4EFHA

Acanthamoeba actin complex with spir domain d
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
370
structure length
364
Chain Sequence
VQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMHTAASSSALEKSYELPDGQVITIGNERFRAPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMQKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-1
publication title Multiple Forms of Spire-Actin Complexes and their Functional Consequences.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Contractile protein/transport protein
total genus 127
structure length 364
sequence length 370
ec nomenclature
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4efhA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4efhA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4efhA03
4BVOA 4H0VB 3QFUA 3CI5A 3MK6A 4K43A 3EL2A 4CBWA 4FPBA 2YHYA 1QZ6A 3CJ7A 1K8KA 1DGKN 2FSKA 1HLUA 4CD3A 4BRHA 3UB5A 3O4WA 3VPZA 4CZHA 3VF2A 5BRDA 5BPMA 3A0IX 4M63C 4B1ZA 2OANA 3IDHA 4XH5A 2D4WA 4BR2A 4JHDB 3BF3A 5E26A 2H3GX 3MN9A 4PL8A 3U8XA 1YAGA 3B8AX 3HI0A 3HZ6A 3GL1A 4FWMA 3SLCA 3O6WA 4BREA 1NGGA 2GEMA 3L0QA 1D4XA 4AM7A 4Z94A 1GLEG 1HX1A 1V4SA 4JNEA 5LJWA 3ZX3A 1MWKA 1KAYA 3EO3A 2QW9A 4BG9A 1BU6O 4WQ4C 4BRQA 3ULEA 4YDUC 2EWSA 4CD1A 3FFKB 4AM6A 5AZJB 5AQSA 4B1YB 4DCHA 2ZGYA 3QICA 1ZXOA 2YI1A 4B1WB 2A40A 3MDQA 4FWKA 3RSEB 1NGHA 5AQVA 5F2RA 2P9LA 3ENHA 2Q0UA 1QQOA 5AR0A 2Q2RA 4LC9B 3WEEB 2Q36A 1Q18A 1QQMA 3EKUA 3EZWA 5AQLA 1HKCA 1DKGD 1GLFO 2QWLA 5AQKA 3D2FB 3IUCA 3MN5A 5AZJA 4M7XA 1TUUA 3WXJA 4RTFD 4FSVA 2ASOA 3FZMA 3DXKB 1NGCA 1NMDA 4XH1A 4IJNA 4ISEA 1GLBG 3U9ZA 3I8BA 3VEOA 3VESA 5BRHA 4BC5A 3ZEUA 3WEEA 1T44A 5AFUH 3VOVA 3VGMA 3A5MC 4CJ7A 4DHYA 4FOIA 1IG8A 2P9SB 3ID8A 2V7ZA 3DXKA 1T6CA 1WUAA 2J4RA 3CIPA 4ISFA 1RGIA 5AQMA 1HUXA 2YHXA 2GTDA 3QBXA 5BPLA 5LJVA 4CBXA 5FPDA 2QWPA 3AAPA 3J8AA 2CGLA 5AFUA 4BRNA 5AZIA 4JN4A 2KHOA 1GLLO 2P9IA 3AARA 4FWPA 2GUPA 4H0PA 5BRFA 5AQYA 3FZKA 4B9QA 2BTFA 2HF3A 1E4GT 1GLCG 2QWRA 1LCUA 2D0PA 4IWVA 3VF4A 5AQHA 1XC3A 2QWNA 4QS8A 3R8EA 1Z6RA 2VWBA 5AQZA 3CJ9A 5BREA 3EN9A 3WXKA 5KQ8A 1G99A 4H0YB 1U2VB 3LDLA 4DB3A 5AQXA 3VERA 4WQ5C 3AAQA 3ZX0A 1C0FA 3O1BA 4ISGA 4BR0A 1E4FT 4IZ9A 5EY4A 1BWFO 2IIRA 1GLJO 3D7EO 4H5TA 2CH5A 3VEZA 1TYQA 1NGIA 5JLFA 2E2QA 1ZC6A 1NWKA 3A8YA 4JD2B 5TKYA 3QMLA 4MLHA 3LDOA 5AQFA 3OHRA 3FZLA 2E2PA 5AQPA 4JAXA 1XQSC 5KPZA 1SQKA 4IXCA 3MN7A 1KAZA 3VETA 5BN9A 4B1XB 3BEXA 2AA4A 2CGJA 4BC4A 3SMPA 1WOQA 4F9OA 2BUPA 3ZX2A 2A5XA 2E2NA 3HTVA 3SK3A 4MO4A 5F1XA 3BUZB 3LL3A 1SAZA 4M7YA 4JD2A 3CERA 3DAWA 3U4LA 1C0GA 4H5VA 4JHDA 3UE5A 4BRDA 3CJBA 2DPNA 2ZWHA 4BRMA 5BN8A 1KXPA 4CZKA 5EX5A 4PL7A 2QWQA 3WXIA 3P4IA 2A3ZA 4GNIA 3A5OC 4FWOA 5AQGA 4CZGA 2HF4A 2NLXA 4H0XB 1NGBA 2A42A 3DWLA 4XEIA 3DXMB 1BOTO 2FF3B 2PAVA 3G25A 4C23A 1YUWA 3M1FA 1YVNA 2E8AA 1Y64A 3IMXA 3RSEA 4RWTA 3LDNA 1ATNA 5KQDA 3ATUA 3CHWA 3VEVA 3HSCA 1RFQA 3SMSA 2V51B 2P9UB 3H46O 2GWJA 2E1ZA 4EIAA 4B1VA 3D2FA 3H1QA 3TU5A 3MN6A 4BVPA 5AQOA 3DXMA 4BRGA 3KHYA 3O5BA 1BA1A 3GBTA 3FZFA 3CJAA 2FSJA 5AQIA 1NM1A 2YJEA 4CZMA 3FLCO 3MMVA 4RCHA 4EHTA 2I7PA 3WT0A 2D1KA 1BG3A 2V52B 1ZBSA 5AQQA 1QHAA 3QB0A 3LM2A 2CH6A 3BP8A 4H0OA 4BQLA 1OKJA 2P9SA 3M6GA 3A5NC 4DQ8A 3WQTA 4BRPA 4BR7A 4PKHA 1H1VA 5FPEA 4O5FA 2E88A 5AQUA 4Y0WA 1QZ5A 4CZIA 5AQTA 3SJHA 2ASMA 3H1VX 4EHUA 3UKUB 1S22A 4MLEA 5BPNA 1NBWA 4FOEA 2HOEA 4FL9A 3CQYA 1MA9B 3L6QA 3QFPA 3C7NB 3O1WA 2P9PB 5I9EB 4QS9A 4FWNA 5EXWA 5AQJA 1IJJA 2IVPA 4KBOA 3O80A 2GWKA 2IVNA 3UKRB 4BRFA 2A41A 3TPQA 1JCEA 2F9TA 4E1JA 1RDWX 2Q0RA 2YJFA 1MWMA 3H6EA 1K8KB 3GG4A 1BUPA 4A2BA 3FE1A 2HMPA 3ZETB 3BF1A 4BG8A 1P8ZA 1MDUB 3IFRA 4NO7A 5AQWA 4H5RA 1U2VA 1NGFA 3C7NA 4CBUA 3WXLA 1JCFA 1HPMA 4CZLA 4IO8A 3UKRA 3GOIA 2AP1A 4BRAA 3D2EB 3F9MA 4PKIA 3DJCA 4BC2A 4QS7A 1Z05A 2QXLA 2WUSA 3ZETA 2YCHA 3ATVA 2FXUA 2GELA 5KPTA 3O08A 4CZJA 3VGLA 1TUYA 4CZFA 3ULEB 4FWSA 1EQYA 3S41A 3QDKA 5JMVA 3VGKA 1XUPO 2ZF5O 4BQZA 1GLAG 4CZEA 3VENA 3D2EA 2IVOA 4PKGA 1BDGA 2F9WA 3R6MA 3WUHA 5BR9A 2P9LB 1T6DA 2VCPA 5B8HA 2ZGZA 3A5LC 3AY9A 3H3NO 3VEXA 3U9DA 4HWIA 3FR0A 4XH4A 2A6AA 4BRCA 1CZAN 4L3QA 4BC3A 4BR5A 4H5NA 5FPNA 2QWMA 1HJOA 1X3MA 2P9KB 3QBWA 5LY3A 3H3OB 2QWOA 3R9PA 1YXQA 1ATSA 4FWLA 3VEYA 1NGJA 2W40A 1DEJA 3CQXA 4K42A 3ZEUB 3O8MA 4H0TB 2Q1NA 4FWQA 2E1YA 4BRKA 1ESVA 4WQ5A 4WYBA 5JICA 2P9NB 5ADXH 3JXUA 5AQRA 1BA0A 1S3XA 5EVZA 2FLOA 3L4IA 4EFHA 3H45C 2P9KA 5E84A 3CETA 3KVGA 4IJAA 1R59O 1NGDA 3VEWA 1SZ2A 2FF6A 3JS6A 3EKSA 3KZBA 5ELZA 4A62A 3ENOA 3MCPA 4BR4A 2PBDA 1ATRA 2P9UA 2V7YA 2VYPA 4HTLA 5FPMA 1HKBA 2FSNA 2W41A 3GDQA 3GE1A 4O8KA 1JCGA 2ASPA 5EOYA 4BGBA 2P9NA 3HM8A 4J8FA 4BR9A 4A2AA 4MO5A 5AZIB 4NB4A 2ITMA 2P9IB 1NLVA 2NRHA 5ADXA 3FGUA 4BROA 3C0BA 4FWRA 3CJ1A 2QM1A 1X9JA 4H03B 1NGEA 4FO0A 1LOTB 5F0XA 3CJCA 4K25A 5AQNA 3W3DA 1J6ZA 3W0LA 2NZTA 4BGAA 3I33A 5CE3A 2E2OA 1V4TA 4EAHD 5KPRA 1BO5O 3LDQA 4WQ4A 4YDUA 4I6MB 2Q97A 4FPAA 1QQNA 3M3ZA 4A61A 3HBTA 3VF6A 2UYTA 5JLHA 1NGAA 2D0OA 3UKUA 1HKGA 3LDPA 2CGKA 2E20A 4GY2B 4BRIA 2Q31A 1GLDG 3LM9A 1TYQB 4B1UB 3FZHA 2YHWA 4CI6A 1X3NA 1KAXA 4BRLA 4K41A 4H5WA 4I6MA 1U6ZA 3WQUA 2P9PA 2I7NA
chains in the Genus database with same CATH superfamily
4BVOA 3OYBA 5C0YA 3AVNA 3CI5A 4J2BA 5JS1A 1QSYA 2YKMA 1KC8O 3EL2A 3NAEA 3CJ7A 1DGKN 1JLCA 4BRHA 4CK2A 1T3VA 4CZHA 3L8BA 2BE2A 3MN9A 2VGMA 3HYFA 3HI0A 3HZ6A 4FWMA 2KFNA 3QEWA 1TKDA 1RBVA 3A2FA 1NK6A 4AM7A 1QS4A 1V4SA 4JNEA 2DY4A 3ZX3A 4CGGA 1KAYA 4CE9A 3BZCA 2QW9A 3KLFA 4KH4A 4FCYA 5CR4A 1FKPA 4JKEA 1HNIA 4DCHA 3CQ8A 3LWMA 1SKRA 3QICA 3VQAA 4JS4A 4FWKA 3RSEB 5AQVA 5F2RA 3TTCA 4JYAK 2P9LA 2YNHA 3NMUA 3ENBA 1Q18A 3MXJA 4IO9L 1QQMA 4JI0K 1B9FA 3EZWA 5C25A 3MWPA 2D0CA 4H4MA 4W5OA 4M7XA 1XI1A 2FBVA 2ASOA 3FZMA 1OH7A 1BL3A 1W7AA 4XH1A 4MDAA 3LWLA 2HHIA 1BGXT 4NYNA 3I8BA 3VEOA 3VESA 5BRHA 1T44A 3CCSN 3OYGA 4CJTA 3P1GA 2D0AA 4DV2K 4DFMA 4FOIA 1IG8A 2P9SB 4OKEA 4JRQA 1CXUA 3AO2A 3MWTA 3O9SA 2J4RA 4FZZA 1BHLA 4JS5A 1VQ8N 2OPPA 3LANA 2YHXA 2OYQA 1IO2A 1NK8A 4BE1A 3RR8A 2VGNA 3VQCA 4LF5K 1LAVA 4G1QA 4JN4A 1YITN 4OO1J 5LMNK 3VQBA 3AVHA 1VSKA 4KFBA 2HBKA 1KLNA 3QEIA 4WCEL 4LF4K 1E4GT 2HNZA 1NG9A 4IWVA 1NK7A 1XC3A 4U7BA 1BCOA 3R8EA 3VQ5A 2VWBA 4LSNA 5BREA 5M1QA 1U2VB 5JENA 1WSJA 3VERA 1J5OA 4YORA 4FLYA 4FJNA 1BI4A 5HLFA 3AAQA 3PY8A 4FW1A 3NF8A 1IKYA 4O8UA 1NJYA 3K57A 3D7EO 4H5TA 3QNOA 1TYQA 4DLEA 4FYDA 3K9KA 1C0MA 3V6DA 1IBKK 5GADP 2E2PA 1IKXA 1XQSC 4CF0A 1SQKA 1ZYQA 1KAZA 4JI1K 5J2MA 4CEAA 2G8FA 4B1XB 1HPZA 3KLIA 1WB9A 1WOQA 3K5LA 3ZX2A 2XY6A 2X74A 1RTJA 1S1VA 2YNFA 4JD2A 3DAWA 4CF9A 4KH5A 2OPQA 3O9QA 1VSLA 3MEEA 3CC4N 4ELTA 1HNWK 3QESA 3CJBA 2WBNA 1S1UA 1HQEA 3CCVN 3HSTB 4KV8A 4CZKA 5DMRA 4Q0BA 4JI8K 1YI2N 1VQ9N 3CMEN 3P4IA 4OPHA 2A3ZA 4CZGA 2G8IA 4YNQA 2GX9A 4M45A 2HF4A 1TAQA 2NLXA 1NGBA 4AHRA 3OS0A 1Q86O 4AHCA 1OVYA 2KQ2A 1WSGA 1RDBA 3HSCA 1RFQA 1TAUA 4ID5A 3HOSA 3V9UA 2GWJA 2E1ZA 4EIAA 3JYTA 1QTMA 4DR2K 4LFAK 3PSFA 3O5BA 5J1EA 4RW9A 4BE7B 2FSJA 1GOBA 2XY5A 1RBTA 1EWRA 3FLCO 5HRPA 2F4VK 4ELUA 1ZBSA 1QHAA 2A1SA 3QB0A 1VQNN 3DLKA 3CMAN 1L3TA 3BP8A 4JI7K 1S6QA 4H0OA 3DRPA 4KPYA 4B08A 3M6GA 3A5NC 3AVLA 4BRPA 1JJ2M 4BR7A 4JI2K 3L4QA 4PKHA 1JXBA 1RTHA 5FLXO 5FPEA 2E88A 1L3SA 5AQUA 3SJHA 2NRXA 5GIPA 3UKUB 3HPOA 2WFBA 2W00A 4AF1A 4CESA 3OYJA 4FZYA 4OGCA 3AO5A 1NBWA 3VQPA 4OKJA 4E7HA 4KHUA 5CY4A 1RT2A 3DOKA 4DS5A 3QLHA 1S1XA 5EXWA 5AQJA 2IVPA 4ZTJA 5HRSA 2FBYA 3OYKA 3HM9A 4FW2A 1VQMN 2A41A 4PUOA 4DFPA 1X1PA 1RDWX 3KKRA 4IDHA 3PV8A 3THYA 2HHHK 3WNEA 3ZETB 4GVEA 3BF1A 1P8ZA 1MDUB 1SV5A 4Z4CA 1T05A 1I94K 4DSKA 3SUQA 4CW7B 4Y1DA 4CK1A 3C65A 1XNQK 5JVHL 2ZQBA 4JKFA 4CZLA 4GVMA 4CIEA 3GOIA 3E66A 3K9JA 2ZJQL 3F9MA 3DJCA 4GV6A 2WUSA 2NRZA 1Q82O 3RRHA 1TK0A 4DTXA 4DSIA 4OPAA 4IOAL 3HXMA 3CPWM 3K0SA 3ULEB 1EQYA 3OVNA 2HHVA 5JMVA 1HR0K 1CZBA 1XUPO 2YHAA 3RVCA 2IVOA 4PKGA 4CJVA 5BR9A 3QEXA 1T6DA 2F7TA 