2P9PB

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
190
structure length
184
Chain Sequence
GVVVDSGDGVTHICPVSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEVGVAELLFNTIQADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 50
structure length 184
sequence length 190
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9pB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9pB02
3SK3A 3KHYA 3CERA 1HLUA 4H5TA 1MDUB 1QZ5A 4LC9B 5E26A 2NLXA 2D0OA 3LDNA 5AQGA 1MA9B 2Q1NA 3OHRA 3H46O 3LM9A 4XH1A 2FLOA 3FZMA 4A2BA 1NGDA 3ZX3A 3VENA 2E1ZA 3EN9A 5F1XA 1NMDA 4CD1A 4F9OA 3M6GA 3D2FA 1QQOA 4RCHA 4J8FA 3A0IX 3EKSA 3VGLA 3CI5A 4XH4A 1GLAG 3SLCA 1ZC6A 3LL3A 1SZ2A 3H1VX 4CD3A 4EIAA 3QFPA 1ZBSA 3O1WA 2IVOA 2QWMA 2GWJA 4BG8A 1SAZA 3SMSA 1Z05A 2QWRA 2PAVA 3CJCA 4QS7A 4FL9A 3FZLA 5EOYA 2FSNA 4CBWA 5ADXA 2A42A 5BN8A 1X3MA 2GEMA 2W40A 4FWOA 5LY3A 1YUWA 3ENOA 3BF1A 4JD2A 2PBDA 5AQJA 4CZGA 3I33A 5E84A 1BUPA 4DB3A 4ISGA 2QWOA 4BGBA 4B1XB 1T6DA 2D1KA 3VESA 2YCHA 4CZJA 5JLHA 1RDWX 3DXKA 4FWKA 3ATVA 4CZFA 4KBOA 3H1QA 1H1VA 3D7EO 4BR2A 4CBXA 3DXMB 4BRMA 3H45C 4FO0A 4WYBA 4CJ7A 4RTFD 3H6EA 2ITMA 3CJAA 2V51B 2YI1A 4BVPA 3AARA 1Z6RA 4JHDB 1U2VB 1RGIA 2P9KB 3MMVA 4BGAA 5BPNA 5AZIB 3W0LA 1V4TA 2P9SA 2QWQA 1NGFA 1BA0A 2E2QA 2VWBA 3ZEUA 1HPMA 4B9QA 5CE3A 5I9EB 2YHYA 2FSKA 1P8ZA 1HUXA 3MK6A 3SMPA 3VEVA 3ID8A 5B8HA 1HX1A 3A8YA 3QB0A 1GLFO 5F2RA 1D4XA 1NGJA 2AA4A 2YJEA 3GDQA 4MO5A 4BQZA 2P9LB 3MN5A 2E20A 1BOTO 3LDPA 4ISEA 3ZX2A 4FWQA 2ASPA 3B8AX 5ADXH 2CH5A 3A5NC 5AFUH 4K43A 3CHWA 5AR0A 1HKGA 1ESVA 3J8AA 4H5VA 4ISFA 2E1YA 3GG4A 4H0XB 4B1YB 1BWFO 1QZ6A 3WXIA 1K8KA 2E8AA 1GLDG 2P9UB 5AQFA 5AZJB 2V7YA 5AQQA 3VGMA 3C0BA 3F9MA 4BRFA 3DWLA 3M1FA 1NBWA 4H5RA 2ASMA 4H0TB 1HKBA 2V7ZA 4H5NA 4DCHA 1S3XA 3UB5A 5TKYA 1JCEA 3R9PA 3O6WA 5AQPA 3LDLA 3DAWA 3LDQA 1EQYA 3C7NA 4BR7A 2HF3A 4IO8A 1BDGA 5AQXA 5JMVA 4PL7A 3HTVA 4WQ4A 4BR5A 1QHAA 4XEIA 1LOTB 4MLEA 2P9IB 3VETA 4DHYA 4M7YA 4B1ZA 1NGGA 3U8XA 4BR9A 4JN4A 3VPZA 4B1UB 5FPMA 3BUZB 4O8KA 1NLVA 1TYQB 3VEYA 3WEEB 2A40A 5LJWA 3ATUA 3TU5A 4A61A 2GTDA 4BRAA 3WQUA 3GE1A 5EVZA 1XQSC 5AQUA 2CGLA 4BRKA 3HBTA 5AQTA 4CI6A 4FSVA 5AQSA 2QWNA 2A41A 4IJNA 5KQDA 4K41A 4I6MA 4H0VB 3VEZA 1YAGA 2P9KA 3HSCA 2YHXA 5FPEA 3CQYA 2FF6A 1NGAA 3R8EA 1V4SA 4K25A 3QMLA 3ZETB 3WT0A 3RSEA 2EWSA 3L0QA 3H3OB 1JCFA 5ELZA 3UKUB 1ATRA 2KHOA 3CJBA 1NGCA 4RWTA 2GELA 3EKUA 3KZBA 1GLEG 3O8MA 4FWRA 1E4GT 1WUAA 2HF4A 5BPMA 1OKJA 4HTLA 1KAYA 4IJAA 5FPNA 1ATNA 2ZGYA 2J4RA 3D2FB 4CBUA 2DPNA 4BRGA 3G25A 2Q2RA 4CZHA 4O5FA 4BRCA 4WQ5C 5AQRA 2Q0RA 2FF3B 3FLCO 3TPQA 4AM7A 4CZIA 1TUYA 4FPBA 4YDUC 3KVGA 3AAPA 2HMPA 4BRHA 4IWVA 1G99A 2D0PA 3QBWA 4A2AA 5AQHA 2YJFA 2IVNA 4GY2B 2E88A 5LJVA 2CGKA 3DJCA 5AQVA 2ZF5O 4FWMA 2ZWHA 1C0GA 3IMXA 4IXCA 3A5OC 3JS6A 4QS9A 5KPZA 2V52B 1RFQA 3VERA 4M7XA 1HKCA 1U6ZA 1IG8A 3WXJA 4M63C 1SQKA 3AY9A 3O1BA 3ZX0A 2W41A 3WQTA 4BRPA 5AQOA 1R59O 3FGUA 1QQNA 2P9IA 2NRHA 4DQ8A 1E4FT 1CZAN 3ULEB 5BRFA 4BROA 2Q31A 3BEXA 3MDQA 3FE1A 4PKIA 3GL1A 2E2OA 4E1JA 1LCUA 4FWPA 3UKRB 2NZTA 4BC3A 2E2PA 2GUPA 2P9PB 2P9NB 2P9SB 4PKGA 4H0PA 3IUCA 4GNIA 5AQIA 1GLLO 3CETA 4BG9A 3H3NO 1GLBG 3ZEUB 3A5MC 4K42A 2QM1A 3MN9A 1T6CA 1KAZA 4B1WB 1DEJA 1QQMA 2E2NA 4FWNA 4CZKA 4PL8A 4H0OA 2BTFA 3CJ9A 1Y64A 1X9JA 3QICA 1TUUA 2CH6A 3VF2A 3ZETA 3CIPA 2VYPA 2BUPA 2FXUA 3P4IA 3VF6A 3UKUA 3IFRA 3CJ7A 3L6QA 3VGKA 3D2EB 5JICA 4FWSA 4HWIA 5BRHA 2YHWA 4H5WA 2F9TA 5AQNA 3FZHA 1NM1A 2I7PA 1KAXA 1S22A 3DXMA 3ENHA 1DKGD 3R6MA 2ASOA 4BRIA 3FR0A 3CJ1A 1K8KB 4BR0A 2Q0UA 1C0FA 3EO3A 2QWPA 4JHDA 4JAXA 1U2VA 5EXWA 4H0YB 5BN9A 5AZIA 5EX5A 3QDKA 2H3GX 3A5LC 3HZ6A 1IJJA 2ZGZA 4C23A 3O5BA 3MCPA 3FFKB 3LDOA 2F9WA 4QS8A 3VEWA 4BRQA 3WUHA 4FPAA 1NGEA 1WOQA 3MN7A 4MO4A 4FOIA 1BA1A 2HOEA 5KQ8A 1GLCG 3QFUA 3MN6A 1NGIA 4BC2A 2P9LA 1XC3A 5AFUA 4BC4A 3CQXA 2QXLA 3C7NB 3QBXA 3WXLA 3GOIA 2FSJA 4A62A 5AQLA 5BREA 5AQZA 4BREA 5AQMA 4BRDA 4Z94A 4Y0WA 2UYTA 2CGJA 1KXPA 4BRLA 5AQKA 3EL2A 1ZXOA 5AQWA 2OANA 3L4IA 5BR9A 1MWMA 2Q97A 3O08A 3M3ZA 4EHUA 2IVPA 3VOVA 2Q36A 1BO5O 2P9UA 3HI0A 3VF4A 4BVOA 1X3NA 3VEOA 5AZJA 1BG3A 2GWKA 3ULEA 4MLHA 4JNEA 4H03B 3IDHA 4I6MB 3BF3A 1NGHA 5JLFA 3U9DA 2D4WA 5KPRA 1YVNA 3UKRA 2QWLA 3JXUA 4CZEA 2A3ZA 2P9PA 2P9NA 5BPLA 1GLJO 3VEXA 1HJOA 1NWKA 4IZ9A 3FZFA 4JD2B 2I7NA 3GBTA 1JCGA 4BR4A 4NO7A 3FZKA 3RSEB 1DGKN 3EZWA 4FOEA 4L3QA 5F0XA 3UE5A 5BRDA 3DXKB 3LM2A 3SJHA 2A6AA 3WXKA 4EFHA 1XUPO 3O4WA 1J6ZA 2A5XA 5FPDA 4EHTA 2IIRA 4AM6A 4WQ5A 1BU6O 1TYQA 3BP8A 3W3DA 4B1VA 4BC5A 3WEEA 2QW9A 5EY4A 3U4LA 3D2EA 4CZLA 1NGBA 4WQ4C 2WUSA 4FWLA 4BRNA 3S41A 4YDUA 1YXQA 4XH5A 4NB4A 2VCPA 3HM8A 1T44A 5KPTA 1ATSA 4CZMA 4PKHA 3AAQA 4EAHD 3I8BA 3O80A 1MWKA 1Q18A 2AP1A 5AQYA 3U9ZA 4BQLA
chains in the Genus database with same CATH superfamily
4EZ9A 4DR2K 3WNGA 3AV9A 2G8FA 3O9TA 3OYFA 1C1BA 3MEDA 4F2RA 3M8PA 3IG1A 1EO1A 2UUAK 3VN5A 4H4MA 1MA9B 2Q1NA 4IEEA 3NF8A 3VA3A 3LM9A 4R5PA 4JI5K 3SAFA 5EU7A 1RDAA 4A2BA 3ZX3A 3OYEA 2P5OA 1EKEA 1NMDA 3AVMA 3G4SN 3ZSZA 4JK9A 4N5SA 1BHLA 1DTTA 5GAEP 4OPJA 4CFAA 4B9TA 4QCLA 3A0IX 3TSUA 3OA9A 4CVNE 1ASVA 4O0JA 1GLAG 3SLCA 1ZC6A 4GKKK 3EY1A 3NH2A 4EIAA 3QFPA 4JS5A 4HVJA 1ZBSA 3O1WA 3S5TA 4BG8A 3NDKA 2QWRA 4FL9A 2G8UA 3OS1A 4BDZA 5ADXA 1L3SA 4U7BA 4K8ZA 2GEMA 4GKJK 5IT9O 1RBSA 4DFMA 2RN2A 2PBDA 5AQJA 2UUBK 2EHGA 4N47A 2VGMA 3DI6A 3RWUA 4ISGA 4WFBL 3U3GA 4Q0BA 2YCHA 4EP4A 1SS6A 2EX3A 1Q9XA 3ATVA 3HOSA 4DQSA 5CY4A 4DQRA 1NK0A 3DXMB 1YJ9N 5GIOA 2KZZA 3PX0A 2IAJA 3V9XA 1JLQA 1U2VB 1TL3A 2NRTA 3W0LA 2NNWA 1RT1A 3LWMA 3HYFA 1JJ2M 1NGFA 4CK3A 1BA0A 1HPMA 3L2QA 5JS2A 4KHSA 3V9UA 2FSKA 1P8ZA 1LWEA 3KWGA 3MK6A 3ID8A 5B8HA 3A8YA 5F2RA 3CYMA 1NGJA 2AA4A 4MO5A 1WAJA 4FM0A 4KHNA 5CYMA 1EWRA 3OY9A 3LDPA 4ISEA 3ZX2A 1S9GA 5AFUH 2NUBA 3CHWA 1HKGA 4ILJA 4H5VA 3AVHA 3DLBA 4RW8A 3T1HK 4C8MA 1BWFO 4IO9L 3VQEA 1K8KA 3R3LA 3DYAA 5KRTA 3QLHA 2HHWA 5AZJB 4FM2A 1TAQA 2ZJQL 4UY8O 1JLAA 3M1FA 3PSIA 4CJQA 1QHTA 1W0HA 4CJ5A 4FK0A 4CJUA 4JV5K 4H0TB 2V7ZA 3ALYA 3UB5A 4JS4A 1JCEA 4CEEA 3OS2A 3PV8A 3OJSA 1EQYA 2NRWA 3MX5A 5AQXA 4CERA 5JMVA 3V1RA 3I0SA 3HTVA 4W5OA 4BR5A 3OJUA 2XY7A 1QHAA 4Z4FA 4DHYA 3NGYA 2WONA 1TYQB 3VEYA 5FROA 2VG7A 1CLQA 2XHBA 4O4GA 2O8CA 1CXQA 1NK5A 1YJWN 3QIPA 1KSPA 1RT2A 1QSLA 5AQSA 4KRFA 3AO1A 4K41A 3SBGA 4DTMA 2YHXA 4DKWA 2XY8A 3CQYA 3QNNA 4K25A 3QMLA 5H1SQ 5HOOA 3L0QA 1KFDA 3H3OB 1JCFA 4BDPA 1HNWK 3MEEA 4CF0A 4RWTA 2GELA 1QVGM 4CK2A 3O8MA 1E4GT 5LMUK 2HF4A 1OKJA 1EX4A 3OYIA 3NMUA 2ZGYA 2ZJRL 1NU0A 4B3SK 2NRVA 4DUZK 1NK4A 1S1XA 3DLHA 4Z0UA 3MX2A 4BRCA 5J2QA 4WQ5C 3KJVA 3FLCO 4AM7A 2A1RA 2D0CA 3SUPA 2D0AA 1HR0K 2PZSA 2VWKA 4IFEA 1FKPA 4G1QA 3V81A 2HMPA 1KVAA 2D0PA 4A2AA 3AA2A 4AF1A 5M1FA 1X9MA 3O3GA 2YHBA 5AQVA 4LD0A 3ENBA 4LSLA 4FWMA 2G8VA 1FK9A 1C0GA 4IXCA 2JWKA 2IDOA 1JKHA 4IOXA 2V52B 1U6ZA 2VG5A 3NVKA 2IOCA 3RVCA 2O8DA 3WQTA 4NXMK 5AQOA 3VQ6A 1YIJN 1A5VA 1N33K 1L3VA 2Z1HA 1T05A 3I56N 1JXBA 4CF1A 4JI0K 4ELTA 5GAHP 4IOAL 2UUCK 3CCUN 3E1YA 4E1JA 3K5NA 1UOCA 1LCUA 3TSPA 2NZTA 3AVBA 4BC3A 1CZBA 2E2PA 2VQEK 4PKGA 4FLVA 1GLLO 4DFJA 3H3NO 1SKRA 3IAYA 2QM1A 3THXA 2E6LA 3SYZA 1Y64A 1X9JA 3LP1A 3QICA 3KTQA 4J2BA 3KLIA 1KC8O 3AO3A 4DV7K 2BUPA 3MXIA 3CJ7A 3L6QA 4E7IA 5BR8K 3VGKA 1RTJA 2C1GA 4FWSA 1D9DA 1NM1A 3L2UA 3CCMN 3THWA 1KAXA 1G15A 4JK7A 4W5QA 3SUQA 3R6MA 3WNHA 1JLCA 1E3MA 3CJ1A 1K8KB 3QIOA 3EO3A 4ID1A 1Z25A 5AZIA 3VQCA 1IBMK 5C2DA 1TK0A 3AA3A 3THYA 3FFKB 2HBLA 4QS8A 4CE9A 3WUHA 1XNQK 4FPAA 4JI6K 1Q86O 3ZSQA 3TABA 3T19A 2AJQA 1Y97A 5FDLA 1NGIA 4FJIA 2A1SA 2P9LA 4DR4K 4B8CA 1HYVA 5AFUA 4OPKA 2E5LK 2FSJA 1HQUA 4BWJA 2O8EA 2B6AA 4BREA 3IS9A 2HMIA 1EP4A 4BRDA 5C10A 4OGEA 5CYQA 3PX6A 3ZLJA 4DSIA 2UYTA 4CEOA 3NF6A 1TVRA 4I2PA 2KKZA 1ZXOA 3SPZA 1P90A 4JRPA 3SUNA 3AVAA 4DV6K 2IVPA 3HP9A 1D5AA 4L8RB 3F2KA 2GWKA 4CHQA 2W00A 