1U2VA

Crystal structure of arp2/3 complex with bound adp and calcium
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
418
structure length
402
Chain Sequence
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-Related Protein 3
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
molecule tags Structural protein
total genus 123
structure length 402
sequence length 418
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1u2vA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1u2vA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1u2vA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1u2vA04
4JD2B 1YVNA 1NGAA 2P9LB 3VEVA 2GEMA 2P9NA 3UKRB 2W41A 3ATVA 3ATUA 4CJ7A 3DXMB 1KAZA 2Q2RA 4IXCA 4IJNA 3CJAA 4RWTA 1T44A 1NGDA 4HWIA 4CZLA 3MN5A 4FWOA 1H1VA 2GUPA 4H0PA 4WQ4A 3VGLA 1X3MA 2E2NA 5AFUA 2A5XA 1TUUA 4H0XB 1KAXA 2HF4A 4QS8A 1K8KA 4JAXA 3QFUA 1XUPO 3O08A 4I6MB 5AQGA 4QS9A 3GE1A 4CZHA 2V52B 4BRCA 3U8XA 4B1XB 5AQFA 2J4RA 5EX5A 4H0TB 3FZFA 3ULEB 4CZMA 2E2OA 2PBDA 5JICA 1U6ZA 4H5RA 3WEEB 3TPQA 1ZBSA 1QQMA 5E26A 2P9KA 4M7YA 5BRDA 3GBTA 1NM1A 4DHYA 5AQNA 4CBXA 4FWKA 2VCPA 3U4LA 1KAYA 5AQSA 4BRPA 3ZETA 3A5OC 3UB5A 3HI0A 4H0OA 3UE5A 2GWKA 3O80A 4GY2B 1GLAG 5FPNA 2Q1NA 3EKSA 3SMSA 2E8AA 2P9SA 1HX1A 4O8KA 2P9PA 3GOIA 3O4WA 4FOIA 1TUYA 4I6MA 4EHTA 4ISGA 3M6GA 1HKCA 3ZEUA 4CZKA 5B8HA 5AQPA 2QXLA 3O1WA 3FZKA 3I8BA 4FWLA 5BRHA 2IVOA 4KBOA 3ULEA 3WQTA 1MWKA 5AZJA 4BGAA 1HKBA 2A42A 1DGKN 5I9EB 3VF4A 5KQDA 2Q31A 1TYQA 2P9UA 1C0FA 2HMPA 3QB0A 4MO4A 4WQ5C 4BC2A 1Q18A 4CZIA 4AM6A 5AQTA 5AQUA 3AAQA 2WUSA 3C7NB 3FZHA 1BOTO 3HM8A 3KHYA 5F2RA 3R8EA 1YAGA 4CZEA 4CD1A 3LDLA 5JLHA 2YHXA 2H3GX 4A2BA 3R6MA 3DAWA 5JMVA 1HUXA 1YXQA 3EN9A 2P9NB 2BTFA 1NGHA 4IJAA 3MK6A 2D4WA 4B1YB 1NMDA 2QW9A 1BU6O 4BC3A 1G99A 1EQYA 3H46O 1S3XA 2NZTA 4CD3A 1R59O 3CERA 4NO7A 2YCHA 3DXKA 1D4XA 1NGFA 4M7XA 3CJCA 5BPLA 4BG8A 4C23A 3CJ7A 3LDQA 2F9WA 4YDUA 3J8AA 4XH1A 3ENOA 2ITMA 1X9JA 1K8KB 4FOEA 3ZX3A 3WQUA 2ASOA 5ADXH 4H03B 2GTDA 4MO5A 3IDHA 2KHOA 2IVNA 2HOEA 3IMXA 3BUZB 3O6WA 4FL9A 4IWVA 4J8FA 1BWFO 2ASPA 4PL7A 3CI5A 3DWLA 2YHYA 1U2VA 1CZAN 1QZ6A 2P9KB 4CZFA 2A6AA 1ZXOA 4CBUA 3ZETB 1T6CA 1ESVA 3IUCA 3ENHA 4DB3A 3WXLA 1XC3A 5AQRA 2QWPA 2E2QA 2YJEA 5EXWA 2P9SB 1NLVA 3JXUA 5AQYA 5KPTA 2P9PB 4B1ZA 4BROA 5JLFA 1E4FT 4BRDA 4CI6A 3MN6A 4EHUA 3A5MC 3ZEUB 4YDUC 3WUHA 3QICA 2VWBA 4QS7A 3MMVA 3A5LC 3H1VX 4FWMA 3FZLA 3MDQA 5AQXA 5AZJB 3VEWA 3QMLA 2CH6A 2E20A 3LM9A 2OANA 1QQOA 3GDQA 1TYQB 2P9UB 1QZ5A 1ATSA 2PAVA 5LY3A 5AQLA 3BP8A 1T6DA 2FF6A 2AP1A 2V51B 3VF2A 2FLOA 3CJ9A 3MCPA 4HTLA 3H6EA 3VEOA 1JCGA 1NGJA 3O1BA 5ELZA 5LJWA 4FWSA 2QWLA 4DQ8A 1ATRA 4A61A 4B1WB 3AARA 1MWMA 3HTVA 5AZIA 4FPBA 1DKGD 4K42A 2GELA 2D0OA 4WQ4C 3L4IA 2V7YA 2I7NA 1BA1A 3A0IX 1LOTB 5FPMA 3AY9A 3S41A 2FXUA 2YHWA 1HPMA 2D0PA 3DXKB 4B9QA 1HLUA 4ISFA 5KPZA 4FWPA 1QHAA 1BG3A 4FPAA 3B8AX 4BRGA 4Y0WA 1HJOA 5AQHA 1BDGA 1NGGA 3RSEA 3VEZA 4B1VA 1GLDG 1XQSC 3VEYA 4JHDA 5BN8A 3IFRA 3ID8A 2ZGYA 3U9ZA 3ZX0A 2VYPA 3LL3A 5AQJA 1SQKA 1U2VB 3EZWA 2F9TA 4XH4A 5LJVA 4A2AA 4BRHA 1KXPA 2FSJA 1SZ2A 4BRKA 2CGLA 1BO5O 4IO8A 4H5NA 3CHWA 2NLXA 4BC4A 4EIAA 5BPMA 3U9DA 2A3ZA 1Z05A 5KPRA 3FLCO 3EKUA 2QWOA 2YJFA 3L6QA 5AR0A 5AQZA 5BN9A 4CZGA 1S22A 4XH5A 3QFPA 3R9PA 5BREA 4F9OA 5FPEA 1P8ZA 3O5BA 4BRMA 2ZGZA 5TKYA 1GLCG 1GLEG 3BF1A 3VENA 1JCFA 3HSCA 4BR4A 4BRIA 3VESA 3LDOA 4GNIA 1GLLO 3SJHA 1WOQA 4H0YB 4FSVA 4MLEA 3VEXA 4FWNA 5F1XA 1C0GA 4BR5A 3LDPA 4BQZA 3VETA 2ZWHA 1SAZA 1YUWA 4E1JA 4JNEA 5EVZA 3G25A 1JCEA 3AAPA 1Y64A 1QQNA 2BUPA 3LDNA 5AQWA 2FF3B 2IIRA 1RGIA 4AM7A 2P9IA 1GLFO 2CGKA 4A62A 3CIPA 5AZIB 3GG4A 3MN7A 5BRFA 1NGEA 4FWQA 5EOYA 4BC5A 2AA4A 2E1YA 3KVGA 5BR9A 4BREA 2FSKA 3WT0A 5FPDA 4WYBA 4PL8A 1BA0A 5F0XA 3SK3A 1Z6RA 3CQXA 3D2FB 3HBTA 3I33A 4L3QA 4BRQA 3VERA 3KZBA 4IZ9A 3FGUA 4BRFA 4BR2A 3QBXA 5AQOA 3A8YA 4Z94A 1IG8A 5AQMA 3D2EA 2GWJA 2E1ZA 2Q97A 3RSEB 5BPNA 2A40A 1BUPA 4CBWA 4EFHA 3H45C 2EWSA 4JHDB 1ATNA 4WQ5A 4BVPA 2YI1A 4FWRA 4BR0A 2IVPA 4EAHD 4JD2A 1DEJA 2Q0RA 3VF6A 2P9LA 3FZMA 3GL1A 3F9MA 3UKRA 2ASMA 2Q36A 2Q0UA 3WXKA 4BGBA 1HKGA 2QWMA 1GLBG 3DXMA 5ADXA 3H3NO 4M63C 3DJCA 4H0VB 4B1UB 1J6ZA 3D2FA 3WXIA 2I7PA 5AQIA 2E88A 4BVOA 3MN9A 3VOVA 4H5TA 3W0LA 3BF3A 5AQKA 3WXJA 4XEIA 2CGJA 3UKUB 3H3OB 5EY4A 3P4IA 5AQVA 3CJBA 3OHRA 1LCUA 4BR7A 3TU5A 4BR9A 4MLHA 3FR0A 3VGKA 4ISEA 3CETA 3WEEA 4H5WA 4NB4A 5AFUH 1NWKA 3EL2A 4BRLA 5CE3A 2UYTA 2DPNA 3VPZA 4FO0A 4H5VA 4K41A 1MDUB 4BRAA 1RDWX 3HZ6A 3FFKB 2FSNA 1WUAA 3CJ1A 4LC9B 2ZF5O 1OKJA 1V4SA 3H1QA 5E84A 3M3ZA 2W40A 3FE1A 2V7ZA 4JN4A 3W3DA 3SMPA 3D7EO 3L0QA 1RFQA 2NRHA 2P9IB 3SLCA 4RTFD 1MA9B 4BQLA 3UKUA 2QWQA 5AQQA 3C0BA 3CQYA 4PKHA 3QBWA 4K25A 1NBWA 3LM2A 2HF3A 4O5FA 4RCHA 3EO3A 2QM1A 3ZX2A 3M1FA 1NGCA 1NGBA 1GLJO 3QDKA 1X3NA 5KQ8A 1ZC6A 3BEXA 2D1KA 3D2EB 3O8MA 4BG9A 1V4TA 2CH5A 4DCHA 3C7NA 4PKIA 2A41A 2E2PA 1NGIA 1IJJA 1E4GT 4BRNA 3JS6A 2QWRA 3A5NC 4K43A 2QWNA 3VGMA 4PKGA 4CZJA
chains in the Genus database with same CATH superfamily
3VEVA 3CCMN 2GEMA 2Z1IA 2RE2A 2W41A 4JKDA 3DXMB 1KAZA 4LSNA 3TSPA 3AV9A 3VQQA 2ZD1A 4BEBA 2D5RA 4J2DA 4B9MA 2ZJPL 4FWOA 3HSTB 4WQ4A 1HYSA 3CCEN 2OA8A 4QS8A 1N8RO 1K8KA 4RW9A 3QFUA 3TAPA 3J80O 4CZHA 3QIPA 4FW1A 3MX5A 3F9KA 4FM1A 5AQFA 3HT3A 4CZMA 3BGRA 4BDPA 2PBDA 4CK1A 1RT6A 3D45A 1HNVA 1SUQA 1B92A 1KAYA 3HM9A 1KFDA 3A5OC 3UB5A 4DTNA 3CD6N 3UE5A 3O80A 4JRQA 3RVCA 1GLAG 3V9WA 3EKSA 2E8AA 4KTQA 1CLQA 1T7PA 3U3YA 3GOIA 4BDZA 1XNQK 4FM0A 1WSGA 3VMFB 4CESA 1EX4A 4E3SA 3MX2A 4EHTA 3QEWA 3VQ8A 4OJRA 4GKKK 2P5OA 1C0TA 4OPAA 1BIUA 4CK3A 4KBOA 1HR0K 1HPZA 3O9TA 1SV5A 3VQ4A 1REVA 5SWMA 4JS5A 1DGKN 5KQDA 1TYQA 2P9UA 1G15A 4E72A 4WQ5C 4BC2A 4CZIA 3DRSA 4AM6A 5AQTA 4OGCA 4OPJA 3S3MA 4DTPA 5AQUA 1YI2N 3AAQA 3DLBA 1BOTO 3HM8A 2WC9A 4R79A 3EZ5A 5JLHA 2YNFA 2YHXA 4A2BA 3R6MA 1BCMA 1EKEA 1K73O 2OCEA 1K8AO 2P9NB 1NGHA 3I0RA 2D4WA 4RW7A 4BC3A 5FRNA 5AJ3K 4DR6K 2QA4N 1S3XA 5DM7L 1JL2A 4B3SK 4M7XA 4CHPA 4BG8A 1KSPA 2ZJQL 4J2AA 1VSMA 1VQLN 2PYLA 4BACA 5HL7L 1FK9A 5C24A 4MO5A 2C1IA 1S9EA 3IMXA 4CHYA 3BUZB 3O6WA 2ASPA 4PL7A 2UXCK 4HCBA 1U2VA 5J2MA 2QXFA 4JKGA 2UUCK 1QZ6A 2P9KB 3RMDA 1FW6A 4B8AB 3P39A 4WFAL 1ZXOA 4JK8A 4DV0K 2HNDA 3ZETB 4JS4A 2Z1JA 1T3VA 3AVBA 3IUCA 3THWB 5AQRA 5FROA 3JXUA 2BH1A 4HVJA 5JLFA 3ZSWA 4LF9K 1M1KO 4JYAK 2O4IA 3A5MC 4O0IA 3PO4A 4ILGB 4YDUC 2KFZA 2KKZA 1K9MO 2UXDK 4DSEA 3HJFA 3A5LC 4FWMA 2IS3A 3FFIA 4DTUA 1DTQA 3QNOA 2KLAA 2PAVA 1RTIA 3KK2A 4JLHA 1YVUA 1T6DA 3HXMA 1R0AA 4CEBA 3VF2A 2HHHK 1UA0A 3O1BA 4CEOA 5HLFA 1JLGA 4Z0UA 4UY8O 5H1SQ 4LF4K 4DQ8A 4A61A 3SQ2A 2C1GA 1MWMA 4ID1A 2XY7A 3AVFA 5CYMA 2B5JA 2D0OA 5SZTA 2I7NA 4X64K 3A0IX 3AVMA 2O8FA 2RN2A 1RT1A 1IO2A 2YHWA 2O8BA 1HPMA 3B6PA 3Q7CA 4KI6A 2W42A 1U4BA 4DQPA 4BE2A 1EWQA 4CJUA 2RF2A 3PX0A 4ID5A 5LMUK 1WSIA 3B8AX 1JLQA 2G8HA 4PWDA 3VEZA 4CIGA 3ZLJA 3VEYA 4E7JA 4CHNA 3NF7A 4JHDA 1VSJA 3ID8A 2ZGYA 2NUBA 4FLXA 1YJ9N 1SQKA 4G9ZA 3CMEN 3L4QA 4E7HA 1JLBA 1L5UA 2VQFK 3LAKA 4HUEA 4A2AA 3F2KA 1KXPA 2R7YA 2XY6A 2CGLA 3Q7BA 1BO5O 4IO8A 5EU7A 4BY9C 1RT7A 3ISNC 4C1NI 3G4SN 4EIAA 3V81A 4IOCL 1Z05A 3ZSVA 1N5YA 3EKUA 1XNRK 3L6QA 5AQZA 3C6AA 5BN9A 1TKDA 4XH5A 3QFPA 1ZBUA 5BREA 1Q8IA 3O5BA 4BRMA 2ZGZA 1QHTA 4A5AA 1S6PA 5HROA 4FJ7A 3OYDA 2EX3A 4OKEA 1WOQA 2JLEA 5F1XA 3MECA 4FWNA 1IBKK 4BR5A 3LDPA 4M3UA 2X78A 3E66A 4K8ZA 2ZWHA 4CFCA 1K6YA 5JS1A 3K58A 4JI7K 2KTQA 3TANA 1JLEA 5AQWA 1RGIA 3NDKA 3AGRA 4A62A 3N4PA 2QKBA 4JKAA 3MN7A 1NGEA 4FWQA 4BC5A 1OH5A 1S1WA 5GADP 2FSKA 1LWEA 5F0XA 3CQXA 1RDDA 3HOSA 3NBPA 4IZ9A 1VQ4N 3KLEA 1WSJA 4BR2A 1TK5A 4FLYA 4DTSA 1NJYA 1I3AA 2A40A 2RPIA 4M3TA 4CBWA 4EP5A 4EFHA 3H45C 4CK2A 3M8PA 3CQ8A 1BIZA 5GINA 4EAHD 1DEJA 2Q0RA 3WNHA 2Q36A 1HKGA 3H3NO 4M63C 4H0VB 4KRFA 3WXIA 3TTFA 4CEEA 2E88A 3MN9A 4WE1A 1S72N 3VOVA 4H5TA 4KHPK 1VQ9N 2O8EB 3BF3A 3WXJA 4XEIA 