3AY9A 4EZ9A 4DUZK 3U9DA 3OS1A 4WFNL 4XH4A 3OYLA 1SL2A 4DV7K 5DM7L 3E9LA 1X3MA 3QBWA 2O8FB 5M1KA 1YXQA 3P38A 1ATSA 3U3GA 4I2QA 4W5QA 3OBYA 4H0TB 4HVJA 1D5AA 1KFDA 2DFFA 1IBMK 4FJJA 2E1YA 4BRKA 2B4JA 4WQ5A 4C8NA 4JV5K 5JICA 3T1AA 5ADXH 3SAGA 3QETA 1UOCA 3I0RA 3MXIA 2ZE2A 4PHTX 4EFHA 1NNEA 4J2EA 2P9KA 5E84A 3CETA 3UIQA 3VEWA 1HNZK 2FF6A 4KO0A 3EKSA 3ENOA 3MCPA 2VYPA 4HTLA 4DTUA 4NLBA 4Z4HA 4JI5K 4QAGA 3GE1A 3GDQA 3CCLN 2ASPA 4A5AA 5AZIB 1NLVA 1U47A 4R5PA 3CFOA 3FGUA 4E1MA 1NGEA 4FO0A 1LOTB 4KHQA 4H4OA 3E1YA 4BGAA 3KD5E 2GBZA 3I33A 4YHHK 1WBBA 1QHTA 2G8HA 4ILGB 3T69A 1HYVA 4G9ZA 2KZZA 2Q3SA 2NRRA 2Z1IA 3BY5A 1L3VA 2VQFK 4B3OA 2UYTA 3ITHA 3C6UA 5JLHA 5DM6L 1HYZA 3LDPA 2E20A 2D0BA 1KLMA 4BDZA 4B1UB 4B9MA 2YHWA 4CI6A 1KCFA 1KAXA 4BRLA 4I6MA 3WQUA 3E9OA 2P9PA 4BRGA 4FLZA 1KD1O 1EXQA 3ZCMA 3HT3A 1WN7A 2P5GA 4M3YA 2NRTA 3TI0A 3OW2M 4IOCL 4O0JA 2NNWA 1NJXA 4E72A 3VQ6A 4ILJA 3OA9A 1K8KA 1G15A 1BIZA 1HLUA 3IS9A 1HRHA 4LFCK 3O4WA 3VPZA 5BPMA 4X66K 1N5YA 1JLGA 4M63C 3IDHA 4CJSA 5E26A 1JKHA 3U8XA 4PL8A 1RT5A 5I3UA 4UY8O 4NLCA 3Q7CA 5SZTA 3SLCA 4B9VA 3GL1A 1RBUA 4PY5A 2KLAA 3O6WA 5HROA 4DQSA 1NGGA 4HUFA 2O4GA 1D4XA 1CXQA 5LJWA 3QIOA 3O4QA 1MWKA 3I55N 3ZYYX 4DS4A 4H8KA 4BRQA 3C95A 4AM6A 5AZJB 4O5BA 2ZGYA 4FLUA 1NKCA 2BGGA 4B1WB 3MDQA 1BIUA 1U49A 4LF6K 3PX4A 1NGHA 4EZ6A 4AH9A 1I39A 3U3YA 2Q36A 4JKDA 3EEQA 2D5RA 4CERA 1HKCA 2QWLA 1GLFO 3AO4A 3G4SN 1W9HA 3D2FB 4RTFD 4FSVA 4DV4K 2ZJRL 2HW3A 2B6AA 4C8KA 4DSEA 2OTLN 4YOYA 4BC5A 3ZEUA 5AFUH 3VOVA 1SL0A 3SUOA 3OYCA 1JL1A 3NF6A 4GV3A 4C1NI 4DUYK 5KTQA 3KTQA 2O8DA 5IT9O 3S3OA 3MAQA 5HP1A 3NGZA 1RGIA 5AQMA 3NFAA 4JKCA 4CBXA 2QWPA 4FM0A 2CGLA 4N41A 2BH1A 4B9SA 2KHOA 1GLLO 3M8PA 3LALA 3EYZA 1JLEA 4FJ5A 5BRFA 3EE9A 4CEEA 2HF3A 5CYMA 3V9ZA 2QWNA 5J2NA 1D8YA 2C1GA 4AHSA 3T3FA 5AQZA 3EN9A 3WXKA 2I5JA 4DB3A 3V9WA 2ZJPL 4RW8A 4WQ5C 4BWMA 3ZT3A 3P39A 2VQEK 4CF8A 1C0FA 2R7YA 3O1BA 4IZ9A 1TL1A 4CJEA 2IIRA 2B5JA 3SUPA 4LF8K 4HUGA 4CVNE 3SNNA 3O9TA 4FJMA 2RHKA 3VQ9A 5TKYA 1L5UA 3OHRA 5AQPA 2P5OA 1WSHA 3SI6A 1OH6A 2ETJA 4JAXA 1SKSA 5KPZA 3J7ZO 4DV1K 4FJXA 2UUAK 2PY5A 2AA4A 4FK2A 1SS6A 3R3LA 3AVCA 3DOLA 3TSQA 5F1XA 4M7YA 1SAZA 2VG7A 3CERA 3U4LA 1C0GA 3L2UA 4H5VA 4JHDA 4CJQA 3CXCM 2IDOA 5A2QO 4BRDA 3OYIA 4YOWA 1T7PA 4BRMA 3OYFA 1KXPA 4HTUA 4E7KA 2Z1JA 3L2QA 4DKWA 1NKEA 3VTHA 5AQGA 3A5OC 4FWOA 1WNSA 3CFRA 1EKEA 1RT1A 1BOTO 4DFJA 3L2RA 2Y1IA 1KRPA 1YUWA 2RKIA 2BDPA 1YTAA 3AVFA 3M1FA 4N5SA 5GINA 4EP4A 3IMXA 1Q9YA 4E7IA 3K59A 3LDNA 1REVA 5KQDA 3ATUA 3CHWA 3EE8A 3VEVA 4B3MK 4FJ7A 1NK0A 3SAFA 1RTIA 3VA0A 3TAMA 4B1VA 3TU5A 4IKFA 3AA4A 3GBTA 4TSXA 1NM1A 2YJEA 1IH7A 1N34K 2O8EB 4CZMA 4I9LA 5LMUK 2I7PA 3NBPA 1RT4A 3WNFA 4E7LA 4R79A 3MXMA 1ZBIA 1HMVA 2V52B 1VQLN 3SZ2A 4CCHA 3LM2A 5K14A 3DI6A 4PA1A 3S9HA 1ASVA 2CH6A 1N32K 3SCXA 3N4PA 3HP6A 3CC2N 1S9GA 4LFBK 2W6LA 3ZT0A 3TAFA 1Q9XA 2DFHA 1H1VA 2QI2A 4Z4IA 4O5FA 2XHBA 3O9RA 1QE1A 2ASMA 3H1VX 4EHUA 2ZM6K 2UXCK 1NKBA 3SUNA 4DSLA 4FOEA 2HOEA 4CHYA 4FL9A 3T7ZA 5I42A 2PZSA 2KFZA 4CEDA 5I9EB 4N76A 1IJJA 4HCCA 3O80A 3OYNA 4ZTFA 3ZSRA 3J80O 4DTNA 3TPQA 1O1WA 1N6QA 1VRUA 1ZBLA 2YJFA 4LF7K 3GG4A 1BUPA 1X9WA 4A2BA 3FE1A 1NK9A 1A5WA 3SV3A 1NJIO 5J2PA 4F2RA 5AQWA 4DFKA 3VTIA 1NGFA 4KKOA 1RT6A 2AJQA 4AILC 3ASMA 1C0UA 4ZHRA 3CCUN 4BRAA 3D2EB 4PKIA 3ZT1A 4HHTA 4BC2A 4QS7A 1TGOA 4IG0A 2QXLA 3ZETA 4LH4A 2YCHA 2GELA 5KPTA 3WXMB 3AVBA 1FK9A 3TAGA 4M3XA 4FWSA 1QQCA 5C42A 3OJUA 2ZF5O 4DR5K 3PX6A 3AA3A 4CZEA 3VENA 2XO7A 1E3MA 1X9SA 2P9LB 2VCPA 4CFBA 2ZGZA 1TK5A 4YFUA 3VEXA 1QVGM 4C8LA 3CCMN 2RPIA 3Q7BA 3FR0A 4IEEA 4DQPA 2A6AA 1JLAA 3F9KA 3R1XA 1IV0A 4FVUA 3MEGA 5FPNA 1W0HA 1TL3A 5LY3A 3DMJA 2HHTA 3R9PA 4CIFA 4E19A 1NGJA 1DEJA 5CHIA 3O8MA 2HVIA 2Q1NA 4FWQA 1HNVA 3T1HK 1ESVA 2P9NB 4IFEA 4OPKA 2QA4N 5GIOA 4FJKA 1BA0A 1XMOK 1S3XA 4GW6A 1T03A 2UXBK 3QEPA 3H45C 2RE2A 1SZ2A 2BANA 3NH2A 4A62A 3M8QA 3LZJA 3O3FA 4BR4A 4CHOA 5C2FA 2P9UA 3TTFA 2FSNA 3THXA 4O8KA 1VSIA 2VG6A 3PO5A 3HM8A 4J8FA 2XY7A 2HHQA 4MDBA 2KW4A 2F96A 4Z0UA 3VQ8A 5ADXA 4BROA 1U45A 4KAZA 2IOCA 5AQNA 2UU9K 1J6ZA 3QERA 2NZTA 4B8AB 2G8VA 4M42A 3NHGA 5HOOA 4V19S 1V4TA 5JS2A 4WFBL 4BDYA 5C15A 3OYMA 3LDQA 2EX3A 4IG3A 1N36K 3PIPL 1VQON 2YX6A 3JAMO 1RDAA 4ICLA 4LF9K 1BI4B 3VF6A 4X64K 4C8OA 3EY1A 4B9NA 1XWLA 3DLEA 4DV3K 4CEOA 1MU2A 3LM9A 3SBGA 1TYQB 3D45A 1X3NA 1RTDA 1VQ7N 2ATQA 4CHNA 1EETA 2HNYA 1I3AA 1BCMA 4H0VB 3QFUA 1KTQA 4GV9A 1C6VA 3VQ7A 4K43A 1TKZA 4CJUA 1QSSA 4AHUA 2YHYA 4OPJA 3QEVA 1YJWN 1U48A 2FBTA 3HL8A 4CFCA 5FROA 4B9TA 1LWEA 1VSJA 2P1JA 3A0IX 1VQKN 4B1ZA 1J54A 2D4WA 4XH5A 2H3GX 3F73A 3DLGA 4FK0A 3B8AX 5M1PA 3IAYA 3L0QA 4CJ3A 4Z94A 1GLEG 1OH8A 3CG7A 4DTRA 4BG9A 1BU6O 2HBJA 4WQ4C 4YDUC 2EWSA 3FFKB 3C6TA 4KI4A 4B1YB 1BQNA 3RTVA 4M3WA 3THWA 1DT9A 2YI1A 4CIGA 3AA2A 5BR8K 2A40A 1TKXA 5TKWA 4M3ZA 4B3SK 3ENHA 5AR0A 3RMBA 2Q2RA 4LC9B 3WEEB 1SKWA 4XIUA 3EKUA 5CYQA 5AQKA 3DYAA 3IUCA 3MN5A 3PUFA 5AZJA 3WXJA 4OLBA 1GOCA 3DXKB 1NGCA 4JKAA 4KI6A 4B3TK 4IJNA 4FXDA 3C94A 3U9ZA 1C1BA 1YJNN 4WE1A 1HNXK 1JXEA 2O8BA 4O44A 1RBRA 3VGMA 3ZSYA 3A5MC 3J7AP 1WAFA 3LP0A 4CJ7A 4OGEA 4BWJA 3NE6A 2V7ZA 4ILHA 4W5RA 3PO4A 1T6CA 1VHXA 1UWBA 3CIPA 4E0DA 4B9UA 2KKZA 4ISFA 1YIJN 2GTDA 3TABA 5LJVA 3VMFB 4DR4K 2O4IA 5FPDA 4HUEA 3CCRN 4FM1A 2O8CA 3O4NA 4CEFA 4CJKA 5AFUA 4BRNA 1C1CA 3LP1A 3AARA 2P9IA 2E6LA 3FZKA 4E89A 4DSJA 4B9QA 1GLCG 4KHNA 1LCUA 2WC9A 2NUBA 5AQHA 1S1TA 4CJRA 3THYB 4QS8A 4H0YB 4K8ZA 1K73O 3ZX0A 1RNHA 4BR0A 5KRSA 1E4FT 4O0IA 2DFEA 1GLJO 3AO1A 4LSLA 2CH5A 3KWIA 3LPTA 3VEZA 4JKGA 3M8SA 4CJ4A 1LWFA 4FLVA 4CECA 2E4LA 4RW6A 2JWKA 1ZC6A 1NWKA 1HQUA 4MLHA 4X65K 3LDOA 1RT7A 4LH5A 2HBMA 3SQ1A 1M1KO 3CYGA 2QKKA 3TANA 4FVMA 3MN7A 3VETA 4N47A 3CCJN 5CZ2A 1YTUA 2CGJA 4EP5A 4BC4A 2PYLA 2G8UA 2E2NA 3NF9A 1S6PA 4MO4A 4DV0K 3LL3A 4FK4A 1N33K 3ZT4A 4MFBA 3D0PA 3CF5L 3UE5A 3HK2A 1WSIA 1VSHA 2DPNA 1IBLK 1U04A 5BN8A 4DU4A 2QTDA 1HJRA 1CZ9A 1VQ5N 4PL7A 5EU7A 2QWQA 4K8XA 5M1OA 1ILYA 2VWJA 1LWCA 4GNIA 2VG5A 1R0AA 1VSFA 4CGHA 1TKTA 5T7BA 4XEIA 2A42A 3DWLA 3LP2A 3DXMB 4DQRA 4B3RK 2FF3B 4OLAA 3G25A 2OZMA 4C23A 4DTSA 4JKBA 1YVNA 2E8AA 1Y64A 3RSEA 4YOXA 3KIOA 2HMIA 1ATNA 1EWQA 1GOAA 3SMSA 1S9EA 4CK3A 2V51B 3H46O 2QEXN 4NCBA 5FRNA 4OKKA 3ID6A 3P83D 4NCGA 3KHYA 3FZFA 3RR7A 4C8MA 1RDDA 4EHTA 3WT0A 1BG3A 1ASUA 3B6PA 1ZBUA 3O3GA 1Q8IA 1TVRA 5KGXA 2P9SA 3SPZA 1C0TA 4KHWA 2PFUA 3LAMA 3WQTA 4Z4FA 3B6OA 3OTOK 3HVRA 2DTUA 2HB5A 4Y0WA 3AV9A 5AQTA 4JI4K 4OVLA 4PQUA 2HSTA 1KVBA 4RW4A 4YOVA 4DR7K 1S22A 4MLEA 5BPNA 4M3TA 3CQYA 3QFPA 3QO9A 5M1FA 3C7NB 3N4QA 3S5TA 3O1WA 2P9PB 1YVUA 3TTDA 4FWNA 3THVA 4FLTA 4DTOA 4FJIA 3HPGA 2IVNA 3UKRB 3K5OA 3ZSXA 5GAHP 3K5NA 2F9TA 3OJSA 4RW7A 2Q0RA 1MWMA 3H6EA 1K8KB 4UQGA 4E7JA 1IKVA 4BG8A 2OZSA 3IFRA 4NO7A 4F8RA 1VSEA 4H5RA 1U2VA 3KD1E 4CBUA 2UXDK 3WXLA 4KRFA 4DMNA 3L3VA 3CM5A 3NVMA 1Z26A 1D9FA 3AVJA 3J7YP 2KZMA 2IAJA 1HYSA 3OYAA 3SV4A 3V1OA 3ATVA 2FXUA 4BY9C 4F3OA 3TSUA 1FKOA 3VGLA 4JRPA 1TUYA 3S41A 3NVKA 3VGKA 4YY3K 1SL1A 2Z1HA 5HBMA 3IG1A 3D2EA 1VSDA 3R6MA 3J81O 4M41A 3WUHA 4KH6A 1J5EK 2GV9A 1U4BA 4CEBA 3HOTA 3WNGA 4CJWA 4DR6K 2ITGA 1CZAN 3ZT2A 4H5NA 4FJLA 3VQDA 1HJOA 2JLEA 3G71N 4M3UA 3H3OB 4DWIA 4N56A 4CFDA 3HPHA 3PLAA 4DSFA 4K42A 2W40A 3CQXA 3ZEUB 2YNGA 3RRGA 1YJ9N 4NXMK 2Y1JA 4CJPA 4WYBA 4X62K 3VQ4A 3TAPA 4DQIA 3QIPA 3DLHA 3L4IA 3MX2A 4B8CA 2O8DB 2QKBA 4IJAA 3KVGA 1R59O 3G0ZA 3JS6A 3KZBA 5HL7L 5FRMA 3ISNC 3T19A 2V7YA 5FPMA 3MEDA 4I2PA 2NRVA 1JCGA 5EOYA 3DRSA 4BGBA 2P9NA 4Q5VA 4CJLA 3RMDA 4MO5A 4F3TA 4NB4A 2G8WA 1VAZA 1ZBFA 1WLJA 3QNNA 3KLGA 4F4KA 4A5BA 4FWRA 4FJHA 3CJ1A 2QM1A 2X78A 4H03B 5F0XA 3CJCA 4K25A 4CFAA 3W0LA 1WAJA 3KK3A 2E2OA 3OBWA 5KPRA 4WQ4A 3SJJA 4FZXC 4Y1CA 4YDUA 2OPRA 2Q97A 3RWUA 2VWKA 1QQNA 4AQYK 3AO3A 2E6MA 3HRGA 1NJWA 1YF5L 2D0OA 3UKUA 1RDCA 4MQ3A 1HKGA 2CGKA 3AGRA 4GY2B 1TK8A 2Q31A 1GLDG 3KK2A 2A1RA 3DM2A 4GMJB 3K2PA 