1U2VA

Crystal structure of arp2/3 complex with bound adp and calcium
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
418
structure length
402
Chain Sequence
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-Related Protein 3
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
total genus 123
structure length 402
sequence length 418
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 1u2vA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1u2vA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1u2vA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1u2vA04
4A62A 3HZ6A 2GTDA 5AQXA 4RWTA 3GG4A 4XH4A 4CZHA 5B8HA 4ISGA 4Z94A 4K42A 2YJEA 3MK6A 3VOVA 1J6ZA 1DKGD 5AQIA 3ATUA 3J8AA 5AQKA 4BQZA 2P9UA 2A6AA 4FO0A 4CZLA 4ISFA 1ATSA 2E2QA 2E2PA 3CETA 4JHDA 5AQSA 3CJAA 3VEZA 3ENOA 2D1KA 3DXKB 4KBOA 3GOIA 5EXWA 1BDGA 4H5RA 1H1VA 4K43A 2E88A 1TUYA 3LDQA 5F2RA 4YDUC 2VWBA 5TKYA 3HI0A 1V4TA 1XQSC 3ZX0A 2V7ZA 3FZFA 3AARA 2ZF5O 1ZC6A 2P9PA 4AM7A 3HM8A 1U6ZA 1X9JA 1LCUA 4MO4A 4BRKA 1HKCA 3ZX2A 1HUXA 1DGKN 4NB4A 2ITMA 1C0FA 2AP1A 4B1UB 2CGKA 4HWIA 5KQDA 1WUAA 1QQOA 3ZETA 3A8YA 3HTVA 1NMDA 5ELZA 2PBDA 3QFUA 2P9KA 4BQLA 4WQ4A 3UE5A 2P9NA 2QWLA 5JLHA 3AY9A 1Q18A 3LDPA 4CZJA 5KQ8A 4H0VB 4I6MA 3H1VX 2YCHA 4BREA 1BO5O 3R6MA 4E1JA 1GLJO 2A3ZA 1TYQA 2ASOA 4IZ9A 1Z05A 4CZEA 4GNIA 3KVGA 2IVPA 3O1WA 4JNEA 1G99A 4CZIA 1GLCG 4JD2A 3QMLA 2ASMA 5AQHA 2QWPA 1C0GA 3VGMA 4C23A 5BPNA 4FWLA 1RFQA 1YVNA 2CH5A 2A41A 3FLCO 3GDQA 3VPZA 3ZEUA 1Y64A 4CD1A 4H5NA 2HMPA 2NRHA 2A5XA 1KXPA 2FSJA 4NO7A 2QWRA 3LM2A 4M7XA 3VENA 1NBWA 4MLEA 2CGJA 4BC5A 1NGJA 3R9PA 5AQZA 2E2NA 1CZAN 1NGIA 1HX1A 3D2EA 2YHXA 1QQMA 2P9PB 4JAXA 4RTFD 3FZKA 3FZLA 5E84A 2P9LA 2ZGYA 4LC9B 1IG8A 4B1ZA 3CJ7A 5CE3A 2EWSA 3U4LA 3GBTA 1RGIA 2HOEA 1MWMA 1D4XA 3UKUA 2P9KB 2YJFA 2Q2RA 3VEOA 2W41A 4BRFA 1XUPO 3OHRA 4BR0A 1T6CA 3H3OB 4BR2A 2ZGZA 3CJ9A 1X3NA 4I6MB 2P9SA 3DXMA 5BRDA 2Q97A 4BRIA 3SMSA 5AFUH 3BF1A 1X3MA 3DAWA 3JS6A 1U2VA 2VCPA 1JCFA 2FLOA 3GE1A 4EHUA 4FWMA 1BA1A 1K8KA 2BUPA 3CJ1A 3RSEA 3VGKA 4H5VA 1XC3A 3HBTA 2GUPA 4JD2B 3LL3A 5FPEA 4BRPA 5AQMA 1V4SA 4AM6A 4IJAA 3SLCA 1HJOA 2WUSA 2A42A 2D0PA 4WQ5A 4Y0WA 4BC3A 3U9DA 2E2OA 4FPBA 4BRHA 2I7PA 3C7NA 4XH1A 5AQTA 4BGAA 3MN9A 4CD3A 3M6GA 2UYTA 1MWKA 4GY2B 2Q36A 1YUWA 3FR0A 3FFKB 1JCEA 3O08A 1SZ2A 4F9OA 3EL2A 3QBXA 4CI6A 3WEEA 3DWLA 3CQXA 3WT0A 4JN4A 3TPQA 4CZGA 2NZTA 1TUUA 4IO8A 1R59O 4PKIA 3I8BA 3VESA 2D4WA 4CJ7A 5BR9A 4BRNA 2A40A 1HLUA 4BVPA 4IJNA 4HTLA 5KPTA 3SJHA 2IVOA 1WOQA 5E26A 1HPMA 5AFUA 3W3DA 1NGDA 1QZ6A 3WXIA 3VEYA 4WQ4C 4BRDA 5AQQA 3DJCA 1S3XA 3LDNA 3QB0A 1NGHA 3IDHA 3VF4A 3B8AX 1T44A 2P9SB 3DXMB 2QW9A 4XEIA 3LDLA 5KPRA 2Q1NA 3ATVA 1KAZA 3O1BA 3HSCA 2V52B 1ZXOA 1MA9B 2YI1A 5LJWA 2IIRA 3GL1A 2E1YA 3RSEB 4B9QA 2P9UB 4FSVA 5AQWA 3A5NC 4CBXA 4JHDB 1NGGA 2KHOA 5EY4A 4FOEA 1IJJA 2DPNA 4ISEA 2I7NA 3C0BA 3MMVA 2F9TA 3C7NB 3IMXA 4MO5A 3M1FA 2FF3B 4FWPA 3VF2A 5AZJA 1Z6RA 1NWKA 4FPAA 1NGAA 4QS8A 1HKGA 4PL7A 2HF3A 1GLAG 4CZKA 3WEEB 5FPNA 1GLEG 5AZIA 3VEWA 1LOTB 4H0PA 1E4FT 3G25A 3IFRA 1NGFA 3CHWA 2IVNA 5BRHA 2CGLA 1ATNA 1QHAA 3CJBA 3DXKA 1GLDG 1BOTO 5BN8A 4BROA 2Q0UA 1ATRA 3BF3A 2QWOA 3ZETB 4B1XB 1P8ZA 1S22A 4H0XB 4BR4A 1JCGA 3H46O 3FE1A 4RCHA 2V51B 1RDWX 2P9NB 4PKGA 2H3GX 4BRLA 2D0OA 5BRFA 3D7EO 3AAPA 3O80A 2QM1A 2HF4A 1NLVA 1OKJA 5AQJA 3H3NO 4QS9A 2GEMA 1QQNA 2FXUA 4BGBA 4QS7A 4K41A 4FWSA 1TYQB 4A2AA 1NGEA 3P4IA 3EZWA 3MN7A 4EIAA 3CI5A 3KHYA 5AQGA 3L0QA 1NGBA 4DCHA 4M63C 2NLXA 4WQ5C 1T6DA 4K25A 3SMPA 4M7YA 4BVOA 3KZBA 3ZEUB 3O8MA 2CH6A 2GWJA 2E8AA 3AAQA 5AQPA 5AZJB 1BG3A 3O6WA 3O4WA 3O5BA 3WXKA 4CBUA 3IUCA 4EHTA 4L3QA 3A0IX 4BRGA 3H1QA 5AQYA 3WQTA 2P9IA 1KAYA 5AQUA 3R8EA 4EFHA 1NM1A 4PKHA 3ID8A 2ZWHA 1ESVA 5AZIB 3D2EB 5LY3A 1E4GT 3WQUA 2FSNA 3BEXA 3QBWA 3EN9A 4H0OA 4H5TA 1YXQA 2P9LB 4BC2A 2Q0RA 1MDUB 3ZX3A 3A5MC 4O8KA 2QWMA 3CIPA 3QICA 4FWKA 3VETA 4BG8A 5JMVA 2QWNA 4DB3A 4BR5A 4O5FA 2BTFA 3LM9A 3UKUB 3W0LA 5F0XA 4J8FA 4MLHA 3D2FA 2PAVA 5AQFA 3MCPA 4BR7A 3ULEA 3BP8A 2ASPA 4BRCA 2FF6A 3FZHA 5JLFA 4YDUA 2GELA 5AQRA 3BUZB 5AQOA 5I9EB 3UKRA 3MN6A 1U2VB 2F9WA 1K8KB 2YHWA 5FPMA 1BA0A 4BRMA 3U8XA 1BWFO 4IXCA 4B1WB 5F1XA 1EQYA 3EKSA 3VEXA 2AA4A 2J4RA 2OANA 4FWOA 5BPLA 3EKUA 1BUPA 3M3ZA 4BC4A 5EX5A 5ADXH 3UB5A 4FL9A 1ZBSA 3U9ZA 3FZMA 5AQNA 3CERA 5LJVA 3TU5A 2FSKA 5AR0A 5KPZA 2P9IB 3H45C 3SK3A 3H6EA 4XH5A 1GLBG 3EO3A 3FGUA 3A5LC 3JXUA 4FWNA 3VGLA 3VERA 1DEJA 2W40A 4H5WA 3QDKA 2VYPA 1QZ5A 4FOIA 2V7YA 3L4IA 5BN9A 3VEVA 4BRAA 4BG9A 3F9MA 4CZFA 3MDQA 3QFPA 2Q31A 4CBWA 4CZMA 2GWKA 5AQVA 4FWRA 5JICA 2E20A 4DHYA 4IWVA 4A61A 3VF6A 3A5OC 5BREA 3D2FB 3S41A 4B1VA 3ENHA 3ULEB 5EVZA 1GLFO 3WXLA 3MN5A 3CJCA 4FWQA 3WUHA 5AQLA 4PL8A 3L6QA 1KAXA 4H0YB 5EOYA 2YHYA 4WYBA 3UKRB 3WXJA 3LDOA 1SQKA 1GLLO 1HKBA 5ADXA 5FPDA 1YAGA 4EAHD 2QXLA 3I33A 4B1YB 2QWQA 4A2BA 4H0TB 2E1ZA 4H03B 5BPMA 1SAZA 3CQYA 1NGCA 4BR9A 4BRQA 4DQ8A 1BU6O
chains in the Genus database with same CATH superfamily
4DUZK 3HZ6A 5HP1A 4RWTA 3GG4A 1VQ6N 1HYZA 2D0BA 3P31A 3CCVN 1RBUA 4CERA 4CJFA 4YOUA 3NBPA 3MK6A 3DLHA 4DLGA 1RNHA 4BDYA 1D9DA 1J6ZA 2QKBA 5AJ3K 4BE7B 1ZBIA 4KH4A 4A57A 4FO0A 4DSLA 4CZLA 1ATSA 2E2PA 5AQSA 3CJAA 1QHTA 3NGYA 4XJXA 3ENOA 4X62K 2NRRA 3WNGA 3ID6A 3T1AA 3NH2A 1VQ8N 3RMDA 3TSQA 1NJZA 1BDGA 4KV8A 1H1VA 1Q7YO 3MEDA 4K43A 3IAYA 2VWBA 3F2KA 4IBNA 4I9QA 3VQPA 3PX0A 3HM8A 3NE6A 3QEVA 1LCUA 1TKXA 4LSNA 4DR1K 3ZX2A 4B9VA 2O8EA 1DGKN 3ALYA 3IKMA 4B1UB 1JLAA 5KQDA 3TTFA 3ZETA 2R7YA 2Y1JA 3HTVA 1NOZA 2PBDA 2P9KA 1HRHA 3EEQA 4FM1A 4FXDA 1Q18A 4DWIA 4HVJA 3A2FA 3L2WA 3G10A 4DV3K 4IO9L 4BREA 4I9LA 4ILGB 3KKSA 4E1JA 3CCLN 2NUBA 4IZ9A 2UXCK 4FJIA 2IVPA 4JD2A 2W00A 2ASMA 5AQHA 2F8SA 4EP4A 3QO9A 2UU9K 2X78A 3GDQA 4KHUA 3FLCO 3OYGA 3ZEUA 1Y64A 4WE1A 4H5NA 5T7BA 2HMPA 2NRHA 4M42A 3C6HA 2YHAA 4CCHA 4DTJA 2F96A 1K9MO 4CJEA 2YNIA 4MDAA 3TANA 3JAMO 2KZZA 5AQZA 4OKKA 1HX1A 1VRTA 3OS0A 1HR0K 3G0ZA 3CC7N 2NRVA 3RR7A 4JAXA 3FZKA 5E84A 2F8TA 3CCQN 1IG8A 4JS4A 3CJ7A 3K59A 4N47A 4ILHA 3TAEA 2C1IA 5FRNA 2XY8A 2VWJA 3P38A 1D4XA 1W9HA 1OH8A 3J7YP 3VEOA 1LAVA 4BR0A 3CJ9A 4BY9C 3T1HK 1KD1O 5AFUH 1X3MA 5EU7A 3GE1A 3CQ8A 1B92A 5FDLA 2O8DA 3LPTA 4MFBA 1B9DA 4H5VA 5C42A 1XC3A 4PY5A 5KTQA 2G8VA 3LL3A 4YOVA 4FYDA 3AVIA 4YOTA 4CEAA 3RTVA 2YKNA 2WUSA 1IKXA 3Q7BA 1F21A 4Y0WA 5CZ1A 4BC3A 1JXEA 3DRRA 4FZYA 2E2OA 2O4IA 3OYHA 4BGAA 5FRMA 2UYTA 1YTAA 3DMJA 1YUWA 3FR0A 1S6QA 4YOXA 4F9OA 3QNOA 4G9ZA 4DQQA 2O8BB 4E1MA 4DTPA 3CQXA 3AGRA 1NJYA 4CZGA 3TPQA 4CFCA 5LMNK 3ASMA 4PKIA 2D4WA 2WFBA 2Z1GA 4BRNA 4CEBA 1BCOA 5C12A 4NYNA 1QSLA 3CM5A 3ZSVA 1HLUA 4KTQA 4LH4A 2HBKA 2OZSA 1HPMA 1WNSA 3VQAA 3CM6A 5AFUA 3W3DA 1NGDA 4DF8A 5CY4A 1X9SA 5AQQA 4Z4GA 4O55A 3QB0A 3IDHA 3CCSN 2GV9A 5FROA 3DXMB 3OYDA 4LFCK 2QW9A 3LDLA 3O1BA 2RPIA 4LSLA 3MECA 1CLQA 1XMQK 3U6FA 2G8HA 1VSDA 2P9UB 3HJFA 4FSVA 5AQWA 3OTOK 3OJSA 4JHDB 1IO2A 1NGGA 1LWCA 4G1QA 1Q9XA 4CHYA 4HUFA 2VG5A 1FXXA 3SYZA 1OVQA 1BISA 2XHBA 4MO5A 4DU1A 3QLHA 4JKGA 5J2QA 2FF3B 4FWPA 3NGIA 5AZJA 3G4SN 3HPOA 1NWKA 4FPAA 3HO1A 4JI4K 4PL7A 2HNZA 4JI2K 4DFPA 1REVA 3N4PA 5AZIA 2PY5A 3CHWA 2IVNA 5BRHA 2CGLA 1ATNA 4GKJK 3CJBA 5C2DA 1BOTO 3KJVA 4DS5A 4BROA 4IEIA 4PA1A 1ATRA 1ASVA 3L2UA 3EY1A 3LP3A 4BR4A 1QVGM 5IT9O 4RCHA 4CHZA 2V51B 4YFUA 3JYTA 4OPHA 4CFAA 2P9NB 3V1RA 2OYQA 4M3WA 4H8KA 5BRFA 1NOYA 3SV4A 3OYKA 3BY5A 2QM1A 1X9WA 3O9TA 4KHQA 1OKJA 3AO1A 3H3NO 1QSSA 2FXUA 3MX5A 2HHSA 3SJJA 3EZWA 4CEFA 4EIAA 4IDKA 4DCHA 4FW1A 4CESA 1IKYA 3SMPA 1ZYQA 5HRPA 1GOBA 1XC9A 3O6WA 3CFPA 4RG8A 2RKIA 4FJ8A 3L8BA 3WQTA 4E7HA 2P9IA 1YTUA 5AQUA 4EFHA 3KLIA 2FBTA 4CEZA 1FJGK 1X1PA 3D2EB 3CPEA 3SAHA 1WLJA 1IBMK 1NK6A 4CFDA 1I39A 4YHHK 4JS5A 4H5TA 1YXQA 1W97L 1MDUB 3A5MC 4O8KA 3QICA 3I56N 4BG8A 1VHXA 4ELTA 2HHXA 2RF2A 4PHTX 4O5FA 4JI5K 1YIJN 1K73O 1OH6A 2D0CA 4J8FA 5AQFA 