4EFHA

Acanthamoeba actin complex with spir domain d
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
370
structure length
364
Chain Sequence
VQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMHTAASSSALEKSYELPDGQVITIGNERFRAPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMQKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-1
publication title Multiple Forms of Spire-Actin Complexes and their Functional Consequences.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Contractile protein/transport protein
total genus 127
structure length 364
sequence length 370
ec nomenclature
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4efhA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4efhA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4efhA03
1ZBSA 2PAVA 2YHXA 3MCPA 2V7YA 3WXJA 3DWLA 1U6ZA 3U9DA 2P9IA 3R6MA 3ZETB 5BRFA 4Y0WA 4XH5A 2IVNA 3AARA 1NGBA 1KAZA 2P9LA 4EHTA 2BTFA 5FPMA 4IXCA 1G99A 1BWFO 1T6CA 3ZEUA 4PKGA 4B1ZA 3GDQA 1XQSC 2QWRA 2P9PA 5BREA 1NGCA 1K8KA 4BRNA 2YHYA 2A5XA 3LDLA 3MDQA 3CIPA 2QW9A 4B1XB 4BVPA 2BUPA 1XC3A 4H0YB 1NWKA 3A5OC 4PL7A 5AZJB 4A62A 5BPMA 4PKIA 3UKRA 3IDHA 2AA4A 4FL9A 3HM8A 1ZC6A 4FPAA 1ATSA 1GLJO 4YDUC 4B9QA 3B8AX 4H0XB 1XUPO 3O4WA 4HTLA 3CJCA 5AZIA 4HWIA 1QQNA 3TPQA 4JAXA 4BRAA 2CGKA 1SAZA 2P9NB 4H5VA 3SK3A 2J4RA 3VGLA 4QS8A 4A2AA 3HZ6A 5KQDA 1WOQA 3W0LA 3ATVA 1TYQB 4GY2B 3CERA 3S41A 4BQZA 5JLFA 1QZ6A 1Z6RA 1YVNA 3QBWA 4QS9A 5ADXA 4CBUA 1NM1A 1GLEG 4PKHA 1MWKA 2CGJA 4BRCA 2KHOA 3ULEA 1V4TA 4CI6A 3CJBA 4H0PA 4NB4A 1TUYA 3D2FA 3F9MA 3A5MC 3EL2A 1NGIA 1D4XA 3JS6A 4JD2A 3O6WA 5BN9A 4LC9B 1C0FA 1NLVA 3D7EO 3U9ZA 1Y64A 1NBWA 3WEEB 2V52B 2HF3A 3CI5A 3MN6A 2Q36A 3H6EA 5AQHA 1LOTB 1RDWX 3VESA 4EIAA 2P9KA 1DGKN 1ZXOA 4BR2A 3WQUA 5LY3A 2IIRA 2WUSA 3A8YA 3AY9A 2HF4A 3LDOA 1OKJA 2E1ZA 2A6AA 2ASPA 5LJWA 2Q2RA 2P9UB 4B1VA 4IJNA 4ISFA 1HKGA 1BUPA 1C0GA 3HSCA 3ZX0A 4BG8A 5AQNA 3O80A 4DCHA 4XH4A 1Z05A 3VETA 3H3NO 3WXLA 4CZFA 4CZJA 2ITMA 4XEIA 2V51B 3CQXA 3QFUA 2NLXA 1V4SA 2W40A 5AQOA 2H3GX 1KAYA 4K43A 5KPRA 1S3XA 4BC3A 1U2VA 4FWLA 4FWOA 5KQ8A 5JMVA 2ZGZA 3SJHA 4M7XA 4FOEA 4RTFD 4H5WA 5EXWA 5BN8A 3O1WA 1P8ZA 2VWBA 3G25A 3RSEA 2E2QA 3FE1A 3AAQA 5AQKA 4CD1A 2CGLA 3UKUA 4AM6A 3O5BA 5F2RA 3WUHA 3FZHA 1X3MA 3O08A 3L6QA 3A0IX 1GLFO 3QFPA 3C7NB 3GE1A 3FZKA 1YAGA 3I8BA 1ESVA 4BG9A 3QMLA 3FLCO 5EX5A 4FWMA 3R8EA 1JCEA 3VEOA 2D1KA 2HMPA 3QICA 4FWNA 4IJAA 4BRPA 4A61A 3FZLA 2GEMA 2E2OA 3KHYA 4MLEA 3CQYA 4FSVA 1BDGA 2P9SA 3CJAA 2QWNA 3LDQA 5AQTA 4MO4A 2UYTA 4BR4A 4I6MA 2NZTA 5JICA 4WYBA 1HPMA 1RFQA 1BOTO 3LDPA 4DHYA 4M63C 2CH6A 1TYQA 5KPZA 1BU6O 4MO5A 4BRQA 3HI0A 3VEZA 3FZMA 1KXPA 4B1WB 4JHDB 4K42A 4JN4A 1GLBG 2P9IB 4EAHD 3VF2A 1T44A 2QWMA 2Q0UA 5JLHA 4J8FA 2P9LB 3WXIA 1IJJA 4BRFA 1MDUB 2I7PA 4FWSA 3KVGA 4WQ5C 4BR7A 3UB5A 3EKUA 4BR5A 2QWQA 2P9PB 4DB3A 3HTVA 4H5RA 3OHRA 3HBTA 3SLCA 5AQXA 3VF6A 2OANA 5AQJA 3SMSA 3KZBA 3WEEA 3GBTA 1K8KB 1HLUA 2YHWA 1HKCA 5AQLA 2CH5A 3C0BA 3DXKA 5AQVA 1QQMA 5FPEA 2QM1A 1BA0A 4FWPA 4BRLA 3H1VX 3UKRB 2GWKA 5AQWA 4K25A 3QDKA 3QB0A 2FF6A 3VGKA 3FR0A 5AQYA 2F9WA 3GL1A 3BF1A 3D2EA 4BGAA 3IMXA 2Q1NA 4H0VB 1JCGA 4KBOA 4CZEA 2D0OA 5AQQA 5AZIB 1J6ZA 2DPNA 4AM7A 2FLOA 1DEJA 3VEVA 2I7NA 3J8AA 3VENA 4H5TA 4MLHA 4NO7A 3BF3A 1YUWA 2HOEA 4BR9A 3ATUA 3CJ1A 3CJ9A 3FGUA 3H45C 4CZIA 1JCFA 3WXKA 3H3OB 1LCUA 5I9EB 3CHWA 3DXMA 1HX1A 2E2NA 1BO5O 2GWJA 2VCPA 5TKYA 1GLDG 4BREA 1NMDA 1KAXA 2AP1A 5BRDA 3ULEB 3ZETA 4CZLA 2A40A 2IVOA 3D2FB 2YCHA 4FOIA 4YDUA 4B1UB 4FWKA 2PBDA 1BG3A 1T6DA 2FXUA 4PL8A 5E84A 2QWLA 3EO3A 4ISEA 3WQTA 1E4GT 2W41A 4B1YB 3UE5A 3P4IA 2YJFA 5BR9A 5AQSA 2P9KB 5AQZA 3WT0A 5AZJA 4XH1A 4FO0A 1H1VA 1MA9B 3MN7A 2FSJA 1NGJA 5E26A 3TU5A 2E88A 2Q31A 4BQLA 2ASMA 1WUAA 1GLLO 2VYPA 2D4WA 1X9JA 4BGBA 4BRGA 5B8HA 3DJCA 1SQKA 4JHDA 1GLCG 4DQ8A 4FWRA 3IUCA 2D0PA 3ENHA 1IG8A 5EVZA 2FSKA 2P9NA 3I33A 4IZ9A 5AQIA 4BRMA 3L0QA 3VF4A 4CD3A 2F9TA 5BPLA 2ZWHA 3MN9A 3DAWA 4EHUA 1U2VB 1NGFA 3ZX3A 2QXLA 3FZFA 1ATRA 3R9PA 3FFKB 4GNIA 2ASOA 3IFRA 3RSEB 1TUUA 2Q97A 1HKBA 4H0OA 4JNEA 3U4LA 4CJ7A 2QWPA 5AQPA 4RCHA 3UKUB 4BC4A 4BC2A 4H5NA 4O8KA 1S22A 3GG4A 3ZEUB 4H03B 4CBXA 3H46O 1E4FT 2GUPA 4C23A 4ISGA 4WQ4A 3JXUA 4K41A 4BRIA 3VPZA 5EOYA 2YI1A 4BROA 2GELA 4BVOA 5LJVA 3BEXA 5F0XA 4H0TB 4CBWA 1DKGD 5AFUH 2P9SB 2QWOA 1SZ2A 5BPNA 1NGGA 4I6MB 4CZGA 1YXQA 2GTDA 2A41A 4EFHA 3VGMA 1NGAA 2E2PA 2P9UA 5AQFA 5KPTA 3M1FA 5AQRA 1BA1A 3H1QA 2A3ZA 1QZ5A 3QBXA 3ENOA 1ATNA 1NGHA 3O1BA 3W3DA 4RWTA 1QQOA 4IWVA 5AQMA 5AR0A 3M3ZA 3O8MA 3MK6A 3M6GA 3L4IA 3A5LC 4FPBA 4BRKA 4BRHA 2EWSA 3ID8A 4O5FA 3VEWA 3MN5A 3CETA 1NGEA 2NRHA 2V7ZA 3MMVA 4M7YA 3LM9A 4FWQA 3VOVA 5AQUA 3DXKB 5FPDA 2FF3B 5CE3A 3CJ7A 1NGDA 3SMPA 1RGIA 2ZF5O 5EY4A 2E20A 4QS7A 4F9OA 3EN9A 4A2BA 3EZWA 3LDNA 4JD2B 4BRDA 4IO8A 1GLAG 3ZX2A 3C7NA 1R59O 1QHAA 4Z94A 3BUZB 3D2EB 3VEXA 2E8AA 3AAPA 4WQ4C 4CZMA 5AQGA 1EQYA 1Q18A 3VERA 3LL3A 5ELZA 2E1YA 3EKSA 1X3NA 3GOIA 4CZHA 5BRHA 3LM2A 4BR0A 1MWMA 4E1JA 2IVPA 5FPNA 2Q0RA 4WQ5A 2ZGYA 2YJEA 5ADXH 1CZAN 4CZKA 3BP8A 4L3QA 1HUXA 3A5NC 2A42A 2FSNA 3DXMB 4BC5A 5AFUA 1HJOA 5F1XA 3U8XA 3VEYA
chains in the Genus database with same CATH superfamily
1ZBSA 2YHXA 1SL0A 1YJNN 4IG0A 2VWKA 3ISNC 3SUQA 3ZETB 5BRFA 4Y0WA 3K57A 1XI1A 2IVNA 3AARA 1BGXT 4HUGA 2UXDK 2P9LA 3D45A 5J1EA 4DQRA 4M42A 5FROA 1KLNA 3GDQA 3N4PA 2QWRA 4DTJA 1BCOA 2HHWA 4YOXA 4E19A 3AVAA 4B9UA 2HSTA 3CD6N 1BCMA 3CIPA 1KRPA 2QW9A 1DTQA 1VSJA 4H0YB 2NRVA 1NWKA 4RW4A 4CHPA 1IV0A 3LPTA 5AZJB 4A62A 3HPOA 3IDHA 4FL9A 3HO1A 1VQMN 5KTQA 4IFEA 2XY6A 3KD1E 2HHHK 4NYNA 1XUPO 2QKBA 4E3SA 4M3UA 1JLEA 3PUFA 1QQNA 1SUQA 4TSXA 3B6OA 4JAXA 4YOUA 4CJUA 4YNQA 2PZSA 4FJKA 1OVYA 3ZLJA 4H5VA 1RT4A 5KRTA 3R1XA 1SKRA 4QS8A 1S72N 1L5UA 3HZ6A 1N6QA 3W0LA 4GY2B 3CERA 4YOWA 1QZ6A 1CXQA 4HCCA 1NM1A 1GLEG 4PKHA 1S9GA 2KHOA 3ULEA 1V4TA 2B5JA 5LL6Z 5J2PA 1ZBUA 4CF1A 4G9ZA 2I5JA 3OYJA 4E0DA 5DM7L 4JD2A 3O6WA 5BN9A 4LF4K 4AF1A 4Q5VA 4ICLA 3ZT2A 4JI5K 5AQHA 3LP3A 3DM2A 3JSMA 4EIAA 5J2MA 2P9KA 1ZXOA 4G1QA 3WQUA 4DSKA 3AY9A 4Y1CA 2A6AA 3CCUN 2VGMA 1Q82O 5LJWA 3E1YA 1HKGA 4BG8A 4FXDA 3AVFA 3O80A 1U49A 1XNRK 4YOTA 4JLHA 1XNQK 1J54A 1UA1A 3HPGA 3KD5E 2A1RA 1FK9A 3SYZA 4AILC 4IEEA 4K8ZA 5M1KA 4BY9C 4LSNA 3LP0A 1XMQK 4LFAK 3AVKA 3CQXA 3QFUA 4DTUA 1NOZA 5AQOA 3TAQA 4KI6A 4DR5K 3SUNA 1UA0A 4FWOA 5KQ8A 4MDBA 4RTFD 3LDSA 3KLGA 4FLUA 3A2FA 3PLAA 1P8ZA 4CJWA 2CGLA 1HNWK 1IBKK 4RW9A 3AVMA 3WUHA 3NGZA 4OPKA 4B3TK 2OPPA 2HHUA 3A0IX 1GLFO 4M3WA 3QFPA 3FZKA 1YAGA 3CCVN 1T8EA 4J2DA 1ESVA 1T3VA 3QMLA 3FLCO 3VEOA 2UXCK 3VQQA 4V19S 4A61A 2E2OA 4MLEA 1S1UA 1BDGA 3TAPA 3VQ9A 1QVFM 2NZTA 1HPMA 4F8RA 1KSPA 3NCIA 4GMJB 5KPZA 1BU6O 4MO5A 3FZMA 4B1WB 2HVIA 4JHDB 2OZMA 4CESA 4CVNE 3VA0A 3RMDA 3JAMO 1EETA 1T44A 2G8IA 4F2RA 1WNSA 1KTQA 2RE2A 1UOCA 5D3GA 4W5TA 2I7PA 4FWSA 3KVGA 2HVHA 3OYMA 4WQ5C 4BR5A 2P9PB 4DB3A 4H5RA 3OHRA 4X65K 4DQPA 5AQXA 3SMSA 3THVA 3GBTA 2YHWA 4GKKK 3BDPA 3G0ZA 3C0BA 4WFAL 3DXKA 5AQVA 1C0MA 4BE1A 3VQBA 3CFRA 1F21A 1VQNN 4B08A 4BDZA 2QTDA 2Z1HA 4BRLA 2XY8A 4LF7K 4X66K 1NK7A 2GWKA 3TWHA 3OYNA 3QB0A 2EHGA 2FF6A 4CIFA 4DV0K 2Z1JA 3BF1A 3DRPA 3QEIA 3IMXA 5C15A 2Q1NA 3OJUA 1JCGA 4CEAA 1ASWA 3RMAA 4K8XA 1A5XA 1HMVA 4KV8A 3OYHA 3TARA 4AM7A 2FLOA 3VENA 4H5TA 3ZSOA 4PQUA 4IFVA 4DV4K 3ATUA 4NCBA 3AA4A 4C8OA 4FZYA 1D5AA 1JCFA 3WXKA 3SV3A 1LCUA 2ZJRL 3T1HK 5BR8K 2VCPA 4DQQA 3T19A 4FJGA 1NMDA 2OZSA 1QE1A 5H1SQ 2F96A 3VQ4A 2A40A 2QEXN 1HNZK 2BH1A 2IVOA 3RRGA 1K9MO 4FZXC 3LWMA 1KQSM 4FJMA 4FM1A 2O8DA 3TSQA 3V81A 3AVLA 5E84A 4A5BA 3QEWA 2QWLA 1W9HA 1XMOK 4I9QA 3MWPA 1HYVA 3O4QA 3K9KA 4CEZA 1N33K 1VQ9N 4UY8O 3WT0A 4CECA 1NGJA 5GAEP 4AHRA 3VQEA 3OYAA 4JYAK 4BQLA 2PFUA 4FLWA 1WUAA 3OS2A 1C0UA 5HLFA 4CFAA 1TKTA 1X9JA 4GV3A 4JI3K 1SQKA 4JHDA 2O8EA 5M1NA 4CK1A 1BI4B 3KLHA 1TKDA 3IUCA 3KKSA 3ENHA 2FSKA 3NDKA 3L0QA 3IG1A 