1U2VA

Crystal structure of arp2/3 complex with bound adp and calcium
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
418
structure length
402
Chain Sequence
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Actin-Related Protein 3
total genus 123
structure length 402
sequence length 418
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1u2vA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1u2vA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1u2vA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1u2vA04
3O80A 3ATVA 3VGLA 4RWTA 3D2FA 4FWPA 1NGGA 3FR0A 2E2OA 4YDUA 2Q2RA 3ZETB 2CH5A 2UYTA 5F1XA 2QM1A 4NB4A 4CZHA 4A62A 2D4WA 1GLJO 1NM1A 2P9PB 4WQ4C 1DEJA 3VGKA 5BR9A 5AQKA 2FSKA 2ITMA 4H0XB 3TU5A 4EHTA 1KAXA 1JCEA 2QXLA 4RTFD 4FO0A 5AFUA 1HPMA 1NGJA 2E2NA 2NLXA 3A5MC 1HKGA 4BROA 3FZKA 4QS8A 1U2VA 4BQLA 3HBTA 5E84A 4Z94A 2FF3B 1OKJA 4GNIA 3LDNA 3AY9A 1XUPO 4XEIA 5AQRA 1YXQA 4DQ8A 5AZJA 2ASOA 2IIRA 1NGFA 2D1KA 1K8KA 3D7EO 3WQTA 3QBWA 3U9DA 2ZWHA 1MA9B 3BUZB 2P9LB 2D0PA 2ZF5O 3KHYA 2FXUA 4M7YA 4YDUC 4DB3A 3IMXA 4ISGA 3VOVA 2Q36A 4BRGA 3H1VX 4CZEA 1NGHA 2ASPA 2QWOA 3FE1A 3QB0A 1YVNA 3L4IA 3VF2A 1BG3A 3FZHA 3O5BA 4BC5A 3HZ6A 3H45C 3RSEB 1LCUA 5BRFA 4M7XA 3S41A 4BGAA 4BRMA 3WEEB 4BRDA 2FSNA 4A2AA 5BPMA 4BQZA 5BRHA 1C0FA 4PL7A 3KVGA 3EKUA 3I33A 3VF6A 3ZX3A 4CD3A 3U9ZA 1SZ2A 2AA4A 3U8XA 4B1VA 4BG8A 3GBTA 2D0OA 2E8AA 3M1FA 5EOYA 5EVZA 3UE5A 4A61A 4BR5A 3IUCA 5AQMA 4BVPA 3FZFA 1E4FT 4IJNA 4CI6A 5BPNA 1Y64A 5AQQA 1RDWX 1S3XA 3O8MA 3VEXA 4I6MB 3FLCO 3R9PA 3H3NO 1MWKA 2ZGYA 4CZJA 2YJEA 3ENOA 4CZGA 5AZIA 3CIPA 2WUSA 3CERA 4FWLA 4H0TB 1TUYA 1BOTO 3MN7A 3CQXA 3WXJA 4PKIA 4FL9A 1HKBA 5AQUA 2A41A 3SMSA 1GLDG 2IVPA 3LDPA 2IVOA 3ZX0A 1ATSA 4JD2A 3IDHA 3GOIA 5AQNA 1RGIA 1ZC6A 2I7NA 4BGBA 1ZBSA 3FGUA 4BR7A 3UB5A 5KPRA 2P9UB 1WUAA 4H5TA 4K43A 2NZTA 3LL3A 5KQDA 2QW9A 1GLAG 2CGJA 2P9NA 2YHYA 2E20A 1ESVA 3CJ9A 3GG4A 3MDQA 3ULEA 2AP1A 3CJBA 5AQWA 4CZMA 5AQZA 5EX5A 2CGKA 4B1WB 4MO5A 2W40A 3CJ1A 3MK6A 4ISEA 4CBXA 3DAWA 2QWNA 3C7NB 4BC4A 3CJ7A 2QWQA 5AQTA 3H3OB 4C23A 4H5NA 3DJCA 2QWLA 2P9KB 4FWQA 3H1QA 4H0OA 4I6MA 4WYBA 3A0IX 3A5LC 5AQOA 4XH1A 1NWKA 5AZIB 4FWNA 3SMPA 2VYPA 2GELA 1MDUB 4CJ7A 5FPDA 5B8HA 4FPAA 1BUPA 1KAZA 2Q31A 4RCHA 3SJHA 4MLHA 2P9SB 1GLEG 4JHDB 5EXWA 1ZXOA 1QQOA 4BR9A 3KZBA 1BDGA 3VEVA 5KPZA 1JCGA 1KAYA 4BRKA 2QWMA 5LJWA 3CETA 1EQYA 3L6QA 4F9OA 4H0VB 2E88A 1LOTB 4Y0WA 1TUUA 4A2BA 3CJAA 3AAQA 4AM7A 1WOQA 1Z05A 2IVNA 2I7PA 1QZ5A 1X3MA 2E2PA 4MO4A 3MCPA 3C0BA 4BRPA 4EFHA 5AR0A 4DCHA 4BC3A 4H03B 5EY4A 1DKGD 4PL8A 3VENA 4J8FA 3ULEB 3FZMA 4FOIA 3ZX2A 1XQSC 4QS9A 3MN6A 4AM6A 4IXCA 4FWOA 3W3DA 3U4LA 3W0LA 3VEWA 4LC9B 3LDQA 4EAHD 2YJFA 1JCFA 2YHWA 5CE3A 4H5WA 3DWLA 3F9MA 4XH4A 4JN4A 1QQNA 3ENHA 3GDQA 3R8EA 4K25A 1QQMA 4PKGA 2PBDA 1HX1A 3FFKB 5FPMA 1QZ6A 2W41A 3QFPA 3JXUA 4WQ5C 2A3ZA 4FPBA 2E1ZA 4DHYA 4FWKA 3ZETA 3TPQA 4BRQA 2E2QA 1K8KB 3B8AX 4IWVA 4HWIA 4NO7A 4CZKA 2HOEA 4FWMA 2V52B 3GL1A 1YAGA 4EHUA 2P9LA 5AQSA 2YI1A 1NGBA 4BR2A 2YCHA 3VEZA 2VCPA 2F9TA 1SQKA 4E1JA 3EL2A 3WXLA 2GWJA 3CHWA 4H5VA 1CZAN 1Q18A 2HF4A 2QWPA 3BF1A 2A40A 1YUWA 4BR0A 3J8AA 3ID8A 1G99A 3LDOA 3WXIA 1U2VB 5AQLA 5JICA 3VF4A 4JNEA 3M6GA 2YHXA 3G25A 3VGMA 3VESA 5JLHA 3AAPA 5AQXA 1T44A 1ATNA 5AZJB 2A5XA 3GE1A 3WXKA 3WUHA 1V4TA 4MLEA 3VPZA 5ADXH 2FSJA 4B9QA 5JLFA 1GLFO 1DGKN 1GLCG 3QMLA 2HMPA 3O4WA 4CBWA 4BG9A 2CH6A 5AQJA 4H5RA 3A5NC 1H1VA 3H46O 2ASMA 5LJVA 1E4GT 2CGLA 4FWSA 3ZEUA 1BA1A 2ZGZA 2PAVA 3RSEA 3L0QA 1KXPA 3VEYA 3UKUB 4M63C 1X3NA 3HI0A 3BF3A 4O8KA 2EWSA 5ELZA 1V4SA 3CI5A 5AQPA 2FLOA 4BRNA 1T6DA 2V7YA 4KBOA 4BRHA 5F0XA 5KQ8A 2P9IB 4CZIA 1C0GA 2Q0RA 1SAZA 3VERA 1BA0A 4BRFA 3EZWA 1TYQB 3O1BA 3O08A 4GY2B 5AQFA 3UKRB 4BRIA 3MN9A 3DXMA 1QHAA 1NGCA 5I9EB 3DXKA 1NGAA 5BREA 5AQGA 5FPNA 5AQIA 5BPLA 1D4XA 2Q1NA 4CBUA 4L3QA 3O1WA 4IZ9A 4CZLA 3SK3A 2P9UA 1HUXA 4K42A 4HTLA 5KPTA 1HLUA 3IFRA 1P8ZA 2GWKA 4BR4A 3AARA 3QBXA 3QDKA 1U6ZA 2J4RA 3FZLA 5FPEA 2FF6A 5AFUH 5E26A 4EIAA 3SLCA 3EN9A 2V7ZA 4WQ4A 5BRDA 3CJCA 1BO5O 1ATRA 3QFUA 4JD2B 4BVOA 3WQUA 4B1UB 3OHRA 1NMDA 2OANA 1BU6O 1MWMA 3P4IA 3CQYA 3HTVA 4CD1A 3ZEUB 3LM9A 5JMVA 4XH5A 4FOEA 1R59O 2Q0UA 3VEOA 5BN8A 3D2EA 1NGEA 4PKHA 2P9KA 2F9WA 2H3GX 1HKCA 3UKUA 3QICA 3M3ZA 2A6AA 2QWRA 2P9NB 4ISFA 1NGIA 3D2FB 3EKSA 3MMVA 2V51B 1HJOA 5AQVA 4H0YB 3O6WA 3WT0A 2P9IA 4BC2A 4FSVA 1RFQA 4IJAA 4O5FA 1TYQA 3UKRA 1T6CA 1J6ZA 5AQHA 3DXMB 2DPNA 3A8YA 1NBWA 2P9PA 2VWBA 2E1YA 2KHOA 3DXKB 2HF3A 4BRCA 3C7NA 3BP8A 3H6EA 2Q97A 1Z6RA 3EO3A 5AQYA 2A42A 4FWRA 2BUPA 5LY3A 5BN9A 4B1ZA 1S22A 1BWFO 3VETA 5TKYA 4JAXA 4CZFA 1X9JA 2GUPA 3HSCA 5F2RA 2NRHA 3A5OC 3MN5A 4B1YB 1GLLO 3ATUA 2GEMA 2P9SA 1IG8A 4BREA 4JHDA 1GLBG 1NLVA 3I8BA 2BTFA 4H0PA 4IO8A 4QS7A 3LDLA 4WQ5A 3BEXA 3LM2A 3R6MA 4K41A 4B1XB 1XC3A 4BRLA 1NGDA 3HM8A 5ADXA 4BRAA 3D2EB 3JS6A 2GTDA 1IJJA 3WEEA
chains in the Genus database with same CATH superfamily
2OTLN 3L2WA 3O80A 2VG5A 3ATVA 1ITGA 3VGLA 2Z1IA 3ISNC 4RWTA 1NJYA 3FR0A 4KO0A 2X78A 3V9ZA 1QHTA 1RBTA 4GVEA 2F96A 4NB4A 4CZHA 4Z4CA 4M3TA 3VGKA 1TKDA 3VA0A 2RE2A 4BDPA 3TU5A 4NLCA 3NMUA 5KGXA 1IV0A 4FO0A 4OLAA 2GBZA 2ZD1A 4CEBA 4DTPA 4BROA 2NLXA 4JKAA 1SL1A 1QSLA 3T1HK 1G15A 3N4QA 1XUPO 4XEIA 5AQRA 4J2DA 2JWKA 1K8KA 2VGMA 1RBSA 3V9XA 3L2VA 2KZZA 2P9LB 2ZF5O 4WCEL 4CEFA 3CC7N 3VOVA 4BRGA 3TAEA 3S5TA 2QWOA 4Q0BA 3L4IA 4C8KA 3RSEB 4HUGA 1EO1A 4IFYA 1N36K 1VQ5N 3DLKA 5BRFA 3S41A 1XHXA 4DQRA 3TR8A 1OH5A 3CFRA 1IKVA 4IEIA 4ILHA 4KHSA 3SAFA 1E3MA 3E9OA 1SL0A 1HNVA 4DF4A 3ZX3A 4CD3A 3AGRA 1OH6A 2AA4A 2D0OA 3IUCA 3ZSOA 3FZFA 1E4FT 4DV2K 4CI6A 4DFJA 2ZM6K 5BPNA 1Y64A 3AA2A 3PIPL 3VEXA 4I6MB 3EY1A 3HL8A 3H3NO 4CZJA 2YJEA 4DSFA 4N76A 4XJXA 5DK5A 4CHYA 5HROA 3AGKA 4CFCA 3CERA 2RKIA 1NK0A 4BWJA 5SZTA 2QA4N 1KD1O 4PKIA 4FL9A 1RTHA 5CZ2A 4GW6A 5AQUA 3IG1A 3SMSA 1M90O 2O8CA 4HUEA 3ZX0A 4ZTFA 3OS0A 1EP4A 1ZC6A 2I7NA 3LZIA 1ZBSA 1KLMA 4J2EA 5KPRA 3AV9A 2WBNA 1BQNA 1L3VA 2NZTA 1XI1A 2EX3A 3CC4N 1JLCA 1TAUA 1YI2N 3OYLA 4CEAA 4B9TA 3HPHA 1JLBA 1TV6A 3GG4A 5JS2A 3BY5A 3MDQA 3AO5A 1NU0A 3CXCM 1VSKA 3VQ5A 3CCJN 2DFEA 1VQON 1N8RO 2E6MA 1HNZK 4B1WB 1D8YA 5J2PA 3DAWA 2QWNA 4X62K 1FKOA 2PY5A 3SZ2A 4FK0A 4RW8A 4E3SA 5AQTA 3RR8A 3O9QA 2QWLA 3H1QA 1HR0K 4CJKA 4XH1A 3MEEA 4FWNA 4QCLA 2XY8A 2X6SA 4KKOA 5FPDA 3QNNA 3TAFA 4RCHA 1NKCA 3SJHA 4MLHA 1J9AA 1S1TA 4CGIA 1IO2A 3VQCA 1ZXOA 3DLEA 4DQPA 2ZJPL 3NH1A 3VEVA 4FCYA 5KPZA 3OYIA 1WAFA 2W6LA 1EQYA 2ZJRL 4H0VB 3CYMA 4C8NA 3NAEA 3LDSA 4Y0WA 3HK2A 1NK4A 4CHPA 4DWIA 5LL6Z 3VQDA 2P5OA 3KD1E 4JI5K 4AH9A 1QZ5A 1X3MA 4CJFA 2HHVA 1JLFA 3S3MA 4EFHA 5AR0A 3WNEA 4BC3A 1NMNA 4H03B 4DCHA 1DKGD 4PL8A 3VENA 4LFAK 3NF8A 3NH2A 3FZMA 4O44A 3ZX2A 3SUQA 1XC9A 5D3GA 1Q8IA 4FWOA 4FLUA 1VQPN 2DTUA 4LY7A 3U4LA 5JVGL 3W0LA 3VEWA 1QS4A 4LC9B 4IOXA 1VSDA 3F9MA 4KTWA 3GDQA 2WOMA 1W9HA 3NCIA 1QQMA 2BE2A 3AVMA 1HX1A 3SPZA 4FLWA 2UXDK 3JXUA 4WQ5C 1L3UA 4F8RA 3K57A 3ZETA 3TPQA 4BRQA 2E2QA 3TSQA 2HVHA 5BR8K 4CZKA 5IT9O 4FWMA 4BACA 2V52B 1TVRA 1O1WA 5HRNA 4KHPK 2YX6A 4BR2A 1J54A 4CJEA 4K8XA 2VCPA 2VGNA 3O9UA 3SJJA 2FBTA 3OYHA 3WXLA 4H5VA 5GIOA 4B3TK 1YVUA 2QWPA 2A40A 1TGOA 3J8AA 1G99A 3PSIA 1K8AO 1I94K 5JICA 3K59A 3M6GA 3G25A 3VGMA 3F9KA 3VESA 3KKRA 1OH7A 3GE1A 4AF1A 1YJWN 3V1QA 1IKXA 5ADXH 4B9QA 1VAZA 4JS5A 5JLFA 1DGKN 3THXB 3QMLA 4TSXA 2OPQA 3O4WA 1RILA 3ZSVA 1LWFA 2UUAK 3PO5A 4BDZA 4PHTX 3LP2A 3QIOA 4FWSA 1L3TA 4CGFA 1EWQA 3KLEA 3M8QA 3DMJA 5TKWA 1KXPA 4I9QA 4IG0A 3UKUB 1IKWA 4M63C 4CJSA 3DRSA 3KLIA 3HI0A 1U48A 5E41A 5ELZA 1V4SA 1YIJN 2OYQA 4KBOA 3TTCA 2W00A 2P9IB 4CIGA 4I9LA 1SAZA 3C6UA 2O8FA 2A1SA 3VERA 1RT4A 1W97L 4BRFA 3EZWA 5AQFA 3B6OA 3MN9A 3DXMA 1BI4A 3AO4A 4B9LA 3DXKA 2D0BA 4KB0A 3LWLA 4L3QA 4IZ9A 4CZLA 1RDAA 2P9UA 1YJNN 4E89A 1WSEA 3M8PA 4EP5A 3MXIA 3U3YA 2NRXA 2J4RA 3FZLA 3T3FA 2QKKA 