3DXKB

Structure of bos taurus arp2/3 complex with bound inhibitor ck0944636
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
211
Chain Sequence
QAVLTLYAQGLLGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-related protein 3
publication title Characterization of two classes of small molecule inhibitors of Arp2/3 complex
pubmed doi rcsb
total genus 56
structure length 211
sequence length 212
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxkB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3dxkB02
3ZEUB 1LCUA 4JD2B 4PKGA 1RGIA 3ULEA 4CI6A 4M7YA 1NMDA 4BRDA 4BR4A 4FWQA 3VETA 3D2FA 3D7EO 2D4WA 2E1YA 3HI0A 4HWIA 1BA0A 2YHYA 3MN9A 1TYQA 1T44A 3FZHA 1TUUA 3FLCO 3OHRA 1MWMA 1HPMA 4XH1A 3F9MA 1S22A 1WUAA 4H0OA 1R59O 4K42A 3WXKA 2CGLA 2P9UB 4NO7A 2QWRA 5AQVA 2CGKA 3VOVA 5FPMA 3H3OB 3GOIA 5EY4A 4J8FA 1TUYA 1OKJA 2FSKA 3CJ9A 3IUCA 4QS9A 3QBXA 5AQZA 4BG9A 1HKCA 3C7NB 4JHDA 1KAZA 3VERA 2ZGYA 1BA1A 4IWVA 4BC3A 3UKRB 3SMPA 4BVOA 4AM7A 3DWLA 4F9OA 3BEXA 3UB5A 3BF3A 3ATUA 2DPNA 4FO0A 2BTFA 2QXLA 2V51B 4BVPA 2GWKA 1NGBA 4BR9A 5AZIB 3FZLA 2IVPA 2FXUA 1C0FA 4B1WB 3KHYA 4H03B 1D4XA 2P9SA 4FPAA 4IJNA 5BPLA 4H5WA 5BREA 3WXIA 1QQNA 3H45C 1V4SA 3VGMA 4H0PA 2A42A 3TU5A 1NLVA 3FZKA 3VF4A 2F9TA 4DCHA 2P9IA 3HM8A 2E2NA 5LJWA 4C23A 5E84A 2A5XA 3TPQA 2E2OA 5AZJA 5BRFA 1Q18A 1CZAN 5EXWA 5E26A 3ZX3A 4B1VA 4BG8A 2YJFA 5CE3A 1XQSC 3ENHA 2QWNA 2E8AA 4L3QA 1HX1A 1YUWA 3SJHA 5BN9A 1EQYA 1Z6RA 5BRHA 3WT0A 5JLHA 4JN4A 4MO5A 1HKBA 2HMPA 4CBUA 2E88A 3GE1A 4FWLA 3VF2A 1ATRA 3LDPA 1NM1A 4YDUC 4I6MB 3SMSA 4BROA 2QWOA 3KVGA 3C0BA 3O6WA 2F9WA 4K43A 3O5BA 3U4LA 3U8XA 5BN8A 4WQ5C 3LM2A 3WUHA 2Q36A 1NGJA 1NGDA 2NRHA 2Q97A 5AQUA 3AAPA 3ULEB 3GBTA 3HZ6A 5F1XA 3EKUA 5KPRA 3VENA 4CBXA 3VEZA 2IIRA 3D2FB 3DXMA 4KBOA 4B9QA 2YCHA 3DXKA 4BRAA 4BRFA 1TYQB 3ZX0A 1MDUB 5EX5A 4FL9A 1J6ZA 1RDWX 2Q0RA 3I8BA 1BDGA 5AQRA 1SQKA 1BU6O 5BR9A 3CJ7A 1K8KA 3QBWA 4H0YB 1E4GT 3D2EB 3WXJA 3H1QA 3G25A 1Z05A 3EL2A 4PL8A 3QB0A 4ISFA 3GL1A 3MK6A 4CD1A 1GLDG 2GELA 3UKUA 4B1ZA 3RSEA 3O08A 5AQGA 3W0LA 4EAHD 2NZTA 5FPNA 3H46O 1BOTO 3QFPA 2UYTA 1KAXA 4K25A 5AQMA 4WQ5A 1NGCA 1ZBSA 4A2AA 2Q0UA 4IXCA 2AA4A 1P8ZA 1NGGA 5AQQA 2QM1A 3VEVA 1U2VA 5F2RA 3MMVA 4PKIA 1DGKN 4FWRA 4CJ7A 5AQTA 4RWTA 4RCHA 3ZETA 3EN9A 5KQ8A 4FOIA 3A0IX 3CI5A 4CZLA 4JNEA 4CD3A 3M6GA 3M1FA 4PKHA 3MN7A 4O5FA 5AQLA 3AAQA 2E2QA 3CJBA 2Q2RA 4WYBA 1MWKA 2P9IB 2GUPA 1X3MA 2P9KA 2P9LA 2YJEA 3WQTA 2ZF5O 3O80A 3L0QA 3WQUA 1ZXOA 1NGFA 2ZGZA 4O8KA 3VEOA 1G99A 4BQLA 3FR0A 1GLBG 2OANA 1S3XA 2QWMA 3B8AX 2A40A 3U9ZA 3P4IA 3M3ZA 1YXQA 3W3DA 3MN5A 3I33A 3MCPA 2BUPA 3DJCA 5AR0A 1JCGA 2EWSA 4IO8A 3R8EA 3UE5A 3WEEB 4CBWA 4CZFA 1KXPA 4QS7A 5AQIA 1H1VA 5LY3A 5AQSA 4B1UB 1IJJA 1JCEA 5AQNA 3EO3A 4XH4A 2I7PA 4A2BA 3SLCA 4B1XB 4BGAA 2A6AA 4EHTA 1XUPO 2ZWHA 3FZMA 4Z94A 5AQYA 3BUZB 3WXLA 1YAGA 4CZGA 3VEXA 4FOEA 1BO5O 5BPNA 4BRLA 3H3NO 2PBDA 1Y64A 1GLCG 2KHOA 3CJAA 4JAXA 5LJVA 1NGIA 3CIPA 4DHYA 4AM6A 2ASPA 1SZ2A 4QS8A 4M63C 3J8AA 4BR7A 2W40A 3QICA 4H0VB 4H5VA 3L6QA 3DXMB 1HLUA 3IDHA 4FWOA 3DXKB 1NGHA 4CZIA 1V4TA 4CZMA 4BR0A 5BRDA 4BRNA 3LL3A 3AY9A 3SK3A 3HBTA 3VESA 1KAYA 2PAVA 2NLXA 1BG3A 1BWFO 5JMVA 4BRCA 1YVNA 1NGAA 3CETA 4CZEA 2YI1A 5AQJA 3CERA 2A41A 2P9NA 2P9PA 3VF6A 3ZX2A 1SAZA 3UKUB 3VGLA 2CH5A 4BRMA 2FLOA 3MN6A 3JS6A 3ATVA 3FGUA 1GLFO 5ADXH 2V7YA 4MLEA 1U2VB 4ISEA 4K41A 1U6ZA 3R6MA 4M7XA 4H0TB 3HSCA 2W41A 3H1VX 4MO4A 4JHDB 5ADXA 4YDUA 2QWPA 3ZETB 2A3ZA 3HTVA 2ASOA 1QQMA 2FF6A 4BR2A 4BGBA 3ID8A 3VPZA 1DEJA 4BC5A 3LDNA 2Q1NA 4IZ9A 5B8HA 4A62A 2D0PA 4XEIA 2E1ZA 2YHXA 3ZEUA 3A5NC 1NGEA 4JD2A 3CHWA 2P9KB 2P9LB 2P9SB 2GEMA 2FSJA 4LC9B 2GTDA 5AQWA 1BUPA 4FWSA 1T6DA 5TKYA 5KQDA 2FSNA 1WOQA 1ATNA 4EHUA 1IG8A 3D2EA 2D0OA 4H5TA 3CJ1A 5AQXA 4BRIA 1GLAG 1QQOA 3LM9A 4MLHA 5FPDA 3EZWA 5AQHA 4Y0WA 1E4FT 2WUSA 1DKGD 3U9DA 5AZJB 3GDQA 4BRPA 2P9UA 4IJAA 3R9PA 2VYPA 3BP8A 5F0XA 3MDQA 5FPEA 1T6CA 4BREA 1HUXA 2IVNA 4WQ4C 4A61A 3FE1A 1RFQA 1C0GA 5AQFA 2HF4A 3A8YA 3H6EA 2E2PA 1ESVA 3CJCA 3QFUA 4BR5A 3LDQA 3C7NA 3IMXA 4H0XB 3O1BA 2HF3A 5BPMA 3UKRA 4BC2A 5JICA 2QWQA 1QHAA 5KPTA 2HOEA 4BRHA 4XH5A 1GLJO 3FZFA 4NB4A 5AQKA 1NBWA 2QW9A 2CH6A 3IFRA 3JXUA 4FPBA 4GY2B 4FWPA 4FSVA 3O4WA 5AZIA 4E1JA 5AQPA 2H3GX 3BF1A 3DAWA 3O1WA 3S41A 4FWMA 3VEWA 4FWNA 4H5RA 2YHWA 3CQXA 1ATSA 2E20A 3GG4A 5JLFA 1JCFA 4RTFD 5AQOA 2Q31A 1ZC6A 3CQYA 2IVOA 4HTLA 4CZKA 2GWJA 4EIAA 2J4RA 1MA9B 3FFKB 1GLLO 3ENOA 3LDOA 5KPZA 4BC4A 2I7NA 1HJOA 2QWLA 2P9NB 4H5NA 2P9PB 3QMLA 4WQ4A 2VWBA 5ELZA 3VEYA 3QDKA 3WEEA 5AFUH 2VCPA 1K8KB 4BRQA 4CZJA 3AARA 5I9EB 4BQZA 3EKSA 2CGJA 2V52B 1GLEG 1HKGA 2ITMA 3O8MA 1LOTB 4ISGA 4BRKA 3L4IA 5AFUA 4EFHA 4FWKA 1QZ5A 4PL7A 3RSEB 2AP1A 3LDLA 3A5LC 3A5MC 2ASMA 1NWKA 5EVZA 4GNIA 2V7ZA 1QZ6A 4CZHA 3KZBA 3VGKA 3A5OC 4I6MA 4DQ8A 1XC3A 1X9JA 2D1KA 5EOYA 4DB3A 2FF3B 4BRGA 4B1YB 1X3NA
chains in the Genus database with same CATH superfamily
5GAGP 4PKGA 3AVKA 2UXCK 1KRPA 3VQQA 2PYJA 2OPQA 1WLJA 4BRDA 4CFAA 2HBLA 3VQEA 4E7JA 5HRNA 3VETA 2NRXA 3D2FA 4IOAL 3NGZA 4FJHA 4KTQA 4Q0BA 3N4PA 3FZHA 2R7YA 4F2RA 1MWMA 1HPMA 4XH1A 3K5LA 3F9MA 5C2FA 1KCFA 1WUAA 1VRTA 4H0OA 4DR4K 4NO7A 2QWRA 4DS5A 3K9KA 1N33K 3KK2A 3GOIA 5EY4A 2D0CA 4J8FA 1TUYA 5DK5A 3CJ9A 4KREA 4IBNA 4QS9A 1BCOA 4CJUA 3SZ2A 1ZBIA 3RRGA 1J53A 2X6SA 1HKCA 4DMNA 3A2FA 3C7NB 1KAZA 2ZGYA 3UKRB 4B8CA 4WFNL 3I55N 4GMJB 4B3SK 3BEXA 3ATUA 4DLGA 4FO0A 4ID1A 3OYDA 3OYGA 2BH1A 2V51B 3P39A 4CF2A 5AZIB 4XJXA 2GX9A 2AJQA 4MFBA 4IJNA 2X6NA 5BPLA 4H5WA 1S6QA 4DWIA 1LWFA 2C1GA 3PUFA 3KKRA 3O3FA 1NLVA 3THXB 2F9TA 4E7KA 2E2NA 5LJWA 5KGWA 1WSFA 1NKEA 4B3OA 5AZJA 5BRFA 3T1YK 1Q18A 1CZAN 2BANA 4C1NI 3KLHA 3J7ZO 4BG8A 5CE3A 4CJ4A 4CJ5A 1TKTA 3DI6A 4L3QA 1HX1A 1YUWA 5BRHA 4M3ZA 4WCEL 4E89A 3WT0A 3OY9A 1NK0A 3THYB 3DM2A 1YTAA 3VA3A 2HMPA 2E88A 3ZSQA 2UUCK 2P51A 1S6PA 3VF2A 3CCSN 5GINA 3LDPA 3E1YA 4GV9A 4UY8O 5HBMA 1T3VA 3O6WA 4YOYA 5BN8A 1WSHA 3THVA 3AA3A 1YIJN 1YVUA 2VG7A 3LZJA 1IBMK 1NGJA 1RBVA 5KPRA 4KI6A 4HHTA 4FW1A 3DXMA 3NF7A 1TL1A 4O0IA 3ZX0A 1MDUB 5EX5A 3OYHA 4DSEA 3D45A 4IDHA 5JVGL 4M3YA 2DFHA 4CK1A 3KKSA 5I3UA 1NKCA 3D2EB 4JK8A 3WXJA 4KV8A 3V1RA 3KWGA 1NJIO 2EX3A 4YOVA 3CCUN 3LDSA 1IKVA 4BDPA 3GL1A 4JI0K 4CD1A 3PO4A 4F8RA 3W0LA 4CJLA 2Z1HA 1RT1A 3H46O 2A1RA 2UYTA 3MAQA 3RRHA 4IXCA 3AVCA 1P8ZA 1A5XA 1U2VA 4OX9K 3MMVA 4PKIA 3VTHA 4W5NA 5A2QO 4X66K 4RCHA 1DT9A 1VHXA 4CZLA 4CD3A 3M6GA 4B9LA 4IEIA 4CJPA 3M1FA 3O9SA 3MN7A 4YOWA 4TSXA 3CF5L 1U45A 2E2QA 5LL6Z 3CJBA 1MWKA 2P9IB 3OTOK 1X3MA 2P9KA 1O13A 1G99A 3FR0A 3SUPA 3TABA 2NRZA 3ZSZA 1GLBG 2OANA 1S3XA 3KK7A 1FJGK 4ELVA 2A40A 3M3ZA 4FJMA 3DLBA 2BUPA 3P38A 1KLMA 1JCGA 4CZFA 3J80O 3T7ZA 2Y1IA 4QS7A 5AQSA 4B1UB 3JSMA 4HCBA 4AHTA 4CHZA 4JKFA 5M1OA 2OPRA 4BGAA 1K6YA 3C6UA 1RT5A 2ZWHA 4NLBA 4Z94A 5AQYA 4DLEA 4U67L 4N76A 4CECA 4CZGA 4FM0A 1BO5O 2O8CA 3OYLA 4GVEA 2B5JA 4FYDA 3H3NO 1GLCG 3DRSA 1NGIA 3CIPA 1SZ2A 4X62K 3RR7A 4JK7A 2ETJA 5LMNK 3IDHA 1HLUA 4FWOA 3ULDA 2O8DA 2Z1GA 1NGHA 4E72A 1V4TA 3MX5A 4BR0A 3ID6A 1VQ8N 3O3GA 4C1NK 4JEPA 3HBTA 4DU3A 2NLXA 4KH6A 3HK2A 1BG3A 1QS4A 4CF1A 3VQPA 1W2BM 3CETA 2ZD1A 4CZEA 4BY9C 2A41A 3LAMA 3AA2A 3CG7A 2VG6A 3ZX2A 2E6MA 4BRMA 5DM6L 3MN6A 3ATVA 1IG9A 3ZT0A 4I2PA 3AVAA 4YNQA 1SS6A 3C6AA 1TK8A 3OBYA 3VQ8A 4CVNE 4ISEA 1ITGA 1U6ZA 1L3SA 1HMVA 5I42A 4H0TB 3HSCA 4N41A 1JLAA 3H1VX 3CC4N 5D3GA 1G15A 4JHDB 4YDUA 2QWPA 3CCQN 4BGBA 5KRSA 3DLRA 4PHTX 2O4GA 4DFJA 2KZZA 2HHXA 2Q1NA 1ZBLA 4FXDA 4F3OA 3CCMN 4OPKA 3ZEUA 1RDBA 3MEDA 1NGEA 4JD2A 2P9SB 1FKOA 3T19A 1N34K 4C8LA 1BUPA 4B8AB 3AV9A 2BDPA 1WOQA 2XY8A 5AQXA 4U7BA 1GLAG 2ATQA 3O4QA 3Q7BA 3O3HA 1VQ7N 3KLIA 1DKGD 3U9DA 2P9UA 3QEWA 2VYPA 1TV6A 3BP8A 3DLGA 1T6CA 5GADP 1HUXA 1KTQA 3AGRA 3H6EA 1XI1A 1RTDA 2XO7A 3CJCA 4BDZA 3LDQA 4JRQA 5KRTA 4BC2A 4CJSA 3T1AA 1QHAA 5KPTA 2HOEA 1GLJO 