3ZSZA 1UAXA 2JLEA 1B92A 3RMBA 1U2VB 1RT3A 1ATRA 3L2VA 4ELTA 4OO1J 1O13A 1XWLA 4CJ4A 3DLLL 3AO5A 3RSEB 4IEIA 3SNNA 4CJ7A 1T7PA 4RG8A 5AQPA 4BC2A 4FVMA 3ZEUB 3PY8A 4CBXA 1E4FT 2E6MA 3F9KA 4BRIA 3VPZA 3SQ2A 5SWMA 2UUBK 1S6QA 3K2PA 1ZYQA 3PO4A 1DKGD 4PHTX 2P9SB 1NKBA 1RBTA 3WNEA 4JKBA 3CYGA 4HCBA 3NMUA 2A1SA 4O44A 3LP1A 3KLFA 4DQIA 1LAWA 3L4QA 5AQFA 4JI1K 3OYFA 2GV9A 4CHQA 3M8PA 1QZ5A 1OH8A 4HHTA 3BZKA 2PYLA 1NGHA 3O1BA 3W3DA 4RWTA 1Q9YA 5AQMA 5AR0A 3QEXA 3J80O 2IC3A 4E7IA 2KZZA 2ZJQL 3CYMA 4BRHA 3ID8A 3MN5A 4M45A 2V7ZA 2IGIA 3MMVA 3P5JA 1NKCA 3VOVA 4IG3A 5AQUA 4M3YA 2F8TA 3MAQA 2OPQA 4GVEA 4JI6K 1C6VA 2OTJN 4BDYA 3AA5X 3SMPA 1RGIA 5EY4A 1MU2A 1BQMA 3ZSQA 4F9OA 4EP5A 4WFBL 3WNHA 4A2BA 3EZWA 3MXJA 3CQ8A 1R59O 4Z94A 3BUZB 3D2EB 3P31A 2VG5A 3WXMB 1C1CA 2ZJPL 3S3OA 5CY4A 3CG7A 3VQCA 4CK2A 1X3NA 3LALA 4JI7K 1MWMA 4DV7K 2YJEA 1CZAN 4DTPA 2YHAA 4FJIA 2VG7A 1HUXA 3A5NC 1IO2A 2FSNA 5AFUA 3VMFB 4HVJA 2YNFA 1HRHA 3EY1A 3ZSWA 4E89A 3E9OA 2PAVA 4DKWA 3C6UA 1X9SA 3CF5L 3WXJA 3DWLA 3CCMN 1VSEA 4FLTA 4GV9A 3R6MA 4XH5A 4DTRA 4DFPA 1NGBA 3P38A 4C8LA 4EHTA 1RBRA 2X6SA 2YNGA 4B9NA 1T6CA 3ZEUA 1OH5A 4M3RA 2JWKA 4PKGA 3RTVA 1W97L 4B1ZA 5BREA 1EXQA 4NCGA 4GW6A 4H8KA 3OW2M 4O55A 4DUZK 4UQGA 4Z4GA 1K8KA 1BQNA 3LDLA 3MDQA 1ASVA 4NYFA 1C0TA 5C2FA 2KFNA 4CHNA 4M3ZA 4PL7A 1VQ7N 5DMRA 3J7ZO 3UKRA 2AA4A 3HM8A 4IDHA 1DLOA 4FPAA 1GLJO 5HROA 4YDUC 4B9QA 3ALYA 4H0XB 4OKJA 1YTAA 1RT5A 2G8KA 1L3VA 5AZIA 3F2KA 3NHGA 1KVCA 3HXMA 3EE9A 2UU9K 3AVCA 1QSSA 4A57A 4BRAA 3PIPL 1SAZA 2DY4A 4BECA 2P9NB 4DR6K 4I2PA 1BHLA 3VGLA 4FW1A 2RPIA 4A2AA 1EP4A 1TYQB 4CJSA 3S41A 1D8YA 4FM2A 1Z6RA 4QAGA 3QBWA 4CF0A 5ADXA 4CBUA 1WSJA 4CK3A 4DFMA 3S3MA 4FK2A 4CI6A 2ETJA 5JS1A 3F9MA 3A5MC 3EL2A 3JS6A 1TK0A 3J7AP 3LWLA 3OS1A 3U9ZA 3C65A 4F2SA 3CI5A 3MN6A 4IBNA 4DMNA 3H6EA 4EP4A 3V9WA 3SAHA 2D0AA 5CHIA 4KRFA 3VESA 2O8CA 5LY3A 3TSPA 1JLBA 3LDOA 3L2RA 3O4NA 2O8BB 1EX4A 5KRSA 2HBKA 4N56A 3AA3A 3VQ5A 2P9UB 5I3UA 3B6PA 4B1VA 4NXNK 1C0GA 3NE6A 4JI0K 4N47A 3ZX0A 2YHBA 1IKXA 3K5NA 1JLFA 3THWA 5JVHL 2BDPA 1Z05A 4RW8A 3QIOA 3VETA 3WNGA 1IKWA 3WXLA 2HHQA 3VQPA 1WLJA 1I94K 1J53A 1OH6A 3M8QA 1WSHA 2NLXA 3HSTB 4CF2A 2VWJA 1EWRA 2KLAA 3OYLA 2ITGA 4FWLA 1DTTA 1Y97A 4FJ9A 2ZGZA 3SJHA 1QSYA 4FOEA 4EZ6A 1HR0K 3CMEN 3FE1A 3AAQA 4FJJA 4CD1A 4DU3A 3THYA 4DTXA 1U48A 5F2RA 5T7BA 3TAEA 3S3NA 4ID5A 1T03A 3L6QA 3C7NB 3AGKA 3I8BA 1X9MA 4E7JA 4BG9A 5EX5A 3R8EA 3K58A 2Y1IA 3IRXA 3L2QA 4JS4A 3KHYA 2GEMA 1TK5A 4JK8A 2QWNA 1A5VA 4MO4A 5AQTA 2UYTA 4WYBA 1WAJA 1RFQA 1BOTO 4LD0A 1VSDA 3K9JA 4DHYA 4M63C 4B9SA 1TYQA 1J5EK 1VSMA 1WBBA 1KXPA 3VA3A 4K42A 4FCYA 4DTMA 2P9IB 1K8AO 3QINA 4H4MA 2G8FA 4ID1A 2Q0UA 5JLHA 1KCFA 3WXIA 1IJJA 4B3OA 2E6LA 5JS2A 4BR7A 3EKUA 5GIPA 5M1OA 2PYJA 2OANA 5AQJA 3NF9A 5AQLA 2CH5A 3AVJA 2QM1A 1BA0A 4CHYA 3U3YA 3H1VX 4NCAA 5AQWA 4Z4IA 2G8UA 4K25A 1HQEA 5JENA 4JI4K 3EYZA 4BGAA 1LWEA 2D0OA 4CGFA 3K5MA 1J6ZA 3SI6A 2NRZA 2DPNA 5GADP 4DV2K 3VEVA 1DEJA 3WNFA 4KTQA 4MLHA 4AHVA 4NO7A 3BF3A 1YUWA 2HOEA 4BR9A 1LV5A 3CJ1A 4Z4HA 4JKGB 2O8FA 3H3OB 3OTOK 4B3SK 4DWIA 3CHWA 4OKKA 4YOVA 2HW3A 2E2NA 2W6LA 3ASMA 5TKYA 5GINA 1S1WA 4LFBK 3ZT1A 1QTMA 1KAXA 2AP1A 1RBVA 3ZETA 5BRDA 5HL7L 3D2FB 4PWDA 3AVBA 4DSJA 1IBMK 4IKFA 3J7YP 2PBDA 1N36K 2FXUA 3IKMA 3LZJA 5CYMA 4W5QA 3T1AA 4FVUA 1E4GT 4N41A 2HBLA 3UE5A 2VG6A 3OS0A 3P4IA 5BR9A 5AZJA 1H1VA 3NVMA 1MA9B 3IS9A 5HOOA 1N5YA 2ASMA 3UIQA 2ZM6K 4BGBA 1TKXA 4JKDA 4XJXA 3F5TA 1IKYA 3CFPA 4DQ8A 4FW2A 2O4IA 3N4QA 2D0PA 4M3XA 3NBPA 4IFYA 3CFOA 4JI8K 1WSGA 2ZWHA 4CJLA 3ID6A 2WONA 3OYKA 2YKNA 3ZX3A 1UWBA 1QSLA 2QXLA 3R9PA 4CF9A 2BE2A 4WFNL 3KJVA 3SPYA 2IS3A 4A59A 1NK5A 1HKBA 4JNEA 3U4LA 2UXBK 1RBSA 4DTSA 4DSLA 4XIUA 3V4IA 3UKUB 4CCHA 3QNOA 4H03B 1A5WA 4DSIA 1Q86O 4CFBA 4X64K 3T7ZA 3DOLA 1W2BM 2XY7A 3TI0A 4CFCA 4JEPA 3DMJA 4BROA 3MXMA 3NGYA 3ZSYA 3LPUA 3BEXA 4BACA 2YKMA 4H0TB 1JLQA 4WE1A 3CM5A 4CEEA 5BPNA 4CZGA 4I6MB 4K0KK 1YXQA 3VGMA 1ZBFA 4JKGA 2OPSA 1NGAA 1BISA 3HVRA 4KAZA 5KPTA 2HBJA 4DV5K 4JKHA 3T1YK 3QBXA 5EU7A 3ENOA 3MWTA 5GAGP 1RT1A 4IOAL 4ZTFA 2GBZA 1VQPN 4X62K 3M6GA 1EWQA 1BIZA 5TKWA 2Y1JA 1VAZA 2OYQA 5J2NA 4OX9K 4BRKA 4KHWA 3CETA 1FW6A 3KTQA 4ZTJA 4LF8K 5FDLA 1YJ9N 4CJRA 3AVIA 4I9LA 2HNZA 2HB5A 3NF6A 1VSIA 2IDOA 2ZF5O 3RRHA 3ZCMA 4GV6A 3LZIA 3EN9A 3HM9A 4BRDA 4DLEA 4IO8A 1M90O 3SUOA 3ZT0A 1OH7A 1HYZA 4GVMA 3AAPA 1QVGM 4FK4A 3QETA 2RKIA 3E9PA 4CZMA 5AQGA 4KI4A 2HNYA 1Q18A 3VERA 5K14A 1B9FA 3NH0A 3EKSA 1HYSA 3LM2A 3MEGA 4BWMA 4KHPK 2IVPA 5FPNA 4CJEA 2ZGYA 3H08A 1TVRA 1YT3A 3V1RA 2BGGA 3PX6A 1GOCA 3BP8A 4L3QA 4CGDA 2YX6A 3DXMB 3SBTA 3E01A 3KWGA 3HL8A 3O9UA 1NG9A 3L2UA 4AH9A 3MCPA 2KFZA 1G15A 1U6ZA 3U9DA 3F73A 2BANA 1KAZA 2BTFA 5FPMA 1U45A 3Q7CA 3SBGA 1BWFO 4U67L 4JKAA 1FJGK 1RT7A 2P9PA 3CC7N 4KB1A 1YTUA 3QEVA 1QS4A 1I3AA 2FBYA 2YHYA 4I7FA 4KHNA 2XY5A 5A2QO 4R5PA 1XC3A 3AGRA 3ZT3A 3OYDA 5IT9O 3QESA 5BPMA 1NK8A 5C42A 4CJFA 3P39A 2DFEA 3EEQA 4CJTA 1QQCA 1ATSA 1Z26A 3B8AX 1TGOA 3O3GA 4HTLA 3CJCA 5LMNK 1C1BA 1VQKN 3V9SA 3JYTA 2HHXA 2CGKA 3G4SN 3AO2A 2F8SA 3SK3A 2J4RA 2W42A 1RDAA 4PA1A 4BQZA 5JLFA 1FKPA 1SKWA 1YVNA 4B3MK 1MWKA 1VRUA 3T3FA 3OYBA 3C6AA 3CJBA 4J2EA 4NB4A 1TUYA 4CIEA 4W5RA 4OGCA 4IO9L 1VK0A 3QEPA 4DR2K 3P83D 1D4XA 3RMCA 5FRNA 4LC9B 1C0FA 1NLVA 3D7EO 3DOKA 4KH5A 1TV6A 3WEEB 1NBWA 2HF3A 4Y1DA 4KREA 2JWLA 4MDAA 1VQ5N 1RDWX 3L3UA 1TAUA 3I0RA 3BGRA 1DGKN 5C0YA 4JKEA 4BWJA 2WUSA 3R3LA 3CCLN 3S5TA 1NJXA 2HF4A 1OKJA 2E1ZA 3I0SA 3KLEA 3THXB 1IG9A 2RHKA 2Q2RA 5HBMA 4IJNA 3HOTA 4B8CA 1BUPA 2UUCK 3SQ0A 2NRTA 3OBYA 1VSLA 1KVAA 4JK9A 1WBDA 2R7YA 1BI4A 1GOBA 1O1WA 2Q3SA 4XH4A 3O9SA 2IOCA 1T05A 3DRSA 3K59A 2P5GA 3DRRA 4CEBA 2ITMA 3MEDA 4XEIA 4CJQA 2V51B 3NF7A 4CJ3A 3PV8A 2W40A 2H3GX 1KAYA 4K43A 1W7AA 3ZSVA 1VQLN 3AVNA 4BC3A 4JV5K 1U2VA 4F3TA 4M7XA 5EXWA 4H5WA 3DLGA 3DLEA 3O1WA 2B6AA 3RSEA 2E2QA 4Z0UA 4AM6A 4Z4CA 3AO1A 3FZHA 1RT2A 3OYEA 1X3MA 4FJ7A 3O08A 3TR8A 3V9XA 1Q8IA 3BY5A 3GE1A 3MX2A 2QK9A 1JKHA 1IH7A 3TAGA 2D1KA 4ILGB 3QICA 3FZLA 5GAHP 4CF8A 2X74A 4FSVA 2P9SA 3BZCA 3CJAA 3LDQA 4IOCL 3L8BA 3O9QA 3CPWM 1RDBA 3Q7BA 3ULDA 3QERA 4N76A 4CIGA 1HJRA 3EE8A 4O5BA 3RR8A 4BRQA 1NK9A 1U4BA 4YFUA 4OVLA 1YJWN 1L3TA 4W5OA 4OPAA 4EAHD 3VF2A 2QWMA 3P1GA 3MXIA 3MECA 2P9LB 4BRFA 2AJQA 1KFSA 4OPHA 4FJHA 4OJRA 3DLRA 3WEEA 3KZBA 5FLXO 1NK0A 3NVKA 1HKCA 1ZBLA 1JLGA 1QQMA 4DR7K 4I2QA 5FPEA 3HOSA 1OVQA 3U3GA 4OKEA 4KHSA 3QDKA 3THXA 4BE0A 3KK3A 5C10A 3I55N 5C2DA 3NH1A 1WSIA 2RF2A 4FK0A 3TAFA 4AHTA 1SV5A 1VRTA 3D2EA 4C8KA 4H0VB 4KBOA 4CZEA 4M3TA 1B9DA 5CYQA 3DLHA 2D5RA 2YV0X 4KH6A 4DU4A 4LF9K 3J8AA 1SS6A 3AV9A 2B4JA 1LWFA 3SV4A 4KTZA 3FGUA 3H45C 4LH4A 4CZIA 1JLAA 4NLCA 4DF8A 4B3RK 1HX1A 1BO5O 2GWJA 3DLBA 1VQ4N 4DR3K 3MX5A 4BREA 2X78A 3CCJN 2HHTA 3O9RA 4E7KA 4OLBA 1HPZA 2W6KA 3RVCA 3ULEB 4CZLA 4DSFA 4AHUA 4DS5A 2YCHA 4FLVA 2OTLN 2IAJA 4EZ9A 2FBVA 3AA2A 2VQFK 4LY7A 1WN7A 3CCQN 3V9UA 4YHHK 3WQTA 2W41A 1KC8O 4N5SA 2WTUA 3VN5A 1X9WA 2YJFA 3VQAA 4IOXA 1RILA 2P9KB 4MFBA 4FJ8A 3OYGA 4XH1A 1ZBHA 3MN7A 2FSJA 4H4OA 3VQDA 5E26A 2DTUA 2E88A 4CEQA 4HUEA 1QHTA 3NGIA 2VYPA 2D4WA 3LAMA 1RNHA 3V9ZA 4F3OA 1YI2N 5HRRA 3AVGA 1JJ2M 1S6PA 1S1TA 2D0CA 1JLCA 3OA9A 5IWAK 4KB0A 3CXCM 4M41A 2E5LK 1RDCA 5J2QA 2P9NA 3I33A 4IZ9A 4YORA 4BRMA 4JK7A 2F9TA 1NK6A 3MN9A 3TTDA 4EHUA 2LSNA 1NGFA 1FKOA 3FZFA 4AQYK 3FFKB 4GNIA 3IFRA 2C1IA 3M8SA 2HHVA 2Q97A 3CCEN 4BEBA 3HRGA 3OVNA 2WC9A 4RCHA 4L8RB 4H5NA 4DTOA 4O8KA 1S22A 3V1OA 1CXUA 1LAVA 2GUPA 4WQ4A 2F4VK 5EOYA 2YI1A 4DS4A 2GELA 2NRXA 4BVOA 1D9DA 5LJVA 3L3VA 4DSEA 4CBWA 5AFUH 3SJJA 2G8HA 1HNIA 1NKEA 1NGGA 3NAEA 3CC4N 5C25A 2A41A 4B9VA 2O8BA 1U47A 1VQ6N 1YHQN 4KHQA 1RDDA 3G71N 2UUAK 3G6EN 2P9UA 3QNNA 1YITN 3VQ8A 1IKVA 1NJYA 5AQRA 1BA1A 3H1QA 1W0HA 3SPZA 1VQ8N 4BE7B 4OGEA 5MLCQ 1ATNA 4IWVA 3PSFA 2ZD1A 1KVBA 3MK6A 2XO7A 3TSUA 3A5LC 4FPBA 2VQEK 2EWSA 5HRNA 4CGGA 2NRWA 4FJNA 