2NRRA 3PO5A 2ZJPL 2Q3SA 5JLFA 3U9DA 4JKAA 5KPRA 3UKRA 4CZEA 3AVJA 2P9PA 1N32K 3RMDA 4JD2B 4IZ9A 3P38A 3TAGA 3HOTA 4NO7A 3NFAA 4CEAA 1DGKN 4KO0A 4JK8A 4FOEA 1K9MO 4YHHK 4KTZA 3UE5A 5HL7L 3DXKB 4DTPA 1XUPO 1ITGA 3O3HA 5FPDA 1GOCA 3CPEA 2G8KA 2PYLA 1JXEA 3SNNA 2GBZA 2Y1IA 1BU6O 2O8FB 2WC9A 4CZLA 3D2EA 2X6SA 3SCXA 4WQ4C 4BRNA 1Q8IA 3P83D 3S41A 3MWPA 3EYZA 1YXQA 3CCQN 4DSKA 1T44A 1ATSA 2OPPA 4Q5VA 1KTQA 1U45A 4GW6A 2W6KA 3O9QA 4KHWA 5AQYA 3U9ZA 4BQLA 3SAGA 3NBPA 4DSJA 4FYDA 3S3MA 1XHXA 3S9HA 1HLUA 2UXCK 1NNEA 4AILC 3KK2A 2XY5A 1QZ5A 4LC9B 3J81O 2NLXA 4DU3A 3S3NA 4O0IA 3OHRA 3M8QA 4CHOA 1VSHA 3H46O 3E01A 3L2WA 5JVGL 3O9RA 4E89A 3VENA 2E1ZA 4FJHA 2O8DB 3BDPA 3VQ9A 4IFYA 1VQ8N 4F9OA 4RCHA 3AA5X 4JKBA 1VRTA 4J8FA 3EKSA 3VGLA 1IKXA 2OPQA 5HRPA 1LAVA 4CD3A 4C8OA 2YNFA 2IVOA 4YORA 3C95A 2YNIA 3HRGA 4IEIA 3PY8A 2WFBA 1Z05A 4QS7A 2KW4A 2QKBA 4CBWA 4J2DA 2A42A 3ZSVA 3CCVN 3TWHA 4FWOA 1K73O 2I5JA 1YUWA 3NF9A 3ENOA 4IDKA 4X66K 1NKBA 3NAEA 3QO9A 4DB3A 2QWOA 4NLCA 4B1XB 1T6DA 2D1KA 3AO5A 4DQIA 2OTJN 3RR8A 1QE1A 3O4NA 5JLHA 4KHYA 4FWKA 4AH9A 4CZFA 4CW7B 4BR2A 3HPOA 3THWB 3HVRA 4BRMA 3CCLN 4FO0A 4K0KK 1Q81O 2Y1JA 4E1MA 2YI1A 4B08A 3TANA 4E19A 4OJRA 3AARA 3OYAA 4FJJA 3AVFA 4BGAA 3KD1E 5AZIB 1V4TA 3HK2A 3ITHA 3SAHA 3C94A 1YT3A 4OO1J 1VQMN 2E2QA 4M3XA 4XIUA 4B9QA 4CGFA 1RDBA 3OW2M 4CHZA 1IH7A 4W5RA 2DTUA 5HRRA 1XHZA 2YJEA 4CJWA 2P9LB 3CFRA 2E20A 3L4QA 1U47A 1L3UA 4BACA 2HBKA 2ASPA 3E9PA 3O4QA 5J1EA 1ESVA 2FC0A 4ISFA 4F3OA 3GG4A 4FW2A 4H0XB 1QZ6A 4FZXC 3I0RA 4DSFA 3ISNC 4A5AA 3VGMA 4I2QA 2WBNA 5I42A 3OYMA 4H5RA 3PX4A 4K8XA 2ASMA 4DCHA 1K8AO 3HP6A 1M90O 4DR6K 4O44A 3O6WA 4EP5A 3JAMO 3AVCA 3F5TA 3DAWA 3LDQA 4WFAL 1XMQK 1RDCA 4I9QA 2HF3A 4RW4A 4IO8A 4PL7A 4ZTFA 1EWQA 4XEIA 2P9IB 4M7YA 3U8XA 5FPMA 3BUZB 4YOUA 5LJWA 2QTDA 3ATUA 4QOZB 3TTDA 1BI4A 2O4IA 2GTDA 4KREA 3DOKA 1FW6A 3WQUA 4LF5K 5EVZA 4X62K 2CGLA 4BRKA 3CMEN 3K57A 1ILYA 4CI6A 4M45A 1N36K 5KQDA 1WLJA 4I6MA 5CHIA 3VEZA 1YAGA 2P9KA 5FPEA 1UA1A 2FF6A 4DV5K 1MU2A 1ZBHA 3OYDA 3CG7A 4BY9C 4AHCA 4LFCK 5D3GA 1UA0A 3UKUB 3CJBA 4OKJA 4DG1A 3LP0A 5C12A 2PY5A 1NGCA 1S1TA 1OVQA 3KZBA 1GLEG 4M3WA 3VQ7A 1WSHA 1ZBLA 1WSGA 1KAYA 4DLGA 2QI2A 1RTDA 4CBUA 4Z4CA 4CEBA 4YOVA 4LH4A 2Q2RA 4CZHA 4WF9L 3HJFA 4H8KA 3D6RA 5C42A 2G8IA 4Z4HA 4FPBA 4B9UA 3MXJA 4GVMA 3SZ2A 4BRHA 1JLBA 1G99A 4KB0A 2IVNA 3B6PA 4GV9A 4YOYA 2OPRA 3DJCA 4X65K 1TKZA 2ZF5O 2JWLA 4PA1A 5KPZA 3TAPA 4CJSA 3RRGA 1HKCA 3AGKA 3SJJA 1IG8A 1FJGK 1VRUA 5MLCQ 4DV0K 2ETJA 2GUIA 3BY5A 1KVCA 1R59O 3OBWA 1I39A 2NRHA 1E4FT 4BROA 4DFPA 4F4KA 3BEXA 3V9SA 4PKIA 4FJ9A 4ID5A 4GV3A 5SZTA 1JL1A 3K9JA 4H0PA 4CJRA 4KAZA 3N4QA 4M3YA 2QK9A 2P51A 3A5MC 1J54A 5DMRA 3MN9A 1T6CA 3ZSYA 3CF5L 1QQMA 2E2NA 4FWNA 4PL8A 2F7TA 4KI6A 1I3AA 2CH6A 3ZETA 3CIPA 5M1OA 4B3RK 3P4IA 4WCEL 3ZSOA 3NF7A 3RMAA 3KKRA 4HWIA 1KRPA 2F9TA 5AQNA 2I7PA 3K58A 2BANA 3NHGA 3ENHA 1WSIA 1ZBFA 2WTUA 4RG8A 1NMNA 3MAQA 1HYZA 4CEZA 3SUOA 2Q0UA 1Z26A 2QWPA 2P1JA 5EXWA 4YOXA 3QDKA 3A5LC 4E72A 4FCYA 1RT4A 2KTQA 3KIOA 3NVMA 2HHTA 3OBYA 4E7HA 4B3TK 2FBTA 3LDOA 3ZT4A 1NGEA 1WOQA 2F8SA 2GX9A 4MO4A 2HOEA 5KQ8A 1YVUA 1KLNA 1QSYA 4WFNL 4CHPA 4B3OA 3HM9A 2PYJA 4BC2A 4IG3A 1XC3A 3CQXA 2QXLA 3QBXA 1ZBIA 4NCGA 1NK6A 4LFAK 3CC4N 4O5BA 4DV3K 1N34K 1S1VA 2HSTA 4CFCA 1RNHA 2E6MA 1KXPA 1TV6A 3C6TA 5AQKA 3ASMA 1RT3A 1KD1O 5I3UA 3L4IA 2HVHA 5BR9A 1MWMA 3MEGA 3O08A 3M3ZA 3VOVA 5KGWA 2P9UA 4JYAK 4OX9K 1NJIO 1X3NA 4ICLA 3VEOA 1BG3A 4PUOA 3ULEA 5GINA 1CZ9A 1YF5L 3IDHA 2LSNA 4I6MB 3SV4A 4DV1K 2D4WA 1YVNA 3JXUA 2P9NA 2R7YA 3VEXA 4E7KA 1NKEA 1HJOA 3FZFA 4CGJA 1WNSA 4M3RA 1SV5A 1XMOK 3FZKA 1NOYA 3QERA 3ZSRA 4AHUA 4FZYA 5F0XA 4BECA 4BE0A 3SJHA 3WXKA 1J6ZA 4JKEA 1EETA 3NH1A 1WBDA 1WBBA 1TGOA 4WQ5A 5EY4A 1J5EK 2WUSA 3PIPL 3CCSN 4NB4A 3TARA 3QINA 1D9FA 1TKDA 2G8HA 4B9SA 1X9SA 5KPTA 4C8KA 1NK9A 1IV0A 3CMAN 2ITGA 3AAQA 4EAHD 2XY6A 1SL1A 3TPQA 4DF8A 3SK3A 2HHHK 2HHIA 3LAMA 4DTRA 4H5TA 1WAFA 4CJPA 1MDUB 4YNQA 1X9WA 3KLEA 3G71N 3L8BA 1VQ5N 2D0OA 4CESA 1QS4A 2IGIA 3AVGA 1L3TA 1RT7A 2O4GA 4I7FA 5A2QO 5T7BA 2FLOA 4JI2K 3V6DA 1NGDA 2HBMA 1WN7A 5DM6L 5F1XA 1QVFM 4FLWA 1IKVA 4M3ZA 1C1AA 3C6HA 4CF9A 1SZ2A 3OYNA 3RMCA 2F4VK 2QWMA 3K59A 2O8BA 5CZ1A 1IKWA 1SAZA 3SMSA 5C2FA 5EOYA 2FSNA 1FXXA 5BN8A 3NE6A 1X3MA 1IO2A 2W40A 3PLAA 4PY5A 3AVIA 5LY3A 3BF1A 4V19S 3I33A 3LANA 3F9KA 5E84A 4O55A 1QSSA 2C1IA 2JLEA 1DT9A 5DM7L 4B8AB 4CZJA 1RDWX 4KBOA 3H1QA 2HHQA 2O8CB 3H45C 4WYBA 2D5RA 4DTJA 2XRIA 1JLFA 4R79A 2V51B 2B5JA 4X64K 3KK1A 3V9WA 4HTUA 4KV8A 5C24A 1U4BA 1XWLA 3LZJA 2QWQA 1W2BM 4JEPA 1F21A 1VQ9N 4JKHA 4KB1A 3CD6N 1BQMA 5CE3A 5I9EB 3TTCA 3T7ZA 1HUXA 1VSKA 3SMPA 3OS0A 4B9LA 3JYTA 1D4XA 3GDQA 5M1NA 5SWMA 4BQZA 1VHXA 2OCEA 3J7YP 1WSFA 3V1QA 2WOMA 4NCBA 1T7PA 1BOTO 4LF9K 4FWQA 3B8AX 5ADXH 3A5NC 4K43A 5AR0A 1VK0A 3I8DA 2E1YA 4B1YB 4CGIA 3WXIA 1VSMA 3LPTA 1GLDG 2FBXA 2KLAA 2P9UB 5AQFA 4CK1A 2V7YA 3C0BA 4KH4A 3F9MA 1J53A 4E1NA 1SKWA 1VQON 3P5JA 4AHVA 1X1PA 4AQYK 1ASUA 1TK8A 3EE9A 5TKYA 4CGHA 2XO7A 3R9PA 1ASWA 5AQPA 3LDLA 5JENA 2OYQA 1RBUA 4GVEA 4BR7A 3EZ5A 1QTMA 1VQKN 5KRSA 3G10A 2VG6A 1BDGA 3H08A 1RBTA 4WQ4A 3RR7A 1LOTB 2YV0X 4MLEA 4A5BA 2HVIA 4MDAA 4BR9A 3CFPA 4JN4A 4C1NK 4O8KA 1NLVA 2A40A 3BGRA 3K5MA 4IKFA 4A61A 4OKEA 1HYSA 3GE1A 1HRHA 3CM6A 2E4LA 1XQSC 3OYGA 5AQTA 3CXCM 1U04A 2QWNA 2A41A 4H0VB 4BWMA 3SQ4A 2DFFA 2G8WA 4LF7K 3THXB 4BEBA 3HSCA 4FJXA 1OH5A 4TSXA 1NGAA 3R8EA 4CJKA 1TK5A 2EWSA 2UU9K 5ELZA 5E41A 1LW0A 2DFHA 3SI6A 2RF2A 5K14A 4I9LA 4RW7A 4J2AA 3EEQA 3HVTA 1WUAA 5BPMA 3Q7CA 3ZSWA 3QEXA 1BIZA 4A59A 2J4RA 4DQPA 4KHUA 2HNYA 3G25A 4M42A 4B9MA 4JI8K 3TR8A 2PFUA 5AQRA 4PHTX 1VQ4N 2FF3B 4UQGA 2HHXA 3HL8A 3QNOA 4KH5A 4CZIA 3LAKA 3THYB 5CZ2A 4YDUC 2RE2A 2O8BB 1D8YA 3L3UA 3VQPA 4DV2K 4FZZA 4JKFA 4PWDA 3LP3A 1NJXA 4FK2A 1RILA 2X74A 1SL2A 2YJFA 1NJZA 4FVMA 1GOBA 4CJEA 1YJNN 4HUFA 1M1KO 4ZTJA 1ZBUA 4CJLA 3IMXA 2O8EB 5KI6A 3A5OC 3JS6A 5AJ3K 3VERA 4M7XA 3V9ZA 3WXJA 5JS1A 4M63C 1K6YA 3C65A 3ZCMA 3O1BA 2DY4A 2W41A 4OPHA 4BRPA 4DTXA 5GAGP 3M8SA 3VQ8A 3FGUA 1QQNA 4FLYA 4DQ8A 2RKIA 2W6LA 3NGZA 1S6QA 5BRFA 2Q31A 3AVNA 3MDQA 4DF4A 5HBMA 3SBTA 3GL1A 2E2OA 1LWCA 3UKRB 1ZYQA 4DTOA 2P9PB 2GUPA 1A5XA 2KFNA 1LW2A 5JVHL 4GNIA 5AQIA 4CIGA 2D0BA 3CETA 4BE1A 4K42A 5CR4A 3QEWA 5J2NA 3VQQA 3T1YK 3M8RA 1KAZA 4JKGA 1DEJA 3HPHA 4FLUA 4H0OA 1BISA 2BTFA 3CJ9A 3DM2A 4DTNA 4E7JA 4OGCA 3VF2A 3DOLA 1RCHA 4DR5K 1HMVA 1QQCA 1JLEA 4FK4A 3D2EB 3AA4A 5BRHA 3PSFA 4G9ZA 3FZHA 3J7AP 1S22A 2F96A 1IBLK 2ASOA 1RDDA 1EXQA 3FR0A 4CJTA 2HNZA 1C0FA 4H4OA 3EE8A 3T69A 4JHDA 4JAXA 3AO4A 3LALA 4DR1K 1T3VA 5BN9A 1SL0A 1YHQN 1J5OA 5EX5A 2H3GX 3HZ6A 1IJJA 1DLOA 3DLEA 3UIQA 4C23A 3TI0A 2KZMA 4OLBA 1W97L 2F9WA 3VEWA 4BRQA 3MN7A 4CEQA 4LY7A 3MXMA 4HHTA 1GLCG 3QFUA 4B9VA 1HQEA 2HW3A 3LPUA 5HP1A 1O1WA 3B6OA 3ULDA 3GOIA 3V4IA 5AQLA 2Z1JA 5BREA 2YKMA 5AQZA 4FLTA 4FJKA 5AQMA 4DU1A 3QESA 3DRSA 4JI7K 3EL2A 4OLAA 3BZKA 3QEPA 2Q97A 5LMNK 2Q36A 3TAEA 1BO5O 3HI0A 4BVOA 3SPYA 1I94K 4WE1A 3KLHA 4E0DA 4KHPK 4MLHA 1RT5A 4JNEA 2VWJA 4H03B 2FBYA 1NGHA 3AVLA 3BF3A 3ZT2A 1REVA 1RTIA 2QWLA 2NRZA 1B92A 2A3ZA 5BPLA 1C0TA 3VQBA 1Q7YO 1IG9A 1NWKA 5DK5A 2I7NA 2IS3A 3GBTA 1JCGA 4DWIA 2W42A 2ZM6K 5GADP 3EZWA 4O8UA 3HSTB 2ATQA 3L3VA 4B3MK 5FRMA 4FJMA 3T3FA 5M1PA 3LM2A 4OPAA 1KLMA 3OYBA 4EHTA 4DU4A 1NJYA 2RPIA 3DLKA 2IIRA 4AM6A 3BP8A 2BH1A 1HNXK 3WEEA 3O9UA 4ELVA 1NGBA 4JRQA 3D45A 1TKTA 4KI4A 3MECA 1BGXT 4U67L 4PKHA 3ZT3A 2B4JA 1CXUA 1OVYA 3TAMA 1MWKA 1Q18A 2AP1A 4M41A 4CFBA 3CYGA 3KHYA 4JKDA 4KTWA 3E9OA 3CERA 4AHSA 1DTQA 4MFBA 5E26A 2Z1GA 3LDNA 1L5UA 5AQGA 1JLGA 1OH7A 3NGIA 3VA0A 3WXMB 4LF4K 4XH1A 3FZMA 4YFUA 2ZQBA 3LZIA 4FJ5A 4DS4A 3M5RA 3EN9A 4CD1A 1BQNA 3R1XA 3M6GA 3D2FA 1QQOA 3L2RA 2YX6A 4ELUA 5C15A 4B9NA 1VQ7N 2KFZA 4Y1CA 3CI5A 1SKSA 5GIPA 4NLBA 4DFKA 4XH4A 2ZD1A 1LWFA 1O13A 