4NB4A 4FPBA 3EEQA 4E7IA 2O8BA 4JKAA 3I0SA 1S9GA 4HUGA 3IRXA 2QKBA 4FJ8A 4H8KA 4JI1K 2VQFK 2YNFA 5M1NA 2H3GX 4O8UA 1VQPN 1TKXA 2YHWA 3VQ4A 3GG4A 3L3UA 4M42A 5AQOA 3L3VA 4NCBA 4HTLA 3CM5A 4IOXA 2YNGA 1L3UA 2J4RA 1MA9B 4A5BA 3FFKB 2FBVA 5KPZA 4BC4A 4CE9A 1HJOA 2HHIA 2KQ2A 2QWLA 2P9NB 3LP3A 1KVBA 2HBMA 3VEYA 4ILHA 4JI5K 4KI4A 5I9EB 4DS4A 4DTPA 2CGJA 4ELTA 1WBBA 4PQUA 1HKGA 1X9SA 2KTQA 4BRKA 1LOTB 5AFUA 3HVRA 3LDLA 3A5MC 4DFMA 2ASMA 1NWKA 5EVZA 1W97L 4GNIA 4FJJA 3DYAA 1LWEA 2F96A 1LWCA 1HYVA 4H4OA 4I6MA 1RDCA 4DQ8A 4DB3A 4M3UA 5C0YA 4BRGA 1KVCA 1X3NA 3SV4A 3N4QA 1RGIA 3ULEA 1FXXA 4M3RA 3ZYYX 1SV5A 1NMDA 5SWMA 4KB1A 3NH2A 4W5RA 3D7EO 5CZ1A 3LALA 3HI0A 4HWIA 5KGXA 1TYQA 3PLAA 4DTMA 1OVQA 1VQ6N 2OCEA 1S22A 3OYFA 1R59O 1F21A 3CFRA 3VQDA 3VOVA 4FJIA 5AQVA 2PYLA 3L2WA 5FPMA 3H3OB 1W9HA 4AILC 3DLKA 4O5BA 3IUCA 4DR2K 4FJGA 2JLEA 4Z4HA 4ZHRA 5AQZA 4DV5K 3MEGA 1RTHA 3VERA 1Q9YA 1BA1A 2HNZA 2HNYA 5J2QA 3SMPA 4CERA 3DWLA 4F9OA 4FM2A 4EZ6A 1KVAA 3UB5A 4LSLA 2DPNA 2QEXN 3RR8A 4W5TA 2W00A 2QXLA 1EX4A 4OPHA 2HVIA 1NGBA 2FXUA 4B1WB 4H03B 2D0BA 2QKKA 3KWIA 1FK9A 4EZ9A 1EWRA 4FPAA 1OVYA 4OO1J 5BREA 3WXIA 1W7AA 3H45C 1X9WA 3CCRN 4H0PA 3G10A 2HVHA 5HLFA 3J81O 3HM8A 4C23A 1XNRK 5C24A 2KW4A 2A5XA 2E2OA 4CHQA 4FM1A 1T05A 3ZX3A 4JK9A 2YJFA 3VQBA 4CJEA 2QWNA 2E8AA 4ID5A 2XY6A 5BN9A 1I94K 5JLHA 2WONA 4MO5A 1HKBA 3QLHA 3PX4A 3GE1A 2YX6A 4FWLA 3HOSA 1ATRA 1NM1A 4BROA 3VQ6A 4QCLA 3C0BA 4FLYA 3PSIA 3NF6A 1SKWA 3DMJA 3GBTA 3HZ6A 4OGCA 3EKUA 2NRTA 5F1XA 1DLOA 3D2FB 4KBOA 4B9QA 3O9TA 3KIOA 4B9TA 4BRFA 1VQLN 3SCXA 3I8BA 3TANA 1SQKA 1B9DA 5BR9A 3CCEN 3CJ7A 4O0JA 1XHXA 3F73A 3SUOA 4ELUA 3E9LA 3EL2A 4M3WA 3T69A 2YNIA 3SUQA 2DTUA 3UKUA 4AHVA 3O08A 5AQGA 1NMNA 4EAHD 4JI8K 2WOMA 2NZTA 4K0KK 1ASWA 3AA4A 3C94A 4DG1A 4K25A 1KAXA 3M8QA 3OYEA 1E3MA 1U04A 4DQQA 5J2PA 3P1GA 4A2AA 3K2PA 5HRSA 3AO1A 2AA4A 1S1XA 4E3SA 1RDAA 4YY3K 2VG5A 4QOZB 3LP0A 1DGKN 3ZETA 4Y1CA 4C8MA 4AHRA 3EN9A 5KQ8A 4YHHK 2KFZA 1S9EA 1SKSA 1BL3A 2IOCA 2YNHA 1NOZA 1KFSA 5CR4A 3KK1A 3QERA 3AAQA 2OZSA 4LFBK 1SL0A 1NK9A 4EP5A 4ZTJA 1YT3A 3K5NA 2ZF5O 3L0QA 3WQUA 2ZGZA 1NGFA 1GOCA 2D5RA 1OH5A 4CEBA 3TWHA 5GIOA 4KFBA 1QSSA 1KLNA 3B8AX 1IV0A 3W3DA 4M3XA 3RMCA 2QK9A 5AR0A 4DFKA 4PY5A 2EWSA 3WEEB 1Q7YO 4NCGA 3EO3A 4KH4A 4XH4A 1L3TA 2Z1IA 3SLCA 2A6AA 1X1PA 2HNDA 3QO9A 5JS2A 5MLCQ 4NXNK 1YAGA 3ZT4A 4LSNA 1C1AA 1QE1A 4BRLA 2DY4A 2PBDA 1Y64A 2KHOA 4N5SA 1BI4A 1D5AA 1S1VA 3IG1A 1TAUA 5J2NA 4R79A 4M63C 1XHZA 3UIQA 4WF9L 4H0VB 4PUOA 3DXMB 4JV5K 1D9FA 4OPAA 4CZIA 4CZMA 4FVMA 4I9QA 4JRPA 3AO2A 2W6LA 1JL1A 3ZSVA 3HYFA 2IC3A 4DR6K 1BWFO 1C0UA 3SNNA 5JMVA 3CQ8A 4BRCA 1K9MO 1C6VA 4CEEA 2YHBA 3LPTA 3CERA 1K73O 4LFCK 4DU4A 4HCCA 2DFEA 3V9UA 1N32K 1SAZA 2CH5A 3O9UA 4DQIA 4J2EA 3JS6A 3PX0A 1RCHA 1YITN 5M1PA 4CK3A 3I0RA 4DV0K 3HT3A 2RN2A 3HRGA 4I7FA 3KTQA 1U2VB 4M7XA 4DTJA 4KHUA 3SYZA 2B4JA 2W41A 3NMUA 4MO4A 5ADXA 4LF6K 3HTVA 1S1TA 4DV4K 1VSIA 4B3TK 3ID8A 3MEEA 2HB5A 4GV3A 2BE2A 4A62A 1IBLK 4LF4K 2JGUA 2P9KB 3NF8A 2GBZA 4LC9B 4A5AA 2Y1JA 5KQDA 1ZYQA 1ATNA 1HYSA 2D0OA 3D2EA 4N47A 3WXMB 3OA9A 3NGYA 3LM9A 4AH9A 3OYBA 3VQ7A 4HUFA 4MLHA 5FPDA 3EZWA 1LW2A 1WBDA 4DTXA 4KAZA 1WAJA 1C1CA 1DTQA 5J1EA 2GUIA 3GDQA 1VK0A 5FPEA 1YTUA 3SBTA 1JXBA 3OYAA 3HP6A 4OJRA 2DFFA 4AQYK 2HF4A 3A8YA 2ITGA 3OBWA 4BR5A 1IH7A 4JKCA 3IMXA 3O1BA 3EE8A 2HF3A 2O8CB 3CPWM 1N6QA 5E41A 1QQCA 1RBTA 5FROA 5BPMA 4B9VA 4FJLA 4XH5A 3FZFA 3TSQA 3T3FA 3U6FA 3V1QA 2QW9A 4FLUA 3IFRA 4FWPA 3RVCA 1L3VA 4LF8K 2O8DB 3O4WA 4OGEA 3ZSOA 1RBSA 2WFBA 4E1JA 4YOXA 4CEQA 3J7AP 3CM6A 3BF1A 3O1WA 3S41A 4FWMA 1VSEA 3PSFA 3K5MA 2E20A 5JLFA 1JCFA 4DR1K 2Q31A 3CC2N 3CQYA 2IVOA 3V9WA 3TAEA 3CCLN 2GWJA 3ENOA 3LDOA 4MDBA 4KHWA 3MXIA 3V6DA 3QMLA 1TGOA 3VN5A 2HW3A 3ISNC 3VQ5A 5AFUH 4HTUA 2VCPA 1K8KB 4BRQA 4CZJA 1GOBA 2B6AA 3AARA 4BQZA 4RW9A 5IWAK 2ZJQL 4B9SA 2UU9K 2HHUA 2HHWA 4ILJA 3NH1A 3DLEA 3S5TA 4FLTA 3SQ4A 1YHQN 1UA0A 4IG3A 1GLEG 4E7HA 4JI6K 3O8MA 3DRPA 4ISGA 2NUBA 4EFHA 2Q3SA 1JL2A 4CFDA 3RSEB 2G8UA 1RTJA 4DR5K 4FJ9A 4CJ3A 3K9JA 3VGKA 1QSLA 3C6HA 4I9LA 5EOYA 1BIZA 4DTNA 2VGNA 3ZEUB 1HR0K 1LCUA 4JD2B 1QHTA 4CI6A 3DLHA 1WSIA 3B6PA 1IKWA 4M7YA 1D8YA 1UAXA 4BR4A 1NK4A 1BA0A 2YHYA 3ZCMA 3FLCO 3S9HA 4GKKK 3S3NA 4IFVA 3NF9A 4LF7K 2D0AA 4B3RK 2P9UB 3SQ0A 2CGKA 4BE0A 3P31A 1HNXK 3H08A 4OVLA 4DFPA 3OJSA 3KLEA 1OKJA 2FSKA 2NRVA 3QBXA 3PX6A 3VA0A 3TTFA 4JI2K 4BG9A 3KK3A 1ZBFA 4JKGA 4JHDA 4IWVA 4BC3A 1SL1A 4E19A 1M90O 3F2KA 1WNSA 4AM7A 2JWLA 4O55A 3L2UA 4C8NA 4RW8A 3S3MA 4RW7A 4CEOA 3AA5X 3I56N 3ZT1A 2HHVA 1TVRA 3HPGA 3OYCA 2IVPA 1C0FA 1R0AA 3KHYA 2IGIA 1D4XA 2P9SA 3E9OA 4BWJA 2G8HA 2HHHK 2G8IA 2G8FA 5FRMA 1V4SA 4JKBA 2QXFA 4DKWA 2KKZA 3CYMA 2G8WA 4JKEA 3HPOA 2A42A 3TU5A 3FZKA 1T8EA 1UWBA 4DCHA 2HHSA 1CXQA 3TPQA 4E7LA 4CJQA 5EXWA 3ZSYA 5DMRA 5CHIA 4FVUA 1U49A 1FW6A 1XQSC 2ZJRL 4G9ZA 4KTZA 4NXMK 1CZ9A 2O8FA 1RILA 4JN4A 3BZKA 1JLFA 4LH4A 5M1KA 4DSFA 2RHKA 3WNGA 4CBUA 2F4VK 1T03A 3AVJA 2YHAA 3NFAA 1NJXA 3K5OA 1LAWA 3NHGA 3O9RA 4YDUC 4I6MB 2ZM6K 4FK4A 2QWOA 3KVGA 3TAFA 3U4LA 4K43A 3L2QA 3O5BA 4C8OA 1BCMA 1VQ9N 4WQ5C 1REVA 3LM2A 3WUHA 2P5GA 2Q36A 4NCAA 1NGDA 5AQUA 3AAPA 3ULEB 4JKHA 4O44A 4CBXA 1P90A 3VEZA 1RT3A 1YF5L 2YCHA 5JVHL 3DXKA 4DTOA 4BRAA 1TYQB 4JS5A 1RT4A 3B6OA 3THWA 1J6ZA 3QNNA 1TL3A 1BDGA 3SUNA 5AQRA 1NJYA 3LPUA 4NLCA 3QBWA 4H0YB 1E4GT 3PV8A 3H1QA 3G25A 4Z4GA 5FDLA 1C0TA 3V9XA 1HNIA 4J2DA 3QB0A 3MK6A 3HM9A 1GLDG 5HL7L 4J2AA 2GELA 4B1ZA 4Z4CA 3MCAB 5FPNA 4X64K 1BOTO 5HRRA 3QFPA 4FZYA 1TKDA 2XY7A 1NGCA 1QTMA 2Q0UA 1IKYA 4DV3K 3QIPA 1L5UA 1B9FA 3NVKA 4CEZA 4F4KA 5AQQA 4LF9K 3VEVA 5F2RA 4FWRA 4CJ7A 4Z4FA 2UUAK 4RG8A 3CMAN 1RT2A 1VQKN 4FOIA 3A0IX 4JLHA 4PKHA 2P5OA 5AQLA 4CJVA 4Z0UA 1N36K 4WYBA 2RKIA 2P9LA 2YJEA 3J7YP 3O80A 1ZXOA 3VEOA 4BQLA 3NAEA 3DOLA 1RT7A 3M5RA 1HNWK 1K8AO 4AF1A 4Z4IA 1EXQA 2QWMA 5CY4A 1BHLA 3P4IA 1RTIA 1VSFA 3RMAA 3NE6A 4DSJA 4DU1A 2ZQBA 3JYTA 3HOTA 2EHGA 3DJCA 2WC9A 4BE7B 3UE5A 1KXPA 1H1VA 3R1XA 3QEPA 4FJNA 4FW2A 2QA4N 1IJJA 1RBUA 3U3GA 4A2BA 4CEFA 2JWKA 4B1XB 4NYNA 4I2QA 3QNOA 3AVFA 5H1SQ 4DTUA 5C10A 3VQ9A 3BUZB 3WXLA 3EZ5A 1YJ9N 4DSKA 1NOYA 4M45A 1HQEA 2F7TA 3CJAA 2VGMA 4AM6A 2ASPA 4QS8A 4DUZK 4FJXA 3FFIA 4BR7A 2W40A 1Q8IA 3QICA 3L6QA 3AGKA 1RDDA 2OTJN 1RNHA 4BRNA 2W42A 3AY9A 1NJWA 3SK3A 1ZBUA 3VESA 2PAVA 1KC8O 5HOOA 4IO9L 1A5VA 2IAJA 1YVNA 1NGAA 4FLWA 3OYKA 2YI1A 5AQJA 4RW4A 2P9PA 3RWUA 3VF6A 2NRWA 3UKUB 4YORA 1BQMA 2FLOA 5M1QA 3G71N 1IO2A 1ASVA 3QEIA 5ADXH 2O8EA 2YKMA 3C95A 3KLFA 3CMEN 1J5EK 1XWLA 2NRRA 4K41A 4EP4A 1ASUA 3ZETB 2A3ZA 1WB9A 1QQMA 5T7BA 3QEXA 2BGGA 5K14A 2C1IA 1T7PA 1HYZA 4WFBL 1EWQA 4KHNA 3LDNA 4DR3K 4IZ9A 1C1BA 4CIEA 2HHQA 2GEMA 3OYMA 1HNVA 2GTDA 5AQWA 3LZIA 4FWSA 1SKRA 5TKYA 3TR8A 2FSNA 5EU7A 1IG8A 4GW6A 4H5TA 3Q7CA 4CIGA 2IS3A 2NNWA 1NG9A 1XC9A 4PWDA 4DQPA 4Y0WA 1E4FT 3KD1E 5AZJB 4IJAA 4CHPA 3CD6N 4N56A 5F0XA 4BREA 2UXBK 2IVNA 4WQ4C 2X74A 4A61A 1C0GA 3AO3A 2FC0A 3L8BA 1NJZA 4DV1K 4Z4EA 2E2PA 3TAQA 4O4GA 1HQUA 3VQAA 3C7NA 4H0XB 2F8TA 5AJ3K 4CFCA 4FLVA 1RBRA 3UKRA 2QWQA 4GV6A 1QSYA 1BI4B 3SBGA 3ASMA 1TK5A 4FJ7A 3PY8A 4CGGA 2CH6A 3EY1A 4CK2A 4FSVA 4E1NA 3ZT3A 4B1YB 5AZIA 1HNZK 1NNEA 1HJRA 4FCYA 1JLCA 5AQPA 3AVGA 1WSEA 4K8XA 4FWNA 4H5RA 3CQXA 3D0PA 3OW2M 4CF0A 3MWTA 5CYQA 4EIAA 4LF5K 3SAFA 3THXA 4OKEA 1M1KO 2I7NA 4CESA 4B9UA 3O9QA 4KHYA 3PIOL 3QETA 3RMBA 2VWBA 5ELZA 3F5TA 3QDKA 5TKWA 3WEEA 3CXCM 1NK7A 2OPPA 3LP2A 3ZSWA 1VSMA 2E6LA 4CGHA 4DV6K 3WNFA 4M41A 4CFBA 4E0DA 4BDYA 5GAEP 3VMFB 4DV2K 2ITMA 3U3YA 3CFOA 1XMQK 4FWKA 3THYA 2X78A 3NCIA 3A5LC 3MX2A 4B9NA 1UA1A 1OH6A 2E4LA 2PFUA 3NBPA 3E01A 4CZHA 4CHYA 4GVMA 3M8PA 2D1KA 3SQ2A 4CJFA 5CZ2A 1NU0A 1NKBA 3TSPA 4JS4A 4K8ZA 4ILGB 4KHPK 2QI2A 2HBJA 3BDPA 1RDUA 5DM7L 4M3TA 2G8VA 3HP9A 3ENBA 4FWQA 3ALYA 4OKKA 2OA8A 1JJ2M 1JLQA 2HHTA 1BQNA 2D4WA 2E1YA 3MN9A 1T44A 2WTUA 