5MLCQ 3ZSWA 1U6ZA 3PSIA 3TAQA 2I7NA 4GKKK 4BDPA 1O13A 1WBDA 3MK6A 2F8TA 3ZSOA 4IBNA 4CBWA 4FPBA 1WSEA 1QZ6A 4CGIA 4KB1A 2FSKA 3NH1A 2WONA 3IKMA 4FJ9A 4CD3A 4DU3A 3UB5A 4CEQA 3VF2A 5BRDA 3EZ5A 4IEIA 2OANA 3D6RA 4BR2A 4A57A 4L8RB 4JHDB 1WSFA 1A5XA 3BF3A 3ZSZA 1XNRK 3RMCA 1YAGA 5H1SQ 5E41A 2WOMA 3MECA 3MX5A 1M90O 2HBLA 4BREA 4CF1A 2GEMA 3L3UA 4O55A 1HX1A 2X6SA 3NH0A 3EO3A 4KHPK 4DTMA 1L3UA 3ULEA 3SBTA 4CD1A 3G6EN 5AQSA 3AVAA 4DV6K 5C24A 1BQMA 1ZXOA 1DLOA 4ID1A 4Z4GA 3I56N 1NOZA 2Q0UA 3V81A 1QQOA 1EO1A 4A59A 2RF2A 5AQLA 1DKGD 1LV5A 3AVIA 1OVQA 1TUUA 1BISA 1NMDA 1K6YA 5KI6A 4ISEA 4NXNK 2O8FA 1GLBG 2G8KA 4CGFA 3VA3A 4IOXA 3WEEA 4DR1K 3FFIA 1A5VA 2W6KA 2JGUA 2HNDA 4JLHA 1K8AO 4DHYA 5SWMA 3ID8A 4WFAL 4JK8A 4KTZA 3DXKA 3V4IA 1NK5A 2F8SA 1WUAA 1IKWA 4CHPA 3TR8A 1KSPA 3AVGA 2WTUA 3I8DA 4K0KK 1RDUA 4DQQA 1TV6A 1HUXA 2YKNA 3QBXA 3OY9A 4IFVA 5BPLA 4LD0A 3AAPA 3J8AA 5DK5A 1KVCA 4I7FA 1VSMA 5AZIA 3QINA 4FWPA 2GUPA 4H0PA 4DU1A 3TSPA 4IFYA 5AQYA 4GKJK 2BTFA 3OYHA 1ASWA 3H08A 1UAXA 2QWRA 2D0PA 2E5LK 3CFPA 3VF4A 4KHYA 2HHSA 4WF9L 1Z6RA 3CJ9A 3DLBA 4JI3K 5KQ8A 2IGIA 1G99A 3KWGA 3LDLA 5AQXA 3PX0A 3ZLJA 3DLLL 5CZ1A 3K58A 3LDSA 4DTJA 3TARA 4ISGA 5EY4A 1BWFO 3C6AA 3V9XA 4BECA 1EP4A 1NGIA 4DG1A 3S3MA 5JLFA 2E2QA 5HRNA 4JD2B 3A8YA 4QCLA 3QMLA 2OPSA 5AQFA 4KHSA 3FZLA 4RG8A 1JLQA 4C1NK 3L2VA 3VQQA 4CHQA 4IXCA 2LSNA 2OTJN 4BE2A 5BN9A 4LY7A 3BEXA 3KK7A 3RMAA 3LZIA 3SMPA 4F9OA 2BUPA 2A5XA 2XRIA 3HTVA 3SK3A 4DF8A 1UA0A 3L2WA 3T1YK 3BUZB 3AVMA 1Q7YO 1XHZA 3M5RA 1D9DA 3KK1A 5AJ3K 1OH5A 3AGKA 4FLXA 3SYZA 1VQ6N 3KJVA 5C12A 3OYEA 1NU0A 3JSMA 4KREA 2ZWHA 4J2DA 4U67L 1YT3A 1ZBHA 4BEBA 2IS3A 1N8RO 3M8RA 5JVGL 5EX5A 3SAHA 4KTQA 3CD6N 2P51A 3WXIA 4ELVA 2OCEA 5KGWA 1LW0A 4JKHA 4H0XB 1VK0A 3BGRA 2PAVA 3G10A 4OJRA 4JK9A 4RWTA 3F5TA 3SQ4A 1F21A 4W5TA 4KTWA 2FC0A 2P9UB 1FW6A 4DLGA 4M3RA 3P31A 3THXB 3D2FA 3H1QA 1IG9A 3MN6A 4BVPA 5AQOA 3DXMA 1BA1A 2Z1GA 4NYFA 3CC7N 1NK4A 3CJAA 3AA5X 5AQIA 4FM2A 3MMVA 4RCHA 5GAEP 4DV5K 4XJXA 1XHXA 2D1KA 4CEZA 3O9UA 1S72N 5AQQA 3LP3A 1W2BM 4BACA 4JI6K 2KTQA 2YV0X 4BQLA 1OKJA 4DQ8A 3TWHA 2OA8A 1S5JA 4CJFA 1VQPN 1X9MA 1Q81O 1QZ5A 4CZIA 2YNIA 3ALYA 3P5JA 2W42A 4CJ5A 1FJGK 4W5NA 1MA9B 3MCAB 3L6QA 3F2KA 4E3SA 3S3NA 4QS9A 1QVFM 3ZSVA 4KBOA 2GWKA 4BRFA 3K5MA 1KFSA 1JCEA 4E1JA 3TAEA 3IRXA 1P90A 2EHGA 2HHXA 2HVHA 3C6HA 2HMPA 4FJGA 1XC9A 3E9PA 1DTQA 2X6NA 1CLQA 3C7NA 2IC3A 1JCFA 1HPMA 3ZSQA 1LW2A 4IO8A 5D3GA 4YOUA 1ITGA 1SUQA 3UKRA 1FXXA 1NJZA 2HHUA 2AP1A 3PIOL 4JEPA 1Z05A 5IWAK 2QK9A 3KKSA 3CCQN 3ULDA 3CYMA 3SQ2A 3O08A 4HCBA 1B92A 1EX4A 4CZJA 3V9SA 4CZFA 3QDKA 1Y97A 3V1RA 5FDLA 1Z25A 1NOYA 3HO1A 2XY8A 4BQZA 3THWB 1JLBA 1GLAG 1T8EA 1BDGA 1JL2A 2F9WA 4PWDA 3CM6A 3U6FA 2C1IA 3BDPA 1VQ4N 5B8HA 4FLWA 3KLEA 4OX9K 3A5LC 3H3NO 3NGIA 3O3HA 4HWIA 2YHBA 4BRCA 2PYJA 4L3QA 4BC3A 4BR5A 3DLRA 3HJFA 1KVAA 2QWMA 1RILA 5KRTA 4J2AA 2P9KB 1VRTA 2QWOA 3KLHA 4KB0A 3VEYA 4FWLA 1W97L 1JLFA 4JK7A 2ZD1A 2O8BB 4O4GA 4CGDA 4DTPA 3HP9A 2HHWA 3JXUA 3OS2A 5AQRA 5EVZA 2FLOA 3NCIA 1J53A 1NGDA 4IDKA 3WNHA 5ELZA 3CPEA 4F2SA 2PBDA 1ATRA 4Z4EA 1B9DA 5C2DA 1NMNA 1UA1A 1YHQN 1HKBA 2W41A 4NCAA 2JWLA 3SQ0A 3VN5A 2O8CB 4BR9A 3NGYA 4A2AA 2ITMA 2P9IB 2UUCK 4QOZB 3DRRA 2NRHA 1KQSM 1S1WA 1QSLA 3AVKA 4YOTA 3C0BA 2O8EA 3OYDA 5GAGP 3LPUA 1X9JA 5HRRA 1RCHA 1LAWA 3LAKA 1K9MO 2RN2A 3W3DA 2GUIA 4AHVA 3E01A 5CE3A 4DR3K 4EAHD 1XMQK 2UUBK 1DTTA 1BO5O 4I9QA 4FJ8A 4I6MB 4FPAA 4E1NA 3M3ZA 4DF4A 3SPYA 4A61A 4CF2A 3NF7A 3V1QA 3HBTA 4CHZA 1NGAA 4AHTA 2QXFA 4BRIA 4CGJA 1J9AA 3HVTA 4B9LA 4JKGB 3VQEA 1RBSA 3FZHA 5J2QA 5C10A 3NDKA 2NRWA 3BZKA 1C1AA 1RT3A 4BE0A 3CCEN 5M1NA 5LL6Z 3I0SA 4K41A 4H5WA 2FBXA
chains in the Genus database with same CATH topology
1KD1O 4BVOA 4H0VB 5C0YA 3QFUA 1O13A 2NRTA 4GV9A 3CI5A 3OW2M 3MK6A 4K43A 4IOCL 1KC8O 2NNWA 3EL2A 4CBWA 4FPBA 2YHYA 1QZ6A 1YJWN 4ILJA 3OA9A 3CJ7A 1K8KA 1DGKN 2FSKA 3IKMA 1HLUA 4CD3A 4BRHA 3UB5A 3O4WA 1T3VA 3VPZA 4CZHA 3VF2A 5BRDA 5BPMA 3A0IX 4IEIA 4M63C 1VQKN 4B1ZA 2OANA 3D6RA 3IDHA 2D4WA 4XH5A 4A57A 4JHDB 4BR2A 3BF3A 5E26A 2H3GX 3MN9A 2VGMA 4PL8A 3U8XA 4UY8O 1YAGA 4NLCA 3Q7CA 5H1SQ 3B8AX 3HI0A 3HZ6A 3GL1A 4FWMA 3SLCA 5M1PA 2KLAA 3O6WA 3MX5A 1M90O 2HBLA 4BREA 1NGGA 2GEMA 3L0QA 1D4XA 4AM7A 4Z94A 1GLEG 1HX1A 1V4SA 4JNEA 5LJWA 3ZX3A 1MWKA 1KAYA 3EO3A 3I55N 3ZYYX 2QW9A 4BG9A 1BU6O 4KH4A 2HBJA 4WQ4C 4BRQA 3ULEA 5CR4A 4YDUC 2EWSA 4JKEA 3FFKB 3SBTA 4AM6A 5AZJB 4CD1A 3G6EN 5AQSA 4B1YB 4DCHA 2ZGYA 3QICA 1DT9A 1ZXOA 2YI1A 4B1WB 2A40A 5TKWA 3MDQA 4FWKA 3RSEB 1NGHA 5AQVA 5F2RA 3TTCA 3I56N 2P9LA 3ENHA 2Q0UA 3NMUA 1QQOA 5AR0A 2Q2RA 4LC9B 3WEEB 1EO1A 3ENBA 2Q36A 4A59A 1Q18A 4JKDA 4IO9L 1QQMA 3EKUA 3EZWA 5AQLA 3MWPA 1HKCA 1DKGD 1GLFO 2QWLA 3G4SN 5AQKA 3D2FB 3IUCA 3MN5A 5AZJA 4M7XA 1TUUA 3WXJA 4RTFD 4FSVA 2ASOA 3FZMA 3DXKB 2ZJRL 1NGCA 1NMDA 4JKAA 4XH1A 4MDAA 4IJNA 2OTLN 4ISEA 1GLBG 3U9ZA 3I8BA 3VEOA 4YOYA 3VESA 4IOXA 5BRHA 4BC5A 1YJNN 3ZEUA 3WEEA 1T44A 5AFUH 3CCSN 3VOVA 3VGMA 3A5MC 1K8AO 4CJ7A 4DHYA 4FOIA 1IG8A 2P9SB 3ID8A 4GV3A 4C1NI 4WFAL 2V7ZA 4ILHA 3DXKA 4JK8A 1T6CA 3MWTA 3O9SA 1WUAA 2J4RA 3CIPA 2KKZA 1VQ8N 4ISFA 1YIJN 1RGIA 1RDUA 5AQMA 1HUXA 2YHXA 2GTDA 3QBXA 5BPLA 5LJVA 4JKCA 4CBXA 3VMFB 5FPDA 3CCRN 2QWPA 3AAPA 3J8AA 2VGNA 2CGLA 2BH1A 4BRNA 5AFUA 5AZIA 4JN4A 1YITN 4OO1J 2KHOA 1GLLO 2P9IA 3AARA 4FWPA 2GUPA 4H0PA 3TSPA 2HBKA 5BRFA 5AQYA 4WCEL 3EE9A 3FZKA 4B9QA 2BTFA 2HF3A 1E4GT 1GLCG 2QWRA 1LCUA 2D0PA 2WC9A 4IWVA 3VF4A 5AQHA 1XC3A 4U7BA 2QWNA 2C1GA 4QS8A 4WF9L 3R8EA 1Z6RA 2VWBA 5AQZA 3CJ9A 5M1QA 3EN9A 3WXKA 5BREA 5KQ8A 1G99A 4H0YB 1U2VB 3KWGA 3LDLA 4DB3A 2ZJPL 5AQXA 3VERA 4WQ5C 4YORA 1K73O 3P39A 3AAQA 3ZX0A 3DLLL 1C0FA 3O1BA 4ISGA 4BR0A 1E4FT 4IZ9A 5EY4A 1BWFO 2IIRA 1GLJO 4O8UA 3C6AA 3D7EO 4H5TA 2CH5A 3KWIA 4BECA 3VEZA 1TYQA 4JKGA 3K9KA 1NGIA 3O9TA 5JLFA 2RHKA 2E2QA 2JWKA 1ZC6A 1NWKA 3A8YA 4JD2B 5TKYA 3QMLA 4MLHA 3LDOA 5AQFA 3OHRA 3FZLA 2E2PA 5AQPA 2HBMA 5GADP 1M1KO 4C1NK 4JAXA 1XQSC 5KPZA 3J7ZO 1SQKA 4IXCA 3MN7A 1KAZA 3VETA 2OTJN 5BN9A 4B1XB 3CCJN 3BEXA 3KK7A 2AA4A 2CGJA 1SS6A 3R3LA 4BC4A 3SMPA 1WOQA 4F9OA 2BUPA 3ZX2A 2A5XA 2E2NA 3HTVA 3SK3A 3TSQA 4MO4A 5F1XA 3BUZB 3LL3A 1SAZA 4M7YA 4JD2A 3CERA 3DAWA 4KH5A 3U4LA 1C0GA 3O9QA 4H5VA 4JHDA 1Q7YO 3CC4N 3M5RA 3CXCM 3CF5L 3AGKA 1VQ6N 5C12A 3UE5A 4BRDA 3CJBA 4YOWA 2WBNA 2DPNA 2ZWHA 4BRMA 3CCVN 5BN8A 1KXPA 4U67L 4CZKA 4BEBA 2QTDA 1N8RO 5JVGL 5EX5A 1YI2N 1VQ5N 4PL7A 2QWQA 3SAHA 5M1OA 1VQ9N 3CMEN 3WXIA 4DKWA 3CD6N 3VTHA 1ILYA 3P4IA 4OPHA 2A3ZA 4GNIA 3A5OC 4FWOA 5AQGA 4CZGA 2GX9A 2HF4A 2NLXA 4JKHA 4H0XB 1NGBA 2A42A 3DWLA 4XEIA 3DXMB 1BOTO 1Q86O 2FF3B 2PAVA 3G25A 4C23A 1OVYA 1YUWA 3M1FA 4JKBA 5GINA 1YVNA 2E8AA 1Y64A 3IMXA 4JK9A 3RSEA 4RWTA 4YOXA 3LDNA 1ATNA 3F5TA 5KQDA 3ATUA 3CHWA 3EE8A 3VEVA 3HSCA 1RFQA 3SMSA 2V51B 3HOSA 2P9UB 3SAFA 3H46O 2GWJA 2QEXN 3P31A 2E1ZA 4EIAA 4B1VA 3ID6A 3D2FA 3H1QA 3TU5A 3MN6A 4BVPA 5AQOA 3DXMA 4BRGA 3KHYA 3O5BA 1BA1A 3GBTA 3FZFA 3CC7N 3CJAA 4BE7B 2FSJA 5AQIA 1NM1A 2YJEA 4CZMA 3FLCO 3MMVA 4RCHA 4EHTA 2I7PA 3WT0A 5GAEP 4XJXA 4R79A 2D1KA 1BG3A 3O9UA 1S72N 2V52B 1ZBSA 5AQQA 1VQLN 1QHAA 1W2BM 3QB0A 3LM2A 1VQNN 3CMAN 2CH6A 3BP8A 4H0OA 4BQLA 1OKJA 2P9SA 3N4PA 3CC2N 3M6GA 3A5NC 2PFUA 4DQ8A 3WQTA 1VQPN 4BRPA 1JJ2M 4BR7A 3L4QA 4PKHA 1H1VA 2QI2A 5FPEA 4O5FA 1Q81O 3O9RA 2E88A 5AQUA 4Y0WA 1QZ5A 4CZIA 5AQTA 3SJHA 2ASMA 3H1VX 4EHUA 2NRXA 5GIPA 3UKUB 2WFBA 2W00A 4AF1A 2HSTA 4YOVA 1S22A 4MLEA 5BPNA 1NBWA 4FOEA 2HOEA 4FL9A 3CQYA 1MA9B 3T7ZA 3MCAB 3L6QA 3QFPA 5M1FA 3C7NB 3N4QA 3O1WA 2P9PB 3F2KA 3TTDA 5I9EB 4QS9A 1QVFM 4FWNA 5EXWA 5AQJA 1IJJA 2IVPA 4KBOA 3O80A 2GWKA 2IVNA 3UKRB 4BRFA 1VQMN 2A41A 3TPQA 5GAHP 1JCEA 2F9TA 4E1JA 1RDWX 1P90A 2Q0RA 2YJFA 1MWMA 3H6EA 1K8KB 4IDHA 3GG4A 3C6HA 1BUPA 4A2BA 3FE1A 2HMPA 3E9PA 3ZETB 4GVEA 3BF1A 4BG8A 1NJIO 1P8ZA 1MDUB 3IFRA 4NO7A 5AQWA 4H5RA 1U2VA 3VTIA 1NGFA 3C7NA 