1U2VA

Crystal structure of arp2/3 complex with bound adp and calcium
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
418
structure length
402
Chain Sequence
b'MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-Related Protein 3
molecule tags Structural protein
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
total genus 123
structure length 402
sequence length 418
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1u2vA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1u2vA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1u2vA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1u2vA04
4Z94A 4BQLA 3R6MA 1CZAN 4B1UB 3CHWA 2E2QA 4CD3A 4CZMA 4BRGA 5AZIB 1U2VB 5AQHA 3SK3A 1NGIA 2P9PB 1SZ2A 1OKJA 1D4XA 4CD1A 3DXMB 1YVNA 3DJCA 2Q0RA 5AQZA 4XH1A 1NGHA 2QXLA 3VEVA 1SQKA 3VGLA 3L0QA 4J8FA 1QZ5A 1BUPA 1NGEA 4CZFA 1MDUB 1RFQA 1GLBG 1HUXA 1GLLO 3VEYA 3FLCO 1X3NA 3WT0A 4CBWA 2FLOA 3CQXA 3FE1A 3FGUA 2P9KB 4A2AA 5B8HA 4XH4A 3IMXA 1HJOA 1HPMA 5KPRA 3ENHA 3RSEA 1TUUA 2HMPA 5AR0A 3B8AX 3VEZA 1BA0A 5JLHA 4PKGA 5AQKA 1LCUA 2IVPA 4K41A 3VGMA 2QWRA 2E2PA 3FZFA 3M6GA 4NB4A 3O8MA 3ZEUA 1DKGD 4FWSA 4MO4A 5TKYA 1V4SA 1X9JA 4FWPA 1MWMA 4BR5A 3HM8A 5AQGA 2P9KA 4QS9A 2P9NA 3A5MC 4BR0A 4FWOA 1WOQA 4YDUA 5AZJA 2P9UA 1EQYA 1QQNA 3CQYA 3DXKB 3GG4A 4H03B 1BU6O 1RDWX 3AY9A 4BRDA 3EN9A 3J8AA 4BRPA 4IXCA 1S3XA 3VF2A 2IIRA 3QDKA 5KPTA 1YUWA 2P9IA 1KAYA 5AQIA 4ISGA 2ZF5O 3QICA 5AQTA 4BRMA 4JNEA 3H3NO 5F2RA 4BC5A 1NGFA 4BRQA 1E4FT 2YCHA 3LM9A 4M63C 2W40A 3A5OC 5AQNA 3WQUA 3LDQA 2P9UB 3H3OB 4BVOA 4BROA 4WQ5C 2CGKA 4CZHA 1Z05A 2DPNA 4HTLA 3IFRA 5BRDA 1MWKA 1TUYA 1SAZA 4BRFA 1GLEG 1ESVA 2Q97A 3CERA 1JCEA 2FF3B 2P9LB 2GELA 3R8EA 3KHYA 3ZETB 2FSKA 4FSVA 2ASMA 2FSJA 1KAXA 2GWKA 4QS7A 2QW9A 3EKUA 1RGIA 2V51B 3A0IX 5ADXA 2I7PA 3WUHA 1WUAA 5BPMA 1S22A 4BRCA 3U9ZA 3VEOA 2YJEA 4MLHA 2QM1A 1NGCA 5FPMA 2CGJA 5AQRA 5AQMA 3DAWA 2E2OA 4HWIA 4BR9A 3DWLA 3AAPA 2GUPA 2HF4A 5KQDA 3VEWA 5AQLA 5AFUH 1HX1A 3IUCA 4BGAA 4EHTA 1KAZA 4FWKA 3A5NC 3QMLA 2QWMA 4BRNA 4BREA 3MN9A 5EX5A 3RSEB 3CJ7A 2QWLA 3M1FA 3GE1A 2V7YA 4H0OA 3VERA 2GEMA 3ZX2A 2UYTA 4BQZA 1J6ZA 4H0PA 4A61A 2D0PA 4M7XA 5AQXA 4DCHA 2VCPA 2Q0UA 2ZGYA 3VGKA 1C0GA 4FWNA 1ZXOA 4YDUC 2ITMA 4F9OA 5JICA 4MLEA 3D2FA 3LL3A 3LDPA 3QBXA 2P9NB 5F1XA 2QWQA 4BRHA 2D4WA 1C0FA 2E2NA 4FWQA 3O1WA 2E1YA 5LY3A 1H1VA 2EWSA 3LDOA 1V4TA 2YJFA 4CBXA 2D1KA 2QWNA 2QWOA 5BN8A 2AP1A 3H1VX 3BEXA 2CH5A 3VESA 1IJJA 1NGGA 4KBOA 1U2VA 1GLDG 3HBTA 4GNIA 3MDQA 5EOYA 1R59O 4O8KA 4MO5A 4LC9B 4E1JA 4XH5A 5BREA 5KPZA 3DXMA 4BC4A 4AM7A 2ZWHA 2Q2RA 2ASPA 4FL9A 3EKSA 3SJHA 5FPDA 5LJWA 1XUPO 4BR7A 2CGLA 3VPZA 5E26A 4PKHA 1NMDA 3MK6A 2F9TA 3C0BA 1Z6RA 3VENA 3GOIA 3IDHA 3D2FB 1BA1A 2P9SB 3GBTA 2W41A 1LOTB 1YAGA 2E1ZA 4BG8A 1QQMA 4CBUA 4RWTA 3BF1A 2A42A 3I33A 5JMVA 3MN7A 1K8KA 3DXKA 3GL1A 2NRHA 2WUSA 5CE3A 2YI1A 4ISEA 4DB3A 4WQ5A 4B9QA 3O80A 4DHYA 2P9IB 3WXJA 1ATNA 3GDQA 1P8ZA 3S41A 5BPLA 3MMVA 4B1VA 1Q18A 3FR0A 4K42A 4IZ9A 1QQOA 3W0LA 2HF3A 3CJ1A 1E4GT 2FXUA 4WQ4A 4QS8A 3QBWA 2YHYA 3HZ6A 2ASOA 3O1BA 1KXPA 4A2BA 3WXLA 3WXKA 3P4IA 4L3QA 5ADXH 5AZJB 4CZLA 2GWJA 1G99A 3EL2A 3JXUA 3G25A 1JCFA 1ATSA 1YXQA 2ZGZA 3M3ZA 3L6QA 4RTFD 4EIAA 3VEXA 4CZEA 3H46O 3BF3A 3BP8A 1NGBA 3LDLA 4BRLA 3ULEA 2A6AA 3HTVA 3HI0A 3FFKB 2A41A 3WXIA 3FZLA 1Y64A 3TPQA 1NLVA 3C7NB 4M7YA 5AZIA 3O08A 1NBWA 5AQQA 4WQ4C 4JHDB 2NZTA 3ATUA 4BG9A 4H5WA 4BRAA 3VOVA 1T44A 1JCGA 5EXWA 3O5BA 5AQWA 3OHRA 1ZBSA 3D7EO 3VF6A 3UKRA 3QFPA 2Q31A 4H0TB 4JAXA 1GLFO 3FZKA 2PBDA 3KVGA 3A5LC 2E20A 4H0XB 3ZETA 3U8XA 2FSNA 2PAVA 2P9PA 4Y0WA 2H3GX 1HKBA 4FWMA 4FPBA 2NLXA 4B1XB 2CH6A 5AQJA 3MN5A 1BG3A 3LM2A 3U4LA 4IO8A 3CI5A 5EVZA 4DQ8A 1NGDA 5AQFA 3LDNA 2BTFA 4FOIA 4JN4A 4IJAA 2YHXA 5BN9A 3JS6A 3SMPA 2GTDA 5ELZA 2QWPA 3A8YA 3SMSA 4H5RA 3EZWA 3QFUA 4CZJA 1GLJO 1T6CA 2E8AA 1BDGA 1U6ZA 2A5XA 4H0VB 4ISFA 4RCHA 5FPEA 3HSCA 3UKUB 5BPNA 3UB5A 5BRHA 1T6DA 4BC3A 1NGJA 5JLFA 3CJCA 2D0OA 1TYQB 4JD2A 3QB0A 1BO5O 4FWLA 2P9LA 3CIPA 3CJ9A 4K25A 1DEJA 4O5FA 4GY2B 3AAQA 2I7NA 1XC3A 1GLAG 5AQOA 1X3MA 1BOTO 4CI6A 5AQPA 2YHWA 4A62A 3O6WA 2Q36A 5LJVA 3TU5A 3H1QA 2J4RA 1ATRA 5AQSA 3I8BA 3R9PA 3ZX0A 3SLCA 2A3ZA 3ULEB 4BC2A 4EAHD 5AQYA 1NM1A 3H6EA 4EHUA 3VF4A 3D2EA 3CJBA 3MCPA 3EO3A 4B1YB 4BR2A 2V7ZA 2FF6A 5F0XA 4CJ7A 2V52B 2AA4A 3FZHA 4BRIA 1QHAA 3BUZB 2OANA 5E84A 3W3DA 4C23A 4K43A 3F9MA 4BRKA 4FO0A 1HLUA 3O4WA 4I6MA 3ZEUB 3UKRB 3WQTA 2F9WA 3L4IA 4EFHA 4PL7A 2P9SA 1NGAA 2VYPA 3C7NA 1QZ6A 2IVOA 4BVPA 3U9DA 5AFUA 2KHOA 4BR4A 3ID8A 4FWRA 5BRFA 1K8KB 3H45C 3VETA 4FOEA 4WYBA 4H5VA 4AM6A 3CETA 3UE5A 4CZIA 4IWVA 1TYQA 4H0YB 3CJAA 1NWKA 4IJNA 2E88A 1IG8A 3MN6A 4B1ZA 5KQ8A 1GLCG 3ATVA 2VWBA 4JHDA 4CZGA 5EY4A 5FPNA 4B1WB 4CZKA 2IVNA 4H5TA 4XEIA 5BR9A 5AQUA 3AARA 1XQSC 3ENOA 1MA9B 4BGBA 3KZBA 2A40A 4FPAA 3UKUA 2BUPA 3ZX3A 2Q1NA 3FZMA 1BWFO 4NO7A 3WEEB 5I9EB 4PKIA 1HKCA 3D2EB 3WEEA 4H5NA 1ZC6A 1DGKN 2HOEA 4JD2B 5AQVA 1HKGA 4I6MB 4PL8A
chains in the Genus database with same CATH superfamily
4Z94A 4LF4K 3CHWA 1BIZA 1U2VB 4CGHA 5IWAK 1OKJA 1D4XA 2GBZA 4FZYA 3D0PA 1YJNN 5DMRA 3DJCA 4OJRA 5I42A 1EWRA 3G4SN 3V4IA 5HRPA 4CGGA 1SQKA 2HBLA 1QZ5A 1C0TA 1NKBA 4A57A 4CZFA 4YOWA 5C2DA 2VGNA 2YHAA 1MDUB 1RFQA 4DTSA 3P31A 4DSIA 3FLCO 4YOXA 3CQXA 4KKOA 3TTCA 2UXCK 5K14A 1D9FA 1HRHA 4M42A 3LANA 5KRSA 4CHZA 3RVCA 1F21A 3O3FA 4B9LA 1NOZA 1S6PA 3DI6A 2HMPA 4CFCA 3VEZA 4PKGA 1LCUA 1BCOA 4IOCL 4Z4EA 4NB4A 3O8MA 2ATQA 3QEIA 3AO5A 1RDBA 4JI8K 3HM8A 2P9KA 2D0BA 2HHVA 4ELUA 2DFFA 2P9NA 3VQ5A 5KRTA 3RMDA 3OS1A 3NE6A 2HHIA 1ZBHA 3BGRA 5CHIA 2B4JA 1VQ6N 3PUFA 3GG4A 5CYMA 4IOXA 1RDWX 3AY9A 3BDPA 4B3RK 4LF8K 4FJNA 4IXCA 3KK3A 3QDKA 1T7PA 3SUNA 3AO3A 4DQQA 1LW2A 1ZBFA 5AQTA 3THWB 4BRMA 1G15A 4GMJB 2NRRA 3TAMA 3ZT3A 4LF5K 4BC5A 2NRZA 2BGGA 1KFDA 3LDQA 3H3OB 2VGMA 4WQ5C 3SZ2A 4FJ5A 2DPNA 4HTLA 4DQIA 2RE2A 4M41A 1SAZA 1GLEG 3ALYA 1JCEA 2P9LB 3NCIA 4GKJK 3ASMA 4B9MA 2B6AA 5HOOA 4XIUA 4KB1A 4AHSA 5LMUK 2QW9A 2HMIA 4ZTJA 1RGIA 5C12A 1IH7A 1KTQA 3I8DA 3A0IX 3SPYA 1VHXA 3SJJA 1KVAA 3RTVA 2WBNA 1VQ7N 1J53A 3SPZA 4OO1J 3WUHA 1WUAA 4KO0A 4FM2A 5FPMA 3TTDA 5CYQA 5AQMA 3DAWA 2E2OA 4HWIA 4R5PA 4FLYA 2HF4A 3AO4A 2ZD1A 3VEWA 4YY3K 1CXQA 3IUCA 4FLXA 2XY5A 4CJWA 1IBMK 3QMLA 2QWMA 4BRNA 3ZSWA 4BREA 3S3MA 1HNIA 5J1EA 2QKKA 3GE1A 2V7YA 4H0OA 3PIPL 3SCXA 4ILHA 2GEMA 4H0PA 4A61A 2D0PA 4M7XA 5C24A 2ZGYA 2X78A 4FM0A 1I3AA 4YDUC 2ITMA 4BEBA 3LL3A 3QBXA 2YV0X 4W5OA 3TAEA 4KH4A 4DU4A 1NNEA 3L2QA 4DR2K 4IDKA 4FWQA 3P1GA 1RNHA 2C1IA 3E1YA 3LDOA 5M1NA 2YJFA 4DFKA 2AJQA 2QWNA 2HB5A 2WOMA 3CCUN 4JKFA 4Z4CA 2IS3A 2QWOA 3THXA 2CH5A 4FLUA 3DLHA 2JWLA 1GLDG 4JI1K 4E1JA 4XH5A 3S9HA 3A2FA 3AVIA 1OH6A 4F3OA 2JLEA 3EKSA 2G8UA 3E9PA 2G8FA 5FPDA 4CW7B 4YOYA 2D0AA 3DLBA 1HMVA 2BE2A 4O4GA 3HVTA 3O9UA 4CCHA 4DTXA 1LOTB 4C8OA 3P38A 5GIPA 4E7JA 1UAXA 1LWEA 2E1ZA 4BG8A 3BF1A 5JMVA 3MXMA 3MN7A 3DXKA 2BANA 5CE3A 4ISEA 4B9QA 4EZ6A 2YKNA 2P9IB 1DTQA 3PSIA 5I3UA 2G8VA 4IG3A 1Q18A 1T8EA 4KHWA 4CF1A 4OKJA 4QS8A 4DSEA 3HZ6A 2ASOA 4JKAA 4E7KA 2G8KA 5DM6L 4KV8A 1BCMA 1CZ9A 3DOLA 4KHQA 4CHOA 5LMNK 3WXLA 4IEEA 1JLFA 5AZJB 1XNRK 4JK9A 2ZGZA 2B5JA 1TK5A 1JJ2M 3AVKA 3H46O 3BF3A 3BP8A 4BRLA 3NF8A 3BZCA 1IV0A 3C6UA 3HTVA 4RW7A 2A41A 3WXIA 1NLVA 3PSFA 4JKDA 3CCJN 4BDZA 4FJ8A 3R1XA 1BGXT 1JLBA 4BRAA 1TKZA 5EXWA 4PWDA 4FZZA 1SKSA 1XHXA 5HBMA 1VSFA 3QFPA 2Q31A 4H0TB 3NF7A 4DG1A 4KPYA 4H0XB 4JK8A 4CJUA 3J80O 1RT6A 2FSNA 5GAHP 4CEQA 4PUOA 1Q9XA 3OYKA 3OW2M 4DQSA 2NLXA 1TKTA 2UXBK 5AQJA 2UUCK 1BG3A 3LM2A 4IO8A 4DQ8A 3KKRA 5KTQA 5AQFA 4U67L 3V9ZA 1O13A 4DV1K 1SV5A 4IJAA 2HHSA 1YT3A 4IBNA 1JLEA 3JS6A 4DKWA 3VQ8A 4M3TA 1WSGA 1GLJO 1S1VA 2A5XA 4H0VB 2UUAK 3UKUB 4F2RA 4Y1DA 2E6LA 3UB5A 1YJWN 1KC8O 4JI0K 3I0RA 5HRRA 4BE0A 3U6FA 3CJCA 2D0OA 4DQPA 5KI6A 3VTIA 4FWLA 3S3NA 3CJ9A 1FJGK 4K25A 3AVHA 4LH4A 