4I6MA

Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of swi/snf chromatin remodeler.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
465
structure length
399
Chain Sequence
b'TLNRKCVVIHNGSHRTVAGFSNVELPQCIIPSSYIKRTEAEFIFGTYNMIDAAAEKRNGDEVYTLVDSQGLPYNWDALEMQWRYLYDTQLKVSPEELPLVITMPATNGKPDMAILERYYELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIGASGCNVTPIIDGIVVKNAVVRSKFGGDFLDFQVHERLAPLIKEEQKRSTDVWYEASTWIQQFKSTMLQVSEKDLFELERYYKEQADIYAKQQENNPLVQKKNFLFKPLNKTLTLDLKECYQFAEYLFKPQLISDKFSPEDGLGPLMAKSVKKAGASISPEQVYSLLLTNVIITGSTSLIEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGWLGALTMANLPSWSLGKWYSKEDYETLKRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 7
publication title Structure of an actin-related subcomplex of the SWI/SNF chromatin remodeler.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
total genus 107
structure length 399
sequence length 465
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4i6mA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4i6mA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4i6mA03
3ZETA 1BO5O 5AQPA 5AQYA 5AR0A 4CBUA 3GE1A 1Y64A 5ELZA 2VYPA 1YAGA 3ULEB 4K41A 3WXIA 4B9QA 2Q2RA 2ZGYA 4ISEA 3WUHA 3UE5A 5ADXA 3DXKB 3SMSA 4BRQA 4CD1A 3U4LA 1GLCG 2A5XA 5BRHA 1XQSC 4BQLA 3LDOA 1H1VA 1BUPA 3FZMA 3UKRB 4FWPA 1GLLO 5AQGA 3A5MC 4YDUC 1BWFO 3FE1A 4FWRA 5AFUH 4BR2A 2HF3A 3DXMA 1X9JA 2V7ZA 3A5OC 3MN9A 1S3XA 4Y0WA 2A40A 4FWMA 5F1XA 4BC3A 1TYQA 4H0OA 4JD2B 4H0TB 4IO8A 4ISFA 2V7YA 4PKHA 3L4IA 4WQ4A 4IZ9A 3AY9A 3CQXA 3BF1A 3W0LA 3VEXA 5JLFA 3OHRA 3KZBA 3A8YA 4EIAA 3VEOA 4BRHA 3L6QA 3HSCA 5AQSA 4XH4A 3QICA 1BU6O 4CZJA 3FZKA 1J6ZA 2FSNA 3UKUB 1Z6RA 3MCPA 1QQNA 5EY4A 3CIPA 3RSEA 3B8AX 3I8BA 4CBXA 1NBWA 5AZJB 1EQYA 4A62A 4JN4A 3O8MA 4IWVA 4Z94A 5LY3A 1MWMA 3CJ7A 4JHDA 2GUPA 4PKIA 3J8AA 1NMDA 2CH5A 3HZ6A 2IVOA 1QHAA 3JS6A 2P9LA 1LCUA 4F9OA 4XH5A 3H1QA 3VPZA 1MWKA 4JAXA 2E8AA 2E2QA 1MA9B 3DWLA 3H6EA 3WQTA 4BROA 4H5NA 1E4GT 5BPNA 4PKGA 3QDKA 2QWRA 1GLBG 3IFRA 3MN7A 2Q31A 5AQIA 3FGUA 4PL8A 1KAXA 1KAYA 2YHXA 4BG9A 2HOEA 5BPLA 2ASMA 4EHTA 4QS7A 3ZX0A 3LDPA 4GNIA 5AQJA 4EHUA 2P9IB 3CJBA 5FPDA 1X3MA 3VENA 4M63C 1S22A 1GLFO 1NWKA 5LJWA 4CZHA 4WQ4C 5AFUA 1NGFA 2Q0UA 1GLJO 2HMPA 2D1KA 2P9PB 5AQTA 2AP1A 2P9KA 2QWNA 3VF6A 2YJFA 2V51B 3AAQA 2QW9A 1JCFA 2GTDA 1T44A 2E20A 5F0XA 5AQQA 3CJAA 3CJ9A 5JICA 4H0PA 4MO4A 4BGAA 1NGGA 1ATSA 1GLDG 4NB4A 3R9PA 4CZIA 2NRHA 2QWMA 2EWSA 5I9EB 5JLHA 1NLVA 4CZEA 1RDWX 3SJHA 5BRFA 4H5TA 2CGJA 4WYBA 4FWLA 1QZ6A 3L0QA 5AQHA 1QQOA 3VETA 2D0PA 4XH1A 4MLHA 3EL2A 2W40A 3FLCO 4H0XB 4MO5A 2V52B 3D2FA 5BN8A 2P9UA 2QXLA 5KPTA 1V4SA 5FPEA 2OANA 4FSVA 1NGHA 1WOQA 2QWQA 4EFHA 4B1VA 3C0BA 3I33A 4A2BA 4FPAA 3DXMB 3WXKA 3H46O 1TYQB 3ULEA 5KQDA 2E88A 3VEYA 5BRDA 3ATUA 4H5VA 2IIRA 5AQRA 3SK3A 4L3QA 3ZX3A 4BRFA 2QWLA 3QB0A 1NM1A 3FR0A 3U9ZA 3ZEUA 3MDQA 5AQVA 3EKUA 1QZ5A 1TUYA 3CERA 3MMVA 3UKRA 4DCHA 2FSKA 1JCGA 5FPNA 1GLAG 3RSEB 4IJAA 3VESA 1IJJA 4RCHA 2ASPA 4B1UB 5AQNA 4BRAA 1HX1A 4JD2A 2VCPA 4BRNA 4BRLA 2F9WA 1QQMA 4WQ5A 1KAZA 2QWPA 2NLXA 3ZX2A 4CZGA 4BC4A 4CD3A 3CJCA 5AQFA 2FF6A 2WUSA 4FOIA 1HKCA 3UB5A 3MN6A 1ESVA 2NZTA 3BF3A 4IJNA 5EXWA 5FPMA 3R6MA 3W3DA 3F9MA 4DB3A 1DGKN 1YUWA 3UKUA 2Q1NA 2P9LB 4FWNA 3H3OB 5BR9A 3U8XA 2I7PA 1ATRA 2PBDA 2DPNA 2FF3B 3M6GA 3O1WA 5F2RA 4BQZA 3S41A 4CZKA 2A6AA 1DEJA 5AQLA 2KHOA 3VERA 1G99A 2E2PA 1NGAA 4FWSA 3LDQA 5ADXH 3LL3A 3O1BA 1DKGD 2P9NA 4BR4A 1U2VA 4CZLA 1SZ2A 3BP8A 5LJVA 2GEMA 4H5WA 3D2EA 2PAVA 3QBXA 3O80A 3AAPA 1HUXA 1NGDA 3M1FA 5AQWA 1NGIA 4B1YB 1LOTB 2BUPA 3WXLA 2P9KB 2E1ZA 2Q0RA 5EOYA 1E4FT 4K43A 4FL9A 3SLCA 2P9SA 4A2AA 4BRIA 3ID8A 3H3NO 2IVPA 4B1ZA 4H5RA 4B1XB 4IXCA 3WEEB 1HKBA 1XC3A 3VEWA 3ENHA 2A41A 5JMVA 1SQKA 4BR0A 5BPMA 1K8KA 4FOEA 3C7NA 5BN9A 4BRMA 2ZGZA 4BRKA 3A5NC 3FZHA 4I6MA 5B8HA 3EO3A 4JNEA 1RGIA 2Q97A 5AQOA 3ZETB 3IMXA 4BVOA 2P9PA 2F9TA 3QFPA 4BG8A 4CZMA 3U9DA 4M7YA 4BREA 1HPMA 3P4IA 4FO0A 3O6WA 4CJ7A 3A0IX 4NO7A 1ATNA 3HBTA 3VF2A 1KXPA 1BG3A 1Z05A 4BRGA 3AARA 2P9UB 2J4RA 1YXQA 3FZLA 3R8EA 4BGBA 3BUZB 1BDGA 1ZXOA 4C23A 5AZIA 3O4WA 5TKYA 4FWQA 3G25A 1P8ZA 3KHYA 4AM7A 1YVNA 4BRPA 3A5LC 5EVZA 4BR5A 3H45C 5AQKA 4M7XA 3IDHA 4E1JA 1T6CA 3M3ZA 3HTVA 3O08A 3DXKA 2ASOA 5KQ8A 1ZC6A 3EKSA 4BC2A 2YCHA 3ZEUB 3KVGA 2ITMA 3GOIA 1C0FA 2FXUA 3IUCA 1NGBA 3H1VX 1SAZA 3CHWA 4ISGA 4FWOA 4GY2B 4RTFD 3WXJA 1MDUB 3VEVA 3O5BA 4BR7A 3D7EO 4RWTA 3DJCA 5KPRA 1BOTO 3ATVA 4QS8A 1C0GA 1NGEA 2CH6A 2YHWA 5EX5A 3QMLA 1CZAN 2CGKA 3VGMA 4BRCA 4K25A 3ENOA 3LDNA 4JHDB 1ZBSA 5AQMA 5E84A 4QS9A 3LM2A 3CJ1A 3GG4A 3TU5A 4CI6A 1R59O 2VWBA 3HI0A 1X3NA 1V4TA 4EAHD 2IVNA 3GL1A 4DHYA 5E26A 5AZJA 2GWJA 4BVPA 2QM1A 2FLOA 2A42A 2P9NB 3VOVA 1GLEG 1HLUA 1U2VB 3WQUA 4FWKA 1BA1A 3VF4A 1BA0A 5AQZA 4BR9A 2W41A 2AA4A 3CQYA 2QWOA 3D2EB 3FFKB 4B1WB 1NGJA 5AQXA 2GWKA 3QFUA 4H0YB 4KBOA 4HWIA 5AQUA 4H0VB 1OKJA 3VGKA 4XEIA 1D4XA 1Q18A 2YHYA 5KPZA 2D0OA 3DAWA 2P9SB 3HM8A 3FZFA 1XUPO 3VEZA 3CETA 2ZWHA 3QBWA 3GBTA 2E2NA 4DQ8A 3JXUA 4PL7A 1HJOA 1TUUA 4YDUA 3WT0A 1WUAA 1K8KB 2CGLA 4AM6A 1HKGA 3C7NB 3VGLA 1NGCA 1IG8A 2ZF5O 2P9IA 4I6MB 3LM9A 2A3ZA 4MLEA 3TPQA 4WQ5C 2FSJA 1RFQA 2H3GX 4K42A 1JCEA 4J8FA 5CE3A 2Q36A 2E2OA 4LC9B 2UYTA 5BREA 4FPBA 3SMPA 4CZFA 4BC5A 4H03B 3MN5A 4O5FA 3CI5A 4CBWA 1U6ZA 2D4WA 4O8KA 3WEEA 2GELA 2HF4A 2E1YA 3BEXA 3GDQA 2YI1A 3EZWA 1T6DA 2BTFA 4HTLA 3D2FB 2I7NA 3MK6A 5AZIB 3EN9A 2YJEA 3LDLA 4BRDA 4A61A
chains in the Genus database with same CATH superfamily
4E7HA 4CBUA 4E1MA 3TTDA 3WXIA 4X66K 4NXMK 2Q2RA 4OLBA 5FRMA 1NK6A 5E41A 1YJWN 4ILHA 1KLNA 4KHNA 3HM9A 2O8CB 3HRGA 1GLCG 2A5XA 3LP0A 5BRHA 3NHGA 4LF6K 4BQLA 4Z0UA 3F2KA 3UKRB 3ITHA 4DG1A 1CLQA 1GLLO 3OYDA 3A5MC 3E9OA 3FE1A 3R3LA 2UUBK 3O9RA 1X9JA 3KK1A 4Y0WA 4BC3A 1TYQA 4JD2B 3SAHA 1LWEA 1Q9YA 4PKHA 4W5TA 3L4IA 5JLFA 3SUQA 3OHRA 3NH0A 1N5YA 3VEOA 4BRHA 4HUGA 1NK5A 1T05A 5AQSA 3QIPA 3FZKA 2FSNA 3SUNA 3MEGA 1QQNA 4JKAA 3B8AX 4FK4A 3I8BA 5AZJB 4E3SA 4DWIA 3RTVA 1Z25A 4DLGA 4KTQA 3SBTA 4PKIA 4IEIA 3VQ9A 4BE0A 4E7KA 3LZIA 3C6AA 3ZYYX 3ZSRA 4N47A 4KTZA 2HNDA 3AV9A 2E2QA 3DWLA 1VSEA 3AVBA 3QDKA 2ZM6K 4FK0A 3IFRA 5GINA 1KAXA 3SAFA 4JS5A 1DT9A 5BPLA 5FPDA 4H4MA 4EHUA 1LAVA 3AO5A 3VENA 4FVMA 4YOYA 4C8MA 2HHTA 4FLZA 5HLFA 2UXBK 2HMPA 2P9PB 2AP1A 4CGHA 3NCIA 2QW9A 4KHSA 1VSDA 4E89A 4E1NA 4AF1A 1T44A 4E7IA 4DUZK 5F0XA 1YJ9N 5JICA 3HPOA 1RILA 3SI6A 1HRHA 3AO1A 1RDDA 2IAJA 1IKWA 3RR7A 4DV0K 5I9EB 4JI4K 3LPUA 4Q5VA 4K8XA 3AVHA 4JRPA 2NRXA 3QLHA 4DSFA 1IG9A 3IRXA 4FWLA 4HTUA 1KVCA 1FXXA 3L0QA 2ATQA 3VETA 3ZSXA 4C8LA 4MO5A 1I3AA 3D2FA 4YOWA 5KPTA 1V4SA 4KREA 4FSVA 1NGHA 2QWQA 4EFHA 3I33A 3ZSWA 2P51A 4A2BA 1TKZA 1EX4A 2F8SA 3NGIA 1TYQB 5KQDA 3K5OA 3ATUA 2QTDA 3P39A 4H5VA 3L2VA 2W42A 4B3MK 1QQCA 3U9ZA 1C1AA 4OPKA 1QZ5A 3QEVA 2P1JA 3KKRA 1GLAG 2IS3A 4CVNE 3SAGA 3AO4A 4X62K 4B1UB 5AQNA 2XHBA 1J54A 2NRWA 2IGIA 3CPWM 1RT6A 1NK0A 3QINA 2HHQA 1QS4A 1S5JA 2FBVA 4KHPK 3I55N 3EY1A 1JLAA 3TSQA 5AQFA 4DFJA 4GW6A 4FOIA 3UB5A 1ESVA 2NZTA 5EXWA 1T3VA 4FJJA 4FLVA 4DB3A 1FK9A 3L3UA 4I9LA 5C24A 5J2NA 4DU1A 3H3OB 5BR9A 2DPNA 5F2RA 4KH4A 2RF2A 3NF8A 4HHTA 4KV8A 4DQSA 2KHOA 5M1QA 4DQIA 2E2PA 2O8FA 1VQKN 2O8BA 1UA1A 3BP8A 5LJVA 5HRRA 4H5WA 3QBXA 2XY8A 1HUXA 3AGRA 1EP4A 3OBYA 1F21A 4O0JA 1NGIA 4B1YB 2G8UA 1LOTB 1Y97A 5EOYA 1NJIO 2PYJA 4H8KA 4DFPA 2VG6A 2P9SA 4DSIA 2IVPA 4M3XA 4B1ZA 4H5RA 3WEEB 1WAJA 1I94K 1VSLA 4A5BA 4BR0A 3NF7A 1K8KA 3CCEN 4CJUA 3HYFA 3OYLA 4BRKA 5B8HA 3PSFA 1SKRA 1WBBA 4Z4GA 5AQOA 1HNWK 4CZMA 3MWPA 1HPMA 4M3WA 1TV6A 4B08A 3KLFA 3P4IA 4FO0A 4CJ7A 3AVAA 5M1PA 1XC9A 4JKGA 2DFHA 4RW7A 3L2WA 1VSHA 4CHYA 5C25A 3JYTA 4CEEA 1U04A 3G25A 4BECA 1WSFA 3NMUA 3MAQA 1YVNA 3K5NA 3A2FA 5EVZA 3PUFA 3SYZA 5J2PA 4FJ7A 4E1JA 1T6CA 3ZCMA 5GIOA 3M3ZA 4W5NA 4JI7K 4DTNA 3ZT4A 2ASOA 4BC2A 3S9HA 1C0FA 2FXUA 1TGOA 3O4NA 4B9SA 3CHWA 4ISGA 4RTFD 4GY2B 1WB9A 1MDUB 3VEVA 4CF8A 