2P9UA

Crystal structure of bovine arp2/3 complex co-crystallized with amp-pnp and calcium
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
414
structure length
398
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
total genus 129
structure length 398
sequence length 414
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 2p9uA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9uA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9uA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9uA04
1RDWX 3D2FB 5EX5A 3RSEA 3UKUA 4BQZA 3F9MA 3WEEB 3LDOA 1GLAG 3DXKA 1WOQA 5E84A 4CJ7A 3S41A 4FL9A 3DJCA 1YUWA 4PKHA 1GLLO 2QWRA 3KVGA 2P9IB 4FWOA 4BRPA 2YHYA 3O80A 4IJAA 4ISFA 1S3XA 1TUUA 3WXKA 3BEXA 4BC2A 1LCUA 3CIPA 1T6DA 4H5WA 4FPBA 3GG4A 2A6AA 4BRAA 4Z94A 2P9KB 3MN9A 2P9PB 3VF6A 3M6GA 1E4FT 4CZGA 3LM2A 3IDHA 2P9KA 2YI1A 2P9PA 5JICA 4M7YA 5AQSA 3VEVA 1KAXA 5KQDA 1G99A 1QHAA 3LDLA 3AY9A 4B1YB 3LDNA 3EN9A 2GTDA 4H0XB 4JNEA 1WUAA 2H3GX 4PL8A 4B1ZA 1S22A 1DEJA 5BREA 5AQXA 1KAYA 5ADXH 4RCHA 1T44A 1EQYA 3CJ1A 4FWSA 1ZC6A 3SJHA 2V7ZA 4BRLA 1XQSC 3A8YA 2D0PA 1R59O 4CD3A 5AQGA 3QFUA 3ULEA 2NLXA 2YJEA 3FLCO 1ATNA 4CZJA 4BRHA 4DB3A 4XEIA 2Q1NA 3ENHA 3VERA 2J4RA 2AP1A 1XC3A 3R6MA 3VF2A 4B1WB 4DCHA 1U6ZA 2FSKA 4IJNA 4H5TA 5F2RA 4PKGA 5AQVA 1GLFO 5AZJB 2E2NA 2A41A 4IZ9A 4H0YB 2P9UB 3GOIA 2DPNA 4EAHD 1X3NA 5AZJA 1ZBSA 1YVNA 2P9LB 4XH5A 3ATVA 3IUCA 1NBWA 3LDQA 3KHYA 1MDUB 2P9LA 3HM8A 2P9NA 2FSNA 4JD2B 2QWMA 3P4IA 4BRQA 5BPMA 1QQNA 3ZEUB 3MMVA 5BN9A 1MWKA 3H6EA 3HSCA 3DXMB 1BO5O 4F9OA 1KXPA 1HPMA 2EWSA 5EVZA 5JLHA 2FXUA 3O8MA 4JAXA 3UB5A 5F1XA 1BA1A 4EHTA 2I7PA 3EKUA 3CJBA 4O5FA 4BC4A 3VETA 1Y64A 4B1XB 5BRHA 4L3QA 4KBOA 3R9PA 3VEWA 5AQYA 3ZX2A 1HJOA 4CZKA 2GUPA 5AQWA 3O5BA 4H03B 2V51B 1V4SA 3U8XA 4FOEA 3D2EB 4YDUA 4H5NA 2QWLA 4CZMA 2E88A 3CETA 1SAZA 2FF6A 4BRCA 2F9WA 4RWTA 1HKBA 3SLCA 2CGJA 2Q0RA 4ISEA 4BGAA 5FPMA 2PAVA 4FPAA 1HLUA 4QS7A 3C0BA 1BDGA 2Q0UA 3SMSA 1NMDA 3D2FA 4XH1A 4J8FA 3FZFA 3WEEA 3CJCA 3OHRA 3SMPA 3BP8A 2HF3A 1GLEG 2NZTA 3TU5A 4FWRA 1RFQA 2P9IA 4E1JA 2GWKA 4CBXA 4QS8A 4BREA 4BR2A 3U4LA 1NGBA 4K43A 4MO5A 1GLBG 2IVNA 4PL7A 1IJJA 1GLCG 2E2QA 3HZ6A 4WQ4C 3O6WA 1NGIA 1NGDA 3FZLA 3MN6A 3CJAA 1K8KB 5AQHA 1BUPA 5ELZA 4GY2B 3UE5A 5FPDA 3H1QA 4FOIA 5BN8A 2FF3B 3H46O 3O1BA 3WXIA 4K25A 3EZWA 3KZBA 5AZIB 1NGAA 1GLDG 5AR0A 3WT0A 1QQMA 4JHDB 3WXJA 4BR5A 4H0OA 5AZIA 2P9SB 1NGGA 3BF1A 4JHDA 5CE3A 5AQOA 5AQJA 5EOYA 2P9SA 3B8AX 3C7NB 3ZETB 4MLHA 2A40A 4BR7A 1YXQA 2BUPA 3C7NA 1D4XA 1TYQB 2FSJA 4FSVA 3MN5A 1ATSA 4H0VB 3JXUA 3GL1A 4B1VA 4BG8A 4AM7A 4LC9B 1E4GT 3IMXA 1QZ6A 3EKSA 3O1WA 2CH5A 3H3OB 2A5XA 4WYBA 3VGLA 3FR0A 1BA0A 3HBTA 3H45C 4B9QA 2P9UA 1X3MA 2YJFA 5E26A 4CD1A 1Z6RA 3ID8A 5AQZA 2W41A 1BG3A 4FWLA 4BVOA 4CZHA 1H1VA 3AAPA 4BROA 5FPNA 2FLOA 1NGCA 4JD2A 1XUPO 3JS6A 4Y0WA 3VEOA 4PKIA 3G25A 3LL3A 4IWVA 2V7YA 3ZEUA 1Z05A 5BRFA 3DAWA 3U9ZA 3FFKB 2Q36A 3DXMA 5TKYA 2E20A 2PBDA 1HKCA 1NGJA 5I9EB 3VESA 3VEYA 4EFHA 2KHOA 2OANA 1RGIA 3SK3A 4QS9A 4CZLA 5LY3A 3I8BA 1MA9B 5JLFA 2QWQA 1OKJA 2VCPA 4IXCA 4M63C 3VOVA 4CZFA 4M7XA 5BR9A 3A5OC 3MK6A 2GELA 3VPZA 3J8AA 1HX1A 4HTLA 4K42A 3WUHA 5EY4A 3A0IX 4RTFD 3O08A 4GNIA 4A62A 4AM6A 3UKRB 3D2EA 5BPLA 2D0OA 1X9JA 2QXLA 3VGKA 1SZ2A 3L0QA 5AQUA 1DKGD 2GEMA 3CI5A 3L6QA 3CERA 1HKGA 3VGMA 3FE1A 4MLEA 5AQKA 4IO8A 3VEXA 2D4WA 2E2OA 3A5MC 3M1FA 3GE1A 2BTFA 3D7EO 5LJVA 5KPZA 2NRHA 3GBTA 3EO3A 5KPTA 4O8KA 2AA4A 2HOEA 5AFUA 4XH4A 4NB4A 2UYTA 2CH6A 3A5LC 5AQLA 1V4TA 4CI6A 2IVOA 3WXLA 3DXKB 4FWMA 1IG8A 2ASOA 3QBXA 3L4IA 1ZXOA 4BQLA 3FZHA 4K41A 2HF4A 3I33A 4DHYA 1NWKA 2QM1A 4BC5A 2QW9A 4BRMA 2Q2RA 2W40A 4CBUA 3QMLA 2E1ZA 2ITMA 3EL2A 2HMPA 3QDKA 1ESVA 2Q31A 1K8KA 1BOTO 1CZAN 5BPNA 5KQ8A 4H0TB 1C0FA 4ISGA 2E8AA 3FZMA 3QICA 1BU6O 2V52B 3HTVA 3TPQA 2VWBA 2YHXA 4FWKA 4C23A 5EXWA 4BRFA 3LM9A 4BC3A 1GLJO 3HI0A 3WQUA 3LDPA 4H5RA 2Q97A 4EHUA 3R8EA 4DQ8A 3CHWA 1LOTB 1T6CA 3ZETA 5AQQA 2WUSA 3VEZA 1C0GA 3W0LA 3AAQA 5AQFA 3MDQA 4BRDA 1TYQA 4A2BA 4BRKA 4FO0A 3ZX3A 3VENA 4BR0A 5ADXA 4WQ4A 1J6ZA 3AARA 4CZIA 3ULEB 5AQPA 3MCPA 4BGBA 4HWIA 5KPRA 3CQYA 1QZ5A 4BR9A 1P8ZA 2ZWHA 2E2PA 1MWMA 4BRNA 1NGEA 4WQ5C 3QB0A 3BF3A 2ASMA 1Q18A 2VYPA 1NGFA 4FWNA 4CBWA 5LJWA 1QQOA 3H3NO 3GDQA 3VF4A 3CJ7A 4JN4A 3WQTA 1JCGA 2YHWA 2GWJA 3ENOA 2CGLA 2I7NA 4YDUC 2ZF5O 3M3ZA 2QWOA 2P9NB 4CZEA 1NGHA 2IIRA 5BRDA 2QWPA 1DGKN 4FWPA 5AQIA 5B8HA 4BRIA 1NLVA 2A3ZA 3DWLA 3IFRA 2CGKA 3CQXA 3H1VX 4A2AA 4BG9A 2ZGYA 1NM1A 4H0PA 1KAZA 2E1YA 4I6MB 4BRGA 4I6MA 4BVPA 1U2VB 4A61A 2QWNA 2D1KA 3U9DA 4H5VA 5AQTA 1U2VA 5AQNA 4WQ5A 5AQRA 5AQMA 1SQKA 4NO7A 3A5NC 3UKRA 3W3DA 3MN7A 2ZGZA 3FZKA 3CJ9A 3O4WA 3ZX0A 5F0XA 5FPEA 1HUXA 2A42A 2YCHA 4BR4A 3FGUA 1YAGA 2IVPA 1BWFO 1ATRA 5JMVA 3QBWA 4MO4A 2ASPA 3BUZB 5AFUH 3ATUA 1TUYA 4EIAA 4FWQA 1JCFA 3RSEB 4B1UB 3UKUB 3QFPA 1JCEA 2F9TA
chains in the Genus database with same CATH superfamily
3C65A 3F9MA 1YIJN 1YTAA 3CCRN 3MWPA 4FL9A 4PKHA 4ELVA 3DLEA 3THWB 4FWOA 2YHYA 4IJAA 2AJQA 1WSHA 4XIUA 3LDSA 1VQ5N 2KZZA 1HQUA 5C10A 4JKDA 4NXMK 3BEXA 4BC2A 2WC9A 1YJWN 3OYLA 1N33K 4FVMA 4DR2K 4FLTA 3SZ2A 4B3TK 2OPSA 3GG4A 4BRAA 2P9KB 3CFRA 3VF6A 1YHQN 4DS4A 2Z1GA 3HRGA 3LM2A 3VTHA 2P9KA 2YI1A 4M7YA 3ZT4A 3OYNA 3OJUA 1TKZA 1KAXA 5KQDA 1G99A 3RWUA 2OZSA 4B3OA 5SZTA 2GTDA 3QLHA 4KHUA 5BREA 1Q82O 2DFFA 1YT3A 1C0UA 1EQYA 3K5OA 1ZC6A 1SS6A 3SCXA 3A8YA 2D0PA 2C1GA 3QINA 3F5TA 5AQGA 1KSPA 2HNDA 1D9DA 3VN5A 4CZJA 4GW6A 4DB3A 3SNNA 3VERA 2J4RA 2AP1A 4B1WB 3R6MA 1C1BA 1VSFA 4DCHA 1Q81O 3CCUN 4DV0K 4IJNA 2ZD1A 5F2RA 3IS9A 3CXCM 1C1AA 3VQAA 5AZJB 4FW1A 2HHHK 4H0YB 3TAMA 3GOIA 4B9LA 4CF9A 5AZJA 2FBTA 3Q7CA 1HNVA 1ZBSA 4DR6K 4XH5A 3KLIA 3IUCA 1NBWA 3LDQA 4HHTA 4DTOA 3AGKA 1QVGM 1A5VA 4KH4A 1NMNA 4JD2B 1N36K 1IBLK 5BPMA 4JV5K 3D6RA 4F9OA 2O8EB 2EWSA 3KK7A 4DR3K 1X9SA 2Z1HA 4CF0A 3RMAA 3J7ZO 2FXUA 3O8MA 3VA3A 3TANA 1RTJA 3CM5A 3UB5A 4WCEL 1U49A 2I7PA 3EKUA 3NF8A 1HMVA 1J53A 4BC4A 2E6MA 4B1XB 1XMQK 3L2WA 4L3QA 1Q86O 4Z4IA 3S3NA 1TL3A 4HUEA 4CZKA 4DV2K 2GUPA 1NK0A 2PYLA 1VQNN 1HRHA 4DTRA 5M1QA 1EWQA 3TWHA 3EE8A 3OYJA 3CETA 1VSLA 2F9WA 4NLCA 2PFUA 3O3HA 2CGJA 2Q0RA 4ISEA 5FPMA 3AVAA 4G9ZA 4FPAA 1SKWA 1BI4B 1ASVA 1A5WA 4HCBA 4K8ZA 3KTQA 3T19A 3HXMA 1BI4A 3TSQA 4XH1A 5J1EA 3FZFA 3LP0A 3WEEA 1IKVA 3OHRA 1XNQK 3G71N 4KH6A 4GV9A 5C25A 2NZTA 4O4GA 3TU5A 1WBDA 4FWRA 5D3GA 2GWKA 3M5RA 1W97L 1NGBA 3QEXA 3SQ0A 4CIEA 5HRNA 3CC4N 3PO5A 3ISNC 1NJYA 4FZXC 4I2QA 4GKJK 2GBZA 3DRPA 1TGOA 3QEWA 4B9NA 1JKHA 4F3TA 3T1AA 3THYB 4B9SA 3HPGA 1O13A 1K8KB 5AQHA 3OYMA 1BUPA 5MLCQ 5BN8A 4K0KK 2FF3B 3H46O 3WXIA 1NGAA 5AR0A 4DV6K 4M3YA 3DM2A 4U67L 3WT0A 3CMEN 1EWRA 1RILA 3SQ1A 2BANA 4X62K 3BF1A 2ETJA 3TR8A 1VRTA 3AGRA 5EOYA 3C7NB 4C1NI 4DFJA 3E66A 3K5MA 3VQ8A 1LW2A 2BUPA 3DI6A 3C7NA 4CJ3A 1HPZA 4FSVA 4H0VB 1ATSA 2UXDK 3DYAA 3HPHA 2YX6A 3O1WA 2QKKA 4DSEA 3AVFA 1FK9A 3J81O 3H3OB 2A5XA 3OYKA 3H45C 4B9QA 1VQPN 1U04A 1RDBA 1SL0A 2YJFA 2UUAK 3ZSWA 4FXDA 2Y1JA 4FWLA 3DLGA 4BVOA 4CZHA 1SL1A 1H1VA 3M8PA 5FROA 4JS5A 2FLOA 4EP5A 1B9FA 3ZSYA 5BRFA 1SL2A 3ZSZA 2Q36A 2E20A 5HLFA 5I9EB 1L3UA 2KZMA 3PO4A 1RGIA 3ID6A 3SK3A 4QS9A 4OO1J 2QA4N 5LY3A 4B08A 5GINA 3OJSA 1CXUA 4CJKA 4M7XA 2G8KA 2KQ2A 3THXA 4C8KA 3VQPA 1VRUA 3VPZA 4C8OA 2LSNA 2XRIA 1HX1A 4HTLA 4K42A 4LH4A 3CCJN 3A0IX 4RTFD 3O08A 1JLBA 4AM6A 1CZBA 1TKTA 1T3VA 3D2EA 4CGDA 5BPLA 1X9JA 2QXLA 1KFSA 1SZ2A 5AQUA 3VQ4A 5KRTA 1DKGD 3FE1A 2R7YA 3D45A 4JK7A 4R5PA 1QTMA 1WSFA 3A5MC 2BTFA 3BZKA 4AHTA 4NYNA 3LP1A 1ILYA 2GX9A 2UYTA 3J7YP 3A5LC 4CI6A 4FYDA 3DXKB 2FBVA 4AHVA 4IOCL 3LAKA 4YNQA 4LF6K 2ASOA 3OY9A 1BQNA 4K41A 3SV3A 3NAEA 4DTSA 4BC5A 1RTDA 3G0ZA 1WSEA 4CJTA 2QW9A 4X66K 4DSFA 4DMNA 2W6KA 3QMLA 2BGGA 1ITGA 1ESVA 2VQFK 4I9LA 1J9AA 1HNZK 3OYAA 1HYVA 1YF5L 2YHXA 4FJ9A 4OJRA 1ASWA 5EXWA 3HI0A 3ZSOA 4IDHA 4WFAL 3OVNA 