA 4MLEA 1YVNA 3A5MC 3O4WA 3ZX0A 4BGBA 4FPBA 1GLEG 5AQOA 2W41A 4BR4A 3FZMA 2FSJA 4RWTA 2Q2RA 3BP8A 2BTFA 3A8YA 2GWKA 3AY9A 3FR0A 3CIPA 5AQVA 4LC9B 3RSEB 5AQRA 3WQTA 3KZBA 4BRKA 5ELZA 3DAWA 1R59O 2CGJA 5FPEA 1YAGA 4CBXA 2Q1NA 3LM2A 4H5NA 2ASPA 2Q0RA 1V4SA 4Y0WA 2YJFA 3UE5A 4B1ZA 3CHWA 2PAVA 3CJ1A 3H46O 3R9PA 1QZ5A 1RGIA 5AFUA 4BQLA 3W0LA 3M1FA 5BPMA 2IVNA 5EX5A 3SLCA 1QHAA 4WYBA 3UKRB 2A6AA 4CZEA 3SMPA 2P9UA 3U4LA 1EQYA 4WQ5C 3C7NA 2A41A 3R8EA 5AQXA 2ASMA 3L0QA 3WUHA 1G99A 2CH5A 2HOEA 4CZGA 3VF6A 5EOYA 3WXLA 3BEXA 3MK6A 4DHYA 2V52B 4FWRA 4H5WA 4MLHA 4CJ7A 1JCEA 1X3MA 4IJAA 5LY3A 3QBWA 1NGCA 4BGAA 1P8ZA 3O1BA 2F9TA 1U2VA 3QFUA 4BR9A 3ZX2A 3QDKA 5AQMA 3HM8A 5AQGA 2QWOA 4I6MA 4B9QA 1MWKA 1K8KA 3KVGA 4FOIA 1ATSA 2V51B 3ENHA 3BF3A 3D7EO 1ZBSA 1RFQA 4BRAA 1D4XA 4BC2A 1GLFO 4BROA 1OKJA 3ENOA 1JCGA 5AQWA 2E2NA 3D2FA 1TYQA 1NGHA 3HBTA 3EKSA 3M3ZA 3W3DA 4FL9A 3ZETA 4NO7A 2QXLA 1NGIA 1T6DA 2QWPA 1NGGA 3CQYA 3SK3A 2WUSA 4JAXA 2AP1A 3B8AX 3CI5A 3MCPA 1H1VA 2YI1A 5KPRA 3GL1A 1GLCG 2P9KA 1GLDG 2FF3B 3HI0A 4L3QA 2FXUA 2VYPA 4K42A 1WUAA 3ATUA 1YUWA 1Z05A 2QWRA 4EFHA 1HPMA 1HLUA 4O5FA 5EVZA 3H3OB 2FSNA 2QWMA 3LDPA 3H6EA 4A2AA 1KAZA 4DB3A 5BREA 1QQNA 3VEYA 4FOEA 2FLOA 4ISEA 4YDUA 4BRLA 4M7YA 5BRHA 2BUPA 4B1UB 3J8AA 1T44A 2FSKA 1S3XA 3LDQA 4B1WB 2P9UB 5JMVA 3TU5A 3WEEB 5KQDA 1S22A 4ISGA 4PL8A 4F9OA 3C7NB 3MN5A 4A61A 4JN4A 5KPTA 1YXQA 3WXIA 5AQQA 5LJWA 1NBWA 4FWKA 5F2RA 2AA4A 3DXMA 3FFKB 3VEZA 1HUXA 3MDQA 1C0FA 5FPMA 5AQHA 1TUYA 4PKIA 4XH5A 1QZ6A 5F0XA 3VETA 3LM9A 3LDLA 1E4FT 3QFPA 3ZEUA 1U2VB 2Q0UA 2P9IA 3EN9A 2ZGYA 3C0BA 5CE3A 4BRMA 5E84A 4I6MB 4BRHA 5TKYA 3JS6A 3FZLA 4RCHA 5AQUA 1K8KB 3H1QA 4BR0A 4CZJA 4DQ8A 4CZLA 3MN6A 3AAQA 5AQIA 2VWBA 2YHWA 3HZ6A 4FWLA 1RDWX 2VCPA 3CJCA 3VEXA 3D2FB 4GY2B 4K41A 5AQNA 1Y64A 1GLJO 1TYQB 4BRIA 5AQLA 2D4WA 1MA9B 1HKCA 3U9ZA 3IUCA 4CBWA 3ZETB 1BA1A 4BQZA 4FWOA 3WT0A 2E1ZA 3FGUA 2ITMA 2GTDA 4XH1A 3HTVA 3WEEA 1GLBG 1GLAG 3EO3A 3VEOA 4O8KA 4AM7A 1V4TA 3GG4A 2P9KB 5BN9A 4Z94A 3GOIA 3DXKA 5B8HA 2IIRA 3CJ9A 1XUPO 4PKHA 2KHOA 2J4RA 5ADXH 5BRDA 3ID8A 3GBTA 4H0YB 3CJ7A 4CD3A 3FE1A 4K25A 2NLXA 2A5XA 2YHYA 4CD1A 5AFUH 4J8FA 4BR5A 4JD2A 4PKGA 4BC5A 4H0XB 1XQSC 3DJCA 5JICA 4BRPA 3EKUA 2ZF5O 3DXMB 3O6WA 2F9WA 3WQUA 5AQKA 3QICA 3KHYA 3BUZB 1NGFA 1SQKA 3HSCA 4BVOA 3AARA 4CI6A 5F1XA 1WOQA 1BO5O 3ZEUB 4YDUC 2P9IB 4QS9A 2P9SA 4FWPA 4BRQA 1ZXOA 4BG9A 1BU6O 1MWMA 2CGLA 2D1KA 4H0TB 3GDQA 3VPZA 2H3GX 4XH4A 3ATVA 4H03B 5FPDA 2IVPA 1HKGA 4FSVA 3S41A 3ULEA 1Z6RA 2V7YA 4CZIA 4FWSA 3WXKA 3EL2A 3UB5A 4XEIA 5JLHA 2E8AA 2QWQA 3FZFA 3L4IA 4WQ4A 3H45C 3OHRA 4H0PA 3FLCO 3F9MA 3I33A 3L6QA 4IZ9A 4BR2A 3O5BA 3QBXA 4B1XB 5BR9A 3DXKB 4BG8A 1MDUB 2Q36A 4FWMA 4RTFD 4AM6A 3LDNA 5E26A 2FF6A
chains in the Genus database with same CATH superfamily
3KWGA 4CBUA 5KRSA 4JNEA 3MMVA 3QINA 4DQSA 2O8CB 4NYNA 3Q7BA 2IVOA 2ETJA 2YKNA 3O4NA 5LJVA 3N4PA 1HX1A 3OVNA 3G25A 1HPZA 4EIAA 3CQXA 4KBOA 4HTLA 1GOCA 3E66A 3P38A 3NH1A 5C10A 2KQ2A 1RBTA 3L2VA 3HSTB 4A5AA 3CFOA 3LAMA 4DTSA 1TV6A 3BY5A 4R79A 3VOVA 4CHOA 4Z4EA 4O5BA 4KHWA 2GWJA 4KHQA 3U9DA 4CFBA 5HRPA 3V9UA 4EHTA 1QSSA 4CZHA 2GUPA 2A1RA 2YHXA 3SCXA 3ZT3A 1LCUA 3H1VX 1HJRA 4C23A 3CJAA 4PUOA 3PY8A 3VF4A 4B3SK 3C94A 1FJGK 4OGCA 4JKGB 1SKRA 1RDUA 4B9VA 4HVJA 3ULEB 2DFEA 1ATNA 1T3VA 1RT6A 1G15A 4FVMA 4FJIA 3T69A 1X1PA 4ISFA 4LH4A 3VQQA 1YITN 4IJNA 3U8XA 3OYBA 2RPIA 3TTFA 3O08A 5JS2A 4KHYA 3UIQA 3S5TA 1ZC6A 1D9FA 3NGZA 4DTUA 4WFNL 4FWQA 1LWEA 4MO5A 3SJJA 3QNNA 1TK0A 3OS2A 4H5TA 4AF1A 2Z1JA 1RDBA 3CG7A 4Y1DA 2EWSA 2O4IA 3SPYA 1NGBA 3R6MA 2Q97A 5CYMA 4Z4CA 2O8BA 4CZKA 4CJVA 3EYZA 1Q18A 3TPQA 3TABA 1A5VA 3FZKA 2QWLA 3TSQA 3A5LC 1WSJA 4BRCA 3O80A 3AAPA 1VSKA 4BE2A 1Q7YO 2HVIA 4IKFA 3FZHA 3SQ0A 4FJ7A 4JKBA 4FLVA 3WXJA 2VG7A 4EZ6A 3PIOL 4Z4HA 2O8FA 1KVAA 1ZBHA 3AVCA 3P4IA 3KLEA 4CJFA 3MXMA 2QM1A 4JK8A 3ZX0A 5AQOA 2W41A 4B3OA 3OYNA 4J2AA 2O4GA 1ITGA 2FSJA 4FJHA 2Q2RA 3L2WA 3BP8A 2KFNA 2W6KA 1RBRA 5CY4A 4AHUA 5KRTA 3WQTA 4BRKA 5ELZA 3DRRA 5T7BA 1CZBA 1YAGA 1VQPN 3OA9A 2Q1NA 4YHHK 3LM2A 3DLEA 4H5NA 4FLWA 4CCHA 1V4SA 3V9XA 2B6AA 1D9DA 2YJFA 4B1ZA 3H46O 3CCVN 2HW3A 1LWFA 2D0CA 2IVNA 5EX5A 4GV3A 4CZEA 4BECA 2P9UA 4DTJA 3AVAA 2A1SA 3MXJA 3HK2A 5M1QA 2A41A 2JWKA 3I0RA 1FKPA 1T8EA 1G99A 2CH5A 3VF6A 3OYCA 3WXLA 3O3FA 3OJUA 3MK6A 3CCSN 4LFBK 2YV0X 4AHVA 1ZBIA 2UXBK 4MDBA 1QHTA 1P8ZA 3RRHA 3QDKA 5AQGA 3QNOA 4B9QA 1MWKA 3AV9A 1K8KA 1TKTA 2YNIA 1ATSA 3L2UA 3BF3A 4B9NA 4O0IA 5C0YA 1GLFO 4CGGA 3V9WA 3ENOA 1JCGA 2E2NA 2O8FB 1IBMK 2UU9K 3HBTA 3MEDA 4A57A 3OYJA 2G8HA 4DTNA 3AO5A 1ILYA 3TAQA 3LP1A 2D0BA 1A5WA 3CI5A 4OKEA 3ID6A 2QXFA 5HLFA 1H1VA 2YI1A 5KPRA 4CJTA 4UQGA 4FJLA 4N41A 4I9LA 1IKVA 2FF3B 2VYPA 1WUAA 3ATUA 3V1RA 1YUWA 1UOCA 4DV3K 4CGFA 5GINA 1WAFA 4KO0A 1HPMA 4QOZB 1Y97A 1HLUA 3VQ8A 3G71N 3C6HA 4CK2A 4OKJA 3H6EA 4A2AA 1HQUA 4W5TA 2OCEA 1VSEA 4CEDA 4DR5K 1ASVA 4JKCA 1U45A 3MECA 4FCYA 2BUPA 3NH0A 4OLAA 1KLMA 2P9UB 5JMVA 3HT3A 3TU5A 1S22A 2Q3SA 4CJUA 1LW0A 4E7JA 3IRXA 4F9OA 3EE8A 4DMNA 3WXIA 1N8RO 5LJWA 2AA4A 1DTTA 5AQHA 2RKIA 4DU3A 1TUYA 4IG0A 3BGRA 3HJFA 2D5RA 4XH5A 1UA0A 4DLGA 4DF4A 4LF7K 4DSEA 3MEGA 1TAUA 2Q0UA 3E9LA 4DSFA 2OTJN 2DY4A 1FK9A 4BRHA 3JS6A 2HBLA 3AA5X 1EETA 4RCHA 3DOLA 1K8KB 3OYDA 1VQ7N 4BR0A 4CZJA 1QVFM 3MN6A 5C2FA 2VWBA 4PWDA 4W5NA 4DLEA 4FWLA 3CMEN 2VCPA 3VEXA 4K41A 1OH6A 1HKCA 1VQ5N 3IUCA 4J2EA 4CBWA 2X6NA 4NCAA 2E1ZA 3FGUA 5M1NA 2JWLA 1S1XA 3EO3A 4CJRA 4LF8K 3L4QA 4O8KA 3LPUA 5BN9A 3TR8A 1BIZA 4DWIA 4Z94A 2KTQA 1JLFA 3AVNA 3NH2A 2I5JA 1XUPO 2FBTA 2KHOA 1SKWA 3V1OA 1RT2A 1N5YA 1WSGA 3LP2A 1XHZA 3CJ7A 4IEEA 1KQSM 4GKKK 3T3FA 2YHYA 3AVHA 4YOXA 3THVA 1KLNA 4CD1A 1VRUA 1VQNN 2PY5A 2IAJA 4PKGA 4BC5A 2DTUA 1VSMA 1XQSC 3WQUA 1Z26A 3QICA 4W5QA 5C24A 5GIOA 3LP0A 3OYFA 3AARA 4CI6A 4CGIA 3HP6A 4DV4K 1TGOA 4YDUC 3T1YK 1FXXA 1K73O 2GX9A 4BG9A 2YX6A 2HMIA 3PO4A 4U7BA 4ELVA 3CM6A 2HVHA 3I55N 5BR8K 3ATVA 3VQ6A 2C1GA 5FPDA 1EXQA 3NBPA 4M3TA 2ZJQL 3ZCMA 2G8UA 2YHAA 4OLBA 5FRNA 5IWAK 1YHQN 3HOSA 3PUFA 4K0KK 4CHQA 2E8AA 3VQEA 1J54A 3H45C 1KC8O 4CJKA 3FLCO 3WNEA 1YJWN 1DTQA 5HL7L 1NK9A 3SPZA 1RDDA 1JL1A 1VSFA 4DFJA 4CE9A 4DV6K 3VMFB 4BG8A 1MDUB 5GIPA 4JEPA 4DFPA 4IFEA 2PZSA 1RTIA 4RTFD 5E26A 5LMNK 2OANA 1OVYA 3K0SA 2HF3A 4DCHA 4CEAA 4Q0BA 1IG8A 3WXMB 4KREA 2A40A 1WSIA 5AQTA 4CIFA 1JCFA 1RNHA 4CF9A 4OJRA 3VEWA 4M63C 3LPTA 5AQYA 2HF4A 2E2OA 3KWIA 4A62A 2E6MA 1X9JA 3F2KA 5AQZA 5KQ8A 2E1YA 5FRMA 2OPRA 3IFRA 3NE6A 3PSFA 4L8RB 1TVRA 4C8MA 5AZJA 4J2DA 1NGEA 3NVKA 1LV5A 4PL7A 4C1NK 3CERA 4FPAA 3A5OC 2I7PA 4JI5K 1D8YA 3SV4A 2D0PA 2P51A 3VQ7A 5FLXO 3KTQA 2BH1A 1CZAN 3T7ZA 3ZSVA 4CESA 4DTPA 3VESA 3UKUA 4B1VA 3CXCM 2G8KA 3L3VA 2LSNA 3BZCA 2P9NA 2ZJPL 2YCHA 4TSXA 4QS8A 4BEBA 1JLCA 4CEOA 1NGDA 4IDKA 3VGMA 5GAEP 3MN7A 3QEIA 3HO1A 4GVEA 5HRNA 3NF6A 2HBJA 4BC4A 4E3SA 2EX3A 4B08A 1HKBA 2I7NA 2G8WA 4FJNA 4GV6A 3CC2N 2WONA 4FM1A 3O3HA 2QEXN 4BWMA 4JS5A 4M3WA 3MN9A 4BVPA 1KTQA 1BI4A 1TUUA 4K8XA 3DOKA 4BR7A 3CCMN 3VQDA 5AR0A 3CMAN 2PBDA 2Q31A 3AVLA 3VGLA 3U3GA 4WQ5A 1J9AA 3VF2A 5EY4A 2UYTA 3ZT4A 3SQ4A 1S9EA 3RVCA 4HCCA 3QEVA 2E88A 3ZX3A 5AQJA 4HTUA 4C8OA 3VERA 4WQ4C 2YJEA 1K8AO 2QK9A 1NGJA 2KKZA 4JLHA 4YORA 2E6LA 2F4VK 5KI6A 1NLVA 4F3TA 1NWKA 1Q9YA 4QS7A 3UKRA 4FVUA 1BG3A 5JLFA 1NJXA 2RE2A 3RRGA 1EO1A 4M7XA 4FK0A 3Q7CA 5AZJB 3HPHA 3SBTA 3EZ5A 2WOMA 2Z1HA 3A5NC 3DWLA 3IDHA 3SJHA 1NKEA 1I3AA 3DI6A 3D6RA 2RF2A 3VQ4A 4ZTFA 1B9DA 3EEQA 4XJXA 3AVGA 4Z4FA 3F9KA 1ZBUA 3PO5A 4X66K 1VSJA 4H5RA 1REVA 3UKUB 3U6FA 4DV2K 3AVJA 5J2MA 2XY6A 1XWLA 5FPNA 1YIJN 3DLBA 2CH6A 