2P9UA

Crystal structure of bovine arp2/3 complex co-crystallized with amp-pnp and calcium
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
414
structure length
398
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 129
structure length 398
sequence length 414
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 2p9uA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9uA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9uA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9uA04
2GWKA 5AQOA 2EWSA 5AQFA 3DXMA 4KBOA 1GLBG 4BQLA 4H0OA 4PKHA 4BRNA 3MN5A 2QWOA 3ATUA 5AZJA 1NMDA 2V52B 4B1WB 5BRFA 2E1ZA 4BRIA 4BRPA 2BTFA 3D2FB 3RSEA 3WXJA 5EX5A 4H0XB 3GG4A 1C0GA 2P9NA 3VEZA 5F2RA 4B1YB 2QWLA 3JXUA 3O4WA 4H5NA 2D0OA 1SAZA 3SMPA 2Q31A 5BPLA 5AR0A 1NLVA 2YHXA 4DB3A 1RDWX 3LDOA 3BF3A 3A0IX 2P9IB 2FSJA 4IWVA 1HUXA 2A3ZA 2CH6A 2IVPA 5AQGA 1NGEA 1NBWA 3VEYA 1HPMA 1BDGA 3ZEUB 1TUUA 3D2FA 4BRLA 3ID8A 2QWQA 3ZETB 1R59O 1J6ZA 4Y0WA 3MCPA 3BEXA 1JCFA 1K8KB 3VETA 3ZX0A 5BRHA 2ITMA 5CE3A 5AQYA 2P9IA 1MA9B 3O8MA 1GLEG 3D2EB 1BWFO 3LL3A 3A8YA 5EXWA 4K41A 3SK3A 5AQZA 4FWOA 3VEOA 3EL2A 2A5XA 4H5WA 3ZETA 1BG3A 3EZWA 2Q2RA 2A6AA 4LC9B 3JS6A 4FSVA 1HKGA 2Q0RA 3UE5A 2QXLA 1K8KA 5E26A 2A41A 5JLHA 3M1FA 4H0VB 3CQXA 3QBWA 5KQDA 2FXUA 3D2EA 4BREA 2NLXA 2QWNA 2UYTA 3AAPA 4CZJA 4RWTA 3L0QA 2VYPA 1SQKA 3H46O 2PBDA 1V4SA 2Q36A 1QQMA 2PAVA 1LCUA 4A62A 4BR7A 1ATNA 3WXLA 3EKSA 5KPTA 1NGGA 3ULEB 1XC3A 5FPEA 3IUCA 2A42A 4BRFA 3MMVA 1HX1A 3A5OC 4YDUA 5EOYA 3WXIA 2ASPA 4BRCA 1TUYA 1T6CA 4BC2A 4WYBA 3IFRA 2GUPA 4L3QA 1RGIA 2I7PA 3VGLA 2AP1A 5AFUH 1BO5O 4PL7A 4M63C 4FL9A 2D4WA 4BRGA 4A2BA 3VOVA 3FR0A 3ULEA 2E20A 1S22A 2YJEA 3ZX3A 1GLDG 3DAWA 4EAHD 3MN9A 2YHYA 5I9EB 2YI1A 4XH1A 1BUPA 1NGJA 2BUPA 2FF6A 4IJNA 4AM6A 3HM8A 1QQOA 5EY4A 1BOTO 3O80A 4BG9A 2V7YA 3HZ6A 4HTLA 1QQNA 1E4GT 5AQJA 3SLCA 5AFUA 1MWMA 2GELA 2CH5A 2FSKA 2ASMA 3DWLA 3GBTA 3VEXA 3MDQA 1NWKA 4EIAA 4ISFA 3U9DA 1ZC6A 3HBTA 2F9WA 4FOIA 4MLEA 1OKJA 2GEMA 3UKUB 5BR9A 5F0XA 4J8FA 1YVNA 2GTDA 4H5TA 4CBUA 1BU6O 4CJ7A 1WUAA 4H0TB 3EKUA 5BN8A 2IIRA 3AY9A 4CBXA 2IVNA 3VESA 4HWIA 1NGDA 4BRHA 2V7ZA 3WT0A 2Q1NA 3BP8A 4FWNA 3S41A 3VENA 3MN6A 2DPNA 1GLLO 1HJOA 1QHAA 4IO8A 5AQKA 4BC5A 4H0YB 5AQUA 3LM9A 4WQ5C 1C0FA 4FWRA 2J4RA 5AQXA 3UKUA 4DQ8A 4CI6A 4CBWA 5KQ8A 4FWKA 3EO3A 5AQPA 3VEVA 4MLHA 4CZLA 3KVGA 3QFUA 4AM7A 3M3ZA 4CZKA 2E8AA 1YAGA 4WQ4C 3ZEUA 5JMVA 4BQZA 2A40A 5KPZA 1G99A 2FLOA 5FPNA 4K42A 4H5RA 4BVPA 1U6ZA 3MK6A 5BPMA 4FOEA 4IZ9A 3CETA 2ZGYA 4O5FA 2ASOA 4JN4A 1NGAA 4K25A 4BR5A 2QM1A 3P4IA 1QZ6A 1TYQB 1BA0A 2F9TA 1ZXOA 4DHYA 3SJHA 3FLCO 4M7XA 1RFQA 2WUSA 3CJBA 5AQRA 2E2NA 3FZKA 4MO4A 3R9PA 4K43A 3CERA 3WUHA 3I8BA 5JLFA 5EVZA 3CJ7A 4CZIA 2CGKA 4BRQA 5LJWA 1Z6RA 2QWRA 1TYQA 4JAXA 4H0PA 1E4FT 2V51B 4EFHA 3VF6A 1KAYA 2QW9A 2W40A 1LOTB 3IMXA 3DXKB 3O1WA 3CIPA 3WQUA 2H3GX 3AARA 3ATVA 3O5BA 1X3NA 2E88A 3QFPA 4ISGA 3FZLA 3EN9A 4QS8A 2GWJA 3FE1A 3R6MA 1NGBA 3U9ZA 1U2VB 2VCPA 3C7NB 4FWLA 3VF2A 1KXPA 4JD2B 3VGMA 4EHTA 2FSNA 3CHWA 5ADXH 5BN9A 3UB5A 2FF3B 1V4TA 1T6DA 3DXKA 3OHRA 1S3XA 3VF4A 2AA4A 3A5LC 3A5NC 2D1KA 3HI0A 1IJJA 4Z94A 4RCHA 1Y64A 4BGBA 1U2VA 4BGAA 2W41A 3C7NA 1NGHA 1GLFO 3GDQA 3H6EA 4FWQA 4JD2A 4WQ5A 1ZBSA 5FPMA 5LY3A 4DCHA 4BRKA 2D0PA 3FZHA 3FZMA 3H45C 2HF3A 4E1JA 1X3MA 5TKYA 4BRDA 3TPQA 4M7YA 5KPRA 4YDUC 3QDKA 2E2PA 3U4LA 5ELZA 1ATRA 2KHOA 5AQHA 4PKIA 1CZAN 1MWKA 3W0LA 4I6MB 5AZIB 1QZ5A 2QWMA 5E84A 3KZBA 2YHWA 5ADXA 4WQ4A 3WQTA 1NM1A 3H1VX 4B1UB 3LDNA 4ISEA 3R8EA 1ESVA 4BC4A 4BROA 5BRDA 4MO5A 2E2OA 1XQSC 3O08A 4PKGA 5AQSA 2P9LB 3QICA 3F9MA 4BC3A 3VPZA 4QS7A 3L4IA 1GLCG 2HOEA 4I6MA 5AZIA 3ENOA 4BR2A 4O8KA 1NGIA 3WXKA 4A2AA 2VWBA 1X9JA 2QWPA 1HKCA 1KAXA 1IG8A 4XEIA 4NO7A 5BPNA 4XH4A 3O6WA 2HMPA 5AQTA 3GL1A 3VERA 2IVOA 3CJAA 4XH5A 3SMSA 2P9LA 4BG8A 4BVOA 5AQMA 3BUZB 1HLUA 1MDUB 5F1XA 3CQYA 2P9SB 2NZTA 4CZFA 4RTFD 3CJ1A 1YXQA 3I33A 4GY2B 1T44A 4B1VA 1JCGA 4CD1A 2Q97A 3H3OB 2HF4A 4FWMA 5FPDA 4A61A 2YJFA 5BREA 3B8AX 3U8XA 3QMLA 3CJCA 4B1ZA 1GLJO 3ZX2A 1ATSA 4BR9A 3QBXA 2ZGZA 3CJ9A 2OANA 3O1BA 4EHUA 3LDQA 2P9SA 2NRHA 1DEJA 4JHDB 4F9OA 3WEEB 3H3NO 3D7EO 2E2QA 3W3DA 3FGUA 2E1YA 5AQIA 4BRAA 1KAZA 1NGCA 3J8AA 4H03B 4FPAA 2ZF5O 1BA1A 5AQNA 1DKGD 3AAQA 1WOQA 1EQYA 1YUWA 2P9UB 3A5MC 3L6QA 4JNEA 5AQQA 4CZEA 4FPBA 4C23A 3MN7A 1JCEA 1NGFA 4JHDA 3WEEA 2P9PB 1D4XA 4IJAA 3FFKB 4GNIA 2CGLA 3BF1A 1SZ2A 4QS9A 4BR4A 4CD3A 4PL8A 2ZWHA 1Q18A 3KHYA 4H5VA 5JICA 2P9KB 3LM2A 3LDPA 2I7NA 3C0BA 4IXCA 2P9UA 1HKBA 3G25A 5AQLA 3HTVA 2Q0UA 5B8HA 3DJCA 4NB4A 3HSCA 3FZFA 3GE1A 3UKRB 3LDLA 4CZGA 2YCHA 3GOIA 2CGJA 2P9PA 3TU5A 3H1QA 3VEWA 1DGKN 3DXMB 1GLAG 3CI5A 4CZMA 3M6GA 5AZJB 3QB0A 4FWPA 3VGKA 3IDHA 4FWSA 4B9QA 1H1VA 1P8ZA 4B1XB 1Z05A 3RSEB 2P9KA 2P9NB 4BRMA 5AQWA 4CZHA 5LJVA 1XUPO 4BR0A 4FO0A 3ENHA 3UKRA 5AQVA
chains in the Genus database with same CATH superfamily
4DTSA 4J2BA 4H8KA 1GLBG 3QEXA 2VQFK 3O4NA 3V1QA 4DV1K 1UAXA 3L2WA 4N41A 4CJ5A 4B1WB 4BRIA 4WFAL 3SAGA 3U3GA 3F9KA 4LF4K 2YNHA 3DLEA 5EX5A 4H0XB 1NJYA 3VEZA 5IWAK 1XC9A 3JXUA 1B9FA 3VA0A 1WSEA 2D0OA 2HVIA 4KTQA 5AR0A 2YHXA 3F73A 1EWRA 3LDOA 4M3UA 3BF3A 4E19A 4DSIA 4E7KA 1HUXA 5GAHP 2IS3A 3AVJA 3D6RA 3D2FA 3K2PA 3ID8A 4B08A 4J2AA 2E6LA 4ID5A 3M8RA 4Q0BA 3MXIA 3KJVA 1U48A 3VQ6A 1SV5A 2ITMA 4YOVA 2KKZA 4YORA 4DR4K 1BGXT 1VRTA 2P9IA 1MA9B 1GLEG 3A8YA 3E66A 3MXJA 3EL2A 4FK2A 4N47A 4FLVA 2YNIA 2A6AA 4FVMA 1Q8IA 5LL6Z 5A2QO 2HBMA 4HCBA 5FROA 4OJRA 3SAHA 4DSFA 1Q9YA 4LF8K 1WSIA 2UYTA 3AAPA 2O8EA 4FJJA 3QIPA 3QETA 4JYAK 2PBDA 1V4SA 3HOTA 1QQMA 2PAVA 3CC4N 1ATNA 3OYHA 1RILA 5CY4A 5KPTA 4ZHRA 3RMDA 4KTZA 4CVNE 1XC3A 2A42A 1YVUA 2DFFA 3SNNA 3HM9A 3BZCA 3THXA 2OTJN 1RGIA 4JKAA 2HB5A 1EX4A 4FL9A 3KKRA 2OPPA 4OLAA 2XO7A 3FR0A 3ULEA 1QQCA 2O8DB 2HHTA 3AVBA 2JGUA 1J53A 1GLDG 1UOCA 4EAHD 1BUPA 3AO3A 1HNWK 3RRGA 3ZSRA 1NNEA 1S9EA 1IV0A 3CCSN 4QCLA 3OS0A 3OYGA 2ZJQL 1HQEA 1VSMA 3ZSXA 1TKDA 2D0CA 1LWCA 3CYGA 3SUQA 5CHIA 1QQNA 1E4GT 4HVJA 2CH5A 2ASMA 3CQ8A 3OYCA 4EIAA 5J2NA 4ISFA 3J81O 1ILYA 3NH0A 4MLEA 2GEMA 2JWKA 2VG5A 1LAVA 4CJVA 5BR9A 5F0XA 1BISA 3MEGA 3JAMO 4J8FA 3CCLN 3QINA 3NDKA 2HHVA 3EKUA 1IBMK 4IG0A 4E7JA 2F96A 4CBXA 4AHVA 4HWIA 3HO1A 4CHZA 2DTUA 3MN6A 2DPNA 3LWLA 1BI4B 1UWBA 1GLLO 5AQKA 4BC5A 4CFDA 5AQUA 1JLEA 3DLLL 4E7IA 1C0FA 4FWRA 4BE0A 1IKYA 5LMUK 2J4RA 4E89A 2G8KA 4FYDA 4CBWA 1OVYA 2VG7A 4FWKA 3PX0A 3EO3A 1X9WA 3D45A 5JVHL 2NUBA 3TTDA 3LP0A 1W9HA 4DTMA 4B3SK 2DFHA 4GKKK 3P39A 3QLHA 5JMVA 5I3UA 5KPZA 1RBVA 4YOUA 1KRPA 1YJNN 4H5RA 1U6ZA 3V9XA 4CJSA 3ZSVA 4IZ9A 3HJFA 3CETA 5CYQA 3VQEA 4DFPA 2ASOA 3LP2A 4A5AA 1FKOA 3KKSA 4F8RA 1WBDA 3DI6A 5I42A 3VTIA 1VQ4N 2RN2A 2HHUA 4IEIA 5D3GA 3R9PA 2W00A 1VQON 3CERA 4KHYA 4DTJA 3C6AA 3CJ7A 4CZIA 3VQPA 4YOYA 5JS2A 1HRHA 1TYQA 4H0PA 1E4FT 2F8TA 4DFKA 3HPGA 1NKBA 3CIPA 2WC9A 2ZD1A 4JS4A 4CGJA 4FZYA 4O8UA 2O8FB 4W5NA 3H08A 1NK4A 1L3VA 4Z4HA 3DLHA 4Z4GA 2FBYA 1HYSA 3FE1A 4J2EA 4RG8A 1VSKA 2VCPA 3DOLA 3WNFA 5ADXH 4JI6K 3KLIA 1RTJA 1HNXK 4CJ3A 4G9ZA 3A5LC 4KHSA 2HNDA 1IJJA 1S1VA 4IKFA 3VQ8A 1ZBHA 2HBLA 4DQQA 1Y97A 3C7NA 4WFBL 4FWQA 1KFSA 3HOSA 2KZMA 4H4OA 5FPMA 1VSDA 4DCHA 3AVHA 1DTQA 3FZMA 5TKYA 1HJRA 4BRDA 3K0SA 1JLFA 3V1OA 2G8VA 5ELZA 2KHOA 1LWEA 4JI0K 1CZBA 1RT1A 3CXCM 3KZBA 4CK2A 5C42A 5ADXA 3WQTA 2HBJA 3HVRA 3H1VX 4CGIA 4CJTA 4BROA 5BRDA 4X65K 1XQSC 1VSIA 5GAEP 1YTAA 3RMAA 3DYAA 4RW9A 3J7AP 3SZ2A 3VPZA 3L4IA 1FJGK 2G8FA 3WXKA 1C1BA 3SQ1A 4GKJK 3OYLA 3MX5A 3T19A 3R1XA 3TAPA 4FJIA 3CJAA 3DMJA 4BVOA 4DU3A 1VQKN 5F1XA 3DM2A 3CQYA 4CEAA 2P9SB 4IG3A 4AHSA 2VGNA 1YXQA 3SPYA 2WOMA 2UUCK 4JKFA 3KWGA 4CD1A 2Q97A 1RT4A 2HF4A 3HPHA 4FWMA 4QAGA 2ZQBA 4WF9L 5C15A 2RKIA 1FXXA 4Y1DA 2UXCK 3SQ0A 1YTUA 3CJCA 3V9UA 1WB9A 3AO1A 4LH4A 2YKNA 3VQ5A 3ZLJA 1SL0A 3CJ9A 3K5OA 3O1BA 1N6QA 4EHUA 3LDQA 3O4QA 