4EFHA

Acanthamoeba actin complex with spir domain d
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
370
structure length
364
Chain Sequence
VQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMHTAASSSALEKSYELPDGQVITIGNERFRAPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMQKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein/transport protein
molecule keywords Actin-1
publication title Multiple Forms of Spire-Actin Complexes and their Functional Consequences.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 127
structure length 364
sequence length 370
ec nomenclature
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4efhA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4efhA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4efhA03
4CZEA 5EOYA 4FPAA 1HJOA 2WUSA 3ULEA 3WT0A 4BROA 1HPMA 4MLEA 5AQSA 2P9KB 1X3NA 3FE1A 5JLHA 3CJAA 3LDLA 5AQHA 1WOQA 2CGKA 4BC2A 1YVNA 3DXMA 5ADXA 3U9DA 4C23A 4AM7A 2CGLA 3ENOA 3HBTA 1T6DA 4NO7A 4JD2B 3L6QA 4FO0A 5AQJA 5AZJB 3AARA 3UE5A 4BC3A 2H3GX 1SQKA 1NBWA 3IFRA 3EN9A 5FPNA 4JHDB 3LDOA 3B8AX 2EWSA 1Z05A 1HKBA 1BDGA 2GUPA 3ZEUA 2A41A 4JAXA 3UKUA 3LDNA 3KZBA 2YJEA 3EZWA 5AQPA 4JN4A 3QICA 1MWMA 5AQUA 3WXKA 4BG9A 4H5VA 4MO5A 3HSCA 3MMVA 1IJJA 1JCEA 2F9TA 4CD1A 3ENHA 3J8AA 2GELA 1KAYA 5EX5A 3A5NC 1QZ6A 4GNIA 4LC9B 5AQWA 1BO5O 3JS6A 1S22A 1RFQA 3ZX3A 4BRFA 1WUAA 4RTFD 3MK6A 2VWBA 3AAPA 4FOIA 3GL1A 2AA4A 2V51B 3A0IX 2VYPA 1HX1A 4A2BA 1OKJA 3CJBA 3FLCO 3ZETA 4CBUA 3CQXA 4CZIA 5KPZA 3DAWA 5AZIB 4EHTA 3WEEA 3VEVA 5KQ8A 2E2PA 3IUCA 2BUPA 5BN8A 1R59O 1DKGD 3R9PA 1ESVA 1BUPA 4BRQA 3U8XA 3VGKA 2V7YA 4ISEA 5AQTA 2P9IA 4BRMA 2HF3A 3CIPA 5BRDA 4FWNA 1GLAG 4BC5A 3O5BA 3D2FA 3VESA 5AR0A 2E1ZA 1NGEA 3O8MA 4PL8A 3ZX2A 1X9JA 3VEYA 2GEMA 2F9WA 4BVOA 3CI5A 3VGLA 2GTDA 1SAZA 3FZKA 4FL9A 4EAHD 2FF6A 1V4TA 2P9KA 5LY3A 1BG3A 5BREA 1C0GA 2ASPA 5F2RA 1U2VA 4H5NA 4H0VB 4O5FA 4DQ8A 4K43A 3UB5A 2GWJA 3EKUA 1QHAA 1C0FA 2UYTA 4JD2A 3VF4A 4QS8A 3QBWA 5AZJA 1CZAN 2NLXA 1MDUB 1BOTO 4DB3A 1GLDG 3SMSA 3RSEB 2Q0UA 4CZMA 3IMXA 1BWFO 4JHDA 3F9MA 3W0LA 1X3MA 1YUWA 3I33A 3KVGA 3MN7A 3DWLA 2VCPA 4BRKA 2J4RA 1MA9B 1NGAA 2QWQA 3U4LA 2Q31A 3HM8A 3D7EO 3VOVA 1NGGA 2E2OA 3BUZB 4JNEA 1Y64A 3LL3A 4IJNA 4YDUC 3P4IA 4CI6A 2GWKA 4WYBA 4FSVA 4H5WA 3AY9A 5AFUH 1P8ZA 4BGAA 3SJHA 4BVPA 2W40A 4H5TA 3M1FA 5BRHA 4EFHA 1QQMA 4FWOA 4BREA 3L0QA 1BA0A 4H0YB 1E4FT 4BR9A 3O08A 3H3NO 1H1VA 3TU5A 1NWKA 3QFUA 2Q0RA 3DJCA 2QWRA 3VEZA 5ADXH 3BF3A 4XEIA 4I6MB 3H45C 2D0OA 4CBWA 5BRFA 3GBTA 1DGKN 3EL2A 3MDQA 4IJAA 2V7ZA 2A40A 4FWRA 2A6AA 1DEJA 4FWKA 2FLOA 2OANA 4QS9A 4B1ZA 5B8HA 5FPEA 3LM9A 1ZBSA 2QWMA 3BEXA 1ATNA 2IIRA 2P9LB 3GG4A 4YDUA 5BR9A 2P9SB 3C7NB 4WQ5A 3KHYA 5TKYA 1TUUA 5I9EB 5AQKA 4BR4A 2PAVA 2QWNA 1QQNA 3R6MA 5EXWA 3LDPA 4DHYA 3CJ7A 4FPBA 5ELZA 2P9PB 4BQZA 3FR0A 3O4WA 3DXMB 3ZX0A 1XQSC 1NGFA 4F9OA 3WUHA 3WQTA 1HKGA 1ZC6A 1GLJO 2ZF5O 3VF6A 4BRIA 2FF3B 1QZ5A 3OHRA 3GE1A 2YI1A 3SK3A 5LJVA 4XH1A 5AQNA 2YHXA 3CJCA 1S3XA 5KPRA 3D2EA 1BU6O 3CJ9A 5CE3A 4CBXA 3ZEUB 3WXLA 5F1XA 3UKUB 2QM1A 3RSEA 1ATSA 1YAGA 2YHYA 3FZFA 2P9NB 4FWPA 3QMLA 1MWKA 4IO8A 2FSJA 1QQOA 1XUPO 2BTFA 2CGJA 2P9UB 3QB0A 4H0OA 4EHUA 3CJ1A 3IDHA 5EY4A 5AQIA 4FWMA 2CH5A 1TUYA 4CZKA 3BP8A 4PKHA 5BPMA 4GY2B 4RCHA 4HWIA 2KHOA 4O8KA 4E1JA 5EVZA 4WQ4A 1SZ2A 1Z6RA 1NGCA 2I7NA 2V52B 3VETA 4CZLA 4ISFA 3FZMA 3LDQA 5E84A 4PKGA 3O1WA 3S41A 5JMVA 4BQLA 2HF4A 3CETA 5AQGA 4BRNA 4A2AA 1JCFA 3C0BA 1Q18A 1GLEG 4H0TB 4BG8A 3MN5A 3WEEB 4CJ7A 3EO3A 2E2NA 3VEOA 3ATUA 5AQVA 5AQZA 1J6ZA 4FOEA 3QDKA 2W41A 3MN9A 4ISGA 4B9QA 2QWPA 1JCGA 2E20A 2AP1A 3UKRB 4BRLA 4CZJA 4DCHA 1NGBA 3O6WA 3TPQA 2FSNA 5JLFA 4H0PA 4WQ5C 5AQYA 4B1VA 5AQXA 3CQYA 3VEWA 3D2FB 4B1XB 2ZGYA 5AQQA 2P9LA 3R8EA 5AFUA 2P9SA 4M63C 1EQYA 2IVPA 1RDWX 3C7NA 2FSKA 4CZFA 1KAZA 4BRGA 3VGMA 4L3QA 1T44A 2D4WA 4BR5A 1LOTB 3DXKB 3WXIA 3CERA 1NGIA 1U2VB 3I8BA 2P9PA 5BPNA 3A5MC 2Q97A 5JICA 3SLCA 1E4GT 1T6CA 5F0XA 1K8KB 1HKCA 5AQRA 4PKIA 4Y0WA 5AZIA 2YCHA 3SMPA 4BRDA 2A42A 2IVOA 4M7YA 5BN9A 4H03B 3GDQA 4XH5A 1GLBG 3L4IA 3MCPA 2Q1NA 4BR7A 1TYQB 4K25A 4RWTA 5KQDA 3VPZA 4CZHA 4BR2A 4IWVA 4XH4A 1D4XA 3ULEB 1KAXA 1HLUA 2NZTA 5AQFA 4K42A 3WQUA 2P9NA 2DPNA 1RGIA 1ATRA 4FWSA 1NM1A 2P9UA 3H46O 4WQ4C 3WXJA 2PBDA 1NMDA 4BRCA 3QFPA 1NLVA 3GOIA 3O1BA 1BA1A 2YHWA 2A5XA 3U9ZA 4J8FA 2ITMA 2QXLA 3JXUA 3H6EA 3A5OC 1V4SA 2YJFA 5BPLA 3H1VX 2NRHA 4Z94A 1U6ZA 4FWQA 2I7PA 4A61A 4FWLA 5LJWA 4BRAA 1NGHA 4M7XA 5E26A 3QBXA 3ID8A 2E2QA 2HMPA 3FZHA 2Q36A 4B1UB 4CD3A 2ASMA 4BRPA 2HOEA 2QWOA 1NGDA 2IVNA 3UKRA 3O80A 1KXPA 1ZXOA 2D1KA 3MN6A 4NB4A 5FPMA 4AM6A 3HTVA 4K41A 3FZLA 3VERA 1G99A 4B1WB 1XC3A 1HUXA 2A3ZA 5KPTA 5AQOA 1LCUA 4IXCA 1GLLO 3G25A 5AQMA 1GLCG 4A62A 3FGUA 3H3OB 4IZ9A 4HTLA 3M6GA 4BRHA 2QW9A 2E1YA 3ZETB 3DXKA 4MLHA 4BR0A 3AAQA 1GLFO 2CH6A 3BF1A 2ZWHA 3VF2A 4CZGA 4KBOA 4I6MA 2FXUA 3FFKB 3A8YA 3ATVA 2E8AA 1IG8A 2Q2RA 1K8KA 4H0XB 2E88A 3M3ZA 4BGBA 3D2EB 4B1YB 2ZGZA 4EIAA 2P9IB 1NGJA 4MO4A 4PL7A 2D0PA 3CHWA 3VENA 3VEXA 5FPDA 3HI0A 4QS7A 3EKSA 4BC4A 3H1QA 4H5RA 3HZ6A 1YXQA 1TYQA 3LM2A 5AQLA 3W3DA 2QWLA 3A5LC 2ASOA
chains in the Genus database with same CATH superfamily
2WUSA 3OYKA 3WT0A 4B9NA 4MLEA 1X3NA 3FE1A 5JLHA 1ASWA 4AHTA 4C1NI 3LDLA 1D5AA 4B9SA 3C6HA 3LAKA 5ADXA 2HHIA 4C23A 2XY5A 3SJJA 1VQ9N 1YHQN 4NO7A 3UE5A 1GOBA 3VA3A 4H4MA 4DTRA 4KB1A 2D5RA 5FPNA 4JHDB 3HP6A 3B8AX 4B8CA 1HKBA 3E9PA 4HHTA 3LWLA 2GUPA 2C1IA 3ZEUA 1RDCA 3DM2A 2XHBA 3E01A 4BDYA 4PA1A 3DLHA 5KRTA 3OJSA 1VK0A 4DMNA 4MO5A 3HM9A 3HSCA 4CD1A 4KKOA 3J8AA 2GELA 1KC8O 3IKMA 4Y1DA 1D9DA 3A5NC 4FJNA 5AQWA 4FZXC 1VSDA 1S22A 1RFQA 3ZX3A 1WUAA 4LF9K 2F8SA 3MK6A 2VWBA 3AAPA 3CMAN 3GL1A 3SCXA 2NRXA 4NYFA 4OGCA 1Z25A 3A0IX 4DR6K 3RMCA 4DU3A 3CQXA 4CZIA 3QNNA 2HBLA 4CF1A 4EHTA 3VEVA 5KQ8A 3WNEA 4JI8K 3MX5A 2HBJA 1RTJA 5GIOA 2HMIA 5BN8A 3CFOA 4JS4A 4JI7K 1JLBA 3LZJA 4ISEA 3HL8A 2XY8A 4C8KA 1UAXA 4BC5A 2Z1GA 4DTPA 1OH8A 4Z4FA 5AR0A 2HNZA 2P1JA 3O8MA 2G8HA 3SAHA 1HNZK 2F9WA 1JL2A 4BVOA 2GTDA 2NRRA 3TSUA 3AA2A 1C0GA 3HRGA 3G10A 5F2RA 4H5NA 1XNRK 1OH7A 4B8AB 4K43A 3UB5A 4DR2K 2PFUA 3TAEA 2UYTA 3PX0A 1MDUB 4JKCA 1GLDG 1O1WA 2Y1JA 1WSEA 3CCJN 3IMXA 3U3YA 1BWFO 3KD5E 3F9MA 2GUIA 3MN7A 1YUWA 4OPHA 5GAGP 3S3NA 1VQ6N 3DWLA 1MA9B 4KRFA 2O8FB 2BGGA 4CK1A 3WNHA 4Z4EA 2QXFA 4WFAL 2P5OA 1C0MA 3D7EO 5C42A 1Y64A 4IJNA 4YDUC 1EWRA 3P4IA 4WYBA 4H5WA 3AY9A 1L3UA 3E9LA 5AFUH 3AVIA 3AV9A 2HHVA 1BA0A 3L2QA 1TKDA 4F2SA 3OW2M 3SV3A 4Z4IA 4B9MA 2VGMA 3TU5A 4A57A 2Q0RA 3CC7N 3AVLA 3AVAA 3V81A 4KPYA 2ZE2A 4CBWA 3SPZA 1J5OA 2YHAA 4JV5K 2BH1A 1WSFA 3CPEA 1W0HA 4DQRA 3MDQA 3TSPA 4FWRA 4M3RA 1DEJA 2HHQA 4CGIA 4QS9A 4JKFA 5B8HA 2HBKA 4AHUA 5FPEA 2R7YA 2QWMA 1ASVA 3HP9A 4Z4CA 1OH5A 5MLCQ 4CIGA 3C7NB 5TKYA 3NF7A 1K8AO 3CC4N 1XI1A 3MX2A 3KTQA 1VQNN 1S5JA 1KVAA 3R6MA 4CVNE 1HYVA 4FPBA 4GMJB 4JS5A 4BQZA 3IS9A 3K57A 3ZX0A 2XY6A 1NKEA 3NMUA 1NGFA 3P1GA 4FM1A 1U49A 4F9OA 4NXNK 3WUHA 1RBRA 4CJFA 2ZF5O 2Z1IA 3VF6A 5HOOA 4E89A 2VQFK 4FLZA 4LF5K 2KZZA 5KPRA 3D2EA 2VGNA 4FJ8A 4CEBA 4YOVA 3TANA 3AO3A 3OYAA 3CCUN 3ZEUB 4JKGB 5F1XA 2YKNA 2Y1IA 2IC3A 2PYLA 3RSEA 1KTQA 1S9GA 4CJWA 3OVNA 4M3UA 3L4QA 2P9NB 1ZBLA 4KHSA 3NF8A 4IDKA 5J2NA 2UUBK 2EX3A 3OS1A 1VQ8N 1N8RO 3DLLL 3IDHA 3O9UA 5AQIA 1TUYA 1D9FA 4PKHA 4IG0A 2AJQA 5BPMA 5C0YA 4CJTA 4YOUA 4B3SK 4HWIA 2OPPA 4JI4K 4JK8A 4E1JA 4Z0UA 1C1CA 5T7BA 1SZ2A 2KTQA 2I7NA 5DM7L 4LH5A 4CZLA 4PKGA 3O1WA 2WC9A 1XNQK 1TK8A 4BRNA 3ZSZA 2IGIA 5GIPA 4BG8A 4CJ7A 2E2NA 3SNNA 3VN5A 1TVRA 5AQVA 4Z4HA 4J2BA 4FOEA 3OS2A 2W41A 1RT3A 4B9QA 4L8RB 2D0BA 3TSQA 4H8KA 3C6TA 3UKRB 4CZJA 4DCHA 1C0UA 1B9DA 4C1NK 3THYA 2FSNA 5AQYA 4WQ5C 1HRHA 5AQXA 4IO9L 3VEWA 5I42A 2P9LA 4FLXA 3AA4A 5AFUA 1EQYA 3VTIA 4CZFA 1U04A 4L3QA 4KH5A 1LOTB 1JL1A 4DTUA 2B6AA 3QLHA 3V6DA 1C1BA 1X9MA 3ASMA 2Q97A 3MAQA 2G8VA 4X66K 3I0SA 1T6CA 