3UKUB

Structure of arp2/3 complex with bound inhibitor ck-869
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
195
structure length
195
Chain Sequence
GVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords ACTIN-LIKE PROTEIN 3
publication title Structure of Arp2/3 complex with bound inhibitor CK-869
rcsb
total genus 46
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ukuB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3ukuB02
1QZ5A 2FSJA 2GELA 3C0BA 5AR0A 2PBDA 5AQNA 3EO3A 4RTFD 4BRLA 2E2PA 2I7NA 5E84A 3FZMA 4PKIA 2HMPA 3CQYA 5JICA 2GUPA 4K42A 2Q97A 4B1VA 3GOIA 2NRHA 1NGJA 4ISGA 4MLEA 2E1YA 3D2EB 3VGMA 1ATSA 4CZLA 4F9OA 1J6ZA 3LDPA 2YCHA 3DXMB 3VEYA 3DXKB 2FF6A 3VPZA 1SAZA 3SMSA 2J4RA 5AZIB 2P9SA 2GWJA 4CZIA 5BR9A 1NGAA 1GLDG 3ULEA 2P9KA 3R6MA 4CBXA 3QBWA 3LDLA 5ELZA 5EX5A 1C0GA 2QXLA 5AFUA 1MWMA 3LDNA 5AQPA 3EL2A 2VYPA 4B1WB 2YHXA 2UYTA 2GEMA 4L3QA 5AZJB 3ENHA 1MDUB 1YVNA 3UKRB 4BC4A 4H0YB 3DXMA 4FWPA 2WUSA 4O5FA 5JLHA 2CH6A 5B8HA 1BWFO 1DKGD 3DXKA 3GE1A 3LM2A 1NLVA 4FWQA 4FWRA 5F0XA 1QHAA 2ASPA 2ITMA 4XH5A 1GLCG 3L0QA 5KQDA 1E4FT 2ZF5O 4O8KA 1ATRA 3QFPA 3MN9A 3QFUA 1TUYA 3CJ7A 3C7NB 4FOIA 2YI1A 3BUZB 4BRAA 5CE3A 4BRIA 3J8AA 2A40A 4H0XB 2FSNA 4DQ8A 2P9LA 1RGIA 4FWOA 2GTDA 4JHDB 5JMVA 5KPTA 2ASMA 5KPZA 2V51B 5BRHA 3D2FB 4B1ZA 4RWTA 3AAPA 3QBXA 5BN9A 5EOYA 3UKRA 4J8FA 1GLAG 3VENA 1XQSC 2CGJA 2HOEA 3EKUA 3HM8A 4I6MA 3ZETB 1D4XA 2OANA 2BUPA 4CI6A 1HJOA 3HI0A 1X3MA 4BG9A 2P9IB 1NGIA 3FZFA 3U9ZA 1QZ6A 3MMVA 3L6QA 3KZBA 1RDWX 3FE1A 4XH4A 1NMDA 5KQ8A 3CJ9A 3HTVA 1U2VB 3MCPA 3SJHA 4PKHA 1IJJA 3H3OB 4WQ5A 5AQLA 4WQ4A 1JCGA 4BR7A 1C0FA 1T6CA 4CBUA 4BR9A 4GNIA 2QWQA 4MLHA 2CH5A 1TYQA 3FLCO 2P9PB 1K8KB 3OHRA 4EFHA 1BU6O 3O08A 3VERA 2D0PA 1WUAA 4JD2A 1NBWA 3R8EA 4M7YA 3QDKA 4WQ5C 4WQ4C 1BA0A 3CJBA 3EN9A 4CD1A 4BRFA 1KAXA 3BF3A 3O8MA 4K25A 3IFRA 4CZFA 4BRKA 4BRNA 1LCUA 4H5WA 4QS8A 2Q36A 4BRPA 2BTFA 3O6WA 2A42A 3ENOA 3CERA 2HF3A 5E26A 1GLLO 2ZGZA 5AQXA 1SZ2A 4IJAA 3U9DA 4YDUA 4BRHA 1BDGA 2D4WA 2P9PA 3CJ1A 1HKCA 4FOEA 5AQMA 3CHWA 3ZEUA 1V4TA 3CQXA 2P9NA 2IVNA 3O1WA 2V52B 2Q0UA 4HWIA 1X9JA 4BR4A 1HX1A 3FZHA 2AP1A 1Z6RA 1ESVA 3LM9A 1R59O 3ID8A 3JXUA 2IIRA 3A5MC 4M63C 5AFUH 4YDUC 3VEOA 4K41A 3QICA 4Y0WA 2H3GX 4DCHA 2QWRA 5BPNA 3D2EA 5LJVA 3FGUA 5AQHA 2CGLA 2YJFA 4DHYA 3WT0A 2I7PA 4B1UB 1BUPA 3M3ZA 1XUPO 3DAWA 3VGLA 3CETA 3R9PA 1WOQA 2CGKA 4FWMA 5F2RA 4EIAA 4AM6A 5AZIA 4BGAA 3GDQA 1GLFO 5FPNA 2F9TA 3KVGA 4JNEA 1E4GT 3AY9A 3W3DA 1XC3A 2E1ZA 4JAXA 2VWBA 4E1JA 4BR5A 1Z05A 3WEEB 2FXUA 1NM1A 1KXPA 4AM7A 5AZJA 1NGHA 1Q18A 3ATUA 3BP8A 3A0IX 4B1XB 5FPEA 1TUUA 5AQKA 4B1YB 3WQUA 1ZBSA 2A6AA 3BF1A 1KAZA 4RCHA 3ZX0A 3UB5A 4FPBA 1BG3A 5AQZA 3VEWA 3ZX2A 4C23A 1T6DA 4H5TA 2V7YA 2VCPA 3A5LC 5AQVA 3DWLA 5AQQA 3MN5A 2A41A 3QMLA 4BVOA 4EAHD 5BPLA 3C7NA 3UE5A 2ZWHA 5AQYA 1CZAN 1NGDA 1EQYA 1U6ZA 4JHDA 3DJCA 3VETA 3H1VX 2HF4A 3D2FA 4BQZA 3GBTA 1QQOA 3RSEB 4IWVA 3L4IA 3QB0A 2DPNA 3HZ6A 5JLFA 1MA9B 3H1QA 3WXIA 1ATNA 3ZETA 1HKGA 5FPMA 3IUCA 1S22A 1BO5O 3O1BA 4DB3A 4PL7A 1BA1A 3VESA 1ZXOA 2P9IA 2A3ZA 1DGKN 1NGGA 4BR2A 5FPDA 4LC9B 4CZGA 1U2VA 4H0TB 2FSKA 5TKYA 5EXWA 4XH1A 4EHTA 3D7EO 5AQJA 2ASOA 4H5VA 2KHOA 4PL8A 4CZJA 2E8AA 3A8YA 3WXJA 5AQSA 3LDOA 3O4WA 1QQNA 5EVZA 2P9SB 1G99A 3AAQA 5ADXA 3W0LA 3AARA 1K8KA 3P4IA 3B8AX 2P9KB 3ULEB 5AQIA 5ADXH 3KHYA 5LY3A 1HPMA 2D0OA 3JS6A 2FF3B 1NWKA 4IXCA 5AQRA 4BRDA 2IVOA 2YJEA 4BR0A 5BN8A 4WYBA 2YHYA 5AQWA 2E2NA 3UKUB 4BREA 2FLOA 4CBWA 3ZX3A 3TPQA 5LJWA 5BREA 3U8XA 4BROA 2NZTA 1ZC6A 4HTLA 3MN6A 5F1XA 3MN7A 5AQFA 3WQTA 1JCEA 3IDHA 5BRFA 1Y64A 4FO0A 2PAVA 3EZWA 2E88A 3TU5A 3M1FA 2Q0RA 3GL1A 3H3NO 2E2QA 4A61A 3VEXA 4NO7A 3O80A 4CZHA 4JN4A 1GLEG 5I9EB 1JCFA 3HBTA 4H0VB 2P9LB 4QS9A 2Q1NA 1YAGA 3SLCA 3UKUA 5BPMA 3WXLA 1KAYA 4FL9A 3CJAA 4GY2B 4ISEA 4BGBA 4KBOA 1HKBA 4BRMA 2AA4A 4A2BA 3A5NC 3VF6A 3LL3A 1NGBA 4BC5A 4Z94A 3FZLA 3I8BA 3GG4A 4I6MB 3IMXA 5AQGA 2P9UB 4M7XA 5BRDA 3WXKA 5EY4A 3SK3A 4ISFA 1H1VA 1NGFA 2QWMA 1HLUA 4FWLA 4CJ7A 1BOTO 3G25A 4BC2A 1V4SA 1LOTB 4BQLA 4H03B 3CI5A 4EHUA 2Q31A 2A5XA 2QWOA 3I33A 3VF4A 1DEJA 1RFQA 1OKJA 4MO5A 2V7ZA 3LDQA 5AQTA 1IG8A 3S41A 1T44A 4BRQA 4IZ9A 5AQUA 1YXQA 3HSCA 4NB4A 3VEZA 3WEEA 4A62A 5KPRA 3O5BA 4CZKA 1NGEA 2E2OA 2P9UA 3FR0A 2IVPA 4BG8A 1TYQB 2D1KA 3CIPA 4JD2B 4QS7A 4FPAA 1NGCA 2QM1A 1X3NA 4FSVA 3M6GA 4H5NA 4H0PA 1SQKA 4FWNA 4CZEA 3BEXA 1YUWA 3CJCA 2E20A 1MWKA 2YHWA 3FZKA 2QWNA 3VGKA 1QQMA 2F9WA 2GWKA 4IJNA 1S3XA 4XEIA 4BRGA 4FWKA 4CD3A 4BVPA 2W41A 2QWLA 2QW9A 3H46O 1P8ZA 3H6EA 4CZMA 1GLBG 1GLJO 3FFKB 4PKGA 4A2AA 3A5OC 3VOVA 4IO8A 4H0OA 2ZGYA 3RSEA 4B9QA 4BC3A 2QWPA 3ZEUB 2NLXA 3H45C 3SMPA 5AQOA 4BRCA 2P9NB 3MK6A 3WUHA 2W40A 2Q2RA 2EWSA 3F9MA 3U4LA 4MO4A 3VF2A 3ATVA 4FWSA 3MDQA 3EKSA 3VEVA 4H5RA 4K43A 1HUXA
chains in the Genus database with same CATH superfamily
3DLRA 2FSJA 1SL2A 3VN5A 2PBDA 4WFBL 3EO3A 4DU1A 2E2PA 3AVIA 4Y1CA 5E84A 1L3VA 4PKIA 4DMNA 4Q5VA 4FJ5A 2GUPA 4IKFA 4LSNA 3O4QA 2Q97A 3GOIA 1QS4A 3G4SN 4DFJA 2E1YA 3VGMA 3LWLA 3LDPA 3TARA 3SQ4A 3NGIA 1VK0A 2KLAA 4FLUA 3SMSA 4DTJA 5AZIB 2GWJA 5IT9O 1EO1A 4CZIA 5BR9A 5J1EA 3ULEA 3R6MA 2XO7A 4EP5A 4RW4A 4R5PA 3LDNA 3O9TA 5AQPA 2XY6A 3T7ZA 4CJQA 1BL3A 4XJXA 3K57A 2RPIA 5C42A 3OYHA 4FJXA 4HCBA 4WE1A 3WNHA 4H0YB 1MU2A 1YHQN 1HNWK 5CY4A 3LM2A 4FWQA 5F0XA 2ASPA 4CEEA 3ALYA 4NYNA 2ZF5O 3QFPA 3THXA 3QEIA 4LF8K 1JL2A 1TUYA 4B8CA 3C7NB 4E0DA 4FM1A 4YOVA 2YI1A 1IBLK 2HW3A 1RT6A 2HBLA 4H0XB 3J80O 2P9LA 4JHDB 4FWOA 2GTDA 4CF1A 5KPZA 4FLZA 2VG6A 4ZTJA 1TL1A 4O55A 4Z4IA 1JJ2M 4N76A 1KFSA 5EOYA 2ZM6K 4J8FA 3VENA 4H8KA 1RTIA 2CGJA 3JSMA 3EKUA 1JLAA 3PV8A 4C8LA 1D4XA 3ZT2A 1KD1O 4B3RK 3THYB 1Q9XA 2P9IB 4CGGA 3FE1A 3LAKA 4FJNA 5SWMA 2F96A 5CR4A 3MCPA 1P90A 3SJHA 3H3OB 1S1UA 3NF7A 2VWKA 4CBUA 4BEBA 5J2NA 1IG9A 1L3UA 4B3MK 1DLOA 4H4OA 4E7KA 1HPZA 4MLHA 1K8KB 1BU6O 2D0PA 2VG5A 4YORA 3PX4A 1FK9A 1IKWA 4W5TA 3OS0A 1RTDA 3OS2A 4DU3A 4M3YA 1LCUA 3SQ2A 3J7AP 3L3UA 1BGXT 4C8KA 3ENOA 2NRZA 3CERA 5E26A 3AVMA 1SZ2A 1HRHA 1VQLN 4KKOA 4BRHA 1BDGA 3CJ1A 3J7YP 3HL8A 3ENBA 2F7TA 2V52B 1HX1A 3N4PA 3FZHA 4IDKA 1EETA 4KHUA 3LM9A 3V1OA 3LALA 1CXUA 4CJ5A 3VEOA 4PHTX 2O8BB 1N33K 4DTNA 1J5EK 3CMEN 3CYGA 1JLQA 1TAQA 1XMQK 4DUZK 5HP1A 4MDBA 5I42A 5AQHA 3OYFA 4KH5A 3AVLA 4KB0A 2JGUA 3HP9A 1BUPA 3M3ZA 3P31A 3E9PA 1WOQA 3B6PA 4I2QA 4AM6A 3ID6A 4YOXA 4BGAA 3OA9A 2D0CA 1GLFO 5FPNA 2F9TA 3CPWM 3C95A 4N5SA 1YIJN 4IOAL 4YY3K 1E4GT 3AY9A 2ETJA 3I8DA 4CGJA 4LFBK 1RDDA 2FXUA 1OH5A 3KK7A 4M3XA 1T7PA 4FVMA 5AZJA 2HHWA 4DUYK 4B9SA 4CJSA 5FPEA 4PQUA 3LPTA 3KKSA 1D5AA 2XY5A 2E5LK 1TK8A 1ZBSA 3BF1A 2WOMA 3ZX2A 3KKRA 1ASVA 2V7YA 4X66K 4B3OA 3OYKA 2OTJN 2WFBA 2DY4A 3DWLA 5AQQA 3MN5A 3QMLA 4BVOA 1QTMA 3K59A 3MEDA 3AV9A 4FJGA 2ZWHA 3O9SA 4E1NA 2C1GA 1EQYA 3SUPA 3VETA 4JRPA 2HF4A 3KLIA 1WSJA 1KFDA 5DM7L 1C1CA 3GBTA 3K0SA 3UIQA 3NGZA 4FK4A 2KW4A 3HZ6A 5CYQA 1MA9B 3H1QA 1HKGA 2VQEK 2IGIA 3G71N 4JI6K 5FPMA 1KVCA 1WSHA 3LDSA 4EZ9A 1BO5O 4E1MA 1BA1A 1T05A 1HNZK 1F21A 3LZIA 1N6QA 2OA8A 1KSPA 3OYEA 1W2BM 1Q86O 1ASWA 5FPDA 2I5JA 1U2VA 2FSKA 2OPQA 1TL3A 3ZSRA 4Z4FA 2X78A 3BZCA 2Q3SA 4H5VA 2NUBA 2OYQA 2E8AA 3A8YA 3WXJA 4FZYA 4DTUA 3O4WA 2P9SB 4LSLA 3QNNA 3W0LA 5E41A 3AARA 3MECA 2O8CA 5AQIA 3KHYA 3RR7A 1VQ8N 5LL6Z 4CVNE 3I55N 2X6NA 4CE9A 2FBXA 5C24A 1TVRA 2YJEA 3K9KA 4OKEA 3U3GA 5KRSA 2W00A 3P5JA 4WYBA 4CJUA 1UOCA 5GADP 4CBWA 3TPQA 5LJWA 4BROA 2NZTA 4DV1K 3CCMN 1YF5L 3P1GA 3OYGA 1NJIO 3Q7CA 1BIZA 4FO0A 1TKZA 3DYAA 1OH8A 2PAVA 2E88A 2ZE2A 3D6RA 3R3LA 1J9AA 4CJ4A 3H3NO 3NVMA 4ILJA 1D9FA 3VEXA 3HXMA 5KGWA 1RBRA 3LANA 3HBTA 5KTQA 1GOAA 2UUAK 3SLCA 2Q1NA 3NMUA 1W7AA 1RT3A 4GVEA 3MXJA 4NXNK 4CF0A 2AA4A 2QA4N 2UXDK 1TKXA 1XMOK 1W0HA 2VGNA 3FZLA 3GG4A 2HNDA 1KC8O 2P9UB 2QTDA 1ASUA 3SK3A 5HLFA 4CFBA 1ZBUA 3L2QA 4CIGA 3AVBA 1BOTO 3G25A 4BQLA 