3E9LA 3LM9A 4DV6K 1VSFA 3DXKB 5GIOA 2FF3B 5CE3A 3CJ7A 4DU1A 3KLIA 3VTIA 3V1QA 4DLGA 3ENBA 3HK2A 4QS7A 1GLAG 1VSHA 3O3FA 1XHXA 3C7NA 4E7HA 3VEXA 2E8AA 1M1KO 2G8VA 4F4KA 3TTFA 4WQ4C 3ZT4A 1N32K 1TAQA 4KTWA 4GKJK 1N8RO 5ELZA 2E1YA 1YIJN 1LW0A 3GOIA 1WAFA 4CZHA 1IBLK 5BRHA 5CR4A 2Q0RA 3HJFA 4WQ5A 1TL3A 4DG1A 5ADXH 3OYCA 4CZKA 3KK1A 3M5RA 3C6TA 4PY5A 2DFHA 2WBNA 1HJOA 4R79A 5F1XA 3U8XA 3VEYA 1JXBA 4WCEL 2F7TA 1ZBIA 2V7YA 4C8MA 2P9IA 1E3MA 1CLQA 2FBXA 1WSFA 2OPRA 4HTUA 1I39A 4IXCA 1G99A 2YNIA 2O8DB 3SQ4A 3OJSA 1J9AA 1XQSC 4DUYK 4CHZA 1NGCA 3CM6A 3C94A 4BRNA 1Q81O 1EKEA 4Q0BA 2A5XA 4CGIA 1P90A 1JL2A 4B1XB 4BVPA 2BUPA 3O3HA 2XRIA 3DI6A 3A5OC 1RTIA 1S1XA 4PKIA 1LWCA 3VTHA 1HNXK 4O0JA 3NH2A 1ZC6A 4DV1K 3VQ6A 3O4WA 2O8EB 4HWIA 3ZSXA 3TPQA 1R0AA 4LSLA 4DR4K 2VGNA 4JKCA 3KK7A 4A5AA 4RW7A 2HHIA 5KQDA 1WOQA 5I42A 3ATVA 1NJIO 4ELVA 1HQUA 4OLAA 4QS9A 4JS5A 4QCLA 4CW7B 4KFBA 4KH4A 2CGJA 4BRCA 4AHCA 4DFKA 3S9HA 1XHZA 4H0PA 3CCSN 2G8WA 3D2FA 5E41A 4ILJA 2KZMA 1NGIA 4BDPA 3AO3A 1Y64A 2V52B 2Q36A 2FBTA 4WF9L 1TK8A 5CZ1A 4B8AB 1LOTB 1S1VA 4AHSA 4CEOA 4FLZA 4BR2A 2IIRA 2HNDA 3A8YA 2HMIA 5KGXA 3SZ2A 1KFDA 2NRRA 4DR1K 1TKZA 2ASPA 3AO4A 4ISFA 3TANA 4LH5A 3V6DA 3M8RA 3HSCA 4J2BA 2HHSA 2P1JA 5AQNA 2WOMA 2KTQA 4CERA 3HVTA 3D6RA 5C24A 4CFDA 4DCHA 3HYFA 4LF6K 3H3NO 4YOYA 5FRMA 4JRQA 4CZFA 4CGJA 4CZJA 3SQ1A 1RCHA 4O4GA 1V4SA 4CJKA 4CHOA 5KPRA 1S3XA 1K73O 1VHXA 2P5OA 5JMVA 4B9MA 5BN8A 4DTNA 2O4GA 2VWBA 2EX3A 1U04A 3G25A 5HP1A 5AQKA 3EZ5A 1KD1O 3OBWA 3HP6A 2Z1GA 3UKUA 3O5BA 3IAYA 5DK5A 1NJWA 2ZE2A 4FWMA 1NNEA 1JCEA 2QXFA 4JKFA 2HMPA 4CJPA 4FWNA 4IJAA 4BRPA 4KKOA 3U6FA 4MQ3A 1KLMA 3CQYA 3KK2A 3SAGA 4FYDA 4NXMK 3AVHA 4BR4A 4I6MA 5JICA 1ASUA 2ATQA 4C1NK 3LDPA 2CH6A 4KHUA 3HI0A 3VEZA 1YVUA 4JN4A 1GLBG 1WSEA 2KKZA 3DYAA 3PSIA 4J8FA 4FZZA 2PY5A 3CC2N 1MDUB 3TAMA 4B9TA 1HNVA 4OPJA 3MEEA 3LAKA 3UB5A 4BE2A 2QWQA 4DF4A 3TABA 3HTVA 3SLCA 3HBTA 2Z1IA 3VF6A 1RT6A 2WFBA 1K8KB 1HLUA 1S5JA 1SKSA 4FJXA 4YY3K 3QLHA 3CMAN 4FWPA 3K5OA 5M1FA 3PO5A 3UKRB 3LANA 3DLKA 1NK4A 2P51A 3FR0A 5AQYA 3VGKA 1FXXA 2F9WA 2HBMA 3GL1A 3L2WA 1TL1A 4B9LA 3E66A 5AQQA 5AZIB 3SUPA 3TTCA 1L3SA 1EO1A 2I7NA 2GUIA 3PX4A 3K0SA 1Q7YO 3CJ9A 2JGUA 3C95A 3KIOA 5I9EB 3SAFA 3DXMA 3O9TA 1L3UA 3ITHA 5M1PA 3PX0A 1D9FA 1GLDG 2C1GA 3VQ7A 3FFIA 2X6NA 2NNWA 1NMNA 4FOIA 1J5OA 3LP2A 4YDUA 4B1UB 4FWKA 1BG3A 1T6DA 4PL8A 3EO3A 4ISEA 4B1YB 2KW4A 5M1QA 4E1MA 4LFCK 3RWUA 3PIOL 1SL2A 4FM0A 5AQSA 1CZBA 2O8CB 2DFFA 5AQZA 1SL1A 4Z4EA 4DFJA 5C12A 4FO0A 4NLBA 5LMUK 3TU5A 2Q31A 5CZ2A 4FLXA 2YNHA 4U7BA 1GLLO 4KPYA 1K6YA 4BRGA 5B8HA 3DJCA 4LF5K 4HUFA 1GLCG 4FWRA 3THWB 1X1PA 4DQSA 1LW2A 1IG8A 5EVZA 4FJ5A 5AQIA 3VF4A 4CD3A 3I56N 5BPLA 2NUBA 3SCXA 2QI2A 3DAWA 3NFAA 1Z25A 4W5NA 3K5LA 2KQ2A 2ZQBA 4Z4FA 2ASOA 1TUUA 4H0OA 1NJZA 3RR7A 3THYB 4C8NA 4DV3K 3KWIA 2QWPA 4BC4A 3GG4A 3H46O 4C23A 4ISGA 3JXUA 4K41A 1RDUA 4J2AA 1Q9XA 1RTDA 4FJLA 5F0XA 2D0BA 3I8DA 1ILYA 4ILHA 4PUOA 2QWOA 4IDKA 1SZ2A 2FC0A 1NOYA 4CGHA 3QO9A 4CJVA 2GTDA 4EFHA 1REVA 3CCRN 4JRPA 2E2PA 3G10A 3M1FA 1RTJA 3D0PA 2A3ZA 5KGWA 4E1NA 3C6HA 2W00A 4E72A 1CZ9A 1JXEA 1S9EA 2GX9A 3NF8A 1BIUA 5KI6A 4JI2K 4FLYA 1QQOA 3T69A 3OY9A 3M3ZA 3O8MA 4KO0A 1VQON 1XC9A 1RTHA 3HP9A 3L4IA 4C1NI 3J81O 1JL1A 4O5FA 3VEWA 4CE9A 1NGEA 2NRHA 1GOAA 4M7YA 3HPHA 4FWQA 1BL3A 4RW6A 1VSKA 5FPDA 1C1AA 3CPEA 1NGDA 5DM6L 2OCEA 2E20A 1NU0A 1N34K 3LDNA 2RN2A 2E4LA 4JD2B 5HRPA 5SZTA 4ZHRA 3ZX2A 3HT3A 1QHAA 2XHBA 3MCAB 5AJ3K 4KHYA 2QKKA 3QIPA 1EQYA 4QOZB 3OYIA 1RBUA 3LL3A 5HRSA 2QA4N 3KKRA 4BR0A 3ZYYX 4CJ5A 4E1JA 1DT9A 5JVGL 1ITGA 1YF5L 4CEFA 2OA8A 4O0IA 1WB9A 2O8FB 4E7LA 4ELUA 2A42A 3ZSRA 4CEDA 4BC5A 4O8UA
chains in the Genus database with same CATH topology
3O9UA 1ZBSA 3E9OA 2PAVA 2YHXA 4DKWA 4WCEL 2F7TA 3MCPA 3CF5L 2V7YA 3WXJA 3DWLA 1U6ZA 3U9DA 1YJNN 3CCMN 4GV9A 2P9IA 3R6MA 3ZETB 5BRFA 4Y0WA 4XH5A 2IVNA 3AARA 1NGBA 3P38A 1KAZA 2P9LA 4EHTA 2BTFA 5FPMA 3Q7CA 4IXCA 1G99A 3SBGA 1BWFO 1T6CA 3ZEUA 4U67L 2JWKA 4PKGA 1W97L 4JKAA 4B1ZA 3GDQA 1XQSC 2QWRA 2P9PA 3N4PA 5BREA 3CC7N 1NGCA 4YOXA 3OW2M 1K8KA 4BRNA 2HSTA 3CD6N 1Q81O 2YHYA 2A5XA 3LDLA 3MDQA 1P90A 3CIPA 2QW9A 4B1XB 4BVPA 5C2FA 2BUPA 1XC3A 3AGRA 4H0YB 2NRVA 1NWKA 3A5OC 4PL7A 5AZJB 4A62A 5BPMA 1VQ7N 4PKIA 3UKRA 3VTHA 3IDHA 3J7ZO 2AA4A 4FL9A 3HM8A 4IDHA 1ZC6A 3P39A 1VQMN 4FPAA 4IFEA 1ATSA 1GLJO 4YDUC 4B9QA 3B8AX 4H0XB 1XUPO 3O4WA 4HTLA 3CJCA 5AZIA 3F2KA 4HWIA 1QQNA 3EE9A 4YOUA 3TPQA 4JAXA 1VQKN 4A57A 4BRAA 2CGKA 3G4SN 1OVYA 1SAZA 3PIPL 4BECA 2P9NB 4H5VA 2VGNA 4JKCA 3KK7A 3R1XA 3SK3A 4A5AA 2J4RA 3VGLA 4QS8A 1S72N 4A2AA 3HZ6A 5KQDA 1WOQA 3W0LA 3ATVA 1TYQB 4GY2B 3CERA 4YOWA 3S41A 1NJIO 4BQZA 5JLFA 1QZ6A 1Z6RA 1YVNA 3QBWA 4QS9A 5ADXA 4CBUA 1NM1A 1GLEG 4PKHA 4KH4A 1MWKA 2CGJA 4BRCA 2KHOA 3ULEA 1V4TA 4CI6A 3C6AA 3CJBA 4H0PA 4NB4A 3CCSN 1TUYA 3D2FA 4G9ZA 3F9MA 3A5MC 4IO9L 3EL2A 4ILJA 5DM7L 1NGIA 1D4XA 3JS6A 4JD2A 3O6WA 5BN9A 4LC9B 1C0FA 1NLVA 3D7EO 3U9ZA 4KH5A 3C65A 3U8XA 1Y64A 1NBWA 3WEEB 4AF1A 2V52B 2HF3A 3CI5A 3MN6A 2Q36A 3H6EA 3SAHA 4WF9L 5AQHA 2JWLA 5CHIA 1LOTB 4MDAA 1RDWX 3VESA 4EIAA 1VQ5N 2P9KA 1DGKN 1ZXOA 4BR2A 3WQUA 5LY3A 5C0YA 2IIRA 4JKEA 2WUSA 3A8YA 3R3LA 3CCLN 3TSPA 3AY9A 2HF4A 3LDOA 1OKJA 2E1ZA 2A6AA 2NRRA 3CCUN 2VGMA 2HBKA 2RHKA 2ASPA 1Q82O 5LJWA 2Q2RA 2P9UB 4B1VA 4IJNA 3E1YA 4ISFA 3HOTA 1HKGA 1BUPA 1C0GA 3HSCA 3ZX0A 4BG8A 5AQNA 3O80A 2NRTA 3OBYA 4YOTA 3D6RA 4JK9A 4DCHA 5JVHL 4XH4A 3O9SA 1Z05A 3VETA 3H3NO 4YOYA 3WXLA 4IEEA 4CZFA 5M1KA 4CZJA 2ITMA 4BY9C 4XEIA 2V51B 3CQXA 3QFUA 2NLXA 1V4SA 2W40A 5AQOA 2H3GX 1KAYA 4K43A 1VQLN 5KPRA 1S3XA 2KLAA 4BC3A 1U2VA 4FWLA 4FWOA 5KQ8A 1K73O 5JMVA 2ZGZA 4MDBA 3SJHA 4M7XA 4FOEA 4RTFD 4H5WA 5EXWA 5BN8A 3O1WA 3PLAA 3CMEN 1P8ZA 2VWBA 3G25A 3RSEA 2E2QA 3FE1A 3AAQA 5AQKA 4CD1A 1KD1O 2CGLA 3OBWA 3UKUA 4AM6A 3O5BA 5F2RA 3WUHA 3FZHA 1X3MA 3O08A 3L6QA 3A0IX 1GLFO 3QFPA 3C7NB 3GE1A 3MX2A 3FZKA 1YAGA 3CCVN 3AGKA 3I8BA 1ESVA 1T3VA 4BG9A 3QMLA 3FLCO 5EX5A 4FWMA 3R8EA 1JCEA 3VEOA 2D1KA 4JKFA 2HMPA 4ILGB 3QICA 4FWNA 4IJAA 4BRPA 4A61A 3FZLA 2GEMA 2E2OA 3KHYA 4MLEA 5GAHP 3CQYA 4FSVA 1BDGA 2P9SA 4JK8A 3CJAA 2QWNA 3LDQA 3SAGA 5AQTA 4MO4A 4IOCL 1QVFM 2UYTA 4BR4A 4I6MA 2NZTA 5JICA 4WYBA 1HPMA 1RFQA 1BOTO 3O9QA 4C1NK 3LDPA 3CPWM 3Q7BA 3K9JA 4DHYA 4M63C 2CH6A 3EE8A 1TYQA 5KPZA 1BU6O 4MO5A 4BRQA 3HI0A 3VEZA 3FZMA 1KXPA 4B1WB 4JHDB 4K42A 4JN4A 1GLBG 1YJWN 2P9IB 1K8AO 4OPAA 4EAHD 3VF2A 1T44A 2KKZA 2QWMA 2Q0UA 5JLHA 2RE2A 4J8FA 2P9LB 3WXIA 1IJJA 4BRFA 3CC2N 1MDUB 2I7PA 4FWSA 3KVGA 4OPHA 4WQ5C 4BR7A 3UB5A 3EKUA 5GIPA 4BR5A 2QWQA 2P9PB 4DB3A 3HTVA 4H5RA 3OHRA 3HBTA 3SLCA 5M1OA 5AQXA 3VF6A 2OANA 5AQJA 3SMSA 3KZBA 3WEEA 2WFBA 1K8KB 1HLUA 2YHWA 3GBTA 3NVKA 1HKCA 5AQLA 2CH5A 3C0BA 4WFAL 3DXKA 5AQVA 1QQMA 5FPEA 2QM1A 3HOSA 1VQNN 3CMAN 2QTDA 1BA0A 4FWPA 4BRLA 3H1VX 5M1FA 3UKRB 2GWKA 5AQWA 4K25A 3QDKA 3QB0A 2FF6A 5C10A 3I55N 3VGKA 3FR0A 5AQYA 5C2DA 2F9WA 2HBMA 3GL1A 3BF1A 3D2EA 4BGAA 3IMXA 5C15A 2Q1NA 4H0VB 1JCGA 4KBOA 4CZEA 3E66A 2D0OA 5AQQA 5AZIB 1J6ZA 3TTCA 2NRZA 2DPNA 5GADP 4AM7A 2FLOA 1DEJA 3VEVA 4KH6A 1EO1A 2I7NA 3J8AA 3VENA 1SS6A 4H5TA 4MLHA 4NO7A 3BF3A 1YUWA 2HOEA 4BR9A 1Q7YO 3ATUA 3CJ1A 3CJ9A 3FGUA 3H45C 4CZIA 1JCFA 4JKGB 3WXKA 3H3OB 1LCUA 5I9EB 2ZJRL 4NLCA 3CHWA 3SAFA 4YOVA 3DXMA 1HX1A 2E2NA 1BO5O 2GWJA 2VCPA 3O9TA 5TKYA 5M1PA 1VQ4N 3MX5A 5GINA 1GLDG 4BREA 1NMDA 3CCJN 2C1GA 5H1SQ 3O9RA 1KAXA 2AP1A 5BRDA 3RVCA 3ULEB 3ZETA 4CZLA 5HL7L 2A40A 2QEXN 2BH1A 2NNWA 2IVOA 3D2FB 2YCHA 1K9MO 4FOIA 1KQSM 2OTLN 3TSQA 4YDUA 4B1UB 4FWKA 2PBDA 1BG3A 1T6DA 2FXUA 4PL8A 3IKMA 3CCQN 5E84A 4A5BA 4FVUA 2QWLA 3EO3A 4ISEA 3WQTA 1E4GT 2W41A 4B1YB 2HBLA 3UE5A 1KC8O 5M1QA 3PIOL 3P4IA 3MWPA 2YJFA 5BR9A 4IOXA 5AQSA 2P9KB 5AQZA 3K9KA 1VQ9N 4UY8O 3WT0A 5AZJA 4XH1A 4FO0A 1H1VA 3NVMA 5C12A 1MA9B 3MN7A 2FSJA 1NGJA 4NLBA 5GAEP 5E26A 3TU5A 2E88A 2Q31A 4BQLA 2ASMA 