3UKUA

Structure of arp2/3 complex with bound inhibitor ck-869
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
415
structure length
399
Chain Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords ACTIN-LIKE PROTEIN 3
publication title Structure of Arp2/3 complex with bound inhibitor CK-869
rcsb
total genus 123
structure length 399
sequence length 415
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ukuA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ukuA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3ukuA03
5E84A 4H0YB 4Y0WA 3DJCA 3VEXA 4FOIA 2E8AA 3QMLA 2Q31A 3H46O 2WUSA 5AQZA 3H6EA 2YCHA 2P9PB 2ZF5O 1NGJA 2P9UB 4KBOA 1GLDG 4WYBA 4BQZA 1HLUA 4NB4A 1BA1A 3WUHA 3LDPA 2HMPA 3GBTA 2P9KB 3LDQA 4JN4A 5KPTA 1GLCG 2E2QA 1S3XA 3CQYA 4BRQA 3GDQA 3H3OB 3VF2A 1DGKN 3KZBA 5KPZA 3VGLA 1JCEA 2E2PA 5JMVA 3BUZB 3AAPA 3H3NO 1XUPO 3JXUA 3JS6A 2BTFA 4FWQA 2CGJA 4CBWA 4JD2A 3QICA 5FPNA 3AAQA 3EKUA 3FE1A 1KAXA 2ITMA 3U4LA 2ZGYA 4BRNA 1KAYA 3CJ7A 4YDUA 1ZXOA 3LL3A 4BG9A 2P9NB 1H1VA 2GWJA 1YUWA 4CZGA 3O4WA 3SJHA 4EHUA 2D1KA 1V4TA 1U6ZA 2ASMA 1K8KB 3WEEB 4CI6A 4I6MB 5AQKA 4CD1A 1NLVA 1HKGA 2CH6A 3HM8A 1HKBA 1NWKA 3O8MA 3VEWA 2J4RA 3HSCA 3SLCA 4JNEA 3MCPA 1BDGA 1MWMA 3O80A 4J8FA 4FWMA 3HZ6A 2P9UA 2E1YA 4HTLA 4B1YB 2Q2RA 3FLCO 1BG3A 4MO4A 3DAWA 4RTFD 1BA0A 3GOIA 3O1WA 1SZ2A 5AQPA 4H0OA 2QM1A 4BRKA 4CZKA 3ZX3A 5F0XA 3RSEB 4BRPA 4PL7A 3EO3A 4CZLA 1T6CA 4BRLA 1C0FA 4MO5A 1WOQA 4K42A 1NGAA 5AQOA 5KQ8A 5BN9A 2NZTA 3DXKB 2IIRA 2IVNA 1TYQB 3LM9A 4H5RA 5I9EB 1RGIA 3CQXA 2CGLA 5AQVA 4FO0A 5AQTA 3SMPA 4CBUA 3O08A 4H5WA 2P9IA 2GTDA 4ISGA 2P9NA 1IJJA 1SAZA 4XH4A 4M7XA 1HX1A 4NO7A 1NM1A 4IWVA 4DB3A 3WEEA 4XH5A 3VERA 1K8KA 5E26A 4I6MA 4K25A 3VOVA 1QQOA 2YJEA 4B1UB 5AZJA 5LJVA 4FWLA 4RCHA 2PBDA 3MMVA 3VETA 1OKJA 4H0TB 4GNIA 1XQSC 4PKIA 2FF6A 1Y64A 3M3ZA 3QBWA 1SQKA 3VF6A 3KHYA 4BC3A 2EWSA 5BPNA 4H0PA 2E2OA 1JCGA 2A41A 2KHOA 3AARA 3ATVA 4EHTA 1HKCA 1T6DA 3HI0A 4BVPA 3RSEA 4F9OA 2Q0UA 4BR5A 2H3GX 5F2RA 2ZGZA 3B8AX 1IG8A 3VEVA 1TUYA 4WQ4C 3VGMA 3CIPA 3OHRA 3MN9A 3W0LA 4RWTA 4HWIA 3WT0A 3SMSA 1RFQA 5CE3A 1Z6RA 4ISEA 4EFHA 4WQ5C 2P9LB 2FF3B 3UKRB 2W41A 2E88A 3QFUA 4DHYA 3IFRA 5ADXH 3LM2A 4MLHA 3M6GA 3BP8A 3FZFA 3DWLA 2PAVA 2YHWA 4M7YA 2BUPA 2QWOA 3EZWA 2D4WA 3BF1A 3U9ZA 1Z05A 5EXWA 4BR9A 1EQYA 3FZLA 2I7PA 4Z94A 4B1XB 4ISFA 5KQDA 3CETA 1ESVA 4M63C 3ZEUA 5JICA 4DCHA 5JLHA 2CH5A 3VF4A 4BRIA 3FR0A 4QS7A 2GWKA 2QW9A 4GY2B 1GLAG 5ELZA 5BPMA 4FPBA 1X9JA 3QBXA 3L4IA 4K43A 4AM6A 3ID8A 3D2FA 3L6QA 4CZIA 1BWFO 3VGKA 3WXLA 1P8ZA 2GEMA 3KVGA 4H5TA 3AY9A 5BR9A 1GLLO 4IZ9A 4B1ZA 1BO5O 1R59O 3MN7A 4QS9A 4CD3A 1NGDA 1BOTO 1HJOA 3L0QA 3O6WA 2E1ZA 1J6ZA 4PL8A 4H0VB 2GUPA 2P9PA 3FZKA 4CZFA 4CZEA 5BPLA 1NGIA 4JHDB 3W3DA 3A0IX 2E2NA 3FZMA 4IJAA 1U2VB 3R8EA 4CBXA 3CJBA 4XEIA 4LC9B 1G99A 3C7NB 1ATNA 2P9KA 2YHYA 4CZHA 4A2AA 5TKYA 1NMDA 2YI1A 3VEOA 3QB0A 3ZX2A 4BRFA 1E4GT 4H0XB 4FOEA 3BEXA 5AQMA 3ZETB 5AQJA 3WQTA 3FZHA 3ULEB 1QQNA 4H03B 3EN9A 4FL9A 2A40A 3DXMB 4H5VA 2AA4A 1HUXA 5FPEA 2NLXA 4WQ4A 3FFKB 2F9WA 3D2EB 2HF3A 4A61A 4H5NA 4CJ7A 4IO8A 4BC5A 5BRFA 1C0GA 5AFUA 4WQ5A 2A3ZA 1S22A 4MLEA 2UYTA 2OANA 3A5OC 4FWPA 4IXCA 1KXPA 2E20A 2ASOA 2D0OA 2QXLA 3GE1A 3F9MA 5AZIB 2FSNA 4BGAA 3CJ9A 4FWKA 3MN6A 2YHXA 3ATUA 3WXKA 5AQWA 1QZ5A 2ASPA 4BR2A 5LJWA 4EAHD 2DPNA 1QHAA 2A5XA 2QWMA 1QQMA 3IUCA 3WQUA 2FXUA 2Q0RA 2V7ZA 4JD2B 2QWLA 4CZJA 3DXKA 3ENHA 4BGBA 1TYQA 2VWBA 3ENOA 1DKGD 4A2BA 1NGGA 4BRMA 2F9TA 1X3NA 4FPAA 5AQQA 2NRHA 3A8YA 5FPMA 3MK6A 1E4FT 2V51B 3QFPA 1GLEG 3TPQA 4C23A 2QWRA 3GL1A 3QDKA 4O5FA 4EIAA 1NBWA 5EX5A 3HBTA 1GLFO 4FWSA 3HTVA 1LCUA 2Q36A 3H1QA 5BRHA 3CJAA 3R6MA 3TU5A 3CI5A 3D7EO 5AZIA 2P9SB 2FSJA 4FWOA 4BVOA 2IVOA 3CJ1A 1XC3A 3FGUA 1BUPA 5AQIA 5AQFA 1ZC6A 4FWRA 5AQLA 2I7NA 4L3QA 1YVNA 5AQHA 1NGEA 3CHWA 5LY3A 3WXJA 2Q1NA 3ZX0A 3A5NC 5AQRA 4B1VA 4DQ8A 4BR4A 5FPDA 4PKHA 2VYPA 5AR0A 4A62A 1BU6O 1NGFA 3I33A 4AM7A 3VEYA 4CZMA 1DEJA 3EKSA 3VESA 4BG8A 2FSKA 5ADXA 4BRGA 3H1VX 2P9IB 3CERA 2P9LA 5B8HA 4BC2A 4BRHA 3VPZA 3UKRA 3H45C 1MA9B 1WUAA 2ZWHA 3VENA 4BQLA 5AQXA 1LOTB 5AQNA 4E1JA 5AZJB 2W40A 2VCPA 4FSVA 5AFUH 3UKUB 4BR0A 4JAXA 3U8XA 1NGCA 1QZ6A 3EL2A 3GG4A 1V4SA 3S41A 3LDOA 1T44A 3VEZA 2HOEA 5F1XA 4BC4A 2QWPA 1NGHA 1HPMA 2P9SA 2V52B 3WXIA 5JLFA 4BREA 2FLOA 4BRCA 1TUUA 1MDUB 3LDNA 5EVZA 2QWQA 1X3MA 4B9QA 3BF3A 5AQUA 1KAZA 5AQYA 3C0BA 1D4XA 5AQSA 3UB5A 2YJFA 5BRDA 5KPRA 3P4IA 4FWNA 3U9DA 3SK3A 4BROA 2AP1A 4YDUC 5EOYA 2QWNA 3MN5A 3LDLA 1ATRA 5AQGA 3I8BA 5BREA 4JHDA 1MWKA 1RDWX 1ZBSA 3A5MC 4PKGA 4BR7A 3UE5A 1NGBA 1U2VA 3IMXA 4BRAA 4BRDA 5BN8A 2GELA 3G25A 3CJCA 5EY4A 3C7NA 2Q97A 3O1BA 1YXQA 3M1FA 3UKUA 1CZAN 4XH1A 2IVPA 2V7YA 3ZETA 3ZEUB 3R9PA 4B1WB 3ULEA 2D0PA 3DXMA 2CGKA 2HF4A 1GLBG 2A6AA 3IDHA 3MDQA 3J8AA 3A5LC 1JCFA 1GLJO 1Q18A 1YAGA 3D2FB 3D2EA 4QS8A 4O8KA 3O5BA 4IJNA 4K41A 2A42A 1ATSA
chains in the Genus database with same CATH superfamily
4Y0WA 3VEXA 1C1CA 4FOIA 4B3RK 3H6EA 2YCHA 4FJIA 3PV8A 3RMAA 1WSHA 1ILYA 4WYBA 4K0KK 1RTIA 4NB4A 3OYDA 1VQ4N 3LDPA 3TAGA 3VTIA 2WONA 5CZ1A 1K73O 4B8AB 1D8YA 2RKIA 4CEFA 2DFHA 1JCEA 3JS6A 1GOAA 4BDYA 2GBZA 1ZBIA 3TAMA 5I3UA 2CGJA 4DF8A 4JI7K 3QICA 3HT3A 2ITMA 4DTUA 3ID6A 4KHQA 3C6HA 2ZGYA 4OPKA 3ISNC 3LL3A 4R5PA 3O4WA 3OYGA 4ELVA 4GKJK 3T19A 1RNHA 3WEEB 3K5MA 1K8KB 3DRRA 1NLVA 4DQSA 2FBVA 3VQQA 4E3SA 2J4RA 1J54A 2E6MA 1VSFA 1MWMA 3HZ6A 4RW9A 4CVNE 2P9UA 2E1YA 4HTLA 4B1YB 4JRQA 2P51A 3M8SA 3OS1A 1W9HA 3GOIA 1FJGK 1SZ2A 1YJ9N 3ZX3A 5KTQA 2G8WA 4PL7A 3EO3A 5HL7L 2O8DB 5C0YA 1JL1A 5M1KA 3HXMA 1NGAA 4B9TA 5AQOA 4HTUA 2FBXA 1RDUA 3DLKA 3Q7BA 2UXBK 4JYAK 4Y1DA 2P1JA 3CQXA 3DLLL 5AQTA 1HNWK 4FXDA 3JYTA 2OPRA 4CFDA 1GOBA 2WC9A 4CEBA 4E72A 4LD0A 2HNZA 4LFBK 2B4JA 4KRFA 4NO7A 4JKBA 3HYFA 4Z4EA 4XH5A 4I6MA 4FCYA 4N41A 3AVAA 2LSNA 4O4GA 1WBDA 3V1OA 3L2RA 2IC3A 3MMVA 1WSIA 1RT2A 1OKJA 4H0TB 1XQSC 2OPPA 4PKIA 1Y64A 4BC3A 1SQKA 2G8UA 2EWSA 5CY4A 1LW2A 1S9GA 4FM0A 1NJWA 4E7KA 4EHTA 1BHLA 2QTDA 3PIOL 1WAFA 4OKJA 1TK5A 2HNYA 1U49A 1IG8A 1QHTA 4WQ4C 3K59A 3CIPA 3SQ0A 3G71N 1CZBA 2HSTA 2F8TA 1ASWA 4DQPA 4HWIA 4ISEA 4O55A 4FZYA 1YITN 2P9LB 1G15A 3UKRB 4DFKA 3QFUA 1U47A 3AA3A 2VWKA 4KH6A 3HM9A 3QO9A 1KVCA 2YHWA 1TV6A 3AV9A 4M7YA 5JS1A 3LP3A 5CYQA 4B08A 2G8FA 5FLXO 4NLCA 2VG7A 4LH4A 4BR9A 3FZLA 3F73A 4FM1A 4KPYA 3SV4A 4ISFA 2A1SA 4O44A 4CECA 1ESVA 4M63C 1HNIA 2CH5A 3DLRA 5CZ2A 4HHTA 4DSIA 4CJLA 3K9JA 2W00A 1GLAG 2QA4N 3L4IA 3AVNA 4A5BA 1WNSA 5M1PA 5DM7L 1NKBA 4M3TA 3O3HA 4DSFA 4KHYA 4H5TA 1QSYA 3AY9A 5BR9A 1J53A 3TANA 5DM6L 1BO5O 1EETA 1WSFA 3MN7A 4QS9A 1HJOA 3O6WA 1VSLA 2Z1IA 3QEIA 3D0PA 2P9PA 1NK5A 3FZKA 1KVBA 1REVA 3CQ8A 4WE1A 3RRGA 4LY7A 1U2VB 3RTVA 1KLMA 4V19S 1WN7A 3PLAA 2VG5A 3AVGA 5LMNK 3M5RA 5FDLA 2G8IA 2RN2A 1G99A 1ATNA 3QETA 4CZHA 4Z4IA 3HOSA 2OPQA 5HRRA 2BDPA 4BRFA 1E4GT 4B3TK 4J2DA 3AGKA 3I0SA 3ZT3A 3AO4A 1VSMA 4CJEA 2NRXA 3C6UA 4RG8A 4BY9C 3DXMB 4H5VA 1T05A 4LFAK 1JLQA 2AA4A 4DV0K 3AA4A 2NLXA 3KKRA 5M1FA 4YHHK 1QSLA 3AA5X 3MX2A 4IO8A 1C0GA 4WQ5A 3HRGA 2HVIA 4M41A 3A5OC 4FWPA 3G4SN 3S5TA 3DLEA 3VQ7A 4DS5A 3QNOA 5HRPA 5KGWA 1JXEA 3LPUA 1EX4A 4CJTA 4FWKA 3ZSRA 2YHXA 1TAQA 4QAGA 4RW8A 3ZYYX 5AQWA 5HLFA 3E9PA 4LF7K 2ASPA 1ITGA 2UXCK 3VQEA 5LJWA 4EAHD 1QQMA 3IUCA 4DV7K 3DLGA 3NMUA 2RE2A 2V7ZA 2VQEK 4KI6A 3OYHA 1VRTA 4DTRA 1C6VA 3DXKA 3ENHA 1X9SA 3OS2A 1TYQA 4FLUA 4CJ5A 3NAEA 3VQ5A 2KFZA 3A8YA 1Q7YO 1IO2A 5HP1A 1LWEA 1S72N 1BI4A 2V51B 3KLFA 1NKCA 2FBTA 3TPQA 1LW0A 2XY6A 3GL1A 4O5FA 1NBWA 1XI1A 3F5TA 3HBTA 4YORA 3Q7CA 1LAWA 3HTVA 2Q36A 4DKWA 3CJAA 4CW7B 4UQGA 3TU5A 3IRXA 4AHUA 4KHUA 3EY1A 2YHBA 3D7EO 4YOWA 1TL3A 1RT7A 1A5VA 4Q5VA 2HHIA 4B9VA 3CJ1A 1K8AO 1BUPA 5AQFA 1EXQA 4CFAA 4B3MK 4FWRA 5AQLA 4G9ZA 5AQHA 1FXXA 1NGEA 3NDKA 4I7FA 1N6QA 1SS6A 3VN5A 4W5RA 4EZ6A 3A5NC 5AQRA 1DTTA 3MCAB 3QEVA 2KFNA 