4H5RA 2KFZA 2Q97A 2IC3A 4TSXA 3LANA 5C2DA 4DQ8A 3CHWA 1S1XA 4DUZK 4CFDA 3MEDA 3ZETA 4NYFA 2WTUA 2HHWA 5HBMA 2BH1A 3V1QA 2E5LK 1ZBIA 3WNEA 1LAVA 1VQKN 4V19S 3F2KA 4BRKA 4H4OA 5H1SQ 3VENA 3CFPA 4KI4A 4QAGA 4UY8O 4CGIA 3DLKA 4BR9A 1QZ5A 1VSKA 5M1FA 3PIPL 2QXFA 3KLFA 3OBYA 4IDKA 3NFAA 3C6UA 3VQEA 5M1NA 2ASMA 4YOYA 1EX4A 2RN2A 5LJWA 4JYAK 1KRPA 1CXQA 4A57A 3GDQA 1VAZA 3VF4A 2OA8A 3KLHA 1QSSA 1IKWA 2CGLA 4DF8A 4JKCA 4N56A 3M3ZA 4BDPA 1TKXA 5BRDA 4Z4HA 1OH7A 4RW6A 4JI2K 3LZIA 3C6TA 3MEGA 4CEZA 2CGKA 1NKCA 3CQXA 1OVYA 1S1VA 3H1VX 3WNHA 1NM1A 4I6MB 1KCFA 2QK9A 4KTZA 2OZMA 4I6MA 2D1KA 4E72A 3DLBA 5AQRA 5AQNA 4WQ5A 5AQMA 4OPJA 4NO7A 3A5NC 4FLZA 4QCLA 3UKRA 3W3DA 2F7TA 4E1MA 5HRRA 1QVFM 3I56N 4M41A 2IOCA 2A42A 4BR4A 3KK2A 1RT6A 4O8UA 2Y1IA 3S3OA 4CK1A 5CZ2A 5JMVA 3QBWA 4Y1DA 4MO4A 4Z0UA 3NHGA 3BUZB 4AHRA 3JYTA 1KD1O 4W5NA 1REVA 1TUYA 4FWQA 4B1UB 1JCEA 3KK3A 3J80O 5FRNA 2F9TA 1RDWX 4FLYA 2IAJA 3A2FA 3D2FB 4JLHA 5EX5A 2WONA 5E84A 1N32K 1VQ8N 3DJCA 5KRSA 1ASUA 1GLLO 3LZJA 3HPOA 4BRPA 3O80A 1TK0A 3VQQA 4ISFA 1S3XA 1TUUA 2I5JA 1NK5A 3CIPA 3RRHA 1XHXA 2KFNA 2OTJN 4Z94A 3NGZA 2EHGA 1RBVA 1QHAA 2G8VA 2WBNA 4NCBA 3LP3A 1RBRA 2YHBA 2UU9K 3SQ2A 1ZBLA 3EN9A 3BDPA 4PL8A 2RE2A 1S22A 3SAFA 5HOOA 4FM0A 3KD1E 1KAYA 4JI1K 5ADXH 4RCHA 1LV5A 1NJZA 3RR8A 4FWSA 2G8IA 3SJHA 4HVJA 4BRLA 1HNIA 1NU0A 1C1CA 4CD3A 4FLXA 1I3AA 1J5EK 2KW4A 3ZYYX 3TABA 1ATNA 3OS2A 3EE9A 4OVLA 1NK9A 2FSKA 4PKGA 2GUIA 3CCQN 4CJRA 4MFBA 4FK0A 4IZ9A 2P9UB 2DPNA 1X3NA 1RTIA 3AO5A 4C8MA 1WAJA 1YVNA 1BCOA 2P9LB 1U4BA 4WFBL 3ATVA 2ZQBA 3V9UA 4IOXA 4CHNA 4CJLA 2P9LA 1RT7A 4KH5A 3P4IA 3NF7A 3NCIA 3KWIA 3HSCA 1KXPA 4Y1CA 4DTPA 2WOMA 2Q3SA 3P38A 5JLHA 1N8RO 4B9MA 1W0HA 5IT9O 3VETA 1QHTA 1NK6A 4KBOA 3VEWA 3NVMA 2KTQA 5AQWA 1TVRA 4KHSA 4JKAA 3U8XA 3HSTB 1M1KO 1C6VA 4CZMA 2E88A 4ZTFA 2FF6A 1J54A 4JI5K 4FJJA 4CESA 4W5QA 4HUGA 2PAVA 5JVHL 4QS7A 2PY5A 1VQ9N 3TARA 3CYGA 4E7HA 3SMSA 4JS4A 4ICLA 3CC7N 1BIZA 3CF5L 3O4NA 1GLEG 2YNFA 3K59A 3VMFB 4DR7K 1RFQA 1RTHA 3THWA 3SAHA 5FRMA 3AVCA 4BR2A 3U4LA 3TTCA 1HJRA 4NLBA 3RR7A 2Z1IA 1GLBG 1G15A 1IJJA 5HL7L 3KD5E 4O0JA 4WQ4C 3O6WA 2XY6A 1LWEA 1NGDA 3OYBA 4OPKA 5TKWA 4KAZA 4DR4K 5CZ1A 4J2BA 3AVJA 3U3YA 3H1QA 4IBNA 3O1BA 4FJMA 2E4LA 3KZBA 1O1WA 1NJIO 4BR5A 4H0OA 1OH5A 4PUOA 1BL3A 1EXQA 2O8CB 1NGGA 3SUNA 4GMJB 4ILGB 1S72N 4YOUA 3L4QA 1KLNA 4UQGA 4HTUA 3QEVA 4BR7A 5KI6A 4CEAA 4LF7K 5C24A 3G6EN 3N4PA 3RRGA 1TYQB 1Y97A 4IO9L 1BCMA 1N5YA 4BG8A 1B92A 2CH5A 3ZT0A 2EX3A 4DLEA 5LL6Z 3VGLA 4FK2A 1BA0A 3HBTA 4KB1A 2W6LA 4YOTA 3PIOL 2XO7A 4N5SA 4DFPA 3HYFA 1X3MA 3PSFA 4CGFA 4DQIA 1C0TA 4CD1A 4M3ZA 1Z6RA 3QEIA 2BE2A 5AQZA 2W41A 3BGRA 4AILC 4BROA 5FPNA 1JLGA 4BE1A 1NGCA 4JD2A 1XUPO 3JS6A 4Y0WA 3VEOA 4AHCA 3G25A 4CEDA 1WSIA 3LL3A 2V7YA 4J2EA 1Z05A 3U9ZA 5TKYA 2ZM6K 3NH1A 2O8EA 2DY4A 2C1IA 4FJKA 3VESA 3ALYA 3KLGA 4BECA 1I39A 4CZLA 4LF5K 2X78A 3B6OA 2QWQA 1OKJA 4M63C 1HNWK 4CZFA 1VK0A 4OPHA 2GELA 3WNGA 3J8AA 3V9XA 5JVGL 4JKGB 2ZJQL 4GNIA 1WAFA 4CEQA 3ZSXA 4CIGA 3DLLL 3RMCA 3VGKA 3CCVN 4DV1K 3P83D 1A5XA 3H08A 3O9SA 3OBWA 4MLEA 1NKBA 4CJEA 1RDAA 3D7EO 3V1OA 4J2AA 3EO3A 5KPTA 4O8KA 2HOEA 4XH4A 4NB4A 4CJPA 1V4TA 4CIFA 4IEEA 3O9RA 1IG8A 3AA3A 1JJ2M 3QBXA 3L4IA 2HNZA 4FVUA 1ZXOA 4O5BA 2QM1A 1SV5A 3HOTA 2UXCK 1BGXT 2O8DB 3PSIA 3ZSRA 1F21A 3EZ5A 3K2PA 1R0AA 3BY5A 2HMPA 1Q9YA 3THYA 1KTQA 1IKYA 1K8KA 4BE2A 1CZAN 2QI2A 4H0TB 4CHPA 1TAUA 1TK5A 2E8AA 4LF8K 1XHZA 3QICA 1BU6O 3TPQA 4C23A 4BRFA 4BC3A 1EETA 4YFUA 4YOWA 3WQUA 4WE1A 1JLQA 3CPWM 1JXBA 3MECA 4EZ6A 3TTDA 4OPAA 5AQQA 2WUSA 3U6FA 3TI0A 1C0GA 3W0LA 3MDQA 2HHTA 4CW7B 4FO0A 5ADXA 5A2QO 4JK9A 2XHBA 4E7LA 4IFEA 4WQ4A 1MU2A 4FCYA 3AA2A 3ULEB 5AQPA 3MCPA 2GV9A 1RNHA 3PX0A 3T1HK 1P8ZA 2ZWHA 3ULDA 1MWMA 3E9LA 1NGEA 1GOBA 2B4JA 4WQ5C 3QIOA 2JWLA 3BF3A 1C0MA 4DKWA 4FJ7A 3NVKA 2HVHA 2NRTA 4CF2A 3OYFA 1NGFA 1RT4A 5C15A 3E9PA 1K8AO 2GWJA 4DTXA 3OTOK 2OCEA 2HHIA 2I7NA 4YDUC 2ZF5O 2BDPA 2P9NB 4X65K 4J2DA 5CY4A 4O44A 3ZT1A 2VG7A 5I3UA 2D0AA 3IFRA 3O3GA 1HYZA 4A2AA 4BG9A 4CEOA 4DR1K 2ATQA 1KAZA 4CGGA 4BRGA 3SI6A 4OKEA 3OYCA 4PY5A 3SPYA 1JLCA 1UOCA 3CCLN 4KHWA 4M3XA 2RKIA 4DFMA 4KPYA 2YNHA 3ASMA 1T7PA 3AV9A 4O0IA 1YTUA 2ZGZA 3CJ9A 3O4WA 5FPEA 1HUXA 5CYQA 3P39A 3I55N 3ZSVA 1VHXA 3FGUA 1IBMK 3PY8A 1BIUA 1BWFO 1IV0A 3N4QA 1VQLN 4F8RA 2RHKA 5IWAK 5AFUH 2UUCK 1K9MO 3KKRA 1TK8A 4EIAA 1JCFA 4DTNA 2JWKA 4A5BA 3NGIA 4B9TA 5K14A 4CFCA 1TV6A 2PYJA 3LDOA 1GLAG 3DXKA 4E7JA 4LFCK 4CHZA 3G10A 4CJ7A 3K57A 5I42A 5JS1A 1N6QA 3KVGA 2P9IB 3O3FA 3NDKA 1ZBFA 3VQ5A 4IKFA 4KV8A 4CEBA 2G8FA 1T6DA 1YVUA 4FPBA 4OLBA 3MXMA 1LWCA 3MN9A 3CCMN 4JRPA 4DU3A 3M6GA 5T7BA 2DFEA 5J2PA 4CZGA 3L2RA 1VQON 4HCCA 5JICA 3ZT3A 3OW2M 1ZBHA 4OGEA 4N47A 4CJFA 4ZTJA 4KI6A 4B1YB 2JGUA 3LDNA 4OLAA 1HNXK 3OS1A 4H0XB 4JNEA 4B1ZA 5J2MA 4CJQA 5AQXA 4FLWA 1T44A 3K5LA 3OA9A 4Z4EA 3AVGA 1NK4A 4CECA 3HJFA 1XQSC 1BHLA 2YNGA 5GAHP 3FLCO 4BRHA 4XEIA 3TSPA 3ENHA 2NRXA 1U6ZA 3U3GA 5KTQA 1X1PA 4Q0BA 3KLEA 5AQVA 3PX6A 1GLFO 1VQMN 2E2NA 4EAHD 4JI7K 4LF4K 5HP1A 3HO1A 2OPRA 4E89A 4CJ4A 4JI8K 2G8WA 1RT5A 1MDUB 3HM8A 2FSNA 2QWMA 2IS3A 3ZEUB 2VG5A 3MMVA 1SUQA 3H6EA 2ZJRL 2W42A 4YOVA 4DV5K 3DXMB 1BO5O 4NCGA 5EVZA 3QNNA 5FLXO 3KKSA 4JAXA 4IOAL 1JXEA 5F1XA 4DWIA 3CJBA 4O5FA 4DU4A 3HVRA 3SUOA 4OKJA 3EYZA 3MEEA 2F4VK 2HHVA 3MX5A 3R9PA 4W5TA 3ZX2A 3P31A 3OS0A 1XWLA 4B9UA 4KTQA 1WSJA 3UIQA 3O5BA 4H03B 1EO1A 2V51B 1V4SA 3S9HA 4FOEA 4BDZA 3ITHA 1YJ9N 4CHOA 4YDUA 4H5NA 3EY1A 3F73A 4DQQA 1SAZA 2O4IA 3WNFA 4M3RA 4DQPA 1HLUA 2YHAA 3LWLA 5DMRA 1BDGA 5HROA 1JLAA 1IO2A 1WBBA 3I0RA 1NMDA 3D2FA 4DV7K 4J8FA 1UA0A 4JKEA 2YKNA 1VSHA 3CJCA 4ILHA 2HF3A 1KFDA 1VSDA 1RBSA 3NF6A 4CF1A 3NH2A 4GV6A 4WFNL 4MQ3A 3TAFA 3HVTA 3KJVA 3CC2N 2HHQA 3O9UA 1Q7YO 4AHSA 4C1NK 2VWKA 1Q8IA 2E2QA 3HZ6A 1WB9A 4FJNA 4KB0A 1NGIA 3QESA 4LH5A 3FZLA 1TL1A 1WLJA 1E3MA 3UE5A 1RBTA 4FOIA 4JKBA 3IG1A 2KKZA 3EZWA 3TTFA 4W5OA 1GLDG 2FBXA 1QQMA 3WXJA 3AVKA 2P9SB 3AA5X 1L3SA 5CE3A 3DOLA 3VQBA 4LF9K 3Q7BA 5AQJA 2P9SA 3B8AX 4DG1A 4AHUA 2ZJPL 4DF4A 1YXQA 2O8BB 1L5UA 1D4XA 4DU1A 3V1RA 2FSJA 3LP2A 3MN5A 3AVNA 4B1VA 4AM7A 4B3RK 1Z26A 4LC9B 1QZ6A 3I8DA 4KTWA 3VTIA 3O9QA 2B5JA 3WXMB 2FC0A 4WYBA 3HT3A 5HRSA 2P9UA 4KHYA 3CCEN 3NBPA 5E26A 2NRVA 3ZLJA 5M1KA 3ID8A 5GIPA 1D5AA 4FJLA 1RDDA 3AAPA 4LSLA 3L8BA 1W7AA 1VQ6N 4PKIA 4ELTA 3TSUA 1NG9A 3MAQA 1HKCA 4JI3K 3VEYA 4EFHA 2KHOA 2NRZA 2OANA 3I8BA 1MA9B 5JLFA 3NF9A 2VCPA 4IXCA 1S6QA 3LPTA 4RW7A 5BR9A 4WF9L 3WUHA 3VQCA 4A5AA 1U47A 2VGNA 4A62A 4FZYA 4GKKK 1WNSA 3KK1A 3P5JA 3CI5A 3P1GA 3ZSQA 1HKGA 3PUFA 4KRFA 5AQKA 3SUQA 3NGYA 4PA1A 4KFBA 3M1FA 3GE1A 4JI6K 4IG0A 4CJUA 1P90A 2NRHA 4JK8A 4NCAA 2AA4A 1S9GA 5AFUA 1NKEA 3KWGA 2CH6A 5AQLA 4OKKA 4F2SA 1I94K 1JL2A 4FWMA 3K0SA 4JKFA 4YORA 1S1WA 2RPIA 4BQLA 3I33A 3DLHA 4DHYA 1HR0K 5DM6L 4M3UA 1EP4A 4LFBK 5CHIA 4E0DA 2E1ZA 4I7FA 2XY8A 4LSNA 2ITMA 3EL2A 1FJGK 3QDKA 3K9JA 5JS2A 4OGCA 5BPNA 3ZT2A 4FJGA 4DSJA 2V52B 3HTVA 2VWBA 1B9DA 1CLQA 4ELUA 3V9SA 5HRPA 3LM9A 1GLJO 4R79A 3LDPA 1YI2N 1YITN 2O8CA 4JEPA 4DUYK 4DTUA 4FZZA 2HMIA 2IDOA 4GVEA 3VEZA 2WFBA 1D9FA 4BWJA 1KLMA 4B3MK 1TYQA 4BEBA 3RMBA 2B6AA 1NJWA 4DSKA 3AARA 3M8QA 4CE9A 5AJ3K 3LPUA 4BGBA 3CQYA 2XY7A 2E2PA 2YNIA 4BRNA 3JAMO 3KIOA 1FW6A 4B8CA 1Q18A 2NRRA 4CBWA 2P5GA 4CK3A 1L3TA 3WQTA 2D5RA 1DLOA 3LWMA 2YHWA 3OYGA 1VSIA 3ENOA 5JENA 1RDCA 2HBJA 3L2VA 3V6DA 1NGHA 3LAMA 2F8SA 4RG8A 4RW4A 1DGKN 4FWPA 5AQIA 3T1YK 1VSJA 4CFAA 5LMNK 4M3WA 1BQMA 2A3ZA 3DWLA 2X74A 4H0PA 2E1YA 2P5OA 1S1UA 1OH8A 1TKDA 4M42A 4BVPA 1U2VB 1ZYQA 4DTJA 4A61A 2QWNA 5FDLA 3DRRA 4JKGA 3C6AA 3CM6A 4H5VA 5AQTA 1U2VA 1RT3A 1SQKA 3OYHA 1W9HA 4N41A 4DSIA 2P51A 2YCHA 1YAGA 4BY9C 3E01A 4CHYA 5DM7L 3S3MA 4BE0A 4W5RA 1X9WA 3ATUA 3PV8A 2O8FB 3AVMA 3E1YA 3RSEB 4K8XA 3UKUB 2O8FA 3QFPA 3FFIA 4E7KA 3RSEA 3UKUA 4BQZA 1T05A 1HYSA 3WEEB 1WOQA 1X9MA 