1WLJA 4HHTA 2E2QA 1KLMA 2OA8A 5FLXO 3W3DA 2O8BA 4BRAA 4H03B 2ZF5O 2JLEA 3DRSA 4GMJB 1DKGD 2ATQA 4FK4A 3L3VA 4PHTX 1QSYA 4DSKA 5JS1A 4M45A 4XIUA 3ZSWA 4Z4EA 3WEEA 4KH4A 2G8IA 1JL1A 3VQCA 3RMCA 1RTHA 1W7AA 4M3TA 4DFJA 4CD3A 1TVRA 4A5BA 5J1EA 4WE1A 3KHYA 4FW2A 3LDPA 2P9UA 1HKBA 5B8HA 2Q0UA 4KHPK 2D0BA 1IG9A 4HUFA 3DJCA 3ZSYA 3FZFA 3LDLA 3C6TA 1MU2A 4CHPA 3EYZA 3QEPA 1T03A 4F4KA 4CZMA 3M6GA 4B3RK 3AVMA 5J2PA 1QSLA 3TAGA 4Z4FA 2P9KA 2P9NB 4BRMA 4CZHA 4N76A 2P1JA 4FO0A 3ENHA 4FM0A 2C1GA 4AQYK 2GWKA 4CF8A 2X6NA 4RW7A 2ZJRL 2EHGA 5AZJA 2V52B 4MDBA 2XY5A 1CZ9A 4CEDA 1IKWA 3AVCA 3GG4A 1NJXA 2X78A 5HRPA 2QWLA 4H5NA 4LFBK 3SMPA 4R5PA 5BPLA 3PIOL 1WBBA 4DB3A 1RDWX 4CJUA 1BQMA 1IBKK 2YHAA 4IWVA 3DRRA 4KHQA 3OYKA 1RT7A 1L3UA 1NGEA 1HPMA 1BDGA 2F8SA 3CCUN 4BECA 4IOXA 3PX4A 4EP4A 2FBTA 3FFIA 1SKWA 1BCOA 1K8KB 3ZX0A 1YT3A 1BIZA 1RTDA 4K8ZA 3O8MA 5C2DA 3D2EB 3LL3A 3JSMA 5KRTA 5DM7L 4K41A 4OKJA 1K73O 4CESA 3VEOA 3PLAA 3MEDA 3ZETA 3EZWA 4WFNL 3JS6A 3C95A 2Q0RA 3UE5A 4AF1A 3VA3A 2A1RA 1XMOK 1BL3A 3M1FA 3CQXA 2RF2A 1GOCA 3QBWA 5KQDA 3L2VA 2ITGA 4M3YA 1TAQA 3OTOK 3EE9A 2QWNA 5HP1A 1U4BA 4RWTA 4PQUA 4CK1A 3QESA 2VYPA 1JKHA 2Q36A 1XMQK 4FJ7A 2OPQA 1SS6A 4A62A 4BR7A 1YHQN 4IO9L 3Q7BA 3WXLA 1JLQA 4YOTA 3ZSOA 1NGGA 2LSNA 3IG1A 5C24A 2VQEK 4CJFA 3IUCA 3A5OC 3BGRA 1A5XA 2ASPA 1T6CA 4WYBA 3IFRA 2GUPA 4H4MA 1BO5O 5AFUH 1TKZA 4M63C 3LP3A 4FZZA 1EKEA 1VSFA 4LFCK 1ZBIA 4YOXA 4F2SA 4KH6A 3NBPA 3RRHA 4M42A 3DAWA 2YHYA 4HUGA 1KFDA 2BUPA 1NGJA 3OS2A 2FF6A 2ZM6K 4IJNA 1RCHA 5LMNK 3THWB 1K6YA 4AM6A 2NNWA 4AILC 4OLBA 5EU7A 1W2BM 1I94K 1QQOA 5EY4A 1T8EA 3O80A 1HR0K 1S1XA 4HCCA 3ULDA 4HTLA 5AQJA 3MWPA 3CCJN 5AFUA 1NK0A 1X9MA 1MWMA 2GELA 3CG7A 3IS9A 4B3MK 1VQ6N 3U9DA 2G8WA 1ZC6A 1VSJA 3HBTA 2A1SA 4FOIA 4JK9A 1OKJA 3QEIA 1C6VA 1Z26A 2GTDA 1Q81O 4DR7K 1WUAA 2FC0A 3AGKA 1M1KO 5C25A 3C6UA 3L3UA 2RE2A 3VESA 3QO9A 1NGDA 4BRHA 4FJMA 2Q1NA 3BP8A 3HVTA 3ID6A 3S41A 3VENA 2D0AA 4H0YB 3QNOA 3LM9A 4GV3A 4DS4A 5AQXA 3UKUA 5KQ8A 4DR3K 3OYMA 5AQPA 3VQAA 2C1IA 1EXQA 3RTVA 1D9DA 3M3ZA 1J5EK 1HYZA 1C1AA 2E8AA 3ZEUA 4BQZA 3PY8A 3MK6A 1TAUA 4IOAL 4FLUA 4I7FA 3AA3A 4BR5A 2QM1A 4CFCA 3SAFA 1F21A 3QNNA 3L2RA 2KLAA 4KV8A 5M1OA 4CGHA 3QIOA 1ZXOA 2OZSA 4JI2K 4C8LA 4K8XA 1RFQA 4K0KK 3O9RA 1LV5A 3CJBA 1RDDA 3FZKA 1X1PA 2UXDK 4MFBA 4BEBA 2CGKA 4BRQA 3TSUA 4BACA 3HP9A 4JAXA 3RMBA 4EFHA 3VF6A 1KAYA 2W40A 5SZTA 4EZ6A 2Y1JA 3IMXA 3DXKB 3O1WA 3ATVA 1OH7A 1D9FA 1X3NA 4IEEA 2E88A 2B5JA 4B3TK 3EN9A 4NXNK 4ZTJA 2HHQA 1KD1O 2GWJA 1NGBA 4BE7B 3NVKA 1JLGA 5SWMA 3CF5L 4KFBA 4IBNA 2FSNA 3AVAA 5M1KA 2WONA 3UB5A 3M8QA 5MLCQ 2QK9A 2YNFA 1L5UA 3VF4A 4KHUA 3A5NC 1RDCA 1VHXA 3AVFA 3HI0A 4Z94A 4DG1A 2FBXA 2BDPA 2EX3A 3O3HA 1Y64A 3VTHA 3SV4A 4BGBA 1U2VA 3TAMA 4BGAA 3IKMA 1YJ9N 1NGHA 2PFUA 1YF5L 4JD2A 1ZBSA 4V19S 1ZBFA 4HTUA 3A2FA 2D0PA 3FZHA 3H45C 3TABA 2HF3A 1X3MA 3TPQA 3K5MA 2Z1IA 3QDKA 3U4LA 3NCIA 5AZIB 1QZ5A 1S1TA 1NK7A 4NCGA 4WQ4A 3OYEA 1NM1A 4B1UB 3LDNA 3NHGA 1B9DA 3R8EA 4UQGA 3O08A 3SCXA 4PKGA 5AQSA 4DV6K 3F9MA 2I5JA 3KLGA 3L2UA 1WN7A 3AVNA 2W6LA 3S3MA 4I6MA 4PUOA 4NYFA 3WXMB 4A2AA 4DTNA 1X9JA 3TI0A 3ASMA 1HNIA 1U04A 4XEIA 1SL2A 3E9LA 3S5TA 1N32K 2B6AA 2P9LA 5AQMA 5JVGL 4OPAA 1QVFM 2DFEA 4W5TA 5T7BA 4CZFA 4RTFD 4L8RB 1E3MA 3CJ1A 2Q3SA 4CF2A 1XI1A 3H3OB 3K5LA 5CZ1A 5FPDA 4A61A 5BREA 1TK8A 2P5GA 4DF8A 4BR9A 3QBXA 4I9QA 1N36K 1EP4A 4A59A 4JHDB 3KK3A 1DEJA 3H3NO 2KZZA 3FGUA 3NVMA 3V9SA 2WTUA 4FPAA 1DTTA 2W6KA 3M8PA 1TK5A 5FRNA 4OGCA 5AQNA 1YUWA 1EQYA 4ELVA 3L6QA 4OX9K 1NK5A 4CZEA 3TTFA 4Z0UA 4FPBA 4JS5A 1I39A 1FW6A 3MN7A 2QXFA 4B9MA 1JCEA 3S3OA 4JI7K 1IO2A 3VQDA 1KLNA 3BF1A 4QS9A 4BR4A 1HNZK 1WSJA 1S6QA 4DS5A 3V1RA 2ZWHA 4CEOA 5JICA 3OBWA 2HHSA 4IXCA 4YHHK 1SKSA 2XY6A 2Z1JA 2KFZA 4LY7A 3LP1A 2UUBK 3NE6A 5M1QA 3O9TA 1KCFA 3F2KA 3GOIA 3H1QA 2P9PA 5GIOA 5AJ3K 3C6HA 5J2QA 5J2MA 1XWLA 3QB0A 3VGKA 4PWDA 4FWSA 2O8CA 4B9QA 4FJGA 2XRIA 4CFAA 3OJSA 4X64K 3NF8A 1XUPO 4BR0A 4CEQA 4DR1K 3UKRA 4AHCA 5IT9O 4CECA 5AQOA 1QSSA 5AQFA 3DXMA 4KBOA 4CF9A 3HYFA 5DM6L 2QWOA 4FXDA 1NMDA 5DMRA 4FM2A 2E1ZA 3TSPA 3D2FB 3RSEA 4KHNA 3TSQA 3O4WA 1J54A 4OO1J 1NJIO 2Q31A 4DV0K 4FVUA 1NLVA 5HRSA 3P31A 2VWKA 4IDHA 3J80O 4DTPA 3A0IX 3O9SA 4DQSA 2P9IB 1VSEA 4BDPA 2IVPA 5AQGA 2KTQA 1A5WA 3HPOA 1NBWA 1DT9A 1VRUA 3ZEUB 1TUUA 4BRLA 4JI1K 1K9MO 3OYNA 3HK2A 1R59O 1WSFA 3V9WA 4Y0WA 3LAMA 3MCPA 3T69A 4LFAK 3ITHA 1VSLA 3TARA 3M8SA 1U49A 3IAYA 4ID1A 3CC7N 3AA2A 3SI6A 1HPZA 4KB1A 1K8AO 4JI4K 4IDKA 4DTOA 1BWFO 1W0HA 4ILJA 1VQ8N 5HOOA 3MX2A 5AQZA 1VQPN 4FWOA 2O8EB 3MCAB 3NFAA 2A5XA 4DU1A 1KVCA 4NYNA 1BG3A 2Q2RA 3NAEA 4LC9B 3PO5A 2HVHA 4FSVA 1A5VA 1HKGA 1L3TA 2QXLA 1NOYA 4KI4A 1CXQA 2NRZA 5K14A 2A41A 3RWUA 3SUNA 4H0VB 3KLHA 1I3AA 4LF9K 1DLOA 4ELTA 3ALYA 1HNVA 3T1AA 5KRSA 3PSFA 3K9JA 3THXB 4F3OA 4CZJA 4CGFA 3RVCA 3N4PA 1IKVA 3G10A 2IGIA 3O9UA 4CJEA 1LW0A 1REVA 1B92A 3ULEB 5FPEA 4DFMA 5HRRA 3MECA 2HSTA 3EZ5A 1NMNA 1TUYA 1ASVA 4I2QA 4KKOA 3ZSQA 4CIEA 3OYFA 2I7PA 3VGLA 2AP1A 1ZBUA 5C12A 4PL7A 4A57A 3F5TA 4AHRA 4BRGA 2WBNA 4A2BA 5GAGP 1RT3A 3VOVA 2VWJA 1S22A 2YJEA 4B3OA 3KD1E 4CJLA 4X62K 4I2PA 2QKKA 4XH1A 3ZT0A 4IFVA 5GIPA 4FJ8A 3O3GA 4CK3A 3ENBA 2NRWA 4W5RA 4JI8K 4OVLA 4CEEA 2IC3A 4CERA 2V7YA 1N34K 1EO1A 5HLFA 3C94A 4DMNA 3SLCA 4FCYA 2YHBA 3NGZA 3VMFB 2FSKA 3GBTA 3P83D 1NWKA 3HSTB 4JKGA 1XNQK 2GX9A 2F9WA 3DLGA 4O44A 4FJHA 4CE9A 1NKCA 1VAZA 1YVNA 3CCVN 4F3TA 4NLBA 2ZJPL 4CJKA 2QA4N 1NOZA 4H0TB 4FJLA 2IIRA 3AY9A 1VQNN 3OYIA 1TL3A 4CF1A 3ZCMA 2HBKA 4FK0A 3ZT2A 1HJOA 1QHAA 3NF7A 4KTWA 1YJWN 3D0PA 4DQ8A 4CI6A 3WNGA 3B6OA 3SJJA 1NK8A 3VEVA 4BWJA 3K59A 4B9UA 4FJXA 4MLHA 4CZLA 1JXBA 1NJWA 3ZYYX 3K57A 4CZKA 4CJQA 3NGYA 4WQ4C 4C1NK 1BI4A 2A40A 3R3LA 1G99A 3MXMA 2OTLN 4BVPA 5BPMA 4FOEA 2ZGYA 3RR8A 4O5FA 2XY8A 1VQ7N 1VK0A 1S6PA 4DSLA 1QZ6A 1TYQB 1BA0A 2F9TA 4G1QA 4DHYA 4YNQA 2IAJA 4M7XA 3CM6A 3Q7CA 2E2NA 4MO4A 4K43A 4DV3K 4LH5A 4GVMA 4CCHA 1Q9XA 5LJWA 5M1NA 1RBRA 1Z6RA 5C2FA 4O0IA 3M5RA 2QWRA 4U67L 2V51B 3LZIA 4ILHA 4MDAA 4DUYK 5CYMA 3AARA 4GV9A 1CXUA 4JKCA 3ISNC 3O5BA 4DQRA 1OH5A 4IFEA 2YV0X 4ISGA 3FZLA 2KFNA 1ZYQA 3U9ZA 3R6MA 4M3XA 4BY9C 3NMUA 3C7NB 3OYDA 4E7HA 3N4QA 3VGMA 2O8CB 3I55N 4FJNA 5BN9A 3DLBA 1RBUA 4JKEA 4FJKA 1T6DA 2W42A 4CJPA 2AA4A 4DSEA 4Z4CA 4ICLA 2O8FA 1S5JA 4JK8A 1S1WA 1LW2A 1FK9A 4BE2A 3BDPA 2W41A 1R0AA 3OYBA 3PO4A 3H6EA 4WQ5A 5LY3A 4Z4IA 3E01A 3SV3A 4BRKA 4ELUA 4JI3K 1JL2A 5KGWA 4W5QA 4M7YA 3J7YP 4LSLA 4YDUC 2BANA 3CFOA 5AQHA 1MWKA 4NLCA 1S9GA 2QWMA 4BDZA 3VQ7A 5KTQA 2YHWA 2HMIA 4XJXA 4E1NA 4DTXA 1JJ2M 5FDLA 1NKEA 3RR7A 3NGIA 3MEEA 1ESVA 3AO5A 4MO5A 2E2OA 1HQUA 4OKEA 3SQ2A 4B9NA 3QICA 4KREA 1BHLA 4BC3A 2KQ2A 2IDOA 1WSGA 4DQIA 4KHWA 1TGOA 2HOEA 4GV6A 3SBTA 1NGIA 2OZMA 5KI6A 2HHXA 4LF7K 2VWBA 2UU9K 3SUPA 4IOCL 4RW6A 1KAXA 4DKWA 1TL1A 4XH4A 3CCRN 4DLGA 3O6WA 2HMPA 2YKMA 1TK0A 3I0RA 5AQTA 1JXEA 3VERA 4XH5A 3SMSA 4BG8A 3I0SA 3KTQA 4E3SA 1MDUB 3AO4A 2HHIA 3AA4A 1NJZA 1NG9A 3CCMN 4RW4A 3I33A 4GY2B 2X6SA 2O8BB 1T44A 3ZT4A 1JCGA 3VQBA 2E6MA 4GVEA 4WCEL 1KSPA 4KI6A 2YJFA 4FJ9A 4LD0A 3B8AX 3WNEA 3U8XA 4B1ZA 1P90A 1GLJO 1O1WA 3ZX2A 1ATSA 1JLCA 1NK6A 2YX6A 2ZGZA 3CCEN 1QVGM 3P5JA 3I56N 2P9SA 2NRHA 4CJWA 3T3FA 3KK7A 1G15A 3WEEB 3D7EO 4DV4K 4C1NI 4C8OA 2E1YA 1KAZA 1NGCA 3J8AA 1RT5A 3CPWM 1BA1A 4FLZA 3AAQA 4Q5VA 3A5MC 2P9UB 4FLWA 3LPUA 3V9ZA 1YITN 2NRVA 1NGFA 4DV7K 2Y1IA 4IJAA 3NH1A 4FZXC 3DOKA 4OPJA 3QEVA 1SUQA 4E72A 1NK9A 4OGEA 1XNRK 4KRFA 4M41A 2P9KB 3TANA 3LM2A 2Z1HA 3KK1A 3G25A 5AQLA 4NB4A 2G8HA 4CZGA 2CGJA 1GLAG 5C0YA 5AZJB 2JWLA 1H1VA 1P8ZA 4B1XB 1Z05A 4JKGB 4DR5K 5AQWA 5CR4A 1TKXA 5LJVA 2D5RA 3O3FA 5TKWA 4ZTFA 1RDUA 4F9OA 2B4JA 1RT2A 2EWSA 3AGRA 1U45A 1SL1A 4BQLA 1RTIA 4H0OA 3VQ9A 4PKHA 4BRNA 1RDAA 3MN5A 3ATUA 4KB0A 3KLEA 5BRFA 4BRPA 3IRXA 2BTFA 1VQMN 3WXJA 3OW2M 3V81A 1WAFA 1C0GA 2P9NA 4U7BA 5F2RA 2OPSA 