4I6MA

Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of swi/snf chromatin remodeler.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
465
structure length
399
Chain Sequence
TLNRKCVVIHNGSHRTVAGFSNVELPQCIIPSSYIKRTEAEFIFGTYNMIDAAAEKRNGDEVYTLVDSQGLPYNWDALEMQWRYLYDTQLKVSPEELPLVITMPATNGKPDMAILERYYELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIGASGCNVTPIIDGIVVKNAVVRSKFGGDFLDFQVHERLAPLIKEEQKRSTDVWYEASTWIQQFKSTMLQVSEKDLFELERYYKEQADIYAKQQENNPLVQKKNFLFKPLNKTLTLDLKECYQFAEYLFKPQLISDKFSPEDGLGPLMAKSVKKAGASISPEQVYSLLLTNVIITGSTSLIEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGWLGALTMANLPSWSLGKWYSKEDYETLKRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 7
publication title Structure of an actin-related subcomplex of the SWI/SNF chromatin remodeler.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
total genus 107
structure length 399
sequence length 465
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4i6mA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4i6mA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4i6mA03
2NLXA 3C0BA 4FPBA 4EHUA 5TKYA 1ZBSA 4F9OA 1Z05A 1X3MA 5FPMA 1K8KB 3FGUA 3MN7A 3C7NB 4XH1A 2QWQA 4FL9A 3U9DA 4GNIA 5FPNA 5BRDA 1ATRA 2IVNA 2P9UA 3L0QA 1GLEG 2IVPA 4WYBA 5AQTA 4BRIA 1MA9B 3VERA 4DCHA 3A0IX 4BRFA 3OHRA 2Q97A 4BRMA 2I7PA 2GWKA 2YHYA 2QWRA 3HTVA 4BRDA 3FFKB 3H1VX 3L4IA 4EIAA 2QWLA 3FZKA 3IMXA 5LY3A 3LM9A 3ZEUB 3QICA 2F9WA 1GLCG 4BVOA 1HPMA 3H6EA 4EHTA 5EVZA 4FSVA 5KPTA 2F9TA 5BRHA 4BR2A 2ASOA 4YDUC 2GWJA 2V52B 1NGEA 2V7YA 3KZBA 4RWTA 1KXPA 3ATVA 4PKIA 4H5TA 4A2BA 4Z94A 5AZIA 4BRPA 3VEYA 4RCHA 1KAXA 3I33A 2GELA 1NGDA 3LDPA 4M7YA 1BUPA 2QXLA 1MWKA 4EFHA 1S3XA 2PAVA 3HBTA 3SMPA 2ASPA 4MO4A 1HKBA 3DAWA 3A5LC 3SMSA 5BREA 3KHYA 3FZMA 2PBDA 1NGJA 4K25A 3ATUA 1ATSA 3WXKA 3FR0A 3ID8A 3O08A 5KQ8A 1NGBA 3GL1A 5AQQA 4CZEA 3SJHA 2ITMA 1QHAA 1TYQB 2HF4A 2V7ZA 3VESA 1K8KA 3ZX0A 3I8BA 5AQGA 3ZETB 5BN8A 5KQDA 3UKUB 3QMLA 3VEXA 1RGIA 3CJCA 5BR9A 3CQXA 4QS9A 3LDOA 3AAQA 5BPNA 4E1JA 2YJFA 5JLHA 1NGCA 4O8KA 3CQYA 3B8AX 3DXKB 2J4RA 4JNEA 3U8XA 4JHDB 1HLUA 1WUAA 4HWIA 3BF3A 5AQHA 2CH5A 3UB5A 1RFQA 1Z6RA 1TUYA 2IVOA 4CZKA 3A8YA 2AA4A 2E88A 4FWSA 1HKGA 3ZEUA 4BRQA 5AQWA 1YAGA 4NB4A 4RTFD 2WUSA 5AQKA 1BA0A 3FE1A 3G25A 3WXIA 4B1YB 5B8HA 3MCPA 3TPQA 3JS6A 4BRAA 4BG8A 2NZTA 3VENA 4BQLA 4FWPA 3UKRB 4BRLA 3WEEB 1SAZA 2EWSA 1Q18A 4H5VA 1YVNA 1S22A 2P9SB 4IJNA 4PKGA 4H5RA 3MDQA 4WQ4A 3TU5A 4BC5A 3L6QA 3H3NO 4ISFA 2FSJA 4JAXA 4FPAA 3GBTA 1NM1A 1DEJA 3CJ9A 4BRCA 2FLOA 3DJCA 4ISGA 1YXQA 3CJ1A 4H5WA 2UYTA 1NGFA 1TYQA 4BR4A 4BGBA 4H0OA 5AZJB 4H5NA 3QDKA 5ADXH 1IG8A 2ZF5O 4M7XA 4H0XB 3VEZA 1V4TA 4BR5A 2W40A 1HJOA 2VYPA 5BPMA 1RDWX 2CH6A 4BGAA 3ZX3A 3WQTA 2ASMA 1J6ZA 2D1KA 4BVPA 3DXMB 5AQIA 1XC3A 2AP1A 3U9ZA 2P9PB 1HKCA 1LCUA 2CGLA 3LDQA 4JD2A 4IXCA 1T6CA 2E1ZA 3FZHA 3WT0A 2P9LB 4NO7A 3QBXA 3M3ZA 3HSCA 4BREA 2Q36A 3F9MA 5JMVA 1NBWA 3VPZA 1X9JA 3D2FA 5BPLA 3RSEA 1P8ZA 4I6MB 3JXUA 1NMDA 4B1UB 5LJWA 2A41A 4FO0A 3GE1A 3H1QA 3U4LA 2QM1A 4B1ZA 2CGKA 3M6GA 4FWKA 3VOVA 2V51B 3W0LA 3ULEB 3AY9A 3H45C 5BN9A 5AQPA 1NGIA 3H46O 3W3DA 2Q1NA 3UKRA 1WOQA 3VF6A 2QW9A 5F0XA 4XH5A 4IO8A 4ISEA 3AAPA 3ENHA 5F1XA 1NGHA 2P9SA 4B9QA 3D2EB 5AQVA 3VGLA 5ADXA 1MWMA 1YUWA 3VEOA 4BR0A 2E2PA 5EX5A 2HF3A 3C7NA 3VEWA 4CBUA 4FOEA 3MN6A 4WQ4C 2GUPA 4FWOA 3WQUA 3S41A 2HMPA 5LJVA 5AQMA 4CJ7A 4CZGA 2A6AA 2P9UB 2CGJA 1BO5O 4CZLA 3BP8A 4A62A 4CBXA 2D0PA 1GLAG 1MDUB 5BRFA 1XQSC 3MK6A 2P9PA 3P4IA 4BRNA 3O5BA 2H3GX 2E8AA 4H0PA 5E84A 1ZXOA 2A40A 3FZFA 4PKHA 3CJAA 5AR0A 2I7NA 1QQMA 4H03B 3GDQA 5I9EB 4LC9B 5ELZA 3VF4A 4BRGA 5E26A 4EAHD 4FWQA 2HOEA 1JCEA 4CD3A 3IFRA 4K41A 4CZIA 2BTFA 4KBOA 3VGMA 1NGGA 4O5FA 4WQ5A 4CZHA 1D4XA 1U2VB 3ULEA 4MLHA 4CBWA 3HZ6A 3H3OB 3IUCA 4BC4A 4AM7A 3R9PA 1GLLO 3QFPA 1C0FA 3UE5A 2A3ZA 3BEXA 3ZX2A 4H0YB 3VEVA 4BQZA 1E4GT 3SLCA 1H1VA 2YCHA 3LM2A 1GLFO 5AQUA 4Y0WA 2QWOA 3EZWA 1XUPO 5AZIB 1ESVA 4CZMA 4B1XB 4BR7A 2P9IB 4JN4A 5AFUH 3O80A 4QS8A 1QQNA 1GLDG 3O6WA 5AQFA 3ZETA 3EN9A 2Q31A 2FSKA 2ZWHA 2D0OA 2D4WA 4K42A 3UKUA 3O8MA 2VWBA 4BG9A 1DGKN 3CJ7A 4FWNA 1EQYA 1SQKA 3CI5A 3CETA 3O1BA 1CZAN 4H0TB 2P9NB 2ZGZA 3DXKA 2BUPA 3VETA 4JHDA 2YHWA 4L3QA 4B1WB 2IIRA 1ATNA 2A5XA 2A42A 4FOIA 1U6ZA 2YJEA 4BRHA 3O1WA 1V4SA 3O4WA 4FWRA 1X3NA 5AQXA 1NWKA 2P9KB 4H0VB 3MN5A 3WUHA 3MMVA 2GEMA 3IDHA 4DB3A 5FPEA 1IJJA 1KAZA 3A5NC 5JICA 3EO3A 5EY4A 1Y64A 1JCFA 2QWNA 2VCPA 3FZLA 5KPZA 1BA1A 3CJBA 1KAYA 3M1FA 3SK3A 2ZGYA 4FWMA 3WXLA 2DPNA 1C0GA 2Q0RA 1BG3A 2FXUA 4BRKA 4IZ9A 4PL8A 1QZ6A 2Q2RA 1BWFO 4GY2B 5AQOA 2NRHA 1OKJA 1GLBG 3WEEA 1QQOA 2QWMA 5AQNA 3QBWA 1U2VA 3EKUA 5AQZA 1HX1A 1E4FT 5AFUA 5AQRA 5AQYA 1ZC6A 1JCGA 2YI1A 1T44A 5CE3A 4CD1A 4CZFA 1HUXA 3LDLA 2E2OA 4FWLA 4A2AA 2E20A 4BC2A 4IJAA 4BC3A 4DQ8A 3A5MC 4WQ5C 3WXJA 3BF1A 5FPDA 4QS7A 3VGKA 3CERA 1QZ5A 3BUZB 2P9IA 5EXWA 4BROA 3HI0A 3LL3A 4MO5A 2Q0UA 3GOIA 2W41A 5AZJA 4MLEA 2QWPA 3ENOA 3D7EO 3CIPA 3FLCO 3J8AA 2GTDA 2P9NA 3A5OC 1BOTO 3DXMA 4PL7A 4XH4A 4B1VA 5F2RA 4IWVA 2FSNA 2P9LA 4BR9A 1BU6O 3EL2A 2P9KA 2OANA 1BDGA 1GLJO 5AQLA 2YHXA 2E2NA 3R6MA 2E2QA 3AARA 3GG4A 4I6MA 1T6DA 3VF2A 4YDUA 4XEIA 4JD2B 1TUUA 4J8FA 1LOTB 3EKSA 4M63C 3QFUA 5KPRA 4DHYA 4CZJA 1SZ2A 3DWLA 3CHWA 3D2FB 5AQJA 3KVGA 1G99A 5EOYA 5AQSA 2E1YA 3MN9A 3RSEB 2FF6A 3LDNA 5JLFA 4C23A 4HTLA 4K43A 2FF3B 1NLVA 3D2EA 4AM6A 3R8EA 4A61A 1DKGD 4CI6A 3QB0A 2KHOA 1R59O 3HM8A 1NGAA
chains in the Genus database with same CATH superfamily
2RHKA 2Y1IA 1I94K 1X3MA 1K8KB 3K5NA 2QWQA 5M1NA 3TAFA 1VSEA 3L0QA 4AHSA 2ZJRL 2UXCK 3HPHA 4GV9A 4DR4K 4BEBA 3OYJA 1NJWA 1Q82O 3PIPL 4B3RK 2G8IA 4JYAK 4O8UA 3J7AP 2YHYA 4CESA 3FFKB 1O13A 1ASVA 2X6SA 1Q81O 2QWLA 3AVIA 3IMXA 1KVBA 3ZEUB 4MQ3A 3QICA 4NLCA 3KK1A 4A5AA 5M1FA 4N5SA 4CGDA 4FLUA 3KD5E 4W5QA 4DWIA 4CERA 4CEDA 2VWJA 3OYHA 4BY9C 4PQUA 4YORA 2ASOA 1KQSM 2GWJA 2V52B 1NGEA 5HL7L 2ZJPL 3HXMA 5J2QA 3SPZA 1NOZA 4H5TA 4A2BA 4Z94A 4DTMA 5AZIA 3VEYA 2O8CB 2GELA 3AO4A 1MWKA 2PAVA 3HBTA 3SMPA 4MO4A 1U45A 4FK0A 3L8BA 5KTQA 3DAWA 1JLEA 4O5BA 3AVMA 3SQ4A 3T1YK 3LPUA 3O9RA 1YJNN 3TAGA 2PBDA 4K25A 4CVNE 1VSLA 3VQDA 5A2QO 4IOAL 3G4SN 1N5YA 2O8BA 1NGBA 3GL1A 5AQQA 3AGRA 4F4KA 1K8KA 4Q0BA 5KQDA 2OZSA 5GIOA 3QEPA 4WCEL 4QS9A 3LDOA 4N47A 5BPNA 3BGRA 1OVQA 1HNWK 4MFBA 4B9SA 3QEWA 4EZ9A 4Z4EA 1YHQN 4JI1K 4PWDA 1HJRA 1NOYA 1FJGK 2J4RA 4FZXC 3U8XA 1HNXK 1C0UA 3TI0A 1WUAA 3S9HA 4F2SA 4C8KA 3U6FA 3S3OA 5J2MA 4CZKA 2B4JA 2E88A 1N8RO 3ZEUA 5BR8K 4BRQA 4E0DA 4NB4A 4KHNA 5HROA 4A5BA 4FJ8A 2YHBA 4KHUA 3LALA 2HW3A 1BA0A 3FE1A 3S3NA 3DOKA 3NFAA 2AJQA 2ZD1A 1RT2A 3V9SA 3TPQA 3TR8A 4KHWA 3OY9A 1J9AA 4BQLA 4FWPA 4ILJA 1NK4A 1TL3A 2EWSA 3PUFA 1WSHA 4E1NA 4KHSA 1Q18A 4H5VA 3CMAN 1YVNA 1YIJN 2YKNA 4PKGA 4WQ4A 1G15A 4BC5A 4DR3K 2W6KA 1X9SA 1W7AA 3TTDA 3CPEA 3GBTA 1NM1A 1R0AA 5HLFA 4FM1A 2UUAK 3SJJA 2FLOA 5J2NA 3ZT1A 1NGFA 1S6QA 3AVBA 3KK2A 3ISNC 4BR4A 4H0OA 4NCGA 5AZJB 3O3FA 3M8PA 2QI2A 3RMAA 5SZTA 1V4TA 3I56N 1HJOA 2WONA 3N4PA 1RDWX 4FW1A 3DI6A 4PA1A 2D1KA 3T7ZA 3NF9A 3OYFA 1X9WA 5AQIA 3G71N 3U9ZA 5CYQA 3TARA 1EETA 4JV5K 1VQKN 1T6CA 4LH4A 2WFBA 3WT0A 2P9LB 4OGCA 3PLAA 2ATQA 4NO7A 3VA3A 3QBXA 4M3ZA 3F9MA 5BPLA 4X64K 3HOTA 5LJWA 3JXUA 1NMDA 3CYGA 4FO0A 2YX6A 3D45A 2OA8A 1VSDA 1O1WA 2CGKA 4JI2K 1TK0A 3VOVA 2HHXA 4OPAA 2GUIA 3H45C 5BN9A 2HBJA 4V19S 1S1VA 2Q1NA 3VF6A 2QW9A 2GBZA 4ISEA 3VQBA 1ITGA 1HQUA 3V6DA 1BIUA 4YOTA 4B9QA 2O8EB 3VGLA 5ADXA 3SPYA 4FM0A 3SV4A 1DLOA 1VHXA 2HF3A 3C7NA 4LH5A 3RTVA 2G8KA 2GUPA 1F21A 4W5RA 5LJVA 3VQ8A 1ZBLA 1HYZA 2P9UB 2CGJA 4Z4FA 4A62A 3M8SA 4CBXA 1GLAG 1X9MA 5BRFA 4AH9A 5IT9O 4FJ7A 4KI4A 5TKWA 3ZLJA 4KH6A 2BE2A 1YJWN 2E8AA 4H0PA 2A40A 3FZFA 4PKHA 3O4QA 2I7NA 1B9FA 1BL3A 1KVCA 3GDQA 4OPJA 2NRVA 3VF4A 3B6OA 4OJRA 1QE1A 4W5TA 2NRWA 4KBOA 1NGGA 1RT1A 4WQ5A 1UA0A 4MLHA 4CBWA 2KFNA 1VSKA 4BC4A 4AM7A 2F8TA 3QFPA 3UE5A 3HVRA 4CFBA 3L2UA 