4FLVA 4BWMA 3ITHA 1JL1A 4GV9A 2D0AA 5EU7A 4BECA 2QWOA 2KZZA 2RN2A 1DEJA 4HUEA 1SKWA 1OKJA 3N4QA 1IG8A 5I3UA 3S41A 4BRQA 4IZ9A 2IS3A 1KVAA 1U4BA 4CZKA 2KFNA 3KJVA 2QEXN 4NCGA 4JI5K 2P9UA 2HBJA 1NU0A 4CGFA 3EE9A 1NGCA 2QM1A 1CZBA 1X3NA 3NF6A 4FSVA 4YOTA 4H0PA 2JWKA 3AO3A 3QEWA 1QVFM 5J2QA 2YHWA 3FZKA 2QWNA 4BE2A 4DR5K 3C6TA 1GOCA 3NF9A 1S3XA 3T1YK 4DV7K 4FZZA 4C1NK 4CGIA 2YHAA 4DFKA 2QWLA 2QW9A 1KQSM 4A59A 2KFZA 1HMVA 2WTUA 4A2AA 3SPYA 1DTTA 4RW9A 4DR7K 1VSHA 4B9QA 1T3VA 4CIEA 3ZEUB 4KH4A 3VQ8A 4KI4A 5AQOA 2OPPA 2O8EB 4DSEA 3SAFA 1BI4B 3T1AA 2KKZA 2EWSA 3U4LA 3I0RA 2UXCK 3VF2A 4N56A 5J2PA 3BDPA 4LF9K 4JKBA 2GELA 3SCXA 3C65A 3TAMA 1A5XA 1S1TA 3OYDA 1JXBA 1QVGM 3AO4A 4MLEA 4CZLA 3OYAA 3VQ4A 5K14A 2AJQA 1RBUA 3CM6A 3DRPA 1S9GA 4CJFA 3OS1A 3VEYA 3KK2A 2FF6A 1X9MA 3RRGA 4KHSA 4C8NA 3VPZA 5LMUK 3CC7N 3AVNA 2G8KA 4CBXA 3QBWA 5EX5A 5ELZA 5AJ3K 1S1XA 3LP3A 4CECA 1VQ9N 1MWMA 4AHVA 1VSFA 3EL2A 4FLYA 2VYPA 1NOYA 3NF8A 1J54A 2UYTA 2GEMA 4L3QA 4DV6K 1UAXA 3ENHA 4PA1A 1A5VA 2XY8A 2YNHA 3C6HA 2Z1JA 3IRXA 4FM2A 1YVNA 3UKRB 3CM5A 2WUSA 5JLHA 3WNFA 1X1PA 4N47A 2ITMA 2VWJA 1YJNN 4XH5A 1GLCG 3MN9A 4CJLA 5CE3A 3J8AA 4AF1A 1BISA 1GOBA 5CHIA 2ASMA 3AA2A 2V51B 1JLEA 1JLGA 5BRHA 3QESA 3D2FB 3AAPA 3QBXA 4KI6A 3IG1A 1LW0A 3L2WA 4KHNA 3UKRA 4HCCA 1G15A 4I6MA 4CEQA 1B9FA 3E66A 3CYMA 3PO5A 3O4NA 2PZSA 1YITN 1IKYA 3U9ZA 3OBWA 4AHUA 4CERA 4GVMA 1LWFA 3CJ9A 1QHTA 2WBNA 3PX6A 2HHTA 3AVAA 4OO1J 3OBYA 3OJUA 4WQ4A 5FLXO 4BR7A 4BR9A 4GNIA 1UA0A 4FJIA 2CH5A 4FJLA 3V1QA 4JI0K 1N8RO 3O08A 3VERA 4FJ7A 4DS5A 4JD2A 2X74A 4M7YA 3QDKA 4CJKA 4KB1A 1S1WA 4WQ4C 2G8FA 1LAWA 5GIPA 1KAXA 3O8MA 3NAEA 4FLTA 3THWB 3DI6A 4H5WA 4MFBA 4IOXA 4QS8A 2A1SA 4QOZB 2JLEA 2Q36A 3BGRA 4RG8A 5IWAK 3O6WA 2WONA 4DKWA 3AGRA 4YHHK 4L8RB 3LP1A 2HF3A 3U9DA 4HUFA 4YDUA 1NMNA 3AGKA 3KLGA 1U49A 2P9NA 4LF5K 1R0AA 3CPEA 4G1QA 2Q0UA 1X9JA 3V1RA 4E3SA 1RCHA 4YNQA 3WNEA 4CHQA 1Z6RA 1WBDA 1BHLA 3THWA 4CGDA 2KTQA 3RR8A 2IIRA 1VQ7N 4YDUC 5C2DA 3QINA 3QICA 4Y0WA 3CXCM 1TKTA 1XWLA 2YX6A 3AA4A 2G8WA 4FW1A 2BDPA 3AO1A 5BPNA 4KHWA 5LJVA 3P83D 4JI1K 4ICLA 2UU9K 2CGLA 5DM6L 4O0JA 4JKAA 1JLCA 3DAWA 3CQ8A 3CETA 2CGKA 3TAPA 4EIAA 4PWDA 1S6PA 4FW2A 5AZIA 3ZSZA 4E7LA 4JI8K 2G8HA 2W6LA 3KVGA 5C15A 2NRRA 3W3DA 5LMNK 4JAXA 1C0TA 1SL1A 4K0KK 4IEIA 5CYMA 4E1JA 3SQ0A 3CFRA 4UY8O 4WCEL 4AM7A 4E7JA 3TTFA 1NGHA 3MWTA 3PLAA 2F8TA 3A0IX 3HPGA 1TUUA 1KVBA 3WQUA 3CCJN 4GV3A 2JWLA 3S5TA 5HRRA 2IOCA 4CJVA 4FPBA 1T6DA 3K5OA 2ZJPL 1HNVA 4O0IA 2A41A 5BPLA 3TAFA 3VMFB 3C7NA 3UE5A 4IEEA 1N36K 3DLGA 5AQYA 1CZAN 1NGDA 4JHDA 1D9DA 4LFCK 2XY7A 4QAGA 3MX2A 1Z26A 4CK1A 3AA3A 4KH6A 4JYAK 4AILC 1BCOA 1I39A 1RT4A 1OH6A 3B6OA 3EEQA 3IUCA 1LAVA 3PIOL 5JS2A 3ULDA 3THYA 3E9OA 3TSUA 1NNEA 1M90O 4FVUA 4W5NA 2P9IA 1C6VA 2A3ZA 1DGKN 2HBMA 3SBTA 4CZGA 4H0TB 4A5BA 2HVIA 4F2RA 5C2FA 5EXWA 1YJWN 4EHTA 1I94K 2DFHA 3VQ9A 3D7EO 3EY1A 4KHQA 5AQJA 2ASOA 3THVA 4PL8A 3PUFA 1FXXA 4DSIA 4M41A 3LDOA 3OYMA 4Z4HA 3L2RA 5EVZA 1K73O 2O8DB 3AVKA 4EP4A 1K8KA 3P4IA 3B8AX 2P9KB 3AVHA 3FFIA 3ZSOA 5ADXH 4DR3K 1RTJA 2PY5A 2RE2A 1HPMA 4OPHA 3QERA 3JS6A 4BDYA 2FF3B 3DLKA 1NWKA 1NKEA 4BR0A 2Y1IA 4DWIA 3O9UA 2YHYA 3MWPA 2IAJA 5AQWA 4DV3K 2FLOA 5BREA 4DFMA 5HOOA 3U8XA 2ZJRL 1ZC6A 4CJEA 3AO5A 5F1XA 3DRSA 3A2FA 5BRFA 2RF2A 3J81O 3MEEA 4OKKA 2Q0RA 1QQCA 2E2QA 4DG1A 4FK2A 4A61A 1CLQA 3DLHA 4HVJA 4ID1A 4M42A 4ELTA 4JN4A 1NOZA 4LH4A 4KV8A 2HBKA 4DFPA 1OH7A 1YI2N 3IKMA 3HM9A 1K8AO 1KAYA 4BGBA 3C94A 3LZJA 4BRMA 4KPYA 4M3WA 1NGBA 4BC5A 2O8BA 3U6FA 3I8BA 1Y97A 4OLBA 3IMXA 1WSFA 3TAGA 2QI2A 4ISFA 1S5JA 1Q9YA 3K5MA 1IO2A 5BR8K 1H1VA 3RMDA 4CEDA 3V9UA 4Y1DA 4FWLA 1NKBA 2BGGA 5CZ2A 1KCFA 1O13A 4BC2A 1LOTB 3PSFA 1SKSA 4EHUA 5T7BA 2Q31A 3VF4A 3ZSWA 4KTQA 3LDQA 4DQQA 1Q8IA 3QEXA 1M1KO 4W5QA 2B6AA 3F73A 1T44A 3LP0A 5AQUA 4NB4A 4HHTA 2GV9A 1YTUA 2IVPA 4KHYA 3E01A 1DTQA 4BG8A 1TYQB 3K58A 3VTHA 1NJXA 4A5AA 3TANA 4O5BA 4JV5K 3BZKA 3V81A 3TTCA 5FRMA 2XHBA 2HHVA 1SQKA 1X9WA 4FWNA 4CZEA 4LF6K 1YUWA 3CJCA 2E20A 5DMRA 2OTLN 4M3UA 1QQMA 2F9WA 4IJNA 4F3TA 2RHKA 3VTIA 3U3YA 4J2EA 4BRGA 1K9MO 4I9QA 5M1FA 4AHRA 1N5YA 2HNZA 2W41A 2YNGA 3QEVA 1RILA 4DV0K 5GAGP 1GLBG 1GLJO 3VQ5A 1TGOA 3FFKB 3IS9A 1UA1A 1RBTA 3VOVA 4IO8A 4KFBA 4C8MA 3SMPA 4CF9A 4QCLA 4DTOA 3WUHA 3DLBA 3CCEN 3F9MA 1W97L 3VQBA 4MO4A 4FYDA 4CHPA 4UQGA 3NVKA 3VEVA 2XRIA 5M1QA 4IG0A 4CJPA 3C0BA 3CCLN 2Z1IA 5AQNA 4BRLA 3OY9A 3T69A 3MAQA 2HMPA 3CQYA 3K5LA 3S3MA 1C1BA 4B1VA 4F9OA 3D2EB 1ATSA 3DM2A 2YCHA 4CK2A 3MEGA 3G0ZA 1BCMA 3DXKB 1XNRK 3HSTB 2P9SA 2WC9A 5GAHP 1GLDG 1RTHA 4LH5A 3TR8A 3E9LA 3LDLA 1U04A 3ZT1A 2VQFK 2QXLA 5AFUA 2PYJA 3VQ6A 1BIUA 2YHXA 3ZSXA 3SI6A 1NKCA 2OPSA 5HL7L 1MDUB 1B9DA 4ELVA 4DTSA 2O4IA 4KREA 5HRNA 1A5WA 5B8HA 1BWFO 1DKGD 1HYVA 3DXKA 5JVHL 1NLVA 3HPOA 2ZD1A 3CCVN 4V19S 3M5RA 3L0QA 5KQDA 1WLJA 4O8KA 1L5UA 1ATRA 3QFUA 4KHPK 1XI1A 4BRIA 2HHHK 3NBPA 3SBGA 4DQ8A 3KK1A 1RGIA 4B8AB 4J2DA 1HNXK 2DTUA 1YTAA 3F9KA 3QNOA 1GLAG 1XQSC 3ZETB 2HOEA 3HM8A 2OANA 2BUPA 1LV5A 3KLFA 2NRTA 1HJOA 1VQNN 3HI0A 1X3MA 4OGCA 4BG9A 1NGIA 1U47A 1EP4A 1QZ6A 3MMVA 1RDWX 4IBNA 4XH4A 1NMDA 5HRPA 1WSGA 4DSJA 4I2PA 4JKFA 4DTXA 3KD1E 3CF5L 4CJWA 3KLHA 2O8FB 3ZLJA 3T1HK 1JCGA 4K8XA 1T6CA 1RDAA 4CHNA 2YHBA 1HYSA 2QWQA 1TK5A 3SAHA 3ZSVA 2P9PB 3OHRA 4FM0A 4EFHA 2OPRA 2NRXA 1WAJA 3PIPL 4PUOA 3M8QA 1NBWA 3R8EA 2GBZA 2UUBK 5J2MA 4CJTA 4YOUA 4BRFA 4O44A 1ZBFA 5M1KA 5M1NA 4K25A 3IFRA 4CZFA 3PSIA 4BRKA 2F4VK 3G10A 2RKIA 5H1SQ 1ZYQA 1O1WA 1GLLO 3NDKA 4IJAA 1QSSA 1DT9A 1IKVA 3AVGA 2P9PA 1LWEA 1RDUA 3ZEUA 5AQMA 3VQCA 3CQXA 2O8EA 4GKKK 3O1WA 1BI4A 3TAQA 4OJRA 5C10A 4FZXC 4HWIA 4DTMA 3HO1A 2E6MA 1WSIA 4M3TA 3ID8A 3A5MC 4DR2K 3M8RA 5AFUH 3KD5E 4NYFA 5MLCQ 3ZCMA 2H3GX 4DCHA 2X6SA 3RVCA 4K8ZA 3HVTA 4KTWA 5M1OA 2BANA 4DHYA 3WT0A 2I7PA 4B1UB 4OPKA 3O3FA 1XUPO 4FWMA 5F2RA 3GDQA 3V9ZA 3P38A 4AQYK 3NH2A 2P5GA 4JNEA 3TSPA 1LWCA 3TABA 4DQIA 1SUQA 2VWBA 1Z05A 3WEEB 1VSMA 1IH7A 2G8UA 1KXPA 3PO4A 3RMBA 4B9VA 3ATUA 3BP8A 4F3OA 3OYLA 4B1XB 4CF2A 4BE1A 5AQKA 4BE7B 1JXEA 2A6AA 2R7YA 2B4JA 3L2VA 3VEWA 4C23A 3NE6A 4CW7B 4H5TA 1I3AA 3HPHA 4FJ9A 1REVA 5AQVA 4ELUA 3VQ7A 4B08A 4I7FA 4EAHD 3OYNA 3WNGA 4CESA 4RW6A 1T03A 3OTOK 3I56N 4OVLA 3CCSN 1EXQA 1VSJA 3NH0A 4ILGB 4E7IA 3D2FA 1QQOA 4O4GA 3SUNA 3RSEB 1HJRA 4IWVA 1HNIA 3QB0A 5CZ1A 2DPNA 4NXMK 5M1PA 3WXIA 4CIFA 1UWBA 4YOYA 1S22A 1NK7A 4DB3A 2EHGA 1KLNA 1NG9A 1ZXOA 3VQPA 4OGEA 1NGGA 1IKXA 1HR0K 2A1RA 2OCEA 4BR2A 3AA5X 4B9LA 3DLLL 1VQ6N 2DFFA 5TKYA 3AVJA 4XH1A 2BE2A 3AVCA 1QE1A 1VSLA 3DLEA 3SZ2A 3CCQN 4CHYA 2P1JA 2KHOA 4CZJA 1S1VA 3RWUA 1QSLA 5ADXA 3AAQA 4JKHA 1U48A 1N32K 3SUQA 3QIOA 3ULEB 3EZ5A 1RDCA 4AHSA 3EE8A 1NK5A 2NRWA 4JI2K 4IXCA 5AQRA 4CJRA 1VQ5N 4DU4A 3UKUB 4BREA 5KI6A 4WF9L 2HHQA 4ZHRA 1NK6A 4CEOA 1C1AA 4AH9A 1KLMA 4CK3A 4FK0A 2NNWA 5AQFA 1JCEA 1VHXA 1KTQA 1Y64A 2Z1HA 1OVQA 4C8OA 3EZWA 2KZMA 3S9HA 3M1FA 4FLXA 2C1IA 1WAFA 3KWIA 3THXB 1TK0A 4IFYA 3O80A 1GLEG 1JCFA 4F4KA 1XHZA 4YFUA 1W9HA 2P9LB 4QS9A 3UKUA 5BPMA 4LFAK 4FL9A 4GY2B 4ISEA 1HKBA 4OPJA 3RRHA 5FRNA 4A2BA 3VF6A 4DSKA 3LL3A 4FJHA 4Z94A 2HNYA 3H08A 3CMAN 5AQGA 5BRDA 4M7XA 3WXKA 5EY4A 4HTUA 3K2PA 3OVNA 1VQMN 2QWMA 1VSEA 4CJ7A 1V4SA 1RT1A 5D3GA 2HHXA 4DF4A 3IAYA 3I33A 1EWRA 1ZBLA 2HHIA 1C0UA 4CHOA 3AO2A 3VEZA 4A62A 1YXQA 4OLAA 3TSQA 4Z4GA 3O5BA 4JK9A 3OW2M 1IV0A 3OYJA 4IG3A 3FR0A 4FJKA 1HYZA 2KQ2A 3CIPA 4DR4K 1RBVA 4H5NA 4B9NA 1OVYA 1EWQA 4X64K 3V9XA 3VGKA 2GWKA 3HYFA 4A57A 3VQDA 3RMCA 4FWKA 4IDHA 4CD3A 4JKCA 4CCHA 3H6EA 1S6QA 1VQON 4JS5A 3T19A 5GIOA 1TV6A 4PKGA 1NK9A 3QEPA 2QWPA 4R79A 3ZSYA 2YKMA 3NCIA 3MK6A 2EX3A 1WBBA 4U67L 2W40A 3VA0A 3K9JA 1HQUA 1ZBIA 2YNIA 3ATVA 3PY8A 3MDQA 3EKSA 4H5RA 4K43A 3ZT0A 1HUXA 1QZ5A 1NK4A 5AR0A 4RTFD 4AHCA 2I7NA 3FZMA 5JICA 4CEAA 4K42A 3F2KA 3M8PA 3L8BA 4DS4A 4OPAA 2NRHA 1NGJA 4ISGA 2FC0A 4JRQA 