1LW0A 3MXJA 3S41A 1YUWA 2QWRA 3VQDA 2O8DA 3NMUA 3WXKA 1FKOA 1LCUA 4ID1A 1UA1A 4H5WA 4E3SA 2A6AA 2P9PB 4B9VA 2HSTA 1E4FT 3IDHA 2X6NA 1K73O 2P9PA 1UWBA 3IKMA 1Q9XA 5AQSA 3VEVA 3LDLA 3SAGA 3AY9A 3SQ4A 4FJ5A 4M45A 4JRQA 3O4QA 4CK2A 3SPZA 1KVAA 1QS4A 3PLAA 4X64K 1WUAA 2H3GX 1DEJA 3V9ZA 5GAEP 1KC8O 4E7IA 3CJ1A 2V7ZA 3NH0A 1R59O 1YJNN 3DRSA 2HBMA 3QFUA 3ULEA 1OH6A 2HBKA 2NLXA 5EU7A 2YJEA 3CQ8A 2Q1NA 1XC3A 3VF2A 3VQ9A 4CJVA 3L2UA 1NK7A 4H5TA 3DOKA 3MCAB 1S1TA 2A41A 4E1NA 4Z4GA 4CERA 4KHPK 3RVCA 1LAWA 3V4IA 3KHYA 4CCHA 4PWDA 1DTTA 2P9NA 4BRQA 1WN7A 1QQNA 4YHHK 5BN9A 1MWKA 2HW3A 2DTUA 4EP4A 4C8LA 1HPMA 3HP6A 4JI4K 2FBYA 1RDUA 2D0BA 1T03A 2UUBK 2JLEA 4JI0K 2YKMA 1BA1A 4EHTA 3QO9A 3PX4A 4I2PA 1EKEA 1Y64A 4H8KA 3THXB 5BRHA 4ILJA 5AQYA 1VQ4N 5C12A 1HJOA 4BWMA 3SJJA 1XI1A 4KO0A 3E9OA 4FM1A 1J5OA 1FXXA 3JSMA 3D2EB 1SKRA 1N34K 4ID5A 4FLVA 3I0SA 4PHTX 2QWLA 4DQSA 1TAQA 4QOZB 4BRCA 3EEQA 4KHNA 4RWTA 1HKBA 3SLCA 5C2FA 4BGAA 3K5NA 2G8HA 3C0BA 3S5TA 1IKXA 2Q0UA 3CMAN 4BDYA 2HVIA 4CEEA 1VQ7N 4A59A 2OPPA 3SMPA 4AH9A 3BP8A 3TAQA 4B3SK 4JKHA 3QIPA 3C6HA 4O55A 1JLEA 2P9IA 4E1JA 2OTLN 2D0CA 2F96A 4CBXA 3MX2A 4QS8A 4CJ5A 3T69A 4BREA 4F3OA 1SKSA 3AVIA 4K43A 4FJXA 4CF8A 1VSMA 2IVNA 4GVMA 4FW2A 4PL7A 4RW9A 3G4SN 1XMOK 1QSLA 4FJHA 1GLCG 4DQRA 1VSEA 3AVLA 5E41A 4M3TA 3HP9A 3MN6A 3CJAA 3HOSA 2PZSA 5ELZA 4GY2B 5FPDA 4DS5A 3OYIA 4K25A 3DMJA 5AZIB 4JHDB 3AO4A 5AZIA 3QNOA 4NXNK 4JHDA 1LWFA 5AQOA 2NUBA 3ZETB 4MLHA 2RF2A 2A40A 5DK5A 4CHQA 3R3LA 4CEFA 4IFVA 1JL1A 1U45A 1KVBA 4XJXA 3JXUA 3GL1A 4PQUA 1S6PA 1E4GT 3LALA 3IMXA 4ZHRA 3EKSA 3HL8A 3QETA 3CG7A 1OVQA 3AO1A 3QEPA 3R1XA 3J7AP 3FR0A 3VA0A 4AF1A 5GIOA 2QKBA 1L3VA 1Z25A 3SYZA 4IEIA 1RBUA 3THVA 4N76A 1NNEA 1BG3A 5KGXA 1D8YA 3CD6N 4I9QA 4Z4FA 4DTMA 2A1RA 4FJIA 2HHSA 3OYDA 4IWVA 3ZEUA 4CGJA 3M8SA 2XY5A 3DAWA 3AVBA 3L3UA 3FFKB 4F4KA 3DXMA 4Q5VA 4LY7A 5J2QA 3RMDA 2PBDA 2KLAA 1NGJA 1T8EA 3C94A 4YY3K 4GV3A 1HQEA 4MDAA 3TAEA 4F2RA 4DR5K 3IAYA 3VOVA 5M1OA 4DSLA 2HNYA 3A5OC 1QE1A 4DLGA 3MK6A 1UAXA 2VQEK 5C42A 5LMUK 1IH7A 1BISA 5EY4A 1FKPA 4BACA 4L8RB 4CJSA 3UKRB 4OX9K 2D0OA 3IRXA 3L0QA 3HM9A 3L6QA 2GEMA 3CERA 3VGMA 2HHUA 4IO8A 3VEXA 2E6LA 2D4WA 2OPQA 3MWTA 2E2OA 3ZCMA 3TAPA 5LJVA 5KPZA 3GBTA 4DV3K 4MDBA 3D0PA 3F9KA 1DTQA 1XNRK 4FK4A 2IVOA 3WXLA 4HUFA 4Z4CA 3RTVA 3L2QA 4AQYK 3AA4A 3FZHA 2HF4A 1IBKK 4DFKA 1NWKA 4FJ8A 4IG3A 4BRMA 2Q2RA 2W40A 4CBUA 2X6SA 1RT1A 3CPEA 5CYMA 5M1PA 4B8AB 2QEXN 1QSYA 5GAGP 2Q31A 3T3FA 1BOTO 1S5JA 3SBTA 2HB5A 4C8NA 5KQ8A 3CFOA 4YOXA 1C0FA 4ISGA 1QQCA 3FZMA 3L3VA 4FWKA 3O9TA 3SV4A 3VQ6A 4EHUA 3R8EA 4DV4K 3B6PA 2VGMA 2QTDA 5SWMA 3K58A 1LOTB 3NE6A 1T6CA 1IG9A 4CFBA 1NJXA 2O8BA 3AAQA 5AQFA 1CZ9A 4IFYA 4BRDA 1XC9A 5C0YA 4A2BA 3ZX3A 4BR0A 3BZCA 4CJWA 5GADP 3V9WA 1J6ZA 1DT9A 3SUPA 4KHQA 2P1JA 4CZIA 3M8RA 2OYQA 4FLUA 4KREA 4HWIA 5KPRA 2DFHA 1KVCA 4LFAK 3V81A 3AO2A 3T7ZA 1ZBUA 3HK2A 1NK8A 3QB0A 2F8TA 2VYPA 2VG6A 4FWNA 2A1SA 5BR8K 1QQOA 3QERA 3H3NO 3CJ7A 4JN4A 1W2BM 3AO3A 1JCGA 1GOCA 2HBLA 4LD0A 4E19A 2QWOA 3DLRA 2VWJA 4CZEA 2IIRA 4H4MA 2QWPA 5B8HA 4BRIA 4CVNE 1KQSM 4BE7B 1NLVA 2HHXA 1RT2A 5KGWA 2ZGYA 2YV0X 3TAGA 2W00A 2NNWA 3ENBA 2ITGA 4KKOA 1S9EA 1WSGA 4CGHA 3C95A 3CCSN 3U9DA 2G8UA 3VQ7A 3CYMA 4EZ9A 1U48A 1GOAA 3MN7A 3FZKA 4FM2A 1M90O 3ZX0A 5F0XA 1K6YA 2ZE2A 3K9KA 2O4GA 4RW8A 3AVHA 5J2NA 3OYEA 4G1QA 2IVPA 2NRWA 1ATRA 2UXBK 1RCHA 2ASPA 1NOZA 1JLFA 3SBGA 2Z1JA 2IGIA 3MXIA 1NOYA 5CR4A 4MO5A 4U7BA
chains in the Genus database with same CATH topology
1RDWX 3D2FB 3C65A 5EX5A 3RSEA 3UKUA 4BQZA 3F9MA 3WEEB 1YIJN 3LDOA 1GLAG 3DXKA 1WOQA 5E84A 4CJ7A 3CCRN 3MWPA 3S41A 1VQ8N 4FL9A 3DJCA 1YUWA 4PKHA 1GLLO 2QWRA 3KVGA 2P9IB 4FWOA 4BRPA 2YHYA 3O80A 4IJAA 1VQ5N 4ISFA 1S3XA 1TUUA 3WXKA 5C10A 4JKDA 3NMUA 3BEXA 4BC2A 2WC9A 1YJWN 1LCUA 3CIPA 1T6DA 4H5WA 4FPBA 3GG4A 2OTJN 2A6AA 4BRAA 4Z94A 2P9KB 3MN9A 2P9PB 3VF6A 3CCMN 3M6GA 1YHQN 2HSTA 1E4FT 4CZGA 3HRGA 3LM2A 3VTHA 1VQON 3IDHA 1K73O 2P9KA 2YI1A 2P9PA 5JICA 3IKMA 4M7YA 5AQSA 3VEVA 3OW2M 1KAXA 5KQDA 1G99A 1QHAA 3LDLA 3SAGA 2WBNA 3AY9A 4B1YB 3LDNA 3EN9A 3PLAA 2GTDA 4H0XB 4JNEA 1WUAA 2H3GX 4PL8A 2RE2A 1S22A 1DEJA 4B1ZA 3SAFA 5BREA 5HOOA 1Q82O 5AQXA 1KAYA 5GAEP 1KC8O 5ADXH 4RCHA 1T44A 1EQYA 3CJ1A 3OA9A 4FWSA 1ZC6A 3SJHA 2V7ZA 1SS6A 4BRLA 1XQSC 3A8YA 2D0PA 1R59O 1YJNN 4CD3A 2C1GA 2HBMA 3F5TA 5AQGA 3QFUA 5GAHP 3ULEA 3ZYYX 2HBKA 2NLXA 2YJEA 3FLCO 1ATNA 4CZJA 5H1SQ 4BRHA 4DB3A 4XEIA 3TSPA 2Q1NA 3EE9A 3ENHA 2NRXA 3VERA 2J4RA 2AP1A 1XC3A 3R6MA 3VF2A 4B1WB 4DCHA 1U6ZA 1Q81O 2FSKA 3CCUN 4IJNA 4H5TA 5F2RA 4PKGA 3MCAB 3CXCM 3CCQN 5AQVA 1GLFO 1VQMN 5AZJB 2E2NA 2A41A 4IZ9A 4H0YB 2P9UB 3GOIA 2DPNA 4EAHD 1X3NA 5AZJA 3Q7CA 1ZBSA 1YVNA 2P9LB 4XH5A 3RVCA 4WFBL 3ATVA 3IUCA 1NBWA 3LDQA 3KHYA 4IOXA 3AGKA 1MDUB 2P9LA 1QVGM 3HM8A 4KH4A 2P9NA 4KH5A 2FSNA 4JD2B 2QWMA 3P4IA 4BRQA 5BPMA 1QQNA 3ZEUB 3MMVA 5BN9A 1MWKA 3H6EA 3KWIA 2ZJRL 3HSCA 4YOVA 3D6RA 3DXMB 1BO5O 4F9OA 1KXPA 1HPMA 2EWSA 3KK7A 5EVZA 1RDUA 3P38A 3J7ZO 5JLHA 2FXUA 3O8MA 4JAXA 1N8RO 4IOAL 3UB5A 4WCEL 5F1XA 1BA1A 4EHTA 2I7PA 3EKUA 3CJBA 4O5FA 4BC4A 3VETA 1Y64A 4B1XB 5BRHA 4L3QA 3MX5A 4KBOA 3R9PA 3VEWA 1Q86O 4ILJA 5AQYA 3NVMA 1VQ4N 3ZX2A 1HJOA 3P31A 5C12A 4CZKA 2GUPA 5AQWA 3E9OA 1VQNN 3O5BA 4H03B 4JKAA 2V51B 1EO1A 1V4SA 3U8XA 4FOEA 1M1KO 5M1QA 3D2EB 1YJ9N 4YDUA 4H5NA 3EE8A 4PHTX 2QWLA 4CZMA 2E88A 3CETA 1SAZA 2FF6A 4BRCA 2F9WA 4NLCA 2PFUA 4RWTA 1HKBA 3SLCA 5C2FA 2CGJA 2Q0RA 4ISEA 4BGAA 5FPMA 2PAVA 4G9ZA 5JVHL 4FPAA 1HLUA 4QS7A 3C0BA 1BDGA 2Q0UA 3CMAN 1VQ9N 3SMSA 1NMDA 3TSQA 3D2FA 4XH1A 4J8FA 1VQ7N 3FZFA 4JKEA 3WEEA 3CC7N 3CJCA 3OHRA 4ILHA 3SMPA 4A59A 3BP8A 2HF3A 3CF5L 1GLEG 3G71N 4KH6A 4JKHA 3VMFB 4GV9A 2NZTA 3TU5A 3C6HA 4FWRA 1RFQA 2P9IA 4E1JA 3SAHA 4GV6A 2OTLN 2GWKA 4CBXA 3MX2A 3M5RA 4QS8A 3T69A 4BREA 4WFNL 1W97L 4BR2A 3U4LA 1NGBA 3TTCA 3CC2N 4K43A 4NLBA 4MO5A 3O9UA 1Q7YO 3CC4N 1GLBG 4C1NK 2IVNA 4PL7A 3G4SN 1IJJA 5HL7L 1GLCG 2E2QA 3HZ6A 4WQ4C 3O6WA 1NGIA 1NGDA 3FZLA 5TKWA 3MN6A 3CJAA 3HOSA 1O13A 1K8KB 5AQHA 1BUPA 5ELZA 4GY2B 3UE5A 5FPDA 5MLCQ 3H1QA 4FOIA 5BN8A 4JKBA 2FF3B 3H46O 3O1BA 3WXIA 4K25A 2KKZA 3EZWA 3KZBA 5AZIB 1NGAA 1GLDG 5AR0A 3TTFA 4U67L 1NJIO 3WT0A 1QQMA 4JHDB 3WXJA 4BR5A 3CMEN 4H0OA 5AZIA 2P9SB 1NGGA 3BF1A 4ILGB 1S72N 4JHDA 4YOUA 5CE3A 5AQOA 3AGRA 3L4QA 3Q7BA 5AQJA 5EOYA 2P9SA 3B8AX 3C7NB 3ZETB 4MLHA 4C1NI 2ZJPL 2A40A 4BR7A 3E66A 1YXQA 2BUPA 3R3LA 3C7NA 3G6EN 1D4XA 3N4PA 1TYQB 2FSJA 4FSVA 4IO9L 3MN5A 1ATSA 4H0VB 4XJXA 3JXUA 3GL1A 4B1VA 2YX6A 4BG8A 4AM7A 4LC9B 1E4GT 3IMXA 1QZ6A 3EKSA 3O1WA 2CH5A 3VTIA 3O9QA 3WXMB 3H3OB 2A5XA 4WYBA 3R1XA 3VGLA 3FR0A 1BA0A 3HBTA 3H45C 4YOTA 2P9UA 4AF1A 4B9QA 5GIOA 3PIOL 1VQPN 3CCEN 1X3MA 2YJFA 5E26A 2NRVA 4IEIA 4CD1A 5M1KA 1Z6RA 3ID8A 5AQZA 2W41A 1BG3A 4FWLA 5GIPA 4BVOA 4CZHA 1H1VA 3AAPA 4BROA 3CD6N 5FPNA 2FLOA 1NGCA 4JD2A 1XUPO 3JS6A 4Y0WA 3VEOA 1VQ6N 4PKIA 3G25A 3LL3A 4IWVA 2V7YA 3TSUA 1Z05A 3ZEUA 3DAWA 5BRFA 3U9ZA 3FFKB 2Q36A 3DXMA 5TKYA 2C1IA 2E20A 2PBDA 2KLAA 1HKCA 1NGJA 5I9EB 4GV3A 3VESA 3VEYA 4EFHA 2KHOA 2NRZA 2OANA 4MDAA 1RGIA 4BECA 3ID6A 3SK3A 4QS9A 4CZLA 4OO1J 2QA4N 5LY3A 3I8BA 1MA9B 5GINA 5JLFA 2QWQA 1OKJA 2VCPA 4IXCA 4M63C 5M1OA 3VOVA 4M7XA 4CZFA 5BR9A 4OPHA 3A5OC 4WF9L 3MK6A 2GELA 3VPZA 3J8AA 1HX1A 4HTLA 4K42A 3WUHA 4A5AA 5JVGL 3CCJN 5EY4A 4JKGB 3A0IX 4RTFD 2ZJQL 2VGNA 3O08A 4GNIA 4A62A 4AM6A 3UKRB 3DLLL 1T3VA 3D2EA 5BPLA 2D0OA 1X9JA 2QXLA 3VGKA 3CCVN 1SZ2A 3L0QA 5AQUA 1DKGD 2GEMA 3CI5A 3L6QA 1HKGA 3CERA 3VGMA 3FE1A 3O9SA 3OBWA 4MLEA 5AQKA 4IO8A 3VEXA 4JK7A 2D4WA 3MWTA 2E2OA 3A5MC 3M1FA 3GE1A 2BTFA 3D7EO 5LJVA 5KPZA 1P90A 2NRHA 3GBTA 3EO3A 4JK8A 5KPTA 4O8KA 4MDBA 2AA4A 2HOEA 5AFUA 1ILYA 3KWGA 2GX9A 4XH4A 4NB4A 2UYTA 2CH6A 3A5LC 5AQLA 1V4TA 4CI6A 4IEEA 2IVOA 3WXLA 3DXKB 3O9RA 4FWMA 4IOCL 1IG8A 4JKFA 2ASOA 4YORA 1JJ2M 3QBXA 