4CBUA 3WXLA 1JCFA 1HPMA 3C65A 5JVHL 4JKFA 4CZLA 4IO8A 4YOUA 3CCUN 3UKRA 3GOIA 3E66A 3NVMA 2AP1A 3K9JA 2ZJQL 4BRAA 3D2EB 3F9MA 4PKIA 3DJCA 3PIOL 4JEPA 4QS7A 4BC2A 1Z05A 4GV6A 2QXLA 2WUSA 3ZETA 3CCQN 2NRZA 1Q82O 2YCHA 3ATVA 2FXUA 2GELA 5KPTA 4BY9C 3WXMB 3TSUA 3O08A 4OPAA 4IOAL 4CZJA 3VGLA 3CPWM 1TUYA 4CZFA 3ULEB 4FWSA 1EQYA 3S41A 3QDKA 3NVKA 5JMVA 3VGKA 1XUPO 2ZF5O 4BQZA 1GLAG 4CZEA 3VENA 3D2EA 3RVCA 2IVOA 4PKGA 1BDGA 2F9WA 3R6MA 2C1IA 3WUHA 4KH6A 5BR9A 2P9LB 1T6DA 1VQ4N 2VCPA 5B8HA 2ZGZA 2F7TA 3A5LC 3AY9A 3H3NO 3HOTA 3VEXA 1QVGM 3U9DA 3CCMN 3Q7BA 4HWIA 4WFNL 3FR0A 4IEEA 4XH4A 2A6AA 4BRCA 5DM7L 3R1XA 1CZAN 4L3QA 4BC3A 4BR5A 4H5NA 4FVUA 5FPNA 2QWMA 3E9LA 1HJOA 1X3MA 2P9KB 3QBWA 5LY3A 3G71N 3H3OB 2QWOA 3R9PA 5M1KA 1YXQA 3P38A 3PLAA 1ATSA 4FWLA 3VEYA 1NGJA 2W40A 1DEJA 3CQXA 4K42A 3OBYA 1W97L 3O8MA 4H0TB 4JK7A 3ZEUB 5CHIA 2Q1NA 4FWQA 1YJ9N 2E1YA 4BRKA 1ESVA 4WQ5A 4WYBA 5JICA 2P9NB 4IFEA 5ADXH 3SAGA 3JXUA 2QA4N 5GIOA 5AQRA 1BA0A 1S3XA 5EVZA 2FLOA 3L4IA 3MX2A 4PHTX 4EFHA 3H45C 2P9KA 5E84A 2RE2A 3CETA 3KVGA 1R59O 1NGDA 4IJAA 1SZ2A 2FF6A 3VEWA 3JS6A 3EKSA 3KZBA 5ELZA 3CPEA 4A62A 5HL7L 3ENOA 3MCPA 4BR4A 2PBDA 1ATRA 5C2FA 2P9UA 2V7YA 2VYPA 4HTLA 5FPMA 4NLBA 3TTFA 5C2DA 1YHQN 1HKBA 2FSNA 2W41A 3GDQA 3GE1A 2NRVA 4O8KA 3CCLN 1JCGA 2ASPA 5EOYA 4A5AA 2JWLA 4BGBA 2P9NA 3HM8A 4J8FA 4MDBA 4BR9A 4A2AA 4MO5A 5AZIB 4NB4A 2ITMA 2P9IB 1VAZA 1NLVA 2NRHA 1KQSM 5ADXA 3FGUA 4YOTA 3C0BA 4FWRA 4A5BA 4BROA 3CJ1A 5GAGP 2QM1A 1X9JA 4H03B 1NGEA 4FO0A 1LOTB 1K9MO 5F0XA 3CJCA 4K25A 5AQNA 3W3DA 3E1YA 1J6ZA 3W0LA 2NZTA 4BGAA 3I33A 5CE3A 2E2OA 5HOOA 1V4TA 4EAHD 3OBWA 4WFBL 5KPRA 4ILGB 1BO5O 3T69A 3LDQA 4WQ4A 5C15A 4YDUA 3PIPL 1VQON 2YX6A 4I6MB 2Q97A 4G9ZA 4FPAA 1QQNA 3M3ZA 4A61A 2NRRA 3HBTA 3VF6A 2UYTA 5JLHA 1NGAA 3HRGA 1YF5L 2D0OA 3UKUA 5DM6L 1HKGA 3LDPA 2CGKA 2E20A 3AGRA 4GY2B 4BRIA 2Q31A 1GLDG 3LM9A 3SBGA 1TYQB 4JKGB 4B1UB 3FZHA 2YHWA 4CI6A 1X3NA 2NRWA 5C10A 1VQ7N 1KAXA 4BRLA 3CCEN 5M1NA 5MLCQ 4K41A 4H5WA 4I6MA 1U6ZA 3WQUA 3E9OA 2P9PA 2I7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BVO A;  4H0V B;  3QFU A;  3CI5 A;  3MK6 A;  4K43 A;  3EL2 A;  4CBW A;  4FPB A;  2YHY A;  1QZ6 A;  3CJ7 A;  1K8K A;  1DGK N;  2FSK A;  1HLU A;  4CD3 A;  4BRH A;  3UB5 A;  3O4W A;  3VPZ A;  4CZH A;  3VF2 A;  5BRD A;  5BPM A;  3A0I X;  4M63 C;  4B1Z A;  2OAN A;  3IDH A;  4XH5 A;  2D4W A;  4BR2 A;  4JHD B;  3BF3 A;  5E26 A;  2H3G X;  3MN9 A;  4PL8 A;  3U8X A;  1YAG A;  3B8A X;  3HI0 A;  3HZ6 A;  3GL1 A;  4FWM A;  3SLC A;  3O6W A;  4BRE A;  1NGG A;  2GEM A;  3L0Q A;  1D4X A;  4AM7 A;  4Z94 A;  1GLE G;  1HX1 A;  1V4S A;  4JNE A;  5LJW A;  3ZX3 A;  1MWK A;  1KAY A;  3EO3 A;  2QW9 A;  4BG9 A;  1BU6 O;  4WQ4 C;  4BRQ A;  3ULE A;  4YDU C;  2EWS A;  4CD1 A;  3FFK B;  4AM6 A;  5AZJ B;  5AQS A;  4B1Y B;  4DCH A;  2ZGY A;  3QIC A;  1ZXO A;  2YI1 A;  4B1W B;  2A40 A;  3MDQ A;  4FWK A;  3RSE B;  1NGH A;  5AQV A;  5F2R A;  2P9L A;  3ENH A;  2Q0U A;  1QQO A;  5AR0 A;  2Q2R A;  4LC9 B;  3WEE B;  2Q36 A;  1Q18 A;  1QQM A;  3EKU A;  3EZW A;  5AQL A;  1HKC A;  1DKG D;  1GLF O;  2QWL A;  5AQK A;  3D2F B;  3IUC A;  3MN5 A;  5AZJ A;  4M7X A;  1TUU A;  3WXJ A;  4RTF D;  4FSV A;  2ASO A;  3FZM A;  3DXK B;  1NGC A;  1NMD A;  4XH1 A;  4IJN A;  4ISE A;  1GLB G;  3U9Z A;  3I8B A;  3VEO A;  3VES A;  5BRH A;  4BC5 A;  3ZEU A;  3WEE A;  1T44 A;  5AFU H;  3VOV A;  3VGM A;  3A5M C;  4CJ7 A;  4DHY A;  4FOI A;  1IG8 A;  2P9S B;  3ID8 A;  2V7Z A;  3DXK A;  1T6C A;  1WUA A;  2J4R A;  3CIP A;  4ISF A;  1RGI A;  5AQM A;  1HUX A;  2YHX A;  2GTD A;  3QBX A;  5BPL A;  5LJV A;  4CBX A;  5FPD A;  2QWP A;  3AAP A;  3J8A A;  2CGL A;  5AFU A;  4BRN A;  5AZI A;  4JN4 A;  2KHO A;  1GLL O;  2P9I A;  3AAR A;  4FWP A;  2GUP A;  4H0P A;  5BRF A;  5AQY A;  3FZK A;  4B9Q A;  2BTF A;  2HF3 A;  1E4G T;  1GLC G;  2QWR A;  1LCU A;  2D0P A;  4IWV A;  3VF4 A;  5AQH A;  1XC3 A;  2QWN A;  4QS8 A;  3R8E A;  1Z6R A;  2VWB A;  5AQZ A;  3CJ9 A;  5BRE A;  3EN9 A;  3WXK A;  5KQ8 A;  1G99 A;  4H0Y B;  1U2V B;  3LDL A;  4DB3 A;  5AQX A;  3VER A;  4WQ5 C;  3AAQ A;  3ZX0 A;  1C0F A;  3O1B A;  4ISG A;  4BR0 A;  1E4F T;  4IZ9 A;  5EY4 A;  1BWF O;  2IIR A;  1GLJ O;  3D7E O;  4H5T A;  2CH5 A;  3VEZ A;  1TYQ A;  1NGI A;  5JLF A;  2E2Q A;  1ZC6 A;  1NWK A;  3A8Y A;  4JD2 B;  5TKY A;  3QML A;  4MLH A;  3LDO A;  5AQF A;  3OHR A;  3FZL A;  2E2P A;  5AQP A;  4JAX A;  1XQS C;  5KPZ A;  1SQK A;  4IXC A;  3MN7 A;  1KAZ A;  3VET A;  5BN9 A;  4B1X B;  3BEX A;  2AA4 A;  2CGJ A;  4BC4 A;  3SMP A;  1WOQ A;  4F9O A;  2BUP A;  3ZX2 A;  2A5X A;  2E2N A;  3HTV A;  3SK3 A;  4MO4 A;  5F1X A;  3BUZ B;  3LL3 A;  1SAZ A;  4M7Y A;  4JD2 A;  3CER A;  3DAW A;  3U4L A;  1C0G A;  4H5V A;  4JHD A;  3UE5 A;  4BRD A;  3CJB A;  2DPN A;  2ZWH A;  4BRM A;  5BN8 A;  1KXP A;  4CZK A;  5EX5 A;  4PL7 A;  2QWQ A;  3WXI A;  3P4I A;  2A3Z A;  4GNI A;  3A5O C;  4FWO A;  5AQG A;  4CZG A;  2HF4 A;  2NLX A;  4H0X B;  1NGB A;  2A42 A;  3DWL A;  4XEI A;  3DXM B;  1BOT O;  2FF3 B;  2PAV A;  3G25 A;  4C23 A;  1YUW A;  3M1F A;  1YVN A;  2E8A A;  1Y64 A;  3IMX A;  3RSE A;  4RWT A;  3LDN A;  1ATN A;  5KQD A;  3ATU A;  3CHW A;  3VEV A;  3HSC A;  1RFQ A;  3SMS A;  2V51 B;  2P9U B;  3H46 O;  2GWJ A;  2E1Z A;  4EIA A;  4B1V A;  3D2F A;  3H1Q A;  3TU5 A;  3MN6 A;  4BVP A;  5AQO A;  3DXM A;  4BRG A;  3KHY A;  3O5B A;  1BA1 A;  3GBT A;  3FZF A;  3CJA A;  2FSJ A;  5AQI A;  1NM1 A;  2YJE A;  4CZM A;  3FLC O;  3MMV A;  4RCH A;  4EHT A;  2I7P A;  3WT0 A;  2D1K A;  1BG3 A;  2V52 B;  1ZBS A;  5AQQ A;  1QHA A;  3QB0 A;  3LM2 A;  2CH6 A;  3BP8 A;  4H0O A;  4BQL A;  1OKJ A;  2P9S A;  3M6G A;  3A5N C;  4DQ8 A;  3WQT A;  4BRP A;  4BR7 A;  4PKH A;  1H1V A;  5FPE A;  4O5F A;  2E88 A;  5AQU A;  4Y0W A;  1QZ5 A;  4CZI A;  5AQT A;  3SJH A;  2ASM A;  3H1V X;  4EHU A;  3UKU B;  1S22 A;  4MLE A;  5BPN A;  1NBW A;  4FOE A;  2HOE A;  4FL9 A;  3CQY A;  1MA9 B;  3L6Q A;  3QFP A;  3C7N B;  3O1W A;  2P9P B;  5I9E B;  4QS9 A;  4FWN A;  5EXW A;  5AQJ A;  1IJJ A;  2IVP A;  4KBO A;  3O80 A;  2GWK A;  2IVN A;  3UKR B;  4BRF A;  2A41 A;  3TPQ A;  1JCE A;  2F9T A;  4E1J A;  1RDW X;  2Q0R A;  2YJF A;  1MWM A;  3H6E A;  1K8K B;  3GG4 A;  1BUP A;  4A2B A;  3FE1 A;  2HMP A;  3ZET B;  3BF1 A;  4BG8 A;  1P8Z A;  1MDU B;  3IFR A;  4NO7 A;  5AQW A;  4H5R A;  1U2V A;  1NGF A;  3C7N A;  4CBU A;  3WXL A;  1JCF A;  1HPM A;  4CZL A;  4IO8 A;  3UKR A;  3GOI A;  2AP1 A;  4BRA A;  3D2E B;  3F9M A;  4PKI A;  3DJC A;  4BC2 A;  4QS7 A;  1Z05 A;  2QXL A;  2WUS A;  3ZET A;  2YCH A;  3ATV A;  2FXU A;  2GEL A;  5KPT A;  3O08 A;  4CZJ A;  3VGL A;  1TUY A;  4CZF A;  3ULE B;  4FWS A;  1EQY A;  3S41 A;  3QDK A;  5JMV A;  3VGK A;  1XUP O;  2ZF5 O;  4BQZ A;  1GLA G;  4CZE A;  3VEN A;  3D2E A;  2IVO A;  4PKG A;  1BDG A;  2F9W A;  3R6M A;  3WUH A;  5BR9 A;  2P9L B;  1T6D A;  2VCP A;  5B8H A;  2ZGZ A;  3A5L C;  3AY9 A;  3H3N O;  3VEX A;  3U9D A;  4HWI A;  3FR0 A;  4XH4 A;  2A6A A;  4BRC A;  1CZA N;  4L3Q A;  4BC3 A;  4BR5 A;  4H5N A;  5FPN A;  2QWM A;  1HJO A;  1X3M A;  2P9K B;  3QBW A;  5LY3 A;  3H3O B;  2QWO A;  3R9P A;  1YXQ A;  1ATS A;  4FWL A;  3VEY A;  1NGJ A;  2W40 A;  1DEJ A;  3CQX A;  4K42 A;  3ZEU B;  3O8M A;  4H0T B;  2Q1N A;  4FWQ A;  2E1Y A;  4BRK A;  1ESV A;  4WQ5 A;  4WYB A;  5JIC A;  2P9N B;  5ADX H;  3JXU A;  5AQR A;  1BA0 A;  1S3X A;  5EVZ A;  2FLO A;  3L4I A;  4EFH A;  3H45 C;  2P9K A;  5E84 A;  3CET A;  3KVG A;  4IJA A;  1R59 O;  1NGD A;  3VEW A;  1SZ2 A;  2FF6 A;  3JS6 A;  3EKS A;  3KZB A;  5ELZ A;  4A62 A;  3ENO A;  3MCP A;  4BR4 A;  2PBD A;  1ATR A;  2P9U A;  2V7Y A;  2VYP A;  4HTL A;  5FPM A;  1HKB A;  2FSN A;  2W41 A;  3GDQ A;  3GE1 A;  4O8K A;  1JCG A;  2ASP A;  5EOY A;  4BGB A;  2P9N A;  3HM8 A;  4J8F A;  4BR9 A;  4A2A A;  4MO5 A;  5AZI B;  4NB4 A;  2ITM A;  2P9I B;  1NLV A;  2NRH A;  5ADX A;  3FGU A;  4BRO A;  3C0B A;  4FWR A;  3CJ1 A;  2QM1 A;  1X9J A;  4H03 B;  1NGE A;  4FO0 A;  1LOT B;  5F0X A;  3CJC A;  4K25 A;  5AQN A;  3W3D A;  1J6Z A;  3W0L A;  2NZT A;  4BGA A;  3I33 A;  5CE3 A;  2E2O A;  1V4T A;  4EAH D;  5KPR A;  1BO5 O;  3LDQ A;  4WQ4 A;  4YDU A;  4I6M B;  2Q97 A;  4FPA A;  1QQN A;  3M3Z A;  4A61 A;  3HBT A;  3VF6 A;  2UYT A;  5JLH A;  1NGA A;  2D0O A;  3UKU A;  1HKG A;  3LDP A;  2CGK A;  2E20 A;  4GY2 B;  4BRI A;  2Q31 A;  1GLD G;  3LM9 A;  1TYQ B;  4B1U B;  3FZH A;  2YHW A;  4CI6 A;  1X3N A;  1KAX A;  4BRL A;  4K41 A;  4H5W A;  4I6M A;  1U6Z A;  3WQU A;  2P9P A;  2I7N A; 
