4XEIA

Orthorhombic isomorph of bovine arp2/3 complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
415
structure length
400
Chain Sequence
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Crystals of the Arp2/3 complex in two new space groups with structural information about actin-related protein 2 and potential WASP binding sites.
pubmed doi rcsb
molecule tags Structural protein
total genus 102
structure length 400
sequence length 415
ec nomenclature
pdb deposition date 2014-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 4xeiA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4xeiA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4xeiA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4xeiA04
1BA0A 3TU5A 2CGLA 3BEXA 4A61A 4AM7A 4BREA 5BREA 4JD2A 2Q31A 3H1QA 4PKHA 4QS9A 3QB0A 3MN6A 5BRDA 2P9UB 3O1WA 3M3ZA 4ISEA 4FOEA 2D4WA 1NGDA 1NGIA 3GBTA 2FSNA 2NZTA 4I6MB 4BRQA 4BRAA 3HBTA 2CGJA 1HKBA 3FGUA 3VEVA 3KZBA 3VGKA 3J8AA 3SMSA 4FWRA 3H46O 4PL7A 3ZEUB 4CZFA 3LL3A 1NGJA 4EAHD 1SAZA 4XH1A 3IMXA 1RFQA 1BWFO 3ZETA 2HF4A 3CJ9A 3CJ7A 2FF6A 2ZWHA 3WUHA 4BC4A 3GOIA 2Q0UA 4CBXA 2CH6A 2VWBA 5AZIA 4CZJA 1GLBG 4MO5A 5AQYA 3MK6A 3H1VX 3EKSA 5AQZA 5BPNA 3DWLA 4C23A 1V4TA 3FFKB 2P9NB 2Q0RA 4DQ8A 5AR0A 1BU6O 3CJAA 4BGBA 4JD2B 1G99A 4B1UB 4B1XB 3ZX2A 2GWKA 3C0BA 1YAGA 3DXKA 4H0VB 4Y0WA 1NGHA 1U2VB 3WXKA 3BP8A 3D2FB 4FSVA 1NGFA 2QM1A 3VEXA 4H0PA 2YHXA 1MA9B 3LDLA 4BC3A 3HSCA 4YDUC 3QDKA 2ZGYA 4CJ7A 4FWMA 2P9IA 5AQJA 1GLEG 1E4FT 5LJVA 4KBOA 1GLFO 3B8AX 5AQHA 3CJCA 2P9PB 2GEMA 4BR2A 3HZ6A 3MN7A 4IJAA 3HM8A 4WYBA 3A8YA 2YJEA 3U9ZA 1Z05A 1XUPO 4WQ4C 1BDGA 5AZIB 2E2QA 2QWMA 1MWKA 1QQOA 3FZFA 5AQFA 4MLHA 1T6DA 3MN5A 3FE1A 3KVGA 3IFRA 4BRIA 3FZHA 3JS6A 4XH5A 3ZX3A 5AQXA 2I7NA 3W0LA 5CE3A 4NB4A 5AFUA 3DXKB 2YJFA 3VGLA 2NLXA 2V52B 2Q97A 3CJ1A 4BR5A 2ZGZA 5BPMA 1NMDA 1YVNA 4XH4A 2ASMA 1X3NA 4FPBA 1QHAA 4E1JA 3KHYA 3GE1A 4BGAA 4BROA 5LJWA 1DEJA 4FWSA 4FWOA 1QZ5A 3R9PA 4IJNA 5FPDA 2F9TA 5EXWA 3H3NO 4BG9A 4H5NA 4L3QA 3O4WA 3VPZA 4BQLA 3IUCA 1HLUA 4A2BA 5KQDA 5KQ8A 1P8ZA 3CETA 4CD1A 4CI6A 1NGCA 4BG8A 2FSKA 2QWRA 3D2EA 4BRKA 2J4RA 3ATUA 1CZAN 3A0IX 3LM9A 4H0OA 4EFHA 2A42A 1OKJA 2P9NA 2Q36A 3AAPA 2P9SB 5TKYA 4BRMA 4H0XB 4CZHA 5EVZA 3EKUA 5JMVA 2P9LB 1U2VA 3QFPA 2VCPA 3D2FA 5KPZA 1KAXA 3ID8A 1S22A 2GWJA 3TPQA 5BN9A 1R59O 2A6AA 2AA4A 5ELZA 4BVPA 2IIRA 4BRPA 3EZWA 3WQTA 3VESA 5B8HA 1EQYA 4M7YA 2P9PA 3P4IA 4PKGA 4FL9A 3S41A 4WQ5C 3SK3A 2FXUA 3QBXA 2E2NA 4IXCA 2GTDA 4FWPA 3VEOA 1TUYA 1ATRA 5AQIA 3R8EA 3U8XA 4H5WA 5JLFA 4B1ZA 3AY9A 4B9QA 4CZLA 3D2EB 1XQSC 4LC9B 4IO8A 4BC2A 5AZJA 1ESVA 3WXLA 1T6CA 2V7YA 5AQOA 5KPRA 2IVNA 5E84A 3M1FA 3WEEA 3ULEA 4JNEA 2QWOA 3CJBA 4QS8A 3VEWA 3QFUA 3LDOA 4B1VA 4BVOA 3F9MA 3I8BA 3AAQA 4K25A 4CBUA 3O5BA 4K41A 3HTVA 2V7ZA 3CI5A 4ISFA 4BRNA 3VF6A 3DXMA 1BG3A 3R6MA 4GNIA 3H3OB 3A5NC 4FWLA 1JCGA 4HTLA 4BR9A 4EHUA 2A5XA 3BUZB 4ISGA 3U4LA 2A41A 4B1WB 4H0YB 5AQSA 3SJHA 3ENHA 4YDUA 1K8KB 5BR9A 4DB3A 3QMLA 3WT0A 1C0FA 4CZKA 4F9OA 1ATNA 2ASOA 4JN4A 3CHWA 3UKUB 5JLHA 3G25A 5AZJB 2W40A 4FOIA 3WQUA 1SZ2A 3FZMA 4FO0A 3VGMA 2ZF5O 5ADXA 3WEEB 3L4IA 3VENA 3ULEB 2E2PA 4H5TA 3O80A 2PAVA 2IVOA 1E4GT 2H3GX 4WQ4A 1NGEA 3FR0A 1V4SA 4FWNA 5AQRA 5F2RA 2D0PA 3UKRA 2P9SA 4QS7A 4BRDA 4BRLA 2P9LA 3H45C 2BTFA 3DXMB 1GLCG 4H5RA 1H1VA 2VYPA 1BUPA 3M6GA 2FSJA 4CZMA 2HOEA 2YCHA 1GLDG 4J8FA 2YI1A 1T44A 1GLAG 4AM6A 4BQZA 4NO7A 2QXLA 1QQNA 4PL8A 5AFUH 3WXJA 3CERA 4CZGA 4CZIA 2FLOA 3O8MA 4IWVA 2BUPA 2CGKA 3L0QA 5AQVA 3O08A 4Z94A 2FF3B 4BR4A 3AARA 1IJJA 3GG4A 1X9JA 3LDNA 3VF2A 3L6QA 5AQKA 4H0TB 4RTFD 2E88A 1QQMA 3MN9A 3MMVA 3CQYA 1KAZA 5FPMA 3UKRB 3GDQA 2P9KA 5AQMA 2QWNA 1ZC6A 5AQWA 5AQUA 4BC5A 5EOYA 3QICA 1JCEA 3UE5A 4EHTA 4B1YB 4BR7A 3H6EA 1ZXOA 3A5MC 1NWKA 2UYTA 4BRFA 4HWIA 1GLJO 2HMPA 1IG8A 2D0OA 1JCFA 3W3DA 3O1BA 4DHYA 4IZ9A 4O5FA 4M7XA 1DGKN 5FPNA 1YXQA 3ATVA 2ITMA 4FWKA 5LY3A 1K8KA 2I7PA 4A62A 1Q18A 3VOVA 3UKUA 4O8KA 1XC3A 3ENOA 2V51B 1KAYA 2OANA 3QBWA 3SMPA 4K43A 1S3XA 4WQ5A 3VERA 4DCHA 5AQNA 1DKGD 3BF3A 1J6ZA 2P9KB 4FWQA 5JICA 4BRCA 2AP1A 2CH5A 2IVPA 5AQPA 2E1YA 3CQXA 3U9DA 3LDPA 1HUXA 2YHYA 4M63C 4MLEA 3DJCA 3EN9A 4BR0A 2HF3A 3FZKA 3EO3A 3SLCA 3C7NA 3A5LC 1RGIA 4CD3A 4MO4A 3VEYA 1HX1A 1U6ZA 5E26A 4JHDA 1ATSA 5F0XA 2F9WA 1NGGA 3VETA 1LCUA 3MCPA 4A2AA 1BA1A 5AQQA 2QW9A 5KPTA 5BN8A 1NM1A 4BRHA 4RWTA 4CZEA 1D4XA 5BPLA 1Z6RA 2KHOA 2QWLA 1YUWA 1TYQA 1NGAA 3LM2A 1WUAA 1HKGA 2E1ZA 2YHWA 4H5VA 2E2OA 3FLCO 3ZETB 1Y64A 3CIPA 2WUSA 3I33A 5BRFA 5EX5A 5F1XA 5FPEA 1TUUA 4PKIA 2ASPA 4RCHA 1LOTB 4GY2B 4BRGA 2GELA 2D1KA 4K42A 2PBDA 4XEIA 5AQTA 4FPAA 3MDQA 1WOQA 2A40A 5EY4A 3HI0A 3C7NB 3RSEA 1RDWX 1GLLO 2EWSA 3LDQA 4JHDB 5ADXH 5AQLA 1BO5O 3WXIA 1HJOA 2QWQA 3JXUA 5BRHA 4CBWA 3O6WA 2QWPA 1MDUB 3ZX0A 2Q2RA 2P9UA 2NRHA 3IDHA 3VEZA 1NBWA 1TYQB 1C0GA 2P9IB 2A3ZA 1MWMA 4I6MA 1HKCA 3VF4A 3DAWA 1SQKA 1NGBA 1BOTO 3EL2A 3OHRA 3BF1A 1QZ6A 2GUPA 4JAXA 3D7EO 3ZEUA 4EIAA 2DPNA 2W41A 2E20A 3A5OC 5I9EB 1HPMA 3UB5A 1ZBSA 3FZLA 3RSEB 2E8AA 1KXPA 3GL1A 1NLVA 4H03B 2Q1NA 1X3MA 5AQGA
chains in the Genus database with same CATH superfamily
4A61A 3QEWA 1SL1A 4JD2A 3J7ZO 4QS9A 4R5PA 3QB0A 2P9UB 3O1WA 1YJ9N 1NGDA 3V1RA 4M3UA 2FSNA 3QEXA 1YF5L 4GV9A 4CEZA 2NZTA 4BRQA 1A5XA 4CFBA 4G9ZA 5M1QA 4DR5K 3KLHA 3VEVA 1XNQK 4CEQA 3SJJA 4FWRA 5C12A 5CR4A 1BQMA 3ZEUB 3E66A 4CEFA 3LL3A 1SAZA 3S5TA 3AGKA 1RFQA 2W42A 3ZETA 4BE1A 3ZT3A 2ZWHA 3TTCA 3NF9A 4C1NI 4CBXA 4KO0A 1REVA 5AQYA 4IDHA 3H1VX 4BE0A 3ZT1A 4GW6A 1ILYA 4BWJA 4DQ8A 4IOCL 3NH2A 1G99A 3QEPA 4KI4A 1UA1A 3NF7A 3DXKA 3WXKA 4BC3A 3HSCA 1GLEG 5LJVA 2VG5A 1BQNA 4KBOA 4CJ3A 2X6NA 4KPYA 1JLGA 5AQHA 3CJCA 1VQ9N 2ZJQL 1VQ5N 3VTHA 3OJSA 4A59A 3I0SA 1RTHA 3G6EN 2O8EA 1VRUA 5AQFA 1EO1A 3FE1A 1NOYA 3LWMA 3S3OA 4BRIA 3FZHA 3AO3A 4Q0BA 3LP1A 4U7BA 2C1IA 3V6DA 4BDYA 1EP4A 4NB4A 4F3OA 3VGLA 2YJFA 3CFPA 2NLXA 4N47A 2VG7A 3CJ1A 2HW3A 5BPMA 1NMDA 2ITGA 4XH4A 4KB0A 3TAGA 2ASMA 1VQMN 2A1SA 4MDAA 4N56A 4E1JA 2DTUA 4BEBA 4W5OA 1YT3A 4FWSA 3V9XA 4IJNA 3THYA 3CCUN 5T7BA 3H3NO 3E1YA 4FM0A 3VPZA 1IO2A 1RTJA 3JYTA 1D9FA 3KK1A 2QEXN 3I8DA 2FSKA 1RT4A 3D2EA 4BRKA 4M41A 3OYJA 2A42A 4HTUA 1VQON 2Q36A 3K59A 3KIOA 2P9SB 1YJWN 3EE8A 4CEDA 2E6LA 1QVFM 3EKUA 3QIPA 4OGCA 4DQSA 4CEEA 3KD1E 1DLOA 3QFPA 1KAXA 5TKWA 1B9DA 1S22A 4AF1A 3CCSN 1WB9A 1UWBA 2GX9A 4CK2A 3CM6A 4CK1A 1IKVA 4M45A 2IIRA 4BRPA 3EZWA 3NVKA 2HBMA 3ZSYA 2P9PA 3S41A 4B9NA 4FL9A 2HVHA 3ITHA 2D0BA 4B08A 3SK3A 1Q81O 4DU3A 4IXCA 4FWPA 4CGGA 3PY8A 4KI6A 1U04A 3KWIA 3D6RA 3B6PA 3U8XA 4JKGA 3P31A 5GIPA 5AZJA 4KHSA 2PZSA 3DYAA 1RT3A 1IH7A 2IVNA 2GBZA 3VEWA 1N33K 2O8CB 3QFUA 1RTIA 4O55A 3SAHA 1Q7YO 3I8BA 2F8SA 3O5BA 4KHUA 4K41A 2V7ZA 1UA0A 5KGWA 1BG3A 3R6MA 5GADP 3H3OB 3A5NC 1HJRA 4HTLA 1QVGM 5IT9O 1TAUA 4FK2A 3RMAA 3U4LA 2A41A 4B1WB 4CEOA 2XY7A 4H0YB 5AQSA 2X6SA 4IG0A 4KTZA 4CIFA 3OYMA 2ETJA 1QSSA 2HBLA 4DB3A 1NKCA 3WT0A 5JLHA 1ATNA 2QI2A 2W40A 1T03A 2NRRA 4FOIA 3VGMA 2ZF5O 5ADXA 3WEEB 3L4IA 3RMDA 2E2PA 3O80A 3P1GA 4OGEA 4DTJA 3ENBA 3CC2N 3ZSZA 4GMJB 3DRSA 4FWNA 4DV2K 2FBTA 3THXB 4YOTA 4DQQA 3THVA 1YITN 4F2RA 3QESA 4M3WA 4XJXA 4NCBA 1B9FA 1X9MA 1GLCG 4TSXA 5DK5A 1U47A 1H1VA 4DMNA 1BUPA 1ZYQA 1ASWA 2HOEA 1GLDG 5C15A 2YI1A 5K14A 4PL8A 4M3YA 1FKOA 2F4VK 5HBMA 4DV1K 4R79A 3C94A 3NF8A 2DFHA 2O4IA 4GKKK 2Z1HA 4BDZA 4CJUA 3VF2A 4EZ9A 3O3HA 3PLAA 2BE2A 3SQ4A 3AO1A 3CQYA 2QA4N 1KAZA 3CYMA 4BC5A 5AQUA 3C6TA 3SCXA 3NVMA 2OZMA 3DLLL 4B3RK 4AHCA 4B1YB 4BR7A 3HRGA 3H6EA 3UIQA 4ELUA 4KV8A 4PY5A 3LZJA 1SV5A 1VSIA 2XY8A 4DR4K 2ZJPL 4CF8A 3C6AA 4ELVA 4O5FA 4M7XA 4Y1CA 3P39A 4V19S 1YTAA 3RMBA 2ZQBA 1VSHA 3CCJN 3T3FA 4FWKA 3E9LA 3NAEA 3SUQA 4DQPA 4CJVA 4IEEA 3ENOA 1NK9A 4FVUA 2YKNA 2VG6A 1C1AA 2D5RA 2P9KB 1OH7A 2AP1A 1Q86O 4ICLA 3O9UA 3K2PA 2IVPA 4YY3K 1U4BA 1VSFA 4FJKA 3VQ6A 4JS4A 4MLEA 4M63C 3IKMA 5DM6L 