2ITGA 1HQEA 3D7EO 4CK2A 5KPRA 3ATVA 1TK8A 1NGEA 4Z4FA 4MDBA 2DFFA 4DU4A 1EWRA 2QKKA 2OTJN 5E84A 4QS9A 3LZJA 4DTOA 2Z1HA 3LM2A 1RTJA 4NLBA 4DLEA 3U6FA 4GV3A 1VQMN 3TU5A 3IG1A 4CI6A 3O3HA 1TVRA 1X3NA 4JLHA 4EAHD 1XMQK 2IVNA 3L3VA 3S3NA 4AH9A 5E26A 3NH1A 4FM0A 3DOLA 4OX9K 2HNZA 1S1VA 3IKMA 4Z4IA 2XY6A 3QNOA 1ZBUA 4J2EA 3VOVA 1W97L 4B9LA 1HLUA 3WQUA 1HMVA 4FWKA 3G0ZA 2AA4A 3MEEA 5AQXA 5GAGP 4XIUA 2GWKA 1S9EA 4OJRA 5AQUA 1TAUA 1QVGM 2YHYA 2YNHA 1BL3A 1QSYA 3K9KA 4OGEA 3THXA 1BI4B 2P9SB 3CQ8A 3FZFA 4I2PA 1CXUA 2O8EA 3VEZA 3JXUA 1O13A 4DV6K 3WT0A 2CGLA 1K8KB 4AM6A 4E0DA 3K0SA 4OO1J 3VGLA 3O4QA 3NAEA 4YOVA 5HROA 2G8WA 3LM9A 3E01A 4ID5A 2OPQA 4KB0A 2H3GX 2O4GA 3DRPA 1JCEA 4J8FA 5I3UA 4JKEA 4KTWA 4FPBA 4CECA 3VA3A 5K14A 4O5FA 3ZSZA 4O8KA 4WE1A 5GAHP 2HF4A 3BEXA 4GMJB 1U45A 3KKSA 3WNGA 2VGNA 3TI0A 3EN9A 2F7TA 4B9NA 3N4PA 2YJEA 5CHIA 4BRDA 1KVBA 4CFBA 3ZETA 4CHOA 2WTUA 2B4JA 3GE1A 1Y64A 3AVNA 3MXIA 2VYPA 1YVUA 2IOCA 4DV4K 3RMDA 3ULEB 3G4SN 1QHTA 4DSEA 4WFBL 3VQ5A 4BRQA 4DUYK 3U4LA 3TTFA 1XHZA 3MX2A 1UAXA 3AA3A 3SQ2A 1LWCA 5CYMA 2O4IA 1YT3A 1RTDA 1XMOK 4CFAA 3J7AP 3VTHA 1BWFO 5AFUH 4BR2A 3A5OC 5KRSA 4DV3K 1S3XA 5F1XA 3AA2A 4H0TB 2QKBA 4IO8A 4ISFA 4B3RK 5HP1A 3CQXA 3HOTA 3RR8A 3BF1A 4CJVA 4XH4A 4CZJA 3OYNA 1OH6A 4CGFA 3F73A 1Z6RA 4CJEA 3OVNA 4U7BA 5EY4A 3CIPA 3RSEA 5A2QO 4KHQA 4CBXA 1NBWA 1JL2A 4O55A 3VQ4A 4A62A 4FCYA 2E6MA 3O8MA 4CIEA 4Z4EA 4IWVA 3KLHA 1MWMA 4JHDA 2GUPA 4JS4A 4G1QA 4JI2K 1NMDA 4I9QA 2CH5A 3ULDA 3HZ6A 2X78A 1QHAA 3J81O 3JS6A 4YOTA 2NRZA 2P9LA 4YFUA 1MWKA 2OZSA 2E8AA 3THXB 4CGJA 2OPRA 1JJ2M 4H5NA 1WSIA 4FJMA 2O8EB 5LL6Z 4C1NK 3DOKA 2OA8A 4JI5K 5FROA 4JEPA 5AQIA 4PL8A 1WSGA 4GV9A 2ASMA 4PA1A 2BGGA 4GNIA 3CJBA 2RHKA 4M63C 1QVFM 3AVLA 2IDOA 2GV9A 1GLFO 3NVKA 3NH2A 1S1UA 4CZHA 3I0RA 5AFUA 2Q0UA 1GLJO 1CZ9A 1SUQA 2QWNA 3HK2A 2YJFA 3AAQA 1WN7A 1YIJN 3P38A 5CZ2A 3SCXA 2E20A 3V1QA 3CJ9A 4CEAA 3OYCA 3AVCA 2OPPA 3LP1A 3P1GA 4CZIA 1VQ9N 1NG9A 3HJFA 3DM2A 3KTQA 2G8VA 1W7AA 1RT7A 4FZYA 3Q7BA 3O3FA 1HJRA 1NU0A 4FVUA 4MLHA 4BE2A 3FLCO 4LF9K 4PWDA 1RT4A 3MXJA 1VQON 1VQNN 5BN8A 1YTAA 1HNVA 5FPEA 1LW2A 4Z4CA 4GKJK 3M8PA 2A1SA 4CJRA 4FPAA 3P5JA 4MDAA 1RTIA 1KVAA 4GV6A 3ZT2A 1L3UA 1HYVA 3U3YA 3CC7N 3I8DA 1QSLA 4CJ3A 4L3QA 3QEPA 1NM1A 3FR0A 4YOUA 3K5MA 3MDQA 4GVEA 4FW2A 4ELTA 1GOBA 1TUYA 3DRSA 3H08A 5FPNA 3RSEB 3OYMA 4IJAA 3QETA 4CEBA 4AHSA 4DF8A 4PY5A 4BRAA 1RNHA 4O8UA 4G9ZA 3T69A 1QQMA 4CF0A 2W6LA 2QWPA 2NLXA 3ZX2A 3TSUA 1NJYA 1C1BA 2ZJQL 3M8SA 2Z1GA 4CESA 3V9UA 3C6TA 4FJNA 3D0PA 1TK0A 3LALA 3R6MA 1DGKN 1JLGA 4LFAK 3UKUA 2Q1NA 4WFNL 2P9LB 4B3SK 3U8XA 2I7PA 4AILC 3M6GA 4CZKA 2A6AA 4DS4A 1NKBA 1BGXT 1KD1O 1IKVA 1NGAA 1L5UA 1S6PA 5ADXH 3C6HA 1DKGD 1TKTA 2P9NA 3THVA 3SZ2A 1SZ2A 1Q9XA 4F3OA 3IAYA 1XI1A 5HRNA 3D2EA 4IG3A 3AAPA 1JKHA 1NGDA 3CFPA 4GKKK 5AQWA 3RMAA 3QEIA 4ILJA 3S5TA 1E4FT 5HOOA 4HCBA 3SLCA 4A2AA 4BRIA 3AO3A 4LY7A 1EXQA 3O3GA 4IXCA 2PY5A 3OS1A 1HKBA 1XC3A 2PFUA 1FW6A 2A41A 1NOYA 1C0UA 4RW6A 5BN9A 3ZSQA 4HUEA 1K8AO 1BCOA 2ZGZA 3FZHA 4I6MA 3F9KA 3DLKA 3EO3A 3ZT0A 1RGIA 2B5JA 3AA5X 3KJVA 2W6KA 5HBMA 4M7YA 4BREA 3CFRA 1VQ5N 3J7YP 3O6WA 3CFOA 4NO7A 1K6YA 1JLBA 2ZJPL 3B6PA 4CJKA 3I56N 1BG3A 1Z05A 4BRGA 3OTOK 2J4RA 1YXQA 3FZLA 3R8EA 3AVJA 4KKOA 1ZXOA 3C94A 5AZIA 4OLAA 1SL1A 2OZMA 2UXDK 3VQEA 3VTIA 4ELUA 3V1OA 4CEDA 4FWQA 1P8ZA 5FDLA 1GOAA 4AM7A 4YOXA 4JYAK 2VWKA 3PIOL 3A5LC 5GIPA 5AQKA 3IDHA 4BACA 1A5XA 4IBNA 1IKYA 4JK8A 4FJHA 3CD6N 5DK5A 3DXKA 1ZC6A 1HYSA 5GAEP 1WAFA 3KVGA 4NLCA 3IUCA 4OKEA 4Z4HA 1NGBA 5J2QA 1TKDA 1SAZA 3OJSA 3HVRA 4IDHA 5IT9O 5C0YA 3O5BA 4BR7A 4M3ZA 4RWTA 4KO0A 2WBNA 3DJCA 5MLCQ 1VQLN 2F8TA 4BE1A 4QS8A 2UUAK 3RMCA 3K59A 1RT2A 1CZAN 4M45A 3VGMA 4ELVA 4BRCA 4W5OA 1VRTA 3LDNA 4HCCA 5AQMA 3SQ4A 4CJPA 4EP5A 4AHVA 5HL7L 4FZZA 4CF1A 2HBKA 4CK1A 1U47A 2HSTA 3U3GA 3DLEA 4RW9A 1VSJA 2VWBA 1V4TA 4LF7K 1BIUA 3GL1A 3I0SA 4IO9L 3E66A 2GWJA 4BVPA 2QM1A 4X65K 2ZE2A 2FLOA 4DV5K 4AQYK 2UUCK 2P9NB 1I39A 2EX3A 1IBLK 4DTPA 1M90O 5AQZA 3J80O 2YKNA 1UA0A 3CQYA 3VQPA 1VQ6N 2Y1JA 3D2EB 3FFKB 4XJXA 3ISNC 4B1WB 4DTRA 2YHBA 4H0VB 1BQNA 3T19A 1EWQA 3LP3A 4DR6K 4W5QA 1L3VA 3SUOA 1UOCA 3QO9A 1SL0A 3NF6A 5KGXA 3CETA 1L3TA 3GBTA 4PL7A 1HJOA 4DV1K 1BHLA 4FM1A 1OH7A 1KSPA 1NGCA 2UXCK 3E9PA 2P9IA 4I6MB 1P90A 1IO2A 1X9SA 3VN5A 1Q81O 4MLEA 1YI2N 1RDUA 5H1SQ 2YX6A 1RFQA 2HMIA 3OYBA 3TAEA 2E2OA 2UYTA 3TSPA 4UY8O 1HQUA 4CZFA 3NVMA 3V9ZA 2AJQA 1LWFA 4KFBA 3S3OA 1U6ZA 4LSNA 2GELA 4O4GA 3HPGA 4ID1A 1BCMA 2YI1A 4RG8A 4HTLA 3D2FB 4AHUA 3SUPA 2I7NA 3MK6A 2F4VK 5AZIB 3EYZA 2HHVA 1NJXA 3MECA 4DMNA 1T7PA 5AQYA 3HP6A 5AR0A 2JLEA 5ELZA 2G8IA 1YAGA 4K41A 4PQUA 4IEEA 4B9QA 4ISEA 3WUHA 3EE9A 1NJWA 3DXKB 3SMSA 4CD1A 2GBZA 4OPHA 1RDBA 2LSNA 4LH5A 1SL2A 3LDOA 4KB1A 1H1VA 2RKIA 3LAKA 2HHXA 4FWPA 3CCQN 5AQGA 3TTCA 4DFMA 4YDUC 4FWRA 2G8FA 3B6OA 2HF3A 4DR3K 4FWMA 3NGYA 4JV5K 4B9MA 4H0OA 2O8DA 4CCHA 1X9WA 1FKOA 5EU7A 2HNYA 4DKWA 3AY9A 5KI6A 3VEXA 2G8HA 3BZKA 3MCAB 3KZBA 3EEQA 4EIAA 1B9FA 1S9GA 3HSCA 2C1GA 1BU6O 3CCVN 1RBVA 3V1RA 3EZ5A 4O5BA 1S1WA 3CCUN 4F2SA 2DTUA 2PZSA 3L2QA 2O8FB 2O8BB 1HNIA 3CJ7A 4KI4A 1C6VA 3LDSA 1MU2A 3QEXA 5TKWA 2IVOA 2NRVA 1LCUA 4MFBA 3H1QA 4WCEL 3VPZA 3SNNA 3UIQA 3ZSOA 3H6EA 1NJZA 4BROA 3KK3A 4DTSA 1ZBIA 1GLBG 3MN7A 1XNRK 5LY3A 3FGUA 2QI2A 1KAYA 2HOEA 3TANA 3ZX0A 3SPYA 4IOXA 2P9IB 1X3MA 1HR0K 4CW7B 5J2MA 1OVQA 3VQCA 4CJ5A 4FJLA 3KWIA 3NBPA 5LJWA 3D6RA 4WQ4C 3EE8A 5AQTA 1NMNA 3BY5A 4C8KA 3SV4A 2V51B 2HVHA 3ZSVA 3T1AA 3BGRA 4A5AA 4BDPA 1RT1A 4FJKA 4JKGB 4JK7A 4H0PA 4IFYA 5C42A 2HBLA 3QIOA 3HL8A 4FJ9A 3DMJA 1GLDG 4NB4A 4ZTFA 4R5PA 2NRHA 1KCFA 3VQ7A 2QWMA 2EWSA 5JLHA 4B8AB 3T7ZA 3C6UA 1SKWA 3QNNA 3AVFA 1NK9A 5BRFA 4FLWA 3NE6A 2CGJA 2FBYA 4WYBA 4JKFA 1QZ6A 1RBTA 4JKHA 2VWJA 1C0MA 2D0PA 3E1YA 3EL2A 4XH1A 4CJQA 4IFEA 4FJ5A 3CCMN 4DV2K 2V52B 2ZJRL 3SV3A 4M3TA 4KRFA 2OANA 1JLEA 1WOQA 4FW1A 2WOMA 3C0BA 5LMNK 2EHGA 3O9QA 3WXKA 3DLLL 2E88A 3VEYA 4E19A 3G6EN 1W0HA 4CHQA 1Q82O 2IIRA 3R1XA 5AQRA 1FJGK 5T7BA 3ZX3A 4BRFA 2QWLA 3PX6A 5CR4A 2NNWA 2FBTA 3UKRA 3MMVA 2QXFA 3CERA 1IV0A 3DLGA 1JCGA 1XHXA 3HT3A 4LSLA 4CF2A 4M42A 3VESA 1IJJA 4PUOA 4DR5K 3SQ0A 4JI3K 1NKCA 4JD2A 2VCPA 4BRNA 4WQ5A 1KAZA 4CD3A 4R79A 1HKCA 2Q3SA 5M1OA 3MN6A 4IJNA 5FPMA 1J5EK 3PY8A 2R7YA 2HBJA 3W3DA 3BDPA 4DSJA 2KZMA 5C12A 1YUWA 4BDYA 1ZBLA 1DTQA 1S6QA 2KFZA 2PBDA 2FF3B 3O1WA 3OBWA 4BQZA 4UQGA 3OYAA 2KFNA 1DEJA 4I7FA 4KI6A 5I42A 5SWMA 5M1NA 4FYDA 4LF8K 3V6DA 1JXEA 4FWSA 4CEOA 2XO7A 1C0TA 3LL3A 2KQ2A 1N33K 3P31A 1R0AA 1EETA 4HVJA 4KHUA 1VRUA 3G71N 4H4OA 2E5LK 3T3FA 4BY9C 4DFKA 4JI6K 2BUPA 3WXLA 3AO2A 3TR8A 2VG7A 1N8RO 4F3TA 4K43A 4FL9A 1HNZK 1KFDA 3ID8A 5SZTA 4K8ZA 4CJWA 3QEWA 3VEWA 2I5JA 1SQKA 4DTXA 4K0KK 3DLBA 5BPMA 4FOEA 3C7NA 1NK8A 2HHSA 4BRMA 3A5NC 3OYEA 3CXCM 4N56A 4N5SA 2Q97A 3ZETB 3IMXA 1NNEA 2P9PA 2F9TA 4LFBK 4LH4A 4RW8A 3JAMO 5IWAK 3VQ8A 1VQPN 3FFIA 1ATNA 3HBTA 3ZT3A 3VF2A 4CFDA 4DSLA 4BGBA 4CJLA 2VQFK 1BDGA 1Q8IA 2VGMA 4C23A 4BEBA 1SKSA 4BWMA 3O4WA 1X9MA 5TKYA 2QA4N 1DTTA 5JVHL 4CJTA 5BR8K 3RWUA 3VQQA 3KHYA 1NOZA 5JENA 3VMFB 4BRPA 4LF5K 4X64K 3H45C 1S1XA 1U48A 1JLFA 2JWLA 1J5OA 2YNIA 3KD5E 3HTVA 4ZHRA 5KQ8A 2YCHA 4JKCA 2ITMA 3TARA 3GOIA 4CF9A 1TKXA 4CHPA 4QOZB 1K9MO 3JSMA 3CM6A 3H1VX 4JK9A 4B3OA 4MQ3A 4KHWA 4DR2K 3WXJA 2NRTA 3CG7A 2WC9A 4DV7K 3MX5A 1BOTO 1NK4A 2A1RA 5KRTA 1EO1A 1LAWA 1HPZA 4M41A 4CGIA 1UWBA 1QTMA 1VSKA 1U4BA 1ILYA 4WF9L 3K5LA 4JHDB 3MWTA 1LV5A 2E4LA 3KK7A 2Y1IA 3CJ1A 3GG4A 2YV0X 5FLXO 3HI0A 2PYLA 2FBXA 1IKXA 3OJUA 5JVGL 4F8RA 1U49A 4KHYA 4DS5A 1ZYQA 1YHQN 1O1WA 2D5RA 3CC4N 1SS6A 1VQ4N 2A42A 4JRQA 4OPAA 3CYMA 1C1CA 1GLEG 3TAQA 4JI0K 1BA1A 2P5OA 3OW2M 5D3GA 4BR9A 2W41A 2QWOA 1BIZA 3PO4A 4YHHK 4EP4A 2WFBA 4DR1K 3M5RA 1RBSA 3QFUA 1YTUA 3AVGA 4KBOA 4AHRA 3CYGA 4CHNA 2E6LA 4XEIA 1D4XA 4B9VA 1XUPO 3V9WA 4M3YA 4BE7B 2ZWHA 2E2NA 1WNSA 1ASVA 4CERA 1KFSA 4YDUA 1WUAA 5AJ3K 3C7NB 4DU3A 4ILGB 3THYA 