4M3RA 2QK9A 1J6ZA 2G8IA 3TAEA 4KAZA 2D5RA 3DXMB 3SJJA 1S72N 4Q0BA 3CCRN 4JEPA 1SAZA 2J4RA 3O9RA 2O8DA 5KRTA 1NGAA 2P9KA 3QIPA 4FJJA 1C0GA 4CEFA 3DRRA 4B9TA 3QO9A 3MCAB 5C25A 3D45A 4TSXA 4J2BA 4E89A 5SZTA 4B1WB 1YT3A 5AZJB 4CEZA 3CFPA 2FBTA 4CFCA 1SV5A 2W6KA 1JLBA 4BC4A 3DXMA 3OYIA 4DTRA 4FWPA 4O5FA 3MX5A 2CH6A 4LY7A 3GE1A 4KO0A 4FWRA 1QHAA 1J5OA 3ZSQA 1E4FT 2E4LA 3SPZA 1Q81O 3CJ7A 3J7ZO 1ILYA 1JKHA 4JI4K 4FOIA 4BRAA 3BUZB 4GW6A 4BACA 2Z1GA 2A40A 2FSNA 4JLHA 3SQ1A 5JMVA 5KPTA 3JYTA 1ZBHA 4EZ6A 4B1ZA 4RWTA 5BN9A 3NH1A 3V6DA 3ZT3A 4Z0UA 5KGXA 4B3TK 2QKKA 4W5OA 1J53A 4X62K 2HHSA 1RT5A 4CI6A 2HB5A 2NRVA 3L4QA 1XC9A 3V9WA 3HVRA 3FZFA 4AHTA 3L6QA 3KZBA 4E72A 4Z4EA 5KQ8A 4GV6A 4B9MA 3OYCA 1VSIA 3M8SA 4LF7K 2OZMA 1VSKA 2G8VA 3HTVA 1U2VB 4DF8A 4NCBA 3S3OA 4PKHA 1IJJA 4IO9L 4WQ5A 5AQLA 3SUOA 4DLEA 3V4IA 4C1NI 3CFOA 2P51A 1C0FA 2YNFA 4LF4K 1RNHA 1WNSA 3VQEA 4F2SA 4DQPA 3NGYA 4BE0A 2PYLA 1TYQA 3KWGA 3FLCO 1LW2A 5FDLA 2W42A 2O8CB 3KIOA 3O9QA 5C0YA 1WUAA 3O3HA 4BY9C 5HBMA 4WQ5C 3ZYYX 2HMIA 1QSYA 1BA0A 3CJBA 4IFVA 2IDOA 4O8UA 3S3NA 4KRFA 3EN9A 4CD1A 1TAUA 2BH1A 1EKEA 4ILHA 3BF3A 4DR6K 4RW7A 1X9SA 4CHZA 4JK8A 4BRNA 3LPUA 1NJWA 4FXDA 4BRPA 3V9SA 2BTFA 2A42A 1SKRA 2ZGZA 5AQXA 4DLGA 3P39A 4FLWA 1L3SA 1NK0A 2D4WA 3OJSA 1HKCA 4FOEA 1Z25A 3CHWA 1VRTA 1V4TA 3C6UA 3AVFA 3LP2A 2IVNA 1VAZA 4BR4A 2UUCK 2ZQBA 4GMJB 2AP1A 1ESVA 4CF8A 1CZ9A 1R59O 3RMAA 2GUIA 3JXUA 4M63C 2FBVA 4K41A 5FROA 5HRSA 4JK7A 2QWRA 1WB9A 3G6EN 3HT3A 3D2EA 3FGUA 3TTDA 4JKDA 2YJFA 4E19A 3DOLA 4CJ3A 3VGLA 1JLFA 3R9PA 5TKWA 2HSTA 4DSLA 3WXMB 1EX4A 1Q82O 3RTVA 2P5OA 2GX9A 4B9UA 1XC3A 2E1ZA 4BR5A 3L3VA 3KLEA 1NM1A 4U7BA 4JKGB 1Q18A 4E7HA 3DOKA 2ITGA 4DV5K 4NCAA 4B1YB 1VSDA 1KAZA 4RCHA 3ZX0A 3UB5A 1VQPN 1BG3A 5AQZA 4JKEA 1FKOA 3ZT4A 2VCPA 3A5LC 3VQAA 1WN7A 4M3ZA 4NLCA 1FW6A 1VQKN 2ZJQL 1U6ZA 3DJCA 4JKGA 1XHXA 2VGMA 3H1VX 1ITGA 4BQZA 4ID5A 3SNNA 3L4IA 4LD0A 5JLFA 1YVUA 1ATNA 3ZETA 3KK3A 3CCUN 2D0BA 5JVGL 4JI7K 1E3MA 1NK8A 3R1XA 3E1YA 3O1BA 4WFAL 4PL7A 3VESA 2FBYA 2IC3A 1VRUA 4PY5A 3SV4A 3ASMA 1RBSA 1NJZA 3CC4N 3LWMA 5JENA 1HQEA 3HOTA 4LC9B 4FJMA 4FCYA 3SYZA 5A2QO 1KRPA 2O4GA 3NHGA 2O8FA 4WFNL 4OKJA 4GKJK 1RDBA 3CC2N 1IBMK 5AQSA 1QQNA 3Q7BA 1SL0A 1B92A 1G99A 2HVHA 2HHUA 1FKPA 1C0MA 1CXQA 5LY3A 2D0OA 4FJ8A 4Z4CA 4BRDA 2IVOA 5GINA 1Q7YO 1D8YA 4W5RA 5BN8A 1U45A 5HROA 2E2NA 3QETA 3ZX3A 4HTLA 3MN6A 3MN7A 3WQTA 3IDHA 3HJFA 1BQNA 2QKBA 3HP6A 4HUGA 1BQMA 3TU5A 3EYZA 4DV2K 3GL1A 4DQRA 4ZTFA 2VG7A 3LAMA 1YJ9N 4CFAA 4I9LA 4NO7A 4CZHA 2YKNA 2YV0X 5I9EB 4DTPA 1T8EA 1IBKK 4H0VB 3CD6N 3VQQA 1YAGA 3DMJA 1NJYA 1TKDA 4J2AA 3WXLA 4DSFA 3NFAA 3CJAA 4KBOA 4DQSA 4CGHA 3QLHA 4JI3K 1N34K 3A5NC 4CFDA 4F8RA 4I6MB 2B5JA 4NLBA 3TI0A 3BY5A 1NGFA 4BDPA 3TWHA 1HLUA 2E6LA 2QXFA 1VQ4N 4H03B 3CI5A 2A5XA 4CEBA 2OZSA 1RFQA 4MO5A 2V7ZA 3CG7A 5AQTA 5KPRA 3HSCA 3MXIA 3WEEA 4KTZA 1NGEA 4BDZA 2E2OA 2F8SA 4G9ZA 3HOSA 4MQ3A 2UXBK 1SS6A 4IOCL 5C12A 2D1KA 3HRGA 4RW8A 4JD2B 3MXMA 4QS7A 4FPAA 1RT7A 3SAGA 3M6GA 4JS4A 4DR1K 3I0SA 3ISNC 1XNQK 5JS1A 3BEXA 1WSEA 5GAEP 4DV4K 3VA3A 1K6YA 1MWKA 3OYBA 4IFEA 3KTQA 3L2UA 1FJGK 2ATQA 3F5TA 4XEIA 4XIUA 4BWJA 4BVPA 4MDAA 3O3GA 2DFEA 3H46O 1P8ZA 3C6AA 4CZMA 3K5NA 1S9EA 1RT2A 4OX9K 3HK2A 3A5OC 4H0OA 2ZGYA 3RSEA 4BC3A 2NLXA 3H45C 3JAMO 3SV3A 4N41A 4YOWA 4BRCA 2P9NB 4B3SK 1L3TA 2Y1JA 4X65K 2Q2RA 5DK5A 3PX0A 4FWSA 3D0PA 3T3FA 4M45A 4H4MA 2LSNA 2PFUA
chains in the Genus database with same CATH topology
1QZ5A 2FSJA 4JKBA 5M1QA 2GELA 3C0BA 3CCLN 5AR0A 3C65A 2PBDA 5AQNA 3EO3A 4RTFD 4BRLA 4WFBL 3T69A 2E2PA 2I7NA 5E84A 3FZMA 4PKIA 2HMPA 3CQYA 5JICA 1QVGM 2GUPA 4K42A 3F2KA 2Q97A 4B1VA 3GOIA 4OPAA 2NRHA 1NGJA 4ISGA 4MLEA 2E1YA 3D2EB 3VGMA 1ATSA 4CZLA 4F9OA 3G4SN 1J6ZA 3LDPA 2YCHA 3DXMB 2KLAA 1S72N 3VEYA 3DXKB 2FF6A 3CCRN 4JEPA 3VPZA 1SAZA 3SMSA 2J4RA 3CC7N 3O9RA 5AZIB 2P9SA 2GWJA 1EO1A 4CZIA 2WC9A 1NGAA 5BR9A 5GAHP 1GLDG 3ULEA 2P9KA 3R6MA 4CBXA 3QBWA 3E9LA 3LDLA 5ELZA 1C0GA 5EX5A 2QXLA 5AFUA 1VQ9N 1MWMA 3LDNA 3MCAB 3O9TA 5AQPA 3EL2A 2VYPA 4B1WB 2YHXA 2UYTA 2GEMA 4L3QA 5AZJB 3T7ZA 3ENHA 4XJXA 5HL7L 1MDUB 3C6HA 1YVNA 3UKRB 4BC4A 4H0YB 1YHQN 3DXMA 4FWPA 2WUSA 4O5FA 5JLHA 3MX5A 2CH6A 5B8HA 1BWFO 1DKGD 3DXKA 3GE1A 3LM2A 5JVHL 1NLVA 4FWQA 4FWRA 5F0XA 1QHAA 2ASPA 2ITMA 1YJNN 3CCVN 4XH5A 3M5RA 1GLCG 3L0QA 5KQDA 1E4FT 2ZF5O 4O8KA 1ATRA 3QFPA 3MN9A 3QFUA 1Q81O 1TUYA 3CJ7A 3J7ZO 3C7NB 1ILYA 4FOIA 4YOVA 2YI1A 3BUZB 4BRAA 5CE3A 4BRIA 3J8AA 4AF1A 2A40A 2HBLA 2FSNA 4H0XB 3SBGA 4DQ8A 2P9LA 1RGIA 4FWOA 2GTDA 4JHDB 5JMVA 5KPTA 5CHIA 2ASMA 5KPZA 2V51B 5BRHA 3D2FB 1JJ2M 4B1ZA 4RWTA 3AAPA 3QBXA 5BN9A 5EOYA 3UKRA 4J8FA 1GLAG 3VENA 1XQSC 2CGJA 2HOEA 3EKUA 3HM8A 4I6MA 3ZETB 3E66A 1D4XA 2OANA 2BUPA 4CI6A 1KD1O 2NRVA 3L4QA 1YITN 2NRTA 1HJOA 1VQNN 3HI0A 1X3MA 4BG9A 2P9IB 1NGIA 3FZFA 3U9ZA 1QZ6A 3MMVA 3OBWA 3L6QA 3KZBA 1RDWX 3FE1A 4XH4A 1NMDA 5KQ8A 4GV6A 4JKFA 3CJ9A 5CR4A 3CF5L 3HTVA 1U2VB 3MCPA 2WBNA 1P90A 3SJHA 4PKHA 1IJJA 4IO9L 4OO1J 3OBYA 3H3OB 4WQ5A 5AQLA 4WQ4A 1KQSM 4C1NI 1JCGA 4BR7A 1C0FA 1T6CA 4CBUA 4BR9A 4BEBA 4GNIA 2QWQA 4MLHA 3SAHA 2CH5A 1TYQA 3KWGA 3FLCO 2P9PB 1K8KB 3OHRA 4EFHA 1N8RO 3O9QA 1BU6O 2NRXA 3O08A 3VERA 3PIPL 5C0YA 2D0PA 1WUAA 4JD2A 1NBWA 3R8EA 4M7YA 3QDKA 4YORA 4BY9C 4WQ5C 3ZYYX 4WQ4C 1BA0A 3CJBA 4O8UA 4YOUA 5GIPA 3EN9A 4CD1A 2BH1A 4BRFA 1KAXA 4ILHA 5M1KA 5M1NA 3BF3A 3O8MA 4K25A 3IFRA 4CZFA 4BRKA 4JK8A 4BRNA 1LCUA 4H5WA 4IOXA 4QS8A 2Q36A 4BRPA 2BTFA 3O6WA 2A42A 4DKWA 5H1SQ 3AGRA 3ENOA 2NRZA 3CERA 2HF3A 5E26A 1GLLO 2ZGZA 5AQXA 1SZ2A 4IJAA 3U9DA 1DT9A 1VQLN 3P39A 4YDUA 4BRHA 1BDGA 2D4WA 2P9PA 3AGKA 1RDUA 3CJ1A 1HKCA 4FOEA 5AQMA 3CHWA 3ZEUA 1V4TA 3CQXA 2P9NA 2IVNA 3O1WA 3ENBA 3CPEA 1VAZA 2F7TA 2V52B 5C10A 2Q0UA 4HWIA 1X9JA 4BR4A 1HX1A 3N4PA 3FZHA 2AP1A 1Z6RA 1ESVA 3LM9A 1R59O 3ID8A 3JXUA 2IIRA 3A5MC 4M63C 5AFUH 1VQ7N 4YDUC 3VEOA 4PHTX 5C2DA 4K41A 5MLCQ 3QICA 4Y0WA 3CXCM 2H3GX 2YX6A 3CMEN 4DCHA 4JK7A 2QWRA 3G6EN 5BPNA 3D2EA 3RVCA 4MDBA 3FGUA 5LJVA 3TTDA 5AQHA 4JKDA 5M1OA 4KH5A 2CGLA 2YJFA 4DHYA 5DM6L 3WT0A 2I7PA 4B1UB 1BUPA 3M3ZA 4JKAA 3P31A 3E9PA 1XUPO 3DAWA 3VGLA 3CETA 3R9PA 1WOQA 2CGKA 4FWMA 5F2RA 5TKWA 4AM6A 4EIAA 3ID6A 5AZIA 4BGAA 2HSTA 3OA9A 3GDQA 1GLFO 4YOXA 5FPNA 2F9TA 3WXMB 3P38A 3CPWM 1YIJN 4IOAL 3KVGA 1Q82O 4JNEA 3TSPA 1E4GT 2NRRA 5C15A 3AY9A 3W3DA 2GX9A 1XC3A 2E1ZA 4JAXA 4IEIA 2VWBA 4E1JA 4BR5A 1Z05A 3WEEB 2FXUA 4UY8O 1NM1A 4WCEL 3KK7A 1KXPA 4U7BA 4JKGB 4AM7A 5AZJA 3TTFA 1NGHA 3MWTA 3PLAA 1Q18A 3ATUA 3BP8A 3A0IX 4B1XB 5FPEA 1TUUA 5AQKA 4B1YB 3WQUA 4GV3A 3CCJN 2JWLA 4BE7B 1ZBSA 2A6AA 3BF1A 1KAZA 4RCHA 3ZX0A 3UB5A 4FPBA 1BG3A 5AQZA 3VEWA 3ZX2A 1VQPN 4JKEA 1T6DA 4C23A 2ZJPL 4H5TA 2V7YA 2VCPA 2OTJN 2WFBA 3A5LC 5AQVA 3DWLA 5AQQA 3MN5A 2A41A 3QMLA 4BVOA 4EAHD 5BPLA 3VMFB 3C7NA 4NLCA 3UE5A 1VQKN 2ZWHA 3O9SA 4IEEA 2ZJQL 3I56N 5AQYA 1CZAN 1NGDA 2C1GA 1EQYA 1U6ZA 4JHDA 3CCSN 3DJCA 4JKGA 3VETA 2VGMA 3H1VX 3MX2A 4ILGB 2HF4A 3D2FA 5DM7L 4BQZA 3GBTA 1QQOA 4KH6A 3RSEB 4IWVA 3L4IA 3QB0A 2DPNA 3HZ6A 5JLFA 1MA9B 3H1QA 5M1PA 3WXIA 1ATNA 3ZETA 1HKGA 3CCUN 5JVGL 3G71N 5FPMA 3IUCA 3R1XA 4YOYA 1S22A 3E1YA 1BO5O 3PIOL 3O1BA 4DB3A 4WFAL 4PL7A 1BA1A 3VESA 3E9OA 3TSUA 1M90O 4FVUA 1ZXOA 2P9IA 2A3ZA 3CC4N 1DGKN 2HBMA 1NGGA 3SBTA 4BR2A 1W2BM 1Q86O 5FPDA 3HOTA 4LC9B 4CZGA 1U2VA 3DLLL 4H0TB 4A5BA 2FSKA 1VQ6N 5C2FA 5TKYA 5EXWA 1YJWN 4XH1A 4EHTA 3D7EO 3CCQN 4WFNL 5AQJA 2ASOA 4H5VA 2KHOA 4PL8A 4CZJA 3CC2N 2E8AA 3A8YA 3WXJA 5AQSA 3LDOA 3O4WA 1QQNA 5EVZA 2P9SB 3Q7BA 1G99A 3AAQA 5ADXA 1K73O 4JKHA 3W0LA 3AARA 1K8KA 3P4IA 3B8AX 2P9KB 3ULEB 5AQIA 5ADXH 3KHYA 1VQ8N 2RE2A 1HPMA 2D0OA 3EE8A 3JS6A 4OPHA 2FF3B 5LY3A 2NRWA 3I55N 1NWKA 4IXCA 5AQRA 4BRDA 2IVOA 5GINA 1Q7YO 2YJEA 3K9KA 4BR0A 1VQ5N 2W00A 5BN8A 3O9UA 4WYBA 2YHYA 3MWPA 5AQWA 2E2NA 3UKUB 4BREA 2FLOA 4CBWA 3ZX3A 3TPQA 5LJWA 5GADP 