3RMAA 4CI6A 1K9MO 3TTFA 3AA2A 1BHLA 3VQQA 5C25A 5LJVA 3J7AP 5CZ2A 4FK2A 1YIJN 3DRRA 1RDCA 5AQSA 5MLCQ 3OYCA 2WTUA 1HYVA 2Y1JA 3LPUA 4J2BA 3H6EA 3T1YK 3LWMA 4H4MA 3CJBA 3MCPA 3EO3A 2O4IA 2FF6A 5F0XA 2AA4A 4BRIA 1NK6A 1JXBA 3OJSA 1VQ8N 5E84A 3W3DA 3ZT1A 4LF7K 2O8CB 4BRKA 1HLUA 2HBKA 4YOTA 3CFRA 3F9KA 2D0CA 3C7NA 3EE9A 4Y1CA 2IVOA 5AFUA 4IDHA 2ZJPL 4TSXA 3F73A 1FK9A 1K8KB 3NHGA 3VETA 3I0SA 1X9WA 1YVUA 3AA5X 4BDPA 4AM6A 3CETA 1NK0A 1TYQA 5D3GA 3CJAA 1SKRA 2VWJA 2E88A 5KQ8A 3ATVA 3NH1A 3I55N 3OYFA 2ZJRL 3KTQA 3VQ6A 4Z4FA 1VQ9N 1HJRA 2X6NA 1QSYA 1CLQA 3SAFA 3ZSZA 1BWFO 4PKIA 2Z1HA 4GV3A 1ASVA 4Z4HA 4YNQA 4O55A 3QETA 1DGKN 1KQSM 4B3TK 1JKHA 4BQLA 4B1UB 2IDOA 1QS4A 4CD3A 5AZIB 3SK3A 1NJXA 1NGIA 2GV9A 1D9DA 3VTHA 1HQUA 2KFZA 1TAUA 1IBLK 3T7ZA 1YVNA 2FBTA 2Q0RA 5AQZA 4XH1A 3IKMA 2NUBA 4IFYA 4CK3A 4WFBL 3AVMA 3DLRA 2ZE2A 1BUPA 4OLBA 4FK4A 3EEQA 1W9HA 3TABA 2ETJA 1GLBG 3HP6A 4DR1K 4HCCA 5GAEP 3CFPA 3TWHA 5J2MA 5J2PA 1BIUA 2QEXN 3WT0A 1VQNN 1WSJA 3FGUA 5B8HA 3CM6A 1Q7YO 4DTNA 5KPRA 3ENHA 3RSEA 3TSQA 5AR0A 2X6SA 4EZ9A 4K41A 1VSDA 3VGMA 2E2PA 3FZFA 4CECA 4FWSA 4NXMK 5TKYA 2FBVA 3R3LA 1MWMA 2YNHA 3HL8A 4CGJA 4BR5A 3QEVA 1WBDA 3AVJA 1KLNA 4BR0A 3OTOK 4DUYK 2Y1IA 4DMNA 1J54A 4WFAL 3NGZA 4H03B 4C8MA 2R7YA 1VSEA 3EN9A 5FDLA 4BRPA 1S3XA 4E72A 3THYB 1S9GA 2P9IA 3K0SA 3AVNA 4FLVA 3QICA 4LFAK 4JNEA 3NMUA 3VQCA 1VQON 2GX9A 3UIQA 3TAGA 1W2BM 3H3NO 1IBKK 3CXCM 1NGFA 4BRQA 3TARA 4CF8A 5AQNA 4E89A 4KTQA 3SNNA 4JKEA 4CZHA 1Z05A 3THVA 4CJ3A 4BY9C 2FBYA 4CEFA 3ITHA 3CERA 1I39A 3PX0A 4ICLA 2FF3B 3ZYYX 4RW9A 1BQMA 4FJ9A 2GELA 1K73O 2PYLA 1B9DA 3ZETB 1REVA 4FSVA 1O1WA 4NYNA 4QS7A 3KLGA 3EKUA 3NGIA 3O9SA 2QXFA 2OYQA 4CJRA 4DV2K 3DRSA 4DSFA 4O0JA 5ADXA 3OYBA 4NCGA 4K8XA 4FJJA 1S22A 4DFMA 4J2AA 1NKCA 2CGJA 2OPRA 5AQRA 3OYDA 4BR9A 3CMAN 5KQDA 2HSTA 1HYSA 5AQLA 1KSPA 3AVAA 3OYAA 3QNNA 3NF9A 3V1OA 4BGAA 4DV5K 4EHTA 3KLFA 1SKWA 4XJXA 4Z4GA 2QWLA 3M1FA 4MFBA 4YFUA 4FYDA 1JLGA 5HL7L 3ZX2A 3K5NA 5C42A 4BQZA 4UQGA 4OKEA 1J6ZA 3G71N 3MCAB 3WXMB 3THWA 2Q0UA 4N41A 3VGKA 4FWNA 1N6QA 3ZT0A 4KHPK 4F9OA 3LDPA 3V9UA 3KD1E 1WB9A 1QSSA 2QWQA 4BWMA 4CIGA 1NG9A 2E2NA 1EXQA 3LAMA 1A5WA 1H1VA 3NBPA 1GOBA 2EWSA 3QNOA 2VG5A 1V4TA 2ITGA 3MXJA 4E3SA 2D1KA 1L5UA 3ZSQA 3NDKA 4KTZA 1NJZA 2IAJA 4C8KA 3OYJA 3QERA 5BN8A 3HPOA 4BDYA 2VQEK 3H1VX 3VESA 4DR4K 1NGGA 3KIOA 4KBOA 3QEXA 4GNIA 1DLOA 4Q0BA 4LC9B 1B92A 4O44A 5KPZA 2IC3A 1I94K 3DXMA 3O9TA 4I9QA 4AM7A 3OYIA 2ZWHA 4B9NA 1VRUA 1VK0A 4FL9A 1VQLN 1MU2A 4BR7A 3HJFA 4YHHK 1NMDA 3MK6A 4PA1A 5HROA 2HBJA 3CYMA 4CF2A 2O8EA 3MEGA 4ILGB 1BA1A 3GBTA 3OJUA 1YAGA 4GV9A 3LZIA 5EU7A 3J7ZO 4OLAA 3GL1A 1Q86O 2BDPA 4CGFA 2NRHA 4DHYA 4WQ5A 3O80A 5CZ1A 4B08A 3CC2N 3GDQA 1HQEA 3FR0A 4K42A 4IZ9A 1QQOA 3W0LA 2JWKA 1E4GT 2FXUA 4FLTA 4O8UA 4WQ4A 3HPGA 2YHYA 3F5TA 4RW6A 2KZMA 2HW3A 4Q5VA 4M3XA 3AGKA 5ADXH 4CJEA 4CZLA 1YITN 3EL2A 1G99A 1JCFA 4CJTA 1ATSA 1RTIA 3HK2A 1HPZA 4CERA 4GV6A 4DF4A 3VEXA 1VRTA 1NGBA 3LDLA 2A1RA 3ULEA 2XHBA 4DV6K 3FFKB 3FZLA 1VSKA 1NBWA 4JHDB 2NZTA 4H4OA 3VOVA 4J2EA 1VSMA 5FRMA 3O5BA 4CFDA 1EP4A 2VG6A 3JYTA 1ZBSA 4CEBA 3D7EO 1L3VA 4JYAK 4JAXA 4DSLA 3CC4N 1K8AO 4QCLA 3KVGA 2YX6A 1WLJA 2DTUA 2PAVA 4B9TA 4CJPA 4DTRA 4FPBA 1N33K 3AVFA 1ZBUA 4DS4A 1ZBLA 2CH6A 3M8QA 1FKOA 4N56A 3S3OA 2O8BB 3MN5A 2DFHA 5GAGP 5EVZA 4GKKK 1N36K 3LDNA 4K8ZA 5FROA 1WAJA 2IOCA 4KH6A 2YHXA 1X9SA 5BN9A 2GTDA 3VQ4A 2QWPA 1C0MA 3ENBA 5T7BA 4M45A 3EZWA 3K9KA 1NOYA 4HUFA 1A5VA 2E8AA 3B6PA 4KH5A 3N4PA 4ISFA 3HSCA 3HOTA 1X1PA 5BRHA 3DLKA 3RMCA 1RT3A 2OZSA 1U45A 4M3YA 1NGJA 1QSLA 5JLFA 3KKSA 2NNWA 1TYQB 3V9WA 4FJGA 3QB0A 3SQ1A 4Z4IA 4B3OA 4W5NA 3AVLA 4O5FA 1XC3A 2JGUA 4CEAA 1NK5A 4ILJA 3OYLA 2Q36A 3KWGA 4OGCA 3TU5A 1KVBA 2J4RA 1ATRA 1U47A 4I2PA 1X9MA 3ULEB 3HP9A 3CCMN 3OS2A 3QEPA 1NM1A 4G1QA 4EHUA 1L3UA 4CJLA 4BACA 3CCLN 2FC0A 4CJ7A 3FZHA 1T3VA 4CEZA 4C23A 4JKCA 3F9MA 3ID6A 5HP1A 4M3ZA 3O4WA 4WCEL 3WQTA 4PL7A 3L4IA 4JRQA 1QZ6A 3IRXA 4Z0UA 4FW1A 3QLHA 4CJVA 2VQFK 2KHOA 1XC9A 2HBMA 4FWRA 5BRFA 3MEEA 3V1QA 4DR5K 1BL3A 4JI6K 3LP3A 3D6RA 3QEWA 4H5VA 4H0YB 1NWKA 4M3WA 1IG8A 4B1ZA 3K58A 3QIPA 4DTJA 4JK7A 1GLCG 1RBRA 3JAMO 2QA4N 2VWBA 3CCQN 2QKBA 2KFNA 3SAHA 1IKYA 3HPHA 4B1WB 2IVNA 4H5TA 4X66K 5AQUA 1XQSC 1JXEA 3AVCA 5A2QO 3ENOA 3BZKA 3KZBA 5E41A 1S1XA 1T05A 2Q1NA 1B9FA 5C0YA 1LWCA 3WEEB 4KHSA 4CGDA 1KVCA 3D2EB 4LY7A 3OVNA 2O4GA 3SAGA 3R6MA 1CZAN 3O4NA 4IEIA 1BI4A 4BRGA 5AQHA 3SQ2A 2ZM6K 4DR7K 4CD1A 2WC9A 4DV3K 2O8BA 3VEVA 1RT7A 3VGLA 4CFAA 1ILYA 1NGEA 3DMJA 2WONA 1HUXA 2RN2A 1GLLO 5KGWA 5M1QA 1U48A 4CJQA 3DLGA 1LV5A 1A5XA 4FVMA 4XH4A 2E5LK 1HPMA 3RRGA 4LD0A 2G8IA 1TUUA 4JKGB 1W97L 3B8AX 3WNFA 4FK0A 2W6KA 2IVPA 4HCBA 4AHUA 2QWRA 3M6GA 4DR6K 2HHTA 1EO1A 4OPKA 3QO9A 3T3FA 3SQ4A 1X9JA 4FWPA 4A5BA 4ELVA 1KFSA 4RW8A 1R0AA 2F8SA 1YF5L 4CGIA 2W6LA 4FJXA 4YDUA 3DM2A 3LDSA 2P9UA 3CCEN 1QQNA 2LSNA 5J2NA 2Z1IA 3VF2A 2IIRA 3C6HA 3T19A 4MDBA 4FJIA 1KAYA 4ISGA 1S9EA 1TK0A 5FRNA 4K0KK 1S1UA 2YNGA 1VQMN 2F4VK 4GVMA 4CJ5A 4FJ7A 3E66A 5F2RA 1WNSA 1BQNA 1M1KO 3LM9A 3WQUA 5KGXA 2P9UB 4OX9K 2E6MA 2CGKA 5HRNA 2W42A 3G10A 3SBTA 4BE2A 5BRDA 1TUYA 1EX4A 3O4QA 1ESVA 3VA0A 4JRPA 1JL1A 1Z25A 3E01A 1NK7A 1OH7A 1TKXA 3R8EA 3TAQA 2FSJA 1KAXA 4LSLA 1RTDA 4CJFA 1RBTA 1RDAA 1FW6A 1QTMA 2I7PA 4IFVA 3SI6A 5BPMA 5H1SQ 2OZMA 4BRCA 4DTUA 3VEOA 4MLHA 2O8FA 4AHCA 2RKIA 4CJKA 3VN5A 4DR3K 4CF0A 3AAPA 3KD5E 2GUPA 3OBWA 1U49A 4DV0K 2FBXA 1C1CA 5AFUH 1HX1A 4J2DA 4FWKA 3A5NC 4EP4A 5DK5A 1JLCA 3MN9A 5EX5A 3WNEA 4B8AB 3O9RA 1TKDA 1RT5A 2O8FB 4BECA 3KLHA 4W5TA 1CZBA 3K9JA 1HNZK 4ELTA 3H08A 3KLEA 3OBYA 4WFNL 3KK7A 4ID5A 1NJIO 4MLEA 4EP5A 3D2FA 1RT2A 3V6DA 3EY1A 4IOAL 5F1XA 5LL6Z 1C0FA 2E1YA 5LY3A 1UA0A 4A5AA 3L2RA 1TL1A 4CBXA 1NJYA 3DYAA 4PY5A 3NVKA 3MAQA 2E4LA 3SUPA 2PYJA 1IO2A 1OVQA 2PFUA 4CIFA 3BEXA 4F2SA 1TL3A 4AH9A 4HUEA 3HBTA 2HNDA 3MDQA 3M8SA 4O8KA 4MO5A 4R79A 3V1RA 4W5QA 1VSIA 1WAFA 5BREA 3PLAA 2P5OA 4LH5A 3PO4A 4BC4A 2Q2RA 3RR8A 1KLMA 3AVBA 5LJWA 4FJKA 3Q7CA 3VPZA 3TAFA 4YORA 5CR4A 1WSHA 4JI5K 1IKXA 1S72N 3C0BA 1KD1O 3VENA 3IDHA 3ZT2A 3D2FB 4FM1A 2P9SB 2Z1GA 4AHVA 3L3VA 3VQBA 4CBUA 4RWTA 5JVHL 2A42A 3I33A 4JLHA 3MXIA 5IT9O 2YI1A 4GVEA 3WXJA 1ATNA 5BPLA 3MMVA 3CCVN 3L3UA 3CJ1A 4IG0A 4CF9A 3CQ8A 4LFCK 3QBWA 1IKVA 3O1BA 2G8WA 3CCRN 1KXPA 3LPTA 3ZSVA 4A2BA 4DFPA 3M8RA 2OPQA 4C8LA 4DTPA 3WXKA 3K5LA 3P4IA 1ASUA 1QHTA 4U7BA 1ZYQA 1C0UA 3AA4A 4BWJA 2GWJA 3JXUA 4JI4K 3K5OA 1WSIA 1YXQA 1DTTA 4AHTA 4CFBA 2OA8A 1YTAA 3L6QA 4RTFD 4EIAA 4CZEA 3SUQA 5GINA 4E1MA 2A6AA 3HI0A 2NRWA 3TPQA 4CHNA 4WF9L 3C7NB 3O08A 4LSNA 3KK1A 4WQ4C 3NGYA 3ATUA 5M1KA 1T44A 1JCGA 1J5OA 2QK9A 2NRVA 3VQ7A 3OHRA 1JLAA 3MWPA 3VF6A 3G6EN 1L3TA 3VA3A 3B6OA 3A5LC 3ZETA 3ULDA 1RT4A 1U04A 3AGRA 4Y0WA 3ZSXA 4CHQA 2QTDA 1HKBA 4FWMA 1OH5A 1VSJA 3C65A 4JI7K 3AO2A 4B1XB 3C6TA 3ZLJA 3IG1A 4F4KA 3CI5A 4B3MK 2C1GA 3O9QA 3DLLL 2BTFA 4FOIA 4KHUA 1P90A 4JN4A 4L8RB 2VG7A 4KI4A 2O8CA 4PL8A 3IAYA 3A8YA 2YKMA 3P5JA 3SMSA 4H5RA 4CZJA 2OTJN 1U6ZA 2PY5A 5FPEA 3QIOA 5BPNA 1NMNA 3OYEA 4DTOA 3EE8A 1Q82O 3T1HK 4O5BA 3HOSA 4CK1A 4OPAA 1RTJA 3PX4A 1BO5O 2UXDK 2P9LA 3CIPA 2F96A 1DEJA 4GY2B 3AAQA 2G8HA 1BOTO 3C94A 1WN7A 5AQPA 1S1TA 2YHWA 4A62A 2KTQA 1HNWK 4FZXC 3RWUA 1RT1A 3R9PA 4FJHA 4BC2A 3BY5A 5AQYA 3HRGA 2HNZA 3MX5A 3VF4A 3ZCMA 1RTHA 3D2EA 4DLGA 2V52B 4H8KA 1TVRA 3OYMA 4PQUA 1K6YA 1OVYA 4QOZB 4B9SA 3CC7N 4M3UA 3ZEUB 5BR8K 2I5JA 4OGEA 3UKRB 2F9WA 2P9SA 2QI2A 2F8TA 4BVPA 3C6AA 3AV9A 3U9DA 4BR4A 4DUZK 2A1SA 3U3YA 3H45C 1JL2A 4DU1A 1Q8IA 4KFBA 3LALA 4FOEA 3UE5A 4KRFA 4IWVA 5DM7L 4QAGA 4DFJA 3CYGA 4IJNA 3AA3A 3MN6A 3FFIA 4G9ZA 4CZGA 5EY4A 3LAKA 2XRIA 3RMBA 1ZBIA 3KJVA 3ZSOA 4XEIA 3M5RA 1XMQK 3AARA 1HNXK 1LW0A 4BGBA 5M1FA 1YTUA 4FPAA 3UKUA 2BUPA 4X65K 3FZMA 1HNVA 5I9EB 2UUBK 1JLQA 3O3GA 3WEEA 4H5NA 1ZC6A 4JD2B 2HOEA 1HKGA 4I6MB 2E2QA 4CZMA 4UY8O 1HYZA 1SUQA 