2P9PB

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
190
structure length
184
Chain Sequence
b'GVVVDSGDGVTHICPVSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEVGVAELLFNTIQADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 50
structure length 184
sequence length 190
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9pB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9pB02
2GELA 4EFHA 3O1BA 2EWSA 1C0GA 3CIPA 3D2EA 2FF6A 2YHYA 4BR9A 4JD2A 1KAZA 5ADXH 1ZBSA 1TUYA 5I9EB 5JMVA 1ATRA 1MWKA 1NGEA 2IVNA 3A5MC 3RSEA 2Q2RA 3LDOA 1D4XA 5FPNA 2GTDA 2P9IA 3P4IA 1ATNA 5AZJA 3H46O 3KZBA 1QQNA 3ZEUA 3CJBA 3MN5A 4BRLA 3DXKA 4H0VB 3EL2A 1CZAN 3CQXA 3LDNA 3A8YA 4ISGA 1XQSC 1GLFO 2GEMA 2E20A 4CZEA 3VERA 3R8EA 3D2FA 1NGBA 1NLVA 4NO7A 2P9SB 5AQMA 1NMDA 3UKUA 1HJOA 4O8KA 4PKHA 3GL1A 3IUCA 3CJ1A 1K8KB 5AZIB 5AQPA 4CBUA 1NGCA 3UB5A 4HTLA 1BOTO 3B8AX 2WUSA 3UKRA 5JLHA 2P9PA 5F1XA 2W41A 3I33A 1Z6RA 5LJVA 3SJHA 3BF3A 3C7NA 4FWSA 3BP8A 3LL3A 5EY4A 3MCPA 5AFUA 5TKYA 3S41A 1NGHA 1BWFO 1ESVA 3CJ7A 4WYBA 2A5XA 4H5WA 3L4IA 3ULEB 1NGFA 1J6ZA 4CBWA 2QWMA 2ASOA 3AAQA 4CJ7A 1YXQA 4BRIA 3FZKA 1X3NA 1YVNA 4CZMA 3BUZB 3R9PA 4H5RA 2FSNA 3W3DA 1NGJA 2FF3B 5AQLA 4BC5A 5FPDA 5KQDA 1E4GT 1HPMA 1LOTB 2E88A 3SK3A 2P9UB 3MN9A 4CZHA 3MN6A 2E1ZA 4BROA 5AQYA 4IJNA 2P9KB 2DPNA 2A40A 2IVPA 3M6GA 5EX5A 2ITMA 5AZIA 3VEVA 3WQUA 4CI6A 3EO3A 4BVOA 1GLDG 1Z05A 4BC2A 1U2VB 4O5FA 4B1VA 4XH5A 3VEZA 2ZF5O 3LDLA 2Q0RA 3LDQA 3HSCA 1GLBG 3ATUA 3VGMA 3H3NO 5BRFA 1NWKA 3VESA 3WXIA 1MWMA 4BGAA 3ULEA 1T6DA 4B1XB 2YHWA 1BA1A 4B9QA 4FO0A 3QB0A 3TPQA 4AM7A 5CE3A 3D7EO 4IO8A 1JCFA 4BR4A 3CJ9A 4BREA 3U9ZA 3CI5A 3WT0A 1JCGA 1Q18A 3JS6A 2QWOA 1Y64A 3H3OB 4B1UB 4H0TB 3SMPA 3JXUA 4JN4A 3LM9A 4BR7A 2P9UA 3L6QA 3U8XA 1ZXOA 2P9KA 1X3MA 5KPTA 3ZX2A 2PAVA 4L3QA 4BRCA 4H5VA 5FPEA 4B1WB 3ENOA 2FSKA 4IJAA 3O4WA 1U2VA 4A61A 1KAYA 5AQNA 2IIRA 1BU6O 5AQGA 4B1ZA 3MDQA 4M7XA 4XH1A 5BPMA 2YJFA 4GY2B 5BR9A 3EKUA 5KQ8A 4LC9B 3ENHA 2QWLA 3VGLA 4BGBA 4FWQA 3L0QA 4GNIA 2V52B 5AQRA 3GOIA 4HWIA 1QZ6A 4CZLA 4BRQA 5LY3A 2VWBA 1U6ZA 1YAGA 4BR5A 4H0PA 3FLCO 2CGKA 5ADXA 3OHRA 3SLCA 2PBDA 3A5OC 4FWPA 4DCHA 1RDWX 5F2RA 2A42A 4IWVA 3QFPA 1TUUA 5AQUA 4CZJA 4DQ8A 2E1YA 1S3XA 3FFKB 3TU5A 4H03B 2YJEA 2AP1A 4ISFA 5LJWA 4BG8A 2Q31A 4B1YB 2E2PA 2KHOA 2QWQA 4MO4A 2IVOA 2CH6A 4DB3A 2Q36A 3QBXA 2ZGYA 3ZETB 3VF4A 1NM1A 2A3ZA 4F9OA 2Q0UA 2AA4A 4FWLA 3A0IX 1BDGA 1WUAA 3LDPA 1HKGA 2VYPA 1HUXA 3BF1A 4BQLA 4FPAA 3U4LA 5AQFA 1OKJA 3ATVA 5BPLA 5BPNA 4BRNA 4BRDA 2P9SA 4A2BA 2VCPA 3UE5A 3CETA 5AQKA 3IMXA 2D0OA 3EN9A 3O6WA 4Y0WA 2V51B 1K8KA 1QQOA 4EAHD 3QFUA 1QQMA 4JHDB 3HM8A 1RGIA 2F9WA 2QW9A 2E2QA 1V4SA 3F9MA 3HTVA 4H0XB 1MA9B 5AQQA 4EHTA 5BRHA 1BG3A 1R59O 5AQOA 4CZKA 2YI1A 1KAXA 3MN7A 4QS9A 4H5NA 4BRHA 4CD1A 3D2EB 5B8HA 4RWTA 5EOYA 3AY9A 3WEEB 4BRGA 1DKGD 2D0PA 4FWOA 2HF3A 3O80A 2UYTA 4BR2A 4CZFA 3HBTA 3QICA 1ZC6A 1HLUA 4IZ9A 4DHYA 3ZEUB 2QWPA 2NRHA 3VF6A 3WXJA 3VGKA 4FSVA 1SQKA 4BRKA 3AAPA 4PL7A 2HF4A 3ZX3A 1H1VA 4BRFA 4BR0A 3GE1A 3WQTA 3FR0A 4FOIA 4FOEA 5JICA 2NLXA 3CQYA 3D2FB 4K43A 5AQJA 4J8FA 3FE1A 2QXLA 3M3ZA 4JHDA 1DGKN 4BQZA 3O8MA 3U9DA 4RTFD 2ASMA 5BN9A 2FSJA 5JLFA 4A2AA 3GDQA 2Q97A 3VEOA 4FL9A 2P9PB 1GLCG 4YDUA 1GLAG 1LCUA 3DWLA 3QDKA 3CJCA 3EKSA 3J8AA 5EXWA 3H45C 1X9JA 3C7NB 4WQ4A 3CHWA 2A6AA 3WEEA 2P9NB 2YCHA 2D1KA 2ZGZA 3WXLA 4YDUC 4K41A 1BA0A 2BTFA 2CGLA 4WQ4C 2P9LB 4IXCA 4BRMA 3FZFA 4MLHA 5AFUH 5AQZA 2A41A 4M63C 3WUHA 1QHAA 2CH5A 4PKIA 3H1QA 2ZWHA 3IFRA 5BRDA 1HKBA 3VF2A 3AARA 4XH4A 3EZWA 4C23A 1GLEG 4A62A 4EIAA 5BN8A 4Z94A 2QWRA 3M1FA 2I7PA 1KXPA 3O08A 5E26A 4FWRA 3FZLA 1ATSA 4FWMA 3VEXA 4CZGA 4JNEA 3GBTA 3ZX0A 2HOEA 4FPBA 3FGUA 5BREA 3QMLA 2HMPA 4RCHA 4JAXA 1IJJA 2H3GX 1HX1A 2QM1A 3DAWA 3DJCA 5AQXA 1QZ5A 2QWNA 4M7YA 3VPZA 4NB4A 5KPRA 3H1VX 1NGIA 3O1WA 2FXUA 2GWKA 4E1JA 1T6CA 1S22A 3VETA 5EVZA 1NGGA 2P9NA 1E4FT 4K42A 3R6MA 5KPZA 3QBWA 1T44A 4BRPA 1WOQA 1MDUB 1XC3A 4QS8A 3IDHA 2GWJA 5AQHA 1BUPA 2P9LA 2E2OA 4XEIA 4BVPA 5AQWA 5FPMA 3VENA 4H0YB 3CJAA 3W0LA 1DEJA 1SAZA 3VOVA 4I6MB 4CZIA 2GUPA 1JCEA 1GLJO 3DXMB 4CBXA 5ELZA 2J4RA 3SMSA 3VEYA 5AQVA 4KBOA 4CD3A 3HI0A 1TYQB 1GLLO 4H0OA 4AM6A 2YHXA 3KVGA 4MO5A 3I8BA 1HKCA 1RFQA 2V7YA 4BG9A 1BO5O 1C0FA 4K25A 5AQIA 3KHYA 1EQYA 3WXKA 4JD2B 5F0XA 2OANA 3RSEB 2CGJA 4ISEA 4BC3A 3ZETA 2P9IB 1G99A 5AZJB 1NGDA 4BC4A 1NGAA 3GG4A 4BRAA 3C0BA 2FLOA 2F9TA 1V4TA 3HZ6A 1IG8A 3FZHA 3A5LC 3DXKB 3A5NC 2E8AA 2BUPA 4EHUA 2Q1NA 1P8ZA 4QS7A 3FZMA 3MMVA 4H5TA 4WQ5A 2V7ZA 1XUPO 5E84A 1SZ2A 3O5BA 4PKGA 5AQSA 4PL8A 3LM2A 3BEXA 3MK6A 4WQ5C 1NBWA 3UKUB 5AQTA 4I6MA 3G25A 3H6EA 1YUWA 3DXMA 2I7NA 5AR0A 3VEWA 2ASPA 2NZTA 4MLEA 2E2NA 4FWKA 2W40A 3CERA 1TYQA 3ID8A 2D4WA 3UKRB 4FWNA
chains in the Genus database with same CATH superfamily
1WSFA 5MLCQ 3D2EA 4BR9A 3T1HK 1ZBSA 3C6HA 5J1EA 3A5MC 1VQPN 5FPNA 1WSGA 2GTDA 4DV1K 5AZJA 4GV6A 2OTLN 3LZJA 5HOOA 3QEIA 1NJWA 3CJBA 1KVBA 5CR4A 1Q82O 3EL2A 4CF0A 1CZAN 3CQXA 4B8CA 3L8BA 4IEIA 5HP1A 2GEMA 3PLAA 4CZEA 3PO5A 3IAYA 1WBBA 1W7AA 3UKUA 4O8KA 5GIOA 3TTCA 5AQPA 3CCEN 1CZ9A 1NGCA 3FFIA 5M1KA 4OPJA 1BOTO 3B8AX 3UKRA 3HPOA 2QI2A 2W42A 3CM6A 4B3SK 3I33A 4V19S 4F4KA 3SJHA 3BF3A 4O4GA 5EY4A 5AFUA 5TKYA 3TR8A 2HHSA 3BGRA 2A5XA 3ULEB 1NGFA 2OCEA 1ZYQA 2ASOA 2B6AA 4CEZA 1YXQA 4BRIA 4JKFA 3DLBA 3W3DA 5KQDA 5AQLA 3PSFA 2E88A 5CY4A 2IOCA 1OVYA 4KKOA 2E1ZA 4OVLA 4JV5K 1Y97A 2X6NA 2DPNA 4DTJA 2A40A 5EX5A 3VEVA 3P1GA 1RT2A 1EXQA 2VG7A 1S5JA 4KFBA 4BVOA 1NJZA 5GAGP 1U2VB 4Y1CA 3DOLA 2ZF5O 3HJFA 2A1SA 3HSCA 1GLBG 4H4OA 3VGMA 4DTMA 4JI6K 1MWMA 2VQFK 2ETJA 5CE3A 4IO8A 1IKWA 3QEWA 4BREA 4O5BA 3PIOL 4FLZA 3TAFA 1IKXA 1ASUA 1Q18A 1M90O 4QAGA 2QWOA 4FLXA 1LW2A 2O8DB 1JLQA 2I5JA 5CYMA 3SMPA 5C42A 1TV6A 1KRPA 3TABA 3TARA 4WFNL 4ICLA 4KHUA 2HBMA 4PHTX 4FJ8A 1ZXOA 2P9KA 4M41A 2PAVA 4L3QA 4DG1A 4BRCA 1KVAA 3SJJA 1S72N 4B1WB 4JS5A 3ENOA 4MFBA 1RCHA 4IJAA 3PV8A 1EX4A 4A61A 5AQGA 4B1ZA 1WNSA 1W9HA 4GY2B 5KGXA 3TSUA 3ISNC 1W0HA 2B4JA 1YJWN 3M8RA 4JRPA 1UWBA 4GNIA 4J2DA 1XMOK 5AQRA 4HWIA 1KLMA 2ZE2A 3CD6N 4CHZA 1IBMK 3DRRA 1YAGA 5J2MA 2ZD1A 4H0PA 3FLCO 3OHRA 4JKGA 4FJGA 2W6KA 1YTUA 2PBDA 4E7IA 2HHQA 2A42A 3G0ZA 1FK9A 2JWKA 4GVMA 2PFUA 3AO3A 5AQUA 4CZJA 4DQ8A 1S3XA 4YY3K 5LJWA 1FKOA 4ISFA 4W5QA 3KWGA 3LWMA 1RTJA 4BDZA 4B1YB 3QETA 2IVOA 3NE6A 1BIUA 1SL0A 2Q36A 2XY8A 3CYMA 3VF4A 3OBWA 4EP5A 2AA4A 2JGUA 3MXMA 4OKEA 4DFPA 1GOCA 4IOXA 4KHNA 1S9EA 1EWRA 5AQFA 3O9UA 3ZSXA 5KRSA 5BPNA 3VN5A 2P9SA 3AVBA 4M3ZA 1NOYA 4FZXC 1L3TA 2VCPA 3AVAA 3I8DA 4G9ZA 2C1IA 4DR5K 3IMXA 4DTUA 3O6WA 4CF9A 4EAHD 4HUFA 4CFDA 4JHDB 3NGIA 4AF1A 2QW9A 5DK5A 2E2QA 4EHTA 3TI0A 4MQ3A 3HP9A 3NCIA 5GAHP 3DRSA 4KTZA 1NK6A 1HMVA 4DQQA 5AQOA 1X9MA 5M1NA 4KHSA 3D2EB 1VSLA 4CJQA 1VQ9N 1HNXK 3VQCA 1VQ6N 1VSMA 2PY5A 3P5JA 2UYTA 1J5OA 4JLHA 3MECA 5IT9O 1ZC6A 4JI1K 2XHBA 4DHYA 1X9WA 2HHIA 3E66A 4FSVA 4KH4A 1NK8A 4BRKA 4DR3K 4LF6K 3AAPA 1KTQA 2HF4A 1H1VA 4BR0A 3U3GA 1NNEA 4L8RB 4CEDA 3DOKA 1XHXA 4DWIA 2KFNA 3HRGA 3AO1A 1JXEA 4JI4K 4DSLA 4FOEA 5JICA 4JKDA 3CQYA 1ZBIA 4KI4A 3DRPA 4IDHA 1UOCA 4CERA 3DMJA 1VQON 3OYAA 2ASMA 3OY9A 2FSJA 4FK2A 5GAEP 2G8KA 3GDQA 2P51A 1VSIA 2Q97A 4HCCA 3AVMA 4B9MA 3C94A 5EXWA 1FW6A 4IFEA 3DWLA 3ZLJA 3K57A 3NH0A 2A6AA 3F5TA 4ILGB 5FLXO 1OH5A 4IEEA 3VQ4A 1I94K 1EO1A 1XI1A 2HBJA 3CCRN 2RHKA 2ZQBA 5AFUH 4OGCA 2A41A 3WUHA 3HP6A 2BGGA 1QHAA 1U48A 2F7TA 3H1QA 4RW6A 5BRDA 1YI2N 1WSHA 4WE1A 4KTWA 3AARA 4C8KA 3ENBA 1VQ7N 3RTVA 4C8NA 1RBTA 3CXCM 1QVGM 5BN8A 2WC9A 3M1FA 2UXBK 4DQRA 3O08A 5E26A 2KW4A 4LF8K 3CC7N 3K0SA 3RR7A 3QIOA 4LF5K 4RCHA 1BISA 4JEPA 4PUOA 1VK0A 2HHWA 3HOSA 3A2FA 3DJCA 5AQXA 2QWNA 4FJLA 3H1VX 3CCLN 1NGIA 3AO4A 2GWKA 1T6CA 2VWJA 4E7HA 5EVZA 2P9NA 1E4FT 2O8EB 1NK7A 3V9ZA 3OYBA 4BRPA 4QS8A 3TAPA 3DLLL 4XEIA 1SL1A 1NK9A 4FVUA 4H0YB 3CJAA 