4XEIA

Orthorhombic isomorph of bovine arp2/3 complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
415
structure length
400
Chain Sequence
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystals of the Arp2/3 complex in two new space groups with structural information about actin-related protein 2 and potential WASP binding sites.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Actin-related protein 3
total genus 102
structure length 400
sequence length 415
ec nomenclature
pdb deposition date 2014-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 4xeiA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4xeiA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4xeiA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4xeiA04
1XQSC 3ZETA 2HOEA 3GL1A 2GUPA 1CZAN 1DEJA 3VGLA 1YAGA 2IVNA 1D4XA 2IVOA 1XUPO 4A2BA 4ISGA 5LJVA 3L6QA 4NO7A 3C7NA 3VENA 5BRHA 2HF3A 4DB3A 3O08A 2QWNA 1DGKN 4CI6A 1T6DA 1RGIA 4QS9A 2EWSA 4FO0A 5AZJB 2ITMA 3ATUA 4BRIA 2FSNA 3M6GA 4IJNA 4BR4A 5F2RA 3U4LA 1Z05A 5EOYA 1IG8A 2P9SB 3M1FA 2BUPA 4NB4A 3ATVA 1BUPA 1ATNA 2ZGYA 3EO3A 5AQPA 2KHOA 4BR9A 3WQTA 4DCHA 3ZETB 5AQJA 5JICA 3H3NO 1BOTO 1MWKA 5AQIA 3LDQA 2QM1A 4JD2B 4BROA 3B8AX 4BRKA 2P9SA 1QHAA 2F9WA 4AM6A 4BR7A 4BG8A 4BREA 4EHTA 3O80A 2I7NA 4A61A 2P9KB 5B8HA 2A3ZA 2AA4A 4CZFA 3QMLA 3H46O 2QWQA 3IDHA 2P9NA 2ASPA 3DWLA 1C0FA 1HUXA 2Q0RA 3CETA 1BG3A 2CH5A 1E4FT 5KPRA 3VERA 4BQLA 1V4SA 5AQVA 4BC5A 1ZBSA 3O4WA 4K43A 4BRPA 3DXMA 1NGEA 2FSKA 3L4IA 3CJ9A 4CZHA 3AAPA 2IVPA 5BREA 3CI5A 5AQKA 4I6MB 1TYQA 2A5XA 4H0XB 3SLCA 5AQNA 1GLJO 1ZC6A 3GE1A 4B1YB 2OANA 1SQKA 3J8AA 2P9NB 2VCPA 5AQXA 2VWBA 2E2NA 3VF4A 2A42A 1KAZA 4H5WA 3JXUA 3ID8A 3DXKB 3VETA 5EY4A 2PBDA 4BR2A 4B1VA 3LDPA 3CERA 3HTVA 5EVZA 3ENHA 2Q97A 2V7ZA 1QQMA 4H5NA 4RWTA 4IZ9A 5AZJA 1Z6RA 3A5NC 3VGKA 5BN8A 3BEXA 4JHDA 1IJJA 4BVPA 5AR0A 4AM7A 4WQ4A 4FWPA 2CGLA 3U8XA 2HF4A 4EFHA 1JCFA 4BRLA 2UYTA 3DAWA 2GWJA 3HM8A 3ULEA 5KPZA 4FWOA 5AQRA 2QWPA 3EKUA 3FZFA 1R59O 4IWVA 3LM9A 3VEZA 5AZIB 2CGKA 4I6MA 2E1ZA 2F9TA 1NGBA 3GBTA 4M7XA 1MA9B 3VEOA 1KXPA 4BG9A 3BF3A 5LY3A 4BC3A 2E2PA 4MLEA 4YDUC 3D2EB 2P9LB 1YUWA 4HWIA 3FZHA 4BRMA 3R6MA 2YCHA 3BUZB 2DPNA 2CH6A 2FF6A 4L3QA 2ZWHA 1K8KB 1NM1A 5FPNA 1GLCG 4H03B 4H5RA 3R8EA 3U9DA 4BRAA 2P9UA 5KQ8A 4QS8A 3MN9A 1NGDA 3H3OB 5BPMA 3QBXA 2YJEA 3I8BA 3VOVA 2BTFA 3H6EA 3GOIA 4PKHA 3P4IA 4IO8A 1U2VB 1JCGA 2D0OA 3LL3A 4HTLA 5AQLA 3SMSA 3CJBA 3MCPA 2QWOA 1HKGA 1MDUB 2J4RA 4YDUA 2AP1A 4FWKA 3CJ7A 4IJAA 4CJ7A 2NLXA 1NLVA 4H0TB 1NGAA 2E2OA 5E84A 3H1VX 2Q0UA 1GLBG 2P9UB 5BRDA 2NRHA 3UKUB 1KAYA 2IIRA 5I9EB 2V52B 2Q31A 4JHDB 3VEXA 1QQNA 1YVNA 1QZ6A 2E88A 3RSEB 3KZBA 1NWKA 1YXQA 3O5BA 4CZLA 3ZEUB 4BQZA 1G99A 1NGFA 1HLUA 3MN7A 2FXUA 4CZEA 4K25A 3A5MC 3ENOA 4PL8A 3CIPA 3MDQA 2D0PA 3UKRB 1H1VA 1HPMA 4FWQA 4J8FA 3EKSA 4BRQA 3BP8A 1HJOA 3ZX0A 3O8MA 4BC4A 2D1KA 1J6ZA 1S22A 1Y64A 4H0PA 1V4TA 4GNIA 2P9IA 3H1QA 5BRFA 2E2QA 5FPMA 4LC9B 3VEYA 4A2AA 4H5VA 4EAHD 5FPEA 4XEIA 3DJCA 2HMPA 3SMPA 5TKYA 1SAZA 3HBTA 3DXMB 4FWMA 2ASOA 2GELA 5AQZA 3AARA 3HSCA 5LJWA 4PKGA 4FOIA 5JLFA 3S41A 3EL2A 3O1WA 1HX1A 1GLEG 2Q1NA 4FWSA 4B1ZA 3MK6A 1JCEA 4WQ4C 4H0YB 5FPDA 3D7EO 2GTDA 4GY2B 2W41A 4DQ8A 4BGBA 3G25A 5BN9A 2YJFA 3DXKA 2W40A 3QBWA 4QS7A 4KBOA 3VGMA 2V7YA 3FE1A 4FPAA 3SJHA 3O1BA 5AQYA 4WQ5A 4O5FA 1ZXOA 4JAXA 3FZMA 3VEWA 5AQFA 4WQ5C 2GWKA 1P8ZA 3WT0A 4BRFA 1EQYA 1TYQB 4RTFD 3WXKA 1DKGD 3IUCA 3M3ZA 3GDQA 4FSVA 4E1JA 1RDWX 2GEMA 3LM2A 4M7YA 2H3GX 4CZMA 3ZX3A 2QW9A 5AQTA 1T6CA 3FZLA 3ZEUA 3A5LC 3AY9A 5AQMA 3CJ1A 3HI0A 1WOQA 4CZJA 4MO4A 1MWMA 3CQXA 1Q18A 3C7NB 2QXLA 3VEVA 4CBUA 3QICA 4PKIA 2A41A 1NMDA 2YHXA 1K8KA 1NGHA 2FSJA 3W0LA 4FWNA 4BR5A 5AFUH 1SZ2A 4FPBA 3FGUA 1QQOA 3WEEA 2ZGZA 2YHWA 3UE5A 1LOTB 3WXIA 1U2VA 1LCUA 1BU6O 1E4GT 3JS6A 2P9IB 3LDNA 3VESA 3CJCA 2Q36A 4BRNA 1GLFO 3EZWA 2A40A 1HKBA 3I33A 1BDGA 3QDKA 2CGJA 2A6AA 4FWLA 1OKJA 3D2FA 5EX5A 4Z94A 4ISFA 3A0IX 3A8YA 2FLOA 1TUUA 1WUAA 5KQDA 3D2FB 5ADXH 1NBWA 3UB5A 4BC2A 1BA1A 3TU5A 1KAXA 3EN9A 2QWMA 4EIAA 3TPQA 2P9PB 5AQUA 4IXCA 5KPTA 3BF1A 3WUHA 2NZTA 3FFKB 4A62A 1TUYA 2Q2RA 4PL7A 2ASMA 2YHYA 3MN6A 5E26A 4BRCA 5AFUA 4M63C 1U6ZA 2E1YA 4BR0A 5EXWA 4BGAA 4H0VB 3UKUA 4K41A 5AQQA 2P9KA 1RFQA 3W3DA 1GLLO 4CBWA 4CD1A 1ATRA 3GG4A 3F9MA 1ATSA 3FLCO 3QFPA 3KHYA 3ULEB 4CD3A 4B1WB 3MMVA 5AQWA 3WQUA 2I7PA 2E20A 3UKRA 1XC3A 4JD2A 4K42A 3U9ZA 4BRHA 2YI1A 3QFUA 4EHUA 5CE3A 3D2EA 4FL9A 5ADXA 4F9OA 5AQGA 3OHRA 2V51B 3C0BA 3O6WA 5AQOA 3SK3A 3LDLA 4RCHA 3CJAA 4CZGA 3CHWA 3R9PA 2WUSA 3IFRA 4MO5A 4JNEA 5AZIA 4CZIA 2FF3B 3H45C 5F1XA 4ISEA 1X3MA 3QB0A 4MLHA 1GLDG 1X3NA 3WXJA 1C0GA 4Y0WA 1BWFO 3MN5A 4FOEA 3VPZA 2P9LA 3CQYA 4O8KA 3HZ6A 1NGJA 5AQHA 3LDOA 4H5TA 4WYBA 1ESVA 1QZ5A 4B1XB 2QWLA 2VYPA 1X9JA 2E8AA 1NGCA 3RSEA 5JLHA 4JN4A 2P9PA 3AAQA 2D4WA 3IMXA 2QWRA 3VF6A 2PAVA 3FZKA 5F0XA 4H0OA 1T44A 4BRGA 4XH5A 4BVOA 5BPLA 4B1UB 1BA0A 4C23A 4FWRA 5JMVA 3KVGA 4BRDA 1GLAG 1BO5O 2ZF5O 3WXLA 1NGGA 3FR0A 4B9QA 3A5OC 4CBXA 5BR9A 5ELZA 4CZKA 3ZX2A 1HKCA 4XH1A 3L0QA 3VF2A 5BPNA 4XH4A 5AQSA 3WEEB 4DHYA 1NGIA 1S3XA
chains in the Genus database with same CATH superfamily
3ZETA 5EU7A 1I39A 4KPYA 3T3FA 1D4XA 3OYAA 3HSTB 4DTPA 4A2BA 2W6LA 2QKBA 2BANA 2ATQA 3OYMA 3O08A 2QWNA 2Y1IA 3UIQA 3QLHA 3OYGA 1RGIA 4QS9A 2I5JA 4IFEA 2EWSA 4B3TK 3M6GA 4BR4A 3U4LA 3EYZA 1NK9A 1Z05A 2ZQBA 5EOYA 1IG8A 1MU2A 1JJ2M 4M42A 3AO4A 1NJIO 3K0SA 3ZETB 5AQJA 1QE1A 2A1RA 2YX6A 4CEBA 3CQ8A 4DQPA 3DYAA 3Q7CA 3V81A 4JD2B 3B8AX 2P9SA 1S1TA 2F9WA 3V1QA 4IOAL 1KVAA 4EHTA 1KLNA 4OPHA 3SPZA 3J7YP 3O80A 3SBTA 3VQ4A 4N5SA 4FK4A 1JKHA 4DV5K 4CHNA 4CZFA 2B5JA 3QMLA 1RT2A 4JI0K 3K9JA 1C0FA 1JLAA 4FLYA 3SUOA 3H08A 1BG3A 3LP1A 2CH5A 1ZBSA 4HVJA 4CGIA 2RPIA 4K43A 4BRPA 4RG8A 3DXMA 4J2DA 4CZHA 3AAPA 5BREA 1XC9A 2A1SA 3CCLN 3IG1A 1HMVA 4KHYA 1GLJO 1ZC6A 3AVIA 4DTUA 1SQKA 4CJ5A 3DI6A 3S3OA 5JS1A 1ZBLA 4H5WA 4X65K 4AQYK 3VETA 5EY4A 1DTTA 3OS1A 4DTNA 5I42A 4JKEA 2HBJA 3CERA 4JI1K 1IKVA 3QNNA 5BR8K 4BDZA 1P90A 2Q97A 1Q8IA 4BEBA 4QOZB 4B9MA 4H5NA 4IZ9A 4E1NA 5AZJA 1YIJN 1FJGK 3A5NC 4YOUA 3VGKA 1UWBA 3DLEA 4JK9A 5HOOA 5CYMA 3LALA 1SS6A 5KPZA 2GUIA 4FWOA 3EKUA 3TAEA 4LF5K 4CGHA 3CPEA 3OYKA 5GIOA 4CF8A 1NGBA 1XHXA 3HOTA 3BF3A 1HYZA 2RKIA 2HVHA 1YUWA 4CECA 4E7JA 3R6MA 2DPNA 1C0TA 4KTQA 4DV1K 1NM1A 3R8EA 3U9DA 4OO1J 4BRAA 4ICLA 1TAQA 3QBXA 1JLQA 3H6EA 3AVFA 4FXDA 2HNZA 3CC7N 4PKHA 4JI8K 2D0OA 2VG5A 4CJSA 2J4RA 4A5AA 2AP1A 4FWKA 2OCEA 4CJ7A 4DSIA 4FZZA 2JGUA 2E2OA 5C2FA 2Q0UA 3DM2A 3MECA 3NGYA 1A5WA 3ZT0A 2UXBK 1JLGA 2NRHA 4JV5K 2Q31A 4FJHA 4AF1A 3HOSA 1YVNA 1J9AA 2P5GA 3FFIA 1NWKA 3ZEUB 1W9HA 1ASVA 3K5OA 2IOCA 3NDKA 4ZTFA 2FXUA 3KKSA 3HO1A 4J2EA 2IS3A 2GX9A 4WCEL 1CLQA 3MDQA 4KH5A 3UKRB 3M5RA 4MDAA 1NK4A 3HYFA 3QINA 3O8MA 4BC4A 4DFPA 4H0PA 4NYNA 4U7BA 5BRFA 2JWKA 3ENBA 4LC9B 3O3HA 1BI4B 4H5VA 4XEIA 2HMPA 1JLBA 5E41A 1SAZA 4FWMA 3ZT4A 4Z4FA 2KFNA 1OVQA 3J7ZO 5CZ1A 5AQZA 1RT4A 1CZBA 1RCHA 4OX9K 3MEEA 5JLFA 3ZSWA 2UUAK 2YHAA 2AJQA 2VGNA 3KKRA 4WQ4C 4FW1A 5KRSA 5FPDA 3D7EO 4FJLA 2HW3A 3KWGA 4BGBA 4N47A 3HT3A 5BN9A 3DXKA 2XY7A 4QCLA 4IO9L 5KGWA 5FRNA 2V7YA 3FE1A 4G1QA 2O8DB 1BIUA 2HNDA 4CF2A 3VEWA 3WT0A 1U4BA 4F3OA 2OPQA 1DKGD 1T3VA 3OYEA 1VQ9N 4CZMA 3AO2A 4B3OA 3RMAA 1DTQA 5AQTA 4O0IA 2NRRA 3ZEUA 3SV3A 3AY9A 5AQMA 5CYQA 4H8KA 3HI0A 4WFAL 3QO9A 1IKYA 3O9UA 3C6AA 4E19A 1HPZA 4CBUA 2YHXA 1VQ5N 1RT6A 1WBDA 2HMIA 4BR5A 1VQPN 1VSJA 1CXUA 3CCUN 1QQOA 3SYZA 5HRSA 3UE5A 2IGIA 2ZE2A 1RT1A 3IRXA 4DR7K 3S5TA 3I33A 3QDKA 1NK0A 2CGJA 1WSGA 4CEOA 4CJRA 2G8UA 1LW0A 3A0IX 3ZSOA 4DQSA 4FM2A 2RE2A 2O8BA 3TARA 3UB5A 3BGRA 5H1SQ 4BC2A 2RF2A 3TU5A 4Y1CA 2OZSA 5AQUA 3AVLA 2QA4N 3S3NA 4I2PA 1SKRA 4FYDA 3VQPA 4H4MA 1SKSA 4M63C 4DS5A 1BQMA 3HPGA 2X74A 1TGOA 4H0VB 5M1PA 3M8RA 3EEQA 1RFQA 1TKXA 3K57A 3ALYA 1C0MA 3VQDA 4E3SA 3SQ2A 2UU9K 5C24A 