1NKBA 3HPOA 2P9NB 4A2BA 4JI3K 2HHXA 3B6OA 3A2FA 1L3UA 2KZZA 1RDAA 3LL3A 3H3NO 4FW1A 5C25A 1IV0A 4WE1A 3EE9A 1BCMA 4IXCA 2CGKA 3LDOA 4OX9K 3PX6A 3A5MC 1GLEG 3FZMA 1BI4B 2OTLN 4X62K 1QSLA 2BTFA 2Z1IA 4IFVA 1LAWA 1Q82O 4OVLA 3FR0A 4CF2A 3NVMA 4M3YA 1JKHA 2IGIA 4B8CA 4LC9B 5AQRA 3KZBA 1RBVA 3MWPA 3SUQA 2EHGA 4CBXA 3P83D 4BE0A 4I9QA 3ULDA 3M8QA 4Y0WA 1TK5A 3CHWA 2PAVA 4KFBA 3HOTA 2HSTA 1JLEA 4KH6A 3M1FA 1NK4A 3SLCA 1QHAA 4Z0UA 4FM2A 4WYBA 3UKRB 2A6AA 3SMPA 1EQYA 5K14A 1K6YA 3L0QA 3LWLA 3WUHA 2HOEA 3G10A 5EOYA 3BEXA 1NJWA 3MX5A 5M1FA 3VQAA 3CPEA 2V52B 1KD1O 4H5WA 4MLHA 4CJ7A 1JCEA 4JKEA 3QBWA 4M3XA 1NGCA 4BR9A 1U2VA 3ZX2A 5AQMA 4FM0A 2QWOA 1HRHA 5HBMA 1CXUA 3AVFA 4ID1A 3KVGA 2VG6A 3ASMA 3L3UA 3OS0A 1ZBSA 3ZLJA 1VSHA 4C8KA 1RFQA 4BRAA 3AGRA 4E89A 5AQWA 4BDYA 3FFIA 4F8RA 1C0UA 3DLLL 3SQ2A 5GAGP 4NO7A 4M42A 3HP9A 1TL1A 1NGIA 2QWPA 3OBWA 3WNFA 3RMAA 1NGGA 3SK3A 1Q86O 4JAXA 4FLUA 4DR6K 1T05A 2DFHA 3AVIA 4BE7B 2OPQA 1HNXK 4JKFA 3GL1A 1HNVA 1GLDG 4FLYA 4L3QA 1WBBA 2FXUA 4X65K 1BHLA 4K42A 4B9LA 5CR4A 4EFHA 5EVZA 3H3OB 3TAPA 2FSNA 4DB3A 3AVMA 3TAMA 4Z4IA 1QQNA 3VEYA 4YOVA 1LWCA 4FOEA 5TKWA 2FLOA 4CJLA 4Z4GA 4M7YA 4JK9A 2ZM6K 3O3GA 4B1UB 1C0TA 3J8AA 1S3XA 3K5NA 3WEEB 4NLCA 1I39A 1OH5A 5JENA 4LY7A 1VAZA 5AQQA 3DRSA 1NBWA 3PX0A 2OZSA 4JRQA 3FFKB 1HUXA 3MDQA 1C0FA 3LALA 3D45A 4I2QA 2ZJRL 1SUQA 4DTMA 3OYAA 1QZ6A 2ATQA 3VETA 5C15A 4O8UA 3LM9A 3LDLA 1E4FT 3S9HA 1U2VB 4OGEA 1NK0A 3EN9A 5CE3A 1NK8A 1XNQK 1VSLA 4DQPA 4DQ8A 4B3RK 1LAVA 2YHWA 3HZ6A 1RDWX 3CJCA 3THXA 4GY2B 2HHUA 1X9WA 1C1BA 1GLJO 4BRIA 2P5OA 1MA9B 4JRPA 3WNHA 4J2BA 4BQZA 4ZTJA 4U67L 3SYZA 2WC9A 3WT0A 4GVMA 3CCLN 3OS1A 1NJIO 1NJYA 3H08A 2ITMA 2GTDA 4JI6K 4Y1CA 1FKOA 1GLBG 4ID5A 3T1HK 3CD6N 1F21A 1U49A 1XC9A 2RHKA 3OYLA 4KTQA 3AVBA 4CJ5A 3RMBA 1J5EK 1BISA 3JAMO 3OYGA 5B8HA 3K58A 3CCEN 3CJ9A 5LMUK 2J4RA 2P5GA 5BRDA 4OPHA 1EWQA 4HUEA 3LAKA 3SQ1A 4FLTA 1DT9A 1IKXA 1SL0A 3S3MA 4CECA 3OBYA 3PSIA 2NLXA 2QI2A 2A5XA 3KIOA 1M90O 4CEQA 3K9KA 2HBKA 5AFUH 1VQ6N 4FW2A 3O9RA 4JD2A 3TANA 1KFDA 4CK3A 4H0XB 1YJ9N 4IEIA 4BRPA 3EKUA 5HRRA 5JICA 4JYAK 2ZF5O 2UUCK 3O6WA 5CYQA 3SAFA 4FZXC 4YOYA 4DQQA 2Y1JA 4KTZA 4BVOA 2XO7A 1YTUA 5F1XA 4ZHRA 4CF1A 4RW9A 2P9SA 4BRQA 4DUYK 2F8SA 3R1XA 3VPZA 1MWMA 4AHCA 1QVGM 4CW7B 3THXB 4WFBL 4CJQA 3ZSYA 5M1KA 2IVPA 3G4SN 1HKGA 4CHNA 1EWRA 3S41A 1RTDA 4FJ5A 5KGXA 2VWKA 4FK2A 4LF4K 4FJGA 3UB5A 4JI8K 4MFBA 4B9TA 3NCIA 1RT3A 1NU0A 3L4IA 4BDPA 4R5PA 2PYJA 4KPYA 3ALYA 3O5BA 3QO9A 4CERA 4B1XB 1IKYA 4DSJA 4GMJB 2KZMA 3ZSOA 1JXEA 4FWMA 5A2QO 3LZIA 2FF6A 4DV7K 3CCRN 2AJQA 5JS1A 2A42A 4IG3A 1HYSA 5I9EB 5C42A 1KAYA 4GV9A 4JKHA 4RG8A 2JLEA 1TK8A 4JS4A 1BDGA 4B1YB 3TARA 4LFCK 4JD2B 3AA3A 3V1QA 1Q81O 3QB0A 4ELTA 3HVRA 1HQEA 4RW4A 4DU1A 2V7ZA 4RW7A 4CFCA 2QW9A 3CJBA 3ZSXA 4YFUA 4CZMA 3TI0A 1QQMA 4N76A 2GELA 1RBSA 3SUPA 1E4GT 2P9SB 2E20A 2W40A 1RBUA 2P9PB 5AQFA 4FZZA 1NMDA 5KTQA 5HP1A 4CHYA 4YOUA 1B9FA 3A0IX 3OYHA 4LD0A 3K57A 1NK7A 3HPGA 4RW6A 3VEVA 4JV5K 1S1WA 4MO4A 3VQCA 2NNWA 3O9UA 1J6ZA 3NAEA 3HXMA 2D0AA 4JHDA 3VA3A 1S6QA 4LF5K 1N32K 4H8KA 3E01A 5GAHP 1BGXT 3MEEA 4QCLA 3J7YP 3C65A 4EAHD 5I42A 4MDAA 2P1JA 3RR8A 3ZSQA 3J7ZO 4E1MA 3T1AA 1VQON 2GEMA 3V9SA 3SNNA 4B9SA 1T7PA 3RSEA 1BL3A 4C1NI 5BPNA 1NM1A 3T19A 1HNIA 5BPLA 2UUBK 2PFUA 3QESA 5FROA 2E5LK 4FLXA 2VGMA 2NRHA 4HHTA 4KV8A 4IOAL 1U6ZA 4EHUA 5C2DA 3PX4A 1C6VA 5AQSA 3VENA 4LH5A 1WB9A 1LOTB 2OA8A 2Z1GA 1HR0K 4BRGA 4XIUA 4K43A 1BA0A 1X3NA 1L3SA 4BWJA 4BC3A 1NMNA 3V4IA 4ICLA 1YVUA 1BUPA 4DSIA 1Q8IA 4E7LA 5KPZA 1ATRA 1IBLK 4AILC 2E2PA 1C0GA 4O4GA 3MWTA 1QE1A 1RT4A 4ILJA 4OPJA 4F3OA 1BWFO 1J53A 3KLFA 1EKEA 3NHGA 4YY3K 1NJZA 4GKJK 4CF8A 4DTXA 3IMXA 4N47A 4O0JA 4JHDB 3SUOA 2FBYA 4F4KA 4BR4A 3LWMA 4JI4K 2XY5A 3DLHA 3CIPA 1L5UA 3ZSWA 5AQVA 3RSEB 4FJXA 2HHSA 5SZTA 2C1IA 3DAWA 4DR2K 1R59O 2CGJA 2YNFA 5FPEA 3LP3A 1RTHA 5EU7A 2ASPA 3VQ9A 4EZ9A 5J2PA 2VG5A 3CJ1A 3R9PA 3G6EN 1RGIA 5AFUA 3AO4A 1W7AA 2NRWA 1WSFA 3CM5A 3U3YA 4CHPA 1W0HA 3SAGA 2FBXA 2HB5A 4HUGA 3DMJA 4GW6A 2NRTA 3C7NA 1RTJA 5AQXA 2WFBA 4CZGA 3QETA 2HHWA 1L3VA 4DHYA 3M5RA 3C95A 4BDZA 3TAEA 1T03A 1NOZA 2X6SA 3DLGA 2FBVA 4BACA 3CC4N 2QKKA 4CEBA 3QFUA 3HM8A 4I6MA 4FOIA 2V51B 1HNZK 3ENHA 4B9MA 4BC2A 4CHZA 1OKJA 4KKOA 4CEEA 4N56A 3RTVA 3D2FA 1GOAA 3NFAA 1TYQA 4PA1A 3EKSA 1NG9A 3OTOK 4FL9A 4DF8A 3CYMA 4BE1A 3V6DA 3SI6A 3CQYA 4E7IA 2AP1A 4DFMA 3MCPA 4KH5A 2X74A 4DR3K 4JI2K 4LFAK 1GLCG 4E72A 3HI0A 2ZQBA 5DK5A 3CCUN 4M3UA 2ZD1A 4ELUA 3HM9A 1Z05A 3I56N 1C1AA 4O5FA 3ISNC 1KSPA 4NCBA 3LANA 1JXBA 3LDPA 3THYA 2BGGA 5BREA 2IOCA 1CZ9A 1UWBA 3KLGA 3IG1A 1WN7A 4EP5A 3L2QA 4ISEA 4YDUA 4BRLA 5HROA 3VTHA 4FJ8A 3K5LA 1ASWA 3KJVA 3OYIA 3K9JA 3NGIA 4CJWA 5KQDA 3SZ2A 4ISGA 4PL8A 3C7NB 4A61A 4JN4A 2BDPA 1YXQA 1NOYA 4KHUA 4IOXA 2YNGA 4FWKA 2NRXA 1IKWA 5FPMA 2NUBA 1UAXA 3PLAA 5CZ1A 5F0XA 3R3LA 4CGJA 3RWUA 3KD5E 2P9IA 3C0BA 4BRMA 3C6TA 4I6MB 5TKYA 3FZLA 5AQUA 3QEWA 2QKBA 2HHIA 2RN2A 3AAQA 4KHNA 1RILA 3KKRA 3BZKA 4IBNA 3D2FB 5AQNA 4DR4K 1TYQB 3U9ZA 1TKXA 2PYLA 5DM7L 3I8DA 3KD1E 2F8TA 1WNSA 1MU2A 3AA4A 3PIPL 3OYKA 1VQ8N 1JJ2M 4XH1A 4OPAA 2JGUA 3HTVA 3WEEA 4FK4A 1Z25A 3AO3A 1GLAG 3QEPA 4WCEL 3VEOA 2W42A 1V4TA 3GG4A 4CF0A 3QERA 3GOIA 4C8LA 4ILGB 5I3UA 1UA1A 4WFAL 1VQ4N 1C1CA 2O8DA 3P31A 3ID8A 4H0YB 3TAFA 3THYB 3KK7A 2O8EA 2VQFK 3ENBA 3FE1A 4K25A 1QS4A 1LW2A 4X64K 3S3NA 1VK0A 3VQBA 3JYTA 1IO2A 4AHRA 1VQLN 3V9ZA 4BR5A 5J2NA 1JLGA 1BQNA 4LSLA 4JKDA 4A59A 4KAZA 3DJCA 3B6PA 1W97L 1ZYQA 3L2RA 4EP4A 2F9WA 5AQKA 2VWJA 1HYZA 4CJEA 5E41A 3BUZB 1NGFA 3O9SA 4O44A 3HSCA 2KW4A 4E19A 2YKMA 2XRIA 1WOQA 1DLOA 3TWHA 1BO5O 2G8VA 5IT9O 3TTCA 2P9IB 3ZYYX 4QS9A 1QSYA 4FWPA 1ZXOA 3DLKA 1BIUA 5DM6L 4E1NA 3M8RA 3PV8A 2H3GX 3KLIA 4H03B 3AO1A 3NF7A 4AHTA 5H1SQ 4DV5K 3KLHA 1NNEA 1Z6RA 3D0PA 4FWSA 3WXKA 5AJ3K 1SKSA 4CJ3A 1I94K 4KB0A 4NYFA 4XEIA 5JLHA 2QWQA 3FZFA 4DV1K 4WQ4A 2NRVA 4H0PA 2HHQA 1JL2A 4RW8A 3L6QA 1IBKK 3CQ8A 2ITGA 3QBXA 2Q36A 1VHXA 4NXMK 4AM6A 3LDNA 2HNYA 2O8DB 4BY9C 4YNQA 1RT1A 1KXPA 3QIOA 4JI1K 3KK3A 5SWMA 4FWNA 2O8EB 4CZFA 4PY5A 4JK7A 5AZIA 1HJOA 2XHBA 4YOTA 5J2QA 3OJSA 4JI0K 3SUNA 4NB4A 4E1JA 2NRRA 2A3ZA 4CFDA 4FJJA 2ZWHA 4BRNA 4E0DA 5J1EA 3KK2A 2P9LA 3IKMA 4O55A 4H4MA 2E2QA 4FO0A 5ADXA 3QIPA 4DU4A 1P90A 2XY8A 3JXUA 1WBDA 4H4OA 4CEFA 1O1WA 1KRPA 5BN8A 2ASOA 4KTWA 4IFYA 2HHVA 3CETA 4UY8O 4BREA 4IWVA 1DGKN 4KHPK 4PHTX 3RR7A 4FYDA 3SAHA 1YT3A 1YF5L 4FJKA 3D2EA 4YOWA 1VSIA 5LL6Z 1X9MA 3THWA 3QEXA 1SL2A 2D0OA 1KAXA 2O8BB 1HYVA 5AQPA 1DKGD 4CIEA 2HHHK 1SAZA 3J7AP 3I8BA 5JVGL 5M1OA 2HHTA 5BRFA 1NK5A 3OYMA 3IS9A 2VGNA 4B3MK 3J81O 3VGKA 4LSNA 4CIGA 4G1QA 4IDHA 1T6CA 2OYQA 3QMLA 4IO8A 1BOTO 3EZWA 3NF8A 2WBNA 1N6QA 1DEJA 3GE1A 3ZT2A 5HOOA 3O1WA 2UXDK 3O8MA 1S72N 3CFRA 2HNZA 3OY9A 2P9PA 4CFAA 3CCJN 4KRFA 4H0VB 5AZIB 1R0AA 4W5RA 2DPNA 2QTDA 3HVTA 2OPSA 3SMSA 3CC7N 3K5OA 1NGAA 1WSHA 1KCFA 1SZ2A 1RT5A 3HL8A 1YJNN 1W9HA 4K8ZA 2P9LB 2QWNA 1ESVA 2ZGZA 3M6GA 1GLLO 4HWIA 4E7HA 1CLQA 1W2BM 1XC3A 2G8IA 1U4BA 2OZMA 2IC3A 4CEZA 4A5BA 4BRDA 1KVCA 1YI2N 3NDKA 3F73A 3VQ5A 3E9PA 4HUFA 2HMPA 3C6UA 3WNGA 2KLAA 2NZTA 4H0OA 4M3RA 1WSEA 5JVHL 3D2EB 1JLAA 4KHSA 3BF1A 3P39A 1HNWK 3THWB 3AVKA 4GNIA 4BRFA 1QQOA 4DS4A 1IJJA 2BE2A 2IS3A 4M3ZA 1CXQA 3E1YA 1N34K 1N36K 4H5VA 3K5MA 5EXWA 2ZE2A 4MLEA 1YVNA 4QAGA 4DKWA 3O4WA 4BGBA 4FPBA 4N5SA 4RWTA 1XNRK 1GOBA 2G8FA 3LZJA 1TKZA 3A8YA 4DG1A 2GWKA 3AY9A 2XY7A 4DUZK 4IOCL 2UXCK 3M8SA 4FJMA 3RMCA 2UUAK 2Q0RA 2YHBA 4CJ4A 1XMOK 3UE5A 4DSKA 3ZSZA 4FJ9A 1QZ5A 4BQLA 3TSUA 3W0LA 1YTAA 3K2PA 5BPMA 1RCHA 1KFSA 2OPPA 3C6AA 3U4LA 4FXDA 