3L4IA 4FVUA 1ZXOA 4BQLA 3FZHA 4K41A 2HF4A 3I33A 4DHYA 1NWKA 2QM1A 4BC5A 3HOTA 5DM6L 2QW9A 4BRMA 2Q2RA 2W40A 4CBUA 5CHIA 3QMLA 2E1ZA 3CPEA 5M1PA 2ITMA 2QEXN 3EL2A 2HMPA 3QDKA 5GAGP 1ESVA 3K9JA 2Q31A 1K8KA 1BOTO 3SBTA 1CZAN 2QI2A 5BPNA 5KQ8A 4H0TB 4YOXA 1C0FA 4ISGA 2E8AA 3FZMA 3QICA 1BU6O 2V52B 3HTVA 3TPQA 1YF5L 2VWBA 2YHXA 4FWKA 4C23A 3O9TA 5EXWA 4BRFA 3LM9A 4BC3A 1GLJO 3HI0A 4YOWA 4IDHA 3WQUA 4R79A 3LDPA 4H5RA 4WFAL 1YI2N 2Q97A 1YITN 4EHUA 4JEPA 3R8EA 5C2DA 4DQ8A 2VGMA 3CPWM 2QTDA 3CHWA 1LOTB 3TTDA 4OPAA 1T6CA 3ZETA 5AQQA 2WUSA 4GVEA 3VEZA 1C0GA 2WFBA 3W0LA 2BH1A 3AAQA 3MDQA 5AQFA 4BRDA 1TYQA 4BEBA 1VQKN 5C0YA 3F2KA 4A2BA 4FO0A 4BRKA 3ZX3A 3VENA 4JK9A 4BR0A 5ADXA 5GADP 4IFEA 4WQ4A 1J6ZA 1DT9A 3AARA 4CZIA 3ULEB 4UY8O 5AQPA 3MCPA 4BGBA 4HWIA 5KPRA 3CQYA 1QZ5A 4BR9A 1P8ZA 2ZWHA 2E2PA 1MWMA 3E9LA 3T7ZA 4BRNA 1NGEA 3OBYA 5M1FA 3PIPL 4WQ5C 3QB0A 2JWLA 5M1NA 3BF3A 4DKWA 3NVKA 2ASMA 1Q18A 4YOYA 2NRTA 2VYPA 1NGFA 2NRRA 4FWNA 4CBWA 5C15A 1QQOA 5LJWA 3E9PA 3H3NO 3GDQA 1VAZA 4A57A 3VF4A 1K8AO 3CJ7A 4JN4A 3WQTA 1W2BM 1JCGA 2HBLA 2YHWA 2GWJA 3ENOA 2CGLA 4JKCA 2HBJA 2I7NA 2ZF5O 3M3ZA 4YDUC 2QWOA 2P9NB 4CZEA 1NGHA 2IIRA 5BRDA 2QWPA 1DGKN 4FWPA 5AQIA 5B8HA 4BRIA 1KQSM 4BE7B 1NLVA 2A3ZA 3DWLA 3IFRA 2CGKA 3CQXA 1OVYA 3H1VX 4A2AA 4BG9A 2ZGYA 1NM1A 4H0PA 1KAZA 2E1YA 4I6MB 4BRGA 2W00A 2NNWA 3ENBA 4I6MA 4BVPA 1U2VB 3CCLN 3CCSN 4A61A 2QWNA 2D1KA 3U9DA 4JKGA 3C6AA 4H5VA 5AQTA 1U2VA 5AQNA 4WQ5A 5AQRA 5AQMA 1SQKA 4NO7A 3A5NC 3UKRA 3W3DA 3MN7A 2F7TA 2ZGZA 3FZKA 1M90O 3CJ9A 3O4WA 3ZX0A 5F0XA 5FPEA 3I56N 1QVFM 3K9KA 1HUXA 3P39A 2A42A 3I55N 2YCHA 4BR4A 3FGUA 1YAGA 2IVPA 1BWFO 2NRWA 3N4QA 1ATRA 4O8UA 4BY9C 5JMVA 3QBWA 5DM7L 4MO4A 2ASPA 1VQLN 2RHKA 3BUZB 5AFUH 1K9MO 3ATUA 1KD1O 3SBGA 1TUYA 4EIAA 4FWQA 3E1YA 1JCFA 3RSEB 4B1UB 3UKUB 2JWKA 3QFPA 1JCEA 4A5BA 5CR4A 2F9TA 4U7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RDW X;  3D2F B;  5EX5 A;  3RSE A;  3UKU A;  4BQZ A;  3F9M A;  3WEE B;  3LDO A;  1GLA G;  3DXK A;  1WOQ A;  5E84 A;  4CJ7 A;  3S41 A;  4FL9 A;  3DJC A;  1YUW A;  4PKH A;  1GLL O;  2QWR A;  3KVG A;  2P9I B;  4FWO A;  4BRP A;  2YHY A;  3O80 A;  4IJA A;  4ISF A;  1S3X A;  1TUU A;  3WXK A;  3BEX A;  4BC2 A;  1LCU A;  3CIP A;  1T6D A;  4H5W A;  4FPB A;  3GG4 A;  2A6A A;  4BRA A;  4Z94 A;  2P9K B;  3MN9 A;  2P9P B;  3VF6 A;  3M6G A;  1E4F T;  4CZG A;  3LM2 A;  3IDH A;  2P9K A;  2YI1 A;  2P9P A;  5JIC A;  4M7Y A;  5AQS A;  3VEV A;  1KAX A;  5KQD A;  1G99 A;  1QHA A;  3LDL A;  3AY9 A;  4B1Y B;  3LDN A;  3EN9 A;  2GTD A;  4H0X B;  4JNE A;  1WUA A;  2H3G X;  4PL8 A;  4B1Z A;  1S22 A;  1DEJ A;  5BRE A;  5AQX A;  1KAY A;  5ADX H;  4RCH A;  1T44 A;  1EQY A;  3CJ1 A;  4FWS A;  1ZC6 A;  3SJH A;  2V7Z A;  4BRL A;  1XQS C;  3A8Y A;  2D0P A;  1R59 O;  4CD3 A;  5AQG A;  3QFU A;  3ULE A;  2NLX A;  2YJE A;  3FLC O;  1ATN A;  4CZJ A;  4BRH A;  4DB3 A;  4XEI A;  2Q1N A;  3ENH A;  3VER A;  2J4R A;  2AP1 A;  1XC3 A;  3R6M A;  3VF2 A;  4B1W B;  4DCH A;  1U6Z A;  2FSK A;  4IJN A;  4H5T A;  5F2R A;  4PKG A;  5AQV A;  1GLF O;  5AZJ B;  2E2N A;  2A41 A;  4IZ9 A;  4H0Y B;  2P9U B;  3GOI A;  2DPN A;  4EAH D;  1X3N A;  5AZJ A;  1ZBS A;  1YVN A;  2P9L B;  4XH5 A;  3ATV A;  3IUC A;  1NBW A;  3LDQ A;  3KHY A;  1MDU B;  2P9L A;  3HM8 A;  2P9N A;  2FSN A;  4JD2 B;  2QWM A;  3P4I A;  4BRQ A;  5BPM A;  1QQN A;  3ZEU B;  3MMV A;  5BN9 A;  1MWK A;  3H6E A;  3HSC A;  3DXM B;  1BO5 O;  4F9O A;  1KXP A;  1HPM A;  2EWS A;  5EVZ A;  5JLH A;  2FXU A;  3O8M A;  4JAX A;  3UB5 A;  5F1X A;  1BA1 A;  4EHT A;  2I7P A;  3EKU A;  3CJB A;  4O5F A;  4BC4 A;  3VET A;  1Y64 A;  4B1X B;  5BRH A;  4L3Q A;  4KBO A;  3R9P A;  3VEW A;  5AQY A;  3ZX2 A;  1HJO A;  4CZK A;  2GUP A;  5AQW A;  3O5B A;  4H03 B;  2V51 B;  1V4S A;  3U8X A;  4FOE A;  3D2E B;  4YDU A;  4H5N A;  2QWL A;  4CZM A;  2E88 A;  3CET A;  1SAZ A;  2FF6 A;  4BRC A;  2F9W A;  4RWT A;  1HKB A;  3SLC A;  2CGJ A;  2Q0R A;  4ISE A;  4BGA A;  5FPM A;  2PAV A;  4FPA A;  1HLU A;  4QS7 A;  3C0B A;  1BDG A;  2Q0U A;  3SMS A;  1NMD A;  3D2F A;  4XH1 A;  4J8F A;  3FZF A;  3WEE A;  3CJC A;  3OHR A;  3SMP A;  3BP8 A;  2HF3 A;  1GLE G;  2NZT A;  3TU5 A;  4FWR A;  1RFQ A;  2P9I A;  4E1J A;  2GWK A;  4CBX A;  4QS8 A;  4BRE A;  4BR2 A;  3U4L A;  1NGB A;  4K43 A;  4MO5 A;  1GLB G;  2IVN A;  4PL7 A;  1IJJ A;  1GLC G;  2E2Q A;  3HZ6 A;  4WQ4 C;  3O6W A;  1NGI A;  1NGD A;  3FZL A;  3MN6 A;  3CJA A;  1K8K B;  5AQH A;  1BUP A;  5ELZ A;  4GY2 B;  3UE5 A;  5FPD A;  3H1Q A;  4FOI A;  5BN8 A;  2FF3 B;  3H46 O;  3O1B A;  3WXI A;  4K25 A;  3EZW A;  3KZB A;  5AZI B;  1NGA A;  1GLD G;  5AR0 A;  3WT0 A;  1QQM A;  4JHD B;  3WXJ A;  4BR5 A;  4H0O A;  5AZI A;  2P9S B;  1NGG A;  3BF1 A;  4JHD A;  5CE3 A;  5AQO A;  5AQJ A;  5EOY A;  2P9S A;  3B8A X;  3C7N B;  3ZET B;  4MLH A;  2A40 A;  4BR7 A;  1YXQ A;  2BUP A;  3C7N A;  1D4X A;  1TYQ B;  2FSJ A;  4FSV A;  3MN5 A;  1ATS A;  4H0V B;  3JXU A;  3GL1 A;  4B1V A;  4BG8 A;  4AM7 A;  4LC9 B;  1E4G T;  3IMX A;  1QZ6 A;  3EKS A;  3O1W A;  2CH5 A;  3H3O B;  2A5X A;  4WYB A;  3VGL A;  3FR0 A;  1BA0 A;  3HBT A;  3H45 C;  4B9Q A;  2P9U A;  1X3M A;  2YJF A;  5E26 A;  4CD1 A;  1Z6R A;  3ID8 A;  5AQZ A;  2W41 A;  1BG3 A;  4FWL A;  4BVO A;  4CZH A;  1H1V A;  3AAP A;  4BRO A;  5FPN A;  2FLO A;  1NGC A;  4JD2 A;  1XUP O;  3JS6 A;  4Y0W A;  3VEO A;  4PKI A;  3G25 A;  3LL3 A;  4IWV A;  2V7Y A;  3ZEU A;  1Z05 A;  5BRF A;  3DAW A;  3U9Z A;  3FFK B;  2Q36 A;  3DXM A;  5TKY A;  2E20 A;  2PBD A;  1HKC A;  1NGJ A;  5I9E B;  3VES A;  3VEY A;  4EFH A;  2KHO A;  2OAN A;  1RGI A;  3SK3 A;  4QS9 A;  4CZL A;  5LY3 A;  3I8B A;  1MA9 B;  5JLF A;  2QWQ A;  1OKJ A;  2VCP A;  4IXC A;  4M63 C;  3VOV A;  4CZF A;  4M7X A;  5BR9 A;  3A5O C;  3MK6 A;  2GEL A;  3VPZ A;  3J8A A;  1HX1 A;  4HTL A;  4K42 A;  3WUH A;  5EY4 A;  3A0I X;  4RTF D;  3O08 A;  4GNI A;  4A62 A;  4AM6 A;  3UKR B;  3D2E A;  5BPL A;  2D0O A;  1X9J A;  2QXL A;  3VGK A;  1SZ2 A;  3L0Q A;  5AQU A;  1DKG D;  2GEM A;  3CI5 A;  3L6Q A;  3CER A;  1HKG A;  3VGM A;  3FE1 A;  4MLE A;  5AQK A;  4IO8 A;  3VEX A;  2D4W A;  2E2O A;  3A5M C;  3M1F A;  3GE1 A;  2BTF A;  3D7E O;  5LJV A;  5KPZ A;  2NRH A;  3GBT A;  3EO3 A;  5KPT A;  4O8K A;  2AA4 A;  2HOE A;  5AFU A;  4XH4 A;  4NB4 A;  2UYT A;  2CH6 A;  3A5L C;  5AQL A;  1V4T A;  4CI6 A;  2IVO A;  3WXL A;  3DXK B;  4FWM A;  1IG8 A;  2ASO A;  3QBX A;  3L4I A;  1ZXO A;  4BQL A;  3FZH A;  4K41 A;  2HF4 A;  3I33 A;  4DHY A;  1NWK A;  2QM1 A;  4BC5 A;  2QW9 A;  4BRM A;  2Q2R A;  2W40 A;  4CBU A;  3QML A;  2E1Z A;  2ITM A;  3EL2 A;  2HMP A;  3QDK A;  1ESV A;  2Q31 A;  1K8K A;  1BOT O;  1CZA N;  5BPN A;  5KQ8 A;  4H0T B;  1C0F A;  4ISG A;  2E8A A;  3FZM A;  3QIC A;  1BU6 O;  2V52 B;  3HTV A;  3TPQ A;  2VWB A;  2YHX A;  4FWK A;  4C23 A;  5EXW A;  4BRF A;  3LM9 A;  4BC3 A;  1GLJ O;  3HI0 A;  3WQU A;  3LDP A;  4H5R A;  2Q97 A;  4EHU A;  3R8E A;  4DQ8 A;  3CHW A;  1LOT B;  1T6C A;  3ZET A;  5AQQ A;  2WUS A;  3VEZ A;  1C0G A;  3W0L A;  3AAQ A;  5AQF A;  3MDQ A;  4BRD A;  1TYQ A;  4A2B A;  4BRK A;  4FO0 A;  3ZX3 A;  3VEN A;  4BR0 A;  5ADX A;  4WQ4 A;  1J6Z A;  3AAR A;  4CZI A;  3ULE B;  5AQP A;  3MCP A;  4BGB A;  4HWI A;  5KPR A;  3CQY A;  1QZ5 A;  4BR9 A;  1P8Z A;  2ZWH A;  2E2P A;  1MWM A;  4BRN A;  1NGE A;  4WQ5 C;  3QB0 A;  3BF3 A;  2ASM A;  1Q18 A;  2VYP A;  1NGF A;  4FWN A;  4CBW A;  5LJW A;  1QQO A;  3H3N O;  3GDQ A;  3VF4 A;  3CJ7 A;  4JN4 A;  3WQT A;  1JCG A;  2YHW A;  2GWJ A;  3ENO A;  2CGL A;  2I7N A;  4YDU C;  2ZF5 O;  3M3Z A;  2QWO A;  2P9N B;  4CZE A;  1NGH A;  2IIR A;  5BRD A;  2QWP A;  1DGK N;  4FWP A;  5AQI A;  5B8H A;  4BRI A;  1NLV A;  2A3Z A;  3DWL A;  3IFR A;  2CGK A;  3CQX A;  3H1V X;  4A2A A;  4BG9 A;  2ZGY A;  1NM1 A;  4H0P A;  1KAZ A;  2E1Y A;  4I6M B;  4BRG A;  4I6M A;  4BVP A;  1U2V B;  4A61 A;  2QWN A;  2D1K A;  3U9D A;  4H5V A;  5AQT A;  1U2V A;  5AQN A;  4WQ5 A;  5AQR A;  5AQM A;  1SQK A;  4NO7 A;  3A5N C;  3UKR A;  3W3D A;  3MN7 A;  2ZGZ A;  3FZK A;  3CJ9 A;  3O4W A;  3ZX0 A;  5F0X A;  5FPE A;  1HUX A;  2A42 A;  2YCH A;  4BR4 A;  3FGU A;  1YAG A;  2IVP A;  1BWF O;  1ATR A;  5JMV A;  3QBW A;  4MO4 A;  2ASP A;  3BUZ B;  5AFU H;  3ATU A;  1TUY A;  4EIA A;  4FWQ A;  1JCF A;  3RSE B;  4B1U B;  3UKU B;  3QFP A;  1JCE A;  2F9T A; 