4FL9A 2YNGA 4G9ZA 4FJ7A 5AQGA 2KFZA 4JKBA 2VWKA 2NRWA 4B8AB 3SK3A 3AO1A 3LDLA 4CGJA 2KQ2A 3CJAA 1YVUA 2KLAA 1Q7YO 2WC9A 4MO5A 4KHQA 5JVHL 2YNHA 3E01A 3QB0A 1X3NA 1YJWN 2NNWA 4IFVA 3D6RA 2P9LA 1KCFA 4JI3K 3CCRN 1EKEA 2XY8A 4KV8A 4IG0A 3JAMO 1T03A 3QIOA 3OYJA 4FZYA 2ZJPL 2G8KA 5DMRA 2P9PA 4CESA 3IMXA 5MLCQ 3ULDA 3FZKA 3OJSA 5F0XA 4BRGA 4BVOA 4B1UB 4FWRA 3TANA 1ZYQA 1GLAG 5HL7L 5HLFA 4DQRA 2ZF5O 1WSJA 4B9QA 3OYNA 4X62K 3IS9A 5HRRA 4CZKA 4XH4A 5AQSA 3IKMA 1ZBHA 1T05A 1DEJA 2IVNA 1A5VA 2IVOA 1XUPO 2G8VA 4PY5A 4KO0A 3L6QA 3THXA 3OBWA 2HF3A 3ZT1A 3VN5A 1DGKN 4FO0A 5AZJB 3TTCA 3ATUA 2FSNA 5F2RA 4C8LA 4M3WA 2D0BA 3RMCA 3O3FA 4NB4A 3ZSYA 1BUPA 1Z25A 3T19A 4C1NI 2KHOA 4BR9A 4DCHA 3PX0A 1YJNN 4KTWA 4E1MA 5JICA 3H3NO 4KAZA 1BOTO 3AVHA 4E7LA 2IDOA 5AQIA 2JLEA 2VG6A 4FJ5A 1JLEA 1LWCA 4A59A 3U6FA 1Q82O 1HQUA 3CCQN 4BG8A 4I2QA 4BREA 4O0JA 4OKEA 5KI6A 3VQAA 2RHKA 4FJ8A 4LF7K 2A3ZA 5FROA 3BDPA 4DV3K 3QEIA 4CERA 5KPRA 3VERA 3TAFA 4FJKA 3O4WA 1VSFA 1NKEA 4FLWA 1DT9A 1N8RO 1WN7A 3ZCMA 1YTAA 1TL1A 2HBLA 2A5XA 4H0XB 4B3SK 3LPTA 4OKKA 4DV2K 3B6OA 3PV8A 3LP2A 3GE1A 4B1YB 4CJQA 3J8AA 3TSUA 3V9XA 2PYLA 1KAZA 4AHVA 3ZSZA 3DXKB 3CCSN 4BR2A 1VSKA 1RDAA 1Q86O 3LDPA 4FLZA 1VQLN 1BGXT 4FJNA 5EVZA 5CZ2A 3AVKA 3BY5A 2ZM6K 3ZSQA 1KC8O 1QQMA 2KKZA 4RW4A 1C1AA 3CCVN 1S1XA 4LH4A 4FLUA 3OYDA 1L5UA 4FJMA 4E72A 3P5JA 5AR0A 3NGZA 5K14A 4FWPA 5CHIA 4Q0BA 3OY9A 1RNHA 2UYTA 4DSEA 1N36K 3ULEA 1TK5A 1YTUA 1VQ7N 2W00A 4CEEA 2QWPA 5J2MA 2HHVA 3QETA 3SAGA 1TAUA 3O3GA 1SL1A 1KQSM 1S6QA 2O8CA 3O9SA 3GBTA 3L3VA 3HRGA 4M7XA 4M3UA 4Y1DA 1QSLA 4V19S 5HBMA 2Z1GA 1KVBA 1KXPA 3MWTA 4BG9A 5LY3A 5GADP 4JKAA 4MLEA 3SCXA 1B9DA 3HK2A 3FZHA 3KD5E 4BY9C 3KTQA 3SPYA 5C0YA 4ELUA 3CYMA 4DSJA 1W97L 4GVMA 3V9WA 4FJJA 1KD1O 2P9UA 2YKNA 3AVBA 4IEIA 1N6QA 3N4PA 1NU0A 3MN9A 4ZHRA 3ZLJA 5KGXA 3DRPA 3CMAN 3TAMA 4W5QA 5M1FA 3S9HA 4IO8A 1U2VB 3THYB 4HTLA 3SMSA 2VGMA 1BISA 4EZ9A 2G8WA 4BWMA 2QWOA 1OH7A 3TTFA 1YI2N 4YDUA 3CJ7A 4DSLA 3M8QA 1NOYA 2OYQA 5IWAK 3CFPA 1JLFA 2BGGA 1NLVA 2OZMA 4H0TB 2HHSA 1GLBG 2P9UB 5BRDA 1VAZA 3UKUB 1U47A 2GV9A 2V52B 1IG9A 3VEXA 4CF0A 1C1BA 3AVNA 4DFJA 4C8MA 4Q5VA 1YXQA 3VQ9A 4CZLA 2F8SA 1VQ8N 1FKPA 1TKDA 1NGFA 1HLUA 5KTQA 3MN7A 3V1RA 2HHHK 1FW6A 1XWLA 2R7YA 4LSLA 3RRGA 4K25A 4JS5A 3A5MC 4KH6A 4PL8A 3CIPA 3V9UA 1EETA 3SNNA 2E6LA 3BZCA 5GAEP 4IG3A 1HPMA 2Z1JA 4BRQA 1HJOA 1S9EA 4WFNL 1RT5A 1N5YA 1S22A 3LANA 4DTJA 4R5PA 2XRIA 4CHYA 5M1KA 4A2AA 3VEYA 3DOKA 3DJCA 4N56A 4CJ4A 2ZD1A 5TKYA 2KW4A 4J2BA 2X6NA 4KHSA 3T7ZA 1T7PA 4CF9A 1VSLA 4JLHA 2C1IA 3CMEN 5LJWA 5J2PA 5FDLA 3O1WA 3VQQA 1HX1A 3RMBA 3F2KA 2BH1A 4B1ZA 3DOLA 4R79A 5JS2A 4DQ8A 2XY5A 3EZ5A 4KB0A 2E4LA 2PZSA 3D45A 3O1BA 4O4GA 1BIZA 3FZMA 4FLXA 4WQ5C 1P8ZA 4EZ6A 1EQYA 4RTFD 3IUCA 2E5LK 2GEMA 2QW9A 1T6CA 4LFBK 1J53A 3AO3A 3V6DA 2FC0A 3A5LC 2E6MA 5CY4A 3LAMA 2YV0X 5GIPA 1A5XA 4CZJA 3T1HK 3HVRA 3THXB 1Q18A 4ELVA 3VEVA 3QICA 4PKIA 2A41A 1VSHA 3N4QA 1K8KA 3K58A 3SUNA 1NGHA 2FSJA 4JYAK 1VRUA 3ASMA 5AFUH 3NF8A 1KVCA 3CC4N 3VMFB 4FPBA 4YOVA 2VQEK 4WFBL 3KLIA 3G71N 3LDNA 4A57A 2Q36A 5I3UA 3AO5A 1GOCA 2Z1HA 1S1VA 3KJVA 2EX3A 4W5OA 2QEXN 4XIUA 5KQDA 3D2FB 4CF1A 1NBWA 3PX6A 4NXNK 4E7KA 1QSSA 3J81O 4FW2A 1LW2A 1SKWA 3EN9A 1C6VA 4EIAA 3TPQA 4DKWA 2W6KA 4CHQA 4FK0A 2O8EA 5KPTA 3WUHA 2NZTA 1N34K 3FFKB 4KHPK 2Q2RA 4DTMA 4L8RB 2YHYA 4BRCA 3G10A 3MN6A 1HYVA 5AFUA 1EO1A 1U6ZA 4YOXA 2E1YA 3NE6A 4BR0A 3RTVA 3UKUA 3EY1A 4OVLA 2P9KA 3RRHA 1QVFM 4TSXA 4FJGA 4QAGA 3DLGA 4DFKA 3PO5A 3GG4A 3MEGA 4GMJB 3DRSA 3FLCO 4PHTX 3JYTA 3KHYA 4JKFA 5AQWA 1XHZA 3UKRA 1NK6A 1XC3A 3PUFA 3U9ZA 4BRHA 4JKGA 2YI1A 1N33K 3DRRA 3T1AA 1RDUA 2IC3A 3OHRA 1C0UA 3O6WA 3MXIA 2O8BB 3E9PA 4CZGA 4WE1A 2ZJQL 1U48A 4JNEA 4BWJA 4CJKA 4CFAA 4CIFA 3NH1A 1X3MA 3O9TA 4GKKK 3WXJA 4W5TA 4DSKA 4JI7K 4Y0WA 4CEZA 1BWFO 4O8KA 3NFAA 1NGJA 5AQHA 1BL3A 4WYBA 1REVA 5M1OA 1RBTA 4M45A 3M8SA 3IAYA 4BDPA 3F9KA 1NGCA 4CJFA 5JLHA 2BDPA 4OPJA 3KLEA 3ZSVA 3CYGA 2HSTA 1RBUA 2VG7A 3VF6A 4LH5A 4NCAA 4DR3K 5C12A 1X9SA 1BA0A 4LF9K 3NVMA 3E9OA 4CFBA 5JMVA 4BRDA 3TAQA 3NBPA 5GAGP 3U3GA 1KRPA 4CJEA 2VQFK 1HKCA 4XH1A 5BPNA 1JLCA 2HHQA 4BE0A 3SQ0A 4CJ3A 3GL1A 2GUPA 3SAFA 4N76A 3VGLA 4MFBA 5GAHP 2F7TA 4CHOA 5LL6Z 4NO7A 2HBKA 4DB3A 1RT3A 3HVTA 4CEDA 4C8KA 3CG7A 4IJNA 1HR0K 3M1FA 2YHBA 3ATVA 4DTXA 1ATNA 2ZGYA 3EO3A 4IBNA 3WQTA 1D9FA 1RBVA 4KB1A 3C95A 3TTDA 4OLBA 4CGFA 1DLOA 3AA3A 3LDQA 2VWJA 1NK8A 4BRKA 4B3MK 1W2BM 4LFAK 1QHAA 2G8HA 3CM5A 2O8DA 3J80O 4CEAA 3CFOA 3RVCA 4DU4A 4F3TA 5HRNA 4B9NA 4DLEA 4A61A 4HUFA 4JRPA 3PLAA 3H46O 3IDHA 3RR8A 2ASPA 4DV0K 1HUXA 2Q0RA 3CETA 2QTDA 3OYCA 3DLKA 3LP0A 1YHQN 4NCGA 4EP5A 1RTDA 1RTHA 3L4IA 5J2QA 3CJ9A 4E89A 4DUYK 2IVPA 3M8PA 3AA5X 3C6TA 1CXQA 3CI5A 3VA3A 5AQKA 3SLCA 4HCCA 2EHGA 4OKJA 3HL8A 1L3SA 4X64K 2PYJA 3I8DA 5AQXA 2VWBA 2WOMA 3AA2A 2E2NA 3VF4A 4DU1A 2A42A 1VSMA 3JXUA 3OTOK 3ID8A 4DFMA 1QSYA 2B6AA 3NF6A 3MWPA 1W0HA 1I94K 4B1VA 2HBMA 4ELTA 4YFUA 3HTVA 5JVGL 3ENHA 2V7ZA 3C65A 3LWMA 3K5MA 4FM1A 1U04A 3KLFA 1WSEA 3OVNA 4RWTA 2IAJA 1Z6RA 4JI6K 5GINA 1NJYA 1EWQA 1U45A 3WNGA 3BEXA 1IJJA 3THWA 1ZBIA 4AM7A 4WQ4A 2CGLA 3VQ6A 3SAHA 1O1WA 1JCFA 3DAWA 4F4KA 4Z0UA 5HROA 3HM8A 4Z4EA 5A2QO 1SL0A 1L3TA 2Y1JA 4B08A 3FZFA 1QTMA 1IBKK 2HVIA 3VEZA 2F96A 2CGKA 5FLXO 4I6MA 3CFRA 3S3MA 1IO2A 4CHZA 2F9TA 4JS4A 4DS4A 3QEVA 2PY5A 1UOCA 3A2FA 3VEOA 4HCBA 5SZTA 4CHPA 4AHUA 2P9LB 4BRMA 3L2VA 2YCHA 4CJPA 1RILA 2KTQA 4DV6K 2CH6A 4M3RA 1K6YA 4L3QA 1K8KB 1GLCG 4H5RA 3QIPA 1OH5A 4LD0A 1YF5L 4ILJA 3L2QA 5JENA 4DUZK 4KH4A 4QS8A 4CJVA 2C1GA 3MXMA 5BPMA 3PSFA 1IH7A 2NUBA 2LSNA 4Z4HA 3KK2A 1ILYA 3V9SA 2Q3SA 3GOIA 3P4IA 1J54A 1JCGA 3LL3A 3PIPL 1OH6A 1MDUB 1C1CA 1WAJA 4IJAA 4CGDA 1QQCA 4CJLA 4UY8O 5HP1A 1NGAA 5E84A 3H1VX 4IOXA 1B9FA 2YKMA 3KK1A 1KAYA 2IIRA 4BACA 5I9EB 3SV4A 1YT3A 3VTIA 4JHDB 2GBZA 4PQUA 3QEPA 1KFDA 1QQNA 3P83D 5TKWA 1QZ6A 4JK7A 4K8XA 3KZBA 3O5BA 5FRMA 3HJFA 4HTUA 2UUCK 2ITGA 2QK9A 1ASWA 4CK2A 3EE9A 1CZ9A 4W5RA 5C15A 4FJ9A 1D8YA 4CE9A 3ENOA 1LV5A 2D0PA 4IDHA 1H1VA 4FWQA 4J8FA 3EKSA 1RBSA 1RTJA 3ZX0A 2D1KA 1S1UA 1Y64A 3VQEA 4DR6K 1S72N 3SUPA 4GNIA 2P9IA 5T7BA 5FPEA 1WB9A 4CIGA 3HBTA 4DV4K 1WBBA 1RTIA 4PKGA 3NMUA 4FVUA 1TK8A 1M90O 2X78A 1M1KO 4FWSA 4YOTA 3KD1E 4H0YB 2F8TA 2GTDA 4FZXC 3DMJA 2W41A 4YOYA 3AVJA 1VRTA 3G25A 2W40A 3MCAB 1EP4A 5C2DA 3L4QA 2WTUA 4PA1A 3SJHA 4FM0A 4GV9A 4O5FA 5HRPA 2ETJA 4JK8A 1ZXOA 4JAXA 3CCJN 1UA0A 4ILHA 5AQFA 2GWKA 2Z1IA 3OYFA 4J2AA 1S6PA 3WXKA 3M3ZA 1IKXA 3GDQA 1QVGM 3WNEA 3LM2A 4CJTA 4CK1A 4M7YA 3BZKA 5M1QA 3SQ1A 3ZX3A 3I55N 1KSPA 1KTQA 2NRVA 1B92A 1JXEA 4DTSA 4O55A 3LPUA 3SUQA 3SBGA 4YY3K 3AA4A 3DLLL 3TAGA 4RW7A 4WF9L 4CEQA 3CC2N 2QXLA 4AHTA 1NMDA 4M3XA 4GV3A 4HHTA 4KHUA 3W0LA 1XNQK 4W5NA 3FGUA 4A5BA 1NJZA 4KI4A 3VA0A 4LF6K 2ZGZA 1VSDA 1LOTB 3WXIA 1U2VA 5DK5A 3THYA 3JS6A 3VESA 1NNEA 4CCHA 4ID5A 1GLFO 3J7AP 2A40A 3QESA 1BDGA 3L3UA 3E66A 5LMUK 4CEFA 1OKJA 1NK7A 1S1WA 3O4QA 1JXBA 4CVNE 1ZBUA 4ILGB 1Q9YA 2HHIA 1X1PA 2UXDK 2OPPA 3VQCA 4C8OA 3ID6A 1HNXK 2P9PB 4IXCA 3BF1A 1TUYA 1E3MA 2ASMA 1S9GA 1UAXA 5E26A 1UA1A 3C6UA 1FK9A 1VSEA 2HNYA 3AVAA 1QHTA 5EXWA 3NH0A 1FKOA 1GLLO 4CBWA 4ZTJA 4CD1A 2O8FA 3KLGA 4BDYA 3LAKA 1RT7A 3ULEB 4B1WB 3OS2A 3WQUA 2KZZA 1ZBFA 2PFUA 3OYLA 4K42A 3HM9A 4JKCA 3SJJA 4EHUA 3THWB 2FBXA 3D2EA 3LDSA 2V51B 3C0BA 4F2SA 4AHCA 3L8BA 3CHWA 3R9PA 4DG1A 2WUSA 3KWIA 4CZIA 3K59A 3H45C 5F1XA 1IKWA 3G4SN 1GLDG 2HHXA 4DMNA 3VQ5A 4OGEA 4BE1A 1IBLK 3MN5A 3VPZA 3CQYA 4CW7B 2OPSA 3DLHA 4H5TA 4KHNA 1OVYA 1QZ5A 4B1XB 4C8NA 2QWLA 2QXFA 2VYPA 2E8AA 3D0PA 3RSEA 1T8EA 1W7AA 1ASUA 4Z4CA 4CJUA 1K9MO 2D4WA 4FCYA 4MQ3A 5DM6L 3NF7A 2QWRA 5SWMA 3AV9A 4DWIA 4GW6A 4H0OA 2O4IA 4CIEA 1T44A 3ZSRA 4KHWA 5IT9O 4JI5K 1JL1A 3I56N 3G6EN 1K73O 2D0CA 4C23A 4FLTA 1NJWA 1O13A 3KVGA 4DV7K 4F2RA 4M3YA 1KLMA 1EX4A 1NGGA 4M3ZA 4OPAA 2QKKA 4CBXA 3C94A 5BR9A 2DTUA 3ZX2A 3MX5A 3VF2A 