5BREA 4WF9L 5HOOA 3U8XA 4BROA 2ZJRL 2NZTA 1ZC6A 4HTLA 3CCMN 3MN6A 5F1XA 1YF5L 3MN7A 2NNWA 5AQFA 3WQTA 1JCEA 1NJIO 3IDHA 3Q7CA 5BRFA 1Y64A 4FO0A 2PAVA 3EZWA 2E88A 3TU5A 3D6RA 3R3LA 3M1FA 2Q0RA 3GL1A 3H3NO 2E2QA 3NVMA 2C1IA 4ILJA 4A61A 3VEXA 3KWIA 1YJ9N 4NO7A 3O80A 4CZHA 4JN4A 1GLEG 5I9EB 2HBKA 1JCFA 3HBTA 4H0VB 1YI2N 2P9LB 3CD6N 4QS9A 2Q1NA 1YAGA 3SLCA 3UKUA 3IKMA 5BPMA 3WXLA 1K8AO 3NMUA 1KAYA 4FL9A 4GVEA 3CJAA 4GY2B 4ISEA 4BGBA 4KBOA 1HKBA 4BRMA 2AA4A 4A2BA 2QA4N 3A5NC 3VF6A 3LL3A 1NGBA 4BC5A 4Z94A 2VGNA 3FZLA 3I8BA 3GG4A 3CMAN 4I6MB 1KC8O 3IMXA 5AQGA 2P9UB 4M7XA 5BRDA 2QTDA 2QI2A 3WXKA 5EY4A 3SK3A 4NLBA 4ISFA 1VQMN 1H1VA 1NGFA 2QWMA 1HLUA 4FWLA 4CJ7A 1BOTO 1O13A 3G25A 4BC2A 1V4SA 1LOTB 4BQLA 1VQ4N 4H03B 4GV9A 3CI5A 4EHUA 4BECA 2Q31A 2A5XA 2QWOA 3I33A 3VF4A 1DEJA 1RFQA 1OKJA 4MO5A 2V7ZA 3LDQA 3N4QA 1IG8A 5AQTA 1M1KO 3S41A 1T44A 4BRQA 4IZ9A 5AQUA 1YXQA 3HSCA 4NB4A 3VEZA 3WEEA 4A62A 3TSQA 5KPRA 3O5BA 4JK9A 4CZKA 1NGEA 3OW2M 2E2OA 2QEXN 2P9UA 3FR0A 2IVPA 4G9ZA 3HOSA 4BG8A 1TYQB 1SS6A 4IOCL 3VTHA 2HBJA 5C12A 2D1KA 3HRGA 3CIPA 4A5AA 3EE9A 4JD2B 4QS7A 4FPAA 1NGCA 2QM1A 3TTCA 1X3NA 4FSVA 3M6GA 4H5NA 3SAGA 4YOTA 4H0PA 1SQKA 2JWKA 4FWNA 4CZEA 3BEXA 1OVYA 1YUWA 2E20A 3CJCA 5GAEP 2OTLN 1QVFM 1MWKA 2YHWA 3FZKA 2QWNA 3VGKA 1QQMA 2F9WA 4IFEA 2GWKA 4IJNA 2RHKA 3VTIA 4A57A 1S3XA 3F5TA 4XEIA 4BRGA 4FWKA 4C1NK 1K9MO 4IDHA 4CD3A 4JKCA 4BVPA 5M1FA 4MDAA 2W41A 2QWLA 2QW9A 3H46O 1P8ZA 3C6AA 3H6EA 4A59A 4CZMA 5GAGP 1GLBG 1GLJO 1VQON 5GIOA 3FFKB 4PKGA 4A2AA 3A5OC 3VOVA 4IO8A 4H0OA 2ZGYA 3RSEA 4B9QA 4BC3A 2QWPA 1T3VA 4R79A 3ZEUB 2NLXA 3H45C 3SMPA 4KH4A 5AQOA 4YOWA 4BRCA 2P9NB 3MK6A 3WUHA 3SAFA 4U67L 2W40A 2Q2RA 2KKZA 3CCEN 2EWSA 3F9MA 3K9JA 1W97L 3U4LA 4MO4A 3VF2A 3ATVA 4FWSA 3MDQA 3NVKA 3EKSA 3VEVA 4H5RA 4K43A 2PFUA 1HUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZ5 A;  2FSJ A;  2GEL A;  3C0B A;  5AR0 A;  2PBD A;  5AQN A;  3EO3 A;  4RTF D;  4BRL A;  2E2P A;  2I7N A;  5E84 A;  3FZM A;  4PKI A;  2HMP A;  3CQY A;  5JIC A;  2GUP A;  4K42 A;  2Q97 A;  4B1V A;  3GOI A;  2NRH A;  1NGJ A;  4ISG A;  4MLE A;  2E1Y A;  3D2E B;  3VGM A;  1ATS A;  4CZL A;  4F9O A;  1J6Z A;  3LDP A;  2YCH A;  3DXM B;  3VEY A;  3DXK B;  2FF6 A;  3VPZ A;  1SAZ A;  3SMS A;  2J4R A;  5AZI B;  2P9S A;  2GWJ A;  4CZI A;  5BR9 A;  1NGA A;  1GLD G;  3ULE A;  2P9K A;  3R6M A;  4CBX A;  3QBW A;  3LDL A;  5ELZ A;  5EX5 A;  1C0G A;  2QXL A;  5AFU A;  1MWM A;  3LDN A;  5AQP A;  3EL2 A;  2VYP A;  4B1W B;  2YHX A;  2UYT A;  2GEM A;  4L3Q A;  5AZJ B;  3ENH A;  1MDU B;  1YVN A;  3UKR B;  4BC4 A;  4H0Y B;  3DXM A;  4FWP A;  2WUS A;  4O5F A;  5JLH A;  2CH6 A;  5B8H A;  1BWF O;  1DKG D;  3DXK A;  3GE1 A;  3LM2 A;  1NLV A;  4FWQ A;  4FWR A;  5F0X A;  1QHA A;  2ASP A;  2ITM A;  4XH5 A;  1GLC G;  3L0Q A;  5KQD A;  1E4F T;  2ZF5 O;  4O8K A;  1ATR A;  3QFP A;  3MN9 A;  3QFU A;  1TUY A;  3CJ7 A;  3C7N B;  4FOI A;  2YI1 A;  3BUZ B;  4BRA A;  5CE3 A;  4BRI A;  3J8A A;  2A40 A;  4H0X B;  2FSN A;  4DQ8 A;  2P9L A;  1RGI A;  4FWO A;  2GTD A;  4JHD B;  5JMV A;  5KPT A;  2ASM A;  5KPZ A;  2V51 B;  5BRH A;  3D2F B;  4B1Z A;  4RWT A;  3AAP A;  3QBX A;  5BN9 A;  5EOY A;  3UKR A;  4J8F A;  1GLA G;  3VEN A;  1XQS C;  2CGJ A;  2HOE A;  3EKU A;  3HM8 A;  4I6M A;  3ZET B;  1D4X A;  2OAN A;  2BUP A;  4CI6 A;  1HJO A;  3HI0 A;  1X3M A;  4BG9 A;  2P9I B;  1NGI A;  3FZF A;  3U9Z A;  1QZ6 A;  3MMV A;  3L6Q A;  3KZB A;  1RDW X;  3FE1 A;  4XH4 A;  1NMD A;  5KQ8 A;  3CJ9 A;  3HTV A;  1U2V B;  3MCP A;  3SJH A;  4PKH A;  1IJJ A;  3H3O B;  4WQ5 A;  5AQL A;  4WQ4 A;  1JCG A;  4BR7 A;  1C0F A;  1T6C A;  4CBU A;  4BR9 A;  4GNI A;  2QWQ A;  4MLH A;  2CH5 A;  1TYQ A;  3FLC O;  2P9P B;  1K8K B;  3OHR A;  4EFH A;  1BU6 O;  3O08 A;  3VER A;  2D0P A;  1WUA A;  4JD2 A;  1NBW A;  3R8E A;  4M7Y A;  3QDK A;  4WQ5 C;  4WQ4 C;  1BA0 A;  3CJB A;  3EN9 A;  4CD1 A;  4BRF A;  1KAX A;  3BF3 A;  3O8M A;  4K25 A;  3IFR A;  4CZF A;  4BRK A;  4BRN A;  1LCU A;  4H5W A;  4QS8 A;  2Q36 A;  4BRP A;  2BTF A;  3O6W A;  2A42 A;  3ENO A;  3CER A;  2HF3 A;  5E26 A;  1GLL O;  2ZGZ A;  5AQX A;  1SZ2 A;  4IJA A;  3U9D A;  4YDU A;  4BRH A;  1BDG A;  2D4W A;  2P9P A;  3CJ1 A;  1HKC A;  4FOE A;  5AQM A;  3CHW A;  3ZEU A;  1V4T A;  3CQX A;  2P9N A;  2IVN A;  3O1W A;  2V52 B;  2Q0U A;  4HWI A;  1X9J A;  4BR4 A;  1HX1 A;  3FZH A;  2AP1 A;  1Z6R A;  1ESV A;  3LM9 A;  1R59 O;  3ID8 A;  3JXU A;  2IIR A;  3A5M C;  4M63 C;  5AFU H;  4YDU C;  3VEO A;  4K41 A;  3QIC A;  4Y0W A;  2H3G X;  4DCH A;  2QWR A;  5BPN A;  3D2E A;  5LJV A;  3FGU A;  5AQH A;  2CGL A;  2YJF A;  4DHY A;  3WT0 A;  2I7P A;  4B1U B;  1BUP A;  3M3Z A;  1XUP O;  3DAW A;  3VGL A;  3CET A;  3R9P A;  1WOQ A;  2CGK A;  4FWM A;  5F2R A;  4EIA A;  4AM6 A;  5AZI A;  4BGA A;  3GDQ A;  1GLF O;  5FPN A;  2F9T A;  3KVG A;  4JNE A;  1E4G T;  3AY9 A;  3W3D A;  1XC3 A;  2E1Z A;  4JAX A;  2VWB A;  4E1J A;  4BR5 A;  1Z05 A;  3WEE B;  2FXU A;  1NM1 A;  1KXP A;  4AM7 A;  5AZJ A;  1NGH A;  1Q18 A;  3ATU A;  3BP8 A;  3A0I X;  4B1X B;  5FPE A;  1TUU A;  5AQK A;  4B1Y B;  3WQU A;  1ZBS A;  2A6A A;  3BF1 A;  1KAZ A;  4RCH A;  3ZX0 A;  3UB5 A;  4FPB A;  1BG3 A;  5AQZ A;  3VEW A;  3ZX2 A;  4C23 A;  1T6D A;  4H5T A;  2V7Y A;  2VCP A;  3A5L C;  5AQV A;  3DWL A;  5AQQ A;  3MN5 A;  2A41 A;  3QML A;  4BVO A;  4EAH D;  5BPL A;  3C7N A;  3UE5 A;  2ZWH A;  5AQY A;  1CZA N;  1NGD A;  1EQY A;  1U6Z A;  4JHD A;  3DJC A;  3VET A;  3H1V X;  2HF4 A;  3D2F A;  4BQZ A;  3GBT A;  1QQO A;  3RSE B;  4IWV A;  3L4I A;  3QB0 A;  2DPN A;  3HZ6 A;  5JLF A;  1MA9 B;  3H1Q A;  3WXI A;  1ATN A;  3ZET A;  1HKG A;  5FPM A;  3IUC A;  1S22 A;  1BO5 O;  3O1B A;  4DB3 A;  4PL7 A;  1BA1 A;  3VES A;  1ZXO A;  2P9I A;  2A3Z A;  1DGK N;  1NGG A;  4BR2 A;  5FPD A;  4LC9 B;  4CZG A;  1U2V A;  4H0T B;  2FSK A;  5TKY A;  5EXW A;  4XH1 A;  4EHT A;  3D7E O;  5AQJ A;  2ASO A;  4H5V A;  2KHO A;  4PL8 A;  4CZJ A;  2E8A A;  3A8Y A;  3WXJ A;  5AQS A;  3LDO A;  3O4W A;  1QQN A;  5EVZ A;  2P9S B;  1G99 A;  3AAQ A;  5ADX A;  3W0L A;  3AAR A;  1K8K A;  3P4I A;  3B8A X;  2P9K B;  3ULE B;  5AQI A;  5ADX H;  3KHY A;  5LY3 A;  1HPM A;  2D0O A;  3JS6 A;  2FF3 B;  1NWK A;  4IXC A;  5AQR A;  4BRD A;  2IVO A;  2YJE A;  4BR0 A;  5BN8 A;  4WYB A;  2YHY A;  5AQW A;  2E2N A;  3UKU B;  4BRE A;  2FLO A;  4CBW A;  3ZX3 A;  3TPQ A;  5LJW A;  5BRE A;  3U8X A;  4BRO A;  2NZT A;  1ZC6 A;  4HTL A;  3MN6 A;  5F1X A;  3MN7 A;  5AQF A;  3WQT A;  1JCE A;  3IDH A;  5BRF A;  1Y64 A;  4FO0 A;  2PAV A;  3EZW A;  2E88 A;  3TU5 A;  3M1F A;  2Q0R A;  3GL1 A;  3H3N O;  2E2Q A;  4A61 A;  3VEX A;  4NO7 A;  3O80 A;  4CZH A;  4JN4 A;  1GLE G;  5I9E B;  1JCF A;  3HBT A;  4H0V B;  2P9L B;  4QS9 A;  2Q1N A;  1YAG A;  3SLC A;  3UKU A;  5BPM A;  3WXL A;  1KAY A;  4FL9 A;  3CJA A;  4GY2 B;  4ISE A;  4BGB A;  4KBO A;  1HKB A;  4BRM A;  2AA4 A;  4A2B A;  3A5N C;  3VF6 A;  3LL3 A;  1NGB A;  4BC5 A;  4Z94 A;  3FZL A;  3I8B A;  3GG4 A;  4I6M B;  3IMX A;  5AQG A;  2P9U B;  4M7X A;  5BRD A;  3WXK A;  5EY4 A;  3SK3 A;  4ISF A;  1H1V A;  1NGF A;  2QWM A;  1HLU A;  4FWL A;  4CJ7 A;  1BOT O;  3G25 A;  4BC2 A;  1V4S A;  1LOT B;  4BQL A;  4H03 B;  3CI5 A;  4EHU A;  2Q31 A;  2A5X A;  2QWO A;  3I33 A;  3VF4 A;  1DEJ A;  1RFQ A;  1OKJ A;  4MO5 A;  2V7Z A;  3LDQ A;  5AQT A;  1IG8 A;  3S41 A;  1T44 A;  4BRQ A;  4IZ9 A;  5AQU A;  1YXQ A;  3HSC A;  4NB4 A;  3VEZ A;  3WEE A;  4A62 A;  5KPR A;  3O5B A;  4CZK A;  1NGE A;  2E2O A;  2P9U A;  3FR0 A;  2IVP A;  4BG8 A;  1TYQ B;  2D1K A;  3CIP A;  4JD2 B;  4QS7 A;  4FPA A;  1NGC A;  2QM1 A;  1X3N A;  4FSV A;  3M6G A;  4H5N A;  4H0P A;  1SQK A;  4FWN A;  4CZE A;  3BEX A;  1YUW A;  3CJC A;  2E20 A;  1MWK A;  2YHW A;  3FZK A;  2QWN A;  3VGK A;  1QQM A;  2F9W A;  2GWK A;  4IJN A;  1S3X A;  4XEI A;  4BRG A;  4FWK A;  4CD3 A;  4BVP A;  2W41 A;  2QWL A;  2QW9 A;  3H46 O;  1P8Z A;  3H6E A;  4CZM A;  1GLB G;  1GLJ O;  3FFK B;  4PKG A;  4A2A A;  3A5O C;  3VOV A;  4IO8 A;  4H0O A;  2ZGY A;  3RSE A;  4B9Q A;  4BC3 A;  2QWP A;  3ZEU B;  2NLX A;  3H45 C;  3SMP A;  5AQO A;  4BRC A;  2P9N B;  3MK6 A;  3WUH A;  2W40 A;  2Q2R A;  2EWS A;  3F9M A;  3U4L A;  4MO4 A;  3VF2 A;  3ATV A;  4FWS A;  3MDQ A;  3EKS A;  3VEV A;  4H5R A;  4K43 A;  1HUX A; 
