4XEIA

Orthorhombic isomorph of bovine arp2/3 complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
415
structure length
400
Chain Sequence
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-related protein 3
publication title Crystals of the Arp2/3 complex in two new space groups with structural information about actin-related protein 2 and potential WASP binding sites.
pubmed doi rcsb
total genus 102
structure length 400
sequence length 415
ec nomenclature
pdb deposition date 2014-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 4xeiA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4xeiA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4xeiA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4xeiA04
1Z05A 1NLVA 3H1QA 3IMXA 3O08A 3O1WA 2NZTA 4BR4A 2ZWHA 5AQSA 3I8BA 3ZEUA 4JHDB 1TYQB 3CJBA 2V7ZA 4M7YA 4QS7A 4FOEA 5AQWA 3U4LA 4BQLA 1HLUA 3DXMB 3D7EO 3CJ7A 2P9UB 1NWKA 1NGAA 2Q36A 3W0LA 4FL9A 1QZ6A 3WT0A 3A0IX 4AM6A 1RGIA 4K42A 4JD2A 1NGEA 3A5MC 1XC3A 3L0QA 4JN4A 3ZX3A 1GLJO 3LDQA 3VETA 5JMVA 3U9ZA 5AQYA 2F9WA 1BU6O 3HSCA 3UKRA 2GWJA 2I7NA 4XH5A 4M63C 3A5NC 3KZBA 2FXUA 4YDUA 1WUAA 4FWOA 4B1VA 5KPTA 3WUHA 4BR9A 3MN5A 4BRKA 3TU5A 4FWKA 4B1ZA 5EXWA 1RDWX 5BN8A 3WXIA 3H46O 1QHAA 2YHWA 1KAYA 4BROA 4ISFA 3DAWA 1Z6RA 3A5OC 4FSVA 2QWLA 2BUPA 3LDPA 3SK3A 4XEIA 2FSJA 4EIAA 4WQ4A 2CH5A 4H0YB 3DJCA 5AQQA 1GLCG 4EHTA 2OANA 2E88A 1T6DA 4RCHA 5FPEA 3D2FA 2P9LB 1GLAG 4BR5A 4WYBA 5BPLA 3W3DA 4ISGA 2Q1NA 1IJJA 3H3NO 2E2NA 1DEJA 1C0FA 1QQOA 2FF6A 4BG9A 2ASMA 3QICA 4BRNA 4CZFA 3FZMA 3H6EA 2A5XA 3L6QA 4RTFD 1MDUB 5AQPA 5EX5A 2P9KA 3U8XA 5TKYA 4BRGA 4JNEA 1QZ5A 1CZAN 1QQNA 5AQUA 2FSKA 1KAXA 2IVOA 2PAVA 2E20A 3LDLA 3C7NB 4O5FA 1U2VA 1IG8A 3HTVA 1HKBA 5EY4A 2QM1A 2V7YA 4BRDA 4KBOA 2VCPA 5LY3A 3A8YA 2Q31A 4I6MA 4H5TA 3S41A 5FPMA 1JCFA 2ASOA 1H1VA 4EFHA 2QWPA 4BR7A 2E1ZA 3WEEB 1YAGA 3TPQA 1GLDG 3CIPA 4FPBA 2HF4A 2VYPA 1EQYA 1JCGA 3VOVA 2V52B 1YXQA 1ZC6A 5E84A 5BRHA 5BRFA 4HWIA 3ZX2A 3EN9A 3KHYA 4PL8A 1NGGA 4QS9A 1R59O 3H3OB 5AQXA 5BPNA 4WQ5A 5AFUA 4B1UB 3FR0A 2ZF5O 5F1XA 3R6MA 3H1VX 3HM8A 1MWMA 5AZIA 2D0PA 3ENHA 3CETA 1C0GA 3EZWA 4FO0A 2A3ZA 1WOQA 4FWRA 4CI6A 3QBWA 5LJVA 2CGJA 4ISEA 4H0TB 3HI0A 3J8AA 4NO7A 4CBUA 1E4GT 2P9SB 3JS6A 4PKIA 4CD1A 5AFUH 1P8ZA 2CGKA 2P9IA 2QW9A 2YJFA 3LDOA 3A5LC 1S3XA 2P9NB 3DXKA 1SAZA 5I9EB 5KQ8A 5AR0A 3M6GA 5JICA 4H0OA 3FE1A 1DGKN 3VPZA 2EWSA 2H3GX 5EOYA 4FPAA 3VERA 2Q2RA 1BO5O 3ULEB 1KXPA 1LOTB 4XH4A 3MN9A 4NB4A 1NGHA 2QWRA 2I7PA 4A61A 3M1FA 1HUXA 3UB5A 3I33A 3VF4A 2IVNA 2FLOA 2Q97A 1GLEG 1DKGD 3GBTA 5AQZA 2ITMA 4A2BA 2KHOA 3RSEB 1MWKA 2YCHA 2YHXA 2A6AA 3GL1A 4BC5A 4BRPA 2YJEA 1ATSA 3WXLA 4CZKA 4J8FA 4BC2A 3AY9A 5AZJB 3UKUA 3M3ZA 2YHYA 3VESA 2A41A 4CZIA 4K41A 3ENOA 5FPDA 3QMLA 2HF3A 3MN6A 3WXJA 3VENA 3AAPA 4A62A 5EVZA 3LDNA 4BQZA 4JHDA 1TYQA 4BRAA 3IDHA 3ZETB 1X3MA 1RFQA 4XH1A 3G25A 2E2PA 3DXMA 4DHYA 1ESVA 1K8KB 3EKSA 4Y0WA 2P9UA 2D1KA 3DWLA 2GELA 5AQNA 1E4FT 4WQ5C 3VEYA 4CZEA 4IO8A 3KVGA 3MN7A 3VEWA 4MO4A 5JLHA 4Z94A 3CERA 4BRLA 1S22A 4K25A 1Q18A 3D2EA 5B8HA 4IXCA 2GEMA 2FF3B 5BR9A 3QFPA 2A42A 1TUUA 4MLEA 3VEXA 3O80A 1HPMA 4BG8A 3ZEUB 3AAQA 1KAZA 2CH6A 2FSNA 4GY2B 4FOIA 4BRIA 1MA9B 4MO5A 3FFKB 5AQFA 3ID8A 4FWQA 3GOIA 4B1XB 1JCEA 1V4TA 3AARA 5JLFA 3ATVA 4RWTA 3CQYA 3DXKB 4BC3A 4EHUA 4DCHA 4JD2B 4BRQA 1U6ZA 4H5NA 3VGKA 1T6CA 4FWNA 5KQDA 2BTFA 4BR0A 4H03B 2AA4A 3FZFA 3UKRB 2D4WA 1BG3A 3EL2A 4HTLA 2P9LA 2CGLA 5F0XA 5AQHA 3F9MA 3B8AX 4YDUC 4B1WB 2P9PA 3EO3A 3CI5A 3IUCA 4O8KA 3IFRA 3O4WA 3BUZB 3SMPA 4F9OA 3H45C 5AQLA 2VWBA 1T44A 4CZMA 4EAHD 3O6WA 4FWMA 5KPZA 1BWFO 1BA0A 4WQ4C 3JXUA 4MLHA 4BR2A 4BRHA 1GLLO 3R8EA 4FWLA 3C7NA 4BRMA 4BGBA 3FGUA 3LM2A 3VEZA 3D2FB 1BDGA 1GLFO 3CJ9A 2QWOA 4PKGA 2J4RA 3EKUA 4CBWA 3WQUA 1ATNA 5ADXA 4BVOA 1SQKA 5AQGA 2WUSA 3WEEA 1SZ2A 3QB0A 4LC9B 3O5BA 1NGFA 3GG4A 3GE1A 1X3NA 5BPMA 2W41A 1NMDA 1X9JA 2P9KB 3ATUA 4K43A 2D0OA 3FZLA 1G99A 3BF3A 4JAXA 3D2EB 1QQMA 1U2VB 3VGLA 4PL7A 5CE3A 2IVPA 5ADXH 5E26A 3CQXA 5BN9A 4C23A 3BEXA 4I6MB 3CJAA 3OHRA 4B9QA 3BF1A 4FWPA 4CD3A 3QDKA 4CZJA 1NGIA 2E2OA 3C0BA 4DB3A 5AQMA 1BUPA 5AQKA 1NGDA 5LJWA 4IJNA 4BRFA 3O1BA 1NM1A 5AQTA 3P4IA 1XQSC 2HOEA 2QWMA 3VF6A 1TUYA 2P9SA 2UYTA 2NLXA 1ZBSA 1HJOA 3FZKA 1NGCA 1GLBG 3SLCA 4BREA 2P9NA 5BREA 1ATRA 4H5RA 2Q0RA 3O8MA 3QFUA 3CJCA 3LL3A 5KPRA 2GWKA 1XUPO 1Y64A 4IWVA 1HX1A 2P9PB 2ASPA 3MMVA 3HZ6A 2E8AA 3ULEA 5AZIB 2AP1A 4BC4A 3WXKA 3FZHA 3ZX0A 1V4SA 1NGJA 3HBTA 3CHWA 4QS8A 4M7XA 2E1YA 4H5WA 3VF2A 2YI1A 4FWSA 3RSEA 2P9IB 3R9PA 2QWQA 5AQIA 4BRCA 2GUPA 4BVPA 5AQOA 4CJ7A 3QBXA 4CZHA 2E2QA 3MK6A 3U9DA 4L3QA 5F2RA 3WQTA 2IIRA 2Q0UA 5AZJA 5AQVA 2W40A 1ZXOA 4GNIA 3GDQA 4H5VA 4IJAA 2F9TA 2V51B 3SJHA 1HKGA 4AM7A 4B1YB 5ELZA 4IZ9A 3VEOA 1HKCA 2NRHA 1NBWA 5FPNA 4CBXA 3MDQA 4H0XB 3SMSA 4CZGA 2GTDA 3VGMA 3ZETA 3CJ1A 3MCPA 3UE5A 1NGBA 2PBDA 2QXLA 3BP8A 4H0PA 1BOTO 2HMPA 1K8KA 1J6ZA 1LCUA 1OKJA 1YUWA 3LM9A 2ZGZA 3L4IA 1D4XA 5AQJA 3VEVA 4H0VB 2DPNA 4E1JA 5AQRA 2A40A 4A2AA 4CZLA 4DQ8A 4BGAA 4PKHA 2ZGYA 5BRDA 1BA1A 1YVNA 2QWNA 3FLCO 3UKUB
chains in the Genus database with same CATH superfamily
3KLFA 4ELUA 4DR3K 4Y1CA 2XY5A 2ZWHA 4KV8A 1TL1A 3HM9A 3ZEUA 2C1GA 1XMOK 2V7ZA 5C2DA 1KLMA 4CJUA 5CHIA 1NWKA 3W0LA 3Q7BA 4IKFA 2OTLN 2C1IA 4CF1A 4Z4HA 4FK4A 1C1AA 4JD2A 4E0DA 1XC3A 5C15A 4FM0A 4FZXC 2UXBK 3LDQA 5JMVA 3U9ZA 4FLXA 1HQUA 5IT9O 1E3MA 2ZJPL 2GWJA 3MXMA 1TAQA 2I7NA 1LW0A 4XH5A 4DR2K 1IBLK 2QI2A 4DSIA 3A5NC 4DG1A 1WN7A 4C1NI 1WBDA 1WUAA 4FWOA 3AO4A 1LV5A 3THYA 4BR9A 3MN5A 3DMJA 3TU5A 4BRKA 4A57A 5EXWA 1RDWX 3PLAA 5BN8A 3RR7A 2ITGA 3TAQA 2F4VK 1YVUA 1N33K 4DFJA 1TKZA 4FSVA 5HRPA 2NRWA 3SNNA 3SK3A 3THVA 4WQ4A 3QEWA 5AQQA 4AHSA 1SKSA 4RCHA 4FW1A 4C8NA 1GLAG 3VQ4A 5BPLA 2UUAK 3V4IA 1IJJA 1SV5A 4J2DA 1C0FA 2IOCA 4DKWA 4BG9A 2ASMA 4YY3K 3CD6N 2WFBA 4DS5A 3THXB 2KFZA 4DSEA 4C8MA 1LAWA 3H6EA 4E7KA 2A5XA 3L6QA 1X9WA 4KHNA 4RTFD 3U3GA 3ZSXA 2DTUA 3B6PA 4X64K 4I9LA 3SCXA 3VQAA 3LDLA 4O5FA 1HKBA 5EY4A 4CJFA 4CW7B 3RMCA 4LF6K 2HW3A 4DUZK 1RTHA 4KBOA 1TVRA 4CGIA 5TKWA 4ID1A 1LWEA 1RDAA 2Q31A 2E6MA 1HPZA 3AVLA 1RBVA 3BY5A 1H1VA 1R0AA 2IAJA 1NK0A 4ICLA 2QWPA 1TGOA 1NU0A 3C6AA 1U47A 1D8YA 1S72N 4LSNA 4LY7A 2VYPA 4FZZA 1N6QA 1JCGA 1S1VA 4CHYA 4JS4A 2V52B 5E84A 1IKVA 4HWIA 3ZX2A 3ZYYX 5AQXA 2EX3A 3DOKA 3TR8A 4JI0K 3FR0A 2VGNA 1QSLA 2ZF5O 4DU1A 3O4QA 2QXFA 4KH6A 1C1BA 4K8ZA 3T1YK 3ENHA 3EZWA 4X62K 1O1WA 2ZM6K 2HVHA 4ISEA 4HUFA 4JI4K 1TKXA 3HI0A 3V81A 4YNQA 1RT2A 3AVIA 2G8FA 4CJ3A 4CD1A 4BDZA 2GBZA 3QNOA 3OYNA 4FJ7A 2YJFA 3ZCMA 1U4BA 1X9MA 2E4LA 1TK8A 3L2RA 1D9DA 4A5AA 2VGMA 2YX6A 1CXUA 2OPRA 5EOYA 4FPAA 4B8CA 4FJIA 2F8SA 2IDOA 1XWLA 1KXPA 1LOTB 1C0UA 2OPQA 4DTMA 1VQ7N 3V1QA 2I7PA 1HUXA 4KHSA 1NNEA 4IFYA 2KQ2A 1DKGD 3GBTA 5AQZA 2ITMA 3I0SA 2KHOA 2Z1GA 1Q86O 2HHWA 2YJEA 3WXLA 4CZKA 1EWRA 4J8FA 1VQ8N 1L3VA 1OVYA 4IG3A 3AY9A 1IBMK 4K0KK 3PY8A 3RRHA 3M8RA 5HBMA 1EX4A 3VENA 3AAPA 2HHTA 3ZT3A 3AO1A 3O9QA 4JHDA 4BRAA 3ZETB 1VQLN 1RFQA 3S9HA 4JV5K 3DXMA 4DR4K 1TL3A 4DHYA 4BWJA 1M90O 3K58A 3CC7N 3VEYA 4IO8A 3OY9A 3P1GA 5KTQA 5JLHA 3RR8A 4YORA 1S22A 1JLAA 2P51A 1K8AO 5B8HA 2W00A 1DLOA 2IS3A 3DM2A 5I3UA 2GEMA 4YOYA 3QFPA 1TUUA 4E7JA 4AHVA 4BE2A 1X1PA 3SUPA 1B92A 3V9XA 3AAQA 3VMFB 2CH6A 1RNHA 3FFKB 1WSJA 4MO5A 5AQFA 2G8HA 5GIPA 4CIGA 4DTSA 1RILA 3NF8A 1L3SA 2O8CB 4Z4FA 1OH8A 1UAXA 3CQYA 4EHUA 1C1CA 1HYZA 3NGYA 4H5NA 5KGXA 2QEXN 4DR1K 3HPHA 4N56A 2HHUA 2YNGA 4OPHA 2BTFA 3T7ZA 1W9HA 4XJXA 4KTZA 1BG3A 4HTLA 1OH5A 3BGRA 2P9PA 5MLCQ 3L8BA 3EO3A 3CI5A 4OKEA 3IFRA 3O4WA 3O4NA 1ZBFA 2AJQA 4F9OA 2VWBA 1T44A 2VQFK 4MDAA 5DM7L 1W2BM 3O6WA 1UA1A 3KJVA 1SKRA 3HPGA 4H8KA 1QQCA 3JXUA 4O4GA 2XRIA 3L2VA 3ZLJA 3G4SN 2VG5A 3C7NA 4BRMA 1ZYQA 3KWIA 1JLQA 4CJWA 5C2FA 4JI1K 3VEZA 1VSMA 1BDGA 3CJ9A 1RTIA 3PO4A 4CBWA 1HNVA 3WQUA 2KFNA 1Z26A 5ADXA 4JKEA 