2XY7A 3SLCA 3ULDA 4IDKA 4WQ4A 3U3GA 5BRDA 3CJCA 4YORA 5HRPA 3CPWM 1GOAA 1BO5O 2IS3A 4IEEA 3BZCA 1NKEA 4B08A 5C0YA 3AVKA 3OHRA 3C65A 3QEWA 1BU6O 1YTAA 3P4IA 1JL2A 4OJRA 3VQAA 3PX0A 3HO1A 3LM9A 3QIPA 4CGDA 4FOEA 5I42A 5MLCQ 4CEEA 3VQQA 4GV3A 5JENA 3QETA 2F9WA 4KHYA 1P90A 3RVCA 3ENBA 3UKUA 5KI6A 2QWRA 2P9NB 1T05A 3EKSA 1XMQK 3MMVA 2C1GA 4K0KK 4FXDA 4BC2A 3OYCA 1BQMA 3SQ2A 3HOSA 4Z0UA 1T6CA 2NRVA 1J6ZA 5FLXO 1BI4B 2KHOA 1ZYQA 3VTHA 4K8ZA 3BP8A 1RT1A 1TKXA 2IDOA 4BE2A 4LF6K 3KWGA 5AQYA 1U04A 1UOCA 3CMEN 3VETA 5I3UA 1Z25A 1VSFA 4JAXA 1VQ7N 1C1AA 4E1NA 4KHNA 4DUZK 1GLLO 4O55A 4IFEA 1RTJA 2GEMA 4CVNE 4GKJK 1KQSM 3ZSWA 1IG8A 3J81O 4H0PA 1RDUA 4JK8A 4DV1K 4CIFA 5IWAK 4JKGB 3I55N 4IDHA 1REVA 3TWHA 3BEXA 1TL1A 3R6MA 4K41A 4B1XB 1WSFA 2UXBK 4KTZA 3MWTA 4BRAA 3FFIA 2GX9A 3D2EB 3P83D 2Y1IA 3JS6A 2O8DA 1IJJA 4Z4FA 1EXQA 5AJ3K 2OTJN 2RPIA 1JJ2M 3SCXA 4LF8K 3NBPA 1RNHA 1RT2A 4DR2K 1N5YA 3ZETB 2CH5A 3RR7A 2UYTA 3ZSQA 2VQFK 1WLJA 4BEBA 2QM1A 4JKEA 4Z4HA 1N33K 1GLJO 4WE1A 2QXFA 1NM1A 3EYZA 5BR9A 2O8BB 4EHTA 2QXLA 2G8HA 1HQUA 5AFUA 2HHWA 3RMBA 2OZSA 3O9TA 3A5MC 5HRSA 1U2VA 2D0AA 5E84A 4Z94A 2FF3B 1OKJA 4Z4EA 3AY9A 2O8EA 1BCMA 2ASOA 4CF1A 1T03A 3D7EO 3WQTA 4LFCK 3U9DA 1MA9B 4M7YA 1SUQA 4YDUC 4DB3A 4X66K 3C95A 4ISGA 4F2RA 3H1VX 1NGHA 3FE1A 4ZTJA 2YNIA 3T7ZA 1BG3A 1S5JA 3DRPA 4DQSA 4BC5A 4DFPA 3HZ6A 4DLEA 3I56N 1LCUA 3F2KA 4M7XA 4AHVA 4BGAA 3PX6A 2HBKA 2HVIA 4DTNA 3ZT4A 3DLHA 4EZ9A 1XWLA 2VWKA 5KRTA 1SV5A 5J1EA 4A2AA 4BQZA 3VQ4A 5BRHA 4EZ6A 1C0FA 4PL7A 1HNIA 3U8XA 3OYMA 3SBTA 2PYLA 4CERA 1RBRA 1RDWX 4JKCA 4V19S 3FLCO 4CZGA 4B9VA 3A2FA 3AVLA 4M3ZA 4HTUA 3LWMA 2O8EB 4NCAA 3MN7A 1B9DA 3O4NA 3CQXA 3KKSA 4E72A 4KI4A 2W6KA 3QEPA 4J2AA 4A5BA 4LSNA 4I7FA 2IVPA 3CCQN 3LDPA 2IVOA 3CCUN 4JD2A 3IDHA 4DTOA 3FGUA 1QVFM 1K9MO 3NF9A 2VG6A 1BGXT 4KI6A 1X9MA 1JLAA 2ATQA 4KRFA 3CJ9A 1UAXA 2W42A 1A5XA 2QKBA 1LV5A 3R3LA 3ULEA 2AP1A 4PWDA 5AQWA 4G9ZA 4E0DA 1YTUA 4OGEA 1XNRK 2CGKA 3ZT3A 4NCBA 4YOYA 1SL2A 4CGGA 4CJ5A 2QWQA 3LAKA 3P5JA 4DS5A 1QVGM 4C23A 3DJCA 4FWQA 4H0OA 3Q7BA 3A0IX 2XO7A 3AVGA 3SNNA 1NWKA 2NUBA 4X65K 2HHUA 3L4QA 3SMPA 3NFAA 3AVJA 4CEZA 2DFHA 2GELA 1MDUB 2VYPA 3S3OA 3PY8A 2P51A 1BUPA 3TAPA 1TL3A 1Q82O 2D5RA 1M1KO 1CZ9A 3ZYYX 2HNYA 4BR9A 4CCHA 1BDGA 1UWBA 4DMNA 3JAMO 3RRGA 3O3HA 1KAYA 3HVRA 2QWMA 1KFDA 3AVBA 4F9OA 4CESA 3AAQA 1Z05A 5HL7L 4DR7K 1WAJA 2IVNA 1WSJA 1VSHA 1NK9A 3P39A 3MCPA 4BRPA 4XIUA 3NDKA 2UUBK 4CEOA 3AA5X 4JV5K 1IBKK 3CFPA 4KFBA 2RHKA 4CGHA 3E1YA 4IXCA 3W3DA 4JS4A 4KB1A 2XY5A 1JCFA 4YFUA 5CE3A 4F3OA 3VMFB 4XH4A 1QQNA 3R1XA 5HLFA 1J5OA 3CFOA 1NOZA 4FJNA 1DLOA 2IAJA 4FJ8A 4FJ7A 4NYNA 4E19A 2P5GA 4DHYA 3MEDA 3ZT1A 3B8AX 4HWIA 2HBLA 4O5BA 2HOEA 3HRGA 3SQ1A 4CK3A 1YAGA 4EHUA 3QLHA 2P9LA 2YI1A 1S9EA 1HJRA 1NGBA 4FLVA 3S9HA 1HPZA 2O8BA 1SQKA 1NJWA 4Y1DA 2GWJA 4DTMA 3M8SA 4CJVA 3LDOA 5C42A 4CHNA 5AQLA 3KLGA 2O4IA 5AQXA 4WFAL 1C0MA 5C10A 2A5XA 3WXKA 3VTIA 4KHWA 3WUHA 1V4TA 4MLEA 2FSJA 4CECA 1GLFO 4E7HA 1GLCG 2XHBA 4BG9A 1RT3A 5AQJA 4I2PA 4NXNK 1BA1A 4AHTA 4CJWA 4IOCL 3SAGA 4B3SK 5C12A 2ZGZA 3LPUA 1RBUA 4FZXC 4O8UA 4CJTA 4NLBA 3MECA 3CCRN 4CHQA 3SV3A 5C24A 4BRNA 3CI5A 3MXJA 1DTQA 3OYGA 1JKHA 2V7YA 4KH6A 2HHIA 4CJPA 1C0GA 2Q0RA 4HVJA 4U7BA 3UKRB 3O1BA 3LALA 3TSPA 3K5OA 3EEQA 3J80O 1FXXA 5I9EB 5J2NA 1BCOA 1HQEA 3AA4A 5FPNA 2HBJA 5AQIA 2QK9A 1JLQA 4DSKA 5A2QO 1D4XA 2Q1NA 4CBUA 5GAEP 3O1WA 2OZMA 3CCSN 3V9WA 1HUXA 1VSJA 4K42A 4LH4A 5KPTA 3IAYA 3DOKA 3KD5E 3SQ4A 3QBXA 3V1OA 2FF6A 5AFUH 3ALYA 4EIAA 4HHTA 1KLNA 2O4GA 2ZQBA 1EETA 3C6HA 4FW1A 3RTVA 1NNEA 1EWRA 3E01A 4Z4IA 2JWLA 3J7AP 1NMDA 2OANA 1MWMA 1W2BM 2JGUA 2Y1JA 4CEQA 5JMVA 2QEXN 3VEOA 2Q0UA 2UXCK 3G4SN 4PKHA 4AILC 2KZMA 3NH0A 4IOAL 4ISFA 3LANA 4YOUA 3D2FB 2V51B 1HJOA 2YNHA 3DLGA 3I0RA 5AQVA 4DV5K 2HBMA 4Z4GA 4FSVA 4IJAA 1TYQA 3E9PA 1VQ4N 4CK2A 2WC9A 2DPNA 2E1YA 3DXKB 2FBYA 3WNGA 1S1WA 2P1JA 3PX4A 1S22A 2X6NA 5TKYA 2HMIA 2YHBA 4CF8A 3LP1A 5JS1A 2NRHA 3A5OC 3SPYA 3MN5A 1VRUA 4CE9A 4CFDA 3C6AA 3ATUA 2EHGA 5GIPA 1NJXA 4NCGA 1LWCA 2P9SA 1TK0A 1VQNN 3CCMN 4BREA 1GLBG 1NLVA 3I8BA 4CGJA 2BTFA 4JK7A 3ASMA 4IO8A 4QS7A 5C15A 3D6RA 3HP6A 1XNQK 4DV0K 5HRRA 4AHUA 3AVIA 1Z26A 2ZJQL 3F5TA 3NHGA 1X1PA 5J2MA 5M1QA 4C8LA 3TTDA 1HYZA 3HSTB 1NGDA 1LW0A 5ADXA 3NGIA 2NRZA 3AVNA 3LP0A 3D2FA 1NGGA 2E2OA 2KKZA 4PUOA 2C1IA 2LSNA 2Q2RA 5CR4A 3NE6A 2HW3A 2G8VA 3DLLL 2YNFA 3THYB 4A62A 2D4WA 4B9SA 4WQ4C 1DEJA 3OS1A 5AQKA 2ITMA 2PZSA 4WF9L 4RTFD 3MCAB 1Q9XA 1CLQA 1NGJA 1T3VA 3FZKA 4QS8A 5FDLA 1N6QA 3HBTA 2ETJA 3LDNA 1QE1A 4FLZA 1YXQA 4AHRA 2HSTA 3ITHA 5AZJA 1NGFA 3IKMA 4CFAA 4ELTA 3MEGA 4FYDA 1S6QA 4DV4K 1VK0A 3KHYA 2FXUA 1HNXK 1S1VA 4OPKA 4CZEA 2ASPA 3QB0A 4FJKA 1YVNA 3VF2A 1VQ8N 3FZHA 1K73O 1YHQN 3O5BA 4DSLA 3H45C 3LAMA 4C1NK 3QO9A 3OYKA 4JKBA 4BRMA 3WEEB 4EP4A 4O0JA 4LH5A 2BDPA 1C0TA 3NF6A 1YT3A 1VQKN 2KQ2A 4JKDA 5BPMA 4DQIA 1NK6A 3EKUA 3VF6A 2NRTA 1IBMK 4J2BA 1JLEA 3U9ZA 1SZ2A 4B1VA 3M1FA 1D5AA 5EVZA 4A61A 4BR5A 5AQMA 3PLAA 1ASWA 4JI8K 4CJQA 3R9PA 3I0SA 4JI0K 3K58A 1MWKA 3OY9A 2X74A 5AZIA 5HOOA 4OPJA 4JRQA 3KK7A 3CIPA 3IRXA 4B9NA 3MXMA 1A5VA 4FK4A 4H0TB 1VSEA 3BDPA 3QEIA 4CIEA 1RT7A 1HKBA 3H08A 2A41A 1GLDG 3T1AA 3NF7A 1ATSA 3CPEA 3GOIA 3CQ8A 1RGIA 3EE8A 4DTRA 3DYAA 3UB5A 2UUCK 4JK9A 2OPPA 3LL3A 3OYDA 1CZBA 5M1OA 1N34K 5C25A 4KPYA 2HHQA 1I39A 1ASUA 3V4IA 2CGJA 2P9NA 1S1UA 2YHYA 2E20A 3CYGA 4YOTA 3CJBA 3K5MA 1NK7A 2B6AA 2R7YA 3QEXA 5EX5A 4MO5A 2W40A 2BH1A 3CJ1A 3MK6A 4ISEA 4FJ5A 3H3OB 3KK1A 4H5NA 3OJUA 5C2FA 3RMAA 1N32K 3NVMA 4Q5VA 4I6MA 3A5LC 2XY6A 1LW2A 1J5EK 5AQOA 3V9SA 4A59A 3C94A 3AA3A 2YKMA 3TSUA 5JVHL 5B8HA 1MU2A 4OKKA 1K6YA 3HJFA 2Q31A 4DTJA 4U67L 3THWA 2P9SB 2PFUA 3QINA 4JHDB 3KLFA 1I3AA 4PY5A 4B3OA 5KRSA 3VQ9A 1BHLA 1IG9A 2ITGA 3D45A 3VQ6A 2YHAA 5LJWA 1RDBA 3CETA 3ZSXA 4OPHA 1LOTB 1TUUA 2Z1JA 3OYNA 4DV6K 3KJVA 1WOQA 4BE0A 2I7PA 4IBNA 3C0BA 3T69A 1RTIA 4JI7K 5EY4A 4N5SA 3ULEB 1U49A 4CF0A 1XQSC 4QS9A 3OTOK 4FJXA 3SYZA 4DTXA 4WFNL 1Y97A 3NGYA 4B3MK 1GOCA 3SV4A 5KTQA 1JXBA 4EAHD 4H5WA 3OYBA 3QNOA 4GV9A 4H8KA 4JN4A 2HNDA 3R8EA 4DU1A 3TARA 1RTDA 1BISA 4MDAA 3VN5A 4PKGA 3FFKB 2F8TA 5FPMA 5FROA 3VQBA 2W41A 3QFPA 2A3ZA 3WNFA 5J2QA 4PA1A 1R0AA 1K8KB 4NO7A 3NVKA 1IKYA 4B3RK 3GL1A 4Y1CA 3ZLJA 2YCHA 3ZT0A 4E1JA 4HUFA 3QERA 2FBVA 3CHWA 1QTMA 1OVQA 1Q18A 3BF1A 1C1CA 5HBMA 4BR0A 3ID8A 3WXIA 1U2VB 1VSMA 5LMNK 4JNEA 2YHXA 4OKJA 4DTSA 1IBLK 5KGWA 4BE7B 1T44A 4DLGA 4MDBA 3V6DA 2OCEA 3E66A 3NGZA 4DV3K 3VPZA 5GINA 1FJGK 4YOVA 2HMPA 4IO9L 4BY9C 4CBWA 1ILYA 2KFZA 4H5RA 1H1VA 3H46O 2NNWA 1GOBA 5LJVA 2Z1GA 2NRRA 1U47A 2PAVA 4W5NA 4DTUA 3L0QA 2FBXA 3BF3A 4E7KA 5AQPA 4KH5A 3MX5A 2FLOA 3HP9A 3L3UA 4FJJA 4DFKA 5DMRA 3OJSA 4JKHA 5F0XA 4CZIA 3P1GA 2KTQA 4G1QA 1BA0A 1TAQA 4ID1A 1W7AA 4NXMK 2KFNA 1NGCA 3L2QA 3RMCA 1NGAA 3E9LA 5BREA 3HT3A 4YY3K 1UA1A 3OBYA 3SK3A 5FRNA 4KV8A 4HTLA 1WBDA 1TKZA 2HHSA 2IOCA 3K5LA 3KK2A 4FK2A 1RT5A 3ZSZA 1NK5A 1P8ZA 4WFBL 1VQMN 4BE1A 4JI2K 4W5TA 1U45A 3AARA 2I5JA 3QDKA 1U6ZA 4MQ3A 4CJ3A 4YOXA 4FLXA 3ID6A 1DT9A 1KRPA 5M1PA 3EN9A 4B9MA 4M42A 3TAGA 2OA8A 2WTUA 1ATRA 1HYVA 4N56A 3L8BA 4CHZA 4BVOA 3WQUA 3CG7A 4JKGA 1NG9A 4FJHA 3CMAN 1JL1A 3AVCA 4DKWA 4JI3K 1U4BA 1C0UA 3D2EA 1QSYA 4RW7A 5M1NA 4LD0A 2VWJA 2Q3SA 4M3UA 3M3ZA 2A6AA 2RN2A 5GADP 4CF2A 4LF9K 4H0YB 3EE9A 3O6WA 4YHHK 3WT0A 4DUYK 4DF8A 4DSIA 1KTQA 1RFQA 3QESA 4O5FA 3VQ7A 4UQGA 5AQHA 3CD6N 3DXMB 3WXMB 1VSIA 1T7PA 4DR5K 2HF3A 2G8KA 2OPRA 4M45A 2Q97A 2Z1HA 1Z6RA 2QTDA 3EO3A 2A42A 4CJLA 2BUPA 4N47A 5LY3A 4B1ZA 1J53A 4FZYA 3HSCA 5F2RA 4RW9A 4CJRA 1ZBFA 4X64K 1CXUA 1HMVA 3O9RA 3P38A 1Q81O 4DU3A 5SWMA 2BGGA 5DM7L 4FM0A 4BECA 4JHDA 4DV7K 3CF5L 3V1RA 4MFBA 5HP1A 3LDLA 4WQ5A 3V81A 3K5NA 1L5UA 4BRLA 3RMDA 3KTQA 1QQCA 1UA0A 4M3RA 3WEEA 4GVMA 3CCEN 2XRIA 5CYMA 3MX2A 4FWPA 3T1YK 5C2DA 1VQLN 4YDUA 2D0CA 1OH8A 5H1SQ 5F1XA 4M3YA 2P9PB 