4WQ5C 1U48A 3R8EA 2ASMA 4KB1A 1QTMA 2VQEK 2QA4N 4WF9L 5KGWA 5D3GA 3L8BA 1NK6A 4FWRA 4B3TK 3TTDA 4LF6K 1X3MA 4IJAA 3JSMA 5LY3A 1EX4A 4KI4A 4ILHA 3OW2M 4PQUA 4BGAA 3O1BA 2F9TA 3HYFA 1JLBA 5HRSA 4V19S 3M8PA 1OH7A 4OKKA 3D7EO 1D4XA 1K9MO 1XHXA 1KVBA 4DQIA 5CZ2A 4BROA 1QQCA 5MLCQ 1IH7A 1NGHA 4F2SA 3M3ZA 3W3DA 3MXIA 3VQPA 3ZETA 1SV5A 3CPWM 2QXLA 1VQ9N 1OH8A 1T6DA 4AQYK 2WUSA 3MAQA 2E4LA 4OPKA 3B8AX 1FW6A 3O9QA 4DV0K 2P9KA 1D5AA 4CJPA 2YNHA 1VRTA 4FZYA 2QWRA 3QLHA 3OYEA 1U47A 4E7KA 2R7YA 2QWMA 4OO1J 1KAZA 3ZT1A 3AA2A 3E9OA 2KFZA 3N4QA 4DS5A 2B4JA 3MX2A 1TAQA 1B92A 1SS6A 3P5JA 5BRHA 1T44A 2FSKA 3LDQA 1X9SA 1RDCA 4B1WB 1WAJA 3CFPA 4DFKA 1VQKN 5FDLA 3MN5A 4DTOA 5KPTA 4DR1K 1VQMN 5F2RA 2BANA 4CGDA 4M45A 3DXMA 4IO9L 3VEZA 1J5OA 4AH9A 1Q9XA 4PKIA 4MQ3A 3DM2A 3HRGA 3I0SA 3QFPA 3KKSA 1A5XA 3ZEUA 3ITHA 3TSPA 2ZGYA 4FLZA 5E84A 4F2RA 4I7FA 4B9UA 1XMQK 1VSDA 3H1QA 4DR7K 3AGKA 4CZLA 3SBGA 1NKCA 5AQIA 3AO2A 5CHIA 1TL3A 1Y64A 5AQLA 2D4WA 3ZETB 1BA1A 1BQMA 4CGHA 4FWOA 1S6PA 5C12A 3CYGA 2FC0A 1ZBFA 3ZT0A 3NF9A 3O9TA 4CVNE 4AM7A 2P9KB 4KI6A 3V81A 3DXKA 4DSLA 2IIRA 4Q5VA 1ZBLA 4PKHA 5ADXH 4C8NA 4DTRA 4M41A 3GBTA 3DLRA 3P1GA 4NCGA 2O8CA 4CD3A 3RMDA 2WTUA 1M1KO 3TAGA 3IAYA 3BDPA 1S1VA 4J8FA 3J80O 1SL1A 3SV3A 1JLQA 2F7TA 1TKDA 1BCOA 4I2PA 2IDOA 3K59A 5GADP 3DXMB 1S5JA 3F5TA 1N33K 1E3MA 3KHYA 4CJSA 4AHSA 1SQKA 3DRPA 2Y1IA 1C0MA 5DMRA 3KK1A 3S3OA 1IG9A 4CK1A 1S1TA 2DFFA 1OVQA 4LF9K 3MCAB 3ZEUB 2HNDA 4G9ZA 1U04A 3G0ZA 1BU6O 2F96A 2X78A 3LDSA 1ASUA 2B5JA 3NGYA 2CGLA 2D1KA 2GUIA 3GDQA 4H0TB 4XH4A 1RT7A 4HCBA 4DQRA 4JI7K 3CF5L 4JKGA 2GV9A 3O4QA 4FSVA 3ULEA 3NMUA 2V7YA 4B8AB 4CZIA 1O13A 2HBMA 3EL2A 2NRZA 2W00A 2W6LA 3ZSRA 4JKAA 1L3TA 5M1PA 3OHRA 3VTIA 1S1UA 3F9MA 3I33A 3DYAA 4IZ9A 4BR2A 4NLBA 1HMVA 5BR9A 3VA0A 4NXNK 3DXKB 3EY1A 4KH4A 4W5OA 2GBZA 3VN5A 1EP4A 1S9GA 1WLJA 1XI1A 3CCQN
chains in the Genus database with same CATH topology
3KWGA 4BY9C 3CCRN 2OANA 1OVYA 4CBUA 1KXPA 2A42A 2HF3A 4FWNA 3MMVA 4JNEA 4DCHA 1IG8A 4CZFA 3WXMB 3Q7BA 2A40A 5I9EB 1KAYA 2IVOA 5AQTA 4JK7A 1JCFA 5LJVA 4GV9A 3N4PA 5AZIA 1HX1A 1HJOA 4JKHA 4YOTA 3G25A 3VEWA 3CQXA 4M63C 4EIAA 4KBOA 4NB4A 4HTLA 1BDGA 5AQYA 4B1YB 4E1JA 2HF4A 2A3ZA 2NRRA 2E2OA 3E66A 3KWIA 3P38A 4A62A 4JD2B 1X9JA 5C10A 3F2KA 5AQZA 1Q81O 3QB0A 5KQ8A 2ZWHA 4BRNA 2E1YA 4A5AA 3IFRA 2P9LA 3IKMA 2E2QA 4R79A 2V7ZA 4FO0A 3VOVA 5AZJA 3NVKA 1NGEA 5ADXA 1P90A 4PL7A 2QW9A 2GWJA 4C1NK 3CJBA 3CERA 4FPAA 3JXUA 3U9DA 4CZMA 3A5OC 4EHTA 1QQMA 2GELA 2I7PA 4CZHA 1E4GT 2ASOA 2P9SB 2E20A 5BN8A 2GUPA 2W40A 3CETA 2D0PA 2P9PB 5AQFA 2BH1A 1CZAN 3T7ZA 4UY8O 2YHXA 1NMDA 4BREA 4IWVA 3VESA 1DGKN 1LCUA 3UKUA 4B1VA 4PHTX 3CXCM 3H1VX 4C23A 3CCQN 3CJAA 3SAHA 4YOUA 1YF5L 2P9NA 2ZJPL 2YCHA 3D2EA 3VF4A 3A0IX 4QS8A 4YOWA 4BEBA 4JKGB 3VEVA 1RDUA 1NGDA 3VGMA 3ULEB 5GAEP 4MO4A 2NNWA 3MN7A 2D0OA 1KAXA 3O9UA 1J6ZA 1ATNA 1T3VA 4GVEA 5AQPA 1DKGD 4JHDA 2HBJA 4BC4A 3T69A 1HKBA 1SAZA 2I7NA 4ISFA 5GAHP 1YITN 4GV6A 3CC2N 3I8BA 5JVGL 5M1OA 5BRFA 3C65A 4EAHD 2QEXN 2VGNA 4MDAA 3MN9A 4IJNA 4BVPA 3U8XA 1TUUA 3VGKA 3J7ZO 4BR7A 3TTFA 3O08A 3CCMN 5AR0A 3CMAN 1VQON 2PBDA 2Q31A 3VGLA 2GEMA 4IDHA 1T6CA 3QMLA 1ZC6A 4IO8A 1BOTO 3EZWA 4WQ5A 3VF2A 2WBNA 5EY4A 3RSEA 1DEJA 2UYTA 3GE1A 4WFNL 4C1NI 5BPNA 1NM1A 4FWQA 5HOOA 3O1WA 4MO5A 5BPLA 3O8MA 2PFUA 3RVCA 1S72N 2E88A 3ZX3A 5AQJA 2P9PA 3VERA 4H5TA 3CCJN 4H0VB 4WQ4C 5AZIB 2VGMA 4AF1A 2YJEA 1K8AO 2DPNA 2QTDA 2NRHA 1NGJA 2KKZA 3SMSA 3CC7N 4IOAL 4YORA 1U6ZA 4EHUA 1NLVA 1NWKA 5C2DA 1NGAA 1SZ2A 2EWSA 4QS7A 3UKRA 4FVUA 5AQSA 3VENA 1YJNN 1BG3A 5JLFA 2P9LB 2RE2A 2QWNA 1ESVA 1LOTB 1NGBA 3R6MA 2ZGZA 2Q97A 3M6GA 4M7XA 3Q7CA 5AZJB 1EO1A 4BRGA 1GLLO 3SBTA 4CZKA 1Q18A 4HWIA 4K43A 3TPQA 3A5NC 3DWLA 3IDHA 3SJHA 3FZKA 1BA0A 2QWLA 1X3NA 1W2BM 3D6RA 1XC3A 4BC3A 4XJXA 3TSQA 3A5LC 4A5BA 4BRCA 4BRDA 3O80A 1YI2N 1BUPA 3AAPA 3E9PA 2HMPA 1Q7YO 2KLAA 2NZTA 4H0OA 1ATRA 5KPZA 4H5RA 3UKUB 2E2PA 1C0GA 3FZHA 3MWTA 4ILJA 5FPNA 1YIJN 1BWFO 2CH6A 4JKBA 2P9NB 4A2BA 5JVHL 3D2EB 3BF1A 3WXJA 3P39A 3PIOL 3LL3A 3H3NO 4GNIA 4BRFA 1QQOA 1IJJA 3P4IA 3IMXA 3EE9A 3E1YA 2CGKA 3LDOA 4IXCA 4JHDB 4H5VA 2QM1A 5EXWA 4JK8A 4MLEA 1YVNA 3A5MC 4DKWA 3O4WA 3ZX0A 4BGBA 4FPBA 1GLEG 5AQOA 2W41A 4BR4A 3FZMA 2FSJA 4RWTA 2OTLN 2Q2RA 3BP8A 2BTFA 3A8YA 2GWKA 3AY9A 1Q82O 3FR0A 3CIPA 3NVMA 5AQVA 4LC9B 3RSEB 5AQRA 4IOCL 3WQTA 3KZBA 4BRKA 5ELZA 3MWPA 2C1IA 3DAWA 1R59O 2CGJA 5FPEA 1YAGA 1VQPN 3OA9A 4CBXA 2Q1NA 3LM2A 4H5NA 2ASPA 2Q0RA 1V4SA 4Y0WA 2YJFA 3UE5A 4B1ZA 3CHWA 2PAVA 3CJ1A 3H46O 3R9PA 3G6EN 1QZ5A 1RGIA 5AFUA 3HOTA 4BQLA 3CCVN 2HSTA 3TSUA 3W0LA 4KH6A 3M1FA 2NRWA 5BPMA 2IVNA 5EX5A 3SLCA 1QHAA 4GV3A 4WYBA 3UKRB 2A6AA 3SAGA 3C6AA 4CZEA 3SMPA 2P9UA 3U4LA 4BECA 1EQYA 4WQ5C 2NRTA 5M1QA 3C7NA 2A41A 2JWKA 3R8EA 5AQXA 2ASMA 3L0QA 3WUHA 1G99A 2CH5A 2HOEA 2WFBA 4CZGA 3VF6A 5EOYA 3WXLA 3BEXA 2QA4N 4WF9L 3MK6A 4DHYA 3M5RA 3MX5A 3CCSN 5M1FA 3CPEA 2V52B 4FWRA 1KD1O 4H5WA 4MLHA 3TTDA 4CJ7A 1JCEA 1X3MA 4IJAA 4JKEA 5LY3A 3QBWA 4ILHA 3OW2M 4MDBA 3CC4N 1NGCA 4BGAA 1P8ZA 3O1BA 2F9TA 1U2VA 3QFUA 4BR9A 3ZX2A 3QDKA 5AQMA 3HM8A 5AQGA 2QWOA 4I6MA 4B9QA 1MWKA 1K8KA 3KVGA 4FOIA 1ATSA 2V51B 3ENHA 3BF3A 3D7EO 5C0YA 1ZBSA 1RFQA 4BRAA 3AGRA 1D4XA 4BC2A 1GLFO 1K9MO 4BROA 1OKJA 3ENOA 1JCGA 5AQWA 2E2NA 3D2FA 5MLCQ 1TYQA 3DLLL 1NGHA 3HBTA 3EKSA 3M3ZA 3W3DA 4A57A 4FL9A 5GAGP 3ZETA 4NO7A 3CPWM 2QXLA 1VQ9N 1NGIA 1T6DA 2QWPA 3OBWA 1Q86O 1NGGA 3CQYA 3SK3A 2WUSA 1ILYA 4JAXA 2AP1A 3B8AX 3CI5A 3MCPA 3ID6A 4BE7B 1H1VA 2YI1A 3O9QA 4KH5A 5KPRA 4JKFA 3GL1A 1GLCG 2P9KA 1GLDG 2FF3B 3HI0A 4L3QA 2FXUA 2VYPA 3CCUN 4K42A 1WUAA 3ATUA 1YUWA 1Z05A 2QWRA 5GINA 3I56N 5CR4A 4EFHA 1HPMA 1HLUA 4O5FA 3G71N 5EVZA 3H3OB 3C6HA 2FSNA 2QWMA 3LDPA 3H6EA 4A2AA 1KAZA 4DB3A 4OO1J 5BREA 3E9OA 1QQNA 3VEYA 3N4QA 4YOVA 4FOEA 5TKWA 2FLOA 3MX2A 4ISEA 4YDUA 4BRLA 4JKCA 4M7YA 1SS6A 4JK9A 5BRHA 2BUPA 4B1UB 3J8AA 3VTHA 1T44A 2FSKA 1S3XA 3LDQA 3K9JA 4B1WB 2P9UB 5JMVA 3TU5A 3WEEB 4NLCA 1S22A 5KQDA 4ISGA 4PL8A 1VQKN 4F9OA 3C7NB 3MN5A 3EE8A 4A61A 4JN4A 5KPTA 1YXQA 3WXIA 1N8RO 1VAZA 4IOXA 5AQQA 5LJWA 1VQMN 1NBWA 4FWKA 5F2RA 2AA4A 2NRXA 3DXMA 3FFKB 3VEZA 1HUXA 3MDQA 1C0FA 5FPMA 5AQHA 4IO9L 1TUYA 2ZJRL 3PLAA 4PKIA 4XH5A 1QZ6A 5F0XA 3VETA 5C15A 3HRGA 4O8UA 3R3LA 3LM9A 3LDLA 1E4FT 3QFPA 3ZEUA 1U2VB 2Q0UA 3E9LA 3TSPA 2P9IA 3EN9A 2ZGYA 3C0BA 5CE3A 2OTJN 4BRMA 5E84A 4I6MB 4BRHA 5TKYA 3JS6A 2HBLA 3FZLA 4RCHA 5AQUA 1K8KB 3H1QA 1VQ7N 4BR0A 4CZJA 4DQ8A 3AGKA 3MN6A 3AAQA 4CZLA 1QVFM 3SBGA 5AQIA 5C2FA 2VWBA 2YHWA 3HZ6A 4FWLA 3CMEN 1RDWX 2VCPA 3CJCA 3VEXA 3D2FB 4GY2B 4K41A 5CHIA 5AQNA 1Y64A 1GLJO 1TYQB 4BRIA 5AQLA 2D4WA 1MA9B 1HKCA 3U9ZA 3IUCA 1VQ5N 4CBWA 3ZETB 1BA1A 4BQZA 5DM7L 4U67L 2WC9A 4FWOA 3WT0A 3PIPL 2E1ZA 3CCLN 1VQ8N 5C12A 3FGUA 5M1NA 1NJIO 1JJ2M 2ITMA 2JWLA 2GTDA 4XH1A 4OPAA 3HTVA 3WEEA 1GLBG 1GLAG 3O9TA 4WCEL 3EO3A 3CD6N 3VEOA 3L4QA 4O8KA 4AM7A 1V4TA 3GG4A 2P9KB 5BN9A 4Z94A 2RHKA 3GOIA 3DXKA 5B8HA 2IIRA 3CJ9A 3CCEN 4ILGB 1XUPO 4PKHA 4WFAL 2KHOA 2J4RA 5ADXH 1VQ4N 5BRDA 4OPHA 3P31A 3ID8A 3GBTA 4H0YB 3KK7A 3CJ7A 4CD3A 3ENBA 1DT9A 3FE1A 4IEEA 1KQSM 4K25A 3OBYA 1M1KO 2NLXA 2QI2A 2A5XA 2YHYA 4YOXA 1M90O 3K9KA 2HBKA 4CD1A 5AFUH 1VQ6N 4J8FA 1VQNN 1VQLN 3O9RA 4JD2A 4BR5A 2F7TA 4PKGA 4BC5A 4A59A 4H0XB 4JKDA 1YJ9N 1XQSC 3DJCA 4IEIA 4BRPA 3EKUA 5JICA 1W97L 5GADP 2ZF5O 3DXMB 3O6WA 2F9WA 3WQUA 3F5TA 5AQKA 3QICA 3KHYA 3SAFA 3BUZB 1NGFA 1SQKA 3O9SA 4YOYA 5GIOA 3HSCA 4BVOA 3AARA 4CI6A 5F1XA 1WOQA 1BO5O 3MCAB 3ZEUB 4YDUC 3TTCA 2P9IB 1K73O 3ZYYX 4G9ZA 4QS9A 2P9SA 4FWPA 2GX9A 1ZXOA 4BG9A 4BRQA 2YX6A 