5FPDA 4PKHA 2NRVA 3DM2A 1NGFA 4DV3K 1EWRA 3VEYA 4IOXA 4AM7A 5ADXA 1W0HA 2ZJRL 3L4QA 5B8HA 1VSIA 4BC2A 3OYJA 3C6TA 4FZZA 1MA9B 2ZWHA 5JS2A 3S3NA 3QERA 4FSVA 2XY5A 1EKEA 3QEPA 2OZSA 3KK7A 3U8XA 1U45A 1TKXA 1CLQA 1T44A 3R3LA 3RRHA 3HO1A 4B3OA 3QIOA 4DR4K 3CM5A 5F1XA 4BC4A 3OJSA 3K0SA 3V1QA 5BR8K 4BRCA 1S9EA 4Y1CA 5EVZA 2QWQA 1X3MA 2OTLN 2I5JA 5AQUA 2NRZA 1RILA 4I2PA 3VQ9A 1VQPN 3P1GA 3P4IA 4FWNA 3SK3A 4FJXA 1RCHA 2G8KA 4DTXA 3ASMA 3CPWM 3ZT2A 1BCMA 5C24A 2YX6A 5BREA 3SUNA 1JJ2M 1MWKA 1RDWX 4B9SA 4PKGA 3IMXA 4NCAA 1RBSA 1DT9A 5BN8A 1C0MA 2YNHA 4CEZA 1J9AA 5EY4A 3CF5L 1E3MA 4FVMA 4OLBA 3E9OA 2IVPA 2HHWA 4MQ3A 4B1WB 5J2QA 4F3OA 4FLTA 2CGKA 3OW2M 2HF4A 2A6AA 4JKGA 1RT1A 3F2KA 3K58A 1IG9A 3O5BA 4H0YB 3VTHA 3OYKA 5C2FA 5C12A 2ZM6K 2PYLA 1XWLA 2Q31A 4JKEA 2WUSA 2P9PB 3OBWA 3NVMA 4KBOA 2O8BA 1CXQA 1GLDG 5HBMA 2HMPA 3LDQA 1SUQA 4NYFA 5KGXA 1B9DA 4DTSA 1UA0A 1YJWN 4NXNK 4IDHA 4BRQA 2XRIA 5KPZA 4A59A 1JXBA 1BISA 4DFJA 3CCMN 3CYMA 3QEWA 2BTFA 4GMJB 4CBWA 3V9XA 3SPYA 3QNNA 3EKUA 4EP4A 2DFEA 3U4LA 3P31A 1BL3A 1KAYA 3VQ4A 3CJ7A 1Q82O 1UWBA 4BG9A 2P9NB 1H1VA 2IS3A 2DFFA 3AA2A 4CZGA 4JK7A 2UUCK 3O4QA 4EHUA 2FBYA 2KKZA 1V4TA 1U6ZA 2ASMA 3CPEA 1RT3A 1EO1A 4B9NA 2XY7A 3HM8A 4CJQA 1NWKA 4W5TA 1YIJN 3VEWA 2O8CB 3L2WA 4OGCA 4JNEA 1BDGA 3G6EN 4CEQA 1RTHA 4DUYK 4KB0A 3FLCO 4MO4A 4RTFD 2PY5A 3O1WA 1N32K 4KO0A 5AQPA 4H0OA 2QM1A 4CZKA 3RSEB 1P90A 4CZLA 5GAGP 4FJLA 2NRRA 3LANA 4IDKA 2E5LK 4MO5A 1WOQA 4K42A 1BQNA 3DXKB 3AO1A 4B9LA 1SV5A 4FJNA 2IIRA 1TYQB 2W6LA 4OPHA 4DSJA 4DUZK 2CGLA 5AQVA 5JVGL 4FO0A 4CF2A 3WNEA 2VWJA 4NCGA 2P9IA 2YHAA 4CHQA 4F2RA 3CYGA 3CFOA 3ZSOA 4QOZB 4M7XA 3L8BA 3E1YA 4DB3A 1NK9A 1NOZA 1F21A 3VERA 1WBBA 5C42A 3VOVA 1QQOA 2YJEA 4LSLA 3S9HA 5GIPA 5LJVA 1YHQN 1RT4A 3VETA 4ILGB 2OZMA 1ZBHA 1CZ9A 4BEBA 2FF6A 3VF6A 5GAHP 3KHYA 2G8HA 4FK2A 5BPNA 3IS9A 3SPZA 3C94A 1TL1A 3J80O 4DU3A 3AARA 4WF9L 4AHVA 4DV2K 3HI0A 4F9OA 4AQYK 4CHYA 1BGXT 1VQLN 4BR5A 4ELUA 5F2RA 3B8AX 1RDBA 4X62K 1Q9YA 1X1PA 3VGMA 3OHRA 4RWTA 3MN9A 1SKRA 2KTQA 1RFQA 4DR7K 3V9UA 5J2MA 1NK8A 3NFAA 4CEEA 4EFHA 4WQ5C 1VQ6N 2E88A 3IFRA 5ADXH 4DQRA 4CESA 4MLHA 3BP8A 1NK6A 4LH5A 4BDPA 2HHVA 3DWLA 3LP1A 2PAVA 5FRNA 2HBKA 3O9TA 2OPSA 1Q86O 1Z05A 4YOVA 1NK7A 4F2SA 4JI4K 1EQYA 2I7PA 3T1AA 1IBLK 4C1NK 5KQDA 3ZEUA 4IFEA 3JAMO 4CFBA 2X78A 3J7ZO 1T8EA 4GY2B 5ELZA 5BPMA 3KLHA 1X9JA 4K43A 4JKFA 3ID8A 3OS0A 1BWFO 3VGKA 3WXLA 1P8ZA 3KVGA 4DFPA 3NH1A 4IZ9A 2YNGA 3HVRA 5GINA 4OO1J 1NGDA 3L0QA 2P5OA 3HK2A 2E1ZA 4PL8A 3LWMA 4CZEA 3SJJA 3HSTB 1NK4A 3I8DA 2B5JA 2E2NA 1HYVA 4KHSA 4JRPA 4I2QA 4BDZA 5T7BA 4ILJA 1VHXA 2P9KA 4TSXA 4ZTJA 4A2AA 3PY8A 4LF8K 1X9MA 1NMDA 3ZX2A 3SAFA 3MWTA 3ZSVA 4H0XB 4OX9K 4GKKK 3BEXA 3KD1E 5AQMA 2HW3A 1W97L 5AQJA 3WQTA 4CJFA 4NLBA 3MXIA 1VQ7N 2O8EB 3OJUA 3T69A 2QKBA 1HRHA 4JKGB 4E7LA 1HUXA 4IFYA 1BIZA 4CF9A 3I55N 3PX4A 1VSHA 2X6NA 3EEQA 4A61A 4FLVA 2Z1JA 4ELTA 2VGNA 4BC5A 5FROA 2A1RA 3ZSZA 4CK2A 4DR1K 4Z4GA 4IXCA 1KXPA 3L2VA 4Z4CA 2E20A 2ASOA 2D0OA 3KTQA 2QXLA 1YTAA 3F9MA 2KQ2A 5AZIB 2QKKA 4KB1A 4BGAA 3UIQA 4O0IA 3CC4N 1RTDA 1B9FA 3WXKA 3O9RA 3NH0A 4EZ9A 1QZ5A 3LAKA 1QHAA 3SBTA 2FXUA 2Q0RA 3U3GA 2OA8A 1LAVA 1GOCA 4OLAA 3TTDA 4DG1A 4N47A 3CMEN 4DTPA 3HP9A 3I0RA 1HPZA 1NGGA 4BRMA 2UUAK 1X3NA 3SV3A 1NJIO 2NRHA 1A5WA 3RR7A 5FPMA 3NF9A 1KFDA 4CFCA 3DLHA 1S1TA 1KD1O 3I56N 2O4IA 4Z0UA 3KLIA 2QWRA 4EIAA 5EX5A 4GW6A 2ZQBA 4FWSA 2ZE2A 1LCUA 3WNHA 1LV5A 5BRHA 4NYNA 4CEAA 3CI5A 2P9SB 4IG3A 1N36K 2IVOA 4WFNL 1XC3A 4E7JA 1ZC6A 3VMFB 4IG0A 2I7NA 4L3QA 4YY3K 1IKYA 2ZJQL 3HL8A 5LY3A 3RR8A 1LWFA 4DV4K 4UY8O 4CEOA 1KC8O 3VQDA 4B1VA 4BR4A 3CFPA 3T3FA 4YOXA 5AR0A 1BU6O 3I33A 4CZMA 1I3AA 1DEJA 3BGRA 3CCQN 4KHWA 3VESA 4BG8A 5IWAK 3CCJN 2FSKA 1T3VA 2BE2A 1LWCA 3SQ2A 1RBUA 4H4MA 1SL2A 2P9IB 2KZZA 4W5OA 3EE9A 3H45C 1Z25A 3PSFA 2Q3SA 4LF9K 5AQXA 3CG7A 5C10A 1S1UA 3K5OA 4BR0A 3F9KA 3UKUB 4JAXA 1KTQA 4IEIA 1WLJA 3ITHA 1NGCA 3TAPA 3EL2A 1RDDA 1V4SA 4DR3K 1NU0A 4JI8K 3CFRA 2HOEA 2QWPA 1NGHA 3WXIA 5JLFA 2FLOA 1TUUA 3L2QA 3LDNA 2RF2A 3K2PA 5DK5A 4DV1K 2FC0A 1BQMA 1SL1A 4CGIA 3OYCA 4LFCK 1TKTA 3ZSYA 3C0BA 5BRDA 3UB5A 1NG9A 4JV5K 1WB9A 3RVCA 2D0BA 3THVA 4BROA 2HHXA 3IG1A 4NCBA 4DSEA 1JLAA 2QWNA 4X65K 4F3TA 1ATRA 3CXCM 4JHDA 4A5AA 4HVJA 3HPGA 4CJ4A 1ZBFA 3QESA 1NGBA 5IT9O 3N4PA 4BRDA 3CCRN 4CJUA 3KLGA 3SUQA 4FZXC 3VQPA 1NKEA 1YXQA 1EP4A 4DTJA 3DI6A 2BH1A 2PZSA 3AVHA 3PSIA 1HYSA 4N5SA 4XH1A 3B6OA 5LL6Z 3ZETA 3ZEUB 4BE2A 1JKHA 3SQ4A 3ULEA 2D0PA 1YVUA 1JLFA 5LMUK 3WNGA 2HBMA 5CR4A 3A5LC 1JCFA 3D2EA 1VSEA 3THXA 2Y1IA 2IOCA 3O3FA 3LPTA 4IJNA 4CF1A 2A42A 3DJCA 1UAXA 5A2QO 1OH8A 3QMLA 3OYMA 2ZF5O 1ASVA 3CCVN 4WFAL 2P9UB 4CJ3A 3CC2N 4BE0A 3ZSWA 3MAQA 2HHTA 1QVGM 4BQZA 1HLUA 4BACA 3WUHA 3GBTA 2P9KB 2QK9A 1I94K 5KPTA 4AHSA 1B92A 4KFBA 3VF2A 2C1GA 2E2PA 5JMVA 5HROA 1U04A 5HOOA 2ITGA 4JD2A 3O9QA 3KLEA 1WSEA 4GV6A 3FE1A 4W5NA 4YOTA 5JVHL 3AO2A 2PYJA 4CIEA 4DMNA 4YDUA 4FLWA 1ZXOA 2F8SA 3SJHA 2D1KA 4CI6A 4I6MB 4X64K 4FJGA 5AQKA 4FJKA 3O8MA 4W5QA 4FM2A 3DYAA 5M1QA 4JI2K 3SLCA 3ZT0A 3O80A 4J8FA 4FWMA 1S6QA 2Q2RA 4JI1K 3NHGA 1VSDA 3CMAN 3DAWA 5J2PA 1BA0A 3TTFA 4BE1A 4Z4HA 1OVYA 4GV9A 1C0FA 4C8LA 3IKMA 1C0TA 3THWA 4KI4A 5BN9A 2NZTA 4O0JA 4CGDA 3K5LA 3LP0A 1N5YA 3MX5A 5EU7A 1RGIA 4MDAA 4FJHA 2GTDA 4E1MA 4L8RB 4KTWA 4ISGA 1IJJA 4N56A 2KW4A 3E66A 3KWIA 4BE7B 2RHKA 2B6AA 5GIOA 3LZIA 4IWVA 4J2EA 4K8XA 1NJZA 3WEEA 1K8KA 1YI2N 5AZJA 3L2UA 4FWLA 1IV0A 4PHTX 1VSJA 4RCHA 4ILHA 2Y1JA 3QBWA 2EHGA 3V1RA 1DLOA 4H0PA 4DTOA 3K5NA 5DMRA 4CEDA 3DLBA 2KHOA 1RBTA 3ATVA 1UOCA 2Q0UA 5KRTA 2H3GX 3D45A 4IEEA 1RDCA 2ZGZA 4I9QA 1TUYA 1DTQA 3T7ZA 4JKDA 1U48A 3DMJA 3NGZA 1JLEA 3VQ6A 3P39A 4U7BA 2FF3B 3MECA 2JWKA 4GV3A 3AO5A 4C8KA 2OTJN 4FLZA 3J7YP 3FZFA 2BUPA 3EZWA 2D4WA 3BF1A 4DSKA 3U9ZA 3HPOA 3EE8A 5EXWA 4E89A 3HJFA 3CC7N 4IBNA 4RW4A 3SNNA 3QIPA 3DOLA 4CHOA 4DV5K 5JLHA 4BRIA 3VF4A 3FR0A 4QS7A 3VA3A 2QW9A 1XMOK 4DSLA 3SUOA 3NH2A 4C8OA 4FJ5A 3D2FA 3OY9A 4NXMK 4J2AA 1GLLO 4B1ZA 4YNQA 4OPJA 4IOAL 1R59O 4PA1A 1ZBLA 4CD3A 4KH5A 1BOTO 4FLXA 1RBVA 1J6ZA 3LAMA 4CGGA 2GUPA 4CZFA 4O5BA 4KHNA 1I39A 4JHDB 3W3DA 3FZMA 4IO9L 3R8EA 4CBXA 4ZHRA 4FK0A 1XC9A 1IKWA 4LC9B 1VQKN 1KCFA 3JSMA 3T1HK 2BGGA 3THYA 3OYLA 4LF4K 3H08A 2YI1A 3QB0A 3KD5E 4G1QA 3ZETB 2GX9A 4FVUA 3EZ5A 3ULEB 1QQNA 4H03B 4FL9A 2A40A 5H1SQ 2HBJA 3TAFA 1TK8A 1C1AA 1CXUA 3CCSN 4M42A 2F9WA 3D2EB 4ID1A 3THXB 4H5NA 4CJ7A 5MLCQ 4DQQA 2KZMA 4FW2A 1YF5L 1BI4B 4MDBA 1T03A 2ATQA 1S22A 2HHQA 3M8QA 1XMQK 4MLEA 2Z1GA 3T1YK 2HB5A 3GE1A 4FK4A 1QTMA 4CJVA 3E01A 3P38A 4EP5A 4KKOA 1JL2A 3NF7A 1MU2A 3C95A 3MN6A 3TSPA 3V9WA 4JS4A 4AHRA 4BR2A 3U3YA 2DPNA 5CYMA 3OYIA 3WQUA 1C1BA 4M3UA 4FW1A 2HHHK 3TI0A 4J2BA 1RT6A 3OBYA 4JD2B 2QWLA 5K14A 4CZJA 3SZ2A 2WFBA 3KWGA 1O13A 3ENOA 3PO5A 3U6FA 4FJJA 2R7YA 2F9TA 2VG6A 1NJXA 5AQQA 3D6RA 3P5JA 4HUEA 4PUOA 3MK6A 3QFPA 1Q9XA 4JI5K 4I9LA 4E19A 4C23A 4Z4FA 3QDKA 4IOCL 2UUBK 3SQ1A 3CCEN 1GLFO 3AVFA 3QEXA 3H1QA 4JI6K 4X66K 3AVBA 2UXDK 2OCEA 2ZD1A 1KFSA 4E0DA 3DRPA 5AQIA 2O4GA 4AHCA 3MEGA 4M3YA 3AVLA 4BECA 1JLGA 3RWUA 3KKSA 1L3TA 3THWB 3AGRA 4BWJA 4CHNA 4C8NA 3LWLA 4DLEA 4LF5K 4DQ8A 1HNVA 3SAHA 5E41A 2X74A 3L3VA 3V4IA 3EKSA 3BZCA 1TK0A 4BRGA 1NK0A 3H1VX 3R1XA 4KTZA 4CE9A 4BRHA 3BY5A 1TAUA 4GVEA 3VPZA 3SUPA 2IGIA 4BQLA 3OYNA 1VQON 1LOTB 4CCHA 1J5EK 4E1JA 5AFUH 5AZJB 2W40A 1S1VA 4WCEL 4JLHA 3GG4A 3S41A 3J81O 3VEZA 1D9FA 4RW7A 2IDOA 2HBLA 2E4LA 1HR0K 2JLEA 1HPMA 3SI6A 1N34K 1L3VA 3ENBA 3K9KA 3HOTA 4HCBA 3MEDA 4JI0K 2QXFA 1MDUB 5J2NA 3ZT4A 3AVKA 2E6LA 3OYFA 3BF3A 1K6YA 3V6DA 1D4XA 5HRSA 5KPRA 3KK1A 3U9DA 2AP1A 4YDUC 4JI3K 4FJ9A 2O8BB 5JENA 3MN5A 1VQNN 2QI2A 2P5GA 1QE1A 4HUGA 4B9UA 4YOYA 1WSGA 4OGEA 3UE5A 3MEEA 5CHIA 4BRAA 2IAJA 3G10A 3KJVA 2EX3A 2F96A 3ZLJA 4MFBA 5C25A 3C7NA 2Q97A 3M1FA 4CK3A 3TWHA 1Z26A 4CJKA 4CGFA 5FRMA 1CZAN 1QQCA 4M45A 4C1NI 