1SUQA 3KIOA 5AJ3K 3R1XA 3WEEB 1NGIA 1S3XA 2B4JA 1Y97A 1XQSC 4YHHK 2HOEA 1CZAN 1LWFA 1SV5A 3LP3A 3P38A 1YAGA 4FJIA 4ISGA 1NOZA 1G15A 1TL3A 4DTRA 5LJVA 3C7NA 3VENA 5BRHA 4HUEA 1NKBA 4CI6A 1T6DA 2RN2A 2ITMA 2OA8A 3CPWM 1WNSA 4BRIA 3PIOL 3LWLA 3NGIA 1NJXA 2P9SB 2BUPA 2DFEA 1NKCA 5AQPA 2HB5A 4OLAA 2DFHA 3VTHA 1D9DA 1HQEA 1MWKA 3DLBA 4BROA 2QM1A 4E7HA 4OJRA 4B9UA 1I3AA 4LFCK 1XMOK 3NVKA 4AM6A 4LF4K 3CD6N 4BR7A 1R0AA 2YNIA 3U3YA 1WSFA 5D3GA 4BE2A 2I7NA 5B8HA 2P9KB 2AA4A 4IFYA 2QWQA 2P9NA 4ID1A 4NCBA 4DR2K 5LMNK 3DWLA 4GKJK 3VQBA 1E4FT 4BQLA 1LAVA 1V4SA 5AQVA 4BC5A 4NLCA 4DU3A 2FSKA 1NGEA 4AHRA 3CXCM 1Q81O 4LY7A 3KLHA 4I6MB 3LZJA 4CFDA 4B9VA 1TYQA 5AQNA 3QEWA 3G0ZA 4IEEA 1U49A 2OANA 2P9NB 3ZSXA 2VCPA 3HPHA 3ITHA 3OYIA 3V4IA 2FBVA 1XMQK 3EE8A 2PBDA 2D5RA 3F73A 2OTJN 2NRZA 1WLJA 2P51A 1QS4A 3JSMA 5KRTA 4DLGA 3ZT2A 2JWLA 2G8FA 3WXMB 5BN8A 2QI2A 4E7IA 3T1YK 3OYHA 4JHDA 4BVPA 4OGCA 3OBYA 3U8XA 2HF4A 4EFHA 3VQ8A 3KK7A 4BRLA 1Q9XA 2GWJA 1D5AA 1HNZK 5AQRA 1R59O 2OPRA 3F5TA 4IWVA 4PWDA 3LM9A 5AZIB 1VHXA 2E1ZA 3OS0A 1HNWK 2WBNA 1X9WA 4CJWA 1MA9B 1HNIA 1VK0A 3ZT3A 4BC3A 2E2PA 4YDUC 3CCMN 3D2EB 4HWIA 4Z4GA 3AVCA 3BUZB 1YITN 3AVMA 4JKDA 2OTLN 3P31A 1RBRA 2FF6A 3HP9A 1TV6A 4BE7B 2G8IA 2ZWHA 3PO4A 5FPNA 2UUBK 4H03B 4H4OA 1GOAA 5KQ8A 3NAEA 1NGDA 3H3OB 4JRQA 2YJEA 2WFBA 3I8BA 4EP4A 3VOVA 2BTFA 4F8RA 3O9RA 1TKTA 5AQLA 4YORA 2P5OA 3NH2A 3CJBA 4RW9A 4YOWA 4X66K 3MCPA 4DQIA 1HKGA 4FLVA 1RDBA 4NYFA 3CM6A 1BHLA 2P1JA 2NLXA 3SQ4A 4UQGA 2F4VK 1NK5A 5J2NA 3LZIA 3NF9A 3RWUA 2YNFA 1VQNN 3TSPA 2E88A 1YJ9N 3RSEB 3SZ2A 4AHSA 1GOBA 4FVMA 4BQZA 3TI0A 1G99A 1WSIA 4U67L 1N32K 3HPOA 2DFFA 4CFCA 4CZEA 1HJRA 3K9KA 2D0AA 5M1NA 4KREA 5J1EA 3E9LA 3WNFA 3BP8A 1HYSA 3K2PA 1J6ZA 2ZJRL 4GVEA 4DR4K 3C6HA 2O8FB 1V4TA 3H1QA 4E0DA 2E2QA 5FPMA 2FBYA 1EWRA 4EAHD 3O4NA 2NRXA 4O8UA 3SMPA 4JI4K 3DXMB 2ASOA 1TK0A 3OYBA 2GELA 3E1YA 3AARA 3HSCA 3PY8A 4FOIA 1VQMN 3S41A 4IDKA 3EL2A 1GLEG 4YNQA 2Q1NA 3MK6A 1JCEA 2BE2A 4GY2B 4AILC 1J5EK 4OPKA 3P1GA 3K5NA 1XI1A 2YJFA 3QBWA 2O4GA 4JI2K 4QS7A 4FJXA 4KBOA 3V1OA 3VGMA 4LF8K 4FPAA 3AGKA 5AQYA 4WQ5A 3V9ZA 1ITGA 5CR4A 4IOCL 4BRFA 4B9LA 1RDDA 1TVRA 1TYQB 4AH9A 4NLBA 1L3UA 4FSVA 4E1JA 3L2UA 1RDWX 1BCMA 1LAWA 2H3GX 4I9LA 3FZLA 3AVGA 4O44A 1JL2A 1S5JA 3CJ1A 1K8AO 1WOQA 4KFBA 3PX4A 4MDBA 1SL2A 5DM7L 4MO4A 4B8CA 1VSIA 1MWMA 3CQXA 3DLRA 4JEPA 2NRTA 3C7NB 3R3LA 3MEDA 1Z26A 3T69A 3THVA 4FWNA 2FBTA 4BECA 1SZ2A 4KRFA 4K0KK 3WEEA 4O5BA 1L3VA 1XNRK 2O8CB 2YHWA 2XO7A 1F21A 3SI6A 4KI6A 1LCUA 1BQNA 1BU6O 1E4GT 2P9IB 2X6SA 3CJCA 4BRNA 3EZWA 1BCOA 3O9QA 1HKBA 4DF8A 4IKFA 2A6AA 4FWLA 3D2FA 5EX5A 4Z94A 4ISFA 3NHGA 3A8YA 2FLOA 5C42A 1FXXA 1TUUA 1WUAA 4N41A 5ADXH 4KKOA 4DR5K 3L2WA 4B9TA 1BA1A 1KAXA 2QWMA 2HHUA 3CF5L 2XY6A 2KZMA 4A62A 3PSIA 1VQ4N 2HHWA 4PL7A 1HRHA 4GV6A 1WSHA 4I7FA 4CGGA 1VQON 4BGAA 3OJUA 4K41A 5AQQA 3AGRA 3K5LA 1VQKN 3W3DA 4FK2A 4XJXA 1ATRA 2UXCK 3F9MA 1ATSA 3QFPA 3NCIA 3P39A 1HNVA 4CD3A 1VQ6N 1LWEA 2HHTA 3MMVA 2I7PA 2E20A 3Q7BA 3B6PA 4DQQA 4LSNA 4JD2A 4DF4A 2DY4A 3QFUA 1IV0A 4DSFA 5CE3A 4PUOA 5ADXA 4F9OA 5C10A 1TKZA 3RMDA 3ZYYX 1EXQA 3ISNC 4B9SA 5AQOA 1NMNA 4RCHA 2WONA 3IFRA 3I0SA 5AZIA 3TAPA 4I9QA 2FF3B 3MAQA 4ISEA 4M3TA 1X9MA 3OA9A 4MLHA 1OH8A 2W42A 4DR1K 1KFSA 3MXJA 1C0GA 4FOEA 4DTOA 3MX2A 3HZ6A 3OW2M 4RW6A 3LDOA 2XHBA 4HUGA 1ESVA 3QNOA 1X9JA 3WNHA 4Z4IA 1IBMK 4JN4A 3TWHA 3AAQA 1J5OA 3CCEN 3HP6A 4JKHA 2O8EB 3TSQA 1BI4A 3TR8A 4C1NK 3QERA 2PAVA 4B3RK 3RR7A 4JKGB 4CK3A 4XH5A 1NG9A 5BPLA 4K8ZA 4NXMK 3I0RA 3L2RA 3HXMA 1BO5O 5C25A 4M41A 3WXLA 3FR0A 3A5OC 5ELZA 3VQ7A 3TABA 3L0QA 1RDCA 1WAFA 4DHYA 3KK3A 3QEXA 4KTZA 4RW8A
chains in the Genus database with same CATH topology
1XQSC 3ZETA 2HOEA 3GL1A 2GUPA 1CZAN 3SAFA 1DEJA 3VGLA 3P38A 1YAGA 2IVNA 1D4XA 2IVOA 2F7TA 5GAHP 1XUPO 4A2BA 4ISGA 5LJVA 3L6QA 4NO7A 3C7NA 3OBWA 3VENA 2HF3A 5BRHA 2HBKA 4DB3A 3O08A 2QWNA 1DGKN 4CI6A 1T6DA 1RGIA 4QS9A 4IFEA 4FO0A 2EWSA 5AZJB 2ITMA 3TTCA 3ATUA 3CPWM 4BRIA 2FSNA 3M6GA 4IJNA 4BR4A 5F2RA 3U4LA 3PIOL 1Z05A 5EOYA 1IG8A 2P9SB 1JJ2M 3M1FA 2BUPA 4NB4A 3ATVA 1NJIO 1BUPA 1ATNA 2ZGYA 3EO3A 5AQPA 4C1NI 2KHOA 4BR9A 3WQTA 4DCHA 3ZETB 1YJNN 5AQJA 3VTHA 5JICA 3H3NO 1BOTO 3TTDA 2YX6A 1MWKA 3Q7CA 5AQIA 3LDQA 2QM1A 4JD2B 4BROA 3B8AX 4BRKA 1W2BM 2P9SA 1QHAA 2F9WA 4A59A 3NVKA 4AM6A 1Q82O 3CD6N 4IOAL 3RVCA 4BR7A 3CCQN 4BG8A 4BREA 4EHTA 4OPHA 3O80A 3SBTA 2RHKA 2I7NA 4A61A 2P9KB 5B8HA 2A3ZA 2AA4A 4CZFA 3QMLA 3PLAA 3H46O 2QWQA 3IDHA 2P9NA 3K9JA 2ASPA 3DWLA 1C0FA 1HUXA 2Q0RA 3CETA 1BG3A 2CH5A 1E4FT 2QTDA 5KPRA 3VERA 4BQLA 1V4SA 5AQVA 1YHQN 4BC5A 1ZBSA 4NLCA 3O4WA 4K43A 4BRPA 3DXMA 1NGEA 2FSKA 3L4IA 3CJ9A 4CZHA 1DT9A 3AAPA 2IVPA 3CXCM 1Q81O 1N8RO 5BREA 3CI5A 5AQKA 3CCLN 4I6MB 2HBLA 1TYQA 2A5XA 4H0XB 3SLCA 5AQNA 1GLJO 1ZC6A 3GE1A 4IEEA 4B1YB 2OANA 1SQKA 3J8AA 2P9NB 2VCPA 5AQXA 3TSUA 2VWBA 2E2NA 3VF4A 2A42A 1KAZA 4H5WA 3JXUA 3ID8A 3DXKB 3CCSN 3VETA 3MWPA 3EE8A 5EY4A 2PBDA 4BR2A 4B1VA 1Q86O 2HBMA 3LDPA 2HBJA 2NRZA 3CERA 4JKEA 1VQLN 2OTJN 3HTVA 5EVZA 5JVGL 3ENHA 1P90A 2Q97A 2V7ZA 3C65A 1KC8O 1QQMA 2KKZA 4BEBA 4H5NA 3CCVN 4RWTA 4IZ9A 2JWLA 5AZJA 1Z6RA 1YIJN 5GINA 3A5NC 4YOUA 3WXMB 3VGKA 5BN8A 2QI2A 3BEXA 4JHDA 1IJJA 4BVPA 5AR0A 4AM7A 4WQ4A 3OBYA 2CGLA 4FWPA 4JK9A 3U8XA 3SAHA 2HF4A 4EFHA 5CHIA 1JCFA 3KK7A 4BRLA 5HOOA 2UYTA 3DAWA 2GWJA 3HM8A 1SS6A 3ULEA 5KPZA 2W00A 1VQ7N 4FWOA 5AQRA 2QWPA 3EKUA 3FZFA 1R59O 3F5TA 3CPEA 4IWVA 3LM9A 3VEZA 3SAGA 5AZIB 2CGKA 5GIOA 4I6MA 1KQSM 2E1ZA 2F9TA 1NGBA 2WBNA 3O9SA 3GBTA 3HRGA 4M7XA 3HOTA 1MA9B 3VEOA 1KXPA 3MWTA 3BF3A 4BG9A 4BC3A 5LY3A 4JKAA 5GADP 2E2PA 4MLEA 4YDUC 3CCMN 3D2EB 2P9LB 1YUWA 4HWIA 3FZHA 4BY9C 4BRMA 5C0YA 3R6MA 2YCHA 3BUZB 2DPNA 1YITN 2OTLN 4JKDA 3P31A 2CH6A 2FF6A 4BE7B 4L3QA 2ZWHA 1K8KB 1W97L 1NM1A 5FPNA 1GLCG 4H03B 4H5RA 3R8EA 3U9DA 4OO1J 4BRAA 1KD1O 2P9UA 4IEIA 1YF5L 4ILJA 5KQ8A 4KH4A 4QS8A 3N4PA 2C1GA 3MN9A 1NGDA 3H3OB 5BPMA 3QBXA 3CMAN 2YJEA 2WFBA 3I8BA 3VOVA 2BTFA 3H6EA 3O9RA 5M1FA 1ILYA 3CC7N 3GOIA 4PKHA 3P4IA 4IO8A 1U2VB 1JCGA 2D0OA 3LL3A 4HTLA 4YORA 2VGMA 5AQLA 3SMSA 3PIPL 3CJBA 4YOWA 3MCPA 2QWOA 1HKGA 1MDUB 3TTFA 2J4RA 4A5AA 1YI2N 4YDUA 2AP1A 4FWKA 3CJ7A 4IJAA 4CJ7A 2NLXA 1NLVA 4UY8O 4H0TB 1NGAA 2E2OA 5C2FA 5E84A 3H1VX 2Q0UA 4IOXA 1GLBG 2P9UB 5BRDA 2NRHA 1VAZA 1KAYA 2IIRA 3UKUB 5I9EB 2V52B 3VTIA 2Q31A 4JHDB 3VEXA 1QQNA 1VQNN 4AF1A 3HOSA 1YVNA 5TKWA 1QZ6A 3TSPA 2E88A 4JK7A 3RSEB 1YJ9N 3KZBA 1NWKA 1YXQA 3O5BA 4CZLA 3ZEUB 1VQ8N 4BQZA 1G99A 1NGFA 1HLUA 4U67L 3MN7A 2FXUA 4CZEA 3EE9A 5C15A 4K25A 3A5MC 2GX9A 3ENOA 4KH6A 3CIPA 4PL8A 4WCEL 3K9KA 3MDQA 2D0PA 4KH5A 3UKRB 5M1NA 4IDHA 5GAEP 1H1VA 1HPMA 4FWQA 4J8FA 3E9LA 3EKSA 3M5RA 4MDAA 4BRQA 3BP8A 1HJOA 3ZX0A 3O8MA 4BC4A 2D1KA 4WFNL 1J6ZA 1S22A 1Y64A 2ZJRL 4GVEA 4H0PA 1S72N 4U7BA 3C6HA 1V4TA 4GNIA 2P9IA 3H1QA 5BRFA 5M1KA 2E2QA 2JWKA 3ENBA 4LC9B 5FPMA 4H5VA 3VEYA 4A2AA 4EAHD 2NRXA 4XEIA 4O8UA 3DJCA 2HMPA 5FPEA 3SMPA 5TKYA 1SAZA 3HBTA 3DXMB 4FWMA 2ASOA 3T7ZA 3J7ZO 2GELA 3E1YA 5AQZA 2C1IA 3AARA 3CMEN 3HSCA 5LJWA 4PKGA 3NMUA 4FOIA 1VQMN 5JLFA 3S41A 3EL2A 3O1WA 4FVUA 1M90O 1HX1A 1GLEG 3F2KA 2Q1NA 2VGNA 2BH1A 1M1KO 4FWSA 4YOTA 4B1ZA 3MK6A 1JCEA 4WQ4C 4H0YB 5FPDA 3D7EO 2GTDA 4R79A 4GY2B 3KWGA 2W41A 4DQ8A 4YOYA 4BGBA 3G25A 5BN9A 2YJFA 3DXKA 2W40A 3MCAB 3QBWA 5C2DA 4IO9L 4QS7A 3L4QA 4KBOA 2V7YA 3FE1A 3VGMA 4FPAA 3SJHA 3O1BA 3AGKA 5AQYA 4WQ5A 4GV9A 4O5FA 4JK8A 1ZXOA 4JAXA 3CCJN 3FZMA 3VEWA 4ILHA 4WQ5C 2GWKA 5AQFA 5CR4A 4IOCL 1P8ZA 3WT0A 4BRFA 1EQYA 1TYQB 4RTFD 3WXKA 1DKGD 3IUCA 3M3ZA 1T3VA 4NLBA 3GDQA 4FSVA 4E1JA 1RDWX 1QVGM 1VQ9N 2GEMA 3LM2A 4M7YA 2H3GX 4CZMA 5M1QA 3ZX3A 2QW9A 5AQTA 3I55N 1T6CA 2NRRA 3FZLA 3ZEUA 2NRVA 3A5LC 3AY9A 5AQMA 5GIPA 3CJ1A 1K8AO 3SBGA 1WOQA 3HI0A 4WFAL 3DLLL 4MDBA 4CZJA 4MO4A 5DM7L 4WF9L 1MWMA 3CQXA 3O9UA 4JEPA 3C7NB 1Q18A 2NRTA 2QXLA 3R3LA 3CC2N 3VEVA 3C6AA 