2P9PB

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
190
structure length
184
Chain Sequence
GVVVDSGDGVTHICPVSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEVGVAELLFNTIQADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-like protein 3
total genus 50
structure length 184
sequence length 190
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9pB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9pB02
5KQ8A 4WQ5A 5AQOA 2Q0UA 5AZJB 4BG8A 3VEVA 2IVOA 1QZ5A 3FZFA 3LDNA 3CERA 3ENHA 1NBWA 2ITMA 2Q97A 1E4GT 2E88A 1OKJA 4B1XB 3H1VX 3ZEUB 1ZBSA 4H03B 2NZTA 2ZF5O 3J8AA 3LDOA 2I7PA 1Z05A 4FWNA 3D7EO 2E2QA 1GLAG 1LCUA 3VESA 4HTLA 4K41A 2FLOA 1G99A 1MA9B 3WXJA 2P9KA 3DJCA 3MN7A 3M1FA 5KPRA 1QQMA 4WQ5C 3CJAA 4H0TB 4FPBA 3MMVA 4WQ4C 1NGHA 1DKGD 2NLXA 1ATSA 4BRNA 1HX1A 5AQUA 1LOTB 1QQOA 1BDGA 3WEEA 4H5VA 3DAWA 1BU6O 3R6MA 4JHDB 4FWKA 5ADXA 4PKIA 3ZX0A 3VEZA 5EVZA 3VEYA 4M7YA 3VPZA 2HF4A 3D2EA 1V4SA 4FOEA 4BREA 3HZ6A 3M6GA 3D2FB 3UKUB 1K8KA 1JCFA 3CQXA 3LL3A 3KHYA 1RGIA 3MDQA 1MWMA 2FSNA 2P9SA 3CJ1A 5JLFA 4HWIA 4XH4A 2FXUA 5AQHA 2CH5A 3BF1A 3HBTA 1BOTO 1J6ZA 4BVPA 3GDQA 2I7NA 2Q31A 3FR0A 3EZWA 3C0BA 3IUCA 5BPLA 1GLLO 4XEIA 4BROA 1TYQA 5KQDA 5AQMA 5E84A 5BN9A 1TYQB 5EXWA 1C0FA 2H3GX 4AM7A 1X9JA 2QXLA 1NGDA 4LC9B 1U2VA 1HKCA 4BR0A 3CJCA 3MN9A 4H0YB 3QB0A 2CH6A 3VF2A 5FPEA 4BRDA 3JXUA 1HKGA 4JHDA 1T6DA 5AQVA 1D4XA 1QZ6A 4CZMA 3MCPA 2PBDA 1GLJO 5EOYA 3RSEA 3O8MA 4YDUC 1T44A 1QHAA 1NGCA 4FWMA 3I8BA 1NGJA 3EO3A 1NLVA 4IJAA 3F9MA 2YI1A 2E8AA 2QW9A 3H45C 4O8KA 3UB5A 3CI5A 3VF6A 4BR2A 5I9EB 1HJOA 4C23A 4FOIA 2QWMA 2ZGYA 4K43A 4FO0A 2P9SB 3QICA 5AQXA 4WYBA 3LM2A 3QBXA 4PKGA 2CGJA 2EWSA 1RFQA 2W40A 4YDUA 3WXLA 3DXMB 2E2OA 1NGGA 4I6MB 4BRLA 4ISGA 1S3XA 5JLHA 3VENA 2W41A 4A62A 2KHOA 3JS6A 3I33A 4B1UB 3MN5A 1BA0A 2YJFA 4KBOA 4BRKA 4A2BA 4O5FA 2AP1A 4MO4A 5CE3A 3GL1A 3WQUA 3H46O 2A3ZA 2VCPA 4DB3A 5FPDA 2ASOA 3FE1A 3FGUA 1GLBG 1X3MA 4FPAA 4QS7A 2V51B 4EFHA 3VERA 2FF3B 1IJJA 4BG9A 2BUPA 3LDLA 3TU5A 1X3NA 4BRQA 3KVGA 4JNEA 3MK6A 2VYPA 1V4TA 1IG8A 3ZETB 4BC5A 1GLEG 3DWLA 4H0XB 4JD2B 2HOEA 4BR7A 1T6CA 3A0IX 3ATUA 4PKHA 4H0PA 1Z6RA 1HLUA 2F9TA 5AQWA 3UKRB 3FZHA 3ID8A 3VOVA 1NGEA 3ZX2A 3WUHA 5ELZA 3IFRA 3HI0A 1RDWX 2P9UA 2ZGZA 3U9DA 3GOIA 3O6WA 4IXCA 5AQLA 4FWLA 3WXKA 3AY9A 2QWPA 3BP8A 2D1KA 2UYTA 4BVOA 5AQTA 3A5LC 4PL8A 2QWRA 3ZX3A 2V7ZA 3EKSA 2P9NB 2P9KB 2HF3A 2FSKA 5FPNA 1MWKA 4CD3A 1XQSC 3CJ7A 4CD1A 3FZKA 3W3DA 3S41A 3FZLA 2Q36A 5AR0A 4BQZA 3O1WA 4EAHD 2ASMA 4B1VA 4DHYA 5F0XA 3BF3A 5AQQA 3CJBA 3U8XA 4BRAA 1XC3A 3WT0A 3AAQA 4FWSA 4GY2B 4B1ZA 1ESVA 5AZIA 4FWQA 5AZIB 3QFPA 1YAGA 5BRDA 2YHXA 4QS8A 1KXPA 1K8KB 1NWKA 2DPNA 2P9LB 3WXIA 3VEWA 1QQNA 4XH1A 4Z94A 3HM8A 1TUUA 4DCHA 4CBXA 1S22A 4FSVA 3VETA 4MLEA 1NGIA 4FL9A 3ULEB 5AQFA 3R8EA 1SZ2A 2P9UB 4NO7A 3ULEA 4H5WA 1BWFO 2GWKA 5F1XA 1HKBA 2GELA 2YHYA 3FFKB 3OHRA 3EKUA 3BEXA 3A8YA 4BR9A 1KAZA 2ZWHA 1ZXOA 4EHUA 5AQNA 4BR5A 3C7NA 4CJ7A 4CZLA 3LDPA 1JCGA 5AQKA 5AFUH 4DQ8A 1DGKN 1Q18A 3AAPA 3U9ZA 3B8AX 4H0VB 3RSEB 3W0LA 2FSJA 2QWOA 3ZETA 1SAZA 3HTVA 1YUWA 4WQ4A 4XH5A 5BN8A 4L3QA 2A42A 2F9WA 3A5MC 3H6EA 1NM1A 3O08A 4NB4A 5AQYA 1HUXA 1KAYA 3FLCO 1NGFA 4H0OA 5LJVA 4JN4A 1BUPA 2D0PA 4BC4A 4AM6A 1WUAA 1CZAN 3EN9A 3GG4A 2YJEA 5F2RA 4CZEA 5BREA 1E4FT 1BO5O 2E1ZA 1YVNA 2A41A 3O5BA 4A61A 5EX5A 3L4IA 3VGLA 2V7YA 2QWNA 4EIAA 5JMVA 3KZBA 5KPZA 4MO5A 3CHWA 4K42A 3VEOA 1JCEA 4BC2A 2D4WA 4ISEA 4BR4A 5LY3A 3WEEB 3VEXA 5AQIA 2GTDA 3QFUA 4GNIA 2P9IB 5AQZA 2P9PB 2BTFA 4K25A 2E2PA 2CGLA 3L0QA 4QS9A 5ADXH 3G25A 2FF6A 3CJ9A 3IDHA 3FZMA 2QWQA 3LM9A 3SMSA 1P8ZA 2PAVA 3A5OC 5KPTA 4FWPA 3D2EB 3D2FA 3UKUA 1WOQA 1U6ZA 4BQLA 2IVNA 5BRHA 2Q1NA 4J8FA 2V52B 4RWTA 2E20A 3DXKB 1YXQA 1Y64A 4B1YB 2Q2RA 3P4IA 2QWLA 2P9LA 3VGKA 4CZKA 2CGKA 3LDQA 2GEMA 4CZHA 2HMPA 2OANA 3DXMA 4CZJA 4CZIA 2VWBA 5BR9A 4I6MA 4RTFD 5B8HA 1NMDA 4BRIA 3IMXA 5E26A 4BRFA 4ISFA 3SMPA 3ATVA 2E1YA 5JICA 4CBUA 2WUSA 4BGBA 3QMLA 4M7XA 5AQPA 4M63C 2J4RA 5BPNA 4CZFA 2Q0RA 3C7NB 3MN6A 2P9IA 2GUPA 4CI6A 2ASPA 4H5NA 3SLCA 5TKYA 5BPMA 1ATRA 2A5XA 2YHWA 4CBWA 2GWJA 4IO8A 4IZ9A 3SK3A 1ZC6A 1R59O 4BRPA 5AZJA 1NGAA 2AA4A 3DXKA 2QM1A 3M3ZA 4JD2A 4F9OA 1HPMA 1BA1A 5EY4A 3R9PA 4FWOA 1NGBA 1XUPO 1ATNA 2NRHA 3O80A 3U4LA 3VGMA 3ZEUA 1GLCG 3UKRA 3QDKA 2D0OA 3H1QA 1GLDG 4IWVA 4Y0WA 4BRHA 4FWRA 3H3OB 4CZGA 1SQKA 3CQYA 3ENOA 3HSCA 4H5RA 5LJWA 3O1BA 3SJHA 2IVPA 3CETA 4BRCA 4RCHA 1TUYA 4MLHA 1MDUB 3VF4A 3L6QA 2P9NA 1EQYA 4B9QA 2E2NA 3CIPA 3EL2A 4JAXA 3QBWA 2A40A 4H5TA 4A2AA 3H3NO 4E1JA 4PL7A 4BRMA 3A5NC 1U2VB 3GE1A 1KAXA 3O4WA 5AQJA 3GBTA 3WQTA 3UE5A 1C0GA 5BRFA 1BG3A 2A6AA 2P9PA 5AQGA 1H1VA 3TPQA 1GLFO 4BC3A 5AQRA 5AFUA 2IIRA 3AARA 5FPMA 4IJNA 2YCHA 1DEJA 4EHTA 4BGAA 5AQSA 3BUZB 4B1WB 4BRGA
chains in the Genus database with same CATH superfamily
4WQ5A 5AQOA 4BG8A 1U4BA 3VEVA 3CMAN 3ENHA 1NBWA 1E4GT 2E88A 3HOTA 4FJIA 1OKJA 3PX4A 3ZEUB 5GAEP 2NZTA 3VQBA 5LMNK 4U67L 2I7PA 3PX0A 3V4IA 4KHUA 2X6SA 1U49A 4FZXC 3WXMB 3S3NA 5JS2A 4HTLA 4K41A 1NK5A 4LSNA 2P9KA 3M1FA 4G1QA 4FJ9A 1XNRK 4WQ4C 1E3MA 4FJXA 1NGHA 2YHAA 3THXB 4Y1DA 2KFZA 1QQOA 4CK3A 1BDGA 1BU6O 4O0IA 5CY4A 4FWKA 1YJ9N 4N47A 1VQLN 1ZBIA 4CJVA 4CF2A 3VTHA 3D2EA 4FOEA 3HSTB 3K0SA 3D2FB 3OYMA 2KTQA 1O13A 5CYQA 4B08A 3MDQA 3SUNA 3CJ1A 5JLFA 4CEBA 5AQHA 1GOCA 4JI2K 2QA4N 3LPUA 3VQAA 4BVPA 4X62K 2I7NA 4C1NK 5BPLA 3CF5L 4BROA 2VGNA 3K5OA 5E84A 1CXUA 3P39A 1C0FA 4E0DA 4LC9B 2ATQA 1HKCA 4DV2K 3KLHA 2E5LK 5M1KA 3TABA 3OYKA 5FPEA 4N5SA 4JHDA 1D4XA 3NGIA 3MCPA 5C24A 3K57A 4KB0A 2O8FA 1T44A 5J2NA 1XMQK 4KHQA 3SUQA 4I9QA 2QW9A 3AO5A 3VF6A 5I9EB 3K9KA 1HJOA 2UU9K 4K43A 4RW9A 5JS1A 4IDHA 5AQXA 5MLCQ 3CC2N 4WYBA 4PKGA 3AVNA 4LH4A 3JYTA 3WXLA 4QAGA 3SAFA 1TKZA 3DXMB 4DQQA 4BRLA 4IOCL 4K8XA 3E66A 3VENA 1D9FA 5HP1A 2XY7A 3VA0A 4BE2A 1XI1A 5DK5A 3KK1A 4MO4A 4NLCA 5CE3A 1VSDA 3GL1A 4B9LA 3WQUA 3LP2A 1KFSA 4HCCA 3TAQA 1NMNA 1SKRA 5FPDA 2ASOA 3FGUA 1GLBG 1X3MA 1I3AA 4FPAA 4QS7A 4EFHA 2YX6A 1IJJA 2X74A 5K14A 2ZM6K 1RDBA 2P51A 4DU1A 2VWKA 4PUOA 3TU5A 4DSFA 1NJWA 1S1WA 4BRQA 1NKCA 4F2RA 2VYPA 4DS5A 3P31A 1V4TA 3VQQA 3ZLJA 1S9EA 3OVNA 4BC5A 1GLEG 3M8RA 3ZSRA 3MWPA 1HRHA 4JD2B 4C8MA 3AVAA 4GVMA 3G71N 2HHTA 4WFAL 3V9UA 1FW6A 3ATUA 4PKHA 3HK2A 3ZX2A 1HLUA 3UKRB 3FZHA 3ID8A 4F3TA 3DLHA 1VQ5N 2Z1HA 1D5AA 1FXXA 3HI0A 2P9UA 3GOIA 4OO1J 3BZCA 4IXCA 3WXKA 3KK2A 2QWPA 3I0SA 1VSKA 2D1KA 1C1AA 2P9NB 4AF1A 1HQUA 2VWJA 2WOMA 1XQSC 4CD1A 3KKSA 3MWTA 3PUFA 4BQZA 4KHYA 4E7KA 3RVCA 3DRRA 4CERA 2ASMA 4FVMA 3OA9A 1I94K 3OW2M 1T05A 1D8YA 4GY2B 4B1ZA 3S3OA 5AZIA 3SQ0A 1HYSA 3RRGA 3QFPA 2UXDK 5BRDA 2QEXN 1KXPA 1RT6A 3OYBA 2AJQA 4M45A 4KTWA 3NHGA 5CYMA 4GV3A 4Z94A 1NJYA 1S22A 3P1GA 2DTUA 4CF1A 1NGIA 3ULEB 5AQFA 3R8EA 1IG9A 4CF8A 4GV9A 4JRPA 4CW7B 4KHSA 1IKWA 3FFKB 3OHRA 2OZSA 5JVHL 3BEXA 3CCRN 3OYLA 4DR3K 1YT3A 4BR9A 5JENA 1T7PA 4EHUA 5AQNA 3OTOK 3THVA 1N36K 3PX6A 1VQ6N 4AHTA 4JK7A 1ASVA 4DQ8A 4PWDA 1DGKN 1Q18A 2D0BA 3U9ZA 3B8AX 4C8LA 3LP0A 3KLIA 1SAZA 3E9PA 4YFUA 5M1FA 4H4MA 4L3QA 3VQDA 1YTUA 3ZSZA 2OYQA 3NVMA 3SBGA 3O08A 4AILC 4Z4CA 3H08A 3THYB 3NE6A 5LJVA 1BUPA 2D0PA 4BC4A 1VQ9N 3LANA 1N34K 1BO5O 1Q81O 1EP4A 5EX5A 3L4IA 4YOYA 4JKBA 2OTJN 4MO5A 4O0JA 4K42A 4XIUA 3TAPA 5KRSA 2KQ2A 5LY3A 3T3FA 2GTDA 4GNIA 2P9PB 4K25A 1TKTA 2CGLA 4E1MA 2DY4A 3OYDA 4E3SA 1RDDA 3S5TA 3E1YA 3HL8A 3IDHA 1DTTA 2QWQA 3A5OC 5KPTA 3KTQA 3D2EB 2XY6A 4DKWA 4BQLA 3TTFA 4DTNA 4DWIA 3TAEA 1TL1A 2E20A 1Y64A 2Q2RA 3P4IA 4R79A 1VSIA 3THYA 1RBTA 4WFBL 3I0RA 3LDQA 4N56A 4CZJA 1ASWA 2VWBA 3VMFB 2HNYA 1NMDA 3R3LA 1WAJA 4ISFA 4CJ3A 4Q0BA 3AVKA 4DV3K 1K8AO 4ICLA 3DLGA 4BGBA 4FM1A 1K9MO 3QMLA 4ELVA 4OVLA 5AQPA 5LL6Z 1LV5A 2J4RA 4CZFA 2D5RA 3VQ7A 2P9IA 2GUPA 1Q82O 2ASPA 4LFBK 3CPEA 5BPMA 4CF0A 3C65A 3K9JA 3DMJA 3QINA 2RF2A 4CBWA 4DF8A 2F4VK 2ZE2A 3CYGA 