2PFUA 5HOOA 1WUAA 4U7BA 1GLLO 2VYPA 2D4WA 1X9JA 4BGBA 4BRGA 5B8HA 3DJCA 4JKDA 1YI2N 4GV3A 1JJ2M 4XJXA 3F5TA 1SQKA 4JHDA 1GLCG 4DQ8A 4FWRA 5M1NA 3N4QA 3OA9A 3CXCM 3IUCA 2D0PA 3ENHA 1IG8A 5EVZA 2FSKA 2P9NA 3I33A 4IZ9A 4YORA 5AQIA 3L0QA 4BRMA 3VF4A 4CD3A 4JK7A 3I56N 2F9TA 5BPLA 2ZWHA 3ID6A 3MN9A 3TTDA 2QI2A 3DAWA 4EHUA 1U2VB 1NGFA 3ZX3A 2QXLA 3FZFA 1ATRA 3R9PA 3FFKB 4WFNL 4GNIA 2ASOA 3IFRA 4OO1J 2C1IA 1O13A 3DLLL 4A59A 3RSEB 1TUUA 4IEIA 2Q97A 1HKBA 4H0OA 4JNEA 3U4LA 3CCEN 4BEBA 3HRGA 3KWIA 2QWPA 5AQPA 2WC9A 4RCHA 3UKUB 4BC4A 4CJ7A 4BC2A 4H5NA 4O8KA 1S22A 3GG4A 3ZEUB 4H03B 1Q86O 4CBXA 3H46O 1E4FT 3T7ZA 1W2BM 2GUPA 4C23A 4ISGA 4WQ4A 3JXUA 4JEPA 4K41A 4BRIA 3VPZA 5EOYA 1RDUA 2YI1A 4BROA 2GELA 2NRXA 4BVOA 5LJVA 3BEXA 5F0XA 4H0TB 4CBWA 1ILYA 1DKGD 4ILHA 5AFUH 4PHTX 2P9SB 2QWOA 1SZ2A 5BPNA 4JKBA 1NGGA 4I6MB 4CZGA 1YXQA 2GTDA 3CC4N 3NMUA 2A41A 4EFHA 3VGMA 1VQ6N 4JKGA 1YHQN 1NGAA 3G71N 3CCRN 3G6EN 2E2PA 2P9UA 3L4QA 1YITN 5AQFA 5KPTA 3M1FA 2HBJA 5AQRA 1BA1A 3H1QA 2A3ZA 4JKHA 1QZ5A 3QBXA 3C6HA 2W00A 2GX9A 3ENOA 3MWTA 1VQ8N 4BE7B 5GAGP 5MLCQ 1ATNA 1NGHA 3O1BA 3W3DA 4RWTA 1QQOA 4IWVA 5AQMA 5AR0A 3T69A 4IOAL 3M3ZA 3O8MA 1VQPN 1VQON 3MK6A 3M6GA 5TKWA 3L4IA 1VAZA 3A5LC 3TSUA 4C1NI 2ZJQL 4FPBA 4BRKA 4BRHA 2EWSA 3ID8A 4O5FA 3VEWA 3MN5A 3CETA 1NGEA 2NRHA 2NRWA 2V7ZA 3MMVA 4M7YA 3E9LA 3LM9A 4FWQA 3VOVA 5AQUA 1YJ9N 3DXKB 5GIOA 4GVEA 5FPDA 2FF3B 5CE3A 3CJ7A 3VTIA 3CPEA 2OTJN 3ENBA 1NGDA 3SMPA 5DM6L 1RGIA 2ZF5O 5EY4A 2E20A 4QS7A 4GV6A 4F9OA 4WFBL 3EN9A 4A2BA 3EZWA 3LDNA 4JD2B 4BRDA 4IO8A 1GLAG 1M90O 3ZX2A 3C7NA 1R59O 1QHAA 4Z94A 3BUZB 3D2EB 3VEXA 2E8AA 3AAPA 3P31A 3MCAB 1QVGM 1M1KO 3TTFA 4WQ4C 3WXMB 3E9PA 4CZMA 5AQGA 2ZJPL 1N8RO 1EQYA 1Q18A 3VERA 3LL3A 2QA4N 5ELZA 2E1YA 1YIJN 3EKSA 1X3NA 3GOIA 4CZHA 5BRHA 3LM2A 5CR4A 1MWMA 3ZYYX 4BR0A 4E1JA 1DT9A 2IVPA 5FPNA 5JVGL 2Q0RA 4WQ5A 2ZGYA 1YF5L 2YJEA 5ADXH 1CZAN 4CZKA 3BP8A 3M5RA 4L3QA 1HUXA 3A5NC 2A42A 2FSNA 2YX6A 3DXMB 4BC5A 4O8UA 5AFUA 2WBNA 3VMFB 1HJOA 4R79A 5F1XA 3SBTA 3KWGA 3VEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBS A;  2PAV A;  2YHX A;  3MCP A;  2V7Y A;  3WXJ A;  3DWL A;  1U6Z A;  3U9D A;  2P9I A;  3R6M A;  3ZET B;  5BRF A;  4Y0W A;  4XH5 A;  2IVN A;  3AAR A;  1NGB A;  1KAZ A;  2P9L A;  4EHT A;  2BTF A;  5FPM A;  4IXC A;  1G99 A;  1BWF O;  1T6C A;  3ZEU A;  4PKG A;  4B1Z A;  3GDQ A;  1XQS C;  2QWR A;  2P9P A;  5BRE A;  1NGC A;  1K8K A;  4BRN A;  2YHY A;  2A5X A;  3LDL A;  3MDQ A;  3CIP A;  2QW9 A;  4B1X B;  4BVP A;  2BUP A;  1XC3 A;  4H0Y B;  1NWK A;  3A5O C;  4PL7 A;  5AZJ B;  4A62 A;  5BPM A;  4PKI A;  3UKR A;  3IDH A;  2AA4 A;  4FL9 A;  3HM8 A;  1ZC6 A;  4FPA A;  1ATS A;  1GLJ O;  4YDU C;  4B9Q A;  3B8A X;  4H0X B;  1XUP O;  3O4W A;  4HTL A;  3CJC A;  5AZI A;  4HWI A;  1QQN A;  3TPQ A;  4JAX A;  4BRA A;  2CGK A;  1SAZ A;  2P9N B;  4H5V A;  3SK3 A;  2J4R A;  3VGL A;  4QS8 A;  4A2A A;  3HZ6 A;  5KQD A;  1WOQ A;  3W0L A;  3ATV A;  1TYQ B;  4GY2 B;  3CER A;  3S41 A;  4BQZ A;  5JLF A;  1QZ6 A;  1Z6R A;  1YVN A;  3QBW A;  4QS9 A;  5ADX A;  4CBU A;  1NM1 A;  1GLE G;  4PKH A;  1MWK A;  2CGJ A;  4BRC A;  2KHO A;  3ULE A;  1V4T A;  4CI6 A;  3CJB A;  4H0P A;  4NB4 A;  1TUY A;  3D2F A;  3F9M A;  3A5M C;  3EL2 A;  1NGI A;  1D4X A;  3JS6 A;  4JD2 A;  3O6W A;  5BN9 A;  4LC9 B;  1C0F A;  1NLV A;  3D7E O;  3U9Z A;  1Y64 A;  1NBW A;  3WEE B;  2V52 B;  2HF3 A;  3CI5 A;  3MN6 A;  2Q36 A;  3H6E A;  5AQH A;  1LOT B;  1RDW X;  3VES A;  4EIA A;  2P9K A;  1DGK N;  1ZXO A;  4BR2 A;  3WQU A;  5LY3 A;  2IIR A;  2WUS A;  3A8Y A;  3AY9 A;  2HF4 A;  3LDO A;  1OKJ A;  2E1Z A;  2A6A A;  2ASP A;  5LJW A;  2Q2R A;  2P9U B;  4B1V A;  4IJN A;  4ISF A;  1HKG A;  1BUP A;  1C0G A;  3HSC A;  3ZX0 A;  4BG8 A;  5AQN A;  3O80 A;  4DCH A;  4XH4 A;  1Z05 A;  3VET A;  3H3N O;  3WXL A;  4CZF A;  4CZJ A;  2ITM A;  4XEI A;  2V51 B;  3CQX A;  3QFU A;  2NLX A;  1V4S A;  2W40 A;  5AQO A;  2H3G X;  1KAY A;  4K43 A;  5KPR A;  1S3X A;  4BC3 A;  1U2V A;  4FWL A;  4FWO A;  5KQ8 A;  5JMV A;  2ZGZ A;  3SJH A;  4M7X A;  4FOE A;  4RTF D;  4H5W A;  5EXW A;  5BN8 A;  3O1W A;  1P8Z A;  2VWB A;  3G25 A;  3RSE A;  2E2Q A;  3FE1 A;  3AAQ A;  5AQK A;  4CD1 A;  2CGL A;  3UKU A;  4AM6 A;  3O5B A;  5F2R A;  3WUH A;  3FZH A;  1X3M A;  3O08 A;  3L6Q A;  3A0I X;  1GLF O;  3QFP A;  3C7N B;  3GE1 A;  3FZK A;  1YAG A;  3I8B A;  1ESV A;  4BG9 A;  3QML A;  3FLC O;  5EX5 A;  4FWM A;  3R8E A;  1JCE A;  3VEO A;  2D1K A;  2HMP A;  3QIC A;  4FWN A;  4IJA A;  4BRP A;  4A61 A;  3FZL A;  2GEM A;  2E2O A;  3KHY A;  4MLE A;  3CQY A;  4FSV A;  1BDG A;  2P9S A;  3CJA A;  2QWN A;  3LDQ A;  5AQT A;  4MO4 A;  2UYT A;  4BR4 A;  4I6M A;  2NZT A;  5JIC A;  4WYB A;  1HPM A;  1RFQ A;  1BOT O;  3LDP A;  4DHY A;  4M63 C;  2CH6 A;  1TYQ A;  5KPZ A;  1BU6 O;  4MO5 A;  4BRQ A;  3HI0 A;  3VEZ A;  3FZM A;  1KXP A;  4B1W B;  4JHD B;  4K42 A;  4JN4 A;  1GLB G;  2P9I B;  4EAH D;  3VF2 A;  1T44 A;  2QWM A;  2Q0U A;  5JLH A;  4J8F A;  2P9L B;  3WXI A;  1IJJ A;  4BRF A;  1MDU B;  2I7P A;  4FWS A;  3KVG A;  4WQ5 C;  4BR7 A;  3UB5 A;  3EKU A;  4BR5 A;  2QWQ A;  2P9P B;  4DB3 A;  3HTV A;  4H5R A;  3OHR A;  3HBT A;  3SLC A;  5AQX A;  3VF6 A;  2OAN A;  5AQJ A;  3SMS A;  3KZB A;  3WEE A;  3GBT A;  1K8K B;  1HLU A;  2YHW A;  1HKC A;  5AQL A;  2CH5 A;  3C0B A;  3DXK A;  5AQV A;  1QQM A;  5FPE A;  2QM1 A;  1BA0 A;  4FWP A;  4BRL A;  3H1V X;  3UKR B;  2GWK A;  5AQW A;  4K25 A;  3QDK A;  3QB0 A;  2FF6 A;  3VGK A;  3FR0 A;  5AQY A;  2F9W A;  3GL1 A;  3BF1 A;  3D2E A;  4BGA A;  3IMX A;  2Q1N A;  4H0V B;  1JCG A;  4KBO A;  4CZE A;  2D0O A;  5AQQ A;  5AZI B;  1J6Z A;  2DPN A;  4AM7 A;  2FLO A;  1DEJ A;  3VEV A;  2I7N A;  3J8A A;  3VEN A;  4H5T A;  4MLH A;  4NO7 A;  3BF3 A;  1YUW A;  2HOE A;  4BR9 A;  3ATU A;  3CJ1 A;  3CJ9 A;  3FGU A;  3H45 C;  4CZI A;  1JCF A;  3WXK A;  3H3O B;  1LCU A;  5I9E B;  3CHW A;  3DXM A;  1HX1 A;  2E2N A;  1BO5 O;  2GWJ A;  2VCP A;  5TKY A;  1GLD G;  4BRE A;  1NMD A;  1KAX A;  2AP1 A;  5BRD A;  3ULE B;  3ZET A;  4CZL A;  2A40 A;  2IVO A;  3D2F B;  2YCH A;  4FOI A;  4YDU A;  4B1U B;  4FWK A;  2PBD A;  1BG3 A;  1T6D A;  2FXU A;  4PL8 A;  5E84 A;  2QWL A;  3EO3 A;  4ISE A;  3WQT A;  1E4G T;  2W41 A;  4B1Y B;  3UE5 A;  3P4I A;  2YJF A;  5BR9 A;  5AQS A;  2P9K B;  5AQZ A;  3WT0 A;  5AZJ A;  4XH1 A;  4FO0 A;  1H1V A;  1MA9 B;  3MN7 A;  2FSJ A;  1NGJ A;  5E26 A;  3TU5 A;  2E88 A;  2Q31 A;  4BQL A;  2ASM A;  1WUA A;  1GLL O;  2VYP A;  2D4W A;  1X9J A;  4BGB A;  4BRG A;  5B8H A;  3DJC A;  1SQK A;  4JHD A;  1GLC G;  4DQ8 A;  4FWR A;  3IUC A;  2D0P A;  3ENH A;  1IG8 A;  5EVZ A;  2FSK A;  2P9N A;  3I33 A;  4IZ9 A;  5AQI A;  4BRM A;  3L0Q A;  3VF4 A;  4CD3 A;  2F9T A;  5BPL A;  2ZWH A;  3MN9 A;  3DAW A;  4EHU A;  1U2V B;  1NGF A;  3ZX3 A;  2QXL A;  3FZF A;  1ATR A;  3R9P A;  3FFK B;  4GNI A;  2ASO A;  3IFR A;  3RSE B;  1TUU A;  2Q97 A;  1HKB A;  4H0O A;  4JNE A;  3U4L A;  4CJ7 A;  2QWP A;  5AQP A;  4RCH A;  3UKU B;  4BC4 A;  4BC2 A;  4H5N A;  4O8K A;  1S22 A;  3GG4 A;  3ZEU B;  4H03 B;  4CBX A;  3H46 O;  1E4F T;  2GUP A;  4C23 A;  4ISG A;  4WQ4 A;  3JXU A;  4K41 A;  4BRI A;  3VPZ A;  5EOY A;  2YI1 A;  4BRO A;  2GEL A;  4BVO A;  5LJV A;  3BEX A;  5F0X A;  4H0T B;  4CBW A;  1DKG D;  5AFU H;  2P9S B;  2QWO A;  1SZ2 A;  5BPN A;  1NGG A;  4I6M B;  4CZG A;  1YXQ A;  2GTD A;  2A41 A;  4EFH A;  3VGM A;  1NGA A;  2E2P A;  2P9U A;  5AQF A;  5KPT A;  3M1F A;  5AQR A;  1BA1 A;  3H1Q A;  2A3Z A;  1QZ5 A;  3QBX A;  3ENO A;  1ATN A;  1NGH A;  3O1B A;  3W3D A;  4RWT A;  1QQO A;  4IWV A;  5AQM A;  5AR0 A;  3M3Z A;  3O8M A;  3MK6 A;  3M6G A;  3L4I A;  3A5L C;  4FPB A;  4BRK A;  4BRH A;  2EWS A;  3ID8 A;  4O5F A;  3VEW A;  3MN5 A;  3CET A;  1NGE A;  2NRH A;  2V7Z A;  3MMV A;  4M7Y A;  3LM9 A;  4FWQ A;  3VOV A;  5AQU A;  3DXK B;  5FPD A;  2FF3 B;  5CE3 A;  3CJ7 A;  1NGD A;  3SMP A;  1RGI A;  2ZF5 O;  5EY4 A;  2E20 A;  4QS7 A;  4F9O A;  3EN9 A;  4A2B A;  3EZW A;  3LDN A;  4JD2 B;  4BRD A;  4IO8 A;  1GLA G;  3ZX2 A;  3C7N A;  1R59 O;  1QHA A;  4Z94 A;  3BUZ B;  3D2E B;  3VEX A;  2E8A A;  3AAP A;  4WQ4 C;  4CZM A;  5AQG A;  1EQY A;  1Q18 A;  3VER A;  3LL3 A;  5ELZ A;  2E1Y A;  3EKS A;  1X3N A;  3GOI A;  4CZH A;  5BRH A;  3LM2 A;  4BR0 A;  1MWM A;  4E1J A;  2IVP A;  5FPN A;  2Q0R A;  4WQ5 A;  2ZGY A;  2YJE A;  5ADX H;  1CZA N;  4CZK A;  3BP8 A;  4L3Q A;  1HUX A;  3A5N C;  2A42 A;  2FSN A;  3DXM B;  4BC5 A;  5AFU A;  1HJO A;  5F1X A;  3U8X A;  3VEY A; 