3SPZA 1N36K 1QSYA 4DS4A 1J5EK 1VQLN 2HF3A 1J54A 4CJRA 5JENA 3SLCA 1JXEA 4OKEA 3TANA 1RGIA 5E26A 3I56N 1ATSA 5H1SQ 1NGGA 2O8FA 1LCUA 3MCPA 1JLFA 2QW9A 3MWTA 3MCAB 4CGDA 5BN8A 3RMCA 1NM1A 4BRHA 4RWTA 1VSLA 3R1XA 2OTJN 3BY5A 4OLAA 1CXQA 2YNHA 2ZM6K 1HKGA 2X74A 4LFAK 2E1ZA 2YHWA 4OLBA 4E7HA 1K73O 1KFDA 3ZSWA 2UXDK 2WUSA 4CJ4A 3I33A 5F1XA 5FPEA 1TUUA 4KAZA 4PKIA 4XEIA 1LWCA 4OPHA 1K9MO 4KH4A 3OBWA 3MDQA 4CGIA 3I0RA 3C7NB 4AHSA 1NJYA 1RBUA 4F2SA 4JHDB 3ZSVA 5ADXH 4JYAK 5AQLA 1S72N 4X66K 1LWEA 4DTNA 1XC9A 3AV9A 2R7YA 2P9UA 3TWHA 3ISNC 3VF4A 1HKCA 4ZTFA 1EWQA 4YHHK 3O9RA 5SZTA 3BF1A 4DR3K 3CC7N 4J2DA 5GAGP 5DM7L 1Q8IA 4JAXA 1KLMA 3ZEUA 5FLXO 1RDCA 1QQCA 1T3VA 2W41A 3BZCA 5HRNA 5I9EB 1HPMA 3UB5A 1RBVA 5JVHL 1RT2A 3FZLA 1IKYA 5JS1A 4FW2A 4LF8K 3HPOA 1NLVA 3RR7A 4DV6K 4CESA 4CJLA 2ZD1A 5EOYA 2PFUA 4PUOA 1BA0A 3F5TA 3MEGA 5BREA 5KRTA 4EZ6A 1QTMA 2D4WA 1NGIA 4FM1A 5J2QA 4KHPK 1LAVA 3OS1A 4KHQA 4O0IA 4FZZA 1BISA 3NFAA 3AA3A 3KZBA 3J8AA 3SMSA 5LMUK 1HNXK 3KTQA 4HVJA 1OH5A 4PL7A 4JK8A 5GAHP 2OZSA 4DTXA 4CZFA 1OH8A 1NGJA 3KK3A 3P5JA 2FBVA 5LMNK 2VWBA 1OVYA 5CZ1A 4UY8O 1IV0A 3EKSA 5AQZA 5BPNA 3DWLA 2OPSA 1U48A 3FFKB 1GOAA 1T05A 3TARA 1YTUA 4FJIA 4B1UB 4B1XB 3ZX2A 2GWKA 3C0BA 4WFBL 4Y0WA 1XI1A 3D2FB 4FSVA 3HM9A 4H0PA 3CC4N 4IFEA 4CHZA 4YDUC 3QDKA 2ZGYA 4F3TA 4FXDA 2P9IA 5AQJA 4DTMA 4JI1K 1E4FT 2HHIA 1S6PA 3B8AX 4DSJA 3HZ6A 4JK9A 4IJAA 3HM8A 4AHTA 1IG9A 2DY4A 1NNEA 1IBKK 2QXFA 3U9ZA 3OYNA 4WQ4C 1QQOA 2P5OA 1T6DA 3MN5A 3NMUA 3U3GA 3JS6A 1BCOA 4XH5A 2NRXA 3SZ2A 5AQXA 2I7NA 4DUZK 4FJ9A 3W0LA 5I42A 3NDKA 3KLGA 1XNRK 1W2BM 3QO9A 4GKJK 1S9EA 4CERA 1L3VA 1KVAA 2HNZA 3V81A 3CCVN 1RBRA 3G4SN 3CPEA 4RW7A 5LJWA 3VA3A 1CLQA 4FJ5A 4OKJA 1L3TA 3DI6A 5EXWA 4X62K 5DMRA 4CJTA 2QKBA 2NUBA 4A2BA 5KQ8A 4FJGA 4J2BA 4CI6A 1NGCA 4BG8A 2QWRA 1KCFA 1ZBHA 3LANA 4LY7A 4AH9A 1CZAN 3A0IX 3LM9A 4X64K 4WF9L 2P9NA 2Y1JA 3AAPA 5TKYA 5EVZA 5C24A 2O8CA 2P9LB 4NYFA 1J5OA 4FK4A 1U2VA 4I2QA 3H08A 5GAEP 4Z4HA 1FK9A 1VQ4N 1R59O 2HHHK 2AA4A 3LP0A 4CJQA 4CHQA 1EQYA 4M7YA 3P4IA 2DFEA 5BR8K 3QEVA 2P1JA 3FFIA 3D0PA 4JK7A 1YVUA 3VEOA 2I5JA 4DSEA 4CIEA 1TUYA 5AQIA 4DTUA 5JLFA 3AY9A 4B9QA 4WFNL 3WXLA 1T6CA 2V7YA 5KPRA 3HVRA 4DR7K 3HP9A 1W7AA 3WEEA 4JNEA 3DLKA 3CJBA 4DV0K 4FVMA 3HXMA 3R3LA 2W00A 4C8MA 3MX2A 3IS9A 3THXA 3CCEN 4CBUA 4IOAL 3OYAA 3TAEA 3HTVA 5CYMA 3SAFA 3TAQA 4DFKA 1TVRA 4GNIA 4BE7B 1RBSA 2VGNA 4EHUA 3TSUA 3BUZB 4WFAL 4ISGA 3C6HA 4JI3K 4LH4A 4JI8K 1RDBA 4JV5K 4YDUA 1K8KB 5BR9A 1C0FA 4JN4A 3K5MA 3QETA 4Z4IA 3AO2A 4M3TA 3AVCA 4DTOA 2A1RA 3C6UA 3EEQA 4M3ZA 5HRPA 3TAPA 4A5AA 1VSDA 2Z1JA 4DSFA 4FZXC 5FRNA 4NXMK 4WQ4A 1C0UA 2VQEK 1XHXA 5F2RA 5AQRA 2C1GA 4FJ8A 4CJSA 4IFVA 2Z1GA 2YV0X 3V9SA 3DRRA 3PIOL 3ZSOA 1K6YA 3O9QA 1C1BA 1Z26A 2VYPA 2FSJA 1NKBA 5SWMA 3NBPA 3OYGA 1RILA 4FJ7A 4BQZA 4N76A 3MECA 3WXJA 3CERA 2FLOA 3O8MA 2XO7A 3E9PA 3L0QA 4NXNK 3O08A 1WAFA 3O4QA 4BR4A 3GG4A 3ZT2A 1X9JA 1YI2N 1TL3A 4JI2K 5AQKA 4H0TB 3SV3A 3MN9A 4DFPA 1NKEA 3TAFA 2YNGA 4QCLA 1WSEA 4CJPA 5FPMA 3WNGA 2G8KA 3NGIA 2P9KA 5AQMA 3NCIA 3QICA 2YX6A 5FROA 5D3GA 1HNZK 1LW2A 1Q9XA 2D0CA 2OA8A 4KRFA 4W5NA 1L3SA 1ZXOA 4CJ5A 4O0JA 4KB1A 1IG8A 4IO9L 3W3DA 3AA4A 4IZ9A 1WN7A 1S1XA 5FPNA 1JL2A 1MU2A 3ZLJA 1DTTA 4AHRA 4O5BA 4CFAA 4AQYK 3UKUA 2QKKA 4CIGA 2O8BA 1JLAA 1OVQA 1XC3A 2V51B 3QBWA 1VQ7N 4K43A 3DM2A 3OYFA 3OYIA 2XY6A 1S3XA 4DQIA 4DCHA 3SYZA 3BF3A 1BI4B 1J6ZA 4NCAA 3V4IA 1LWFA 4DV7K 4JKFA 4CGFA 4OPJA 2CH5A 3G71N 3VQPA 4AHUA 4JKCA 1RT6A 2G8WA 1IBLK 3DJCA 3K0SA 1N6QA 4B9TA 2UXCK 1HPZA 3EN9A 2Z1IA 4YORA 3EO3A 5CYQA 4IDKA 4JKEA 3C7NA 3ZYYX 1KLNA 1RT1A 4JI0K 1HX1A 2XY5A 4K8XA 4JHDA 5F0XA 2F9WA 1EETA 3LAMA 3G0ZA 5HRSA 4CW7B 2X78A 4HHTA 3M8PA 4CJWA 2HMIA 4CZEA 1Z6RA 2YNIA 3M8SA 3K9KA 4CEBA 1T7PA 1D9DA 1NGAA 3LM2A 4LF9K 3P83D 4Z4GA 1X9SA 1BCMA 2RKIA 3T1AA 5HRRA 1WSGA 1VQPN 1RNHA 3FLCO 3ZETB 1Y64A 3CIPA 1FW6A 4B3OA 5EX5A 4LF6K 4LF4K 3V1QA 4LD0A 4GY2B 2GELA 4KH6A 3T69A 1KC8O 3DLRA 1KQSM 5EY4A 3HI0A 3WXMB 1RDWX 4GV6A 2XHBA 4DSLA 2NRWA 3DLGA 3SQ2A 3F73A 3KLEA 2QWQA 4Z4FA 3MWPA 3CM5A 1BL3A 5BRHA 1WNSA 4CBWA 5KRSA 4CF2A 4DR6K 2WONA 3HSTB 2Y1IA 1MDUB 3ZX0A 2DFFA 4JKBA 3RTVA 1S1VA 5J1EA 1DT9A 4B3TK 1TYQB 3NH0A 4E72A 3T1YK 3SUPA 1MWMA 2KTQA 3DAWA 1ASUA 1NGBA 3PSFA 3EL2A 4CHPA 1IKWA 4YFUA 4KHWA 3O9TA 4EIAA 3K57A 2DPNA 3LPUA 3RWUA 1HNIA 3A5OC 3CG7A 4O44A 1NG9A 3TSPA 1HYVA 4H4OA 3AVFA 1RBTA 1LAWA 2E8AA 2D0AA 2EX3A 2FC0A 4ILHA 5C25A 1VSEA 3LP3A 3VN5A 1KXPA 2HSTA 3GL1A 3THWB 4FLTA 3SQ1A 4DWIA 5C2FA 1X3MA 5AQGA 3TU5A 2CGLA 2PY5A 4AM7A 4BREA 2Q31A 4JRPA 4PKHA 3MN6A 3AVHA 4ILJA 4B8CA 5BRDA 2F7TA 3KJVA 3M3ZA 1QS4A 1S1TA 4GV3A 3GBTA 4I6MB 4JKDA 3CFRA 3TAMA 4IBNA 3QEIA 1LW0A 4DSIA 4NLBA 3THYB 3VGKA 5J2NA 3H46O 3BZKA 3RR8A 5HP1A 2YNFA 5IWAK 4K0KK 4EAHD 4PHTX 3AVNA 3IMXA 1BWFO 4FW1A 2HF4A 4JI6K 1TK5A 3CJ9A 3WUHA 4BC4A 1VSJA 2CH6A 4YNQA 4CZJA 1L3UA 3MK6A 4O8UA 3OYBA 3LALA 4C23A 1V4TA 2Q0RA 4A5BA 4IEIA 5AR0A 1SKWA 3CJAA 4J2AA 1NJWA 3V1OA 3PIPL 3MXIA 5HLFA 5GINA 3J80O 5FDLA 4LFCK 4DQRA 3LAKA 3CCQN 1NGFA 2QM1A 3VEXA 2GUIA 2G8VA 1KSPA 4JEPA 3NGYA 4WE1A 1JLBA 1RDUA 1I94K 1GLFO 2P9PB 4HCCA 3MN7A 4WYBA 3QLHA 1Z05A 5JVGL 3CYGA 1BDGA 4AHVA 5AZIB 2E2QA 2QWMA 1MWKA 1FXXA 4QOZB 3P38A 2RHKA 2G8HA 3PSIA 3PV8A 1WSHA 1WBDA 3ZX3A 2B6AA 3IAYA 4E19A 5CE3A 5AFUA 4CGHA 4FLXA 2WC9A 2V52B 4CF0A 4BR5A 2ZGZA 2LSNA 4OO1J 1YVNA 1X3NA 3OYLA 4FPBA 1QHAA 4FLZA 1NU0A 1N8RO 1VQ6N 3NF6A 4F8RA 3GE1A 4BGAA 4BROA 4E7LA 4B9SA 4KHNA 4FWOA 1JL1A 4OX9K 1VAZA 1NK6A 5M1NA 1SKSA 3PX0A 4BG9A 4H5NA 4L3QA 4CF9A 3WNEA 3O4WA 2VWJA 4BQLA 3IUCA 5KQDA 1X1PA 4YOYA 4KTQA 2YKMA 4ZHRA 2J4RA 1CXUA 4H0OA 4EFHA 3AVAA 4DUYK 1G15A 4H0XB 4CZHA 1UOCA 5JMVA 3KK2A 5KPZA 4CF1A 3ID8A 4IOXA 5J2MA 1NJIO 2WBNA 2KKZA 2A6AA 4A57A 4E7KA 1S6QA 3VESA 4N41A 2W6LA 2HVIA 1SS6A 1OH6A 3QBXA 3CCLN 4B9MA 2E2NA 2UXBK 3AVIA 4LF5K 4MFBA 3OY9A 3OYKA 4Z4CA 3V9UA 4CZLA 5C2DA 1XQSC 4LC9B 4BC2A 4FYDA 3RRHA 2GV9A 3PX4A 1J9AA 1M90O 5E84A 3M1FA 1ZBFA 4I9QA 4WCEL 2IAJA 3OYHA 1ZBIA 2HNDA 3AGRA 3AVJA 5C42A 3F9MA 4OJRA 1SUQA 3OBYA 3AAQA 4K25A 3VQ8A 3F2KA 1EX4A 4DR2K 1HNWK 4NLCA 1F21A 3MXJA 4N5SA 1EXQA 1GOCA 4BY9C 2O4GA 5HROA 2G8UA 1KTQA 1JCGA 5JS2A 2A5XA 4I9LA 3DOKA 2EHGA 4HCBA 3SJHA 1HMVA 5M1PA 1XMOK 4KREA 4CZKA 2FBXA 3G25A 4L8RB 2HHUA 4FO0A 1SZ2A 2HHVA 5LL6Z 3D45A 3CF5L 2O8DB 3ULEB 3ZSQA 4H5TA 4CK3A 3OA9A 4FJNA 3I55N 2PAVA 2IGIA 4HUEA 1J53A 1NGEA 3LPTA 3K5NA 5KI6A 4KHYA 1V4SA 2D0PA 1O1WA 1QE1A 3L2RA 2P9SA 3VQQA 4BRDA 5GIOA 2HHQA 1TKZA 3H45C 2BANA 3DXMB 4H5RA 4KKOA 3LZIA 3M6GA 2KZZA 1W0HA 4CZMA 3SAGA 2YCHA 3L2VA 2HHWA 3VQDA 2IOCA 4FCYA 4I2PA 4BWMA 4NO7A 3VA0A 1JLQA 2QXLA 4BACA 4EP5A 1WSIA 5AFUH 3F9KA 3HOTA 2BUPA 2CGKA 4PQUA 4ILGB 1A5WA 4FJXA 3AARA 1IJJA 3LDNA 2WOMA 1RT5A 2RF2A 4DFMA 2OYQA 4Z0UA 2E88A 1QQMA 4FM2A 3MMVA 3KLFA 1BI4A 3UKRB 1VK0A 3GDQA 1NJZA 3ULDA 2QWNA 5AQWA 1ZC6A 1JCEA 1W9HA 1D5AA 1XMQK 1ZBUA 1BGXT 2QK9A 4LSLA 3AVBA 3QIOA 4DKWA 4M3RA 4JKAA 1NWKA 3DLHA 4BRFA 4HWIA 1GLJO 1VHXA 1U49A 5AJ3K 2UUBK 1HNVA 1JCFA 2YHAA 3AO4A 3KWGA 1JKHA 1UAXA 1DGKN 1YXQA 3ATVA 1HYSA 4DS5A 3NE6A 4NCGA 1NJXA 4DG1A 4O8KA 3HL8A 2IDOA 3L4QA 1I3AA 3SMPA 2OPQA 3N4QA 1A5VA 3CQ8A 3LDSA 3VERA 3O3GA 1CZ9A 1DKGD 4QAGA 4W5RA 1Q82O 3EZ5A 3AA2A 2NRTA 3HPGA 4FWQA 4BRCA 4CJFA 4DV3K 1QSLA 3G10A 5AQPA 1KD1O 3AA5X 3CQXA 1ASVA 3U9DA 1HUXA 2YHYA 2XRIA 4DSKA 5I3UA 1WLJA 4CEAA 3SUNA 3EYZA 3T7ZA 3E9OA 2HBJA 3CXCM 3C95A 4A2AA 1BA1A 1S5JA 5AQQA 1EWRA 5KPTA 1D4XA 5BPLA 4E89A 4X65K 1HYZA 1TYQA 1NK4A 1GOBA 2FBYA 2PYLA 3ZSXA 4C8NA 4W5TA 2E2OA 2AJQA 4DU1A 2G8FA 1WBBA 2ASPA 1LOTB 2D1KA 4RG8A 5AQTA 1YIJN 3MX5A 5M1KA 2KFZA 4I7FA 3OYEA 1GLLO 3LDQA 3THWA 4DR1K 3WXIA 1HJOA 3M8QA 3SV4A 3JXUA 4OPKA 1BHLA 5J2PA 3O6WA 4CHNA 1VRTA 2QWPA 2ZJRL 3VMFB 1VQ8N 1C1CA 1RDAA 2HB5A 2NRHA 3VEZA 1NBWA 1C0GA 4DLEA 2P9IB 1WAJA 1RCHA 2A3ZA 1W97L 4I6MA 2P5GA 3O4NA 1SQKA 4KTWA 