3UKUB

Structure of arp2/3 complex with bound inhibitor ck-869
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
195
structure length
195
Chain Sequence
GVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Arp2/3 complex with bound inhibitor CK-869
rcsb
molecule tags Structural protein
molecule keywords ACTIN-LIKE PROTEIN 3
total genus 46
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ukuB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3ukuB02
2Q97A 3VF4A 3M1FA 1T6CA 3HTVA 5AQJA 4EAHD 3MCPA 4H5WA 5ADXH 3AAPA 5LY3A 3O80A 3O5BA 1QZ5A 5AQUA 2E20A 1ZXOA 5AQNA 3GDQA 2KHOA 4PKIA 3GE1A 4WQ5A 3D7EO 5EOYA 3VEZA 4CZIA 3JXUA 3JS6A 2AA4A 3MN6A 4XH4A 1SAZA 4BROA 4CI6A 4BR2A 3VEVA 3WXJA 2YHXA 3VETA 3DXMA 3D2FA 5JMVA 5LJVA 1EQYA 4PKGA 5EXWA 3DAWA 4IWVA 4CD1A 4K43A 3H46O 3VEYA 4NO7A 2F9WA 1GLCG 3U8XA 3W0LA 4IJNA 2DPNA 3O8MA 5AQQA 2IIRA 3A5NC 3FGUA 2Q0RA 3ULEA 1MWMA 1NGBA 2F9TA 4H0TB 4AM7A 4CZKA 3WEEA 3ZX2A 5E26A 2QWNA 4I6MA 3H1QA 1S3XA 5EX5A 5AZJB 5BPMA 2GTDA 4A61A 4K25A 1NGAA 3WEEB 3TU5A 2CH5A 1ATRA 3ATVA 4BRQA 1QQNA 4ISGA 4JHDA 4H5RA 2IVOA 2YHYA 4YDUA 4FOEA 4BRNA 1QQOA 2P9UA 3IUCA 3FZHA 3IFRA 1GLFO 3C7NA 2UYTA 2V7YA 3DXKA 4BG9A 2HF3A 4RWTA 3MN9A 1BU6O 3DXMB 3GBTA 5F0XA 1TYQB 1IJJA 3MK6A 3CIPA 2GWKA 4HTLA 1BO5O 5AFUA 1NGFA 1H1VA 3VENA 3L6QA 3H45C 3QICA 4WQ4C 4H5VA 5AQMA 4DB3A 3FR0A 2YJFA 3EL2A 3UKUA 3MN7A 3HM8A 3ZX0A 3BUZB 2Q1NA 4XEIA 4BVPA 5AQZA 3MDQA 4FWNA 1LOTB 3A5LC 4BRFA 1P8ZA 3GG4A 1C0GA 3LDQA 2QXLA 1BDGA 3WXLA 1GLJO 4BRAA 2Q2RA 2P9LA 3MN5A 4BRCA 3LDOA 4BQZA 4PL8A 4DCHA 5BN8A 3QBXA 4BRHA 3VF6A 4IZ9A 2GEMA 5BPLA 3FZKA 2HF4A 2OANA 5AQPA 3AAQA 3U9DA 4XH1A 2ZF5O 3H6EA 2EWSA 4B1ZA 1XUPO 4BRKA 3H3NO 2PBDA 2A41A 2CGJA 3EKSA 5BPNA 1RGIA 1MWKA 4FWMA 1HJOA 2HOEA 1QHAA 4A62A 2CH6A 2E1ZA 4NB4A 5CE3A 3EZWA 2E2PA 4BRMA 4B1XB 3LDLA 1V4TA 1R59O 2FLOA 2FXUA 5AQGA 1HX1A 3HBTA 5BN9A 5AR0A 4CZLA 3SJHA 3LM9A 1V4SA 3A0IX 4H0YB 3ENOA 4M7YA 5FPDA 4FWLA 2A40A 4FPBA 2P9LB 3UKRB 1DKGD 2E2NA 3LL3A 4H5TA 4M7XA 2D0OA 2GELA 4XH5A 3KZBA 4BGBA 4FWSA 3BF3A 1Q18A 1DEJA 1ZC6A 2YCHA 1RDWX 2ASPA 4BC3A 1HPMA 3WUHA 3LM2A 5BRHA 4JD2B 3KHYA 3CI5A 3ENHA 4QS8A 3A8YA 3FFKB 1X9JA 1KAZA 5KPTA 4L3QA 3R8EA 3SMPA 4KBOA 3LDNA 1QZ6A 1NGJA 5AQFA 5KQDA 2E2OA 4BQLA 4BRDA 2CGLA 1T6DA 2VCPA 2W41A 3HSCA 3VEWA 3J8AA 3LDPA 3AY9A 3QDKA 3O1WA 1HKBA 3P4IA 2ASMA 5AQOA 3UE5A 4H0XB 1NGCA 3L4IA 3RSEB 3DWLA 3O08A 1Y64A 4H5NA 2A5XA 5BRDA 3WQTA 1ATNA 3FZFA 4CZGA 2J4RA 3D2EB 2E2QA 4PKHA 2ITMA 3EO3A 1ATSA 1BOTO 5FPMA 4B1VA 3SLCA 3O6WA 2E88A 1GLBG 1BA0A 4H0OA 2I7PA 1XC3A 5AQRA 4BC2A 1LCUA 2QW9A 3FZMA 1HLUA 4RCHA 2Q31A 5LJWA 3FLCO 2YHWA 3D2EA 4FPAA 2QWMA 4BR7A 3ZETB 4FWOA 4PL7A 2Q36A 4GY2B 5AQWA 2P9IA 3GOIA 1DGKN 4CD3A 3IDHA 4E1JA 2VYPA 2V51B 4QS9A 2BTFA 2P9SB 1OKJA 2AP1A 4EIAA 1IG8A 5AQVA 1KAXA 2CGKA 3ATUA 5AQSA 3CQYA 2D4WA 4A2AA 3HZ6A 4CJ7A 5AQKA 1GLLO 5FPNA 1T44A 2A42A 3CHWA 5JLFA 2GWJA 4BC5A 4MLHA 4BR5A 3CJBA 1YXQA 2P9NB 2QWOA 2NLXA 5JICA 3M6GA 4BC4A 3H1VX 3MMVA 2A6AA 3QFUA 4DQ8A 1JCEA 1KXPA 3B8AX 1K8KB 4CZJA 1XQSC 3AARA 4JNEA 4FWRA 3OHRA 4FWQA 1WUAA 4B9QA 3R9PA 3A5OC 3F9MA 4A2BA 2PAVA 3ID8A 1E4FT 4B1WB 2GUPA 5EY4A 1QQMA 1X3NA 2V52B 3WXIA 3VESA 2BUPA 3H3OB 1BA1A 4C23A 3VEXA 3VGKA 2QM1A 5EVZA 3CJ1A 3TPQA 1MA9B 4CZFA 2QWLA 3UKRA 1NGIA 3W3DA 3QB0A 2FF6A 1GLAG 4EHUA 1NLVA 5JLHA 1ESVA 2FSJA 1BWFO 4YDUC 5AQYA 1C0FA 3CERA 1J6ZA 4BR9A 4MO4A 4CBUA 4IXCA 1NM1A 2P9UB 1CZAN 5BREA 4IO8A 4ISEA 4RTFD 3L0QA 2P9IB 5AQXA 2QWQA 1NWKA 3O4WA 2P9SA 2FF3B 4H0VB 4FSVA 5AFUH 3HI0A 2W40A 2P9PB 5F1XA 4B1UB 1TYQA 3QBWA 4FWKA 4WYBA 4JHDB 2P9KA 1SZ2A 3ZEUB 3EN9A 5BRFA 1YUWA 2IVNA 2HMPA 1D4XA 4O5FA 4AM6A 5ADXA 4CBXA 4BGAA 2VWBA 1HKCA 1GLEG 1U2VB 1NGDA 2NRHA 5AZJA 3WQUA 3CETA 3VEOA 3FZLA 2NZTA 4MLEA 4I6MB 3WT0A 4EFHA 2H3GX 1GLDG 1TUYA 2D0PA 2D1KA 2IVPA 5FPEA 5AQTA 1RFQA 4LC9B 2E1YA 4CZMA 1K8KA 1BUPA 5KPRA 4Y0WA 3CJAA 3S41A 5BR9A 2A3ZA 3M3ZA 5KPZA 2Q0UA 4J8FA 3CJCA 5I9EB 1NMDA 4FO0A 4HWIA 3RSEA 4BR4A 4BRPA 2E8AA 3BEXA 1JCGA 4FOIA 3VF2A 4FWPA 4BR0A 1Z6RA 4IJAA 4M63C 1E4GT 1NGGA 4CZEA 3KVGA 3CJ7A 5AZIA 5KQ8A 1S22A 3VERA 4Z94A 5F2RA 1BG3A 3UB5A 3SMSA 1KAYA 3ZETA 4CBWA 3CJ9A 5ELZA 1HUXA 3BP8A 3U4LA 5B8HA 1SQKA 3DJCA 4QS7A 2YI1A 4B1YB 1NBWA 2QWPA 1YAGA 5AQHA 1HKGA 3GL1A 1NGHA 2QWRA 3DXKB 5E84A 1NGEA 4CZHA 2P9KB 1WOQA 1YVNA 4H03B 4BRLA 3QMLA 1U6ZA 2P9NA 2P9PA 2YJEA 2FSNA 3WXKA 1X3MA 4DHYA 3UKUB 3CQXA 3EKUA 5AQIA 4EHTA 1MDUB 2ASOA 5AZIB 3U9ZA 4BRIA 4MO5A 2WUSA 4O8KA 3R6MA 5AQLA 3BF1A 4ISFA 4JN4A 3VGMA 4BRGA 1ZBSA 3ULEB 3VGLA 4BG8A 4GNIA 4BVOA 4JAXA 3I33A 3ZX3A 3I8BA 2V7ZA 2ZGZA 4K41A 2I7NA 1JCFA 3A5MC 3VPZA 1U2VA 4K42A 4FL9A 4JD2A 4H0PA 1G99A 3D2FB 4WQ4A 3IMXA 4WQ5C 3VOVA 4BREA 2FSKA 3G25A 3QFPA 1TUUA 4F9OA 5TKYA 3SK3A 2ZGYA 3ZEUA 2ZWHA 3C0BA 3O1BA 3C7NB 1Z05A 3FE1A
chains in the Genus database with same CATH superfamily
4H5WA 3O80A 1QZ5A 3VQBA 1Z26A 1W0HA 4WQ5A 3D7EO 2W6KA 4CZIA 3NFAA 4DR5K 1NU0A 2UUCK 5HRPA 3RMAA 4FLWA 4QAGA 3OS0A 4BR2A 2W00A 3G71N 2G8UA 1IKVA 2YKMA 3AVMA 4FK4A 3DAWA 3JYTA 3VEYA 1TK8A 2IOCA 4A5AA 3LWMA 4FLTA 3FGUA 1RDCA 1IG9A 3E01A 4HUGA 4L8RB 2F9TA 1BIUA 1JXBA 3SZ2A 4KB0A 3THWB 3VTIA 3EEQA 5AZJB 3OY9A 2GTDA 3P31A 4A61A 3ULDA 4LF7K 3TU5A 4CEFA 4DU4A 4X62K 4WF9L 4BRQA 2PZSA 1VSMA 1FXXA 4W5TA 4HCBA 3K5MA 2YHYA 4FOEA 2X78A 4CHQA 3PV8A 1GLFO 3C7NA 4RG8A 4CIFA 2UYTA 3DXKA 3MN9A 3GBTA 5F0XA 4OVLA 2HNDA 1TYQB 3MK6A 2LSNA 1C0MA 3HL8A 2GWKA 4M45A 3PY8A 1H1VA 4CF2A 4C8OA 1P90A 3QICA 4H5VA 5AQMA 3PUFA 2YJFA 4DR6K 3EL2A 1TVRA 3ZX0A 3BUZB 1X1PA 1N8RO 4KB1A 3I0SA 4XEIA 4BVPA 3SAHA 3CC7N 4H4MA 4FWNA 1WLJA 3SPZA 4KI4A 2EHGA 2XO7A 2YNIA 4YNQA 3LDQA 2HHWA 4B9MA 1GLJO 3U3GA 4OPHA 3V9UA 3TI0A 2BDPA 3MN5A 2DFFA 1OH6A 4DCHA 1TK0A 4KH5A 4AF1A 1ZBUA 1S1WA 4NXMK 3MXIA 2GEMA 1WBDA 3CCVN 2OTJN 4C8LA 4CJ5A 4C1NI 4CHOA 4B1ZA 4MDBA 1XUPO 2PBDA 2Z1JA 3WNGA 2CGJA 3EY1A 3T1AA 5BPNA 1ASWA 3C6HA 3V1OA 4BY9C 3ZSOA 3RVCA 2B4JA 3ZT0A 5LL6Z 2BANA 3HPOA 1VSJA 3D6RA 4E7HA 2F4VK 4H4OA 5C12A 3OJSA 3LDLA 3L3UA 2FXUA 1ILYA 1HX1A 5KI6A 4GW6A 4CZLA 1VQ4N 3IKMA 4CIGA 5FPDA 5FRNA 2ZJQL 2GUIA 3HM9A 2E2NA 3QIOA 3LL3A 3CCQN 3KZBA 4FWSA 5FDLA 3DLLL 1KQSM 2YCHA 2ASPA 4B9SA 3KHYA 3A8YA 1KVBA 5JVGL 4DV2K 2F8SA 1VQNN 1JLAA 1TL1A 5IWAK 5KPTA 3R8EA 3SMPA 4DLEA 4FZYA 3LDNA 1RT4A 4JEPA 3H08A 2G8VA 1C0UA 4NCBA 1BGXT 5C10A 3O9RA 2VGMA 3J8AA 3CCMN 3O1WA 1HKBA 3UE5A 4DQPA 5JS2A 3RSEB 3DWLA 4IEEA 3O08A 1TV6A 3WQTA 1D9FA 2YNFA 2Z1HA 2G8KA 4PKHA 2ITMA 1X9SA 2Q3SA 3TTDA 3THYB 1VQ6N 3AGRA 3SLCA 4AH9A 3O6WA 2VG6A 3TSUA 4H0OA 1LCUA 1SS6A 3FZMA 3U6FA 4DR7K 5LJWA 1JL2A 3D2EA 4DFMA 3DLGA 3ZETB 4FWOA 3AO5A 4GY2B 5AQWA 3VQPA 3ZCMA 1DGKN 4CVNE 4CHZA 1OKJA 5M1NA 2CGKA 1ZBIA 1L3VA 1WSIA 4A2AA 1F21A 4CJ7A 1L3SA 1CLQA 4DU3A 4C8KA 4GKJK 3G6EN 1WSFA 3PX0A 2XHBA 4DV1K 1Q7YO 1WSJA 3ITHA 2NLXA 3VQEA 4KHWA 4YOUA 1NK4A 2VG7A 4XIUA 1UAXA 5FRMA 5E41A 3WXMB 1KXPA 3B8AX 1S1UA 3OHRA 4FWRA 4FWQA 4ID1A 4ELVA 4EZ6A 3F9MA 3NGIA 2PAVA 3VQ6A 4B9NA 5J2PA 1QQMA 1X3NA 1C0TA 1YTUA 3CCRN 4M3WA 3V6DA 2BUPA 3H3OB 3LANA 4FXDA 2NRTA 3VGKA 1XWLA 1CZ9A 2HSTA 4M3UA 1IKXA 4BDYA 4FM1A 4KPYA 1NLVA 4DTPA 4ELUA 1ESVA 1Q82O 4YDUC 4E0DA 1RBTA 1VSHA 3N4PA 1HRHA 4FCYA 4DU1A 1NJWA 4CECA 4IXCA 1NM1A 3KLGA 4DTRA 4RTFD 3L0QA 4IOXA 4FLVA 2FC0A 3O4WA 1RTDA 4B1UB 1KRPA 2OPPA 3V9XA 4JHDB 2ZE2A 3TAPA 3EN9A 2ZJPL 4JRQA 2IVNA 1YVUA 1WAJA 3TTCA 4O5FA 4AM6A 5KGXA 5DK5A 1HNVA 3M8RA 1U2VB 1NKEA 1B9FA 5AZJA 5JENA 3O9TA 2HBMA 5JS1A 3CMEN 4MLEA 3MCAB 4I6MB 4EFHA 2H3GX 4JK9A 3HVRA 4DSIA 2IVPA 4B8CA 2GX9A 5FPEA 4FW1A 3L3VA 2UUAK 4Y0WA 3QEPA 3CJAA 5DMRA 1UA0A 3KD1E 2Q0UA 1EX4A 3CJCA 1HJRA 2NRRA 2HW3A 4HWIA 4BR4A 5I3UA 4JKEA 4FOIA 4KHQA 3HK2A 2IDOA 4FWPA 1JJ2M 3OVNA 3V1RA 4M63C 1XC9A 4U7BA 1NGGA 3SUQA 1KFSA 3KVGA 3M5RA 4LSLA 3NVMA 5KGWA 1BG3A 3MAQA 1VQMN 3R3LA 3UB5A 4CBWA 