3DXKB

Structure of bos taurus arp2/3 complex with bound inhibitor ck0944636
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
211
Chain Sequence
QAVLTLYAQGLLGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Characterization of two classes of small molecule inhibitors of Arp2/3 complex
pubmed doi rcsb
molecule tags Structural protein
total genus 56
structure length 211
sequence length 212
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3dxkB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3dxkB02
2IIRA 2W40A 3WUHA 1ATNA 3SK3A 3DXMA 4H0PA 3CJAA 1QQMA 5AZIA 5JICA 1T6DA 5AQRA 5FPNA 2P9SB 3SMPA 4CD3A 3WQUA 2QWOA 4IWVA 4CZHA 4IJNA 3CJBA 1X3MA 3FLCO 1QQNA 2YCHA 4M63C 1KAZA 4JN4A 3ZEUB 3D7EO 3RSEB 1NWKA 1U2VA 2QWRA 3I8BA 4RWTA 4K25A 3SJHA 3WXJA 1IG8A 3CJCA 4BRKA 2E1YA 3WXLA 3AAQA 5BR9A 2QWMA 2D1KA 3VESA 1TYQA 3ULEA 3U9DA 5ADXH 5FPDA 3IFRA 2PBDA 3KZBA 1GLLO 4JAXA 1ZBSA 2FSKA 3WEEB 4BRHA 4FWSA 4BG8A 2F9TA 4I6MA 5EY4A 4J8FA 4BC4A 2IVNA 4BRFA 4YDUA 2P9LA 3SLCA 2CGKA 4NB4A 3ZX0A 1YUWA 4CBWA 3A0IX 1QHAA 4H5WA 1JCFA 1NGIA 1IJJA 3LM2A 1ESVA 4BR0A 3UB5A 3CQXA 2A40A 4HTLA 3CHWA 3MN7A 2BTFA 4DCHA 3FGUA 1NGHA 4H5TA 1XUPO 3DXMB 4B1VA 3VEXA 1R59O 5AQMA 3VF4A 2PAVA 2QWPA 3LDPA 4RTFD 4DHYA 2CGJA 5LJWA 3FE1A 3CERA 4CZJA 2DPNA 3D2EA 2P9PA 4JHDB 3IDHA 4QS8A 1KXPA 4BVOA 4CZEA 4CZMA 1RFQA 3M1FA 1U2VB 3ZX3A 1JCGA 5AQPA 3CETA 1HKBA 4H0OA 2FSJA 2Q36A 4A2AA 3GOIA 4PKGA 3C7NA 3R9PA 3ZX2A 3ENOA 2IVOA 1TYQB 1QZ5A 2E2QA 1KAYA 4MLHA 5AQTA 3ULEB 4B1ZA 2VWBA 5B8HA 4WYBA 3L0QA 2ZGZA 5BN9A 4I6MB 3P4IA 5ELZA 3FR0A 4JNEA 3U8XA 1NBWA 1BWFO 1MWKA 2QM1A 5FPEA 5AQKA 4B1UB 4BRIA 3UKRB 5AQGA 2NLXA 2V52B 2NZTA 2YI1A 2FXUA 1BA1A 5AFUA 3QFUA 3BEXA 2BUPA 1J6ZA 3KVGA 4FO0A 5AQWA 3J8AA 3M6GA 1BDGA 1Z05A 3FZLA 1Y64A 2WUSA 5AFUH 3VETA 3A5NC 4FWQA 5AR0A 1BA0A 4Z94A 3BF1A 3EN9A 3EL2A 5AQQA 3O6WA 2ZWHA 2E88A 3VF2A 2ASMA 4PL8A 1T6CA 3O8MA 2FSNA 4ISFA 3OHRA 4EAHD 4ISGA 4FWLA 4L3QA 4BR7A 3VEWA 4H03B 3DJCA 2P9KA 5AQHA 3C7NB 1BO5O 2E2PA 2VYPA 3MN9A 3VF6A 3CI5A 3WQTA 4CI6A 3HSCA 4FWRA 4A62A 3G25A 1QZ6A 4JHDA 4QS9A 1DKGD 1P8ZA 1MWMA 3O1BA 3GG4A 3U9ZA 4C23A 4IZ9A 4K41A 1GLJO 4FWNA 5E84A 2V7YA 5CE3A 4F9OA 5KPZA 3U4LA 1GLDG 4ISEA 4AM6A 5AQXA 1K8KB 1H1VA 3H3NO 3LDLA 4BRLA 4BGBA 3H3OB 4CZFA 2Q0UA 4H5RA 4BQLA 2I7NA 1NMDA 1JCEA 4DQ8A 4B1XB 4YDUC 4B1WB 4B9QA 2IVPA 3GL1A 4XH1A 3FZFA 3VEOA 3LDNA 3R6MA 3L6QA 4HWIA 1BG3A 3FZMA 3JXUA 1TUUA 2I7PA 3O5BA 4CD1A 5AQFA 1SAZA 3ATVA 4E1JA 1G99A 4FWPA 5KQDA 2D4WA 1NGAA 5AQZA 1BU6O 2A5XA 3UKRA 1RGIA 3VGKA 3MN6A 3QFPA 1BOTO 1HX1A 5EX5A 5BRDA 2P9KB 2E2OA 2HF4A 5AQNA 1V4SA 3ENHA 4Y0WA 1HKCA 4H0TB 3QICA 5F0XA 3VGLA 1D4XA 3HI0A 4B1YB 2Q97A 3HTVA 3EZWA 4BRAA 3LL3A 4CZKA 2P9NA 1GLEG 1NGDA 3AY9A 2Q0RA 3CQYA 4BC3A 3WXIA 1C0GA 2ZF5O 2A6AA 4BRMA 5LJVA 5BRFA 4K42A 5KPTA 1MA9B 1U6ZA 3EKSA 1YAGA 4BR5A 1BUPA 4BQZA 4BRPA 3QMLA 2J4RA 4BC2A 2HOEA 1SZ2A 2AP1A 2UYTA 2YHYA 3WXKA 2E20A 4FSVA 3VGMA 2EWSA 5EXWA 2H3GX 2QXLA 1NGBA 2CGLA 5JLFA 3A8YA 1T44A 1GLBG 1K8KA 2CH6A 1HKGA 4LC9B 1WOQA 3MCPA 5LY3A 3FZHA 1Q18A 2HF3A 3MDQA 4O8KA 4CZIA 5BPNA 4GY2B 3O4WA 1NM1A 1QQOA 2QWLA 3ZETA 4XEIA 2QWQA 1GLFO 4WQ4A 2P9NB 3MN5A 3A5OC 3KHYA 4BG9A 5F2RA 3VEYA 1ATRA 4WQ5A 3VERA 2YHXA 3QBWA 3CJ7A 3AARA 4GNIA 5AZJA 2Q2RA 1HJOA 1V4TA 2Q1NA 3TPQA 1XC3A 2D0PA 5EVZA 1NGGA 4KBOA 4JD2A 3VENA 1YVNA 4FOIA 2E2NA 4IJAA 3UE5A 4H0XB 2QWNA 3LDQA 4FWOA 5BPMA 3W0LA 1HLUA 4AM7A 3MMVA 4NO7A 2YJFA 3HM8A 2A41A 1CZAN 4PL7A 4MO4A 4BRGA 4PKHA 2P9UA 3QDKA 2P9IB 5AQLA 4CZLA 4BRQA 3LM9A 3HZ6A 3D2FB 2E8AA 3ID8A 2F9WA 2KHOA 3LDOA 2GTDA 4BRDA 4M7XA 3AAPA 1EQYA 1LCUA 2VCPA 4RCHA 4MLEA 2FF6A 1NGCA 3W3DA 3H1QA 1OKJA 3ZETB 4CJ7A 2FF3B 1X9JA 3BUZB 3EO3A 5I9EB 4FPBA 4H0VB 5ADXA 3IMXA 4FOEA 5AQOA 1XQSC 3DXKA 2FLOA 3I33A 3DAWA 4H5VA 4MO5A 3SMSA 3DWLA 3BF3A 3TU5A 1C0FA 5AZJB 3O1WA 5AQYA 1ZXOA 4O5FA 3IUCA 4PKIA 2GEMA 3H6EA 3HBTA 2QW9A 2ASOA 1DGKN 2YJEA 4JD2B 5E26A 4EHTA 3C0BA 4M7YA 1RDWX 3VEZA 3VPZA 3EKUA 1YXQA 2NRHA 5EOYA 4FWMA 5AQUA 1NGEA 4IXCA 2A42A 5JLHA 4EIAA 1HUXA 2ITMA 5KPRA 4BVPA 2P9UB 3L4IA 2AA4A 5BN8A 1ATSA 5KQ8A 4A61A 4CBUA 5AZIB 1NGJA 3CJ9A 3F9MA 3H46O 3FFKB 4QS7A 4BRNA 3O80A 2V51B 1TUYA 4A2BA 1E4GT 4FL9A 4CBXA 4H0YB 2GELA 2D0OA 2ASPA 2YHWA 5AQJA 3UKUA 1WUAA 3A5LC 1KAXA 5BREA 3JS6A 1HPMA 4CZGA 4BR4A 3H45C 4EFHA 3GBTA 3A5MC 3DXKB 4EHUA 2P9IA 3MK6A 5FPMA 2Q31A 5AQIA 2GWKA 1NGFA 3QB0A 1SQKA 3D2FA 2P9SA 4XH4A 5AQVA 4BR9A 4DB3A 1GLAG 4BRCA 2OANA 4IO8A 4BGAA 4BROA 3ATUA 3GE1A 1S3XA 1MDUB 5JMVA 3ZEUA 3CIPA 2P9LB 3RSEA 2GUPA 2HMPA 4WQ4C 3BP8A 3S41A 4BREA 3VOVA 5F1XA 4WQ5C 1GLCG 3VEVA 3FZKA 4H5NA 1ZC6A 2ZGYA 2W41A 4XH5A 4BC5A 4BR2A 3CJ1A 4FWKA 2GWJA 3GDQA 3R8EA 2CH5A 3B8AX 1S22A 3WEEA 4FPAA 2E1ZA 4K43A 1E4FT 3QBXA 1LOTB 1NLVA 3M3ZA 5BRHA 1Z6RA 5AQSA 3D2EB 2P9PB 1DEJA 3H1VX 5BPLA 3WT0A 2A3ZA 1X3NA 3UKUB 3O08A 5TKYA 2V7ZA
chains in the Genus database with same CATH superfamily
2IIRA 1C6VA 5J2PA 5JVHL 4R79A 2NRXA 4PY5A 5JICA 3O9QA 5AQRA 4CD3A 3ZT4A 1D5AA 3SAFA 2G8UA 2F8SA 3CJBA 4E7LA 3PIOL 3FLCO 4M63C 1QQNA 1RCHA 1ITGA 2EX3A 2AJQA 3RSEB 4JI1K 1J5EK 2HB5A 3SJHA 1BCOA 1S9EA 2GX9A 3PO5A 3OYKA 1N5YA 5ADXH 3U9DA 1ZYQA 5FROA 1ASWA 1UOCA 2YNFA 4JAXA 4YOUA 1UA0A 4I9LA 4J8FA 1U04A 4CFAA 2XO7A 2IAJA 3SLCA 3ZX0A 5HRNA 2KQ2A 4CBWA 3A0IX 3MCAB 4JKHA 1W2BM 1Q7YO 4Z4HA 4CJSA 4X64K 4CK3A 3K59A 1NGIA 4DFJA 1WSJA 3UB5A 4AF1A 2Z1JA 4HTLA 3CHWA 3QIOA 4DCHA 3FGUA 4CE9A 1IBKK 4B1VA 3DXMB 4CGJA 3MXMA 1N34K 2QWPA 4KB1A 4DHYA 2XY7A 4CJLA 3FE1A 4JHDB 3LP0A 2HBKA 4CZMA 4CZEA 3P1GA 1JXEA 1JCGA 1QSSA 1XI1A 4CGFA 3HT3A 4MDAA 4CHQA 4Z4FA 2Q36A 4K0KK 3GOIA 3KTQA 4PKGA 3T69A 3C7NA 3ZX2A 1TYQB 1QZ5A 2NRWA 3R1XA 5AQTA 2ZGZA 4X65K 1KQSM 2HHUA 3RR7A 3K58A 4ZTJA 1HQEA 1TL3A 3HPGA 1FW6A 2OTLN 1Z25A 2UUCK 4V19S 4O0IA 1NBWA 1MWKA 3EE9A 4M3ZA 5AQKA 4HTUA 3UKRB 2YI1A 4IOXA 3OS0A 5AFUA 1XNRK 2ETJA 1BIZA 3SQ0A 3KVGA 3J7ZO 5AQWA 3CC2N 3M6GA 3FZLA 4IFYA 3KLGA 4HUGA 5CYQA 3LZJA 4DF4A 4NCAA 4I7FA 3BGRA 1KLMA 1BA0A 2DFEA 1S6QA 2G8HA 3T7ZA 3BF1A 5SZTA 2BH1A 4IEEA 3CCJN 2E88A 1T6CA 1QTMA 1ZBFA 3OA9A 3AA4A 3KD1E 4FWLA 1I39A 4BEBA 3DJCA 2VQEK 4CHNA 3CCVN 1KVCA 3MN9A 4FWRA 1YJWN 1QZ6A 1NK6A 1P8ZA 1EX4A 4RW9A 4C23A 3DRRA 4YOXA 3TI0A 4CJPA 1LWFA 4BWJA 1UAXA 4JI6K 4ISEA 2O8DA 1RDBA 3AO4A 4AM6A 4N76A 2O8CB 1TK8A 1H1VA 2KZMA 1IBMK 2Q3SA 4FJKA 2YNIA 3WNFA 2Q0UA 1OH5A 4BQLA 3VQ9A 4B1XB 3HO1A 3PY8A 3VEOA 3R6MA 4FM2A 4B3OA 4A57A 5HP1A 3JXUA 2QXFA 4JYAK 2JWKA 2X6SA 1SAZA 2W6LA 1CXUA 4WCEL 1KFSA 3KKSA 4CJFA 3OYIA 2A5XA 1RGIA 1OH6A 5EX5A 3JYTA 2P9KB 1YITN 3VTHA 4ILGB 1WBDA 1V4SA 2NNWA 2HNDA 3ENHA 5T7BA 3TANA 4H0TB 1KCFA 1U47A 3CCSN 1JLFA 2Q97A 3HTVA 4B9UA 3LL3A 1GLEG 1NGDA 3AY9A 1K6YA 3KIOA 4JI3K 2Q0RA 4N47A 4BC3A 2OZSA 3G71N 4JK8A 4M42A 1RT7A 4K42A 1U6ZA 3EKSA 5DMRA 4B3SK 3CCEN 3S3MA 1BUPA 2YNHA 4CEQA 2RKIA 3CCLN 2GBZA 5J2NA 3I0SA 3QMLA 3ID6A 4BC2A 1IH7A 3AVCA 1S72N 1SZ2A 4MFBA 2YHYA 4F2RA 1W97L 4FSVA 3VGMA 1TGOA 3PO4A 2H3GX 4IBNA 2QXLA 2ZM6K 3HM9A 3MXJA 2CGLA 3MXIA 3NGZA 1T3VA 1T44A 4DUYK 1DT9A 4BY9C 3QEXA 5CYMA 3VA3A 1VQLN 4AHTA 4E7KA 4FK2A 4IOAL 1WSHA 4H8KA 1S1XA 3LWMA 1RDCA 3AA5X 4CFBA 5LY3A 1NK8A 3DRPA 2RE2A 3MDQA 4CZIA 4H4OA 3J80O 3CPEA 3VA0A 4M45A 2QWLA 4E1NA 4XEIA 1XWLA 3NE6A 3EZ5A 4M3WA 4BG9A 4GMJB 5F2RA 1C0MA 1RILA 1ATRA 4WQ5A 3ZSYA 3UIQA 2Q2RA 3P5JA 4BDZA 3F73A 1XC3A 4OPHA 5EVZA 3L3VA 4KBOA 3RVCA 2HW3A 2E2NA 4CHYA 4FWOA 2YHBA 1S6PA 4KRFA 2G8WA 3W0LA 3HPHA 2YJFA 3HM8A 5M1QA 1G15A 4PL7A 1CZAN 1MU2A 1KVAA 1IV0A 3QINA 2HHXA 4JS4A 3VQPA 2KLAA 1SUQA 3LDOA 5SWMA 1SS6A 1BI4A 2VCPA 2HBMA 4RCHA 4MLEA 3W3DA 3H1QA 2FF3B 4DV4K 1L3UA 4CJTA 1ILYA 4FPBA 4H0VB 3M8PA 1NK9A 5AQOA 1XQSC 3DXKA 2UXBK 2FLOA 4FLTA 3DAWA 4LD0A 4H5VA 3SMSA 1RTHA 4FW1A 3TU5A 1TKXA 5AZJB 3AGRA 4FZXC 3PX0A 4DR5K 4OGEA 2GEMA 2YJEA 3VEZA 3VPZA 2YKMA 3EKUA 4JKGB 1QS4A 