3A5MC

Crystal structure of a dictyostelium p109i mg2+-actin in complex with human gelsolin segment 1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
370
structure length
364
Chain Sequence
QALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAILNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAAAAIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gelsolin
publication title Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 113
structure length 364
sequence length 370
ec nomenclature
pdb deposition date 2009-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5mC01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5mC02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3a5mC03
3O5BA 4YDUA 1YUWA 3LDOA 5AQUA 4AM6A 4CBWA 3WT0A 3ZX2A 1JCEA 3WEEB 2A5XA 1BA0A 4MLHA 4CZJA 3HTVA 1NM1A 4BRMA 4BRCA 5FPMA 3ATVA 3M1FA 5JLHA 3DJCA 2QWRA 4FWSA 3I8BA 1J6ZA 3ZEUA 2FF3B 3D7EO 3H3OB 2BTFA 3KVGA 4HTLA 2D4WA 4BVOA 4K25A 2FLOA 3GBTA 1NGBA 5BR9A 4CJ7A 3TPQA 4PKHA 4LC9B 4CZIA 1X3NA 4RWTA 3UKUA 5BRDA 5JICA 2HOEA 4DB3A 3AAPA 3IFRA 4WQ4C 3VEVA 3EZWA 3FZHA 4IXCA 5BRHA 4CZHA 4FSVA 2GTDA 2CH5A 3EKUA 4CBXA 3BF3A 3UE5A 1U2VA 4WQ5A 4FWRA 3WXKA 3O1BA 2IVPA 1RFQA 4YDUC 3SLCA 2AP1A 3VERA 3M6GA 1HX1A 5ADXA 1U2VB 3ZETA 5JLFA 1C0GA 2ASPA 4JD2A 1NMDA 1GLBG 3MN7A 5AQRA 1TYQA 3ULEA 2QM1A 4GY2B 1T44A 3FE1A 1QQMA 3CIPA 1ZC6A 3VENA 4CZKA 1GLEG 3ZETB 3GL1A 4JD2B 2GWJA 3UB5A 5BPMA 3ULEB 1TYQB 3VOVA 3VF2A 1ZBSA 4K41A 2GELA 1BDGA 4KBOA 3CJ9A 4BVPA 2P9SA 3GOIA 4DCHA 2IIRA 5F2RA 3GE1A 4Y0WA 2A40A 5AQFA 4BG9A 3QB0A 1HKGA 1QQOA 2CGKA 1NGHA 3VEYA 1ATRA 4GNIA 2P9SB 4FOIA 2A42A 5AQZA 5FPDA 4XEIA 3KZBA 3LDQA 3ENHA 3VPZA 1XQSC 3QMLA 2NRHA 