4YOTA 1IO2A 4BE7B 1VRUA 1D5AA 4RW7A 3U4LA 5B8HA 2ITGA 4OPJA 1HQEA 4JKGA 3DOLA 5CY4A 4YY3K 2P9KB 1YVNA 4JI7K 3P38A 1WSHA 4OKJA 4CHYA 4DSKA 4JRPA 2FBYA 4BRLA 2HHUA 1S6QA 2HNZA 4OGEA 1SUQA 1IBKK 2P9NA 3AVIA 3WXKA 1WNSA 4MDAA 4FVUA 1XHXA 1QSSA 1TKTA 4DHYA 4BE0A 5AQIA 1Q86O 1KLNA 1VQ5N 4DTMA 4FJ5A 5AQLA 3BF1A 3VGMA 4BRGA 3KTQA 1W2BM 4X64K 3ULEB 2ZD1A 4ILHA 2V7ZA 2OTLN 1JCFA 3OBWA 3VPZA 3J7AP 4JV5K 3IMXA 1NJYA 2FSKA 3G25A 3VMFB 1JLFA 3SK3A 3I0RA 3LP1A 3AVAA 1GLDG 3THYA 3FE1A 4Z4GA 2Q97A 1RT1A 3HTVA 4EAHD 3HT3A 3MCPA 5ADXH 1T7PA 4WFNL 1NJIO 1BL3A 1EETA 4CESA 5AQUA 4DTNA 2KFNA 3DYAA 4PKIA 3OYDA 2O8FB 5EOYA 1SL0A 3AGKA 3JS6A 3MN6A 4DMNA 4RW8A 3OA9A 1WN7A 4FJLA 3HP6A 4BDPA 4FJKA 3VETA 3O9QA 3RTVA 3O9UA 1IH7A 3W0LA 3O3GA 4IJNA 2DPNA 3TR8A 2VWKA 3ULEA 4AM7A 1NGBA 5E26A 3J7YP 5C0YA 3U3YA 3D0PA 1EKEA 1FW6A 5EX5A 4IKFA 4E19A 1HYVA 4CK1A 5DM7L 3RWUA 3THWA 4O55A 4JHDA 4A59A 3OYGA 2IVOA 1GOCA 4V19S 4BRNA 2P9UA 4CE9A 3SV3A 3KLIA 1K9MO 5GAHP 1SV5A 4RWTA 4LF4K 1YT3A 4H8KA 3DXMB 3RMDA 3NH1A 1IJJA 1BI4B 2PYLA 2O8BB 2B5JA 1RBVA 4CGIA 2WONA 3NH2A 3LP3A 4JI8K 3VENA 3L6QA 5AJ3K 1CZBA 4WQ4C 1REVA 1XMQK 4DB3A 3ZT4A 1SKSA 3THXA 3UKUA 4FJXA 1JLGA 1NMNA 2R7YA 4HUEA 2YHBA 4IDHA 5HL7L 4KTQA 3OYLA 2C1IA 3A5LC 1WBBA 3OYJA 1HNWK 1N34K 1BDGA 2KLAA 4BRAA 2Q2RA 1RBRA 1ZBFA 3VQQA 4YFUA 1S9GA 4BRCA 4BQZA 3K5LA 3T1YK 5BN8A 3LP2A 3TAFA 4LF6K 4CEQA 1HNIA 4NCAA 4CF8A 4IEIA 3HP9A 4KRFA 3BY5A 3SNNA 4QCLA 3AVCA 3NDKA 3SPYA 4DR2K 3NMUA 3CF5L 2A41A 1RGIA 1RDUA 1O1WA 1N33K 2O8DA 2HOEA 4A62A 3AVNA 2ATQA 4NB4A 3QEXA 4N56A 4BRMA 4K8ZA 4CHPA 1KVAA 1R59O 4DF4A 1ITGA 5AQGA 1NKBA 3HBTA 5AR0A 2NNWA 4W5NA 1V4SA 3A0IX 3HSTB 1RILA 4H0YB 1XHZA 3ENOA 4M7YA 2BE2A 4GVMA 4FWLA 4FPBA 2P9LB 3K57A 4HUFA 4H5TA 5SWMA 1VQKN 3L8BA 1Q18A 1DEJA 4K8XA 4FLZA 3MEDA 5BRHA 3ENHA 4QS8A 4KREA 3FFKB 1X9JA 4Z0UA 4GVEA 3C95A 1S1XA 3EE9A 1QZ6A 1NGJA 3LAMA 4E3SA 5KQDA 4BQLA 1JLEA 1T6DA 3EZ5A 4CGGA 1YJNN 4J2DA 2VGNA 3SQ4A 3QDKA 3AY9A 3P4IA 4DFPA 4DWIA 4DTOA 1QVFM 4H0XB 4LFCK 1OVYA 1Y97A 4FK2A 3O4NA 4KHUA 3LPUA 3FZFA 4CZGA 4I2QA 4EP5A 1ATSA 4B1VA 3K0SA 3DRPA 3K2PA 4DSJA 2E88A 1GLBG 1ASUA 4JI0K 4PQUA 1L5UA 4F3OA 1Q9YA 1HLUA 1TAQA 1VSLA 2QI2A 3ZLJA 2YHWA 1RT3A 2YX6A 4FPAA 4BR7A 1QVGM 2QKBA 3AO1A 4PL7A 4ELTA 3TAGA 2Q36A 3RRHA 2P9IA 3GOIA 4NXNK 4LF8K 2VYPA 3DRRA 2P9SB 4EIAA 3SAGA 5AQSA 5FROA 3QNOA 3HZ6A 4CF9A 3CHWA 4AHTA 1RDBA 5M1OA 4BC5A 1I3AA 4CFAA 1N5YA 1HQUA 1NOYA 5JICA 3M6GA 3ALYA 3WNFA 3CCLN 3IS9A 3QFUA 4DQ8A 3MX5A 3AARA 4E89A 1WUAA 3A5OC 4FLXA 4GMJB 4A2BA 4B1WB 1E4FT 1S6PA 3AVHA 5EY4A 3C6AA 3VTHA 4CJKA 2E6MA 1B9DA 3DLRA 3KK3A 4B3MK 2KFZA 4JS4A 3AVFA 2VQEK 1NKCA 2OYQA 4FJ9A 4C23A 3VEXA 2C1GA 2QM1A 3CCSN 4I2PA 5EVZA 2HBLA 3CJ1A 3TPQA 4CZFA 1TL3A 2QWLA 4C1NK 4Q5VA 1JL1A 3W3DA 5M1KA 3SQ0A 1GLAG 4EHUA 3KK2A 2HHXA 3CERA 4E7IA 1J6ZA 4MO4A 2RF2A 1LAWA 1A5VA 1CXQA 4JKAA 2UUBK 2P9UB 1VSFA 4IO8A 2Y1IA 2O8FA 1S1VA 2YHAA 4H0VB 5AFUH 3HI0A 2QEXN 4KHPK 3ZYYX 4CJVA 2IAJA 1TYQA 3QBWA 3LWLA 5J1EA 2D0BA 1W7AA 1OH8A 2AJQA 1S5JA 1SL2A 4AQYK 2P51A 5BRFA 3AO2A 1D4XA 5CR4A 1YITN 3L2RA 1UOCA 1HKCA 4CEDA 1GLEG 1VSEA 3HJFA 3ZT3A 4M3YA 1J5OA 3FZLA 3OYIA 3WT0A 2YNHA 4LH4A 3F9KA 1TUYA 2D0PA 1C1AA 1RT2A 5A2QO 4JKGB 1QSYA 2DTUA 4CFDA 4DF8A 4LC9B 2E1YA 4R5PA 3KK7A 5KPRA 3CM5A 4HCCA 2BGGA 4E72A 3S41A 5BR9A 3VN5A 1VQPN 4B8AB 1JKHA 5I9EB 2RE2A 3PLAA 3BEXA 1U47A 3L2WA 3VF2A 4FM2A 4BR0A 1Z6RA 4J2AA 4NCGA 2JLEA 2OPSA 4ID5A 1S22A 1IKWA 4Z94A 3PSFA 2F96A 2G8FA 3CJ9A 2XRIA 3WNHA 4CEEA 5ELZA 1HUXA 4KFBA 3DJCA 3VQDA 4WFBL 2IGIA 4B1YB 2QWPA 3OYCA 4DSFA 1S72N 1HKGA 4JLHA 1ZBHA 1SKWA 1NGEA 3MXJA 2ZM6K 3RRGA 3Q7BA 2GBZA 4CJUA 1RTJA 3CFRA 1VSIA 2P9PA 2RHKA 3MWPA 3SYZA 2O8EA 2OA8A 3CQXA 5AZIB 4BRIA 3U9ZA 4CJTA 4MO5A 3HXMA 2WUSA 4O8KA 4HTUA 4ISFA 3LP0A 3DOKA 3V9SA 1JLCA 3O4QA 4BG8A 2WBNA 4BVOA 1RBSA 4JAXA 4KH4A 3I33A 3I8BA 4K41A 2I7NA 4K42A 4FL9A 4IG3A 2XY7A 4J2EA 4O0JA 1FKPA 2PYJA 3AV9A 3RR8A 3VOVA 2HHIA 3DRSA 4FK0A 2DY4A 2ZGYA 4ILJA 1Z05A 3R6MA 1G15A 3G10A 5HRSA 4DS4A 1J54A 1T6CA 5AQJA 3AA2A 3AVLA 4Z4HA 2FBTA 3ZSQA 3AAPA 5LY3A 4KO0A 2F8TA 3O5BA 4B08A 3SBTA 3S3NA 3GDQA 2KHOA 1VK0A 4JKDA 3PO4A 3GE1A 2E6LA 3JAMO 4UQGA 4XH4A 3G4SN 5JVHL 1N36K 2NRVA 4IOCL 3VEVA 3DXMA 3D2FA 5JMVA 5LJVA 1EQYA 3OYEA 2WOMA 1BI4A 5EXWA 2OZSA 1RDDA 3PSIA 4CD1A 2KKZA 3H46O 4JK8A 3QEVA 4NO7A 4DS5A 4ICLA 2F9WA 1GLCG 4IDKA 3U8XA 2O8CB 5AQQA 3AO4A 2IIRA 3A5NC 3LPTA 5LMUK 3TSQA 3WEEA 5C24A 2NRWA 4Z4EA 3V9ZA 5KRSA 3THXB 4K25A 3NGYA 1NGAA 2D0AA 5J2MA 2CH5A 1ATRA 3I8DA 3ATVA 3F2KA 4B3SK 2KTQA 3SI6A 4H5RA 2RN2A 4KHSA 3V9WA 4YDUA 3T3FA 1QQOA 4CJEA 3FZHA 3IFRA 3ZSYA 2V7YA 4BG9A 2HF3A 3HO1A 1XI1A 4HHTA 3SCXA 4LF9K 3CIPA 2UXBK 3ZSRA 3C65A 5LMNK 4CJRA 2KZMA 1BO5O 1NGFA 3SAFA 3I55N 4DTSA 5MLCQ 3H45C 4JKFA 2WTUA 3VQCA 3AA5X 1HPZA 4E1MA 2Z1IA 4DR3K 3HM8A 4BE2A 3KJVA 2DFEA 2Q1NA 4RW9A 4JI3K 5AQZA 4LFBK 5HBMA 4YHHK 1OVQA 3C6UA 2OPRA 5J2NA 4BRFA 1BQMA 4OX9K 3GG4A 4CJ3A 5GADP 4JI1K 2P9LA 1OH7A 3THVA 3LDOA 3T69A 3P83D 1EXQA 1GOBA 1K6YA 4B3OA 1JLQA 3ZSZA 4DV4K 2G8WA 3VF6A 4IZ9A 5BPLA 2RKIA 1YF5L 3FZKA 2OANA 5AQPA 3TAQA 3U9DA 2ZF5O 3H6EA 3V1QA 2EWSA 4OPAA 3CCJN 3H3NO 3QO9A 2QK9A 4NLBA 3CG7A 4YORA 3PO5A 1MWKA 4FWMA 4CJ4A 4O0IA 5HROA 1HJOA 1RTIA 1VQLN 1LAVA 3J80O 4F3TA 1QHAA 1WAFA 5GIPA 3VQAA 4BEBA 2IC3A 3P1GA 4I7FA 4J2BA 2E2PA 4CGHA 1V4TA 4JKCA 1HR0K 4IG0A 5HRRA 3SJHA 1NK9A 3L2QA 2HNYA 3OYHA 2A40A 4CK2A 4FYDA 3UKRB 5TKWA 3OYAA 4M7XA 5KTQA 4JKBA 2D0OA 5GINA 1X9WA 4M3XA 1VAZA 1EWRA 4BGBA 2OCEA 1RDWX 4CGJA 1HPMA 3LM2A 1J53A 5C2DA 1HYSA 2ETJA 3MWTA 3VQ9A 1LWCA 4F4KA 4L3QA 1NOZA 4KBOA 3RMCA 1XMOK 1ASVA 3O3HA 2E2OA 1YHQN 1TKXA 4BRDA 2VCPA 2W41A 3OYBA 3VEWA 4PHTX 1JLBA 2ASMA 4CFCA 5AQOA 3L2UA 1NGCA 3L4IA 4H5NA 4M3RA 5BRDA 3NE6A 3HVTA 3KIOA 4F2RA 3D2EB 1S9EA 5HOOA 2E2QA 1NK7A 4KHNA 3S5TA 3CC4N 3QETA 1M90O 1BA0A 4WFAL 1XC3A 4BC2A 3S3MA 1SKRA 2QW9A 1CXUA 3HOTA 3FLCO 2O8CA 2QWMA 4JS5A 1HNZK 4RW6A 2W6LA 1TAUA 3SJJA 3E66A 1IG8A 5AQVA 4N41A 1KAXA 4O8UA 3ATUA 1QTMA 4YOXA 3CFOA 3T19A 1EO1A 2P5OA 1GLLO 1T44A 4OO1J 1Q81O 3KD5E 5JLFA 2GWJA 4BR5A 3EYZA 3CJBA 4DR4K 1YXQA 2P9NB 2QWOA 1W9HA 1RTHA 1K73O 3H1VX 3MMVA 1NJZA 2A6AA 4FZZA 2HHTA 3E9OA 4CZJA 1XQSC 1KTQA 2HVIA 4B9QA 2PFUA 3R9PA 4DQSA 3ZSXA 4AHUA 3ID8A 4DUYK 3SV4A 2O4GA 2V52B 4I9QA 3NAEA 3CYGA 4N76A 1VQ8N 3OYNA 3NHGA 3DLEA 2HHQA 3SUPA 3E1YA 1NGIA 5JLHA 1BWFO 5AQYA 1NG9A 4PA1A 1YJWN 1VRTA 3O9SA 1RT6A 4BR9A 4N5SA 2HBJA 3BGRA 4KV8A 4LY7A 3ID6A 1VQ7N 1KLMA 4ISEA 5AQXA 2P9IB 4AILC 3K5NA 2QWQA 3VA0A 1B92A 3T7ZA 2P9SA 3BZKA 2W40A 2P9PB 2X74A 4FJHA 1WSGA 5C42A 1R0AA 5HLFA 2I5JA 2UXCK 4WYBA 4C8NA 4CJQA 1BCOA 1YI2N 1SZ2A 3ZEUB 5K14A 1QHTA 1I39A 1N32K 4MFBA 1X9MA 2HMPA 2HVHA 3WNEA 5ADXA 3TABA 4DTUA 1KSPA 4DQIA 1FK9A 1IBMK 3SUOA 4CBXA 4BGAA 2XY6A 2VWBA 1BIZA 4G1QA 3WQUA 4JI5K 2A1RA 3VEOA 3CC2N 4OKEA 1M1KO 1WSEA 4B3TK 4CF1A 2HMIA 3CQ8A 3QESA 1GOAA 1RT7A 1RFQA 3DLBA 1K8KA 1BUPA 5HP1A 4DQRA 3ENBA 2A3ZA 3M3ZA 4FJJA 3DM2A 4J8FA 4DKWA 1NNEA 4W5RA 4OGCA 1A5WA 5EU7A 1JCGA 2O4IA 4Z4IA 4IJAA 4CZEA 4CEBA 3CJ7A 5AZIA 3VERA 2PY5A 5F2RA 4GV6A 1KAYA 3ZETA 4QOZB 4IBNA 4K0KK 1SQKA 4QS7A 2VWJA 2YI1A 3OBYA 1IBLK 3M8PA 5GAEP 4FJGA 3CD6N 1YAGA 3VA3A 2W42A 5AQHA 1QE1A 1NGHA 1RCHA 2QWRA 4JI4K 4HVJA 3NF6A 4A57A 4H03B 1XNQK 5M1QA 1NJXA 1LW0A 1K8AO 1NK8A 3CCUN 4Z4CA 2YJEA 2FSNA 1FJGK 2E5LK 1X3MA 3P39A 3EKUA 4EHTA 1MDUB 2ASOA 3L2VA 3AVKA 1ZBSA 4CJWA 4YOYA 1LV5A 3ASMA 3VGLA 1FKOA 3KLHA 2GV9A 2X6NA 3TAMA 3LALA 2HHVA 2QA4N 3QEIA 4DLGA 4B3RK 4KKOA 2QKKA 4UY8O 2P5GA 4JD2A 4IFYA 3BDPA 1A5XA 3D2FB 1RT5A 4EZ9A 3D45A 1BHLA 4JYAK 1KC8O 3QFPA 3A2FA 2JWKA 4O44A 3ZEUA 3C0BA 3DMJA 3VF4A 1TK5A 4DUZK 3LAKA 5CYQA 1U4BA 3M1FA 4KAZA 1TKZA 4F8RA 4Y1CA 2E20A 1ZXOA 1LW2A 2WC9A 5AQNA 1VHXA 4YOVA 3VEZA 3HPHA 1DT9A 5CZ1A 3DI6A 3JXUA 2AA4A 1U04A 4ILGB 1C1CA 4G9ZA 1SAZA 3F73A 