4AHVA 3V1RA 3H3OB 4QCLA 5EY4A 3P4IA 3CJBA 3P38A 4FK2A 1D5AA 4JKFA 4MDAA 4WFBL 5IT9O 3M5RA 3VTHA 3ZT1A 2IAJA 1NJXA 3IG1A 4OGEA 4CGJA 1BI4A 2IOCA 2DPNA 4KH6A 4FJMA 4LF8K 4O44A 4LC9B 1IH7A 1HYZA 3KK7A 1WLJA 4CJFA 3M3ZA 3OS2A 2W40A 1FJGK 1TKTA 2V7ZA 3W3DA 2KQ2A 3TR8A 2KZZA 2NRHA 3SLCA 4RTFD 4FJHA 2I5JA 2OZSA 1Q9YA 4DV5K 3OBYA 3QBWA 4KH4A 3CC4N 1QQCA 3VQ9A 2WOMA 4FZXC 2YKNA 1NBWA 3OBWA 4E89A 1I94K 1VSFA 2QM1A 4JEPA 1GLJO 1X9WA 3DRPA 3QDKA 1RDBA 3OA9A 3U3GA 3TAEA 5KQ8A 3NVKA 3O8MA 3QETA 2OPQA 2W6KA 2CH5A 4DCHA 3C7NA 5KGXA 1T05A 2UU9K 1NGIA 3ZSXA 3J7YP 3TWHA 4NYFA 4DTRA 4E0DA 1SL1A 1BCOA 3AVGA 1UAXA 1WSHA 2HHTA 4H8KA 1IBLK 1Q9XA 3CCLN 5KGWA 3CYMA 3CFPA 1YVNA 4IG0A 3OVNA 3UKRB 4AH9A 1VAZA 3A2FA 4OVLA 4CJ7A 3NE6A 3T3FA 1JLCA 4IXCA 4RW4A 4WFNL 4IJNA 1TL3A 4DQRA 4DSKA 5JS2A 4FLUA 3I56N 4H0PA 3G10A 5AFUA 3V9ZA 2HF4A 4FJKA 4JAXA 3O08A 4AHRA 2KW4A 1DTTA 4BE0A 3AVLA 1HQEA 3HO1A 3FZFA 1OVQA 2E2OA 1N34K 5JICA 3KJVA 1TVRA 3TPQA 3C65A 1ZBSA 1T8EA 4CEQA 4LH5A 4M7YA 5BRDA 3OYFA 1NM1A 3OYBA 5AQNA 3NF6A 4CBXA 3HVRA 2HHQA 2BANA 2VCPA 2HSTA 1ITGA 5AQSA 4C8KA 4BRPA 2GWKA 3MEDA 3L2QA 3RMCA 2P9SA 3AVJA 3I55N 2P9PA 3KWGA 4B9UA 1N6QA 3L2RA 1TUYA 1WAFA 3HPGA 1HKCA 4I9QA 1KVCA 4CZKA 5A2QO 3FZKA 4KHWA 3I8BA 2Y1IA 4E7IA 3IRXA 3DM2A 1LV5A 4DSLA 4BGAA 1ASVA 4KO0A 5I9EB 4IEEA 4OPKA 2G8KA 4MO4A 5C2FA 3DLEA 3CFOA 1TKZA 1X1PA 3FZHA 2HVIA 3KKRA 3KHYA 4FJ8A 3R8EA 4ICLA 4Y1DA 4CZEA 4CJTA 4AF1A 4CD1A 3AVCA 3OYNA 1NKBA 2X74A 3NH1A 3DAWA 5JMVA 1YXQA 3EN9A 3MAQA 4JKGB 3ITHA 1U45A 1G99A 2O8DB 1RDUA 1EQYA 2NZTA 4CJRA 4IFYA 1R59O 3CERA 4NO7A 3O9SA 4B3MK 3DXKA 2JWKA 2HHUA 2XHBA 4C23A 4E7LA 1IKYA 1JXEA 3CJ7A 4XH1A 1WSEA 2F7TA 2D0AA 3G71N 3ZX3A 1VSDA 3C6TA 4LF6K 3AA2A 1YHQN 5ADXH 1Q81O 4N47A 1QSLA 3QIOA 2HOEA 4IWVA 4J8FA 1BWFO 2YNIA 2VGNA 2YHYA 4DSFA 4CZFA 1U49A 4ELVA 3EE9A 4CBUA 4DWIA 1ESVA 3P1GA 3SAHA 3ENHA 3WXLA 4AHUA 4KB1A 4CEZA 5EXWA 1NLVA 2Z1HA 3E1YA 2P51A 1JLAA 3CCQN 1BGXT 1UWBA 4IEIA 1QE1A 3ZEUB 1A5WA 3WUHA 3DLKA 1WSFA 1NMNA 3CF5L 5AZJB 2CH6A 2E20A 4JI2K 3AA3A 1GOBA 4M42A 5LY3A 3LAMA 4I9LA 4DFMA 2AP1A 4MQ3A 1NK8A 2FLOA 4HTLA 4YOUA 4CIEA 4FLVA 3L2WA 1NK4A 3CCSN 4KI4A 3T1AA 5LJWA 2HBLA 1XMOK 2DFFA 1ATRA 4RG8A 4B1WB 4FK4A 3AARA 3PIOL 4JK7A 5HRNA 4KHYA 5AZIA 1DKGD 1KVBA 1VQ7N 1B9DA 2OPPA 2WONA 3L4IA 5M1KA 3K5MA 2V7YA 2UUBK 3OS1A 1LOTB 1F21A 1CXQA 1NOZA 3CYGA 2FXUA 1RT4A 1LWCA 1O13A 4NYNA 3QO9A 4B9QA 3LPUA 4ISFA 5KPZA 1Z25A 2D0CA 4FWPA 3PIPL 3LWMA 3SPZA 1J5EK 1QHAA 3M8QA 4YOTA 3ULDA 4AHSA 1FXXA 3VQBA 4BRGA 5AQHA 5C25A 5HP1A 3SPYA 4B1VA 5D3GA 4OX9K 1YJNN 3IFRA 1W2BM 3U9ZA 5C0YA 4K8XA 4DLEA 5AQJA 3EZWA 2F9TA 5TKWA 1C1BA 5LJVA 3VA3A 1VQ8N 1C0MA 1RDCA 3SV3A 3CHWA 3THXA 2W6LA 4W5OA 3CCRN 2XY5A 1OH6A 4DMNA 3NH2A 3DYAA 4BC4A 4XJXA 3MCAB 4J2BA 4CJWA 3FLCO 4CJ3A 3OYIA 1QTMA 3CCUN 1DT9A 4B3TK 5AR0A 1Z26A 1SL2A 4KHUA 2GBZA 2VWJA 4F9OA 5HBMA 3LZJA 1GLCG 2EHGA 4H4OA 1GLEG 2OYQA 4DTMA 1BHLA 3BF1A 4BR4A 1JCFA 3CXCM 4BRIA 3LDOA 3PX6A 1OH7A 3F73A 4YOVA 4EP4A 4YNQA 1VQKN 2GX9A 5MLCQ 1C0GA 3KLIA 4K0KK 2YHBA 4E1JA 4TSXA 4DR4K 3G25A 1JCEA 4I2PA 3L8BA 1KFSA 2ZJRL 2P9IA 4PHTX 4CEFA 1QVFM 2OTLN 4A59A 4FW2A 5HRPA 5EOYA 4FLTA 5BR9A 2WTUA 4BREA 3M8SA 1O1WA 4WYBA 3ZSRA 1VSEA 3SBTA 3SUNA 2PY5A 1Z6RA 1KVAA 2X6NA 4KV8A 4BRQA 3C6HA 3KZBA 1ASWA 3FGUA 2F4VK 1LAVA 2VWKA 4FZZA 1U04A 1S9GA 2G8WA 2JGUA 1LWFA 3D2EA 1RBTA 1A5XA 2YHAA 3OYAA 2E1ZA 3RSEB 5BPNA 4B9NA 2ETJA 1LW2A 1Y97A 3O9RA 3VTIA 3RWUA 3SAFA 4WQ5A 2NNWA 4CCHA 3H08A 1ILYA 1N33K 4FWRA 2IVPA 4OKJA 3VF6A 1HYVA 1VSKA 2ASMA 2HHIA 2Q0UA 4BGBA 4KTZA 3DXMA 3MWPA 5ADXA 2HHXA 1BISA 3DJCA 4Y1CA 4B1UB 1J6ZA 3KIOA 3I0SA 4YFUA 3D2FA 5C15A 2DFEA 4NXMK 1J9AA 3JYTA 1RT2A 4CJEA 3CCJN 4KHQA 4CERA 3CM6A 3W0LA 1J54A 3SV4A 2E4LA 3V9SA 4DV7K 5JVGL 3OHRA 4JI5K 4MLHA 3VGKA 4J2EA 4ISEA 1NK0A 3TTCA 5AFUH 1S5JA 1NJZA 4R5PA 4BRLA 3NHGA 3V1QA 4M41A 3VQEA 1YJWN 4FO0A 4K41A 3ALYA 1MDUB 3EEQA 1RDWX 3FFKB 2FSNA 2IGIA 4OLBA 2Z1GA 3CJ1A 2FC0A 2ZF5O 1OKJA 3H1QA 1L3VA 3ASMA 5HOOA 3FE1A 3SUPA 4FLWA 3KD1E 4LFAK 4OKKA 3P83D 2E6LA 4DTJA 3TI0A 1C6VA 4ZTFA 4BQLA 3UKUA 1KLNA 3OYCA 2QWQA 1U48A 4GW6A 3THYB 3CQYA 4YORA 1S1UA 4PKHA 3E9PA 4YY3K 1UA1A 4W5RA 2G8IA 4W5TA 2HF3A 4O5FA 3K5NA 3F5TA 4FJJA 3ZX2A 4N56A 1X9MA 4NCAA 4KHNA 1OVYA 1W9HA 1ZC6A 1RNHA 3OYLA 4QAGA 3NF8A 1V4TA 4JI0K 3D0PA 5CY4A 3OYHA 1JLFA 1IJJA 4BRNA 3JS6A 4KH5A 5BR8K 2QWRA 4JI6K 4DUZK 4DV1K 3OYEA 1Q86O 4CZJA 4JD2B 3P31A 1NGAA 1XC9A 2P9LB 2P9NA 3O3FA 3T1HK 4CFDA 5J2PA 1TAUA 3OJSA 2Q2RA 5M1FA 1T44A 1NGDA 4E19A 4CZLA 4HTUA 4CVNE 3T69A 4WCEL 3MWTA 3MN5A 3VGLA 1H1VA 1X3MA 2P5GA 1W97L 3KLFA 4A57A 4OO1J 1KAXA 1NKEA 3EE8A 3E9LA 3T7ZA 3SI6A 4FJNA 3GE1A 4BWJA 2V52B 4BRCA 1HQUA 3M8RA 4KFBA 1KCFA 1NJIO 2J4RA 4H0TB 4DS4A 1U6ZA 3V1OA 3WEEB 2UXBK 2X6SA 3J7AP 3OYJA 4B08A 4F2RA 1QQMA 5E26A 2P9KA 2VG5A 3HPHA 1S6QA 4FWKA 2ZE2A 4HUFA 3E9OA 3ZETA 1IV0A 4H0OA 4O4GA 3THWA 4I2QA 1XHZA 1YT3A 2NRTA 2Q1NA 4M45A 2Y1JA 3VA0A 2O8CB 4B9VA 4O8KA 3NGIA 1S1VA 2F8TA 3O4WA 4FOIA 3DLHA 4KKOA 1RTJA 4DV4K 4E1NA 4I6MA 5J2NA 4ISGA 3M6GA 4B9LA 5AQPA 2QXLA 3O1WA 4KHSA 5KRSA 3LDSA 4IOAL 2IVOA 4DV2K 3ULEA 4LSLA 4JKCA 1HKBA 2A42A 3MEEA 1NJWA 5GAEP 1C0FA 2HMPA 3QB0A 1IBMK 5JVHL 3LP1A 2WUSA 5F2RA 2HNYA 1D8YA 3OJUA 4F4KA 3CFRA 1EETA 4OLAA 2FBYA 1HUXA 4GVMA 2BTFA 1VSHA 4IJAA 3SYZA 2BE2A 3O9QA 2QW9A 4B3OA 4IBNA 3H46O 4CD3A 2HW3A 2GUIA 1NGFA 1XWLA 5BPLA 3AVNA 2IC3A 2F9WA 3J8AA 3VQ6A 3PLAA 1K8KB 4FOEA 4CF2A 3DLLL 2ASOA 3SJJA 3AO4A 2OZMA 3IDHA 4DTOA 3N4QA 2HVHA 4M3WA 3QNNA 2BGGA 4B3RK 1TK8A 4G1QA 3CI5A 1CZAN 4YOYA 4IFEA 4AQYK 1VSLA 1JJ2M 2A6AA 3LPTA 4FVUA 1T6CA 3QEIA 4CECA 4N5SA 4DB3A 3CM5A 5HRRA 2QKKA 1U47A 2QWPA 2E2QA 4DFJA 3CC7N 4YHHK 2XRIA 5AQYA 3LP0A 4BROA 3C94A 3AA4A 5C42A 1E4FT 4BRDA 4NXNK 4FJXA 3HPOA 3HK2A 3MN6A 4MDBA 5M1PA 4B8CA 3NGYA 4DKWA 1SKWA 3MMVA 3H1VX 2E5LK 3FZLA 3MDQA 5AQXA 1TV6A 1L3UA 2OANA 3GDQA 1TYQB 2P9UB 3TSUA 2E6MA 5AQLA 2NRWA 1A5VA 3BP8A 3KKSA 3WNGA 1RT3A 4DU1A 3CJ9A 3VEOA 1JCGA 4DQQA 4AHCA 1IKWA 5ELZA 1CZBA 3S9HA 3RR7A 4C8MA 1YITN 4GMJB 4NCGA 1KC8O 3VQPA 4FPBA 4IKFA 2GELA 4WQ4C 5KI6A 1BA1A 4CJKA 3AY9A 3S41A 2P1JA 4C8OA 4BE1A 3UIQA 2D0PA 2OTJN 4W5QA 1HLUA 3K57A 4X65K 3BDPA 3HRGA 4FPAA 3AVKA 4NCBA 4Z4IA 3QINA 4Y0WA 1HJOA 1BDGA 1NGGA 3HP9A 4DV3K 1XQSC 1NK5A 1VQPN 3D6RA 5BN8A 3IKMA 5HRSA 1SL0A 1SKRA 2UUAK 1UOCA 4DR2K 1U2VB 3K2PA 1C0UA 4XH4A 1WBBA 3OTOK 3HOTA 3OY9A 1C1AA 2RHKA 3QERA 4GV9A 4BRKA 2GV9A 4Z4GA 5GAGP 3OS0A 4JI1K 4CGFA 1ZBIA 3O3HA 2NRRA 3ZSOA 4C8LA 5BPMA 1TL1A 3U9DA 3SBGA 5KPRA 3HP6A 2W00A 4CZGA 1S22A 4IDKA 5FPEA 1P8ZA 5C12A 5TKYA 3EY1A 4CJLA 1VHXA 1SKSA 1NNEA 2KZMA 3KK3A 3HSCA 3VESA 1EWRA 4GNIA 1GLLO 3SJHA 3L2VA 5T7BA 3PV8A 4H0YB 1ZBHA 4FSVA 4MLEA 4CGHA 4JKEA 3VETA 4JNEA 4CE9A 4CHOA 5EVZA 1Y64A 2BUPA 4V19S 4IO9L 2FF3B 3VQ5A 4GV3A 2IIRA 2RKIA 4AM7A 2CGKA 3HL8A 5BRFA 4CEDA 4LY7A 3PY8A 1RT5A 3RRHA 3R1XA 5FPDA 1IKXA 2O8FB 4A5BA 4PL8A 1ZBLA 1BA0A 2WFBA 4IG3A 2HB5A 2O8BB 3D2FB 3K59A 1VQ5N 1N36K 4L3QA 3VERA 3S3NA 3OYMA 2DY4A 3ZT3A 3A8YA 4ZTJA 3SCXA 1IG8A 3NAEA 2YNGA 3OYGA 2QI2A 3ZYYX 5FRMA 4FXDA 2EWSA 4JHDB 1XHXA 1J53A 1VSIA 4M3XA 2YI1A 4BR0A 3RRGA 4AHTA 4FJIA 5DK5A 3F9MA 3LALA 4DFKA 3UKRA 1HNZK 2BDPA 3TABA 3G6EN 2PYJA 3WXKA 3J81O 4IFVA 4FJLA 1DLOA 4LF7K 4CJPA 1HMVA 2I7PA 2NRZA 3P5JA 4BVOA 2DFHA 2HBJA 3BZCA 4RW6A 4CFBA 4U67L 1RBRA 5AQKA 3UKUB 5M1NA 5AQVA 3VQDA 1GOAA 5LL6Z 3MXMA 3O9UA 1LCUA 4ILHA 3TU5A 4O55A 3FR0A 1HRHA 3DOLA 3KTQA 1KTQA 4LF5K 4BWMA 4YOWA 3TARA 2VG6A 1NWKA 3EL2A 4N41A 3KLGA 5FDLA 3T1YK 2VQEK 3VPZA 4H5VA 3RMBA 3CG7A 5C2DA 2B6AA 3ZT0A 1ZYQA 1HNXK 3SQ0A 2XY8A 1WUAA 3QESA 1IG9A 1TK0A 1VK0A 1RTHA 3U6FA 4F3OA 4LFCK 3D7EO 4DU4A 4JKHA 1RFQA 2A1SA 4DF4A 4KAZA 2G8UA 4JKBA 5IWAK 1NG9A 1Q7YO 4O0JA 3ZSZA 3C0BA 4CF0A 3TAQA 3BY5A 4GVEA 1QSSA 4M3ZA 1WN7A 4K25A 3SQ4A 4CHZA 4KREA 4RCHA 3EO3A 4DR1K 1NGCA 3EYZA 