4H0YB 1GOBA 5DK5A 4DSEA 3LM2A 3LANA 2FBTA 1ESVA 4B1XB 4OO1J 4DFJA 4OGEA 1WSIA 2HSTA 4QS8A 3EN9A 3CCSN 3I8DA 4CFDA 3QNOA 2RN2A 5C10A 1XHXA 3VQ9A 3K57A 3CJ7A 1EQYA 1TKDA 1SQKA 4XJXA 1OH6A 3CETA 2IOCA 3RRHA 3UIQA 4PY5A 1S1TA 1RNHA 1LW2A 4QOZB 1BISA 2JWLA 1XI1A 1OH7A 2QEXN 4CFAA 1REVA 2HHVA 3VETA 4B1WB 3IG1A 2A5XA 4HUGA 1WBDA 5M1OA 4MDBA 4BRHA 1X3NA 4CHZA 1NKCA 1JKHA 2P9KB 3MMVA 4IOXA 5J2PA 5FPEA 1TK8A 3SZ2A 3TTFA 5JICA 3EO3A 5EY4A 1X1PA 3DLRA 1NK6A 3DRPA 3SQ0A 2ZGYA 4FJHA 3WXLA 1BG3A 2FXUA 4BRKA 3DLEA 1QZ6A 1BWFO 4HUFA 4BE0A 3WEEA 4YOYA 3OS0A 2HMIA 1E4FT 3QIOA 2YI1A 3V9UA 1GOAA 3I0SA 1TV6A 3DLGA 2E2OA 4A2AA 3KLFA 4BC3A 3A5MC 3DLHA 5JVHL 5LL6Z 4DFKA 5C2FA 3V9WA 2HHSA 4YNQA 2W41A 4O44A 3E1YA 4AHVA 1RBSA 1S9GA 3KJVA 2HNDA 4CJLA 4DKWA 5LMUK 1W0HA 3FLCO 4A59A 3OYEA 4JKHA 3J8AA 1VQLN 3A5OC 3HK2A 4O0JA 3T1HK 3CM6A 4CIEA 4H4MA 3AVHA 3O4NA 3CCUN 4CFCA 4XH4A 3V1OA 3V4IA 3LWMA 1RILA 2DY4A 4E89A 3EL2A 2P9KA 1VQMN 1BDGA 2VG7A 3AARA 3GG4A 2HVHA 4I6MA 3VF2A 4DMNA 4ILHA 1L3TA 1EO1A 4JD2B 1TUUA 3CCMN 1LOTB 1JXBA 2QK9A 3QFUA 3TANA 5KPRA 1VQ7N 4DHYA 1TL1A 4RW6A 2BANA 4YFUA 2F96A 3CHWA 3RSEB 5C24A 1JJ2M 4CF1A 2FF6A 1IKWA 4BDZA 3C6HA 4C23A 2NUBA 4HTLA 5SWMA 2RKIA 4JKAA 4FJGA 4K43A 1WSEA 4CHOA 2FF3B 1YF5L 3MECA 3SI6A 4HCBA 4A61A 4G9ZA 3KKRA 4CI6A 2G8WA 1R59O 1Y97A 4YOWA 3HM8A 3TWHA 2OPSA 3ULDA 3O9QA 3C0BA 4YOXA 4PUOA 3K2PA 3WNHA 4KHPK 3MN7A 4FVMA 5FPNA 5BRDA 3PX6A 3AVKA 1YTUA 1ATRA 4I2PA 4OPKA 3NHGA 1L3VA 3AA3A 2IVPA 4Q5VA 4WYBA 1RDUA 3T3FA 4I2QA 4DR5K 2NRTA 1CXUA 2EX3A 5EU7A 4DF4A 3V81A 3A0IX 2Q97A 1U04A 2I7PA 4C8MA 1SKSA 3LM9A 3VQ4A 2F9WA 3OW2M 3KWGA 1FKPA 2O8DB 4C1NK 1S9EA 1KTQA 3V9ZA 2HNZA 2BGGA 3OYIA 5KPTA 3WNEA 4JK8A 3SUQA 2C1GA 3O3GA 4N76A 3K5MA 5CHIA 4F3OA 2HHIA 4RWTA 3KZBA 1KXPA 3VTHA 3OBYA 1ZBHA 2F7TA 3THVA 3K0SA 3CFPA 4NYNA 4JKGB 3ZSZA 3PIOL 1KAXA 2FBXA 3L2WA 1NGDA 4M7YA 1BUPA 1J53A 3J7ZO 4IEIA 1OH5A 2FBVA 3A5LC 3QEXA 4DF8A 5I3UA 3FZMA 1T03A 3ATUA 3WXKA 4E7HA 1SL2A 1W97L 3NGIA 2ITMA 2HF4A 2V7ZA 3ZX0A 3I8BA 1EWRA 3ENBA 4E7LA 5BR9A 1ZBFA 2PYLA 3ITHA 3CQXA 2OZMA 4CEAA 4E1JA 2G8VA 1C0TA 3QIPA 3HPOA 3DXKB 3O9SA 4JNEA 1XMOK 3UB5A 4Z4GA 3KK7A 5KI6A 3A8YA 1XMQK 1VQNN 2OPRA 4LSLA 1LWCA 4N41A 4OKKA 4DV3K 5AQKA 2IS3A 4C8NA 4KTWA 3T69A 3HPGA 5B8HA 3IKMA 4ID5A 3NCIA 3KLEA 1NKEA 4BRAA 4BG8A 1IO2A 3SUNA 4CIGA 1VSMA 4JKEA 1SAZA 3PO4A 1DTTA 1S22A 2P51A 4KB1A 3TU5A 5HOOA 5GADP 4ISFA 4DV6K 2FSJA 3NBPA 4JAXA 4DU3A 3AA2A 4BRCA 4ISGA 4WE1A 1YXQA 3CJ1A 4H5WA 4KHQA 4F2RA 2GV9A 1WAJA 2PYJA 4BGBA 3HT3A 1EP4A 4H5NA 1LWFA 4DTRA 1IG8A 4M7XA 1C1BA 2VQEK 1BGXT 4CGGA 2DFEA 1LAVA 4E7JA 2VYPA 2CH6A 4JI4K 4AHUA 3HJFA 4CJ5A 4BVPA 2YNFA 4NYFA 4DR7K 2VG6A 3IS9A 4KPYA 1XC3A 2P9PB 3E01A 1BCMA 1B92A 4JI5K 3SQ1A 4JI8K 3HSTB 1C1AA 3L2QA 2BH1A 3L2VA 5HBMA 1D8YA 4B1UB 2OPQA 4B9UA 1WBBA 1RT7A 3H1QA 2QM1A 3AA4A 4B1ZA 3OS2A 2P5GA 5LMNK 4NXMK 3W0LA 4X65K 1NGIA 3OS1A 3ALYA 5F0XA 4IO8A 3VTIA 4LF8K 3HOSA 3DLLL 3AAPA 3CC2N 1RBUA 4CW7B 5AQVA 1MWMA 2XRIA 4DSLA 3MXIA 1NKBA 2UXBK 2E2PA 1JLFA 3ZSQA 1VSIA 1CLQA 2KLAA 3MN6A 2QA4N 3CQ8A 4JI6K 4ILGB 4JKCA 2Y1JA 4DFMA 3THWB 1YITN 3DM2A 1XC9A 1U49A 2P9PA 4BRNA 2H3GX 1YTAA 3SUPA 4KTZA 1RDAA 5E84A 2HVIA 3CJAA 1Q7YO 1QQMA 5I9EB 1GOCA 5ELZA 3HM9A 1VRUA 4BRGA 4FJIA 3OYGA 3F2KA 4WFBL 1T3VA 4LD0A 4O0IA 1T7PA 3THXB 1HYSA 4CZHA 4JK7A 1U2VB 3HZ6A 3H3OB 2O8CA 3IUCA 1GLLO 3MX5A 3BEXA 1E4GT 1Q9YA 2JWKA 3CPWM 3DLKA 2YCHA 1GLFO 1VAZA 4OX9K 1J5OA 1EWQA 1QSYA 3TABA 3OYDA 4BR7A 1YT3A 4JN4A 3O80A 3KKSA 2KFZA 1GLDG 3TAQA 5FRNA 4M3RA 2VG5A 1JL2A 1QVGM 2FSKA 4O55A 3F73A 2D0OA 2D4WA 2P1JA 3ZT4A 4ZTFA 2VWBA 3TSUA 4FWNA 2ITGA 3SAHA 4F3TA 4LY7A 4M3WA 3CCRN 3O1BA 5FRMA 2W00A 1CZAN 1RT6A 2P9NB 4NCAA 2F4VK 3J7YP 3THWA 3KLIA 2IIRA 3MEDA 3SUOA 3AO2A 1B9DA 2YJEA 3O4WA 1NWKA 4H0VB 4CK3A 3MN5A 3WUHA 3IDHA 1JLAA 1KAZA 1KLMA 1HNVA 3A5NC 4HCCA 3K59A 1JCFA 3MXJA 1EX4A 2VCPA 5MLCQ 3SK3A 1TGOA 3B6PA 1BHLA 4DTSA 2Q2RA 4LFBK 3CCLN 2C1IA 2WBNA 4GY2B 4HHTA 2NRHA 1OKJA 2FBYA 3QBWA 1U2VA 3N4QA 3ZYYX 5AFUA 4OKJA 1KVAA 1ZC6A 1JCGA 5AQYA 1LAWA 2VGMA 5M1PA 4CZFA 2E20A 4AHCA 4DQ8A 3AVNA 3WXJA 3BF1A 3VGKA 1NG9A 1JLGA 1QZ5A 3BUZB 4GW6A 4M3UA 4MO5A 1VQ6N 5AZJA 2B6AA 3MWPA 4FK2A 3QESA 4BWJA 3VQ5A 4E19A 3VN5A 3CIPA 3NMUA 2P9NA 4GVEA 2YKMA 1TKZA 1I3AA 5JENA 4B1VA 4IWVA 2ZQBA 2FSNA 2P9LA 3V1RA 4CK1A 3ZSXA 2KZZA 1FK9A 1GLJO 4DTPA 2YHXA 3R6MA 4CJ3A 4IG3A 3KLHA 4DTNA 4B9NA 2EHGA 2B5JA 4J8FA 1XNQK 3ID6A 4CZJA 4FZZA 3D2FB 5T7BA 4CHPA 2QKBA 3LDNA 5JLFA 3OYLA 4JI0K 2UU9K 2O8EA 2WOMA 4UQGA 4DSFA 1CZ9A 5D3GA 3HL8A 4IO9L 3CCVN 1WSJA 3OBWA 2NLXA 4LSNA 2OPPA 5K14A 1WNSA 1ZBSA 1LV5A 1Z05A 4E72A 5DM7L 3C6TA 3FGUA 5KRTA 4DQQA 4RW7A 4FL9A 2ETJA 4JS4A 4LF4K 3E9OA 2D0CA 2IVNA 2P9UA 2HBKA 1GLEG 4NLBA 4BRIA 3O9UA 1MA9B 4JEPA 1ZBIA 3E66A 1L5UA 4DCHA 4QAGA 4BRFA 4BRMA 3AVJA 2GWKA 3KWIA 4M3XA 4CECA 3V9XA 3ZT3A 4BVOA 1S1WA 1HPMA 3TAPA 2G8UA 4EHTA 4FSVA 3WNGA 2HHWA 3OVNA 3BDPA 5FROA 4JRQA 1YI2N 2F9TA 3TSPA 1C6VA 4DV7K 2XY8A 4YDUC 2YNIA 1IKVA 4FM2A 2V7YA 3QNNA 3ATVA 4PKIA 3THYB 1WLJA 1VQ8N 2QXLA 3EZ5A 1NMNA 1S3XA 2ASPA 3RRGA 4GV3A 1HKBA 2RPIA 3SMSA 3DLBA 5BREA 3KHYA 1N33K 1IV0A 4J2DA 1JLBA 4E3SA 2XY7A 3MEEA 4JK9A 4DTOA 4FW2A 1ATSA 3KTQA 1S5JA 3ID8A 4CJEA 3O08A 4FLVA 1UOCA 3SJHA 1QHAA 1TYQB 3VESA 5AQGA 3ZETB 5BN8A 2DTUA 3G0ZA 3UKUB 3M8QA 1RGIA 2X78A 3CJCA 5CZ1A 3SAFA 4BE1A 2D5RA 1NK5A 3AAQA 4K8XA 1RDBA 2YJFA 4O8KA 1VK0A 3B8AX 4IFVA 4FLXA 4IG0A 4JHDB 2IC3A 1HLUA 1TAQA 4HWIA 3BF3A 5AQHA 2CH5A 4EP4A 2Z1GA 1DTQA 1HKGA 3PSFA 3D6RA 1ASUA 5AQWA 4C8OA 2OCEA 1N34K 4LF6K 3BZCA 4M3TA 4W5NA 5HRNA 3G25A 1VQPN 3BY5A 4E1MA 3LPTA 4FJ9A 3MCPA 3CD6N 1WAFA 1BIZA 4TSXA 4CJFA 2A1SA 3OYCA 1JLQA 4M42A 5GAEP 1FKOA 4OLAA 4CEFA 3SCXA 3K5LA 4IJNA 4LFAK 4M41A 1RCHA 5C42A 3L6QA 1TKXA 2HHQA 4FPAA 4CCHA 3C94A 3CJ9A 4DSJA 2NNWA 2QXFA 3DJCA 2YHAA 2UYTA 4DLGA 1TYQA 3IAYA 5ADXH 3QDKA 2HHTA 4B8CA 2E5LK 2ZM6K 4DG1A 5JVGL 4Z0UA 4CGIA 2ZF5O 4H0XB 1JL1A 4IEEA 2O8FB 4BR5A 2W40A 4I7FA 4BGAA 3NF8A 3ZX3A 3CCEN 3D0PA 1BI4B 3DXMB 3Q7CA 3RMDA 1IBMK 1HKCA 1NK9A 3LP3A 1LCUA 2CGLA 3LDQA 4OVLA 1M1KO 4JD2A 4IXCA 2E1ZA 3R1XA 4N56A 1ASWA 4RG8A 1J54A 4K8ZA 4BREA 2Q36A 4KAZA 1NBWA 1X9JA 3RSEA 1P8ZA 4B3TK 4RW4A 2HHHK 3GE1A 4NCBA 2X74A 4HUEA 4FWKA 1NJXA 4IOCL 3AY9A 4FLWA 1S72N 4Y1DA 4DS4A 1WOQA 1IG9A 1W2BM 4CJTA 3OJUA 3ENHA 3LP0A 1NGHA 2JGUA 4BE7B 3RWUA 3D2EB 5CR4A 1YUWA 3VEOA 1RDDA 5EX5A 3VEWA 4CBUA 3NH2A 3RVCA 4OPHA 4EP5A 3ZSRA 3OJSA 1K9MO 5E41A 4FWOA 4E7KA 3AO1A 2HMPA 2W42A 3AA5X 4H8KA 3T1AA 5KGWA 4CJRA 4CZGA 5AJ3K 4CZLA 1BO5O 3PX0A 3C6UA 1MDUB 3QO9A 3MK6A 1NJYA 3VA0A 3O5BA 4E7IA 3E9PA 2VWKA 2O8DA 3P31A 1FXXA 4JKDA 4H03B 3MCAB 1NNEA 4LC9B 3F9KA 4EAHD 3LAMA 1OH8A 2HOEA 2KQ2A 2WC9A 4KHYA 1JCEA 2G8HA 3IFRA 4CZIA 5DM6L 3VGMA 4O5FA 4DSIA 1D4XA 3PX4A 4JKGA 2NRXA 3R9PA 3KIOA 2A3ZA 4CJSA 3NF6A 3SLCA 1H1VA 5AZIB 1HRHA 5HRSA 4DR1K 4FCYA 3SBGA 3AGKA 3CCJN 3L3UA 3P83D 3Q7BA 3O6WA 1VQ5N 3CMEN 2HNYA 2Q31A 4DV5K 2ZJQL 1WN7A 4CF2A 4K42A 4FVUA 2IAJA 1T8EA 2O8BB 5C0YA 4GVMA 2ZGZA 3DXKA 4AF1A 3NAEA 4CHNA 4FJLA 4FJKA 4DR6K 3ZCMA 2OTJN 1KFSA 1N32K 2A42A 3JAMO 4FOIA 3EE9A 3O1WA 1V4SA 1NU0A 2Q3SA 2P5OA 4DQPA 4FLTA 5AQXA 2GEMA 4DB3A 1IJJA 4B9TA 2HBMA 3G6EN 4IFEA 1NK8A 1Y64A 4DSKA 4B3OA 2QWNA 4FJNA 3SYZA 5KPZA 1BA1A 3VMFB 3CJBA 2QKKA 3KK3A 3M1FA 1HMVA 3MWTA 2DPNA 2XHBA 1C0GA 4JRPA 3DOLA 3CM5A 4M45A 4Z4CA 5AQOA 1RT5A 3OYBA 1GLBG 4X66K 1QQOA 2QWMA 3RR7A 4I9QA 1QSLA 5AQZA 2IDOA 1HX1A 3ZSWA 3A2FA 5AQRA 2D0AA 1CXQA 1JLCA 1S6PA 4CD1A 1HUXA 2Z1IA 1T05A 3LDLA 1SL1A 4FWLA 4BC2A 4CF9A 3LDSA 1M90O 3O9TA 4U67L 1XWLA 4BROA 3S3MA 3HI0A 4WF9L 4CJVA 2Q0UA 3MEGA 3LAKA 1EKEA 3LZJA 3AV9A 2QWPA 1OVYA 4RW8A 4FXDA 4CJ4A 4B08A 3OYAA 1BOTO 4KV8A 4PHTX 2FC0A 5F2RA 4FJJA 2KTQA 1HQEA 1RT3A 4KKOA 1VQ9N 3NGZA 1YJ9N 1K73O 1BU6O 4RW9A 2OANA 5AQLA 1RBVA 2E2NA 2E2QA 1QHTA 5FLXO 5CZ2A 4YDUA 4XEIA 3OYKA 2DFHA 4JKFA 3ASMA 3LZIA 3V1QA 2PFUA 3VQPA 4M63C 