4Y1DA 3L4QA 1QSSA 1CZBA 1N6QA 4BDZA 2A3ZA 3TPQA 5CY4A 4WQ5C 2DFEA 4NYFA 3T1YK 2RE2A 3CCLN 2NRRA 5LMUK 1VAZA 1A5VA 2X6SA 4I2QA 3SMPA 5JS2A 4BC5A 4H03B 3MN5A 2G8KA 4CJFA 4CBWA 2ETJA 3WEEA 2E1YA 3GDQA 3TABA 3EZWA 1T6DA 4NCBA 1G15A 1D5AA 3KLEA 2VG5A 2HB5A 3DRRA 3LDLA 3PLAA 3N4QA 1K73O 1VHXA 1BO5O 5AQPA 2P5GA 3E9LA 2UU9K 2IC3A 1S1TA 2ZGYA 2HHIA 1OVYA 3UE5A 5ADXA 1WSJA 4CGGA 4LFCK 3AVIA 4FJXA 4BWJA 1XQSC 4HUFA 1BUPA 3FZMA 3PX0A 5C2FA 4RW4A 2YKMA 4FLXA 3KD1E 1TL3A 3OY9A 3OS2A 3PSIA 1JLQA 3DXMA 1B92A 2V7ZA 3MN9A 2A40A 3MEDA 5J1EA 3KWGA 5DM6L 2V7YA 3SBGA 3OYKA 4FZXC 4WQ4A 4IZ9A 4DR4K 3W0LA 1OH8A 3A8YA 2HHUA 4CK3A 3L6QA 3QICA 1J6ZA 3UKUB 4U67L 3MCPA 4ZTJA 3J7ZO 1SV5A 3V4IA 4JI1K 4OVLA 3S3MA 1VSMA 3CF5L 1EQYA 1REVA 4JN4A 3WNFA 2KW4A 3IS9A 4Z94A 5C10A 4FLUA 3P83D 5DMRA 3WXMB 3J8AA 2D0CA 1KQSM 4OKKA 1L3SA 1W9HA 3CCJN 3K57A 1LW0A 2HHWA 4F9OA 4XH5A 4CGDA 4JAXA 4Q0BA 1MA9B 4QCLA 1D9DA 3WQTA 3V9SA 3ZLJA 5CYQA 1E4GT 1QE1A 3AVKA 4PKGA 5BPNA 2JWKA 2QWRA 3NGZA 4QAGA 1HNXK 3C95A 2Q31A 4BG9A 2YHXA 3KIOA 3L2UA 4EHTA 4QS7A 3THYB 3LDPA 5AQJA 4FK2A 4J2AA 3G10A 3THWA 1S22A 4C1NI 1T8EA 1NWKA 4CEQA 1TL1A 1NGFA 2D1KA 3WNEA 2P9KA 3VF6A 1KRPA 4CEZA 1BI4A 1BQMA 1JCFA 2GTDA 2OTLN 4NYNA 4FJGA 5AQQA 1E3MA 1RBUA 3K9JA 2OYQA 3CJAA 4MO4A 4BGAA 4A59A 4F2RA 2F96A 1NGGA 1ATSA 3R9PA 3PV8A 4A57A 1X1PA 4V19S 3ASMA 1NLVA 3VQDA 5GADP 4PHTX 4CZEA 1RDWX 2DY4A 4CIFA 4IDKA 1HYZA 3SJHA 4H5TA 4IG0A 2YNFA 2BH1A 5AQHA 1QQOA 2Z1IA 3TAMA 1VSIA 3O9UA 4FJIA 3OA9A 4L8RB 2W40A 4H0XB 4N41A 4E72A 3SQ1A 2YNGA 1WSEA 1ASUA 2P9UA 2QXLA 1TAQA 4JKDA 3CCSN 2GUIA 4B1VA 4KAZA 3DLRA 3O9TA 3OYIA 3DXMB 3H46O 3ULEA 3L2RA 1TK5A 3C65A 4O44A 1KLMA 5FRNA 5BRDA 4EZ9A 2KZZA 3SK3A 1N34K 3HSTB 3QB0A 3DYAA 4E7JA 1BISA 4CFCA 1DLOA 3ZEUA 3TAFA 4N76A 5AQVA 3EKUA 3K2PA 1YITN 2BE2A 4DCHA 2FSKA 4O0IA 2Z1JA 1ASWA 1B9DA 1RDCA 1WLJA 4RCHA 3NDKA 1JXBA 2ASPA 4DTJA 4JI8K 1T03A 2C1IA 1KC8O 2XRIA 1HX1A 2NUBA 4NXNK 4BRLA 2F9WA 4C8OA 3CM5A 1Q7YO 4CZGA 1XNQK 4BC4A 3CJCA 4F4KA 4YORA 3KLGA 2FF6A 2WUSA 3SPZA 1N36K 4FXDA 4W5RA 3CPEA 3BF3A 3V9XA 2X74A 3F9MA 4CIGA 1VK0A 2QK9A 4FWNA 4OPJA 1ATRA 3BZCA 3S41A 2ZD1A 1IH7A 3MXMA 5AQLA 1J53A 1D9FA 4OGCA 3VERA 3VQAA 1JL1A 1G99A 1D8YA 3LDQA 4C8NA 3DLHA 3PO5A 2KTQA 3CMAN 3O1BA 4BR4A 1U2VA 4CZLA 1RTHA 4KPYA 5DM7L 1KTQA 2GEMA 3THWB 2HVIA 2XY5A 1OH5A 4AHCA 2PAVA 3O80A 4AHTA 5JS1A 3AA4A 3M1FA 3TWHA 4J2BA 3HVTA 4DQPA 2B6AA 1RBRA 3NF9A 2YHAA 1W2BM 1IBKK 4GVMA 2P9KB 4FLYA 2E1ZA 2RPIA 3O9SA 2Q0RA 2BANA 2QEXN 3H3NO 1GOCA 4B9TA 4B1XB 5KTQA 1RT5A 5JMVA 3ENHA 1VSFA 1ZBFA 3CCRN 4M3RA 3SJJA 5C2DA 3Q7CA 4LD0A 5M1FA 1WBDA 4B3TK 4JNEA 4BVOA 1RT3A 3PIPL 3QFPA 4BG8A 2KLAA 4FJ8A 3U9DA 4M3UA 3A0IX 4KH6A 3LP2A 3ID6A 4CHZA 2OCEA 4JKBA 1KXPA 1VQ7N 3HXMA 3AARA 2P9UB 3AGKA 3ALYA 5HRPA 2GX9A 3BUZB 4WFAL 3T1HK 4NCGA 4FLTA 3KLIA 1RDAA 3LANA 3L8BA 3VQ6A 1RCHA 4CJ4A 2FC0A 4BR5A 2O8DB 4IFVA 4M7XA 3QERA 1CXQA 2RN2A 4YNQA 4EZ6A 3ZSYA 1M1KO 3O08A 2O8CA 1FKPA 4J2DA 3EKSA 2ZQBA 2XY7A 3ZEUB 4IOCL 3HP9A 4YY3K 4IOAL 5M1KA 4Y1CA 1EKEA 4KH5A 4FWOA 4FM2A 4DR7K 3OYHA 5C15A 3K58A 4DSKA 1C0GA 2CH6A 4DTMA 3LAMA 3V81A 3ZT1A 2YHWA 5EX5A 3M8RA 3QMLA 2CGKA 3D45A 3VQBA 4K25A 3ENOA 2HBMA 3NFAA 1JLCA 1ZBSA 4CJSA 4NCAA 4DTUA 2OPSA 3RRGA 4IKFA 1R59O 4DHYA 5CZ1A 4DQRA 5AZJA 3CMEN 3OYGA 2X6NA 2D0AA 3RVCA 4B9UA 1U2VB 4DF4A 4ICLA 1YJNN 3F5TA 1BA0A 4TSXA 3VF4A 1IBMK 4CE9A 1N32K 1NGJA 3LWLA 2BDPA 1WSHA 1XWLA 4H0YB 4CEFA 4HWIA 2KKZA 1OKJA 3OYFA 3VGKA 1NK7A 1Q18A 1ITGA 3ENBA 5KPZA 3HOSA 2D0OA 3DAWA 3HM8A 4E7LA 4OKJA 2WONA 3QBWA 4DQ8A 5KGWA 1S72N 3CC2N 1TUUA 3M8QA 2VQEK 1HKGA 1A5WA 1VQ8N 1IG8A 2ZF5O 4B8CA 3QESA 1NKEA 3WNHA 3HPHA 2FSJA 2JGUA 3HO1A 3LWMA 3PX4A 4K42A 3OYJA 5CE3A 2W00A 2Q36A 4DQQA 4LC9B 5BREA 3RRHA 4LF4K 3LPTA 3KK2A 1Q86O 1ZBHA 3AVMA 1J9AA 3CI5A 3RMBA 2HHHK 2D4WA 3DI6A 3VA0A 3TAPA 2D0BA 2BTFA 3TAGA 1Z26A 1YF5L 3OS0A 5HRSA 2HW3A 4A61A
chains in the Genus database with same CATH topology
3ZETA 1BO5O 5AQPA 5AQYA 5AR0A 4CBUA 3GE1A 1Y64A 5ELZA 2VYPA 1YAGA 3ULEB 4K41A 3TTDA 3E9LA 3WXIA 4IEEA 3G4SN 4B9QA 2Q2RA 2ZGYA 4ISEA 3WUHA 1OVYA 3EE9A 3UE5A 4WFBL 5ADXA 1YJWN 4ILHA 3DXKB 3SMSA 4BRQA 4CD1A 3HRGA 3U4LA 1GLCG 2A5XA 3TTFA 5BRHA 4OPHA 1XQSC 3MX2A 4BQLA 3LDOA 1H1VA 1BUPA 3F2KA 3FZMA 3UKRB 5C2FA 4FWPA 3VTHA 1GLLO 3CCQN 5AQGA 3A5MC 3TTCA 4YDUC 1BWFO 3E9OA 3FE1A 3R3LA 4FWRA 5AFUH 4BR2A 3O9RA 2HF3A 3DXMA 1X9JA 2V7ZA 3A5OC 3MN9A 1S3XA 4Y0WA 2A40A 4FWMA 5F1XA 4BC3A 1TYQA 4H0OA 4JD2B 3KWGA 3SAHA 4H0TB 5DM6L 4IO8A 4ISFA 2V7YA 4PKHA 3L4IA 3SBGA 4WQ4A 4IZ9A 4DKWA 3AY9A 3CQXA 3HOTA 3BF1A 3W0LA 3VEXA 5JLFA 3MCAB 3OHRA 3KZBA 3A8YA 4EIAA 3VEOA 4BRHA 3L6QA 3HSCA 2C1GA 5AQSA 4XH4A 3QICA 1BU6O 4CZJA 3FZKA 1J6ZA 2FSNA 3UKUB 4U67L 1Z6RA 3MCPA 3J7ZO 1QQNA 4U7BA 4JKAA 5EY4A 3CIPA 3RSEA 3B8AX 3I8BA 3CCVN 4CBXA 1NBWA 5AZJB 3CF5L 1EQYA 4A62A 4JN4A 3O8MA 4IWVA 3CCUN 4Z94A 5C10A 5LY3A 1MWMA 3CJ7A 4JHDA 3SBTA 2GUPA 4PKIA 4IEIA 3WXMB 3J8AA 1KQSM 1NMDA 2CH5A 3CCJN 5TKWA 3HZ6A 2IVOA 1QHAA 3C6AA 2NRVA 3JS6A 4YOTA 2NRZA 3ZYYX 2P9LA 1LCUA 4F9OA 4XH5A 3H1QA 4WCEL 3VPZA 1MWKA 4JAXA 2E8AA 2E2QA 1MA9B 3DWLA 3H6EA 3WQTA 4BROA 1JJ2M 4H5NA 1E4GT 5BPNA 4PKGA 4C1NK 2JWKA 2QWRA 3QDKA 1GLBG 3IFRA 3MN7A 4JEPA 2Q31A 5AQIA 3FGUA 2QI2A 1KAXA 1KAYA 2YHXA 4PL8A 1DT9A 2HOEA 4BG9A 5BPLA 2ASMA 3SAFA 4GV9A 4EHTA 4QS7A 3ZX0A 3LDPA 4GNIA 5AQJA 4IOXA 2P9IB 3CJBA 4EHUA 1X3MA 3VENA 5FPDA 2RHKA 4M63C 4YOYA 1QVFM 1S22A 4C1NI 1GLFO 3NVKA 3KWIA 1NWKA 5LJWA 3D6RA 4CZHA 4WQ4C 5AFUA 1NGFA 2Q0UA 3EE8A 1GLJO 2HMPA 2D1KA 2P9PB 5AQTA 2AP1A 2P9KA 2QWNA 3VF6A 2YJFA 2V51B 3AAQA 2QW9A 1JCFA 2GTDA 3P38A 1YIJN 4AF1A 2OTLN 1T44A 4A5AA 2E20A 5F0XA 5AQQA 3K9JA 3CJAA 3CJ9A 5JICA 4JKGB 1YJ9N 4JK7A 4H0PA 4MO4A 2HBLA 4BGAA 4A59A 1NGGA 1ATSA 1GLDG 4NB4A 3R9PA 4CZIA 2NRHA 1VQ9N 4A57A 2QWMA 2EWSA 5I9EB 5JLHA 1NLVA 5GADP 4PHTX 3T7ZA 4CZEA 1RDWX 2NRXA 3SJHA 5BRFA 4H5TA 2CGJA 3Q7BA 4WYBA 2BH1A 4FWLA 1QZ6A 3L0QA 4JKFA 5AQHA 1QQOA 4JKHA 3VETA 2D0PA 4XH1A 3E1YA 3EL2A 4MLHA 3O9UA 4FVUA 3OA9A 2W40A 3FLCO 4H0XB 4IFEA 3CCMN 4MO5A 2V52B 3D2FA 4YOWA 1VQON 1VQNN 5BN8A 2P9UA 2QXLA 2ZJRL 5KPTA 1V4SA 5FPEA 4JKDA 2OANA 4FSVA 1NGHA 1WOQA 2QWQA 4EFHA 3CCSN 4B1VA 3C0BA 3I33A 4A2BA 3O9TA 4FPAA 3DXMB 3O9QA 4MDAA 3H46O 3WXKA 3DLLL 1TYQB 3ULEA 4GV6A 5KQDA 2E88A 3C65A 3VEYA 3CC7N 3G6EN 5BRDA 3ATUA 2QTDA 3P39A 4H5VA 1Q82O 2IIRA 3R1XA 5AQRA 3SK3A 4L3QA 3ZX3A 4BRFA 2QWLA 3QB0A 5CR4A 1NM1A 3FR0A 4YOUA 3U9ZA 2NNWA 3ZEUA 3MDQA 4GVEA 5AQVA 3EKUA 1QZ5A 1TUYA 3CERA 3MMVA 3UKRA 4DCHA 1YITN 2FSKA 1JCGA 5FPNA 1GLAG 3RSEB 3SAGA 4IJAA 3VESA 1IJJA 4RCHA 2ASPA 4B1UB 5AQNA 4BRAA 2C1IA 1KC8O 2NRWA 3CPWM 4O8UA 1HX1A 3T69A 4G9ZA 4JD2A 2VCPA 4BRNA 4BRLA 2F9WA 1QQMA 4WQ5A 1KAZA 2QWPA 1Q7YO 2NLXA 3ZX2A 4CZGA 3TSUA 4BC4A 4CD3A 3I55N 3CJCA 2ZJQL 4YORA 5AQFA 3TSQA 2FF6A 2WUSA 4FOIA 4R79A 1HKCA 5GINA 5M1OA 3CPEA 3UB5A 3MN6A 1ESVA 2NZTA 3BF3A 4IJNA 1T3VA 5EXWA 5FPMA 2HBJA 3R6MA 3W3DA 3F9MA 4DB3A 1DGKN 5C12A 1YUWA 3UKUA 2Q1NA 4WFNL 2P9LB 4FWNA 3H3OB 5BR9A 3U8XA 2I7PA 1ATRA 2PBDA 2DPNA 2FF3B 3M6GA 3O1WA 3OBWA 5F2RA 3S41A 4BQZA 2A6AA 4KH4A 4CZKA 1DEJA 5AQLA 1KD1O 2KHOA 3VERA 5M1QA 5M1NA 1G99A 2E2PA 1NGAA 4FWSA 3LDQA 3CMAN 5ADXH 3C6HA 3LL3A 3O1BA 1DKGD 2P9NA 1VQKN 3P31A 4BR4A 1U2VA 4CZLA 5DM7L 1SZ2A 3BP8A 5LJVA 2GEMA 4H5WA 3G71N 3D2EA 2PAVA 3QBXA 3O80A 3AAPA 1HUXA 1NGDA 3AGRA 3M1FA 3OBYA 4BY9C 1W2BM 5AQWA 1NGIA 4B1YB 1LOTB 2BUPA 3WXLA 2P9KB 2E1ZA 3O9SA 4ILJA 2Q0RA 5EOYA 1NJIO 1N8RO 1E4FT 5HOOA 4K43A 4FL9A 3SLCA 2P9SA 4A2AA 4BRIA 2QEXN 3ID8A 3H3NO 2IVPA 4B1ZA 4H5RA 4B1XB 4IXCA 3WEEB 1HKBA 1XC3A 2PFUA 3ENHA 2A41A 3VEWA 5JMVA 1SQKA 4A5BA 4BR0A 3CCRN 5BPMA 1K8KA 3CCEN 4FOEA 3C7NA 5BN9A 1K8AO 4BRMA 2ZGZA 4BRKA 3A5NC 3FZHA 4I6MA 5B8HA 3Q7CA 5C2DA 3CXCM 3EO3A 5M1FA 4JNEA 1RGIA 2Q97A 5AQOA 3ZETB 3IMXA 4BVOA 2P9PA 2F9TA 3PIPL 3QFPA 4BG8A 2KLAA 4CZMA 3MWPA 3U9DA 4M7YA 4BREA 1HPMA 1VQ5N 3P4IA 4FO0A 3O6WA 