4FVMA 5J1EA 4DUYK 2FBVA 4DTPA 4EP5A 2B4JA 4LC9B 1NGFA 3GG4A 4CIFA 3ZSYA 5KGWA 3MX5A 1X9JA 1N34K 4AHCA 2D0OA 3N4QA 4CESA 1G99A 1NKCA 1JLFA 3BF3A 4JAXA 4PL7A 2IVPA 4U7BA 3CQXA 4C23A 1RT4A 3BEXA 4Z4CA 4OVLA 4CECA 2ZJRL 4GVMA 4FW2A 4CD3A 3NDKA 4B3OA 1I3AA 3G0ZA 2QTDA 2JLEA 4DB3A 5AQMA 1BUPA 3OYKA 4KHPK 4YFUA 3BZCA 4DV7K 5HROA 4BY9C 2HBJA 1D5AA 1HJOA 4DV3K 2O8DA 1GLBG 4IO9L 3AVCA 1VQMN 2GWKA 4JI7K 5FRNA 1NK7A 5FDLA 2XO7A 1HX1A 3OYMA 4CJ4A 2E8AA 3ULEA 5AZIB 1N8RO 4RG8A 4B3TK 4JK7A 3OYDA 1NGJA 1J9AA 4E7LA 4ZTJA 1NJWA 4M7XA 3VF2A 3NGIA 1RT6A 2BE2A 2O8BB 2P9IB 2QWQA 4BRCA 2GUPA 3ZT0A 4BVPA 1LW2A 2EHGA 3AGKA 5F2RA 3K5OA 5AQVA 4DTJA 1QVGM 1T03A 4IJAA 4JI6K 2V51B 1IG9A 1CXQA 1KCFA 1T8EA 4CEFA 3S3MA 4B1YB 3HT3A 3VEOA 3OYIA 1HKCA 4IOAL 3ASMA 4H0XB 3SMSA 4JYAK 2GTDA 3VGMA 4M3ZA 1K9MO 3LP0A 2HHHK 3BP8A 4H0PA 3QEVA 4Y1DA 4DS4A 1J6ZA 1LCUA 1YUWA 3LM9A 1VHXA 3L4IA 2DPNA 4E1JA 5AQRA 1YIJN 3L2UA 1XHXA 2Q3SA 4PKHA 2YHAA 1NK4A 5JS1A 1YVNA 3UKUB 2B6AA 4H4MA 1Z05A 3PSIA 1NLVA 3RMBA 4E1NA 4DTUA 3O1WA 2NZTA 4BR4A 4DR5K 4HCCA 5AQSA 4CGDA 3TTFA 1A5VA 4WFAL 4OO1J 1G15A 3DRSA 4AF1A 3CJBA 4O55A 5AQWA 3U4LA 2VWJA 1TKTA 5HRRA 4NLBA 3MXIA 2Y1IA 2I5JA 2ETJA 4OLAA 3DLGA 2Q36A 4FL9A 3A0IX 1U04A 4K42A 4CGHA 1U49A 3OYAA 4LFCK 3WNFA 2X74A 3U3YA 3OBWA 1GLJO 4ELVA 4MFBA 1SUQA 2OPPA 4DV6K 5AQYA 2YNHA 4M3YA 3CC2N 4G9ZA 3UKRA 4J2EA 2HBMA 1YTAA 2G8WA 3KZBA 2FXUA 4YDUA 3ZSWA 4GW6A 4B1VA 1ZBLA 3WUHA 4FJJA 4B1ZA 1LWCA 4HUEA 3U6FA 3WXIA 4CFBA 1KAYA 4BROA 2G8KA 2NNWA 1Z6RA 2BUPA 3LDPA 5HRNA 3OYJA 5I42A 1KSPA 3MX2A 4H0YB 3E66A 4CJTA 1GOCA 4KHYA 1OH6A 2E88A 4B08A 4LF4K 5FPEA 3VN5A 3D2FA 4CF9A 5T7BA 2Q1NA 2E2NA 3ID6A 2FF6A 1Y97A 3TSUA 3QICA 3AV9A 4CZFA 4FJKA 1MDUB 5AQPA 4UQGA 4CHNA 5TKYA 3QERA 4JNEA 3SBTA 1QZ5A 1S1UA 1QQNA 5AQUA 4KO0A 5BR8K 4ILJA 4DF8A 1VQ6N 4BACA 3I0RA 2E20A 4LH4A 2KKZA 4BRDA 1W7AA 1IH7A 2YV0X 1IKYA 4O5BA 2BDPA 4ZHRA 1NOYA 4DR6K 3Q7CA 2XY8A 4FJ9A 1JCFA 4Z4EA 1XMQK 4CK2A 5SWMA 4BR7A 3BDPA 3WEEB 1YAGA 4IFVA 3TPQA 2HF4A 1UOCA 1BI4A 3RVCA 1QVFM 2UXDK 2HNDA 4CHQA 1T7PA 5BRFA 1JLGA 1RT1A 4I7FA 3AVBA 3EN9A 2QKKA 1NGGA 1YF5L 3K0SA 4C8LA 1LWFA 2HMIA 2RF2A 3K5MA 4WQ5A 5AFUA 4ILHA 4YOTA 4XIUA 4CF8A 4OGEA 1A5WA 2W42A 3CETA 1C0GA 2A3ZA 5FROA 2P1JA 4CEQA 4CI6A 5CZ2A 2CGJA 3DLHA 3ZT2A 4PKIA 1P8ZA 2QW9A 3A5LC 1S3XA 5JVHL 3DXKA 5KQ8A 1EKEA 4C8KA 5AR0A 3M6GA 5JICA 3THWA 3D0PA 1FK9A 3OA9A 4BECA 4FJMA 3FE1A 3LANA 3VPZA 2FC0A 3NFAA 3VERA 2Q2RA 1BO5O 4GKJK 3OTOK 4FZYA 1LAVA 4CJQA 5C0YA 1JLCA 1SKWA 3I33A 1WAJA 2Q97A 5C42A 3RSEB 1MWKA 2YCHA 3NVMA 2A6AA 3GL1A 4BC5A 3QLHA 2PYLA 2BGGA 3KD5E 3C94A 5AZJB 3NH2A 3VESA 4DMNA 3ENOA 3LPTA 1O13A 3QMLA 2YKMA 2HF3A 4A62A 5J2PA 5EVZA 5GINA 3AA5X 4R5PA 5C24A 3AO5A 3G25A 2DFHA 4AH9A 4NYFA 1ESVA 1K8KB 4Y0WA 2KZZA 4FLZA 1FJGK 2D1KA 3DWLA 5H1SQ 1XI1A 3KVGA 2NUBA 1CZ9A 5AJ3K 5J2NA 4LF9K 2Y1JA 3EY1A 3HO1A 4IG0A 1NK6A 4KHUA 2FSNA 3TAPA 4FOIA 1N5YA 1KVBA 3KK7A 3TI0A 4W5NA 2BANA 3B6OA 3GOIA 4B1XB 4LF7K 4FJNA 3AARA 1T05A 4RWTA 4BE7B 4JLHA 4BRQA 4NCBA 3VTHA 3SPZA 4AHUA 1T6CA 5HLFA 3FZFA 2NRVA 2OZMA 3EL2A 5F0XA 1DTTA 3F9MA 3AVAA 4B1WB 4O0IA 3J81O 4M45A 1K6YA 3IKMA 3PIOL 4GV3A 3THXA 2O4GA 3M8SA 3FFIA 3LZIA 1GOAA 4EAHD 4BEBA 3LP2A 3EE8A 1BA0A 4IEIA 3HVTA 3VQ9A 4M3WA 2DY4A 5M1OA 3R8EA 4MQ3A 3CFRA 4F4KA 3LM2A 4NCAA 1BHLA 4GMJB 3K9JA 1KVAA 1GLFO 2IGIA 4PKGA 2J4RA 3OJSA 4RW9A 4W5OA 1Z25A 3AO2A 4B9SA 3QB0A 3CCRN 3AVMA 4NYNA 3PO5A 2HVIA 2O8EB 1NMDA 2P9KB 2DFEA 4YOXA 3FZLA 4LFAK 4LF5K 3WNGA 1U2VB 3VGLA 3SPYA 3HXMA 1HNXK 1FKPA 5ADXH 2W6LA 4WE1A 2UU9K 4I6MB 3OHRA 4B9QA 3BF1A 4FWPA 2QKBA 4CZJA 1S1XA 1KC8O 3C0BA 5AQKA 3TAGA 4GV6A 3CCQN 1I39A 4BRFA 1BCMA 4JK9A 3V1OA 3HOSA 3P4IA 1QSYA 2HOEA 3DRRA 4B9LA 1YJNN 2NRZA 3FZKA 1UA0A 2HHIA 5M1QA 4CK1A 3CJCA 3LL3A 3VA0A 5KPRA 4CVNE 4E3SA 4IWVA 2P9PB 2HHVA 3HZ6A 4J2BA 1A5XA 1S6PA 5DMRA 3WXKA 3FZHA 1VQON 4JKGB 4DTNA 1VSKA 3CHWA 1K73O 3O9TA 4W5RA 5KI6A 4DTXA 2O8FB 4TSXA 4OKKA 2VQEK 3ULDA 1BGXT 4Q5VA 3QBXA 4RW8A 2DFFA 4CGFA 3CCUN 5D3GA 3TSQA 3ALYA 1RTDA 4JI2K 4JKAA 4H5VA 3SJHA 5CY4A 1NOZA 4BWMA 1NBWA 4CBXA 1YT3A 4KB0A 3MDQA 4CZGA 3ZETA 1BL3A 3DLBA 4FJ5A 3CJ1A 1EWQA 3E9LA 3HVRA 1NGBA 2RKIA 4QCLA 4N47A 2P5OA 2ZGZA 3EZ5A 4H0VB 3NBPA 3IRXA 2A40A 4PA1A 4CZLA 3RWUA 3DOLA 4FJGA 4BGAA 2OZSA 4IEEA 3QINA 1BA1A 3KLHA 4F3TA 4UY8O 1VQ5N 3IMXA 3O08A 3AVNA 1ILYA 1MU2A 3VQ5A 4U67L 3I8BA 1L3TA 3P38A 1TYQB 3CCSN 4BQLA 4QS7A 4FOEA 5SZTA 3V9ZA 3DLKA 1SL0A 4DV5K 1HLUA 1YTUA 4JKFA 5GAHP 3OW2M 4B3MK 2HSTA 5M1FA 3CJ7A 2P9UB 3CFPA 2O8CA 3WT0A 1QZ6A 4AM6A 1RGIA 5HL7L 1WSGA 1N32K 4O44A 1NGEA 3A5MC 3L0QA 1VQKN 4I2QA 4CJEA 5HP1A 2F8TA 2F9WA 3VQ6A 3O9SA 1WSIA 3OYFA 1W97L 3SQ4A 5KPTA 1CZBA 1RDCA 4FWKA 4JKCA 3T19A 4IOCL 3H46O 4CJRA 3DRPA 4I2PA 2D5RA 4AHRA 3DAWA 3O9UA 3A5OC 3V9UA 1BQNA 4XEIA 3BZKA 4EIAA 4CEAA 2CH5A 1Q81O 3SBGA 1GLCG 4OGCA 2OANA 3MXJA 1NJZA 1T6DA 3ITHA 2P9LB 4MDBA 4WYBA 2YKNA 4ISGA 1RBTA 1ASUA 4PY5A 1DEJA 3N4PA 3QETA 1QQOA 1TV6A 4J2AA 4BRNA 4FCYA 3FZMA 4BDYA 3F5TA 5EX5A 3OS1A 3P31A 4BRGA 3LDSA 4CHZA 2R7YA 1CZAN 3E9OA 2RPIA 4FJHA 2IVOA 2PAVA 3CMAN 3HTVA 5JS2A 2QM1A 2V7YA 3K59A 3SJJA 1EP4A 4A59A 3M8PA 3SV4A 3S41A 4JI8K 2X6SA 4CE9A 1S9GA 4A5BA 1YJWN 3QESA 1GLDG 3CIPA 4E7HA 2Z1IA 1RDDA 3ISNC 1ZC6A 5GIOA 3PX0A 3QNNA 3CCLN 5M1KA 1HR0K 3MWPA 1IKWA 4FK0A 1JL1A 4JKDA 2XHBA 5BPNA 4E89A 1VSDA 1L3UA 3O3FA 3ZT1A 5F1XA 3VQQA 4E1MA 3TAFA 1B9FA 5AZIA 3HM8A 1MWMA 4H4OA 1WOQA 2ZE2A 2NRTA 1Q8IA 3ZSQA 3V9WA 3LALA 2UUCK 4NO7A 3KKSA 3C95A 2P9SB 1SL2A 5JVGL 1NJYA 5AFUH 1KLNA 4CGGA 2O8BA 2P9IA 4OPKA 2P9NB 1SAZA 2HHQA 4GKKK 2OCEA 4KTWA 4H0OA 3TTDA 2XY6A 4NXMK 4CEEA 2EWSA 3OYLA 1HYSA 3ZT4A 1TKDA 3WNEA 3CPEA 2D0BA 3HK2A 3SAGA 1WSEA 3MN9A 1KQSM 2W6KA 5GAEP 3K2PA 3M1FA 3UB5A 2IVNA 4Z4IA 2FLOA 5J2MA 1GLEG 5HRSA 4JS5A 4N76A 2OPSA 3WNHA 4B9MA 3VQEA 1VAZA 4FXDA 3NVKA 4CJSA 3O9RA 3K9KA 1FKOA 1DT9A 1JLEA 4KI4A 3UKUA 2YHYA 2A41A 4CZIA 5FPDA 4GV9A 3MWTA 3MCAB 4NCGA 3MAQA 1WSHA 3WXJA 4DQSA 4FLUA 2ZD1A 2VG7A 3LDNA 4AHTA 3K5NA 4BQZA 1X3MA 4XH1A 5A2QO 2E2PA 3EKSA 3NH0A 1TK0A 4WQ5C 4CZEA 1J5EK 1L5UA 3VEWA 4QAGA 4Z94A 3CERA 1RTJA 3LAMA 4BRLA 3C6UA 4FYDA 3D2EA 4W5TA 3P5JA 4IXCA 4CF2A 2FF3B 2X6NA 4MLEA 3VEXA 4FVUA 5FRMA 4QOZB 4DV0K 2OA8A 4BG8A 3ZEUB 1WNSA 4GY2B 4KHQA 4BRIA 1GOBA 3C6HA 4OPJA 4FWQA 1V4TA 5JLFA 4C8OA 3DXKB 4BC3A 3G71N 3PUFA 1X9SA 4JD2B 1HYVA 1U6ZA 2YHBA 3QEXA 1IBKK 4JEPA 4EP4A 3TARA 4FM1A 4FWNA 5KQDA 4BR0A 4H03B 2PFUA 3SQ0A 2D4WA 3SAHA 2CGLA 3HPOA 1U45A 4KKOA 4KH4A 5E41A 4DQPA 4OPAA 1HNWK 3TWHA 4CEZA 3IUCA 4O8KA 3THYB 1KFSA 1HJRA 1WAFA 3PV8A 3BUZB 3CM6A 3SMPA 3OVNA 4CCHA 5AQLA 4WFBL 2UXCK 3RMDA 4FWMA 5KPZA 3AA4A 4DU4A 4WQ4C 4MLHA 4BR2A 3KKRA 3CCEN 4CF0A 1C0TA 2RN2A 2XY7A 3OJUA 1YI2N 3MEGA 4FWLA 4BE0A 3T3FA 4BGBA 3KK2A 3O3HA 4HVJA 4YOVA 4OJRA 3EKUA 1ATNA 4LFBK 1SQKA 5AQGA 2WUSA 4PUOA 3WEEA 2YNFA 1SZ2A 4C1NK 3O5BA 3AO3A 2VWKA 1X3NA 5C12A 3KD1E 4I9QA 1ZBIA 4K43A 3ATUA 2QA4N 3RTVA 4M3TA 1OH7A 4IBNA 4B9NA 3KWGA 5KRSA 1ITGA 4E72A 1HNZK 4FJ8A 2HNYA 3NAEA 1REVA 5E26A 4W5QA 2HBKA 3CJAA 4E7IA 4JRPA 3JSMA 4CFDA 4RW4A 2E2OA 4KRFA 1NGDA 4CGJA 3AVFA 1RT5A 4LD0A 4CIEA 4PHTX 1NK5A 1XQSC 3VF6A 1SS6A 3E9PA 4WCEL 1DTQA 4O8UA 2NLXA 3HP9A 2A1SA 5J2QA 2HHSA 1NGCA 4BREA 3SLCA 4FLVA 3JAMO 2KW4A 1WLJA 1XC9A 4N41A 4FLTA 1Y64A 3IG1A 3S3OA 1HMVA 1RDBA 4EZ6A 2ASPA 3MMVA 4N5SA 1UWBA 3NCIA 3CCMN 1NJXA 3HYFA 1S6QA 4R79A 3ZX0A 1WBBA 3EYZA 4HUGA 4JKBA 1WB9A 4B3RK 1J54A 3NMUA 3ZSVA 4H5WA 3P39A 4FWSA 3DI6A 1S1WA 3RSEA 4DWIA 3SV3A 3J80O 3H08A 3I56N 4BE1A 4X66K 1S5JA 4CZHA 3OYGA 2E2QA 3SZ2A 1JL2A 3NGZA 3MK6A 4IDKA 3U9DA 3ENBA 3OYBA 1KRPA 3V1RA 4F3OA 2IIRA 2Q0UA 5AZJA 3I55N 1IO2A 4DQQA 2W40A 1ZXOA 1NK8A 3VQ8A 1NK9A 1TK5A 3KK1A 3F2KA 4DFMA 1HKGA 4AM7A 2Z1JA 4M3XA 3VA3A 5LL6Z 1KD1O 1NKBA 4ILGB 5CR4A 3PX6A 3MCPA 2D0CA 3J7ZO 2PBDA 1VK0A 1BCOA 4RW7A 4CK3A 5CYMA 1K8KA 3OS2A 5M1NA 3QO9A 4DSFA 