2P9PB

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
190
structure length
184
Chain Sequence
GVVVDSGDGVTHICPVSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEVGVAELLFNTIQADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 50
structure length 184
sequence length 190
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9pB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9pB02
5KPZA 4BRGA 1XQSC 3CETA 3WXJA 4CZHA 1YAGA 2EWSA 3W0LA 4C23A 1NGEA 3MMVA 3A5NC 4XH5A 3CJCA 3GBTA 3L0QA 4CZIA 3C7NA 2P9LB 4DB3A 3LM9A 4B1VA 1GLDG 2HF4A 4MLEA 3HM8A 1X9JA 5FPMA 2D0PA 3MN7A 3UB5A 1CZAN 5AQLA 4IXCA 4JD2B 2V7ZA 2FSKA 2Q1NA 3JS6A 3BF3A 2I7PA 3O6WA 1MA9B 2P9UA 3VEVA 3P4IA 1NGJA 1BA0A 2NZTA 2YCHA 3I8BA 5E26A 1WUAA 1U2VB 3WUHA 2PBDA 3VEWA 3QB0A 2AA4A 4H0VB 4O8KA 4I6MA 4XH1A 3RSEB 4BG9A 1HLUA 3CHWA 4H5TA 3KVGA 2A40A 2YJFA 4BR4A 4PKIA 3FZHA 4DQ8A 4CBUA 4FL9A 4BC5A 4BQLA 4AM6A 1RFQA 2QWLA 3WEEA 1P8ZA 3EKUA 4FSVA 5LY3A 2NLXA 3QFPA 3ULEB 5AQOA 2FXUA 5AQKA 3VF2A 3M1FA 3U9ZA 5B8HA 1EQYA 2FSNA 3ZEUB 1HJOA 3H6EA 2D4WA 1SAZA 2BUPA 3GL1A 4H5WA 3DXMA 5FPEA 2PAVA 3CIPA 3SMPA 3OHRA 3WXKA 3FZFA 3ZETB 3BP8A 5AFUA 1KAZA 3CQXA 1QQMA 1LCUA 4FWSA 3DXKA 2GELA 1QZ5A 3A5OC 1H1VA 5AQXA 2GWJA 4M63C 4K43A 4H0PA 3U8XA 4CI6A 3WXLA 1S22A 3WXIA 4BR2A 4FOEA 4M7YA 3LDPA 3QBXA 4JHDB 2QWOA 3AAPA 3LL3A 3TU5A 2CGJA 4GNIA 1ZBSA 3H3OB 1BO5O 3EL2A 1NGFA 4FWMA 3KHYA 3R6MA 4WQ5A 2VWBA 5BRHA 1Z6RA 5BN9A 3FFKB 1T44A 4BG8A 5AZJB 4JAXA 4CBXA 2GEMA 1NGHA 1R59O 2FF3B 4J8FA 4K41A 1DKGD 1XC3A 3C0BA 4EIAA 1BDGA 4PKGA 4CZGA 3MN6A 1HPMA 1DEJA 4H5VA 2F9TA 2YHXA 3MDQA 4WQ5C 2E1YA 1ATNA 3DAWA 1NBWA 1J6ZA 2P9LA 4ISFA 3O5BA 4K25A 1SQKA 1NGBA 4BVPA 4BRQA 2HMPA 2ZF5O 1MWKA 4NB4A 4BROA 4BRHA 5ADXH 4RCHA 4JD2A 1E4FT 1YVNA 3IUCA 1HKCA 2P9NB 2W40A 3R9PA 4H5NA 3VEZA 5AR0A 1WOQA 1U2VA 2J4RA 3F9MA 5AZIB 1JCGA 4Z94A 1HUXA 2FF6A 2IIRA 3D2EB 2QWMA 3L4IA 1NM1A 3FE1A 4WQ4C 1OKJA 3UKRB 4DCHA 2AP1A 5EY4A 3KZBA 4BRCA 4JN4A 4O5FA 3UKUB 1LOTB 2HF3A 2Q0UA 2P9SB 1DGKN 2F9WA 2WUSA 4BRDA 4BRAA 3VF4A 3ULEA 2I7NA 5BPNA 4BC3A 4KBOA 4PL7A 2DPNA 3CJ7A 2E1ZA 3CJAA 3VESA 3HTVA 3ZEUA 5AQJA 3H3NO 3U4LA 2P9PA 3MK6A 4K42A 2GUPA 5AQFA 4BC2A 5KPRA 3C7NB 3H46O 3ZETA 1U6ZA 1BWFO 3HI0A 3ENOA 1TYQA 4B1UB 1GLFO 3VEYA 4RWTA 4IJNA 2ASPA 2YJEA 2QWNA 4FWKA 4WYBA 3CERA 4ISEA 4AM7A 4CZLA 2P9IB 2NRHA 3M6GA 4QS8A 4BR5A 4FWRA 5AQWA 5AQIA 5AQRA 4B1XB 3L6QA 1KXPA 5EVZA 4IJAA 4XEIA 2HOEA 4FWQA 5CE3A 2V7YA 2QWPA 3HZ6A 3LDLA 2Q31A 3TPQA 1JCFA 4PL8A 2E20A 5BPLA 3CJ1A 3IFRA 1E4GT 5KQ8A 1GLAG 4Y0WA 3O08A 5AZJA 2E2QA 3VOVA 3D2FB 4A2BA 4BRFA 4L3QA 1YXQA 3VPZA 4FWLA 1RDWX 3W3DA 3QBWA 5AQPA 3BUZB 3DJCA 3O1BA 3ATUA 5FPNA 3J8AA 5FPDA 3AAQA 1IJJA 2A42A 5BR9A 3VEXA 4CZKA 3S41A 4BR0A 1ESVA 3WQTA 1BG3A 2E88A 1ATSA 3ATVA 4BQZA 3VGKA 4H0XB 5EXWA 2D0OA 5LJVA 3LM2A 5KQDA 5JLFA 3JXUA 3DXKB 4BC4A 5AQGA 2CH6A 3LDOA 4CBWA 4RTFD 1HKBA 2P9NA 4BGAA 1X3MA 1MWMA 4CJ7A 2W41A 3CQYA 1K8KB 4CZFA 4FPBA 3A8YA 3HSCA 2ASOA 3IDHA 3GDQA 4BREA 5JLHA 3H1VX 1G99A 3VENA 3WQUA 3VEOA 3CI5A 4BR9A 2YHWA 1V4TA 2KHOA 3D2EA 4B1WB 5AQYA 3R8EA 2P9KB 3ZX3A 3MN9A 3FR0A 4FWOA 4BVOA 3A5LC 5E84A 1NWKA 2E8AA 2QWRA 3UKUA 4BGBA 2Q2RA 2P9SA 2UYTA 2FLOA 2Q97A 4A2AA 3HBTA 5AFUH 3G25A 3MCPA 3VF6A 2GWKA 2VYPA 1C0GA 3FZMA 4PKHA 3VGLA 4FOIA 3RSEA 5EX5A 4DHYA 4EHTA 2QXLA 2QW9A 1GLBG 3QDKA 1V4SA 4M7XA 3O4WA 4MLHA 5AQTA 1HKGA 4B9QA 3CJBA 1MDUB 3M3ZA 2Q36A 2A41A 2BTFA 3EN9A 1T6CA 1QQNA 4MO5A 3FLCO 3H45C 2D1KA 3MN5A 4B1ZA 2ASMA 4ISGA 5BRFA 4A61A 3QFUA 1GLLO 4H5RA 1C0FA 5AQMA 5AQZA 2CGKA 2QWQA 3EO3A 4JNEA 2A6AA 3GOIA 3O80A 2P9IA 3B8AX 4CZEA 3GG4A 3D7EO 1BU6O 1TUUA 1HX1A 4BR7A 3BF1A 4FPAA 2A3ZA 1NGCA 5EOYA 5F0XA 4IWVA 2ZWHA 3QICA 5LJWA 4BRKA 5TKYA 1NMDA 3QMLA 4EHUA 4LC9B 3EZWA 3VGMA 1ZXOA 4FWNA 3A0IX 2E2NA 3FZLA 1Q18A 1QHAA 5AQSA 3SLCA 1BA1A 3IMXA 2P9UB 2E2PA 5F2RA 3CJ9A 4CD1A 4FWPA 3D2FA 4JHDA 1RGIA 3ZX0A 5I9EB 4BRNA 4IO8A 2IVNA 3VETA 4H0TB 4IZ9A 2QM1A 5BPMA 5AQUA 4F9OA 5F1XA 5AQNA 4I6MB 3U9DA 3A5MC 3I33A 5ADXA 4YDUA 4EFHA 1GLCG 2YHYA 3UE5A 2CH5A 3O1WA 1D4XA 3LDNA 3LDQA 4H0YB 2P9PB 5BREA 2Q0RA 1S3XA 4CZMA 3WEEB 3EKSA 1NGIA 2IVOA 4FO0A 2V52B 1TYQB 1ATRA 4H0OA 2YI1A 4NO7A 3GE1A 4YDUC 5ELZA 5BN8A 2ZGYA 4GY2B 2VCPA 3SK3A 4BRMA 3DXMB 1K8KA 4QS7A 4HWIA 5AQQA 4BRPA 3ZX2A 2GTDA 1BOTO 2FSJA 1QQOA 1ZC6A 4EAHD 4CD3A 4CZJA 1BUPA 4QS9A 3SMSA 1Y64A 1JCEA 2P9KA 3AY9A 2E2OA 4XH4A 4HTLA 1KAYA 4B1YB 4E1JA 1TUYA 1NGGA 1T6DA 2H3GX 2A5XA 1IG8A 3AARA 3FZKA 2IVPA 3SJHA 5AZIA 1NGAA 2ZGZA 1SZ2A 1NLVA 2OANA 3O8MA 3DWLA 1NGDA 1GLJO 3UKRA 4BRLA 1YUWA 3H1QA 2ITMA 1X3NA 4A62A 4MO4A 3WT0A 1QZ6A 3ID8A 3FGUA 4H03B 3ENHA 3BEXA 2V51B 1Z05A 5JICA 2CGLA 5BRDA 3VERA 4BRIA 5AQHA 5JMVA 1KAXA 1XUPO 1GLEG 5AQVA 5KPTA 4WQ4A
chains in the Genus database with same CATH superfamily
2O4IA 1I39A 4KTQA 3CETA 4TSXA 3WXJA 3L2UA 1NK4A 4X65K 1JLGA 5HP1A 4CEOA 3THWA 1VRTA 3OYFA 3DRSA 4K0KK 1GLDG 1S72N 4MLEA 4OJRA 5JVHL 4CFBA 2D0PA 3UB5A 3K9JA 3KD5E 5AQLA 4B9SA 1REVA 2KLAA 2V7ZA 3V9SA 3BF3A 1BISA 2ZM6K 1BA0A 3I8BA 1YI2N 3WUHA 1ZBFA 2PBDA 3D45A 1DTQA 4CESA 4H0VB 3TANA 2NRXA 3OVNA 1A5VA 4PUOA 3DLEA 1OH6A 1WN7A 4N76A 4FCYA 4PKIA 1NJXA 4CBUA 1NNEA 1EO1A 4CERA 1NKCA 2WTUA 2QWLA 1C6VA 4CF0A 4BE0A 4FSVA 3KWIA 4CJUA 1WSFA 3M1FA 1T8EA 3KK3A 3MXMA 4CHQA 4OLAA 5B8HA 1EQYA 5MLCQ 1TAQA 2D4WA 4J2DA 5TKWA 3DXMA 3CIPA 3R3LA 2HHXA 4Z4IA 3SUOA 3OHRA 3WXKA 4JS5A 3OYIA 5C2FA 2HHQA 2Q3SA 4DQPA 3AVJA 3TAQA 2GELA 3U3GA 4ID1A 1VQNN 2GWJA 2D0CA 3K0SA 4CGDA 1RTJA 5LMNK 3QESA 4CI6A 4JS4A 1N36K 1KCFA 5I3UA 4JKBA 3LP3A 3WXIA 5FRMA 4LF5K 3QNNA 1LW0A 2WFBA 3B6PA 1HNZK 4U67L 1Q82O 3TTFA 1IKWA 4JLHA 1RDUA 3H3OB 3NAEA 3O3GA 4WQ5A 3PY8A 1VK0A 4DTPA 2W6KA 5BN9A 4BG8A 5AZJB 2O8FB 2X6NA 4JAXA 2FBTA 3OTOK 2FF3B 4J8FA 2B6AA 4DU3A 5C2DA 3J80O 3AVNA 1LW2A 2NRRA 5FDLA 1J5OA 4CZGA 2HHTA 1NG9A 3DLRA 2ZE2A 3RMDA 1ATNA 1FKPA 2P9LA 4JKFA 1SQKA 1KTQA 1HYSA 4CJKA 2OPQA 1MWKA 4NB4A 4BROA 5ADXH 4JKDA 3AVBA 5J2MA 3IUCA 3V4IA 2FBYA 3T3FA 4H5NA 4RW4A 3M5RA 1WOQA 1U2VA 2E6MA 1JCGA 3KLIA 3IS9A 4NYNA 2YNHA 2HHVA 1XMQK 2QWMA 4WQ4C 3UKRB 4W5NA 1XC9A 4MDAA 3ISNC 5HRRA 2BDPA 4BEBA 4GKJK 4IOCL 3QETA 3UKUB 1LOTB 2HF3A 1KLNA 2Q0UA 1EX4A 1DGKN 1B92A 2WUSA 2R7YA 4DLGA 1NMNA 3AGRA 3ULEA 4QCLA 3CJAA 4CGIA 1WBBA 3DLBA 3LP0A 1LWCA 3O9RA 4OX9K 1BIZA 3ZT0A 2P5OA 1N5YA 3CXCM 4E72A 5KPRA 3ZETA 5KRTA 1CLQA 1UAXA 4KHNA 2G8UA 1GLFO 3VQ5A 2ASPA 2YJEA 1RILA 4CEBA 3NCIA 3V9WA 2G8VA 2P9IB 3O9TA 1HR0K 1NJZA 4BWMA 1VSFA 4FWRA 3OY9A 3AVCA 4JKGA 5AQRA 2B5JA 4M41A 4YOVA 2YKNA 2RE2A 4B9MA 2QWPA 3HZ6A 1U45A 3PUFA 1JCFA 4PL8A 4I2QA 3IFRA 3LDSA 2WOMA 2O8DA 2UXCK 3D2FB 1L5UA 2YHBA 4M3XA 1RDWX 3ZSXA 1TL1A 3DJCA 3O1BA 5GADP 5FPDA 2QTDA 3SNNA 1OH5A 3DLLL 4YNQA 4DV7K 4OVLA 1BG3A 2E88A 4BQZA 3THVA 4OO1J 3OBWA 5LJVA 1X1PA 1FXXA 5KGWA 5HRNA 1D8YA 5AQGA 1JXBA 3MCAB 1S6PA 4FJNA 1LWFA 5M1PA 5GAGP 4W5OA 2NUBA 4BGAA 1HYVA 1K8AO 1IKYA 3HSCA 1XI1A 3H1VX 1Q86O 2JGUA 4BR9A 1V4TA 3RMBA 4U7BA 5AQYA 1NU0A 2PZSA 2O8CA 2P9KB 1RDDA 1NWKA 2QWRA 4CJ3A 3TSPA 1RDBA 5HL7L 4O5BA 4KI6A 3LPTA 4KFBA 1C0GA 3FZMA 1SV5A 1ZBUA 4E7KA 4FJLA 2QW9A 4PHTX 3S9HA 1V4SA 1LAWA 2E4LA 3O4WA 4GV3A 1S1VA 3M3ZA 2Q36A 4FZYA 2A41A 2O8EA 4E1NA 1T6CA 3H45C 2D1KA 5M1OA 5BRFA 4A61A 2F4VK 3KKRA 1C0FA 3P83D 1E3MA 3QEWA 3J7YP 2I5JA 2OPPA 3ZSWA 5AJ3K 3AO5A 4F3OA 2DFFA 3O80A 4HUEA 2OZMA 3GG4A 3HVRA 3D7EO 1BU6O 1HX1A 2OTLN 4BR7A 3PX0A 4CGGA 2HSTA 3P5JA 4LF8K 5F0XA 3O4QA 4IWVA 2D0BA 3ZT1A 1NMDA 5I42A 2G8FA 5KRSA 5KGXA 1VQMN 5AQSA 3E1YA 3SLCA 3O9UA 5DM7L 3L2VA 4ILJA 4JHDA 3ZX0A 4Z4EA 4BRNA 3EZ5A 4CJPA 1NJIO 4IZ9A 1WSJA 5HRSA 3OYKA 3DYAA 4BDPA 1GLCG 2F8TA 3LWLA 1WBDA 3O1WA 3LDQA 2EHGA 2P9PB 5BREA 1EWQA 2ZQBA 1S3XA 4ICLA 3SPYA 3CCJN 3DM2A 1TYQB 4NCBA 3GE1A 3NMUA 2Z1HA 5IT9O 2OPSA 4BRMA 1S1UA 1JLCA 4B3TK 4FJHA 4BWJA 4QS7A 5GAEP 2KQ2A 