4F3TA 5AQRA 4Y0WA 1U45A 5AZIA 4IFVA 4MFBA 3AVFA 5FLXO 2YCHA 3Q7CA 2DFEA 1WN7A 3ID6A 4M7YA 4H03B 3MCPA 3IRXA 2Q1NA 4BR7A 3K2PA 4K25A 4DF4A 5JENA 4CZHA 4BR2A 4IWVA 3ZT4A 1D4XA 5KTQA 1CLQA 3ULEB 4CEFA 5HRRA 2WTUA 3C6AA 4K42A 3WQUA 3OYLA 2DPNA 5C2DA 1ATRA 4LFAK 4FWSA 3C95A 2P9UA 1VQ7N 4IEEA 1P90A 4WQ4C 4K0KK 1IKVA 3D6RA 3LDSA 4DS4A 2ETJA 2W42A 1BA1A 5J1EA 4CJUA 3PV8A 4DQQA 3AGRA 3J7AP 4J8FA 1BCOA 3NF6A 3EE9A 2UU9K 3MXIA 1XHZA 1V4SA 4KHWA 3F2KA 3CCQN 3NDKA 4M7XA 5E26A 3QBXA 3C65A 3CM5A 2ASMA 4BRPA 1NK8A 4FJLA 3MCAB 3VQ7A 4DKWA 3HTVA 4K41A 3VMFB 3FZLA 1ZYQA 4DR7K 1G99A 3LPTA 5HBMA 5AQOA 1GLLO 1A5XA 3FGUA 4CFCA 4ZTJA 4YNQA 3B6PA 4HTLA 2E6LA 1WAJA 2Z1JA 1N36K 3BF1A 2ZWHA 4I2PA 4J2AA 1YIJN 1WBBA 4I6MA 2KZMA 3FFKB 1IKWA 3HXMA 2E8AA 4KHNA 4DLEA 1C1AA 4JKBA 5K14A 4EZ6A 5IWAK 4H0XB 3N4PA 2E88A 2G8UA 3D2EB 2UUCK 4B1YB 4DTJA 4EIAA 1NGJA 3MEEA 3T69A 2D0PA 3KK2A 1I3AA 4PHTX 3HI0A 3OYDA 4BC4A 3H1QA 4GV3A 3LALA 3OYJA 4H5RA 3LM2A 4O5BA 1BI4A 5AQLA 5LMUK 3TTCA 4O0IA 4HCBA 4CZEA 5EOYA 3THXA 4BDZA 2QEXN 1HPMA 2O4GA 3D45A 2JWKA 1IKXA 1JKHA 1FKPA 1RBSA 3H08A 4BC2A 1YVNA 2HSTA 3T1HK 1YJ9N 2IDOA 3U9DA 1WSIA 4DWIA 3SBGA 3OYCA 2HHHK 1YVUA 4NCBA 1G15A 1T6DA 4JD2B 5AZJB 2H3GX 2OTLN 1VSFA 5KGXA 4IEIA 3V9ZA 3AA5X 3E9OA 3EN9A 4CECA 4H4OA 3TR8A 3HJFA 3LDOA 1Z05A 1HNXK 1BDGA 4WF9L 4FW1A 2KFNA 4DU4A 1M90O 1FJGK 2HVIA 3K9JA 1WSGA 1CXQA 1DTTA 1RDDA 1BHLA 3K9KA 1LWCA 4Q0BA 3THYB 4BG9A 4H5VA 4LSLA 1IJJA 3ENHA 3MWPA 5CYMA 1XMQK 3AO5A 2O8DA 5C10A 4CJLA 3JS6A 4CW7B 3VQ9A 4FOIA 4DLGA 2AA4A 3KLHA 4M45A 3G6EN 4DV0K 1N33K 5CHIA 4PY5A 4W5NA 4DV6K 3OA9A 5HRSA 3OS0A 1KRPA 4LY7A 3DAWA 3C6UA 4JI3K 5AZIB 1UA1A 1NU0A 1UWBA 3CCVN 1NKCA 2FBYA 1R59O 4FJIA 3SQ2A 4BRQA 4CJQA 4IOAL 4OO1J 2RN2A 5CY4A 2V7YA 4BRMA 3HPOA 3CIPA 4FWNA 4M3YA 1GLAG 1BIUA 3O4QA 2VG7A 3O5BA 4CEAA 3VESA 4IOXA 1J9AA 4A5BA 3P38A 3ZX2A 4E1MA 3NHGA 4CF0A 3VEYA 1OH6A 3CQ8A 3K5OA 3RVCA 1SAZA 3RRGA 3FZKA 4FL9A 4EAHD 2FF6A 2P9KA 3LANA 4AH9A 4N56A 1WSHA 3TAFA 1K73O 4LF6K 1VRTA 3L3VA 3QEPA 4O5FA 1FKOA 4DQ8A 1E3MA 2GWJA 1QVFM 4FW2A 2HVHA 1QHAA 3M8PA 4CK2A 1C0FA 1IBKK 1VQON 2NLXA 1BIZA 3SMSA 2Q0UA 4CZMA 4FJJA 4HUGA 5IT9O 2VCPA 5M1KA 2KFZA 3U4LA 4CIEA 5TKWA 2Q31A 3HM8A 1Q8IA 3VOVA 1NGGA 3BUZB 4JK7A 4CK3A 4JNEA 4FJ9A 2NUBA 4WFNL 4CI6A 2GX9A 1R0AA 2XY7A 3T1YK 4EP5A 3B6OA 1P8ZA 3TTDA 5SZTA 5BRHA 4FWOA 4H0YB 3PUFA 2P51A 1NK6A 1E4FT 1IH7A 3OYHA 3O08A 1H1VA 1RBVA 1XMOK 1U4BA 1NWKA 3DJCA 2QWRA 3VEZA 1Q82O 3BF3A 3JYTA 4XEIA 4I6MB 5BRFA 4FLTA 4DU1A 3HVRA 2F4VK 3EL2A 1A5WA 3O9SA 3TWHA 2A40A 2O8CA 3EEQA 2A6AA 4MQ3A 3I8DA 2OANA 1REVA 4B1ZA 3LM9A 3ITHA 2HHUA 1IG9A 4KHUA 4FXDA 5BR9A 3THVA 1BI4B 2P9SB 3DRRA 1TUUA 4E7KA 2QI2A 3HVTA 1VRUA 5AQKA 4YORA 4BR4A 4CJ4A 2WONA 5J2PA 4JI1K 4DHYA 3CJ7A 5ELZA 5FRNA 4IFYA 2P9PB 3FR0A 4BE1A 3ZSVA 2HHTA 3HOTA 3K58A 3P31A 1Q9XA 4KHPK 1HKGA 1ZC6A 1GLJO 4E7JA 3THWB 1SKSA 4BRIA 4FJ5A 1KQSM 3BDPA 1BGXT 3SK3A 2XO7A 1RT7A 3CJ9A 4B9TA 3AVKA 4CBXA 3N4QA 4W5QA 3WXLA 3G4SN 2QM1A 4G9ZA 2O8EA 1GOCA 2GV9A 4PWDA 3P83D 3FZFA 3OYBA 4IBNA 5J2QA 1MWKA 4DTXA 1XUPO 4GKJK 4IG3A 3QB0A 4EHUA 3A2FA 3SYZA 5EY4A 1YI2N 2G8WA 4CZKA 1C0TA 2O8DB 3BP8A 4A5AA 2VQEK 3V9SA 5DK5A 4KH4A 4OPAA 1TK0A 4CHYA 1RDAA 1VAZA 2KHOA 5EVZA 2UUAK 4UY8O 2YNFA 1NGCA 2JWLA 4B3MK 3FZMA 2KW4A 4X65K 4LSNA 3DI6A 4DTMA 2HF4A 2NRZA 4A2AA 1ITGA 4XIUA 3MXJA 1GLEG 1Q18A 4H0TB 4CIFA 1VQ5N 3ENBA 3OYEA 3EO3A 3CCMN 1JLGA 3OJUA 3ATUA 4M3WA 1S1UA 3QDKA 4ISGA 4JLHA 1JCGA 2AP1A 4CEZA 1JLQA 2BE2A 4HCCA 1NGBA 1N6QA 1SUQA 2FC0A 5JLFA 1RNHA 4B1XB 1JLAA 2HBMA 2ZGYA 4NXMK 1RDWX 2UXCK 3I55N 1VSKA 3VGMA 1TK5A 3PSFA 2D4WA 1KVBA 4E0DA 3CERA 4EP4A 4FM0A 1BL3A 1NK9A 2VWJA 4YOTA 3I8BA 4HVJA 3SLCA 4B3RK 3KLEA 4CJPA 4DQSA 3L3UA 1K8KB 1BQMA 1HKCA 3NVKA 4B9LA 4RW7A 1VQLN 4FZYA 2PYJA 4DQIA 3GDQA 4XH5A 5LMNK 2ITGA 3CM6A 2QTDA 3HPGA 1NOZA 3HOSA 3T19A 5GADP 4XH4A 1NK4A 5CR4A 4B9UA 1X9WA 4FZZA 3ZSXA 1RGIA 1HYZA 1KFSA 4FJMA 3P5JA 1QSSA 4DR1K 3WXJA 1NJXA 3TAPA 1HPZA 3QFPA 2A1RA 2EHGA 3IG1A 3LP3A 2YHWA 3SPYA 2X74A 3U9ZA 2QXLA 1TGOA 5CZ2A 1LAWA 4KFBA 4BEBA 3H6EA 4DSFA 1HNIA 4AHCA 4RW9A 1S1XA 2NRHA 4Z94A 1CZ9A 4FWQA 2I7PA 5LJWA 1U48A 3AVJA 3CPWM 4F3OA 1NGHA 4CCHA 3SBTA 2E2QA 5C12A 3FZHA 4LF8K 2Q36A 4JKEA 2HOEA 1VHXA 3DYAA 1SKRA 1NGDA 3MN6A 1OVQA 1XWLA 4NB4A 1J5EK 3KLIA 1XC3A 1HUXA 2A3ZA 1LCUA 3SUQA 4A62A 4DSLA 1RTIA 2Z1HA 4FLYA 2QW9A 4BR0A 3TI0A 3DXKA 4MLHA 5D3GA 3AAQA 5FROA 2P5GA 4FJKA 3ZT0A 4ZHRA 3VF2A 4W5RA 5LL6Z 3R3LA 4KBOA 3NVMA 4CEOA 1RTDA 1JLCA 3J80O 3ATVA 2E5LK 4KB0A 4NLCA 4I9QA 3M3ZA 4BGBA 3C94A 4MO4A 3ZLJA 4O4GA 1Y97A 5C24A 3VQAA 4W5TA 1NJWA 3VENA 3RR7A 3R1XA 3EKSA 3S9HA 1YXQA 1SL1A 4CHOA 1TYQA 1L3TA 3S3OA 3W3DA 2QWLA 1WLJA 4DTOA 3QESA 1XC9A 5JVGL 4FVUA 1HJOA 4DV5K 1NK0A 4CHQA 3HPHA 4BROA 2QK9A 3CJAA 1EP4A 3WNFA 4FLUA 3AVMA 1KCFA 1K9MO 5AQHA 2CGKA 4DV7K 1YT3A 3O4NA 1IBMK 2VG5A 4AM7A 4CESA 1JLFA 1RBUA 1NJZA 3ENOA 4OVLA 1TV6A 4FO0A 5AQJA 3O3GA 4U67L 4CHZA 2ZJQL 4YOWA 4BWMA 1QS4A 1VSMA 1HQUA 1QSLA 4O55A 3QEIA 2A41A 3CXCM 3UKUA 5C15A 1K6YA 2YJEA 5AQPA 4W5OA 1IBLK 4KREA 3QICA 5AQUA 3CCRN 3LWMA 3TAQA 3MMVA 4V19S 4JI5K 1JCEA 3OBWA 2F9TA 2G8IA 1LWEA 3OTOK 4GKKK 1B92A 1T7PA 2NRTA 4GNIA 3AO1A 4CFBA 1BO5O 1Q86O 4BECA 5EU7A 4BRFA 2YNIA 3QEWA 1SL2A 1RT5A 4A2BA 1J54A 4DFPA 3ZETA 3KKSA 3FFIA 2B5JA 1S1WA 3QEVA 4E19A 2BUPA 4DV1K 4E1NA 4LH4A 4CJEA 1DKGD 2A1SA 1ESVA 2X6NA 3NFAA 3U8XA 4CFDA 3VGKA 1FK9A 2IS3A 2P9IA 5AQTA 3V9UA 2HF3A 5BRDA 4F4KA 3V1OA 4IFEA 4YFUA 2NRVA 5M1OA 4CJSA 1X9SA 1X9JA 1A5VA 2GEMA 3MECA 1EX4A 3CI5A 4CHNA 3DRPA 4CEEA 4CJKA 1ASUA 1BG3A 5BREA 4JKDA 2QKBA 3SUPA 1VQKN 3K5LA 1U2VA 1TAUA 2ZJPL 1QSYA 1VQPN 1ILYA 4EZ9A 4H0VB 3PLAA 5E41A 1L3VA 3EKUA 3KK1A 1DTQA 3WXMB 3I0RA 4FLWA 3VF4A 1I94K 4QS8A 1CZAN 4ID1A 1BOTO 4DB3A 1QE1A 1LW2A 1KLMA 3DLKA 3RSEB 2VG6A 4BE0A 4JHDA 1TL3A 4JI6K 1HQEA 2IOCA 3I33A 2UXBK 4BRKA 3VTHA 4KTQA 3K5MA 3QIPA 2QWQA 3MWTA 3NCIA 2E2OA 3AO2A 3LL3A 2GWKA 3E1YA 4BGAA 3SJHA 4BVPA 2W40A 4H5TA 5J2MA 5I3UA 1JJ2M 1Z26A 3M1FA 5GAHP 4EFHA 5HL7L 4BREA 3L0QA 4PQUA 3K59A 3CD6N 2ATQA 3VQDA 3OYFA 4N76A 3QERA 5CZ1A 3H3NO 4CJVA 3RR8A 2HHSA 2C1GA 4CE9A 5ADXH 4X64K 4DSKA 3BZCA 4FVMA 2D0OA 2NRWA 1VSEA 1ZBFA 1HMVA 4I7FA 4CGHA 3KK7A 1FXXA 3GBTA 1DGKN 2V7ZA 2W6LA 4FWKA 4ILHA 3SQ4A 2YX6A 1T8EA 3LP2A 2P9LB 3G0ZA 3GG4A 4FJGA 3RTVA 4WQ5A 3KHYA 5I9EB 2ZJRL 4CGDA 4I9LA 1WAFA 1VQMN 2W00A 2PAVA 3LDPA 4IOCL 4WCEL 1Q7YO 3EZ5A 2F7TA 2WFBA 1W9HA 3M5RA 3VQ6A 5GINA 3CG7A 2WOMA 4DSIA 1XQSC 4OLBA 3J7ZO 3KIOA 4C8NA 5BR8K 4DTSA 1QZ5A 3EY1A 1VSIA 1FW6A 4KHYA 3GE1A 2YI1A 4XH1A 5AQNA 4B08A 2RPIA 1NMNA 1BU6O 5CE3A 3DRSA 1T03A 1W2BM 3UKUB 4DQPA 4I2QA 1EETA 1ATSA 4FK0A 2RKIA 5H1SQ 2E4LA 4FWPA 1LWFA 3QMLA 3CCLN 1QQOA 2HNDA 4CEQA 2O8FA 3HYFA 2P9UB 3SI6A 4H0OA 3PIOL 3CJ1A 4GV9A 1LAVA 4CFAA 1OVYA 4DR3K 3SUOA 4GY2B 4WQ4A 3ZSQA 2V52B 3LDQA 5E84A 2HHWA 1N32K 3E66A 2YHBA 5JMVA 3MEGA 3AVGA 5AQGA 2OPRA 2RF2A 4ICLA 4HUEA 3VEOA 3V4IA 3VQPA 4KV8A 3MN9A 3AVNA 2BDPA 2QWPA 3CYGA 2E20A 4E3SA 4CERA 1HNVA 1KFDA 1S1VA 3O6WA 4QCLA 4B1VA 2JGUA 3KD1E 1J53A 2KLAA 1RT1A 2E6MA 4WFBL 4M63C 2IVPA 3C7NA 2ZQBA 4BRGA 3QETA 3VQBA 2RHKA 4BR5A 4F2RA 4CGJA 3RWUA 4KAZA 4J2EA 1NGIA 4E7IA 1U2VB 2O4IA 3A5MC 2YV0X 5JICA 3JAMO 4UQGA 3HSTB 4PKIA 2B4JA 3HO1A 4OKJA 1QVGM 2DY4A 4KO0A 3ZT3A 1HNWK 3SMPA 4BRDA 2A42A 1TKZA 1QHTA 3PX6A 1GOAA 2UXDK 4NCAA 3LPUA 4CJ5A 3TARA 5KQDA 1UA0A 3VPZA 4OGEA 3THXB 4JKGA 4M42A 1KAXA 1HLUA 4MDBA 2NZTA 3V1QA 2P9NA 3LZIA 2QKKA 4RW4A 5DMRA 2YNHA 1DT9A 3SQ1A 4O44A 2G8FA 1NM1A 4IKFA 1M1KO 4O0JA 2PBDA 1NMDA 4BRCA 1NLVA 4B9VA 4FCYA 1C6VA 3SV4A 2OTJN 3VA0A 1VQ4N 3PIPL 2ITMA 1BISA 3CYMA 4G1QA 4K8XA 3LP1A 4HUFA 3A5OC 4AILC 1YJNN 3DLRA 4JKAA 1U6ZA 3K5NA 2YNGA 3F9KA 4QAGA 3BZKA 3ZSYA 4RW8A 4GV6A 4GVEA 4TSXA 4B1UB 2D0CA 4CD3A 5SWMA 2X6SA 2KQ2A 5C25A 3UKRA 3O80A 4BE2A 2D1KA 1RTHA 5FPMA 1YJWN 3VERA 4E72A 1NJIO 1WBDA 1KLNA 