4JS5A 1BOTO 3TR8A 3L2WA 1QZ6A 2GUPA 2KQ2A 1XHZA 3CCRN 2E20A 4CFCA 3RSEB 1L5UA 2HHTA 4H03B 3B6OA 3J7AP 5KTQA 1TK0A 3VQ4A 3SI6A 2I7PA 5MLCQ 3JSMA 3BEXA 1N5YA 3S9HA 1HQEA 3H1QA 3PX6A 2P51A 2W6KA 4H4MA 3S3MA 2PYJA 2KLAA 4ISEA 4FOEA 1SL0A 4C1NK 1TKDA 3E01A 3M8RA 4BRAA 3HBTA 3AVGA 3K5OA 2CGJA 1HKBA 3FGUA 4MDBA 1NMNA 3L2UA 4DTSA 1HQUA 3SNNA 4F4KA 2HNYA 3IG1A 4HUFA 4CECA 4XH1A 2JLEA 3MAQA 1HRHA 3CJ7A 2FF6A 2QTDA 3GOIA 2Q0UA 2RN2A 5AZIA 3HOSA 5KGXA 1GLBG 4MO5A 2VGMA 3PUFA 1N32K 4IG3A 5E41A 1JJ2M 4FJLA 4RW6A 2P9NB 4Y1DA 1BU6O 4DFJA 4BGBA 4J2EA 4JD2B 4E0DA 4EP4A 1C0MA 1YAGA 3OS2A 3HYFA 4H0VB 4FK0A 3KD5E 1E3MA 4FZYA 1NGHA 1U2VB 3BP8A 2YHXA 1ZBLA 1MA9B 3LDLA 4YOUA 3TSQA 2F8TA 3HK2A 4CJ7A 4FWMA 4C8LA 1FKPA 1M1KO 2HHSA 2GEMA 4BR2A 1WSJA 3BGRA 3CFOA 3M5RA 3A8YA 3V9WA 2YJEA 1XUPO 3SUOA 2VQFK 3AVMA 3FZFA 3DMJA 4MLHA 2ZE2A 3VQEA 2UU9K 3KVGA 3IFRA 1R0AA 1RT7A 3KKSA 3ZSRA 4G1QA 4RW9A 1O13A 2BDPA 3ASMA 3DXKB 1IBMK 2Q97A 3KKRA 4B8AB 2JGUA 1JLCA 3J81O 5CHIA 3ZT4A 1DTQA 3NGZA 2RPIA 3KHYA 1DEJA 1RDDA 1TV6A 4FJMA 2NNWA 1QZ5A 3R9PA 5A2QO 5FPDA 2F9TA 3VTIA 2O8EB 3OVNA 3OTOK 2G8IA 2KW4A 4KFBA 5CZ2A 3MEEA 1HLUA 4YOWA 1P8ZA 3CETA 4CD1A 4JLHA 3QNNA 1KVCA 4DTRA 3ATUA 1OKJA 3HP6A 1XWLA 2UUAK 4DF8A 4BRMA 4OVLA 4B3MK 3RVCA 1N34K 3OYCA 2VCPA 3D2FA 4RW4A 4E7IA 4JI4K 3AVKA 4JKHA 1S1WA 2GWJA 1Z25A 1P90A 3TPQA 5BN9A 4GVMA 5ELZA 4BVPA 3WQTA 1KFSA 1S9GA 5B8HA 3EY1A 4PKGA 4WQ5C 3Q7CA 3TTDA 1T8EA 2B5JA 2FXUA 2HBKA 4YOVA 3JAMO 3VQBA 3VQAA 4CVNE 2GTDA 3WNFA 4ID1A 1ATRA 3R8EA 4H5WA 4B1ZA 2BGGA 2Q3SA 3D2EB 3DOLA 4FJHA 4IO8A 1ESVA 3ZCMA 3NHGA 5AQOA 3OS0A 4M3XA 2O8DA 3ULEA 1QHTA 2QWOA 4DF4A 2BH1A 4QS8A 4B3SK 4FJJA 3LDOA 4DV5K 4B1VA 5C0YA 4BVOA 4CGJA 1U45A 4CE9A 4B9LA 1Y97A 3CI5A 3MEDA 4ISFA 4BRNA 1SL2A 3VF6A 4FLVA 3DXMA 3A2FA 3QNOA 4CCHA 4FWLA 2E4LA 1TK8A 4BR9A 2OCEA 4E3SA 4ZTJA 1KRPA 1ITGA 3ENHA 3V9ZA 1B92A 1EKEA 3TTFA 4Q5VA 1S1UA 1TGOA 4ELTA 4JKGB 3QMLA 4F9OA 2ASOA 3UKUB 2WTUA 3CHWA 4PA1A 4DLGA 2O8BB 5AZJB 4H8KA 4E1NA 2OPPA 3WQUA 3FZMA 1WSFA 3VENA 4AILC 4E7JA 2IVOA 1E4GT 2H3GX 3HVTA 4BE2A 2JWKA 4CJKA 3FR0A 3HT3A 3UKRA 4QS7A 4FLUA 4DTPA 4BRLA 1CZBA 2P9LA 3L3UA 4E1MA 4BDPA 1SKRA 2YHBA 4RW8A 2BTFA 1X9WA 3DLEA 2KZMA 1TL1A 1TKTA 3CMAN 4FLWA 5EU7A 3T19A 4J8FA 4C8KA 2B4JA 1T44A 1GLAG 4AM6A 1QQNA 3L2QA 3TABA 3ZT0A 4Z4EA 4CZGA 3Q7BA 4CZIA 4IWVA 4CJEA 5C10A 5FRMA 4K8ZA 5AQVA 4Z94A 2FF3B 2NRZA 4CFDA 1TKXA 3WNHA 2UUCK 3LP2A 3L6QA 4CHOA 4RTFD 4JI5K 1FJGK 4XIUA 4GVEA 4ID5A 4LFBK 4NYNA 3ID6A 1VQNN 3ALYA 2ATQA 5M1FA 3PO4A 3UE5A 4EHTA 3CD6N 1BIUA 1KVBA 3KK7A 2F96A 2IS3A 3SQ0A 3A5MC 5HOOA 4UQGA 3O3FA 2UYTA 2HMPA 4OKKA 4JRQA 1I39A 2D0OA 3N4PA 4W5QA 3O1BA 4DHYA 3L8BA 3QERA 1NK5A 3OJUA 3VQ9A 2ITMA 5LY3A 3BDPA 1K8KA 4A62A 1YJNN 1Q18A 3VOVA 2WFBA 3HPHA 1KAYA 2OANA 2E5LK 4WQ5A 1VSMA 3NH1A 5AQNA 3K9JA 5JICA 1Q9YA 4DV4K 2E1YA 5M1OA 3TI0A 5HL7L 3LDPA 1C6VA 1NOZA 3AO5A 2OTLN 3VQ5A 1JLEA 1VQKN 4JI7K 4BR0A 1D8YA 3FZKA 2JWLA 4O4GA 3A5LC 3C65A 1IKXA 4MO4A 3VEYA 1U6ZA 4CD3A 3HJFA 2KFNA 3OYDA 3AVLA 4LH5A 4HUGA 3VETA 3MXMA 3OW2M 4B9UA 3O9SA 4LSNA 4M42A 2E6MA 2KHOA 4PWDA 2QWLA 1YUWA 3J7YP 3L3VA 3CCMN 2HHXA 1WUAA 3U6FA 2RE2A 4H5VA 3CMEN 3KLIA 5CY4A 1TAQA 5BRFA 2VWKA 1YHQN 3VQ7A 1NK0A 4RCHA 4DU4A 3U3YA 4BRGA 1NK8A 4K42A 2PBDA 4FPAA 1WOQA 2A40A 3RSEA 3RRGA 2IC3A 3VQCA 1LV5A 1RTDA 3DLBA 1C0TA 2EWSA 4KH5A 1NK7A 4B9VA 1BO5O 2O8FB 2OPRA 3K58A 1K8AO 3K5LA 3PO5A 4YOXA 2Q2RA 3IDHA 1JXBA 4OPAA 3S3NA 4BECA 1HR0K 4U67L 3DRPA 4C8OA 3HO1A 4CHYA 3OHRA 4MQ3A 3SBGA 2NRVA 3SPYA 1BIZA 4LF7K 3D7EO 3T1HK 1VSKA 3IRXA 1ZBSA 4IFYA 3EE9A 4IKFA 3QINA 4FLYA 3CPWM 3SBTA 3LWLA 2Q1NA
chains in the Genus database with same CATH topology
1BA0A 5MLCQ 3TU5A 2CGLA 3BEXA 4A61A 3F5TA 4AM7A 4BREA 5BREA 4JD2A 2Q31A 3J7ZO 3H1QA 4PKHA 4QS9A 3QB0A 3MN6A 4ILJA 5BRDA 2P9UB 2F7TA 3O1WA 2KLAA 3M3ZA 4ISEA 4FOEA 2D4WA 1YJ9N 4GV3A 1NGDA 1NGIA 3GBTA 2FSNA 4C1NK 1YF5L 4GV9A 2NZTA 4I6MB 4JKDA 4BRQA 4BRAA 3HBTA 5M1QA 4G9ZA 2CGJA 1HKBA 3FGUA 4MDBA 3VEVA 4NLBA 3KZBA 3VGKA 3J8AA 3SMSA 4FWRA 3H46O 5C12A 5CR4A 4JK8A 4PL7A 3ZEUB 5GAHP 3E66A 4CZFA 3LL3A 1NGJA 4EAHD 1SAZA 4PHTX 3AGKA 3IMXA 1RFQA 1BWFO 4XH1A 3ZETA 2HF4A 3CJ9A 3CJ7A 2FF6A 2ZWHA 3TTCA 2QTDA 3GOIA 3WUHA 4BC4A 2Q0UA 4C1NI 2CH6A 2VWBA 5AZIA 4CBXA 3HOSA 1OVYA 4CZJA 4UY8O 1GLBG 4MO5A 5AQYA 3MK6A 4O8UA 4IDHA 3H1VX 2VGMA 3EKSA 5AQZA 5BPNA 3DWLA 4C23A 1JJ2M 1V4TA 1ILYA 3FFKB 2P9NB 2Q0RA 4A5BA 4DQ8A 4IEIA 1BU6O 5AR0A 3CJAA 4BGBA 4IOCL 4JD2B 1G99A 3PIPL 4B1UB 4B1XB 5GINA 3ZX2A 2GWKA 3C0BA 1YAGA 4WFBL 3DXKA 4H0VB 4Y0WA 1NGHA 1U2VB 3WXKA 3BP8A 3D2FB 4FSVA 1NGFA 3CCQN 2QM1A 3VEXA 4H0PA 2YHXA 3CC4N 1MA9B 3LDLA 4IFEA 4YOUA 3TSQA 4BC3A 3HSCA 4YDUC 3QDKA 2ZGYA 4CJ7A 4FWMA 2P9IA 5AQJA 1GLEG 4JEPA 1E4FT 5LJVA 1RDUA 4KBOA 1GLFO 3B8AX 5AQHA 3CJCA 1M1KO 2P9PB 2GEMA 4BR2A 3HZ6A 3MN7A 4IJAA 3HM8A 4WYBA 4JK9A 3VTHA 2ZJQL 3M5RA 1VQ5N 3A8YA 2YJEA 3U9ZA 1Z05A 4A59A 1XUPO 4WQ4C 3G6EN 5JVGL 1BDGA 5AZIB 2E2QA 2QWMA 1MWKA 1QQOA 3FZFA 5AQFA 3P38A 4MLHA 1T6DA 3MN5A 1EO1A 3FE1A 3KVGA 2RHKA 3IFRA 4BRIA 3FZHA 3NMUA 3JS6A 4XH5A 4U7BA 2NRXA 2C1IA 3ZX3A 5AQXA 2I7NA 1O13A 3W0LA 5CE3A 4NB4A 5AFUA 3DXKB 2YJFA 3VGLA 2NLXA 2WC9A 2V52B 1W2BM 2Q97A 3CJ1A 4BR5A 2ZGZA 5BPMA 1NMDA 4OO1J 1YVNA 4XH4A 2ASMA 1X3NA 5CHIA 1VQMN 4FPBA 1QHAA 4MDAA 4E1JA 3G4SN 3CCVN 1N8RO 3CPEA 1VQ6N 4BEBA 3KHYA 3GE1A 4BGAA 4BROA 5LJWA 1DEJA 4FWSA 2NNWA 1QZ5A 4FWOA 3R9PA 4IJNA 5FPDA 2F9TA 3VTIA 5EXWA 1VAZA 5M1NA 3CCUN 3H3NO 3E1YA 4BG9A 4H5NA 4L3QA 3O4WA 3VPZA 2QEXN 4BQLA 3IUCA 1HLUA 4A2BA 5KQDA 5KQ8A 1P8ZA 4YOWA 3CETA 4CD1A 4YOYA 4CI6A 1NGCA 4BG8A 2FSKA 2QWRA 3D2EA 4BRKA 2J4RA 3ATUA 1CZAN 3A0IX 3LM9A 4H0OA 4EFHA 2A42A 1VQON 1OKJA 2P9NA 2Q36A 4WF9L 3AAPA 2P9SB 5TKYA 4BRMA 4H0XB 1YJWN 3EE8A 1QVFM 4CZHA 5EVZA 3EKUA 5JMVA 2P9LB 3RVCA 1U2VA 3QFPA 2VCPA 3D2FA 5KPZA 1KAXA 3ID8A 5GAEP 4IOXA 4JKHA 5TKWA 1S22A 1NJIO 2WBNA 2GWJA 2KKZA 1VQ4N 4AF1A 1P90A 3TPQA 3CCSN 5BN9A 1R59O 2GX9A 2A6AA 2AA4A 5ELZA 4A57A 4BVPA 2IIRA 4BRPA 3EZWA 3WQTA 3NVKA 3VESA 2HBMA 5B8HA 1EQYA 1SS6A 2P9PA 3P4IA 4PKGA 4FL9A 4M7YA 3S41A 1Q81O 4WQ5C 3Q7CA 3SK3A 3TTDA 2FXUA 2HBKA 3QBXA 4YOVA 3CCLN 2E2NA 4JK7A 4IXCA 2GTDA 4FWPA 3VEOA 1TUYA 1ATRA 3KWIA 3D6RA 5AQIA 3R8EA 3U8XA 4H5WA 4JKGA 5JLFA 3P31A 3AY9A 4B1ZA 4B9QA 4CZLA 3D2EB 5C2DA 1XQSC 4WFNL 4LC9B 4IO8A 5GIPA 4BC2A 5AZJA 1ESVA 3WXLA 1T6CA 2V7YA 5AQOA 5KPRA 1M90O 2IVNA 5E84A 3M1FA 3WEEA 1VQ9N 3ULEA 4JNEA 2QWOA 3CJBA 2BH1A 4QS8A 3VEWA 4WCEL 3R3LA 3QFUA 3LDOA 3SAHA 2W00A 3AGRA 4B1VA 5C0YA 4BVOA 3MX2A 3F9MA 3I8BA 3OBYA 1Q7YO 3AAQA 4K25A 3CCEN 4CBUA 4IOAL 3O5BA 3F2KA 4K41A 3HTVA 2V7ZA 3SAFA 3CI5A 4ISFA 4BRNA 4NLCA 3VF6A 3DXMA 1BG3A 3R6MA 4GNIA 4BY9C 4BE7B 5GADP 3H3OB 3A5NC 2VGNA 4FWLA 1JCGA 4HTLA 4BR9A 4EHUA 1QVGM 3TSUA 2A5XA 3BUZB 4WFAL 4ISGA 3C6HA 3U4LA 2A41A 4B1WB 4H0YB 5AQSA 3SJHA 5M1PA 3ENHA 3TTFA 4YDUA 1K8KB 4JKGB 5BR9A 2HBLA 4DB3A 3QMLA 3WT0A 1C0FA 4CZKA 4F9OA 1ATNA 2ASOA 2QI2A 3CHWA 4JN4A 3UKUB 5JLHA 3G25A 5AZJB 2W40A 2NRRA 4FOIA 3WQUA 4FO0A 1SZ2A 3FZMA 3VGMA 2ZF5O 5ADXA 3CF5L 3WEEB 3L4IA 3VENA 3ULEB 2E2PA 4H5TA 3O80A 4A5AA 3OA9A 3I55N 2PAVA 2IVOA 1E4GT 2H3GX 3ENBA 4WQ4A 2JWKA 3CC2N 1NGEA 3FR0A 1V4SA 4FWNA 5AQRA 5F2RA 2D0PA 2C1GA 3UKRA 4YOTA 2P9SA 4QS7A 1YITN 4BRDA 5GIOA 4XJXA 4BRLA 2P9LA 3H45C 3PIOL 2BTFA 3DXMB 1GLCG 4H5RA 3O9QA 3CMAN 1H1VA 2VYPA 1BUPA 3M6GA 2FSJA 4CZMA 2HOEA 3SAGA 2YCHA 1GLDG 5C15A 4J8FA 2YI1A 1T44A 1GLAG 4AM6A 4BQZA 4NO7A 2QXLA 1QQNA 4PL8A 5AFUH 3WXJA 3CERA 4CZGA 3Q7BA 4CZIA 2FLOA 3O8MA 4R79A 3HOTA 4IWVA 5C10A 2BUPA 2CGKA 3E9PA 3L0QA 5AQVA 4ILGB 3O08A 4Z94A 2FF3B 2NRZA 4BR4A 3AARA 1IJJA 3GG4A 1X9JA 1YI2N 3LDNA 3VF2A 3L6QA 5AQKA 4H0TB 4RTFD 3PLAA 2E88A 1QQMA 3MN9A 3MMVA 3CQYA 4GVEA 2QA4N 3ID6A 1VQNN 1KAZA 5FPMA 3UKRB 3GDQA 2P9KA 5AQMA 2QWNA 1ZC6A 5AQWA 5AQUA 4BC5A 5EOYA 3QICA 2YX6A 1JCEA 5M1FA 3UE5A 4EHTA 3NVMA 