3RMBA 5M1OA 4CJPA 3R9PA 1FKPA 1IH7A 1IKXA 2BANA 3VQAA 4AHTA 1TKZA 4K8ZA 5C2DA 3ZSXA 1RT5A 1N33K 4E7HA 3D2FB 4IFVA 3NGIA 3CCUN 3E9LA 4YFUA 5E84A 4XIUA 1N8RO 3ZT1A 1VQ9N 3OVNA 2E8AA 3H46O 5AQZA 1S1XA 1YJNN 1YT3A 1NGJA 3QINA 1BCOA 3P83D 3RMCA 4JK8A 1BA1A 1S6PA 3NE6A 4DTNA 3OYBA 4XJXA 4JN4A 3THYB 4F8RA 1GLCG 1Q8IA 1S3XA 2E2QA 3CQYA 4JKCA 1KLNA 3GDQA 3H3OB 4DFMA 1DGKN 3KZBA 1D5AA 3AVJA 3EYZA 4M3RA 3MXJA 3VGLA 3TTCA 5D3GA 2O8FA 3BUZB 3AAPA 3H3NO 1XUPO 3JXUA 4BWMA 4FWQA 3CD6N 2X6SA 5FPNA 3AAQA 1KAXA 3KK2A 4BRNA 4M3WA 3TAEA 1UA1A 1HYZA 2GWJA 4CGHA 1YUWA 1RBRA 3TAQA 4M3ZA 4CHZA 3NCIA 3VA0A 2YNIA 4CD1A 1HKGA 2CH6A 1Q81O 1HKBA 1Y97A 1OH6A 1NMNA 2NNWA 2JWLA 3HSCA 4DTMA 3MCPA 2WOMA 4CJSA 1M1KO 4DV6K 4IKFA 1BG3A 3V81A 4OKKA 4BRKA 4OPAA 5F0XA 4BRPA 1TGOA 4KHPK 1T6CA 1QS4A 4BRLA 1SKSA 3VQBA 1QVFM 5KQ8A 4PQUA 4JKAA 2KLAA 3V9SA 4CGJA 5HRNA 4B3SK 2IVNA 3AVCA 3LM9A 4H5RA 5I9EB 3NVKA 1OH5A 4JEPA 3OYAA 3SMPA 1ZYQA 4CBUA 5KRSA 3O08A 4H5WA 4FJ7A 4B9MA 3AO3A 4FLYA 2P9NA 2HNDA 1OVQA 1SAZA 4XH4A 3TR8A 1HX1A 1NM1A 3PIPL 1O1WA 5E26A 1QSSA 4K25A 5M1NA 4B1UB 1JLCA 2HVHA 2PBDA 2O8CA 1TVRA 3AVMA 4GNIA 5GAEP 1JLBA 3M3ZA 3J7AP 2W6KA 1HNZK 3SBGA 1VQMN 2E2OA 1JCGA 1VK0A 4DR5K 2A41A 1KVAA 1HKCA 1T6DA 4F4KA 4BVPA 3RSEA 3OTOK 1A5XA 2VQFK 3VEVA 3VQCA 3W0LA 1XHZA 1TKDA 3WT0A 4CF0A 4CERA 3SMSA 4DF4A 3OA9A 5CE3A 1Z6RA 1HMVA 1YTUA 2ETJA 4OKEA 3ZSQA 4CJRA 4LSNA 2W41A 4DHYA 3LM2A 2D0CA 3M6GA 2XHBA 3SAGA 1HQUA 4LF6K 2ZJPL 3LALA 2QWOA 4ZTFA 3FFIA 4E1NA 3BZKA 4Z94A 4B1XB 1R0AA 4AILC 2PFUA 1ASUA 3CETA 4CF8A 5JICA 4Q0BA 3G0ZA 3A2FA 4DCHA 1J5OA 1D9DA 3SCXA 3MWPA 2GWKA 3KK3A 4CHPA 4R79A 1ZBUA 4FPBA 3QBXA 3LDSA 4AM6A 1RTJA 3L6QA 4CZIA 2GEMA 2GV9A 1FK9A 3O3GA 4DR2K 4DS4A 1VRUA 2NUBA 1HQEA 1WAJA 4H0VB 1XHXA 3C65A 5BPLA 1NGIA 3LZJA 3A0IX 2W42A 3ULDA 4E7IA 4FJ8A 4IJAA 1SL0A 2GUIA 3NF6A 3CJBA 3PX0A 1K9MO 4XEIA 2F7TA 4OVLA 5J1EA 3C7NB 2YHYA 3VQ8A 2OYQA 3LP2A 1NOYA 1KQSM 5TKYA 3VEOA 4FOEA 3M8RA 2HHSA 3ZCMA 3FZHA 3EN9A 1L3UA 4FYDA 3WXMB 2YNFA 5FPEA 5KI6A 4WQ4A 4M3XA 3FFKB 1IKVA 3TSQA 2HF3A 4CK1A 4KAZA 1RDAA 3CM6A 4KH4A 5BRFA 2YV0X 5AFUA 1W2BM 2A3ZA 2UYTA 2OANA 4DR6K 2C1IA 4FJMA 4AF1A 2D5RA 4C8MA 3M8PA 1L5UA 1KSPA 3RMDA 2FSNA 4JK9A 2AJQA 2XO7A 3CJ9A 3QLHA 2D0AA 3ATUA 1T7PA 1W7AA 4ID5A 2A5XA 2O8FB 2O8DA 5AJ3K 2QWMA 3V9ZA 3PUFA 4YOUA 3K57A 4CJWA 4KTQA 4BGBA 3O9SA 3TSUA 1HJRA 1VAZA 4HUFA 2O8EA 2VWBA 1DKGD 4N76A 4A2BA 3DOKA 2DTUA 4A57A 4FPAA 3B6PA 1E4FT 4CIGA 3L3UA 4DWIA 1GLEG 1VQ5N 1OH7A 2DY4A 2G8VA 4O8UA 4PWDA 2F4VK 3R6MA 4JKHA 5SWMA 5AZIA 2FSJA 4FWOA 4BVOA 3OYEA 3FGUA 2XY8A 3AVIA 3TABA 1KRPA 1XNRK 1YVNA 3CHWA 1C0UA 4JS5A 3BDPA 3PX6A 3WXJA 2Q1NA 3ZX0A 1SKWA 4U67L 2VYPA 2Z1HA 4A62A 2UU9K 5C15A 1IBKK 4KREA 1EWQA 3NF8A 4KV8A 4DU1A 3CERA 2NRTA 3MXMA 2P9LA 5GADP 3UKRA 1WUAA 3VENA 2QEXN 4DU4A 5AQNA 4B8CA 2VCPA 2YKMA 4OJRA 2WTUA 1QZ6A 3IAYA 1S5JA 1HNXK 3LDOA 1M90O 4ICLA 4GVMA 1IBMK 3WNFA 1FKOA 3C6AA 5TKWA 3TARA 1NJYA 1X9WA 2P9SA 2V52B 1U4BA 4BREA 1XNQK 3CCLN 3S3OA 3HVTA 3KIOA 1VSKA 3NGYA 4B9QA 2VGMA 1KAZA 5AQYA 5AQSA 4PY5A 3N4QA 2YJFA 4CIFA 1L3SA 5EOYA 1VQ8N 3PO4A 3LDLA 2YKNA 3O4NA 5AQGA 3I8BA 3S3MA 2HMIA 4H8KA 1ZBSA 2JGUA 3A5MC 3DRSA 4BR7A 1S1WA 4QCLA 1U2VA 1NNEA 2NRWA 4WFBL 2GELA 3G25A 3CJCA 5SZTA 3ALYA 3O1BA 2HHUA 4DQIA 3HPHA 4RW6A 3UKUA 1WSJA 2RPIA 1BIUA 2V7YA 5I42A 4AH9A 2WBNA 4DLGA 1FW6A 3DXMA 1GLBG 3IDHA 3MDQA 3NBPA 3J8AA 3HP6A 1GLJO 1YAGA 1Q18A 3O9UA 4QS8A 4O8KA 3SYZA 4HCCA 4H4OA 4K41A 1ATSA
chains in the Genus database with same CATH topology
5E84A 4H0YB 4Y0WA 1N8RO 3DJCA 3VTHA 1VQ9N 5C2FA 3VEXA 5C12A 4FOIA 2E8AA 3QMLA 2Q31A 3H46O 4JKEA 2WUSA 5AQZA 3H6EA 2YCHA 2P9PB 2ZF5O 1YJNN 3OBWA 1NGJA 3CCVN 4WFAL 2P9UB 3CC2N 3NVMA 4KBOA 1GLDG 1QVGM 4WYBA 4BQZA 1ILYA 1HLUA 4JK8A 4NB4A 1BA1A 3WUHA 3LDPA 2HMPA 3GBTA 1VQ4N 2P9KB 3LDQA 4XJXA 4JN4A 5KPTA 1YJWN 4IDHA 1GLCG 2E2QA 1S3XA 3CQYA 4JKCA 3VTIA 4BRQA 1K73O 3GDQA 3H3OB 3VF2A 1DGKN 3KZBA 5KPZA 2C1GA 3VGLA 3TTCA 1JCEA 2E2PA 4A59A 5JMVA 3BUZB 3CCMN 3AAPA 3H3NO 1XUPO 3JXUA 3JS6A 2BTFA 4FWQA 5HOOA 3CD6N 2CGJA 4CBWA 4JD2A 3QICA 3O9QA 5FPNA 3AAQA 4GV6A 3EKUA 3FE1A 1KAXA 2ITMA 3U4LA 3P31A 3ID6A 4YOTA 3C6HA 2ZGYA 4BRNA 1KAYA 5JVHL 3CJ7A 4YDUA 1Q82O 1ZXOA 3LL3A 4BG9A 2P9NB 1H1VA 2GWJA 3CXCM 1YUWA 4CZGA 3O4WA 4JK7A 3SJHA 4EHUA 3CPEA 2D1KA 1V4TA 1U6ZA 2ASMA 1K8KB 2KKZA 3WEEB 4I6MB 4CI6A 1EO1A 5AQKA 4CD1A 1NLVA 1HKGA 2CH6A 3HM8A 1HKBA 1Q81O 1NWKA 1YIJN 3O8MA 2NNWA 3VEWA 2J4RA 2JWLA 3HSCA 5M1QA 3SLCA 4JNEA 3MCPA 1BDGA 1MWMA 3O80A 3G6EN 4J8FA 4FWMA 3HZ6A 2P9UA 2E1YA 4HTLA 4B1YB 1M1KO 2Q2RA 3FLCO 1BG3A 3CMAN 4MO4A 3DAWA 4RTFD 1BA0A 3GOIA 3O1WA 3TTFA 1SZ2A 5AQPA 4H0OA 2QM1A 4BRKA 4CZKA 3ZX3A 4OPAA 5F0XA 3RSEB 1YJ9N 4BRPA 1P90A 3EO3A 4CZLA 4PL7A 5HL7L 5GAGP 4BEBA 1OVYA 5C0YA 1T6CA 4BRLA 2NRRA 4GV9A 5M1KA 1C0FA 4MO5A 1WOQA 4K42A 1NGAA 3IKMA 5AQOA 1QVFM 5KQ8A 4JKAA 5BN9A 2NZTA 2KLAA 1RDUA 3DXKB 3Q7BA 2IIRA 2IVNA 1TYQB 3LM9A 3MX5A 4H5RA 5I9EB 4OPHA 3NVKA 1RGIA 3CQXA 3DLLL 2CGLA 5AQVA 5JVGL 4FO0A 5AQTA 4JEPA 4MDAA 3SMPA 2WC9A 4CBUA 3O08A 4H5WA 2P9IA 2GTDA 4ISGA 2P9NA 1IJJA 1SAZA 4XH4A 3E66A 4M7XA 3KWIA 4BE7B 2RHKA 3E1YA 1HX1A 5GIOA 4NO7A 1NM1A 4IWVA 4JKBA 4DB3A 3PIPL 3WEEA 4XH5A 3VERA 1K8KA 5E26A 4I6MA 4K25A 1YI2N 3VOVA 5M1NA 1QQOA 2YJEA 4B1UB 5AZJA 5GIPA 5LJVA 4FWLA 4PHTX 1YHQN 4RCHA 2PBDA 4ILHA 3MMVA 3VETA 4ILGB 1OKJA 4H0TB 4GNIA 1XQSC 4PKIA 2FF6A 1Y64A 3M3ZA 3QBWA 1SQKA 3VF6A 3KHYA 4BC3A 5GAHP 2EWSA 5BPNA 4H0PA 3SBGA 1VQMN 2E2OA 1JCGA 2A41A 2KHOA 3AARA 3ATVA 4EHTA 4WF9L 2QTDA 1HKCA 1T6DA 3HI0A 4BVPA 3RSEA 4F9OA 3PIOL 2Q0UA 1VQLN 4BR5A 2H3GX 4IEEA 5F2RA 2ZGZA 3B8AX 1IG8A 3VEVA 1TUYA 4WQ4C 3VGMA 3CIPA 3OHRA 3MN9A 3W0LA 3T7ZA 4RWTA 4JKDA 3G71N 2HSTA 4HWIA 3WT0A 3SMSA 1RFQA 3OA9A 5CE3A 1Z6RA 4ISEA 4EFHA 4WQ5C 1YITN 2P9LB 3P39A 4U7BA 1VQ6N 2FF3B 2JWKA 2W41A 3UKRB 4GV3A 2E88A 3QFUA 4DHYA 3IFRA 5ADXH 3LM2A 4MLHA 3M6GA 3BP8A 2OTJN 4KH6A 3FZFA 3DWLA 3SAGA 2PAVA 2YHWA 2ZJPL 2HBKA 2BUPA 3O9TA 4M7YA 2QWOA 3EZWA 2D4WA 3BF1A 3U9ZA 1Z05A 4YOVA 1Q86O 3EE8A 4NLCA 5EXWA 4BR9A 1EQYA 3FZLA 3CC7N 2I7PA 4Z94A 4B1XB 4ISFA 2PFUA 4C1NK 3CETA 1ESVA 4M63C 3ZEUA 4IFEA 5JICA 5KQDA 4DCHA 5JLHA 2CH5A 3VF4A 4BRIA 3FR0A 4QS7A 3J7ZO 3MWPA 2GWKA 2QW9A 3K9JA 4R79A 2W00A 4GY2B 1GLAG 5ELZA 5BPMA 4FPBA 1X9JA 3QBXA 3L4IA 4K43A 2QA4N 4JKFA 4A5BA 4AM6A 3ID8A 3D2FA 3L6QA 5M1PA 4CZIA 1BWFO 3VGKA 5DM7L 3WXLA 1P8ZA 2GEMA 3KVGA 4H5TA 3AY9A 5BR9A 1GLLO 4IZ9A 4B1ZA 1BO5O 5DM6L 4IOAL 1R59O 3MN7A 4QS9A 5GINA 4CD3A 4KH5A 1NGDA 1BOTO 1HJOA 3L0QA 3O6WA 2E1ZA 1J6ZA 4PL8A 4OO1J 4H0VB 2GUPA 2P9PA 3FZKA 3C65A 4CZFA 4CZEA 5BPLA 1NGIA 4JHDB 3W3DA 3A0IX 2E2NA 3FZMA 4IJAA 4IO9L 1U2VB 3R8EA 4CBXA 3CJBA 3PLAA 1K9MO 4XEIA 4ILJA 2F7TA 3M5RA 4LC9B 1G99A 3C7NB 1ATNA 2P9KA 2YHYA 1VQKN 4CZHA 3HOSA 1KQSM 4A2AA 5TKYA 1NMDA 2YI1A 3VEOA 3QB0A 3MWTA 3ZX2A 1E4GT 4H0XB 4FOEA 4BRFA 3BEXA 3AGKA 5AQMA 3ZETB 2GX9A 4FVUA 1W97L 5AQJA 3WQTA 3FZHA 2NRXA 3ULEB 1QQNA 4H03B 3EN9A 4NLBA 4BY9C 4FL9A 2A40A 3DXMB 4H5VA 5H1SQ 2HBJA 1VQ7N 3T69A 2AA4A 4JKGB 1HUXA 3WXMB 5FPEA 2NLXA 4WQ4A 3CCSN 3I55N 3FFKB 5M1FA 2F9WA 3D2EB 3TSQA 2HF3A 4A61A 4H5NA 4CJ7A 5MLCQ 1YF5L 2VGNA 3MX2A 4IO8A 4BC5A 4KH4A 5BRFA 1C0GA 5AFUA 4MDBA 1W2BM 4WQ5A 2A3ZA 3HRGA 1S22A 4MLEA 2UYTA 2OANA 3A5OC 4FWPA 2C1IA 3G4SN 4IXCA 4AF1A 1KXPA 2E20A 2ASOA 2D0OA 2QXLA 3GE1A 3F9MA 3P38A 5AZIB 2FSNA 4JK9A 4BGAA 3CJ9A 4FWKA 3CC4N 3MN6A 3TSPA 2YHXA 3ATUA 3WXKA 3O9RA 3ZYYX 5AQWA 3E9PA 1QZ5A 2ASPA 4BR2A 5LJWA 5GAEP 4EAHD 2DPNA 1QHAA 2A5XA 2QWMA 1QQMA 3IUCA 3SBTA 2FXUA 3WQUA 3NMUA 2Q0RA 2RE2A 4YOUA 2V7ZA 3OBYA 4JD2B 2QWLA 3TTDA 3DXKA 4CZJA 3ENHA 4BGBA 3O9SA 3CMEN 2WFBA 3KWGA 3TSUA 1VAZA 1O13A 1TYQA 2VWBA 3ENOA 1DKGD 4A2BA 1NGGA 4BRMA 2F9TA 4A57A 1X3NA 4FPAA 5AQQA 1NJIO 3D6RA 2NRHA 3A8YA 1Q7YO 5FPMA 3MK6A 1E4FT 1S72N 2V51B 3QFPA 1GLEG 1KD1O 3I56N 