4BROA 4CI6A 4ZTJA 3WXJA 2YHXA 4CIEA 4OPKA 4PKGA 4W5QA 3V81A 3DLHA 4IWVA 4K43A 5FLXO 5GIOA 3O8MA 3S9HA 4BACA 3CM6A 2Q0RA 1MWMA 4H0TB 4CZKA 3ZX2A 2FBVA 2QWNA 4FJIA 4I6MA 3H1QA 4FVMA 4CCHA 1S3XA 4LFAK 1KD1O 5BPMA 2YV0X 3LZIA 4DSEA 3WEEB 1TGOA 3OYKA 1HYZA 3SBGA 4CEAA 4CF0A 1QQNA 4R79A 1T3VA 4ISGA 1D9DA 4PY5A 1MU2A 4X65K 1DLOA 4U67L 3IUCA 4CFBA 2BH1A 2IS3A 3VQ5A 3C6TA 1E3MA 2D5RA 2UXDK 4FLYA 1BU6O 3LZJA 4AHVA 1KFDA 3OTOK 1NK5A 1BISA 3IG1A 4HTLA 5AFUA 4FJ7A 1RNHA 2WFBA 3AVJA 4TSXA 2KW4A 4IOAL 3FR0A 3ZT2A 4C8MA 4M42A 2O8BA 3MN7A 2OZMA 1Q9XA 3IAYA 3QERA 4DTJA 1U45A 3HPGA 4Y1DA 1OH5A 3MDQA 4CERA 1LWFA 1W97L 1KCFA 1LOTB 1P8ZA 4O4GA 3AVBA 4FW2A 1C0GA 2QXLA 2NUBA 3EE8A 1IV0A 4GKKK 3WXLA 4DV7K 4DTXA 5KRTA 3VQ7A 3TARA 2EX3A 3KKRA 4PL8A 3MX2A 3VQ8A 2VG5A 4DG1A 4E7JA 3QBXA 1U48A 4BRHA 4CGFA 3TANA 2JWLA 4PUOA 2HF4A 3TSPA 3AAQA 4XH1A 3KWGA 1C6VA 3KLEA 2XY8A 4KTZA 4BRKA 4KHYA 1EP4A 4PWDA 1YTAA 4ZHRA 3EKSA 4GV3A 2O8EB 2KQ2A 5D3GA 2HB5A 5DM6L 1LWEA 5CZ2A 1J9AA 1WB9A 3QNNA 3DLKA 2CH6A 2E1ZA 4CK3A 3JSMA 5CE3A 3EZWA 4FM0A 4MQ3A 4B1XB 2FLOA 2Y1JA 4AHSA 4BECA 5BN9A 4BWJA 3J7ZO 3VQ4A 2DFHA 3LM9A 4DFKA 4Q0BA 3V4IA 1VSDA 1DKGD 2D0CA 5M1FA 5H1SQ 4GV9A 3PX4A 3CYMA 3QLHA 1RDAA 2GELA 4XH5A 3BF3A 4NLCA 1ZC6A 2FBXA 4BE1A 1T03A 1EWQA 4BC3A 3WUHA 4JD2B 3CI5A 4JI6K 4DR1K 1KAZA 3SUNA 4B9LA 4KI6A 3RR7A 3S3OA 1DTTA 3UIQA 1RBUA 3QIPA 2B6AA 5BR8K 3TTFA 3N4QA 5AQFA 2ZJRL 4DV6K 2CGLA 1XNRK 1UWBA 3HSCA 4NYFA 3LDPA 2X6SA 1YIJN 4YOWA 4I9LA 3CMAN 1Y64A 2A5XA 1I94K 1ATNA 3J81O 4JKHA 2J4RA 3K59A 3TAEA 3EO3A 4E7KA 1BOTO 5FPMA 2HBKA 2QTDA 1BCMA 5AQRA 3AO3A 2I7PA 3OW2M 1SL1A 1NK6A 1YJ9N 1IKYA 3C94A 4RCHA 1C1BA 5CYMA 4LF5K 3O3FA 4IFEA 2G8HA 3PIOL 4DSLA 1L3UA 1S1TA 2NRXA 4CJSA 1VSKA 1UA1A 4CD3A 3AA4A 3IDHA 4E1JA 1L3TA 2Z1GA 2V51B 4QS9A 2BTFA 3KLFA 2G8IA 3KWIA 2AP1A 4O5BA 4M3ZA 1HNXK 3CQYA 2D4WA 4CJFA 1BQNA 5AQKA 3PX6A 5FPNA 1T8EA 4LH5A 2A42A 5T7BA 3CFPA 3TWHA 4MLHA 4KTWA 2KZZA 4X66K 3CCEN 3B6OA 3PIPL 3NCIA 4BC4A 4FJMA 3CPEA 3MECA 2NRZA 1JCEA 3CPWM 1K8KB 4WCEL 3T1HK 1JXEA 4JNEA 2A1SA 2RPIA 4E7LA 4FLUA 2GUPA 3SQ1A 3WXIA 3VESA 3K9JA 5M1PA 2F7TA 3OS2A 1BA1A 4CEOA 3R1XA 2VQFK 1MA9B 2UU9K 3UKRA 3QB0A 3OYFA 2FF6A 2FSJA 2O8DB 1C0FA 4M41A 2YKNA 4AHCA 1ZYQA 4CBUA 3MEEA 3NH0A 4CJPA 3ZSWA 5HRNA 3OYMA 4JI2K 1CZAN 5BREA 4CJLA 4DFJA 4Z4FA 3G0ZA 1NWKA 5IT9O 5CHIA 2FF3B 4FSVA 3KK1A 4A5BA 1Z25A 2JGUA 5F1XA 4RW4A 3HYFA 1QS4A 3RMBA 4FWKA 4DV0K 3OJUA 2P9KA 4B9UA 4DQQA 1D8YA 4WE1A 1YUWA 4KH6A 3MXMA 3M8QA 3ZSVA 2P1JA 1ZBLA 4F2SA 3K58A 3HRGA 3E9LA 4BWMA 1NGDA 2NRHA 4OLBA 3CETA 2NZTA 3F5TA 4JK7A 4FJ8A 4OLAA 2E4LA 2D1KA 5C2FA 1J5EK 5AQTA 4LD0A 1HMVA 4CZMA 4CHNA 3ZT1A 4ZTFA 1N6QA 4NYNA 3AVGA 5KPZA 3E9PA 4W5OA 1NMDA 4FO0A 3RSEA 4M3TA 4BRPA 2E8AA 3NBPA 4FJNA 4LSNA 3CXCM 3ISNC 3BZCA 4XJXA 1O13A 4N47A 4DV3K 2XY5A 1E4GT 3L4QA 4IFVA 1QSLA 3Q7CA 5KQ8A 3NF9A 3HOSA 3SMSA 1NK0A 2OPQA 1U49A 3BP8A 3SQ2A 3AA3A 1DTQA 3NF8A 4OJRA 1NBWA 3MEGA 4BDZA 2HHHK 2ZQBA 4CEZA 3OS1A 5C15A 2HHSA 2QXFA 3GL1A 4B9VA 3DXKB 5E84A 4CZHA 1WOQA 5C25A 4OKKA 4EP4A 3QMLA 3LDSA 1U6ZA 4CGDA 3B6PA 1QQCA 1KVCA 5I42A 3QINA 4E1NA 4CW7B 5GAGP 3UKUB 3K9KA 3K5OA 1VQON 1VQ9N 5J2QA 3KKSA 5SZTA 3P5JA 4JN4A 1Q8IA 4AHRA 4GNIA 4IO9L 3ZX3A 1TKDA 2ZGZA 3A5MC 1U2VA 4FZXC 4H0PA 1G99A 3NGZA 4WQ4A 2YNGA 1T05A 4WQ5C 4BREA 3M8SA 4DV5K 1TUUA 3QEWA 3I56N 4F9OA 3NF7A 5TKYA 2ZWHA 3O1BA 3C7NB 3FFIA 3NVKA 3IRXA 2Q31A 4B9TA
chains in the Genus database with same CATH topology
2Q97A 3VF4A 3M1FA 1T6CA 3HTVA 5AQJA 4EAHD 3MCPA 4H5WA 5ADXH 3AAPA 5LY3A 3O80A 4WFNL 3O5BA 1QZ5A 1NJIO 5AQUA 2E20A 1ZXOA 3SBTA 2WC9A 5AQNA 3GDQA 2KHOA 4JKDA 4PKIA 3GE1A 4WQ5A 3D7EO 5EOYA 1DT9A 3VEZA 3AGKA 4CZIA 3JXUA 4YOVA 3JS6A 2AA4A 3MN6A 4XH4A 3OA9A 3G4SN 4ILGB 5JVHL 4G9ZA 1SAZA 2NRVA 4IOCL 4BROA 4CI6A 4BR2A 2W00A 3VEVA 3WXJA 2YHXA 3G71N 3VETA 3DXMA 3D2FA 5JMVA 5LJVA 1EQYA 4PKGA 3O9QA 3O9UA 5EXWA 3DAWA 4IWVA 4CD1A 2KKZA 4K43A 3H46O 4JK8A 3VEYA 4NO7A 4A5AA 2F9WA 5GIOA 1GLCG 3U8XA 3W0LA 4IJNA 2DPNA 3O8MA 5AQQA 2IIRA 3A5NC 3FGUA 2Q0RA 3ULEA 1MWMA 1NGBA 2F9TA 4H0TB 3TSQA 4AM7A 4CZKA 3WEEA 3ZX2A 5E26A 5C0YA 2QWNA 4I6MA 2NRWA 3H1QA 3VTIA 1S3XA 5EX5A 5AZJB 1KD1O 5BPMA 2GTDA 3P31A 4A61A 4K25A 1NGAA 3WEEB 3TU5A 3SBGA 2CH5A 1ATRA 3ATVA 3F2KA 5DM7L 4WF9L 4BRQA 1QQNA 4R79A 1T3VA 4ISGA 4JHDA 4A59A 4H5RA 2IVOA 2YHYA 4YDUA 4FOEA 4U67L 4BRNA 1QQOA 2P9UA 3IUCA 3FZHA 3IFRA 2BH1A 1GLFO 3C7NA 1K9MO 5GAHP 2UYTA 2V7YA 3DXKA 4BG9A 2HF3A 4RWTA 3MN9A 1BU6O 3DXMB 3GBTA 5F0XA 1TYQB 1IJJA 3MK6A 3CIPA 3C65A 2GWKA 4HTLA 1BO5O 5AFUA 1NGFA 3SAFA 2WFBA 3I55N 1H1VA 3VENA 5MLCQ 3L6QA 3H45C 1P90A 3QICA 4JKFA 4WQ4C 4H5VA 5AQMA 4DB3A 3FR0A 4IOAL 2YJFA 3EL2A 3UKUA 3MN7A 3HM8A 3ZX0A 3BUZB 1N8RO 2Q1NA 4XEIA 4IDHA 4BVPA 3SAHA 5AQZA 5HL7L 3CC7N 3MDQA 4FWNA 1W97L 2C1IA 1LOTB 3A5LC 4BRFA 1P8ZA 3NVKA 3GG4A 1C0GA 3LDQA 2QXLA 3EE8A 1BDGA 3WXLA 2KLAA 1GLJO 5GADP 4BRAA 2Q2RA 4OPHA 2P9LA 3MN5A 4BRCA 3LDOA 4BQZA 4PL8A 3MX2A 3T69A 4DCHA 5BN8A 4KH5A 4AF1A 3QBXA 4BRHA 3VF6A 4IZ9A 2GEMA 5BPLA 2JWLA 4IEIA 1YF5L 3FZKA 3CCVN 2HF4A 2OANA 2OTJN 5AQPA 3TSPA 3AAQA 3U9DA 4XH1A 3KWGA 2ZF5O 3H6EA 4C1NI 2EWSA 4OPAA 4B1ZA 4MDBA 1XUPO 4BRKA 3H3NO 2PBDA 3CCJN 3NMUA 3CF5L 4NLBA 2A41A 2CGJA 3EKSA 5BPNA 4YORA 4GV3A 3C6HA 1RGIA 1MWKA 4FWMA 1VQLN 4BY9C 1HJOA 1RDUA 3RVCA 5DM6L 2HOEA 1QHAA 4A62A 5GIPA 4BEBA 2CH6A 2E1ZA 4NB4A 3D6RA 5CE3A 3EZWA 2E2PA 4BRMA 4B1XB 3LDLA 5C12A 1V4TA 1R59O 4JKCA 2FLOA 2FXUA 1ILYA 5AQGA 1HX1A 3HBTA 4BECA 5BN9A 5AR0A 4CZLA 3J7ZO 2NNWA 3SJHA 1VQ4N 3IKMA 3LM9A 1V4SA 3A0IX 4H0YB 3ENOA 4M7YA 5FPDA 4FWLA 2A40A 4FPBA 2ZJQL 2P9LB 3UKRB 1DKGD 5TKWA 5M1FA 5H1SQ 4GV9A 2E2NA 3LL3A 4H5TA 4M7XA 4JKBA 2D0OA 5GINA 1VAZA 2GELA 4XH5A 3CCQN 3KZBA 4BGBA 4FWSA 3BF3A 4NLCA 1VQKN 3DLLL 1Q18A 1DEJA 1ZC6A 1KQSM 2YCHA 1RDWX 2ASPA 4BC3A 1HPMA 3WUHA 3LM2A 5BRHA 4JD2B 3CI5A 3ENHA 3KHYA 4QS8A 5C2DA 3A8YA 5JVGL 3MWTA 3FFKB 1VQNN 1X9JA 1KAZA 5KPTA 4GVEA 4L3QA 3R8EA 3SMPA 4KBOA 3LDNA 3TTFA 3N4QA 3EE9A 4JEPA 1QZ6A 1NGJA 5AQFA 5KQDA 2E2OA 2ZJRL 5C10A 3O9RA 4BQLA 1YHQN 4BRDA 2CGLA 1T6DA 2VCPA 2W41A 3HSCA 3VEWA 4PHTX 1YJNN 2VGNA 2VGMA 3J8AA 3LDPA 3AY9A 3QDKA 3O1WA 1HKBA 3P4IA 2ASMA 3CCMN 5AQOA 1YIJN 3UE5A 4YOWA 1QVFM 4H0XB 1OVYA 1NGCA 3L4IA 3RSEB 3DWLA 3CMAN 4IEEA 3O08A 1Y64A 4H5NA 2A5XA 5BRDA 3WQTA 1ATNA 3FZFA 4CZGA 4JKHA 2J4RA 3D2EB 5HOOA 2E2QA 4PKHA 2ITMA 3EO3A 3TTDA 1ATSA 1BOTO 3AGRA 5FPMA 3SLCA 4B1VA 3O6WA 2HBKA 2QTDA 3CC4N 2E88A 4WFAL 3TSUA 1M90O 1GLBG 1BA0A 4H0OA 2I7PA 1XC3A 5AQRA 4BC2A 1LCUA 1SS6A 2QW9A 3FZMA 3OW2M 1YJ9N 1HLUA 4RCHA 2QI2A 3HOTA 5LJWA 3FLCO 1VQ6N 2YHWA 3D2EA 4IFEA 4FPAA 2QWMA 2YX6A 4BR7A 3PIOL 1QVGM 3ZETB 4FWOA 2NRXA 4PL7A 2Q36A 4GY2B 3E66A 5AQWA 2P9IA 3GOIA 1DGKN 4CD3A 3IDHA 4E1JA 2VYPA 2V51B 4QS9A 2BTFA 2P9SB 1OKJA 2AP1A 3KWIA 1IG8A 5AQVA 4EIAA 1KAXA 2CGKA 4O8UA 3ATUA 5AQSA 3SAGA 4YOXA 3CQYA 2D4WA 4A2AA 1EO1A 3HZ6A 4CJ7A 5AQKA 1GLLO 5FPNA 1T44A 4OO1J 2A42A 3CHWA 3G6EN 1Q81O 5JLFA 2GWJA 5M1OA 4MLHA 4BC5A 4BR5A 1Q7YO 3CJBA 3CCEN 1YXQA 2P9NB 2QWOA 2NLXA 3PIPL 5JICA 3M6GA 4YOUA 4BC4A 1K73O 3H1VX 3MMVA 3CCLN 3CPEA 2A6AA 3E9OA 3QFUA 2NRZA 1JCEA 3WXMB 4DQ8A 1KXPA 3B8AX 1K8KB 4CZJA 4WCEL 3CPWM 3MX5A 1XQSC 3AARA 4JNEA 4FWRA 3OHRA 4FWQA 1WUAA 4B9QA 2PFUA 3A5OC 3R9PA 3F9MA 4A2BA 2PAVA 3ID8A 1E4FT 4B1WB 2GUPA 5EY4A 3C6AA 3VTHA 1QQMA 1X3NA 2V52B 3WXIA 3VESA 3K9JA 5M1PA 2F7TA 3CCRN 2BUPA 3H3OB 1BA1A 1VQ8N 4C23A 3VEXA 2NRTA 3VGKA 2C1GA 2QM1A 3CCSN 3R1XA 5EVZA 2HBLA 3CJ1A 3TPQA 1MA9B 2HSTA 2QWLA 3E1YA 3UKRA 1NGIA 3W3DA 4C1NK 3QB0A 4CZFA 5M1KA 2FF6A 1GLAG 4EHUA 1NLVA 5JLHA 1ESVA 2FSJA 1Q82O 1BWFO 4YDUC 5AQYA 3N4PA 1C0FA 1YJWN 3CERA 1J6ZA 3O9SA 4BR9A 4MO4A 4CBUA 2HBJA 4IXCA 4JKAA 1NM1A 2P9UB 1CZAN 5BREA 3ID6A 1VQ7N 4IO8A 4ISEA 4RTFD 3L0QA 2P9IB 5AQXA 4IOXA 2QWQA 1NWKA 5CHIA 3O4WA 3T7ZA 2P9SA 2FF3B 4H0VB 4FSVA 5AFUH 3HI0A 2W40A 2QEXN 2P9PB 4A5BA 3ZYYX 5F1XA 4B1UB 1TYQA 3QBWA 4FWKA 4WYBA 4JHDB 2P9KA 1YI2N 1SZ2A 3ZEUB 3EN9A 5BRFA 2ZJPL 1YUWA 2IVNA 4KH6A 2HMPA 1D4XA 3TTCA 4O5FA 4AM6A 5ADXA 5CR4A 1YITN 3HRGA 3E9LA 4CBXA 4BGAA 2VWBA 1HKCA 1GLEG 1U2VB 1NGDA 2NRHA 5AZJA 3WQUA 3CETA 3O9TA 2HBMA 3VEOA 3FZLA 3CMEN 2NZTA 3F5TA 4MLEA 3CC2N 4JK7A 5M1NA 3MCAB 4I6MB 3WT0A 2H3GX 1GLDG 4JK9A 4EFHA 1M1KO 1TUYA 2D0PA 2D1KA 4JKGB 5C2FA 3FE1A 2IVPA 2GX9A 5FPEA 5AQTA 1RFQA 4LC9B 2E1YA 4CZMA 1K8KA 1BUPA 3KK7A 5KPRA 4Y0WA 3CJAA 3S41A 5BR9A 3ENBA 2A3ZA 3M3ZA 5KPZA 2Q0UA 1VQPN 3E9PA 4J8FA 3CJCA 4DKWA 2NRRA 5I9EB 1NMDA 4FO0A 4HWIA 3RSEA 2RE2A 4BR4A 2E8AA 3BEXA 4BRPA 3PLAA 4JKEA 1JCGA 4FOIA 3VF2A 4FWPA 3CXCM 4BR0A 4XJXA 1O13A 1Z6RA 1JJ2M 4IJAA 4M63C 1E4GT 4U7BA 1NGGA 3L4QA 4CZEA 3KVGA 3CJ7A 3Q7CA 5AZIA 3M5RA 1S22A 3NVMA 5KQ8A 3VERA 4Z94A 5F2RA 4GV6A 1BG3A 3HOSA 3R3LA 1VQMN 3UB5A 3SMSA 1KAYA 4YOTA 3ZETA 4CBWA 3CJ9A 4BE7B 5ELZA 1HUXA 3BP8A 3U4LA 5B8HA 1SQKA 3DJCA 4QS7A 4WFBL 2YI1A 3OBYA 4B1YB 1NBWA 2QWPA 5GAEP 3CD6N 4JKGA 5C15A 1YAGA 1S72N 5AQHA 1HKGA 3GL1A 1NGHA 2QWRA 3DXKB 5E84A 1NGEA 4CZHA 2P9KB 1WOQA 1YVNA 4A57A 3P38A 4H03B 5M1QA 3Q7BA 4BRLA 3QMLA 1K8AO 3CCUN 1U6ZA 2P9NA 2P9PA 2YJEA 2FSNA 3WXKA 2RHKA 3MWPA 4MDAA 4FVUA 1X3MA 4DHYA 5GAGP 3P39A 3UKUB 3CQXA 3EKUA 5AQIA 3K9KA 1MDUB 4EHTA 2ASOA 5AZIB 3U9ZA 4BRIA 1Q86O 1VQ5N 1VQON 4MO5A 1VQ9N 2WUSA 4O8KA 3R6MA 5AQLA 3BF1A 4ISFA 4JN4A 3VGMA 4BRGA 1ZBSA 1W2BM 4YOYA 3ULEB 3VGLA 4BG8A 2WBNA 4GNIA 4BVOA 4IO9L 4JAXA 4KH4A 3I33A 3ZX3A 3I8BA 4ILHA 2QA4N 2V7ZA 2ZGZA 4K41A 2OTLN 2I7NA 1JCFA 3A5MC 3OBWA 3VPZA 1U2VA 4K42A 4FL9A 4UY8O 4JD2A 4H0PA 1G99A 3D2FB 4WQ4A 3IMXA 4WQ5C 3VOVA 4BREA 2FSKA 3G25A 3QFPA 1KC8O 1TUUA 2JWKA 3VMFB 3I56N 4F9OA 5TKYA 3SK3A 2ZGYA 3ZEUA 2ZWHA 3C0BA 3O1BA 3C7NB 4ILJA 1Z05A 2Q31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q97 A;  3VF4 A;  3M1F A;  1T6C A;  3HTV A;  5AQJ A;  4EAH D;  3MCP A;  4H5W A;  5ADX H;  3AAP A;  5LY3 A;  3O80 A;  3O5B A;  1QZ5 A;  5AQU A;  2E20 A;  1ZXO A;  5AQN A;  3GDQ A;  2KHO A;  4PKI A;  3GE1 A;  4WQ5 A;  3D7E O;  5EOY A;  3VEZ A;  4CZI A;  3JXU A;  3JS6 A;  2AA4 A;  3MN6 A;  4XH4 A;  1SAZ A;  4BRO A;  4CI6 A;  4BR2 A;  3VEV A;  3WXJ A;  2YHX A;  3VET A;  3DXM A;  3D2F A;  5JMV A;  5LJV A;  1EQY A;  4PKG A;  5EXW A;  3DAW A;  4IWV A;  4CD1 A;  4K43 A;  3H46 O;  3VEY A;  4NO7 A;  2F9W A;  1GLC G;  3U8X A;  3W0L A;  4IJN A;  2DPN A;  3O8M A;  5AQQ A;  2IIR A;  3A5N C;  3FGU A;  2Q0R A;  3ULE A;  1MWM A;  1NGB A;  2F9T A;  4H0T B;  4AM7 A;  4CZK A;  3WEE A;  3ZX2 A;  5E26 A;  2QWN A;  4I6M A;  3H1Q A;  1S3X A;  5EX5 A;  5AZJ B;  5BPM A;  2GTD A;  4A61 A;  4K25 A;  1NGA A;  3WEE B;  3TU5 A;  2CH5 A;  1ATR A;  3ATV A;  4BRQ A;  1QQN A;  4ISG A;  4JHD A;  4H5R A;  2IVO A;  2YHY A;  4YDU A;  4FOE A;  4BRN A;  1QQO A;  2P9U A;  3IUC A;  3FZH A;  3IFR A;  1GLF O;  3C7N A;  2UYT A;  2V7Y A;  3DXK A;  4BG9 A;  2HF3 A;  4RWT A;  3MN9 A;  1BU6 O;  3DXM B;  3GBT A;  5F0X A;  1TYQ B;  1IJJ A;  3MK6 A;  3CIP A;  2GWK A;  4HTL A;  1BO5 O;  5AFU A;  1NGF A;  1H1V A;  3VEN A;  3L6Q A;  3H45 C;  3QIC A;  4WQ4 C;  4H5V A;  5AQM A;  4DB3 A;  3FR0 A;  2YJF A;  3EL2 A;  3UKU A;  3MN7 A;  3HM8 A;  3ZX0 A;  3BUZ B;  2Q1N A;  4XEI A;  4BVP A;  5AQZ A;  3MDQ A;  4FWN A;  1LOT B;  3A5L C;  4BRF A;  1P8Z A;  3GG4 A;  1C0G A;  3LDQ A;  2QXL A;  1BDG A;  3WXL A;  1GLJ O;  4BRA A;  2Q2R A;  2P9L A;  3MN5 A;  4BRC A;  3LDO A;  4BQZ A;  4PL8 A;  4DCH A;  5BN8 A;  3QBX A;  4BRH A;  3VF6 A;  4IZ9 A;  2GEM A;  5BPL A;  3FZK A;  2HF4 A;  2OAN A;  5AQP A;  3AAQ A;  3U9D A;  4XH1 A;  2ZF5 O;  3H6E A;  2EWS A;  4B1Z A;  1XUP O;  4BRK A;  3H3N O;  2PBD A;  2A41 A;  2CGJ A;  3EKS A;  5BPN A;  1RGI A;  1MWK A;  4FWM A;  1HJO A;  2HOE A;  1QHA A;  4A62 A;  2CH6 A;  2E1Z A;  4NB4 A;  5CE3 A;  3EZW A;  2E2P A;  4BRM A;  4B1X B;  3LDL A;  1V4T A;  1R59 O;  2FLO A;  2FXU A;  5AQG A;  1HX1 A;  3HBT A;  5BN9 A;  5AR0 A;  4CZL A;  3SJH A;  3LM9 A;  1V4S A;  3A0I X;  4H0Y B;  3ENO A;  4M7Y A;  5FPD A;  4FWL A;  2A40 A;  4FPB A;  2P9L B;  3UKR B;  1DKG D;  2E2N A;  3LL3 A;  4H5T A;  4M7X A;  2D0O A;  2GEL A;  4XH5 A;  3KZB A;  4BGB A;  4FWS A;  3BF3 A;  1Q18 A;  1DEJ A;  1ZC6 A;  2YCH A;  1RDW X;  2ASP A;  4BC3 A;  1HPM A;  3WUH A;  3LM2 A;  5BRH A;  4JD2 B;  3KHY A;  3CI5 A;  3ENH A;  4QS8 A;  3A8Y A;  3FFK B;  1X9J A;  1KAZ A;  5KPT A;  4L3Q A;  3R8E A;  3SMP A;  4KBO A;  3LDN A;  1QZ6 A;  1NGJ A;  5AQF A;  5KQD A;  2E2O A;  4BQL A;  4BRD A;  2CGL A;  1T6D A;  2VCP A;  2W41 A;  3HSC A;  3VEW A;  3J8A A;  3LDP A;  3AY9 A;  3QDK A;  3O1W A;  1HKB A;  3P4I A;  2ASM A;  5AQO A;  3UE5 A;  4H0X B;  1NGC A;  3L4I A;  3RSE B;  3DWL A;  3O08 A;  1Y64 A;  4H5N A;  2A5X A;  5BRD A;  3WQT A;  1ATN A;  3FZF A;  4CZG A;  2J4R A;  3D2E B;  2E2Q A;  4PKH A;  2ITM A;  3EO3 A;  1ATS A;  1BOT O;  5FPM A;  4B1V A;  3SLC A;  3O6W A;  2E88 A;  1GLB G;  1BA0 A;  4H0O A;  2I7P A;  1XC3 A;  5AQR A;  4BC2 A;  1LCU A;  2QW9 A;  3FZM A;  1HLU A;  4RCH A;  2Q31 A;  5LJW A;  3FLC O;  2YHW A;  3D2E A;  4FPA A;  2QWM A;  4BR7 A;  3ZET B;  4FWO A;  4PL7 A;  2Q36 A;  4GY2 B;  5AQW A;  2P9I A;  3GOI A;  1DGK N;  4CD3 A;  3IDH A;  4E1J A;  2VYP A;  2V51 B;  4QS9 A;  2BTF A;  2P9S B;  1OKJ A;  2AP1 A;  4EIA A;  1IG8 A;  5AQV A;  1KAX A;  2CGK A;  3ATU A;  5AQS A;  3CQY A;  2D4W A;  4A2A A;  3HZ6 A;  4CJ7 A;  5AQK A;  1GLL O;  5FPN A;  1T44 A;  2A42 A;  3CHW A;  5JLF A;  2GWJ A;  4BC5 A;  4MLH A;  4BR5 A;  3CJB A;  1YXQ A;  2P9N B;  2QWO A;  2NLX A;  5JIC A;  3M6G A;  4BC4 A;  3H1V X;  3MMV A;  2A6A A;  3QFU A;  4DQ8 A;  1JCE A;  1KXP A;  3B8A X;  1K8K B;  4CZJ A;  1XQS C;  3AAR A;  4JNE A;  4FWR A;  3OHR A;  4FWQ A;  1WUA A;  4B9Q A;  3R9P A;  3A5O C;  3F9M A;  4A2B A;  2PAV A;  3ID8 A;  1E4F T;  4B1W B;  2GUP A;  5EY4 A;  1QQM A;  1X3N A;  2V52 B;  3WXI A;  3VES A;  2BUP A;  3H3O B;  1BA1 A;  4C23 A;  3VEX A;  3VGK A;  2QM1 A;  5EVZ A;  3CJ1 A;  3TPQ A;  1MA9 B;  4CZF A;  2QWL A;  3UKR A;  1NGI A;  3W3D A;  3QB0 A;  2FF6 A;  1GLA G;  4EHU A;  1NLV A;  5JLH A;  1ESV A;  2FSJ A;  1BWF O;  4YDU C;  5AQY A;  1C0F A;  3CER A;  1J6Z A;  4BR9 A;  4MO4 A;  4CBU A;  4IXC A;  1NM1 A;  2P9U B;  1CZA N;  5BRE A;  4IO8 A;  4ISE A;  4RTF D;  3L0Q A;  2P9I B;  5AQX A;  2QWQ A;  1NWK A;  3O4W A;  2P9S A;  2FF3 B;  4H0V B;  4FSV A;  5AFU H;  3HI0 A;  2W40 A;  2P9P B;  5F1X A;  4B1U B;  1TYQ A;  3QBW A;  4FWK A;  4WYB A;  4JHD B;  2P9K A;  1SZ2 A;  3ZEU B;  3EN9 A;  5BRF A;  1YUW A;  2IVN A;  2HMP A;  1D4X A;  4O5F A;  4AM6 A;  5ADX A;  4CBX A;  4BGA A;  2VWB A;  1HKC A;  1GLE G;  1U2V B;  1NGD A;  2NRH A;  5AZJ A;  3WQU A;  3CET A;  3VEO A;  3FZL A;  2NZT A;  4MLE A;  4I6M B;  3WT0 A;  4EFH A;  2H3G X;  1GLD G;  1TUY A;  2D0P A;  2D1K A;  2IVP A;  5FPE A;  5AQT A;  1RFQ A;  4LC9 B;  2E1Y A;  4CZM A;  1K8K A;  1BUP A;  5KPR A;  4Y0W A;  3CJA A;  3S41 A;  5BR9 A;  2A3Z A;  3M3Z A;  5KPZ A;  2Q0U A;  4J8F A;  3CJC A;  5I9E B;  1NMD A;  4FO0 A;  4HWI A;  3RSE A;  4BR4 A;  4BRP A;  2E8A A;  3BEX A;  1JCG A;  4FOI A;  3VF2 A;  4FWP A;  4BR0 A;  1Z6R A;  4IJA A;  4M63 C;  1E4G T;  1NGG A;  4CZE A;  3KVG A;  3CJ7 A;  5AZI A;  5KQ8 A;  1S22 A;  3VER A;  4Z94 A;  5F2R A;  1BG3 A;  3UB5 A;  3SMS A;  1KAY A;  3ZET A;  4CBW A;  3CJ9 A;  5ELZ A;  1HUX A;  3BP8 A;  3U4L A;  5B8H A;  1SQK A;  3DJC A;  4QS7 A;  2YI1 A;  4B1Y B;  1NBW A;  2QWP A;  1YAG A;  5AQH A;  1HKG A;  3GL1 A;  1NGH A;  2QWR A;  3DXK B;  5E84 A;  1NGE A;  4CZH A;  2P9K B;  1WOQ A;  1YVN A;  4H03 B;  4BRL A;  3QML A;  1U6Z A;  2P9N A;  2P9P A;  2YJE A;  2FSN A;  3WXK A;  1X3M A;  4DHY A;  3UKU B;  3CQX A;  3EKU A;  5AQI A;  4EHT A;  1MDU B;  2ASO A;  5AZI B;  3U9Z A;  4BRI A;  4MO5 A;  2WUS A;  4O8K A;  3R6M A;  5AQL A;  3BF1 A;  4ISF A;  4JN4 A;  3VGM A;  4BRG A;  1ZBS A;  3ULE B;  3VGL A;  4BG8 A;  4GNI A;  4BVO A;  4JAX A;  3I33 A;  3ZX3 A;  3I8B A;  2V7Z A;  2ZGZ A;  4K41 A;  2I7N A;  1JCF A;  3A5M C;  3VPZ A;  1U2V A;  4K42 A;  4FL9 A;  4JD2 A;  4H0P A;  1G99 A;  3D2F B;  4WQ4 A;  3IMX A;  4WQ5 C;  3VOV A;  4BRE A;  2FSK A;  3G25 A;  3QFP A;  1TUU A;  4F9O A;  5TKY A;  3SK3 A;  2ZGY A;  3ZEU A;  2ZWH A;  3C0B A;  3O1B A;  3C7N B;  1Z05 A;  3FE1 A; 