3CD6N 3KK7A 3DLLL 4B1YB 4BR7A 3HRGA 3H6EA 4DKWA 1ZXOA 3A5MC 4JKAA 5HOOA 1NWKA 2UYTA 4BRFA 4HWIA 1GLJO 2HMPA 2ZJPL 1IG8A 2D0OA 4IO9L 3N4PA 1JCFA 3W3DA 3O1BA 4DHYA 4IZ9A 3KWGA 3C6AA 4O5FA 4M7XA 1DGKN 3P39A 5FPNA 1YXQA 3ATVA 3CCJN 2ITMA 4FWKA 5LY3A 3E9LA 1K8KA 2I7PA 4A62A 1YJNN 1Q18A 3VOVA 3UKUA 4O8KA 1XC3A 2WFBA 3L4QA 3ENOA 4IEEA 2V51B 1KAYA 2OANA 3QBWA 3SMPA 1VQ7N 4K43A 3N4QA 4FVUA 1S3XA 4WQ5A 3VERA 4DCHA 5AQNA 1DKGD 3BF3A 1Q82O 1J6ZA 2P9KB 3K9JA 2NRTA 4FWQA 4JKFA 4BRCA 2AP1A 5JICA 1Q86O 3O9UA 2CH5A 3G71N 2IVPA 5AQPA 1KD1O 2E1YA 5M1OA 3CQXA 4JKCA 5HL7L 3U9DA 3LDPA 1HUXA 2YHYA 4M63C 3IKMA 3DJCA 4MLEA 5DM6L 2OTLN 1VQKN 3EN9A 4BR0A 2HF3A 1VQLN 3T7ZA 4YORA 3FZKA 2JWLA 3E9OA 3EO3A 4JKEA 3SLCA 3C7NA 3ZYYX 2HBJA 1RGIA 3A5LC 3C65A 4MO4A 1HX1A 1U6ZA 5E26A 3VEYA 4CD3A 3CXCM 4JHDA 3I56N 1ATSA 5F0XA 2F9WA 5H1SQ 1NGGA 3VETA 1LCUA 3MCPA 4A2AA 3OW2M 1BA1A 5AQQA 2QW9A 5KPTA 3MWTA 3MCAB 5BN8A 1NM1A 4BRHA 4RWTA 3O9SA 4CZEA 1D4XA 3R1XA 5BPLA 1Z6RA 2OTJN 2KHOA 3K9KA 2QWLA 1YUWA 1TYQA 1NGAA 3LM2A 3CCMN 1WUAA 1HKGA 2E1ZA 2YHWA 1K73O 2RE2A 4H5VA 1VQPN 3CMEN 2E2OA 3FLCO 3ZETB 1Y64A 3CIPA 2WUSA 3I33A 5BRFA 5EX5A 1YHQN 5F1XA 5FPEA 1TUUA 4PKIA 2ASPA 4RCHA 1LOTB 4GY2B 4BRGA 2GELA 4KH6A 3T69A 2D1KA 4K42A 1KC8O 2PBDA 4XEIA 4OPHA 1K9MO 5AQTA 4KH4A 3OBWA 1YIJN 4FPAA 3MX5A 3MDQA 5M1KA 1KQSM 1WOQA 2A40A 5EY4A 3HI0A 3C7NB 3RSEA 3WXMB 1RDWX 4GV6A 1GLLO 2EWSA 2NRWA 3LDQA 4JHDB 4KH5A 5ADXH 5AQLA 1BO5O 3WXIA 1HJOA 2QWQA 2PFUA 3JXUA 1S72N 3MWPA 5BRHA 1K8AO 4CBWA 3O6WA 2QWPA 4YOXA 1MDUB 3ZX0A 2ZJRL 4JKBA 3VMFB 2Q2RA 1VQ8N 2P9UA 2NRHA 3IDHA 1DT9A 1NBWA 3VEZA 1TYQB 1C0GA 2P9IB 4OPAA 2A3ZA 1MWMA 1W97L 4BECA 4I6MA 1HKCA 3VF4A 3DAWA 1SQKA 4U67L 1NGBA 1BOTO 3O9RA 3EL2A 3OHRA 3BF1A 3SBGA 2NRVA 3CC7N 5GAGP 5DM7L 1QZ6A 2GUPA 3O9TA 4JAXA 3D7EO 3ZEUA 4EIAA 3CCRN 2DPNA 1T3VA 2W41A 2E20A 3A5OC 5I9EB 1HPMA 3TSPA 3UB5A 1ZBSA 5JVHL 3EE9A 3FZLA 3RSEB 2E8AA 4ILHA 1KXPA 2HSTA 3GL1A 3CPWM 1NLVA 4H03B 3SBTA 5C2FA 2Q1NA 1X3MA 5AQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BA0 A;  3TU5 A;  2CGL A;  3BEX A;  4A61 A;  4AM7 A;  4BRE A;  5BRE A;  4JD2 A;  2Q31 A;  3H1Q A;  4PKH A;  4QS9 A;  3QB0 A;  3MN6 A;  5BRD A;  2P9U B;  3O1W A;  3M3Z A;  4ISE A;  4FOE A;  2D4W A;  1NGD A;  1NGI A;  3GBT A;  2FSN A;  2NZT A;  4I6M B;  4BRQ A;  4BRA A;  3HBT A;  2CGJ A;  1HKB A;  3FGU A;  3VEV A;  3KZB A;  3VGK A;  3J8A A;  3SMS A;  4FWR A;  3H46 O;  4PL7 A;  3ZEU B;  4CZF A;  3LL3 A;  1NGJ A;  4EAH D;  1SAZ A;  4XH1 A;  3IMX A;  1RFQ A;  1BWF O;  3ZET A;  2HF4 A;  3CJ9 A;  3CJ7 A;  2FF6 A;  2ZWH A;  3WUH A;  4BC4 A;  3GOI A;  2Q0U A;  4CBX A;  2CH6 A;  2VWB A;  5AZI A;  4CZJ A;  1GLB G;  4MO5 A;  5AQY A;  3MK6 A;  3H1V X;  3EKS A;  5AQZ A;  5BPN A;  3DWL A;  4C23 A;  1V4T A;  3FFK B;  2P9N B;  2Q0R A;  4DQ8 A;  5AR0 A;  1BU6 O;  3CJA A;  4BGB A;  4JD2 B;  1G99 A;  4B1U B;  4B1X B;  3ZX2 A;  2GWK A;  3C0B A;  1YAG A;  3DXK A;  4H0V B;  4Y0W A;  1NGH A;  1U2V B;  3WXK A;  3BP8 A;  3D2F B;  4FSV A;  1NGF A;  2QM1 A;  3VEX A;  4H0P A;  2YHX A;  1MA9 B;  3LDL A;  4BC3 A;  3HSC A;  4YDU C;  3QDK A;  2ZGY A;  4CJ7 A;  4FWM A;  2P9I A;  5AQJ A;  1GLE G;  1E4F T;  5LJV A;  4KBO A;  1GLF O;  3B8A X;  5AQH A;  3CJC A;  2P9P B;  2GEM A;  4BR2 A;  3HZ6 A;  3MN7 A;  4IJA A;  3HM8 A;  4WYB A;  3A8Y A;  2YJE A;  3U9Z A;  1Z05 A;  1XUP O;  4WQ4 C;  1BDG A;  5AZI B;  2E2Q A;  2QWM A;  1MWK A;  1QQO A;  3FZF A;  5AQF A;  4MLH A;  1T6D A;  3MN5 A;  3FE1 A;  3KVG A;  3IFR A;  4BRI A;  3FZH A;  3JS6 A;  4XH5 A;  3ZX3 A;  5AQX A;  2I7N A;  3W0L A;  5CE3 A;  4NB4 A;  5AFU A;  3DXK B;  2YJF A;  3VGL A;  2NLX A;  2V52 B;  2Q97 A;  3CJ1 A;  4BR5 A;  2ZGZ A;  5BPM A;  1NMD A;  1YVN A;  4XH4 A;  2ASM A;  1X3N A;  4FPB A;  1QHA A;  4E1J A;  3KHY A;  3GE1 A;  4BGA A;  4BRO A;  5LJW A;  1DEJ A;  4FWS A;  4FWO A;  1QZ5 A;  3R9P A;  4IJN A;  5FPD A;  2F9T A;  5EXW A;  3H3N O;  4BG9 A;  4H5N A;  4L3Q A;  3O4W A;  3VPZ A;  4BQL A;  3IUC A;  1HLU A;  4A2B A;  5KQD A;  5KQ8 A;  1P8Z A;  3CET A;  4CD1 A;  4CI6 A;  1NGC A;  4BG8 A;  2FSK A;  2QWR A;  3D2E A;  4BRK A;  2J4R A;  3ATU A;  1CZA N;  3A0I X;  3LM9 A;  4H0O A;  4EFH A;  2A42 A;  1OKJ A;  2P9N A;  2Q36 A;  3AAP A;  2P9S B;  5TKY A;  4BRM A;  4H0X B;  4CZH A;  5EVZ A;  3EKU A;  5JMV A;  2P9L B;  1U2V A;  3QFP A;  2VCP A;  3D2F A;  5KPZ A;  1KAX A;  3ID8 A;  1S22 A;  2GWJ A;  3TPQ A;  5BN9 A;  1R59 O;  2A6A A;  2AA4 A;  5ELZ A;  4BVP A;  2IIR A;  4BRP A;  3EZW A;  3WQT A;  3VES A;  5B8H A;  1EQY A;  4M7Y A;  2P9P A;  3P4I A;  4PKG A;  4FL9 A;  3S41 A;  4WQ5 C;  3SK3 A;  2FXU A;  3QBX A;  2E2N A;  4IXC A;  2GTD A;  4FWP A;  3VEO A;  1TUY A;  1ATR A;  5AQI A;  3R8E A;  3U8X A;  4H5W A;  5JLF A;  4B1Z A;  3AY9 A;  4B9Q A;  4CZL A;  3D2E B;  1XQS C;  4LC9 B;  4IO8 A;  4BC2 A;  5AZJ A;  1ESV A;  3WXL A;  1T6C A;  2V7Y A;  5AQO A;  5KPR A;  2IVN A;  5E84 A;  3M1F A;  3WEE A;  3ULE A;  4JNE A;  2QWO A;  3CJB A;  4QS8 A;  3VEW A;  3QFU A;  3LDO A;  4B1V A;  4BVO A;  3F9M A;  3I8B A;  3AAQ A;  4K25 A;  4CBU A;  3O5B A;  4K41 A;  3HTV A;  2V7Z A;  3CI5 A;  4ISF A;  4BRN A;  3VF6 A;  3DXM A;  1BG3 A;  3R6M A;  4GNI A;  3H3O B;  3A5N C;  4FWL A;  1JCG A;  4HTL A;  4BR9 A;  4EHU A;  2A5X A;  3BUZ B;  4ISG A;  3U4L A;  2A41 A;  4B1W B;  4H0Y B;  5AQS A;  3SJH A;  3ENH A;  4YDU A;  1K8K B;  5BR9 A;  4DB3 A;  3QML A;  3WT0 A;  1C0F A;  4CZK A;  4F9O A;  1ATN A;  2ASO A;  4JN4 A;  3CHW A;  3UKU B;  5JLH A;  3G25 A;  5AZJ B;  2W40 A;  4FOI A;  3WQU A;  1SZ2 A;  3FZM A;  4FO0 A;  3VGM A;  2ZF5 O;  5ADX A;  3WEE B;  3L4I A;  3VEN A;  3ULE B;  2E2P A;  4H5T A;  3O80 A;  2PAV A;  2IVO A;  1E4G T;  2H3G X;  4WQ4 A;  1NGE A;  3FR0 A;  1V4S A;  4FWN A;  5AQR A;  5F2R A;  2D0P A;  3UKR A;  2P9S A;  4QS7 A;  4BRD A;  4BRL A;  2P9L A;  3H45 C;  2BTF A;  3DXM B;  1GLC G;  4H5R A;  1H1V A;  2VYP A;  1BUP A;  3M6G A;  2FSJ A;  4CZM A;  2HOE A;  2YCH A;  1GLD G;  4J8F A;  2YI1 A;  1T44 A;  1GLA G;  4AM6 A;  4BQZ A;  4NO7 A;  2QXL A;  1QQN A;  4PL8 A;  5AFU H;  3WXJ A;  3CER A;  4CZG A;  4CZI A;  2FLO A;  3O8M A;  4IWV A;  2BUP A;  2CGK A;  3L0Q A;  5AQV A;  3O08 A;  4Z94 A;  2FF3 B;  4BR4 A;  3AAR A;  1IJJ A;  3GG4 A;  1X9J A;  3LDN A;  3VF2 A;  3L6Q A;  5AQK A;  4H0T B;  4RTF D;  2E88 A;  1QQM A;  3MN9 A;  3MMV A;  3CQY A;  1KAZ A;  5FPM A;  3UKR B;  3GDQ A;  2P9K A;  5AQM A;  2QWN A;  1ZC6 A;  5AQW A;  5AQU A;  4BC5 A;  5EOY A;  3QIC A;  1JCE A;  3UE5 A;  4EHT A;  4B1Y B;  4BR7 A;  3H6E A;  1ZXO A;  3A5M C;  1NWK A;  2UYT A;  4BRF A;  4HWI A;  1GLJ O;  2HMP A;  1IG8 A;  2D0O A;  1JCF A;  3W3D A;  3O1B A;  4DHY A;  4IZ9 A;  4O5F A;  4M7X A;  1DGK N;  5FPN A;  1YXQ A;  3ATV A;  2ITM A;  4FWK A;  5LY3 A;  1K8K A;  2I7P A;  4A62 A;  1Q18 A;  3VOV A;  3UKU A;  4O8K A;  1XC3 A;  3ENO A;  2V51 B;  1KAY A;  2OAN A;  3QBW A;  3SMP A;  4K43 A;  1S3X A;  4WQ5 A;  3VER A;  4DCH A;  5AQN A;  1DKG D;  3BF3 A;  1J6Z A;  2P9K B;  4FWQ A;  5JIC A;  4BRC A;  2AP1 A;  2CH5 A;  2IVP A;  5AQP A;  2E1Y A;  3CQX A;  3U9D A;  3LDP A;  1HUX A;  2YHY A;  4M63 C;  4MLE A;  3DJC A;  3EN9 A;  4BR0 A;  2HF3 A;  3FZK A;  3EO3 A;  3SLC A;  3C7N A;  3A5L C;  1RGI A;  4CD3 A;  4MO4 A;  3VEY A;  1HX1 A;  1U6Z A;  5E26 A;  4JHD A;  1ATS A;  5F0X A;  2F9W A;  1NGG A;  3VET A;  1LCU A;  3MCP A;  4A2A A;  1BA1 A;  5AQQ A;  2QW9 A;  5KPT A;  5BN8 A;  1NM1 A;  4BRH A;  4RWT A;  4CZE A;  1D4X A;  5BPL A;  1Z6R A;  2KHO A;  2QWL A;  1YUW A;  1TYQ A;  1NGA A;  3LM2 A;  1WUA A;  1HKG A;  2E1Z A;  2YHW A;  4H5V A;  2E2O A;  3FLC O;  3ZET B;  1Y64 A;  3CIP A;  2WUS A;  3I33 A;  5BRF A;  5EX5 A;  5F1X A;  5FPE A;  1TUU A;  4PKI A;  2ASP A;  4RCH A;  1LOT B;  4GY2 B;  4BRG A;  2GEL A;  2D1K A;  4K42 A;  2PBD A;  4XEI A;  5AQT A;  4FPA A;  3MDQ A;  1WOQ A;  2A40 A;  5EY4 A;  3HI0 A;  3C7N B;  3RSE A;  1RDW X;  1GLL O;  2EWS A;  3LDQ A;  4JHD B;  5ADX H;  5AQL A;  1BO5 O;  3WXI A;  1HJO A;  2QWQ A;  3JXU A;  5BRH A;  4CBW A;  3O6W A;  2QWP A;  1MDU B;  3ZX0 A;  2Q2R A;  2P9U A;  2NRH A;  3IDH A;  3VEZ A;  1NBW A;  1TYQ B;  1C0G A;  2P9I B;  2A3Z A;  1MWM A;  4I6M A;  1HKC A;  3VF4 A;  3DAW A;  1SQK A;  1NGB A;  1BOT O;  3EL2 A;  3OHR A;  3BF1 A;  1QZ6 A;  2GUP A;  4JAX A;  3D7E O;  3ZEU A;  4EIA A;  2DPN A;  2W41 A;  2E20 A;  3A5O C;  5I9E B;  1HPM A;  3UB5 A;  1ZBS A;  3FZL A;  3RSE B;  2E8A A;  1KXP A;  3GL1 A;  1NLV A;  4H03 B;  2Q1N A;  1X3M A;  5AQG A; 