3HZ6A 4FWMA 2FXUA 4CD3A 5CE3A 2P9LA 2QWLA 5E26A 3DWLA 3D2EA 2A3ZA 3FZKA 1HPMA 5AQGA 2VWBA 1MA9B 4PKIA 3ZX0A 4O5FA 3ENOA 3HBTA 4BRIA 2E2NA 2QWQA 3D2EB 3R8EA 2Q36A 4J8FA 1NGFA 1U6ZA 4WQ5C 5F0XA 2V51B 3L6QA 3DXKA 1K8KA 4RCHA 5LY3A 2WUSA 4O8KA 3HSCA 5F1XA 5LJVA 4H0TB 3DXKB 5EVZA 1K8KB 3H6EA 1G99A 3J8AA 1X9JA 3L0QA 5AQNA 3FFKB 3OHRA 1XC3A 1SQKA 2YHYA 3EN9A 1GLCG 1S3XA 3GDQA 4XH1A 3VF4A 2D0OA 3WEEA 2QWMA 4H5TA 4B1WB 3CJ1A 4IJNA 1ESVA 1BG3A 5AQKA 3SJHA 3IMXA 1LOTB 3LDLA 4E1JA 4QS9A 2P9NA 1JCFA 5EOYA 2CH6A 3QBXA 2PBDA 3VEWA 4A2AA 2ASMA 2VCPA 2QWNA 4B1UB 4BC2A 2P9NB 3CERA 5I9EB 1ZXOA 3W3DA 3JS6A 3MN9A 4FWQA 3VEOA 2I7NA 4ISGA 5AQQA 2W40A 3A5LC 3G25A 5ADXH 4BGBA 4M63C 2UYTA 3LDPA 2HF4A 3H1VX 3H46O 1RDWX 3O4WA 4XH4A 4CBUA 3EO3A 5AZJB 2ASOA 2P9IA 2A41A 5FPNA 4JHDB 3AAQA 4BRPA 2A6AA 3FZFA 4FPAA 4JAXA 5AQHA 1QZ5A 3WQUA 3RSEA 4CZEA 3CJCA 1BUPA 3VGMA 2E2PA 2Q2RA 2P9IB 4C23A 3FGUA 2IVOA 2BUPA 4M7YA 2F9WA 3RSEB 2KHOA 3CI5A 1SAZA 4MO5A 1BU6O 4QS8A 1S22A 1YVNA 3QFUA 5AQSA 3WUHA 3U8XA 1T6DA 3O80A 1NGAA 4BROA 3IUCA 3LM9A 2ZGYA 1QQNA 2Q1NA 5LJWA 1NGDA 1T6CA 3A8YA 5BN9A 4BREA 5JMVA 4JN4A 2E1ZA 2QW9A 4ISFA 3SMPA 4BC4A 4BC5A 5KPRA 2FF6A 3DXMA 4IJAA 3SK3A 1KAYA 4PKGA 3DXMB 5EY4A 4BGAA 5AQMA 1Q18A 4H0PA 5AQYA 2D0PA 4CZFA 4H5RA 3P4IA 4BG8A 5KQDA 4JNEA 1WUAA 1GLAG 3A5MC 3CHWA 3LL3A 4B9QA 4B1VA 4BQLA 3HI0A 4MO4A 4CI6A 2E2OA 5AFUH 4A62A 1YAGA 2FSJA 4QS7A 4FO0A 2ZWHA 5AZIA 2V7ZA 3IDHA 3O08A 1ATSA 4IO8A 3U9ZA 2YCHA 3WXIA 3AY9A 5TKYA 4CZMA 3BP8A 3MK6A 4EHUA 5AZIB 1Y64A 2E8AA 3R6MA 4FOEA 1HJOA 3QFPA 5AQVA 4BR7A 2VYPA 3MN5A 3WXJA 3VESA 1E4FT 2IVNA 2F9TA 2HF3A 2GUPA 4IZ9A 1QHAA 1HLUA 1NGEA 5AR0A 1SZ2A 3VEXA 4NO7A 4A61A 4XH5A 3AARA 4H5WA 3A5OC 1WOQA 