#chains in the Genus database with same CATH topology
 4H5W A;  3O80 A;  1QZ5 A;  3VQB A;  1Z26 A;  1W0H A;  4WQ5 A;  3D7E O;  2W6K A;  4CZI A;  3NFA A;  4DR5 K;  1NU0 A;  2UUC K;  5HRP A;  3RMA A;  4FLW A;  4QAG A;  3OS0 A;  4BR2 A;  2W00 A;  3G71 N;  2G8U A;  1IKV A;  2YKM A;  3AVM A;  4FK4 A;  3DAW A;  3JYT A;  3VEY A;  1TK8 A;  2IOC A;  4A5A A;  3LWM A;  4FLT A;  3FGU A;  1RDC A;  1IG9 A;  3E01 A;  4HUG A;  4L8R B;  2F9T A;  1BIU A;  1JXB A;  3SZ2 A;  4KB0 A;  3THW B;  3VTI A;  3EEQ A;  5AZJ B;  3OY9 A;  2GTD A;  3P31 A;  4A61 A;  3ULD A;  4LF7 K;  3TU5 A;  4CEF A;  4DU4 A;  4X62 K;  4WF9 L;  4BRQ A;  2PZS A;  1VSM A;  1FXX A;  4W5T A;  4HCB A;  3K5M A;  2YHY A;  4FOE A;  2X78 A;  4CHQ A;  3PV8 A;  1GLF O;  3C7N A;  4RG8 A;  4CIF A;  2UYT A;  3DXK A;  3MN9 A;  3GBT A;  5F0X A;  4OVL A;  2HND A;  1TYQ B;  3MK6 A;  2LSN A;  1C0M A;  3HL8 A;  2GWK A;  4M45 A;  3PY8 A;  1H1V A;  4CF2 A;  4C8O A;  1P90 A;  3QIC A;  4H5V A;  5AQM A;  3PUF A;  2YJF A;  4DR6 K;  3EL2 A;  1TVR A;  3ZX0 A;  3BUZ B;  1X1P A;  1N8R O;  4KB1 A;  3I0S A;  4XEI A;  4BVP A;  3SAH A;  3CC7 N;  4H4M A;  4FWN A;  1WLJ A;  3SPZ A;  4KI4 A;  2EHG A;  2XO7 A;  2YNI A;  4YNQ A;  3LDQ A;  2HHW A;  4B9M A;  1GLJ O;  3U3G A;  4OPH A;  3V9U A;  3TI0 A;  2BDP A;  3MN5 A;  2DFF A;  1OH6 A;  4DCH A;  1TK0 A;  4KH5 A;  4AF1 A;  1ZBU A;  1S1W A;  4NXM K;  3MXI A;  2GEM A;  1WBD A;  3CCV N;  2OTJ N;  4C8L A;  4CJ5 A;  4C1N I;  4CHO A;  4B1Z A;  4MDB A;  1XUP O;  2PBD A;  2Z1J A;  3WNG A;  2CGJ A;  3EY1 A;  3T1A A;  5BPN A;  1ASW A;  3C6H A;  3V1O A;  4BY9 C;  3ZSO A;  3RVC A;  2B4J A;  3ZT0 A;  5LL6 Z;  2BAN A;  3HPO A;  1VSJ A;  3D6R A;  4E7H A;  2F4V K;  4H4O A;  5C12 A;  3OJS A;  3LDL A;  3L3U A;  2FXU A;  1ILY A;  1HX1 A;  5KI6 A;  4GW6 A;  4CZL A;  1VQ4 N;  3IKM A;  4CIG A;  5FPD A;  5FRN A;  2ZJQ L;  2GUI A;  3HM9 A;  2E2N A;  3QIO A;  3LL3 A;  3CCQ N;  3KZB A;  4FWS A;  5FDL A;  3DLL L;  1KQS M;  2YCH A;  2ASP A;  4B9S A;  3KHY A;  3A8Y A;  1KVB A;  5JVG L;  4DV2 K;  2F8S A;  1VQN N;  1JLA A;  1TL1 A;  5IWA K;  5KPT A;  3R8E A;  3SMP A;  4DLE A;  4FZY A;  3LDN A;  1RT4 A;  4JEP A;  3H08 A;  2G8V A;  1C0U A;  4NCB A;  1BGX T;  5C10 A;  3O9R A;  2VGM A;  3J8A A;  3CCM N;  3O1W A;  1HKB A;  3UE5 A;  4DQP A;  5JS2 A;  3RSE B;  3DWL A;  4IEE A;  3O08 A;  1TV6 A;  3WQT A;  1D9F A;  2YNF A;  2Z1H A;  2G8K A;  4PKH A;  2ITM A;  1X9S A;  2Q3S A;  3TTD A;  3THY B;  1VQ6 N;  3AGR A;  3SLC A;  4AH9 A;  3O6W A;  2VG6 A;  3TSU A;  4H0O A;  1LCU A;  1SS6 A;  3FZM A;  3U6F A;  4DR7 K;  5LJW A;  1JL2 A;  3D2E A;  4DFM A;  3DLG A;  3ZET B;  4FWO A;  3AO5 A;  4GY2 B;  5AQW A;  3VQP A;  3ZCM A;  1DGK N;  4CVN E;  4CHZ A;  1OKJ A;  5M1N A;  2CGK A;  1ZBI A;  1L3V A;  1WSI A;  4A2A A;  1F21 A;  4CJ7 A;  1L3S A;  1CLQ A;  4DU3 A;  4C8K A;  4GKJ K;  3G6E N;  1WSF A;  3PX0 A;  2XHB A;  4DV1 K;  1Q7Y O;  1WSJ A;  3ITH A;  2NLX A;  3VQE A;  4KHW A;  4YOU A;  1NK4 A;  2VG7 A;  4XIU A;  1UAX A;  5FRM A;  5E41 A;  3WXM B;  1KXP A;  3B8A X;  1S1U A;  3OHR A;  4FWR A;  4FWQ A;  4ID1 A;  4ELV A;  4EZ6 A;  3F9M A;  3NGI A;  2PAV A;  3VQ6 A;  4B9N A;  5J2P A;  1QQM A;  1X3N A;  1C0T A;  1YTU A;  3CCR N;  4M3W A;  3V6D A;  2BUP A;  3H3O B;  3LAN A;  4FXD A;  2NRT A;  3VGK A;  1XWL A;  1CZ9 A;  2HST A;  4M3U A;  1IKX A;  4BDY A;  4FM1 A;  4KPY A;  1NLV A;  4DTP A;  4ELU A;  1ESV A;  1Q82 O;  4YDU C;  4E0D A;  1RBT A;  1VSH A;  3N4P A;  1HRH A;  4FCY A;  4DU1 A;  1NJW A;  4CEC A;  4IXC A;  1NM1 A;  3KLG A;  4DTR A;  4RTF D;  3L0Q A;  4IOX A;  4FLV A;  2FC0 A;  3O4W A;  1RTD A;  4B1U B;  1KRP A;  2OPP A;  3V9X A;  4JHD B;  2ZE2 A;  3TAP A;  3EN9 A;  2ZJP L;  4JRQ A;  2IVN A;  1YVU A;  1WAJ A;  3TTC A;  4O5F A;  4AM6 A;  5KGX A;  5DK5 A;  1HNV A;  3M8R A;  1U2V B;  1NKE A;  1B9F A;  5AZJ A;  5JEN A;  3O9T A;  2HBM A;  5JS1 A;  3CME N;  4MLE A;  3MCA B;  4I6M B;  4EFH A;  2H3G X;  4JK9 A;  3HVR A;  4DSI A;  2IVP A;  4B8C A;  2GX9 A;  5FPE A;  4FW1 A;  3L3V A;  2UUA K;  4Y0W A;  3QEP A;  3CJA A;  5DMR A;  1UA0 A;  3KD1 E;  2Q0U A;  1EX4 A;  3CJC A;  1HJR A;  2NRR A;  2HW3 A;  4HWI A;  4BR4 A;  5I3U A;  4JKE A;  4FOI A;  4KHQ A;  3HK2 A;  2IDO A;  4FWP A;  1JJ2 M;  3OVN A;  3V1R A;  4M63 C;  1XC9 A;  4U7B A;  1NGG A;  3SUQ A;  1KFS A;  3KVG A;  3M5R A;  4LSL A;  3NVM A;  5KGW A;  1BG3 A;  3MAQ A;  1VQM N;  3R3L A;  3UB5 A;  4CBW A;  4YOT A;  1IO2 A;  4BE7 B;  1VRU A;  1D5A A;  4RW7 A;  3U4L A;  5B8H A;  2ITG A;  4OPJ A;  1HQE A;  4JKG A;  3DOL A;  5CY4 A;  4YY3 K;  2P9K B;  1YVN A;  4JI7 K;  3P38 A;  1WSH A;  4OKJ A;  4CHY A;  4DSK A;  4JRP A;  2FBY A;  4BRL A;  2HHU A;  1S6Q A;  2HNZ A;  4OGE A;  1SUQ A;  1IBK K;  2P9N A;  3AVI A;  3WXK A;  1WNS A;  4MDA A;  4FVU A;  1XHX A;  1QSS A;  1TKT A;  4DHY A;  4BE0 A;  5AQI A;  1Q86 O;  1KLN A;  1VQ5 N;  4DTM A;  4FJ5 A;  5AQL A;  3BF1 A;  3VGM A;  4BRG A;  3KTQ A;  1W2B M;  4X64 K;  3ULE B;  2ZD1 A;  4ILH A;  2V7Z A;  2OTL N;  1JCF A;  3OBW A;  3VPZ A;  3J7A P;  4JV5 K;  3IMX A;  1NJY A;  2FSK A;  3G25 A;  3VMF B;  1JLF A;  3SK3 A;  3I0R A;  3LP1 A;  3AVA A;  1GLD G;  3THY A;  3FE1 A;  4Z4G A;  2Q97 A;  1RT1 A;  3HTV A;  4EAH D;  3HT3 A;  3MCP A;  5ADX H;  1T7P A;  4WFN L;  1NJI O;  1BL3 A;  1EET A;  4CES A;  5AQU A;  4DTN A;  2KFN A;  3DYA A;  4PKI A;  3OYD A;  2O8F B;  5EOY A;  1SL0 A;  3AGK A;  3JS6 A;  3MN6 A;  4DMN A;  4RW8 A;  3OA9 A;  1WN7 A;  4FJL A;  3HP6 A;  4BDP A;  4FJK A;  3VET A;  3O9Q A;  3RTV A;  3O9U A;  1IH7 A;  3W0L A;  3O3G A;  4IJN A;  2DPN A;  3TR8 A;  2VWK A;  3ULE A;  4AM7 A;  1NGB A;  5E26 A;  3J7Y P;  5C0Y A;  3U3Y A;  3D0P A;  1EKE A;  1FW6 A;  5EX5 A;  4IKF A;  4E19 A;  1HYV A;  4CK1 A;  5DM7 L;  3RWU A;  3THW A;  4O55 A;  4JHD A;  4A59 A;  3OYG A;  2IVO A;  1GOC A;  4V19 S;  4BRN A;  2P9U A;  4CE9 A;  3SV3 A;  3KLI A;  1K9M O;  5GAH P;  1SV5 A;  4RWT A;  4LF4 K;  1YT3 A;  4H8K A;  3DXM B;  3RMD A;  3NH1 A;  1IJJ A;  1BI4 B;  2PYL A;  2O8B B;  2B5J A;  1RBV A;  4CGI A;  2WON A;  3NH2 A;  3LP3 A;  4JI8 K;  3VEN A;  3L6Q A;  5AJ3 K;  1CZB A;  4WQ4 C;  1REV A;  1XMQ K;  4DB3 A;  3ZT4 A;  1SKS A;  3THX A;  3UKU A;  4FJX A;  1JLG A;  1NMN A;  2R7Y A;  4HUE A;  2YHB A;  4IDH A;  5HL7 L;  4KTQ A;  3OYL A;  2C1I A;  3A5L C;  1WBB A;  3OYJ A;  1HNW K;  1N34 K;  1BDG A;  2KLA A;  4BRA A;  2Q2R A;  1RBR A;  1ZBF A;  3VQQ A;  4YFU A;  1S9G A;  4BRC A;  4BQZ A;  3K5L A;  3T1Y K;  5BN8 A;  3LP2 A;  3TAF A;  4LF6 K;  4CEQ A;  1HNI A;  4NCA A;  4CF8 A;  4IEI A;  3HP9 A;  4KRF A;  3BY5 A;  3SNN A;  4QCL A;  3AVC A;  3NDK A;  3SPY A;  4DR2 K;  3NMU A;  3CF5 L;  2A41 A;  1RGI A;  1RDU A;  1O1W A;  1N33 K;  2O8D A;  2HOE A;  4A62 A;  3AVN A;  2ATQ A;  4NB4 A;  3QEX A;  4N56 A;  4BRM A;  4K8Z A;  4CHP A;  1KVA A;  1R59 O;  4DF4 A;  1ITG A;  5AQG A;  1NKB A;  3HBT A;  5AR0 A;  2NNW A;  4W5N A;  1V4S A;  3A0I X;  3HST B;  1RIL A;  4H0Y B;  1XHZ A;  3ENO A;  4M7Y A;  2BE2 A;  4GVM A;  4FWL A;  4FPB A;  2P9L B;  3K57 A;  4HUF A;  4H5T A;  5SWM A;  1VQK N;  3L8B A;  1Q18 A;  1DEJ A;  4K8X A;  4FLZ A;  3MED A;  5BRH A;  3ENH A;  4QS8 A;  4KRE A;  3FFK B;  1X9J A;  4Z0U A;  