3MCPA 4GVMA 4BR7A 2BGGA 3BP8A 4FLVA 2P5GA 4V19S 5JLFA 4OGEA 4AQYK 3BUZB 5I9EB 3KKRA 3UKRA 1U2VB 1U48A 3AO5A 1K8KB 3QESA 3E1YA 3SUPA 4IFVA 3U8XA 4IXCA 3VEXA 4ID1A 3BGRA 3I8DA 3S3OA 3DLKA 5EX5A 3AV9A 4B9TA 4FZXC 4FL9A 3TAQA 1T3VA 3CCJN 3CERA 1WSGA 5LJVA 4AHCA 5AR0A 4CHOA 4MQ3A 1UWBA 3H6EA 1I94K 3JXUA 3MAQA 3A5LC 3VERA 1HPZA 1DEJA 2W40A 3T3FA 4DLEA 3O3HA 1JLQA 2ETJA 4JKDA 2Y1IA 2V7YA 3VQBA 2KW4A 2G8IA 1A5WA 4HCCA 1CZ9A 4DR7K 4CZFA 3AVHA 4KO0A 4B9MA 5AQVA 2I5JA 4JK9A 3PLAA 1JLBA 4LFBK 2LSNA 4B9UA 4DSIA 3VQQA 3KIOA 3G6EN 1GLFO 1RT7A 3WXLA 4FWQA 1W2BM 1VQ5N 3LP2A 3L6QA 1IG9A 3OY9A 2YHYA 1NJXA 3OYFA 2RN2A 3WXJA 4DSEA 4FJ9A 1YAGA 4E19A 3VQDA 3VQ9A 1VQPN 2JWKA 3LANA 4Z4HA 4FLUA 1X9MA 4O4GA 1SAZA 3LALA 1VQON 4IOAL 3TTDA 4AF1A 4DKWA 4OGCA 3PIPL 1XNQK 1HYSA 1BU6O 4LF9K 4ELUA 1VSEA 5AQXA 5HLFA 3ITHA 3C6AA 3VA0A 1IV0A 3WNFA 3VOVA 1SL2A 5AQIA 5AQKA 3DOKA 4ISFA 1XHZA 3SV3A 1ZBLA 5GAHP 3VEZA 4CJ3A 4A59A 1WBBA 4DSJA 1IBKK 4IG3A 4QOZB 4R79A 1BGXT 5SWMA 2DFFA 3DI6A 1CZBA 2E88A 1TUYA 1V4TA 2ZF5O 1ZC6A 2P9PA 2E6MA 4YORA 4AM7A 2W6KA 3OYCA 3PX6A 2KQ2A 1LV5A 4M3ZA 2IS3A 3CCMN 1NKCA 4A5BA 1ASUA 3A8YA 4FK2A 3MEGA 2HHQA 5JENA 3V9WA 3OJUA 4O0IA 4B9SA 3OYLA 1QTMA 4KHYA 4BWMA 3TTCA 5JLHA 3AY9A 3B6PA 4CZJA 5KQ8A 4I6MA 5TKWA 1NG9A 3H1VX 4Z0UA 3QIPA 2YCHA 3C6TA 3R6MA 1HMVA 2A3ZA 2QXFA 4CJWA 4DQRA 4JV5K 4FM0A 1U4BA 1Z05A 4CZEA 4O0JA 3KVGA 4JYAK 3O1WA 4CZIA 1GLCG 3KWIA 2FBXA 3K5LA 1C0GA 3VGMA 4C23A 5BPNA 4FWLA 1RFQA 1YVNA 1BHLA 4CJ4A 4KB0A 2A5XA 2Q3SA 3AVCA 3LM2A 3DM2A 4M7XA 1NBWA 1IH7A 2CGJA 1UA0A 1K8AO 4HUEA 4DR3K 5KGWA 2KLAA 3LDSA 4RTFD 4DV5K 3CC4N 3KK2A 2P9LA 4LC9B 1TKZA 3T1YK 4CJPA 4B1ZA 4ID5A 1YF5L 3QEPA 3U4LA 4FLYA 3GBTA 2OPQA 1RDBA 4DTUA 3UKUA 2PYLA 3M8QA 2P9KB 1RT4A 1SUQA 2Q2RA 3LZJA 4BRFA 1XUPO 3H3OB 3I0RA 1X3NA 5BRDA 2P9SA 4CFBA 2Q97A 4BRIA 5BR8K 4JI7K 3SMSA 3P83D 3KLEA 3DAWA 1BI4B 5KGXA 2ZJRL 4OLAA 2VCPA 1JCFA 3ENBA 4FWMA 1BA1A 3VGKA 2UUAK 4K0KK 3HBTA 3MXJA 4JD2B 2ZE2A 4R5PA 4BRPA 3HK2A 4E7JA 5KRSA 4AM6A 1VQMN 2G8KA 2A42A 4AHRA 3U9DA 2HVHA 4FPBA 1ITGA 3C95A 2I7PA 3NGZA 3MN9A 3M6GA 4NLBA 1RBTA 4GY2B 4LY7A 1NK7A 3OA9A 1JKHA 1JCEA 3OYJA 1ILYA 3ZT0A 1VSFA 1SZ2A 4DV1K 1Q82O 1N5YA 3WEEA 3F73A 2OTLN 4LF7K 4JN4A 3L2QA 4F2SA 3AVKA 4M41A 1S9GA 4IO8A 2HNYA 3VESA 4CJ7A 2OPPA 4KH6A 5BR9A 1FKPA 4J2EA 2A40A 3CMAN 3HP6A 4AHTA 4JRQA 4CECA 4BWJA 4CK1A 2A1RA 3SPYA 3RWUA 1WOQA 5E26A 2ZD1A 5JVGL 3TSPA 1VQ7N 2WTUA 1XI1A 3ZSWA 2F4VK 4BRDA 4WQ4C 3DJCA 4DSKA 3C65A 1NGHA 2KKZA 1T44A 4DR5K 5JS2A 3LWMA 3HSCA 1ZXOA 1WSEA 3DYAA 5LJWA 2O8DB 3GL1A 1ZBUA 4B9QA 1P90A 3CPWM 3A5NC 3V9ZA 1SS6A 4CBXA 3PO4A 3O9SA 2X6NA 1IJJA 2DPNA 4IKFA 2FBYA 4F3OA 3M1FA 4DQPA 1HNVA 1Z6RA 1J5OA 4CK2A 1NU0A 4DR6K 3HP9A 3AA3A 1NGAA 4ELVA 4BDPA 4KB1A 2HF3A 4DV4K 1NKBA 3THYB 4CZKA 1WAFA 4HHTA 5FPNA 3SQ4A 1GLEG 1Z25A 4F4KA 4JEPA 4OJRA 4H0PA 1NGFA 3K58A 1WBDA 3ZSRA 1Q81O 4NCAA 5CZ2A 2IC3A 5GINA 3NDKA 5HRSA 3BF3A 1N6QA 5JVHL 4IG0A 4CEEA 1KQSM 1S22A 4RW7A 3FE1A 1IKVA 3E01A 2H3GX 5GAEP 1BQMA 4FJ5A 3D7EO 3AAPA 5D3GA 3NH0A 1LWEA 1JL2A 5AQJA 4QS9A 4BGBA 1QQNA 4L8RB 3S5TA 2BE2A 4KFBA 1TYQB 1NGEA 3P4IA 4W5NA 4KI6A 1TL1A 1NJIO 3NF6A 2B4JA 4BVOA 2CH6A 4JKGB 2E8AA 4DTSA 5AQPA 5AZJB 1BG3A 1KTQA 1C0UA 4CIEA 4OPKA 2VGMA 3IUCA 4EHTA 4BRGA 1WN7A 3DOLA 3SPZA 3TR8A 1KAYA 4DU4A 1NM1A 4PKHA 4B8AB 3ZSOA 4CEOA 5AZIB 1E4GT 4I7FA 3WQUA 4FJLA 5KI6A 1EKEA 3T7ZA 3BEXA 1T03A 4KTWA 4H0OA 4QAGA 4BC2A 1Z26A 2Q0RA 4WFAL 2YHBA 3DLGA 1QS4A 3VQ6A 3E9PA 4Z4IA 3PSIA 3VQ4A 2BTFA 3VQ7A 4JK7A 1UA1A 4NXMK 1KVAA 5F0XA 3VTIA 4MLHA 2HHWA 2PAVA 4FCYA 3ULEA 1RDDA 2HHTA 2O8FA 3VQEA 1RTHA 2XRIA 4FZZA 5AQRA 2DFHA 3PUFA 5C25A 3OS2A 2HBJA 2X74A 1HNIA 3SQ0A 3QNNA 3CYGA 5F1XA 4RW6A 1Y97A 3AVNA 3EKSA 3NFAA 1BIZA 4FWOA 3K0SA 4M3TA 3EKUA 2O8CB 3LPUA 5CR4A 4NCBA 5ADXH 2HHUA 4WFBL 4CW7B 4EP5A 5DM7L 3FZMA 5AQNA 1C1AA 1UOCA 2FC0A 2FSKA 1WB9A 3AVGA 3QEIA 4M3XA 2P9IB 3AA4A 3WNHA 2PFUA 3VGLA 3WXMB 3OBWA 3KD5E 3VQCA 4GVEA 4CJLA 1TGOA 3CMEN 1U47A 2JWLA 4OX9K 3THWB 2YNFA 3QFPA 1NK4A 4CBWA 2GWKA 3THVA 3OYEA 4HTUA 3QEWA 4ZHRA 1YVUA 3VF6A 1EWRA 3D6RA 3R3LA 1J9AA 3MN5A 2O8BA 3O9QA 2DY4A 5A2QO 1EETA 5J2MA 1KAXA 1J54A 3UKRB 4GW6A 2QEXN 4KHSA 5C15A 5ADXA 1YJNN 4OKJA 1C1BA 4CGDA 2ZJPL 4EAHD 4JK8A 4CJVA 4O44A 4KH5A 2E1ZA 3CYMA 4A62A 4CIFA 4MDBA 4CJSA 1U45A 4CZHA 5B8HA 4ISGA 3KK1A 2NRWA 3PX4A 4K42A 3M8SA 3OVNA 4FK0A 4CF9A 3K5MA 3J81O 1RT2A 3TAMA 4BQZA 2P9UA 4Q5VA 2A6AA 5MLCQ 4K8ZA 3SCXA 4NLCA 4JHDA 3CETA 3KTQA 4AHVA 3G71N 2ZM6K 1OVYA 3DXKB 1RTJA 3CXCM 1JLEA 3ZSZA 3WNEA 1N34K 5EXWA 4H5RA 5HBMA 3HXMA 1ASWA 3RRHA 3ZLJA 4FM2A 3LDQA 5F2RA 2OPSA 4CJ5A 3ZSXA 1XQSC 1RDUA 2UXBK 2WOMA 3FZFA 3AARA 4FK4A 4DQSA 4CE9A 3AO2A 1U6ZA 1X9JA 4CK3A 4DQIA 1HKCA 1T7PA 1HUXA 3LZIA 4NB4A 1C0FA 2Z1HA 4I2PA 5HRNA 4HWIA 4B08A 4QCLA 5ELZA 4E7IA 3DRPA 1YHQN 3QFUA 4BQLA 4WQ4A 3VTHA 2P9NA 3QERA 2QWLA 4ILJA 2KFNA 4E0DA 4IOXA 3SUOA 3LDPA 4H0VB 2FBVA 1RTDA 4UQGA 1UAXA 3M8RA 2HHIA 1G15A 1GLJO 4N76A 2ASOA 3K5OA 3CFOA 4GNIA 1TAUA 4JNEA 4DTMA 3QINA 1L5UA 3QMLA 3E9LA 2QWPA 1HQEA 2CH5A 2A41A 3VPZA 4W5OA 3ULDA 4Z4FA 4W5RA 4OVLA 2QWRA 2HBMA 4E7KA 3NF9A 4BDZA 3VENA 1N36K 4MLEA 4KHNA 3U3GA 3U3YA 4BC5A 3MCAB 4CEQA 2G8UA 1RT5A 1CZAN 3KLFA 2HW3A 3D2EA 1A5XA 3NAEA 2P9PB 4YOWA 2BDPA 3QIOA 1SKSA 3BZKA 2DFEA 1M1KO 1RDCA 2VG7A 1N8RO 3UIQA 4JKEA 3SUNA 1SV5A 1VQ9N 1MU2A 1VRUA 1K6YA 1YITN 1MWMA 5E41A 3RRGA 3AO3A 2YJFA 5M1NA 2W41A 2X6SA 1WAJA 4BR2A 2ZGZA 3KD1E 4KREA 4I6MB 4CF8A 1J5EK 1C6VA 3V6DA 2EHGA 3BF1A 3JS6A 1RT1A 4DR2K 1U2VA 3AVFA 3O9UA 2FLOA 5CYMA 4Y1CA 1K8KA 3R1XA 3I55N 4IFEA 3CCRN 4DF4A 2ITGA 1L3UA 2BUPA 3RSEA 2GUPA 4CF1A 3J80O 3OBYA 3SLCA 1HJOA 2D0PA 2YV0X 4CJQA 5GIPA 4BRHA 3C7NA 4DMNA 4CD3A 4DFJA 1MWKA 1OH5A 4LFAK 4LF4K 3FFKB 3O08A 4X65K 3QBXA 4UY8O 4CI6A 4CF2A 1W0HA 3T19A 4B3RK 2OCEA 3DWLA 3CF5L 4E3SA 1TUUA 4JKBA 4LF8K 3I8BA 2W6LA 1RT6A 3VQ8A 1YJWN 4JI6K 4AHUA 2KZMA 5KPTA 3S3NA 4C1NK 1KRPA 1C0TA 3MXMA 4BE2A 3WXIA 2BH1A 5I42A 2VQFK 3HOTA 3VN5A 3VF4A 3V4IA 1FW6A 2GX9A 2P9SB 3BZCA 2UUCK 5KPRA 2Q1NA 1YT3A 2V52B 1MA9B 4RW9A 2YI1A 4ZTFA 3L3UA 4XIUA 2IIRA 1NK8A 3LWLA 3SQ1A 1ZBFA 3HSTB 1QE1A 5C10A 2KHOA 3MX2A 1NK5A 4FOEA 5M1QA 4CGGA 3HVTA 1JL1A 5M1OA 4ISEA 2I7NA 1S1VA 3C0BA 3E66A 2HNDA 2F9TA 2XY5A 3O4QA 3IMXA 4B9LA 4LH5A 1JXBA 2B5JA 3K57A 3MWPA 3M5RA 1BCMA 4KPYA 3V81A 2Z1JA 3WEEB 3H08A 1QQCA 1LOTB 4FW2A 3K5NA 4JRPA 3THXA 1E4FT 2HMIA 3IFRA 2UUBK 5C2FA 4CEDA 1YI2N 1KC8O 1QHAA 3LP0A 1C1CA 2O8EB 1TK5A 1GLDG 1LW0A 5BN8A 3MWTA 4CGJA 2Q0UA 4CGHA 2C1GA 3ZETB 1J53A 4IDHA 2AJQA 1JCGA 3H46O 3PIOL 4H4OA 1RDWX 4F3TA 4JKCA 4CJRA 4PKGA 1JLFA 2D0OA 4NXNK 1WSFA 4OKEA 2HF4A 1NLVA 3T69A 4K41A 4KRFA 1R0AA 5FLXO 3MN7A 3JSMA 3CI5A 3IG1A 3KHYA 4JI3K 4WQ5C 5IWAK 4Q0BA 4IEEA 3Q7CA 3LAKA 4DU3A 2WONA 3ZEUB 3O8MA 1RDAA 3HT3A 3HPGA 4JI1K 1JJ2M 1U04A 1B9FA 1A5VA 2GBZA 3O4WA 2O4GA 4CBUA 3HPHA 1OH7A 2E4LA 5M1PA 4DFMA 3A0IX 2HHVA 3H1QA 5AQYA 2YX6A 3R8EA 2D5RA 1D5AA 3PV8A 4WF9L 1ESVA 5LY3A 1QVFM 2HBLA 2FSNA 3CD6N 3QBWA 2VGNA 3EN9A 3OYAA 1VAZA 2YNHA 3ZX3A 5SZTA 1VSIA 3VA3A 2QWMA 3CIPA 4FWKA 4Y1DA 2B6AA 2G8FA 4AILC 2QWNA 4DB3A 3VMFB 1CXUA 1W7AA 2JGUA 3OYMA 5LMUK 2Z1IA 3D2FA 3EE8A 3V9XA 4BRCA 2FF6A 2GELA 1KLNA 1HQUA 2DTUA 2XY7A 3MN6A 1DTTA 1D9FA 5FPMA 4X64K 1RILA 1BA0A 4BRMA 2PYJA 1BWFO 4EZ6A 1EQYA 2E5LK 2J4RA 2OANA 3CCEN 5BPLA 4RW4A 1BUPA 2ATQA 4BC4A 5GADP 3ZT2A 3SUQA 4H4MA 4O5BA 3U9ZA 3PSFA 3TU5A 1YJ9N 4C1NI 3AVAA 3HOSA 1LAWA 1S1TA 5KPZA 3TAGA 1S72N 1BI4A 4F8RA 3RR8A 4XH5A 4B3OA 4H5WA 2ZJQL 3J7ZO 4GKKK 5DM6L 3ISNC 1N32K 1HYVA 5BN9A 3VEVA 5C24A 4CGIA 4BRAA 2QKKA 1SKRA 3SBTA 1VSJA 4BG9A 3F9MA 3MDQA 2Q31A 4CZMA 4DV7K 4FJKA 4FWRA 4KKOA 4DTRA 5JICA 4DV6K 1L3VA 2E20A 4DHYA 3NVKA 4DS4A 4A61A 4HUGA 1EXQA 3A5OC 4FLZA 5BREA 1HJRA 2HB5A 3S41A 5M1FA 4B1VA 1XWLA 3MEEA 3ULEB 4EZ9A 2O8FB 3CJCA 3WUHA 3O9RA 3SI6A 5AQLA 4N41A 4OLBA 