4CBUA 3QICA 4PKIA 2A41A 1NMDA 2YHXA 1K8KA 3N4QA 4GV3A 1VQ5N 1NGHA 2FSJA 3T69A 3W0LA 4FWNA 4BR5A 4BECA 5AFUH 1VQPN 3CC4N 3VMFB 1SZ2A 4FPBA 3FGUA 4A5BA 4YOVA 3CCUN 1QQOA 3WEEA 2ZGZA 4WFBL 2YHWA 3UE5A 1LOTB 3WXIA 3G71N 1U2VA 1LCUA 1BU6O 1E4GT 3JS6A 2P9IB 3LDNA 3VESA 3CJCA 4A57A 2Q36A 4BRNA 1GLFO 3EZWA 2A40A 3O9QA 1HKBA 3I33A 1BDGA 3QDKA 3E66A 2CGJA 2A6AA 4FWLA 1OKJA 3D2FA 5EX5A 4Z94A 4ISFA 3A0IX 3A8YA 2FLOA 2QEXN 4ILGB 1TUUA 1WUAA 2RE2A 3D2FB 5KQDA 5ADXH 1NBWA 3UB5A 3ID6A 5H1SQ 4BC2A 1BA1A 3TU5A 1KAXA 3EN9A 2QWMA 4EIAA 3TPQA 4DKWA 2P9PB 5AQUA 4IXCA 5KPTA 3BF1A 2QA4N 3WUHA 2NZTA 3CF5L 3FFKB 4A62A 1TUYA 2Q2RA 1VQ4N 4PL7A 2ASMA 4GV6A 2YHYA 3MN6A 5E26A 4BRCA 5AFUA 1EO1A 4M63C 1U6ZA 4YOXA 2E1YA 4BR0A 5EXWA 4BGAA 4H0VB 3UKUA 1VQON 5M1PA 4K41A 5AQQA 2P9KA 3AGRA 1QVFM 1RFQA 3W3DA 1GLLO 4CBWA 1VQKN 4CD1A 4XJXA 1ATRA 3GG4A 3F9MA 1ATSA 3FLCO 3QFPA 4PHTX 3KHYA 3P39A 3ULEB 4JKFA 4CD3A 1VQ6N 4B1WB 3MMVA 5AQWA 3WQUA 2I7PA 2E20A 3UKRA 3Q7BA 2PFUA 1XC3A 4JD2A 4K42A 3U9ZA 4BRHA 4JKGA 4JKCA 2YI1A 3QFUA 4EHUA 5CE3A 3D2EA 4FL9A 5ADXA 4F9OA 5C10A 1RDUA 3ZYYX 4G9ZA 5AQGA 3OHRA 4JKBA 2V51B 2NRWA 3C0BA 3O6WA 5AQOA 3SK3A 3LDLA 3E9PA 4RCHA 3CJAA 4CZGA 3CHWA 3R9PA 2ZJQL 2WUSA 2KLAA 3IFRA 2WC9A 4MO5A 1Q7YO 4JNEA 3KWIA 5AZIA 4CZIA 5JVHL 2FF3B 3H45C 5F1XA 4ISEA 1X3MA 3G4SN 3OA9A 3QB0A 4MLHA 1GLDG 1X3NA 3O9TA 1YJWN 2NNWA 3WXJA 1C0GA 4Y0WA 1BWFO 3MN5A 4FOEA 3D6RA 2P9LA 3VPZA 3CQYA 3MX2A 3HZ6A 4O8KA 1NGJA 5AQHA 3OW2M 3LDOA 4H5TA 3CCRN 4WYBA 1OVYA 1ESVA 1QZ5A 4B1XB 2QWLA 5M1OA 2VYPA 1X9JA 2ZJPL 2E8AA 1NGCA 3RSEA 5JLHA 4JN4A 2P9PA 3AAQA 1K9MO 2D4WA 3CCEN 4JKHA 2HSTA 3IMXA 3TSQA 5DM6L 2QWRA 3VF6A 4C1NK 5MLCQ 2PAVA 3FZKA 5F0XA 4H0OA 1T44A 4BRGA 4JKGB 5C12A 4XH5A 4BVOA 5BPLA 4B1UB 3I56N 3G6EN 1BA0A 1K73O 4C23A 3NVMA 1O13A 3E9OA 4FWRA 5JMVA 3KVGA 4BRDA 5GAGP 1GLAG 5HL7L 1BO5O 2ZF5O 3WXLA 1NGGA 3FR0A 4OPAA 4B9QA 3A5OC 4CBXA 5BR9A 5ELZA 4CZKA 3ZX2A 1HKCA 3MX5A 4XH1A 3L0QA 3VF2A 5BPNA 4XH4A 3R1XA 5AQSA 3WEEB 4DHYA 1NGIA 1S3XA 3IKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XQS C;  3ZET A;  2HOE A;  3GL1 A;  2GUP A;  1CZA N;  1DEJ A;  3VGL A;  1YAG A;  2IVN A;  1D4X A;  2IVO A;  1XUP O;  4A2B A;  4ISG A;  5LJV A;  3L6Q A;  4NO7 A;  3C7N A;  3VEN A;  5BRH A;  2HF3 A;  4DB3 A;  3O08 A;  2QWN A;  1DGK N;  4CI6 A;  1T6D A;  1RGI A;  4QS9 A;  2EWS A;  4FO0 A;  5AZJ B;  2ITM A;  3ATU A;  4BRI A;  2FSN A;  3M6G A;  4IJN A;  4BR4 A;  5F2R A;  3U4L A;  1Z05 A;  5EOY A;  1IG8 A;  2P9S B;  3M1F A;  2BUP A;  4NB4 A;  3ATV A;  1BUP A;  1ATN A;  2ZGY A;  3EO3 A;  5AQP A;  2KHO A;  4BR9 A;  3WQT A;  4DCH A;  3ZET B;  5AQJ A;  5JIC A;  3H3N O;  1BOT O;  1MWK A;  5AQI A;  3LDQ A;  2QM1 A;  4JD2 B;  4BRO A;  3B8A X;  4BRK A;  2P9S A;  1QHA A;  2F9W A;  4AM6 A;  4BR7 A;  4BG8 A;  4BRE A;  4EHT A;  3O80 A;  2I7N A;  4A61 A;  2P9K B;  5B8H A;  2A3Z A;  2AA4 A;  4CZF A;  3QML A;  3H46 O;  2QWQ A;  3IDH A;  2P9N A;  2ASP A;  3DWL A;  1C0F A;  1HUX A;  2Q0R A;  3CET A;  1BG3 A;  2CH5 A;  1E4F T;  5KPR A;  3VER A;  4BQL A;  1V4S A;  5AQV A;  4BC5 A;  1ZBS A;  3O4W A;  4K43 A;  4BRP A;  3DXM A;  1NGE A;  2FSK A;  3L4I A;  3CJ9 A;  4CZH A;  3AAP A;  2IVP A;  5BRE A;  3CI5 A;  5AQK A;  4I6M B;  1TYQ A;  2A5X A;  4H0X B;  3SLC A;  5AQN A;  1GLJ O;  1ZC6 A;  3GE1 A;  4B1Y B;  2OAN A;  1SQK A;  3J8A A;  2P9N B;  2VCP A;  5AQX A;  2VWB A;  2E2N A;  3VF4 A;  2A42 A;  1KAZ A;  4H5W A;  3JXU A;  3ID8 A;  3DXK B;  3VET A;  5EY4 A;  2PBD A;  4BR2 A;  4B1V A;  3LDP A;  3CER A;  3HTV A;  5EVZ A;  3ENH A;  2Q97 A;  2V7Z A;  1QQM A;  4H5N A;  4RWT A;  4IZ9 A;  5AZJ A;  1Z6R A;  3A5N C;  3VGK A;  5BN8 A;  3BEX A;  4JHD A;  1IJJ A;  4BVP A;  5AR0 A;  4AM7 A;  4WQ4 A;  4FWP A;  2CGL A;  3U8X A;  2HF4 A;  4EFH A;  1JCF A;  4BRL A;  2UYT A;  3DAW A;  2GWJ A;  3HM8 A;  3ULE A;  5KPZ A;  4FWO A;  5AQR A;  2QWP A;  3EKU A;  3FZF A;  1R59 O;  4IWV A;  3LM9 A;  3VEZ A;  5AZI B;  2CGK A;  4I6M A;  2E1Z A;  2F9T A;  1NGB A;  3GBT A;  4M7X A;  1MA9 B;  3VEO A;  1KXP A;  4BG9 A;  3BF3 A;  5LY3 A;  4BC3 A;  2E2P A;  4MLE A;  4YDU C;  3D2E B;  2P9L B;  1YUW A;  4HWI A;  3FZH A;  4BRM A;  3R6M A;  2YCH A;  3BUZ B;  2DPN A;  2CH6 A;  2FF6 A;  4L3Q A;  2ZWH A;  1K8K B;  1NM1 A;  5FPN A;  1GLC G;  4H03 B;  4H5R A;  3R8E A;  3U9D A;  4BRA A;  2P9U A;  5KQ8 A;  4QS8 A;  3MN9 A;  1NGD A;  3H3O B;  5BPM A;  3QBX A;  2YJE A;  3I8B A;  3VOV A;  2BTF A;  3H6E A;  3GOI A;  4PKH A;  3P4I A;  4IO8 A;  1U2V B;  1JCG A;  2D0O A;  3LL3 A;  4HTL A;  5AQL A;  3SMS A;  3CJB A;  3MCP A;  2QWO A;  1HKG A;  1MDU B;  2J4R A;  4YDU A;  2AP1 A;  4FWK A;  3CJ7 A;  4IJA A;  4CJ7 A;  2NLX A;  1NLV A;  4H0T B;  1NGA A;  2E2O A;  5E84 A;  3H1V X;  2Q0U A;  1GLB G;  2P9U B;  5BRD A;  2NRH A;  3UKU B;  1KAY A;  2IIR A;  5I9E B;  2V52 B;  2Q31 A;  4JHD B;  3VEX A;  1QQN A;  1YVN A;  1QZ6 A;  2E88 A;  3RSE B;  3KZB A;  1NWK A;  1YXQ A;  3O5B A;  4CZL A;  3ZEU B;  4BQZ A;  1G99 A;  1NGF A;  1HLU A;  3MN7 A;  2FXU A;  4CZE A;  4K25 A;  3A5M C;  3ENO A;  4PL8 A;  3CIP A;  3MDQ A;  2D0P A;  3UKR B;  1H1V A;  1HPM A;  4FWQ A;  4J8F A;  3EKS A;  4BRQ A;  3BP8 A;  1HJO A;  3ZX0 A;  3O8M A;  4BC4 A;  2D1K A;  1J6Z A;  1S22 A;  1Y64 A;  4H0P A;  1V4T A;  4GNI A;  2P9I A;  3H1Q A;  5BRF A;  2E2Q A;  5FPM A;  4LC9 B;  3VEY A;  4A2A A;  4H5V A;  4EAH D;  5FPE A;  4XEI A;  3DJC A;  2HMP A;  3SMP A;  5TKY A;  1SAZ A;  3HBT A;  3DXM B;  4FWM A;  2ASO A;  2GEL A;  5AQZ A;  3AAR A;  3HSC A;  5LJW A;  4PKG A;  4FOI A;  5JLF A;  3S41 A;  3EL2 A;  3O1W A;  1HX1 A;  1GLE G;  2Q1N A;  4FWS A;  4B1Z A;  3MK6 A;  1JCE A;  4WQ4 C;  4H0Y B;  5FPD A;  3D7E O;  2GTD A;  4GY2 B;  2W41 A;  4DQ8 A;  4BGB A;  3G25 A;  5BN9 A;  2YJF A;  3DXK A;  2W40 A;  3QBW A;  4QS7 A;  4KBO A;  3VGM A;  2V7Y A;  3FE1 A;  4FPA A;  3SJH A;  3O1B A;  5AQY A;  4WQ5 A;  4O5F A;  1ZXO A;  4JAX A;  3FZM A;  3VEW A;  5AQF A;  4WQ5 C;  2GWK A;  1P8Z A;  3WT0 A;  4BRF A;  1EQY A;  1TYQ B;  4RTF D;  3WXK A;  1DKG D;  3IUC A;  3M3Z A;  3GDQ A;  4FSV A;  4E1J A;  1RDW X;  2GEM A;  3LM2 A;  4M7Y A;  2H3G X;  4CZM A;  3ZX3 A;  2QW9 A;  5AQT A;  1T6C A;  3FZL A;  3ZEU A;  3A5L C;  3AY9 A;  5AQM A;  3CJ1 A;  3HI0 A;  1WOQ A;  4CZJ A;  4MO4 A;  1MWM A;  3CQX A;  1Q18 A;  3C7N B;  2QXL A;  3VEV A;  4CBU A;  3QIC A;  4PKI A;  2A41 A;  1NMD A;  2YHX A;  1K8K A;  1NGH A;  2FSJ A;  3W0L A;  4FWN A;  4BR5 A;  5AFU H;  1SZ2 A;  4FPB A;  3FGU A;  1QQO A;  3WEE A;  2ZGZ A;  2YHW A;  3UE5 A;  1LOT B;  3WXI A;  1U2V A;  1LCU A;  1BU6 O;  1E4G T;  3JS6 A;  2P9I B;  3LDN A;  3VES A;  3CJC A;  2Q36 A;  4BRN A;  1GLF O;  3EZW A;  2A40 A;  1HKB A;  3I33 A;  1BDG A;  3QDK A;  2CGJ A;  2A6A A;  4FWL A;  1OKJ A;  3D2F A;  5EX5 A;  4Z94 A;  4ISF A;  3A0I X;  3A8Y A;  2FLO A;  1TUU A;  1WUA A;  5KQD A;  3D2F B;  5ADX H;  1NBW A;  3UB5 A;  4BC2 A;  1BA1 A;  3TU5 A;  1KAX A;  3EN9 A;  2QWM A;  4EIA A;  3TPQ A;  2P9P B;  5AQU A;  4IXC A;  5KPT A;  3BF1 A;  3WUH A;  2NZT A;  3FFK B;  4A62 A;  1TUY A;  2Q2R A;  4PL7 A;  2ASM A;  2YHY A;  3MN6 A;  5E26 A;  4BRC A;  5AFU A;  4M63 C;  1U6Z A;  2E1Y A;  4BR0 A;  5EXW A;  4BGA A;  4H0V B;  3UKU A;  4K41 A;  5AQQ A;  2P9K A;  1RFQ A;  3W3D A;  1GLL O;  4CBW A;  4CD1 A;  1ATR A;  3GG4 A;  3F9M A;  1ATS A;  3FLC O;  3QFP A;  3KHY A;  3ULE B;  4CD3 A;  4B1W B;  3MMV A;  5AQW A;  3WQU A;  2I7P A;  2E20 A;  3UKR A;  1XC3 A;  4JD2 A;  4K42 A;  3U9Z A;  4BRH A;  2YI1 A;  3QFU A;  4EHU A;  5CE3 A;  3D2E A;  4FL9 A;  5ADX A;  4F9O A;  5AQG A;  3OHR A;  2V51 B;  3C0B A;  3O6W A;  5AQO A;  3SK3 A;  3LDL A;  4RCH A;  3CJA A;  4CZG A;  3CHW A;  3R9P A;  2WUS A;  3IFR A;  4MO5 A;  4JNE A;  5AZI A;  4CZI A;  2FF3 B;  3H45 C;  5F1X A;  4ISE A;  1X3M A;  3QB0 A;  4MLH A;  1GLD G;  1X3N A;  3WXJ A;  1C0G A;  4Y0W A;  1BWF O;  3MN5 A;  4FOE A;  3VPZ A;  2P9L A;  3CQY A;  4O8K A;  3HZ6 A;  1NGJ A;  5AQH A;  3LDO A;  4H5T A;  4WYB A;  1ESV A;  1QZ5 A;  4B1X B;  2QWL A;  2VYP A;  1X9J A;  2E8A A;  1NGC A;  3RSE A;  5JLH A;  4JN4 A;  2P9P A;  3AAQ A;  2D4W A;  3IMX A;  2QWR A;  3VF6 A;  2PAV A;  3FZK A;  5F0X A;  4H0O A;  1T44 A;  4BRG A;  4XH5 A;  4BVO A;  5BPL A;  4B1U B;  1BA0 A;  4C23 A;  4FWR A;  5JMV A;  3KVG A;  4BRD A;  1GLA G;  1BO5 O;  2ZF5 O;  3WXL A;  1NGG A;  3FR0 A;  4B9Q A;  3A5O C;  4CBX A;  5BR9 A;  5ELZ A;  4CZK A;  3ZX2 A;  1HKC A;  4XH1 A;  3L0Q A;  3VF2 A;  5BPN A;  4XH4 A;  5AQS A;  3WEE B;  4DHY A;  1NGI A;  1S3X A; 