1BU6O 5DM6L 4U7BA 3R1XA 1MWMA 2CGLA 2D1KA 4H0TB 3GDQA 3VPZA 2H3GX 3I55N 4XH4A 3ATVA 1QVGM 4H03B 2C1GA 5FPDA 4WFBL 2ZJQL 5M1KA 3CF5L 2IVPA 3G4SN 1HKGA 4JKGA 4FSVA 3S41A 5H1SQ 3ULEA 1Z6RA 2V7YA 3NMUA 4CZIA 1O13A 4FWSA 3WXKA 1YHQN 2HBMA 3EL2A 3UB5A 2NRZA 2W00A 3HOSA 4JKAA 4XEIA 5JLHA 2E8AA 2QWQA 3FZFA 3L4IA 5M1PA 4WQ4A 2NRVA 3H45C 3OHRA 4H0PA 1KC8O 3FLCO 3VTIA 1YJWN 3F9MA 3I33A 3L6QA 4IZ9A 4BR2A 3O5BA 5HL7L 4NLBA 3QBXA 4B1XB 5BR9A 3DXKB 3VMFB 4BG8A 1MDUB 2Q36A 5GIPA 4JEPA 4IFEA 4FWMA 4KH4A 4RTFD 4AM6A 3LDNA 5E26A 2FF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAN A;  4CBU A;  1KXP A;  2A42 A;  2HF3 A;  4FWN A;  3MMV A;  4JNE A;  4DCH A;  1IG8 A;  4CZF A;  2A40 A;  5I9E B;  1KAY A;  2IVO A;  5AQT A;  1JCF A;  5LJV A;  5AZI A;  1HX1 A;  1HJO A;  3G25 A;  3VEW A;  3CQX A;  4M63 C;  4EIA A;  4KBO A;  4NB4 A;  4HTL A;  1BDG A;  5AQY A;  4B1Y B;  4E1J A;  2HF4 A;  2A3Z A;  2E2O A;  4A62 A;  4JD2 B;  1X9J A;  5AQZ A;  3QB0 A;  5KQ8 A;  2ZWH A;  4BRN A;  2E1Y A;  3IFR A;  2P9L A;  2E2Q A;  2V7Z A;  4FO0 A;  3VOV A;  5AZJ A;  1NGE A;  5ADX A;  4PL7 A;  2QW9 A;  2GWJ A;  3CJB A;  3CER A;  4FPA A;  3JXU A;  3U9D A;  4CZM A;  3A5O C;  4EHT A;  1QQM A;  2GEL A;  2I7P A;  4CZH A;  1E4G T;  2ASO A;  2P9S B;  2E20 A;  5BN8 A;  2GUP A;  2W40 A;  3CET A;  2D0P A;  2P9P B;  5AQF A;  1CZA N;  2YHX A;  1NMD A;  4BRE A;  4IWV A;  3VES A;  1DGK N;  1LCU A;  3UKU A;  4B1V A;  3H1V X;  4C23 A;  3CJA A;  2P9N A;  2YCH A;  3D2E A;  3VF4 A;  3A0I X;  4QS8 A;  3VEV A;  1NGD A;  3VGM A;  3ULE B;  4MO4 A;  3MN7 A;  2D0O A;  1KAX A;  1J6Z A;  1ATN A;  5AQP A;  1DKG D;  4JHD A;  4BC4 A;  1HKB A;  1SAZ A;  2I7N A;  4ISF A;  3I8B A;  5BRF A;  4EAH D;  3MN9 A;  4IJN A;  4BVP A;  3U8X A;  1TUU A;  3VGK A;  4BR7 A;  3O08 A;  5AR0 A;  2PBD A;  2Q31 A;  3VGL A;  2GEM A;  1T6C A;  3QML A;  1ZC6 A;  4IO8 A;  1BOT O;  3EZW A;  4WQ5 A;  3VF2 A;  5EY4 A;  3RSE A;  1DEJ A;  2UYT A;  3GE1 A;  5BPN A;  1NM1 A;  4FWQ A;  3O1W A;  4MO5 A;  5BPL A;  3O8M A;  2E88 A;  3ZX3 A;  5AQJ A;  2P9P A;  3VER A;  4H5T A;  4H0V B;  4WQ4 C;  5AZI B;  2YJE A;  2DPN A;  2NRH A;  1NGJ A;  3SMS A;  1U6Z A;  4EHU A;  1NLV A;  1NWK A;  1NGA A;  1SZ2 A;  2EWS A;  4QS7 A;  3UKR A;  5AQS A;  3VEN A;  1BG3 A;  5JLF A;  2P9L B;  2QWN A;  1ESV A;  1LOT B;  1NGB A;  3R6M A;  2ZGZ A;  2Q97 A;  3M6G A;  4M7X A;  5AZJ B;  4BRG A;  1GLL O;  4CZK A;  1Q18 A;  4HWI A;  4K43 A;  3TPQ A;  3A5N C;  3DWL A;  3IDH A;  3SJH A;  3FZK A;  1BA0 A;  2QWL A;  1X3N A;  1XC3 A;  4BC3 A;  3A5L C;  4BRD A;  4BRC A;  3O80 A;  1BUP A;  3AAP A;  2HMP A;  2NZT A;  4H0O A;  5KPZ A;  1ATR A;  4H5R A;  3UKU B;  2E2P A;  1C0G A;  3FZH A;  5FPN A;  1BWF O;  2CH6 A;  2P9N B;  4A2B A;  3D2E B;  3BF1 A;  3WXJ A;  3LL3 A;  3H3N O;  4GNI A;  4BRF A;  1QQO A;  1IJJ A;  3P4I A;  3IMX A;  4IXC A;  2CGK A;  3LDO A;  4JHD B;  4H5V A;  2QM1 A;  5EXW A;  4MLE A;  1YVN A;  3A5M C;  3O4W A;  3ZX0 A;  4BGB A;  4FPB A;  1GLE G;  5AQO A;  2W41 A;  4BR4 A;  3FZM A;  2FSJ A;  4RWT A;  2Q2R A;  3BP8 A;  2BTF A;  3A8Y A;  2GWK A;  3AY9 A;  3FR0 A;  3CIP A;  5AQV A;  4LC9 B;  3RSE B;  5AQR A;  3WQT A;  3KZB A;  4BRK A;  5ELZ A;  3DAW A;  1R59 O;  2CGJ A;  5FPE A;  1YAG A;  4CBX A;  2Q1N A;  3LM2 A;  4H5N A;  2ASP A;  2Q0R A;  1V4S A;  4Y0W A;  2YJF A;  3UE5 A;  4B1Z A;  3CHW A;  2PAV A;  3CJ1 A;  3H46 O;  3R9P A;  1QZ5 A;  1RGI A;  5AFU A;  4BQL A;  3W0L A;  3M1F A;  5BPM A;  2IVN A;  5EX5 A;  3SLC A;  1QHA A;  4WYB A;  3UKR B;  2A6A A;  4CZE A;  3SMP A;  2P9U A;  3U4L A;  1EQY A;  4WQ5 C;  3C7N A;  2A41 A;  3R8E A;  5AQX A;  2ASM A;  3L0Q A;  3WUH A;  1G99 A;  2CH5 A;  2HOE A;  4CZG A;  3VF6 A;  5EOY A;  3WXL A;  3BEX A;  3MK6 A;  4DHY A;  2V52 B;  4FWR A;  4H5W A;  4MLH A;  4CJ7 A;  1JCE A;  1X3M A;  4IJA A;  5LY3 A;  3QBW A;  1NGC A;  4BGA A;  1P8Z A;  3O1B A;  2F9T A;  1U2V A;  3QFU A;  4BR9 A;  3ZX2 A;  3QDK A;  5AQM A;  3HM8 A;  5AQG A;  2QWO A;  4I6M A;  4B9Q A;  1MWK A;  1K8K A;  3KVG A;  4FOI A;  1ATS A;  2V51 B;  3ENH A;  3BF3 A;  3D7E O;  1ZBS A;  1RFQ A;  4BRA A;  1D4X A;  4BC2 A;  1GLF O;  4BRO A;  1OKJ A;  3ENO A;  1JCG A;  5AQW A;  2E2N A;  3D2F A;  1TYQ A;  1NGH A;  3HBT A;  3EKS A;  3M3Z A;  3W3D A;  4FL9 A;  3ZET A;  4NO7 A;  2QXL A;  1NGI A;  1T6D A;  2QWP A;  1NGG A;  3CQY A;  3SK3 A;  2WUS A;  4JAX A;  2AP1 A;  3B8A X;  3CI5 A;  3MCP A;  1H1V A;  2YI1 A;  5KPR A;  3GL1 A;  1GLC G;  2P9K A;  1GLD G;  2FF3 B;  3HI0 A;  4L3Q A;  2FXU A;  2VYP A;  4K42 A;  1WUA A;  3ATU A;  1YUW A;  1Z05 A;  2QWR A;  4EFH A;  1HPM A;  1HLU A;  4O5F A;  5EVZ A;  3H3O B;  2FSN A;  2QWM A;  3LDP A;  3H6E A;  4A2A A;  1KAZ A;  4DB3 A;  5BRE A;  1QQN A;  3VEY A;  4FOE A;  2FLO A;  4ISE A;  4YDU A;  4BRL A;  4M7Y A;  5BRH A;  2BUP A;  4B1U B;  3J8A A;  1T44 A;  2FSK A;  1S3X A;  3LDQ A;  4B1W B;  2P9U B;  5JMV A;  3TU5 A;  3WEE B;  5KQD A;  1S22 A;  4ISG A;  4PL8 A;  4F9O A;  3C7N B;  3MN5 A;  4A61 A;  4JN4 A;  5KPT A;  1YXQ A;  3WXI A;  5AQQ A;  5LJW A;  1NBW A;  4FWK A;  5F2R A;  2AA4 A;  3DXM A;  3FFK B;  3VEZ A;  1HUX A;  3MDQ A;  1C0F A;  5FPM A;  5AQH A;  1TUY A;  4PKI A;  4XH5 A;  1QZ6 A;  5F0X A;  3VET A;  3LM9 A;  3LDL A;  1E4F T;  3QFP A;  3ZEU A;  1U2V B;  2Q0U A;  2P9I A;  3EN9 A;  2ZGY A;  3C0B A;  5CE3 A;  4BRM A;  5E84 A;  4I6M B;  4BRH A;  5TKY A;  3JS6 A;  3FZL A;  4RCH A;  5AQU A;  1K8K B;  3H1Q A;  4BR0 A;  4CZJ A;  4DQ8 A;  4CZL A;  3MN6 A;  3AAQ A;  5AQI A;  2VWB A;  2YHW A;  3HZ6 A;  4FWL A;  1RDW X;  2VCP A;  3CJC A;  3VEX A;  3D2F B;  4GY2 B;  4K41 A;  5AQN A;  1Y64 A;  1GLJ O;  1TYQ B;  4BRI A;  5AQL A;  2D4W A;  1MA9 B;  1HKC A;  3U9Z A;  3IUC A;  4CBW A;  3ZET B;  1BA1 A;  4BQZ A;  4FWO A;  3WT0 A;  2E1Z A;  3FGU A;  2ITM A;  2GTD A;  4XH1 A;  3HTV A;  3WEE A;  1GLB G;  1GLA G;  3EO3 A;  3VEO A;  4O8K A;  4AM7 A;  1V4T A;  3GG4 A;  2P9K B;  5BN9 A;  4Z94 A;  3GOI A;  3DXK A;  5B8H A;  2IIR A;  3CJ9 A;  1XUP O;  4PKH A;  2KHO A;  2J4R A;  5ADX H;  5BRD A;  3ID8 A;  3GBT A;  4H0Y B;  3CJ7 A;  4CD3 A;  3FE1 A;  4K25 A;  2NLX A;  2A5X A;  2YHY A;  4CD1 A;  5AFU H;  4J8F A;  4BR5 A;  4JD2 A;  4PKG A;  4BC5 A;  4H0X B;  1XQS C;  3DJC A;  5JIC A;  4BRP A;  3EKU A;  2ZF5 O;  3DXM B;  3O6W A;  2F9W A;  3WQU A;  5AQK A;  3QIC A;  3KHY A;  3BUZ B;  1NGF A;  1SQK A;  3HSC A;  4BVO A;  3AAR A;  4CI6 A;  5F1X A;  1WOQ A;  1BO5 O;  3ZEU B;  4YDU C;  2P9I B;  4QS9 A;  2P9S A;  4FWP A;  4BRQ A;  1ZXO A;  4BG9 A;  1BU6 O;  1MWM A;  2CGL A;  2D1K A;  4H0T B;  3GDQ A;  3VPZ A;  2H3G X;  4XH4 A;  3ATV A;  4H03 B;  5FPD A;  2IVP A;  1HKG A;  4FSV A;  3S41 A;  3ULE A;  1Z6R A;  2V7Y A;  4CZI A;  4FWS A;  3WXK A;  3EL2 A;  3UB5 A;  4XEI A;  5JLH A;  2E8A A;  2QWQ A;  3FZF A;  3L4I A;  4WQ4 A;  3H45 C;  3OHR A;  4H0P A;  3FLC O;  3F9M A;  3I33 A;  3L6Q A;  4IZ9 A;  4BR2 A;  3O5B A;  3QBX A;  4B1X B;  5BR9 A;  3DXK B;  4BG8 A;  1MDU B;  2Q36 A;  4FWM A;  4RTF D;  4AM6 A;  3LDN A;  5E26 A;  2FF6 A; 
#chains in the Genus database with same CATH topology