1R59O 5AZJA 3MX2A 3AA3A 1NGAA 2JWKA 2GV9A 3KIOA 4KO0A 5C25A 1ZYQA 4C8NA 2HMIA 3LWMA 4X66K 1NK7A 4FWOA 4FCYA 5GIPA 1ATNA 3HM9A 2HBKA 3OBYA 3U4LA 4CEAA 4FJHA 3ZEUA 3ISNC 1T8EA 4IWVA 2IAJA 4CFDA 4CK1A 3PY8A 1RTHA 1KLNA 2HHHK 1B9FA 3ENOA 1G15A 3HSCA 3DOLA 2Q3SA 2IVPA 4YORA 1X9SA 5C0YA 1NU0A 4RCHA 4MLHA 4Z4GA 1MDUB 1EWQA 1M90O 4DF4A 1HNVA 2NRVA 2VGMA 3CIPA 3QETA 3QBWA 4A2AA 3H3NO 4RW7A 1OH7A 1U2VB 1JKHA 2X78A 3GBTA 5CZ1A 2A6AA 2UUBK 2P9PA 1H1VA 2OZMA 1GLFO 4BE7B 4EP4A 2IIRA 5TKWA 3AA4A 5I3UA 3BUZB 3V6DA 4BRGA 5KQ8A 2BGGA 1SL1A 4NCBA 3CERA 4B8AB 4DSKA 1C0UA 2O4IA 3U6FA 2XY5A 1BCOA 3L8BA 1HNXK 1NK9A 3G0ZA 4ZTJA 1Z05A 4JK8A 1BISA 2E2QA 4DQPA 1GLAG 4DFPA 4LH5A 5M1QA 1G99A 1BCMA 1IBKK 3MN7A 3DJCA 1QQMA 4O55A 3ID6A 3MMVA 2ZD1A 3J7ZO 3BDPA 4OKJA 4FLXA 3QEPA 3CM5A 3F9KA 1LOTB 4RW8A 5LMUK 3VQ4A 3IRXA 4H5VA 3QLHA 3TTCA 3TWHA 3DAWA 4JHDB 5ADXA 5J1EA 2YV0X 4OX9K 2HVIA 3VEZA 1OH5A 4NCAA 2HF4A 2B6AA 4M3XA 5KI6A 4JKHA 1V4SA 3HVTA 4KFBA 2QK9A 3HZ6A 4CJPA 3ZT0A 3L2QA 3M6GA 3UKUB 4K0KK 3IKMA 3SUOA 3MEGA 3T1HK 1K8KA 3CQXA 3TSQA 4I2QA 3KHYA 3E9LA 1CXQA 1RDUA 4OKKA 1UAXA 3P83D 2FXUA 2OCEA 4B3OA 2C1IA 3QEIA 3L2WA 1J6ZA 3GDQA 1UWBA 1Q8IA 3EZWA 3C0BA 1VQ7N 3IUCA 3ZYYX 4YOVA 3JSMA 4H4OA 4NLBA 1B92A 5E41A 4E1NA 5CHIA 1A5XA 1BHLA 5HRRA 3RR8A 2A1SA 5H1SQ 4FXDA 3QO9A 4R5PA 2NRRA 1NK4A 2QKKA 4LF7K 4BDZA 4M3TA 4BRDA 3JXUA 1HKGA 1RDAA 3ALYA 4YY3K 4CHQA 1RTDA 1T6DA 5AQVA 1QZ6A 3AO4A 2KFNA 2PBDA 3NH2A 3V1RA 1QQCA 5EOYA 3D45A 3RSEA 1JJ2M 3O8MA 1NGCA 4FWMA 2HHVA 3I8BA 3EO3A 4DG1A 4DV0K 2YI1A 2E8AA 3UB5A 3CI5A 4BR2A 3V9WA 3DLBA 4FK0A 1TK0A 4FO0A 4PQUA 2YHBA 4B3SK 1UOCA 4FW1A 4KHNA 3F2KA 2YNFA 2X6NA 4CEEA 4NCGA 4KB1A 1LAWA 4YDUA 3MEEA 2E2OA 2IS3A 1ASUA 2YNIA 4JKGB 4ISGA 1D9DA 1KRPA 5DMRA 3VN5A 1JLEA 1N5YA 1ZBFA 4BRKA 4KBOA 5M1OA 4O5FA 1S72N 1OH6A 1C1BA 1NKBA 3K58A 3EE8A 2A3ZA 3NGYA 3BZKA 2V51B 1BIZA 1BIUA 4LF5K 3CC7N 1HQEA 4N76A 3MK6A 1L3SA 3ZETB 4DR6K 5AJ3K 3C6TA 3L2VA 2HOEA 2G8KA 5AQWA 3PSIA 4FJJA 1NGEA 1OVYA 3QNNA 3AV9A 3AVCA 1S5JA 1J5EK 3SJJA 1HNIA 3SPZA 1WBBA 2O8CA 1NOYA 2ZGZA 3U9DA 4LF6K 3O6WA 4E7IA 3AY9A 3BP8A 4MFBA 2QWRA 3EKSA 2P9KB 2HF3A 2FSKA 3NMUA 3TAFA 3HXMA 4OPHA 1JLBA 3CJ7A 1VRUA 3ZSQA 1HNWK 5AR0A 4CESA 2P1JA 4EAHD 3LZJA 4HVJA 4M3YA 4JRQA 4JYAK 3U8XA 3C6HA 1KCFA 1XC3A 4LF9K 1WSJA 4KI6A 3AVIA 1ESVA 4DTSA 1XHZA 4GKKK 1IO2A 1YAGA 1P90A 2YHXA 4QS8A 2E6LA 2JWLA 3VQ9A 3DLEA 1NWKA 3U3GA 2P9LB 3VEWA 3LDSA 4HUEA 2OPRA 1UA0A 3U3YA 4FSVA 4MLEA 4CFAA 1XNQK 4BDPA 4JI5K 3HYFA 1LWEA 3ULEA 3B6PA 2YHYA 3EEQA 4IDKA 2ZJPL 3AO2A 3EY1A 4CJKA 1TK8A 1ZXOA 3C7NA 3KK7A 2O8EB 4CJRA 1K73O 3TR8A 2FC0A 1JXBA 3AAPA 1JLCA 4CHNA 4H0VB 1C1CA 3QEVA 4QOZB 2W6KA 2FSJA 4CIGA 3HTVA 1CZ9A 3PIPL 1VQ8N 1Z26A 2A42A 1NK8A 3WNGA 2F96A 3B6OA 1NM1A 4E19A 1WSEA 2JGUA 4H0OA 3OS0A 4AQYK 4JN4A 3ZSYA 4B9TA 2KZZA 1WUAA 3KK3A 2R7YA 5F2RA 4KREA 3THWA 2Y1IA 2E1ZA 4BWJA 4JI6K 2A41A 2HHQA 3O5BA 4JEPA 3CFOA 2QWNA 2ITGA 3NVKA 3EZ5A 4BC2A 3TAGA 1RT4A 2D4WA 3NF8A 4ISEA 4OPKA 3CCVN 3WEEB 1U04A 1W97L 2P9IB 2E2PA 3L0QA 4LF8K 2WONA 4DR7K 2FF6A 3CJ9A 1RT2A 3LM9A 3BY5A 2PAVA 3OYCA 4BY9C 4KH6A 3C6UA 1WOQA 4E72A 4M3RA 2IVNA 3R1XA 1GOAA 2Q1NA 4J8FA 1L3UA 4W5NA 4MQ3A 3SAHA 2VG7A 1ITGA 2QWLA 4ZTFA 1YJWN 3MECA 2HMPA 1YF5L 3THWB 3DXMA 1S6QA 3FFIA 4LFCK 1XWLA 4RTFD 3ZT2A 5B8HA 3MCAB 1N33K 4BRIA 3IMXA 4BRFA 3SMPA 3ATVA 4DS4A 4YOXA 3MXIA 4DQSA 3C6AA 4H8KA 4M7XA 3SCXA 1CZBA 3WNEA 4Z0UA 4JKCA 1LW0A 1SUQA 3IG1A 4MDBA 4DMNA 4E89A 4FW2A 5HOOA 3OY9A 5C2FA 4H5NA 2EHGA 1BQNA 3VQEA 2O8FB 3IAYA 2PZSA 4KHWA 1ZC6A 4BRPA 4DV5K 2HVHA 4WF9L 3AO1A 2AA4A 3AVMA 3NF7A 4FK4A 1EWRA 1IH7A 1Q86O 2O8BB 3SAGA 5J2MA 1HNZK 1XUPO 3EE9A 1Y97A 1S1TA 3O80A 2HHUA 1QSYA 4DSIA 3LAKA 3QDKA 3H1QA 1GLDG 4E7JA 4CZGA 4LF4K 1TVRA 4H5RA 5LJWA 2KW4A 2QXFA 2GX9A 3CETA 4BRCA 2HNDA 2VQEK 1TUYA 3ZT1A 4KTQA 2QTDA 2RPIA 4DTUA 1EQYA 4B9QA 4FJGA 3DOKA 1YVUA 2E4LA 4IOXA 1N6QA 2ETJA 4WFNL 3GE1A 1X9MA 4RG8A 3O4WA 5AQJA 3WNHA 3UE5A 1C0GA 2QI2A 2IC3A 1BG3A 4JS5A 4PHTX 4CHZA 5T7BA 4IJNA 4DLEA 3MX5A 4A5BA 1LWCA 2OPQA 3SBTA 2Q0UA 4CJUA 3MXJA 4DQRA 1VQMN 2Q97A 1TGOA 3LWLA 1QHTA 1J5OA 4BWMA 4B1XB 4UY8O 2DFEA 4H03B 3I55N 4FWNA 3D7EO 4DTMA 3KKRA 3CCMN 1J9AA 3HO1A 2VG6A 3TSPA 3OYEA 1I39A 5FRNA 1IKVA 3N4QA 4KH4A 4WQ5C 4H0TB 3ULDA 4FPBA 4C8KA 1DKGD 2NLXA 4GW6A 2UUAK 3G6EN 4BRNA 1HX1A 5AQUA 1NG9A 2RE2A 3L4QA 3CXCM 4BEBA 3G10A 4PKIA 5CR4A 5EVZA 3K59A 1S9GA 4AHVA 3ZSOA 1SL2A 1VSFA 4BREA 4CVNE 2F8SA 1M1KO 4BACA 4KPYA 1JCFA 3LL3A 4U7BA 2O8BA 5HRPA 2FSNA 3QERA 4XH4A 3SV3A 4CEZA 1X9WA 2OA8A 3BF1A 3HBTA 1RBRA 1BOTO 1Q9XA 4JKDA 3E01A 1FJGK 5DM7L 4PA1A 2Q31A 1WBDA 1A5VA 2A1RA 3CM6A 4XEIA 4KHPK 1TYQA 5KQDA 5AQMA 4CJSA 4V19S 3P5JA 4AM7A 2QXLA 4B9MA 4FZYA 1VQNN 4BR0A 3CJCA 4OKEA 4H0YB 3K2PA 3QB0A 3JAMO 3V9SA 1NK0A 3V9ZA 4W5RA 1GLJO 4HCBA 4F2SA 3VTIA 1JL1A 4W5QA 1NLVA 4IJAA 3F9MA 4CEQA 5IT9O 4I2PA 4O8KA 4CEFA 1QE1A 5GAGP 4IEIA 4C23A 1C6VA 3M8SA 4CJTA 3PO5A 5J2QA 2QWMA 2ZGYA 3DI6A 4CJQA 3OYJA 2QKBA 3QBXA 4ID1A 4FM0A 4J2EA 5GINA 1KTQA 1RFQA 4JKAA 4Z4FA 4ELTA 1WSFA 3J7YP 1NGGA 1CLQA 4I6MB 3O9TA 2W41A 4A62A 3RR7A 1FKOA 2KHOA 3JS6A 4GV6A 3I33A 4CHYA 2YKMA 3MN5A 1BA0A 2YJFA 3J81O 4A2BA 4CJ5A 2AP1A 1VK0A 3J7AP 2PY5A 3QEWA 1KLMA 1RT1A 3H46O 2VCPA 4DB3A 2YKNA 2FF3B 2HHWA 1S6PA 1RBUA 3K5NA 2BUPA 2FBXA 1NOZA 3LDLA 1EETA 1X3NA 1IKYA 3KVGA 3BGRA 3PSFA 1ZBHA 4HHTA 5FROA 2ZJRL 2VQFK 4OPJA 4L8RB 1T6CA 4F4KA 3A0IX 5GIOA 5SZTA 2F9TA 4BE0A 3VOVA 3KWGA 5HRNA 1QSSA 4F8RA 3IFRA 1RDWX 3HPHA 2P5GA 2G8FA 5C15A 4FWLA 4DTOA 4BVOA 4N41A 1BQMA 3A5LC 4PL8A 3ZX3A 2V7ZA 4JI1K 4CE9A 4YNQA 1MWKA 4CD3A 4CIEA 4O5BA 4DR2K 3THXA 1OH8A 5M1PA 4JK9A 1WSHA 2G8UA 4DR4K 3OJSA 3O1WA 4DU4A 5KRTA 4DHYA 1K6YA 3BF3A 3ZSWA 2UXBK 4OJRA 3CJBA 3WT0A 3AAQA 3LP1A 1HPZA 5KGWA 4DSEA 5EU7A 4FWQA 5AZIB 2IOCA 2HHSA 4CIFA 1VSHA 1SKWA 1K8KB 2RHKA 3D6RA 2VG5A 3RMBA 3CC4N 5FRMA 4C1NI 1VAZA 4B3MK 4YHHK 4CBXA 2OPSA 3VETA 4FL9A 3OS1A 1NNEA 4NO7A 4C8OA 4CJLA 1HKBA 2GELA 3EKUA 5J2PA 4GKJK 4OGCA 2ZJQL 1KVCA 1WSIA 2Z1JA 1TK5A 4M42A 3DYAA 4BR5A 4B8CA 3HP9A 4GMJB 2HBLA 4HUGA 1R0AA 1JCGA 4CFBA 3C95A 1MU2A 4E7LA 3RSEB 3W0LA 2LSNA 2QWOA 3L3VA 2HSTA 4Z4HA 1HMVA 4JI8K 1YUWA 4WQ4A 4FYDA 1IKXA 4XH5A 1S1XA 3KD5E 4I9LA 1JLGA 1BI4A 4OLAA 3DLLL 4NB4A 3AVJA 5AQYA 2XY8A 1KAYA 3FLCO 5HLFA 3HPGA 4ZHRA 3LAMA 1CZAN 2YJEA 2BANA 3M8QA 5KTQA 2BH1A 3KJVA 4DQIA 1RDCA 2FBVA 3DLRA 3VGLA 4CEDA 2V7YA 1W0HA 5KPZA 2F7TA 4DFKA 5C42A 1VQKN 1KVBA 1JLAA 3AO3A 4AHSA 4KRFA 2PYJA 1VQON 5AQIA 1RT3A 3QFUA 4MDAA 1L3VA 2GUIA 1FKPA 1IV0A 5HROA 2BTFA 3HT3A 4BE1A 3IS9A 4M3UA 1X1PA 2HB5A 3SMSA 4FJKA 3D2FA 1U6ZA 4AHUA 3CFRA 4FLUA 4CJ4A 1J53A 4CCHA 4Q5VA 2V52B 4ILJA 2YNHA 4W5TA 4B1YB 3HJFA 2P9LA 3VGKA 2CGKA 3O9SA 4KI4A 3OYGA 2JLEA 2DFHA 1RBSA 1RILA 1YIJN 2WBNA 1XC9A 2WFBA 4FJ7A 5BR9A 1HR0K 4BDYA 3AVGA 3DRPA 5E26A 1YTAA 1TAUA 5JICA 3TANA 1TKXA 4CJWA 5C10A 4LD0A 1NJZA 1B9DA 3SPYA 4M63C 3EYZA 1Q9YA 3C7NB 3MEDA 3SQ4A 1C0MA 4CI6A 3L3UA 3LPTA 5CZ2A 3PO4A 2DFFA 4W5OA 4FJLA 3KLEA 4IZ9A 3SK3A 1LW2A 2BDPA 5IWAK 4CGIA 2WC9A 2XHBA 1NK6A 3NAEA 3PLAA 3NGZA 2HNZA 2QM1A 3M3ZA 4F9OA 5EY4A 3WNFA 3OYIA 1Z25A 1F21A 2OTLN 4IOAL 3VGMA 1KC8O 4DUYK 3S3MA 3UKRA 1QSLA 2PYLA 2D0OA 2FBTA 4FWRA 3M8PA 3CCEN 4YOTA 3S9HA 1QVGM 1VSJA 4DV6K 3L6QA 2P9NA 1VSLA 3CQ8A 4CGDA 4HUFA 3OYNA 4NYNA 2A40A 2RKIA 4E1JA 4PL7A 4DUZK 4IG3A 3KWIA 4KAZA 4M3ZA 1YITN 3WQTA 3T7ZA 2IGIA 5BRFA 3SUPA 3F5TA 3RTVA 1RNHA 5AQRA 5AFUA 4DLGA 3T1AA 3RMCA 2YCHA 1QS4A 4EHTA 2D0CA 1WLJA 4DTJA 4B1WB 2C1GA 3AVLA 2G8WA 4FLTA 5AZJB 1JL2A 2IVOA 3K5MA 1QZ5A 3FZFA 3LDNA 4IBNA 2ITMA 4DV1K 4G9ZA 2F8TA 3Q7BA 3LZIA 3H1VX 1ZBSA 2WTUA 4IO9L 2ZF5O 3VQ5A 3J8AA 3OYHA 3LDOA 1RTIA 4AHCA 4AH9A 1S1UA 4ILGB 1WB9A 1LCUA 3VESA 2O8CB 1W9HA 2FLOA 1MA9B 3WXJA 4O4GA 4K8ZA 4WE1A 5KPRA 1C0TA 3CJAA 4WCEL 1WN7A 3NF6A 3O3HA 4FLWA 1ATSA 3HP6A 3WEEA 