1SAZA 4CZIA 2GUPA 3TTDA 3K59A 2OTJN 3DXMB 3MEEA 4CBXA 2YKNA 4H0OA 4E7JA 4M3TA 1RTIA 4MO5A 1XWLA 4FVMA 3OJSA 1HKCA 1RFQA 2V7YA 4BG9A 1BO5O 5GIPA 3QNOA 4K25A 4O0JA 5AQIA 5HLFA 3KHYA 4FM0A 3THXA 4KRFA 2KQ2A 2OANA 3RSEB 1JXBA 4ISEA 2O4GA 1G99A 5HRSA 1Z26A 1NGDA 2FC0A 2UUCK 1VQLN 4M3WA 4BWMA 2IS3A 4EHUA 2Q1NA 1P8ZA 2KZZA 4H5TA 4CJFA 3J7YP 3O3GA 1L3UA 1XUPO 2YKMA 3O5BA 3NVMA 2OPSA 1BL3A 1SS6A 3VA3A 1HNZK 4LFCK 1REVA 5AQTA 4E72A 5AR0A 1C1CA 3VEWA 3JYTA 2NZTA 4MLEA 4FWKA 2XY6A 4AQYK 4OLAA 2Z1GA 4JKGB 4JKEA 3KK1A 3O1BA 2EWSA 4E89A 2O8BB 1XHZA 2YHYA 1KAZA 3L4QA 1NJIO 5I9EB 1MWKA 2IVNA 3TTFA 2NRXA 1D4XA 1T7PA 1KFSA 2P9IA 4CK2A 4CJTA 3KZBA 3ZEUA 4Q5VA 3C6UA 1KD1O 1KFDA 3MN5A 3WNHA 1WAFA 4BRLA 1VAZA 2HHHK 3LDNA 1KQSM 1J53A 3MXIA 1XQSC 4KHYA 2F8SA 2QXFA 1UA0A 2E20A 3VERA 1NJYA 3LP3A 2E4LA 3OYHA 4NO7A 2P9SB 5AQMA 1NMDA 2X6SA 4I2QA 1T8EA 2NRRA 4CBUA 4NLCA 5C15A 2DFHA 3UB5A 2WUSA 4C8OA 2W41A 4B9LA 3O9TA 3SBTA 3SUOA 4A57A 3S41A 1NGHA 4ZTFA 1IV0A 3CCJN 4B08A 4A59A 3AO5A 4K8ZA 1J6ZA 1RDCA 4DSEA 4JK7A 2FBYA 1O1WA 1IKYA 1Z25A 2OPQA 2UXCK 4X66K 1I39A 1X3NA 5EU7A 5C10A 1NOZA 3F73A 1FXXA 3R9PA 3TAMA 4H5RA 2FSNA 4MDAA 3MEGA 4BC5A 4G1QA 5A2QO 3CC2N 3VQ7A 4FJ5A 1WB9A 2P9UB 2UUAK 3MN6A 2DY4A 2BDPA 2A1RA 1BGXT 2ITMA 5AZIA 4CFBA 2YNGA 3HSTB 3THWA 4B3TK 2WTUA 3SAHA 5KTQA 3KLIA 3L3VA 3TSPA 4GKJK 4CFAA 1VQKN 3VEZA 3NBPA 3LDLA 2Q0RA 3CCUN 1ZBUA 3H3NO 3VESA 3OW2M 1IH7A 4BGAA 1VSJA 4NXMK 3O9QA 5T7BA 3NHGA 4EZ6A 1VRUA 4HVJA 5CHIA 3RMAA 3CJ9A 4O8UA 1TKXA 3CCQN 2Y1IA 3TAEA 4YOVA 4FJKA 3WT0A 2IC3A 2WOMA 4AILC 1L5UA 1RBSA 4DTOA 1K73O 4B1UB 4W5OA 1S1TA 5C12A 2O4IA 2G8WA 2HBLA 4WF9L 5CYQA 4Z4EA 4B3RK 2B5JA 1YJ9N 3MAQA 2JLEA 2GV9A 2YNFA 4H5VA 4N41A 4B8AB 5FPEA 5JVGL 3J80O 2FSKA 3V1RA 3O4WA 5AQNA 4OLBA 1RT6A 3MEDA 3TAQA 3OVNA 3IKMA 4AHRA 4AHCA 2WONA 3D6RA 5BPMA 4DQSA 1SKRA 3AVGA 3EE9A 2ZJPL 3KD1E 4CFCA 3ENHA 3ALYA 3V4IA 3KK3A 4CHYA 3G71N 3QNNA 1C1AA 2V52B 3QLHA 4GV9A 1QZ6A 3CC4N 2E6LA 5LY3A 3MWTA 1J9AA 3O9RA 4M3RA 2F4VK 3K9JA 4I9LA 4CK1A 2HVIA 4CHQA 4CHOA 4FWPA 3A5OC 3ID6A 4DCHA 1RDWX 5F2RA 5LMUK 2F8TA 3ZT2A 3L2QA 4KB0A 3DLRA 5TKWA 3VTHA 2AP1A 2GBZA 4YHHK 2Q31A 4LF9K 4MO4A 3AVJA 4M3UA 5HBMA 4B3OA 4CIEA 4N76A 1QQCA 2A3ZA 4F9OA 2Q0UA 4OKKA 5KI6A 3ZT0A 2X78A 4CEEA 1YITN 3NF6A 2F96A 3U4LA 1BHLA 4PQUA 3ATVA 4BRNA 4BRDA 1TKDA 2QEXN 3UE5A 4DTNA 2ATQA 1W2BM 3V1OA 1K8KA 3KIOA 2BH1A 4DTSA 1KSPA 4DF4A 4CHNA 4FJIA 2NNWA 4C1NK 3F9MA 1MA9B 5AQQA 2D0AA 5BRHA 4FJNA 3OBYA 1R59O 3CCVN 3KK7A 3LDSA 4CZKA 4H5NA 1S1UA 5B8HA 3AVCA 3WEEB 3M8QA 1TAQA 4FWOA 4DV6K 2HF3A 3LAKA 3HBTA 1HLUA 1JLBA 3U6FA 4OKJA 5C0YA 1VSKA 3ZEUB 2QWPA 2NRHA 3KJVA 4C8LA 3VGKA 1SQKA 4IDKA 3OYMA 1D9DA 1HQEA 2RKIA 4BRFA 2JWLA 3GE1A 4CJ5A 3OYFA 1VRTA 1HPZA 1TK5A 2XY7A 3ZSRA 4JI5K 1JL2A 2NLXA 1VHXA 3HXMA 1SKSA 4CEAA 4BY9C 4EP4A 3G4SN 2HNYA 4DU1A 2Y1JA 4BQZA 3U9DA 1S1WA 3B6PA 1RBUA 4HUGA 1TAUA 4DTPA 3SQ1A 3SQ4A 1RBVA 1GLAG 1LCUA 3CCSN 2G8UA 3CPEA 3EKSA 1N32K 3H45C 1TL1A 4CE9A 3VQPA 4YDUC 2OZMA 2CGLA 1WSJA 4WQ4C 3NDKA 4IXCA 4BRMA 4CGHA 4M63C 3AO2A 4B9SA 2ZWHA 3IFRA 1HKBA 4J2AA 1D5AA 4XH4A 1LW0A 4FK4A 2Z1HA 5DM7L 5JVHL 1K9MO 2IDOA 4E0DA 1RDDA 3FZLA 4FWMA 4CZGA 4DR2K 4CGDA 5FRMA 3ZX0A 2HOEA 3FGUA 4AHSA 3QMLA 4KAZA 4FW2A 2VGNA 3F2KA 1QSYA 3VQ6A 4NB4A 1ZBLA 4CJSA 3HYFA 2OPPA 4K42A 2XO7A 1GOBA 4FLTA 1N8RO 4IO9L 1T44A 4DV3K 3AVLA 1WOQA 1MDUB 1XC3A 3CPWM 2GWJA 1BUPA 2P9LA 1VSDA 4OJRA 4E3SA 2E2OA 3T1AA 4BVPA 2RE2A 1U45A 4JKCA 3VENA 4KV8A 4E19A 3M5RA 1JLCA 3VOVA 4R79A 3T7ZA 3O3HA 1GLJO 3AVIA 5ELZA 5FDLA 3CFPA 4KBOA 2NRVA 2HHXA 5HRRA 1GLLO 2YHXA 3KVGA 3SYZA 1VQMN 4KTQA 4IKFA 1C0FA 3V6DA 4M3YA 4YFUA 2KKZA 3RVCA 1L3VA 4CCHA 4BC3A 3NF7A 2PZSA 3AV9A 3DI6A 4KHWA 5AZJB 4CJEA 1NGAA 2HNDA 2FLOA 1NKBA 1IG8A 3FZHA 3A5LC 2E8AA 3A5NC 2BUPA 2YHAA 4QS7A 3FZMA 1EKEA 4FJJA 3KKRA 3LP2A 3NF9A 1QTMA 3WNGA 3SQ0A 5AQSA 4IOAL 3E1YA 3RMBA 1IBKK 3MK6A 3BEXA 3K5MA 4DFMA 3UKUB 2W6LA 4I6MA 4DV4K 1FKPA 3THYA 2I7NA 2ASPA 3HVRA 4E1MA 5JENA 2E2NA 3CERA 1TYQA 1C0MA 3K2PA 5C2DA 4CJKA 1E3MA 3UKRB 1Q9YA 3T19A 4LFBK 3PX4A 4KI6A 4E1JA 3OTOK 4EFHA 1C0GA 3M8PA 2FF6A 1JJ2M 4JD2A 2O8CA 4HHTA 4CGFA 1NGEA 1OH8A 3CFOA 3LDOA 5H1SQ 3P4IA 2FBXA 3KK2A 3LP1A 1QQNA 4KH6A 1GOAA 4AHTA 3DXKA 3R3LA 3BDPA 4JI0K 4IOCL 5J2PA 1VQ5N 3J7AP 2DTUA 4GV3A 1BCMA 4ISGA 2O8FA 1GLFO 4NYNA 4YOTA 3R8EA 3D2FA 4O0IA 4JI2K 3L2RA 1NLVA 2P5OA 4IFYA 4ZTJA 3PO4A 3AGKA 3KLHA 4IG0A 1MU2A 2YX6A 2OA8A 3GL1A 3BZKA 1K8KB 2HW3A 4JKAA 1U47A 3OJUA 4CEBA 1Q9XA 1TK0A 1QS4A 2P9PA 5F1XA 5FRNA 2QKBA 1BQNA 2P1JA 1Z6RA 4FWSA 3BP8A 3LL3A 3MCPA 2LSNA 4CF8A 3KLEA 3I55N 2FBTA 1TKZA 3AA5X 3CJ7A 4WYBA 3K5LA 2PYJA 3VQQA 3JAMO 4CBWA 3ZSZA 1T3VA 3AAQA 4CJ7A 1U4BA 3FZKA 2VGMA 3KLFA 2E6MA 1YVNA 4CZMA 4OPKA 4H8KA 3HT3A 2ZJQL 1R0AA 3BUZB 4JI7K 2RN2A 1NGJA 2FF3B 5M1QA 5SWMA 4FM2A 1E4GT 1LOTB 3OS0A 3SI6A 4DSJA 4CZHA 4BROA 1WBDA 5AQYA 4IJNA 4CJWA 1LWEA 2P9KB 4CI6A 3TWHA 4H4MA 4LD0A 1ZBHA 4PA1A 1WN7A 1GLDG 4FCYA 1N33K 4O5FA 4CVNE 1B9DA 1U49A 3EEQA 2X74A 3EY1A 3ATUA 4JI3K 5BRFA 1YHQN 1ILYA 1NMNA 3V9SA 4QOZB 4B9QA 3ULEA 1T6DA 4KREA 4WFBL 3G6EN 1KCFA 4FO0A 3QB0A 4YORA 5M1PA 3TPQA 4DF8A 4DV7K 3NGZA 1QSLA 3IG1A 1WSEA 4YOXA 1VQNN 3U9ZA 3CI5A 3LPTA 3JS6A 4J2BA 5GADP 2D0CA 2P5GA 4NYFA 3S3NA 1Y64A 3H3OB 3QEVA 2HNZA 4OPHA 1BI4A 3BY5A 3MCAB 1LV5A 3ZSVA 4FJXA 4WCEL 1U2VA 1BU6O 4ILJA 3VA0A 3MDQA 4XH1A 1RILA 5BR9A 2YJFA 3HM9A 4C1NI 4NCAA 3SPZA 2QWLA 3VGLA 4K0KK 4BE2A 4BGBA 1IKVA 4W5RA 3EZ5A 3L0QA 3D45A 3HPHA 3VMFB 1C1BA 4CGIA 1VQ4N 3OYCA 2VWBA 2YNHA 1X9SA 4B9UA 1Q81O 2VG5A 4O44A 2O8DA 4N5SA 4RW9A 5ADXA 4FLYA 4JS4A 1S1VA 4DFKA 4FJ7A 3SLCA 4JKBA 5J2NA 3LANA 4IWVA 2XRIA 3QFPA 1TUUA 3SAGA 3I56N 2E1YA 3TU5A 1HYZA 4H03B 4AH9A 4DV5K 3DLGA 4E7LA 4A5BA 4BG8A 2E2PA 2KHOA 4DKWA 3V9XA 4CHPA 2CH6A 1IO2A 1P90A 4DB3A 4LSNA 4CJRA 3QBXA 2ZGYA 1BQMA 3A0IX 3HO1A 1WUAA 4ID5A 3O4QA 1DT9A 3BF1A 4CJLA 3SUNA 1C0TA 4BQLA 4DUZK 3TSQA 5BPLA 4Z4FA 4GKKK 3WNFA 5KRTA 4A2BA 2RPIA 4ELUA 3CETA 1YIJN 5AQKA 4LSLA 3EN9A 3MXJA 4Y0WA 2VG6A 2V51B 1WSIA 1LWFA 3QFUA 4AHVA 4I7FA 4CEFA 1QQMA 3HM8A 5J2QA 2F9WA 3WNEA 4F3TA 5DM6L 3HTVA 4J2EA 3CM5A 4H0XB 1HNIA 1TL3A 4F8RA 4M42A 3PX6A 1JKHA 1OH6A 2YI1A 3MN7A 4RWTA 4R5PA 5EOYA 4BRGA 2D0PA 2QTDA 1VQ8N 3UIQA 3HK2A 4BR2A 4CZFA 4U67L 4IZ9A 1WAJA 3SNNA 3NH2A 1HR0K 3VF6A 4BE1A 3Q7BA 3SPYA 3WQTA 3SZ2A 1Q7YO 3FR0A 1NK0A 3SCXA 4DLGA 3D2FB 2VQEK 4W5TA 4I2PA 3FE1A 2QXLA 3M3ZA 4JHDA 4B9VA 4DV0K 2ZM6K 5JLFA 2G8FA 3CMAN 4B9NA 3VEOA 2P9PB 1EP4A 4YDUA 3CJCA 3J8AA 4DSFA 4FJHA 3ZYYX 1VSEA 5SZTA 4WQ4A 3CHWA 3NMUA 2IGIA 3G10A 2P9NB 4RG8A 4Z4HA 2ZJRL 4K41A 2BTFA 3FZFA 4MLHA 1I3AA 3T3FA 3DLKA 3LWLA 2NRTA 1RDBA 1XNQK 4PKIA 4DU4A 1ASVA 3VF2A 3CYGA 1YTAA 3EZWA 4C23A 4CF2A 4EIAA 4A62A 1SL2A 4GVEA 1XC9A 4DTXA 1KXPA 4BE7B 4KHPK 3HL8A 4X65K 1RBRA 3THXB 4JNEA 3GBTA 4FPBA 1NJXA 2HMPA 4JAXA 1IJJA 5K14A 3HPGA 2RF2A 1ZBFA 1S6QA 2VWKA 4CW7B 3VQBA 4JKHA 3O3FA 4KB1A 1S22A 3VETA 3K5NA 3KD5E 1J54A 1G15A 5KPZA 1YJNN 4DFJA 3OYGA 3IDHA 5AQHA 3WXMB 1B92A 1UA1A 1JLGA 3W0LA 1DEJA 3DLHA 4FYDA 4N47A 1JCEA 4JRQA 1C0UA 3NH1A 1S1XA 2J4RA 3SMSA 2GX9A 3HI0A 4W5NA 4CF1A 4AM6A 1BCOA 4UY8O 4DV2K 1BI4B 1EQYA 3ZSWA 3WXKA 4DR4K 1RT5A 3ZETA 3OYNA 3OYKA 2P9IB 2PYLA 3RRGA 4I9QA 3ZSQA 2WBNA 3QIPA 4OPAA 3EYZA 1U04A 3DLEA 3SAFA 4DQIA 3C0BA 4BECA 3QEPA 2F9TA 5CZ1A 1UAXA 3RR8A 4LH5A 2O8EA 2HHUA 1OH7A 4DUYK 3ZSYA 1KLNA 3SV3A 5E84A 3THVA 2KLAA 2C1GA 1SZ2A 4M45A 5BR8K 3CCMN 4PWDA 1JL1A 4PL8A 4OX9K 4JYAK 1RT1A 3S3OA 3LM2A 1L3SA 4WQ5C 1NBWA 4CIGA 3M8SA 2HBKA 4JK8A 3NAEA 3QERA 3DXMA 4U7BA 2QK9A 2NRWA 3K5OA 2W40A 3ID8A 3VQ9A 4FW1A 5LMNK 2D4WA 4NCBA 3CFRA 3RWUA 1RT4A 3CMEN 3NGYA 3LP0A 4IBNA 4FWNA 2GELA 1DLOA 4DQPA 3OA9A 3CIPA 5ADXH 1TUYA 2UXDK 3AA4A 1ATRA 3RSEA 5JMVA 2Q2RA 3SV4A 1ATNA 2FBVA 3H46O 4LF4K 1NK5A 3C6TA 5C25A 5LL6Z 1HYVA 4H0VB 4DSIA 4DTRA 