 3KWG A;  4CBU A;  5KRS A;  4JNE A;  3MMV A;  3QIN A;  4DQS A;  2O8C B;  4NYN A;  3Q7B A;  2IVO A;  2ETJ A;  2YKN A;  3O4N A;  5LJV A;  3N4P A;  1HX1 A;  3OVN A;  3G25 A;  1HPZ A;  4EIA A;  3CQX A;  4KBO A;  4HTL A;  1GOC A;  3E66 A;  3P38 A;  3NH1 A;  5C10 A;  2KQ2 A;  1RBT A;  3L2V A;  3HST B;  4A5A A;  3CFO A;  3LAM A;  4DTS A;  1TV6 A;  3BY5 A;  4R79 A;  3VOV A;  4CHO A;  4Z4E A;  4O5B A;  4KHW A;  2GWJ A;  4KHQ A;  3U9D A;  4CFB A;  5HRP A;  3V9U A;  4EHT A;  1QSS A;  4CZH A;  2GUP A;  2A1R A;  2YHX A;  3SCX A;  3ZT3 A;  1LCU A;  3H1V X;  1HJR A;  4C23 A;  3CJA A;  4PUO A;  3PY8 A;  3VF4 A;  4B3S K;  3C94 A;  1FJG K;  4OGC A;  4JKG B;  1SKR A;  1RDU A;  4B9V A;  4HVJ A;  3ULE B;  2DFE A;  1ATN A;  1T3V A;  1RT6 A;  1G15 A;  4FVM A;  4FJI A;  3T69 A;  1X1P A;  4ISF A;  4LH4 A;  3VQQ A;  1YIT N;  4IJN A;  3U8X A;  3OYB A;  2RPI A;  3TTF A;  3O08 A;  5JS2 A;  4KHY A;  3UIQ A;  3S5T A;  1ZC6 A;  1D9F A;  3NGZ A;  4DTU A;  4WFN L;  4FWQ A;  1LWE A;  4MO5 A;  3SJJ A;  3QNN A;  1TK0 A;  3OS2 A;  4H5T A;  4AF1 A;  2Z1J A;  1RDB A;  3CG7 A;  4Y1D A;  2EWS A;  2O4I A;  3SPY A;  1NGB A;  3R6M A;  2Q97 A;  5CYM A;  4Z4C A;  2O8B A;  4CZK A;  4CJV A;  3EYZ A;  1Q18 A;  3TPQ A;  3TAB A;  1A5V A;  3FZK A;  2QWL A;  3TSQ A;  3A5L C;  1WSJ A;  4BRC A;  3O80 A;  3AAP A;  1VSK A;  4BE2 A;  1Q7Y O;  2HVI A;  4IKF A;  3FZH A;  3SQ0 A;  4FJ7 A;  4JKB A;  4FLV A;  3WXJ A;  2VG7 A;  4EZ6 A;  3PIO L;  4Z4H A;  2O8F A;  1KVA A;  1ZBH A;  3AVC A;  3P4I A;  3KLE A;  4CJF A;  3MXM A;  2QM1 A;  4JK8 A;  3ZX0 A;  5AQO A;  2W41 A;  4B3O A;  3OYN A;  4J2A A;  2O4G A;  1ITG A;  2FSJ A;  4FJH A;  2Q2R A;  3L2W A;  3BP8 A;  2KFN A;  2W6K A;  1RBR A;  5CY4 A;  4AHU A;  5KRT A;  3WQT A;  4BRK A;  5ELZ A;  3DRR A;  5T7B A;  1CZB A;  1YAG A;  1VQP N;  3OA9 A;  2Q1N A;  4YHH K;  3LM2 A;  3DLE A;  4H5N A;  4FLW A;  4CCH A;  1V4S A;  3V9X A;  2B6A A;  1D9D A;  2YJF A;  4B1Z A;  3H46 O;  3CCV N;  2HW3 A;  1LWF A;  2D0C A;  2IVN A;  5EX5 A;  4GV3 A;  4CZE A;  4BEC A;  2P9U A;  4DTJ A;  3AVA A;  2A1S A;  3MXJ A;  3HK2 A;  5M1Q A;  2A41 A;  2JWK A;  3I0R A;  1FKP A;  1T8E A;  1G99 A;  2CH5 A;  3VF6 A;  3OYC A;  3WXL A;  3O3F A;  3OJU A;  3MK6 A;  3CCS N;  4LFB K;  2YV0 X;  4AHV A;  1ZBI A;  2UXB K;  4MDB A;  1QHT A;  1P8Z A;  3RRH A;  3QDK A;  5AQG A;  3QNO A;  4B9Q A;  1MWK A;  3AV9 A;  1K8K A;  1TKT A;  2YNI A;  1ATS A;  3L2U A;  3BF3 A;  4B9N A;  4O0I A;  5C0Y A;  1GLF O;  4CGG A;  3V9W A;  3ENO A;  1JCG A;  2E2N A;  2O8F B;  1IBM K;  2UU9 K;  3HBT A;  3MED A;  4A57 A;  3OYJ A;  2G8H A;  4DTN A;  3AO5 A;  1ILY A;  3TAQ A;  3LP1 A;  2D0B A;  1A5W A;  3CI5 A;  4OKE A;  3ID6 A;  2QXF A;  5HLF A;  1H1V A;  2YI1 A;  5KPR A;  4CJT A;  4UQG A;  4FJL A;  4N41 A;  4I9L A;  1IKV A;  2FF3 B;  2VYP A;  1WUA A;  3ATU A;  3V1R A;  1YUW A;  1UOC A;  4DV3 K;  4CGF A;  5GIN A;  1WAF A;  4KO0 A;  1HPM A;  4QOZ B;  1Y97 A;  1HLU A;  3VQ8 A;  3G71 N;  3C6H A;  4CK2 A;  4OKJ A;  3H6E A;  4A2A A;  1HQU A;  4W5T A;  2OCE A;  1VSE A;  4CED A;  4DR5 K;  1ASV A;  4JKC A;  1U45 A;  3MEC A;  4FCY A;  2BUP A;  3NH0 A;  4OLA A;  1KLM A;  2P9U B;  5JMV A;  3HT3 A;  3TU5 A;  1S22 A;  2Q3S A;  4CJU A;  1LW0 A;  4E7J A;  3IRX A;  4F9O A;  3EE8 A;  4DMN A;  3WXI A;  1N8R O;  5LJW A;  2AA4 A;  1DTT A;  5AQH A;  2RKI A;  4DU3 A;  1TUY A;  4IG0 A;  3BGR A;  3HJF A;  2D5R A;  4XH5 A;  1UA0 A;  4DLG A;  4DF4 A;  4LF7 K;  4DSE A;  3MEG A;  1TAU A;  2Q0U A;  3E9L A;  4DSF A;  2OTJ N;  2DY4 A;  1FK9 A;  4BRH A;  3JS6 A;  2HBL A;  3AA5 X;  1EET A;  4RCH A;  3DOL A;  1K8K B;  3OYD A;  1VQ7 N;  4BR0 A;  4CZJ A;  1QVF M;  3MN6 A;  5C2F A;  2VWB A;  4PWD A;  4W5N A;  4DLE A;  4FWL A;  3CME N;  2VCP A;  3VEX A;  4K41 A;  1OH6 A;  1HKC A;  1VQ5 N;  3IUC A;  4J2E A;  4CBW A;  2X6N A;  4NCA A;  2E1Z A;  3FGU A;  5M1N A;  2JWL A;  1S1X A;  3EO3 A;  4CJR A;  4LF8 K;  3L4Q A;  4O8K A;  3LPU A;  5BN9 A;  3TR8 A;  1BIZ A;  4DWI A;  4Z94 A;  2KTQ A;  1JLF A;  3AVN A;  3NH2 A;  2I5J A;  1XUP O;  2FBT A;  2KHO A;  1SKW A;  3V1O A;  1RT2 A;  1N5Y A;  1WSG A;  3LP2 A;  1XHZ A;  3CJ7 A;  4IEE A;  1KQS M;  4GKK K;  3T3F A;  2YHY A;  3AVH A;  4YOX A;  3THV A;  1KLN A;  4CD1 A;  1VRU A;  1VQN N;  2PY5 A;  2IAJ A;  4PKG A;  4BC5 A;  2DTU A;  1VSM A;  1XQS C;  3WQU A;  1Z26 A;  3QIC A;  4W5Q A;  5C24 A;  5GIO A;  3LP0 A;  3OYF A;  3AAR A;  4CI6 A;  4CGI A;  3HP6 A;  4DV4 K;  1TGO A;  4YDU C;  3T1Y K;  1FXX A;  1K73 O;  2GX9 A;  4BG9 A;  2YX6 A;  2HMI A;  3PO4 A;  4U7B A;  4ELV A;  3CM6 A;  2HVH A;  3I55 N;  5BR8 K;  3ATV A;  3VQ6 A;  2C1G A;  5FPD A;  1EXQ A;  3NBP A;  4M3T A;  2ZJQ L;  3ZCM A;  2G8U A;  2YHA A;  4OLB A;  5FRN A;  5IWA K;  1YHQ N;  3HOS A;  3PUF A;  4K0K K;  4CHQ A;  2E8A A;  3VQE A;  1J54 A;  3H45 C;  1KC8 O;  4CJK A;  3FLC O;  3WNE A;  1YJW N;  1DTQ A;  5HL7 L;  1NK9 A;  3SPZ A;  1RDD A;  1JL1 A;  1VSF A;  4DFJ A;  4CE9 A;  4DV6 K;  3VMF B;  4BG8 A;  1MDU B;  5GIP A;  4JEP A;  4DFP A;  4IFE A;  2PZS A;  1RTI A;  4RTF D;  5E26 A;  5LMN K;  2OAN A;  1OVY A;  3K0S A;  2HF3 A;  4DCH A;  4CEA A;  4Q0B A;  1IG8 A;  3WXM B;  4KRE A;  2A40 A;  1WSI A;  5AQT A;  4CIF A;  1JCF A;  1RNH A;  4CF9 A;  4OJR A;  3VEW A;  4M63 C;  3LPT A;  5AQY A;  2HF4 A;  2E2O A;  3KWI A;  4A62 A;  2E6M A;  1X9J A;  3F2K A;  5AQZ A;  5KQ8 A;  2E1Y A;  5FRM A;  2OPR A;  3IFR A;  3NE6 A;  3PSF A;  4L8R B;  1TVR A;  4C8M A;  5AZJ A;  4J2D A;  1NGE A;  3NVK A;  1LV5 A;  4PL7 A;  4C1N K;  3CER A;  4FPA A;  3A5O C;  2I7P A;  4JI5 K;  1D8Y A;  3SV4 A;  2D0P A;  2P51 A;  3VQ7 A;  5FLX O;  3KTQ A;  2BH1 A;  1CZA N;  3T7Z A;  3ZSV A;  4CES A;  4DTP A;  3VES A;  3UKU A;  4B1V A;  3CXC M;  2G8K A;  3L3V A;  2LSN A;  3BZC A;  2P9N A;  2ZJP L;  2YCH A;  4TSX A;  4QS8 A;  4BEB A;  1JLC A;  4CEO A;  1NGD A;  4IDK A;  3VGM A;  5GAE P;  3MN7 A;  3QEI A;  3HO1 A;  4GVE A;  5HRN A;  3NF6 A;  2HBJ A;  4BC4 A;  4E3S A;  2EX3 A;  4B08 A;  1HKB A;  2I7N A;  2G8W A;  4FJN A;  4GV6 A;  3CC2 N;  2WON A;  4FM1 A;  3O3H A;  2QEX N;  4BWM A;  4JS5 A;  4M3W A;  3MN9 A;  4BVP A;  1KTQ A;  1BI4 A;  1TUU A;  4K8X A;  3DOK A;  4BR7 A;  3CCM N;  3VQD A;  5AR0 A;  3CMA N;  2PBD A;  2Q31 A;  3AVL A;  3VGL A;  3U3G A;  4WQ5 A;  1J9A A;  3VF2 A;  5EY4 A;  2UYT A;  3ZT4 A;  3SQ4 A;  1S9E A;  3RVC A;  4HCC A;  3QEV A;  2E88 A;  3ZX3 A;  5AQJ A;  4HTU A;  4C8O A;  3VER A;  4WQ4 C;  2YJE A;  1K8A O;  2QK9 A;  1NGJ A;  2KKZ A;  4JLH A;  4YOR A;  2E6L A;  2F4V K;  5KI6 A;  1NLV A;  4F3T A;  1NWK A;  1Q9Y A;  4QS7 A;  3UKR A;  4FVU A;  1BG3 A;  5JLF A;  1NJX A;  2RE2 A;  3RRG A;  1EO1 A;  4M7X A;  4FK0 A;  3Q7C A;  5AZJ B;  3HPH A;  3SBT A;  3EZ5 A;  2WOM A;  2Z1H A;  3A5N C;  3DWL A;  3IDH A;  3SJH A;  1NKE A;  1I3A A;  3DI6 A;  3D6R A;  2RF2 A;  3VQ4 A;  4ZTF A;  1B9D A;  3EEQ A;  4XJX A;  3AVG A;  4Z4F A;  3F9K A;  1ZBU A;  3PO5 A;  4X66 K;  1VSJ A;  4H5R A;  1REV A;  3UKU B;  3U6F A;  4DV2 K;  3AVJ A;  5J2M A;  2XY6 A;  1XWL A;  5FPN A;  1YIJ N;  3DLB A;  2CH6 A;  1NKB A;  3HPO A;  2P9N B;  4A2B A;  4JI3 K;  2HHX A;  3B6O A;  3A2F A;  1L3U A;  2KZZ A;  1RDA A;  3LL3 A;  3H3N O;  4FW1 A;  5C25 A;  1IV0 A;  4WE1 A;  3EE9 A;  1BCM A;  4IXC A;  2CGK A;  3LDO A;  4OX9 K;  3PX6 A;  3A5M C;  1GLE G;  3FZM A;  1BI4 B;  2OTL N;  4X62 K;  1QSL A;  2BTF A;  2Z1I A;  4IFV A;  1LAW A;  1Q82 O;  4OVL A;  3FR0 A;  4CF2 A;  3NVM A;  4M3Y A;  1JKH A;  2IGI A;  4B8C A;  4LC9 B;  5AQR A;  3KZB A;  1RBV A;  3MWP A;  3SUQ A;  2EHG A;  4CBX A;  3P83 D;  4BE0 A;  4I9Q A;  3ULD A;  3M8Q A;  4Y0W A;  1TK5 A;  3CHW A;  2PAV A;  4KFB A;  3HOT A;  2HST A;  1JLE A;  4KH6 A;  3M1F A;  1NK4 A;  3SLC A;  1QHA A;  4Z0U A;  4FM2 A;  4WYB A;  3UKR B;  2A6A A;  3SMP A;  1EQY A;  5K14 A;  1K6Y A;  3L0Q A;  3LWL A;  3WUH A;  2HOE A;  3G10 A;  5EOY A;  3BEX A;  1NJW A;  3MX5 A;  5M1F A;  3VQA A;  