4CFAA 1D4XA 5AQJA 2KLAA 3AA3A 4A2AA 2ZGYA 4LF8K 5BRDA 3T1HK 3SUOA 3VTIA 1BISA 3H1QA 4DV4K 4NLCA 3NF6A 1BIUA 2F96A 4JHDB 4M7YA 3CYGA 1QE1A 3DXMB 3D7EO 1BIZA 2RHKA 4KFBA 1VQ4N 1NGAA 4M3RA 1SL1A 2RE2A 5CYQA 1HRHA 4AILC 3AVJA 4JN4A 3ZX3A 4RW6A 4CJVA 3VETA 4Q0BA 3VQDA 3F9KA 1VQNN 4YOUA 1BU6O 3HSCA 1VSEA 2GUIA 4CEOA 3CC4N 5CZ1A 2WTUA 4M63C 2JWKA 1J5OA 2X78A 3TAMA 1QHAA 3KIOA 2YHWA 3DYAA 2ATQA 4ISFA 4DTOA 4FJXA 4B9VA 2E5LK 1IKXA 2QWLA 3TTCA 1HQEA 4FJLA 2FSJA 3SQ1A 3DJCA 2KTQA 2OTJN 4EHTA 1B9DA 1VSIA 3PSFA 4IDHA 1JXEA 3V9SA 4BR5A 2WOMA 1ZBUA 1YITN 3W3DA 3NH1A 3H3NO 3MEDA 3I8DA 2B5JA 3AVKA 2WC9A 3CM5A 3MEEA 3LP3A 4KI6A 1F21A 1RBRA 2O8EA 2P9KA 3U8XA 4IOXA 2PZSA 3KK3A 2FSKA 4CJ5A 1KAXA 4FLYA 1C0MA 3C65A 1NKEA 3IAYA 3C7NB 1U2VA 1IG8A 3SI6A 4OLBA 2NRXA 4JKHA 5HOOA 2F7TA 2VCPA 5LY3A 5C25A 3CPWM 2HNZA 3A8YA 1YHQN 4I6MA 4H5TA 3S5TA 5FPMA 2BH1A 2ASOA 3EE9A 4DQRA 4M41A 4EFHA 3A2FA 4F2RA 3L3UA 2E1ZA 3TAEA 1FW6A 1QSSA 3G10A 2OYQA 4FPBA 4L8RB 1KTQA 1EQYA 3J7YP 1Q9XA 3DLLL 3K5LA 3V6DA 3VOVA 4X65K 1YXQA 3OYCA 5BRHA 3KHYA 4PL8A 3PX4A 4QS9A 4HCBA 1BQMA 1R59O 3H3OB 4DV2K 1U48A 1NG9A 4JRQA 3E01A 4CJKA 3ZSZA 3VQCA 4B1UB 1KVCA 1WSFA 3M8QA 3HSTB 1Q82O 3T1AA 4DR7K 1VRUA 3L3VA 1S9EA 3H1VX 3R6MA 2O4IA 5KRTA 2D0PA 3KLIA 4G1QA 5DK5A 4FWRA 4JKGA 4FO0A 3QBWA 1VQPN 5LJVA 4H0TB 4DQIA 3J8AA 4CBUA 4WFNL 2O8FA 1E4GT 3JS6A 3F73A 4PWDA 2CGKA 3LDOA 4YOWA 2O8DB 2WONA 5I9EB 3C6TA 3CYMA 3P83D 4DFKA 4EZ9A 1DGKN 2H3GX 3SUNA 5GADP 4ID5A 3ULEB 2VG6A 2HHXA 2ZQBA 4XH4A 4CJLA 2G8UA 4NB4A 1NGHA 2QWRA 4A61A 3VF4A 4B9UA 4KB1A 1JLBA 2KZMA 4A2BA 3TSPA 1XNRK 4Z0UA 3PIPL 3OYHA 4F8RA 4JI3K 3QEPA 3CCJN 2YHXA 3KLGA 4M3UA 5IWAK 4FM2A 3R1XA 4BRPA 5GAGP 1ATSA 4BC2A 4LSLA 3KLEA 3CF5L 1VSHA 3SQ2A 3AGRA 3TABA 3M3ZA 4K41A 3NHGA 4F2SA 3MN6A 2YNIA 4BDPA 1TYQA 4OKJA 3DLRA 3IDHA 3E1YA 3NF7A 3OYEA 4WF9L 1EETA 2P9UA 2GELA 5AQNA 4NXNK 4DSJA 1E4FT 2FBTA 3HL8A 3O3GA 3MN7A 4MO4A 1JXBA 2JWLA 4K25A 4ZTFA 1Q18A 2Z1HA 3SAFA 4YHHK 1EXQA 1Q9YA 5BR9A 2A42A 1VSLA 3CQ8A 3AVHA 2WBNA 3O80A 5LMUK 1HPMA 3CCVN 1KAZA 1MA9B 3L2WA 1VQ9N 3ID8A 4CHPA 1JCEA 3ATVA 2NRRA 4CERA 4DCHA 4OX9K 3NE6A 3UIQA 1Q7YO 3VGKA 1RDUA 2FBYA 1RBUA 4IFEA 1RT7A 2AA4A 3UKRB 3LP1A 3WXMB 2P9LA 3DLEA 5AQHA 4DSLA 3B8AX 3T69A 4YDUC 3KTQA 3LWMA 1YJ9N 1M1KO 1S1TA 2G8VA 3L4QA 2D0AA 3QIPA 2ZJQL 3H45C 5EU7A 1D9FA 2GV9A 4CZMA 3HOTA 4DFPA 5FLXO 1BWFO 3JYTA 3LAKA 4CJPA 4BRHA 4B8AB 2PY5A 1JKHA 1GLLO 4GVEA 2E6LA 3AA2A 4FLWA 4KH5A 4LH5A 3FGUA 3HRGA 4DV1K 3D2FB 2UUBK 3R3LA 3OBYA 3HP6A 2QWOA 3CFOA 4KAZA 1NMNA 3J7AP 1HNIA 2FBXA 4BVOA 1T3VA 3K57A 4V19S 1FXXA 3ZSOA 5C10A 3D45A 3GE1A 4JI5K 5BPMA 2W41A 4DF4A 3SYZA 4KREA 2HBLA 3D2EB 1QQMA 3LWLA 4M42A 1QTMA 5M1PA 5CE3A 3QIOA 1P90A 4FK2A 4KTQA 5BN9A 1TAUA 3LZJA 4DU3A 3QDKA 1RBSA 1NGIA 5LMNK 1QHTA 3D6RA 2QK9A 1IV0A 5LJWA 1RT3A 4IJNA 3IS9A 3ZSRA 1BI4B 1NM1A 3O1BA 5AQTA 3CG7A 4O0JA 2QWMA 1TUYA 4HHTA 2P9SA 3CXCM 2UYTA 4ELTA 1ZBSA 2GX9A 3VQPA 3SUQA 1ASVA 1ASWA 3LPUA 2P9NA 1XNQK 5BREA 1ATRA 4H5RA 2G8IA 2Q0RA 3O8MA 3QFUA 5JENA 5K14A 1XUPO 4AQYK 4B9TA 4CEDA 5DM6L 3S3NA 3OS0A 4JK8A 3TANA 1W0HA 1ZBHA 3VQBA 1QS4A 2AP1A 3M5RA 4BC4A 4B3SK 1V4SA 4E19A 3NF9A 3HBTA 1XHZA 4KHWA 1RCHA 1CLQA 4QS8A 4K8XA 2E1YA 2YI1A 4Z4GA 3HJFA 1J53A 3R9PA 5AQIA 2A1RA 1VSFA 2P5GA 3MECA 5AQOA 3RMAA 4CJ7A 2PYJA 3VQ7A 4CFCA 3THWB 2IC3A 4L3QA 3WQTA 4DTRA 2LSNA 3AVGA 3CMEN 4CEBA 2JGUA 4GNIA 3GDQA 1VSJA 1NJIO 4HTUA 1C6VA 2F9TA 3RRGA 1N36K 5ELZA 4IZ9A 4DLEA 1KFDA 2NRHA 5FPNA 4DSKA 3UE5A 1I94K 2QXLA 1BOTO 2HMPA 1OKJA 2HB5A 4KPYA 3VEVA 1OVQA 3EEQA 4DLGA 4PQUA 4DQ8A 1VRTA 4CHOA 3L2QA 1JJ2M 1EO1A 3G6EN 2QWNA 3FLCO 3QEIA
chains in the Genus database with same CATH topology
4UY8O 1Z05A 1NLVA 3H1QA 3IMXA 3O08A 1VQ5N 3O1WA 2NZTA 4NLCA 2ZWHA 4BR4A 5AQSA 1ILYA 3TTFA 4U67L 4WFAL 3I8BA 4OO1J 3ZEUA 2C1GA 3P38A 1TYQB 3CJBA 2V7ZA 4JHDB 4M7YA 4FOEA 4QS7A 5AQWA 3U4LA 4BQLA 5C2DA 1HLUA 4NLBA 4JKFA 3DXMB 5GAHP 3D7EO 3OW2M 2HSTA 2RHKA 5M1FA 1VQ4N 3CJ7A 2P9UB 5CHIA 1NWKA 1NGAA 2Q36A 3Q7BA 4FL9A 1QZ6A 3W0LA 3A0IX 3WT0A 4AM6A 2RE2A 1RGIA 4K42A 5HL7L 2OTLN 2C1IA 3CCSN 4JD2A 1NGEA 3A5MC 1XC3A 3L0QA 5C15A 1VQKN 4JN4A 3OBWA 3ZX3A 1GLJO 3LDQA 3VETA 5JMVA 3U9ZA 5AQYA 1VQNN 4YOUA 2F9WA 1BU6O 3CC2N 3HSCA 3UKRA 4G9ZA 3O9SA 2ZJPL 2GWJA 3CC4N 2I7NA 4XH5A 2HBMA 2QI2A 2JWKA 3A5NC 4M63C 1W97L 3KZBA 2FXUA 4C1NI 4YDUA 1WUAA 4FWOA 4B1VA 5KPTA 3WUHA 4BR9A 3MN5A 4BRKA 3TU5A 4FWKA 4JKCA 4A57A 4B1ZA 5EXWA 1RDWX 3PLAA 5BN8A 4IOCL 3WXIA 3H46O 1QHAA 2YHWA 1KAYA 4BROA 4ISFA 3DAWA 2NNWA 1Z6RA 3A5OC 3O9UA 4FSVA 2QWLA 2NRWA 2BUPA 3LDPA 3TTCA 3SK3A 4XEIA 2FSJA 4EIAA 4WQ4A 2CH5A 1Q81O 3MX2A 4H0YB 3DJCA 5AQQA 3E66A 2OTJN 3SBGA 1GLCG 4EHTA 2OANA 2E88A 1T6DA 4RCHA 4IDHA 5FPEA 3D2FA 2P9LB 1GLAG 4MDBA 4WYBA 4BR5A 5BPLA 1YITN 3W3DA 4ISGA 2Q1NA 1IJJA 3H3NO 2E2NA 3ID6A 1DEJA 1C0FA 3N4PA 1QQOA 2WC9A 2FF6A 4BG9A 4DKWA 3TSUA 2ASMA 3CD6N 3QICA 4BRNA 2WFBA 4CZFA 3FZMA 3H6EA 2A5XA 3L6QA 4RTFD 1MDUB 5AQPA 3F5TA 5EX5A 2P9KA 3P31A 5TKYA 3U8XA 4IOXA 4BRGA 4JNEA 3SBTA 1QZ5A 1CZAN 1QQNA 5AQUA 2FSKA 1KAXA 3E9OA 4ILJA 3C65A 1VQ6N 2IVOA 2PAVA 2E20A 3CMAN 3LDLA 3C7NB 4O5FA 2KKZA 1U2VA 1IG8A 3HTVA 1HKBA 5EY4A 2QM1A 2NRXA 2V7YA 4JKHA 4A59A 4BRDA 4KBOA 5HOOA 2F7TA 2VCPA 5LY3A 5TKWA 3A8YA 3CPWM 3Q7CA 2Q31A 4I6MA 4H5TA 3S41A 1YHQN 5FPMA 2BH1A 1JCFA 2ASOA 3EE9A 1H1VA 4EFHA 4A5BA 2QWPA 4BR7A 2E1ZA 3WEEB 3C6AA 1YJWN 1YAGA 1S72N 3TPQA 1GLDG 3CIPA 4FPBA 2HF4A 2VYPA 1EQYA 3RVCA 3DLLL 1QVFM 1JCGA 3VOVA 2V52B 1YXQA 1ZC6A 5E84A 5GIOA 5BRHA 3CCLN 5BRFA 4HWIA 5M1KA 3ZX2A 3MWPA 3EN9A 3KHYA 4PL8A 1NGGA 1YF5L 4QS9A 3ZYYX 1R59O 3H3OB 5AQXA 4JKDA 5BPNA 4WQ5A 5AFUA 4B1UB 3FR0A 4ILHA 4YOTA 2VGNA 1Q82O 2ZF5O 4KH6A 5F1XA 3R6MA 3H1VX 3HM8A 1MWMA 5AZIA 2D0PA 3ENHA 3CETA 1C0GA 3EZWA 4FO0A 2A3ZA 1WOQA 4FWRA 4JKGA 2NRTA 4CI6A 3QBWA 1VQPN 5LJVA 2CGJA 4ISEA 4H0TB 3HI0A 3J8AA 4NO7A 4CBUA 4WFNL 1E4GT 2P9SB 3JS6A 5JVGL 4PKIA 4CD1A 5AFUH 1P8ZA 2CGKA 2P9IA 2QW9A 2YJFA 3LDOA 4YOWA 3A5LC 1S3XA 2P9NB 3DXKA 1SAZA 5I9EB 5KQ8A 5JVHL 5AR0A 3M6GA 5JICA 4H0OA 3TTDA 3OA9A 4BECA 4A5AA 3FE1A 2VGMA 1DGKN 3VPZA 2EWSA 2H3GX 2YX6A 3CPEA 5EOYA 4FPAA 3VERA 5GADP 2Q2RA 1BO5O 3ULEB 1KXPA 1LOTB 3SAGA 4XH4A 3MN9A 4NB4A 1KQSM 1VQ7N 1NGHA 5C0YA 5GAEP 2QWRA 2I7PA 4A61A 3M1FA 1HUXA 3UB5A 3I33A 3VF4A 2IVNA 2FLOA 2Q97A 1GLEG 1DKGD 3GBTA 5AQZA 2ITMA 3TSPA 4A2BA 3PIPL 2KHOA 3RSEB 1Q86O 1MWKA 2YCHA 2YHXA 3CCJN 3NVMA 3R1XA 2A6AA 3GL1A 4BC5A 1VAZA 4BRPA 5GAGP 2YJEA 1ATSA 3WXLA 4CZKA 3NVKA 4J8FA 4BC2A 1VQ8N 3O9RA 3K9KA 1OVYA 3CF5L 3AY9A 5AZJB 1DT9A 3UKUA 3AGRA 3M3ZA 2YHYA 3VESA 2A41A 4CZIA 4K41A 3ENOA 5FPDA 4GV9A 1O13A 3QMLA 3MWTA 3MCAB 2HF3A 3MN6A 3WXJA 3VENA 3AAPA 4A62A 5EVZA 5GINA 3O9QA 3LDNA 4BQZA 4JHDA 1TYQA 4BRAA 3IDHA 3ZETB 1X3MA 1VQLN 1RFQA 4XH1A 3G25A 2E2PA 3E1YA 3DXMA 4WF9L 4DHYA 1ESVA 1K8KB 3EKSA 4Y0WA 1M90O 2P9UA 2D1KA 3DWLA 2GELA 5AQNA 1E4FT 4WQ5C 3VEYA 5H1SQ 4CZEA 3CC7N 4IO8A 3KVGA 3MN7A 3VEWA 4MO4A 5JLHA 4Z94A 3CERA 4YORA 2JWLA 4BRLA 1S22A 4K25A 1Q18A 3SAFA 1K8AO 3D2EA 5B8HA 2W00A 4IXCA 2GEMA 2FF3B 4YOYA 5BR9A 3QFPA 2A42A 1TUUA 4MLEA 3VEXA 4FVUA 2WBNA 3O80A 1HPMA 4BG8A 3ZEUB 3AAQA 3CCVN 3VMFB 1KAZA 2CH6A 2FSNA 4GY2B 4FOIA 4BRIA 1MA9B 3KK7A 4MO5A 3FFKB 5AQFA 1VQ9N 3C6HA 3ID8A 5GIPA 4FWQA 3GOIA 4B1XB 1JCEA 1V4TA 3AARA 5JLFA 3ATVA 4RWTA 3CQYA 3DXKB 4BC3A 4EHUA 2NRRA 3G71N 4DCHA 4BE7B 4JD2B 4BRQA 1U6ZA 4H5NA 3VTHA 1Q7YO 2QEXN 3VGKA 1RDUA 4JEPA 1T6CA 4OPHA 4FWNA 5KQDA 2BTFA 3T7ZA 4BR0A 4H03B 4IFEA 2PFUA 4XJXA 2AA4A 2NRVA 3FZFA 3UKRB 2D4WA 1BG3A 3EL2A 3SAHA 4HTLA 3WXMB 2P9LA 2CGLA 5F0XA 4KH4A 5AQHA 3F9MA 3B8AX 4OPAA 4YDUC 3T69A 4B1WB 2P9PA 5MLCQ 3EO3A 3CI5A 1YJ9N 3IUCA 4O8KA 1M1KO 3IFRA 3O4WA 3IKMA 3PIOL 3L4QA 4GV3A 4AF1A 2ZJQL 3BUZB 3SMPA 4F9OA 3H45C 5AQLA 2VWBA 1T44A 4WFBL 4MDAA 5DM7L 4CZMA 3HOTA 1W2BM 4EAHD 3O6WA 4FWMA 4BEBA 5KPZA 1BWFO 3EE8A 1BA0A 4IEIA 4WQ4C 