#chains in the Genus database with same CATH topology
 3DLR A;  2FSJ A;  1SL2 A;  3VN5 A;  2PBD A;  4WFB L;  3EO3 A;  4DU1 A;  2E2P A;  3AVI A;  4Y1C A;  5E84 A;  1L3V A;  4PKI A;  4DMN A;  4Q5V A;  4FJ5 A;  2GUP A;  4IKF A;  4LSN A;  3O4Q A;  2Q97 A;  3GOI A;  1QS4 A;  3G4S N;  4DFJ A;  2E1Y A;  3VGM A;  3LWL A;  3LDP A;  3TAR A;  3SQ4 A;  3NGI A;  1VK0 A;  2KLA A;  4FLU A;  3SMS A;  4DTJ A;  5AZI B;  2GWJ A;  5IT9 O;  1EO1 A;  4CZI A;  5BR9 A;  5J1E A;  3ULE A;  3R6M A;  2XO7 A;  4EP5 A;  4RW4 A;  4R5P A;  3LDN A;  3O9T A;  5AQP A;  2XY6 A;  3T7Z A;  4CJQ A;  1BL3 A;  4XJX A;  3K57 A;  2RPI A;  5C42 A;  3OYH A;  4FJX A;  4HCB A;  4WE1 A;  3WNH A;  4H0Y B;  1MU2 A;  1YHQ N;  1HNW K;  5CY4 A;  3LM2 A;  4FWQ A;  5F0X A;  2ASP A;  4CEE A;  3ALY A;  4NYN A;  2ZF5 O;  3QFP A;  3THX A;  3QEI A;  4LF8 K;  1JL2 A;  1TUY A;  4B8C A;  3C7N B;  4E0D A;  4FM1 A;  4YOV A;  2YI1 A;  1IBL K;  2HW3 A;  1RT6 A;  2HBL A;  4H0X B;  3J80 O;  2P9L A;  4JHD B;  4FWO A;  2GTD A;  4CF1 A;  5KPZ A;  4FLZ A;  2VG6 A;  4ZTJ A;  1TL1 A;  4O55 A;  4Z4I A;  1JJ2 M;  4N76 A;  1KFS A;  5EOY A;  2ZM6 K;  4J8F A;  3VEN A;  4H8K A;  1RTI A;  2CGJ A;  3JSM A;  3EKU A;  1JLA A;  3PV8 A;  4C8L A;  1D4X A;  3ZT2 A;  1KD1 O;  4B3R K;  3THY B;  1Q9X A;  2P9I B;  4CGG A;  3FE1 A;  3LAK A;  4FJN A;  5SWM A;  2F96 A;  5CR4 A;  3MCP A;  1P90 A;  3SJH A;  3H3O B;  1S1U A;  3NF7 A;  2VWK A;  4CBU A;  4BEB A;  5J2N A;  1IG9 A;  1L3U A;  4B3M K;  1DLO A;  4H4O A;  4E7K A;  1HPZ A;  4MLH A;  1K8K B;  1BU6 O;  2D0P A;  2VG5 A;  4YOR A;  3PX4 A;  1FK9 A;  1IKW A;  4W5T A;  3OS0 A;  1RTD A;  3OS2 A;  4DU3 A;  4M3Y A;  1LCU A;  3SQ2 A;  3J7A P;  3L3U A;  1BGX T;  4C8K A;  3ENO A;  2NRZ A;  3CER A;  5E26 A;  3AVM A;  1SZ2 A;  1HRH A;  1VQL N;  4KKO A;  4BRH A;  1BDG A;  3CJ1 A;  3J7Y P;  3HL8 A;  3ENB A;  2F7T A;  2V52 B;  1HX1 A;  3N4P A;  3FZH A;  4IDK A;  1EET A;  4KHU A;  3LM9 A;  3V1O A;  3LAL A;  1CXU A;  4CJ5 A;  3VEO A;  4PHT X;  2O8B B;  1N33 K;  4DTN A;  1J5E K;  3CME N;  3CYG A;  1JLQ A;  1TAQ A;  1XMQ K;  4DUZ K;  5HP1 A;  4MDB A;  5I42 A;  5AQH A;  3OYF A;  4KH5 A;  3AVL A;  4KB0 A;  2JGU A;  3HP9 A;  1BUP A;  3M3Z A;  3P31 A;  3E9P A;  1WOQ A;  3B6P A;  4I2Q A;  4AM6 A;  3ID6 A;  4YOX A;  4BGA A;  3OA9 A;  2D0C A;  1GLF O;  5FPN A;  2F9T A;  3CPW M;  3C95 A;  4N5S A;  1YIJ N;  4IOA L;  4YY3 K;  1E4G T;  3AY9 A;  2ETJ A;  3I8D A;  4CGJ A;  4LFB K;  1RDD A;  2FXU A;  1OH5 A;  3KK7 A;  4M3X A;  1T7P A;  4FVM A;  5AZJ A;  2HHW A;  4DUY K;  4B9S A;  4CJS A;  5FPE A;  4PQU A;  3LPT A;  3KKS A;  1D5A A;  2XY5 A;  2E5L K;  1TK8 A;  1ZBS A;  3BF1 A;  2WOM A;  3ZX2 A;  3KKR A;  1ASV A;  2V7Y A;  4X66 K;  4B3O A;  3OYK A;  2OTJ N;  2WFB A;  2DY4 A;  3DWL A;  5AQQ A;  3MN5 A;  3QML A;  4BVO A;  1QTM A;  3K59 A;  3MED A;  3AV9 A;  4FJG A;  2ZWH A;  3O9S A;  4E1N A;  2C1G A;  1EQY A;  3SUP A;  3VET A;  4JRP A;  2HF4 A;  3KLI A;  1WSJ A;  1KFD A;  5DM7 L;  1C1C A;  3GBT A;  3K0S A;  3UIQ A;  3NGZ A;  4FK4 A;  2KW4 A;  3HZ6 A;  5CYQ A;  1MA9 B;  3H1Q A;  1HKG A;  2VQE K;  2IGI A;  3G71 N;  4JI6 K;  5FPM A;  1KVC A;  1WSH A;  3LDS A;  4EZ9 A;  1BO5 O;  4E1M A;  1BA1 A;  1T05 A;  1HNZ K;  1F21 A;  3LZI A;  1N6Q A;  2OA8 A;  1KSP A;  3OYE A;  1W2B M;  1Q86 O;  1ASW A;  5FPD A;  2I5J A;  1U2V A;  2FSK A;  2OPQ A;  1TL3 A;  3ZSR A;  4Z4F A;  2X78 A;  3BZC A;  2Q3S A;  4H5V A;  2NUB A;  2OYQ A;  2E8A A;  3A8Y A;  3WXJ A;  4FZY A;  4DTU A;  3O4W A;  2P9S B;  4LSL A;  3QNN A;  3W0L A;  5E41 A;  3AAR A;  3MEC A;  2O8C A;  5AQI A;  3KHY A;  3RR7 A;  1VQ8 N;  5LL6 Z;  4CVN E;  3I55 N;  2X6N A;  4CE9 A;  2FBX A;  5C24 A;  1TVR A;  2YJE A;  3K9K A;  4OKE A;  3U3G A;  5KRS A;  2W00 A;  3P5J A;  4WYB A;  4CJU A;  1UOC A;  5GAD P;  4CBW A;  3TPQ A;  5LJW A;  4BRO A;  2NZT A;  4DV1 K;  3CCM N;  1YF5 L;  3P1G A;  3OYG A;  1NJI O;  3Q7C A;  1BIZ A;  4FO0 A;  1TKZ A;  3DYA A;  1OH8 A;  2PAV A;  2E88 A;  2ZE2 A;  3D6R A;  3R3L A;  1J9A A;  4CJ4 A;  3H3N O;  3NVM A;  4ILJ A;  1D9F A;  3VEX A;  3HXM A;  5KGW A;  1RBR A;  3LAN A;  3HBT A;  5KTQ A;  1GOA A;  2UUA K;  3SLC A;  2Q1N A;  3NMU A;  1W7A A;  1RT3 A;  4GVE A;  3MXJ A;  4NXN K;  4CF0 A;  2AA4 A;  2QA4 N;  2UXD K;  1TKX A;  1XMO K;  1W0H A;  2VGN A;  3FZL A;  3GG4 A;  2HND A;  1KC8 O;  2P9U B;  2QTD A;  1ASU A;  3SK3 A;  5HLF A;  4CFB A;  1ZBU A;  3L2Q A;  4CIG A;  3AVB A;  1BOT O;  3G25 A;  4BQL A;  4FLV A;  4BWM A;  3ITH A;  1JL1 A;  4GV9 A;  2D0A A;  5EU7 A;  4BEC A;  2QWO A;  2KZZ A;  2RN2 A;  1DEJ A;  4HUE A;  1SKW A;  1OKJ A;  3N4Q A;  1IG8 A;  5I3U A;  3S41 A;  4BRQ A;  4IZ9 A;  2IS3 A;  1KVA A;  1U4B A;  4CZK A;  2KFN A;  3KJV A;  2QEX N;  4NCG A;  4JI5 K;  2P9U A;  2HBJ A;  1NU0 A;  4CGF A;  3EE9 A;  1NGC A;  2QM1 A;  1CZB A;  1X3N A;  3NF6 A;  4FSV A;  4YOT A;  4H0P A;  2JWK A;  3AO3 A;  3QEW A;  1QVF M;  5J2Q A;  2YHW A;  3FZK A;  2QWN A;  4BE2 A;  4DR5 K;  3C6T A;  1GOC A;  3NF9 A;  1S3X A;  3T1Y K;  4DV7 K;  4FZZ A;  4C1N K;  4CGI A;  2YHA A;  4DFK A;  2QWL A;  2QW9 A;  1KQS M;  4A59 A;  2KFZ A;  1HMV A;  2WTU A;  4A2A A;  3SPY A;  1DTT A;  4RW9 A;  4DR7 K;  1VSH A;  4B9Q A;  1T3V A;  4CIE A;  3ZEU B;  4KH4 A;  3VQ8 A;  4KI4 A;  5AQO A;  2OPP A;  2O8E B;  4DSE A;  3SAF A;  1BI4 B;  3T1A A;  2KKZ A;  2EWS A;  3U4L A;  3I0R A;  2UXC K;  3VF2 A;  4N56 A;  5J2P A;  3BDP A;  4LF9 K;  4JKB A;  2GEL A;  3SCX A;  3C65 A;  3TAM A;  1A5X A;  1S1T A;  3OYD A;  1JXB A;  1QVG M;  3AO4 A;  4MLE A;  4CZL A;  3OYA A;  3VQ4 A;  5K14 A;  2AJQ A;  1RBU A;  3CM6 A;  3DRP A;  1S9G A;  4CJF A;  3OS1 A;  3VEY A;  3KK2 A;  2FF6 A;  1X9M A;  3RRG A;  4KHS A;  4C8N A;  3VPZ A;  5LMU K;  3CC7 N;  3AVN A;  2G8K A;  4CBX A;  3QBW A;  5EX5 A;  5ELZ A;  5AJ3 K;  1S1X A;  3LP3 A;  4CEC A;  1VQ9 N;  1MWM A;  4AHV A;  1VSF A;  3EL2 A;  4FLY A;  2VYP A;  1NOY A;  3NF8 A;  1J54 A;  2UYT A;  2GEM A;  4L3Q A;  4DV6 K;  1UAX A;  3ENH A;  4PA1 A;  1A5V A;  2XY8 A;  2YNH A;  3C6H A;  2Z1J A;  3IRX A;  4FM2 A;  1YVN A;  3UKR B;  3CM5 A;  2WUS A;  5JLH A;  3WNF A;  1X1P A;  4N47 A;  2ITM A;  2VWJ A;  1YJN N;  4XH5 A;  1GLC G;  3MN9 A;  4CJL A;  5CE3 A;  3J8A A;  4AF1 A;  1BIS A;  1GOB A;  5CHI A;  2ASM A;  3AA2 A;  2V51 B;  1JLE A;  1JLG A;  5BRH A;  3QES A;  3D2F B;  3AAP A;  3QBX A;  4KI6 A;  3IG1 A;  1LW0 A;  3L2W A;  4KHN A;  3UKR A;  4HCC A;  1G15 A;  4I6M A;  4CEQ A;  1B9F A;  3E66 A;  3CYM A;  3PO5 A;  3O4N A;  2PZS A;  1YIT N;  1IKY A;  3U9Z A;  3OBW A;  4AHU A;  4CER A;  4GVM A;  1LWF A;  3CJ9 A;  1QHT A;  2WBN A;  3PX6 A;  2HHT A;  3AVA A;  4OO1 J;  3OBY A;  3OJU A;  4WQ4 A;  5FLX O;  4BR7 A;  4BR9 A;  4GNI A;  1UA0 A;  4FJI A;  2CH5 A;  4FJL A;  3V1Q A;  4JI0 K;  1N8R O;  3O08 A;  3VER A;  4FJ7 A;  4DS5 A;  4JD2 A;  2X74 A;  4M7Y A;  3QDK A;  4CJK A;  4KB1 A;  1S1W A;  4WQ4 C;  2G8F A;  1LAW A;  5GIP A;  1KAX A;  3O8M A;  3NAE A;  4FLT A;  3THW B;  3DI6 A;  4H5W A;  4MFB A;  4IOX A;  4QS8 A;  2A1S A;  4QOZ B;  2JLE A;  2Q36 A;  3BGR A;  4RG8 A;  5IWA K;  3O6W A;  2WON A;  4DKW A;  3AGR A;  4YHH K;  4L8R B;  3LP1 A;  2HF3 A;  3U9D A;  4HUF A;  4YDU A;  1NMN A;  3AGK A;  3KLG A;  1U49 A;  