1NGBA 3SUQA 1EXQA 1QVGM 3AO5A 3O3GA 1X3NA 1BL3A 3NH0A 2D1KA 1BQNA 3BZKA 2D0BA 3LANA 3PUFA 2F8SA 2E2PA 1YF5L 3DRRA 1E4GT 4ZHRA 2YX6A 2IDOA 4F8RA 2YNHA 4K43A 4YOXA 2QWNA 3VGMA 3ENBA 4FM2A 4C8NA 3HVTA 3ATVA 3ATUA 4AILC 1CXUA 4JK9A 4BECA 4CGGA 3NMUA 4IOXA 2OPSA 3MXJA 2O8DA 3PSIA 4FZYA 3CJAA 4RWTA 1JKHA 3KD5E 4HWIA 3DLRA 4JI4K 4FVMA 1RBSA 4CJ4A 1YTUA 3ZSYA 2GUPA 1X9SA 4CGDA 2E2NA 5CZ2A 1YIJN 2A5XA 1TUUA 4H0XB 1QS4A 3J7ZO 4E7KA 1XUPO 4I6MB 5AQGA 4QS9A 3K0SA 1VQNN 3U8XA 5GAHP 4B1XB 1FKOA 1TAQA 3AA5X 5EX5A 1RTDA 3ULEB 2NRVA 4H5RA 1KRPA 4HHTA 2Q3SA 1BI4B 3GBTA 4NLBA 4DHYA 4H4MA 3TAGA 4UQGA 3CPEA 3U4LA 3HI0A 4CW7B 4GY2B 5FPNA 1T03A 5DMRA 2HHVA 3VQCA 3SMSA 3K9JA 1HX1A 1KLMA 1W7AA 4FJ5A 3C95A 3AVHA 2NRXA 2PFUA 4Z4HA 4CJVA 3K9KA 2QTDA 3ZEUA 3DMJA 4L8RB 5B8HA 3V9UA 1VQ6N 3V4IA 4DR7K 1VQMN 4FWLA 3SUOA 5BRHA 1MU2A 4ELUA 4O5BA 1WB9A 3WQTA 1MWKA 5AZJA 1NK7A 4ELTA 4DSIA 3VF4A 2Q31A 1Q18A 2ZQBA 5LMNK 4FLZA 1RDAA 3C7NB 2PZSA 1YAGA 4FYDA 5FLXO 4DR3K 3LDLA 2HHSA 3IAYA 2H3GX 4DLGA 3THVA 3V6DA 4JI8K 4RW8A 4B9TA 3AVAA 4W5NA 3C6UA 3MK6A 4B1YB 1NMDA 3SAGA 2FBVA 3QEXA 2A1RA 1BU6O 1JXBA 4LD0A 5I3UA 1W0HA 3OW2M 1HJRA 3OYKA 4C1NK 1E3MA 2YCHA 1SS6A 1D4XA 3CJCA 1HNIA 3LDQA 4YDUA 3VQAA 1VQON 3ENOA 3RTVA 2ITMA 1X9JA 3WQUA 1C1CA 4DQSA 4H03B 2GTDA 4OPHA 5CHIA 2KHOA 2IVNA 3LP3A 3WXMB 3MEGA 1OH8A 2FBTA 4Q0BA 3I8DA 4FL9A 4WF9L 4DV6K 4PY5A 4QOZB 3DWLA 1WBDA 3V9XA 4CF8A 3AO3A 1LAWA 5GIPA 4Q5VA 1QSYA 3O4NA 1ZBFA 1XC3A 1FKPA 2YJEA 3LP2A 4BDYA 2P9SB 5KPTA 2F96A 2KFNA 4DQIA 2P9PB 4B1ZA 4I7FA 4CI6A 4EHUA 1LW0A 1VRUA 3QICA 2VWBA 4QS7A 3S5TA 3PX4A 1RILA 2LSNA 3VEWA 3QMLA 3LM9A 2DTUA 1QQOA 1QZ5A 1ATSA 2FF6A 4HUGA 4FJGA 2V51B 3MCPA 4CJSA 3H6EA 4DF8A 3RR8A 4B9SA 1NGJA 2VG7A 4FWSA 5M1OA 2QWLA 4DFPA 4DU3A 3AGKA 5K14A 2QK9A 4GV6A 3LWLA 2O4GA 1VRTA 3HTVA 3G0ZA 4K42A 1KD1O 4JV5K 3NFAA 5GIOA 3TAMA 5FPMA 3QEPA 1D9DA 4O8UA 3TSQA 3K5OA 3DXKB 3T19A 4HCCA 1BG3A 1WNSA 5J2QA 3AO2A 3QLHA 5KRTA 3LZIA 3AVIA 3RSEA 4DG1A 4MFBA 3L3UA 1GLDG 3QEVA 3KWIA 3K5LA 3PO5A 1S1XA 3ZX0A 3TAFA 5JENA 2VYPA 4CFAA 2G8VA 3LL3A 3O4QA 2HNZA 1Q82O 4LH4A 4FJ9A 5M1QA 4M3YA 4BRHA 4E1MA 2FSJA 1XI1A 1SZ2A 3IS9A 4FK0A 1XMQK 5CZ1A 4H5NA 3E01A 3SNNA 2NLXA 3KLHA 3WNFA 1WAJA 3VN5A 2A3ZA 4DTXA 3CPWM 3DLGA 2QWOA 4EZ6A 2YJFA 4CJQA 3R9PA 5J1EA 4PQUA 5CR4A 1M90O 3AO1A 1NK6A 4U7BA 1NU0A 3VENA 1YTAA 1RBUA 1P90A 3VQ7A 3L3VA 4Z4EA 4EZ9A 2YV0X 1RBVA 4DUYK 3VEXA 4Z4CA 4F2SA 4BQZA 1L3TA 1SAZA 1YUWA 5KTQA 3AAPA 4PUOA 3NF9A 3LDNA 1QQNA 2HBKA 1GLFO 3CIPA 3ZCMA 5AZIB 3GG4A 3NVMA 1TGOA 3THYA 2ZM6K 2AA4A 2E1YA 3KVGA 1NK9A 3WT0A 4X66K 3WNEA 1TKXA 3SK3A 3HBTA 3I33A 3JAMO 2B4JA 2ITGA 4ILJA 2ATQA 1L3SA 2HMIA 4CIFA 1JL1A 4BRFA 3QBXA 2VGMA 5AQOA 3TTDA 1HNWK 3SQ1A 4Z94A 5AQMA 1KQSM 3NGZA 2GWJA 2Q97A 3KK1A 2G8FA 2JWLA 3CMAN 1NKCA 1BUPA 1IKVA 4JI3K 1ATNA 1EP4A 4BVPA 1NOYA 5I42A 4JD2A 3CCVN 2P9LA 3FZMA 3GL1A 4CJ5A 4CF9A 2QWMA 1GLBG 5CYQA 1BQMA 3S3OA 3JSMA 3CC2N 1CZ9A 1N32K 5AQIA 4XIUA 3THXB 4DSJA 1EO1A 4X62K 2YKMA 1B9FA 2CGJA 4KB0A 3MXIA 2HHWA 3RMAA 4BR7A 4BR9A 2FBXA 3CETA 3WEEA 4H5WA 4NB4A 3ZSQA 4BE7B 4KTWA 5CE3A 3HYFA 2UYTA 4N76A 4BRAA 4CHQA 3HZ6A 1S1TA 3ZT2A 2WBNA 1V4SA 5E84A 1D9FA 4JN4A 4LFBK 3ID6A 3SMPA 4PA1A 3B6OA 2O8CA 3L0QA 3ZT4A 4IDHA 2P9IB 4F3TA 2O8EA 1MA9B 5C10A 2AJQA 3DI6A 4DR5K 5AQQA 4DS5A 4CEAA 1J5OA 1GOCA 4GKJK 4Z4FA 5DM6L 3LM2A 4CF1A 5E41A 3R3LA 4KPYA 3L2UA 3SZ2A 4NLCA 1I39A 3M1FA 4FCYA 2HBMA 3BEXA 3D2EB 3NCIA 4BG9A 4PKIA 2A41A 3DOKA 4JRPA 2XO7A 3PSFA 1RCHA 2OPRA 4CGIA 1ASUA 4M3RA 3A5NC 2QEXN 4PKGA
chains in the Genus database with same CATH topology
4JD2B 3P31A 1YVNA 1NGAA 2P9LB 3VEVA 3CCMN 2GEMA 2P9NA 2RE2A 3UKRB 2W41A 3ATVA 3ATUA 1VAZA 4JK9A 4JKDA 4CJ7A 4BECA 3NMUA 3DXMB 4IOXA 1KAZA 2Q2RA 4IXCA 4WFNL 4IJNA 5M1FA 3CJAA 3TSPA 4RWTA 1T44A 1NGDA 4HWIA 4CZLA 3I56N 4BEBA 3T69A 4WCEL 3MWTA 3MN5A 4FWOA 1H1VA 2GUPA 4H0PA 4WQ4A 3VGLA 1X3MA 2E2NA 1YIJN 5AFUA 3CCEN 2A5XA 1W97L 4A57A 1TUUA 4H0XB 4OO1J 1KAXA 2HF4A 3EE8A 4QS8A 3J7ZO 1K8KA 3E9LA 4JAXA 3T7ZA 3QFUA 1N8RO 1XUPO 3O08A 4I6MB 5AQGA 4QS9A 3GE1A 4CZHA 2V52B 4BRCA 1VQNN 3MX5A 3U8XA 5GAHP 4B1XB 5AQFA 2ZJPL 2J4RA 1NJIO 5EX5A 4H0TB 3FZFA 3ULEB 2NRVA 4CZMA 2E2OA 2PBDA 5JICA 1U6ZA 4H5RA 3WEEB 3TPQA 3C65A 1ZBSA 1QQMA 5E26A 2P9KA 4M7YA 5BRDA 3GBTA 1NM1A 4NLBA 4DHYA 5AQNA 4CBXA 4FWKA 3CPEA 2VCPA 2HSTA 1KAYA 5AQSA 3E9OA 3U4LA 4BRPA 3ZETA 3A5OC 3UB5A 3CD6N 3HI0A 4H0OA 3UE5A 2GWKA 3O80A 4GY2B 3RVCA 1GLAG 5FPNA 2NRTA 2Q1NA 3EKSA 3SMSA 2E8AA 2P9SA 1HX1A 3K9JA 4O8KA 3I55N 2P9PA 3GOIA 3KWGA 3O4WA 4FOIA 3VMFB 2NRXA 2PFUA 1TUYA 3MX2A 4I6MA 4EHTA 4ISGA 3M6GA 1HKCA 2QTDA 3K9KA 3ZEUA 4CZKA 5B8HA 5AQPA 2QXLA 3O1WA 3FZKA 1VQ6N 4OPAA 3I8BA 1VQMN 4FWLA 5BRHA 2IVOA 4KBOA 4IOAL 3O9TA 3ULEA 4JKCA 3WQTA 1MWKA 5AZJA 4BGAA 1HKBA 2A42A 1DGKN 5I9EB 3VF4A 5KQDA 2Q31A 4IEEA 1TYQA 2P9UA 5GAEP 1C0FA 2HMPA 3QB0A 4MO4A 4WQ5C 4BC2A 1Q18A 5JVHL 4CZIA 4AM6A 5AQTA 5C2FA 5AQUA 1YI2N 3AAQA 2WUSA 3C7NB 3FZHA 1BOTO 3HM8A 3KHYA 2WC9A 5F2RA 1YAGA 3R8EA 4CZEA 4R79A 4AF1A 3LDLA 4CD1A 5JLHA 2YHXA 2H3GX 4A2BA 3R6MA 1K73O 3DAWA 5JMVA 1HUXA 1YXQA 3EN9A 1K8AO 2P9NB 2BTFA 1NGHA 4JKGB 4IJAA 3MK6A 2D4WA 4B1YB 1NMDA 3SAGA 3O9QA 2QW9A 1BU6O 4BC3A 1G99A 1RDUA 1EQYA 3H46O 2QA4N 1S3XA 2NZTA 5DM7L 3OW2M 4CD3A 1R59O 3CERA 4NO7A 3O9SA 4C1NK 2YCHA 1SS6A 3DXKA 1D4XA 2JWKA 1NGFA 4M7XA 3CJCA 5BPLA 4BG8A 4C23A 2ZJQL 3CJ7A 3LDQA 2F9WA 4YDUA 3J8AA 4XH1A 1VQON 2F7TA 3ENOA 1VQLN 3PLAA 2ITMA 1X9JA 5HL7L 1K8KB 4FOEA 3G71N 3ZX3A 3DLLL 3WQUA 2ASOA 1YHQN 5ADXH 4H03B 2GTDA 4MO5A 4OPHA 5CHIA 1Q81O 3IDHA 2KHOA 2C1IA 2IVNA 3WXMB 3N4QA 2HOEA 3IMXA 3BUZB 3O6WA 4FL9A 4WF9L 4IWVA 4J8FA 1BWFO 4CZJA 2ASPA 4PL7A 3CI5A 2VGNA 3DWLA 2YHYA 1U2VA 1CZAN 4YOYA 4IFEA 4JKGA 1QZ6A 2P9KB 4CZFA 1JJ2M 3P39A 2A6AA 1ZXOA 4WFAL 4JK8A 3EE9A 4CBUA 3ZETB 5GIPA 4FVUA 1T6CA 1ESVA 1T3VA 3IUCA 3ENHA 4DB3A 3WXLA 3SAHA 1XC3A 5AQRA 2QWPA 2E2QA 3CC7N 2YJEA 5EXWA 2P9SB 1NLVA 3JXUA 5AQYA 3E1YA 5KPTA 2BH1A 2P9PB 4B1ZA 4BROA 5JLFA 1E4FT 4BRDA 3CCQN 1M1KO 4CI6A 4IEIA 3MN6A 4EHUA 3A5MC 3ZEUB 4ILGB 4MDBA 4YDUC 5M1PA 3WUHA 3QICA 2VWBA 2KKZA 4QS7A 1K9MO 4DKWA 3MMVA 3A5LC 3H1VX 4FWMA 3FZLA 3MDQA 5AQXA 5AZJB 3VEWA 3CF5L 3QMLA 2CH6A 2E20A 3LM9A 2OANA 1QQOA 3GDQA 1TYQB 2P9UB 3TSUA 1QZ5A 2KLAA 1ATSA 2PAVA 5LY3A 5AQLA 2NRWA 3BP8A 1T6DA 2FF6A 2AP1A 2V51B 3VF2A 2FLOA 3CJ9A 3MCPA 4HTLA 3H6EA 4YOUA 3VEOA 1JCGA 1NGJA 3O1BA 5ELZA 3CCSN 1YITN 5LJWA 4FWSA 5M1OA 4UY8O 2QWLA 5H1SQ 2HBLA 4DQ8A 3AGKA 1ATRA 4A61A 1KC8O 4B1WB 4GV6A 2C1GA 3AARA 3PIOL 4JK7A 1MWMA 3HTVA 5AZIA 4FPBA 1DKGD 1VQ7N 4K42A 2GELA 2D0OA 4WQ4C 1KD1O 3L4IA 5M1KA 5GIOA 2V7YA 2I7NA 1BA1A 3A0IX 1LOTB 5FPMA 3AY9A 3S41A 2FXUA 1O13A 2YHWA 4O8UA 1HPMA 3Q7CA 3TSQA 2D0PA 3DXKB 2OTJN 4B9QA 1HLUA 4ISFA 5KPZA 3PIPL 4FWPA 1QHAA 1BG3A 4YOTA 3HRGA 4FPAA 3B8AX 4BRGA 4Y0WA 1HJOA 5AQHA 1BDGA 1NGGA 3RSEA 3VEZA 4B1VA 1GLDG 1XQSC 3VEYA 3KWIA 4JHDA 1YJNN 1VQPN 3D6RA 3IFRA 3IKMA 5BN8A 1W2BM 3ID8A 2ZGYA 3U9ZA 3ZX0A 5C0YA 2VYPA 3LL3A 5AQJA 1SQKA 1YJ9N 4G9ZA 3CMEN 1U2VB 3EZWA 1Q82O 2F9TA 3L4QA 5TKWA 4XH4A 5M1QA 5LJVA 3HOTA 4A2AA 3F2KA 2RHKA 4BRHA 1KXPA 2FSJA 4GV9A 1SZ2A 4BRKA 2CGLA 1VQ8N 3Q7BA 1BO5O 4IO8A 4H5NA 5GAGP 4BY9C 3CHWA 3CCRN 2NLXA 4C1NI 3G4SN 4BC4A 2NRRA 4EIAA 4XJXA 5BPMA 3MCAB 3U9DA 3SBGA 2A3ZA 4IOCL 1Z05A 5KPRA 3FLCO 3EKUA 3CPWM 2QWOA 2YJFA 3CCUN 1DT9A 3L6QA 5AR0A 3C6AA 5AQZA 5BN9A 2W00A 4CZGA 1S22A 4XH5A 3QFPA 3R9PA 5BREA 4F9OA 5FPEA 1P8ZA 3O5BA 4BRMA 5C12A 2ZGZA 5TKYA 5CR4A 1GLCG 1M90O 1GLEG 4A5AA 3BF1A 4U7BA 3VENA 1JCFA 3HSCA 4BR4A 3CXCM 4BRIA 3VESA 3LDOA 1P90A 4GNIA 1GLLO 3SJHA 1WOQA 4H0YB 4YOVA 4FSVA 1VQKN 2GX9A 4MLEA 4FWNA 3VEXA 5F1XA 1C0GA 5MLCQ 4BR5A 3LDPA 4BQZA 4JKEA 3E66A 3VETA 2ZWHA 1SAZA 1YUWA 4E1JA 4JNEA 5EVZA 3G25A 1JCEA 3AAPA 1Y64A 1QQNA 2BUPA 3LDNA 5AQWA 2FF3B 4IO9L 4GV3A 2HBKA 2IIRA 2ZJRL 1RGIA 4AM7A 2P9IA 4PHTX 