3ZCMA 2NRHA 3V4IA 5EOYA 4LH5A 5HRSA 2ZJQL 3O4NA 3DLGA 4KH4A 4FJ5A 4EIAA 2WFBA 1HUXA 1SL1A 3NGYA 3CCRN 4JI7K 3V1OA 4BVPA 3VQ6A 2P9UB 2C1GA 5KQ8A 4A61A 4KTQA 5AZIB 2ZJRL 5DK5A 3C94A 1FK9A 3H46O 2Z1GA 1YF5L 3QO9A 2V51B 2G8FA 4FL9A 3EY1A 1WLJA 2C1IA 5CR4A 3UKUA 4FZYA 1RTIA 1VSHA 3A5LC 4DR2K 1KAXA 3JS6A 2FBTA 2D0CA 4CZGA 3VQ7A 4BR4A 3L2VA 3AGKA 3H45C 3A5MC 1RT4A 5FPMA 2KFNA 1SQKA 3D2FA 1VQMN 4CK1A 4Z4IA 4BR9A 3Q7BA 4DB3A 3NMUA 4BRCA 4IO8A 1RBSA 3KWGA 3P38A 4BROA 4BE1A 4QCLA 5FDLA 4DS5A 1WAJA 3RSEA 4CGGA 2HMPA 4WQ4C 5GIPA 3OTOK 4DTJA 4E7IA 3SQ4A 5LL6Z 4JKCA 3ZSRA 2O8FB 3FZKA 3SPYA 1SKWA 2O4GA 2R7YA 4HVJA 4O5BA 4FWKA 2IDOA 4W5NA 4JV5K 3GDQA 4YOVA 1XC9A 3OBYA 3DLRA 3M8SA 3QBXA 1B92A 3F9KA 3M3ZA 4CF8A 1SKRA 5BRHA 3D2EB 2P9PB 2O4IA 1DEJA 3H1VX 3CYMA 2E6LA 2A3ZA 1X3NA 3NBPA 3C95A 3O08A 3IAYA 1Q82O 4NLBA 1N36K 2W40A 1ATNA 4KHWA 3TSUA 3SK3A 3RRHA 3DXMA 4H0PA 4DF8A 4B9MA 1T6DA 3SMPA 3CCMN 2P9SB 3OVNA 1BCMA 3WQUA 3EE8A 4IWVA 4TSXA 4CZHA 2ZQBA 2W6KA 4IO9L 3FFIA 3ZEUB 3TR8A 2QWRA 2XY8A 4RWTA 4OX9K 4K25A 3WXJA 4RW7A 4BRKA 4KREA 2E1YA 3AVFA 4CECA 3AAQA 4Y1DA 3TAPA 3VESA 2D1KA 1HNWK 1DLOA 1TYQA 5FPDA 4BECA 3IFRA 2PBDA 3KZBA 4ELTA 4BACA 2UUAK 4QAGA 4IFVA 5I42A 1T05A 2CGKA 4NB4A 3AO5A 1YUWA 4O4GA 1VSKA 3KLFA 2QI2A 1JCFA 2P1JA 1S1WA 1JLCA 4FJ8A 3LM2A 1ESVA 3NH1A 3CQXA 3LP3A 2FBVA 1R59O 3PSFA 3AO3A 4DV6K 3LDPA 4YHHK 4B3MK 2CGJA 1HMVA 5LJWA 2EHGA 3H08A 3CERA 2DPNA 3HYFA 3IDHA 1KXPA 3T19A 4DQQA 5C2DA 4B9NA 1RFQA 3CMAN 1U2VB 4LH4A 2P51A 3WNGA 3CETA 1HKBA 3ZSQA 4KHNA 2FSJA 1VSJA 3CF5L 4C8OA 1Q8IA 3R9PA 4FJNA 3NF8A 3SNNA 5D3GA 1KTQA 2VWBA 4JI8K 5K14A 4WYBA 5HRRA 4J2BA 3TAQA 4CEZA 4I2PA 1NNEA 3P4IA 3ZSXA 3AVBA 4B9LA 2QK9A 4DV7K 1ZBHA 3FR0A 2VQFK 4LY7A 5C15A 5FPEA 1IKVA 3SV4A 2OPRA 1LAVA 4OO1J 2I5JA 3G0ZA 3PX4A 1LWEA 3O9UA 3DLBA 4B3RK 3QFUA 4FO0A 1ASUA 2WUSA 5AFUH 3VETA 3A5NC 3K5MA 5AR0A 4JRPA 3QLHA 4E7HA 1NOYA 2ZWHA 3VF2A 1HYVA 1ZBLA 4BR7A 4DSFA 4H03B 3SAGA 5C25A 2O8EB 2P9KA 5AQHA 3EYZA 4DV3K 4FCYA 2KW4A 4CJ3A 3C6TA 3CXCM 2NRZA 3IG1A 4IG3A 3O1BA 4ILJA 3U9ZA 4K41A 1GLJO 4FWNA 4ICLA 4JEPA 1WNSA 4AH9A 3HVRA 4GV9A 1GLDG 4JKDA 3E1YA 4FM1A 3M8QA 4FJJA 3LDLA 5C24A 1Q81O 4CW7B 2ZD1A 4H5RA 1I3AA 4DQ8A 4YDUC 4AQYK 3SBGA 4XH1A 1HNXK 3FZFA 3B6OA 4B9TA 3LPTA 3LDNA 4OKEA 3PV8A 3DLEA 1BG3A 3ULDA 1RBTA 1NK0A 2HHWA 2DFFA 4F8RA 5AQFA 4E89A 4B08A 4E1JA 2PYLA 4LFBK 5HOOA 1BOTO 5BRDA 4M3YA 2KZZA 3DRSA 2HF4A 3E9LA 5AQNA 4Y0WA 3O3GA 2KTQA 3QICA 3S9HA 2IOCA 3OBWA 1D4XA 1VQKN 4B8AB 4CHPA 4B1YB 5GAHP 4Q5VA 2DFHA 3G10A 2G8IA 2D0BA 4GKKK 1LW2A 3KWIA 2Y1JA 1C0TA 3NDKA 3O9RA 5KPTA 4KFBA 4DG1A 3R3LA 4FJGA 4E7JA 4C1NK 2PYJA 2WTUA 1IKYA 4BRPA 5KGWA 4DR6K 3QNNA 3WXKA 2E20A 3VQ5A 1NGBA 1Q9XA 2WC9A 3U3YA 3HRGA 3THXB 4ZHRA 3OJSA 4JKBA 3BZCA 3B6PA 5JVGL 1K8KA 3LPUA 4BE7B 3HVTA 1HKGA 4PA1A 4FLXA 1RBUA 4CJKA 2NRRA 3MCPA 4PQUA 3U6FA 1A5XA 4GW6A 1QQOA 2QWQA 1NOZA 3OJUA 3HJFA 3TAGA 4BE0A 1EP4A 4O8UA 5AZJA 1B9DA 1V4TA 2E4LA 2NRTA 1YHQN 1NG9A 1YJ9N 3L3UA 5AJ3K 1JKHA 1T7PA 4O44A 3CCUN 1YVNA 2XY6A 4DV2K 4JKGA 3L2RA 4NO7A 3CG7A 1LAWA 3O4QA 3SCXA 2P9UA 3LM9A 3D45A 3K9JA 5HBMA 4HHTA 2E8AA 1TK0A 2F9WA 3L2UA 1RT1A 4DQIA 4BRDA 1U4BA 4CVNE 2FF6A 1NGCA 4JKFA 1TKTA 1RNHA 1D9DA 2VG7A 1X9JA 3PIPL 1VSEA 3BUZB 1N32K 4OKJA 1I94K 4FK4A 5I9EB 5ADXA 4LSLA 3IMXA 2RN2A 1BQNA 5HRPA 3DWLA 1ASVA 3DI6A 2HHVA 4PHTX 5AQYA 1ZXOA 3IUCA 3HBTA 4N56A 3VQ4A 2HBLA 4KTZA 2JWLA 3SPZA 4FLYA 2QW9A 3ASMA 2ASOA 3KK2A 4CEAA 3NF6A 1J54A 4AHVA 4H4MA 4JS5A 3AVMA 2O8FA 3K9KA 4C8MA 5DM7L 3MX2A 4A5BA 4CF9A 4JK7A 2B4JA 2ITMA 3TARA 1XMOK 1NGJA 4DSKA 2KKZA 2OPPA 3VQ8A 4NXMK 1E4GT 4LF4K 2GELA 1XHZA 2YHWA 1CXQA 5CZ1A 3OW2M 4NCBA 3T1AA 1RT6A 1WUAA 3KLEA 4KHPK 2RPIA 2OZMA 4CGDA 3QEVA 1RT2A 1VHXA 1A5WA 3GBTA 3OYCA 2P9IA 2G8VA 2Q31A 3LAMA 3QB0A 1OH8A 2P9SA 5AQVA 4N5SA 1GLAG 3C6AA 4LF9K 3CCQN 2BE2A 4B9VA 4BGAA 2QKKA 1IBLK 3ZEUA 1JLAA 1C1AA 3V9UA 2DY4A 3AA2A 3VOVA 5F1XA 1IO2A 1GLCG 2RF2A 5H1SQ 3MWTA 2W41A 1J5OA 3K57A 1T03A 2GWJA 3THWB 4F4KA 4I9QA 1UWBA 1VQ9N 1SL0A 4FJMA 1NU0A 1LOTB 3V1QA 4OLBA 3LZIA 3MX5A 1Z6RA 3IS9A 4GV3A 5AQSA 3G6EN 3WT0A 2OCEA 3QETA 2XY5A 1TAUA 4MQ3A 4GV6A 3WUHA 3CJAA 1QQMA 1W7AA 3J7YP 4Q0BA 1HNIA 3E9OA 5FPNA 4CJ5A 4CJRA 1WSIA 2QWOA 4OKKA 3AV9A 4AHUA 4BDPA 4YOTA 4R5PA 2YCHA 1KAZA 4JN4A 3D7EO 1NWKA 1U2VA 3V9WA 1OVYA 4J2AA 5JS1A 4U7BA 2OPQA 1IG8A 4EP4A 3CJCA 3V6DA 3WXLA 4A59A 2YV0X 1JJ2M 1NK5A 3PX6A 1LW0A 3TAFA 3NVMA 1GLLO 4AHCA 1ZBSA 5KRSA 3WEEB 4BRHA 3KLHA 4FWSA 4BG8A 3S3NA 3E01A 5EY4A 4BC4A 4BRFA 2P9LA 4NYFA 1QHAA 4E19A 4W5QA 2A1SA 3D0PA 4JRQA 1IJJA 3KK1A 1IKXA 4BR0A 3NHGA 3MN7A 1WAFA 4RW8A 4RG8A 3CM5A 4DTXA 1XUPO 1U48A 2HNZA 3VEXA 3VF4A 1N8RO 2P5OA 2PAVA 4RTFD 1U45A 4IDKA 3ENBA 1J9AA 1VQ8N 2VWKA 2BGGA 2WBNA 4DTRA 4QS8A 1VQON 2UUBK 3M5RA 4BVOA 4C8LA 3MAQA 1EXQA 1RDAA 4H0OA 2HSTA 1HNVA 4EZ6A 4G1QA 2IVOA 3T1YK 2E2QA 3ULEB 1KAYA 3TAMA 4B1ZA 1BGXT 4DFKA 3QEIA 4LF8K 1RT3A 5B8HA 3DM2A 4I6MB 4FLVA 4PWDA 5ELZA 4NXNK 4JNEA 3U8XA 3OYAA 3J81O 1NK7A 4B1UB 1X9MA 4JI0K 4BRIA 1F21A 2GV9A 2NLXA 2BANA 1QSYA 2NZTA 1L3VA 1REVA 4DMNA 2BUPA 1J6ZA 4BWMA 1P90A 4HUEA 3J8AA 1S1UA 1Z05A 3ZT0A 1WSGA 3NAEA 1Y64A 1WN7A 4Z94A 1BL3A 3TWHA 4KAZA 3PLAA 3EL2A 3O6WA 3SJJA 1QE1A 4PL8A 5C12A 2FSNA 5C2FA 3OS2A 4DLEA 3OHRA 1VQPN 3DMJA 3L2QA 5TKWA 3VEWA 4HCCA 1JLEA 3D6RA 1YI2N 1IG9A 4DFPA 3CFOA 4YY3K 3SI6A 3VF6A 1K9MO 5CY4A 3IKMA 2NRVA 4ELUA 3G25A 4JHDA 1NJYA 4QS9A 3KK3A 4FLUA 1MWMA 4DS4A 2PZSA 4CJWA 1EO1A 3AVAA 3AVLA 4DUZK 5E84A 5CE3A 3TTFA 5KPZA 4EZ9A 2FBXA 2X74A 5AQXA 3C6HA 4B9SA 1WSFA 3RMDA 3H3NO 1YTUA 3V9SA 3H3OB 1X9SA 2D5RA 4DLGA 1JCEA 4X66K 3KLIA 4OGCA 2IVPA 2UXDK 3ZYYX 3NGIA 2VGMA 4HWIA 3TSQA 3QEPA 1TK5A 3FZMA 3SAHA 2QEXN 2F8TA 2A1RA 3MEDA 3ZSZA 1TUUA 2NUBA 3O5BA 3THXA 4CD1A 3NH0A 2W42A 3ATVA 4FWPA 5KQDA 2D4WA 1NGAA 4NCGA 5AQZA 3UKRA 4FVMA 1L5UA 3CQ8A 4DQSA 4KHUA 1N33K 2OTJN 3HPOA 1Z26A 4FJIA 1HKCA 1IKWA 5HROA 4CHZA 4W5OA 5JENA 5J1EA 5F0XA 3HI0A 4BRAA 4J2DA 3EZWA 3OY9A 1KSPA 4CZKA 4JKEA 1YTAA 1O1WA 3CQYA 1NMNA 3WXIA 3SUNA 3OYEA 2ZF5O 1J53A 5CZ2A 1R0AA 4MDBA 4M41A 4FJ7A 1JLBA 3VQQA 5BRFA 3RRGA 3LP1A 3LALA 4DTPA 4BQZA 3AVKA 5MLCQ 5FRNA 4CHOA 1VQ4N 4KB0A 3AVJA 2J4RA 1EKEA 3CC4N 2AP1A 3J7AP 4DQPA 3O9SA 1W0HA 1QQCA 1D9FA 2BDPA 3HP6A 4FJLA 4DTOA 1NJXA 5JLFA 3SV3A 3A8YA 3L2WA 4CIFA 2O8CA 1OH7A 2CH6A 1NKBA 3L8BA 4LC9B 4DSEA 1WSEA 1WOQA 4U67L 3OYGA 2KFZA 4E72A 4F2SA 2HF3A 4M3UA 4LFCK 1YJNN 1KRPA 1VSLA 1GLFO 4WQ4A 1GOAA 1SKSA 1WBBA 4QOZB 2P9NB 1RBVA 3MN5A 4DV0K 4FK0A 3KHYA 2QKBA 3VEYA 3KD5E 3QEWA 2YHXA 3AARA 1JLQA 4GNIA 3KKRA 5FLXO 1HJOA 1YIJN 3BDPA 1E3MA 3TPQA 2D0PA 5M1OA 4KHQA 3V1RA 1NGGA 1S9GA 4XIUA 3HXMA 2IS3A 5KI6A 3K2PA 1HJRA 1ZBUA 4IJAA 3O3FA 4H0XB 2QWNA 2ATQA 2YX6A 1VQ6N 1HLUA 5GINA 2VGNA 4MO4A 1SV5A 5AQLA 4CZLA 4HUFA 2OA8A 5E41A 3D2FB 4CESA 4C1NI 4BE2A 2ZE2A 2KHOA 3AAPA 1EQYA 3PUFA 4ZTFA 5EU7A 1NK4A 4FJXA 1BHLA 1KLNA 4KI6A 1RTJA 1OKJA 3ZETB 4CJ7A 1Y97A 5GAEP 1HR0K 3EO3A 5IT9O 3TSPA 3QNOA 4FOEA 4KHYA 3VTIA 3I33A 4F3TA 3CM6A 4AILC 2G8KA 3BZKA 3NFAA 4O5FA 5KGXA 3T1HK 4O0JA 3H6EA 4CF1A 2VG6A 2RHKA 1K8AO 2X78A 4JD2B 5E26A 3C0BA 3CPWM 1RDWX 1B9FA 3DOLA 3K5OA 1YXQA 4OPKA 5AQUA 1NGEA 3E9PA 4IXCA 2GUIA 4DV5K 3NCIA 5JLHA 2E5LK 4IEIA 2HHSA 3S3OA 4FVUA 5KPRA 3L4IA 5BN8A 1S5JA 3THWA 4KPYA 4CBUA 1XNQK 2X6NA 4LF5K 3M8RA 5IWAK 3CJ9A 3VQAA 4UY8O 1NJWA 1NJZA 3Q7CA 3O80A 2YKNA 4A2BA 4DR1K 1FKPA 4GVMA 3O3HA 4KKOA 2D0OA 5AQJA 4UQGA 3TTDA 5BREA 3F2KA 1HPMA 3V81A 1KVBA 3MK6A 3SQ1A 4BDYA 3LP2A 3HL8A 4B3TK 4XH4A 1C1BA 1O13A 2OANA 3WNEA 1JLGA 4DTMA 1S3XA 1MDUB 4YOYA 4OJRA 5JMVA 2GUPA 3ZSWA 3C65A 4AHRA 3MEGA 3N4PA 1NKEA 1HYZA 3S41A 1VQNN 4WQ5C 2IC3A 3VEVA 2HHHK 2ZGYA 5C0YA 4BC5A 4CEFA 1JL1A 3CJ1A 1VSIA 3T3FA 4JK9A 1KFDA 1S1TA 3R8EA 2CH5A 3B8AX 1S22A 3WEEA 1T8EA 4FPAA 4CJVA 4HCBA 3VN5A 1E4FT 3OYLA 1NLVA 5M1NA 1RDDA 2WOMA 3ZLJA 