3JXUA 4MLHA 4BR2A 4BRHA 3CCEN 3G4SN 5M1OA 1GLLO 4GVEA 3R8EA 1YI2N 4FWLA 3C7NA 4BRMA 4BGBA 4KH5A 3KWIA 3FGUA 3HRGA 5C2FA 3LM2A 3VEZA 3D2FB 3K9JA 4YOVA 1BDGA 3R3LA 1GLFO 3CJ9A 3OBYA 2QWOA 4PKGA 2J4RA 3EKUA 4CBWA 3WQUA 1ATNA 5ADXA 4BVOA 1SQKA 4JKEA 5AQGA 1T3VA 2WUSA 3WEEA 1SZ2A 3QB0A 4C1NK 4LC9B 3O5BA 1NGFA 3GG4A 3GE1A 5C10A 1X3NA 3CCRN 5C12A 5BPMA 3MX5A 2W41A 1NMDA 1X9JA 2P9KB 3ATUA 4K43A 2QA4N 2HBLA 3KWGA 2D0OA 4YOXA 3N4QA 3FZLA 1G99A 3BF3A 4JAXA 3D2EB 1QQMA 1U2VB 3VGLA 4PL7A 5M1PA 5CE3A 2IVPA 1P90A 5ADXH 5E26A 4U7BA 2HBKA 3CQXA 5BN9A 4C23A 3BEXA 4I6MB 3CJAA 3OHRA 2ZJRL 4B9QA 3BF1A 4FWPA 4CD3A 3QDKA 4CZJA 1NGIA 1KC8O 2QTDA 2E2OA 3C0BA 4DB3A 5AQMA 1BUPA 5AQKA 3D6RA 4GV6A 1NGDA 3CCQN 5LJWA 4IJNA 4BRFA 3O1BA 1NM1A 4JK9A 5AQTA 4PHTX 3P4IA 3HOSA 1XQSC 4BY9C 2HOEA 2QWMA 3VF6A 1TUYA 1SS6A 2HBJA 3E9PA 4WCEL 2P9SA 3CXCM 4O8UA 2UYTA 2NLXA 1ZBSA 2GX9A 1YJNN 1HJOA 2NRZA 1NGCA 3FZKA 1GLBG 3SLCA 4BREA 2P9NA 5BREA 1ATRA 4H5RA 2Q0RA 5M1QA 3O8MA 3QFUA 3CJCA 4IO9L 1VQMN 3LL3A 5KPRA 2GWKA 1XUPO 1Y64A 5DM6L 4IWVA 1HX1A 2P9PB 2ASPA 4JK8A 3G6EN 3MMVA 3HZ6A 3CCMN 2E8AA 3ULEA 5AZIB 1N8RO 2AP1A 3M5RA 4BC4A 3WXKA 4JK7A 3FZHA 4R79A 1VQON 3ZX0A 1V4SA 4JKGB 1NGJA 4JKBA 3HBTA 3CHWA 1K73O 3O9TA 3NMUA 4QS8A 4M7XA 2E1YA 4H5WA 3P39A 3VF2A 2YI1A 4FWSA 3RSEA 2P9IB 3R9PA 2QWQA 5AQIA 4BRCA 2GUPA 4BVPA 5AQOA 3I56N 4CJ7A 3QBXA 4CZHA 2E2QA 3AGKA 3MK6A 3U9DA 3ENBA 3CCUN 4L3QA 5F2RA 3WQTA 2IIRA 2Q0UA 3TSQA 5AQVA 5AZJA 3I55N 3CMEN 2W40A 1ZXOA 1QVGM 4GNIA 4JKAA 3GDQA 3F2KA 4H5VA 4IJAA 1NJIO 2F9TA 2V51B 3SJHA 1HKGA 4AM7A 4B1YB 5ELZA 4IZ9A 3VEOA 1HKCA 2NRHA 1NBWA 5FPNA 4CBXA 1KD1O 4IOAL 3MDQA 4H0XB 4ILGB 5CR4A 3SMSA 4CZGA 2GTDA 3VGMA 3ZETA 3CJ1A 3MCPA 3E9LA 3UE5A 1NGBA 3J7ZO 2PBDA 1K9MO 2QXLA 3BP8A 4H0PA 1BOTO 2HMPA 1K8KA 1J6ZA 1LCUA 1OKJA 1YUWA 3LM9A 5M1NA 2ZGZA 3L4IA 1D4XA 5AQJA 3VEVA 4H0VB 2DPNA 4E1JA 2KLAA 5AQRA 1YIJN 2A40A 4A2AA 4CZLA 4DQ8A 4BGAA 4PKHA 2ZGYA 1JJ2M 5BRDA 4IEEA 1EO1A 1BA1A 1YVNA 2QWNA 3FLCO 3UKUB 3VTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z05 A;  1NLV A;  3H1Q A;  3IMX A;  3O08 A;  3O1W A;  2NZT A;  4BR4 A;  2ZWH A;  5AQS A;  3I8B A;  3ZEU A;  4JHD B;  1TYQ B;  3CJB A;  2V7Z A;  4M7Y A;  4QS7 A;  4FOE A;  5AQW A;  3U4L A;  4BQL A;  1HLU A;  3DXM B;  3D7E O;  3CJ7 A;  2P9U B;  1NWK A;  1NGA A;  2Q36 A;  3W0L A;  4FL9 A;  1QZ6 A;  3WT0 A;  3A0I X;  4AM6 A;  1RGI A;  4K42 A;  4JD2 A;  1NGE A;  3A5M C;  1XC3 A;  3L0Q A;  4JN4 A;  3ZX3 A;  1GLJ O;  3LDQ A;  3VET A;  5JMV A;  3U9Z A;  5AQY A;  2F9W A;  1BU6 O;  3HSC A;  3UKR A;  2GWJ A;  2I7N A;  4XH5 A;  4M63 C;  3A5N C;  3KZB A;  2FXU A;  4YDU A;  1WUA A;  4FWO A;  4B1V A;  5KPT A;  3WUH A;  4BR9 A;  3MN5 A;  4BRK A;  3TU5 A;  4FWK A;  4B1Z A;  5EXW A;  1RDW X;  5BN8 A;  3WXI A;  3H46 O;  1QHA A;  2YHW A;  1KAY A;  4BRO A;  4ISF A;  3DAW A;  1Z6R A;  3A5O C;  4FSV A;  2QWL A;  2BUP A;  3LDP A;  3SK3 A;  4XEI A;  2FSJ A;  4EIA A;  4WQ4 A;  2CH5 A;  4H0Y B;  3DJC A;  5AQQ A;  1GLC G;  4EHT A;  2OAN A;  2E88 A;  1T6D A;  4RCH A;  5FPE A;  3D2F A;  2P9L B;  1GLA G;  4BR5 A;  4WYB A;  5BPL A;  3W3D A;  4ISG A;  2Q1N A;  1IJJ A;  3H3N O;  2E2N A;  1DEJ A;  1C0F A;  1QQO A;  2FF6 A;  4BG9 A;  2ASM A;  3QIC A;  4BRN A;  4CZF A;  3FZM A;  3H6E A;  2A5X A;  3L6Q A;  4RTF D;  1MDU B;  5AQP A;  5EX5 A;  2P9K A;  3U8X A;  5TKY A;  4BRG A;  4JNE A;  1QZ5 A;  1CZA N;  1QQN A;  5AQU A;  2FSK A;  1KAX A;  2IVO A;  2PAV A;  2E20 A;  3LDL A;  3C7N B;  4O5F A;  1U2V A;  1IG8 A;  3HTV A;  1HKB A;  5EY4 A;  2QM1 A;  2V7Y A;  4BRD A;  4KBO A;  2VCP A;  5LY3 A;  3A8Y A;  2Q31 A;  4I6M A;  4H5T A;  3S41 A;  5FPM A;  1JCF A;  2ASO A;  1H1V A;  4EFH A;  2QWP A;  4BR7 A;  2E1Z A;  3WEE B;  1YAG A;  3TPQ A;  1GLD G;  3CIP A;  4FPB A;  2HF4 A;  2VYP A;  1EQY A;  1JCG A;  3VOV A;  2V52 B;  1YXQ A;  1ZC6 A;  5E84 A;  5BRH A;  5BRF A;  4HWI A;  3ZX2 A;  3EN9 A;  3KHY A;  4PL8 A;  1NGG A;  4QS9 A;  1R59 O;  3H3O B;  5AQX A;  5BPN A;  4WQ5 A;  5AFU A;  4B1U B;  3FR0 A;  2ZF5 O;  5F1X A;  3R6M A;  3H1V X;  3HM8 A;  1MWM A;  5AZI A;  2D0P A;  3ENH A;  3CET A;  1C0G A;  3EZW A;  4FO0 A;  2A3Z A;  1WOQ A;  4FWR A;  4CI6 A;  3QBW A;  5LJV A;  2CGJ A;  4ISE A;  4H0T B;  3HI0 A;  3J8A A;  4NO7 A;  4CBU A;  1E4G T;  2P9S B;  3JS6 A;  4PKI A;  4CD1 A;  5AFU H;  1P8Z A;  2CGK A;  2P9I A;  2QW9 A;  2YJF A;  3LDO A;  3A5L C;  1S3X A;  2P9N B;  3DXK A;  1SAZ A;  5I9E B;  5KQ8 A;  5AR0 A;  3M6G A;  5JIC A;  4H0O A;  3FE1 A;  1DGK N;  3VPZ A;  2EWS A;  2H3G X;  5EOY A;  4FPA A;  3VER A;  2Q2R A;  1BO5 O;  3ULE B;  1KXP A;  1LOT B;  4XH4 A;  3MN9 A;  4NB4 A;  1NGH A;  2QWR A;  2I7P A;  4A61 A;  3M1F A;  1HUX A;  3UB5 A;  3I33 A;  3VF4 A;  2IVN A;  2FLO A;  2Q97 A;  1GLE G;  1DKG D;  3GBT A;  5AQZ A;  2ITM A;  4A2B A;  2KHO A;  3RSE B;  1MWK A;  2YCH A;  2YHX A;  2A6A A;  3GL1 A;  4BC5 A;  4BRP A;  2YJE A;  1ATS A;  3WXL A;  4CZK A;  4J8F A;  4BC2 A;  3AY9 A;  5AZJ B;  3UKU A;  3M3Z A;  2YHY A;  3VES A;  2A41 A;  4CZI A;  4K41 A;  3ENO A;  5FPD A;  3QML A;  2HF3 A;  3MN6 A;  3WXJ A;  3VEN A;  3AAP A;  4A62 A;  5EVZ A;  3LDN A;  4BQZ A;  4JHD A;  1TYQ A;  4BRA A;  3IDH A;  3ZET B;  1X3M A;  1RFQ A;  4XH1 A;  3G25 A;  2E2P A;  3DXM A;  4DHY A;  1ESV A;  1K8K B;  3EKS A;  4Y0W A;  2P9U A;  2D1K A;  3DWL A;  2GEL A;  5AQN A;  1E4F T;  4WQ5 C;  3VEY A;  4CZE A;  4IO8 A;  3KVG A;  3MN7 A;  3VEW A;  4MO4 A;  5JLH A;  4Z94 A;  3CER A;  4BRL A;  1S22 A;  4K25 A;  1Q18 A;  3D2E A;  5B8H A;  4IXC A;  2GEM A;  2FF3 B;  5BR9 A;  3QFP A;  2A42 A;  1TUU A;  4MLE A;  3VEX A;  3O80 A;  1HPM A;  4BG8 A;  3ZEU B;  3AAQ A;  1KAZ A;  2CH6 A;  2FSN A;  4GY2 B;  4FOI A;  4BRI A;  1MA9 B;  4MO5 A;  3FFK B;  5AQF A;  3ID8 A;  4FWQ A;  3GOI A;  4B1X B;  1JCE A;  1V4T A;  3AAR A;  5JLF A;  3ATV A;  4RWT A;  3CQY A;  3DXK B;  4BC3 A;  4EHU A;  4DCH A;  4JD2 B;  4BRQ A;  1U6Z A;  4H5N A;  3VGK A;  1T6C A;  4FWN A;  5KQD A;  2BTF A;  4BR0 A;  4H03 B;  2AA4 A;  3FZF A;  3UKR B;  2D4W A;  1BG3 A;  3EL2 A;  4HTL A;  2P9L A;  2CGL A;  5F0X A;  5AQH A;  3F9M A;  3B8A X;  4YDU C;  4B1W B;  2P9P A;  3EO3 A;  3CI5 A;  3IUC A;  4O8K A;  3IFR A;  3O4W A;  3BUZ B;  3SMP A;  4F9O A;  3H45 C;  5AQL A;  2VWB A;  1T44 A;  4CZM A;  4EAH D;  3O6W A;  4FWM A;  5KPZ A;  1BWF O;  1BA0 A;  4WQ4 C;  3JXU A;  4MLH A;  4BR2 A;  4BRH A;  1GLL O;  3R8E A;  4FWL A;  3C7N A;  4BRM A;  4BGB A;  3FGU A;  3LM2 A;  3VEZ A;  3D2F B;  1BDG A;  1GLF O;  3CJ9 A;  2QWO A;  4PKG A;  2J4R A;  3EKU A;  4CBW A;  3WQU A;  1ATN A;  5ADX A;  4BVO A;  1SQK A;  5AQG A;  2WUS A;  3WEE A;  1SZ2 A;  3QB0 A;  4LC9 B;  3O5B A;  1NGF A;  3GG4 A;  3GE1 A;  1X3N A;  5BPM A;  2W41 A;  1NMD A;  1X9J A;  2P9K B;  3ATU A;  4K43 A;  2D0O A;  3FZL A;  1G99 A;  3BF3 A;  4JAX A;  3D2E B;  1QQM A;  1U2V B;  3VGL A;  4PL7 A;  5CE3 A;  2IVP A;  5ADX H;  5E26 A;  3CQX A;  5BN9 A;  4C23 A;  3BEX A;  4I6M B;  3CJA A;  3OHR A;  4B9Q A;  3BF1 A;  4FWP A;  4CD3 A;  3QDK A;  4CZJ A;  1NGI A;  2E2O A;  3C0B A;  4DB3 A;  5AQM A;  1BUP A;  5AQK A;  1NGD A;  5LJW A;  4IJN A;  4BRF A;  3O1B A;  1NM1 A;  5AQT A;  3P4I A;  1XQS C;  2HOE A;  2QWM A;  3VF6 A;  1TUY A;  2P9S A;  2UYT A;  2NLX A;  1ZBS A;  1HJO A;  3FZK A;  1NGC A;  1GLB G;  3SLC A;  4BRE A;  2P9N A;  5BRE A;  1ATR A;  4H5R A;  2Q0R A;  3O8M A;  3QFU A;  3CJC A;  3LL3 A;  5KPR A;  2GWK A;  1XUP O;  1Y64 A;  4IWV A;  1HX1 A;  2P9P B;  2ASP A;  3MMV A;  3HZ6 A;  2E8A A;  3ULE A;  5AZI B;  2AP1 A;  4BC4 A;  3WXK A;  3FZH A;  3ZX0 A;  1V4S A;  1NGJ A;  3HBT A;  3CHW A;  4QS8 A;  4M7X A;  2E1Y A;  4H5W A;  3VF2 A;  2YI1 A;  4FWS A;  3RSE A;  2P9I B;  3R9P A;  2QWQ A;  5AQI A;  4BRC A;  2GUP A;  4BVP A;  5AQO A;  4CJ7 A;  3QBX A;  4CZH A;  2E2Q A;  3MK6 A;  3U9D A;  4L3Q A;  5F2R A;  3WQT A;  2IIR A;  2Q0U A;  5AZJ A;  5AQV A;  2W40 A;  1ZXO A;  4GNI A;  3GDQ A;  4H5V A;  4IJA A;  2F9T A;  2V51 B;  3SJH A;  1HKG A;  4AM7 A;  4B1Y B;  5ELZ A;  4IZ9 A;  3VEO A;  1HKC A;  2NRH A;  1NBW A;  5FPN A;  4CBX A;  3MDQ A;  4H0X B;  3SMS A;  4CZG A;  2GTD A;  3VGM A;  3ZET A;  3CJ1 A;  3MCP A;  3UE5 A;  1NGB A;  2PBD A;  2QXL A;  3BP8 A;  4H0P A;  1BOT O;  2HMP A;  1K8K A;  1J6Z A;  1LCU A;  1OKJ A;  1YUW A;  3LM9 A;  2ZGZ A;  3L4I A;  1D4X A;  5AQJ A;  3VEV A;  4H0V B;  2DPN A;  4E1J A;  5AQR A;  2A40 A;  4A2A A;  4CZL A;  4DQ8 A;  4BGA A;  4PKH A;  2ZGY A;  5BRD A;  1BA1 A;  1YVN A;  2QWN A;  3FLC O;  3UKU B; 