2D0AA 1GOAA 4CHZA 1VRUA 5C15A 3ZX2A 2GTDA 4LF9K 4KV8A 4KPYA 2RKIA 1IKXA 1Y64A 1M90O 1YITN 3AY9A 3SBGA 4HTLA 1KAYA 4B1YB 3SUQA 4RW6A 1TUYA 2P5GA 5J1EA 3SJHA 1C0MA 3HL8A 5DMRA 3THYA 4AHUA 3NH1A 5GINA 4FLTA 2HBKA 1Q9YA 3DWLA 4B3RK 1Y97A 3U6FA 2NRWA 2KKZA 4E1MA 4OPKA 4DMNA 4KAZA 1IKVA 2PYLA 3ZT2A 4IEEA 1X9WA 2YX6A 4F4KA 1XUPO 2RPIA 1TAUA 1VSKA 4BACA 5KPZA 4CZHA 3MX2A 3LZIA 1SKWA 1QSLA 3W0LA 4C23A 1NGEA 3C6AA 3CJCA 1BQNA 3GBTA 4CZIA 3C7NA 2HBJA 4DB3A 4X64K 4DSJA 4B1VA 4NLCA 4DTSA 4FJKA 4IG3A 4XJXA 3RMCA 5FPMA 3MN7A 3CQ8A 3HSTB 4ILHA 4DR5K 4EP4A 3C65A 4OKKA 2IGIA 3JS6A 3NFAA 3O6WA 5K14A 2P9UA 4DR7K 4DS5A 3OYNA 3EEQA 2W00A 4X62K 1NGJA 2NZTA 2G8WA 3BDPA 5E26A 2HBMA 4RG8A 2DFEA 1WUAA 4CJ4A 4M45A 2XY6A 1NOYA 1JLFA 2AA4A 4CHOA 3B6OA 4O8KA 4I6MA 5KTQA 1RBSA 1BL3A 4H5TA 4O8UA 2YJFA 1UWBA 5LMUK 4AM6A 3WEEA 3HOSA 2NLXA 2Y1JA 2XY7A 1IV0A 4I2PA 3SAGA 4AH9A 3U9ZA 1UOCA 3OS2A 3ZEUB 3DRRA 3VQPA 1SAZA 3GL1A 4H5WA 1M1KO 5CR4A 1QVFM 5AFUA 3BP8A 3CQXA 1VQ8N 1D9DA 3DXKA 1BGXT 1QZ5A 4E0DA 1H1VA 5AQXA 4DWIA 4H0PA 4M42A 1BCOA 3P38A 1JLBA 3NVMA 4FK4A 1S22A 3NVKA 4NXNK 1VQ6N 4YOYA 4FLYA 4B9VA 3FFIA 2HMIA 4FLZA 3LL3A 4DU4A 1WAJA 2CGJA 3KHYA 3R6MA 2HNZA 3VQAA 3S5TA 1TGOA 5BRHA 4XIUA 4M3TA 1S6QA 3H08A 1KFSA 1N32K 3VQ7A 1R59O 4AHVA 2NNWA 4NLBA 3C0BA 4IO9L 4Z4FA 2OPRA 3MN6A 1KFDA 1DEJA 4H5VA 2YHXA 3MDQA 4NCGA 3WXMB 3ZYYX 4DSFA 3PO4A 3DAWA 2HHHK 1DLOA 4CGJA 1A5WA 5FROA 4K25A 3TTDA 4FM2A 1XHZA 2VGNA 4OKJA 4FVUA 1IBKK 5EU7A 1TKXA 4RCHA 1E4FT 3OYDA 3MEDA 3ZCMA 3R9PA 1NK7A 4DFJA 2HHSA 5AR0A 5AZIB 3AVHA 4WCEL 3D2EB 3HYFA 2VQEK 3L4IA 1NM1A 3FE1A 2RF2A 3TAEA 1RBVA 2AP1A 3KZBA 1RT3A 2FC0A 4BRCA 4JN4A 1RT6A 4O5FA 3CCUN 2P9SB 4G9ZA 2F9WA 4BRDA 3VQCA 4AHRA 4BRAA 4KBOA 4PL7A 3VESA 3HTVA 3KK2A 4O0IA 4W5QA 4FJIA 3MK6A 5AQFA 4BC2A 3THWB 1VQ5N 3NH2A 3K2PA 4JI5K 1BWFO 4IEIA 4AQYK 2XY5A 1SKSA 4LF6K 3HI0A 3J81O 4B1UB 3ZSYA 2HHWA 2FBVA 4IJNA 1YJWN 2QWNA 4CHYA 4FWKA 4WYBA 3CERA 4ISEA 1FJGK 4PA1A 1ZYQA 5C10A 3M6GA 4BR5A 2UUAK 4HHTA 1RBUA 3WNEA 1U48A 1KXPA 5EVZA 4FJGA 4XEIA 3AVMA 2JWKA 3CCRN 4FJ9A 3TPQA 3QIPA 2E20A 1J53A 1GLAG 2XY8A 3O08A 5AZJA 4DR4K 2O8FA 4A2BA 1S1XA 3SAFA 1NJYA 1ASVA 4FWLA 3CPWM 3LZJA 1KVAA 5AQPA 1N8RO 3BUZB 2QI2A 1J5EK 1EXQA 4DV2K 4M3YA 4JK9A 3ID6A 5BR9A 3AO3A 4IDHA 1B9FA 1JLEA 1NK9A 1W97L 4RW8A 1OVYA 3VGKA 4GVMA 1SS6A 5JLFA 4WFNL 4G1QA 3PX4A 5JS2A 2IDOA 4OLBA 3SI6A 3QO9A 1OVQA 3TTCA 2ZJQL 1EKEA 4IFEA 1MWMA 3CQYA 4FPBA 1X9SA 3IDHA 2ASOA 4CGFA 3C6UA 3CI5A 2KHOA 3ZX3A 2WC9A 3FR0A 5E84A 4KHPK 2E8AA 3UKUA 1ZBLA 5HRPA 3O3FA 3S3OA 3MCPA 3VF6A 2GWKA 3CCMN 4DS4A 4CFDA 1B9DA 4FOIA 3RSEA 3ZT4A 2JLEA 3QDKA 4MLHA 1HKGA 1MDUB 2DTUA 3SCXA 1QQNA 1WSGA 3MN5A 3CFOA 4B1ZA 2Z1JA 1JKHA 4ISGA 3MWTA 5KI6A 2QA4N 3OYBA 1IBLK 3QEIA 3OYCA 4QAGA 2RN2A 2IS3A 2NRVA 1BI4A 3ZSVA 1ITGA 2BH1A 3ASMA 2QWQA 3KK1A 3V9ZA 4JNEA 2A6AA 4E19A 2P9IA 1TL3A 4DQQA 1TUUA 3L2QA 5JVGL 1TKTA 2PYJA 3AA3A 1RT7A 5EOYA 4B9NA 5J2NA 4DF8A 1LV5A 2ZWHA 3QICA 4H4MA 4BRKA 3F5TA 3MXIA 4KI4A 3PO5A 2HBLA 3QMLA 1HNWK 4LC9B 3PSFA 3VGMA 1ZXOA 2E2NA 1QHAA 1BA1A 3D2FA 4MFBA 5CYMA 4IO8A 2IVNA 4WFAL 3VETA 3BZCA 3NF6A 1TK8A 5F1XA 4DSLA 3U9DA 2O8BB 1LAVA 4DUZK 3I33A 2F8SA 5ADXA 1C1BA 4N41A 2YHYA 3UE5A 1HQEA 1QSYA 3CYGA 4DV4K 3RR7A 3AVIA 2KW4A 3MXJA 1DT9A 4CZMA 3TAFA 1NGIA 2IVOA 4CF1A 5E41A 2YKMA 4KO0A 1ATRA 4H0OA 2YI1A 4YHHK 3CCQN 3HP9A 3DLKA 1U04A 1BQMA 2FBXA 1ZBIA 5AQQA 3KWGA 1K6YA 4BRPA 1VSJA 2FSJA 1QQOA 4CD3A 4F3TA 1BUPA 4QS9A 1IO2A 2P9KA 3SPZA 2E2OA 4B08A 4GV6A 4CCHA 3HJFA 1T6DA 3FZKA 2IVPA 2O8DB 5LL6Z 4Z4HA 2VGMA 2GBZA 4OGEA 1WLJA 4BRLA 3AO4A 1NK5A 1YUWA 2RHKA 3H1QA 4C8LA 1X3NA 4A62A 4MO4A 4MQ3A 4DF4A 3HK2A 4E7IA 3C6TA 3J7AP 2BANA 4KHYA 4BRIA 5JMVA 1GLEG 3CFPA 1T05A 2OYQA 3G4SN 3TABA 1FW6A 4CEDA 1WSEA 1YAGA 2EWSA 3KJVA 3HT3A 4JI4K 3VA0A 3CCSN 4EZ9A 3LM9A 3O9QA 2HF4A 3HM8A 4LSNA 1X9JA 4FYDA 4B9UA 3KLGA 4IXCA 4JD2B 2FSKA 2Q1NA 3V9XA 1MA9B 4FZXC 1N33K 3V1OA 3VEVA 3VQQA 2ZJPL 4KHWA 3VEWA 4AHSA 3I8DA 4BG9A 2OZSA 3ZSOA 4EZ6A 1HLUA 3CHWA 4DKWA 4ZTFA 3MWPA 1KC8O 2A40A 2Z1IA 4BR4A 2O8EB 4DQ8A 4BC5A 4BQLA 3VA3A 4AHTA 4BECA 3V9UA 1RFQA 1P8ZA 3EKUA 3RRHA 3QFPA 3RRGA 5AQOA 2E5LK 1XMOK 1HPZA 5HLFA 2FXUA 5AQKA 1N6QA 4ELVA 1QQCA 1D5AA 1WSIA 3SAHA 3T1YK 4V19S 3BZKA 4OPHA 4AILC 4LH5A 4Q0BA 1S1TA 1HJOA 3V1RA 3H6EA 3ZT3A 4CK1A 4L8RB 2BUPA 3CFRA 4WFBL 4E7HA 4DSIA 3SUNA 2PAVA 3SMPA 3IKMA 1P90A 5JS1A 1KAZA 2IAJA 4MDBA 1JL2A 3C94A 1LCUA 3A5OC 1HQUA 1RCHA 5C25A 3NF9A 4K43A 2A1RA 3PSIA 4CJ5A 4FM0A 5IWAK 4DTOA 4DLEA 4CW7B 3LDPA 3TWHA 3QBXA 3RTVA 1Q8IA 4JHDB 4KREA 2QWOA 3AAPA 1RDAA 1SKRA 3TU5A 5M1NA 1W9HA 1BO5O 4A5BA 1NGFA 4FWMA 4I7FA 4GV9A 3VTIA 3E01A 3KLEA 1YT3A 4CGHA 3S3MA 2VWBA 4IFVA 1Z6RA 2IC3A 3OYLA 4FLWA 1YF5L 5GAHP 3OYGA 2X6SA 3Q7CA 1SL1A 4DFKA 4CBXA 4BY9C 1NGHA 4FW1A 3JYTA 1CZBA 3SUPA 4Y1DA 1J9AA 4K41A 4EIAA 1BDGA 4JKEA 2KZZA 1GOBA 4CEAA 1QS4A 2HVIA 3ZSRA 4DR1K 1HPMA 1W2BM 1DTTA 4CHNA 1J6ZA 4ELTA 3I55N 4ISFA 3O5BA 4KTWA 4BVPA 3EY1A 4BRQA 1L3UA 1G15A 2HMPA 3G6EN 1C1CA 5A2QO 1UA1A 3HO1A 2P9NB 2W40A 3VEZA 2X74A 5GIPA 3K5MA 4DQRA 3NF7A 3KLFA 4DTXA 1HRHA 1FKOA 2J4RA 4W5TA 1QVGM 4Z94A 1HUXA 3SBTA 2FF6A 4CJTA 1O1WA 4DU1A 4OPJA 1IBMK 3LWMA 4FJXA 3N4PA 1S9EA 1BIUA 1VQON 5CHIA 4LY7A 4E7LA 2I7NA 4YOUA 3VQEA 4FLXA 2DPNA 2P1JA 4RW7A 2E1ZA 4C8MA 3ZEUA 4KHUA 3LANA 3H3NO 4CJEA 4LD0A 3U4LA 1XNQK 4YOWA 3KD1E 5CZ1A 4FM1A 2GUPA 2VG5A 4UQGA 3C6HA 3C7NB 3KK7A 1U6ZA 3TI0A 3RWUA 1VHXA 3OYMA 4FJ7A 4DUYK 3SQ2A 2LSNA 3CYMA 3L8BA 4AM7A 1VSMA 4CZLA 5FLXO 4N56A 5C12A 5FRNA 3CM5A 1NKEA 5AQWA 1XHXA 4B1XB 3LAKA 1C0TA 1WAFA 4FWQA 4GMJB 2GX9A 5CE3A 4B3OA 2Q31A 4KKOA 1T03A 1YJ9N 4HVJA 2KTQA 3CJ1A 3SQ0A 1E4GT 2D5RA 5KQ8A 1CXUA 1K73O 1FK9A 4Y0WA 4Q5VA 3PIOL 2E2QA 3VOVA 4BRFA 4L3QA 2VG6A 4YORA 5CZ2A 4IDKA 3KTQA 3THXA 5FPNA 3HRGA 3PIPL 3CM6A 1YHQN 4CIFA 3VEXA 3N4QA 3S41A 4JI2K 4CZKA 4CK3A 3I56N 4BR0A 3NHGA 1NOZA 1SL2A 1I94K 4GKKK 2HB5A 3ATVA 4JKCA 3LM2A 5KQDA 3MEEA 3JXUA 3HPOA 4Z4CA 2UUCK 3CD6N 1BHLA 3S3NA 4I9QA 3DXKB 4JRPA 4GVEA 4DFPA 2E6LA 3E9PA 1L3TA 3CCEN 1SL0A 4DFMA 1HKBA 2PY5A 3OS1A 1X3MA 1NK0A 2W41A 3WNFA 1RBTA 1K8KB 5D3GA 3A8YA 3VENA 5DK5A 3WQUA 3L3UA 2YHWA 3D2EA 3UIQA 5JENA 3VQ9A 4B1WB 3KIOA 3MN9A 4IFYA 1TK5A 4FZZA 4KB1A 4FWOA 2UU9K 3A5LC 1S9GA 1NKBA 1U4BA 2Q2RA 3OYHA 4CFCA 3HOTA 2P9SA 2UYTA 3JAMO 3T19A 3K57A 3TSQA 4NYFA 3IAYA 2VYPA 4ELUA 3VGLA 4DHYA 4EHTA 4NXMK 5H1SQ 4KHSA 2QXLA 4KH5A 4M7XA 4BDYA 5AQTA 4B9QA 4DR3K 1NK8A 4LFBK 3CJBA 2KZMA 4LFAK 4M3WA 2HNDA 1TVRA 1KQSM 4IBNA 3EN9A 1I3AA 3SYZA 4MO5A 2XO7A 3FLCO 4JI0K 1GLLO 4H5RA 3I0RA 3SV3A 4FJ5A 2BGGA 4CF8A 3CCVN 3EO3A 3TAPA 3QNOA 4BE7B 4A5AA 3B8AX 4CZEA 4JI8K 3ENBA 4CF2A 4JK7A 3HM9A 4CJWA 3OW2M 1ASWA 2A3ZA 1NGCA 2C1GA 3QEPA 5LJWA 1N34K 3EZWA 3CC2N 1Q18A 1HNVA 4B3SK 1YTAA 4CD1A 3L2RA 4RW9A 5I9EB 4CEEA 5CYQA 4GW6A 3ITHA 5AQUA 4M3RA 3NH0A 3A5MC 2ITGA 3M8PA 3SQ4A 2CH5A 2QKKA 1D4XA 2VWJA 1VSLA 4H0YB 3EE9A 3TARA 3V1QA 3NDKA 2V52B 4KHQA 4ZTJA 3I0SA 4NO7A 4C1NK 4KRFA 2F7TA 4YDUC 4CF9A 5BN8A 2ZGYA 3CF5L 4GY2B 2VCPA 5GIOA 3AV9A 3AVFA 3DXMB 4C8KA 3PLAA 4HWIA 4M3ZA 4IKFA 1BOTO 4EAHD 1ZC6A 3DRPA 4CZJA 3SMSA 4B9TA 1RTDA 3ZSQA 4CJFA 1NGGA 3K5NA 4B8AB 3EE8A 1IG8A 3AARA 1TKZA 4O55A 3QIOA 3VQBA 1NGAA 3VTHA 1SZ2A 4B3MK 2OANA 3F73A 1RTIA 3A2FA 1BCMA 3O8MA 1NGDA 1W0HA 3UKRA 1NK6A 4IOXA 4LH4A 4CEFA 3SQ1A 1VQLN 3QEXA 3ID8A 4H03B 4DTJA 3BEXA 4J2AA 2V51B 5JICA 2CGLA 1Q7YO 3T1HK 5AQHA 3AVAA 1VAZA 4JKHA 1KVBA 4X66K 3DLGA 5KPTA 3LP1A 1WB9A 4CJQA 4BRGA 1XQSC 1HJRA 3AA5X 3MMVA 3A5NC 4XH5A 3L0QA 3OJUA 1OH8A 3VQ8A 4LF7K 4FK0A 2P9LB 3L2WA 1JJ2M 4CFAA 4M3UA 1JXEA 3CMEN 5SZTA 2OTJN 1S5JA 2HHIA 3VMFB 4FXDA 3VQ6A 1CZAN 4BE1A 3CC4N 1VSEA 2I7PA 2YV0X 3P4IA 2YCHA 4CIEA 3HP6A 1U2VB 4J2BA 2VQFK 4FW2A 3QB0A 1WNSA 4JK8A 4XH1A 4O4GA 2O8BA 3RSEB 1MU2A 4H4OA 3C95A 1KD1O 3RR8A 3L3VA 2ATQA 3KVGA 