1BQMA 3P39A 4FZZA 1Q86O 2V7ZA 4DTNA 1CZ9A 4CIEA 1S1VA 2XRIA 1VSFA 5I3UA 5AZIA 4KTWA 4N41A 5LMNK 4IOCL 3SBTA 4JI4K 1LWCA 1XMQK 4IJNA 4DTSA 1X3MA 2O8BB 3I8BA 2IGIA 2VG5A 3OYMA 5M1FA 4LFAK 5BR9A 4CJUA 2QWMA 3ALYA 4DSLA 3ULEA 3VQBA 5C42A 1VQ5N 4ILHA 2FSKA 2OPSA 3I55N 3AO1A 2PY5A 1JL2A 2F9TA 4I6MA 3EEQA 3ZT3A 2IVNA 4A5AA 1OVQA 2QTDA 3F5TA 1VSMA 4YDUA 3THYB 4M3RA 4PUOA 3ZSVA 4H5WA 2F4VK 3P31A 2HBJA 3CMEN 1VSDA 3RMCA 2A40A 1NKCA 3I0RA 2BTFA 3SUOA 3OYBA 1NGHA 2JGUA 3WNHA 1FXXA 4H5TA 3VMFB 4W5RA 4Z4EA 5HL7L 3MECA 1A5VA 5AQMA 5A2QO 3P83D 3I8DA 4FW2A 2P5GA 4KO0A 4X62K 4ELVA 4DR4K 1XHXA 4CZJA 3D2EA 2P9PA 3OYDA 2QA4N 1LV5A 3M1FA 4CF2A 3QESA 3OYJA 3ZT1A 4CGHA 3ZX3A 4ID1A 5AQPA 3RTVA 4A2AA 2DTUA 4Z0UA 3ENOA 5LMUK 4MLHA 2HMIA 4IDHA 3JAMO 3A2FA 4IKFA 3TTCA 3L0QA 5BN9A 3DYAA 5GADP 4OVLA 3QERA 1UA1A 2ZJPL 3HP9A 3SYZA 2D0AA 3OS1A 4CEDA 3PSIA 4DR7K 1BWFO 1EWQA 2QM1A 5GAGP 3CFPA 5AQGA 2V52B 4WE1A 2FXUA 3HOSA 3RMBA 1VAZA 1BA1A 4YFUA 3BEXA 4YNQA 1BDGA 4NYNA 3JSMA 2UU9K 4FWQA 3EN9A 5AQQA 3G4SN 2ASMA 2F96A 3O8MA 2B5JA 5HLFA 4ISFA 4EAHD 4DU1A 1VRUA 4ISGA 4L3QA 4L8RB 3MEEA 1TKZA 3C7NB 4CEBA 4RW6A 1BO5O 2E2PA 2VYPA 5FRMA 3WQTA 3CI5A 4CI6A 3HSCA 4DTUA 4E1MA 4A62A 4DWIA 3NF7A 1DKGD 3SUPA 3GG4A 3TAEA 4IZ9A 2OYQA 1TL1A 3OYFA 4DFMA 2V7YA 4AHSA 4F9OA 3U4LA 4NLCA 4FYDA 5JS2A 1W9HA 1K8KB 4BRLA 4B8CA 4BGBA 4JI5K 4CZFA 1HYSA 1EETA 2I7NA 1NMDA 4DV1K 3SQ2A 4B1WB 4B9QA 3GL1A 5J2QA 3L6QA 1RDUA 2XHBA 3HK2A 3DLHA 2I7PA 3RR8A 3K5LA 4DSIA 1G99A 3DOKA 3DLLL 1BU6O 3L4QA 3VGKA 1VRTA 3MN6A 3QFPA 1HX1A 2LSNA 1K73O 4IG0A 3VQDA 4FLZA 2E2OA 2HVHA 1C1CA 4G9ZA 4CIGA 3VGLA 3AVGA 3K0SA 4Z4GA 3AO2A 2P9NA 4OLAA 3VQEA 1C0GA 2A6AA 4ID5A 4BRMA 5LJVA 1BISA 1HPZA 1MA9B 2O8DB 2O8EA 3V9ZA 1YAGA 4GVEA 4BR5A 4LSNA 3QIPA 4KV8A 1WB9A 1RT5A 4E3SA 4DQRA 2UXCK 2HNYA 2HOEA 2UYTA 3VQCA 1HRHA 2EWSA 1D8YA 5EXWA 3ITHA 3SUQA 1L3TA 3CYGA 1CZBA 4CGIA 2WONA 1NJIO 4KHSA 1RTDA 2F7TA 1GLBG 3AVHA 4JKAA 1QHTA 1TAQA 1CLQA 1N6QA 4C8KA 3FZHA 4CFCA 2VWJA 3TABA 1Q18A 4O8KA 5BPNA 4GY2B 3O4WA 4KI4A 1NM1A 3NF9A 4I2QA 3ZETA 1U49A 2E6MA 4EP5A 4XJXA 3A5OC 4LF6K 5KRTA 3VERA 3QBWA 3CJ7A 4Y1CA 3U3GA 1X1PA 4C8NA 1ZBIA 2Q1NA 1QVFM 2Z1HA 2W00A 4JD2A 3VENA 1QVGM 4FOIA 3CC7N 3UE5A 4CJ4A 3NVKA 2YNGA 1KC8O 4CJQA 4FM0A 3LDQA 4CEEA 4JI2K 5BPMA 4AM7A 3MMVA 3MWPA 3NH2A 2ITGA 2A41A 4BRGA 4PKHA 5C10A 3QDKA 2P9IB 3OYHA 4F3OA 4BRQA 3HZ6A 1DTTA 4K8ZA 2FC0A 2B6AA 3LDSA 3ID8A 4E0DA 4FXDA 2GTDA 4M7XA 3AVNA 1LCUA 3RMAA 3IRXA 4W5TA 1FJGK 4CK2A 3LWLA 2FBYA 5KTQA 4K8XA 4WFAL 3KK7A 4DU4A 4DKWA 1DTQA 4YOWA 2PFUA 4MO5A 3BF3A 3HSTB 1SL2A 1C0FA 4WF9L 4GKJK 3O1WA 1L3SA 5J2MA 2YHAA 4PKIA 4JLHA 2HHTA 4Z4CA 4CCHA 1DGKN 4EHTA 1HNZK 2HVIA 4M7YA 2Y1IA 1VK0A 3SZ2A 4FWMA 4FJ9A 4M3TA 5CHIA 4DSJA 2A42A 3K5NA 5M1KA 4O55A 4KH5A 1M90O 1VQ7N 2AA4A 1ATSA 1JXBA 1M1KO 3KJVA 4J2EA 1BIUA 3CFRA 3F9MA 3FFKB 4QS7A 4BRNA 1YVUA 5BR8K 4CF0A 1TUYA 4CERA 4CJEA 1RBRA 1BI4B 3ZSOA 4CBXA 3I56N 4H0YB 4DU3A 2ASPA 4LF7K 3WXMB 4YORA 4CFDA 1YT3A 4EFHA 3DXKB 4EHUA 5AQIA 2GWKA 1NGFA 1EWRA 3LANA 4WFBL 1X9WA 3ISNC 4DR3K 3ATUA 4OPJA 3GE1A 3THVA 1QSLA 4KH6A 3CIPA 2P9LB 3E66A 3ZT2A 2O8BA 3DLKA 1KD1O 3HOTA 4WFNL 1TVRA 3BP8A 3LAKA 4BREA 1GOCA 4RW4A 4IFEA 3V9XA 4H5NA 4FJHA 1ZC6A 4XH5A 4BR2A 1FKOA 5M1PA 5GIOA 3CD6N 3AVIA 2E1ZA 4K43A 4M3XA 2HHIA 1GOBA 2Z1IA 4OPAA 1TV6A 3THYA 1Q9YA 3RWUA 3N4QA 2HHQA 3OYNA 5DM6L 4FLWA 3C6UA 5BPLA 3S5TA 3BY5A 1HQUA 3AA3A 4CEOA 3UKUB 1C0UA 3O9TA 5TKYA 2JLEA 1TKDA
chains in the Genus database with same CATH topology
4GV6A 2IIRA 4NLBA 2W40A 3WUHA 1ATNA 3TSUA 3SK3A 3DXMA 4H0PA 3CJAA 4R79A 5JVHL 1QQMA 5AZIA 2NRXA 5JICA 1T6DA 3O9QA 3E9OA 2P9SB 5AQRA 5FPNA 3SMPA 4CD3A 3CCMN 4IOCL 3SBTA 3WQUA 3SAFA 3EE8A 2QWOA 4IWVA 4CZHA 4IJNA 4YOTA 3CJBA 3PIOL 1X3MA 3FLCO 1QQNA 2YCHA 4M63C 1KAZA 4IO9L 4JN4A 3ZEUB 3D7EO 3RSEB 1NWKA 1U2VA 2QWRA 1OVYA 3I8BA 4RWTA 4K25A 3SJHA 3WXJA 4U7BA 1IG8A 3CJCA 4BRKA 5M1FA 2GX9A 2E1YA 3WXLA 4A59A 3AAQA 5BR9A 1JJ2M 2QWMA 2D1KA 3VESA 1TYQA 3ULEA 3U9DA 5ADXH 5FPDA 4BECA 3IFRA 2PBDA 3NVMA 3KZBA 1VQ5N 1GLLO 4ILHA 4JAXA 1ZBSA 4YOUA 2FSKA 3WEEB 4BRHA 3I55N 4FWSA 4BG8A 2F9TA 4I6MA 5EY4A 4J8FA 4BC4A 2IVNA 4A5AA 4BRFA 2QTDA 4YDUA 2P9LA 3F5TA 2CGKA 4NB4A 3SLCA 1YUWA 3ZX0A 4CBWA 3A0IX 3MCAB 4JKHA 1QHAA 1W2BM 1Q7YO 4H5WA 2QI2A 1JCFA 1NGIA 1IJJA 3P31A 3LM2A 1ESVA 4BR0A 2HBJA 3UB5A 4AF1A 3CMEN 3CQXA 2A40A 4HTLA 3CHWA 3MN7A 2BTFA 4DCHA 3FGUA 1NGHA 4H5TA 1XUPO 3DXMB 3VMFB 4B1VA 3VEXA 1R59O 5HL7L 5AQMA 3VF4A 1N8RO 2PAVA 2QWPA 3LDPA 4RTFD 4DHYA 2CGJA 5LJWA 3FE1A 3ENBA 1VQ8N 3CERA 4CZJA 2DPNA 2WBNA 2P9PA 3D2EA 3IDHA 4JHDB 4QS8A 2QA4N 1KXPA 1VQON 3M5RA 4BVOA 2HBKA 4CZMA 1RFQA 4CZEA 5C2DA 3CMAN 3M1FA 1U2VB 3ZX3A 1JCGA 5AQPA 3CETA 4MDAA 1HKBA 4H0OA 2HSTA 2FSJA 2Q36A 4A2AA 3GOIA 3CF5L 4PKGA 3T69A 3C7NA 3R9PA 3ZX2A 3ENOA 2IVOA 1TYQB 1QZ5A 2E2QA 1KAYA 2NRWA 3R1XA 4IDHA 4MLHA 5AQTA 3ULEB 4B1ZA 2VWBA 3TTCA 5B8HA 4WYBA 3L0QA 2ZGZA 5BN9A 5GADP 1KQSM 4I6MB 3P4IA 5ELZA 2ZJPL 3FR0A 2OTLN 4JNEA 3U8XA 1NBWA 1BWFO 5C15A 1MWKA 2QM1A 5GAGP 3EE9A 5FPEA 5AQKA 4B1UB 4BRIA 4OO1J 3UKRB 5AQGA 2NLXA 2V52B 2NZTA 2YI1A 3O9UA 2FXUA 3HOSA 4IOXA 1VAZA 1BA1A 5AFUA 3QFUA 3BEXA 2BUPA 1J6ZA 3KVGA 4FO0A 3J7ZO 5AQWA 1P90A 3CC2N 3J8AA 3M6GA 1BDGA 1Z05A 3FZLA 1Y64A 2WUSA 5AFUH 3VETA 3A5NC 4FWQA 5AR0A 1BA0A 4Z94A 3T7ZA 3BF1A 3EN9A 3PLAA 3EL2A 5AQQA 3O6WA 2BH1A 4IEEA 3G4SN 2ZWHA 2E88A 3VF2A 2ASMA 4PL8A 3CCJN 1T6CA 3O8MA 5C12A 2FSNA 3OA9A 5C2FA 4ISFA 3OHRA 4EAHD 1VQPN 4ISGA 4FWLA 4L3QA 4BR7A 5TKWA 3VEWA 4H03B 4BEBA 3SAGA 3DJCA 2P9KA 5AQHA 3D6RA 1YI2N 3C7NB 1BO5O 3CCVN 2E2PA 3CXCM 2VYPA 2NRZA 3MN9A 3CI5A 3VF6A 3WQTA 4CI6A 3HSCA 1K9MO 4FWRA 3IKMA 2NRVA 1YJWN 4A62A 3G25A 1QZ6A 4JHDA 4QS9A 1DKGD 1P8ZA 1MWMA 3O1BA 3GG4A 4ILJA 3U9ZA 4C23A 4IZ9A 4K41A 1EO1A 4YOXA 1GLJO 4FWNA 5E84A 2V7YA 5CE3A 3TTFA 4JEPA 4GV9A 4F9OA 5KPZA 3U4LA 4NLCA 1GLDG 4ISEA 4JKDA 4AM6A 3E1YA 5AQXA 3C6HA 1K8KB 1H1VA 3H3NO 3LDLA 4BRLA 1Q81O 4BGBA 3H3OB 4CZFA 2Q0UA 4H5RA 4BQLA 2I7NA 1NMDA 1JCEA 4DQ8A 4B1XB 4YDUC 4B1WB 3SBGA 4B9QA 2IVPA 3ZYYX 3GL1A 4XH1A 3FZFA 3VEOA 3LDNA 3R6MA 2VGMA 3L6QA 1RDUA 4A57A 4HWIA 3TSQA 1BG3A 3FZMA 3SAHA 2QEXN 3JXUA 1TUUA 2I7PA 3O5BA 2JWKA 5AQFA 1SAZA 4CD1A 3ATVA 4WCEL 4E1JA 1G99A 4FWPA 5KQDA 2D4WA 1NGAA 3DLLL 5AQZA 1BU6O 2A5XA 3L4QA 1RGIA 3UKRA 3VGKA 5HOOA 3MN6A 3QFPA 1BOTO 1HX1A 5EX5A 1K73O 2OTJN 5BRDA 2P9KB 1YITN 3VTHA 2E2OA 4ILGB 2HF4A 3E9LA 5AQNA 1V4SA 2NNWA 3ENHA 4Y0WA 1HKCA 4H0TB 3QICA 3CCSN 4G9ZA 3OBWA 3VGLA 5F0XA 1D4XA 1VQKN 3HI0A 4B1YB 2Q97A 3HTVA 3EZWA 4BRAA 5GAHP 3LL3A 4CZKA 4JKEA 2P9NA 1GLEG 1NGDA 3AY9A 2Q0RA 3CQYA 4BC3A 3WXIA 1C0GA 3G71N 2ZF5O 2A6AA 3KWIA 4MDBA 4BRMA 4JK8A 5LJVA 5BRFA 4K42A 3O9RA 1MA9B 1U6ZA 3EKSA 5KPTA 3CCEN 1YAGA 4GVEA 3R3LA 4BR5A 1BUPA 3CCLN 4BQZA 4C1NK 5MLCQ 4BRPA 3QMLA 1VQ4N 3ID6A 2J4RA 4BC2A 3CC4N 1S72N 2HOEA 1SZ2A 2AP1A 2UYTA 2YHYA 3WXKA 2E20A 1W97L 4FSVA 3O9SA 3VGMA 2EWSA 5EXWA 2H3GX 2QXLA 1NGBA 2CGLA 2WC9A 1NJIO 5JLFA 3HRGA 1T3VA 3A8YA 1T44A 2F7TA 1GLBG 4JKBA 1DT9A 4BY9C 5JVGL 1K8KA 4JKAA 1VQLN 4BE7B 2CH6A 1HKGA 4IOAL 4LC9B 1WOQA 4U67L 2NRRA 3MCPA 5LY3A 3FZHA 1Q18A 2HF3A 2RE2A 3MDQA 4O8KA 4CZIA 5BPNA 3CPEA 3O4WA 4GY2B 1NM1A 1QQOA 2QWLA 3ZETA 1YJNN 4XEIA 2QWQA 1GLFO 4WQ4A 2P9NB 4XJXA 3MN5A 3A5OC 3KHYA 4BG9A 5F2RA 3VEYA 1ATRA 4WQ5A 3VERA 2YHXA 3QBWA 3CJ7A 3AARA 4GNIA 4O8UA 5AZJA 2Q2RA 1HJOA 1V4TA 1YIJN 2NRTA 2Q1NA 3TPQA 1XC3A 4OPHA 1YHQN 1QVFM 1YJ9N 2D0PA 5M1OA 5EVZA 1NGGA 2W00A 4KBOA 3RVCA 4JD2A 3VENA 3CCUN 1YVNA 1QVGM 4FOIA 3CC7N 2E2NA 4IJAA 3UE5A 3NVKA 4JKGA 4H0XB 1KC8O 2QWNA 3LDQA 4FWOA 2YX6A 5BPMA 3W0LA 1VQ6N 1HLUA 4AM7A 3MMVA 5GINA 4NO7A 2YJFA 3HM8A 5M1QA 2VGNA 3MWPA 2A41A 1CZAN 4PL7A 4MO4A 4BRGA 4PKHA 2P9UA 5C10A 3QDKA 2P9IB 5AQLA 4CZLA 4BRQA 3LM9A 3HZ6A 3D2FB 3K9JA 2E8AA 3ID8A 4C1NI 2F9WA 2KLAA 2KHOA 3LDOA 2GTDA 4BRDA 4M7XA 