4CJ7A 3A0IX 4NO7A 5M1PA 4KH6A 1VQPN 3ID6A 4JKGA 1ATNA 3HBTA 4JKBA 3VF2A 2ZJPL 1KXPA 3I56N 1VQ7N 1BG3A 1Z05A 4BRGA 3AARA 2P9UB 3AGKA 2J4RA 1YXQA 3FZLA 3R8EA 4BGBA 2GX9A 1BDGA 1ZXOA 2VGMA 3BUZB 4C23A 4WFAL 5AZIA 4BEBA 3O4WA 3VTIA 5TKYA 2QA4N 4FWQA 4BECA 3G25A 1P8ZA 5JVHL 3NMUA 3KHYA 4AM7A 4YOXA 1K73O 1YVNA 3VMFB 4BRPA 3PIOL 3A5LC 5EVZA 4BR5A 3H45C 5GIPA 5AQKA 4M7XA 3IDHA 4E1JA 1T6CA 2JWLA 5GIOA 4JK8A 3M3ZA 3HTVA 1M1KO 3O08A 3CD6N 3DXKA 2ASOA 5KQ8A 1ZC6A 3EKSA 5GAEP 4BC2A 2YCHA 3ZEUB 4JKCA 3KVGA 2ITMA 3GOIA 4NLCA 1C0FA 4IOCL 2FXUA 3IUCA 1K9MO 4IOAL 1NGBA 5M1KA 3H1VX 4JK9A 1SAZA 4KH5A 3CHWA 4ISGA 4FWOA 4GY2B 4RTFD 4IDHA 3WXJA 5C0YA 1MDUB 2NRTA 3VEVA 5C15A 2WC9A 3O5BA 4BR7A 3D7EO 3MX5A 4RWTA 5MLCQ 2WBNA 3DJCA 5KPRA 1VQLN 1BOTO 3ATVA 4QS8A 1EO1A 1C0GA 1NGEA 2CH6A 2YHWA 4MDBA 5EX5A 3QMLA 1CZAN 2CGKA 3VGMA 4BRCA 4K25A 3ENOA 1ILYA 2HBMA 4WF9L 3LDNA 4JHDB 1ZBSA 5AQMA 5E84A 2OTJN 3MWTA 4QS9A 5HL7L 2HBKA 3LM2A 2HSTA 4NLBA 3KK7A 4GV3A 3CJ1A 1VQMN 3GG4A 3TU5A 4CI6A 1R59O 2VWBA 3HI0A 1X3NA 1V4TA 4EAHD 2IVNA 3GL1A 4DHYA 5E26A 5JVGL 4IO9L 3E66A 5AZJA 3CMEN 2GWJA 4BVPA 1YHQN 2QM1A 3IKMA 3CC4N 3RVCA 1SS6A 1VQ4N 2FLOA 2A42A 1W97L 2P9NB 4OPAA 3VOVA 1GLEG 1HLUA 1U2VB 3WQUA 1M90O 4FWKA 1BA1A 3F5TA 1BA0A 5AQZA 3VF4A 3OW2M 1YJNN 4BR9A 2W41A 2AA4A 3CQYA 1VQ6N 2QWOA 3D2EB 3FFKB 4XJXA 4B1WB 1NGJA 2WFBA 5AQXA 5GAGP 3M5RA 2GWKA 3QFUA 4H0YB 4KBOA 4HWIA 5AQUA 4H0VB 2KKZA 1OKJA 3VGKA 1QVGM 4XEIA 1D4XA 1Q18A 2YHYA 3ENBA 3K9KA 5KPZA 3HOSA 2D0OA 3DAWA 2P9SB 3HM8A 3FZFA 1XUPO 3VEZA 4BE7B 3CETA 2ZWHA 3QBWA 3GBTA 2E2NA 4DQ8A 3JXUA 1S72N 1O13A 4PL7A 3CC2N 1HJOA 1TUUA 4YDUA 3WT0A 1WUAA 1K8KB 2CGLA 4AM6A 1HKGA 3C7NB 4OO1J 4ILGB 3VGLA 1NGCA 1VQ8N 1IG8A 2ZF5O 3E9PA 2P9IA 3L4QA 4I6MB 1P90A 4YOVA 3LM9A 1Q81O 2A3ZA 4MLEA 3TPQA 4WQ5C 1YI2N 2FSJA 1RDUA 5H1SQ 2RE2A 2YX6A 1RFQA 2H3GX 3CCLN 4K42A 1JCEA 4J8FA 5CE3A 4JKEA 2W00A 2NRRA 2Q36A 2E2OA 4LC9B 1VAZA 2UYTA 3TSPA 5BREA 4UY8O 4FPBA 3SMPA 1Q86O 4CZFA 4BC5A 4H03B 3MN5A 3NVMA 4O5FA 3CI5A 4CBWA 1U6ZA 2D4WA 4O8KA 3WEEA 2GELA 2HF4A 2E1YA 3BEXA 3GDQA 5GAHP 2YI1A 3EZWA 2VGNA 1T6DA 2BTFA 4HTLA 3D2FB 2I7NA 3MK6A 5AZIB 3EN9A 2F7TA 3N4PA 2YJEA 5CHIA 1YF5L 3LDLA 4BRDA 3PLAA 3N4QA 4A61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZET A;  1BO5 O;  5AQP A;  5AQY A;  5AR0 A;  4CBU A;  3GE1 A;  1Y64 A;  5ELZ A;  2VYP A;  1YAG A;  3ULE B;  4K41 A;  3WXI A;  4B9Q A;  2Q2R A;  2ZGY A;  4ISE A;  3WUH A;  3UE5 A;  5ADX A;  3DXK B;  3SMS A;  4BRQ A;  4CD1 A;  3U4L A;  1GLC G;  2A5X A;  5BRH A;  1XQS C;  4BQL A;  3LDO A;  1H1V A;  1BUP A;  3FZM A;  3UKR B;  4FWP A;  1GLL O;  5AQG A;  3A5M C;  4YDU C;  1BWF O;  3FE1 A;  4FWR A;  5AFU H;  4BR2 A;  2HF3 A;  3DXM A;  1X9J A;  2V7Z A;  3A5O C;  3MN9 A;  1S3X A;  4Y0W A;  2A40 A;  4FWM A;  5F1X A;  4BC3 A;  1TYQ A;  4H0O A;  4JD2 B;  4H0T B;  4IO8 A;  4ISF A;  2V7Y A;  4PKH A;  3L4I A;  4WQ4 A;  4IZ9 A;  3AY9 A;  3CQX A;  3BF1 A;  3W0L A;  3VEX A;  5JLF A;  3OHR A;  3KZB A;  3A8Y A;  4EIA A;  3VEO A;  4BRH A;  3L6Q A;  3HSC A;  5AQS A;  4XH4 A;  3QIC A;  1BU6 O;  4CZJ A;  3FZK A;  1J6Z A;  2FSN A;  3UKU B;  1Z6R A;  3MCP A;  1QQN A;  5EY4 A;  3CIP A;  3RSE A;  3B8A X;  3I8B A;  4CBX A;  1NBW A;  5AZJ B;  1EQY A;  4A62 A;  4JN4 A;  3O8M A;  4IWV A;  4Z94 A;  5LY3 A;  1MWM A;  3CJ7 A;  4JHD A;  2GUP A;  4PKI A;  3J8A A;  1NMD A;  2CH5 A;  3HZ6 A;  2IVO A;  1QHA A;  3JS6 A;  2P9L A;  1LCU A;  4F9O A;  4XH5 A;  3H1Q A;  3VPZ A;  1MWK A;  4JAX A;  2E8A A;  2E2Q A;  1MA9 B;  3DWL A;  3H6E A;  3WQT A;  4BRO A;  4H5N A;  1E4G T;  5BPN A;  4PKG A;  3QDK A;  2QWR A;  1GLB G;  3IFR A;  3MN7 A;  2Q31 A;  5AQI A;  3FGU A;  4PL8 A;  1KAX A;  1KAY A;  2YHX A;  4BG9 A;  2HOE A;  5BPL A;  2ASM A;  4EHT A;  4QS7 A;  3ZX0 A;  3LDP A;  4GNI A;  5AQJ A;  4EHU A;  2P9I B;  3CJB A;  5FPD A;  1X3M A;  3VEN A;  4M63 C;  1S22 A;  1GLF O;  1NWK A;  5LJW A;  4CZH A;  4WQ4 C;  5AFU A;  1NGF A;  2Q0U A;  1GLJ O;  2HMP A;  2D1K A;  2P9P B;  5AQT A;  2AP1 A;  2P9K A;  2QWN A;  3VF6 A;  2YJF A;  2V51 B;  3AAQ A;  2QW9 A;  1JCF A;  2GTD A;  1T44 A;  2E20 A;  5F0X A;  5AQQ A;  3CJA A;  3CJ9 A;  5JIC A;  4H0P A;  4MO4 A;  4BGA A;  1NGG A;  1ATS A;  1GLD G;  4NB4 A;  3R9P A;  4CZI A;  2NRH A;  2QWM A;  2EWS A;  5I9E B;  5JLH A;  1NLV A;  4CZE A;  1RDW X;  3SJH A;  5BRF A;  4H5T A;  2CGJ A;  4WYB A;  4FWL A;  1QZ6 A;  3L0Q A;  5AQH A;  1QQO A;  3VET A;  2D0P A;  4XH1 A;  4MLH A;  3EL2 A;  2W40 A;  3FLC O;  4H0X B;  4MO5 A;  2V52 B;  3D2F A;  5BN8 A;  2P9U A;  2QXL A;  5KPT A;  1V4S A;  5FPE A;  2OAN A;  4FSV A;  1NGH A;  1WOQ A;  2QWQ A;  4EFH A;  4B1V A;  3C0B A;  3I33 A;  4A2B A;  4FPA A;  3DXM B;  3WXK A;  3H46 O;  1TYQ B;  3ULE A;  5KQD A;  2E88 A;  3VEY A;  5BRD A;  3ATU A;  4H5V A;  2IIR A;  5AQR A;  3SK3 A;  4L3Q A;  3ZX3 A;  4BRF A;  2QWL A;  3QB0 A;  1NM1 A;  3FR0 A;  3U9Z A;  3ZEU A;  3MDQ A;  5AQV A;  3EKU A;  1QZ5 A;  1TUY A;  3CER A;  3MMV A;  3UKR A;  4DCH A;  2FSK A;  1JCG A;  5FPN A;  1GLA G;  3RSE B;  4IJA A;  3VES A;  1IJJ A;  4RCH A;  2ASP A;  4B1U B;  5AQN A;  4BRA A;  1HX1 A;  4JD2 A;  2VCP A;  4BRN A;  4BRL A;  2F9W A;  1QQM A;  4WQ5 A;  1KAZ A;  2QWP A;  2NLX A;  3ZX2 A;  4CZG A;  4BC4 A;  4CD3 A;  3CJC A;  5AQF A;  2FF6 A;  2WUS A;  4FOI A;  1HKC A;  3UB5 A;  3MN6 A;  1ESV A;  2NZT A;  3BF3 A;  4IJN A;  5EXW A;  5FPM A;  3R6M A;  3W3D A;  3F9M A;  4DB3 A;  1DGK N;  1YUW A;  3UKU A;  2Q1N A;  2P9L B;  4FWN A;  3H3O B;  5BR9 A;  3U8X A;  2I7P A;  1ATR A;  2PBD A;  2DPN A;  2FF3 B;  3M6G A;  3O1W A;  5F2R A;  4BQZ A;  3S41 A;  4CZK A;  2A6A A;  1DEJ A;  5AQL A;  2KHO A;  3VER A;  1G99 A;  2E2P A;  1NGA A;  4FWS A;  3LDQ A;  5ADX H;  3LL3 A;  3O1B A;  1DKG D;  2P9N A;  4BR4 A;  1U2V A;  4CZL A;  1SZ2 A;  3BP8 A;  5LJV A;  2GEM A;  4H5W A;  3D2E A;  2PAV A;  3QBX A;  3O80 A;  3AAP A;  1HUX A;  1NGD A;  3M1F A;  5AQW A;  1NGI A;  4B1Y B;  1LOT B;  2BUP A;  3WXL A;  2P9K B;  2E1Z A;  2Q0R A;  5EOY A;  1E4F T;  4K43 A;  4FL9 A;  3SLC A;  2P9S A;  4A2A A;  4BRI A;  3ID8 A;  3H3N O;  2IVP A;  4B1Z A;  4H5R A;  4B1X B;  4IXC A;  3WEE B;  1HKB A;  1XC3 A;  3VEW A;  3ENH A;  2A41 A;  5JMV A;  1SQK A;  4BR0 A;  5BPM A;  1K8K A;  4FOE A;  3C7N A;  5BN9 A;  4BRM A;  2ZGZ A;  4BRK A;  3A5N C;  3FZH A;  4I6M A;  5B8H A;  3EO3 A;  4JNE A;  1RGI A;  2Q97 A;  5AQO A;  3ZET B;  3IMX A;  4BVO A;  2P9P A;  2F9T A;  3QFP A;  4BG8 A;  4CZM A;  3U9D A;  4M7Y A;  4BRE A;  1HPM A;  3P4I A;  4FO0 A;  3O6W A;  4CJ7 A;  3A0I X;  4NO7 A;  1ATN A;  3HBT A;  3VF2 A;  1KXP A;  1BG3 A;  1Z05 A;  4BRG A;  3AAR A;  2P9U B;  2J4R A;  1YXQ A;  3FZL A;  3R8E A;  4BGB A;  3BUZ B;  1BDG A;  1ZXO A;  4C23 A;  5AZI A;  3O4W A;  5TKY A;  4FWQ A;  3G25 A;  1P8Z A;  3KHY A;  4AM7 A;  1YVN A;  4BRP A;  3A5L C;  5EVZ A;  4BR5 A;  3H45 C;  5AQK A;  4M7X A;  3IDH A;  4E1J A;  1T6C A;  3M3Z A;  3HTV A;  3O08 A;  3DXK A;  2ASO A;  5KQ8 A;  1ZC6 A;  3EKS A;  4BC2 A;  2YCH A;  3ZEU B;  3KVG A;  2ITM A;  3GOI A;  1C0F A;  2FXU A;  3IUC A;  1NGB A;  3H1V X;  1SAZ A;  3CHW A;  4ISG A;  4FWO A;  4GY2 B;  4RTF D;  3WXJ A;  1MDU B;  3VEV A;  3O5B A;  4BR7 A;  3D7E O;  4RWT A;  3DJC A;  5KPR A;  1BOT O;  3ATV A;  4QS8 A;  1C0G A;  1NGE A;  2CH6 A;  2YHW A;  5EX5 A;  3QML A;  1CZA N;  2CGK A;  3VGM A;  4BRC A;  4K25 A;  3ENO A;  3LDN A;  4JHD B;  1ZBS A;  5AQM A;  5E84 A;  4QS9 A;  3LM2 A;  3CJ1 A;  3GG4 A;  3TU5 A;  4CI6 A;  1R59 O;  2VWB A;  3HI0 A;  1X3N A;  1V4T A;  4EAH D;  2IVN A;  3GL1 A;  4DHY A;  5E26 A;  5AZJ A;  2GWJ A;  4BVP A;  2QM1 A;  2FLO A;  2A42 A;  2P9N B;  3VOV A;  1GLE G;  1HLU A;  1U2V B;  3WQU A;  4FWK A;  1BA1 A;  3VF4 A;  1BA0 A;  5AQZ A;  4BR9 A;  2W41 A;  2AA4 A;  3CQY A;  2QWO A;  3D2E B;  3FFK B;  4B1W B;  1NGJ A;  5AQX A;  2GWK A;  3QFU A;  4H0Y B;  4KBO A;  4HWI A;  5AQU A;  4H0V B;  1OKJ A;  3VGK A;  4XEI A;  1D4X A;  1Q18 A;  2YHY A;  5KPZ A;  2D0O A;  3DAW A;  2P9S B;  3HM8 A;  3FZF A;  1XUP O;  3VEZ A;  3CET A;  2ZWH A;  3QBW A;  3GBT A;  2E2N A;  4DQ8 A;  3JXU A;  4PL7 A;  1HJO A;  1TUU A;  4YDU A;  3WT0 A;  1WUA A;  1K8K B;  2CGL A;  4AM6 A;  1HKG A;  3C7N B;  3VGL A;  1NGC A;  1IG8 A;  2ZF5 O;  2P9I A;  4I6M B;  3LM9 A;  2A3Z A;  4MLE A;  3TPQ A;  4WQ5 C;  2FSJ A;  1RFQ A;  2H3G X;  4K42 A;  1JCE A;  4J8F A;  5CE3 A;  2Q36 A;  2E2O A;  4LC9 B;  2UYT A;  5BRE A;  4FPB A;  3SMP A;  4CZF A;  4BC5 A;  4H03 B;  3MN5 A;  4O5F A;  3CI5 A;  4CBW A;  1U6Z A;  2D4W A;  4O8K A;  3WEE A;  2GEL A;  2HF4 A;  2E1Y A;  3BEX A;  3GDQ A;  2YI1 A;  3EZW A;  1T6D A;  2BTF A;  4HTL A;  3D2F B;  2I7N A;  3MK6 A;  5AZI B;  3EN9 A;  2YJE A;  3LDL A;  4BRD A;  4A61 A; 