#chains in the Genus database with same CATH topology
 1ZBS A;  2YHX A;  1SL0 A;  1YJN N;  4IG0 A;  2VWK A;  3ISN C;  3SUQ A;  3ZET B;  5BRF A;  4Y0W A;  3K57 A;  1XI1 A;  2IVN A;  3AAR A;  1BGX T;  4HUG A;  2UXD K;  2P9L A;  3D45 A;  5J1E A;  4DQR A;  4M42 A;  5FRO A;  1KLN A;  3GDQ A;  3N4P A;  2QWR A;  4DTJ A;  1BCO A;  2HHW A;  4YOX A;  4E19 A;  3AVA A;  4B9U A;  2HST A;  3CD6 N;  1BCM A;  3CIP A;  1KRP A;  2QW9 A;  1DTQ A;  1VSJ A;  4H0Y B;  2NRV A;  1NWK A;  4RW4 A;  4CHP A;  1IV0 A;  3LPT A;  5AZJ B;  4A62 A;  3HPO A;  3IDH A;  4FL9 A;  3HO1 A;  1VQM N;  5KTQ A;  4IFE A;  2XY6 A;  3KD1 E;  2HHH K;  4NYN A;  1XUP O;  2QKB A;  4E3S A;  4M3U A;  1JLE A;  3PUF A;  1QQN A;  1SUQ A;  4TSX A;  3B6O A;  4JAX A;  4YOU A;  4CJU A;  4YNQ A;  2PZS A;  4FJK A;  1OVY A;  3ZLJ A;  4H5V A;  1RT4 A;  5KRT A;  3R1X A;  1SKR A;  4QS8 A;  1S72 N;  1L5U A;  3HZ6 A;  1N6Q A;  3W0L A;  4GY2 B;  3CER A;  4YOW A;  1QZ6 A;  1CXQ A;  4HCC A;  1NM1 A;  1GLE G;  4PKH A;  1S9G A;  2KHO A;  3ULE A;  1V4T A;  2B5J A;  5LL6 Z;  5J2P A;  1ZBU A;  4CF1 A;  4G9Z A;  2I5J A;  3OYJ A;  4E0D A;  5DM7 L;  4JD2 A;  3O6W A;  5BN9 A;  4LF4 K;  4AF1 A;  4Q5V A;  4ICL A;  3ZT2 A;  4JI5 K;  5AQH A;  3LP3 A;  3DM2 A;  3JSM A;  4EIA A;  5J2M A;  2P9K A;  1ZXO A;  4G1Q A;  3WQU A;  4DSK A;  3AY9 A;  4Y1C A;  2A6A A;  3CCU N;  2VGM A;  1Q82 O;  5LJW A;  3E1Y A;  1HKG A;  4BG8 A;  4FXD A;  3AVF A;  3O80 A;  1U49 A;  1XNR K;  4YOT A;  4JLH A;  1XNQ K;  1J54 A;  1UA1 A;  3HPG A;  3KD5 E;  2A1R A;  1FK9 A;  3SYZ A;  4AIL C;  4IEE A;  4K8Z A;  5M1K A;  4BY9 C;  4LSN A;  3LP0 A;  1XMQ K;  4LFA K;  3AVK A;  3CQX A;  3QFU A;  4DTU A;  1NOZ A;  5AQO A;  3TAQ A;  4KI6 A;  4DR5 K;  3SUN A;  1UA0 A;  4FWO A;  5KQ8 A;  4MDB A;  4RTF D;  3LDS A;  3KLG A;  4FLU A;  3A2F A;  3PLA A;  1P8Z A;  4CJW A;  2CGL A;  1HNW K;  1IBK K;  4RW9 A;  3AVM A;  3WUH A;  3NGZ A;  4OPK A;  4B3T K;  2OPP A;  2HHU A;  3A0I X;  1GLF O;  4M3W A;  3QFP A;  3FZK A;  1YAG A;  3CCV N;  1T8E A;  4J2D A;  1ESV A;  1T3V A;  3QML A;  3FLC O;  3VEO A;  2UXC K;  3VQQ A;  4V19 S;  4A61 A;  2E2O A;  4MLE A;  1S1U A;  1BDG A;  3TAP A;  3VQ9 A;  1QVF M;  2NZT A;  1HPM A;  4F8R A;  1KSP A;  3NCI A;  4GMJ B;  5KPZ A;  1BU6 O;  4MO5 A;  3FZM A;  4B1W B;  2HVI A;  4JHD B;  2OZM A;  4CES A;  4CVN E;  3VA0 A;  3RMD A;  3JAM O;  1EET A;  1T44 A;  2G8I A;  4F2R A;  1WNS A;  1KTQ A;  2RE2 A;  1UOC A;  5D3G A;  4W5T A;  2I7P A;  4FWS A;  3KVG A;  2HVH A;  3OYM A;  4WQ5 C;  4BR5 A;  2P9P B;  4DB3 A;  4H5R A;  3OHR A;  4X65 K;  4DQP A;  5AQX A;  3SMS A;  3THV A;  3GBT A;  2YHW A;  4GKK K;  3BDP A;  3G0Z A;  3C0B A;  4WFA L;  3DXK A;  5AQV A;  1C0M A;  4BE1 A;  3VQB A;  3CFR A;  1F21 A;  1VQN N;  4B08 A;  4BDZ A;  2QTD A;  2Z1H A;  4BRL A;  2XY8 A;  4LF7 K;  4X66 K;  1NK7 A;  2GWK A;  3TWH A;  3OYN A;  3QB0 A;  2EHG A;  2FF6 A;  4CIF A;  4DV0 K;  2Z1J A;  3BF1 A;  3DRP A;  3QEI A;  3IMX A;  5C15 A;  2Q1N A;  3OJU A;  1JCG A;  4CEA A;  1ASW A;  3RMA A;  4K8X A;  1A5X A;  1HMV A;  4KV8 A;  3OYH A;  3TAR A;  4AM7 A;  2FLO A;  3VEN A;  4H5T A;  3ZSO A;  4PQU A;  4IFV A;  4DV4 K;  3ATU A;  4NCB A;  3AA4 A;  4C8O A;  4FZY A;  1D5A A;  1JCF A;  3WXK A;  3SV3 A;  1LCU A;  2ZJR L;  3T1H K;  5BR8 K;  2VCP A;  4DQQ A;  3T19 A;  4FJG A;  1NMD A;  2OZS A;  1QE1 A;  5H1S Q;  2F96 A;  3VQ4 A;  2A40 A;  2QEX N;  1HNZ K;  2BH1 A;  2IVO A;  3RRG A;  1K9M O;  4FZX C;  3LWM A;  1KQS M;  4FJM A;  4FM1 A;  2O8D A;  3TSQ A;  3V81 A;  3AVL A;  5E84 A;  4A5B A;  3QEW A;  2QWL A;  1W9H A;  1XMO K;  4I9Q A;  3MWP A;  1HYV A;  3O4Q A;  3K9K A;  4CEZ A;  1N33 K;  1VQ9 N;  4UY8 O;  3WT0 A;  4CEC A;  1NGJ A;  5GAE P;  4AHR A;  3VQE A;  3OYA A;  4JYA K;  4BQL A;  2PFU A;  4FLW A;  1WUA A;  3OS2 A;  1C0U A;  5HLF A;  4CFA A;  1TKT A;  1X9J A;  4GV3 A;  4JI3 K;  1SQK A;  4JHD A;  2O8E A;  5M1N A;  4CK1 A;  1BI4 B;  3KLH A;  1TKD A;  3IUC A;  3KKS A;  3ENH A;  2FSK A;  3NDK A;  3L0Q A;  3IG1 A;  3ZSZ A;  1UAX A;  2JLE A;  1B92 A;  3RMB A;  1U2V B;  1RT3 A;  1ATR A;  3L2V A;  4ELT A;  4OO1 J;  1O13 A;  1XWL A;  4CJ4 A;  3DLL L;  3AO5 A;  3RSE B;  4IEI A;  3SNN A;  4CJ7 A;  1T7P A;  4RG8 A;  5AQP A;  4BC2 A;  4FVM A;  3ZEU B;  3PY8 A;  4CBX A;  1E4F T;  2E6M A;  3F9K A;  4BRI A;  3VPZ A;  3SQ2 A;  5SWM A;  2UUB K;  1S6Q A;  3K2P A;  1ZYQ A;  3PO4 A;  1DKG D;  4PHT X;  2P9S B;  1NKB A;  1RBT A;  3WNE A;  4JKB A;  3CYG A;  4HCB A;  3NMU A;  2A1S A;  4O44 A;  3LP1 A;  3KLF A;  4DQI A;  1LAW A;  3L4Q A;  5AQF A;  4JI1 K;  3OYF A;  2GV9 A;  4CHQ A;  3M8P A;  1QZ5 A;  1OH8 A;  4HHT A;  3BZK A;  2PYL A;  1NGH A;  3O1B A;  3W3D A;  4RWT A;  1Q9Y A;  5AQM A;  5AR0 A;  3QEX A;  3J80 O;  2IC3 A;  4E7I A;  2KZZ A;  2ZJQ L;  3CYM A;  4BRH A;  3ID8 A;  3MN5 A;  4M45 A;  2V7Z A;  2IGI A;  3MMV A;  3P5J A;  1NKC A;  3VOV A;  4IG3 A;  5AQU A;  4M3Y A;  2F8T A;  3MAQ A;  2OPQ A;  4GVE A;  4JI6 K;  1C6V A;  2OTJ N;  4BDY A;  3AA5 X;  3SMP A;  1RGI A;  5EY4 A;  1MU2 A;  1BQM A;  3ZSQ A;  4F9O A;  4EP5 A;  4WFB L;  3WNH A;  4A2B A;  3EZW A;  3MXJ A;  3CQ8 A;  1R59 O;  4Z94 A;  3BUZ B;  3D2E B;  3P31 A;  2VG5 A;  3WXM B;  1C1C A;  2ZJP L;  3S3O A;  5CY4 A;  3CG7 A;  3VQC A;  4CK2 A;  1X3N A;  3LAL A;  4JI7 K;  1MWM A;  4DV7 K;  2YJE A;  1CZA N;  4DTP A;  2YHA A;  4FJI A;  2VG7 A;  1HUX A;  3A5N C;  1IO2 A;  2FSN A;  5AFU A;  3VMF B;  4HVJ A;  2YNF A;  1HRH A;  3EY1 A;  3ZSW A;  4E89 A;  3E9O A;  2PAV A;  4DKW A;  3C6U A;  1X9S A;  3CF5 L;  3WXJ A;  3DWL A;  3CCM N;  1VSE A;  4FLT A;  4GV9 A;  3R6M A;  4XH5 A;  4DTR A;  4DFP A;  1NGB A;  3P38 A;  4C8L A;  4EHT A;  1RBR A;  2X6S A;  2YNG A;  4B9N A;  1T6C A;  3ZEU A;  1OH5 A;  4M3R A;  2JWK A;  4PKG A;  3RTV A;  1W97 L;  4B1Z A;  5BRE A;  1EXQ A;  4NCG A;  4GW6 A;  4H8K A;  3OW2 M;  4O55 A;  4DUZ K;  4UQG A;  4Z4G A;  1K8K A;  1BQN A;  3LDL A;  3MDQ A;  1ASV A;  4NYF A;  1C0T A;  5C2F A;  2KFN A;  4CHN A;  4M3Z A;  4PL7 A;  1VQ7 N;  5DMR A;  3J7Z O;  3UKR A;  2AA4 A;  3HM8 A;  4IDH A;  1DLO A;  4FPA A;  1GLJ O;  5HRO A;  4YDU C;  4B9Q A;  3ALY A;  4H0X B;  4OKJ A;  1YTA A;  1RT5 A;  2G8K A;  1L3V A;  5AZI A;  3F2K A;  3NHG A;  1KVC A;  3HXM A;  3EE9 A;  2UU9 K;  3AVC A;  1QSS A;  4A57 A;  4BRA A;  3PIP L;  1SAZ A;  2DY4 A;  4BEC A;  2P9N B;  4DR6 K;  4I2P A;  1BHL A;  3VGL A;  4FW1 A;  2RPI A;  4A2A A;  1EP4 A;  1TYQ B;  4CJS A;  3S41 A;  1D8Y A;  4FM2 A;  1Z6R A;  4QAG A;  3QBW A;  4CF0 A;  5ADX A;  4CBU A;  1WSJ A;  4CK3 A;  4DFM A;  3S3M A;  4FK2 A;  4CI6 A;  2ETJ A;  5JS1 A;  3F9M A;  3A5M C;  3EL2 A;  3JS6 A;  1TK0 A;  3J7A P;  3LWL A;  3OS1 A;  3U9Z A;  3C65 A;  4F2S A;  3CI5 A;  3MN6 A;  4IBN A;  4DMN A;  3H6E A;  4EP4 A;  3V9W A;  3SAH A;  2D0A A;  5CHI A;  4KRF A;  3VES A;  2O8C A;  5LY3 A;  3TSP A;  1JLB A;  3LDO A;  3L2R A;  3O4N A;  2O8B B;  1EX4 A;  5KRS A;  2HBK A;  4N56 A;  3AA3 A;  3VQ5 A;  2P9U B;  5I3U A;  3B6P A;  4B1V A;  4NXN K;  1C0G A;  3NE6 A;  4JI0 K;  4N47 A;  3ZX0 A;  2YHB A;  1IKX A;  3K5N A;  1JLF A;  3THW A;  