4B8CA 2KTQA 3K9JA 2YNGA 3LDOA 1GLLO 2QXLA 4Z4CA 3AVBA 3I33A 4NYFA 4B1YB 4A2BA 4H0TB 4H03B 3PO5A 3TABA 3CQYA 1NGCA 3O4NA 4BRQA 2QK9A 1T8EA 3D45A 4TSXA 4AH9A 2RHKA 4RW8A 1VK0A 2GTDA 4XH4A 1T05A 2QA4N 4Z94A 2W42A 4CJKA 2YJEA 2NNWA 3ZCMA 1DKGD 3ATUA 3J8AA 1EP4A 4KAZA 1KSPA 4CHQA 5K14A 4W5QA 3SBGA 3ZSQA 2E2QA 2P1JA 4AHSA 1VSKA 3NVMA 1QSYA 1EWQA 2D1KA 4KBOA 3GOIA 1XMOK 1DTQA 3RVCA 3AVMA 2XO7A 4YDUC 3THYA 5TKYA 1GOCA 3HI0A 4CHNA 4JLHA 3ZX0A 2V7ZA 4PQUA 3NF7A 1TKDA 5CYQA 2IAJA 4MO4A 4BRKA 3TAFA 1ZBHA 2ITMA 1NMNA 2AP1A 4JI8K 2CGKA 4W5TA 4E7LA 1WUAA 3ZT1A 1QQOA 1RBRA 4ZTJA 5KRTA 1RCHA 1NMDA 3ZSYA 1S5JA 1NK9A 1VSHA 3UE5A 1LWFA 4FJNA 1I3AA 3HM9A 4LF5K 1SL1A 4DG1A 1BO5O 1VSMA 5J2PA 1FKOA 1TYQA 5J1EA 4DTOA 1G99A 3EYZA 1BQNA 1JLGA 5GIOA 3FFIA 3L2VA 3E9OA 3C94A 4U67L 1N33K 1M90O 4FJGA 4E1NA 4CD1A 3TI0A 4KHPK 2FSJA 1KXPA 4NO7A 3SQ2A 1NGJA 3R9PA 4BE0A 3J7AP 2E2NA 2D0AA 1NGIA 3TARA 2YHXA 1GOAA 1QQMA 4M3UA 4CHPA 3KLHA 3FZLA 5HRRA 2ZGYA 4HCBA 1S6PA 5CE3A 2EWSA 1BIUA 1RGIA 2HOEA 4BE1A 1HNWK 1JLCA 3OYBA 3NH1A 4WFNL 3OHRA 4JKFA 4FLTA 1T6CA 2HSTA 3ZT3A 3VQ5A 3DXMA 1O13A 3I0SA 1WSIA 4OPJA 1DLOA 3P5JA 3M8PA 2VQEK 3HYFA 4EHUA 4C8MA 3CJ1A 5FPEA 2KFZA 2VG6A 5AQMA 1NJWA 1V4SA 4IJAA 4FVUA 2O8CA 4WQ5A 4YNQA 1RT3A 5LL6Z 1TV6A 4M3RA 2OTJN 1E3MA 3MXIA 3AVLA 4XH1A 5AQTA 4C8NA 3LP1A 3IS9A 3V1OA 4E89A 2Q36A 1XNRK 2GUIA 4C8OA 3EL2A 1O1WA 4FVMA 2RE2A 3CC2N 3WT0A 1RTIA 2NZTA 4CIGA 1R59O 1TL3A 3S9HA 3THWA 4FJ7A 3NHGA 1KVCA 4OPAA 4DTNA 4BVPA 4IJNA 1Q86O 4K8XA 3QEXA 4HTLA 4IOCL 3SJHA 2IVOA 4U7BA 2NRXA 4NCGA 5M1KA 1QZ6A 3VEYA 3L3VA 4Z4EA 1S3XA 3LDNA 4J2AA 3B8AX 4XEIA 4FJHA 3ATVA 1KAZA 1D8YA 4B3MK 4DR4K 4E72A 1C0MA 3CFRA 4FJJA 1CXQA 2F7TA 3DLEA 2WC9A 2E1YA 3RSEB 4CJUA 2IOCA 3SAFA 1RBVA 4LD0A 5EY4A 2P5OA 2A1SA 2QI2A 3MMVA 3C7NB 3VF2A 4I2QA 4A5AA 4DV2K 5JS1A 4QS8A 4KI4A 1HKGA 4B3SK 1GLAG 2JLEA 3O3GA 1KFDA 3NF8A 1NK0A 4KHWA 4LF6K 1VQKN 3HRGA 3VEWA 1FK9A 4C8KA 3OYNA 3G25A 1TK0A 3V1QA 3IRXA 3DXKA 1TKTA 4X66K 3HVRA 1VQLN 2QWOA 4B1XB 1P8ZA 3AVJA 4F2RA 4H0XB 1TVRA 2PZSA 3AA2A 4GMJB 4BRLA 4DSFA 3O80A 4KTZA 3V9UA 3RMAA 3KK7A 3DLBA 3L2RA 2HHHK 1S1UA 3K2PA 2GEMA 4JKHA 2ZQBA 4QS7A 4FLXA 4FWSA 4FJXA 1EO1A 4A2AA 3AGKA 5AQGA 3S3MA 2NRZA 3L0QA 1NGBA 4GV9A 4M63C 2NLXA 3TWHA 1T6DA 4K25A 5HROA 4M7YA 3C6UA 1L3TA 3KZBA 2GWJA 3AAQA 3TSUA 4JI0K 4O8UA 3O5BA 3WXKA 4L3QA 4BACA 3PY8A 1VQ4N 4B9NA 3SAGA 4M45A 1VSLA 4DFKA 1SL0A 3EE9A 3DRSA 3ID8A 1SKWA 2ZWHA 1XHXA 3OYIA 1NKEA 2BANA 3THXB 4ICLA 1EX4A 2UXDK 4FJMA 2P9LB 4CVNE 2OPRA 3CCUN 3D0PA 3VETA 2P51A 5JMVA 2OA8A 4IFYA 1S1XA 4PWDA 4BR5A 1KVBA 2QTDA 3LM9A 4YOYA 3UKUB 3W0LA 4FLWA 3OW2M 1IKWA 3LAMA 5H1SQ 3HL8A 2YKMA 2ASPA 3FZHA 4YDUA 1Q9YA 3V9SA 3NCIA 3F5TA 4GV3A 1LW2A 2IDOA 5AQOA 4DUYK 3BDPA 2F9WA 2YHWA 3B6OA 4GV6A 2XY6A 2IGIA 4BECA 5GAGP 4B1WB 4DTXA 3EZ5A 1VQNN 2AA4A 3O3FA 3QETA 2G8WA 3CG7A 3N4QA 3DLLL 1HNZK 4B3TK 3M3ZA 1Q8IA 3UB5A 3K9KA 1ZBSA 4N56A 5DMRA 4N5SA 3DLRA 1U49A 2VWKA 3RMCA 5CHIA 1TK8A 1KLMA 3SNNA 3H45C 3NMUA 4J2BA 3SK3A 1GLBG 3EO3A 3FGUA 3L4QA 4FWNA 3QDKA 2VYPA 3KWGA 1QZ5A 4FOIA 4M3YA 3L4IA 5DK5A 4PUOA 4DV0K 1KFSA 2WBNA 1TAQA 1WSJA 3P39A 2E6LA 3F9KA 1KCFA 4IWVA 3RMBA 2NRTA 3SZ2A 4YY3K 1S1WA 3KK3A 3ZYYX 3AO4A 4CF0A 1DT9A 1RBSA 4WCEL 3D2FB 4JKAA 3TAPA 3ENHA 5EVZA 5J2NA 3KLGA 2HVIA 4OO1J 4PL8A 1WSHA 4H0YB 5EOYA 4BEBA 4CJTA 3AA5X 4C8LA 4J2DA 4WYBA 5FPDA 1SQKA 1HKBA 5I3UA 5HL7L 3ZT4A 5HOOA 1NNEA 2EX3A 3OS1A 2QWQA 1HNXK 5BPMA 5C0YA 1L3SA 2OZMA 1S9EA 4BR9A 1IBLK 3P1GA 4DQ8A 1BL3A 4CGFA
chains in the Genus database with same CATH topology
2RHKA 4A62A 3HZ6A 2GTDA 5AQXA 4MDBA 4RWTA 3GG4A 4XH4A 1VQ6N 3C6AA 2QA4N 3P31A 3CCVN 4YOUA 4CZHA 5B8HA 4ISGA 4Z94A 2NRWA 4K42A 2YJEA 3MK6A 2NNWA 3VOVA 1J6ZA 1DKGD 5AQIA 3ATUA 3J8AA 4BE7B 5AQKA 4BQZA 2P9UA 4KH4A 4A57A 2A6AA 4FO0A 3SBGA 5MLCQ 4CZLA 4ISFA 4NLCA 1ATSA 2E2QA 2E2PA 3CETA 4JHDA 5AQSA 3CJAA 5GAHP 3NVMA 3G71N 4XJXA 3VEZA 1OVYA 3ENOA 2NRRA 4A59A 2D1KA 3ID6A 3DXKB 4KBOA 3CXCM 3GOIA 1VQ8N 4R79A 3TSQA 5EXWA 1BDGA 4H5RA 1Q7YO 1H1VA 4K43A 3RVCA 2E88A 1TUYA 3LDQA 5F2RA 4YDUC 2VWBA 5TKYA 3F2KA 3HI0A 1V4TA 1XQSC 1RDUA 3ZX0A 2V7ZA 3FZFA 3AARA 2ZF5O 1ZC6A 2P9PA 4YORA 4AM7A 3HM8A 1U6ZA 1X9JA 1LCUA 4MO4A 4BRKA 1HKCA 3ZX2A 1HUXA 1DGKN 4NB4A 2ITMA 1C0FA 3CCMN 2AP1A 3IKMA 4A5BA 4B1UB 2CGKA 4HWIA 5KQDA 1WUAA 1QQOA 3TTFA 3ZETA 3A8YA 3HTVA 1NMDA 5ELZA 2PBDA 1YHQN 3QFUA 2P9KA 4BQLA 4WQ4A 3UE5A 3TTCA 2P9NA 3VTHA 2QWLA 4ILJA 4IOXA 5JLHA 3AY9A 1Q18A 3LDPA 4CZJA 5KQ8A 4H0VB 4I6MA 5TKWA 3H1VX 4IO9L 2YCHA 4BREA 1BO5O 3R6MA 4ILGB 4E1JA 1GLJO 3CCLN 2A3ZA 1TYQA 2ASOA 4IZ9A 1Z05A 4CZEA 4GNIA 3KVGA 2IVPA 3O1WA 4JNEA 1G99A 4CZIA 1GLCG 3KWIA 4JD2A 5GIOA 3QMLA 2W00A 2ASMA 5AQHA 3E9OA 3E9LA 2QWPA 1C0GA 3VGMA 4C23A 4U67L 5BPNA 1M90O 4FWLA 1RFQA 1YVNA 2CH5A 2A41A 3FLCO 3GDQA 3VPZA 3ZEUA 1Y64A 4CD1A 4H5NA 2NRHA 2HMPA 2A5XA 1KXPA 2FSJA 3C6HA 4NO7A 2QWRA 2HBMA 3LM2A 4M7XA 3VENA 1K9MO 1NBWA 4MLEA 4MDAA 2CGJA 4BC5A 1NGJA 3R9PA 5AQZA 1K8AO 3MCAB 2E2NA 1CZAN 1NGIA 1HX1A 3D2EA 3CC7N 2YHXA 1QQMA 2NRVA 2KLAA 2P9PB 4JAXA 4YOWA 4RTFD 3FZKA 3FZLA 5E84A 3CC4N 2P9LA 2ZGYA 4LC9B 1M1KO 3CCQN 1IG8A 4B1ZA 3CJ7A 1N8RO 5CE3A 1YF5L 2EWSA 4JKEA 4ILHA 3U4LA 3GBTA 2C1IA 1RGIA 2HOEA 1VQ9N 3P38A 1YITN 1MWMA 1D4XA 3UKUA 5M1NA 2P9KB 2YJFA 2Q2RA 3VEOA 2W41A 4WFNL 4BRFA 1XUPO 3OHRA 4JKFA 4BR0A 1T6CA 3H3OB 4BR2A 2ZGZA 2HSTA 3CJ9A 4BY9C 1X3NA 4I6MB 2P9SA 3DXMA 5BRDA 1O13A 2Q97A 4BRIA 1KD1O 3SMSA 5AFUH 3BF1A 1X3MA 3DAWA 3JS6A 2ZJRL 1U2VA 2VCPA 1JCFA 2FLOA 3GE1A 3ENBA 3O9UA 4FWMA 4EHUA 1BA1A 1K8KA 3R1XA 3I55N 4IFEA 3CCRN 2BUPA 3CJ1A 3RSEA 3VGKA 4H5VA 1XC3A 3HBTA 2GUPA 4JD2B 3LL3A 5FPEA 4YOVA 4YOTA 4BRPA 5AQMA 3OBYA 1V4SA 4AM6A 4IJAA 3SLCA 4FVUA 1HJOA 1VQMN 2WUSA 2A42A 2D0PA 4WQ5A 3Q7BA 4Y0WA 4BC3A 3U9DA 2E2OA 4FPBA 2OTJN 5GIPA 4BRHA 2I7PA 3C7NA 4XH1A 5AQTA 4BGAA 3MN9A 4CD3A 3M6GA 4NLBA 2UYTA 1MWKA 4GY2B 3OA9A 2Q36A 1YUWA 3FR0A 3FFKB 4YOXA 1JCEA 1ILYA 3O08A 1SZ2A 4F9OA 3EL2A 3QBXA 4UY8O 4CI6A 1Q82O 4G9ZA 3WEEA 3DWLA 2RE2A 3CF5L 3CQXA 3AGRA 3WT0A 4JN4A 3TPQA 4CZGA 2OTLN 3CC2N 2NZTA 1TUUA 4JKBA 4IO8A 1R59O 4PKIA 3I8BA 3VESA 2D4WA 4CJ7A 2WFBA 4KH6A 5BR9A 4BRNA 2A40A 3CMAN 5C12A 4OPAA 1YJWN 1HLUA 4BVPA 2HBKA 4IJNA 1Q86O 4HTLA 5KPTA 4IOCL 3SJHA 2IVOA 1WOQA 4U7BA 5E26A 1HPMA 2NRXA 5AFUA 4C1NK 5JVGL 3W3DA 5M1KA 3TSPA 1NGDA 1VQ7N 1QZ6A 3WXIA 3VEYA 4WQ4C 4BRDA 2BH1A 5AQQA 3DJCA 1S3XA 3LDNA 3QB0A 3C65A 3HOTA 1NGHA 3IDHA 3VF4A 2KKZA 3CCSN 3B8AX 1T44A 2GX9A 2P9SB 3DXMB 2QW9A 4XEIA 3LDLA 5KPRA 2Q1NA 3ATVA 1KAZA 3O1BA 3HSCA 2V52B 1ZXOA 1MA9B 2F7TA 2YI1A 5LJWA 2IIRA 3GL1A 2WC9A 2E1YA 3RSEB 4B9QA 1P90A 2P9UB 3CPWM 4FSVA 5AQWA 3A5NC 3SAFA 1SS6A 4CBXA 4JHDB 5C10A 1NGGA 2KHOA 3O9SA 5EY4A 3MX2A 4FOEA 5M1QA 1IJJA 2DPNA 5M1OA 4ISEA 2I7NA 3C0BA 2QI2A 3MMVA 3E66A 2F9TA 3C7NB 3IMXA 4MO5A 4JKGA 3M1FA 2FF3B 4FWPA 3VF2A 5AZJA 3G4SN 1Z6RA 4A5AA 1NWKA 4FPAA 1NGAA 4QS8A 3MWPA 1HKGA 3M5RA 4PL7A 2HF3A 1GLAG 4CZKA 3WEEB 5FPNA 1VQKN 3N4PA 1GLEG 3HRGA 5AZIA 3VEWA 1LOTB 4JEPA 4H0PA 1E4FT 3G25A 3IFRA 1NGFA 5C2FA 3CHWA 1YI2N 2IVNA 5BRHA 1KC8O 2CGLA 1ATNA 1QHAA 1Q81O 3CJBA 5C2DA 3DXKA 1GLDG 1BOTO 5BN8A 3MWTA 4BROA 4IEIA 2Q0UA 1ATRA 5GINA 1VQLN 2C1GA 3BF3A 2QWOA 3ZETB 4IDHA 4B1XB 5JVHL 1P8ZA 1KQSM 1S22A 4H0XB 4BR4A 1JCGA 3H46O 1QVGM 3FE1A 3PIOL 4RCHA 2V51B 4OPHA 1RDWX 2P9NB 4JKCA 4PKGA 2H3GX 5GAEP 4BRLA 2D0OA 5BRFA 3D7EO 3AAPA 3O80A 2QM1A 3KK7A 2HF4A 3O9TA 1NLVA 1OKJA 3T69A 5AQJA 3H3NO 4QS9A 2GEMA 1QQNA 2FXUA 4JKHA 4BGBA 4QS7A 4K41A 4FWSA 3MX5A 1TYQB 1EO1A 4A2AA 3AGKA 1NGEA 3P4IA 3EZWA 3MN7A 4EIAA 3CI5A 3KHYA 5AQGA 2NRZA 3L0QA 1NGBA 4DCHA 4M63C 1NJIO 2NLXA 4GV9A 4WQ5C 1T6DA 4K25A 3SMPA 4M7YA 4IEEA 3Q7CA 3KZBA 4BVOA 3ZEUB 3O8MA 2CH6A 4JKGB 2GWJA 2E8AA 3AAQA 5AQPA 5AZJB 3TSUA 1BG3A 1JJ2M 3O6WA 4O8UA 3O4WA 3O5BA 3WXKA 4CBUA 2VGMA 3IUCA 4EHTA 4L3QA 5M1PA 3A0IX 4BRGA 