3O8MA 4NB4A 4BR0A 4H0XB 3H45C 1BOTO 4FPBA 3QDKA 4FWLA 4FWPA 4DQ8A 1C0FA 3U9DA 1HUXA 3A5NC 3D2FA 1OKJA 1V4TA 4Z94A 1MDUB 1NGCA 2ZGZA 4BRLA 1Z6RA 1P8ZA 3F9MA 2E20A 4HWIA 2P9PB 1XUPO 3D2FB 1DEJA 2GWKA 1NBWA 3MMVA 3UKRB 4BQZA 2E1YA 1QZ6A 4FWNA 3W0LA 3ID8A 4RTFD 1GLLO 1E4GT 4CZGA 5AZJA 5ELZA 4B1YB 2QXLA 4A2BA 1HKBA 3M3ZA 4JHDA 2E2QA 1BWFO 2FSNA 5AQJA 3EL2A 3CJBA 1H1VA 4ISEA 4BRHA 1DGKN 4L3QA 1IJJA 2ZF5O 4BC3A 3HM8A 3MCPA 3H1QA 4K42A 3CQYA 2Q0UA 1JCGA 5AQIA 5KPTA 4BRQA 5EX5A 4B1ZA 3A0IX 2EWSA 3ZEUB 3FR0A 5AQLA 5BPNA 5BRFA 1KAZA 1MWMA 2E88A 3QBWA 3C0BA 3CJAA 4BRKA 4M7XA 2QWPA 3VETA 3ZX3A 4BRAA 3UKUB 3GG4A 2I7PA 4BRDA 3FZLA 2PAVA 1V4SA 4DHYA 2Q31A 2J4RA 3BUZB 1DKGD 3KHYA 4H5NA 2YJFA 4I6MA 3LM2A 4FL9A 2NZTA 4H03B 3SMSA 2Q0RA 1NWKA 5AQXA 4BRNA 1LCUA 3S41A 1NLVA 3CETA 1HKCA 2Q97A 3WXLA 1YXQA 3U4LA 4I6MB 3MDQA 4EHTA 2V7YA 2P9KA 1D4XA 5KPZA 4PL8A 4EIAA 4H0YB 5B8HA 4BR5A 2V52B 4PL7A 3H3NO 5BREA 2P9KB 3TU5A 5AQWA 1TUYA 1NGIA 3CQXA 1IG8A 1KAXA 1Z05A 2OANA 4MLEA 4H0OA 4BR4A 3DAWA 1R59O 1RGIA 4H0VB 5AQPA 5FPEA 3FZMA 3O1WA 2ITMA 3VGKA 2AA4A 3VF6A 3VGLA 3I33A 3EKSA 4BR2A 2YHXA 3QICA 2W41A 1GLJO 4WYBA 4BRGA 2CGJA 4CZLA 1NGJA 2H3GX 3LDNA 1GLDG 2DPNA 5AQOA 4FWOA 5BPLA 2P9UA 5KQ8A 2QWOA 1CZAN 5AQTA 2FSKA 2NLXA 1NGGA 1GLFO 2HMPA 5BN8A 4K43A 1TUUA 2P9UB 1ATNA 4BR9A 5E84A 2P9LB 3WQTA 4EAHD 1KXPA 3BF1A 4F9OA 4IWVA 2YHWA 3FLCO 1MWKA 3B8AX 4AM7A 4FWKA 3C7NA 3O6WA 1BA1A 1X3MA 2D1KA 3JXUA 2GEMA 3L4IA 3CJ7A 1EQYA 2YJEA 2P9PA 4WQ4A 3C7NB 3UKRA 5EXWA 4BRFA 2CGLA 4EFHA 3ATUA 1BO5O 3BEXA 3VEZA 2YI1A 4CD1A 3R9PA 4H5VA 5AFUA 3MN6A 4B1XB
chains in the Genus database with same CATH superfamily