#chains in the Genus database with same CATH topology
 4A61 A;  3QEW A;  1SL1 A;  4JD2 A;  3J7Z O;  4QS9 A;  4R5P A;  3QB0 A;  2P9U B;  3O1W A;  1YJ9 N;  1NGD A;  3V1R A;  4M3U A;  2FSN A;  3QEX A;  1YF5 L;  4GV9 A;  4CEZ A;  2NZT A;  4BRQ A;  1A5X A;  4CFB A;  4G9Z A;  5M1Q A;  4DR5 K;  3KLH A;  3VEV A;  1XNQ K;  4CEQ A;  3SJJ A;  4FWR A;  5C12 A;  5CR4 A;  1BQM A;  3ZEU B;  3E66 A;  4CEF A;  3LL3 A;  1SAZ A;  3S5T A;  3AGK A;  1RFQ A;  2W42 A;  3ZET A;  4BE1 A;  3ZT3 A;  2ZWH A;  3TTC A;  3NF9 A;  4C1N I;  4CBX A;  4KO0 A;  1REV A;  5AQY A;  4IDH A;  3H1V X;  4BE0 A;  3ZT1 A;  4GW6 A;  1ILY A;  4BWJ A;  4DQ8 A;  4IOC L;  3NH2 A;  1G99 A;  3QEP A;  4KI4 A;  1UA1 A;  3NF7 A;  3DXK A;  3WXK A;  4BC3 A;  3HSC A;  1GLE G;  5LJV A;  2VG5 A;  1BQN A;  4KBO A;  4CJ3 A;  2X6N A;  4KPY A;  1JLG A;  5AQH A;  3CJC A;  1VQ9 N;  2ZJQ L;  1VQ5 N;  3VTH A;  3OJS A;  4A59 A;  3I0S A;  1RTH A;  3G6E N;  2O8E A;  1VRU A;  5AQF A;  1EO1 A;  3FE1 A;  1NOY A;  3LWM A;  3S3O A;  4BRI A;  3FZH A;  3AO3 A;  4Q0B A;  3LP1 A;  4U7B A;  2C1I A;  3V6D A;  4BDY A;  1EP4 A;  4NB4 A;  4F3O A;  3VGL A;  2YJF A;  3CFP A;  2NLX A;  4N47 A;  2VG7 A;  3CJ1 A;  2HW3 A;  5BPM A;  1NMD A;  2ITG A;  4XH4 A;  4KB0 A;  3TAG A;  2ASM A;  1VQM N;  2A1S A;  4MDA A;  4N56 A;  4E1J A;  2DTU A;  4BEB A;  4W5O A;  1YT3 A;  4FWS A;  3V9X A;  4IJN A;  3THY A;  3CCU N;  5T7B A;  3H3N O;  3E1Y A;  4FM0 A;  3VPZ A;  1IO2 A;  1RTJ A;  3JYT A;  1D9F A;  3KK1 A;  2QEX N;  3I8D A;  2FSK A;  1RT4 A;  3D2E A;  4BRK A;  4M41 A;  3OYJ A;  2A42 A;  4HTU A;  1VQO N;  2Q36 A;  3K59 A;  3KIO A;  2P9S B;  1YJW N;  3EE8 A;  4CED A;  2E6L A;  1QVF M;  3EKU A;  3QIP A;  4OGC A;  4DQS A;  4CEE A;  3KD1 E;  1DLO A;  3QFP A;  1KAX A;  5TKW A;  1B9D A;  1S22 A;  4AF1 A;  3CCS N;  1WB9 A;  1UWB A;  2GX9 A;  4CK2 A;  3CM6 A;  4CK1 A;  1IKV A;  4M45 A;  2IIR A;  4BRP A;  3EZW A;  3NVK A;  2HBM A;  3ZSY A;  2P9P A;  3S41 A;  4B9N A;  4FL9 A;  2HVH A;  3ITH A;  2D0B A;  4B08 A;  3SK3 A;  1Q81 O;  4DU3 A;  4IXC A;  4FWP A;  4CGG A;  3PY8 A;  4KI6 A;  1U04 A;  3KWI A;  3D6R A;  3B6P A;  3U8X A;  4JKG A;  3P31 A;  5GIP A;  5AZJ A;  4KHS A;  2PZS A;  3DYA A;  1RT3 A;  1IH7 A;  2IVN A;  2GBZ A;  3VEW A;  1N33 K;  2O8C B;  3QFU A;  1RTI A;  4O55 A;  3SAH A;  1Q7Y O;  3I8B A;  2F8S A;  3O5B A;  4KHU A;  4K41 A;  2V7Z A;  1UA0 A;  5KGW A;  1BG3 A;  3R6M A;  5GAD P;  3H3O B;  3A5N C;  1HJR A;  4HTL A;  1QVG M;  5IT9 O;  1TAU A;  4FK2 A;  3RMA A;  3U4L A;  2A41 A;  4B1W B;  4CEO A;  2XY7 A;  4H0Y B;  5AQS A;  2X6S A;  4IG0 A;  4KTZ A;  4CIF A;  3OYM A;  2ETJ A;  1QSS A;  2HBL A;  4DB3 A;  1NKC A;  3WT0 A;  5JLH A;  1ATN A;  2QI2 A;  2W40 A;  1T03 A;  2NRR A;  4FOI A;  3VGM A;  2ZF5 O;  5ADX A;  3WEE B;  3L4I A;  3RMD A;  2E2P A;  3O80 A;  3P1G A;  4OGE A;  4DTJ A;  3ENB A;  3CC2 N;  3ZSZ A;  4GMJ B;  3DRS A;  4FWN A;  4DV2 K;  2FBT A;  3THX B;  4YOT A;  4DQQ A;  3THV A;  1YIT N;  4F2R A;  3QES A;  4M3W A;  4XJX A;  4NCB A;  1B9F A;  1X9M A;  1GLC G;  4TSX A;  5DK5 A;  1U47 A;  1H1V A;  4DMN A;  1BUP A;  1ZYQ A;  1ASW A;  2HOE A;  1GLD G;  5C15 A;  2YI1 A;  5K14 A;  4PL8 A;  4M3Y A;  1FKO A;  2F4V K;  5HBM A;  4DV1 K;  4R79 A;  3C94 A;  3NF8 A;  2DFH A;  2O4I A;  4GKK K;  2Z1H A;  4BDZ A;  4CJU A;  3VF2 A;  4EZ9 A;  3O3H A;  3PLA A;  2BE2 A;  3SQ4 A;  3AO1 A;  3CQY A;  2QA4 N;  1KAZ A;  3CYM A;  4BC5 A;  5AQU A;  3C6T A;  3SCX A;  3NVM A;  2OZM A;  3DLL L;  4B3R K;  4AHC A;  4B1Y B;  4BR7 A;  3HRG A;  3H6E A;  3UIQ A;  4ELU A;  4KV8 A;  4PY5 A;  3LZJ A;  1SV5 A;  1VSI A;  2XY8 A;  4DR4 K;  2ZJP L;  4CF8 A;  3C6A A;  4ELV A;  4O5F A;  4M7X A;  4Y1C A;  3P39 A;  4V19 S;  1YTA A;  3RMB A;  2ZQB A;  1VSH A;  3CCJ N;  3T3F A;  4FWK A;  3E9L A;  3NAE A;  3SUQ A;  4DQP A;  4CJV A;  4IEE A;  3ENO A;  1NK9 A;  4FVU A;  2YKN A;  2VG6 A;  1C1A A;  2D5R A;  2P9K B;  1OH7 A;  2AP1 A;  1Q86 O;  4ICL A;  3O9U A;  3K2P A;  2IVP A;  4YY3 K;  1U4B A;  1VSF A;  4FJK A;  3VQ6 A;  4JS4 A;  4MLE A;  4M63 C;  3IKM A;  5DM6 L;  3SPZ A;  1N36 K;  1QSY A;  4DS4 A;  1J5E K;  1VQL N;  2HF3 A;  1J54 A;  4CJR A;  5JEN A;  3SLC A;  1JXE A;  4OKE A;  3TAN A;  1RGI A;  5E26 A;  3I56 N;  1ATS A;  5H1S Q;  1NGG A;  2O8F A;  1LCU A;  3MCP A;  1JLF A;  2QW9 A;  3MWT A;  3MCA B;  4CGD A;  5BN8 A;  3RMC A;  1NM1 A;  4BRH A;  4RWT A;  1VSL A;  3R1X A;  2OTJ N;  3BY5 A;  4OLA A;  1CXQ A;  2YNH A;  2ZM6 K;  1HKG A;  2X74 A;  4LFA K;  2E1Z A;  2YHW A;  4OLB A;  4E7H A;  1K73 O;  1KFD A;  3ZSW A;  2UXD K;  2WUS A;  4CJ4 A;  3I33 A;  5F1X A;  5FPE A;  1TUU A;  4KAZ A;  4PKI A;  4XEI A;  1LWC A;  4OPH A;  1K9M O;  4KH4 A;  3OBW A;  3MDQ A;  4CGI A;  3I0R A;  3C7N B;  4AHS A;  1NJY A;  1RBU A;  4F2S A;  4JHD B;  3ZSV A;  5ADX H;  4JYA K;  5AQL A;  1S72 N;  4X66 K;  1LWE A;  4DTN A;  1XC9 A;  3AV9 A;  2R7Y A;  2P9U A;  3TWH A;  3ISN C;  3VF4 A;  1HKC A;  4ZTF A;  1EWQ A;  4YHH K;  3O9R A;  5SZT A;  3BF1 A;  4DR3 K;  3CC7 N;  4J2D A;  5GAG P;  5DM7 L;  1Q8I A;  4JAX A;  1KLM A;  3ZEU A;  5FLX O;  1RDC A;  1QQC A;  1T3V A;  2W41 A;  3BZC A;  5HRN A;  5I9E B;  1HPM A;  3UB5 A;  1RBV A;  5JVH L;  1RT2 A;  3FZL A;  1IKY A;  5JS1 A;  4FW2 A;  4LF8 K;  3HPO A;  1NLV A;  3RR7 A;  4DV6 K;  4CES A;  4CJL A;  2ZD1 A;  5EOY A;  2PFU A;  4PUO A;  1BA0 A;  3F5T A;  3MEG A;  5BRE A;  5KRT A;  4EZ6 A;  1QTM A;  2D4W A;  1NGI A;  4FM1 A;  5J2Q A;  4KHP K;  1LAV A;  3OS1 A;  4KHQ A;  4O0I A;  4FZZ A;  1BIS A;  3NFA A;  3AA3 A;  3KZB A;  3J8A A;  3SMS A;  5LMU K;  1HNX K;  3KTQ A;  4HVJ A;  1OH5 A;  4PL7 A;  4JK8 A;  5GAH P;  2OZS A;  4DTX A;  4CZF A;  1OH8 A;  1NGJ A;  3KK3 A;  3P5J A;  2FBV A;  5LMN K;  2VWB A;  1OVY A;  5CZ1 A;  4UY8 O;  1IV0 A;  3EKS A;  5AQZ A;  5BPN A;  3DWL A;  2OPS A;  1U48 A;  3FFK B;  1GOA A;  1T05 A;  3TAR A;  1YTU A;  4FJI A;  4B1U B;  4B1X B;  3ZX2 A;  2GWK A;  3C0B A;  4WFB L;  4Y0W A;  1XI1 A;  3D2F B;  4FSV A;  3HM9 A;  4H0P A;  3CC4 N;  4IFE A;  4CHZ A;  4YDU C;  3QDK A;  2ZGY A;  4F3T A;  4FXD A;  2P9I A;  5AQJ A;  4DTM A;  4JI1 K;  1E4F T;  2HHI A;  1S6P A;  3B8A X;  4DSJ A;  3HZ6 A;  4JK9 A;  4IJA A;  3HM8 A;  4AHT A;  1IG9 A;  2DY4 A;  1NNE A;  1IBK K;  2QXF A;  3U9Z A;  3OYN A;  4WQ4 C;  1QQO A;  2P5O A;  1T6D A;  3MN5 A;  3NMU A;  3U3G A;  3JS6 A;  1BCO A;  4XH5 A;  2NRX A;  3SZ2 A;  5AQX A;  2I7N A;  4DUZ K;  4FJ9 A;  3W0L A;  5I42 A;  3NDK A;  3KLG A;  1XNR K;  1W2B M;  3QO9 A;  4GKJ K;  1S9E A;  4CER A;  1L3V A;  1KVA A;  2HNZ A;  3V81 A;  3CCV N;  1RBR A;  3G4S N;  3CPE A;  4RW7 A;  5LJW A;  3VA3 A;  1CLQ A;  4FJ5 A;  4OKJ A;  1L3T A;  3DI6 A;  5EXW A;  4X62 K;  5DMR A;  4CJT A;  2QKB A;  2NUB A;  4A2B A;  5KQ8 A;  4FJG A;  4J2B A;  4CI6 A;  1NGC A;  4BG8 A;  2QWR A;  1KCF A;  1ZBH A;  3LAN A;  4LY7 A;  4AH9 A;  1CZA N;  3A0I X;  3LM9 A;  4X64 K;  4WF9 L;  2P9N A;  2Y1J A;  3AAP A;  5TKY A;  5EVZ A;  5C24 A;  2O8C A;  2P9L B;  4NYF A;  1J5O A;  4FK4 A;  1U2V A;  4I2Q A;  3H08 A;  5GAE P;  4Z4H A;  1FK9 A;  1VQ4 N;  1R59 O;  2HHH K;  2AA4 A;  3LP0 A;  