3R6MA 1IBLK 4FM2A 3F73A 3ZX0A 3HPOA 3CPWM 3VEYA 4M7YA 3VPZA 4RW4A 4IFVA 2B5JA 2G8VA 3NH0A 2FBYA 3T69A 5D3GA 1BGXT 4CJFA 1BI4B 1EX4A 4KH5A 1RGIA 1JLQA 3AA2A 1MWMA 2P9SA 1SKSA 4HWIA 2CH5A 3ENBA 2B4JA 4B9NA 4JV5K 3LP3A 3FR0A 4NXMK 3PIOL 3SV4A 3QNOA 1GLLO 2XO7A 4JKFA 4DR5K 3CYMA 2G8HA 2HW3A 2D0AA 5BN9A 1TYQB 4O8UA 5EXWA 2H3GX 4DV4K 1X9JA 1NGDA 1T03A 3CD6N 1U2VA 1O1WA 2RN2A 3MN9A 3OYAA 2CH6A 3VF2A 4JI4K 5C12A 3PV8A 4FJ5A 5SWMA 4CZMA 3SZ2A 4DR1K 3TI0A 4CJEA 2ZQBA 4YDUC 4KV8A 1QHAA 1NGJA 1VSEA 3H45C 4JS4A 4FVUA 1REVA 3ASMA 3O9RA 4FOIA 2P9SB 3OS2A 3QICA 4EZ9A 4AHRA 3V9XA 4LSLA 3LM2A 2CGJA 2EWSA 4RW6A 2Z1IA 1SV5A 2W40A 4OGEA 4CGHA 4JKGA 3QEXA 3VQ6A 3KLFA 1S3XA 2BE2A 3TSUA 5JLHA 4DFMA 1YHQN 2KZMA 4DTPA 5JVGL 4B1UB 3E9OA 4O44A 4A57A 1U48A 1YJNN 2XRIA 4HTUA 2Y1JA 4LFAK 3NBPA 3P38A 3FE1A 4B3TK 3V1OA 4I7FA 3M5RA 3VERA 4ELUA 1FK9A 1DLOA 4BG9A 2HBJA 4DTXA 3V1QA 2NRTA 2W00A 4JNEA 2O8DA 4OLBA 4NYFA 1IG8A 2PFUA 3TTDA 3DWLA 4H0XB 3TARA 3CMEN 5FLXO 3RMDA 3RRHA 2IDOA 3CCJN 4BR7A 1VRTA 4H0PA 1Z6RA 3VQCA 1DTQA 3WUHA 5ELZA 3AA5X 1DT9A 4BECA 4FLYA 3O9UA 3CCQN 5AQLA 3VQPA 1HJRA 4J2BA 4JI0K 1BL3A 2UYTA 3AGRA 5AQTA 3I8DA 1EKEA 2KKZA 4KTZA 2HHIA 2P5OA 5FPNA 2YNGA 4F3OA 2GBZA 3FZKA 3W3DA 3S41A 3FZLA 2Q36A 3SI6A 4KKOA 4NXNK 3ZSVA 1XMOK 3ZCMA 4B1VA 3ZSXA 1HYZA 3QIPA 5F0XA 5AQQA 4BRAA 3AVFA 4FWSA 1W2BM 4J2DA 1L3TA 5M1NA 4FJ8A 3O3GA 4CHPA 3N4PA 3CG7A 5DM6L 4CGFA 2DPNA 3WXIA 1ZBLA 3SNNA 3L2RA 1QQNA 4XH1A 1TV6A 3T1YK 1EO1A 3HM8A 4B3RK 1VQ4N 4FK2A 4Z4IA 1TUUA 4DCHA 1SL0A 3NF9A 4Y1CA 1SZ2A 2P9UB 4H5WA 3SQ1A 1BWFO 1J54A 2HBMA 3ZT4A 1RCHA 2GWKA 1ILYA 5F1XA 3NH1A 3CCSN 2Z1GA 3ITHA 4IKFA 3A8YA 3UIQA 1KAZA 1S1VA 1EXQA 2ZWHA 4CGGA 1RT5A 3O3FA 4CJ7A 4IFYA 5BR8K 4CZLA 3LDPA 4PY5A 1KVAA 5HL7L 1Q7YO 5AQKA 5AFUH 3L2UA 1U45A 3HOSA 2NNWA 3ZETA 3Q7CA 4FLVA 1QVFM 3MAQA 3CCLN 5BN8A 1VSMA 3NFAA 3OBWA 4YOUA 4UQGA 2F9WA 3A5MC 3CCUN 3H6EA 4A59A 1TAQA 1HUXA 4ID5A 3ZT3A 4CEOA 1NGFA 5FDLA 2I5JA 1KQSM 1N8RO 4AM6A 4CF9A 3EN9A 3GG4A 3O9QA 1WAFA 1XHXA 2W42A 4CZEA 3J80O 5BREA 4CFCA 1E4FT 1YVNA 2KLAA 4A61A 2UXCK 1RBVA 4Z4EA 4EIAA 5JMVA 1LAVA 3KZBA 3CHWA 3VEOA 1JCEA 2W6LA 4BR4A 3QIOA 5GADP 1GOBA 5A2QO 3VEXA 1WNSA 5AQZA 2NRXA 4J2AA 5ADXH 3RMAA 4QS9A 5I42A 3G25A 4IG0A 3HRGA 3FZMA 1P8ZA 4JI7K 4FWPA 3I56N 3TAMA 3UKUA 3VA3A 5BRHA 1KFDA 4M41A 1NKEA 3A2FA 4DFJA 4RWTA 3DXKB 1YXQA 3QESA 4E7HA 4DSJA 2NUBA 1NJXA 1TKDA 3LALA 2G8IA 3SQ2A 4FJNA 4EZ6A 4JLHA 4CZKA 5HRSA 3HVRA 4DU3A 4JKEA 2GEMA 4CZHA 2OPPA 5C2DA 1SS6A 2OANA 4CZIA 3AVHA 3KLGA 4IEEA 4I6MA 5KGXA 3DLKA 4LY7A 3V81A 3C94A 3G4SN 2E1YA 4CBUA 2WUSA 4B9VA 1HYVA 2NRZA 3D0PA 1QTMA 4XJXA 3RWUA 1LWFA 4CHOA 1VHXA 5BPNA 2Q0RA 3MN6A 4GVEA 4FLZA 2E6MA 1TL3A 3KD1E 1ZBUA 3VQ8A 3MXMA 3SLCA 5TKYA 1IBMK 1ATRA 2A5XA 2YHWA 4CECA 1A5WA 1W7AA 4CK2A 1RT7A 2GWJA 4IO8A 2O8DB 1WSGA 1JXEA 1KD1O 3O4QA 1L5UA 2UUCK 1U47A 3DXKA 4X65K 1T3VA 1JLFA 3O4NA 4YOWA 4JD2A 1HPMA 3DRSA 1BA1A 3T19A 3R9PA 4OPAA 4A5AA 1NGBA 4ILHA 3OJUA 4DTRA 2NRHA 4DV7K 1UA1A 2O4GA 1GLCG 4FZZA 3CFPA 4Y0WA 4BRHA 4M3WA 4IFEA 2HHXA 3H3OB 4EP5A 1SQKA 3CQYA 5GAHP 1RTJA 1KSPA 4JI3K 4DSLA 3AGKA 3O1BA 3AVBA 3SJHA 3NDKA 1YI2N 4X64K 1N32K 4TSXA 3NCIA 3SYZA 3VF4A 4QCLA 3DM2A 2E2NA 3EL2A 4JAXA 1NJIO 4H5TA 4BRMA 3OYFA 3A5NC 1KAXA 3K5LA 4CGJA 2O8EA 5AQGA 3TPQA 4FJMA 4B9SA 4BC3A 1VQPN 2EX3A 3AARA 5FPMA 1OVQA 4B9UA 2NRWA 5HBMA 1DEJA 4BGAA 5AQSA
chains in the Genus database with same CATH topology
5KQ8A 3SBTA 4WQ5A 5AQOA 2Q0UA 5AZJB 4BG8A 3VEVA 2IVOA 3CMAN 1QZ5A 3FZFA 3LDNA 1VQMN 3CERA 3ENHA 1NBWA 2ITMA 4G9ZA 2Q97A 1E4GT 2E88A 3Q7BA 3HOTA 1OKJA 4B1XB 3H1VX 4UY8O 3ZEUB 5GAEP 1ZBSA 4H03B 4IO9L 2NZTA 2ZF5O 3J8AA 3I55N 3LDOA 4U67L 2I7PA 1Z05A 4JK8A 4FWNA 3D7EO 4ILGB 3WXMB 2E2QA 3CCMN 1GLAG 1LCUA 3VESA 4HTLA 4K41A 2FLOA 5M1QA 1G99A 1MA9B 3TSPA 3WXJA 3N4QA 4KH4A 2P9KA 3DJCA 3MN7A 3M1FA 5KPRA 1QQMA 4WQ5C 3CJAA 4H0TB 4WCEL 3ID6A 4FPBA 3MMVA 4WQ4C 1NGHA 3J7ZO 1DKGD 2NLXA 3G6EN 1ATSA 4BRNA 1HX1A 5AQUA 2RE2A 1LOTB 1QQOA 1BDGA 3L4QA 3WEEA 3CXCM 4BEBA 4H5VA 3TTCA 3DAWA 1BU6O 3R6MA 4JHDB 4FWKA 5ADXA 4PKIA 1YJ9N 3ZX0A 1VQLN 5CR4A 3VEZA 5EVZA 3CPWM 3VEYA 4M7YA 3VPZA 2HF4A 3VTHA 3D2EA 4JKHA 3T69A 1V4SA 4FOEA 4BREA 3HZ6A 3M6GA 3D2FB 3UKUB 3IKMA 1M1KO 1K8KA 1JCFA 3CQXA 3LL3A 3TSQA 3KHYA 1O13A 4KH5A 1RGIA 3E9LA 3MDQA 4U7BA 1RDUA 1MWMA 2FSNA 2P9SA 3CJ1A 5JLFA 4HWIA 4XH4A 2FXUA 5AQHA 3ZX2A 2CH5A 3BF1A 3HBTA 2C1IA 1BOTO 2QA4N 3ENBA 4JKDA 1J6ZA 4BVPA 3GDQA 5DM7L 2I7NA 2Q31A 3FR0A 3EZWA 3C0BA 3PIOL 1VQ7N 3IUCA 4C1NK 3ZYYX 5BPLA 4YOVA 1GLLO 4JKFA 4XEIA 3CF5L 4BROA 4NLBA 1TYQA 5KQDA 5AQMA 2VGNA 5E84A 3P39A 5BN9A 5CHIA 1TYQB 4O8UA 5EXWA 1C0FA 2H3GX 4AM7A 1X9JA 2QXLA 1NGDA 5H1SQ 3CD6N 4LC9B 1U2VA 1VQNN 1HKCA 4BR0A 3CJCA 3MN9A 2NRRA 4H0YB 3QB0A 2CH6A 5M1KA 3VF2A 5FPEA 4BRDA 5C12A 3JXUA 1HKGA 4JHDA 1T6DA 5AQVA 1D4XA 1QZ6A 4CZMA 3MCPA 2PBDA 1GLJO 5EOYA 4BGAA 3RSEA 1JJ2M 3O8MA 4YDUC 1T44A 3VTIA 1QHAA 1NGCA 4FWMA 3I8BA 1NGJA 3EO3A 1NLVA 4IJAA 3F9MA 2YI1A 2E8AA 2QW9A 3H45C 4O8KA 3UB5A 3CI5A 3VF6A 3K9KA 4BR2A 5GAGP 1HJOA 4IEIA 4C23A 5I9EB 3O9RA 4FOIA 2QWMA 2ZGYA 4K43A 4FO0A 2P9SB 3QICA 4IDHA 5AQXA 5MLCQ 3CC2N 4WYBA 3LM2A 3QBXA 4PKGA 2CGJA 2EWSA 3F2KA 5GINA 1RFQA 4JKAA 2W40A 4YDUA 3WXLA 3SAFA 3DXMB 4JKGA 2E2OA 1NGGA 4JKGB 4I6MB 4BRLA 4ISGA 1S3XA 3O9TA 3TSUA 3E66A 3VENA 5JLHA 4IOCL 2W41A 1YHQN 4A62A 2KHOA 3JS6A 5JVGL 3I33A 4GV6A 4B1UB 3E9OA 3MN5A 1BA0A 2YJFA 4KBOA 5M1OA 4A57A 4A2BA 4BRKA 4O5FA 2AP1A 4MO4A 4NLCA 5CE3A 3GL1A 1S72N 3WQUA 1YJNN 3H46O 3EE8A 2A3ZA 3P38A 2VCPA 4DB3A 5FPDA 2ASOA 3FE1A 3FGUA 1GLBG 1X3MA 4FPAA 4QS7A 2V51B 3M5RA 3VERA 2YX6A 4EFHA 4FVUA 2FF3B 1IJJA 3CC7N 4BG9A 2BUPA 3LDLA 3TU5A 2HBJA 1X3NA 4BRQA 3KVGA 2NRTA 2W00A 4JNEA 3MK6A 2VYPA 3P31A 1V4TA 1IG8A 3ZETB 2PFUA 3TTDA 4BC5A 1GLEG 3DWLA 3MWPA 4H0XB 4JD2B 2ZJRL 3CMEN 3G71N 3CCJN 2HOEA 4BR7A 4WFAL 1T6CA 3A0IX 5GIOA 3ATUA 4PKHA 4H0PA 1Z6RA 1HLUA 2F9TA 5AQWA 3KWGA 3FZHA 3ID8A 3UKRB 1NGEA 1OVYA 3VOVA 3WUHA 5ELZA 1VQ5N 1DT9A 4BECA 3IFRA 3HI0A 3O9UA 3CCQN 1RDWX 2P9UA 2ZGZA 3U9DA 3GOIA 3O6WA 4OO1J 5C15A 4IXCA 5AQLA 4FWLA 3WXKA 3AY9A 2QWPA 3BP8A 2D1KA 2UYTA 4BVOA 3AGRA 5AQTA 3A5LC 4PL8A 2KKZA 2QWRA 3ZX3A 2V7ZA 3EKSA 2P9NB 2P9KB 2HF3A 4AF1A 2FSKA 5FPNA 3NMUA 1MWKA 4OPHA 4CD3A 1XQSC 3CJ7A 4CD1A 5M1PA 3FZKA 3W3DA 3S41A 3FZLA 2Q36A 3MWTA 5AR0A 4BQZA 4JK9A 3O1WA 3RVCA 4EAHD 2ASMA 4B1VA 4DHYA 5F0XA 3BF3A 3OA9A 5AQQA 3CJBA 3U8XA 4BRAA 3C6HA 1XC3A 3OW2M 3WT0A 3AAQA 4FWSA 4GY2B 4B1ZA 1ESVA 5AZIA 1W2BM 4FWQA 5AZIB 3QFPA 5M1NA 1YAGA 1P90A 3N4PA 2YHXA 4QS8A 5BRDA 1KXPA 2QEXN 2JWLA 5DM6L 1K8KB 2RHKA 3D6RA 1NWKA 2DPNA 2P9LB 3WXIA 3CC4N 3VEWA 1QQNA 4XH1A 4C1NI 4GV3A 1EO1A 4Z94A 1VAZA 3HM8A 1VQ4N 1TUUA 4DCHA 4CBXA 1S22A 4FSVA 3VETA 4MLEA 1NGIA 4FL9A 3ULEB 5AQFA 3R8EA 1SZ2A 2P9UB 4NO7A 3ULEA 4H5WA 1BWFO 2HBMA 4GV9A 1ILYA 2GWKA 5F1XA 3CCSN 1HKBA 2GELA 2YHYA 3FFKB 3OHRA 3EKUA 5JVHL 3BEXA 2ZJPL 2ZJQL 3CCRN 3A8YA 4BR9A 1KAZA 2ZWHA 1ZXOA 4EHUA 5AQNA 4BR5A 3C7NA 4CJ7A 3KK7A 4CZLA 3LDPA 1K73O 1VQ6N 2HBLA 1JCGA 5HL7L 4JK7A 5AQKA 5AFUH 1Q7YO 4DQ8A 1DGKN 1Q18A 3AAPA 3U9ZA 3HOSA 3B8AX 2NNWA 4H0VB 3RSEB 3W0LA 2FSJA 2QWOA 3ZETA 3Q7CA 2HSTA 1SAZA 3E9PA 3HTVA 1QVFM 1YUWA 4WQ4A 3CCLN 4XH5A 5BN8A 3PIPL 5M1FA 4L3QA 1VQ8N 2A42A 3OBWA 4YOUA 2F9WA 3A5MC 3CCUN 3H6EA 4A59A 3DLLL 3NVMA 3SBGA 1NM1A 3O08A 4NB4A 5AQYA 1HUXA 1KAYA 3FLCO 1NGFA 4H0OA 5LJVA 1KQSM 4JN4A 1BUPA 2D0PA 4BC4A 1N8RO 4AM6A 1WUAA 1VQ9N 1CZAN 3EN9A 3GG4A 3O9QA 2YJEA 5F2RA 4CZEA 5BREA 1E4FT 1BO5O 2E1ZA 1YVNA 2A41A 2BH1A 2KLAA 3O5BA 1Q81O 4JEPA 4A61A 5EX5A 3L4IA 3VGLA 2V7YA 4YOYA 2QWNA 4JKBA 4EIAA 5JMVA 2OTJN 3KZBA 2F7TA 4MO5A 5KPZA 3CHWA 4K42A 3VEOA 3NVKA 1JCEA 1VQKN 4BC2A 2D4WA 4ISEA 4BR4A 5LY3A 3CCVN 5GADP 3WEEB 3VEXA 1VQON 5AQIA 2GTDA 2NRXA 1W97L 2P9IB 3QFUA 4GNIA 2P9PB 4MDAA 5AQZA 2BTFA 4K25A 