4B1YB 4UY8O 4CEFA 3VN5A 3LZJA 4M3RA 3OJUA 4FW1A 3KIOA 2F7TA 4DU4A 3CFPA 4DV2K 1SAZA 3CD6N 2FSJA 1LAWA 2DY4A 4O5BA 2A3ZA 4O4GA 2CH6A 3NH2A 4B8AB 3VEYA 3B6PA 4B8CA 2QWQA 3ZETB 3LAKA 3HT3A 2UXBK 1J6ZA 1KVBA 2GV9A 3BEXA 1JCFA 3VETA 4YY3K 1FKPA 1Q82O 1J5OA 2PYLA 5BRHA 5H1SQ 5CE3A 2OPRA 3KD5E 2OYQA 5AQYA 4QOZB 4CFBA 5EXWA 3SK3A 2RHKA 4KAZA 3MWTA 3HRGA 2QKBA 4CIFA 3AVGA 2GBZA 1X9SA 1GOAA 4H5WA 3SQ4A 1C0UA 4JLHA 4BE1A 1K8KA 3EY1A 5E26A 3PV8A 5JLHA 2HNZA 3OBYA 3L8BA 1ASWA 2FXUA 3D2EA 4BREA 2NLXA 2YNGA 1L3SA 4J2DA 3CCQN 3L0QA 2OCEA 1SQKA 3OS1A 3H46O 2RPIA 1LCUA 4BDYA 3LPTA 1ASUA 3U6FA 1T3VA 2E4LA 4CHOA 4CJRA 3EKSA 3PIPL 3TR8A 5HROA 4GW6A 4C8NA 2AJQA 2O4GA 4BRFA 3MMVA 1HX1A 5EOYA 4YDUA 5CZ2A 3WXIA 4PY5A 2HHHK 4BRCA 4FLYA 3OY9A 4BC2A 3LWMA 1T05A 4L3QA 1WNSA 4ILGB 3LALA 3NF6A 3CYMA 3CM5A 3V4IA 2D4WA 1JLAA 3V6DA 5E41A 2E20A 3ZX3A 4CHQA 4CW7B 1O13A 3UIQA 3MN9A 5I9EB 2YI1A 1W97L 3THYA 2KW4A 1YI2N 3SBGA 2NRXA 3HM8A 4DSJA 2NRTA 1BOTO 1UA1A 4M3WA 4BG9A 4N56A 3OA9A 3EEQA 4JRQA 3DLKA 3HZ6A 3O9QA 4FJ5A 3TTCA 4KH5A 4JKBA 3DWLA 3VEXA 3PUFA 3MDQA 3CFRA 3OYAA 4FLTA 3KLFA 3THWA 3UKUB 3AV9A 3TAQA 4CEZA 4H5TA 2VG6A 4CBUA 2ETJA 2XHBA 1BU6O 1HYVA 4CJ7A 4DV5K 5BN8A 1N33K 2IVNA 4X66K 1OVQA 2V7ZA 3WT0A 4FWNA 4IO8A 4MQ3A 1M90O 4KPYA 3P1GA 4JI5K 4KO0A 4WQ5C 1QE1A 4C8KA 5HRNA 4CF0A 3ZSZA 3BY5A 4RW8A 3KVGA 4FM1A 3QFUA 2BGGA 4AM7A 4BWMA 5JENA 4YOWA 1KVAA 3E9PA 4OPHA 2PY5A 1YAGA 5DK5A 1S1UA 2FLOA 5FPNA 1Q7YO 1CLQA 4K42A 3LANA 3LDSA 3DLRA 1LWFA 4OPKA 4JN4A 1NGAA 4K25A 3P4IA 1GOBA 1U47A 4JV5K 2ZE2A 4HUEA 3SJHA 3FLCO 2WUSA 2QEXN 2QI2A 5AQRA 1RBTA 3T1HK 4AHUA 2NRRA 3L4QA 2O4IA 1WAJA 3WUHA 3I8BA 5JLFA 3K58A 5EVZA 3SUOA 3C65A 4LF6K 4JKHA 1SKRA 1RBSA 2QW9A 1LOTB 3AA5X 2XY7A 3CMAN 4IFYA 3WQUA 2H3GX 4O0JA 3HP6A 3QFPA 3THVA 4QS8A 4CIGA 4TSXA 4NCAA 4B9VA 4E1MA 1U2VB 3VF2A 4FWLA 4DTUA 4CHNA 2WFBA 1KXPA 4JD2B 1ITGA 4JKDA 1EETA 4AH9A 4EHTA 3CHWA 1QHTA 5HBMA 2FF3B 1V4TA 4CJ4A 2P51A 3DXKA 3PSIA 3OHRA 1S3XA 2Z1GA 4C8MA 1BCMA 2D1KA 1WSHA 3QEWA 1XHXA 5C10A 4E7LA 1IKXA 3EE8A 1EWQA 4RCHA 1IH7A 3KK2A 2E5LK 1C1CA 2O8DA 4OKKA 5KGXA 3G0ZA 1GLFO 3GDQA 1VQ9N 1QS4A 3OYJA 2QTDA 4E1JA 3MAQA 3T7ZA 4CEBA 5KPRA 2E2PA 3TWHA 1ATRA 3TAFA 1D8YA 4PKIA 1CZAN 3W0LA 4I6MB 5E84A 4FLXA 4NCBA 1TV6A 3CC2N 4ISEA 4BC4A 4M3ZA 4DUZK 4E0DA 4JRPA 3TAEA 2P9LB 2UUAK 3WNHA 4W5OA 3AO2A 4QS7A 1GLCG 4DQPA 2BE2A 3NF9A 3ENOA 5AZIA 1RDBA 4BR2A 3S9HA 4O8KA 1KQSM 4B9TA 4DLEA 2QWPA 1HKCA 3CMEN 2F4VK 4NO7A 1IG8A 5BPNA 2BH1A 3SPZA 1ZBLA 4DWIA 3GL1A 2HW3A 2IVOA 1UA0A 4CHYA 4EP5A 3BUZB 1HLUA 5HL7L 1Q86O 2G8UA 2NZTA 4F2RA 3K5NA 4Y1CA 3L2QA 1KTQA 4O55A 4JEPA 3VQQA 3J7ZO 4DR6K 4B1VA 5M1PA 1C0TA 5GADP 2HNYA 4R79A 4NXMK 1QTMA 3U3YA 1JLBA 4YFUA 3G4SN 4DTRA 3QMLA 4N5SA 4LF5K 3G6EN 4AHTA 1S72N 1XHZA 3DRPA 3HXMA 1TKTA 4JK7A 3JYTA 3T1YK 2OANA 4LSNA 3BZKA 3VQ4A 1OH6A 1RNHA 3AVIA 3KWIA 5AQIA 2IOCA 1NU0A 4DR2K 3E9OA 1KC8O 2X74A 4B9SA 1OH8A 3P38A 1VQ5N 1Z25A 3E1YA 3QERA 1WOQA 3ZT3A 2PYJA 4JNEA 1N8RO 5AQQA 4C23A 1N5YA 1RT6A 4JHDA 2P9PB 3ZT1A 1D4XA 1C0MA 3FFKB 4GNIA 2CGLA 4CGGA 5BR8K 1HMVA 1SZ2A 1VSHA 4PL8A 1Q18A 4H5VA 5GINA 3THYB 1T7PA 3K9KA 4I9LA 2VGMA 2FBVA 3G71N 2I7NA 3C0BA 1BIUA 2R7YA 4B9LA 4EZ9A 3HTVA 3CPEA 3SYZA 5M1FA 3HSCA 1YIJN 3GE1A 3UKRB 2YCHA 2HHWA 3AVKA 3VEWA 3TU5A 2PZSA 1DGKN 3DXMB 1BQNA 3S3NA 4DF4A 3CI5A 1IBLK 3I8DA 4FWPA 3IDHA 2GUIA 4CGDA 5FRMA 1D5AA 3RSEB 4PA1A 3PX6A 3OVNA 2P5OA 3HL8A 1VQLN 1J9AA 3AVLA 5AQVA
chains in the Genus database with same CATH topology
2GWKA 5AQOA 2EWSA 3AGRA 5AQFA 3DXMA 4KBOA 1GLBG 4BQLA 4H0OA 4PKHA 5DM6L 4BRNA 3MN5A 2QWOA 3ATUA 5AZJA 2ZJRL 1NMDA 2V52B 4MDBA 4B1WB 5BRFA 2E1ZA 4BRIA 3TSPA 4BRPA 2BTFA 4WFAL 1VQMN 3SAGA 3D2FB 3RSEA 3WXJA 3OW2M 5EX5A 4H0XB 3GG4A 1C0GA 2P9NA 3VEZA 5F2RA 4U7BA 4B1YB 4UY8O 2QWLA 3JXUA 3TSQA 3O4WA 2F7TA 4H5NA 2D0OA 4OO1J 1SAZA 1NJIO 3SMPA 2Q31A 5BPLA 5AR0A 1NLVA 4FVUA 3PIOL 2YHXA 3P31A 3CD6N 4IDHA 4DB3A 1RDWX 3LDOA 3BF3A 3A0IX 3O9SA 2P9IB 2FSJA 4IWVA 1HUXA 5GAHP 2A3ZA 3D6RA 2CH6A 2IVPA 5AQGA 1NGEA 1NBWA 3VEYA 1DT9A 1HPMA 1BDGA 3ZEUB 1TUUA 3D2FA 4BRLA 3ID8A 2QWQA 1K9MO 3ZETB 3CCUN 4BECA 1R59O 4IOXA 1J6ZA 4Y0WA 3MCPA 3T69A 3BEXA 1JCFA 1K8KB 3VETA 3CC7N 1Q82O 3ZX0A 5BRHA 2ITMA 5H1SQ 4YOVA 1K8AO 5CE3A 2KKZA 4YORA 5AQYA 2P9IA 1MA9B 3O8MA 1GLEG 3D2EB 1BWFO 3LL3A 5C2DA 3A8YA 4ILJA 5EXWA 5DM7L 4K41A 5HOOA 3SK3A 1VQ8N 3MX2A 5AQZA 1K73O 3E66A 4FWOA 1VQPN 2RHKA 3VEOA 3PLAA 3EL2A 3HRGA 3MCAB 3MWTA 2A5XA 4H5WA 3ZETA 1BG3A 3EZWA 2Q2RA 2A6AA 4LC9B 4WFNL 3JS6A 4FSVA 1HKGA 2Q0RA 3UE5A 4AF1A 2QXLA 1K8KA 2NRZA 2HBMA 5E26A 2A41A 5JLHA 3M1FA 4H0VB 3CQXA 3SAHA 3OBYA 3QBWA 5KQDA 2FXUA 3D2EA 4BREA 2NLXA 3EE9A 2QWNA 2UYTA 3AAPA 3K9JA 4CZJA 4RWTA 3CCQN 3L0QA 2VYPA 3RVCA 1SQKA 3H46O 2PBDA 1V4SA 3N4PA 2Q36A 3HOTA 1QQMA 2PAVA 1LCUA 1SS6A 3O9UA 4A62A 1T3VA 4BR7A 1YHQN 4IO9L 3CC4N 1ATNA 3Q7BA 3WXLA 3EKSA 4YOTA 5KPTA 1NGGA 3PIPL 3ULEB 1XC3A 5FPEA 3IUCA 2A42A 4BRFA 3MMVA 1HX1A 3A5OC 4YDUA 5EOYA 3WXIA 1VQ9N 2HSTA 2ASPA 4BRCA 1TUYA 1T6CA 4BC2A 4WYBA 3IFRA 2GUPA 4L3QA 2OTJN 4ILGB 1RGIA 2I7PA 3VGLA 4JKAA 2AP1A 5AFUH 1BO5O 5C12A 4PL7A 4A57A 4M63C 3F5TA 4FL9A 2D4WA 4BRGA 2WBNA 4A2BA 5GAGP 3VOVA 3FR0A 3ULEA 2E20A 1S22A 2YJEA 3ZX3A 4YOXA 1O13A 1GLDG 4KH6A 3DAWA 4EAHD 3MN9A 2YHYA 5I9EB 2YI1A 4XH1A 1BUPA 1NGJA 2BUPA 1W97L 2FF6A 5GIPA 1YI2N 4IJNA 3CCSN 4AM6A 2NNWA 3ENBA 2NRWA 3SBGA 2NRXA 2ZJQL 3HM8A 1W2BM 2NRTA 1QQOA 5EY4A 1BOTO 3O80A 4BG9A 3OA9A 2V7YA 3HZ6A 3O9QA 4HTLA 5CHIA 1EO1A 3TTCA 1QQNA 1E4GT 5AQJA 3MWPA 4KH5A 3SLCA 5AFUA 3CCJN 1MWMA 3VMFB 2GELA 4JKBA 2CH5A 2FSKA 2ASMA 3DWLA 3GBTA 3VEXA 3MDQA 1NWKA 1VQ6N 4EIAA 4JKGA 4ISFA 3U9DA 1ZC6A 3HBTA 1ILYA 2GX9A 2F9WA 4FOIA 4JK9A 4MLEA 1OKJA 2GEMA 2JWKA 3UKUB 5BR9A 5F0XA 1VAZA 4J8FA 1YVNA 2GTDA 4H5TA 3CCVN 3CCLN 1Q81O 4CBUA 4NLBA 2ZJPL 1BU6O 4CJ7A 2QA4N 1WUAA 4H0TB 3EKUA 3AGKA 5BN8A 2IIRA 3AY9A 1M1KO 1VQNN 4CBXA 2IVNA 2RE2A 4HWIA 3VESA 1NGDA 4BRHA 2V7ZA 3WT0A 2Q1NA 3BP8A 3ID6A 4FWNA 2HBKA 3S41A 3MN6A 2DPNA 3VENA 1GLLO 1HJOA 1QHAA 4IO8A 1M90O 5AQKA 4BC5A 4H0YB 5AQUA 3LM9A 3DLLL 4GV3A 4WQ5C 1C0FA 4FWRA 1YJWN 2J4RA 5AQXA 3UKUA 4DQ8A 4CI6A 4CBWA 5KQ8A 1OVYA 4FWKA 3EO3A 5AQPA 3VEVA 4MLHA 4CZLA 3KVGA 2C1IA 3QFUA 4AM7A 3ZYYX 5JVHL 3TTDA 4YOWA 3M3ZA 4CZKA 3E9PA 2E8AA 3P39A 4OPHA 1YAGA 4WQ4C 3ZEUA 5JMVA 4C1NK 4BQZA 2A40A 3R3LA 5KPZA 1G99A 2FLOA 4YOUA 5FPNA 1Q7YO 4K42A 2OTLN 1YJNN 4H5RA 4BVPA 1U6ZA 3MK6A 4IOAL 5BPMA 4FOEA 4IZ9A 3CETA 2ZGYA 4O5FA 2ASOA 4JN4A 4A5AA 1NGAA 4K25A 1VQ7N 4BR5A 2QM1A 3P4IA 3SAFA 1QZ6A 1TYQB 1BA0A 2F9TA 2KLAA 5M1OA 1ZXOA 3VTIA 3SJHA 3FLCO 4DHYA 1VQ4N 4M7XA 1RFQA 3Q7CA 3O9RA 2WUSA 2QEXN 3CJBA 2QI2A 4IEIA 5AQRA 2E2NA 3FZKA 4MO4A 3R9PA 4K43A 2W00A 2NRRA 3L4QA 1VQON 3CERA 3WUHA 3I8BA 5JLFA 5EVZA 4BEBA 3C6AA 3CJ7A 4CZIA 2CGKA 4BRQA 5LJWA 3TSUA 1Z6RA 5M1NA 4YOYA 3C65A 5C2FA 3M5RA 4JKHA 2QWRA 1TYQA 4JAXA 4H0PA 1E4FT 4U67L 2V51B 4EFHA 3VF6A 1KAYA 2QW9A 2W40A 1LOTB 3IMXA 4ILHA 3DXKB 4MDAA 3O1WA 3CIPA 3CMAN 3WQUA 2WC9A 2H3GX 3AARA 3ATVA 4GV9A 4JKCA 3O5BA 1X3NA 4IEEA 2E88A 4O8UA 3QFPA 4IFEA 4ISGA 3FZLA 3EN9A 4QS8A 1KD1O 2GWJA 3FE1A 3R6MA 1NGBA 3U9ZA 4BY9C 4BE7B 1U2VB 3NVKA 3NMUA 2VCPA 3C7NB 4FWLA 3VF2A 3CF5L 2WFBA 1KXPA 4JD2B 4JKDA 3N4QA 3VGMA 4EHTA 2FSNA 3CHWA 5ADXH 5M1KA 3I55N 5BN9A 3UB5A 2FF3B 1V4TA 4JKEA 1T6DA 3DXKA 5MLCQ 3OHRA 1S3XA 3VF4A 4G9ZA 2AA4A 3A5LC 3A5NC 2D1KA 3HI0A 1IJJA 5C10A 3EE8A 4Z94A 4JK8A 4RCHA 2HBLA 1Y64A 3VTHA 4BGBA 1U2VA 4BGAA 1YJ9N 2W41A 3C7NA 3IKMA 1NGHA 2PFUA 1YF5L 1GLFO 3GDQA 3H6EA 4FWQA 4JD2A 4WQ5A 4WFBL 1ZBSA 3HOSA 5FPMA 5LY3A 4DCHA 2QTDA 4BRKA 2D0PA 3FZHA 3FZMA 3H45C 2HF3A 4E1JA 1X3MA 5TKYA 3T7ZA 3TPQA 4BRDA 4M7YA 5KPRA 4YDUC 3QDKA 2E2PA 3U4LA 5ELZA 1ATRA 2KHOA 5AQHA 4PKIA 1CZAN 1MWKA 3W0LA 4I6MB 4NLCA 5AZIB 1QZ5A 2QWMA 5E84A 3CXCM 3KZBA 2YHWA 5ADXA 4WQ4A 3WQTA 4XJXA 1NM1A 2HBJA 