3LL3A 3H1VX 1OH6A 1VSIA 3OYKA 1B9FA 3L2VA 2GWJA 3OVNA 2PAVA 3CJCA 4F8RA 3VQ5A 1RBVA 3FZLA 4DTSA 4E3SA 1XC9A 1LV5A 4JKGB 3KK3A 5M1KA 4JD2A 3DLGA 4CZGA 2VGNA 3ID6A 1BUPA 4BGBA 3NCIA 4XJXA 3VESA 4CECA 3VQ4A 3U3YA 3THVA 3D0PA 5HRSA 1BI4B 3DXKA 3E66A 2BDPA 1TKXA 3HPGA 1H1VA 3D7EO 4OVLA 1NJWA 1TAUA 4CBXA 4CJ7A 4RTFD 1KQSM 3H6EA 2ITMA 4DSLA 3CJAA 2GV9A 2O8FA 4KFBA 4CGDA 4BVPA 1Z6RA 3TTFA 2QXFA 4JHDB 4DQQA 3KKSA 3PIOL 1RGIA 2P9KB 3MMVA 4M3UA 5BPNA 4KKOA 5FRNA 2P9SA 3G6EN 4FM1A 2VWBA 3WNFA 3ZEUA 1VSLA 5KGXA 2YHYA 1YITN 3CCJN 3VEVA 4FJNA 1HX1A 3QB0A 1GLFO 2QA4N 3DLLL 4LSNA 3F73A 3MN5A 1RBRA 4IG0A 2RHKA 1HJRA 2QEXN 5HRNA 3E9LA 2IC3A 2CH5A 1IKYA 2YKNA 3J8AA 1S6PA 3IRXA 1WSEA 4LF6K 4CHNA 1FKOA 3CPWM 3QETA 4FJ8A 3DLRA 2E8AA 3RRHA 3CCRN 3J80O 3AGRA 5AQQA 1UAXA 4CFDA 1C0MA 3O9SA 3QEIA 4BRFA 2UXBK 3DWLA 3CC7N 2OPSA 3VTHA 4HUEA 1NBWA 4NYFA 4CJVA 3LP2A 2FBVA 1HKBA 2YNGA 4H5NA 1S3XA 1KVBA 1VSFA 2KQ2A 5J2MA 2HHVA 4IDHA 5TKWA 3C7NA 4DLEA 4DS5A 4N41A 4CIEA 3A2FA 2HHUA 4W5TA 2ZE2A 4CJ3A 3QEVA 3VETA 4NCAA 4NXNK 4B1ZA 1NGGA 4CHYA 3VPZA 4B1UB 5HROA 4YOTA 3WEEB 3DRPA 3TU5A 4RW9A 4BRAA 3JSMA 4BE7B 1T8EA 4IOCL 3CC2N 3PO4A 2HB5A 3CFOA 5AQUA 3HBTA 4FSVA 3KD5E 3KLFA 4IJNA 3KLGA 1C1CA 1S72N 1C6VA 4DUYK 4FJ7A 4CEFA 1W7AA 1V4SA 1RDUA 3ZETB 3WT0A 3RSEA 1NOZA 1ATRA 2KHOA 3KWIA 1LAWA 1S5JA 3K9KA 3EKUA 4CF8A 1BIUA 1T03A 4FWRA 3N4PA 2BGGA 4HTLA 4IJAA 1NK7A 5FPNA 1ATNA 1HNIA 3ZSXA 3I55N 3D2FB 1N6QA 1XI1A 2DPNA 4DR3K 4BRGA 4HUGA 4O5FA 1VQLN 4FJLA 4ILHA 2Q0RA 4AHRA 5FLXO 1BCOA 3HO1A 2OZSA 1TUYA 3TAQA 3WNEA 1HPZA 3KVGA 1BCMA 5IWAK 3AAPA 4J2EA 1B9DA 4IWVA 3OYCA 1NK8A 3QBWA 4IBNA 5AQHA 4GY2B 3J7ZO 1HNZK 4DSEA 1U49A 2OA8A 2E88A 4RW6A 5LJVA 2X78A 2CGKA 3FFIA 3V1OA 4KTQA 3T1AA 3PUFA 1NKCA 4FXDA 4EZ6A 2ZWHA 1HNVA 4ILGB 3TAFA 4N56A 1U48A 4QS9A 1UWBA 1RFQA 2Z1IA 4CF2A 1Q9YA 3HT3A 3VMFB 3OYLA 4YOWA 1SQKA 3AY9A 4C8LA 3ZX0A 3ZYYX 3O3FA 4BE2A 3SQ1A 2JGUA 2YHAA 4IFVA 1NG9A 4OKKA 1RT6A 4DV4K 2HBJA 2P9IA 3TSQA 4KHQA 1CZAN 3ULEB 4NYNA 1VQNN 1JL2A 5J2PA 3LWLA 4CJFA 3FE1A 3K0SA 2OZMA 4W5NA 4FWPA 2P9NB 2P9SB 3IUCA 1VSDA 4BG9A 1GLBG 3ZEUB 2BE2A 4AHTA 5KTQA 3DMJA 4MDBA 2HHSA 2X6NA 4B1WB 4CCHA 3G0ZA 1S1WA 4CZKA 5C25A 4KPYA 1A5WA 1TUUA 4CJ4A 2QKKA 2VYPA 3ZT1A 3CM5A 3OYHA 2FXUA 4F3TA 3VF6A 4JI3K 3UKUA 4Z4IA 3IFRA 4JLHA 3RTVA 4YY3K 3ZT0A 5JICA 3VTIA 2YHWA 4H5WA 2UXDK 1R0AA 4LFBK 1YTUA 5LL6Z 4JKCA 3DXMA 2HNDA 1VQPN 4BDYA 1DKGD 4KH6A 3BZCA 4BRIA 4FLXA 4DTUA 3IKMA 3MCAB 1VSEA 4BR0A 4QAGA 3NH0A 4FW1A 3K5OA 4FLZA 1U2VA 4LH5A 1VAZA 4H0YB 2DFEA 3S3OA 3P31A 4M3TA 4HCCA 4E7LA 2ZGZA 4FVUA 3O5BA 3MCPA 4CGGA 1VSJA 2VQFK 1N8RO 4FOIA 2YNHA 1BA1A 3MN6A 5C0YA 1XNRK 3HXMA 3SV3A 4BC4A 3C7NB 3WXLA 3VQAA 4JI1K 4A62A 4Z4EA 1TL1A 3K2PA 4Z94A 1KCFA 3SQ0A 4Y0WA 4CIFA 1BL3A 2CGJA 4BRLA 3DRRA 5AQWA 2OANA 3AO2A 1KFSA 2NRXA 4EHUA 3C6AA 4FJGA 3VF4A 1WB9A 1RTHA 5AZJA 3VQDA 4DR7K 4CEDA 1IBKK 4JI4K 3Q7BA 4N76A 4Z4GA 3CQ8A 3K5LA 1GLJO 1W9HA 3MWTA 1VQ6N 4A57A 4BR4A 3P39A 4GV6A 2P5GA 3RSEB 4C1NI 1N5YA 4L3QA 4Y1DA 5BRDA 4ZHRA 1C0UA 2A6AA 4MQ3A 4EFHA 3O4WA 3OYJA 2A5XA 3SQ2A 3AVKA 4F2SA 4LF8K 1S9EA 1YTAA 3U6FA 1TYQA 3W3DA 3P1GA 5M1QA 4B1VA 4BC5A 3OTOK 2QW9A 3CCEN 3U4LA 4FWLA 1OH8A 5HLFA 4YDUA 4XH5A 2F8TA 1YI2N 2VCPA 3KK7A 1GOAA 1WSJA 3HM8A 1S1UA 4PQUA 4HCBA 4DMNA 4CZMA 1Q82O 3LDSA 2OTLN 1SUQA 3RMBA 4C8NA 3I8BA 1J9AA 3O80A 4GMJB 3C6UA
chains in the Genus database with same CATH topology
3SK3A 3KHYA 4JKDA 3E9OA 3CERA 1HLUA 4H5TA 3O9TA 1MDUB 1QZ5A 3G71N 1EO1A 4LC9B 5E26A 1VQ5N 2NLXA 2D0OA 3LDNA 5AQGA 1MA9B 2Q1NA 4IEEA 3OHRA 3WXMB 3H46O 3LM9A 4XH1A 3SAFA 2FLOA 3FZMA 4A2BA 5JVGL 1NGDA 3ZX3A 3O9RA 3VENA 2HBMA 2E1ZA 3M5RA 5DM6L 3EN9A 5F1XA 1VQ8N 1NMDA 4CD1A 4F9OA 3G4SN 1QVFM 3R1XA 3M6GA 3D2FA 1QQOA 4JK9A 2YX6A 4RCHA 4JKBA 5GAEP 5C15A 4J8FA 3A0IX 3TSUA 1VQ7N 3EKSA 3C6HA 3VGLA 3CI5A 3OA9A 5GIPA 4NLBA 4XH4A 1GLAG 3SLCA 1ZC6A 1O13A 1SZ2A 3H1VX 3LL3A 4CD3A 4EIAA 3QFPA 1ZBSA 3O1WA 2IVOA 2QWMA 4YORA 2GWJA 3HRGA 4IEIA 4BG8A 1SAZA 2WFBA 3SMSA 1Z05A 2QWRA 2PAVA 5C2FA 3CJCA 4QS7A 4FL9A 3FZLA 5EOYA 2FSNA 4CBWA 5ADXA 4U7BA 2A42A 5BN8A 3CCVN 1X3MA 2GEMA 2W40A 3PLAA 4JKGB 4FWOA 1K73O 5LY3A 1YUWA 3ENOA 3BF1A 4JD2A 2PBDA 5M1KA 5AQJA 4CZGA 3I33A 2VGNA 2VGMA 3ID6A 5E84A 1BUPA 4DB3A 4ISGA 2QWOA 4BGBA 4NLCA 4WFBL 4B1XB 4XJXA 2C1IA 1T6DA 2D1KA 3VESA 2YCHA 1DT9A 1SS6A 5DM7L 2OTJN 4CZJA 5JLHA 1RDWX 3DXKA 3E66A 4FWKA 3ATVA 4CZFA 4KBOA 3HOSA 3H1QA 1H1VA 3D7EO 4BR2A 4CBXA 3DXMB 4BRMA 3CCLN 3H45C 4FO0A 4WYBA 4CJ7A 1YJ9N 5GIOA 4RTFD 1KQSM 3H6EA 2ITMA 3CJAA 1Q81O 4R79A 2V51B 2YI1A 4BVPA 3AARA 1Z6RA 3TTFA 4JHDB 1U2VB 3PIOL 1RGIA 2P9KB 3MMVA 4BGAA 5BPNA 2NRTA 5AZIB 3W0LA 1V4TA 2P9SA 2NNWA 1W2BM 2QWQA 3SAHA 4JEPA 1JJ2M 3G6EN 1VQ9N 1NGFA 4JKHA 4OO1J 1VQMN 3CD6N 1BA0A 2E2QA 2VWBA 3ZEUA 1HPMA 4B9QA 5CE3A 5I9EB 3TTCA 2YHYA 1YITN 2FSKA 3OW2M 3CCJN 3T7ZA 1P8ZA 1HUXA 3KWGA 3MK6A 3SMPA 3ID8A 3VEVA 5B8HA 1HX1A 3A8YA 3QB0A 1GLFO 5F2RA 2QA4N 1D4XA 1NGJA 2AA4A 2YJEA 3GDQA 4MO5A 4BQZA 5M1NA 3DLLL 2P9LB 3MN5A 2E20A 3L4QA 2RHKA 2QEXN 1BOTO 3LDPA 3E9LA 2HBKA 4FWQA 2ASPA 4ISEA 3ZX2A 3B8AX 3E9PA 5ADXH 2CH5A 3A5NC 5AFUH 4K43A 3CHWA 5AR0A 1HKGA 1ESVA 4ILJA 3J8AA 4H5VA 4ISFA 2E1YA 3GG4A 4H0XB 4B1YB 1BWFO 1QZ6A 4IO9L 3WXIA 3CPWM 1K8KA 2E8AA 3R3LA 1GLDG 2KLAA 2P9UB 5AQFA 3CCRN 4A5AA 5AZJB 2V7YA 3AGRA 5AQQA 3VGMA 3C0BA 4KH4A 3F9MA 3O9SA 4BRFA 3DWLA 3CC7N 2ZJQL 2WBNA 3VTHA 1VQON 3M1FA 4UY8O 1NBWA 4H5RA 2ASMA 4H0TB 1HKBA 2V7ZA 4H5NA 4DCHA 1K8AO 1S3XA 3EE9A 1M90O 3UB5A 5TKYA 1JCEA 3R9PA 3O6WA 5AQPA 3LDLA 3F5TA 4IDHA 3DAWA 3LDQA 4WFAL 4GVEA 1EQYA 3C7NA 5TKWA 2NRWA 4BR7A 2HF3A 1VQKN 4IO8A 1BDGA 3MX5A 5AQXA 5JMVA 4PL7A 3HTVA 4WQ4A 4BR5A 1QHAA 4XEIA 1LOTB 4MLEA 2P9IB 3VETA 4A5BA 4DHYA 4M7YA 4MDAA 4B1ZA 1NGGA 3U8XA 4BR9A 4JN4A 3VPZA 4B1UB 5FPMA 4C1NK 3BUZB 4O8KA 1NLVA 1TYQB 3VEYA 4YOUA 4YOTA 3WEEB 2A40A 5LJWA 2QTDA 3ATUA 3TU5A 3TTDA 4A61A 2GTDA 4BRAA 4BE7B 3WQUA 4IOCL 3CC2N 3GE1A 5EVZA 1XQSC 1YJWN 5AQUA 2CGLA 4BRKA 3CMEN 3HBTA 5AQTA 4CI6A 1ILYA 4FSVA 5AQSA 3CXCM 2QWNA 2A41A 4IJNA 5KQDA 4K41A 4I6MA 4H0VB 5CHIA 3SBGA 1S72N 3VEZA 1YAGA 2P9KA 4BEBA 3HSCA 2YHXA 5FPEA 4DKWA 3CQYA 2FF6A 1NGAA 3R8EA 1V4SA 1RDUA 4K25A 3QMLA 3ZETB 3WT0A 3RSEA 5H1SQ 2EWSA 3L0QA 5HOOA 4BY9C 3H3OB 1JCFA 5ELZA 3UKUB 1ATRA 2KHOA 3CJBA 5C12A 1NGCA 4RWTA 2GELA 3KWIA 1QVGM 3K9KA 3EKUA 3KZBA 1GLEG 3O8MA 4FWRA 1E4GT 1WUAA 2HF4A 3N4PA 1OKJA 3Q7CA 5BPMA 4HTLA 1KAYA 4IJAA 5FPNA 2QI2A 1ATNA 3NMUA 2ZGYA 2ZJRL 4A59A 2J4RA 3D2FB 3I55N 4CBUA 2DPNA 2NRVA 4BRGA 3G25A 4YOVA 2Q2RA 4CZHA 2PFUA 4O5FA 3MX2A 4BRCA 1VQLN 4WF9L 4WQ5C 5AQRA 4ILHA 4PHTX 2Q0RA 1VQ4N 2FF3B 3D6RA 3FLCO 3TPQA 4AM7A 4KH5A 4CZIA 1TUYA 4FPBA 4YDUC 2RE2A 3KVGA 4IFEA 3AAPA 2HMPA 4JKFA 4BRHA 4IWVA 1G99A 2D0PA 3QBWA 4A2AA 5AQHA 2YJFA 2IVNA 4GY2B 4AF1A 5M1FA 3J7ZO 2E88A 5LJVA 2CGKA 4GV9A 4YOYA 3DJCA 5AQVA 1YJNN 3ENBA 2ZF5O 4FWMA 1M1KO 2ZWHA 4ILGB 1C0GA 3IMXA 2JWKA 2JWLA 4IXCA 3A5OC 3JS6A 4IOXA 4QS9A 5KPZA 2V52B 1RFQA 3VERA 4M7XA 1HKCA 1U6ZA 3AGKA 1IG8A 3VMFB 3WXJA 3NVKA 4M63C 4YOWA 1SQKA 3AY9A 5MLCQ 3C65A 3O1BA 3ZX0A 3ZYYX 3RVCA 2W41A 3WQTA 4OPHA 4BRPA 5GAGP 5AQOA 1YIJN 1R59O 3FGUA 1QQNA 3OBWA 3I56N 2HBJA 2NRHA 2P9IA 3TSQA 4DQ8A 1E4FT 5GAHP 1CZAN 3ULEB 5BRFA 4BROA 1VQNN 2Q31A 3BEXA 3MDQA 4IOAL 3CCUN 3FE1A 4PKIA 3SBTA 3GL1A 3E1YA 2E2OA 4E1JA 1LCUA 4FWPA 3TSPA 3UKRB 2NZTA 4GV3A 4BC3A 2E2PA 2GUPA 2P9PB 2P9NB 2P9SB 4PKGA 3K9JA 4H0PA 3IUCA 3N4QA 4GNIA 5JVHL 5AQIA 1GLLO 3CETA 4BG9A 3H3NO 1GLBG 3ZEUB 3A5MC 4K42A 5CR4A 2QM1A 3MN9A 4MDBA 1T6CA 1KAZA 4B1WB 4JKGA 1DEJA 1QQMA 2E2NA 4FWNA 4CZKA 4PL8A 2F7TA 3CF5L 4H0OA 2BTFA 3CJ9A 1Y64A 1X9JA 3QICA 1TUUA 1KC8O 2CH6A 3VF2A 3ZETA 3CIPA 2VYPA 5M1OA 2BUPA 2FXUA 3P4IA 3VF6A 4WCEL 3UKUA 3IFRA 3CJ7A 3L6QA 3VGKA 3D2EB 5JICA 2C1GA 4FWSA 4HWIA 3VTIA 2YHWA 4H5WA 5BRHA 2F9TA 5AQNA 