4DV7K 2DY4A 1UOCA 3SQ0A 2P9PB 3L4QA 1SZ2A 1LAVA 5HRSA 3DXMB 3TSPA 1W7AA 4JEPA 1NGHA 2QXLA 1D8YA 2UU9K 1N34K 3L0QA 4J8FA 1DT9A 1XI1A 2X74A 2IGIA 4DV4K 2HVIA 4RW4A 3L2UA 5FLXO 1XHZA 1HR0K 3VEYA 4DQRA 1XWLA 1X3NA 4CBWA 2FLOA 3FE1A 3CPWM 2P9KB 4A2AA 3IMXA 2OPPA 1HJOA 1Q9YA 1QE1A 3IS9A 1VQKN 3OS0A 1N32K 3CG7A 3CM5A 4NCBA 4FVUA 1NK4A 1S1WA 4DSJA 1M90O 5TKWA 5SWMA 3NAEA 1VSHA 5JLHA 1BA0A 3P39A 3SV3A 4E7IA 4DSKA 1WSEA 5AQKA 5JS2A 4FXDA 1DKGD 4MO4A 2KZZA 4JV5K 1V4SA 3NVMA 2XY6A 3NH2A 2PZSA 5AQGA 3J81O 4HHTA 1TV6A 3O3HA 4QS9A 3PX6A 3A5MC 4WE1A 4FWOA 1WOQA 5AZJA 4ZTFA 4AHRA 1EQYA 3CQYA 3DXKB 3CF5L 1BU6O 1BISA 4BRDA 4CEDA 3LWLA 2KLAA 3J8AA 5JVGL 3QINA 5KPTA 1YUWA 2NRTA 5AQIA 3NF6A 2OCEA 2ZF5O 2OPSA 4CHYA 1SS6A 4JI3K 2HHQA 3S5TA 2RPIA 1E4FT 2YCHA 4M63C 1UWBA 2W40A 3A5OC 1NK8A 3RRHA 4BVOA 3HYFA 4BROA 4F3TA 5GADP 4YOUA 4I2QA 2F7TA 3L2WA 3IFRA 1MWKA 1RCHA 3T1AA 2HHWA 4IKFA 4BRFA 1C6VA 1RILA 3L2VA 2Q97A 1UA1A 3I56N 4CE9A 3HO1A 4BE7B 5AJ3K 2P1JA 3KHYA 4ZHRA 2FSKA 1WBBA 2ASMA 4NCAA 3KLIA 2GWKA 1RBUA 3N4QA 1EKEA 2V51B 3V9XA 4GW6A 4CHPA 3U3GA 4DS5A 1XNQK 3T69A 3U9ZA 2YJEA 2Q3SA 1E3MA 2QM1A 4KREA 1NGCA 3SV4A 3DWLA 1GOCA 3K5MA 1QVFM 5GIOA 4FJLA 1VQPN 1ITGA 4KTWA 3Q7BA 1KAZA 1TGOA 4E19A 4FLZA 2O8EB 3M8PA 3RSEB 3CJ7A 4YOVA 3HT3A 3MWTA 3VQPA 2KW4A 3VERA 2DFEA 2UYTA 4DCHA 5AQXA 4CVNE 4NYFA 2VCPA 1J5EK 3HXMA 4X62K 4PHTX 1C0GA 1ZXOA 5JS1A 1C1AA 4B3SK 4MQ3A 5JICA 1W0HA 2P9NB 2ZQBA 4BE1A 1L3SA 5C15A 4BRHA 2D4WA 3TSUA 2P5GA 3TANA 3LP1A 3O1WA 4DLEA 4C8NA 4B9VA 2YNIA 2VWKA 3OY9A 2HHUA 3HVRA 2AP1A 1NKEA 1IJJA 4B8CA 1U2VA 4IO9L 5EOYA 1R59O 3LP2A 4CEEA 1C1BA 3MX2A 3PIOL 3K57A 1KRPA 3ZT4A 3KWIA 3AO1A 4CEOA 4AILC 3THYA 3ZSRA 2ASPA 4V19S 1NJWA 2ZJQL 4AQYK 3SJHA 1XUPO 2CGLA 5E26A 3D45A 4PKHA 4CK2A 3VQ9A 2F9TA 1FKPA 2BH1A 1IKWA 1Z6RA 3G0ZA 3GOIA 4JS5A 3MECA 2KQ2A 2W41A 1WSFA 1S6QA 2EHGA 1KCFA 1QQMA 3K2PA 4N47A 1Q81O 5C10A 2OTLN 1RBVA 1K8KA 3CD6N 3QESA 4LF6K 3F2KA 4JS4A 2WUSA 4DB3A 2O8DB 4AF1A 4DTMA 1QQCA 4O0IA 3TAPA 3LZJA 1SL1A 4FW2A 1P8ZA 3S41A 4B1VA 3E9OA 3PV8A 2HF3A 3L8BA 3J7YP 3AVGA 1VQ4N 1XMOK 4I7FA 3OYHA 4JKBA 1LWFA 4RG8A 4X64K 4L3QA 4LFBK 3G25A 3PO5A 4B9UA 1S5JA 3M3ZA 4IFEA 3HSTB 4CJ4A 4ID1A 1U4BA 2HHHK 4E7LA 2HHXA 1ASWA 4FJMA 5HLFA 4CJSA 3VQEA 1QVGM 1Y64A 1BI4B 3VQAA 4M7YA 5AZIA 5AQQA 1T03A 2EX3A 1TK8A 2RHKA 3WNGA 1RDUA 4BG9A 4H5WA 5M1PA 4HVJA 5AQWA 4NXNK 2YHBA 3NH0A 2O8DA 3UKRA 3OA9A 1GLFO 3FZKA 5CY4A 2PBDA 2Z1JA 5C2FA 2E20A 2HNYA 3K59A 4KHNA 3U8XA 1N5YA 4M3RA 2P9PA 2H3GX 3RR7A 3ZSYA 4E0DA 2XO7A 3NFAA 4OKKA 3CFOA 3SUOA 1YJ9N 1NK9A 3VQDA 3U4LA 1NGDA 4N5SA 4CIEA 3KK2A 3EZ5A 1EETA 4DF8A 5J2QA 4LF9K 3P83D 4CESA 4KAZA 1YI2N 4DWIA 3E9LA 3SMPA 1RBSA 5M1OA 1N8RO 3QFUA 1T6CA 4FCYA 1BDGA 4RCHA 1J9AA 3MEDA 3VMFB 1T6DA 4E1NA 3C95A 4DU3A 2HVHA 4JKGA 4BC3A 2KKZA 1GOAA 2W00A 4JD2A 3WNHA 2YNFA 4A59A 2I7NA 1SL0A 1GLAG 4JKHA 5AQOA 1X3MA 3OYNA 4HUGA 1VQ5N 3OYGA 3O6WA 2D5RA 2XY8A 3H1QA 4KB0A 3CPEA 3I8BA 3ZX0A 1D5AA 2A3ZA 3SLCA 4MDAA 1SL2A 4EAHD 4NLCA 1IG9A 4I9LA 3V9SA 3DRPA 4C1NI 1Z26A 1Y97A 4B1YB 2V7ZA 3HM9A 2XY7A 3CMEN 1QHAA 3BUZB 3DOKA 2OANA 4FLWA 1OH8A 3DLEA 4K43A 4KHYA 1EWQA 4FO0A 4I6MA 4NLBA 4EFHA 3ISNC 1NGAA 2VYPA 3LP0A 3SYZA 3ID8A 3PY8A 4W5RA 3V81A 2RF2A 1NU0A 4WYBA 4KI6A 4CZIA 2GUIA 4C1NK 4N76A 4OVLA 3THXB 3JSMA 4JHDA 1VAZA 1TAQA 1RDDA 2WFBA 3SBGA 5FPNA 4CZKA 5BR9A 1FXXA 5SZTA 4HTUA 1VSLA 3TR8A 5JENA 3CCSN 4OPJA 1MA9B 4JI2K 2NRXA 4F8RA 4OPHA 2A40A 3ZX3A 1CXUA 4NO7A 1YHQN 1HKCA 4E7HA 2P51A 1LAWA 3TI0A 5AQVA 4BR2A 3EYZA 3ZEUA 5ELZA
chains in the Genus database with same CATH topology
4Z94A 4BQLA 3SAGA 3R6MA 1CZAN 4B1UB 3CHWA 2E2QA 4IEIA 4CD3A 4CZMA 4UY8O 4BRGA 5AZIB 1U2VB 5AQHA 3SK3A 1NGIA 2P9PB 3L4QA 1SZ2A 3VTHA 1OKJA 1D4XA 1YJNN 4CD1A 2WC9A 3DXMB 3TSPA 3T7ZA 1YVNA 3DJCA 2Q0RA 5AQZA 4XH1A 4JEPA 1NGHA 3IKMA 3G4SN 2QXLA 4WFBL 3VEVA 1SQKA 2HBLA 3VGLA 3L0QA 4J8FA 1QZ5A 1DT9A 1BUPA 4A57A 1ILYA 1NGEA 4CZFA 4YOWA 5C2DA 2VGNA 1MDUB 1RFQA 1GLBG 1HUXA 1GLLO 5GAEP 3VEYA 5M1QA 3P31A 2QEXN 3FLCO 1X3NA 3WT0A 4CBWA 4YOXA 2FLOA 3CQXA 3FE1A 3FGUA 3TTCA 1VQNN 3CPWM 2P9KB 4A2AA 5B8HA 1Q7YO 4XH4A 3IMXA 3RVCA 1HJOA 1HPMA 1VQKN 5KPRA 3ENHA 3RSEA 4FVUA 3TSQA 1TUUA 4JKGB 2HMPA 1W97L 5AR0A 5TKWA 3B8AX 1M90O 3VEZA 1BA0A 3P39A 5JLHA 4PKGA 5AQKA 1LCUA 2IVPA 4K41A 3VGMA 2QWRA 2E2PA 4IOCL 3FZFA 3M6GA 4NB4A 1EO1A 3O8MA 3ZEUA 1DKGD 4FWSA 4MO4A 5TKYA 1V4SA 1X9JA 3NVMA 1MWMA 3R3LA 4FWPA 4BR5A 3HM8A 5AQGA 2P9KA 4A5BA 4QS9A 1YF5L 2P9NA 3A5MC 4BR0A 4FWOA 1WOQA 4YDUA 5AZJA 5CHIA 1VQ6N 2P9UA 3CCEN 1EQYA 1QQNA 3CQYA 3DXKB 3GG4A 4H03B 1BU6O 1RDWX 4IOXA 4WFAL 3AY9A 3CF5L 4BRDA 3EN9A 2KLAA 3J8AA 4BRPA 4IXCA 5JVGL 1S3XA 3VF2A 2IIRA 3C6HA 3QDKA 4MDBA 5KPTA 1YUWA 2NRTA 1KAYA 2P9IA 5AQIA 4ISGA 2ZF5O 3QICA 5AQTA 4BRMA 4JNEA 3NMUA 1VQMN 1VQON 2GX9A 1SS6A 2NRRA 1W2BM 3H3NO 3E66A 5F2RA 4BC5A 3CXCM 2NRZA 1NGFA 4BRQA 1E4FT 1M1KO 2YCHA 3LM9A 4M63C 2W40A 3A5OC 5AQNA 3WQUA 3LDQA 2P9UB 3H3OB 4BVOA 4BROA 2VGMA 4WQ5C 2CGKA 4JKEA 4YOUA 3SBTA 4CZHA 1Z05A 5GADP 2DPNA 2F7TA 3IFRA 4HTLA 1MWKA 1TUYA 5BRDA 2RE2A 1SAZA 4BRFA 4BY9C 1GLEG 1ESVA 2Q97A 3CERA 1JCEA 2FF3B 2P9LB 3ZYYX 3I56N 2GELA 3R8EA 1K73O 4BE7B 5HOOA 3KHYA 3ZETB 2FSKA 4FSVA 2ASMA 2FSJA 1KAXA 2GWKA 4QS7A 2QW9A 3EKUA 3O9SA 1RGIA 3N4QA 5C12A 2V51B 3A0IX 2WBNA 5ADXA 1VQ7N 2I7PA 4OO1J 3WUHA 1WUAA 5BPMA 5H1SQ 1S22A 4BRCA 3T69A 3U9ZA 3VEOA 2YJEA 4MLHA 2QM1A 1NGCA 5FPMA 2CGJA 3TTDA 5AQRA 5AQMA 3DAWA 2E2OA 4HWIA 4BR9A 3CMAN 3DWLA 3AAPA 2GUPA 2HF4A 3OBWA 5KQDA 2HSTA 3VEWA 1QVFM 5AQLA 5GIOA 1VQPN 5AFUH 1HX1A 3IUCA 4BGAA 3Q7BA 4EHTA 1KAZA 4FWKA 3A5NC 3QMLA 4XJXA 2QWMA 4BRNA 4BREA 3MN9A 5EX5A 3RSEB 3CJ7A 3O9RA 2QWLA 3M1FA 3GE1A 2V7YA 4H0OA 4YOVA 3PIPL 3MWTA 4BECA 3VERA 4ILHA 2GEMA 3ZX2A 5HL7L 2UYTA 4BQZA 3K9JA 1J6ZA 4H0PA 4A61A 3G71N 3MCAB 2D0PA 4M7XA 5AQXA 3WXMB 4DCHA 2VCPA 2Q0UA 2ZGYA 3OBYA 4PHTX 3VGKA 4WFNL 1C0GA 4FWNA 1ZXOA 4YDUC 2ITMA 3KK7A 4F9OA 5JICA 1NJIO 4BEBA 4MLEA 3D2FA 3LL3A 3LDPA 3QBXA 2P9NB 4IOAL 4KH4A 5F1XA 5C15A 2QWQA 4BRHA 2D4WA 3TSUA 1C0FA 2E2NA 4FWQA 3O1WA 2E1YA 5LY3A 4A5AA 1H1VA 2C1IA 2EWSA 3E1YA 3LDOA 1V4TA 2YJFA 4CBXA 5M1NA 2D1KA 2QWNA 3NVKA 3CCUN 4JKFA 2QWOA 5BN8A 2AP1A 2PFUA 3H1VX 3BEXA 2CH5A 3VESA 1IJJA 1NGGA 4KBOA 2JWLA 1U2VA 1GLDG 3HBTA 4GNIA 4IO9L 3MDQA 5EOYA 1R59O 4O8KA 4MO5A 4LC9B 4R79A 3MX2A 4XH5A 4E1JA 3PIOL 5BREA 3PLAA 5KPZA 3DXMA 4BC4A 3O9TA 3KWIA 4AM7A 2ZWHA 2Q2RA 2ASPA 2ZJQL 4FL9A 1VQLN 3EKSA 3E9PA 3SJHA 5FPDA 5LJWA 3Q7CA 1XUPO 4BR7A 4YOYA 2CGLA 3VPZA 4YORA 5E26A 5CR4A 4PKHA 1NMDA 3MK6A 1S72N 2F9TA 2HBJA 3C0BA 1KD1O 2BH1A 1Z6RA 3O9UA 3VENA 4ILGB 3GOIA 3IDHA 3D2FB 1BA1A 2P9SB 3GBTA 2W41A 1LOTB 1YAGA 4GV9A 3P38A 5GIPA 2E1ZA 4BG8A 1QQMA 3J7ZO 4CBUA 1Q81O 5C10A 4RWTA 5JVHL 3BF1A 2A42A 3I33A 5JMVA 2OTLN 3MN7A 1K8KA 3CD6N 3DXKA 3GL1A 1Q86O 3F2KA 2NRHA 2WUSA 5CE3A 2YI1A 4ISEA 4DB3A 4WQ5A 4B9QA 3O80A 4AF1A 4DHYA 2P9IB 4GVEA 3WXJA 1ATNA 3CC2N 3GDQA 1P8ZA 3S41A 5BPLA 3MMVA 4B1VA 1Q18A 3FR0A 4K42A 3CCVN 3E9OA 4IZ9A 1QQOA 3W0LA 2HF3A 2JWKA 3CJ1A 1E4GT 2FXUA 4O8UA 4WQ4A 4QS8A 3QBWA 1VQ4N 2YHYA 3HZ6A 2ASOA 3F5TA 4JKAA 3O1BA 5DM6L 3CCRN 1KXPA 4JKBA 4A2BA 3WXLA 3WXKA 3P4IA 3AGKA 4U7BA 4L3QA 4IEEA 5ADXH 5AZJB 4CZLA 1YITN 2GWJA 1G99A 3EL2A 3JXUA 3G25A 1JCFA 1ATSA 4JK9A 1YXQA 2ZGZA 3M3ZA 4IFEA 3L6QA 4RTFD 4EIAA 1JJ2M 4GV6A 3VEXA 4CZEA 3H46O 3BF3A 3BP8A 1NGBA 3LDLA 5GINA 4BRLA 3ULEA 2A6AA 3HTVA 3HI0A 2NRWA 3FFKB 1QVGM 2A41A 3WXIA 3FZLA 1Y64A 3TPQA 1NLVA 3C7NB 4M7YA 5AZIA 3O08A 4WF9L 1NBWA 5AQQA 4WQ4C 4JKDA 4JHDB 3CCJN 2NZTA 3ATUA 5M1KA 2RHKA 1RDUA 3R1XA 4BG9A 4H5WA 4BRAA 3VOVA 1T44A 1JCGA 5EXWA 3O5BA 5M1PA 5AQWA 2NRVA 3OHRA 1ZBSA 3D7EO 3MWPA 3VF6A 3UKRA 3OA9A 3QFPA 3G6EN 2Q31A 4H0TB 4JAXA 1GLFO 3CC4N 1K8AO 3FZKA 2PBDA 3KVGA 3A5LC 5C2FA 2E20A 4H0XB 4JK8A 2YX6A 3ZETA 3U8XA 2FSNA 3AGRA 2PAVA 5GAHP 2P9PA 4Y0WA 2H3GX 