#chains in the Genus database with same CATH topology
 3C65 A;  3F9M A;  1YIJ N;  1YTA A;  3CCR N;  3MWP A;  4FL9 A;  4PKH A;  4ELV A;  3DLE A;  3THW B;  4FWO A;  2YHY A;  4IJA A;  2AJQ A;  1WSH A;  4XIU A;  3LDS A;  1VQ5 N;  2KZZ A;  1HQU A;  5C10 A;  4JKD A;  4NXM K;  3BEX A;  4BC2 A;  2WC9 A;  1YJW N;  3OYL A;  1N33 K;  4FVM A;  4DR2 K;  4FLT A;  3SZ2 A;  4B3T K;  2OPS A;  3GG4 A;  4BRA A;  2P9K B;  3CFR A;  3VF6 A;  1YHQ N;  4DS4 A;  2Z1G A;  3HRG A;  3LM2 A;  3VTH A;  2P9K A;  2YI1 A;  4M7Y A;  3ZT4 A;  3OYN A;  3OJU A;  1TKZ A;  1KAX A;  5KQD A;  1G99 A;  3RWU A;  2OZS A;  4B3O A;  5SZT A;  2GTD A;  3QLH A;  4KHU A;  5BRE A;  1Q82 O;  2DFF A;  1YT3 A;  1C0U A;  1EQY A;  3K5O A;  1ZC6 A;  1SS6 A;  3SCX A;  3A8Y A;  2D0P A;  2C1G A;  3QIN A;  3F5T A;  5AQG A;  1KSP A;  2HND A;  1D9D A;  3VN5 A;  4CZJ A;  4GW6 A;  4DB3 A;  3SNN A;  3VER A;  2J4R A;  2AP1 A;  4B1W B;  3R6M A;  1C1B A;  1VSF A;  4DCH A;  1Q81 O;  3CCU N;  4DV0 K;  4IJN A;  2ZD1 A;  5F2R A;  3IS9 A;  3CXC M;  1C1A A;  3VQA A;  5AZJ B;  4FW1 A;  2HHH K;  4H0Y B;  3TAM A;  3GOI A;  4B9L A;  4CF9 A;  5AZJ A;  2FBT A;  3Q7C A;  1HNV A;  1ZBS A;  4DR6 K;  4XH5 A;  3KLI A;  3IUC A;  1NBW A;  3LDQ A;  4HHT A;  4DTO A;  3AGK A;  1QVG M;  1A5V A;  4KH4 A;  1NMN A;  4JD2 B;  1N36 K;  1IBL K;  5BPM A;  4JV5 K;  3D6R A;  4F9O A;  2O8E B;  2EWS A;  3KK7 A;  4DR3 K;  1X9S A;  2Z1H A;  4CF0 A;  3RMA A;  3J7Z O;  2FXU A;  3O8M A;  3VA3 A;  3TAN A;  1RTJ A;  3CM5 A;  3UB5 A;  4WCE L;  1U49 A;  2I7P A;  3EKU A;  3NF8 A;  1HMV A;  1J53 A;  4BC4 A;  2E6M A;  4B1X B;  1XMQ K;  3L2W A;  4L3Q A;  1Q86 O;  4Z4I A;  3S3N A;  1TL3 A;  4HUE A;  4CZK A;  4DV2 K;  2GUP A;  1NK0 A;  2PYL A;  1VQN N;  1HRH A;  4DTR A;  5M1Q A;  1EWQ A;  3TWH A;  3EE8 A;  3OYJ A;  3CET A;  1VSL A;  2F9W A;  4NLC A;  2PFU A;  3O3H A;  2CGJ A;  2Q0R A;  4ISE A;  5FPM A;  3AVA A;  4G9Z A;  4FPA A;  1SKW A;  1BI4 B;  1ASV A;  1A5W A;  4HCB A;  4K8Z A;  3KTQ A;  3T19 A;  3HXM A;  1BI4 A;  3TSQ A;  4XH1 A;  5J1E A;  3FZF A;  3LP0 A;  3WEE A;  1IKV A;  3OHR A;  1XNQ K;  3G71 N;  4KH6 A;  4GV9 A;  5C25 A;  2NZT A;  4O4G A;  3TU5 A;  1WBD A;  4FWR A;  5D3G A;  2GWK A;  3M5R A;  1W97 L;  1NGB A;  3QEX A;  3SQ0 A;  4CIE A;  5HRN A;  3CC4 N;  3PO5 A;  3ISN C;  1NJY A;  4FZX C;  4I2Q A;  4GKJ K;  2GBZ A;  3DRP A;  1TGO A;  3QEW A;  4B9N A;  1JKH A;  4F3T A;  3T1A A;  3THY B;  4B9S A;  3HPG A;  1O13 A;  1K8K B;  5AQH A;  3OYM A;  1BUP A;  5MLC Q;  5BN8 A;  4K0K K;  2FF3 B;  3H46 O;  3WXI A;  1NGA A;  5AR0 A;  4DV6 K;  4M3Y A;  3DM2 A;  4U67 L;  3WT0 A;  3CME N;  1EWR A;  1RIL A;  3SQ1 A;  2BAN A;  4X62 K;  3BF1 A;  2ETJ A;  3TR8 A;  1VRT A;  3AGR A;  5EOY A;  3C7N B;  4C1N I;  4DFJ A;  3E66 A;  3K5M A;  3VQ8 A;  1LW2 A;  2BUP A;  3DI6 A;  3C7N A;  4CJ3 A;  1HPZ A;  4FSV A;  4H0V B;  1ATS A;  2UXD K;  3DYA A;  3HPH A;  2YX6 A;  3O1W A;  2QKK A;  4DSE A;  3AVF A;  1FK9 A;  3J81 O;  3H3O B;  2A5X A;  3OYK A;  3H45 C;  4B9Q A;  1VQP N;  1U04 A;  1RDB A;  1SL0 A;  2YJF A;  2UUA K;  3ZSW A;  4FXD A;  2Y1J A;  4FWL A;  3DLG A;  4BVO A;  4CZH A;  1SL1 A;  1H1V A;  3M8P A;  5FRO A;  4JS5 A;  2FLO A;  4EP5 A;  1B9F A;  3ZSY A;  5BRF A;  1SL2 A;  3ZSZ A;  2Q36 A;  2E20 A;  5HLF A;  5I9E B;  1L3U A;  2KZM A;  3PO4 A;  1RGI A;  3ID6 A;  3SK3 A;  4QS9 A;  4OO1 J;  2QA4 N;  5LY3 A;  4B08 A;  5GIN A;  3OJS A;  1CXU A;  4CJK A;  4M7X A;  2G8K A;  2KQ2 A;  3THX A;  4C8K A;  3VQP A;  1VRU A;  3VPZ A;  4C8O A;  2LSN A;  2XRI A;  1HX1 A;  4HTL A;  4K42 A;  4LH4 A;  3CCJ N;  3A0I X;  4RTF D;  3O08 A;  1JLB A;  4AM6 A;  1CZB A;  1TKT A;  1T3V A;  3D2E A;  4CGD A;  5BPL A;  1X9J A;  2QXL A;  1KFS A;  1SZ2 A;  5AQU A;  3VQ4 A;  5KRT A;  1DKG D;  3FE1 A;  2R7Y A;  3D45 A;  4JK7 A;  4R5P A;  1QTM A;  1WSF A;  3A5M C;  2BTF A;  3BZK A;  4AHT A;  4NYN A;  3LP1 A;  1ILY A;  2GX9 A;  2UYT A;  3J7Y P;  3A5L C;  4CI6 A;  4FYD A;  3DXK B;  2FBV A;  4AHV A;  4IOC L;  3LAK A;  4YNQ A;  4LF6 K;  2ASO A;  3OY9 A;  1BQN A;  4K41 A;  3SV3 A;  3NAE A;  4DTS A;  4BC5 A;  1RTD A;  3G0Z A;  1WSE A;  4CJT A;  2QW9 A;  4X66 K;  4DSF A;  4DMN A;  2W6K A;  3QML A;  2BGG A;  1ITG A;  1ESV A;  2VQF K;  4I9L A;  1J9A A;  1HNZ K;  3OYA A;  1HYV A;  1YF5 L;  2YHX A;  4FJ9 A;  4OJR A;  1ASW A;  5EXW A;  3HI0 A;  3ZSO A;  4IDH A;  4WFA L;  3OVN A;  4H5R A;  2KFZ A;  2Q97 A;  2IC3 A;  4TSX A;  3LAN A;  5C2D A;  4DQ8 A;  3CHW A;  1S1X A;  4DUZ K;  4CFD A;  3MED A;  3ZET A;  4NYF A;  2WTU A;  2HHW A;  5HBM A;  2BH1 A;  3V1Q A;  2E5L K;  1ZBI A;  3WNE A;  1LAV A;  1VQK N;  4V19 S;  3F2K A;  4BRK A;  4H4O A;  5H1S Q;  3VEN A;  3CFP A;  4KI4 A;  4QAG A;  4UY8 O;  4CGI A;  3DLK A;  4BR9 A;  1QZ5 A;  1VSK A;  5M1F A;  3PIP L;  2QXF A;  3KLF A;  3OBY A;  4IDK A;  3NFA A;  3C6U A;  3VQE A;  5M1N A;  2ASM A;  4YOY A;  1EX4 A;  2RN2 A;  5LJW A;  4JYA K;  1KRP A;  1CXQ A;  4A57 A;  3GDQ A;  1VAZ A;  3VF4 A;  2OA8 A;  3KLH A;  1QSS A;  1IKW A;  2CGL A;  4DF8 A;  4JKC A;  4N56 A;  3M3Z A;  4BDP A;  1TKX A;  5BRD A;  4Z4H A;  1OH7 A;  4RW6 A;  4JI2 K;  3LZI A;  3C6T A;  3MEG A;  4CEZ A;  2CGK A;  1NKC A;  3CQX A;  1OVY A;  1S1V A;  3H1V X;  3WNH A;  1NM1 A;  4I6M B;  1KCF A;  2QK9 A;  4KTZ A;  2OZM A;  4I6M A;  2D1K A;  4E72 A;  3DLB A;  5AQR A;  5AQN A;  4WQ5 A;  5AQM A;  4OPJ A;  4NO7 A;  3A5N C;  4FLZ A;  4QCL A;  3UKR A;  3W3D A;  2F7T A;  4E1M A;  5HRR A;  1QVF M;  3I56 N;  4M41 A;  2IOC A;  2A42 A;  4BR4 A;  3KK2 A;  1RT6 A;  4O8U A;  2Y1I A;  3S3O A;  4CK1 A;  5CZ2 A;  5JMV A;  3QBW A;  4Y1D A;  4MO4 A;  4Z0U A;  3NHG A;  3BUZ B;  4AHR A;  3JYT A;  1KD1 O;  4W5N A;  1REV A;  1TUY A;  4FWQ A;  4B1U B;  1JCE A;  3KK3 A;  3J80 O;  5FRN A;  2F9T A;  1RDW X;  4FLY A;  2IAJ A;  3A2F A;  3D2F B;  4JLH A;  5EX5 A;  2WON A;  5E84 A;  1N32 K;  1VQ8 N;  3DJC A;  5KRS A;  1ASU A;  1GLL O;  3LZJ A;  3HPO A;  4BRP A;  3O80 A;  1TK0 A;  3VQQ A;  4ISF A;  1S3X A;  1TUU A;  2I5J A;  1NK5 A;  3CIP A;  3RRH A;  1XHX A;  2KFN A;  2OTJ N;  4Z94 A;  3NGZ A;  2EHG A;  1RBV A;  1QHA A;  2G8V A;  2WBN A;  4NCB A;  3LP3 A;  1RBR A;  2YHB A;  2UU9 K;  3SQ2 A;  1ZBL A;  3EN9 A;  3BDP A;  4PL8 A;  2RE2 A;  1S22 A;  3SAF A;  5HOO A;  4FM0 A;  3KD1 E;  1KAY A;  4JI1 K;  5ADX H;  4RCH A;  1LV5 A;  1NJZ A;  3RR8 A;  4FWS A;  2G8I A;  3SJH A;  4HVJ A;  4BRL A;  1HNI A;  1NU0 A;  1C1C A;  4CD3 A;  4FLX A;  1I3A A;  1J5E K;  2KW4 A;  3ZYY X;  3TAB A;  1ATN A;  3OS2 A;  3EE9 A;  4OVL A;  1NK9 A;  2FSK A;  4PKG A;  2GUI A;  3CCQ N;  4CJR A;  4MFB A;  4FK0 A;  4IZ9 A;  2P9U B;  2DPN A;  1X3N A;  1RTI A;  3AO5 A;  4C8M A;  1WAJ A;  1YVN A;  1BCO A;  2P9L B;  1U4B A;  4WFB L;  3ATV A;  2ZQB A;  3V9U A;  4IOX A;  4CHN A;  4CJL A;  2P9L A;  1RT7 A;  4KH5 A;  3P4I A;  3NF7 A;  3NCI A;  3KWI A;  3HSC A;  1KXP A;  4Y1C A;  4DTP A;  2WOM A;  2Q3S A;  3P38 A;  5JLH A;  1N8R O;  4B9M A;  1W0H A;  5IT9 O;  3VET A;  1QHT A;  1NK6 A;  4KBO A;  3VEW A;  3NVM A;  2KTQ A;  5AQW A;  1TVR A;  4KHS A;  4JKA A;  3U8X A;  3HST B;  1M1K O;  1C6V A;  4CZM A;  2E88 A;  4ZTF A;  2FF6 A;  1J54 A;  4JI5 K;  4FJJ A;  4CES A;  4W5Q A;  4HUG A;  