1TKDA 2OCEA 4DR6K 4JI3K 3FZHA 3BY5A 3G0ZA 4FL9A 4JI1K 3DOLA 2VG7A 4DV1K 1D9FA 5LY3A 2YHAA 3ULEB 1R0AA 3EYZA 3LP2A 3VF2A 1BI4B 2QEXN 4HUGA 4E89A 4DTUA 2FSNA 3K5LA 4F8RA 4HUFA 2HHUA 5C24A 2G8KA 3WNGA 2NRTA 3P31A 5FPEA 5SWMA 1VSHA 3AA2A 3G71N 1EWRA 4HTUA 3AO2A 1VQKN 3FZFA 3ZETB 4JYAK 5HROA 3D6RA 2JWLA 4FK2A 1QQMA 4FWSA 2P51A 3DMJA 5CY4A 3P1GA 4M63C 3U8XA 3WXLA 3OS0A 4BR2A 3NE6A 4FOEA 4M7YA 1KSPA 2X78A 4JV5K 4JKGB 3MEGA 1JLQA 4GNIA 1ZBSA 1TV6A 1L3SA 3EL2A 3KKSA 4CE9A 1XWLA 1QSSA 3FFKB 1T44A 4UY8O 3F9KA 2GEMA 4CIGA 1IH7A 1DKGD 1XC3A 1U49A 1XNRK 1HNIA 4F2RA 1ASUA 3VN5A 1A5XA 2YNGA 4PKGA 1YJNN 4LFCK 3OBYA 4A59A 5C0YA 2HVHA 4R79A 3PV8A 2F9TA 4WQ5C 2E1YA 1YIJN 5T7BA 1W7AA 1NBWA 1VQPN 3IRXA 3F2KA 1NGBA 1NJWA 3TR8A 1F21A 3AA4A 2UXBK 2ZF5O 3K5OA 3HVTA 3RVCA 1JL1A 4BRHA 4JD2A 1RT1A 1YVNA 3LPUA 4OPAA 1VSIA 2DY4A 1HKCA 3VQ4A 1U47A 2QK9A 3QLHA 3F9MA 3QINA 4C8NA 2IIRA 1OKJA 4DCHA 3PX6A 3DLHA 2O8CB 1RBRA 5EY4A 4Z4GA 2YNIA 3AVGA 4PY5A 1VQ7N 3J7ZO 4KH4A 1Z25A 2G8IA 3NGZA 1RT2A 3OYAA 2UXDK 3VF4A 4KB0A 5BPNA 4BC3A 3U3YA 4QOZB 4CEZA 4ID5A 3CJ7A 3SV4A 3G10A 5AQJA 1UA0A 4B8CA 4E7JA 2A1SA 4JRQA 2GV9A 2P9PA 2G8HA 3QERA 4K42A 1J54A 3H46O 3KLHA 3LAMA 1RT5A 3NBPA 3SJJA 3ENOA 2WONA 3SZ2A 1TYQA 1T7PA 4PQUA 4DTNA 4RWTA 2IOCA 3VEYA 4BE2A 1OH7A 4DV6K 3ZLJA 1L3VA 1IG9A 4LF4K 4WE1A 4R5PA 4F2SA 3OYEA 2NRHA 3HPHA 4QS8A 1KVCA 4OKEA 1KRPA 1C0UA 2BE2A 3TAMA 5AQIA 3L6QA 3BGRA 4IJAA 3CG7A 1C1AA 3P39A 2HOEA 2V7YA 3LDLA 3L4QA 5HOOA 3DI6A 4JI7K 4N47A 2B4JA 5BPLA 5M1KA 1YVUA 1VQ9N 4OGCA 3VPZA 1YXQA 3AVLA 4FVMA 3W3DA 4IOAL 4I9LA 4FLUA 3QBWA 3ULDA 3O4NA 2F96A 1QTMA 3ATUA 3Q7BA 3J8AA 4E3SA 3AAQA 3WNHA 3TAGA 1IJJA 2A42A 4K8ZA 3O9SA 1SUQA 3NGIA 1ESVA 1RTHA 3WQTA 3JSMA 1ATSA 4DQIA 4H0XB 3M8SA 5EXWA 2D0OA 2W6LA 3OA9A 2Z1GA 3AO1A 3V81A 3HPGA 3AGKA 2ZD1A 2UUBK 1CZ9A 4BC4A 4AF1A 4DTMA 1HYZA 2CH6A 3LDOA 2KFNA 1QE1A 4CBWA 2NRZA 4JI6K 2VWKA 4RTFD 1O13A 2P9NA 1RDCA 5J2QA 4CJ7A 3DOKA 4K8XA 4CZFA 4JEPA 4BREA 3GDQA 5JLHA 4YOXA 1G99A 4Y1CA 4J2EA 4YFUA 3VEOA 4W5RA 4DTRA 1EP4A 3R8EA 2C1IA 3MECA 5J2PA 2OA8A 2ZJRL 4HCCA 4BVOA 1X9MA 4DV0K 4BGBA 2FLOA 2Q97A 4A2AA 3THYB 4YY3K 3HBTA 5AFUH 3G25A 1LWEA 3T69A 4PKHA 5EX5A 3M8QA 1GLBG 4CK2A 4H8KA 3CMAN 3CCLN 4JKAA 3K58A 4CJSA 3ALYA 2BTFA 3QEVA 4CJLA 1RT4A 1WSHA 3VQDA 4KH6A 3O3HA 2ASMA 4AHCA 4FJJA 3QFUA 1TK0A 5AQMA 4C1NI 4CJRA 5AQZA 4A57A 5BR8K 4CECA 2CGKA 1Z26A 4DSEA 3GOIA 1VQ4N 1Q9XA 2YNFA 2HW3A 1KLMA 4CEQA 4WF9L 3BF1A 4FPAA 4NCAA 4FLVA 4FJ8A 3LALA 2ETJA 4DG1A 2QXFA 1HMVA 3RMAA 5TKYA 4EHUA 3M8RA 3R1XA 4KTZA 1Q81O 1EETA 4FWNA 3A0IX 3FZLA 2DFHA 3MX5A 5HBMA 3IMXA 1S1WA 1HNXK 2P9UB 2E2PA 5F2RA 3CJ9A 4BDZA 5M1QA 3AVKA 4FWPA 4B9LA 1VSDA 1RGIA 3TSUA 2XRIA 3T1AA 3MAQA 4H0TB 2QM1A 5BPMA 4F9OA 2EX3A 5AQNA 4I6MB 3NF8A 2PFUA 3CC7N 4YDUA 4EFHA 4DSKA 4YOTA 3K9KA 4Z0UA 2W42A 4DV5K 2O4GA 4C8OA 3LDNA 2QKBA 3T7ZA 3D0PA 2Y1IA 2Q0RA 1QHTA 3E9LA 1ZBHA 4CHPA 5C42A 3WEEB 4N5SA 3EKSA 4DR2K 4FO0A 4PWDA 3ZSZA 4CVNE 1JLAA 3NGYA 2XHBA 1GOCA 5ELZA 3OYJA 4ZHRA 3SK3A 4HCBA 1K8KA 2GUIA 1ILYA 5M1FA 1K9MO 3E9OA 4O44A 4DQSA 1JCEA 4XH4A 2HNYA 4EP5A 4E1JA 4ILGB 2H3GX 2A5XA 3E66A 1YTUA 1CXQA 5AZIA 3OJSA 4LSLA 2ZGZA 1NLVA 2WBNA 4DV3K 2AJQA 3THXB 1RNHA 1GLJO 3HXMA 2ITMA 4IG0A 3WT0A 1QZ6A 3FGUA 3ENHA 4O0JA 1Z05A 5BRDA 3VERA 5DM6L 2KFZA 4CJVA 4FJMA 1KAXA 3CPEA 3IG1A 3K59A 5AQVA 1T3VA 3V6DA 4WQ4A
chains in the Genus database with same CATH topology
5KPZA 4BRGA 1XQSC 3CETA 3WXJA 4CZHA 3MX2A 1YAGA 2EWSA 3W0LA 4C23A 1NGEA 3MMVA 3A5NC 3C6AA 4XH5A 3CJCA 3GBTA 3L0QA 4CZIA 3CCSN 3C7NA 2P9LB 1JJ2M 2HBJA 4DB3A 3LM9A 3O9QA 4B1VA 3CMEN 1GLDG 4NLCA 1S72N 2HF4A 4MLEA 2OTJN 3HM8A 1X9JA 4XJXA 5JVHL 5FPMA 3VMFB 2D0PA 3MN7A 4ILHA 3K9JA 3UB5A 1CZAN 5AQLA 4IXCA 3CC4N 4JD2B 2KLAA 2FSKA 2V7ZA 2Q1NA 3C65A 3BF3A 2I7PA 3JS6A 1MA9B 3O6WA 2P9UA 3VEVA 3P4IA 2W00A 1NGJA 1BA0A 2NZTA 2YCHA 3I8BA 2ZJPL 5E26A 2HBMA 1YI2N 1WUAA 1U2VB 3WUHA 2PBDA 3VEWA 3QB0A 4JK8A 2AA4A 4H0VB 4O8KA 4I6MA 4XH1A 3RSEB 2NRXA 4BG9A 1HLUA 1KD1O 3CHWA 4DKWA 4H5TA 3KVGA 3MWPA 4O8UA 1KC8O 2A40A 2YJFA 4BR4A 4PKIA 3FZHA 4DQ8A 4CBUA 4FL9A 4BC5A 4BQLA 4BECA 4AM6A 1RFQA 2QWLA 3WEEA 3HOSA 1P8ZA 3EKUA 4FSVA 5LY3A 2NLXA 3QFPA 3ULEB 5AQOA 3KWIA 3SAGA 2FXUA 5AQKA 3VF2A 3M1FA 3U9ZA 3SAHA 2QEXN 4OPHA 1EQYA 5B8HA 5MLCQ 2FSNA 3ZEUB 1HJOA 3H6EA 2D4WA 1SAZA 2BUPA 2NRTA 3GL1A 3P31A 5TKWA 4H5WA 4WFBL 3DXMA 5FPEA 1M1KO 2PAVA 3CIPA 3R3LA 3IKMA 3SMPA 3G71N 1P90A 5CR4A 1QVFM 3OHRA 3WXKA 3FZFA 3ZETB 3BP8A 5AFUA 1VQKN 1KAZA 5C2FA 3CQXA 3D6RA 1VQ8N 2JWLA 4MDBA 1QQMA 1LCUA 4FWSA 2GELA 3DXKA 1QZ5A 3A5OC 1VQNN 1H1VA 5AQXA 2GWJA 4M63C 4K43A 4H0PA 3U8XA 4CI6A 3P38A 3WXLA 3NVMA 4JKBA 1S22A 3WXIA 4BR2A 3NVKA 1VQ6N 4FOEA 4M7YA 3LDPA 4YOYA 3QBXA 2WFBA 4JHDB 4JKGB 2QWOA 3AAPA 3LL3A 3TU5A 4U67L 2CGJA 5M1NA 1Q82O 3TTFA 4GNIA 1ZBSA 1RDUA 3H3OB 1BO5O 3EL2A 4A5BA 1NGFA 4FWMA 4GV9A 3KHYA 3R6MA 3VTIA 4WQ5A 2VWBA 5BRHA 1Z6RA 1YF5L 5GAHP 5BN9A 3FFKB 1T44A 4BG8A 3Q7CA 5AZJB 4UY8O 4JAXA 4CBXA 2GEMA 1NGHA 4BY9C 1R59O 2FF3B 4J8FA 2NNWA 4NLBA 4K41A 1DKGD 5C2DA 1XC3A 3C0BA 4EIAA 2NRRA 4IO9L 1BDGA 4JKEA 4PKGA 4CZGA 3MN6A 1YJNN 3OBYA 4A59A 1HPMA 5C0YA 1W2BM 1DEJA 4H5VA 4R79A 2F9TA 2YHXA 3MDQA 4WQ5C 2E1YA 1ATNA 3WXMB 3ZYYX 1YIJN 3DAWA 1NBWA 1J6ZA 2P9LA 3I55N 4JKFA 4ISFA 1VQPN 3O5BA 3F2KA 1SQKA 4K25A 3TTDA 1NGBA 4BVPA 2VGNA 4BRQA 4FVUA 2HMPA 2ZF5O 1MWKA 4NB4A 3RVCA 4BROA 3G6EN 4BRHA 5ADXH 4JKDA 4RCHA 4JD2A 1E4FT 1YVNA 3IUCA 4OPAA 1HKCA 2P9NB 2W40A 3R9PA 4H5NA 3VEZA 5AR0A 3M5RA 5GIPA 1WOQA 1U2VA 2J4RA 3F9MA 5AZIB 1JCGA 1QVGM 4Z94A 1HUXA 3SBTA 2FF6A 4WCEL 2IIRA 3D2EB 2QWMA 3L4IA 1NM1A 3FE1A 4WQ4C 1OKJA 3UKRB 4DCHA 4MDAA 2AP1A 4BEBA 5EY4A 3KZBA 4BRCA 1VQ7N 3J7ZO 4KH4A 3N4PA 4IOCL 4JN4A 4O5FA 3UKUB 1LOTB 2HF3A 3CCUN 2Q0UA 2P9SB 1DGKN 2F9WA 2WUSA 1VQON 4G9ZA 5CHIA 4BRDA 4BRAA 3AGRA 3VF4A 3ULEA 2I7NA 5BPNA 4YOUA 4BC3A 4KBOA 4PL7A 2DPNA 3CJ7A 2E1ZA 3CJAA 3VESA 3HTVA 3ZEUA 5AQJA 3H3NO 3U4LA 3O9RA 4YOWA 2P9PA 3MK6A 4K42A 2GUPA 5AQFA 3C6HA 4BC2A 3CXCM 5KPRA 3C7NB 3H46O 3KK7A 1U6ZA 3ZETA 1VQ5N 1BWFO 4IEIA 3HI0A 3ENOA 1TYQA 4B1UB 1GLFO 3VEYA 4RWTA 4IJNA 2ASPA 2YJEA 1YJWN 2QWNA 4FWKA 4WYBA 3CERA 4ISEA 4AM7A 4CZLA 2P9IB 5H1SQ 2NRHA 5C12A 3O9TA 5C10A 3M6GA 4QS8A 4BR5A 4FWRA 5AQWA 4JKGA 5AQIA 5AQRA 4B1XB 3L6QA 1KXPA 5EVZA 4YOVA 4IJAA 4XEIA 3P39A 2JWKA 2RE2A 3CCRN 2HOEA 4FWQA 5CE3A 2QWPA 2V7YA 2GX9A 3HZ6A 3LDLA 2Q31A 3L4QA 1YJ9N 3TPQA 5HOOA 1JCFA 4PL8A 2E20A 5BPLA 3CJ1A 3IFRA 5M1KA 1E4GT 5KQ8A 1K73O 1GLAG 4Y0WA 3O08A 5AZJA 2E2QA 3PIOL 3VOVA 3D2FB 4A2BA 4BRFA 4L3QA 3SAFA 1YXQA 4YORA 3VPZA 1VQ9N 4FWLA 1RDWX 3CPWM 3W3DA 4IOAL 3QBWA 5AQPA 1N8RO 3BUZB 2QI2A 3DJCA 3O1BA 5GADP 3ATUA 3Q7BA 3J8AA 2QTDA 5FPNA 5FPDA 3HRGA 3AAQA 1IJJA 3PIPL 2A42A 4JK9A 1YHQN 3ID6A 5BR9A 3DLLL 3VEXA 3N4QA 3O9SA 3S41A 4CZKA 3I56N 4IDHA 4BR0A 1ESVA 3WQTA 1BG3A 2E88A 1ATSA 3ATVA 4JKCA 4BQZA 1W97L 4OO1J 1OVYA 4H0XB 3VGKA 5EXWA 2D0OA 3OBWA 3OA9A 5LJVA 3LM2A 1SS6A 5KQDA 5JLFA 3JXUA 4WFNL 3AGKA 3CD6N 3DXKB 4BC4A 5AQGA 4AF1A 2CH6A 3LDOA 3E9PA 3MCAB 4GVEA 3CCEN 4CBWA 5M1PA 5GAGP 2NRZA 4RTFD 3TTCA 2ZJQL 1O13A 1HKBA 2P9NA 4BGAA 1X3MA 4IFEA 1MWMA 1K8AO 4CJ7A 2W41A 3CQYA 1K8KB 4CZFA 4FPBA 3A8YA 3HSCA 2ASOA 3IDHA 3GDQA 4JEPA 4BREA 5JLHA 3H1VX 1G99A 3VENA 3WQUA 4YOXA 1Q86O 3VEOA 3CI5A 4BR9A 2YHWA 1V4TA 2KHOA 3D2EA 4U7BA 4B1WB 5AQYA 3R8EA 2C1IA 2P9KB 3ZX3A 3MN9A 2WC9A 2ZJRL 3FR0A 4FWOA 4BVOA 3A5LC 5E84A 1NWKA 2E8AA 2QWRA 3TSPA 3UKUA 4BGBA 5HL7L 2Q2RA 3HOTA 2P9SA 2UYTA 2FLOA 2Q97A 4A2AA 3HBTA 5AFUH 3TSQA 3G25A 3MCPA 3VF6A 2GWKA 3CCMN 2VYPA 1C0GA 3FZMA 4PKHA 3T69A 4FOIA 3RSEA 5EX5A 3VGLA 4DHYA 2QXLA 2QW9A 4EHTA 1GLBG 4KH5A 3QDKA 4PHTX 1V4SA 4M7XA 3CMAN 3O4WA 3CCLN 4MLHA 5AQTA 1HKGA 4JKAA 4B9QA 4GV3A 3CJBA 1MDUB 3M3ZA 1KQSM 2Q36A 2A41A 2BTFA 3EN9A 1T6CA 1QQNA 4MO5A 4KH6A 3FLCO 3H45C 2D1KA 