2E2PA 2CGLA 3L0QA 4QS9A 5ADXH 3G25A 3E1YA 2FF6A 3CJ9A 3HRGA 3IDHA 3FZMA 2QWQA 3LM9A 3SMSA 1P8ZA 2PAVA 3A5OC 5KPTA 4FWPA 4BY9C 4KH6A 3I56N 3D2EB 3D2FA 3UKUA 1WOQA 1U6ZA 4DKWA 4BQLA 2IVNA 3R1XA 5BRHA 3TTFA 2Q1NA 4J8FA 2V52B 4RWTA 2E20A 3DXKB 1YXQA 4ILJA 1Y64A 4B1YB 2Q2RA 3SAHA 3P4IA 2QWLA 4R79A 2P9LA 4WFBL 3VGKA 4CZKA 1YJWN 2CGKA 3O9SA 4JKEA 3LDQA 2GEMA 4CZHA 2HMPA 5C2DA 1YIJN 1SS6A 1YF5L 2OANA 2WBNA 2WFBA 3DXMA 4CZIA 2VWBA 4CZJA 5BR9A 4IEEA 4I6MA 3VMFB 4RTFD 5B8HA 3MCAB 1NMDA 4BRIA 3R3LA 3IMXA 5E26A 4BRFA 4ISFA 3SMPA 3G4SN 3ATVA 2E1YA 5JICA 4CBUA 5C10A 1K8AO 2WUSA 4YOXA 2NRZA 4BGBA 1K9MO 3C6AA 3QMLA 4M7XA 5AQPA 4XJXA 4M63C 2J4RA 5BPNA 4CZFA 2Q0RA 3C7NB 3MN6A 4JKCA 4GVEA 2P9IA 2GUPA 4MDBA 1Q82O 4CI6A 2ASPA 5HOOA 5C2FA 4H5NA 3SLCA 3CPEA 5TKYA 5BPMA 3C65A 1ATRA 3K9JA 2A5XA 2YHWA 4CBWA 2GWJA 4IO8A 4IZ9A 3SK3A 1ZC6A 1NJIO 1R59O 4BRPA 3MX2A 5AZJA 1KD1O 4WF9L 1NGAA 2JWKA 2WC9A 2AA4A 3DXKA 3PLAA 1T3VA 1Q86O 4YOWA 2QM1A 3M3ZA 4JD2A 4F9OA 3SAGA 1HPMA 1BA1A 5EY4A 3R9PA 4OPAA 4FWOA 4A5AA 1NGBA 1XUPO 3EE9A 4ILHA 5GIPA 1ATNA 2NRHA 2HBKA 2OTLN 3OBYA 3O80A 3U4LA 3VGMA 4IOAL 1KC8O 3ZEUA 1GLCG 3UKRA 3QDKA 2D0OA 3H1QA 1GLDG 4IWVA 4Y0WA 4BRHA 4IFEA 4FWRA 3H3OB 4CZGA 1SQKA 3CQYA 3ENOA 3HSCA 4H5RA 5GAHP 5LJWA 3CCEN 4YOTA 3AGKA 3O1BA 3SJHA 2IVPA 1YI2N 2GX9A 1QVGM 3CETA 4BRCA 4YORA 5C0YA 4RCHA 1TUYA 4MLHA 1MDUB 3VF4A 2QTDA 3L6QA 2P9NA 1EQYA 4B9QA 1M90O 2E2NA 2NRVA 2VGMA 3CIPA 3EL2A 4IOXA 3QBWA 2A40A 4H5TA 4JAXA 3H3NO 4A2AA 4E1JA 4BRMA 4PL7A 4WFNL 3A5NC 1U2VB 3GE1A 3KWIA 1KAXA 3O4WA 5AQJA 1YITN 3GBTA 2C1GA 3WQTA 3UE5A 1C0GA 3T7ZA 2QI2A 5BRFA 1BG3A 2A6AA 2P9PA 5AQGA 1H1VA 3TPQA 1GLFO 3F5TA 4PHTX 4BE7B 4BC3A 1VQPN 5AQRA 5AFUA 2IIRA 3AARA 5FPMA 2NRWA 4IJNA 5TKWA 2YCHA 1DEJA 3MX5A 4A5BA 5AQSA 4EHTA 3BUZB 4B1WB 4BRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KQ8 A;  4WQ5 A;  5AQO A;  2Q0U A;  5AZJ B;  4BG8 A;  3VEV A;  2IVO A;  1QZ5 A;  3FZF A;  3LDN A;  3CER A;  3ENH A;  1NBW A;  2ITM A;  2Q97 A;  1E4G T;  2E88 A;  1OKJ A;  4B1X B;  3H1V X;  3ZEU B;  1ZBS A;  4H03 B;  2NZT A;  2ZF5 O;  3J8A A;  3LDO A;  2I7P A;  1Z05 A;  4FWN A;  3D7E O;  2E2Q A;  1GLA G;  1LCU A;  3VES A;  4HTL A;  4K41 A;  2FLO A;  1G99 A;  1MA9 B;  3WXJ A;  2P9K A;  3DJC A;  3MN7 A;  3M1F A;  5KPR A;  1QQM A;  4WQ5 C;  3CJA A;  4H0T B;  4FPB A;  3MMV A;  4WQ4 C;  1NGH A;  1DKG D;  2NLX A;  1ATS A;  4BRN A;  1HX1 A;  5AQU A;  1LOT B;  1QQO A;  1BDG A;  3WEE A;  4H5V A;  3DAW A;  1BU6 O;  3R6M A;  4JHD B;  4FWK A;  5ADX A;  4PKI A;  3ZX0 A;  3VEZ A;  5EVZ A;  3VEY A;  4M7Y A;  3VPZ A;  2HF4 A;  3D2E A;  1V4S A;  4FOE A;  4BRE A;  3HZ6 A;  3M6G A;  3D2F B;  3UKU B;  1K8K A;  1JCF A;  3CQX A;  3LL3 A;  3KHY A;  1RGI A;  3MDQ A;  1MWM A;  2FSN A;  2P9S A;  3CJ1 A;  5JLF A;  4HWI A;  4XH4 A;  2FXU A;  5AQH A;  2CH5 A;  3BF1 A;  3HBT A;  1BOT O;  1J6Z A;  4BVP A;  3GDQ A;  2I7N A;  2Q31 A;  3FR0 A;  3EZW A;  3C0B A;  3IUC A;  5BPL A;  1GLL O;  4XEI A;  4BRO A;  1TYQ A;  5KQD A;  5AQM A;  5E84 A;  5BN9 A;  1TYQ B;  5EXW A;  1C0F A;  2H3G X;  4AM7 A;  1X9J A;  2QXL A;  1NGD A;  4LC9 B;  1U2V A;  1HKC A;  4BR0 A;  3CJC A;  3MN9 A;  4H0Y B;  3QB0 A;  2CH6 A;  3VF2 A;  5FPE A;  4BRD A;  3JXU A;  1HKG A;  4JHD A;  1T6D A;  5AQV A;  1D4X A;  1QZ6 A;  4CZM A;  3MCP A;  2PBD A;  1GLJ O;  5EOY A;  3RSE A;  3O8M A;  4YDU C;  1T44 A;  1QHA A;  1NGC A;  4FWM A;  3I8B A;  1NGJ A;  3EO3 A;  1NLV A;  4IJA A;  3F9M A;  2YI1 A;  2E8A A;  2QW9 A;  3H45 C;  4O8K A;  3UB5 A;  3CI5 A;  3VF6 A;  4BR2 A;  5I9E B;  1HJO A;  4C23 A;  4FOI A;  2QWM A;  2ZGY A;  4K43 A;  4FO0 A;  2P9S B;  3QIC A;  5AQX A;  4WYB A;  3LM2 A;  3QBX A;  4PKG A;  2CGJ A;  2EWS A;  1RFQ A;  2W40 A;  4YDU A;  3WXL A;  3DXM B;  2E2O A;  1NGG A;  4I6M B;  4BRL A;  4ISG A;  1S3X A;  5JLH A;  3VEN A;  2W41 A;  4A62 A;  2KHO A;  3JS6 A;  3I33 A;  4B1U B;  3MN5 A;  1BA0 A;  2YJF A;  4KBO A;  4BRK A;  4A2B A;  4O5F A;  2AP1 A;  4MO4 A;  5CE3 A;  3GL1 A;  3WQU A;  3H46 O;  2A3Z A;  2VCP A;  4DB3 A;  5FPD A;  2ASO A;  3FE1 A;  3FGU A;  1GLB G;  1X3M A;  4FPA A;  4QS7 A;  2V51 B;  4EFH A;  3VER A;  2FF3 B;  1IJJ A;  4BG9 A;  2BUP A;  3LDL A;  3TU5 A;  1X3N A;  4BRQ A;  3KVG A;  4JNE A;  3MK6 A;  2VYP A;  1V4T A;  1IG8 A;  3ZET B;  4BC5 A;  1GLE G;  3DWL A;  4H0X B;  4JD2 B;  2HOE A;  4BR7 A;  1T6C A;  3A0I X;  3ATU A;  4PKH A;  4H0P A;  1Z6R A;  1HLU A;  2F9T A;  5AQW A;  3UKR B;  3FZH A;  3ID8 A;  3VOV A;  1NGE A;  3ZX2 A;  3WUH A;  5ELZ A;  3IFR A;  3HI0 A;  1RDW X;  2P9U A;  2ZGZ A;  3U9D A;  3GOI A;  3O6W A;  4IXC A;  5AQL A;  4FWL A;  3WXK A;  3AY9 A;  2QWP A;  3BP8 A;  2D1K A;  2UYT A;  4BVO A;  5AQT A;  3A5L C;  4PL8 A;  2QWR A;  3ZX3 A;  2V7Z A;  3EKS A;  2P9N B;  2P9K B;  2HF3 A;  2FSK A;  5FPN A;  1MWK A;  4CD3 A;  1XQS C;  3CJ7 A;  4CD1 A;  3FZK A;  3W3D A;  3S41 A;  3FZL A;  2Q36 A;  5AR0 A;  4BQZ A;  3O1W A;  4EAH D;  2ASM A;  4B1V A;  4DHY A;  5F0X A;  3BF3 A;  5AQQ A;  3CJB A;  3U8X A;  4BRA A;  1XC3 A;  3WT0 A;  3AAQ A;  4FWS A;  4GY2 B;  4B1Z A;  1ESV A;  5AZI A;  4FWQ A;  5AZI B;  3QFP A;  1YAG A;  5BRD A;  2YHX A;  4QS8 A;  1KXP A;  1K8K B;  1NWK A;  2DPN A;  2P9L B;  3WXI A;  3VEW A;  1QQN A;  4XH1 A;  4Z94 A;  3HM8 A;  1TUU A;  4DCH A;  4CBX A;  1S22 A;  4FSV A;  3VET A;  4MLE A;  1NGI A;  4FL9 A;  3ULE B;  5AQF A;  3R8E A;  1SZ2 A;  2P9U B;  4NO7 A;  3ULE A;  4H5W A;  1BWF O;  2GWK A;  5F1X A;  1HKB A;  2GEL A;  2YHY A;  3FFK B;  3OHR A;  3EKU A;  3BEX A;  3A8Y A;  4BR9 A;  1KAZ A;  2ZWH A;  1ZXO A;  4EHU A;  5AQN A;  4BR5 A;  3C7N A;  4CJ7 A;  4CZL A;  3LDP A;  1JCG A;  5AQK A;  5AFU H;  4DQ8 A;  1DGK N;  1Q18 A;  3AAP A;  3U9Z A;  3B8A X;  4H0V B;  3RSE B;  3W0L A;  2FSJ A;  2QWO A;  3ZET A;  1SAZ A;  3HTV A;  1YUW A;  4WQ4 A;  4XH5 A;  5BN8 A;  4L3Q A;  2A42 A;  2F9W A;  3A5M C;  3H6E A;  1NM1 A;  3O08 A;  4NB4 A;  5AQY A;  1HUX A;  1KAY A;  3FLC O;  1NGF A;  4H0O A;  5LJV A;  4JN4 A;  1BUP A;  2D0P A;  4BC4 A;  4AM6 A;  1WUA A;  1CZA N;  3EN9 A;  3GG4 A;  2YJE A;  5F2R A;  4CZE A;  5BRE A;  1E4F T;  1BO5 O;  2E1Z A;  1YVN A;  2A41 A;  3O5B A;  4A61 A;  5EX5 A;  3L4I A;  3VGL A;  2V7Y A;  2QWN A;  4EIA A;  5JMV A;  3KZB A;  5KPZ A;  4MO5 A;  3CHW A;  4K42 A;  3VEO A;  1JCE A;  4BC2 A;  2D4W A;  4ISE A;  4BR4 A;  5LY3 A;  3WEE B;  3VEX A;  5AQI A;  2GTD A;  3QFU A;  4GNI A;  2P9I B;  5AQZ A;  2P9P B;  2BTF A;  4K25 A;  2E2P A;  2CGL A;  3L0Q A;  4QS9 A;  5ADX H;  3G25 A;  2FF6 A;  3CJ9 A;  3IDH A;  3FZM A;  2QWQ A;  3LM9 A;  3SMS A;  1P8Z A;  2PAV A;  3A5O C;  5KPT A;  4FWP A;  3D2E B;  3D2F A;  3UKU A;  1WOQ A;  1U6Z A;  4BQL A;  2IVN A;  5BRH A;  2Q1N A;  4J8F A;  2V52 B;  4RWT A;  2E20 A;  3DXK B;  1YXQ A;  1Y64 A;  4B1Y B;  2Q2R A;  3P4I A;  2QWL A;  2P9L A;  3VGK A;  4CZK A;  2CGK A;  3LDQ A;  2GEM A;  4CZH A;  2HMP A;  2OAN A;  3DXM A;  4CZJ A;  4CZI A;  2VWB A;  5BR9 A;  4I6M A;  4RTF D;  5B8H A;  1NMD A;  4BRI A;  3IMX A;  5E26 A;  4BRF A;  4ISF A;  3SMP A;  3ATV A;  2E1Y A;  5JIC A;  4CBU A;  2WUS A;  4BGB A;  3QML A;  4M7X A;  5AQP A;  4M63 C;  2J4R A;  5BPN A;  4CZF A;  2Q0R A;  3C7N B;  3MN6 A;  2P9I A;  2GUP A;  4CI6 A;  2ASP A;  4H5N A;  3SLC A;  5TKY A;  5BPM A;  1ATR A;  2A5X A;  2YHW A;  4CBW A;  2GWJ A;  4IO8 A;  4IZ9 A;  3SK3 A;  1ZC6 A;  1R59 O;  4BRP A;  5AZJ A;  1NGA A;  2AA4 A;  3DXK A;  2QM1 A;  3M3Z A;  4JD2 A;  4F9O A;  1HPM A;  1BA1 A;  5EY4 A;  3R9P A;  4FWO A;  1NGB A;  1XUP O;  1ATN A;  2NRH A;  3O80 A;  3U4L A;  3VGM A;  3ZEU A;  1GLC G;  3UKR A;  3QDK A;  2D0O A;  3H1Q A;  1GLD G;  4IWV A;  4Y0W A;  4BRH A;  4FWR A;  3H3O B;  4CZG A;  1SQK A;  3CQY A;  3ENO A;  3HSC A;  4H5R A;  5LJW A;  3O1B A;  3SJH A;  2IVP A;  3CET A;  4BRC A;  4RCH A;  1TUY A;  4MLH A;  1MDU B;  3VF4 A;  3L6Q A;  2P9N A;  1EQY A;  4B9Q A;  2E2N A;  3CIP A;  3EL2 A;  4JAX A;  3QBW A;  2A40 A;  4H5T A;  4A2A A;  3H3N O;  4E1J A;  4PL7 A;  4BRM A;  3A5N C;  1U2V B;  3GE1 A;  1KAX A;  3O4W A;  5AQJ A;  3GBT A;  3WQT A;  3UE5 A;  1C0G A;  5BRF A;  1BG3 A;  2A6A A;  2P9P A;  5AQG A;  1H1V A;  3TPQ A;  1GLF O;  4BC3 A;  5AQR A;  5AFU A;  2IIR A;  3AAR A;  5FPM A;  4IJN A;  2YCH A;  1DEJ A;  4EHT A;  4BGA A;  5AQS A;  3BUZ B;  4B1W B;  4BRG A; 