3U3GA 4CEDA 5GAEP 4A59A 3NGYA 3G25A 5AQMA 1GLCG 1T3VA 1NKBA 3H3OB 3K0SA 4IZ9A 3EE8A 3M6GA 4BRHA 4ELVA 1L3SA 2CH6A 3ZYYX 4CZGA 4PUOA 5HP1A 3HK2A 1Q81O 3A8YA 4Z4GA 3O3HA 3QO9A 1IG8A 2DFFA 1SKWA 4GW6A 2ZGZA 3CFRA 4KI6A 4PL7A 4DFKA 1TKXA 1EKEA 5FPDA 3VEXA 4QS7A 2X78A 3ZT1A 3OBYA 3ZSWA 4DSJA 3RRHA 1NG9A 1SS6A 1RILA 4BE7B 1RT2A 4FPAA 3ULEA 4C8LA 2NNWA 5AQSA 2P9KB 4JI0K 3RMAA 3T3FA 3Q7BA 3KJVA 3F73A 3CCSN 1WOQA 4J2DA 2VWKA 1S6PA 3DXMA 3O3FA 3KLGA 3CF5L 3T7ZA 3RMDA 2CGLA 3HBTA 3PSIA 3DMJA 3L6QA 3AARA 4BC3A 3CCEN 1VSLA 1T05A 1SQKA 1NBWA 3IFRA 3NBPA 3PX4A 2EWSA 4FYDA 1RCHA 3MEDA 4JAXA 1CXUA 3LDNA 4CF8A 3ALYA 3KZBA 3OY9A 3EZWA 4FM2A 4DSEA 4JN4A 2DTUA 2ZD1A 4BWJA 4Q5VA 1MWMA 3WXKA 3V1RA 1YTAA 1UOCA 4FK4A 4FK2A 2I5JA 3O9TA 5CYQA 3U6FA 1KAYA 1W7AA 4O8UA 5EX5A 3OYNA 1QZ6A 4ELUA 2GBZA 3PO5A 4LC9B 4RTFD 4R79A 3HT3A 4GVMA 2KKZA 4OPKA 4KHQA 4DS5A 5HLFA 4ZTFA 2V51B 5FRMA 2DFHA 2VYPA 1HX1A 4KH6A 1OKJA 3CJBA 1DLOA 3L2VA 3FLCO 4CBUA 5M1QA 2RE2A 5KRSA 5KPZA 3WEEA 5M1FA 2O8CB 1XHXA 4DV2K 1N5YA 2E2PA 3IUCA 4DV4K 1EXQA 3I56N 2YKMA 3AO4A 3R9PA 1BUPA 4CGGA 4CHPA 3CFPA 3V9XA 3VQEA 1KVCA 4WE1A 4LF4K 3TAMA 3EYZA 3D2FA 3JSMA 3NGIA 2FBVA 2E1ZA 4JEPA 1NGEA 4PL8A 2FBXA 1YITN 4Y1CA 3NAEA 1WNSA 2ZM6K 3G71N 3VGLA 3L2RA 3DOLA 1KSPA 1V4TA 5LY3A 4M3TA 3DLBA 1NOYA 2ASPA 3V9WA 1HR0K 4YOYA 4DV3K 4NYNA 2OCEA 3DLEA 3LAMA 4KTZA 4JD2A 2O8BA 3QBWA 5AZJA 3CMEN 3PO4A 1LV5A 4JYAK 3KK3A 4E7LA 2O8EB 4N5SA 4E7HA 1S9EA 4B3OA 2HNYA 3ISNC 4DUYK 3W0LA 1IV0A 1X3MA 3KVGA 4F8RA 2J4RA 4CGFA 3J81O 3VQQA 1NGAA 4OKEA 1QTMA 2OYQA 2D0AA 5HRPA 3KLFA 4ILJA 4LFBK 4FSVA 4AHSA 1NNEA 1D8YA 4LFCK 3SZ2A 1F21A 4NCGA 4AHRA 1W97L 1QQMA 4BACA 3KWGA 5M1NA 3L2UA 3QNOA 4M3ZA 4BR9A 4FJ7A 4RG8A 5JS1A 4KI4A 4ILGB 3QFUA 1TAQA 3ZT2A 3VQ4A 3H45C 4DTNA 1VSJA 2OA8A 4N41A 4IJAA 4NLBA 4R5PA 5FDLA 1ZBUA 2FLOA 3OYGA 1ZBSA 3M8RA 3BEXA 1ATNA 2IIRA 4YDUA 3ZSRA 3PY8A 1HYSA 1BQNA 1S1TA 1LW0A 1N34K 4B3TK 1RT6A 2QWNA 1QQNA 5EXWA 3MXMA 3LP0A 5C2FA 4DUZK 3O4WA 3DXMB 1KD1O 3AA3A 4OPJA 2HHXA 1RBTA 2QA4N 1I39A 2OPSA 4DFMA 4OX9K 3WQTA 3TABA 2FF3B 3OHRA 4JRPA 4LD0A 5KGWA 5LJVA 3KKRA 2YHXA 3CJCA 1S3XA 3IAYA 5AJ3K 4OLAA 1SL0A 1NJYA 2Q3SA 4BDPA 3S3MA 1YAGA 2YHYA 3VQ8A 2JLEA 1RDBA 5HRNA 4IO8A 2FSJA 5HROA 2BTFA 2CGJA 3M8QA 1RT4A 4AF1A 4DF8A 1X1PA 4FWMA 3J7YP 1EO1A 1SV5A 5A2QO 2CH5A 3SAFA 1TL1A 5DM6L 4YHHK 4C8OA 4RCHA 4O8KA 4MDAA 1Z6RA 1BCMA 3VETA 4ISFA 4N47A 4QOZB 4CJ3A 3S41A 1YTUA 2HB5A 3BY5A 4BQLA 3CETA 1JCFA 3C0BA 3SQ0A 4ELTA 3MN5A 3WEEB 1WSJA 3P39A 4OKKA 5AQZA 1J6ZA 4XJXA 4JI2K 1JXBA 1TKTA 4BRLA 3L2WA 2F8TA 2FBTA 4DR5K 3TPQA 1NK5A 4H0PA 1QQCA 4CF2A 3CQYA 4AQYK 3D2FB 3ZCMA 5AQQA 3L8BA 3R8EA 1U47A 2P9SA 3QIOA 3M8SA 3WNGA 2FSKA 1KAZA 3SUNA 3AGKA 4FLVA 2LSNA 1T44A 3DXKB 3WXIA 4YOXA 3CC2N 4K8ZA 2PZSA 3ULDA 2F96A 2P9PA 5BPNA 5JVHL 3QINA 2BANA 1E4GT 5F0XA 4OJRA 4DFJA 1IO2A 4JRQA 2PY5A 4U7BA 4LF7K 3THWA 2O8BB 2IVOA 5BN9A 3AVCA 1GLBG 3DOKA 3L4IA 1WB9A 4IDHA 1TYQB 3UIQA 4RWTA 4M41A 3F5TA 1O13A 3S5TA 3VQ5A 3AVBA 4HTUA 3O9RA 5AQFA 3D0PA 3AVHA 4KTWA 3VQCA 4X62K 3TAGA 1Q9YA 1EWQA 3H46O 3NF9A 4DR4K 5M1PA 4JK9A 4YY3K 4AHVA 3GOIA 3O1BA 3NGZA 1RDUA 3DLGA 2OZMA 2A5XA 1VSHA 1JXEA 1JLEA 3JXUA 3TTFA 2YJFA 5BPLA 1L5UA 3H1VX 2OZSA 2W6KA 4A61A 4FWLA 4BRAA 2XRIA 4BY9C 1S6QA 1ZBIA 3ID8A 2HMPA 3NH2A 4FJXA 2QWOA 2IVNA 1HJRA 2HW3A 1KXPA 1ZXOA 4AM6A 1S72N 4CJRA 3T1AA 3RMBA 4B1WB 5KPTA 2G8KA 1ZBHA 4IXCA 5KI6A 4JKHA 3NH1A 3QEXA 2E1YA 5JS2A 3ZETB 4DG1A 1GLFO 3OYIA 4FJHA 1MU2A 3BGRA 1CZBA 4ID5A 4CF9A 2FXUA 2WBNA 1YF5L 2Q2RA 1K8KA 3ZSOA 3NE6A 4M3XA 1NK7A 2OPQA 1B9FA 3O9QA 4C8MA 2P9IB 3CHWA 3KWIA 3NH0A 3OYMA 1IKYA 2IAJA 4RW6A 3HZ6A 3SAGA 3A5LC 2ASOA
chains in the Genus database with same CATH topology
4CZEA 5JVGL 5EOYA 4FVUA 4FPAA 1HJOA 2WUSA 3ULEA 2QEXN 3WT0A 4BROA 1HPMA 2NNWA 4MLEA 5AQSA 2P9KB 1X3NA 3FE1A 5JLHA 2JWKA 3CJAA 4C1NI 3LDLA 3Q7BA 1K9MO 3CCSN 3C6HA 5AQHA 1WOQA 2CGKA 4BC2A 1YVNA 2HSTA 3DXMA 5ADXA 1YJ9N 3U9DA 4C23A 3CF5L 3T7ZA 3SBGA 4AM7A 2CGLA 3ENOA 3HBTA 1VQ9N 1YHQN 1T6DA 4NO7A 4JD2B 3L6QA 4FO0A 5AQJA 5AZJB 3AARA 3UE5A 4BC3A 4U67L 2H3GX 2ZJQL 3CCEN 4YOWA 2OTLN 1SQKA 1NBWA 3IFRA 4IEIA 3EN9A 3E9OA 5FPNA 4JHDB 3LDOA 3B8AX 2EWSA 1Z05A 1HKBA 3E9PA 1BDGA 4WF9L 2GUPA 2C1IA 3ZEUA 2A41A 4JAXA 3CXCM 3UKUA 5C15A 3LDNA 1M90O 3K9JA 3KZBA 2YJEA 3EZWA 3K9KA 5AQPA 4JN4A 3QICA 1MWMA 5AQUA 3WXKA 3CCRN 4BG9A 4H5VA 4MO5A 3HSCA 3MMVA 1IJJA 1JCEA 2F9TA 3OBWA 4CD1A 3ENHA 3J8AA 3MWPA 3O9TA 2GELA 1KAYA 3IKMA 1KC8O 4O8UA 5EX5A 3A5NC 1QZ6A 5C10A 2NRTA 4GNIA 4LC9B 5AQWA 1BO5O 1Q86O 3JS6A 4BECA 1S22A 1RFQA 3ZX3A 4BRFA 1WUAA 4RTFD 4R79A 3MK6A 2VWBA 3AAPA 4FOIA 2KKZA 3GL1A 3CMAN 2AA4A 2V51B 3G6EN 2NRXA 5CHIA 3A0IX 2VYPA 1HX1A 3OA9A 1OKJA 4KH6A 3CJBA 4A2BA 3FLCO 3ZETA 4CBUA 5M1QA 2RE2A 3CQXA 4CZIA 5KPZA 3DAWA 5AZIB 2HBLA 3WEEA 4EHTA 5M1FA 3VEVA 5KQ8A 2E2PA 3MX5A 2HBJA 3IUCA 3CCVN 5GIOA 2BUPA 5BN8A 1R59O 3I56N 1DKGD 3R9PA 4OO1J 1ESVA 1BUPA 4BRQA 3U8XA 4IOAL 3VGKA 2V7YA 4ISEA 5AQTA 2P9IA 4BRMA 2HF3A 3CIPA 5BRDA 4FWNA 1GLAG 4BC5A 3O5BA 3D2FA 4IFEA 3VESA 2NRVA 5AR0A 2E1ZA 4JEPA 1NGEA 3O8MA 4IOXA 4PL8A 5M1OA 4A5BA 3P38A 3ZX2A 3SAHA 1YITN 1X9JA 3VEYA 2GEMA 2F9WA 3G71N 4BVOA 3CI5A 3RVCA 3VGLA 2GTDA 1SAZA 3FZKA 4FL9A 4EAHD 2NRRA 2FF6A 1V4TA 2P9KA 5LY3A 1BG3A 3TSUA 5BREA 1C0GA 4JKDA 3HRGA 2ASPA 1VQKN 5F2RA 1U2VA 4H5NA 4YOYA 2ZJPL 1K73O 1VQPN 1ILYA 4H0VB 4O5FA 4DQ8A 3PLAA 4K43A 3UB5A 2GWJA 1QVFM 3EKUA 1QHAA 2PFUA 3WXMB 1C0FA 2UYTA 4JD2A 3VF4A 4QS8A 3QBWA 5AZJA 1VQON 3CMEN 1CZAN 2NLXA 1MDUB 1BOTO 4DB3A 4JKCA 1GLDG 3SMSA 3RSEB 2Q0UA 4CZMA 3CCJN 3IMXA 1BWFO 4JHDA 3F9MA 3W0LA 1X3MA 1YUWA 3I33A 3KVGA 3MN7A 4OPHA 5GAGP 3DWLA 2VCPA 4BRKA 2J4RA 1VQ6N 1MA9B 3VTHA 5M1KA 1NGAA 2QWQA 3U4LA 5TKWA 2Q31A 4WFAL 3HM8A 3D7EO 3MWTA 3VOVA 1NGGA 2E2OA 3BUZB 4JK7A 4JNEA 1Y64A 3LL3A 4IJNA 4YDUC 4WFNL 3P4IA 2GX9A 4ILJA 4CI6A 2GWKA 4WYBA 4FSVA 4H5WA 3AY9A 3E1YA 3E9LA 5AFUH 1P8ZA 4BGAA 3SJHA 3TTDA 4BVPA 2W40A 4H5TA 1JJ2M 3M1FA 5GAHP 5BRHA 1W97L 4EFHA 1QQMA 4FWOA 3KWGA 3L0QA 1BA0A 4BREA 5M1NA 5HL7L 3CD6N 4H0YB 1E4FT 4BR9A 3OW2M 2VGMA 3O08A 3H3NO 1H1VA 4ILGB 3TU5A 2C1GA 1NWKA 3QFUA 2Q0RA 4A57A 3DJCA 3CC7N 2QWRA 3VEZA 5ADXH 1Q82O 3BF3A 4XEIA 4I6MB 3H45C 2D0OA 4CBWA 5BRFA 2NRWA 2BH1A 3KK7A 3GBTA 1DGKN 3CPEA 3EL2A 3MDQA 4IJAA 4NLBA 3O9SA 3TSPA 2V7ZA 2A40A 4FWRA 2A6AA 1DEJA 4FWKA 4ILHA 2FLOA 2OANA 2YX6A 4QS9A 4B1ZA 4JKFA 5B8HA 2HBKA 5FPEA 3LM9A 1ZBSA 2QWMA 3BEXA 1ATNA 2IIRA 2P9LB 3GG4A 4YDUA 5BR9A 5MLCQ 2P9SB 3C7NB 4WQ5A 3KHYA 5TKYA 1TUUA 1K8AO 3CC4N 3MX2A 2QI2A 5I9EB 2ZJRL 5AQKA 4YORA 4BR4A 1VQMN 1VQNN 2W00A 2PAVA 2QWNA 1QQNA 3R6MA 5EXWA 3LDPA 4DHYA 3CJ7A 4FPBA 5ELZA 5C2FA 4IOCL 2P9PB 4WCEL 1Q7YO 2F7TA 4BQZA 3FR0A 3O4WA 2WFBA 3DXMB 1KD1O 3M5RA 3ZX0A 5GINA 3HOTA 2QA4N 3NMUA 1XQSC 1NGFA 4F9OA 3P31A 3WUHA 3WQTA 3J7ZO 1HKGA 1ZC6A 1GLJO 2ZF5O 3VF6A 4BRIA 2FF3B 1QZ5A 3OHRA 1KQSM 5HOOA 3GE1A 2YI1A 3SK3A 5LJVA 4XH1A 5AQNA 2YHXA 3CJCA 1S3XA 5KPRA 3D2EA 1BU6O 2VGNA 3CJ9A 5CE3A 4YOVA 1W2BM 4CBXA 3CCUN 3N4QA 3ZEUB 3WXLA 4JKGB 5F1XA 3G4SN 3UKUB 2QM1A 4G9ZA 3RSEA 1ATSA 1YAGA 2YHYA 5H1SQ 3FZFA 3L4QA 2P9NB 4FWPA 3QMLA 1MWKA 4IO8A 2FSJA 1QQOA 1XUPO 3CCLN 2BTFA 2CGJA 2P9UB 4AF1A 3QB0A 4H0OA 4EHUA 3PIOL 3CJ1A 4GV9A 1VQ8N 1N8RO 3DLLL 3IDHA 3O9UA 5AQIA 4FWMA 5EY4A 1YI2N 1EO1A 2CH5A 1TUYA 4CZKA 3SAFA 3BP8A 1OVYA 4PKHA 4A5AA 5BPMA 5DM6L 5C0YA 4GY2B 4YOUA 4KH4A 4OPAA 4RCHA 4HWIA 1VAZA 2KHOA 4JK8A 4O8KA 4WQ4A 5EVZA 4MDAA 4E1JA 1SZ2A 4UY8O 1Z6RA 1NGCA 2I7NA 2JWLA 2V52B 3VETA 5DM7L 4CZLA 4ISFA 3FZMA 3LDQA 5E84A 4PKGA 3O1WA 3E66A 3S41A 5JMVA 2WC9A 4BQLA 2HF4A 3CETA 2NRZA 5AQGA 4BRNA 4A2AA 1JCFA 3C0BA 5GIPA 1GLEG 1Q18A 4H0TB 4BG8A 3MN5A 3WEEB 1VQ5N 3ENBA 4CJ7A 3EO3A 3CCMN 2E2NA 3VEOA 3ATUA 3P39A 5AQVA 5AQZA 1J6ZA 4FOEA 3QDKA 2W41A 3MN9A 4ISGA 4B9QA 4XJXA 2QWPA 3TSQA 1JCGA 2E20A 2AP1A 3UKRB 4BRLA 4CZJA 4DCHA 4C1NK 1NGBA 3O6WA 