3MN5A 4B1ZA 2ASMA 4ISGA 5M1OA 4A61A 3MWTA 5BRFA 2QA4N 3QFUA 1GLLO 4H5RA 1C0FA 2NRVA 5AQMA 4C1NI 5AQZA 4A57A 2BH1A 2CGKA 3CCVN 2QWQA 3EO3A 4JNEA 2A6AA 3GOIA 4BE7B 4A5AA 1VQ4N 3O80A 2P9IA 3B8AX 4CZEA 3GG4A 3D7EO 1BU6O 1TUUA 1HX1A 3ENBA 5JVGL 4BR7A 2OTLN 4JK7A 4WF9L 3BF1A 4FPAA 3OW2M 2A3ZA 1NGCA 2HSTA 5EOYA 5F0XA 2C1GA 4IWVA 2ZWHA 3QICA 5LJWA 4BRKA 3F5TA 5TKYA 1NMDA 2HBLA 3QMLA 4EHUA 3R1XA 4LC9B 1Q81O 3EZWA 3VGMA 1ZXOA 1VQMN 3CC2N 4FWNA 3A0IX 2E2NA 3FZLA 1Q18A 1QHAA 3MX5A 3E1YA 5AQSA 3SLCA 1BA1A 3IMXA 3O9UA 2P9UB 2E2PA 5F2RA 3CJ9A 4CD1A 5DM7L 5M1QA 4FWPA 4ILJA 3D2FA 4JHDA 1RGIA 3ZX0A 5I9EB 3TSUA 4BRNA 4IO8A 2IVNA 4WFAL 3VETA 4H0TB 4IZ9A 1NJIO 2QM1A 5BPMA 5AQUA 4F9OA 5F1XA 5AQNA 4I6MB 3U9DA 3A5MC 2PFUA 3I33A 3CC7N 5ADXA 4YDUA 4EFHA 4YOTA 1GLCG 2YHYA 3K9KA 2CH5A 3UE5A 3O1WA 1D4XA 3LDNA 3T7ZA 3LDQA 4H0YB 3EE9A 2P9PB 5BREA 2Q0RA 3E9LA 1DT9A 1S3XA 4CZMA 3WEEB 3EKSA 3CCJN 1NGIA 2IVOA 4FO0A 2V52B 1TYQB 1ATRA 4H0OA 2YI1A 4NO7A 4C1NK 3GE1A 3NMUA 2F7TA 4YDUC 5ELZA 3CCQN 5BN8A 2ZGYA 3CF5L 4GY2B 2VCPA 3SK3A 4BRMA 5GIOA 3DXMB 1K8KA 4QS7A 5GAEP 3PLAA 4HWIA 5AQQA 3KWGA 4BRPA 1ILYA 5C15A 3ZX2A 2GTDA 1BOTO 2FSJA 1QQOA 1ZC6A 4EAHD 5M1FA 4CD3A 1K9MO 4CZJA 1BUPA 3E9OA 4QS9A 3SMSA 1Y64A 1JCEA 1YITN 1M90O 2P9KA 3AY9A 2E2OA 3SBGA 4XH4A 4HTLA 1KAYA 4B1YB 4E1JA 4ILGB 1TUYA 4GV6A 1NGGA 1T6DA 2H3GX 3EE8A 2A5XA 1IG8A 3AARA 3E66A 3FZKA 2IVPA 3SJHA 5AZIA 1NGAA 2ZGZA 1SZ2A 3VTHA 1NLVA 2OANA 2WBNA 2VGMA 5GINA 3O8MA 2HBKA 3DWLA 1NGDA 1GLJO 3UKRA 4BRLA 2NRWA 1YUWA 2RHKA 3H1QA 2ITMA 2KKZA 4IOXA 1X3NA 4A62A 4MO4A 3WT0A 1QZ6A 1VQLN 3ID8A 3FGUA 4H03B 3ENHA 3BEXA 2V51B 1Z05A 5JICA 2CGLA 4IEEA 3VERA 4BRIA 5BRDA 5DM6L 1Q7YO 2YX6A 5AQHA 5JMVA 1KAXA 1XUPO 1GLEG 1VAZA 4JKHA 3CPEA 5AQVA 1T3VA 5KPTA 3G4SN 1EO1A 4WQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KPZ A;  4BRG A;  1XQS C;  3CET A;  3WXJ A;  4CZH A;  1YAG A;  2EWS A;  3W0L A;  4C23 A;  1NGE A;  3MMV A;  3A5N C;  4XH5 A;  3CJC A;  3GBT A;  3L0Q A;  4CZI A;  3C7N A;  2P9L B;  4DB3 A;  3LM9 A;  4B1V A;  1GLD G;  2HF4 A;  4MLE A;  3HM8 A;  1X9J A;  5FPM A;  2D0P A;  3MN7 A;  3UB5 A;  1CZA N;  5AQL A;  4IXC A;  4JD2 B;  2V7Z A;  2FSK A;  2Q1N A;  3JS6 A;  3BF3 A;  2I7P A;  3O6W A;  1MA9 B;  2P9U A;  3VEV A;  3P4I A;  1NGJ A;  1BA0 A;  2NZT A;  2YCH A;  3I8B A;  5E26 A;  1WUA A;  1U2V B;  3WUH A;  2PBD A;  3VEW A;  3QB0 A;  2AA4 A;  4H0V B;  4O8K A;  4I6M A;  4XH1 A;  3RSE B;  4BG9 A;  1HLU A;  3CHW A;  4H5T A;  3KVG A;  2A40 A;  2YJF A;  4BR4 A;  4PKI A;  3FZH A;  4DQ8 A;  4CBU A;  4FL9 A;  4BC5 A;  4BQL A;  4AM6 A;  1RFQ A;  2QWL A;  3WEE A;  1P8Z A;  3EKU A;  4FSV A;  5LY3 A;  2NLX A;  3QFP A;  3ULE B;  5AQO A;  2FXU A;  5AQK A;  3VF2 A;  3M1F A;  3U9Z A;  5B8H A;  1EQY A;  2FSN A;  3ZEU B;  1HJO A;  3H6E A;  2D4W A;  1SAZ A;  2BUP A;  3GL1 A;  4H5W A;  3DXM A;  5FPE A;  2PAV A;  3CIP A;  3SMP A;  3OHR A;  3WXK A;  3FZF A;  3ZET B;  3BP8 A;  5AFU A;  1KAZ A;  3CQX A;  1QQM A;  1LCU A;  4FWS A;  3DXK A;  2GEL A;  1QZ5 A;  3A5O C;  1H1V A;  5AQX A;  2GWJ A;  4M63 C;  4K43 A;  4H0P A;  3U8X A;  4CI6 A;  3WXL A;  1S22 A;  3WXI A;  4BR2 A;  4FOE A;  4M7Y A;  3LDP A;  3QBX A;  4JHD B;  2QWO A;  3AAP A;  3LL3 A;  3TU5 A;  2CGJ A;  4GNI A;  1ZBS A;  3H3O B;  1BO5 O;  3EL2 A;  1NGF A;  4FWM A;  3KHY A;  3R6M A;  4WQ5 A;  2VWB A;  5BRH A;  1Z6R A;  5BN9 A;  3FFK B;  1T44 A;  4BG8 A;  5AZJ B;  4JAX A;  4CBX A;  2GEM A;  1NGH A;  1R59 O;  2FF3 B;  4J8F A;  4K41 A;  1DKG D;  1XC3 A;  3C0B A;  4EIA A;  1BDG A;  4PKG A;  4CZG A;  3MN6 A;  1HPM A;  1DEJ A;  4H5V A;  2F9T A;  2YHX A;  3MDQ A;  4WQ5 C;  2E1Y A;  1ATN A;  3DAW A;  1NBW A;  1J6Z A;  2P9L A;  4ISF A;  3O5B A;  4K25 A;  1SQK A;  1NGB A;  4BVP A;  4BRQ A;  2HMP A;  2ZF5 O;  1MWK A;  4NB4 A;  4BRO A;  4BRH A;  5ADX H;  4RCH A;  4JD2 A;  1E4F T;  1YVN A;  3IUC A;  1HKC A;  2P9N B;  2W40 A;  3R9P A;  4H5N A;  3VEZ A;  5AR0 A;  1WOQ A;  1U2V A;  2J4R A;  3F9M A;  5AZI B;  1JCG A;  4Z94 A;  1HUX A;  2FF6 A;  2IIR A;  3D2E B;  2QWM A;  3L4I A;  1NM1 A;  3FE1 A;  4WQ4 C;  1OKJ A;  3UKR B;  4DCH A;  2AP1 A;  5EY4 A;  3KZB A;  4BRC A;  4JN4 A;  4O5F A;  3UKU B;  1LOT B;  2HF3 A;  2Q0U A;  2P9S B;  1DGK N;  2F9W A;  2WUS A;  4BRD A;  4BRA A;  3VF4 A;  3ULE A;  2I7N A;  5BPN A;  4BC3 A;  4KBO A;  4PL7 A;  2DPN A;  3CJ7 A;  2E1Z A;  3CJA A;  3VES A;  3HTV A;  3ZEU A;  5AQJ A;  3H3N O;  3U4L A;  2P9P A;  3MK6 A;  4K42 A;  2GUP A;  5AQF A;  4BC2 A;  5KPR A;  3C7N B;  3H46 O;  3ZET A;  1U6Z A;  1BWF O;  3HI0 A;  3ENO A;  1TYQ A;  4B1U B;  1GLF O;  3VEY A;  4RWT A;  4IJN A;  2ASP A;  2YJE A;  2QWN A;  4FWK A;  4WYB A;  3CER A;  4ISE A;  4AM7 A;  4CZL A;  2P9I B;  2NRH A;  3M6G A;  4QS8 A;  4BR5 A;  4FWR A;  5AQW A;  5AQI A;  5AQR A;  4B1X B;  3L6Q A;  1KXP A;  5EVZ A;  4IJA A;  4XEI A;  2HOE A;  4FWQ A;  5CE3 A;  2V7Y A;  2QWP A;  3HZ6 A;  3LDL A;  2Q31 A;  3TPQ A;  1JCF A;  4PL8 A;  2E20 A;  5BPL A;  3CJ1 A;  3IFR A;  1E4G T;  5KQ8 A;  1GLA G;  4Y0W A;  3O08 A;  5AZJ A;  2E2Q A;  3VOV A;  3D2F B;  4A2B A;  4BRF A;  4L3Q A;  1YXQ A;  3VPZ A;  4FWL A;  1RDW X;  3W3D A;  3QBW A;  5AQP A;  3BUZ B;  3DJC A;  3O1B A;  3ATU A;  5FPN A;  3J8A A;  5FPD A;  3AAQ A;  1IJJ A;  2A42 A;  5BR9 A;  3VEX A;  4CZK A;  3S41 A;  4BR0 A;  1ESV A;  3WQT A;  1BG3 A;  2E88 A;  1ATS A;  3ATV A;  4BQZ A;  3VGK A;  4H0X B;  5EXW A;  2D0O A;  5LJV A;  3LM2 A;  5KQD A;  5JLF A;  3JXU A;  3DXK B;  4BC4 A;  5AQG A;  2CH6 A;  3LDO A;  4CBW A;  4RTF D;  1HKB A;  2P9N A;  4BGA A;  1X3M A;  1MWM A;  4CJ7 A;  2W41 A;  3CQY A;  1K8K B;  4CZF A;  4FPB A;  3A8Y A;  3HSC A;  2ASO A;  3IDH A;  3GDQ A;  4BRE A;  5JLH A;  3H1V X;  1G99 A;  3VEN A;  3WQU A;  3VEO A;  3CI5 A;  4BR9 A;  2YHW A;  1V4T A;  2KHO A;  3D2E A;  4B1W B;  5AQY A;  3R8E A;  2P9K B;  3ZX3 A;  3MN9 A;  3FR0 A;  4FWO A;  4BVO A;  3A5L C;  5E84 A;  1NWK A;  2E8A A;  2QWR A;  3UKU A;  4BGB A;  2Q2R A;  2P9S A;  2UYT A;  2FLO A;  2Q97 A;  4A2A A;  3HBT A;  5AFU H;  3G25 A;  3MCP A;  3VF6 A;  2GWK A;  2VYP A;  1C0G A;  3FZM A;  4PKH A;  3VGL A;  4FOI A;  3RSE A;  5EX5 A;  4DHY A;  4EHT A;  2QXL A;  2QW9 A;  1GLB G;  3QDK A;  1V4S A;  4M7X A;  3O4W A;  4MLH A;  5AQT A;  1HKG A;  4B9Q A;  3CJB A;  1MDU B;  3M3Z A;  2Q36 A;  2A41 A;  2BTF A;  3EN9 A;  1T6C A;  1QQN A;  4MO5 A;  3FLC O;  3H45 C;  2D1K A;  3MN5 A;  4B1Z A;  2ASM A;  4ISG A;  5BRF A;  4A61 A;  3QFU A;  1GLL O;  4H5R A;  1C0F A;  5AQM A;  5AQZ A;  2CGK A;  2QWQ A;  3EO3 A;  4JNE A;  2A6A A;  3GOI A;  3O80 A;  2P9I A;  3B8A X;  4CZE A;  3GG4 A;  3D7E O;  1BU6 O;  1TUU A;  1HX1 A;  4BR7 A;  3BF1 A;  4FPA A;  2A3Z A;  1NGC A;  5EOY A;  5F0X A;  4IWV A;  2ZWH A;  3QIC A;  5LJW A;  4BRK A;  5TKY A;  1NMD A;  3QML A;  4EHU A;  4LC9 B;  3EZW A;  3VGM A;  1ZXO A;  4FWN A;  3A0I X;  2E2N A;  3FZL A;  1Q18 A;  1QHA A;  5AQS A;  3SLC A;  1BA1 A;  3IMX A;  2P9U B;  2E2P A;  5F2R A;  3CJ9 A;  4CD1 A;  4FWP A;  3D2F A;  4JHD A;  1RGI A;  3ZX0 A;  5I9E B;  4BRN A;  4IO8 A;  2IVN A;  3VET A;  4H0T B;  4IZ9 A;  2QM1 A;  5BPM A;  5AQU A;  4F9O A;  5F1X A;  5AQN A;  4I6M B;  3U9D A;  3A5M C;  3I33 A;  5ADX A;  4YDU A;  4EFH A;  1GLC G;  2YHY A;  3UE5 A;  2CH5 A;  3O1W A;  1D4X A;  3LDN A;  3LDQ A;  4H0Y B;  2P9P B;  5BRE A;  2Q0R A;  1S3X A;  4CZM A;  3WEE B;  3EKS A;  1NGI A;  2IVO A;  4FO0 A;  2V52 B;  1TYQ B;  1ATR A;  4H0O A;  2YI1 A;  4NO7 A;  3GE1 A;  4YDU C;  5ELZ A;  5BN8 A;  2ZGY A;  4GY2 B;  2VCP A;  3SK3 A;  4BRM A;  3DXM B;  1K8K A;  4QS7 A;  4HWI A;  5AQQ A;  4BRP A;  3ZX2 A;  2GTD A;  1BOT O;  2FSJ A;  1QQO A;  1ZC6 A;  4EAH D;  4CD3 A;  4CZJ A;  1BUP A;  4QS9 A;  3SMS A;  1Y64 A;  1JCE A;  2P9K A;  3AY9 A;  2E2O A;  4XH4 A;  4HTL A;  1KAY A;  4B1Y B;  4E1J A;  1TUY A;  1NGG A;  1T6D A;  2H3G X;  2A5X A;  1IG8 A;  3AAR A;  3FZK A;  2IVP A;  3SJH A;  5AZI A;  1NGA A;  2ZGZ A;  1SZ2 A;  1NLV A;  2OAN A;  3O8M A;  3DWL A;  1NGD A;  1GLJ O;  3UKR A;  4BRL A;  1YUW A;  3H1Q A;  2ITM A;  1X3N A;  4A62 A;  4MO4 A;  3WT0 A;  1QZ6 A;  3ID8 A;  3FGU A;  4H03 B;  3ENH A;  3BEX A;  2V51 B;  1Z05 A;  5JIC A;  2CGL A;  5BRD A;  3VER A;  4BRI A;  5AQH A;  5JMV A;  1KAX A;  1XUP O;  1GLE G;  5AQV A;  5KPT A;  4WQ4 A; 