#chains in the Genus database with same CATH topology
 3ZET A;  5EU7 A;  1I39 A;  4KPY A;  3T3F A;  1D4X A;  3OYA A;  3HST B;  4DTP A;  4A2B A;  2W6L A;  2QKB A;  2BAN A;  2ATQ A;  3OYM A;  3O08 A;  2QWN A;  2Y1I A;  3UIQ A;  3QLH A;  3OYG A;  1RGI A;  4QS9 A;  2I5J A;  4IFE A;  2EWS A;  4B3T K;  3M6G A;  4BR4 A;  3U4L A;  3EYZ A;  1NK9 A;  1Z05 A;  2ZQB A;  5EOY A;  1IG8 A;  1MU2 A;  1JJ2 M;  4M42 A;  3AO4 A;  1NJI O;  3K0S A;  3ZET B;  5AQJ A;  1QE1 A;  2A1R A;  2YX6 A;  4CEB A;  3CQ8 A;  4DQP A;  3DYA A;  3Q7C A;  3V81 A;  4JD2 B;  3B8A X;  2P9S A;  1S1T A;  2F9W A;  3V1Q A;  4IOA L;  1KVA A;  4EHT A;  1KLN A;  4OPH A;  3SPZ A;  3J7Y P;  3O80 A;  3SBT A;  3VQ4 A;  4N5S A;  4FK4 A;  1JKH A;  4DV5 K;  4CHN A;  4CZF A;  2B5J A;  3QML A;  1RT2 A;  4JI0 K;  3K9J A;  1C0F A;  1JLA A;  4FLY A;  3SUO A;  3H08 A;  1BG3 A;  3LP1 A;  2CH5 A;  1ZBS A;  4HVJ A;  4CGI A;  2RPI A;  4K43 A;  4BRP A;  4RG8 A;  3DXM A;  4J2D A;  4CZH A;  3AAP A;  5BRE A;  1XC9 A;  2A1S A;  3CCL N;  3IG1 A;  1HMV A;  4KHY A;  1GLJ O;  1ZC6 A;  3AVI A;  4DTU A;  1SQK A;  4CJ5 A;  3DI6 A;  3S3O A;  5JS1 A;  1ZBL A;  4H5W A;  4X65 K;  4AQY K;  3VET A;  5EY4 A;  1DTT A;  3OS1 A;  4DTN A;  5I42 A;  4JKE A;  2HBJ A;  3CER A;  4JI1 K;  1IKV A;  3QNN A;  5BR8 K;  4BDZ A;  1P90 A;  2Q97 A;  1Q8I A;  4BEB A;  4QOZ B;  4B9M A;  4H5N A;  4IZ9 A;  4E1N A;  5AZJ A;  1YIJ N;  1FJG K;  3A5N C;  4YOU A;  3VGK A;  1UWB A;  3DLE A;  4JK9 A;  5HOO A;  5CYM A;  3LAL A;  1SS6 A;  5KPZ A;  2GUI A;  4FWO A;  3EKU A;  3TAE A;  4LF5 K;  4CGH A;  3CPE A;  3OYK A;  5GIO A;  4CF8 A;  1NGB A;  1XHX A;  3HOT A;  3BF3 A;  1HYZ A;  2RKI A;  2HVH A;  1YUW A;  4CEC A;  4E7J A;  3R6M A;  2DPN A;  1C0T A;  4KTQ A;  4DV1 K;  1NM1 A;  3R8E A;  3U9D A;  4OO1 J;  4BRA A;  4ICL A;  1TAQ A;  3QBX A;  1JLQ A;  3H6E A;  3AVF A;  4FXD A;  2HNZ A;  3CC7 N;  4PKH A;  4JI8 K;  2D0O A;  2VG5 A;  4CJS A;  2J4R A;  4A5A A;  2AP1 A;  4FWK A;  2OCE A;  4CJ7 A;  4DSI A;  4FZZ A;  2JGU A;  2E2O A;  5C2F A;  2Q0U A;  3DM2 A;  3MEC A;  3NGY A;  1A5W A;  3ZT0 A;  2UXB K;  1JLG A;  2NRH A;  4JV5 K;  2Q31 A;  4FJH A;  4AF1 A;  3HOS A;  1YVN A;  1J9A A;  2P5G A;  3FFI A;  1NWK A;  3ZEU B;  1W9H A;  1ASV A;  3K5O A;  2IOC A;  3NDK A;  4ZTF A;  2FXU A;  3KKS A;  3HO1 A;  4J2E A;  2IS3 A;  2GX9 A;  4WCE L;  1CLQ A;  3MDQ A;  4KH5 A;  3UKR B;  3M5R A;  4MDA A;  1NK4 A;  3HYF A;  3QIN A;  3O8M A;  4BC4 A;  4DFP A;  4H0P A;  4NYN A;  4U7B A;  5BRF A;  2JWK A;  3ENB A;  4LC9 B;  3O3H A;  1BI4 B;  4H5V A;  4XEI A;  2HMP A;  1JLB A;  5E41 A;  1SAZ A;  4FWM A;  3ZT4 A;  4Z4F A;  2KFN A;  1OVQ A;  3J7Z O;  5CZ1 A;  5AQZ A;  1RT4 A;  1CZB A;  1RCH A;  4OX9 K;  3MEE A;  5JLF A;  3ZSW A;  2UUA K;  2YHA A;  2AJQ A;  2VGN A;  3KKR A;  4WQ4 C;  4FW1 A;  5KRS A;  5FPD A;  3D7E O;  4FJL A;  2HW3 A;  3KWG A;  4BGB A;  4N47 A;  3HT3 A;  5BN9 A;  3DXK A;  2XY7 A;  4QCL A;  4IO9 L;  5KGW A;  5FRN A;  2V7Y A;  3FE1 A;  4G1Q A;  2O8D B;  1BIU A;  2HND A;  4CF2 A;  3VEW A;  3WT0 A;  1U4B A;  4F3O A;  2OPQ A;  1DKG D;  1T3V A;  3OYE A;  1VQ9 N;  4CZM A;  3AO2 A;  4B3O A;  3RMA A;  1DTQ A;  5AQT A;  4O0I A;  2NRR A;  3ZEU A;  3SV3 A;  3AY9 A;  5AQM A;  5CYQ A;  4H8K A;  3HI0 A;  4WFA L;  3QO9 A;  1IKY A;  3O9U A;  3C6A A;  4E19 A;  1HPZ A;  4CBU A;  2YHX A;  1VQ5 N;  1RT6 A;  1WBD A;  2HMI A;  4BR5 A;  1VQP N;  1VSJ A;  1CXU A;  3CCU N;  1QQO A;  3SYZ A;  5HRS A;  3UE5 A;  2IGI A;  2ZE2 A;  1RT1 A;  3IRX A;  4DR7 K;  3S5T A;  3I33 A;  3QDK A;  1NK0 A;  2CGJ A;  1WSG A;  4CEO A;  4CJR A;  2G8U A;  1LW0 A;  3A0I X;  3ZSO A;  4DQS A;  4FM2 A;  2RE2 A;  2O8B A;  3TAR A;  3UB5 A;  3BGR A;  5H1S Q;  4BC2 A;  2RF2 A;  3TU5 A;  4Y1C A;  2OZS A;  5AQU A;  3AVL A;  2QA4 N;  3S3N A;  4I2P A;  1SKR A;  4FYD A;  3VQP A;  4H4M A;  1SKS A;  4M63 C;  4DS5 A;  1BQM A;  3HPG A;  2X74 A;  1TGO A;  4H0V B;  5M1P A;  3M8R A;  3EEQ A;  1RFQ A;  1TKX A;  3K57 A;  3ALY A;  1C0M A;  3VQD A;  4E3S A;  3SQ2 A;  2UU9 K;  5C24 A;  4FL9 A;  2YNG A;  4G9Z A;  4FJ7 A;  5AQG A;  2KFZ A;  4JKB A;  2VWK A;  2NRW A;  4B8A B;  3SK3 A;  3AO1 A;  3LDL A;  4CGJ A;  2KQ2 A;  3CJA A;  1YVU A;  2KLA A;  1Q7Y O;  2WC9 A;  4MO5 A;  4KHQ A;  5JVH L;  2YNH A;  3E01 A;  3QB0 A;  1X3N A;  1YJW N;  2NNW A;  4IFV A;  3D6R A;  2P9L A;  1KCF A;  4JI3 K;  3CCR N;  1EKE A;  2XY8 A;  4KV8 A;  4IG0 A;  3JAM O;  1T03 A;  3QIO A;  3OYJ A;  4FZY A;  2ZJP L;  2G8K A;  5DMR A;  2P9P A;  4CES A;  3IMX A;  5MLC Q;  3ULD A;  3FZK A;  3OJS A;  5F0X A;  4BRG A;  4BVO A;  4B1U B;  4FWR A;  3TAN A;  1ZYQ A;  1GLA G;  5HL7 L;  5HLF A;  4DQR A;  2ZF5 O;  1WSJ A;  4B9Q A;  3OYN A;  4X62 K;  3IS9 A;  5HRR A;  4CZK A;  4XH4 A;  5AQS A;  3IKM A;  1ZBH A;  1T05 A;  1DEJ A;  2IVN A;  1A5V A;  2IVO A;  1XUP O;  2G8V A;  4PY5 A;  4KO0 A;  3L6Q A;  3THX A;  3OBW A;  2HF3 A;  3ZT1 A;  3VN5 A;  1DGK N;  4FO0 A;  5AZJ B;  3TTC A;  3ATU A;  2FSN A;  5F2R A;  4C8L A;  4M3W A;  2D0B A;  3RMC A;  3O3F A;  4NB4 A;  3ZSY A;  1BUP A;  1Z25 A;  3T19 A;  4C1N I;  2KHO A;  4BR9 A;  4DCH A;  3PX0 A;  1YJN N;  4KTW A;  4E1M A;  5JIC A;  3H3N O;  4KAZ A;  1BOT O;  3AVH A;  4E7L A;  2IDO A;  5AQI A;  2JLE A;  2VG6 A;  4FJ5 A;  1JLE A;  1LWC A;  4A59 A;  3U6F A;  1Q82 O;  1HQU A;  3CCQ N;  4BG8 A;  4I2Q A;  4BRE A;  4O0J A;  4OKE A;  5KI6 A;  3VQA A;  2RHK A;  4FJ8 A;  4LF7 K;  2A3Z A;  5FRO A;  3BDP A;  4DV3 K;  3QEI A;  4CER A;  5KPR A;  3VER A;  3TAF A;  4FJK A;  3O4W A;  1VSF A;  1NKE A;  4FLW A;  1DT9 A;  1N8R O;  1WN7 A;  3ZCM A;  1YTA A;  1TL1 A;  2HBL A;  2A5X A;  4H0X B;  4B3S K;  3LPT A;  4OKK A;  4DV2 K;  3B6O A;  3PV8 A;  3LP2 A;  3GE1 A;  4B1Y B;  4CJQ A;  3J8A A;  3TSU A;  3V9X A;  2PYL A;  1KAZ A;  4AHV A;  3ZSZ A;  3DXK B;  3CCS N;  4BR2 A;  1VSK A;  1RDA A;  1Q86 O;  3LDP A;  4FLZ A;  1VQL N;  1BGX T;  4FJN A;  5EVZ A;  5CZ2 A;  3AVK A;  3BY5 A;  2ZM6 K;  3ZSQ A;  1KC8 O;  1QQM A;  2KKZ A;  4RW4 A;  1C1A A;  3CCV N;  1S1X A;  4LH4 A;  4FLU A;  3OYD A;  1L5U A;  4FJM A;  4E72 A;  3P5J A;  5AR0 A;  3NGZ A;  5K14 A;  4FWP A;  5CHI A;  4Q0B A;  3OY9 A;  1RNH A;  2UYT A;  4DSE A;  1N36 K;  3ULE A;  1TK5 A;  1YTU A;  1VQ7 N;  2W00 A;  4CEE A;  2QWP A;  5J2M A;  2HHV A;  3QET A;  3SAG A;  1TAU A;  3O3G A;  1SL1 A;  1KQS M;  1S6Q A;  2O8C A;  3O9S A;  3GBT A;  3L3V A;  3HRG A;  4M7X A;  4M3U A;  4Y1D A;  1QSL A;  4V19 S;  5HBM A;  2Z1G A;  1KVB A;  1KXP A;  3MWT A;  4BG9 A;  5LY3 A;  5GAD P;  4JKA A;  4MLE A;  3SCX A;  1B9D A;  3HK2 A;  3FZH A;  3KD5 E;  4BY9 C;  3KTQ A;  3SPY A;  5C0Y A;  4ELU A;  3CYM A;  4DSJ A;  1W97 L;  4GVM A;  3V9W A;  4FJJ A;  1KD1 O;  2P9U A;  2YKN A;  3AVB A;  4IEI A;  1N6Q A;  3N4P A;  1NU0 A;  3MN9 A;  4ZHR A;  3ZLJ A;  5KGX A;  3DRP A;  3CMA N;  3TAM A;  4W5Q A;  5M1F A;  3S9H A;  4IO8 A;  1U2V B;  3THY B;  4HTL A;  3SMS A;  2VGM A;  1BIS A;  4EZ9 A;  2G8W A;  4BWM A;  2QWO A;  1OH7 A;  3TTF A;  1YI2 N;  4YDU A;  3CJ7 A;  4DSL A;  3M8Q A;  1NOY A;  2OYQ A;  5IWA K;  3CFP A;  1JLF A;  2BGG A;  1NLV A;  2OZM A;  