#chains in the Genus database with same CATH topology
 4WQ5 A;  5AQO A;  4BG8 A;  1U4B A;  3VEV A;  3CMA N;  3ENH A;  1NBW A;  1E4G T;  2E88 A;  3HOT A;  4FJI A;  1OKJ A;  3PX4 A;  3ZEU B;  5GAE P;  2NZT A;  3VQB A;  5LMN K;  4U67 L;  2I7P A;  3PX0 A;  3V4I A;  4KHU A;  2X6S A;  1U49 A;  4FZX C;  3WXM B;  3S3N A;  5JS2 A;  4HTL A;  4K41 A;  1NK5 A;  4LSN A;  2P9K A;  3M1F A;  4G1Q A;  4FJ9 A;  1XNR K;  4WQ4 C;  1E3M A;  4FJX A;  1NGH A;  2YHA A;  3THX B;  4Y1D A;  2KFZ A;  1QQO A;  4CK3 A;  1BDG A;  1BU6 O;  4O0I A;  5CY4 A;  4FWK A;  1YJ9 N;  4N47 A;  1VQL N;  1ZBI A;  4CJV A;  4CF2 A;  3VTH A;  3D2E A;  4FOE A;  3HST B;  3K0S A;  3D2F B;  3OYM A;  2KTQ A;  1O13 A;  5CYQ A;  4B08 A;  3MDQ A;  3SUN A;  3CJ1 A;  5JLF A;  4CEB A;  5AQH A;  1GOC A;  4JI2 K;  2QA4 N;  3LPU A;  3VQA A;  4BVP A;  4X62 K;  2I7N A;  4C1N K;  5BPL A;  3CF5 L;  4BRO A;  2VGN A;  3K5O A;  5E84 A;  1CXU A;  3P39 A;  1C0F A;  4E0D A;  4LC9 B;  2ATQ A;  1HKC A;  4DV2 K;  3KLH A;  2E5L K;  5M1K A;  3TAB A;  3OYK A;  5FPE A;  4N5S A;  4JHD A;  1D4X A;  3NGI A;  3MCP A;  5C24 A;  3K57 A;  4KB0 A;  2O8F A;  1T44 A;  5J2N A;  1XMQ K;  4KHQ A;  3SUQ A;  4I9Q A;  2QW9 A;  3AO5 A;  3VF6 A;  5I9E B;  3K9K A;  1HJO A;  2UU9 K;  4K43 A;  4RW9 A;  5JS1 A;  4IDH A;  5AQX A;  5MLC Q;  3CC2 N;  4WYB A;  4PKG A;  3AVN A;  4LH4 A;  3JYT A;  3WXL A;  4QAG A;  3SAF A;  1TKZ A;  3DXM B;  4DQQ A;  4BRL A;  4IOC L;  4K8X A;  3E66 A;  3VEN A;  1D9F A;  5HP1 A;  2XY7 A;  3VA0 A;  4BE2 A;  1XI1 A;  5DK5 A;  3KK1 A;  4MO4 A;  4NLC A;  5CE3 A;  1VSD A;  3GL1 A;  4B9L A;  3WQU A;  3LP2 A;  1KFS A;  4HCC A;  3TAQ A;  1NMN A;  1SKR A;  5FPD A;  2ASO A;  3FGU A;  1GLB G;  1X3M A;  1I3A A;  4FPA A;  4QS7 A;  4EFH A;  2YX6 A;  1IJJ A;  2X74 A;  5K14 A;  2ZM6 K;  1RDB A;  2P51 A;  4DU1 A;  2VWK A;  4PUO A;  3TU5 A;  4DSF A;  1NJW A;  1S1W A;  4BRQ A;  1NKC A;  4F2R A;  2VYP A;  4DS5 A;  3P31 A;  1V4T A;  3VQQ A;  3ZLJ A;  1S9E A;  3OVN A;  4BC5 A;  1GLE G;  3M8R A;  3ZSR A;  3MWP A;  1HRH A;  4JD2 B;  4C8M A;  3AVA A;  4GVM A;  3G71 N;  2HHT A;  4WFA L;  3V9U A;  1FW6 A;  3ATU A;  4PKH A;  3HK2 A;  3ZX2 A;  1HLU A;  3UKR B;  3FZH A;  3ID8 A;  4F3T A;  3DLH A;  1VQ5 N;  2Z1H A;  1D5A A;  1FXX A;  3HI0 A;  2P9U A;  3GOI A;  4OO1 J;  3BZC A;  4IXC A;  3WXK A;  3KK2 A;  2QWP A;  3I0S A;  1VSK A;  2D1K A;  1C1A A;  2P9N B;  4AF1 A;  1HQU A;  2VWJ A;  2WOM A;  1XQS C;  4CD1 A;  3KKS A;  3MWT A;  3PUF A;  4BQZ A;  4KHY A;  4E7K A;  3RVC A;  3DRR A;  4CER A;  2ASM A;  4FVM A;  3OA9 A;  1I94 K;  3OW2 M;  1T05 A;  1D8Y A;  4GY2 B;  4B1Z A;  3S3O A;  5AZI A;  3SQ0 A;  1HYS A;  3RRG A;  3QFP A;  2UXD K;  5BRD A;  2QEX N;  1KXP A;  1RT6 A;  3OYB A;  2AJQ A;  4M45 A;  4KTW A;  3NHG A;  5CYM A;  4GV3 A;  4Z94 A;  1NJY A;  1S22 A;  3P1G A;  2DTU A;  4CF1 A;  1NGI A;  3ULE B;  5AQF A;  3R8E A;  1IG9 A;  4CF8 A;  4GV9 A;  4JRP A;  4CW7 B;  4KHS A;  1IKW A;  3FFK B;  3OHR A;  2OZS A;  5JVH L;  3BEX A;  3CCR N;  3OYL A;  4DR3 K;  1YT3 A;  4BR9 A;  5JEN A;  1T7P A;  4EHU A;  5AQN A;  3OTO K;  3THV A;  1N36 K;  3PX6 A;  1VQ6 N;  4AHT A;  4JK7 A;  1ASV A;  4DQ8 A;  4PWD A;  1DGK N;  1Q18 A;  2D0B A;  3U9Z A;  3B8A X;  4C8L A;  3LP0 A;  3KLI A;  1SAZ A;  3E9P A;  4YFU A;  5M1F A;  4H4M A;  4L3Q A;  3VQD A;  1YTU A;  3ZSZ A;  2OYQ A;  3NVM A;  3SBG A;  3O08 A;  4AIL C;  4Z4C A;  3H08 A;  3THY B;  3NE6 A;  5LJV A;  1BUP A;  2D0P A;  4BC4 A;  1VQ9 N;  3LAN A;  1N34 K;  1BO5 O;  1Q81 O;  1EP4 A;  5EX5 A;  3L4I A;  4YOY A;  4JKB A;  2OTJ N;  4MO5 A;  4O0J A;  4K42 A;  4XIU A;  3TAP A;  5KRS A;  2KQ2 A;  5LY3 A;  3T3F A;  2GTD A;  4GNI A;  2P9P B;  4K25 A;  1TKT A;  2CGL A;  4E1M A;  2DY4 A;  3OYD A;  4E3S A;  1RDD A;  3S5T A;  3E1Y A;  3HL8 A;  3IDH A;  1DTT A;  2QWQ A;  3A5O C;  5KPT A;  3KTQ A;  3D2E B;  2XY6 A;  4DKW A;  4BQL A;  3TTF A;  4DTN A;  4DWI A;  3TAE A;  1TL1 A;  2E20 A;  1Y64 A;  2Q2R A;  3P4I A;  4R79 A;  1VSI A;  3THY A;  1RBT A;  4WFB L;  3I0R A;  3LDQ A;  4N56 A;  4CZJ A;  1ASW A;  2VWB A;  3VMF B;  2HNY A;  1NMD A;  3R3L A;  1WAJ A;  4ISF A;  4CJ3 A;  4Q0B A;  3AVK A;  4DV3 K;  1K8A O;  4ICL A;  3DLG A;  4BGB A;  4FM1 A;  1K9M O;  3QML A;  4ELV A;  4OVL A;  5AQP A;  5LL6 Z;  1LV5 A;  2J4R A;  4CZF A;  2D5R A;  3VQ7 A;  2P9I A;  2GUP A;  1Q82 O;  2ASP A;  4LFB K;  3CPE A;  5BPM A;  4CF0 A;  3C65 A;  3K9J A;  3DMJ A;  3QIN A;  2RF2 A;  4CBW A;  4DF8 A;  2F4V K;  2ZE2 A;  3CYG A;  1R59 O;  5AZJ A;  3MX2 A;  3AA3 A;  1NGA A;  2JWK A;  2GV9 A;  3KIO A;  4KO0 A;  5C25 A;  1ZYQ A;  4C8N A;  2HMI A;  3LWM A;  4X66 K;  1NK7 A;  4FWO A;  4FCY A;  5GIP A;  1ATN A;  3HM9 A;  2HBK A;  3OBY A;  3U4L A;  4CEA A;  4FJH A;  3ZEU A;  3ISN C;  1T8E A;  4IWV A;  2IAJ A;  4CFD A;  4CK1 A;  3PY8 A;  1RTH A;  1KLN A;  2HHH K;  1B9F A;  3ENO A;  1G15 A;  3HSC A;  3DOL A;  2Q3S A;  2IVP A;  4YOR A;  1X9S A;  5C0Y A;  1NU0 A;  4RCH A;  4MLH A;  4Z4G A;  1MDU B;  1EWQ A;  1M90 O;  4DF4 A;  1HNV A;  2NRV A;  2VGM A;  3CIP A;  3QET A;  3QBW A;  4A2A A;  3H3N O;  4RW7 A;  1OH7 A;  1U2V B;  1JKH A;  2X78 A;  3GBT A;  5CZ1 A;  2A6A A;  2UUB K;  2P9P A;  1H1V A;  2OZM A;  1GLF O;  4BE7 B;  4EP4 A;  2IIR A;  5TKW A;  3AA4 A;  5I3U A;  3BUZ B;  3V6D A;  4BRG A;  5KQ8 A;  2BGG A;  1SL1 A;  4NCB A;  3CER A;  4B8A B;  4DSK A;  1C0U A;  2O4I A;  3U6F A;  2XY5 A;  1BCO A;  3L8B A;  1HNX K;  1NK9 A;  3G0Z A;  4ZTJ A;  1Z05 A;  4JK8 A;  1BIS A;  2E2Q A;  4DQP A;  1GLA G;  4DFP A;  4LH5 A;  5M1Q A;  1G99 A;  1BCM A;  1IBK K;  3MN7 A;  3DJC A;  1QQM A;  4O55 A;  3ID6 A;  3MMV A;  2ZD1 A;  3J7Z O;  3BDP A;  4OKJ A;  4FLX A;  3QEP A;  3CM5 A;  3F9K A;  1LOT B;  4RW8 A;  5LMU K;  3VQ4 A;  3IRX A;  4H5V A;  3QLH A;  3TTC A;  3TWH A;  3DAW A;  4JHD B;  5ADX A;  5J1E A;  2YV0 X;  4OX9 K;  2HVI A;  3VEZ A;  1OH5 A;  4NCA A;  2HF4 A;  2B6A A;  4M3X A;  5KI6 A;  4JKH A;  1V4S A;  3HVT A;  4KFB A;  2QK9 A;  3HZ6 A;  4CJP A;  3ZT0 A;  3L2Q A;  3M6G A;  3UKU B;  4K0K K;  3IKM A;  3SUO A;  3MEG A;  3T1H K;  1K8K A;  3CQX A;  3TSQ A;  4I2Q A;  3KHY A;  3E9L A;  1CXQ A;  1RDU A;  4OKK A;  1UAX A;  3P83 D;  2FXU A;  2OCE A;  4B3O A;  2C1I A;  3QEI A;  3L2W A;  1J6Z A;  3GDQ A;  1UWB A;  1Q8I A;  3EZW A;  3C0B A;  1VQ7 N;  3IUC A;  3ZYY X;  4YOV A;  3JSM A;  4H4O A;  4NLB A;  1B92 A;  5E41 A;  4E1N A;  5CHI A;  1A5X A;  1BHL A;  5HRR A;  3RR8 A;  2A1S A;  5H1S Q;  4FXD A;  3QO9 A;  4R5P A;  2NRR A;  1NK4 A;  2QKK A;  4LF7 K;  4BDZ A;  4M3T A;  4BRD A;  3JXU A;  1HKG A;  1RDA A;  3ALY A;  4YY3 K;  4CHQ A;  1RTD A;  1T6D A;  5AQV A;  1QZ6 A;  3AO4 A;  2KFN A;  2PBD A;  3NH2 A;  3V1R A;  1QQC A;  5EOY A;  3D45 A;  3RSE A;  1JJ2 M;  3O8M A;  1NGC A;  4FWM A;  2HHV A;  3I8B A;  3EO3 A;  4DG1 A;  4DV0 K;  2YI1 A;  2E8A A;  3UB5 A;  3CI5 A;  4BR2 A;  3V9W A;  3DLB A;  4FK0 A;  1TK0 A;  4FO0 A;  4PQU A;  2YHB A;  4B3S K;  1UOC A;  4FW1 A;  4KHN A;  3F2K A;  2YNF A;  2X6N A;  4CEE A;  4NCG A;  4KB1 A;  1LAW A;  4YDU A;  3MEE A;  2E2O A;  2IS3 A;  1ASU A;  2YNI A;  4JKG B;  4ISG A;  1D9D A;  1KRP A;  5DMR A;  3VN5 A;  1JLE A;  1N5Y A;  1ZBF A;  4BRK A;  4KBO A;  5M1O A;  4O5F A;  1S72 N;  1OH6 A;  