4GVE A;  3C95 A;  1S1X A;  3EE9 A;  1QZ6 A;  1NGJ A;  3LAM A;  4E3S A;  5KQD A;  4BQL A;  1JLE A;  1T6D A;  3EZ5 A;  4CGG A;  1YJN N;  4J2D A;  2VGN A;  3SQ4 A;  3QDK A;  3AY9 A;  3P4I A;  4DFP A;  4DWI A;  4DTO A;  1QVF M;  4H0X B;  4LFC K;  1OVY A;  1Y97 A;  4FK2 A;  3O4N A;  4KHU A;  3LPU A;  3FZF A;  4CZG A;  4I2Q A;  4EP5 A;  1ATS A;  4B1V A;  3K0S A;  3DRP A;  3K2P A;  4DSJ A;  2E88 A;  1GLB G;  1ASU A;  4JI0 K;  4PQU A;  1L5U A;  4F3O A;  1Q9Y A;  1HLU A;  1TAQ A;  1VSL A;  2QI2 A;  3ZLJ A;  2YHW A;  1RT3 A;  2YX6 A;  4FPA A;  4BR7 A;  1QVG M;  2QKB A;  3AO1 A;  4PL7 A;  4ELT A;  3TAG A;  2Q36 A;  3RRH A;  2P9I A;  3GOI A;  4NXN K;  4LF8 K;  2VYP A;  3DRR A;  2P9S B;  4EIA A;  3SAG A;  5AQS A;  5FRO A;  3QNO A;  3HZ6 A;  4CF9 A;  3CHW A;  4AHT A;  1RDB A;  5M1O A;  4BC5 A;  1I3A A;  4CFA A;  1N5Y A;  1HQU A;  1NOY A;  5JIC A;  3M6G A;  3ALY A;  3WNF A;  3CCL N;  3IS9 A;  3QFU A;  4DQ8 A;  3MX5 A;  3AAR A;  4E89 A;  1WUA A;  3A5O C;  4FLX A;  4GMJ B;  4A2B A;  4B1W B;  1E4F T;  1S6P A;  3AVH A;  5EY4 A;  3C6A A;  3VTH A;  4CJK A;  2E6M A;  1B9D A;  3DLR A;  3KK3 A;  4B3M K;  2KFZ A;  4JS4 A;  3AVF A;  2VQE K;  1NKC A;  2OYQ A;  4FJ9 A;  4C23 A;  3VEX A;  2C1G A;  2QM1 A;  3CCS N;  4I2P A;  5EVZ A;  2HBL A;  3CJ1 A;  3TPQ A;  4CZF A;  1TL3 A;  2QWL A;  4C1N K;  4Q5V A;  1JL1 A;  3W3D A;  5M1K A;  3SQ0 A;  1GLA G;  4EHU A;  3KK2 A;  2HHX A;  3CER A;  4E7I A;  1J6Z A;  4MO4 A;  2RF2 A;  1LAW A;  1A5V A;  1CXQ A;  4JKA A;  2UUB K;  2P9U B;  1VSF A;  4IO8 A;  2Y1I A;  2O8F A;  1S1V A;  2YHA A;  4H0V B;  5AFU H;  3HI0 A;  2QEX N;  4KHP K;  3ZYY X;  4CJV A;  2IAJ A;  1TYQ A;  3QBW A;  3LWL A;  5J1E A;  2D0B A;  1W7A A;  1OH8 A;  2AJQ A;  1S5J A;  1SL2 A;  4AQY K;  2P51 A;  5BRF A;  3AO2 A;  1D4X A;  5CR4 A;  1YIT N;  3L2R A;  1UOC A;  1HKC A;  4CED A;  1GLE G;  1VSE A;  3HJF A;  3ZT3 A;  4M3Y A;  1J5O A;  3FZL A;  3OYI A;  3WT0 A;  2YNH A;  4LH4 A;  3F9K A;  1TUY A;  2D0P A;  1C1A A;  1RT2 A;  5A2Q O;  4JKG B;  1QSY A;  2DTU A;  4CFD A;  4DF8 A;  4LC9 B;  2E1Y A;  4R5P A;  3KK7 A;  5KPR A;  3CM5 A;  4HCC A;  2BGG A;  4E72 A;  3S41 A;  5BR9 A;  3VN5 A;  1VQP N;  4B8A B;  1JKH A;  5I9E B;  2RE2 A;  3PLA A;  3BEX A;  1U47 A;  3L2W A;  3VF2 A;  4FM2 A;  4BR0 A;  1Z6R A;  4J2A A;  4NCG A;  2JLE A;  2OPS A;  4ID5 A;  1S22 A;  1IKW A;  4Z94 A;  3PSF A;  2F96 A;  2G8F A;  3CJ9 A;  2XRI A;  3WNH A;  4CEE A;  5ELZ A;  1HUX A;  4KFB A;  3DJC A;  3VQD A;  4WFB L;  2IGI A;  4B1Y B;  2QWP A;  3OYC A;  4DSF A;  1S72 N;  1HKG A;  4JLH A;  1ZBH A;  1SKW A;  1NGE A;  3MXJ A;  2ZM6 K;  3RRG A;  3Q7B A;  2GBZ A;  4CJU A;  1RTJ A;  3CFR A;  1VSI A;  2P9P A;  2RHK A;  3MWP A;  3SYZ A;  2O8E A;  2OA8 A;  3CQX A;  5AZI B;  4BRI A;  3U9Z A;  4CJT A;  4MO5 A;  3HXM A;  2WUS A;  4O8K A;  4HTU A;  4ISF A;  3LP0 A;  3DOK A;  3V9S A;  1JLC A;  3O4Q A;  4BG8 A;  2WBN A;  4BVO A;  1RBS A;  4JAX A;  4KH4 A;  3I33 A;  3I8B A;  4K41 A;  2I7N A;  4K42 A;  4FL9 A;  4IG3 A;  2XY7 A;  4J2E A;  4O0J A;  1FKP A;  2PYJ A;  3AV9 A;  3RR8 A;  3VOV A;  2HHI A;  3DRS A;  4FK0 A;  2DY4 A;  2ZGY A;  4ILJ A;  1Z05 A;  3R6M A;  1G15 A;  3G10 A;  5HRS A;  4DS4 A;  1J54 A;  1T6C A;  5AQJ A;  3AA2 A;  3AVL A;  4Z4H A;  2FBT A;  3ZSQ A;  3AAP A;  5LY3 A;  4KO0 A;  2F8T A;  3O5B A;  4B08 A;  3SBT A;  3S3N A;  3GDQ A;  2KHO A;  1VK0 A;  4JKD A;  3PO4 A;  3GE1 A;  2E6L A;  3JAM O;  4UQG A;  4XH4 A;  3G4S N;  5JVH L;  1N36 K;  2NRV A;  4IOC L;  3VEV A;  3DXM A;  3D2F A;  5JMV A;  5LJV A;  1EQY A;  3OYE A;  2WOM A;  1BI4 A;  5EXW A;  2OZS A;  1RDD A;  3PSI A;  4CD1 A;  2KKZ A;  3H46 O;  4JK8 A;  3QEV A;  4NO7 A;  4DS5 A;  4ICL A;  2F9W A;  1GLC G;  4IDK A;  3U8X A;  2O8C B;  5AQQ A;  3AO4 A;  2IIR A;  3A5N C;  3LPT A;  5LMU K;  3TSQ A;  3WEE A;  5C24 A;  2NRW A;  4Z4E A;  3V9Z A;  5KRS A;  3THX B;  4K25 A;  3NGY A;  1NGA A;  2D0A A;  5J2M A;  2CH5 A;  1ATR A;  3I8D A;  3ATV A;  3F2K A;  4B3S K;  2KTQ A;  3SI6 A;  4H5R A;  2RN2 A;  4KHS A;  3V9W A;  4YDU A;  3T3F A;  1QQO A;  4CJE A;  3FZH A;  3IFR A;  3ZSY A;  2V7Y A;  4BG9 A;  2HF3 A;  3HO1 A;  1XI1 A;  4HHT A;  3SCX A;  4LF9 K;  3CIP A;  2UXB K;  3ZSR A;  3C65 A;  5LMN K;  4CJR A;  2KZM A;  1BO5 O;  1NGF A;  3SAF A;  3I55 N;  4DTS A;  5MLC Q;  3H45 C;  4JKF A;  2WTU A;  3VQC A;  3AA5 X;  1HPZ A;  4E1M A;  2Z1I A;  4DR3 K;  3HM8 A;  4BE2 A;  3KJV A;  2DFE A;  2Q1N A;  4RW9 A;  4JI3 K;  5AQZ A;  4LFB K;  5HBM A;  4YHH K;  1OVQ A;  3C6U A;  2OPR A;  5J2N A;  4BRF A;  1BQM A;  4OX9 K;  3GG4 A;  4CJ3 A;  5GAD P;  4JI1 K;  2P9L A;  1OH7 A;  3THV A;  3LDO A;  3T69 A;  3P83 D;  1EXQ A;  1GOB A;  1K6Y A;  4B3O A;  1JLQ A;  3ZSZ A;  4DV4 K;  2G8W A;  3VF6 A;  4IZ9 A;  5BPL A;  2RKI A;  1YF5 L;  3FZK A;  2OAN A;  5AQP A;  3TAQ A;  3U9D A;  2ZF5 O;  3H6E A;  3V1Q A;  2EWS A;  4OPA A;  3CCJ N;  3H3N O;  3QO9 A;  2QK9 A;  4NLB A;  3CG7 A;  4YOR A;  3PO5 A;  1MWK A;  4FWM A;  4CJ4 A;  4O0I A;  5HRO A;  1HJO A;  1RTI A;  1VQL N;  1LAV A;  3J80 O;  4F3T A;  1QHA A;  1WAF A;  5GIP A;  3VQA A;  4BEB A;  2IC3 A;  3P1G A;  4I7F A;  4J2B A;  2E2P A;  4CGH A;  1V4T A;  4JKC A;  1HR0 K;  4IG0 A;  5HRR A;  3SJH A;  1NK9 A;  3L2Q A;  2HNY A;  3OYH A;  2A40 A;  4CK2 A;  4FYD A;  3UKR B;  5TKW A;  3OYA A;  4M7X A;  5KTQ A;  4JKB A;  2D0O A;  5GIN A;  1X9W A;  4M3X A;  1VAZ A;  1EWR A;  4BGB A;  2OCE A;  1RDW X;  4CGJ A;  1HPM A;  3LM2 A;  1J53 A;  5C2D A;  1HYS A;  2ETJ A;  3MWT A;  3VQ9 A;  1LWC A;  4F4K A;  4L3Q A;  1NOZ A;  4KBO A;  3RMC A;  1XMO K;  1ASV A;  3O3H A;  2E2O A;  1YHQ N;  1TKX A;  4BRD A;  2VCP A;  2W41 A;  3OYB A;  3VEW A;  4PHT X;  1JLB A;  2ASM A;  4CFC A;  5AQO A;  3L2U A;  1NGC A;  3L4I A;  4H5N A;  4M3R A;  5BRD A;  3NE6 A;  3HVT A;  3KIO A;  4F2R A;  3D2E B;  1S9E A;  5HOO A;  2E2Q A;  1NK7 A;  4KHN A;  3S5T A;  3CC4 N;  3QET A;  1M90 O;  1BA0 A;  4WFA L;  1XC3 A;  4BC2 A;  3S3M A;  1SKR A;  2QW9 A;  1CXU A;  3HOT A;  3FLC O;  2O8C A;  2QWM A;  4JS5 A;  1HNZ K;  4RW6 A;  2W6L A;  1TAU A;  3SJJ A;  3E66 A;  1IG8 A;  5AQV A;  4N41 A;  1KAX A;  4O8U A;  3ATU A;  1QTM A;  4YOX A;  3CFO A;  3T19 A;  1EO1 A;  2P5O A;  1GLL O;  1T44 A;  4OO1 J;  1Q81 O;  3KD5 E;  5JLF A;  2GWJ A;  4BR5 A;  3EYZ A;  3CJB A;  4DR4 K;  1YXQ A;  2P9N B;  2QWO A;  1W9H A;  1RTH A;  1K73 O;  3H1V X;  3MMV A;  1NJZ A;  2A6A A;  4FZZ A;  2HHT A;  3E9O A;  4CZJ A;  1XQS C;  1KTQ A;  2HVI A;  4B9Q A;  2PFU A;  3R9P A;  4DQS A;  3ZSX A;  4AHU A;  3ID8 A;  4DUY K;  3SV4 A;  2O4G A;  2V52 B;  4I9Q A;  3NAE A;  3CYG A;  4N76 A;  1VQ8 N;  3OYN A;  3NHG A;  3DLE A;  2HHQ A;  3SUP A;  3E1Y A;  1NGI A;  5JLH A;  1BWF O;  5AQY A;  1NG9 A;  4PA1 A;  1YJW N;  1VRT A;  3O9S A;  1RT6 A;  4BR9 A;  4N5S A;  2HBJ A;  3BGR A;  4KV8 A;  4LY7 A;  3ID6 A;  1VQ7 N;  1KLM A;  4ISE A;  5AQX A;  2P9I B;  4AIL C;  3K5N A;  2QWQ A;  3VA0 A;  1B92 A;  3T7Z A;  2P9S A;  3BZK A;  2W40 A;  2P9P B;  2X74 A;  4FJH A;  1WSG A;  5C42 A;  1R0A A;  5HLF A;  2I5J A;  2UXC K;  4WYB A;  4C8N A;  4CJQ A;  1BCO A;  1YI2 N;  1SZ2 A;  3ZEU B;  5K14 A;  1QHT A;  1I39 A;  1N32 K;  4MFB A;  1X9M A;  2HMP A;  2HVH A;  3WNE A;  5ADX A;  3TAB A;  4DTU A;  1KSP A;  4DQI A;  1FK9 A;  1IBM K;  3SUO A;  4CBX A;  4BGA A;  2XY6 A;  2VWB A;  1BIZ A;  4G1Q A;  3WQU A;  4JI5 K;  2A1R A;  3VEO A;  3CC2 N;  4OKE A;  1M1K O;  1WSE A;  4B3T K;  4CF1 A;  2HMI A;  3CQ8 A;  3QES A;  1GOA A;  1RT7 A;  1RFQ A;  3DLB A;  1K8K A;  1BUP A;  5HP1 A;  4DQR A;  3ENB A;  2A3Z A;  3M3Z A;  4FJJ A;  3DM2 A;  4J8F A;  4DKW A;  1NNE A;  4W5R A;  4OGC A;  1A5W A;  5EU7 A;  1JCG A;  2O4I A;  4Z4I A;  4IJA A;  4CZE A;  4CEB A;  3CJ7 A;  5AZI A;  3VER A;  2PY5 A;  5F2R A;  4GV6 