3I8DA 2ZM6K 4IEIA 3WT0A 4FM2A 4YY3K 1BA0A 4MLHA 3AVFA 1ZYQA 1NM1A 3L3VA 2BANA 1YT3A 3ZYYX 3ATVA 3B6OA 1KQSM 1BI4B 3M1FA 4DTRA 1X9MA 4DUZK 2RE2A 4XJXA 3PUFA 1RT3A 3H3OB 3ISNC 1KD1O 4LFCK 2NNWA 3KVGA 5AJ3K 2Z1IA 4K25A 4CHQA 1JLFA 3QESA 1NJZA 3CG7A 4DUYK 2PYJA 1NGBA 3TPQA 3OW2M 4CZIA 1X3NA 4FJ9A 3UKUA 1C0UA 1QSLA 2O8BB 3SBGA 4CHOA 5GIPA 3NGIA 3AAPA 3IFRA 4AQYK 5BRHA 3CCUN 1CXUA 1RBRA 3AVKA 3MX5A 3BF3A 1XNQK 3THWB 1HQEA 2OPSA 1CLQA 4FWRA 2O8DA 3WXKA 2P1JA 5GIOA 3KLEA 4YDUC 1OH5A 4JEPA 2LSNA 2YNHA 3HOSA 5HROA 4DSIA 4CJ4A 1C0GA 4JD2A 1NMDA 4CW7B 3MN7A 5AQRA 1TYQA 2BE2A 3ULEA 1QQMA 5H1SQ 2NRWA 4C8MA 3KLHA 1GLEG 4JS5A 4FVUA 4JLHA 4YOVA 2ZQBA 1YHQN 1REVA 4K41A 4FK4A 4B9VA 4DCHA 2IIRA 3ZCMA 1N33K 3U3GA 3L4QA 2CGKA 3WNEA 2Z1HA 2A42A 3KZBA 3LDQA 4M3TA 3VPZA 2KFZA 4OX9K 3HZ6A 3D2EA 5BR8K 2VWBA 1MA9B 3AA2A 4CVNE 4O5FA 3OBYA 4H4OA 2YV0X 3SYZA 3SQ4A 4J8FA 5F0XA 5DMRA 1YF5L 2V51B 1RT2A 1K8KA 3VQDA 1L3VA 1WN7A 3NF7A 4RCHA 1N34K 5SWMA 1NKBA 5LJVA 3KKRA 1M1KO 5FRNA 4CIEA 1NK8A 1ZBFA 5EVZA 3L0QA 4CE9A 4DFPA 1C1BA 3OYGA 5JVGL 1XC3A 3GDQA 3DI6A 5C2FA 4B1WB 1HYSA 4IJNA 1BG3A 2VWKA 5AQKA 3SJHA 3NVMA 4IOXA 1LOTB 2HBMA 4LSLA 3VA3A 3DM2A 3TTFA 3CPWM 3RTVA 5EOYA 4K8ZA 3LAMA 2PBDA 3ZSXA 2ASMA 4ELVA 4B1UB 3KK2A 4BC2A 5I9EB 3MN9A 4FWQA 1EWRA 3VEOA 4BE1A 4YHHK 3OJSA 5ADXH 1KC8O 2O8BA 1JXEA 4E1NA 2P5GA 2HF4A 3H46O 5AZJB 4KHWA 1UA0A 4GKKK 5FPNA 4JAXA 3DRRA 3V1OA 3THWA 3HPGA 5EU7A 4CJWA 4FCYA 3CI5A 1SAZA 2O8FB 1BU6O 3OYNA 1YVNA 2D0CA 1VQ7N 5M1QA 4KHYA 4B3TK 4FJ7A 3TSPA 1N6QA 3LZIA 3WNGA 3PO5A 1T6CA 5JMVA 4JN4A 3P31A 4W5NA 2QW9A 4BC4A 5KPRA 1DTTA 2FF6A 1BISA 3DXMA 5M1NA 4FJMA 3OS0A 4MDBA 4DV2K 2UXBK 1L3SA 1WAJA 1RDBA 1Z26A 5EY4A 4C8NA 4CGHA 2UUAK 3VQ8A 3OVNA 3P4IA 3C6UA 4BG8A 5KQDA 1RT4A 1U45A 