3AAPA 1EQYA 1LCUA 1SS6A 2VCPA 2HBMA 4RCHA 4MLEA 2FF6A 1NGCA 3W3DA 3H1QA 4JKFA 1OKJA 3ZETB 4CJ7A 2FF3B 3PIPL 1X9JA 3BUZB 5GAEP 3EO3A 1ILYA 5I9EB 4FPBA 4H0VB 3TSPA 4WFAL 5ADXA 3IMXA 3KK7A 4FOEA 1XQSC 3DXKA 5AQOA 3VTIA 2FLOA 3I33A 3DAWA 4DKWA 4YOWA 2PFUA 4H5VA 4MO5A 3SMSA 3DWLA 3BF3A 3TU5A 1C0FA 5AZJB 4WF9L 4PHTX 3O1WA 5AQYA 3AGRA 1ZXOA 4O5FA 3IUCA 4PKIA 2GEMA 3H6EA 3HBTA 2HBLA 2JWLA 2RHKA 1K8AO 2QW9A 2ASOA 1DGKN 2YJEA 4JD2B 5E26A 4EHTA 3C0BA 3CPWM 4M7YA 1RDWX 3VEZA 3VPZA 3EKUA 4JKGB 1YXQA 2NRHA 5EOYA 4FWMA 5AQUA 1NGEA 3E9PA 3K9KA 5CHIA 4IXCA 2ZJQL 2A42A 5M1KA 5DM7L 5JLHA 3MX2A 4KH4A 4A5BA 2WFBA 1HUXA 4IEIA 4EIAA 4JK7A 4KH5A 3CCRN 2ITMA 4FVUA 5KPRA 4BVPA 1M90O 2P9UB 1VQ7N 3L4IA 2AA4A 5BN8A 1ATSA 2C1GA 5KQ8A 4A61A 4CBUA 5AZIB 1NGJA 2ZJRL 1M1KO 2KKZA 3CJ9A 3F9MA 4UY8O 3H46O 3FFKB 4QS7A 4BRNA 1YF5L 3Q7CA 3O80A 2V51B 1TUYA 4A2BA 1E4GT 4FL9A 4CBXA 4H0YB 2GELA 3I56N 2D0OA 2ASPA 2YHWA 5AQJA 2C1IA 5CR4A 3OW2M 3UKUA 1WUAA 3A5LC 3TTDA 1KAXA 5BREA 3JS6A 3WXMB 3F2KA 1HPMA 4YORA 4CZGA 4BR4A 3AGKA 3H45C 4EFHA 3GBTA 3A5MC 3DXKB 4EHUA 2P9IA 3MK6A 5FPMA 2Q31A 5AQIA 2GWKA 1NGFA 3QB0A 1SQKA 3D2FA 1VQMN 2P9SA 4XH4A 5AQVA 3Q7BA 4BR9A 4DB3A 4WFBL 1GLAG 3C6AA 1O13A 3NMUA 4BRCA 2OANA 3CCQN 4IO8A 3KWGA 3P38A 4BGAA 4BROA 3ATUA 3GE1A 1S3XA 1MDUB 4YOYA 4KH6A 5JMVA 3ZEUA 3CIPA 2P9LB 3E66A 3RSEA 2GUPA 2HMPA 4WQ4C 5GIPA 1KD1O 3C65A 3HOTA 4WFNL 3BP8A 3N4PA 3S41A 4BREA 3VOVA 5F1XA 4JKCA 1VQNN 4WQ5C 1GLCG 3VEVA 3FZKA 4IFEA 5H1SQ 4H5NA 3MWTA 1ZC6A 2ZGYA 2W41A 5C0YA 4XH5A 4BC5A 4BR2A 3CJ1A 4FWKA 2GWJA 4JK9A 3GDQA 5M1PA 3R8EA 4YOVA 2CH5A 5GIOA 3B8AX 3CD6N 1S22A 3OBYA 3WEEA 4FPAA 1VQ9N 2E1ZA 4K43A 1E4FT 3QBXA 1LOTB 1NLVA 5M1NA 3M3ZA 3MX5A 5BRHA 1Z6RA 4OPAA 4GV3A 5AQSA 3D2EB 2P9PB 3N4QA 1DEJA 5DM6L 3G6EN 3H1VX 5BPLA 3P39A 3WT0A 2A3ZA 1X3NA 3UKUB 3O08A 3O9TA 5TKYA 1Q86O 2V7ZA 1Q82O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IIR A;  2W40 A;  3WUH A;  1ATN A;  3SK3 A;  3DXM A;  4H0P A;  3CJA A;  1QQM A;  5AZI A;  5JIC A;  1T6D A;  5AQR A;  5FPN A;  2P9S B;  3SMP A;  4CD3 A;  3WQU A;  2QWO A;  4IWV A;  4CZH A;  4IJN A;  3CJB A;  1X3M A;  3FLC O;  1QQN A;  2YCH A;  4M63 C;  1KAZ A;  4JN4 A;  3ZEU B;  3D7E O;  3RSE B;  1NWK A;  1U2V A;  2QWR A;  3I8B A;  4RWT A;  4K25 A;  3SJH A;  3WXJ A;  1IG8 A;  3CJC A;  4BRK A;  2E1Y A;  3WXL A;  3AAQ A;  5BR9 A;  2QWM A;  2D1K A;  3VES A;  1TYQ A;  3ULE A;  3U9D A;  5ADX H;  5FPD A;  3IFR A;  2PBD A;  3KZB A;  1GLL O;  4JAX A;  1ZBS A;  2FSK A;  3WEE B;  4BRH A;  4FWS A;  4BG8 A;  2F9T A;  4I6M A;  5EY4 A;  4J8F A;  4BC4 A;  2IVN A;  4BRF A;  4YDU A;  2P9L A;  3SLC A;  2CGK A;  4NB4 A;  3ZX0 A;  1YUW A;  4CBW A;  3A0I X;  1QHA A;  4H5W A;  1JCF A;  1NGI A;  1IJJ A;  3LM2 A;  1ESV A;  4BR0 A;  3UB5 A;  3CQX A;  2A40 A;  4HTL A;  3CHW A;  3MN7 A;  2BTF A;  4DCH A;  3FGU A;  1NGH A;  4H5T A;  1XUP O;  3DXM B;  4B1V A;  3VEX A;  1R59 O;  5AQM A;  3VF4 A;  2PAV A;  2QWP A;  3LDP A;  4RTF D;  4DHY A;  2CGJ A;  5LJW A;  3FE1 A;  3CER A;  4CZJ A;  2DPN A;  3D2E A;  2P9P A;  4JHD B;  3IDH A;  4QS8 A;  1KXP A;  4BVO A;  4CZE A;  4CZM A;  1RFQ A;  3M1F A;  1U2V B;  3ZX3 A;  1JCG A;  5AQP A;  3CET A;  1HKB A;  4H0O A;  2FSJ A;  2Q36 A;  4A2A A;  3GOI A;  4PKG A;  3C7N A;  3R9P A;  3ZX2 A;  3ENO A;  2IVO A;  1TYQ B;  1QZ5 A;  2E2Q A;  1KAY A;  4MLH A;  5AQT A;  3ULE B;  4B1Z A;  2VWB A;  5B8H A;  4WYB A;  3L0Q A;  2ZGZ A;  5BN9 A;  4I6M B;  3P4I A;  5ELZ A;  3FR0 A;  4JNE A;  3U8X A;  1NBW A;  1BWF O;  1MWK A;  2QM1 A;  5FPE A;  5AQK A;  4B1U B;  4BRI A;  3UKR B;  5AQG A;  2NLX A;  2V52 B;  2NZT A;  2YI1 A;  2FXU A;  1BA1 A;  5AFU A;  3QFU A;  3BEX A;  2BUP A;  1J6Z A;  3KVG A;  4FO0 A;  5AQW A;  3J8A A;  3M6G A;  1BDG A;  1Z05 A;  3FZL A;  1Y64 A;  2WUS A;  5AFU H;  3VET A;  3A5N C;  4FWQ A;  5AR0 A;  1BA0 A;  4Z94 A;  3BF1 A;  3EN9 A;  3EL2 A;  5AQQ A;  3O6W A;  2ZWH A;  2E88 A;  3VF2 A;  2ASM A;  4PL8 A;  1T6C A;  3O8M A;  2FSN A;  4ISF A;  3OHR A;  4EAH D;  4ISG A;  4FWL A;  4L3Q A;  4BR7 A;  3VEW A;  4H03 B;  3DJC A;  2P9K A;  5AQH A;  3C7N B;  1BO5 O;  2E2P A;  2VYP A;  3MN9 A;  3VF6 A;  3CI5 A;  3WQT A;  4CI6 A;  3HSC A;  4FWR A;  4A62 A;  3G25 A;  1QZ6 A;  4JHD A;  4QS9 A;  1DKG D;  1P8Z A;  1MWM A;  3O1B A;  3GG4 A;  3U9Z A;  4C23 A;  4IZ9 A;  4K41 A;  1GLJ O;  4FWN A;  5E84 A;  2V7Y A;  5CE3 A;  4F9O A;  5KPZ A;  3U4L A;  1GLD G;  4ISE A;  4AM6 A;  5AQX A;  1K8K B;  1H1V A;  3H3N O;  3LDL A;  4BRL A;  4BGB A;  3H3O B;  4CZF A;  2Q0U A;  4H5R A;  4BQL A;  2I7N A;  1NMD A;  1JCE A;  4DQ8 A;  4B1X B;  4YDU C;  4B1W B;  4B9Q A;  2IVP A;  3GL1 A;  4XH1 A;  3FZF A;  3VEO A;  3LDN A;  3R6M A;  3L6Q A;  4HWI A;  1BG3 A;  3FZM A;  3JXU A;  1TUU A;  2I7P A;  3O5B A;  4CD1 A;  5AQF A;  1SAZ A;  3ATV A;  4E1J A;  1G99 A;  4FWP A;  5KQD A;  2D4W A;  1NGA A;  5AQZ A;  1BU6 O;  2A5X A;  3UKR A;  1RGI A;  3VGK A;  3MN6 A;  3QFP A;  1BOT O;  1HX1 A;  5EX5 A;  5BRD A;  2P9K B;  2E2O A;  2HF4 A;  5AQN A;  1V4S A;  3ENH A;  4Y0W A;  1HKC A;  4H0T B;  3QIC A;  5F0X A;  3VGL A;  1D4X A;  3HI0 A;  4B1Y B;  2Q97 A;  3HTV A;  3EZW A;  4BRA A;  3LL3 A;  4CZK A;  2P9N A;  1GLE G;  1NGD A;  3AY9 A;  2Q0R A;  3CQY A;  4BC3 A;  3WXI A;  1C0G A;  2ZF5 O;  2A6A A;  4BRM A;  5LJV A;  5BRF A;  4K42 A;  5KPT A;  1MA9 B;  1U6Z A;  3EKS A;  1YAG A;  4BR5 A;  1BUP A;  4BQZ A;  4BRP A;  3QML A;  2J4R A;  4BC2 A;  2HOE A;  1SZ2 A;  2AP1 A;  2UYT A;  2YHY A;  3WXK A;  2E20 A;  4FSV A;  3VGM A;  2EWS A;  5EXW A;  2H3G X;  2QXL A;  1NGB A;  2CGL A;  5JLF A;  3A8Y A;  1T44 A;  1GLB G;  1K8K A;  2CH6 A;  1HKG A;  4LC9 B;  1WOQ A;  3MCP A;  5LY3 A;  3FZH A;  1Q18 A;  2HF3 A;  3MDQ A;  4O8K A;  4CZI A;  5BPN A;  4GY2 B;  3O4W A;  1NM1 A;  1QQO A;  2QWL A;  3ZET A;  4XEI A;  2QWQ A;  1GLF O;  4WQ4 A;  2P9N B;  3MN5 A;  3A5O C;  3KHY A;  4BG9 A;  5F2R A;  3VEY A;  1ATR A;  4WQ5 A;  3VER A;  2YHX A;  3QBW A;  3CJ7 A;  3AAR A;  4GNI A;  5AZJ A;  2Q2R A;  1HJO A;  1V4T A;  2Q1N A;  3TPQ A;  1XC3 A;  2D0P A;  5EVZ A;  1NGG A;  4KBO A;  4JD2 A;  3VEN A;  1YVN A;  4FOI A;  2E2N A;  4IJA A;  3UE5 A;  4H0X B;  2QWN A;  3LDQ A;  4FWO A;  5BPM A;  3W0L A;  1HLU A;  4AM7 A;  3MMV A;  4NO7 A;  2YJF A;  3HM8 A;  2A41 A;  1CZA N;  4PL7 A;  4MO4 A;  4BRG A;  4PKH A;  2P9U A;  3QDK A;  2P9I B;  5AQL A;  4CZL A;  4BRQ A;  3LM9 A;  3HZ6 A;  3D2F B;  2E8A A;  3ID8 A;  2F9W A;  2KHO A;  3LDO A;  2GTD A;  4BRD A;  4M7X A;  3AAP A;  1EQY A;  1LCU A;  2VCP A;  4RCH A;  4MLE A;  2FF6 A;  1NGC A;  3W3D A;  3H1Q A;  1OKJ A;  3ZET B;  4CJ7 A;  2FF3 B;  1X9J A;  3BUZ B;  3EO3 A;  5I9E B;  4FPB A;  4H0V B;  5ADX A;  3IMX A;  4FOE A;  5AQO A;  1XQS C;  3DXK A;  2FLO A;  3I33 A;  3DAW A;  4H5V A;  4MO5 A;  3SMS A;  3DWL A;  3BF3 A;  3TU5 A;  1C0F A;  5AZJ B;  3O1W A;  5AQY A;  1ZXO A;  4O5F A;  3IUC A;  4PKI A;  2GEM A;  3H6E A;  3HBT A;  2QW9 A;  2ASO A;  1DGK N;  2YJE A;  4JD2 B;  5E26 A;  4EHT A;  3C0B A;  4M7Y A;  1RDW X;  3VEZ A;  3VPZ A;  3EKU A;  1YXQ A;  2NRH A;  5EOY A;  4FWM A;  5AQU A;  1NGE A;  4IXC A;  2A42 A;  5JLH A;  4EIA A;  1HUX A;  2ITM A;  5KPR A;  4BVP A;  2P9U B;  3L4I A;  2AA4 A;  5BN8 A;  1ATS A;  5KQ8 A;  4A61 A;  4CBU A;  5AZI B;  1NGJ A;  3CJ9 A;  3F9M A;  3H46 O;  3FFK B;  4QS7 A;  4BRN A;  3O80 A;  2V51 B;  1TUY A;  4A2B A;  1E4G T;  4FL9 A;  4CBX A;  4H0Y B;  2GEL A;  2D0O A;  2ASP A;  2YHW A;  5AQJ A;  3UKU A;  1WUA A;  3A5L C;  1KAX A;  5BRE A;  3JS6 A;  1HPM A;  4CZG A;  4BR4 A;  3H45 C;  4EFH A;  3GBT A;  3A5M C;  3DXK B;  4EHU A;  2P9I A;  3MK6 A;  5FPM A;  2Q31 A;  5AQI A;  2GWK A;  1NGF A;  3QB0 A;  1SQK A;  3D2F A;  2P9S A;  4XH4 A;  5AQV A;  4BR9 A;  4DB3 A;  1GLA G;  4BRC A;  2OAN A;  4IO8 A;  4BGA A;  4BRO A;  3ATU A;  3GE1 A;  1S3X A;  1MDU B;  5JMV A;  3ZEU A;  3CIP A;  2P9L B;  3RSE A;  2GUP A;  2HMP A;  4WQ4 C;  3BP8 A;  3S41 A;  4BRE A;  3VOV A;  5F1X A;  4WQ5 C;  1GLC G;  3VEV A;  3FZK A;  4H5N A;  1ZC6 A;  2ZGY A;  2W41 A;  4XH5 A;  4BC5 A;  4BR2 A;  3CJ1 A;  4FWK A;  2GWJ A;  3GDQ A;  3R8E A;  2CH5 A;  3B8A X;  1S22 A;  3WEE A;  4FPA A;  2E1Z A;  4K43 A;  1E4F T;  3QBX A;  1LOT B;  1NLV A;  3M3Z A;  5BRH A;  1Z6R A;  5AQS A;  3D2E B;  2P9P B;  1DEJ A;  3H1V X;  5BPL A;  3WT0 A;  2A3Z A;  1X3N A;  3UKU B;  3O08 A;  5TKY A;  2V7Z A; 