#chains in the Genus database with same CATH topology
 4BVO A;  3OYB A;  5C0Y A;  3AVN A;  3CI5 A;  4J2B A;  5JS1 A;  1QSY A;  2YKM A;  1KC8 O;  3EL2 A;  3NAE A;  3CJ7 A;  1DGK N;  1JLC A;  4BRH A;  4CK2 A;  1T3V A;  4CZH A;  3L8B A;  2BE2 A;  3MN9 A;  2VGM A;  3HYF A;  3HI0 A;  3HZ6 A;  4FWM A;  2KFN A;  3QEW A;  1TKD A;  1RBV A;  3A2F A;  1NK6 A;  4AM7 A;  1QS4 A;  1V4S A;  4JNE A;  2DY4 A;  3ZX3 A;  4CGG A;  1KAY A;  4CE9 A;  3BZC A;  2QW9 A;  3KLF A;  4KH4 A;  4FCY A;  5CR4 A;  1FKP A;  4JKE A;  1HNI A;  4DCH A;  3CQ8 A;  3LWM A;  1SKR A;  3QIC A;  3VQA A;  4JS4 A;  4FWK A;  3RSE B;  5AQV A;  5F2R A;  3TTC A;  4JYA K;  2P9L A;  2YNH A;  3NMU A;  3ENB A;  1Q18 A;  3MXJ A;  4IO9 L;  1QQM A;  4JI0 K;  1B9F A;  3EZW A;  5C25 A;  3MWP A;  2D0C A;  4H4M A;  4W5O A;  4M7X A;  1XI1 A;  2FBV A;  2ASO A;  3FZM A;  1OH7 A;  1BL3 A;  1W7A A;  4XH1 A;  4MDA A;  3LWL A;  2HHI A;  1BGX T;  4NYN A;  3I8B A;  3VEO A;  3VES A;  5BRH A;  1T44 A;  3CCS N;  3OYG A;  4CJT A;  3P1G A;  2D0A A;  4DV2 K;  4DFM A;  4FOI A;  1IG8 A;  2P9S B;  4OKE A;  4JRQ A;  1CXU A;  3AO2 A;  3MWT A;  3O9S A;  2J4R A;  4FZZ A;  1BHL A;  4JS5 A;  1VQ8 N;  2OPP A;  3LAN A;  2YHX A;  2OYQ A;  1IO2 A;  1NK8 A;  4BE1 A;  3RR8 A;  2VGN A;  3VQC A;  4LF5 K;  1LAV A;  4G1Q A;  4JN4 A;  1YIT N;  4OO1 J;  5LMN K;  3VQB A;  3AVH A;  1VSK A;  4KFB A;  2HBK A;  1KLN A;  3QEI A;  4WCE L;  4LF4 K;  1E4G T;  2HNZ A;  1NG9 A;  4IWV A;  1NK7 A;  1XC3 A;  4U7B A;  1BCO A;  3R8E A;  3VQ5 A;  2VWB A;  4LSN A;  5BRE A;  5M1Q A;  1U2V B;  5JEN A;  1WSJ A;  3VER A;  1J5O A;  4YOR A;  4FLY A;  4FJN A;  1BI4 A;  5HLF A;  3AAQ A;  3PY8 A;  4FW1 A;  3NF8 A;  1IKY A;  4O8U A;  1NJY A;  3K57 A;  3D7E O;  4H5T A;  3QNO A;  1TYQ A;  4DLE A;  4FYD A;  3K9K A;  1C0M A;  3V6D A;  1IBK K;  5GAD P;  2E2P A;  1IKX A;  1XQS C;  4CF0 A;  1SQK A;  1ZYQ A;  1KAZ A;  4JI1 K;  5J2M A;  4CEA A;  2G8F A;  4B1X B;  1HPZ A;  3KLI A;  1WB9 A;  1WOQ A;  3K5L A;  3ZX2 A;  2XY6 A;  2X74 A;  1RTJ A;  1S1V A;  2YNF A;  4JD2 A;  3DAW A;  4CF9 A;  4KH5 A;  2OPQ A;  3O9Q A;  1VSL A;  3MEE A;  3CC4 N;  4ELT A;  1HNW K;  3QES A;  3CJB A;  2WBN A;  1S1U A;  1HQE A;  3CCV N;  3HST B;  4KV8 A;  4CZK A;  5DMR A;  4Q0B A;  4JI8 K;  1YI2 N;  1VQ9 N;  3CME N;  3P4I A;  4OPH A;  2A3Z A;  4CZG A;  2G8I A;  4YNQ A;  2GX9 A;  4M45 A;  2HF4 A;  1TAQ A;  2NLX A;  1NGB A;  4AHR A;  3OS0 A;  1Q86 O;  4AHC A;  1OVY A;  2KQ2 A;  1WSG A;  1RDB A;  3HSC A;  1RFQ A;  1TAU A;  4ID5 A;  3HOS A;  3V9U A;  2GWJ A;  2E1Z A;  4EIA A;  3JYT A;  1QTM A;  4DR2 K;  4LFA K;  3PSF A;  3O5B A;  5J1E A;  4RW9 A;  4BE7 B;  2FSJ A;  1GOB A;  2XY5 A;  1RBT A;  1EWR A;  3FLC O;  5HRP A;  2F4V K;  4ELU A;  1ZBS A;  1QHA A;  2A1S A;  3QB0 A;  1VQN N;  3DLK A;  3CMA N;  1L3T A;  3BP8 A;  4JI7 K;  1S6Q A;  4H0O A;  3DRP A;  4KPY A;  4B08 A;  3M6G A;  3A5N C;  3AVL A;  4BRP A;  1JJ2 M;  4BR7 A;  4JI2 K;  3L4Q A;  4PKH A;  1JXB A;  1RTH A;  5FLX O;  5FPE A;  2E88 A;  1L3S A;  5AQU A;  3SJH A;  2NRX A;  5GIP A;  3UKU B;  3HPO A;  2WFB A;  2W00 A;  4AF1 A;  4CES A;  3OYJ A;  4FZY A;  4OGC A;  3AO5 A;  1NBW A;  3VQP A;  4OKJ A;  4E7H A;  4KHU A;  5CY4 A;  1RT2 A;  3DOK A;  4DS5 A;  3QLH A;  1S1X A;  5EXW A;  5AQJ A;  2IVP A;  4ZTJ A;  5HRS A;  2FBY A;  3OYK A;  3HM9 A;  4FW2 A;  1VQM N;  2A41 A;  4PUO A;  4DFP A;  1X1P A;  1RDW X;  3KKR A;  4IDH A;  3PV8 A;  3THY A;  2HHH K;  3WNE A;  3ZET B;  4GVE A;  3BF1 A;  1P8Z A;  1MDU B;  1SV5 A;  4Z4C A;  1T05 A;  1I94 K;  4DSK A;  3SUQ A;  4CW7 B;  4Y1D A;  4CK1 A;  3C65 A;  1XNQ K;  5JVH L;  2ZQB A;  4JKF A;  4CZL A;  4GVM A;  4CIE A;  3GOI A;  3E66 A;  3K9J A;  2ZJQ L;  3F9M A;  3DJC A;  4GV6 A;  2WUS A;  2NRZ A;  1Q82 O;  3RRH A;  1TK0 A;  4DTX A;  4DSI A;  4OPA A;  4IOA L;  3HXM A;  3CPW M;  3K0S A;  3ULE B;  1EQY A;  3OVN A;  2HHV A;  5JMV A;  1HR0 K;  1CZB A;  1XUP O;  2YHA A;  3RVC A;  2IVO A;  4PKG A;  4CJV A;  5BR9 A;  3QEX A;  1T6D A;  2F7T A;  3AY9 A;  4EZ9 A;  4DUZ K;  3U9D A;  3OS1 A;  4WFN L;  4XH4 A;  3OYL A;  1SL2 A;  4DV7 K;  5DM7 L;  3E9L A;  1X3M A;  3QBW A;  2O8F B;  5M1K A;  1YXQ A;  3P38 A;  1ATS A;  3U3G A;  4I2Q A;  4W5Q A;  3OBY A;  4H0T B;  4HVJ A;  1D5A A;  1KFD A;  2DFF A;  1IBM K;  4FJJ A;  2E1Y A;  4BRK A;  2B4J A;  4WQ5 A;  4C8N A;  4JV5 K;  5JIC A;  3T1A A;  5ADX H;  3SAG A;  3QET A;  1UOC A;  3I0R A;  3MXI A;  2ZE2 A;  4PHT X;  4EFH A;  1NNE A;  4J2E A;  2P9K A;  5E84 A;  3CET A;  3UIQ A;  3VEW A;  1HNZ K;  2FF6 A;  4KO0 A;  3EKS A;  3ENO A;  3MCP A;  2VYP A;  4HTL A;  4DTU A;  4NLB A;  4Z4H A;  4JI5 K;  4QAG A;  3GE1 A;  3GDQ A;  3CCL N;  2ASP A;  4A5A A;  5AZI B;  1NLV A;  1U47 A;  4R5P A;  3CFO A;  3FGU A;  4E1M A;  1NGE A;  4FO0 A;  1LOT B;  4KHQ A;  4H4O A;  3E1Y A;  4BGA A;  3KD5 E;  2GBZ A;  3I33 A;  4YHH K;  1WBB A;  1QHT A;  2G8H A;  4ILG B;  3T69 A;  1HYV A;  4G9Z A;  2KZZ A;  2Q3S A;  2NRR A;  2Z1I A;  3BY5 A;  1L3V A;  2VQF K;  4B3O A;  2UYT A;  3ITH A;  3C6U A;  5JLH A;  5DM6 L;  1HYZ A;  3LDP A;  2E20 A;  2D0B A;  1KLM A;  4BDZ A;  4B1U B;  4B9M A;  2YHW A;  4CI6 A;  1KCF A;  1KAX A;  4BRL A;  4I6M A;  3WQU A;  3E9O A;  2P9P A;  4BRG A;  4FLZ A;  1KD1 O;  1EXQ A;  3ZCM A;  3HT3 A;  1WN7 A;  2P5G A;  4M3Y A;  2NRT A;  3TI0 A;  3OW2 M;  4IOC L;  4O0J A;  2NNW A;  1NJX A;  4E72 A;  3VQ6 A;  4ILJ A;  3OA9 A;  1K8K A;  1G15 A;  1BIZ A;  1HLU A;  3IS9 A;  1HRH A;  4LFC K;  3O4W A;  3VPZ A;  5BPM A;  4X66 K;  1N5Y A;  1JLG A;  4M63 C;  3IDH A;  4CJS A;  5E26 A;  1JKH A;  3U8X A;  4PL8 A;  1RT5 A;  5I3U A;  4UY8 O;  4NLC A;  3Q7C A;  5SZT A;  3SLC A;  4B9V A;  3GL1 A;  1RBU A;  4PY5 A;  2KLA A;  3O6W A;  5HRO A;  4DQS A;  1NGG A;  4HUF A;  2O4G A;  1D4X A;  1CXQ A;  5LJW A;  3QIO A;  3O4Q A;  1MWK A;  3I55 N;  3ZYY X;  4DS4 A;  4H8K A;  4BRQ A;  3C95 A;  4AM6 A;  5AZJ B;  4O5B A;  2ZGY A;  4FLU A;  1NKC A;  2BGG A;  4B1W B;  3MDQ A;  1BIU A;  1U49 A;  4LF6 K;  3PX4 A;  1NGH A;  4EZ6 A;  4AH9 A;  1I39 A;  3U3Y A;  2Q36 A;  4JKD A;  3EEQ A;  2D5R A;  4CER A;  1HKC A;  2QWL A;  1GLF O;  3AO4 A;  3G4S N;  1W9H A;  3D2F B;  4RTF D;  4FSV A;  4DV4 K;  2ZJR L;  2HW3 A;  2B6A A;  4C8K A;  4DSE A;  2OTL N;  4YOY A;  4BC5 A;  3ZEU A;  5AFU H;  3VOV A;  1SL0 A;  3SUO A;  3OYC A;  1JL1 A;  3NF6 A;  4GV3 A;  4C1N I;  4DUY K;  5KTQ A;  3KTQ A;  2O8D A;  5IT9 O;  3S3O A;  3MAQ A;  5HP1 A;  3NGZ A;  1RGI A;  5AQM A;  3NFA A;  4JKC A;  4CBX A;  2QWP A;  4FM0 A;  2CGL A;  4N41 A;  2BH1 A;  4B9S A;  2KHO A;  1GLL O;  3M8P A;  3LAL A;  3EYZ A;  1JLE A;  4FJ5 A;  5BRF A;  3EE9 A;  4CEE A;  2HF3 A;  5CYM A;  3V9Z A;  2QWN A;  5J2N A;  1D8Y A;  2C1G A;  4AHS A;  3T3F A;  5AQZ A;  3EN9 A;  3WXK A;  2I5J A;  4DB3 A;  3V9W A;  2ZJP L;  4RW8 A;  4WQ5 C;  4BWM A;  3ZT3 A;  3P39 A;  2VQE K;  4CF8 A;  1C0F A;  2R7Y A;  3O1B A;  4IZ9 A;  1TL1 A;  4CJE A;  2IIR A;  2B5J A;  3SUP A;  4LF8 K;  4HUG A;  4CVN E;  3SNN A;  3O9T A;  4FJM A;  2RHK A;  3VQ9 A;  5TKY A;  1L5U A;  3OHR A;  5AQP A;  2P5O A;  1WSH A;  3SI6 A;  