3AGRA 1GLFO 2CGKA 3N4PA 3CIPA 4A62A 2OTLN 1QVFM 4JKAA 5AZIB 4A59A 3GG4A 3MN7A 3NVMA 5BRFA 1NGEA 4FWQA 5EOYA 4BC5A 2AA4A 2E1YA 3KVGA 5BR9A 3R1XA 2FSKA 3WT0A 4BREA 5GADP 5FPDA 4WYBA 4A5BA 4PL8A 1BA0A 2WFBA 3SBTA 3SK3A 5F0XA 1Z6RA 3CQXA 3D2FB 3HBTA 1VQ5N 3I33A 4L3QA 4BRQA 3C6HA 3VERA 4ILJA 3KZBA 3HOSA 4IZ9A 3FGUA 1VQ4N 4BRFA 4BR2A 3QBXA 2VGMA 5AQOA 3TTDA 3A8YA 4Z94A 1IG8A 5AQMA 3D2EA 1KQSM 2GWJA 2E1ZA 2Q97A 3RSEB 5BPNA 2JWLA 3CMAN 2A40A 2QI2A 3ZYYX 1BUPA 4CBWA 3O9RA 4EFHA 3H45C 3VTIA 2EWSA 4JHDB 1ATNA 3SAFA 4WQ5A 2NNWA 4BVPA 1ILYA 5GINA 2YI1A 4FWRA 4BR0A 2IVPA 4EAHD 4JD2A 1DEJA 2Q0RA 3VF6A 2P9LA 3CCVN 3FZMA 3GL1A 3F9MA 3UKRA 2ASMA 2Q36A 2Q0UA 3G6EN 3WXKA 4BGBA 1HKGA 2QWMA 1GLBG 3DXMA 3MWPA 3H3NO 5ADXA 4M63C 3DJCA 4H0VB 4B1UB 3CC2N 1J6ZA 3D2FA 3WXIA 3TTFA 2I7PA 2NRZA 5AQIA 1EO1A 2E88A 4BVOA 5C15A 3MN9A 2HBJA 3CCJN 1S72N 3VOVA 4H5TA 4U67L 1VQ9N 3W0LA 3BF3A 5AQKA 3WXJA 4XEIA 2CGJA 3UKUB 3H3OB 5EY4A 3P4IA 5AQVA 5M1NA 5JVGL 3CJBA 3O9UA 3OHRA 3P38A 1LCUA 4ILHA 4BR7A 3TU5A 4BR9A 4MLHA 3FR0A 3VGKA 4JKFA 4MDAA 4WFBL 4ISEA 3CETA 3WEEA 4H5WA 3M5RA 4NB4A 3TTCA 5AFUH 3VTHA 4YOWA 4BE7B 1NWKA 3EL2A 4BRLA 5CE3A 2UYTA 2DPNA 1YJWN 3VPZA 4FO0A 4H5VA 4K41A 1MDUB 4BRAA 5C2DA 1RDWX 3HZ6A 4KH6A 3FFKB 2FSNA 1WUAA 3CJ1A 2WBNA 2ZF5O 4LC9B 1OKJA 1V4SA 3H1QA 3KK7A 5E84A 3M3ZA 5HOOA 2W40A 3FE1A 2V7ZA 4JN4A 3W3DA 3ID6A 3SMPA 3D7EO 3L0QA 4JKHA 1RFQA 2NRHA 4IDHA 2P9IB 3SLCA 4RTFD 1MA9B 5C10A 4BQLA 3UKUA 4JKBA 2QWQA 5AQQA 1Q7YO 3C0BA 3CQYA 4YORA 3OBYA 4PKHA 3QBWA 4GVEA 4KH4A 3E9PA 3CC4N 4K25A 1NBWA 5DM6L 3OBWA 3LM2A 2HF3A 4O5FA 3R3LA 4RCHA 3F5TA 3EO3A 4NLCA 2QM1A 4JEPA 3ZX2A 3M1FA 1NGCA 1NGBA 1GLJO 3QDKA 1QVGM 3OA9A 2HBMA 1X3NA 5KQ8A 1OVYA 1ZC6A 2D1KA 3BEXA 3NVKA 3D2EB 3O8MA 4BG9A 1V4TA 2CH5A 4DCHA 3C7NA 4PKIA 2A41A 2E2PA 1NGIA 1YF5L 1IJJA 1E4GT 4BRNA 3JS6A 2YX6A 4KH5A 2QWRA 3A5NC 4K43A 3CCLN 4YOXA 2QEXN 2QWNA 3VGMA 4PKGA 1Q86O 3ENBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JD2 B;  1YVN A;  1NGA A;  2P9L B;  3VEV A;  2GEM A;  2P9N A;  3UKR B;  2W41 A;  3ATV A;  3ATU A;  4CJ7 A;  3DXM B;  1KAZ A;  2Q2R A;  4IXC A;  4IJN A;  3CJA A;  4RWT A;  1T44 A;  1NGD A;  4HWI A;  4CZL A;  3MN5 A;  4FWO A;  1H1V A;  2GUP A;  4H0P A;  4WQ4 A;  3VGL A;  1X3M A;  2E2N A;  5AFU A;  2A5X A;  1TUU A;  4H0X B;  1KAX A;  2HF4 A;  4QS8 A;  1K8K A;  4JAX A;  3QFU A;  1XUP O;  3O08 A;  4I6M B;  5AQG A;  4QS9 A;  3GE1 A;  4CZH A;  2V52 B;  4BRC A;  3U8X A;  4B1X B;  5AQF A;  2J4R A;  5EX5 A;  4H0T B;  3FZF A;  3ULE B;  4CZM A;  2E2O A;  2PBD A;  5JIC A;  1U6Z A;  4H5R A;  3WEE B;  3TPQ A;  1ZBS A;  1QQM A;  5E26 A;  2P9K A;  4M7Y A;  5BRD A;  3GBT A;  1NM1 A;  4DHY A;  5AQN A;  4CBX A;  4FWK A;  2VCP A;  3U4L A;  1KAY A;  5AQS A;  4BRP A;  3ZET A;  3A5O C;  3UB5 A;  3HI0 A;  4H0O A;  3UE5 A;  2GWK A;  3O80 A;  4GY2 B;  1GLA G;  5FPN A;  2Q1N A;  3EKS A;  3SMS A;  2E8A A;  2P9S A;  1HX1 A;  4O8K A;  2P9P A;  3GOI A;  3O4W A;  4FOI A;  1TUY A;  4I6M A;  4EHT A;  4ISG A;  3M6G A;  1HKC A;  3ZEU A;  4CZK A;  5B8H A;  5AQP A;  2QXL A;  3O1W A;  3FZK A;  3I8B A;  4FWL A;  5BRH A;  2IVO A;  4KBO A;  3ULE A;  3WQT A;  1MWK A;  5AZJ A;  4BGA A;  1HKB A;  2A42 A;  1DGK N;  5I9E B;  3VF4 A;  5KQD A;  2Q31 A;  1TYQ A;  2P9U A;  1C0F A;  2HMP A;  3QB0 A;  4MO4 A;  4WQ5 C;  4BC2 A;  1Q18 A;  4CZI A;  4AM6 A;  5AQT A;  5AQU A;  3AAQ A;  2WUS A;  3C7N B;  3FZH A;  1BOT O;  3HM8 A;  3KHY A;  5F2R A;  3R8E A;  1YAG A;  4CZE A;  4CD1 A;  3LDL A;  5JLH A;  2YHX A;  2H3G X;  4A2B A;  3R6M A;  3DAW A;  5JMV A;  1HUX A;  1YXQ A;  3EN9 A;  2P9N B;  2BTF A;  1NGH A;  4IJA A;  3MK6 A;  2D4W A;  4B1Y B;  1NMD A;  2QW9 A;  1BU6 O;  4BC3 A;  1G99 A;  1EQY A;  3H46 O;  1S3X A;  2NZT A;  4CD3 A;  1R59 O;  3CER A;  4NO7 A;  2YCH A;  3DXK A;  1D4X A;  1NGF A;  4M7X A;  3CJC A;  5BPL A;  4BG8 A;  4C23 A;  3CJ7 A;  3LDQ A;  2F9W A;  4YDU A;  3J8A A;  4XH1 A;  3ENO A;  2ITM A;  1X9J A;  1K8K B;  4FOE A;  3ZX3 A;  3WQU A;  2ASO A;  5ADX H;  4H03 B;  2GTD A;  4MO5 A;  3IDH A;  2KHO A;  2IVN A;  2HOE A;  3IMX A;  3BUZ B;  3O6W A;  4FL9 A;  4IWV A;  4J8F A;  1BWF O;  2ASP A;  4PL7 A;  3CI5 A;  3DWL A;  2YHY A;  1U2V A;  1CZA N;  1QZ6 A;  2P9K B;  4CZF A;  2A6A A;  1ZXO A;  4CBU A;  3ZET B;  1T6C A;  1ESV A;  3IUC A;  3ENH A;  4DB3 A;  3WXL A;  1XC3 A;  5AQR A;  2QWP A;  2E2Q A;  2YJE A;  5EXW A;  2P9S B;  1NLV A;  3JXU A;  5AQY A;  5KPT A;  2P9P B;  4B1Z A;  4BRO A;  5JLF A;  1E4F T;  4BRD A;  4CI6 A;  3MN6 A;  4EHU A;  3A5M C;  3ZEU B;  4YDU C;  3WUH A;  3QIC A;  2VWB A;  4QS7 A;  3MMV A;  3A5L C;  3H1V X;  4FWM A;  3FZL A;  3MDQ A;  5AQX A;  5AZJ B;  3VEW A;  3QML A;  2CH6 A;  2E20 A;  3LM9 A;  2OAN A;  1QQO A;  3GDQ A;  1TYQ B;  2P9U B;  1QZ5 A;  1ATS A;  2PAV A;  5LY3 A;  5AQL A;  3BP8 A;  1T6D A;  2FF6 A;  2AP1 A;  2V51 B;  3VF2 A;  2FLO A;  3CJ9 A;  3MCP A;  4HTL A;  3H6E A;  3VEO A;  1JCG A;  1NGJ A;  3O1B A;  5ELZ A;  5LJW A;  4FWS A;  2QWL A;  4DQ8 A;  1ATR A;  4A61 A;  4B1W B;  3AAR A;  1MWM A;  3HTV A;  5AZI A;  4FPB A;  1DKG D;  4K42 A;  2GEL A;  2D0O A;  4WQ4 C;  3L4I A;  2V7Y A;  2I7N A;  1BA1 A;  3A0I X;  1LOT B;  5FPM A;  3AY9 A;  3S41 A;  2FXU A;  2YHW A;  1HPM A;  2D0P A;  3DXK B;  4B9Q A;  1HLU A;  4ISF A;  5KPZ A;  4FWP A;  1QHA A;  1BG3 A;  4FPA A;  3B8A X;  4BRG A;  4Y0W A;  1HJO A;  5AQH A;  1BDG A;  1NGG A;  3RSE A;  3VEZ A;  4B1V A;  1GLD G;  1XQS C;  3VEY A;  4JHD A;  5BN8 A;  3IFR A;  3ID8 A;  2ZGY A;  3U9Z A;  3ZX0 A;  2VYP A;  3LL3 A;  5AQJ A;  1SQK A;  1U2V B;  3EZW A;  2F9T A;  4XH4 A;  5LJV A;  4A2A A;  4BRH A;  1KXP A;  2FSJ A;  1SZ2 A;  4BRK A;  2CGL A;  1BO5 O;  4IO8 A;  4H5N A;  3CHW A;  2NLX A;  4BC4 A;  4EIA A;  5BPM A;  3U9D A;  2A3Z A;  1Z05 A;  5KPR A;  3FLC O;  3EKU A;  2QWO A;  2YJF A;  3L6Q A;  5AR0 A;  5AQZ A;  5BN9 A;  4CZG A;  1S22 A;  4XH5 A;  3QFP A;  3R9P A;  5BRE A;  4F9O A;  5FPE A;  1P8Z A;  3O5B A;  4BRM A;  2ZGZ A;  5TKY A;  1GLC G;  1GLE G;  3BF1 A;  3VEN A;  1JCF A;  3HSC A;  4BR4 A;  4BRI A;  3VES A;  3LDO A;  4GNI A;  1GLL O;  3SJH A;  1WOQ A;  4H0Y B;  4FSV A;  4MLE A;  3VEX A;  4FWN A;  5F1X A;  1C0G A;  4BR5 A;  3LDP A;  4BQZ A;  3VET A;  2ZWH A;  1SAZ A;  1YUW A;  4E1J A;  4JNE A;  5EVZ A;  3G25 A;  1JCE A;  3AAP A;  1Y64 A;  1QQN A;  2BUP A;  3LDN A;  5AQW A;  2FF3 B;  2IIR A;  1RGI A;  4AM7 A;  2P9I A;  1GLF O;  2CGK A;  4A62 A;  3CIP A;  5AZI B;  3GG4 A;  3MN7 A;  5BRF A;  1NGE A;  4FWQ A;  5EOY A;  4BC5 A;  2AA4 A;  2E1Y A;  3KVG A;  5BR9 A;  4BRE A;  2FSK A;  3WT0 A;  5FPD A;  4WYB A;  4PL8 A;  1BA0 A;  5F0X A;  3SK3 A;  1Z6R A;  3CQX A;  3D2F B;  3HBT A;  3I33 A;  4L3Q A;  4BRQ A;  3VER A;  3KZB A;  4IZ9 A;  3FGU A;  4BRF A;  4BR2 A;  3QBX A;  5AQO A;  3A8Y A;  4Z94 A;  1IG8 A;  5AQM A;  3D2E A;  2GWJ A;  2E1Z A;  2Q97 A;  3RSE B;  5BPN A;  2A40 A;  1BUP A;  4CBW A;  4EFH A;  3H45 C;  2EWS A;  4JHD B;  1ATN A;  4WQ5 A;  4BVP A;  2YI1 A;  4FWR A;  4BR0 A;  2IVP A;  4EAH D;  4JD2 A;  1DEJ A;  2Q0R A;  3VF6 A;  2P9L A;  3FZM A;  3GL1 A;  3F9M A;  3UKR A;  2ASM A;  2Q36 A;  2Q0U A;  3WXK A;  4BGB A;  1HKG A;  2QWM A;  1GLB G;  3DXM A;  5ADX A;  3H3N O;  4M63 C;  3DJC A;  4H0V B;  4B1U B;  1J6Z A;  3D2F A;  3WXI A;  2I7P A;  5AQI A;  2E88 A;  4BVO A;  3MN9 A;  3VOV A;  4H5T A;  3W0L A;  3BF3 A;  5AQK A;  3WXJ A;  4XEI A;  2CGJ A;  3UKU B;  3H3O B;  5EY4 A;  3P4I A;  5AQV A;  3CJB A;  3OHR A;  1LCU A;  4BR7 A;  3TU5 A;  4BR9 A;  4MLH A;  3FR0 A;  3VGK A;  4ISE A;  3CET A;  3WEE A;  4H5W A;  4NB4 A;  5AFU H;  1NWK A;  3EL2 A;  4BRL A;  5CE3 A;  2UYT A;  2DPN A;  3VPZ A;  4FO0 A;  4H5V A;  4K41 A;  1MDU B;  4BRA A;  1RDW X;  3HZ6 A;  3FFK B;  2FSN A;  1WUA A;  3CJ1 A;  4LC9 B;  2ZF5 O;  1OKJ A;  1V4S A;  3H1Q A;  5E84 A;  3M3Z A;  2W40 A;  3FE1 A;  2V7Z A;  4JN4 A;  3W3D A;  3SMP A;  3D7E O;  3L0Q A;  1RFQ A;  2NRH A;  2P9I B;  3SLC A;  4RTF D;  1MA9 B;  4BQL A;  3UKU A;  2QWQ A;  5AQQ A;  3C0B A;  3CQY A;  4PKH A;  3QBW A;  4K25 A;  1NBW A;  3LM2 A;  2HF3 A;  4O5F A;  4RCH A;  3EO3 A;  2QM1 A;  3ZX2 A;  3M1F A;  1NGC A;  1NGB A;  1GLJ O;  3QDK A;  1X3N A;  5KQ8 A;  1ZC6 A;  3BEX A;  2D1K A;  3D2E B;  3O8M A;  4BG9 A;  1V4T A;  2CH5 A;  4DCH A;  3C7N A;  4PKI A;  2A41 A;  2E2P A;  1NGI A;  1IJJ A;  1E4G T;  4BRN A;  3JS6 A;  2QWR A;  3A5N C;  4K43 A;  2QWN A;  3VGM A;  4PKG A;  4CZJ A; 