3I0SA 3A8YA 2ITGA 2DFFA 4RW4A 3ZT1A 4LH4A 3T69A 3OYIA 1ASWA 3V1QA 4ID1A 1NGBA 3PX0A 3O9SA 1HJOA 4PKHA 4F2SA 4FZYA 3LALA 1CXQA 4YOWA 1JLFA 3D0PA 3IUCA 3CJ1A 1NG9A 4MDBA 5AZIB 3LAMA 3THWB 2HSTA 4CJVA 4HTLA 4ELVA 5JLHA 1SV5A 2EX3A 3PIPL 5LJVA 3DYAA 2O8BA 4CGJA 1VSHA 4RW8A 3C7NA 1BWFO 1ESVA 4H5WA 3L4IA 3OYDA 4NLBA 2QWMA 3SUQA 1TK8A 1S6PA 2D5RA 4FM1A 1TKTA 3NFAA 4ELTA 3OYJA 5FPDA 3L2WA 1HPMA 4FLWA 4BE0A 3SK3A 1YVUA 3MN9A 4FXDA 1CXUA 3TAGA 3MX5A 2IVPA 3M6GA 3WQUA 3EO3A 1C6VA 1LWCA 5I42A 1Z05A 4BC2A 3ULDA 2G8VA 2Q3SA 4FLUA 1EETA 3CF5L 4B1VA 4XH5A 3L3UA 1N6QA 4X62K 1T05A 4BDPA 1QVFM 2W00A 1B9FA 3LDQA 2G8HA 2HB5A 4CEQA 3CQ8A 1CZBA 1NWKA 3WXIA 4B1XB 4CJ4A 2YHWA 1BA1A 3E9LA 3KWIA 3S9HA 3C95A 4AM7A 3D7EO 3IRXA 2HHTA 1JCFA 1N34K 2GUIA 4DS5A 3RRHA 3F9KA 4BR4A 3CG7A 4F2RA 4QCLA 3QO9A 1JCGA 4E7KA 3E9PA 1DTTA 4CESA 4H0TB 4UQGA 3JXUA 3DM2A 1LAVA 4JN4A 3LM9A 4BR7A 2P9UA 3L6QA 5C2FA 3V81A 1M1KO 2OYQA 3U8XA 4F3OA 1X3MA 4OO1J 5KPTA 3ZX2A 4YNQA 1JLEA 4DU3A 1RTHA 4XIUA 1RDAA 4BWJA 3SQ2A 1KAYA 1N5YA 2IIRA 5HRPA 1YF5L 4AHUA 4M7XA 3S3MA 4DR1K 3S5TA 4DR6K 1NU0A 5KQ8A 3EKUA 1HRHA 4LC9B 3VQEA 1FJGK 3VQAA 1QE1A 2WFBA 4FWQA 3NVKA 3GOIA 1YT3A 1D8YA 4CZLA 2HMIA 5HL7L 4FK0A 4BRQA 1HNWK 4A5AA 1U6ZA 3T1YK 4YOYA 1XNRK 4BR5A 1W97L 2OZSA 5JS1A 2CGKA 1A5VA 2UUBK 3P83D 3LPUA 4GW6A 4C8MA 4FJMA 1QSSA 3K9KA 3P31A 3K58A 3FFKB 2YJEA 2DFEA 2NUBA 1SUQA 2QWQA 4DR7K 3B6OA 3JSMA 3BZCA 3ZETB 3VQ5A 3OYLA 3QESA 4NXNK 1NM1A 5M1FA 5IWAK 2IAJA 4FWLA 1WLJA 5M1OA 1BDGA 4CGGA 5KGWA 5E41A 3LDPA 1HKGA 1NK4A 1LAWA 2Z1IA 1A5XA 2VYPA 1HUXA 1BIZA 1HJRA 1ITGA 1CLQA 4FPAA 4CJUA 2KTQA 1OKJA 3QINA 3ITHA 1J5EK 3MWPA 3Q7CA 2D0OA 1RT3A 3KTQA 4K8XA 1QQOA 1TGOA 4Q0BA 1VSFA 1RGIA 2YV0X 1V4SA 4TSXA 1HYSA 1BG3A 3RMDA 1RNHA 5C24A 3OS1A 3ZSOA 1KAXA 4QS9A 3HVTA 4BRHA 4CD1A 4FZZA 3AVHA 4BEBA 3AY9A 3I0RA 1DKGD 4ZHRA 3O80A 2BANA 3QICA 3AVKA 4BACA 3E01A 5AJ3K 4CK3A 1K8AO 3WXJA 3ASMA 4PL7A 4LFAK 5HROA 3ZX3A 3AA3A 3AVFA 3HOTA 3MX2A 3LZIA 4FOIA 4EZ9A 3IS9A 3TANA 2HHVA 4K43A 1IG9A 5AQJA 4B9TA 4J8FA 4Y1DA 1X1PA 4DS4A 1DGKN 3O8MA 4RTFD 5BN9A 4Z4GA 2OPRA 4A2AA 1JLAA 4JK9A 1EWQA 4FL9A 3U3YA 3OYEA 1GLCG 3QDKA 3SBGA 4O55A 2KZMA 4N56A 3O4NA 4IG3A 1X9JA 1TVRA 3C7NB 1HNVA 1K6YA 1RDUA 3WEEA 4CEOA 2YCHA 5D3GA 2D1KA 3ZT3A 2ZGZA 3RMCA 3NF8A 3WXLA 1BA0A 3SUPA 1N36K 4XJXA 3PY8A 2P9LB 3AA2A 3H08A 1SKWA 5AQZA 3E9OA 4Z4CA 1NKCA 2CH5A 3ZT4A 3ZCMA 3PSIA 4HUEA 2YHBA 4Z0UA 1GLEG 1S9GA 1XMQK 4Z94A 2QWRA 2I7PA 1QHTA 2XY5A 4KH5A 1O13A 4FWRA 3PUFA 3C65A 1ATSA 3VEXA 4Z4IA 1T03A 4FJ9A 1KC8O 5BREA 2AJQA 2QKKA 4YOUA 2H3GX 1HX1A 2Z1JA 3N4PA 2QM1A 2QA4N 4WFAL 5CZ2A 3DAWA 1QZ5A 4M7YA 3VPZA 5KPRA 3O1WA 2FXUA 3R1XA 4RW7A 3L2VA 1NGGA 4KO0A 3R6MA 4PY5A 3QBWA 3AVNA 4ILHA 3L2UA 3J81O 4GMJB 3QEXA 2EHGA 3N4QA 4DSKA 5AQWA 3OS2A 5FPMA 5DMRA 1Q8IA 4IFVA 5HRNA 1D9FA 4E1NA 4I6MB 1NKEA 1A5WA 3VTIA 3THYB 2YNIA 3VEYA 5GINA 5AQVA 4CD3A 2E5LK 1TYQB 3VQ8A 3I8BA 4LY7A 1Q86O 3P39A 3KKSA 4JD2B 2O8CB 5F0XA 4DLEA 4DMNA 4KHQA 5JS2A 2CGJA 4CECA 1F21A 1OVQA 1IBLK 4BC4A 4HTUA 4NCGA 3GG4A 4BRAA 4KPYA 2HVHA 5FROA 4B3MK 3KLGA 1RTDA 4LF7K 1V4TA 3VQDA 1RT7A 3HZ6A 3EE8A 5I3UA 3DXKB 4CJPA 3V9WA 4FLVA 4CJ3A 3MMVA 3J7ZO 4WQ5A 3AGRA 2O8FB 2V7ZA 4X64K 2D0BA 4M3XA 4PKGA 2G8IA 2BE2A 3C6AA 4CIFA 4HCBA 3P38A 1HQUA 1KVCA 4BDYA 3G25A 3H6EA 3V9UA 1YUWA 2NRZA 4OGEA 2KFZA 4JI8K 2R7YA 1DTQA 2UU9K
chains in the Genus database with same CATH topology
2GELA 4EFHA 3O1BA 3OA9A 5MLCQ 2EWSA 1C0GA 3CIPA 3D2EA 2FF6A 2YHYA 4BR9A 4JD2A 1KAZA 5ADXH 1ZBSA 1TUYA 3C6HA 3L4QA 5I9EB 5JMVA 1ATRA 1MWKA 1NGEA 2IVNA 3A5MC 2NRXA 2Q2RA 3RSEA 3LDOA 1D4XA 1VQPN 5FPNA 5H1SQ 2GTDA 2P9IA 3P4IA 1ATNA 5AZJA 4GV6A 3H46O 3KZBA 2OTLN 1QQNA 4KH6A 3ZEUA 5HOOA 3CJBA 1KD1O 3MN5A 4BRLA 1VAZA 5CR4A 1Q82O 3DXKA 4H0VB 3R3LA 3EL2A 4IOCL 1CZAN 1VQ5N 3CQXA 3LDNA 3A8YA 1KQSM 4GV3A 4ISGA 1XQSC 1GLFO 4IEIA 2GEMA 3PLAA 3T69A 2E20A 4CZEA 4YOTA 3VERA 3R8EA 3D2FA 1NGBA 1NLVA 4NO7A 2P9SB 5AQMA 1NMDA 3AGKA 3O9SA 3UKUA 1HJOA 4O8KA 4PKHA 5GIOA 2YX6A 4YOWA 3GL1A 3IUCA 3TTCA 3CJ1A 1K8KB 4MDBA 5AZIB 2NRRA 5AQPA 4JKAA 4CBUA 4NLCA 5C15A 2HSTA 3CCEN 5M1KA 1NGCA 3UB5A 4HTLA 1BOTO 3B8AX 2WUSA 3UKRA 5JLHA 2P9PA 2QI2A 5F1XA 2W41A 3PIPL 3I33A 3O9TA 1Z6RA 5LJVA 3SJHA 3BF3A 3C7NA 4FWSA 3SBTA 3BP8A 3LL3A 5EY4A 3MCPA 4A57A 5AFUA 5TKYA 3S41A 1NGHA 3I55N 1BWFO 1ESVA 3CJ7A 4WYBA 2A5XA 3CCJN 4H5WA 3L4IA 4A59A 4NLBA 3ULEB 1NGFA 1J6ZA 4JK7A 4CBWA 2QWMA 2ASOA 1T3VA 3AAQA 4CJ7A 1YXQA 4BRIA 3FZKA 4JKFA 2VGMA 1X3NA 5C10A 1YVNA 4CZMA 2ZJQL 3BUZB 3R9PA 4H5RA 2FSNA 4MDAA 3W3DA 1NGJA 2FF3B 5AQLA 5M1QA 4BC5A 5FPDA 5KQDA 1E4GT 1HPMA 1LOTB 3CC2N 2E88A 3SK3A 2P9UB 1OVYA 3MN9A 4CZHA 3MN6A 2E1ZA 4BROA 5AQYA 4IJNA 2P9KB 3MX5A 2DPNA 2A40A 2IVPA 3M6GA 5EX5A 2ITMA 5AZIA 3VEVA 3WQUA 4CI6A 3EO3A 4BVOA 3SAHA 1GLDG 1Z05A 4BC2A 5GAGP 1U2VB 3CF5L 4O5FA 3TSPA 3CCSN 4B1VA 4XH5A 1QVFM 2W00A 1VQKN 3VEZA 2ZF5O 3LDLA 2Q0RA 3LDQA 3HSCA 1GLBG 3ATUA 3VGMA 3CCUN 3H3NO 5BRFA 1NWKA 3VESA 3WXIA 3OW2M 1YHQN 1ILYA 1MWMA 4BGAA 3ULEA 1T6DA 4B1XB 2YHWA 1BA1A 4B9QA 4WFBL 3G6EN 3E9LA 4FO0A 3KWIA 3O9QA 3QB0A 4YORA 5M1PA 3TPQA 4AM7A 5CE3A 3D7EO 4IO8A 4YOXA 1JCFA 5CHIA 4BR4A 3CJ9A 4BREA 3PIOL 4O8UA 3U9ZA 3CCQN 3CI5A 1VQNN 4YOVA 3WT0A 1JCGA 1Q18A 1M90O 3JS6A 2QWOA 5GADP 3E9PA 1K73O 1Y64A 3H3OB 4B1UB 4H0TB 3SMPA 3JXUA 5C12A 4JN4A 3LM9A 4BR7A 2P9UA 3L6QA 2HBLA 4WF9L 4WFNL 5C2FA 2HBMA 4PHTX 4OPHA 1M1KO 3U8XA 1ZXOA 2P9KA 1X3MA 4OO1J 5KPTA 3ZX2A 2PAVA 1YJ9N 4L3QA 4BRCA 4H5VA 5FPEA 1S72N 5JVGL 4B1WB 3MCAB 3ENOA 2FSKA 4IJAA 3O4WA 4WCEL 1U2VA 4A61A 1KAYA 5AQNA 2IIRA 1BU6O 5AQGA 4B1ZA 1YF5L 4ILJA 3MDQA 4M7XA 4XH1A 3IKMA 3D6RA 5BPMA 2YJFA 4GY2B 5BR9A 3EKUA 5KQ8A 3TSUA 3EE9A 2ZJPL 4LC9B 4C1NI 1YJWN 3ENHA 2QWLA 3VGLA 2WFBA 4BGBA 4FWQA 3NVKA 3L0QA 4GNIA 3G71N 2V52B 5AQRA 3VMFB 3GOIA 4HWIA 4GV9A 1QZ6A 4CZLA 1VQ4N 5HL7L 4BRQA 3CC4N 5LY3A 3CD6N 2VWBA 3MWTA 4A5AA 1U6ZA 4YOYA 1Q81O 1YAGA 4BR5A 4H0PA 1W97L 3O9RA 3FLCO 2CGKA 3K9JA 5ADXA 3OHRA 4JKGA 3SLCA 2PBDA 3A5OC 4FWPA 3ID6A 4JKBA 4DCHA 1RDWX 5F2RA 2A42A 4IWVA 3QFPA 1TUUA 3SAGA 3K9KA 2JWKA 3I56N 3P31A 2PFUA 5TKWA 5AQUA 4CZJA 4DQ8A 2E1YA 1S3XA 3FFKB 3TU5A 4H03B 2YJEA 3VTHA 2AP1A 4ISFA 5LJWA 3KWGA 4A5BA 4BG8A 2Q31A 4B1YB 2E2PA 2KHOA 2QWQA 4MO4A 4DKWA 1QVGM 2IVOA 2CH6A 4DB3A 1P90A 2Q36A 3QBXA 2ZGYA 3ZETB 3VF4A 1NM1A 2A3ZA 3OBWA 3TTFA 4F9OA 2Q0UA 5M1FA 2AA4A 4FWLA 5M1OA 3A0IX 1BDGA 1WUAA 3LDPA 1HKGA 1DT9A 2VYPA 1HUXA 4IOXA 3BF1A 1YITN 4BQLA 4FPAA 3U4LA 5AQFA 3O9UA 3TSQA 1OKJA 3ATVA 5BPLA 5BPNA 3MWPA 4BRNA 4BRDA 2P9SA 4A2BA 2QEXN 2VCPA 3UE5A 3CETA 4G9ZA 1YIJN 1W2BM 2C1IA 5AQKA 3IMXA 2D0OA 3Q7CA 3EN9A 3O6WA 4Y0WA 2V51B 1K8KA 1QQOA 4EAHD 2BH1A 3QFUA 1QQMA 4JHDB 2NNWA 3HM8A 1RGIA 4AF1A 2F9WA 4C1NK 2QW9A 2E2QA 1V4SA 3F9MA 5DM6L 3HTVA 4H0XB 1MA9B 5AQQA 4EHTA 5BRHA 1BG3A 3OBYA 5GAHP 1R59O 3CCVN 3KK7A 5AQOA 4CZKA 2YI1A 1KAXA 3MN7A 4QS9A 4H5NA 4BRHA 4CD1A 3D2EB 5B8HA 5M1NA 4RWTA 5EOYA 1VQ9N 3AY9A 4BEBA 3WEEB 4BRGA 1DKGD 2D0PA 2QTDA 4FWOA 2HF3A 3O80A 1VQ8N 1VQ6N 2UYTA 4BR2A 4CZFA 4U67L 3HBTA 3QICA 1ZC6A 1HLUA 4IZ9A 5C0YA 4DHYA 3ZEUB 2QWPA 2NRHA 1K8AO 3E66A 3VF6A 3WXJA 3VGKA 4FSVA 4KH4A 1SQKA 4BRKA 3AAPA 3Q7BA 4PL7A 2HF4A 3ZX3A 1H1VA 4BRFA 4BR0A 2JWLA 3GE1A 3WQTA 3HOTA 3MX2A 1Q7YO 3FR0A 3HRGA 4FOIA 4FOEA 5JICA 2NLXA 3CQYA 3D2FB 4JKDA 4K43A 5AQJA 4J8FA 3FE1A 4IDHA 4BY9C 2QXLA 3M3ZA 4JHDA 3G4SN 1DGKN 4BQZA 3O8MA 3U9DA 4RTFD 1VQON 2ASMA 5BN9A 2FSJA 5JLFA 4A2AA 5GAEP 3GDQA 4JK9A 2Q97A 3CMAN 3VEOA 4FL9A 2P9PB 1GLCG 4YDUA 1GLAG 1LCUA 3DWLA 3QDKA 3CJCA 3CPEA 3EKSA 3J8AA 4IFEA 3SBGA 3H45C 5EXWA 3ZYYX 1X9JA 3C7NB 4WQ4A 3CHWA 3NMUA 2A6AA 3F5TA 1RDUA 3WEEA 4ILGB 2P9NB 2YCHA 2D1KA 4IEEA 2ZGZA 3WXLA 4YDUC 2ZJRL 1EO1A 4K41A 2HBJA 1BA0A 2BTFA 2CGLA 4XJXA 4WQ4C 3CCRN 2P9LB 4IXCA 4BRMA 2RHKA 3FZFA 4MLHA 5AFUH 5AQZA 2A41A 4M63C 3E9OA 2NRTA 3WUHA 1QHAA 2CH5A 4PKIA 2F7TA 3H1QA 2ZWHA 3IFRA 5BRDA 1YI2N 1HKBA 3VF2A 3AARA 4XH4A 3ENBA 1VQ7N 3EZWA 4C23A 5DM7L 3CXCM 1GLEG 4A62A 4EIAA 5BN8A 2WC9A 2QWRA 3M1FA 4GVEA 4Z94A 2I7PA 5JVHL 1K9MO 1KXPA 4BE7B 3O08A 4KH5A 5E26A 1O13A 4FWRA 3C65A 3FZLA 1ATSA 4FWMA 3VEXA 4CZGA 3CC7N 4JNEA 3GBTA 3ZX0A 2HOEA 4FPBA 3FGUA 5BREA 3QMLA 1KC8O 2HMPA 4YOUA 4RCHA 4JAXA 4JEPA 1IJJA 2H3GX 1HX1A 3N4PA 2QA4N 2QM1A 4WFAL 3HOSA 2VGNA 3DAWA 3DJCA 3F2KA 5AQXA 1QZ5A 2QWNA 4M7YA 3VPZA 4NB4A 5KPRA 4JKHA 3H1VX 3CCLN 1NGIA 3O1WA 2FXUA 2GWKA 4E1JA 3R1XA 1T6CA 1S22A 3VETA 5EVZA 1NGGA 2P9NA 1E4FT 4K42A 3R6MA 1N8RO 5KPZA 1YJNN 3QBWA 4IO9L 1T44A 4ILHA 4BRPA 1WOQA 1MDUB 1XC3A 4QS8A 3CPWM 3IDHA 2GWJA 5AQHA 1BUPA 3WXMB 2P9LA 3N4QA 1NJIO 2E2OA 4XEIA 4BVPA 3DLLL 2RE2A 5AQWA 5FPMA 4JKCA 3VENA 4FVUA 4H0YB 3M5RA 3CJAA 3W0LA 1DEJA 1SAZA 3VOVA 4I6MB 4CZIA 2GUPA 1JCEA 3T7ZA 4R79A 3VTIA 3TTDA 2OTJN 1GLJO 3DXMB 4CBXA 5ELZA 2J4RA 3SMSA 3VEYA 5GINA 2GX9A 4KBOA 2NRVA 5AQVA 3HI0A 4CD3A 1TYQB 1GLLO 4H0OA 4AM6A 4UY8O 2YHXA 3KVGA 4MO5A 3I8BA 1HKCA 1RFQA 2V7YA 4BG9A 1BO5O 3P39A 1C0FA 5GIPA 4K25A 5AQIA 1Q86O 1VQMN 3KHYA 1EQYA 3WXKA 4JD2B 2KKZA 5F0XA 2OANA 3RSEB 3RVCA 2CGJA 4ISEA 4BC3A 3ZETA 2P9IB 1G99A 2WBNA 5AZJB 4OPAA 1NGDA 4BC4A 1NGAA 3GG4A 4BRAA 3SAFA 3C0BA 4BECA 2FLOA 2F9TA 1V4TA 1VQLN 3HZ6A 1IG8A 3FZHA 3A5LC 3EE8A 2E8AA 3A5NC 3DXKB 2BUPA 4EHUA 2Q1NA 1P8ZA 4QS7A 3FZMA 3MMVA 4H5TA 3J7ZO 4WQ5A 3AGRA 2V7ZA 1XUPO 5E84A 2KLAA 2C1GA 1SZ2A 3O5BA 4PKGA 3CCMN 5AQSA 4IOAL 3E1YA 4PL8A 3C6AA 3NVMA 3LM2A 3BEXA 3MK6A 1SS6A 3P38A 4WQ5C 1NBWA 3UKUB 5AQTA 4I6MA 3G25A 2HBKA 3H6EA 4JK8A 1YUWA 3DXMA 1JJ2M 2I7NA 5AR0A 3VEWA 4U7BA 2ASPA 2NZTA 4MLEA 2E2NA 4FWKA 2NRZA 2NRWA 2W40A 3CERA 1TYQA 3ID8A 5C2DA 4JKGB 2D4WA 3UKRB 4JKEA 3CMEN 4FWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GEL A;  4EFH A;  3O1B A;  2EWS A;  1C0G A;  3CIP A;  3D2E A;  2FF6 A;  2YHY A;  4BR9 A;  4JD2 A;  1KAZ A;  5ADX H;  1ZBS A;  1TUY A;  5I9E B;  5JMV A;  1ATR A;  1MWK A;  1NGE A;  2IVN A;  3A5M C;  3RSE A;  2Q2R A;  3LDO A;  1D4X A;  5FPN A;  2GTD A;  2P9I A;  3P4I A;  1ATN A;  5AZJ A;  3H46 O;  3KZB A;  1QQN A;  3ZEU A;  3CJB A;  3MN5 A;  4BRL A;  3DXK A;  4H0V B;  3EL2 A;  1CZA N;  3CQX A;  3LDN A;  3A8Y A;  4ISG A;  1XQS C;  1GLF O;  2GEM A;  2E20 A;  4CZE A;  3VER A;  3R8E A;  3D2F A;  1NGB A;  1NLV A;  4NO7 A;  2P9S B;  5AQM A;  1NMD A;  3UKU A;  1HJO A;  4O8K A;  4PKH A;  3GL1 A;  3IUC A;  3CJ1 A;  1K8K B;  5AZI B;  5AQP A;  4CBU A;  1NGC A;  3UB5 A;  4HTL A;  1BOT O;  3B8A X;  2WUS A;  3UKR A;  5JLH A;  2P9P A;  5F1X A;  2W41 A;  3I33 A;  1Z6R A;  5LJV A;  3SJH A;  3BF3 A;  3C7N A;  4FWS A;  3BP8 A;  3LL3 A;  5EY4 A;  3MCP A;  5AFU A;  5TKY A;  3S41 A;  1NGH A;  1BWF O;  1ESV A;  3CJ7 A;  4WYB A;  2A5X A;  4H5W A;  3L4I A;  3ULE B;  1NGF A;  1J6Z A;  4CBW A;  2QWM A;  2ASO A;  3AAQ A;  4CJ7 A;  1YXQ A;  4BRI A;  3FZK A;  1X3N A;  1YVN A;  4CZM A;  3BUZ B;  3R9P A;  4H5R A;  2FSN A;  3W3D A;  1NGJ A;  2FF3 B;  5AQL A;  4BC5 A;  5FPD A;  5KQD A;  1E4G T;  1HPM A;  1LOT B;  2E88 A;  3SK3 A;  2P9U B;  3MN9 A;  4CZH A;  3MN6 A;  2E1Z A;  4BRO A;  5AQY A;  4IJN A;  2P9K B;  2DPN A;  2A40 A;  2IVP A;  3M6G A;  5EX5 A;  2ITM A;  5AZI A;  3VEV A;  3WQU A;  4CI6 A;  3EO3 A;  4BVO A;  1GLD G;  1Z05 A;  4BC2 A;  1U2V B;  4O5F A;  4B1V A;  4XH5 A;  3VEZ A;  2ZF5 O;  3LDL A;  2Q0R A;  3LDQ A;  3HSC A;  1GLB G;  3ATU A;  3VGM A;  3H3N O;  5BRF A;  1NWK A;  3VES A;  3WXI A;  1MWM A;  4BGA A;  3ULE A;  1T6D A;  4B1X B;  2YHW A;  1BA1 A;  4B9Q A;  4FO0 A;  3QB0 A;  3TPQ A;  4AM7 A;  5CE3 A;  3D7E O;  4IO8 A;  1JCF A;  4BR4 A;  3CJ9 A;  4BRE A;  3U9Z A;  3CI5 A;  3WT0 A;  1JCG A;  1Q18 A;  3JS6 A;  2QWO A;  1Y64 A;  3H3O B;  4B1U B;  4H0T B;  3SMP A;  3JXU A;  4JN4 A;  3LM9 A;  4BR7 A;  2P9U A;  3L6Q A;  3U8X A;  1ZXO A;  2P9K A;  1X3M A;  5KPT A;  3ZX2 A;  2PAV A;  4L3Q A;  4BRC A;  4H5V A;  5FPE A;  4B1W B;  3ENO A;  2FSK A;  4IJA A;  3O4W A;  1U2V A;  4A61 A;  1KAY A;  5AQN A;  2IIR A;  1BU6 O;  5AQG A;  4B1Z A;  3MDQ A;  4M7X A;  4XH1 A;  5BPM A;  2YJF A;  4GY2 B;  5BR9 A;  3EKU A;  5KQ8 A;  4LC9 B;  3ENH A;  2QWL A;  3VGL A;  4BGB A;  4FWQ A;  3L0Q A;  4GNI A;  2V52 B;  5AQR A;  3GOI A;  4HWI A;  1QZ6 A;  4CZL A;  4BRQ A;  5LY3 A;  2VWB A;  1U6Z A;  1YAG A;  4BR5 A;  4H0P A;  3FLC O;  2CGK A;  5ADX A;  3OHR A;  3SLC A;  2PBD A;  3A5O C;  4FWP A;  4DCH A;  1RDW X;  5F2R A;  2A42 A;  4IWV A;  3QFP A;  1TUU A;  5AQU A;  4CZJ A;  4DQ8 A;  2E1Y A;  1S3X A;  3FFK B;  3TU5 A;  4H03 B;  2YJE A;  2AP1 A;  4ISF A;  5LJW A;  4BG8 A;  2Q31 A;  4B1Y B;  2E2P A;  2KHO A;  2QWQ A;  4MO4 A;  2IVO A;  2CH6 A;  4DB3 A;  2Q36 A;  3QBX A;  2ZGY A;  3ZET B;  3VF4 A;  1NM1 A;  2A3Z A;  4F9O A;  2Q0U A;  2AA4 A;  4FWL A;  3A0I X;  1BDG A;  1WUA A;  3LDP A;  1HKG A;  2VYP A;  1HUX A;  3BF1 A;  4BQL A;  4FPA A;  3U4L A;  5AQF A;  1OKJ A;  3ATV A;  5BPL A;  5BPN A;  4BRN A;  4BRD A;  2P9S A;  4A2B A;  2VCP A;  3UE5 A;  3CET A;  5AQK A;  3IMX A;  2D0O A;  3EN9 A;  3O6W A;  4Y0W A;  2V51 B;  1K8K A;  1QQO A;  4EAH D;  3QFU A;  1QQM A;  4JHD B;  3HM8 A;  1RGI A;  2F9W A;  2QW9 A;  2E2Q A;  1V4S A;  3F9M A;  3HTV A;  4H0X B;  1MA9 B;  5AQQ A;  4EHT A;  5BRH A;  1BG3 A;  1R59 O;  5AQO A;  4CZK A;  2YI1 A;  1KAX A;  3MN7 A;  4QS9 A;  4H5N A;  4BRH A;  4CD1 A;  3D2E B;  5B8H A;  4RWT A;  5EOY A;  3AY9 A;  3WEE B;  4BRG A;  1DKG D;  2D0P A;  4FWO A;  2HF3 A;  3O80 A;  2UYT A;  4BR2 A;  4CZF A;  3HBT A;  3QIC A;  1ZC6 A;  1HLU A;  4IZ9 A;  4DHY A;  3ZEU B;  2QWP A;  2NRH A;  3VF6 A;  3WXJ A;  3VGK A;  4FSV A;  1SQK A;  4BRK A;  3AAP A;  4PL7 A;  2HF4 A;  3ZX3 A;  1H1V A;  4BRF A;  4BR0 A;  3GE1 A;  3WQT A;  3FR0 A;  4FOI A;  4FOE A;  5JIC A;  2NLX A;  3CQY A;  3D2F B;  4K43 A;  5AQJ A;  4J8F A;  3FE1 A;  2QXL A;  3M3Z A;  4JHD A;  1DGK N;  4BQZ A;  3O8M A;  3U9D A;  4RTF D;  2ASM A;  5BN9 A;  2FSJ A;  5JLF A;  4A2A A;  3GDQ A;  2Q97 A;  3VEO A;  4FL9 A;  2P9P B;  1GLC G;  4YDU A;  1GLA G;  1LCU A;  3DWL A;  3QDK A;  3CJC A;  3EKS A;  3J8A A;  5EXW A;  3H45 C;  1X9J A;  3C7N B;  4WQ4 A;  3CHW A;  2A6A A;  3WEE A;  2P9N B;  2YCH A;  2D1K A;  2ZGZ A;  3WXL A;  4YDU C;  4K41 A;  1BA0 A;  2BTF A;  2CGL A;  4WQ4 C;  2P9L B;  4IXC A;  4BRM A;  3FZF A;  4MLH A;  5AFU H;  5AQZ A;  2A41 A;  4M63 C;  3WUH A;  1QHA A;  2CH5 A;  4PKI A;  3H1Q A;  2ZWH A;  3IFR A;  5BRD A;  1HKB A;  3VF2 A;  3AAR A;  4XH4 A;  3EZW A;  4C23 A;  1GLE G;  4A62 A;  4EIA A;  5BN8 A;  4Z94 A;  2QWR A;  3M1F A;  2I7P A;  1KXP A;  3O08 A;  5E26 A;  4FWR A;  3FZL A;  1ATS A;  4FWM A;  3VEX A;  4CZG A;  4JNE A;  3GBT A;  3ZX0 A;  2HOE A;  4FPB A;  3FGU A;  5BRE A;  3QML A;  2HMP A;  4RCH A;  4JAX A;  1IJJ A;  2H3G X;  1HX1 A;  2QM1 A;  3DAW A;  3DJC A;  5AQX A;  1QZ5 A;  2QWN A;  4M7Y A;  3VPZ A;  4NB4 A;  5KPR A;  3H1V X;  1NGI A;  3O1W A;  2FXU A;  2GWK A;  4E1J A;  1T6C A;  1S22 A;  3VET A;  5EVZ A;  1NGG A;  2P9N A;  1E4F T;  4K42 A;  3R6M A;  5KPZ A;  3QBW A;  1T44 A;  4BRP A;  1WOQ A;  1MDU B;  1XC3 A;  4QS8 A;  3IDH A;  2GWJ A;  5AQH A;  1BUP A;  2P9L A;  2E2O A;  4XEI A;  4BVP A;  5AQW A;  5FPM A;  3VEN A;  4H0Y B;  3CJA A;  3W0L A;  1DEJ A;  1SAZ A;  3VOV A;  4I6M B;  4CZI A;  2GUP A;  1JCE A;  1GLJ O;  3DXM B;  4CBX A;  5ELZ A;  2J4R A;  3SMS A;  3VEY A;  5AQV A;  4KBO A;  4CD3 A;  3HI0 A;  1TYQ B;  1GLL O;  4H0O A;  4AM6 A;  2YHX A;  3KVG A;  4MO5 A;  3I8B A;  1HKC A;  1RFQ A;  2V7Y A;  4BG9 A;  1BO5 O;  1C0F A;  4K25 A;  5AQI A;  3KHY A;  1EQY A;  3WXK A;  4JD2 B;  5F0X A;  2OAN A;  3RSE B;  2CGJ A;  4ISE A;  4BC3 A;  3ZET A;  2P9I B;  1G99 A;  5AZJ B;  1NGD A;  4BC4 A;  1NGA A;  3GG4 A;  4BRA A;  3C0B A;  2FLO A;  2F9T A;  1V4T A;  3HZ6 A;  1IG8 A;  3FZH A;  3A5L C;  3DXK B;  3A5N C;  2E8A A;  2BUP A;  4EHU A;  2Q1N A;  1P8Z A;  4QS7 A;  3FZM A;  3MMV A;  4H5T A;  4WQ5 A;  2V7Z A;  1XUP O;  5E84 A;  1SZ2 A;  3O5B A;  4PKG A;  5AQS A;  4PL8 A;  3LM2 A;  3BEX A;  3MK6 A;  4WQ5 C;  1NBW A;  3UKU B;  5AQT A;  4I6M A;  3G25 A;  3H6E A;  1YUW A;  3DXM A;  2I7N A;  5AR0 A;  3VEW A;  2ASP A;  2NZT A;  4MLE A;  2E2N A;  4FWK A;  2W40 A;  3CER A;  1TYQ A;  3ID8 A;  2D4W A;  3UKR B;  4FWN A; 