1CLQA 4HVJA 1TUUA 3OHRA 1C0MA 4CJRA 4JYAK 3QIOA 4K42A 3NH0A 3WXKA 2CGLA 4WE1A 4A59A 4IEEA 1NK6A 1JLBA 2OTLN 3D6RA 3R3LA 5C15A 2XHBA 3RTVA 3EE9A 3DOKA 4CHOA 4QAGA 3BY5A 2WBNA 1TAQA 2FBYA 3MXJA 4BVOA 2ZE2A 3BF3A 5BR8K 2BTFA 4KH5A 4BVPA 3OS2A 3G6EN 2GWKA 5KI6A 4BR9A 3FZLA 4KHSA 1BISA 2VQEK 2KZMA 1QQNA 3VGMA 4X65K 3LAKA 3OJUA 4RW6A 1BGXT 4KB0A 1N5YA 4FK2A 3SQ1A 3VF4A 2P9IA 4YOTA 2G8KA 3MWPA 5E84A 1KD1O 1YJWN 5E26A 1VSJA 3AVHA 1JKHA 4UQGA 1NK8A 2GV9A 4B1VA 2KFNA 3AVNA 4CF8A 4B08A 3OS1A 3G4SN 4DQSA 3ENHA 3HJFA 3SJHA 1EQYA 1Z6RA 4DF4A 3WNEA 4KRFA 4CGIA 4OPJA 3BGRA 4IFYA 3E9PA 3TTDA 3V81A 4YFUA 4IG0A 4V19S 3IKMA 3CFPA 1VQ4N 3CCJN 4BWMA 3VQCA 4CJWA 3DLLL 5CYMA 3SMSA 3U8XA 2F9WA 3AO4A 2OZMA 4DV7K 2NRHA 2Q97A 3LANA 3HXMA 3K0SA 3MXMA 5IT9O 1EP4A 3VENA 4G1QA 1UOCA 4B3MK 2IIRA 1BIUA 4Y1DA 4FLZA 1ZBHA 3PO5A 4Q5VA 4CEAA 2I5JA 2PY5A 5KTQA 3ZT2A 1HRHA 4CGJA 1EO1A 4FL9A 1RDWX 2Q0RA 1IBKK 3OS0A 4NYFA 1BU6O 1J54A 1K8KA 4W5OA 3M8SA 4F2SA 4BECA 1SUQA 4FJKA 1LW0A 4B9MA 1QVGM 1Z05A 4PL8A 2W6KA 1JLEA 4HUEA 4ISFA 4LY7A 4JKDA 4JKGB 3RSEA 1YJNN 3OVNA 3K57A 1OH8A 1LV5A 5AQMA 4MQ3A 4WQ5A 1ZBSA 4CCHA 1TKZA 4ICLA 3MECA 1VQON 1NGGA 5LMUK 2QM1A 4AHUA 3TARA 3CYGA 2ZJPL 2YV0X 5AQTA 1S72N 4RWTA 4FZZA 5HRPA 4DSLA 1TK0A 1VAZA 1HPZA 2RPIA 3TAGA 3CI5A 4IDKA 4JNEA 3F9KA 4CIFA 1S5JA 3AVIA 3AVMA 4LH5A 2O8BB 1VSKA 4O5FA 3C6TA 2RF2A 2Q2RA 1WAFA 2GUPA 3WQTA 1Q81O 4O8KA 3V1OA 3PIPL 3IS9A 3TI0A 1JXEA 3U9ZA 1YXQA 3KD5E 1RT6A 3TSUA 2O8FB 3MN5A 3I33A 3MCPA 4IO8A 3R8EA 4CBWA 5HP1A 5AQIA 5LY3A 1B92A 1Q9XA 4KHQA 1JCEA 5AQNA 1KQSM 2I7PA 2RE2A 1IKXA 4EHTA 1XUPO 4DR7K 3FZMA 4OLBA 2YKNA 2O4IA 5JENA 2LSNA 3VEXA 4FOEA 3M8RA 3BZCA 5BPNA 2HBKA 2Z1JA 3SI6A 3AO5A 4JAXA 4FK0A 1GOAA 5J2MA 3TAPA 5LJVA 4JI4K 4DHYA 1MU2A 4CW7B 4CJTA 3J8AA 3TTCA 3SPZA 4H5VA 4JI7K 3S3OA 3DXKB 2A1SA 1CZBA 5BRDA 3LL3A 2OYQA 3THWB 1KAYA 4DSIA 3V4IA 3O4NA 1KFDA 1VSLA 4FJ5A 3SAGA 4A57A 4KTWA 1ILYA 2P9NA 2VWJA 2XRIA 3EYZA 4J2BA 5GIPA 3KLGA 3VGLA 3ZSRA 2UXDK 3HVTA 4AHSA 5FLXO 4BE1A 3VTIA 3FGUA 1S1UA 1GLFO 2V7YA 3IAYA 2FBXA 4MLEA 4R5PA 4MDAA 4CGFA 4DTRA 4GKJK 5SZTA 3HL8A 1U47A 3R6MA 2E5LK 1WSGA 1EETA 3NVMA 1NK5A 1VQMN 4DTSA 4IKFA 1KSPA 3OYNA 2ASOA 2FF6A 2KLAA 4BR2A 5C25A 3DRRA 4FZXC 4FLXA 1U48A 3VPZA 1DEJA 4IOCL 4OLAA 3NGIA 4BC5A 3AVLA 4ZTFA 5B8HA 1WN7A 2D0PA 4XEIA 2E1ZA 2YHXA 3K59A 3A5NC 4CF9A 3E66A 4XIUA 3CHWA 3QEVA 2P9LB 5M1FA 1A5WA 3CC7N 2FSJA 4H4MA 4YOUA 1EKEA 1W0HA 1T6DA 4DF8A 1J9AA 4EHUA 3CJ1A 4BACA 4BRIA 4AHCA 1LAVA 3T1HK 1QQOA 1S1WA 2HMIA 1CXUA 4KPYA 4CJKA 5AQHA 3ITHA 4JI3K 1OH7A 2WUSA 2QTDA 4BRPA 3R9PA 3HPHA 3MDQA 3I8DA 3WNHA 1D9DA 3SAHA 3FE1A 1RFQA 3K58A 3LP1A 1DTTA 5AQFA 1Q82O 2FBTA 1JLGA 3CPEA 1ESVA 1SL2A 3RMDA 1X9MA 5C12A 3QFUA 1VSHA 2OPSA 2IDOA 5JICA 3ZSXA 4IFEA 4BRHA 2VWKA 3QINA 5AQKA 1NBWA 3JXUA 4GY2B 3G0ZA 5C2DA 1YI2N 1XNQK 3V9SA 4KKOA 1J5OA 3L2VA 3SJJA 3V9ZA 3HO1A 2HSTA 1I39A 3CCVN 3DAWA 4PA1A 3VEWA 1ATSA 2XY5A 5JS1A 4RTFD 1ZC6A 3AVBA 3NDKA 3ZLJA 1QVFM 5C42A 1N8RO 1FKPA 4CGDA 4CHNA 4CZKA 3OYIA 3SV3A 4L8RB 1GLLO 4DUYK 4WFAL 4LFAK 4H5NA 2P9PB 1XMOK 1I3AA 4WQ4A 1Q86O 4OKJA 3C65A 1VSDA 3EKSA 1Y97A 4CEDA 3JAMO 4W5QA 2P1JA 3SPYA 2O8EB 2V52B 3HSTB 4E1MA 3OYJA 3LWMA 3L4IA 1VQNN 3P83D 1QZ5A 3L4QA 4PL7A 5HROA 3KJVA 1VQ5N 3LWLA 4BE2A 2PZSA 2AP1A 3L2RA 3TAMA 1Z25A 2V7ZA 5GAHP 1QZ6A 4BEBA 3KZBA 2F8SA 1WSJA 3A5OC 1U4BA 4C8KA 1XC3A 1X9JA 3P5JA 4LD0A 2UUBK 2FF3B 4KO0A 5FRNA 1Z26A 4F3TA 4DQRA 1VRUA 1O1WA 3QESA
chains in the Genus database with same CATH topology
2VGNA 3TSPA 3N4QA 3ZEUB 5GAGP 1LCUA 4JD2B 4PKGA 4ILGB 1RGIA 3ULEA 2QI2A 4CI6A 2HBJA 1RDUA 3ZYYX 5DM7L 4M7YA 1NMDA 3ENBA 4BRDA 2HBLA 4BR4A 4FWQA 3VETA 2NRXA 3D2FA 4IOAL 3D7EO 1JJ2M 2D4WA 2E1YA 3HI0A 4HWIA 1BA0A 2YHYA 3MN9A 1TYQA 1T44A 3FZHA 3N4PA 1TUUA 3FLCO 3PLAA 3OHRA 1MWMA 1HPMA 1VQ6N 4XH1A 3F9MA 5C2FA 1S22A 1WUAA 4H0OA 1R59O 4K42A 3WXKA 2CGLA 2P9UB 4NO7A 2QWRA 5AQVA 2CGKA 3VOVA 3K9KA 5FPMA 4A59A 4IEEA 3P31A 3H3OB 3GOIA 3D6RA 5EY4A 2OTLN 3R3LA 5C15A 4J8FA 1TUYA 1OKJA 2FSKA 3CJ9A 2NRVA 3IUCA 3EE9A 4QS9A 3QBXA 2WBNA 3TTFA 5AQZA 4BG9A 1HKCA 4JKGA 3C7NB 4JHDA 1KAZA 3VERA 2ZGYA 1BA1A 4IWVA 4BC3A 1M90O 3UKRB 3F2KA 3SMPA 4BVOA 4WFNL 4AM7A 3I55N 3DWLA 2JWLA 4F9OA 3BEXA 3UB5A 3BF3A 3ATUA 2DPNA 2QEXN 4FO0A 2BTFA 2QXLA 4KH5A 3I56N 2W00A 2BH1A 2V51B 4BVPA 3P39A 3G6EN 4OPHA 2GWKA 1NGBA 4BR9A 5AZIB 3FZLA 2IVPA 2FXUA 1C0FA 4B1WB 3KHYA 3E9OA 1D4XA 2GX9A 2P9SA 4H03B 4XJXA 3KWIA 4OO1J 4FPAA 4IJNA 1OVYA 5BPLA 4H5WA 5BREA 3WXIA 1QQNA 3H45C 1V4SA 4JKBA 3VGMA 4DKWA 2KKZA 4H0PA 3CCRN 2C1GA 4JKEA 2A42A 3TU5A 1NLVA 3FZKA 3VF4A 2F9TA 4DCHA 2P9IA 3HM8A 2E2NA 4YOTA 5LJWA 4C23A 3MWPA 5E84A 2A5XA 3TPQA 1KD1O 2E2OA 1YJWN 5AZJA 5BRFA 1Q18A 1CZAN 5EXWA 5E26A 3ZX3A 4C1NI 5CHIA 4FVUA 4B1VA 4JK9A 4BG8A 2YJFA 5CE3A 3J7ZO 1XQSC 2ZJRL 4G9ZA 3G4SN 3ENHA 2QWNA 2E8AA 4L3QA 1HX1A 1YUWA 3SJHA 5BN9A 1EQYA 1Z6RA 4WCEL 5BRHA 3WT0A 5JLHA 4JN4A 5M1KA 4MO5A 1HKBA 3E9PA 3TTDA 2RHKA 2HMPA 4CBUA 2E88A 3GE1A 2YX6A 3IKMA 4FWLA 3VF2A 3HOSA 3CCSN 1VQ4N 3CCJN 5GINA 1ATRA 3LDPA 1NM1A 3E1YA 3O9RA 4I6MB 4YDUC 3DLLL 3SMSA 4GV9A 4BROA 4UY8O 2QWOA 3KVGA 1T3VA 3C0BA 3O6WA 2F9WA 4K43A 3O5BA 3U4LA 3U8XA 5BN8A 4YOYA 1YIJN 1VQ9N 4WQ5C 3LM2A 3WUHA 2Q36A 1NGJA 1NGDA 2NRHA 2Q97A 5AQUA 3AAPA 3ULEB 3GBTA 3HZ6A 5F1XA 3EKUA 2NRTA 5KPRA 3VENA 4JKHA 4CBXA 1P90A 3VEZA 2IIRA 3D2FB 3DXMA 4KBOA 1YF5L 3O9TA 4B9QA 2YCHA 5JVHL 3DXKA 4BRAA 4BRFA 1TYQB 3ZX0A 1MDUB 1VQLN 5EX5A 1EO1A 4FL9A 1J6ZA 1RDWX 2Q0RA 3I8BA 1BDGA 5AQRA 1SQKA 4IDHA 1BU6O 5BR9A 3CCEN 3CJ7A 1K8KA 4NLCA 3QBWA 5JVGL 4H0YB 1E4GT 4BECA 3D2EB 4JK8A 3WXJA 3H1QA 3G25A 1QVGM 1Z05A 3E9LA 3EL2A 3KWGA 4PL8A 3T69A 1NJIO 4YOVA 3CCUN 3QB0A 4ISFA 3GL1A 3MK6A 4CD1A 1GLDG 5HL7L 2GELA 3UKUA 4JKDA 4B1ZA 4JKGB 3O08A 3RSEA 5AQGA 1YJNN 3W0LA 4EAHD 2NZTA 3MCAB 3H46O 1BOTO 5FPNA 3QFPA 2UYTA 1KAXA 4K25A 5AQMA 4WQ5A 1NGCA 1ZBSA 4A2AA 2Q0UA 4IXCA 2AA4A 1VQON 1P8ZA 3NVKA 1NGGA 5AQQA 2QM1A 3VEVA 1U2VA 5F2RA 3MMVA 4PKIA 1DGKN 4FWRA 3VTHA 4CJ7A 2ZJPL 5AQTA 1S72N 4RWTA 4RCHA 3ZETA 3CMAN 1DT9A 1VQKN 1VAZA 3EN9A 5KQ8A 4FOIA 3A0IX 3CI5A 4CZLA 4JNEA 4CD3A 3M6GA 4IEIA 3M1FA 3O9SA 4PKHA 3MN7A 4YOWA 3CF5L 4O5FA 5CR4A 5AQLA 3AAQA 2E2QA 3CJBA 2Q2RA 4WYBA 1MWKA 2P9IB 2GUPA 1X3MA 2P9KA 2P9LA 2YJEA 1O13A 2ZF5O 3WQTA 3O80A 1Q81O 3L0QA 3WQUA 1ZXOA 1NGFA 2ZGZA 4O8KA 3VEOA 1G99A 4BQLA 3FR0A 3PIPL 5GIOA 3M5RA 2NRZA 1K8AO 4AF1A 1GLBG 2OANA 1S3XA 3KK7A 2QWMA 3B8AX 2A40A 3U9ZA 3P4IA 3M3ZA 1YXQA 3W3DA 3TSUA 3MN5A 3HOTA 3I33A 3MCPA 2BUPA 3DJCA 2WC9A 3P38A 5AR0A 4BE7B 1JCGA 2EWSA 4IO8A 3R8EA 3UE5A 3WEEB 4CBWA 3T7ZA 4CZFA 1KXPA 4QS7A 5AQIA 1H1VA 3R1XA 5AQSA 4B1UB 5LY3A 1Q7YO 2QA4N 1IJJA 1JCEA 5AQNA 3EO3A 4KH4A 4XH4A 2I7PA 1KQSM 2RE2A 4JKFA 5M1OA 4A2BA 2JWKA 3SLCA 4B1XB 4BGAA 2A6AA 4EHTA 1XUPO 2ZWHA 4NLBA 5H1SQ 3FZMA 4Z94A 5AQYA 5MLCQ 5C10A 3BUZB 3WXLA 4U67L 1YAGA 4CZGA 3VEXA 4FOEA 1YJ9N 1BO5O 5BPNA 2HBKA 4GVEA 4BRLA 3H3NO 2PBDA 1Y64A 1GLCG 2F7TA 2KHOA 3CJAA 4JAXA 2VGMA 5LJVA 1NGIA 3CIPA 4DHYA 4AM6A 2ASPA 1SZ2A 4QS8A 4R79A 4M63C 3J8AA 4JK7A 3TTCA 2W40A 3QICA 4H0VB 4H5VA 3L6QA 3DXMB 1HLUA 3IDHA 4FWOA 3DXKB 3AGKA 4OPAA 1NGHA 4CZIA 1V4TA 3MX5A 4CZMA 4BR0A 5BRDA 3ID6A 4BRNA 1VQ8N 3LL3A 3AY9A 4C1NK 2OTJN 3SK3A 4JEPA 3HBTA 3VESA 1KAYA 2PAVA 1KC8O 2NLXA 4KH6A 5HOOA 1BG3A 3SAGA 4IO9L 1BWFO 1K9MO 5JMVA 4BRCA 1W2BM 1YVNA 4A57A 1NGAA 3CETA 4CZEA 2YI1A 5AQJA 3CERA 1ILYA 4BY9C 2A41A 2P9NA 1K73O 2P9PA 3VF6A 3ZX2A 2NRWA 1SAZA 3UKUB 3VGLA 2CH5A 4YORA 4BRMA 5GIPA 2FLOA 5M1QA 5DM6L 3G71N 3MN6A 3O9UA 3VTIA 3JS6A 3ATVA 3FGUA 1GLFO 5ADXH 2V7YA 1YITN 5M1PA 4MLEA 4MDAA 1SS6A 3CMEN 3C6AA 3HRGA 3OBYA 2NRRA 1U2VB 4ISEA 4K41A 1U6ZA 3R6MA 4M7XA 4H0TB 3HSCA 2W41A 3H1VX 3NVMA 4MO4A 3CC4N 4JHDB 5ADXA 1VQMN 3NMUA 4YDUA 2QWPA 3ZETB 2A3ZA 3HTVA 2ASOA 3CCQN 1QQMA 2FF6A 2KLAA 4BR2A 2C1IA 4BGBA 3ID8A 