#chains in the Genus database with same CATH topology
 2O4I A;  1I39 A;  4KTQ A;  3CET A;  4TSX A;  3WXJ A;  3L2U A;  1NK4 A;  4X65 K;  1JLG A;  5HP1 A;  4CEO A;  3THW A;  1VRT A;  3OYF A;  3DRS A;  4K0K K;  1GLD G;  1S72 N;  4MLE A;  4OJR A;  5JVH L;  4CFB A;  2D0P A;  3UB5 A;  3K9J A;  3KD5 E;  5AQL A;  4B9S A;  1REV A;  2KLA A;  2V7Z A;  3V9S A;  3BF3 A;  1BIS A;  2ZM6 K;  1BA0 A;  3I8B A;  1YI2 N;  3WUH A;  1ZBF A;  2PBD A;  3D45 A;  1DTQ A;  4CES A;  4H0V B;  3TAN A;  2NRX A;  3OVN A;  1A5V A;  4PUO A;  3DLE A;  1OH6 A;  1WN7 A;  4N76 A;  4FCY A;  4PKI A;  1NJX A;  4CBU A;  1NNE A;  1EO1 A;  4CER A;  1NKC A;  2WTU A;  2QWL A;  1C6V A;  4CF0 A;  4BE0 A;  4FSV A;  3KWI A;  4CJU A;  1WSF A;  3M1F A;  1T8E A;  3KK3 A;  3MXM A;  4CHQ A;  4OLA A;  5B8H A;  1EQY A;  5MLC Q;  1TAQ A;  2D4W A;  4J2D A;  5TKW A;  3DXM A;  3CIP A;  3R3L A;  2HHX A;  4Z4I A;  3SUO A;  3OHR A;  3WXK A;  4JS5 A;  3OYI A;  5C2F A;  2HHQ A;  2Q3S A;  4DQP A;  3AVJ A;  3TAQ A;  2GEL A;  3U3G A;  4ID1 A;  1VQN N;  2GWJ A;  2D0C A;  3K0S A;  4CGD A;  1RTJ A;  5LMN K;  3QES A;  4CI6 A;  4JS4 A;  1N36 K;  1KCF A;  5I3U A;  4JKB A;  3LP3 A;  3WXI A;  5FRM A;  4LF5 K;  3QNN A;  1LW0 A;  2WFB A;  3B6P A;  1HNZ K;  4U67 L;  1Q82 O;  3TTF A;  1IKW A;  4JLH A;  1RDU A;  3H3O B;  3NAE A;  3O3G A;  4WQ5 A;  3PY8 A;  1VK0 A;  4DTP A;  2W6K A;  5BN9 A;  4BG8 A;  5AZJ B;  2O8F B;  2X6N A;  4JAX A;  2FBT A;  3OTO K;  2FF3 B;  4J8F A;  2B6A A;  4DU3 A;  5C2D A;  3J80 O;  3AVN A;  1LW2 A;  2NRR A;  5FDL A;  1J5O A;  4CZG A;  2HHT A;  1NG9 A;  3DLR A;  2ZE2 A;  3RMD A;  1ATN A;  1FKP A;  2P9L A;  4JKF A;  1SQK A;  1KTQ A;  1HYS A;  4CJK A;  2OPQ A;  1MWK A;  4NB4 A;  4BRO A;  5ADX H;  4JKD A;  3AVB A;  5J2M A;  3IUC A;  3V4I A;  2FBY A;  3T3F A;  4H5N A;  4RW4 A;  3M5R A;  1WOQ A;  1U2V A;  2E6M A;  1JCG A;  3KLI A;  3IS9 A;  4NYN A;  2YNH A;  2HHV A;  1XMQ K;  2QWM A;  4WQ4 C;  3UKR B;  4W5N A;  1XC9 A;  4MDA A;  3ISN C;  5HRR A;  2BDP A;  4BEB A;  4GKJ K;  4IOC L;  3QET A;  3UKU B;  1LOT B;  2HF3 A;  1KLN A;  2Q0U A;  1EX4 A;  1DGK N;  1B92 A;  2WUS A;  2R7Y A;  4DLG A;  1NMN A;  3AGR A;  3ULE A;  4QCL A;  3CJA A;  4CGI A;  1WBB A;  3DLB A;  3LP0 A;  1LWC A;  3O9R A;  4OX9 K;  1BIZ A;  3ZT0 A;  2P5O A;  1N5Y A;  3CXC M;  4E72 A;  5KPR A;  3ZET A;  5KRT A;  1CLQ A;  1UAX A;  4KHN A;  2G8U A;  1GLF O;  3VQ5 A;  2ASP A;  2YJE A;  1RIL A;  4CEB A;  3NCI A;  3V9W A;  2G8V A;  2P9I B;  3O9T A;  1HR0 K;  1NJZ A;  4BWM A;  1VSF A;  4FWR A;  3OY9 A;  3AVC A;  4JKG A;  5AQR A;  2B5J A;  4M41 A;  4YOV A;  2YKN A;  2RE2 A;  4B9M A;  2QWP A;  3HZ6 A;  1U45 A;  3PUF A;  1JCF A;  4PL8 A;  4I2Q A;  3IFR A;  3LDS A;  2WOM A;  2O8D A;  2UXC K;  3D2F B;  1L5U A;  2YHB A;  4M3X A;  1RDW X;  3ZSX A;  1TL1 A;  3DJC A;  3O1B A;  5GAD P;  5FPD A;  2QTD A;  3SNN A;  1OH5 A;  3DLL L;  4YNQ A;  4DV7 K;  4OVL A;  1BG3 A;  2E88 A;  4BQZ A;  3THV A;  4OO1 J;  3OBW A;  5LJV A;  1X1P A;  1FXX A;  5KGW A;  5HRN A;  1D8Y A;  5AQG A;  1JXB A;  3MCA B;  1S6P A;  4FJN A;  1LWF A;  5M1P A;  5GAG P;  4W5O A;  2NUB A;  4BGA A;  1HYV A;  1K8A O;  1IKY A;  3HSC A;  1XI1 A;  3H1V X;  1Q86 O;  2JGU A;  4BR9 A;  1V4T A;  3RMB A;  4U7B A;  5AQY A;  1NU0 A;  2PZS A;  2O8C A;  2P9K B;  1RDD A;  1NWK A;  2QWR A;  4CJ3 A;  3TSP A;  1RDB A;  5HL7 L;  4O5B A;  4KI6 A;  3LPT A;  4KFB A;  1C0G A;  3FZM A;  1SV5 A;  1ZBU A;  4E7K A;  4FJL A;  2QW9 A;  4PHT X;  3S9H A;  1V4S A;  1LAW A;  2E4L A;  3O4W A;  4GV3 A;  1S1V A;  3M3Z A;  2Q36 A;  4FZY A;  2A41 A;  2O8E A;  4E1N A;  1T6C A;  3H45 C;  2D1K A;  5M1O A;  5BRF A;  4A61 A;  2F4V K;  3KKR A;  1C0F A;  3P83 D;  1E3M A;  3QEW A;  3J7Y P;  2I5J A;  2OPP A;  3ZSW A;  5AJ3 K;  3AO5 A;  4F3O A;  2DFF A;  3O80 A;  4HUE A;  2OZM A;  3GG4 A;  3HVR A;  3D7E O;  1BU6 O;  1HX1 A;  2OTL N;  4BR7 A;  3PX0 A;  4CGG A;  2HST A;  3P5J A;  4LF8 K;  5F0X A;  3O4Q A;  4IWV A;  2D0B A;  3ZT1 A;  1NMD A;  5I42 A;  2G8F A;  5KRS A;  5KGX A;  1VQM N;  5AQS A;  3E1Y A;  3SLC A;  3O9U A;  5DM7 L;  3L2V A;  4ILJ A;  4JHD A;  3ZX0 A;  4Z4E A;  4BRN A;  3EZ5 A;  4CJP A;  1NJI O;  4IZ9 A;  1WSJ A;  5HRS A;  3OYK A;  3DYA A;  4BDP A;  1GLC G;  2F8T A;  3LWL A;  1WBD A;  3O1W A;  3LDQ A;  2EHG A;  2P9P B;  5BRE A;  1EWQ A;  2ZQB A;  1S3X A;  4ICL A;  3SPY A;  3CCJ N;  3DM2 A;  1TYQ B;  4NCB A;  3GE1 A;  3NMU A;  2Z1H A;  5IT9 O;  2OPS A;  4BRM A;  1S1U A;  1JLC A;  4B3T K;  4FJH A;  4BWJ A;  4QS7 A;  5GAE P;  2KQ2 A;  2D0A A;  1GOA A;  4CHZ A;  1VRU A;  5C15 A;  3ZX2 A;  2GTD A;  4LF9 K;  4KV8 A;  4KPY A;  2RKI A;  1IKX A;  1Y64 A;  1M90 O;  1YIT N;  3AY9 A;  3SBG A;  4HTL A;  1KAY A;  4B1Y B;  3SUQ A;  4RW6 A;  1TUY A;  2P5G A;  5J1E A;  3SJH A;  1C0M A;  3HL8 A;  5DMR A;  3THY A;  4AHU A;  3NH1 A;  5GIN A;  4FLT A;  2HBK A;  1Q9Y A;  3DWL A;  4B3R K;  1Y97 A;  3U6F A;  2NRW A;  2KKZ A;  4E1M A;  4OPK A;  4DMN A;  4KAZ A;  1IKV A;  2PYL A;  3ZT2 A;  4IEE A;  1X9W A;  2YX6 A;  4F4K A;  1XUP O;  2RPI A;  1TAU A;  1VSK A;  4BAC A;  5KPZ A;  4CZH A;  3MX2 A;  3LZI A;  1SKW A;  1QSL A;  3W0L A;  4C23 A;  1NGE A;  3C6A A;  3CJC A;  1BQN A;  3GBT A;  4CZI A;  3C7N A;  2HBJ A;  4DB3 A;  4X64 K;  4DSJ A;  4B1V A;  4NLC A;  4DTS A;  4FJK A;  4IG3 A;  4XJX A;  3RMC A;  5FPM A;  3MN7 A;  3CQ8 A;  3HST B;  4ILH A;  4DR5 K;  4EP4 A;  3C65 A;  4OKK A;  2IGI A;  3JS6 A;  3NFA A;  3O6W A;  5K14 A;  2P9U A;  4DR7 K;  4DS5 A;  3OYN A;  3EEQ A;  2W00 A;  4X62 K;  1NGJ A;  2NZT A;  2G8W A;  3BDP A;  5E26 A;  2HBM A;  4RG8 A;  2DFE A;  1WUA A;  4CJ4 A;  4M45 A;  2XY6 A;  1NOY A;  1JLF A;  2AA4 A;  4CHO A;  3B6O A;  4O8K A;  4I6M A;  5KTQ A;  1RBS A;  1BL3 A;  4H5T A;  4O8U A;  2YJF A;  1UWB A;  5LMU K;  4AM6 A;  3WEE A;  3HOS A;  2NLX A;  2Y1J A;  2XY7 A;  1IV0 A;  4I2P A;  3SAG A;  4AH9 A;  3U9Z A;  1UOC A;  3OS2 A;  3ZEU B;  3DRR A;  3VQP A;  1SAZ A;  3GL1 A;  4H5W A;  1M1K O;  5CR4 A;  1QVF M;  5AFU A;  3BP8 A;  3CQX A;  1VQ8 N;  1D9D A;  3DXK A;  1BGX T;  1QZ5 A;  4E0D A;  1H1V A;  5AQX A;  4DWI A;  4H0P A;  4M42 A;  1BCO A;  3P38 A;  1JLB A;  3NVM A;  4FK4 A;  1S22 A;  3NVK A;  4NXN K;  1VQ6 N;  4YOY A;  4FLY A;  4B9V A;  3FFI A;  2HMI A;  4FLZ A;  3LL3 A;  4DU4 A;  1WAJ A;  2CGJ A;  3KHY A;  3R6M A;  2HNZ A;  3VQA A;  3S5T A;  1TGO A;  5BRH A;  4XIU A;  4M3T A;  1S6Q A;  3H08 A;  1KFS A;  1N32 K;  3VQ7 A;  1R59 O;  4AHV A;  2NNW A;  4NLB A;  3C0B A;  4IO9 L;  4Z4F A;  2OPR A;  3MN6 A;  1KFD A;  1DEJ A;  4H5V A;  2YHX A;  3MDQ A;  4NCG A;  3WXM B;  3ZYY X;  4DSF A;  3PO4 A;  3DAW A;  2HHH K;  1DLO A;  4CGJ A;  1A5W A;  5FRO A;  4K25 A;  3TTD A;  4FM2 A;  1XHZ A;  2VGN A;  4OKJ A;  4FVU A;  1IBK K;  5EU7 A;  1TKX A;  4RCH A;  1E4F T;  3OYD A;  3MED A;  3ZCM A;  3R9P A;  1NK7 A;  4DFJ A;  2HHS A;  5AR0 A;  5AZI B;  3AVH A;  4WCE L;  3D2E B;  3HYF A;  2VQE K;  3L4I A;  1NM1 A;  3FE1 A;  2RF2 A;  3TAE A;  1RBV A;  2AP1 A;  3KZB A;  1RT3 A;  2FC0 A;  4BRC A;  4JN4 A;  1RT6 A;  4O5F A;  3CCU N;  2P9S B;  4G9Z A;  2F9W A;  4BRD A;  3VQC A;  4AHR A;  4BRA A;  4KBO A;  4PL7 A;  3VES A;  3HTV A;  3KK2 A;  4O0I A;  4W5Q A;  4FJI A;  3MK6 A;  5AQF A;  4BC2 A;  3THW B;  