#chains in the Genus database with same CATH topology
 4E7H A;  4CBU A;  4E1M A;  3TTD A;  3WXI A;  4X66 K;  4NXM K;  2Q2R A;  4OLB A;  5FRM A;  1NK6 A;  5E41 A;  1YJW N;  4ILH A;  1KLN A;  4KHN A;  3HM9 A;  2O8C B;  3HRG A;  1GLC G;  2A5X A;  3LP0 A;  5BRH A;  3NHG A;  4LF6 K;  4BQL A;  4Z0U A;  3F2K A;  3UKR B;  3ITH A;  4DG1 A;  1CLQ A;  1GLL O;  3OYD A;  3A5M C;  3E9O A;  3FE1 A;  3R3L A;  2UUB K;  3O9R A;  1X9J A;  3KK1 A;  4Y0W A;  4BC3 A;  1TYQ A;  4JD2 B;  3SAH A;  1LWE A;  1Q9Y A;  4PKH A;  4W5T A;  3L4I A;  5JLF A;  3SUQ A;  3OHR A;  3NH0 A;  1N5Y A;  3VEO A;  4BRH A;  4HUG A;  1NK5 A;  1T05 A;  5AQS A;  3QIP A;  3FZK A;  2FSN A;  3SUN A;  3MEG A;  1QQN A;  4JKA A;  3B8A X;  4FK4 A;  3I8B A;  5AZJ B;  4E3S A;  4DWI A;  3RTV A;  1Z25 A;  4DLG A;  4KTQ A;  3SBT A;  4PKI A;  4IEI A;  3VQ9 A;  4BE0 A;  4E7K A;  3LZI A;  3C6A A;  3ZYY X;  3ZSR A;  4N47 A;  4KTZ A;  2HND A;  3AV9 A;  2E2Q A;  3DWL A;  1VSE A;  3AVB A;  3QDK A;  2ZM6 K;  4FK0 A;  3IFR A;  5GIN A;  1KAX A;  3SAF A;  4JS5 A;  1DT9 A;  5BPL A;  5FPD A;  4H4M A;  4EHU A;  1LAV A;  3AO5 A;  3VEN A;  4FVM A;  4YOY A;  4C8M A;  2HHT A;  4FLZ A;  5HLF A;  2UXB K;  2HMP A;  2P9P B;  2AP1 A;  4CGH A;  3NCI A;  2QW9 A;  4KHS A;  1VSD A;  4E89 A;  4E1N A;  4AF1 A;  1T44 A;  4E7I A;  4DUZ K;  5F0X A;  1YJ9 N;  5JIC A;  3HPO A;  1RIL A;  3SI6 A;  1HRH A;  3AO1 A;  1RDD A;  2IAJ A;  1IKW A;  3RR7 A;  4DV0 K;  5I9E B;  4JI4 K;  3LPU A;  4Q5V A;  4K8X A;  3AVH A;  4JRP A;  2NRX A;  3QLH A;  4DSF A;  1IG9 A;  3IRX A;  4FWL A;  4HTU A;  1KVC A;  1FXX A;  3L0Q A;  2ATQ A;  3VET A;  3ZSX A;  4C8L A;  4MO5 A;  1I3A A;  3D2F A;  4YOW A;  5KPT A;  1V4S A;  4KRE A;  4FSV A;  1NGH A;  2QWQ A;  4EFH A;  3I33 A;  3ZSW A;  2P51 A;  4A2B A;  1TKZ A;  1EX4 A;  2F8S A;  3NGI A;  1TYQ B;  5KQD A;  3K5O A;  3ATU A;  2QTD A;  3P39 A;  4H5V A;  3L2V A;  2W42 A;  4B3M K;  1QQC A;  3U9Z A;  1C1A A;  4OPK A;  1QZ5 A;  3QEV A;  2P1J A;  3KKR A;  1GLA G;  2IS3 A;  4CVN E;  3SAG A;  3AO4 A;  4X62 K;  4B1U B;  5AQN A;  2XHB A;  1J54 A;  2NRW A;  2IGI A;  3CPW M;  1RT6 A;  1NK0 A;  3QIN A;  2HHQ A;  1QS4 A;  1S5J A;  2FBV A;  4KHP K;  3I55 N;  3EY1 A;  1JLA A;  3TSQ A;  5AQF A;  4DFJ A;  4GW6 A;  4FOI A;  3UB5 A;  1ESV A;  2NZT A;  5EXW A;  1T3V A;  4FJJ A;  4FLV A;  4DB3 A;  1FK9 A;  3L3U A;  4I9L A;  5C24 A;  5J2N A;  4DU1 A;  3H3O B;  5BR9 A;  2DPN A;  5F2R A;  4KH4 A;  2RF2 A;  3NF8 A;  4HHT A;  4KV8 A;  4DQS A;  2KHO A;  5M1Q A;  4DQI A;  2E2P A;  2O8F A;  1VQK N;  2O8B A;  1UA1 A;  3BP8 A;  5LJV A;  5HRR A;  4H5W A;  3QBX A;  2XY8 A;  1HUX A;  3AGR A;  1EP4 A;  3OBY A;  1F21 A;  4O0J A;  1NGI A;  4B1Y B;  2G8U A;  1LOT B;  1Y97 A;  5EOY A;  1NJI O;  2PYJ A;  4H8K A;  4DFP A;  2VG6 A;  2P9S A;  4DSI A;  2IVP A;  4M3X A;  4B1Z A;  4H5R A;  3WEE B;  1WAJ A;  1I94 K;  1VSL A;  4A5B A;  4BR0 A;  3NF7 A;  1K8K A;  3CCE N;  4CJU A;  3HYF A;  3OYL A;  4BRK A;  5B8H A;  3PSF A;  1SKR A;  1WBB A;  4Z4G A;  5AQO A;  1HNW K;  4CZM A;  3MWP A;  1HPM A;  4M3W A;  1TV6 A;  4B08 A;  3KLF A;  3P4I A;  4FO0 A;  4CJ7 A;  3AVA A;  5M1P A;  1XC9 A;  4JKG A;  2DFH A;  4RW7 A;  3L2W A;  1VSH A;  4CHY A;  5C25 A;  3JYT A;  4CEE A;  1U04 A;  3G25 A;  4BEC A;  1WSF A;  3NMU A;  3MAQ A;  1YVN A;  3K5N A;  3A2F A;  5EVZ A;  3PUF A;  3SYZ A;  5J2P A;  4FJ7 A;  4E1J A;  1T6C A;  3ZCM A;  5GIO A;  3M3Z A;  4W5N A;  4JI7 K;  4DTN A;  3ZT4 A;  2ASO A;  4BC2 A;  3S9H A;  1C0F A;  2FXU A;  1TGO A;  3O4N A;  4B9S A;  3CHW A;  4ISG A;  4RTF D;  4GY2 B;  1WB9 A;  1MDU B;  3VEV A;  4CF8 A;  2ITG A;  1HQE A;  3D7E O;  4CK2 A;  5KPR A;  3ATV A;  1TK8 A;  1NGE A;  4Z4F A;  4MDB A;  2DFF A;  4DU4 A;  1EWR A;  2QKK A;  2OTJ N;  5E84 A;  4QS9 A;  3LZJ A;  4DTO A;  2Z1H A;  3LM2 A;  1RTJ A;  4NLB A;  4DLE A;  3U6F A;  4GV3 A;  1VQM N;  3TU5 A;  3IG1 A;  4CI6 A;  3O3H A;  1TVR A;  1X3N A;  4JLH A;  4EAH D;  1XMQ K;  2IVN A;  3L3V A;  3S3N A;  4AH9 A;  5E26 A;  3NH1 A;  4FM0 A;  3DOL A;  4OX9 K;  2HNZ A;  1S1V A;  3IKM A;  4Z4I A;  2XY6 A;  3QNO A;  1ZBU A;  4J2E A;  3VOV A;  1W97 L;  4B9L A;  1HLU A;  3WQU A;  1HMV A;  4FWK A;  3G0Z A;  2AA4 A;  3MEE A;  5AQX A;  5GAG P;  4XIU A;  2GWK A;  1S9E A;  4OJR A;  5AQU A;  1TAU A;  1QVG M;  2YHY A;  2YNH A;  1BL3 A;  1QSY A;  3K9K A;  4OGE A;  3THX A;  1BI4 B;  2P9S B;  3CQ8 A;  3FZF A;  4I2P A;  1CXU A;  2O8E A;  3VEZ A;  3JXU A;  1O13 A;  4DV6 K;  3WT0 A;  2CGL A;  1K8K B;  4AM6 A;  4E0D A;  3K0S A;  4OO1 J;  3VGL A;  3O4Q A;  3NAE A;  4YOV A;  5HRO A;  2G8W A;  3LM9 A;  3E01 A;  4ID5 A;  2OPQ A;  4KB0 A;  2H3G X;  2O4G A;  3DRP A;  1JCE A;  4J8F A;  5I3U A;  4JKE A;  4KTW A;  4FPB A;  4CEC A;  3VA3 A;  5K14 A;  4O5F A;  3ZSZ A;  4O8K A;  4WE1 A;  5GAH P;  2HF4 A;  3BEX A;  4GMJ B;  1U45 A;  3KKS A;  3WNG A;  2VGN A;  3TI0 A;  3EN9 A;  2F7T A;  4B9N A;  3N4P A;  2YJE A;  5CHI A;  4BRD A;  1KVB A;  4CFB A;  3ZET A;  4CHO A;  2WTU A;  2B4J A;  3GE1 A;  1Y64 A;  3AVN A;  3MXI A;  2VYP A;  1YVU A;  2IOC A;  4DV4 K;  3RMD A;  3ULE B;  3G4S N;  1QHT A;  4DSE A;  4WFB L;  3VQ5 A;  4BRQ A;  4DUY K;  3U4L A;  3TTF A;  1XHZ A;  3MX2 A;  1UAX A;  3AA3 A;  3SQ2 A;  1LWC A;  5CYM A;  2O4I A;  1YT3 A;  1RTD A;  1XMO K;  4CFA A;  3J7A P;  3VTH A;  1BWF O;  5AFU H;  4BR2 A;  3A5O C;  5KRS A;  4DV3 K;  1S3X A;  5F1X A;  3AA2 A;  4H0T B;  2QKB A;  4IO8 A;  4ISF A;  4B3R K;  5HP1 A;  3CQX A;  3HOT A;  3RR8 A;  3BF1 A;  4CJV A;  4XH4 A;  4CZJ A;  3OYN A;  1OH6 A;  4CGF A;  3F73 A;  1Z6R A;  4CJE A;  3OVN A;  4U7B A;  5EY4 A;  3CIP A;  3RSE A;  5A2Q O;  4KHQ A;  4CBX A;  1NBW A;  1JL2 A;  4O55 A;  3VQ4 A;  4A62 A;  4FCY A;  2E6M A;  3O8M A;  4CIE A;  4Z4E A;  4IWV A;  3KLH A;  1MWM A;  4JHD A;  2GUP A;  4JS4 A;  4G1Q A;  4JI2 K;  1NMD A;  4I9Q A;  2CH5 A;  3ULD A;  3HZ6 A;  2X78 A;  1QHA A;  3J81 O;  3JS6 A;  4YOT A;  2NRZ A;  2P9L A;  4YFU A;  1MWK A;  2OZS A;  2E8A A;  3THX B;  4CGJ A;  2OPR A;  1JJ2 M;  4H5N A;  1WSI A;  4FJM A;  2O8E B;  5LL6 Z;  4C1N K;  3DOK A;  2OA8 A;  4JI5 K;  5FRO A;  4JEP A;  5AQI A;  4PL8 A;  1WSG A;  4GV9 A;  2ASM A;  4PA1 A;  2BGG A;  4GNI A;  3CJB A;  2RHK A;  4M63 C;  1QVF M;  3AVL A;  2IDO A;  2GV9 A;  1GLF O;  3NVK A;  3NH2 A;  1S1U A;  4CZH A;  3I0R A;  5AFU A;  2Q0U A;  1GLJ O;  1CZ9 A;  1SUQ A;  2QWN A;  3HK2 A;  2YJF A;  3AAQ A;  1WN7 A;  1YIJ N;  3P38 A;  5CZ2 A;  3SCX A;  2E20 A;  3V1Q A;  3CJ9 A;  4CEA A;  3OYC A;  3AVC A;  2OPP A;  3LP1 A;  3P1G A;  4CZI A;  1VQ9 N;  1NG9 A;  3HJF A;  3DM2 A;  3KTQ A;  2G8V A;  1W7A A;  1RT7 A;  4FZY A;  3Q7B A;  3O3F A;  1HJR A;  1NU0 A;  4FVU A;  4MLH A;  4BE2 A;  3FLC O;  4LF9 K;  4PWD A;  1RT4 A;  3MXJ A;  1VQO N;  1VQN N;  5BN8 A;  1YTA A;  1HNV A;  5FPE A;  1LW2 A;  4Z4C A;  4GKJ K;  3M8P A;  2A1S A;  4CJR A;  4FPA A;  3P5J A;  4MDA A;  1RTI A;  1KVA A;  4GV6 A;  3ZT2 A;  1L3U A;  1HYV A;  3U3Y A;  3CC7 N;  3I8D A;  1QSL A;  