4WFBL 4PHTX 3VPZA 1DEJA 4IOCL 4BC5A 3LDNA 4GV3A 2Q1NA 4IZ9A 5B8HA 3CCMN 4A62A 2D0PA 4XEIA 2E1ZA 2YHXA 3ZEUA 3A5NC 1NGEA 3E66A 4JD2A 3CHWA 2P9KB 2P9LB 2P9SB 2GEMA 5M1FA 3CC7N 2FSJA 4LC9B 4A5AA 2GTDA 5AQWA 4YOUA 1BUPA 4FWSA 1T6DA 5TKYA 5KQDA 2FSNA 1WOQA 1ATNA 4EHUA 1IG8A 2D0OA 3D2EA 4H5TA 3CJ1A 5AQXA 4BRIA 3WXMB 3OA9A 3Q7CA 4U7BA 1GLAG 1QQOA 3LM9A 2NNWA 3Q7BA 4MLHA 5FPDA 3EZWA 1VQ7N 5AQHA 4Y0WA 1E4FT 2WUSA 1DKGD 3U9DA 2QTDA 5AZJB 3GDQA 4BRPA 2P9UA 4IJAA 3R9PA 3CD6N 2VYPA 3BP8A 5F0XA 3MDQA 5FPEA 4WF9L 3SBTA 1T6CA 4BREA 5GADP 1HUXA 2IVNA 4WQ4C 4A61A 3SAHA 3FE1A 1RFQA 1C0GA 5AQFA 2HF4A 1Q82O 3A8YA 3AGRA 3H6EA 2E2PA 3CPEA 1ESVA 3OBWA 3CJCA 5C12A 3QFUA 4BR5A 3LDQA 3C7NA 3IMXA 4H0XB 3O1BA 3EE8A 2HF3A 4JKCA 3CPWM 5BPMA 3UKRA 4BC2A 5JICA 2QWQA 4GV6A 1QHAA 5KPTA 2HOEA 4IFEA 3SBGA 4XH5A 1GLJO 4BRHA 3FZFA 4NB4A 5AQKA 1NBWA 3TSQA 2QW9A 2CH6A 3IFRA 3JXUA 4FPBA 4GY2B 4FWPA 4JKAA 3RVCA 5C2DA 1YI2N 4FSVA 3O4WA 5AZIA 2WFBA 4E1JA 2HSTA 5AQPA 4YOXA 5M1NA 3CCVN 2H3GX 3BF1A 3DAWA 3O1WA 4O8UA 4FWMA 3S41A 3VEWA 4FWNA 4H5RA 2YHWA 3CQXA 1VQPN 1ATSA 2E20A 3GG4A 5JLFA 3OW2M 1JCFA 4RTFD 5AQOA 2Q31A 1ZC6A 3CQYA 3MWTA 3CC2N 2IVOA 1QVFM 4HTLA 1N8RO 4IOXA 4CZKA 2GWJA 4EIAA 2J4RA 1MA9B 4A5BA 3CCLN 3FFKB 1GLLO 3ENOA 3LDOA 5KPZA 4WFAL 4MDBA 3SAFA 4BC4A 1M1KO 2I7NA 1HJOA 2QWLA 2P9NB 4H5NA 2P9PB 3QMLA 3O9QA 3PIOL 4WQ4A 1Q86O 2HBMA 2VWBA 5ELZA 3F5TA 3QDKA 5TKWA 3VEYA 3WEEA 3CXCM 4ILHA 5AFUH 2VCPA 1K8KB 4BRQA 3C65A 3AARA 4CZJA 5I9EB 4BQZA 3EKSA 2ZJQL 4ILJA 2CGJA 1YHQN 5GAEP 3VMFB 2V52B 1GLEG 1HKGA 2ITMA 3O8MA 1LOTB 4ISGA 4BRKA 4BR7A 3L4IA 5AFUA 1VQNN 4EFHA 4FWKA 1QZ5A 3L4QA 4PL7A 3RSEB 1VQ5N 2AP1A 3LDLA 3A5LC 3A5MC 3MX2A 2ASMA 1NWKA 5EVZA 1W97L 2PFUA 4GNIA 2V7ZA 5GAHP 1QZ6A 4CZHA 4BEBA 3KZBA 3K9JA 3VGKA 3A5OC 3C6HA 4I6MA 4DQ8A 1XC3A 1X9JA 2D1KA 5EOYA 4DB3A 2FF3B 5C0YA 4BRGA 4B1YB 1X3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZEU B;  1LCU A;  4JD2 B;  4PKG A;  1RGI A;  3ULE A;  4CI6 A;  4M7Y A;  1NMD A;  4BRD A;  4BR4 A;  4FWQ A;  3VET A;  3D2F A;  3D7E O;  2D4W A;  2E1Y A;  3HI0 A;  4HWI A;  1BA0 A;  2YHY A;  3MN9 A;  1TYQ A;  1T44 A;  3FZH A;  1TUU A;  3FLC O;  3OHR A;  1MWM A;  1HPM A;  4XH1 A;  3F9M A;  1S22 A;  1WUA A;  4H0O A;  1R59 O;  4K42 A;  3WXK A;  2CGL A;  2P9U B;  4NO7 A;  2QWR A;  5AQV A;  2CGK A;  3VOV A;  5FPM A;  3H3O B;  3GOI A;  5EY4 A;  4J8F A;  1TUY A;  1OKJ A;  2FSK A;  3CJ9 A;  3IUC A;  4QS9 A;  3QBX A;  5AQZ A;  4BG9 A;  1HKC A;  3C7N B;  4JHD A;  1KAZ A;  3VER A;  2ZGY A;  1BA1 A;  4IWV A;  4BC3 A;  3UKR B;  3SMP A;  4BVO A;  4AM7 A;  3DWL A;  4F9O A;  3BEX A;  3UB5 A;  3BF3 A;  3ATU A;  2DPN A;  4FO0 A;  2BTF A;  2QXL A;  2V51 B;  4BVP A;  2GWK A;  1NGB A;  4BR9 A;  5AZI B;  3FZL A;  2IVP A;  2FXU A;  1C0F A;  4B1W B;  3KHY A;  4H03 B;  1D4X A;  2P9S A;  4FPA A;  4IJN A;  5BPL A;  4H5W A;  5BRE A;  3WXI A;  1QQN A;  3H45 C;  1V4S A;  3VGM A;  4H0P A;  2A42 A;  3TU5 A;  1NLV A;  3FZK A;  3VF4 A;  2F9T A;  4DCH A;  2P9I A;  3HM8 A;  2E2N A;  5LJW A;  4C23 A;  5E84 A;  2A5X A;  3TPQ A;  2E2O A;  5AZJ A;  5BRF A;  1Q18 A;  1CZA N;  5EXW A;  5E26 A;  3ZX3 A;  4B1V A;  4BG8 A;  2YJF A;  5CE3 A;  1XQS C;  3ENH A;  2QWN A;  2E8A A;  4L3Q A;  1HX1 A;  1YUW A;  3SJH A;  5BN9 A;  1EQY A;  1Z6R A;  5BRH A;  3WT0 A;  5JLH A;  4JN4 A;  4MO5 A;  1HKB A;  2HMP A;  4CBU A;  2E88 A;  3GE1 A;  4FWL A;  3VF2 A;  1ATR A;  3LDP A;  1NM1 A;  4YDU C;  4I6M B;  3SMS A;  4BRO A;  2QWO A;  3KVG A;  3C0B A;  3O6W A;  2F9W A;  4K43 A;  3O5B A;  3U4L A;  3U8X A;  5BN8 A;  4WQ5 C;  3LM2 A;  3WUH A;  2Q36 A;  1NGJ A;  1NGD A;  2NRH A;  2Q97 A;  5AQU A;  3AAP A;  3ULE B;  3GBT A;  3HZ6 A;  5F1X A;  3EKU A;  5KPR A;  3VEN A;  4CBX A;  3VEZ A;  2IIR A;  3D2F B;  3DXM A;  4KBO A;  4B9Q A;  2YCH A;  3DXK A;  4BRA A;  4BRF A;  1TYQ B;  3ZX0 A;  1MDU B;  5EX5 A;  4FL9 A;  1J6Z A;  1RDW X;  2Q0R A;  3I8B A;  1BDG A;  5AQR A;  1SQK A;  1BU6 O;  5BR9 A;  3CJ7 A;  1K8K A;  3QBW A;  4H0Y B;  1E4G T;  3D2E B;  3WXJ A;  3H1Q A;  3G25 A;  1Z05 A;  3EL2 A;  4PL8 A;  3QB0 A;  4ISF A;  3GL1 A;  3MK6 A;  4CD1 A;  1GLD G;  2GEL A;  3UKU A;  4B1Z A;  3RSE A;  3O08 A;  5AQG A;  3W0L A;  4EAH D;  2NZT A;  5FPN A;  3H46 O;  1BOT O;  3QFP A;  2UYT A;  1KAX A;  4K25 A;  5AQM A;  4WQ5 A;  1NGC A;  1ZBS A;  4A2A A;  2Q0U A;  4IXC A;  2AA4 A;  1P8Z A;  1NGG A;  5AQQ A;  2QM1 A;  3VEV A;  1U2V A;  5F2R A;  3MMV A;  4PKI A;  1DGK N;  4FWR A;  4CJ7 A;  5AQT A;  4RWT A;  4RCH A;  3ZET A;  3EN9 A;  5KQ8 A;  4FOI A;  3A0I X;  3CI5 A;  4CZL A;  4JNE A;  4CD3 A;  3M6G A;  3M1F A;  4PKH A;  3MN7 A;  4O5F A;  5AQL A;  3AAQ A;  2E2Q A;  3CJB A;  2Q2R A;  4WYB A;  1MWK A;  2P9I B;  2GUP A;  1X3M A;  2P9K A;  2P9L A;  2YJE A;  3WQT A;  2ZF5 O;  3O80 A;  3L0Q A;  3WQU A;  1ZXO A;  1NGF A;  2ZGZ A;  4O8K A;  3VEO A;  1G99 A;  4BQL A;  3FR0 A;  1GLB G;  2OAN A;  1S3X A;  2QWM A;  3B8A X;  2A40 A;  3U9Z A;  3P4I A;  3M3Z A;  1YXQ A;  3W3D A;  3MN5 A;  3I33 A;  3MCP A;  2BUP A;  3DJC A;  5AR0 A;  1JCG A;  2EWS A;  4IO8 A;  3R8E A;  3UE5 A;  3WEE B;  4CBW A;  4CZF A;  1KXP A;  4QS7 A;  5AQI A;  1H1V A;  5LY3 A;  5AQS A;  4B1U B;  1IJJ A;  1JCE A;  5AQN A;  3EO3 A;  4XH4 A;  2I7P A;  4A2B A;  3SLC A;  4B1X B;  4BGA A;  2A6A A;  4EHT A;  1XUP O;  2ZWH A;  3FZM A;  4Z94 A;  5AQY A;  3BUZ B;  3WXL A;  1YAG A;  4CZG A;  3VEX A;  4FOE A;  1BO5 O;  5BPN A;  4BRL A;  3H3N O;  2PBD A;  1Y64 A;  1GLC G;  2KHO A;  3CJA A;  4JAX A;  5LJV A;  1NGI A;  3CIP A;  4DHY A;  4AM6 A;  2ASP A;  1SZ2 A;  4QS8 A;  4M63 C;  3J8A A;  4BR7 A;  2W40 A;  3QIC A;  4H0V B;  4H5V A;  3L6Q A;  3DXM B;  1HLU A;  3IDH A;  4FWO A;  3DXK B;  1NGH A;  4CZI A;  1V4T A;  4CZM A;  4BR0 A;  5BRD A;  4BRN A;  3LL3 A;  3AY9 A;  3SK3 A;  3HBT A;  3VES A;  1KAY A;  2PAV A;  2NLX A;  1BG3 A;  1BWF O;  5JMV A;  4BRC A;  1YVN A;  1NGA A;  3CET A;  4CZE A;  2YI1 A;  5AQJ A;  3CER A;  2A41 A;  2P9N A;  2P9P A;  3VF6 A;  3ZX2 A;  1SAZ A;  3UKU B;  3VGL A;  2CH5 A;  4BRM A;  2FLO A;  3MN6 A;  3JS6 A;  3ATV A;  3FGU A;  1GLF O;  5ADX H;  2V7Y A;  4MLE A;  1U2V B;  4ISE A;  4K41 A;  1U6Z A;  3R6M A;  4M7X A;  4H0T B;  3HSC A;  2W41 A;  3H1V X;  4MO4 A;  4JHD B;  5ADX A;  4YDU A;  2QWP A;  3ZET B;  2A3Z A;  3HTV A;  2ASO A;  1QQM A;  2FF6 A;  4BR2 A;  4BGB A;  3ID8 A;  3VPZ A;  1DEJ A;  4BC5 A;  3LDN A;  2Q1N A;  4IZ9 A;  5B8H A;  4A62 A;  2D0P A;  4XEI A;  2E1Z A;  2YHX A;  3ZEU A;  3A5N C;  1NGE A;  4JD2 A;  3CHW A;  2P9K B;  2P9L B;  2P9S B;  2GEM A;  2FSJ A;  4LC9 B;  2GTD A;  5AQW A;  1BUP A;  4FWS A;  1T6D A;  5TKY A;  5KQD A;  2FSN A;  1WOQ A;  1ATN A;  4EHU A;  1IG8 A;  3D2E A;  2D0O A;  4H5T A;  3CJ1 A;  5AQX A;  4BRI A;  1GLA G;  1QQO A;  3LM9 A;  4MLH A;  5FPD A;  3EZW A;  5AQH A;  4Y0W A;  1E4F T;  2WUS A;  1DKG D;  3U9D A;  5AZJ B;  3GDQ A;  4BRP A;  2P9U A;  4IJA A;  3R9P A;  2VYP A;  3BP8 A;  5F0X A;  3MDQ A;  5FPE A;  1T6C A;  4BRE A;  1HUX A;  2IVN A;  4WQ4 C;  4A61 A;  3FE1 A;  1RFQ A;  1C0G A;  5AQF A;  2HF4 A;  3A8Y A;  3H6E A;  2E2P A;  1ESV A;  3CJC A;  3QFU A;  4BR5 A;  3LDQ A;  3C7N A;  3IMX A;  4H0X B;  3O1B A;  2HF3 A;  5BPM A;  3UKR A;  4BC2 A;  5JIC A;  2QWQ A;  1QHA A;  5KPT A;  2HOE A;  4BRH A;  4XH5 A;  1GLJ O;  3FZF A;  4NB4 A;  5AQK A;  1NBW A;  2QW9 A;  2CH6 A;  3IFR A;  3JXU A;  4FPB A;  4GY2 B;  4FWP A;  4FSV A;  3O4W A;  5AZI A;  4E1J A;  5AQP A;  2H3G X;  3BF1 A;  3DAW A;  3O1W A;  3S41 A;  4FWM A;  3VEW A;  4FWN A;  4H5R A;  2YHW A;  3CQX A;  1ATS A;  2E20 A;  3GG4 A;  5JLF A;  1JCF A;  4RTF D;  5AQO A;  2Q31 A;  1ZC6 A;  3CQY A;  2IVO A;  4HTL A;  4CZK A;  2GWJ A;  4EIA A;  2J4R A;  1MA9 B;  3FFK B;  1GLL O;  3ENO A;  3LDO A;  5KPZ A;  4BC4 A;  2I7N A;  1HJO A;  2QWL A;  2P9N B;  4H5N A;  2P9P B;  3QML A;  4WQ4 A;  2VWB A;  5ELZ A;  3VEY A;  3QDK A;  3WEE A;  5AFU H;  2VCP A;  1K8K B;  4BRQ A;  4CZJ A;  3AAR A;  5I9E B;  4BQZ A;  3EKS A;  2CGJ A;  2V52 B;  1GLE G;  1HKG A;  2ITM A;  3O8M A;  1LOT B;  4ISG A;  4BRK A;  3L4I A;  5AFU A;  4EFH A;  4FWK A;  1QZ5 A;  4PL7 A;  3RSE B;  2AP1 A;  3LDL A;  3A5L C;  3A5M C;  2ASM A;  1NWK A;  5EVZ A;  4GNI A;  2V7Z A;  1QZ6 A;  4CZH A;  3KZB A;  3VGK A;  3A5O C;  4I6M A;  4DQ8 A;  1XC3 A;  1X9J A;  2D1K A;  5EOY A;  4DB3 A;  2FF3 B;  4BRG A;  4B1Y B;  1X3N A; 