#chains in the Genus database with same CATH topology
 2IIR A;  1C6V A;  5J2P A;  5JVH L;  4R79 A;  2NRX A;  4PY5 A;  5JIC A;  3O9Q A;  5AQR A;  4CD3 A;  3ZT4 A;  1D5A A;  3SAF A;  2G8U A;  2F8S A;  3CJB A;  4E7L A;  3PIO L;  3FLC O;  4M63 C;  1QQN A;  1RCH A;  1ITG A;  2EX3 A;  2AJQ A;  3RSE B;  4JI1 K;  1J5E K;  2HB5 A;  3SJH A;  1BCO A;  1S9E A;  2GX9 A;  3PO5 A;  3OYK A;  1N5Y A;  5ADX H;  3U9D A;  1ZYQ A;  5FRO A;  1ASW A;  1UOC A;  2YNF A;  4JAX A;  4YOU A;  1UA0 A;  4I9L A;  4J8F A;  1U04 A;  4CFA A;  2XO7 A;  2IAJ A;  3SLC A;  3ZX0 A;  5HRN A;  2KQ2 A;  4CBW A;  3A0I X;  3MCA B;  4JKH A;  1W2B M;  1Q7Y O;  4Z4H A;  4CJS A;  4X64 K;  4CK3 A;  3K59 A;  1NGI A;  4DFJ A;  1WSJ A;  3UB5 A;  4AF1 A;  2Z1J A;  4HTL A;  3CHW A;  3QIO A;  4DCH A;  3FGU A;  4CE9 A;  1IBK K;  4B1V A;  3DXM B;  4CGJ A;  3MXM A;  1N34 K;  2QWP A;  4KB1 A;  4DHY A;  2XY7 A;  4CJL A;  3FE1 A;  4JHD B;  3LP0 A;  2HBK A;  4CZM A;  4CZE A;  3P1G A;  1JXE A;  1JCG A;  1QSS A;  1XI1 A;  4CGF A;  3HT3 A;  4MDA A;  4CHQ A;  4Z4F A;  2Q36 A;  4K0K K;  3GOI A;  3KTQ A;  4PKG A;  3T69 A;  3C7N A;  3ZX2 A;  1TYQ B;  1QZ5 A;  2NRW A;  3R1X A;  5AQT A;  2ZGZ A;  4X65 K;  1KQS M;  2HHU A;  3RR7 A;  3K58 A;  4ZTJ A;  1HQE A;  1TL3 A;  3HPG A;  1FW6 A;  2OTL N;  1Z25 A;  2UUC K;  4V19 S;  4O0I A;  1NBW A;  1MWK A;  3EE9 A;  4M3Z A;  5AQK A;  4HTU A;  3UKR B;  2YI1 A;  4IOX A;  3OS0 A;  5AFU A;  1XNR K;  2ETJ A;  1BIZ A;  3SQ0 A;  3KVG A;  3J7Z O;  5AQW A;  3CC2 N;  3M6G A;  3FZL A;  4IFY A;  3KLG A;  4HUG A;  5CYQ A;  3LZJ A;  4DF4 A;  4NCA A;  4I7F A;  3BGR A;  1KLM A;  1BA0 A;  2DFE A;  1S6Q A;  2G8H A;  3T7Z A;  3BF1 A;  5SZT A;  2BH1 A;  4IEE A;  3CCJ N;  2E88 A;  1T6C A;  1QTM A;  1ZBF A;  3OA9 A;  3AA4 A;  3KD1 E;  4FWL A;  1I39 A;  4BEB A;  3DJC A;  2VQE K;  4CHN A;  3CCV N;  1KVC A;  3MN9 A;  4FWR A;  1YJW N;  1QZ6 A;  1NK6 A;  1P8Z A;  1EX4 A;  4RW9 A;  4C23 A;  3DRR A;  4YOX A;  3TI0 A;  4CJP A;  1LWF A;  4BWJ A;  1UAX A;  4JI6 K;  4ISE A;  2O8D A;  1RDB A;  3AO4 A;  4AM6 A;  4N76 A;  2O8C B;  1TK8 A;  1H1V A;  2KZM A;  1IBM K;  2Q3S A;  4FJK A;  2YNI A;  3WNF A;  2Q0U A;  1OH5 A;  4BQL A;  3VQ9 A;  4B1X B;  3HO1 A;  3PY8 A;  3VEO A;  3R6M A;  4FM2 A;  4B3O A;  4A57 A;  5HP1 A;  3JXU A;  2QXF A;  4JYA K;  2JWK A;  2X6S A;  1SAZ A;  2W6L A;  1CXU A;  4WCE L;  1KFS A;  3KKS A;  4CJF A;  3OYI A;  2A5X A;  1RGI A;  1OH6 A;  5EX5 A;  3JYT A;  2P9K B;  1YIT N;  3VTH A;  4ILG B;  1WBD A;  1V4S A;  2NNW A;  2HND A;  3ENH A;  5T7B A;  3TAN A;  4H0T B;  1KCF A;  1U47 A;  3CCS N;  1JLF A;  2Q97 A;  3HTV A;  4B9U A;  3LL3 A;  1GLE G;  1NGD A;  3AY9 A;  1K6Y A;  3KIO A;  4JI3 K;  2Q0R A;  4N47 A;  4BC3 A;  2OZS A;  3G71 N;  4JK8 A;  4M42 A;  1RT7 A;  4K42 A;  1U6Z A;  3EKS A;  5DMR A;  4B3S K;  3CCE N;  3S3M A;  1BUP A;  2YNH A;  4CEQ A;  2RKI A;  3CCL N;  2GBZ A;  5J2N A;  3I0S A;  3QML A;  3ID6 A;  4BC2 A;  1IH7 A;  3AVC A;  1S72 N;  1SZ2 A;  4MFB A;  2YHY A;  4F2R A;  1W97 L;  4FSV A;  3VGM A;  1TGO A;  3PO4 A;  2H3G X;  4IBN A;  2QXL A;  2ZM6 K;  3HM9 A;  3MXJ A;  2CGL A;  3MXI A;  3NGZ A;  1T3V A;  1T44 A;  4DUY K;  1DT9 A;  4BY9 C;  3QEX A;  5CYM A;  3VA3 A;  1VQL N;  4AHT A;  4E7K A;  4FK2 A;  4IOA L;  1WSH A;  4H8K A;  1S1X A;  3LWM A;  1RDC A;  3AA5 X;  4CFB A;  5LY3 A;  1NK8 A;  3DRP A;  2RE2 A;  3MDQ A;  4CZI A;  4H4O A;  3J80 O;  3CPE A;  3VA0 A;  4M45 A;  2QWL A;  4E1N A;  4XEI A;  1XWL A;  3NE6 A;  3EZ5 A;  4M3W A;  4BG9 A;  4GMJ B;  5F2R A;  1C0M A;  1RIL A;  1ATR A;  4WQ5 A;  3ZSY A;  3UIQ A;  2Q2R A;  3P5J A;  4BDZ A;  3F73 A;  1XC3 A;  4OPH A;  5EVZ A;  3L3V A;  4KBO A;  3RVC A;  2HW3 A;  2E2N A;  4CHY A;  4FWO A;  2YHB A;  1S6P A;  4KRF A;  2G8W A;  3W0L A;  3HPH A;  2YJF A;  3HM8 A;  5M1Q A;  1G15 A;  4PL7 A;  1CZA N;  1MU2 A;  1KVA A;  1IV0 A;  3QIN A;  2HHX A;  4JS4 A;  3VQP A;  2KLA A;  1SUQ A;  3LDO A;  5SWM A;  1SS6 A;  1BI4 A;  2VCP A;  2HBM A;  4RCH A;  4MLE A;  3W3D A;  3H1Q A;  2FF3 B;  4DV4 K;  1L3U A;  4CJT A;  1ILY A;  4FPB A;  4H0V B;  3M8P A;  1NK9 A;  5AQO A;  1XQS C;  3DXK A;  2UXB K;  2FLO A;  4FLT A;  3DAW A;  4LD0 A;  4H5V A;  3SMS A;  1RTH A;  4FW1 A;  3TU5 A;  1TKX A;  5AZJ B;  3AGR A;  4FZX C;  3PX0 A;  4DR5 K;  4OGE A;  2GEM A;  2YJE A;  3VEZ A;  3VPZ A;  2YKM A;  3EKU A;  4JKG B;  1QS4 A;  3ZCM A;  2NRH A;  3V4I A;  5EOY A;  4LH5 A;  5HRS A;  2ZJQ L;  3O4N A;  3DLG A;  4KH4 A;  4FJ5 A;  4EIA A;  2WFB A;  1HUX A;  1SL1 A;  3NGY A;  3CCR N;  4JI7 K;  3V1O A;  4BVP A;  3VQ6 A;  2P9U B;  2C1G A;  5KQ8 A;  4A61 A;  4KTQ A;  5AZI B;  2ZJR L;  5DK5 A;  3C94 A;  1FK9 A;  3H46 O;  2Z1G A;  1YF5 L;  3QO9 A;  2V51 B;  2G8F A;  4FL9 A;  3EY1 A;  1WLJ A;  2C1I A;  5CR4 A;  3UKU A;  4FZY A;  1RTI A;  1VSH A;  3A5L C;  4DR2 K;  1KAX A;  3JS6 A;  2FBT A;  2D0C A;  4CZG A;  3VQ7 A;  4BR4 A;  3L2V A;  3AGK A;  3H45 C;  3A5M C;  1RT4 A;  5FPM A;  2KFN A;  1SQK A;  3D2F A;  1VQM N;  4CK1 A;  4Z4I A;  4BR9 A;  3Q7B A;  4DB3 A;  3NMU A;  4BRC A;  4IO8 A;  1RBS A;  3KWG A;  3P38 A;  4BRO A;  4BE1 A;  4QCL A;  5FDL A;  4DS5 A;  1WAJ A;  3RSE A;  4CGG A;  2HMP A;  4WQ4 C;  5GIP A;  3OTO K;  4DTJ A;  4E7I A;  3SQ4 A;  5LL6 Z;  4JKC A;  3ZSR A;  2O8F B;  3FZK A;  3SPY A;  1SKW A;  2O4G A;  2R7Y A;  4HVJ A;  4O5B A;  4FWK A;  2IDO A;  4W5N A;  4JV5 K;  3GDQ A;  4YOV A;  1XC9 A;  3OBY A;  3DLR A;  3M8S A;  3QBX A;  1B92 A;  3F9K A;  3M3Z A;  4CF8 A;  1SKR A;  5BRH A;  3D2E B;  2P9P B;  2O4I A;  1DEJ A;  3H1V X;  3CYM A;  2E6L A;  2A3Z A;  1X3N A;  3NBP A;  3C95 A;  3O08 A;  3IAY A;  1Q82 O;  4NLB A;  1N36 K;  2W40 A;  1ATN A;  4KHW A;  3TSU A;  3SK3 A;  3RRH A;  3DXM A;  4H0P A;  4DF8 A;  4B9M A;  1T6D A;  3SMP A;  3CCM N;  2P9S B;  3OVN A;  1BCM A;  3WQU A;  3EE8 A;  4IWV A;  4TSX A;  4CZH A;  2ZQB A;  2W6K A;  4IO9 L;  3FFI A;  3ZEU B;  3TR8 A;  2QWR A;  2XY8 A;  4RWT A;  4OX9 K;  4K25 A;  3WXJ A;  4RW7 A;  4BRK A;  4KRE A;  2E1Y A;  3AVF A;  4CEC A;  3AAQ A;  4Y1D A;  3TAP A;  3VES A;  2D1K A;  1HNW K;  1DLO A;  1TYQ A;  5FPD A;  4BEC A;  3IFR A;  2PBD A;  3KZB A;  4ELT A;  4BAC A;  2UUA K;  4QAG A;  4IFV A;  5I42 A;  1T05 A;  2CGK A;  4NB4 A;  3AO5 A;  1YUW A;  4O4G A;  1VSK A;  3KLF A;  2QI2 A;  1JCF A;  2P1J A;  1S1W A;  1JLC A;  4FJ8 A;  3LM2 A;  1ESV A;  3NH1 A;  3CQX A;  3LP3 A;  2FBV A;  1R59 O;  3PSF A;  3AO3 A;  4DV6 K;  3LDP A;  4YHH K;  4B3M K;  2CGJ A;  1HMV A;  5LJW A;  2EHG A;  3H08 A;  3CER A;  2DPN A;  3HYF A;  3IDH A;  1KXP A;  3T19 A;  4DQQ A;  5C2D A;  4B9N A;  1RFQ A;  3CMA N;  1U2V B;  4LH4 A;  2P51 A;  3WNG A;  3CET A;  1HKB A;  3ZSQ A;  4KHN A;  2FSJ A;  1VSJ A;  3CF5 L;  4C8O A;  1Q8I A;  3R9P A;  4FJN A;  3NF8 A;  3SNN A;  5D3G A;  1KTQ A;  2VWB A;  4JI8 K;  5K14 A;  4WYB A;  5HRR A;  4J2B A;  3TAQ A;  4CEZ A;  4I2P A;  1NNE A;  3P4I A;  3ZSX A;  3AVB A;  4B9L A;  2QK9 A;  4DV7 K;  1ZBH A;  3FR0 A;  2VQF K;  4LY7 A;  5C15 A;  5FPE A;  1IKV A;  3SV4 A;  2OPR A;  1LAV A;  4OO1 J;  2I5J A;  3G0Z A;  3PX4 A;  1LWE A;  3O9U A;  3DLB A;  4B3R K;  3QFU A;  4FO0 A;  1ASU A;  2WUS A;  5AFU H;  3VET A;  3A5N C;  3K5M A;  5AR0 A;  