2QTDA 1HKBA 4FWMA 4FPBA 3OW2M 2NLXA 3C65A 4B1XB 2CH6A 5AQJA 3MN5A 1YJ9N 1BG3A 3LM2A 3U4LA 5GAGP 4IO8A 3CI5A 5EVZA 4DQ8A 1NGDA 5AQFA 2C1GA 3LDNA 4U67L 3O9QA 3DLLL 2BTFA 4FOIA 1P90A 4JN4A 1O13A 4IJAA 4KH6A 2YHXA 1YI2N 3E9LA 5BN9A 3JS6A 3SMPA 2GTDA 5ELZA 2QWPA 3ENBA 3A8YA 5M1OA 3SMSA 4DKWA 4H5RA 1N8RO 3EZWA 3QFUA 3K9KA 1GLJO 4CZJA 1T6CA 2OTJN 2E8AA 1BDGA 1U6ZA 2A5XA 4KH5A 3N4PA 4H0VB 4ISFA 4RCHA 5FPEA 3HSCA 3UKUB 5BPNA 3HOTA 3UB5A 3VMFB 1T6DA 5BRHA 1YJWN 3EE8A 1KC8O 4JKGA 4BC3A 1Q82O 1NGJA 5JLFA 3HOSA 2KKZA 3CJCA 2D0OA 2NNWA 1TYQB 2W00A 4OPAA 4JD2A 3QB0A 1BO5O 4FWLA 3VTIA 2P9LA 3CIPA 3CJ9A 4K25A 1DEJA 4O5FA 4GY2B 4A59A 3AAQA 2I7NA 1XC3A 1GLAG 4JKHA 5AQOA 1X3MA 1BOTO 4CI6A 1K9MO 3TTFA 4ILJA 2YHWA 5AQPA 4A62A 1VQ5N 3O6WA 2Q36A 3KWGA 5LJVA 3TU5A 3H1QA 1YIJN 2J4RA 1ATRA 5AQSA 3CPEA 3I8BA 3R9PA 3ZX0A 3SLCA 2A3ZA 3ULEB 4MDAA 4BC2A 5MLCQ 4EAHD 4NLCA 5AQYA 3CCMN 3HRGA 1NM1A 3H6EA 4EHUA 4C1NI 3MX5A 3VF4A 3D2EA 3CJBA 3MCPA 3EO3A 4B1YB 4BR2A 3CCLN 2V7ZA 2FF6A 5F0XA 4CJ7A 2V52B 2AA4A 3FZHA 3CMEN 4BRIA 1T3VA 1QHAA 3BUZB 1VQ8N 2OANA 5E84A 3W3DA 1OVYA 4C23A 4K43A 4JKCA 3CC7N 3F9MA 3ID6A 4BRKA 4FO0A 1HLUA 3O4WA 4I6MA 3ZEUB 2HBKA 4YOTA 4NLBA 3UKRB 4WCEL 3WQTA 2F9WA 3L4IA 4EFHA 4PL7A 2P9SA 1NGAA 2VYPA 3C7NA 1QZ6A 2QI2A 3EE9A 2IVOA 4BVPA 3C6AA 3U9DA 5AFUA 4IDHA 2ZJPL 2KHOA 4BR4A 3ID8A 2HBMA 4FWRA 5BRFA 1K8KB 3H45C 3VETA 3D6RA 4WYBA 4FOEA 4H5VA 4AM6A 3CETA 3UE5A 4CZIA 4IWVA 4C1NK 5DM7L 1TYQA 4H0YB 3CJAA 1NWKA 4IJNA 2E88A 1IG8A 3MN6A 4B1ZA 5KQ8A 4G9ZA 4JK7A 1GLCG 3ATVA 3I55N 2ZJRL 2QA4N 2VWBA 3CCQN 4JHDA 1VAZA 4CZGA 5EY4A 2WFBA 3SBGA 3SAHA 5FPNA 4B1WB 4CZKA 1VQ9N 2IVNA 4H5TA 4XEIA 3M5RA 5AQUA 3AARA 5BR9A 1XQSC 3CCSN 3ENOA 1MA9B 4BGBA 2NRXA 5M1FA 3KZBA 4OPHA 2A40A 4FPAA 3UKUA 2BUPA 3ZX3A 3SAFA 2Q1NA 3FZMA 1BWFO 4NO7A 5C0YA 1YHQN 3WEEB 5I9EB 4PKIA 4GV3A 1HKCA 3D2EB 3WEEA 4H5NA 1ZC6A 1DGKN 2HOEA 4JD2B 5AQVA 1HKGA 1KQSM 4I6MB 4PL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z94 A;  4BQL A;  3R6M A;  1CZA N;  4B1U B;  3CHW A;  2E2Q A;  4CD3 A;  4CZM A;  4BRG A;  5AZI B;  1U2V B;  5AQH A;  3SK3 A;  1NGI A;  2P9P B;  1SZ2 A;  1OKJ A;  1D4X A;  4CD1 A;  3DXM B;  1YVN A;  3DJC A;  2Q0R A;  5AQZ A;  4XH1 A;  1NGH A;  2QXL A;  3VEV A;  1SQK A;  3VGL A;  3L0Q A;  4J8F A;  1QZ5 A;  1BUP A;  1NGE A;  4CZF A;  1MDU B;  1RFQ A;  1GLB G;  1HUX A;  1GLL O;  3VEY A;  3FLC O;  1X3N A;  3WT0 A;  4CBW A;  2FLO A;  3CQX A;  3FE1 A;  3FGU A;  2P9K B;  4A2A A;  5B8H A;  4XH4 A;  3IMX A;  1HJO A;  1HPM A;  5KPR A;  3ENH A;  3RSE A;  1TUU A;  2HMP A;  5AR0 A;  3B8A X;  3VEZ A;  1BA0 A;  5JLH A;  4PKG A;  5AQK A;  1LCU A;  2IVP A;  4K41 A;  3VGM A;  2QWR A;  2E2P A;  3FZF A;  3M6G A;  4NB4 A;  3O8M A;  3ZEU A;  1DKG D;  4FWS A;  4MO4 A;  5TKY A;  1V4S A;  1X9J A;  4FWP A;  1MWM A;  4BR5 A;  3HM8 A;  5AQG A;  2P9K A;  4QS9 A;  2P9N A;  3A5M C;  4BR0 A;  4FWO A;  1WOQ A;  4YDU A;  5AZJ A;  2P9U A;  1EQY A;  1QQN A;  3CQY A;  3DXK B;  3GG4 A;  4H03 B;  1BU6 O;  1RDW X;  3AY9 A;  4BRD A;  3EN9 A;  3J8A A;  4BRP A;  4IXC A;  1S3X A;  3VF2 A;  2IIR A;  3QDK A;  5KPT A;  1YUW A;  2P9I A;  1KAY A;  5AQI A;  4ISG A;  2ZF5 O;  3QIC A;  5AQT A;  4BRM A;  4JNE A;  3H3N O;  5F2R A;  4BC5 A;  1NGF A;  4BRQ A;  1E4F T;  2YCH A;  3LM9 A;  4M63 C;  2W40 A;  3A5O C;  5AQN A;  3WQU A;  3LDQ A;  2P9U B;  3H3O B;  4BVO A;  4BRO A;  4WQ5 C;  2CGK A;  4CZH A;  1Z05 A;  2DPN A;  4HTL A;  3IFR A;  5BRD A;  1MWK A;  1TUY A;  1SAZ A;  4BRF A;  1GLE G;  1ESV A;  2Q97 A;  3CER A;  1JCE A;  2FF3 B;  2P9L B;  2GEL A;  3R8E A;  3KHY A;  3ZET B;  2FSK A;  4FSV A;  2ASM A;  2FSJ A;  1KAX A;  2GWK A;  4QS7 A;  2QW9 A;  3EKU A;  1RGI A;  2V51 B;  3A0I X;  5ADX A;  2I7P A;  3WUH A;  1WUA A;  5BPM A;  1S22 A;  4BRC A;  3U9Z A;  3VEO A;  2YJE A;  4MLH A;  2QM1 A;  1NGC A;  5FPM A;  2CGJ A;  5AQR A;  5AQM A;  3DAW A;  2E2O A;  4HWI A;  4BR9 A;  3DWL A;  3AAP A;  2GUP A;  2HF4 A;  5KQD A;  3VEW A;  5AQL A;  5AFU H;  1HX1 A;  3IUC A;  4BGA A;  4EHT A;  1KAZ A;  4FWK A;  3A5N C;  3QML A;  2QWM A;  4BRN A;  4BRE A;  3MN9 A;  5EX5 A;  3RSE B;  3CJ7 A;  2QWL A;  3M1F A;  3GE1 A;  2V7Y A;  4H0O A;  3VER A;  2GEM A;  3ZX2 A;  2UYT A;  4BQZ A;  1J6Z A;  4H0P A;  4A61 A;  2D0P A;  4M7X A;  5AQX A;  4DCH A;  2VCP A;  2Q0U A;  2ZGY A;  3VGK A;  1C0G A;  4FWN A;  1ZXO A;  4YDU C;  2ITM A;  4F9O A;  5JIC A;  4MLE A;  3D2F A;  3LL3 A;  3LDP A;  3QBX A;  2P9N B;  5F1X A;  2QWQ A;  4BRH A;  2D4W A;  1C0F A;  2E2N A;  4FWQ A;  3O1W A;  2E1Y A;  5LY3 A;  1H1V A;  2EWS A;  3LDO A;  1V4T A;  2YJF A;  4CBX A;  2D1K A;  2QWN A;  2QWO A;  5BN8 A;  2AP1 A;  3H1V X;  3BEX A;  2CH5 A;  3VES A;  1IJJ A;  1NGG A;  4KBO A;  1U2V A;  1GLD G;  3HBT A;  4GNI A;  3MDQ A;  5EOY A;  1R59 O;  4O8K A;  4MO5 A;  4LC9 B;  4E1J A;  4XH5 A;  5BRE A;  5KPZ A;  3DXM A;  4BC4 A;  4AM7 A;  2ZWH A;  2Q2R A;  2ASP A;  4FL9 A;  3EKS A;  3SJH A;  5FPD A;  5LJW A;  1XUP O;  4BR7 A;  2CGL A;  3VPZ A;  5E26 A;  4PKH A;  1NMD A;  3MK6 A;  2F9T A;  3C0B A;  1Z6R A;  3VEN A;  3GOI A;  3IDH A;  3D2F B;  1BA1 A;  2P9S B;  3GBT A;  2W41 A;  1LOT B;  1YAG A;  2E1Z A;  4BG8 A;  1QQM A;  4CBU A;  4RWT A;  3BF1 A;  2A42 A;  3I33 A;  5JMV A;  3MN7 A;  1K8K A;  3DXK A;  3GL1 A;  2NRH A;  2WUS A;  5CE3 A;  2YI1 A;  4ISE A;  4DB3 A;  4WQ5 A;  4B9Q A;  3O80 A;  4DHY A;  2P9I B;  3WXJ A;  1ATN A;  3GDQ A;  1P8Z A;  3S41 A;  5BPL A;  3MMV A;  4B1V A;  1Q18 A;  3FR0 A;  4K42 A;  4IZ9 A;  1QQO A;  3W0L A;  2HF3 A;  3CJ1 A;  1E4G T;  2FXU A;  4WQ4 A;  4QS8 A;  3QBW A;  2YHY A;  3HZ6 A;  2ASO A;  3O1B A;  1KXP A;  4A2B A;  3WXL A;  3WXK A;  3P4I A;  4L3Q A;  5ADX H;  5AZJ B;  4CZL A;  2GWJ A;  1G99 A;  3EL2 A;  3JXU A;  3G25 A;  1JCF A;  1ATS A;  1YXQ A;  2ZGZ A;  3M3Z A;  3L6Q A;  4RTF D;  4EIA A;  3VEX A;  4CZE A;  3H46 O;  3BF3 A;  3BP8 A;  1NGB A;  3LDL A;  4BRL A;  3ULE A;  2A6A A;  3HTV A;  3HI0 A;  3FFK B;  2A41 A;  3WXI A;  3FZL A;  1Y64 A;  3TPQ A;  1NLV A;  3C7N B;  4M7Y A;  5AZI A;  3O08 A;  1NBW A;  5AQQ A;  4WQ4 C;  4JHD B;  2NZT A;  3ATU A;  4BG9 A;  4H5W A;  4BRA A;  3VOV A;  1T44 A;  1JCG A;  5EXW A;  3O5B A;  5AQW A;  3OHR A;  1ZBS A;  3D7E O;  3VF6 A;  3UKR A;  3QFP A;  2Q31 A;  4H0T B;  4JAX A;  1GLF O;  3FZK A;  2PBD A;  3KVG A;  3A5L C;  2E20 A;  4H0X B;  3ZET A;  3U8X A;  2FSN A;  2PAV A;  2P9P A;  4Y0W A;  2H3G X;  1HKB A;  4FWM A;  4FPB A;  2NLX A;  4B1X B;  2CH6 A;  5AQJ A;  3MN5 A;  1BG3 A;  3LM2 A;  3U4L A;  4IO8 A;  3CI5 A;  5EVZ A;  4DQ8 A;  1NGD A;  5AQF A;  3LDN A;  2BTF A;  4FOI A;  4JN4 A;  4IJA A;  2YHX A;  5BN9 A;  3JS6 A;  3SMP A;  2GTD A;  5ELZ A;  2QWP A;  3A8Y A;  3SMS A;  4H5R A;  3EZW A;  3QFU A;  4CZJ A;  1GLJ O;  1T6C A;  2E8A A;  1BDG A;  1U6Z A;  2A5X A;  4H0V B;  4ISF A;  4RCH A;  5FPE A;  3HSC A;  3UKU B;  5BPN A;  3UB5 A;  5BRH A;  1T6D A;  4BC3 A;  1NGJ A;  5JLF A;  3CJC A;  2D0O A;  1TYQ B;  4JD2 A;  3QB0 A;  1BO5 O;  4FWL A;  2P9L A;  3CIP A;  3CJ9 A;  4K25 A;  1DEJ A;  4O5F A;  4GY2 B;  3AAQ A;  2I7N A;  1XC3 A;  1GLA G;  5AQO A;  1X3M A;  1BOT O;  4CI6 A;  5AQP A;  2YHW A;  4A62 A;  3O6W A;  2Q36 A;  5LJV A;  3TU5 A;  3H1Q A;  2J4R A;  1ATR A;  5AQS A;  3I8B A;  3R9P A;  3ZX0 A;  3SLC A;  2A3Z A;  3ULE B;  4BC2 A;  4EAH D;  5AQY A;  1NM1 A;  3H6E A;  4EHU A;  3VF4 A;  3D2E A;  3CJB A;  3MCP A;  3EO3 A;  4B1Y B;  4BR2 A;  2V7Z A;  2FF6 A;  5F0X A;  4CJ7 A;  2V52 B;  2AA4 A;  3FZH A;  4BRI A;  1QHA A;  3BUZ B;  2OAN A;  5E84 A;  3W3D A;  4C23 A;  4K43 A;  3F9M A;  4BRK A;  4FO0 A;  1HLU A;  3O4W A;  4I6M A;  3ZEU B;  3UKR B;  3WQT A;  2F9W A;  3L4I A;  4EFH A;  4PL7 A;  2P9S A;  1NGA A;  2VYP A;  3C7N A;  1QZ6 A;  2IVO A;  4BVP A;  3U9D A;  5AFU A;  2KHO A;  4BR4 A;  3ID8 A;  4FWR A;  5BRF A;  1K8K B;  3H45 C;  3VET A;  4FOE A;  4WYB A;  4H5V A;  4AM6 A;  3CET A;  3UE5 A;  4CZI A;  4IWV A;  1TYQ A;  4H0Y B;  3CJA A;  1NWK A;  4IJN A;  2E88 A;  1IG8 A;  3MN6 A;  4B1Z A;  5KQ8 A;  1GLC G;  3ATV A;  2VWB A;  4JHD A;  4CZG A;  5EY4 A;  5FPN A;  4B1W B;  4CZK A;  2IVN A;  4H5T A;  4XEI A;  5BR9 A;  5AQU A;  3AAR A;  1XQS C;  3ENO A;  1MA9 B;  4BGB A;  3KZB A;  2A40 A;  4FPA A;  3UKU A;  2BUP A;  3ZX3 A;  2Q1N A;  3FZM A;  1BWF O;  4NO7 A;  3WEE B;  5I9E B;  4PKI A;  1HKC A;  3D2E B;  3WEE A;  4H5N A;  1ZC6 A;  1DGK N;  2HOE A;  4JD2 B;  5AQV A;  1HKG A;  4I6M B;  4PL8 A; 