3CC2N 3H1VX 4B1UB 3LDNA 1JJ2M 4ISEA 3R8EA 1ESVA 4BC4A 4BROA 5BRDA 4MO5A 2E2OA 1XQSC 3O08A 4PKGA 5GAEP 5AQSA 2P9LB 3QICA 3F9MA 4BC3A 3VPZA 4QS7A 3L4IA 1GLCG 2HOEA 4GV6A 4I6MA 5AZIA 3SBTA 3ENOA 4BR2A 4O8KA 1NGIA 3WXKA 1KQSM 3WXMB 4A2AA 2VWBA 4IOCL 1X9JA 2QWPA 1HKCA 3CMEN 1KAXA 1IG8A 4XEIA 3MX5A 4NO7A 4XH4A 4DKWA 5BPNA 3R1XA 3CCRN 3E9LA 3O6WA 2BH1A 2HMPA 5AQTA 3GL1A 3VERA 2IVOA 3CJAA 4XH5A 3SMSA 2P9LA 4BG8A 4BVOA 1VQKN 5AQMA 3BUZB 1HLUA 1MDUB 5F1XA 5JVGL 5HL7L 4OPAA 1Q86O 1QVFM 3CQYA 2P9SB 2NZTA 4CZFA 4RTFD 2VGNA 3CJ1A 3CCMN 1YXQA 3I33A 4GY2B 4JEPA 3J7ZO 1T44A 4JKFA 4B1VA 3KWGA 5M1PA 1JCGA 4CD1A 5GADP 2Q97A 3H3OB 4R79A 4GVEA 4WCEL 2HF4A 4FWMA 5FPDA 4A61A 2YJFA 4WF9L 5C15A 5BREA 3G4SN 3B8AX 3U8XA 3QMLA 3CJCA 4B1ZA 3G6EN 1P90A 1GLJO 3ZX2A 1ATSA 1S72N 2YX6A 4BR9A 4JK7A 3QBXA 2ZGZA 3CCEN 3CJ9A 2OANA 1QVGM 3O1BA 4EHUA 3LDQA 4A59A 2P9SA 2NRHA 1DEJA 4JHDB 3KK7A 4F9OA 3WEEB 3I56N 3H3NO 3D7EO 2E2QA 3W3DA 4C1NI 3FGUA 2E1YA 3NVMA 3KWIA 5AQIA 4BRAA 1KAZA 1NGCA 3J8AA 4H03B 4FPAA 2ZF5O 3E9OA 3CPWM 1KC8O 1BA1A 3P38A 1VQ5N 5AQNA 1DKGD 3AAQA 3E1YA 1WOQA 1EQYA 1YUWA 2P9UB 3A5MC 3L6QA 4JNEA 1N8RO 5AQQA 4PHTX 4CZEA 3TTFA 4FPBA 1YITN 4C23A 3MN7A 1JCEA 2NRVA 1NGFA 4JHDA 3WEEA 2P9PB 4KH4A 1D4XA 4IJAA 3FFKB 4GNIA 2CGLA 3BF1A 1SZ2A 4QS9A 4BR4A 4CD3A 4PL8A 4A5BA 2ZWHA 1Q18A 3KHYA 4H5VA 5GINA 5JICA 2P9KB 3K9KA 2VGMA 3OBWA 3G71N 3LM2A 3LDPA 2I7NA 3C0BA 4IXCA 2P9UA 1HKBA 3G25A 5AQLA 3HTVA 2Q0UA 5B8HA 3CPEA 3DJCA 4NB4A 5M1FA 3HSCA 1YIJN 3FZFA 3GE1A 3UKRB 3LDLA 5M1QA 3O9TA 4CZGA 2YCHA 3F2KA 3GOIA 2CGJA 2P9PA 3TU5A 3H1QA 3VEWA 5GIOA 1DGKN 3DXMB 1GLAG 3C6HA 3CI5A 4CZMA 3M6GA 5C0YA 5AZJB 3QB0A 4FWPA 3VGKA 2JWLA 3IDHA 4FWSA 4B9QA 1H1VA 1P8ZA 4B1XB 1Z05A 3RSEB 2P9KA 4JKGB 2P9NB 4BRMA 5AQWA 4CZHA 5CR4A 1VQLN 5LJVA 1XUPO 5TKWA 4BR0A 4FO0A 1RDUA 3ENHA 2C1GA 3UKRA 5AQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GWK A;  5AQO A;  2EWS A;  5AQF A;  3DXM A;  4KBO A;  1GLB G;  4BQL A;  4H0O A;  4PKH A;  4BRN A;  3MN5 A;  2QWO A;  3ATU A;  5AZJ A;  1NMD A;  2V52 B;  4B1W B;  5BRF A;  2E1Z A;  4BRI A;  4BRP A;  2BTF A;  3D2F B;  3RSE A;  3WXJ A;  5EX5 A;  4H0X B;  3GG4 A;  1C0G A;  2P9N A;  3VEZ A;  5F2R A;  4B1Y B;  2QWL A;  3JXU A;  3O4W A;  4H5N A;  2D0O A;  1SAZ A;  3SMP A;  2Q31 A;  5BPL A;  5AR0 A;  1NLV A;  2YHX A;  4DB3 A;  1RDW X;  3LDO A;  3BF3 A;  3A0I X;  2P9I B;  2FSJ A;  4IWV A;  1HUX A;  2A3Z A;  2CH6 A;  2IVP A;  5AQG A;  1NGE A;  1NBW A;  3VEY A;  1HPM A;  1BDG A;  3ZEU B;  1TUU A;  3D2F A;  4BRL A;  3ID8 A;  2QWQ A;  3ZET B;  1R59 O;  1J6Z A;  4Y0W A;  3MCP A;  3BEX A;  1JCF A;  1K8K B;  3VET A;  3ZX0 A;  5BRH A;  2ITM A;  5CE3 A;  5AQY A;  2P9I A;  1MA9 B;  3O8M A;  1GLE G;  3D2E B;  1BWF O;  3LL3 A;  3A8Y A;  5EXW A;  4K41 A;  3SK3 A;  5AQZ A;  4FWO A;  3VEO A;  3EL2 A;  2A5X A;  4H5W A;  3ZET A;  1BG3 A;  3EZW A;  2Q2R A;  2A6A A;  4LC9 B;  3JS6 A;  4FSV A;  1HKG A;  2Q0R A;  3UE5 A;  2QXL A;  1K8K A;  5E26 A;  2A41 A;  5JLH A;  3M1F A;  4H0V B;  3CQX A;  3QBW A;  5KQD A;  2FXU A;  3D2E A;  4BRE A;  2NLX A;  2QWN A;  2UYT A;  3AAP A;  4CZJ A;  4RWT A;  3L0Q A;  2VYP A;  1SQK A;  3H46 O;  2PBD A;  1V4S A;  2Q36 A;  1QQM A;  2PAV A;  1LCU A;  4A62 A;  4BR7 A;  1ATN A;  3WXL A;  3EKS A;  5KPT A;  1NGG A;  3ULE B;  1XC3 A;  5FPE A;  3IUC A;  2A42 A;  4BRF A;  3MMV A;  1HX1 A;  3A5O C;  4YDU A;  5EOY A;  3WXI A;  2ASP A;  4BRC A;  1TUY A;  1T6C A;  4BC2 A;  4WYB A;  3IFR A;  2GUP A;  4L3Q A;  1RGI A;  2I7P A;  3VGL A;  2AP1 A;  5AFU H;  1BO5 O;  4PL7 A;  4M63 C;  4FL9 A;  2D4W A;  4BRG A;  4A2B A;  3VOV A;  3FR0 A;  3ULE A;  2E20 A;  1S22 A;  2YJE A;  3ZX3 A;  1GLD G;  3DAW A;  4EAH D;  3MN9 A;  2YHY A;  5I9E B;  2YI1 A;  4XH1 A;  1BUP A;  1NGJ A;  2BUP A;  2FF6 A;  4IJN A;  4AM6 A;  3HM8 A;  1QQO A;  5EY4 A;  1BOT O;  3O80 A;  4BG9 A;  2V7Y A;  3HZ6 A;  4HTL A;  1QQN A;  1E4G T;  5AQJ A;  3SLC A;  5AFU A;  1MWM A;  2GEL A;  2CH5 A;  2FSK A;  2ASM A;  3DWL A;  3GBT A;  3VEX A;  3MDQ A;  1NWK A;  4EIA A;  4ISF A;  3U9D A;  1ZC6 A;  3HBT A;  2F9W A;  4FOI A;  4MLE A;  1OKJ A;  2GEM A;  3UKU B;  5BR9 A;  5F0X A;  4J8F A;  1YVN A;  2GTD A;  4H5T A;  4CBU A;  1BU6 O;  4CJ7 A;  1WUA A;  4H0T B;  3EKU A;  5BN8 A;  2IIR A;  3AY9 A;  4CBX A;  2IVN A;  3VES A;  4HWI A;  1NGD A;  4BRH A;  2V7Z A;  3WT0 A;  2Q1N A;  3BP8 A;  4FWN A;  3S41 A;  3VEN A;  3MN6 A;  2DPN A;  1GLL O;  1HJO A;  1QHA A;  4IO8 A;  5AQK A;  4BC5 A;  4H0Y B;  5AQU A;  3LM9 A;  4WQ5 C;  1C0F A;  4FWR A;  2J4R A;  5AQX A;  3UKU A;  4DQ8 A;  4CI6 A;  4CBW A;  5KQ8 A;  4FWK A;  3EO3 A;  5AQP A;  3VEV A;  4MLH A;  4CZL A;  3KVG A;  3QFU A;  4AM7 A;  3M3Z A;  4CZK A;  2E8A A;  1YAG A;  4WQ4 C;  3ZEU A;  5JMV A;  4BQZ A;  2A40 A;  5KPZ A;  1G99 A;  2FLO A;  5FPN A;  4K42 A;  4H5R A;  4BVP A;  1U6Z A;  3MK6 A;  5BPM A;  4FOE A;  4IZ9 A;  3CET A;  2ZGY A;  4O5F A;  2ASO A;  4JN4 A;  1NGA A;  4K25 A;  4BR5 A;  2QM1 A;  3P4I A;  1QZ6 A;  1TYQ B;  1BA0 A;  2F9T A;  1ZXO A;  4DHY A;  3SJH A;  3FLC O;  4M7X A;  1RFQ A;  2WUS A;  3CJB A;  5AQR A;  2E2N A;  3FZK A;  4MO4 A;  3R9P A;  4K43 A;  3CER A;  3WUH A;  3I8B A;  5JLF A;  5EVZ A;  3CJ7 A;  4CZI A;  2CGK A;  4BRQ A;  5LJW A;  1Z6R A;  2QWR A;  1TYQ A;  4JAX A;  4H0P A;  1E4F T;  2V51 B;  4EFH A;  3VF6 A;  1KAY A;  2QW9 A;  2W40 A;  1LOT B;  3IMX A;  3DXK B;  3O1W A;  3CIP A;  3WQU A;  2H3G X;  3AAR A;  3ATV A;  3O5B A;  1X3N A;  2E88 A;  3QFP A;  4ISG A;  3FZL A;  3EN9 A;  4QS8 A;  2GWJ A;  3FE1 A;  3R6M A;  1NGB A;  3U9Z A;  1U2V B;  2VCP A;  3C7N B;  4FWL A;  3VF2 A;  1KXP A;  4JD2 B;  3VGM A;  4EHT A;  2FSN A;  3CHW A;  5ADX H;  5BN9 A;  3UB5 A;  2FF3 B;  1V4T A;  1T6D A;  3DXK A;  3OHR A;  1S3X A;  3VF4 A;  2AA4 A;  3A5L C;  3A5N C;  2D1K A;  3HI0 A;  1IJJ A;  4Z94 A;  4RCH A;  1Y64 A;  4BGB A;  1U2V A;  4BGA A;  2W41 A;  3C7N A;  1NGH A;  1GLF O;  3GDQ A;  3H6E A;  4FWQ A;  4JD2 A;  4WQ5 A;  1ZBS A;  5FPM A;  5LY3 A;  4DCH A;  4BRK A;  2D0P A;  3FZH A;  3FZM A;  3H45 C;  2HF3 A;  4E1J A;  1X3M A;  5TKY A;  4BRD A;  3TPQ A;  4M7Y A;  5KPR A;  4YDU C;  3QDK A;  2E2P A;  3U4L A;  5ELZ A;  1ATR A;  2KHO A;  5AQH A;  4PKI A;  1CZA N;  1MWK A;  3W0L A;  4I6M B;  5AZI B;  1QZ5 A;  2QWM A;  5E84 A;  3KZB A;  2YHW A;  5ADX A;  4WQ4 A;  3WQT A;  1NM1 A;  3H1V X;  4B1U B;  3LDN A;  4ISE A;  3R8E A;  1ESV A;  4BC4 A;  4BRO A;  5BRD A;  4MO5 A;  2E2O A;  1XQS C;  3O08 A;  4PKG A;  5AQS A;  2P9L B;  3QIC A;  3F9M A;  4BC3 A;  3VPZ A;  4QS7 A;  3L4I A;  1GLC G;  2HOE A;  4I6M A;  5AZI A;  3ENO A;  4BR2 A;  4O8K A;  1NGI A;  3WXK A;  4A2A A;  2VWB A;  1X9J A;  2QWP A;  1HKC A;  1KAX A;  1IG8 A;  4XEI A;  4NO7 A;  5BPN A;  4XH4 A;  3O6W A;  2HMP A;  5AQT A;  3GL1 A;  3VER A;  2IVO A;  3CJA A;  4XH5 A;  3SMS A;  2P9L A;  4BG8 A;  4BVO A;  5AQM A;  3BUZ B;  1HLU A;  1MDU B;  5F1X A;  3CQY A;  2P9S B;  2NZT A;  4CZF A;  4RTF D;  3CJ1 A;  1YXQ A;  3I33 A;  4GY2 B;  1T44 A;  4B1V A;  1JCG A;  4CD1 A;  2Q97 A;  3H3O B;  2HF4 A;  4FWM A;  5FPD A;  4A61 A;  2YJF A;  5BRE A;  3B8A X;  3U8X A;  3QML A;  3CJC A;  4B1Z A;  1GLJ O;  3ZX2 A;  1ATS A;  4BR9 A;  3QBX A;  2ZGZ A;  3CJ9 A;  2OAN A;  3O1B A;  4EHU A;  3LDQ A;  2P9S A;  2NRH A;  1DEJ A;  4JHD B;  4F9O A;  3WEE B;  3H3N O;  3D7E O;  2E2Q A;  3W3D A;  3FGU A;  2E1Y A;  5AQI A;  4BRA A;  1KAZ A;  1NGC A;  3J8A A;  4H03 B;  4FPA A;  2ZF5 O;  1BA1 A;  5AQN A;  1DKG D;  3AAQ A;  1WOQ A;  1EQY A;  1YUW A;  2P9U B;  3A5M C;  3L6Q A;  4JNE A;  5AQQ A;  4CZE A;  4FPB A;  4C23 A;  3MN7 A;  1JCE A;  1NGF A;  4JHD A;  3WEE A;  2P9P B;  1D4X A;  4IJA A;  3FFK B;  4GNI A;  2CGL A;  3BF1 A;  1SZ2 A;  4QS9 A;  4BR4 A;  4CD3 A;  4PL8 A;  2ZWH A;  1Q18 A;  3KHY A;  4H5V A;  5JIC A;  2P9K B;  3LM2 A;  3LDP A;  2I7N A;  3C0B A;  4IXC A;  2P9U A;  1HKB A;  3G25 A;  5AQL A;  3HTV A;  2Q0U A;  5B8H A;  3DJC A;  4NB4 A;  3HSC A;  3FZF A;  3GE1 A;  3UKR B;  3LDL A;  4CZG A;  2YCH A;  3GOI A;  2CGJ A;  2P9P A;  3TU5 A;  3H1Q A;  3VEW A;  1DGK N;  3DXM B;  1GLA G;  3CI5 A;  4CZM A;  3M6G A;  5AZJ B;  3QB0 A;  4FWP A;  3VGK A;  3IDH A;  4FWS A;  4B9Q A;  1H1V A;  1P8Z A;  4B1X B;  1Z05 A;  3RSE B;  2P9K A;  2P9N B;  4BRM A;  5AQW A;  4CZH A;  5LJV A;  1XUP O;  4BR0 A;  4FO0 A;  3ENH A;  3UKR A;  5AQV A; 