4JRP A;  3QLH A;  4E7H A;  1NOY A;  2ZWH A;  3VF2 A;  1HYV A;  1ZBL A;  4BR7 A;  4DSF A;  4H03 B;  3SAG A;  5C25 A;  2O8E B;  2P9K A;  5AQH A;  3EYZ A;  4DV3 K;  4FCY A;  2KW4 A;  4CJ3 A;  3C6T A;  3CXC M;  2NRZ A;  3IG1 A;  4IG3 A;  3O1B A;  4ILJ A;  3U9Z A;  4K41 A;  1GLJ O;  4FWN A;  4ICL A;  4JEP A;  1WNS A;  4AH9 A;  3HVR A;  4GV9 A;  1GLD G;  4JKD A;  3E1Y A;  4FM1 A;  3M8Q A;  4FJJ A;  3LDL A;  5C24 A;  1Q81 O;  4CW7 B;  2ZD1 A;  4H5R A;  1I3A A;  4DQ8 A;  4YDU C;  4AQY K;  3SBG A;  4XH1 A;  1HNX K;  3FZF A;  3B6O A;  4B9T A;  3LPT A;  3LDN A;  4OKE A;  3PV8 A;  3DLE A;  1BG3 A;  3ULD A;  1RBT A;  1NK0 A;  2HHW A;  2DFF A;  4F8R A;  5AQF A;  4E89 A;  4B08 A;  4E1J A;  2PYL A;  4LFB K;  5HOO A;  1BOT O;  5BRD A;  4M3Y A;  2KZZ A;  3DRS A;  2HF4 A;  3E9L A;  5AQN A;  4Y0W A;  3O3G A;  2KTQ A;  3QIC A;  3S9H A;  2IOC A;  3OBW A;  1D4X A;  1VQK N;  4B8A B;  4CHP A;  4B1Y B;  5GAH P;  4Q5V A;  2DFH A;  3G10 A;  2G8I A;  2D0B A;  4GKK K;  1LW2 A;  3KWI A;  2Y1J A;  1C0T A;  3NDK A;  3O9R A;  5KPT A;  4KFB A;  4DG1 A;  3R3L A;  4FJG A;  4E7J A;  4C1N K;  2PYJ A;  2WTU A;  1IKY A;  4BRP A;  5KGW A;  4DR6 K;  3QNN A;  3WXK A;  2E20 A;  3VQ5 A;  1NGB A;  1Q9X A;  2WC9 A;  3U3Y A;  3HRG A;  3THX B;  4ZHR A;  3OJS A;  4JKB A;  3BZC A;  3B6P A;  5JVG L;  1K8K A;  3LPU A;  4BE7 B;  3HVT A;  1HKG A;  4PA1 A;  4FLX A;  1RBU A;  4CJK A;  2NRR A;  3MCP A;  4PQU A;  3U6F A;  1A5X A;  4GW6 A;  1QQO A;  2QWQ A;  1NOZ A;  3OJU A;  3HJF A;  3TAG A;  4BE0 A;  1EP4 A;  4O8U A;  5AZJ A;  1B9D A;  1V4T A;  2E4L A;  2NRT A;  1YHQ N;  1NG9 A;  1YJ9 N;  3L3U A;  5AJ3 K;  1JKH A;  1T7P A;  4O44 A;  3CCU N;  1YVN A;  2XY6 A;  4DV2 K;  4JKG A;  3L2R A;  4NO7 A;  3CG7 A;  1LAW A;  3O4Q A;  3SCX A;  2P9U A;  3LM9 A;  3D45 A;  3K9J A;  5HBM A;  4HHT A;  2E8A A;  1TK0 A;  2F9W A;  3L2U A;  1RT1 A;  4DQI A;  4BRD A;  1U4B A;  4CVN E;  2FF6 A;  1NGC A;  4JKF A;  1TKT A;  1RNH A;  1D9D A;  2VG7 A;  1X9J A;  3PIP L;  1VSE A;  3BUZ B;  1N32 K;  4OKJ A;  1I94 K;  4FK4 A;  5I9E B;  5ADX A;  4LSL A;  3IMX A;  2RN2 A;  1BQN A;  5HRP A;  3DWL A;  1ASV A;  3DI6 A;  2HHV A;  4PHT X;  5AQY A;  1ZXO A;  3IUC A;  3HBT A;  4N56 A;  3VQ4 A;  2HBL A;  4KTZ A;  2JWL A;  3SPZ A;  4FLY A;  2QW9 A;  3ASM A;  2ASO A;  3KK2 A;  4CEA A;  3NF6 A;  1J54 A;  4AHV A;  4H4M A;  4JS5 A;  3AVM A;  2O8F A;  3K9K A;  4C8M A;  5DM7 L;  3MX2 A;  4A5B A;  4CF9 A;  4JK7 A;  2B4J A;  2ITM A;  3TAR A;  1XMO K;  1NGJ A;  4DSK A;  2KKZ A;  2OPP A;  3VQ8 A;  4NXM K;  1E4G T;  4LF4 K;  2GEL A;  1XHZ A;  2YHW A;  1CXQ A;  5CZ1 A;  3OW2 M;  4NCB A;  3T1A A;  1RT6 A;  1WUA A;  3KLE A;  4KHP K;  2RPI A;  2OZM A;  4CGD A;  3QEV A;  1RT2 A;  1VHX A;  1A5W A;  3GBT A;  3OYC A;  2P9I A;  2G8V A;  2Q31 A;  3LAM A;  3QB0 A;  1OH8 A;  2P9S A;  5AQV A;  4N5S A;  1GLA G;  3C6A A;  4LF9 K;  3CCQ N;  2BE2 A;  4B9V A;  4BGA A;  2QKK A;  1IBL K;  3ZEU A;  1JLA A;  1C1A A;  3V9U A;  2DY4 A;  3AA2 A;  3VOV A;  5F1X A;  1IO2 A;  1GLC G;  2RF2 A;  5H1S Q;  3MWT A;  2W41 A;  1J5O A;  3K57 A;  1T03 A;  2GWJ A;  3THW B;  4F4K A;  4I9Q A;  1UWB A;  1VQ9 N;  1SL0 A;  4FJM A;  1NU0 A;  1LOT B;  3V1Q A;  4OLB A;  3LZI A;  3MX5 A;  1Z6R A;  3IS9 A;  4GV3 A;  5AQS A;  3G6E N;  3WT0 A;  2OCE A;  3QET A;  2XY5 A;  1TAU A;  4MQ3 A;  4GV6 A;  3WUH A;  3CJA A;  1QQM A;  1W7A A;  3J7Y P;  4Q0B A;  1HNI A;  3E9O A;  5FPN A;  4CJ5 A;  4CJR A;  1WSI A;  2QWO A;  4OKK A;  3AV9 A;  4AHU A;  4BDP A;  4YOT A;  4R5P A;  2YCH A;  1KAZ A;  4JN4 A;  3D7E O;  1NWK A;  1U2V A;  3V9W A;  1OVY A;  4J2A A;  5JS1 A;  4U7B A;  2OPQ A;  1IG8 A;  4EP4 A;  3CJC A;  3V6D A;  3WXL A;  4A59 A;  2YV0 X;  1JJ2 M;  1NK5 A;  3PX6 A;  1LW0 A;  3TAF A;  3NVM A;  1GLL O;  4AHC A;  1ZBS A;  5KRS A;  3WEE B;  4BRH A;  3KLH A;  4FWS A;  4BG8 A;  3S3N A;  3E01 A;  5EY4 A;  4BC4 A;  4BRF A;  2P9L A;  4NYF A;  1QHA A;  4E19 A;  4W5Q A;  2A1S A;  3D0P A;  4JRQ A;  1IJJ A;  3KK1 A;  1IKX A;  4BR0 A;  3NHG A;  3MN7 A;  1WAF A;  4RW8 A;  4RG8 A;  3CM5 A;  4DTX A;  1XUP O;  1U48 A;  2HNZ A;  3VEX A;  3VF4 A;  1N8R O;  2P5O A;  2PAV A;  4RTF D;  1U45 A;  4IDK A;  3ENB A;  1J9A A;  1VQ8 N;  2VWK A;  2BGG A;  2WBN A;  4DTR A;  4QS8 A;  1VQO N;  2UUB K;  3M5R A;  4BVO A;  4C8L A;  3MAQ A;  1EXQ A;  1RDA A;  4H0O A;  2HST A;  1HNV A;  4EZ6 A;  4G1Q A;  2IVO A;  3T1Y K;  2E2Q A;  3ULE B;  1KAY A;  3TAM A;  4B1Z A;  1BGX T;  4DFK A;  3QEI A;  4LF8 K;  1RT3 A;  5B8H A;  3DM2 A;  4I6M B;  4FLV A;  4PWD A;  5ELZ A;  4NXN K;  4JNE A;  3U8X A;  3OYA A;  3J81 O;  1NK7 A;  4B1U B;  1X9M A;  4JI0 K;  4BRI A;  1F21 A;  2GV9 A;  2NLX A;  2BAN A;  1QSY A;  2NZT A;  1L3V A;  1REV A;  4DMN A;  2BUP A;  1J6Z A;  4BWM A;  1P90 A;  4HUE A;  3J8A A;  1S1U A;  1Z05 A;  3ZT0 A;  1WSG A;  3NAE A;  1Y64 A;  1WN7 A;  4Z94 A;  1BL3 A;  3TWH A;  4KAZ A;  3PLA A;  3EL2 A;  3O6W A;  3SJJ A;  1QE1 A;  4PL8 A;  5C12 A;  2FSN A;  5C2F A;  3OS2 A;  4DLE A;  3OHR A;  1VQP N;  3DMJ A;  3L2Q A;  5TKW A;  3VEW A;  4HCC A;  1JLE A;  3D6R A;  1YI2 N;  1IG9 A;  4DFP A;  3CFO A;  4YY3 K;  3SI6 A;  3VF6 A;  1K9M O;  5CY4 A;  3IKM A;  2NRV A;  4ELU A;  3G25 A;  4JHD A;  1NJY A;  4QS9 A;  3KK3 A;  4FLU A;  1MWM A;  4DS4 A;  2PZS A;  4CJW A;  1EO1 A;  3AVA A;  3AVL A;  4DUZ K;  5E84 A;  5CE3 A;  3TTF A;  5KPZ A;  4EZ9 A;  2FBX A;  2X74 A;  5AQX A;  3C6H A;  4B9S A;  1WSF A;  3RMD A;  3H3N O;  1YTU A;  3V9S A;  3H3O B;  1X9S A;  2D5R A;  4DLG A;  1JCE A;  4X66 K;  3KLI A;  4OGC A;  2IVP A;  2UXD K;  3ZYY X;  3NGI A;  2VGM A;  4HWI A;  3TSQ A;  3QEP A;  1TK5 A;  3FZM A;  3SAH A;  2QEX N;  2F8T A;  2A1R A;  3MED A;  3ZSZ A;  1TUU A;  2NUB A;  3O5B A;  3THX A;  4CD1 A;  3NH0 A;  2W42 A;  3ATV A;  4FWP A;  5KQD A;  2D4W A;  1NGA A;  4NCG A;  5AQZ A;  3UKR A;  4FVM A;  1L5U A;  3CQ8 A;  4DQS A;  4KHU A;  1N33 K;  2OTJ N;  3HPO A;  1Z26 A;  4FJI A;  1HKC A;  1IKW A;  5HRO A;  4CHZ A;  4W5O A;  5JEN A;  5J1E A;  5F0X A;  3HI0 A;  4BRA A;  4J2D A;  3EZW A;  3OY9 A;  1KSP A;  4CZK A;  4JKE A;  1YTA A;  1O1W A;  3CQY A;  1NMN A;  3WXI A;  3SUN A;  3OYE A;  2ZF5 O;  1J53 A;  5CZ2 A;  1R0A A;  4MDB A;  4M41 A;  4FJ7 A;  1JLB A;  3VQQ A;  5BRF A;  3RRG A;  3LP1 A;  3LAL A;  4DTP A;  4BQZ A;  3AVK A;  5MLC Q;  5FRN A;  4CHO A;  1VQ4 N;  4KB0 A;  3AVJ A;  2J4R A;  1EKE A;  3CC4 N;  2AP1 A;  3J7A P;  4DQP A;  3O9S A;  1W0H A;  1QQC A;  1D9F A;  2BDP A;  3HP6 A;  4FJL A;  4DTO A;  1NJX A;  5JLF A;  3SV3 A;  3A8Y A;  3L2W A;  4CIF A;  2O8C A;  1OH7 A;  2CH6 A;  1NKB A;  3L8B A;  4LC9 B;  4DSE A;  1WSE A;  1WOQ A;  4U67 L;  3OYG A;  2KFZ A;  4E72 A;  4F2S A;  2HF3 A;  4M3U A;  4LFC K;  1YJN N;  1KRP A;  1VSL A;  1GLF O;  4WQ4 A;  1GOA A;  1SKS A;  1WBB A;  4QOZ B;  2P9N B;  1RBV A;  3MN5 A;  4DV0 K;  4FK0 A;  3KHY A;  2QKB A;  3VEY A;  3KD5 E;  3QEW A;  2YHX A;  3AAR A;  1JLQ A;  4GNI A;  3KKR A;  5FLX O;  1HJO A;  1YIJ N;  3BDP A;  1E3M A;  3TPQ A;  2D0P A;  5M1O A;  4KHQ A;  3V1R A;  1NGG A;  1S9G A;  4XIU A;  3HXM A;  2IS3 A;  5KI6 A;  3K2P A;  1HJR A;  1ZBU A;  4IJA A;  3O3F A;  4H0X B;  2QWN A;  2ATQ A;  2YX6 A;  1VQ6 N;  1HLU A;  5GIN A;  2VGN A;  4MO4 A;  1SV5 A;  5AQL A;  4CZL A;  4HUF A;  2OA8 A;  5E41 A;  3D2F B;  4CES A;  4C1N I;  4BE2 A;  2ZE2 A;  2KHO A;  3AAP A;  1EQY A;  3PUF A;  4ZTF A;  5EU7 A;  1NK4 A;  4FJX A;  1BHL A;  1KLN A;  4KI6 A;  1RTJ A;  1OKJ A;  3ZET B;  4CJ7 A;  1Y97 A;  5GAE P;  1HR0 K;  3EO3 A;  5IT9 O;  3TSP A;  3QNO A;  4FOE A;  4KHY A;  3VTI A;  3I33 A;  4F3T A;  3CM6 A;  4AIL C;  2G8K A;  3BZK A;  3NFA A;  4O5F A;  5KGX A;  3T1H K;  4O0J A;  3H6E A;  4CF1 A;  2VG6 A;  2RHK A;  1K8A O;  2X78 A;  4JD2 B;  5E26 A;  3C0B A;  3CPW M;  1RDW X;  