5H1SQ 1QVFM 3AVCA 1A5WA 2PY5A 3HRGA 1HPZA 1J5EK 3DWLA 4CJWA 1ILYA 5AQJA 2KKZA 4BECA 3EE8A 5AQSA 2E1YA 3MN9A 5C25A 4YHHK 1QS4A 1RBRA 4I9LA 4HVJA 2UUCK 5CYMA 3CFOA 3RMCA 3I0RA 3WNFA 3R8EA 4DV2K 4LFCK 1MU2A 3QB0A 2KHOA 2Z1JA 1YVUA 3MXMA 4CJKA 3RMBA 4FPBA 3SQ2A 4EHUA 5TKYA 4JLHA 4F9OA 4BACA 3AVGA 5FPMA 3EEQA 4U7BA 1HYVA 5M1KA 3U9DA 3C7NB 4XH1A 4GNIA 4BDPA 4JS5A 2YNHA 1C0MA 4YOVA 4IKFA 3VQ7A 1NK0A 3S5TA 3TSQA 3E9LA 5AQTA 5GAHP 3ZT2A 3QEVA 1E3MA 1QQCA 3VERA 2HBLA 1VSHA 3OHRA 4HTUA 3HP9A 3I55N 2QWRA 3HTVA 4BRDA 3H1VX 3L4IA 3NF7A 1WB9A 1Z25A 4EIAA 1Q86O 4KI6A 3FZKA 5LY3A 4CGHA 4IDKA 1GLCG 4A57A 4AQYK 3H6EA 1BQNA 3THXA 3DMJA 5EVZA 3CCQN 4BE2A 5GAGP 1D5AA 4OLBA 5BRHA 1KD1O 4DUZK 3CF5L 4BR2A 1LW0A 3R3LA 4GMJB 1UWBA 4BRPA 4FLYA 1BQMA 2UXDK 4RCHA 3LDPA 3I33A 4EFHA 3CFRA 4KREA 4B8AB 1I39A 4B3MK 2KW4A 1SS6A 4ID1A 1NGJA 3L2RA 4KH5A 3PY8A 3FR0A 5KQ8A 4CZEA 4O4GA 3NH1A 4C8LA 3AO3A 3VEXA 3QMLA 4CF0A 4DV1K 5JLHA 1NGCA 3CQYA 4KH4A 4IBNA 2F8SA 1NJZA 3C6AA 1RFQA 1Z6RA 1TUYA 2IVOA 4B9VA 3H08A 2UUBK 2AA4A 1WSFA 1L3SA 4FWSA 1VSJA 2GX9A 2I5JA 4WFNL 5J1EA 1S1XA 1YAGA 4IDHA 4RTFD 5DMRA 1RTIA 2WUSA 3L3VA 3VQEA 3ZT0A 4FJMA 1QTMA 4CJPA 3F5TA 3WXIA 5GINA 1XHZA 4B1YB 4CEEA 2VQFK 3JS6A 2NZTA 4JI3K 3VENA 3T19A 3UKRB 4BRLA 3WEEB 3AVFA 1KSPA 4DQSA 2P9SB 4Z4HA 4H5RA 3MDQA 3K58A 3P5JA 3H3NO 3CG7A 1VSFA 4CEZA 1DEJA 2VGNA 3JSMA 5C12A 4DU1A 3CC7N 2W6LA 2LSNA 5HP1A 4J2AA 3QETA 4DTXA 2KZMA 4KFBA 5KRSA 3VEZA 1QSSA 4R79A 5BPMA 4BWMA 2XY5A 3WQTA 2ASMA 2OYQA 1J6ZA 1XNRK 3PSIA 2AP1A 4AHRA 2E6MA 3LP1A 3PO5A 1IH7A 4W5OA 3OTOK 3FZHA 2XY6A 3C95A 2YNGA 3RR8A 3NDKA 3M3ZA 3HSCA 1CZBA 4C1NI 5JMVA 3SV3A 3VPZA 3KLGA 3D2FA 1P90A 3K9JA 4I6MB 4WFAL 2A41A 4X62K 4CIFA 3U4LA 1JXEA 3M6GA 4CEOA 2V51B 3ULEB 4KRFA 1RBTA 2RF2A 5AQPA 3H46O 3W3DA 3OYNA 2WTUA 3UKRA 1TVRA 4ZHRA 4CK2A 4XH5A 1LWEA 4K0KK 4YOUA 5F1XA 3MAQA 2P9SA 4CHQA 2E6LA 1RTDA 2BDPA 4IFYA 1IBLK 3DYAA 4LF9K 1S1UA 1HNIA 1KLNA 4BR0A 5KGXA 4Z4IA 4ICLA 3QINA 4CJUA 4OKEA 4FOEA 2ZE2A 3G10A 4WQ4C 1TK5A 3FFIA 3WQUA 4B9MA 1K6YA 3S41A 1U4BA 5AQMA 2NRZA 4CJ7A 3TAEA 4J2BA 4FLZA 2A6AA 4R5PA 3BP8A 4DU4A 2D0PA 1XQSC 4CE9A 2O4IA 3K9KA 3QEIA 3P4IA 3M5RA 4QCLA 4CGFA 1ZXOA 5AR0A 2RE2A 2XO7A 3NE6A 4DS5A 2O4GA 1UA1A 1ZYQA 1FW6A 4FZYA 5E26A 4EZ6A 4FWQA 4CHYA 4CD3A 4H4OA 4K41A 3HO1A 2E4LA 5HRPA 2BTFA 3TTCA 2QTDA 4LF5K 1VRTA 3THYA 2HHUA 3ULEA 1NK7A 2X6NA 3K5OA 4ELTA 1C0FA 4DQRA 3C65A 3ZX2A 3VEVA 4BQZA 4YY3K 4FK4A 1ZBUA 2R7YA 1U48A 5AQUA 4CF8A 1VQ4N 4Y0WA 2QWOA 3EZWA 1XUPO 1WSGA 1TKTA 4CZMA 3VQQA 4M3YA 1D9DA 2P9IB 2OTLN 5AFUH 1QQNA 3SNNA 5AQFA 4LF7K 3ZETA 3EY1A 2ZWHA 1IBKK 3UKUA 5FDLA 3O8MA 4BG9A 3VQCA 1DGKN 1DT9A 3PV8A 3CI5A 3ZSVA 1VQON 4ELVA 1U47A 4H0TB 3QERA 4KB0A 3NGYA 2BUPA 3OA9A 4JHDA 2YHWA 4L3QA 5C2DA 4UY8O 2JLEA 1Q8IA 1ATNA 1N6QA 3ZSYA 4B3SK 1TAUA 4ELUA 1U6ZA 3HP6A 4DV0K 3HVTA 4FWRA 3J81O 4FYDA 3TAMA 2HB5A 5JS2A 3NVMA 1RTJA 3CXCM 3FZLA 3DRSA 1KAYA 1KC8O 3ZSOA 4FWMA 3U3YA 4MDAA 2Q0RA 4IZ9A 4DFPA 4PL8A 4J2EA 2A1RA 3KD1E 2G8FA 2NRRA 2Z1HA 5AQNA 1BCOA 3EKUA 3WXMB 3SAGA 1EXQA 1SL0A 1KCFA 1L3UA 4KTQA 1W9HA 1T44A 5CE3A 1C1CA 2PZSA 4DUYK 1HNZK 1RT4A 4IJAA 1D9FA 4WQ5C 5FPDA 3P38A 1RTHA 4QS7A 5HRRA 1A5VA 3CERA 2P9IA 5EXWA 3JYTA 4JKBA 3LL3A 4FJXA 4DTJA 5JS1A 3GOIA 3P1GA 1HR0K 2D0BA 2IGIA 4CGJA 4KO0A 3AVAA 3AVLA 1K8AO 1KFDA 3MX2A 3HYFA 3VQAA 4DTUA 3QLHA 4MLEA 3U3GA 3ENOA 3SBTA 1A5XA 3D7EO 2O8FA 1Z26A 4F8RA 2GTDA 2YV0X 3LWLA 1UAXA 1BI4A 3DXMA 4PL7A 5CY4A 3P39A 4GKJK 3OYMA 5I42A 4L8RB 4BDYA 4FJ5A 4BR9A 3DRRA 4AILC 5C15A 5IWAK 3NH0A 4ZTJA 3NVKA 3L4QA 3EYZA 4NXNK 3VQ6A 4DQIA 1T6DA 4Y1CA 1SKWA 4G1QA 4CJQA 3LP2A 1N36K 1Q9XA 4B9LA 3EKSA 3J80O 3IRXA 3AO5A 1SZ2A 1KRPA 3BZKA 4XIUA 5EOYA 3KVGA 1G99A 3CYMA 4GV6A 4CEBA 3O3HA 4GKKK 1SUQA 1IKXA 5GIPA 1SKRA 5M1QA 1NLVA 3D2EA 1RDCA 1IKYA 4AM6A 3CC4N 1DKGD 4JI7K 4AHTA 4DV4K 4DR2K 2DFFA 3M8RA 1SV5A 4CEQA 1NJIO 4DLEA 1NGAA
chains in the Genus database with same CATH topology
2RHKA 2NLXA 3OBWA 3O9QA 3C0BA 4FPBA 4EHUA 4YOXA 5TKYA 1ZBSA 4F9OA 1Z05A 5DM7L 1X3MA 5FPMA 4U7BA 1K8KB 3FGUA 5M1KA 3MN7A 3C7NB 4XH1A 2QWQA 4FL9A 3U9DA 4GNIA 5FPNA 5BRDA 3E9OA 1ATRA 5M1NA 2IVNA 2P9UA 4YOVA 2HBKA 3L0QA 1GLEG 4NLBA 2ZJRL 2IVPA 3TSQA 3E9LA 1RDUA 4WYBA 5AQTA 5GAHP 4BRIA 4GV9A 3O9UA 1MA9B 2NRTA 4BEBA 3VERA 4JEPA 3E66A 4DCHA 2HBLA 3A0IX 1Q82O 4BRFA 3OHRA 3PIPL 2Q97A 4BRMA 4O8UA 3I55N 2I7PA 2GWKA 2YHYA 3KWIA 2QWRA 3HTVA 4BRDA 3FFKB 1O13A 3H1VX 3L4IA 4EIAA 1Q81O 2QWLA 1Q86O 3FZKA 3IMXA 5LY3A 3LM9A 3ZEUB 3QICA 2F9WA 4NLCA 3OW2M 1GLCG 3KWGA 4A5AA 4A57A 4BVOA 1HPMA 3H6EA 5M1FA 4C1NK 4EHTA 5EVZA 4FSVA 3CCQN 5GAGP 1YI2N 5KPTA 2F9TA 5BRHA 3TSPA 4JK8A 4BY9C 2C1GA 1KD1O 3CF5L 4YORA 4BR2A 2ASOA 4YDUC 5CHIA 1KQSM 2GWJA 2V52B 1NGEA 2V7YA 3KZBA 4RWTA 1KXPA 3R3LA 5HL7L 3VTHA 2ZJPL 3OBYA 3ATVA 4PKIA 4H5TA 2F7TA 4A2BA 4Z94A 5AZIA 4JKGB 4BRPA 3VEYA 3PIOL 4RCHA 1VQ8N 1KAXA 3I33A 2GELA 1NGDA 3LDPA 4M7YA 1BUPA 2QXLA 1MWKA 4EFHA 3J7ZO 1S3XA 2PAVA 3HBTA 4IEIA 2ASPA 4MO4A 3SMPA 4GV3A 1HKBA 3DAWA 3A5LC 3SMSA 5BREA 3KHYA 1SS6A 3FZMA 3O9RA 1YJNN 2PBDA 1NGJA 4JK9A 4K25A 3ATUA 4KH5A 1ATSA 3WXKA 3FR0A 3ID8A 1W97L 3O08A 5KQ8A 4IOAL 3G4SN 1NGBA 3GL1A 5AQQA 4CZEA 3SJHA 2ITMA 1QHAA 1TYQB 2HF4A 2V7ZA 3AGRA 1K8KA 3VESA 3I8BA 5AQGA 3ZETB 3ZX0A 5BN8A 3ENBA 5KQDA 3UKUB 3QMLA 3VEXA 1RGIA 3CJCA 5BR9A 3SAFA 5GIOA 3CQXA 4WCEL 4QS9A 3LDOA 3AAQA 5BPNA 4E1JA 2YJFA 5JLHA 1NGCA 4O8KA 1YHQN 3CQYA 3B8AX 3DXKB 2J4RA 4KH4A 3O9SA 4JNEA 3U8XA 4JHDB 1HLUA 1WUAA 4HWIA 3BF3A 5AQHA 2CH5A 3UB5A 3C6AA 1RFQA 1Z6RA 1TUYA 2IVOA 3KK7A 4CZKA 3A8YA 2AA4A 1VQNN 2E88A 4FWSA 1HKGA 1N8RO 2GX9A 3ZEUA 4WFNL 4BRQA 3D6RA 5AQWA 1YAGA 4NB4A 4IDHA 4RTFD 2WUSA 5AQKA 4A5BA 3F5TA 1BA0A 3FE1A 3T69A 3G25A 1VQPN 3WXIA 5GINA 4B1YB 5B8HA 3IKMA 3MCPA 3CD6N 3TPQA 3JS6A 4BRAA 4BG8A 2NZTA 3VENA 4BQLA 4FWPA 4ILJA 3UKRB 4BRLA 4JKEA 3WEEB 1SAZA 2EWSA 1Q18A 4H5VA 5GAEP 1YVNA 3CMAN 1YIJN 1S22A 2P9SB 4IJNA 4PKGA 4H5RA 3MDQA 4WQ4A 3TU5A 5HOOA 4BC5A 5GADP 3L6QA 3H3NO 4ISFA 2FSJA 4JAXA 3TTDA 3CPEA 4FPAA 3GBTA 1NM1A 1DEJA 3CJ9A 2VGNA 4BRCA 2FLOA 2NNWA 3DJCA 4ISGA 1YXQA 5C12A 3CJ1A 4H5WA 3CC7N 2UYTA 1NGFA 1TYQA 4BR4A 4BGBA 4H0OA 5AZJB 4H5NA 3QDKA 5ADXH 5JVGL 2QI2A 1IG8A 2ZF5O 4M7XA 4H0XB 3VEZA 4IEEA 1V4TA 4BR5A 3I56N 2W40A 4R79A 1HJOA 2VYPA 3N4PA 5BPMA 1RDWX 2CH6A 4BGAA 3ZX3A 3CCEN 3WQTA 2ASMA 1J6ZA 2D1KA 3T7ZA 4BVPA 3DXMB 3Q7CA 5AQIA 1XC3A 3G71N 2AP1A 3U9ZA 2P9PB 1HKCA 1LCUA 2CGLA 3LDQA 1VQKN 1M1KO 4JD2A 4IXCA 1T6CA 2E1ZA 3FZHA 3R1XA 2WFBA 3WT0A 2P9LB 3PLAA 4NO7A 2BH1A 3QBXA 3M3ZA 3HSCA 4BREA 2Q36A 3F9MA 4C1NI 5JMVA 1NBWA 3VPZA 1X9JA 3D2FA 5BPLA 3RSEA 1P90A 1P8ZA 3K9JA 3HOTA 4I6MB 3JXUA 1NMDA 4B1UB 5LJWA 4WFAL 2A41A 2YX6A 4FO0A 3GE1A 3H1QA 3U4LA 2QM1A 4B1ZA 2CGKA 3M6GA 4FWKA 3VOVA 2V51B 3W0LA 4OPAA 3ULEB 4IOCL 3AY9A 3H45C 1S72N 5BN9A 5AQPA 1NGIA 2HBJA 3H46O 3W3DA 2Q1NA 3UKRA 1WOQA 3VF6A 2QW9A 5F0XA 4XH5A 1W2BM 4IO8A 4ISEA 3VTIA 3HOSA 3DLLL 3AAPA 3ENHA 4YOUA 5F1XA 1NGHA 2P9SA 4YOTA 3CC2N 4BE7B 4B9QA 3D2EB 5AQVA 3VGLA 5CR4A 1MWMA 5ADXA 1YUWA 3VEOA 4BR0A 2E2PA 5EX5A 2HF3A 3C7NA 3VEWA 4CBUA 3RVCA 4OPHA 1K9MO 4FOEA 2KLAA 3MN6A 4WQ4C 2QA4N 2GUPA 4FWOA 3WQUA 4ILGB 3S41A 2HMPA 4JKCA 5LJVA 5AQMA 2NRZA 4CJ7A 4CZGA 2A6AA 1YITN 2P9UB 2CGJA 1BO5O 4CZLA 3BP8A 4A62A 4CBXA 2D0PA 1GLAG 1MDUB 5BRFA 1XQSC 3MK6A 2P9PA 3K9KA 5TKWA 3P4IA 4BRNA 4KH6A 3O5BA 2H3GX 3M5RA 1YJWN 3E9PA 2E8AA 4H0PA 5E84A 1ZXOA 2A40A 3FZFA 2RE2A 3CJAA 4PKHA 5AR0A 3P31A 2I7NA 1Q7YO 4JKDA 1QQMA 4H03B 3GDQA 3MCAB 5I9EB 2NRVA 4LC9B 5ELZA 3VF4A 4BRGA 3F2KA 5E26A 4EAHD 4WFBL 4FWQA 1T3VA 2HOEA 2WC9A 1JCEA 4CD3A 3IFRA 4K41A 4CZIA 2BTFA 2NRWA 3TTCA 2QTDA 5DM6L 4KBOA 3VGMA 1NGGA 4O5FA 4WQ5A 4CZHA 1D4XA 4JK7A 1U2VB 4JKGA 3ULEA 4MLHA 2NRXA 4CBWA 3HZ6A 3H3OB 3IUCA 4BC4A 4AM7A 3R9PA 1GLLO 3QFPA 1C0FA 3MX5A 3UE5A 2A3ZA 3BEXA 3C65A 3ZX2A 4H0YB 3VEVA 4BQZA 1E4GT 2JWKA 3CPWM 3SLCA 1H1VA 2YCHA 3LM2A 1GLFO 1VAZA 5AQUA 