#chains in the Genus database with same CATH topology
 4DTS A;  4J2B A;  4H8K A;  1GLB G;  3QEX A;  2VQF K;  3O4N A;  3V1Q A;  4DV1 K;  1UAX A;  3L2W A;  4N41 A;  4CJ5 A;  4B1W B;  4BRI A;  4WFA L;  3SAG A;  3U3G A;  3F9K A;  4LF4 K;  2YNH A;  3DLE A;  5EX5 A;  4H0X B;  1NJY A;  3VEZ A;  5IWA K;  1XC9 A;  3JXU A;  1B9F A;  3VA0 A;  1WSE A;  2D0O A;  2HVI A;  4KTQ A;  5AR0 A;  2YHX A;  3F73 A;  1EWR A;  3LDO A;  4M3U A;  3BF3 A;  4E19 A;  4DSI A;  4E7K A;  1HUX A;  5GAH P;  2IS3 A;  3AVJ A;  3D6R A;  3D2F A;  3K2P A;  3ID8 A;  4B08 A;  4J2A A;  2E6L A;  4ID5 A;  3M8R A;  4Q0B A;  3MXI A;  3KJV A;  1U48 A;  3VQ6 A;  1SV5 A;  2ITM A;  4YOV A;  2KKZ A;  4YOR A;  4DR4 K;  1BGX T;  1VRT A;  2P9I A;  1MA9 B;  1GLE G;  3A8Y A;  3E66 A;  3MXJ A;  3EL2 A;  4FK2 A;  4N47 A;  4FLV A;  2YNI A;  2A6A A;  4FVM A;  1Q8I A;  5LL6 Z;  5A2Q O;  2HBM A;  4HCB A;  5FRO A;  4OJR A;  3SAH A;  4DSF A;  1Q9Y A;  4LF8 K;  1WSI A;  2UYT A;  3AAP A;  2O8E A;  4FJJ A;  3QIP A;  3QET A;  4JYA K;  2PBD A;  1V4S A;  3HOT A;  1QQM A;  2PAV A;  3CC4 N;  1ATN A;  3OYH A;  1RIL A;  5CY4 A;  5KPT A;  4ZHR A;  3RMD A;  4KTZ A;  4CVN E;  1XC3 A;  2A42 A;  1YVU A;  2DFF A;  3SNN A;  3HM9 A;  3BZC A;  3THX A;  2OTJ N;  1RGI A;  4JKA A;  2HB5 A;  1EX4 A;  4FL9 A;  3KKR A;  2OPP A;  4OLA A;  2XO7 A;  3FR0 A;  3ULE A;  1QQC A;  2O8D B;  2HHT A;  3AVB A;  2JGU A;  1J53 A;  1GLD G;  1UOC A;  4EAH D;  1BUP A;  3AO3 A;  1HNW K;  3RRG A;  3ZSR A;  1NNE A;  1S9E A;  1IV0 A;  3CCS N;  4QCL A;  3OS0 A;  3OYG A;  2ZJQ L;  1HQE A;  1VSM A;  3ZSX A;  1TKD A;  2D0C A;  1LWC A;  3CYG A;  3SUQ A;  5CHI A;  1QQN A;  1E4G T;  4HVJ A;  2CH5 A;  2ASM A;  3CQ8 A;  3OYC A;  4EIA A;  5J2N A;  4ISF A;  3J81 O;  1ILY A;  3NH0 A;  4MLE A;  2GEM A;  2JWK A;  2VG5 A;  1LAV A;  4CJV A;  5BR9 A;  5F0X A;  1BIS A;  3MEG A;  3JAM O;  4J8F A;  3CCL N;  3QIN A;  3NDK A;  2HHV A;  3EKU A;  1IBM K;  4IG0 A;  4E7J A;  2F96 A;  4CBX A;  4AHV A;  4HWI A;  3HO1 A;  4CHZ A;  2DTU A;  3MN6 A;  2DPN A;  3LWL A;  1BI4 B;  1UWB A;  1GLL O;  5AQK A;  4BC5 A;  4CFD A;  5AQU A;  1JLE A;  3DLL L;  4E7I A;  1C0F A;  4FWR A;  4BE0 A;  1IKY A;  5LMU K;  2J4R A;  4E89 A;  2G8K A;  4FYD A;  4CBW A;  1OVY A;  2VG7 A;  4FWK A;  3PX0 A;  3EO3 A;  1X9W A;  3D45 A;  5JVH L;  2NUB A;  3TTD A;  3LP0 A;  1W9H A;  4DTM A;  4B3S K;  2DFH A;  4GKK K;  3P39 A;  3QLH A;  5JMV A;  5I3U A;  5KPZ A;  1RBV A;  4YOU A;  1KRP A;  1YJN N;  4H5R A;  1U6Z A;  3V9X A;  4CJS A;  3ZSV A;  4IZ9 A;  3HJF A;  3CET A;  5CYQ A;  3VQE A;  4DFP A;  2ASO A;  3LP2 A;  4A5A A;  1FKO A;  3KKS A;  4F8R A;  1WBD A;  3DI6 A;  5I42 A;  3VTI A;  1VQ4 N;  2RN2 A;  2HHU A;  4IEI A;  5D3G A;  3R9P A;  2W00 A;  1VQO N;  3CER A;  4KHY A;  4DTJ A;  3C6A A;  3CJ7 A;  4CZI A;  3VQP A;  4YOY A;  5JS2 A;  1HRH A;  1TYQ A;  4H0P A;  1E4F T;  2F8T A;  4DFK A;  3HPG A;  1NKB A;  3CIP A;  2WC9 A;  2ZD1 A;  4JS4 A;  4CGJ A;  4FZY A;  4O8U A;  2O8F B;  4W5N A;  3H08 A;  1NK4 A;  1L3V A;  4Z4H A;  3DLH A;  4Z4G A;  2FBY A;  1HYS A;  3FE1 A;  4J2E A;  4RG8 A;  1VSK A;  2VCP A;  3DOL A;  3WNF A;  5ADX H;  4JI6 K;  3KLI A;  1RTJ A;  1HNX K;  4CJ3 A;  4G9Z A;  3A5L C;  4KHS A;  2HND A;  1IJJ A;  1S1V A;  4IKF A;  3VQ8 A;  1ZBH A;  2HBL A;  4DQQ A;  1Y97 A;  3C7N A;  4WFB L;  4FWQ A;  1KFS A;  3HOS A;  2KZM A;  4H4O A;  5FPM A;  1VSD A;  4DCH A;  3AVH A;  1DTQ A;  3FZM A;  5TKY A;  1HJR A;  4BRD A;  3K0S A;  1JLF A;  3V1O A;  2G8V A;  5ELZ A;  2KHO A;  1LWE A;  4JI0 K;  1CZB A;  1RT1 A;  3CXC M;  3KZB A;  4CK2 A;  5C42 A;  5ADX A;  3WQT A;  2HBJ A;  3HVR A;  3H1V X;  4CGI A;  4CJT A;  4BRO A;  5BRD A;  4X65 K;  1XQS C;  1VSI A;  5GAE P;  1YTA A;  3RMA A;  3DYA A;  4RW9 A;  3J7A P;  3SZ2 A;  3VPZ A;  3L4I A;  1FJG K;  2G8F A;  3WXK A;  1C1B A;  3SQ1 A;  4GKJ K;  3OYL A;  3MX5 A;  3T19 A;  3R1X A;  3TAP A;  4FJI A;  3CJA A;  3DMJ A;  4BVO A;  4DU3 A;  1VQK N;  5F1X A;  3DM2 A;  3CQY A;  4CEA A;  2P9S B;  4IG3 A;  4AHS A;  2VGN A;  1YXQ A;  3SPY A;  2WOM A;  2UUC K;  4JKF A;  3KWG A;  4CD1 A;  2Q97 A;  1RT4 A;  2HF4 A;  3HPH A;  4FWM A;  4QAG A;  2ZQB A;  4WF9 L;  5C15 A;  2RKI A;  1FXX A;  4Y1D A;  2UXC K;  3SQ0 A;  1YTU A;  3CJC A;  3V9U A;  1WB9 A;  3AO1 A;  4LH4 A;  2YKN A;  3VQ5 A;  3ZLJ A;  1SL0 A;  3CJ9 A;  3K5O A;  3O1B A;  1N6Q A;  4EHU A;  3LDQ A;  3O4Q A;  1WLJ A;  4HHT A;  2E2Q A;  1KLM A;  2OA8 A;  5FLX O;  3W3D A;  2O8B A;  4BRA A;  4H03 B;  2ZF5 O;  2JLE A;  3DRS A;  4GMJ B;  1DKG D;  2ATQ A;  4FK4 A;  3L3V A;  4PHT X;  1QSY A;  4DSK A;  5JS1 A;  4M45 A;  4XIU A;  3ZSW A;  4Z4E A;  3WEE A;  4KH4 A;  2G8I A;  1JL1 A;  3VQC A;  3RMC A;  1RTH A;  1W7A A;  4M3T A;  4DFJ A;  4CD3 A;  1TVR A;  4A5B A;  5J1E A;  4WE1 A;  3KHY A;  4FW2 A;  3LDP A;  2P9U A;  1HKB A;  5B8H A;  2Q0U A;  4KHP K;  2D0B A;  1IG9 A;  4HUF A;  3DJC A;  3ZSY A;  3FZF A;  3LDL A;  3C6T A;  1MU2 A;  4CHP A;  3EYZ A;  3QEP A;  1T03 A;  4F4K A;  4CZM A;  3M6G A;  4B3R K;  3AVM A;  5J2P A;  1QSL A;  3TAG A;  4Z4F A;  2P9K A;  2P9N B;  4BRM A;  4CZH A;  4N76 A;  2P1J A;  4FO0 A;  3ENH A;  4FM0 A;  2C1G A;  4AQY K;  2GWK A;  4CF8 A;  2X6N A;  4RW7 A;  2ZJR L;  2EHG A;  5AZJ A;  2V52 B;  4MDB A;  2XY5 A;  1CZ9 A;  4CED A;  1IKW A;  3AVC A;  3GG4 A;  1NJX A;  2X78 A;  5HRP A;  2QWL A;  4H5N A;  4LFB K;  3SMP A;  4R5P A;  5BPL A;  3PIO L;  1WBB A;  4DB3 A;  1RDW X;  4CJU A;  1BQM A;  1IBK K;  2YHA A;  4IWV A;  3DRR A;  4KHQ A;  3OYK A;  1RT7 A;  1L3U A;  1NGE A;  1HPM A;  1BDG A;  2F8S A;  3CCU N;  4BEC A;  4IOX A;  3PX4 A;  4EP4 A;  2FBT A;  3FFI A;  1SKW A;  1BCO A;  1K8K B;  3ZX0 A;  1YT3 A;  1BIZ A;  1RTD A;  4K8Z A;  3O8M A;  5C2D A;  3D2E B;  3LL3 A;  3JSM A;  5KRT A;  5DM7 L;  4K41 A;  4OKJ A;  1K73 O;  4CES A;  3VEO A;  3PLA A;  3MED A;  3ZET A;  3EZW A;  4WFN L;  3JS6 A;  3C95 A;  2Q0R A;  3UE5 A;  4AF1 A;  3VA3 A;  2A1R A;  1XMO K;  1BL3 A;  3M1F A;  3CQX A;  2RF2 A;  1GOC A;  3QBW A;  5KQD A;  3L2V A;  2ITG A;  4M3Y A;  1TAQ A;  3OTO K;  3EE9 A;  2QWN A;  5HP1 A;  1U4B A;  4RWT A;  4PQU A;  4CK1 A;  3QES A;  2VYP A;  1JKH A;  2Q36 A;  1XMQ K;  4FJ7 A;  2OPQ A;  1SS6 A;  4A62 A;  4BR7 A;  1YHQ N;  4IO9 L;  3Q7B A;  3WXL A;  1JLQ A;  4YOT A;  3ZSO A;  1NGG A;  2LSN A;  3IG1 A;  5C24 A;  2VQE K;  4CJF A;  3IUC A;  3A5O C;  3BGR A;  1A5X A;  2ASP A;  1T6C A;  4WYB A;  3IFR A;  2GUP A;  4H4M A;  1BO5 O;  5AFU H;  1TKZ A;  4M63 C;  3LP3 A;  4FZZ A;  1EKE A;  1VSF A;  4LFC K;  1ZBI A;  4YOX A;  4F2S A;  4KH6 A;  3NBP A;  3RRH A;  4M42 A;  3DAW A;  2YHY A;  4HUG A;  1KFD A;  2BUP A;  1NGJ A;  3OS2 A;  2FF6 A;  2ZM6 K;  4IJN A;  1RCH A;  5LMN K;  3THW B;  1K6Y A;  4AM6 A;  2NNW A;  4AIL C;  4OLB A;  5EU7 A;  1W2B M;  1I94 K;  1QQO A;  5EY4 A;  1T8E A;  3O80 A;  1HR0 K;  1S1X A;  4HCC A;  3ULD A;  4HTL A;  5AQJ A;  3MWP A;  3CCJ N;  5AFU A;  1NK0 A;  1X9M A;  1MWM A;  2GEL A;  3CG7 A;  3IS9 A;  4B3M K;  1VQ6 N;  3U9D A;  2G8W A;  1ZC6 A;  1VSJ A;  3HBT A;  2A1S A;  4FOI A;  4JK9 A;  1OKJ A;  3QEI A;  1C6V A;  1Z26 A;  2GTD A;  1Q81 O;  4DR7 K;  1WUA A;  2FC0 A;  3AGK A;  1M1K O;  5C25 A;  3C6U A;  3L3U A;  2RE2 