1VQ5 N;  3NH2 A;  3K2P A;  4JI5 K;  1BWF O;  4IEI A;  4AQY K;  2XY5 A;  1SKS A;  4LF6 K;  3HI0 A;  3J81 O;  4B1U B;  3ZSY A;  2HHW A;  2FBV A;  4IJN A;  1YJW N;  2QWN A;  4CHY A;  4FWK A;  4WYB A;  3CER A;  4ISE A;  1FJG K;  4PA1 A;  1ZYQ A;  5C10 A;  3M6G A;  4BR5 A;  2UUA K;  4HHT A;  1RBU A;  3WNE A;  1U48 A;  1KXP A;  5EVZ A;  4FJG A;  4XEI A;  3AVM A;  2JWK A;  3CCR N;  4FJ9 A;  3TPQ A;  3QIP A;  2E20 A;  1J53 A;  1GLA G;  2XY8 A;  3O08 A;  5AZJ A;  4DR4 K;  2O8F A;  4A2B A;  1S1X A;  3SAF A;  1NJY A;  1ASV A;  4FWL A;  3CPW M;  3LZJ A;  1KVA A;  5AQP A;  1N8R O;  3BUZ B;  2QI2 A;  1J5E K;  1EXQ A;  4DV2 K;  4M3Y A;  4JK9 A;  3ID6 A;  5BR9 A;  3AO3 A;  4IDH A;  1B9F A;  1JLE A;  1NK9 A;  1W97 L;  4RW8 A;  1OVY A;  3VGK A;  4GVM A;  1SS6 A;  5JLF A;  4WFN L;  4G1Q A;  3PX4 A;  5JS2 A;  2IDO A;  4OLB A;  3SI6 A;  3QO9 A;  1OVQ A;  3TTC A;  2ZJQ L;  1EKE A;  4IFE A;  1MWM A;  3CQY A;  4FPB A;  1X9S A;  3IDH A;  2ASO A;  4CGF A;  3C6U A;  3CI5 A;  2KHO A;  3ZX3 A;  2WC9 A;  3FR0 A;  5E84 A;  4KHP K;  2E8A A;  3UKU A;  1ZBL A;  5HRP A;  3O3F A;  3S3O A;  3MCP A;  3VF6 A;  2GWK A;  3CCM N;  4DS4 A;  4CFD A;  1B9D A;  4FOI A;  3RSE A;  3ZT4 A;  2JLE A;  3QDK A;  4MLH A;  1HKG A;  1MDU B;  2DTU A;  3SCX A;  1QQN A;  1WSG A;  3MN5 A;  3CFO A;  4B1Z A;  2Z1J A;  1JKH A;  4ISG A;  3MWT A;  5KI6 A;  2QA4 N;  3OYB A;  1IBL K;  3QEI A;  3OYC A;  4QAG A;  2RN2 A;  2IS3 A;  2NRV A;  1BI4 A;  3ZSV A;  1ITG A;  2BH1 A;  3ASM A;  2QWQ A;  3KK1 A;  3V9Z A;  4JNE A;  2A6A A;  4E19 A;  2P9I A;  1TL3 A;  4DQQ A;  1TUU A;  3L2Q A;  5JVG L;  1TKT A;  2PYJ A;  3AA3 A;  1RT7 A;  5EOY A;  4B9N A;  5J2N A;  4DF8 A;  1LV5 A;  2ZWH A;  3QIC A;  4H4M A;  4BRK A;  3F5T A;  3MXI A;  4KI4 A;  3PO5 A;  2HBL A;  3QML A;  1HNW K;  4LC9 B;  3PSF A;  3VGM A;  1ZXO A;  2E2N A;  1QHA A;  1BA1 A;  3D2F A;  4MFB A;  5CYM A;  4IO8 A;  2IVN A;  4WFA L;  3VET A;  3BZC A;  3NF6 A;  1TK8 A;  5F1X A;  4DSL A;  3U9D A;  2O8B B;  1LAV A;  4DUZ K;  3I33 A;  2F8S A;  5ADX A;  1C1B A;  4N41 A;  2YHY A;  3UE5 A;  1HQE A;  1QSY A;  3CYG A;  4DV4 K;  3RR7 A;  3AVI A;  2KW4 A;  3MXJ A;  1DT9 A;  4CZM A;  3TAF A;  1NGI A;  2IVO A;  4CF1 A;  5E41 A;  2YKM A;  4KO0 A;  1ATR A;  4H0O A;  2YI1 A;  4YHH K;  3CCQ N;  3HP9 A;  3DLK A;  1U04 A;  1BQM A;  2FBX A;  1ZBI A;  5AQQ A;  3KWG A;  1K6Y A;  4BRP A;  1VSJ A;  2FSJ A;  1QQO A;  4CD3 A;  4F3T A;  1BUP A;  4QS9 A;  1IO2 A;  2P9K A;  3SPZ A;  2E2O A;  4B08 A;  4GV6 A;  4CCH A;  3HJF A;  1T6D A;  3FZK A;  2IVP A;  2O8D B;  5LL6 Z;  4Z4H A;  2VGM A;  2GBZ A;  4OGE A;  1WLJ A;  4BRL A;  3AO4 A;  1NK5 A;  1YUW A;  2RHK A;  3H1Q A;  4C8L A;  1X3N A;  4A62 A;  4MO4 A;  4MQ3 A;  4DF4 A;  3HK2 A;  4E7I A;  3C6T A;  3J7A P;  2BAN A;  4KHY A;  4BRI A;  5JMV A;  1GLE G;  3CFP A;  1T05 A;  2OYQ A;  3G4S N;  3TAB A;  1FW6 A;  4CED A;  1WSE A;  1YAG A;  2EWS A;  3KJV A;  3HT3 A;  4JI4 K;  3VA0 A;  3CCS N;  4EZ9 A;  3LM9 A;  3O9Q A;  2HF4 A;  3HM8 A;  4LSN A;  1X9J A;  4FYD A;  4B9U A;  3KLG A;  4IXC A;  4JD2 B;  2FSK A;  2Q1N A;  3V9X A;  1MA9 B;  4FZX C;  1N33 K;  3V1O A;  3VEV A;  3VQQ A;  2ZJP L;  4KHW A;  3VEW A;  4AHS A;  3I8D A;  4BG9 A;  2OZS A;  3ZSO A;  4EZ6 A;  1HLU A;  3CHW A;  4DKW A;  4ZTF A;  3MWP A;  1KC8 O;  2A40 A;  2Z1I A;  4BR4 A;  2O8E B;  4DQ8 A;  4BC5 A;  4BQL A;  3VA3 A;  4AHT A;  4BEC A;  3V9U A;  1RFQ A;  1P8Z A;  3EKU A;  3RRH A;  3QFP A;  3RRG A;  5AQO A;  2E5L K;  1XMO K;  1HPZ A;  5HLF A;  2FXU A;  5AQK A;  1N6Q A;  4ELV A;  1QQC A;  1D5A A;  1WSI A;  3SAH A;  3T1Y K;  4V19 S;  3BZK A;  4OPH A;  4AIL C;  4LH5 A;  4Q0B A;  1S1T A;  1HJO A;  3V1R A;  3H6E A;  3ZT3 A;  4CK1 A;  4L8R B;  2BUP A;  3CFR A;  4WFB L;  4E7H A;  4DSI A;  3SUN A;  2PAV A;  3SMP A;  3IKM A;  1P90 A;  5JS1 A;  1KAZ A;  2IAJ A;  4MDB A;  1JL2 A;  3C94 A;  1LCU A;  3A5O C;  1HQU A;  1RCH A;  5C25 A;  3NF9 A;  4K43 A;  2A1R A;  3PSI A;  4CJ5 A;  4FM0 A;  5IWA K;  4DTO A;  4DLE A;  4CW7 B;  3LDP A;  3TWH A;  3QBX A;  3RTV A;  1Q8I A;  4JHD B;  4KRE A;  2QWO A;  3AAP A;  1RDA A;  1SKR A;  3TU5 A;  5M1N A;  1W9H A;  1BO5 O;  4A5B A;  1NGF A;  4FWM A;  4I7F A;  4GV9 A;  3VTI A;  3E01 A;  3KLE A;  1YT3 A;  4CGH A;  3S3M A;  2VWB A;  4IFV A;  1Z6R A;  2IC3 A;  3OYL A;  4FLW A;  1YF5 L;  5GAH P;  3OYG A;  2X6S A;  3Q7C A;  1SL1 A;  4DFK A;  4CBX A;  4BY9 C;  1NGH A;  4FW1 A;  3JYT A;  1CZB A;  3SUP A;  4Y1D A;  1J9A A;  4K41 A;  4EIA A;  1BDG A;  4JKE A;  2KZZ A;  1GOB A;  4CEA A;  1QS4 A;  2HVI A;  3ZSR A;  4DR1 K;  1HPM A;  1W2B M;  1DTT A;  4CHN A;  1J6Z A;  4ELT A;  3I55 N;  4ISF A;  3O5B A;  4KTW A;  4BVP A;  3EY1 A;  4BRQ A;  1L3U A;  1G15 A;  2HMP A;  3G6E N;  1C1C A;  5A2Q O;  1UA1 A;  3HO1 A;  2P9N B;  2W40 A;  3VEZ A;  2X74 A;  5GIP A;  3K5M A;  4DQR A;  3NF7 A;  3KLF A;  4DTX A;  1HRH A;  1FKO A;  2J4R A;  4W5T A;  1QVG M;  4Z94 A;  1HUX A;  3SBT A;  2FF6 A;  4CJT A;  1O1W A;  4DU1 A;  4OPJ A;  1IBM K;  3LWM A;  4FJX A;  3N4P A;  1S9E A;  1BIU A;  1VQO N;  5CHI A;  4LY7 A;  4E7L A;  2I7N A;  4YOU A;  3VQE A;  4FLX A;  2DPN A;  2P1J A;  4RW7 A;  2E1Z A;  4C8M A;  3ZEU A;  4KHU A;  3LAN A;  3H3N O;  4CJE A;  4LD0 A;  3U4L A;  1XNQ K;  4YOW A;  3KD1 E;  5CZ1 A;  4FM1 A;  2GUP A;  2VG5 A;  4UQG A;  3C6H A;  3C7N B;  3KK7 A;  1U6Z A;  3TI0 A;  3RWU A;  1VHX A;  3OYM A;  4FJ7 A;  4DUY K;  3SQ2 A;  2LSN A;  3CYM A;  3L8B A;  4AM7 A;  1VSM A;  4CZL A;  5FLX O;  4N56 A;  5C12 A;  5FRN A;  3CM5 A;  1NKE A;  5AQW A;  1XHX A;  4B1X B;  3LAK A;  1C0T A;  1WAF A;  4FWQ A;  4GMJ B;  2GX9 A;  5CE3 A;  4B3O A;  2Q31 A;  4KKO A;  1T03 A;  1YJ9 N;  4HVJ A;  2KTQ A;  3CJ1 A;  3SQ0 A;  1E4G T;  2D5R A;  5KQ8 A;  1CXU A;  1K73 O;  1FK9 A;  4Y0W A;  4Q5V A;  3PIO L;  2E2Q A;  3VOV A;  4BRF A;  4L3Q A;  2VG6 A;  4YOR A;  5CZ2 A;  4IDK A;  3KTQ A;  3THX A;  5FPN A;  3HRG A;  3PIP L;  3CM6 A;  1YHQ N;  4CIF A;  3VEX A;  3N4Q A;  3S41 A;  4JI2 K;  4CZK A;  4CK3 A;  3I56 N;  4BR0 A;  3NHG A;  1NOZ A;  1SL2 A;  1I94 K;  4GKK K;  2HB5 A;  3ATV A;  4JKC A;  3LM2 A;  5KQD A;  3MEE A;  3JXU A;  3HPO A;  4Z4C A;  2UUC K;  3CD6 N;  1BHL A;  3S3N A;  4I9Q A;  3DXK B;  4JRP A;  4GVE A;  4DFP A;  2E6L A;  3E9P A;  1L3T A;  3CCE N;  1SL0 A;  4DFM A;  1HKB A;  2PY5 A;  3OS1 A;  1X3M A;  1NK0 A;  2W41 A;  3WNF A;  1RBT A;  1K8K B;  5D3G A;  3A8Y A;  3VEN A;  5DK5 A;  3WQU A;  3L3U A;  2YHW A;  3D2E A;  3UIQ A;  5JEN A;  3VQ9 A;  4B1W B;  3KIO A;  3MN9 A;  4IFY A;  1TK5 A;  4FZZ A;  4KB1 A;  4FWO A;  2UU9 K;  3A5L C;  1S9G A;  1NKB A;  1U4B A;  2Q2R A;  3OYH A;  4CFC A;  3HOT A;  2P9S A;  2UYT A;  3JAM O;  3T19 A;  3K57 A;  3TSQ A;  4NYF A;  3IAY A;  2VYP A;  4ELU A;  3VGL A;  4DHY A;  4EHT A;  4NXM K;  5H1S Q;  4KHS A;  2QXL A;  4KH5 A;  4M7X A;  4BDY A;  5AQT A;  4B9Q A;  4DR3 K;  1NK8 A;  4LFB K;  3CJB A;  2KZM A;  4LFA K;  4M3W A;  2HND A;  1TVR A;  1KQS M;  4IBN A;  3EN9 A;  1I3A A;  3SYZ A;  4MO5 A;  2XO7 A;  3FLC O;  4JI0 K;  1GLL O;  4H5R A;  3I0R A;  3SV3 A;  4FJ5 A;  2BGG A;  4CF8 A;  3CCV N;  3EO3 A;  3TAP A;  3QNO A;  4BE7 B;  4A5A A;  3B8A X;  4CZE A;  4JI8 K;  3ENB A;  4CF2 A;  4JK7 A;  3HM9 A;  4CJW A;  3OW2 M;  1ASW A;  2A3Z A;  1NGC A;  2C1G A;  3QEP A;  5LJW A;  1N34 K;  3EZW A;  3CC2 N;  1Q18 A;  1HNV A;  4B3S K;  1YTA A;  4CD1 A;  3L2R A;  4RW9 A;  5I9E B;  4CEE A;  5CYQ A;  4GW6 A;  3ITH A;  5AQU A;  4M3R A;  3NH0 A;  3A5M C;  2ITG A;  3M8P A;  3SQ4 A;  2CH5 A;  2QKK A;  1D4X A;  2VWJ A;  1VSL A;  4H0Y B;  3EE9 A;  3TAR A;  3V1Q A;  3NDK A;  2V52 B;  4KHQ A;  4ZTJ A;  3I0S A;  4NO7 A;  4C1N K;  4KRF A;  2F7T A;  4YDU C;  4CF9 A;  5BN8 A;  2ZGY A;  3CF5 L;  4GY2 B;  2VCP A;  5GIO A;  3AV9 