#chains in the Genus database with same CATH topology
 5GAG P;  4PKG A;  3AVK A;  2UXC K;  1KRP A;  3VQQ A;  2PYJ A;  2OPQ A;  1WLJ A;  4BRD A;  4CFA A;  2HBL A;  3VQE A;  4E7J A;  5HRN A;  3VET A;  2NRX A;  3D2F A;  4IOA L;  3NGZ A;  4FJH A;  4KTQ A;  4Q0B A;  3N4P A;  3FZH A;  2R7Y A;  4F2R A;  1MWM A;  1HPM A;  4XH1 A;  3K5L A;  3F9M A;  5C2F A;  1KCF A;  1WUA A;  1VRT A;  4H0O A;  4DR4 K;  4NO7 A;  2QWR A;  4DS5 A;  3K9K A;  1N33 K;  3KK2 A;  3GOI A;  5EY4 A;  2D0C A;  4J8F A;  1TUY A;  5DK5 A;  3CJ9 A;  4KRE A;  4IBN A;  4QS9 A;  1BCO A;  4CJU A;  3SZ2 A;  1ZBI A;  3RRG A;  1J53 A;  2X6S A;  1HKC A;  4DMN A;  3A2F A;  3C7N B;  1KAZ A;  2ZGY A;  3UKR B;  4B8C A;  4WFN L;  3I55 N;  4GMJ B;  4B3S K;  3BEX A;  3ATU A;  4DLG A;  4FO0 A;  4ID1 A;  3OYD A;  3OYG A;  2BH1 A;  2V51 B;  3P39 A;  4CF2 A;  5AZI B;  4XJX A;  2GX9 A;  2AJQ A;  4MFB A;  4IJN A;  2X6N A;  5BPL A;  4H5W A;  1S6Q A;  4DWI A;  1LWF A;  2C1G A;  3PUF A;  3KKR A;  3O3F A;  1NLV A;  3THX B;  2F9T A;  4E7K A;  2E2N A;  5LJW A;  5KGW A;  1WSF A;  1NKE A;  4B3O A;  5AZJ A;  5BRF A;  3T1Y K;  1Q18 A;  1CZA N;  2BAN A;  4C1N I;  3KLH A;  3J7Z O;  4BG8 A;  5CE3 A;  4CJ4 A;  4CJ5 A;  1TKT A;  3DI6 A;  4L3Q A;  1HX1 A;  1YUW A;  5BRH A;  4M3Z A;  4WCE L;  4E89 A;  3WT0 A;  3OY9 A;  1NK0 A;  3THY B;  3DM2 A;  1YTA A;  3VA3 A;  2HMP A;  2E88 A;  3ZSQ A;  2UUC K;  2P51 A;  1S6P A;  3VF2 A;  3CCS N;  5GIN A;  3LDP A;  3E1Y A;  4GV9 A;  4UY8 O;  5HBM A;  1T3V A;  3O6W A;  4YOY A;  5BN8 A;  1WSH A;  3THV A;  3AA3 A;  1YIJ N;  1YVU A;  2VG7 A;  3LZJ A;  1IBM K;  1NGJ A;  1RBV A;  5KPR A;  4KI6 A;  4HHT A;  4FW1 A;  3DXM A;  3NF7 A;  1TL1 A;  4O0I A;  3ZX0 A;  1MDU B;  5EX5 A;  3OYH A;  4DSE A;  3D45 A;  4IDH A;  5JVG L;  4M3Y A;  2DFH A;  4CK1 A;  3KKS A;  5I3U A;  1NKC A;  3D2E B;  4JK8 A;  3WXJ A;  4KV8 A;  3V1R A;  3KWG A;  1NJI O;  2EX3 A;  4YOV A;  3CCU N;  3LDS A;  1IKV A;  4BDP A;  3GL1 A;  4JI0 K;  4CD1 A;  3PO4 A;  4F8R A;  3W0L A;  4CJL A;  2Z1H A;  1RT1 A;  3H46 O;  2A1R A;  2UYT A;  3MAQ A;  3RRH A;  4IXC A;  3AVC A;  1P8Z A;  1A5X A;  1U2V A;  4OX9 K;  3MMV A;  4PKI A;  3VTH A;  4W5N A;  5A2Q O;  4X66 K;  4RCH A;  1DT9 A;  1VHX A;  4CZL A;  4CD3 A;  3M6G A;  4B9L A;  4IEI A;  4CJP A;  3M1F A;  3O9S A;  3MN7 A;  4YOW A;  4TSX A;  3CF5 L;  1U45 A;  2E2Q A;  5LL6 Z;  3CJB A;  1MWK A;  2P9I B;  3OTO K;  1X3M A;  2P9K A;  1O13 A;  1G99 A;  3FR0 A;  3SUP A;  3TAB A;  2NRZ A;  3ZSZ A;  1GLB G;  2OAN A;  1S3X A;  3KK7 A;  1FJG K;  4ELV A;  2A40 A;  3M3Z A;  4FJM A;  3DLB A;  2BUP A;  3P38 A;  1KLM A;  1JCG A;  4CZF A;  3J80 O;  3T7Z A;  2Y1I A;  4QS7 A;  5AQS A;  4B1U B;  3JSM A;  4HCB A;  4AHT A;  4CHZ A;  4JKF A;  5M1O A;  2OPR A;  4BGA A;  1K6Y A;  3C6U A;  1RT5 A;  2ZWH A;  4NLB A;  4Z94 A;  5AQY A;  4DLE A;  4U67 L;  4N76 A;  4CEC A;  4CZG A;  4FM0 A;  1BO5 O;  2O8C A;  3OYL A;  4GVE A;  2B5J A;  4FYD A;  3H3N O;  1GLC G;  3DRS A;  1NGI A;  3CIP A;  1SZ2 A;  4X62 K;  3RR7 A;  4JK7 A;  2ETJ A;  5LMN K;  3IDH A;  1HLU A;  4FWO A;  3ULD A;  2O8D A;  2Z1G A;  1NGH A;  4E72 A;  1V4T A;  3MX5 A;  4BR0 A;  3ID6 A;  1VQ8 N;  3O3G A;  4C1N K;  4JEP A;  3HBT A;  4DU3 A;  2NLX A;  4KH6 A;  3HK2 A;  1BG3 A;  1QS4 A;  4CF1 A;  3VQP A;  1W2B M;  3CET A;  2ZD1 A;  4CZE A;  4BY9 C;  2A41 A;  3LAM A;  3AA2 A;  3CG7 A;  2VG6 A;  3ZX2 A;  2E6M A;  4BRM A;  5DM6 L;  3MN6 A;  3ATV A;  1IG9 A;  3ZT0 A;  4I2P A;  3AVA A;  4YNQ A;  1SS6 A;  3C6A A;  1TK8 A;  3OBY A;  3VQ8 A;  4CVN E;  4ISE A;  1ITG A;  1U6Z A;  1L3S A;  1HMV A;  5I42 A;  4H0T B;  3HSC A;  4N41 A;  1JLA A;  3H1V X;  3CC4 N;  5D3G A;  1G15 A;  4JHD B;  4YDU A;  2QWP A;  3CCQ N;  4BGB A;  5KRS A;  3DLR A;  4PHT X;  2O4G A;  4DFJ A;  2KZZ A;  2HHX A;  2Q1N A;  1ZBL A;  4FXD A;  4F3O A;  3CCM N;  4OPK A;  3ZEU A;  1RDB A;  3MED A;  1NGE A;  4JD2 A;  2P9S B;  1FKO A;  3T19 A;  1N34 K;  4C8L A;  1BUP A;  4B8A B;  3AV9 A;  2BDP A;  1WOQ A;  2XY8 A;  5AQX A;  4U7B A;  1GLA G;  2ATQ A;  3O4Q A;  3Q7B A;  3O3H A;  1VQ7 N;  3KLI A;  1DKG D;  3U9D A;  2P9U A;  3QEW A;  2VYP A;  1TV6 A;  3BP8 A;  3DLG A;  1T6C A;  5GAD P;  1HUX A;  1KTQ A;  3AGR A;  3H6E A;  1XI1 A;  1RTD A;  2XO7 A;  3CJC A;  4BDZ A;  3LDQ A;  4JRQ A;  5KRT A;  4BC2 A;  4CJS A;  3T1A A;  1QHA A;  5KPT A;  2HOE A;  1GLJ O;  4NB4 A;  4FPB A;  3EEQ A;  4E7I A;  2O8B A;  4JKA A;  3I0S A;  1S9G A;  4HUG A;  3IRX A;  2QKB A;  4FJ8 A;  4H8K A;  4JI1 K;  2VQF K;  2YNF A;  5M1N A;  2H3G X;  4O8U A;  1VQP N;  1TKX A;  2YHW A;  3VQ4 A;  3GG4 A;  3L3U A;  4M42 A;  5AQO A;  3L3V A;  4NCB A;  4HTL A;  3CM5 A;  4IOX A;  2YNG A;  1L3U A;  2J4R A;  1MA9 B;  4A5B A;  3FFK B;  2FBV A;  5KPZ A;  4BC4 A;  4CE9 A;  1HJO A;  2HHI A;  2KQ2 A;  2QWL A;  2P9N B;  3LP3 A;  1KVB A;  2HBM A;  3VEY A;  4ILH A;  4JI5 K;  4KI4 A;  5I9E B;  4DS4 A;  4DTP A;  2CGJ A;  4ELT A;  1WBB A;  4PQU A;  1HKG A;  1X9S A;  2KTQ A;  4BRK A;  1LOT B;  5AFU A;  3HVR A;  3LDL A;  3A5M C;  4DFM A;  2ASM A;  1NWK A;  5EVZ A;  1W97 L;  4GNI A;  4FJJ A;  3DYA A;  1LWE A;  2F96 A;  1LWC A;  1HYV A;  4H4O A;  4I6M A;  1RDC A;  4DQ8 A;  4DB3 A;  4M3U A;  5C0Y A;  4BRG A;  1KVC A;  1X3N A;  3SV4 A;  3N4Q A;  1RGI A;  3ULE A;  1FXX A;  4M3R A;  3ZYY X;  1SV5 A;  1NMD A;  5SWM A;  4KB1 A;  3NH2 A;  4W5R A;  3D7E O;  5CZ1 A;  3LAL A;  3HI0 A;  4HWI A;  5KGX A;  1TYQ A;  3PLA A;  4DTM A;  1OVQ A;  1VQ6 N;  2OCE A;  1S22 A;  3OYF A;  1R59 O;  1F21 A;  3CFR A;  3VQD A;  3VOV A;  4FJI A;  5AQV A;  2PYL A;  3L2W A;  5FPM A;  3H3O B;  1W9H A;  4AIL C;  3DLK A;  4O5B A;  3IUC A;  4DR2 K;  4FJG A;  2JLE A;  4Z4H A;  4ZHR A;  5AQZ A;  4DV5 K;  3MEG A;  1RTH A;  3VER A;  1Q9Y A;  1BA1 A;  2HNZ A;  2HNY A;  5J2Q A;  3SMP A;  4CER A;  3DWL A;  4F9O A;  4FM2 A;  4EZ6 A;  1KVA A;  3UB5 A;  4LSL A;  2DPN A;  2QEX N;  3RR8 A;  4W5T A;  2W00 A;  2QXL A;  1EX4 A;  4OPH A;  2HVI A;  1NGB A;  2FXU A;  4B1W B;  4H03 B;  2D0B A;  2QKK A;  3KWI A;  1FK9 A;  4EZ9 A;  1EWR A;  4FPA A;  1OVY A;  4OO1 J;  5BRE A;  3WXI A;  1W7A A;  3H45 C;  1X9W A;  3CCR N;  4H0P A;  3G10 A;  2HVH A;  5HLF A;  3J81 O;  3HM8 A;  4C23 A;  1XNR K;  5C24 A;  2KW4 A;  2A5X A;  2E2O A;  4CHQ A;  4FM1 A;  1T05 A;  3ZX3 A;  4JK9 A;  2YJF A;  3VQB A;  4CJE A;  2QWN A;  2E8A A;  4ID5 A;  2XY6 A;  5BN9 A;  1I94 K;  5JLH A;  2WON A;  4MO5 A;  1HKB A;  3QLH A;  3PX4 A;  3GE1 A;  2YX6 A;  4FWL A;  3HOS A;  1ATR A;  1NM1 A;  4BRO A;  3VQ6 A;  4QCL A;  3C0B A;  4FLY A;  3PSI A;  3NF6 A;  1SKW A;  3DMJ A;  3GBT A;  3HZ6 A;  4OGC A;  3EKU A;  2NRT A;  5F1X A;  1DLO A;  3D2F B;  4KBO A;  4B9Q A;  3O9T A;  3KIO A;  4B9T A;  4BRF A;  1VQL N;  3SCX A;  3I8B A;  3TAN A;  1SQK A;  1B9D A;  5BR9 A;  3CCE N;  3CJ7 A;  4O0J A;  1XHX A;  3F73 A;  3SUO A;  4ELU A;  3E9L A;  3EL2 A;  4M3W A;  3T69 A;  2YNI A;  3SUQ A;  2DTU A;  3UKU A;  4AHV A;  3O08 A;  5AQG A;  1NMN A;  4EAH D;  4JI8 K;  2WOM A;  2NZT A;  4K0K K;  1ASW A;  3AA4 A;  3C94 A;  4DG1 A;  4K25 A;  1KAX A;  3M8Q A;  3OYE A;  1E3M A;  1U04 A;  4DQQ A;  5J2P A;  3P1G A;  4A2A A;  3K2P A;  5HRS A;  3AO1 A;  2AA4 A;  1S1X A;  4E3S A;  