3FZHA 1NM1A 2I7PA 4G9ZA 3CCMN 1KAXA 1S22A 3DXMA 4JKCA 3ENHA 4JK7A 1VQPN 1DKGD 3R6MA 2ASOA 4KH6A 4BRIA 3IKMA 3FR0A 3MCAB 3CJ1A 1K8KB 4BR0A 2Q0UA 1C0FA 3EO3A 3EE8A 3T69A 2QWPA 4JHDA 4JAXA 1U2VA 1VAZA 5EXWA 4H0YB 1T3VA 5AZIA 5BN9A 3P31A 1YHQN 5C2DA 5EX5A 3QDKA 2H3GX 4YOXA 3A5LC 3HZ6A 1IJJA 2ZGZA 4FVUA 4C23A 3NVMA 3OBYA 3O5BA 3MCPA 3FFKB 3LDOA 1W97L 2F9WA 2HBLA 4QS8A 3VEWA 4BRQA 3WUHA 4FPAA 1N8RO 1NGEA 1WOQA 3MN7A 1Q86O 2GX9A 4MO4A 4FOIA 1BA1A 2HOEA 5KQ8A 1GLCG 3QFUA 4WFNL 3MN6A 5C0YA 1NGIA 4BC2A 2P9LA 1XC3A 5AFUA 4BC4A 3CQXA 2QXLA 3C7NB 3QBXA 3WXLA 3GOIA 2FSJA 4A62A 5AQLA 3CC4N 5BREA 5AQZA 4BREA 5AQMA 4BRDA 2HSTA 4Z94A 5C10A 4Y0WA 2UYTA 2CGJA 1KXPA 4BRLA 5AQKA 3EL2A 1KD1O 2KKZA 1ZXOA 5AQWA 2OANA 1P90A 3L4IA 2NRXA 5BR9A 1MWMA 2Q97A 3O08A 3M3ZA 4EHUA 2IVPA 3VOVA 2Q36A 3C6AA 1BO5O 2P9UA 3HI0A 3VF4A 4BVOA 1NJIO 1X3NA 3VEOA 5AZJA 1BG3A 3F2KA 2GWKA 3ULEA 5GINA 2W00A 4MLHA 4JNEA 2NRRA 1YF5L 4H03B 3IDHA 2ZJPL 4I6MB 3BF3A 1NGHA 5JLFA 3Q7BA 3U9DA 2D4WA 4JKAA 1YVNA 3UKRA 2QWLA 3JXUA 4CZEA 5KPRA 2NRZA 2A3ZA 2P9PA 2P9NA 5BPLA 1GLJO 3VEXA 1Q7YO 1HJOA 1NWKA 3MWTA 3FZFA 3P38A 4IZ9A 2I7NA 4JD2B 4A57A 3GBTA 1JCGA 4BR4A 1VQ6N 3P39A 3HOTA 4GV6A 4NO7A 3FZKA 3RSEB 1DGKN 5GADP 3EZWA 4C1NI 4JK8A 4O8UA 4FOEA 1K9MO 4L3QA 5F0XA 3UE5A 5BRDA 4BECA 5HL7L 5M1PA 3DXKB 3LM2A 3SJHA 2A6AA 3WXKA 4OPAA 4EFHA 1XUPO 3O4WA 1J6ZA 4JKEA 2A5XA 5FPDA 3CPEA 4EHTA 2IIRA 4AM6A 4WQ5A 1BU6O 1TYQA 2BH1A 3BP8A 5M1QA 3W3DA 3WEEA 2WC9A 3O9UA 4B1VA 4BC5A 2QW9A 5EY4A 3CCEN 3U4LA 3D2EA 4CZLA 1NGBA 4WQ4C 2WUSA 4FWLA 4BRNA 3PIPL 3S41A 3MWPA 4YDUA 1YXQA 4XH5A 4NB4A 3CCSN 2VCPA 3KK7A 1YI2N 3CCQN 3HM8A 1T44A 5KPTA 1ATSA 4CZMA 4U67L 4PKHA 3CMAN 1Q82O 3AAQA 4EAHD 2OTLN 3O9QA 3I8BA 1OVYA 3O80A 1MWKA 1Q18A 2AP1A 5AQYA 3U9ZA 4BQLA 3SAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SK3 A;  3KHY A;  3CER A;  1HLU A;  4H5T A;  1MDU B;  1QZ5 A;  4LC9 B;  5E26 A;  2NLX A;  2D0O A;  3LDN A;  5AQG A;  1MA9 B;  2Q1N A;  3OHR A;  3H46 O;  3LM9 A;  4XH1 A;  2FLO A;  3FZM A;  4A2B A;  1NGD A;  3ZX3 A;  3VEN A;  2E1Z A;  3EN9 A;  5F1X A;  1NMD A;  4CD1 A;  4F9O A;  3M6G A;  3D2F A;  1QQO A;  4RCH A;  4J8F A;  3A0I X;  3EKS A;  3VGL A;  3CI5 A;  4XH4 A;  1GLA G;  3SLC A;  1ZC6 A;  3LL3 A;  1SZ2 A;  3H1V X;  4CD3 A;  4EIA A;  3QFP A;  1ZBS A;  3O1W A;  2IVO A;  2QWM A;  2GWJ A;  4BG8 A;  1SAZ A;  3SMS A;  1Z05 A;  2QWR A;  2PAV A;  3CJC A;  4QS7 A;  4FL9 A;  3FZL A;  5EOY A;  2FSN A;  4CBW A;  5ADX A;  2A42 A;  5BN8 A;  1X3M A;  2GEM A;  2W40 A;  4FWO A;  5LY3 A;  1YUW A;  3ENO A;  3BF1 A;  4JD2 A;  2PBD A;  5AQJ A;  4CZG A;  3I33 A;  5E84 A;  1BUP A;  4DB3 A;  4ISG A;  2QWO A;  4BGB A;  4B1X B;  1T6D A;  2D1K A;  3VES A;  2YCH A;  4CZJ A;  5JLH A;  1RDW X;  3DXK A;  4FWK A;  3ATV A;  4CZF A;  4KBO A;  3H1Q A;  1H1V A;  3D7E O;  4BR2 A;  4CBX A;  3DXM B;  4BRM A;  3H45 C;  4FO0 A;  4WYB A;  4CJ7 A;  4RTF D;  3H6E A;  2ITM A;  3CJA A;  2V51 B;  2YI1 A;  4BVP A;  3AAR A;  1Z6R A;  4JHD B;  1U2V B;  1RGI A;  2P9K B;  3MMV A;  4BGA A;  5BPN A;  5AZI B;  3W0L A;  1V4T A;  2P9S A;  2QWQ A;  1NGF A;  1BA0 A;  2E2Q A;  2VWB A;  3ZEU A;  1HPM A;  4B9Q A;  5CE3 A;  5I9E B;  2YHY A;  2FSK A;  1P8Z A;  1HUX A;  3MK6 A;  3SMP A;  3VEV A;  3ID8 A;  5B8H A;  1HX1 A;  3A8Y A;  3QB0 A;  1GLF O;  5F2R A;  1D4X A;  1NGJ A;  2AA4 A;  2YJE A;  3GDQ A;  4MO5 A;  4BQZ A;  2P9L B;  3MN5 A;  2E20 A;  1BOT O;  3LDP A;  4ISE A;  3ZX2 A;  4FWQ A;  2ASP A;  3B8A X;  5ADX H;  2CH5 A;  3A5N C;  5AFU H;  4K43 A;  3CHW A;  5AR0 A;  1HKG A;  1ESV A;  3J8A A;  4H5V A;  4ISF A;  2E1Y A;  3GG4 A;  4H0X B;  4B1Y B;  1BWF O;  1QZ6 A;  3WXI A;  1K8K A;  2E8A A;  1GLD G;  2P9U B;  5AQF A;  5AZJ B;  2V7Y A;  5AQQ A;  3VGM A;  3C0B A;  3F9M A;  4BRF A;  3DWL A;  3M1F A;  1NBW A;  4H5R A;  2ASM A;  4H0T B;  1HKB A;  2V7Z A;  4H5N A;  4DCH A;  1S3X A;  3UB5 A;  5TKY A;  1JCE A;  3R9P A;  3O6W A;  5AQP A;  3LDL A;  3DAW A;  3LDQ A;  1EQY A;  3C7N A;  4BR7 A;  2HF3 A;  4IO8 A;  1BDG A;  5AQX A;  5JMV A;  4PL7 A;  3HTV A;  4WQ4 A;  4BR5 A;  1QHA A;  4XEI A;  1LOT B;  4MLE A;  2P9I B;  3VET A;  4DHY A;  4M7Y A;  4B1Z A;  1NGG A;  3U8X A;  4BR9 A;  4JN4 A;  3VPZ A;  4B1U B;  5FPM A;  3BUZ B;  4O8K A;  1NLV A;  1TYQ B;  3VEY A;  3WEE B;  2A40 A;  5LJW A;  3ATU A;  3TU5 A;  4A61 A;  2GTD A;  4BRA A;  3WQU A;  3GE1 A;  5EVZ A;  1XQS C;  5AQU A;  2CGL A;  4BRK A;  3HBT A;  5AQT A;  4CI6 A;  4FSV A;  5AQS A;  2QWN A;  2A41 A;  4IJN A;  5KQD A;  4K41 A;  4I6M A;  4H0V B;  3VEZ A;  1YAG A;  2P9K A;  3HSC A;  2YHX A;  5FPE A;  3CQY A;  2FF6 A;  1NGA A;  3R8E A;  1V4S A;  4K25 A;  3QML A;  3ZET B;  3WT0 A;  3RSE A;  2EWS A;  3L0Q A;  3H3O B;  1JCF A;  5ELZ A;  3UKU B;  1ATR A;  2KHO A;  3CJB A;  1NGC A;  4RWT A;  2GEL A;  3EKU A;  3KZB A;  1GLE G;  3O8M A;  4FWR A;  1E4G T;  1WUA A;  2HF4 A;  5BPM A;  1OKJ A;  4HTL A;  1KAY A;  4IJA A;  5FPN A;  1ATN A;  2ZGY A;  2J4R A;  3D2F B;  4CBU A;  2DPN A;  4BRG A;  3G25 A;  2Q2R A;  4CZH A;  4O5F A;  4BRC A;  4WQ5 C;  5AQR A;  2Q0R A;  2FF3 B;  3FLC O;  3TPQ A;  4AM7 A;  4CZI A;  1TUY A;  4FPB A;  4YDU C;  3KVG A;  3AAP A;  2HMP A;  4BRH A;  4IWV A;  1G99 A;  2D0P A;  3QBW A;  4A2A A;  5AQH A;  2YJF A;  2IVN A;  4GY2 B;  2E88 A;  5LJV A;  2CGK A;  3DJC A;  5AQV A;  2ZF5 O;  4FWM A;  2ZWH A;  1C0G A;  3IMX A;  4IXC A;  3A5O C;  3JS6 A;  4QS9 A;  5KPZ A;  2V52 B;  1RFQ A;  3VER A;  4M7X A;  1HKC A;  1U6Z A;  1IG8 A;  3WXJ A;  4M63 C;  1SQK A;  3AY9 A;  3O1B A;  3ZX0 A;  2W41 A;  3WQT A;  4BRP A;  5AQO A;  1R59 O;  3FGU A;  1QQN A;  2P9I A;  2NRH A;  4DQ8 A;  1E4F T;  1CZA N;  3ULE B;  5BRF A;  4BRO A;  2Q31 A;  3BEX A;  3MDQ A;  3FE1 A;  4PKI A;  3GL1 A;  2E2O A;  4E1J A;  1LCU A;  4FWP A;  3UKR B;  2NZT A;  4BC3 A;  2E2P A;  2GUP A;  2P9P B;  2P9N B;  2P9S B;  4PKG A;  4H0P A;  3IUC A;  4GNI A;  5AQI A;  1GLL O;  3CET A;  4BG9 A;  3H3N O;  1GLB G;  3ZEU B;  3A5M C;  4K42 A;  2QM1 A;  3MN9 A;  1T6C A;  1KAZ A;  4B1W B;  1DEJ A;  1QQM A;  2E2N A;  4FWN A;  4CZK A;  4PL8 A;  4H0O A;  2BTF A;  3CJ9 A;  1Y64 A;  1X9J A;  3QIC A;  1TUU A;  2CH6 A;  3VF2 A;  3ZET A;  3CIP A;  2VYP A;  2BUP A;  2FXU A;  3P4I A;  3VF6 A;  3UKU A;  3IFR A;  3CJ7 A;  3L6Q A;  3VGK A;  3D2E B;  5JIC A;  4FWS A;  4HWI A;  5BRH A;  2YHW A;  4H5W A;  2F9T A;  5AQN A;  3FZH A;  1NM1 A;  2I7P A;  1KAX A;  1S22 A;  3DXM A;  3ENH A;  1DKG D;  3R6M A;  2ASO A;  4BRI A;  3FR0 A;  3CJ1 A;  1K8K B;  4BR0 A;  2Q0U A;  1C0F A;  3EO3 A;  2QWP A;  4JHD A;  4JAX A;  1U2V A;  5EXW A;  4H0Y B;  5BN9 A;  5AZI A;  5EX5 A;  3QDK A;  2H3G X;  3A5L C;  3HZ6 A;  1IJJ A;  2ZGZ A;  4C23 A;  3O5B A;  3MCP A;  3FFK B;  3LDO A;  2F9W A;  4QS8 A;  3VEW A;  4BRQ A;  3WUH A;  4FPA A;  1NGE A;  1WOQ A;  3MN7 A;  4MO4 A;  4FOI A;  1BA1 A;  2HOE A;  5KQ8 A;  1GLC G;  3QFU A;  3MN6 A;  1NGI A;  4BC2 A;  2P9L A;  1XC3 A;  5AFU A;  4BC4 A;  3CQX A;  2QXL A;  3C7N B;  3QBX A;  3WXL A;  3GOI A;  2FSJ A;  4A62 A;  5AQL A;  5BRE A;  5AQZ A;  4BRE A;  5AQM A;  4BRD A;  4Z94 A;  4Y0W A;  2UYT A;  2CGJ A;  1KXP A;  4BRL A;  5AQK A;  3EL2 A;  1ZXO A;  5AQW A;  2OAN A;  3L4I A;  5BR9 A;  1MWM A;  2Q97 A;  3O08 A;  3M3Z A;  4EHU A;  2IVP A;  3VOV A;  2Q36 A;  1BO5 O;  2P9U A;  3HI0 A;  3VF4 A;  4BVO A;  1X3N A;  3VEO A;  5AZJ A;  1BG3 A;  2GWK A;  3ULE A;  4MLH A;  4JNE A;  4H03 B;  3IDH A;  4I6M B;  3BF3 A;  1NGH A;  5JLF A;  3U9D A;  2D4W A;  5KPR A;  1YVN A;  3UKR A;  2QWL A;  3JXU A;  4CZE A;  2A3Z A;  2P9P A;  2P9N A;  5BPL A;  1GLJ O;  3VEX A;  1HJO A;  1NWK A;  4IZ9 A;  3FZF A;  4JD2 B;  2I7N A;  3GBT A;  1JCG A;  4BR4 A;  4NO7 A;  3FZK A;  3RSE B;  1DGK N;  3EZW A;  4FOE A;  4L3Q A;  5F0X A;  3UE5 A;  5BRD A;  3DXK B;  3LM2 A;  3SJH A;  2A6A A;  3WXK A;  4EFH A;  1XUP O;  3O4W A;  1J6Z A;  2A5X A;  5FPD A;  4EHT A;  2IIR A;  4AM6 A;  4WQ5 A;  1BU6 O;  1TYQ A;  3BP8 A;  3W3D A;  4B1V A;  4BC5 A;  3WEE A;  2QW9 A;  5EY4 A;  3U4L A;  3D2E A;  4CZL A;  1NGB A;  4WQ4 C;  2WUS A;  4FWL A;  4BRN A;  3S41 A;  4YDU A;  1YXQ A;  4XH5 A;  4NB4 A;  2VCP A;  3HM8 A;  1T44 A;  5KPT A;  1ATS A;  4CZM A;  4PKH A;  3AAQ A;  4EAH D;  3I8B A;  3O80 A;  1MWK A;  1Q18 A;  2AP1 A;  5AQY A;  3U9Z A;  4BQL A; 