4CJQ A;  4CHQ A;  1EQY A;  4M7Y A;  3P4I A;  2DFE A;  5BR8 K;  3QEV A;  2P1J A;  3FFI A;  3D0P A;  4JK7 A;  1YVU A;  3VEO A;  2I5J A;  4DSE A;  4CIE A;  1TUY A;  5AQI A;  4DTU A;  5JLF A;  3AY9 A;  4B9Q A;  4WFN L;  3WXL A;  1T6C A;  2V7Y A;  5KPR A;  3HVR A;  4DR7 K;  3HP9 A;  1W7A A;  3WEE A;  4JNE A;  3DLK A;  3CJB A;  4DV0 K;  4FVM A;  3HXM A;  3R3L A;  2W00 A;  4C8M A;  3MX2 A;  3IS9 A;  3THX A;  3CCE N;  4CBU A;  4IOA L;  3OYA A;  3TAE A;  3HTV A;  5CYM A;  3SAF A;  3TAQ A;  4DFK A;  1TVR A;  4GNI A;  4BE7 B;  1RBS A;  2VGN A;  4EHU A;  3TSU A;  3BUZ B;  4WFA L;  4ISG A;  3C6H A;  4JI3 K;  4LH4 A;  4JI8 K;  1RDB A;  4JV5 K;  4YDU A;  1K8K B;  5BR9 A;  1C0F A;  4JN4 A;  3K5M A;  3QET A;  4Z4I A;  3AO2 A;  4M3T A;  3AVC A;  4DTO A;  2A1R A;  3C6U A;  3EEQ A;  4M3Z A;  5HRP A;  3TAP A;  4A5A A;  1VSD A;  2Z1J A;  4DSF A;  4FZX C;  5FRN A;  4NXM K;  4WQ4 A;  1C0U A;  2VQE K;  1XHX A;  5F2R A;  5AQR A;  2C1G A;  4FJ8 A;  4CJS A;  4IFV A;  2Z1G A;  2YV0 X;  3V9S A;  3DRR A;  3PIO L;  3ZSO A;  1K6Y A;  3O9Q A;  1C1B A;  1Z26 A;  2VYP A;  2FSJ A;  1NKB A;  5SWM A;  3NBP A;  3OYG A;  1RIL A;  4FJ7 A;  4BQZ A;  4N76 A;  3MEC A;  3WXJ A;  3CER A;  2FLO A;  3O8M A;  2XO7 A;  3E9P A;  3L0Q A;  4NXN K;  3O08 A;  1WAF A;  3O4Q A;  4BR4 A;  3GG4 A;  3ZT2 A;  1X9J A;  1YI2 N;  1TL3 A;  4JI2 K;  5AQK A;  4H0T B;  3SV3 A;  3MN9 A;  4DFP A;  1NKE A;  3TAF A;  2YNG A;  4QCL A;  1WSE A;  4CJP A;  5FPM A;  3WNG A;  2G8K A;  3NGI A;  2P9K A;  5AQM A;  3NCI A;  3QIC A;  2YX6 A;  5FRO A;  5D3G A;  1HNZ K;  1LW2 A;  1Q9X A;  2D0C A;  2OA8 A;  4KRF A;  4W5N A;  1L3S A;  1ZXO A;  4CJ5 A;  4O0J A;  4KB1 A;  1IG8 A;  4IO9 L;  3W3D A;  3AA4 A;  4IZ9 A;  1WN7 A;  1S1X A;  5FPN A;  1JL2 A;  1MU2 A;  3ZLJ A;  1DTT A;  4AHR A;  4O5B A;  4CFA A;  4AQY K;  3UKU A;  2QKK A;  4CIG A;  2O8B A;  1JLA A;  1OVQ A;  1XC3 A;  2V51 B;  3QBW A;  1VQ7 N;  4K43 A;  3DM2 A;  3OYF A;  3OYI A;  2XY6 A;  1S3X A;  4DQI A;  4DCH A;  3SYZ A;  3BF3 A;  1BI4 B;  1J6Z A;  4NCA A;  3V4I A;  1LWF A;  4DV7 K;  4JKF A;  4CGF A;  4OPJ A;  2CH5 A;  3G71 N;  3VQP A;  4AHU A;  4JKC A;  1RT6 A;  2G8W A;  1IBL K;  3DJC A;  3K0S A;  1N6Q A;  4B9T A;  2UXC K;  1HPZ A;  3EN9 A;  2Z1I A;  4YOR A;  3EO3 A;  5CYQ A;  4IDK A;  4JKE A;  3C7N A;  3ZYY X;  1KLN A;  1RT1 A;  4JI0 K;  1HX1 A;  2XY5 A;  4K8X A;  4JHD A;  5F0X A;  2F9W A;  1EET A;  3LAM A;  3G0Z A;  5HRS A;  4CW7 B;  2X78 A;  4HHT A;  3M8P A;  4CJW A;  2HMI A;  4CZE A;  1Z6R A;  2YNI A;  3M8S A;  3K9K A;  4CEB A;  1T7P A;  1D9D A;  1NGA A;  3LM2 A;  4LF9 K;  3P83 D;  4Z4G A;  1X9S A;  1BCM A;  2RKI A;  3T1A A;  5HRR A;  1WSG A;  1VQP N;  1RNH A;  3FLC O;  3ZET B;  1Y64 A;  3CIP A;  1FW6 A;  4B3O A;  5EX5 A;  4LF6 K;  4LF4 K;  3V1Q A;  4LD0 A;  4GY2 B;  2GEL A;  4KH6 A;  3T69 A;  1KC8 O;  3DLR A;  1KQS M;  5EY4 A;  3HI0 A;  3WXM B;  1RDW X;  4GV6 A;  2XHB A;  4DSL A;  2NRW A;  3DLG A;  3SQ2 A;  3F73 A;  3KLE A;  2QWQ A;  4Z4F A;  3MWP A;  3CM5 A;  1BL3 A;  5BRH A;  1WNS A;  4CBW A;  5KRS A;  4CF2 A;  4DR6 K;  2WON A;  3HST B;  2Y1I A;  1MDU B;  3ZX0 A;  2DFF A;  4JKB A;  3RTV A;  1S1V A;  5J1E A;  1DT9 A;  4B3T K;  1TYQ B;  3NH0 A;  4E72 A;  3T1Y K;  3SUP A;  1MWM A;  2KTQ A;  3DAW A;  1ASU A;  1NGB A;  3PSF A;  3EL2 A;  4CHP A;  1IKW A;  4YFU A;  4KHW A;  3O9T A;  4EIA A;  3K57 A;  2DPN A;  3LPU A;  3RWU A;  1HNI A;  3A5O C;  3CG7 A;  4O44 A;  1NG9 A;  3TSP A;  1HYV A;  4H4O A;  3AVF A;  1RBT A;  1LAW A;  2E8A A;  2D0A A;  2EX3 A;  2FC0 A;  4ILH A;  5C25 A;  1VSE A;  3LP3 A;  3VN5 A;  1KXP A;  2HST A;  3GL1 A;  3THW B;  4FLT A;  3SQ1 A;  4DWI A;  5C2F A;  1X3M A;  5AQG A;  3TU5 A;  2CGL A;  2PY5 A;  4AM7 A;  4BRE A;  2Q31 A;  4JRP A;  4PKH A;  3MN6 A;  3AVH A;  4ILJ A;  4B8C A;  5BRD A;  2F7T A;  3KJV A;  3M3Z A;  1QS4 A;  1S1T A;  4GV3 A;  3GBT A;  4I6M B;  4JKD A;  3CFR A;  3TAM A;  4IBN A;  3QEI A;  1LW0 A;  4DSI A;  4NLB A;  3THY B;  3VGK A;  5J2N A;  3H46 O;  3BZK A;  3RR8 A;  5HP1 A;  2YNF A;  5IWA K;  4K0K K;  4EAH D;  4PHT X;  3AVN A;  3IMX A;  1BWF O;  4FW1 A;  2HF4 A;  4JI6 K;  1TK5 A;  3CJ9 A;  3WUH A;  4BC4 A;  1VSJ A;  2CH6 A;  4YNQ A;  4CZJ A;  1L3U A;  3MK6 A;  4O8U A;  3OYB A;  3LAL A;  4C23 A;  1V4T A;  2Q0R A;  4A5B A;  4IEI A;  5AR0 A;  1SKW A;  3CJA A;  4J2A A;  1NJW A;  3V1O A;  3PIP L;  3MXI A;  5HLF A;  5GIN A;  3J80 O;  5FDL A;  4LFC K;  4DQR A;  3LAK A;  3CCQ N;  1NGF A;  2QM1 A;  3VEX A;  2GUI A;  2G8V A;  1KSP A;  4JEP A;  3NGY A;  4WE1 A;  1JLB A;  1RDU A;  1I94 K;  1GLF O;  2P9P B;  4HCC A;  3MN7 A;  4WYB A;  3QLH A;  1Z05 A;  5JVG L;  3CYG A;  1BDG A;  4AHV A;  5AZI B;  2E2Q A;  2QWM A;  1MWK A;  1FXX A;  4QOZ B;  3P38 A;  2RHK A;  2G8H A;  3PSI A;  3PV8 A;  1WSH A;  1WBD A;  3ZX3 A;  2B6A A;  3IAY A;  4E19 A;  5CE3 A;  5AFU A;  4CGH A;  4FLX A;  2WC9 A;  2V52 B;  4CF0 A;  4BR5 A;  2ZGZ A;  2LSN A;  4OO1 J;  1YVN A;  1X3N A;  3OYL A;  4FPB A;  1QHA A;  4FLZ A;  1NU0 A;  1N8R O;  1VQ6 N;  3NF6 A;  4F8R A;  3GE1 A;  4BGA A;  4BRO A;  4E7L A;  4B9S A;  4KHN A;  4FWO A;  1JL1 A;  4OX9 K;  1VAZ A;  1NK6 A;  5M1N A;  1SKS A;  3PX0 A;  4BG9 A;  4H5N A;  4L3Q A;  4CF9 A;  3WNE A;  3O4W A;  2VWJ A;  4BQL A;  3IUC A;  5KQD A;  1X1P A;  4YOY A;  4KTQ A;  2YKM A;  4ZHR A;  2J4R A;  1CXU A;  4H0O A;  4EFH A;  3AVA A;  4DUY K;  1G15 A;  4H0X B;  4CZH A;  1UOC A;  5JMV A;  3KK2 A;  5KPZ A;  4CF1 A;  3ID8 A;  4IOX A;  5J2M A;  1NJI O;  2WBN A;  2KKZ A;  2A6A A;  4A57 A;  4E7K A;  1S6Q A;  3VES A;  4N41 A;  2W6L A;  2HVI A;  1SS6 A;  1OH6 A;  3QBX A;  3CCL N;  4B9M A;  2E2N A;  2UXB K;  3AVI A;  4LF5 K;  4MFB A;  3OY9 A;  3OYK A;  4Z4C A;  3V9U A;  4CZL A;  5C2D A;  1XQS C;  4LC9 B;  4BC2 A;  4FYD A;  3RRH A;  2GV9 A;  3PX4 A;  1J9A A;  1M90 O;  5E84 A;  3M1F A;  1ZBF A;  4I9Q A;  4WCE L;  2IAJ A;  3OYH A;  1ZBI A;  2HND A;  3AGR A;  3AVJ A;  5C42 A;  3F9M A;  4OJR A;  1SUQ A;  3OBY A;  3AAQ A;  4K25 A;  3VQ8 A;  3F2K A;  1EX4 A;  4DR2 K;  1HNW K;  4NLC A;  1F21 A;  3MXJ A;  4N5S A;  1EXQ A;  1GOC A;  4BY9 C;  2O4G A;  5HRO A;  2G8U A;  1KTQ A;  1JCG A;  5JS2 A;  2A5X A;  4I9L A;  3DOK A;  2EHG A;  4HCB A;  3SJH A;  1HMV A;  5M1P A;  1XMO K;  4KRE A;  4CZK A;  2FBX A;  3G25 A;  4L8R B;  2HHU A;  4FO0 A;  1SZ2 A;  2HHV A;  5LL6 Z;  3D45 A;  3CF5 L;  2O8D B;  3ULE B;  3ZSQ A;  4H5T A;  4CK3 A;  3OA9 A;  4FJN A;  3I55 N;  2PAV A;  2IGI A;  4HUE A;  1J53 A;  1NGE A;  3LPT A;  3K5N A;  5KI6 A;  4KHY A;  1V4S A;  2D0P A;  1O1W A;  1QE1 A;  3L2R A;  2P9S A;  3VQQ A;  4BRD A;  5GIO A;  2HHQ A;  1TKZ A;  3H45 C;  2BAN A;  3DXM B;  4H5R A;  4KKO A;  3LZI A;  3M6G A;  2KZZ A;  1W0H A;  4CZM A;  3SAG A;  2YCH A;  3L2V A;  2HHW A;  3VQD A;  2IOC A;  4FCY A;  4I2P A;  4BWM A;  4NO7 A;  3VA0 A;  1JLQ A;  2QXL A;  4BAC A;  4EP5 A;  1WSI A;  5AFU H;  3F9K A;  3HOT A;  2BUP A;  2CGK A;  4PQU A;  4ILG B;  1A5W A;  4FJX A;  3AAR A;  1IJJ A;  3LDN A;  2WOM A;  1RT5 A;  2RF2 A;  4DFM A;  2OYQ A;  4Z0U A;  2E88 A;  1QQM A;  4FM2 A;  3MMV A;  3KLF A;  1BI4 A;  3UKR B;  1VK0 A;  3GDQ A;  1NJZ A;  3ULD A;  2QWN A;  5AQW A;  1ZC6 A;  1JCE A;  1W9H A;  1D5A A;  1XMQ K;  1ZBU A;  1BGX T;  2QK9 A;  4LSL A;  3AVB A;  3QIO A;  4DKW A;  4M3R A;  4JKA A;  1NWK A;  3DLH A;  4BRF A;  4HWI A;  1GLJ O;  1VHX A;  1U49 A;  5AJ3 K;  2UUB K;  1HNV A;  1JCF A;  2YHA A;  3AO4 A;  3KWG A;  1JKH A;  1UAX A;  1DGK N;  1YXQ A;  3ATV A;  1HYS A;  4DS5 A;  3NE6 A;  4NCG A;  1NJX A;  4DG1 A;  4O8K A;  3HL8 A;  2IDO A;  3L4Q A;  1I3A A;  3SMP A;  2OPQ A;  3N4Q A;  1A5V A;  3CQ8 A;  3LDS A;  3VER A;  3O3G A;  1CZ9 A;  1DKG D;  4QAG A;  4W5R A;  1Q82 O;  3EZ5 A;  3AA2 A;  2NRT A;  3HPG A;  4FWQ A;  4BRC A;  4CJF A;  4DV3 K;  1QSL A;  3G10 A;  5AQP A;  1KD1 O;  3AA5 X;  3CQX A;  1ASV A;  3U9D A;  1HUX A;  2YHY A;  2XRI A;  4DSK A;  5I3U A;  1WLJ A;  4CEA A;  3SUN A;  3EYZ A;  3T7Z A;  3E9O A;  2HBJ A;  3CXC M;  3C95 A;  4A2A A;  1BA1 A;  1S5J A;  5AQQ A;  1EWR A;  5KPT A;  1D4X A;  5BPL A;  4E89 A;  4X65 K;  1HYZ A;  1TYQ A;  1NK4 A;  1GOB A;  2FBY A;  2PYL A;  3ZSX A;  4C8N A;  4W5T A;  2E2O A;  2AJQ A;  4DU1 A;  2G8F A;  1WBB A;  2ASP A;  1LOT B;  2D1K A;  4RG8 A;  5AQT A;  1YIJ N;  3MX5 A;  5M1K A;  2KFZ A;  4I7F A;  3OYE A;  1GLL O;  3LDQ A;  3THW A;  4DR1 K;  3WXI A;  1HJO A;  3M8Q A;  3SV4 A;  3JXU A;  4OPK A;  1BHL A;  5J2P A;  3O6W A;  4CHN A;  1VRT A;  2QWP A;  2ZJR L;  3VMF B;  1VQ8 N;  1C1C A;  1RDA A;  2HB5 A;  2NRH A;  3VEZ A;  1NBW A;  1C0G A;  4DLE A;  2P9I B;  1WAJ A;  1RCH A;  2A3Z A;  1W97 L;  4I6M A;  2P5G A;  3O4N A;  1SQK A;  4KTW A;  4JS5 A;  1BOT O;  3TR8 A;  3L2W A;  1QZ6 A;  2GUP A;  2KQ2 A;  1XHZ A;  3CCR N;  2E20 A;  4CFC A;  3RSE B;  1L5U A;  2HHT A;  4H03 B;  3B6O A;  3J7A P;  5KTQ A;  1TK0 A;  3VQ4 A;  3SI6 A;  2I7P A;  5MLC Q;  3JSM A;  3BEX A;  1N5Y A;  3S9H A;  1HQE A;  3H1Q A;  3PX6 A;  2P51 A;  2W6K A;  4H4M A;  3S3M A;  2PYJ A;  2KLA A;  4ISE A;  4FOE A;  1SL0 A;  4C1N K;  1TKD A;  3E01 A;  3M8R A;  4BRA A;  3HBT A;  3AVG A;  3K5O A;  2CGJ A;  1HKB A;  3FGU A;  4MDB A;  1NMN A;  3L2U A;  4DTS A;  1HQU A;  3SNN A;  4F4K A;  2HNY A;  3IG1 A;  4HUF A;  4CEC A;  4XH1 A;  2JLE A;  3MAQ A;  1HRH A;  3CJ7 A;  2FF6 A;  2QTD A;  3GOI A;  2Q0U A;  2RN2 A;  5AZI A;  3HOS A;  5KGX A;  1GLB G;  4MO5 A;  2VGM A;  3PUF A;  1N32 K;  4IG3 A;  5E41 A;  1JJ2 M;  4FJL A;  4RW6 A;  2P9N B;  4Y1D A;  1BU6 O;  4DFJ A;  4BGB A;  4J2E A;  4JD2 B;  4E0D A;  4EP4 A;  1C0M A;  1YAG A;  3OS2 A;  3HYF A;  4H0V B;  4FK0 A;  3KD5 E;  1E3M A;  4FZY A;  1NGH A;  1U2V B;  3BP8 A;  2YHX A;  1ZBL A;  1MA9 B;  3LDL A;  4YOU A;  3TSQ A;  2F8T A;  3HK2 A;  4CJ7 A;  4FWM A;  4C8L A;  1FKP A;  1M1K O;  2HHS A;  2GEM A;  4BR2 A;  1WSJ A;  3BGR A;  3CFO A;  3M5R A;  3A8Y A;  3V9W A;  2YJE A;  1XUP O;  3SUO A;  2VQF K;  3AVM A;  3FZF A;  3DMJ A;  4MLH A;  2ZE2 A;  3VQE A;  2UU9 K;  3KVG A;  3IFR A;  1R0A A;  1RT7 A;  3KKS A;  3ZSR A;  4G1Q A;  4RW9 A;  1O13 A;  2BDP A;  3ASM A;  3DXK B;  1IBM K;  2Q97 A;  3KKR A;  4B8A B;  2JGU A;  1JLC A;  3J81 O;  5CHI A;  3ZT4 A;  1DTQ A;  3NGZ A;  2RPI A;  3KHY A;  1DEJ A;  1RDD A;  1TV6 A;  4FJM A;  2NNW A;  1QZ5 A;  3R9P A;  5A2Q O;  5FPD A;  2F9T A;  3VTI A;  2O8E B;  3OVN A;  3OTO K;  2G8I A;  2KW4 A;  4KFB A;  5CZ2 A;  3MEE A;  1HLU A;  4YOW A;  1P8Z A;  3CET A;  4CD1 A;  4JLH A;  3QNN A;  1KVC A;  4DTR A;  3ATU A;  1OKJ A;  3HP6 A;  1XWL A;  2UUA K;  4DF8 A;  4BRM A;  4OVL A;  4B3M K;  3RVC A;  1N34 K;  3OYC A;  2VCP A;  3D2F A;  4RW4 A;  4E7I A;  4JI4 K;  3AVK A;  4JKH A;  1S1W A;  2GWJ A;  1Z25 A;  1P90 A;  3TPQ A;  5BN9 A;  4GVM A;  5ELZ A;  4BVP A;  3WQT A;  1KFS A;  1S9G A;  5B8H A;  3EY1 A;  4PKG A;  4WQ5 C;  3Q7C A;  3TTD A;  1T8E A;  2B5J A;  2FXU A;  2HBK A;  4YOV A;  3JAM O;  3VQB A;  3VQA A;  4CVN E;  2GTD A;  3WNF A;  4ID1 A;  1ATR A;  3R8E A;  4H5W A;  4B1Z A;  2BGG A;  2Q3S A;  3D2E B;  3DOL A;  4FJH A;  4IO8 A;  1ESV A;  3ZCM A;  3NHG A;  5AQO A;  3OS0 A;  4M3X A;  2O8D A;  3ULE A;  1QHT A;  2QWO A;  4DF4 A;  2BH1 A;  4QS8 A;  4B3S K;  4FJJ A;  3LDO A;  4DV5 K;  4B1V A;  5C0Y A;  4BVO A;  4CGJ A;  1U45 A;  4CE9 A;  4B9L A;  1Y97 A;  3CI5 A;  3MED A;  4ISF A;  4BRN A;  1SL2 A;  3VF6 A;  4FLV A;  3DXM A;  3A2F A;  3QNO A;  4CCH A;  4FWL A;  2E4L A;  1TK8 A;  4BR9 A;  2OCE A;  4E3S A;  4ZTJ A;  1KRP A;  1ITG A;  3ENH A;  3V9Z A;  1B92 A;  1EKE A;  3TTF A;  4Q5V A;  1S1U A;  1TGO A;  4ELT A;  4JKG B;  3QML A;  4F9O A;  2ASO A;  3UKU B;  2WTU A;  3CHW A;  4PA1 A;  4DLG A;  2O8B B;  5AZJ B;  4H8K A;  4E1N A;  2OPP A;  3WQU A;  3FZM A;  1WSF A;  3VEN A;  4AIL C;  4E7J A;  2IVO A;  1E4G T;  2H3G X;  3HVT A;  4BE2 A;  2JWK A;  4CJK A;  3FR0 A;  3HT3 A;  3UKR A;  4QS7 A;  4FLU A;  4DTP A;  4BRL A;  1CZB A;  2P9L A;  3L3U A;  4E1M A;  4BDP A;  1SKR A;  2YHB A;  4RW8 A;  2BTF A;  1X9W A;  3DLE A;  2KZM A;  1TL1 A;  1TKT A;  3CMA N;  4FLW A;  5EU7 A;  3T19 A;  4J8F A;  4C8K A;  2B4J A;  1T44 A;  1GLA G;  4AM6 A;  1QQN A;  3L2Q A;  3TAB A;  3ZT0 A;  4Z4E A;  4CZG A;  3Q7B A;  4CZI A;  4IWV A;  4CJE A;  5C10 A;  5FRM A;  4K8Z A;  5AQV A;  4Z94 A;  2FF3 B;  2NRZ A;  4CFD A;  1TKX A;  3WNH A;  2UUC K;  3LP2 A;  3L6Q A;  4CHO A;  4RTF D;  4JI5 K;  1FJG K;  4XIU A;  4GVE A;  4ID5 A;  4LFB K;  4NYN A;  3ID6 A;  1VQN N;  3ALY A;  2ATQ A;  5M1F A;  3PO4 A;  3UE5 A;  4EHT A;  3CD6 N;  1BIU A;  1KVB A;  3KK7 A;  2F96 A;  2IS3 A;  3SQ0 A;  3A5M C;  5HOO A;  4UQG A;  3O3F A;  2UYT A;  2HMP A;  4OKK A;  4JRQ A;  1I39 A;  2D0O A;  3N4P A;  4W5Q A;  3O1B A;  4DHY A;  3L8B A;  3QER A;  1NK5 A;  3OJU A;  3VQ9 A;  2ITM A;  5LY3 A;  3BDP A;  1K8K A;  4A62 A;  1YJN N;  1Q18 A;  3VOV A;  2WFB A;  3HPH A;  1KAY A;  2OAN A;  2E5L K;  4WQ5 A;  1VSM A;  3NH1 A;  5AQN A;  3K9J A;  5JIC A;  1Q9Y A;  4DV4 K;  2E1Y A;  5M1O A;  3TI0 A;  5HL7 L;  3LDP A;  1C6V A;  1NOZ A;  3AO5 A;  2OTL N;  3VQ5 A;  1JLE A;  1VQK N;  4JI7 K;  4BR0 A;  1D8Y A;  3FZK A;  2JWL A;  4O4G A;  3A5L C;  3C65 A;  1IKX A;  4MO4 A;  3VEY A;  1U6Z A;  4CD3 A;  3HJF A;  2KFN A;  3OYD A;  3AVL A;  4LH5 A;  4HUG A;  3VET A;  3MXM A;  3OW2 M;  4B9U A;  3O9S A;  4LSN A;  4M42 A;  2E6M A;  2KHO A;  4PWD A;  2QWL A;  1YUW A;  3J7Y P;  3L3V A;  3CCM N;  2HHX A;  1WUA A;  3U6F A;  2RE2 A;  4H5V A;  3CME N;  3KLI A;  5CY4 A;  1TAQ A;  5BRF A;  2VWK A;  1YHQ N;  3VQ7 A;  1NK0 A;  4RCH A;  4DU4 A;  3U3Y A;  4BRG A;  1NK8 A;  4K42 A;  2PBD A;  4FPA A;  1WOQ A;  2A40 A;  3RSE A;  3RRG A;  2IC3 A;  3VQC A;  1LV5 A;  1RTD A;  3DLB A;  1C0T A;  2EWS A;  4KH5 A;  1NK7 A;  4B9V A;  1BO5 O;  2O8F B;  2OPR A;  3K58 A;  1K8A O;  3K5L A;  3PO5 A;  4YOX A;  2Q2R A;  3IDH A;  1JXB A;  4OPA A;  3S3N A;  4BEC A;  1HR0 K;  4U67 L;  3DRP A;  4C8O A;  3HO1 A;  4CHY A;  3OHR A;  4MQ3 A;  3SBG A;  2NRV A;  3SPY A;  1BIZ A;  4LF7 K;  3D7E O;  3T1H K;  1VSK A;  3IRX A;  1ZBS A;  4IFY A;  3EE9 A;  4IKF A;  3QIN A;  4FLY A;  3CPW M;  3SBT A;  3LWL A;  2Q1N A; 
#chains in the Genus database with same CATH homology
 1BA0 A;  5MLC Q;  3TU5 A;  2CGL A;  3BEX A;  4A61 A;  3F5T A;  4AM7 A;  4BRE A;  5BRE A;  4JD2 A;  2Q31 A;  3J7Z O;  3H1Q A;  4PKH A;  4QS9 A;  3QB0 A;  3MN6 A;  4ILJ A;  5BRD A;  2P9U B;  2F7T A;  3O1W A;  2KLA A;  3M3Z A;  4ISE A;  4FOE A;  2D4W A;  1YJ9 N;  4GV3 A;  1NGD A;  1NGI A;  3GBT A;  2FSN A;  4C1N K;  1YF5 L;  4GV9 A;  2NZT A;  4I6M B;  4JKD A;  4BRQ A;  4BRA A;  3HBT A;  5M1Q A;  4G9Z A;  2CGJ A;  1HKB A;  3FGU A;  4MDB A;  3VEV A;  4NLB A;  3KZB A;  3VGK A;  3J8A A;  3SMS A;  4FWR A;  3H46 O;  5C12 A;  5CR4 A;  4JK8 A;  4PL7 A;  3ZEU B;  5GAH P;  3E66 A;  4CZF A;  3LL3 A;  1NGJ A;  4EAH D;  1SAZ A;  4PHT X;  3AGK A;  3IMX A;  1RFQ A;  1BWF O;  4XH1 A;  3ZET A;  2HF4 A;  3CJ9 A;  3CJ7 A;  2FF6 A;  2ZWH A;  3TTC A;  2QTD A;  3GOI A;  3WUH A;  4BC4 A;  2Q0U A;  4C1N I;  2CH6 A;  2VWB A;  5AZI A;  4CBX A;  3HOS A;  1OVY A;  4CZJ A;  4UY8 O;  1GLB G;  4MO5 A;  5AQY A;  3MK6 A;  4O8U A;  4IDH A;  3H1V X;  2VGM A;  3EKS A;  5AQZ A;  5BPN A;  3DWL A;  4C23 A;  1JJ2 M;  1V4T A;  1ILY A;  3FFK B;  2P9N B;  2Q0R A;  4A5B A;  4DQ8 A;  4IEI A;  1BU6 O;  5AR0 A;  3CJA A;  4BGB A;  4IOC L;  4JD2 B;  1G99 A;  3PIP L;  4B1U B;  4B1X B;  5GIN A;  3ZX2 A;  2GWK A;  3C0B A;  1YAG A;  4WFB L;  3DXK A;  4H0V B;  4Y0W A;  1NGH A;  1U2V B;  3WXK A;  3BP8 A;  3D2F B;  4FSV A;  1NGF A;  3CCQ N;  2QM1 A;  3VEX A;  4H0P A;  2YHX A;  3CC4 N;  1MA9 B;  3LDL A;  4IFE A;  4YOU A;  3TSQ A;  4BC3 A;  3HSC A;  4YDU C;  3QDK A;  2ZGY A;  4CJ7 A;  4FWM A;  2P9I A;  5AQJ A;  1GLE G;  4JEP A;  1E4F T;  5LJV A;  1RDU A;  4KBO A;  1GLF O;  3B8A X;  5AQH A;  3CJC A;  1M1K O;  2P9P B;  2GEM A;  4BR2 A;  3HZ6 A;  3MN7 A;  4IJA A;  3HM8 A;  4WYB A;  4JK9 A;  3VTH A;  2ZJQ L;  3M5R A;  1VQ5 N;  3A8Y A;  2YJE A;  3U9Z A;  1Z05 A;  4A59 A;  1XUP O;  4WQ4 C;  3G6E N;  5JVG L;  1BDG A;  5AZI B;  2E2Q A;  2QWM A;  1MWK A;  1QQO A;  3FZF A;  5AQF A;  3P38 A;  4MLH A;  1T6D A;  3MN5 A;  1EO1 A;  3FE1 A;  3KVG A;  2RHK A;  3IFR A;  4BRI A;  3FZH A;  3NMU A;  3JS6 A;  4XH5 A;  4U7B A;  2NRX A;  2C1I A;  3ZX3 A;  5AQX A;  2I7N A;  1O13 A;  3W0L A;  5CE3 A;  4NB4 A;  5AFU A;  3DXK B;  2YJF A;  3VGL A;  2NLX A;  2WC9 A;  2V52 B;  1W2B M;  2Q97 A;  3CJ1 A;  4BR5 A;  2ZGZ A;  5BPM A;  1NMD A;  4OO1 J;  1YVN A;  4XH4 A;  2ASM A;  1X3N A;  5CHI A;  1VQM N;  4FPB A;  1QHA A;  4MDA A;  4E1J A;  3G4S N;  3CCV N;  1N8R O;  3CPE A;  1VQ6 N;  4BEB A;  3KHY A;  3GE1 A;  4BGA A;  4BRO A;  5LJW A;  1DEJ A;  4FWS A;  2NNW A;  1QZ5 A;  4FWO A;  3R9P A;  4IJN A;  5FPD A;  2F9T A;  3VTI A;  5EXW A;  1VAZ A;  5M1N A;  3CCU N;  3H3N O;  3E1Y A;  4BG9 A;  4H5N A;  4L3Q A;  3O4W A;  3VPZ A;  2QEX N;  4BQL A;  3IUC A;  1HLU A;  4A2B A;  5KQD A;  5KQ8 A;  1P8Z A;  4YOW A;  3CET A;  4CD1 A;  4YOY A;  4CI6 A;  1NGC A;  4BG8 A;  2FSK A;  2QWR A;  3D2E A;  4BRK A;  2J4R A;  3ATU A;  1CZA N;  3A0I X;  3LM9 A;  4H0O A;  4EFH A;  2A42 A;  1VQO N;  1OKJ A;  2P9N A;  2Q36 A;  4WF9 L;  3AAP A;  2P9S B;  5TKY A;  4BRM A;  4H0X B;  1YJW N;  3EE8 A;  1QVF M;  4CZH A;  5EVZ A;  3EKU A;  5JMV A;  2P9L B;  3RVC A;  1U2V A;  3QFP A;  2VCP A;  3D2F A;  5KPZ A;  1KAX A;  3ID8 A;  5GAE P;  4IOX A;  4JKH A;  5TKW A;  1S22 A;  1NJI O;  2WBN A;  2GWJ A;  2KKZ A;  1VQ4 N;  4AF1 A;  1P90 A;  3TPQ A;  3CCS N;  5BN9 A;  1R59 O;  2GX9 A;  2A6A A;  2AA4 A;  5ELZ A;  4A57 A;  4BVP A;  2IIR A;  4BRP A;  3EZW A;  3WQT A;  3NVK A;  3VES A;  2HBM A;  5B8H A;  1EQY A;  1SS6 A;  2P9P A;  3P4I A;  4PKG A;  4FL9 A;  4M7Y A;  3S41 A;  1Q81 O;  4WQ5 C;  3Q7C A;  3SK3 A;  3TTD A;  2FXU A;  2HBK A;  3QBX A;  4YOV A;  3CCL N;  2E2N A;  4JK7 A;  4IXC A;  2GTD A;  4FWP A;  3VEO A;  1TUY A;  1ATR A;  3KWI A;  3D6R A;  5AQI A;  3R8E A;  3U8X A;  4H5W A;  4JKG A;  5JLF A;  3P31 A;  3AY9 A;  4B1Z A;  4B9Q A;  4CZL A;  3D2E B;  5C2D A;  1XQS C;  4WFN L;  4LC9 B;  4IO8 A;  5GIP A;  4BC2 A;  5AZJ A;  1ESV A;  3WXL A;  1T6C A;  2V7Y A;  5AQO A;  5KPR A;  1M90 O;  2IVN A;  5E84 A;  3M1F A;  3WEE A;  1VQ9 N;  3ULE A;  4JNE A;  2QWO A;  3CJB A;  2BH1 A;  4QS8 A;  3VEW A;  4WCE L;  3R3L A;  3QFU A;  3LDO A;  3SAH A;  2W00 A;  3AGR A;  4B1V A;  5C0Y A;  4BVO A;  3MX2 A;  3F9M A;  3I8B A;  3OBY A;  1Q7Y O;  3AAQ A;  4K25 A;  3CCE N;  4CBU A;  4IOA L;  3O5B A;  3F2K A;  4K41 A;  3HTV A;  2V7Z A;  3SAF A;  3CI5 A;  4ISF A;  4BRN A;  4NLC A;  3VF6 A;  3DXM A;  1BG3 A;  3R6M A;  4GNI A;  4BY9 C;  4BE7 B;  5GAD P;  3H3O B;  3A5N C;  2VGN A;  4FWL A;  1JCG A;  4HTL A;  4BR9 A;  4EHU A;  1QVG M;  3TSU A;  2A5X A;  3BUZ B;  4WFA L;  4ISG A;  3C6H A;  3U4L A;  2A41 A;  4B1W B;  4H0Y B;  5AQS A;  3SJH A;  5M1P A;  3ENH A;  3TTF A;  4YDU A;  1K8K B;  4JKG B;  5BR9 A;  2HBL A;  4DB3 A;  3QML A;  3WT0 A;  1C0F A;  4CZK A;  4F9O A;  1ATN A;  2ASO A;  2QI2 A;  3CHW A;  4JN4 A;  3UKU B;  5JLH A;  3G25 A;  5AZJ B;  2W40 A;  2NRR A;  4FOI A;  3WQU A;  4FO0 A;  1SZ2 A;  3FZM A;  3VGM A;  2ZF5 O;  5ADX A;  3CF5 L;  3WEE B;  3L4I A;  3VEN A;  3ULE B;  2E2P A;  4H5T A;  3O80 A;  4A5A A;  3OA9 A;  3I55 N;  2PAV A;  2IVO A;  1E4G T;  2H3G X;  3ENB A;  4WQ4 A;  2JWK A;  3CC2 N;  1NGE A;  3FR0 A;  1V4S A;  4FWN A;  5AQR A;  5F2R A;  2D0P A;  2C1G A;  3UKR A;  4YOT A;  2P9S A;  4QS7 A;  1YIT N;  4BRD A;  5GIO A;  4XJX A;  4BRL A;  2P9L A;  3H45 C;  3PIO L;  2BTF A;  3DXM B;  1GLC G;  4H5R A;  3O9Q A;  3CMA N;  1H1V A;  2VYP A;  1BUP A;  3M6G A;  2FSJ A;  4CZM A;  2HOE A;  3SAG A;  2YCH A;  1GLD G;  5C15 A;  4J8F A;  2YI1 A;  1T44 A;  1GLA G;  4AM6 A;  4BQZ A;  4NO7 A;  2QXL A;  1QQN A;  4PL8 A;  5AFU H;  3WXJ A;  3CER A;  4CZG A;  3Q7B A;  4CZI A;  2FLO A;  3O8M A;  4R79 A;  3HOT A;  4IWV A;  5C10 A;  2BUP A;  2CGK A;  3E9P A;  3L0Q A;  5AQV A;  4ILG B;  3O08 A;  4Z94 A;  2FF3 B;  2NRZ A;  4BR4 A;  3AAR A;  1IJJ A;  3GG4 A;  1X9J A;  1YI2 N;  3LDN A;  3VF2 A;  3L6Q A;  5AQK A;  4H0T B;  4RTF D;  3PLA A;  2E88 A;  1QQM A;  3MN9 A;  3MMV A;  3CQY A;  4GVE A;  2QA4 N;  3ID6 A;  1VQN N;  1KAZ A;  5FPM A;  3UKR B;  3GDQ A;  2P9K A;  5AQM A;  2QWN A;  1ZC6 A;  5AQW A;  5AQU A;  4BC5 A;  5EOY A;  3QIC A;  2YX6 A;  1JCE A;  5M1F A;  3UE5 A;  4EHT A;  3NVM A;  3CD6 N;  3KK7 A;  3DLL L;  4B1Y B;  4BR7 A;  3HRG A;  3H6E A;  4DKW A;  1ZXO A;  3A5M C;  4JKA A;  5HOO A;  1NWK A;  2UYT A;  4BRF A;  4HWI A;  1GLJ O;  2HMP A;  2ZJP L;  1IG8 A;  2D0O A;  4IO9 L;  3N4P A;  1JCF A;  3W3D A;  3O1B A;  4DHY A;  4IZ9 A;  3KWG A;  3C6A A;  4O5F A;  4M7X A;  1DGK N;  3P39 A;  5FPN A;  1YXQ A;  3ATV A;  3CCJ N;  2ITM A;  4FWK A;  5LY3 A;  3E9L A;  1K8K A;  2I7P A;  4A62 A;  1YJN N;  1Q18 A;  3VOV A;  3UKU A;  4O8K A;  1XC3 A;  2WFB A;  3L4Q A;  3ENO A;  4IEE A;  2V51 B;  1KAY A;  2OAN A;  3QBW A;  3SMP A;  1VQ7 N;  4K43 A;  3N4Q A;  4FVU A;  1S3X A;  4WQ5 A;  3VER A;  4DCH A;  5AQN A;  1DKG D;  3BF3 A;  1Q82 O;  1J6Z A;  2P9K B;  3K9J A;  2NRT A;  4FWQ A;  4JKF A;  4BRC A;  2AP1 A;  5JIC A;  1Q86 O;  3O9U A;  2CH5 A;  3G71 N;  2IVP A;  5AQP A;  1KD1 O;  2E1Y A;  5M1O A;  3CQX A;  4JKC A;  5HL7 L;  3U9D A;  3LDP A;  1HUX A;  2YHY A;  4M63 C;  3IKM A;  3DJC A;  4MLE A;  5DM6 L;  2OTL N;  1VQK N;  3EN9 A;  4BR0 A;  2HF3 A;  1VQL N;  3T7Z A;  4YOR A;  3FZK A;  2JWL A;  3E9O A;  3EO3 A;  4JKE A;  3SLC A;  3C7N A;  3ZYY X;  2HBJ A;  1RGI A;  3A5L C;  3C65 A;  4MO4 A;  1HX1 A;  1U6Z A;  5E26 A;  3VEY A;  4CD3 A;  3CXC M;  4JHD A;  3I56 N;  1ATS A;  5F0X A;  2F9W A;  5H1S Q;  1NGG A;  3VET A;  1LCU A;  3MCP A;  4A2A A;  3OW2 M;  1BA1 A;  5AQQ A;  2QW9 A;  5KPT A;  3MWT A;  3MCA B;  5BN8 A;  1NM1 A;  4BRH A;  4RWT A;  3O9S A;  4CZE A;  1D4X A;  3R1X A;  5BPL A;  1Z6R A;  2OTJ N;  2KHO A;  3K9K A;  2QWL A;  1YUW A;  1TYQ A;  1NGA A;  3LM2 A;  3CCM N;  1WUA A;  1HKG A;  2E1Z A;  2YHW A;  1K73 O;  2RE2 A;  4H5V A;  1VQP N;  3CME N;  2E2O A;  3FLC O;  3ZET B;  1Y64 A;  3CIP A;  2WUS A;  3I33 A;  5BRF A;  5EX5 A;  1YHQ N;  5F1X A;  5FPE A;  1TUU A;  4PKI A;  2ASP A;  4RCH A;  1LOT B;  4GY2 B;  4BRG A;  2GEL A;  4KH6 A;  3T69 A;  2D1K A;  4K42 A;  1KC8 O;  2PBD A;  4XEI A;  4OPH A;  1K9M O;  5AQT A;  4KH4 A;  3OBW A;  1YIJ N;  4FPA A;  3MX5 A;  3MDQ A;  5M1K A;  1KQS M;  1WOQ A;  2A40 A;  5EY4 A;  3HI0 A;  3C7N B;  3RSE A;  3WXM B;  1RDW X;  4GV6 A;  1GLL O;  2EWS A;  2NRW A;  3LDQ A;  4JHD B;  4KH5 A;  5ADX H;  5AQL A;  1BO5 O;  3WXI A;  1HJO A;  2QWQ A;  2PFU A;  3JXU A;  1S72 N;  3MWP A;  5BRH A;  1K8A O;  4CBW A;  3O6W A;  2QWP A;  4YOX A;  1MDU B;  3ZX0 A;  2ZJR L;  4JKB A;  3VMF B;  2Q2R A;  1VQ8 N;  2P9U A;  2NRH A;  3IDH A;  1DT9 A;  1NBW A;  3VEZ A;  1TYQ B;  1C0G A;  2P9I B;  4OPA A;  2A3Z A;  1MWM A;  1W97 L;  4BEC A;  4I6M A;  1HKC A;  3VF4 A;  3DAW A;  1SQK A;  4U67 L;  1NGB A;  1BOT O;  3O9R A;  3EL2 A;  3OHR A;  3BF1 A;  3SBG A;  2NRV A;  3CC7 N;  5GAG P;  5DM7 L;  1QZ6 A;  2GUP A;  3O9T A;  4JAX A;  3D7E O;  3ZEU A;  4EIA A;  3CCR N;  2DPN A;  1T3V A;  2W41 A;  2E20 A;  3A5O C;  5I9E B;  1HPM A;  3TSP A;  3UB5 A;  1ZBS A;  5JVH L;  3EE9 A;  3FZL A;  3RSE B;  2E8A A;  4ILH A;  1KXP A;  2HST A;  3GL1 A;  3CPW M;  1NLV A;  4H03 B;  3SBT A;  5C2F A;  2Q1N A;  1X3M A;  5AQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...