1VQ4N 3H1QA 3SAGA 5AQYA 2YX6A 3WQTA 2P9IA 1KAYA 5AQUA 3R8EA 3EE9A 1NM1A 4PKHA 4EFHA 3ID8A 4WF9L 2ZWHA 1ESVA 5AZIB 3D2EB 5LY3A 1E4GT 1QVFM 2HBLA 2FSNA 3CPEA 3WQUA 3SAHA 3CD6N 3T7ZA 3BEXA 3QBWA 2VGNA 3EN9A 4H0OA 1VAZA 4H5TA 1YXQA 2P9LB 4BC2A 1W97L 2Q0RA 4WFAL 1MDUB 3ZX3A 3CCUN 3A5MC 4O8KA 2QWMA 3CIPA 3QICA 4FWKA 3VETA 4BG8A 5JMVA 3I56N 3E9PA 2QWNA 4PHTX 4DB3A 3VMFB 4BR5A 4O5FA 2BTFA 2QTDA 3LM9A 4YOYA 1YIJN 3UKUB 1K73O 4JK7A 3W0LA 3OW2M 5F0XA 4J8FA 4MLHA 3D2FA 2PAVA 5AQFA 3MCPA 3VTIA 4BR7A 5H1SQ 3ULEA 3BP8A 3EE8A 2ASPA 4BRCA 2FF6A 3FZHA 5JLFA 4YDUA 2GELA 3F5TA 5AQRA 4GV3A 3BUZB 5AQOA 5I9EB 3UKRA 3MN6A 1U2VB 2F9WA 1K8KB 2HBJA 2YHWA 5FPMA 4GV6A 3E1YA 4BECA 1BA0A 4BRMA 3U8XA 1BWFO 4IXCA 4B1WB 5GAGP 5F1XA 1EQYA 3EKSA 1VQNN 3VEXA 2AA4A 2J4RA 2OANA 4FWOA 3CCEN 3DLLL 3N4QA 5BPLA 3EKUA 1BUPA 3M3ZA 4BC4A 5CR4A 5GADP 5EX5A 5ADXH 3UB5A 4WFBL 4FL9A 3K9KA 1ZBSA 5DM7L 3U9ZA 1T3VA 3FZMA 5AQNA 3CERA 3CCJN 5LJVA 3TU5A 1YJ9N 2FSKA 4C1NI 3HOSA 5CHIA 5AR0A 5KPZA 2P9IB 1S72N 3H45C 3NMUA 3SK3A 3H6EA 4XH5A 1GLBG 2PFUA 3EO3A 3A5LC 3FGUA 3JXUA 3L4QA 4FWNA 3VGLA 3VERA 3WXMB 1DEJA 2W40A 3OBWA 4H5WA 2ZJQL 3QDKA 2VYPA 3KWGA 1QZ5A 4JKDA 3J7ZO 4FOIA 2V7YA 3L4IA 4GVEA 5DM6L 5BN9A 3VEVA 3CMEN 4BRAA 2JWLA 2WBNA 3SBTA 4BG9A 3F9MA 4CZFA 3MDQA 3QFPA 3P39A 2Q31A 4CBWA 4CZMA 2GWKA 5AQVA 4FWRA 5JICA 2E20A 4DHYA 3NVKA 4IWVA 4JK9A 3PLAA 2NRTA 4A61A 3VF6A 3ZYYX 3A5OC 3D6RA 5BREA 4WCEL 1DT9A 3D2FB 4JKAA 3S41A 5M1FA 4B1VA 3ENHA 3R3LA 3ULEB 5EVZA 3G6EN 1GLFO 3WXLA 3MN5A 3CJCA 4FWQA 3O9QA 3O9RA 3WUHA 5AQLA 1W2BM 4PL8A 1VQ5N 4OO1J 3L6QA 1KAXA 4H0YB 5EOYA 4BEBA 2YHYA 4WYBA 3UKRB 2QEXN 3K9JA 3WXJA 3LDOA 1SQKA 1GLLO 1HKBA 5C15A 5ADXA 5FPDA 5HL7L 1YJNN 1YAGA 2ZJPL 4EAHD 4JK8A 2QXLA 5HOOA 1VQPN 3I33A 4B1YB 2QWQA 4A2BA 4H0TB 2JWKA 2E1ZA 4KH5A 4H03B 5BPMA 4IOAL 5C0YA 1SAZA 1VQON 3CQYA 1NGCA 3TTDA 4BR9A 4AF1A 4BRQA 4DKWA 3PIPL 4DQ8A 1BU6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A62 A;  3HZ6 A;  2GTD A;  5AQX A;  4RWT A;  3GG4 A;  4XH4 A;  4CZH A;  5B8H A;  4ISG A;  4Z94 A;  4K42 A;  2YJE A;  3MK6 A;  3VOV A;  1J6Z A;  1DKG D;  5AQI A;  3ATU A;  3J8A A;  5AQK A;  4BQZ A;  2P9U A;  2A6A A;  4FO0 A;  4CZL A;  4ISF A;  1ATS A;  2E2Q A;  2E2P A;  3CET A;  4JHD A;  5AQS A;  3CJA A;  3VEZ A;  3ENO A;  2D1K A;  3DXK B;  4KBO A;  3GOI A;  5EXW A;  1BDG A;  4H5R A;  1H1V A;  4K43 A;  2E88 A;  1TUY A;  3LDQ A;  5F2R A;  4YDU C;  2VWB A;  5TKY A;  3HI0 A;  1V4T A;  1XQS C;  3ZX0 A;  2V7Z A;  3FZF A;  3AAR A;  2ZF5 O;  1ZC6 A;  2P9P A;  4AM7 A;  3HM8 A;  1U6Z A;  1X9J A;  1LCU A;  4MO4 A;  4BRK A;  1HKC A;  3ZX2 A;  1HUX A;  1DGK N;  4NB4 A;  2ITM A;  1C0F A;  2AP1 A;  4B1U B;  2CGK A;  4HWI A;  5KQD A;  1WUA A;  1QQO A;  3ZET A;  3A8Y A;  3HTV A;  1NMD A;  5ELZ A;  2PBD A;  3QFU A;  2P9K A;  4BQL A;  4WQ4 A;  3UE5 A;  2P9N A;  2QWL A;  5JLH A;  3AY9 A;  1Q18 A;  3LDP A;  4CZJ A;  5KQ8 A;  4H0V B;  4I6M A;  3H1V X;  2YCH A;  4BRE A;  1BO5 O;  3R6M A;  4E1J A;  1GLJ O;  2A3Z A;  1TYQ A;  2ASO A;  4IZ9 A;  1Z05 A;  4CZE A;  4GNI A;  3KVG A;  2IVP A;  3O1W A;  4JNE A;  1G99 A;  4CZI A;  1GLC G;  4JD2 A;  3QML A;  2ASM A;  5AQH A;  2QWP A;  1C0G A;  3VGM A;  4C23 A;  5BPN A;  4FWL A;  1RFQ A;  1YVN A;  2CH5 A;  2A41 A;  3FLC O;  3GDQ A;  3VPZ A;  3ZEU A;  1Y64 A;  4CD1 A;  4H5N A;  2HMP A;  2NRH A;  2A5X A;  1KXP A;  2FSJ A;  4NO7 A;  2QWR A;  3LM2 A;  4M7X A;  3VEN A;  1NBW A;  4MLE A;  2CGJ A;  4BC5 A;  1NGJ A;  3R9P A;  5AQZ A;  2E2N A;  1CZA N;  1NGI A;  1HX1 A;  3D2E A;  2YHX A;  1QQM A;  2P9P B;  4JAX A;  4RTF D;  3FZK A;  3FZL A;  5E84 A;  2P9L A;  2ZGY A;  4LC9 B;  1IG8 A;  4B1Z A;  3CJ7 A;  5CE3 A;  2EWS A;  3U4L A;  3GBT A;  1RGI A;  2HOE A;  1MWM A;  1D4X A;  3UKU A;  2P9K B;  2YJF A;  2Q2R A;  3VEO A;  2W41 A;  4BRF A;  1XUP O;  3OHR A;  4BR0 A;  1T6C A;  3H3O B;  4BR2 A;  2ZGZ A;  3CJ9 A;  1X3N A;  4I6M B;  2P9S A;  3DXM A;  5BRD A;  2Q97 A;  4BRI A;  3SMS A;  5AFU H;  3BF1 A;  1X3M A;  3DAW A;  3JS6 A;  1U2V A;  2VCP A;  1JCF A;  2FLO A;  3GE1 A;  4EHU A;  4FWM A;  1BA1 A;  1K8K A;  2BUP A;  3CJ1 A;  3RSE A;  3VGK A;  4H5V A;  1XC3 A;  3HBT A;  2GUP A;  4JD2 B;  3LL3 A;  5FPE A;  4BRP A;  5AQM A;  1V4S A;  4AM6 A;  4IJA A;  3SLC A;  1HJO A;  2WUS A;  2A42 A;  2D0P A;  4WQ5 A;  4Y0W A;  4BC3 A;  3U9D A;  2E2O A;  4FPB A;  4BRH A;  2I7P A;  3C7N A;  4XH1 A;  5AQT A;  4BGA A;  3MN9 A;  4CD3 A;  3M6G A;  2UYT A;  1MWK A;  4GY2 B;  2Q36 A;  1YUW A;  3FR0 A;  3FFK B;  1JCE A;  3O08 A;  1SZ2 A;  4F9O A;  3EL2 A;  3QBX A;  4CI6 A;  3WEE A;  3DWL A;  3CQX A;  3WT0 A;  4JN4 A;  3TPQ A;  4CZG A;  2NZT A;  1TUU A;  4IO8 A;  1R59 O;  4PKI A;  3I8B A;  3VES A;  2D4W A;  4CJ7 A;  5BR9 A;  4BRN A;  2A40 A;  1HLU A;  4BVP A;  4IJN A;  4HTL A;  5KPT A;  3SJH A;  2IVO A;  1WOQ A;  5E26 A;  1HPM A;  5AFU A;  3W3D A;  1NGD A;  1QZ6 A;  3WXI A;  3VEY A;  4WQ4 C;  4BRD A;  5AQQ A;  3DJC A;  1S3X A;  3LDN A;  3QB0 A;  1NGH A;  3IDH A;  3VF4 A;  3B8A X;  1T44 A;  2P9S B;  3DXM B;  2QW9 A;  4XEI A;  3LDL A;  5KPR A;  2Q1N A;  3ATV A;  1KAZ A;  3O1B A;  3HSC A;  2V52 B;  1ZXO A;  1MA9 B;  2YI1 A;  5LJW A;  2IIR A;  3GL1 A;  2E1Y A;  3RSE B;  4B9Q A;  2P9U B;  4FSV A;  5AQW A;  3A5N C;  4CBX A;  4JHD B;  1NGG A;  2KHO A;  5EY4 A;  4FOE A;  1IJJ A;  2DPN A;  4ISE A;  2I7N A;  3C0B A;  3MMV A;  2F9T A;  3C7N B;  3IMX A;  4MO5 A;  3M1F A;  2FF3 B;  4FWP A;  3VF2 A;  5AZJ A;  1Z6R A;  1NWK A;  4FPA A;  1NGA A;  4QS8 A;  1HKG A;  4PL7 A;  2HF3 A;  1GLA G;  4CZK A;  3WEE B;  5FPN A;  1GLE G;  5AZI A;  3VEW A;  1LOT B;  4H0P A;  1E4F T;  3G25 A;  3IFR A;  1NGF A;  3CHW A;  2IVN A;  5BRH A;  2CGL A;  1ATN A;  1QHA A;  3CJB A;  3DXK A;  1GLD G;  1BOT O;  5BN8 A;  4BRO A;  2Q0U A;  1ATR A;  3BF3 A;  2QWO A;  3ZET B;  4B1X B;  1P8Z A;  1S22 A;  4H0X B;  4BR4 A;  1JCG A;  3H46 O;  3FE1 A;  4RCH A;  2V51 B;  1RDW X;  2P9N B;  4PKG A;  2H3G X;  4BRL A;  2D0O A;  5BRF A;  3D7E O;  3AAP A;  3O80 A;  2QM1 A;  2HF4 A;  1NLV A;  1OKJ A;  5AQJ A;  3H3N O;  4QS9 A;  2GEM A;  1QQN A;  2FXU A;  4BGB A;  4QS7 A;  4K41 A;  4FWS A;  1TYQ B;  4A2A A;  1NGE A;  3P4I A;  3EZW A;  3MN7 A;  4EIA A;  3CI5 A;  3KHY A;  5AQG A;  3L0Q A;  1NGB A;  4DCH A;  4M63 C;  2NLX A;  4WQ5 C;  1T6D A;  4K25 A;  3SMP A;  4M7Y A;  4BVO A;  3KZB A;  3ZEU B;  3O8M A;  2CH6 A;  2GWJ A;  2E8A A;  3AAQ A;  5AQP A;  5AZJ B;  1BG3 A;  3O6W A;  3O4W A;  3O5B A;  3WXK A;  4CBU A;  3IUC A;  4EHT A;  4L3Q A;  3A0I X;  4BRG A;  3H1Q A;  5AQY A;  3WQT A;  2P9I A;  1KAY A;  5AQU A;  3R8E A;  4EFH A;  1NM1 A;  4PKH A;  3ID8 A;  2ZWH A;  1ESV A;  5AZI B;  3D2E B;  5LY3 A;  1E4G T;  3WQU A;  2FSN A;  3BEX A;  3QBW A;  3EN9 A;  4H0O A;  4H5T A;  1YXQ A;  2P9L B;  4BC2 A;  2Q0R A;  1MDU B;  3ZX3 A;  3A5M C;  4O8K A;  2QWM A;  3CIP A;  3QIC A;  4FWK A;  3VET A;  4BG8 A;  5JMV A;  2QWN A;  4DB3 A;  4BR5 A;  4O5F A;  2BTF A;  3LM9 A;  3UKU B;  3W0L A;  5F0X A;  4J8F A;  4MLH A;  3D2F A;  2PAV A;  5AQF A;  3MCP A;  4BR7 A;  3ULE A;  3BP8 A;  2ASP A;  4BRC A;  2FF6 A;  3FZH A;  5JLF A;  4YDU A;  2GEL A;  5AQR A;  3BUZ B;  5AQO A;  5I9E B;  3UKR A;  3MN6 A;  1U2V B;  2F9W A;  1K8K B;  2YHW A;  5FPM A;  1BA0 A;  4BRM A;  3U8X A;  1BWF O;  4IXC A;  4B1W B;  5F1X A;  1EQY A;  3EKS A;  3VEX A;  2AA4 A;  2J4R A;  2OAN A;  4FWO A;  5BPL A;  3EKU A;  1BUP A;  3M3Z A;  4BC4 A;  5EX5 A;  5ADX H;  3UB5 A;  4FL9 A;  1ZBS A;  3U9Z A;  3FZM A;  5AQN A;  3CER A;  5LJV A;  3TU5 A;  2FSK A;  5AR0 A;  5KPZ A;  2P9I B;  3H45 C;  3SK3 A;  3H6E A;  4XH5 A;  1GLB G;  3EO3 A;  3FGU A;  3A5L C;  3JXU A;  4FWN A;  3VGL A;  3VER A;  1DEJ A;  2W40 A;  4H5W A;  3QDK A;  2VYP A;  1QZ5 A;  4FOI A;  2V7Y A;  3L4I A;  5BN9 A;  3VEV A;  4BRA A;  4BG9 A;  3F9M A;  4CZF A;  3MDQ A;  3QFP A;  2Q31 A;  4CBW A;  4CZM A;  2GWK A;  5AQV A;  4FWR A;  5JIC A;  2E20 A;  4DHY A;  4IWV A;  4A61 A;  3VF6 A;  3A5O C;  5BRE A;  3D2F B;  3S41 A;  4B1V A;  3ENH A;  3ULE B;  5EVZ A;  1GLF O;  3WXL A;  3MN5 A;  3CJC A;  4FWQ A;  3WUH A;  5AQL A;  4PL8 A;  3L6Q A;  1KAX A;  4H0Y B;  5EOY A;  2YHY A;  4WYB A;  3UKR B;  3WXJ A;  3LDO A;  1SQK A;  1GLL O;  1HKB A;  5ADX A;  5FPD A;  1YAG A;  4EAH D;  2QXL A;  3I33 A;  4B1Y B;  2QWQ A;  4A2B A;  4H0T B;  2E1Z A;  4H03 B;  5BPM A;  1SAZ A;  3CQY A;  1NGC A;  4BR9 A;  4BRQ A;  4DQ8 A;  1BU6 O; 