#chains in the Genus database with same CATH topology
 4EZ9 A;  4DR2 K;  3WNG A;  3AV9 A;  2G8F A;  3O9T A;  3OYF A;  1C1B A;  3MED A;  4F2R A;  3M8P A;  3IG1 A;  1EO1 A;  2UUA K;  3VN5 A;  4H4M A;  1MA9 B;  2Q1N A;  4IEE A;  3NF8 A;  3VA3 A;  3LM9 A;  4R5P A;  4JI5 K;  3SAF A;  5EU7 A;  1RDA A;  4A2B A;  3ZX3 A;  3OYE A;  2P5O A;  1EKE A;  1NMD A;  3AVM A;  3G4S N;  3ZSZ A;  4JK9 A;  4N5S A;  1BHL A;  1DTT A;  5GAE P;  4OPJ A;  4CFA A;  4B9T A;  4QCL A;  3A0I X;  3TSU A;  3OA9 A;  4CVN E;  1ASV A;  4O0J A;  1GLA G;  3SLC A;  1ZC6 A;  4GKK K;  3EY1 A;  3NH2 A;  4EIA A;  3QFP A;  4JS5 A;  4HVJ A;  1ZBS A;  3O1W A;  3S5T A;  4BG8 A;  3NDK A;  2QWR A;  4FL9 A;  2G8U A;  3OS1 A;  4BDZ A;  5ADX A;  1L3S A;  4U7B A;  4K8Z A;  2GEM A;  4GKJ K;  5IT9 O;  1RBS A;  4DFM A;  2RN2 A;  2PBD A;  5AQJ A;  2UUB K;  2EHG A;  4N47 A;  2VGM A;  3DI6 A;  3RWU A;  4ISG A;  4WFB L;  3U3G A;  4Q0B A;  2YCH A;  4EP4 A;  1SS6 A;  2EX3 A;  1Q9X A;  3ATV A;  3HOS A;  4DQS A;  5CY4 A;  4DQR A;  1NK0 A;  3DXM B;  1YJ9 N;  5GIO A;  2KZZ A;  3PX0 A;  2IAJ A;  3V9X A;  1JLQ A;  1U2V B;  1TL3 A;  2NRT A;  3W0L A;  2NNW A;  1RT1 A;  3LWM A;  3HYF A;  1JJ2 M;  1NGF A;  4CK3 A;  1BA0 A;  1HPM A;  3L2Q A;  5JS2 A;  4KHS A;  3V9U A;  2FSK A;  1P8Z A;  1LWE A;  3KWG A;  3MK6 A;  3ID8 A;  5B8H A;  3A8Y A;  5F2R A;  3CYM A;  1NGJ A;  2AA4 A;  4MO5 A;  1WAJ A;  4FM0 A;  4KHN A;  5CYM A;  1EWR A;  3OY9 A;  3LDP A;  4ISE A;  3ZX2 A;  1S9G A;  5AFU H;  2NUB A;  3CHW A;  1HKG A;  4ILJ A;  4H5V A;  3AVH A;  3DLB A;  4RW8 A;  3T1H K;  4C8M A;  1BWF O;  4IO9 L;  3VQE A;  1K8K A;  3R3L A;  3DYA A;  5KRT A;  3QLH A;  2HHW A;  5AZJ B;  4FM2 A;  1TAQ A;  2ZJQ L;  4UY8 O;  1JLA A;  3M1F A;  3PSI A;  4CJQ A;  1QHT A;  1W0H A;  4CJ5 A;  4FK0 A;  4CJU A;  4JV5 K;  4H0T B;  2V7Z A;  3ALY A;  3UB5 A;  4JS4 A;  1JCE A;  4CEE A;  3OS2 A;  3PV8 A;  3OJS A;  1EQY A;  2NRW A;  3MX5 A;  5AQX A;  4CER A;  5JMV A;  3V1R A;  3I0S A;  3HTV A;  4W5O A;  4BR5 A;  3OJU A;  2XY7 A;  1QHA A;  4Z4F A;  4DHY A;  3NGY A;  2WON A;  1TYQ B;  3VEY A;  5FRO A;  2VG7 A;  1CLQ A;  2XHB A;  4O4G A;  2O8C A;  1CXQ A;  1NK5 A;  1YJW N;  3QIP A;  1KSP A;  1RT2 A;  1QSL A;  5AQS A;  4KRF A;  3AO1 A;  4K41 A;  3SBG A;  4DTM A;  2YHX A;  4DKW A;  2XY8 A;  3CQY A;  3QNN A;  4K25 A;  3QML A;  5H1S Q;  5HOO A;  3L0Q A;  1KFD A;  3H3O B;  1JCF A;  4BDP A;  1HNW K;  3MEE A;  4CF0 A;  4RWT A;  2GEL A;  1QVG M;  4CK2 A;  3O8M A;  1E4G T;  5LMU K;  2HF4 A;  1OKJ A;  1EX4 A;  3OYI A;  3NMU A;  2ZGY A;  2ZJR L;  1NU0 A;  4B3S K;  2NRV A;  4DUZ K;  1NK4 A;  1S1X A;  3DLH A;  4Z0U A;  3MX2 A;  4BRC A;  5J2Q A;  4WQ5 C;  3KJV A;  3FLC O;  4AM7 A;  2A1R A;  2D0C A;  3SUP A;  2D0A A;  1HR0 K;  2PZS A;  2VWK A;  4IFE A;  1FKP A;  4G1Q A;  3V81 A;  2HMP A;  1KVA A;  2D0P A;  4A2A A;  3AA2 A;  4AF1 A;  5M1F A;  1X9M A;  3O3G A;  2YHB A;  5AQV A;  4LD0 A;  3ENB A;  4LSL A;  4FWM A;  2G8V A;  1FK9 A;  1C0G A;  4IXC A;  2JWK A;  2IDO A;  1JKH A;  4IOX A;  2V52 B;  1U6Z A;  2VG5 A;  3NVK A;  2IOC A;  3RVC A;  2O8D A;  3WQT A;  4NXM K;  5AQO A;  3VQ6 A;  1YIJ N;  1A5V A;  1N33 K;  1L3V A;  2Z1H A;  1T05 A;  3I56 N;  1JXB A;  4CF1 A;  4JI0 K;  4ELT A;  5GAH P;  4IOA L;  2UUC K;  3CCU N;  3E1Y A;  4E1J A;  3K5N A;  1UOC A;  1LCU A;  3TSP A;  2NZT A;  3AVB A;  4BC3 A;  1CZB A;  2E2P A;  2VQE K;  4PKG A;  4FLV A;  1GLL O;  4DFJ A;  3H3N O;  1SKR A;  3IAY A;  2QM1 A;  3THX A;  2E6L A;  3SYZ A;  1Y64 A;  1X9J A;  3LP1 A;  3QIC A;  3KTQ A;  4J2B A;  3KLI A;  1KC8 O;  3AO3 A;  4DV7 K;  2BUP A;  3MXI A;  3CJ7 A;  3L6Q A;  4E7I A;  5BR8 K;  3VGK A;  1RTJ A;  2C1G A;  4FWS A;  1D9D A;  1NM1 A;  3L2U A;  3CCM N;  3THW A;  1KAX A;  1G15 A;  4JK7 A;  4W5Q A;  3SUQ A;  3R6M A;  3WNH A;  1JLC A;  1E3M A;  3CJ1 A;  1K8K B;  3QIO A;  3EO3 A;  4ID1 A;  1Z25 A;  5AZI A;  3VQC A;  1IBM K;  5C2D A;  1TK0 A;  3AA3 A;  3THY A;  3FFK B;  2HBL A;  4QS8 A;  4CE9 A;  3WUH A;  1XNQ K;  4FPA A;  4JI6 K;  1Q86 O;  3ZSQ A;  3TAB A;  3T19 A;  2AJQ A;  1Y97 A;  5FDL A;  1NGI A;  4FJI A;  2A1S A;  2P9L A;  4DR4 K;  4B8C A;  1HYV A;  5AFU A;  4OPK A;  2E5L K;  2FSJ A;  1HQU A;  4BWJ A;  2O8E A;  2B6A A;  4BRE A;  3IS9 A;  2HMI A;  1EP4 A;  4BRD A;  5C10 A;  4OGE A;  5CYQ A;  3PX6 A;  3ZLJ A;  4DSI A;  2UYT A;  4CEO A;  3NF6 A;  1TVR A;  4I2P A;  2KKZ A;  1ZXO A;  3SPZ A;  1P90 A;  4JRP A;  3SUN A;  3AVA A;  4DV6 K;  2IVP A;  3HP9 A;  1D5A A;  4L8R B;  3F2K A;  2GWK A;  4CHQ A;  2W00 A;  2NRR A;  3PO5 A;  2ZJP L;  2Q3S A;  5JLF A;  3U9D A;  4JKA A;  5KPR A;  3UKR A;  4CZE A;  3AVJ A;  2P9P A;  1N32 K;  3RMD A;  4JD2 B;  4IZ9 A;  3P38 A;  3TAG A;  3HOT A;  4NO7 A;  3NFA A;  4CEA A;  1DGK N;  4KO0 A;  4JK8 A;  4FOE A;  1K9M O;  4YHH K;  4KTZ A;  3UE5 A;  5HL7 L;  3DXK B;  4DTP A;  1XUP O;  1ITG A;  3O3H A;  5FPD A;  1GOC A;  3CPE A;  2G8K A;  2PYL A;  1JXE A;  3SNN A;  2GBZ A;  2Y1I A;  1BU6 O;  2O8F B;  2WC9 A;  4CZL A;  3D2E A;  2X6S A;  3SCX A;  4WQ4 C;  4BRN A;  1Q8I A;  3P83 D;  3S41 A;  3MWP A;  3EYZ A;  1YXQ A;  3CCQ N;  4DSK A;  1T44 A;  1ATS A;  2OPP A;  4Q5V A;  1KTQ A;  1U45 A;  4GW6 A;  2W6K A;  3O9Q A;  4KHW A;  5AQY A;  3U9Z A;  4BQL A;  3SAG A;  3NBP A;  4DSJ A;  4FYD A;  3S3M A;  1XHX A;  3S9H A;  1HLU A;  2UXC K;  1NNE A;  4AIL C;  3KK2 A;  2XY5 A;  1QZ5 A;  4LC9 B;  3J81 O;  2NLX A;  4DU3 A;  3S3N A;  4O0I A;  3OHR A;  3M8Q A;  4CHO A;  1VSH A;  3H46 O;  3E01 A;  3L2W A;  5JVG L;  3O9R A;  4E89 A;  3VEN A;  2E1Z A;  4FJH A;  2O8D B;  3BDP A;  3VQ9 A;  4IFY A;  1VQ8 N;  4F9O A;  4RCH A;  3AA5 X;  4JKB A;  1VRT A;  4J8F A;  3EKS A;  3VGL A;  1IKX A;  2OPQ A;  5HRP A;  1LAV A;  4CD3 A;  4C8O A;  2YNF A;  2IVO A;  4YOR A;  3C95 A;  2YNI A;  3HRG A;  4IEI A;  3PY8 A;  2WFB A;  1Z05 A;  4QS7 A;  2KW4 A;  2QKB A;  4CBW A;  4J2D A;  2A42 A;  3ZSV A;  3CCV N;  3TWH A;  4FWO A;  1K73 O;  2I5J A;  1YUW A;  3NF9 A;  3ENO A;  4IDK A;  4X66 K;  1NKB A;  3NAE A;  3QO9 A;  4DB3 A;  2QWO A;  4NLC A;  4B1X B;  1T6D A;  2D1K A;  3AO5 A;  4DQI A;  2OTJ N;  3RR8 A;  1QE1 A;  3O4N A;  5JLH A;  4KHY A;  4FWK A;  4AH9 A;  4CZF A;  4CW7 B;  4BR2 A;  3HPO A;  3THW B;  3HVR A;  4BRM A;  3CCL N;  4FO0 A;  4K0K K;  1Q81 O;  2Y1J A;  4E1M A;  2YI1 A;  4B08 A;  3TAN A;  4E19 A;  4OJR A;  3AAR A;  3OYA A;  4FJJ A;  3AVF A;  4BGA A;  3KD1 E;  5AZI B;  1V4T A;  3HK2 A;  3ITH A;  3SAH A;  3C94 A;  1YT3 A;  4OO1 J;  1VQM N;  2E2Q A;  4M3X A;  4XIU A;  4B9Q A;  4CGF A;  1RDB A;  3OW2 M;  4CHZ A;  1IH7 A;  4W5R A;  2DTU A;  5HRR A;  1XHZ A;  2YJE A;  4CJW A;  2P9L B;  3CFR A;  2E20 A;  3L4Q A;  1U47 A;  1L3U A;  4BAC A;  2HBK A;  2ASP A;  3E9P A;  3O4Q A;  5J1E A;  1ESV A;  2FC0 A;  4ISF A;  4F3O A;  3GG4 A;  4FW2 A;  4H0X B;  1QZ6 A;  4FZX C;  3I0R A;  4DSF A;  3ISN C;  4A5A A;  3VGM A;  4I2Q A;  2WBN A;  5I42 A;  3OYM A;  4H5R A;  3PX4 A;  4K8X A;  2ASM A;  4DCH A;  1K8A O;  3HP6 A;  1M90 O;  4DR6 K;  4O44 A;  3O6W A;  4EP5 A;  3JAM O;  3AVC A;  3F5T A;  3DAW A;  3LDQ A;  4WFA L;  1XMQ K;  1RDC A;  4I9Q A;  2HF3 A;  4RW4 A;  4IO8 A;  4PL7 A;  4ZTF A;  1EWQ A;  4XEI A;  2P9I B;  4M7Y A;  3U8X A;  5FPM A;  3BUZ B;  4YOU A;  5LJW A;  