A;  3VES A;  3QO9 A;  1NGD A;  4BRH A;  4FJM A;  2Q1N A;  3BP8 A;  3HVT A;  3ID6 A;  3S41 A;  3VEN A;  2D0A A;  4H0Y B;  3QNO A;  3LM9 A;  4GV3 A;  4DS4 A;  5AQX A;  3UKU A;  5KQ8 A;  4DR3 K;  3OYM A;  5AQP A;  3VQA A;  2C1I A;  1EXQ A;  3RTV A;  1D9D A;  3M3Z A;  1J5E K;  1HYZ A;  1C1A A;  2E8A A;  3ZEU A;  4BQZ A;  3PY8 A;  3MK6 A;  1TAU A;  4IOA L;  4FLU A;  4I7F A;  3AA3 A;  4BR5 A;  2QM1 A;  4CFC A;  3SAF A;  1F21 A;  3QNN A;  3L2R A;  2KLA A;  4KV8 A;  5M1O A;  4CGH A;  3QIO A;  1ZXO A;  2OZS A;  4JI2 K;  4C8L A;  4K8X A;  1RFQ A;  4K0K K;  3O9R A;  1LV5 A;  3CJB A;  1RDD A;  3FZK A;  1X1P A;  2UXD K;  4MFB A;  4BEB A;  2CGK A;  4BRQ A;  3TSU A;  4BAC A;  3HP9 A;  4JAX A;  3RMB A;  4EFH A;  3VF6 A;  1KAY A;  2W40 A;  5SZT A;  4EZ6 A;  2Y1J A;  3IMX A;  3DXK B;  3O1W A;  3ATV A;  1OH7 A;  1D9F A;  1X3N A;  4IEE A;  2E88 A;  2B5J A;  4B3T K;  3EN9 A;  4NXN K;  4ZTJ A;  2HHQ A;  1KD1 O;  2GWJ A;  1NGB A;  4BE7 B;  3NVK A;  1JLG A;  5SWM A;  3CF5 L;  4KFB A;  4IBN A;  2FSN A;  3AVA A;  5M1K A;  2WON A;  3UB5 A;  3M8Q A;  5MLC Q;  2QK9 A;  2YNF A;  1L5U A;  3VF4 A;  4KHU A;  3A5N C;  1RDC A;  1VHX A;  3AVF A;  3HI0 A;  4Z94 A;  4DG1 A;  2FBX A;  2BDP A;  2EX3 A;  3O3H A;  1Y64 A;  3VTH A;  3SV4 A;  4BGB A;  1U2V A;  3TAM A;  4BGA A;  3IKM A;  1YJ9 N;  1NGH A;  2PFU A;  1YF5 L;  4JD2 A;  1ZBS A;  4V19 S;  1ZBF A;  4HTU A;  3A2F A;  2D0P A;  3FZH A;  3H45 C;  3TAB A;  2HF3 A;  1X3M A;  3TPQ A;  3K5M A;  2Z1I A;  3QDK A;  3U4L A;  3NCI A;  5AZI B;  1QZ5 A;  1S1T A;  1NK7 A;  4NCG A;  4WQ4 A;  3OYE A;  1NM1 A;  4B1U B;  3LDN A;  3NHG A;  1B9D A;  3R8E A;  4UQG A;  3O08 A;  3SCX A;  4PKG A;  5AQS A;  4DV6 K;  3F9M A;  2I5J A;  3KLG A;  3L2U A;  1WN7 A;  3AVN A;  2W6L A;  3S3M A;  4I6M A;  4PUO A;  4NYF A;  3WXM B;  4A2A A;  4DTN A;  1X9J A;  3TI0 A;  3ASM A;  1HNI A;  1U04 A;  4XEI A;  1SL2 A;  3E9L A;  3S5T A;  1N32 K;  2B6A A;  2P9L A;  5AQM A;  5JVG L;  4OPA A;  1QVF M;  2DFE A;  4W5T A;  5T7B A;  4CZF A;  4RTF D;  4L8R B;  1E3M A;  3CJ1 A;  2Q3S A;  4CF2 A;  1XI1 A;  3H3O B;  3K5L A;  5CZ1 A;  5FPD A;  4A61 A;  5BRE A;  1TK8 A;  2P5G A;  4DF8 A;  4BR9 A;  3QBX A;  4I9Q A;  1N36 K;  1EP4 A;  4A59 A;  4JHD B;  3KK3 A;  1DEJ A;  3H3N O;  2KZZ A;  3FGU A;  3NVM A;  3V9S A;  2WTU A;  4FPA A;  1DTT A;  2W6K A;  3M8P A;  1TK5 A;  5FRN A;  4OGC A;  5AQN A;  1YUW A;  1EQY A;  4ELV A;  3L6Q A;  4OX9 K;  1NK5 A;  4CZE A;  3TTF A;  4Z0U A;  4FPB A;  4JS5 A;  1I39 A;  1FW6 A;  3MN7 A;  2QXF A;  4B9M A;  1JCE A;  3S3O A;  4JI7 K;  1IO2 A;  3VQD A;  1KLN A;  3BF1 A;  4QS9 A;  4BR4 A;  1HNZ K;  1WSJ A;  1S6Q A;  4DS5 A;  3V1R A;  2ZWH A;  4CEO A;  5JIC A;  3OBW A;  2HHS A;  4IXC A;  4YHH K;  1SKS A;  2XY6 A;  2Z1J A;  2KFZ A;  4LY7 A;  3LP1 A;  2UUB K;  3NE6 A;  5M1Q A;  3O9T A;  1KCF A;  3F2K A;  3GOI A;  3H1Q A;  2P9P A;  5GIO A;  5AJ3 K;  3C6H A;  5J2Q A;  5J2M A;  1XWL A;  3QB0 A;  3VGK A;  4PWD A;  4FWS A;  2O8C A;  4B9Q A;  4FJG A;  2XRI A;  4CFA A;  3OJS A;  4X64 K;  3NF8 A;  1XUP O;  4BR0 A;  4CEQ A;  4DR1 K;  3UKR A;  4AHC A;  5IT9 O;  4CEC A;  5AQO A;  1QSS A;  5AQF A;  3DXM A;  4KBO A;  4CF9 A;  3HYF A;  5DM6 L;  2QWO A;  4FXD A;  1NMD A;  5DMR A;  4FM2 A;  2E1Z A;  3TSP A;  3D2F B;  3RSE A;  4KHN A;  3TSQ A;  3O4W A;  1J54 A;  4OO1 J;  1NJI O;  2Q31 A;  4DV0 K;  4FVU A;  1NLV A;  5HRS A;  3P31 A;  2VWK A;  4IDH A;  3J80 O;  4DTP A;  3A0I X;  3O9S A;  4DQS A;  2P9I B;  1VSE A;  4BDP A;  2IVP A;  5AQG A;  2KTQ A;  1A5W A;  3HPO A;  1NBW A;  1DT9 A;  1VRU A;  3ZEU B;  1TUU A;  4BRL A;  4JI1 K;  1K9M O;  3OYN A;  3HK2 A;  1R59 O;  1WSF A;  3V9W A;  4Y0W A;  3LAM A;  3MCP A;  3T69 A;  4LFA K;  3ITH A;  1VSL A;  3TAR A;  3M8S A;  1U49 A;  3IAY A;  4ID1 A;  3CC7 N;  3AA2 A;  3SI6 A;  1HPZ A;  4KB1 A;  1K8A O;  4JI4 K;  4IDK A;  4DTO A;  1BWF O;  1W0H A;  4ILJ A;  1VQ8 N;  5HOO A;  3MX2 A;  5AQZ A;  1VQP N;  4FWO A;  2O8E B;  3MCA B;  3NFA A;  2A5X A;  4DU1 A;  1KVC A;  4NYN A;  1BG3 A;  2Q2R A;  3NAE A;  4LC9 B;  3PO5 A;  2HVH A;  4FSV A;  1A5V A;  1HKG A;  1L3T A;  2QXL A;  1NOY A;  4KI4 A;  1CXQ A;  2NRZ A;  5K14 A;  2A41 A;  3RWU A;  3SUN A;  4H0V B;  3KLH A;  1I3A A;  4LF9 K;  1DLO A;  4ELT A;  3ALY A;  1HNV A;  3T1A A;  5KRS A;  3PSF A;  3K9J A;  3THX B;  4F3O A;  4CZJ A;  4CGF A;  3RVC A;  3N4P A;  1IKV A;  3G10 A;  2IGI A;  3O9U A;  4CJE A;  1LW0 A;  1REV A;  1B92 A;  3ULE B;  5FPE A;  4DFM A;  5HRR A;  3MEC A;  2HST A;  3EZ5 A;  1NMN A;  1TUY A;  1ASV A;  4I2Q A;  4KKO A;  3ZSQ A;  4CIE A;  3OYF A;  2I7P A;  3VGL A;  2AP1 A;  1ZBU A;  5C12 A;  4PL7 A;  4A57 A;  3F5T A;  4AHR A;  4BRG A;  2WBN A;  4A2B A;  5GAG P;  1RT3 A;  3VOV A;  2VWJ A;  1S22 A;  2YJE A;  4B3O A;  3KD1 E;  4CJL A;  4X62 K;  4I2P A;  2QKK A;  4XH1 A;  3ZT0 A;  4IFV A;  5GIP A;  4FJ8 A;  3O3G A;  4CK3 A;  3ENB A;  2NRW A;  4W5R A;  4JI8 K;  4OVL A;  4CEE A;  2IC3 A;  4CER A;  2V7Y A;  1N34 K;  1EO1 A;  5HLF A;  3C94 A;  4DMN A;  3SLC A;  4FCY A;  2YHB A;  3NGZ A;  3VMF B;  2FSK A;  3GBT A;  3P83 D;  1NWK A;  3HST B;  4JKG A;  1XNQ K;  2GX9 A;  2F9W A;  3DLG A;  4O44 A;  4FJH A;  4CE9 A;  1NKC A;  1VAZ A;  1YVN A;  3CCV N;  4F3T A;  4NLB A;  2ZJP L;  4CJK A;  2QA4 N;  1NOZ A;  4H0T B;  4FJL A;  2IIR A;  3AY9 A;  1VQN N;  3OYI A;  1TL3 A;  4CF1 A;  3ZCM A;  2HBK A;  4FK0 A;  3ZT2 A;  1HJO A;  1QHA A;  3NF7 A;  4KTW A;  1YJW N;  3D0P A;  4DQ8 A;  4CI6 A;  3WNG A;  3B6O A;  3SJJ A;  1NK8 A;  3VEV A;  4BWJ A;  3K59 A;  4B9U A;  4FJX A;  4MLH A;  4CZL A;  1JXB A;  1NJW A;  3ZYY X;  3K57 A;  4CZK A;  4CJQ A;  3NGY A;  4WQ4 C;  4C1N K;  1BI4 A;  2A40 A;  3R3L A;  1G99 A;  3MXM A;  2OTL N;  4BVP A;  5BPM A;  4FOE A;  2ZGY A;  3RR8 A;  4O5F A;  2XY8 A;  1VQ7 N;  1VK0 A;  1S6P A;  4DSL A;  1QZ6 A;  1TYQ B;  1BA0 A;  2F9T A;  4G1Q A;  4DHY A;  4YNQ A;  2IAJ A;  4M7X A;  3CM6 A;  3Q7C A;  2E2N A;  4MO4 A;  4K43 A;  4DV3 K;  4LH5 A;  4GVM A;  4CCH A;  1Q9X A;  5LJW A;  5M1N A;  1RBR A;  1Z6R A;  5C2F A;  4O0I A;  3M5R A;  2QWR A;  4U67 L;  2V51 B;  3LZI A;  4ILH A;  4MDA A;  4DUY K;  5CYM A;  3AAR A;  4GV9 A;  1CXU A;  4JKC A;  3ISN C;  3O5B A;  4DQR A;  1OH5 A;  4IFE A;  2YV0 X;  4ISG A;  3FZL A;  2KFN A;  1ZYQ A;  3U9Z A;  3R6M A;  4M3X A;  4BY9 C;  3NMU A;  3C7N B;  3OYD A;  4E7H A;  3N4Q A;  3VGM A;  2O8C B;  3I55 N;  4FJN A;  5BN9 A;  3DLB A;  1RBU A;  4JKE A;  4FJK A;  1T6D A;  2W42 A;  4CJP A;  2AA4 A;  4DSE A;  4Z4C A;  4ICL A;  2O8F A;  1S5J A;  4JK8 A;  1S1W A;  1LW2 A;  1FK9 A;  4BE2 A;  3BDP A;  2W41 A;  1R0A A;  3OYB A;  3PO4 A;  3H6E A;  4WQ5 A;  5LY3 A;  4Z4I A;  3E01 A;  3SV3 A;  4BRK A;  4ELU A;  4JI3 K;  1JL2 A;  5KGW A;  4W5Q A;  4M7Y A;  3J7Y P;  4LSL A;  4YDU C;  2BAN A;  3CFO A;  5AQH A;  1MWK A;  4NLC A;  1S9G A;  2QWM A;  4BDZ A;  3VQ7 A;  5KTQ A;  2YHW A;  2HMI A;  4XJX A;  4E1N A;  4DTX A;  1JJ2 M;  5FDL A;  1NKE A;  3RR7 A;  3NGI A;  3MEE A;  1ESV A;  3AO5 A;  4MO5 A;  2E2O A;  1HQU A;  4OKE A;  3SQ2 A;  4B9N A;  3QIC A;  4KRE A;  1BHL A;  4BC3 A;  2KQ2 A;  2IDO A;  1WSG A;  4DQI A;  4KHW A;  1TGO A;  2HOE A;  4GV6 A;  3SBT A;  1NGI A;  2OZM A;  5KI6 A;  2HHX A;  4LF7 K;  2VWB A;  2UU9 K;  3SUP A;  4IOC L;  4RW6 A;  1KAX A;  4DKW A;  1TL1 A;  4XH4 A;  3CCR N;  4DLG A;  3O6W A;  2HMP A;  2YKM A;  1TK0 A;  3I0R A;  5AQT A;  1JXE A;  3VER A;  4XH5 A;  3SMS A;  4BG8 A;  3I0S A;  3KTQ A;  4E3S A;  1MDU B;  3AO4 A;  2HHI A;  3AA4 A;  1NJZ A;  1NG9 A;  3CCM N;  4RW4 A;  3I33 A;  4GY2 B;  2X6S A;  2O8B B;  1T44 A;  3ZT4 A;  1JCG A;  3VQB A;  2E6M A;  4GVE A;  4WCE L;  1KSP A;  4KI6 A;  2YJF A;  4FJ9 A;  4LD0 A;  3B8A X;  3WNE A;  3U8X A;  4B1Z A;  1P90 A;  1GLJ O;  1O1W A;  3ZX2 A;  1ATS