3VQPA 4KH4A 4A57A 1D9FA 4IKFA 2FSKA 2WFBA 1S72N 4H0XB 3HM9A 4FVUA 1KAXA 1JCEA 3PIOL 4DSJA 3DLBA 1HPMA 2E2NA 1HKGA 2F8SA 3AO2A 1W0HA 4BQLA 1B9FA 3OBWA 4GNIA 4FJ9A 4BWMA 4DQ8A 3CM5A 4A5AA 4DU4A 4HCBA 2IIRA 4UY8O 2F7TA 1SKWA 2E5LK 2D1KA 4LFBK 2RF2A 3G71N 2DY4A 3QEVA 3QBWA 2G8WA 2ZWHA 3G10A 3BUZB 4DR4K 2D0PA 1FK9A 1WSHA 1LAWA 3IMXA 3LPTA 2Q36A 4GMJB 3O3FA 1B92A 4OGCA 3J7YP 4JI1K 2AJQA 1F21A 3T19A 4DS4A 3G0ZA 3P31A 4KHUA 3TI0A 4GV6A 1YF5L 2OPSA 1O13A 1WB9A 4CJ4A 4FLTA 3TANA 4BRDA 2FSNA 3U6FA 5CZ1A 2O8FB 3DI6A 3KVGA 3CCLN 3I33A 1HNWK 1HRHA 3KWIA 1X9SA 5LMUK 4BG8A 4H4OA 3GBTA 2E8AA 3THYA 5EOYA 3UE5A 3ZT2A 5GAGP 4BVPA 1WN7A 4DFMA 4CEDA 1QSSA 4IJNA 4JI6K 4O0IA 3LZJA 4E7JA 3HPOA 4CF9A 5AQQA 1S3XA 3O8MA 4R79A 5CYQA 2ZGYA 4OX9K 3ENOA 4KHQA 2BANA 3UIQA 2WUSA 4FWLA 2YV0X 1TUYA 1JLGA 1BOTO 3VQEA 3N4PA 3VA3A 2VG7A 3WXJA 4W5RA 4H4MA 4DR1K 4NYFA 3TTFA 2FC0A 1SKSA 1VRTA 4FJLA 1RDCA 5AQNA 4BGBA 3KK3A 4BR7A 5DM6L 1Q86O 2P9UB 1WUAA 1C1BA 1S6PA 4H5TA 3B6PA 4K43A 4FJIA 1BIUA 3HVTA 2HNZA 2PYJA 5KQDA 2QW9A 1GLAG 4FM1A 2ZE2A 1TKTA 1ESVA 1RT6A 4B9UA 4F4KA 4GKKK 3PUFA 4PQUA 4IG3A 3L2UA 1Q9YA 3AVAA 4CZMA 5AQZA 1KSPA 4LSLA 1WSIA 3SUOA 3K0SA 4L8RB 1KCFA 4HCCA 1JXEA 4CBXA 3HOTA 1VSLA 3C7NB 4BC4A 3CJ7A 3PV8A 4E1MA 2VQEK 5M1KA 2P9KB 2E6LA 4I2QA 2HHTA 4WYBA 1RBVA 2G8UA 1S1XA 5AZIB 2IGIA 4LF7K 4R5PA 4CJ7A 1KVAA 4FPAA 1KAZA 3VQ8A 3HPGA 2KW4A 4FJMA 1GLEG 4JLHA 1DTTA 3I8DA 5EXWA 2O8CB 1QQOA 4RG8A 1YJ9N 3KZBA 1YITN 1TK8A 3OVNA 1JCGA 3DOLA 4BRKA 3EZ5A 1RCHA 4DSEA 1VQ9N 4CJUA 3L6QA 4DQQA 4JEPA 4JYAK 2E88A 4A2BA 3CJAA 4AM7A 2E4LA 2O8DB 1VHXA 1TK5A 4DG1A 2E2PA 1ZBLA 4MO4A 1LAVA 3MAQA 3TABA 3K9KA 4J8FA 4FOIA 4M41A 3JYTA 3KIOA 4LF5K 1XHZA 3DRRA 3BGRA 4OLBA 3MN6A 2JLEA 4AM6A 5GAHP 4ICLA 5CHIA 1SS6A 3AO1A 4LF4K 3LDQA 2YJFA 2YHWA 3F73A 3DWLA 4F3TA 1XMOK 3ENHA 4K25A 3PO4A 4ID5A 4JKFA 2PBDA 4ILGB 4AHCA 4YNQA 1QZ6A 4FPBA 3SUPA 2E1ZA 4FWKA 2NRWA 4BDYA 4QAGA 3WNHA 3SAHA 3PSFA 4IWVA 4FZZA 3J7ZO 1KVCA 3THWB 2UU9K 5AQSA 4KAZA 3MWPA 3RWUA 3VEZA 2F9TA 3EL2A 4OPAA 3CM6A 1CZAN 2HF4A 1YUWA 3C6TA 3VF4A 4M3WA 1ASVA 3AAPA 5JLHA 4RW6A 3TAMA 3O3GA 1ATNA 1Q7YO 5AZJB 4ELUA 1SKRA 2HHXA 1LWEA 3OA9A 1T8EA 3O4QA 2CH6A 2HHHK 4KTQA 1KC8O 3A5NC 3K2PA 2ASMA 4B8CA 1E4GT 3L3VA 4E7IA 2CGLA 3ZEUA 3LP3A 2F4VK 1D9DA 4FVMA 1L3SA 4N41A 4ZHRA 3OS2A 3HYFA 3RSEA 3VEYA 1KFSA 2G8IA 3DM2A 3BZKA 3G6EN 1X3NA 4CFBA 1X9WA 4O8KA 2EWSA 3AVHA 4C1NI 2KLAA 4KREA 1EKEA 3M5RA 1T6DA 3Q7CA 1HYSA 4BRHA 5KQ8A 4ILJA 4DR6K 4AHSA 2G8FA 4OVLA 1IH7A 1TYQB 4GY2B 3O08A 4BRIA 3V9UA 1NKBA 3SUNA 1QHAA 1NJIO 5AQGA 5BPLA 1WBBA 2QI2A 1S9GA 1NK8A 3CC2N 5T7BA 4O4GA 4FJGA 3AO3A 3OYJA 1HLUA 3IFRA 4JRPA 3ZSYA 3THVA 2GWKA 4BR4A 1WSGA 5FPEA 5E26A 4IFVA 3D0PA 2V7ZA 1EX4A 1FW6A 1OVYA 4AQYK 1ZBHA 3K9JA 3THXA 5CY4A 2GUIA 3SBGA 3QFUA 3HXMA 4JD2B 4B1UB 4FM2A 3CQYA 3HTVA 3O9SA 4RW4A 4CD1A 3ZEUB 4OKEA 4XH5A 2HB5A 1R59O 5BN8A 3SI6A 3DLRA 1NGEA 2P9KA 3AVFA 2H3GX 1HKCA 4W5QA 3OYEA 3QICA 1KVBA 3TAQA 1NGIA 3OW2M 4FW2A 4CHOA 2YKNA 2P9IA 4C8MA 5EU7A 4JI4K 4W5OA 3UKRA 4M3XA 4E7LA 3A8YA 1NBWA 2P9PA 2VWBA 4YOWA 3ZSRA 3IS9A 4BRCA 1RDDA 3C7NA 3M8RA 3H6EA 1A5WA 1BIZA 4FWRA 1NJZA 1BL3A 4QOZB 3L2RA 5FRMA 5BN9A 5K14A 1BWFO 4CZFA 4C8OA 3ZCMA 1X9JA 2GUPA 2IC3A 1VQ6N 2WONA 4B8AB 4B1YB 1CXQA 4CK1A 5M1FA 4DR3K 4ELVA 4F2SA 2DFFA 2B4JA 4FLYA 1C6VA 1WNSA 2A1RA 3RRHA 3OYFA 3KLHA 1ZBIA 1FKPA 1NOYA 4OO1J 3JSMA 3CCVN 3LM2A 1XC3A 4CW7B 3OYAA 3HM8A 3S3NA 2B5JA 3SQ0A 2YNGA 1ZBUA 2GTDA 2GV9A
chains in the Genus database with same CATH topology
2OTLN 3O80A 3ATVA 3VGLA 2OTJN 1JJ2M 4RWTA 3D2FA 3MX2A 1NGGA 4FWPA 3FR0A 2E2OA 5C2DA 1VQLN 2KKZA 4YDUA 2C1IA 2Q2RA 4GVEA 5CR4A 3ZETB 2CH5A 2UYTA 5H1SQ 5F1XA 4BEBA 3DLLL 2QM1A 4NB4A 4CZHA 4A62A 2D4WA 4JKEA 1GLJO 1NM1A 2P9PB 4WQ4C 4A57A 1DEJA 4KH4A 3VGKA 5BR9A 5AQKA 2FSKA 2WFBA 2ITMA 2RE2A 1S72N 4H0XB 3TU5A 4NLCA 1KAXA 1JCEA 2QXLA 4RTFD 4EHTA 4WF9L 3NMUA 4FO0A 3PIOL 5AFUA 3MCAB 3O9TA 1HPMA 1NGJA 1T3VA 2E2NA 2NLXA 1HKGA 3A5MC 3FZKA 4QS8A 4BROA 1U2VA 4JKAA 4BQLA 3HBTA 5E84A 4Z94A 2FF3B 1OKJA 3OBWA 3LDNA 3N4QA 3AY9A 4GNIA 1XUPO 4XEIA 5AQRA 1YXQA 4DQ8A 4A5AA 2HSTA 5AZJA 2ASOA 2IIRA 2JWKA 4UY8O 2F7TA 1NGFA 2D1KA 3IKMA 3G71N 1K8KA 2VGMA 3D7EO 3WQTA 3QBWA 3U9DA 2ZWHA 1MA9B 3BUZB 2P9LB 2D0PA 2ZF5O 3KHYA 2FXUA 4M7YA 4YDUC 4DB3A 4WCEL 3IMXA 4ISGA 3VOVA 3CC7N 2Q36A 4BRGA 3H1VX 4CZEA 1NGHA 2ASPA 2QWOA 3FE1A 3QB0A 1YVNA 3L4IA 3T7ZA 1BG3A 3VF2A 1VQ8N 3FZHA 1K73O 1YHQN 3O5BA 4BC5A 3HZ6A 3P31A 3H45C 3RSEB 4C1NK 3I56N 4GV6A 1EO1A 1LCUA 1VQ5N 3F2KA 5BRFA 4M7XA 3S41A 1YF5L 4BGAA 1O13A 4JKBA 2HBKA 4BRMA 3WEEB 4IEIA 4ILHA 3SAFA 1VQKN 3E9OA 4BRDA 2FSNA 4A2AA 4JKDA 4BQZA 5BPMA 5BRHA 1C0FA 4PL7A 3KVGA 3EKUA 3CCLN 3I33A 3VF6A 3ZX3A 2NRTA 4CD3A 3KWIA 3AGRA 3U9ZA 1SZ2A 2AA4A 3U8XA 4B1VA 4BG8A 3GBTA 2D0OA 2E8AA 3M1FA 5EOYA 5EVZA 3UE5A 4A61A 4BR5A 3IUCA 5AQMA 4BVPA 5GAGP 3FZFA 3SBTA 1E4FT 4IJNA 4CI6A 3PLAA 5BPNA 1Y64A 5AQQA 1RDWX 1S3XA 3O8MA 4JKCA 3VEXA 3PIPL 4I6MB 3FLCO 3R9PA 4R79A 3H3NO 1MWKA 2ZGYA 4CZJA 2YJEA 3ENOA 4CZGA 5AZIA 5HOOA 4XJXA 3KK7A 3CIPA 2WUSA 3AGKA 3CERA 4FWLA 4H0TB 1TUYA 1BOTO 3MN7A 3N4PA 3J7ZO 2QA4N 1KD1O 3CQXA 3WXJA 4PKIA 4FL9A 3TTFA 4A5BA 1HKBA 5AQUA 2A41A 3SMSA 1M90O 1GLDG 2IVPA 3LDPA 3CCQN 2IVOA 3ZX0A 1ATSA 3CCUN 3CPEA 4JD2A 3IDHA 3GOIA 5AQNA 1RGIA 1ZC6A 2I7NA 3EE8A 4BGBA 1ZBSA 3FGUA 1QVFM 4BR7A 5DM6L 3UB5A 1Q86O 5KPRA 2P9UB 1K9MO 1WUAA 4JK9A 4H5TA 2WBNA 4K43A 2NZTA 3LL3A 5M1OA 5KQDA 2QW9A 3CC4N 1YI2N 1GLAG 2CGJA 2P9NA 2YHYA 2E20A 1ESVA 3CJ9A 3GG4A 4YOTA 3MDQA 3CCEN 3R3LA 3ULEA 2AP1A 3CJBA 5AQWA 3CXCM 3CCJN 1VQON 4CZMA 5AQZA 1N8RO 4G9ZA 5EX5A 2CGKA 4B1WB 4MO5A 2W40A 3CJ1A 2BH1A 3MK6A 4ISEA 4CBXA 3DAWA 2QWNA 3HOTA 4YOYA 3C7NB 4BC4A 3CJ7A 2QWQA 5AQTA 1QVGM 3H3OB 4C23A 5M1KA 4H5NA 3DJCA 3O9QA 2QWLA 5C2FA 2P9KB 4FWQA 3H1QA 3NVMA 4H0OA 3Q7BA 4I6MA 4WYBA 3A0IX 3A5LC 5AQOA 4XH1A 1NWKA 4A59A 5AZIB 3L4QA 4FWNA 3SMPA 2VYPA 2GELA 1MDUB 4CJ7A 3TSUA 5JVHL 5FPDA 5B8HA 4FPAA 1BUPA 1KAZA 1Q82O 2Q31A 4U67L 4RCHA 3SJHA 4MLHA 2P9SB 2PFUA 1GLEG 1M1KO 4JHDB 3ZYYX 5EXWA 1ZXOA 1QQOA 1YJ9N 4BR9A 3KZBA 2ZJPL 1BDGA 1YITN 3VEVA 5KPZA 1JCGA 1KAYA 4BRKA 1VQ9N 2QWMA 5LJWA 3CETA 1EQYA 3L6QA 4OPHA 4F9OA 4H0VB 2ZJRL 4JEPA 2E88A 1LOTB 4Y0WA 1TUUA 4A2BA 3CJAA 3AAQA 4AM7A 1WOQA 1Z05A 5HL7L 2IVNA 2I7PA 1QZ5A 1X3MA 2E2PA 4MO4A 3P39A 3MCPA 3C0BA 4BRPA 4EFHA 3T69A 5AR0A 4DCHA 4BC3A 4H03B 5EY4A 1DKGD 4PL8A 3VENA 3K9KA 4J8FA 3FZMA 4FOIA 3ULEB 3ZX2A 2RHKA 1XQSC 4QS9A 3MN6A 4AM6A 3E1YA 4IXCA 4FWOA 5GAHP 3W3DA 1VQPN 4WFNL 3U4LA 5JVGL 3W0LA 5CHIA 3VEWA 1SS6A 4LC9B 3LDQA 4EAHD 2YJFA 1JCFA 2YHWA 5CE3A 4IOXA 4H5WA 3DWLA 3VMFB 3F9MA 4XH4A 4GV9A 4JN4A 1QQNA 3ENHA 3GDQA 3R1XA 3R8EA 4K25A 4MDAA 1QQMA 4JKFA 4PKGA 2PBDA 1HX1A 4ILGB 3FFKB 5FPMA 1QZ6A 2W41A 3QFPA 3JXUA 4WQ5C 2A3ZA 4FPBA 2E1ZA 4DHYA 4FWKA 2NRWA 3ZETA 3TPQA 4BRQA 2E2QA 3TSQA 3SAHA 1K8KB 3B8AX 4IWVA 4HWIA 2HBLA 4NO7A 2HOEA 3HRGA 2V52B 3GL1A 1YAGA 4FWMA 4EHUA 2P9LA 5AQSA 2YI1A 1NGBA 2YX6A 4BR2A 3MWPA 2YCHA 3VEZA 2VCPA 2F9TA 1SQKA 2VGNA 3EL2A 4E1JA 3O9UA 4OPAA 3WXLA 2GWJA 3CHWA 4H5VA 5GIOA 1CZAN 1Q18A 2HF4A 3BF1A 2QWPA 2A40A 1YUWA 4BR0A 3J8AA 3ID8A 1G99A 3LDOA 1K8AO 3WXIA 1U2VB 5AQLA 5JICA 3VF4A 4JNEA 3M6GA 2YHXA 3G25A 3VGMA 3VESA 5JLHA 3AAPA 5AQXA 4WFAL 4BE7B 1T44A 1ATNA 1Q7YO 4MDBA 5AZJB 2A5XA 3GE1A 3WXKA 3E66A 3VTIA 4AF1A 5C10A 1YJWN 4FVUA 3WUHA 1V4TA 4MLEA 3VPZA 5ADXH 2FSJA 5GINA 4B9QA 1VAZA 5JLFA 1GLFO 1DGKN 4YOVA 1GLCG 3OA9A 2HMPA 3QMLA 4IO9L 3O4WA 4BY9C 4CBWA 4BG9A 2CH6A 1ILYA 1KC8O 5AQJA 4H5RA 3A5NC 1H1VA 3H46O 2NNWA 2ASMA 4PHTX 5LJVA 1E4GT 2CGLA 4FWSA 3ZEUA 1BA1A 2NRRA 4IOCL 3SAGA 5C12A 2ZGZA 2PAVA 4O8UA 3RSEA 3L0QA 4NLBA 5TKWA 1KXPA 3VEYA 3UKUB 4M63C 3CCRN 3G6EN 1X3NA 3HI0A 3BF3A 4KH5A 2EWSA 4O8KA 1V4SA 2KLAA 3CI5A 2FLOA 3MX5A 5ELZA 5AQPA 4BRNA 3M5RA 3Q7CA 1T6DA 2V7YA 1YIJN 4KBOA 