1VQ4N 4Y0WA 2QWOA 3EZWA 1XUPO 5AZIB 1ESVA 4CZMA 3SBGA 4B1XB 3AGKA 2P9IB 4BR7A 3CCJN 2OTLN 4JN4A 5AFUH 3O80A 4QS8A 2HSTA 4OO1J 1QQNA 3Q7BA 1GLDG 3O6WA 5AQFA 1VQ5N 3ZETA 3CMEN 3EN9A 2Q31A 2FSKA 2ZWHA 2ZJQL 3CCSN 1QVGM 2D0OA 2D4WA 4K42A 3UKUA 5C10A 4FVUA 3O8MA 2VWBA 3TSUA 4BG9A 1DGKN 3CJ7A 4FWNA 3SAHA 1EQYA 1SQKA 1DT9A 4XJXA 3CI5A 3CETA 3CCRN 3O1BA 1VQON 2W00A 1CZAN 5C0YA 4H0TB 2P9NB 2JWLA 2ZGZA 3DXKA 2BUPA 3OA9A 2QEXN 4AF1A 3VETA 4JHDA 2YHWA 4L3QA 5C2DA 4UY8O 2OTJN 4B1WB 2IIRA 1ATNA 2A5XA 2A42A 4FOIA 1U6ZA 2YJEA 5M1OA 3EE9A 3O1WA 1V4SA 3O4WA 4FWRA 4MDBA 4BRHA 1X3NA 5AQXA 1NWKA 2P9KB 4H0VB 3MN5A 3WUHA 3MMVA 4IOXA 2GEMA 3IDHA 3NVMA 4DB3A 5FPEA 1IJJA 1KAZA 3A5NC 3TTFA 5JICA 2HBMA 3G6EN 3EO3A 4IFEA 5EY4A 1Y64A 1JCFA 2QWNA 3CXCM 2VCPA 3FZLA 5KPZA 1BA1A 3VMFB 3CJBA 1KAYA 5MLCQ 1KC8O 3M1FA 3SK3A 2ZGYA 4FWMA 3MWTA 3WXLA 2DPNA 1C0GA 4MDAA 2Q0RA 1BG3A 2FXUA 4BRKA 4IZ9A 4PL8A 1QZ6A 2Q2RA 3CCLN 2C1IA 1BWFO 2WBNA 2NRRA 2NRHA 4GY2B 1OKJA 1GLBG 5AQOA 3WEEA 1QQOA 4YOYA 2QWMA 5AQNA 3QBWA 1U2VA 3EKUA 5AQZA 3WXMB 3SAGA 3N4QA 1HX1A 1E4FT 3ZYYX 5AFUA 5AQRA 5AQYA 1ZC6A 1JCGA 2YI1A 2VGMA 1T44A 5M1PA 5CE3A 4CD1A 4CZFA 1HUXA 3LDLA 2E2OA 4FWLA 4A2AA 2E20A 4BC2A 1M90O 4IJAA 3O9TA 4BC3A 4DQ8A 3A5MC 4WQ5C 3WXJA 3BF1A 5FPDA 3P38A 4U67L 5JVHL 4QS7A 3VGKA 3CERA 5C2FA 1QZ5A 3BUZB 2P9IA 5EXWA 4BROA 3HI0A 4JKBA 3LL3A 4MO5A 4WF9L 2Q0UA 3GOIA 2W41A 1VQ6N 5AZJA 1K8AO 3E1YA 3MWPA 3MX2A 4MLEA 2QWPA 1OVYA 3ENOA 3SBTA 3D7EO 4DKWA 3CIPA 3FLCO 4A59A 3NMUA 4JKHA 3J8AA 2GTDA 1VQLN 2P9NA 3A5OC 4GVEA 1BOTO 3DXMA 4PL7A 4PHTX 3CCUN 4XH4A 3P39A 4B1VA 5F2RA 4IWVA 2FSNA 2P9LA 1VQ9N 4BR9A 1YJ9N 1K73O 1BU6O 3EL2A 2P9KA 1VQMN 2OANA 1BDGA 1GLJO 5AQLA 5C15A 2YHXA 2E2NA 3NVKA 3R6MA 2E2QA 3L4QA 3AARA 3GG4A 4I6MA 1T6DA 3VF2A 4ILHA 4YDUA 1EO1A 4XEIA 4JD2B 1TUUA 4JKFA 4J8FA 1LOTB 3CCMN 2PFUA 3EKSA 4M63C 5H1SQ 1QVFM 3QFUA 3ID6A 5KPRA 1VQ7N 4DHYA 4CZJA 3HRGA 1SZ2A 3DWLA 3CHWA 1ILYA 3D2FB 5AQJA 2KKZA 1G99A 3EE8A 3KVGA 2E1YA 3MN9A 5EOYA 5AQSA 3RSEB 1JJ2M 4BECA 4GV6A 2FF6A 3LDNA 3C6HA 5JLFA 4C23A 5GIPA 4HTLA 4JKAA 4K43A 5M1QA 2FF3B 1NLVA 3D2EA 1YF5L 4AM6A 3R8EA 4G9ZA 4A61A 3CC4N 1DKGD 4CI6A 3QB0A 2KHOA 4IO9L 1R59O 3CCVN 1NJIO 4YOWA 3HM8A 1NGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NLX A;  3C0B A;  4FPB A;  4EHU A;  5TKY A;  1ZBS A;  4F9O A;  1Z05 A;  1X3M A;  5FPM A;  1K8K B;  3FGU A;  3MN7 A;  3C7N B;  4XH1 A;  2QWQ A;  4FL9 A;  3U9D A;  4GNI A;  5FPN A;  5BRD A;  1ATR A;  2IVN A;  2P9U A;  3L0Q A;  1GLE G;  2IVP A;  4WYB A;  5AQT A;  4BRI A;  1MA9 B;  3VER A;  4DCH A;  3A0I X;  4BRF A;  3OHR A;  2Q97 A;  4BRM A;  2I7P A;  2GWK A;  2YHY A;  2QWR A;  3HTV A;  4BRD A;  3FFK B;  3H1V X;  3L4I A;  4EIA A;  2QWL A;  3FZK A;  3IMX A;  5LY3 A;  3LM9 A;  3ZEU B;  3QIC A;  2F9W A;  1GLC G;  4BVO A;  1HPM A;  3H6E A;  4EHT A;  5EVZ A;  4FSV A;  5KPT A;  2F9T A;  5BRH A;  4BR2 A;  2ASO A;  4YDU C;  2GWJ A;  2V52 B;  1NGE A;  2V7Y A;  3KZB A;  4RWT A;  1KXP A;  3ATV A;  4PKI A;  4H5T A;  4A2B A;  4Z94 A;  5AZI A;  4BRP A;  3VEY A;  4RCH A;  1KAX A;  3I33 A;  2GEL A;  1NGD A;  3LDP A;  4M7Y A;  1BUP A;  2QXL A;  1MWK A;  4EFH A;  1S3X A;  2PAV A;  3HBT A;  3SMP A;  2ASP A;  4MO4 A;  1HKB A;  3DAW A;  3A5L C;  3SMS A;  5BRE A;  3KHY A;  3FZM A;  2PBD A;  1NGJ A;  4K25 A;  3ATU A;  1ATS A;  3WXK A;  3FR0 A;  3ID8 A;  3O08 A;  5KQ8 A;  1NGB A;  3GL1 A;  5AQQ A;  4CZE A;  3SJH A;  2ITM A;  1QHA A;  1TYQ B;  2HF4 A;  2V7Z A;  3VES A;  1K8K A;  3ZX0 A;  3I8B A;  5AQG A;  3ZET B;  5BN8 A;  5KQD A;  3UKU B;  3QML A;  3VEX A;  1RGI A;  3CJC A;  5BR9 A;  3CQX A;  4QS9 A;  3LDO A;  3AAQ A;  5BPN A;  4E1J A;  2YJF A;  5JLH A;  1NGC A;  4O8K A;  3CQY A;  3B8A X;  3DXK B;  2J4R A;  4JNE A;  3U8X A;  4JHD B;  1HLU A;  1WUA A;  4HWI A;  3BF3 A;  5AQH A;  2CH5 A;  3UB5 A;  1RFQ A;  1Z6R A;  1TUY A;  2IVO A;  4CZK A;  3A8Y A;  2AA4 A;  2E88 A;  4FWS A;  1HKG A;  3ZEU A;  4BRQ A;  5AQW A;  1YAG A;  4NB4 A;  4RTF D;  2WUS A;  5AQK A;  1BA0 A;  3FE1 A;  3G25 A;  3WXI A;  4B1Y B;  5B8H A;  3MCP A;  3TPQ A;  3JS6 A;  4BRA A;  4BG8 A;  2NZT A;  3VEN A;  4BQL A;  4FWP A;  3UKR B;  4BRL A;  3WEE B;  1SAZ A;  2EWS A;  1Q18 A;  4H5V A;  1YVN A;  1S22 A;  2P9S B;  4IJN A;  4PKG A;  4H5R A;  3MDQ A;  4WQ4 A;  3TU5 A;  4BC5 A;  3L6Q A;  3H3N O;  4ISF A;  2FSJ A;  4JAX A;  4FPA A;  3GBT A;  1NM1 A;  1DEJ A;  3CJ9 A;  4BRC A;  2FLO A;  3DJC A;  4ISG A;  1YXQ A;  3CJ1 A;  4H5W A;  2UYT A;  1NGF A;  1TYQ A;  4BR4 A;  4BGB A;  4H0O A;  5AZJ B;  4H5N A;  3QDK A;  5ADX H;  1IG8 A;  2ZF5 O;  4M7X A;  4H0X B;  3VEZ A;  1V4T A;  4BR5 A;  2W40 A;  1HJO A;  2VYP A;  5BPM A;  1RDW X;  2CH6 A;  4BGA A;  3ZX3 A;  3WQT A;  2ASM A;  1J6Z A;  2D1K A;  4BVP A;  3DXM B;  5AQI A;  1XC3 A;  2AP1 A;  3U9Z A;  2P9P B;  1HKC A;  1LCU A;  2CGL A;  3LDQ A;  4JD2 A;  4IXC A;  1T6C A;  2E1Z A;  3FZH A;  3WT0 A;  2P9L B;  4NO7 A;  3QBX A;  3M3Z A;  3HSC A;  4BRE A;  2Q36 A;  3F9M A;  5JMV A;  1NBW A;  3VPZ A;  1X9J A;  3D2F A;  5BPL A;  3RSE A;  1P8Z A;  4I6M B;  3JXU A;  1NMD A;  4B1U B;  5LJW A;  2A41 A;  4FO0 A;  3GE1 A;  3H1Q A;  3U4L A;  2QM1 A;  4B1Z A;  2CGK A;  3M6G A;  4FWK A;  3VOV A;  2V51 B;  3W0L A;  3ULE B;  3AY9 A;  3H45 C;  5BN9 A;  5AQP A;  1NGI A;  3H46 O;  3W3D A;  2Q1N A;  3UKR A;  1WOQ A;  3VF6 A;  2QW9 A;  5F0X A;  4XH5 A;  4IO8 A;  4ISE A;  3AAP A;  3ENH A;  5F1X A;  1NGH A;  2P9S A;  4B9Q A;  3D2E B;  5AQV A;  3VGL A;  5ADX A;  1MWM A;  1YUW A;  3VEO A;  4BR0 A;  2E2P A;  5EX5 A;  2HF3 A;  3C7N A;  3VEW A;  4CBU A;  4FOE A;  3MN6 A;  4WQ4 C;  2GUP A;  4FWO A;  3WQU A;  3S41 A;  2HMP A;  5LJV A;  5AQM A;  4CJ7 A;  4CZG A;  2A6A A;  2P9U B;  2CGJ A;  1BO5 O;  4CZL A;  3BP8 A;  4A62 A;  4CBX A;  2D0P A;  1GLA G;  1MDU B;  5BRF A;  1XQS C;  3MK6 A;  2P9P A;  3P4I A;  4BRN A;  3O5B A;  2H3G X;  2E8A A;  4H0P A;  5E84 A;  1ZXO A;  2A40 A;  3FZF A;  4PKH A;  3CJA A;  5AR0 A;  2I7N A;  1QQM A;  4H03 B;  3GDQ A;  5I9E B;  4LC9 B;  5ELZ A;  3VF4 A;  4BRG A;  5E26 A;  4EAH D;  4FWQ A;  2HOE A;  1JCE A;  4CD3 A;  3IFR A;  4K41 A;  4CZI A;  2BTF A;  4KBO A;  3VGM A;  1NGG A;  4O5F A;  4WQ5 A;  4CZH A;  1D4X A;  1U2V B;  3ULE A;  4MLH A;  4CBW A;  3HZ6 A;  3H3O B;  3IUC A;  4BC4 A;  4AM7 A;  3R9P A;  1GLL O;  3QFP A;  1C0F A;  3UE5 A;  2A3Z A;  3BEX A;  3ZX2 A;  4H0Y B;  3VEV A;  4BQZ A;  1E4G T;  3SLC A;  1H1V A;  2YCH A;  3LM2 A;  1GLF O;  5AQU A;  4Y0W A;  2QWO A;  3EZW A;  1XUP O;  5AZI B;  1ESV A;  4CZM A;  4B1X B;  4BR7 A;  2P9I B;  4JN4 A;  5AFU H;  3O80 A;  4QS8 A;  1QQN A;  1GLD G;  3O6W A;  5AQF A;  3ZET A;  3EN9 A;  2Q31 A;  2FSK A;  2ZWH A;  2D0O A;  2D4W A;  4K42 A;  3UKU A;  3O8M A;  2VWB A;  4BG9 A;  1DGK N;  3CJ7 A;  4FWN A;  1EQY A;  1SQK A;  3CI5 A;  3CET A;  3O1B A;  1CZA N;  4H0T B;  2P9N B;  2ZGZ A;  3DXK A;  2BUP A;  3VET A;  4JHD A;  2YHW A;  4L3Q A;  4B1W B;  2IIR A;  1ATN A;  2A5X A;  2A42 A;  4FOI A;  1U6Z A;  2YJE A;  4BRH A;  3O1W A;  1V4S A;  3O4W A;  4FWR A;  1X3N A;  5AQX A;  1NWK A;  2P9K B;  4H0V B;  3MN5 A;  3WUH A;  3MMV A;  2GEM A;  3IDH A;  4DB3 A;  5FPE A;  1IJJ A;  1KAZ A;  3A5N C;  5JIC A;  3EO3 A;  5EY4 A;  1Y64 A;  1JCF A;  2QWN A;  2VCP A;  3FZL A;  5KPZ A;  1BA1 A;  3CJB A;  1KAY A;  3M1F A;  3SK3 A;  2ZGY A;  4FWM A;  3WXL A;  2DPN A;  1C0G A;  2Q0R A;  1BG3 A;  2FXU A;  4BRK A;  4IZ9 A;  4PL8 A;  1QZ6 A;  2Q2R A;  1BWF O;  4GY2 B;  5AQO A;  2NRH A;  1OKJ A;  1GLB G;  3WEE A;  1QQO A;  2QWM A;  5AQN A;  3QBW A;  1U2V A;  3EKU A;  5AQZ A;  1HX1 A;  1E4F T;  5AFU A;  5AQR A;  5AQY A;  1ZC6 A;  1JCG A;  2YI1 A;  1T44 A;  5CE3 A;  4CD1 A;  4CZF A;  1HUX A;  3LDL A;  2E2O A;  4FWL A;  4A2A A;  2E20 A;  4BC2 A;  4IJA A;  4BC3 A;  4DQ8 A;  3A5M C;  4WQ5 C;  3WXJ A;  3BF1 A;  5FPD A;  4QS7 A;  3VGK A;  3CER A;  1QZ5 A;  3BUZ B;  2P9I A;  5EXW A;  4BRO A;  3HI0 A;  3LL3 A;  4MO5 A;  2Q0U A;  3GOI A;  2W41 A;  5AZJ A;  4MLE A;  2QWP A;  3ENO A;  3D7E O;  3CIP A;  3FLC O;  3J8A A;  2GTD A;  2P9N A;  3A5O C;  1BOT O;  3DXM A;  4PL7 A;  4XH4 A;  4B1V A;  5F2R A;  4IWV A;  2FSN A;  2P9L A;  4BR9 A;  1BU6 O;  3EL2 A;  2P9K A;  2OAN A;  1BDG A;  1GLJ O;  5AQL A;  2YHX A;  2E2N A;  3R6M A;  2E2Q A;  3AAR A;  3GG4 A;  4I6M A;  1T6D A;  3VF2 A;  4YDU A;  4XEI A;  4JD2 B;  1TUU A;  4J8F A;  1LOT B;  3EKS A;  4M63 C;  3QFU A;  5KPR A;  4DHY A;  4CZJ A;  1SZ2 A;  3DWL A;  3CHW A;  3D2F B;  5AQJ A;  3KVG A;  1G99 A;  5EOY A;  5AQS A;  2E1Y A;  3MN9 A;  3RSE B;  2FF6 A;  3LDN A;  5JLF A;  4C23 A;  4HTL A;  4K43 A;  2FF3 B;  1NLV A;  3D2E A;  4AM6 A;  3R8E A;  4A61 A;  1DKG D;  4CI6 A;  3QB0 A;  2KHO A;  1R59 O;  3HM8 A;  1NGA A; 