4CJ3 A;  4L3Q A;  3QEP A;  1NM1 A;  3FR0 A;  4YOU A;  3K5M A;  3MDQ A;  4GVE A;  4FW2 A;  4ELT A;  1GOB A;  1TUY A;  3DRS A;  3H08 A;  5FPN A;  3RSE B;  3OYM A;  4IJA A;  3QET A;  4CEB A;  4AHS A;  4DF8 A;  4PY5 A;  4BRA A;  1RNH A;  4O8U A;  4G9Z A;  3T69 A;  1QQM A;  4CF0 A;  2W6L A;  2QWP A;  2NLX A;  3ZX2 A;  3TSU A;  1NJY A;  1C1B A;  2ZJQ L;  3M8S A;  2Z1G A;  4CES A;  3V9U A;  3C6T A;  4FJN A;  3D0P A;  1TK0 A;  3LAL A;  3R6M A;  1DGK N;  1JLG A;  4LFA K;  3UKU A;  2Q1N A;  4WFN L;  2P9L B;  4B3S K;  3U8X A;  2I7P A;  4AIL C;  3M6G A;  4CZK A;  2A6A A;  4DS4 A;  1NKB A;  1BGX T;  1KD1 O;  1IKV A;  1NGA A;  1L5U A;  1S6P A;  5ADX H;  3C6H A;  1DKG D;  1TKT A;  2P9N A;  3THV A;  3SZ2 A;  1SZ2 A;  1Q9X A;  4F3O A;  3IAY A;  1XI1 A;  5HRN A;  3D2E A;  4IG3 A;  3AAP A;  1JKH A;  1NGD A;  3CFP A;  4GKK K;  5AQW A;  3RMA A;  3QEI A;  4ILJ A;  3S5T A;  1E4F T;  5HOO A;  4HCB A;  3SLC A;  4A2A A;  4BRI A;  3AO3 A;  4LY7 A;  1EXQ A;  3O3G A;  4IXC A;  2PY5 A;  3OS1 A;  1HKB A;  1XC3 A;  2PFU A;  1FW6 A;  2A41 A;  1NOY A;  1C0U A;  4RW6 A;  5BN9 A;  3ZSQ A;  4HUE A;  1K8A O;  1BCO A;  2ZGZ A;  3FZH A;  4I6M A;  3F9K A;  3DLK A;  3EO3 A;  3ZT0 A;  1RGI A;  2B5J A;  3AA5 X;  3KJV A;  2W6K A;  5HBM A;  4M7Y A;  4BRE A;  3CFR A;  1VQ5 N;  3J7Y P;  3O6W A;  3CFO A;  4NO7 A;  1K6Y A;  1JLB A;  2ZJP L;  3B6P A;  4CJK A;  3I56 N;  1BG3 A;  1Z05 A;  4BRG A;  3OTO K;  2J4R A;  1YXQ A;  3FZL A;  3R8E A;  3AVJ A;  4KKO A;  1ZXO A;  3C94 A;  5AZI A;  4OLA A;  1SL1 A;  2OZM A;  2UXD K;  3VQE A;  3VTI A;  4ELU A;  3V1O A;  4CED A;  4FWQ A;  1P8Z A;  5FDL A;  1GOA A;  4AM7 A;  4YOX A;  4JYA K;  2VWK A;  3PIO L;  3A5L C;  5GIP A;  5AQK A;  3IDH A;  4BAC A;  1A5X A;  4IBN A;  1IKY A;  4JK8 A;  4FJH A;  3CD6 N;  5DK5 A;  3DXK A;  1ZC6 A;  1HYS A;  5GAE P;  1WAF A;  3KVG A;  4NLC A;  3IUC A;  4OKE A;  4Z4H A;  1NGB A;  5J2Q A;  1TKD A;  1SAZ A;  3OJS A;  3HVR A;  4IDH A;  5IT9 O;  5C0Y A;  3O5B A;  4BR7 A;  4M3Z A;  4RWT A;  4KO0 A;  2WBN A;  3DJC A;  5MLC Q;  1VQL N;  2F8T A;  4BE1 A;  4QS8 A;  2UUA K;  3RMC A;  3K59 A;  1RT2 A;  1CZA N;  4M45 A;  3VGM A;  4ELV A;  4BRC A;  4W5O A;  1VRT A;  3LDN A;  4HCC A;  5AQM A;  3SQ4 A;  4CJP A;  4EP5 A;  4AHV A;  5HL7 L;  4FZZ A;  4CF1 A;  2HBK A;  4CK1 A;  1U47 A;  2HST A;  3U3G A;  3DLE A;  4RW9 A;  1VSJ A;  2VWB A;  1V4T A;  4LF7 K;  1BIU A;  3GL1 A;  3I0S A;  4IO9 L;  3E66 A;  2GWJ A;  4BVP A;  2QM1 A;  4X65 K;  2ZE2 A;  2FLO A;  4DV5 K;  4AQY K;  2UUC K;  2P9N B;  1I39 A;  2EX3 A;  1IBL K;  4DTP A;  1M90 O;  5AQZ A;  3J80 O;  2YKN A;  1UA0 A;  3CQY A;  3VQP A;  1VQ6 N;  2Y1J A;  3D2E B;  3FFK B;  4XJX A;  3ISN C;  4B1W B;  4DTR A;  2YHB A;  4H0V B;  1BQN A;  3T19 A;  1EWQ A;  3LP3 A;  4DR6 K;  4W5Q A;  1L3V A;  3SUO A;  1UOC A;  3QO9 A;  1SL0 A;  3NF6 A;  5KGX A;  3CET A;  1L3T A;  3GBT A;  4PL7 A;  1HJO A;  4DV1 K;  1BHL A;  4FM1 A;  1OH7 A;  1KSP A;  1NGC A;  2UXC K;  3E9P A;  2P9I A;  4I6M B;  1P90 A;  1IO2 A;  1X9S A;  3VN5 A;  1Q81 O;  4MLE A;  1YI2 N;  1RDU A;  5H1S Q;  2YX6 A;  1RFQ A;  2HMI A;  3OYB A;  3TAE A;  2E2O A;  2UYT A;  3TSP A;  4UY8 O;  1HQU A;  4CZF A;  3NVM A;  3V9Z A;  2AJQ A;  1LWF A;  4KFB A;  3S3O A;  1U6Z A;  4LSN A;  2GEL A;  4O4G A;  3HPG A;  4ID1 A;  1BCM A;  2YI1 A;  4RG8 A;  4HTL A;  3D2F B;  4AHU A;  3SUP A;  2I7N A;  3MK6 A;  2F4V K;  5AZI B;  3EYZ A;  2HHV A;  1NJX A;  3MEC A;  4DMN A;  1T7P A;  5AQY A;  3HP6 A;  5AR0 A;  2JLE A;  5ELZ A;  2G8I A;  1YAG A;  4K41 A;  4PQU A;  4IEE A;  4B9Q A;  4ISE A;  3WUH A;  3EE9 A;  1NJW A;  3DXK B;  3SMS A;  4CD1 A;  2GBZ A;  4OPH A;  1RDB A;  2LSN A;  4LH5 A;  1SL2 A;  3LDO A;  4KB1 A;  1H1V A;  2RKI A;  3LAK A;  2HHX A;  4FWP A;  3CCQ N;  5AQG A;  3TTC A;  4DFM A;  4YDU C;  4FWR A;  2G8F A;  3B6O A;  2HF3 A;  4DR3 K;  4FWM A;  3NGY A;  4JV5 K;  4B9M A;  4H0O A;  2O8D A;  4CCH A;  1X9W A;  1FKO A;  5EU7 A;  2HNY A;  4DKW A;  3AY9 A;  5KI6 A;  3VEX A;  2G8H A;  3BZK A;  3MCA B;  3KZB A;  3EEQ A;  4EIA A;  1B9F A;  1S9G A;  3HSC A;  2C1G A;  1BU6 O;  3CCV N;  1RBV A;  3V1R A;  3EZ5 A;  4O5B A;  1S1W A;  3CCU N;  4F2S A;  2DTU A;  2PZS A;  3L2Q A;  2O8F B;  2O8B B;  1HNI A;  3CJ7 A;  4KI4 A;  1C6V A;  3LDS A;  1MU2 A;  3QEX A;  5TKW A;  2IVO A;  2NRV A;  1LCU A;  4MFB A;  3H1Q A;  4WCE L;  3VPZ A;  3SNN A;  3UIQ A;  3ZSO A;  3H6E A;  1NJZ A;  4BRO A;  3KK3 A;  4DTS A;  1ZBI A;  1GLB G;  3MN7 A;  1XNR K;  5LY3 A;  3FGU A;  2QI2 A;  1KAY A;  2HOE A;  3TAN A;  3ZX0 A;  3SPY A;  4IOX A;  2P9I B;  1X3M A;  1HR0 K;  4CW7 B;  5J2M A;  1OVQ A;  3VQC A;  4CJ5 A;  4FJL A;  3KWI A;  3NBP A;  5LJW A;  3D6R A;  4WQ4 C;  3EE8 A;  5AQT A;  1NMN A;  3BY5 A;  4C8K A;  3SV4 A;  2V51 B;  2HVH A;  3ZSV A;  3T1A A;  3BGR A;  4A5A A;  4BDP A;  1RT1 A;  4FJK A;  4JKG B;  4JK7 A;  4H0P A;  4IFY A;  5C42 A;  2HBL A;  3QIO A;  3HL8 A;  4FJ9 A;  3DMJ A;  1GLD G;  4NB4 A;  4ZTF A;  4R5P A;  2NRH A;  1KCF A;  3VQ7 A;  2QWM A;  2EWS A;  5JLH A;  4B8A B;  3T7Z A;  3C6U A;  1SKW A;  3QNN A;  3AVF A;  1NK9 A;  5BRF A;  4FLW A;  3NE6 A;  2CGJ A;  2FBY A;  4WYB A;  4JKF A;  1QZ6 A;  1RBT A;  4JKH A;  2VWJ A;  1C0M A;  2D0P A;  3E1Y A;  3EL2 A;  4XH1 A;  4CJQ A;  4IFE A;  4FJ5 A;  3CCM N;  4DV2 K;  2V52 B;  2ZJR L;  3SV3 A;  4M3T A;  4KRF A;  2OAN A;  1JLE A;  1WOQ A;  4FW1 A;  2WOM A;  3C0B A;  5LMN K;  2EHG A;  3O9Q A;  3WXK A;  3DLL L;  2E88 A;  3VEY A;  4E19 A;  3G6E N;  1W0H A;  4CHQ A;  1Q82 O;  2IIR A;  3R1X A;  5AQR A;  1FJG K;  5T7B A;  3ZX3 A;  4BRF A;  2QWL A;  3PX6 A;  5CR4 A;  2NNW A;  2FBT A;  3UKR A;  3MMV A;  2QXF A;  3CER A;  1IV0 A;  3DLG A;  1JCG A;  1XHX A;  3HT3 A;  4LSL A;  4CF2 A;  4M42 A;  3VES A;  1IJJ A;  4PUO A;  4DR5 K;  3SQ0 A;  4JI3 K;  1NKC A;  4JD2 A;  2VCP A;  4BRN A;  4WQ5 A;  1KAZ A;  4CD3 A;  4R79 A;  1HKC A;  2Q3S A;  5M1O A;  3MN6 A;  4IJN A;  5FPM A;  1J5E K;  3PY8 A;  2R7Y A;  2HBJ A;  3W3D A;  3BDP A;  4DSJ A;  2KZM A;  5C12 A;  1YUW A;  4BDY A;  1ZBL A;  1DTQ A;  1S6Q A;  2KFZ A;  2PBD A;  2FF3 B;  3O1W A;  3OBW A;  4BQZ A;  4UQG A;  3OYA A;  2KFN A;  1DEJ A;  4I7F A;  4KI6 A;  5I42 A;  5SWM A;  5M1N A;  4FYD A;  4LF8 K;  3V6D A;  1JXE A;  4FWS A;  4CEO A;  2XO7 A;  1C0T A;  3LL3 A;  2KQ2 A;  1N33 K;  3P31 A;  1R0A A;  1EET A;  4HVJ A;  4KHU A;  1VRU A;  3G71 N;  4H4O A;  2E5L K;  3T3F A;  4BY9 C;  4DFK A;  4JI6 K;  2BUP A;  3WXL A;  3AO2 A;  3TR8 A;  2VG7 A;  1N8R O;  4F3T A;  4K43 A;  4FL9 A;  1HNZ K;  1KFD A;  3ID8 A;  5SZT A;  4K8Z A;  4CJW A;  3QEW A;  3VEW A;  2I5J A;  1SQK A;  4DTX A;  4K0K K;  3DLB A;  5BPM A;  4FOE A;  3C7N A;  1NK8 A;  2HHS A;  4BRM A;  3A5N C;  3OYE A;  3CXC M;  4N56 A;  4N5S A;  2Q97 A;  3ZET B;  3IMX A;  1NNE A;  2P9P A;  2F9T A;  4LFB K;  4LH4 A;  4RW8 A;  3JAM O;  5IWA K;  3VQ8 A;  1VQP N;  3FFI A;  1ATN A;  3HBT A;  3ZT3 A;  3VF2 A;  4CFD A;  4DSL A;  4BGB A;  4CJL A;  2VQF K;  1BDG A;  1Q8I A;  2VGM A;  4C23 A;  4BEB A;  1SKS A;  4BWM A;  3O4W A;  1X9M A;  5TKY A;  2QA4 N;  1DTT A;  5JVH L;  4CJT A;  5BR8 K;  3RWU A;  3VQQ A;  3KHY A;  1NOZ A;  5JEN A;  3VMF B;  4BRP A;  4LF5 K;  4X64 K;  3H45 C;  1S1X A;  1U48 A;  1JLF A;  2JWL A;  1J5O A;  2YNI A;  3KD5 E;  3HTV A;  4ZHR A;  5KQ8 A;  2YCH A;  4JKC A;  2ITM A;  3TAR A;  3GOI A;  4CF9 A;  1TKX A;  4CHP A;  4QOZ B;  1K9M O;  3JSM A;  3CM6 A;  3H1V X;  4JK9 A;  4B3O A;  4MQ3 A;  4KHW A;  4DR2 K;  3WXJ A;  2NRT A;  3CG7 A;  2WC9 A;  4DV7 K;  3MX5 A;  1BOT O;  1NK4 A;  2A1R A;  5KRT A;  1EO1 A;  1LAW A;  1HPZ A;  4M41 A;  4CGI A;  1UWB A;  1QTM A;  1VSK A;  1U4B A;  1ILY A;  4WF9 L;  3K5L A;  4JHD B;  3MWT A;  1LV5 A;  2E4L A;  3KK7 A;  2Y1I A;  3CJ1 A;  3GG4 A;  2YV0 X;  5FLX O;  3HI0 A;  2PYL A;  2FBX A;  1IKX A;  3OJU A;  5JVG L;  4F8R A;  1U49 A;  