2PAV A;  5JVH L;  4QS7 A;  2PY5 A;  1VQ9 N;  3TAR A;  3CYG A;  4E7H A;  3SMS A;  4JS4 A;  4ICL A;  3CC7 N;  1BIZ A;  3CF5 L;  3O4N A;  1GLE G;  2YNF A;  3K59 A;  3VMF B;  4DR7 K;  1RFQ A;  1RTH A;  3THW A;  3SAH A;  5FRM A;  3AVC A;  4BR2 A;  3U4L A;  3TTC A;  1HJR A;  4NLB A;  3RR7 A;  2Z1I A;  1GLB G;  1G15 A;  1IJJ A;  5HL7 L;  3KD5 E;  4O0J A;  4WQ4 C;  3O6W A;  2XY6 A;  1LWE A;  1NGD A;  3OYB A;  4OPK A;  5TKW A;  4KAZ A;  4DR4 K;  5CZ1 A;  4J2B A;  3AVJ A;  3U3Y A;  3H1Q A;  4IBN A;  3O1B A;  4FJM A;  2E4L A;  3KZB A;  1O1W A;  1NJI O;  4BR5 A;  4H0O A;  1OH5 A;  4PUO A;  1BL3 A;  1EXQ A;  2O8C B;  1NGG A;  3SUN A;  4GMJ B;  4ILG B;  1S72 N;  4YOU A;  3L4Q A;  1KLN A;  4UQG A;  4HTU A;  3QEV A;  4BR7 A;  5KI6 A;  4CEA A;  4LF7 K;  5C24 A;  3G6E N;  3N4P A;  3RRG A;  1TYQ B;  1Y97 A;  4IO9 L;  1BCM A;  1N5Y A;  4BG8 A;  1B92 A;  2CH5 A;  3ZT0 A;  2EX3 A;  4DLE A;  5LL6 Z;  3VGL A;  4FK2 A;  1BA0 A;  3HBT A;  4KB1 A;  2W6L A;  4YOT A;  3PIO L;  2XO7 A;  4N5S A;  4DFP A;  3HYF A;  1X3M A;  3PSF A;  4CGF A;  4DQI A;  1C0T A;  4CD1 A;  4M3Z A;  1Z6R A;  3QEI A;  2BE2 A;  5AQZ A;  2W41 A;  3BGR A;  4AIL C;  4BRO A;  5FPN A;  1JLG A;  4BE1 A;  1NGC A;  4JD2 A;  1XUP O;  3JS6 A;  4Y0W A;  3VEO A;  4AHC A;  3G25 A;  4CED A;  1WSI A;  3LL3 A;  2V7Y A;  4J2E A;  1Z05 A;  3U9Z A;  5TKY A;  2ZM6 K;  3NH1 A;  2O8E A;  2DY4 A;  2C1I A;  4FJK A;  3VES A;  3ALY A;  3KLG A;  4BEC A;  1I39 A;  4CZL A;  4LF5 K;  2X78 A;  3B6O A;  2QWQ A;  1OKJ A;  4M63 C;  1HNW K;  4CZF A;  1VK0 A;  4OPH A;  2GEL A;  3WNG A;  3J8A A;  3V9X A;  5JVG L;  4JKG B;  2ZJQ L;  4GNI A;  1WAF A;  4CEQ A;  3ZSX A;  4CIG A;  3DLL L;  3RMC A;  3VGK A;  3CCV N;  4DV1 K;  3P83 D;  1A5X A;  3H08 A;  3O9S A;  3OBW A;  4MLE A;  1NKB A;  4CJE A;  1RDA A;  3D7E O;  3V1O A;  4J2A A;  3EO3 A;  5KPT A;  4O8K A;  2HOE A;  4XH4 A;  4NB4 A;  4CJP A;  1V4T A;  4CIF A;  4IEE A;  3O9R A;  1IG8 A;  3AA3 A;  1JJ2 M;  3QBX A;  3L4I A;  2HNZ A;  4FVU A;  1ZXO A;  4O5B A;  2QM1 A;  1SV5 A;  3HOT A;  2UXC K;  1BGX T;  2O8D B;  3PSI A;  3ZSR A;  1F21 A;  3EZ5 A;  3K2P A;  1R0A A;  3BY5 A;  2HMP A;  1Q9Y A;  3THY A;  1KTQ A;  1IKY A;  1K8K A;  4BE2 A;  1CZA N;  2QI2 A;  4H0T B;  4CHP A;  1TAU A;  1TK5 A;  2E8A A;  4LF8 K;  1XHZ A;  3QIC A;  1BU6 O;  3TPQ A;  4C23 A;  4BRF A;  4BC3 A;  1EET A;  4YFU A;  4YOW A;  3WQU A;  4WE1 A;  1JLQ A;  3CPW M;  1JXB A;  3MEC A;  4EZ6 A;  3TTD A;  4OPA A;  5AQQ A;  2WUS A;  3U6F A;  3TI0 A;  1C0G A;  3W0L A;  3MDQ A;  2HHT A;  4CW7 B;  4FO0 A;  5ADX A;  5A2Q O;  4JK9 A;  2XHB A;  4E7L A;  4IFE A;  4WQ4 A;  1MU2 A;  4FCY A;  3AA2 A;  3ULE B;  5AQP A;  3MCP A;  2GV9 A;  1RNH A;  3PX0 A;  3T1H K;  1P8Z A;  2ZWH A;  3ULD A;  1MWM A;  3E9L A;  1NGE A;  1GOB A;  2B4J A;  4WQ5 C;  3QIO A;  2JWL A;  3BF3 A;  1C0M A;  4DKW A;  4FJ7 A;  3NVK A;  2HVH A;  2NRT A;  4CF2 A;  3OYF A;  1NGF A;  1RT4 A;  5C15 A;  3E9P A;  1K8A O;  2GWJ A;  4DTX A;  3OTO K;  2OCE A;  2HHI A;  2I7N A;  4YDU C;  2ZF5 O;  2BDP A;  2P9N B;  4X65 K;  4J2D A;  5CY4 A;  4O44 A;  3ZT1 A;  2VG7 A;  5I3U A;  2D0A A;  3IFR A;  3O3G A;  1HYZ A;  4A2A A;  4BG9 A;  4CEO A;  4DR1 K;  2ATQ A;  1KAZ A;  4CGG A;  4BRG A;  3SI6 A;  4OKE A;  3OYC A;  4PY5 A;  3SPY A;  1JLC A;  1UOC A;  3CCL N;  4KHW A;  4M3X A;  2RKI A;  4DFM A;  4KPY A;  2YNH A;  3ASM A;  1T7P A;  3AV9 A;  4O0I A;  1YTU A;  2ZGZ A;  3CJ9 A;  3O4W A;  5FPE A;  1HUX A;  5CYQ A;  3P39 A;  3I55 N;  3ZSV A;  1VHX A;  3FGU A;  1IBM K;  3PY8 A;  1BIU A;  1BWF O;  1IV0 A;  3N4Q A;  1VQL N;  4F8R A;  2RHK A;  5IWA K;  5AFU H;  2UUC K;  1K9M O;  3KKR A;  1TK8 A;  4EIA A;  1JCF A;  4DTN A;  2JWK A;  4A5B A;  3NGI A;  4B9T A;  5K14 A;  4CFC A;  1TV6 A;  2PYJ A;  3LDO A;  1GLA G;  3DXK A;  4E7J A;  4LFC K;  4CHZ A;  3G10 A;  4CJ7 A;  3K57 A;  5I42 A;  5JS1 A;  1N6Q A;  3KVG A;  2P9I B;  3O3F A;  3NDK A;  1ZBF A;  3VQ5 A;  4IKF A;  4KV8 A;  4CEB A;  2G8F A;  1T6D A;  1YVU A;  4FPB A;  4OLB A;  3MXM A;  1LWC A;  3MN9 A;  3CCM N;  4JRP A;  4DU3 A;  3M6G A;  5T7B A;  2DFE A;  5J2P A;  4CZG A;  3L2R A;  1VQO N;  4HCC A;  5JIC A;  3ZT3 A;  3OW2 M;  1ZBH A;  4OGE A;  4N47 A;  4CJF A;  4ZTJ A;  4KI6 A;  4B1Y B;  2JGU A;  3LDN A;  4OLA A;  1HNX K;  3OS1 A;  4H0X B;  4JNE A;  4B1Z A;  5J2M A;  4CJQ A;  5AQX A;  4FLW A;  1T44 A;  3K5L A;  3OA9 A;  4Z4E A;  3AVG A;  1NK4 A;  4CEC A;  3HJF A;  1XQS C;  1BHL A;  2YNG A;  5GAH P;  3FLC O;  4BRH A;  4XEI A;  3TSP A;  3ENH A;  2NRX A;  1U6Z A;  3U3G A;  5KTQ A;  1X1P A;  4Q0B A;  3KLE A;  5AQV A;  3PX6 A;  1GLF O;  1VQM N;  2E2N A;  4EAH D;  4JI7 K;  4LF4 K;  5HP1 A;  3HO1 A;  2OPR A;  4E89 A;  4CJ4 A;  4JI8 K;  2G8W A;  1RT5 A;  1MDU B;  3HM8 A;  2FSN A;  2QWM A;  2IS3 A;  3ZEU B;  2VG5 A;  3MMV A;  1SUQ A;  3H6E A;  2ZJR L;  2W42 A;  4YOV A;  4DV5 K;  3DXM B;  1BO5 O;  4NCG A;  5EVZ A;  3QNN A;  5FLX O;  3KKS A;  4JAX A;  4IOA L;  1JXE A;  5F1X A;  4DWI A;  3CJB A;  4O5F A;  4DU4 A;  3HVR A;  3SUO A;  4OKJ A;  3EYZ A;  3MEE A;  2F4V K;  2HHV A;  3MX5 A;  3R9P A;  4W5T A;  3ZX2 A;  3P31 A;  3OS0 A;  1XWL A;  4B9U A;  4KTQ A;  1WSJ A;  3UIQ A;  3O5B A;  4H03 B;  1EO1 A;  2V51 B;  1V4S A;  3S9H A;  4FOE A;  4BDZ A;  3ITH A;  1YJ9 N;  4CHO A;  4YDU A;  4H5N A;  3EY1 A;  3F73 A;  4DQQ A;  1SAZ A;  2O4I A;  3WNF A;  4M3R A;  4DQP A;  1HLU A;  2YHA A;  3LWL A;  5DMR A;  1BDG A;  5HRO A;  1JLA A;  1IO2 A;  1WBB A;  3I0R A;  1NMD A;  3D2F A;  4DV7 K;  4J8F A;  1UA0 A;  4JKE A;  2YKN A;  1VSH A;  3CJC A;  4ILH A;  2HF3 A;  1KFD A;  1VSD A;  1RBS A;  3NF6 A;  4CF1 A;  3NH2 A;  4GV6 A;  4WFN L;  4MQ3 A;  3TAF A;  3HVT A;  3KJV A;  3CC2 N;  2HHQ A;  3O9U A;  1Q7Y O;  4AHS A;  4C1N K;  2VWK A;  1Q8I A;  2E2Q A;  3HZ6 A;  1WB9 A;  4FJN A;  4KB0 A;  1NGI A;  3QES A;  4LH5 A;  3FZL A;  1TL1 A;  1WLJ A;  1E3M A;  3UE5 A;  1RBT A;  4FOI A;  4JKB A;  3IG1 A;  2KKZ A;  3EZW A;  3TTF A;  4W5O A;  1GLD G;  2FBX A;  1QQM A;  3WXJ A;  3AVK A;  2P9S B;  3AA5 X;  1L3S A;  5CE3 A;  3DOL A;  3VQB A;  4LF9 K;  3Q7B A;  5AQJ A;  2P9S A;  3B8A X;  4DG1 A;  4AHU A;  2ZJP L;  4DF4 A;  1YXQ A;  2O8B B;  1L5U A;  1D4X A;  4DU1 A;  3V1R A;  2FSJ A;  3LP2 A;  3MN5 A;  3AVN A;  4B1V A;  4AM7 A;  4B3R K;  1Z26 A;  4LC9 B;  1QZ6 A;  3I8D A;  4KTW A;  3VTI A;  3O9Q A;  2B5J A;  3WXM B;  2FC0 A;  4WYB A;  3HT3 A;  5HRS A;  2P9U A;  4KHY A;  3CCE N;  3NBP A;  5E26 A;  2NRV A;  3ZLJ A;  5M1K A;  3ID8 A;  5GIP A;  1D5A A;  4FJL A;  1RDD A;  3AAP A;  4LSL A;  3L8B A;  1W7A A;  1VQ6 N;  4PKI A;  4ELT A;  3TSU A;  1NG9 A;  3MAQ A;  1HKC A;  4JI3 K;  3VEY A;  4EFH A;  2KHO A;  2NRZ A;  2OAN A;  3I8B A;  1MA9 B;  5JLF A;  3NF9 A;  2VCP A;  4IXC A;  1S6Q A;  3LPT A;  4RW7 A;  5BR9 A;  4WF9 L;  3WUH A;  3VQC A;  4A5A A;  1U47 A;  2VGN A;  4A62 A;  4FZY A;  4GKK K;  1WNS A;  3KK1 A;  3P5J A;  3CI5 A;  3P1G A;  3ZSQ A;  1HKG A;  3PUF A;  4KRF A;  5AQK A;  3SUQ A;  3NGY A;  4PA1 A;  4KFB A;  3M1F A;  3GE1 A;  4JI6 K;  4IG0 A;  4CJU A;  1P90 A;  2NRH A;  4JK8 A;  4NCA A;  2AA4 A;  1S9G A;  5AFU A;  1NKE A;  3KWG A;  2CH6 A;  5AQL A;  4OKK A;  4F2S A;  1I94 K;  1JL2 A;  4FWM A;  3K0S A;  4JKF A;  4YOR A;  1S1W A;  2RPI A;  4BQL A;  3I33 A;  3DLH A;  4DHY A;  1HR0 K;  5DM6 L;  4M3U A;  1EP4 A;  4LFB K;  5CHI A;  4E0D A;  2E1Z A;  4I7F A;  2XY8 A;  4LSN A;  2ITM A;  3EL2 A;  1FJG K;  3QDK A;  3K9J A;  5JS2 A;  4OGC A;  5BPN A;  3ZT2 A;  4FJG A;  4DSJ A;  2V52 B;  3HTV A;  2VWB A;  1B9D A;  1CLQ A;  4ELU A;  3V9S A;  5HRP A;  3LM9 A;  1GLJ O;  4R79 A;  3LDP A;  1YI2 N;  1YIT N;  2O8C A;  4JEP A;  4DUY K;  4DTU A;  4FZZ A;  2HMI A;  2IDO A;  4GVE A;  3VEZ A;  2WFB A;  1D9F A;  4BWJ A;  1KLM A;  4B3M K;  1TYQ A;  4BEB