5JVH L;  2BDP A;  1Z05 A;  4RW8 A;  3QIO A;  3VET A;  3WNG A;  1IKW A;  3WXL A;  2HHQ A;  3VQP A;  1WLJ A;  1I94 K;  1J53 A;  1OH6 A;  3M8Q A;  1WSH A;  2NLX A;  3HST B;  4CF2 A;  2VWJ A;  1EWR A;  2KLA A;  3OYL A;  2ITG A;  4FWL A;  1DTT A;  1Y97 A;  4FJ9 A;  2ZGZ A;  3SJH A;  1QSY A;  4FOE A;  4EZ6 A;  1HR0 K;  3CME N;  3FE1 A;  3AAQ A;  4FJJ A;  4CD1 A;  4DU3 A;  3THY A;  4DTX A;  1U48 A;  5F2R A;  5T7B A;  3TAE A;  3S3N A;  4ID5 A;  1T03 A;  3L6Q A;  3C7N B;  3AGK A;  3I8B A;  1X9M A;  4E7J A;  4BG9 A;  5EX5 A;  3R8E A;  3K58 A;  2Y1I A;  3IRX A;  3L2Q A;  4JS4 A;  3KHY A;  2GEM A;  1TK5 A;  4JK8 A;  2QWN A;  1A5V A;  4MO4 A;  5AQT A;  2UYT A;  4WYB A;  1WAJ A;  1RFQ A;  1BOT O;  4LD0 A;  1VSD A;  3K9J A;  4DHY A;  4M63 C;  4B9S A;  1TYQ A;  1J5E K;  1VSM A;  1WBB A;  1KXP A;  3VA3 A;  4K42 A;  4FCY A;  4DTM A;  2P9I B;  1K8A O;  3QIN A;  4H4M A;  2G8F A;  4ID1 A;  2Q0U A;  5JLH A;  1KCF A;  3WXI A;  1IJJ A;  4B3O A;  2E6L A;  5JS2 A;  4BR7 A;  3EKU A;  5GIP A;  5M1O A;  2PYJ A;  2OAN A;  5AQJ A;  3NF9 A;  5AQL A;  2CH5 A;  3AVJ A;  2QM1 A;  1BA0 A;  4CHY A;  3U3Y A;  3H1V X;  4NCA A;  5AQW A;  4Z4I A;  2G8U A;  4K25 A;  1HQE A;  5JEN A;  4JI4 K;  3EYZ A;  4BGA A;  1LWE A;  2D0O A;  4CGF A;  3K5M A;  1J6Z A;  3SI6 A;  2NRZ A;  2DPN A;  5GAD P;  4DV2 K;  3VEV A;  1DEJ A;  3WNF A;  4KTQ A;  4MLH A;  4AHV A;  4NO7 A;  3BF3 A;  1YUW A;  2HOE A;  4BR9 A;  1LV5 A;  3CJ1 A;  4Z4H A;  4JKG B;  2O8F A;  3H3O B;  3OTO K;  4B3S K;  4DWI A;  3CHW A;  4OKK A;  4YOV A;  2HW3 A;  2E2N A;  2W6L A;  3ASM A;  5TKY A;  5GIN A;  1S1W A;  4LFB K;  3ZT1 A;  1QTM A;  1KAX A;  2AP1 A;  1RBV A;  3ZET A;  5BRD A;  5HL7 L;  3D2F B;  4PWD A;  3AVB A;  4DSJ A;  1IBM K;  4IKF A;  3J7Y P;  2PBD A;  1N36 K;  2FXU A;  3IKM A;  3LZJ A;  5CYM A;  4W5Q A;  3T1A A;  4FVU A;  1E4G T;  4N41 A;  2HBL A;  3UE5 A;  2VG6 A;  3OS0 A;  3P4I A;  5BR9 A;  5AZJ A;  1H1V A;  3NVM A;  1MA9 B;  3IS9 A;  5HOO A;  1N5Y A;  2ASM A;  3UIQ A;  2ZM6 K;  4BGB A;  1TKX A;  4JKD A;  4XJX A;  3F5T A;  1IKY A;  3CFP A;  4DQ8 A;  4FW2 A;  2O4I A;  3N4Q A;  2D0P A;  4M3X A;  3NBP A;  4IFY A;  3CFO A;  4JI8 K;  1WSG A;  2ZWH A;  4CJL A;  3ID6 A;  2WON A;  3OYK A;  2YKN A;  3ZX3 A;  1UWB A;  1QSL A;  2QXL A;  3R9P A;  4CF9 A;  2BE2 A;  4WFN L;  3KJV A;  3SPY A;  2IS3 A;  4A59 A;  1NK5 A;  1HKB A;  4JNE A;  3U4L A;  2UXB K;  1RBS A;  4DTS A;  4DSL A;  4XIU A;  3V4I A;  3UKU B;  4CCH A;  3QNO A;  4H03 B;  1A5W A;  4DSI A;  1Q86 O;  4CFB A;  4X64 K;  3T7Z A;  3DOL A;  1W2B M;  2XY7 A;  3TI0 A;  4CFC A;  4JEP A;  3DMJ A;  4BRO A;  3MXM A;  3NGY A;  3ZSY A;  3LPU A;  3BEX A;  4BAC A;  2YKM A;  4H0T B;  1JLQ A;  4WE1 A;  3CM5 A;  4CEE A;  5BPN A;  4CZG A;  4I6M B;  4K0K K;  1YXQ A;  3VGM A;  1ZBF A;  4JKG A;  2OPS A;  1NGA A;  1BIS A;  3HVR A;  4KAZ A;  5KPT A;  2HBJ A;  4DV5 K;  4JKH A;  3T1Y K;  3QBX A;  5EU7 A;  3ENO A;  3MWT A;  5GAG P;  1RT1 A;  4IOA L;  4ZTF A;  2GBZ A;  1VQP N;  4X62 K;  3M6G A;  1EWQ A;  1BIZ A;  5TKW A;  2Y1J A;  1VAZ A;  2OYQ A;  5J2N A;  4OX9 K;  4BRK A;  4KHW A;  3CET A;  1FW6 A;  3KTQ A;  4ZTJ A;  4LF8 K;  5FDL A;  1YJ9 N;  4CJR A;  3AVI A;  4I9L A;  2HNZ A;  2HB5 A;  3NF6 A;  1VSI A;  2IDO A;  2ZF5 O;  3RRH A;  3ZCM A;  4GV6 A;  3LZI A;  3EN9 A;  3HM9 A;  4BRD A;  4DLE A;  4IO8 A;  1M90 O;  3SUO A;  3ZT0 A;  1OH7 A;  1HYZ A;  4GVM A;  3AAP A;  1QVG M;  4FK4 A;  3QET A;  2RKI A;  3E9P A;  4CZM A;  5AQG A;  4KI4 A;  2HNY A;  1Q18 A;  3VER A;  5K14 A;  1B9F A;  3NH0 A;  3EKS A;  1HYS A;  3LM2 A;  3MEG A;  4BWM A;  4KHP K;  2IVP A;  5FPN A;  4CJE A;  2ZGY A;  3H08 A;  1TVR A;  1YT3 A;  3V1R A;  2BGG A;  3PX6 A;  1GOC A;  3BP8 A;  4L3Q A;  4CGD A;  2YX6 A;  3DXM B;  3SBT A;  3E01 A;  3KWG A;  3HL8 A;  3O9U A;  1NG9 A;  3L2U A;  4AH9 A;  3MCP A;  2KFZ A;  1G15 A;  1U6Z A;  3U9D A;  3F73 A;  2BAN A;  1KAZ A;  2BTF A;  5FPM A;  1U45 A;  3Q7C A;  3SBG A;  1BWF O;  4U67 L;  4JKA A;  1FJG K;  1RT7 A;  2P9P A;  3CC7 N;  4KB1 A;  1YTU A;  3QEV A;  1QS4 A;  1I3A A;  2FBY A;  2YHY A;  4I7F A;  4KHN A;  2XY5 A;  5A2Q O;  4R5P A;  1XC3 A;  3AGR A;  3ZT3 A;  3OYD A;  5IT9 O;  3QES A;  5BPM A;  1NK8 A;  5C42 A;  4CJF A;  3P39 A;  2DFE A;  3EEQ A;  4CJT A;  1QQC A;  1ATS A;  1Z26 A;  3B8A X;  1TGO A;  3O3G A;  4HTL A;  3CJC A;  5LMN K;  1C1B A;  1VQK N;  3V9S A;  3JYT A;  2HHX A;  2CGK A;  3G4S N;  3AO2 A;  2F8S A;  3SK3 A;  2J4R A;  2W42 A;  1RDA A;  4PA1 A;  4BQZ A;  5JLF A;  1FKP A;  1SKW A;  1YVN A;  4B3M K;  1MWK A;  1VRU A;  3T3F A;  3OYB A;  3C6A A;  3CJB A;  4J2E A;  4NB4 A;  1TUY A;  4CIE A;  4W5R A;  4OGC A;  4IO9 L;  1VK0 A;  3QEP A;  4DR2 K;  3P83 D;  1D4X A;  3RMC A;  5FRN A;  4LC9 B;  1C0F A;  1NLV A;  3D7E O;  3DOK A;  4KH5 A;  1TV6 A;  3WEE B;  1NBW A;  2HF3 A;  4Y1D A;  4KRE A;  2JWL A;  4MDA A;  1VQ5 N;  1RDW X;  3L3U A;  1TAU A;  3I0R A;  3BGR A;  1DGK N;  5C0Y A;  4JKE A;  4BWJ A;  2WUS A;  3R3L A;  3CCL N;  3S5T A;  1NJX A;  2HF4 A;  1OKJ A;  2E1Z A;  3I0S A;  3KLE A;  3THX B;  1IG9 A;  2RHK A;  2Q2R A;  5HBM A;  4IJN A;  3HOT A;  4B8C A;  1BUP A;  2UUC K;  3SQ0 A;  2NRT A;  3OBY A;  1VSL A;  1KVA A;  4JK9 A;  1WBD A;  2R7Y A;  1BI4 A;  1GOB A;  1O1W A;  2Q3S A;  4XH4 A;  3O9S A;  2IOC A;  1T05 A;  3DRS A;  3K59 A;  2P5G A;  3DRR A;  4CEB A;  2ITM A;  3MED A;  4XEI A;  4CJQ A;  2V51 B;  3NF7 A;  4CJ3 A;  3PV8 A;  2W40 A;  2H3G X;  1KAY A;  4K43 A;  1W7A A;  3ZSV A;  1VQL N;  3AVN A;  4BC3 A;  4JV5 K;  1U2V A;  4F3T A;  4M7X A;  5EXW A;  4H5W A;  3DLG A;  3DLE A;  3O1W A;  2B6A A;  3RSE A;  2E2Q A;  4Z0U A;  4AM6 A;  4Z4C A;  3AO1 A;  3FZH A;  1RT2 A;  3OYE A;  1X3M A;  4FJ7 A;  3O08 A;  3TR8 A;  3V9X A;  1Q8I A;  3BY5 A;  3GE1 A;  3MX2 A;  2QK9 A;  1JKH A;  1IH7 A;  3TAG A;  2D1K A;  4ILG B;  3QIC A;  3FZL A;  5GAH P;  4CF8 A;  2X74 A;  4FSV A;  2P9S A;  3BZC A;  3CJA A;  3LDQ A;  4IOC L;  3L8B A;  3O9Q A;  3CPW M;  1RDB A;  3Q7B A;  3ULD A;  3QER A;  4N76 A;  4CIG A;  1HJR A;  3EE8 A;  4O5B A;  3RR8 A;  4BRQ A;  1NK9 A;  1U4B A;  4YFU A;  4OVL A;  1YJW N;  1L3T A;  4W5O A;  4OPA A;  4EAH D;  3VF2 A;  2QWM A;  3P1G A;  3MXI A;  3MEC A;  2P9L B;  4BRF A;  2AJQ A;  1KFS A;  4OPH A;  4FJH A;  4OJR A;  3DLR A;  3WEE A;  3KZB A;  5FLX O;  1NK0 A;  3NVK A;  1HKC A;  1ZBL A;  1JLG A;  1QQM A;  4DR7 K;  4I2Q A;  5FPE A;  3HOS A;  1OVQ A;  3U3G A;  4OKE A;  4KHS A;  3QDK A;  3THX A;  4BE0 A;  3KK3 A;  5C10 A;  3I55 N;  5C2D A;  3NH1 A;  1WSI A;  2RF2 A;  4FK0 A;  3TAF A;  4AHT A;  1SV5 A;  1VRT A;  3D2E A;  4C8K A;  4H0V B;  4KBO A;  4CZE A;  4M3T A;  1B9D A;  5CYQ A;  3DLH A;  2D5R A;  2YV0 X;  4KH6 A;  4DU4 A;  4LF9 K;  3J8A A;  1SS6 A;  3AV9 A;  2B4J A;  1LWF A;  3SV4 A;  4KTZ A;  3FGU A;  3H45 C;  4LH4 A;  4CZI A;  1JLA A;  4NLC A;  4DF8 A;  4B3R K;  1HX1 A;  1BO5 O;  2GWJ A;  3DLB A;  1VQ4 N;  4DR3 K;  3MX5 A;  4BRE A;  2X78 A;  3CCJ N;  2HHT A;  3O9R A;  4E7K A;  4OLB A;  1HPZ A;  2W6K A;  3RVC A;  3ULE B;  4CZL A;  4DSF A;  4AHU A;  4DS5 A;  2YCH A;  4FLV A;  2OTL N;  2IAJ A;  4EZ9 A;  2FBV A;  3AA2 A;  2VQF K;  4LY7 A;  1WN7 A;  3CCQ N;  3V9U A;  4YHH K;  3WQT A;  2W41 A;  1KC8 O;  4N5S A;  2WTU A;  3VN5 A;  1X9W A;  2YJF A;  3VQA A;  4IOX A;  1RIL A;  2P9K B;  4MFB A;  4FJ8 A;  3OYG A;  4XH1 A;  1ZBH A;  3MN7 A;  2FSJ A;  4H4O A;  3VQD A;  5E26 A;  2DTU A;  2E88 A;  4CEQ A;  4HUE A;  1QHT A;  3NGI A;  2VYP A;  2D4W A;  3LAM A;  1RNH A;  3V9Z A;  4F3O A;  1YI2 N;  5HRR A;  3AVG A;  1JJ2 M;  1S6P A;  1S1T A;  2D0C A;  1JLC A;  3OA9 A;  5IWA K;  4KB0 A;  3CXC M;  4M41 A;  2E5L K;  1RDC A;  5J2Q A;  2P9N A;  3I33 A;  4IZ9 A;  4YOR A;  4BRM A;  4JK7 A;  2F9T A;  1NK6 A;  3MN9 A;  3TTD A;  4EHU A;  2LSN A;  1NGF A;  1FKO A;  3FZF A;  