3CPE A;  2V52 B;  1KD1 O;  4H5W A;  4MLH A;  4CJ7 A;  1JCE A;  4JKE A;  3QBW A;  4M3X A;  1NGC A;  4BR9 A;  1U2V A;  3ZX2 A;  5AQM A;  4FM0 A;  2QWO A;  1HRH A;  5HBM A;  1CXU A;  3AVF A;  4ID1 A;  3KVG A;  2VG6 A;  3ASM A;  3L3U A;  3OS0 A;  1ZBS A;  3ZLJ A;  1VSH A;  4C8K A;  1RFQ A;  4BRA A;  3AGR A;  4E89 A;  5AQW A;  4BDY A;  3FFI A;  4F8R A;  1C0U A;  3DLL L;  3SQ2 A;  5GAG P;  4NO7 A;  4M42 A;  3HP9 A;  1TL1 A;  1NGI A;  2QWP A;  3OBW A;  3WNF A;  3RMA A;  1NGG A;  3SK3 A;  1Q86 O;  4JAX A;  4FLU A;  4DR6 K;  1T05 A;  2DFH A;  3AVI A;  4BE7 B;  2OPQ A;  1HNX K;  4JKF A;  3GL1 A;  1HNV A;  1GLD G;  4FLY A;  4L3Q A;  1WBB A;  2FXU A;  4X65 K;  1BHL A;  4K42 A;  4B9L A;  5CR4 A;  4EFH A;  5EVZ A;  3H3O B;  3TAP A;  2FSN A;  4DB3 A;  3AVM A;  3TAM A;  4Z4I A;  1QQN A;  3VEY A;  4YOV A;  1LWC A;  4FOE A;  5TKW A;  2FLO A;  4CJL A;  4Z4G A;  4M7Y A;  4JK9 A;  2ZM6 K;  3O3G A;  4B1U B;  1C0T A;  3J8A A;  1S3X A;  3K5N A;  3WEE B;  4NLC A;  1I39 A;  1OH5 A;  5JEN A;  4LY7 A;  1VAZ A;  5AQQ A;  3DRS A;  1NBW A;  3PX0 A;  2OZS A;  4JRQ A;  3FFK B;  1HUX A;  3MDQ A;  1C0F A;  3LAL A;  3D45 A;  4I2Q A;  2ZJR L;  1SUQ A;  4DTM A;  3OYA A;  1QZ6 A;  2ATQ A;  3VET A;  5C15 A;  4O8U A;  3LM9 A;  3LDL A;  1E4F T;  3S9H A;  1U2V B;  4OGE A;  1NK0 A;  3EN9 A;  5CE3 A;  1NK8 A;  1XNQ K;  1VSL A;  4DQP A;  4DQ8 A;  4B3R K;  1LAV A;  2YHW A;  3HZ6 A;  1RDW X;  3CJC A;  3THX A;  4GY2 B;  2HHU A;  1X9W A;  1C1B A;  1GLJ O;  4BRI A;  2P5O A;  1MA9 B;  4JRP A;  3WNH A;  4J2B A;  4BQZ A;  4ZTJ A;  4U67 L;  3SYZ A;  2WC9 A;  3WT0 A;  4GVM A;  3CCL N;  3OS1 A;  1NJI O;  1NJY A;  3H08 A;  2ITM A;  2GTD A;  4JI6 K;  4Y1C A;  1FKO A;  1GLB G;  4ID5 A;  3T1H K;  3CD6 N;  1F21 A;  1U49 A;  1XC9 A;  2RHK A;  3OYL A;  4KTQ A;  3AVB A;  4CJ5 A;  3RMB A;  1J5E K;  1BIS A;  3JAM O;  3OYG A;  5B8H A;  3K58 A;  3CCE N;  3CJ9 A;  5LMU K;  2J4R A;  2P5G A;  5BRD A;  4OPH A;  1EWQ A;  4HUE A;  3LAK A;  3SQ1 A;  4FLT A;  1DT9 A;  1IKX A;  1SL0 A;  3S3M A;  4CEC A;  3OBY A;  3PSI A;  2NLX A;  2QI2 A;  2A5X A;  3KIO A;  1M90 O;  4CEQ A;  3K9K A;  2HBK A;  5AFU H;  1VQ6 N;  4FW2 A;  3O9R A;  4JD2 A;  3TAN A;  1KFD A;  4CK3 A;  4H0X B;  1YJ9 N;  4IEI A;  4BRP A;  3EKU A;  5HRR A;  5JIC A;  4JYA K;  2ZF5 O;  2UUC K;  3O6W A;  5CYQ A;  3SAF A;  4FZX C;  4YOY A;  4DQQ A;  2Y1J A;  4KTZ A;  4BVO A;  2XO7 A;  1YTU A;  5F1X A;  4ZHR A;  4CF1 A;  4RW9 A;  2P9S A;  4BRQ A;  4DUY K;  2F8S A;  3R1X A;  3VPZ A;  1MWM A;  4AHC A;  1QVG M;  4CW7 B;  3THX B;  4WFB L;  4CJQ A;  3ZSY A;  5M1K A;  2IVP A;  3G4S N;  1HKG A;  4CHN A;  1EWR A;  3S41 A;  1RTD A;  4FJ5 A;  5KGX A;  2VWK A;  4FK2 A;  4LF4 K;  4FJG A;  3UB5 A;  4JI8 K;  4MFB A;  4B9T A;  3NCI A;  1RT3 A;  1NU0 A;  3L4I A;  4BDP A;  4R5P A;  2PYJ A;  4KPY A;  3ALY A;  3O5B A;  3QO9 A;  4CER A;  4B1X B;  1IKY A;  4DSJ A;  4GMJ B;  2KZM A;  3ZSO A;  1JXE A;  4FWM A;  5A2Q O;  3LZI A;  2FF6 A;  4DV7 K;  3CCR N;  2AJQ A;  5JS1 A;  2A42 A;  4IG3 A;  1HYS A;  5I9E B;  5C42 A;  1KAY A;  4GV9 A;  4JKH A;  4RG8 A;  2JLE A;  1TK8 A;  4JS4 A;  1BDG A;  4B1Y B;  3TAR A;  4LFC K;  4JD2 B;  3AA3 A;  3V1Q A;  1Q81 O;  3QB0 A;  4ELT A;  3HVR A;  1HQE A;  4RW4 A;  4DU1 A;  2V7Z A;  4RW7 A;  4CFC A;  2QW9 A;  3CJB A;  3ZSX A;  4YFU A;  4CZM A;  3TI0 A;  1QQM A;  4N76 A;  2GEL A;  1RBS A;  3SUP A;  1E4G T;  2P9S B;  2E20 A;  2W40 A;  1RBU A;  2P9P B;  5AQF A;  4FZZ A;  1NMD A;  5KTQ A;  5HP1 A;  4CHY A;  4YOU A;  1B9F A;  3A0I X;  3OYH A;  4LD0 A;  3K57 A;  1NK7 A;  3HPG A;  4RW6 A;  3VEV A;  4JV5 K;  1S1W A;  4MO4 A;  3VQC A;  2NNW A;  3O9U A;  1J6Z A;  3NAE A;  3HXM A;  2D0A A;  4JHD A;  3VA3 A;  1S6Q A;  4LF5 K;  1N32 K;  4H8K A;  3E01 A;  5GAH P;  1BGX T;  3MEE A;  4QCL A;  3J7Y P;  3C65 A;  4EAH D;  5I42 A;  4MDA A;  2P1J A;  3RR8 A;  3ZSQ A;  3J7Z O;  4E1M A;  3T1A A;  1VQO N;  2GEM A;  3V9S A;  3SNN A;  4B9S A;  1T7P A;  3RSE A;  1BL3 A;  4C1N I;  5BPN A;  1NM1 A;  3T19 A;  1HNI A;  5BPL A;  2UUB K;  2PFU A;  3QES A;  5FRO A;  2E5L K;  4FLX A;  2VGM A;  2NRH A;  4HHT A;  4KV8 A;  4IOA L;  1U6Z A;  4EHU A;  5C2D A;  3PX4 A;  1C6V A;  5AQS A;  3VEN A;  4LH5 A;  1WB9 A;  1LOT B;  2OA8 A;  2Z1G A;  1HR0 K;  4BRG A;  4XIU A;  4K43 A;  1BA0 A;  1X3N A;  1L3S A;  4BWJ A;  4BC3 A;  1NMN A;  3V4I A;  4ICL A;  1YVU A;  1BUP A;  4DSI A;  1Q8I A;  4E7L A;  5KPZ A;  1ATR A;  1IBL K;  4AIL C;  2E2P A;  1C0G A;  4O4G A;  3MWT A;  1QE1 A;  1RT4 A;  4ILJ A;  4OPJ A;  4F3O A;  1BWF O;  1J53 A;  3KLF A;  1EKE A;  3NHG A;  4YY3 K;  1NJZ A;  4GKJ K;  4CF8 A;  4DTX A;  3IMX A;  4N47 A;  4O0J A;  4JHD B;  3SUO A;  2FBY A;  4F4K A;  4BR4 A;  3LWM A;  4JI4 K;  2XY5 A;  3DLH A;  3CIP A;  1L5U A;  3ZSW A;  5AQV A;  3RSE B;  4FJX A;  2HHS A;  5SZT A;  2C1I A;  3DAW A;  4DR2 K;  1R59 O;  2CGJ A;  2YNF A;  5FPE A;  3LP3 A;  1RTH A;  5EU7 A;  2ASP A;  3VQ9 A;  4EZ9 A;  5J2P A;  2VG5 A;  3CJ1 A;  3R9P A;  3G6E N;  1RGI A;  5AFU A;  3AO4 A;  1W7A A;  2NRW A;  1WSF A;  3CM5 A;  3U3Y A;  4CHP A;  1W0H A;  3SAG A;  2FBX A;  2HB5 A;  4HUG A;  3DMJ A;  4GW6 A;  2NRT A;  3C7N A;  1RTJ A;  5AQX A;  2WFB A;  4CZG A;  3QET A;  2HHW A;  1L3V A;  4DHY A;  3M5R A;  3C95 A;  4BDZ A;  3TAE A;  1T03 A;  1NOZ A;  2X6S A;  3DLG A;  2FBV A;  4BAC A;  3CC4 N;  2QKK A;  4CEB A;  3QFU A;  3HM8 A;  4I6M A;  4FOI A;  2V51 B;  1HNZ K;  3ENH A;  4B9M A;  4BC2 A;  4CHZ A;  1OKJ A;  4KKO A;  4CEE A;  4N56 A;  3RTV A;  3D2F A;  1GOA A;  3NFA A;  1TYQ A;  4PA1 A;  3EKS A;  1NG9 A;  3OTO K;  4FL9 A;  4DF8 A;  3CYM A;  4BE1 A;  3V6D A;  3SI6 A;  3CQY A;  4E7I A;  2AP1 A;  4DFM A;  3MCP A;  4KH5 A;  2X74 A;  4DR3 K;  4JI2 K;  4LFA K;  1GLC G;  4E72 A;  3HI0 A;  2ZQB A;  5DK5 A;  3CCU N;  4M3U A;  2ZD1 A;  4ELU A;  3HM9 A;  1Z05 A;  3I56 N;  1C1A A;  4O5F A;  3ISN C;  1KSP A;  4NCB A;  3LAN A;  1JXB A;  3LDP A;  3THY A;  2BGG A;  5BRE A;  2IOC A;  1CZ9 A;  1UWB A;  3KLG A;  3IG1 A;  1WN7 A;  4EP5 A;  3L2Q A;  4ISE A;  4YDU A;  4BRL A;  5HRO A;  3VTH A;  4FJ8 A;  3K5L A;  1ASW A;  3KJV A;  3OYI A;  3K9J A;  3NGI A;  4CJW A;  5KQD A;  3SZ2 A;  4ISG A;  4PL8 A;  3C7N B;  4A61 A;  4JN4 A;  2BDP A;  1YXQ A;  1NOY A;  4KHU A;  4IOX A;  2YNG A;  4FWK A;  2NRX A;  1IKW A;  5FPM A;  2NUB A;  1UAX A;  3PLA A;  5CZ1 A;  5F0X A;  3R3L A;  4CGJ A;  3RWU A;  3KD5 E;  2P9I A;  3C0B A;  4BRM A;  3C6T A;  4I6M B;  5TKY A;  3FZL A;  5AQU A;  3QEW A;  2QKB A;  2HHI A;  2RN2 A;  3AAQ A;  4KHN A;  1RIL A;  3KKR A;  3BZK A;  4IBN A;  3D2F B;  5AQN A;  4DR4 K;  1TYQ B;  3U9Z A;  1TKX A;  2PYL A;  5DM7 L;  3I8D A;  3KD1 E;  2F8T A;  1WNS A;  1MU2 A;  3AA4 A;  3PIP L;  3OYK A;  1VQ8 N;  1JJ2 M;  4XH1 A;  4OPA A;  2JGU A;  3HTV A;  3WEE A;  4FK4 A;  1Z25 A;  3AO3 A;  1GLA G;  3QEP A;  4WCE L;  3VEO A;  2W42 A;  1V4T A;  3GG4 A;  4CF0 A;  3QER A;  3GOI A;  4C8L A;  4ILG B;  5I3U A;  1UA1 A;  4WFA L;  1VQ4 N;  1C1C A;  2O8D A;  3P31 A;  3ID8 A;  4H0Y B;  3TAF A;  3THY B;  3KK7 A;  2O8E A;  2VQF K;  3ENB A;  3FE1 A;  4K25 A;  1QS4 A;  1LW2 A;  4X64 K;  3S3N A;  1VK0 A;  3VQB A;  3JYT A;  1IO2 A;  4AHR A;  1VQL N;  3V9Z A;  4BR5 A;  5J2N A;  1JLG A;  1BQN A;  4LSL A;  4JKD A;  4A59 A;  4KAZ A;  3DJC A;  3B6P A;  1W97 L;  1ZYQ A;  3L2R A;  4EP4 A;  2F9W A;  5AQK A;  2VWJ A;  1HYZ A;  4CJE A;  5E41 A;  3BUZ B;  1NGF A;  3O9S A;  4O44 A;  3HSC A;  2KW4 A;  4E19 A;  2YKM A;  2XRI A;  1WOQ A;  1DLO A;  3TWH A;  1BO5 O;  2G8V