3SAFA 1VQ5N 3TPQA 4C23A 2QWRA 3GL1A 3QDKA 4O5FA 4EIAA 4IOCL 1NBWA 5EX5A 3CCEN 3F5TA 3HBTA 4O8UA 4YORA 3Q7CA 1GLFO 4FWSA 3HTVA 1LCUA 2Q36A 4DKWA 3H1QA 5BRHA 3CJAA 3R6MA 4JKHA 3TU5A 3CI5A 3D7EO 4YOWA 5AZIA 2P9SB 2FSJA 4FWOA 4BVOA 2IVOA 4WFNL 3CJ1A 1XC3A 3FGUA 1BUPA 5AQIA 5AQFA 1K8AO 1ZC6A 3VMFB 4FWRA 5AQLA 2I7NA 4L3QA 1YVNA 5AQHA 2ZJQL 4G9ZA 1NGEA 4BECA 3CHWA 5LY3A 4UY8O 3WXJA 3AGRA 2Q1NA 1SS6A 3ZX0A 1KC8O 3A5NC 5AQRA 4B1VA 4DQ8A 3MCAB 4BR4A 4U67L 3SAHA 4YOXA 5FPDA 4PKHA 2NRVA 2VYPA 5AR0A 4A62A 1BU6O 1NGFA 3I33A 4AM7A 3VEYA 4IOXA 4CZMA 1DEJA 5C15A 3EKSA 3CCQN 3VESA 4BG8A 3CCJN 2FSKA 1T3VA 5ADXA 4BRGA 3H1VX 3R1XA 2ZJRL 3L4QA 2P9IB 3CERA 2NRTA 2P9LA 5B8HA 4BC2A 4BRHA 5GADP 4GVEA 3VPZA 3UKRA 3EE9A 3H45C 1MA9B 1WUAA 2ZWHA 3VENA 4BQLA 2QEXN 5AQXA 1VQON 1LOTB 5C10A 5AQNA 4E1JA 5AZJB 2W40A 2VCPA 4FSVA 5AFUH 3UKUB 4BR0A 4JAXA 4WCEL 4IEIA 3KK7A 3U8XA 1NGCA 1QZ6A 3EL2A 3GG4A 1V4SA 3S41A 3LDOA 1T44A 3R3LA 3VEZA 1M90O 2HOEA 3C6AA 5TKWA 2QWPA 4BC4A 2HBLA 1NGHA 5F1XA 1HPMA 2P9SA 3ENBA 2V52B 3K9KA 3WXIA 5JLFA 3HOTA 4BREA 2FLOA 4BRCA 3CCLN 1TUUA 1MDUB 3LDNA 5EVZA 2QWQA 1X3MA 4B9QA 3BF3A 2VGMA 2OTLN 5AQUA 2NRZA 1KAZA 5AQYA 3C0BA 1D4XA 3N4QA 5AQSA 2YJFA 3UB5A 5BRDA 1VQPN 3RVCA 3P4IA 5KPRA 4FWNA 3U9DA 3SK3A 4BROA 2AP1A 4YDUC 5EOYA 1VQ8N 2QWNA 3MN5A 1VQNN 2QI2A 3LDLA 1ATRA 3CPWM 5AQGA 4YOYA 1JJ2M 2YX6A 3I8BA 5BREA 4JHDA 1MWKA 1RDWX 1ZBSA 3A5MC 4PKGA 4A5AA 4BR7A 3UE5A 1NGBA 1U2VA 3IMXA 3N4PA 4BRAA 4BRDA 1DT9A 5BN8A 5CHIA 3CCRN 2NRWA 4WFBL 2GELA 3G25A 3CJCA 5EY4A 3CF5L 3C7NA 2Q97A 3O1BA 1YXQA 3M1FA 2BH1A 3UKUA 1CZAN 3E9OA 4C1NI 4XH1A 2IVPA 2V7YA 5M1OA 3ZETA 3ZEUB 3R9PA 4B1WB 3ULEA 2WBNA 2D0PA 3DXMA 2CGKA 3OW2M 2HF4A 5C2DA 1GLBG 2A6AA 3IDHA 4JKGA 3MDQA 2HBMA 3J8AA 3F2KA 5CR4A 3A5LC 1JCFA 1GLJO 1Q18A 1YAGA 3D2FB 3D2EA 3O9UA 4QS8A 4O8KA 3O5BA 3CCUN 4IJNA 3E9LA 4K41A 2A42A 1ATSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E84 A;  4H0Y B;  4Y0W A;  3DJC A;  3VEX A;  4FOI A;  2E8A A;  3QML A;  2Q31 A;  3H46 O;  2WUS A;  5AQZ A;  3H6E A;  2YCH A;  2P9P B;  2ZF5 O;  1NGJ A;  2P9U B;  4KBO A;  1GLD G;  4WYB A;  4BQZ A;  1HLU A;  4NB4 A;  1BA1 A;  3WUH A;  3LDP A;  2HMP A;  3GBT A;  2P9K B;  3LDQ A;  4JN4 A;  5KPT A;  1GLC G;  2E2Q A;  1S3X A;  3CQY A;  4BRQ A;  3GDQ A;  3H3O B;  3VF2 A;  1DGK N;  3KZB A;  5KPZ A;  3VGL A;  1JCE A;  2E2P A;  5JMV A;  3BUZ B;  3AAP A;  3H3N O;  1XUP O;  3JXU A;  3JS6 A;  2BTF A;  4FWQ A;  2CGJ A;  4CBW A;  4JD2 A;  3QIC A;  5FPN A;  3AAQ A;  3EKU A;  3FE1 A;  1KAX A;  2ITM A;  3U4L A;  2ZGY A;  4BRN A;  1KAY A;  3CJ7 A;  4YDU A;  1ZXO A;  3LL3 A;  4BG9 A;  2P9N B;  1H1V A;  2GWJ A;  1YUW A;  4CZG A;  3O4W A;  3SJH A;  4EHU A;  2D1K A;  1V4T A;  1U6Z A;  2ASM A;  1K8K B;  3WEE B;  4CI6 A;  4I6M B;  5AQK A;  4CD1 A;  1NLV A;  1HKG A;  2CH6 A;  3HM8 A;  1HKB A;  1NWK A;  3O8M A;  3VEW A;  2J4R A;  3HSC A;  3SLC A;  4JNE A;  3MCP A;  1BDG A;  1MWM A;  3O80 A;  4J8F A;  4FWM A;  3HZ6 A;  2P9U A;  2E1Y A;  4HTL A;  4B1Y B;  2Q2R A;  3FLC O;  1BG3 A;  4MO4 A;  3DAW A;  4RTF D;  1BA0 A;  3GOI A;  3O1W A;  1SZ2 A;  5AQP A;  4H0O A;  2QM1 A;  4BRK A;  4CZK A;  3ZX3 A;  5F0X A;  3RSE B;  4BRP A;  4PL7 A;  3EO3 A;  4CZL A;  1T6C A;  4BRL A;  1C0F A;  4MO5 A;  1WOQ A;  4K42 A;  1NGA A;  5AQO A;  5KQ8 A;  5BN9 A;  2NZT A;  3DXK B;  2IIR A;  2IVN A;  1TYQ B;  3LM9 A;  4H5R A;  5I9E B;  1RGI A;  3CQX A;  2CGL A;  5AQV A;  4FO0 A;  5AQT A;  3SMP A;  4CBU A;  3O08 A;  4H5W A;  2P9I A;  2GTD A;  4ISG A;  2P9N A;  1IJJ A;  1SAZ A;  4XH4 A;  4M7X A;  1HX1 A;  4NO7 A;  1NM1 A;  4IWV A;  4DB3 A;  3WEE A;  4XH5 A;  3VER A;  1K8K A;  5E26 A;  4I6M A;  4K25 A;  3VOV A;  1QQO A;  2YJE A;  4B1U B;  5AZJ A;  5LJV A;  4FWL A;  4RCH A;  2PBD A;  3MMV A;  3VET A;  1OKJ A;  4H0T B;  4GNI A;  1XQS C;  4PKI A;  2FF6 A;  1Y64 A;  3M3Z A;  3QBW A;  1SQK A;  3VF6 A;  3KHY A;  4BC3 A;  2EWS A;  5BPN A;  4H0P A;  2E2O A;  1JCG A;  2A41 A;  2KHO A;  3AAR A;  3ATV A;  4EHT A;  1HKC A;  1T6D A;  3HI0 A;  4BVP A;  3RSE A;  4F9O A;  2Q0U A;  4BR5 A;  2H3G X;  5F2R A;  2ZGZ A;  3B8A X;  1IG8 A;  3VEV A;  1TUY A;  4WQ4 C;  3VGM A;  3CIP A;  3OHR A;  3MN9 A;  3W0L A;  4RWT A;  4HWI A;  3WT0 A;  3SMS A;  1RFQ A;  5CE3 A;  1Z6R A;  4ISE A;  4EFH A;  4WQ5 C;  2P9L B;  2FF3 B;  3UKR B;  2W41 A;  2E88 A;  3QFU A;  4DHY A;  3IFR A;  5ADX H;  3LM2 A;  4MLH A;  3M6G A;  3BP8 A;  3FZF A;  3DWL A;  2PAV A;  2YHW A;  4M7Y A;  2BUP A;  2QWO A;  3EZW A;  2D4W A;  3BF1 A;  3U9Z A;  1Z05 A;  5EXW A;  4BR9 A;  1EQY A;  3FZL A;  2I7P A;  4Z94 A;  4B1X B;  4ISF A;  5KQD A;  3CET A;  1ESV A;  4M63 C;  3ZEU A;  5JIC A;  4DCH A;  5JLH A;  2CH5 A;  3VF4 A;  4BRI A;  3FR0 A;  4QS7 A;  2GWK A;  2QW9 A;  4GY2 B;  1GLA G;  5ELZ A;  5BPM A;  4FPB A;  1X9J A;  3QBX A;  3L4I A;  4K43 A;  4AM6 A;  3ID8 A;  3D2F A;  3L6Q A;  4CZI A;  1BWF O;  3VGK A;  3WXL A;  1P8Z A;  2GEM A;  3KVG A;  4H5T A;  3AY9 A;  5BR9 A;  1GLL O;  4IZ9 A;  4B1Z A;  1BO5 O;  1R59 O;  3MN7 A;  4QS9 A;  4CD3 A;  1NGD A;  1BOT O;  1HJO A;  3L0Q A;  3O6W A;  2E1Z A;  1J6Z A;  4PL8 A;  4H0V B;  2GUP A;  2P9P A;  3FZK A;  4CZF A;  4CZE A;  5BPL A;  1NGI A;  4JHD B;  3W3D A;  3A0I X;  2E2N A;  3FZM A;  4IJA A;  1U2V B;  3R8E A;  4CBX A;  3CJB A;  4XEI A;  4LC9 B;  1G99 A;  3C7N B;  1ATN A;  2P9K A;  2YHY A;  4CZH A;  4A2A A;  5TKY A;  1NMD A;  2YI1 A;  3VEO A;  3QB0 A;  3ZX2 A;  4BRF A;  1E4G T;  4H0X B;  4FOE A;  3BEX A;  5AQM A;  3ZET B;  5AQJ A;  3WQT A;  3FZH A;  3ULE B;  1QQN A;  4H03 B;  3EN9 A;  4FL9 A;  2A40 A;  3DXM B;  4H5V A;  2AA4 A;  1HUX A;  5FPE A;  2NLX A;  4WQ4 A;  3FFK B;  2F9W A;  3D2E B;  2HF3 A;  4A61 A;  4H5N A;  4CJ7 A;  4IO8 A;  4BC5 A;  5BRF A;  1C0G A;  5AFU A;  4WQ5 A;  2A3Z A;  1S22 A;  4MLE A;  2UYT A;  2OAN A;  3A5O C;  4FWP A;  4IXC A;  1KXP A;  2E20 A;  2ASO A;  2D0O A;  2QXL A;  3GE1 A;  3F9M A;  5AZI B;  2FSN A;  4BGA A;  3CJ9 A;  4FWK A;  3MN6 A;  2YHX A;  3ATU A;  3WXK A;  5AQW A;  1QZ5 A;  2ASP A;  4BR2 A;  5LJW A;  4EAH D;  2DPN A;  1QHA A;  2A5X A;  2QWM A;  1QQM A;  3IUC A;  3WQU A;  2FXU A;  2Q0R A;  2V7Z A;  4JD2 B;  2QWL A;  4CZJ A;  3DXK A;  3ENH A;  4BGB A;  1TYQ A;  2VWB A;  3ENO A;  1DKG D;  4A2B A;  1NGG A;  4BRM A;  2F9T A;  1X3N A;  4FPA A;  5AQQ A;  2NRH A;  3A8Y A;  5FPM A;  3MK6 A;  1E4F T;  2V51 B;  3QFP A;  1GLE G;  3TPQ A;  4C23 A;  2QWR A;  3GL1 A;  3QDK A;  4O5F A;  4EIA A;  1NBW A;  5EX5 A;  3HBT A;  1GLF O;  4FWS A;  3HTV A;  1LCU A;  2Q36 A;  3H1Q A;  5BRH A;  3CJA A;  3R6M A;  3TU5 A;  3CI5 A;  3D7E O;  5AZI A;  2P9S B;  2FSJ A;  4FWO A;  4BVO A;  2IVO A;  3CJ1 A;  1XC3 A;  3FGU A;  1BUP A;  5AQI A;  5AQF A;  1ZC6 A;  4FWR A;  5AQL A;  2I7N A;  4L3Q A;  1YVN A;  5AQH A;  1NGE A;  3CHW A;  5LY3 A;  3WXJ A;  2Q1N A;  3ZX0 A;  3A5N C;  5AQR A;  4B1V A;  4DQ8 A;  4BR4 A;  5FPD A;  4PKH A;  2VYP A;  5AR0 A;  4A62 A;  1BU6 O;  1NGF A;  3I33 A;  4AM7 A;  3VEY A;  4CZM A;  1DEJ A;  3EKS A;  3VES A;  4BG8 A;  2FSK A;  5ADX A;  4BRG A;  3H1V X;  2P9I B;  3CER A;  2P9L A;  5B8H A;  4BC2 A;  4BRH A;  3VPZ A;  3UKR A;  3H45 C;  1MA9 B;  1WUA A;  2ZWH A;  3VEN A;  4BQL A;  5AQX A;  1LOT B;  5AQN A;  4E1J A;  5AZJ B;  2W40 A;  2VCP A;  4FSV A;  5AFU H;  3UKU B;  4BR0 A;  4JAX A;  3U8X A;  1NGC A;  1QZ6 A;  3EL2 A;  3GG4 A;  1V4S A;  3S41 A;  3LDO A;  1T44 A;  3VEZ A;  2HOE A;  5F1X A;  4BC4 A;  2QWP A;  1NGH A;  1HPM A;  2P9S A;  2V52 B;  3WXI A;  5JLF A;  4BRE A;  2FLO A;  4BRC A;  1TUU A;  1MDU B;  3LDN A;  5EVZ A;  2QWQ A;  1X3M A;  4B9Q A;  3BF3 A;  5AQU A;  1KAZ A;  5AQY A;  3C0B A;  1D4X A;  5AQS A;  3UB5 A;  2YJF A;  5BRD A;  5KPR A;  3P4I A;  4FWN A;  3U9D A;  3SK3 A;  4BRO A;  2AP1 A;  4YDU C;  5EOY A;  2QWN A;  3MN5 A;  3LDL A;  1ATR A;  5AQG A;  3I8B A;  5BRE A;  4JHD A;  1MWK A;  1RDW X;  1ZBS A;  3A5M C;  4PKG A;  4BR7 A;  3UE5 A;  1NGB A;  1U2V A;  3IMX A;  4BRA A;  4BRD A;  5BN8 A;  2GEL A;  3G25 A;  3CJC A;  5EY4 A;  3C7N A;  2Q97 A;  3O1B A;  1YXQ A;  3M1F A;  3UKU A;  1CZA N;  4XH1 A;  2IVP A;  2V7Y A;  3ZET A;  3ZEU B;  3R9P A;  4B1W B;  3ULE A;  2D0P A;  3DXM A;  2CGK A;  2HF4 A;  1GLB G;  2A6A A;  3IDH A;  3MDQ A;  3J8A A;  3A5L C;  1JCF A;  1GLJ O;  1Q18 A;  1YAG A;  3D2F B;  3D2E A;  4QS8 A;  4O8K A;  3O5B A;  4IJN A;  4K41 A;  2A42 A;  1ATS A; 