3TPQA 2FSNA 5JLFA 4H0PA 4WQ5C 5AQYA 4B1VA 5AQXA 3CQYA 4IO9L 2KLAA 3D2FB 3VEWA 4B1XB 2HBMA 2ZGYA 5AQQA 2P9LA 3R8EA 4WFBL 5AFUA 2P9SA 4M63C 1EQYA 2IVPA 1RDWX 3C7NA 3VTIA 2FSKA 4CZFA 1KAZA 3I55N 4BRGA 3VGMA 3AGKA 4L3QA 1T44A 2D4WA 2RHKA 4KH5A 1LOTB 3DXKB 3WXIA 3CERA 4BR5A 4YOXA 3CC2N 1NGIA 1U2VB 4YOTA 3I8BA 2P9PA 5BPNA 5JVHL 3A5MC 2Q97A 5JICA 3SLCA 1E4GT 1T6CA 5F0XA 1K8KB 1HKCA 5AQRA 4PKIA 3NVKA 4Y0WA 4U7BA 5AZIA 1QVGM 2YCHA 3Q7CA 1VQLN 3ID6A 3SMPA 4BRDA 2A42A 2IVOA 4M7YA 5BN9A 4H03B 3GDQA 4XH5A 1GLBG 3L4IA 3MCPA 4IDHA 2QTDA 2Q1NA 4BR7A 1TYQB 4K25A 4RWTA 5KQDA 3VPZA 3HOSA 5GADP 4CZHA 4BR2A 4IWVA 4XH4A 4JKGA 3F5TA 1D4XA 1O13A 3ULEB 5CR4A 1KAXA 1HLUA 4MDBA 2NZTA 3O9RA 5AQFA 3C6AA 4K42A 3WQUA 2P9NA 2DPNA 1RGIA 5C2DA 1ATRA 4FWSA 1DT9A 1NM1A 2P9UA 3H46O 1M1KO 1VQ7N 4IEEA 1P90A 5M1PA 4WQ4C 4JK9A 3WXJA 2PBDA 1NMDA 4BRCA 3QFPA 1NLVA 3D6RA 3GOIA 3O1BA 2OTJN 1BA1A 1RDUA 2YHWA 1VQ4N 2A5XA 3PIPL 3AGRA 3U9ZA 4J8FA 2ITMA 2QXLA 3EE9A 4BEBA 3JXUA 3H6EA 3TTFA 3A5OC 1V4SA 2YJFA 5BPLA 1YJNN 3H1VX 3F2KA 3CCQN 2NRHA 4Z94A 4JKAA 1U6ZA 4FWQA 2I7PA 4A61A 4FWLA 5LJWA 3CPWM 4BRAA 1NGHA 4M7XA 4BY9C 5E26A 3QBXA 4GV6A 3ID8A 4GVEA 3SBTA 2E2QA 5C12A 3C65A 2HMPA 3FZHA 2Q36A 4B1UB 4CD3A 2ASMA 4JKEA 4BRPA 2HOEA 2QWOA 1NGDA 2IVNA 3UKRA 3O80A 1KXPA 1ZXOA 2D1KA 3MCAB 3MN6A 4NB4A 5FPMA 4AM6A 4DKWA 1YJWN 3HTVA 1S72N 4K41A 3VMFB 3FZLA 3VERA 1NJIO 1G99A 4B1WB 5GAEP 1XC3A 1HUXA 2A3ZA 5KPTA 5AQOA 1LCUA 4A59A 4IXCA 1GLLO 3G25A 5AQMA 1GLCG 1T3VA 4A62A 3FGUA 3H3OB 4IZ9A 3EE8A 4HTLA 3M6GA 4JKHA 4BRHA 2QW9A 2E1YA 3ZETB 3DXKA 4MLHA 4BR0A 3AAQA 1GLFO 2CH6A 3BF1A 2ZWHA 3ZYYX 3VF2A 4CZGA 1YIJN 3R3LA 4KBOA 3NVMA 4I6MA 1Q81O 2FXUA 3FFKB 3A8YA 3ATVA 2WBNA 2E8AA 1IG8A 1YF5L 4JKBA 2Q2RA 1K8KA 4NLCA 4H0XB 3N4PA 2E88A 3M3ZA 4BGBA 3D2EB 4B1YB 2ZGZA 3O9QA 4EIAA 2P9IB 1NGJA 4MO4A 3T69A 4PL7A 2D0PA 3CHWA 3KWIA 4PHTX 3VENA 3VEXA 5FPDA 3HI0A 4QS7A 3R1XA 3EKSA 4BC4A 3H1QA 4GV3A 4H5RA 3HZ6A 3OBYA 1YXQA 1TYQA 3LM2A 5AQLA 3SAGA 3W3DA 2QWLA 3A5LC 1SS6A 3TTCA 4BE7B 2ASOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZE A;  5EOY A;  4FPA A;  1HJO A;  2WUS A;  3ULE A;  3WT0 A;  4BRO A;  1HPM A;  4MLE A;  5AQS A;  2P9K B;  1X3N A;  3FE1 A;  5JLH A;  3CJA A;  3LDL A;  5AQH A;  1WOQ A;  2CGK A;  4BC2 A;  1YVN A;  3DXM A;  5ADX A;  3U9D A;  4C23 A;  4AM7 A;  2CGL A;  3ENO A;  3HBT A;  1T6D A;  4NO7 A;  4JD2 B;  3L6Q A;  4FO0 A;  5AQJ A;  5AZJ B;  3AAR A;  3UE5 A;  4BC3 A;  2H3G X;  1SQK A;  1NBW A;  3IFR A;  3EN9 A;  5FPN A;  4JHD B;  3LDO A;  3B8A X;  2EWS A;  1Z05 A;  1HKB A;  1BDG A;  2GUP A;  3ZEU A;  2A41 A;  4JAX A;  3UKU A;  3LDN A;  3KZB A;  2YJE A;  3EZW A;  5AQP A;  4JN4 A;  3QIC A;  1MWM A;  5AQU A;  3WXK A;  4BG9 A;  4H5V A;  4MO5 A;  3HSC A;  3MMV A;  1IJJ A;  1JCE A;  2F9T A;  4CD1 A;  3ENH A;  3J8A A;  2GEL A;  1KAY A;  5EX5 A;  3A5N C;  1QZ6 A;  4GNI A;  4LC9 B;  5AQW A;  1BO5 O;  3JS6 A;  1S22 A;  1RFQ A;  3ZX3 A;  4BRF A;  1WUA A;  4RTF D;  3MK6 A;  2VWB A;  3AAP A;  4FOI A;  3GL1 A;  2AA4 A;  2V51 B;  3A0I X;  2VYP A;  1HX1 A;  4A2B A;  1OKJ A;  3CJB A;  3FLC O;  3ZET A;  4CBU A;  3CQX A;  4CZI A;  5KPZ A;  3DAW A;  5AZI B;  4EHT A;  3WEE A;  3VEV A;  5KQ8 A;  2E2P A;  3IUC A;  2BUP A;  5BN8 A;  1R59 O;  1DKG D;  3R9P A;  1ESV A;  1BUP A;  4BRQ A;  3U8X A;  3VGK A;  2V7Y A;  4ISE A;  5AQT A;  2P9I A;  4BRM A;  2HF3 A;  3CIP A;  5BRD A;  4FWN A;  1GLA G;  4BC5 A;  3O5B A;  3D2F A;  3VES A;  5AR0 A;  2E1Z A;  1NGE A;  3O8M A;  4PL8 A;  3ZX2 A;  1X9J A;  3VEY A;  2GEM A;  2F9W A;  4BVO A;  3CI5 A;  3VGL A;  2GTD A;  1SAZ A;  3FZK A;  4FL9 A;  4EAH D;  2FF6 A;  1V4T A;  2P9K A;  5LY3 A;  1BG3 A;  5BRE A;  1C0G A;  2ASP A;  5F2R A;  1U2V A;  4H5N A;  4H0V B;  4O5F A;  4DQ8 A;  4K43 A;  3UB5 A;  2GWJ A;  3EKU A;  1QHA A;  1C0F A;  2UYT A;  4JD2 A;  3VF4 A;  4QS8 A;  3QBW A;  5AZJ A;  1CZA N;  2NLX A;  1MDU B;  1BOT O;  4DB3 A;  1GLD G;  3SMS A;  3RSE B;  2Q0U A;  4CZM A;  3IMX A;  1BWF O;  4JHD A;  3F9M A;  3W0L A;  1X3M A;  1YUW A;  3I33 A;  3KVG A;  3MN7 A;  3DWL A;  2VCP A;  4BRK A;  2J4R A;  1MA9 B;  1NGA A;  2QWQ A;  3U4L A;  2Q31 A;  3HM8 A;  3D7E O;  3VOV A;  1NGG A;  2E2O A;  3BUZ B;  4JNE A;  1Y64 A;  3LL3 A;  4IJN A;  4YDU C;  3P4I A;  4CI6 A;  2GWK A;  4WYB A;  4FSV A;  4H5W A;  3AY9 A;  5AFU H;  1P8Z A;  4BGA A;  3SJH A;  4BVP A;  2W40 A;  4H5T A;  3M1F A;  5BRH A;  4EFH A;  1QQM A;  4FWO A;  4BRE A;  3L0Q A;  1BA0 A;  4H0Y B;  1E4F T;  4BR9 A;  3O08 A;  3H3N O;  1H1V A;  3TU5 A;  1NWK A;  3QFU A;  2Q0R A;  3DJC A;  2QWR A;  3VEZ A;  5ADX H;  3BF3 A;  4XEI A;  4I6M B;  3H45 C;  2D0O A;  4CBW A;  5BRF A;  3GBT A;  1DGK N;  3EL2 A;  3MDQ A;  4IJA A;  2V7Z A;  2A40 A;  4FWR A;  2A6A A;  1DEJ A;  4FWK A;  2FLO A;  2OAN A;  4QS9 A;  4B1Z A;  5B8H A;  5FPE A;  3LM9 A;  1ZBS A;  2QWM A;  3BEX A;  1ATN A;  2IIR A;  2P9L B;  3GG4 A;  4YDU A;  5BR9 A;  2P9S B;  3C7N B;  4WQ5 A;  3KHY A;  5TKY A;  1TUU A;  5I9E B;  5AQK A;  4BR4 A;  2PAV A;  2QWN A;  1QQN A;  3R6M A;  5EXW A;  3LDP A;  4DHY A;  3CJ7 A;  4FPB A;  5ELZ A;  2P9P B;  4BQZ A;  3FR0 A;  3O4W A;  3DXM B;  3ZX0 A;  1XQS C;  1NGF A;  4F9O A;  3WUH A;  3WQT A;  1HKG A;  1ZC6 A;  1GLJ O;  2ZF5 O;  3VF6 A;  4BRI A;  2FF3 B;  1QZ5 A;  3OHR A;  3GE1 A;  2YI1 A;  3SK3 A;  5LJV A;  4XH1 A;  5AQN A;  2YHX A;  3CJC A;  1S3X A;  5KPR A;  3D2E A;  1BU6 O;  3CJ9 A;  5CE3 A;  4CBX A;  3ZEU B;  3WXL A;  5F1X A;  3UKU B;  2QM1 A;  3RSE A;  1ATS A;  1YAG A;  2YHY A;  3FZF A;  2P9N B;  4FWP A;  3QML A;  1MWK A;  4IO8 A;  2FSJ A;  1QQO A;  1XUP O;  2BTF A;  2CGJ A;  2P9U B;  3QB0 A;  4H0O A;  4EHU A;  3CJ1 A;  3IDH A;  5EY4 A;  5AQI A;  4FWM A;  2CH5 A;  1TUY A;  4CZK A;  3BP8 A;  4PKH A;  5BPM A;  4GY2 B;  4RCH A;  4HWI A;  2KHO A;  4O8K A;  4E1J A;  5EVZ A;  4WQ4 A;  1SZ2 A;  1Z6R A;  1NGC A;  2I7N A;  2V52 B;  3VET A;  4CZL A;  4ISF A;  3FZM A;  3LDQ A;  5E84 A;  4PKG A;  3O1W A;  3S41 A;  5JMV A;  4BQL A;  2HF4 A;  3CET A;  5AQG A;  4BRN A;  4A2A A;  1JCF A;  3C0B A;  1Q18 A;  1GLE G;  4H0T B;  4BG8 A;  3MN5 A;  3WEE B;  4CJ7 A;  3EO3 A;  2E2N A;  3VEO A;  3ATU A;  5AQV A;  5AQZ A;  1J6Z A;  4FOE A;  3QDK A;  2W41 A;  3MN9 A;  4ISG A;  4B9Q A;  2QWP A;  1JCG A;  2E20 A;  2AP1 A;  3UKR B;  4BRL A;  4CZJ A;  4DCH A;  1NGB A;  3O6W A;  3TPQ A;  2FSN A;  5JLF A;  4H0P A;  4WQ5 C;  5AQY A;  4B1V A;  5AQX A;  3CQY A;  3VEW A;  3D2F B;  4B1X B;  2ZGY A;  5AQQ A;  2P9L A;  3R8E A;  5AFU A;  2P9S A;  4M63 C;  1EQY A;  2IVP A;  1RDW X;  3C7N A;  2FSK A;  4CZF A;  1KAZ A;  4BRG A;  3VGM A;  4L3Q A;  1T44 A;  2D4W A;  4BR5 A;  1LOT B;  3DXK B;  3WXI A;  3CER A;  1NGI A;  1U2V B;  3I8B A;  2P9P A;  5BPN A;  3A5M C;  2Q97 A;  5JIC A;  3SLC A;  1E4G T;  1T6C A;  5F0X A;  1K8K B;  1HKC A;  5AQR A;  4PKI A;  4Y0W A;  5AZI A;  2YCH A;  3SMP A;  4BRD A;  2A42 A;  2IVO A;  4M7Y A;  5BN9 A;  4H03 B;  3GDQ A;  4XH5 A;  1GLB G;  3L4I A;  3MCP A;  2Q1N A;  4BR7 A;  1TYQ B;  4K25 A;  4RWT A;  5KQD A;  3VPZ A;  4CZH A;  4BR2 A;  4IWV A;  4XH4 A;  1D4X A;  3ULE B;  1KAX A;  1HLU A;  2NZT A;  5AQF A;  4K42 A;  3WQU A;  2P9N A;  2DPN A;  1RGI A;  1ATR A;  4FWS A;  1NM1 A;  2P9U A;  3H46 O;  4WQ4 C;  3WXJ A;  2PBD A;  1NMD A;  4BRC A;  3QFP A;  1NLV A;  3GOI A;  3O1B A;  1BA1 A;  2YHW A;  2A5X A;  3U9Z A;  4J8F A;  2ITM A;  2QXL A;  3JXU A;  3H6E A;  3A5O C;  1V4S A;  2YJF A;  5BPL A;  3H1V X;  2NRH A;  4Z94 A;  1U6Z A;  4FWQ A;  2I7P A;  4A61 A;  4FWL A;  5LJW A;  4BRA A;  1NGH A;  4M7X A;  5E26 A;  3QBX A;  3ID8 A;  2E2Q A;  2HMP A;  3FZH A;  2Q36 A;  4B1U B;  4CD3 A;  2ASM A;  4BRP A;  2HOE A;  2QWO A;  1NGD A;  2IVN A;  3UKR A;  3O80 A;  1KXP A;  1ZXO A;  2D1K A;  3MN6 A;  4NB4 A;  5FPM A;  4AM6 A;  3HTV A;  4K41 A;  3FZL A;  3VER A;  1G99 A;  4B1W B;  1XC3 A;  1HUX A;  2A3Z A;  5KPT A;  5AQO A;  1LCU A;  4IXC A;  1GLL O;  3G25 A;  5AQM A;  1GLC G;  4A62 A;  3FGU A;  3H3O B;  4IZ9 A;  4HTL A;  3M6G A;  4BRH A;  2QW9 A;  2E1Y A;  3ZET B;  3DXK A;  4MLH A;  4BR0 A;  3AAQ A;  1GLF O;  2CH6 A;  3BF1 A;  2ZWH A;  3VF2 A;  4CZG A;  4KBO A;  4I6M A;  2FXU A;  3FFK B;  3A8Y A;  3ATV A;  2E8A A;  1IG8 A;  2Q2R A;  1K8K A;  4H0X B;  2E88 A;  3M3Z A;  4BGB A;  3D2E B;  4B1Y B;  2ZGZ A;  4EIA A;  2P9I B;  1NGJ A;  4MO4 A;  4PL7 A;  2D0P A;  3CHW A;  3VEN A;  3VEX A;  5FPD A;  3HI0 A;  4QS7 A;  3EKS A;  4BC4 A;  3H1Q A;  4H5R A;  3HZ6 A;  1YXQ A;  1TYQ A;  3LM2 A;  5AQL A;  3W3D A;  2QWL A;  3A5L C;  2ASO A; 