4KHY A;  4DS5 A;  1ZYQ A;  1YHQ N;  1O1W A;  2D5R A;  3CC4 N;  1SS6 A;  1VQ4 N;  2A42 A;  4JRQ A;  4OPA A;  3CYM A;  1C1C A;  1GLE G;  3TAQ A;  4JI0 K;  1BA1 A;  2P5O A;  3OW2 M;  5D3G A;  4BR9 A;  2W41 A;  2QWO A;  1BIZ A;  3PO4 A;  4YHH K;  4EP4 A;  2WFB A;  4DR1 K;  3M5R A;  1RBS A;  3QFU A;  1YTU A;  3AVG A;  4KBO A;  4AHR A;  3CYG A;  4CHN A;  2E6L A;  4XEI A;  1D4X A;  4B9V A;  1XUP O;  3V9W A;  4M3Y A;  4BE7 B;  2ZWH A;  2E2N A;  1WNS A;  1ASV A;  4CER A;  1KFS A;  4YDU A;  1WUA A;  5AJ3 K;  3C7N B;  4DU3 A;  4ILG B;  3THY A;  4Y1D A;  3L4Q A;  1QSS A;  1CZB A;  1N6Q A;  4BDZ A;  2A3Z A;  3TPQ A;  5CY4 A;  4WQ5 C;  2DFE A;  4NYF A;  3T1Y K;  2RE2 A;  3CCL N;  2NRR A;  5LMU K;  1VAZ A;  1A5V A;  2X6S A;  4I2Q A;  3SMP A;  5JS2 A;  4BC5 A;  4H03 B;  3MN5 A;  2G8K A;  4CJF A;  4CBW A;  2ETJ A;  3WEE A;  2E1Y A;  3GDQ A;  3TAB A;  3EZW A;  1T6D A;  4NCB A;  1G15 A;  1D5A A;  3KLE A;  2VG5 A;  2HB5 A;  3DRR A;  3LDL A;  3PLA A;  3N4Q A;  1K73 O;  1VHX A;  1BO5 O;  5AQP A;  2P5G A;  3E9L A;  2UU9 K;  2IC3 A;  1S1T A;  2ZGY A;  2HHI A;  1OVY A;  3UE5 A;  5ADX A;  1WSJ A;  4CGG A;  4LFC K;  3AVI A;  4FJX A;  4BWJ A;  1XQS C;  4HUF A;  1BUP A;  3FZM A;  3PX0 A;  5C2F A;  4RW4 A;  2YKM A;  4FLX A;  3KD1 E;  1TL3 A;  3OY9 A;  3OS2 A;  3PSI A;  1JLQ A;  3DXM A;  1B92 A;  2V7Z A;  3MN9 A;  2A40 A;  3MED A;  5J1E A;  3KWG A;  5DM6 L;  2V7Y A;  3SBG A;  3OYK A;  4FZX C;  4WQ4 A;  4IZ9 A;  4DR4 K;  3W0L A;  1OH8 A;  3A8Y A;  2HHU A;  4CK3 A;  3L6Q A;  3QIC A;  1J6Z A;  3UKU B;  4U67 L;  3MCP A;  4ZTJ A;  3J7Z O;  1SV5 A;  3V4I A;  4JI1 K;  4OVL A;  3S3M A;  1VSM A;  3CF5 L;  1EQY A;  1REV A;  4JN4 A;  3WNF A;  2KW4 A;  3IS9 A;  4Z94 A;  5C10 A;  4FLU A;  3P83 D;  5DMR A;  3WXM B;  3J8A A;  2D0C A;  1KQS M;  4OKK A;  1L3S A;  1W9H A;  3CCJ N;  3K57 A;  1LW0 A;  2HHW A;  4F9O A;  4XH5 A;  4CGD A;  4JAX A;  4Q0B A;  1MA9 B;  4QCL A;  1D9D A;  3WQT A;  3V9S A;  3ZLJ A;  5CYQ A;  1E4G T;  1QE1 A;  3AVK A;  4PKG A;  5BPN A;  2JWK A;  2QWR A;  3NGZ A;  4QAG A;  1HNX K;  3C95 A;  2Q31 A;  4BG9 A;  2YHX A;  3KIO A;  3L2U A;  4EHT A;  4QS7 A;  3THY B;  3LDP A;  5AQJ A;  4FK2 A;  4J2A A;  3G10 A;  3THW A;  1S22 A;  4C1N I;  1T8E A;  1NWK A;  4CEQ A;  1TL1 A;  1NGF A;  2D1K A;  3WNE A;  2P9K A;  3VF6 A;  1KRP A;  4CEZ A;  1BI4 A;  1BQM A;  1JCF A;  2GTD A;  2OTL N;  4NYN A;  4FJG A;  5AQQ A;  1E3M A;  1RBU A;  3K9J A;  2OYQ A;  3CJA A;  4MO4 A;  4BGA A;  4A59 A;  4F2R A;  2F96 A;  1NGG A;  1ATS A;  3R9P A;  3PV8 A;  4A57 A;  1X1P A;  4V19 S;  3ASM A;  1NLV A;  3VQD A;  5GAD P;  4PHT X;  4CZE A;  1RDW X;  2DY4 A;  4CIF A;  4IDK A;  1HYZ A;  3SJH A;  4H5T A;  4IG0 A;  2YNF A;  2BH1 A;  5AQH A;  1QQO A;  2Z1I A;  3TAM A;  1VSI A;  3O9U A;  4FJI A;  3OA9 A;  4L8R B;  2W40 A;  4H0X B;  4N41 A;  4E72 A;  3SQ1 A;  2YNG A;  1WSE A;  1ASU A;  2P9U A;  2QXL A;  1TAQ A;  4JKD A;  3CCS N;  2GUI A;  4B1V A;  4KAZ A;  3DLR A;  3O9T A;  3OYI A;  3DXM B;  3H46 O;  3ULE A;  3L2R A;  1TK5 A;  3C65 A;  4O44 A;  1KLM A;  5FRN A;  5BRD A;  4EZ9 A;  2KZZ A;  3SK3 A;  1N34 K;  3HST B;  3QB0 A;  3DYA A;  4E7J A;  1BIS A;  4CFC A;  1DLO A;  3ZEU A;  3TAF A;  4N76 A;  5AQV A;  3EKU A;  3K2P A;  1YIT N;  2BE2 A;  4DCH A;  2FSK A;  4O0I A;  2Z1J A;  1ASW A;  1B9D A;  1RDC A;  1WLJ A;  4RCH A;  3NDK A;  1JXB A;  2ASP A;  4DTJ A;  4JI8 K;  1T03 A;  2C1I A;  1KC8 O;  2XRI A;  1HX1 A;  2NUB A;  4NXN K;  4BRL A;  2F9W A;  4C8O A;  3CM5 A;  1Q7Y O;  4CZG A;  1XNQ K;  4BC4 A;  3CJC A;  4F4K A;  4YOR A;  3KLG A;  2FF6 A;  2WUS A;  3SPZ A;  1N36 K;  4FXD A;  4W5R A;  3CPE A;  3BF3 A;  3V9X A;  2X74 A;  3F9M A;  4CIG A;  1VK0 A;  2QK9 A;  4FWN A;  4OPJ A;  1ATR A;  3BZC A;  3S41 A;  2ZD1 A;  1IH7 A;  3MXM A;  5AQL A;  1J53 A;  1D9F A;  4OGC A;  3VER A;  3VQA A;  1JL1 A;  1G99 A;  1D8Y A;  3LDQ A;  4C8N A;  3DLH A;  3PO5 A;  2KTQ A;  3CMA N;  3O1B A;  4BR4 A;  1U2V A;  4CZL A;  1RTH A;  4KPY A;  5DM7 L;  1KTQ A;  2GEM A;  3THW B;  2HVI A;  2XY5 A;  1OH5 A;  4AHC A;  2PAV A;  3O80 A;  4AHT A;  5JS1 A;  3AA4 A;  3M1F A;  3TWH A;  4J2B A;  3HVT A;  4DQP A;  2B6A A;  1RBR A;  3NF9 A;  2YHA A;  1W2B M;  1IBK K;  4GVM A;  2P9K B;  4FLY A;  2E1Z A;  2RPI A;  3O9S A;  2Q0R A;  2BAN A;  2QEX N;  3H3N O;  1GOC A;  4B9T A;  4B1X B;  5KTQ A;  1RT5 A;  5JMV A;  3ENH A;  1VSF A;  1ZBF A;  3CCR N;  4M3R A;  3SJJ A;  5C2D A;  3Q7C A;  4LD0 A;  5M1F A;  1WBD A;  4B3T K;  4JNE A;  4BVO A;  1RT3 A;  3PIP L;  3QFP A;  4BG8 A;  2KLA A;  4FJ8 A;  3U9D A;  4M3U A;  3A0I X;  4KH6 A;  3LP2 A;  3ID6 A;  4CHZ A;  2OCE A;  4JKB A;  1KXP A;  1VQ7 N;  3HXM A;  3AAR A;  2P9U B;  3AGK A;  3ALY A;  5HRP A;  2GX9 A;  3BUZ B;  4WFA L;  3T1H K;  4NCG A;  4FLT A;  3KLI A;  1RDA A;  3LAN A;  3L8B A;  3VQ6 A;  1RCH A;  4CJ4 A;  2FC0 A;  4BR5 A;  2O8D B;  4IFV A;  4M7X A;  3QER A;  1CXQ A;  2RN2 A;  4YNQ A;  4EZ6 A;  3ZSY A;  1M1K O;  3O08 A;  2O8C A;  1FKP A;  4J2D A;  3EKS A;  2ZQB A;  2XY7 A;  3ZEU B;  4IOC L;  3HP9 A;  4YY3 K;  4IOA L;  5M1K A;  4Y1C A;  1EKE A;  4KH5 A;  4FWO A;  4FM2 A;  4DR7 K;  3OYH A;  5C15 A;  3K58 A;  4DSK A;  1C0G A;  2CH6 A;  4DTM A;  3LAM A;  3V81 A;  3ZT1 A;  2YHW A;  5EX5 A;  3M8R A;  3QML A;  2CGK A;  3D45 A;  3VQB A;  4K25 A;  3ENO A;  2HBM A;  3NFA A;  1JLC A;  1ZBS A;  4CJS A;  4NCA A;  4DTU A;  2OPS A;  3RRG A;  4IKF A;  1R59 O;  4DHY A;  5CZ1 A;  4DQR A;  5AZJ A;  3CME N;  3OYG A;  2X6N A;  2D0A A;  3RVC A;  4B9U A;  1U2V B;  4DF4 A;  4ICL A;  1YJN N;  3F5T A;  1BA0 A;  4TSX A;  3VF4 A;  1IBM K;  4CE9 A;  1N32 K;  1NGJ A;  3LWL A;  2BDP A;  1WSH A;  1XWL A;  4H0Y B;  4CEF A;  4HWI A;  2KKZ A;  1OKJ A;  3OYF A;  3VGK A;  1NK7 A;  1Q18 A;  1ITG A;  3ENB A;  5KPZ A;  3HOS A;  2D0O A;  3DAW A;  3HM8 A;  4E7L A;  4OKJ A;  2WON A;  3QBW A;  4DQ8 A;  5KGW A;  1S72 N;  3CC2 N;  1TUU A;  3M8Q A;  2VQE K;  1HKG A;  1A5W A;  1VQ8 N;  1IG8 A;  2ZF5 O;  4B8C A;  3QES A;  1NKE A;  3WNH A;  3HPH A;  2FSJ A;  2JGU A;  3HO1 A;  3LWM A;  3PX4 A;  4K42 A;  3OYJ A;  5CE3 A;  2W00 A;  2Q36 A;  4DQQ A;  4LC9 B;  5BRE A;  3RRH A;  4LF4 K;  3LPT A;  3KK2 A;  1Q86 O;  1ZBH A;  3AVM A;  1J9A A;  3CI5 A;  3RMB A;  2HHH K;  2D4W A;  3DI6 A;  3VA0 A;  3TAP A;  2D0B A;  2BTF A;  3TAG A;  1Z26 A;  1YF5 L;  3OS0 A;  5HRS A;  2HW3 A;  4A61 A; 
#chains in the Genus database with same CATH homology
 3ZET A;  1BO5 O;  5AQP A;  5AQY A;  5AR0 A;  4CBU A;  3GE1 A;  1Y64 A;  5ELZ A;  2VYP A;  1YAG A;  3ULE B;  4K41 A;  3TTD A;  3E9L A;  3WXI A;  4IEE A;  3G4S N;  4B9Q A;  2Q2R A;  2ZGY A;  4ISE A;  3WUH A;  1OVY A;  3EE9 A;  3UE5 A;  4WFB L;  5ADX A;  1YJW N;  4ILH A;  3DXK B;  3SMS A;  4BRQ A;  4CD1 A;  3HRG A;  3U4L A;  1GLC G;  2A5X A;  3TTF A;  5BRH A;  4OPH A;  1XQS C;  3MX2 A;  4BQL A;  3LDO A;  1H1V A;  1BUP A;  3F2K A;  3FZM A;  3UKR B;  5C2F A;  4FWP A;  3VTH A;  1GLL O;  3CCQ N;  5AQG A;  3A5M C;  3TTC A;  4YDU C;  1BWF O;  3E9O A;  3FE1 A;  3R3L A;  4FWR A;  5AFU H;  4BR2 A;  3O9R A;  2HF3 A;  3DXM A;  1X9J A;  2V7Z A;  3A5O C;  3MN9 A;  1S3X A;  4Y0W A;  2A40 A;  4FWM A;  5F1X A;  4BC3 A;  1TYQ A;  4H0O A;  4JD2 B;  3KWG A;  3SAH A;  4H0T B;  5DM6 L;  4IO8 A;  4ISF A;  2V7Y A;  4PKH A;  3L4I A;  3SBG A;  4WQ4 A;  4IZ9 A;  4DKW A;  3AY9 A;  3CQX A;  3HOT A;  3BF1 A;  3W0L A;  3VEX A;  5JLF A;  3MCA B;  3OHR A;  3KZB A;  3A8Y A;  4EIA A;  3VEO A;  4BRH A;  3L6Q A;  3HSC A;  2C1G A;  5AQS A;  4XH4 A;  3QIC A;  1BU6 O;  4CZJ A;  3FZK A;  1J6Z A;  2FSN A;  3UKU B;  4U67 L;  1Z6R A;  3MCP A;  3J7Z O;  1QQN A;  4U7B A;  4JKA A;  5EY4 A;  3CIP A;  3RSE A;  3B8A X;  3I8B A;  3CCV N;  4CBX A;  1NBW A;  5AZJ B;  3CF5 L;  1EQY A;  4A62 A;  4JN4 A;  3O8M A;  4IWV A;  3CCU N;  4Z94 A;  5C10 A;  5LY3 A;  1MWM A;  3CJ7 A;  4JHD A;  