A;  1JLC A;  1NK6 A;  2YX6 A;  2ZGZ A;  3CCE N;  1QVG M;  3P5J A;  3I56 N;  2P9S A;  2NRH A;  4CJW A;  3T3F A;  3KK7 A;  1G15 A;  3WEE B;  3D7E O;  4DV4 K;  4C1N I;  4C8O A;  2E1Y A;  1KAZ A;  1NGC A;  3J8A A;  1RT5 A;  3CPW M;  1BA1 A;  4FLZ A;  3AAQ A;  4Q5V A;  3A5M C;  2P9U B;  4FLW A;  3LPU A;  3V9Z A;  1YIT N;  2NRV A;  1NGF A;  4DV7 K;  2Y1I A;  4IJA A;  3NH1 A;  4FZX C;  3DOK A;  4OPJ A;  3QEV A;  1SUQ A;  4E72 A;  1NK9 A;  4OGE A;  1XNR K;  4KRF A;  4M41 A;  2P9K B;  3TAN A;  3LM2 A;  2Z1H A;  3KK1 A;  3G25 A;  5AQL A;  4NB4 A;  2G8H A;  4CZG A;  2CGJ A;  1GLA G;  5C0Y A;  5AZJ B;  2JWL A;  1H1V A;  1P8Z A;  4B1X B;  1Z05 A;  4JKG B;  4DR5 K;  5AQW A;  5CR4 A;  1TKX A;  5LJV A;  2D5R A;  3O3F A;  5TKW A;  4ZTF A;  1RDU A;  4F9O A;  2B4J A;  1RT2 A;  2EWS A;  3AGR A;  1U45 A;  1SL1 A;  4BQL A;  1RTI A;  4H0O A;  3VQ9 A;  4PKH A;  4BRN A;  1RDA A;  3MN5 A;  3ATU A;  4KB0 A;  3KLE A;  5BRF A;  4BRP A;  3IRX A;  2BTF A;  1VQM N;  3WXJ A;  3OW2 M;  3V81 A;  1WAF A;  1C0G A;  2P9N A;  4U7B A;  5F2R A;  2OPS A;  4B1Y B;  4UY8 O;  4CEF A;  3VN5 A;  3LZJ A;  4M3R A;  3OJU A;  4FW1 A;  3KIO A;  2F7T A;  4DU4 A;  3CFP A;  4DV2 K;  1SAZ A;  3CD6 N;  2FSJ A;  1LAW A;  2DY4 A;  4O5B A;  2A3Z A;  4O4G A;  2CH6 A;  3NH2 A;  4B8A B;  3VEY A;  3B6P A;  4B8C A;  2QWQ A;  3ZET B;  3LAK A;  3HT3 A;  2UXB K;  1J6Z A;  1KVB A;  2GV9 A;  3BEX A;  1JCF A;  3VET A;  4YY3 K;  1FKP A;  1Q82 O;  1J5O A;  2PYL A;  5BRH A;  5H1S Q;  5CE3 A;  2OPR A;  3KD5 E;  2OYQ A;  5AQY A;  4QOZ B;  4CFB A;  5EXW A;  3SK3 A;  2RHK A;  4KAZ A;  3MWT A;  3HRG A;  2QKB A;  4CIF A;  3AVG A;  2GBZ A;  1X9S A;  1GOA A;  4H5W A;  3SQ4 A;  1C0U A;  4JLH A;  4BE1 A;  1K8K A;  3EY1 A;  5E26 A;  3PV8 A;  5JLH A;  2HNZ A;  3OBY A;  3L8B A;  1ASW A;  2FXU A;  3D2E A;  4BRE A;  2NLX A;  2YNG A;  1L3S A;  4J2D A;  3CCQ N;  3L0Q A;  2OCE A;  1SQK A;  3OS1 A;  3H46 O;  2RPI A;  1LCU A;  4BDY A;  3LPT A;  1ASU A;  3U6F A;  1T3V A;  2E4L A;  4CHO A;  4CJR A;  3EKS A;  3PIP L;  3TR8 A;  5HRO A;  4GW6 A;  4C8N A;  2AJQ A;  2O4G A;  4BRF A;  3MMV A;  1HX1 A;  5EOY A;  4YDU A;  5CZ2 A;  3WXI A;  4PY5 A;  2HHH K;  4BRC A;  4FLY A;  3OY9 A;  4BC2 A;  3LWM A;  1T05 A;  4L3Q A;  1WNS A;  4ILG B;  3LAL A;  3NF6 A;  3CYM A;  3CM5 A;  3V4I A;  2D4W A;  1JLA A;  3V6D A;  5E41 A;  2E20 A;  3ZX3 A;  4CHQ A;  4CW7 B;  1O13 A;  3UIQ A;  3MN9 A;  5I9E B;  2YI1 A;  1W97 L;  3THY A;  2KW4 A;  1YI2 N;  3SBG A;  2NRX A;  3HM8 A;  4DSJ A;  2NRT A;  1BOT O;  1UA1 A;  4M3W A;  4BG9 A;  4N56 A;  3OA9 A;  3EEQ A;  4JRQ A;  3DLK A;  3HZ6 A;  3O9Q A;  4FJ5 A;  3TTC A;  4KH5 A;  4JKB A;  3DWL A;  3VEX A;  3PUF A;  3MDQ A;  3CFR A;  3OYA A;  4FLT A;  3KLF A;  3THW A;  3UKU B;  3AV9 A;  3TAQ A;  4CEZ A;  4H5T A;  2VG6 A;  4CBU A;  2ETJ A;  2XHB A;  1BU6 O;  1HYV A;  4CJ7 A;  4DV5 K;  5BN8 A;  1N33 K;  2IVN A;  4X66 K;  1OVQ A;  2V7Z A;  3WT0 A;  4FWN A;  4IO8 A;  4MQ3 A;  1M90 O;  4KPY A;  3P1G A;  4JI5 K;  4KO0 A;  4WQ5 C;  1QE1 A;  4C8K A;  5HRN A;  4CF0 A;  3ZSZ A;  3BY5 A;  4RW8 A;  3KVG A;  4FM1 A;  3QFU A;  2BGG A;  4AM7 A;  4BWM A;  5JEN A;  4YOW A;  1KVA A;  3E9P A;  4OPH A;  2PY5 A;  1YAG A;  5DK5 A;  1S1U A;  2FLO A;  5FPN A;  1Q7Y O;  1CLQ A;  4K42 A;  3LAN A;  3LDS A;  3DLR A;  1LWF A;  4OPK A;  4JN4 A;  1NGA A;  4K25 A;  3P4I A;  1GOB A;  1U47 A;  4JV5 K;  2ZE2 A;  4HUE A;  3SJH A;  3FLC O;  2WUS A;  2QEX N;  2QI2 A;  5AQR A;  1RBT A;  3T1H K;  4AHU A;  2NRR A;  3L4Q A;  2O4I A;  1WAJ A;  3WUH A;  3I8B A;  5JLF A;  3K58 A;  5EVZ A;  3SUO A;  3C65 A;  4LF6 K;  4JKH A;  1SKR A;  1RBS A;  2QW9 A;  1LOT B;  3AA5 X;  2XY7 A;  3CMA N;  4IFY A;  3WQU A;  2H3G X;  4O0J A;  3HP6 A;  3QFP A;  3THV A;  4QS8 A;  4CIG A;  4TSX A;  4NCA A;  4B9V A;  4E1M A;  1U2V B;  3VF2 A;  4FWL A;  4DTU A;  4CHN A;  2WFB A;  1KXP A;  4JD2 B;  1ITG A;  4JKD A;  1EET A;  4AH9 A;  4EHT A;  3CHW A;  1QHT A;  5HBM A;  2FF3 B;  1V4T A;  4CJ4 A;  2P51 A;  3DXK A;  3PSI A;  3OHR A;  1S3X A;  2Z1G A;  4C8M A;  1BCM A;  2D1K A;  1WSH A;  3QEW A;  1XHX A;  5C10 A;  4E7L A;  1IKX A;  3EE8 A;  1EWQ A;  4RCH A;  1IH7 A;  3KK2 A;  2E5L K;  1C1C A;  2O8D A;  4OKK A;  5KGX A;  3G0Z A;  1GLF O;  3GDQ A;  1VQ9 N;  1QS4 A;  3OYJ A;  2QTD A;  4E1J A;  3MAQ A;  3T7Z A;  4CEB A;  5KPR A;  2E2P A;  3TWH A;  1ATR A;  3TAF A;  1D8Y A;  4PKI A;  1CZA N;  3W0L A;  4I6M B;  5E84 A;  4FLX A;  4NCB A;  1TV6 A;  3CC2 N;  4ISE A;  4BC4 A;  4M3Z A;  4DUZ K;  4E0D A;  4JRP A;  3TAE A;  2P9L B;  2UUA K;  3WNH A;  4W5O A;  3AO2 A;  4QS7 A;  1GLC G;  4DQP A;  2BE2 A;  3NF9 A;  3ENO A;  5AZI A;  1RDB A;  4BR2 A;  3S9H A;  4O8K A;  1KQS M;  4B9T A;  4DLE A;  2QWP A;  1HKC A;  3CME N;  2F4V K;  4NO7 A;  1IG8 A;  5BPN A;  2BH1 A;  3SPZ A;  1ZBL A;  4DWI A;  3GL1 A;  2HW3 A;  2IVO A;  1UA0 A;  4CHY A;  4EP5 A;  3BUZ B;  1HLU A;  5HL7 L;  1Q86 O;  2G8U A;  2NZT A;  4F2R A;  3K5N A;  4Y1C A;  3L2Q A;  1KTQ A;  4O55 A;  4JEP A;  3VQQ A;  3J7Z O;  4DR6 K;  4B1V A;  5M1P A;  1C0T A;  5GAD P;  2HNY A;  4R79 A;  4NXM K;  1QTM A;  3U3Y A;  1JLB A;  4YFU A;  3G4S N;  4DTR A;  3QML A;  4N5S A;  4LF5 K;  3G6E N;  4AHT A;  1S72 N;  1XHZ A;  3DRP A;  3HXM A;  1TKT A;  4JK7 A;  3JYT A;  3T1Y K;  2OAN A;  4LSN A;  3BZK A;  3VQ4 A;  1OH6 A;  1RNH A;  3AVI A;  3KWI A;  5AQI A;  2IOC A;  1NU0 A;  4DR2 K;  3E9O A;  1KC8 O;  2X74 A;  4B9S A;  1OH8 A;  3P38 A;  1VQ5 N;  1Z25 A;  3E1Y A;  3QER A;  1WOQ A;  3ZT3 A;  2PYJ A;  4JNE A;  1N8R O;  5AQQ A;  4C23 A;  1N5Y A;  1RT6 A;  4JHD A;  2P9P B;  3ZT1 A;  1D4X A;  1C0M A;  3FFK B;  4GNI A;  2CGL A;  4CGG A;  5BR8 K;  1HMV A;  1SZ2 A;  1VSH A;  4PL8 A;  1Q18 A;  4H5V A;  5GIN A;  3THY B;  1T7P A;  3K9K A;  4I9L A;  2VGM A;  2FBV A;  3G71 N;  2I7N A;  3C0B A;  1BIU A;  2R7Y A;  4B9L A;  4EZ9 A;  3HTV A;  3CPE A;  3SYZ A;  5M1F A;  3HSC A;  1YIJ N;  3GE1 A;  3UKR B;  2YCH A;  2HHW A;  3AVK A;  3VEW A;  3TU5 A;  2PZS A;  1DGK N;  3DXM B;  1BQN A;  3S3N A;  4DF4 A;  3CI5 A;  1IBL K;  3I8D A;  4FWP A;  3IDH A;  2GUI A;  4CGD A;  5FRM A;  1D5A A;  3RSE B;  4PA1 A;  3PX6 A;  3OVN A;  2P5O A;  3HL8 A;  1VQL N;  1J9A A;  3AVL A;  5AQV A; 
#chains in the Genus database with same CATH homology
 2GWK A;  5AQO A;  2EWS A;  3AGR A;  5AQF A;  3DXM A;  4KBO A;  1GLB G;  4BQL A;  4H0O A;  4PKH A;  5DM6 L;  4BRN A;  3MN5 A;  2QWO A;  3ATU A;  5AZJ A;  2ZJR L;  1NMD A;  2V52 B;  4MDB A;  4B1W B;  5BRF A;  2E1Z A;  4BRI A;  3TSP A;  4BRP A;  2BTF A;  4WFA L;  1VQM N;  3SAG A;  3D2F B;  3RSE A;  3WXJ A;  3OW2 M;  5EX5 A;  4H0X B;  3GG4 A;  1C0G A;  2P9N A;  3VEZ A;  5F2R A;  4U7B A;  4B1Y B;  4UY8 O;  2QWL A;  3JXU A;  3TSQ A;  3O4W A;  2F7T A;  4H5N A;  2D0O A;  4OO1 J;  1SAZ A;  1NJI O;  3SMP A;  2Q31 A;  5BPL A;  5AR0 A;  1NLV A;  4FVU A;  3PIO L;  2YHX A;  3P31 A;  3CD6 N;  4IDH A;  4DB3 A;  1RDW X;  3LDO A;  3BF3 A;  3A0I X;  3O9S A;  2P9I B;  2FSJ A;  4IWV A;  1HUX A;  5GAH P;  2A3Z A;  3D6R A;  2CH6 A;  2IVP A;  5AQG A;  1NGE A;  1NBW A;  3VEY A;  1DT9 A;  1HPM A;  1BDG A;  3ZEU B;  1TUU A;  3D2F A;  4BRL A;  3ID8 A;  2QWQ A;  1K9M O;  3ZET B;  3CCU N;  4BEC A;  1R59 O;  4IOX A;  1J6Z A;  4Y0W A;  3MCP A;  3T69 A;  3BEX A;  1JCF A;  1K8K B;  3VET A;  3CC7 N;  1Q82 O;  3ZX0 A;  5BRH A;  2ITM A;  5H1S Q;  4YOV A;  1K8A O;  5CE3 A;  2KKZ A;  4YOR A;  5AQY A;  2P9I A;  1MA9 B;  3O8M A;  1GLE G;  3D2E B;  1BWF O;  3LL3 A;  5C2D A;  3A8Y A;  4ILJ A;  5EXW A;  5DM7 L;  4K41 A;  5HOO A;  3SK3 A;  1VQ8 N;  3MX2 A;  5AQZ A;  1K73 O;  3E66 A;  4FWO A;  1VQP N;  2RHK A;  3VEO A;  3PLA A;  3EL2 A;  3HRG A;  3MCA B;  3MWT A;  2A5X A;  4H5W A;  3ZET A;  1BG3 A;  3EZW A;  2Q2R A;  2A6A A;  4LC9 B;  4WFN