4KH6A 4BRHA 3TTCA 4JKHA 5F0XA 2P9IB 5KQ8A 4CZIA 2W00A 4ILJA 1C0GA 2Q0RA 1SAZA 3VERA 4U7BA 1BA0A 1W97L 3EZWA 1TYQB 3O1BA 3O08A 4GY2B 5AQFA 3UKRB 4BRIA 3TSPA 3MN9A 3DXMA 1QHAA 1NGCA 5I9EB 1NJIO 3DXKA 1NGAA 3E9LA 5BREA 5AQGA 5FPNA 2HBJA 5AQIA 5BPLA 1D4XA 2Q1NA 4CBUA 2QI2A 4L3QA 5GAEP 3O1WA 4IZ9A 3OBYA 4CZLA 3SK3A 3CC2N 2P9UA 3CCSN 1YJNN 1HUXA 4K42A 4HTLA 5KPTA 1HLUA 3IFRA 1P8ZA 2GWKA 4WFBL 4BR4A 1VQMN 3AARA 3QBXA 3QDKA 2NRXA 1U6ZA 2J4RA 3FZLA 5FPEA 2FF6A 5AFUH 5E26A 4YOXA 4EIAA 3SLCA 3ID6A 1DT9A 3C6HA 5M1PA 3EN9A 2V7ZA 4WQ4A 5BRDA 3CJCA 4YORA 1OVYA 3CPWM 3K9JA 1BO5O 1ATRA 3SBGA 3QFUA 4IEEA 4JD2B 4BVOA 3WQUA 4JKGA 5C0YA 2JWLA 4B1UB 3OHRA 3C65A 3CMAN 1NMDA 2OANA 1BU6O 1MWMA 3P4IA 1W2BM 3CQYA 3HTVA 3O9SA 4CD1A 3ZEUB 3LM9A 5JMVA 4XH5A 4DKWA 4FOEA 1R59O 2Q0UA 3VEOA 5BN8A 5MLCQ 2QEXN 4GV3A 3D2EA 1NGEA 3G4SN 5M1NA 4PKHA 2P9KA 2F9WA 1P90A 2H3GX 3RVCA 1HKCA 3ENBA 3UKUA 3QICA 3M3ZA 2A6AA 2QWRA 2P9NB 4IOAL 4ISFA 4YOUA 1NGIA 3D2FB 3EKSA 4BRFA 5GADP 3OW2M 3MMVA 2V51B 1HJOA 5AQVA 2C1GA 4H0YB 3EE9A 3O6WA 3WT0A 2P9IA 4BC2A 2HBMA 4FSVA 1RFQA 4IJAA 4O5FA 3HOSA 1TYQA 3UKRA 1T6CA 2NRVA 3E9PA 1VQ4N 1J6ZA 5AQHA 3CD6N 2WC9A 3DXMB 3WXMB 2DPNA 3A8YA 1NBWA 2P9PA 2VWBA 4YOWA 2E1YA 2KHOA 3DXKB 2HF3A 4BRCA 3C7NA 3VTHA 3BP8A 3H6EA 2Q97A 1Z6RA 3KWGA 2QTDA 3EO3A 5AQYA 2A42A 4FWRA 2BUPA 5LY3A 5BN9A 4B1ZA 3NVKA 1S22A 1BWFO 3VETA 3CMEN 5TKYA 4JAXA 4CZFA 1VQ7N 1X9JA 2GUPA 3HSCA 5F2RA 2NRHA 1VQ6N 3A5OC 3MN5A 4B1YB 1GLLO 3O9RA 3P38A 1Q81O 3C6AA 3ATUA 4IFEA 5M1FA 2GEMA 5GIPA 1KQSM 2P9SA 5DM7L 1VQNN 1IG8A 4BREA 4JHDA 3CCMN 4BECA 1GLBG 1NLVA 3I8BA 2BTFA 4JK7A 4H0PA 4IO8A 4QS7A 5C15A 3CF5L 3D6RA 4C1NI 1RDUA 4JK8A 4JKGB 3I55N 3LDLA 4IDHA 2ZJQL 4WQ5A 4CZKA 3F5TA 4OO1J 3BEXA 3LM2A 5M1QA 3CCVN 3TTDA 3R6MA 4K41A 4B1XB 1XC3A 4BRLA 1NGDA 3MWTA 3HM8A 5ADXA 4BRAA 2GX9A 3D2EB 3JS6A 2NRZA 2GTDA 1IJJA 3WEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O80 A;  3ATV A;  3VGL A;  4RWT A;  3D2F A;  4FWP A;  1NGG A;  3FR0 A;  2E2O A;  4YDU A;  2Q2R A;  3ZET B;  2CH5 A;  2UYT A;  5F1X A;  2QM1 A;  4NB4 A;  4CZH A;  4A62 A;  2D4W A;  1GLJ O;  1NM1 A;  2P9P B;  4WQ4 C;  1DEJ A;  3VGK A;  5BR9 A;  5AQK A;  2FSK A;  2ITM A;  4H0X B;  3TU5 A;  4EHT A;  1KAX A;  1JCE A;  2QXL A;  4RTF D;  4FO0 A;  5AFU A;  1HPM A;  1NGJ A;  2E2N A;  2NLX A;  3A5M C;  1HKG A;  4BRO A;  3FZK A;  4QS8 A;  1U2V A;  4BQL A;  3HBT A;  5E84 A;  4Z94 A;  2FF3 B;  1OKJ A;  4GNI A;  3LDN A;  3AY9 A;  1XUP O;  4XEI A;  5AQR A;  1YXQ A;  4DQ8 A;  5AZJ A;  2ASO A;  2IIR A;  1NGF A;  2D1K A;  1K8K A;  3D7E O;  3WQT A;  3QBW A;  3U9D A;  2ZWH A;  1MA9 B;  3BUZ B;  2P9L B;  2D0P A;  2ZF5 O;  3KHY A;  2FXU A;  4M7Y A;  4YDU C;  4DB3 A;  3IMX A;  4ISG A;  3VOV A;  2Q36 A;  4BRG A;  3H1V X;  4CZE A;  1NGH A;  2ASP A;  2QWO A;  3FE1 A;  3QB0 A;  1YVN A;  3L4I A;  3VF2 A;  1BG3 A;  3FZH A;  3O5B A;  4BC5 A;  3HZ6 A;  3H45 C;  3RSE B;  1LCU A;  5BRF A;  4M7X A;  3S41 A;  4BGA A;  4BRM A;  3WEE B;  4BRD A;  2FSN A;  4A2A A;  5BPM A;  4BQZ A;  5BRH A;  1C0F A;  4PL7 A;  3KVG A;  3EKU A;  3I33 A;  3VF6 A;  3ZX3 A;  4CD3 A;  3U9Z A;  1SZ2 A;  2AA4 A;  3U8X A;  4B1V A;  4BG8 A;  3GBT A;  2D0O A;  2E8A A;  3M1F A;  5EOY A;  5EVZ A;  3UE5 A;  4A61 A;  4BR5 A;  3IUC A;  5AQM A;  4BVP A;  3FZF A;  1E4F T;  4IJN A;  4CI6 A;  5BPN A;  1Y64 A;  5AQQ A;  1RDW X;  1S3X A;  3O8M A;  3VEX A;  4I6M B;  3FLC O;  3R9P A;  3H3N O;  1MWK A;  2ZGY A;  4CZJ A;  2YJE A;  3ENO A;  4CZG A;  5AZI A;  3CIP A;  2WUS A;  3CER A;  4FWL A;  4H0T B;  1TUY A;  1BOT O;  3MN7 A;  3CQX A;  3WXJ A;  4PKI A;  4FL9 A;  1HKB A;  5AQU A;  2A41 A;  3SMS A;  1GLD G;  2IVP A;  3LDP A;  2IVO A;  3ZX0 A;  1ATS A;  4JD2 A;  3IDH A;  3GOI A;  5AQN A;  1RGI A;  1ZC6 A;  2I7N A;  4BGB A;  1ZBS A;  3FGU A;  4BR7 A;  3UB5 A;  5KPR A;  2P9U B;  1WUA A;  4H5T A;  4K43 A;  2NZT A;  3LL3 A;  5KQD A;  2QW9 A;  1GLA G;  2CGJ A;  2P9N A;  2YHY A;  2E20 A;  1ESV A;  3CJ9 A;  3GG4 A;  3MDQ A;  3ULE A;  2AP1 A;  3CJB A;  5AQW A;  4CZM A;  5AQZ A;  5EX5 A;  2CGK A;  4B1W B;  4MO5 A;  2W40 A;  3CJ1 A;  3MK6 A;  4ISE A;  4CBX A;  3DAW A;  2QWN A;  3C7N B;  4BC4 A;  3CJ7 A;  2QWQ A;  5AQT A;  3H3O B;  4C23 A;  4H5N A;  3DJC A;  2QWL A;  2P9K B;  4FWQ A;  3H1Q A;  4H0O A;  4I6M A;  4WYB A;  3A0I X;  3A5L C;  5AQO A;  4XH1 A;  1NWK A;  5AZI B;  4FWN A;  3SMP A;  2VYP A;  2GEL A;  1MDU B;  4CJ7 A;  5FPD A;  5B8H A;  4FPA A;  1BUP A;  1KAZ A;  2Q31 A;  4RCH A;  3SJH A;  4MLH A;  2P9S B;  1GLE G;  4JHD B;  5EXW A;  1ZXO A;  1QQO A;  4BR9 A;  3KZB A;  1BDG A;  3VEV A;  5KPZ A;  1JCG A;  1KAY A;  4BRK A;  2QWM A;  5LJW A;  3CET A;  1EQY A;  3L6Q A;  4F9O A;  4H0V B;  2E88 A;  1LOT B;  4Y0W A;  1TUU A;  4A2B A;  3CJA A;  3AAQ A;  4AM7 A;  1WOQ A;  1Z05 A;  2IVN A;  2I7P A;  1QZ5 A;  1X3M A;  2E2P A;  4MO4 A;  3MCP A;  3C0B A;  4BRP A;  4EFH A;  5AR0 A;  4DCH A;  4BC3 A;  4H03 B;  5EY4 A;  1DKG D;  4PL8 A;  3VEN A;  4J8F A;  3ULE B;  3FZM A;  4FOI A;  3ZX2 A;  1XQS C;  4QS9 A;  3MN6 A;  4AM6 A;  4IXC A;  4FWO A;  3W3D A;  3U4L A;  3W0L A;  3VEW A;  4LC9 B;  3LDQ A;  4EAH D;  2YJF A;  1JCF A;  2YHW A;  5CE3 A;  4H5W A;  3DWL A;  3F9M A;  4XH4 A;  4JN4 A;  1QQN A;  3ENH A;  3GDQ A;  3R8E A;  4K25 A;  1QQM A;  4PKG A;  2PBD A;  1HX1 A;  3FFK B;  5FPM A;  1QZ6 A;  2W41 A;  3QFP A;  3JXU A;  4WQ5 C;  2A3Z A;  4FPB A;  2E1Z A;  4DHY A;  4FWK A;  3ZET A;  3TPQ A;  4BRQ A;  2E2Q A;  1K8K B;  3B8A X;  4IWV A;  4HWI A;  4NO7 A;  4CZK A;  2HOE A;  4FWM A;  2V52 B;  3GL1 A;  1YAG A;  4EHU A;  2P9L A;  5AQS A;  2YI1 A;  1NGB A;  4BR2 A;  2YCH A;  3VEZ A;  2VCP A;  2F9T A;  1SQK A;  4E1J A;  3EL2 A;  3WXL A;  2GWJ A;  3CHW A;  4H5V A;  1CZA N;  1Q18 A;  2HF4 A;  2QWP A;  3BF1 A;  2A40 A;  1YUW A;  4BR0 A;  3J8A A;  3ID8 A;  1G99 A;  3LDO A;  3WXI A;  1U2V B;  5AQL A;  5JIC A;  3VF4 A;  4JNE A;  3M6G A;  2YHX A;  3G25 A;  3VGM A;  3VES A;  5JLH A;  3AAP A;  5AQX A;  1T44 A;  1ATN A;  5AZJ B;  2A5X A;  3GE1 A;  3WXK A;  3WUH A;  1V4T A;  4MLE A;  3VPZ A;  5ADX H;  2FSJ A;  4B9Q A;  5JLF A;  1GLF O;  1DGK N;  1GLC G;  3QML A;  2HMP A;  3O4W A;  4CBW A;  4BG9 A;  2CH6 A;  5AQJ A;  4H5R A;  3A5N C;  1H1V A;  3H46 O;  2ASM A;  5LJV A;  1E4G T;  2CGL A;  4FWS A;  3ZEU A;  1BA1 A;  2ZGZ A;  2PAV A;  3RSE A;  3L0Q A;  1KXP A;  3VEY A;  3UKU B;  4M63 C;  1X3N A;  3HI0 A;  3BF3 A;  4O8K A;  2EWS A;  5ELZ A;  1V4S A;  3CI5 A;  5AQP A;  2FLO A;  4BRN A;  1T6D A;  2V7Y A;  4KBO A;  4BRH A;  5F0X A;  5KQ8 A;  2P9I B;  4CZI A;  1C0G A;  2Q0R A;  1SAZ A;  3VER A;  1BA0 A;  4BRF A;  3EZW A;  1TYQ B;  3O1B A;  3O08 A;  4GY2 B;  5AQF A;  3UKR B;  4BRI A;  3MN9 A;  3DXM A;  1QHA A;  1NGC A;  5I9E B;  3DXK A;  1NGA A;  5BRE A;  5AQG A;  5FPN A;  5AQI A;  5BPL A;  1D4X A;  2Q1N A;  4CBU A;  4L3Q A;  3O1W A;  4IZ9 A;  4CZL A;  3SK3 A;  2P9U A;  1HUX A;  4K42 A;  4HTL A;  5KPT A;  1HLU A;  3IFR A;  1P8Z A;  2GWK A;  4BR4 A;  3AAR A;  3QBX A;  3QDK A;  1U6Z A;  2J4R A;  3FZL A;  5FPE A;  2FF6 A;  5AFU H;  5E26 A;  4EIA A;  3SLC A;  3EN9 A;  2V7Z A;  4WQ4 A;  5BRD A;  3CJC A;  1BO5 O;  1ATR A;  3QFU A;  4JD2 B;  4BVO A;  3WQU A;  4B1U B;  3OHR A;  1NMD A;  2OAN A;  1BU6 O;  1MWM A;  3P4I A;  3CQY A;  3HTV A;  4CD1 A;  3ZEU B;  3LM9 A;  5JMV A;  4XH5 A;  4FOE A;  1R59 O;  2Q0U A;  3VEO A;  5BN8 A;  3D2E A;  1NGE A;  4PKH A;  2P9K A;  2F9W A;  2H3G X;  1HKC A;  3UKU A;  3QIC A;  3M3Z A;  2A6A A;  2QWR A;  2P9N B;  4ISF A;  1NGI A;  3D2F B;  3EKS A;  3MMV A;  2V51 B;  1HJO A;  5AQV A;  4H0Y B;  3O6W A;  3WT0 A;  2P9I A;  4BC2 A;  4FSV A;  1RFQ A;  4IJA A;  4O5F A;  1TYQ A;  3UKR A;  1T6C A;  1J6Z A;  5AQH A;  3DXM B;  2DPN A;  3A8Y A;  1NBW A;  2P9P A;  2VWB A;  2E1Y A;  2KHO A;  3DXK B;  2HF3 A;  4BRC A;  3C7N A;  3BP8 A;  3H6E A;  2Q97 A;  1Z6R A;  3EO3 A;  5AQY A;  2A42 A;  4FWR A;  2BUP A;  5LY3 A;  5BN9 A;  4B1Z A;  1S22 A;  1BWF O;  3VET A;  5TKY A;  4JAX A;  4CZF A;  1X9J A;  2GUP A;  3HSC A;  5F2R A;  2NRH A;  3A5O C;  3MN5 A;  4B1Y B;  1GLL O;  3ATU A;  2GEM A;  2P9S A;  1IG8 A;  4BRE A;  4JHD A;  1GLB G;  1NLV A;  3I8B A;  2BTF A;  4H0P A;  4IO8 A;  4QS7 A;  3LDL A;  4WQ5 A;  3BEX A;  3LM2 A;  3R6M A;  4K41 A;  4B1X B;  1XC3 A;  4BRL A;  1NGD A;  3HM8 A;  5ADX A;  4BRA A;  3D2E B;  3JS6 A;  2GTD A;  1IJJ A;  3WEE A; 