#chains in the Genus database with same CATH topology
 3KLF A;  4ELU A;  4DR3 K;  4Y1C A;  2XY5 A;  2ZWH A;  4KV8 A;  1TL1 A;  3HM9 A;  3ZEU A;  2C1G A;  1XMO K;  2V7Z A;  5C2D A;  1KLM A;  4CJU A;  5CHI A;  1NWK A;  3W0L A;  3Q7B A;  4IKF A;  2OTL N;  2C1I A;  4CF1 A;  4Z4H A;  4FK4 A;  1C1A A;  4JD2 A;  4E0D A;  1XC3 A;  5C15 A;  4FM0 A;  4FZX C;  2UXB K;  3LDQ A;  5JMV A;  3U9Z A;  4FLX A;  1HQU A;  5IT9 O;  1E3M A;  2ZJP L;  2GWJ A;  3MXM A;  1TAQ A;  2I7N A;  1LW0 A;  4XH5 A;  4DR2 K;  1IBL K;  2QI2 A;  4DSI A;  3A5N C;  4DG1 A;  1WN7 A;  4C1N I;  1WBD A;  1WUA A;  4FWO A;  3AO4 A;  1LV5 A;  3THY A;  4BR9 A;  3MN5 A;  3DMJ A;  3TU5 A;  4BRK A;  4A57 A;  5EXW A;  1RDW X;  3PLA A;  5BN8 A;  3RR7 A;  2ITG A;  3TAQ A;  2F4V K;  1YVU A;  1N33 K;  4DFJ A;  1TKZ A;  4FSV A;  5HRP A;  2NRW A;  3SNN A;  3SK3 A;  3THV A;  4WQ4 A;  3QEW A;  5AQQ A;  4AHS A;  1SKS A;  4RCH A;  4FW1 A;  4C8N A;  1GLA G;  3VQ4 A;  5BPL A;  2UUA K;  3V4I A;  1IJJ A;  1SV5 A;  4J2D A;  1C0F A;  2IOC A;  4DKW A;  4BG9 A;  2ASM A;  4YY3 K;  3CD6 N;  2WFB A;  4DS5 A;  3THX B;  2KFZ A;  4DSE A;  4C8M A;  1LAW A;  3H6E A;  4E7K A;  2A5X A;  3L6Q A;  1X9W A;  4KHN A;  4RTF D;  3U3G A;  3ZSX A;  2DTU A;  3B6P A;  4X64 K;  4I9L A;  3SCX A;  3VQA A;  3LDL A;  4O5F A;  1HKB A;  5EY4 A;  4CJF A;  4CW7 B;  3RMC A;  4LF6 K;  2HW3 A;  4DUZ K;  1RTH A;  4KBO A;  1TVR A;  4CGI A;  5TKW A;  4ID1 A;  1LWE A;  1RDA A;  2Q31 A;  2E6M A;  1HPZ A;  3AVL A;  1RBV A;  3BY5 A;  1H1V A;  1R0A A;  2IAJ A;  1NK0 A;  4ICL A;  2QWP A;  1TGO A;  1NU0 A;  3C6A A;  1U47 A;  1D8Y A;  1S72 N;  4LSN A;  4LY7 A;  2VYP A;  4FZZ A;  1N6Q A;  1JCG A;  1S1V A;  4CHY A;  4JS4 A;  2V52 B;  5E84 A;  1IKV A;  4HWI A;  3ZX2 A;  3ZYY X;  5AQX A;  2EX3 A;  3DOK A;  3TR8 A;  4JI0 K;  3FR0 A;  2VGN A;  1QSL A;  2ZF5 O;  4DU1 A;  3O4Q A;  2QXF A;  4KH6 A;  1C1B A;  4K8Z A;  3T1Y K;  3ENH A;  3EZW A;  4X62 K;  1O1W A;  2ZM6 K;  2HVH A;  4ISE A;  4HUF A;  4JI4 K;  1TKX A;  3HI0 A;  3V81 A;  4YNQ A;  1RT2 A;  3AVI A;  2G8F A;  4CJ3 A;  4CD1 A;  4BDZ A;  2GBZ A;  3QNO A;  3OYN A;  4FJ7 A;  2YJF A;  3ZCM A;  1U4B A;  1X9M A;  2E4L A;  1TK8 A;  3L2R A;  1D9D A;  4A5A A;  2VGM A;  2YX6 A;  1CXU A;  2OPR A;  5EOY A;  4FPA A;  4B8C A;  4FJI A;  2F8S A;  2IDO A;  1XWL A;  1KXP A;  1LOT B;  1C0U A;  2OPQ A;  4DTM A;  1VQ7 N;  3V1Q A;  2I7P A;  1HUX A;  4KHS A;  1NNE A;  4IFY A;  2KQ2 A;  1DKG D;  3GBT A;  5AQZ A;  2ITM A;  3I0S A;  2KHO A;  2Z1G A;  1Q86 O;  2HHW A;  2YJE A;  3WXL A;  4CZK A;  1EWR A;  4J8F A;  1VQ8 N;  1L3V A;  1OVY A;  4IG3 A;  3AY9 A;  1IBM K;  4K0K K;  3PY8 A;  3RRH A;  3M8R A;  5HBM A;  1EX4 A;  3VEN A;  3AAP A;  2HHT A;  3ZT3 A;  3AO1 A;  3O9Q A;  4JHD A;  4BRA A;  3ZET B;  1VQL N;  1RFQ A;  3S9H A;  4JV5 K;  3DXM A;  4DR4 K;  1TL3 A;  4DHY A;  4BWJ A;  1M90 O;  3K58 A;  3CC7 N;  3VEY A;  4IO8 A;  3OY9 A;  3P1G A;  5KTQ A;  5JLH A;  3RR8 A;  4YOR A;  1S22 A;  1JLA A;  2P51 A;  1K8A O;  5B8H A;  2W00 A;  1DLO A;  2IS3 A;  3DM2 A;  5I3U A;  2GEM A;  4YOY A;  3QFP A;  1TUU A;  4E7J A;  4AHV A;  4BE2 A;  1X1P A;  3SUP A;  1B92 A;  3V9X A;  3AAQ A;  3VMF B;  2CH6 A;  1RNH A;  3FFK B;  1WSJ A;  4MO5 A;  5AQF A;  2G8H A;  5GIP A;  4CIG A;  4DTS A;  1RIL A;  3NF8 A;  1L3S A;  2O8C B;  4Z4F A;  1OH8 A;  1UAX A;  3CQY A;  4EHU A;  1C1C A;  1HYZ A;  3NGY A;  4H5N A;  5KGX A;  2QEX N;  4DR1 K;  3HPH A;  4N56 A;  2HHU A;  2YNG A;  4OPH A;  2BTF A;  3T7Z A;  1W9H A;  4XJX A;  4KTZ A;  1BG3 A;  4HTL A;  1OH5 A;  3BGR A;  2P9P A;  5MLC Q;  3L8B A;  3EO3 A;  3CI5 A;  4OKE A;  3IFR A;  3O4W A;  3O4N A;  1ZBF A;  2AJQ A;  4F9O A;  2VWB A;  1T44 A;  2VQF K;  4MDA A;  5DM7 L;  1W2B M;  3O6W A;  1UA1 A;  3KJV A;  1SKR A;  3HPG A;  4H8K A;  1QQC A;  3JXU A;  4O4G A;  2XRI A;  3L2V A;  3ZLJ A;  3G4S N;  2VG5 A;  3C7N A;  4BRM A;  1ZYQ A;  3KWI A;  1JLQ A;  4CJW A;  5C2F A;  4JI1 K;  3VEZ A;  1VSM A;  1BDG A;  3CJ9 A;  1RTI A;  3PO4 A;  4CBW A;  1HNV A;  3WQU A;  2KFN A;  1Z26 A;  5ADX A;  4JKE A;  4FVM A;  5J1E A;  4DUY K;  2FBV A;  4DTP A;  4EP5 A;  2B4J A;  4LC9 B;  1NGF A;  3GG4 A;  4CIF A;  3ZSY A;  5KGW A;  3MX5 A;  1X9J A;  1N34 K;  4AHC A;  2D0O A;  3N4Q A;  4CES A;  1G99 A;  1NKC A;  1JLF A;  3BF3 A;  4JAX A;  4PL7 A;  2IVP A;  4U7B A;  3CQX A;  4C23 A;  1RT4 A;  3BEX A;  4Z4C A;  4OVL A;  4CEC A;  2ZJR L;  4GVM A;  4FW2 A;  4CD3 A;  3NDK A;  4B3O A;  1I3A A;  3G0Z A;  2QTD A;  2JLE A;  4DB3 A;  5AQM A;  1BUP A;  3OYK A;  4KHP K;  4YFU A;  3BZC A;  4DV7 K;  5HRO A;  4BY9 C;  2HBJ A;  1D5A A;  1HJO A;  4DV3 K;  2O8D A;  1GLB G;  4IO9 L;  3AVC A;  1VQM N;  2GWK A;  4JI7 K;  5FRN A;  1NK7 A;  5FDL A;  2XO7 A;  1HX1 A;  3OYM A;  4CJ4 A;  2E8A A;  3ULE A;  5AZI B;  1N8R O;  4RG8 A;  4B3T K;  4JK7 A;  3OYD A;  1NGJ A;  1J9A A;  4E7L A;  4ZTJ A;  1NJW A;  4M7X A;  3VF2 A;  3NGI A;  1RT6 A;  2BE2 A;  2O8B B;  2P9I B;  2QWQ A;  4BRC A;  2GUP A;  3ZT0 A;  4BVP A;  1LW2 A;  2EHG A;  3AGK A;  5F2R A;  3K5O A;  5AQV A;  4DTJ A;  1QVG M;  1T03 A;  4IJA A;  4JI6 K;  2V51 B;  1IG9 A;  1CXQ A;  1KCF A;  1T8E A;  4CEF A;  3S3M A;  4B1Y B;  3HT3 A;  3VEO A;  3OYI A;  1HKC A;  4IOA L;  3ASM A;  4H0X B;  3SMS A;  4JYA K;  2GTD A;  3VGM A;  4M3Z A;  1K9M O;  3LP0 A;  2HHH K;  3BP8 A;  4H0P A;  3QEV A;  4Y1D A;  4DS4 A;  1J6Z A;  1LCU A;  1YUW A;  3LM9 A;  1VHX A;  3L4I A;  2DPN A;  4E1J A;  5AQR A;  1YIJ N;  3L2U A;  1XHX A;  2Q3S A;  4PKH A;  2YHA A;  1NK4 A;  5JS1 A;  1YVN A;  3UKU B;  2B6A A;  4H4M A;  1Z05 A;  3PSI A;  1NLV A;  3RMB A;  4E1N A;  4DTU A;  3O1W A;  2NZT A;  4BR4 A;  4DR5 K;  4HCC A;  5AQS A;  4CGD A;  3TTF A;  1A5V A;  4WFA L;  4OO1 J;  1G15 A;  3DRS A;  4AF1 A;  3CJB A;  4O55 A;  5AQW A;  3U4L A;  2VWJ A;  1TKT A;  5HRR A;  4NLB A;  3MXI A;  2Y1I A;  2I5J A;  2ETJ A;  4OLA A;  3DLG A;  2Q36 A;  4FL9 A;  3A0I X;  1U04 A;  4K42 A;  4CGH A;  1U49 A;  3OYA A;  4LFC K;  3WNF A;  2X74 A;  3U3Y A;  3OBW A;  1GLJ O;  4ELV A;  4MFB A;  1SUQ A;  2OPP A;  4DV6 K;  5AQY A;  2YNH A;  4M3Y A;  3CC2 N;  4G9Z A;  3UKR A;  4J2E A;  2HBM A;  1YTA A;  2G8W A;  3KZB A;  2FXU A;  4YDU A;  3ZSW A;  4GW6 A;  4B1V A;  1ZBL A;  3WUH A;  4FJJ A;  4B1Z A;  1LWC A;  4HUE A;  3U6F A;  3WXI A;  4CFB A;  1KAY A;  4BRO A;  2G8K A;  2NNW A;  1Z6R A;  2BUP A;  3LDP A;  5HRN A;  3OYJ A;  5I42 A;  1KSP A;  3MX2 A;  4H0Y B;  3E66 A;  4CJT A;  1GOC A;  4KHY A;  1OH6 A;  2E88 A;  4B08 A;  4LF4 K;  5FPE A;  3VN5 A;  3D2F A;  4CF9 A;  5T7B A;  2Q1N A;  2E2N A;  3ID6 A;  2FF6 A;  1Y97 A;  3TSU A;  3QIC A;  3AV9 A;  4CZF A;  4FJK A;  1MDU B;  5AQP A;  4UQG A;  4CHN A;  5TKY A;  3QER A;  4JNE A;  3SBT A;  1QZ5 A;  1S1U A;  1QQN A;  5AQU A;  4KO0 A;  5BR8 K;  4ILJ A;  4DF8 A;  1VQ6 N;  4BAC A;  3I0R A;  2E20 A;  4LH4 A;  2KKZ A;  4BRD A;  1W7A A;  1IH7 A;  2YV0 X;  1IKY A;  4O5B A;  2BDP A;  4ZHR A;  1NOY A;  4DR6 K;  3Q7C A;  2XY8 A;  4FJ9 A;  1JCF A;  4Z4E A;  1XMQ K;  4CK2 A;  5SWM A;  4BR7 A;  3BDP A;  3WEE B;  1YAG A;  4IFV A;  3TPQ A;  2HF4 A;  1UOC A;  1BI4 A;  