#chains in the Genus database with same CATH topology
 3VEV A;  3CCM N;  2GEM A;  2Z1I A;  2RE2 A;  2W41 A;  4JKD A;  3DXM B;  1KAZ A;  4LSN A;  3TSP A;  3AV9 A;  3VQQ A;  2ZD1 A;  4BEB A;  2D5R A;  4J2D A;  4B9M A;  2ZJP L;  4FWO A;  3HST B;  4WQ4 A;  1HYS A;  3CCE N;  2OA8 A;  4QS8 A;  1N8R O;  1K8K A;  4RW9 A;  3QFU A;  3TAP A;  3J80 O;  4CZH A;  3QIP A;  4FW1 A;  3MX5 A;  3F9K A;  4FM1 A;  5AQF A;  3HT3 A;  4CZM A;  3BGR A;  4BDP A;  2PBD A;  4CK1 A;  1RT6 A;  3D45 A;  1HNV A;  1SUQ A;  1B92 A;  1KAY A;  3HM9 A;  1KFD A;  3A5O C;  3UB5 A;  4DTN A;  3CD6 N;  3UE5 A;  3O80 A;  4JRQ A;  3RVC A;  1GLA G;  3V9W A;  3EKS A;  2E8A A;  4KTQ A;  1CLQ A;  1T7P A;  3U3Y A;  3GOI A;  4BDZ A;  1XNQ K;  4FM0 A;  1WSG A;  3VMF B;  4CES A;  1EX4 A;  4E3S A;  3MX2 A;  4EHT A;  3QEW A;  3VQ8 A;  4OJR A;  4GKK K;  2P5O A;  1C0T A;  4OPA A;  1BIU A;  4CK3 A;  4KBO A;  1HR0 K;  1HPZ A;  3O9T A;  1SV5 A;  3VQ4 A;  1REV A;  5SWM A;  4JS5 A;  1DGK N;  5KQD A;  1TYQ A;  2P9U A;  1G15 A;  4E72 A;  4WQ5 C;  4BC2 A;  4CZI A;  3DRS A;  4AM6 A;  5AQT A;  4OGC A;  4OPJ A;  3S3M A;  4DTP A;  5AQU A;  1YI2 N;  3AAQ A;  3DLB A;  1BOT O;  3HM8 A;  2WC9 A;  4R79 A;  3EZ5 A;  5JLH A;  2YNF A;  2YHX A;  4A2B A;  3R6M A;  1BCM A;  1EKE A;  1K73 O;  2OCE A;  1K8A O;  2P9N B;  1NGH A;  3I0R A;  2D4W A;  4RW7 A;  4BC3 A;  5FRN A;  5AJ3 K;  4DR6 K;  2QA4 N;  1S3X A;  5DM7 L;  1JL2 A;  4B3S K;  4M7X A;  4CHP A;  4BG8 A;  1KSP A;  2ZJQ L;  4J2A A;  1VSM A;  1VQL N;  2PYL A;  4BAC A;  5HL7 L;  1FK9 A;  5C24 A;  4MO5 A;  2C1I A;  1S9E A;  3IMX A;  4CHY A;  3BUZ B;  3O6W A;  2ASP A;  4PL7 A;  2UXC K;  4HCB A;  1U2V A;  5J2M A;  2QXF A;  4JKG A;  2UUC K;  1QZ6 A;  2P9K B;  3RMD A;  1FW6 A;  4B8A B;  3P39 A;  4WFA L;  1ZXO A;  4JK8 A;  4DV0 K;  2HND A;  3ZET B;  4JS4 A;  2Z1J A;  1T3V A;  3AVB A;  3IUC A;  3THW B;  5AQR A;  5FRO A;  3JXU A;  2BH1 A;  4HVJ A;  5JLF A;  3ZSW A;  4LF9 K;  1M1K O;  4JYA K;  2O4I A;  3A5M C;  4O0I A;  3PO4 A;  4ILG B;  4YDU C;  2KFZ A;  2KKZ A;  1K9M O;  2UXD K;  4DSE A;  3HJF A;  3A5L C;  4FWM A;  2IS3 A;  3FFI A;  4DTU A;  1DTQ A;  3QNO A;  2KLA A;  2PAV A;  1RTI A;  3KK2 A;  4JLH A;  1YVU A;  1T6D A;  3HXM A;  1R0A A;  4CEB A;  3VF2 A;  2HHH K;  1UA0 A;  3O1B A;  4CEO A;  5HLF A;  1JLG A;  4Z0U A;  4UY8 O;  5H1S Q;  4LF4 K;  4DQ8 A;  4A61 A;  3SQ2 A;  2C1G A;  1MWM A;  4ID1 A;  2XY7 A;  3AVF A;  5CYM A;  2B5J A;  2D0O A;  5SZT A;  2I7N A;  4X64 K;  3A0I X;  3AVM A;  2O8F A;  2RN2 A;  1RT1 A;  1IO2 A;  2YHW A;  2O8B A;  1HPM A;  3B6P A;  3Q7C A;  4KI6 A;  2W42 A;  1U4B A;  4DQP A;  4BE2 A;  1EWQ A;  4CJU A;  2RF2 A;  3PX0 A;  4ID5 A;  5LMU K;  1WSI A;  3B8A X;  1JLQ A;  2G8H A;  4PWD A;  3VEZ A;  4CIG A;  3ZLJ A;  3VEY A;  4E7J A;  4CHN A;  3NF7 A;  4JHD A;  1VSJ A;  3ID8 A;  2ZGY A;  2NUB A;  4FLX A;  1YJ9 N;  1SQK A;  4G9Z A;  3CME N;  3L4Q A;  4E7H A;  1JLB A;  1L5U A;  2VQF K;  3LAK A;  4HUE A;  4A2A A;  3F2K A;  1KXP A;  2R7Y A;  2XY6 A;  2CGL A;  3Q7B A;  1BO5 O;  4IO8 A;  5EU7 A;  4BY9 C;  1RT7 A;  3ISN C;  4C1N I;  3G4S N;  4EIA A;  3V81 A;  4IOC L;  1Z05 A;  3ZSV A;  1N5Y A;  3EKU A;  1XNR K;  3L6Q A;  5AQZ A;  3C6A A;  5BN9 A;  1TKD A;  4XH5 A;  3QFP A;  1ZBU A;  5BRE A;  1Q8I A;  3O5B A;  4BRM A;  2ZGZ A;  1QHT A;  4A5A A;  1S6P A;  5HRO A;  4FJ7 A;  3OYD A;  2EX3 A;  4OKE A;  1WOQ A;  2JLE A;  5F1X A;  3MEC A;  4FWN A;  1IBK K;  4BR5 A;  3LDP A;  4M3U A;  2X78 A;  3E66 A;  4K8Z A;  2ZWH A;  4CFC A;  1K6Y A;  5JS1 A;  3K58 A;  4JI7 K;  2KTQ A;  3TAN A;  1JLE A;  5AQW A;  1RGI A;  3NDK A;  3AGR A;  4A62 A;  3N4P A;  2QKB A;  4JKA A;  3MN7 A;  1NGE A;  4FWQ A;  4BC5 A;  1OH5 A;  1S1W A;  5GAD P;  2FSK A;  1LWE A;  5F0X A;  3CQX A;  1RDD A;  3HOS A;  3NBP A;  4IZ9 A;  1VQ4 N;  3KLE A;  1WSJ A;  4BR2 A;  1TK5 A;  4FLY A;  4DTS A;  1NJY A;  1I3A A;  2A40 A;  2RPI A;  4M3T A;  4CBW A;  4EP5 A;  4EFH A;  3H45 C;  4CK2 A;  3M8P A;  3CQ8 A;  1BIZ A;  5GIN A;  4EAH D;  1DEJ A;  2Q0R A;  3WNH A;  2Q36 A;  1HKG A;  3H3N O;  4M63 C;  4H0V B;  4KRF A;  3WXI A;  3TTF A;  4CEE A;  2E88 A;  3MN9 A;  4WE1 A;  1S72 N;  3VOV A;  4H5T A;  4KHP K;  1VQ9 N;  2O8E B;  3BF3 A;  3WXJ A;  4XEI A;  4AHV A;  3V1R A;  3H3O B;  4QCL A;  5EY4 A;  3P4I A;  3CJB A;  3P38 A;  4FK2 A;  1D5A A;  4JKF A;  4MDA A;  4WFB L;  5IT9 O;  3M5R A;  3VTH A;  3ZT1 A;  2IAJ A;  1NJX A;  3IG1 A;  4OGE A;  4CGJ A;  1BI4 A;  2IOC A;  2DPN A;  4KH6 A;  4FJM A;  4LF8 K;  4O44 A;  4LC9 B;  1IH7 A;  1HYZ A;  3KK7 A;  1WLJ A;  4CJF A;  3M3Z A;  3OS2 A;  2W40 A;  1FJG K;  1TKT A;  2V7Z A;  3W3D A;  2KQ2 A;  3TR8 A;  2KZZ A;  2NRH A;  3SLC A;  4RTF D;  4FJH A;  2I5J A;  2OZS A;  1Q9Y A;  4DV5 K;  3OBY A;  3QBW A;  4KH4 A;  3CC4 N;  1QQC A;  3VQ9 A;  2WOM A;  4FZX C;  2YKN A;  1NBW A;  3OBW A;  4E89 A;  1I94 K;  1VSF A;  2QM1 A;  4JEP A;  1GLJ O;  1X9W A;  3DRP A;  3QDK A;  1RDB A;  3OA9 A;  3U3G A;  3TAE A;  5KQ8 A;  3NVK A;  3O8M A;  3QET A;  2OPQ A;  2W6K A;  2CH5 A;  4DCH A;  3C7N A;  5KGX A;  1T05 A;  2UU9 K;  1NGI A;  3ZSX A;  3J7Y P;  3TWH A;  4NYF A;  4DTR A;  4E0D A;  1SL1 A;  1BCO A;  3AVG A;  1UAX A;  1WSH A;  2HHT A;  4H8K A;  1IBL K;  1Q9X A;  3CCL N;  5KGW A;  3CYM A;  3CFP A;  1YVN A;  4IG0 A;  3OVN A;  3UKR B;  4AH9 A;  1VAZ A;  3A2F A;  4OVL A;  4CJ7 A;  3NE6 A;  3T3F A;  1JLC A;  4IXC A;  4RW4 A;  4WFN L;  4IJN A;  1TL3 A;  4DQR A;  4DSK A;  5JS2 A;  4FLU A;  3I56 N;  4H0P A;  3G10 A;  5AFU A;  3V9Z A;  2HF4 A;  4FJK A;  4JAX A;  3O08 A;  4AHR A;  2KW4 A;  1DTT A;  4BE0 A;  3AVL A;  1HQE A;  3HO1 A;  3FZF A;  1OVQ A;  2E2O A;  1N34 K;  5JIC A;  3KJV A;  1TVR A;  3TPQ A;  3C65 A;  1ZBS A;  1T8E A;  4CEQ A;  4LH5 A;  4M7Y A;  5BRD A;  3OYF A;  1NM1 A;  3OYB A;  5AQN A;  3NF6 A;  4CBX A;  3HVR A;  2HHQ A;  2BAN A;  2VCP A;  2HST A;  1ITG A;  5AQS A;  4C8K A;  4BRP A;  2GWK A;  3MED A;  3L2Q A;  3RMC A;  2P9S A;  3AVJ A;  3I55 N;  2P9P A;  3KWG A;  4B9U A;  1N6Q A;  3L2R A;  1TUY A;  1WAF A;  3HPG A;  1HKC A;  4I9Q A;  1KVC A;  4CZK A;  5A2Q O;  3FZK A;  4KHW A;  3I8B A;  2Y1I A;  4E7I A;  3IRX A;  3DM2 A;  1LV5 A;  4DSL A;  4BGA A;  1ASV A;  4KO0 A;  5I9E B;  4IEE A;  4OPK A;  2G8K A;  4MO4 A;  5C2F A;  3DLE A;  3CFO A;  1TKZ A;  1X1P A;  3FZH A;  2HVI A;  3KKR A;  3KHY A;  4FJ8 A;  3R8E A;  4ICL A;  4Y1D A;  4CZE A;  4CJT A;  4AF1 A;  4CD1 A;  3AVC A;  3OYN A;  1NKB A;  2X74 A;  3NH1 A;  3DAW A;  5JMV A;  1YXQ A;  3EN9 A;  3MAQ A;  4JKG B;  3ITH A;  1U45 A;  1G99 A;  2O8D B;  1RDU A;  1EQY A;  2NZT A;  4CJR A;  4IFY A;  1R59 O;  3CER A;  4NO7 A;  3O9S A;  4B3M K;  3DXK A;  2JWK A;  2HHU A;  2XHB A;  4C23 A;  4E7L A;  1IKY A;  1JXE A;  3CJ7 A;  4XH1 A;  1WSE A;  2F7T A;  2D0A A;  3G71 N;  3ZX3 A;  1VSD A;  3C6T A;  4LF6 K;  3AA2 A;  1YHQ N;  5ADX H;  1Q81 O;  4N47 A;  1QSL A;  3QIO A;  2HOE A;  4IWV A;  4J8F A;  1BWF O;  2YNI A;  2VGN A;  2YHY A;  4DSF A;  4CZF A;  1U49 A;  4ELV A;  3EE9 A;  4CBU A;  4DWI A;  1ESV A;  3P1G A;  3SAH A;  3ENH A;  3WXL A;  4AHU A;  4KB1 A;  4CEZ A;  5EXW A;  1NLV A;  2Z1H A;  3E1Y A;  2P51 A;  1JLA A;  