A;  3AVF A;  3DXM B;  4C8K A;  3PLA A;  4HWI A;  4M3Z A;  4IKF A;  1BOT O;  4EAH D;  1ZC6 A;  3DRP A;  4CZJ A;  3SMS A;  4B9T A;  1RTD A;  3ZSQ A;  4CJF A;  1NGG A;  3K5N A;  4B8A B;  3EE8 A;  1IG8 A;  3AAR A;  1TKZ A;  4O55 A;  3QIO A;  3VQB A;  1NGA A;  3VTH A;  1SZ2 A;  4B3M K;  2OAN A;  3F73 A;  1RTI A;  3A2F A;  1BCM A;  3O8M A;  1NGD A;  1W0H A;  3UKR A;  1NK6 A;  4IOX A;  4LH4 A;  4CEF A;  3SQ1 A;  1VQL N;  3QEX A;  3ID8 A;  4H03 B;  4DTJ A;  3BEX A;  4J2A A;  2V51 B;  5JIC A;  2CGL A;  1Q7Y O;  3T1H K;  5AQH A;  3AVA A;  1VAZ A;  4JKH A;  1KVB A;  4X66 K;  3DLG A;  5KPT A;  3LP1 A;  1WB9 A;  4CJQ A;  4BRG A;  1XQS C;  1HJR A;  3AA5 X;  3MMV A;  3A5N C;  4XH5 A;  3L0Q A;  3OJU A;  1OH8 A;  3VQ8 A;  4LF7 K;  4FK0 A;  2P9L B;  3L2W A;  1JJ2 M;  4CFA A;  4M3U A;  1JXE A;  3CME N;  5SZT A;  2OTJ N;  1S5J A;  2HHI A;  3VMF B;  4FXD A;  3VQ6 A;  1CZA N;  4BE1 A;  3CC4 N;  1VSE A;  2I7P A;  2YV0 X;  3P4I A;  2YCH A;  4CIE A;  3HP6 A;  1U2V B;  4J2B A;  2VQF K;  4FW2 A;  3QB0 A;  1WNS A;  4JK8 A;  4XH1 A;  4O4G A;  2O8B A;  3RSE B;  1MU2 A;  4H4O A;  3C95 A;  1KD1 O;  3RR8 A;  3L3V A;  2ATQ A;  3KVG A;  1TKD A;  2OCE A;  4DR6 K;  4JI3 K;  3FZH A;  3BY5 A;  3G0Z A;  4FL9 A;  4JI1 K;  3DOL A;  2VG7 A;  4DV1 K;  1D9F A;  5LY3 A;  2YHA A;  3ULE B;  1R0A A;  3EYZ A;  3LP2 A;  3VF2 A;  1BI4 B;  2QEX N;  4HUG A;  4E89 A;  4DTU A;  2FSN A;  3K5L A;  4F8R A;  4HUF A;  2HHU A;  5C24 A;  2G8K A;  3WNG A;  2NRT A;  3P31 A;  5FPE A;  5SWM A;  1VSH A;  3AA2 A;  3G71 N;  1EWR A;  4HTU A;  3AO2 A;  1VQK N;  3FZF A;  3ZET B;  4JYA K;  5HRO A;  3D6R A;  2JWL A;  4FK2 A;  1QQM A;  4FWS A;  2P51 A;  3DMJ A;  5CY4 A;  3P1G A;  4M63 C;  3U8X A;  3WXL A;  3OS0 A;  4BR2 A;  3NE6 A;  4FOE A;  4M7Y A;  1KSP A;  2X78 A;  4JV5 K;  4JKG B;  3MEG A;  1JLQ A;  4GNI A;  1ZBS A;  1TV6 A;  1L3S A;  3EL2 A;  3KKS A;  4CE9 A;  1XWL A;  1QSS A;  3FFK B;  1T44 A;  4UY8 O;  3F9K A;  2GEM A;  4CIG A;  1IH7 A;  1DKG D;  1XC3 A;  1U49 A;  1XNR K;  1HNI A;  4F2R A;  1ASU A;  3VN5 A;  1A5X A;  2YNG A;  4PKG A;  1YJN N;  4LFC K;  3OBY A;  4A59 A;  5C0Y A;  2HVH A;  4R79 A;  3PV8 A;  2F9T A;  4WQ5 C;  2E1Y A;  1YIJ N;  5T7B A;  1W7A A;  1NBW A;  1VQP N;  3IRX A;  3F2K A;  1NGB A;  1NJW A;  3TR8 A;  1F21 A;  3AA4 A;  2UXB K;  2ZF5 O;  3K5O A;  3HVT A;  3RVC A;  1JL1 A;  4BRH A;  4JD2 A;  1RT1 A;  1YVN A;  3LPU A;  4OPA A;  1VSI A;  2DY4 A;  1HKC A;  3VQ4 A;  1U47 A;  2QK9 A;  3QLH A;  3F9M A;  3QIN A;  4C8N A;  2IIR A;  1OKJ A;  4DCH A;  3PX6 A;  3DLH A;  2O8C B;  1RBR A;  5EY4 A;  4Z4G A;  2YNI A;  3AVG A;  4PY5 A;  1VQ7 N;  3J7Z O;  4KH4 A;  1Z25 A;  2G8I A;  3NGZ A;  1RT2 A;  3OYA A;  2UXD K;  3VF4 A;  4KB0 A;  5BPN A;  4BC3 A;  3U3Y A;  4QOZ B;  4CEZ A;  4ID5 A;  3CJ7 A;  3SV4 A;  3G10 A;  5AQJ A;  1UA0 A;  4B8C A;  4E7J A;  2A1S A;  4JRQ A;  2GV9 A;  2P9P A;  2G8H A;  3QER A;  4K42 A;  1J54 A;  3H46 O;  3KLH A;  3LAM A;  1RT5 A;  3NBP A;  3SJJ A;  3ENO A;  2WON A;  3SZ2 A;  1TYQ A;  1T7P A;  4PQU A;  4DTN A;  4RWT A;  2IOC A;  3VEY A;  4BE2 A;  1OH7 A;  4DV6 K;  3ZLJ A;  1L3V A;  1IG9 A;  4LF4 K;  4WE1 A;  4R5P A;  4F2S A;  3OYE A;  2NRH A;  3HPH A;  4QS8 A;  1KVC A;  4OKE A;  1KRP A;  1C0U A;  2BE2 A;  3TAM A;  5AQI A;  3L6Q A;  3BGR A;  4IJA A;  3CG7 A;  1C1A A;  3P39 A;  2HOE A;  2V7Y A;  3LDL A;  3L4Q A;  5HOO A;  3DI6 A;  4JI7 K;  4N47 A;  2B4J A;  5BPL A;  5M1K A;  1YVU A;  1VQ9 N;  4OGC A;  3VPZ A;  1YXQ A;  3AVL A;  4FVM A;  3W3D A;  4IOA L;  4I9L A;  4FLU A;  3QBW A;  3ULD A;  3O4N A;  2F96 A;  1QTM A;  3ATU A;  3Q7B A;  3J8A A;  4E3S A;  3AAQ A;  3WNH A;  3TAG A;  1IJJ A;  2A42 A;  4K8Z A;  3O9S A;  1SUQ A;  3NGI A;  1ESV A;  1RTH A;  3WQT A;  3JSM A;  1ATS A;  4DQI A;  4H0X B;  3M8S A;  5EXW A;  2D0O A;  2W6L A;  3OA9 A;  2Z1G A;  3AO1 A;  3V81 A;  3HPG A;  3AGK A;  2ZD1 A;  2UUB K;  1CZ9 A;  4BC4 A;  4AF1 A;  4DTM A;  1HYZ A;  2CH6 A;  3LDO A;  2KFN A;  1QE1 A;  4CBW A;  2NRZ A;  4JI6 K;  2VWK A;  4RTF D;  1O13 A;  2P9N A;  1RDC A;  5J2Q A;  4CJ7 A;  3DOK A;  4K8X A;  4CZF A;  4JEP A;  4BRE A;  3GDQ A;  5JLH A;  4YOX A;  1G99 A;  4Y1C A;  4J2E A;  4YFU A;  3VEO A;  4W5R A;  4DTR A;  1EP4 A;  3R8E A;  2C1I A;  3MEC A;  5J2P A;  2OA8 A;  2ZJR L;  4HCC A;  4BVO A;  1X9M A;  4DV0 K;  4BGB A;  2FLO A;  2Q97 A;  4A2A A;  3THY B;  4YY3 K;  3HBT A;  5AFU H;  3G25 A;  1LWE A;  3T69 A;  4PKH A;  5EX5 A;  3M8Q A;  1GLB G;  4CK2 A;  4H8K A;  3CMA N;  3CCL N;  4JKA A;  3K58 A;  4CJS A;  3ALY A;  2BTF A;  3QEV A;  4CJL A;  1RT4 A;  1WSH A;  3VQD A;  4KH6 A;  3O3H A;  2ASM A;  4AHC A;  4FJJ A;  3QFU A;  1TK0 A;  5AQM A;  4C1N I;  4CJR A;  5AQZ A;  4A57 A;  5BR8 K;  4CEC A;  2CGK A;  1Z26 A;  4DSE A;  3GOI A;  1VQ4 N;  1Q9X A;  2YNF A;  2HW3 A;  1KLM A;  4CEQ A;  4WF9 L;  3BF1 A;  4FPA A;  4NCA A;  4FLV A;  4FJ8 A;  3LAL A;  2ETJ A;  4DG1 A;  2QXF A;  1HMV A;  3RMA A;  5TKY A;  4EHU A;  3M8R A;  3R1X A;  4KTZ A;  1Q81 O;  1EET A;  4FWN A;  3A0I X;  3FZL A;  2DFH A;  3MX5 A;  5HBM A;  3IMX A;  1S1W A;  1HNX K;  2P9U B;  2E2P A;  5F2R A;  3CJ9 A;  4BDZ A;  5M1Q A;  3AVK A;  4FWP A;  4B9L A;  1VSD A;  1RGI A;  3TSU A;  2XRI A;  3T1A A;  3MAQ A;  4H0T B;  2QM1 A;  5BPM A;  4F9O A;  2EX3 A;  5AQN A;  4I6M B;  3NF8 A;  2PFU A;  3CC7 N;  4YDU A;  4EFH A;  4DSK A;  4YOT A;  3K9K A;  4Z0U A;  2W42 A;  4DV5 K;  2O4G A;  4C8O A;  3LDN A;  2QKB A;  3T7Z A;  3D0P A;  2Y1I A;  2Q0R A;  1QHT A;  3E9L A;  1ZBH A;  4CHP A;  5C42 A;  3WEE B;  4N5S A;  3EKS A;  4DR2 K;  4FO0 A;  4PWD A;  3ZSZ A;  4CVN E;  1JLA A;  3NGY A;  2XHB A;  1GOC A;  5ELZ A;  3OYJ A;  4ZHR A;  3SK3 A;  4HCB A;  1K8K A;  2GUI A;  1ILY A;  5M1F A;  1K9M O;  3E9O A;  4O44 A;  4DQS A;  1JCE A;  4XH4 A;  2HNY A;  4EP5 A;  4E1J A;  4ILG B;  2H3G X;  2A5X A;  3E66 A;  1YTU A;  1CXQ A;  5AZI A;  3OJS A;  4LSL A;  2ZGZ A;  1NLV A;  2WBN A;  4DV3 K;  2AJQ A;  3THX B;  1RNH A;  1GLJ O;  3HXM A;  2ITM A;  4IG0 A;  3WT0 A;  1QZ6 A;  3FGU A;  3ENH A;  4O0J A;  1Z05 A;  5BRD A;  3VER A;  5DM6 L;  2KFZ A;  4CJV A;  4FJM A;  1KAX A;  3CPE A;  3IG1 A;  3K59 A;  5AQV A;  1T3V A;  3V6D A;  4WQ4 A; 
#chains in the Genus database with same CATH homology
 5KPZ A;  4BRG A;  1XQS C;  3CET A;  3WXJ A;  4CZH A;  3MX2 A;  1YAG A;  2EWS A;  3W0L A;  4C23 A;  1NGE A;  3MMV A;  3A5N C;  3C6A A;  4XH5 A;  3CJC A;  3GBT A;  3L0Q A;  4CZI A;  3CCS N;  3C7N A;  2P9L B;  1JJ2 M;  2HBJ A;  4DB3 A;  3LM9 A;  3O9Q A;  4B1V A;  3CME N;  1GLD G;  4NLC A;  1S72 N;  2HF4 A;  4MLE A;  2OTJ N;  3HM8 A;  1X9J A;  4XJX A;  5JVH L;  5FPM A;  3VMF B;  2D0P A;  3MN7 A;  4ILH A;  3K9J A;  3UB5 A;  1CZA N;  5AQL A;  4IXC A;  3CC4 N;  4JD2 B;  2KLA A;  2FSK A;  2V7Z A;  2Q1N A;  3C65 A;  3BF3 A;  2I7P A;  3JS6 A;  1MA9 B;  3O6W A;  2P9U A;  3VEV A;  3P4I A;  2W00 A;  1NGJ A;  1BA0 A;  2NZT A;  2YCH A;  3I8B A;  2ZJP L;  5E26 A;  2HBM A;  1YI2 N;  1WUA A;  1U2V B;  3WUH A;  2PBD A;  3VEW A;  3QB0 A;  4JK8 A;  2AA4 A;  4H0V B;  4O8K A;  4I6M A;  4XH1 A;  3RSE B;  2NRX A;  4BG9 A;  1HLU A;  1KD1 O;  3CHW A;  4DKW A;  4H5T A;  3KVG A;  3MWP A;  4O8U A;  1KC8 O;  2A40 A;  2YJF A;  4BR4 A;  4PKI A;  3FZH A;  4DQ8 A;  4CBU A;  4FL9 A;  4BC5 A;  4BQL A;  4BEC A;  4AM6 A;  1RFQ A;  2QWL A;  3WEE A;  3HOS A;  1P8Z A;  3EKU A;  4FSV A;  5LY3 A;  2NLX A;  3QFP A;  3ULE B;  5AQO A;  3KWI A;  3SAG A;  2FXU A;  5AQK A;  3VF2 A;  3M1F A;  3U9Z A;  3SAH A;  2QEX N;  4OPH A;  1EQY A;  5B8H A;  5MLC Q;  2FSN A;  3ZEU B;  1HJO A;  3H6E A;  2D4W A;  1SAZ A;  2BUP A;  2NRT A;  3GL1 A;  3P31 A;  5TKW A;  4H5W A;  4WFB L;  3DXM A;  5FPE A;  1M1K O;  2PAV A;  3CIP A;  3R3L A;  3IKM A;  3SMP A;  3G71 N;  1P90 A;  