#chains in the Genus database with same CATH topology
 2OTL N;  3L2W A;  3O80 A;  2VG5 A;  3ATV A;  1ITG A;  3VGL A;  2Z1I A;  3ISN C;  4RWT A;  1NJY A;  3FR0 A;  4KO0 A;  2X78 A;  3V9Z A;  1QHT A;  1RBT A;  4GVE A;  2F96 A;  4NB4 A;  4CZH A;  4Z4C A;  4M3T A;  3VGK A;  1TKD A;  3VA0 A;  2RE2 A;  4BDP A;  3TU5 A;  4NLC A;  3NMU A;  5KGX A;  1IV0 A;  4FO0 A;  4OLA A;  2GBZ A;  2ZD1 A;  4CEB A;  4DTP A;  4BRO A;  2NLX A;  4JKA A;  1SL1 A;  1QSL A;  3T1H K;  1G15 A;  3N4Q A;  1XUP O;  4XEI A;  5AQR A;  4J2D A;  2JWK A;  1K8K A;  2VGM A;  1RBS A;  3V9X A;  3L2V A;  2KZZ A;  2P9L B;  2ZF5 O;  4WCE L;  4CEF A;  3CC7 N;  3VOV A;  4BRG A;  3TAE A;  3S5T A;  2QWO A;  4Q0B A;  3L4I A;  4C8K A;  3RSE B;  4HUG A;  1EO1 A;  4IFY A;  1N36 K;  1VQ5 N;  3DLK A;  5BRF A;  3S41 A;  1XHX A;  4DQR A;  3TR8 A;  1OH5 A;  3CFR A;  1IKV A;  4IEI A;  4ILH A;  4KHS A;  3SAF A;  1E3M A;  3E9O A;  1SL0 A;  1HNV A;  4DF4 A;  3ZX3 A;  4CD3 A;  3AGR A;  1OH6 A;  2AA4 A;  2D0O A;  3IUC A;  3ZSO A;  3FZF A;  1E4F T;  4DV2 K;  4CI6 A;  4DFJ A;  2ZM6 K;  5BPN A;  1Y64 A;  3AA2 A;  3PIP L;  3VEX A;  4I6M B;  3EY1 A;  3HL8 A;  3H3N O;  4CZJ A;  2YJE A;  4DSF A;  4N76 A;  4XJX A;  5DK5 A;  4CHY A;  5HRO A;  3AGK A;  4CFC A;  3CER A;  2RKI A;  1NK0 A;  4BWJ A;  5SZT A;  2QA4 N;  1KD1 O;  4PKI A;  4FL9 A;  1RTH A;  5CZ2 A;  4GW6 A;  5AQU A;  3IG1 A;  3SMS A;  1M90 O;  2O8C A;  4HUE A;  3ZX0 A;  4ZTF A;  3OS0 A;  1EP4 A;  1ZC6 A;  2I7N A;  3LZI A;  1ZBS A;  1KLM A;  4J2E A;  5KPR A;  3AV9 A;  2WBN A;  1BQN A;  1L3V A;  2NZT A;  1XI1 A;  2EX3 A;  3CC4 N;  1JLC A;  1TAU A;  1YI2 N;  3OYL A;  4CEA A;  4B9T A;  3HPH A;  1JLB A;  1TV6 A;  3GG4 A;  5JS2 A;  3BY5 A;  3MDQ A;  3AO5 A;  1NU0 A;  3CXC M;  1VSK A;  3VQ5 A;  3CCJ N;  2DFE A;  1VQO N;  1N8R O;  2E6M A;  1HNZ K;  4B1W B;  1D8Y A;  5J2P A;  3DAW A;  2QWN A;  4X62 K;  1FKO A;  2PY5 A;  3SZ2 A;  4FK0 A;  4RW8 A;  4E3S A;  5AQT A;  3RR8 A;  3O9Q A;  2QWL A;  3H1Q A;  1HR0 K;  4CJK A;  4XH1 A;  3MEE A;  4FWN A;  4QCL A;  2XY8 A;  2X6S A;  4KKO A;  5FPD A;  3QNN A;  3TAF A;  4RCH A;  1NKC A;  3SJH A;  4MLH A;  1J9A A;  1S1T A;  4CGI A;  1IO2 A;  3VQC A;  1ZXO A;  3DLE A;  4DQP A;  2ZJP L;  3NH1 A;  3VEV A;  4FCY A;  5KPZ A;  3OYI A;  1WAF A;  2W6L A;  1EQY A;  2ZJR L;  4H0V B;  3CYM A;  4C8N A;  3NAE A;  3LDS A;  4Y0W A;  3HK2 A;  1NK4 A;  4CHP A;  4DWI A;  5LL6 Z;  3VQD A;  2P5O A;  3KD1 E;  4JI5 K;  4AH9 A;  1QZ5 A;  1X3M A;  4CJF A;  2HHV A;  1JLF A;  3S3M A;  4EFH A;  5AR0 A;  3WNE A;  4BC3 A;  1NMN A;  4H03 B;  4DCH A;  1DKG D;  4PL8 A;  3VEN A;  4LFA K;  3NF8 A;  3NH2 A;  3FZM A;  4O44 A;  3ZX2 A;  3SUQ A;  1XC9 A;  5D3G A;  1Q8I A;  4FWO A;  4FLU A;  1VQP N;  2DTU A;  4LY7 A;  3U4L A;  5JVG L;  3W0L A;  3VEW A;  1QS4 A;  4LC9 B;  4IOX A;  1VSD A;  3F9M A;  4KTW A;  3GDQ A;  2WOM A;  1W9H A;  3NCI A;  1QQM A;  2BE2 A;  3AVM A;  1HX1 A;  3SPZ A;  4FLW A;  2UXD K;  3JXU A;  4WQ5 C;  1L3U A;  4F8R A;  3K57 A;  3ZET A;  3TPQ A;  4BRQ A;  2E2Q A;  3TSQ A;  2HVH A;  5BR8 K;  4CZK A;  5IT9 O;  4FWM A;  4BAC A;  2V52 B;  1TVR A;  1O1W A;  5HRN A;  4KHP K;  2YX6 A;  4BR2 A;  1J54 A;  4CJE A;  4K8X A;  2VCP A;  2VGN A;  3O9U A;  3SJJ A;  2FBT A;  3OYH A;  3WXL A;  4H5V A;  5GIO A;  4B3T K;  1YVU A;  2QWP A;  2A40 A;  1TGO A;  3J8A A;  1G99 A;  3PSI A;  1K8A O;  1I94 K;  5JIC A;  3K59 A;  3M6G A;  3G25 A;  3VGM A;  3F9K A;  3VES A;  3KKR A;  1OH7 A;  3GE1 A;  4AF1 A;  1YJW N;  3V1Q A;  1IKX A;  5ADX H;  4B9Q A;  1VAZ A;  4JS5 A;  5JLF A;  1DGK N;  3THX B;  3QML A;  4TSX A;  2OPQ A;  3O4W A;  1RIL A;  3ZSV A;  1LWF A;  2UUA K;  3PO5 A;  4BDZ A;  4PHT X;  3LP2 A;  3QIO A;  4FWS A;  1L3T A;  4CGF A;  1EWQ A;  3KLE A;  3M8Q A;  3DMJ A;  5TKW A;  1KXP A;  4I9Q A;  4IG0 A;  3UKU B;  1IKW A;  4M63 C;  4CJS A;  3DRS A;  3KLI A;  3HI0 A;  1U48 A;  5E41 A;  5ELZ A;  1V4S A;  1YIJ N;  2OYQ A;  4KBO A;  3TTC A;  2W00 A;  2P9I B;  4CIG A;  4I9L A;  1SAZ A;  3C6U A;  2O8F A;  2A1S A;  3VER A;  1RT4 A;  1W97 L;  4BRF A;  3EZW A;  5AQF A;  3B6O A;  3MN9 A;  3DXM A;  1BI4 A;  3AO4 A;  4B9L A;  3DXK A;  2D0B A;  4KB0 A;  3LWL A;  4L3Q A;  4IZ9 A;  4CZL A;  1RDA A;  2P9U A;  1YJN N;  4E89 A;  1WSE A;  3M8P A;  4EP5 A;  3MXI A;  3U3Y A;  2NRX A;  2J4R A;  3FZL A;  3T3F A;  2QKK A;  2XY7 A;  3SLC A;  3ULD A;  4IDK A;  4WQ4 A;  3U3G A;  5BRD A;  3CJC A;  4YOR A;  5HRP A;  3CPW M;  1GOA A;  1BO5 O;  2IS3 A;  4IEE A;  3BZC A;  1NKE A;  4B08 A;  5C0Y A;  3AVK A;  3OHR A;  3C65 A;  3QEW A;  1BU6 O;  1YTA A;  3P4I A;  1JL2 A;  4OJR A;  3VQA A;  3PX0 A;  3HO1 A;  3LM9 A;  3QIP A;  4CGD A;  4FOE A;  5I42 A;  5MLC Q;  4CEE A;  3VQQ A;  4GV3 A;  5JEN A;  3QET A;  2F9W A;  4KHY A;  1P90 A;  3RVC A;  3ENB A;  3UKU A;  5KI6 A;  2QWR A;  2P9N B;  1T05 A;  3EKS A;  1XMQ K;  3MMV A;  2C1G A;  4K0K K;  4FXD A;  4BC2 A;  3OYC A;  1BQM A;  3SQ2 A;  3HOS A;  4Z0U A;  1T6C A;  2NRV A;  1J6Z A;  5FLX O;  1BI4 B;  2KHO A;  1ZYQ A;  3VTH A;  4K8Z A;  3BP8 A;  1RT1 A;  1TKX A;  2IDO A;  4BE2 A;  4LF6 K;  3KWG A;  5AQY A;  1U04 A;  1UOC A;  3CME N;  3VET A;  5I3U A;  1Z25 A;  1VSF A;  4JAX A;  1VQ7 N;  1C1A A;  4E1N A;  4KHN A;  4DUZ K;  1GLL O;  4O55 A;  4IFE A;  1RTJ A;  2GEM A;  4CVN E;  4GKJ K;  1KQS M;  3ZSW A;  1IG8 A;  3J81 O;  4H0P A;  1RDU A;  4JK8 A;  4DV1 K;  4CIF A;  5IWA K;  4JKG B;  3I55 N;  4IDH A;  1REV A;  3TWH A;  3BEX A;  1TL1 A;  3R6M A;  4K41 A;  4B1X B;  1WSF A;  2UXB K;  4KTZ A;  3MWT A;  4BRA A;  3FFI A;  2GX9 A;  3D2E B;  3P83 D;  2Y1I A;  3JS6 A;  2O8D A;  1IJJ A;  4Z4F A;  1EXQ A;  5AJ3 K;  2OTJ N;  2RPI A;  1JJ2 M;  3SCX A;  4LF8 K;  3NBP A;  1RNH A;  1RT2 A;  4DR2 K;  1N5Y A;  3ZET B;  2CH5 A;  3RR7 A;  2UYT A;  3ZSQ A;  2VQF K;  1WLJ A;  4BEB A;  2QM1 A;  4JKE A;  4Z4H A;  1N33 K;  1GLJ O;  4WE1 A;  2QXF A;  1NM1 A;  3EYZ A;  5BR9 A;  2O8B B;  4EHT A;  2QXL A;  2G8H A;  1HQU A;  5AFU A;  2HHW A;  3RMB A;  2OZS A;  3O9T A;  3A5M C;  5HRS A;  1U2V A;  2D0A A;  5E84 A;  4Z94 A;  2FF3 B;  1OKJ A;  4Z4E A;  3AY9 A;  2O8E A;  1BCM A;  2ASO A;  4CF1 A;  1T03 A;  3D7E O;  3WQT A;  4LFC K;  3U9D A;  1MA9 B;  4M7Y A;  1SUQ A;  4YDU C;  4DB3 A;  4X66 K;  3C95 A;  4ISG A;  4F2R A;  3H1V X;  1NGH A;  3FE1 A;  4ZTJ A;  2YNI A;  3T7Z A;  1BG3 A;  1S5J A;  3DRP A;  4DQS A;  4BC5 A;  4DFP A;  3HZ6 A;  4DLE A;  3I56 N;  1LCU A;  3F2K A;  4M7X A;  4AHV A;  4BGA A;  3PX6 A;  2HBK A;  2HVI A;  4DTN A;  3ZT4 A;  3DLH A;  4EZ9 A;  1XWL A;  2VWK A;  5KRT A;  1SV5 A;  5J1E A;  4A2A A;  4BQZ A;  3VQ4 A;  5BRH A;  4EZ6 A;  1C0F A;  4PL7 A;  1HNI A;  3U8X A;  3OYM A;  3SBT A;  2PYL A;  4CER A;  1RBR A;  1RDW X;  4JKC A;  4V19 S;  3FLC O;  4CZG A;  4B9V A;  3A2F A;  3AVL A;  4M3Z A;  4HTU A;  3LWM A;  2O8E B;  4NCA A;  3MN7 A;  1B9D A;  3O4N A;  3CQX A;  3KKS A;  4E72 A;  4KI4 A;  2W6K A;  3QEP A;  4J2A A;  4A5B A;  4LSN A;  4I7F A;  2IVP A;  3CCQ N;  3LDP A;  2IVO A;  3CCU N;  4JD2 A;  3IDH A;  4DTO A;  3FGU A;  1QVF M;  1K9M O;  3NF9 A;  2VG6 A;  1BGX T;  4KI6 A;  1X9M A;  1JLA A;  2ATQ A;  4KRF A;  3CJ9 A;  1UAX A;  2W42 A;  1A5X A;  2QKB A;  1LV5 A;  3R3L