#chains in the Genus database with same CATH topology
 4Y0W A;  3VEX A;  1C1C A;  4FOI A;  4B3R K;  3H6E A;  2YCH A;  4FJI A;  3PV8 A;  3RMA A;  1WSH A;  1ILY A;  4WYB A;  4K0K K;  1RTI A;  4NB4 A;  3OYD A;  1VQ4 N;  3LDP A;  3TAG A;  3VTI A;  2WON A;  5CZ1 A;  1K73 O;  4B8A B;  1D8Y A;  2RKI A;  4CEF A;  2DFH A;  1JCE A;  3JS6 A;  1GOA A;  4BDY A;  2GBZ A;  1ZBI A;  3TAM A;  5I3U A;  2CGJ A;  4DF8 A;  4JI7 K;  3QIC A;  3HT3 A;  2ITM A;  4DTU A;  3ID6 A;  4KHQ A;  3C6H A;  2ZGY A;  4OPK A;  3ISN C;  3LL3 A;  4R5P A;  3O4W A;  3OYG A;  4ELV A;  4GKJ K;  3T19 A;  1RNH A;  3WEE B;  3K5M A;  1K8K B;  3DRR A;  1NLV A;  4DQS A;  2FBV A;  3VQQ A;  4E3S A;  2J4R A;  1J54 A;  2E6M A;  1VSF A;  1MWM A;  3HZ6 A;  4RW9 A;  4CVN E;  2P9U A;  2E1Y A;  4HTL A;  4B1Y B;  4JRQ A;  2P51 A;  3M8S A;  3OS1 A;  1W9H A;  3GOI A;  1FJG K;  1SZ2 A;  1YJ9 N;  3ZX3 A;  5KTQ A;  2G8W A;  4PL7 A;  3EO3 A;  5HL7 L;  2O8D B;  5C0Y A;  1JL1 A;  5M1K A;  3HXM A;  1NGA A;  4B9T A;  5AQO A;  4HTU A;  2FBX A;  1RDU A;  3DLK A;  3Q7B A;  2UXB K;  4JYA K;  4Y1D A;  2P1J A;  3CQX A;  3DLL L;  5AQT A;  1HNW K;  4FXD A;  3JYT A;  2OPR A;  4CFD A;  1GOB A;  2WC9 A;  4CEB A;  4E72 A;  4LD0 A;  2HNZ A;  4LFB K;  2B4J A;  4KRF A;  4NO7 A;  4JKB A;  3HYF A;  4Z4E A;  4XH5 A;  4I6M A;  4FCY A;  4N41 A;  3AVA A;  2LSN A;  4O4G A;  1WBD A;  3V1O A;  3L2R A;  2IC3 A;  3MMV A;  1WSI A;  1RT2 A;  1OKJ A;  4H0T B;  1XQS C;  2OPP A;  4PKI A;  1Y64 A;  4BC3 A;  1SQK A;  2G8U A;  2EWS A;  5CY4 A;  1LW2 A;  1S9G A;  4FM0 A;  1NJW A;  4E7K A;  4EHT A;  1BHL A;  2QTD A;  3PIO L;  1WAF A;  4OKJ A;  1TK5 A;  2HNY A;  1U49 A;  1IG8 A;  1QHT A;  4WQ4 C;  3K59 A;  3CIP A;  3SQ0 A;  3G71 N;  1CZB A;  2HST A;  2F8T A;  1ASW A;  4DQP A;  4HWI A;  4ISE A;  4O55 A;  4FZY A;  1YIT N;  2P9L B;  1G15 A;  3UKR B;  4DFK A;  3QFU A;  1U47 A;  3AA3 A;  2VWK A;  4KH6 A;  3HM9 A;  3QO9 A;  1KVC A;  2YHW A;  1TV6 A;  3AV9 A;  4M7Y A;  5JS1 A;  3LP3 A;  5CYQ A;  4B08 A;  2G8F A;  5FLX O;  4NLC A;  2VG7 A;  4LH4 A;  4BR9 A;  3FZL A;  3F73 A;  4FM1 A;  4KPY A;  3SV4 A;  4ISF A;  2A1S A;  4O44 A;  4CEC A;  1ESV A;  4M63 C;  1HNI A;  2CH5 A;  3DLR A;  5CZ2 A;  4HHT A;  4DSI A;  4CJL A;  3K9J A;  2W00 A;  1GLA G;  2QA4 N;  3L4I A;  3AVN A;  4A5B A;  1WNS A;  5M1P A;  5DM7 L;  1NKB A;  4M3T A;  3O3H A;  4DSF A;  4KHY A;  4H5T A;  1QSY A;  3AY9 A;  5BR9 A;  1J53 A;  3TAN A;  5DM6 L;  1BO5 O;  1EET A;  1WSF A;  3MN7 A;  4QS9 A;  1HJO A;  3O6W A;  1VSL A;  2Z1I A;  3QEI A;  3D0P A;  2P9P A;  1NK5 A;  3FZK A;  1KVB A;  1REV A;  3CQ8 A;  4WE1 A;  3RRG A;  4LY7 A;  1U2V B;  3RTV A;  1KLM A;  4V19 S;  1WN7 A;  3PLA A;  2VG5 A;  3AVG A;  5LMN K;  3M5R A;  5FDL A;  2G8I A;  2RN2 A;  1G99 A;  1ATN A;  3QET A;  4CZH A;  4Z4I A;  3HOS A;  2OPQ A;  5HRR A;  2BDP A;  4BRF A;  1E4G T;  4B3T K;  4J2D A;  3AGK A;  3I0S A;  3ZT3 A;  3AO4 A;  1VSM A;  4CJE A;  2NRX A;  3C6U A;  4RG8 A;  4BY9 C;  3DXM B;  4H5V A;  1T05 A;  4LFA K;  1JLQ A;  2AA4 A;  4DV0 K;  3AA4 A;  2NLX A;  3KKR A;  5M1F A;  4YHH K;  1QSL A;  3AA5 X;  3MX2 A;  4IO8 A;  1C0G A;  4WQ5 A;  3HRG A;  2HVI A;  4M41 A;  3A5O C;  4FWP A;  3G4S N;  3S5T A;  3DLE A;  3VQ7 A;  4DS5 A;  3QNO A;  5HRP A;  5KGW A;  1JXE A;  3LPU A;  1EX4 A;  4CJT A;  4FWK A;  3ZSR A;  2YHX A;  1TAQ A;  4QAG A;  4RW8 A;  3ZYY X;  5AQW A;  5HLF A;  3E9P A;  4LF7 K;  2ASP A;  1ITG A;  2UXC K;  3VQE A;  5LJW A;  4EAH D;  1QQM A;  3IUC A;  4DV7 K;  3DLG A;  3NMU A;  2RE2 A;  2V7Z A;  2VQE K;  4KI6 A;  3OYH A;  1VRT A;  4DTR A;  1C6V A;  3DXK A;  3ENH A;  1X9S A;  3OS2 A;  1TYQ A;  4FLU A;  4CJ5 A;  3NAE A;  3VQ5 A;  2KFZ A;  3A8Y A;  1Q7Y O;  1IO2 A;  5HP1 A;  1LWE A;  1S72 N;  1BI4 A;  2V51 B;  3KLF A;  1NKC A;  2FBT A;  3TPQ A;  1LW0 A;  2XY6 A;  3GL1 A;  4O5F A;  1NBW A;  1XI1 A;  3F5T A;  3HBT A;  4YOR A;  3Q7C A;  1LAW A;  3HTV A;  2Q36 A;  4DKW A;  3CJA A;  4CW7 B;  4UQG A;  3TU5 A;  3IRX A;  4AHU A;  4KHU A;  3EY1 A;  2YHB A;  3D7E O;  4YOW A;  1TL3 A;  1RT7 A;  1A5V A;  4Q5V A;  2HHI A;  4B9V A;  3CJ1 A;  1K8A O;  1BUP A;  5AQF A;  1EXQ A;  4CFA A;  4B3M K;  4FWR A;  5AQL A;  4G9Z A;  5AQH A;  1FXX A;  1NGE A;  3NDK A;  4I7F A;  1N6Q A;  1SS6 A;  3VN5 A;  4W5R A;  4EZ6 A;  3A5N C;  5AQR A;  1DTT A;  3MCA B;  3QEV A;  2KFN A;  5FPD A;  4PKH A;  2NRV A;  3DM2 A;  1NGF A;  4DV3 K;  1EWR A;  3VEY A;  4IOX A;  4AM7 A;  5ADX A;  1W0H A;  2ZJR L;  3L4Q A;  5B8H A;  1VSI A;  4BC2 A;  3OYJ A;  3C6T A;  4FZZ A;  1MA9 B;  2ZWH A;  5JS2 A;  3S3N A;  3QER A;  4FSV A;  2XY5 A;  1EKE A;  3QEP A;  2OZS A;  3KK7 A;  3U8X A;  1U45 A;  1TKX A;  1CLQ A;  1T44 A;  3R3L A;  3RRH A;  3HO1 A;  4B3O A;  3QIO A;  4DR4 K;  3CM5 A;  5F1X A;  4BC4 A;  3OJS A;  3K0S A;  3V1Q A;  5BR8 K;  4BRC A;  1S9E A;  4Y1C A;  5EVZ A;  2QWQ A;  1X3M A;  2OTL N;  2I5J A;  5AQU A;  2NRZ A;  1RIL A;  4I2P A;  3VQ9 A;  1VQP N;  3P1G A;  3P4I A;  4FWN A;  3SK3 A;  4FJX A;  1RCH A;  2G8K A;  4DTX A;  3ASM A;  3CPW M;  3ZT2 A;  1BCM A;  5C24 A;  2YX6 A;  5BRE A;  3SUN A;  1JJ2 M;  1MWK A;  1RDW X;  4B9S A;  4PKG A;  3IMX A;  4NCA A;  1RBS A;  1DT9 A;  5BN8 A;  1C0M A;  2YNH A;  4CEZ A;  1J9A A;  5EY4 A;  3CF5 L;  1E3M A;  4FVM A;  4OLB A;  3E9O A;  2IVP A;  2HHW A;  4MQ3 A;  4B1W B;  5J2Q A;  4F3O A;  4FLT A;  2CGK A;  3OW2 M;  2HF4 A;  2A6A A;  4JKG A;  1RT1 A;  3F2K A;  3K58 A;  1IG9 A;  3O5B A;  4H0Y B;  3VTH A;  3OYK A;  5C2F A;  5C12 A;  2ZM6 K;  2PYL A;  1XWL A;  2Q31 A;  4JKE A;  2WUS A;  2P9P B;  3OBW A;  3NVM A;  4KBO A;  2O8B A;  1CXQ A;  1GLD G;  5HBM A;  2HMP A;  3LDQ A;  1SUQ A;  4NYF A;  5KGX A;  1B9D A;  4DTS A;  1UA0 A;  1YJW N;  4NXN K;  4IDH A;  4BRQ A;  2XRI A;  5KPZ A;  4A59 A;  1JXB A;  1BIS A;  4DFJ A;  3CCM N;  3CYM A;  3QEW A;  2BTF A;  4GMJ B;  4CBW A;  3V9X A;  3SPY A;  3QNN A;  3EKU A;  4EP4 A;  2DFE A;  3U4L A;  3P31 A;  1BL3 A;  1KAY A;  3VQ4 A;  3CJ7 A;  1Q82 O;  1UWB A;  4BG9 A;  2P9N B;  1H1V A;  2IS3 A;  2DFF A;  3AA2 A;  4CZG A;  4JK7 A;  2UUC K;  3O4Q A;  4EHU A;  2FBY A;  2KKZ A;  1V4T A;  1U6Z A;  2ASM A;  3CPE A;  1RT3 A;  1EO1 A;  4B9N A;  2XY7 A;  3HM8 A;  4CJQ A;  1NWK A;  4W5T A;  1YIJ N;  3VEW A;  2O8C B;  3L2W A;  4OGC A;  4JNE A;  1BDG A;  3G6E N;  4CEQ A;  1RTH A;  4DUY K;  4KB0 A;  3FLC O;  4MO4 A;  4RTF D;  2PY5 A;  3O1W A;  1N32 K;  4KO0 A;  5AQP A;  4H0O A;  2QM1 A;  4CZK A;  3RSE B;  1P90 A;  4CZL A;  5GAG P;  4FJL A;  2NRR A;  3LAN A;  4IDK A;  2E5L K;  4MO5 A;  1WOQ A;  4K42 A;  1BQN A;  3DXK B;  3AO1 A;  4B9L A;  1SV5 A;  4FJN A;  2IIR A;  1TYQ B;  2W6L A;  4OPH A;  4DSJ A;  4DUZ K;  2CGL A;  5AQV A;  5JVG L;  4FO0 A;  4CF2 A;  3WNE A;  2VWJ A;  4NCG A;  2P9I A;  2YHA A;  4CHQ A;  4F2R A;  3CYG A;  3CFO A;  3ZSO A;  4QOZ B;  4M7X A;  3L8B A;  3E1Y A;  4DB3 A;  1NK9 A;  1NOZ A;  1F21 A;  3VER A;  1WBB A;  5C42 A;  3VOV A;  1QQO A;  2YJE A;  4LSL A;  3S9H A;  5GIP A;  5LJV A;  1YHQ N;  1RT4 A;  3VET A;  4ILG B;  2OZM A;  1ZBH A;  1CZ9 A;  4BEB A;  2FF6 A;  3VF6 A;  5GAH P;  3KHY A;  2G8H A;  4FK2 A;  5BPN A;  3IS9 A;  3SPZ A;  3C94 A;  1TL1 A;  3J80 O;  4DU3 A;  3AAR A;  