A;  1KAY A;  3ZET A;  4QOZ B;  4IBN A;  4K0K K;  1SQK A;  4QS7 A;  2VWJ A;  2YI1 A;  3OBY A;  1IBL K;  3M8P A;  5GAE P;  4FJG A;  3CD6 N;  1YAG A;  3VA3 A;  2W42 A;  5AQH A;  1QE1 A;  1NGH A;  1RCH A;  2QWR A;  4JI4 K;  4HVJ A;  3NF6 A;  4A57 A;  4H03 B;  1XNQ K;  5M1Q A;  1NJX A;  1LW0 A;  1K8A O;  1NK8 A;  3CCU N;  4Z4C A;  2YJE A;  2FSN A;  1FJG K;  2E5L K;  1X3M A;  3P39 A;  3EKU A;  4EHT A;  1MDU B;  2ASO A;  3L2V A;  3AVK A;  1ZBS A;  4CJW A;  4YOY A;  1LV5 A;  3ASM A;  3VGL A;  1FKO A;  3KLH A;  2GV9 A;  2X6N A;  3TAM A;  3LAL A;  2HHV A;  2QA4 N;  3QEI A;  4DLG A;  4B3R K;  4KKO A;  2QKK A;  4UY8 O;  2P5G A;  4JD2 A;  4IFY A;  3BDP A;  1A5X A;  3D2F B;  1RT5 A;  4EZ9 A;  3D45 A;  1BHL A;  4JYA K;  1KC8 O;  3QFP A;  3A2F A;  2JWK A;  4O44 A;  3ZEU A;  3C0B A;  3DMJ A;  3VF4 A;  1TK5 A;  4DUZ K;  3LAK A;  5CYQ A;  1U4B A;  3M1F A;  4KAZ A;  1TKZ A;  4F8R A;  4Y1C A;  2E20 A;  1ZXO A;  1LW2 A;  2WC9 A;  5AQN A;  1VHX A;  4YOV A;  3VEZ A;  3HPH A;  1DT9 A;  5CZ1 A;  3DI6 A;  3JXU A;  2AA4 A;  1U04 A;  4ILG B;  1C1C A;  4G9Z A;  1SAZ A;  3F73 A;  4BRO A;  4CI6 A;  4ZTJ A;  3WXJ A;  2YHX A;  4CIE A;  4OPK A;  4PKG A;  4W5Q A;  3V81 A;  3DLH A;  4IWV A;  4K43 A;  5FLX O;  5GIO A;  3O8M A;  3S9H A;  4BAC A;  3CM6 A;  2Q0R A;  1MWM A;  4H0T B;  4CZK A;  3ZX2 A;  2FBV A;  2QWN A;  4FJI A;  4I6M A;  3H1Q A;  4FVM A;  4CCH A;  1S3X A;  4LFA K;  1KD1 O;  5BPM A;  2YV0 X;  3LZI A;  4DSE A;  3WEE B;  1TGO A;  3OYK A;  1HYZ A;  3SBG A;  4CEA A;  4CF0 A;  1QQN A;  4R79 A;  1T3V A;  4ISG A;  1D9D A;  4PY5 A;  1MU2 A;  4X65 K;  1DLO A;  4U67 L;  3IUC A;  4CFB A;  2BH1 A;  2IS3 A;  3VQ5 A;  3C6T A;  1E3M A;  2D5R A;  2UXD K;  4FLY A;  1BU6 O;  3LZJ A;  4AHV A;  1KFD A;  3OTO K;  1NK5 A;  1BIS A;  3IG1 A;  4HTL A;  5AFU A;  4FJ7 A;  1RNH A;  2WFB A;  3AVJ A;  4TSX A;  2KW4 A;  4IOA L;  3FR0 A;  3ZT2 A;  4C8M A;  4M42 A;  2O8B A;  3MN7 A;  2OZM A;  1Q9X A;  3IAY A;  3QER A;  4DTJ A;  1U45 A;  3HPG A;  4Y1D A;  1OH5 A;  3MDQ A;  4CER A;  1LWF A;  1W97 L;  1KCF A;  1LOT B;  1P8Z A;  4O4G A;  3AVB A;  4FW2 A;  1C0G A;  2QXL A;  2NUB A;  3EE8 A;  1IV0 A;  4GKK K;  3WXL A;  4DV7 K;  4DTX A;  5KRT A;  3VQ7 A;  3TAR A;  2EX3 A;  3KKR A;  4PL8 A;  3MX2 A;  3VQ8 A;  2VG5 A;  4DG1 A;  4E7J A;  3QBX A;  1U48 A;  4BRH A;  4CGF A;  3TAN A;  2JWL A;  4PUO A;  2HF4 A;  3TSP A;  3AAQ A;  4XH1 A;  3KWG A;  1C6V A;  3KLE A;  2XY8 A;  4KTZ A;  4BRK A;  4KHY A;  1EP4 A;  4PWD A;  1YTA A;  4ZHR A;  3EKS A;  4GV3 A;  2O8E B;  2KQ2 A;  5D3G A;  2HB5 A;  5DM6 L;  1LWE A;  5CZ2 A;  1J9A A;  1WB9 A;  3QNN A;  3DLK A;  2CH6 A;  2E1Z A;  4CK3 A;  3JSM A;  5CE3 A;  3EZW A;  4FM0 A;  4MQ3 A;  4B1X B;  2FLO A;  2Y1J A;  4AHS A;  4BEC A;  5BN9 A;  4BWJ A;  3J7Z O;  3VQ4 A;  2DFH A;  3LM9 A;  4DFK A;  4Q0B A;  3V4I A;  1VSD A;  1DKG D;  2D0C A;  5M1F A;  5H1S Q;  4GV9 A;  3PX4 A;  3CYM A;  3QLH A;  1RDA A;  2GEL A;  4XH5 A;  3BF3 A;  4NLC A;  1ZC6 A;  2FBX A;  4BE1 A;  1T03 A;  1EWQ A;  4BC3 A;  3WUH A;  4JD2 B;  3CI5 A;  4JI6 K;  4DR1 K;  1KAZ A;  3SUN A;  4B9L A;  4KI6 A;  3RR7 A;  3S3O A;  1DTT A;  3UIQ A;  1RBU A;  3QIP A;  2B6A A;  5BR8 K;  3TTF A;  3N4Q A;  5AQF A;  2ZJR L;  4DV6 K;  2CGL A;  1XNR K;  1UWB A;  3HSC A;  4NYF A;  3LDP A;  2X6S A;  1YIJ N;  4YOW A;  4I9L A;  3CMA N;  1Y64 A;  2A5X A;  1I94 K;  1ATN A;  3J81 O;  4JKH A;  2J4R A;  3K59 A;  3TAE A;  3EO3 A;  4E7K A;  1BOT O;  5FPM A;  2HBK A;  2QTD A;  1BCM A;  5AQR A;  3AO3 A;  2I7P A;  3OW2 M;  1SL1 A;  1NK6 A;  1YJ9 N;  1IKY A;  3C94 A;  4RCH A;  1C1B A;  5CYM A;  4LF5 K;  3O3F A;  4IFE A;  2G8H A;  3PIO L;  4DSL A;  1L3U A;  1S1T A;  2NRX A;  4CJS A;  1VSK A;  1UA1 A;  4CD3 A;  3AA4 A;  3IDH A;  4E1J A;  1L3T A;  2Z1G A;  2V51 B;  4QS9 A;  2BTF A;  3KLF A;  2G8I A;  3KWI A;  2AP1 A;  4O5B A;  4M3Z A;  1HNX K;  3CQY A;  2D4W A;  4CJF A;  1BQN A;  5AQK A;  3PX6 A;  5FPN A;  1T8E A;  4LH5 A;  2A42 A;  5T7B A;  3CFP A;  3TWH A;  4MLH A;  4KTW A;  2KZZ A;  4X66 K;  3CCE N;  3B6O A;  3PIP L;  3NCI A;  4BC4 A;  4FJM A;  3CPE A;  3MEC A;  2NRZ A;  1JCE A;  3CPW M;  1K8K B;  4WCE L;  3T1H K;  1JXE A;  4JNE A;  2A1S A;  2RPI A;  4E7L A;  4FLU A;  2GUP A;  3SQ1 A;  3WXI A;  3VES A;  3K9J A;  5M1P A;  2F7T A;  3OS2 A;  1BA1 A;  4CEO A;  3R1X A;  2VQF K;  1MA9 B;  2UU9 K;  3UKR A;  3QB0 A;  3OYF A;  2FF6 A;  2FSJ A;  2O8D B;  1C0F A;  4M41 A;  2YKN A;  4AHC A;  1ZYQ A;  4CBU A;  3MEE A;  3NH0 A;  4CJP A;  3ZSW A;  5HRN A;  3OYM A;  4JI2 K;  1CZA N;  5BRE A;  4CJL A;  4DFJ A;  4Z4F A;  3G0Z A;  1NWK A;  5IT9 O;  5CHI A;  2FF3 B;  4FSV A;  3KK1 A;  4A5B A;  1Z25 A;  2JGU A;  5F1X A;  4RW4 A;  3HYF A;  1QS4 A;  3RMB A;  4FWK A;  4DV0 K;  3OJU A;  2P9K A;  4B9U A;  4DQQ A;  1D8Y A;  4WE1 A;  1YUW A;  4KH6 A;  3MXM A;  3M8Q A;  3ZSV A;  2P1J A;  1ZBL A;  4F2S A;  3K58 A;  3HRG A;  3E9L A;  4BWM A;  1NGD A;  2NRH A;  4OLB A;  3CET A;  2NZT A;  3F5T A;  4JK7 A;  4FJ8 A;  4OLA A;  2E4L A;  2D1K A;  5C2F A;  1J5E K;  5AQT A;  4LD0 A;  1HMV A;  4CZM A;  4CHN A;  3ZT1 A;  4ZTF A;  1N6Q A;  4NYN A;  3AVG A;  5KPZ A;  3E9P A;  4W5O A;  1NMD A;  4FO0 A;  3RSE A;  4M3T A;  4BRP A;  2E8A A;  3NBP A;  4FJN A;  4LSN A;  3CXC M;  3ISN C;  3BZC A;  4XJX A;  1O13 A;  4N47 A;  4DV3 K;  2XY5 A;  1E4G T;  3L4Q A;  4IFV A;  1QSL A;  3Q7C A;  5KQ8 A;  3NF9 A;  3HOS A;  3SMS A;  1NK0 A;  2OPQ A;  1U49 A;  3BP8 A;  3SQ2 A;  3AA3 A;  1DTQ A;  3NF8 A;  4OJR A;  1NBW A;  3MEG A;  4BDZ A;  2HHH K;  2ZQB A;  4CEZ A;  3OS1 A;  5C15 A;  2HHS A;  2QXF A;  3GL1 A;  4B9V A;  3DXK B;  5E84 A;  4CZH A;  1WOQ A;  5C25 A;  4OKK A;  4EP4 A;  3QML A;  3LDS A;  1U6Z A;  4CGD A;  3B6P A;  1QQC A;  1KVC A;  5I42 A;  3QIN A;  4E1N A;  4CW7 B;  5GAG P;  3UKU B;  3K9K A;  3K5O A;  1VQO N;  1VQ9 N;  5J2Q A;  3KKS A;  5SZT A;  3P5J A;  4JN4 A;  1Q8I A;  4AHR A;  4GNI A;  4IO9 L;  3ZX3 A;  1TKD A;  2ZGZ A;  3A5M C;  1U2V A;  4FZX C;  4H0P A;  1G99 A;  3NGZ A;  4WQ4 A;  2YNG A;  1T05 A;  4WQ5 C;  4BRE A;  3M8S A;  4DV5 K;  1TUU A;  3QEW A;  3I56 N;  4F9O A;  3NF7 A;  5TKY A;  2ZWH A;  3O1B A;  3C7N B;  3FFI A;  3NVK A;  3IRX A;  2Q31 A;  4B9T A; 
#chains in the Genus database with same CATH homology
 2Q97 A;  3VF4 A;  3M1F A;  1T6C A;  3HTV A;  5AQJ A;  4EAH D;  3MCP A;  4H5W A;  5ADX H;  3AAP A;  5LY3 A;  3O80 A;  4WFN L;  3O5B A;  1QZ5 A;  1NJI O;  5AQU A;  2E20 A;  1ZXO A;  3SBT A;  2WC9 A;  5AQN A;  3GDQ A;  2KHO A;  4JKD A;  4PKI A;  3GE1 A;  4WQ5 A;  3D7E O;  5EOY A;  1DT9 A;  3VEZ A;  3AGK A;  4CZI A;  3JXU A;  4YOV A;  3JS6 A;  2AA4 A;  3MN6 A;  4XH4 A;  3OA9 A;  3G4S N;  4ILG B;  5JVH L;  4G9Z A;  1SAZ A;  2NRV A;  4IOC L;  4BRO A;  4CI6 A;  4BR2 A;  2W00 A;  3VEV A;  3WXJ A;  2YHX A;  3G71 N;  3VET A;  3DXM A;  3D2F A;  5JMV A;  5LJV A;  1EQY A;  4PKG A;  3O9Q A;  3O9U A;  5EXW A;  3DAW A;  4IWV A;  4CD1 A;  2KKZ A;  4K43 A;  3H46 O;  4JK8 A;  3VEY A;  4NO7 A;  4A5A A;  2F9W A;  5GIO A;  1GLC G;  3U8X A;  3W0L A;  4IJN A;  2DPN A;  3O8M A;  5AQQ A;  2IIR A;  3A5N C;  3FGU A;  2Q0R A;  3ULE A;  1MWM A;  1NGB A;  2F9T A;  4H0T B;  3TSQ A;  4AM7 A;  4CZK A;  3WEE A;  3ZX2 A;  5E26 A;  5C0Y A;  2QWN A;  4I6M A;  2NRW A;  3H1Q A;  3VTI A;  1S3X A;  5EX5 A;  5AZJ B;  1KD1 O;  5BPM A;  2GTD A;  3P31 A;  4A61 A;  4K25 A;  1NGA A;  3WEE B;  3TU5 A;  3SBG A;  2CH5 A;  1ATR A;  3ATV A;  3F2K A;  5DM7 L;  4WF9 L;  4BRQ A;  1QQN A;  4R79 A;  1T3V A;  4ISG A;  4JHD A;  4A59 A;  4H5R A;  2IVO A;  2YHY A;  4YDU A;  4FOE A;  4U67 L;  4BRN A;  1QQO A;  2P9U A;  3IUC A;  3FZH A;  3IFR A;  2BH1 A;  1GLF O;  3C7N A;  1K9M O;  5GAH P;  2UYT A;  2V7Y A;  3DXK A;  4BG9 A;  2HF3 A;  4RWT A;  3MN9 A;  1BU6 O;  