A;  3ULE A;  2AP1 A;  4PWD A;  5AQW A;  4G9Z A;  4E0D A;  1YTU A;  4OGE A;  1XNR K;  2CGK A;  3ZT3 A;  4NCB A;  4YOY A;  1SL2 A;  4CGG A;  4CJ5 A;  2QWQ A;  3LAK A;  3P5J A;  4DS5 A;  1QVG M;  4C23 A;  3DJC A;  4FWQ A;  4H0O A;  3Q7B A;  3A0I X;  2XO7 A;  3AVG A;  3SNN A;  1NWK A;  2NUB A;  4X65 K;  2HHU A;  3L4Q A;  3SMP A;  3NFA A;  3AVJ A;  4CEZ A;  2DFH A;  2GEL A;  1MDU B;  2VYP A;  3S3O A;  3PY8 A;  2P51 A;  1BUP A;  3TAP A;  1TL3 A;  1Q82 O;  2D5R A;  1M1K O;  1CZ9 A;  3ZYY X;  2HNY A;  4BR9 A;  4CCH A;  1BDG A;  1UWB A;  4DMN A;  3JAM O;  3RRG A;  3O3H A;  1KAY A;  3HVR A;  2QWM A;  1KFD A;  3AVB A;  4F9O A;  4CES A;  3AAQ A;  1Z05 A;  5HL7 L;  4DR7 K;  1WAJ A;  2IVN A;  1WSJ A;  1VSH A;  1NK9 A;  3P39 A;  3MCP A;  4BRP A;  4XIU A;  3NDK A;  2UUB K;  4CEO A;  3AA5 X;  4JV5 K;  1IBK K;  3CFP A;  4KFB A;  2RHK A;  4CGH A;  3E1Y A;  4IXC A;  3W3D A;  4JS4 A;  4KB1 A;  2XY5 A;  1JCF A;  4YFU A;  5CE3 A;  4F3O A;  3VMF B;  4XH4 A;  1QQN A;  3R1X A;  5HLF A;  1J5O A;  3CFO A;  1NOZ A;  4FJN A;  1DLO A;  2IAJ A;  4FJ8 A;  4FJ7 A;  4NYN A;  4E19 A;  2P5G A;  4DHY A;  3MED A;  3ZT1 A;  3B8A X;  4HWI A;  2HBL A;  4O5B A;  2HOE A;  3HRG A;  3SQ1 A;  4CK3 A;  1YAG A;  4EHU A;  3QLH A;  2P9L A;  2YI1 A;  1S9E A;  1HJR A;  1NGB A;  4FLV A;  3S9H A;  1HPZ A;  2O8B A;  1SQK A;  1NJW A;  4Y1D A;  2GWJ A;  4DTM A;  3M8S A;  4CJV A;  3LDO A;  5C42 A;  4CHN A;  5AQL A;  3KLG A;  2O4I A;  5AQX A;  4WFA L;  1C0M A;  5C10 A;  2A5X A;  3WXK A;  3VTI A;  4KHW A;  3WUH A;  1V4T A;  4MLE A;  2FSJ A;  4CEC A;  1GLF O;  4E7H A;  1GLC G;  2XHB A;  4BG9 A;  1RT3 A;  5AQJ A;  4I2P A;  4NXN K;  1BA1 A;  4AHT A;  4CJW A;  4IOC L;  3SAG A;  4B3S K;  5C12 A;  2ZGZ A;  3LPU A;  1RBU A;  4FZX C;  4O8U A;  4CJT A;  4NLB A;  3MEC A;  3CCR N;  4CHQ A;  3SV3 A;  5C24 A;  4BRN A;  3CI5 A;  3MXJ A;  1DTQ A;  3OYG A;  1JKH A;  2V7Y A;  4KH6 A;  2HHI A;  4CJP A;  1C0G A;  2Q0R A;  4HVJ A;  4U7B A;  3UKR B;  3O1B A;  3LAL A;  3TSP A;  3K5O A;  3EEQ A;  3J80 O;  1FXX A;  5I9E B;  5J2N A;  1BCO A;  1HQE A;  3AA4 A;  5FPN A;  2HBJ A;  5AQI A;  2QK9 A;  1JLQ A;  4DSK A;  5A2Q O;  1D4X A;  2Q1N A;  4CBU A;  5GAE P;  3O1W A;  2OZM A;  3CCS N;  3V9W A;  1HUX A;  1VSJ A;  4K42 A;  4LH4 A;  5KPT A;  3IAY A;  3DOK A;  3KD5 E;  3SQ4 A;  3QBX A;  3V1O A;  2FF6 A;  5AFU H;  3ALY A;  4EIA A;  4HHT A;  1KLN A;  2O4G A;  2ZQB A;  1EET A;  3C6H A;  4FW1 A;  3RTV A;  1NNE A;  1EWR A;  3E01 A;  4Z4I A;  2JWL A;  3J7A P;  1NMD A;  2OAN A;  1MWM A;  1W2B M;  2JGU A;  2Y1J A;  4CEQ A;  5JMV A;  2QEX N;  3VEO A;  2Q0U A;  2UXC K;  3G4S N;  4PKH A;  4AIL C;  2KZM A;  3NH0 A;  4IOA L;  4ISF A;  3LAN A;  4YOU A;  3D2F B;  2V51 B;  1HJO A;  2YNH A;  3DLG A;  3I0R A;  5AQV A;  4DV5 K;  2HBM A;  4Z4G A;  4FSV A;  4IJA A;  1TYQ A;  3E9P A;  1VQ4 N;  4CK2 A;  2WC9 A;  2DPN A;  2E1Y A;  3DXK B;  2FBY A;  3WNG A;  1S1W A;  2P1J A;  3PX4 A;  1S22 A;  2X6N A;  5TKY A;  2HMI A;  2YHB A;  4CF8 A;  3LP1 A;  5JS1 A;  2NRH A;  3A5O C;  3SPY A;  3MN5 A;  1VRU A;  4CE9 A;  4CFD A;  3C6A A;  3ATU A;  2EHG A;  5GIP A;  1NJX A;  4NCG A;  1LWC A;  2P9S A;  1TK0 A;  1VQN N;  3CCM N;  4BRE A;  1GLB G;  1NLV A;  3I8B A;  4CGJ A;  2BTF A;  4JK7 A;  3ASM A;  4IO8 A;  4QS7 A;  5C15 A;  3D6R A;  3HP6 A;  1XNQ K;  4DV0 K;  5HRR A;  4AHU A;  3AVI A;  1Z26 A;  2ZJQ L;  3F5T A;  3NHG A;  1X1P A;  5J2M A;  5M1Q A;  4C8L A;  3TTD A;  1HYZ A;  3HST B;  1NGD A;  1LW0 A;  5ADX A;  3NGI A;  2NRZ A;  3AVN A;  3LP0 A;  3D2F A;  1NGG A;  2E2O A;  2KKZ A;  4PUO A;  2C1I A;  2LSN A;  2Q2R A;  5CR4 A;  3NE6 A;  2HW3 A;  2G8V A;  3DLL L;  2YNF A;  3THY B;  4A62 A;  2D4W A;  4B9S A;  4WQ4 C;  1DEJ A;  3OS1 A;  5AQK A;  2ITM A;  2PZS A;  4WF9 L;  4RTF D;  3MCA B;  1Q9X A;  1CLQ A;  1NGJ A;  1T3V A;  3FZK A;  4QS8 A;  5FDL A;  1N6Q A;  3HBT A;  2ETJ A;  3LDN A;  1QE1 A;  4FLZ A;  1YXQ A;  4AHR A;  2HST A;  3ITH A;  5AZJ A;  1NGF A;  3IKM A;  4CFA A;  4ELT A;  3MEG A;  4FYD A;  1S6Q A;  4DV4 K;  1VK0 A;  3KHY A;  2FXU A;  1HNX K;  1S1V A;  4OPK A;  4CZE A;  2ASP A;  3QB0 A;  4FJK A;  1YVN A;  3VF2 A;  1VQ8 N;  3FZH A;  1K73 O;  1YHQ N;  3O5B A;  4DSL A;  3H45 C;  3LAM A;  4C1N K;  3QO9 A;  3OYK A;  4JKB A;  4BRM A;  3WEE B;  4EP4 A;  4O0J A;  4LH5 A;  2BDP A;  1C0T A;  3NF6 A;  1YT3 A;  1VQK N;  2KQ2 A;  4JKD A;  5BPM A;  4DQI A;  1NK6 A;  3EKU A;  3VF6 A;  2NRT A;  1IBM K;  4J2B A;  1JLE A;  3U9Z A;  1SZ2 A;  4B1V A;  3M1F A;  1D5A A;  5EVZ A;  4A61 A;  4BR5 A;  5AQM A;  3PLA A;  1ASW A;  4JI8 K;  4CJQ A;  3R9P A;  3I0S A;  4JI0 K;  3K58 A;  1MWK A;  3OY9 A;  2X74 A;  5AZI A;  5HOO A;  4OPJ A;  4JRQ A;  3KK7 A;  3CIP A;  3IRX A;  4B9N A;  3MXM A;  1A5V A;  4FK4 A;  4H0T B;  1VSE A;  3BDP A;  3QEI A;  4CIE A;  1RT7 A;  1HKB A;  3H08 A;  2A41 A;  1GLD G;  3T1A A;  3NF7 A;  1ATS A;  3CPE A;  3GOI A;  3CQ8 A;  1RGI A;  3EE8 A;  4DTR A;  3DYA A;  3UB5 A;  2UUC K;  4JK9 A;  2OPP A;  3LL3 A;  3OYD A;  1CZB A;  5M1O A;  1N34 K;  5C25 A;  4KPY A;  2HHQ A;  1I39 A;  1ASU A;  3V4I A;  2CGJ A;  2P9N A;  1S1U A;  2YHY A;  2E20 A;  3CYG A;  4YOT A;  3CJB A;  3K5M A;  1NK7 A;  2B6A A;  2R7Y A;  3QEX A;  5EX5 A;  4MO5 A;  2W40 A;  2BH1 A;  3CJ1 A;  3MK6 A;  4ISE A;  4FJ5 A;  3H3O B;  3KK1 A;  4H5N A;  3OJU A;  5C2F A;  3RMA A;  1N32 K;  3NVM A;  4Q5V A;  4I6M A;  3A5L C;  2XY6 A;  1LW2 A;  1J5E K;  5AQO A;  3V9S A;  4A59 A;  3C94 A;  3AA3 A;  2YKM A;  3TSU A;  5JVH L;  5B8H A;  1MU2 A;  4OKK A;  1K6Y A;  3HJF A;  2Q31 A;  4DTJ A;  4U67 L;  3THW A;  2P9S B;  2PFU A;  3QIN A;  4JHD B;  3KLF A;  1I3A A;  4PY5 A;  4B3O A;  5KRS A;  3VQ9 A;  1BHL A;  1IG9 A;  2ITG A;  3D45 A;  3VQ6 A;  2YHA A;  5LJW A;  1RDB A;  3CET A;  3ZSX A;  4OPH A;  1LOT B;  1TUU A;  2Z1J A;  3OYN A;  4DV6 K;  3KJV A;  1WOQ A;  4BE0 A;  2I7P A;  4IBN A;  3C0B A;  3T69 A;  1RTI A;  4JI7 K;  5EY4 A;  4N5S A;  3ULE B;  1U49 A;  4CF0 A;  1XQS C;  4QS9 A;  3OTO K;  4FJX A;  3SYZ A;  4DTX A;  4WFN L;  1Y97 A;  3NGY A;  4B3M K;  1GOC A;  3SV4 A;  5KTQ A;  1JXB A;  4EAH D;  4H5W A;  3OYB A;  3QNO A;  4GV9 A;  4H8K A;  4JN4 A;  2HND A;  3R8E A;  4DU1 A;  3TAR A;  1RTD A;  1BIS A;  4MDA A;  3VN5 A;  4PKG A;  3FFK B;  2F8T A;  5FPM A;  5FRO A;  3VQB A;  2W41 A;  3QFP A;  2A3Z A;  3WNF A;  5J2Q A;  4PA1 A;  1R0A A;  1K8K B;  4NO7 A;  3NVK A;  1IKY A;  4B3R K;  3GL1 A;  4Y1C A;  3ZLJ A;  2YCH A;  3ZT0 A;  4E1J A;  4HUF A;  3QER A;  2FBV A;  3CHW A;  1QTM A;  1OVQ A;  1Q18 A;  3BF1 A;  1C1C A;  5HBM A;  4BR0 A;  3ID8 A;  3WXI A;  1U2V B;  1VSM A;  5LMN K;  4JNE A;  2YHX A;  4OKJ A;  4DTS A;  1IBL K;  5KGW A;  4BE7 B;  1T44 A;  4DLG A;  4MDB A;  3V6D A;  2OCE A;  3E66 A;  3NGZ A;  4DV3 K;  3VPZ A;  5GIN A;  1FJG K;  4YOV A;  2HMP A;  4IO9 L;  4BY9 C;  4CBW A;  1ILY A;  2KFZ A;  4H5R A;  1H1V A;  3H46 O;  2NNW A;  1GOB A;  5LJV A;  2Z1G A;  2NRR A;  1U47 A;  2PAV A;  4W5N A;  4DTU A;  3L0Q A;  2FBX A;  3BF3 A;  4E7K A;  5AQP A;  4KH5 A;  3MX5 A;  2FLO A;  3HP9 A;  3L3U A;  4FJJ A;  4DFK A;  5DMR A;  3OJS A;  4JKH A;  5F0X A;  4CZI A;  3P1G A;  2KTQ A;  4G1Q A;  1BA0 A;  1TAQ A;  4ID1 A;  1W7A A;  4NXM K;  2KFN A;  1NGC A;  3L2Q A;  3RMC A;  1NGA A;  3E9L A;  5BRE A;  3HT3 A;  4YY3 K;  1UA1 A;  3OBY A;  3SK3 A;  5FRN A;  4KV8 A;  4HTL A;  1WBD A;  1TKZ A;  2HHS A;  2IOC A;  3K5L A;  3KK2 A;  4FK2 A;  1RT5 A;  3ZSZ A;  1NK5 A;  1P8Z A;  4WFB L;  1VQM N;  4BE1 A;  4JI2 K;  4W5T A;  1U45 A;  3AAR A;  2I5J A;  3QDK A;  1U6Z A;  4MQ3 A;  4CJ3 A;  4YOX A;  4FLX A;  3ID6 A;  1DT9 A;  1KRP A;  5M1P A;  3EN9 A;  4B9M A;  4M42 A;  3TAG A;  2OA8 A;  2WTU A;  1ATR A;  1HYV A;  4N56 A;  3L8B A;  4CHZ A;  4BVO A;  3WQU A;  3CG7 A;  4JKG A;  1NG9 