#chains in the Genus database with same CATH topology
 2RHK A;  2Y1I A;  1I94 K;  1X3M A;  1K8K B;  3K5N A;  2QWQ A;  5M1N A;  3TAF A;  1VSE A;  3L0Q A;  4AHS A;  2ZJR L;  2UXC K;  3HPH A;  4GV9 A;  4DR4 K;  4BEB A;  3OYJ A;  1NJW A;  1Q82 O;  3PIP L;  4B3R K;  2G8I A;  4JYA K;  4O8U A;  3J7A P;  2YHY A;  4CES A;  3FFK B;  1O13 A;  1ASV A;  2X6S A;  1Q81 O;  2QWL A;  3AVI A;  3IMX A;  1KVB A;  3ZEU B;  4MQ3 A;  3QIC A;  4NLC A;  3KK1 A;  4A5A A;  5M1F A;  4N5S A;  4CGD A;  4FLU A;  3KD5 E;  4W5Q A;  4DWI A;  4CER A;  4CED A;  2VWJ A;  3OYH A;  4BY9 C;  4PQU A;  4YOR A;  2ASO A;  1KQS M;  2GWJ A;  2V52 B;  1NGE A;  5HL7 L;  2ZJP L;  3HXM A;  5J2Q A;  3SPZ A;  1NOZ A;  4H5T A;  4A2B A;  4Z94 A;  4DTM A;  5AZI A;  3VEY A;  2O8C B;  2GEL A;  3AO4 A;  1MWK A;  2PAV A;  3HBT A;  3SMP A;  4MO4 A;  1U45 A;  4FK0 A;  3L8B A;  5KTQ A;  3DAW A;  1JLE A;  4O5B A;  3AVM A;  3SQ4 A;  3T1Y K;  3LPU A;  3O9R A;  1YJN N;  3TAG A;  2PBD A;  4K25 A;  4CVN E;  1VSL A;  3VQD A;  5A2Q O;  4IOA L;  3G4S N;  1N5Y A;  2O8B A;  1NGB A;  3GL1 A;  5AQQ A;  3AGR A;  4F4K A;  1K8K A;  4Q0B A;  5KQD A;  2OZS A;  5GIO A;  3QEP A;  4WCE L;  4QS9 A;  3LDO A;  4N47 A;  5BPN A;  3BGR A;  1OVQ A;  1HNW K;  4MFB A;  4B9S A;  3QEW A;  4EZ9 A;  4Z4E A;  1YHQ N;  4JI1 K;  4PWD A;  1HJR A;  1NOY A;  1FJG K;  2J4R A;  4FZX C;  3U8X A;  1HNX K;  1C0U A;  3TI0 A;  1WUA A;  3S9H A;  4F2S A;  4C8K A;  3U6F A;  3S3O A;  5J2M A;  4CZK A;  2B4J A;  2E88 A;  1N8R O;  3ZEU A;  5BR8 K;  4BRQ A;  4E0D A;  4NB4 A;  4KHN A;  5HRO A;  4A5B A;  4FJ8 A;  2YHB A;  4KHU A;  3LAL A;  2HW3 A;  1BA0 A;  3FE1 A;  3S3N A;  3DOK A;  3NFA A;  2AJQ A;  2ZD1 A;  1RT2 A;  3V9S A;  3TPQ A;  3TR8 A;  4KHW A;  3OY9 A;  1J9A A;  4BQL A;  4FWP A;  4ILJ A;  1NK4 A;  1TL3 A;  2EWS A;  3PUF A;  1WSH A;  4E1N A;  4KHS A;  1Q18 A;  4H5V A;  3CMA N;  1YVN A;  1YIJ N;  2YKN A;  4PKG A;  4WQ4 A;  1G15 A;  4BC5 A;  4DR3 K;  2W6K A;  1X9S A;  1W7A A;  3TTD A;  3CPE A;  3GBT A;  1NM1 A;  1R0A A;  5HLF A;  4FM1 A;  2UUA K;  3SJJ A;  2FLO A;  5J2N A;  3ZT1 A;  1NGF A;  1S6Q A;  3AVB A;  3KK2 A;  3ISN C;  4BR4 A;  4H0O A;  4NCG A;  5AZJ B;  3O3F A;  3M8P A;  2QI2 A;  3RMA A;  5SZT A;  1V4T A;  3I56 N;  1HJO A;  2WON A;  3N4P A;  1RDW X;  4FW1 A;  3DI6 A;  4PA1 A;  2D1K A;  3T7Z A;  3NF9 A;  3OYF A;  1X9W A;  5AQI A;  3G71 N;  3U9Z A;  5CYQ A;  3TAR A;  1EET A;  4JV5 K;  1VQK N;  1T6C A;  4LH4 A;  2WFB A;  3WT0 A;  2P9L B;  4OGC A;  3PLA A;  2ATQ A;  4NO7 A;  3VA3 A;  3QBX A;  4M3Z A;  3F9M A;  5BPL A;  4X64 K;  3HOT A;  5LJW A;  3JXU A;  1NMD A;  3CYG A;  4FO0 A;  2YX6 A;  3D45 A;  2OA8 A;  1VSD A;  1O1W A;  2CGK A;  4JI2 K;  1TK0 A;  3VOV A;  2HHX A;  4OPA A;  2GUI A;  3H45 C;  5BN9 A;  2HBJ A;  4V19 S;  1S1V A;  2Q1N A;  3VF6 A;  2QW9 A;  2GBZ A;  4ISE A;  3VQB A;  1ITG A;  1HQU A;  3V6D A;  1BIU A;  4YOT A;  4B9Q A;  2O8E B;  3VGL A;  5ADX A;  3SPY A;  4FM0 A;  3SV4 A;  1DLO A;  1VHX A;  2HF3 A;  3C7N A;  4LH5 A;  3RTV A;  2G8K A;  2GUP A;  1F21 A;  4W5R A;  5LJV A;  3VQ8 A;  1ZBL A;  1HYZ A;  2P9U B;  2CGJ A;  4Z4F A;  4A62 A;  3M8S A;  4CBX A;  1GLA G;  1X9M A;  5BRF A;  4AH9 A;  5IT9 O;  4FJ7 A;  4KI4 A;  5TKW A;  3ZLJ A;  4KH6 A;  2BE2 A;  1YJW N;  2E8A A;  4H0P A;  2A40 A;  3FZF A;  4PKH A;  3O4Q A;  2I7N A;  1B9F A;  1BL3 A;  1KVC A;  3GDQ A;  4OPJ A;  2NRV A;  3VF4 A;  3B6O A;  4OJR A;  1QE1 A;  4W5T A;  2NRW A;  4KBO A;  1NGG A;  1RT1 A;  4WQ5 A;  1UA0 A;  4MLH A;  4CBW A;  2KFN A;  1VSK A;  4BC4 A;  4AM7 A;  2F8T A;  3QFP A;  3UE5 A;  3HVR A;  4CFB A;  3L2U A;  4H0Y B;  1GOB A;  5DK5 A;  4DSE A;  3LM2 A;  3LAN A;  2FBT A;  1ESV A;  4B1X B;  4OO1 J;  4DFJ A;  4OGE A;  1WSI A;  2HST A;  4QS8 A;  3EN9 A;  3CCS N;  3I8D A;  4CFD A;  3QNO A;  2RN2 A;  5C10 A;  1XHX A;  3VQ9 A;  3K57 A;  3CJ7 A;  1EQY A;  1TKD A;  1SQK A;  4XJX A;  1OH6 A;  3CET A;  2IOC A;  3RRH A;  3UIQ A;  4PY5 A;  1S1T A;  1RNH A;  1LW2 A;  4QOZ B;  1BIS A;  2JWL A;  1XI1 A;  1OH7 A;  2QEX N;  4CFA A;  1REV A;  2HHV A;  3VET A;  4B1W B;  3IG1 A;  2A5X A;  4HUG A;  1WBD A;  5M1O A;  4MDB A;  4BRH A;  1X3N A;  4CHZ A;  1NKC A;  1JKH A;  2P9K B;  3MMV A;  4IOX A;  5J2P A;  5FPE A;  1TK8 A;  3SZ2 A;  3TTF A;  5JIC A;  3EO3 A;  5EY4 A;  1X1P A;  3DLR A;  1NK6 A;  3DRP A;  3SQ0 A;  2ZGY A;  4FJH A;  3WXL A;  1BG3 A;  2FXU A;  4BRK A;  3DLE A;  1QZ6 A;  1BWF O;  4HUF A;  4BE0 A;  3WEE A;  4YOY A;  3OS0 A;  2HMI A;  1E4F T;  3QIO A;  2YI1 A;  3V9U A;  1GOA A;  3I0S A;  1TV6 A;  3DLG A;  2E2O A;  4A2A A;  3KLF A;  4BC3 A;  3A5M C;  3DLH A;  5JVH L;  5LL6 Z;  4DFK A;  5C2F A;  3V9W A;  2HHS A;  4YNQ A;  2W41 A;  4O44 A;  3E1Y A;  4AHV A;  1RBS A;  1S9G A;  3KJV A;  2HND A;  4CJL A;  4DKW A;  5LMU K;  1W0H A;  3FLC O;  4A59 A;  3OYE A;  4JKH A;  3J8A A;  1VQL N;  3A5O C;  3HK2 A;  4O0J A;  3T1H K;  3CM6 A;  4CIE A;  4H4M A;  3AVH A;  3O4N A;  3CCU N;  4CFC A;  4XH4 A;  3V1O A;  3V4I A;  3LWM A;  1RIL A;  2DY4 A;  4E89 A;  3EL2 A;  2P9K A;  1VQM N;  1BDG A;  2VG7 A;  3AAR A;  3GG4 A;  2HVH A;  4I6M A;  3VF2 A;  4DMN A;  4ILH A;  1L3T A;  1EO1 A;  4JD2 B;  1TUU A;  3CCM N;  1LOT B;  1JXB A;  2QK9 A;  3QFU A;  3TAN A;  5KPR A;  1VQ7 N;  4DHY A;  1TL1 A;  4RW6 A;  2BAN A;  4YFU A;  2F96 A;  3CHW A;  3RSE B;  5C24 A;  1JJ2 M;  4CF1 A;  2FF6 A;  1IKW A;  4BDZ A;  3C6H A;  4C23 A;  2NUB A;  4HTL A;  5SWM A;  2RKI A;  4JKA A;  4FJG A;  4K43 A;  1WSE A;  4CHO A;  2FF3 B;  1YF5 L;  3MEC A;  3SI6 A;  4HCB A;  4A61 A;  4G9Z A;  3KKR A;  4CI6 A;  2G8W A;  1R59 O;  1Y97 A;  4YOW A;  3HM8 A;  3TWH A;  2OPS A;  3ULD A;  3O9Q A;  3C0B A;  4YOX A;  4PUO A;  3K2P A;  3WNH A;  4KHP K;  3MN7 A;  4FVM A;  5FPN A;  5BRD A;  3PX6 A;  3AVK A;  1YTU A;  1ATR A;  4I2P A;  4OPK A;  3NHG A;  1L3V A;  3AA3 A;  2IVP A;  4Q5V A;  4WYB A;  1RDU A;  3T3F A;  4I2Q A;  4DR5 K;  2NRT A;  1CXU A;  2EX3 A;  5EU7 A;  4DF4 A;  3V81 A;  3A0I X;  2Q97 A;  1U04 A;  2I7P A;  4C8M A;  1SKS A;  3LM9 A;  3VQ4 A;  2F9W A;  3OW2 M;  3KWG A;  1FKP A;  2O8D B;  4C1N K;  1S9E A;  1KTQ A;  3V9Z A;  2HNZ A;  2BGG A;  3OYI A;  5KPT A;  3WNE A;  4JK8 A;  3SUQ A;  2C1G A;  3O3G A;  4N76 A;  3K5M A;  5CHI A;  4F3O A;  2HHI A;  4RWT A;  3KZB A;  1KXP A;  3VTH A;  3OBY A;  1ZBH A;  2F7T A;  3THV A;  3K0S A;  3CFP A;  4NYN A;  4JKG B;  3ZSZ A;  3PIO L;  1KAX A;  2FBX A;  3L2W A;  1NGD A;  4M7Y A;  1BUP A;  1J53 A;  3J7Z O;  4IEI A;  1OH5 A;  2FBV A;  3A5L C;  3QEX A;  4DF8 A;  5I3U A;  3FZM A;  1T03 A;  3ATU A;  3WXK A;  4E7H A;  1SL2 A;  1W97 L;  3NGI A;  2ITM A;  2HF4 A;  2V7Z A;  3ZX0 A;  3I8B A;  1EWR A;  3ENB A;  4E7L A;  5BR9 A;  1ZBF A;  2PYL A;  3ITH A;  3CQX A;  2OZM A;  4CEA A;  4E1J A;  2G8V A;  1C0T A;  3QIP A;  3HPO A;  3DXK B;  3O9S A;  4JNE A;  1XMO K;  3UB5 A;  4Z4G A;  3KK7 A;  5KI6 A;  3A8Y A;  1XMQ K;  1VQN N;  2OPR A;  4LSL A;  1LWC A;  4N41 A;  4OKK A;  4DV3 K;  5AQK A;  2IS3 A;  4C8N