1RDA A;  4YY3 K;  2VG5 A;  4QOZ B;  3LP0 A;  1DGK N;  3ZET A;  4Y1C A;  4C8M A;  4AHR A;  3EN9 A;  5KQ8 A;  4YHH K;  2KFZ A;  1S9E A;  1SKS A;  1BL3 A;  2IOC A;  2YNH A;  1NOZ A;  1KFS A;  5CR4 A;  3KK1 A;  3QER A;  3AAQ A;  2OZS A;  4LFB K;  1SL0 A;  1NK9 A;  4EP5 A;  4ZTJ A;  1YT3 A;  3K5N A;  2ZF5 O;  3L0Q A;  3WQU A;  2ZGZ A;  1NGF A;  1GOC A;  2D5R A;  1OH5 A;  4CEB A;  3TWH A;  5GIO A;  4KFB A;  1QSS A;  1KLN A;  3B8A X;  1IV0 A;  3W3D A;  4M3X A;  3RMC A;  2QK9 A;  5AR0 A;  4DFK A;  4PY5 A;  2EWS A;  3WEE B;  1Q7Y O;  4NCG A;  3EO3 A;  4KH4 A;  4XH4 A;  1L3T A;  2Z1I A;  3SLC A;  2A6A A;  1X1P A;  2HND A;  3QO9 A;  5JS2 A;  5MLC Q;  4NXN K;  1YAG A;  3ZT4 A;  4LSN A;  1C1A A;  1QE1 A;  4BRL A;  2DY4 A;  2PBD A;  1Y64 A;  2KHO A;  4N5S A;  1BI4 A;  1D5A A;  1S1V A;  3IG1 A;  1TAU A;  5J2N A;  4R79 A;  4M63 C;  1XHZ A;  3UIQ A;  4WF9 L;  4H0V B;  4PUO A;  3DXM B;  4JV5 K;  1D9F A;  4OPA A;  4CZI A;  4CZM A;  4FVM A;  4I9Q A;  4JRP A;  3AO2 A;  2W6L A;  1JL1 A;  3ZSV A;  3HYF A;  2IC3 A;  4DR6 K;  1BWF O;  1C0U A;  3SNN A;  5JMV A;  3CQ8 A;  4BRC A;  1K9M O;  1C6V A;  4CEE A;  2YHB A;  3LPT A;  3CER A;  1K73 O;  4LFC K;  4DU4 A;  4HCC A;  2DFE A;  3V9U A;  1N32 K;  1SAZ A;  2CH5 A;  3O9U A;  4DQI A;  4J2E A;  3JS6 A;  3PX0 A;  1RCH A;  1YIT N;  5M1P A;  4CK3 A;  3I0R A;  4DV0 K;  3HT3 A;  2RN2 A;  3HRG A;  4I7F A;  3KTQ A;  1U2V B;  4M7X A;  4DTJ A;  4KHU A;  3SYZ A;  2B4J A;  2W41 A;  3NMU A;  4MO4 A;  5ADX A;  4LF6 K;  3HTV A;  1S1T A;  4DV4 K;  1VSI A;  4B3T K;  3ID8 A;  3MEE A;  2HB5 A;  4GV3 A;  2BE2 A;  4A62 A;  1IBL K;  4LF4 K;  2JGU A;  2P9K B;  3NF8 A;  2GBZ A;  4LC9 B;  4A5A A;  2Y1J A;  5KQD A;  1ZYQ A;  1ATN A;  1HYS A;  2D0O A;  3D2E A;  4N47 A;  3WXM B;  3OA9 A;  3NGY A;  3LM9 A;  4AH9 A;  3OYB A;  3VQ7 A;  4HUF A;  4MLH A;  5FPD A;  3EZW A;  1LW2 A;  1WBD A;  4DTX A;  4KAZ A;  1WAJ A;  1C1C A;  1DTQ A;  5J1E A;  2GUI A;  3GDQ A;  1VK0 A;  5FPE A;  1YTU A;  3SBT A;  1JXB A;  3OYA A;  3HP6 A;  4OJR A;  2DFF A;  4AQY K;  2HF4 A;  3A8Y A;  2ITG A;  3OBW A;  4BR5 A;  1IH7 A;  4JKC A;  3IMX A;  3O1B A;  3EE8 A;  2HF3 A;  2O8C B;  3CPW M;  1N6Q A;  5E41 A;  1QQC A;  1RBT A;  5FRO A;  5BPM A;  4B9V A;  4FJL A;  4XH5 A;  3FZF A;  3TSQ A;  3T3F A;  3U6F A;  3V1Q A;  2QW9 A;  4FLU A;  3IFR A;  4FWP A;  3RVC A;  1L3V A;  4LF8 K;  2O8D B;  3O4W A;  4OGE A;  3ZSO A;  1RBS A;  2WFB A;  4E1J A;  4YOX A;  4CEQ A;  3J7A P;  3CM6 A;  3BF1 A;  3O1W A;  3S41 A;  4FWM A;  1VSE A;  3PSF A;  3K5M A;  2E20 A;  5JLF A;  1JCF A;  4DR1 K;  2Q31 A;  3CC2 N;  3CQY A;  2IVO A;  3V9W A;  3TAE A;  3CCL N;  2GWJ A;  3ENO A;  3LDO A;  4MDB A;  4KHW A;  3MXI A;  3V6D A;  3QML A;  1TGO A;  3VN5 A;  2HW3 A;  3ISN C;  3VQ5 A;  5AFU H;  4HTU A;  2VCP A;  1K8K B;  4BRQ A;  4CZJ A;  1GOB A;  2B6A A;  3AAR A;  4BQZ A;  4RW9 A;  5IWA K;  2ZJQ L;  4B9S A;  2UU9 K;  2HHU A;  2HHW A;  4ILJ A;  3NH1 A;  3DLE A;  3S5T A;  4FLT A;  3SQ4 A;  1YHQ N;  1UA0 A;  4IG3 A;  1GLE G;  4E7H A;  4JI6 K;  3O8M A;  3DRP A;  4ISG A;  2NUB A;  4EFH A;  2Q3S A;  1JL2 A;  4CFD A;  3RSE B;  2G8U A;  1RTJ A;  4DR5 K;  4FJ9 A;  4CJ3 A;  3K9J A;  3VGK A;  1QSL A;  3C6H A;  4I9L A;  5EOY A;  1BIZ A;  4DTN A;  2VGN A;  3ZEU B;  1HR0 K;  1LCU A;  4JD2 B;  1QHT A;  4CI6 A;  3DLH A;  1WSI A;  3B6P A;  1IKW A;  4M7Y A;  1D8Y A;  1UAX A;  4BR4 A;  1NK4 A;  1BA0 A;  2YHY A;  3ZCM A;  3FLC O;  3S9H A;  4GKK K;  3S3N A;  4IFV A;  3NF9 A;  4LF7 K;  2D0A A;  4B3R K;  2P9U B;  3SQ0 A;  2CGK A;  4BE0 A;  3P31 A;  1HNX K;  3H08 A;  4OVL A;  4DFP A;  3OJS A;  3KLE A;  1OKJ A;  2FSK A;  2NRV A;  3QBX A;  3PX6 A;  3VA0 A;  3TTF A;  4JI2 K;  4BG9 A;  3KK3 A;  1ZBF A;  4JKG A;  4JHD A;  4IWV A;  4BC3 A;  1SL1 A;  4E19 A;  1M90 O;  3F2K A;  1WNS A;  4AM7 A;  2JWL A;  4O55 A;  3L2U A;  4C8N A;  4RW8 A;  3S3M A;  4RW7 A;  4CEO A;  3AA5 X;  3I56 N;  3ZT1 A;  2HHV A;  1TVR A;  3HPG A;  3OYC A;  2IVP A;  1C0F A;  1R0A A;  3KHY A;  2IGI A;  1D4X A;  2P9S A;  3E9O A;  4BWJ A;  2G8H A;  2HHH K;  2G8I A;  2G8F A;  5FRM A;  1V4S A;  4JKB A;  2QXF A;  4DKW A;  2KKZ A;  3CYM A;  2G8W A;  4JKE A;  3HPO A;  2A42 A;  3TU5 A;  3FZK A;  1T8E A;  1UWB A;  4DCH A;  2HHS A;  1CXQ A;  3TPQ A;  4E7L A;  4CJQ A;  5EXW A;  3ZSY A;  5DMR A;  5CHI A;  4FVU A;  1U49 A;  1FW6 A;  1XQS C;  2ZJR L;  4G9Z A;  4KTZ A;  4NXM K;  1CZ9 A;  2O8F A;  1RIL A;  4JN4 A;  3BZK A;  1JLF A;  4LH4 A;  5M1K A;  4DSF A;  2RHK A;  3WNG A;  4CBU A;  2F4V K;  1T03 A;  3AVJ A;  2YHA A;  3NFA A;  1NJX A;  3K5O A;  1LAW A;  3NHG A;  3O9R A;  4YDU C;  4I6M B;  2ZM6 K;  4FK4 A;  2QWO A;  3KVG A;  3TAF A;  3U4L A;  4K43 A;  3L2Q A;  3O5B A;  4C8O A;  1BCM A;  1VQ9 N;  4WQ5 C;  1REV A;  3LM2 A;  3WUH A;  2P5G A;  2Q36 A;  4NCA A;  1NGD A;  5AQU A;  3AAP A;  3ULE B;  4JKH A;  4O44 A;  4CBX A;  1P90 A;  3VEZ A;  1RT3 A;  1YF5 L;  2YCH A;  5JVH L;  3DXK A;  4DTO A;  4BRA A;  1TYQ B;  4JS5 A;  1RT4 A;  3B6O A;  3THW A;  1J6Z A;  3QNN A;  1TL3 A;  1BDG A;  3SUN A;  5AQR A;  1NJY A;  3LPU A;  4NLC A;  3QBW A;  4H0Y B;  1E4G T;  3PV8 A;  3H1Q A;  3G25 A;  4Z4G A;  5FDL A;  1C0T A;  3V9X A;  1HNI A;  4J2D A;  3QB0 A;  3MK6 A;  3HM9 A;  1GLD G;  5HL7 L;  4J2A A;  2GEL A;  4B1Z A;  4Z4C A;  3MCA B;  5FPN A;  4X64 K;  1BOT O;  5HRR A;  3QFP A;  4FZY A;  1TKD A;  2XY7 A;  1NGC A;  1QTM A;  2Q0U A;  1IKY A;  4DV3 K;  3QIP A;  1L5U A;  1B9F A;  3NVK A;  4CEZ A;  4F4K A;  5AQQ A;  4LF9 K;  3VEV A;  5F2R A;  4FWR A;  4CJ7 A;  4Z4F A;  2UUA K;  4RG8 A;  3CMA N;  1RT2 A;  1VQK N;  4FOI A;  3A0I X;  4JLH A;  4PKH A;  2P5O A;  5AQL A;  4CJV A;  4Z0U A;  1N36 K;  4WYB A;  2RKI A;  2P9L A;  2YJE A;  3J7Y P;  3O80 A;  1ZXO A;  3VEO A;  4BQL A;  3NAE A;  3DOL A;  1RT7 A;  3M5R A;  1HNW K;  1K8A O;  4AF1 A;  4Z4I A;  1EXQ A;  2QWM A;  5CY4 A;  1BHL A;  3P4I A;  1RTI A;  1VSF A;  3RMA A;  3NE6 A;  4DSJ A;  4DU1 A;  2ZQB A;  3JYT A;  3HOT A;  2EHG A;  3DJC A;  2WC9 A;  4BE7 B;  3UE5 A;  1KXP A;  1H1V A;  3R1X A;  3QEP A;  4FJN A;  4FW2 A;  2QA4 N;  1IJJ A;  1RBU A;  3U3G A;  4A2B A;  4CEF A;  2JWK A;  4B1X B;  4NYN A;  4I2Q A;  3QNO A;  3AVF A;  5H1S Q;  4DTU A;  5C10 A;  3VQ9 A;  3BUZ B;  3WXL A;  3EZ5 A;  1YJ9 N;  4DSK A;  1NOY A;  4M45 A;  1HQE A;  2F7T A;  3CJA A;  2VGM A;  4AM6 A;  2ASP A;  4QS8 A;  4DUZ K;  4FJX A;  3FFI A;  4BR7 A;  2W40 A;  1Q8I A;  3QIC A;  3L6Q A;  3AGK A;  1RDD A;  2OTJ N;  1RNH A;  4BRN A;  2W42 A;  3AY9 A;  1NJW A;  3SK3 A;  1ZBU A;  3VES A;  2PAV A;  1KC8 O;  5HOO A;  4IO9 L;  1A5V A;  2IAJ A;  1YVN A;  1NGA A;  4FLW A;  3OYK A;  2YI1 A;  5AQJ A;  4RW4 A;  2P9P A;  3RWU A;  3VF6 A;  2NRW A;  3UKU B;  4YOR A;  1BQM A;  2FLO A;  5M1Q A;  3G71 N;  1IO2 A;  1ASV A;  3QEI A;  5ADX H;  2O8E A;  2YKM A;  3C95 A;  3KLF A;  3CME N;  1J5E K;  1XWL A;  2NRR A;  4K41 A;  4EP4 A;  1ASU A;  3ZET B;  2A3Z A;  1WB9 A;  1QQM A;  5T7B A;  3QEX A;  2BGG A;  5K14 A;  2C1I A;  1T7P A;  1HYZ A;  4WFB L;  1EWQ A;  4KHN A;  3LDN A;  4DR3 K;  4IZ9 A;  1C1B A;  4CIE A;  2HHQ A;  2GEM A;  3OYM A;  1HNV A;  2GTD A;  5AQW A;  3LZI A;  4FWS A;  1SKR A;  5TKY A;  3TR8 A;  2FSN A;  5EU7 A;  1IG8 A;  4GW6 A;  4H5T A;  3Q7C A;  4CIG A;  2IS3 A;  2NNW A;  1NG9 A;  1XC9 A;  4PWD A;  4DQP A;  4Y0W A;  1E4F T;  3KD1 E;  5AZJ B;  4IJA A;  4CHP A;  3CD6 N;  4N56 A;  5F0X A;  4BRE A;  2UXB K;  2IVN A;  4WQ4 C;  2X74 A;  4A61 A;  1C0G A;  3AO3 A;  2FC0 A;  3L8B A;  1NJZ A;  4DV1 K;  4Z4E A;  2E2P A;  3TAQ A;  4O4G A;  1HQU A;  3VQA A;  3C7N A;  4H0X B;  2F8T A;  5AJ3 K;  4CFC A;  4FLV A;  1RBR A;  3UKR A;  2QWQ A;  4GV6 A;  1QSY A;  1BI4 B;  3SBG A;  3ASM A;  1TK5 A;  4FJ7 A;  3PY8 A;  4CGG A;  2CH6 A;  3EY1 A;  4CK2 A;  