A;  5IT9 O;  3TTC A;  2P9I B;  3ZYY X;  4QS9 A;  1QSY A;  4FWP A;  1ZXO A;  3DLK A;  1BIU A;  5DM6 L;  4E1N A;  3M8R A;  3PV8 A;  2H3G X;  3KLI A;  4H03 B;  3AO1 A;  3NF7 A;  4AHT A;  5H1S Q;  4DV5 K;  3KLH A;  1NNE A;  1Z6R A;  3D0P A;  4FWS A;  3WXK A;  5AJ3 K;  1SKS A;  4CJ3 A;  1I94 K;  4KB0 A;  4NYF A;  4XEI A;  5JLH A;  2QWQ A;  3FZF A;  4DV1 K;  4WQ4 A;  2NRV A;  4H0P A;  2HHQ A;  1JL2 A;  4RW8 A;  3L6Q A;  1IBK K;  3CQ8 A;  2ITG A;  3QBX A;  2Q36 A;  1VHX A;  4NXM K;  4AM6 A;  3LDN A;  2HNY A;  2O8D B;  4BY9 C;  4YNQ A;  1RT1 A;  1KXP A;  3QIO A;  4JI1 K;  3KK3 A;  5SWM A;  4FWN A;  2O8E B;  4CZF A;  4PY5 A;  4JK7 A;  5AZI A;  1HJO A;  2XHB A;  4YOT A;  5J2Q A;  3OJS A;  4JI0 K;  3SUN A;  4NB4 A;  4E1J A;  2NRR A;  2A3Z A;  4CFD A;  4FJJ A;  2ZWH A;  4BRN A;  4E0D A;  5J1E A;  3KK2 A;  2P9L A;  3IKM A;  4O55 A;  4H4M A;  2E2Q A;  4FO0 A;  5ADX A;  3QIP A;  4DU4 A;  1P90 A;  2XY8 A;  3JXU A;  1WBD A;  4H4O A;  4CEF A;  1O1W A;  1KRP A;  5BN8 A;  2ASO A;  4KTW A;  4IFY A;  2HHV A;  3CET A;  4UY8 O;  4BRE A;  4IWV A;  1DGK N;  4KHP K;  4PHT X;  3RR7 A;  4FYD A;  3SAH A;  1YT3 A;  1YF5 L;  4FJK A;  3D2E A;  4YOW A;  1VSI A;  5LL6 Z;  1X9M A;  3THW A;  3QEX A;  1SL2 A;  2D0O A;  1KAX A;  2O8B B;  1HYV A;  5AQP A;  1DKG D;  4CIE A;  2HHH K;  1SAZ A;  3J7A P;  3I8B A;  5JVG L;  5M1O A;  2HHT A;  5BRF A;  1NK5 A;  3OYM A;  3IS9 A;  2VGN A;  4B3M K;  3J81 O;  3VGK A;  4LSN A;  4CIG A;  4G1Q A;  4IDH A;  1T6C A;  2OYQ A;  3QML A;  4IO8 A;  1BOT O;  3EZW A;  3NF8 A;  2WBN A;  1N6Q A;  1DEJ A;  3GE1 A;  3ZT2 A;  5HOO A;  3O1W A;  2UXD K;  3O8M A;  1S72 N;  3CFR A;  2HNZ A;  3OY9 A;  2P9P A;  4CFA A;  3CCJ N;  4KRF A;  4H0V B;  5AZI B;  1R0A A;  4W5R A;  2DPN A;  2QTD A;  3HVT A;  2OPS A;  3SMS A;  3CC7 N;  3K5O A;  1NGA A;  1WSH A;  1KCF A;  1SZ2 A;  1RT5 A;  3HL8 A;  1YJN N;  1W9H A;  4K8Z A;  2P9L B;  2QWN A;  1ESV A;  2ZGZ A;  3M6G A;  1GLL O;  4HWI A;  4E7H A;  1CLQ A;  1W2B M;  1XC3 A;  2G8I A;  1U4B A;  2OZM A;  2IC3 A;  4CEZ A;  4A5B A;  4BRD A;  1KVC A;  1YI2 N;  3NDK A;  3F73 A;  3VQ5 A;  3E9P A;  4HUF A;  2HMP A;  3C6U A;  3WNG A;  2KLA A;  2NZT A;  4H0O A;  4M3R A;  1WSE A;  5JVH L;  3D2E B;  1JLA A;  4KHS A;  3BF1 A;  3P39 A;  1HNW K;  3THW B;  3AVK A;  4GNI A;  4BRF A;  1QQO A;  4DS4 A;  1IJJ A;  2BE2 A;  2IS3 A;  4M3Z A;  1CXQ A;  3E1Y A;  1N34 K;  1N36 K;  4H5V A;  3K5M A;  5EXW A;  2ZE2 A;  4MLE A;  1YVN A;  4QAG A;  4DKW A;  3O4W A;  4BGB A;  4FPB A;  4N5S A;  4RWT A;  1XNR K;  1GOB A;  2G8F A;  3LZJ A;  1TKZ A;  3A8Y A;  4DG1 A;  2GWK A;  3AY9 A;  2XY7 A;  4DUZ K;  4IOC L;  2UXC K;  3M8S A;  4FJM A;  3RMC A;  2UUA K;  2Q0R A;  2YHB A;  4CJ4 A;  1XMO K;  3UE5 A;  4DSK A;  3ZSZ A;  4FJ9 A;  1QZ5 A;  4BQL A;  3TSU A;  3W0L A;  1YTA A;  3K2P A;  5BPM A;  1RCH A;  1KFS A;  2OPP A;  3C6A A;  3U4L A;  4FXD A;  4WQ5 C;  1U48 A;  3R8E A;  2ASM A;  4KB1 A;  1QTM A;  2VQE K;  2QA4 N;  4WF9 L;  5KGW A;  5D3G A;  3L8B A;  1NK6 A;  4FWR A;  4B3T K;  3TTD A;  4LF6 K;  1X3M A;  4IJA A;  3JSM A;  5LY3 A;  1EX4 A;  4KI4 A;  4ILH A;  3OW2 M;  4PQU A;  4BGA A;  3O1B A;  2F9T A;  3HYF A;  1JLB A;  5HRS A;  4V19 S;  3M8P A;  1OH7 A;  4OKK A;  3D7E O;  1D4X A;  1K9M O;  1XHX A;  1KVB A;  4DQI A;  5CZ2 A;  4BRO A;  1QQC A;  5MLC Q;  1IH7 A;  1NGH A;  4F2S A;  3M3Z A;  3W3D A;  3MXI A;  3VQP A;  3ZET A;  1SV5 A;  3CPW M;  2QXL A;  1VQ9 N;  1OH8 A;  1T6D A;  4AQY K;  2WUS A;  3MAQ A;  2E4L A;  4OPK A;  3B8A X;  1FW6 A;  3O9Q A;  4DV0 K;  2P9K A;  1D5A A;  4CJP A;  2YNH A;  1VRT A;  4FZY A;  2QWR A;  3QLH A;  3OYE A;  1U47 A;  4E7K A;  2R7Y A;  2QWM A;  4OO1 J;  1KAZ A;  3ZT1 A;  3AA2 A;  3E9O A;  2KFZ A;  3N4Q A;  4DS5 A;  2B4J A;  3MX2 A;  1TAQ A;  1B92 A;  1SS6 A;  3P5J A;  5BRH A;  1T44 A;  2FSK A;  3LDQ A;  1X9S A;  1RDC A;  4B1W B;  1WAJ A;  3CFP A;  4DFK A;  1VQK N;  5FDL A;  3MN5 A;  4DTO A;  5KPT A;  4DR1 K;  1VQM N;  5F2R A;  2BAN A;  4CGD A;  4M45 A;  3DXM A;  4IO9 L;  3VEZ A;  1J5O A;  4AH9 A;  1Q9X A;  4PKI A;  4MQ3 A;  3DM2 A;  3HRG A;  3I0S A;  3QFP A;  3KKS A;  1A5X A;  3ZEU A;  3ITH A;  3TSP A;  2ZGY A;  4FLZ A;  5E84 A;  4F2R A;  4I7F A;  4B9U A;  1XMQ K;  1VSD A;  3H1Q A;  4DR7 K;  3AGK A;  4CZL A;  3SBG A;  1NKC A;  5AQI A;  3AO2 A;  5CHI A;  1TL3 A;  1Y64 A;  5AQL A;  2D4W A;  3ZET B;  1BA1 A;  1BQM A;  4CGH A;  4FWO A;  1S6P A;  5C12 A;  3CYG A;  2FC0 A;  1ZBF A;  3ZT0 A;  3NF9 A;  3O9T A;  4CVN E;  4AM7 A;  2P9K B;  4KI6 A;  3V81 A;  3DXK A;  4DSL A;  2IIR A;  4Q5V A;  1ZBL A;  4PKH A;  5ADX H;  4C8N A;  4DTR A;  4M41 A;  3GBT A;  3DLR A;  3P1G A;  4NCG A;  2O8C A;  4CD3 A;  3RMD A;  2WTU A;  1M1K O;  3TAG A;  3IAY A;  3BDP A;  1S1V A;  4J8F A;  3J80 O;  1SL1 A;  3SV3 A;  1JLQ A;  2F7T A;  1TKD A;  1BCO A;  4I2P A;  2IDO A;  3K59 A;  5GAD P;  3DXM B;  1S5J A;  3F5T A;  1N33 K;  1E3M A;  3KHY A;  4CJS A;  4AHS A;  1SQK A;  3DRP A;  2Y1I A;  1C0M A;  5DMR A;  3KK1 A;  3S3O A;  1IG9 A;  4CK1 A;  1S1T A;  2DFF A;  1OVQ A;  4LF9 K;  3MCA B;  3ZEU B;  2HND A;  4G9Z A;  1U04 A;  3G0Z A;  1BU6 O;  2F96 A;  2X78 A;  3LDS A;  1ASU A;  2B5J A;  3NGY A;  2CGL A;  2D1K A;  2GUI A;  3GDQ A;  4H0T B;  4XH4 A;  1RT7 A;  4HCB A;  4DQR A;  4JI7 K;  3CF5 L;  4JKG A;  2GV9 A;  3O4Q A;  4FSV A;  3ULE A;  3NMU A;  2V7Y A;  4B8A B;  4CZI A;  1O13 A;  2HBM A;  3EL2 A;  2NRZ A;  2W00 A;  2W6L A;  3ZSR A;  4JKA A;  1L3T A;  5M1P A;  3OHR A;  3VTI A;  1S1U A;  3F9M A;  3I33 A;  3DYA A;  4IZ9 A;  4BR2 A;  4NLB A;  1HMV A;  5BR9 A;  3VA0 A;  4NXN K;  3DXK B;  3EY1 A;  4KH4 A;  4W5O A;  2GBZ A;  3VN5 A;  1EP4 A;  1S9G A;  1WLJ A;  1XI1 A;  3CCQ N; 
#chains in the Genus database with same CATH homology
 3KWG A;  4BY9 C;  3CCR N;  2OAN A;  1OVY A;  4CBU A;  1KXP A;  2A42 A;  2HF3 A;  4FWN A;  3MMV A;  4JNE A;  4DCH A;  1IG8 A;  4CZF A;  3WXM B;  3Q7B A;  2A40 A;  5I9E B;  1KAY A;  2IVO A;  5AQT A;  4JK7 A;  1JCF A;  5LJV A;  4GV9 A;  3N4P A;  5AZI A;  1HX1 A;  1HJO A;  4JKH A;  4YOT A;  3G25 A;  3VEW A;  3CQX A;  4M63 C;  4EIA A;  4KBO A;  4NB4 A;  4HTL A;  1BDG A;  5AQY A;  4B1Y B;  4E1J A;  2HF4 A;  2A3Z A;  2NRR A;  2E2O A;  3E66 A;  3KWI A;  3P38 A;  4A62 A;  4JD2 B;  1X9J A;  5C10 A;  3F2K A;  5AQZ A;  1Q81 O;  3QB0 A;  5KQ8 A;  2ZWH A;  4BRN A;  2E1Y A;  4A5A A;  3IFR A;  2P9L A;  3IKM A;  2E2Q A;  4R79 A;  2V7Z A;  4FO0 A;  3VOV A;  5AZJ A;  3NVK A;  1NGE A;  5ADX A;  1P90 A;  4PL7 A;  2QW9 A;  2GWJ A;  4C1N K;  3CJB A;  3CER A;  4FPA A;  3JXU A;  3U9D A;  4CZM A;  3A5O C;  4EHT A;  1QQM A;  2GEL A;  2I7P A;  4CZH A;  1E4G T;  2ASO A;  2P9S B;  2E20 A;  5BN8 A;  2GUP A;  2W40 A;  3CET A;  2D0P A;  2P9P B;  5AQF A;  2BH1 A;  1CZA N;  3T7Z A;  4UY8 O;  2YHX A;  1NMD A;  4BRE A;  4IWV A;  3VES A;  1DGK N;  1LCU A;  3UKU A;  4B1V A;  4PHT X;  3CXC M;  3H1V X;  4C23 A;  3CCQ N;  3CJA A;  3SAH A;  4YOU A;  1YF5 L;  2P9N A;  2ZJP L;  2YCH A;  3D2E A;  3VF4 A;  3A0I X;  4QS8 A;  4YOW A;  4BEB A;  4JKG B;  3VEV A;  1RDU A;  1NGD A;  3VGM A;  3ULE B;  5GAE P;  4MO4 A;  2NNW A;  3MN7 A;  2D0O A;  1KAX A;  3O9U A;  1J6Z A;  1ATN A;  1T3V A;  4GVE A;  5AQP A;  1DKG D;  4JHD A;  2HBJ A;  4BC4 A;  3T69 A;  1HKB A;  1SAZ A;  2I7N A;  4ISF A;  5GAH P;  1YIT N;  4GV6 A;  3CC2 N;  3I8B A;  5JVG L;  5M1O A;  5BRF A;  3C65 A;  4EAH D;  2QEX N;  2VGN A;  4MDA A;  3MN9 A;  4IJN A;  4BVP A;  3U8X A;  1TUU A;  3VGK A;  3J7Z O;  4BR7 A;  3TTF A;  3O08 A;  