2QTD A;  3ATU A;  4QOZ B;  3TTD A;  1BI4 A;  2O4I A;  2GTD A;  4KRE A;  3DOK A;  1FW6 A;  3WQU A;  4LF5 K;  5EVZ A;  4X62 K;  2CGL A;  4BRK A;  3CME N;  3K57 A;  1ILY A;  4CI6 A;  4M45 A;  1N36 K;  5KQD A;  1WLJ A;  4I6M A;  5CHI A;  3VEZ A;  1YAG A;  2P9K A;  5FPE A;  1UA1 A;  2FF6 A;  4DV5 K;  1MU2 A;  1ZBH A;  3OYD A;  3CG7 A;  4BY9 C;  4AHC A;  4LFC K;  5D3G A;  1UA0 A;  3UKU B;  3CJB A;  4OKJ A;  4DG1 A;  3LP0 A;  5C12 A;  2PY5 A;  1NGC A;  1S1T A;  1OVQ A;  3KZB A;  1GLE G;  4M3W A;  3VQ7 A;  1WSH A;  1ZBL A;  1WSG A;  1KAY A;  4DLG A;  2QI2 A;  1RTD A;  4CBU A;  4Z4C A;  4CEB A;  4YOV A;  4LH4 A;  2Q2R A;  4CZH A;  4WF9 L;  3HJF A;  4H8K A;  3D6R A;  5C42 A;  2G8I A;  4Z4H A;  4FPB A;  4B9U A;  3MXJ A;  4GVM A;  3SZ2 A;  4BRH A;  1JLB A;  1G99 A;  4KB0 A;  2IVN A;  3B6P A;  4GV9 A;  4YOY A;  2OPR A;  3DJC A;  4X65 K;  1TKZ A;  2ZF5 O;  2JWL A;  4PA1 A;  5KPZ A;  3TAP A;  4CJS A;  3RRG A;  1HKC A;  3AGK A;  3SJJ A;  1IG8 A;  1FJG K;  1VRU A;  5MLC Q;  4DV0 K;  2ETJ A;  2GUI A;  3BY5 A;  1KVC A;  1R59 O;  3OBW A;  1I39 A;  2NRH A;  1E4F T;  4BRO A;  4DFP A;  4F4K A;  3BEX A;  3V9S A;  4PKI A;  4FJ9 A;  4ID5 A;  4GV3 A;  5SZT A;  1JL1 A;  3K9J A;  4H0P A;  4CJR A;  4KAZ A;  3N4Q A;  4M3Y A;  2QK9 A;  2P51 A;  3A5M C;  1J54 A;  5DMR A;  3MN9 A;  1T6C A;  3ZSY A;  3CF5 L;  1QQM A;  2E2N A;  4FWN A;  4PL8 A;  2F7T A;  4KI6 A;  1I3A A;  2CH6 A;  3ZET A;  3CIP A;  5M1O A;  4B3R K;  3P4I A;  4WCE L;  3ZSO A;  3NF7 A;  3RMA A;  3KKR A;  4HWI A;  1KRP A;  2F9T A;  5AQN A;  2I7P A;  3K58 A;  2BAN A;  3NHG A;  3ENH A;  1WSI A;  1ZBF A;  2WTU A;  4RG8 A;  1NMN A;  3MAQ A;  1HYZ A;  4CEZ A;  3SUO A;  2Q0U A;  1Z26 A;  2QWP A;  2P1J A;  5EXW A;  4YOX A;  3QDK A;  3A5L C;  4E72 A;  4FCY A;  1RT4 A;  2KTQ A;  3KIO A;  3NVM A;  2HHT A;  3OBY A;  4E7H A;  4B3T K;  2FBT A;  3LDO A;  3ZT4 A;  1NGE A;  1WOQ A;  2F8S A;  2GX9 A;  4MO4 A;  2HOE A;  5KQ8 A;  1YVU A;  1KLN A;  1QSY A;  4WFN L;  4CHP A;  4B3O A;  3HM9 A;  2PYJ A;  4BC2 A;  4IG3 A;  1XC3 A;  3CQX A;  2QXL A;  3QBX A;  1ZBI A;  4NCG A;  1NK6 A;  4LFA K;  3CC4 N;  4O5B A;  4DV3 K;  1N34 K;  1S1V A;  2HST A;  4CFC A;  1RNH A;  2E6M A;  1KXP A;  1TV6 A;  3C6T A;  5AQK A;  3ASM A;  1RT3 A;  1KD1 O;  5I3U A;  3L4I A;  2HVH A;  5BR9 A;  1MWM A;  3MEG A;  3O08 A;  3M3Z A;  3VOV A;  5KGW A;  2P9U A;  4JYA K;  4OX9 K;  1NJI O;  1X3N A;  4ICL A;  3VEO A;  1BG3 A;  4PUO A;  3ULE A;  5GIN A;  1CZ9 A;  1YF5 L;  3IDH A;  2LSN A;  4I6M B;  3SV4 A;  4DV1 K;  2D4W A;  1YVN A;  3JXU A;  2P9N A;  2R7Y A;  3VEX A;  4E7K A;  1NKE A;  1HJO A;  3FZF A;  4CGJ A;  1WNS A;  4M3R A;  1SV5 A;  1XMO K;  3FZK A;  1NOY A;  3QER A;  3ZSR A;  4AHU A;  4FZY A;  5F0X A;  4BEC A;  4BE0 A;  3SJH A;  3WXK A;  1J6Z A;  4JKE A;  1EET A;  3NH1 A;  1WBD A;  1WBB A;  1TGO A;  4WQ5 A;  5EY4 A;  1J5E K;  2WUS A;  3PIP L;  3CCS N;  4NB4 A;  3TAR A;  3QIN A;  1D9F A;  1TKD A;  2G8H A;  4B9S A;  1X9S A;  5KPT A;  4C8K A;  1NK9 A;  1IV0 A;  3CMA N;  2ITG A;  3AAQ A;  4EAH D;  2XY6 A;  1SL1 A;  3TPQ A;  4DF8 A;  3SK3 A;  2HHH K;  2HHI A;  3LAM A;  4DTR A;  4H5T A;  1WAF A;  4CJP A;  1MDU B;  4YNQ A;  1X9W A;  3KLE A;  3G71 N;  3L8B A;  1VQ5 N;  2D0O A;  4CES A;  1QS4 A;  2IGI A;  3AVG A;  1L3T A;  1RT7 A;  2O4G A;  4I7F A;  5A2Q O;  5T7B A;  2FLO A;  4JI2 K;  3V6D A;  1NGD A;  2HBM A;  1WN7 A;  5DM6 L;  5F1X A;  1QVF M;  4FLW A;  1IKV A;  4M3Z A;  1C1A A;  3C6H A;  4CF9 A;  1SZ2 A;  3OYN A;  3RMC A;  2F4V K;  2QWM A;  3K59 A;  2O8B A;  5CZ1 A;  1IKW A;  1SAZ A;  3SMS A;  5C2F A;  5EOY A;  2FSN A;  1FXX A;  5BN8 A;  3NE6 A;  1X3M A;  1IO2 A;  2W40 A;  3PLA A;  4PY5 A;  3AVI A;  5LY3 A;  3BF1 A;  4V19 S;  3I33 A;  3LAN A;  3F9K A;  5E84 A;  4O55 A;  1QSS A;  2C1I A;  2JLE A;  1DT9 A;  5DM7 L;  4B8A B;  4CZJ A;  1RDW X;  4KBO A;  3H1Q A;  2HHQ A;  2O8C B;  3H45 C;  4WYB A;  2D5R A;  4DTJ A;  2XRI A;  1JLF A;  4R79 A;  2V51 B;  2B5J A;  4X64 K;  3KK1 A;  3V9W A;  4HTU A;  4KV8 A;  5C24 A;  1U4B A;  1XWL A;  3LZJ A;  2QWQ A;  1W2B M;  4JEP A;  1F21 A;  1VQ9 N;  4JKH A;  4KB1 A;  3CD6 N;  1BQM A;  5CE3 A;  5I9E B;  3TTC A;  3T7Z A;  1HUX A;  1VSK A;  3SMP A;  3OS0 A;  4B9L A;  3JYT A;  1D4X A;  3GDQ A;  5M1N A;  5SWM A;  4BQZ A;  1VHX A;  2OCE A;  3J7Y P;  1WSF A;  3V1Q A;  2WOM A;  4NCB A;  1T7P A;  1BOT O;  4LF9 K;  4FWQ A;  3B8A X;  5ADX H;  3A5N C;  4K43 A;  5AR0 A;  1VK0 A;  3I8D A;  2E1Y A;  4B1Y B;  4CGI A;  3WXI A;  1VSM A;  3LPT A;  1GLD G;  2FBX A;  2KLA A;  2P9U B;  5AQF A;  4CK1 A;  2V7Y A;  3C0B A;  4KH4 A;  3F9M A;  1J53 A;  4E1N A;  1SKW A;  1VQO N;  3P5J A;  4AHV A;  1X1P A;  4AQY K;  1ASU A;  1TK8 A;  3EE9 A;  5TKY A;  4CGH A;  2XO7 A;  3R9P A;  1ASW A;  5AQP A;  3LDL A;  5JEN A;  2OYQ A;  1RBU A;  4GVE A;  4BR7 A;  3EZ5 A;  1QTM A;  1VQK N;  5KRS A;  3G10 A;  2VG6 A;  1BDG A;  3H08 A;  1RBT A;  4WQ4 A;  3RR7 A;  1LOT B;  2YV0 X;  4MLE A;  4A5B A;  2HVI A;  4MDA A;  4BR9 A;  3CFP A;  4JN4 A;  4C1N K;  4O8K A;  1NLV A;  2A40 A;  3BGR A;  3K5M A;  4IKF A;  4A61 A;  4OKE A;  1HYS A;  3GE1 A;  1HRH A;  3CM6 A;  2E4L A;  1XQS C;  3OYG A;  5AQT A;  3CXC M;  1U04 A;  2QWN A;  2A41 A;  4H0V B;  4BWM A;  3SQ4 A;  2DFF A;  2G8W A;  4LF7 K;  3THX B;  4BEB A;  3HSC A;  4FJX A;  1OH5 A;  4TSX A;  1NGA A;  3R8E A;  4CJK A;  1TK5 A;  2EWS A;  2UU9 K;  5ELZ A;  5E41 A;  1LW0 A;  2DFH A;  3SI6 A;  2RF2 A;  5K14 A;  4I9L A;  4RW7 A;  4J2A A;  3EEQ A;  3HVT A;  1WUA A;  5BPM A;  3Q7C A;  3ZSW A;  3QEX A;  1BIZ A;  4A59 A;  2J4R A;  4DQP A;  4KHU A;  2HNY A;  3G25 A;  4M42 A;  4B9M A;  4JI8 K;  3TR8 A;  2PFU A;  5AQR A;  4PHT X;  1VQ4 N;  2FF3 B;  4UQG A;  2HHX A;  3HL8 A;  3QNO A;  4KH5 A;  4CZI A;  3LAK A;  3THY B;  5CZ2 A;  4YDU C;  2RE2 A;  2O8B B;  1D8Y A;  3L3U A;  3VQP A;  4DV2 K;  4FZZ A;  4JKF A;  4PWD A;  3LP3 A;  1NJX A;  4FK2 A;  1RIL A;  2X74 A;  1SL2 A;  2YJF A;  1NJZ A;  4FVM A;  1GOB A;  4CJE A;  1YJN N;  4HUF A;  1M1K O;  4ZTJ A;  1ZBU A;  4CJL A;  3IMX A;  2O8E B;  5KI6 A;  3A5O C;  3JS6 A;  5AJ3 K;  3VER A;  4M7X A;  3V9Z A;  3WXJ A;  5JS1 A;  4M63 C;  1K6Y A;  3C65 A;  3ZCM A;  3O1B A;  2DY4 A;  2W41 A;  4OPH A;  4BRP A;  4DTX A;  5GAG P;  3M8S A;  3VQ8 A;  3FGU A;  1QQN A;  4FLY A;  4DQ8 A;  2RKI A;  2W6L A;  3NGZ A;  1S6Q A;  5BRF A;  2Q31 A;  3AVN A;  3MDQ A;  4DF4 A;  5HBM A;  3SBT A;  3GL1 A;  2E2O A;  1LWC A;  3UKR B;  1ZYQ A;  4DTO A;  2P9P B;  2GUP A;  1A5X A;  2KFN A;  1LW2 A;  5JVH L;  4GNI A;  5AQI A;  4CIG A;  2D0B A;  3CET A;  4BE1 A;  4K42 A;  5CR4 A;  3QEW A;  5J2N A;  3VQQ A;  3T1Y K;  3M8R A;  1KAZ A;  4JKG A;  1DEJ A;  3HPH A;  4FLU A;  4H0O A;  1BIS A;  2BTF A;  3CJ9 A;  3DM2 A;  4DTN A;  4E7J A;  4OGC A;  3VF2 A;  3DOL A;  1RCH A;  4DR5 K;  1HMV A;  1QQC A;  1JLE A;  4FK4 A;  3D2E B;  3AA4 A;  5BRH A;  3PSF A;  4G9Z A;  3FZH A;  3J7A P;  1S22 A;  2F96 A;  1IBL K;  2ASO A;  1RDD A;  1EXQ A;  3FR0 A;  4CJT A;  2HNZ A;  1C0F A;  4H4O A;  3EE8 A;  3T69 A;  4JHD A;  4JAX A;  3AO4 A;  3LAL A;  4DR1 K;  1T3V A;  5BN9 A;  1SL0 A;  1YHQ N;  1J5O A;  5EX5 A;  2H3G X;  3HZ6 A;  1IJJ A;  1DLO A;  3DLE A;  3UIQ A;  4C23 A;  3TI0 A;  2KZM A;  4OLB A;  1W97 L;  2F9W A;  3VEW A;  4BRQ A;  3MN7 A;  4CEQ A;  4LY7 A;  3MXM A;  4HHT A;  1GLC G;  3QFU A;  4B9V A;  1HQE A;  2HW3 A;  3LPU A;  5HP1 A;  1O1W A;  3B6O A;  3ULD A;  3GOI A;  3V4I A;  5AQL A;  2Z1J A;  5BRE A;  2YKM A;  5AQZ A;  4FLT A;  4FJK A;  5AQM A;  4DU1 A;  3QES A;  3DRS A;  4JI7 K;  3EL2 A;  4OLA A;  3BZK A;  3QEP A;  2Q97 A;  5LMN K;  2Q36 A;  3TAE A;  1BO5 O;  3HI0 A;  4BVO A;  3SPY A;  1I94 K;  4WE1 A;  3KLH A;  4E0D A;  4KHP K;  4MLH A;  1RT5 A;  4JNE A;  2VWJ A;  4H03 