L;  3JS6 A;  4FSV A;  1HKG A;  2Q0R A;  3UE5 A;  4AF1 A;  2QXL A;  1K8K A;  2NRZ A;  2HBM A;  5E26 A;  2A41 A;  5JLH A;  3M1F A;  4H0V B;  3CQX A;  3SAH A;  3OBY A;  3QBW A;  5KQD A;  2FXU A;  3D2E A;  4BRE A;  2NLX A;  3EE9 A;  2QWN A;  2UYT A;  3AAP A;  3K9J A;  4CZJ A;  4RWT A;  3CCQ N;  3L0Q A;  2VYP A;  3RVC A;  1SQK A;  3H46 O;  2PBD A;  1V4S A;  3N4P A;  2Q36 A;  3HOT A;  1QQM A;  2PAV A;  1LCU A;  1SS6 A;  3O9U A;  4A62 A;  1T3V A;  4BR7 A;  1YHQ N;  4IO9 L;  3CC4 N;  1ATN A;  3Q7B A;  3WXL A;  3EKS A;  4YOT A;  5KPT A;  1NGG A;  3PIP L;  3ULE B;  1XC3 A;  5FPE A;  3IUC A;  2A42 A;  4BRF A;  3MMV A;  1HX1 A;  3A5O C;  4YDU A;  5EOY A;  3WXI A;  1VQ9 N;  2HST A;  2ASP A;  4BRC A;  1TUY A;  1T6C A;  4BC2 A;  4WYB A;  3IFR A;  2GUP A;  4L3Q A;  2OTJ N;  4ILG B;  1RGI A;  2I7P A;  3VGL A;  4JKA A;  2AP1 A;  5AFU H;  1BO5 O;  5C12 A;  4PL7 A;  4A57 A;  4M63 C;  3F5T A;  4FL9 A;  2D4W A;  4BRG A;  2WBN A;  4A2B A;  5GAG P;  3VOV A;  3FR0 A;  3ULE A;  2E20 A;  1S22 A;  2YJE A;  3ZX3 A;  4YOX A;  1O13 A;  1GLD G;  4KH6 A;  3DAW A;  4EAH D;  3MN9 A;  2YHY A;  5I9E B;  2YI1 A;  4XH1 A;  1BUP A;  1NGJ A;  2BUP A;  1W97 L;  2FF6 A;  5GIP A;  1YI2 N;  4IJN A;  3CCS N;  4AM6 A;  2NNW A;  3ENB A;  2NRW A;  3SBG A;  2NRX A;  2ZJQ L;  3HM8 A;  1W2B M;  2NRT A;  1QQO A;  5EY4 A;  1BOT O;  3O80 A;  4BG9 A;  3OA9 A;  2V7Y A;  3HZ6 A;  3O9Q A;  4HTL A;  5CHI A;  1EO1 A;  3TTC A;  1QQN A;  1E4G T;  5AQJ A;  3MWP A;  4KH5 A;  3SLC A;  5AFU A;  3CCJ N;  1MWM A;  3VMF B;  2GEL A;  4JKB A;  2CH5 A;  2FSK A;  2ASM A;  3DWL A;  3GBT A;  3VEX A;  3MDQ A;  1NWK A;  1VQ6 N;  4EIA A;  4JKG A;  4ISF A;  3U9D A;  1ZC6 A;  3HBT A;  1ILY A;  2GX9 A;  2F9W A;  4FOI A;  4JK9 A;  4MLE A;  1OKJ A;  2GEM A;  2JWK A;  3UKU B;  5BR9 A;  5F0X A;  1VAZ A;  4J8F A;  1YVN A;  2GTD A;  4H5T A;  3CCV N;  3CCL N;  1Q81 O;  4CBU A;  4NLB A;  2ZJP L;  1BU6 O;  4CJ7 A;  2QA4 N;  1WUA A;  4H0T B;  3EKU A;  3AGK A;  5BN8 A;  2IIR A;  3AY9 A;  1M1K O;  1VQN N;  4CBX A;  2IVN A;  2RE2 A;  4HWI A;  3VES A;  1NGD A;  4BRH A;  2V7Z A;  3WT0 A;  2Q1N A;  3BP8 A;  3ID6 A;  4FWN A;  2HBK A;  3S41 A;  3MN6 A;  2DPN A;  3VEN A;  1GLL O;  1HJO A;  1QHA A;  4IO8 A;  1M90 O;  5AQK A;  4BC5 A;  4H0Y B;  5AQU A;  3LM9 A;  3DLL L;  4GV3 A;  4WQ5 C;  1C0F A;  4FWR A;  1YJW N;  2J4R A;  5AQX A;  3UKU A;  4DQ8 A;  4CI6 A;  4CBW A;  5KQ8 A;  1OVY A;  4FWK A;  3EO3 A;  5AQP A;  3VEV A;  4MLH A;  4CZL A;  3KVG A;  2C1I A;  3QFU A;  4AM7 A;  3ZYY X;  5JVH L;  3TTD A;  4YOW A;  3M3Z A;  4CZK A;  3E9P A;  2E8A A;  3P39 A;  4OPH A;  1YAG A;  4WQ4 C;  3ZEU A;  5JMV A;  4C1N K;  4BQZ A;  2A40 A;  3R3L A;  5KPZ A;  1G99 A;  2FLO A;  4YOU A;  5FPN A;  1Q7Y O;  4K42 A;  2OTL N;  1YJN N;  4H5R A;  4BVP A;  1U6Z A;  3MK6 A;  4IOA L;  5BPM A;  4FOE A;  4IZ9 A;  3CET A;  2ZGY A;  4O5F A;  2ASO A;  4JN4 A;  4A5A A;  1NGA A;  4K25 A;  1VQ7 N;  4BR5 A;  2QM1 A;  3P4I A;  3SAF A;  1QZ6 A;  1TYQ B;  1BA0 A;  2F9T A;  2KLA A;  5M1O A;  1ZXO A;  3VTI A;  3SJH A;  3FLC O;  4DHY A;  1VQ4 N;  4M7X A;  1RFQ A;  3Q7C A;  3O9R A;  2WUS A;  2QEX N;  3CJB A;  2QI2 A;  4IEI A;  5AQR A;  2E2N A;  3FZK A;  4MO4 A;  3R9P A;  4K43 A;  2W00 A;  2NRR A;  3L4Q A;  1VQO N;  3CER A;  3WUH A;  3I8B A;  5JLF A;  5EVZ A;  4BEB A;  3C6A A;  3CJ7 A;  4CZI A;  2CGK A;  4BRQ A;  5LJW A;  3TSU A;  1Z6R A;  5M1N A;  4YOY A;  3C65 A;  5C2F A;  3M5R A;  4JKH A;  2QWR A;  1TYQ A;  4JAX A;  4H0P A;  1E4F T;  4U67 L;  2V51 B;  4EFH A;  3VF6 A;  1KAY A;  2QW9 A;  2W40 A;  1LOT B;  3IMX A;  4ILH A;  3DXK B;  4MDA A;  3O1W A;  3CIP A;  3CMA N;  3WQU A;  2WC9 A;  2H3G X;  3AAR A;  3ATV A;  4GV9 A;  4JKC A;  3O5B A;  1X3N A;  4IEE A;  2E88 A;  4O8U A;  3QFP A;  4IFE A;  4ISG A;  3FZL A;  3EN9 A;  4QS8 A;  1KD1 O;  2GWJ A;  3FE1 A;  3R6M A;  1NGB A;  3U9Z A;  4BY9 C;  4BE7 B;  1U2V B;  3NVK A;  3NMU A;  2VCP A;  3C7N B;  4FWL A;  3VF2 A;  3CF5 L;  2WFB A;  1KXP A;  4JD2 B;  4JKD A;  3N4Q A;  3VGM A;  4EHT A;  2FSN A;  3CHW A;  5ADX H;  5M1K A;  3I55 N;  5BN9 A;  3UB5 A;  2FF3 B;  1V4T A;  4JKE A;  1T6D A;  3DXK A;  5MLC Q;  3OHR A;  1S3X A;  3VF4 A;  4G9Z A;  2AA4 A;  3A5L C;  3A5N C;  2D1K A;  3HI0 A;  1IJJ A;  5C10 A;  3EE8 A;  4Z94 A;  4JK8 A;  4RCH A;  2HBL A;  1Y64 A;  3VTH A;  4BGB A;  1U2V A;  4BGA A;  1YJ9 N;  2W41 A;  3C7N A;  3IKM A;  1NGH A;  2PFU A;  1YF5 L;  1GLF O;  3GDQ A;  3H6E A;  4FWQ A;  4JD2 A;  4WQ5 A;  4WFB L;  1ZBS A;  3HOS A;  5FPM A;  5LY3 A;  4DCH A;  2QTD A;  4BRK A;  2D0P A;  3FZH A;  3FZM A;  3H45 C;  2HF3 A;  4E1J A;  1X3M A;  5TKY A;  3T7Z A;  3TPQ A;  4BRD A;  4M7Y A;  5KPR A;  4YDU C;  3QDK A;  2E2P A;  3U4L A;  5ELZ A;  1ATR A;  2KHO A;  5AQH A;  4PKI A;  1CZA N;  1MWK A;  3W0L A;  4I6M B;  4NLC A;  5AZI B;  1QZ5 A;  2QWM A;  5E84 A;  3CXC M;  3KZB A;  2YHW A;  5ADX A;  4WQ4 A;  3WQT A;  4XJX A;  1NM1 A;  2HBJ A;  3CC2 N;  3H1V X;  4B1U B;  3LDN A;  1JJ2 M;  4ISE A;  3R8E A;  1ESV A;  4BC4 A;  4BRO A;  5BRD A;  4MO5 A;  2E2O A;  1XQS C;  3O08 A;  4PKG A;  5GAE P;  5AQS A;  2P9L B;  3QIC A;  3F9M A;  4BC3 A;  3VPZ A;  4QS7 A;  3L4I A;  1GLC G;  2HOE A;  4GV6 A;  4I6M A;  5AZI A;  3SBT A;  3ENO A;  4BR2 A;  4O8K A;  1NGI A;  3WXK A;  1KQS M;  3WXM B;  4A2A A;  2VWB A;  4IOC L;  1X9J A;  2QWP A;  1HKC A;  3CME N;  1KAX A;  1IG8 A;  4XEI A;  3MX5 A;  4NO7 A;  4XH4 A;  4DKW A;  5BPN A;  3R1X A;  3CCR N;  3E9L A;  3O6W A;  2BH1 A;  2HMP A;  5AQT A;  3GL1 A;  3VER A;  2IVO A;  3CJA A;  4XH5 A;  3SMS A;  2P9L A;  4BG8 A;  4BVO A;  1VQK N;  5AQM A;  3BUZ B;  1HLU A;  1MDU B;  5F1X A;  5JVG L;  5HL7 L;  4OPA A;  1Q86 O;  1QVF M;  3CQY A;  2P9S B;  2NZT A;  4CZF A;  4RTF D;  2VGN A;  3CJ1 A;  3CCM N;  1YXQ A;  3I33 A;  4GY2 B;  4JEP A;  3J7Z O;  1T44 A;  4JKF A;  4B1V A;  3KWG A;  5M1P A;  1JCG A;  4CD1 A;  5GAD P;  2Q97 A;  3H3O B;  4R79 A;  4GVE A;  4WCE L;  2HF4 A;  4FWM A;  5FPD A;  4A61 A;  2YJF A;  4WF9 L;  5C15 A;  5BRE A;  3G4S N;  3B8A X;  3U8X A;  3QML A;  3CJC A;  4B1Z A;  3G6E N;  1P90 A;  1GLJ O;  3ZX2 A;  1ATS A;  1S72 N;  2YX6 A;  4BR9 A;  4JK7 A;  3QBX A;  2ZGZ A;  3CCE N;  3CJ9 A;  2OAN A;  1QVG M;  3O1B A;  4EHU A;  3LDQ A;  4A59 A;  2P9S A;  2NRH A;  1DEJ A;  4JHD B;  3KK7 A;  4F9O A;  3WEE B;  3I56 N;  3H3N O;  3D7E O;  2E2Q A;  3W3D A;  4C1N I;  3FGU A;  2E1Y A;  3NVM A;  3KWI A;  5AQI A;  4BRA A;  1KAZ A;  1NGC A;  3J8A A;  4H03 B;  4FPA A;  2ZF5 O;  3E9O A;  3CPW M;  1KC8 O;  1BA1 A;  3P38 A;  1VQ5 N;  5AQN A;  1DKG D;  3AAQ A;  3E1Y A;  1WOQ A;  1EQY A;  1YUW A;  2P9U B;  3A5M C;  3L6Q A;  4JNE A;  1N8R O;  5AQQ A;  4PHT X;  4CZE A;  3TTF A;  4FPB A;  1YIT N;  4C23 A;  3MN7 A;  1JCE A;  2NRV A;  1NGF A;  4JHD A;  3WEE A;  2P9P B;  4KH4 A;  1D4X A;  4IJA A;  3FFK B;  4GNI A;  2CGL A;  3BF1 A;  1SZ2 A;  4QS9 A;  4BR4 A;  4CD3 A;  4PL8 A;  4A5B A;  2ZWH A;  1Q18 A;  3KHY A;  4H5V A;  5GIN A;  5JIC A;  2P9K B;  3K9K A;  2VGM A;  3OBW A;  3G71 N;  3LM2 A;  3LDP A;  2I7N A;  3C0B A;  4IXC A;  2P9U A;  1HKB A;  3G25 A;  5AQL A;  3HTV A;  2Q0U A;  5B8H A;  3CPE A;  3DJC A;  4NB4 A;  5M1F A;  3HSC A;  1YIJ N;  3FZF A;  3GE1 A;  3UKR B;  3LDL A;  5M1Q A;  3O9T A;  4CZG A;  2YCH A;  3F2K A;  3GOI A;  2CGJ A;  2P9P A;  3TU5 A;  3H1Q A;  3VEW A;  5GIO A;  1DGK N;  3DXM B;  1GLA G;  3C6H A;  3CI5 A;  4CZM A;  3M6G A;  5C0Y A;  5AZJ B;  3QB0 A;  4FWP A;  3VGK A;  2JWL A;  3IDH A;  4FWS A;  4B9Q A;  1H1V A;  1P8Z A;  4B1X B;  1Z05 A;  3RSE B;  2P9K A;  4JKG B;  2P9N B;  4BRM A;  5AQW A;  4CZH A;  5CR4 A;  1VQL N;  5LJV A;  1XUP O;  5TKW A;  4BR0 A;  4FO0 A;  1RDU A;  3ENH A;  2C1G A;  3UKR A;  5AQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...