1B9F A;  3DOL A;  3K5O A;  1YXQ A;  4OPK A;  5AQU A;  1NGE A;  3E9P A;  4IXC A;  2GUI A;  4DV5 K;  3NCI A;  5JLH A;  2E5L K;  4IEI A;  2HHS A;  3S3O A;  4FVU A;  5KPR A;  3L4I A;  5BN8 A;  1S5J A;  3THW A;  4KPY A;  4CBU A;  1XNQ K;  2X6N A;  4LF5 K;  3M8R A;  5IWA K;  3CJ9 A;  3VQA A;  4UY8 O;  1NJW A;  1NJZ A;  3Q7C A;  3O80 A;  2YKN A;  4A2B A;  4DR1 K;  1FKP A;  4GVM A;  3O3H A;  4KKO A;  2D0O A;  5AQJ A;  4UQG A;  3TTD A;  5BRE A;  3F2K A;  1HPM A;  3V81 A;  1KVB A;  3MK6 A;  3SQ1 A;  4BDY A;  3LP2 A;  3HL8 A;  4B3T K;  4XH4 A;  1C1B A;  1O13 A;  2OAN A;  3WNE A;  1JLG A;  4DTM A;  1S3X A;  1MDU B;  4YOY A;  4OJR A;  5JMV A;  2GUP A;  3ZSW A;  3C65 A;  4AHR A;  3MEG A;  3N4P A;  1NKE A;  1HYZ A;  3S41 A;  1VQN N;  4WQ5 C;  2IC3 A;  3VEV A;  2HHH K;  2ZGY A;  5C0Y A;  4BC5 A;  4CEF A;  1JL1 A;  3CJ1 A;  1VSI A;  3T3F A;  4JK9 A;  1KFD A;  1S1T A;  3R8E A;  2CH5 A;  3B8A X;  1S22 A;  3WEE A;  1T8E A;  4FPA A;  4CJV A;  4HCB A;  3VN5 A;  1E4F T;  3OYL A;  1NLV A;  5M1N A;  1RDD A;  2WOM A;  3ZLJ A;  1BQM A;  3P39 A;  4FZZ A;  1Q86 O;  2V7Z A;  4DTN A;  1CZ9 A;  4CIE A;  1S1V A;  2XRI A;  1VSF A;  5I3U A;  5AZI A;  4KTW A;  4N41 A;  5LMN K;  4IOC L;  3SBT A;  4JI4 K;  1LWC A;  1XMQ K;  4IJN A;  4DTS A;  1X3M A;  2O8B B;  3I8B A;  2IGI A;  2VG5 A;  3OYM A;  5M1F A;  4LFA K;  5BR9 A;  4CJU A;  2QWM A;  3ALY A;  4DSL A;  3ULE A;  3VQB A;  5C42 A;  1VQ5 N;  4ILH A;  2FSK A;  2OPS A;  3I55 N;  3AO1 A;  2PY5 A;  1JL2 A;  2F9T A;  4I6M A;  3EEQ A;  3ZT3 A;  2IVN A;  4A5A A;  1OVQ A;  2QTD A;  3F5T A;  1VSM A;  4YDU A;  3THY B;  4M3R A;  4PUO A;  3ZSV A;  4H5W A;  2F4V K;  3P31 A;  2HBJ A;  3CME N;  1VSD A;  3RMC A;  2A40 A;  1NKC A;  3I0R A;  2BTF A;  3SUO A;  3OYB A;  1NGH A;  2JGU A;  3WNH A;  1FXX A;  4H5T A;  3VMF B;  4W5R A;  4Z4E A;  5HL7 L;  3MEC A;  1A5V A;  5AQM A;  5A2Q O;  3P83 D;  3I8D A;  4FW2 A;  2P5G A;  4KO0 A;  4X62 K;  4ELV A;  4DR4 K;  1XHX A;  4CZJ A;  3D2E A;  2P9P A;  3OYD A;  2QA4 N;  1LV5 A;  3M1F A;  4CF2 A;  3QES A;  3OYJ A;  3ZT1 A;  4CGH A;  3ZX3 A;  4ID1 A;  5AQP A;  3RTV A;  4A2A A;  2DTU A;  4Z0U A;  3ENO A;  5LMU K;  4MLH A;  2HMI A;  4IDH A;  3JAM O;  3A2F A;  4IKF A;  3TTC A;  3L0Q A;  5BN9 A;  3DYA A;  5GAD P;  4OVL A;  3QER A;  1UA1 A;  2ZJP L;  3HP9 A;  3SYZ A;  2D0A A;  3OS1 A;  4CED A;  3PSI A;  4DR7 K;  1BWF O;  1EWQ A;  2QM1 A;  5GAG P;  3CFP A;  5AQG A;  2V52 B;  4WE1 A;  2FXU A;  3HOS A;  3RMB A;  1VAZ A;  1BA1 A;  4YFU A;  3BEX A;  4YNQ A;  1BDG A;  4NYN A;  3JSM A;  2UU9 K;  4FWQ A;  3EN9 A;  5AQQ A;  3G4S N;  2ASM A;  2F96 A;  3O8M A;  2B5J A;  5HLF A;  4ISF A;  4EAH D;  4DU1 A;  1VRU A;  4ISG A;  4L3Q A;  4L8R B;  3MEE A;  1TKZ A;  3C7N B;  4CEB A;  4RW6 A;  1BO5 O;  2E2P A;  2VYP A;  5FRM A;  3WQT A;  3CI5 A;  4CI6 A;  3HSC A;  4DTU A;  4E1M A;  4A62 A;  4DWI A;  3NF7 A;  1DKG D;  3SUP A;  3GG4 A;  3TAE A;  4IZ9 A;  2OYQ A;  1TL1 A;  3OYF A;  4DFM A;  2V7Y A;  4AHS A;  4F9O A;  3U4L A;  4NLC A;  4FYD A;  5JS2 A;  1W9H A;  1K8K B;  4BRL A;  4B8C A;  4BGB A;  4JI5 K;  4CZF A;  1HYS A;  1EET A;  2I7N A;  1NMD A;  4DV1 K;  3SQ2 A;  4B1W B;  4B9Q A;  3GL1 A;  5J2Q A;  3L6Q A;  1RDU A;  2XHB A;  3HK2 A;  3DLH A;  2I7P A;  3RR8 A;  3K5L A;  4DSI A;  1G99 A;  3DOK A;  3DLL L;  1BU6 O;  3L4Q A;  3VGK A;  1VRT A;  3MN6 A;  3QFP A;  1HX1 A;  2LSN A;  1K73 O;  4IG0 A;  3VQD A;  4FLZ A;  2E2O A;  2HVH A;  1C1C A;  4G9Z A;  4CIG A;  3VGL A;  3AVG A;  3K0S A;  4Z4G A;  3AO2 A;  2P9N A;  4OLA A;  3VQE A;  1C0G A;  2A6A A;  4ID5 A;  4BRM A;  5LJV A;  1BIS A;  1HPZ A;  1MA9 B;  2O8D B;  2O8E A;  3V9Z A;  1YAG A;  4GVE A;  4BR5 A;  4LSN A;  3QIP A;  4KV8 A;  1WB9 A;  1RT5 A;  4E3S A;  4DQR A;  2UXC K;  2HNY A;  2HOE A;  2UYT A;  3VQC A;  1HRH A;  2EWS A;  1D8Y A;  5EXW A;  3ITH A;  3SUQ A;  1L3T A;  3CYG A;  1CZB A;  4CGI A;  2WON A;  1NJI O;  4KHS A;  1RTD A;  2F7T A;  1GLB G;  3AVH A;  4JKA A;  1QHT A;  1TAQ A;  1CLQ A;  1N6Q A;  4C8K A;  3FZH A;  4CFC A;  2VWJ A;  3TAB A;  1Q18 A;  4O8K A;  5BPN A;  4GY2 B;  3O4W A;  4KI4 A;  1NM1 A;  3NF9 A;  4I2Q A;  3ZET A;  1U49 A;  2E6M A;  4EP5 A;  4XJX A;  3A5O C;  4LF6 K;  5KRT A;  3VER A;  3QBW A;  3CJ7 A;  4Y1C A;  3U3G A;  1X1P A;  4C8N A;  1ZBI A;  2Q1N A;  1QVF M;  2Z1H A;  2W00 A;  4JD2 A;  3VEN A;  1QVG M;  4FOI A;  3CC7 N;  3UE5 A;  4CJ4 A;  3NVK A;  2YNG A;  1KC8 O;  4CJQ A;  4FM0 A;  3LDQ A;  4CEE A;  4JI2 K;  5BPM A;  4AM7 A;  3MMV A;  3MWP A;  3NH2 A;  2ITG A;  2A41 A;  4BRG A;  4PKH A;  5C10 A;  3QDK A;  2P9I B;  3OYH A;  4F3O A;  4BRQ A;  3HZ6 A;  1DTT A;  4K8Z A;  2FC0 A;  2B6A A;  3LDS A;  3ID8 A;  4E0D A;  4FXD A;  2GTD A;  4M7X A;  3AVN A;  1LCU A;  3RMA A;  3IRX A;  4W5T A;  1FJG K;  4CK2 A;  3LWL A;  2FBY A;  5KTQ A;  4K8X A;  4WFA L;  3KK7 A;  4DU4 A;  4DKW A;  1DTQ A;  4YOW A;  2PFU A;  4MO5 A;  3BF3 A;  3HST B;  1SL2 A;  1C0F A;  4WF9 L;  4GKJ K;  3O1W A;  1L3S A;  5J2M A;  2YHA A;  4PKI A;  4JLH A;  2HHT A;  4Z4C A;  4CCH A;  1DGK N;  4EHT A;  1HNZ K;  2HVI A;  4M7Y A;  2Y1I A;  1VK0 A;  3SZ2 A;  4FWM A;  4FJ9 A;  4M3T A;  5CHI A;  4DSJ A;  2A42 A;  3K5N A;  5M1K A;  4O55 A;  4KH5 A;  1M90 O;  1VQ7 N;  2AA4 A;  1ATS A;  1JXB A;  1M1K O;  3KJV A;  4J2E A;  1BIU A;  3CFR A;  3F9M A;  3FFK B;  4QS7 A;  4BRN A;  1YVU A;  5BR8 K;  4CF0 A;  1TUY A;  4CER A;  4CJE A;  1RBR A;  1BI4 B;  3ZSO A;  4CBX A;  3I56 N;  4H0Y B;  4DU3 A;  2ASP A;  4LF7 K;  3WXM B;  4YOR A;  4CFD A;  1YT3 A;  4EFH A;  3DXK B;  4EHU A;  5AQI A;  2GWK A;  1NGF A;  1EWR A;  3LAN A;  4WFB L;  1X9W A;  3ISN C;  4DR3 K;  3ATU A;  4OPJ A;  3GE1 A;  3THV A;  1QSL A;  4KH6 A;  3CIP A;  2P9L B;  3E66 A;  3ZT2 A;  2O8B A;  3DLK A;  1KD1 O;  3HOT A;  4WFN L;  1TVR A;  3BP8 A;  3LAK A;  4BRE A;  1GOC A;  4RW4 A;  4IFE A;  3V9X A;  4H5N A;  4FJH A;  1ZC6 A;  4XH5 A;  4BR2 A;  1FKO A;  5M1P A;  5GIO A;  3CD6 N;  3AVI A;  2E1Z A;  4K43 A;  4M3X A;  2HHI A;  1GOB A;  2Z1I A;  4OPA A;  1TV6 A;  3THY A;  1Q9Y A;  3RWU A;  3N4Q A;  2HHQ A;  3OYN A;  5DM6 L;  4FLW A;  3C6U A;  5BPL A;  3S5T A;  3BY5 A;  1HQU A;  3AA3 A;  4CEO A;  3UKU B;  1C0U A;  3O9T A;  5TKY A;  2JLE A;  1TKD A; 
#chains in the Genus database with same CATH homology
 4GV6 A;  2IIR A;  4NLB A;  2W40 A;  3WUH A;  1ATN A;  3TSU A;  3SK3 A;  3DXM A;  4H0P A;  3CJA A;  4R79 A;  5JVH L;  1QQM A;  5AZI A;  2NRX A;  5JIC A;  1T6D A;  3O9Q A;  3E9O A;  2P9S B;  5AQR A;  5FPN A;  3SMP A;  4CD3 A;  3CCM N;  4IOC L;  3SBT A;  3WQU A;  3SAF A;  3EE8 A;  2QWO A;  4IWV A;  4CZH A;  4IJN A;  4YOT A;  3CJB A;  3PIO L;  1X3M A;  3FLC O;  1QQN A;  2YCH A;  4M63 C;  1KAZ A;  4IO9 L;  4JN4 A;  3ZEU B;  3D7E O;  3RSE B;  1NWK A;  1U2V A;  2QWR A;  1OVY A;  3I8B A;  4RWT A;  4K25 A;  3SJH A;  3WXJ A;  4U7B A;  1IG8 A;  3CJC A;  4BRK A;  5M1F A;  2GX9 A;  2E1Y A;  3WXL A;  4A59 A;  3AAQ A;  5BR9 A;  1JJ2 M;  2QWM A;  2D1K A;  3VES A;  1TYQ A;  3ULE A;  3U9D A;  5ADX H;  5FPD A;  4BEC A;  3IFR A;  2PBD A;  3NVM A;  3KZB A;  1VQ5 N;  1GLL O;  4ILH A;  4JAX A;  1ZBS A;  4YOU A;  2FSK A;  3WEE B;  4BRH A;  3I55 N;  4FWS A;  4BG8 A;  2F9T A;  4I6M A;  5EY4 A;  4J8F A;  4BC4 A;  2IVN A;  4A5A A;  4BRF A;  2QTD A;  4YDU A;  2P9L A;  3F5T A;  2CGK A;  4NB4 A;  3SLC A;  1YUW A;  3ZX0 A;  4CBW A;  3A0I X;  3MCA B;  4JKH A;  1QHA A;  1W2B M;  1Q7Y O;  4H5W A;  2QI2 A;  1JCF A;  1NGI A;  1IJJ A;  3P31 A;  3LM2 A;  1ESV A;  4BR0 A;  2HBJ A;  3UB5 A;  4AF1 A;  3CME N;  3CQX A;  2A40 A;  4HTL A;  3CHW A;  3MN7 A;  2BTF A;  4DCH A;  3FGU A;  1NGH A;  4H5T A;  1XUP O;  3DXM B;  3VMF B;  4B1V A;  3VEX A;  1R59 O;  5HL7 L;  5AQM A;  3VF4 A;  1N8R O;  2PAV A;  2QWP A;  3LDP A;  4RTF D;  4DHY A;  2CGJ A;  5LJW A;  3FE1 A;  3ENB A;  1VQ8 N;  3CER A;  4CZJ A;  2DPN A;  2WBN A;  2P9P A;  3D2E A;  3IDH A;  4JHD B;  4QS8 A;  2QA4 N;  1KXP A;  1VQO N;  3M5R A;  4BVO A;  2HBK A;  4CZM A;  1RFQ A;  4CZE A;  5C2D A;  3CMA N;  3M1F A;  1U2V B;  3ZX3 A;  1JCG A;  5AQP A;  3CET A;  4MDA A;  1HKB A;  4H0O A;  2HST A;  2FSJ A;  2Q36 A;  4A2A A;  3GOI A;  3CF5 L;  4PKG A;  3T69 A;  3C7N A;  3R9P A;  3ZX2 A;  3ENO A;  2IVO A;  1TYQ B;  1QZ5 A;  2E2Q A;  1KAY A;  2NRW A;  3R1X A;  4IDH A;  4MLH A;  5AQT A;  3ULE B;  4B1Z A;  2VWB A;  3TTC A;  5B8H A;  4WYB A;  3L0Q A;  2ZGZ A;  5BN9 A;  5GAD P;  1KQS M;  4I6M B;  3P4I A;  5ELZ A;  2ZJP L;  3FR0 A;  2OTL N;  4JNE A;  3U8X A;  1NBW A;  1BWF O;  5C15 A;  1MWK A;  2QM1 A;  5GAG P;  3EE9 A;  5FPE A;  5AQK A;  4B1U B;  4BRI A;  4OO1 J;  3UKR B;  5AQG A;  2NLX A;  2V52 B;  2NZT A;  2YI1 A;  3O9U A;  2FXU A;  3HOS A;  4IOX A;  1VAZ A;  1BA1 A;  5AFU A;  3QFU A;  3BEX A;  2BUP A;  1J6Z A;  3KVG A;  4FO0 A;  3J7Z O;  5AQW A;  1P90 A;  3CC2 N;  3J8A A;  3M6G A;  1BDG A;  1Z05 A;  3FZL A;  1Y64 A;  2WUS A;  5AFU H;  3VET A;  3A5N C;  4FWQ A;  5AR0 A;  1BA0 A;  4Z94 A;  3T7Z A;  3BF1 A;  3EN9 A;  3PLA A;  3EL2 A;  5AQQ A;  3O6W A;  2BH1 A;  4IEE A;  3G4S N;  2ZWH A;  2E88 A;  3VF2 A;  2ASM A;  4PL8 A;  3CCJ N;  1T6C A;  3O8M A;  5C12 A;  2FSN A;  3OA9 A;  5C2F A;  4ISF A;  3OHR A;  4EAH D;  1VQP N;  4ISG A;  4FWL A;  4L3Q A;  4BR7 A;  5TKW A;  3VEW A;  4H03 B;  4BEB A;  3SAG A;  3DJC A;  2P9K A;  5AQH A;  3D6R A;  1YI2 N;  3C7N B;  1BO5 O;  3CCV N;  2E2P A;  3CXC M;  2VYP A;  2NRZ A;  3MN9 A;  3CI5 A;  3VF6 A;  3WQT A;  4CI6 A;  3HSC A;  1K9M O;  4FWR A;  3IKM A;  2NRV A;  1YJW N;  4A62 A;  3G25 A;  1QZ6 A;  4JHD A;  4QS9 A;  1DKG D;  1P8Z A;  1MWM A;  3O1B A;  3GG4 A;  4ILJ A;  3U9Z A;  4C23 A;  4IZ9 A;  4K41 A;  1EO1 A;  4YOX A;  1GLJ O;  4FWN A;  5E84 A;  2V7Y A;  5CE3 A;  3TTF A;  4JEP A;  4GV9 A;  4F9O A;  5KPZ A;  3U4L A;  4NLC A;  1GLD G;  4ISE A;  4JKD A;  4AM6 A;  3E1Y A;  5AQX A;  3C6H A;  1K8K B;  1H1V A;  3H3N O;  3LDL A;  4BRL A;  1Q81 O;  4BGB A;  3H3O B;  4CZF A;  2Q0U A;  4H5R A;  4BQL A;  2I7N A;  1NMD A;  1JCE A;  4DQ8 A;  4B1X B;  4YDU C;  4B1W B;  3SBG A;  4B9Q A;  2IVP A;  3ZYY X;  3GL1 A;  4XH1 A;  3FZF A;  3VEO A;  3LDN A;  3R6M A;  2VGM A;  3L6Q A;  1RDU A;  4A57 A;  4HWI A;  3TSQ A;  1BG3 A;  3FZM A;  3SAH A;  2QEX N;  3JXU A;  1TUU A;  2I7P A;  3O5B A;  2JWK A;  5AQF A;  1SAZ A;  4CD1 A;  3ATV A;  4WCE L;  4E1J A;  1G99 A;  4FWP A;  5KQD A;  2D4W A;  1NGA A;  3DLL L;  5AQZ A;  1BU6 O;  2A5X A;  3L4Q A;  1RGI A;  3UKR A;  3VGK A;  5HOO A;  3MN6 A;  3QFP A;  1BOT O;  1HX1 A;  5EX5 A;  1K73 O;  2OTJ N;  5BRD A;  2P9K B;  1YIT N;  3VTH A;  2E2O A;  4ILG B;  2HF4 A;  3E9L A;  5AQN A;  1V4S A;  2NNW A;  3ENH A;  4Y0W A;  1HKC A;  4H0T B;  3QIC A;  3CCS N;  4G9Z A;  3OBW A;  3VGL A;  5F0X A;  1D4X A;  1VQK N;  3HI0 A;  4B1Y B;  2Q97 A;  3HTV A;  3EZW A;  4BRA A;  5GAH P;  3LL3 A;  4CZK A;  4JKE A;  2P9N A;  1GLE G;  1NGD A;  3AY9 A;  2Q0R A;  3CQY A;  4BC3 A;  3WXI A;  1C0G A;  3G71 N;  2ZF5 O;  2A6A A;  3KWI A;  4MDB A;  4BRM A;  4JK8 A;  5LJV A;  5BRF A;  4K42 A;  3O9R A;  1MA9 B;  1U6Z A;  3EKS A;  5KPT A;  3CCE N;  1YAG A;  4GVE A;  3R3L A;  4BR5 A;  1BUP A;  3CCL N;  4BQZ A;  4C1N K;  5MLC Q;  4BRP A;  3QML A;  1VQ4 N;  3ID6 A;  2J4R A;  4BC2 A;  3CC4 N;  1S72 N;  2HOE A;  1SZ2 A;  2AP1 A;  2UYT A;  2YHY A;  3WXK A;  2E20 A;  1W97 L;  4FSV A;  3O9S A;  3VGM A;  2EWS A;  5EXW A;  2H3G X;  2QXL A;  1NGB A;  2CGL A;  2WC9 A;  1NJI O;  5JLF A;  3HRG A;  1T3V A;  3A8Y A;  1T44 A;  2F7T A;  1GLB G;  4JKB A;  1DT9 A;  4BY9 C;  5JVG L;  1K8K A;  4JKA A;  1VQL N;  4BE7 B;  2CH6 A;  1HKG A;  4IOA L;  4LC9 B;  1WOQ A;  4U67 L;  2NRR A;  3MCP A;  5LY3 A;  3FZH A;  1Q18 A;  2HF3 A;  2RE2 A;  3MDQ A;  4O8K A;  4CZI A;  5BPN A;  3CPE A;  3O4W A;  4GY2 B;  1NM1 A;  1QQO A;  2QWL A;  3ZET A;  1YJN N;  4XEI A;  2QWQ A;  1GLF O;  4WQ4 A;  2P9N B;  4XJX A;  3MN5 A;  3A5O C;  3KHY A;  4BG9 A;  5F2R A;  3VEY A;  1ATR A;  4WQ5 A;  3VER A;  2YHX A;  3QBW A;  3CJ7 A;  3AAR A;  4GNI A;  4O8U A;  5AZJ A;  2Q2R A;  1HJO A;  1V4T A;  1YIJ N;  2NRT A;  2Q1N A;  3TPQ A;  1XC3 A;  4OPH A;  1YHQ N;  1QVF M;  1YJ9 N;  2D0P A;  5M1O A;  5EVZ A;  1NGG A;  2W00 A;  4KBO A;  3RVC A;  4JD2 A;  3VEN A;  3CCU N;  1YVN A;  1QVG M;  4FOI A;  3CC7 N;  2E2N A;  4IJA A;  3UE5 A;  3NVK A;  4JKG A;  4H0X B;  1KC8 O;  2QWN A;  3LDQ A;  4FWO A;  2YX6 A;  5BPM A;  3W0L A;  1VQ6 N;  1HLU A;  4AM7 A;  3MMV A;  5GIN A;  4NO7 A;  2YJF A;  3HM8 A;  5M1Q A;  2VGN A;  3MWP A;  2A41 A;  1CZA N;  4PL7 A;  4MO4 A;  4BRG A;  4PKH A;  2P9U A;  5C10 A;  3QDK A;  2P9I B;  5AQL A;  4CZL A;  4BRQ A;  3LM9 A;  3HZ6 A;  3D2F B;  3K9J A;  2E8A A;  3ID8 A;  4C1N I;  2F9W A;  2KLA A;  2KHO A;  3LDO A;  2GTD A;  4BRD A;  4M7X A;  3AAP A;  1EQY A;  1LCU A;  1SS6 A;  2VCP A;  2HBM A;  4RCH A;  4MLE A;  2FF6 A;  1NGC A;  3W3D A;  3H1Q A;  4JKF A;  1OKJ A;  3ZET B;  4CJ7 A;  2FF3 B;  3PIP L;  1X9J A;  3BUZ B;  5GAE P;  3EO3 A;  1ILY A;  5I9E B;  4FPB A;  4H0V B;  3TSP A;  4WFA L;  5ADX A;  3IMX A;  3KK7 A;  4FOE A;  1XQS C;  3DXK A;  5AQO A;  3VTI A;  2FLO A;  3I33 A;  3DAW A;  4DKW A;  4YOW A;  2PFU A;  4H5V A;  4MO5 A;  3SMS A;  3DWL A;  3BF3 A;  3TU5 A;  1C0F A;  5AZJ B;  4WF9 L;  4PHT X;  3O1W A;  5AQY A;  3AGR A;  1ZXO A;  4O5F A;  3IUC A;  4PKI A;  2GEM A;  3H6E A;  3HBT A;  2HBL A;  2JWL A;  2RHK A;  1K8A O;  2QW9 A;  2ASO A;  1DGK N;  2YJE A;  4JD2 B;  5E26 A;  4EHT A;  3C0B A;  3CPW M;  4M7Y A;  1RDW X;  3VEZ A;  3VPZ A;  3EKU A;  4JKG B;  1YXQ A;  2NRH A;  5EOY A;  4FWM A;  5AQU A;  1NGE A;  3E9P A;  3K9K A;  5CHI A;  4IXC A;  2ZJQ L;  2A42 A;  5M1K A;  5DM7 L;  5JLH A;  3MX2 A;  4KH4 A;  4A5B A;  2WFB A;  1HUX A;  4IEI A;  4EIA A;  4JK7 A;  4KH5 A;  3CCR N;  2ITM A;  4FVU A;  5KPR A;  4BVP A;  1M90 O;  2P9U B;  1VQ7 N;  3L4I A;  2AA4 A;  5BN8 A;  1ATS A;  2C1G A;  5KQ8 A;  4A61 A;  4CBU A;  5AZI B;  1NGJ A;  2ZJR L;  1M1K O;  2KKZ A;  3CJ9 A;  3F9M A;  4UY8 O;  3H46 O;  3FFK B;  4QS7 A;  4BRN A;  1YF5 L;  3Q7C A;  3O80 A;  2V51 B;  1TUY A;  4A2B A;  1E4G T;  4FL9 A;  4CBX A;  4H0Y B;  2GEL A;  3I56 N;  2D0O A;  2ASP A;  2YHW A;  5AQJ A;  2C1I A;  5CR4 A;  3OW2 M;  3UKU A;  1WUA A;  3A5L C;  3TTD A;  1KAX A;  5BRE A;  3JS6 A;  3WXM B;  3F2K A;  1HPM A;  4YOR A;  4CZG A;  4BR4 A;  3AGK A;  3H45 C;  4EFH A;  3GBT A;  3A5M C;  3DXK B;  4EHU A;  2P9I A;  3MK6 A;  5FPM A;  2Q31 A;  5AQI A;  2GWK A;  1NGF A;  3QB0 A;  1SQK A;  3D2F A;  1VQM N;  2P9S A;  4XH4 A;  5AQV A;  3Q7B A;  4BR9 A;  4DB3 A;  4WFB L;  1GLA G;  3C6A A;  1O13 A;  3NMU A;  4BRC A;  2OAN A;  3CCQ N;  4IO8 A;  3KWG A;  3P38 A;  4BGA A;  4BRO A;  3ATU A;  3GE1 A;  1S3X A;  1MDU B;  4YOY A;  4KH6 A;  5JMV A;  3ZEU A;  3CIP A;  2P9L B;  3E66 A;  3RSE A;  2GUP A;  2HMP A;  4WQ4 C;  5GIP A;  1KD1 O;  3C65 A;  3HOT A;  4WFN L;  3BP8 A;  3N4P A;  3S41 A;  4BRE A;  3VOV A;  5F1X A;  4JKC A;  1VQN N;  4WQ5 C;  1GLC G;  3VEV A;  3FZK A;  4IFE A;  5H1S Q;  4H5N A;  3MWT A;  1ZC6 A;  2ZGY A;  2W41 A;  5C0Y A;  4XH5 A;  4BC5 A;  4BR2 A;  3CJ1 A;  4FWK A;  2GWJ A;  4JK9 A;  3GDQ A;  5M1P A;  3R8E A;  4YOV A;  2CH5 A;  5GIO A;  3B8A X;  3CD6 N;  1S22 A;  3OBY A;  3WEE A;  4FPA A;  1VQ9 N;  2E1Z A;  4K43 A;  1E4F T;  3QBX A;  1LOT B;  1NLV A;  5M1N A;  3M3Z A;  3MX5 A;  5BRH A;  1Z6R A;  4OPA A;  4GV3 A;  5AQS A;  3D2E B;  2P9P B;  3N4Q A;  1DEJ A;  5DM6 L;  3G6E N;  3H1V X;  5BPL A;  3P39 A;  3WT0 A;  2A3Z A;  1X3N A;  3UKU B;  3O08 A;  3O9T A;  5TKY A;  1Q86 O;  2V7Z A;  1Q82 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...