4B1VA 3HI0A 4C1NK 1FK9A 2E2OA 2ZJQL 1B9FA 4BY9C 4DTNA 3I55N 1OH6A 3TAQA 4CIGA 2FSJA 3CFRA 4DQSA 1IG9A 4CGIA 1X9SA 4LH4A 1GOBA 3LP2A 4M3XA 3AY9A 4DR3K 4DR4K 2YHAA 3R6MA 3Q7CA 2F8SA 2W6KA 5CZ1A 4U67L 2VYPA 5KGXA 1VQPN 1RBSA 3VESA 1E4FT 1QHAA 3J7AP 5AR0A 3VEXA 4IFVA 4A61A 4C8KA 4OPKA 4IDKA 1EWQA 1IKXA 3A5OC 3ASMA 3HO1A 1XHXA 4H0XB 4E72A 4E0DA 1S1UA 3V9ZA 4DR7K 1IH7A 1HUXA 3K58A 2G8WA 5M1PA 4GW6A 1BCOA 1OKJA 2HBLA 4Z94A 4OPAA 5MLCQ 1NGCA 1YTUA 2ZGZA 3OA9A 1P8ZA 3EZ5A 4OKJA 4HWIA 1DEJA 2GWKA 3F9KA 3WNHA 3S3MA 1QZ6A 4FWNA 3W0LA 4CZGA 5AZJA 1RNHA 2VQFK 3ZSOA 3ITHA 3G6EN 2HHHK 2FSNA 5FRMA 5AQJA 1KVAA 4KH5A 4L3QA 1VRTA 3VTIA 3RRHA 4AILC 4N5SA 2QKBA 4K42A 2Q0UA 1JCGA 1D5AA 4B1ZA 4EP4A 2EWSA 3ZEUB 5BRFA 5BPNA 3NDKA 2QKKA 1KAZA 5GAGP 4A5BA 4IBNA 3MECA 4BRKA 4HCBA 4M7XA 4XIUA 2QWPA 3VETA 4JRQA 3M8SA 2KLAA 3D6RA 2AJQA 1K8AO 4FJ8A 3NH2A 4BRAA 3T1HK 4C8OA 1J5OA 4HHTA 4LSNA 3KHYA 1DKGD 5M1OA 4H5NA 4CEAA 3LM2A 3SMSA 1HR0K 4BRNA 3TWHA 4CEZA 3U4LA 4I6MB 4CFCA 3MDQA 4M3UA 2P9KA 4B9MA 1ITGA 4CGFA 5KPZA 1U4BA 4OGCA 3CMEN 1IKVA 3S3NA 3H3NO 3KK3A 1J9AA 2HHTA 1OH8A 3C65A 3SNNA 3ZLJA 3NCIA 3TSUA 1KAXA 3CQXA 3K5MA 3K5LA 1QTMA 1RGIA 1LV5A 5AQPA 2HW3A 4LF9K 2HNZA 2AA4A 3VF6A 1TKDA 3K9KA 3OYHA 4DSFA 3I33A 1RTDA 4N47A 3EKSA 3HVTA 2YHXA 1W97L 1VQ4N 4CZLA 1WSFA 3SJJA 3O4NA 5AQOA 3AV9A 3CYMA 1CZAN 4FJLA 3QIOA 1GLFO 4BE2A 1TUUA 3B6PA 4DV4K 4BR9A 5E84A 3AVAA 4ILJA 3TR8A 1EO1A 3B8AX 1GOAA 3G4SN 1ILYA 1TAQA 4CJ5A 3AVHA 4U7BA 2D1KA 4F3TA 3QEIA 1KVBA 3NFAA 1RT7A 1JLGA 1I39A 3CJ7A 1EQYA 4CK1A 4JKDA 2CGLA 1I94K 4EFHA 3ATUA 1BO5O 4NXNK 5GAEP 4B1XB 4CHPA 1YIJN 3NH0A 1YUWA 1Q86O 4R5PA 3LDOA 3KTQA 3TANA 2QK9A 3ZX2A 1RT5A 3SAGA 2A5XA 4CZJA 4FW2A 3G71N 3V9WA 