A;  3RMB A;  2B6A A;  1NJW A;  4DSK A;  3AAR A;  3M8Q A;  4CE9 A;  5AJ3 K;  3LPU A;  4BGB A;  3CQY A;  2XY7 A;  2E2P A;  2YNI A;  4BRN A;  3JAM O;  3KIO A;  1FW6 A;  4B8C A;  1Q18 A;  2NRR A;  4CBW A;  2P5G A;  4CK3 A;  1L3T A;  3WQT A;  2D5R A;  1DLO A;  3LWM A;  2YHW A;  3OYG A;  1VSI A;  3ENO A;  5JEN A;  1RDC A;  2HBJ A;  3L2V A;  3V6D A;  1NGH A;  3LAM A;  2F8S A;  4RG8 A;  4RW4 A;  1DGK N;  4FWP A;  5AQI A;  3T1Y K;  1VSJ A;  4CFA A;  5LMN K;  4M3W A;  1BQM A;  2A3Z A;  3DWL A;  2X74 A;  4H0P A;  2E1Y A;  2P5O A;  1S1U A;  1OH8 A;  1TKD A;  4M42 A;  4BVP A;  1U2V B;  1ZYQ A;  4DTJ A;  4A61 A;  2QWN A;  5FDL A;  3DRR A;  4JKG A;  3C6A A;  3CM6 A;  4H5V A;  5AQT A;  1U2V A;  1RT3 A;  1SQK A;  3OYH A;  1W9H A;  4N41 A;  4DSI A;  2P51 A;  2YCH A;  1YAG A;  4BY9 C;  3E01 A;  4CHY A;  5DM7 L;  3S3M A;  4BE0 A;  4W5R A;  1X9W A;  3ATU A;  3PV8 A;  2O8F B;  3AVM A;  3E1Y A;  3RSE B;  4K8X A;  3UKU B;  2O8F A;  3QFP A;  3FFI A;  4E7K A;  3RSE A;  3UKU A;  4BQZ A;  1T05 A;  1HYS A;  3WEE B;  1WOQ A;  1X9M A;  1LW0 A;  3MXJ A;  3S41 A;  1YUW A;  2QWR A;  3VQD A;  2O8D A;  3NMU A;  3WXK A;  1FKO A;  1LCU A;  4ID1 A;  1UA1 A;  4H5W A;  4E3S A;  2A6A A;  2P9P B;  4B9V A;  2HST A;  1E4F T;  3IDH A;  2X6N A;  1K73 O;  2P9P A;  1UWB A;  3IKM A;  1Q9X A;  5AQS A;  3VEV A;  3LDL A;  3SAG A;  3AY9 A;  3SQ4 A;  4FJ5 A;  4M45 A;  4JRQ A;  3O4Q A;  4CK2 A;  3SPZ A;  1KVA A;  1QS4 A;  3PLA A;  4X64 K;  1WUA A;  2H3G X;  1DEJ A;  3V9Z A;  5GAE P;  1KC8 O;  4E7I A;  3CJ1 A;  2V7Z A;  3NH0 A;  1R59 O;  1YJN N;  3DRS A;  2HBM A;  3QFU A;  3ULE A;  1OH6 A;  2HBK A;  2NLX A;  5EU7 A;  2YJE A;  3CQ8 A;  2Q1N A;  1XC3 A;  3VF2 A;  3VQ9 A;  4CJV A;  3L2U A;  1NK7 A;  4H5T A;  3DOK A;  3MCA B;  1S1T A;  2A41 A;  4E1N A;  4Z4G A;  4CER A;  4KHP K;  3RVC A;  1LAW A;  3V4I A;  3KHY A;  4CCH A;  4PWD A;  1DTT A;  2P9N A;  4BRQ A;  1WN7 A;  1QQN A;  4YHH K;  5BN9 A;  1MWK A;  2HW3 A;  2DTU A;  4EP4 A;  4C8L A;  1HPM A;  3HP6 A;  4JI4 K;  2FBY A;  1RDU A;  2D0B A;  1T03 A;  2UUB K;  2JLE A;  4JI0 K;  2YKM A;  1BA1 A;  4EHT A;  3QO9 A;  3PX4 A;  4I2P A;  1EKE A;  1Y64 A;  4H8K A;  3THX B;  5BRH A;  4ILJ A;  5AQY A;  1VQ4 N;  5C12 A;  1HJO A;  4BWM A;  3SJJ A;  1XI1 A;  4KO0 A;  3E9O A;  4FM1 A;  1J5O A;  1FXX A;  3JSM A;  3D2E B;  1SKR A;  1N34 K;  4ID5 A;  4FLV A;  3I0S A;  4PHT X;  2QWL A;  4DQS A;  1TAQ A;  4QOZ B;  4BRC A;  3EEQ A;  4KHN A;  4RWT A;  1HKB A;  3SLC A;  5C2F A;  4BGA A;  3K5N A;  2G8H A;  3C0B A;  3S5T A;  1IKX A;  2Q0U A;  3CMA N;  4BDY A;  2HVI A;  4CEE A;  1VQ7 N;  4A59 A;  2OPP A;  3SMP A;  4AH9 A;  3BP8 A;  3TAQ A;  4B3S K;  4JKH A;  3QIP A;  3C6H A;  4O55 A;  1JLE A;  2P9I A;  4E1J A;  2OTL N;  2D0C A;  2F96 A;  4CBX A;  3MX2 A;  4QS8 A;  4CJ5 A;  3T69 A;  4BRE A;  4F3O A;  1SKS A;  3AVI A;  4K43 A;  4FJX A;  4CF8 A;  1VSM A;  2IVN A;  4GVM A;  4FW2 A;  4PL7 A;  4RW9 A;  3G4S N;  1XMO K;  1QSL A;  4FJH A;  1GLC G;  4DQR A;  1VSE A;  3AVL A;  5E41 A;  4M3T A;  3HP9 A;  3MN6 A;  3CJA A;  3HOS A;  2PZS A;  5ELZ A;  4GY2 B;  5FPD A;  4DS5 A;  3OYI A;  4K25 A;  3DMJ A;  5AZI B;  4JHD B;  3AO4 A;  5AZI A;  3QNO A;  4NXN K;  4JHD A;  1LWF A;  5AQO A;  2NUB A;  3ZET B;  4MLH A;  2RF2 A;  2A40 A;  5DK5 A;  4CHQ A;  3R3L A;  4CEF A;  4IFV A;  1JL1 A;  1U45 A;  1KVB A;  4XJX A;  3JXU A;  3GL1 A;  4PQU A;  1S6P A;  1E4G T;  3LAL A;  3IMX A;  4ZHR A;  3EKS A;  3HL8 A;  3QET A;  3CG7 A;  1OVQ A;  3AO1 A;  3QEP A;  3R1X A;  3J7A P;  3FR0 A;  3VA0 A;  4AF1 A;  5GIO A;  2QKB A;  1L3V A;  1Z25 A;  3SYZ A;  4IEI A;  1RBU A;  3THV A;  4N76 A;  1NNE A;  1BG3 A;  5KGX A;  1D8Y A;  3CD6 N;  4I9Q A;  4Z4F A;  4DTM A;  2A1R A;  4FJI A;  2HHS A;  3OYD A;  4IWV A;  3ZEU A;  4CGJ A;  3M8S A;  2XY5 A;  3DAW A;  3AVB A;  3L3U A;  3FFK B;  4F4K A;  3DXM A;  4Q5V A;  4LY7 A;  5J2Q A;  3RMD A;  2PBD A;  2KLA A;  1NGJ A;  1T8E A;  3C94 A;  4YY3 K;  4GV3 A;  1HQE A;  4MDA A;  3TAE A;  4F2R A;  4DR5 K;  3IAY A;  3VOV A;  5M1O A;  4DSL A;  2HNY A;  3A5O C;  1QE1 A;  4DLG A;  3MK6 A;  1UAX A;  2VQE K;  5C42 A;  5LMU K;  1IH7 A;  1BIS A;  5EY4 A;  1FKP A;  4BAC A;  4L8R B;  4CJS A;  3UKR B;  4OX9 K;  2D0O A;  3IRX A;  3L0Q A;  3HM9 A;  3L6Q A;  2GEM A;  3CER A;  3VGM A;  2HHU A;  4IO8 A;  3VEX A;  2E6L A;  2D4W A;  2OPQ A;  3MWT A;  2E2O A;  3ZCM A;  3TAP A;  5LJV A;  5KPZ A;  3GBT A;  4DV3 K;  4MDB A;  3D0P A;  3F9K A;  1DTQ A;  1XNR K;  4FK4 A;  2IVO A;  3WXL A;  4HUF A;  4Z4C A;  3RTV A;  3L2Q A;  4AQY K;  3AA4 A;  3FZH A;  2HF4 A;  1IBK K;  4DFK A;  1NWK A;  4FJ8 A;  4IG3 A;  4BRM A;  2Q2R A;  2W40 A;  4CBU A;  2X6S A;  1RT1 A;  3CPE A;  5CYM A;  5M1P A;  4B8A B;  2QEX N;  1QSY A;  5GAG P;  2Q31 A;  3T3F A;  1BOT O;  1S5J A;  3SBT A;  2HB5 A;  4C8N A;  5KQ8 A;  3CFO A;  4YOX A;  1C0F A;  4ISG A;  1QQC A;  3FZM A;  3L3V A;  4FWK A;  3O9T A;  3SV4 A;  3VQ6 A;  4EHU A;  3R8E A;  4DV4 K;  3B6P A;  2VGM A;  2QTD A;  5SWM A;  3K58 A;  1LOT B;  3NE6 A;  1T6C A;  1IG9 A;  4CFB A;  1NJX A;  2O8B A;  3AAQ A;  5AQF A;  1CZ9 A;  4IFY A;  4BRD A;  1XC9 A;  5C0Y A;  4A2B A;  3ZX3 A;  4BR0 A;  3BZC A;  4CJW A;  5GAD P;  3V9W A;  1J6Z A;  1DT9 A;  3SUP A;  4KHQ A;  2P1J A;  4CZI A;  3M8R A;  2OYQ A;  4FLU A;  4KRE A;  4HWI A;  5KPR A;  2DFH A;  1KVC A;  4LFA K;  3V81 A;  3AO2 A;  3T7Z A;  1ZBU A;  3HK2 A;  1NK8 A;  3QB0 A;  2F8T A;  2VYP A;  2VG6 A;  4FWN A;  2A1S A;  5BR8 K;  1QQO A;  3QER A;  3H3N O;  3CJ7 A;  4JN4 A;  1W2B M;  3AO3 A;  1JCG A;  1GOC A;  2HBL A;  4LD0 A;  4E19 A;  2QWO A;  3DLR A;  2VWJ A;  4CZE A;  2IIR A;  4H4M A;  2QWP A;  5B8H A;  4BRI A;  4CVN E;  1KQS M;  4BE7 B;  1NLV A;  2HHX A;  1RT2 A;  5KGW A;  2ZGY A;  2YV0 X;  3TAG A;  2W00 A;  2NNW A;  3ENB A;  2ITG A;  4KKO A;  1S9E A;  1WSG A;  4CGH A;  3C95 A;  3CCS N;  3U9D A;  2G8U A;  3VQ7 A;  3CYM A;  4EZ9 A;  1U48 A;  1GOA A;  3MN7 A;  3FZK A;  4FM2 A;  1M90 O;  3ZX0 A;  5F0X A;  1K6Y A;  2ZE2 A;  3K9K A;  2O4G A;  4RW8 A;  3AVH A;  5J2N A;  3OYE A;  4G1Q A;  2IVP A;  2NRW A;  1ATR A;  2UXB K;  1RCH A;  2ASP A;  1NOZ A;  1JLF A;  3SBG A;  2Z1J A;  2IGI A;  3MXI A;  1NOY A;  5CR4 A;  4MO5 A;  4U7B A; 
#chains in the Genus database with same CATH homology
 1RDW X;  3D2F B;  3C65 A;  5EX5 A;  3RSE A;  3UKU A;  4BQZ A;  3F9M A;  3WEE B;  1YIJ N;  3LDO A;  1GLA G;  3DXK A;  1WOQ A;  5E84 A;  4CJ7 A;  3CCR N;  3MWP A;  3S41 A;  1VQ8 N;  4FL9 A;  3DJC A;  1YUW A;  4PKH A;  1GLL O;  2QWR A;  3KVG A;  2P9I B;  4FWO A;  4BRP A;  2YHY A;  3O80 A;  4IJA A;  1VQ5 N;  4ISF A;  1S3X A;  1TUU A;  3WXK A;  5C10 A;  4JKD A;  3NMU A;  3BEX A;  4BC2 A;  2WC9 A;  1YJW N;  1LCU A;  3CIP A;  1T6D A;  4H5W A;  4FPB A;  3GG4 A;  2OTJ N;  2A6A A;  4BRA A;  4Z94 A;  2P9K B;  3MN9 A;  2P9P B;  3VF6 A;  3CCM N;  3M6G A;  1YHQ N;  2HST A;  1E4F T;  4CZG A;  3HRG A;  3LM2 A;  3VTH A;  1VQO N;  3IDH A;  1K73 O;  2P9K A;  2YI1 A;  2P9P A;  5JIC A;  3IKM A;  4M7Y A;  5AQS A;  3VEV A;  3OW2 M;  1KAX A;  5KQD A;  1G99 A;  1QHA A;  3LDL A;  3SAG A;  2WBN A;  3AY9 A;  4B1Y B;  3LDN A;  3EN9 A;  3PLA A;  2GTD A;  4H0X B;  4JNE A;  1WUA A;  2H3G X;  4PL8 A;  2RE2 A;  1S22 A;  1DEJ A;  4B1Z A;  3SAF A;  5BRE A;  5HOO A;  1Q82 O;  5AQX A;  1KAY A;  5GAE P;  1KC8 O;  5ADX H;  4RCH A;  1T44 A;  1EQY A;  3CJ1 A;  3OA9 A;  4FWS A;  1ZC6 A;  3SJH A;  2V7Z A;  1SS6 A;  4BRL A;  1XQS C;  3A8Y A;  2D0P A;  1R59 O;  1YJN N;  4CD3 A;  2C1G A;  2HBM A;  3F5T A;  5AQG A;  3QFU A;  5GAH P;  3ULE A;  3ZYY X;  2HBK A;  2NLX A;  2YJE A;  3FLC O;  1ATN A;  4CZJ A;  5H1S Q;  4BRH A;  4DB3 A;  4XEI A;  3TSP A;  2Q1N A;  3EE9 A;  3ENH A;  2NRX A;  3VER A;  2J4R A;  2AP1 A;  1XC3 A;  3R6M A;  3VF2 A;  4B1W