A;  4FJH A;  3CMA N;  1JL1 A;  3AVC A;  4DKW A;  4JI3 K;  1U4B A;  1C0U A;  3D2E A;  1QSY A;  4RW7 A;  5M1N A;  4LD0 A;  2VWJ A;  2Q3S A;  4M3U A;  3M3Z A;  2A6A A;  2RN2 A;  5GAD P;  4CF2 A;  4LF9 K;  4H0Y B;  3EE9 A;  3O6W A;  4YHH K;  3WT0 A;  4DUY K;  4DF8 A;  4DSI A;  1KTQ A;  1RFQ A;  3QES A;  4O5F A;  3VQ7 A;  4UQG A;  5AQH A;  3CD6 N;  3DXM B;  3WXM B;  1VSI A;  1T7P A;  4DR5 K;  2HF3 A;  2G8K A;  2OPR A;  4M45 A;  2Q97 A;  2Z1H A;  1Z6R A;  2QTD A;  3EO3 A;  2A42 A;  4CJL A;  2BUP A;  4N47 A;  5LY3 A;  4B1Z A;  1J53 A;  4FZY A;  3HSC A;  5F2R A;  4RW9 A;  4CJR A;  1ZBF A;  4X64 K;  1CXU A;  1HMV A;  3O9R A;  3P38 A;  1Q81 O;  4DU3 A;  5SWM A;  2BGG A;  5DM7 L;  4FM0 A;  4BEC A;  4JHD A;  4DV7 K;  3CF5 L;  3V1R A;  4MFB A;  5HP1 A;  3LDL A;  4WQ5 A;  3V81 A;  3K5N A;  1L5U A;  4BRL A;  3RMD A;  3KTQ A;  1QQC A;  1UA0 A;  4M3R A;  3WEE A;  4GVM A;  3CCE N;  2XRI A;  5CYM A;  3MX2 A;  4FWP A;  3T1Y K;  5C2D A;  1VQL N;  4YDU A;  2D0C A;  1OH8 A;  5H1S Q;  5F1X A;  4M3Y A;  2P9P B;  3VQP A;  4KH4 A;  4A57 A;  1D9F A;  4IKF A;  2FSK A;  2WFB A;  1S72 N;  4H0X B;  3HM9 A;  4FVU A;  1KAX A;  1JCE A;  3PIO L;  4DSJ A;  3DLB A;  1HPM A;  2E2N A;  1HKG A;  2F8S A;  3AO2 A;  1W0H A;  4BQL A;  1B9F A;  3OBW A;  4GNI A;  4FJ9 A;  4BWM A;  4DQ8 A;  3CM5 A;  4A5A A;  4DU4 A;  4HCB A;  2IIR A;  4UY8 O;  2F7T A;  1SKW A;  2E5L K;  2D1K A;  4LFB K;  2RF2 A;  3G71 N;  2DY4 A;  3QEV A;  3QBW A;  2G8W A;  2ZWH A;  3G10 A;  3BUZ B;  4DR4 K;  2D0P A;  1FK9 A;  1WSH A;  1LAW A;  3IMX A;  3LPT A;  2Q36 A;  4GMJ B;  3O3F A;  1B92 A;  4OGC A;  3J7Y P;  4JI1 K;  2AJQ A;  1F21 A;  3T19 A;  4DS4 A;  3G0Z A;  3P31 A;  4KHU A;  3TI0 A;  4GV6 A;  1YF5 L;  2OPS A;  1O13 A;  1WB9 A;  4CJ4 A;  4FLT A;  3TAN A;  4BRD A;  2FSN A;  3U6F A;  5CZ1 A;  2O8F B;  3DI6 A;  3KVG A;  3CCL N;  3I33 A;  1HNW K;  1HRH A;  3KWI A;  1X9S A;  5LMU K;  4BG8 A;  4H4O A;  3GBT A;  2E8A A;  3THY A;  5EOY A;  3UE5 A;  3ZT2 A;  5GAG P;  4BVP A;  1WN7 A;  4DFM A;  4CED A;  1QSS A;  4IJN A;  4JI6 K;  4O0I A;  3LZJ A;  4E7J A;  3HPO A;  4CF9 A;  5AQQ A;  1S3X A;  3O8M A;  4R79 A;  5CYQ A;  2ZGY A;  4OX9 K;  3ENO A;  4KHQ A;  2BAN A;  3UIQ A;  2WUS A;  4FWL A;  2YV0 X;  1TUY A;  1JLG A;  1BOT O;  3VQE A;  3N4P A;  3VA3 A;  2VG7 A;  3WXJ A;  4W5R A;  4H4M A;  4DR1 K;  4NYF A;  3TTF A;  2FC0 A;  1SKS A;  1VRT A;  4FJL A;  1RDC A;  5AQN A;  4BGB A;  3KK3 A;  4BR7 A;  5DM6 L;  1Q86 O;  2P9U B;  1WUA A;  1C1B A;  1S6P A;  4H5T A;  3B6P A;  4K43 A;  4FJI A;  1BIU A;  3HVT A;  2HNZ A;  2PYJ A;  5KQD A;  2QW9 A;  1GLA G;  4FM1 A;  2ZE2 A;  1TKT A;  1ESV A;  1RT6 A;  4B9U A;  4F4K A;  4GKK K;  3PUF A;  4PQU A;  4IG3 A;  3L2U A;  1Q9Y A;  3AVA A;  4CZM A;  5AQZ A;  1KSP A;  4LSL A;  1WSI A;  3SUO A;  3K0S A;  4L8R B;  1KCF A;  4HCC A;  1JXE A;  4CBX A;  3HOT A;  1VSL A;  3C7N B;  4BC4 A;  3CJ7 A;  3PV8 A;  4E1M A;  2VQE K;  5M1K A;  2P9K B;  2E6L A;  4I2Q A;  2HHT A;  4WYB A;  1RBV A;  2G8U A;  1S1X A;  5AZI B;  2IGI A;  4LF7 K;  4R5P A;  4CJ7 A;  1KVA A;  4FPA A;  1KAZ A;  3VQ8 A;  3HPG A;  2KW4 A;  4FJM A;  1GLE G;  4JLH A;  1DTT A;  3I8D A;  5EXW A;  2O8C B;  1QQO A;  4RG8 A;  1YJ9 N;  3KZB A;  1YIT N;  1TK8 A;  3OVN A;  1JCG A;  3DOL A;  4BRK A;  3EZ5 A;  1RCH A;  4DSE A;  1VQ9 N;  4CJU A;  3L6Q A;  4DQQ A;  4JEP A;  4JYA K;  2E88 A;  4A2B A;  3CJA A;  4AM7 A;  2E4L A;  2O8D B;  1VHX A;  1TK5 A;  4DG1 A;  2E2P A;  1ZBL A;  4MO4 A;  1LAV A;  3MAQ A;  3TAB A;  3K9K A;  4J8F A;  4FOI A;  4M41 A;  3JYT A;  3KIO A;  4LF5 K;  1XHZ A;  3DRR A;  3BGR A;  4OLB A;  3MN6 A;  2JLE A;  4AM6 A;  5GAH P;  4ICL A;  5CHI A;  1SS6 A;  3AO1 A;  4LF4 K;  3LDQ A;  2YJF A;  2YHW A;  3F73 A;  3DWL A;  4F3T A;  1XMO K;  3ENH A;  4K25 A;  3PO4 A;  4ID5 A;  4JKF A;  2PBD A;  4ILG B;  4AHC A;  4YNQ A;  1QZ6 A;  4FPB A;  3SUP A;  2E1Z A;  4FWK A;  2NRW A;  4BDY A;  4QAG A;  3WNH A;  3SAH A;  3PSF A;  4IWV A;  4FZZ A;  3J7Z O;  1KVC A;  3THW B;  2UU9 K;  5AQS A;  4KAZ A;  3MWP A;  3RWU A;  3VEZ A;  2F9T A;  3EL2 A;  4OPA A;  3CM6 A;  1CZA N;  2HF4 A;  1YUW A;  3C6T A;  3VF4 A;  4M3W A;  1ASV A;  3AAP A;  5JLH A;  4RW6 A;  3TAM A;  3O3G A;  1ATN A;  1Q7Y O;  5AZJ B;  4ELU A;  1SKR A;  2HHX A;  1LWE A;  3OA9 A;  1T8E A;  3O4Q A;  2CH6 A;  2HHH K;  4KTQ A;  1KC8 O;  3A5N C;  3K2P A;  2ASM A;  4B8C A;  1E4G T;  3L3V A;  4E7I A;  2CGL A;  3ZEU A;  3LP3 A;  2F4V K;  1D9D A;  4FVM A;  1L3S A;  4N41 A;  4ZHR A;  3OS2 A;  3HYF A;  3RSE A;  3VEY A;  1KFS A;  2G8I A;  3DM2 A;  3BZK A;  3G6E N;  1X3N A;  4CFB A;  1X9W A;  4O8K A;  2EWS A;  3AVH A;  4C1N I;  2KLA A;  4KRE A;  1EKE A;  3M5R A;  1T6D A;  3Q7C A;  1HYS A;  4BRH A;  5KQ8 A;  4ILJ A;  4DR6 K;  4AHS A;  2G8F A;  4OVL A;  1IH7 A;  1TYQ B;  4GY2 B;  3O08 A;  4BRI A;  3V9U A;  1NKB A;  3SUN A;  1QHA A;  1NJI O;  5AQG A;  5BPL A;  1WBB A;  2QI2 A;  1S9G A;  1NK8 A;  3CC2 N;  5T7B A;  4O4G A;  4FJG A;  3AO3 A;  3OYJ A;  1HLU A;  3IFR A;  4JRP A;  3ZSY A;  3THV A;  2GWK A;  4BR4 A;  1WSG A;  5FPE A;  5E26 A;  4IFV A;  3D0P A;  2V7Z A;  1EX4 A;  1FW6 A;  1OVY A;  4AQY K;  1ZBH A;  3K9J A;  3THX A;  5CY4 A;  2GUI A;  3SBG A;  3QFU A;  3HXM A;  4JD2 B;  4B1U B;  4FM2 A;  3CQY A;  3HTV A;  3O9S A;  4RW4 A;  4CD1 A;  3ZEU B;  4OKE A;  4XH5 A;  2HB5 A;  1R59 O;  5BN8 A;  3SI6 A;  3DLR A;  1NGE A;  2P9K A;  3AVF A;  2H3G X;  1HKC A;  4W5Q A;  3OYE A;  3QIC A;  1KVB A;  3TAQ A;  1NGI A;  3OW2 M;  4FW2 A;  4CHO A;  2YKN A;  2P9I A;  4C8M A;  5EU7 A;  4JI4 K;  4W5O A;  3UKR A;  4M3X A;  4E7L A;  3A8Y A;  1NBW A;  2P9P A;  2VWB A;  4YOW A;  3ZSR A;  3IS9 A;  4BRC A;  1RDD A;  3C7N A;  3M8R A;  3H6E A;  1A5W A;  1BIZ A;  4FWR A;  1NJZ A;  1BL3 A;  4QOZ B;  3L2R A;  5FRM A;  5BN9 A;  5K14 A;  1BWF O;  4CZF A;  4C8O A;  3ZCM A;  1X9J A;  2GUP A;  2IC3 A;  1VQ6 N;  2WON A;  4B8A B;  4B1Y B;  1CXQ A;  4CK1 A;  5M1F A;  4DR3 K;  4ELV A;  4F2S A;  2DFF A;  2B4J A;  4FLY A;  1C6V A;  1WNS A;  2A1R A;  3RRH A;  3OYF A;  3KLH A;  1ZBI A;  1FKP A;  1NOY A;  4OO1 J;  3JSM A;  3CCV N;  3LM2 A;  1XC3 A;  4CW7 B;  3OYA A;  3HM8 A;  3S3N A;  2B5J A;  3SQ0 A;  2YNG A;  1ZBU A;  2GTD A;  2GV9 A; 
#chains in the Genus database with same CATH homology
 2OTL N;  3O80 A;  3ATV A;  3VGL A;  2OTJ N;  1JJ2 M;  4RWT A;  3D2F A;  3MX2 A;  1NGG A;  4FWP A;  3FR0 A;  2E2O A;  5C2D A;  1VQL N;  2KKZ A;  4YDU A;  2C1I A;  2Q2R A;  4GVE A;  5CR4 A;  3ZET B;  2CH5 A;  2UYT A;  5H1S Q;  5F1X A;  4BEB A;  3DLL L;  2QM1 A;  4NB4 A;  4CZH A;  4A62 A;  2D4W A;  4JKE A;  1GLJ O;  1NM1 A;  2P9P B;  4WQ4 C;  4A57 A;  1DEJ A;  4KH4 A;  3VGK A;  5BR9 A;  5AQK A;  2FSK A;  2WFB A;  2ITM A;  2RE2 A;  1S72 N;  4H0X B;  3TU5 A;  4NLC A;  1KAX A;  1JCE A;  2QXL A;  4RTF D;  4EHT A;  4WF9 L;  3NMU A;  4FO0 A;  3PIO L;  5AFU A;  3MCA B;  3O9T A;  1HPM A;  1NGJ A;  1T3V A;  2E2N A;  2NLX A;  1HKG A;  3A5M C;  3FZK A;  4QS8 A;  4BRO A;  1U2V A;  4JKA A;  4BQL A;  3HBT A;  5E84 A;  4Z94 A;  2FF3 B;  1OKJ A;  3OBW A;  3LDN A;  3N4Q A;  3AY9 A;  4GNI A;  1XUP O;  4XEI A;  5AQR A;  1YXQ A;  4DQ8 A;  4A5A A;  2HST A;  5AZJ A;  2ASO A;  2IIR A;  2JWK A;  4UY8 O;  2F7T A;  1NGF A;  2D1K A;  3IKM A;  3G71 N;  1K8K A;  2VGM A;  3D7E O;  3WQT A;  3QBW A;  3U9D A;  2ZWH A;  1MA9 B;  3BUZ B;  2P9L B;  2D0P A;  2ZF5 O;  3KHY A;  2FXU A;  4M7Y A;  4YDU C;  4DB3 A;  4WCE L;  3IMX A;  4ISG A;  3VOV A;  3CC7 N;  2Q36 A;  4BRG A;  3H1V X;  4CZE A;  1NGH A;  2ASP A;  2QWO A;  3FE1 A;  3QB0 A;  1YVN A;  3L4I A;  3T7Z A;  1BG3 A;  3VF2 A;  1VQ8 N;  3FZH A;  1K73 O;  1YHQ N;  3O5B A;  4BC5 A;  3HZ6 A;  3P31 A;  3H45 C;  3RSE B;  4C1N K;  3I56 N;  4GV6 A;  1EO1 A;  1LCU A;  1VQ5 N;  3F2K A;  