3RVC A;  1QVF M;  2UXD K;  2HND A;  4CHQ A;  1T7P A;  5BRF A;  1JLG A;  1RT1 A;  4I7F A;  3AVB A;  3EN9 A;  2QKK A;  1NGG A;  1YF5 L;  3K0S A;  4C8L A;  1LWF A;  2HMI A;  2RF2 A;  3K5M A;  4WQ5 A;  5AFU A;  4ILH A;  4YOT A;  4XIU A;  4CF8 A;  4OGE A;  1A5W A;  2W42 A;  3CET A;  1C0G A;  2A3Z A;  5FRO A;  2P1J A;  4CEQ A;  4CI6 A;  5CZ2 A;  2CGJ A;  3DLH A;  3ZT2 A;  4PKI A;  1P8Z A;  2QW9 A;  3A5L C;  1S3X A;  5JVH L;  3DXK A;  5KQ8 A;  1EKE A;  4C8K A;  5AR0 A;  3M6G A;  5JIC A;  3THW A;  3D0P A;  1FK9 A;  3OA9 A;  4BEC A;  4FJM A;  3FE1 A;  3LAN A;  3VPZ A;  2FC0 A;  3NFA A;  3VER A;  2Q2R A;  1BO5 O;  4GKJ K;  3OTO K;  4FZY A;  1LAV A;  4CJQ A;  5C0Y A;  1JLC A;  1SKW A;  3I33 A;  1WAJ A;  2Q97 A;  5C42 A;  3RSE B;  1MWK A;  2YCH A;  3NVM A;  2A6A A;  3GL1 A;  4BC5 A;  3QLH A;  2PYL A;  2BGG A;  3KD5 E;  3C94 A;  5AZJ B;  3NH2 A;  3VES A;  4DMN A;  3ENO A;  3LPT A;  1O13 A;  3QML A;  2YKM A;  2HF3 A;  4A62 A;  5J2P A;  5EVZ A;  5GIN A;  3AA5 X;  4R5P A;  5C24 A;  3AO5 A;  3G25 A;  2DFH A;  4AH9 A;  4NYF A;  1ESV A;  1K8K B;  4Y0W A;  2KZZ A;  4FLZ A;  1FJG K;  2D1K A;  3DWL A;  5H1S Q;  1XI1 A;  3KVG A;  2NUB A;  1CZ9 A;  5AJ3 K;  5J2N A;  4LF9 K;  2Y1J A;  3EY1 A;  3HO1 A;  4IG0 A;  1NK6 A;  4KHU A;  2FSN A;  3TAP A;  4FOI A;  1N5Y A;  1KVB A;  3KK7 A;  3TI0 A;  4W5N A;  2BAN A;  3B6O A;  3GOI A;  4B1X B;  4LF7 K;  4FJN A;  3AAR A;  1T05 A;  4RWT A;  4BE7 B;  4JLH A;  4BRQ A;  4NCB A;  3VTH A;  3SPZ A;  4AHU A;  1T6C A;  5HLF A;  3FZF A;  2NRV A;  2OZM A;  3EL2 A;  5F0X A;  1DTT A;  3F9M A;  3AVA A;  4B1W B;  4O0I A;  3J81 O;  4M45 A;  1K6Y A;  3IKM A;  3PIO L;  4GV3 A;  3THX A;  2O4G A;  3M8S A;  3FFI A;  3LZI A;  1GOA A;  4EAH D;  4BEB A;  3LP2 A;  3EE8 A;  1BA0 A;  4IEI A;  3HVT A;  3VQ9 A;  4M3W A;  2DY4 A;  5M1O A;  3R8E A;  4MQ3 A;  3CFR A;  4F4K A;  3LM2 A;  4NCA A;  1BHL A;  4GMJ B;  3K9J A;  1KVA A;  1GLF O;  2IGI A;  4PKG A;  2J4R A;  3OJS A;  4RW9 A;  4W5O A;  1Z25 A;  3AO2 A;  4B9S A;  3QB0 A;  3CCR N;  3AVM A;  4NYN A;  3PO5 A;  2HVI A;  2O8E B;  1NMD A;  2P9K B;  2DFE A;  4YOX A;  3FZL A;  4LFA K;  4LF5 K;  3WNG A;  1U2V B;  3VGL A;  3SPY A;  3HXM A;  1HNX K;  1FKP A;  5ADX H;  2W6L A;  4WE1 A;  2UU9 K;  4I6M B;  3OHR A;  4B9Q A;  3BF1 A;  4FWP A;  2QKB A;  4CZJ A;  1S1X A;  1KC8 O;  3C0B A;  5AQK A;  3TAG A;  4GV6 A;  3CCQ N;  1I39 A;  4BRF A;  1BCM A;  4JK9 A;  3V1O A;  3HOS A;  3P4I A;  1QSY A;  2HOE A;  3DRR A;  4B9L A;  1YJN N;  2NRZ A;  3FZK A;  1UA0 A;  2HHI A;  5M1Q A;  4CK1 A;  3CJC A;  3LL3 A;  3VA0 A;  5KPR A;  4CVN E;  4E3S A;  4IWV A;  2P9P B;  2HHV A;  3HZ6 A;  4J2B A;  1A5X A;  1S6P A;  5DMR A;  3WXK A;  3FZH A;  1VQO N;  4JKG B;  4DTN A;  1VSK A;  3CHW A;  1K73 O;  3O9T A;  4W5R A;  5KI6 A;  4DTX A;  2O8F B;  4TSX A;  4OKK A;  2VQE K;  3ULD A;  1BGX T;  4Q5V A;  3QBX A;  4RW8 A;  2DFF A;  4CGF A;  3CCU N;  5D3G A;  3TSQ A;  3ALY A;  1RTD A;  4JI2 K;  4JKA A;  4H5V A;  3SJH A;  5CY4 A;  1NOZ A;  4BWM A;  1NBW A;  4CBX A;  1YT3 A;  4KB0 A;  3MDQ A;  4CZG A;  3ZET A;  1BL3 A;  3DLB A;  4FJ5 A;  3CJ1 A;  1EWQ A;  3E9L A;  3HVR A;  1NGB A;  2RKI A;  4QCL A;  4N47 A;  2P5O A;  2ZGZ A;  3EZ5 A;  4H0V B;  3NBP A;  3IRX A;  2A40 A;  4PA1 A;  4CZL A;  3RWU A;  3DOL A;  4FJG A;  4BGA A;  2OZS A;  4IEE A;  3QIN A;  1BA1 A;  3KLH A;  4F3T A;  4UY8 O;  1VQ5 N;  3IMX A;  3O08 A;  3AVN A;  1ILY A;  1MU2 A;  3VQ5 A;  4U67 L;  3I8B A;  1L3T A;  3P38 A;  1TYQ B;  3CCS N;  4BQL A;  4QS7 A;  4FOE A;  5SZT A;  3V9Z A;  3DLK A;  1SL0 A;  4DV5 K;  1HLU A;  1YTU A;  4JKF A;  5GAH P;  3OW2 M;  4B3M K;  2HST A;  5M1F A;  3CJ7 A;  2P9U B;  3CFP A;  2O8C A;  3WT0 A;  1QZ6 A;  4AM6 A;  1RGI A;  5HL7 L;  1WSG A;  1N32 K;  4O44 A;  1NGE A;  3A5M C;  3L0Q A;  1VQK N;  4I2Q A;  4CJE A;  5HP1 A;  2F8T A;  2F9W A;  3VQ6 A;  3O9S A;  1WSI A;  3OYF A;  1W97 L;  3SQ4 A;  5KPT A;  1CZB A;  1RDC A;  4FWK A;  4JKC A;  3T19 A;  4IOC L;  3H46 O;  4CJR A;  3DRP A;  4I2P A;  2D5R A;  4AHR A;  3DAW A;  3O9U A;  3A5O C;  3V9U A;  1BQN A;  4XEI A;  3BZK A;  4EIA A;  4CEA A;  2CH5 A;  1Q81 O;  3SBG A;  1GLC G;  4OGC A;  2OAN A;  3MXJ A;  1NJZ A;  1T6D A;  3ITH A;  2P9L B;  4MDB A;  4WYB A;  2YKN A;  4ISG A;  1RBT A;  1ASU A;  4PY5 A;  1DEJ A;  3N4P A;  3QET A;  1QQO A;  1TV6 A;  4J2A A;  4BRN A;  4FCY A;  3FZM A;  4BDY A;  3F5T A;  5EX5 A;  3OS1 A;  3P31 A;  4BRG A;  3LDS A;  4CHZ A;  2R7Y A;  1CZA N;  3E9O A;  2RPI A;  4FJH A;  2IVO A;  2PAV A;  3CMA N;  3HTV A;  5JS2 A;  2QM1 A;  2V7Y A;  3K59 A;  3SJJ A;  1EP4 A;  4A59 A;  3M8P A;  3SV4 A;  3S41 A;  4JI8 K;  2X6S A;  4CE9 A;  1S9G A;  4A5B A;  1YJW N;  3QES A;  1GLD G;  3CIP A;  4E7H A;  2Z1I A;  1RDD A;  3ISN C;  1ZC6 A;  5GIO A;  3PX0 A;  3QNN A;  3CCL N;  5M1K A;  1HR0 K;  3MWP A;  1IKW A;  4FK0 A;  1JL1 A;  4JKD A;  2XHB A;  5BPN A;  4E89 A;  1VSD A;  1L3U A;  3O3F A;  3ZT1 A;  5F1X A;  3VQQ A;  4E1M A;  3TAF A;  1B9F A;  5AZI A;  3HM8 A;  1MWM A;  4H4O A;  1WOQ A;  2ZE2 A;  2NRT A;  1Q8I A;  3ZSQ A;  3V9W A;  3LAL A;  2UUC K;  4NO7 A;  3KKS A;  3C95 A;  2P9S B;  1SL2 A;  5JVG L;  1NJY A;  5AFU H;  1KLN A;  4CGG A;  2O8B A;  2P9I A;  4OPK A;  2P9N B;  1SAZ A;  2HHQ A;  4GKK K;  2OCE A;  4KTW A;  4H0O A;  3TTD A;  2XY6 A;  4NXM K;  4CEE A;  2EWS A;  3OYL A;  1HYS A;  3ZT4 A;  1TKD A;  3WNE A;  3CPE A;  2D0B A;  3HK2 A;  3SAG A;  1WSE A;  3MN9 A;  1KQS M;  2W6K A;  5GAE P;  3K2P A;  3M1F A;  3UB5 A;  2IVN A;  4Z4I A;  2FLO A;  5J2M A;  1GLE G;  5HRS A;  4JS5 A;  4N76 A;  2OPS A;  3WNH A;  4B9M A;  3VQE A;  1VAZ A;  4FXD A;  3NVK A;  4CJS A;  3O9R A;  3K9K A;  1FKO A;  1DT9 A;  1JLE A;  4KI4 A;  3UKU A;  2YHY A;  2A41 A;  4CZI A;  5FPD A;  4GV9 A;  3MWT A;  3MCA B;  4NCG A;  3MAQ A;  1WSH A;  3WXJ A;  4DQS A;  4FLU A;  2ZD1 A;  2VG7 A;  3LDN A;  4AHT A;  3K5N A;  4BQZ A;  1X3M A;  4XH1 A;  5A2Q O;  2E2P A;  3EKS A;  3NH0 A;  1TK0 A;  4WQ5 C;  4CZE A;  1J5E K;  1L5U A;  3VEW A;  4QAG A;  4Z94 A;  3CER A;  1RTJ A;  3LAM A;  4BRL A;  3C6U A;  4FYD A;  3D2E A;  4W5T A;  3P5J A;  4IXC A;  4CF2 A;  2FF3 B;  2X6N A;  4MLE A;  3VEX A;  4FVU A;  5FRM A;  4QOZ B;  4DV0 K;  2OA8 A;  4BG8 A;  3ZEU B;  1WNS A;  4GY2 B;  4KHQ A;  4BRI A;  1GOB A;  3C6H A;  4OPJ A;  4FWQ A;  1V4T A;  5JLF A;  4C8O A;  3DXK B;  4BC3 A;  3G71 N;  3PUF A;  1X9S A;  4JD2 B;  1HYV A;  1U6Z A;  2YHB A;  3QEX A;  1IBK K;  4JEP A;  4EP4 A;  3TAR A;  4FM1 A;  4FWN A;  5KQD A;  4BR0 A;  4H03 B;  2PFU A;  3SQ0 A;  2D4W A;  3SAH A;  2CGL A;  3HPO A;  1U45 A;  4KKO A;  4KH4 A;  5E41 A;  4DQP A;  4OPA A;  1HNW K;  3TWH A;  4CEZ A;  3IUC A;  4O8K A;  3THY B;  1KFS A;  1HJR A;  1WAF A;  3PV8 A;  3BUZ B;  3CM6 A;  3SMP A;  3OVN A;  4CCH A;  5AQL A;  4WFB L;  2UXC K;  3RMD A;  4FWM A;  5KPZ A;  3AA4 A;  4DU4 A;  4WQ4 C;  4MLH A;  4BR2 A;  3KKR A;  3CCE N;  4CF0 A;  1C0T A;  2RN2 A;  2XY7 A;  3OJU A;  1YI2 N;  3MEG A;  4FWL A;  4BE0 A;  3T3F A;  4BGB A;  3KK2 A;  3O3H A;  4HVJ A;  4YOV A;  4OJR A;  3EKU A;  1ATN A;  4LFB K;  1SQK A;  5AQG A;  2WUS A;  4PUO A;  3WEE A;  2YNF A;  1SZ2 A;  4C1N K;  3O5B A;  3AO3 A;  2VWK A;  1X3N A;  5C12 A;  3KD1 E;  4I9Q A;  1ZBI A;  4K43 A;  3ATU A;  2QA4 N;  3RTV A;  4M3T A;  1OH7 A;  4IBN A;  4B9N A;  3KWG A;  5KRS A;  1ITG A;  4E72 A;  1HNZ K;  4FJ8 A;  2HNY A;  3NAE A;  1REV A;  5E26 A;  4W5Q A;  2HBK A;  3CJA A;  4E7I A;  4JRP A;  3JSM A;  4CFD A;  4RW4 A;  2E2O A;  4KRF A;  1NGD A;  4CGJ A;  3AVF A;  1RT5 A;  4LD0 A;  4CIE A;  4PHT X;  1NK5 A;  1XQS C;  3VF6 A;  1SS6 A;  3E9P A;  4WCE L;  1DTQ A;  4O8U A;  2NLX A;  3HP9 A;  2A1S A;  5J2Q A;  2HHS A;  1NGC A;  4BRE A;  3SLC A;  4FLV A;  3JAM O;  2KW4 A;  1WLJ A;  1XC9 A;  4N41 A;  4FLT A;  1Y64 A;  3IG1 A;  