2P9N A;  4LF5 K;  1R0A A;  3CPE A;  4G1Q A;  2Q0U A;  1X9J A;  3V1R A;  4E3S A;  1RCH A;  4YNQ A;  3WNE A;  4CHQ A;  1Z6R A;  1WBD A;  1BHL A;  3THW A;  4CGD A;  2KTQ A;  3RR8 A;  2IIR A;  1VQ7 N;  4YDU C;  5C2D A;  3QIN A;  3QIC A;  4Y0W A;  3CXC M;  1TKT A;  1XWL A;  2YX6 A;  3AA4 A;  2G8W A;  4FW1 A;  2BDP A;  3AO1 A;  5BPN A;  4KHW A;  5LJV A;  3P83 D;  4JI1 K;  4ICL A;  2UU9 K;  2CGL A;  5DM6 L;  4O0J A;  4JKA A;  1JLC A;  3DAW A;  3CQ8 A;  3CET A;  2CGK A;  3TAP A;  4EIA A;  4PWD A;  1S6P A;  4FW2 A;  5AZI A;  3ZSZ A;  4E7L A;  4JI8 K;  2G8H A;  2W6L A;  3KVG A;  5C15 A;  2NRR A;  3W3D A;  5LMN K;  4JAX A;  1C0T A;  1SL1 A;  4K0K K;  4IEI A;  5CYM A;  4E1J A;  3SQ0 A;  3CFR A;  4UY8 O;  4WCE L;  4AM7 A;  4E7J A;  3TTF A;  1NGH A;  3MWT A;  3PLA A;  2F8T A;  3A0I X;  3HPG A;  1TUU A;  1KVB A;  3WQU A;  3CCJ N;  4GV3 A;  2JWL A;  3S5T A;  5HRR A;  2IOC A;  4CJV A;  4FPB A;  1T6D A;  3K5O A;  2ZJP L;  1HNV A;  4O0I A;  2A41 A;  5BPL A;  3TAF A;  3VMF B;  3C7N A;  3UE5 A;  4IEE A;  1N36 K;  3DLG A;  5AQY A;  1CZA N;  1NGD A;  4JHD A;  1D9D A;  4LFC K;  2XY7 A;  4QAG A;  3MX2 A;  1Z26 A;  4CK1 A;  3AA3 A;  4KH6 A;  4JYA K;  4AIL C;  1BCO A;  1I39 A;  1RT4 A;  1OH6 A;  3B6O A;  3EEQ A;  3IUC A;  1LAV A;  3PIO L;  5JS2 A;  3ULD A;  3THY A;  3E9O A;  3TSU A;  1NNE A;  1M90 O;  4FVU A;  4W5N A;  2P9I A;  1C6V A;  2A3Z A;  1DGK N;  2HBM A;  3SBT A;  4CZG A;  4H0T B;  4A5B A;  2HVI A;  4F2R A;  5C2F A;  5EXW A;  1YJW N;  4EHT A;  1I94 K;  2DFH A;  3VQ9 A;  3D7E O;  3EY1 A;  4KHQ A;  5AQJ A;  2ASO A;  3THV A;  4PL8 A;  3PUF A;  1FXX A;  4DSI A;  4M41 A;  3LDO A;  3OYM A;  4Z4H A;  3L2R A;  5EVZ A;  1K73 O;  2O8D B;  3AVK A;  4EP4 A;  1K8K A;  3P4I A;  3B8A X;  2P9K B;  3AVH A;  3FFI A;  3ZSO A;  5ADX H;  4DR3 K;  1RTJ A;  2PY5 A;  2RE2 A;  1HPM A;  4OPH A;  3QER A;  3JS6 A;  4BDY A;  2FF3 B;  3DLK A;  1NWK A;  1NKE A;  4BR0 A;  2Y1I A;  4DWI A;  3O9U A;  2YHY A;  3MWP A;  2IAJ A;  5AQW A;  4DV3 K;  2FLO A;  5BRE A;  4DFM A;  5HOO A;  3U8X A;  2ZJR L;  1ZC6 A;  4CJE A;  3AO5 A;  5F1X A;  3DRS A;  3A2F A;  5BRF A;  2RF2 A;  3J81 O;  3MEE A;  4OKK A;  2Q0R A;  1QQC A;  2E2Q A;  4DG1 A;  4FK2 A;  4A61 A;  1CLQ A;  3DLH A;  4HVJ A;  4ID1 A;  4M42 A;  4ELT A;  4JN4 A;  1NOZ A;  4LH4 A;  4KV8 A;  2HBK A;  4DFP A;  1OH7 A;  1YI2 N;  3IKM A;  3HM9 A;  1K8A O;  1KAY A;  4BGB A;  3C94 A;  3LZJ A;  4BRM A;  4KPY A;  4M3W A;  1NGB A;  4BC5 A;  2O8B A;  3U6F A;  3I8B A;  1Y97 A;  4OLB A;  3IMX A;  1WSF A;  3TAG A;  2QI2 A;  4ISF A;  1S5J A;  1Q9Y A;  3K5M A;  1IO2 A;  5BR8 K;  1H1V A;  3RMD A;  4CED A;  3V9U A;  4Y1D A;  4FWL A;  1NKB A;  2BGG A;  5CZ2 A;  1KCF A;  1O13 A;  4BC2 A;  1LOT B;  3PSF A;  1SKS A;  4EHU A;  5T7B A;  2Q31 A;  3VF4 A;  3ZSW A;  4KTQ A;  3LDQ A;  4DQQ A;  1Q8I A;  3QEX A;  1M1K O;  4W5Q A;  2B6A A;  3F73 A;  1T44 A;  3LP0 A;  5AQU A;  4NB4 A;  4HHT A;  2GV9 A;  1YTU A;  2IVP A;  4KHY A;  3E01 A;  1DTQ A;  4BG8 A;  1TYQ B;  3K58 A;  3VTH A;  1NJX A;  4A5A A;  3TAN A;  4O5B A;  4JV5 K;  3BZK A;  3V81 A;  3TTC A;  5FRM A;  2XHB A;  2HHV A;  1SQK A;  1X9W A;  4FWN A;  4CZE A;  4LF6 K;  1YUW A;  3CJC A;  2E20 A;  5DMR A;  2OTL N;  4M3U A;  1QQM A;  2F9W A;  4IJN A;  4F3T A;  2RHK A;  3VTI A;  3U3Y A;  4J2E A;  4BRG A;  1K9M O;  4I9Q A;  5M1F A;  4AHR A;  1N5Y A;  2HNZ A;  2W41 A;  2YNG A;  3QEV A;  1RIL A;  4DV0 K;  5GAG P;  1GLB G;  1GLJ O;  3VQ5 A;  1TGO A;  3FFK B;  3IS9 A;  1UA1 A;  1RBT A;  3VOV A;  4IO8 A;  4KFB A;  4C8M A;  3SMP A;  4CF9 A;  4QCL A;  4DTO A;  3WUH A;  3DLB A;  3CCE N;  3F9M A;  1W97 L;  3VQB A;  4MO4 A;  4FYD A;  4CHP A;  4UQG A;  3NVK A;  3VEV A;  2XRI A;  5M1Q A;  4IG0 A;  4CJP A;  3C0B A;  3CCL N;  2Z1I A;  5AQN A;  4BRL A;  3OY9 A;  3T69 A;  3MAQ A;  2HMP A;  3CQY A;  3K5L A;  3S3M A;  1C1B A;  4B1V A;  4F9O A;  3D2E B;  1ATS A;  3DM2 A;  2YCH A;  4CK2 A;  3MEG A;  3G0Z A;  1BCM A;  3DXK B;  1XNR K;  3HST B;  2P9S A;  2WC9 A;  5GAH P;  1GLD G;  1RTH A;  4LH5 A;  3TR8 A;  3E9L A;  3LDL A;  1U04 A;  3ZT1 A;  2VQF K;  2QXL A;  5AFU A;  2PYJ A;  3VQ6 A;  1BIU A;  2YHX A;  3ZSX A;  3SI6 A;  1NKC A;  2OPS A;  5HL7 L;  1MDU B;  1B9D A;  4ELV A;  4DTS A;  2O4I A;  4KRE A;  5HRN A;  1A5W A;  5B8H A;  1BWF O;  1DKG D;  1HYV A;  3DXK A;  5JVH L;  1NLV A;  3HPO A;  2ZD1 A;  3CCV N;  4V19 S;  3M5R A;  3L0Q A;  5KQD A;  1WLJ A;  4O8K A;  1L5U A;  1ATR A;  3QFU A;  4KHP K;  1XI1 A;  4BRI A;  2HHH K;  3NBP A;  3SBG A;  4DQ8 A;  3KK1 A;  1RGI A;  4B8A B;  4J2D A;  1HNX K;  2DTU A;  1YTA A;  3F9K A;  3QNO A;  1GLA G;  1XQS C;  3ZET B;  2HOE A;  3HM8 A;  2OAN A;  2BUP A;  1LV5 A;  3KLF A;  2NRT A;  1HJO A;  1VQN N;  3HI0 A;  1X3M A;  4OGC A;  4BG9 A;  1NGI A;  1U47 A;  1EP4 A;  1QZ6 A;  3MMV A;  1RDW X;  4IBN A;  4XH4 A;  1NMD A;  5HRP A;  1WSG A;  4DSJ A;  4I2P A;  4JKF A;  4DTX A;  3KD1 E;  3CF5 L;  4CJW A;  3KLH A;  2O8F B;  3ZLJ A;  3T1H K;  1JCG A;  4K8X A;  1T6C A;  1RDA A;  4CHN A;  2YHB A;  1HYS A;  2QWQ A;  1TK5 A;  3SAH A;  3ZSV A;  2P9P B;  3OHR A;  4FM0 A;  4EFH A;  2OPR A;  2NRX A;  1WAJ A;  3PIP L;  4PUO A;  3M8Q A;  1NBW A;  3R8E A;  2GBZ A;  2UUB K;  5J2M A;  4CJT A;  4YOU A;  4BRF A;  4O44 A;  1ZBF A;  5M1K A;  5M1N A;  4K25 A;  3IFR A;  4CZF A;  3PSI A;  4BRK A;  2F4V K;  3G10 A;  2RKI A;  5H1S Q;  1ZYQ A;  1O1W A;  1GLL O;  3NDK A;  4IJA A;  1QSS A;  1DT9 A;  1IKV A;  3AVG A;  2P9P A;  1LWE A;  1RDU A;  3ZEU A;  5AQM A;  3VQC A;  3CQX A;  2O8E A;  4GKK K;  3O1W A;  1BI4 A;  3TAQ A;  4OJR A;  5C10 A;  4FZX C;  4HWI A;  4DTM A;  3HO1 A;  2E6M A;  1WSI A;  4M3T A;  3ID8 A;  3A5M C;  4DR2 K;  3M8R A;  5AFU H;  3KD5 E;  4NYF A;  5MLC Q;  3ZCM A;  2H3G X;  4DCH A;  2X6S A;  3RVC A;  4K8Z A;  3HVT A;  4KTW A;  5M1O A;  2BAN A;  4DHY A;  3WT0 A;  2I7P A;  4B1U B;  4OPK A;  3O3F A;  1XUP O;  4FWM A;  5F2R A;  3GDQ A;  3V9Z A;  3P38 A;  4AQY K;  3NH2 A;  2P5G A;  4JNE A;  3TSP A;  1LWC A;  3TAB A;  4DQI A;  1SUQ A;  2VWB A;  1Z05 A;  3WEE B;  1VSM A;  1IH7 A;  2G8U A;  1KXP A;  3PO4 A;  3RMB A;  4B9V A;  3ATU A;  3BP8 A;  4F3O A;  3OYL A;  4B1X B;  4CF2 A;  4BE1 A;  5AQK A;  4BE7 B;  1JXE A;  2A6A A;  2R7Y A;  2B4J A;  3L2V A;  3VEW A;  4C23 A;  3NE6 A;  4CW7 B;  4H5T A;  1I3A A;  3HPH A;  4FJ9 A;  1REV A;  5AQV A;  4ELU A;  3VQ7 A;  4B08 A;  4I7F A;  4EAH D;  3OYN A;  3WNG A;  4CES A;  4RW6 A;  1T03 A;  3OTO K;  3I56 N;  4OVL A;  3CCS N;  1EXQ A;  1VSJ A;  3NH0 A;  4ILG B;  4E7I A;  3D2F A;  1QQO A;  4O4G A;  3SUN A;  3RSE B;  1HJR A;  4IWV A;  1HNI A;  3QB0 A;  5CZ1 A;  2DPN A;  4NXM K;  5M1P A;  3WXI A;  4CIF A;  1UWB A;  4YOY A;  1S22 A;  1NK7 A;  4DB3 A;  2EHG A;  1KLN A;  1NG9 A;  1ZXO A;  3VQP A;  4OGE A;  1NGG A;  1IKX A;  1HR0 K;  2A1R A;  2OCE A;  4BR2 A;  3AA5 X;  4B9L A;  3DLL L;  1VQ6 N;  2DFF A;  5TKY A;  3AVJ A;  4XH1 A;  2BE2 A;  3AVC A;  1QE1 A;  1VSL A;  3DLE A;  3SZ2 A;  3CCQ N;  4CHY A;  2P1J A;  2KHO A;  4CZJ A;  1S1V A;  3RWU A;  1QSL A;  5ADX A;  3AAQ A;  4JKH A;  1U48 A;  1N32 K;  3SUQ A;  3QIO A;  3ULE B;  3EZ5 A;  1RDC A;  4AHS A;  3EE8 A;  1NK5 A;  2NRW A;  4JI2 K;  4IXC A;  5AQR A;  4CJR A;  1VQ5 N;  4DU4 A;  3UKU B;  4BRE A;  5KI6 A;  4WF9 L;  2HHQ A;  4ZHR A;  1NK6 A;  4CEO A;  1C1A A;  4AH9 A;  1KLM A;  4CK3 A;  4FK0 A;  2NNW A;  5AQF A;  1JCE A;  1VHX A;  1KTQ A;  1Y64 A;  2Z1H A;  1OVQ A;  4C8O A;  3EZW A;  2KZM A;  3S9H A;  3M1F A;  4FLX A;  2C1I A;  1WAF A;  3KWI A;  3THX B;  1TK0 A;  4IFY A;  3O80 A;  1GLE G;  1JCF A;  4F4K A;  1XHZ A;  4YFU A;  1W9H A;  2P9L B;  4QS9 A;  3UKU A;  5BPM A;  4LFA K;  4FL9 A;  4GY2 B;  4ISE A;  1HKB A;  4OPJ A;  3RRH A;  5FRN A;  4A2B A;  3VF6 A;  4DSK A;  3LL3 A;  