4H0T B;  2HHS A;  1GLB G;  2P9U B;  5BRD A;  1VAZ A;  3UKU B;  1U47 A;  2GV9 A;  2V52 B;  1IG9 A;  3VEX A;  4CF0 A;  1C1B A;  3AVN A;  4DFJ A;  4C8M A;  4Q5V A;  1YXQ A;  3VQ9 A;  4CZL A;  2F8S A;  1VQ8 N;  1FKP A;  1TKD A;  1NGF A;  1HLU A;  5KTQ A;  3MN7 A;  3V1R A;  2HHH K;  1FW6 A;  1XWL A;  2R7Y A;  4LSL A;  3RRG A;  4K25 A;  4JS5 A;  3A5M C;  4KH6 A;  4PL8 A;  3CIP A;  3V9U A;  1EET A;  3SNN A;  2E6L A;  3BZC A;  5GAE P;  4IG3 A;  1HPM A;  2Z1J A;  4BRQ A;  1HJO A;  1S9E A;  4WFN L;  1RT5 A;  1N5Y A;  1S22 A;  3LAN A;  4DTJ A;  4R5P A;  2XRI A;  4CHY A;  5M1K A;  4A2A A;  3VEY A;  3DOK A;  3DJC A;  4N56 A;  4CJ4 A;  2ZD1 A;  5TKY A;  2KW4 A;  4J2B A;  2X6N A;  4KHS A;  3T7Z A;  1T7P A;  4CF9 A;  1VSL A;  4JLH A;  2C1I A;  3CME N;  5LJW A;  5J2P A;  5FDL A;  3O1W A;  3VQQ A;  1HX1 A;  3RMB A;  3F2K A;  2BH1 A;  4B1Z A;  3DOL A;  4R79 A;  5JS2 A;  4DQ8 A;  2XY5 A;  3EZ5 A;  4KB0 A;  2E4L A;  2PZS A;  3D45 A;  3O1B A;  4O4G A;  1BIZ A;  3FZM A;  4FLX A;  4WQ5 C;  1P8Z A;  4EZ6 A;  1EQY A;  4RTF D;  3IUC A;  2E5L K;  2GEM A;  2QW9 A;  1T6C A;  4LFB K;  1J53 A;  3AO3 A;  3V6D A;  2FC0 A;  3A5L C;  2E6M A;  5CY4 A;  3LAM A;  2YV0 X;  5GIP A;  1A5X A;  4CZJ A;  3T1H K;  3HVR A;  3THX B;  1Q18 A;  4ELV A;  3VEV A;  3QIC A;  4PKI A;  2A41 A;  1VSH A;  3N4Q A;  1K8K A;  3K58 A;  3SUN A;  1NGH A;  2FSJ A;  4JYA K;  1VRU A;  3ASM A;  5AFU H;  3NF8 A;  1KVC A;  3CC4 N;  3VMF B;  4FPB A;  4YOV A;  2VQE K;  4WFB L;  3KLI A;  3G71 N;  3LDN A;  4A57 A;  2Q36 A;  5I3U A;  3AO5 A;  1GOC A;  2Z1H A;  1S1V A;  3KJV A;  2EX3 A;  4W5O A;  2QEX N;  4XIU A;  5KQD A;  3D2F B;  4CF1 A;  1NBW A;  3PX6 A;  4NXN K;  4E7K A;  1QSS A;  3J81 O;  4FW2 A;  1LW2 A;  1SKW A;  3EN9 A;  1C6V A;  4EIA A;  3TPQ A;  4DKW A;  2W6K A;  4CHQ A;  4FK0 A;  2O8E A;  5KPT A;  3WUH A;  2NZT A;  1N34 K;  3FFK B;  4KHP K;  2Q2R A;  4DTM A;  4L8R B;  2YHY A;  4BRC A;  3G10 A;  3MN6 A;  1HYV A;  5AFU A;  1EO1 A;  1U6Z A;  4YOX A;  2E1Y A;  3NE6 A;  4BR0 A;  3RTV A;  3UKU A;  3EY1 A;  4OVL A;  2P9K A;  3RRH A;  1QVF M;  4TSX A;  4FJG A;  4QAG A;  3DLG A;  4DFK A;  3PO5 A;  3GG4 A;  3MEG A;  4GMJ B;  3DRS A;  3FLC O;  4PHT X;  3JYT A;  3KHY A;  4JKF A;  5AQW A;  1XHZ A;  3UKR A;  1NK6 A;  1XC3 A;  3PUF A;  3U9Z A;  4BRH A;  4JKG A;  2YI1 A;  1N33 K;  3DRR A;  3T1A A;  1RDU A;  2IC3 A;  3OHR A;  1C0U A;  3O6W A;  3MXI A;  2O8B B;  3E9P A;  4CZG A;  4WE1 A;  2ZJQ L;  1U48 A;  4JNE A;  4BWJ A;  4CJK A;  4CFA A;  4CIF A;  3NH1 A;  1X3M A;  3O9T A;  4GKK K;  3WXJ A;  4W5T A;  4DSK A;  4JI7 K;  4Y0W A;  4CEZ A;  1BWF O;  4O8K A;  3NFA A;  1NGJ A;  5AQH A;  1BL3 A;  4WYB A;  1REV A;  5M1O A;  1RBT A;  4M45 A;  3M8S A;  3IAY A;  4BDP A;  3F9K A;  1NGC A;  4CJF A;  5JLH A;  2BDP A;  4OPJ A;  3KLE A;  3ZSV A;  3CYG A;  2HST A;  1RBU A;  2VG7 A;  3VF6 A;  4LH5 A;  4NCA A;  4DR3 K;  5C12 A;  1X9S A;  1BA0 A;  4LF9 K;  3NVM A;  3E9O A;  4CFB A;  5JMV A;  4BRD A;  3TAQ A;  3NBP A;  5GAG P;  3U3G A;  1KRP A;  4CJE A;  2VQF K;  1HKC A;  4XH1 A;  5BPN A;  1JLC A;  2HHQ A;  4BE0 A;  3SQ0 A;  4CJ3 A;  3GL1 A;  2GUP A;  3SAF A;  4N76 A;  3VGL A;  4MFB A;  5GAH P;  2F7T A;  4CHO A;  5LL6 Z;  4NO7 A;  2HBK A;  4DB3 A;  1RT3 A;  3HVT A;  4CED A;  4C8K A;  3CG7 A;  4IJN A;  1HR0 K;  3M1F A;  2YHB A;  3ATV A;  4DTX A;  1ATN A;  2ZGY A;  3EO3 A;  4IBN A;  3WQT A;  1D9F A;  1RBV A;  4KB1 A;  3C95 A;  3TTD A;  4OLB A;  4CGF A;  1DLO A;  3AA3 A;  3LDQ A;  2VWJ A;  1NK8 A;  4BRK A;  4B3M K;  1W2B M;  4LFA K;  1QHA A;  2G8H A;  3CM5 A;  2O8D A;  3J80 O;  4CEA A;  3CFO A;  3RVC A;  4DU4 A;  4F3T A;  5HRN A;  4B9N A;  4DLE A;  4A61 A;  4HUF A;  4JRP A;  3PLA A;  3H46 O;  3IDH A;  3RR8 A;  2ASP A;  4DV0 K;  1HUX A;  2Q0R A;  3CET A;  2QTD A;  3OYC A;  3DLK A;  3LP0 A;  1YHQ N;  4NCG A;  4EP5 A;  1RTD A;  1RTH A;  3L4I A;  5J2Q A;  3CJ9 A;  4E89 A;  4DUY K;  2IVP A;  3M8P A;  3AA5 X;  3C6T A;  1CXQ A;  3CI5 A;  3VA3 A;  5AQK A;  3SLC A;  4HCC A;  2EHG A;  4OKJ A;  3HL8 A;  1L3S A;  4X64 K;  2PYJ A;  3I8D A;  5AQX A;  2VWB A;  2WOM A;  3AA2 A;  2E2N A;  3VF4 A;  4DU1 A;  2A42 A;  1VSM A;  3JXU A;  3OTO K;  3ID8 A;  4DFM A;  1QSY A;  2B6A A;  3NF6 A;  3MWP A;  1W0H A;  1I94 K;  4B1V A;  2HBM A;  4ELT A;  4YFU A;  3HTV A;  5JVG L;  3ENH A;  2V7Z A;  3C65 A;  3LWM A;  3K5M A;  4FM1 A;  1U04 A;  3KLF A;  1WSE A;  3OVN A;  4RWT A;  2IAJ A;  1Z6R A;  4JI6 K;  5GIN A;  1NJY A;  1EWQ A;  1U45 A;  3WNG A;  3BEX A;  1IJJ A;  3THW A;  1ZBI A;  4AM7 A;  4WQ4 A;  2CGL A;  3VQ6 A;  3SAH A;  1O1W A;  1JCF A;  3DAW A;  4F4K A;  4Z0U A;  5HRO A;  3HM8 A;  4Z4E A;  5A2Q O;  1SL0 A;  1L3T A;  2Y1J A;  4B08 A;  3FZF A;  1QTM A;  1IBK K;  2HVI A;  3VEZ A;  2F96 A;  2CGK A;  5FLX O;  4I6M A;  3CFR A;  3S3M A;  1IO2 A;  4CHZ A;  2F9T A;  4JS4 A;  4DS4 A;  3QEV A;  2PY5 A;  1UOC A;  3A2F A;  3VEO A;  4HCB A;  5SZT A;  4CHP A;  4AHU A;  2P9L B;  4BRM A;  3L2V A;  2YCH A;  4CJP A;  1RIL A;  2KTQ A;  4DV6 K;  2CH6 A;  4M3R A;  1K6Y A;  4L3Q A;  1K8K B;  1GLC G;  4H5R A;  3QIP A;  1OH5 A;  4LD0 A;  1YF5 L;  4ILJ A;  3L2Q A;  5JEN A;  4DUZ K;  4KH4 A;  4QS8 A;  4CJV A;  2C1G A;  3MXM A;  5BPM A;  3PSF A;  1IH7 A;  2NUB A;  2LSN A;  4Z4H A;  3KK2 A;  1ILY A;  3V9S A;  2Q3S A;  3GOI A;  3P4I A;  1J54 A;  1JCG A;  3LL3 A;  3PIP L;  1OH6 A;  1MDU B;  1C1C A;  1WAJ A;  4IJA A;  4CGD A;  1QQC A;  4CJL A;  4UY8 O;  5HP1 A;  1NGA A;  5E84 A;  3H1V X;  4IOX A;  1B9F A;  2YKM A;  3KK1 A;  1KAY A;  2IIR A;  4BAC A;  5I9E B;  3SV4 A;  1YT3 A;  3VTI A;  4JHD B;  2GBZ A;  4PQU A;  3QEP A;  1KFD A;  1QQN A;  3P83 D;  5TKW A;  1QZ6 A;  4JK7 A;  4K8X A;  3KZB A;  3O5B A;  5FRM A;  3HJF A;  4HTU A;  2UUC K;  2ITG A;  2QK9 A;  1ASW A;  4CK2 A;  3EE9 A;  1CZ9 A;  4W5R A;  5C15 A;  4FJ9 A;  1D8Y A;  4CE9 A;  3ENO A;  1LV5 A;  2D0P A;  4IDH A;  1H1V A;  4FWQ A;  4J8F A;  3EKS A;  1RBS A;  1RTJ A;  3ZX0 A;  2D1K A;  1S1U A;  1Y64 A;  3VQE A;  4DR6 K;  1S72 N;  3SUP A;  4GNI A;  2P9I A;  5T7B A;  5FPE A;  1WB9 A;  4CIG A;  3HBT A;  4DV4 K;  1WBB A;  1RTI A;  4PKG A;  3NMU A;  4FVU A;  1TK8 A;  1M90 O;  2X78 A;  1M1K O;  4FWS A;  4YOT A;  3KD1 E;  4H0Y B;  2F8T A;  2GTD A;  4FZX C;  3DMJ A;  2W41 A;  4YOY A;  3AVJ A;  1VRT A;  3G25 A;  2W40 A;  3MCA B;  1EP4 A;  5C2D A;  3L4Q A;  2WTU A;  4PA1 A;  3SJH A;  4FM0 A;  4GV9 A;  4O5F A;  5HRP A;  2ETJ A;  4JK8 A;  1ZXO A;  4JAX A;  3CCJ N;  1UA0 A;  4ILH A;  5AQF A;  2GWK A;  2Z1I A;  3OYF A;  4J2A A;  1S6P A;  3WXK A;  3M3Z A;  1IKX A;  3GDQ A;  1QVG M;  3WNE A;  3LM2 A;  4CJT A;  4CK1 A;  4M7Y A;  3BZK A;  5M1Q A;  3SQ1 A;  3ZX3 A;  3I55 N;  1KSP A;  1KTQ A;  2NRV A;  1B92 A;  1JXE A;  4DTS A;  4O55 A;  3LPU A;  3SUQ A;  3SBG A;  4YY3 K;  3AA4 A;  3DLL L;  3TAG A;  4RW7 A;  4WF9 L;  4CEQ A;  3CC2 N;  2QXL A;  4AHT A;  1NMD A;  4M3X A;  4GV3 A;  4HHT A;  4KHU A;  3W0L A;  1XNQ K;  4W5N A;  3FGU A;  4A5B A;  1NJZ A;  4KI4 A;  3VA0 A;  4LF6 K;  2ZGZ A;  1VSD A;  1LOT B;  3WXI A;  1U2V A;  5DK5 A;  3THY A;  3JS6 A;  3VES A;  1NNE A;  4CCH A;  4ID5 A;  1GLF O;  3J7A P;  2A40 A;  3QES A;  1BDG A;  3L3U A;  3E66 A;  5LMU K;  4CEF A;  1OKJ A;  1NK7 A;  1S1W A;  3O4Q A;  1JXB A;  4CVN E;  1ZBU A;  4ILG B;  1Q9Y A;  2HHI A;  1X1P A;  2UXD K;  2OPP A;  3VQC A;  4C8O A;  3ID6 A;  1HNX K;  2P9P B;  4IXC A;  3BF1 A;  1TUY A;  1E3M A;  2ASM A;  1S9G A;  1UAX A;  5E26 A;  1UA1 A;  3C6U A;  1FK9 A;  1VSE A;  2HNY A;  3AVA A;  1QHT A;  5EXW A;  3NH0 A;  1FKO A;  1GLL O;  4CBW A;  4ZTJ A;  4CD1 A;  2O8F A;  3KLG A;  4BDY A;  3LAK A;  1RT7 A;  3ULE B;  4B1W B;  3OS2 A;  3WQU A;  2KZZ A;  1ZBF A;  2PFU A;  3OYL A;  4K42 A;  3HM9 A;  4JKC A;  3SJJ A;  4EHU A;  3THW B;  2FBX A;  3D2E A;  3LDS A;  2V51 