5BRF A;  4M7X A;  3S41 A;  1YF5 L;  4BGA A;  1O13 A;  4JKB A;  2HBK A;  4BRM A;  3WEE B;  4IEI A;  4ILH A;  3SAF A;  1VQK N;  3E9O A;  4BRD A;  2FSN A;  4A2A A;  4JKD A;  4BQZ A;  5BPM A;  5BRH A;  1C0F A;  4PL7 A;  3KVG A;  3EKU A;  3CCL N;  3I33 A;  3VF6 A;  3ZX3 A;  2NRT A;  4CD3 A;  3KWI A;  3AGR A;  3U9Z A;  1SZ2 A;  2AA4 A;  3U8X A;  4B1V A;  4BG8 A;  3GBT A;  2D0O A;  2E8A A;  3M1F A;  5EOY A;  5EVZ A;  3UE5 A;  4A61 A;  4BR5 A;  3IUC A;  5AQM A;  4BVP A;  5GAG P;  3FZF A;  3SBT A;  1E4F T;  4IJN A;  4CI6 A;  3PLA A;  5BPN A;  1Y64 A;  5AQQ A;  1RDW X;  1S3X A;  3O8M A;  4JKC A;  3VEX A;  3PIP L;  4I6M B;  3FLC O;  3R9P A;  4R79 A;  3H3N O;  1MWK A;  2ZGY A;  4CZJ A;  2YJE A;  3ENO A;  4CZG A;  5AZI A;  5HOO A;  4XJX A;  3KK7 A;  3CIP A;  2WUS A;  3AGK A;  3CER A;  4FWL A;  4H0T B;  1TUY A;  1BOT O;  3MN7 A;  3N4P A;  3J7Z O;  2QA4 N;  1KD1 O;  3CQX A;  3WXJ A;  4PKI A;  4FL9 A;  3TTF A;  4A5B A;  1HKB A;  5AQU A;  2A41 A;  3SMS A;  1M90 O;  1GLD G;  2IVP A;  3LDP A;  3CCQ N;  2IVO A;  3ZX0 A;  1ATS A;  3CCU N;  3CPE A;  4JD2 A;  3IDH A;  3GOI A;  5AQN A;  1RGI A;  1ZC6 A;  2I7N A;  3EE8 A;  4BGB A;  1ZBS A;  3FGU A;  1QVF M;  4BR7 A;  5DM6 L;  3UB5 A;  1Q86 O;  5KPR A;  2P9U B;  1K9M O;  1WUA A;  4JK9 A;  4H5T A;  2WBN A;  4K43 A;  2NZT A;  3LL3 A;  5M1O A;  5KQD A;  2QW9 A;  3CC4 N;  1YI2 N;  1GLA G;  2CGJ A;  2P9N A;  2YHY A;  2E20 A;  1ESV A;  3CJ9 A;  3GG4 A;  4YOT A;  3MDQ A;  3CCE N;  3R3L A;  3ULE A;  2AP1 A;  3CJB A;  5AQW A;  3CXC M;  3CCJ N;  1VQO N;  4CZM A;  5AQZ A;  1N8R O;  4G9Z A;  5EX5 A;  2CGK A;  4B1W B;  4MO5 A;  2W40 A;  3CJ1 A;  2BH1 A;  3MK6 A;  4ISE A;  4CBX A;  3DAW A;  2QWN A;  3HOT A;  4YOY A;  3C7N B;  4BC4 A;  3CJ7 A;  2QWQ A;  5AQT A;  1QVG M;  3H3O B;  4C23 A;  5M1K A;  4H5N A;  3DJC A;  3O9Q A;  2QWL A;  5C2F A;  2P9K B;  4FWQ A;  3H1Q A;  3NVM A;  4H0O A;  3Q7B A;  4I6M A;  4WYB A;  3A0I X;  3A5L C;  5AQO A;  4XH1 A;  1NWK A;  4A59 A;  5AZI B;  3L4Q A;  4FWN A;  3SMP A;  2VYP A;  2GEL A;  1MDU B;  4CJ7 A;  3TSU A;  5JVH L;  5FPD A;  5B8H A;  4FPA A;  1BUP A;  1KAZ A;  1Q82 O;  2Q31 A;  4U67 L;  4RCH A;  3SJH A;  4MLH A;  2P9S B;  2PFU A;  1GLE G;  1M1K O;  4JHD B;  3ZYY X;  5EXW A;  1ZXO A;  1QQO A;  1YJ9 N;  4BR9 A;  3KZB A;  2ZJP L;  1BDG A;  1YIT N;  3VEV A;  5KPZ A;  1JCG A;  1KAY A;  4BRK A;  1VQ9 N;  2QWM A;  5LJW A;  3CET A;  1EQY A;  3L6Q A;  4OPH A;  4F9O A;  4H0V B;  2ZJR L;  4JEP A;  2E88 A;  1LOT B;  4Y0W A;  1TUU A;  4A2B A;  3CJA A;  3AAQ A;  4AM7 A;  1WOQ A;  1Z05 A;  5HL7 L;  2IVN A;  2I7P A;  1QZ5 A;  1X3M A;  2E2P A;  4MO4 A;  3P39 A;  3MCP A;  3C0B A;  4BRP A;  4EFH A;  3T69 A;  5AR0 A;  4DCH A;  4BC3 A;  4H03 B;  5EY4 A;  1DKG D;  4PL8 A;  3VEN A;  3K9K A;  4J8F A;  3FZM A;  4FOI A;  3ULE B;  3ZX2 A;  2RHK A;  1XQS C;  4QS9 A;  3MN6 A;  4AM6 A;  3E1Y A;  4IXC A;  4FWO A;  5GAH P;  3W3D A;  1VQP N;  4WFN L;  3U4L A;  5JVG L;  3W0L A;  5CHI A;  3VEW A;  1SS6 A;  4LC9 B;  3LDQ A;  4EAH D;  2YJF A;  1JCF A;  2YHW A;  5CE3 A;  4IOX A;  4H5W A;  3DWL A;  3VMF B;  3F9M A;  4XH4 A;  4GV9 A;  4JN4 A;  1QQN A;  3ENH A;  3GDQ A;  3R1X A;  3R8E A;  4K25 A;  4MDA A;  1QQM A;  4JKF A;  4PKG A;  2PBD A;  1HX1 A;  4ILG B;  3FFK B;  5FPM A;  1QZ6 A;  2W41 A;  3QFP A;  3JXU A;  4WQ5 C;  2A3Z A;  4FPB A;  2E1Z A;  4DHY A;  4FWK A;  2NRW A;  3ZET A;  3TPQ A;  4BRQ A;  2E2Q A;  3TSQ A;  3SAH A;  1K8K B;  3B8A X;  4IWV A;  4HWI A;  2HBL A;  4NO7 A;  2HOE A;  3HRG A;  2V52 B;  3GL1 A;  1YAG A;  4FWM A;  4EHU A;  2P9L A;  5AQS A;  2YI1 A;  1NGB A;  2YX6 A;  4BR2 A;  3MWP A;  2YCH A;  3VEZ A;  2VCP A;  2F9T A;  1SQK A;  2VGN A;  3EL2 A;  4E1J A;  3O9U A;  4OPA A;  3WXL A;  2GWJ A;  3CHW A;  4H5V A;  5GIO A;  1CZA N;  1Q18 A;  2HF4 A;  3BF1 A;  2QWP A;  2A40 A;  1YUW A;  4BR0 A;  3J8A A;  3ID8 A;  1G99 A;  3LDO A;  1K8A O;  3WXI A;  1U2V B;  5AQL A;  5JIC A;  3VF4 A;  4JNE A;  3M6G A;  2YHX A;  3G25 A;  3VGM A;  3VES A;  5JLH A;  3AAP A;  5AQX A;  4WFA L;  4BE7 B;  1T44 A;  1ATN A;  1Q7Y O;  4MDB A;  5AZJ B;  2A5X A;  3GE1 A;  3WXK A;  3E66 A;  3VTI A;  4AF1 A;  5C10 A;  1YJW N;  4FVU A;  3WUH A;  1V4T A;  4MLE A;  3VPZ A;  5ADX H;  2FSJ A;  5GIN A;  4B9Q A;  1VAZ A;  5JLF A;  1GLF O;  1DGK N;  4YOV A;  1GLC G;  3OA9 A;  2HMP A;  3QML A;  4IO9 L;  3O4W A;  4BY9 C;  4CBW A;  4BG9 A;  2CH6 A;  1ILY A;  1KC8 O;  5AQJ A;  4H5R A;  3A5N C;  1H1V A;  3H46 O;  2NNW A;  2ASM A;  4PHT X;  5LJV A;  1E4G T;  2CGL A;  4FWS A;  3ZEU A;  1BA1 A;  2NRR A;  4IOC L;  3SAG A;  5C12 A;  2ZGZ A;  2PAV A;  4O8U A;  3RSE A;  3L0Q A;  4NLB A;  5TKW A;  1KXP A;  3VEY A;  3UKU B;  4M63 C;  3CCR N;  3G6E N;  1X3N A;  3HI0 A;  3BF3 A;  4KH5 A;  2EWS A;  4O8K A;  1V4S A;  2KLA A;  3CI5 A;  2FLO A;  3MX5 A;  5ELZ A;  5AQP A;  4BRN A;  3M5R A;  3Q7C A;  1T6D A;  2V7Y A;  1YIJ N;  4KBO A;  4KH6 A;  4BRH A;  3TTC A;  4JKH A;  5F0X A;  2P9I B;  5KQ8 A;  4CZI A;  2W00 A;  4ILJ A;  1C0G A;  2Q0R A;  1SAZ A;  3VER A;  4U7B A;  1BA0 A;  1W97 L;  3EZW A;  1TYQ B;  3O1B A;  3O08 A;  4GY2 B;  5AQF A;  3UKR B;  4BRI A;  3TSP A;  3MN9 A;  3DXM A;  1QHA A;  1NGC A;  5I9E B;  1NJI O;  3DXK A;  1NGA A;  3E9L A;  5BRE A;  5AQG A;  5FPN A;  2HBJ A;  5AQI A;  5BPL A;  1D4X A;  2Q1N A;  4CBU A;  2QI2 A;  4L3Q A;  5GAE P;  3O1W A;  4IZ9 A;  3OBY A;  4CZL A;  3SK3 A;  3CC2 N;  2P9U A;  3CCS N;  1YJN N;  1HUX A;  4K42 A;  4HTL A;  5KPT A;  1HLU A;  3IFR A;  1P8Z A;  2GWK A;  4WFB L;  4BR4 A;  1VQM N;  3AAR A;  3QBX A;  3QDK A;  2NRX A;  1U6Z A;  2J4R A;  3FZL A;  5FPE A;  2FF6 A;  5AFU H;  5E26 A;  4YOX A;  4EIA A;  3SLC A;  3ID6 A;  1DT9 A;  3C6H A;  5M1P A;  3EN9 A;  2V7Z A;  4WQ4 A;  5BRD A;  3CJC A;  4YOR A;  1OVY A;  3CPW M;  3K9J A;  1BO5 O;  1ATR A;  3SBG A;  3QFU A;  4IEE A;  4JD2 B;  4BVO A;  3WQU A;  4JKG A;  5C0Y A;  2JWL A;  4B1U B;  3OHR A;  3C65 A;  3CMA N;  1NMD A;  2OAN A;  1BU6 O;  1MWM A;  3P4I A;  1W2B M;  3CQY A;  3HTV A;  3O9S A;  4CD1 A;  3ZEU B;  3LM9 A;  5JMV A;  4XH5 A;  4DKW A;  4FOE A;  1R59 O;  2Q0U A;  3VEO A;  5BN8 A;  5MLC Q;  2QEX N;  4GV3 A;  3D2E A;  1NGE A;  3G4S N;  5M1N A;  4PKH A;  2P9K A;  2F9W A;  1P90 A;  2H3G X;  3RVC A;  1HKC A;  3ENB A;  3UKU A;  3QIC A;  3M3Z A;  2A6A A;  2QWR A;  2P9N B;  4IOA L;  4ISF A;  4YOU A;  1NGI A;  3D2F B;  3EKS A;  4BRF A;  5GAD P;  3OW2 M;  3MMV A;  2V51 B;  1HJO A;  5AQV A;  2C1G A;  4H0Y B;  3EE9 A;  3O6W A;  3WT0 A;  2P9I A;  4BC2 A;  2HBM A;  4FSV A;  1RFQ A;  4IJA A;  4O5F A;  3HOS A;  1TYQ A;  3UKR A;  1T6C A;  2NRV A;  3E9P A;  1VQ4 N;  1J6Z A;  5AQH A;  3CD6 N;  2WC9 A;  3DXM B;  3WXM B;  2DPN A;  3A8Y A;  1NBW A;  2P9P A;  2VWB A;  4YOW A;  2E1Y A;  2KHO A;  3DXK B;  2HF3 A;  4BRC A;  3C7N A;  3VTH A;  3BP8 A;  3H6E A;  2Q97 A;  1Z6R A;  3KWG A;  2QTD A;  3EO3 A;  5AQY A;  2A42 A;  4FWR A;  2BUP A;  5LY3 A;  5BN9 A;  4B1Z A;  3NVK A;  1S22 A;  1BWF O;  3VET A;  3CME N;  5TKY A;  4JAX A;  4CZF A;  1VQ7 N;  1X9J A;  2GUP A;  3HSC A;  5F2R A;  2NRH A;  1VQ6 N;  3A5O C;  3MN5 A;  4B1Y B;  1GLL O;  3O9R A;  3P38 A;  1Q81 O;  3C6A A;  3ATU A;  4IFE A;  5M1F A;  2GEM A;  5GIP A;  1KQS M;  2P9S A;  5DM7 L;  1VQN N;  1IG8 A;  4BRE A;  4JHD A;  3CCM N;  4BEC A;  1GLB G;  1NLV A;  3I8B A;  2BTF A;  4JK7 A;  4H0P A;  4IO8 A;  4QS7 A;  5C15 A;  3CF5 L;  3D6R A;  4C1N I;  1RDU A;  4JK8 A;  4JKG B;  3I55 N;  3LDL A;  4IDH A;  2ZJQ L;  4WQ5 A;  4CZK A;  3F5T A;  4OO1 J;  3BEX A;  3LM2 A;  5M1Q A;  3CCV N;  3TTD A;  3R6M A;  4K41 A;  4B1X B;  1XC3 A;  4BRL A;  1NGD A;  3MWT A;  3HM8 A;  5ADX A;  4BRA A;  2GX9 A;  3D2E B;  3JS6 A;  2NRZ A;  2GTD A;  1IJJ A;  3WEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...