3DXM B;  3GBT A;  5F0X A;  1TYQ B;  1IJJ A;  3MK6 A;  3CIP A;  3C65 A;  2GWK A;  4HTL A;  1BO5 O;  5AFU A;  1NGF A;  3SAF A;  2WFB A;  3I55 N;  1H1V A;  3VEN A;  5MLC Q;  3L6Q A;  3H45 C;  1P90 A;  3QIC A;  4JKF A;  4WQ4 C;  4H5V A;  5AQM A;  4DB3 A;  3FR0 A;  4IOA L;  2YJF A;  3EL2 A;  3UKU A;  3MN7 A;  3HM8 A;  3ZX0 A;  3BUZ B;  1N8R O;  2Q1N A;  4XEI A;  4IDH A;  4BVP A;  3SAH A;  5AQZ A;  5HL7 L;  3CC7 N;  3MDQ A;  4FWN A;  1W97 L;  2C1I A;  1LOT B;  3A5L C;  4BRF A;  1P8Z A;  3NVK A;  3GG4 A;  1C0G A;  3LDQ A;  2QXL A;  3EE8 A;  1BDG A;  3WXL A;  2KLA A;  1GLJ O;  5GAD P;  4BRA A;  2Q2R A;  4OPH A;  2P9L A;  3MN5 A;  4BRC A;  3LDO A;  4BQZ A;  4PL8 A;  3MX2 A;  3T69 A;  4DCH A;  5BN8 A;  4KH5 A;  4AF1 A;  3QBX A;  4BRH A;  3VF6 A;  4IZ9 A;  2GEM A;  5BPL A;  2JWL A;  4IEI A;  1YF5 L;  3FZK A;  3CCV N;  2HF4 A;  2OAN A;  2OTJ N;  5AQP A;  3TSP A;  3AAQ A;  3U9D A;  4XH1 A;  3KWG A;  2ZF5 O;  3H6E A;  4C1N I;  2EWS A;  4OPA A;  4B1Z A;  4MDB A;  1XUP O;  4BRK A;  3H3N O;  2PBD A;  3CCJ N;  3NMU A;  3CF5 L;  4NLB A;  2A41 A;  2CGJ A;  3EKS A;  5BPN A;  4YOR A;  4GV3 A;  3C6H A;  1RGI A;  1MWK A;  4FWM A;  1VQL N;  4BY9 C;  1HJO A;  1RDU A;  3RVC A;  5DM6 L;  2HOE A;  1QHA A;  4A62 A;  5GIP A;  4BEB A;  2CH6 A;  2E1Z A;  4NB4 A;  3D6R A;  5CE3 A;  3EZW A;  2E2P A;  4BRM A;  4B1X B;  3LDL A;  5C12 A;  1V4T A;  1R59 O;  4JKC A;  2FLO A;  2FXU A;  1ILY A;  5AQG A;  1HX1 A;  3HBT A;  4BEC A;  5BN9 A;  5AR0 A;  4CZL A;  3J7Z O;  2NNW A;  3SJH A;  1VQ4 N;  3IKM A;  3LM9 A;  1V4S A;  3A0I X;  4H0Y B;  3ENO A;  4M7Y A;  5FPD A;  4FWL A;  2A40 A;  4FPB A;  2ZJQ L;  2P9L B;  3UKR B;  1DKG D;  5TKW A;  5M1F A;  5H1S Q;  4GV9 A;  2E2N A;  3LL3 A;  4H5T A;  4M7X A;  4JKB A;  2D0O A;  5GIN A;  1VAZ A;  2GEL A;  4XH5 A;  3CCQ N;  3KZB A;  4BGB A;  4FWS A;  3BF3 A;  4NLC A;  1VQK N;  3DLL L;  1Q18 A;  1DEJ A;  1ZC6 A;  1KQS M;  2YCH A;  1RDW X;  2ASP A;  4BC3 A;  1HPM A;  3WUH A;  3LM2 A;  5BRH A;  4JD2 B;  3CI5 A;  3ENH A;  3KHY A;  4QS8 A;  5C2D A;  3A8Y A;  5JVG L;  3MWT A;  3FFK B;  1VQN N;  1X9J A;  1KAZ A;  5KPT A;  4GVE A;  4L3Q A;  3R8E A;  3SMP A;  4KBO A;  3LDN A;  3TTF A;  3N4Q A;  3EE9 A;  4JEP A;  1QZ6 A;  1NGJ A;  5AQF A;  5KQD A;  2E2O A;  2ZJR L;  5C10 A;  3O9R A;  4BQL A;  1YHQ N;  4BRD A;  2CGL A;  1T6D A;  2VCP A;  2W41 A;  3HSC A;  3VEW A;  4PHT X;  1YJN N;  2VGN A;  2VGM A;  3J8A A;  3LDP A;  3AY9 A;  3QDK A;  3O1W A;  1HKB A;  3P4I A;  2ASM A;  3CCM N;  5AQO A;  1YIJ N;  3UE5 A;  4YOW A;  1QVF M;  4H0X B;  1OVY A;  1NGC A;  3L4I A;  3RSE B;  3DWL A;  3CMA N;  4IEE A;  3O08 A;  1Y64 A;  4H5N A;  2A5X A;  5BRD A;  3WQT A;  1ATN A;  3FZF A;  4CZG A;  4JKH A;  2J4R A;  3D2E B;  5HOO A;  2E2Q A;  4PKH A;  2ITM A;  3EO3 A;  3TTD A;  1ATS A;  1BOT O;  3AGR A;  5FPM A;  3SLC A;  4B1V A;  3O6W A;  2HBK A;  2QTD A;  3CC4 N;  2E88 A;  4WFA L;  3TSU A;  1M90 O;  1GLB G;  1BA0 A;  4H0O A;  2I7P A;  1XC3 A;  5AQR A;  4BC2 A;  1LCU A;  1SS6 A;  2QW9 A;  3FZM A;  3OW2 M;  1YJ9 N;  1HLU A;  4RCH A;  2QI2 A;  3HOT A;  5LJW A;  3FLC O;  1VQ6 N;  2YHW A;  3D2E A;  4IFE A;  4FPA A;  2QWM A;  2YX6 A;  4BR7 A;  3PIO L;  1QVG M;  3ZET B;  4FWO A;  2NRX A;  4PL7 A;  2Q36 A;  4GY2 B;  3E66 A;  5AQW A;  2P9I A;  3GOI A;  1DGK N;  4CD3 A;  3IDH A;  4E1J A;  2VYP A;  2V51 B;  4QS9 A;  2BTF A;  2P9S B;  1OKJ A;  2AP1 A;  3KWI A;  1IG8 A;  5AQV A;  4EIA A;  1KAX A;  2CGK A;  4O8U A;  3ATU A;  5AQS A;  3SAG A;  4YOX A;  3CQY A;  2D4W A;  4A2A A;  1EO1 A;  3HZ6 A;  4CJ7 A;  5AQK A;  1GLL O;  5FPN A;  1T44 A;  4OO1 J;  2A42 A;  3CHW A;  3G6E N;  1Q81 O;  5JLF A;  2GWJ A;  5M1O A;  4MLH A;  4BC5 A;  4BR5 A;  1Q7Y O;  3CJB A;  3CCE N;  1YXQ A;  2P9N B;  2QWO A;  2NLX A;  3PIP L;  5JIC A;  3M6G A;  4YOU A;  4BC4 A;  1K73 O;  3H1V X;  3MMV A;  3CCL N;  3CPE A;  2A6A A;  3E9O A;  3QFU A;  2NRZ A;  1JCE A;  3WXM B;  4DQ8 A;  1KXP A;  3B8A X;  1K8K B;  4CZJ A;  4WCE L;  3CPW M;  3MX5 A;  1XQS C;  3AAR A;  4JNE A;  4FWR A;  3OHR A;  4FWQ A;  1WUA A;  4B9Q A;  2PFU A;  3A5O C;  3R9P A;  3F9M A;  4A2B A;  2PAV A;  3ID8 A;  1E4F T;  4B1W B;  2GUP A;  5EY4 A;  3C6A A;  3VTH A;  1QQM A;  1X3N A;  2V52 B;  3WXI A;  3VES A;  3K9J A;  5M1P A;  2F7T A;  3CCR N;  2BUP A;  3H3O B;  1BA1 A;  1VQ8 N;  4C23 A;  3VEX A;  2NRT A;  3VGK A;  2C1G A;  2QM1 A;  3CCS N;  3R1X A;  5EVZ A;  2HBL A;  3CJ1 A;  3TPQ A;  1MA9 B;  2HST A;  2QWL A;  3E1Y A;  3UKR A;  1NGI A;  3W3D A;  4C1N K;  3QB0 A;  4CZF A;  5M1K A;  2FF6 A;  1GLA G;  4EHU A;  1NLV A;  5JLH A;  1ESV A;  2FSJ A;  1Q82 O;  1BWF O;  4YDU C;  5AQY A;  3N4P A;  1C0F A;  1YJW N;  3CER A;  1J6Z A;  3O9S A;  4BR9 A;  4MO4 A;  4CBU A;  2HBJ A;  4IXC A;  4JKA A;  1NM1 A;  2P9U B;  1CZA N;  5BRE A;  3ID6 A;  1VQ7 N;  4IO8 A;  4ISE A;  4RTF D;  3L0Q A;  2P9I B;  5AQX A;  4IOX A;  2QWQ A;  1NWK A;  5CHI A;  3O4W A;  3T7Z A;  2P9S A;  2FF3 B;  4H0V B;  4FSV A;  5AFU H;  3HI0 A;  2W40 A;  2QEX N;  2P9P B;  4A5B A;  3ZYY X;  5F1X A;  4B1U B;  1TYQ A;  3QBW A;  4FWK A;  4WYB A;  4JHD B;  2P9K A;  1YI2 N;  1SZ2 A;  3ZEU B;  3EN9 A;  5BRF A;  2ZJP L;  1YUW A;  2IVN A;  4KH6 A;  2HMP A;  1D4X A;  3TTC A;  4O5F A;  4AM6 A;  5ADX A;  5CR4 A;  1YIT N;  3HRG A;  3E9L A;  4CBX A;  4BGA A;  2VWB A;  1HKC A;  1GLE G;  1U2V B;  1NGD A;  2NRH A;  5AZJ A;  3WQU A;  3CET A;  3O9T A;  2HBM A;  3VEO A;  3FZL A;  3CME N;  2NZT A;  3F5T A;  4MLE A;  3CC2 N;  4JK7 A;  5M1N A;  3MCA B;  4I6M B;  3WT0 A;  2H3G X;  1GLD G;  4JK9 A;  4EFH A;  1M1K O;  1TUY A;  2D0P A;  2D1K A;  4JKG B;  5C2F A;  3FE1 A;  2IVP A;  2GX9 A;  5FPE A;  5AQT A;  1RFQ A;  4LC9 B;  2E1Y A;  4CZM A;  1K8K A;  1BUP A;  3KK7 A;  5KPR A;  4Y0W A;  3CJA A;  3S41 A;  5BR9 A;  3ENB A;  2A3Z A;  3M3Z A;  5KPZ A;  2Q0U A;  1VQP N;  3E9P A;  4J8F A;  3CJC A;  4DKW A;  2NRR A;  5I9E B;  1NMD A;  4FO0 A;  4HWI A;  3RSE A;  2RE2 A;  4BR4 A;  2E8A A;  3BEX A;  4BRP A;  3PLA A;  4JKE A;  1JCG A;  4FOI A;  3VF2 A;  4FWP A;  3CXC M;  4BR0 A;  4XJX A;  1O13 A;  1Z6R A;  1JJ2 M;  4IJA A;  4M63 C;  1E4G T;  4U7B A;  1NGG A;  3L4Q A;  4CZE A;  3KVG A;  3CJ7 A;  3Q7C A;  5AZI A;  3M5R A;  1S22 A;  3NVM A;  5KQ8 A;  3VER A;  4Z94 A;  5F2R A;  4GV6 A;  1BG3 A;  3HOS A;  3R3L A;  1VQM N;  3UB5 A;  3SMS A;  1KAY A;  4YOT A;  3ZET A;  4CBW A;  3CJ9 A;  4BE7 B;  5ELZ A;  1HUX A;  3BP8 A;  3U4L A;  5B8H A;  1SQK A;  3DJC A;  4QS7 A;  4WFB L;  2YI1 A;  3OBY A;  4B1Y B;  1NBW A;  2QWP A;  5GAE P;  3CD6 N;  4JKG A;  5C15 A;  1YAG A;  1S72 N;  5AQH A;  1HKG A;  3GL1 A;  1NGH A;  2QWR A;  3DXK B;  5E84 A;  1NGE A;  4CZH A;  2P9K B;  1WOQ A;  1YVN A;  4A57 A;  3P38 A;  4H03 B;  5M1Q A;  3Q7B A;  4BRL A;  3QML A;  1K8A O;  3CCU N;  1U6Z A;  2P9N A;  2P9P A;  2YJE A;  2FSN A;  3WXK A;  2RHK A;  3MWP A;  4MDA A;  4FVU A;  1X3M A;  4DHY A;  5GAG P;  3P39 A;  3UKU B;  3CQX A;  3EKU A;  5AQI A;  3K9K A;  1MDU B;  4EHT A;  2ASO A;  5AZI B;  3U9Z A;  4BRI A;  1Q86 O;  1VQ5 N;  1VQO N;  4MO5 A;  1VQ9 N;  2WUS A;  4O8K A;  3R6M A;  5AQL A;  3BF1 A;  4ISF A;  4JN4 A;  3VGM A;  4BRG A;  1ZBS A;  1W2B M;  4YOY A;  3ULE B;  3VGL A;  4BG8 A;  2WBN A;  4GNI A;  4BVO A;  4IO9 L;  4JAX A;  4KH4 A;  3I33 A;  3ZX3 A;  3I8B A;  4ILH A;  2QA4 N;  2V7Z A;  2ZGZ A;  4K41 A;  2OTL N;  2I7N A;  1JCF A;  3A5M C;  3OBW A;  3VPZ A;  1U2V A;  4K42 A;  4FL9 A;  4UY8 O;  4JD2 A;  4H0P A;  1G99 A;  3D2F B;  4WQ4 A;  3IMX A;  4WQ5 C;  3VOV A;  4BRE A;  2FSK A;  3G25 A;  3QFP A;  1KC8 O;  1TUU A;  2JWK A;  3VMF B;  3I56 N;  4F9O A;  5TKY A;  3SK3 A;  2ZGY A;  3ZEU A;  2ZWH A;  3C0B A;  3O1B A;  3C7N B;  4ILJ A;  1Z05 A;  2Q31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...