3S3O A;  1HMV A;  1RDB A;  4EZ6 A;  2ASP A;  3MMV A;  4N5S A;  1UWB A;  3NCI A;  3CCM N;  1NJX A;  3HYF A;  1S6Q A;  4R79 A;  3ZX0 A;  1WBB A;  3EYZ A;  4HUG A;  4JKB A;  1WB9 A;  4B3R K;  1J54 A;  3NMU A;  3ZSV A;  4H5W A;  3P39 A;  4FWS A;  3DI6 A;  1S1W A;  3RSE A;  4DWI A;  3SV3 A;  3J80 O;  3H08 A;  3I56 N;  4BE1 A;  4X66 K;  1S5J A;  4CZH A;  3OYG A;  2E2Q A;  3SZ2 A;  1JL2 A;  3NGZ A;  3MK6 A;  4IDK A;  3U9D A;  3ENB A;  3OYB A;  1KRP A;  3V1R A;  4F3O A;  2IIR A;  2Q0U A;  5AZJ A;  3I55 N;  1IO2 A;  4DQQ A;  2W40 A;  1ZXO A;  1NK8 A;  3VQ8 A;  1NK9 A;  1TK5 A;  3KK1 A;  3F2K A;  4DFM A;  1HKG A;  4AM7 A;  2Z1J A;  4M3X A;  3VA3 A;  5LL6 Z;  1KD1 O;  1NKB A;  4ILG B;  5CR4 A;  3PX6 A;  3MCP A;  2D0C A;  3J7Z O;  2PBD A;  1VK0 A;  1BCO A;  4RW7 A;  4CK3 A;  5CYM A;  1K8K A;  3OS2 A;  5M1N A;  3QO9 A;  4DSF A;  4CFA A;  1D4X A;  5AQJ A;  2KLA A;  3AA3 A;  4A2A A;  2ZGY A;  4LF8 K;  5BRD A;  3T1H K;  3SUO A;  3VTI A;  1BIS A;  3H1Q A;  4DV4 K;  4NLC A;  3NF6 A;  1BIU A;  2F96 A;  4JHD B;  4M7Y A;  3CYG A;  1QE1 A;  3DXM B;  3D7E O;  1BIZ A;  2RHK A;  4KFB A;  1VQ4 N;  1NGA A;  4M3R A;  1SL1 A;  2RE2 A;  5CYQ A;  1HRH A;  4AIL C;  3AVJ A;  4JN4 A;  3ZX3 A;  4RW6 A;  4CJV A;  3VET A;  4Q0B A;  3VQD A;  3F9K A;  1VQN N;  4YOU A;  1BU6 O;  3HSC A;  1VSE A;  2GUI A;  4CEO A;  3CC4 N;  5CZ1 A;  2WTU A;  4M63 C;  2JWK A;  1J5O A;  2X78 A;  3TAM A;  1QHA A;  3KIO A;  2YHW A;  3DYA A;  2ATQ A;  4ISF A;  4DTO A;  4FJX A;  4B9V A;  2E5L K;  1IKX A;  2QWL A;  3TTC A;  1HQE A;  4FJL A;  2FSJ A;  3SQ1 A;  3DJC A;  2KTQ A;  2OTJ N;  4EHT A;  1B9D A;  1VSI A;  3PSF A;  4IDH A;  1JXE A;  3V9S A;  4BR5 A;  2WOM A;  1ZBU A;  1YIT N;  3W3D A;  3NH1 A;  3H3N O;  3MED A;  3I8D A;  2B5J A;  3AVK A;  2WC9 A;  3CM5 A;  3MEE A;  3LP3 A;  4KI6 A;  1F21 A;  1RBR A;  2O8E A;  2P9K A;  3U8X A;  4IOX A;  2PZS A;  3KK3 A;  2FSK A;  4CJ5 A;  1KAX A;  4FLY A;  1C0M A;  3C65 A;  1NKE A;  3IAY A;  3C7N B;  1U2V A;  1IG8 A;  3SI6 A;  4OLB A;  2NRX A;  4JKH A;  5HOO A;  2F7T A;  2VCP A;  5LY3 A;  5C25 A;  3CPW M;  2HNZ A;  3A8Y A;  1YHQ N;  4I6M A;  4H5T A;  3S5T A;  5FPM A;  2BH1 A;  2ASO A;  3EE9 A;  4DQR A;  4M41 A;  4EFH A;  3A2F A;  4F2R A;  3L3U A;  2E1Z A;  3TAE A;  1FW6 A;  1QSS A;  3G10 A;  2OYQ A;  4FPB A;  4L8R B;  1KTQ A;  1EQY A;  3J7Y P;  1Q9X A;  3DLL L;  3K5L A;  3V6D A;  3VOV A;  4X65 K;  1YXQ A;  3OYC A;  5BRH A;  3KHY A;  4PL8 A;  3PX4 A;  4QS9 A;  4HCB A;  1BQM A;  1R59 O;  3H3O B;  4DV2 K;  1U48 A;  1NG9 A;  4JRQ A;  3E01 A;  4CJK A;  3ZSZ A;  3VQC A;  4B1U B;  1KVC A;  1WSF A;  3M8Q A;  3HST B;  1Q82 O;  3T1A A;  4DR7 K;  1VRU A;  3L3V A;  1S9E A;  3H1V X;  3R6M A;  2O4I A;  5KRT A;  2D0P A;  3KLI A;  4G1Q A;  5DK5 A;  4FWR A;  4JKG A;  4FO0 A;  3QBW A;  1VQP N;  5LJV A;  4H0T B;  4DQI A;  3J8A A;  4CBU A;  4WFN L;  2O8F A;  1E4G T;  3JS6 A;  3F73 A;  4PWD A;  2CGK A;  3LDO A;  4YOW A;  2O8D B;  2WON A;  5I9E B;  3C6T A;  3CYM A;  3P83 D;  4DFK A;  4EZ9 A;  1DGK N;  2H3G X;  3SUN A;  5GAD P;  4ID5 A;  3ULE B;  2VG6 A;  2HHX A;  2ZQB A;  4XH4 A;  4CJL A;  2G8U A;  4NB4 A;  1NGH A;  2QWR A;  4A61 A;  3VF4 A;  4B9U A;  4KB1 A;  1JLB A;  2KZM A;  4A2B A;  3TSP A;  1XNR K;  4Z0U A;  3PIP L;  3OYH A;  4F8R A;  4JI3 K;  3QEP A;  3CCJ N;  2YHX A;  3KLG A;  4M3U A;  5IWA K;  4FM2 A;  3R1X A;  4BRP A;  5GAG P;  1ATS A;  4BC2 A;  4LSL A;  3KLE A;  3CF5 L;  1VSH A;  3SQ2 A;  3AGR A;  3TAB A;  3M3Z A;  4K41 A;  3NHG A;  4F2S A;  3MN6 A;  2YNI A;  4BDP A;  1TYQ A;  4OKJ A;  3DLR A;  3IDH A;  3E1Y A;  3NF7 A;  3OYE A;  4WF9 L;  1EET A;  2P9U A;  2GEL A;  5AQN A;  4NXN K;  4DSJ A;  1E4F T;  2FBT A;  3HL8 A;  3O3G A;  3MN7 A;  4MO4 A;  1JXB A;  2JWL A;  4K25 A;  4ZTF A;  1Q18 A;  2Z1H A;  3SAF A;  4YHH K;  1EXQ A;  1Q9Y A;  5BR9 A;  2A42 A;  1VSL A;  3CQ8 A;  3AVH A;  2WBN A;  3O80 A;  5LMU K;  1HPM A;  3CCV N;  1KAZ A;  1MA9 B;  3L2W A;  1VQ9 N;  3ID8 A;  4CHP A;  1JCE A;  3ATV A;  2NRR A;  4CER A;  4DCH A;  4OX9 K;  3NE6 A;  3UIQ A;  1Q7Y O;  3VGK A;  1RDU A;  2FBY A;  1RBU A;  4IFE A;  1RT7 A;  2AA4 A;  3UKR B;  3LP1 A;  3WXM B;  2P9L A;  3DLE A;  5AQH A;  4DSL A;  3B8A X;  3T69 A;  4YDU C;  3KTQ A;  3LWM A;  1YJ9 N;  1M1K O;  1S1T A;  2G8V A;  3L4Q A;  2D0A A;  3QIP A;  2ZJQ L;  3H45 C;  5EU7 A;  1D9F A;  2GV9 A;  4CZM A;  3HOT A;  4DFP A;  5FLX O;  1BWF O;  3JYT A;  3LAK A;  4CJP A;  4BRH A;  4B8A B;  2PY5 A;  1JKH A;  1GLL O;  4GVE A;  2E6L A;  3AA2 A;  4FLW A;  4KH5 A;  4LH5 A;  3FGU A;  3HRG A;  4DV1 K;  3D2F B;  2UUB K;  3R3L A;  3OBY A;  3HP6 A;  2QWO A;  3CFO A;  4KAZ A;  1NMN A;  3J7A P;  1HNI A;  2FBX A;  4BVO A;  1T3V A;  3K57 A;  4V19 S;  1FXX A;  3ZSO A;  5C10 A;  3D45 A;  3GE1 A;  4JI5 K;  5BPM A;  2W41 A;  4DF4 A;  3SYZ A;  4KRE A;  2HBL A;  3D2E B;  1QQM A;  3LWL A;  4M42 A;  1QTM A;  5M1P A;  5CE3 A;  3QIO A;  1P90 A;  4FK2 A;  4KTQ A;  5BN9 A;  1TAU A;  3LZJ A;  4DU3 A;  3QDK A;  1RBS A;  1NGI A;  5LMN K;  1QHT A;  3D6R A;  2QK9 A;  1IV0 A;  5LJW A;  1RT3 A;  4IJN A;  3IS9 A;  3ZSR A;  1BI4 B;  1NM1 A;  3O1B A;  5AQT A;  3CG7 A;  4O0J A;  2QWM A;  1TUY A;  4HHT A;  2P9S A;  3CXC M;  2UYT A;  4ELT A;  1ZBS A;  2GX9 A;  3VQP A;  3SUQ A;  1ASV A;  1ASW A;  3LPU A;  2P9N A;  1XNQ K;  5BRE A;  1ATR A;  4H5R A;  2G8I A;  2Q0R A;  3O8M A;  3QFU A;  5JEN A;  5K14 A;  1XUP O;  4AQY K;  4B9T A;  4CED A;  5DM6 L;  3S3N A;  3OS0 A;  4JK8 A;  3TAN A;  1W0H A;  1ZBH A;  3VQB A;  1QS4 A;  2AP1 A;  3M5R A;  4BC4 A;  4B3S K;  1V4S A;  4E19 A;  3NF9 A;  3HBT A;  1XHZ A;  4KHW A;  1RCH A;  1CLQ A;  4QS8 A;  4K8X A;  2E1Y A;  2YI1 A;  4Z4G A;  3HJF A;  1J53 A;  3R9P A;  5AQI A;  2A1R A;  1VSF A;  2P5G A;  3MEC A;  5AQO A;  3RMA A;  4CJ7 A;  2PYJ A;  3VQ7 A;  4CFC A;  3THW B;  2IC3 A;  4L3Q A;  3WQT A;  4DTR A;  2LSN A;  3AVG A;  3CME N;  4CEB A;  2JGU A;  4GNI A;  3GDQ A;  1VSJ A;  1NJI O;  4HTU A;  1C6V A;  2F9T A;  3RRG A;  1N36 K;  5ELZ A;  4IZ9 A;  4DLE A;  1KFD A;  2NRH A;  5FPN A;  4DSK A;  3UE5 A;  1I94 K;  2QXL A;  1BOT O;  2HMP A;  1OKJ A;  2HB5 A;  4KPY A;  3VEV A;  1OVQ A;  3EEQ A;  4DLG A;  4PQU A;  4DQ8 A;  1VRT A;  4CHO A;  3L2Q A;  1JJ2 M;  1EO1 A;  3G6E N;  2QWN A;  3FLC O;  3QEI A; 
#chains in the Genus database with same CATH homology
 4UY8 O;  1Z05 A;  1NLV A;  3H1Q A;  3IMX A;  3O08 A;  1VQ5 N;  3O1W A;  2NZT A;  4NLC A;  2ZWH A;  4BR4 A;  5AQS A;  1ILY A;  3TTF A;  4U67 L;  4WFA L;  3I8B A;  4OO1 J;  3ZEU A;  2C1G A;  3P38 A;  1TYQ B;  3CJB A;  2V7Z A;  4JHD B;  4M7Y A;  4FOE A;  4QS7 A;  5AQW A;  3U4L A;  4BQL A;  5C2D A;  1HLU A;  4NLB A;  4JKF A;  3DXM B;  5GAH P;  3D7E O;  3OW2 M;  2HST A;  2RHK A;  5M1F A;  1VQ4 N;  3CJ7 A;  2P9U B;  5CHI A;  1NWK A;  1NGA A;  2Q36 A;  3Q7B A;  4FL9 A;  1QZ6 A;  3W0L A;  3A0I X;  3WT0 A;  4AM6 A;  2RE2 A;  1RGI A;  4K42 A;  5HL7 L;  2OTL N;  2C1I A;  3CCS N;  4JD2 A;  1NGE A;  3A5M C;  1XC3 A;  3L0Q A;  5C15 A;  1VQK N;  4JN4 A;  3OBW A;  3ZX3 A;  1GLJ O;  3LDQ A;  3VET A;  5JMV A;  3U9Z A;  5AQY A;  1VQN N;  4YOU A;  2F9W A;  1BU6 O;  3CC2 N;  3HSC A;  3UKR A;  4G9Z A;  3O9S A;  2ZJP L;  2GWJ A;  3CC4 N;  2I7N A;  4XH5 A;  2HBM A;  2QI2 A;  2JWK A;  3A5N C;  4M63 C;  1W97 L;  3KZB A;  2FXU A;  4C1N I;  4YDU A;  1WUA A;  4FWO A;  4B1V A;  5KPT A;  3WUH A;  4BR9 A;  3MN5 A;  4BRK A;  3TU5 A;  4FWK A;  4JKC A;  4A57 A;  4B1Z A;  5EXW A;  1RDW X;  3PLA A;  5BN8 A;  4IOC L;  3WXI A;  3H46 O;  1QHA A;  2YHW A;  1KAY A;  4BRO A;  4ISF A;  3DAW A;  2NNW A;  1Z6R A;  3A5O C;  3O9U A;  4FSV A;  2QWL A;  2NRW A;  2BUP A;  3LDP A;  3TTC A;  3SK3 A;  4XEI A;  2FSJ A;  4EIA A;  4WQ4 A;  2CH5 A;  1Q81 O;  3MX2 A;  4H0Y B;  3DJC A;  5AQQ A;  3E66 A;  2OTJ N;  3SBG A;  1GLC