#chains in the Genus database with same CATH topology
 4DUZ K;  3HZ6 A;  5HP1 A;  4RWT A;  3GG4 A;  1VQ6 N;  1HYZ A;  2D0B A;  3P31 A;  3CCV N;  1RBU A;  4CER A;  4CJF A;  4YOU A;  3NBP A;  3MK6 A;  3DLH A;  4DLG A;  1RNH A;  4BDY A;  1D9D A;  1J6Z A;  2QKB A;  5AJ3 K;  4BE7 B;  1ZBI A;  4KH4 A;  4A57 A;  4FO0 A;  4DSL A;  4CZL A;  1ATS A;  2E2P A;  5AQS A;  3CJA A;  1QHT A;  3NGY A;  4XJX A;  3ENO A;  4X62 K;  2NRR A;  3WNG A;  3ID6 A;  3T1A A;  3NH2 A;  1VQ8 N;  3RMD A;  3TSQ A;  1NJZ A;  1BDG A;  4KV8 A;  1H1V A;  1Q7Y O;  3MED A;  4K43 A;  3IAY A;  2VWB A;  3F2K A;  4IBN A;  4I9Q A;  3VQP A;  3PX0 A;  3HM8 A;  3NE6 A;  3QEV A;  1LCU A;  1TKX A;  4LSN A;  4DR1 K;  3ZX2 A;  4B9V A;  2O8E A;  1DGK N;  3ALY A;  3IKM A;  4B1U B;  1JLA A;  5KQD A;  3TTF A;  3ZET A;  2R7Y A;  2Y1J A;  3HTV A;  1NOZ A;  2PBD A;  2P9K A;  1HRH A;  3EEQ A;  4FM1 A;  4FXD A;  1Q18 A;  4DWI A;  4HVJ A;  3A2F A;  3L2W A;  3G10 A;  4DV3 K;  4IO9 L;  4BRE A;  4I9L A;  4ILG B;  3KKS A;  4E1J A;  3CCL N;  2NUB A;  4IZ9 A;  2UXC K;  4FJI A;  2IVP A;  4JD2 A;  2W00 A;  2ASM A;  5AQH A;  2F8S A;  4EP4 A;  3QO9 A;  2UU9 K;  2X78 A;  3GDQ A;  4KHU A;  3FLC O;  3OYG A;  3ZEU A;  1Y64 A;  4WE1 A;  4H5N A;  5T7B A;  2HMP A;  2NRH A;  4M42 A;  3C6H A;  2YHA A;  4CCH A;  4DTJ A;  2F96 A;  1K9M O;  4CJE A;  2YNI A;  4MDA A;  3TAN A;  3JAM O;  2KZZ A;  5AQZ A;  4OKK A;  1HX1 A;  1VRT A;  3OS0 A;  1HR0 K;  3G0Z A;  3CC7 N;  2NRV A;  3RR7 A;  4JAX A;  3FZK A;  5E84 A;  2F8T A;  3CCQ N;  1IG8 A;  4JS4 A;  3CJ7 A;  3K59 A;  4N47 A;  4ILH A;  3TAE A;  2C1I A;  5FRN A;  2XY8 A;  2VWJ A;  3P38 A;  1D4X A;  1W9H A;  1OH8 A;  3J7Y P;  3VEO A;  1LAV A;  4BR0 A;  3CJ9 A;  4BY9 C;  3T1H K;  1KD1 O;  5AFU H;  1X3M A;  5EU7 A;  3GE1 A;  3CQ8 A;  1B92 A;  5FDL A;  2O8D A;  3LPT A;  4MFB A;  1B9D A;  4H5V A;  5C42 A;  1XC3 A;  4PY5 A;  5KTQ A;  2G8V A;  3LL3 A;  4YOV A;  4FYD A;  3AVI A;  4YOT A;  4CEA A;  3RTV A;  2YKN A;  2WUS A;  1IKX A;  3Q7B A;  1F21 A;  4Y0W A;  5CZ1 A;  4BC3 A;  1JXE A;  3DRR A;  4FZY A;  2E2O A;  2O4I A;  3OYH A;  4BGA A;  5FRM A;  2UYT A;  1YTA A;  3DMJ A;  1YUW A;  3FR0 A;  1S6Q A;  4YOX A;  4F9O A;  3QNO A;  4G9Z A;  4DQQ A;  2O8B B;  4E1M A;  4DTP A;  3CQX A;  3AGR A;  1NJY A;  4CZG A;  3TPQ A;  4CFC A;  5LMN K;  3ASM A;  4PKI A;  2D4W A;  2WFB A;  2Z1G A;  4BRN A;  4CEB A;  1BCO A;  5C12 A;  4NYN A;  1QSL A;  3CM5 A;  3ZSV A;  1HLU A;  4KTQ A;  4LH4 A;  2HBK A;  2OZS A;  1HPM A;  1WNS A;  3VQA A;  3CM6 A;  5AFU A;  3W3D A;  1NGD A;  4DF8 A;  5CY4 A;  1X9S A;  5AQQ A;  4Z4G A;  4O55 A;  3QB0 A;  3IDH A;  3CCS N;  2GV9 A;  5FRO A;  3DXM B;  3OYD A;  4LFC K;  2QW9 A;  3LDL A;  3O1B A;  2RPI A;  4LSL A;  3MEC A;  1CLQ A;  1XMQ K;  3U6F A;  2G8H A;  1VSD A;  2P9U B;  3HJF A;  4FSV A;  5AQW A;  3OTO K;  3OJS A;  4JHD B;  1IO2 A;  1NGG A;  1LWC A;  4G1Q A;  1Q9X A;  4CHY A;  4HUF A;  2VG5 A;  1FXX A;  3SYZ A;  1OVQ A;  1BIS A;  2XHB A;  4MO5 A;  4DU1 A;  3QLH A;  4JKG A;  5J2Q A;  2FF3 B;  4FWP A;  3NGI A;  5AZJ A;  3G4S N;  3HPO A;  1NWK A;  4FPA A;  3HO1 A;  4JI4 K;  4PL7 A;  2HNZ A;  4JI2 K;  4DFP A;  1REV A;  3N4P A;  5AZI A;  2PY5 A;  3CHW A;  2IVN A;  5BRH A;  2CGL A;  1ATN A;  4GKJ K;  3CJB A;  5C2D A;  1BOT O;  3KJV A;  4DS5 A;  4BRO A;  4IEI A;  4PA1 A;  1ATR A;  1ASV A;  3L2U A;  3EY1 A;  3LP3 A;  4BR4 A;  1QVG M;  5IT9 O;  4RCH A;  4CHZ A;  2V51 B;  4YFU A;  3JYT A;  4OPH A;  4CFA A;  2P9N B;  3V1R A;  2OYQ A;  4M3W A;  4H8K A;  5BRF A;  1NOY A;  3SV4 A;  3OYK A;  3BY5 A;  2QM1 A;  1X9W A;  3O9T A;  4KHQ A;  1OKJ A;  3AO1 A;  3H3N O;  1QSS A;  2FXU A;  3MX5 A;  2HHS A;  3SJJ A;  3EZW A;  4CEF A;  4EIA A;  4IDK A;  4DCH A;  4FW1 A;  4CES A;  1IKY A;  3SMP A;  1ZYQ A;  5HRP A;  1GOB A;  1XC9 A;  3O6W A;  3CFP A;  4RG8 A;  2RKI A;  4FJ8 A;  3L8B A;  3WQT A;  4E7H A;  2P9I A;  1YTU A;  5AQU A;  4EFH A;  3KLI A;  2FBT A;  4CEZ A;  1FJG K;  1X1P A;  3D2E B;  3CPE A;  3SAH A;  1WLJ A;  1IBM K;  1NK6 A;  4CFD A;  1I39 A;  4YHH K;  4JS5 A;  4H5T A;  1YXQ A;  1W97 L;  1MDU B;  3A5M C;  4O8K A;  3QIC A;  3I56 N;  4BG8 A;  1VHX A;  4ELT A;  2HHX A;  2RF2 A;  4PHT X;  4O5F A;  4JI5 K;  1YIJ N;  1K73 O;  1OH6 A;  2D0C A;  4J8F A;  5AQF A;  3MCP A;  4GVM A;  4BR7 A;  2BGG A;  3BP8 A;  4FLV A;  2P5G A;  4V19 S;  5JLF A;  4OGE A;  4AQY K;  3BUZ B;  5I9E B;  3KKR A;  3UKR A;  1U2V B;  1U48 A;  3AO5 A;  1K8K B;  3QES A;  3E1Y A;  3SUP A;  4IFV A;  3U8X A;  4IXC A;  3VEX A;  4ID1 A;  3BGR A;  3I8D A;  3S3O A;  3DLK A;  5EX5 A;  3AV9 A;  4B9T A;  4FZX C;  4FL9 A;  3TAQ A;  1T3V A;  3CCJ N;  3CER A;  1WSG A;  5LJV A;  4AHC A;  5AR0 A;  4CHO A;  4MQ3 A;  1UWB A;  3H6E A;  1I94 K;  3JXU A;  3MAQ A;  3A5L C;  3VER A;  1HPZ A;  1DEJ A;  2W40 A;  3T3F A;  4DLE A;  3O3H A;  1JLQ A;  2ETJ A;  4JKD A;  2Y1I A;  2V7Y A;  3VQB A;  2KW4 A;  2G8I A;  1A5W A;  4HCC A;  1CZ9 A;  4DR7 K;  4CZF A;  3AVH A;  4KO0 A;  4B9M A;  5AQV A;  2I5J A;  4JK9 A;  3PLA A;  1JLB A;  4LFB K;  2LSN A;  4B9U A;  4DSI A;  3VQQ A;  3KIO A;  3G6E N;  1GLF O;  1RT7 A;  3WXL A;  4FWQ A;  1W2B M;  1VQ5 N;  3LP2 A;  3L6Q A;  1IG9 A;  3OY9 A;  2YHY A;  1NJX A;  3OYF A;  2RN2 A;  3WXJ A;  4DSE A;  4FJ9 A;  1YAG A;  4E19 A;  3VQD A;  3VQ9 A;  1VQP N;  2JWK A;  3LAN A;  4Z4H A;  4FLU A;  1X9M A;  4O4G A;  1SAZ A;  3LAL A;  1VQO N;  4IOA L;  3TTD A;  4AF1 A;  4DKW A;  4OGC A;  3PIP L;  1XNQ K;  1HYS A;  1BU6 O;  4LF9 K;  4ELU A;  1VSE A;  5AQX A;  5HLF A;  3ITH A;  3C6A A;  3VA0 A;  1IV0 A;  3WNF A;  3VOV A;  1SL2 A;  5AQI A;  5AQK A;  3DOK A;  4ISF A;  1XHZ A;  3SV3 A;  1ZBL A;  5GAH P;  3VEZ A;  4CJ3 A;  4A59 A;  1WBB A;  4DSJ A;  1IBK K;  4IG3 A;  4QOZ B;  4R79 A;  1BGX T;  5SWM A;  2DFF A;  3DI6 A;  1CZB A;  2E88 A;  1TUY A;  1V4T A;  2ZF5 O;  1ZC6 A;  2P9P A;  2E6M A;  4YOR A;  4AM7 A;  2W6K A;  3OYC A;  3PX6 A;  2KQ2 A;  1LV5 A;  4M3Z A;  2IS3 A;  3CCM N;  1NKC A;  4A5B A;  1ASU A;  3A8Y A;  4FK2 A;  3MEG A;  2HHQ A;  5JEN A;  3V9W A;  3OJU A;  4O0I A;  4B9S A;  3OYL A;  1QTM A;  4KHY A;  4BWM A;  3TTC A;  5JLH A;  3AY9 A;  3B6P A;  4CZJ A;  5KQ8 A;  4I6M A;  5TKW A;  1NG9 A;  3H1V X;  4Z0U A;  3QIP A;  2YCH A;  3C6T A;  3R6M A;  1HMV A;  2A3Z A;  2QXF A;  4CJW A;  4DQR A;  4JV5 K;  4FM0 A;  1U4B A;  1Z05 A;  4CZE A;  4O0J A;  3KVG A;  4JYA K;  3O1W A;  4CZI A;  1GLC G;  3KWI A;  2FBX A;  3K5L A;  1C0G A;  3VGM A;  4C23 A;  5BPN A;  4FWL A;  1RFQ A;  1YVN A;  1BHL A;  4CJ4 A;  4KB0 A;  2A5X A;  2Q3S A;  3AVC A;  3LM2 A;  3DM2 A;  4M7X A;  1NBW A;  1IH7 A;  2CGJ A;  1UA0 A;  1K8A O;  4HUE A;  4DR3 K;  5KGW A;  2KLA A;  3LDS A;  4RTF D;  4DV5 K;  3CC4 N;  3KK2 A;  2P9L A;  4LC9 B;  1TKZ A;  3T1Y K;  4CJP A;  4B1Z A;  4ID5 A;  1YF5 L;  3QEP A;  3U4L A;  4FLY A;  3GBT A;  2OPQ A;  1RDB A;  4DTU A;  3UKU A;  2PYL A;  3M8Q A;  2P9K B;  1RT4 A;  1SUQ A;  2Q2R A;  3LZJ A;  4BRF A;  1XUP O;  3H3O B;  3I0R A;  1X3N A;  5BRD A;  2P9S A;  4CFB A;  2Q97 A;  4BRI A;  5BR8 K;  4JI7 K;  3SMS A;  3P83 D;  3KLE A;  3DAW A;  1BI4 B;  5KGX A;  2ZJR L;  4OLA A;  2VCP A;  1JCF A;  3ENB A;  4FWM A;  