3CCQ N;  1BGX T;  1UWB A;  4IEI A;  1QE1 A;  3ZEU B;  1A5W A;  3WUH A;  3DLK A;  1WSF A;  1NMN A;  3CF5 L;  5AZJ B;  2CH6 A;  2E20 A;  4JI2 K;  3AA3 A;  1GOB A;  4M42 A;  5LY3 A;  3LAM A;  4I9L A;  4DFM A;  2AP1 A;  4MQ3 A;  1NK8 A;  2FLO A;  4HTL A;  4YOU A;  4CIE A;  4FLV A;  3L2W A;  1NK4 A;  3CCS N;  4KI4 A;  3T1A A;  5LJW A;  2HBL A;  1XMO K;  2DFF A;  1ATR A;  4RG8 A;  4B1W B;  4FK4 A;  3AAR A;  3PIO L;  4JK7 A;  5HRN A;  4KHY A;  5AZI A;  1DKG D;  1KVB A;  1VQ7 N;  1B9D A;  2OPP A;  2WON A;  3L4I A;  5M1K A;  3K5M A;  2V7Y A;  2UUB K;  3OS1 A;  1LOT B;  1F21 A;  1CXQ A;  1NOZ A;  3CYG A;  2FXU A;  1RT4 A;  1LWC A;  1O13 A;  4NYN A;  3QO9 A;  4B9Q A;  3LPU A;  4ISF A;  5KPZ A;  1Z25 A;  2D0C A;  4FWP A;  3PIP L;  3LWM A;  3SPZ A;  1J5E K;  1QHA A;  3M8Q A;  4YOT A;  3ULD A;  4AHS A;  1FXX A;  3VQB A;  4BRG A;  5AQH A;  5C25 A;  5HP1 A;  3SPY A;  4B1V A;  5D3G A;  4OX9 K;  1YJN N;  3IFR A;  1W2B M;  3U9Z A;  5C0Y A;  4K8X A;  4DLE A;  5AQJ A;  3EZW A;  2F9T A;  5TKW A;  1C1B A;  5LJV A;  3VA3 A;  1VQ8 N;  1C0M A;  1RDC A;  3SV3 A;  3CHW A;  3THX A;  2W6L A;  4W5O A;  3CCR N;  2XY5 A;  1OH6 A;  4DMN A;  3NH2 A;  3DYA A;  4BC4 A;  4XJX A;  3MCA B;  4J2B A;  4CJW A;  3FLC O;  4CJ3 A;  3OYI A;  1QTM A;  3CCU N;  1DT9 A;  4B3T K;  5AR0 A;  1Z26 A;  1SL2 A;  4KHU A;  2GBZ A;  2VWJ A;  4F9O A;  5HBM A;  3LZJ A;  1GLC G;  2EHG A;  4H4O A;  1GLE G;  2OYQ A;  4DTM A;  1BHL A;  3BF1 A;  4BR4 A;  1JCF A;  3CXC M;  4BRI A;  3LDO A;  3PX6 A;  1OH7 A;  3F73 A;  4YOV A;  4EP4 A;  4YNQ A;  1VQK N;  2GX9 A;  5MLC Q;  1C0G A;  3KLI A;  4K0K K;  2YHB A;  4E1J A;  4TSX A;  4DR4 K;  3G25 A;  1JCE A;  4I2P A;  3L8B A;  1KFS A;  2ZJR L;  2P9I A;  4PHT X;  4CEF A;  1QVF M;  2OTL N;  4A59 A;  4FW2 A;  5HRP A;  5EOY A;  4FLT A;  5BR9 A;  2WTU A;  4BRE A;  3M8S A;  1O1W A;  4WYB A;  3ZSR A;  1VSE A;  3SBT A;  3SUN A;  2PY5 A;  1Z6R A;  1KVA A;  2X6N A;  4KV8 A;  4BRQ A;  3C6H A;  3KZB A;  1ASW A;  3FGU A;  2F4V K;  1LAV A;  2VWK A;  4FZZ A;  1U04 A;  1S9G A;  2G8W A;  2JGU A;  1LWF A;  3D2E A;  1RBT A;  1A5X A;  2YHA A;  3OYA A;  2E1Z A;  3RSE B;  5BPN A;  4B9N A;  2ETJ A;  1LW2 A;  1Y97 A;  3O9R A;  3VTI A;  3RWU A;  3SAF A;  4WQ5 A;  2NNW A;  4CCH A;  3H08 A;  1ILY A;  1N33 K;  4FWR A;  2IVP A;  4OKJ A;  3VF6 A;  1HYV A;  1VSK A;  2ASM A;  2HHI A;  2Q0U A;  4BGB A;  4KTZ A;  3DXM A;  3MWP A;  5ADX A;  2HHX A;  1BIS A;  3DJC A;  4Y1C A;  4B1U B;  1J6Z A;  3KIO A;  3I0S A;  4YFU A;  3D2F A;  5C15 A;  2DFE A;  4NXM K;  1J9A A;  3JYT A;  1RT2 A;  4CJE A;  3CCJ N;  4KHQ A;  4CER A;  3CM6 A;  3W0L A;  1J54 A;  3SV4 A;  2E4L A;  3V9S A;  4DV7 K;  5JVG L;  3OHR A;  4JI5 K;  4MLH A;  3VGK A;  4J2E A;  4ISE A;  1NK0 A;  3TTC A;  5AFU H;  1S5J A;  1NJZ A;  4R5P A;  4BRL A;  3NHG A;  3V1Q A;  4M41 A;  3VQE A;  1YJW N;  4FO0 A;  4K41 A;  3ALY A;  1MDU B;  3EEQ A;  1RDW X;  3FFK B;  2FSN A;  2IGI A;  4OLB A;  2Z1G A;  3CJ1 A;  2FC0 A;  2ZF5 O;  1OKJ A;  3H1Q A;  1L3V A;  3ASM A;  5HOO A;  3FE1 A;  3SUP A;  4FLW A;  3KD1 E;  4LFA K;  4OKK A;  3P83 D;  2E6L A;  4DTJ A;  3TI0 A;  1C6V A;  4ZTF A;  4BQL A;  3UKU A;  1KLN A;  3OYC A;  2QWQ A;  1U48 A;  4GW6 A;  3THY B;  3CQY A;  4YOR A;  1S1U A;  4PKH A;  3E9P A;  4YY3 K;  1UA1 A;  4W5R A;  2G8I A;  4W5T A;  2HF3 A;  4O5F A;  3K5N A;  3F5T A;  4FJJ A;  3ZX2 A;  4N56 A;  1X9M A;  4NCA A;  4KHN A;  1OVY A;  1W9H A;  1ZC6 A;  1RNH A;  3OYL A;  4QAG A;  3NF8 A;  1V4T A;  4JI0 K;  3D0P A;  5CY4 A;  3OYH A;  1JLF A;  1IJJ A;  4BRN A;  3JS6 A;  4KH5 A;  5BR8 K;  2QWR A;  4JI6 K;  4DUZ K;  4DV1 K;  3OYE A;  1Q86 O;  4CZJ A;  4JD2 B;  3P31 A;  1NGA A;  1XC9 A;  2P9L B;  2P9N A;  3O3F A;  3T1H K;  4CFD A;  5J2P A;  1TAU A;  3OJS A;  2Q2R A;  5M1F A;  1T44 A;  1NGD A;  4E19 A;  4CZL A;  4HTU A;  4CVN E;  3T69 A;  4WCE L;  3MWT A;  3MN5 A;  3VGL A;  1H1V A;  1X3M A;  2P5G A;  1W97 L;  3KLF A;  4A57 A;  4OO1 J;  1KAX A;  1NKE A;  3EE8 A;  3E9L A;  3T7Z A;  3SI6 A;  4FJN A;  3GE1 A;  4BWJ A;  2V52 B;  4BRC A;  1HQU A;  3M8R A;  4KFB A;  1KCF A;  1NJI O;  2J4R A;  4H0T B;  4DS4 A;  1U6Z A;  3V1O A;  3WEE B;  2UXB K;  2X6S A;  3J7A P;  3OYJ A;  4B08 A;  4F2R A;  1QQM A;  5E26 A;  2P9K A;  2VG5 A;  3HPH A;  1S6Q A;  4FWK A;  2ZE2 A;  4HUF A;  3E9O A;  3ZET A;  1IV0 A;  4H0O A;  4O4G A;  3THW A;  4I2Q A;  1XHZ A;  1YT3 A;  2NRT A;  2Q1N A;  4M45 A;  2Y1J A;  3VA0 A;  2O8C B;  4B9V A;  4O8K A;  3NGI A;  1S1V A;  2F8T A;  3O4W A;  4FOI A;  3DLH A;  4KKO A;  1RTJ A;  4DV4 K;  4E1N A;  4I6M A;  5J2N A;  4ISG A;  3M6G A;  4B9L A;  5AQP A;  2QXL A;  3O1W A;  4KHS A;  5KRS A;  3LDS A;  4IOA L;  2IVO A;  4DV2 K;  3ULE A;  4LSL A;  4JKC A;  1HKB A;  2A42 A;  3MEE A;  1NJW A;  5GAE P;  1C0F A;  2HMP A;  3QB0 A;  1IBM K;  5JVH L;  3LP1 A;  2WUS A;  5F2R A;  2HNY A;  1D8Y A;  3OJU A;  4F4K A;  3CFR A;  1EET A;  4OLA A;  2FBY A;  1HUX A;  4GVM A;  2BTF A;  1VSH A;  4IJA A;  3SYZ A;  2BE2 A;  3O9Q A;  2QW9 A;  4B3O A;  4IBN A;  3H46 O;  4CD3 A;  2HW3 A;  2GUI A;  1NGF A;  1XWL A;  5BPL A;  3AVN A;  2IC3 A;  2F9W A;  3J8A A;  3VQ6 A;  3PLA A;  1K8K B;  4FOE A;  4CF2 A;  3DLL L;  2ASO A;  3SJJ A;  3AO4 A;  2OZM A;  3IDH A;  4DTO A;  3N4Q A;  2HVH A;  4M3W A;  3QNN A;  2BGG A;  4B3R K;  1TK8 A;  4G1Q A;  3CI5 A;  1CZA N;  4YOY A;  4IFE A;  4AQY K;  1VSL A;  1JJ2 M;  2A6A A;  3LPT A;  4FVU A;  1T6C A;  3QEI A;  4CEC A;  4N5S A;  4DB3 A;  3CM5 A;  5HRR A;  2QKK A;  1U47 A;  2QWP A;  2E2Q A;  4DFJ A;  3CC7 N;  4YHH K;  2XRI A;  5AQY A;  3LP0 A;  4BRO A;  3C94 A;  3AA4 A;  5C42 A;  1E4F T;  4BRD A;  4NXN K;  4FJX A;  3HPO A;  3HK2 A;  3MN6 A;  4MDB A;  5M1P A;  4B8C A;  3NGY A;  4DKW A;  1SKW A;  3MMV A;  3H1V X;  2E5L K;  3FZL A;  3MDQ A;  5AQX A;  1TV6 A;  1L3U A;  2OAN A;  3GDQ A;  1TYQ B;  2P9U B;  3TSU A;  2E6M A;  5AQL A;  2NRW A;  1A5V A;  3BP8 A;  3KKS A;  3WNG A;  1RT3 A;  4DU1 A;  3CJ9 A;  3VEO A;  1JCG A;  4DQQ A;  4AHC A;  1IKW A;  5ELZ A;  1CZB A;  3S9H A;  3RR7 A;  4C8M A;  1YIT N;  4GMJ B;  4NCG A;  1KC8 O;  3VQP A;  4FPB A;  4IKF A;  2GEL A;  4WQ4 C;  5KI6 A;  1BA1 A;  4CJK A;  3AY9 A;  3S41 A;  2P1J A;  4C8O A;  4BE1 A;  3UIQ A;  2D0P A;  2OTJ N;  4W5Q A;  1HLU A;  3K57 A;  4X65 K;  3BDP A;  3HRG A;  4FPA A;  3AVK A;  4NCB A;  4Z4I A;  3QIN A;  4Y0W A;  1HJO A;  1BDG A;  1NGG A;  3HP9 A;  4DV3 K;  1XQS C;  1NK5 A;  1VQP N;  3D6R A;  5BN8 A;  3IKM A;  5HRS A;  1SL0 A;  1SKR A;  2UUA K;  1UOC A;  4DR2 K;  1U2V B;  3K2P A;  1C0U A;  4XH4 A;  1WBB A;  3OTO K;  3HOT A;  3OY9 A;  1C1A A;  2RHK A;  3QER A;  4GV9 A;  4BRK A;  2GV9 A;  4Z4G A;  5GAG P;  3OS0 A;  4JI1 K;  4CGF A;  1ZBI A;  3O3H A;  2NRR A;  3ZSO A;  4C8L A;  5BPM A;  1TL1 A;  3U9D A;  3SBG A;  5KPR A;  3HP6 A;  2W00 A;  4CZG A;  1S22 A;  4IDK A;  5FPE A;  1P8Z A;  5C12 A;  5TKY A;  3EY1 A;  4CJL A;  1VHX A;  1SKS A;  1NNE A;  2KZM A;  3KK3 A;  3HSC A;  3VES A;  1EWR A;  4GNI A;  1GLL O;  3SJH A;  3L2V A;  5T7B A;  3PV8 A;  4H0Y B;  1ZBH A;  4FSV A;  4MLE A;  4CGH A;  4JKE A;  3VET A;  4JNE A;  4CE9 A;  4CHO A;  5EVZ A;  1Y64 A;  2BUP A;  4V19 S;  4IO9 L;  2FF3 B;  3VQ5 A;  4GV3 A;  2IIR A;  2RKI A;  4AM7 A;  2CGK A;  3HL8 A;  5BRF A;  4CED A;  4LY7 A;  3PY8 A;  1RT5 A;  3RRH A;  3R1X A;  5FPD A;  1IKX A;  2O8F B;  4A5B A;  4PL8 A;  1ZBL A;  1BA0 A;  2WFB A;  4IG3 A;  2HB5 A;  2O8B B;  3D2F B;  3K59 A;  1VQ5 N;  1N36 K;  4L3Q A;  3VER A;  3S3N A;  3OYM A;  2DY4 A;  3ZT3 A;  3A8Y A;  4ZTJ A;  3SCX A;  1IG8 A;  3NAE A;  2YNG A;  3OYG A;  2QI2 A;  3ZYY X;  5FRM A;  4FXD A;  2EWS A;  4JHD B;  1XHX A;  1J53 A;  1VSI A;  4M3X A;  2YI1 A;  4BR0 A;  3RRG A;  4AHT A;  4FJI A;  5DK5 A;  3F9M A;  3LAL A;  4DFK A;  3UKR A;  1HNZ K;  2BDP