#chains in the Genus database with same CATH topology
 4Z94 A;  4LF4 K;  3CHW A;  1BIZ A;  1U2V B;  4CGH A;  5IWA K;  1OKJ A;  1D4X A;  2GBZ A;  4FZY A;  3D0P A;  1YJN N;  5DMR A;  3DJC A;  4OJR A;  5I42 A;  1EWR A;  3G4S N;  3V4I A;  5HRP A;  4CGG A;  1SQK A;  2HBL A;  1QZ5 A;  1C0T A;  1NKB A;  4A57 A;  4CZF A;  4YOW A;  5C2D A;  2VGN A;  2YHA A;  1MDU B;  1RFQ A;  4DTS A;  3P31 A;  4DSI A;  3FLC O;  4YOX A;  3CQX A;  4KKO A;  3TTC A;  2UXC K;  5K14 A;  1D9F A;  1HRH A;  4M42 A;  3LAN A;  5KRS A;  4CHZ A;  3RVC A;  1F21 A;  3O3F A;  4B9L A;  1NOZ A;  1S6P A;  3DI6 A;  2HMP A;  4CFC A;  3VEZ A;  4PKG A;  1LCU A;  1BCO A;  4IOC L;  4Z4E A;  4NB4 A;  3O8M A;  2ATQ A;  3QEI A;  3AO5 A;  1RDB A;  4JI8 K;  3HM8 A;  2P9K A;  2D0B A;  2HHV A;  4ELU A;  2DFF A;  2P9N A;  3VQ5 A;  5KRT A;  3RMD A;  3OS1 A;  3NE6 A;  2HHI A;  1ZBH A;  3BGR A;  5CHI A;  2B4J A;  1VQ6 N;  3PUF A;  3GG4 A;  5CYM A;  4IOX A;  1RDW X;  3AY9 A;  3BDP A;  4B3R K;  4LF8 K;  4FJN A;  4IXC A;  3KK3 A;  3QDK A;  1T7P A;  3SUN A;  3AO3 A;  4DQQ A;  1LW2 A;  1ZBF A;  5AQT A;  3THW B;  4BRM A;  1G15 A;  4GMJ B;  2NRR A;  3TAM A;  3ZT3 A;  4LF5 K;  4BC5 A;  2NRZ A;  2BGG A;  1KFD A;  3LDQ A;  3H3O B;  2VGM A;  4WQ5 C;  3SZ2 A;  4FJ5 A;  2DPN A;  4HTL A;  4DQI A;  2RE2 A;  4M41 A;  1SAZ A;  1GLE G;  3ALY A;  1JCE A;  2P9L B;  3NCI A;  4GKJ K;  3ASM A;  4B9M A;  2B6A A;  5HOO A;  4XIU A;  4KB1 A;  4AHS A;  5LMU K;  2QW9 A;  2HMI A;  4ZTJ A;  1RGI A;  5C12 A;  1IH7 A;  1KTQ A;  3I8D A;  3A0I X;  3SPY A;  1VHX A;  3SJJ A;  1KVA A;  3RTV A;  2WBN A;  1VQ7 N;  1J53 A;  3SPZ A;  4OO1 J;  3WUH A;  1WUA A;  4KO0 A;  4FM2 A;  5FPM A;  3TTD A;  5CYQ A;  5AQM A;  3DAW A;  2E2O A;  4HWI A;  4R5P A;  4FLY A;  2HF4 A;  3AO4 A;  2ZD1 A;  3VEW A;  4YY3 K;  1CXQ A;  3IUC A;  4FLX A;  2XY5 A;  4CJW A;  1IBM K;  3QML A;  2QWM A;  4BRN A;  3ZSW A;  4BRE A;  3S3M A;  1HNI A;  5J1E A;  2QKK A;  3GE1 A;  2V7Y A;  4H0O A;  3PIP L;  3SCX A;  4ILH A;  2GEM A;  4H0P A;  4A61 A;  2D0P A;  4M7X A;  5C24 A;  2ZGY A;  2X78 A;  4FM0 A;  1I3A A;  4YDU C;  2ITM A;  4BEB A;  3LL3 A;  3QBX A;  2YV0 X;  4W5O A;  3TAE A;  4KH4 A;  4DU4 A;  1NNE A;  3L2Q A;  4DR2 K;  4IDK A;  4FWQ A;  3P1G A;  1RNH A;  2C1I A;  3E1Y A;  3LDO A;  5M1N A;  2YJF A;  4DFK A;  2AJQ A;  2QWN A;  2HB5 A;  2WOM A;  3CCU N;  4JKF A;  4Z4C A;  2IS3 A;  2QWO A;  3THX A;  2CH5 A;  4FLU A;  3DLH A;  2JWL A;  1GLD G;  4JI1 K;  4E1J A;  4XH5 A;  3S9H A;  3A2F A;  3AVI A;  1OH6 A;  4F3O A;  2JLE A;  3EKS A;  2G8U A;  3E9P A;  2G8F A;  5FPD A;  4CW7 B;  4YOY A;  2D0A A;  3DLB A;  1HMV A;  2BE2 A;  4O4G A;  3HVT A;  3O9U A;  4CCH A;  4DTX A;  1LOT B;  4C8O A;  3P38 A;  5GIP A;  4E7J A;  1UAX A;  1LWE A;  2E1Z A;  4BG8 A;  3BF1 A;  5JMV A;  3MXM A;  3MN7 A;  3DXK A;  2BAN A;  5CE3 A;  4ISE A;  4B9Q A;  4EZ6 A;  2YKN A;  2P9I B;  1DTQ A;  3PSI A;  5I3U A;  2G8V A;  4IG3 A;  1Q18 A;  1T8E A;  4KHW A;  4CF1 A;  4OKJ A;  4QS8 A;  4DSE A;  3HZ6 A;  2ASO A;  4JKA A;  4E7K A;  2G8K A;  5DM6 L;  4KV8 A;  1BCM A;  1CZ9 A;  3DOL A;  4KHQ A;  4CHO A;  5LMN K;  3WXL A;  4IEE A;  1JLF A;  5AZJ B;  1XNR K;  4JK9 A;  2ZGZ A;  2B5J A;  1TK5 A;  1JJ2 M;  3AVK A;  3H46 O;  3BF3 A;  3BP8 A;  4BRL A;  3NF8 A;  3BZC A;  1IV0 A;  3C6U A;  3HTV A;  4RW7 A;  2A41 A;  3WXI A;  1NLV A;  3PSF A;  4JKD A;  3CCJ N;  4BDZ A;  4FJ8 A;  3R1X A;  1BGX T;  1JLB A;  4BRA A;  1TKZ A;  5EXW A;  4PWD A;  4FZZ A;  1SKS A;  1XHX A;  5HBM A;  1VSF A;  3QFP A;  2Q31 A;  4H0T B;  3NF7 A;  4DG1 A;  4KPY A;  4H0X B;  4JK8 A;  4CJU A;  3J80 O;  1RT6 A;  2FSN A;  5GAH P;  4CEQ A;  4PUO A;  1Q9X A;  3OYK A;  3OW2 M;  4DQS A;  2NLX A;  1TKT A;  2UXB K;  5AQJ A;  2UUC K;  1BG3 A;  3LM2 A;  4IO8 A;  4DQ8 A;  3KKR A;  5KTQ A;  5AQF A;  4U67 L;  3V9Z A;  1O13 A;  4DV1 K;  1SV5 A;  4IJA A;  2HHS A;  1YT3 A;  4IBN A;  1JLE A;  3JS6 A;  4DKW A;  3VQ8 A;  4M3T A;  1WSG A;  1GLJ O;  1S1V A;  2A5X A;  4H0V B;  2UUA K;  3UKU B;  4F2R A;  4Y1D A;  2E6L A;  3UB5 A;  1YJW N;  1KC8 O;  4JI0 K;  3I0R A;  5HRR A;  4BE0 A;  3U6F A;  3CJC A;  2D0O A;  4DQP A;  5KI6 A;  3VTI A;  4FWL A;  3S3N A;  3CJ9 A;  1FJG K;  4K25 A;  3AVH A;  4LH4 A;  3RMA A;  4CI6 A;  1K9M O;  3TTF A;  3AA2 A;  1BHL A;  3VQQ A;  5C25 A;  5LJV A;  3J7A P;  5CZ2 A;  4FK2 A;  1YIJ N;  3DRR A;  1RDC A;  5AQS A;  5MLC Q;  3OYC A;  2WTU A;  1HYV A;  2Y1J A;  3LPU A;  4J2B A;  3H6E A;  3T1Y K;  3LWM A;  4H4M A;  3CJB A;  3MCP A;  3EO3 A;  2O4I A;  2FF6 A;  5F0X A;  2AA4 A;  4BRI A;  1NK6 A;  1JXB A;  3OJS A;  1VQ8 N;  5E84 A;  3W3D A;  3ZT1 A;  4LF7 K;  2O8C B;  4BRK A;  1HLU A;  2HBK A;  4YOT A;  3CFR A;  3F9K A;  2D0C A;  3C7N A;  3EE9 A;  4Y1C A;  2IVO A;  5AFU A;  4IDH A;  2ZJP L;  4TSX A;  3F73 A;  1FK9 A;  1K8K B;  3NHG A;  3VET A;  3I0S A;  1X9W A;  1YVU A;  3AA5 X;  4BDP A;  4AM6 A;  3CET A;  1NK0 A;  1TYQ A;  5D3G A;  3CJA A;  1SKR A;  2VWJ A;  2E88 A;  5KQ8 A;  3ATV A;  3NH1 A;  3I55 N;  3OYF A;  2ZJR L;  3KTQ A;  3VQ6 A;  4Z4F A;  1VQ9 N;  1HJR A;  2X6N A;  1QSY A;  1CLQ A;  3SAF A;  3ZSZ A;  1BWF O;  4PKI A;  2Z1H A;  4GV3 A;  1ASV A;  4Z4H A;  4YNQ A;  4O55 A;  3QET A;  1DGK N;  1KQS M;  4B3T K;  1JKH A;  4BQL A;  4B1U B;  2IDO A;  1QS4 A;  4CD3 A;  5AZI B;  3SK3 A;  1NJX A;  1NGI A;  2GV9 A;  1D9D A;  3VTH A;  1HQU A;  2KFZ A;  1TAU A;  1IBL K;  3T7Z A;  1YVN A;  2FBT A;  2Q0R A;  5AQZ A;  4XH1 A;  3IKM A;  2NUB A;  4IFY A;  4CK3 A;  4WFB L;  3AVM A;  3DLR A;  2ZE2 A;  1BUP A;  4OLB A;  4FK4 A;  3EEQ A;  1W9H A;  3TAB A;  2ETJ A;  1GLB G;  3HP6 A;  4DR1 K;  4HCC A;  5GAE P;  3CFP A;  3TWH A;  5J2M A;  5J2P A;  1BIU A;  2QEX N;  3WT0 A;  1VQN N;  1WSJ A;  3FGU A;  5B8H A;  3CM6 A;  1Q7Y O;  4DTN A;  5KPR A;  3ENH A;  3RSE A;  3TSQ A;  5AR0 A;  2X6S A;  4EZ9 A;  4K41 A;  1VSD A;  3VGM A;  2E2P A;  3FZF A;  4CEC A;  4FWS A;  4NXM K;  5TKY A;  2FBV A;  3R3L A;  1MWM A;  2YNH A;  3HL8 A;  4CGJ A;  4BR5 A;  3QEV A;  1WBD A;  3AVJ A;  1KLN A;  4BR0 A;  3OTO K;  4DUY K;  2Y1I A;  4DMN A;  1J54 A;  4WFA L;  3NGZ A;  4H03 B;  4C8M A;  2R7Y A;  1VSE A;  3EN9 A;  5FDL A;  4BRP A;  1S3X A;  4E72 A;  3THY B;  1S9G A;  2P9I A;  3K0S A;  3AVN A;  4FLV A;  3QIC A;  4LFA K;  4JNE A;  3NMU A;  3VQC A;  1VQO N;  2GX9 A;  3UIQ A;  3TAG A;  1W2B M;  3H3N O;  1IBK K;  3CXC M;  1NGF A;  4BRQ A;  3TAR A;  4CF8 A;  5AQN A;  4E89 A;  4KTQ A;  3SNN A;  4JKE A;  4CZH A;  1Z05 A;  3THV A;  4CJ3 A;  4BY9 C;  2FBY A;  4CEF A;  3ITH A;  3CER A;  1I39 A;  3PX0 A;  4ICL A;  2FF3 B;  3ZYY X;  4RW9 A;  1BQM A;  4FJ9 A;  2GEL A;  1K73 O;  2PYL A;  1B9D A;  3ZET B;  1REV A;  4FSV A;  1O1W A;  4NYN A;  4QS7 A;  3KLG A;  3EKU A;  3NGI A;  3O9S A;  2QXF A;  2OYQ A;  4CJR A;  4DV2 K;  3DRS A;  4DSF A;  4O0J A;  5ADX A;  3OYB A;  4NCG A;  4K8X A;  4FJJ A;  1S22 A;  4DFM A;  4J2A A;  1NKC A;  2CGJ A;  2OPR A;  5AQR A;  3OYD A;  4BR9 A;  3CMA N;  5KQD A;  2HST A;  1HYS A;  5AQL A;  1KSP A;  3AVA A;  3OYA A;  3QNN A;  3NF9 A;  3V1O A;  4BGA A;  4DV5 K;  4EHT A;  3KLF A;  1SKW A;  4XJX A;  4Z4G A;  2QWL A;  3M1F A;  4MFB A;  4YFU A;  