4WF9 L;  4AHV A;  4DV2 K;  3HI0 A;  4F9O A;  4AQY K;  4CHY A;  1BGX T;  1VQL N;  4BR5 A;  4ELU A;  5F2R A;  3B8A X;  1RDB A;  4X62 K;  1Q9Y A;  1X1P A;  3VGM A;  3OHR A;  4RWT A;  3MN9 A;  1SKR A;  2KTQ A;  1RFQ A;  4DR7 K;  3V9U A;  5J2M A;  1NK8 A;  3NFA A;  4CEE A;  4EFH A;  4WQ5 C;  1VQ6 N;  2E88 A;  3IFR A;  5ADX H;  4DQR A;  4CES A;  4MLH A;  3BP8 A;  1NK6 A;  4LH5 A;  4BDP A;  2HHV A;  3DWL A;  3LP1 A;  2PAV A;  5FRN A;  2HBK A;  3O9T A;  2OPS A;  1Q86 O;  1Z05 A;  4YOV A;  1NK7 A;  4F2S A;  4JI4 K;  1EQY A;  2I7P A;  3T1A A;  1IBL K;  4C1N K;  5KQD A;  3ZEU A;  4IFE A;  3JAM O;  4CFB A;  2X78 A;  3J7Z O;  1T8E A;  4GY2 B;  5ELZ A;  5BPM A;  3KLH A;  1X9J A;  4K43 A;  4JKF A;  3ID8 A;  3OS0 A;  1BWF O;  3VGK A;  3WXL A;  1P8Z A;  3KVG A;  4DFP A;  3NH1 A;  4IZ9 A;  2YNG A;  3HVR A;  5GIN A;  4OO1 J;  1NGD A;  3L0Q A;  2P5O A;  3HK2 A;  2E1Z A;  4PL8 A;  3LWM A;  4CZE A;  3SJJ A;  3HST B;  1NK4 A;  3I8D A;  2B5J A;  2E2N A;  1HYV A;  4KHS A;  4JRP A;  4I2Q A;  4BDZ A;  5T7B A;  4ILJ A;  1VHX A;  2P9K A;  4TSX A;  4ZTJ A;  4A2A A;  3PY8 A;  4LF8 K;  1X9M A;  1NMD A;  3ZX2 A;  3SAF A;  3MWT A;  3ZSV A;  4H0X B;  4OX9 K;  4GKK K;  3BEX A;  3KD1 E;  5AQM A;  2HW3 A;  1W97 L;  5AQJ A;  3WQT A;  4CJF A;  4NLB A;  3MXI A;  1VQ7 N;  2O8E B;  3OJU A;  3T69 A;  2QKB A;  1HRH A;  4JKG B;  4E7L A;  1HUX A;  4IFY A;  1BIZ A;  4CF9 A;  3I55 N;  3PX4 A;  1VSH A;  2X6N A;  3EEQ A;  4A61 A;  4FLV A;  2Z1J A;  4ELT A;  2VGN A;  4BC5 A;  5FRO A;  2A1R A;  3ZSZ A;  4CK2 A;  4DR1 K;  4Z4G A;  4IXC A;  1KXP A;  3L2V A;  4Z4C A;  2E20 A;  2ASO A;  2D0O A;  3KTQ A;  2QXL A;  1YTA A;  3F9M A;  2KQ2 A;  5AZI B;  2QKK A;  4KB1 A;  4BGA A;  3UIQ A;  4O0I A;  3CC4 N;  1RTD A;  1B9F A;  3WXK A;  3O9R A;  3NH0 A;  4EZ9 A;  1QZ5 A;  3LAK A;  1QHA A;  3SBT A;  2FXU A;  2Q0R A;  3U3G A;  2OA8 A;  1LAV A;  1GOC A;  4OLA A;  3TTD A;  4DG1 A;  4N47 A;  3CME N;  4DTP A;  3HP9 A;  3I0R A;  1HPZ A;  1NGG A;  4BRM A;  2UUA K;  1X3N A;  3SV3 A;  1NJI O;  2NRH A;  1A5W A;  3RR7 A;  5FPM A;  3NF9 A;  1KFD A;  4CFC A;  3DLH A;  1S1T A;  1KD1 O;  3I56 N;  2O4I A;  4Z0U A;  3KLI A;  2QWR A;  4EIA A;  5EX5 A;  4GW6 A;  2ZQB A;  4FWS A;  2ZE2 A;  1LCU A;  3WNH A;  1LV5 A;  5BRH A;  4NYN A;  4CEA A;  3CI5 A;  2P9S B;  4IG3 A;  1N36 K;  2IVO A;  4WFN L;  1XC3 A;  4E7J A;  1ZC6 A;  3VMF B;  4IG0 A;  2I7N A;  4L3Q A;  4YY3 K;  1IKY A;  2ZJQ L;  3HL8 A;  5LY3 A;  3RR8 A;  1LWF A;  4DV4 K;  4UY8 O;  4CEO A;  1KC8 O;  3VQD A;  4B1V A;  4BR4 A;  3CFP A;  3T3F A;  4YOX A;  5AR0 A;  1BU6 O;  3I33 A;  4CZM A;  1I3A A;  1DEJ A;  3BGR A;  3CCQ N;  4KHW A;  3VES A;  4BG8 A;  5IWA K;  3CCJ N;  2FSK A;  1T3V A;  2BE2 A;  1LWC A;  3SQ2 A;  1RBU A;  4H4M A;  1SL2 A;  2P9I B;  2KZZ A;  4W5O A;  3EE9 A;  3H45 C;  1Z25 A;  3PSF A;  2Q3S A;  4LF9 K;  5AQX A;  3CG7 A;  5C10 A;  1S1U A;  3K5O A;  4BR0 A;  3F9K A;  3UKU B;  4JAX A;  1KTQ A;  4IEI A;  1WLJ A;  3ITH A;  1NGC A;  3TAP A;  3EL2 A;  1RDD A;  1V4S A;  4DR3 K;  1NU0 A;  4JI8 K;  3CFR A;  2HOE A;  2QWP A;  1NGH A;  3WXI A;  5JLF A;  2FLO A;  1TUU A;  3L2Q A;  3LDN A;  2RF2 A;  3K2P A;  5DK5 A;  4DV1 K;  2FC0 A;  1BQM A;  1SL1 A;  4CGI A;  3OYC A;  4LFC K;  1TKT A;  3ZSY A;  3C0B A;  5BRD A;  3UB5 A;  1NG9 A;  4JV5 K;  1WB9 A;  3RVC A;  2D0B A;  3THV A;  4BRO A;  2HHX A;  3IG1 A;  4NCB A;  4DSE A;  1JLA A;  2QWN A;  4X65 K;  4F3T A;  1ATR A;  3CXC M;  4JHD A;  4A5A A;  4HVJ A;  3HPG A;  4CJ4 A;  1ZBF A;  3QES A;  1NGB A;  5IT9 O;  3N4P A;  4BRD A;  3CCR N;  4CJU A;  3KLG A;  3SUQ A;  4FZX C;  3VQP A;  1NKE A;  1YXQ A;  1EP4 A;  4DTJ A;  3DI6 A;  2BH1 A;  2PZS A;  3AVH A;  3PSI A;  1HYS A;  4N5S A;  4XH1 A;  3B6O A;  5LL6 Z;  3ZET A;  3ZEU B;  4BE2 A;  1JKH A;  3SQ4 A;  3ULE A;  2D0P A;  1YVU A;  1JLF A;  5LMU K;  3WNG A;  2HBM A;  5CR4 A;  3A5L C;  1JCF A;  3D2E A;  1VSE A;  3THX A;  2Y1I A;  2IOC A;  3O3F A;  3LPT A;  4IJN A;  4CF1 A;  2A42 A;  3DJC A;  1UAX A;  5A2Q O;  1OH8 A;  3QML A;  3OYM A;  2ZF5 O;  1ASV A;  3CCV N;  4WFA L;  2P9U B;  4CJ3 A;  3CC2 N;  4BE0 A;  3ZSW A;  3MAQ A;  2HHT A;  1QVG M;  4BQZ A;  1HLU A;  4BAC A;  3WUH A;  3GBT A;  2P9K B;  2QK9 A;  1I94 K;  5KPT A;  4AHS A;  1B92 A;  4KFB A;  3VF2 A;  2C1G A;  2E2P A;  5JMV A;  5HRO A;  1U04 A;  5HOO A;  2ITG A;  4JD2 A;  3O9Q A;  3KLE A;  1WSE A;  4GV6 A;  3FE1 A;  4W5N A;  4YOT A;  5JVH L;  3AO2 A;  2PYJ A;  4CIE A;  4DMN A;  4YDU A;  4FLW A;  1ZXO A;  2F8S A;  3SJH A;  2D1K A;  4CI6 A;  4I6M B;  4X64 K;  4FJG A;  5AQK A;  4FJK A;  3O8M A;  4W5Q A;  4FM2 A;  3DYA A;  5M1Q A;  4JI2 K;  3SLC A;  3ZT0 A;  3O80 A;  4J8F A;  4FWM A;  1S6Q A;  2Q2R A;  4JI1 K;  3NHG A;  1VSD A;  3CMA N;  3DAW A;  5J2P A;  1BA0 A;  3TTF A;  4BE1 A;  4Z4H A;  1OVY A;  4GV9 A;  1C0F A;  4C8L A;  3IKM A;  1C0T A;  3THW A;  4KI4 A;  5BN9 A;  2NZT A;  4O0J A;  4CGD A;  3K5L A;  3LP0 A;  1N5Y A;  3MX5 A;  5EU7 A;  1RGI A;  4MDA A;  4FJH A;  2GTD A;  4E1M A;  4L8R B;  4KTW A;  4ISG A;  1IJJ A;  4N56 A;  2KW4 A;  3E66 A;  3KWI A;  4BE7 B;  2RHK A;  2B6A A;  5GIO A;  3LZI A;  4IWV A;  4J2E A;  4K8X A;  1NJZ A;  3WEE A;  1K8K A;  1YI2 N;  5AZJ A;  3L2U A;  4FWL A;  1IV0 A;  4PHT X;  1VSJ A;  4RCH A;  4ILH A;  2Y1J A;  3QBW A;  2EHG A;  3V1R A;  1DLO A;  4H0P A;  4DTO A;  3K5N A;  5DMR A;  4CED A;  3DLB A;  2KHO A;  1RBT A;  3ATV A;  1UOC A;  2Q0U A;  5KRT A;  2H3G X;  3D45 A;  4IEE A;  1RDC A;  2ZGZ A;  4I9Q A;  1TUY A;  1DTQ A;  3T7Z A;  4JKD A;  1U48 A;  3DMJ A;  3NGZ A;  1JLE A;  3VQ6 A;  3P39 A;  4U7B A;  2FF3 B;  3MEC A;  2JWK A;  4GV3 A;  3AO5 A;  4C8K A;  2OTJ N;  4FLZ A;  3J7Y P;  3FZF A;  2BUP A;  3EZW A;  2D4W A;  3BF1 A;  4DSK A;  3U9Z A;  3HPO A;  3EE8 A;  5EXW A;  4E89 A;  3HJF A;  3CC7 N;  4IBN A;  4RW4 A;  3SNN A;  3QIP A;  3DOL A;  4CHO A;  4DV5 K;  5JLH A;  4BRI A;  3VF4 A;  3FR0 A;  4QS7 A;  3VA3 A;  2QW9 A;  1XMO K;  4DSL A;  3SUO A;  3NH2 A;  4C8O A;  4FJ5 A;  3D2F A;  3OY9 A;  4NXM K;  4J2A A;  1GLL O;  4B1Z A;  4YNQ A;  4OPJ A;  4IOA L;  1R59 O;  4PA1 A;  1ZBL A;  4CD3 A;  4KH5 A;  1BOT O;  4FLX A;  1RBV A;  1J6Z A;  3LAM A;  4CGG A;  2GUP A;  4CZF A;  4O5B A;  4KHN A;  1I39 A;  4JHD B;  3W3D A;  3FZM A;  4IO9 L;  3R8E A;  4CBX A;  4ZHR A;  4FK0 A;  1XC9 A;  1IKW A;  4LC9 B;  1VQK N;  1KCF A;  3JSM A;  3T1H K;  2BGG A;  3THY A;  3OYL A;  4LF4 K;  3H08 A;  2YI1 A;  3QB0 A;  3KD5 E;  4G1Q A;  3ZET B;  2GX9 A;  4FVU A;  3EZ5 A;  3ULE B;  1QQN A;  4H03 B;  4FL9 A;  2A40 A;  5H1S Q;  2HBJ A;  3TAF A;  1TK8 A;  1C1A A;  1CXU A;  3CCS N;  4M42 A;  2F9W A;  3D2E B;  4ID1 A;  3THX B;  4H5N A;  4CJ7 A;  5MLC Q;  4DQQ A;  2KZM A;  4FW2 A;  1YF5 L;  1BI4 B;  4MDB A;  1T03 A;  2ATQ A;  1S22 A;  2HHQ A;  3M8Q A;  1XMQ K;  4MLE A;  2Z1G A;  3T1Y K;  2HB5 A;  3GE1 A;  4FK4 A;  1QTM A;  4CJV A;  3E01 A;  3P38 A;  4EP5 A;  4KKO A;  1JL2 A;  3NF7 A;  1MU2 A;  3C95 A;  3MN6 A;  3TSP A;  3V9W A;  4JS4 A;  4AHR A;  4BR2 A;  3U3Y A;  2DPN A;  5CYM A;  3OYI A;  3WQU A;  1C1B A;  4M3U A;  4FW1 A;  2HHH K;  3TI0 A;  4J2B A;  1RT6 A;  3OBY A;  4JD2 B;  2QWL A;  5K14 A;  4CZJ A;  3SZ2 A;  2WFB A;  3KWG A;  1O13 A;  3ENO A;  3PO5 A;  3U6F A;  4FJJ A;  2R7Y A;  2F9T A;  2VG6 A;  1NJX A;  5AQQ A;  3D6R A;  3P5J A;  4HUE A;  4PUO A;  3MK6 A;  3QFP A;  1Q9X A;  4JI5 K;  4I9L A;  4E19 A;  4C23 A;  4Z4F A;  3QDK A;  4IOC L;  2UUB K;  3SQ1 A;  3CCE N;  1GLF O;  3AVF A;  3QEX A;  3H1Q A;  4JI6 K;  4X66 K;  3AVB A;  2UXD K;  2OCE A;  2ZD1 A;  1KFS A;  4E0D A;  3DRP A;  5AQI A;  2O4G A;  4AHC A;  3MEG A;  4M3Y A;  3AVL A;  4BEC A;  1JLG A;  3RWU A;  3KKS A;  1L3T A;  3THW B;  3AGR A;  4BWJ A;  4CHN A;  4C8N A;  3LWL A;  4DLE A;  4LF5 K;  4DQ8 A;  1HNV