1OH6 A;  2ETJ A;  4JAX A;  1SKS A;  5KPZ A;  3J7Z O;  4DV1 K;  4FJX A;  2UUA K;  2PY5 A;  2AA4 A;  4FK2 A;  1SS6 A;  3R3L A;  3AVC A;  3DOL A;  3TSQ A;  5F1X A;  4M7Y A;  1SAZ A;  2VG7 A;  3CER A;  3U4L A;  1C0G A;  3L2U A;  4H5V A;  4JHD A;  4CJQ A;  3CXC M;  2IDO A;  5A2Q O;  4BRD A;  3OYI A;  4YOW A;  1T7P A;  4BRM A;  3OYF A;  1KXP A;  4HTU A;  4E7K A;  2Z1J A;  3L2Q A;  4DKW A;  1NKE A;  3VTH A;  5AQG A;  3A5O C;  4FWO A;  1WNS A;  3CFR A;  1EKE A;  1RT1 A;  1BOT O;  4DFJ A;  3L2R A;  2Y1I A;  1KRP A;  1YUW A;  2RKI A;  2BDP A;  1YTA A;  3AVF A;  3M1F A;  4N5S A;  5GIN A;  4EP4 A;  3IMX A;  1Q9Y A;  4E7I A;  3K59 A;  3LDN A;  1REV A;  5KQD A;  3ATU A;  3CHW A;  3EE8 A;  3VEV A;  4B3M K;  4FJ7 A;  1NK0 A;  3SAF A;  1RTI A;  3VA0 A;  3TAM A;  4B1V A;  3TU5 A;  4IKF A;  3AA4 A;  3GBT A;  4TSX A;  1NM1 A;  2YJE A;  1IH7 A;  1N34 K;  2O8E B;  4CZM A;  4I9L A;  5LMU K;  2I7P A;  3NBP A;  1RT4 A;  3WNF A;  4E7L A;  4R79 A;  3MXM A;  1ZBI A;  1HMV A;  2V52 B;  1VQL N;  3SZ2 A;  4CCH A;  3LM2 A;  5K14 A;  3DI6 A;  4PA1 A;  3S9H A;  1ASV A;  2CH6 A;  1N32 K;  3SCX A;  3N4P A;  3HP6 A;  3CC2 N;  1S9G A;  4LFB K;  2W6L A;  3ZT0 A;  3TAF A;  1Q9X A;  2DFH A;  1H1V A;  2QI2 A;  4Z4I A;  4O5F A;  2XHB A;  3O9R A;  1QE1 A;  2ASM A;  3H1V X;  4EHU A;  2ZM6 K;  2UXC K;  1NKB A;  3SUN A;  4DSL A;  4FOE A;  2HOE A;  4CHY A;  4FL9 A;  3T7Z A;  5I42 A;  2PZS A;  2KFZ A;  4CED A;  5I9E B;  4N76 A;  1IJJ A;  4HCC A;  3O80 A;  3OYN A;  4ZTF A;  3ZSR A;  3J80 O;  4DTN A;  3TPQ A;  1O1W A;  1N6Q A;  1VRU A;  1ZBL A;  2YJF A;  4LF7 K;  3GG4 A;  1BUP A;  1X9W A;  4A2B A;  3FE1 A;  1NK9 A;  1A5W A;  3SV3 A;  1NJI O;  5J2P A;  4F2R A;  5AQW A;  4DFK A;  3VTI A;  1NGF A;  4KKO A;  1RT6 A;  2AJQ A;  4AIL C;  3ASM A;  1C0U A;  4ZHR A;  3CCU N;  4BRA A;  3D2E B;  4PKI A;  3ZT1 A;  4HHT A;  4BC2 A;  4QS7 A;  1TGO A;  4IG0 A;  2QXL A;  3ZET A;  4LH4 A;  2YCH A;  2GEL A;  5KPT A;  3WXM B;  3AVB A;  1FK9 A;  3TAG A;  4M3X A;  4FWS A;  1QQC A;  5C42 A;  3OJU A;  2ZF5 O;  4DR5 K;  3PX6 A;  3AA3 A;  4CZE A;  3VEN A;  2XO7 A;  1E3M A;  1X9S A;  2P9L B;  2VCP A;  4CFB A;  2ZGZ A;  1TK5 A;  4YFU A;  3VEX A;  1QVG M;  4C8L A;  3CCM N;  2RPI A;  3Q7B A;  3FR0 A;  4IEE A;  4DQP A;  2A6A A;  1JLA A;  3F9K A;  3R1X A;  1IV0 A;  4FVU A;  3MEG A;  5FPN A;  1W0H A;  1TL3 A;  5LY3 A;  3DMJ A;  2HHT A;  3R9P A;  4CIF A;  4E19 A;  1NGJ A;  1DEJ A;  5CHI A;  3O8M A;  2HVI A;  2Q1N A;  4FWQ A;  1HNV A;  3T1H K;  1ESV A;  2P9N B;  4IFE A;  4OPK A;  2QA4 N;  5GIO A;  4FJK A;  1BA0 A;  1XMO K;  1S3X A;  4GW6 A;  1T03 A;  2UXB K;  3QEP A;  3H45 C;  2RE2 A;  1SZ2 A;  2BAN A;  3NH2 A;  4A62 A;  3M8Q A;  3LZJ A;  3O3F A;  4BR4 A;  4CHO A;  5C2F A;  2P9U A;  3TTF A;  2FSN A;  3THX A;  4O8K A;  1VSI A;  2VG6 A;  3PO5 A;  3HM8 A;  4J8F A;  2XY7 A;  2HHQ A;  4MDB A;  2KW4 A;  2F96 A;  4Z0U A;  3VQ8 A;  5ADX A;  4BRO A;  1U45 A;  4KAZ A;  2IOC A;  5AQN A;  2UU9 K;  1J6Z A;  3QER A;  2NZT A;  4B8A B;  2G8V A;  4M42 A;  3NHG A;  5HOO A;  4V19 S;  1V4T A;  5JS2 A;  4WFB L;  4BDY A;  5C15 A;  3OYM A;  3LDQ A;  2EX3 A;  4IG3 A;  1N36 K;  3PIP L;  1VQO N;  2YX6 A;  3JAM O;  1RDA A;  4ICL A;  4LF9 K;  1BI4 B;  3VF6 A;  4X64 K;  4C8O A;  3EY1 A;  4B9N A;  1XWL A;  3DLE A;  4DV3 K;  4CEO A;  1MU2 A;  3LM9 A;  3SBG A;  1TYQ B;  3D45 A;  1X3N A;  1RTD A;  1VQ7 N;  2ATQ A;  4CHN A;  1EET A;  2HNY A;  1I3A A;  1BCM A;  4H0V B;  3QFU A;  1KTQ A;  4GV9 A;  1C6V A;  3VQ7 A;  4K43 A;  1TKZ A;  4CJU A;  1QSS A;  4AHU A;  2YHY A;  4OPJ A;  3QEV A;  1YJW N;  1U48 A;  2FBT A;  3HL8 A;  4CFC A;  5FRO A;  4B9T A;  1LWE A;  1VSJ A;  2P1J A;  3A0I X;  1VQK N;  4B1Z A;  1J54 A;  2D4W A;  4XH5 A;  2H3G X;  3F73 A;  3DLG A;  4FK0 A;  3B8A X;  5M1P A;  3IAY A;  3L0Q A;  4CJ3 A;  4Z94 A;  1GLE G;  1OH8 A;  3CG7 A;  4DTR A;  4BG9 A;  1BU6 O;  2HBJ A;  4WQ4 C;  4YDU C;  2EWS A;  3FFK B;  3C6T A;  4KI4 A;  4B1Y B;  1BQN A;  3RTV A;  4M3W A;  3THW A;  1DT9 A;  2YI1 A;  4CIG A;  3AA2 A;  5BR8 K;  2A40 A;  1TKX A;  5TKW A;  4M3Z A;  4B3S K;  3ENH A;  5AR0 A;  3RMB A;  2Q2R A;  4LC9 B;  3WEE B;  1SKW A;  4XIU A;  3EKU A;  5CYQ A;  5AQK A;  3DYA A;  3IUC A;  3MN5 A;  3PUF A;  5AZJ A;  3WXJ A;  4OLB A;  1GOC A;  3DXK B;  1NGC A;  4JKA A;  4KI6 A;  4B3T K;  4IJN A;  4FXD A;  3C94 A;  3U9Z A;  1C1B A;  1YJN N;  4WE1 A;  1HNX K;  1JXE A;  2O8B A;  4O44 A;  1RBR A;  3VGM A;  3ZSY A;  3A5M C;  3J7A P;  1WAF A;  3LP0 A;  4CJ7 A;  4OGE A;  4BWJ A;  3NE6 A;  2V7Z A;  4ILH A;  4W5R A;  3PO4 A;  1T6C A;  1VHX A;  1UWB A;  3CIP A;  4E0D A;  4B9U A;  2KKZ A;  4ISF A;  1YIJ N;  2GTD A;  3TAB A;  5LJV A;  3VMF B;  4DR4 K;  2O4I A;  5FPD A;  4HUE A;  3CCR N;  4FM1 A;  2O8C A;  3O4N A;  4CEF A;  4CJK A;  5AFU A;  4BRN A;  1C1C A;  3LP1 A;  3AAR A;  2P9I A;  2E6L A;  3FZK A;  4E89 A;  4DSJ A;  4B9Q A;  1GLC G;  4KHN A;  1LCU A;  2WC9 A;  2NUB A;  5AQH A;  1S1T A;  4CJR A;  3THY B;  4QS8 A;  4H0Y B;  4K8Z A;  1K73 O;  3ZX0 A;  1RNH A;  4BR0 A;  5KRS A;  1E4F T;  4O0I A;  2DFE A;  1GLJ O;  3AO1 A;  4LSL A;  2CH5 A;  3KWI A;  3LPT A;  3VEZ A;  4JKG A;  3M8S A;  4CJ4 A;  1LWF A;  4FLV A;  4CEC A;  2E4L A;  4RW6 A;  2JWK A;  1ZC6 A;  1NWK A;  1HQU A;  4MLH A;  4X65 K;  3LDO A;  1RT7 A;  4LH5 A;  2HBM A;  3SQ1 A;  1M1K O;  3CYG A;  2QKK A;  3TAN A;  4FVM A;  3MN7 A;  3VET A;  4N47 A;  3CCJ N;  5CZ2 A;  1YTU A;  2CGJ A;  4EP5 A;  4BC4 A;  2PYL A;  2G8U A;  2E2N A;  3NF9 A;  1S6P A;  4MO4 A;  4DV0 K;  3LL3 A;  4FK4 A;  1N33 K;  3ZT4 A;  4MFB A;  3D0P A;  3CF5 L;  3UE5 A;  3HK2 A;  1WSI A;  1VSH A;  2DPN A;  1IBL K;  1U04 A;  5BN8 A;  4DU4 A;  2QTD A;  1HJR A;  1CZ9 A;  1VQ5 N;  4PL7 A;  5EU7 A;  2QWQ A;  4K8X A;  5M1O A;  1ILY A;  2VWJ A;  1LWC A;  4GNI A;  2VG5 A;  1R0A A;  1VSF A;  4CGH A;  1TKT A;  5T7B A;  4XEI A;  2A42 A;  3DWL A;  3LP2 A;  3DXM B;  4DQR A;  4B3R K;  2FF3 B;  4OLA A;  3G25 A;  2OZM A;  4C23 A;  4DTS A;  4JKB A;  1YVN A;  2E8A A;  1Y64 A;  3RSE A;  4YOX A;  3KIO A;  2HMI A;  1ATN A;  1EWQ A;  1GOA A;  3SMS A;  1S9E A;  4CK3 A;  2V51 B;  3H46 O;  2QEX N;  4NCB A;  5FRN A;  4OKK A;  3ID6 A;  3P83 D;  4NCG A;  3KHY A;  3FZF A;  3RR7 A;  4C8M A;  1RDD A;  4EHT A;  3WT0 A;  1BG3 A;  1ASU A;  3B6P A;  1ZBU A;  3O3G A;  1Q8I A;  1TVR A;  5KGX A;  2P9S A;  3SPZ A;  1C0T A;  4KHW A;  2PFU A;  3LAM A;  3WQT A;  4Z4F A;  3B6O A;  3OTO K;  3HVR A;  2DTU A;  2HB5 A;  4Y0W A;  3AV9 A;  5AQT A;  4JI4 K;  4OVL A;  4PQU A;  2HST A;  1KVB A;  4RW4 A;  4YOV A;  4DR7 K;  1S22 A;  4MLE A;  5BPN A;  4M3T A;  3CQY A;  3QFP A;  3QO9 A;  5M1F A;  3C7N B;  3N4Q A;  3S5T A;  3O1W A;  2P9P B;  1YVU A;  3TTD A;  4FWN A;  3THV A;  4FLT A;  4DTO A;  4FJI A;  3HPG A;  2IVN A;  3UKR B;  3K5O A;  3ZSX A;  5GAH P;  3K5N A;  2F9T A;  3OJS A;  4RW7 A;  2Q0R A;  1MWM A;  3H6E A;  1K8K B;  4UQG A;  4E7J A;  1IKV A;  4BG8 A;  2OZS A;  3IFR A;  4NO7 A;  4F8R A;  1VSE A;  4H5R A;  1U2V A;  3KD1 E;  4CBU A;  2UXD K;  3WXL A;  4KRF A;  4DMN A;  3L3V A;  3CM5 A;  3NVM A;  1Z26 A;  1D9F A;  3AVJ A;  3J7Y P;  2KZM A;  2IAJ A;  1HYS A;  3OYA A;  3SV4 A;  3V1O A;  3ATV A;  2FXU A;  4BY9 C;  4F3O A;  3TSU A;  1FKO A;  3VGL A;  4JRP A;  1TUY A;  3S41 A;  3NVK A;  3VGK A;  4YY3 K;  1SL1 A;  2Z1H A;  5HBM A;  3IG1 A;  3D2E A;  1VSD A;  3R6M A;  3J81 O;  4M41 A;  3WUH A;  4KH6 A;  1J5E K;  2GV9 A;  1U4B A;  4CEB A;  3HOT A;  3WNG A;  4CJW A;  4DR6 K;  2ITG A;  1CZA N;  3ZT2 A;  4H5N A;  4FJL A;  3VQD A;  1HJO A;  2JLE A;  3G71 N;  4M3U A;  3H3O B;  4DWI A;  4N56 A;  4CFD A;  3HPH A;  3PLA A;  4DSF A;  4K42 A;  2W40 A;  3CQX A;  3ZEU B;  2YNG A;  3RRG A;  1YJ9 N;  4NXM K;  2Y1J A;  4CJP A;  4WYB A;  4X62 K;  3VQ4 A;  3TAP A;  4DQI A;  3QIP A;  3DLH A;  