4FJH A;  4Z94 A;  2HNY A;  3H08 A;  3CMA N;  5AQG A;  5BRD A;  4M7X A;  3WXK A;  5EY4 A;  4HTU A;  3K2P A;  3OVN A;  1VQM N;  2QWM A;  1VSE A;  4CJ7 A;  1V4S A;  1RT1 A;  5D3G A;  2HHX A;  4DF4 A;  3IAY A;  3I33 A;  1EWR A;  1ZBL A;  2HHI A;  1C0U A;  4CHO A;  3AO2 A;  3VEZ A;  4A62 A;  1YXQ A;  4OLA A;  3TSQ A;  4Z4G A;  3O5B A;  4JK9 A;  3OW2 M;  1IV0 A;  3OYJ A;  4IG3 A;  3FR0 A;  4FJK A;  1HYZ A;  2KQ2 A;  3CIP A;  4DR4 K;  1RBV A;  4H5N A;  4B9N A;  1OVY A;  1EWQ A;  4X64 K;  3V9X A;  3VGK A;  2GWK A;  3HYF A;  4A57 A;  3VQD A;  3RMC A;  4FWK A;  4IDH A;  4CD3 A;  4JKC A;  4CCH A;  3H6E A;  1S6Q A;  1VQO N;  4JS5 A;  3T19 A;  5GIO A;  1TV6 A;  4PKG A;  1NK9 A;  3QEP A;  2QWP A;  4R79 A;  3ZSY A;  2YKM A;  3NCI A;  3MK6 A;  2EX3 A;  1WBB A;  4U67 L;  2W40 A;  3VA0 A;  3K9J A;  1HQU A;  1ZBI A;  2YNI A;  3ATV A;  3PY8 A;  3MDQ A;  3EKS A;  4H5R A;  4K43 A;  3ZT0 A;  1HUX A;  1QZ5 A;  1NK4 A;  5AR0 A;  4RTF D;  4AHC A;  2I7N A;  3FZM A;  5JIC A;  4CEA A;  4K42 A;  3F2K A;  3M8P A;  3L8B A;  4DS4 A;  4OPA A;  2NRH A;  1NGJ A;  4ISG A;  2FC0 A;  4JRQ A;  4M3R A;  2QK9 A;  1J6Z A;  2G8I A;  3TAE A;  4KAZ A;  2D5R A;  3DXM B;  3SJJ A;  1S72 N;  4Q0B A;  3CCR N;  4JEP A;  1SAZ A;  2J4R A;  3O9R A;  2O8D A;  5KRT A;  1NGA A;  2P9K A;  3QIP A;  4FJJ A;  1C0G A;  4CEF A;  3DRR A;  4B9T A;  3QO9 A;  3MCA B;  5C25 A;  3D45 A;  4TSX A;  4J2B A;  4E89 A;  5SZT A;  4B1W B;  1YT3 A;  5AZJ B;  4CEZ A;  3CFP A;  2FBT A;  4CFC A;  1SV5 A;  2W6K A;  1JLB A;  4BC4 A;  3DXM A;  3OYI A;  4DTR A;  4FWP A;  4O5F A;  3MX5 A;  2CH6 A;  4LY7 A;  3GE1 A;  4KO0 A;  4FWR A;  1QHA A;  1J5O A;  3ZSQ A;  1E4F T;  2E4L A;  3SPZ A;  1Q81 O;  3CJ7 A;  3J7Z O;  1ILY A;  1JKH A;  4JI4 K;  4FOI A;  4BRA A;  3BUZ B;  4GW6 A;  4BAC A;  2Z1G A;  2A40 A;  2FSN A;  4JLH A;  3SQ1 A;  5JMV A;  5KPT A;  3JYT A;  1ZBH A;  4EZ6 A;  4B1Z A;  4RWT A;  5BN9 A;  3NH1 A;  3V6D A;  3ZT3 A;  4Z0U A;  5KGX A;  4B3T K;  2QKK A;  4W5O A;  1J53 A;  4X62 K;  2HHS A;  1RT5 A;  4CI6 A;  2HB5 A;  2NRV A;  3L4Q A;  1XC9 A;  3V9W A;  3HVR A;  3FZF A;  4AHT A;  3L6Q A;  3KZB A;  4E72 A;  4Z4E A;  5KQ8 A;  4GV6 A;  4B9M A;  3OYC A;  1VSI A;  3M8S A;  4LF7 K;  2OZM A;  1VSK A;  2G8V A;  3HTV A;  1U2V B;  4DF8 A;  4NCB A;  3S3O A;  4PKH A;  1IJJ A;  4IO9 L;  4WQ5 A;  5AQL A;  3SUO A;  4DLE A;  3V4I A;  4C1N I;  3CFO A;  2P51 A;  1C0F A;  2YNF A;  4LF4 K;  1RNH A;  1WNS A;  3VQE A;  4F2S A;  4DQP A;  3NGY A;  4BE0 A;  2PYL A;  1TYQ A;  3KWG A;  3FLC O;  1LW2 A;  5FDL A;  2W42 A;  2O8C B;  3KIO A;  3O9Q A;  5C0Y A;  1WUA A;  3O3H A;  4BY9 C;  5HBM A;  4WQ5 C;  3ZYY X;  2HMI A;  1QSY A;  1BA0 A;  3CJB A;  4IFV A;  2IDO A;  4O8U A;  3S3N A;  4KRF A;  3EN9 A;  4CD1 A;  1TAU A;  2BH1 A;  1EKE A;  4ILH A;  3BF3 A;  4DR6 K;  4RW7 A;  1X9S A;  4CHZ A;  4JK8 A;  4BRN A;  3LPU A;  1NJW A;  4FXD A;  4BRP A;  3V9S A;  2BTF A;  2A42 A;  1SKR A;  2ZGZ A;  5AQX A;  4DLG A;  3P39 A;  4FLW A;  1L3S A;  1NK0 A;  2D4W A;  3OJS A;  1HKC A;  4FOE A;  1Z25 A;  3CHW A;  1VRT A;  1V4T A;  3C6U A;  3AVF A;  3LP2 A;  2IVN A;  1VAZ A;  4BR4 A;  2UUC K;  2ZQB A;  4GMJ B;  2AP1 A;  1ESV A;  4CF8 A;  1CZ9 A;  1R59 O;  3RMA A;  2GUI A;  3JXU A;  4M63 C;  2FBV A;  4K41 A;  5FRO A;  5HRS A;  4JK7 A;  2QWR A;  1WB9 A;  3G6E N;  3HT3 A;  3D2E A;  3FGU A;  3TTD A;  4JKD A;  2YJF A;  4E19 A;  3DOL A;  4CJ3 A;  3VGL A;  1JLF A;  3R9P A;  5TKW A;  2HST A;  4DSL A;  3WXM B;  1EX4 A;  1Q82 O;  3RTV A;  2P5O A;  2GX9 A;  4B9U A;  1XC3 A;  2E1Z A;  4BR5 A;  3L3V A;  3KLE A;  1NM1 A;  4U7B A;  4JKG B;  1Q18 A;  4E7H A;  3DOK A;  2ITG A;  4DV5 K;  4NCA A;  4B1Y B;  1VSD A;  1KAZ A;  4RCH A;  3ZX0 A;  3UB5 A;  1VQP N;  1BG3 A;  5AQZ A;  4JKE A;  1FKO A;  3ZT4 A;  2VCP A;  3A5L C;  3VQA A;  1WN7 A;  4M3Z A;  4NLC A;  1FW6 A;  1VQK N;  2ZJQ L;  1U6Z A;  3DJC A;  4JKG A;  1XHX A;  2VGM A;  3H1V X;  1ITG A;  4BQZ A;  4ID5 A;  3SNN A;  3L4I A;  4LD0 A;  5JLF A;  1YVU A;  1ATN A;  3ZET A;  3KK3 A;  3CCU N;  2D0B A;  5JVG L;  4JI7 K;  1E3M A;  1NK8 A;  3R1X A;  3E1Y A;  3O1B A;  4WFA L;  4PL7 A;  3VES A;  2FBY A;  2IC3 A;  1VRU A;  4PY5 A;  3SV4 A;  3ASM A;  1RBS A;  1NJZ A;  3CC4 N;  3LWM A;  5JEN A;  1HQE A;  3HOT A;  4LC9 B;  4FJM A;  4FCY A;  3SYZ A;  5A2Q O;  1KRP A;  2O4G A;  3NHG A;  2O8F A;  4WFN L;  4OKJ A;  4GKJ K;  1RDB A;  3CC2 N;  1IBM K;  5AQS A;  1QQN A;  3Q7B A;  1SL0 A;  1B92 A;  1G99 A;  2HVH A;  2HHU A;  1FKP A;  1C0M A;  1CXQ A;  5LY3 A;  2D0O A;  4FJ8 A;  4Z4C A;  4BRD A;  2IVO A;  5GIN A;  1Q7Y O;  1D8Y A;  4W5R A;  5BN8 A;  1U45 A;  5HRO A;  2E2N A;  3QET A;  3ZX3 A;  4HTL A;  3MN6 A;  3MN7 A;  3WQT A;  3IDH A;  3HJF A;  1BQN A;  2QKB A;  3HP6 A;  4HUG A;  1BQM A;  3TU5 A;  3EYZ A;  4DV2 K;  3GL1 A;  4DQR A;  4ZTF A;  2VG7 A;  3LAM A;  1YJ9 N;  4CFA A;  4I9L A;  4NO7 A;  4CZH A;  2YKN A;  2YV0 X;  5I9E B;  4DTP A;  1T8E A;  1IBK K;  4H0V B;  3CD6 N;  3VQQ A;  1YAG A;  3DMJ A;  1NJY A;  1TKD A;  4J2A A;  3WXL A;  4DSF A;  3NFA A;  3CJA A;  4KBO A;  4DQS A;  4CGH A;  3QLH A;  4JI3 K;  1N34 K;  3A5N C;  4CFD A;  4F8R A;  4I6M B;  2B5J A;  4NLB A;  3TI0 A;  3BY5 A;  1NGF A;  4BDP A;  3TWH A;  1HLU A;  2E6L A;  2QXF A;  1VQ4 N;  4H03 B;  3CI5 A;  2A5X A;  4CEB A;  2OZS A;  1RFQ A;  4MO5 A;  2V7Z A;  3CG7 A;  5AQT A;  5KPR A;  3HSC A;  3MXI A;  3WEE A;  4KTZ A;  1NGE A;  4BDZ A;  2E2O A;  2F8S A;  4G9Z A;  3HOS A;  4MQ3 A;  2UXB K;  1SS6 A;  4IOC L;  5C12 A;  2D1K A;  3HRG A;  4RW8 A;  4JD2 B;  3MXM A;  4QS7 A;  4FPA A;  1RT7 A;  3SAG A;  3M6G A;  4JS4 A;  4DR1 K;  3I0S A;  3ISN C;  1XNQ K;  5JS1 A;  3BEX A;  1WSE A;  5GAE P;  4DV4 K;  3VA3 A;  1K6Y A;  1MWK A;  3OYB A;  4IFE A;  3KTQ A;  3L2U A;  1FJG K;  2ATQ A;  3F5T A;  4XEI A;  4XIU A;  4BWJ A;  4BVP A;  4MDA A;  3O3G A;  2DFE A;  3H46 O;  1P8Z A;  3C6A A;  4CZM A;  3K5N A;  1S9E A;  1RT2 A;  4OX9 K;  3HK2 A;  3A5O C;  4H0O A;  2ZGY A;  3RSE A;  4BC3 A;  2NLX A;  3H45 C;  3JAM O;  3SV3 A;  4N41 A;  4YOW A;  4BRC A;  2P9N B;  4B3S K;  1L3T A;  2Y1J A;  4X65 K;  2Q2R A;  5DK5 A;  3PX0 A;  4FWS A;  3D0P A;  3T3F A;  4M45 A;  4H4M A;  2LSN A;  2PFU A; 
#chains in the Genus database with same CATH homology
 1QZ5 A;  2FSJ A;  4JKB A;  5M1Q A;  2GEL A;  3C0B A;  3CCL N;  5AR0 A;  3C65 A;  2PBD A;  5AQN A;  3EO3 A;  4RTF D;  4BRL A;  4WFB L;  3T69 A;  2E2P A;  2I7N A;  5E84 A;  3FZM A;  4PKI A;  2HMP A;  3CQY A;  5JIC A;  1QVG M;  2GUP A;  4K42 A;  3F2K A;  2Q97 A;  4B1V A;  3GOI A;  4OPA A;  2NRH A;  1NGJ A;  4ISG A;  4MLE A;  2E1Y A;  3D2E B;  3VGM A;  1ATS A;  4CZL A;  4F9O A;  3G4S N;  1J6Z A;  3LDP A;  2YCH A;  3DXM B;  2KLA A;  1S72 N;  3VEY A;  3DXK B;  2FF6 A;  3CCR N;  4JEP A;  3VPZ A;  1SAZ A;  3SMS A;  2J4R A;  3CC7 N;  3O9R A;  5AZI B;  2P9S A;  2GWJ A;  1EO1 A;  4CZI A;  2WC9 A;  1NGA A;  5BR9 A;  5GAH P;  1GLD G;  3ULE A;  2P9K A;  3R6M A;  4CBX A;  3QBW A;  3E9L A;  3LDL A;  5ELZ A;  1C0G A;  5EX5 A;  2QXL A;  5AFU A;  1VQ9 N;  1MWM A;  3LDN A;  3MCA B;  3O9T A;  5AQP A;  3EL2 A;  2VYP A;  4B1W B;  2YHX A;  2UYT A;  2GEM A;  4L3Q A;  5AZJ B;  3T7Z A;  3ENH A;  4XJX A;  5HL7 L;  1MDU B;  3C6H A;  1YVN A;  3UKR B;  4BC4 A;  4H0Y B;  1YHQ N;  3DXM A;  4FWP A;  2WUS A;  4O5F A;  5JLH A;  3MX5 A;  2CH6 A;  5B8H A;  1BWF O;  1DKG D;  3DXK A;  3GE1 A;  3LM2 A;  5JVH L;  1NLV A;  4FWQ A;  4FWR A;  5F0X A;  1QHA A;  2ASP A;  2ITM A;  1YJN N;  3CCV N;  4XH5 A;  3M5R A;  1GLC G;  3L0Q A;  5KQD A;  1E4F T;  2ZF5 O;  4O8K A;  1ATR A;  3QFP A;  3MN9 A;  3QFU A;  1Q81 O;  1TUY A;  3CJ7 A;  3J7Z O;  3C7N B;  1ILY A;  4FOI A;  4YOV A;  2YI1 A;  3BUZ B;  4BRA A;  5CE3 A;  4BRI A;  3J8A A;  4AF1 A;  2A40 A;  