3CCM N;  5AR0 A;  3CMA N;  1VQO N;  2PBD A;  2Q31 A;  3VGL A;  2GEM A;  4IDH A;  1T6C A;  3QML A;  1ZC6 A;  4IO8 A;  1BOT O;  3EZW A;  4WQ5 A;  3VF2 A;  2WBN A;  5EY4 A;  3RSE A;  1DEJ A;  2UYT A;  3GE1 A;  4WFN L;  4C1N I;  5BPN A;  1NM1 A;  4FWQ A;  5HOO A;  3O1W A;  4MO5 A;  5BPL A;  3O8M A;  2PFU A;  3RVC A;  1S72 N;  2E88 A;  3ZX3 A;  5AQJ A;  2P9P A;  3VER A;  4H5T A;  3CCJ N;  4H0V B;  4WQ4 C;  5AZI B;  2VGM A;  4AF1 A;  2YJE A;  1K8A O;  2DPN A;  2QTD A;  2NRH A;  1NGJ A;  2KKZ A;  3SMS A;  3CC7 N;  4IOA L;  4YOR A;  1U6Z A;  4EHU A;  1NLV A;  1NWK A;  5C2D A;  1NGA A;  1SZ2 A;  2EWS A;  4QS7 A;  3UKR A;  4FVU A;  5AQS A;  3VEN A;  1YJN N;  1BG3 A;  5JLF A;  2P9L B;  2RE2 A;  2QWN A;  1ESV A;  1LOT B;  1NGB A;  3R6M A;  2ZGZ A;  2Q97 A;  3M6G A;  4M7X A;  3Q7C A;  5AZJ B;  1EO1 A;  4BRG A;  1GLL O;  3SBT A;  4CZK A;  1Q18 A;  4HWI A;  4K43 A;  3TPQ A;  3A5N C;  3DWL A;  3IDH A;  3SJH A;  3FZK A;  1BA0 A;  2QWL A;  1X3N A;  1W2B M;  3D6R A;  1XC3 A;  4BC3 A;  4XJX A;  3TSQ A;  3A5L C;  4A5B A;  4BRC A;  4BRD A;  3O80 A;  1YI2 N;  1BUP A;  3AAP A;  3E9P A;  2HMP A;  1Q7Y O;  2KLA A;  2NZT A;  4H0O A;  1ATR A;  5KPZ A;  4H5R A;  3UKU B;  2E2P A;  1C0G A;  3FZH A;  3MWT A;  4ILJ A;  5FPN A;  1YIJ N;  1BWF O;  2CH6 A;  4JKB A;  2P9N B;  4A2B A;  5JVH L;  3D2E B;  3BF1 A;  3WXJ A;  3P39 A;  3PIO L;  3LL3 A;  3H3N O;  4GNI A;  4BRF A;  1QQO A;  1IJJ A;  3P4I A;  3IMX A;  3EE9 A;  3E1Y A;  2CGK A;  3LDO A;  4IXC A;  4JHD B;  4H5V A;  2QM1 A;  5EXW A;  4JK8 A;  4MLE A;  1YVN A;  3A5M C;  4DKW A;  3O4W A;  3ZX0 A;  4BGB A;  4FPB A;  1GLE G;  5AQO A;  2W41 A;  4BR4 A;  3FZM A;  2FSJ A;  4RWT A;  2OTL N;  2Q2R A;  3BP8 A;  2BTF A;  3A8Y A;  2GWK A;  3AY9 A;  1Q82 O;  3FR0 A;  3CIP A;  3NVM A;  5AQV A;  4LC9 B;  3RSE B;  5AQR A;  4IOC L;  3WQT A;  3KZB A;  4BRK A;  5ELZ A;  3MWP A;  2C1I A;  3DAW A;  1R59 O;  2CGJ A;  5FPE A;  1YAG A;  1VQP N;  3OA9 A;  4CBX A;  2Q1N A;  3LM2 A;  4H5N A;  2ASP A;  2Q0R A;  1V4S A;  4Y0W A;  2YJF A;  3UE5 A;  4B1Z A;  3CHW A;  2PAV A;  3CJ1 A;  3H46 O;  3R9P A;  3G6E N;  1QZ5 A;  1RGI A;  5AFU A;  3HOT A;  4BQL A;  3CCV N;  2HST A;  3TSU A;  3W0L A;  4KH6 A;  3M1F A;  2NRW A;  5BPM A;  2IVN A;  5EX5 A;  3SLC A;  1QHA A;  4GV3 A;  4WYB A;  3UKR B;  2A6A A;  3SAG A;  3C6A A;  4CZE A;  3SMP A;  2P9U A;  3U4L A;  4BEC A;  1EQY A;  4WQ5 C;  2NRT A;  5M1Q A;  3C7N A;  2A41 A;  2JWK A;  3R8E A;  5AQX A;  2ASM A;  3L0Q A;  3WUH A;  1G99 A;  2CH5 A;  2HOE A;  2WFB A;  4CZG A;  3VF6 A;  5EOY A;  3WXL A;  3BEX A;  2QA4 N;  4WF9 L;  3MK6 A;  4DHY A;  3M5R A;  3MX5 A;  3CCS N;  5M1F A;  3CPE A;  2V52 B;  4FWR A;  1KD1 O;  4H5W A;  4MLH A;  3TTD A;  4CJ7 A;  1JCE A;  1X3M A;  4IJA A;  4JKE A;  5LY3 A;  3QBW A;  4ILH A;  3OW2 M;  4MDB A;  3CC4 N;  1NGC A;  4BGA A;  1P8Z A;  3O1B A;  2F9T A;  1U2V A;  3QFU A;  4BR9 A;  3ZX2 A;  3QDK A;  5AQM A;  3HM8 A;  5AQG A;  2QWO A;  4I6M A;  4B9Q A;  1MWK A;  1K8K A;  3KVG A;  4FOI A;  1ATS A;  2V51 B;  3ENH A;  3BF3 A;  3D7E O;  5C0Y A;  1ZBS A;  1RFQ A;  4BRA A;  3AGR A;  1D4X A;  4BC2 A;  1GLF O;  1K9M O;  4BRO A;  1OKJ A;  3ENO A;  1JCG A;  5AQW A;  2E2N A;  3D2F A;  5MLC Q;  1TYQ A;  3DLL L;  1NGH A;  3HBT A;  3EKS A;  3M3Z A;  3W3D A;  4A57 A;  4FL9 A;  5GAG P;  3ZET A;  4NO7 A;  3CPW M;  2QXL A;  1VQ9 N;  1NGI A;  1T6D A;  2QWP A;  3OBW A;  1Q86 O;  1NGG A;  3CQY A;  3SK3 A;  2WUS A;  1ILY A;  4JAX A;  2AP1 A;  3B8A X;  3CI5 A;  3MCP A;  3ID6 A;  4BE7 B;  1H1V A;  2YI1 A;  3O9Q A;  4KH5 A;  5KPR A;  4JKF A;  3GL1 A;  1GLC G;  2P9K A;  1GLD G;  2FF3 B;  3HI0 A;  4L3Q A;  2FXU A;  2VYP A;  3CCU N;  4K42 A;  1WUA A;  3ATU A;  1YUW A;  1Z05 A;  2QWR A;  5GIN A;  3I56 N;  5CR4 A;  4EFH A;  1HPM A;  1HLU A;  4O5F A;  3G71 N;  5EVZ A;  3H3O B;  3C6H A;  2FSN A;  2QWM A;  3LDP A;  3H6E A;  4A2A A;  1KAZ A;  4DB3 A;  4OO1 J;  5BRE A;  3E9O A;  1QQN A;  3VEY A;  3N4Q A;  4YOV A;  4FOE A;  5TKW A;  2FLO A;  3MX2 A;  4ISE A;  4YDU A;  4BRL A;  4JKC A;  4M7Y A;  1SS6 A;  4JK9 A;  5BRH A;  2BUP A;  4B1U B;  3J8A A;  3VTH A;  1T44 A;  2FSK A;  1S3X A;  3LDQ A;  3K9J A;  4B1W B;  2P9U B;  5JMV A;  3TU5 A;  3WEE B;  4NLC A;  1S22 A;  5KQD A;  4ISG A;  4PL8 A;  1VQK N;  4F9O A;  3C7N B;  3MN5 A;  3EE8 A;  4A61 A;  4JN4 A;  5KPT A;  1YXQ A;  3WXI A;  1N8R O;  1VAZ A;  4IOX A;  5AQQ A;  5LJW A;  1VQM N;  1NBW A;  4FWK A;  5F2R A;  2AA4 A;  2NRX A;  3DXM A;  3FFK B;  3VEZ A;  1HUX A;  3MDQ A;  1C0F A;  5FPM A;  5AQH A;  4IO9 L;  1TUY A;  2ZJR L;  3PLA A;  4PKI A;  4XH5 A;  1QZ6 A;  5F0X A;  3VET A;  5C15 A;  3HRG A;  4O8U A;  3R3L A;  3LM9 A;  3LDL A;  1E4F T;  3QFP A;  3ZEU A;  1U2V B;  2Q0U A;  3E9L A;  3TSP A;  2P9I A;  3EN9 A;  2ZGY A;  3C0B A;  5CE3 A;  2OTJ N;  4BRM A;  5E84 A;  4I6M B;  4BRH A;  5TKY A;  3JS6 A;  2HBL A;  3FZL A;  4RCH A;  5AQU A;  1K8K B;  3H1Q A;  1VQ7 N;  4BR0 A;  4CZJ A;  4DQ8 A;  3AGK A;  3MN6 A;  3AAQ A;  4CZL A;  1QVF M;  3SBG A;  5AQI A;  5C2F A;  2VWB A;  2YHW A;  3HZ6 A;  4FWL A;  3CME N;  1RDW X;  2VCP A;  3CJC A;  3VEX A;  3D2F B;  4GY2 B;  4K41 A;  5CHI A;  5AQN A;  1Y64 A;  1GLJ O;  1TYQ B;  4BRI A;  5AQL A;  2D4W A;  1MA9 B;  1HKC A;  3U9Z A;  3IUC A;  1VQ5 N;  4CBW A;  3ZET B;  1BA1 A;  4BQZ A;  5DM7 L;  4U67 L;  2WC9 A;  4FWO A;  3WT0 A;  3PIP L;  2E1Z A;  3CCL N;  1VQ8 N;  5C12 A;  3FGU A;  5M1N A;  1NJI O;  1JJ2 M;  2ITM A;  2JWL A;  2GTD A;  4XH1 A;  4OPA A;  3HTV A;  3WEE A;  1GLB G;  1GLA G;  3O9T A;  4WCE L;  3EO3 A;  3CD6 N;  3VEO A;  3L4Q A;  4O8K A;  4AM7 A;  1V4T A;  3GG4 A;  2P9K B;  5BN9 A;  4Z94 A;  2RHK A;  3GOI A;  3DXK A;  5B8H A;  2IIR A;  3CJ9 A;  3CCE N;  4ILG B;  1XUP O;  4PKH A;  4WFA L;  2KHO A;  2J4R A;  5ADX H;  1VQ4 N;  5BRD A;  4OPH A;  3P31 A;  3ID8 A;  3GBT A;  4H0Y B;  3KK7 A;  3CJ7 A;  4CD3 A;  3ENB A;  1DT9 A;  3FE1 A;  4IEE A;  1KQS M;  4K25 A;  3OBY A;  1M1K O;  2NLX A;  2QI2 A;  2A5X A;  2YHY A;  4YOX A;  1M90 O;  3K9K A;  2HBK A;  4CD1 A;  5AFU H;  1VQ6 N;  4J8F A;  1VQN N;  1VQL N;  3O9R A;  4JD2 A;  4BR5 A;  2F7T A;  4PKG A;  4BC5 A;  4A59 A;  4H0X B;  4JKD A;  1YJ9 N;  1XQS C;  3DJC A;  4IEI A;  4BRP A;  3EKU A;  5JIC A;  1W97 L;  5GAD P;  2ZF5 O;  3DXM B;  3O6W A;  2F9W A;  3WQU A;  3F5T A;  5AQK A;  3QIC A;  3KHY A;  3SAF A;  3BUZ B;  1NGF A;  1SQK A;  3O9S A;  4YOY A;  5GIO A;  3HSC A;  4BVO A;  3AAR A;  4CI6 A;  5F1X A;  1WOQ A;  1BO5 O;  3MCA B;  3ZEU B;  4YDU C;  3TTC A;  2P9I B;  1K73 O;  3ZYY X;  4G9Z A;  4QS9 A;  2P9S A;  4FWP A;  2GX9 A;  1ZXO A;  4BG9 A;  4BRQ A;  2YX6 A;  1BU6 O;  5DM6 L;  4U7B A;  3R1X A;  1MWM A;  2CGL A;  2D1K A;  4H0T B;  3GDQ A;  3VPZ A;  2H3G X;  3I55 N;  4XH4 A;  3ATV A;  1QVG M;  4H03 B;  2C1G A;  5FPD A;  4WFB L;  2ZJQ L;  5M1K A;  3CF5 L;  2IVP A;  3G4S N;  1HKG A;  4JKG A;  4FSV A;  3S41 A;  5H1S Q;  3ULE A;  1Z6R A;  2V7Y A;  3NMU A;  4CZI A;  1O13 A;  4FWS A;  3WXK A;  1YHQ N;  2HBM A;  3EL2 A;  3UB5 A;  2NRZ A;  2W00 A;  3HOS A;  4JKA A;  4XEI A;  5JLH A;  2E8A A;  2QWQ A;  3FZF A;  3L4I A;  5M1P A;  4WQ4 A;  2NRV A;  3H45 C;  3OHR A;  4H0P A;  1KC8 O;  3FLC O;  3VTI A;  1YJW N;  3F9M A;  3I33 A;  3L6Q A;  4IZ9 A;  4BR2 A;  3O5B A;  5HL7 L;  4NLB A;  3QBX A;  4B1X B;  5BR9 A;  3DXK B;  3VMF B;  4BG8 A;  1MDU B;  2Q36 A;  5GIP A;  4JEP A;  4IFE A;  4FWM A;  4KH4 A;  4RTF D;  4AM6 A;  3LDN A;  5E26 A;  2FF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...