A;  3TAB A;  3G6E N;  2PYJ A;  3WXK A;  3J81 O;  4IFV A;  4FJL A;  1DLO A;  4LF7 K;  4CJP A;  1HMV A;  2I7P A;  2NRZ A;  3P5J A;  4BVO A;  2DFH A;  2HBJ A;  3BZC A;  4RW6 A;  4CFB A;  4U67 L;  1RBR A;  5AQK A;  3UKU B;  5M1N A;  5AQV A;  3VQD A;  1GOA A;  5LL6 Z;  3MXM A;  3O9U A;  1LCU A;  4ILH A;  3TU5 A;  4O55 A;  3FR0 A;  1HRH A;  3DOL A;  3KTQ A;  1KTQ A;  4LF5 K;  4BWM A;  4YOW A;  3TAR A;  2VG6 A;  1NWK A;  3EL2 A;  4N41 A;  3KLG A;  5FDL A;  3T1Y K;  2VQE K;  3VPZ A;  4H5V A;  3RMB A;  3CG7 A;  5C2D A;  2B6A A;  3ZT0 A;  1ZYQ A;  1HNX K;  3SQ0 A;  2XY8 A;  1WUA A;  3QES A;  1IG9 A;  1TK0 A;  1VK0 A;  1RTH A;  3U6F A;  4F3O A;  4LFC K;  3D7E O;  4DU4 A;  4JKH A;  1RFQ A;  2A1S A;  4DF4 A;  4KAZ A;  2G8U A;  4JKB A;  5IWA K;  1NG9 A;  1Q7Y O;  4O0J A;  3ZSZ A;  3C0B A;  4CF0 A;  3TAQ A;  3BY5 A;  4GVE A;  1QSS A;  4M3Z A;  1WN7 A;  4K25 A;  3SQ4 A;  4CHZ A;  4KRE A;  4RCH A;  3EO3 A;  4DR1 K;  1NGC A;  3EYZ A;  1NGB A;  3SUQ A;  1EXQ A;  1QVG M;  3AO5 A;  3O3G A;  1X3N A;  1BL3 A;  3NH0 A;  2D1K A;  1BQN A;  3BZK A;  2D0B A;  3LAN A;  3PUF A;  2F8S A;  2E2P A;  1YF5 L;  3DRR A;  1E4G T;  4ZHR A;  2YX6 A;  2IDO A;  4F8R A;  2YNH A;  4K43 A;  4YOX A;  2QWN A;  3VGM A;  3ENB A;  4FM2 A;  4C8N A;  3HVT A;  3ATV A;  3ATU A;  4AIL C;  1CXU A;  4JK9 A;  4BEC A;  4CGG A;  3NMU A;  4IOX A;  2OPS A;  3MXJ A;  2O8D A;  3PSI A;  4FZY A;  3CJA A;  4RWT A;  1JKH A;  3KD5 E;  4HWI A;  3DLR A;  4JI4 K;  4FVM A;  1RBS A;  4CJ4 A;  1YTU A;  3ZSY A;  2GUP A;  1X9S A;  4CGD A;  2E2N A;  5CZ2 A;  1YIJ N;  2A5X A;  1TUU A;  4H0X B;  1QS4 A;  3J7Z O;  4E7K A;  1XUP O;  4I6M B;  5AQG A;  4QS9 A;  3K0S A;  1VQN N;  3U8X A;  5GAH P;  4B1X B;  1FKO A;  1TAQ A;  3AA5 X;  5EX5 A;  1RTD A;  3ULE B;  2NRV A;  4H5R A;  1KRP A;  4HHT A;  2Q3S A;  1BI4 B;  3GBT A;  4NLB A;  4DHY A;  4H4M A;  3TAG A;  4UQG A;  3CPE A;  3U4L A;  3HI0 A;  4CW7 B;  4GY2 B;  5FPN A;  1T03 A;  5DMR A;  2HHV A;  3VQC A;  3SMS A;  3K9J A;  1HX1 A;  1KLM A;  1W7A A;  4FJ5 A;  3C95 A;  3AVH A;  2NRX A;  2PFU A;  4Z4H A;  4CJV A;  3K9K A;  2QTD A;  3ZEU A;  3DMJ A;  4L8R B;  5B8H A;  3V9U A;  1VQ6 N;  3V4I A;  4DR7 K;  1VQM N;  4FWL A;  3SUO A;  5BRH A;  1MU2 A;  4ELU A;  4O5B A;  1WB9 A;  3WQT A;  1MWK A;  5AZJ A;  1NK7 A;  4ELT A;  4DSI A;  3VF4 A;  2Q31 A;  1Q18 A;  2ZQB A;  5LMN K;  4FLZ A;  1RDA A;  3C7N B;  2PZS A;  1YAG A;  4FYD A;  5FLX O;  4DR3 K;  3LDL A;  2HHS A;  3IAY A;  2H3G X;  4DLG A;  3THV A;  3V6D A;  4JI8 K;  4RW8 A;  4B9T A;  3AVA A;  4W5N A;  3C6U A;  3MK6 A;  4B1Y B;  1NMD A;  3SAG A;  2FBV A;  3QEX A;  2A1R A;  1BU6 O;  1JXB A;  4LD0 A;  5I3U A;  1W0H A;  3OW2 M;  1HJR A;  3OYK A;  4C1N K;  1E3M A;  2YCH A;  1SS6 A;  1D4X A;  3CJC A;  1HNI A;  3LDQ A;  4YDU A;  3VQA A;  1VQO N;  3ENO A;  3RTV A;  2ITM A;  1X9J A;  3WQU A;  1C1C A;  4DQS A;  4H03 B;  2GTD A;  4OPH A;  5CHI A;  2KHO A;  2IVN A;  3LP3 A;  3WXM B;  3MEG A;  1OH8 A;  2FBT A;  4Q0B A;  3I8D A;  4FL9 A;  4WF9 L;  4DV6 K;  4PY5 A;  4QOZ B;  3DWL A;  1WBD A;  3V9X A;  4CF8 A;  3AO3 A;  1LAW A;  5GIP A;  4Q5V A;  1QSY A;  3O4N A;  1ZBF A;  1XC3 A;  1FKP A;  2YJE A;  3LP2 A;  4BDY A;  2P9S B;  5KPT A;  2F96 A;  2KFN A;  4DQI A;  2P9P B;  4B1Z A;  4I7F A;  4CI6 A;  4EHU A;  1LW0 A;  1VRU A;  3QIC A;  2VWB A;  4QS7 A;  3S5T A;  3PX4 A;  1RIL A;  2LSN A;  3VEW A;  3QML A;  3LM9 A;  2DTU A;  1QQO A;  1QZ5 A;  1ATS A;  2FF6 A;  4HUG A;  4FJG A;  2V51 B;  3MCP A;  4CJS A;  3H6E A;  4DF8 A;  3RR8 A;  4B9S A;  1NGJ A;  2VG7 A;  4FWS A;  5M1O A;  2QWL A;  4DFP A;  4DU3 A;  3AGK A;  5K14 A;  2QK9 A;  4GV6 A;  3LWL A;  2O4G A;  1VRT A;  3HTV A;  3G0Z A;  4K42 A;  1KD1 O;  4JV5 K;  3NFA A;  5GIO A;  3TAM A;  5FPM A;  3QEP A;  1D9D A;  4O8U A;  3TSQ A;  3K5O A;  3DXK B;  3T19 A;  4HCC A;  1BG3 A;  1WNS A;  5J2Q A;  3AO2 A;  3QLH A;  5KRT A;  3LZI A;  3AVI A;  3RSE A;  4DG1 A;  4MFB A;  3L3U A;  1GLD G;  3QEV A;  3KWI A;  3K5L A;  3PO5 A;  1S1X A;  3ZX0 A;  3TAF A;  5JEN A;  2VYP A;  4CFA A;  2G8V A;  3LL3 A;  3O4Q A;  2HNZ A;  1Q82 O;  4LH4 A;  4FJ9 A;  5M1Q A;  4M3Y A;  4BRH A;  4E1M A;  2FSJ A;  1XI1 A;  1SZ2 A;  3IS9 A;  4FK0 A;  1XMQ K;  5CZ1 A;  4H5N A;  3E01 A;  3SNN A;  2NLX A;  3KLH A;  3WNF A;  1WAJ A;  3VN5 A;  2A3Z A;  4DTX A;  3CPW M;  3DLG A;  2QWO A;  4EZ6 A;  2YJF A;  4CJQ A;  3R9P A;  5J1E A;  4PQU A;  5CR4 A;  1M90 O;  3AO1 A;  1NK6 A;  4U7B A;  1NU0 A;  3VEN A;  1YTA A;  1RBU A;  1P90 A;  3VQ7 A;  3L3V A;  4Z4E A;  4EZ9 A;  2YV0 X;  1RBV A;  4DUY K;  3VEX A;  4Z4C A;  4F2S A;  4BQZ A;  1L3T A;  1SAZ A;  1YUW A;  5KTQ A;  3AAP A;  4PUO A;  3NF9 A;  3LDN A;  1QQN A;  2HBK A;  1GLF O;  3CIP A;  3ZCM A;  5AZI B;  3GG4 A;  3NVM A;  1TGO A;  3THY A;  2ZM6 K;  2AA4 A;  2E1Y A;  3KVG A;  1NK9 A;  3WT0 A;  4X66 K;  3WNE A;  1TKX A;  3SK3 A;  3HBT A;  3I33 A;  3JAM O;  2B4J A;  2ITG A;  4ILJ A;  2ATQ A;  1L3S A;  2HMI A;  4CIF A;  1JL1 A;  4BRF A;  3QBX A;  2VGM A;  5AQO A;  3TTD A;  1HNW K;  3SQ1 A;  4Z94 A;  5AQM A;  1KQS M;  3NGZ A;  2GWJ A;  2Q97 A;  3KK1 A;  2G8F A;  2JWL A;  3CMA N;  1NKC A;  1BUP A;  1IKV A;  4JI3 K;  1ATN A;  1EP4 A;  4BVP A;  1NOY A;  5I42 A;  4JD2 A;  3CCV N;  2P9L A;  3FZM A;  3GL1 A;  4CJ5 A;  4CF9 A;  2QWM A;  1GLB G;  5CYQ A;  1BQM A;  3S3O A;  3JSM A;  3CC2 N;  1CZ9 A;  1N32 K;  5AQI A;  4XIU A;  3THX B;  4DSJ A;  1EO1 A;  4X62 K;  2YKM A;  1B9F A;  2CGJ A;  4KB0 A;  3MXI A;  2HHW A;  3RMA A;  4BR7 A;  4BR9 A;  2FBX A;  3CET A;  3WEE A;  4H5W A;  4NB4 A;  3ZSQ A;  4BE7 B;  4KTW A;  5CE3 A;  3HYF A;  2UYT A;  4N76 A;  4BRA A;  4CHQ A;  3HZ6 A;  1S1T A;  3ZT2 A;  2WBN A;  1V4S A;  5E84 A;  1D9F A;  4JN4 A;  4LFB K;  3ID6 A;  3SMP A;  4PA1 A;  3B6O A;  2O8C A;  3L0Q A;  3ZT4 A;  4IDH A;  2P9I B;  4F3T A;  2O8E A;  1MA9 B;  5C10 A;  2AJQ A;  3DI6 A;  4DR5 K;  5AQQ A;  4DS5 A;  4CEA A;  1J5O A;  1GOC A;  4GKJ K;  4Z4F A;  5DM6 L;  3LM2 A;  4CF1 A;  5E41 A;  3R3L A;  4KPY A;  3L2U A;  3SZ2 A;  4NLC A;  1I39 A;  3M1F A;  4FCY A;  2HBM A;  3BEX A;  3D2E B;  3NCI A;  4BG9 A;  4PKI A;  2A41 A;  3DOK A;  4JRP A;  2XO7 A;  3PSF A;  1RCH A;  2OPR A;  4CGI A;  1ASU A;  4M3R A;  3A5N C;  2QEX N;  4PKG A; 
#chains in the Genus database with same CATH homology
 4JD2 B;  3P31 A;  1YVN A;  1NGA A;  2P9L B;  3VEV A;  3CCM N;  2GEM A;  2P9N A;  2RE2 A;  3UKR B;  2W41 A;  3ATV A;  3ATU A;  1VAZ A;  4JK9 A;  4JKD A;  4CJ7 A;  4BEC A;  3NMU A;  3DXM B;  4IOX A;  1KAZ A;  2Q2R A;  4IXC A;  4WFN L;  4IJN A;  5M1F A;  3CJA A;  3TSP A;  4RWT A;  1T44 A;  1NGD A;  4HWI A;  4CZL A;  3I56 N;  4BEB A;  3T69 A;  4WCE L;  3MWT A;  3MN5 A;  4FWO A;  1H1V A;  2GUP A;  4H0P A;  4WQ4 A;  3VGL A;  1X3M A;  2E2N A;  1YIJ N;  5AFU A;  3CCE N;  2A5X A;  1W97 L;  4A57 A;  1TUU A;  4H0X B;  4OO1 J;  1KAX A;  2HF4 A;  3EE8 A;  4QS8 A;  3J7Z O;  1K8K A;  3E9L A;  4JAX A;  3T7Z A;  3QFU A;  1N8R O;  1XUP O;  3O08 A;  4I6M B;  5AQG A;  4QS9 A;  3GE1 A;  4CZH A;  2V52 B;  4BRC A;  1VQN N;  3MX5 A;  3U8X A;  5GAH P;  4B1X B;  5AQF A;  2ZJP L;  2J4R A;  1NJI O;  5EX5 A;  4H0T B;  3FZF A;  3ULE B;  2NRV A;  4CZM A;  2E2O A;  2PBD A;  5JIC A;  1U6Z A;  4H5R A;  3WEE B;  3TPQ A;  3C65 A;  1ZBS A;  1QQM A;  5E26 A;  2P9K A;  4M7Y A;  5BRD A;  3GBT A;  1NM1 A;  4NLB A;  4DHY A;  5AQN A;  4CBX A;  4FWK A;  3CPE A;  2VCP A;  2HST A;  1KAY A;  5AQS A;  3E9O A;  3U4L A;  4BRP A;  3ZET A;  3A5O C;  3UB5 A;  3CD6 N;  3HI0 A;  4H0O A;  3UE5 A;  2GWK A;  3O80 A;  4GY2 B;  3RVC A;  1GLA G;  5FPN A;  2NRT A;  2Q1N A;  3EKS A;  3SMS A;  2E8A A;  2P9S A;  1HX1 A;  3K9J A;  4O8K A;  3I55 N;  2P9P A;  3GOI A;  3KWG A;  3O4W A;  4FOI A;  3VMF B;  2NRX A;  2PFU A;  1TUY A;  3MX2 A;  4I6M A;  