2HBL A;  2FSN A;  4H0X B;  3SBG A;  4DQ8 A;  2P9L A;  1RGI A;  4FWO A;  2GTD A;  4JHD B;  5JMV A;  5KPT A;  5CHI A;  2ASM A;  5KPZ A;  2V51 B;  5BRH A;  3D2F B;  1JJ2 M;  4B1Z A;  4RWT A;  3AAP A;  3QBX A;  5BN9 A;  5EOY A;  3UKR A;  4J8F A;  1GLA G;  3VEN A;  1XQS C;  2CGJ A;  2HOE A;  3EKU A;  3HM8 A;  4I6M A;  3ZET B;  3E66 A;  1D4X A;  2OAN A;  2BUP A;  4CI6 A;  1KD1 O;  2NRV A;  3L4Q A;  1YIT N;  2NRT A;  1HJO A;  1VQN N;  3HI0 A;  1X3M A;  4BG9 A;  2P9I B;  1NGI A;  3FZF A;  3U9Z A;  1QZ6 A;  3MMV A;  3OBW A;  3L6Q A;  3KZB A;  1RDW X;  3FE1 A;  4XH4 A;  1NMD A;  5KQ8 A;  4GV6 A;  4JKF A;  3CJ9 A;  5CR4 A;  3CF5 L;  3HTV A;  1U2V B;  3MCP A;  2WBN A;  1P90 A;  3SJH A;  4PKH A;  1IJJ A;  4IO9 L;  4OO1 J;  3OBY A;  3H3O B;  4WQ5 A;  5AQL A;  4WQ4 A;  1KQS M;  4C1N I;  1JCG A;  4BR7 A;  1C0F A;  1T6C A;  4CBU A;  4BR9 A;  4BEB A;  4GNI A;  2QWQ A;  4MLH A;  3SAH A;  2CH5 A;  1TYQ A;  3KWG A;  3FLC O;  2P9P B;  1K8K B;  3OHR A;  4EFH A;  1N8R O;  3O9Q A;  1BU6 O;  2NRX A;  3O08 A;  3VER A;  3PIP L;  5C0Y A;  2D0P A;  1WUA A;  4JD2 A;  1NBW A;  3R8E A;  4M7Y A;  3QDK A;  4YOR A;  4BY9 C;  4WQ5 C;  3ZYY X;  4WQ4 C;  1BA0 A;  3CJB A;  4O8U A;  4YOU A;  5GIP A;  3EN9 A;  4CD1 A;  2BH1 A;  4BRF A;  1KAX A;  4ILH A;  5M1K A;  5M1N A;  3BF3 A;  3O8M A;  4K25 A;  3IFR A;  4CZF A;  4BRK A;  4JK8 A;  4BRN A;  1LCU A;  4H5W A;  4IOX A;  4QS8 A;  2Q36 A;  4BRP A;  2BTF A;  3O6W A;  2A42 A;  4DKW A;  5H1S Q;  3AGR A;  3ENO A;  2NRZ A;  3CER A;  2HF3 A;  5E26 A;  1GLL O;  2ZGZ A;  5AQX A;  1SZ2 A;  4IJA A;  3U9D A;  1DT9 A;  1VQL N;  3P39 A;  4YDU A;  4BRH A;  1BDG A;  2D4W A;  2P9P A;  3AGK A;  1RDU A;  3CJ1 A;  1HKC A;  4FOE A;  5AQM A;  3CHW A;  3ZEU A;  1V4T A;  3CQX A;  2P9N A;  2IVN A;  3O1W A;  3ENB A;  3CPE A;  1VAZ A;  2F7T A;  2V52 B;  5C10 A;  2Q0U A;  4HWI A;  1X9J A;  4BR4 A;  1HX1 A;  3N4P A;  3FZH A;  2AP1 A;  1Z6R A;  1ESV A;  3LM9 A;  1R59 O;  3ID8 A;  3JXU A;  2IIR A;  3A5M C;  4M63 C;  5AFU H;  1VQ7 N;  4YDU C;  3VEO A;  4PHT X;  5C2D A;  4K41 A;  5MLC Q;  3QIC A;  4Y0W A;  3CXC M;  2H3G X;  2YX6 A;  3CME N;  4DCH A;  4JK7 A;  2QWR A;  3G6E N;  5BPN A;  3D2E A;  3RVC A;  4MDB A;  3FGU A;  5LJV A;  3TTD A;  5AQH A;  4JKD A;  5M1O A;  4KH5 A;  2CGL A;  2YJF A;  4DHY A;  5DM6 L;  3WT0 A;  2I7P A;  4B1U B;  1BUP A;  3M3Z A;  4JKA A;  3P31 A;  3E9P A;  1XUP O;  3DAW A;  3VGL A;  3CET A;  3R9P A;  1WOQ A;  2CGK A;  4FWM A;  5F2R A;  5TKW A;  4AM6 A;  4EIA A;  3ID6 A;  5AZI A;  4BGA A;  2HST A;  3OA9 A;  3GDQ A;  1GLF O;  4YOX A;  5FPN A;  2F9T A;  3WXM B;  3P38 A;  3CPW M;  1YIJ N;  4IOA L;  3KVG A;  1Q82 O;  4JNE A;  3TSP A;  1E4G T;  2NRR A;  5C15 A;  3AY9 A;  3W3D A;  2GX9 A;  1XC3 A;  2E1Z A;  4JAX A;  4IEI A;  2VWB A;  4E1J A;  4BR5 A;  1Z05 A;  3WEE B;  2FXU A;  4UY8 O;  1NM1 A;  4WCE L;  3KK7 A;  1KXP A;  4U7B A;  4JKG B;  4AM7 A;  5AZJ A;  3TTF A;  1NGH A;  3MWT A;  3PLA A;  1Q18 A;  3ATU A;  3BP8 A;  3A0I X;  4B1X B;  5FPE A;  1TUU A;  5AQK A;  4B1Y B;  3WQU A;  4GV3 A;  3CCJ N;  2JWL A;  4BE7 B;  1ZBS A;  2A6A A;  3BF1 A;  1KAZ A;  4RCH A;  3ZX0 A;  3UB5 A;  4FPB A;  1BG3 A;  5AQZ A;  3VEW A;  3ZX2 A;  1VQP N;  4JKE A;  1T6D A;  4C23 A;  2ZJP L;  4H5T A;  2V7Y A;  2VCP A;  2OTJ N;  2WFB A;  3A5L C;  5AQV A;  3DWL A;  5AQQ A;  3MN5 A;  2A41 A;  3QML A;  4BVO A;  4EAH D;  5BPL A;  3VMF B;  3C7N A;  4NLC A;  3UE5 A;  1VQK N;  2ZWH A;  3O9S A;  4IEE A;  2ZJQ L;  3I56 N;  5AQY A;  1CZA N;  1NGD A;  2C1G A;  1EQY A;  1U6Z A;  4JHD A;  3CCS N;  3DJC A;  4JKG A;  3VET A;  2VGM A;  3H1V X;  3MX2 A;  4ILG B;  2HF4 A;  3D2F A;  5DM7 L;  4BQZ A;  3GBT A;  1QQO A;  4KH6 A;  3RSE B;  4IWV A;  3L4I A;  3QB0 A;  2DPN A;  3HZ6 A;  5JLF A;  1MA9 B;  3H1Q A;  5M1P A;  3WXI A;  1ATN A;  3ZET A;  1HKG A;  3CCU N;  5JVG L;  3G71 N;  5FPM A;  3IUC A;  3R1X A;  4YOY A;  1S22 A;  3E1Y A;  1BO5 O;  3PIO L;  3O1B A;  4DB3 A;  4WFA L;  4PL7 A;  1BA1 A;  3VES A;  3E9O A;  3TSU A;  1M90 O;  4FVU A;  1ZXO A;  2P9I A;  2A3Z A;  3CC4 N;  1DGK N;  2HBM A;  1NGG A;  3SBT A;  4BR2 A;  1W2B M;  1Q86 O;  5FPD A;  3HOT A;  4LC9 B;  4CZG A;  1U2V A;  3DLL L;  4H0T B;  4A5B A;  2FSK A;  1VQ6 N;  5C2F A;  5TKY A;  5EXW A;  1YJW N;  4XH1 A;  4EHT A;  3D7E O;  3CCQ N;  4WFN L;  5AQJ A;  2ASO A;  4H5V A;  2KHO A;  4PL8 A;  4CZJ A;  3CC2 N;  2E8A A;  3A8Y A;  3WXJ A;  5AQS A;  3LDO A;  3O4W A;  1QQN A;  5EVZ A;  2P9S B;  3Q7B A;  1G99 A;  3AAQ A;  5ADX A;  1K73 O;  4JKH A;  3W0L A;  3AAR A;  1K8K A;  3P4I A;  3B8A X;  2P9K B;  3ULE B;  5AQI A;  5ADX H;  3KHY A;  1VQ8 N;  2RE2 A;  1HPM A;  2D0O A;  3EE8 A;  3JS6 A;  4OPH A;  2FF3 B;  5LY3 A;  2NRW A;  3I55 N;  1NWK A;  4IXC A;  5AQR A;  4BRD A;  2IVO A;  5GIN A;  1Q7Y O;  2YJE A;  3K9K A;  4BR0 A;  1VQ5 N;  2W00 A;  5BN8 A;  3O9U A;  4WYB A;  2YHY A;  3MWP A;  5AQW A;  2E2N A;  3UKU B;  4BRE A;  2FLO A;  4CBW A;  3ZX3 A;  3TPQ A;  5LJW A;  5GAD P;  5BRE A;  4WF9 L;  5HOO A;  3U8X A;  4BRO A;  2ZJR L;  2NZT A;  1ZC6 A;  4HTL A;  3CCM N;  3MN6 A;  5F1X A;  1YF5 L;  3MN7 A;  2NNW A;  5AQF A;  3WQT A;  1JCE A;  1NJI O;  3IDH A;  3Q7C A;  5BRF A;  1Y64 A;  4FO0 A;  2PAV A;  3EZW A;  2E88 A;  3TU5 A;  3D6R A;  3R3L A;  3M1F A;  2Q0R A;  3GL1 A;  3H3N O;  2E2Q A;  3NVM A;  2C1I A;  4ILJ A;  4A61 A;  3VEX A;  3KWI A;  1YJ9 N;  4NO7 A;  3O80 A;  4CZH A;  4JN4 A;  1GLE G;  5I9E B;  2HBK A;  1JCF A;  3HBT A;  4H0V B;  1YI2 N;  2P9L B;  3CD6 N;  4QS9 A;  2Q1N A;  1YAG A;  3SLC A;  3UKU A;  3IKM A;  5BPM A;  3WXL A;  1K8A O;  3NMU A;  1KAY A;  4FL9 A;  4GVE A;  3CJA A;  4GY2 B;  4ISE A;  4BGB A;  4KBO A;  1HKB A;  4BRM A;  2AA4 A;  4A2B A;  2QA4 N;  3A5N C;  3VF6 A;  3LL3 A;  1NGB A;  4BC5 A;  4Z94 A;  2VGN A;  3FZL A;  3I8B A;  3GG4 A;  3CMA N;  4I6M B;  1KC8 O;  3IMX A;  5AQG A;  2P9U B;  4M7X A;  5BRD A;  2QTD A;  2QI2 A;  3WXK A;  5EY4 A;  3SK3 A;  4NLB A;  4ISF A;  1VQM N;  1H1V A;  1NGF A;  2QWM A;  1HLU A;  4FWL A;  4CJ7 A;  1BOT O;  1O13 A;  3G25 A;  4BC2 A;  1V4S A;  1LOT B;  4BQL A;  1VQ4 N;  4H03 B;  4GV9 A;  3CI5 A;  4EHU A;  4BEC A;  2Q31 A;  2A5X A;  2QWO A;  3I33 A;  3VF4 A;  1DEJ A;  1RFQ A;  1OKJ A;  4MO5 A;  2V7Z A;  3LDQ A;  3N4Q A;  1IG8 A;  5AQT A;  1M1K O;  3S41 A;  1T44 A;  4BRQ A;  4IZ9 A;  5AQU A;  1YXQ A;  3HSC A;  4NB4 A;  3VEZ A;  3WEE A;  4A62 A;  3TSQ A;  5KPR A;  3O5B A;  4JK9 A;  4CZK A;  1NGE A;  3OW2 M;  2E2O A;  2QEX N;  2P9U A;  3FR0 A;  2IVP A;  4G9Z A;  3HOS A;  4BG8 A;  1TYQ B;  1SS6 A;  4IOC L;  3VTH A;  2HBJ A;  5C12 A;  2D1K A;  3HRG A;  3CIP A;  4A5A A;  3EE9 A;  4JD2 B;  4QS7 A;  4FPA A;  1NGC A;  2QM1 A;  3TTC A;  1X3N A;  4FSV A;  3M6G A;  4H5N A;  3SAG A;  4YOT A;  4H0P A;  1SQK A;  2JWK A;  4FWN A;  4CZE A;  3BEX A;  1OVY A;  1YUW A;  2E20 A;  3CJC A;  5GAE P;  2OTL N;  1QVF M;  1MWK A;  2YHW A;  3FZK A;  2QWN A;  3VGK A;  1QQM A;  2F9W A;  4IFE A;  2GWK A;  4IJN A;  2RHK A;  3VTI A;  4A57 A;  1S3X A;  3F5T A;  4XEI A;  4BRG A;  4FWK A;  4C1N K;  1K9M O;  4IDH A;  4CD3 A;  4JKC A;  4BVP A;  5M1F A;  4MDA A;  2W41 A;  2QWL A;  2QW9 A;  3H46 O;  1P8Z A;  3C6A A;  3H6E A;  4A59 A;  4CZM A;  5GAG P;  1GLB G;  1GLJ O;  1VQO N;  5GIO A;  3FFK B;  4PKG A;  4A2A A;  3A5O C;  3VOV A;  4IO8 A;  4H0O A;  2ZGY A;  3RSE A;  4B9Q A;  4BC3 A;  2QWP A;  1T3V A;  4R79 A;  3ZEU B;  2NLX A;  3H45 C;  3SMP A;  4KH4 A;  5AQO A;  4YOW A;  4BRC A;  2P9N B;  3MK6 A;  3WUH A;  3SAF A;  4U67 L;  2W40 A;  2Q2R A;  2KKZ A;  3CCE N;  2EWS A;  3F9M A;  3K9J A;  1W97 L;  3U4L A;  4MO4 A;  3VF2 A;  3ATV A;  4FWS A;  3MDQ A;  3NVK A;  3EKS A;  3VEV A;  4H5R A;  4K43 A;  2PFU A;  1HUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...