#chains in the Genus database with same CATH topology
 2WUS A;  3OYK A;  3WT0 A;  4B9N A;  4MLE A;  1X3N A;  3FE1 A;  5JLH A;  1ASW A;  4AHT A;  4C1N I;  3LDL A;  1D5A A;  4B9S A;  3C6H A;  3LAK A;  5ADX A;  2HHI A;  4C23 A;  2XY5 A;  3SJJ A;  1VQ9 N;  1YHQ N;  4NO7 A;  3UE5 A;  1GOB A;  3VA3 A;  4H4M A;  4DTR A;  4KB1 A;  2D5R A;  5FPN A;  4JHD B;  3HP6 A;  3B8A X;  4B8C A;  1HKB A;  3E9P A;  4HHT A;  3LWL A;  2GUP A;  2C1I A;  3ZEU A;  1RDC A;  3DM2 A;  2XHB A;  3E01 A;  4BDY A;  4PA1 A;  3DLH A;  5KRT A;  3OJS A;  1VK0 A;  4DMN A;  4MO5 A;  3HM9 A;  3HSC A;  4CD1 A;  4KKO A;  3J8A A;  2GEL A;  1KC8 O;  3IKM A;  4Y1D A;  1D9D A;  3A5N C;  4FJN A;  5AQW A;  4FZX C;  1VSD A;  1S22 A;  1RFQ A;  3ZX3 A;  1WUA A;  4LF9 K;  2F8S A;  3MK6 A;  2VWB A;  3AAP A;  3CMA N;  3GL1 A;  3SCX A;  2NRX A;  4NYF A;  4OGC A;  1Z25 A;  3A0I X;  4DR6 K;  3RMC A;  4DU3 A;  3CQX A;  4CZI A;  3QNN A;  2HBL A;  4CF1 A;  4EHT A;  3VEV A;  5KQ8 A;  3WNE A;  4JI8 K;  3MX5 A;  2HBJ A;  1RTJ A;  5GIO A;  2HMI A;  5BN8 A;  3CFO A;  4JS4 A;  4JI7 K;  1JLB A;  3LZJ A;  4ISE A;  3HL8 A;  2XY8 A;  4C8K A;  1UAX A;  4BC5 A;  2Z1G A;  4DTP A;  1OH8 A;  4Z4F A;  5AR0 A;  2HNZ A;  2P1J A;  3O8M A;  2G8H A;  3SAH A;  1HNZ K;  2F9W A;  1JL2 A;  4BVO A;  2GTD A;  2NRR A;  3TSU A;  3AA2 A;  1C0G A;  3HRG A;  3G10 A;  5F2R A;  4H5N A;  1XNR K;  1OH7 A;  4B8A B;  4K43 A;  3UB5 A;  4DR2 K;  2PFU A;  3TAE A;  2UYT A;  3PX0 A;  1MDU B;  4JKC A;  1GLD G;  1O1W A;  2Y1J A;  1WSE A;  3CCJ N;  3IMX A;  3U3Y A;  1BWF O;  3KD5 E;  3F9M A;  2GUI A;  3MN7 A;  1YUW A;  4OPH A;  5GAG P;  3S3N A;  1VQ6 N;  3DWL A;  1MA9 B;  4KRF A;  2O8F B;  2BGG A;  4CK1 A;  3WNH A;  4Z4E A;  2QXF A;  4WFA L;  2P5O A;  1C0M A;  3D7E O;  5C42 A;  1Y64 A;  4IJN A;  4YDU C;  1EWR A;  3P4I A;  4WYB A;  4H5W A;  3AY9 A;  1L3U A;  3E9L A;  5AFU H;  3AVI A;  3AV9 A;  2HHV A;  1BA0 A;  3L2Q A;  1TKD A;  4F2S A;  3OW2 M;  3SV3 A;  4Z4I A;  4B9M A;  2VGM A;  3TU5 A;  4A57 A;  2Q0R A;  3CC7 N;  3AVL A;  3AVA A;  3V81 A;  4KPY A;  2ZE2 A;  4CBW A;  3SPZ A;  1J5O A;  2YHA A;  4JV5 K;  2BH1 A;  1WSF A;  3CPE A;  1W0H A;  4DQR A;  3MDQ A;  3TSP A;  4FWR A;  4M3R A;  1DEJ A;  2HHQ A;  4CGI A;  4QS9 A;  4JKF A;  5B8H A;  2HBK A;  4AHU A;  5FPE A;  2R7Y A;  2QWM A;  1ASV A;  3HP9 A;  4Z4C A;  1OH5 A;  5MLC Q;  4CIG A;  3C7N B;  5TKY A;  3NF7 A;  1K8A O;  3CC4 N;  1XI1 A;  3MX2 A;  3KTQ A;  1VQN N;  1S5J A;  1KVA A;  3R6M A;  4CVN E;  1HYV A;  4FPB A;  4GMJ B;  4JS5 A;  4BQZ A;  3IS9 A;  3K57 A;  3ZX0 A;  2XY6 A;  1NKE A;  3NMU A;  1NGF A;  3P1G A;  4FM1 A;  1U49 A;  4F9O A;  4NXN K;  3WUH A;  1RBR A;  4CJF A;  2ZF5 O;  2Z1I A;  3VF6 A;  5HOO A;  4E89 A;  2VQF K;  4FLZ A;  4LF5 K;  2KZZ A;  5KPR A;  3D2E A;  2VGN A;  4FJ8 A;  4CEB A;  4YOV A;  3TAN A;  3AO3 A;  3OYA A;  3CCU N;  3ZEU B;  4JKG B;  5F1X A;  2YKN A;  2Y1I A;  2IC3 A;  2PYL A;  3RSE A;  1KTQ A;  1S9G A;  4CJW A;  3OVN A;  4M3U A;  3L4Q A;  2P9N B;  1ZBL A;  4KHS A;  3NF8 A;  4IDK A;  5J2N A;  2UUB K;  2EX3 A;  3OS1 A;  1VQ8 N;  1N8R O;  3DLL L;  3IDH A;  3O9U A;  5AQI A;  1TUY A;  1D9F A;  4PKH A;  4IG0 A;  2AJQ A;  5BPM A;  5C0Y A;  4CJT A;  4YOU A;  4B3S K;  4HWI A;  2OPP A;  4JI4 K;  4JK8 A;  4E1J A;  4Z0U A;  1C1C A;  5T7B A;  1SZ2 A;  2KTQ A;  2I7N A;  5DM7 L;  4LH5 A;  4CZL A;  4PKG A;  3O1W A;  2WC9 A;  1XNQ K;  1TK8 A;  4BRN A;  3ZSZ A;  2IGI A;  5GIP A;  4BG8 A;  4CJ7 A;  2E2N A;  3SNN A;  3VN5 A;  1TVR A;  5AQV A;  4Z4H A;  4J2B A;  4FOE A;  3OS2 A;  2W41 A;  1RT3 A;  4B9Q A;  4L8R B;  2D0B A;  3TSQ A;  4H8K A;  3C6T A;  3UKR B;  4CZJ A;  4DCH A;  1C0U A;  1B9D A;  4C1N K;  3THY A;  2FSN A;  5AQY A;  4WQ5 C;  1HRH A;  5AQX A;  4IO9 L;  3VEW A;  5I42 A;  2P9L A;  4FLX A;  3AA4 A;  5AFU A;  1EQY A;  3VTI A;  4CZF A;  1U04 A;  4L3Q A;  4KH5 A;  1LOT B;  1JL1 A;  4DTU A;  2B6A A;  3QLH A;  3V6D A;  1C1B A;  1X9M A;  3ASM A;  2Q97 A;  3MAQ A;  2G8V A;  4X66 K;  3I0S A;  1T6C A;  4F3T A;  5AQR A;  4Y0W A;  1U45 A;  5AZI A;  4IFV A;  4MFB A;  3AVF A;  5FLX O;  2YCH A;  3Q7C A;  2DFE A;  1WN7 A;  3ID6 A;  4M7Y A;  4H03 B;  3MCP A;  3IRX A;  2Q1N A;  4BR7 A;  3K2P A;  4K25 A;  4DF4 A;  5JEN A;  4CZH A;  4BR2 A;  4IWV A;  3ZT4 A;  1D4X A;  5KTQ A;  1CLQ A;  3ULE B;  4CEF A;  5HRR A;  2WTU A;  3C6A A;  4K42 A;  3WQU A;  3OYL A;  2DPN A;  5C2D A;  1ATR A;  4LFA K;  4FWS A;  3C95 A;  2P9U A;  1VQ7 N;  4IEE A;  1P90 A;  4WQ4 C;  4K0K K;  1IKV A;  3D6R A;  3LDS A;  4DS4 A;  2ETJ A;  2W42 A;  1BA1 A;  5J1E A;  4CJU A;  3PV8 A;  4DQQ A;  3AGR A;  3J7A P;  4J8F A;  1BCO A;  3NF6 A;  3EE9 A;  2UU9 K;  3MXI A;  1XHZ A;  1V4S A;  4KHW A;  3F2K A;  3CCQ N;  3NDK A;  4M7X A;  5E26 A;  3QBX A;  3C65 A;  3CM5 A;  2ASM A;  4BRP A;  1NK8 A;  4FJL A;  3MCA B;  3VQ7 A;  4DKW A;  3HTV A;  4K41 A;  3VMF B;  3FZL A;  1ZYQ A;  4DR7 K;  1G99 A;  3LPT A;  5HBM A;  5AQO A;  1GLL O;  1A5X A;  3FGU A;  4CFC A;  4ZTJ A;  4YNQ A;  3B6P A;  4HTL A;  2E6L A;  1WAJ A;  2Z1J A;  1N36 K;  3BF1 A;  2ZWH A;  4I2P A;  4J2A A;  1YIJ N;  1WBB A;  4I6M A;  2KZM A;  3FFK B;  1IKW A;  3HXM A;  2E8A A;  4KHN A;  4DLE A;  1C1A A;  4JKB A;  5K14 A;  4EZ6 A;  5IWA K;  4H0X B;  3N4P A;  2E88 A;  2G8U A;  3D2E B;  2UUC K;  4B1Y B;  4DTJ A;  4EIA A;  1NGJ A;  3MEE A;  3T69 A;  2D0P A;  3KK2 A;  1I3A A;  4PHT X;  3HI0 A;  3OYD A;  4BC4 A;  3H1Q A;  4GV3 A;  3LAL A;  3OYJ A;  4H5R A;  3LM2 A;  4O5B A;  1BI4 A;  5AQL A;  5LMU K;  3TTC A;  4O0I A;  4HCB A;  4CZE A;  5EOY A;  3THX A;  4BDZ A;  2QEX N;  1HPM A;  2O4G A;  3D45 A;  2JWK A;  1IKX A;  1JKH A;  1FKP A;  1RBS A;  3H08 A;  4BC2 A;  1YVN A;  2HST A;  3T1H K;  1YJ9 N;  2IDO A;  3U9D A;  1WSI A;  4DWI A;  3SBG A;  3OYC A;  2HHH K;  1YVU A;  4NCB A;  1G15 A;  1T6D A;  4JD2 B;  5AZJ B;  2H3G X;  2OTL N;  1VSF A;  5KGX A;  4IEI A;  3V9Z A;  3AA5 X;  3E9O A;  3EN9 A;  4CEC A;  4H4O A;  3TR8 A;  3HJF A;  3LDO A;  1Z05 A;  1HNX K;  1BDG A;  4WF9 L;  4FW1 A;  2KFN A;  4DU4 A;  1M90 O;  1FJG K;  2HVI A;  3K9J A;  1WSG A;  1CXQ A;  1DTT A;  1RDD A;  1BHL A;  3K9K A;  1LWC A;  4Q0B A;  3THY B;  4BG9 A;  4H5V A;  4LSL A;  1IJJ A;  3ENH A;  3MWP A;  5CYM A;  1XMQ K;  3AO5 A;  2O8D A;  5C10 A;  4CJL A;  3JS6 A;  4CW7 B;  3VQ9 A;  4FOI A;  4DLG A;  2AA4 A;  3KLH A;  4M45 A;  3G6E N;  4DV0 K;  1N33 K;  5CHI A;  4PY5 A;  4W5N A;  4DV6 K;  3OA9 A;  5HRS A;  3OS0 A;  1KRP A;  4LY7 A;  3DAW A;  3C6U A;  4JI3 K;  5AZI B;  1UA1 A;  1NU0 A;  1UWB A;  3CCV N;  1NKC A;  2FBY A;  1R59 O;  4FJI A;  3SQ2 A;  4BRQ A;  4CJQ A;  4IOA L;  4OO1 J;  2RN2 A;  5CY4 A;  2V7Y A;  4BRM A;  3HPO A;  3CIP A;  4FWN A;  4M3Y A;  1GLA G;  1BIU A;  3O4Q A;  2VG7 A;  3O5B A;  4CEA A;  3VES A;  4IOX A;  1J9A A;  4A5B A;  3P38 A;  3ZX2 A;  4E1M A;  3NHG A;  4CF0 A;  3VEY A;  1OH6 A;  3CQ8 A;  3K5O A;  3RVC A;  1SAZ A;  3RRG A;  3FZK A;  4FL9 A;  4EAH D;  2FF6 A;  2P9K A;  3LAN A;  4AH9 A;  4N56 A;  1WSH A;  3TAF A;  1K73 O;  4LF6 K;  1VRT A;  3L3V A;  3QEP A;  4O5F A;  1FKO A;  4DQ8 A;  1E3M A;  2GWJ A;  1QVF M;  4FW2 A;  2HVH A;  1QHA A;  3M8P A;  4CK2 A;  1C0F A;  1IBK K;  1VQO N;  2NLX A;  1BIZ A;  3SMS A;  2Q0U A;  4CZM A;  4FJJ A;  4HUG A;  5IT9 O;  2VCP A;  5M1K A;  2KFZ A;  3U4L A;  4CIE A;  5TKW A;  2Q31 A;  3HM8 A;  1Q8I A;  3VOV A;  1NGG A;  3BUZ B;  4JK7 A;  4CK3 A;  4JNE A;  4FJ9 A;  2NUB A;  4WFN L;  4CI6 A;  2GX9 A;  1R0A A;  2XY7 A;  3T1Y K;  4EP5 A;  3B6O A;  1P8Z A;  3TTD A;  5SZT A;  5BRH A;  4FWO A;  4H0Y B;  3PUF A;  2P51 A;  1NK6 A;  1E4F T;  1IH7 A;  3OYH A;  3O08 A;  1H1V A;  1RBV A;  1XMO K;  1U4B A;  1NWK A;  3DJC A;  2QWR A;  3VEZ A;  1Q82 O;  3BF3 A;  3JYT A;  4XEI A;  4I6M B;  5BRF A;  4FLT A;  4DU1 A;  3HVR A;  2F4V K;  3EL2 A;  1A5W A;  3O9S A;  3TWH A;  2A40 A;  2O8C A;  3EEQ A;  2A6A A;  4MQ3 A;  3I8D A;  2OAN A;  1REV A;  4B1Z A;  3LM9 A;  3ITH A;  2HHU A;  1IG9 A;  4KHU A;  4FXD A;  5BR9 A;  3THV A;  1BI4 B;  2P9S B;  3DRR A;  1TUU A;  4E7K A;  2QI2 A;  3HVT A;  1VRU A;  5AQK A;  4YOR A;  4BR4 A;  4CJ4 A;  2WON A;  5J2P A;  4JI1 K;  4DHY A;  3CJ7 A;  5ELZ A;  5FRN A;  4IFY A;  2P9P B;  3FR0 A;  4BE1 A;  3ZSV A;  2HHT A;  3HOT A;  3K58 A;  3P31 A;  1Q9X A;  4KHP K;  1HKG A;  1ZC6 A;  1GLJ O;  4E7J A;  3THW B;  1SKS A;  4BRI A;  4FJ5 A;  1KQS M;  3BDP A;  1BGX T;  3SK3 A;  2XO7 A;  1RT7 A;  3CJ9 A;  4B9T A;  3AVK A;  4CBX A;  3N4Q A;  4W5Q A;  3WXL A;  3G4S N;  2QM1 A;  4G9Z A;  2O8E A;  1GOC A;  2GV9 A;  4PWD A;  3P83 D;  3FZF A;  3OYB A;  4IBN A;  5J2Q A;  1MWK A;  4DTX A;  1XUP O;  4GKJ K;  4IG3 A;  3QB0 A;  4EHU A;  3A2F A;  3SYZ A;  5EY4 A;  1YI2 N;  2G8W A;  4CZK A;  1C0T A;  2O8D B;  3BP8 A;  4A5A A;  2VQE K;  3V9S A;  5DK5 A;  4KH4 A;  4OPA A;  1TK0 A;  4CHY A;  1RDA A;  1VAZ A;  2KHO A;  5EVZ A;  2UUA K;  4UY8 O;  2YNF A;  1NGC A;  2JWL A;  4B3M K;  3FZM A;  2KW4 A;  4X65 K;  4LSN A;  3DI6 A;  4DTM A;  2HF4 A;  2NRZ A;  4A2A A;  1ITG A;  4XIU A;  3MXJ A;  1GLE G;  1Q18 A;  4H0T B;  4CIF A;  1VQ5 N;  3ENB A;  3OYE A;  3EO3 A;  3CCM N;  1JLG A;  3OJU A;  3ATU A;  4M3W A;  1S1U A;  3QDK A;  4ISG A;  4JLH A;  1JCG A;  2AP1 A;  4CEZ A;  1JLQ A;  2BE2 A;  4HCC A;  1NGB A;  1N6Q A;  1SUQ A;  2FC0 A;  5JLF A;  1RNH A;  4B1X B;  1JLA A;  2HBM A;  2ZGY A;  4NXM K;  1RDW X;  2UXC K;  3I55 N;  1VSK A;  3VGM A;  1TK5 A;  3PSF A;  2D4W A;  1KVB A;  4E0D A;  3CER A;  4EP4 A;  4FM0 A;  1BL3 A;  1NK9 A;  2VWJ A;  4YOT A;  3I8B A;  4HVJ A;  3SLC A;  4B3R K;  3KLE A;  4CJP A;  4DQS A;  3L3U A;  1K8K B;  1BQM A;  1HKC A;  3NVK A;  4B9L A;  4RW7 A;  1VQL N;  4FZY A;  2PYJ A;  4DQI A;  3GDQ A;  4XH5 A;  5LMN K;  2ITG A;  3CM6 A;  2QTD A;  3HPG A;  1NOZ A;  3HOS A;  3T19 A;  5GAD P;  4XH4 A;  1NK4 A;  5CR4 A;  4B9U A;  1X9W A;  4FZZ A;  3ZSX A;  1RGI A;  1HYZ A;  1KFS A;  4FJM A;  3P5J A;  1QSS A;  4DR1 K;  3WXJ A;  1NJX A;  3TAP A;  1HPZ A;  3QFP A;  2A1R A;  2EHG A;  3IG1 A;  3LP3 A;  2YHW A;  3SPY A;  2X74 A;  3U9Z A;  2QXL A;  1TGO A;  5CZ2 A;  1LAW A;  4KFB A;  4BEB A;  3H6E A;  4DSF A;  1HNI A;  4AHC A;  4RW9 A;  1S1X A;  2NRH A;  4Z94 A;  1CZ9 A;  4FWQ A;  2I7P A;  5LJW A;  1U48 A;  3AVJ A;  3CPW M;  4F3O A;  1NGH A;  4CCH A;  3SBT A;  2E2Q A;  5C12 A;  3FZH A;  4LF8 K;  2Q36 A;  4JKE A;  2HOE A;  1VHX A;  3DYA A;  1SKR A;  1NGD A;  3MN6 A;  1OVQ A;  1XWL A;  4NB4 A;  1J5E K;  3KLI A;  1XC3 A;  1HUX A;  2A3Z A;  1LCU A;  3SUQ A;  4A62 A;  4DSL A;  1RTI A;  2Z1H A;  4FLY A;  2QW9 A;  4BR0 A;  3TI0 A;  3DXK A;  4MLH A;  5D3G A;  3AAQ A;  5FRO A;  2P5G A;  4FJK A;  3ZT0 A;  4ZHR A;  3VF2 A;  4W5R A;  5LL6 Z;  3R3L A;  4KBO A;  3NVM A;  4CEO A;  1RTD A;  1JLC A;  3J80 O;  3ATV A;  2E5L K;  4KB0 A;  4NLC A;  4I9Q A;  3M3Z A;  4BGB A;  3C94 A;  4MO4 A;  3ZLJ A;  4O4G A;  1Y97 A;  5C24 A;  3VQA A;  4W5T A;  1NJW A;  3VEN A;  3RR7 A;  3R1X A;  3EKS A;  3S9H A;  1YXQ A;  1SL1 A;  4CHO A;  1TYQ A;  1L3T A;  3S3O A;  3W3D A;  2QWL A;  1WLJ A;  4DTO A;  3QES A;  1XC9 A;  5JVG L;  4FVU A;  1HJO A;  4DV5 K;  1NK0 A;  4CHQ A;  3HPH A;  4BRO A;  2QK9 A;  3CJA A;  1EP4 A;  3WNF A;  4FLU A;  3AVM A;  1KCF A;  1K9M O;  5AQH A;  2CGK A;  4DV7 K;  1YT3 A;  3O4N A;  1IBM K;  2VG5 A;  4AM7 A;  4CES A;  1JLF A;  1RBU A;  1NJZ A;  3ENO A;  4OVL A;  1TV6 A;  4FO0 A;  5AQJ A;  3O3G A;  4U67 L;  4CHZ A;  2ZJQ L;  4YOW A;  4BWM A;  1QS4 A;  1VSM A;  1HQU A;  1QSL A;  4O55 A;  3QEI A;  2A41 A;  3CXC M;  3UKU A;  5C15 A;  1K6Y A;  2YJE A;  5AQP A;  4W5O A;  1IBL K;  4KRE A;  3QIC A;  5AQU A;  3CCR N;  3LWM A;  3TAQ A;  3MMV A;  4V19 S;  4JI5 K;  1JCE A;  3OBW A;  2F9T A;  2G8I A;  1LWE A;  3OTO K;  4GKK K;  1B92 A;  1T7P A;  2NRT A;  4GNI A;  3AO1 A;  4CFB A;  1BO5 O;  1Q86 O;  4BEC A;  5EU7 A;  4BRF A;  2YNI A;  3QEW A;  1SL2 A;  1RT5 A;  4A2B A;  1J54 A;  4DFP A;  3ZET A;  3KKS A;  3FFI A;  2B5J A;  1S1W A;  3QEV A;  4E19 A;  2BUP A;  4DV1 K;  4E1N A;  4LH4 A;  4CJE A;  1DKG D;  2A1S A;  1ESV A;  2X6N A;  3NFA A;  3U8X A;  4CFD A;  3VGK A;  1FK9 A;  2IS3 A;  2P9I A;  5AQT A;  3V9U A;  2HF3 A;  5BRD A;  4F4K A;  3V1O A;  4IFE A;  4YFU A;  2NRV A;  5M1O A;  4CJS A;  1X9S A;  1X9J A;  1A5V A;  2GEM A;  3MEC A;  1EX4 A;  3CI5 A;  4CHN A;  3DRP A;  4CEE A;  4CJK A;  1ASU A;  1BG3 A;  5BRE A;  4JKD A;  2QKB A;  3SUP A;  1VQK N;  3K5L A;  1U2V A;  1TAU A;  2ZJP L;  1QSY A;  1VQP N;  1ILY A;  4EZ9 A;  4H0V B;  3PLA A;  5E41 A;  1L3V A;  3EKU A;  3KK1 A;  1DTQ A;  3WXM B;  3I0R A;  4FLW A;  3VF4 A;  1I94 K;  4QS8 A;  1CZA N;  4ID1 A;  1BOT O;  4DB3 A;  1QE1 A;  1LW2 A;  1KLM A;  3DLK A;  3RSE B;  2VG6 A;  4BE0 A;  4JHD A;  1TL3 A;  4JI6 K;  1HQE A;  2IOC A;  3I33 A;  2UXB K;  4BRK A;  3VTH A;  4KTQ A;  3K5M A;  3QIP A;  2QWQ A;  3MWT A;  3NCI A;  2E2O A;  3AO2 A;  3LL3 A;  2GWK A;  3E1Y A;  4BGA A;  3SJH A;  4BVP A;  2W40 A;  4H5T A;  5J2M A;  5I3U A;  1JJ2 M;  1Z26 A;  3M1F A;  5GAH P;  4EFH A;  5HL7 L;  4BRE A;  3L0Q A;  4PQU A;  3K59 A;  3CD6 N;  2ATQ A;  3VQD A;  3OYF A;  4N76 A;  3QER A;  5CZ1 A;  3H3N O;  4CJV A;  3RR8 A;  2HHS A;  2C1G A;  4CE9 A;  5ADX H;  4X64 K;  4DSK A;  3BZC A;  4FVM A;  2D0O A;  2NRW A;  1VSE A;  1ZBF A;  1HMV A;  4I7F A;  4CGH A;  3KK7 A;  1FXX A;  3GBT A;  1DGK N;  2V7Z A;  2W6L A;  4FWK A;  4ILH A;  3SQ4 A;  2YX6 A;  1T8E A;  3LP2 A;  2P9L B;  3G0Z A;  3GG4 A;  4FJG A;  3RTV A;  4WQ5 A;  3KHY A;  5I9E B;  2ZJR L;  4CGD A;  4I9L A;  1WAF A;  1VQM N;  2W00 A;  2PAV A;  3LDP A;  4IOC L;  4WCE L;  1Q7Y O;  3EZ5 A;  2F7T A;  2WFB A;  1W9H A;  3M5R A;  3VQ6 A;  5GIN A;  3CG7 A;  2WOM A;  4DSI A;  1XQS C;  4OLB A;  3J7Z O;  3KIO A;  4C8N A;  5BR8 K;  4DTS A;  1QZ5 A;  3EY1 A;  1VSI A;  1FW6 A;  4KHY A;  3GE1 A;  2YI1 A;  4XH1 A;  5AQN A;  4B08 A;  2RPI A;  1NMN A;  1BU6 O;  5CE3 A;  3DRS A;  1T03 A;  1W2B M;  3UKU B;  4DQP A;  4I2Q A;  1EET A;  1ATS A;  4FK0 A;  2RKI A;  5H1S Q;  2E4L A;  4FWP A;  1LWF A;  3QML A;  3CCL N;  1QQO A;  2HND A;  4CEQ A;  2O8F A;  3HYF A;  2P9U B;  3SI6 A;  4H0O A;  3PIO L;  3CJ1 A;  4GV9 A;  1LAV A;  4CFA A;  1OVY A;  4DR3 K;  3SUO A;  4GY2 B;  4WQ4 A;  3ZSQ A;  2V52 B;  3LDQ A;  5E84 A;  2HHW A;  1N32 K;  3E66 A;  2YHB A;  5JMV A;  3MEG A;  3AVG A;  5AQG A;  2OPR A;  2RF2 A;  4ICL A;  4HUE A;  3VEO A;  3V4I A;  3VQP A;  4KV8 A;  3MN9 A;  3AVN A;  2BDP A;  2QWP A;  3CYG A;  2E20 A;  4E3S A;  4CER A;  1HNV A;  1KFD A;  1S1V A;  3O6W A;  4QCL A;  4B1V A;  2JGU A;  3KD1 E;  1J53 A;  2KLA A;  1RT1 A;  2E6M A;  4WFB L;  4M63 C;  2IVP A;  3C7N A;  2ZQB A;  4BRG A;  3QET A;  3VQB A;  2RHK A;  4BR5 A;  4F2R A;  4CGJ A;  3RWU A;  4KAZ A;  4J2E A;  1NGI A;  4E7I A;  1U2V B;  2O4I A;  3A5M C;  2YV0 X;  5JIC A;  3JAM O;  4UQG A;  3HST B;  4PKI A;  2B4J A;  3HO1 A;  4OKJ A;  1QVG M;  2DY4 A;  4KO0 A;  3ZT3 A;  1HNW K;  3SMP A;  4BRD A;  2A42 A;  1TKZ A;  