4EHT A;  4ISG A;  3M6G A;  1HKC A;  2QTD A;  3K9K A;  3ZEU A;  4CZK A;  5B8H A;  5AQP A;  2QXL A;  3O1W A;  3FZK A;  1VQ6 N;  4OPA A;  3I8B A;  1VQM N;  4FWL A;  5BRH A;  2IVO A;  4KBO A;  4IOA L;  3O9T A;  3ULE A;  4JKC A;  3WQT A;  1MWK A;  5AZJ A;  4BGA A;  1HKB A;  2A42 A;  1DGK N;  5I9E B;  3VF4 A;  5KQD A;  2Q31 A;  4IEE A;  1TYQ A;  2P9U A;  5GAE P;  1C0F A;  2HMP A;  3QB0 A;  4MO4 A;  4WQ5 C;  4BC2 A;  1Q18 A;  5JVH L;  4CZI A;  4AM6 A;  5AQT A;  5C2F A;  5AQU A;  1YI2 N;  3AAQ A;  2WUS A;  3C7N B;  3FZH A;  1BOT O;  3HM8 A;  3KHY A;  2WC9 A;  5F2R A;  1YAG A;  3R8E A;  4CZE A;  4R79 A;  4AF1 A;  3LDL A;  4CD1 A;  5JLH A;  2YHX A;  2H3G X;  4A2B A;  3R6M A;  1K73 O;  3DAW A;  5JMV A;  1HUX A;  1YXQ A;  3EN9 A;  1K8A O;  2P9N B;  2BTF A;  1NGH A;  4JKG B;  4IJA A;  3MK6 A;  2D4W A;  4B1Y B;  1NMD A;  3SAG A;  3O9Q A;  2QW9 A;  1BU6 O;  4BC3 A;  1G99 A;  1RDU A;  1EQY A;  3H46 O;  2QA4 N;  1S3X A;  2NZT A;  5DM7 L;  3OW2 M;  4CD3 A;  1R59 O;  3CER A;  4NO7 A;  3O9S A;  4C1N K;  2YCH A;  1SS6 A;  3DXK A;  1D4X A;  2JWK A;  1NGF A;  4M7X A;  3CJC A;  5BPL A;  4BG8 A;  4C23 A;  2ZJQ L;  3CJ7 A;  3LDQ A;  2F9W A;  4YDU A;  3J8A A;  4XH1 A;  1VQO N;  2F7T A;  3ENO A;  1VQL N;  3PLA A;  2ITM A;  1X9J A;  5HL7 L;  1K8K B;  4FOE A;  3G71 N;  3ZX3 A;  3DLL L;  3WQU A;  2ASO A;  1YHQ N;  5ADX H;  4H03 B;  2GTD A;  4MO5 A;  4OPH A;  5CHI A;  1Q81 O;  3IDH A;  2KHO A;  2C1I A;  2IVN A;  3WXM B;  3N4Q A;  2HOE A;  3IMX A;  3BUZ B;  3O6W A;  4FL9 A;  4WF9 L;  4IWV A;  4J8F A;  1BWF O;  4CZJ A;  2ASP A;  4PL7 A;  3CI5 A;  2VGN A;  3DWL A;  2YHY A;  1U2V A;  1CZA N;  4YOY A;  4IFE A;  4JKG A;  1QZ6 A;  2P9K B;  4CZF A;  1JJ2 M;  3P39 A;  2A6A A;  1ZXO A;  4WFA L;  4JK8 A;  3EE9 A;  4CBU A;  3ZET B;  5GIP A;  4FVU A;  1T6C A;  1ESV A;  1T3V A;  3IUC A;  3ENH A;  4DB3 A;  3WXL A;  3SAH A;  1XC3 A;  5AQR A;  2QWP A;  2E2Q A;  3CC7 N;  2YJE A;  5EXW A;  2P9S B;  1NLV A;  3JXU A;  5AQY A;  3E1Y A;  5KPT A;  2BH1 A;  2P9P B;  4B1Z A;  4BRO A;  5JLF A;  1E4F T;  4BRD A;  3CCQ N;  1M1K O;  4CI6 A;  4IEI A;  3MN6 A;  4EHU A;  3A5M C;  3ZEU B;  4ILG B;  4MDB A;  4YDU C;  5M1P A;  3WUH A;  3QIC A;  2VWB A;  2KKZ A;  4QS7 A;  1K9M O;  4DKW A;  3MMV A;  3A5L C;  3H1V X;  4FWM A;  3FZL A;  3MDQ A;  5AQX A;  5AZJ B;  3VEW A;  3CF5 L;  3QML A;  2CH6 A;  2E20 A;  3LM9 A;  2OAN A;  1QQO A;  3GDQ A;  1TYQ B;  2P9U B;  3TSU A;  1QZ5 A;  2KLA A;  1ATS A;  2PAV A;  5LY3 A;  5AQL A;  2NRW A;  3BP8 A;  1T6D A;  2FF6 A;  2AP1 A;  2V51 B;  3VF2 A;  2FLO A;  3CJ9 A;  3MCP A;  4HTL A;  3H6E A;  4YOU A;  3VEO A;  1JCG A;  1NGJ A;  3O1B A;  5ELZ A;  3CCS N;  1YIT N;  5LJW A;  4FWS A;  5M1O A;  4UY8 O;  2QWL A;  5H1S Q;  2HBL A;  4DQ8 A;  3AGK A;  1ATR A;  4A61 A;  1KC8 O;  4B1W B;  4GV6 A;  2C1G A;  3AAR A;  3PIO L;  4JK7 A;  1MWM A;  3HTV A;  5AZI A;  4FPB A;  1DKG D;  1VQ7 N;  4K42 A;  2GEL A;  2D0O A;  4WQ4 C;  1KD1 O;  3L4I A;  5M1K A;  5GIO A;  2V7Y A;  2I7N A;  1BA1 A;  3A0I X;  1LOT B;  5FPM A;  3AY9 A;  3S41 A;  2FXU A;  1O13 A;  2YHW A;  4O8U A;  1HPM A;  3Q7C A;  3TSQ A;  2D0P A;  3DXK B;  2OTJ N;  4B9Q A;  1HLU A;  4ISF A;  5KPZ A;  3PIP L;  4FWP A;  1QHA A;  1BG3 A;  4YOT A;  3HRG A;  4FPA A;  3B8A X;  4BRG A;  4Y0W A;  1HJO A;  5AQH A;  1BDG A;  1NGG A;  3RSE A;  3VEZ A;  4B1V A;  1GLD G;  1XQS C;  3VEY A;  3KWI A;  4JHD A;  1YJN N;  1VQP N;  3D6R A;  3IFR A;  3IKM A;  5BN8 A;  1W2B M;  3ID8 A;  2ZGY A;  3U9Z A;  3ZX0 A;  5C0Y A;  2VYP A;  3LL3 A;  5AQJ A;  1SQK A;  1YJ9 N;  4G9Z A;  3CME N;  1U2V B;  3EZW A;  1Q82 O;  2F9T A;  3L4Q A;  5TKW A;  4XH4 A;  5M1Q A;  5LJV A;  3HOT A;  4A2A A;  3F2K A;  2RHK A;  4BRH A;  1KXP A;  2FSJ A;  4GV9 A;  1SZ2 A;  4BRK A;  2CGL A;  1VQ8 N;  3Q7B A;  1BO5 O;  4IO8 A;  4H5N A;  5GAG P;  4BY9 C;  3CHW A;  3CCR N;  2NLX A;  4C1N I;  3G4S N;  4BC4 A;  2NRR A;  4EIA A;  4XJX A;  5BPM A;  3MCA B;  3U9D A;  3SBG A;  2A3Z A;  4IOC L;  1Z05 A;  5KPR A;  3FLC O;  3EKU A;  3CPW M;  2QWO A;  2YJF A;  3CCU N;  1DT9 A;  3L6Q A;  5AR0 A;  3C6A A;  5AQZ A;  5BN9 A;  2W00 A;  4CZG A;  1S22 A;  4XH5 A;  3QFP A;  3R9P A;  5BRE A;  4F9O A;  5FPE A;  1P8Z A;  3O5B A;  4BRM A;  5C12 A;  2ZGZ A;  5TKY A;  5CR4 A;  1GLC G;  1M90 O;  1GLE G;  4A5A A;  3BF1 A;  4U7B A;  3VEN A;  1JCF A;  3HSC A;  4BR4 A;  3CXC M;  4BRI A;  3VES A;  3LDO A;  1P90 A;  4GNI A;  1GLL O;  3SJH A;  1WOQ A;  4H0Y B;  4YOV A;  4FSV A;  1VQK N;  2GX9 A;  4MLE A;  4FWN A;  3VEX A;  5F1X A;  1C0G A;  5MLC Q;  4BR5 A;  3LDP A;  4BQZ A;  4JKE A;  3E66 A;  3VET A;  2ZWH A;  1SAZ A;  1YUW A;  4E1J A;  4JNE A;  5EVZ A;  3G25 A;  1JCE A;  3AAP A;  1Y64 A;  1QQN A;  2BUP A;  3LDN A;  5AQW A;  2FF3 B;  4IO9 L;  4GV3 A;  2HBK A;  2IIR A;  2ZJR L;  1RGI A;  4AM7 A;  2P9I A;  4PHT X;  3AGR A;  1GLF O;  2CGK A;  3N4P A;  3CIP A;  4A62 A;  2OTL N;  1QVF M;  4JKA A;  5AZI B;  4A59 A;  3GG4 A;  3MN7 A;  3NVM A;  5BRF A;  1NGE A;  4FWQ A;  5EOY A;  4BC5 A;  2AA4 A;  2E1Y A;  3KVG A;  5BR9 A;  3R1X A;  2FSK A;  3WT0 A;  4BRE A;  5GAD P;  5FPD A;  4WYB A;  4A5B A;  4PL8 A;  1BA0 A;  2WFB A;  3SBT A;  3SK3 A;  5F0X A;  1Z6R A;  3CQX A;  3D2F B;  3HBT A;  1VQ5 N;  3I33 A;  4L3Q A;  4BRQ A;  3C6H A;  3VER A;  4ILJ A;  3KZB A;  3HOS A;  4IZ9 A;  3FGU A;  1VQ4 N;  4BRF A;  4BR2 A;  3QBX A;  2VGM A;  5AQO A;  3TTD A;  3A8Y A;  4Z94 A;  1IG8 A;  5AQM A;  3D2E A;  1KQS M;  2GWJ A;  2E1Z A;  2Q97 A;  3RSE B;  5BPN A;  2JWL A;  3CMA N;  2A40 A;  2QI2 A;  3ZYY X;  1BUP A;  4CBW A;  3O9R A;  4EFH A;  3H45 C;  3VTI A;  2EWS A;  4JHD B;  1ATN A;  3SAF A;  4WQ5 A;  2NNW A;  4BVP A;  1ILY A;  5GIN A;  2YI1 A;  4FWR A;  4BR0 A;  2IVP A;  4EAH D;  4JD2 A;  1DEJ A;  2Q0R A;  3VF6 A;  2P9L A;  3CCV N;  3FZM A;  3GL1 A;  3F9M A;  3UKR A;  2ASM A;  2Q36 A;  2Q0U A;  3G6E N;  3WXK A;  4BGB A;  1HKG A;  2QWM A;  1GLB G;  3DXM A;  3MWP A;  3H3N O;  5ADX A;  4M63 C;  3DJC A;  4H0V B;  4B1U B;  3CC2 N;  1J6Z A;  3D2F A;  3WXI A;  3TTF A;  2I7P A;  2NRZ A;  5AQI A;  1EO1 A;  2E88 A;  4BVO A;  5C15 A;  3MN9 A;  2HBJ A;  3CCJ N;  1S72 N;  3VOV A;  4H5T A;  4U67 L;  1VQ9 N;  3W0L A;  3BF3 A;  5AQK A;  3WXJ A;  4XEI A;  2CGJ A;  3UKU B;  3H3O B;  5EY4 A;  3P4I A;  5AQV A;  5M1N A;  5JVG L;  3CJB A;  3O9U A;  3OHR A;  3P38 A;  1LCU A;  4ILH A;  4BR7 A;  3TU5 A;  4BR9 A;  4MLH A;  3FR0 A;  3VGK A;  4JKF A;  4MDA A;  4WFB L;  4ISE A;  3CET A;  3WEE A;  4H5W A;  3M5R A;  4NB4 A;  3TTC A;  5AFU H;  3VTH A;  4YOW A;  4BE7 B;  1NWK A;  3EL2 A;  4BRL A;  5CE3 A;  2UYT A;  2DPN A;  1YJW N;  3VPZ A;  4FO0 A;  4H5V A;  4K41 A;  1MDU B;  4BRA A;  5C2D A;  1RDW X;  3HZ6 A;  4KH6 A;  3FFK B;  2FSN A;  1WUA A;  3CJ1 A;  2WBN A;  2ZF5 O;  4LC9 B;  1OKJ A;  1V4S A;  3H1Q A;  3KK7 A;  5E84 A;  3M3Z A;  5HOO A;  2W40 A;  3FE1 A;  2V7Z A;  4JN4 A;  3W3D A;  3ID6 A;  3SMP A;  3D7E O;  3L0Q A;  4JKH A;  1RFQ A;  2NRH A;  4IDH A;  2P9I B;  3SLC A;  4RTF D;  1MA9 B;  5C10 A;  4BQL A;  3UKU A;  4JKB A;  2QWQ A;  5AQQ A;  1Q7Y O;  3C0B A;  3CQY A;  4YOR A;  3OBY A;  4PKH A;  3QBW A;  4GVE A;  4KH4 A;  3E9P A;  3CC4 N;  4K25 A;  1NBW A;  5DM6 L;  3OBW A;  3LM2 A;  2HF3 A;  4O5F A;  3R3L A;  4RCH A;  3F5T A;  3EO3 A;  4NLC A;  2QM1 A;  4JEP A;  3ZX2 A;  3M1F A;  1NGC A;  1NGB A;  1GLJ O;  3QDK A;  1QVG M;  3OA9 A;  2HBM A;  1X3N A;  5KQ8 A;  1OVY A;  1ZC6 A;  2D1K A;  3BEX A;  3NVK A;  3D2E B;  3O8M A;  4BG9 A;  1V4T A;  2CH5 A;  4DCH A;  3C7N A;  4PKI A;  2A41 A;  2E2P A;  1NGI A;  1YF5 L;  1IJJ A;  1E4G T;  4BRN A;  3JS6 A;  2YX6 A;  4KH5 A;  2QWR A;  3A5N C;  4K43 A;  3CCL N;  4YOX A;  2QEX N;  2QWN A;  3VGM A;  4PKG A;  1Q86 O;  3ENB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...