3SBT A;  2GUP A;  4PKI A;  4IEI A;  3WXM B;  3J8A A;  1KQS M;  1NMD A;  2CH5 A;  3CCJ N;  5TKW A;  3HZ6 A;  2IVO A;  1QHA A;  3C6A A;  2NRV A;  3JS6 A;  4YOT A;  2NRZ A;  3ZYY X;  2P9L A;  1LCU A;  4F9O A;  4XH5 A;  3H1Q A;  4WCE L;  3VPZ A;  1MWK A;  4JAX A;  2E8A A;  2E2Q A;  1MA9 B;  3DWL A;  3H6E A;  3WQT A;  4BRO A;  1JJ2 M;  4H5N A;  1E4G T;  5BPN A;  4PKG A;  4C1N K;  2JWK A;  2QWR A;  3QDK A;  1GLB G;  3IFR A;  3MN7 A;  4JEP A;  2Q31 A;  5AQI A;  3FGU A;  2QI2 A;  1KAX A;  1KAY A;  2YHX A;  4PL8 A;  1DT9 A;  2HOE A;  4BG9 A;  5BPL A;  2ASM A;  3SAF A;  4GV9 A;  4EHT A;  4QS7 A;  3ZX0 A;  3LDP A;  4GNI A;  5AQJ A;  4IOX A;  2P9I B;  3CJB A;  4EHU A;  1X3M A;  3VEN A;  5FPD A;  2RHK A;  4M63 C;  4YOY A;  1QVF M;  1S22 A;  4C1N I;  1GLF O;  3NVK A;  3KWI A;  1NWK A;  5LJW A;  3D6R A;  4CZH A;  4WQ4 C;  5AFU A;  1NGF A;  2Q0U A;  3EE8 A;  1GLJ O;  2HMP A;  2D1K A;  2P9P B;  5AQT A;  2AP1 A;  2P9K A;  2QWN A;  3VF6 A;  2YJF A;  2V51 B;  3AAQ A;  2QW9 A;  1JCF A;  2GTD A;  3P38 A;  1YIJ N;  4AF1 A;  2OTL N;  1T44 A;  4A5A A;  2E20 A;  5F0X A;  5AQQ A;  3K9J A;  3CJA A;  3CJ9 A;  5JIC A;  4JKG B;  1YJ9 N;  4JK7 A;  4H0P A;  4MO4 A;  2HBL A;  4BGA A;  4A59 A;  1NGG A;  1ATS A;  1GLD G;  4NB4 A;  3R9P A;  4CZI A;  2NRH A;  1VQ9 N;  4A57 A;  2QWM A;  2EWS A;  5I9E B;  5JLH A;  1NLV A;  5GAD P;  4PHT X;  3T7Z A;  4CZE A;  1RDW X;  2NRX A;  3SJH A;  5BRF A;  4H5T A;  2CGJ A;  3Q7B A;  4WYB A;  2BH1 A;  4FWL A;  1QZ6 A;  3L0Q A;  4JKF A;  5AQH A;  1QQO A;  4JKH A;  3VET A;  2D0P A;  4XH1 A;  3E1Y A;  3EL2 A;  4MLH A;  3O9U A;  4FVU A;  3OA9 A;  2W40 A;  3FLC O;  4H0X B;  4IFE A;  3CCM N;  4MO5 A;  2V52 B;  3D2F A;  4YOW A;  1VQO N;  1VQN N;  5BN8 A;  2P9U A;  2QXL A;  2ZJR L;  5KPT A;  1V4S A;  5FPE A;  4JKD A;  2OAN A;  4FSV A;  1NGH A;  1WOQ A;  2QWQ A;  4EFH A;  3CCS N;  4B1V A;  3C0B A;  3I33 A;  4A2B A;  3O9T A;  4FPA A;  3DXM B;  3O9Q A;  4MDA A;  3H46 O;  3WXK A;  3DLL L;  1TYQ B;  3ULE A;  4GV6 A;  5KQD A;  2E88 A;  3C65 A;  3VEY A;  3CC7 N;  3G6E N;  5BRD A;  3ATU A;  2QTD A;  3P39 A;  4H5V A;  1Q82 O;  2IIR A;  3R1X A;  5AQR A;  3SK3 A;  4L3Q A;  3ZX3 A;  4BRF A;  2QWL A;  3QB0 A;  5CR4 A;  1NM1 A;  3FR0 A;  4YOU A;  3U9Z A;  2NNW A;  3ZEU A;  3MDQ A;  4GVE A;  5AQV A;  3EKU A;  1QZ5 A;  1TUY A;  3CER A;  3MMV A;  3UKR A;  4DCH A;  1YIT N;  2FSK A;  1JCG A;  5FPN A;  1GLA G;  3RSE B;  3SAG A;  4IJA A;  3VES A;  1IJJ A;  4RCH A;  2ASP A;  4B1U B;  5AQN A;  4BRA A;  2C1I A;  1KC8 O;  2NRW A;  3CPW M;  4O8U A;  1HX1 A;  3T69 A;  4G9Z A;  4JD2 A;  2VCP A;  4BRN A;  4BRL A;  2F9W A;  1QQM A;  4WQ5 A;  1KAZ A;  2QWP A;  1Q7Y O;  2NLX A;  3ZX2 A;  4CZG A;  3TSU A;  4BC4 A;  4CD3 A;  3I55 N;  3CJC A;  2ZJQ L;  4YOR A;  5AQF A;  3TSQ A;  2FF6 A;  2WUS A;  4FOI A;  4R79 A;  1HKC A;  5GIN A;  5M1O A;  3CPE A;  3UB5 A;  3MN6 A;  1ESV A;  2NZT A;  3BF3 A;  4IJN A;  1T3V A;  5EXW A;  5FPM A;  2HBJ A;  3R6M A;  3W3D A;  3F9M A;  4DB3 A;  1DGK N;  5C12 A;  1YUW A;  3UKU A;  2Q1N A;  4WFN L;  2P9L B;  4FWN A;  3H3O B;  5BR9 A;  3U8X A;  2I7P A;  1ATR A;  2PBD A;  2DPN A;  2FF3 B;  3M6G A;  3O1W A;  3OBW A;  5F2R A;  3S41 A;  4BQZ A;  2A6A A;  4KH4 A;  4CZK A;  1DEJ A;  5AQL A;  1KD1 O;  2KHO A;  3VER A;  5M1Q A;  5M1N A;  1G99 A;  2E2P A;  1NGA A;  4FWS A;  3LDQ A;  3CMA N;  5ADX H;  3C6H A;  3LL3 A;  3O1B A;  1DKG D;  2P9N A;  1VQK N;  3P31 A;  4BR4 A;  1U2V A;  4CZL A;  5DM7 L;  1SZ2 A;  3BP8 A;  5LJV A;  2GEM A;  4H5W A;  3G71 N;  3D2E A;  2PAV A;  3QBX A;  3O80 A;  3AAP A;  1HUX A;  1NGD A;  3AGR A;  3M1F A;  3OBY A;  4BY9 C;  1W2B M;  5AQW A;  1NGI A;  4B1Y B;  1LOT B;  2BUP A;  3WXL A;  2P9K B;  2E1Z A;  3O9S A;  4ILJ A;  2Q0R A;  5EOY A;  1NJI O;  1N8R O;  1E4F T;  5HOO A;  4K43 A;  4FL9 A;  3SLC A;  2P9S A;  4A2A A;  4BRI A;  2QEX N;  3ID8 A;  3H3N O;  2IVP A;  4B1Z A;  4H5R A;  4B1X B;  4IXC A;  3WEE B;  1HKB A;  1XC3 A;  2PFU A;  3ENH A;  2A41 A;  3VEW A;  5JMV A;  1SQK A;  4A5B A;  4BR0 A;  3CCR N;  5BPM A;  1K8K A;  3CCE N;  4FOE A;  3C7N A;  5BN9 A;  1K8A O;  4BRM A;  2ZGZ A;  4BRK A;  3A5N C;  3FZH A;  4I6M A;  5B8H A;  3Q7C A;  5C2D A;  3CXC M;  3EO3 A;  5M1F A;  4JNE A;  1RGI A;  2Q97 A;  5AQO A;  3ZET B;  3IMX A;  4BVO A;  2P9P A;  2F9T A;  3PIP L;  3QFP A;  4BG8 A;  2KLA A;  4CZM A;  3MWP A;  3U9D A;  4M7Y A;  4BRE A;  1HPM A;  1VQ5 N;  3P4I A;  4FO0 A;  3O6W A;  4CJ7 A;  3A0I X;  4NO7 A;  5M1P A;  4KH6 A;  1VQP N;  3ID6 A;  4JKG A;  1ATN A;  3HBT A;  4JKB A;  3VF2 A;  2ZJP L;  1KXP A;  3I56 N;  1VQ7 N;  1BG3 A;  1Z05 A;  4BRG A;  3AAR A;  2P9U B;  3AGK A;  2J4R A;  1YXQ A;  3FZL A;  3R8E A;  4BGB A;  2GX9 A;  1BDG A;  1ZXO A;  2VGM A;  3BUZ B;  4C23 A;  4WFA L;  5AZI A;  4BEB A;  3O4W A;  3VTI A;  5TKY A;  2QA4 N;  4FWQ A;  4BEC A;  3G25 A;  1P8Z A;  5JVH L;  3NMU A;  3KHY A;  4AM7 A;  4YOX A;  1K73 O;  1YVN A;  3VMF B;  4BRP A;  3PIO L;  3A5L C;  5EVZ A;  4BR5 A;  3H45 C;  5GIP A;  5AQK A;  4M7X A;  3IDH A;  4E1J A;  1T6C A;  2JWL A;  5GIO A;  4JK8 A;  3M3Z A;  3HTV A;  1M1K O;  3O08 A;  3CD6 N;  3DXK A;  2ASO A;  5KQ8 A;  1ZC6 A;  3EKS A;  5GAE P;  4BC2 A;  2YCH A;  3ZEU B;  4JKC A;  3KVG A;  2ITM A;  3GOI A;  4NLC A;  1C0F A;  4IOC L;  2FXU A;  3IUC A;  1K9M O;  4IOA L;  1NGB A;  5M1K A;  3H1V X;  4JK9 A;  1SAZ A;  4KH5 A;  3CHW A;  4ISG A;  4FWO A;  4GY2 B;  4RTF D;  4IDH A;  3WXJ A;  5C0Y A;  1MDU B;  2NRT A;  3VEV A;  5C15 A;  2WC9 A;  3O5B A;  4BR7 A;  3D7E O;  3MX5 A;  4RWT A;  5MLC Q;  2WBN A;  3DJC A;  5KPR A;  1VQL N;  1BOT O;  3ATV A;  4QS8 A;  1EO1 A;  1C0G A;  1NGE A;  2CH6 A;  2YHW A;  4MDB A;  5EX5 A;  3QML A;  1CZA N;  2CGK A;  3VGM A;  4BRC A;  4K25 A;  3ENO A;  1ILY A;  2HBM A;  4WF9 L;  3LDN A;  4JHD B;  1ZBS A;  5AQM A;  5E84 A;  2OTJ N;  3MWT A;  4QS9 A;  5HL7 L;  2HBK A;  3LM2 A;  2HST A;  4NLB A;  3KK7 A;  4GV3 A;  3CJ1 A;  1VQM N;  3GG4 A;  3TU5 A;  4CI6 A;  1R59 O;  2VWB A;  3HI0 A;  1X3N A;  1V4T A;  4EAH D;  2IVN A;  3GL1 A;  4DHY A;  5E26 A;  5JVG L;  4IO9 L;  3E66 A;  5AZJ A;  3CME N;  2GWJ A;  4BVP A;  1YHQ N;  2QM1 A;  3IKM A;  3CC4 N;  3RVC A;  1SS6 A;  1VQ4 N;  2FLO A;  2A42 A;  1W97 L;  2P9N B;  4OPA A;  3VOV A;  1GLE G;  1HLU A;  1U2V B;  3WQU A;  1M90 O;  4FWK A;  1BA1 A;  3F5T A;  1BA0 A;  5AQZ A;  3VF4 A;  3OW2 M;  1YJN N;  4BR9 A;  2W41 A;  2AA4 A;  3CQY A;  1VQ6 N;  2QWO A;  3D2E B;  3FFK B;  4XJX A;  4B1W B;  1NGJ A;  2WFB A;  5AQX A;  5GAG P;  3M5R A;  2GWK A;  3QFU A;  4H0Y B;  4KBO A;  4HWI A;  5AQU A;  4H0V B;  2KKZ A;  1OKJ A;  3VGK A;  1QVG M;  4XEI A;  1D4X A;  1Q18 A;  2YHY A;  3ENB A;  3K9K A;  5KPZ A;  3HOS A;  2D0O A;  3DAW A;  2P9S B;  3HM8 A;  3FZF A;  1XUP O;  3VEZ A;  4BE7 B;  3CET A;  2ZWH A;  3QBW A;  3GBT A;  2E2N A;  4DQ8 A;  3JXU A;  1S72 N;  1O13 A;  4PL7 A;  3CC2 N;  1HJO A;  1TUU A;  4YDU A;  3WT0 A;  1WUA A;  1K8K B;  2CGL A;  4AM6 A;  1HKG A;  3C7N B;  4OO1 J;  4ILG B;  3VGL A;  1NGC A;  1VQ8 N;  1IG8 A;  2ZF5 O;  3E9P A;  2P9I A;  3L4Q A;  4I6M B;  1P90 A;  4YOV A;  3LM9 A;  1Q81 O;  2A3Z A;  4MLE A;  3TPQ A;  4WQ5 C;  1YI2 N;  2FSJ A;  1RDU A;  5H1S Q;  2RE2 A;  2YX6 A;  1RFQ A;  2H3G X;  3CCL N;  4K42 A;  1JCE A;  4J8F A;  5CE3 A;  4JKE A;  2W00 A;  2NRR A;  2Q36 A;  2E2O A;  4LC9 B;  1VAZ A;  2UYT A;  3TSP A;  5BRE A;  4UY8 O;  4FPB A;  3SMP A;  1Q86 O;  4CZF A;  4BC5 A;  4H03 B;  3MN5 A;  3NVM A;  4O5F A;  3CI5 A;  4CBW A;  1U6Z A;  2D4W A;  4O8K A;  3WEE A;  2GEL A;  2HF4 A;  2E1Y A;  3BEX A;  3GDQ A;  5GAH P;  2YI1 A;  3EZW A;  2VGN A;  1T6D A;  2BTF A;  4HTL A;  3D2F B;  2I7N A;  3MK6 A;  5AZI B;  3EN9 A;  2F7T A;  3N4P A;  2YJE A;  5CHI A;  1YF5 L;  3LDL A;  4BRD A;  3PLA A;  3N4Q A;  4A61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...