3L4I A;  3MX2 A;  4B8C A;  2O8D B;  2QKB A;  4IJA A;  3KVG A;  1R59 O;  3G0Z A;  3JS6 A;  3KZB A;  5HL7 L;  5FRM A;  3ISN C;  3T19 A;  2V7Y A;  5FPM A;  3MED A;  4I2P A;  2NRV A;  1JCG A;  5EOY A;  3DRS A;  4BGB A;  2P9N A;  4Q5V A;  4CJL A;  3RMD A;  4MO5 A;  4F3T A;  4NB4 A;  2G8W A;  1VAZ A;  1ZBF A;  1WLJ A;  3QNN A;  3KLG A;  4F4K A;  4A5B A;  4FWR A;  4FJH A;  3CJ1 A;  2QM1 A;  2X78 A;  4H03 B;  5F0X A;  3CJC A;  4K25 A;  4CFA A;  3W0L A;  1WAJ A;  3KK3 A;  2E2O A;  3OBW A;  5KPR A;  4WQ4 A;  3SJJ A;  4FZX C;  4Y1C A;  4YDU A;  2OPR A;  2Q97 A;  3RWU A;  2VWK A;  1QQN A;  4AQY K;  3AO3 A;  2E6M A;  3HRG A;  1NJW A;  1YF5 L;  2D0O A;  3UKU A;  1RDC A;  4MQ3 A;  1HKG A;  2CGK A;  3AGR A;  4GY2 B;  1TK8 A;  2Q31 A;  1GLD G;  3KK2 A;  2A1R A;  3DM2 A;  4GMJ B;  3K2P A;  5MLC Q;  3ZSW A;  1U6Z A;  3PSI A;  3TAQ A;  2I7N A;  4GKK K;  4BDP A;  1O13 A;  1WBD A;  3MK6 A;  2F8T A;  3ZSO A;  4IBN A;  4CBW A;  4FPB A;  1WSE A;  1QZ6 A;  4CGI A;  4KB1 A;  2FSK A;  3NH1 A;  2WON A;  3IKM A;  4FJ9 A;  4CD3 A;  4DU3 A;  3UB5 A;  4CEQ A;  3VF2 A;  5BRD A;  3EZ5 A;  4IEI A;  2OAN A;  3D6R A;  4BR2 A;  4A57 A;  4L8R B;  4JHD B;  1WSF A;  1A5X A;  3BF3 A;  3ZSZ A;  1XNR K;  3RMC A;  1YAG A;  5H1S Q;  5E41 A;  2WOM A;  3MEC A;  3MX5 A;  1M90 O;  2HBL A;  4BRE A;  4CF1 A;  2GEM A;  3L3U A;  4O55 A;  1HX1 A;  2X6S A;  3NH0 A;  3EO3 A;  4KHP K;  4DTM A;  1L3U A;  3ULE A;  3SBT A;  4CD1 A;  3G6E N;  5AQS A;  3AVA A;  4DV6 K;  5C24 A;  1BQM A;  1ZXO A;  1DLO A;  4ID1 A;  4Z4G A;  3I56 N;  1NOZ A;  2Q0U A;  3V81 A;  1QQO A;  1EO1 A;  4A59 A;  2RF2 A;  5AQL A;  1DKG D;  1LV5 A;  3AVI A;  1OVQ A;  1TUU A;  1BIS A;  1NMD A;  1K6Y A;  5KI6 A;  4ISE A;  4NXN K;  2O8F A;  1GLB G;  2G8K A;  4CGF A;  3VA3 A;  4IOX A;  3WEE A;  4DR1 K;  3FFI A;  1A5V A;  2W6K A;  2JGU A;  2HND A;  4JLH A;  1K8A O;  4DHY A;  5SWM A;  3ID8 A;  4WFA L;  4JK8 A;  4KTZ A;  3DXK A;  3V4I A;  1NK5 A;  2F8S A;  1WUA A;  1IKW A;  4CHP A;  3TR8 A;  1KSP A;  3AVG A;  2WTU A;  3I8D A;  4K0K K;  1RDU A;  4DQQ A;  1TV6 A;  1HUX A;  2YKN A;  3QBX A;  3OY9 A;  4IFV A;  5BPL A;  4LD0 A;  3AAP A;  3J8A A;  5DK5 A;  1KVC A;  4I7F A;  1VSM A;  5AZI A;  3QIN A;  4FWP A;  2GUP A;  4H0P A;  4DU1 A;  3TSP A;  4IFY A;  5AQY A;  4GKJ K;  2BTF A;  3OYH A;  1ASW A;  3H08 A;  1UAX A;  2QWR A;  2D0P A;  2E5L K;  3CFP A;  3VF4 A;  4KHY A;  2HHS A;  4WF9 L;  1Z6R A;  3CJ9 A;  3DLB A;  4JI3 K;  5KQ8 A;  2IGI A;  1G99 A;  3KWG A;  3LDL A;  5AQX A;  3PX0 A;  3ZLJ A;  3DLL L;  5CZ1 A;  3K58 A;  3LDS A;  4DTJ A;  3TAR A;  4ISG A;  5EY4 A;  1BWF O;  3C6A A;  3V9X A;  4BEC A;  1EP4 A;  1NGI A;  4DG1 A;  3S3M A;  5JLF A;  2E2Q A;  5HRN A;  4JD2 B;  3A8Y A;  4QCL A;  3QML A;  2OPS A;  5AQF A;  4KHS A;  3FZL A;  4RG8 A;  1JLQ A;  4C1N K;  3L2V A;  3VQQ A;  4CHQ A;  4IXC A;  2LSN A;  2OTJ N;  4BE2 A;  5BN9 A;  4LY7 A;  3BEX A;  3KK7 A;  3RMA A;  3LZI A;  3SMP A;  4F9O A;  2BUP A;  2A5X A;  2XRI A;  3HTV A;  3SK3 A;  4DF8 A;  1UA0 A;  3L2W A;  3T1Y K;  3BUZ B;  3AVM A;  1Q7Y O;  1XHZ A;  3M5R A;  1D9D A;  3KK1 A;  5AJ3 K;  1OH5 A;  3AGK A;  4FLX A;  3SYZ A;  1VQ6 N;  3KJV A;  5C12 A;  3OYE A;  1NU0 A;  3JSM A;  4KRE A;  2ZWH A;  4J2D A;  4U67 L;  1YT3 A;  1ZBH A;  4BEB A;  2IS3 A;  1N8R O;  3M8R A;  5JVG L;  5EX5 A;  3SAH A;  4KTQ A;  3CD6 N;  2P51 A;  3WXI A;  4ELV A;  2OCE A;  5KGW A;  1LW0 A;  4JKH A;  4H0X B;  1VK0 A;  3BGR A;  2PAV A;  3G10 A;  4OJR A;  4JK9 A;  4RWT A;  3F5T A;  3SQ4 A;  1F21 A;  4W5T A;  4KTW A;  2FC0 A;  2P9U B;  1FW6 A;  4DLG A;  4M3R A;  3P31 A;  3THX B;  3D2F A;  3H1Q A;  1IG9 A;  3MN6 A;  4BVP A;  5AQO A;  3DXM A;  1BA1 A;  2Z1G A;  4NYF A;  3CC7 N;  1NK4 A;  3CJA A;  3AA5 X;  5AQI A;  4FM2 A;  3MMV A;  4RCH A;  5GAE P;  4DV5 K;  4XJX A;  1XHX A;  2D1K A;  4CEZ A;  3O9U A;  1S72 N;  5AQQ A;  3LP3 A;  1W2B M;  4BAC A;  4JI6 K;  2KTQ A;  2YV0 X;  4BQL A;  1OKJ A;  4DQ8 A;  3TWH A;  2OA8 A;  1S5J A;  4CJF A;  1VQP N;  1X9M A;  1Q81 O;  1QZ5 A;  4CZI A;  2YNI A;  3ALY A;  3P5J A;  2W42 A;  4CJ5 A;  1FJG K;  4W5N A;  1MA9 B;  3MCA B;  3L6Q A;  3F2K A;  4E3S A;  3S3N A;  4QS9 A;  1QVF M;  3ZSV A;  4KBO A;  2GWK A;  4BRF A;  3K5M A;  1KFS A;  1JCE A;  4E1J A;  3TAE A;  3IRX A;  1P90 A;  2EHG A;  2HHX A;  2HVH A;  3C6H A;  2HMP A;  4FJG A;  1XC9 A;  3E9P A;  1DTQ A;  2X6N A;  1CLQ A;  3C7N A;  2IC3 A;  1JCF A;  1HPM A;  3ZSQ A;  1LW2 A;  4IO8 A;  5D3G A;  4YOU A;  1ITG A;  1SUQ A;  3UKR A;  1FXX A;  1NJZ A;  2HHU A;  2AP1 A;  3PIO L;  4JEP A;  1Z05 A;  5IWA K;  2QK9 A;  3KKS A;  3CCQ N;  3ULD A;  3CYM A;  3SQ2 A;  3O08 A;  4HCB A;  1B92 A;  1EX4 A;  4CZJ A;  3V9S A;  4CZF A;  3QDK A;  1Y97 A;  3V1R A;  5FDL A;  1Z25 A;  1NOY A;  3HO1 A;  2XY8 A;  4BQZ A;  3THW B;  1JLB A;  1GLA G;  1T8E A;  1BDG A;  1JL2 A;  2F9W A;  4PWD A;  3CM6 A;  3U6F A;  2C1I A;  3BDP A;  1VQ4 N;  5B8H A;  4FLW A;  3KLE A;  4OX9 K;  3A5L C;  3H3N O;  3NGI A;  3O3H A;  4HWI A;  2YHB A;  4BRC A;  2PYJ A;  4L3Q A;  4BC3 A;  4BR5 A;  3DLR A;  3HJF A;  1KVA A;  2QWM A;  1RIL A;  5KRT A;  4J2A A;  2P9K B;  1VRT A;  2QWO A;  3KLH A;  4KB0 A;  3VEY A;  4FWL A;  1W97 L;  1JLF A;  4JK7 A;  2ZD1 A;  2O8B B;  4O4G A;  4CGD A;  4DTP A;  3HP9 A;  2HHW A;  3JXU A;  3OS2 A;  5AQR A;  5EVZ A;  2FLO A;  3NCI A;  1J53 A;  1NGD A;  4IDK A;  3WNH A;  5ELZ A;  3CPE A;  4F2S A;  2PBD A;  1ATR A;  4Z4E A;  1B9D A;  5C2D A;  1NMN A;  1UA1 A;  1YHQ N;  1HKB A;  2W41 A;  4NCA A;  2JWL A;  3SQ0 A;  3VN5 A;  2O8C B;  4BR9 A;  3NGY A;  4A2A A;  2ITM A;  2P9I B;  2UUC K;  4QOZ B;  3DRR A;  2NRH A;  1KQS M;  1S1W A;  1QSL A;  3AVK A;  4YOT A;  3C0B A;  2O8E A;  3OYD A;  5GAG P;  3LPU A;  1X9J A;  5HRR A;  1RCH A;  1LAW A;  3LAK A;  1K9M O;  2RN2 A;  3W3D A;  2GUI A;  4AHV A;  3E01 A;  5CE3 A;  4DR3 K;  4EAH D;  1XMQ K;  2UUB K;  1DTT A;  1BO5 O;  4I9Q A;  4FJ8 A;  4I6M B;  4FPA A;  4E1N A;  3M3Z A;  4DF4 A;  3SPY A;  4A61 A;  4CF2 A;  3NF7 A;  3V1Q A;  3HBT A;  4CHZ A;  1NGA A;  4AHT A;  2QXF A;  4BRI A;  4CGJ A;  1J9A A;  3HVT A;  4B9L A;  4JKG B;  3VQE A;  1RBS A;  3FZH A;  5J2Q A;  5C10 A;  3NDK A;  2NRW A;  3BZK A;  1C1A A;  1RT3 A;  4BE0 A;  3CCE N;  5M1N A;  5LL6 Z;  3I0S A;  4K41 A;  4H5W A;  2FBX A; 
#chains in the Genus database with same CATH homology
 1KD1 O;  4BVO A;  4H0V B;  5C0Y A;  3QFU A;  1O13 A;  2NRT A;  4GV9 A;  3CI5 A;  3OW2 M;  3MK6 A;  4K43 A;  4IOC L;  1KC8 O;  2NNW A;  3EL2 A;  4CBW A;  4FPB A;  2YHY A;  1QZ6 A;  1YJW N;  4ILJ A;  3OA9 A;  3CJ7 A;  1K8K A;  1DGK N;  2FSK A;  3IKM A;  1HLU A;  4CD3 A;  4BRH A;  3UB5 A;  3O4W A;  1T3V A;  3VPZ A;  4CZH A;  3VF2 A;  5BRD A;  5BPM A;  3A0I X;  4IEI A;  4M63 C;  1VQK N;  4B1Z A;  2OAN A;  3D6R A;  3IDH A;  2D4W A;  4XH5 A;  4A57 A;  4JHD B;  4BR2 A;  3BF3 A;  5E26 A;  2H3G X;  3MN9 A;  2VGM A;  4PL8 A;  3U8X A;  4UY8 O;  1YAG A;  4NLC A;  3Q7C A;  5H1S Q;  3B8A X;  3HI0 A;  3HZ6 A;  3GL1 A;  4FWM A;  3SLC A;  5M1P A;  2KLA A;  3O6W A;  3MX5 A;  1M90 O;  2HBL A;  4BRE A;  1NGG A;  2GEM A;  3L0Q A;  1D4X A;  4AM7 A;  4Z94 A;  1GLE G;  1HX1 A;  1V4S A;  4JNE A;  5LJW A;  3ZX3 A;  1MWK A;  1KAY A;  3EO3 A;  3I55 N;  3ZYY X;  2QW9 A;  4BG9 A;  1BU6 O;  4KH4 A;  2HBJ A;  4WQ4 C;  4BRQ A;  3ULE A;  5CR4 A;  4YDU C;  2EWS A;  4JKE A;  3FFK B;  3SBT A;  4AM6 A;  5AZJ B;  4CD1 A;  3G6E N;  5AQS A;  4B1Y B;  4DCH A;  2ZGY A;  3QIC A;  1DT9 A;  1ZXO A;  2YI1 A;  4B1W B;  2A40 A;  5TKW A;  3MDQ A;  4FWK A;  3RSE B;  1NGH A;  5AQV A;  5F2R A;  3TTC A;  3I56 N;  2P9L A;  3ENH A;  2Q0U A;  3NMU A;  1QQO A;  5AR0 A;  2Q2R A;  4LC9 B;  3WEE B;  1EO1 A;  3ENB A;  2Q36 A;  4A59 A;  1Q18 A;  4JKD A;  4IO9 L;  1QQM A;  3EKU A;  3EZW A;  5AQL A;  3MWP A;  1HKC A;  1DKG