1BA1 A;  3VGK A;  2UUA K;  4K0K K;  3HBT A;  3MXJ A;  4JD2 B;  2ZE2 A;  4R5P A;  4BRP A;  3HK2 A;  4E7J A;  5KRS A;  4AM6 A;  1VQM N;  2G8K A;  2A42 A;  4AHR A;  3U9D A;  2HVH A;  4FPB A;  1ITG A;  3C95 A;  2I7P A;  3NGZ A;  3MN9 A;  3M6G A;  4NLB A;  1RBT A;  4GY2 B;  4LY7 A;  1NK7 A;  3OA9 A;  1JKH A;  1JCE A;  3OYJ A;  1ILY A;  3ZT0 A;  1VSF A;  1SZ2 A;  4DV1 K;  1Q82 O;  1N5Y A;  3WEE A;  3F73 A;  2OTL N;  4LF7 K;  4JN4 A;  3L2Q A;  4F2S A;  3AVK A;  4M41 A;  1S9G A;  4IO8 A;  2HNY A;  3VES A;  4CJ7 A;  2OPP A;  4KH6 A;  5BR9 A;  1FKP A;  4J2E A;  2A40 A;  3CMA N;  3HP6 A;  4AHT A;  4JRQ A;  4CEC A;  4BWJ A;  4CK1 A;  2A1R A;  3SPY A;  3RWU A;  1WOQ A;  5E26 A;  2ZD1 A;  5JVG L;  3TSP A;  1VQ7 N;  2WTU A;  1XI1 A;  3ZSW A;  2F4V K;  4BRD A;  4WQ4 C;  3DJC A;  4DSK A;  3C65 A;  1NGH A;  2KKZ A;  1T44 A;  4DR5 K;  5JS2 A;  3LWM A;  3HSC A;  1ZXO A;  1WSE A;  3DYA A;  5LJW A;  2O8D B;  3GL1 A;  1ZBU A;  4B9Q A;  1P90 A;  3CPW M;  3A5N C;  3V9Z A;  1SS6 A;  4CBX A;  3PO4 A;  3O9S A;  2X6N A;  1IJJ A;  2DPN A;  4IKF A;  2FBY A;  4F3O A;  3M1F A;  4DQP A;  1HNV A;  1Z6R A;  1J5O A;  4CK2 A;  1NU0 A;  4DR6 K;  3HP9 A;  3AA3 A;  1NGA A;  4ELV A;  4BDP A;  4KB1 A;  2HF3 A;  4DV4 K;  1NKB A;  3THY B;  4CZK A;  1WAF A;  4HHT A;  5FPN A;  3SQ4 A;  1GLE G;  1Z25 A;  4F4K A;  4JEP A;  4OJR A;  4H0P A;  1NGF A;  3K58 A;  1WBD A;  3ZSR A;  1Q81 O;  4NCA A;  5CZ2 A;  2IC3 A;  5GIN A;  3NDK A;  5HRS A;  3BF3 A;  1N6Q A;  5JVH L;  4IG0 A;  4CEE A;  1KQS M;  1S22 A;  4RW7 A;  3FE1 A;  1IKV A;  3E01 A;  2H3G X;  5GAE P;  1BQM A;  4FJ5 A;  3D7E O;  3AAP A;  5D3G A;  3NH0 A;  1LWE A;  1JL2 A;  5AQJ A;  4QS9 A;  4BGB A;  1QQN A;  4L8R B;  3S5T A;  2BE2 A;  4KFB A;  1TYQ B;  1NGE A;  3P4I A;  4W5N A;  4KI6 A;  1TL1 A;  1NJI O;  3NF6 A;  2B4J A;  4BVO A;  2CH6 A;  4JKG B;  2E8A A;  4DTS A;  5AQP A;  5AZJ B;  1BG3 A;  1KTQ A;  1C0U A;  4CIE A;  4OPK A;  2VGM A;  3IUC A;  4EHT A;  4BRG A;  1WN7 A;  3DOL A;  3SPZ A;  3TR8 A;  1KAY A;  4DU4 A;  1NM1 A;  4PKH A;  4B8A B;  3ZSO A;  4CEO A;  5AZI B;  1E4G T;  4I7F A;  3WQU A;  4FJL A;  5KI6 A;  1EKE A;  3T7Z A;  3BEX A;  1T03 A;  4KTW A;  4H0O A;  4QAG A;  4BC2 A;  1Z26 A;  2Q0R A;  4WFA L;  2YHB A;  3DLG A;  1QS4 A;  3VQ6 A;  3E9P A;  4Z4I A;  3PSI A;  3VQ4 A;  2BTF A;  3VQ7 A;  4JK7 A;  1UA1 A;  4NXM K;  1KVA A;  5F0X A;  3VTI A;  4MLH A;  2HHW A;  2PAV A;  4FCY A;  3ULE A;  1RDD A;  2HHT A;  2O8F A;  3VQE A;  1RTH A;  2XRI A;  4FZZ A;  5AQR A;  2DFH A;  3PUF A;  5C25 A;  3OS2 A;  2HBJ A;  2X74 A;  1HNI A;  3SQ0 A;  3QNN A;  3CYG A;  5F1X A;  4RW6 A;  1Y97 A;  3AVN A;  3EKS A;  3NFA A;  1BIZ A;  4FWO A;  3K0S A;  4M3T A;  3EKU A;  2O8C B;  3LPU A;  5CR4 A;  4NCB A;  5ADX H;  2HHU A;  4WFB L;  4CW7 B;  4EP5 A;  5DM7 L;  3FZM A;  5AQN A;  1C1A A;  1UOC A;  2FC0 A;  2FSK A;  1WB9 A;  3AVG A;  3QEI A;  4M3X A;  2P9I B;  3AA4 A;  3WNH A;  2PFU A;  3VGL A;  3WXM B;  3OBW A;  3KD5 E;  3VQC A;  4GVE A;  4CJL A;  1TGO A;  3CME N;  1U47 A;  2JWL A;  4OX9 K;  3THW B;  2YNF A;  3QFP A;  1NK4 A;  4CBW A;  2GWK A;  3THV A;  3OYE A;  4HTU A;  3QEW A;  4ZHR A;  1YVU A;  3VF6 A;  1EWR A;  3D6R A;  3R3L A;  1J9A A;  3MN5 A;  2O8B A;  3O9Q A;  2DY4 A;  5A2Q O;  1EET A;  5J2M A;  1KAX A;  1J54 A;  3UKR B;  4GW6 A;  2QEX N;  4KHS A;  5C15 A;  5ADX A;  1YJN N;  4OKJ A;  1C1B A;  4CGD A;  2ZJP L;  4EAH D;  4JK8 A;  4CJV A;  4O44 A;  4KH5 A;  2E1Z A;  3CYM A;  4A62 A;  4CIF A;  4MDB A;  4CJS A;  1U45 A;  4CZH A;  5B8H A;  4ISG A;  3KK1 A;  2NRW A;  3PX4 A;  4K42 A;  3M8S A;  3OVN A;  4FK0 A;  4CF9 A;  3K5M A;  3J81 O;  1RT2 A;  3TAM A;  4BQZ A;  2P9U A;  4Q5V A;  2A6A A;  5MLC Q;  4K8Z A;  3SCX A;  4NLC A;  4JHD A;  3CET A;  3KTQ A;  4AHV A;  3G71 N;  2ZM6 K;  1OVY A;  3DXK B;  1RTJ A;  3CXC M;  1JLE A;  3ZSZ A;  3WNE A;  1N34 K;  5EXW A;  4H5R A;  5HBM A;  3HXM A;  1ASW A;  3RRH A;  3ZLJ A;  4FM2 A;  3LDQ A;  5F2R A;  2OPS A;  4CJ5 A;  3ZSX A;  1XQS C;  1RDU A;  2UXB K;  2WOM A;  3FZF A;  3AAR A;  4FK4 A;  4DQS A;  4CE9 A;  3AO2 A;  1U6Z A;  1X9J A;  4CK3 A;  4DQI A;  1HKC A;  1T7P A;  1HUX A;  3LZI A;  4NB4 A;  1C0F A;  2Z1H A;  4I2P A;  5HRN A;  4HWI A;  4B08 A;  4QCL A;  5ELZ A;  4E7I A;  3DRP A;  1YHQ N;  3QFU A;  4BQL A;  4WQ4 A;  3VTH A;  2P9N A;  3QER A;  2QWL A;  4ILJ A;  2KFN A;  4E0D A;  4IOX A;  3SUO A;  3LDP A;  4H0V B;  2FBV A;  1RTD A;  4UQG A;  1UAX A;  3M8R A;  2HHI A;  1G15 A;  1GLJ O;  4N76 A;  2ASO A;  3K5O A;  3CFO A;  4GNI A;  1TAU A;  4JNE A;  4DTM A;  3QIN A;  1L5U A;  3QML A;  3E9L A;  2QWP A;  1HQE A;  2CH5 A;  2A41 A;  3VPZ A;  4W5O A;  3ULD A;  4Z4F A;  4W5R A;  4OVL A;  2QWR A;  2HBM A;  4E7K A;  3NF9 A;  4BDZ A;  3VEN A;  1N36 K;  4MLE A;  4KHN A;  3U3G A;  3U3Y A;  4BC5 A;  3MCA B;  4CEQ A;  2G8U A;  1RT5 A;  1CZA N;  3KLF A;  2HW3 A;  3D2E A;  1A5X A;  3NAE A;  2P9P B;  4YOW A;  2BDP A;  3QIO A;  1SKS A;  3BZK A;  2DFE A;  1M1K O;  1RDC A;  2VG7 A;  1N8R O;  3UIQ A;  4JKE A;  3SUN A;  1SV5 A;  1VQ9 N;  1MU2 A;  1VRU A;  1K6Y A;  1YIT N;  1MWM A;  5E41 A;  3RRG A;  3AO3 A;  2YJF A;  5M1N A;  2W41 A;  2X6S A;  1WAJ A;  4BR2 A;  2ZGZ A;  3KD1 E;  4KRE A;  4I6M B;  4CF8 A;  1J5E K;  1C6V A;  3V6D A;  2EHG A;  3BF1 A;  3JS6 A;  1RT1 A;  4DR2 K;  1U2V A;  3AVF A;  3O9U A;  2FLO A;  5CYM A;  4Y1C A;  1K8K A;  3R1X A;  3I55 N;  4IFE A;  3CCR N;  4DF4 A;  2ITG A;  1L3U A;  2BUP A;  3RSE A;  2GUP A;  4CF1 A;  3J80 O;  3OBY A;  3SLC A;  1HJO A;  2D0P A;  2YV0 X;  4CJQ A;  5GIP A;  4BRH A;  3C7N A;  4DMN A;  4CD3 A;  4DFJ A;  1MWK A;  1OH5 A;  4LFA K;  4LF4 K;  3FFK B;  3O08 A;  4X65 K;  3QBX A;  4UY8 O;  4CI6 A;  4CF2 A;  1W0H A;  3T19 A;  4B3R K;  2OCE A;  3DWL A;  3CF5 L;  4E3S A;  1TUU A;  4JKB A;  4LF8 K;  3I8B A;  2W6L A;  1RT6 A;  3VQ8 A;  1YJW N;  4JI6 K;  4AHU A;  2KZM A;  5KPT A;  3S3N A;  4C1N K;  1KRP A;  1C0T A;  3MXM A;  4BE2 A;  3WXI A;  2BH1 A;  5I42 A;  2VQF K;  3HOT A;  3VN5 A;  3VF4 A;  3V4I A;  1FW6 A;  2GX9 A;  2P9S B;  3BZC A;  2UUC K;  5KPR A;  2Q1N A;  1YT3 A;  2V52 B;  1MA9 B;  4RW9 A;  2YI1 A;  4ZTF A;  3L3U A;  4XIU A;  2IIR A;  1NK8 A;  3LWL A;  3SQ1 A;  1ZBF A;  3HST B;  1QE1 A;  5C10 A;  2KHO A;  3MX2 A;  1NK5 A;  4FOE A;  5M1Q A;  4CGG A;  3HVT A;  1JL1 A;  5M1O A;  4ISE A;  2I7N A;  1S1V A;  3C0B A;  3E66 A;  2HND A;  2F9T A;  2XY5 A;  3O4Q A;  3IMX A;  4B9L A;  4LH5 A;  1JXB A;  2B5J A;  3K57 A;  3MWP A;  3M5R A;  1BCM A;  4KPY A;  3V81 A;  2Z1J A;  3WEE B;  3H08 A;  1QQC A;  1LOT B;  4FW2 A;  3K5N A;  4JRP A;  3THX A;  1E4F T;  2HMI A;  3IFR A;  2UUB K;  5C2F A;  4CED A;  1YI2 N;  1KC8 O;  1QHA A;  3LP0 A;  1C1C A;  2O8E B;  1TK5 A;  1GLD G;  1LW0 A;  5BN8 A;  3MWT A;  4CGJ A;  2Q0U A;  4CGH A;  2C1G A;  3ZET B;  1J53 A;  4IDH A;  2AJQ A;  1JCG A;  3H46 O;  3PIO L;  4H4O A;  1RDW X;  4F3T A;  4JKC A;  4CJR A;  4PKG A;  1JLF A;  2D0O A;  4NXN K;  1WSF A;  4OKE A;  2HF4 A;  1NLV A;  3T69 A;  4K41 A;  4KRF A;  1R0A A;  5FLX O;  3MN7 A;  3JSM A;  3CI5 A;  3IG1 A;  3KHY A;  4JI3 K;  4WQ5 C;  5IWA K;  4Q0B A;  4IEE A;  3Q7C A;  3LAK A;  4DU3 A;  2WON A;  3ZEU B;  3O8M A;  1RDA A;  3HT3 A;  3HPG A;  4JI1 K;  1JJ2 M;  1U04 A;  1B9F A;  1A5V A;  2GBZ A;  3O4W A;  2O4G A;  4CBU A;  3HPH A;  1OH7 A;  2E4L A;  5M1P A;  4DFM A;  3A0I X;  2HHV A;  3H1Q A;  5AQY A;  2YX6 A;  3R8E A;  2D5R A;  1D5A A;  3PV8 A;  4WF9 L;  1ESV A;  5LY3 A;  1QVF M;  2HBL A;  2FSN A;  3CD6 N;  3QBW A;  2VGN A;  3EN9 A;  3OYA A;  1VAZ A;  2YNH A;  3ZX3 A;  5SZT A;  1VSI A;  3VA3 A;  2QWM A;  3CIP A;  4FWK A;  4Y1D A;  2B6A A;  2G8F A;  4AIL C;  2QWN A;  4DB3 A;  3VMF B;  1CXU A;  1W7A A;  2JGU A;  3OYM A;  5LMU K;  2Z1I A;  3D2F A;  3EE8 A;  3V9X A;  4BRC