B;  2FBY A;  1NGH A;  3AVL A;  3BF3 A;  3ZT2 A;  1REV A;  1RTI A;  2QWL A;  2NRZ A;  1B92 A;  2A3Z A;  5BPL A;  1C0T A;  3VQB A;  1Q7Y O;  1IG9 A;  1NWK A;  5DK5 A;  2I7N A;  2IS3 A;  3GBT A;  1JCG A;  4DWI A;  2W42 A;  2ZM6 K;  5GAD P;  3EZW A;  4O8U A;  3HST B;  2ATQ A;  3L3V A;  4B3M K;  5FRM A;  4FJM A;  3T3F A;  5M1P A;  3LM2 A;  4OPA A;  1KLM A;  3OYB A;  4EHT A;  4DU4 A;  1NJY A;  2RPI A;  3DLK A;  2IIR A;  4AM6 A;  3BP8 A;  2BH1 A;  1HNX K;  3WEE A;  3O9U A;  4ELV A;  1NGB A;  4JRQ A;  3D45 A;  1TKT A;  4KI4 A;  3MEC A;  1BGX T;  4U67 L;  4PKH A;  3ZT3 A;  2B4J A;  1CXU A;  1OVY A;  3TAM A;  1MWK A;  1Q18 A;  2AP1 A;  4M41 A;  4CFB A;  3CYG A;  3KHY A;  4JKD A;  4KTW A;  3E9O A;  3CER A;  4AHS A;  1DTQ A;  4MFB A;  5E26 A;  2Z1G A;  3LDN A;  1L5U A;  5AQG A;  1JLG A;  1OH7 A;  3NGI A;  3VA0 A;  3WXM B;  4LF4 K;  4XH1 A;  3FZM A;  4YFU A;  2ZQB A;  3LZI A;  4FJ5 A;  4DS4 A;  3M5R A;  3EN9 A;  4CD1 A;  1BQN A;  3R1X A;  3M6G A;  3D2F A;  1QQO A;  3L2R A;  2YX6 A;  4ELU A;  5C15 A;  4B9N A;  1VQ7 N;  2KFZ A;  4Y1C A;  3CI5 A;  1SKS A;  5GIP A;  4NLB A;  4DFK A;  4XH4 A;  2ZD1 A;  1LWF A;  1O13 A;  3LL3 A;  3H1V X;  1OH6 A;  1VSI A;  3OYK A;  1B9F A;  3L2V A;  2GWJ A;  3OVN A;  2PAV A;  3CJC A;  4F8R A;  3VQ5 A;  1RBV A;  3FZL A;  4DTS A;  4E3S A;  1XC9 A;  1LV5 A;  4JKG B;  3KK3 A;  5M1K A;  4JD2 A;  3DLG A;  4CZG A;  2VGN A;  3ID6 A;  1BUP A;  4BGB A;  3NCI A;  4XJX A;  3VES A;  4CEC A;  3VQ4 A;  3U3Y A;  3THV A;  3D0P A;  5HRS A;  1BI4 B;  3DXK A;  3E66 A;  2BDP A;  1TKX A;  3HPG A;  1H1V A;  3D7E O;  4OVL A;  1NJW A;  1TAU A;  4CBX A;  4CJ7 A;  4RTF D;  1KQS M;  3H6E A;  2ITM A;  4DSL A;  3CJA A;  2GV9 A;  2O8F A;  4KFB A;  4CGD A;  4BVP A;  1Z6R A;  3TTF A;  2QXF A;  4JHD B;  4DQQ A;  3KKS A;  3PIO L;  1RGI A;  2P9K B;  3MMV A;  4M3U A;  5BPN A;  4KKO A;  5FRN A;  2P9S A;  3G6E N;  4FM1 A;  2VWB A;  3WNF A;  3ZEU A;  1VSL A;  5KGX A;  2YHY A;  1YIT N;  3CCJ N;  3VEV A;  4FJN A;  1HX1 A;  3QB0 A;  1GLF O;  2QA4 N;  3DLL L;  4LSN A;  3F73 A;  3MN5 A;  1RBR A;  4IG0 A;  2RHK A;  1HJR A;  2QEX N;  5HRN A;  3E9L A;  2IC3 A;  2CH5 A;  1IKY A;  2YKN A;  3J8A A;  1S6P A;  3IRX A;  1WSE A;  4LF6 K;  4CHN A;  1FKO A;  3CPW M;  3QET A;  4FJ8 A;  3DLR A;  2E8A A;  3RRH A;  3CCR N;  3J80 O;  3AGR A;  5AQQ A;  1UAX A;  4CFD A;  1C0M A;  3O9S A;  3QEI A;  4BRF A;  2UXB K;  3DWL A;  3CC7 N;  2OPS A;  3VTH A;  4HUE A;  1NBW A;  4NYF A;  4CJV A;  3LP2 A;  2FBV A;  1HKB A;  2YNG A;  4H5N A;  1S3X A;  1KVB A;  1VSF A;  2KQ2 A;  5J2M A;  2HHV A;  4IDH A;  5TKW A;  3C7N A;  4DLE A;  4DS5 A;  4N41 A;  4CIE A;  3A2F A;  2HHU A;  4W5T A;  2ZE2 A;  4CJ3 A;  3QEV A;  3VET A;  4NCA A;  4NXN K;  4B1Z A;  1NGG A;  4CHY A;  3VPZ A;  4B1U B;  5HRO A;  4YOT A;  3WEE B;  3DRP A;  3TU5 A;  4RW9 A;  4BRA A;  3JSM A;  4BE7 B;  1T8E A;  4IOC L;  3CC2 N;  3PO4 A;  2HB5 A;  3CFO A;  5AQU A;  3HBT A;  4FSV A;  3KD5 E;  3KLF A;  4IJN A;  3KLG A;  1C1C A;  1S72 N;  1C6V A;  4DUY K;  4FJ7 A;  4CEF A;  1W7A A;  1V4S A;  1RDU A;  3ZET B;  3WT0 A;  3RSE A;  1NOZ A;  1ATR A;  2KHO A;  3KWI A;  1LAW A;  1S5J A;  3K9K A;  3EKU A;  4CF8 A;  1BIU A;  1T03 A;  4FWR A;  3N4P A;  2BGG A;  4HTL A;  4IJA A;  1NK7 A;  5FPN A;  1ATN A;  1HNI A;  3ZSX A;  3I55 N;  3D2F B;  1N6Q A;  1XI1 A;  2DPN A;  4DR3 K;  4BRG A;  4HUG A;  4O5F A;  1VQL N;  4FJL A;  4ILH A;  2Q0R A;  4AHR A;  5FLX O;  1BCO A;  3HO1 A;  2OZS A;  1TUY A;  3TAQ A;  3WNE A;  1HPZ A;  3KVG A;  1BCM A;  5IWA K;  3AAP A;  4J2E A;  1B9D A;  4IWV A;  3OYC A;  1NK8 A;  3QBW A;  4IBN A;  5AQH A;  4GY2 B;  3J7Z O;  1HNZ K;  4DSE A;  1U49 A;  2OA8 A;  2E88 A;  4RW6 A;  5LJV A;  2X78 A;  2CGK A;  3FFI A;  3V1O A;  4KTQ A;  3T1A A;  3PUF A;  1NKC A;  4FXD A;  4EZ6 A;  2ZWH A;  1HNV A;  4ILG B;  3TAF A;  4N56 A;  1U48 A;  4QS9 A;  1UWB A;  1RFQ A;  2Z1I A;  4CF2 A;  1Q9Y A;  3HT3 A;  3VMF B;  3OYL A;  4YOW A;  1SQK A;  3AY9 A;  4C8L A;  3ZX0 A;  3ZYY X;  3O3F A;  4BE2 A;  3SQ1 A;  2JGU A;  2YHA A;  4IFV A;  1NG9 A;  4OKK A;  1RT6 A;  4DV4 K;  2HBJ A;  2P9I A;  3TSQ A;  4KHQ A;  1CZA N;  3ULE B;  4NYN A;  1VQN N;  1JL2 A;  5J2P A;  3LWL A;  4CJF A;  3FE1 A;  3K0S A;  2OZM A;  4W5N A;  4FWP A;  2P9N B;  2P9S B;  3IUC A;  1VSD A;  4BG9 A;  1GLB G;  3ZEU B;  2BE2 A;  4AHT A;  5KTQ A;  3DMJ A;  4MDB A;  2HHS A;  2X6N A;  4B1W B;  4CCH A;  3G0Z A;  1S1W A;  4CZK A;  5C25 A;  4KPY A;  1A5W A;  1TUU A;  4CJ4 A;  2QKK A;  2VYP A;  3ZT1 A;  3CM5 A;  3OYH A;  2FXU A;  4F3T A;  3VF6 A;  4JI3 K;  3UKU A;  4Z4I A;  3IFR A;  4JLH A;  3RTV A;  4YY3 K;  3ZT0 A;  5JIC A;  3VTI A;  2YHW A;  4H5W A;  2UXD K;  1R0A A;  4LFB K;  1YTU A;  5LL6 Z;  4JKC A;  3DXM A;  2HND A;  1VQP N;  4BDY A;  1DKG D;  4KH6 A;  3BZC A;  4BRI A;  4FLX A;  4DTU A;  3IKM A;  3MCA B;  1VSE A;  4BR0 A;  4QAG A;  3NH0 A;  4FW1 A;  3K5O A;  4FLZ A;  1U2V A;  4LH5 A;  1VAZ A;  4H0Y B;  2DFE A;  3S3O A;  3P31 A;  4M3T A;  4HCC A;  4E7L A;  2ZGZ A;  4FVU A;  3O5B A;  3MCP A;  4CGG A;  1VSJ A;  2VQF K;  1N8R O;  4FOI A;  2YNH A;  1BA1 A;  3MN6 A;  5C0Y A;  1XNR K;  3HXM A;  3SV3 A;  4BC4 A;  3C7N B;  3WXL A;  3VQA A;  4JI1 K;  4A62 A;  4Z4E A;  1TL1 A;  3K2P A;  4Z94 A;  1KCF A;  3SQ0 A;  4Y0W A;  4CIF A;  1BL3 A;  2CGJ A;  4BRL A;  3DRR A;  5AQW A;  2OAN A;  3AO2 A;  1KFS A;  2NRX A;  4EHU A;  3C6A A;  4FJG A;  3VF4 A;  1WB9 A;  1RTH A;  5AZJ A;  3VQD A;  4DR7 K;  4CED A;  1IBK K;  4JI4 K;  3Q7B A;  4N76 A;  4Z4G A;  3CQ8 A;  3K5L A;  1GLJ O;  1W9H A;  3MWT A;  1VQ6 N;  4A57 A;  4BR4 A;  3P39 A;  4GV6 A;  2P5G A;  3RSE B;  4C1N I;  1N5Y A;  4L3Q A;  4Y1D A;  5BRD A;  4ZHR A;  1C0U A;  2A6A A;  4MQ3 A;  4EFH A;  3O4W A;  3OYJ A;  2A5X A;  3SQ2 A;  3AVK A;  4F2S A;  4LF8 K;  1S9E A;  1YTA A;  3U6F A;  1TYQ A;  3W3D A;  3P1G A;  5M1Q A;  4B1V A;  4BC5 A;  3OTO K;  2QW9 A;  3CCE N;  3U4L A;  4FWL A;  1OH8 A;  5HLF A;  4YDU A;  4XH5 A;  2F8T A;  1YI2 N;  2VCP A;  3KK7 A;  1GOA A;  1WSJ A;  3HM8 A;  1S1U A;  4PQU A;  4HCB A;  4DMN A;  4CZM A;  1Q82 O;  3LDS A;  2OTL N;  1SUQ A;  3RMB A;  4C8N A;  3I8B A;  1J9A A;  3O80 A;  4GMJ B;  3C6U A; 
#chains in the Genus database with same CATH homology
 3SK3 A;  3KHY A;  4JKD A;  3E9O A;  3CER A;  1HLU A;  4H5T A;  3O9T A;  1MDU B;  1QZ5 A;  3G71 N;  1EO1 A;  4LC9 B;  5E26 A;  1VQ5 N;  2NLX A;  2D0O A;  3LDN A;  5AQG A;  1MA9 B;  2Q1N A;  4IEE A;  3OHR A;  3WXM B;  3H46 O;  3LM9 A;  4XH1 A;  3SAF A;  2FLO A;  3FZM A;  4A2B A;  5JVG L;  1NGD A;  3ZX3 A;  3O9R A;  3VEN A;  2HBM A;  2E1Z A;  3M5R A;  5DM6 L;  3EN9 A;  5F1X A;  1VQ8 N;  1NMD A;  4CD1 A;  4F9O A;  3G4S N;  1QVF M;  3R1X A;  3M6G A;  3D2F A;  1QQO A;  4JK9 A;  2YX6 A;  4RCH A;  4JKB A;  5GAE P;  5C15 A;  4J8F A;  3A0I X;  3TSU A;  1VQ7 N;  3EKS A;  3C6H A;  3VGL A;  3CI5 A;  3OA9 A;  5GIP A;  4NLB A;  4XH4 A;  1GLA G;  3SLC A;  1ZC6 A;  1O13 A;  1SZ2 A;  3H1V X;  3LL3 A;  4CD3 A;  4EIA A;  3QFP A;  1ZBS A;  3O1W A;  2IVO A;  2QWM A;  4YOR A;  2GWJ A;  3HRG A;  4IEI A;  4BG8 A;  1SAZ A;  2WFB A;  3SMS A;  1Z05 A;  2QWR A;  2PAV A;  5C2F A;  3CJC A;  4QS7 A;  4FL9 A;  3FZL A;  5EOY A;  2FSN A;  4CBW A;  5ADX A;  4U7B A;  2A42 A;  5BN8 A;  3CCV N;  1X3M A;  2GEM A;  2W40 A;  3PLA A;  4JKG B;  4FWO A;  1K73 O;  5LY3 A;  1YUW A;  3ENO A;  3BF1 A;  4JD2 A;  2PBD A;  5M1K A;  5AQJ A;  4CZG A;  3I33 A;  2VGN A;  2VGM A;  3ID6 A;  5E84 A;  1BUP A;  4DB3 A;  4ISG A;  2QWO A;  4BGB A;  4NLC A;  4WFB L;  4B1X B;  4XJX A;  2C1I A;  1T6D A;  2D1K A;  3VES A;  2YCH A;  1DT9 A;  1SS6 A;  5DM7 L;  2OTJ N;  4CZJ A;  5JLH A;  1RDW X;  3DXK A;  3E66 A;  4FWK A;  3ATV A;  4CZF A;  4KBO A;  3HOS A;  3H1Q A;  1H1V A;  