B;  3C0B A;  4F2S A;  4AHC A;  3L8B A;  3CHW A;  3R9P A;  4DG1 A;  2WUS A;  3KWI A;  4CZI A;  3K59 A;  3H45 C;  5F1X A;  1IKW A;  3G4S N;  1GLD G;  2HHX A;  4DMN A;  3VQ5 A;  4OGE A;  4BE1 A;  1IBL K;  3MN5 A;  3VPZ A;  3CQY A;  4CW7 B;  2OPS A;  3DLH A;  4H5T A;  4KHN A;  1OVY A;  1QZ5 A;  4B1X B;  4C8N A;  2QWL A;  2QXF A;  2VYP A;  2E8A A;  3D0P A;  3RSE A;  1T8E A;  1W7A A;  1ASU A;  4Z4C A;  4CJU A;  1K9M O;  2D4W A;  4FCY A;  4MQ3 A;  5DM6 L;  3NF7 A;  2QWR A;  5SWM A;  3AV9 A;  4DWI A;  4GW6 A;  4H0O A;  2O4I A;  4CIE A;  1T44 A;  3ZSR A;  4KHW A;  5IT9 O;  4JI5 K;  1JL1 A;  3I56 N;  3G6E N;  1K73 O;  2D0C A;  4C23 A;  4FLT A;  1NJW A;  1O13 A;  3KVG A;  4DV7 K;  4F2R A;  4M3Y A;  1KLM A;  1EX4 A;  1NGG A;  4M3Z A;  4OPA A;  2QKK A;  4CBX A;  3C94 A;  5BR9 A;  2DTU A;  3ZX2 A;  3MX5 A;  3VF2 A;  1SUQ A;  3KIO A;  5AJ3 K;  3R1X A;  3WEE B;  1NGI A;  1S3X A;  2B4J A;  1Y97 A;  1XQS C;  4YHH K;  2HOE A;  1CZA N;  1LWF A;  1SV5 A;  3LP3 A;  3P38 A;  1YAG A;  4FJI A;  4ISG A;  1NOZ A;  1G15 A;  1TL3 A;  4DTR A;  5LJV A;  3C7N A;  3VEN A;  5BRH A;  4HUE A;  1NKB A;  4CI6 A;  1T6D A;  2RN2 A;  2ITM A;  2OA8 A;  3CPW M;  1WNS A;  4BRI A;  3PIO L;  3LWL A;  3NGI A;  1NJX A;  2P9S B;  2BUP A;  2DFE A;  1NKC A;  5AQP A;  2HB5 A;  4OLA A;  2DFH A;  3VTH A;  1D9D A;  1HQE A;  1MWK A;  3DLB A;  4BRO A;  2QM1 A;  4E7H A;  4OJR A;  4B9U A;  1I3A A;  4LFC K;  1XMO K;  3NVK A;  4AM6 A;  4LF4 K;  3CD6 N;  4BR7 A;  1R0A A;  2YNI A;  3U3Y A;  1WSF A;  5D3G A;  4BE2 A;  2I7N A;  5B8H A;  2P9K B;  2AA4 A;  4IFY A;  2QWQ A;  2P9N A;  4ID1 A;  4NCB A;  4DR2 K;  5LMN K;  3DWL A;  4GKJ K;  3VQB A;  1E4F T;  4BQL A;  1LAV A;  1V4S A;  5AQV A;  4BC5 A;  4NLC A;  4DU3 A;  2FSK A;  1NGE A;  4AHR A;  3CXC M;  1Q81 O;  4LY7 A;  3KLH A;  4I6M B;  3LZJ A;  4CFD A;  4B9V A;  1TYQ A;  5AQN A;  3QEW A;  3G0Z A;  4IEE A;  1U49 A;  2OAN A;  2P9N B;  3ZSX A;  2VCP A;  3HPH A;  3ITH A;  3OYI A;  3V4I A;  2FBV A;  1XMQ K;  3EE8 A;  2PBD A;  2D5R A;  3F73 A;  2OTJ N;  2NRZ A;  1WLJ A;  2P51 A;  1QS4 A;  3JSM A;  5KRT A;  4DLG A;  3ZT2 A;  2JWL A;  2G8F A;  3WXM B;  5BN8 A;  2QI2 A;  4E7I A;  3T1Y K;  3OYH A;  4JHD A;  4BVP A;  4OGC A;  3OBY A;  3U8X A;  2HF4 A;  4EFH A;  3VQ8 A;  3KK7 A;  4BRL A;  1Q9X A;  2GWJ A;  1D5A A;  1HNZ K;  5AQR A;  1R59 O;  2OPR A;  3F5T A;  4IWV A;  4PWD A;  3LM9 A;  5AZI B;  1VHX A;  2E1Z A;  3OS0 A;  1HNW K;  2WBN A;  1X9W A;  4CJW A;  1MA9 B;  1HNI A;  1VK0 A;  3ZT3 A;  4BC3 A;  2E2P A;  4YDU C;  3CCM N;  3D2E B;  4HWI A;  4Z4G A;  3AVC A;  3BUZ B;  1YIT N;  3AVM A;  4JKD A;  2OTL N;  3P31 A;  1RBR A;  2FF6 A;  3HP9 A;  1TV6 A;  4BE7 B;  2G8I A;  2ZWH A;  3PO4 A;  5FPN A;  2UUB K;  4H03 B;  4H4O A;  1GOA A;  5KQ8 A;  3NAE A;  1NGD A;  3H3O B;  4JRQ A;  2YJE A;  2WFB A;  3I8B A;  4EP4 A;  3VOV A;  2BTF A;  4F8R A;  3O9R A;  1TKT A;  5AQL A;  4YOR A;  2P5O A;  3NH2 A;  3CJB A;  4RW9 A;  4YOW A;  4X66 K;  3MCP A;  4DQI A;  1HKG A;  4FLV A;  1RDB A;  4NYF A;  3CM6 A;  1BHL A;  2P1J A;  2NLX A;  3SQ4 A;  4UQG A;  2F4V K;  1NK5 A;  5J2N A;  3LZI A;  3NF9 A;  3RWU A;  2YNF A;  1VQN N;  3TSP A;  2E88 A;  1YJ9 N;  3RSE B;  3SZ2 A;  4AHS A;  1GOB A;  4FVM A;  4BQZ A;  3TI0 A;  1G99 A;  1WSI A;  4U67 L;  1N32 K;  3HPO A;  2DFF A;  4CFC A;  4CZE A;  1HJR A;  3K9K A;  2D0A A;  5M1N A;  4KRE A;  5J1E A;  3E9L A;  3WNF A;  3BP8 A;  1HYS A;  3K2P A;  1J6Z A;  2ZJR L;  4GVE A;  4DR4 K;  3C6H A;  2O8F B;  1V4T A;  3H1Q A;  4E0D A;  2E2Q A;  5FPM A;  2FBY A;  1EWR A;  4EAH D;  3O4N A;  2NRX A;  4O8U A;  3SMP A;  4JI4 K;  3DXM B;  2ASO A;  1TK0 A;  3OYB A;  2GEL A;  3E1Y A;  3AAR A;  3HSC A;  3PY8 A;  4FOI A;  1VQM N;  3S41 A;  4IDK A;  3EL2 A;  1GLE G;  4YNQ A;  2Q1N A;  3MK6 A;  1JCE A;  2BE2 A;  4GY2 B;  4AIL C;  1J5E K;  4OPK A;  3P1G A;  3K5N A;  1XI1 A;  2YJF A;  3QBW A;  2O4G A;  4JI2 K;  4QS7 A;  4FJX A;  4KBO A;  3V1O A;  3VGM A;  4LF8 K;  4FPA A;  3AGK A;  5AQY A;  4WQ5 A;  3V9Z A;  1ITG A;  5CR4 A;  4IOC L;  4BRF A;  4B9L A;  1RDD A;  1TVR A;  1TYQ B;  4AH9 A;  4NLB A;  1L3U A;  4FSV A;  4E1J A;  3L2U A;  1RDW X;  1BCM A;  1LAW A;  2H3G X;  4I9L A;  3FZL A;  3AVG A;  4O44 A;  1JL2 A;  1S5J A;  3CJ1 A;  1K8A O;  1WOQ A;  4KFB A;  3PX4 A;  4MDB A;  1SL2 A;  5DM7 L;  4MO4 A;  4B8C A;  1VSI A;  1MWM A;  3CQX A;  3DLR A;  4JEP A;  2NRT A;  3C7N B;  3R3L A;  3MED A;  1Z26 A;  3T69 A;  3THV A;  4FWN A;  2FBT A;  4BEC A;  1SZ2 A;  4KRF A;  4K0K K;  3WEE A;  4O5B A;  1L3V A;  1XNR K;  2O8C B;  2YHW A;  2XO7 A;  1F21 A;  3SI6 A;  4KI6 A;  1LCU A;  1BQN A;  1BU6 O;  1E4G T;  2P9I B;  2X6S A;  3CJC A;  4BRN A;  3EZW A;  1BCO A;  3O9Q A;  1HKB A;  4DF8 A;  4IKF A;  2A6A A;  4FWL A;  3D2F A;  5EX5 A;  4Z94 A;  4ISF A;  3NHG A;  3A8Y A;  2FLO A;  5C42 A;  1FXX A;  1TUU A;  1WUA A;  4N41 A;  5ADX H;  4KKO A;  4DR5 K;  3L2W A;  4B9T A;  1BA1 A;  1KAX A;  2QWM A;  2HHU A;  3CF5 L;  2XY6 A;  2KZM A;  4A62 A;  3PSI A;  1VQ4 N;  2HHW A;  4PL7 A;  1HRH A;  4GV6 A;  1WSH A;  4I7F A;  4CGG A;  1VQO N;  4BGA A;  3OJU A;  4K41 A;  5AQQ A;  3AGR A;  3K5L A;  1VQK N;  3W3D A;  4FK2 A;  4XJX A;  1ATR A;  2UXC K;  3F9M A;  1ATS A;  3QFP A;  3NCI A;  3P39 A;  1HNV A;  4CD3 A;  1VQ6 N;  1LWE A;  2HHT A;  3MMV A;  2I7P A;  2E20 A;  3Q7B A;  3B6P A;  4DQQ A;  4LSN A;  4JD2 A;  4DF4 A;  2DY4 A;  3QFU A;  1IV0 A;  4DSF A;  5CE3 A;  4PUO A;  5ADX A;  4F9O A;  5C10 A;  1TKZ A;  3RMD A;  3ZYY X;  1EXQ A;  3ISN C;  4B9S A;  5AQO A;  1NMN A;  4RCH A;  2WON A;  3IFR A;  3I0S A;  5AZI A;  3TAP A;  4I9Q A;  2FF3 B;  3MAQ A;  4ISE A;  4M3T A;  1X9M A;  3OA9 A;  4MLH A;  1OH8 A;  2W42 A;  4DR1 K;  1KFS A;  3MXJ A;  1C0G A;  4FOE A;  4DTO A;  3MX2 A;  3HZ6 A;  3OW2 M;  4RW6 A;  3LDO A;  2XHB A;  4HUG A;  1ESV A;  3QNO A;  1X9J A;  3WNH A;  4Z4I A;  1IBM K;  4JN4 A;  3TWH A;  3AAQ A;  1J5O A;  3CCE N;  3HP6 A;  4JKH A;  2O8E B;  3TSQ A;  1BI4 A;  3TR8 A;  4C1N K;  3QER A;  2PAV A;  4B3R K;  3RR7 A;  4JKG B;  4CK3 A;  4XH5 A;  1NG9 A;  5BPL A;  4K8Z A;  4NXM K;  3I0R A;  3L2R A;  3HXM A;  1BO5 O;  5C25 A;  4M41 A;  3WXL A;  3FR0 A;  3A5O C;  5ELZ A;  3VQ7 A;  3TAB A;  3L0Q A;  1RDC A;  1WAF A;  4DHY A;  3KK3 A;  3QEX A;  4KTZ A;  4RW8 A; 
#chains in the Genus database with same CATH homology
 1XQS C;  3ZET A;  2HOE A;  3GL1 A;  2GUP A;  1CZA N;  3SAF A;  1DEJ A;  3VGL A;  3P38 A;  1YAG A;  2IVN A;  1D4X A;  2IVO A;  2F7T A;  5GAH P;  1XUP O;  4A2B A;  4ISG A;  5LJV A;  3L6Q A;  4NO7 A;  3C7N A;  3OBW A;  3VEN A;  2HF3 A;  5BRH A;  2HBK A;  4DB3 A;  3O08 A;  2QWN A;  1DGK N;  4CI6 A;  1T6D A;  1RGI A;  4QS9 A;  4IFE A;  4FO0 A;  2EWS A;  5AZJ B;  2ITM A;  3TTC A;  3ATU A;  3CPW M;  4BRI A;  2FSN A;  3M6G A;  4IJN A;  4BR4 A;  5F2R A;  3U4L A;  3PIO L;  1Z05 A;  5EOY A;  1IG8 A;  2P9S B;  1JJ2 M;  3M1F A;  2BUP A;  4NB4 A;  3ATV A;  1NJI O;  1BUP A;  1ATN A;  2ZGY A;  3EO3 A;  5AQP A;  4C1N I;  2KHO A;  4BR9 A;  3WQT A;  4DCH A;  3ZET B;  1YJN N;  5AQJ A;  3VTH A;  5JIC A;  3H3N O;  1BOT O;  3TTD A;  2YX6 A;  1MWK A;  3Q7C A;  5AQI A;  3LDQ A;  2QM1 A;  4JD2 B;  4BRO A;  3B8A X;  4BRK A;  1W2B M;  2P9S A;  1QHA A;  2F9W A;  4A59 A;  3NVK A;  4AM6 A;  1Q82 O;  3CD6 N;  4IOA L;  3RVC A;  4BR7 A;  3CCQ N;  4BG8 A;  4BRE A;  4EHT A;  4OPH A;  3O80 A;  3SBT A;  2RHK A;  2I7N A;  4A61 A;  2P9K B;  5B8H A;  2A3Z A;  2AA4 A;  4CZF A;  3QML A;  3PLA A;  3H46 O;  2QWQ A;  3IDH A;  2P9N A;  3K9J A;  2ASP A;  3DWL A;  1C0F A;  1HUX A;  2Q0R A;  3CET A;  1BG3 A;  2CH5 A;  1E4F T;  2QTD A;  5KPR A;  3VER A;  4BQL A;  1V4S A;  5AQV A;  1YHQ N;  4BC5 A;  1ZBS A;  4NLC A;  3O4W A;  4K43 A;  4BRP A;  3DXM A;  1NGE A;  2FSK A;  3L4I A;  3CJ9 A;  4CZH A;  1DT9 A;  3AAP A;  