1QHT A;  3PX6 A;  1GOA A;  2UXD K;  4NCA A;  3LPU A;  4CJ5 A;  3TAR A;  5KQD A;  1UA0 A;  3VPZ A;  4OGE A;  3THX B;  4JKG A;  4M42 A;  1KAX A;  1HLU A;  4MDB A;  2NZT A;  3V1Q A;  2P9N A;  3LZI A;  2QKK A;  4RW4 A;  5DMR A;  2YNH A;  1DT9 A;  3SQ1 A;  4O44 A;  2G8F A;  1NM1 A;  4IKF A;  1M1K O;  4O0J A;  2PBD A;  1NMD A;  4BRC A;  1NLV A;  4B9V A;  4FCY A;  1C6V A;  3SV4 A;  2OTJ N;  3VA0 A;  1VQ4 N;  3PIP L;  2ITM A;  1BIS A;  3CYM A;  4G1Q A;  4K8X A;  3LP1 A;  4HUF A;  3A5O C;  4AIL C;  1YJN N;  3DLR A;  4JKA A;  1U6Z A;  3K5N A;  2YNG A;  3F9K A;  4QAG A;  3BZK A;  3ZSY A;  4RW8 A;  4GV6 A;  4GVE A;  4TSX A;  4B1U B;  2D0C A;  4CD3 A;  5SWM A;  2X6S A;  2KQ2 A;  5C25 A;  3UKR A;  3O80 A;  4BE2 A;  2D1K A;  1RTH A;  5FPM A;  1YJW N;  3VER A;  4E72 A;  1NJI O;  1WBD A;  1KLN A;  3U3G A;  4CED A;  5GAE P;  4A59 A;  3NGY A;  3G25 A;  5AQM A;  1GLC G;  1T3V A;  1NKB A;  3H3O B;  3K0S A;  4IZ9 A;  3EE8 A;  3M6G A;  4BRH A;  4ELV A;  1L3S A;  2CH6 A;  3ZYY X;  4CZG A;  4PUO A;  5HP1 A;  3HK2 A;  1Q81 O;  3A8Y A;  4Z4G A;  3O3H A;  3QO9 A;  1IG8 A;  2DFF A;  1SKW A;  4GW6 A;  2ZGZ A;  3CFR A;  4KI6 A;  4PL7 A;  4DFK A;  1TKX A;  1EKE A;  5FPD A;  3VEX A;  4QS7 A;  2X78 A;  3ZT1 A;  3OBY A;  3ZSW A;  4DSJ A;  3RRH A;  1NG9 A;  1SS6 A;  1RIL A;  4BE7 B;  1RT2 A;  4FPA A;  3ULE A;  4C8L A;  2NNW A;  5AQS A;  2P9K B;  4JI0 K;  3RMA A;  3T3F A;  3Q7B A;  3KJV A;  3F73 A;  3CCS N;  1WOQ A;  4J2D A;  2VWK A;  1S6P A;  3DXM A;  3O3F A;  3KLG A;  3CF5 L;  3T7Z A;  3RMD A;  2CGL A;  3HBT A;  3PSI A;  3DMJ A;  3L6Q A;  3AAR A;  4BC3 A;  3CCE N;  1VSL A;  1T05 A;  1SQK A;  1NBW A;  3IFR A;  3NBP A;  3PX4 A;  2EWS A;  4FYD A;  1RCH A;  3MED A;  4JAX A;  1CXU A;  3LDN A;  4CF8 A;  3ALY A;  3KZB A;  3OY9 A;  3EZW A;  4FM2 A;  4DSE A;  4JN4 A;  2DTU A;  2ZD1 A;  4BWJ A;  4Q5V A;  1MWM A;  3WXK A;  3V1R A;  1YTA A;  1UOC A;  4FK4 A;  4FK2 A;  2I5J A;  3O9T A;  5CYQ A;  3U6F A;  1KAY A;  1W7A A;  4O8U A;  5EX5 A;  3OYN A;  1QZ6 A;  4ELU A;  2GBZ A;  3PO5 A;  4LC9 B;  4RTF D;  4R79 A;  3HT3 A;  4GVM A;  2KKZ A;  4OPK A;  4KHQ A;  4DS5 A;  5HLF A;  4ZTF A;  2V51 B;  5FRM A;  2DFH A;  2VYP A;  1HX1 A;  4KH6 A;  1OKJ A;  3CJB A;  1DLO A;  3L2V A;  3FLC O;  4CBU A;  5M1Q A;  2RE2 A;  5KRS A;  5KPZ A;  3WEE A;  5M1F A;  2O8C B;  1XHX A;  4DV2 K;  1N5Y A;  2E2P A;  3IUC A;  4DV4 K;  1EXQ A;  3I56 N;  2YKM A;  3AO4 A;  3R9P A;  1BUP A;  4CGG A;  4CHP A;  3CFP A;  3V9X A;  3VQE A;  1KVC A;  4WE1 A;  4LF4 K;  3TAM A;  3EYZ A;  3D2F A;  3JSM A;  3NGI A;  2FBV A;  2E1Z A;  4JEP A;  1NGE A;  4PL8 A;  2FBX A;  1YIT N;  4Y1C A;  3NAE A;  1WNS A;  2ZM6 K;  3G71 N;  3VGL A;  3L2R A;  3DOL A;  1KSP A;  1V4T A;  5LY3 A;  4M3T A;  3DLB A;  1NOY A;  2ASP A;  3V9W A;  1HR0 K;  4YOY A;  4DV3 K;  4NYN A;  2OCE A;  3DLE A;  3LAM A;  4KTZ A;  4JD2 A;  2O8B A;  3QBW A;  5AZJ A;  3CME N;  3PO4 A;  1LV5 A;  4JYA K;  3KK3 A;  4E7L A;  2O8E B;  4N5S A;  4E7H A;  1S9E A;  4B3O A;  2HNY A;  3ISN C;  4DUY K;  3W0L A;  1IV0 A;  1X3M A;  3KVG A;  4F8R A;  2J4R A;  4CGF A;  3J81 O;  3VQQ A;  1NGA A;  4OKE A;  1QTM A;  2OYQ A;  2D0A A;  5HRP A;  3KLF A;  4ILJ A;  4LFB K;  4FSV A;  4AHS A;  1NNE A;  1D8Y A;  4LFC K;  3SZ2 A;  1F21 A;  4NCG A;  4AHR A;  1W97 L;  1QQM A;  4BAC A;  3KWG A;  5M1N A;  3L2U A;  3QNO A;  4M3Z A;  4BR9 A;  4FJ7 A;  4RG8 A;  5JS1 A;  4KI4 A;  4ILG B;  3QFU A;  1TAQ A;  3ZT2 A;  3VQ4 A;  3H45 C;  4DTN A;  1VSJ A;  2OA8 A;  4N41 A;  4IJA A;  4NLB A;  4R5P A;  5FDL A;  1ZBU A;  2FLO A;  3OYG A;  1ZBS A;  3M8R A;  3BEX A;  1ATN A;  2IIR A;  4YDU A;  3ZSR A;  3PY8 A;  1HYS A;  1BQN A;  1S1T A;  1LW0 A;  1N34 K;  4B3T K;  1RT6 A;  2QWN A;  1QQN A;  5EXW A;  3MXM A;  3LP0 A;  5C2F A;  4DUZ K;  3O4W A;  3DXM B;  1KD1 O;  3AA3 A;  4OPJ A;  2HHX A;  1RBT A;  2QA4 N;  1I39 A;  2OPS A;  4DFM A;  4OX9 K;  3WQT A;  3TAB A;  2FF3 B;  3OHR A;  4JRP A;  4LD0 A;  5KGW A;  5LJV A;  3KKR A;  2YHX A;  3CJC A;  1S3X A;  3IAY A;  5AJ3 K;  4OLA A;  1SL0 A;  1NJY A;  2Q3S A;  4BDP A;  3S3M A;  1YAG A;  2YHY A;  3VQ8 A;  2JLE A;  1RDB A;  5HRN A;  4IO8 A;  2FSJ A;  5HRO A;  2BTF A;  2CGJ A;  3M8Q A;  1RT4 A;  4AF1 A;  4DF8 A;  1X1P A;  4FWM A;  3J7Y P;  1EO1 A;  1SV5 A;  5A2Q O;  2CH5 A;  3SAF A;  1TL1 A;  5DM6 L;  4YHH K;  4C8O A;  4RCH A;  4O8K A;  4MDA A;  1Z6R A;  1BCM A;  3VET A;  4ISF A;  4N47 A;  4QOZ B;  4CJ3 A;  3S41 A;  1YTU A;  2HB5 A;  3BY5 A;  4BQL A;  3CET A;  1JCF A;  3C0B A;  3SQ0 A;  4ELT A;  3MN5 A;  3WEE B;  1WSJ A;  3P39 A;  4OKK A;  5AQZ A;  1J6Z A;  4XJX A;  4JI2 K;  1JXB A;  1TKT A;  4BRL A;  3L2W A;  2F8T A;  2FBT A;  4DR5 K;  3TPQ A;  1NK5 A;  4H0P A;  1QQC A;  4CF2 A;  3CQY A;  4AQY K;  3D2F B;  3ZCM A;  5AQQ A;  3L8B A;  3R8E A;  1U47 A;  2P9S A;  3QIO A;  3M8S A;  3WNG A;  2FSK A;  1KAZ A;  3SUN A;  3AGK A;  4FLV A;  2LSN A;  1T44 A;  3DXK B;  3WXI A;  4YOX A;  3CC2 N;  4K8Z A;  2PZS A;  3ULD A;  2F96 A;  2P9P A;  5BPN A;  5JVH L;  3QIN A;  2BAN A;  1E4G T;  5F0X A;  4OJR A;  4DFJ A;  1IO2 A;  4JRQ A;  2PY5 A;  4U7B A;  4LF7 K;  3THW A;  2O8B B;  2IVO A;  5BN9 A;  3AVC A;  1GLB G;  3DOK A;  3L4I A;  1WB9 A;  4IDH A;  1TYQ B;  3UIQ A;  4RWT A;  4M41 A;  3F5T A;  1O13 A;  3S5T A;  3VQ5 A;  3AVB A;  4HTU A;  3O9R A;  5AQF A;  3D0P A;  3AVH A;  4KTW A;  3VQC A;  4X62 K;  3TAG A;  1Q9Y A;  1EWQ A;  3H46 O;  3NF9 A;  4DR4 K;  5M1P A;  4JK9 A;  4YY3 K;  4AHV A;  3GOI A;  3O1B A;  3NGZ A;  1RDU A;  3DLG A;  2OZM A;  2A5X A;  1VSH A;  1JXE A;  1JLE A;  3JXU A;  3TTF A;  2YJF A;  5BPL A;  1L5U A;  3H1V X;  2OZS A;  2W6K A;  4A61 A;  4FWL A;  4BRA A;  2XRI A;  4BY9 C;  1S6Q A;  1ZBI A;  3ID8 A;  2HMP A;  3NH2 A;  4FJX A;  2QWO A;  2IVN A;  1HJR A;  2HW3 A;  1KXP A;  1ZXO A;  4AM6 A;  1S72 N;  4CJR A;  3T1A A;  3RMB A;  4B1W B;  5KPT A;  2G8K A;  1ZBH A;  4IXC A;  5KI6 A;  4JKH A;  3NH1 A;  3QEX A;  2E1Y A;  5JS2 A;  3ZET B;  4DG1 A;  1GLF O;  3OYI A;  4FJH A;  1MU2 A;  3BGR A;  1CZB A;  4ID5 A;  4CF9 A;  2FXU A;  2WBN A;  1YF5 L;  2Q2R A;  1K8K A;  3ZSO A;  3NE6 A;  4M3X A;  1NK7 A;  2OPQ A;  1B9F A;  3O9Q A;  4C8M A;  2P9I B;  3CHW A;  3KWI A;  3NH0 A;  3OYM A;  1IKY A;  2IAJ A;  4RW6 A;  3HZ6 A;  3SAG A;  3A5L C;  2ASO A; 
#chains in the Genus database with same CATH homology
 4CZE A;  5JVG L;  5EOY A;  4FVU A;  4FPA A;  1HJO A;  2WUS A;  3ULE A;  2QEX N;  3WT0 A;  4BRO A;  1HPM A;  2NNW A;  4MLE A;  5AQS A;  2P9K B;  1X3N A;  3FE1 A;  5JLH A;  2JWK A;  3CJA A;  4C1N I;  3LDL A;  3Q7B A;  1K9M O;  3CCS N;  3C6H A;  5AQH A;  1WOQ A;  2CGK A;  4BC2 A;  1YVN A;  2HST A;  3DXM A;  5ADX A;  1YJ9 N;  3U9D A;  4C23 A;  3CF5 L;  3T7Z A;  3SBG A;  4AM7 A;  2CGL A;  3ENO A;  3HBT A;  1VQ9 N;  1YHQ N;  1T6D A;  4NO7 A;  4JD2 B;  3L6Q A;  4FO0 A;  5AQJ A;  5AZJ B;  3AAR A;  3UE5 A;  4BC3 A;  4U67 L;  2H3G X;  2ZJQ L;  3CCE N;  4YOW A;  2OTL N;  1SQK A;  1NBW A;  3IFR A;  4IEI A;  3EN9 A;  3E9O A;  5FPN A;  4JHD B;  3LDO A;  3B8A X;  2EWS A;  1Z05 A;  1HKB A;  3E9P A;  1BDG A;  4WF9 L;  2GUP A;  2C1I A;  3ZEU A;  2A41 A;  4JAX A;  3CXC M;  3UKU A;  5C15 A;  3LDN A;  1M90 O;  3K9J A;  3KZB A;  2YJE A;  3EZW A;  3K9K A;  5AQP A;  4JN4 A;  3QIC A;  1MWM A;  5AQU A;  3WXK A;  3CCR N;  4BG9 A;  4H5V A;  4MO5 A;  3HSC A;  3MMV A;  1IJJ A;  1JCE A;  2F9T A;  3OBW A;  4CD1 A;  3ENH A;  3J8A A;  3MWP A;  3O9T A;  2GEL A;  1KAY A;  3IKM A;  1KC8 O;  4O8U A;  5EX5 A;  3A5N C;  1QZ6 A;  5C10 A;  2NRT A;  4GNI A;  4LC9 B;  5AQW A;  1BO5 O;  1Q86 O;  3JS6 A;  4BEC A;  1S22 A;  1RFQ A;  3ZX3 A;  4BRF A;  1WUA A;  4RTF D;  4R79 A;  3MK6 A;  2VWB A;  3AAP A;  4FOI A;  2KKZ A;  3GL1 A;  3CMA N;  2AA4 A;  2V51 B;  3G6E N;  2NRX A;  5CHI A;  3A0I X;  2VYP A;  1HX1 A;  