G;  4EHT A;  2OAN A;  2E88 A;  1T6D A;  4RCH A;  4IDH A;  5FPE A;  3D2F A;  2P9L B;  1GLA G;  4MDB A;  4WYB A;  4BR5 A;  5BPL A;  1YIT N;  3W3D A;  4ISG A;  2Q1N A;  1IJJ A;  3H3N O;  2E2N A;  3ID6 A;  1DEJ A;  1C0F A;  3N4P A;  1QQO A;  2WC9 A;  2FF6 A;  4BG9 A;  4DKW A;  3TSU A;  2ASM A;  3CD6 N;  3QIC A;  4BRN A;  2WFB A;  4CZF A;  3FZM A;  3H6E A;  2A5X A;  3L6Q A;  4RTF D;  1MDU B;  5AQP A;  3F5T A;  5EX5 A;  2P9K A;  3P31 A;  5TKY A;  3U8X A;  4IOX A;  4BRG A;  4JNE A;  3SBT A;  1QZ5 A;  1CZA N;  1QQN A;  5AQU A;  2FSK A;  1KAX A;  3E9O A;  4ILJ A;  3C65 A;  1VQ6 N;  2IVO A;  2PAV A;  2E20 A;  3CMA N;  3LDL A;  3C7N B;  4O5F A;  2KKZ A;  1U2V A;  1IG8 A;  3HTV A;  1HKB A;  5EY4 A;  2QM1 A;  2NRX A;  2V7Y A;  4JKH A;  4A59 A;  4BRD A;  4KBO A;  5HOO A;  2F7T A;  2VCP A;  5LY3 A;  5TKW A;  3A8Y A;  3CPW M;  3Q7C A;  2Q31 A;  4I6M A;  4H5T A;  3S41 A;  1YHQ N;  5FPM A;  2BH1 A;  1JCF A;  2ASO A;  3EE9 A;  1H1V A;  4EFH A;  4A5B A;  2QWP A;  4BR7 A;  2E1Z A;  3WEE B;  3C6A A;  1YJW N;  1YAG A;  1S72 N;  3TPQ A;  1GLD G;  3CIP A;  4FPB A;  2HF4 A;  2VYP A;  1EQY A;  3RVC A;  3DLL L;  1QVF M;  1JCG A;  3VOV A;  2V52 B;  1YXQ A;  1ZC6 A;  5E84 A;  5GIO A;  5BRH A;  3CCL N;  5BRF A;  4HWI A;  5M1K A;  3ZX2 A;  3MWP A;  3EN9 A;  3KHY A;  4PL8 A;  1NGG A;  1YF5 L;  4QS9 A;  3ZYY X;  1R59 O;  3H3O B;  5AQX A;  4JKD A;  5BPN A;  4WQ5 A;  5AFU A;  4B1U B;  3FR0 A;  4ILH A;  4YOT A;  2VGN A;  1Q82 O;  2ZF5 O;  4KH6 A;  5F1X A;  3R6M A;  3H1V X;  3HM8 A;  1MWM A;  5AZI A;  2D0P A;  3ENH A;  3CET A;  1C0G A;  3EZW A;  4FO0 A;  2A3Z A;  1WOQ A;  4FWR A;  4JKG A;  2NRT A;  4CI6 A;  3QBW A;  1VQP N;  5LJV A;  2CGJ A;  4ISE A;  4H0T B;  3HI0 A;  3J8A A;  4NO7 A;  4CBU A;  4WFN L;  1E4G T;  2P9S B;  3JS6 A;  5JVG L;  4PKI A;  4CD1 A;  5AFU H;  1P8Z A;  2CGK A;  2P9I A;  2QW9 A;  2YJF A;  3LDO A;  4YOW A;  3A5L C;  1S3X A;  2P9N B;  3DXK A;  1SAZ A;  5I9E B;  5KQ8 A;  5JVH L;  5AR0 A;  3M6G A;  5JIC A;  4H0O A;  3TTD A;  3OA9 A;  4BEC A;  4A5A A;  3FE1 A;  2VGM A;  1DGK N;  3VPZ A;  2EWS A;  2H3G X;  2YX6 A;  3CPE A;  5EOY A;  4FPA A;  3VER A;  5GAD P;  2Q2R A;  1BO5 O;  3ULE B;  1KXP A;  1LOT B;  3SAG A;  4XH4 A;  3MN9 A;  4NB4 A;  1KQS M;  1VQ7 N;  1NGH A;  5C0Y A;  5GAE P;  2QWR A;  2I7P A;  4A61 A;  3M1F A;  1HUX A;  3UB5 A;  3I33 A;  3VF4 A;  2IVN A;  2FLO A;  2Q97 A;  1GLE G;  1DKG D;  3GBT A;  5AQZ A;  2ITM A;  3TSP A;  4A2B A;  3PIP L;  2KHO A;  3RSE B;  1Q86 O;  1MWK A;  2YCH A;  2YHX A;  3CCJ N;  3NVM A;  3R1X A;  2A6A A;  3GL1 A;  4BC5 A;  1VAZ A;  4BRP A;  5GAG P;  2YJE A;  1ATS A;  3WXL A;  4CZK A;  3NVK A;  4J8F A;  4BC2 A;  1VQ8 N;  3O9R A;  3K9K A;  1OVY A;  3CF5 L;  3AY9 A;  5AZJ B;  1DT9 A;  3UKU A;  3AGR A;  3M3Z A;  2YHY A;  3VES A;  2A41 A;  4CZI A;  4K41 A;  3ENO A;  5FPD A;  4GV9 A;  1O13 A;  3QML A;  3MWT A;  3MCA B;  2HF3 A;  3MN6 A;  3WXJ A;  3VEN A;  3AAP A;  4A62 A;  5EVZ A;  5GIN A;  3O9Q A;  3LDN A;  4BQZ A;  4JHD A;  1TYQ A;  4BRA A;  3IDH A;  3ZET B;  1X3M A;  1VQL N;  1RFQ A;  4XH1 A;  3G25 A;  2E2P A;  3E1Y A;  3DXM A;  4WF9 L;  4DHY A;  1ESV A;  1K8K B;  3EKS A;  4Y0W A;  1M90 O;  2P9U A;  2D1K A;  3DWL A;  2GEL A;  5AQN A;  1E4F T;  4WQ5 C;  3VEY A;  5H1S Q;  4CZE A;  3CC7 N;  4IO8 A;  3KVG A;  3MN7 A;  3VEW A;  4MO4 A;  5JLH A;  4Z94 A;  3CER A;  4YOR A;  2JWL A;  4BRL A;  1S22 A;  4K25 A;  1Q18 A;  3SAF A;  1K8A O;  3D2E A;  5B8H A;  2W00 A;  4IXC A;  2GEM A;  2FF3 B;  4YOY A;  5BR9 A;  3QFP A;  2A42 A;  1TUU A;  4MLE A;  3VEX A;  4FVU A;  2WBN A;  3O80 A;  1HPM A;  4BG8 A;  3ZEU B;  3AAQ A;  3CCV N;  3VMF B;  1KAZ A;  2CH6 A;  2FSN A;  4GY2 B;  4FOI A;  4BRI A;  1MA9 B;  3KK7 A;  4MO5 A;  3FFK B;  5AQF A;  1VQ9 N;  3C6H A;  3ID8 A;  5GIP A;  4FWQ A;  3GOI A;  4B1X B;  1JCE A;  1V4T A;  3AAR A;  5JLF A;  3ATV A;  4RWT A;  3CQY A;  3DXK B;  4BC3 A;  4EHU A;  2NRR A;  3G71 N;  4DCH A;  4BE7 B;  4JD2 B;  4BRQ A;  1U6Z A;  4H5N A;  3VTH A;  1Q7Y O;  2QEX N;  3VGK A;  1RDU A;  4JEP A;  1T6C A;  4OPH A;  4FWN A;  5KQD A;  2BTF A;  3T7Z A;  4BR0 A;  4H03 B;  4IFE A;  2PFU A;  4XJX A;  2AA4 A;  2NRV A;  3FZF A;  3UKR B;  2D4W A;  1BG3 A;  3EL2 A;  3SAH A;  4HTL A;  3WXM B;  2P9L A;  2CGL A;  5F0X A;  4KH4 A;  5AQH A;  3F9M A;  3B8A X;  4OPA A;  4YDU C;  3T69 A;  4B1W B;  2P9P A;  5MLC Q;  3EO3 A;  3CI5 A;  1YJ9 N;  3IUC A;  4O8K A;  1M1K O;  3IFR A;  3O4W A;  3IKM A;  3PIO L;  3L4Q A;  4GV3 A;  4AF1 A;  2ZJQ L;  3BUZ B;  3SMP A;  4F9O A;  3H45 C;  5AQL A;  2VWB A;  1T44 A;  4WFB L;  4MDA A;  5DM7 L;  4CZM A;  3HOT A;  1W2B M;  4EAH D;  3O6W A;  4FWM A;  4BEB A;  5KPZ A;  1BWF O;  3EE8 A;  1BA0 A;  4IEI A;  4WQ4 C;  3JXU A;  4MLH A;  4BR2 A;  4BRH A;  3CCE N;  3G4S N;  5M1O A;  1GLL O;  4GVE A;  3R8E A;  1YI2 N;  4FWL A;  3C7N A;  4BRM A;  4BGB A;  4KH5 A;  3KWI A;  3FGU A;  3HRG A;  5C2F A;  3LM2 A;  3VEZ A;  3D2F B;  3K9J A;  4YOV A;  1BDG A;  3R3L A;  1GLF O;  3CJ9 A;  3OBY A;  2QWO A;  4PKG A;  2J4R A;  3EKU A;  4CBW A;  3WQU A;  1ATN A;  5ADX A;  4BVO A;  1SQK A;  4JKE A;  5AQG A;  1T3V A;  2WUS A;  3WEE A;  1SZ2 A;  3QB0 A;  4C1N K;  4LC9 B;  3O5B A;  1NGF A;  3GG4 A;  3GE1 A;  5C10 A;  1X3N A;  3CCR N;  5C12 A;  5BPM A;  3MX5 A;  2W41 A;  1NMD A;  1X9J A;  2P9K B;  3ATU A;  4K43 A;  2QA4 N;  2HBL A;  3KWG A;  2D0O A;  4YOX A;  3N4Q A;  3FZL A;  1G99 A;  3BF3 A;  4JAX A;  3D2E B;  1QQM A;  1U2V B;  3VGL A;  4PL7 A;  5M1P A;  5CE3 A;  2IVP A;  1P90 A;  5ADX H;  5E26 A;  4U7B A;  2HBK A;  3CQX A;  5BN9 A;  4C23 A;  3BEX A;  4I6M B;  3CJA A;  3OHR A;  2ZJR L;  4B9Q A;  3BF1 A;  4FWP A;  4CD3 A;  3QDK A;  4CZJ A;  1NGI A;  1KC8 O;  2QTD A;  2E2O A;  3C0B A;  4DB3 A;  5AQM A;  1BUP A;  5AQK A;  3D6R A;  4GV6 A;  1NGD A;  3CCQ N;  5LJW A;  4IJN A;  4BRF A;  3O1B A;  1NM1 A;  4JK9 A;  5AQT A;  4PHT X;  3P4I A;  3HOS A;  1XQS C;  4BY9 C;  2HOE A;  2QWM A;  3VF6 A;  1TUY A;  1SS6 A;  2HBJ A;  3E9P A;  4WCE L;  2P9S A;  3CXC M;  4O8U A;  2UYT A;  2NLX A;  1ZBS A;  2GX9 A;  1YJN N;  1HJO A;  2NRZ A;  1NGC A;  3FZK A;  1GLB G;  3SLC A;  4BRE A;  2P9N A;  5BRE A;  1ATR A;  4H5R A;  2Q0R A;  5M1Q A;  3O8M A;  3QFU A;  3CJC A;  4IO9 L;  1VQM N;  3LL3 A;  5KPR A;  2GWK A;  1XUP O;  1Y64 A;  5DM6 L;  4IWV A;  1HX1 A;  2P9P B;  2ASP A;  4JK8 A;  3G6E N;  3MMV A;  3HZ6 A;  3CCM N;  2E8A A;  3ULE A;  5AZI B;  1N8R O;  2AP1 A;  3M5R A;  4BC4 A;  3WXK A;  4JK7 A;  3FZH A;  4R79 A;  1VQO N;  3ZX0 A;  1V4S A;  4JKG B;  1NGJ A;  4JKB A;  3HBT A;  3CHW A;  1K73 O;  3O9T A;  3NMU A;  4QS8 A;  4M7X A;  2E1Y A;  4H5W A;  3P39 A;  3VF2 A;  2YI1 A;  4FWS A;  3RSE A;  2P9I B;  3R9P A;  2QWQ A;  5AQI A;  4BRC A;  2GUP A;  4BVP A;  5AQO A;  3I56 N;  4CJ7 A;  3QBX A;  4CZH A;  2E2Q A;  3AGK A;  3MK6 A;  3U9D A;  3ENB A;  3CCU N;  4L3Q A;  5F2R A;  3WQT A;  2IIR A;  2Q0U A;  3TSQ A;  5AQV A;  5AZJ A;  3I55 N;  3CME N;  2W40 A;  1ZXO A;  1QVG M;  4GNI A;  4JKA A;  3GDQ A;  3F2K A;  4H5V A;  4IJA A;  1NJI O;  2F9T A;  2V51 B;  3SJH A;  1HKG A;  4AM7 A;  4B1Y B;  5ELZ A;  4IZ9 A;  3VEO A;  1HKC A;  2NRH A;  1NBW A;  5FPN A;  4CBX A;  1KD1 O;  4IOA L;  3MDQ A;  4H0X B;  4ILG B;  5CR4 A;  3SMS A;  4CZG A;  2GTD A;  3VGM A;  3ZET A;  3CJ1 A;  3MCP A;  3E9L A;  3UE5 A;  1NGB A;  3J7Z O;  2PBD A;  1K9M O;  2QXL A;  3BP8 A;  4H0P A;  1BOT O;  2HMP A;  1K8K A;  1J6Z A;  1LCU A;  1OKJ A;  1YUW A;  3LM9 A;  5M1N A;  2ZGZ A;  3L4I A;  1D4X A;  5AQJ A;  3VEV A;  4H0V B;  2DPN A;  4E1J A;  2KLA A;  5AQR A;  1YIJ N;  2A40 A;  4A2A A;  4CZL A;  4DQ8 A;  4BGA A;  4PKH A;  2ZGY A;  1JJ2 M;  5BRD A;  4IEE A;  1EO1 A;  1BA1 A;  1YVN A;  2QWN A;  3FLC O;  3UKU B;  3VTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...