#chains in the Genus database with same CATH topology
 1WSF A;  5MLC Q;  3D2E A;  4BR9 A;  3T1H K;  1ZBS A;  3C6H A;  5J1E A;  3A5M C;  1VQP N;  5FPN A;  1WSG A;  2GTD A;  4DV1 K;  5AZJ A;  4GV6 A;  2OTL N;  3LZJ A;  5HOO A;  3QEI A;  1NJW A;  3CJB A;  1KVB A;  5CR4 A;  1Q82 O;  3EL2 A;  4CF0 A;  1CZA N;  3CQX A;  4B8C A;  3L8B A;  4IEI A;  5HP1 A;  2GEM A;  3PLA A;  4CZE A;  3PO5 A;  3IAY A;  1WBB A;  1W7A A;  3UKU A;  4O8K A;  5GIO A;  3TTC A;  5AQP A;  3CCE N;  1CZ9 A;  1NGC A;  3FFI A;  5M1K A;  4OPJ A;  1BOT O;  3B8A X;  3UKR A;  3HPO A;  2QI2 A;  2W42 A;  3CM6 A;  4B3S K;  3I33 A;  4V19 S;  4F4K A;  3SJH A;  3BF3 A;  4O4G A;  5EY4 A;  5AFU A;  5TKY A;  3TR8 A;  2HHS A;  3BGR A;  2A5X A;  3ULE B;  1NGF A;  2OCE A;  1ZYQ A;  2ASO A;  2B6A A;  4CEZ A;  1YXQ A;  4BRI A;  4JKF A;  3DLB A;  3W3D A;  5KQD A;  5AQL A;  3PSF A;  2E88 A;  5CY4 A;  2IOC A;  1OVY A;  4KKO A;  2E1Z A;  4OVL A;  4JV5 K;  1Y97 A;  2X6N A;  2DPN A;  4DTJ A;  2A40 A;  5EX5 A;  3VEV A;  3P1G A;  1RT2 A;  1EXQ A;  2VG7 A;  1S5J A;  4KFB A;  4BVO A;  1NJZ A;  5GAG P;  1U2V B;  4Y1C A;  3DOL A;  2ZF5 O;  3HJF A;  2A1S A;  3HSC A;  1GLB G;  4H4O A;  3VGM A;  4DTM A;  4JI6 K;  1MWM A;  2VQF K;  2ETJ A;  5CE3 A;  4IO8 A;  1IKW A;  3QEW A;  4BRE A;  4O5B A;  3PIO L;  4FLZ A;  3TAF A;  1IKX A;  1ASU A;  1Q18 A;  1M90 O;  4QAG A;  2QWO A;  4FLX A;  1LW2 A;  2O8D B;  1JLQ A;  2I5J A;  5CYM A;  3SMP A;  5C42 A;  1TV6 A;  1KRP A;  3TAB A;  3TAR A;  4WFN L;  4ICL A;  4KHU A;  2HBM A;  4PHT X;  4FJ8 A;  1ZXO A;  2P9K A;  4M41 A;  2PAV A;  4L3Q A;  4DG1 A;  4BRC A;  1KVA A;  3SJJ A;  1S72 N;  4B1W B;  4JS5 A;  3ENO A;  4MFB A;  1RCH A;  4IJA A;  3PV8 A;  1EX4 A;  4A61 A;  5AQG A;  4B1Z A;  1WNS A;  1W9H A;  4GY2 B;  5KGX A;  3TSU A;  3ISN C;  1W0H A;  2B4J A;  1YJW N;  3M8R A;  4JRP A;  1UWB A;  4GNI A;  4J2D A;  1XMO K;  5AQR A;  4HWI A;  1KLM A;  2ZE2 A;  3CD6 N;  4CHZ A;  1IBM K;  3DRR A;  1YAG A;  5J2M A;  2ZD1 A;  4H0P A;  3FLC O;  3OHR A;  4JKG A;  4FJG A;  2W6K A;  1YTU A;  2PBD A;  4E7I A;  2HHQ A;  2A42 A;  3G0Z A;  1FK9 A;  2JWK A;  4GVM A;  2PFU A;  3AO3 A;  5AQU A;  4CZJ A;  4DQ8 A;  1S3X A;  4YY3 K;  5LJW A;  1FKO A;  4ISF A;  4W5Q A;  3KWG A;  3LWM A;  1RTJ A;  4BDZ A;  4B1Y B;  3QET A;  2IVO A;  3NE6 A;  1BIU A;  1SL0 A;  2Q36 A;  2XY8 A;  3CYM A;  3VF4 A;  3OBW A;  4EP5 A;  2AA4 A;  2JGU A;  3MXM A;  4OKE A;  4DFP A;  1GOC A;  4IOX A;  4KHN A;  1S9E A;  1EWR A;  5AQF A;  3O9U A;  3ZSX A;  5KRS A;  5BPN A;  3VN5 A;  2P9S A;  3AVB A;  4M3Z A;  1NOY A;  4FZX C;  1L3T A;  2VCP A;  3AVA A;  3I8D A;  4G9Z A;  2C1I A;  4DR5 K;  3IMX A;  4DTU A;  3O6W A;  4CF9 A;  4EAH D;  4HUF A;  4CFD A;  4JHD B;  3NGI A;  4AF1 A;  2QW9 A;  5DK5 A;  2E2Q A;  4EHT A;  3TI0 A;  4MQ3 A;  3HP9 A;  3NCI A;  5GAH P;  3DRS A;  4KTZ A;  1NK6 A;  1HMV A;  4DQQ A;  5AQO A;  1X9M A;  5M1N A;  4KHS A;  3D2E B;  1VSL A;  4CJQ A;  1VQ9 N;  1HNX K;  3VQC A;  1VQ6 N;  1VSM A;  2PY5 A;  3P5J A;  2UYT A;  1J5O A;  4JLH A;  3MEC A;  5IT9 O;  1ZC6 A;  4JI1 K;  2XHB A;  4DHY A;  1X9W A;  2HHI A;  3E66 A;  4FSV A;  4KH4 A;  1NK8 A;  4BRK A;  4DR3 K;  4LF6 K;  3AAP A;  1KTQ A;  2HF4 A;  1H1V A;  4BR0 A;  3U3G A;  1NNE A;  4L8R B;  4CED A;  3DOK A;  1XHX A;  4DWI A;  2KFN A;  3HRG A;  3AO1 A;  1JXE A;  4JI4 K;  4DSL A;  4FOE A;  5JIC A;  4JKD A;  3CQY A;  1ZBI A;  4KI4 A;  3DRP A;  4IDH A;  1UOC A;  4CER A;  3DMJ A;  1VQO N;  3OYA A;  2ASM A;  3OY9 A;  2FSJ A;  4FK2 A;  5GAE P;  2G8K A;  3GDQ A;  2P51 A;  1VSI A;  2Q97 A;  4HCC A;  3AVM A;  4B9M A;  3C94 A;  5EXW A;  1FW6 A;  4IFE A;  3DWL A;  3ZLJ A;  3K57 A;  3NH0 A;  2A6A A;  3F5T A;  4ILG B;  5FLX O;  1OH5 A;  4IEE A;  3VQ4 A;  1I94 K;  1EO1 A;  1XI1 A;  2HBJ A;  3CCR N;  2RHK A;  2ZQB A;  5AFU H;  4OGC A;  2A41 A;  3WUH A;  3HP6 A;  2BGG A;  1QHA A;  1U48 A;  2F7T A;  3H1Q A;  4RW6 A;  5BRD A;  1YI2 N;  1WSH A;  4WE1 A;  4KTW A;  3AAR A;  4C8K A;  3ENB A;  1VQ7 N;  3RTV A;  4C8N A;  1RBT A;  3CXC M;  1QVG M;  5BN8 A;  2WC9 A;  3M1F A;  2UXB K;  4DQR A;  3O08 A;  5E26 A;  2KW4 A;  4LF8 K;  3CC7 N;  3K0S A;  3RR7 A;  3QIO A;  4LF5 K;  4RCH A;  1BIS A;  4JEP A;  4PUO A;  1VK0 A;  2HHW A;  3HOS A;  3A2F A;  3DJC A;  5AQX A;  2QWN A;  4FJL A;  3H1V X;  3CCL N;  1NGI A;  3AO4 A;  2GWK A;  1T6C A;  2VWJ A;  4E7H A;  5EVZ A;  2P9N A;  1E4F T;  2O8E B;  1NK7 A;  3V9Z A;  3OYB A;  4BRP A;  4QS8 A;  3TAP A;  3DLL L;  4XEI A;  1SL1 A;  1NK9 A;  4FVU A;  4H0Y B;  3CJA A;  1SAZ A;  4CZI A;  2GUP A;  3TTD A;  3K59 A;  2OTJ N;  3DXM B;  3MEE A;  4CBX A;  2YKN A;  4H0O A;  4E7J A;  4M3T A;  1RTI A;  4MO5 A;  1XWL A;  4FVM A;  3OJS A;  1HKC A;  1RFQ A;  2V7Y A;  4BG9 A;  1BO5 O;  5GIP A;  3QNO A;  4K25 A;  4O0J A;  5AQI A;  5HLF A;  3KHY A;  4FM0 A;  3THX A;  4KRF A;  2KQ2 A;  2OAN A;  3RSE B;  1JXB A;  4ISE A;  2O4G A;  1G99 A;  5HRS A;  1Z26 A;  1NGD A;  2FC0 A;  2UUC K;  1VQL N;  4M3W A;  4BWM A;  2IS3 A;  4EHU A;  2Q1N A;  1P8Z A;  2KZZ A;  4H5T A;  4CJF A;  3J7Y P;  3O3G A;  1L3U A;  1XUP O;  2YKM A;  3O5B A;  3NVM A;  2OPS A;  1BL3 A;  1SS6 A;  3VA3 A;  1HNZ K;  4LFC K;  1REV A;  5AQT A;  4E72 A;  5AR0 A;  1C1C A;  3VEW A;  3JYT A;  2NZT A;  4MLE A;  4FWK A;  2XY6 A;  4AQY K;  4OLA A;  2Z1G A;  4JKG B;  4JKE A;  3KK1 A;  3O1B A;  2EWS A;  4E89 A;  2O8B B;  1XHZ A;  2YHY A;  1KAZ A;  3L4Q A;  1NJI O;  5I9E B;  1MWK A;  2IVN A;  3TTF A;  2NRX A;  1D4X A;  1T7P A;  1KFS A;  2P9I A;  4CK2 A;  4CJT A;  3KZB A;  3ZEU A;  4Q5V A;  3C6U A;  1KD1 O;  1KFD A;  3MN5 A;  3WNH A;  1WAF A;  4BRL A;  1VAZ A;  2HHH K;  3LDN A;  1KQS M;  1J53 A;  3MXI A;  1XQS C;  4KHY A;  2F8S A;  2QXF A;  1UA0 A;  2E20 A;  3VER A;  1NJY A;  3LP3 A;  2E4L A;  3OYH A;  4NO7 A;  2P9S B;  5AQM A;  1NMD A;  2X6S A;  4I2Q A;  1T8E A;  2NRR A;  4CBU A;  4NLC A;  5C15 A;  2DFH A;  3UB5 A;  2WUS A;  4C8O A;  2W41 A;  4B9L A;  3O9T A;  3SBT A;  3SUO A;  4A57 A;  3S41 A;  1NGH A;  4ZTF A;  1IV0 A;  3CCJ N;  4B08 A;  4A59 A;  3AO5 A;  4K8Z A;  1J6Z A;  1RDC A;  4DSE A;  4JK7 A;  2FBY A;  1O1W A;  1IKY A;  1Z25 A;  2OPQ A;  2UXC K;  4X66 K;  1I39 A;  1X3N A;  5EU7 A;  5C10 A;  1NOZ A;  3F73 A;  1FXX A;  3R9P A;  3TAM A;  4H5R A;  2FSN A;  4MDA A;  3MEG A;  4BC5 A;  4G1Q A;  5A2Q O;  3CC2 N;  3VQ7 A;  4FJ5 A;  1WB9 A;  2P9U B;  2UUA K;  3MN6 A;  2DY4 A;  2BDP A;  2A1R A;  1BGX T;  2ITM A;  5AZI A;  4CFB A;  2YNG A;  3HST B;  3THW A;  4B3T K;  2WTU A;  3SAH A;  5KTQ A;  3KLI A;  3L3V A;  3TSP A;  4GKJ K;  4CFA A;  1VQK N;  3VEZ A;  3NBP A;  3LDL A;  2Q0R A;  3CCU N;  1ZBU A;  3H3N O;  3VES A;  3OW2 M;  1IH7 A;  4BGA A;  1VSJ A;  4NXM K;  3O9Q A;  5T7B A;  3NHG A;  4EZ6 A;  1VRU A;  4HVJ A;  5CHI A;  3RMA A;  3CJ9 A;  4O8U A;  1TKX A;  3CCQ N;  2Y1I A;  3TAE A;  4YOV A;  4FJK A;  3WT0 A;  2IC3 A;  2WOM A;  4AIL C;  1L5U A;  1RBS A;  4DTO A;  1K73 O;  4B1U B;  4W5O A;  1S1T A;  5C12 A;  2O4I A;  2G8W A;  2HBL A;  4WF9 L;  5CYQ A;  4Z4E A;  4B3R K;  2B5J A;  1YJ9 N;  3MAQ A;  2JLE A;  2GV9 A;  2YNF A;  4H5V A;  4N41 A;  4B8A B;  5FPE A;  5JVG L;  3J80 O;  2FSK A;  3V1R A;  3O4W A;  5AQN A;  4OLB A;  1RT6 A;  3MED A;  3TAQ A;  3OVN A;  3IKM A;  