A;  4KTW A;  3T69 A;  3HPG A;  5B8H A;  3IKM A;  4ID5 A;  3NCI A;  3KLE A;  1NKE A;  4BRA A;  4BG8 A;  1IO2 A;  3SUN A;  4CIG A;  1VSM A;  4JKE A;  1SAZ A;  3PO4 A;  1DTT A;  1S22 A;  2P51 A;  4KB1 A;  3TU5 A;  5HOO A;  5GAD P;  4ISF A;  4DV6 K;  2FSJ A;  3NBP A;  4JAX A;  4DU3 A;  3AA2 A;  4BRC A;  4ISG A;  4WE1 A;  1YXQ A;  3CJ1 A;  4H5W A;  4KHQ A;  4F2R A;  2GV9 A;  1WAJ A;  2PYJ A;  4BGB A;  3HT3 A;  1EP4 A;  4H5N A;  1LWF A;  4DTR A;  1IG8 A;  4M7X A;  1C1B A;  2VQE K;  1BGX T;  4CGG A;  2DFE A;  1LAV A;  4E7J A;  2VYP A;  2CH6 A;  4JI4 K;  4AHU A;  3HJF A;  4CJ5 A;  4BVP A;  2YNF A;  4NYF A;  4DR7 K;  2VG6 A;  3IS9 A;  4KPY A;  1XC3 A;  2P9P B;  3E01 A;  1BCM A;  1B92 A;  4JI5 K;  3SQ1 A;  4JI8 K;  3HST B;  1C1A A;  3L2Q A;  2BH1 A;  3L2V A;  5HBM A;  1D8Y A;  4B1U B;  2OPQ A;  4B9U A;  1WBB A;  1RT7 A;  3H1Q A;  2QM1 A;  3AA4 A;  4B1Z A;  3OS2 A;  2P5G A;  5LMN K;  4NXM K;  3W0L A;  4X65 K;  1NGI A;  3OS1 A;  3ALY A;  5F0X A;  4IO8 A;  3VTI A;  4LF8 K;  3HOS A;  3DLL L;  3AAP A;  3CC2 N;  1RBU A;  4CW7 B;  5AQV A;  1MWM A;  2XRI A;  4DSL A;  3MXI A;  1NKB A;  2UXB K;  2E2P A;  1JLF A;  3ZSQ A;  1VSI A;  1CLQ A;  2KLA A;  3MN6 A;  2QA4 N;  3CQ8 A;  4JI6 K;  4ILG B;  4JKC A;  2Y1J A;  4DFM A;  3THW B;  1YIT N;  3DM2 A;  1XC9 A;  1U49 A;  2P9P A;  4BRN A;  2H3G X;  1YTA A;  3SUP A;  4KTZ A;  1RDA A;  5E84 A;  2HVI A;  3CJA A;  1Q7Y O;  1QQM A;  5I9E B;  1GOC A;  5ELZ A;  3HM9 A;  1VRU A;  4BRG A;  4FJI A;  3OYG A;  3F2K A;  4WFB L;  1T3V A;  4LD0 A;  4O0I A;  1T7P A;  3THX B;  1HYS A;  4CZH A;  4JK7 A;  1U2V B;  3HZ6 A;  3H3O B;  2O8C A;  3IUC A;  1GLL O;  3MX5 A;  3BEX A;  1E4G T;  1Q9Y A;  2JWK A;  3CPW M;  3DLK A;  2YCH A;  1GLF O;  1VAZ A;  4OX9 K;  1J5O A;  1EWQ A;  1QSY A;  3TAB A;  3OYD A;  4BR7 A;  1YT3 A;  4JN4 A;  3O80 A;  3KKS A;  2KFZ A;  1GLD G;  3TAQ A;  5FRN A;  4M3R A;  2VG5 A;  1JL2 A;  1QVG M;  2FSK A;  4O55 A;  3F73 A;  2D0O A;  2D4W A;  2P1J A;  3ZT4 A;  4ZTF A;  2VWB A;  3TSU A;  4FWN A;  2ITG A;  3SAH A;  4F3T A;  4LY7 A;  4M3W A;  3CCR N;  3O1B A;  5FRM A;  2W00 A;  1CZA N;  1RT6 A;  2P9N B;  4NCA A;  2F4V K;  3J7Y P;  3THW A;  3KLI A;  2IIR A;  3MED A;  3SUO A;  3AO2 A;  1B9D A;  2YJE A;  3O4W A;  1NWK A;  4H0V B;  4CK3 A;  3MN5 A;  3WUH A;  3IDH A;  1JLA A;  1KAZ A;  1KLM A;  1HNV A;  3A5N C;  4HCC A;  3K59 A;  1JCF A;  3MXJ A;  1EX4 A;  2VCP A;  5MLC Q;  3SK3 A;  1TGO A;  3B6P A;  1BHL A;  4DTS A;  2Q2R A;  4LFB K;  3CCL N;  2C1I A;  2WBN A;  4GY2 B;  4HHT A;  2NRH A;  1OKJ A;  2FBY A;  3QBW A;  1U2V A;  3N4Q A;  3ZYY X;  5AFU A;  4OKJ A;  1KVA A;  1ZC6 A;  1JCG A;  5AQY A;  1LAW A;  2VGM A;  5M1P A;  4CZF A;  2E20 A;  4AHC A;  4DQ8 A;  3AVN A;  3WXJ A;  3BF1 A;  3VGK A;  1NG9 A;  1JLG A;  1QZ5 A;  3BUZ B;  4GW6 A;  4M3U A;  4MO5 A;  1VQ6 N;  5AZJ A;  2B6A A;  3MWP A;  4FK2 A;  3QES A;  4BWJ A;  3VQ5 A;  4E19 A;  3VN5 A;  3CIP A;  3NMU A;  2P9N A;  4GVE A;  2YKM A;  1TKZ A;  1I3A A;  5JEN A;  4B1V A;  4IWV A;  2ZQB A;  2FSN A;  2P9L A;  3V1R A;  4CK1 A;  3ZSX A;  2KZZ A;  1FK9 A;  1GLJ O;  4DTP A;  2YHX A;  3R6M A;  4CJ3 A;  4IG3 A;  3KLH A;  4DTN A;  4B9N A;  2EHG A;  2B5J A;  4J8F A;  1XNQ K;  3ID6 A;  4CZJ A;  4FZZ A;  3D2F B;  5T7B A;  4CHP A;  2QKB A;  3LDN A;  5JLF A;  3OYL A;  4JI0 K;  2UU9 K;  2O8E A;  2WOM A;  4UQG A;  4DSF A;  1CZ9 A;  5D3G A;  3HL8 A;  4IO9 L;  3CCV N;  1WSJ A;  3OBW A;  2NLX A;  4LSN A;  2OPP A;  5K14 A;  1WNS A;  1ZBS A;  1LV5 A;  1Z05 A;  4E72 A;  5DM7 L;  3C6T A;  3FGU A;  5KRT A;  4DQQ A;  4RW7 A;  4FL9 A;  2ETJ A;  4JS4 A;  4LF4 K;  3E9O A;  2D0C A;  2IVN A;  2P9U A;  2HBK A;  1GLE G;  4NLB A;  4BRI A;  3O9U A;  1MA9 B;  4JEP A;  1ZBI A;  3E66 A;  1L5U A;  4DCH A;  4QAG A;  4BRF A;  4BRM A;  3AVJ A;  2GWK A;  3KWI A;  4M3X A;  4CEC A;  3V9X A;  3ZT3 A;  4BVO A;  1S1W A;  1HPM A;  3TAP A;  2G8U A;  4EHT A;  4FSV A;  3WNG A;  2HHW A;  3OVN A;  3BDP A;  5FRO A;  4JRQ A;  1YI2 N;  2F9T A;  3TSP A;  1C6V A;  4DV7 K;  2XY8 A;  4YDU C;  2YNI A;  1IKV A;  4FM2 A;  2V7Y A;  3QNN A;  3ATV A;  4PKI A;  3THY B;  1WLJ A;  1VQ8 N;  2QXL A;  3EZ5 A;  1NMN A;  1S3X A;  2ASP A;  3RRG A;  4GV3 A;  1HKB A;  2RPI A;  3SMS A;  3DLB A;  5BRE A;  3KHY A;  1N33 K;  1IV0 A;  4J2D A;  1JLB A;  4E3S A;  2XY7 A;  3MEE A;  4JK9 A;  4DTO A;  4FW2 A;  1ATS A;  3KTQ A;  1S5J A;  3ID8 A;  4CJE A;  3O08 A;  4FLV A;  1UOC A;  3SJH A;  1QHA A;  1TYQ B;  3VES A;  5AQG A;  3ZET B;  5BN8 A;  2DTU A;  3G0Z A;  3UKU B;  3M8Q A;  1RGI A;  2X78 A;  3CJC A;  5CZ1 A;  3SAF A;  4BE1 A;  2D5R A;  1NK5 A;  3AAQ A;  4K8X A;  1RDB A;  2YJF A;  4O8K A;  1VK0 A;  3B8A X;  4IFV A;  4FLX A;  4IG0 A;  4JHD B;  2IC3 A;  1HLU A;  1TAQ A;  4HWI A;  3BF3 A;  5AQH A;  2CH5 A;  4EP4 A;  2Z1G A;  1DTQ A;  1HKG A;  3PSF A;  3D6R A;  1ASU A;  5AQW A;  4C8O A;  2OCE A;  1N34 K;  4LF6 K;  3BZC A;  4M3T A;  4W5N A;  5HRN A;  3G25 A;  1VQP N;  3BY5 A;  4E1M A;  3LPT A;  4FJ9 A;  3MCP A;  3CD6 N;  1WAF A;  1BIZ A;  4TSX A;  4CJF A;  2A1S A;  3OYC A;  1JLQ A;  4M42 A;  5GAE P;  1FKO A;  4OLA A;  4CEF A;  3SCX A;  3K5L A;  4IJN A;  4LFA K;  4M41 A;  1RCH A;  5C42 A;  3L6Q A;  1TKX A;  2HHQ A;  4FPA A;  4CCH A;  3C94 A;  3CJ9 A;  4DSJ A;  2NNW A;  2QXF A;  3DJC A;  2YHA A;  2UYT A;  4DLG A;  1TYQ A;  3IAY A;  5ADX H;  3QDK A;  2HHT A;  4B8C A;  2E5L K;  2ZM6 K;  4DG1 A;  5JVG L;  4Z0U A;  4CGI A;  2ZF5 O;  4H0X B;  1JL1 A;  4IEE A;  2O8F B;  4BR5 A;  2W40 A;  4I7F A;  4BGA A;  3NF8 A;  3ZX3 A;  3CCE N;  3D0P A;  1BI4 B;  3DXM B;  3Q7C A;  3RMD A;  1IBM K;  1HKC A;  1NK9 A;  3LP3 A;  1LCU A;  2CGL A;  3LDQ A;  4OVL A;  1M1K O;  4JD2 A;  4IXC A;  2E1Z A;  3R1X A;  4N56 A;  1ASW A;  4RG8 A;  1J54 A;  4K8Z A;  4BRE A;  2Q36 A;  4KAZ A;  1NBW A;  1X9J A;  3RSE A;  1P8Z A;  4B3T K;  4RW4 A;  2HHH K;  3GE1 A;  4NCB A;  2X74 A;  4HUE A;  4FWK A;  1NJX A;  4IOC L;  3AY9 A;  4FLW A;  1S72 N;  4Y1D A;  4DS4 A;  1WOQ A;  1IG9 A;  1W2B M;  4CJT A;  3OJU A;  3ENH A;  3LP0 A;  1NGH A;  2JGU A;  4BE7 B;  3RWU A;  3D2E B;  5CR4 A;  1YUW A;  3VEO A;  1RDD A;  5EX5 A;  3VEW A;  4CBU A;  3NH2 A;  3RVC A;  4OPH A;  4EP5 A;  3ZSR A;  3OJS A;  1K9M O;  5E41 A;  4FWO A;  4E7K A;  3AO1 A;  2HMP A;  2W42 A;  3AA5 X;  4H8K A;  3T1A A;  5KGW A;  4CJR A;  4CZG A;  5AJ3 K;  4CZL A;  1BO5 O;  3PX0 A;  3C6U A;  1MDU B;  3QO9 A;  3MK6 A;  1NJY A;  3VA0 A;  3O5B A;  4E7I A;  3E9P A;  2VWK A;  2O8D A;  3P31 A;  1FXX A;  4JKD A;  4H03 B;  3MCA B;  1NNE A;  4LC9 B;  3F9K A;  4EAH D;  3LAM A;  1OH8 A;  2HOE A;  2KQ2 A;  2WC9 A;  4KHY A;  1JCE A;  2G8H A;  3IFR A;  4CZI A;  5DM6 L;  3VGM A;  4O5F A;  4DSI A;  1D4X A;  3PX4 A;  4JKG A;  2NRX A;  3R9P A;  3KIO A;  2A3Z A;  4CJS A;  3NF6 A;  3SLC A;  1H1V A;  5AZI B;  1HRH A;  5HRS A;  4DR1 K;  4FCY A;  3SBG A;  3AGK A;  3CCJ N;  3L3U A;  3P83 D;  3Q7B A;  3O6W A;  1VQ5 N;  3CME N;  2HNY A;  2Q31 A;  4DV5 K;  2ZJQ L;  1WN7 A;  4CF2 A;  4K42 A;  4FVU A;  2IAJ A;  1T8E A;  2O8B B;  5C0Y A;  4GVM A;  2ZGZ A;  3DXK A;  4AF1 A;  3NAE A;  4CHN A;  4FJL A;  4FJK A;  4DR6 K;  3ZCM A;  2OTJ N;  1KFS A;  1N32 K;  2A42 A;  3JAM O;  4FOI A;  3EE9 A;  3O1W A;  1V4S A;  1NU0 A;  2Q3S A;  2P5O A;  4DQP A;  4FLT A;  5AQX A;  2GEM A;  4DB3 A;  1IJJ A;  4B9T A;  2HBM A;  3G6E N;  4IFE A;  1NK8 A;  1Y64 A;  4DSK A;  4B3O A;  2QWN A;  4FJN A;  3SYZ A;  5KPZ A;  1BA1 A;  3VMF B;  3CJB A;  2QKK A;  3KK3 A;  3M1F A;  1HMV A;  3MWT A;  2DPN A;  2XHB A;  1C0G A;  4JRP A;  3DOL A;  3CM5 A;  4M45 A;  4Z4C A;  5AQO A;  1RT5 A;  3OYB A;  1GLB G;  4X66 K;  1QQO A;  2QWM A;  3RR7 A;  4I9Q A;  1QSL A;  5AQZ A;  2IDO A;  1HX1 A;  3ZSW A;  3A2F A;  5AQR A;  2D0A A;  1CXQ A;  1JLC A;  1S6P A;  4CD1 A;  1HUX A;  2Z1I A;  1T05 A;  3LDL A;  1SL1 A;  4FWL A;  