4AQY K;  3FFK B;  4GNI A;  3IFR A;  2C1I A;  3M8S A;  2HHV A;  2Q97 A;  3CCE N;  4BEB A;  3HRG A;  3OVN A;  2WC9 A;  4RCH A;  4L8R B;  4H5N A;  4DTO A;  4O8K A;  1S22 A;  3V1O A;  1CXU A;  1LAV A;  2GUP A;  4WQ4 A;  2F4V K;  5EOY A;  2YI1 A;  4DS4 A;  2GEL A;  2NRX A;  4BVO A;  1D9D A;  5LJV A;  3L3V A;  4DSE A;  4CBW A;  5AFU H;  3SJJ A;  2G8H A;  1HNI A;  1NKE A;  1NGG A;  3NAE A;  3CC4 N;  5C25 A;  2A41 A;  4B9V A;  2O8B A;  1U47 A;  1VQ6 N;  1YHQ N;  4KHQ A;  1RDD A;  3G71 N;  2UUA K;  3G6E N;  2P9U A;  3QNN A;  1YIT N;  3VQ8 A;  1IKV A;  1NJY A;  5AQR A;  1BA1 A;  3H1Q A;  1W0H A;  3SPZ A;  1VQ8 N;  4BE7 B;  4OGE A;  5MLC Q;  1ATN A;  4IWV A;  3PSF A;  2ZD1 A;  1KVB A;  3MK6 A;  2XO7 A;  3TSU A;  3A5L C;  4FPB A;  2VQE K;  2EWS A;  5HRN A;  4CGG A;  2NRW A;  4FJN A;  3E9L A;  3LM9 A;  4DV6 K;  1VSF A;  3DXK B;  5GIO A;  2FF3 B;  5CE3 A;  3CJ7 A;  4DU1 A;  3KLI A;  3VTI A;  3V1Q A;  4DLG A;  3ENB A;  3HK2 A;  4QS7 A;  1GLA G;  1VSH A;  3O3F A;  1XHX A;  3C7N A;  4E7H A;  3VEX A;  2E8A A;  1M1K O;  2G8V A;  4F4K A;  3TTF A;  4WQ4 C;  3ZT4 A;  1N32 K;  1TAQ A;  4KTW A;  4GKJ K;  1N8R O;  5ELZ A;  2E1Y A;  1YIJ N;  1LW0 A;  3GOI A;  1WAF A;  4CZH A;  1IBL K;  5BRH A;  5CR4 A;  2Q0R A;  3HJF A;  4WQ5 A;  1TL3 A;  4DG1 A;  5ADX H;  3OYC A;  4CZK A;  3KK1 A;  3M5R A;  3C6T A;  4PY5 A;  2DFH A;  2WBN A;  1HJO A;  4R79 A;  5F1X A;  3U8X A;  3VEY A;  1JXB A;  4WCE L;  2F7T A;  1ZBI A;  2V7Y A;  4C8M A;  2P9I A;  1E3M A;  1CLQ A;  2FBX A;  1WSF A;  2OPR A;  4HTU A;  1I39 A;  4IXC A;  1G99 A;  2YNI A;  2O8D B;  3SQ4 A;  3OJS A;  1J9A A;  1XQS C;  4DUY K;  4CHZ A;  1NGC A;  3CM6 A;  3C94 A;  4BRN A;  1Q81 O;  1EKE A;  4Q0B A;  2A5X A;  4CGI A;  1P90 A;  1JL2 A;  4B1X B;  4BVP A;  2BUP A;  3O3H A;  2XRI A;  3DI6 A;  3A5O C;  1RTI A;  1S1X A;  4PKI A;  1LWC A;  3VTH A;  1HNX K;  4O0J A;  3NH2 A;  1ZC6 A;  4DV1 K;  3VQ6 A;  3O4W A;  2O8E B;  4HWI A;  3ZSX A;  3TPQ A;  1R0A A;  4LSL A;  4DR4 K;  2VGN A;  4JKC A;  3KK7 A;  4A5A A;  4RW7 A;  2HHI A;  5KQD A;  1WOQ A;  5I42 A;  3ATV A;  1NJI O;  4ELV A;  1HQU A;  4OLA A;  4QS9 A;  4JS5 A;  4QCL A;  4CW7 B;  4KFB A;  4KH4 A;  2CGJ A;  4BRC A;  4AHC A;  4DFK A;  3S9H A;  1XHZ A;  4H0P A;  3CCS N;  2G8W A;  3D2F A;  5E41 A;  4ILJ A;  2KZM A;  1NGI A;  4BDP A;  3AO3 A;  1Y64 A;  2V52 B;  2Q36 A;  2FBT A;  4WF9 L;  1TK8 A;  5CZ1 A;  4B8A B;  1LOT B;  1S1V A;  4AHS A;  4CEO A;  4FLZ A;  4BR2 A;  2IIR A;  2HND A;  3A8Y A;  2HMI A;  5KGX A;  3SZ2 A;  1KFD A;  2NRR A;  4DR1 K;  1TKZ A;  2ASP A;  3AO4 A;  4ISF A;  3TAN A;  4LH5 A;  3V6D A;  3M8R A;  3HSC A;  4J2B A;  2HHS A;  2P1J A;  5AQN A;  2WOM A;  2KTQ A;  4CER A;  3HVT A;  3D6R A;  5C24 A;  4CFD A;  4DCH A;  3HYF A;  4LF6 K;  3H3N O;  4YOY A;  5FRM A;  4JRQ A;  4CZF A;  4CGJ A;  4CZJ A;  3SQ1 A;  1RCH A;  4O4G A;  1V4S A;  4CJK A;  4CHO A;  5KPR A;  1S3X A;  1K73 O;  1VHX A;  2P5O A;  5JMV A;  4B9M A;  5BN8 A;  4DTN A;  2O4G A;  2VWB A;  2EX3 A;  1U04 A;  3G25 A;  5HP1 A;  5AQK A;  3EZ5 A;  1KD1 O;  3OBW A;  3HP6 A;  2Z1G A;  3UKU A;  3O5B A;  3IAY A;  5DK5 A;  1NJW A;  2ZE2 A;  4FWM A;  1NNE A;  1JCE A;  2QXF A;  4JKF A;  2HMP A;  4CJP A;  4FWN A;  4IJA A;  4BRP A;  4KKO A;  3U6F A;  4MQ3 A;  1KLM A;  3CQY A;  3KK2 A;  3SAG A;  4FYD A;  4NXM K;  3AVH A;  4BR4 A;  4I6M A;  5JIC A;  1ASU A;  2ATQ A;  4C1N K;  3LDP A;  2CH6 A;  4KHU A;  3HI0 A;  3VEZ A;  1YVU A;  4JN4 A;  1GLB G;  1WSE A;  2KKZ A;  3DYA A;  3PSI A;  4J8F A;  4FZZ A;  2PY5 A;  3CC2 N;  1MDU B;  3TAM A;  4B9T A;  1HNV A;  4OPJ A;  3MEE A;  3LAK A;  3UB5 A;  4BE2 A;  2QWQ A;  4DF4 A;  3TAB A;  3HTV A;  3SLC A;  3HBT A;  2Z1I A;  3VF6 A;  1RT6 A;  2WFB A;  1K8K B;  1HLU A;  1S5J A;  1SKS A;  4FJX A;  4YY3 K;  3QLH A;  3CMA N;  4FWP A;  3K5O A;  5M1F A;  3PO5 A;  3UKR B;  3LAN A;  3DLK A;  1NK4 A;  2P51 A;  3FR0 A;  5AQY A;  3VGK A;  1FXX A;  2F9W A;  2HBM A;  3GL1 A;  3L2W A;  1TL1 A;  4B9L A;  3E66 A;  5AQQ A;  5AZI B;  3SUP A;  3TTC A;  1L3S A;  1EO1 A;  2I7N A;  2GUI A;  3PX4 A;  3K0S A;  1Q7Y O;  3CJ9 A;  2JGU A;  3C95 A;  3KIO A;  5I9E B;  3SAF A;  3DXM A;  3O9T A;  1L3U A;  3ITH A;  5M1P A;  3PX0 A;  1D9F A;  1GLD G;  2C1G A;  3VQ7 A;  3FFI A;  2X6N A;  2NNW A;  1NMN A;  4FOI A;  1J5O A;  3LP2 A;  4YDU A;  4B1U B;  4FWK A;  1BG3 A;  1T6D A;  4PL8 A;  3EO3 A;  4ISE A;  4B1Y B;  2KW4 A;  5M1Q A;  4E1M A;  4LFC K;  3RWU A;  3PIO L;  1SL2 A;  4FM0 A;  5AQS A;  1CZB A;  2O8C B;  2DFF A;  5AQZ A;  1SL1 A;  4Z4E A;  4DFJ A;  5C12 A;  4FO0 A;  4NLB A;  5LMU K;  3TU5 A;  2Q31 A;  5CZ2 A;  4FLX A;  2YNH A;  4U7B A;  1GLL O;  4KPY A;  1K6Y A;  4BRG A;  5B8H A;  3DJC A;  4LF5 K;  4HUF A;  1GLC G;  4FWR A;  3THW B;  1X1P A;  4DQS A;  1LW2 A;  1IG8 A;  5EVZ A;  4FJ5 A;  5AQI A;  3VF4 A;  4CD3 A;  3I56 N;  5BPL A;  2NUB A;  3SCX A;  2QI2 A;  3DAW A;  3NFA A;  1Z25 A;  4W5N A;  3K5L A;  2KQ2 A;  2ZQB A;  4Z4F A;  2ASO A;  1TUU A;  4H0O A;  1NJZ A;  3RR7 A;  3THY B;  4C8N A;  4DV3 K;  3KWI A;  2QWP A;  4BC4 A;  3GG4 A;  3H46 O;  4C23 A;  4ISG A;  3JXU A;  4K41 A;  1RDU A;  4J2A A;  1Q9X A;  1RTD A;  4FJL A;  5F0X A;  2D0B A;  3I8D A;  1ILY A;  4ILH A;  4PUO A;  2QWO A;  4IDK A;  1SZ2 A;  2FC0 A;  1NOY A;  4CGH A;  3QO9 A;  4CJV A;  2GTD A;  4EFH A;  1REV A;  3CCR N;  4JRP A;  2E2P A;  3G10 A;  3M1F A;  1RTJ A;  3D0P A;  2A3Z A;  5KGW A;  4E1N A;  3C6H A;  2W00 A;  4E72 A;  1CZ9 A;  1JXE A;  1S9E A;  2GX9 A;  3NF8 A;  1BIU A;  5KI6 A;  4JI2 K;  4FLY A;  1QQO A;  3T69 A;  3OY9 A;  3M3Z A;  3O8M A;  4KO0 A;  1VQO N;  1XC9 A;  1RTH A;  3HP9 A;  3L4I A;  4C1N I;  3J81 O;  1JL1 A;  4O5F A;  3VEW A;  4CE9 A;  1NGE A;  2NRH A;  1GOA A;  4M7Y A;  3HPH A;  4FWQ A;  1BL3 A;  4RW6 A;  1VSK A;  5FPD A;  1C1A A;  3CPE A;  1NGD A;  5DM6 L;  2OCE A;  2E20 A;  1NU0 A;  1N34 K;  3LDN A;  2RN2 A;  2E4L A;  4JD2 B;  5HRP A;  5SZT A;  4ZHR A;  3ZX2 A;  3HT3 A;  1QHA A;  2XHB A;  3MCA B;  5AJ3 K;  4KHY A;  2QKK A;  3QIP A;  1EQY A;  4QOZ B;  3OYI A;  1RBU A;  3LL3 A;  5HRS A;  2QA4 N;  3KKR A;  4BR0 A;  3ZYY X;  4CJ5 A;  4E1J A;  1DT9 A;  5JVG L;  1ITG A;  1YF5 L;  4CEF A;  2OA8 A;  4O0I A;  1WB9 A;  2O8F B;  4E7L A;  4ELU A;  2A42 A;  3ZSR A;  4CED A;  4BC5 A;  4O8U A; 
#chains in the Genus database with same CATH homology
 3O9U A;  1ZBS A;  3E9O A;  2PAV A;  2YHX A;  4DKW A;  4WCE L;  2F7T A;  3MCP A;  3CF5 L;  2V7Y A;  3WXJ A;  3DWL A;  1U6Z A;  3U9D A;  1YJN N;  3CCM N;  4GV9 A;  2P9I A;  3R6M A;  3ZET B;  5BRF A;  4Y0W A;  4XH5 A;  2IVN A;  3AAR A;  1NGB A;  3P38 A;  1KAZ A;  2P9L A;  4EHT A;  2BTF A;  5FPM A;  3Q7C A;  4IXC A;  1G99 A;  3SBG A;  1BWF O;  1T6C A;  3ZEU A;  4U67 L;  2JWK A;  4PKG A;  1W97 L;  4JKA A;  4B1Z A;  3GDQ A;  1XQS C;  2QWR A;  2P9P A;  3N4P A;  5BRE A;  3CC7 N;  1NGC A;  4YOX A;  3OW2 M;  1K8K A;  4BRN A;  2HST A;  3CD6 N;  1Q81 O;  2YHY A;  2A5X A;  3LDL A;  3MDQ A;  1P90 A;  3CIP A;  2QW9 A;  4B1X B;  4BVP A;  5C2F A;  2BUP A;  1XC3 A;  3AGR A;  4H0Y B;  2NRV A;  1NWK A;  3A5O C;  4PL7 A;  5AZJ B;  4A62 A;  5BPM A;  1VQ7 N;  4PKI A;  3UKR A;  3VTH A;  3IDH A;  3J7Z O;  2AA4 A;  4FL9 A;  3HM8 A;  4IDH A;  1ZC6 A;  3P39 A;  1VQM N;  4FPA A;  4IFE A;  1ATS A;  1GLJ O;  4YDU C;  4B9Q A;  3B8A X;  4H0X B;  1XUP O;  3O4W A;  4HTL A;  3CJC A;  5AZI A;  3F2K A;  4HWI A;  1QQN A;  3EE9 A;  4YOU A;  3TPQ A;  4JAX A;  1VQK N;  4A57 A;  4BRA A;  2CGK A;  3G4S N;  1OVY A;  1SAZ A;  3PIP L;  4BEC A;  2P9N B;  4H5V A;  2VGN A;  4JKC A;  3KK7 A;  3R1X A;  3SK3 A;  4A5A A;  2J4R A;  3VGL A;  4QS8 A;  1S72 N;  4A2A A;  3HZ6 A;  5KQD A;  1WOQ A;  3W0L A;  3ATV A;  1TYQ B;  4GY2 B;  3CER A;  4YOW A;  3S41 A;  1NJI O;  4BQZ A;  5JLF A;  1QZ6 A;  1Z6R A;  1YVN A;  3QBW