4AHR A;  4AHC A;  2WON A;  3D6R A;  5BPM A;  4DQS A;  1SKR A;  3AVG A;  3EE9 A;  2ZJP L;  3KD1 E;  4CFC A;  3ENH A;  3ALY A;  3V4I A;  3KK3 A;  4CHY A;  3G71 N;  3QNN A;  1C1A A;  2V52 B;  3QLH A;  4GV9 A;  1QZ6 A;  3CC4 N;  2E6L A;  5LY3 A;  3MWT A;  1J9A A;  3O9R A;  4M3R A;  2F4V K;  3K9J A;  4I9L A;  4CK1 A;  2HVI A;  4CHQ A;  4CHO A;  4FWP A;  3A5O C;  3ID6 A;  4DCH A;  1RDW X;  5F2R A;  5LMU K;  2F8T A;  3ZT2 A;  3L2Q A;  4KB0 A;  3DLR A;  5TKW A;  3VTH A;  2AP1 A;  2GBZ A;  4YHH K;  2Q31 A;  4LF9 K;  4MO4 A;  3AVJ A;  4M3U A;  5HBM A;  4B3O A;  4CIE A;  4N76 A;  1QQC A;  2A3Z A;  4F9O A;  2Q0U A;  4OKK A;  5KI6 A;  3ZT0 A;  2X78 A;  4CEE A;  1YIT N;  3NF6 A;  2F96 A;  3U4L A;  1BHL A;  4PQU A;  3ATV A;  4BRN A;  4BRD A;  1TKD A;  2QEX N;  3UE5 A;  4DTN A;  2ATQ A;  1W2B M;  3V1O A;  1K8K A;  3KIO A;  2BH1 A;  4DTS A;  1KSP A;  4DF4 A;  4CHN A;  4FJI A;  2NNW A;  4C1N K;  3F9M A;  1MA9 B;  5AQQ A;  2D0A A;  5BRH A;  4FJN A;  3OBY A;  1R59 O;  3CCV N;  3KK7 A;  3LDS A;  4CZK A;  4H5N A;  1S1U A;  5B8H A;  3AVC A;  3WEE B;  3M8Q A;  1TAQ A;  4FWO A;  4DV6 K;  2HF3 A;  3LAK A;  3HBT A;  1HLU A;  1JLB A;  3U6F A;  4OKJ A;  5C0Y A;  1VSK A;  3ZEU B;  2QWP A;  2NRH A;  3KJV A;  4C8L A;  3VGK A;  1SQK A;  4IDK A;  3OYM A;  1D9D A;  1HQE A;  2RKI A;  4BRF A;  2JWL A;  3GE1 A;  4CJ5 A;  3OYF A;  1VRT A;  1HPZ A;  1TK5 A;  2XY7 A;  3ZSR A;  4JI5 K;  1JL2 A;  2NLX A;  1VHX A;  3HXM A;  1SKS A;  4CEA A;  4BY9 C;  4EP4 A;  3G4S N;  2HNY A;  4DU1 A;  2Y1J A;  4BQZ A;  3U9D A;  1S1W A;  3B6P A;  1RBU A;  4HUG A;  1TAU A;  4DTP A;  3SQ1 A;  3SQ4 A;  1RBV A;  1GLA G;  1LCU A;  3CCS N;  2G8U A;  3CPE A;  3EKS A;  1N32 K;  3H45 C;  1TL1 A;  4CE9 A;  3VQP A;  4YDU C;  2OZM A;  2CGL A;  1WSJ A;  4WQ4 C;  3NDK A;  4IXC A;  4BRM A;  4CGH A;  4M63 C;  3AO2 A;  4B9S A;  2ZWH A;  3IFR A;  1HKB A;  4J2A A;  1D5A A;  4XH4 A;  1LW0 A;  4FK4 A;  2Z1H A;  5DM7 L;  5JVH L;  1K9M O;  2IDO A;  4E0D A;  1RDD A;  3FZL A;  4FWM A;  4CZG A;  4DR2 K;  4CGD A;  5FRM A;  3ZX0 A;  2HOE A;  3FGU A;  4AHS A;  3QML A;  4KAZ A;  4FW2 A;  2VGN A;  3F2K A;  1QSY A;  3VQ6 A;  4NB4 A;  1ZBL A;  4CJS A;  3HYF A;  2OPP A;  4K42 A;  2XO7 A;  1GOB A;  4FLT A;  1N8R O;  4IO9 L;  1T44 A;  4DV3 K;  3AVL A;  1WOQ A;  1MDU B;  1XC3 A;  3CPW M;  2GWJ A;  1BUP A;  2P9L A;  1VSD A;  4OJR A;  4E3S A;  2E2O A;  3T1A A;  4BVP A;  2RE2 A;  1U45 A;  4JKC A;  3VEN A;  4KV8 A;  4E19 A;  3M5R A;  1JLC A;  3VOV A;  4R79 A;  3T7Z A;  3O3H A;  1GLJ O;  3AVI A;  5ELZ A;  5FDL A;  3CFP A;  4KBO A;  2NRV A;  2HHX A;  5HRR A;  1GLL O;  2YHX A;  3KVG A;  3SYZ A;  1VQM N;  4KTQ A;  4IKF A;  1C0F A;  3V6D A;  4M3Y A;  4YFU A;  2KKZ A;  3RVC A;  1L3V A;  4CCH A;  4BC3 A;  3NF7 A;  2PZS A;  3AV9 A;  3DI6 A;  4KHW A;  5AZJ B;  4CJE A;  1NGA A;  2HND A;  2FLO A;  1NKB A;  1IG8 A;  3FZH A;  3A5L C;  2E8A A;  3A5N C;  2BUP A;  2YHA A;  4QS7 A;  3FZM A;  1EKE A;  4FJJ A;  3KKR A;  3LP2 A;  3NF9 A;  1QTM A;  3WNG A;  3SQ0 A;  5AQS A;  4IOA L;  3E1Y A;  3RMB A;  1IBK K;  3MK6 A;  3BEX A;  3K5M A;  4DFM A;  3UKU B;  2W6L A;  4I6M A;  4DV4 K;  1FKP A;  3THY A;  2I7N A;  2ASP A;  3HVR A;  4E1M A;  5JEN A;  2E2N A;  3CER A;  1TYQ A;  1C0M A;  3K2P A;  5C2D A;  4CJK A;  1E3M A;  3UKR B;  1Q9Y A;  3T19 A;  4LFB K;  3PX4 A;  4KI6 A;  4E1J A;  3OTO K;  4EFH A;  1C0G A;  3M8P A;  2FF6 A;  1JJ2 M;  4JD2 A;  2O8C A;  4HHT A;  4CGF A;  1NGE A;  1OH8 A;  3CFO A;  3LDO A;  5H1S Q;  3P4I A;  2FBX A;  3KK2 A;  3LP1 A;  1QQN A;  4KH6 A;  1GOA A;  4AHT A;  3DXK A;  3R3L A;  3BDP A;  4JI0 K;  4IOC L;  5J2P A;  1VQ5 N;  3J7A P;  2DTU A;  4GV3 A;  1BCM A;  4ISG A;  2O8F A;  1GLF O;  4NYN A;  4YOT A;  3R8E A;  3D2F A;  4O0I A;  4JI2 K;  3L2R A;  1NLV A;  2P5O A;  4IFY A;  4ZTJ A;  3PO4 A;  3AGK A;  3KLH A;  4IG0 A;  1MU2 A;  2YX6 A;  2OA8 A;  3GL1 A;  3BZK A;  1K8K B;  2HW3 A;  4JKA A;  1U47 A;  3OJU A;  4CEB A;  1Q9X A;  1TK0 A;  1QS4 A;  2P9P A;  5F1X A;  5FRN A;  2QKB A;  1BQN A;  2P1J A;  1Z6R A;  4FWS A;  3BP8 A;  3LL3 A;  3MCP A;  2LSN A;  4CF8 A;  3KLE A;  3I55 N;  2FBT A;  1TKZ A;  3AA5 X;  3CJ7 A;  4WYB A;  3K5L A;  2PYJ A;  3VQQ A;  3JAM O;  4CBW A;  3ZSZ A;  1T3V A;  3AAQ A;  4CJ7 A;  1U4B A;  3FZK A;  2VGM A;  3KLF A;  2E6M A;  1YVN A;  4CZM A;  4OPK A;  4H8K A;  3HT3 A;  2ZJQ L;  1R0A A;  3BUZ B;  4JI7 K;  2RN2 A;  1NGJ A;  2FF3 B;  5M1Q A;  5SWM A;  4FM2 A;  1E4G T;  1LOT B;  3OS0 A;  3SI6 A;  4DSJ A;  4CZH A;  4BRO A;  1WBD A;  5AQY A;  4IJN A;  4CJW A;  1LWE A;  2P9K B;  4CI6 A;  3TWH A;  4H4M A;  4LD0 A;  1ZBH A;  4PA1 A;  1WN7 A;  1GLD G;  4FCY A;  1N33 K;  4O5F A;  4CVN E;  1B9D A;  1U49 A;  3EEQ A;  2X74 A;  3EY1 A;  3ATU A;  4JI3 K;  5BRF A;  1YHQ N;  1ILY A;  1NMN A;  3V9S A;  4QOZ B;  4B9Q A;  3ULE A;  1T6D A;  4KRE A;  4WFB L;  3G6E N;  1KCF A;  4FO0 A;  3QB0 A;  4YOR A;  5M1P A;  3TPQ A;  4DF8 A;  4DV7 K;  3NGZ A;  1QSL A;  3IG1 A;  1WSE A;  4YOX A;  1VQN N;  3U9Z A;  3CI5 A;  3LPT A;  3JS6 A;  4J2B A;  5GAD P;  2D0C A;  2P5G A;  4NYF A;  3S3N A;  1Y64 A;  3H3O B;  3QEV A;  2HNZ A;  4OPH A;  1BI4 A;  3BY5 A;  3MCA B;  1LV5 A;  3ZSV A;  4FJX A;  4WCE L;  1U2V A;  1BU6 O;  4ILJ A;  3VA0 A;  3MDQ A;  4XH1 A;  1RIL A;  5BR9 A;  2YJF A;  3HM9 A;  4C1N I;  4NCA A;  3SPZ A;  2QWL A;  3VGL A;  4K0K K;  4BE2 A;  4BGB A;  1IKV A;  4W5R A;  3EZ5 A;  3L0Q A;  3D45 A;  3HPH A;  3VMF B;  1C1B A;  4CGI A;  1VQ4 N;  3OYC A;  2VWB A;  2YNH A;  1X9S A;  4B9U A;  1Q81 O;  2VG5 A;  4O44 A;  2O8D A;  4N5S A;  4RW9 A;  5ADX A;  4FLY A;  4JS4 A;  1S1V A;  4DFK A;  4FJ7 A;  3SLC A;  4JKB A;  5J2N A;  3LAN A;  4IWV A;  2XRI A;  3QFP A;  1TUU A;  3SAG A;  3I56 N;  2E1Y A;  3TU5 A;  1HYZ A;  4H03 B;  4AH9 A;  4DV5 K;  3DLG A;  4E7L A;  4A5B A;  4BG8 A;  2E2P A;  2KHO A;  4DKW A;  3V9X A;  4CHP A;  2CH6 A;  1IO2 A;  1P90 A;  4DB3 A;  4LSN A;  4CJR A;  3QBX A;  2ZGY A;  1BQM A;  3A0I X;  3HO1 A;  1WUA A;  4ID5 A;  3O4Q A;  1DT9 A;  3BF1 A;  4CJL A;  3SUN A;  1C0T A;  4BQL A;  4DUZ K;  3TSQ A;  5BPL A;  4Z4F A;  4GKK K;  3WNF A;  5KRT A;  4A2B A;  2RPI A;  4ELU A;  3CET A;  1YIJ N;  5AQK A;  4LSL A;  3EN9 A;  3MXJ A;  4Y0W A;  2VG6 A;  2V51 B;  1WSI A;  1LWF A;  3QFU A;  4AHV A;  4I7F A;  4CEF A;  1QQM A;  3HM8 A;  5J2Q A;  2F9W A;  3WNE A;  4F3T A;  5DM6 L;  3HTV A;  4J2E A;  3CM5 A;  4H0X B;  1HNI A;  1TL3 A;  4F8R A;  4M42 A;  3PX6 A;  1JKH A;  1OH6 A;  2YI1 A;  3MN7 A;  4RWT A;  4R5P A;  5EOY A;  4BRG A;  2D0P A;  2QTD A;  1VQ8 N;  3UIQ A;  3HK2 A;  4BR2 A;  4CZF A;  4U67 L;  4IZ9 A;  1WAJ A;  3SNN A;  3NH2 A;  1HR0 K;  3VF6 A;  4BE1 A;  3Q7B A;  3SPY A;  3WQT A;  3SZ2 A;  1Q7Y O;  3FR0 A;  1NK0 A;  3SCX A;  4DLG A;  3D2F B;  2VQE K;  4W5T A;  4I2P A;  3FE1 A;  2QXL A;  3M3Z A;  4JHD A;  4B9V A;  4DV0 K;  2ZM6 K;  5JLF A;  2G8F A;  3CMA N;  4B9N A;  3VEO A;  2P9P B;  1EP4 A;  4YDU A;  3CJC A;  3J8A A;  4DSF A;  4FJH A;  3ZYY X;  1VSE A;  5SZT A;  4WQ4 A;  3CHW A;  3NMU A;  2IGI A;  3G10 A;  2P9N B;  4RG8 A;  4Z4H A;  2ZJR L;  4K41 A;  2BTF A;  3FZF A;  4MLH A;  1I3A A;  3T3F A;  3DLK A;  3LWL A;  2NRT A;  1RDB A;  1XNQ K;  4PKI A;  4DU4 A;  1ASV A;  3VF2 A;  3CYG A;  1YTA A;  3EZW A;  4C23 A;  4CF2 A;  4EIA A;  4A62 A;  1SL2 A;  4GVE A;  1XC9 A;  4DTX A;  1KXP A;  4BE7 B;  4KHP K;  3HL8 A;  4X65 K;  1RBR A;  3THX B;  4JNE A;  3GBT A;  4FPB A;  1NJX A;  2HMP A;  4JAX A;  1IJJ A;  5K14 A;  3HPG A;  2RF2 A;  1ZBF A;  1S6Q A;  2VWK A;  4CW7 B;  3VQB A;  4JKH A;  3O3F A;  4KB1 A;  1S22 A;  3VET A;  3K5N A;  3KD5 E;  1J54 A;  1G15 A;  5KPZ A;  1YJN N;  4DFJ A;  3OYG A;  3IDH A;  5AQH A;  3WXM B;  1B92 A;  1UA1 A;  1JLG A;  3W0L A;  1DEJ A;  3DLH A;  4FYD A;  4N47 A;  1JCE A;  4JRQ A;  1C0U A;  3NH1 A;  1S1X A;  2J4R A;  3SMS A;  2GX9 A;  3HI0 A;  4W5N A;  4CF1 A;  4AM6 A;  1BCO A;  4UY8 O;  4DV2 K;  1BI4 B;  1EQY A;  3ZSW A;  3WXK A;  4DR4 K;  1RT5 A;  3ZET A;  3OYN A;  3OYK A;  2P9I B;  2PYL A;  3RRG A;  4I9Q A;  3ZSQ A;  2WBN A;  3QIP A;  4OPA A;  3EYZ A;  1U04 A;  3DLE A;  3SAF A;  4DQI A;  3C0B A;  4BEC A;  3QEP A;  2F9T A;  5CZ1 A;  1UAX A;  3RR8 A;  4LH5 A;  2O8E A;  2HHU A;  1OH7 A;  4DUY K;  3ZSY A;  1KLN A;  3SV3 A;  5E84 A;  3THV A;  2KLA A;  2C1G A;  1SZ2 A;  4M45 A;  5BR8 K;  3CCM N;  4PWD A;  1JL1 A;  4PL8 A;  4OX9 K;  4JYA K;  1RT1 A;  3S3O A;  3LM2 A;  1L3S A;  4WQ5 C;  1NBW A;  4CIG A;  3M8S A;  2HBK A;  4JK8 A;  3NAE A;  3QER A;  3DXM A;  4U7B A;  2QK9 A;  2NRW A;  3K5O A;  2W40 A;  3ID8 A;  3VQ9 A;  4FW1 A;  5LMN K;  2D4W A;  4NCB A;  3CFR A;  3RWU A;  1RT4 A;  3CME N;  3NGY A;  3LP0 A;  4IBN A;  4FWN A;  2GEL A;  1DLO A;  4DQP A;  3OA9 A;  3CIP A;  5ADX H;  1TUY A;  2UXD K;  3AA4 A;  1ATR A;  3RSE A;  5JMV A;  2Q2R A;  3SV4 A;  1ATN A;  2FBV A;  3H46 O;  4LF4 K;  1NK5 A;  3C6T A;  5C25 A;  5LL6 Z;  1HYV A;  4H0V B;  4DSI A;  4DTR A;  3I0S A;  3A8Y A;  2ITG A;  2DFF A;  4RW4 A;  3ZT1 A;  4LH4 A;  3T69 A;  3OYI A;  1ASW A;  3V1Q A;  4ID1 A;  1NGB A;  3PX0 A;  3O9S A;  1HJO A;  4PKH A;  4F2S A;  4FZY A;  3LAL A;  1CXQ A;  4YOW A;  1JLF A;  3D0P A;  3IUC A;  3CJ1 A;  1NG9 A;  4MDB A;  5AZI B;  3LAM A;  3THW B;  2HST A;  4CJV A;  4HTL A;  4ELV A;  5JLH A;  1SV5 A;  2EX3 A;  3PIP L;  5LJV A;  3DYA A;  2O8B A;  4CGJ A;  1VSH A;  4RW8 A;  3C7N A;  1BWF O;  1ESV A;  4H5W A;  3L4I A;  3OYD A;  4NLB A;  2QWM A;  3SUQ A;  1TK8 A;  1S6P A;  2D5R A;  4FM1 A;  1TKT A;  3NFA A;  4ELT A;  3OYJ A;  5FPD A;  3L2W A;  1HPM A;  4FLW A;  4BE0 A;  3SK3 A;  1YVU A;  3MN9 A;  4FXD A;  1CXU A;  3TAG A;  3MX5 A;  2IVP A;  3M6G A;  3WQU A;  3EO3 A;  1C6V A;  1LWC A;  5I42 A;  1Z05 A;  4BC2 A;  3ULD A;  2G8V A;  2Q3S A;  4FLU A;  1EET A;  3CF5 L;  4B1V A;  4XH5 A;  3L3U A;  1N6Q A;  4X62 K;  1T05 A;  4BDP A;  1QVF M;  2W00 A;  1B9F A;  3LDQ A;  2G8H A;  2HB5 A;  4CEQ A;  3CQ8 A;  1CZB A;  1NWK A;  3WXI A;  4B1X B;  4CJ4 A;  2YHW A;  1BA1 A;  3E9L A;  3KWI A;  3S9H A;  3C95 A;  4AM7 A;  3D7E O;  3IRX A;  2HHT A;  1JCF A;  1N34 K;  2GUI A;  4DS5 A;  3RRH A;  3F9K A;  4BR4 A;  3CG7 A;  4F2R A;  4QCL A;  3QO9 A;  1JCG A;  4E7K A;  3E9P A;  1DTT A;  4CES A;  4H0T B;  4UQG A;  3JXU A;  3DM2 A;  1LAV A;  4JN4 A;  3LM9 A;  4BR7 A;  2P9U A;  3L6Q A;  5C2F A;  3V81 A;  1M1K O;  2OYQ A;  3U8X A;  4F3O A;  1X3M A;  4OO1 J;  5KPT A;  3ZX2 A;  4YNQ A;  1JLE A;  4DU3 A;  1RTH A;  4XIU A;  1RDA A;  4BWJ A;  3SQ2 A;  1KAY A;  1N5Y A;  2IIR A;  5HRP A;  1YF5 L;  4AHU A;  4M7X A;  3S3M A;  4DR1 K;  3S5T A;  4DR6 K;  1NU0 A;  5KQ8 A;  3EKU A;  1HRH A;  4LC9 B;  3VQE A;  1FJG K;  3VQA A;  1QE1 A;  2WFB A;  4FWQ A;  3NVK A;  3GOI A;  1YT3 A;  1D8Y A;  4CZL A;  2HMI A;  5HL7 L;  4FK0 A;  4BRQ A;  1HNW K;  4A5A A;  1U6Z A;  3T1Y K;  4YOY A;  1XNR K;  4BR5 A;  1W97 L;  2OZS A;  5JS1 A;  2CGK A;  1A5V A;  2UUB K;  3P83 D;  3LPU A;  4GW6 A;  4C8M A;  4FJM A;  1QSS A;  3K9K A;  3P31 A;  3K58 A;  3FFK B;  2YJE A;  2DFE A;  2NUB A;  1SUQ A;  2QWQ A;  4DR7 K;  3B6O A;  3JSM A;  3BZC A;  3ZET B;  3VQ5 A;  3OYL A;  3QES A;  4NXN K;  1NM1 A;  5M1F A;  5IWA K;  2IAJ A;  4FWL A;  1WLJ A;  5M1O A;  1BDG A;  4CGG A;  5KGW A;  5E41 A;  3LDP A;  1HKG A;  1NK4 A;  1LAW A;  2Z1I A;  1A5X A;  2VYP A;  1HUX A;  1BIZ A;  1HJR A;  1ITG A;  1CLQ A;  4FPA A;  4CJU A;  2KTQ A;  1OKJ A;  3QIN A;  3ITH A;  1J5E K;  3MWP A;  3Q7C A;  2D0O A;  1RT3 A;  3KTQ A;  4K8X A;  1QQO A;  1TGO A;  4Q0B A;  1VSF A;  1RGI A;  2YV0 X;  1V4S A;  4TSX A;  1HYS A;  1BG3 A;  3RMD A;  1RNH A;  5C24 A;  3OS1 A;  3ZSO A;  1KAX A;  4QS9 A;  3HVT A;  4BRH A;  4CD1 A;  4FZZ A;  3AVH A;  4BEB A;  3AY9 A;  3I0R A;  1DKG D;  4ZHR A;  3O80 A;  2BAN A;  3QIC A;  3AVK A;  4BAC A;  3E01 A;  5AJ3 K;  4CK3 A;  1K8A O;  3WXJ A;  3ASM A;  4PL7 A;  4LFA K;  5HRO A;  3ZX3 A;  3AA3 A;  3AVF A;  3HOT A;  3MX2 A;  3LZI A;  4FOI A;  4EZ9 A;  3IS9 A;  3TAN A;  2HHV A;  4K43 A;  1IG9 A;  5AQJ A;  4B9T A;  4J8F A;  4Y1D A;  1X1P A;  4DS4 A;  1DGK N;  3O8M A;  4RTF D;  5BN9 A;  4Z4G A;  2OPR A;  4A2A A;  1JLA A;  4JK9 A;  1EWQ A;  4FL9 A;  3U3Y A;  3OYE A;  1GLC G;  3QDK A;  3SBG A;  4O55 A;  2KZM A;  4N56 A;  3O4N A;  4IG3 A;  1X9J A;  1TVR A;  3C7N B;  1HNV A;  1K6Y A;  1RDU A;  3WEE A;  4CEO A;  2YCH A;  5D3G A;  2D1K A;  3ZT3 A;  2ZGZ A;  3RMC A;  3NF8 A;  3WXL A;  1BA0 A;  3SUP A;  1N36 K;  4XJX A;  3PY8 A;  2P9L B;  3AA2 A;  3H08 A;  1SKW A;  5AQZ A;  3E9O A;  4Z4C A;  1NKC A;  2CH5 A;  3ZT4 A;  3ZCM A;  3PSI A;  4HUE A;  2YHB A;  4Z0U A;  1GLE G;  1S9G A;  1XMQ K;  4Z94 A;  2QWR A;  2I7P A;  1QHT A;  2XY5 A;  4KH5 A;  1O13 A;  4FWR A;  3PUF A;  3C65 A;  1ATS A;  3VEX A;  4Z4I A;  1T03 A;  4FJ9 A;  1KC8 O;  5BRE A;  2AJQ A;  2QKK A;  4YOU A;  2H3G X;  1HX1 A;  2Z1J A;  3N4P A;  2QM1 A;  2QA4 N;  4WFA L;  5CZ2 A;  3DAW A;  1QZ5 A;  4M7Y A;  3VPZ A;  5KPR A;  3O1W A;  2FXU A;  3R1X A;  4RW7 A;  3L2V A;  1NGG A;  4KO0 A;  3R6M A;  4PY5 A;  3QBW A;  3AVN A;  4ILH A;  3L2U A;  3J81 O;  4GMJ B;  3QEX A;  2EHG A;  3N4Q A;  4DSK A;  5AQW A;  3OS2 A;  5FPM A;  5DMR A;  1Q8I A;  4IFV A;  5HRN A;  1D9F A;  4E1N A;  4I6M B;  1NKE A;  1A5W A;  3VTI A;  3THY B;  2YNI A;  3VEY A;  5GIN A;  5AQV A;  4CD3 A;  2E5L K;  1TYQ B;  3VQ8 A;  3I8B A;  4LY7 A;  1Q86 O;  3P39 A;  3KKS A;  4JD2 B;  2O8C B;  5F0X A;  4DLE A;  4DMN A;  4KHQ A;  5JS2 A;  2CGJ A;  4CEC A;  1F21 A;  1OVQ A;  1IBL K;  4BC4 A;  4HTU A;  4NCG A;  3GG4 A;  4BRA A;  4KPY A;  2HVH A;  5FRO A;  4B3M K;  3KLG A;  1RTD A;  4LF7 K;  1V4T A;  3VQD A;  1RT7 A;  3HZ6 A;  3EE8 A;  5I3U A;  3DXK B;  4CJP A;  3V9W A;  4FLV A;  4CJ3 A;  3MMV A;  3J7Z O;  4WQ5 A;  3AGR A;  2O8F B;  2V7Z A;  4X64 K;  2D0B A;  4M3X A;  4PKG A;  2G8I A;  2BE2 A;  3C6A A;  4CIF A;  4HCB A;  3P38 A;  1HQU A;  1KVC A;  4BDY A;  3G25 A;  3H6E A;  3V9U A;  1YUW A;  2NRZ A;  4OGE A;  2KFZ A;  4JI8 K;  2R7Y A;  1DTQ A;  2UU9 K; 
#chains in the Genus database with same CATH homology
 2GEL A;  4EFH A;  3O1B A;  3OA9 A;  5MLC Q;  2EWS A;  1C0G A;  3CIP A;  3D2E A;  2FF6 A;  2YHY A;  4BR9 A;  4JD2 A;  1KAZ A;  5ADX H;  1ZBS A;  1TUY A;  3C6H A;  3L4Q A;  5I9E B;  5JMV A;  1ATR A;  1MWK A;  1NGE A;  2IVN A;  3A5M C;  2NRX A;  2Q2R A;  3RSE A;  3LDO A;  1D4X A;  1VQP N;  5FPN A;  5H1S Q;  2GTD A;  2P9I A;  3P4I A;  1ATN A;  5AZJ A;  4GV6 A;  3H46 O;  3KZB A;  2OTL N;  1QQN A;  4KH6 A;  3ZEU A;  5HOO A;  3CJB A;  1KD1 O;  3MN5 A;  4BRL A;  1VAZ A;  5CR4 A;  1Q82 O;  3DXK A;  4H0V B;  3R3L A;  3EL2 A;  4IOC L;  1CZA N;  1VQ5 N;  3CQX A;  3LDN A;  3A8Y A;  1KQS M;  4GV3 A;  4ISG A;  1XQS C;  1GLF O;  4IEI A;  2GEM A;  3PLA A;  3T69 A;  2E20 A;  4CZE A;  4YOT A;  3VER A;  3R8E A;  3D2F A;  1NGB A;  1NLV A;  4NO7 A;  2P9S B;  5AQM A;  1NMD A;  3AGK A;  3O9S A;  3UKU A;  1HJO A;  4O8K A;  4PKH A;  5GIO A;  2YX6 A;  4YOW A;  3GL1 A;  3IUC A;  3TTC A;  3CJ1 A;  1K8K B;  4MDB A;  5AZI B;  2NRR A;  5AQP A;  4JKA A;  4CBU A;  4NLC A;  5C15 A;  2HST A;  3CCE N;  5M1K A;  1NGC A;  3UB5 A;  4HTL A;  1BOT O;  3B8A X;  2WUS A;  3UKR A;  5JLH A;  2P9P A;  2QI2 A;  5F1X A;  2W41 A;  3PIP L;  3I33 A;  3O9T A;  1Z6R A;  5LJV A;  3SJH A;  3BF3 A;  3C7N A;  4FWS A;  3SBT A;  3BP8 A;  3LL3 A;  5EY4 A;  3MCP A;  4A57 A;  5AFU A;  5TKY A;  3S41 A;  1NGH A;  3I55 N;  1BWF O;  1ESV A;  3CJ7 A;  4WYB A;  2A5X A;  3CCJ N;  4H5W A;  3L4I A;  4A59 A;  4NLB A;  3ULE B;  1NGF A;  1J6Z A;  4JK7 A;  4CBW A;  2QWM A;  2ASO A;  