4KTZA 1D8YA 4PUOA 4DV7K 2QWRA 3ZEUA 3I8BA 1J6ZA 4I7FA 1IBKK 4OLAA 5FROA 3DLRA 3PSIA 1Q82O 2D4WA 2QEXN 3QNOA 5CR4A 4M3WA 2FLOA 3CQ8A 3HVRA 4RW6A 2HHVA 3N4PA 3CM5A 1B92A 2B5JA 3OYMA 4RWTA 1HNZK 4JI0K 1JKHA 5JICA 3ZSYA 1BL3A 1ASVA 1UOCA 3O3HA 4DB3A 3MXJA 3OYKA 1VQ8N 3L2QA 1IKWA 3BGRA 2GTDA 3UE5A 1SUQA 4DFKA 3PX6A 4O0IA 4FK2A 4DF4A 3LPUA 3L2UA 1RFQA 3CCLN 1YJ9N 1UA1A 4OVLA 1QVGM 4JKBA 4CJTA 1WSIA 4IFEA 2KQ2A 1WNSA 2XHBA 4NYNA 3NGZA 3VENA 1NJYA 3GL1A 4JD2B 4AHSA 3QO9A 3HM9A 3UB5A 3IS9A 3ULEB 1TYQB 3VOVA 2RKIA 4CK2A 2HNDA 1BDGA 4OPJA 4BVPA 1NOYA 4KB0A 4Z4IA 4B9NA 1WSJA 1JLQA 2JWKA 2YNGA 1VQ9N 4BG9A 3K59A 1QQOA 4JI4K 5FPDA 1ATRA 4J2BA 4FOIA 4EZ9A 4XEIA 1YJNN 1C1CA 3VA0A 2NRHA 4CD3A 5CE3A 3AO4A 2QWLA 5E26A 3DWLA 2A3ZA 4IG3A 3ENOA 1NKCA 2E2NA 2QWQA 4LY7A 3D2EB 2ZJPL 2GX9A 1VRUA 4B3MK 3NGYA 4CHNA 4FZZA 3JAMO 4M42A 5LY3A 2WUSA 2F7TA 3JYTA 4DR1K 1VSKA 3SUNA 1K8KB 1G99A 3IAYA 3KWIA 3E01A 5AQNA 3OHRA 1WSGA 2NRVA 4DU1A 2YHYA 1GLCG 1S3XA 4DFJA 1NOZA 2D0OA 4JI8K 2QWMA 1FW6A 3ZT0A 3OYCA 3IMXA 3LDLA 1T3VA 2P9NA 2UXDK 1EXQA 1JCFA 1W2BM 4RG8A 1RBVA 4A2AA 5CHIA 2QWNA 4I2QA 2XO7A 3CERA 3E1YA 1T7PA 4KH6A 1IV0A 3F5TA 4DV0K 2D5RA 4AHVA 4JK9A 4CGJA 2UXCK 2W40A 3G25A 4F8RA 4BGBA 2HHXA 3LDPA 4XH4A 2ASOA 1SL2A 4LF6K 2O4IA 3ZSQA 2P9IA 2OTJN 2E6MA 1QZ5A 3WQUA 3CJCA 1BUPA 3VGMA 2G8KA 2E2PA 3WNFA 4DKWA 5I42A 3RVCA 4C23A 2HB5A 3ZSVA 4NLBA 1N32K 4QS8A 3V6DA 3QFUA 4O44A 1S6PA 4C8LA 4BWJA 3RR8A 1FXXA 1S1XA 3SUQA 2YX6A 4X66K 4EZ6A 2NRXA 3CC7N 1S9GA 3VQ7A 5JS1A 5LJWA 1X9WA 3ZSWA 3RMAA 3IKMA 3OJUA 4DF8A 4DV5K 4DFMA 2GUIA 4ISFA 3CPEA 3SMPA 4BC5A 4J2DA 4JV5K 4IJAA 4B9SA 3SK3A 4YOTA 1KAYA 1GOCA 3C95A 3PX4A 3DXMB 4DU3A 1ZBUA 4LF5K 3HL8A 4BGAA 2KW4A 