3D7E O;  4BR2 A;  4CBX A;  3DXM B;  4BRM A;  3CCL N;  3H45 C;  4FO0 A;  4WYB A;  4CJ7 A;  1YJ9 N;  5GIO A;  4RTF D;  1KQS M;  3H6E A;  2ITM A;  3CJA A;  1Q81 O;  4R79 A;  2V51 B;  2YI1 A;  4BVP A;  3AAR A;  1Z6R A;  3TTF A;  4JHD B;  1U2V B;  3PIO L;  1RGI A;  2P9K B;  3MMV A;  4BGA A;  5BPN A;  2NRT A;  5AZI B;  3W0L A;  1V4T A;  2P9S A;  2NNW A;  1W2B M;  2QWQ A;  3SAH A;  4JEP A;  1JJ2 M;  3G6E N;  1VQ9 N;  1NGF A;  4JKH A;  4OO1 J;  1VQM N;  3CD6 N;  1BA0 A;  2E2Q A;  2VWB A;  3ZEU A;  1HPM A;  4B9Q A;  5CE3 A;  5I9E B;  3TTC A;  2YHY A;  1YIT N;  2FSK A;  3OW2 M;  3CCJ N;  3T7Z A;  1P8Z A;  1HUX A;  3KWG A;  3MK6 A;  3SMP A;  3ID8 A;  3VEV A;  5B8H A;  1HX1 A;  3A8Y A;  3QB0 A;  1GLF O;  5F2R A;  2QA4 N;  1D4X A;  1NGJ A;  2AA4 A;  2YJE A;  3GDQ A;  4MO5 A;  4BQZ A;  5M1N A;  3DLL L;  2P9L B;  3MN5 A;  2E20 A;  3L4Q A;  2RHK A;  2QEX N;  1BOT O;  3LDP A;  3E9L A;  2HBK A;  4FWQ A;  2ASP A;  4ISE A;  3ZX2 A;  3B8A X;  3E9P A;  5ADX H;  2CH5 A;  3A5N C;  5AFU H;  4K43 A;  3CHW A;  5AR0 A;  1HKG A;  1ESV A;  4ILJ A;  3J8A A;  4H5V A;  4ISF A;  2E1Y A;  3GG4 A;  4H0X B;  4B1Y B;  1BWF O;  1QZ6 A;  4IO9 L;  3WXI A;  3CPW M;  1K8K A;  2E8A A;  3R3L A;  1GLD G;  2KLA A;  2P9U B;  5AQF A;  3CCR N;  4A5A A;  5AZJ B;  2V7Y A;  3AGR A;  5AQQ A;  3VGM A;  3C0B A;  4KH4 A;  3F9M A;  3O9S A;  4BRF A;  3DWL A;  3CC7 N;  2ZJQ L;  2WBN A;  3VTH A;  1VQO N;  3M1F A;  4UY8 O;  1NBW A;  4H5R A;  2ASM A;  4H0T B;  1HKB A;  2V7Z A;  4H5N A;  4DCH A;  1K8A O;  1S3X A;  3EE9 A;  1M90 O;  3UB5 A;  5TKY A;  1JCE A;  3R9P A;  3O6W A;  5AQP A;  3LDL A;  3F5T A;  4IDH A;  3DAW A;  3LDQ A;  4WFA L;  4GVE A;  1EQY A;  3C7N A;  5TKW A;  2NRW A;  4BR7 A;  2HF3 A;  1VQK N;  4IO8 A;  1BDG A;  3MX5 A;  5AQX A;  5JMV A;  4PL7 A;  3HTV A;  4WQ4 A;  4BR5 A;  1QHA A;  4XEI A;  1LOT B;  4MLE A;  2P9I B;  3VET A;  4A5B A;  4DHY A;  4M7Y A;  4MDA A;  4B1Z A;  1NGG A;  3U8X A;  4BR9 A;  4JN4 A;  3VPZ A;  4B1U B;  5FPM A;  4C1N K;  3BUZ B;  4O8K A;  1NLV A;  1TYQ B;  3VEY A;  4YOU A;  4YOT A;  3WEE B;  2A40 A;  5LJW A;  2QTD A;  3ATU A;  3TU5 A;  3TTD A;  4A61 A;  2GTD A;  4BRA A;  4BE7 B;  3WQU A;  4IOC L;  3CC2 N;  3GE1 A;  5EVZ A;  1XQS C;  1YJW N;  5AQU A;  2CGL A;  4BRK A;  3CME N;  3HBT A;  5AQT A;  4CI6 A;  1ILY A;  4FSV A;  5AQS A;  3CXC M;  2QWN A;  2A41 A;  4IJN A;  5KQD A;  4K41 A;  4I6M A;  4H0V B;  5CHI A;  3SBG A;  1S72 N;  3VEZ A;  1YAG A;  2P9K A;  4BEB A;  3HSC A;  2YHX A;  5FPE A;  4DKW A;  3CQY A;  2FF6 A;  1NGA A;  3R8E A;  1V4S A;  1RDU A;  4K25 A;  3QML A;  3ZET B;  3WT0 A;  3RSE A;  5H1S Q;  2EWS A;  3L0Q A;  5HOO A;  4BY9 C;  3H3O B;  1JCF A;  5ELZ A;  3UKU B;  1ATR A;  2KHO A;  3CJB A;  5C12 A;  1NGC A;  4RWT A;  2GEL A;  3KWI A;  1QVG M;  3K9K A;  3EKU A;  3KZB A;  1GLE G;  3O8M A;  4FWR A;  1E4G T;  1WUA A;  2HF4 A;  3N4P A;  1OKJ A;  3Q7C A;  5BPM A;  4HTL A;  1KAY A;  4IJA A;  5FPN A;  2QI2 A;  1ATN A;  3NMU A;  2ZGY A;  2ZJR L;  4A59 A;  2J4R A;  3D2F B;  3I55 N;  4CBU A;  2DPN A;  2NRV A;  4BRG A;  3G25 A;  4YOV A;  2Q2R A;  4CZH A;  2PFU A;  4O5F A;  3MX2 A;  4BRC A;  1VQL N;  4WF9 L;  4WQ5 C;  5AQR A;  4ILH A;  4PHT X;  2Q0R A;  1VQ4 N;  2FF3 B;  3D6R A;  3FLC O;  3TPQ A;  4AM7 A;  4KH5 A;  4CZI A;  1TUY A;  4FPB A;  4YDU C;  2RE2 A;  3KVG A;  4IFE A;  3AAP A;  2HMP A;  4JKF A;  4BRH A;  4IWV A;  1G99 A;  2D0P A;  3QBW A;  4A2A A;  5AQH A;  2YJF A;  2IVN A;  4GY2 B;  4AF1 A;  5M1F A;  3J7Z O;  2E88 A;  5LJV A;  2CGK A;  4GV9 A;  4YOY A;  3DJC A;  5AQV A;  1YJN N;  3ENB A;  2ZF5 O;  4FWM A;  1M1K O;  2ZWH A;  4ILG B;  1C0G A;  3IMX A;  2JWK A;  2JWL A;  4IXC A;  3A5O C;  3JS6 A;  4IOX A;  4QS9 A;  5KPZ A;  2V52 B;  1RFQ A;  3VER A;  4M7X A;  1HKC A;  1U6Z A;  3AGK A;  1IG8 A;  3VMF B;  3WXJ A;  3NVK A;  4M63 C;  4YOW A;  1SQK A;  3AY9 A;  5MLC Q;  3C65 A;  3O1B A;  3ZX0 A;  3ZYY X;  3RVC A;  2W41 A;  3WQT A;  4OPH A;  4BRP A;  5GAG P;  5AQO A;  1YIJ N;  1R59 O;  3FGU A;  1QQN A;  3OBW A;  3I56 N;  2HBJ A;  2NRH A;  2P9I A;  3TSQ A;  4DQ8 A;  1E4F T;  5GAH P;  1CZA N;  3ULE B;  5BRF A;  4BRO A;  1VQN N;  2Q31 A;  3BEX A;  3MDQ A;  4IOA L;  3CCU N;  3FE1 A;  4PKI A;  3SBT A;  3GL1 A;  3E1Y A;  2E2O A;  4E1J A;  1LCU A;  4FWP A;  3TSP A;  3UKR B;  2NZT A;  4GV3 A;  4BC3 A;  2E2P A;  2GUP A;  2P9P B;  2P9N B;  2P9S B;  4PKG A;  3K9J A;  4H0P A;  3IUC A;  3N4Q A;  4GNI A;  5JVH L;  5AQI A;  1GLL O;  3CET A;  4BG9 A;  3H3N O;  1GLB G;  3ZEU B;  3A5M C;  4K42 A;  5CR4 A;  2QM1 A;  3MN9 A;  4MDB A;  1T6C A;  1KAZ A;  4B1W B;  4JKG A;  1DEJ A;  1QQM A;  2E2N A;  4FWN A;  4CZK A;  4PL8 A;  2F7T A;  3CF5 L;  4H0O A;  2BTF A;  3CJ9 A;  1Y64 A;  1X9J A;  3QIC A;  1TUU A;  1KC8 O;  2CH6 A;  3VF2 A;  3ZET A;  3CIP A;  2VYP A;  5M1O A;  2BUP A;  2FXU A;  3P4I A;  3VF6 A;  4WCE L;  3UKU A;  3IFR A;  3CJ7 A;  3L6Q A;  3VGK A;  3D2E B;  5JIC A;  2C1G A;  4FWS A;  4HWI A;  3VTI A;  2YHW A;  4H5W A;  5BRH A;  2F9T A;  5AQN A;  3FZH A;  1NM1 A;  2I7P A;  4G9Z A;  3CCM N;  1KAX A;  1S22 A;  3DXM A;  4JKC A;  3ENH A;  4JK7 A;  1VQP N;  1DKG D;  3R6M A;  2ASO A;  4KH6 A;  4BRI A;  3IKM A;  3FR0 A;  3MCA B;  3CJ1 A;  1K8K B;  4BR0 A;  2Q0U A;  1C0F A;  3EO3 A;  3EE8 A;  3T69 A;  2QWP A;  4JHD A;  4JAX A;  1U2V A;  1VAZ A;  5EXW A;  4H0Y B;  1T3V A;  5AZI A;  5BN9 A;  3P31 A;  1YHQ N;  5C2D A;  5EX5 A;  3QDK A;  2H3G X;  4YOX A;  3A5L C;  3HZ6 A;  1IJJ A;  2ZGZ A;  4FVU A;  4C23 A;  3NVM A;  3OBY A;  3O5B A;  3MCP A;  3FFK B;  3LDO A;  1W97 L;  2F9W A;  2HBL A;  4QS8 A;  3VEW A;  4BRQ A;  3WUH A;  4FPA A;  1N8R O;  1NGE A;  1WOQ A;  3MN7 A;  1Q86 O;  2GX9 A;  4MO4 A;  4FOI A;  1BA1 A;  2HOE A;  5KQ8 A;  1GLC G;  3QFU A;  4WFN L;  3MN6 A;  5C0Y A;  1NGI A;  4BC2 A;  2P9L A;  1XC3 A;  5AFU A;  4BC4 A;  3CQX A;  2QXL A;  3C7N B;  3QBX A;  3WXL A;  3GOI A;  2FSJ A;  4A62 A;  5AQL A;  3CC4 N;  5BRE A;  5AQZ A;  4BRE A;  5AQM A;  4BRD A;  2HST A;  4Z94 A;  5C10 A;  4Y0W A;  2UYT A;  2CGJ A;  1KXP A;  4BRL A;  5AQK A;  3EL2 A;  1KD1 O;  2KKZ A;  1ZXO A;  5AQW A;  2OAN A;  1P90 A;  3L4I A;  2NRX A;  5BR9 A;  1MWM A;  2Q97 A;  3O08 A;  3M3Z A;  4EHU A;  2IVP A;  3VOV A;  2Q36 A;  3C6A A;  1BO5 O;  2P9U A;  3HI0 A;  3VF4 A;  4BVO A;  1NJI O;  1X3N A;  3VEO A;  5AZJ A;  1BG3 A;  3F2K A;  2GWK A;  3ULE A;  5GIN A;  2W00 A;  4MLH A;  4JNE A;  2NRR A;  1YF5 L;  4H03 B;  3IDH A;  2ZJP L;  4I6M B;  3BF3 A;  1NGH A;  5JLF A;  3Q7B A;  3U9D A;  2D4W A;  4JKA A;  1YVN A;  3UKR A;  2QWL A;  3JXU A;  4CZE A;  5KPR A;  2NRZ A;  2A3Z A;  2P9P A;  2P9N A;  5BPL A;  1GLJ O;  3VEX A;  1Q7Y O;  1HJO A;  1NWK A;  3MWT A;  3FZF A;  3P38 A;  4IZ9 A;  2I7N A;  4JD2 B;  4A57 A;  3GBT A;  1JCG A;  4BR4 A;  1VQ6 N;  3P39 A;  3HOT A;  4GV6 A;  4NO7 A;  3FZK A;  3RSE B;  1DGK N;  5GAD P;  3EZW A;  4C1N I;  4JK8 A;  4O8U A;  4FOE A;  1K9M O;  4L3Q A;  5F0X A;  3UE5 A;  5BRD A;  4BEC A;  5HL7 L;  5M1P A;  3DXK B;  3LM2 A;  3SJH A;  2A6A A;  3WXK A;  4OPA A;  4EFH A;  1XUP O;  3O4W A;  1J6Z A;  4JKE A;  2A5X A;  5FPD A;  3CPE A;  4EHT A;  2IIR A;  4AM6 A;  4WQ5 A;  1BU6 O;  1TYQ A;  2BH1 A;  3BP8 A;  5M1Q A;  3W3D A;  3WEE A;  2WC9 A;  3O9U A;  4B1V A;  4BC5 A;  2QW9 A;  5EY4 A;  3CCE N;  3U4L A;  3D2E A;  4CZL A;  1NGB A;  4WQ4 C;  2WUS A;  4FWL A;  4BRN A;  3PIP L;  3S41 A;  3MWP A;  4YDU A;  1YXQ A;  4XH5 A;  4NB4 A;  3CCS N;  2VCP A;  3KK7 A;  1YI2 N;  3CCQ N;  3HM8 A;  1T44 A;  5KPT A;  1ATS A;  4CZM A;  4U67 L;  4PKH A;  3CMA N;  1Q82 O;  3AAQ A;  4EAH D;  2OTL N;  3O9Q A;  3I8B A;  1OVY A;  3O80 A;  1MWK A;  1Q18 A;  2AP1 A;  5AQY A;  3U9Z A;  4BQL A;  3SAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...