5CR4 A;  1QVF M;  3OHR A;  3WXK A;  3FZF A;  3ZET B;  3BP8 A;  5AFU A;  1VQK N;  1KAZ A;  5C2F A;  3CQX A;  3D6R A;  1VQ8 N;  2JWL A;  4MDB A;  1QQM A;  1LCU A;  4FWS A;  2GEL A;  3DXK A;  1QZ5 A;  3A5O C;  1VQN N;  1H1V A;  5AQX A;  2GWJ A;  4M63 C;  4K43 A;  4H0P A;  3U8X A;  4CI6 A;  3P38 A;  3WXL A;  3NVM A;  4JKB A;  1S22 A;  3WXI A;  4BR2 A;  3NVK A;  1VQ6 N;  4FOE A;  4M7Y A;  3LDP A;  4YOY A;  3QBX A;  2WFB A;  4JHD B;  4JKG B;  2QWO A;  3AAP A;  3LL3 A;  3TU5 A;  4U67 L;  2CGJ A;  5M1N A;  1Q82 O;  3TTF A;  4GNI A;  1ZBS A;  1RDU A;  3H3O B;  1BO5 O;  3EL2 A;  4A5B A;  1NGF A;  4FWM A;  4GV9 A;  3KHY A;  3R6M A;  3VTI A;  4WQ5 A;  2VWB A;  5BRH A;  1Z6R A;  1YF5 L;  5GAH P;  5BN9 A;  3FFK B;  1T44 A;  4BG8 A;  3Q7C A;  5AZJ B;  4UY8 O;  4JAX A;  4CBX A;  2GEM A;  1NGH A;  4BY9 C;  1R59 O;  2FF3 B;  4J8F A;  2NNW A;  4NLB A;  4K41 A;  1DKG D;  5C2D A;  1XC3 A;  3C0B A;  4EIA A;  2NRR A;  4IO9 L;  1BDG A;  4JKE A;  4PKG A;  4CZG A;  3MN6 A;  1YJN N;  3OBY A;  4A59 A;  1HPM A;  5C0Y A;  1W2B M;  1DEJ A;  4H5V A;  4R79 A;  2F9T A;  2YHX A;  3MDQ A;  4WQ5 C;  2E1Y A;  1ATN A;  3WXM B;  3ZYY X;  1YIJ N;  3DAW A;  1NBW A;  1J6Z A;  2P9L A;  3I55 N;  4JKF A;  4ISF A;  1VQP N;  3O5B A;  3F2K A;  1SQK A;  4K25 A;  3TTD A;  1NGB A;  4BVP A;  2VGN A;  4BRQ A;  4FVU A;  2HMP A;  2ZF5 O;  1MWK A;  4NB4 A;  3RVC A;  4BRO A;  3G6E N;  4BRH A;  5ADX H;  4JKD A;  4RCH A;  4JD2 A;  1E4F T;  1YVN A;  3IUC A;  4OPA A;  1HKC A;  2P9N B;  2W40 A;  3R9P A;  4H5N A;  3VEZ A;  5AR0 A;  3M5R A;  5GIP A;  1WOQ A;  1U2V A;  2J4R A;  3F9M A;  5AZI B;  1JCG A;  1QVG M;  4Z94 A;  1HUX A;  3SBT A;  2FF6 A;  4WCE L;  2IIR A;  3D2E B;  2QWM A;  3L4I A;  1NM1 A;  3FE1 A;  4WQ4 C;  1OKJ A;  3UKR B;  4DCH A;  4MDA A;  2AP1 A;  4BEB A;  5EY4 A;  3KZB A;  4BRC A;  1VQ7 N;  3J7Z O;  4KH4 A;  3N4P A;  4IOC L;  4JN4 A;  4O5F A;  3UKU B;  1LOT B;  2HF3 A;  3CCU N;  2Q0U A;  2P9S B;  1DGK N;  2F9W A;  2WUS A;  1VQO N;  4G9Z A;  5CHI A;  4BRD A;  4BRA A;  3AGR A;  3VF4 A;  3ULE A;  2I7N A;  5BPN A;  4YOU A;  4BC3 A;  4KBO A;  4PL7 A;  2DPN A;  3CJ7 A;  2E1Z A;  3CJA A;  3VES A;  3HTV A;  3ZEU A;  5AQJ A;  3H3N O;  3U4L A;  3O9R A;  4YOW A;  2P9P A;  3MK6 A;  4K42 A;  2GUP A;  5AQF A;  3C6H A;  4BC2 A;  3CXC M;  5KPR A;  3C7N B;  3H46 O;  3KK7 A;  1U6Z A;  3ZET A;  1VQ5 N;  1BWF O;  4IEI A;  3HI0 A;  3ENO A;  1TYQ A;  4B1U B;  1GLF O;  3VEY A;  4RWT A;  4IJN A;  2ASP A;  2YJE A;  1YJW N;  2QWN A;  4FWK A;  4WYB A;  3CER A;  4ISE A;  4AM7 A;  4CZL A;  2P9I B;  5H1S Q;  2NRH A;  5C12 A;  3O9T A;  5C10 A;  3M6G A;  4QS8 A;  4BR5 A;  4FWR A;  5AQW A;  4JKG A;  5AQI A;  5AQR A;  4B1X B;  3L6Q A;  1KXP A;  5EVZ A;  4YOV A;  4IJA A;  4XEI A;  3P39 A;  2JWK A;  2RE2 A;  3CCR N;  2HOE A;  4FWQ A;  5CE3 A;  2QWP A;  2V7Y A;  2GX9 A;  3HZ6 A;  3LDL A;  2Q31 A;  3L4Q A;  1YJ9 N;  3TPQ A;  5HOO A;  1JCF A;  4PL8 A;  2E20 A;  5BPL A;  3CJ1 A;  3IFR A;  5M1K A;  1E4G T;  5KQ8 A;  1K73 O;  1GLA G;  4Y0W A;  3O08 A;  5AZJ A;  2E2Q A;  3PIO L;  3VOV A;  3D2F B;  4A2B A;  4BRF A;  4L3Q A;  3SAF A;  1YXQ A;  4YOR A;  3VPZ A;  1VQ9 N;  4FWL A;  1RDW X;  3CPW M;  3W3D A;  4IOA L;  3QBW A;  5AQP A;  1N8R O;  3BUZ B;  2QI2 A;  3DJC A;  3O1B A;  5GAD P;  3ATU A;  3Q7B A;  3J8A A;  2QTD A;  5FPN A;  5FPD A;  3HRG A;  3AAQ A;  1IJJ A;  3PIP L;  2A42 A;  4JK9 A;  1YHQ N;  3ID6 A;  5BR9 A;  3DLL L;  3VEX A;  3N4Q A;  3O9S A;  3S41 A;  4CZK A;  3I56 N;  4IDH A;  4BR0 A;  1ESV A;  3WQT A;  1BG3 A;  2E88 A;  1ATS A;  3ATV A;  4JKC A;  4BQZ A;  1W97 L;  4OO1 J;  1OVY A;  4H0X B;  3VGK A;  5EXW A;  2D0O A;  3OBW A;  3OA9 A;  5LJV A;  3LM2 A;  1SS6 A;  5KQD A;  5JLF A;  3JXU A;  4WFN L;  3AGK A;  3CD6 N;  3DXK B;  4BC4 A;  5AQG A;  4AF1 A;  2CH6 A;  3LDO A;  3E9P A;  3MCA B;  4GVE A;  3CCE N;  4CBW A;  5M1P A;  5GAG P;  2NRZ A;  4RTF D;  3TTC A;  2ZJQ L;  1O13 A;  1HKB A;  2P9N A;  4BGA A;  1X3M A;  4IFE A;  1MWM A;  1K8A O;  4CJ7 A;  2W41 A;  3CQY A;  1K8K B;  4CZF A;  4FPB A;  3A8Y A;  3HSC A;  2ASO A;  3IDH A;  3GDQ A;  4JEP A;  4BRE A;  5JLH A;  3H1V X;  1G99 A;  3VEN A;  3WQU A;  4YOX A;  1Q86 O;  3VEO A;  3CI5 A;  4BR9 A;  2YHW A;  1V4T A;  2KHO A;  3D2E A;  4U7B A;  4B1W B;  5AQY A;  3R8E A;  2C1I A;  2P9K B;  3ZX3 A;  3MN9 A;  2WC9 A;  2ZJR L;  3FR0 A;  4FWO A;  4BVO A;  3A5L C;  5E84 A;  1NWK A;  2E8A A;  2QWR A;  3TSP A;  3UKU A;  4BGB A;  5HL7 L;  2Q2R A;  3HOT A;  2P9S A;  2UYT A;  2FLO A;  2Q97 A;  4A2A A;  3HBT A;  5AFU H;  3TSQ A;  3G25 A;  3MCP A;  3VF6 A;  2GWK A;  3CCM N;  2VYP A;  1C0G A;  3FZM A;  4PKH A;  3T69 A;  4FOI A;  3RSE A;  5EX5 A;  3VGL A;  4DHY A;  2QXL A;  2QW9 A;  4EHT A;  1GLB G;  4KH5 A;  3QDK A;  4PHT X;  1V4S A;  4M7X A;  3CMA N;  3O4W A;  3CCL N;  4MLH A;  5AQT A;  1HKG A;  4JKA A;  4B9Q A;  4GV3 A;  3CJB A;  1MDU B;  3M3Z A;  1KQS M;  2Q36 A;  2A41 A;  2BTF A;  3EN9 A;  1T6C A;  1QQN A;  4MO5 A;  4KH6 A;  3FLC O;  3H45 C;  2D1K A;  3MN5 A;  4B1Z A;  2ASM A;  4ISG A;  5M1O A;  4A61 A;  3MWT A;  5BRF A;  2QA4 N;  3QFU A;  1GLL O;  4H5R A;  1C0F A;  2NRV A;  5AQM A;  4C1N I;  5AQZ A;  4A57 A;  2BH1 A;  2CGK A;  3CCV N;  2QWQ A;  3EO3 A;  4JNE A;  2A6A A;  3GOI A;  4BE7 B;  4A5A A;  1VQ4 N;  3O80 A;  2P9I A;  3B8A X;  4CZE A;  3GG4 A;  3D7E O;  1BU6 O;  1TUU A;  1HX1 A;  3ENB A;  5JVG L;  4BR7 A;  2OTL N;  4JK7 A;  4WF9 L;  3BF1 A;  4FPA A;  3OW2 M;  2A3Z A;  1NGC A;  2HST A;  5EOY A;  5F0X A;  2C1G A;  4IWV A;  2ZWH A;  3QIC A;  5LJW A;  4BRK A;  3F5T A;  5TKY A;  1NMD A;  2HBL A;  3QML A;  4EHU A;  3R1X A;  4LC9 B;  1Q81 O;  3EZW A;  3VGM A;  1ZXO A;  1VQM N;  3CC2 N;  4FWN A;  3A0I X;  2E2N A;  3FZL A;  1Q18 A;  1QHA A;  3MX5 A;  3E1Y A;  5AQS A;  3SLC A;  1BA1 A;  3IMX A;  3O9U A;  2P9U B;  2E2P A;  5F2R A;  3CJ9 A;  4CD1 A;  5DM7 L;  5M1Q A;  4FWP A;  4ILJ A;  3D2F A;  4JHD A;  1RGI A;  3ZX0 A;  5I9E B;  3TSU A;  4BRN A;  4IO8 A;  2IVN A;  4WFA L;  3VET A;  4H0T B;  4IZ9 A;  1NJI O;  2QM1 A;  5BPM A;  5AQU A;  4F9O A;  5F1X A;  5AQN A;  4I6M B;  3U9D A;  3A5M C;  2PFU A;  3I33 A;  3CC7 N;  5ADX A;  4YDU A;  4EFH A;  4YOT A;  1GLC G;  2YHY A;  3K9K A;  2CH5 A;  3UE5 A;  3O1W A;  1D4X A;  3LDN A;  3T7Z A;  3LDQ A;  4H0Y B;  3EE9 A;  2P9P B;  5BRE A;  2Q0R A;  3E9L A;  1DT9 A;  1S3X A;  4CZM A;  3WEE B;  3EKS A;  3CCJ N;  1NGI A;  2IVO A;  4FO0 A;  2V52 B;  1TYQ B;  1ATR A;  4H0O A;  2YI1 A;  4NO7 A;  4C1N K;  3GE1 A;  3NMU A;  2F7T A;  4YDU C;  5ELZ A;  3CCQ N;  5BN8 A;  2ZGY A;  3CF5 L;  4GY2 B;  2VCP A;  3SK3 A;  4BRM A;  5GIO A;  3DXM B;  1K8K A;  4QS7 A;  5GAE P;  3PLA A;  4HWI A;  5AQQ A;  3KWG A;  4BRP A;  1ILY A;  5C15 A;  3ZX2 A;  2GTD A;  1BOT O;  2FSJ A;  1QQO A;  1ZC6 A;  4EAH D;  5M1F A;  4CD3 A;  1K9M O;  4CZJ A;  1BUP A;  3E9O A;  4QS9 A;  3SMS A;  1Y64 A;  1JCE A;  1YIT N;  1M90 O;  2P9K A;  3AY9 A;  2E2O A;  3SBG A;  4XH4 A;  4HTL A;  1KAY A;  4B1Y B;  4E1J A;  4ILG B;  1TUY A;  4GV6 A;  1NGG A;  1T6D A;  2H3G X;  3EE8 A;  2A5X A;  1IG8 A;  3AAR A;  3E66 A;  3FZK A;  2IVP A;  3SJH A;  5AZI A;  1NGA A;  2ZGZ A;  1SZ2 A;  3VTH A;  1NLV A;  2OAN A;  2WBN A;  2VGM A;  5GIN A;  3O8M A;  2HBK A;  3DWL A;  1NGD A;  1GLJ O;  3UKR A;  4BRL A;  2NRW A;  1YUW A;  2RHK A;  3H1Q A;  2ITM A;  2KKZ A;  4IOX A;  1X3N A;  4A62 A;  4MO4 A;  3WT0 A;  1QZ6 A;  1VQL N;  3ID8 A;  3FGU A;  4H03 B;  3ENH A;  3BEX A;  2V51 B;  1Z05 A;  5JIC A;  2CGL A;  4IEE A;  3VER A;  4BRI A;  5BRD A;  5DM6 L;  1Q7Y O;  2YX6 A;  5AQH A;  5JMV A;  1KAX A;  1XUP O;  1GLE G;  1VAZ A;  4JKH A;  3CPE A;  5AQV A;  1T3V A;  5KPT A;  3G4S N;  1EO1 A;  4WQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...