4FSV A;  4E1N A;  3ZT3 A;  4B1Y B;  5AZI A;  1HNZ K;  1NNE A;  1HJR A;  4FCY A;  1JLC A;  5AQP A;  3AVG A;  1WSE A;  4K8X A;  4FWN A;  4H5R A;  3CQX A;  3D0P A;  3OW2 M;  4CF0 A;  3MWT A;  5CYQ A;  4EIA A;  4LF5 K;  3SAF A;  3THX A;  4OKE A;  1M1K O;  2I7N A;  4CES A;  4B9U A;  3O9Q A;  4KHY A;  3PIO L;  3QET A;  3RMB A;  2VWB A;  5ELZ A;  3F5T A;  3QDK A;  5TKW A;  3WEE A;  3CXC M;  1NK7 A;  2OPP A;  3LP2 A;  3ZSW A;  1VSM A;  2E6L A;  4CGH A;  4DV6 K;  3WNF A;  4M41 A;  4CFB A;  4E0D A;  4BDY A;  5GAE P;  3VMF B;  4DV2 K;  2ITM A;  3U3Y A;  3CFO A;  1XMQ K;  4FWK A;  3THY A;  2X78 A;  3NCI A;  3A5L C;  3MX2 A;  4B9N A;  1UA1 A;  1OH6 A;  2E4L A;  2PFU A;  3NBP A;  3E01 A;  4CZH A;  4CHY A;  4GVM A;  3M8P A;  2D1K A;  3SQ2 A;  4CJF A;  5CZ2 A;  1NU0 A;  1NKB A;  3TSP A;  4JS4 A;  4K8Z A;  4ILG B;  4KHP K;  2QI2 A;  2HBJ A;  3BDP A;  1RDU A;  5DM7 L;  4M3T A;  2G8V A;  3HP9 A;  3ENB A;  4FWQ A;  3ALY A;  4OKK A;  2OA8 A;  1JJ2 M;  1JLQ A;  2HHT A;  1BQN A;  2D4W A;  2E1Y A;  3MN9 A;  1T44 A;  2WTU A;  1CLQ A;  4HVJ A;  1TUU A;  3OHR A;  1C0M A;  4CJR A;  4JYA K;  3QIO A;  4K42 A;  3NH0 A;  3WXK A;  2CGL A;  4WE1 A;  4A59 A;  4IEE A;  1NK6 A;  1JLB A;  2OTL N;  3D6R A;  3R3L A;  5C15 A;  2XHB A;  3RTV A;  3EE9 A;  3DOK A;  4CHO A;  4QAG A;  3BY5 A;  2WBN A;  1TAQ A;  2FBY A;  3MXJ A;  4BVO A;  2ZE2 A;  3BF3 A;  5BR8 K;  2BTF A;  4KH5 A;  4BVP A;  3OS2 A;  3G6E N;  2GWK A;  5KI6 A;  4BR9 A;  3FZL A;  4KHS A;  1BIS A;  2VQE K;  2KZM A;  1QQN A;  3VGM A;  4X65 K;  3LAK A;  3OJU A;  4RW6 A;  1BGX T;  4KB0 A;  1N5Y A;  4FK2 A;  3SQ1 A;  3VF4 A;  2P9I A;  4YOT A;  2G8K A;  3MWP A;  5E84 A;  1KD1 O;  1YJW N;  5E26 A;  1VSJ A;  3AVH A;  1JKH A;  4UQG A;  1NK8 A;  2GV9 A;  4B1V A;  2KFN A;  3AVN A;  4CF8 A;  4B08 A;  3OS1 A;  3G4S N;  4DQS A;  3ENH A;  3HJF A;  3SJH A;  1EQY A;  1Z6R A;  4DF4 A;  3WNE A;  4KRF A;  4CGI A;  4OPJ A;  3BGR A;  4IFY A;  3E9P A;  3TTD A;  3V81 A;  4YFU A;  4IG0 A;  4V19 S;  3IKM A;  3CFP A;  1VQ4 N;  3CCJ N;  4BWM A;  3VQC A;  4CJW A;  3DLL L;  5CYM A;  3SMS A;  3U8X A;  2F9W A;  3AO4 A;  2OZM A;  4DV7 K;  2NRH A;  2Q97 A;  3LAN A;  3HXM A;  3K0S A;  3MXM A;  5IT9 O;  1EP4 A;  3VEN A;  4G1Q A;  1UOC A;  4B3M K;  2IIR A;  1BIU A;  4Y1D A;  4FLZ A;  1ZBH A;  3PO5 A;  4Q5V A;  4CEA A;  2I5J A;  2PY5 A;  5KTQ A;  3ZT2 A;  1HRH A;  4CGJ A;  1EO1 A;  4FL9 A;  1RDW X;  2Q0R A;  1IBK K;  3OS0 A;  4NYF A;  1BU6 O;  1J54 A;  1K8K A;  4W5O A;  3M8S A;  4F2S A;  4BEC A;  1SUQ A;  4FJK A;  1LW0 A;  4B9M A;  1QVG M;  1Z05 A;  4PL8 A;  2W6K A;  1JLE A;  4HUE A;  4ISF A;  4LY7 A;  4JKD A;  4JKG B;  3RSE A;  1YJN N;  3OVN A;  3K57 A;  1OH8 A;  1LV5 A;  5AQM A;  4MQ3 A;  4WQ5 A;  1ZBS A;  4CCH A;  1TKZ A;  4ICL A;  3MEC A;  1VQO N;  1NGG A;  5LMU K;  2QM1 A;  4AHU A;  3TAR A;  3CYG A;  2ZJP L;  2YV0 X;  5AQT A;  1S72 N;  4RWT A;  4FZZ A;  5HRP A;  4DSL A;  1TK0 A;  1VAZ A;  1HPZ A;  2RPI A;  3TAG A;  3CI5 A;  4IDK A;  4JNE A;  3F9K A;  4CIF A;  1S5J A;  3AVI A;  3AVM A;  4LH5 A;  2O8B B;  1VSK A;  4O5F A;  3C6T A;  2RF2 A;  2Q2R A;  1WAF A;  2GUP A;  3WQT A;  1Q81 O;  4O8K A;  3V1O A;  3PIP L;  3IS9 A;  3TI0 A;  1JXE A;  3U9Z A;  1YXQ A;  3KD5 E;  1RT6 A;  3TSU A;  2O8F B;  3MN5 A;  3I33 A;  3MCP A;  4IO8 A;  3R8E A;  4CBW A;  5HP1 A;  5AQI A;  5LY3 A;  1B92 A;  1Q9X A;  4KHQ A;  1JCE A;  5AQN A;  1KQS M;  2I7P A;  2RE2 A;  1IKX A;  4EHT A;  1XUP O;  4DR7 K;  3FZM A;  4OLB A;  2YKN A;  2O4I A;  5JEN A;  2LSN A;  3VEX A;  4FOE A;  3M8R A;  3BZC A;  5BPN A;  2HBK A;  2Z1J A;  3SI6 A;  3AO5 A;  4JAX A;  4FK0 A;  1GOA A;  5J2M A;  3TAP A;  5LJV A;  4JI4 K;  4DHY A;  1MU2 A;  4CW7 B;  4CJT A;  3J8A A;  3TTC A;  3SPZ A;  4H5V A;  4JI7 K;  3S3O A;  3DXK B;  2A1S A;  1CZB A;  5BRD A;  3LL3 A;  2OYQ A;  3THW B;  1KAY A;  4DSI A;  3V4I A;  3O4N A;  1KFD A;  1VSL A;  4FJ5 A;  3SAG A;  4A57 A;  4KTW A;  1ILY A;  2P9N A;  2VWJ A;  2XRI A;  3EYZ A;  4J2B A;  5GIP A;  3KLG A;  3VGL A;  3ZSR A;  2UXD K;  3HVT A;  4AHS A;  5FLX O;  4BE1 A;  3VTI A;  3FGU A;  1S1U A;  1GLF O;  2V7Y A;  3IAY A;  2FBX A;  4MLE A;  4R5P A;  4MDA A;  4CGF A;  4DTR A;  4GKJ K;  5SZT A;  3HL8 A;  1U47 A;  3R6M A;  2E5L K;  1WSG A;  1EET A;  3NVM A;  1NK5 A;  1VQM N;  4DTS A;  4IKF A;  1KSP A;  3OYN A;  2ASO A;  2FF6 A;  2KLA A;  4BR2 A;  5C25 A;  3DRR A;  4FZX C;  4FLX A;  1U48 A;  3VPZ A;  1DEJ A;  4IOC L;  4OLA A;  3NGI A;  4BC5 A;  3AVL A;  4ZTF A;  5B8H A;  1WN7 A;  2D0P A;  4XEI A;  2E1Z A;  2YHX A;  3K59 A;  3A5N C;  4CF9 A;  3E66 A;  4XIU A;  3CHW A;  3QEV A;  2P9L B;  5M1F A;  1A5W A;  3CC7 N;  2FSJ A;  4H4M A;  4YOU A;  1EKE A;  1W0H A;  1T6D A;  4DF8 A;  1J9A A;  4EHU A;  3CJ1 A;  4BAC A;  4BRI A;  4AHC A;  1LAV A;  3T1H K;  1QQO A;  1S1W A;  2HMI A;  1CXU A;  4KPY A;  4CJK A;  5AQH A;  3ITH A;  4JI3 K;  1OH7 A;  2WUS A;  2QTD A;  4BRP A;  3R9P A;  3HPH A;  3MDQ A;  3I8D A;  3WNH A;  1D9D A;  3SAH A;  3FE1 A;  1RFQ A;  3K58 A;  3LP1 A;  1DTT A;  5AQF A;  1Q82 O;  2FBT A;  1JLG A;  3CPE A;  1ESV A;  1SL2 A;  3RMD A;  1X9M A;  5C12 A;  3QFU A;  1VSH A;  2OPS A;  2IDO A;  5JIC A;  3ZSX A;  4IFE A;  4BRH A;  2VWK A;  3QIN A;  5AQK A;  1NBW A;  3JXU A;  4GY2 B;  3G0Z A;  5C2D A;  1YI2 N;  1XNQ K;  3V9S A;  4KKO A;  1J5O A;  3L2V A;  3SJJ A;  3V9Z A;  3HO1 A;  2HST A;  1I39 A;  3CCV N;  3DAW A;  4PA1 A;  3VEW A;  1ATS A;  2XY5 A;  5JS1 A;  4RTF D;  1ZC6 A;  3AVB A;  3NDK A;  3ZLJ A;  1QVF M;  5C42 A;  1N8R O;  1FKP A;  4CGD A;  4CHN A;  4CZK A;  3OYI A;  3SV3 A;  4L8R B;  1GLL O;  4DUY K;  4WFA L;  4LFA K;  4H5N A;  2P9P B;  1XMO K;  1I3A A;  4WQ4 A;  1Q86 O;  4OKJ A;  3C65 A;  1VSD A;  3EKS A;  1Y97 A;  4CED A;  3JAM O;  4W5Q A;  2P1J A;  3SPY A;  2O8E B;  2V52 B;  3HST B;  4E1M A;  3OYJ A;  3LWM A;  3L4I A;  1VQN N;  3P83 D;  1QZ5 A;  3L4Q A;  4PL7 A;  5HRO A;  3KJV A;  1VQ5 N;  3LWL A;  4BE2 A;  2PZS A;  2AP1 A;  3L2R A;  3TAM A;  1Z25 A;  2V7Z A;  5GAH P;  1QZ6 A;  4BEB A;  3KZB A;  2F8S A;  1WSJ A;  3A5O C;  1U4B A;  4C8K A;  1XC3 A;  1X9J A;  3P5J A;  4LD0 A;  2UUB K;  2FF3 B;  4KO0 A;  5FRN A;  1Z26 A;  4F3T A;  4DQR A;  1VRU A;  1O1W A;  3QES A; 
#chains in the Genus database with same CATH homology
 2VGN A;  3TSP A;  3N4Q A;  3ZEU B;  5GAG P;  1LCU A;  4JD2 B;  4PKG A;  4ILG B;  1RGI A;  3ULE A;  2QI2 A;  4CI6 A;  2HBJ A;  1RDU A;  3ZYY X;  5DM7 L;  4M7Y A;  1NMD A;  3ENB A;  4BRD A;  2HBL A;  4BR4 A;  4FWQ A;  3VET A;  2NRX A;  3D2F A;  4IOA L;  3D7E O;  1JJ2 M;  2D4W A;  2E1Y A;  3HI0 A;  4HWI A;  1BA0 A;  2YHY A;  3MN9 A;  1TYQ A;  1T44 A;  3FZH A;  3N4P A;  1TUU A;  3FLC O;  3PLA A;  3OHR A;  1MWM A;  1HPM A;  1VQ6 N;  4XH1 A;  3F9M A;  5C2F A;  1S22 A;  1WUA A;  4H0O A;  1R59 O;  4K42 A;  3WXK A;  2CGL A;  2P9U B;  4NO7 A;  2QWR A;  5AQV A;  2CGK A;  3VOV A;  3K9K A;  5FPM A;  4A59 A;  4IEE A;  3P31 A;  3H3O B;  3GOI A;  3D6R A;  5EY4 A;  2OTL N;  3R3L A;  5C15 A;  4J8F A;  1TUY A;  1OKJ A;  2FSK A;  3CJ9 A;  2NRV A;  3IUC A;  3EE9 A;  4QS9 A;  3QBX A;  2WBN A;  3TTF A;  5AQZ A;  4BG9 A;  1HKC A;  4JKG A;  3C7N B;  4JHD A;  1KAZ A;  3VER A;  2ZGY A;  1BA1 A;  4IWV A;  4BC3 A;  1M90 O;  3UKR B;  3F2K A;  3SMP A;  4BVO A;  4WFN L;  4AM7 A;  3I55 N;  3DWL A;  2JWL A;  4F9O A;  3BEX A;  3UB5 A;  3BF3 A;  3ATU A;  2DPN A;  2QEX N;  4FO0 A;  2BTF A;  2QXL A;  4KH5 A;  3I56 N;  2W00 A;  2BH1 A;  2V51 B;  4BVP A;  3P39 A;  3G6E N;  4OPH A;  2GWK A;  1NGB A;  4BR9 A;  5AZI B;  3FZL A;  2IVP A;  2FXU A;  1C0F A;  4B1W B;  3KHY A;  3E9O A;  1D4X A;  2GX9 A;  2P9S A;  4H03 B;  4XJX A;  3KWI A;  4OO1 J;  4FPA A;  4IJN A;  1OVY A;  5BPL A;  4H5W A;  5BRE A;  3WXI A;  1QQN A;  3H45 C;  1V4S A;  