2IVP A;  3CXC M;  1Q81 O;  1N8R O;  5BRE A;  3CI5 A;  5AQK A;  3CCL N;  4I6M B;  2HBL A;  1TYQ A;  2A5X A;  4H0X B;  3SLC A;  5AQN A;  1GLJ O;  1ZC6 A;  3GE1 A;  4IEE A;  4B1Y B;  2OAN A;  1SQK A;  3J8A A;  2P9N B;  2VCP A;  5AQX A;  3TSU A;  2VWB A;  2E2N A;  3VF4 A;  2A42 A;  1KAZ A;  4H5W A;  3JXU A;  3ID8 A;  3DXK B;  3CCS N;  3VET A;  3MWP A;  3EE8 A;  5EY4 A;  2PBD A;  4BR2 A;  4B1V A;  1Q86 O;  2HBM A;  3LDP A;  2HBJ A;  2NRZ A;  3CER A;  4JKE A;  1VQL N;  2OTJ N;  3HTV A;  5EVZ A;  5JVG L;  3ENH A;  1P90 A;  2Q97 A;  2V7Z A;  3C65 A;  1KC8 O;  1QQM A;  2KKZ A;  4BEB A;  4H5N A;  3CCV N;  4RWT A;  4IZ9 A;  2JWL A;  5AZJ A;  1Z6R A;  1YIJ N;  5GIN A;  3A5N C;  4YOU A;  3WXM B;  3VGK A;  5BN8 A;  2QI2 A;  3BEX A;  4JHD A;  1IJJ A;  4BVP A;  5AR0 A;  4AM7 A;  4WQ4 A;  3OBY A;  2CGL A;  4FWP A;  4JK9 A;  3U8X A;  3SAH A;  2HF4 A;  4EFH A;  5CHI A;  1JCF A;  3KK7 A;  4BRL A;  5HOO A;  2UYT A;  3DAW A;  2GWJ A;  3HM8 A;  1SS6 A;  3ULE A;  5KPZ A;  2W00 A;  1VQ7 N;  4FWO A;  5AQR A;  2QWP A;  3EKU A;  3FZF A;  1R59 O;  3F5T A;  3CPE A;  4IWV A;  3LM9 A;  3VEZ A;  3SAG A;  5AZI B;  2CGK A;  5GIO A;  4I6M A;  1KQS M;  2E1Z A;  2F9T A;  1NGB A;  2WBN A;  3O9S A;  3GBT A;  3HRG A;  4M7X A;  3HOT A;  1MA9 B;  3VEO A;  1KXP A;  3MWT A;  3BF3 A;  4BG9 A;  4BC3 A;  5LY3 A;  4JKA A;  5GAD P;  2E2P A;  4MLE A;  4YDU C;  3CCM N;  3D2E B;  2P9L B;  1YUW A;  4HWI A;  3FZH A;  4BY9 C;  4BRM A;  5C0Y A;  3R6M A;  2YCH A;  3BUZ B;  2DPN A;  1YIT N;  2OTL N;  4JKD A;  3P31 A;  2CH6 A;  2FF6 A;  4BE7 B;  4L3Q A;  2ZWH A;  1K8K B;  1W97 L;  1NM1 A;  5FPN A;  1GLC G;  4H03 B;  4H5R A;  3R8E A;  3U9D A;  4OO1 J;  4BRA A;  1KD1 O;  2P9U A;  4IEI A;  1YF5 L;  4ILJ A;  5KQ8 A;  4KH4 A;  4QS8 A;  3N4P A;  2C1G A;  3MN9 A;  1NGD A;  3H3O B;  5BPM A;  3QBX A;  3CMA N;  2YJE A;  2WFB A;  3I8B A;  3VOV A;  2BTF A;  3H6E A;  3O9R A;  5M1F A;  1ILY A;  3CC7 N;  3GOI A;  4PKH A;  3P4I A;  4IO8 A;  1U2V B;  1JCG A;  2D0O A;  3LL3 A;  4HTL A;  4YOR A;  2VGM A;  5AQL A;  3SMS A;  3PIP L;  3CJB A;  4YOW A;  3MCP A;  2QWO A;  1HKG A;  1MDU B;  3TTF A;  2J4R A;  4A5A A;  1YI2 N;  4YDU A;  2AP1 A;  4FWK A;  3CJ7 A;  4IJA A;  4CJ7 A;  2NLX A;  1NLV A;  4UY8 O;  4H0T B;  1NGA A;  2E2O A;  5C2F A;  5E84 A;  3H1V X;  2Q0U A;  4IOX A;  1GLB G;  2P9U B;  5BRD A;  2NRH A;  1VAZ A;  1KAY A;  2IIR A;  3UKU B;  5I9E B;  2V52 B;  3VTI A;  2Q31 A;  4JHD B;  3VEX A;  1QQN A;  1VQN N;  4AF1 A;  3HOS A;  1YVN A;  5TKW A;  1QZ6 A;  3TSP A;  2E88 A;  4JK7 A;  3RSE B;  1YJ9 N;  3KZB A;  1NWK A;  1YXQ A;  3O5B A;  4CZL A;  3ZEU B;  1VQ8 N;  4BQZ A;  1G99 A;  1NGF A;  1HLU A;  4U67 L;  3MN7 A;  2FXU A;  4CZE A;  3EE9 A;  5C15 A;  4K25 A;  3A5M C;  2GX9 A;  3ENO A;  4KH6 A;  3CIP A;  4PL8 A;  4WCE L;  3K9K A;  3MDQ A;  2D0P A;  4KH5 A;  3UKR B;  5M1N A;  4IDH A;  5GAE P;  1H1V A;  1HPM A;  4FWQ A;  4J8F A;  3E9L A;  3EKS A;  3M5R A;  4MDA A;  4BRQ A;  3BP8 A;  1HJO A;  3ZX0 A;  3O8M A;  4BC4 A;  2D1K A;  4WFN L;  1J6Z A;  1S22 A;  1Y64 A;  2ZJR L;  4GVE A;  4H0P A;  1S72 N;  4U7B A;  3C6H A;  1V4T A;  4GNI A;  2P9I A;  3H1Q A;  5BRF A;  5M1K A;  2E2Q A;  2JWK A;  3ENB A;  4LC9 B;  5FPM A;  4H5V A;  3VEY A;  4A2A A;  4EAH D;  2NRX A;  4XEI A;  4O8U A;  3DJC A;  2HMP A;  5FPE A;  3SMP A;  5TKY A;  1SAZ A;  3HBT A;  3DXM B;  4FWM A;  2ASO A;  3T7Z A;  3J7Z O;  2GEL A;  3E1Y A;  5AQZ A;  2C1I A;  3AAR A;  3CME N;  3HSC A;  5LJW A;  4PKG A;  3NMU A;  4FOI A;  1VQM N;  5JLF A;  3S41 A;  3EL2 A;  3O1W A;  4FVU A;  1M90 O;  1HX1 A;  1GLE G;  3F2K A;  2Q1N A;  2VGN A;  2BH1 A;  1M1K O;  4FWS A;  4YOT A;  4B1Z A;  3MK6 A;  1JCE A;  4WQ4 C;  4H0Y B;  5FPD A;  3D7E O;  2GTD A;  4R79 A;  4GY2 B;  3KWG A;  2W41 A;  4DQ8 A;  4YOY A;  4BGB A;  3G25 A;  5BN9 A;  2YJF A;  3DXK A;  2W40 A;  3MCA B;  3QBW A;  5C2D A;  4IO9 L;  4QS7 A;  3L4Q A;  4KBO A;  2V7Y A;  3FE1 A;  3VGM A;  4FPA A;  3SJH A;  3O1B A;  3AGK A;  5AQY A;  4WQ5 A;  4GV9 A;  4O5F A;  4JK8 A;  1ZXO A;  4JAX A;  3CCJ N;  3FZM A;  3VEW A;  4ILH A;  4WQ5 C;  2GWK A;  5AQF A;  5CR4 A;  4IOC L;  1P8Z A;  3WT0 A;  4BRF A;  1EQY A;  1TYQ B;  4RTF D;  3WXK A;  1DKG D;  3IUC A;  3M3Z A;  1T3V A;  4NLB A;  3GDQ A;  4FSV A;  4E1J A;  1RDW X;  1QVG M;  1VQ9 N;  2GEM A;  3LM2 A;  4M7Y A;  2H3G X;  4CZM A;  5M1Q A;  3ZX3 A;  2QW9 A;  5AQT A;  3I55 N;  1T6C A;  2NRR A;  3FZL A;  3ZEU A;  2NRV A;  3A5L C;  3AY9 A;  5AQM A;  5GIP A;  3CJ1 A;  1K8A O;  3SBG A;  1WOQ A;  3HI0 A;  4WFA L;  3DLL L;  4MDB A;  4CZJ A;  4MO4 A;  5DM7 L;  4WF9 L;  1MWM A;  3CQX A;  3O9U A;  4JEP A;  3C7N B;  1Q18 A;  2NRT A;  2QXL A;  3R3L A;  3CC2 N;  3VEV A;  3C6A A;  4CBU A;  3QIC A;  4PKI A;  2A41 A;  1NMD A;  2YHX A;  1K8K A;  3N4Q A;  4GV3 A;  1VQ5 N;  1NGH A;  2FSJ A;  3T69 A;  3W0L A;  4FWN A;  4BR5 A;  4BEC A;  5AFU H;  1VQP N;  3CC4 N;  3VMF B;  1SZ2 A;  4FPB A;  3FGU A;  4A5B A;  4YOV A;  3CCU N;  1QQO A;  3WEE A;  2ZGZ A;  4WFB L;  2YHW A;  3UE5 A;  1LOT B;  3WXI A;  3G71 N;  1U2V A;  1LCU A;  1BU6 O;  1E4G T;  3JS6 A;  2P9I B;  3LDN A;  3VES A;  3CJC A;  4A57 A;  2Q36 A;  4BRN A;  1GLF O;  3EZW A;  2A40 A;  3O9Q A;  1HKB A;  3I33 A;  1BDG A;  3QDK A;  3E66 A;  2CGJ A;  2A6A A;  4FWL A;  1OKJ A;  3D2F A;  5EX5 A;  4Z94 A;  4ISF A;  3A0I X;  3A8Y A;  2FLO A;  2QEX N;  4ILG B;  1TUU A;  1WUA A;  2RE2 A;  3D2F B;  5KQD A;  5ADX H;  1NBW A;  3UB5 A;  3ID6 A;  5H1S Q;  4BC2 A;  1BA1 A;  3TU5 A;  1KAX A;  3EN9 A;  2QWM A;  4EIA A;  3TPQ A;  4DKW A;  2P9P B;  5AQU A;  4IXC A;  5KPT A;  3BF1 A;  2QA4 N;  3WUH A;  2NZT A;  3CF5 L;  3FFK B;  4A62 A;  1TUY A;  2Q2R A;  1VQ4 N;  4PL7 A;  2ASM A;  4GV6 A;  2YHY A;  3MN6 A;  5E26 A;  4BRC A;  5AFU A;  1EO1 A;  4M63 C;  1U6Z A;  4YOX A;  2E1Y A;  4BR0 A;  5EXW A;  4BGA A;  4H0V B;  3UKU A;  1VQO N;  5M1P A;  4K41 A;  5AQQ A;  2P9K A;  3AGR A;  1QVF M;  1RFQ A;  3W3D A;  1GLL O;  4CBW A;  1VQK N;  4CD1 A;  4XJX A;  1ATR A;  3GG4 A;  3F9M A;  1ATS A;  3FLC O;  3QFP A;  4PHT X;  3KHY A;  3P39 A;  3ULE B;  4JKF A;  4CD3 A;  1VQ6 N;  4B1W B;  3MMV A;  5AQW A;  3WQU A;  2I7P A;  2E20 A;  3UKR A;  3Q7B A;  2PFU A;  1XC3 A;  4JD2 A;  4K42 A;  3U9Z A;  4BRH A;  4JKG A;  4JKC A;  2YI1 A;  3QFU A;  4EHU A;  5CE3 A;  3D2E A;  4FL9 A;  5ADX A;  4F9O A;  5C10 A;  1RDU A;  3ZYY X;  4G9Z A;  5AQG A;  3OHR A;  4JKB A;  2V51 B;  2NRW A;  3C0B A;  3O6W A;  5AQO A;  3SK3 A;  3LDL A;  3E9P A;  4RCH A;  3CJA A;  4CZG A;  3CHW A;  3R9P A;  2ZJQ L;  2WUS A;  2KLA A;  3IFR A;  2WC9 A;  4MO5 A;  1Q7Y O;  4JNE A;  3KWI A;  5AZI A;  4CZI A;  5JVH L;  2FF3 B;  3H45 C;  5F1X A;  4ISE A;  1X3M A;  3G4S N;  3OA9 A;  3QB0 A;  4MLH A;  1GLD G;  1X3N A;  3O9T A;  1YJW N;  2NNW A;  3WXJ A;  1C0G A;  4Y0W A;  1BWF O;  3MN5 A;  4FOE A;  3D6R A;  2P9L A;  3VPZ A;  3CQY A;  3MX2 A;  3HZ6 A;  4O8K A;  1NGJ A;  5AQH A;  3OW2 M;  3LDO A;  4H5T A;  3CCR N;  4WYB A;  1OVY A;  1ESV A;  1QZ5 A;  4B1X B;  2QWL A;  5M1O A;  2VYP A;  1X9J A;  2ZJP L;  2E8A A;  1NGC A;  3RSE A;  5JLH A;  4JN4 A;  2P9P A;  3AAQ A;  1K9M O;  2D4W A;  3CCE N;  4JKH A;  2HST A;  3IMX A;  3TSQ A;  5DM6 L;  2QWR A;  3VF6 A;  4C1N K;  5MLC Q;  2PAV A;  3FZK A;  5F0X A;  4H0O A;  1T44 A;  4BRG A;  4JKG B;  5C12 A;  4XH5 A;  4BVO A;  5BPL A;  4B1U B;  3I56 N;  3G6E N;  1BA0 A;  1K73 O;  4C23 A;  3NVM A;  1O13 A;  3E9O A;  4FWR A;  5JMV A;  3KVG A;  4BRD A;  5GAG P;  1GLA G;  5HL7 L;  1BO5 O;  2ZF5 O;  3WXL A;  1NGG A;  3FR0 A;  4OPA A;  4B9Q A;  3A5O C;  4CBX A;  5BR9 A;  5ELZ A;  4CZK A;  3ZX2 A;  1HKC A;  3MX5 A;  4XH1 A;  3L0Q A;  3VF2 A;  5BPN A;  4XH4 A;  3R1X A;  5AQS A;  3WEE B;  4DHY A;  1NGI A;  1S3X A;  3IKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...