A;  3SAH A;  5E41 A;  2X74 A;  3L3V A;  3V4I A;  3EKS A;  3BZC A;  1TK0 A;  4BRG A;  1NK0 A;  3H1V X;  3R1X A;  4KTZ A;  4CE9 A;  4BRH A;  3BY5 A;  1TAU A;  4GVE A;  3VPZ A;  3SUP A;  2IGI A;  4BQL A;  3OYN A;  1VQO N;  1LOT B;  4CCH A;  1J5E K;  4E1J A;  5AFU H;  5AZJ B;  2W40 A;  1S1V A;  4WCE L;  4JLH A;  3GG4 A;  3S41 A;  3J81 O;  3VEZ A;  1D9F A;  4RW7 A;  2IDO A;  2HBL A;  2E4L A;  1HR0 K;  2JLE A;  1HPM A;  3SI6 A;  1N34 K;  1L3V A;  3ENB A;  3K9K A;  3HOT A;  4HCB A;  3MED A;  4JI0 K;  2QXF A;  1MDU B;  5J2N A;  3ZT4 A;  3AVK A;  2E6L A;  3OYF A;  3BF3 A;  1K6Y A;  3V6D A;  1D4X A;  5HRS A;  5KPR A;  3KK1 A;  3U9D A;  2AP1 A;  4YDU C;  4JI3 K;  4FJ9 A;  2O8B B;  5JEN A;  3MN5 A;  1VQN N;  2QI2 A;  2P5G A;  1QE1 A;  4HUG A;  4B9U A;  4YOY A;  1WSG A;  4OGE A;  3UE5 A;  3MEE A;  5CHI A;  4BRA A;  2IAJ A;  3G10 A;  3KJV A;  2EX3 A;  2F96 A;  3ZLJ A;  4MFB A;  5C25 A;  3C7N A;  2Q97 A;  3M1F A;  4CK3 A;  3TWH A;  1Z26 A;  4CJK A;  4CGF A;  5FRM A;  1CZA N;  1QQC A;  4M45 A;  4C1N I;  3RMB A;  5M1O A;  4CJP A;  3R9P A;  1FKP A;  1IH7 A;  1IKX A;  2BAN A;  3VQA A;  4AHT A;  1TKZ A;  4K8Z A;  5C2D A;  3ZSX A;  1RT5 A;  1N33 K;  4E7H A;  3D2F B;  4IFV A;  3NGI A;  3CCU N;  3E9L A;  4YFU A;  5E84 A;  4XIU A;  1N8R O;  3ZT1 A;  1VQ9 N;  3OVN A;  2E8A A;  3H46 O;  5AQZ A;  1S1X A;  1YJN N;  1YT3 A;  1NGJ A;  3QIN A;  1BCO A;  3P83 D;  3RMC A;  4JK8 A;  1BA1 A;  1S6P A;  3NE6 A;  4DTN A;  3OYB A;  4XJX A;  4JN4 A;  3THY B;  4F8R A;  1GLC G;  1Q8I A;  1S3X A;  2E2Q A;  3CQY A;  4JKC A;  1KLN A;  3GDQ A;  3H3O B;  4DFM A;  1DGK N;  3KZB A;  1D5A A;  3AVJ A;  3EYZ A;  4M3R A;  3MXJ A;  3VGL A;  3TTC A;  5D3G A;  2O8F A;  3BUZ B;  3AAP A;  3H3N O;  1XUP O;  3JXU A;  4BWM A;  4FWQ A;  3CD6 N;  2X6S A;  5FPN A;  3AAQ A;  1KAX A;  3KK2 A;  4BRN A;  4M3W A;  3TAE A;  1UA1 A;  1HYZ A;  2GWJ A;  4CGH A;  1YUW A;  1RBR A;  3TAQ A;  4M3Z A;  4CHZ A;  3NCI A;  3VA0 A;  2YNI A;  4CD1 A;  1HKG A;  2CH6 A;  1Q81 O;  1HKB A;  1Y97 A;  1OH6 A;  1NMN A;  2NNW A;  2JWL A;  3HSC A;  4DTM A;  3MCP A;  2WOM A;  4CJS A;  1M1K O;  4DV6 K;  4IKF A;  1BG3 A;  3V81 A;  4OKK A;  4BRK A;  4OPA A;  5F0X A;  4BRP A;  1TGO A;  4KHP K;  1T6C A;  1QS4 A;  4BRL A;  1SKS A;  3VQB A;  1QVF M;  5KQ8 A;  4PQU A;  4JKA A;  2KLA A;  3V9S A;  4CGJ A;  5HRN A;  4B3S K;  2IVN A;  3AVC A;  3LM9 A;  4H5R A;  5I9E B;  3NVK A;  1OH5 A;  4JEP A;  3OYA A;  3SMP A;  1ZYQ A;  4CBU A;  5KRS A;  3O08 A;  4H5W A;  4FJ7 A;  4B9M A;  3AO3 A;  4FLY A;  2P9N A;  2HND A;  1OVQ A;  1SAZ A;  4XH4 A;  3TR8 A;  1HX1 A;  1NM1 A;  3PIP L;  1O1W A;  5E26 A;  1QSS A;  4K25 A;  5M1N A;  4B1U B;  1JLC A;  2HVH A;  2PBD A;  2O8C A;  1TVR A;  3AVM A;  4GNI A;  5GAE P;  1JLB A;  3M3Z A;  3J7A P;  2W6K A;  1HNZ K;  3SBG A;  1VQM N;  2E2O A;  1JCG A;  1VK0 A;  4DR5 K;  2A41 A;  1KVA A;  1HKC A;  1T6D A;  4F4K A;  4BVP A;  3RSE A;  3OTO K;  1A5X A;  2VQF K;  3VEV A;  3VQC A;  3W0L A;  1XHZ A;  1TKD A;  3WT0 A;  4CF0 A;  4CER A;  3SMS A;  4DF4 A;  3OA9 A;  5CE3 A;  1Z6R A;  1HMV A;  1YTU A;  2ETJ A;  4OKE A;  3ZSQ A;  4CJR A;  4LSN A;  2W41 A;  4DHY A;  3LM2 A;  2D0C A;  3M6G A;  2XHB A;  3SAG A;  1HQU A;  4LF6 K;  2ZJP L;  3LAL A;  2QWO A;  4ZTF A;  3FFI A;  4E1N A;  3BZK A;  4Z94 A;  4B1X B;  1R0A A;  4AIL C;  2PFU A;  1ASU A;  3CET A;  4CF8 A;  5JIC A;  4Q0B A;  3G0Z A;  3A2F A;  4DCH A;  1J5O A;  1D9D A;  3SCX A;  3MWP A;  2GWK A;  3KK3 A;  4CHP A;  4R79 A;  1ZBU A;  4FPB A;  3QBX A;  3LDS A;  4AM6 A;  1RTJ A;  3L6Q A;  4CZI A;  2GEM A;  2GV9 A;  1FK9 A;  3O3G A;  4DR2 K;  4DS4 A;  1VRU A;  2NUB A;  1HQE A;  1WAJ A;  4H0V B;  1XHX A;  3C65 A;  5BPL A;  1NGI A;  3LZJ A;  3A0I X;  2W42 A;  3ULD A;  4E7I A;  4FJ8 A;  4IJA A;  1SL0 A;  2GUI A;  3NF6 A;  3CJB A;  3PX0 A;  1K9M O;  4XEI A;  2F7T A;  4OVL A;  5J1E A;  3C7N B;  2YHY A;  3VQ8 A;  2OYQ A;  3LP2 A;  1NOY A;  1KQS M;  5TKY A;  3VEO A;  4FOE A;  3M8R A;  2HHS A;  3ZCM A;  3FZH A;  3EN9 A;  1L3U A;  4FYD A;  3WXM B;  2YNF A;  5FPE A;  5KI6 A;  4WQ4 A;  4M3X A;  3FFK B;  1IKV A;  3TSQ A;  2HF3 A;  4CK1 A;  4KAZ A;  1RDA A;  3CM6 A;  4KH4 A;  5BRF A;  2YV0 X;  5AFU A;  1W2B M;  2A3Z A;  2UYT A;  2OAN A;  4DR6 K;  2C1I A;  4FJM A;  4AF1 A;  2D5R A;  4C8M A;  3M8P A;  1L5U A;  1KSP A;  3RMD A;  2FSN A;  4JK9 A;  2AJQ A;  2XO7 A;  3CJ9 A;  3QLH A;  2D0A A;  3ATU A;  1T7P A;  1W7A A;  4ID5 A;  2A5X A;  2O8F B;  2O8D A;  5AJ3 K;  2QWM A;  3V9Z A;  3PUF A;  4YOU A;  3K57 A;  4CJW A;  4KTQ A;  4BGB A;  3O9S A;  3TSU A;  1HJR A;  1VAZ A;  4HUF A;  2O8E A;  2VWB A;  1DKG D;  4N76 A;  4A2B A;  3DOK A;  2DTU A;  4A57 A;  4FPA A;  3B6P A;  1E4F T;  4CIG A;  3L3U A;  4DWI A;  1GLE G;  1VQ5 N;  1OH7 A;  2DY4 A;  2G8V A;  4O8U A;  4PWD A;  2F4V K;  3R6M A;  4JKH A;  5SWM A;  5AZI A;  2FSJ A;  4FWO A;  4BVO A;  3OYE A;  3FGU A;  2XY8 A;  3AVI A;  3TAB A;  1KRP A;  1XNR K;  1YVN A;  3CHW A;  1C0U A;  4JS5 A;  3BDP A;  3PX6 A;  3WXJ A;  2Q1N A;  3ZX0 A;  1SKW A;  4U67 L;  2VYP A;  2Z1H A;  4A62 A;  2UU9 K;  5C15 A;  1IBK K;  4KRE A;  1EWQ A;  3NF8 A;  4KV8 A;  4DU1 A;  3CER A;  2NRT A;  3MXM A;  2P9L A;  5GAD P;  3UKR A;  1WUA A;  3VEN A;  2QEX N;  4DU4 A;  5AQN A;  4B8C A;  2VCP A;  2YKM A;  4OJR A;  2WTU A;  1QZ6 A;  3IAY A;  1S5J A;  1HNX K;  3LDO A;  1M90 O;  4ICL A;  4GVM A;  1IBM K;  3WNF A;  1FKO A;  3C6A A;  5TKW A;  3TAR A;  1NJY A;  1X9W A;  2P9S A;  2V52 B;  1U4B A;  4BRE A;  1XNQ K;  3CCL N;  3S3O A;  3HVT A;  3KIO A;  1VSK A;  3NGY A;  4B9Q A;  2VGM A;  1KAZ A;  5AQY A;  5AQS A;  4PY5 A;  3N4Q A;  2YJF A;  4CIF A;  1L3S A;  5EOY A;  1VQ8 N;  3PO4 A;  3LDL A;  2YKN A;  3O4N A;  5AQG A;  3I8B A;  3S3M A;  2HMI A;  4H8K A;  1ZBS A;  2JGU A;  3A5M C;  3DRS A;  4BR7 A;  1S1W A;  4QCL A;  1U2V A;  1NNE A;  2NRW A;  4WFB L;  2GEL A;  3G25 A;  3CJC A;  5SZT A;  3ALY A;  3O1B A;  2HHU A;  4DQI A;  3HPH A;  4RW6 A;  3UKU A;  1WSJ A;  2RPI A;  1BIU A;  2V7Y A;  5I42 A;  4AH9 A;  2WBN A;  4DLG A;  1FW6 A;  3DXM A;  1GLB G;  3IDH A;  3MDQ A;  3NBP A;  3J8A A;  3HP6 A;  1GLJ O;  1YAG A;  1Q18 A;  3O9U A;  4QS8 A;  4O8K A;  3SYZ A;  4HCC A;  4H4O A;  4K41 A;  1ATS A; 
#chains in the Genus database with same CATH homology
 5E84 A;  4H0Y B;  4Y0W A;  1N8R O;  3DJC A;  3VTH A;  1VQ9 N;  5C2F A;  3VEX A;  5C12 A;  4FOI A;  2E8A A;  3QML A;  2Q31 A;  3H46 O;  4JKE A;  2WUS A;  5AQZ A;  3H6E A;  2YCH A;  2P9P B;  2ZF5 O;  1YJN N;  3OBW A;  1NGJ A;  3CCV N;  4WFA L;  2P9U B;  3CC2 N;  3NVM A;  4KBO A;  1GLD G;  1QVG M;  4WYB A;  4BQZ A;  1ILY A;  1HLU A;  4JK8 A;  4NB4 A;  1BA1 A;  3WUH A;  3LDP A;  2HMP A;  3GBT A;  1VQ4 N;  2P9K B;  3LDQ A;  4XJX A;  4JN4 A;  5KPT A;  1YJW N;  4IDH A;  1GLC G;  2E2Q A;  1S3X A;  3CQY A;  4JKC A;  3VTI A;  4BRQ A;  1K73 O;  3GDQ A;  3H3O B;  3VF2 A;  1DGK N;  3KZB A;  5KPZ A;  2C1G A;  3VGL A;  3TTC A;  1JCE A;  2E2P A;  4A59 A;  5JMV A;  3BUZ B;  3CCM N;  3AAP A;  3H3N O;  1XUP O;  3JXU A;  3JS6 A;  2BTF A;  4FWQ A;  5HOO A;  3CD6 N;  2CGJ A;  4CBW A;  4JD2 A;  3QIC A;  3O9Q A;  5FPN A;  3AAQ A;  4GV6 A;  3EKU A;  3FE1 A;  1KAX A;  2ITM A;  3U4L A;  3P31 A;  3ID6 A;  4YOT A;  3C6H A;  2ZGY A;  4BRN A;  1KAY A;  5JVH L;  3CJ7 A;  4YDU A;  1Q82 O;  1ZXO A;  3LL3 A;  4BG9 A;  2P9N B;  1H1V A;  2GWJ A;  3CXC M;  1YUW A;  4CZG A;  3O4W A;  4JK7 A;  3SJH A;  4EHU A;  3CPE A;  2D1K A;  1V4T A;  1U6Z A;  2ASM A;  1K8K B;  2KKZ A;  3WEE B;  4I6M B;  4CI6 A;  1EO1 A;  5AQK A;  4CD1 A;  1NLV A;  1HKG A;  2CH6 A;  3HM8 A;  1HKB A;  1Q81 O;  1NWK A;  1YIJ N;  3O8M A;  2NNW A;  3VEW A;  2J4R A;  2JWL A;  3HSC A;  5M1Q A;  3SLC A;  4JNE A;  3MCP A;  1BDG A;  1MWM A;  3O80 A;  3G6E N;  4J8F A;  