D;  1GLF O;  2QWL A;  3G4S N;  5AQK A;  3D2F B;  3IUC A;  3MN5 A;  5AZJ A;  4M7X A;  1TUU A;  3WXJ A;  4RTF D;  4FSV A;  2ASO A;  3FZM A;  3DXK B;  2ZJR L;  1NGC A;  1NMD A;  4JKA A;  4XH1 A;  4MDA A;  4IJN A;  2OTL N;  4ISE A;  1GLB G;  3U9Z A;  3I8B A;  3VEO A;  4YOY A;  3VES A;  4IOX A;  5BRH A;  4BC5 A;  1YJN N;  3ZEU A;  3WEE A;  1T44 A;  5AFU H;  3CCS N;  3VOV A;  3VGM A;  3A5M C;  1K8A O;  4CJ7 A;  4DHY A;  4FOI A;  1IG8 A;  2P9S B;  3ID8 A;  4GV3 A;  4C1N I;  4WFA L;  2V7Z A;  4ILH A;  3DXK A;  4JK8 A;  1T6C A;  3MWT A;  3O9S A;  1WUA A;  2J4R A;  3CIP A;  2KKZ A;  1VQ8 N;  4ISF A;  1YIJ N;  1RGI A;  1RDU A;  5AQM A;  1HUX A;  2YHX A;  2GTD A;  3QBX A;  5BPL A;  5LJV A;  4JKC A;  4CBX A;  3VMF B;  5FPD A;  3CCR N;  2QWP A;  3AAP A;  3J8A A;  2VGN A;  2CGL A;  2BH1 A;  4BRN A;  5AFU A;  5AZI A;  4JN4 A;  1YIT N;  4OO1 J;  2KHO A;  1GLL O;  2P9I A;  3AAR A;  4FWP A;  2GUP A;  4H0P A;  3TSP A;  2HBK A;  5BRF A;  5AQY A;  4WCE L;  3EE9 A;  3FZK A;  4B9Q A;  2BTF A;  2HF3 A;  1E4G T;  1GLC G;  2QWR A;  1LCU A;  2D0P A;  2WC9 A;  4IWV A;  3VF4 A;  5AQH A;  1XC3 A;  4U7B A;  2QWN A;  2C1G A;  4QS8 A;  4WF9 L;  3R8E A;  1Z6R A;  2VWB A;  5AQZ A;  3CJ9 A;  5M1Q A;  3EN9 A;  3WXK A;  5BRE A;  5KQ8 A;  1G99 A;  4H0Y B;  1U2V B;  3KWG A;  3LDL A;  4DB3 A;  2ZJP L;  5AQX A;  3VER A;  4WQ5 C;  4YOR A;  1K73 O;  3P39 A;  3AAQ A;  3ZX0 A;  3DLL L;  1C0F A;  3O1B A;  4ISG A;  4BR0 A;  1E4F T;  4IZ9 A;  5EY4 A;  1BWF O;  2IIR A;  1GLJ O;  4O8U A;  3C6A A;  3D7E O;  4H5T A;  2CH5 A;  3KWI A;  4BEC A;  3VEZ A;  1TYQ A;  4JKG A;  3K9K A;  1NGI A;  3O9T A;  5JLF A;  2RHK A;  2E2Q A;  2JWK A;  1ZC6 A;  1NWK A;  3A8Y A;  4JD2 B;  5TKY A;  3QML A;  4MLH A;  3LDO A;  5AQF A;  3OHR A;  3FZL A;  2E2P A;  5AQP A;  2HBM A;  5GAD P;  1M1K O;  4C1N K;  4JAX A;  1XQS C;  5KPZ A;  3J7Z O;  1SQK A;  4IXC A;  3MN7 A;  1KAZ A;  3VET A;  2OTJ N;  5BN9 A;  4B1X B;  3CCJ N;  3BEX A;  3KK7 A;  2AA4 A;  2CGJ A;  1SS6 A;  3R3L A;  4BC4 A;  3SMP A;  1WOQ A;  4F9O A;  2BUP A;  3ZX2 A;  2A5X A;  2E2N A;  3HTV A;  3SK3 A;  3TSQ A;  4MO4 A;  5F1X A;  3BUZ B;  3LL3 A;  1SAZ A;  4M7Y A;  4JD2 A;  3CER A;  3DAW A;  4KH5 A;  3U4L A;  1C0G A;  3O9Q A;  4H5V A;  4JHD A;  1Q7Y O;  3CC4 N;  3M5R A;  3CXC M;  3CF5 L;  3AGK A;  1VQ6 N;  5C12 A;  3UE5 A;  4BRD A;  3CJB A;  4YOW A;  2WBN A;  2DPN A;  2ZWH A;  4BRM A;  3CCV N;  5BN8 A;  1KXP A;  4U67 L;  4CZK A;  4BEB A;  2QTD A;  1N8R O;  5JVG L;  5EX5 A;  1YI2 N;  1VQ5 N;  4PL7 A;  2QWQ A;  3SAH A;  5M1O A;  1VQ9 N;  3CME N;  3WXI A;  4DKW A;  3CD6 N;  3VTH A;  1ILY A;  3P4I A;  4OPH A;  2A3Z A;  4GNI A;  3A5O C;  4FWO A;  5AQG A;  4CZG A;  2GX9 A;  2HF4 A;  2NLX A;  4JKH A;  4H0X B;  1NGB A;  2A42 A;  3DWL A;  4XEI A;  3DXM B;  1BOT O;  1Q86 O;  2FF3 B;  2PAV A;  3G25 A;  4C23 A;  1OVY A;  1YUW A;  3M1F A;  4JKB A;  5GIN A;  1YVN A;  2E8A A;  1Y64 A;  3IMX A;  4JK9 A;  3RSE A;  4RWT A;  4YOX A;  3LDN A;  1ATN A;  3F5T A;  5KQD A;  3ATU A;  3CHW A;  3EE8 A;  3VEV A;  3HSC A;  1RFQ A;  3SMS A;  2V51 B;  3HOS A;  2P9U B;  3SAF A;  3H46 O;  2GWJ A;  2QEX N;  3P31 A;  2E1Z A;  4EIA A;  4B1V A;  3ID6 A;  3D2F A;  3H1Q A;  3TU5 A;  3MN6 A;  4BVP A;  5AQO A;  3DXM A;  4BRG A;  3KHY A;  3O5B A;  1BA1 A;  3GBT A;  3FZF A;  3CC7 N;  3CJA A;  4BE7 B;  2FSJ A;  5AQI A;  1NM1 A;  2YJE A;  4CZM A;  3FLC O;  3MMV A;  4RCH A;  4EHT A;  2I7P A;  3WT0 A;  5GAE P;  4XJX A;  4R79 A;  2D1K A;  1BG3 A;  3O9U A;  1S72 N;  2V52 B;  1ZBS A;  5AQQ A;  1VQL N;  1QHA A;  1W2B M;  3QB0 A;  3LM2 A;  1VQN N;  3CMA N;  2CH6 A;  3BP8 A;  4H0O A;  4BQL A;  1OKJ A;  2P9S A;  3N4P A;  3CC2 N;  3M6G A;  3A5N C;  2PFU A;  4DQ8 A;  3WQT A;  1VQP N;  4BRP A;  1JJ2 M;  4BR7 A;  3L4Q A;  4PKH A;  1H1V A;  2QI2 A;  5FPE A;  4O5F A;  1Q81 O;  3O9R A;  2E88 A;  5AQU A;  4Y0W A;  1QZ5 A;  4CZI A;  5AQT A;  3SJH A;  2ASM A;  3H1V X;  4EHU A;  2NRX A;  5GIP A;  3UKU B;  2WFB A;  2W00 A;  4AF1 A;  2HST A;  4YOV A;  1S22 A;  4MLE A;  5BPN A;  1NBW A;  4FOE A;  2HOE A;  4FL9 A;  3CQY A;  1MA9 B;  3T7Z A;  3MCA B;  3L6Q A;  3QFP A;  5M1F A;  3C7N B;  3N4Q A;  3O1W A;  2P9P B;  3F2K A;  3TTD A;  5I9E B;  4QS9 A;  1QVF M;  4FWN A;  5EXW A;  5AQJ A;  1IJJ A;  2IVP A;  4KBO A;  3O80 A;  2GWK A;  2IVN A;  3UKR B;  4BRF A;  1VQM N;  2A41 A;  3TPQ A;  5GAH P;  1JCE A;  2F9T A;  4E1J A;  1RDW X;  1P90 A;  2Q0R A;  2YJF A;  1MWM A;  3H6E A;  1K8K B;  4IDH A;  3GG4 A;  3C6H A;  1BUP A;  4A2B A;  3FE1 A;  2HMP A;  3E9P A;  3ZET B;  4GVE A;  3BF1 A;  4BG8 A;  1NJI O;  1P8Z A;  1MDU B;  3IFR A;  4NO7 A;  5AQW A;  4H5R A;  1U2V A;  3VTI A;  1NGF A;  3C7N A;  4CBU A;  3WXL A;  1JCF A;  1HPM A;  3C65 A;  5JVH L;  4JKF A;  4CZL A;  4IO8 A;  4YOU A;  3CCU N;  3UKR A;  3GOI A;  3E66 A;  3NVM A;  2AP1 A;  3K9J A;  2ZJQ L;  4BRA A;  3D2E B;  3F9M A;  4PKI A;  3DJC A;  3PIO L;  4JEP A;  4QS7 A;  4BC2 A;  1Z05 A;  4GV6 A;  2QXL A;  2WUS A;  3ZET A;  3CCQ N;  2NRZ A;  1Q82 O;  2YCH A;  3ATV A;  2FXU A;  2GEL A;  5KPT A;  4BY9 C;  3WXM B;  3TSU A;  3O08 A;  4OPA A;  4IOA L;  4CZJ A;  3VGL A;  3CPW M;  1TUY A;  4CZF A;  3ULE B;  4FWS A;  1EQY A;  3S41 A;  3QDK A;  3NVK A;  5JMV A;  3VGK A;  1XUP O;  2ZF5 O;  4BQZ A;  1GLA G;  4CZE A;  3VEN A;  3D2E A;  3RVC A;  2IVO A;  4PKG A;  1BDG A;  2F9W A;  3R6M A;  2C1I A;  3WUH A;  4KH6 A;  5BR9 A;  2P9L B;  1T6D A;  1VQ4 N;  2VCP A;  5B8H A;  2ZGZ A;  2F7T A;  3A5L C;  3AY9 A;  3H3N O;  3HOT A;  3VEX A;  1QVG M;  3U9D A;  3CCM N;  3Q7B A;  4HWI A;  4WFN L;  3FR0 A;  4IEE A;  4XH4 A;  2A6A A;  4BRC A;  5DM7 L;  3R1X A;  1CZA N;  4L3Q A;  4BC3 A;  4BR5 A;  4H5N A;  4FVU A;  5FPN A;  2QWM A;  3E9L A;  1HJO A;  1X3M A;  2P9K B;  3QBW A;  5LY3 A;  3G71 N;  3H3O B;  2QWO A;  3R9P A;  5M1K A;  1YXQ A;  3P38 A;  3PLA A;  1ATS A;  4FWL A;  3VEY A;  1NGJ A;  2W40 A;  1DEJ A;  3CQX A;  4K42 A;  3OBY A;  1W97 L;  3O8M A;  4H0T B;  4JK7 A;  3ZEU B;  5CHI A;  2Q1N A;  4FWQ A;  1YJ9 N;  2E1Y A;  4BRK A;  1ESV A;  4WQ5 A;  4WYB A;  5JIC A;  2P9N B;  4IFE A;  5ADX H;  3SAG A;  3JXU A;  2QA4 N;  5GIO A;  5AQR A;  1BA0 A;  1S3X A;  5EVZ A;  2FLO A;  3L4I A;  3MX2 A;  4PHT X;  4EFH A;  3H45 C;  2P9K A;  5E84 A;  2RE2 A;  3CET A;  3KVG A;  1R59 O;  1NGD A;  4IJA A;  1SZ2 A;  2FF6 A;  3VEW A;  3JS6 A;  3EKS A;  3KZB A;  5ELZ A;  3CPE A;  4A62 A;  5HL7 L;  3ENO A;  3MCP A;  4BR4 A;  2PBD A;  1ATR A;  5C2F A;  2P9U A;  2V7Y A;  2VYP A;  4HTL A;  5FPM A;  4NLB A;  3TTF A;  5C2D A;  1YHQ N;  1HKB A;  2FSN A;  2W41 A;  3GDQ A;  3GE1 A;  2NRV A;  4O8K A;  3CCL N;  1JCG A;  2ASP A;  5EOY A;  4A5A A;  2JWL A;  4BGB A;  2P9N A;  3HM8 A;  4J8F A;  4MDB A;  4BR9 A;  4A2A A;  4MO5 A;  5AZI B;  4NB4 A;  2ITM A;  2P9I B;  1VAZ A;  1NLV A;  2NRH A;  1KQS M;  5ADX A;  3FGU A;  4YOT A;  3C0B A;  4FWR A;  4A5B A;  4BRO A;  3CJ1 A;  5GAG P;  2QM1 A;  1X9J A;  4H03 B;  1NGE A;  4FO0 A;  1LOT B;  1K9M O;  5F0X A;  3CJC A;  4K25 A;  5AQN A;  3W3D A;  3E1Y A;  1J6Z A;  3W0L A;  2NZT A;  4BGA A;  3I33 A;  5CE3 A;  2E2O A;  5HOO A;  1V4T A;  4EAH D;  3OBW A;  4WFB L;  5KPR A;  4ILG B;  1BO5 O;  3T69 A;  3LDQ A;  4WQ4 A;  5C15 A;  4YDU A;  3PIP L;  1VQO N;  2YX6 A;  4I6M B;  2Q97 A;  4G9Z A;  4FPA A;  1QQN A;  3M3Z A;  4A61 A;  2NRR A;  3HBT A;  3VF6 A;  2UYT A;  5JLH A;  1NGA A;  3HRG A;  1YF5 L;  2D0O A;  3UKU A;  5DM6 L;  1HKG A;  3LDP A;  2CGK A;  2E20 A;  3AGR A;  4GY2 B;  4BRI A;  2Q31 A;  1GLD G;  3LM9 A;  3SBG A;  1TYQ B;  4JKG B;  4B1U B;  3FZH A;  2YHW A;  4CI6 A;  1X3N A;  2NRW A;  5C10 A;  1VQ7 N;  1KAX A;  4BRL A;  3CCE N;  5M1N A;  5MLC Q;  4K41 A;  4H5W A;  4I6M A;  1U6Z A;  3WQU A;  3E9O A;  2P9P A;  2I7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...