4BC2 A;  4CF9 A;  3LDS A;  1M90 O;  3O9T A;  4U67 L;  1XWL A;  4BRO A;  3S3M A;  3HI0 A;  4WF9 L;  4CJV A;  2Q0U A;  3MEG A;  3LAK A;  1EKE A;  3LZJ A;  3AV9 A;  2QWP A;  1OVY A;  4RW8 A;  4FXD A;  4CJ4 A;  4B08 A;  3OYA A;  1BOT O;  4KV8 A;  4PHT X;  2FC0 A;  5F2R A;  4FJJ A;  2KTQ A;  1HQE A;  1RT3 A;  4KKO A;  1VQ9 N;  3NGZ A;  1YJ9 N;  1K73 O;  1BU6 O;  4RW9 A;  2OAN A;  5AQL A;  1RBV A;  2E2N A;  2E2Q A;  1QHT A;  5FLX O;  5CZ2 A;  4YDU A;  4XEI A;  3OYK A;  2DFH A;  4JKF A;  3ASM A;  3LZI A;  3V1Q A;  2PFU A;  3VQP A;  4M63 C;  5H1S Q;  1QVF M;  3AVC A;  1A5W A;  2PY5 A;  3HRG A;  1HPZ A;  1J5E K;  3DWL A;  4CJW A;  1ILY A;  5AQJ A;  2KKZ A;  4BEC A;  3EE8 A;  5AQS A;  2E1Y A;  3MN9 A;  5C25 A;  4YHH K;  1QS4 A;  1RBR A;  4I9L A;  4HVJ A;  2UUC K;  5CYM A;  3CFO A;  3RMC A;  3I0R A;  3WNF A;  3R8E A;  4DV2 K;  4LFC K;  1MU2 A;  3QB0 A;  2KHO A;  2Z1J A;  1YVU A;  3MXM A;  4CJK A;  3RMB A;  4FPB A;  3SQ2 A;  4EHU A;  5TKY A;  4JLH A;  4F9O A;  4BAC A;  3AVG A;  5FPM A;  3EEQ A;  4U7B A;  1HYV A;  5M1K A;  3U9D A;  3C7N B;  4XH1 A;  4GNI A;  4BDP A;  4JS5 A;  2YNH A;  1C0M A;  4YOV A;  4IKF A;  3VQ7 A;  1NK0 A;  3S5T A;  3TSQ A;  3E9L A;  5AQT A;  5GAH P;  3ZT2 A;  3QEV A;  1E3M A;  1QQC A;  3VER A;  2HBL A;  1VSH A;  3OHR A;  4HTU A;  3HP9 A;  3I55 N;  2QWR A;  3HTV A;  4BRD A;  3H1V X;  3L4I A;  3NF7 A;  1WB9 A;  1Z25 A;  4EIA A;  1Q86 O;  4KI6 A;  3FZK A;  5LY3 A;  4CGH A;  4IDK A;  1GLC G;  4A57 A;  4AQY K;  3H6E A;  1BQN A;  3THX A;  3DMJ A;  5EVZ A;  3CCQ N;  4BE2 A;  5GAG P;  1D5A A;  4OLB A;  5BRH A;  1KD1 O;  4DUZ K;  3CF5 L;  4BR2 A;  1LW0 A;  3R3L A;  4GMJ B;  1UWB A;  4BRP A;  4FLY A;  1BQM A;  2UXD K;  4RCH A;  3LDP A;  3I33 A;  4EFH A;  3CFR A;  4KRE A;  4B8A B;  1I39 A;  4B3M K;  2KW4 A;  1SS6 A;  4ID1 A;  1NGJ A;  3L2R A;  4KH5 A;  3PY8 A;  3FR0 A;  5KQ8 A;  4CZE A;  4O4G A;  3NH1 A;  4C8L A;  3AO3 A;  3VEX A;  3QML A;  4CF0 A;  4DV1 K;  5JLH A;  1NGC A;  3CQY A;  4KH4 A;  4IBN A;  2F8S A;  1NJZ A;  3C6A A;  1RFQ A;  1Z6R A;  1TUY A;  2IVO A;  4B9V A;  3H08 A;  2UUB K;  2AA4 A;  1WSF A;  1L3S A;  4FWS A;  1VSJ A;  2GX9 A;  2I5J A;  4WFN L;  5J1E A;  1S1X A;  1YAG A;  4IDH A;  4RTF D;  5DMR A;  1RTI A;  2WUS A;  3L3V A;  3VQE A;  3ZT0 A;  4FJM A;  1QTM A;  4CJP A;  3F5T A;  3WXI A;  5GIN A;  1XHZ A;  4B1Y B;  4CEE A;  2VQF K;  3JS6 A;  2NZT A;  4JI3 K;  3VEN A;  3T19 A;  3UKR B;  4BRL A;  3WEE B;  3AVF A;  1KSP A;  4DQS A;  2P9S B;  4Z4H A;  4H5R A;  3MDQ A;  3K58 A;  3P5J A;  3H3N O;  3CG7 A;  1VSF A;  4CEZ A;  1DEJ A;  2VGN A;  3JSM A;  5C12 A;  4DU1 A;  3CC7 N;  2W6L A;  2LSN A;  5HP1 A;  4J2A A;  3QET A;  4DTX A;  2KZM A;  4KFB A;  5KRS A;  3VEZ A;  1QSS A;  4R79 A;  5BPM A;  4BWM A;  2XY5 A;  3WQT A;  2ASM A;  2OYQ A;  1J6Z A;  1XNR K;  3PSI A;  2AP1 A;  4AHR A;  2E6M A;  3LP1 A;  3PO5 A;  1IH7 A;  4W5O A;  3OTO K;  3FZH A;  2XY6 A;  3C95 A;  2YNG A;  3RR8 A;  3NDK A;  3M3Z A;  3HSC A;  1CZB A;  4C1N I;  5JMV A;  3SV3 A;  3VPZ A;  3KLG A;  3D2F A;  1P90 A;  3K9J A;  4I6M B;  4WFA L;  2A41 A;  4X62 K;  4CIF A;  3U4L A;  1JXE A;  3M6G A;  4CEO A;  2V51 B;  3ULE B;  4KRF A;  1RBT A;  2RF2 A;  5AQP A;  3H46 O;  3W3D A;  3OYN A;  2WTU A;  3UKR A;  1TVR A;  4ZHR A;  4CK2 A;  4XH5 A;  1LWE A;  4K0K K;  4YOU A;  5F1X A;  3MAQ A;  2P9S A;  4CHQ A;  2E6L A;  1RTD A;  2BDP A;  4IFY A;  1IBL K;  3DYA A;  4LF9 K;  1S1U A;  1HNI A;  1KLN A;  4BR0 A;  5KGX A;  4Z4I A;  4ICL A;  3QIN A;  4CJU A;  4OKE A;  4FOE A;  2ZE2 A;  3G10 A;  4WQ4 C;  1TK5 A;  3FFI A;  3WQU A;  4B9M A;  1K6Y A;  3S41 A;  1U4B A;  5AQM A;  2NRZ A;  4CJ7 A;  3TAE A;  4J2B A;  4FLZ A;  2A6A A;  4R5P A;  3BP8 A;  4DU4 A;  2D0P A;  1XQS C;  4CE9 A;  2O4I A;  3K9K A;  3QEI A;  3P4I A;  3M5R A;  4QCL A;  4CGF A;  1ZXO A;  5AR0 A;  2RE2 A;  2XO7 A;  3NE6 A;  4DS5 A;  2O4G A;  1UA1 A;  1ZYQ A;  1FW6 A;  4FZY A;  5E26 A;  4EZ6 A;  4FWQ A;  4CHY A;  4CD3 A;  4H4O A;  4K41 A;  3HO1 A;  2E4L A;  5HRP A;  2BTF A;  3TTC A;  2QTD A;  4LF5 K;  1VRT A;  3THY A;  2HHU A;  3ULE A;  1NK7 A;  2X6N A;  3K5O A;  4ELT A;  1C0F A;  4DQR A;  3C65 A;  3ZX2 A;  3VEV A;  4BQZ A;  4YY3 K;  4FK4 A;  1ZBU A;  2R7Y A;  1U48 A;  5AQU A;  4CF8 A;  1VQ4 N;  4Y0W A;  2QWO A;  3EZW A;  1XUP O;  1WSG A;  1TKT A;  4CZM A;  3VQQ A;  4M3Y A;  1D9D A;  2P9I B;  2OTL N;  5AFU H;  1QQN A;  3SNN A;  5AQF A;  4LF7 K;  3ZET A;  3EY1 A;  2ZWH A;  1IBK K;  3UKU A;  5FDL A;  3O8M A;  4BG9 A;  3VQC A;  1DGK N;  1DT9 A;  3PV8 A;  3CI5 A;  3ZSV A;  1VQO N;  4ELV A;  1U47 A;  4H0T B;  3QER A;  4KB0 A;  3NGY A;  2BUP A;  3OA9 A;  4JHD A;  2YHW A;  4L3Q A;  5C2D A;  4UY8 O;  2JLE A;  1Q8I A;  1ATN A;  1N6Q A;  3ZSY A;  4B3S K;  1TAU A;  4ELU A;  1U6Z A;  3HP6 A;  4DV0 K;  3HVT A;  4FWR A;  3J81 O;  4FYD A;  3TAM A;  2HB5 A;  5JS2 A;  3NVM A;  1RTJ A;  3CXC M;  3FZL A;  3DRS A;  1KAY A;  1KC8 O;  3ZSO A;  4FWM A;  3U3Y A;  4MDA A;  2Q0R A;  4IZ9 A;  4DFP A;  4PL8 A;  4J2E A;  2A1R A;  3KD1 E;  2G8F A;  2NRR A;  2Z1H A;  5AQN A;  1BCO A;  3EKU A;  3WXM B;  3SAG A;  1EXQ A;  1SL0 A;  1KCF A;  1L3U A;  4KTQ A;  1W9H A;  1T44 A;  5CE3 A;  1C1C A;  2PZS A;  4DUY K;  1HNZ K;  1RT4 A;  4IJA A;  1D9F A;  4WQ5 C;  5FPD A;  3P38 A;  1RTH A;  4QS7 A;  5HRR A;  1A5V A;  3CER A;  2P9I A;  5EXW A;  3JYT A;  4JKB A;  3LL3 A;  4FJX A;  4DTJ A;  5JS1 A;  3GOI A;  3P1G A;  1HR0 K;  2D0B A;  2IGI A;  4CGJ A;  4KO0 A;  3AVA A;  3AVL A;  1K8A O;  1KFD A;  3MX2 A;  3HYF A;  3VQA A;  4DTU A;  3QLH A;  4MLE A;  3U3G A;  3ENO A;  3SBT A;  1A5X A;  3D7E O;  2O8F A;  1Z26 A;  4F8R A;  2GTD A;  2YV0 X;  3LWL A;  1UAX A;  1BI4 A;  3DXM A;  4PL7 A;  5CY4 A;  3P39 A;  4GKJ K;  3OYM A;  5I42 A;  4L8R B;  4BDY A;  4FJ5 A;  4BR9 A;  3DRR A;  4AIL C;  5C15 A;  5IWA K;  3NH0 A;  4ZTJ A;  3NVK A;  3L4Q A;  3EYZ A;  4NXN K;  3VQ6 A;  4DQI A;  1T6D A;  4Y1C A;  1SKW A;  4G1Q A;  4CJQ A;  3LP2 A;  1N36 K;  1Q9X A;  4B9L A;  3EKS A;  3J80 O;  3IRX A;  3AO5 A;  1SZ2 A;  1KRP A;  3BZK A;  4XIU A;  5EOY A;  3KVG A;  1G99 A;  3CYM A;  4GV6 A;  4CEB A;  3O3H A;  4GKK K;  1SUQ A;  1IKX A;  5GIP A;  1SKR A;  5M1Q A;  1NLV A;  3D2E A;  1RDC A;  1IKY A;  4AM6 A;  3CC4 N;  1DKG D;  4JI7 K;  4AHT A;  4DV4 K;  4DR2 K;  2DFF A;  3M8R A;  1SV5 A;  4CEQ A;  1NJI O;  4DLE A;  1NGA A; 
#chains in the Genus database with same CATH homology
 2RHK A;  2NLX A;  3OBW A;  3O9Q A;  3C0B A;  4FPB A;  4EHU A;  4YOX A;  5TKY A;  1ZBS A;  4F9O A;  1Z05 A;  5DM7 L;  1X3M A;  5FPM A;  4U7B A;  1K8K B;  3FGU A;  5M1K A;  3MN7 A;  3C7N B;  4XH1 A;  2QWQ A;  4FL9 A;  3U9D A;  4GNI A;  5FPN A;  5BRD A;  3E9O A;  1ATR A;  5M1N A;  2IVN A;  2P9U A;  4YOV A;  2HBK A;  3L0Q A;  1GLE G;  4NLB A;  2ZJR L;  2IVP A;  3TSQ A;  3E9L A;  1RDU A;  4WYB A;  5AQT A;  5GAH P;  4BRI A;  4GV9 A;  3O9U A;  1MA9 B;  2NRT A;  4BEB A;  3VER A;  4JEP A;  3E66 A;  4DCH A;  2HBL A;  3A0I X;  1Q82 O;  4BRF A;  3OHR A;  3PIP L;  2Q97 A;  4BRM A;  4O8U A;  3I55 N;  2I7P A;  2GWK A;  2YHY A;  3KWI A;  2QWR A;  3HTV A;  4BRD A;  3FFK B;  1O13 A;  3H1V X;  3L4I A;  4EIA A;  1Q81 O;  2QWL A;  1Q86 O;  3FZK A;  3IMX A;  5LY3 A;  3LM9 A;  3ZEU B;  3QIC A;  2F9W A;  4NLC A;  3OW2 M;  1GLC G;  3KWG A;  4A5A A;  4A57 A;  4BVO A;  1HPM A;  3H6E A;  5M1F A;  4C1N K;  4EHT A;  5EVZ A;  4FSV A;  3CCQ N;  5GAG P;  1YI2 N;  5KPT A;  2F9T A;  5BRH A;  3TSP A;  4JK8 A;  4BY9 C;  2C1G A;  1KD1 O;  3CF5 L;  4YOR A;  4BR2 A;  2ASO A;  4YDU C;  5CHI A;  1KQS M;  2GWJ A;  2V52 B;  1NGE A;  2V7Y A;  3KZB A;  4RWT A;  1KXP A;  3R3L A;  5HL7 L;  3VTH A;  2ZJP L;  3OBY A;  3ATV A;  4PKI A;  4H5T A;  2F7T A;  4A2B A;  4Z94 A;  5AZI A;  4JKG B;  4BRP A;  3VEY A;  3PIO L;  4RCH A;  1VQ8 N;  1KAX A;  3I33 A;  2GEL A;  1NGD A;  3LDP