1C1B A;  1NKB A;  3K58 A;  3EE8 A;  2A3Z A;  3NGY A;  3BZK A;  2V51 B;  1BIZ A;  1BIU A;  4LF5 K;  3CC7 N;  1HQE A;  4N76 A;  3MK6 A;  1L3S A;  3ZET B;  4DR6 K;  5AJ3 K;  3C6T A;  3L2V A;  2HOE A;  2G8K A;  5AQW A;  3PSI A;  4FJJ A;  1NGE A;  1OVY A;  3QNN A;  3AV9 A;  3AVC A;  1S5J A;  1J5E K;  3SJJ A;  1HNI A;  3SPZ A;  1WBB A;  2O8C A;  1NOY A;  2ZGZ A;  3U9D A;  4LF6 K;  3O6W A;  4E7I A;  3AY9 A;  3BP8 A;  4MFB A;  2QWR A;  3EKS A;  2P9K B;  2HF3 A;  2FSK A;  3NMU A;  3TAF A;  3HXM A;  4OPH A;  1JLB A;  3CJ7 A;  1VRU A;  3ZSQ A;  1HNW K;  5AR0 A;  4CES A;  2P1J A;  4EAH D;  3LZJ A;  4HVJ A;  4M3Y A;  4JRQ A;  4JYA K;  3U8X A;  3C6H A;  1KCF A;  1XC3 A;  4LF9 K;  1WSJ A;  4KI6 A;  3AVI A;  1ESV A;  4DTS A;  1XHZ A;  4GKK K;  1IO2 A;  1YAG A;  1P90 A;  2YHX A;  4QS8 A;  2E6L A;  2JWL A;  3VQ9 A;  3DLE A;  1NWK A;  3U3G A;  2P9L B;  3VEW A;  3LDS A;  4HUE A;  2OPR A;  1UA0 A;  3U3Y A;  4FSV A;  4MLE A;  4CFA A;  1XNQ K;  4BDP A;  4JI5 K;  3HYF A;  1LWE A;  3ULE A;  3B6P A;  2YHY A;  3EEQ A;  4IDK A;  2ZJP L;  3AO2 A;  3EY1 A;  4CJK A;  1TK8 A;  1ZXO A;  3C7N A;  3KK7 A;  2O8E B;  4CJR A;  1K73 O;  3TR8 A;  2FC0 A;  1JXB A;  3AAP A;  1JLC A;  4CHN A;  4H0V B;  1C1C A;  3QEV A;  4QOZ B;  2W6K A;  2FSJ A;  4CIG A;  3HTV A;  1CZ9 A;  3PIP L;  1VQ8 N;  1Z26 A;  2A42 A;  1NK8 A;  3WNG A;  2F96 A;  3B6O A;  1NM1 A;  4E19 A;  1WSE A;  2JGU A;  4H0O A;  3OS0 A;  4AQY K;  4JN4 A;  3ZSY A;  4B9T A;  2KZZ A;  1WUA A;  3KK3 A;  2R7Y A;  5F2R A;  4KRE A;  3THW A;  2Y1I A;  2E1Z A;  4BWJ A;  4JI6 K;  2A41 A;  2HHQ A;  3O5B A;  4JEP A;  3CFO A;  2QWN A;  2ITG A;  3NVK A;  3EZ5 A;  4BC2 A;  3TAG A;  1RT4 A;  2D4W A;  3NF8 A;  4ISE A;  4OPK A;  3CCV N;  3WEE B;  1U04 A;  1W97 L;  2P9I B;  2E2P A;  3L0Q A;  4LF8 K;  2WON A;  4DR7 K;  2FF6 A;  3CJ9 A;  1RT2 A;  3LM9 A;  3BY5 A;  2PAV A;  3OYC A;  4BY9 C;  4KH6 A;  3C6U A;  1WOQ A;  4E72 A;  4M3R A;  2IVN A;  3R1X A;  1GOA A;  2Q1N A;  4J8F A;  1L3U A;  4W5N A;  4MQ3 A;  3SAH A;  2VG7 A;  1ITG A;  2QWL A;  4ZTF A;  1YJW N;  3MEC A;  2HMP A;  1YF5 L;  3THW B;  3DXM A;  1S6Q A;  3FFI A;  4LFC K;  1XWL A;  4RTF D;  3ZT2 A;  5B8H A;  3MCA B;  1N33 K;  4BRI A;  3IMX A;  4BRF A;  3SMP A;  3ATV A;  4DS4 A;  4YOX A;  3MXI A;  4DQS A;  3C6A A;  4H8K A;  4M7X A;  3SCX A;  1CZB A;  3WNE A;  4Z0U A;  4JKC A;  1LW0 A;  1SUQ A;  3IG1 A;  4MDB A;  4DMN A;  4E89 A;  4FW2 A;  5HOO A;  3OY9 A;  5C2F A;  4H5N A;  2EHG A;  1BQN A;  3VQE A;  2O8F B;  3IAY A;  2PZS A;  4KHW A;  1ZC6 A;  4BRP A;  4DV5 K;  2HVH A;  4WF9 L;  3AO1 A;  2AA4 A;  3AVM A;  3NF7 A;  4FK4 A;  1EWR A;  1IH7 A;  1Q86 O;  2O8B B;  3SAG A;  5J2M A;  1HNZ K;  1XUP O;  3EE9 A;  1Y97 A;  1S1T A;  3O80 A;  2HHU A;  1QSY A;  4DSI A;  3LAK A;  3QDK A;  3H1Q A;  1GLD G;  4E7J A;  4CZG A;  4LF4 K;  1TVR A;  4H5R A;  5LJW A;  2KW4 A;  2QXF A;  2GX9 A;  3CET A;  4BRC A;  2HND A;  2VQE K;  1TUY A;  3ZT1 A;  4KTQ A;  2QTD A;  2RPI A;  4DTU A;  1EQY A;  4B9Q A;  4FJG A;  3DOK A;  1YVU A;  2E4L A;  4IOX A;  1N6Q A;  2ETJ A;  4WFN L;  3GE1 A;  1X9M A;  4RG8 A;  3O4W A;  5AQJ A;  3WNH A;  3UE5 A;  1C0G A;  2QI2 A;  2IC3 A;  1BG3 A;  4JS5 A;  4PHT X;  4CHZ A;  5T7B A;  4IJN A;  4DLE A;  3MX5 A;  4A5B A;  1LWC A;  2OPQ A;  3SBT A;  2Q0U A;  4CJU A;  3MXJ A;  4DQR A;  1VQM N;  2Q97 A;  1TGO A;  3LWL A;  1QHT A;  1J5O A;  4BWM A;  4B1X B;  4UY8 O;  2DFE A;  4H03 B;  3I55 N;  4FWN A;  3D7E O;  4DTM A;  3KKR A;  3CCM N;  1J9A A;  3HO1 A;  2VG6 A;  3TSP A;  3OYE A;  1I39 A;  5FRN A;  1IKV A;  3N4Q A;  4KH4 A;  4WQ5 C;  4H0T B;  3ULD A;  4FPB A;  4C8K A;  1DKG D;  2NLX A;  4GW6 A;  2UUA K;  3G6E N;  4BRN A;  1HX1 A;  5AQU A;  1NG9 A;  2RE2 A;  3L4Q A;  3CXC M;  4BEB A;  3G10 A;  4PKI A;  5CR4 A;  5EVZ A;  3K59 A;  1S9G A;  4AHV A;  3ZSO A;  1SL2 A;  1VSF A;  4BRE A;  4CVN E;  2F8S A;  1M1K O;  4BAC A;  4KPY A;  1JCF A;  3LL3 A;  4U7B A;  2O8B A;  5HRP A;  2FSN A;  3QER A;  4XH4 A;  3SV3 A;  4CEZ A;  1X9W A;  2OA8 A;  3BF1 A;  3HBT A;  1RBR A;  1BOT O;  1Q9X A;  4JKD A;  3E01 A;  1FJG K;  5DM7 L;  4PA1 A;  2Q31 A;  1WBD A;  1A5V A;  2A1R A;  3CM6 A;  4XEI A;  4KHP K;  1TYQ A;  5KQD A;  5AQM A;  4CJS A;  4V19 S;  3P5J A;  4AM7 A;  2QXL A;  4B9M A;  4FZY A;  1VQN N;  4BR0 A;  3CJC A;  4OKE A;  4H0Y B;  3K2P A;  3QB0 A;  3JAM O;  3V9S A;  1NK0 A;  3V9Z A;  4W5R A;  1GLJ O;  4HCB A;  4F2S A;  3VTI A;  1JL1 A;  4W5Q A;  1NLV A;  4IJA A;  3F9M A;  4CEQ A;  5IT9 O;  4I2P A;  4O8K A;  4CEF A;  1QE1 A;  5GAG P;  4IEI A;  4C23 A;  1C6V A;  3M8S A;  4CJT A;  3PO5 A;  5J2Q A;  2QWM A;  2ZGY A;  3DI6 A;  4CJQ A;  3OYJ A;  2QKB A;  3QBX A;  4ID1 A;  4FM0 A;  4J2E A;  5GIN A;  1KTQ A;  1RFQ A;  4JKA A;  4Z4F A;  4ELT A;  1WSF A;  3J7Y P;  1NGG A;  1CLQ A;  4I6M B;  3O9T A;  2W41 A;  4A62 A;  3RR7 A;  1FKO A;  2KHO A;  3JS6 A;  4GV6 A;  3I33 A;  4CHY A;  2YKM A;  3MN5 A;  1BA0 A;  2YJF A;  3J81 O;  4A2B A;  4CJ5 A;  2AP1 A;  1VK0 A;  3J7A P;  2PY5 A;  3QEW A;  1KLM A;  1RT1 A;  3H46 O;  2VCP A;  4DB3 A;  2YKN A;  2FF3 B;  2HHW A;  1S6P A;  1RBU A;  3K5N A;  2BUP A;  2FBX A;  1NOZ A;  3LDL A;  1EET A;  1X3N A;  1IKY A;  3KVG A;  3BGR A;  3PSF A;  1ZBH A;  4HHT A;  5FRO A;  2ZJR L;  2VQF K;  4OPJ A;  4L8R B;  1T6C A;  4F4K A;  3A0I X;  5GIO A;  5SZT A;  2F9T A;  4BE0 A;  3VOV A;  3KWG A;  5HRN A;  1QSS A;  4F8R A;  3IFR A;  1RDW X;  3HPH A;  2P5G A;  2G8F A;  5C15 A;  4FWL A;  4DTO A;  4BVO A;  4N41 A;  1BQM A;  3A5L C;  4PL8 A;  3ZX3 A;  2V7Z A;  4JI1 K;  4CE9 A;  4YNQ A;  1MWK A;  4CD3 A;  4CIE A;  4O5B A;  4DR2 K;  3THX A;  1OH8 A;  5M1P A;  4JK9 A;  1WSH A;  2G8U A;  4DR4 K;  3OJS A;  3O1W A;  4DU4 A;  5KRT A;  4DHY A;  1K6Y A;  3BF3 A;  3ZSW A;  2UXB K;  4OJR A;  3CJB A;  3WT0 A;  3AAQ A;  3LP1 A;  1HPZ A;  5KGW A;  4DSE A;  5EU7 A;  4FWQ A;  5AZI B;  2IOC A;  2HHS A;  4CIF A;  1VSH A;  1SKW A;  1K8K B;  2RHK A;  3D6R A;  2VG5 A;  3RMB A;  3CC4 N;  5FRM A;  4C1N I;  1VAZ A;  4B3M K;  4YHH K;  4CBX A;  2OPS A;  3VET A;  4FL9 A;  3OS1 A;  1NNE A;  4NO7 A;  4C8O A;  4CJL A;  1HKB A;  2GEL A;  3EKU A;  5J2P A;  4GKJ K;  4OGC A;  2ZJQ L;  1KVC A;  1WSI A;  2Z1J A;  1TK5 A;  4M42 A;  3DYA A;  4BR5 A;  4B8C A;  3HP9 A;  4GMJ B;  2HBL A;  4HUG A;  1R0A A;  1JCG A;  4CFB A;  3C95 A;  1MU2 A;  4E7L A;  3RSE B;  3W0L A;  2LSN A;  2QWO A;  3L3V A;  2HST A;  4Z4H A;  1HMV A;  4JI8 K;  1YUW A;  4WQ4 A;  4FYD A;  1IKX A;  4XH5 A;  1S1X A;  3KD5 E;  4I9L A;  1JLG A;  1BI4 A;  4OLA A;  3DLL L;  4NB4 A;  3AVJ A;  5AQY A;  2XY8 A;  1KAY A;  3FLC O;  5HLF A;  3HPG A;  4ZHR A;  3LAM A;  1CZA N;  2YJE A;  2BAN A;  3M8Q A;  5KTQ A;  2BH1 A;  3KJV A;  4DQI A;  1RDC A;  2FBV A;  3DLR A;  3VGL A;  4CED A;  2V7Y A;  1W0H A;  5KPZ A;  2F7T A;  4DFK A;  5C42 A;  1VQK N;  1KVB A;  1JLA A;  3AO3 A;  4AHS A;  4KRF A;  2PYJ A;  1VQO N;  5AQI A;  1RT3 A;  3QFU A;  4MDA A;  1L3V A;  2GUI A;  1FKP A;  1IV0 A;  5HRO A;  2BTF A;  3HT3 A;  4BE1 A;  3IS9 A;  4M3U A;  1X1P A;  2HB5 A;  3SMS A;  4FJK A;  3D2F A;  1U6Z A;  4AHU A;  3CFR A;  4FLU A;  4CJ4 A;  1J53 A;  4CCH A;  4Q5V A;  2V52 B;  4ILJ A;  2YNH A;  4W5T A;  4B1Y B;  3HJF A;  2P9L A;  3VGK A;  2CGK A;  3O9S A;  4KI4 A;  3OYG A;  2JLE A;  2DFH A;  1RBS A;  1RIL A;  1YIJ N;  2WBN A;  1XC9 A;  2WFB A;  4FJ7 A;  5BR9 A;  1HR0 K;  4BDY A;  3AVG A;  3DRP A;  5E26 A;  1YTA A;  1TAU A;  5JIC A;  3TAN A;  1TKX A;  4CJW A;  5C10 A;  4LD0 A;  1NJZ A;  1B9D A;  3SPY A;  4M63 C;  3EYZ A;  1Q9Y A;  3C7N B;  3MED A;  3SQ4 A;  1C0M A;  4CI6 A;  3L3U A;  3LPT A;  5CZ2 A;  3PO4 A;  2DFF A;  4W5O A;  4FJL A;  3KLE A;  4IZ9 A;  3SK3 A;  1LW2 A;  2BDP A;  5IWA K;  4CGI A;  2WC9 A;  2XHB A;  1NK6 A;  3NAE