B;  4DCH A;  1U6Z A;  1Q81 O;  2FSK A;  3CCU N;  4IJN A;  4H5T A;  5F2R A;  4PKG A;  3MCA B;  3CXC M;  3CCQ N;  5AQV A;  1GLF O;  1VQM N;  5AZJ B;  2E2N A;  2A41 A;  4IZ9 A;  4H0Y B;  2P9U B;  3GOI A;  2DPN A;  4EAH D;  1X3N A;  5AZJ A;  3Q7C A;  1ZBS A;  1YVN A;  2P9L B;  4XH5 A;  3RVC A;  4WFB L;  3ATV A;  3IUC A;  1NBW A;  3LDQ A;  3KHY A;  4IOX A;  3AGK A;  1MDU B;  2P9L A;  1QVG M;  3HM8 A;  4KH4 A;  2P9N A;  4KH5 A;  2FSN A;  4JD2 B;  2QWM A;  3P4I A;  4BRQ A;  5BPM A;  1QQN A;  3ZEU B;  3MMV A;  5BN9 A;  1MWK A;  3H6E A;  3KWI A;  2ZJR L;  3HSC A;  4YOV A;  3D6R A;  3DXM B;  1BO5 O;  4F9O A;  1KXP A;  1HPM A;  2EWS A;  3KK7 A;  5EVZ A;  1RDU A;  3P38 A;  3J7Z O;  5JLH A;  2FXU A;  3O8M A;  4JAX A;  1N8R O;  4IOA L;  3UB5 A;  4WCE L;  5F1X A;  1BA1 A;  4EHT A;  2I7P A;  3EKU A;  3CJB A;  4O5F A;  4BC4 A;  3VET A;  1Y64 A;  4B1X B;  5BRH A;  4L3Q A;  3MX5 A;  4KBO A;  3R9P A;  3VEW A;  1Q86 O;  4ILJ A;  5AQY A;  3NVM A;  1VQ4 N;  3ZX2 A;  1HJO A;  3P31 A;  5C12 A;  4CZK A;  2GUP A;  5AQW A;  3E9O A;  1VQN N;  3O5B A;  4H03 B;  4JKA A;  2V51 B;  1EO1 A;  1V4S A;  3U8X A;  4FOE A;  1M1K O;  5M1Q A;  3D2E B;  1YJ9 N;  4YDU A;  4H5N A;  3EE8 A;  4PHT X;  2QWL A;  4CZM A;  2E88 A;  3CET A;  1SAZ A;  2FF6 A;  4BRC A;  2F9W A;  4NLC A;  2PFU A;  4RWT A;  1HKB A;  3SLC A;  5C2F A;  2CGJ A;  2Q0R A;  4ISE A;  4BGA A;  5FPM A;  2PAV A;  4G9Z A;  5JVH L;  4FPA A;  1HLU A;  4QS7 A;  3C0B A;  1BDG A;  2Q0U A;  3CMA N;  1VQ9 N;  3SMS A;  1NMD A;  3TSQ A;  3D2F A;  4XH1 A;  4J8F A;  1VQ7 N;  3FZF A;  4JKE A;  3WEE A;  3CC7 N;  3CJC A;  3OHR A;  4ILH A;  3SMP A;  4A59 A;  3BP8 A;  2HF3 A;  3CF5 L;  1GLE G;  3G71 N;  4KH6 A;  4JKH A;  3VMF B;  4GV9 A;  2NZT A;  3TU5 A;  3C6H A;  4FWR A;  1RFQ A;  2P9I A;  4E1J A;  3SAH A;  4GV6 A;  2OTL N;  2GWK A;  4CBX A;  3MX2 A;  3M5R A;  4QS8 A;  3T69 A;  4BRE A;  4WFN L;  1W97 L;  4BR2 A;  3U4L A;  1NGB A;  3TTC A;  3CC2 N;  4K43 A;  4NLB A;  4MO5 A;  3O9U A;  1Q7Y O;  3CC4 N;  1GLB G;  4C1N K;  2IVN A;  4PL7 A;  3G4S N;  1IJJ A;  5HL7 L;  1GLC G;  2E2Q A;  3HZ6 A;  4WQ4 C;  3O6W A;  1NGI A;  1NGD A;  3FZL A;  5TKW A;  3MN6 A;  3CJA A;  3HOS A;  1O13 A;  1K8K B;  5AQH A;  1BUP A;  5ELZ A;  4GY2 B;  3UE5 A;  5FPD A;  5MLC Q;  3H1Q A;  4FOI A;  5BN8 A;  4JKB A;  2FF3 B;  3H46 O;  3O1B A;  3WXI A;  4K25 A;  2KKZ A;  3EZW A;  3KZB A;  5AZI B;  1NGA A;  1GLD G;  5AR0 A;  3TTF A;  4U67 L;  1NJI O;  3WT0 A;  1QQM A;  4JHD B;  3WXJ A;  4BR5 A;  3CME N;  4H0O A;  5AZI A;  2P9S B;  1NGG A;  3BF1 A;  4ILG B;  1S72 N;  4JHD A;  4YOU A;  5CE3 A;  5AQO A;  3AGR A;  3L4Q A;  3Q7B A;  5AQJ A;  5EOY A;  2P9S A;  3B8A X;  3C7N B;  3ZET B;  4MLH A;  4C1N I;  2ZJP L;  2A40 A;  4BR7 A;  3E66 A;  1YXQ A;  2BUP A;  3R3L A;  3C7N A;  3G6E N;  1D4X A;  3N4P A;  1TYQ B;  2FSJ A;  4FSV A;  4IO9 L;  3MN5 A;  1ATS A;  4H0V B;  4XJX A;  3JXU A;  3GL1 A;  4B1V A;  2YX6 A;  4BG8 A;  4AM7 A;  4LC9 B;  1E4G T;  3IMX A;  1QZ6 A;  3EKS A;  3O1W A;  2CH5 A;  3VTI A;  3O9Q A;  3WXM B;  3H3O B;  2A5X A;  4WYB A;  3R1X A;  3VGL A;  3FR0 A;  1BA0 A;  3HBT A;  3H45 C;  4YOT A;  2P9U A;  4AF1 A;  4B9Q A;  5GIO A;  3PIO L;  1VQP N;  3CCE N;  1X3M A;  2YJF A;  5E26 A;  2NRV A;  4IEI A;  4CD1 A;  5M1K A;  1Z6R A;  3ID8 A;  5AQZ A;  2W41 A;  1BG3 A;  4FWL A;  5GIP A;  4BVO A;  4CZH A;  1H1V A;  3AAP A;  4BRO A;  3CD6 N;  5FPN A;  2FLO A;  1NGC A;  4JD2 A;  1XUP O;  3JS6 A;  4Y0W A;  3VEO A;  1VQ6 N;  4PKI A;  3G25 A;  3LL3 A;  4IWV A;  2V7Y A;  3TSU A;  1Z05 A;  3ZEU A;  3DAW A;  5BRF A;  3U9Z A;  3FFK B;  2Q36 A;  3DXM A;  5TKY A;  2C1I A;  2E20 A;  2PBD A;  2KLA A;  1HKC A;  1NGJ A;  5I9E B;  4GV3 A;  3VES A;  3VEY A;  4EFH A;  2KHO A;  2NRZ A;  2OAN A;  4MDA A;  1RGI A;  4BEC A;  3ID6 A;  3SK3 A;  4QS9 A;  4CZL A;  4OO1 J;  2QA4 N;  5LY3 A;  3I8B A;  1MA9 B;  5GIN A;  5JLF A;  2QWQ A;  1OKJ A;  2VCP A;  4IXC A;  4M63 C;  5M1O A;  3VOV A;  4M7X A;  4CZF A;  5BR9 A;  4OPH A;  3A5O C;  4WF9 L;  3MK6 A;  2GEL A;  3VPZ A;  3J8A A;  1HX1 A;  4HTL A;  4K42 A;  3WUH A;  4A5A A;  5JVG L;  3CCJ N;  5EY4 A;  4JKG B;  3A0I X;  4RTF D;  2ZJQ L;  2VGN A;  3O08 A;  4GNI A;  4A62 A;  4AM6 A;  3UKR B;  3DLL L;  1T3V A;  3D2E A;  5BPL A;  2D0O A;  1X9J A;  2QXL A;  3VGK A;  3CCV N;  1SZ2 A;  3L0Q A;  5AQU A;  1DKG D;  2GEM A;  3CI5 A;  3L6Q A;  1HKG A;  3CER A;  3VGM A;  3FE1 A;  3O9S A;  3OBW A;  4MLE A;  5AQK A;  4IO8 A;  3VEX A;  4JK7 A;  2D4W A;  3MWT A;  2E2O A;  3A5M C;  3M1F A;  3GE1 A;  2BTF A;  3D7E O;  5LJV A;  5KPZ A;  1P90 A;  2NRH A;  3GBT A;  3EO3 A;  4JK8 A;  5KPT A;  4O8K A;  4MDB A;  2AA4 A;  2HOE A;  5AFU A;  1ILY A;  3KWG A;  2GX9 A;  4XH4 A;  4NB4 A;  2UYT A;  2CH6 A;  3A5L C;  5AQL A;  1V4T A;  4CI6 A;  4IEE A;  2IVO A;  3WXL A;  3DXK B;  3O9R A;  4FWM A;  4IOC L;  1IG8 A;  4JKF A;  2ASO A;  4YOR A;  1JJ2 M;  3QBX A;  3L4I A;  4FVU A;  1ZXO A;  4BQL A;  3FZH A;  4K41 A;  2HF4 A;  3I33 A;  4DHY A;  1NWK A;  2QM1 A;  4BC5 A;  3HOT A;  5DM6 L;  2QW9 A;  4BRM A;  2Q2R A;  2W40 A;  4CBU A;  5CHI A;  3QML A;  2E1Z A;  3CPE A;  5M1P A;  2ITM A;  2QEX N;  3EL2 A;  2HMP A;  3QDK A;  5GAG P;  1ESV A;  3K9J A;  2Q31 A;  1K8K A;  1BOT O;  3SBT A;  1CZA N;  2QI2 A;  5BPN A;  5KQ8 A;  4H0T B;  4YOX A;  1C0F A;  4ISG A;  2E8A A;  3FZM A;  3QIC A;  1BU6 O;  2V52 B;  3HTV A;  3TPQ A;  1YF5 L;  2VWB A;  2YHX A;  4FWK A;  4C23 A;  3O9T A;  5EXW A;  4BRF A;  3LM9 A;  4BC3 A;  1GLJ O;  3HI0 A;  4YOW A;  4IDH A;  3WQU A;  4R79 A;  3LDP A;  4H5R A;  4WFA L;  1YI2 N;  2Q97 A;  1YIT N;  4EHU A;  4JEP A;  3R8E A;  5C2D A;  4DQ8 A;  2VGM A;  3CPW M;  2QTD A;  3CHW A;  1LOT B;  3TTD A;  4OPA A;  1T6C A;  3ZET A;  5AQQ A;  2WUS A;  4GVE A;  3VEZ A;  1C0G A;  2WFB A;  3W0L A;  2BH1 A;  3AAQ A;  3MDQ A;  5AQF A;  4BRD A;  1TYQ A;  4BEB A;  1VQK N;  5C0Y A;  3F2K A;  4A2B A;  4FO0 A;  4BRK A;  3ZX3 A;  3VEN A;  4JK9 A;  4BR0 A;  5ADX A;  5GAD P;  4IFE A;  4WQ4 A;  1J6Z A;  1DT9 A;  3AAR A;  4CZI A;  3ULE B;  4UY8 O;  5AQP A;  3MCP A;  4BGB A;  4HWI A;  5KPR A;  3CQY A;  1QZ5 A;  4BR9 A;  1P8Z A;  2ZWH A;  2E2P A;  1MWM A;  3E9L A;  3T7Z A;  4BRN A;  1NGE A;  3OBY A;  5M1F A;  3PIP L;  4WQ5 C;  3QB0 A;  2JWL A;  5M1N A;  3BF3 A;  4DKW A;  3NVK A;  2ASM A;  1Q18 A;  4YOY A;  2NRT A;  2VYP A;  1NGF A;  2NRR A;  4FWN A;  4CBW A;  5C15 A;  1QQO A;  5LJW A;  3E9P A;  3H3N O;  3GDQ A;  1VAZ A;  4A57 A;  3VF4 A;  1K8A O;  3CJ7 A;  4JN4 A;  3WQT A;  1W2B M;  1JCG A;  2HBL A;  2YHW A;  2GWJ A;  3ENO A;  2CGL A;  4JKC A;  2HBJ A;  2I7N A;  2ZF5 O;  3M3Z A;  4YDU C;  2QWO A;  2P9N B;  4CZE A;  1NGH A;  2IIR A;  5BRD A;  2QWP A;  1DGK N;  4FWP A;  5AQI A;  5B8H A;  4BRI A;  1KQS M;  4BE7 B;  1NLV A;  2A3Z A;  3DWL A;  3IFR A;  2CGK A;  3CQX A;  1OVY A;  3H1V X;  4A2A A;  4BG9 A;  2ZGY A;  1NM1 A;  4H0P A;  1KAZ A;  2E1Y A;  4I6M B;  4BRG A;  2W00 A;  2NNW A;  3ENB A;  4I6M A;  4BVP A;  1U2V B;  3CCL N;  3CCS N;  4A61 A;  2QWN A;  2D1K A;  3U9D A;  4JKG A;  3C6A A;  4H5V A;  5AQT A;  1U2V A;  5AQN A;  4WQ5 A;  5AQR A;  5AQM A;  1SQK A;  4NO7 A;  3A5N C;  3UKR A;  3W3D A;  3MN7 A;  2F7T A;  2ZGZ A;  3FZK A;  1M90 O;  3CJ9 A;  3O4W A;  3ZX0 A;  5F0X A;  5FPE A;  3I56 N;  1QVF M;  3K9K A;  1HUX A;  3P39 A;  2A42 A;  3I55 N;  2YCH A;  4BR4 A;  3FGU A;  1YAG A;  2IVP A;  1BWF O;  2NRW A;  3N4Q A;  1ATR A;  4O8U A;  4BY9 C;  5JMV A;  3QBW A;  5DM7 L;  4MO4 A;  2ASP A;  1VQL N;  2RHK A;  3BUZ B;  5AFU H;  1K9M O;  3ATU A;  1KD1 O;  3SBG A;  1TUY A;  4EIA A;  4FWQ A;  3E1Y A;  1JCF A;  3RSE B;  4B1U B;  3UKU B;  2JWK A;  3QFP A;  1JCE A;  4A5B A;  5CR4 A;  2F9T A;  4U7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...