A;  4M7Y A;  1BUP A;  2QXL A;  1MWK A;  4EFH A;  3J7Z O;  1S3X A;  2PAV A;  3HBT A;  4IEI A;  2ASP A;  4MO4 A;  3SMP A;  4GV3 A;  1HKB A;  3DAW A;  3A5L C;  3SMS A;  5BRE A;  3KHY A;  1SS6 A;  3FZM A;  3O9R A;  1YJN N;  2PBD A;  1NGJ A;  4JK9 A;  4K25 A;  3ATU A;  4KH5 A;  1ATS A;  3WXK A;  3FR0 A;  3ID8 A;  1W97 L;  3O08 A;  5KQ8 A;  4IOA L;  3G4S N;  1NGB A;  3GL1 A;  5AQQ A;  4CZE A;  3SJH A;  2ITM A;  1QHA A;  1TYQ B;  2HF4 A;  2V7Z A;  3AGR A;  1K8K A;  3VES A;  3I8B A;  5AQG A;  3ZET B;  3ZX0 A;  5BN8 A;  3ENB A;  5KQD A;  3UKU B;  3QML A;  3VEX A;  1RGI A;  3CJC A;  5BR9 A;  3SAF A;  5GIO A;  3CQX A;  4WCE L;  4QS9 A;  3LDO A;  3AAQ A;  5BPN A;  4E1J A;  2YJF A;  5JLH A;  1NGC A;  4O8K A;  1YHQ N;  3CQY A;  3B8A X;  3DXK B;  2J4R A;  4KH4 A;  3O9S A;  4JNE A;  3U8X A;  4JHD B;  1HLU A;  1WUA A;  4HWI A;  3BF3 A;  5AQH A;  2CH5 A;  3UB5 A;  3C6A A;  1RFQ A;  1Z6R A;  1TUY A;  2IVO A;  3KK7 A;  4CZK A;  3A8Y A;  2AA4 A;  1VQN N;  2E88 A;  4FWS A;  1HKG A;  1N8R O;  2GX9 A;  3ZEU A;  4WFN L;  4BRQ A;  3D6R A;  5AQW A;  1YAG A;  4NB4 A;  4IDH A;  4RTF D;  2WUS A;  5AQK A;  4A5B A;  3F5T A;  1BA0 A;  3FE1 A;  3T69 A;  3G25 A;  1VQP N;  3WXI A;  5GIN A;  4B1Y B;  5B8H A;  3IKM A;  3MCP A;  3CD6 N;  3TPQ A;  3JS6 A;  4BRA A;  4BG8 A;  2NZT A;  3VEN A;  4BQL A;  4FWP A;  4ILJ A;  3UKR B;  4BRL A;  4JKE A;  3WEE B;  1SAZ A;  2EWS A;  1Q18 A;  4H5V A;  5GAE P;  1YVN A;  3CMA N;  1YIJ N;  1S22 A;  2P9S B;  4IJN A;  4PKG A;  4H5R A;  3MDQ A;  4WQ4 A;  3TU5 A;  5HOO A;  4BC5 A;  5GAD P;  3L6Q A;  3H3N O;  4ISF A;  2FSJ A;  4JAX A;  3TTD A;  3CPE A;  4FPA A;  3GBT A;  1NM1 A;  1DEJ A;  3CJ9 A;  2VGN A;  4BRC A;  2FLO A;  2NNW A;  3DJC A;  4ISG A;  1YXQ A;  5C12 A;  3CJ1 A;  4H5W A;  3CC7 N;  2UYT A;  1NGF A;  1TYQ A;  4BR4 A;  4BGB A;  4H0O A;  5AZJ B;  4H5N A;  3QDK A;  5ADX H;  5JVG L;  2QI2 A;  1IG8 A;  2ZF5 O;  4M7X A;  4H0X B;  3VEZ A;  4IEE A;  1V4T A;  4BR5 A;  3I56 N;  2W40 A;  4R79 A;  1HJO A;  2VYP A;  3N4P A;  5BPM A;  1RDW X;  2CH6 A;  4BGA A;  3ZX3 A;  3CCE N;  3WQT A;  2ASM A;  1J6Z A;  2D1K A;  3T7Z A;  4BVP A;  3DXM B;  3Q7C A;  5AQI A;  1XC3 A;  3G71 N;  2AP1 A;  3U9Z A;  2P9P B;  1HKC A;  1LCU A;  2CGL A;  3LDQ A;  1VQK N;  1M1K O;  4JD2 A;  4IXC A;  1T6C A;  2E1Z A;  3FZH A;  3R1X A;  2WFB A;  3WT0 A;  2P9L B;  3PLA A;  4NO7 A;  2BH1 A;  3QBX A;  3M3Z A;  3HSC A;  4BRE A;  2Q36 A;  3F9M A;  4C1N I;  5JMV A;  1NBW A;  3VPZ A;  1X9J A;  3D2F A;  5BPL A;  3RSE A;  1P90 A;  1P8Z A;  3K9J A;  3HOT A;  4I6M B;  3JXU A;  1NMD A;  4B1U B;  5LJW A;  4WFA L;  2A41 A;  2YX6 A;  4FO0 A;  3GE1 A;  3H1Q A;  3U4L A;  2QM1 A;  4B1Z A;  2CGK A;  3M6G A;  4FWK A;  3VOV A;  2V51 B;  3W0L A;  4OPA A;  3ULE B;  4IOC L;  3AY9 A;  3H45 C;  1S72 N;  5BN9 A;  5AQP A;  1NGI A;  2HBJ A;  3H46 O;  3W3D A;  2Q1N A;  3UKR A;  1WOQ A;  3VF6 A;  2QW9 A;  5F0X A;  4XH5 A;  1W2B M;  4IO8 A;  4ISE A;  3VTI A;  3HOS A;  3DLL L;  3AAP A;  3ENH A;  4YOU A;  5F1X A;  1NGH A;  2P9S A;  4YOT A;  3CC2 N;  4BE7 B;  4B9Q A;  3D2E B;  5AQV A;  3VGL A;  5CR4 A;  1MWM A;  5ADX A;  1YUW A;  3VEO A;  4BR0 A;  2E2P A;  5EX5 A;  2HF3 A;  3C7N A;  3VEW A;  4CBU A;  3RVC A;  4OPH A;  1K9M O;  4FOE A;  2KLA A;  3MN6 A;  4WQ4 C;  2QA4 N;  2GUP A;  4FWO A;  3WQU A;  4ILG B;  3S41 A;  2HMP A;  4JKC A;  5LJV A;  5AQM A;  2NRZ A;  4CJ7 A;  4CZG A;  2A6A A;  1YIT N;  2P9U B;  2CGJ A;  1BO5 O;  4CZL A;  3BP8 A;  4A62 A;  4CBX A;  2D0P A;  1GLA G;  1MDU B;  5BRF A;  1XQS C;  3MK6 A;  2P9P A;  3K9K A;  5TKW A;  3P4I A;  4BRN A;  4KH6 A;  3O5B A;  2H3G X;  3M5R A;  1YJW N;  3E9P A;  2E8A A;  4H0P A;  5E84 A;  1ZXO A;  2A40 A;  3FZF A;  2RE2 A;  3CJA A;  4PKH A;  5AR0 A;  3P31 A;  2I7N A;  1Q7Y O;  4JKD A;  1QQM A;  4H03 B;  3GDQ A;  3MCA B;  5I9E B;  2NRV A;  4LC9 B;  5ELZ A;  3VF4 A;  4BRG A;  3F2K A;  5E26 A;  4EAH D;  4WFB L;  4FWQ A;  1T3V A;  2HOE A;  2WC9 A;  1JCE A;  4CD3 A;  3IFR A;  4K41 A;  4CZI A;  2BTF A;  2NRW A;  3TTC A;  2QTD A;  5DM6 L;  4KBO A;  3VGM A;  1NGG A;  4O5F A;  4WQ5 A;  4CZH A;  1D4X A;  4JK7 A;  1U2V B;  4JKG A;  3ULE A;  4MLH A;  2NRX A;  4CBW A;  3HZ6 A;  3H3O B;  3IUC A;  4BC4 A;  4AM7 A;  3R9P A;  1GLL O;  3QFP A;  1C0F A;  3MX5 A;  3UE5 A;  2A3Z A;  3BEX A;  3C65 A;  3ZX2 A;  4H0Y B;  3VEV A;  4BQZ A;  1E4G T;  2JWK A;  3CPW M;  3SLC A;  1H1V A;  2YCH A;  3LM2 A;  1GLF O;  1VAZ A;  5AQU A;  1VQ4 N;  4Y0W A;  2QWO A;  3EZW A;  1XUP O;  5AZI B;  1ESV A;  4CZM A;  3SBG A;  4B1X B;  3AGK A;  2P9I B;  4BR7 A;  3CCJ N;  2OTL N;  4JN4 A;  5AFU H;  3O80 A;  4QS8 A;  2HST A;  4OO1 J;  1QQN A;  3Q7B A;  1GLD G;  3O6W A;  5AQF A;  1VQ5 N;  3ZET A;  3CME N;  3EN9 A;  2Q31 A;  2FSK A;  2ZWH A;  2ZJQ L;  3CCS N;  1QVG M;  2D0O A;  2D4W A;  4K42 A;  3UKU A;  5C10 A;  4FVU A;  3O8M A;  2VWB A;  3TSU A;  4BG9 A;  1DGK N;  3CJ7 A;  4FWN A;  3SAH A;  1EQY A;  1SQK A;  1DT9 A;  4XJX A;  3CI5 A;  3CET A;  3CCR N;  3O1B A;  1VQO N;  2W00 A;  1CZA N;  5C0Y A;  4H0T B;  2P9N B;  2JWL A;  2ZGZ A;  3DXK A;  2BUP A;  3OA9 A;  2QEX N;  4AF1 A;  3VET A;  4JHD A;  2YHW A;  4L3Q A;  5C2D A;  4UY8 O;  2OTJ N;  4B1W B;  2IIR A;  1ATN A;  2A5X A;  2A42 A;  4FOI A;  1U6Z A;  2YJE A;  5M1O A;  3EE9 A;  3O1W A;  1V4S A;  3O4W A;  4FWR A;  4MDB A;  4BRH A;  1X3N A;  5AQX A;  1NWK A;  2P9K B;  4H0V B;  3MN5 A;  3WUH A;  3MMV A;  4IOX A;  2GEM A;  3IDH A;  3NVM A;  4DB3 A;  5FPE A;  1IJJ A;  1KAZ A;  3A5N C;  3TTF A;  5JIC A;  2HBM A;  3G6E N;  3EO3 A;  4IFE A;  5EY4 A;  1Y64 A;  1JCF A;  2QWN A;  3CXC M;  2VCP A;  3FZL A;  5KPZ A;  1BA1 A;  3VMF B;  3CJB A;  1KAY A;  5MLC Q;  1KC8 O;  3M1F A;  3SK3 A;  2ZGY A;  4FWM A;  3MWT A;  3WXL A;  2DPN A;  1C0G A;  4MDA A;  2Q0R A;  1BG3 A;  2FXU A;  4BRK A;  4IZ9 A;  4PL8 A;  1QZ6 A;  2Q2R A;  3CCL N;  2C1I A;  1BWF O;  2WBN A;  2NRR A;  2NRH A;  4GY2 B;  1OKJ A;  1GLB G;  5AQO A;  3WEE A;  1QQO A;  4YOY A;  2QWM A;  5AQN A;  3QBW A;  1U2V A;  3EKU A;  5AQZ A;  3WXM B;  3SAG A;  3N4Q A;  1HX1 A;  1E4F T;  3ZYY X;  5AFU A;  5AQR A;  5AQY A;  1ZC6 A;  1JCG A;  2YI1 A;  2VGM A;  1T44 A;  5M1P A;  5CE3 A;  4CD1 A;  4CZF A;  1HUX A;  3LDL A;  2E2O A;  4FWL A;  4A2A A;  2E20 A;  4BC2 A;  1M90 O;  4IJA A;  3O9T A;  4BC3 A;  4DQ8 A;  3A5M C;  4WQ5 C;  3WXJ A;  3BF1 A;  5FPD A;  3P38 A;  4U67 L;  5JVH L;  4QS7 A;  3VGK A;  3CER A;  5C2F A;  1QZ5 A;  3BUZ B;  2P9I A;  5EXW A;  4BRO A;  3HI0 A;  4JKB A;  3LL3 A;  4MO5 A;  4WF9 L;  2Q0U A;  3GOI A;  2W41 A;  1VQ6 N;  5AZJ A;  1K8A O;  3E1Y A;  3MWP A;  3MX2 A;  4MLE A;  2QWP A;  1OVY A;  3ENO A;  3SBT A;  3D7E O;  4DKW A;  3CIP A;  3FLC O;  4A59 A;  3NMU A;  4JKH A;  3J8A A;  2GTD A;  1VQL N;  2P9N A;  3A5O C;  4GVE A;  1BOT O;  3DXM A;  4PL7 A;  4PHT X;  3CCU N;  4XH4 A;  3P39 A;  4B1V A;  5F2R A;  4IWV A;  2FSN A;  2P9L A;  1VQ9 N;  4BR9 A;  1YJ9 N;  1K73 O;  1BU6 O;  3EL2 A;  2P9K A;  1VQM N;  2OAN A;  1BDG A;  1GLJ O;  5AQL A;  5C15 A;  2YHX A;  2E2N A;  3NVK A;  3R6M A;  2E2Q A;  3L4Q A;  3AAR A;  3GG4 A;  4I6M A;  1T6D A;  3VF2 A;  4ILH A;  4YDU A;  1EO1 A;  4XEI A;  4JD2 B;  1TUU A;  4JKF A;  4J8F A;  1LOT B;  3CCM N;  2PFU A;  3EKS A;  4M63 C;  5H1S Q;  1QVF M;  3QFU A;  3ID6 A;  5KPR A;  1VQ7 N;  4DHY A;  4CZJ A;  3HRG A;  1SZ2 A;  3DWL A;  3CHW A;  1ILY A;  3D2F B;  5AQJ A;  2KKZ A;  1G99 A;  3EE8 A;  3KVG A;  2E1Y A;  3MN9 A;  5EOY A;  5AQS A;  3RSE B;  1JJ2 M;  4BEC A;  4GV6 A;  2FF6 A;  3LDN A;  3C6H A;  5JLF A;  4C23 A;  5GIP A;  4HTL A;  4JKA A;  4K43 A;  5M1Q A;  2FF3 B;  1NLV A;  3D2E A;  1YF5 L;  4AM6 A;  3R8E A;  4G9Z A;  4A61 A;  3CC4 N;  1DKG D;  4CI6 A;  3QB0 A;  2KHO A;  4IO9 L;  1R59 O;  3CCV N;  1NJI O;  4YOW A;  3HM8 A;  1NGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...