A;  2FF6 A;  2GEL A;  1KLN A;  1HQU A;  2DTU A;  2XY7 A;  3MN6 A;  1DTT A;  1D9F A;  5FPM A;  4X64 K;  1RIL A;  1BA0 A;  4BRM A;  2PYJ A;  1BWF O;  4EZ6 A;  1EQY A;  2E5L K;  2J4R A;  2OAN A;  3CCE N;  5BPL A;  4RW4 A;  1BUP A;  2ATQ A;  4BC4 A;  5GAD P;  3ZT2 A;  3SUQ A;  4H4M A;  4O5B A;  3U9Z A;  3PSF A;  3TU5 A;  1YJ9 N;  4C1N I;  3AVA A;  3HOS A;  1LAW A;  1S1T A;  5KPZ A;  3TAG A;  1S72 N;  1BI4 A;  4F8R A;  3RR8 A;  4XH5 A;  4B3O A;  4H5W A;  2ZJQ L;  3J7Z O;  4GKK K;  5DM6 L;  3ISN C;  1N32 K;  1HYV A;  5BN9 A;  3VEV A;  5C24 A;  4CGI A;  4BRA A;  2QKK A;  1SKR A;  3SBT A;  1VSJ A;  4BG9 A;  3F9M A;  3MDQ A;  2Q31 A;  4CZM A;  4DV7 K;  4FJK A;  4FWR A;  4KKO A;  4DTR A;  5JIC A;  4DV6 K;  1L3V A;  2E20 A;  4DHY A;  3NVK A;  4DS4 A;  4A61 A;  4HUG A;  1EXQ A;  3A5O C;  4FLZ A;  5BRE A;  1HJR A;  2HB5 A;  3S41 A;  5M1F A;  4B1V A;  1XWL A;  3MEE A;  3ULE B;  4EZ9 A;  2O8F B;  3CJC A;  3WUH A;  3O9R A;  3SI6 A;  5AQL A;  4N41 A;  4OLB A;  4B8C A;  2KTQ A;  3K9J A;  2YNG A;  3LDO A;  1GLL O;  2QXL A;  4Z4C A;  3AVB A;  3I33 A;  4NYF A;  4B1Y B;  4A2B A;  4H0T B;  4H03 B;  3PO5 A;  3TAB A;  3CQY A;  1NGC A;  3O4N A;  4BRQ A;  2QK9 A;  1T8E A;  3D45 A;  4TSX A;  4AH9 A;  2RHK A;  4RW8 A;  1VK0 A;  2GTD A;  4XH4 A;  1T05 A;  2QA4 N;  4Z94 A;  2W42 A;  4CJK A;  2YJE A;  2NNW A;  3ZCM A;  1DKG D;  3ATU A;  3J8A A;  1EP4 A;  4KAZ A;  1KSP A;  4CHQ A;  5K14 A;  4W5Q A;  3SBG A;  3ZSQ A;  2E2Q A;  2P1J A;  4AHS A;  1VSK A;  3NVM A;  1QSY A;  1EWQ A;  2D1K A;  4KBO A;  3GOI A;  1XMO K;  1DTQ A;  3RVC A;  3AVM A;  2XO7 A;  4YDU C;  3THY A;  5TKY A;  1GOC A;  3HI0 A;  4CHN A;  4JLH A;  3ZX0 A;  2V7Z A;  4PQU A;  3NF7 A;  1TKD A;  5CYQ A;  2IAJ A;  4MO4 A;  4BRK A;  3TAF A;  1ZBH A;  2ITM A;  1NMN A;  2AP1 A;  4JI8 K;  2CGK A;  4W5T A;  4E7L A;  1WUA A;  3ZT1 A;  1QQO A;  1RBR A;  4ZTJ A;  5KRT A;  1RCH A;  1NMD A;  3ZSY A;  1S5J A;  1NK9 A;  1VSH A;  3UE5 A;  1LWF A;  4FJN A;  1I3A A;  3HM9 A;  4LF5 K;  1SL1 A;  4DG1 A;  1BO5 O;  1VSM A;  5J2P A;  1FKO A;  1TYQ A;  5J1E A;  4DTO A;  1G99 A;  3EYZ A;  1BQN A;  1JLG A;  5GIO A;  3FFI A;  3L2V A;  3E9O A;  3C94 A;  4U67 L;  1N33 K;  1M90 O;  4FJG A;  4E1N A;  4CD1 A;  3TI0 A;  4KHP K;  2FSJ A;  1KXP A;  4NO7 A;  3SQ2 A;  1NGJ A;  3R9P A;  4BE0 A;  3J7A P;  2E2N A;  2D0A A;  1NGI A;  3TAR A;  2YHX A;  1GOA A;  1QQM A;  4M3U A;  4CHP A;  3KLH A;  3FZL A;  5HRR A;  2ZGY A;  4HCB A;  1S6P A;  5CE3 A;  2EWS A;  1BIU A;  1RGI A;  2HOE A;  4BE1 A;  1HNW K;  1JLC A;  3OYB A;  3NH1 A;  4WFN L;  3OHR A;  4JKF A;  4FLT A;  1T6C A;  2HST A;  3ZT3 A;  3VQ5 A;  3DXM A;  1O13 A;  3I0S A;  1WSI A;  4OPJ A;  1DLO A;  3P5J A;  3M8P A;  2VQE K;  3HYF A;  4EHU A;  4C8M A;  3CJ1 A;  5FPE A;  2KFZ A;  2VG6 A;  5AQM A;  1NJW A;  1V4S A;  4IJA A;  4FVU A;  2O8C A;  4WQ5 A;  4YNQ A;  1RT3 A;  5LL6 Z;  1TV6 A;  4M3R A;  2OTJ N;  1E3M A;  3MXI A;  3AVL A;  4XH1 A;  5AQT A;  4C8N A;  3LP1 A;  3IS9 A;  3V1O A;  4E89 A;  2Q36 A;  1XNR K;  2GUI A;  4C8O A;  3EL2 A;  1O1W A;  4FVM A;  2RE2 A;  3CC2 N;  3WT0 A;  1RTI A;  2NZT A;  4CIG A;  1R59 O;  1TL3 A;  3S9H A;  3THW A;  4FJ7 A;  3NHG A;  1KVC A;  4OPA A;  4DTN A;  4BVP A;  4IJN A;  1Q86 O;  4K8X A;  3QEX A;  4HTL A;  4IOC L;  3SJH A;  2IVO A;  4U7B A;  2NRX A;  4NCG A;  5M1K A;  1QZ6 A;  3VEY A;  3L3V A;  4Z4E A;  1S3X A;  3LDN A;  4J2A A;  3B8A X;  4XEI A;  4FJH A;  3ATV A;  1KAZ A;  1D8Y A;  4B3M K;  4DR4 K;  4E72 A;  1C0M A;  3CFR A;  4FJJ A;  1CXQ A;  2F7T A;  3DLE A;  2WC9 A;  2E1Y A;  3RSE B;  4CJU A;  2IOC A;  3SAF A;  1RBV A;  4LD0 A;  5EY4 A;  2P5O A;  2A1S A;  2QI2 A;  3MMV A;  3C7N B;  3VF2 A;  4I2Q A;  4A5A A;  4DV2 K;  5JS1 A;  4QS8 A;  4KI4 A;  1HKG A;  4B3S K;  1GLA G;  2JLE A;  3O3G A;  1KFD A;  3NF8 A;  1NK0 A;  4KHW A;  4LF6 K;  1VQK N;  3HRG A;  3VEW A;  1FK9 A;  4C8K A;  3OYN A;  3G25 A;  1TK0 A;  3V1Q A;  3IRX A;  3DXK A;  1TKT A;  4X66 K;  3HVR A;  1VQL N;  2QWO A;  4B1X B;  1P8Z A;  3AVJ A;  4F2R A;  4H0X B;  1TVR A;  2PZS A;  3AA2 A;  4GMJ B;  4BRL A;  4DSF A;  3O80 A;  4KTZ A;  3V9U A;  3RMA A;  3KK7 A;  3DLB A;  3L2R A;  2HHH K;  1S1U A;  3K2P A;  2GEM A;  4JKH A;  2ZQB A;  4QS7 A;  4FLX A;  4FWS A;  4FJX A;  1EO1 A;  4A2A A;  3AGK A;  5AQG A;  3S3M A;  2NRZ A;  3L0Q A;  1NGB A;  4GV9 A;  4M63 C;  2NLX A;  3TWH A;  1T6D A;  4K25 A;  5HRO A;  4M7Y A;  3C6U A;  1L3T A;  3KZB A;  2GWJ A;  3AAQ A;  3TSU A;  4JI0 K;  4O8U A;  3O5B A;  3WXK A;  4L3Q A;  4BAC A;  3PY8 A;  1VQ4 N;  4B9N A;  3SAG A;  4M45 A;  1VSL A;  4DFK A;  1SL0 A;  3EE9 A;  3DRS A;  3ID8 A;  1SKW A;  2ZWH A;  1XHX A;  3OYI A;  1NKE A;  2BAN A;  3THX B;  4ICL A;  1EX4 A;  2UXD K;  4FJM A;  2P9L B;  4CVN E;  2OPR A;  3CCU N;  3D0P A;  3VET A;  2P51 A;  5JMV A;  2OA8 A;  4IFY A;  1S1X A;  4PWD A;  4BR5 A;  1KVB A;  2QTD A;  3LM9 A;  4YOY A;  3UKU B;  3W0L A;  4FLW A;  3OW2 M;  1IKW A;  3LAM A;  5H1S Q;  3HL8 A;  2YKM A;  2ASP A;  3FZH A;  4YDU A;  1Q9Y A;  3V9S A;  3NCI A;  3F5T A;  4GV3 A;  1LW2 A;  2IDO A;  5AQO A;  4DUY K;  3BDP A;  2F9W A;  2YHW A;  3B6O A;  4GV6 A;  2XY6 A;  2IGI A;  4BEC A;  5GAG P;  4B1W B;  4DTX A;  3EZ5 A;  1VQN N;  2AA4 A;  3O3F A;  3QET A;  2G8W A;  3CG7 A;  3N4Q A;  3DLL L;  1HNZ K;  4B3T K;  3M3Z A;  1Q8I A;  3UB5 A;  3K9K A;  1ZBS A;  4N56 A;  5DMR A;  4N5S A;  3DLR A;  1U49 A;  2VWK A;  3RMC A;  5CHI A;  1TK8 A;  1KLM A;  3SNN A;  3H45 C;  3NMU A;  4J2B A;  3SK3 A;  1GLB G;  3EO3 A;  3FGU A;  3L4Q A;  4FWN A;  3QDK A;  2VYP A;  3KWG A;  1QZ5 A;  4FOI A;  4M3Y A;  3L4I A;  5DK5 A;  4PUO A;  4DV0 K;  1KFS A;  2WBN A;  1TAQ A;  1WSJ A;  3P39 A;  2E6L A;  3F9K A;  1KCF A;  4IWV A;  3RMB A;  2NRT A;  3SZ2 A;  4YY3 K;  1S1W A;  3KK3 A;  3ZYY X;  3AO4 A;  4CF0 A;  1DT9 A;  1RBS A;  4WCE L;  3D2F B;  4JKA A;  3TAP A;  3ENH A;  5EVZ A;  5J2N A;  3KLG A;  2HVI A;  4OO1 J;  4PL8 A;  1WSH A;  4H0Y B;  5EOY A;  4BEB A;  4CJT A;  3AA5 X;  4C8L A;  4J2D A;  4WYB A;  5FPD A;  1SQK A;  1HKB A;  5I3U A;  5HL7 L;  3ZT4 A;  5HOO A;  1NNE A;  2EX3 A;  3OS1 A;  2QWQ A;  1HNX K;  5BPM A;  5C0Y A;  1L3S A;  2OZM A;  1S9E A;  4BR9 A;  1IBL K;  3P1G A;  4DQ8 A;  1BL3 A;  4CGF A; 
#chains in the Genus database with same CATH homology
 2RHK A;  4A62 A;  3HZ6 A;  2GTD A;  5AQX A;  4MDB A;  4RWT A;  3GG4 A;  4XH4 A;  1VQ6 N;  3C6A A;  2QA4 N;  3P31 A;  3CCV N;  4YOU A;  4CZH A;  5B8H A;  4ISG A;  4Z94 A;  2NRW A;  4K42 A;  2YJE A;  3MK6 A;  2NNW A;  3VOV A;  1J6Z A;  1DKG D;  5AQI A;  3ATU A;  3J8A A;  4BE7 B;  5AQK A;  4BQZ A;  2P9U A;  4KH4 A;  4A57 A;  2A6A A;  4FO0 A;  3SBG A;  5MLC Q;  4CZL A;  4ISF A;  4NLC A;  1ATS A;  2E2Q A;  2E2P A;  3CET A;  4JHD A;  5AQS A;  3CJA A;  5GAH P;  3NVM A;  3G71 N;  4XJX A;  3VEZ A;  1OVY A;  3ENO A;  2NRR A;  4A59 A;  2D1K A;  3ID6 A;  3DXK B;  4KBO A;  3CXC M;  3GOI A;  1VQ8 N;  4R79 A;  3TSQ A;  5EXW A;  1BDG A;  4H5R A;  1Q7Y O;  1H1V A;  4K43 A;  3RVC A;  2E88 A;  1TUY A;  3LDQ A;  5F2R A;  4YDU C;  2VWB A;  5TKY A;  3F2K A;  3HI0 A;  1V4T A;  1XQS C;  1RDU A;  3ZX0 A;  2V7Z A;  3FZF A;  3AAR A;  2ZF5 O;  1ZC6 A;  2P9P A;  4YOR A;  4AM7 A;  3HM8 A;  1U6Z A;  1X9J A;  1LCU A;  4MO4 A;  4BRK A;  1HKC A;  3ZX2 A;  1HUX A;  1DGK N;  4NB4 A;  2ITM A;  1C0F A;  3CCM N;  2AP1 A;  3IKM A;  4A5B A;  4B1U B;  2CGK A;  4HWI A;  5KQD A;  1WUA A;  1QQO A;  3TTF A;  3ZET A;  3A8Y A;  3HTV A;  1NMD A;  5ELZ A;  2PBD A;  1YHQ N;  3QFU A;  2P9K A;  4BQL A;  4WQ4 A;  3UE5 A;  3TTC A;  2P9N A;  3VTH A;  2QWL A;  4ILJ A;  4IOX A;  5JLH A;  3AY9 A;  1Q18 A;  3LDP A;  4CZJ A;  5KQ8 A;  4H0V B;  4I6M A;  5TKW A;  3H1V X;  4IO9 L;  2YCH A;  4BRE A;  1BO5 O;  3R6M A;  4ILG B;  4E1J A;  1GLJ O;  3CCL