4FYD A;  1JLG A;  5HL7 L;  3ZX2 A;  3K5N A;  5C42 A;  4BQZ A;  4UQG A;  4OKE A;  1J6Z A;  3G71 N;  3MCA B;  3WXM B;  3THW A;  2Q0U A;  4N41 A;  3VGK A;  4FWN A;  1N6Q A;  3ZT0 A;  4KHP K;  4F9O A;  3LDP A;  3V9U A;  3KD1 E;  1WB9 A;  1QSS A;  2QWQ A;  4BWM A;  4CIG A;  1NG9 A;  2E2N A;  1EXQ A;  3LAM A;  1A5W A;  1H1V A;  3NBP A;  1GOB A;  2EWS A;  3QNO A;  2VG5 A;  1V4T A;  2ITG A;  3MXJ A;  4E3S A;  2D1K A;  1L5U A;  3ZSQ A;  3NDK A;  4KTZ A;  1NJZ A;  2IAJ A;  4C8K A;  3OYJ A;  3QER A;  5BN8 A;  3HPO A;  4BDY A;  2VQE K;  3H1V X;  3VES A;  4DR4 K;  1NGG A;  3KIO A;  4KBO A;  3QEX A;  4GNI A;  1DLO A;  4Q0B A;  4LC9 B;  1B92 A;  4O44 A;  5KPZ A;  2IC3 A;  1I94 K;  3DXM A;  3O9T A;  4I9Q A;  4AM7 A;  3OYI A;  2ZWH A;  4B9N A;  1VRU A;  1VK0 A;  4FL9 A;  1VQL N;  1MU2 A;  4BR7 A;  3HJF A;  4YHH K;  1NMD A;  3MK6 A;  4PA1 A;  5HRO A;  2HBJ A;  3CYM A;  4CF2 A;  2O8E A;  3MEG A;  4ILG B;  1BA1 A;  3GBT A;  3OJU A;  1YAG A;  4GV9 A;  3LZI A;  5EU7 A;  3J7Z O;  4OLA A;  3GL1 A;  1Q86 O;  2BDP A;  4CGF A;  2NRH A;  4DHY A;  4WQ5 A;  3O80 A;  5CZ1 A;  4B08 A;  3CC2 N;  3GDQ A;  1HQE A;  3FR0 A;  4K42 A;  4IZ9 A;  1QQO A;  3W0L A;  2JWK A;  1E4G T;  2FXU A;  4FLT A;  4O8U A;  4WQ4 A;  3HPG A;  2YHY A;  3F5T A;  4RW6 A;  2KZM A;  2HW3 A;  4Q5V A;  4M3X A;  3AGK A;  5ADX H;  4CJE A;  4CZL A;  1YIT N;  3EL2 A;  1G99 A;  1JCF A;  4CJT A;  1ATS A;  1RTI A;  3HK2 A;  1HPZ A;  4CER A;  4GV6 A;  4DF4 A;  3VEX A;  1VRT A;  1NGB A;  3LDL A;  2A1R A;  3ULE A;  2XHB A;  4DV6 K;  3FFK B;  3FZL A;  1VSK A;  1NBW A;  4JHD B;  2NZT A;  4H4O A;  3VOV A;  4J2E A;  1VSM A;  5FRM A;  3O5B A;  4CFD A;  1EP4 A;  2VG6 A;  3JYT A;  1ZBS A;  4CEB A;  3D7E O;  1L3V A;  4JYA K;  4JAX A;  4DSL A;  3CC4 N;  1K8A O;  4QCL A;  3KVG A;  2YX6 A;  1WLJ A;  2DTU A;  2PAV A;  4B9T A;  4CJP A;  4DTR A;  4FPB A;  1N33 K;  3AVF A;  1ZBU A;  4DS4 A;  1ZBL A;  2CH6 A;  3M8Q A;  1FKO A;  4N56 A;  3S3O A;  2O8B B;  3MN5 A;  2DFH A;  5GAG P;  5EVZ A;  4GKK K;  1N36 K;  3LDN A;  4K8Z A;  5FRO A;  1WAJ A;  2IOC A;  4KH6 A;  2YHX A;  1X9S A;  5BN9 A;  2GTD A;  3VQ4 A;  2QWP A;  1C0M A;  3ENB A;  5T7B A;  4M45 A;  3EZW A;  3K9K A;  1NOY A;  4HUF A;  1A5V A;  2E8A A;  3B6P A;  4KH5 A;  3N4P A;  4ISF A;  3HSC A;  3HOT A;  1X1P A;  5BRH A;  3DLK A;  3RMC A;  1RT3 A;  2OZS A;  1U45 A;  4M3Y A;  1NGJ A;  1QSL A;  5JLF A;  3KKS A;  2NNW A;  1TYQ B;  3V9W A;  4FJG A;  3QB0 A;  3SQ1 A;  4Z4I A;  4B3O A;  4W5N A;  3AVL A;  4O5F A;  1XC3 A;  2JGU A;  4CEA A;  1NK5 A;  4ILJ A;  3OYL A;  2Q36 A;  3KWG A;  4OGC A;  3TU5 A;  1KVB A;  2J4R A;  1ATR A;  1U47 A;  4I2P A;  1X9M A;  3ULE B;  3HP9 A;  3CCM N;  3OS2 A;  3QEP A;  1NM1 A;  4G1Q A;  4EHU A;  1L3U A;  4CJL A;  4BAC A;  3CCL N;  2FC0 A;  4CJ7 A;  3FZH A;  1T3V A;  4CEZ A;  4C23 A;  4JKC A;  3F9M A;  3ID6 A;  5HP1 A;  4M3Z A;  3O4W A;  4WCE L;  3WQT A;  4PL7 A;  3L4I A;  4JRQ A;  1QZ6 A;  3IRX A;  4Z0U A;  4FW1 A;  3QLH A;  4CJV A;  2VQF K;  2KHO A;  1XC9 A;  2HBM A;  4FWR A;  5BRF A;  3MEE A;  3V1Q A;  4DR5 K;  1BL3 A;  4JI6 K;  3LP3 A;  3D6R A;  3QEW A;  4H5V A;  4H0Y B;  1NWK A;  4M3W A;  1IG8 A;  4B1Z A;  3K58 A;  3QIP A;  4DTJ A;  4JK7 A;  1GLC G;  1RBR A;  3JAM O;  2QA4 N;  2VWB A;  3CCQ N;  2QKB A;  2KFN A;  3SAH A;  1IKY A;  3HPH A;  4B1W B;  2IVN A;  4H5T A;  4X66 K;  5AQU A;  1XQS C;  1JXE A;  3AVC A;  5A2Q O;  3ENO A;  3BZK A;  3KZB A;  5E41 A;  1S1X A;  1T05 A;  2Q1N A;  1B9F A;  5C0Y A;  1LWC A;  3WEE B;  4KHS A;  4CGD A;  1KVC A;  3D2E B;  4LY7 A;  3OVN A;  2O4G A;  3SAG A;  3R6M A;  1CZA N;  3O4N A;  4IEI A;  1BI4 A;  4BRG A;  5AQH A;  3SQ2 A;  2ZM6 K;  4DR7 K;  4CD1 A;  2WC9 A;  4DV3 K;  2O8B A;  3VEV A;  1RT7 A;  3VGL A;  4CFA A;  1ILY A;  1NGE A;  3DMJ A;  2WON A;  1HUX A;  2RN2 A;  1GLL O;  5KGW A;  5M1Q A;  1U48 A;  4CJQ A;  3DLG A;  1LV5 A;  1A5X A;  4FVM A;  4XH4 A;  2E5L K;  1HPM A;  3RRG A;  4LD0 A;  2G8I A;  1TUU A;  4JKG B;  1W97 L;  3B8A X;  3WNF A;  4FK0 A;  2W6K A;  2IVP A;  4HCB A;  4AHU A;  2QWR A;  3M6G A;  4DR6 K;  2HHT A;  1EO1 A;  4OPK A;  3QO9 A;  3T3F A;  3SQ4 A;  1X9J A;  4FWP A;  4A5B A;  4ELV A;  1KFS A;  4RW8 A;  1R0A A;  2F8S A;  1YF5 L;  4CGI A;  2W6L A;  4FJX A;  4YDU A;  3DM2 A;  3LDS A;  2P9U A;  3CCE N;  1QQN A;  2LSN A;  5J2N A;  2Z1I A;  3VF2 A;  2IIR A;  3C6H A;  3T19 A;  4MDB A;  4FJI A;  1KAY A;  4ISG A;  1S9E A;  1TK0 A;  5FRN A;  4K0K K;  1S1U A;  2YNG A;  1VQM N;  2F4V K;  4GVM A;  4CJ5 A;  4FJ7 A;  3E66 A;  5F2R A;  1WNS A;  1BQN A;  1M1K O;  3LM9 A;  3WQU A;  5KGX A;  2P9U B;  4OX9 K;  2E6M A;  2CGK A;  5HRN A;  2W42 A;  3G10 A;  3SBT A;  4BE2 A;  5BRD A;  1TUY A;  1EX4 A;  3O4Q A;  1ESV A;  3VA0 A;  4JRP A;  1JL1 A;  1Z25 A;  3E01 A;  1NK7 A;  1OH7 A;  1TKX A;  3R8E A;  3TAQ A;  2FSJ A;  1KAX A;  4LSL A;  1RTD A;  4CJF A;  1RBT A;  1RDA A;  1FW6 A;  1QTM A;  2I7P A;  4IFV A;  3SI6 A;  5BPM A;  5H1S Q;  2OZM A;  4BRC A;  4DTU A;  3VEO A;  4MLH A;  2O8F A;  4AHC A;  2RKI A;  4CJK A;  3VN5 A;  4DR3 K;  4CF0 A;  3AAP A;  3KD5 E;  2GUP A;  3OBW A;  1U49 A;  4DV0 K;  2FBX A;  1C1C A;  5AFU H;  1HX1 A;  4J2D A;  4FWK A;  3A5N C;  4EP4 A;  5DK5 A;  1JLC A;  3MN9 A;  5EX5 A;  3WNE A;  4B8A B;  3O9R A;  1TKD A;  1RT5 A;  2O8F B;  4BEC A;  3KLH A;  4W5T A;  1CZB A;  3K9J A;  1HNZ K;  4ELT A;  3H08 A;  3KLE A;  3OBY A;  4WFN L;  3KK7 A;  4ID5 A;  1NJI O;  4MLE A;  4EP5 A;  3D2F A;  1RT2 A;  3V6D A;  3EY1 A;  4IOA L;  5F1X A;  5LL6 Z;  1C0F A;  2E1Y A;  5LY3 A;  1UA0 A;  4A5A A;  3L2R A;  1TL1 A;  4CBX A;  1NJY A;  3DYA A;  4PY5 A;  3NVK A;  3MAQ A;  2E4L A;  3SUP A;  2PYJ A;  1IO2 A;  1OVQ A;  2PFU A;  4CIF A;  3BEX A;  4F2S A;  1TL3 A;  4AH9 A;  4HUE A;  3HBT A;  2HND A;  3MDQ A;  3M8S A;  4O8K A;  4MO5 A;  4R79 A;  3V1R A;  4W5Q A;  1VSI A;  1WAF A;  5BRE A;  3PLA A;  2P5O A;  4LH5 A;  3PO4 A;  4BC4 A;  2Q2R A;  3RR8 A;  1KLM A;  3AVB A;  5LJW A;  4FJK A;  3Q7C A;  3VPZ A;  3TAF A;  4YOR A;  5CR4 A;  1WSH A;  4JI5 K;  1IKX A;  1S72 N;  3C0B A;  1KD1 O;  3VEN A;  3IDH A;  3ZT2 A;  3D2F B;  4FM1 A;  2P9S B;  2Z1G A;  4AHV A;  3L3V A;  3VQB A;  4CBU A;  4RWT A;  5JVH L;  2A42 A;  3I33 A;  4JLH A;  3MXI A;  5IT9 O;  2YI1 A;  4GVE A;  3WXJ A;  1ATN A;  5BPL A;  3MMV A;  3CCV N;  3L3U A;  3CJ1 A;  4IG0 A;  4CF9 A;  3CQ8 A;  4LFC K;  3QBW A;  1IKV A;  3O1B A;  2G8W A;  3CCR N;  1KXP A;  3LPT A;  3ZSV A;  4A2B A;  4DFP A;  3M8R A;  2OPQ A;  4C8L A;  4DTP A;  3WXK A;  3K5L A;  3P4I A;  1ASU A;  1QHT A;  4U7B A;  1ZYQ A;  1C0U A;  3AA4 A;  4BWJ A;  2GWJ A;  3JXU A;  4JI4 K;  3K5O A;  1WSI A;  1YXQ A;  1DTT A;  4AHT A;  4CFB A;  2OA8 A;  1YTA A;  3L6Q A;  4RTF D;  4EIA A;  4CZE A;  3SUQ A;  5GIN A;  4E1M A;  2A6A A;  3HI0 A;  2NRW A;  3TPQ A;  4CHN A;  4WF9 L;  3C7N B;  3O08 A;  4LSN A;  3KK1 A;  4WQ4 C;  3NGY A;  3ATU A;  5M1K A;  1T44 A;  1JCG A;  1J5O A;  2QK9 A;  2NRV A;  3VQ7 A;  3OHR A;  1JLA A;  3MWP A;  3VF6 A;  3G6E N;  1L3T A;  3VA3 A;  3B6O A;  3A5L C;  3ZET A;  3ULD A;  1RT4 A;  1U04 A;  3AGR A;  4Y0W A;  3ZSX A;  4CHQ A;  2QTD A;  1HKB A;  4FWM A;  1OH5 A;  1VSJ A;  3C65 A;  4JI7 K;  3AO2 A;  4B1X B;  3C6T A;  3ZLJ A;  3IG1 A;  4F4K A;  3CI5 A;  4B3M K;  2C1G A;  3O9Q A;  3DLL L;  2BTF A;  4FOI A;  4KHU A;  1P90 A;  4JN4 A;  4L8R B;  2VG7 A;  4KI4 A;  2O8C A;  4PL8 A;  3IAY A;  3A8Y A;  2YKM A;  3P5J A;  3SMS A;  4H5R A;  4CZJ A;  2OTJ N;  1U6Z A;  2PY5 A;  5FPE A;  3QIO A;  5BPN A;  1NMN A;  3OYE A;  4DTO A;  3EE8 A;  1Q82 O;  3T1H K;  4O5B A;  3HOS A;  4CK1 A;  4OPA A;  1RTJ A;  3PX4 A;  1BO5 O;  2UXD K;  2P9L A;  3CIP A;  2F96 A;  1DEJ A;  4GY2 B;  3AAQ A;  2G8H A;  1BOT O;  3C94 A;  1WN7 A;  5AQP A;  1S1T A;  2YHW A;  4A62 A;  2KTQ A;  1HNW K;  4FZX C;  3RWU A;  1RT1 A;  3R9P A;  4FJH A;  4BC2 A;  3BY5 A;  5AQY A;  3HRG A;  2HNZ A;  3MX5 A;  3VF4 A;  3ZCM A;  1RTH A;  3D2E A;  4DLG A;  2V52 B;  4H8K A;  1TVR A;  3OYM A;  4PQU A;  1K6Y A;  1OVY A;  4QOZ B;  4B9S A;  3CC7 N;  4M3U A;  3ZEU B;  5BR8 K;  2I5J A;  4OGE A;  3UKR B;  2F9W A;  2P9S A;  2QI2 A;  2F8T A;  4BVP A;  3C6A A;  3AV9 A;  3U9D A;  4BR4 A;  4DUZ K;  2A1S A;  3U3Y A;  3H45 C;  1JL2 A;  4DU1 A;  1Q8I A;  4KFB A;  3LAL A;  4FOE A;  3UE5 A;  4KRF A;  4IWV A;  5DM7 L;  4QAG A;  4DFJ A;  3CYG A;  4IJN A;  3AA3 A;  3MN6 A;  3FFI A;  4G9Z A;  4CZG A;  5EY4 A;  3LAK A;  2XRI A;  3RMB A;  1ZBI A;  3KJV A;  3ZSO A;  4XEI A;  3M5R A;  1XMQ K;  3AAR A;  1HNX K;  1LW0 A;  4BGB A;  5M1F A;  1YTU A;  4FPA A;  3UKU A;  2BUP A;  4X65 K;  3FZM A;  1HNV A;  5I9E B;  2UUB K;  1JLQ A;  3O3G A;  3WEE A;  4H5N A;  1ZC6 A;  4JD2 B;  2HOE A;  1HKG A;  4I6M B;  2E2Q A;  4CZM A;  4UY8 O;  1HYZ A;  1SUQ A;  4DV7 K;  2DY4 A;  1UOC A;  3SQ0 A;  2P9P B;  3L4Q A;  1SZ2 A;  1LAV A;  5HRS A;  3DXM B;  3TSP A;  1W7A A;  4JEP A;  1NGH A;  2QXL A;  1D8Y A;  2UU9 K;  1N34 K;  3L0Q A;  4J8F A;  1DT9 A;  1XI1 A;  2X74 A;  2IGI A;  4DV4 K;  2HVI A;  4RW4 A;  3L2U A;  5FLX O;  1XHZ A;  1HR0 K;  3VEY A;  4DQR A;  1XWL A;  1X3N A;  4CBW A;  2FLO A;  3FE1 A;  3CPW M;  2P9K B;  4A2A A;  3IMX A;  2OPP A;  1HJO A;  1Q9Y A;  1QE1 A;  3IS9 A;  1VQK N;  3OS0 A;  1N32 K;  3CG7 A;  3CM5 A;  4NCB A;  4FVU A;  1NK4 A;  1S1W A;  4DSJ A;  1M90 O;  5TKW A;  5SWM A;  3NAE A;  1VSH A;  5JLH A;  1BA0 A;  3P39 A;  3SV3 A;  4E7I A;  4DSK A;  1WSE A;  5AQK A;  5JS2 A;  4FXD A;  1DKG D;  4MO4 A;  2KZZ A;  4JV5 K;  1V4S A;  3NVM A;  2XY6 A;  3NH2 A;  2PZS A;  5AQG A;  3J81 O;  4HHT A;  1TV6 A;  3O3H A;  4QS9 A;  3PX6 A;  3A5M C;  4WE1 A;  4FWO A;  1WOQ A;  5AZJ A;  4ZTF A;  4AHR A;  1EQY A;  3CQY A;  3DXK B;  3CF5 L;  1BU6 O;  1BIS A;  4BRD A;  4CED A;  3LWL A;  2KLA A;  3J8A A;  5JVG L;  3QIN A;  5KPT A;  1YUW A;  2NRT A;  5AQI A;  3NF6 A;  2OCE A;  2ZF5 O;  2OPS A;  4CHY A;  1SS6 A;  4JI3 K;  2HHQ A;  3S5T A;  2RPI A;  1E4F T;  2YCH A;  4M63 C;  1UWB A;  2W40 A;  3A5O C;  1NK8 A;  3RRH A;  4BVO A;  3HYF A;  4BRO A;  4F3T A;  5GAD P;  4YOU A;  4I2Q A;  2F7T A;  3L2W A;  3IFR A;  1MWK A;  1RCH A;  3T1A A;  2HHW A;  4IKF A;  4BRF A;  1C6V A;  1RIL A;  3L2V A;  2Q97 A;  1UA1 A;  3I56 N;  4CE9 A;  3HO1 A;  4BE7 B;  5AJ3 K;  2P1J A;  3KHY A;  4ZHR A;  2FSK A;  1WBB A;  2ASM A;  4NCA A;  3KLI A;  2GWK A;  1RBU A;  3N4Q A;  1EKE A;  2V51 B;  3V9X A;  4GW6 A;  4CHP A;  3U3G A;  4DS5 A;  1XNQ K;  3T69 A;  3U9Z A;  2YJE A;  2Q3S A;  1E3M A;  2QM1 A;  4KRE A;  1NGC A;  3SV4 A;  3DWL A;  1GOC A;  3K5M A;  1QVF M;  5GIO A;  4FJL A;  1VQP N;  1ITG A;  4KTW A;  3Q7B A;  1KAZ A;  1TGO A;  4E19 A;  4FLZ A;  2O8E B;  3M8P A;  3RSE B;  3CJ7 A;  4YOV A;  3HT3 A;  3MWT A;  3VQP A;  2KW4 A;  3VER A;  2DFE A;  2UYT A;  4DCH A;  5AQX A;  4CVN E;  4NYF A;  2VCP A;  1J5E K;  3HXM A;  4X62 K;  4PHT X;  1C0G A;  1ZXO A;  5JS1 A;  1C1A A;  4B3S K;  4MQ3 A;  5JIC A;  1W0H A;  2P9N B;  2ZQB A;  4BE1 A;  1L3S A;  5C15 A;  4BRH A;  2D4W A;  3TSU A;  2P5G A;  3TAN A;  3LP1 A;  3O1W A;  4DLE A;  4C8N A;  4B9V A;  2YNI A;  2VWK A;  3OY9 A;  2HHU A;  3HVR A;  2AP1 A;  1NKE A;  1IJJ A;  4B8C A;  1U2V A;  4IO9 L;  5EOY A;  1R59 O;  3LP2 A;  4CEE A;  1C1B A;  3MX2 A;  3PIO L;  3K57 A;  1KRP A;  3ZT4 A;  3KWI A;  3AO1 A;  4CEO A;  4AIL C;  3THY A;  3ZSR A;  2ASP A;  4V19 S;  1NJW A;  2ZJQ L;  4AQY K;  3SJH A;  1XUP O;  2CGL A;  5E26 A;  3D45 A;  4PKH A;  4CK2 A;  3VQ9 A;  2F9T A;  1FKP A;  2BH1 A;  1IKW A;  1Z6R A;  3G0Z A;  3GOI A;  4JS5 A;  3MEC A;  2KQ2 A;  2W41 A;  1WSF A;  1S6Q A;  2EHG A;  1KCF A;  1QQM A;  3K2P A;  4N47 A;  1Q81 O;  5C10 A;  2OTL N;  1RBV A;  1K8K A;  3CD6 N;  3QES A;  4LF6 K;  3F2K A;  4JS4 A;  2WUS A;  4DB3 A;  2O8D B;  4AF1 A;  4DTM A;  1QQC A;  4O0I A;  3TAP A;  3LZJ A;  1SL1 A;  4FW2 A;  1P8Z A;  3S41 A;  4B1V A;  3E9O A;  3PV8 A;  2HF3 A;  3L8B A;  3J7Y P;  3AVG A;  1VQ4 N;  1XMO K;  4I7F A;  3OYH A;  4JKB A;  1LWF A;  4RG8 A;  4X64 K;  4L3Q A;  4LFB K;  3G25 A;  3PO5 A;  4B9U A;  1S5J A;  3M3Z A;  4IFE A;  3HST B;  4CJ4 A;  4ID1 A;  1U4B A;  2HHH K;  4E7L A;  2HHX A;  1ASW A;  4FJM A;  5HLF A;  4CJS A;  3VQE A;  1QVG M;  1Y64 A;  1BI4 B;  3VQA A;  4M7Y A;  5AZI A;  5AQQ A;  1T03 A;  2EX3 A;  1TK8 A;  2RHK A;  3WNG A;  1RDU A;  4BG9 A;  4H5W A;  5M1P A;  4HVJ A;  5AQW A;  4NXN K;  2YHB A;  3NH0 A;  2O8D A;  3UKR A;  3OA9 A;  1GLF O;  3FZK A;  5CY4 A;  2PBD A;  2Z1J A;  5C2F A;  2E20 A;  2HNY A;  3K59 A;  4KHN A;  3U8X A;  1N5Y A;  4M3R A;  2P9P A;  2H3G X;  3RR7 A;  3ZSY A;  4E0D A;  2XO7 A;  3NFA A;  4OKK A;  3CFO A;  3SUO A;  1YJ9 N;  1NK9 A;  3VQD A;  3U4L A;  1NGD A;  4N5S A;  4CIE A;  3KK2 A;  3EZ5 A;  1EET A;  4DF8 A;  5J2Q A;  4LF9 K;  3P83 D;  4CES A;  4KAZ A;  1YI2 N;  4DWI A;  3E9L A;  3SMP A;  1RBS A;  5M1O A;  1N8R O;  3QFU A;  1T6C A;  4FCY A;  1BDG A;  4RCH A;  1J9A A;  3MED A;  3VMF B;  1T6D A;  4E1N A;  3C95 A;  4DU3 A;  2HVH A;  4JKG A;  4BC3 A;  2KKZ A;  1GOA A;  2W00 A;  4JD2 A;  3WNH A;  2YNF A;  4A59 A;  2I7N A;  1SL0 A;  1GLA G;  4JKH A;  5AQO A;  1X3M A;  3OYN A;  4HUG A;  1VQ5 N;  3OYG A;  3O6W A;  2D5R A;  2XY8 A;  3H1Q A;  4KB0 A;  3CPE A;  3I8B A;  3ZX0 A;  1D5A A;  2A3Z A;  3SLC A;  4MDA A;  1SL2 A;  4EAH D;  4NLC A;  1IG9 A;  4I9L A;  3V9S A;  3DRP A;  4C1N I;  1Z26 A;  1Y97 A;  4B1Y B;  2V7Z A;  3HM9 A;  2XY7 A;  3CME N;  1QHA A;  3BUZ B;  3DOK A;  2OAN A;  4FLW A;  1OH8 A;  3DLE A;  4K43 A;  4KHY A;  1EWQ A;  4FO0 A;  4I6M A;  4NLB A;  4EFH A;  3ISN C;  1NGA A;  2VYP A;  3LP0 A;  3SYZ A;  3ID8 A;  3PY8 A;  4W5R A;  3V81 A;  2RF2 A;  1NU0 A;  4WYB A;  4KI6 A;  4CZI A;  2GUI A;  4C1N K;  4N76 A;  4OVL A;  3THX B;  3JSM A;  4JHD A;  1VAZ A;  1TAQ A;  1RDD A;  2WFB A;  3SBG A;  5FPN A;  4CZK A;  5BR9 A;  1FXX A;  5SZT A;  4HTU A;  1VSL A;  3TR8 A;  5JEN A;  3CCS N;  4OPJ A;  1MA9 B;  4JI2 K;  2NRX A;  4F8R A;  4OPH A;  2A40 A;  3ZX3 A;  1CXU A;  4NO7 A;  1YHQ N;  1HKC A;  4E7H A;  2P51 A;  1LAW A;  3TI0 A;  5AQV A;  4BR2 A;  3EYZ A;  3ZEU A;  5ELZ A; 
#chains in the Genus database with same CATH homology
 4Z94 A;  4BQL A;  3SAG A;  3R6M A;  1CZA N;  4B1U B;  3CHW A;  2E2Q A;  4IEI A;  4CD3 A;  4CZM A;  4UY8 O;  4BRG A;  5AZI B;  1U2V B;  5AQH A;  3SK3 A;  1NGI A;  2P9P B;  3L4Q A;  1SZ2 A;  3VTH A;  1OKJ A;  1D4X A;  1YJN N;  4CD1 A;  2WC9 A;  3DXM B;  3TSP A;  3T7Z A;  1YVN A;  3DJC A;  2Q0R A;  5AQZ A;  4XH1 A;  4JEP A;  1NGH A;  3IKM A;  3G4S N;  2QXL A;  4WFB L;  3VEV A;  1SQK A;  2HBL A;  3VGL A;  3L0Q A;  4J8F A;  1QZ5 A;  1DT9 A;  1BUP A;  4A57 A;  1ILY A;  1NGE A;  4CZF A;  4YOW A;  5C2D A;  2VGN A;  1MDU B;  1RFQ A;  1GLB G;  1HUX A;  1GLL O;  5GAE P;  3VEY A;  5M1Q A;  3P31 A;  2QEX N;  3FLC O;  1X3N A;  3WT0 A;  4CBW A;  4YOX A;  2FLO A;  3CQX A;  3FE1 A;  3FGU A;  3TTC A;  1VQN N;  3CPW M;  2P9K B;  4A2A A;  5B8H A;  1Q7Y O;  4XH4 A;  3IMX A;  3RVC A;  1HJO A;  1HPM A;  1VQK N;  5KPR A;  3ENH A;  3RSE A;  4FVU A;  3TSQ A;  1TUU A;  4JKG B;  2HMP A;  1W97 L;  5AR0 A;  5TKW A;  3B8A X;  1M90 O;  3VEZ A;  1BA0 A;  3P39 A;  5JLH A;  4PKG A;  5AQK A;  1LCU A;  2IVP A;  4K41 A;  3VGM A;  2QWR A;  2E2P A;  4IOC L;  3FZF A;  3M6G A;  4NB4 A;  1EO1 A;  3O8M A;  3ZEU A;  1DKG D;  4FWS A;  4MO4 A;  5TKY A;  1V4S A;  1X9J A;  3NVM A;  1MWM A;  3R3L A;  4FWP A;  4BR5 A;  3HM8 A;  5AQG A;  2P9K A;  4A5B A;  4QS9 A;  1YF5 L;  2P9N A;  3A5M C;  4BR0 A;  4FWO A;  1WOQ A;  4YDU A;  5AZJ A;  5CHI A;  1VQ6 N;  2P9U A;  3CCE N;  1EQY A;  1QQN A;  3CQY A;  3DXK B;  3GG4 A;  4H03 B;  1BU6 O;  