3OA9 A;  1OKJ A;  4KH6 A;  3CJB A;  4A2B A;  3FLC O;  3ZET A;  4CBU A;  5M1Q A;  2RE2 A;  3CQX A;  4CZI A;  5KPZ A;  3DAW A;  5AZI B;  2HBL A;  3WEE A;  4EHT A;  5M1F A;  3VEV A;  5KQ8 A;  2E2P A;  3MX5 A;  2HBJ A;  3IUC A;  3CCV N;  5GIO A;  2BUP A;  5BN8 A;  1R59 O;  3I56 N;  1DKG D;  3R9P A;  4OO1 J;  1ESV A;  1BUP A;  4BRQ A;  3U8X A;  4IOA L;  3VGK A;  2V7Y A;  4ISE A;  5AQT A;  2P9I A;  4BRM A;  2HF3 A;  3CIP A;  5BRD A;  4FWN A;  1GLA G;  4BC5 A;  3O5B A;  3D2F A;  4IFE A;  3VES A;  2NRV A;  5AR0 A;  2E1Z A;  4JEP A;  1NGE A;  3O8M A;  4IOX A;  4PL8 A;  5M1O A;  4A5B A;  3P38 A;  3ZX2 A;  3SAH A;  1YIT N;  1X9J A;  3VEY A;  2GEM A;  2F9W A;  3G71 N;  4BVO A;  3CI5 A;  3RVC A;  3VGL A;  2GTD A;  1SAZ A;  3FZK A;  4FL9 A;  4EAH D;  2NRR A;  2FF6 A;  1V4T A;  2P9K A;  5LY3 A;  1BG3 A;  3TSU A;  5BRE A;  1C0G A;  4JKD A;  3HRG A;  2ASP A;  1VQK N;  5F2R A;  1U2V A;  4H5N A;  4YOY A;  2ZJP L;  1K73 O;  1VQP N;  1ILY A;  4H0V B;  4O5F A;  4DQ8 A;  3PLA A;  4K43 A;  3UB5 A;  2GWJ A;  1QVF M;  3EKU A;  1QHA A;  2PFU A;  3WXM B;  1C0F A;  2UYT A;  4JD2 A;  3VF4 A;  4QS8 A;  3QBW A;  5AZJ A;  1VQO N;  3CME N;  1CZA N;  2NLX A;  1MDU B;  1BOT O;  4DB3 A;  4JKC A;  1GLD G;  3SMS A;  3RSE B;  2Q0U A;  4CZM A;  3CCJ N;  3IMX A;  1BWF O;  4JHD A;  3F9M A;  3W0L A;  1X3M A;  1YUW A;  3I33 A;  3KVG A;  3MN7 A;  4OPH A;  5GAG P;  3DWL A;  2VCP A;  4BRK A;  2J4R A;  1VQ6 N;  1MA9 B;  3VTH A;  5M1K A;  1NGA A;  2QWQ A;  3U4L A;  5TKW A;  2Q31 A;  4WFA L;  3HM8 A;  3D7E O;  3MWT A;  3VOV A;  1NGG A;  2E2O A;  3BUZ B;  4JK7 A;  4JNE A;  1Y64 A;  3LL3 A;  4IJN A;  4YDU C;  4WFN L;  3P4I A;  2GX9 A;  4ILJ A;  4CI6 A;  2GWK A;  4WYB A;  4FSV A;  4H5W A;  3AY9 A;  3E1Y A;  3E9L A;  5AFU H;  1P8Z A;  4BGA A;  3SJH A;  3TTD A;  4BVP A;  2W40 A;  4H5T A;  1JJ2 M;  3M1F A;  5GAH P;  5BRH A;  1W97 L;  4EFH A;  1QQM A;  4FWO A;  3KWG A;  3L0Q A;  1BA0 A;  4BRE A;  5M1N A;  5HL7 L;  3CD6 N;  4H0Y B;  1E4F T;  4BR9 A;  3OW2 M;  2VGM A;  3O08 A;  3H3N O;  1H1V A;  4ILG B;  3TU5 A;  2C1G A;  1NWK A;  3QFU A;  2Q0R A;  4A57 A;  3DJC A;  3CC7 N;  2QWR A;  3VEZ A;  5ADX H;  1Q82 O;  3BF3 A;  4XEI A;  4I6M B;  3H45 C;  2D0O A;  4CBW A;  5BRF A;  2NRW A;  2BH1 A;  3KK7 A;  3GBT A;  1DGK N;  3CPE A;  3EL2 A;  3MDQ A;  4IJA A;  4NLB A;  3O9S A;  3TSP A;  2V7Z A;  2A40 A;  4FWR A;  2A6A A;  1DEJ A;  4FWK A;  4ILH A;  2FLO A;  2OAN A;  2YX6 A;  4QS9 A;  4B1Z A;  4JKF A;  5B8H A;  2HBK A;  5FPE A;  3LM9 A;  1ZBS A;  2QWM A;  3BEX A;  1ATN A;  2IIR A;  2P9L B;  3GG4 A;  4YDU A;  5BR9 A;  5MLC Q;  2P9S B;  3C7N B;  4WQ5 A;  3KHY A;  5TKY A;  1TUU A;  1K8A O;  3CC4 N;  3MX2 A;  2QI2 A;  5I9E B;  2ZJR L;  5AQK A;  4YOR A;  4BR4 A;  1VQM N;  1VQN N;  2W00 A;  2PAV A;  2QWN A;  1QQN A;  3R6M A;  5EXW A;  3LDP A;  4DHY A;  3CJ7 A;  4FPB A;  5ELZ A;  5C2F A;  4IOC L;  2P9P B;  4WCE L;  1Q7Y O;  2F7T A;  4BQZ A;  3FR0 A;  3O4W A;  2WFB A;  3DXM B;  1KD1 O;  3M5R A;  3ZX0 A;  5GIN A;  3HOT A;  2QA4 N;  3NMU A;  1XQS C;  1NGF A;  4F9O A;  3P31 A;  3WUH A;  3WQT A;  3J7Z O;  1HKG A;  1ZC6 A;  1GLJ O;  2ZF5 O;  3VF6 A;  4BRI A;  2FF3 B;  1QZ5 A;  3OHR A;  1KQS M;  5HOO A;  3GE1 A;  2YI1 A;  3SK3 A;  5LJV A;  4XH1 A;  5AQN A;  2YHX A;  3CJC A;  1S3X A;  5KPR A;  3D2E A;  1BU6 O;  2VGN A;  3CJ9 A;  5CE3 A;  4YOV A;  1W2B M;  4CBX A;  3CCU N;  3N4Q A;  3ZEU B;  3WXL A;  4JKG B;  5F1X A;  3G4S N;  3UKU B;  2QM1 A;  4G9Z A;  3RSE A;  1ATS A;  1YAG A;  2YHY A;  5H1S Q;  3FZF A;  3L4Q A;  2P9N B;  4FWP A;  3QML A;  1MWK A;  4IO8 A;  2FSJ A;  1QQO A;  1XUP O;  3CCL N;  2BTF A;  2CGJ A;  2P9U B;  4AF1 A;  3QB0 A;  4H0O A;  4EHU A;  3PIO L;  3CJ1 A;  4GV9 A;  1VQ8 N;  1N8R O;  3DLL L;  3IDH A;  3O9U A;  5AQI A;  4FWM A;  5EY4 A;  1YI2 N;  1EO1 A;  2CH5 A;  1TUY A;  4CZK A;  3SAF A;  3BP8 A;  1OVY A;  4PKH A;  4A5A A;  5BPM A;  5DM6 L;  5C0Y A;  4GY2 B;  4YOU A;  4KH4 A;  4OPA A;  4RCH A;  4HWI A;  1VAZ A;  2KHO A;  4JK8 A;  4O8K A;  4WQ4 A;  5EVZ A;  4MDA A;  4E1J A;  1SZ2 A;  4UY8 O;  1Z6R A;  1NGC A;  2I7N A;  2JWL A;  2V52 B;  3VET A;  5DM7 L;  4CZL A;  4ISF A;  3FZM A;  3LDQ A;  5E84 A;  4PKG A;  3O1W A;  3E66 A;  3S41 A;  5JMV A;  2WC9 A;  4BQL A;  2HF4 A;  3CET A;  2NRZ A;  5AQG A;  4BRN A;  4A2A A;  1JCF A;  3C0B A;  5GIP A;  1GLE G;  1Q18 A;  4H0T B;  4BG8 A;  3MN5 A;  3WEE B;  1VQ5 N;  3ENB A;  4CJ7 A;  3EO3 A;  3CCM N;  2E2N A;  3VEO A;  3ATU A;  3P39 A;  5AQV A;  5AQZ A;  1J6Z A;  4FOE A;  3QDK A;  2W41 A;  3MN9 A;  4ISG A;  4B9Q A;  4XJX A;  2QWP A;  3TSQ A;  1JCG A;  2E20 A;  2AP1 A;  3UKR B;  4BRL A;  4CZJ A;  4DCH A;  4C1N K;  1NGB A;  3O6W A;  3TPQ A;  2FSN A;  5JLF A;  4H0P A;  4WQ5 C;  5AQY A;  4B1V A;  5AQX A;  3CQY A;  4IO9 L;  2KLA A;  3D2F B;  3VEW A;  4B1X B;  2HBM A;  2ZGY A;  5AQQ A;  2P9L A;  3R8E A;  4WFB L;  5AFU A;  2P9S A;  4M63 C;  1EQY A;  2IVP A;  1RDW X;  3C7N A;  3VTI A;  2FSK A;  4CZF A;  1KAZ A;  3I55 N;  4BRG A;  3VGM A;  3AGK A;  4L3Q A;  1T44 A;  2D4W A;  2RHK A;  4KH5 A;  1LOT B;  3DXK B;  3WXI A;  3CER A;  4BR5 A;  4YOX A;  3CC2 N;  1NGI A;  1U2V B;  4YOT A;  3I8B A;  2P9P A;  5BPN A;  5JVH L;  3A5M C;  2Q97 A;  5JIC A;  3SLC A;  1E4G T;  1T6C A;  5F0X A;  1K8K B;  1HKC A;  5AQR A;  4PKI A;  3NVK A;  4Y0W A;  4U7B A;  5AZI A;  1QVG M;  2YCH A;  3Q7C A;  1VQL N;  3ID6 A;  3SMP A;  4BRD A;  2A42 A;  2IVO A;  4M7Y A;  5BN9 A;  4H03 B;  3GDQ A;  4XH5 A;  1GLB G;  3L4I A;  3MCP A;  4IDH A;  2QTD A;  2Q1N A;  4BR7 A;  1TYQ B;  4K25 A;  4RWT A;  5KQD A;  3VPZ A;  3HOS A;  5GAD P;  4CZH A;  4BR2 A;  4IWV A;  4XH4 A;  4JKG A;  3F5T A;  1D4X A;  1O13 A;  3ULE B;  5CR4 A;  1KAX A;  1HLU A;  4MDB A;  2NZT A;  3O9R A;  5AQF A;  3C6A A;  4K42 A;  3WQU A;  2P9N A;  2DPN A;  1RGI A;  5C2D A;  1ATR A;  4FWS A;  1DT9 A;  1NM1 A;  2P9U A;  3H46 O;  1M1K O;  1VQ7 N;  4IEE A;  1P90 A;  5M1P A;  4WQ4 C;  4JK9 A;  3WXJ A;  2PBD A;  1NMD A;  4BRC A;  3QFP A;  1NLV A;  3D6R A;  3GOI A;  3O1B A;  2OTJ N;  1BA1 A;  1RDU A;  2YHW A;  1VQ4 N;  2A5X A;  3PIP L;  3AGR A;  3U9Z A;  4J8F A;  2ITM A;  2QXL A;  3EE9 A;  4BEB A;  3JXU A;  3H6E A;  3TTF A;  3A5O C;  1V4S A;  2YJF A;  5BPL A;  1YJN N;  3H1V X;  3F2K A;  3CCQ N;  2NRH A;  4Z94 A;  4JKA A;  1U6Z A;  4FWQ A;  2I7P A;  4A61 A;  4FWL A;  5LJW A;  3CPW M;  4BRA A;  1NGH A;  4M7X A;  4BY9 C;  5E26 A;  3QBX A;  4GV6 A;  3ID8 A;  4GVE A;  3SBT A;  2E2Q A;  5C12 A;  3C65 A;  2HMP A;  3FZH A;  2Q36 A;  4B1U B;  4CD3 A;  2ASM A;  4JKE A;  4BRP A;  2HOE A;  2QWO A;  1NGD A;  2IVN A;  3UKR A;  3O80 A;  1KXP A;  1ZXO A;  2D1K A;  3MCA B;  3MN6 A;  4NB4 A;  5FPM A;  4AM6 A;  4DKW A;  1YJW N;  3HTV A;  1S72 N;  4K41 A;  3VMF B;  3FZL A;  3VER A;  1NJI O;  1G99 A;  4B1W B;  5GAE P;  1XC3 A;  1HUX A;  2A3Z A;  5KPT A;  5AQO A;  1LCU A;  4A59 A;  4IXC A;  1GLL O;  3G25 A;  5AQM A;  1GLC G;  1T3V A;  4A62 A;  3FGU A;  3H3O B;  4IZ9 A;  3EE8 A;  4HTL A;  3M6G A;  4JKH A;  4BRH A;  2QW9 A;  2E1Y A;  3ZET B;  3DXK A;  4MLH A;  4BR0 A;  3AAQ A;  1GLF O;  2CH6 A;  3BF1 A;  2ZWH A;  3ZYY X;  3VF2 A;  4CZG A;  1YIJ N;  3R3L A;  4KBO A;  3NVM A;  4I6M A;  1Q81 O;  2FXU A;  3FFK B;  3A8Y A;  3ATV A;  2WBN A;  2E8A A;  1IG8 A;  1YF5 L;  4JKB A;  2Q2R A;  1K8K A;  4NLC A;  4H0X B;  3N4P A;  2E88 A;  3M3Z A;  4BGB A;  3D2E B;  4B1Y B;  2ZGZ A;  3O9Q A;  4EIA A;  2P9I B;  1NGJ A;  4MO4 A;  3T69 A;  4PL7 A;  2D0P A;  3CHW A;  3KWI A;  4PHT X;  3VEN A;  3VEX A;  5FPD A;  3HI0 A;  4QS7 A;  3R1X A;  3EKS A;  4BC4 A;  3H1Q A;  4GV3 A;  4H5R A;  3HZ6 A;  3OBY A;  1YXQ A;  1TYQ A;  3LM2 A;  5AQL A;  3SAG A;  3W3D A;  2QWL A;  3A5L C;  1SS6 A;  3TTC A;  4BE7 B;  2ASO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...