N;  2A3Z A;  1TYQ A;  2ASO A;  4IZ9 A;  1Z05 A;  4CZE A;  4GNI A;  3KVG A;  2IVP A;  3O1W A;  4JNE A;  1G99 A;  4CZI A;  1GLC G;  3KWI A;  4JD2 A;  5GIO A;  3QML A;  2W00 A;  2ASM A;  5AQH A;  3E9O A;  3E9L A;  2QWP A;  1C0G A;  3VGM A;  4C23 A;  4U67 L;  5BPN A;  1M90 O;  4FWL A;  1RFQ A;  1YVN A;  2CH5 A;  2A41 A;  3FLC O;  3GDQ A;  3VPZ A;  3ZEU A;  1Y64 A;  4CD1 A;  4H5N A;  2NRH A;  2HMP A;  2A5X A;  1KXP A;  2FSJ A;  3C6H A;  4NO7 A;  2QWR A;  2HBM A;  3LM2 A;  4M7X A;  3VEN A;  1K9M O;  1NBW A;  4MLE A;  4MDA A;  2CGJ A;  4BC5 A;  1NGJ A;  3R9P A;  5AQZ A;  1K8A O;  3MCA B;  2E2N A;  1CZA N;  1NGI A;  1HX1 A;  3D2E A;  3CC7 N;  2YHX A;  1QQM A;  2NRV A;  2KLA A;  2P9P B;  4JAX A;  4YOW A;  4RTF D;  3FZK A;  3FZL A;  5E84 A;  3CC4 N;  2P9L A;  2ZGY A;  4LC9 B;  1M1K O;  3CCQ N;  1IG8 A;  4B1Z A;  3CJ7 A;  1N8R O;  5CE3 A;  1YF5 L;  2EWS A;  4JKE A;  4ILH A;  3U4L A;  3GBT A;  2C1I A;  1RGI A;  2HOE A;  1VQ9 N;  3P38 A;  1YIT N;  1MWM A;  1D4X A;  3UKU A;  5M1N A;  2P9K B;  2YJF A;  2Q2R A;  3VEO A;  2W41 A;  4WFN L;  4BRF A;  1XUP O;  3OHR A;  4JKF A;  4BR0 A;  1T6C A;  3H3O B;  4BR2 A;  2ZGZ A;  2HST A;  3CJ9 A;  4BY9 C;  1X3N A;  4I6M B;  2P9S A;  3DXM A;  5BRD A;  1O13 A;  2Q97 A;  4BRI A;  1KD1 O;  3SMS A;  5AFU H;  3BF1 A;  1X3M A;  3DAW A;  3JS6 A;  2ZJR L;  1U2V A;  2VCP A;  1JCF A;  2FLO A;  3GE1 A;  3ENB A;  3O9U A;  4FWM A;  4EHU A;  1BA1 A;  1K8K A;  3R1X A;  3I55 N;  4IFE A;  3CCR N;  2BUP A;  3CJ1 A;  3RSE A;  3VGK A;  4H5V A;  1XC3 A;  3HBT A;  2GUP A;  4JD2 B;  3LL3 A;  5FPE A;  4YOV A;  4YOT A;  4BRP A;  5AQM A;  3OBY A;  1V4S A;  4AM6 A;  4IJA A;  3SLC A;  4FVU A;  1HJO A;  1VQM N;  2WUS A;  2A42 A;  2D0P A;  4WQ5 A;  3Q7B A;  4Y0W A;  4BC3 A;  3U9D A;  2E2O A;  4FPB A;  2OTJ N;  5GIP A;  4BRH A;  2I7P A;  3C7N A;  4XH1 A;  5AQT A;  4BGA A;  3MN9 A;  4CD3 A;  3M6G A;  4NLB A;  2UYT A;  1MWK A;  4GY2 B;  3OA9 A;  2Q36 A;  1YUW A;  3FR0 A;  3FFK B;  4YOX A;  1JCE A;  1ILY A;  3O08 A;  1SZ2 A;  4F9O A;  3EL2 A;  3QBX A;  4UY8 O;  4CI6 A;  1Q82 O;  4G9Z A;  3WEE A;  3DWL A;  2RE2 A;  3CF5 L;  3CQX A;  3AGR A;  3WT0 A;  4JN4 A;  3TPQ A;  4CZG A;  2OTL N;  3CC2 N;  2NZT A;  1TUU A;  4JKB A;  4IO8 A;  1R59 O;  4PKI A;  3I8B A;  3VES A;  2D4W A;  4CJ7 A;  2WFB A;  4KH6 A;  5BR9 A;  4BRN A;  2A40 A;  3CMA N;  5C12 A;  4OPA A;  1YJW N;  1HLU A;  4BVP A;  2HBK A;  4IJN A;  1Q86 O;  4HTL A;  5KPT A;  4IOC L;  3SJH A;  2IVO A;  1WOQ A;  4U7B A;  5E26 A;  1HPM A;  2NRX A;  5AFU A;  4C1N K;  5JVG L;  3W3D A;  5M1K A;  3TSP A;  1NGD A;  1VQ7 N;  1QZ6 A;  3WXI A;  3VEY A;  4WQ4 C;  4BRD A;  2BH1 A;  5AQQ A;  3DJC A;  1S3X A;  3LDN A;  3QB0 A;  3C65 A;  3HOT A;  1NGH A;  3IDH A;  3VF4 A;  2KKZ A;  3CCS N;  3B8A X;  1T44 A;  2GX9 A;  2P9S B;  3DXM B;  2QW9 A;  4XEI A;  3LDL A;  5KPR A;  2Q1N A;  3ATV A;  1KAZ A;  3O1B A;  3HSC A;  2V52 B;  1ZXO A;  1MA9 B;  2F7T A;  2YI1 A;  5LJW A;  2IIR A;  3GL1 A;  2WC9 A;  2E1Y A;  3RSE B;  4B9Q A;  1P90 A;  2P9U B;  3CPW M;  4FSV A;  5AQW A;  3A5N C;  3SAF A;  1SS6 A;  4CBX A;  4JHD B;  5C10 A;  1NGG A;  2KHO A;  3O9S A;  5EY4 A;  3MX2 A;  4FOE A;  5M1Q A;  1IJJ A;  2DPN A;  5M1O A;  4ISE A;  2I7N A;  3C0B A;  2QI2 A;  3MMV A;  3E66 A;  2F9T A;  3C7N B;  3IMX A;  4MO5 A;  4JKG A;  3M1F A;  2FF3 B;  4FWP A;  3VF2 A;  5AZJ A;  3G4S N;  1Z6R A;  4A5A A;  1NWK A;  4FPA A;  1NGA A;  4QS8 A;  3MWP A;  1HKG A;  3M5R A;  4PL7 A;  2HF3 A;  1GLA G;  4CZK A;  3WEE B;  5FPN A;  1VQK N;  3N4P A;  1GLE G;  3HRG A;  5AZI A;  3VEW A;  1LOT B;  4JEP A;  4H0P A;  1E4F T;  3G25 A;  3IFR A;  1NGF A;  5C2F A;  3CHW A;  1YI2 N;  2IVN A;  5BRH A;  1KC8 O;  2CGL A;  1ATN A;  1QHA A;  1Q81 O;  3CJB A;  5C2D A;  3DXK A;  1GLD G;  1BOT O;  5BN8 A;  3MWT A;  4BRO A;  4IEI A;  2Q0U A;  1ATR A;  5GIN A;  1VQL N;  2C1G A;  3BF3 A;  2QWO A;  3ZET B;  4IDH A;  4B1X B;  5JVH L;  1P8Z A;  1KQS M;  1S22 A;  4H0X B;  4BR4 A;  1JCG A;  3H46 O;  1QVG M;  3FE1 A;  3PIO L;  4RCH A;  2V51 B;  4OPH A;  1RDW X;  2P9N B;  4JKC A;  4PKG A;  2H3G X;  5GAE P;  4BRL A;  2D0O A;  5BRF A;  3D7E O;  3AAP A;  3O80 A;  2QM1 A;  3KK7 A;  2HF4 A;  3O9T A;  1NLV A;  1OKJ A;  3T69 A;  5AQJ A;  3H3N O;  4QS9 A;  2GEM A;  1QQN A;  2FXU A;  4JKH A;  4BGB A;  4QS7 A;  4K41 A;  4FWS A;  3MX5 A;  1TYQ B;  1EO1 A;  4A2A A;  3AGK A;  1NGE A;  3P4I A;  3EZW A;  3MN7 A;  4EIA A;  3CI5 A;  3KHY A;  5AQG A;  2NRZ A;  3L0Q A;  1NGB A;  4DCH A;  4M63 C;  1NJI O;  2NLX A;  4GV9 A;  4WQ5 C;  1T6D A;  4K25 A;  3SMP A;  4M7Y A;  4IEE A;  3Q7C A;  3KZB A;  4BVO A;  3ZEU B;  3O8M A;  2CH6 A;  4JKG B;  2GWJ A;  2E8A A;  3AAQ A;  5AQP A;  5AZJ B;  3TSU A;  1BG3 A;  1JJ2 M;  3O6W A;  4O8U A;  3O4W A;  3O5B A;  3WXK A;  4CBU A;  2VGM A;  3IUC A;  4EHT A;  4L3Q A;  5M1P A;  3A0I X;  4BRG A;  1VQ4 N;  3H1Q A;  3SAG A;  5AQY A;  2YX6 A;  3WQT A;  2P9I A;  1KAY A;  5AQU A;  3R8E A;  3EE9 A;  1NM1 A;  4PKH A;  4EFH A;  3ID8 A;  4WF9 L;  2ZWH A;  1ESV A;  5AZI B;  3D2E B;  5LY3 A;  1E4G T;  1QVF M;  2HBL A;  2FSN A;  3CPE A;  3WQU A;  3SAH A;  3CD6 N;  3T7Z A;  3BEX A;  3QBW A;  2VGN A;  3EN9 A;  4H0O A;  1VAZ A;  4H5T A;  1YXQ A;  2P9L B;  4BC2 A;  1W97 L;  2Q0R A;  4WFA L;  1MDU B;  3ZX3 A;  3CCU N;  3A5M C;  4O8K A;  2QWM A;  3CIP A;  3QIC A;  4FWK A;  3VET A;  4BG8 A;  5JMV A;  3I56 N;  3E9P A;  2QWN A;  4PHT X;  4DB3 A;  3VMF B;  4BR5 A;  4O5F A;  2BTF A;  2QTD A;  3LM9 A;  4YOY A;  1YIJ N;  3UKU B;  1K73 O;  4JK7 A;  3W0L A;  3OW2 M;  5F0X A;  4J8F A;  4MLH A;  3D2F A;  2PAV A;  5AQF A;  3MCP A;  3VTI A;  4BR7 A;  5H1S Q;  3ULE A;  3BP8 A;  3EE8 A;  2ASP A;  4BRC A;  2FF6 A;  3FZH A;  5JLF A;  4YDU A;  2GEL A;  3F5T A;  5AQR A;  4GV3 A;  3BUZ B;  5AQO A;  5I9E B;  3UKR A;  3MN6 A;  1U2V B;  2F9W A;  1K8K B;  2HBJ A;  2YHW A;  5FPM A;  4GV6 A;  3E1Y A;  4BEC A;  1BA0 A;  4BRM A;  3U8X A;  1BWF O;  4IXC A;  4B1W B;  5GAG P;  5F1X A;  1EQY A;  3EKS A;  1VQN N;  3VEX A;  2AA4 A;  2J4R A;  2OAN A;  4FWO A;  3CCE N;  3DLL L;  3N4Q A;  5BPL A;  3EKU A;  1BUP A;  3M3Z A;  4BC4 A;  5CR4 A;  5GAD P;  5EX5 A;  5ADX H;  3UB5 A;  4WFB L;  4FL9 A;  3K9K A;  1ZBS A;  5DM7 L;  3U9Z A;  1T3V A;  3FZM A;  5AQN A;  3CER A;  3CCJ N;  5LJV A;  3TU5 A;  1YJ9 N;  2FSK A;  4C1N I;  3HOS A;  5CHI A;  5AR0 A;  5KPZ A;  2P9I B;  1S72 N;  3H45 C;  3NMU A;  3SK3 A;  3H6E A;  4XH5 A;  1GLB G;  2PFU A;  3EO3 A;  3A5L C;  3FGU A;  3JXU A;  3L4Q A;  4FWN A;  3VGL A;  3VER A;  3WXM B;  1DEJ A;  2W40 A;  3OBW A;  4H5W A;  2ZJQ L;  3QDK A;  2VYP A;  3KWG A;  1QZ5 A;  4JKD A;  3J7Z O;  4FOI A;  2V7Y A;  3L4I A;  4GVE A;  5DM6 L;  5BN9 A;  3VEV A;  3CME N;  4BRA A;  2JWL A;  2WBN A;  3SBT A;  4BG9 A;  3F9M A;  4CZF A;  3MDQ A;  3QFP A;  3P39 A;  2Q31 A;  4CBW A;  4CZM A;  2GWK A;  5AQV A;  4FWR A;  5JIC A;  2E20 A;  4DHY A;  3NVK A;  4IWV A;  4JK9 A;  3PLA A;  2NRT A;  4A61 A;  3VF6 A;  3ZYY X;  3A5O C;  3D6R A;  5BRE A;  4WCE L;  1DT9 A;  3D2F B;  4JKA A;  3S41 A;  5M1F A;  4B1V A;  3ENH A;  3R3L A;  3ULE B;  5EVZ A;  3G6E N;  1GLF O;  3WXL A;  3MN5 A;  3CJC A;  4FWQ A;  3O9Q A;  3O9R A;  3WUH A;  5AQL A;  1W2B M;  4PL8 A;  1VQ5 N;  4OO1 J;  3L6Q A;  1KAX A;  4H0Y B;  5EOY A;  4BEB A;  2YHY A;  4WYB A;  3UKR B;  2QEX N;  3K9J A;  3WXJ A;  3LDO A;  1SQK A;  1GLL O;  1HKB A;  5C15 A;  5ADX A;  5FPD A;  5HL7 L;  1YJN N;  1YAG A;  2ZJP L;  4EAH D;  4JK8 A;  2QXL A;  5HOO A;  1VQP N;  3I33 A;  4B1Y B;  2QWQ A;  4A2B A;  4H0T B;  2JWK A;  2E1Z A;  4KH5 A;  4H03 B;  5BPM A;  4IOA L;  5C0Y A;  1SAZ A;  1VQO N;  3CQY A;  1NGC A;  3TTD A;  4BR9 A;  4AF1 A;  4BRQ A;  4DKW A;  3PIP L;  4DQ8 A;  1BU6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...