1RDW X;  4IOX A;  4WFA L;  3AY9 A;  3CF5 L;  4BRD A;  3EN9 A;  2KLA A;  3J8A A;  4BRP A;  4IXC A;  5JVG L;  1S3X A;  3VF2 A;  2IIR A;  3C6H A;  3QDK A;  4MDB A;  5KPT A;  1YUW A;  2NRT A;  1KAY A;  2P9I A;  5AQI A;  4ISG A;  2ZF5 O;  3QIC A;  5AQT A;  4BRM A;  4JNE A;  3NMU A;  1VQM N;  1VQO N;  2GX9 A;  1SS6 A;  2NRR A;  1W2B M;  3H3N O;  3E66 A;  5F2R A;  4BC5 A;  3CXC M;  2NRZ A;  1NGF A;  4BRQ A;  1E4F T;  1M1K O;  2YCH A;  3LM9 A;  4M63 C;  2W40 A;  3A5O C;  5AQN A;  3WQU A;  3LDQ A;  2P9U B;  3H3O B;  4BVO A;  4BRO A;  2VGM A;  4WQ5 C;  2CGK A;  4JKE A;  4YOU A;  3SBT A;  4CZH A;  1Z05 A;  5GAD P;  2DPN A;  2F7T A;  3IFR A;  4HTL A;  1MWK A;  1TUY A;  5BRD A;  2RE2 A;  1SAZ A;  4BRF A;  4BY9 C;  1GLE G;  1ESV A;  2Q97 A;  3CER A;  1JCE A;  2FF3 B;  2P9L B;  3ZYY X;  3I56 N;  2GEL A;  3R8E A;  1K73 O;  4BE7 B;  5HOO A;  3KHY A;  3ZET B;  2FSK A;  4FSV A;  2ASM A;  2FSJ A;  1KAX A;  2GWK A;  4QS7 A;  2QW9 A;  3EKU A;  3O9S A;  1RGI A;  3N4Q A;  5C12 A;  2V51 B;  3A0I X;  2WBN A;  5ADX A;  1VQ7 N;  2I7P A;  4OO1 J;  3WUH A;  1WUA A;  5BPM A;  5H1S Q;  1S22 A;  4BRC A;  3T69 A;  3U9Z A;  3VEO A;  2YJE A;  4MLH A;  2QM1 A;  1NGC A;  5FPM A;  2CGJ A;  3TTD A;  5AQR A;  5AQM A;  3DAW A;  2E2O A;  4HWI A;  4BR9 A;  3CMA N;  3DWL A;  3AAP A;  2GUP A;  2HF4 A;  3OBW A;  5KQD A;  2HST A;  3VEW A;  1QVF M;  5AQL A;  5GIO A;  1VQP N;  5AFU H;  1HX1 A;  3IUC A;  4BGA A;  3Q7B A;  4EHT A;  1KAZ A;  4FWK A;  3A5N C;  3QML A;  4XJX A;  2QWM A;  4BRN A;  4BRE A;  3MN9 A;  5EX5 A;  3RSE B;  3CJ7 A;  3O9R A;  2QWL A;  3M1F A;  3GE1 A;  2V7Y A;  4H0O A;  4YOV A;  3PIP L;  3MWT A;  4BEC A;  3VER A;  4ILH A;  2GEM A;  3ZX2 A;  5HL7 L;  2UYT A;  4BQZ A;  3K9J A;  1J6Z A;  4H0P A;  4A61 A;  3G71 N;  3MCA B;  2D0P A;  4M7X A;  5AQX A;  3WXM B;  4DCH A;  2VCP A;  2Q0U A;  2ZGY A;  3OBY A;  4PHT X;  3VGK A;  4WFN L;  1C0G A;  4FWN A;  1ZXO A;  4YDU C;  2ITM A;  3KK7 A;  4F9O A;  5JIC A;  1NJI O;  4BEB A;  4MLE A;  3D2F A;  3LL3 A;  3LDP A;  3QBX A;  2P9N B;  4IOA L;  4KH4 A;  5F1X A;  5C15 A;  2QWQ A;  4BRH A;  2D4W A;  3TSU A;  1C0F A;  2E2N A;  4FWQ A;  3O1W A;  2E1Y A;  5LY3 A;  4A5A A;  1H1V A;  2C1I A;  2EWS A;  3E1Y A;  3LDO A;  1V4T A;  2YJF A;  4CBX A;  5M1N A;  2D1K A;  2QWN A;  3NVK A;  3CCU N;  4JKF A;  2QWO A;  5BN8 A;  2AP1 A;  2PFU A;  3H1V X;  3BEX A;  2CH5 A;  3VES A;  1IJJ A;  1NGG A;  4KBO A;  2JWL A;  1U2V A;  1GLD G;  3HBT A;  4GNI A;  4IO9 L;  3MDQ A;  5EOY A;  1R59 O;  4O8K A;  4MO5 A;  4LC9 B;  4R79 A;  3MX2 A;  4XH5 A;  4E1J A;  3PIO L;  5BRE A;  3PLA A;  5KPZ A;  3DXM A;  4BC4 A;  3O9T A;  3KWI A;  4AM7 A;  2ZWH A;  2Q2R A;  2ASP A;  2ZJQ L;  4FL9 A;  1VQL N;  3EKS A;  3E9P A;  3SJH A;  5FPD A;  5LJW A;  3Q7C A;  1XUP O;  4BR7 A;  4YOY A;  2CGL A;  3VPZ A;  4YOR A;  5E26 A;  5CR4 A;  4PKH A;  1NMD A;  3MK6 A;  1S72 N;  2F9T A;  2HBJ A;  3C0B A;  1KD1 O;  2BH1 A;  1Z6R A;  3O9U A;  3VEN A;  4ILG B;  3GOI A;  3IDH A;  3D2F B;  1BA1 A;  2P9S B;  3GBT A;  2W41 A;  1LOT B;  1YAG A;  4GV9 A;  3P38 A;  5GIP A;  2E1Z A;  4BG8 A;  1QQM A;  3J7Z O;  4CBU A;  1Q81 O;  5C10 A;  4RWT A;  5JVH L;  3BF1 A;  2A42 A;  3I33 A;  5JMV A;  2OTL N;  3MN7 A;  1K8K A;  3CD6 N;  3DXK A;  3GL1 A;  1Q86 O;  3F2K A;  2NRH A;  2WUS A;  5CE3 A;  2YI1 A;  4ISE A;  4DB3 A;  4WQ5 A;  4B9Q A;  3O80 A;  4AF1 A;  4DHY A;  2P9I B;  4GVE A;  3WXJ A;  1ATN A;  3CC2 N;  3GDQ A;  1P8Z A;  3S41 A;  5BPL A;  3MMV A;  4B1V A;  1Q18 A;  3FR0 A;  4K42 A;  3CCV N;  3E9O A;  4IZ9 A;  1QQO A;  3W0L A;  2HF3 A;  2JWK A;  3CJ1 A;  1E4G T;  2FXU A;  4O8U A;  4WQ4 A;  4QS8 A;  3QBW A;  1VQ4 N;  2YHY A;  3HZ6 A;  2ASO A;  3F5T A;  4JKA A;  3O1B A;  5DM6 L;  3CCR N;  1KXP A;  4JKB A;  4A2B A;  3WXL A;  3WXK A;  3P4I A;  3AGK A;  4U7B A;  4L3Q A;  4IEE A;  5ADX H;  5AZJ B;  4CZL A;  1YIT N;  2GWJ A;  1G99 A;  3EL2 A;  3JXU A;  3G25 A;  1JCF A;  1ATS A;  4JK9 A;  1YXQ A;  2ZGZ A;  3M3Z A;  4IFE A;  3L6Q A;  4RTF D;  4EIA A;  1JJ2 M;  4GV6 A;  3VEX A;  4CZE A;  3H46 O;  3BF3 A;  3BP8 A;  1NGB A;  3LDL A;  5GIN A;  4BRL A;  3ULE A;  2A6A A;  3HTV A;  3HI0 A;  2NRW A;  3FFK B;  1QVG M;  2A41 A;  3WXI A;  3FZL A;  1Y64 A;  3TPQ A;  1NLV A;  3C7N B;  4M7Y A;  5AZI A;  3O08 A;  4WF9 L;  1NBW A;  5AQQ A;  4WQ4 C;  4JKD A;  4JHD B;  3CCJ N;  2NZT A;  3ATU A;  5M1K A;  2RHK A;  1RDU A;  3R1X A;  4BG9 A;  4H5W A;  4BRA A;  3VOV A;  1T44 A;  1JCG A;  5EXW A;  3O5B A;  5M1P A;  5AQW A;  2NRV A;  3OHR A;  1ZBS A;  3D7E O;  3MWP A;  3VF6 A;  3UKR A;  3OA9 A;  3QFP A;  3G6E N;  2Q31 A;  4H0T B;  4JAX A;  1GLF O;  3CC4 N;  1K8A O;  3FZK A;  2PBD A;  3KVG A;  3A5L C;  5C2F A;  2E20 A;  4H0X B;  4JK8 A;  2YX6 A;  3ZET A;  3U8X A;  2FSN A;  3AGR A;  2PAV A;  5GAH P;  2P9P A;  4Y0W A;  2H3G X;  2QTD A;  1HKB A;  4FWM A;  4FPB A;  3OW2 M;  2NLX A;  3C65 A;  4B1X B;  2CH6 A;  5AQJ A;  3MN5 A;  1YJ9 N;  1BG3 A;  3LM2 A;  3U4L A;  5GAG P;  4IO8 A;  3CI5 A;  5EVZ A;  4DQ8 A;  1NGD A;  5AQF A;  2C1G A;  3LDN A;  4U67 L;  3O9Q A;  3DLL L;  2BTF A;  4FOI A;  1P90 A;  4JN4 A;  1O13 A;  4IJA A;  4KH6 A;  2YHX A;  1YI2 N;  3E9L A;  5BN9 A;  3JS6 A;  3SMP A;  2GTD A;  5ELZ A;  2QWP A;  3ENB A;  3A8Y A;  5M1O A;  3SMS A;  4DKW A;  4H5R A;  1N8R O;  3EZW A;  3QFU A;  3K9K A;  1GLJ O;  4CZJ A;  1T6C A;  2OTJ N;  2E8A A;  1BDG A;  1U6Z A;  2A5X A;  4KH5 A;  3N4P A;  4H0V B;  4ISF A;  4RCH A;  5FPE A;  3HSC A;  3UKU B;  5BPN A;  3HOT A;  3UB5 A;  3VMF B;  1T6D A;  5BRH A;  1YJW N;  3EE8 A;  1KC8 O;  4JKG A;  4BC3 A;  1Q82 O;  1NGJ A;  5JLF A;  3HOS A;  2KKZ A;  3CJC A;  2D0O A;  2NNW A;  1TYQ B;  2W00 A;  4OPA A;  4JD2 A;  3QB0 A;  1BO5 O;  4FWL A;  3VTI A;  2P9L A;  3CIP A;  3CJ9 A;  4K25 A;  1DEJ A;  4O5F A;  4GY2 B;  4A59 A;  3AAQ A;  2I7N A;  1XC3 A;  1GLA G;  4JKH A;  5AQO A;  1X3M A;  1BOT O;  4CI6 A;  1K9M O;  3TTF A;  4ILJ A;  2YHW A;  5AQP A;  4A62 A;  1VQ5 N;  3O6W A;  2Q36 A;  3KWG A;  5LJV A;  3TU5 A;  3H1Q A;  1YIJ N;  2J4R A;  1ATR A;  5AQS A;  3CPE A;  3I8B A;  3R9P A;  3ZX0 A;  3SLC A;  2A3Z A;  3ULE B;  4MDA A;  4BC2 A;  5MLC Q;  4EAH D;  4NLC A;  5AQY A;  3CCM N;  3HRG A;  1NM1 A;  3H6E A;  4EHU A;  4C1N I;  3MX5 A;  3VF4 A;  3D2E A;  3CJB A;  3MCP A;  3EO3 A;  4B1Y B;  4BR2 A;  3CCL N;  2V7Z A;  2FF6 A;  5F0X A;  4CJ7 A;  2V52 B;  2AA4 A;  3FZH A;  3CME N;  4BRI A;  1T3V A;  1QHA A;  3BUZ B;  1VQ8 N;  2OAN A;  5E84 A;  3W3D A;  1OVY A;  4C23 A;  4K43 A;  4JKC A;  3CC7 N;  3F9M A;  3ID6 A;  4BRK A;  4FO0 A;  1HLU A;  3O4W A;  4I6M A;  3ZEU B;  2HBK A;  4YOT A;  4NLB A;  3UKR B;  4WCE L;  3WQT A;  2F9W A;  3L4I A;  4EFH A;  4PL7 A;  2P9S A;  1NGA A;  2VYP A;  3C7N A;  1QZ6 A;  2QI2 A;  3EE9 A;  2IVO A;  4BVP A;  3C6A A;  3U9D A;  5AFU A;  4IDH A;  2ZJP L;  2KHO A;  4BR4 A;  3ID8 A;  2HBM A;  4FWR A;  5BRF A;  1K8K B;  3H45 C;  3VET A;  3D6R A;  4WYB A;  4FOE A;  4H5V A;  4AM6 A;  3CET A;  3UE5 A;  4CZI A;  4IWV A;  4C1N K;  5DM7 L;  1TYQ A;  4H0Y B;  3CJA A;  1NWK A;  4IJN A;  2E88 A;  1IG8 A;  3MN6 A;  4B1Z A;  5KQ8 A;  4G9Z A;  4JK7 A;  1GLC G;  3ATV A;  3I55 N;  2ZJR L;  2QA4 N;  2VWB A;  3CCQ N;  4JHD A;  1VAZ A;  4CZG A;  5EY4 A;  2WFB A;  3SBG A;  3SAH A;  5FPN A;  4B1W B;  4CZK A;  1VQ9 N;  2IVN A;  4H5T A;  4XEI A;  3M5R A;  5AQU A;  3AAR A;  5BR9 A;  1XQS C;  3CCS N;  3ENO A;  1MA9 B;  4BGB A;  2NRX A;  5M1F A;  3KZB A;  4OPH A;  2A40 A;  4FPA A;  3UKU A;  2BUP A;  3ZX3 A;  3SAF A;  2Q1N A;  3FZM A;  1BWF O;  4NO7 A;  5C0Y A;  1YHQ N;  3WEE B;  5I9E B;  4PKI A;  4GV3 A;  1HKC A;  3D2E B;  3WEE A;  4H5N A;  1ZC6 A;  1DGK N;  2HOE A;  4JD2 B;  5AQV A;  1HKG A;  1KQS M;  4I6M B;  4PL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...