A;  4QS9 A;  5ADX A;  4CBU A;  1NM1 A;  1GLE G;  4PKH A;  4KH4 A;  1MWK A;  2CGJ A;  4BRC A;  2KHO A;  3ULE A;  1V4T A;  4CI6 A;  3C6A A;  3CJB A;  4H0P A;  4NB4 A;  3CCS N;  1TUY A;  3D2F A;  4G9Z A;  3F9M A;  3A5M C;  4IO9 L;  3EL2 A;  4ILJ A;  5DM7 L;  1NGI A;  1D4X A;  3JS6 A;  4JD2 A;  3O6W A;  5BN9 A;  4LC9 B;  1C0F A;  1NLV A;  3D7E O;  3U9Z A;  4KH5 A;  3C65 A;  3U8X A;  1Y64 A;  1NBW A;  3WEE B;  4AF1 A;  2V52 B;  2HF3 A;  3CI5 A;  3MN6 A;  2Q36 A;  3H6E A;  3SAH A;  4WF9 L;  5AQH A;  2JWL A;  5CHI A;  1LOT B;  4MDA A;  1RDW X;  3VES A;  4EIA A;  1VQ5 N;  2P9K A;  1DGK N;  1ZXO A;  4BR2 A;  3WQU A;  5LY3 A;  5C0Y A;  2IIR A;  4JKE A;  2WUS A;  3A8Y A;  3R3L A;  3CCL N;  3TSP A;  3AY9 A;  2HF4 A;  3LDO A;  1OKJ A;  2E1Z A;  2A6A A;  2NRR A;  3CCU N;  2VGM A;  2HBK A;  2RHK A;  2ASP A;  1Q82 O;  5LJW A;  2Q2R A;  2P9U B;  4B1V A;  4IJN A;  3E1Y A;  4ISF A;  3HOT A;  1HKG A;  1BUP A;  1C0G A;  3HSC A;  3ZX0 A;  4BG8 A;  5AQN A;  3O80 A;  2NRT A;  3OBY A;  4YOT A;  3D6R A;  4JK9 A;  4DCH A;  5JVH L;  4XH4 A;  3O9S A;  1Z05 A;  3VET A;  3H3N O;  4YOY A;  3WXL A;  4IEE A;  4CZF A;  5M1K A;  4CZJ A;  2ITM A;  4BY9 C;  4XEI A;  2V51 B;  3CQX A;  3QFU A;  2NLX A;  1V4S A;  2W40 A;  5AQO A;  2H3G X;  1KAY A;  4K43 A;  1VQL N;  5KPR A;  1S3X A;  2KLA A;  4BC3 A;  1U2V A;  4FWL A;  4FWO A;  5KQ8 A;  1K73 O;  5JMV A;  2ZGZ A;  4MDB A;  3SJH A;  4M7X A;  4FOE A;  4RTF D;  4H5W A;  5EXW A;  5BN8 A;  3O1W A;  3PLA A;  3CME N;  1P8Z A;  2VWB A;  3G25 A;  3RSE A;  2E2Q A;  3FE1 A;  3AAQ A;  5AQK A;  4CD1 A;  1KD1 O;  2CGL A;  3OBW A;  3UKU A;  4AM6 A;  3O5B A;  5F2R A;  3WUH A;  3FZH A;  1X3M A;  3O08 A;  3L6Q A;  3A0I X;  1GLF O;  3QFP A;  3C7N B;  3GE1 A;  3MX2 A;  3FZK A;  1YAG A;  3CCV N;  3AGK A;  3I8B A;  1ESV A;  1T3V A;  4BG9 A;  3QML A;  3FLC O;  5EX5 A;  4FWM A;  3R8E A;  1JCE A;  3VEO A;  2D1K A;  4JKF A;  2HMP A;  4ILG B;  3QIC A;  4FWN A;  4IJA A;  4BRP A;  4A61 A;  3FZL A;  2GEM A;  2E2O A;  3KHY A;  4MLE A;  5GAH P;  3CQY A;  4FSV A;  1BDG A;  2P9S A;  4JK8 A;  3CJA A;  2QWN A;  3LDQ A;  3SAG A;  5AQT A;  4MO4 A;  4IOC L;  1QVF M;  2UYT A;  4BR4 A;  4I6M A;  2NZT A;  5JIC A;  4WYB A;  1HPM A;  1RFQ A;  1BOT O;  3O9Q A;  4C1N K;  3LDP A;  3CPW M;  3Q7B A;  3K9J A;  4DHY A;  4M63 C;  2CH6 A;  3EE8 A;  1TYQ A;  5KPZ A;  1BU6 O;  4MO5 A;  4BRQ A;  3HI0 A;  3VEZ A;  3FZM A;  1KXP A;  4B1W B;  4JHD B;  4K42 A;  4JN4 A;  1GLB G;  1YJW N;  2P9I B;  1K8A O;  4OPA A;  4EAH D;  3VF2 A;  1T44 A;  2KKZ A;  2QWM A;  2Q0U A;  5JLH A;  2RE2 A;  4J8F A;  2P9L B;  3WXI A;  1IJJ A;  4BRF A;  3CC2 N;  1MDU B;  2I7P A;  4FWS A;  3KVG A;  4OPH A;  4WQ5 C;  4BR7 A;  3UB5 A;  3EKU A;  5GIP A;  4BR5 A;  2QWQ A;  2P9P B;  4DB3 A;  3HTV A;  4H5R A;  3OHR A;  3HBT A;  3SLC A;  5M1O A;  5AQX A;  3VF6 A;  2OAN A;  5AQJ A;  3SMS A;  3KZB A;  3WEE A;  2WFB A;  1K8K B;  1HLU A;  2YHW A;  3GBT A;  3NVK A;  1HKC A;  5AQL A;  2CH5 A;  3C0B A;  4WFA L;  3DXK A;  5AQV A;  1QQM A;  5FPE A;  2QM1 A;  3HOS A;  1VQN N;  3CMA N;  2QTD A;  1BA0 A;  4FWP A;  4BRL A;  3H1V X;  5M1F A;  3UKR B;  2GWK A;  5AQW A;  4K25 A;  3QDK A;  3QB0 A;  2FF6 A;  5C10 A;  3I55 N;  3VGK A;  3FR0 A;  5AQY A;  5C2D A;  2F9W A;  2HBM A;  3GL1 A;  3BF1 A;  3D2E A;  4BGA A;  3IMX A;  5C15 A;  2Q1N A;  4H0V B;  1JCG A;  4KBO A;  4CZE A;  3E66 A;  2D0O A;  5AQQ A;  5AZI B;  1J6Z A;  3TTC A;  2NRZ A;  2DPN A;  5GAD P;  4AM7 A;  2FLO A;  1DEJ A;  3VEV A;  4KH6 A;  1EO1 A;  2I7N A;  3J8A A;  3VEN A;  1SS6 A;  4H5T A;  4MLH A;  4NO7 A;  3BF3 A;  1YUW A;  2HOE A;  4BR9 A;  1Q7Y O;  3ATU A;  3CJ1 A;  3CJ9 A;  3FGU A;  3H45 C;  4CZI A;  1JCF A;  4JKG B;  3WXK A;  3H3O B;  1LCU A;  5I9E B;  2ZJR L;  4NLC A;  3CHW A;  3SAF A;  4YOV A;  3DXM A;  1HX1 A;  2E2N A;  1BO5 O;  2GWJ A;  2VCP A;  3O9T A;  5TKY A;  5M1P A;  1VQ4 N;  3MX5 A;  5GIN A;  1GLD G;  4BRE A;  1NMD A;  3CCJ N;  2C1G A;  5H1S Q;  3O9R A;  1KAX A;  2AP1 A;  5BRD A;  3RVC A;  3ULE B;  3ZET A;  4CZL A;  5HL7 L;  2A40 A;  2QEX N;  2BH1 A;  2NNW A;  2IVO A;  3D2F B;  2YCH A;  1K9M O;  4FOI A;  1KQS M;  2OTL N;  3TSQ A;  4YDU A;  4B1U B;  4FWK A;  2PBD A;  1BG3 A;  1T6D A;  2FXU A;  4PL8 A;  3IKM A;  3CCQ N;  5E84 A;  4A5B A;  4FVU A;  2QWL A;  3EO3 A;  4ISE A;  3WQT A;  1E4G T;  2W41 A;  4B1Y B;  2HBL A;  3UE5 A;  1KC8 O;  5M1Q A;  3PIO L;  3P4I A;  3MWP A;  2YJF A;  5BR9 A;  4IOX A;  5AQS A;  2P9K B;  5AQZ A;  3K9K A;  1VQ9 N;  4UY8 O;  3WT0 A;  5AZJ A;  4XH1 A;  4FO0 A;  1H1V A;  3NVM A;  5C12 A;  1MA9 B;  3MN7 A;  2FSJ A;  1NGJ A;  4NLB A;  5GAE P;  5E26 A;  3TU5 A;  2E88 A;  2Q31 A;  4BQL A;  2ASM A;  2PFU A;  5HOO A;  1WUA A;  4U7B A;  1GLL O;  2VYP A;  2D4W A;  1X9J A;  4BGB A;  4BRG A;  5B8H A;  3DJC A;  4JKD A;  1YI2 N;  4GV3 A;  1JJ2 M;  4XJX A;  3F5T A;  1SQK A;  4JHD A;  1GLC G;  4DQ8 A;  4FWR A;  5M1N A;  3N4Q A;  3OA9 A;  3CXC M;  3IUC A;  2D0P A;  3ENH A;  1IG8 A;  5EVZ A;  2FSK A;  2P9N A;  3I33 A;  4IZ9 A;  4YOR A;  5AQI A;  3L0Q A;  4BRM A;  3VF4 A;  4CD3 A;  4JK7 A;  3I56 N;  2F9T A;  5BPL A;  2ZWH A;  3ID6 A;  3MN9 A;  3TTD A;  2QI2 A;  3DAW A;  4EHU A;  1U2V B;  1NGF A;  3ZX3 A;  2QXL A;  3FZF A;  1ATR A;  3R9P A;  3FFK B;  4WFN L;  4GNI A;  2ASO A;  3IFR A;  4OO1 J;  2C1I A;  1O13 A;  3DLL L;  4A59 A;  3RSE B;  1TUU A;  4IEI A;  2Q97 A;  1HKB A;  4H0O A;  4JNE A;  3U4L A;  3CCE N;  4BEB A;  3HRG A;  3KWI A;  2QWP A;  5AQP A;  2WC9 A;  4RCH A;  3UKU B;  4BC4 A;  4CJ7 A;  4BC2 A;  4H5N A;  4O8K A;  1S22 A;  3GG4 A;  3ZEU B;  4H03 B;  1Q86 O;  4CBX A;  3H46 O;  1E4F T;  3T7Z A;  1W2B M;  2GUP A;  4C23 A;  4ISG A;  4WQ4 A;  3JXU A;  4JEP A;  4K41 A;  4BRI A;  3VPZ A;  5EOY A;  1RDU A;  2YI1 A;  4BRO A;  2GEL A;  2NRX A;  4BVO A;  5LJV A;  3BEX A;  5F0X A;  4H0T B;  4CBW A;  1ILY A;  1DKG D;  4ILH A;  5AFU H;  4PHT X;  2P9S B;  2QWO A;  1SZ2 A;  5BPN A;  4JKB A;  1NGG A;  4I6M B;  4CZG A;  1YXQ A;  2GTD A;  3CC4 N;  3NMU A;  2A41 A;  4EFH A;  3VGM A;  1VQ6 N;  4JKG A;  1YHQ N;  1NGA A;  3G71 N;  3CCR N;  3G6E N;  2E2P A;  2P9U A;  3L4Q A;  1YIT N;  5AQF A;  5KPT A;  3M1F A;  2HBJ A;  5AQR A;  1BA1 A;  3H1Q A;  2A3Z A;  4JKH A;  1QZ5 A;  3QBX A;  3C6H A;  2W00 A;  2GX9 A;  3ENO A;  3MWT A;  1VQ8 N;  4BE7 B;  5GAG P;  5MLC Q;  1ATN A;  1NGH A;  3O1B A;  3W3D A;  4RWT A;  1QQO A;  4IWV A;  5AQM A;  5AR0 A;  3T69 A;  4IOA L;  3M3Z A;  3O8M A;  1VQP N;  1VQO N;  3MK6 A;  3M6G A;  5TKW A;  3L4I A;  1VAZ A;  3A5L C;  3TSU A;  4C1N I;  2ZJQ L;  4FPB A;  4BRK A;  4BRH A;  2EWS A;  3ID8 A;  4O5F A;  3VEW A;  3MN5 A;  3CET A;  1NGE A;  2NRH A;  2NRW A;  2V7Z A;  3MMV A;  4M7Y A;  3E9L A;  3LM9 A;  4FWQ A;  3VOV A;  5AQU A;  1YJ9 N;  3DXK B;  5GIO A;  4GVE A;  5FPD A;  2FF3 B;  5CE3 A;  3CJ7 A;  3VTI A;  3CPE A;  2OTJ N;  3ENB A;  1NGD A;  3SMP A;  5DM6 L;  1RGI A;  2ZF5 O;  5EY4 A;  2E20 A;  4QS7 A;  4GV6 A;  4F9O A;  4WFB L;  3EN9 A;  4A2B A;  3EZW A;  3LDN A;  4JD2 B;  4BRD A;  4IO8 A;  1GLA G;  1M90 O;  3ZX2 A;  3C7N A;  1R59 O;  1QHA A;  4Z94 A;  3BUZ B;  3D2E B;  3VEX A;  2E8A A;  3AAP A;  3P31 A;  3MCA B;  1QVG M;  1M1K O;  3TTF A;  4WQ4 C;  3WXM B;  3E9P A;  4CZM A;  5AQG A;  2ZJP L;  1N8R O;  1EQY A;  1Q18 A;  3VER A;  3LL3 A;  2QA4 N;  5ELZ A;  2E1Y A;  1YIJ N;  3EKS A;  1X3N A;  3GOI A;  4CZH A;  5BRH A;  3LM2 A;  5CR4 A;  1MWM A;  3ZYY X;  4BR0 A;  4E1J A;  1DT9 A;  2IVP A;  5FPN A;  5JVG L;  2Q0R A;  4WQ5 A;  2ZGY A;  1YF5 L;  2YJE A;  5ADX H;  1CZA N;  4CZK A;  3BP8 A;  3M5R A;  4L3Q A;  1HUX A;  3A5N C;  2A42 A;  2FSN A;  2YX6 A;  3DXM B;  4BC5 A;  4O8U A;  5AFU A;  2WBN A;  3VMF B;  1HJO A;  4R79 A;  5F1X A;  3SBT A;  3KWG A;  3VEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...