4FWM A;  3HZ6 A;  2P9U A;  2E1Y A;  4HTL A;  4B1Y B;  1M1K O;  2Q2R A;  3FLC O;  1BG3 A;  3CMA N;  4MO4 A;  3DAW A;  4RTF D;  1BA0 A;  3GOI A;  3O1W A;  3TTF A;  1SZ2 A;  5AQP A;  4H0O A;  2QM1 A;  4BRK A;  4CZK A;  3ZX3 A;  4OPA A;  5F0X A;  3RSE B;  1YJ9 N;  4BRP A;  1P90 A;  3EO3 A;  4CZL A;  4PL7 A;  5HL7 L;  5GAG P;  4BEB A;  1OVY A;  5C0Y A;  1T6C A;  4BRL A;  2NRR A;  4GV9 A;  5M1K A;  1C0F A;  4MO5 A;  1WOQ A;  4K42 A;  1NGA A;  3IKM A;  5AQO A;  1QVF M;  5KQ8 A;  4JKA A;  5BN9 A;  2NZT A;  2KLA A;  1RDU A;  3DXK B;  3Q7B A;  2IIR A;  2IVN A;  1TYQ B;  3LM9 A;  3MX5 A;  4H5R A;  5I9E B;  4OPH A;  3NVK A;  1RGI A;  3CQX A;  3DLL L;  2CGL A;  5AQV A;  5JVG L;  4FO0 A;  5AQT A;  4JEP A;  4MDA A;  3SMP A;  2WC9 A;  4CBU A;  3O08 A;  4H5W A;  2P9I A;  2GTD A;  4ISG A;  2P9N A;  1IJJ A;  1SAZ A;  4XH4 A;  3E66 A;  4M7X A;  3KWI A;  4BE7 B;  2RHK A;  3E1Y A;  1HX1 A;  5GIO A;  4NO7 A;  1NM1 A;  4IWV A;  4JKB A;  4DB3 A;  3PIP L;  3WEE A;  4XH5 A;  3VER A;  1K8K A;  5E26 A;  4I6M A;  4K25 A;  1YI2 N;  3VOV A;  5M1N A;  1QQO A;  2YJE A;  4B1U B;  5AZJ A;  5GIP A;  5LJV A;  4FWL A;  4PHT X;  1YHQ N;  4RCH A;  2PBD A;  4ILH A;  3MMV A;  3VET A;  4ILG B;  1OKJ A;  4H0T B;  4GNI A;  1XQS C;  4PKI A;  2FF6 A;  1Y64 A;  3M3Z A;  3QBW A;  1SQK A;  3VF6 A;  3KHY A;  4BC3 A;  5GAH P;  2EWS A;  5BPN A;  4H0P A;  3SBG A;  1VQM N;  2E2O A;  1JCG A;  2A41 A;  2KHO A;  3AAR A;  3ATV A;  4EHT A;  4WF9 L;  2QTD A;  1HKC A;  1T6D A;  3HI0 A;  4BVP A;  3RSE A;  4F9O A;  3PIO L;  2Q0U A;  1VQL N;  4BR5 A;  2H3G X;  4IEE A;  5F2R A;  2ZGZ A;  3B8A X;  1IG8 A;  3VEV A;  1TUY A;  4WQ4 C;  3VGM A;  3CIP A;  3OHR A;  3MN9 A;  3W0L A;  3T7Z A;  4RWT A;  4JKD A;  3G71 N;  2HST A;  4HWI A;  3WT0 A;  3SMS A;  1RFQ A;  3OA9 A;  5CE3 A;  1Z6R A;  4ISE A;  4EFH A;  4WQ5 C;  1YIT N;  2P9L B;  3P39 A;  4U7B A;  1VQ6 N;  2FF3 B;  2JWK A;  2W41 A;  3UKR B;  4GV3 A;  2E88 A;  3QFU A;  4DHY A;  3IFR A;  5ADX H;  3LM2 A;  4MLH A;  3M6G A;  3BP8 A;  2OTJ N;  4KH6 A;  3FZF A;  3DWL A;  3SAG A;  2PAV A;  2YHW A;  2ZJP L;  2HBK A;  2BUP A;  3O9T A;  4M7Y A;  2QWO A;  3EZW A;  2D4W A;  3BF1 A;  3U9Z A;  1Z05 A;  4YOV A;  1Q86 O;  3EE8 A;  4NLC A;  5EXW A;  4BR9 A;  1EQY A;  3FZL A;  3CC7 N;  2I7P A;  4Z94 A;  4B1X B;  4ISF A;  2PFU A;  4C1N K;  3CET A;  1ESV A;  4M63 C;  3ZEU A;  4IFE A;  5JIC A;  5KQD A;  4DCH A;  5JLH A;  2CH5 A;  3VF4 A;  4BRI A;  3FR0 A;  4QS7 A;  3J7Z O;  3MWP A;  2GWK A;  2QW9 A;  3K9J A;  4R79 A;  2W00 A;  4GY2 B;  1GLA G;  5ELZ A;  5BPM A;  4FPB A;  1X9J A;  3QBX A;  3L4I A;  4K43 A;  2QA4 N;  4JKF A;  4A5B A;  4AM6 A;  3ID8 A;  3D2F A;  3L6Q A;  5M1P A;  4CZI A;  1BWF O;  3VGK A;  5DM7 L;  3WXL A;  1P8Z A;  2GEM A;  3KVG A;  4H5T A;  3AY9 A;  5BR9 A;  1GLL O;  4IZ9 A;  4B1Z A;  1BO5 O;  5DM6 L;  4IOA L;  1R59 O;  3MN7 A;  4QS9 A;  5GIN A;  4CD3 A;  4KH5 A;  1NGD A;  1BOT O;  1HJO A;  3L0Q A;  3O6W A;  2E1Z A;  1J6Z A;  4PL8 A;  4OO1 J;  4H0V B;  2GUP A;  2P9P A;  3FZK A;  3C65 A;  4CZF A;  4CZE A;  5BPL A;  1NGI A;  4JHD B;  3W3D A;  3A0I X;  2E2N A;  3FZM A;  4IJA A;  4IO9 L;  1U2V B;  3R8E A;  4CBX A;  3CJB A;  3PLA A;  1K9M O;  4XEI A;  4ILJ A;  2F7T A;  3M5R A;  4LC9 B;  1G99 A;  3C7N B;  1ATN A;  2P9K A;  2YHY A;  1VQK N;  4CZH A;  3HOS A;  1KQS M;  4A2A A;  5TKY A;  1NMD A;  2YI1 A;  3VEO A;  3QB0 A;  3MWT A;  3ZX2 A;  1E4G T;  4H0X B;  4FOE A;  4BRF A;  3BEX A;  3AGK A;  5AQM A;  3ZET B;  2GX9 A;  4FVU A;  1W97 L;  5AQJ A;  3WQT A;  3FZH A;  2NRX A;  3ULE B;  1QQN A;  4H03 B;  3EN9 A;  4NLB A;  4BY9 C;  4FL9 A;  2A40 A;  3DXM B;  4H5V A;  5H1S Q;  2HBJ A;  1VQ7 N;  3T69 A;  2AA4 A;  4JKG B;  1HUX A;  3WXM B;  5FPE A;  2NLX A;  4WQ4 A;  3CCS N;  3I55 N;  3FFK B;  5M1F A;  2F9W A;  3D2E B;  3TSQ A;  2HF3 A;  4A61 A;  4H5N A;  4CJ7 A;  5MLC Q;  1YF5 L;  2VGN A;  3MX2 A;  4IO8 A;  4BC5 A;  4KH4 A;  5BRF A;  1C0G A;  5AFU A;  4MDB A;  1W2B M;  4WQ5 A;  2A3Z A;  3HRG A;  1S22 A;  4MLE A;  2UYT A;  2OAN A;  3A5O C;  4FWP A;  2C1I A;  3G4S N;  4IXC A;  4AF1 A;  1KXP A;  2E20 A;  2ASO A;  2D0O A;  2QXL A;  3GE1 A;  3F9M A;  3P38 A;  5AZI B;  2FSN A;  4JK9 A;  4BGA A;  3CJ9 A;  4FWK A;  3CC4 N;  3MN6 A;  3TSP A;  2YHX A;  3ATU A;  3WXK A;  3O9R A;  3ZYY X;  5AQW A;  3E9P A;  1QZ5 A;  2ASP A;  4BR2 A;  5LJW A;  5GAE P;  4EAH D;  2DPN A;  1QHA A;  2A5X A;  2QWM A;  1QQM A;  3IUC A;  3SBT A;  2FXU A;  3WQU A;  3NMU A;  2Q0R A;  2RE2 A;  4YOU A;  2V7Z A;  3OBY A;  4JD2 B;  2QWL A;  3TTD A;  3DXK A;  4CZJ A;  3ENH A;  4BGB A;  3O9S A;  3CME N;  2WFB A;  3KWG A;  3TSU A;  1VAZ A;  1O13 A;  1TYQ A;  2VWB A;  3ENO A;  1DKG D;  4A2B A;  1NGG A;  4BRM A;  2F9T A;  4A57 A;  1X3N A;  4FPA A;  5AQQ A;  1NJI O;  3D6R A;  2NRH A;  3A8Y A;  1Q7Y O;  5FPM A;  3MK6 A;  1E4F T;  1S72 N;  2V51 B;  3QFP A;  1GLE G;  1KD1 O;  3I56 N;  3SAF A;  1VQ5 N;  3TPQ A;  4C23 A;  2QWR A;  3GL1 A;  3QDK A;  4O5F A;  4EIA A;  4IOC L;  1NBW A;  5EX5 A;  3CCE N;  3F5T A;  3HBT A;  4O8U A;  4YOR A;  3Q7C A;  1GLF O;  4FWS A;  3HTV A;  1LCU A;  2Q36 A;  4DKW A;  3H1Q A;  5BRH A;  3CJA A;  3R6M A;  4JKH A;  3TU5 A;  3CI5 A;  3D7E O;  4YOW A;  5AZI A;  2P9S B;  2FSJ A;  4FWO A;  4BVO A;  2IVO A;  4WFN L;  3CJ1 A;  1XC3 A;  3FGU A;  1BUP A;  5AQI A;  5AQF A;  1K8A O;  1ZC6 A;  3VMF B;  4FWR A;  5AQL A;  2I7N A;  4L3Q A;  1YVN A;  5AQH A;  2ZJQ L;  4G9Z A;  1NGE A;  4BEC A;  3CHW A;  5LY3 A;  4UY8 O;  3WXJ A;  3AGR A;  2Q1N A;  1SS6 A;  3ZX0 A;  1KC8 O;  3A5N C;  5AQR A;  4B1V A;  4DQ8 A;  3MCA B;  4BR4 A;  4U67 L;  3SAH A;  4YOX A;  5FPD A;  4PKH A;  2NRV A;  2VYP A;  5AR0 A;  4A62 A;  1BU6 O;  1NGF A;  3I33 A;  4AM7 A;  3VEY A;  4IOX A;  4CZM A;  1DEJ A;  5C15 A;  3EKS A;  3CCQ N;  3VES A;  4BG8 A;  3CCJ N;  2FSK A;  1T3V A;  5ADX A;  4BRG A;  3H1V X;  3R1X A;  2ZJR L;  3L4Q A;  2P9I B;  3CER A;  2NRT A;  2P9L A;  5B8H A;  4BC2 A;  4BRH A;  5GAD P;  4GVE A;  3VPZ A;  3UKR A;  3EE9 A;  3H45 C;  1MA9 B;  1WUA A;  2ZWH A;  3VEN A;  4BQL A;  2QEX N;  5AQX A;  1VQO N;  1LOT B;  5C10 A;  5AQN A;  4E1J A;  5AZJ B;  2W40 A;  2VCP A;  4FSV A;  5AFU H;  3UKU B;  4BR0 A;  4JAX A;  4WCE L;  4IEI A;  3KK7 A;  3U8X A;  1NGC A;  1QZ6 A;  3EL2 A;  3GG4 A;  1V4S A;  3S41 A;  3LDO A;  1T44 A;  3R3L A;  3VEZ A;  1M90 O;  2HOE A;  3C6A A;  5TKW A;  2QWP A;  4BC4 A;  2HBL A;  1NGH A;  5F1X A;  1HPM A;  2P9S A;  3ENB A;  2V52 B;  3K9K A;  3WXI A;  5JLF A;  3HOT A;  4BRE A;  2FLO A;  4BRC A;  3CCL N;  1TUU A;  1MDU B;  3LDN A;  5EVZ A;  2QWQ A;  1X3M A;  4B9Q A;  3BF3 A;  2VGM A;  2OTL N;  5AQU A;  2NRZ A;  1KAZ A;  5AQY A;  3C0B A;  1D4X A;  3N4Q A;  5AQS A;  2YJF A;  3UB5 A;  5BRD A;  1VQP N;  3RVC A;  3P4I A;  5KPR A;  4FWN A;  3U9D A;  3SK3 A;  4BRO A;  2AP1 A;  4YDU C;  5EOY A;  1VQ8 N;  2QWN A;  3MN5 A;  1VQN N;  2QI2 A;  3LDL A;  1ATR A;  3CPW M;  5AQG A;  4YOY A;  1JJ2 M;  2YX6 A;  3I8B A;  5BRE A;  4JHD A;  1MWK A;  1RDW X;  1ZBS A;  3A5M C;  4PKG A;  4A5A A;  4BR7 A;  3UE5 A;  1NGB A;  1U2V A;  3IMX A;  3N4P A;  4BRA A;  4BRD A;  1DT9 A;  5BN8 A;  5CHI A;  3CCR N;  2NRW A;  4WFB L;  2GEL A;  3G25 A;  3CJC A;  5EY4 A;  3CF5 L;  3C7N A;  2Q97 A;  3O1B A;  1YXQ A;  3M1F A;  2BH1 A;  3UKU A;  1CZA N;  3E9O A;  4C1N I;  4XH1 A;  2IVP A;  2V7Y A;  5M1O A;  3ZET A;  3ZEU B;  3R9P A;  4B1W B;  3ULE A;  2WBN A;  2D0P A;  3DXM A;  2CGK A;  3OW2 M;  2HF4 A;  5C2D A;  1GLB G;  2A6A A;  3IDH A;  4JKG A;  3MDQ A;  2HBM A;  3J8A A;  3F2K A;  5CR4 A;  3A5L C;  1JCF A;  1GLJ O;  1Q18 A;  1YAG A;  3D2F B;  3D2E A;  3O9U A;  4QS8 A;  4O8K A;  3O5B A;  3CCU N;  4IJN A;  3E9L A;  4K41 A;  2A42 A;  1ATS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...