1T3V A;  3AAQ A;  4CJ7 A;  1YXQ A;  4BRI A;  3FZK A;  4JKF A;  2VGM A;  1X3N A;  5C10 A;  1YVN A;  4CZM A;  2ZJQ L;  3BUZ B;  3R9P A;  4H5R A;  2FSN A;  4MDA A;  3W3D A;  1NGJ A;  2FF3 B;  5AQL A;  5M1Q A;  4BC5 A;  5FPD A;  5KQD A;  1E4G T;  1HPM A;  1LOT B;  3CC2 N;  2E88 A;  3SK3 A;  2P9U B;  1OVY A;  3MN9 A;  4CZH A;  3MN6 A;  2E1Z A;  4BRO A;  5AQY A;  4IJN A;  2P9K B;  3MX5 A;  2DPN A;  2A40 A;  2IVP A;  3M6G A;  5EX5 A;  2ITM A;  5AZI A;  3VEV A;  3WQU A;  4CI6 A;  3EO3 A;  4BVO A;  3SAH A;  1GLD G;  1Z05 A;  4BC2 A;  5GAG P;  1U2V B;  3CF5 L;  4O5F A;  3TSP A;  3CCS N;  4B1V A;  4XH5 A;  1QVF M;  2W00 A;  1VQK N;  3VEZ A;  2ZF5 O;  3LDL A;  2Q0R A;  3LDQ A;  3HSC A;  1GLB G;  3ATU A;  3VGM A;  3CCU N;  3H3N O;  5BRF A;  1NWK A;  3VES A;  3WXI A;  3OW2 M;  1YHQ N;  1ILY A;  1MWM A;  4BGA A;  3ULE A;  1T6D A;  4B1X B;  2YHW A;  1BA1 A;  4B9Q A;  4WFB L;  3G6E N;  3E9L A;  4FO0 A;  3KWI A;  3O9Q A;  3QB0 A;  4YOR A;  5M1P A;  3TPQ A;  4AM7 A;  5CE3 A;  3D7E O;  4IO8 A;  4YOX A;  1JCF A;  5CHI A;  4BR4 A;  3CJ9 A;  4BRE A;  3PIO L;  4O8U A;  3U9Z A;  3CCQ N;  3CI5 A;  1VQN N;  4YOV A;  3WT0 A;  1JCG A;  1Q18 A;  1M90 O;  3JS6 A;  2QWO A;  5GAD P;  3E9P A;  1K73 O;  1Y64 A;  3H3O B;  4B1U B;  4H0T B;  3SMP A;  3JXU A;  5C12 A;  4JN4 A;  3LM9 A;  4BR7 A;  2P9U A;  3L6Q A;  2HBL A;  4WF9 L;  4WFN L;  5C2F A;  2HBM A;  4PHT X;  4OPH A;  1M1K O;  3U8X A;  1ZXO A;  2P9K A;  1X3M A;  4OO1 J;  5KPT A;  3ZX2 A;  2PAV A;  1YJ9 N;  4L3Q A;  4BRC A;  4H5V A;  5FPE A;  1S72 N;  5JVG L;  4B1W B;  3MCA B;  3ENO A;  2FSK A;  4IJA A;  3O4W A;  4WCE L;  1U2V A;  4A61 A;  1KAY A;  5AQN A;  2IIR A;  1BU6 O;  5AQG A;  4B1Z A;  1YF5 L;  4ILJ A;  3MDQ A;  4M7X A;  4XH1 A;  3IKM A;  3D6R A;  5BPM A;  2YJF A;  4GY2 B;  5BR9 A;  3EKU A;  5KQ8 A;  3TSU A;  3EE9 A;  2ZJP L;  4LC9 B;  4C1N I;  1YJW N;  3ENH A;  2QWL A;  3VGL A;  2WFB A;  4BGB A;  4FWQ A;  3NVK A;  3L0Q A;  4GNI A;  3G71 N;  2V52 B;  5AQR A;  3VMF B;  3GOI A;  4HWI A;  4GV9 A;  1QZ6 A;  4CZL A;  1VQ4 N;  5HL7 L;  4BRQ A;  3CC4 N;  5LY3 A;  3CD6 N;  2VWB A;  3MWT A;  4A5A A;  1U6Z A;  4YOY A;  1Q81 O;  1YAG A;  4BR5 A;  4H0P A;  1W97 L;  3O9R A;  3FLC O;  2CGK A;  3K9J A;  5ADX A;  3OHR A;  4JKG A;  3SLC A;  2PBD A;  3A5O C;  4FWP A;  3ID6 A;  4JKB A;  4DCH A;  1RDW X;  5F2R A;  2A42 A;  4IWV A;  3QFP A;  1TUU A;  3SAG A;  3K9K A;  2JWK A;  3I56 N;  3P31 A;  2PFU A;  5TKW A;  5AQU A;  4CZJ A;  4DQ8 A;  2E1Y A;  1S3X A;  3FFK B;  3TU5 A;  4H03 B;  2YJE A;  3VTH A;  2AP1 A;  4ISF A;  5LJW A;  3KWG A;  4A5B A;  4BG8 A;  2Q31 A;  4B1Y B;  2E2P A;  2KHO A;  2QWQ A;  4MO4 A;  4DKW A;  1QVG M;  2IVO A;  2CH6 A;  4DB3 A;  1P90 A;  2Q36 A;  3QBX A;  2ZGY A;  3ZET B;  3VF4 A;  1NM1 A;  2A3Z A;  3OBW A;  3TTF A;  4F9O A;  2Q0U A;  5M1F A;  2AA4 A;  4FWL A;  5M1O A;  3A0I X;  1BDG A;  1WUA A;  3LDP A;  1HKG A;  1DT9 A;  2VYP A;  1HUX A;  4IOX A;  3BF1 A;  1YIT N;  4BQL A;  4FPA A;  3U4L A;  5AQF A;  3O9U A;  3TSQ A;  1OKJ A;  3ATV A;  5BPL A;  5BPN A;  3MWP A;  4BRN A;  4BRD A;  2P9S A;  4A2B A;  2QEX N;  2VCP A;  3UE5 A;  3CET A;  4G9Z A;  1YIJ N;  1W2B M;  2C1I A;  5AQK A;  3IMX A;  2D0O A;  3Q7C A;  3EN9 A;  3O6W A;  4Y0W A;  2V51 B;  1K8K A;  1QQO A;  4EAH D;  2BH1 A;  3QFU A;  1QQM A;  4JHD B;  2NNW A;  3HM8 A;  1RGI A;  4AF1 A;  2F9W A;  4C1N K;  2QW9 A;  2E2Q A;  1V4S A;  3F9M A;  5DM6 L;  3HTV A;  4H0X B;  1MA9 B;  5AQQ A;  4EHT A;  5BRH A;  1BG3 A;  3OBY A;  5GAH P;  1R59 O;  3CCV N;  3KK7 A;  5AQO A;  4CZK A;  2YI1 A;  1KAX A;  3MN7 A;  4QS9 A;  4H5N A;  4BRH A;  4CD1 A;  3D2E B;  5B8H A;  5M1N A;  4RWT A;  5EOY A;  1VQ9 N;  3AY9 A;  4BEB A;  3WEE B;  4BRG A;  1DKG D;  2D0P A;  2QTD A;  4FWO A;  2HF3 A;  3O80 A;  1VQ8 N;  1VQ6 N;  2UYT A;  4BR2 A;  4CZF A;  4U67 L;  3HBT A;  3QIC A;  1ZC6 A;  1HLU A;  4IZ9 A;  5C0Y A;  4DHY A;  3ZEU B;  2QWP A;  2NRH A;  1K8A O;  3E66 A;  3VF6 A;  3WXJ A;  3VGK A;  4FSV A;  4KH4 A;  1SQK A;  4BRK A;  3AAP A;  3Q7B A;  4PL7 A;  2HF4 A;  3ZX3 A;  1H1V A;  4BRF A;  4BR0 A;  2JWL A;  3GE1 A;  3WQT A;  3HOT A;  3MX2 A;  1Q7Y O;  3FR0 A;  3HRG A;  4FOI A;  4FOE A;  5JIC A;  2NLX A;  3CQY A;  3D2F B;  4JKD A;  4K43 A;  5AQJ A;  4J8F A;  3FE1 A;  4IDH A;  4BY9 C;  2QXL A;  3M3Z A;  4JHD A;  3G4S N;  1DGK N;  4BQZ A;  3O8M A;  3U9D A;  4RTF D;  1VQO N;  2ASM A;  5BN9 A;  2FSJ A;  5JLF A;  4A2A A;  5GAE P;  3GDQ A;  4JK9 A;  2Q97 A;  3CMA N;  3VEO A;  4FL9 A;  2P9P B;  1GLC G;  4YDU A;  1GLA G;  1LCU A;  3DWL A;  3QDK A;  3CJC A;  3CPE A;  3EKS A;  3J8A A;  4IFE A;  3SBG A;  3H45 C;  5EXW A;  3ZYY X;  1X9J A;  3C7N B;  4WQ4 A;  3CHW A;  3NMU A;  2A6A A;  3F5T A;  1RDU A;  3WEE A;  4ILG B;  2P9N B;  2YCH A;  2D1K A;  4IEE A;  2ZGZ A;  3WXL A;  4YDU C;  2ZJR L;  1EO1 A;  4K41 A;  2HBJ A;  1BA0 A;  2BTF A;  2CGL A;  4XJX A;  4WQ4 C;  3CCR N;  2P9L B;  4IXC A;  4BRM A;  2RHK A;  3FZF A;  4MLH A;  5AFU H;  5AQZ A;  2A41 A;  4M63 C;  3E9O A;  2NRT A;  3WUH A;  1QHA A;  2CH5 A;  4PKI A;  2F7T A;  3H1Q A;  2ZWH A;  3IFR A;  5BRD A;  1YI2 N;  1HKB A;  3VF2 A;  3AAR A;  4XH4 A;  3ENB A;  1VQ7 N;  3EZW A;  4C23 A;  5DM7 L;  3CXC M;  1GLE G;  4A62 A;  4EIA A;  5BN8 A;  2WC9 A;  2QWR A;  3M1F A;  4GVE A;  4Z94 A;  2I7P A;  5JVH L;  1K9M O;  1KXP A;  4BE7 B;  3O08 A;  4KH5 A;  5E26 A;  1O13 A;  4FWR A;  3C65 A;  3FZL A;  1ATS A;  4FWM A;  3VEX A;  4CZG A;  3CC7 N;  4JNE A;  3GBT A;  3ZX0 A;  2HOE A;  4FPB A;  3FGU A;  5BRE A;  3QML A;  1KC8 O;  2HMP A;  4YOU A;  4RCH A;  4JAX A;  4JEP A;  1IJJ A;  2H3G X;  1HX1 A;  3N4P A;  2QA4 N;  2QM1 A;  4WFA L;  3HOS A;  2VGN A;  3DAW A;  3DJC A;  3F2K A;  5AQX A;  1QZ5 A;  2QWN A;  4M7Y A;  3VPZ A;  4NB4 A;  5KPR A;  4JKH A;  3H1V X;  3CCL N;  1NGI A;  3O1W A;  2FXU A;  2GWK A;  4E1J A;  3R1X A;  1T6C A;  1S22 A;  3VET A;  5EVZ A;  1NGG A;  2P9N A;  1E4F T;  4K42 A;  3R6M A;  1N8R O;  5KPZ A;  1YJN N;  3QBW A;  4IO9 L;  1T44 A;  4ILH A;  4BRP A;  1WOQ A;  1MDU B;  1XC3 A;  4QS8 A;  3CPW M;  3IDH A;  2GWJ A;  5AQH A;  1BUP A;  3WXM B;  2P9L A;  3N4Q A;  1NJI O;  2E2O A;  4XEI A;  4BVP A;  3DLL L;  2RE2 A;  5AQW A;  5FPM A;  4JKC A;  3VEN A;  4FVU A;  4H0Y B;  3M5R A;  3CJA A;  3W0L A;  1DEJ A;  1SAZ A;  3VOV A;  4I6M B;  4CZI A;  2GUP A;  1JCE A;  3T7Z A;  4R79 A;  3VTI A;  3TTD A;  2OTJ N;  1GLJ O;  3DXM B;  4CBX A;  5ELZ A;  2J4R A;  3SMS A;  3VEY A;  5GIN A;  2GX9 A;  4KBO A;  2NRV A;  5AQV A;  3HI0 A;  4CD3 A;  1TYQ B;  1GLL O;  4H0O A;  4AM6 A;  4UY8 O;  2YHX A;  3KVG A;  4MO5 A;  3I8B A;  1HKC A;  1RFQ A;  2V7Y A;  4BG9 A;  1BO5 O;  3P39 A;  1C0F A;  5GIP A;  4K25 A;  5AQI A;  1Q86 O;  1VQM N;  3KHY A;  1EQY A;  3WXK A;  4JD2 B;  2KKZ A;  5F0X A;  2OAN A;  3RSE B;  3RVC A;  2CGJ A;  4ISE A;  4BC3 A;  3ZET A;  2P9I B;  1G99 A;  2WBN A;  5AZJ B;  4OPA A;  1NGD A;  4BC4 A;  1NGA A;  3GG4 A;  4BRA A;  3SAF A;  3C0B A;  4BEC A;  2FLO A;  2F9T A;  1V4T A;  1VQL N;  3HZ6 A;  1IG8 A;  3FZH A;  3A5L C;  3EE8 A;  2E8A A;  3A5N C;  3DXK B;  2BUP A;  4EHU A;  2Q1N A;  1P8Z A;  4QS7 A;  3FZM A;  3MMV A;  4H5T A;  3J7Z O;  4WQ5 A;  3AGR A;  2V7Z A;  1XUP O;  5E84 A;  2KLA A;  2C1G A;  1SZ2 A;  3O5B A;  4PKG A;  3CCM N;  5AQS A;  4IOA L;  3E1Y A;  4PL8 A;  3C6A A;  3NVM A;  3LM2 A;  3BEX A;  3MK6 A;  1SS6 A;  3P38 A;  4WQ5 C;  1NBW A;  3UKU B;  5AQT A;  4I6M A;  3G25 A;  2HBK A;  3H6E A;  4JK8 A;  1YUW A;  3DXM A;  1JJ2 M;  2I7N A;  5AR0 A;  3VEW A;  4U7B A;  2ASP A;  2NZT A;  4MLE A;  2E2N A;  4FWK A;  2NRZ A;  2NRW A;  2W40 A;  3CER A;  1TYQ A;  3ID8 A;  5C2D A;  4JKG B;  2D4W A;  3UKR B;  4JKE A;  3CME N;  4FWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...