4JKB A;  3VGM A;  4DKW A;  2KKZ A;  4H0P A;  3CCR N;  2C1G A;  4JKE A;  2A42 A;  3TU5 A;  1NLV A;  3FZK A;  3VF4 A;  2F9T A;  4DCH A;  2P9I A;  3HM8 A;  2E2N A;  4YOT A;  5LJW A;  4C23 A;  3MWP A;  5E84 A;  2A5X A;  3TPQ A;  1KD1 O;  2E2O A;  1YJW N;  5AZJ A;  5BRF A;  1Q18 A;  1CZA N;  5EXW A;  5E26 A;  3ZX3 A;  4C1N I;  5CHI A;  4FVU A;  4B1V A;  4JK9 A;  4BG8 A;  2YJF A;  5CE3 A;  3J7Z O;  1XQS C;  2ZJR L;  4G9Z A;  3G4S N;  3ENH A;  2QWN A;  2E8A A;  4L3Q A;  1HX1 A;  1YUW A;  3SJH A;  5BN9 A;  1EQY A;  1Z6R A;  4WCE L;  5BRH A;  3WT0 A;  5JLH A;  4JN4 A;  5M1K A;  4MO5 A;  1HKB A;  3E9P A;  3TTD A;  2RHK A;  2HMP A;  4CBU A;  2E88 A;  3GE1 A;  2YX6 A;  3IKM A;  4FWL A;  3VF2 A;  3HOS A;  3CCS N;  1VQ4 N;  3CCJ N;  5GIN A;  1ATR A;  3LDP A;  1NM1 A;  3E1Y A;  3O9R A;  4I6M B;  4YDU C;  3DLL L;  3SMS A;  4GV9 A;  4BRO A;  4UY8 O;  2QWO A;  3KVG A;  1T3V A;  3C0B A;  3O6W A;  2F9W A;  4K43 A;  3O5B A;  3U4L A;  3U8X A;  5BN8 A;  4YOY A;  1YIJ N;  1VQ9 N;  4WQ5 C;  3LM2 A;  3WUH A;  2Q36 A;  1NGJ A;  1NGD A;  2NRH A;  2Q97 A;  5AQU A;  3AAP A;  3ULE B;  3GBT A;  3HZ6 A;  5F1X A;  3EKU A;  2NRT A;  5KPR A;  3VEN A;  4JKH A;  4CBX A;  1P90 A;  3VEZ A;  2IIR A;  3D2F B;  3DXM A;  4KBO A;  1YF5 L;  3O9T A;  4B9Q A;  2YCH A;  5JVH L;  3DXK A;  4BRA A;  4BRF A;  1TYQ B;  3ZX0 A;  1MDU B;  1VQL N;  5EX5 A;  1EO1 A;  4FL9 A;  1J6Z A;  1RDW X;  2Q0R A;  3I8B A;  1BDG A;  5AQR A;  1SQK A;  4IDH A;  1BU6 O;  5BR9 A;  3CCE N;  3CJ7 A;  1K8K A;  4NLC A;  3QBW A;  5JVG L;  4H0Y B;  1E4G T;  4BEC A;  3D2E B;  4JK8 A;  3WXJ A;  3H1Q A;  3G25 A;  1QVG M;  1Z05 A;  3E9L A;  3EL2 A;  3KWG A;  4PL8 A;  3T69 A;  1NJI O;  4YOV A;  3CCU N;  3QB0 A;  4ISF A;  3GL1 A;  3MK6 A;  4CD1 A;  1GLD G;  5HL7 L;  2GEL A;  3UKU A;  4JKD A;  4B1Z A;  4JKG B;  3O08 A;  3RSE A;  5AQG A;  1YJN N;  3W0L A;  4EAH D;  2NZT A;  3MCA B;  3H46 O;  1BOT O;  5FPN A;  3QFP A;  2UYT A;  1KAX A;  4K25 A;  5AQM A;  4WQ5 A;  1NGC A;  1ZBS A;  4A2A A;  2Q0U A;  4IXC A;  2AA4 A;  1VQO N;  1P8Z A;  3NVK A;  1NGG A;  5AQQ A;  2QM1 A;  3VEV A;  1U2V A;  5F2R A;  3MMV A;  4PKI A;  1DGK N;  4FWR A;  3VTH A;  4CJ7 A;  2ZJP L;  5AQT A;  1S72 N;  4RWT A;  4RCH A;  3ZET A;  3CMA N;  1DT9 A;  1VQK N;  1VAZ A;  3EN9 A;  5KQ8 A;  4FOI A;  3A0I X;  3CI5 A;  4CZL A;  4JNE A;  4CD3 A;  3M6G A;  4IEI A;  3M1F A;  3O9S A;  4PKH A;  3MN7 A;  4YOW A;  3CF5 L;  4O5F A;  5CR4 A;  5AQL A;  3AAQ A;  2E2Q A;  3CJB A;  2Q2R A;  4WYB A;  1MWK A;  2P9I B;  2GUP A;  1X3M A;  2P9K A;  2P9L A;  2YJE A;  1O13 A;  2ZF5 O;  3WQT A;  3O80 A;  1Q81 O;  3L0Q A;  3WQU A;  1ZXO A;  1NGF A;  2ZGZ A;  4O8K A;  3VEO A;  1G99 A;  4BQL A;  3FR0 A;  3PIP L;  5GIO A;  3M5R A;  2NRZ A;  1K8A O;  4AF1 A;  1GLB G;  2OAN A;  1S3X A;  3KK7 A;  2QWM A;  3B8A X;  2A40 A;  3U9Z A;  3P4I A;  3M3Z A;  1YXQ A;  3W3D A;  3TSU A;  3MN5 A;  3HOT A;  3I33 A;  3MCP A;  2BUP A;  3DJC A;  2WC9 A;  3P38 A;  5AR0 A;  4BE7 B;  1JCG A;  2EWS A;  4IO8 A;  3R8E A;  3UE5 A;  3WEE B;  4CBW A;  3T7Z A;  4CZF A;  1KXP A;  4QS7 A;  5AQI A;  1H1V A;  3R1X A;  5AQS A;  4B1U B;  5LY3 A;  1Q7Y O;  2QA4 N;  1IJJ A;  1JCE A;  5AQN A;  3EO3 A;  4KH4 A;  4XH4 A;  2I7P A;  1KQS M;  2RE2 A;  4JKF A;  5M1O A;  4A2B A;  2JWK A;  3SLC A;  4B1X B;  4BGA A;  2A6A A;  4EHT A;  1XUP O;  2ZWH A;  4NLB A;  5H1S Q;  3FZM A;  4Z94 A;  5AQY A;  5MLC Q;  5C10 A;  3BUZ B;  3WXL A;  4U67 L;  1YAG A;  4CZG A;  3VEX A;  4FOE A;  1YJ9 N;  1BO5 O;  5BPN A;  2HBK A;  4GVE A;  4BRL A;  3H3N O;  2PBD A;  1Y64 A;  1GLC G;  2F7T A;  2KHO A;  3CJA A;  4JAX A;  2VGM A;  5LJV A;  1NGI A;  3CIP A;  4DHY A;  4AM6 A;  2ASP A;  1SZ2 A;  4QS8 A;  4R79 A;  4M63 C;  3J8A A;  4JK7 A;  3TTC A;  2W40 A;  3QIC A;  4H0V B;  4H5V A;  3L6Q A;  3DXM B;  1HLU A;  3IDH A;  4FWO A;  3DXK B;  3AGK A;  4OPA A;  1NGH A;  4CZI A;  1V4T A;  3MX5 A;  4CZM A;  4BR0 A;  5BRD A;  3ID6 A;  4BRN A;  1VQ8 N;  3LL3 A;  3AY9 A;  4C1N K;  2OTJ N;  3SK3 A;  4JEP A;  3HBT A;  3VES A;  1KAY A;  2PAV A;  1KC8 O;  2NLX A;  4KH6 A;  5HOO A;  1BG3 A;  3SAG A;  4IO9 L;  1BWF O;  1K9M O;  5JMV A;  4BRC A;  1W2B M;  1YVN A;  4A57 A;  1NGA A;  3CET A;  4CZE A;  2YI1 A;  5AQJ A;  3CER A;  1ILY A;  4BY9 C;  2A41 A;  2P9N A;  1K73 O;  2P9P A;  3VF6 A;  3ZX2 A;  2NRW A;  1SAZ A;  3UKU B;  3VGL A;  2CH5 A;  4YOR A;  4BRM A;  5GIP A;  2FLO A;  5M1Q A;  5DM6 L;  3G71 N;  3MN6 A;  3O9U A;  3VTI A;  3JS6 A;  3ATV A;  3FGU A;  1GLF O;  5ADX H;  2V7Y A;  1YIT N;  5M1P A;  4MLE A;  4MDA A;  1SS6 A;  3CME N;  3C6A A;  3HRG A;  3OBY A;  2NRR A;  1U2V B;  4ISE A;  4K41 A;  1U6Z A;  3R6M A;  4M7X A;  4H0T B;  3HSC A;  2W41 A;  3H1V X;  3NVM A;  4MO4 A;  3CC4 N;  4JHD B;  5ADX A;  1VQM N;  3NMU A;  4YDU A;  2QWP A;  3ZET B;  2A3Z A;  3HTV A;  2ASO A;  3CCQ N;  1QQM A;  2FF6 A;  2KLA A;  4BR2 A;  2C1I A;  4BGB A;  3ID8 A;  4WFB L;  4PHT X;  3VPZ A;  1DEJ A;  4IOC L;  4BC5 A;  3LDN A;  4GV3 A;  2Q1N A;  4IZ9 A;  5B8H A;  3CCM N;  4A62 A;  2D0P A;  4XEI A;  2E1Z A;  2YHX A;  3ZEU A;  3A5N C;  1NGE A;  3E66 A;  4JD2 A;  3CHW A;  2P9K B;  2P9L B;  2P9S B;  2GEM A;  5M1F A;  3CC7 N;  2FSJ A;  4LC9 B;  4A5A A;  2GTD A;  5AQW A;  4YOU A;  1BUP A;  4FWS A;  1T6D A;  5TKY A;  5KQD A;  2FSN A;  1WOQ A;  1ATN A;  4EHU A;  1IG8 A;  2D0O A;  3D2E A;  4H5T A;  3CJ1 A;  5AQX A;  4BRI A;  3WXM B;  3OA9 A;  3Q7C A;  4U7B A;  1GLA G;  1QQO A;  3LM9 A;  2NNW A;  3Q7B A;  4MLH A;  5FPD A;  3EZW A;  1VQ7 N;  5AQH A;  4Y0W A;  1E4F T;  2WUS A;  1DKG D;  3U9D A;  2QTD A;  5AZJ B;  3GDQ A;  4BRP A;  2P9U A;  4IJA A;  3R9P A;  3CD6 N;  2VYP A;  3BP8 A;  5F0X A;  3MDQ A;  5FPE A;  4WF9 L;  3SBT A;  1T6C A;  4BRE A;  5GAD P;  1HUX A;  2IVN A;  4WQ4 C;  4A61 A;  3SAH A;  3FE1 A;  1RFQ A;  1C0G A;  5AQF A;  2HF4 A;  1Q82 O;  3A8Y A;  3AGR A;  3H6E A;  2E2P A;  3CPE A;  1ESV A;  3OBW A;  3CJC A;  5C12 A;  3QFU A;  4BR5 A;  3LDQ A;  3C7N A;  3IMX A;  4H0X B;  3O1B A;  3EE8 A;  2HF3 A;  4JKC A;  3CPW M;  5BPM A;  3UKR A;  4BC2 A;  5JIC A;  2QWQ A;  4GV6 A;  1QHA A;  5KPT A;  2HOE A;  4IFE A;  3SBG A;  4XH5 A;  1GLJ O;  4BRH A;  3FZF A;  4NB4 A;  5AQK A;  1NBW A;  3TSQ A;  2QW9 A;  2CH6 A;  3IFR A;  3JXU A;  4FPB A;  4GY2 B;  4FWP A;  4JKA A;  3RVC A;  5C2D A;  1YI2 N;  4FSV A;  3O4W A;  5AZI A;  2WFB A;  4E1J A;  2HST A;  5AQP A;  4YOX A;  5M1N A;  3CCV N;  2H3G X;  3BF1 A;  3DAW A;  3O1W A;  4O8U A;  4FWM A;  3S41 A;  3VEW A;  4FWN A;  4H5R A;  2YHW A;  3CQX A;  1VQP N;  1ATS A;  2E20 A;  3GG4 A;  5JLF A;  3OW2 M;  1JCF A;  4RTF D;  5AQO A;  2Q31 A;  1ZC6 A;  3CQY A;  3MWT A;  3CC2 N;  2IVO A;  1QVF M;  4HTL A;  1N8R O;  4IOX A;  4CZK A;  2GWJ A;  4EIA A;  2J4R A;  1MA9 B;  4A5B A;  3CCL N;  3FFK B;  1GLL O;  3ENO A;  3LDO A;  5KPZ A;  4WFA L;  4MDB A;  3SAF A;  4BC4 A;  1M1K O;  2I7N A;  1HJO A;  2QWL A;  2P9N B;  4H5N A;  2P9P B;  3QML A;  3O9Q A;  3PIO L;  4WQ4 A;  1Q86 O;  2HBM A;  2VWB A;  5ELZ A;  3F5T A;  3QDK A;  5TKW A;  3VEY A;  3WEE A;  3CXC M;  4ILH A;  5AFU H;  2VCP A;  1K8K B;  4BRQ A;  3C65 A;  3AAR A;  4CZJ A;  5I9E B;  4BQZ A;  3EKS A;  2ZJQ L;  4ILJ A;  2CGJ A;  1YHQ N;  5GAE P;  3VMF B;  2V52 B;  1GLE G;  1HKG A;  2ITM A;  3O8M A;  1LOT B;  4ISG A;  4BRK A;  4BR7 A;  3L4I A;  5AFU A;  1VQN N;  4EFH A;  4FWK A;  1QZ5 A;  3L4Q A;  4PL7 A;  3RSE B;  1VQ5 N;  2AP1 A;  3LDL A;  3A5L C;  3A5M C;  3MX2 A;  2ASM A;  1NWK A;  5EVZ A;  1W97 L;  2PFU A;  4GNI A;  2V7Z A;  5GAH P;  1QZ6 A;  4CZH A;  4BEB A;  3KZB A;  3K9J A;  3VGK A;  3A5O C;  3C6H A;  4I6M A;  4DQ8 A;  1XC3 A;  1X9J A;  2D1K A;  5EOY A;  4DB3 A;  2FF3 B;  5C0Y A;  4BRG A;  4B1Y B;  1X3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...