A;  3PLA A;  3NGZ A;  2HNZ A;  2QM1 A;  3M3Z A;  4F9O A;  5EY4 A;  3WNF A;  3OYI A;  1Z25 A;  1F21 A;  2OTL N;  4IOA L;  3VGM A;  1KC8 O;  4DUY K;  3S3M A;  3UKR A;  1QSL A;  2PYL A;  2D0O A;  2FBT A;  4FWR A;  3M8P A;  3CCE N;  4YOT A;  3S9H A;  1QVG M;  1VSJ A;  4DV6 K;  3L6Q A;  2P9N A;  1VSL A;  3CQ8 A;  4CGD A;  4HUF A;  3OYN A;  4NYN A;  2A40 A;  2RKI A;  4E1J A;  4PL7 A;  4DUZ K;  4IG3 A;  3KWI A;  4KAZ A;  4M3Z A;  1YIT N;  3WQT A;  3T7Z A;  2IGI A;  5BRF A;  3SUP A;  3F5T A;  3RTV A;  1RNH A;  5AQR A;  5AFU A;  4DLG A;  3T1A A;  3RMC A;  2YCH A;  1QS4 A;  4EHT A;  2D0C A;  1WLJ A;  4DTJ A;  4B1W B;  2C1G A;  3AVL A;  2G8W A;  4FLT A;  5AZJ B;  1JL2 A;  2IVO A;  3K5M A;  1QZ5 A;  3FZF A;  3LDN A;  4IBN A;  2ITM A;  4DV1 K;  4G9Z A;  2F8T A;  3Q7B A;  3LZI A;  3H1V X;  1ZBS A;  2WTU A;  4IO9 L;  2ZF5 O;  3VQ5 A;  3J8A A;  3OYH A;  3LDO A;  1RTI A;  4AHC A;  4AH9 A;  1S1U A;  4ILG B;  1WB9 A;  1LCU A;  3VES A;  2O8C B;  1W9H A;  2FLO A;  1MA9 B;  3WXJ A;  4O4G A;  4K8Z A;  4WE1 A;  5KPR A;  1C0T A;  3CJA A;  4WCE L;  1WN7 A;  3NF6 A;  3O3H A;  4FLW A;  1ATS A;  3HP6 A;  3WEE A;  3R6M A;  1IBL K;  4FM2 A;  3F73 A;  3ZX0 A;  3HPO A;  3CPW M;  3VEY A;  4M7Y A;  3VPZ A;  4RW4 A;  4IFV A;  2B5J A;  2G8V A;  3NH0 A;  2FBY A;  3T69 A;  5D3G A;  1BGX T;  4CJF A;  1BI4 B;  1EX4 A;  4KH5 A;  1RGI A;  1JLQ A;  3AA2 A;  1MWM A;  2P9S A;  1SKS A;  4HWI A;  2CH5 A;  3ENB A;  2B4J A;  4B9N A;  4JV5 K;  3LP3 A;  3FR0 A;  4NXM K;  3PIO L;  3SV4 A;  3QNO A;  1GLL O;  2XO7 A;  4JKF A;  4DR5 K;  3CYM A;  2G8H A;  2HW3 A;  2D0A A;  5BN9 A;  1TYQ B;  4O8U A;  5EXW A;  2H3G X;  4DV4 K;  1X9J A;  1NGD A;  1T03 A;  3CD6 N;  1U2V A;  1O1W A;  2RN2 A;  3MN9 A;  3OYA A;  2CH6 A;  3VF2 A;  4JI4 K;  5C12 A;  3PV8 A;  4FJ5 A;  5SWM A;  4CZM A;  3SZ2 A;  4DR1 K;  3TI0 A;  4CJE A;  2ZQB A;  4YDU C;  4KV8 A;  1QHA A;  1NGJ A;  1VSE A;  3H45 C;  4JS4 A;  4FVU A;  1REV A;  3ASM A;  3O9R A;  4FOI A;  2P9S B;  3OS2 A;  3QIC A;  4EZ9 A;  4AHR A;  3V9X A;  4LSL A;  3LM2 A;  2CGJ A;  2EWS A;  4RW6 A;  2Z1I A;  1SV5 A;  2W40 A;  4OGE A;  4CGH A;  4JKG A;  3QEX A;  3VQ6 A;  3KLF A;  1S3X A;  2BE2 A;  3TSU A;  5JLH A;  4DFM A;  1YHQ N;  2KZM A;  4DTP A;  5JVG L;  4B1U B;  3E9O A;  4O44 A;  4A57 A;  1U48 A;  1YJN N;  2XRI A;  4HTU A;  2Y1J A;  4LFA K;  3NBP A;  3P38 A;  3FE1 A;  4B3T K;  3V1O A;  4I7F A;  3M5R A;  3VER A;  4ELU A;  1FK9 A;  1DLO A;  4BG9 A;  2HBJ A;  4DTX A;  3V1Q A;  2NRT A;  2W00 A;  4JNE A;  2O8D A;  4OLB A;  4NYF A;  1IG8 A;  2PFU A;  3TTD A;  3DWL A;  4H0X B;  3TAR A;  3CME N;  5FLX O;  3RMD A;  3RRH A;  2IDO A;  3CCJ N;  4BR7 A;  1VRT A;  4H0P A;  1Z6R A;  3VQC A;  1DTQ A;  3WUH A;  5ELZ A;  3AA5 X;  1DT9 A;  4BEC A;  4FLY A;  3O9U A;  3CCQ N;  5AQL A;  3VQP A;  1HJR A;  4J2B A;  4JI0 K;  1BL3 A;  2UYT A;  3AGR A;  5AQT A;  3I8D A;  1EKE A;  2KKZ A;  4KTZ A;  2HHI A;  2P5O A;  5FPN A;  2YNG A;  4F3O A;  2GBZ A;  3FZK A;  3W3D A;  3S41 A;  3FZL A;  2Q36 A;  3SI6 A;  4KKO A;  4NXN K;  3ZSV A;  1XMO K;  3ZCM A;  4B1V A;  3ZSX A;  1HYZ A;  3QIP A;  5F0X A;  5AQQ A;  4BRA A;  3AVF A;  4FWS A;  1W2B M;  4J2D A;  1L3T A;  5M1N A;  4FJ8 A;  3O3G A;  4CHP A;  3N4P A;  3CG7 A;  5DM6 L;  4CGF A;  2DPN A;  3WXI A;  1ZBL A;  3SNN A;  3L2R A;  1QQN A;  4XH1 A;  1TV6 A;  3T1Y K;  1EO1 A;  3HM8 A;  4B3R K;  1VQ4 N;  4FK2 A;  4Z4I A;  1TUU A;  4DCH A;  1SL0 A;  3NF9 A;  4Y1C A;  1SZ2 A;  2P9U B;  4H5W A;  3SQ1 A;  1BWF O;  1J54 A;  2HBM A;  3ZT4 A;  1RCH A;  2GWK A;  1ILY A;  5F1X A;  3NH1 A;  3CCS N;  2Z1G A;  3ITH A;  4IKF A;  3A8Y A;  3UIQ A;  1KAZ A;  1S1V A;  1EXQ A;  2ZWH A;  4CGG A;  1RT5 A;  3O3F A;  4CJ7 A;  4IFY A;  5BR8 K;  4CZL A;  3LDP A;  4PY5 A;  1KVA A;  5HL7 L;  1Q7Y O;  5AQK A;  5AFU H;  3L2U A;  1U45 A;  3HOS A;  2NNW A;  3ZET A;  3Q7C A;  4FLV A;  1QVF M;  3MAQ A;  3CCL N;  5BN8 A;  1VSM A;  3NFA A;  3OBW A;  4YOU A;  4UQG A;  2F9W A;  3A5M C;  3CCU N;  3H6E A;  4A59 A;  1TAQ A;  1HUX A;  4ID5 A;  3ZT3 A;  4CEO A;  1NGF A;  5FDL A;  2I5J A;  1KQS M;  1N8R O;  4AM6 A;  4CF9 A;  3EN9 A;  3GG4 A;  3O9Q A;  1WAF A;  1XHX A;  2W42 A;  4CZE A;  3J80 O;  5BRE A;  4CFC A;  1E4F T;  1YVN A;  2KLA A;  4A61 A;  2UXC K;  1RBV A;  4Z4E A;  4EIA A;  5JMV A;  1LAV A;  3KZB A;  3CHW A;  3VEO A;  1JCE A;  2W6L A;  4BR4 A;  3QIO A;  5GAD P;  1GOB A;  5A2Q O;  3VEX A;  1WNS A;  5AQZ A;  2NRX A;  4J2A A;  5ADX H;  3RMA A;  4QS9 A;  5I42 A;  3G25 A;  4IG0 A;  3HRG A;  3FZM A;  1P8Z A;  4JI7 K;  4FWP A;  3I56 N;  3TAM A;  3UKU A;  3VA3 A;  5BRH A;  1KFD A;  4M41 A;  1NKE A;  3A2F A;  4DFJ A;  4RWT A;  3DXK B;  1YXQ A;  3QES A;  4E7H A;  4DSJ A;  2NUB A;  1NJX A;  1TKD A;  3LAL A;  2G8I A;  3SQ2 A;  4FJN A;  4EZ6 A;  4JLH A;  4CZK A;  5HRS A;  3HVR A;  4DU3 A;  4JKE A;  2GEM A;  4CZH A;  2OPP A;  5C2D A;  1SS6 A;  2OAN A;  4CZI A;  3AVH A;  3KLG A;  4IEE A;  4I6M A;  5KGX A;  3DLK A;  4LY7 A;  3V81 A;  3C94 A;  3G4S N;  2E1Y A;  4CBU A;  2WUS A;  4B9V A;  1HYV A;  2NRZ A;  3D0P A;  1QTM A;  4XJX A;  3RWU A;  1LWF A;  4CHO A;  1VHX A;  5BPN A;  2Q0R A;  3MN6 A;  4GVE A;  4FLZ A;  2E6M A;  1TL3 A;  3KD1 E;  1ZBU A;  3VQ8 A;  3MXM A;  3SLC A;  5TKY A;  1IBM K;  1ATR A;  2A5X A;  2YHW A;  4CEC A;  1A5W A;  1W7A A;  4CK2 A;  1RT7 A;  2GWJ A;  4IO8 A;  2O8D B;  1WSG A;  1JXE A;  1KD1 O;  3O4Q A;  1L5U A;  2UUC K;  1U47 A;  3DXK A;  4X65 K;  1T3V A;  1JLF A;  3O4N A;  4YOW A;  4JD2 A;  1HPM A;  3DRS A;  1BA1 A;  3T19 A;  3R9P A;  4OPA A;  4A5A A;  1NGB A;  4ILH A;  3OJU A;  4DTR A;  2NRH A;  4DV7 K;  1UA1 A;  2O4G A;  1GLC G;  4FZZ A;  3CFP A;  4Y0W A;  4BRH A;  4M3W A;  4IFE A;  2HHX A;  3H3O B;  4EP5 A;  1SQK A;  3CQY A;  5GAH P;  1RTJ A;  1KSP A;  4JI3 K;  4DSL A;  3AGK A;  3O1B A;  3AVB A;  3SJH A;  3NDK A;  1YI2 N;  4X64 K;  1N32 K;  4TSX A;  3NCI A;  3SYZ A;  3VF4 A;  4QCL A;  3DM2 A;  2E2N A;  3EL2 A;  4JAX A;  1NJI O;  4H5T A;  4BRM A;  3OYF A;  3A5N C;  1KAX A;  3K5L A;  4CGJ A;  2O8E A;  5AQG A;  3TPQ A;  4FJM A;  4B9S A;  4BC3 A;  1VQP N;  2EX3 A;  3AAR A;  5FPM A;  1OVQ A;  4B9U A;  2NRW A;  5HBM A;  1DEJ A;  4BGA A;  5AQS A; 
#chains in the Genus database with same CATH homology
 5KQ8 A;  3SBT A;  4WQ5 A;  5AQO A;  2Q0U A;  5AZJ B;  4BG8 A;  3VEV A;  2IVO A;  3CMA N;  1QZ5 A;  3FZF A;  3LDN A;  1VQM N;  3CER A;  3ENH A;  1NBW A;  2ITM A;  4G9Z A;  2Q97 A;  1E4G T;  2E88 A;  3Q7B A;  3HOT A;  1OKJ A;  4B1X B;  3H1V X;  4UY8 O;  3ZEU B;  5GAE P;  1ZBS A;  4H03 B;  4IO9 L;  2NZT A;  2ZF5 O;  3J8A A;  3I55 N;  3LDO A;  4U67 L;  2I7P A;  1Z05 A;  4JK8 A;  4FWN A;  3D7E O;  4ILG B;  3WXM B;  2E2Q A;  3CCM N;  1GLA G;  1LCU A;  3VES A;  4HTL A;  4K41 A;  2FLO A;  5M1Q A;  1G99 A;  1MA9 B;  3TSP A;  3WXJ A;  3N4Q A;  4KH4 A;  2P9K A;  3DJC A;  3MN7 A;  3M1F A;  5KPR A;  1QQM A;  4WQ5 C;  3CJA A;  4H0T B;  4WCE L;  3ID6 A;  4FPB A;  3MMV A;  4WQ4 C;  1NGH A;  3J7Z O;  1DKG D;  2NLX A;  3G6E N;  1ATS A;  4BRN A;  1HX1 A;  5AQU A;  2RE2 A;  1LOT B;  1QQO A;  1BDG A;  3L4Q A;  3WEE A;  3CXC M;  4BEB A;  4H5V A;  3TTC A;  3DAW A;  1BU6 O;  3R6M A;  4JHD B;  4FWK A;  5ADX A;  4PKI A;  1YJ9 N;  3ZX0 A;  1VQL N;  5CR4 A;  3VEZ A;  5EVZ A;  3CPW M;  3VEY A;  4M7Y A;  3VPZ A;  2HF4 A;  3VTH A;  3D2E A;  4JKH A;  3T69 A;  1V4S A;  4FOE A;  4BRE A;  3HZ6 A;  3M6G A;  3D2F B;  3UKU B;  3IKM A;  1M1K O;  1K8K A;  1JCF A;  3CQX A;  3LL3 A;  3TSQ A;  3KHY A;  1O13 A;  4KH5 A;  1RGI A;  3E9L A;  3MDQ A;  4U7B A;  1RDU A;  1MWM A;  2FSN A;  2P9S A;  3CJ1 A;  5JLF A;  4HWI A;  4XH4 A;  2FXU A;  5AQH A;  3ZX2 A;  2CH5 A;  3BF1 A;  3HBT A;  2C1I A;  1BOT O;  2QA4 N;  3ENB A;  4JKD A;  1J6Z A;  4BVP A;  3GDQ A;  5DM7 L;  2I7N A;  2Q31 A;  3FR0 A;  3EZW A;  3C0B A;  3PIO L;  1VQ7 N;  3IUC A;  4C1N K;  3ZYY X;  5BPL A;  4YOV A;  1GLL O;  4JKF A;  4XEI A;  3CF5 L;  4BRO A;  4NLB A;  1TYQ A;  5KQD A;  5AQM A;  2VGN A;  5E84 A;  3P39 A;  5BN9 A;  5CHI A;  1TYQ B;  4O8U A;  5EXW A;  1C0F A;  2H3G X;  4AM7 A;  1X9J A;  2QXL A;  1NGD A;  5H1S Q;  3CD6 N;  4LC9 B;  1U2V A;  1VQN N;  1HKC A;  4BR0 A;  3CJC A;  3MN9 A;  2NRR A;  4H0Y B;  3QB0 A;  2CH6 A;  5M1K A;  3VF2 A;  5FPE A;  4BRD A;  5C12 A;  3JXU A;  1HKG A;  4JHD A;  1T6D A;  5AQV A;  1D4X A;  1QZ6 A;  4CZM A;  3MCP A;  2PBD A;  1GLJ O;  5EOY A;  4BGA A;  3RSE A;  1JJ2 M;  3O8M A;  4YDU C;  1T44 A;  3VTI A;  1QHA A;  1NGC A;  4FWM A;  3I8B A;  1NGJ A;  3EO3 A;  1NLV A;  4IJA A;  3F9M A;  2YI1 A;  2E8A A;  2QW9 A;  3H45 C;  4O8K A;  3UB5 A;  3CI5 A;  3VF6 A;  3K9K A;  4BR2 A;  5GAG P;  1HJO A;  4IEI A;  4C23 A;  5I9E B;  3O9R A;  4FOI A;  2QWM A;  2ZGY A;  4K43 A;  4FO0 A;  2P9S B;  3QIC A;  4IDH A;  5AQX A;  5MLC Q;  3CC2 N;  4WYB A;  3LM2 A;  3QBX A;  4PKG A;  2CGJ A;  2EWS A;  3F2K A;  5GIN A;  1RFQ A;  4JKA A;  2W40 A;  4YDU A;  3WXL A;  3SAF A;  3DXM B;  4JKG A;  2E2O A;  1NGG A;  4JKG B;  4I6M B;  4BRL A;  4ISG A;  1S3X A;  3O9T A;  3TSU A;  3E66 A;  3VEN A;  5JLH A;  4IOC L;  2W41 A;  1YHQ N;  4A62 A;  2KHO A;  3JS6 A;  5JVG L;  3I33 A;  4GV6 A;  4B1U B;  3E9O A;  3MN5 A;  1BA0 A;  2YJF A;  4KBO A;  5M1O A;  4A57 A;  4A2B A;  4BRK A;  4O5F A;  2AP1 A;  4MO4 A;  4NLC A;  5CE3 A;  3GL1 A;  1S72 N;  3WQU A;  1YJN N;  3H46 O;  3EE8 A;  2A3Z A;  3P38 A;  2VCP A;  4DB3 A;  5FPD A;  2ASO A;  3FE1 A;  3FGU A;  1GLB G;  1X3M A;  4FPA A;  4QS7 A;  2V51 B;  3M5R A;  3VER A;  2YX6 A;  4EFH A;  4FVU A;  2FF3 B;  1IJJ A;  3CC7 N;  4BG9 A;  2BUP A;  3LDL A;  3TU5 A;  2HBJ A;  1X3N A;  4BRQ A;  3KVG A;  2NRT A;  2W00 A;  4JNE A;  3MK6 A;  2VYP A;  3P31 A;  1V4T A;  1IG8 A;  3ZET B;  2PFU A;  3TTD A;  4BC5 A;  1GLE G;  3DWL A;  3MWP A;  4H0X B;  4JD2 B;  2ZJR L;  3CME N;  3G71 N;  3CCJ N;  2HOE A;  4BR7 A;  4WFA L;  1T6C A;  3A0I X;  5GIO A;  3ATU A;  4PKH A;  4H0P A;  1Z6R A;  1HLU A;  2F9T A;  5AQW A;  3KWG A;  3FZH A;  3ID8 A;  3UKR B;  1NGE A;  1OVY A;  3VOV A;  3WUH A;  5ELZ A;  1VQ5 N;  1DT9 A;  4BEC A;  3IFR A;  3HI0 A;  3O9U A;  3CCQ N;  1RDW X;  2P9U A;  2ZGZ A;  3U9D A;  3GOI A;  3O6W A;  4OO1 J;  5C15 A;  4IXC A;  5AQL A;  4FWL A;  3WXK A;  3AY9 A;  2QWP A;  3BP8 A;  2D1K A;  2UYT A;  4BVO A;  3AGR A;  5AQT A;  3A5L C;  4PL8 A;  2KKZ A;  2QWR A;  3ZX3 A;  2V7Z A;  3EKS A;  2P9N B;  2P9K B;  2HF3 A;  4AF1 A;  2FSK A;  5FPN A;  3NMU A;  1MWK A;  4OPH A;  4CD3 A;  1XQS C;  3CJ7 A;  4CD1 A;  5M1P A;  3FZK A;  3W3D A;  3S41 A;  3FZL A;  2Q36 A;  3MWT A;  5AR0 A;  4BQZ A;  4JK9 A;  3O1W A;  3RVC A;  4EAH D;  2ASM A;  4B1V A;  4DHY A;  5F0X A;  3BF3 A;  3OA9 A;  5AQQ A;  3CJB A;  3U8X A;  4BRA A;  3C6H A;  1XC3 A;  3OW2 M;  3WT0 A;  3AAQ A;  4FWS A;  4GY2 B;  4B1Z A;  1ESV A;  5AZI A;  1W2B M;  4FWQ A;  5AZI B;  3QFP A;  5M1N A;  1YAG A;  1P90 A;  3N4P A;  2YHX A;  4QS8 A;  5BRD A;  1KXP A;  2QEX N;  2JWL A;  5DM6 L;  1K8K B;  2RHK A;  3D6R A;  1NWK A;  2DPN A;  2P9L B;  3WXI A;  3CC4 N;  3VEW A;  1QQN A;  4XH1 A;  4C1N I;  4GV3 A;  1EO1 A;  4Z94 A;  1VAZ A;  3HM8 A;  1VQ4 N;  1TUU A;  4DCH A;  4CBX A;  1S22 A;  4FSV A;  3VET A;  4MLE A;  1NGI A;  4FL9 A;  3ULE B;  5AQF A;  3R8E A;  1SZ2 A;  2P9U B;  4NO7 A;  3ULE A;  4H5W A;  1BWF O;  2HBM A;  4GV9 A;  1ILY A;  2GWK A;  5F1X A;  3CCS N;  1HKB A;  2GEL A;  2YHY A;  3FFK B;  3OHR A;  3EKU A;  5JVH L;  3BEX A;  2ZJP L;  2ZJQ L;  3CCR N;  3A8Y A;  4BR9 A;  1KAZ A;  2ZWH A;  1ZXO A;  4EHU A;  5AQN A;  4BR5 A;  3C7N A;  4CJ7 A;  3KK7 A;  4CZL A;  3LDP A;  1K73 O;  1VQ6 N;  2HBL A;  1JCG A;  5HL7 L;  4JK7 A;  5AQK A;  5AFU H;  1Q7Y O;  4DQ8 A;  1DGK N;  1Q18 A;  3AAP A;  3U9Z A;  3HOS A;  3B8A X;  2NNW A;  4H0V B;  3RSE B;  3W0L A;  2FSJ A;  2QWO A;  3ZET A;  3Q7C A;  2HST A;  1SAZ A;  3E9P A;  3HTV A;  1QVF M;  1YUW A;  4WQ4 A;  3CCL N;  4XH5 A;  5BN8 A;  3PIP L;  5M1F A;  4L3Q A;  1VQ8 N;  2A42 A;  3OBW A;  4YOU A;  2F9W A;  3A5M C;  3CCU N;  3H6E A;  4A59 A;  3DLL L;  3NVM A;  3SBG A;  1NM1 A;  3O08 A;  4NB4 A;  5AQY A;  1HUX A;  1KAY A;  3FLC O;  1NGF A;  4H0O A;  5LJV A;  1KQS M;  4JN4 A;  1BUP A;  2D0P A;  4BC4 A;  1N8R O;  4AM6 A;  1WUA A;  1VQ9 N;  1CZA N;  3EN9 A;  3GG4 A;  3O9Q A;  2YJE A;  5F2R A;  4CZE A;  5BRE A;  1E4F T;  1BO5 O;  2E1Z A;  1YVN A;  2A41 A;  2BH1 A;  2KLA A;  3O5B A;  1Q81 O;  4JEP A;  4A61 A;  5EX5 A;  3L4I A;  3VGL A;  2V7Y A;  4YOY A;  2QWN A;  4JKB A;  4EIA A;  5JMV A;  2OTJ N;  3KZB A;  2F7T A;  4MO5 A;  5KPZ A;  3CHW A;  4K42 A;  3VEO A;  3NVK A;  1JCE A;  1VQK N;  4BC2 A;  2D4W A;  4ISE A;  4BR4 A;  5LY3 A;  3CCV N;  5GAD P;  3WEE B;  3VEX A;  1VQO N;  5AQI A;  2GTD A;  2NRX A;  1W97 L;  2P9I B;  3QFU A;  4GNI A;  2P9P B;  4MDA A;  5AQZ A;  2BTF A;  4K25 A;  2E2P A;  2CGL A;  3L0Q A;  4QS9 A;  5ADX H;  3G25 A;  3E1Y A;  2FF6 A;  3CJ9 A;  3HRG A;  3IDH A;  3FZM A;  2QWQ A;  3LM9 A;  3SMS A;  1P8Z A;  2PAV A;  3A5O C;  5KPT A;  4FWP A;  4BY9 C;  4KH6 A;  3I56 N;  3D2E B;  3D2F A;  3UKU A;  1WOQ A;  1U6Z A;  4DKW A;  4BQL A;  2IVN A;  3R1X A;  5BRH A;  3TTF A;  2Q1N A;  4J8F A;  2V52 B;  4RWT A;  2E20 A;  3DXK B;  1YXQ A;  4ILJ A;  1Y64 A;  4B1Y B;  2Q2R A;  3SAH A;  3P4I A;  2QWL A;  4R79 A;  2P9L A;  4WFB L;  3VGK A;  4CZK A;  1YJW N;  2CGK A;  3O9S A;  4JKE A;  3LDQ A;  2GEM A;  4CZH A;  2HMP A;  5C2D A;  1YIJ N;  1SS6 A;  1YF5 L;  2OAN A;  2WBN A;  2WFB A;  3DXM A;  4CZI A;  2VWB A;  4CZJ A;  5BR9 A;  4IEE A;  4I6M A;  3VMF B;  4RTF D;  5B8H A;  3MCA B;  1NMD A;  4BRI A;  3R3L A;  3IMX A;  5E26 A;  4BRF A;  4ISF A;  3SMP A;  3G4S N;  3ATV A;  2E1Y A;  5JIC A;  4CBU A;  5C10 A;  1K8A O;  2WUS A;  4YOX A;  2NRZ A;  4BGB A;  1K9M O;  3C6A A;  3QML A;  4M7X A;  5AQP A;  4XJX A;  4M63 C;  2J4R A;  5BPN A;  4CZF A;  2Q0R A;  3C7N B;  3MN6 A;  4JKC A;  4GVE A;  2P9I A;  2GUP A;  4MDB A;  1Q82 O;  4CI6 A;  2ASP A;  5HOO A;  5C2F A;  4H5N A;  3SLC A;  3CPE A;  5TKY A;  5BPM A;  3C65 A;  1ATR A;  3K9J A;  2A5X A;  2YHW A;  4CBW A;  2GWJ A;  4IO8 A;  4IZ9 A;  3SK3 A;  1ZC6 A;  1NJI O;  1R59 O;  4BRP A;  3MX2 A;  5AZJ A;  1KD1 O;  4WF9 L;  1NGA A;  2JWK A;  2WC9 A;  2AA4 A;  3DXK A;  3PLA A;  1T3V A;  1Q86 O;  4YOW A;  2QM1 A;  3M3Z A;  4JD2 A;  4F9O A;  3SAG A;  1HPM A;  1BA1 A;  5EY4 A;  3R9P A;  4OPA A;  4FWO A;  4A5A A;  1NGB A;  1XUP O;  3EE9 A;  4ILH A;  5GIP A;  1ATN A;  2NRH A;  2HBK A;  2OTL N;  3OBY A;  3O80 A;  3U4L A;  3VGM A;  4IOA L;  1KC8 O;  3ZEU A;  1GLC G;  3UKR A;  3QDK A;  2D0O A;  3H1Q A;  1GLD G;  4IWV A;  4Y0W A;  4BRH A;  4IFE A;  4FWR A;  3H3O B;  4CZG A;  1SQK A;  3CQY A;  3ENO A;  3HSC A;  4H5R A;  5GAH P;  5LJW A;  3CCE N;  4YOT A;  3AGK A;  3O1B A;  3SJH A;  2IVP A;  1YI2 N;  2GX9 A;  1QVG M;  3CET A;  4BRC A;  4YOR A;  5C0Y A;  4RCH A;  1TUY A;  4MLH A;  1MDU B;  3VF4 A;  2QTD A;  3L6Q A;  2P9N A;  1EQY A;  4B9Q A;  1M90 O;  2E2N A;  2NRV A;  2VGM A;  3CIP A;  3EL2 A;  4IOX A;  3QBW A;  2A40 A;  4H5T A;  4JAX A;  3H3N O;  4A2A A;  4E1J A;  4BRM A;  4PL7 A;  4WFN L;  3A5N C;  1U2V B;  3GE1 A;  3KWI A;  1KAX A;  3O4W A;  5AQJ A;  1YIT N;  3GBT A;  2C1G A;  3WQT A;  3UE5 A;  1C0G A;  3T7Z A;  2QI2 A;  5BRF A;  1BG3 A;  2A6A A;  2P9P A;  5AQG A;  1H1V A;  3TPQ A;  1GLF O;  3F5T A;  4PHT X;  4BE7 B;  4BC3 A;  1VQP N;  5AQR A;  5AFU A;  2IIR A;  3AAR A;  5FPM A;  2NRW A;  4IJN A;  5TKW A;  2YCH A;  1DEJ A;  3MX5 A;  4A5B A;  5AQS A;  4EHT A;  3BUZ B;  4B1W B;  4BRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...