1Q18A 4PA1A 4FJJA 3LP3A 4H0PA 5AQYA 4CZFA 1OH7A 3QNNA 3CHWA 3LL3A 5HLFA 4B9QA 3OY9A 4JI1K 4MO4A 2D0AA 4M3RA 1RDDA 3V81A 4QCLA 4FO0A 4E3SA 4JKCA 5AZIA 1TVRA 3O9RA 3J81O 3ULDA 3CD6N 1TKTA 4IO8A 3OS2A 1IBMK 1YJWN 4C1NI 2WONA 3P39A 4CJRA 4IOCL 2E8AA 4W5OA 3DLHA 3K2PA 2OZMA 4BR7A 3WXJA 1BHLA 3HJFA 2RN2A 1NK9A 2HF3A 4KI4A 1SZ2A 4M45A 1C0MA 3AARA 4DV6K 2OA8A 1WOQA 1UWBA 4E89A 4F2SA 5K14A 4BR0A 1Q81O 4FJGA 3V4IA 4H8KA 3DLBA 4FWPA 4YOXA 4DQ8A 4B3RK 1C0FA 3QEPA 3U9DA 3AGRA 4JKGB 3NE6A 2F8TA 1L5UA 3D2FA 1TKXA 4LF4K 2IAJA 3A2FA 3PSFA 4BRLA 3AVLA 3F9MA 1K9MO 3UKRB 1NBWA 4KAZA 3ID8A 3LWLA 4DSKA 4B1YB 4JI3K 2QXLA 4A2BA 5IWAK 1HKBA 3M3ZA 3DLLL 1BWFO 3RWUA 4ISEA 4BRHA 1DGKN 1IJJA 1SV5A 3HM8A 3BZCA 3D0PA 3H1QA 3K5OA 1VSLA 5AQIA 1Q9YA 1RILA 2X6SA 3LALA 2B4JA 3QEWA 2BGGA 2VG6A 5KTQA 3TAMA 1TL3A 1JJ2M 3CCVN 4CJEA 4YOUA 2DTUA 4BRDA 4HVJA 1U47A 2PAVA 4M41A 4NCGA 1V4SA 4DHYA 1NJIO 3BUZB 2PY5A 5T7BA 3KJVA 3BY5A 4FM0A 1VSJA 2Q0RA 5AQXA 4BDZA 1QVFM 1BQMA 3WXLA 3O3GA 5M1FA 2FBYA 3O9TA 1YXQA 3V9SA 4EHTA 2V7YA 4PL8A 4FJXA 3THYB 5FLXO 1KFSA 5HRRA 5B8HA 4BR5A 4GVEA 5BREA 2KKZA 5GAHP 2P9KB 1OVYA 3TU5A 1TUYA 1U48A 4AHTA 4O4GA 3DAWA 1QS4A 4H0VB 3ZT3A 4M3ZA 3O1WA 5D3GA 2XY7A 5C2DA 2HNYA 1RT1A 4DTJA 3I0RA 1FJGK 3QICA 2C1GA 1GLJO 4WYBA 4Z4GA 4CF2A 3C6TA 1Q9XA 2KFNA 5CYQA 4HCCA 1S1WA 1NGJA 2DPNA 4DQQA 4FWOA 2Z1GA 2P9UA 1N36K 5KQ8A 4DV3K 2QWOA 4PHTX 4KPYA 3KWGA 1Y97A 1ATNA 2DFHA 4AHRA 4E7IA 3DOKA 2P9LB 3CCMN 3MCAB 1QSSA 2A1SA 4DTPA 5IT9O 4DSJA 3BF1A 4F9OA 3O9QA 1XWLA 2PYLA 4JI6K 4DQIA 2YHWA 4JKGA 4AM7A 4FWKA 4K0KK 1JLAA 1E3MA 3C7NA 5C15A 3K0SA 1RTJA 2VGNA 2R7YA 2HHIA 4WQ4A 4KRFA 3TAGA 3UKRA 4BRFA 4YOYA 4FJKA 2OCEA 2ETJA 1ASWA 3VEZA 4WE1A 4H5VA 3SPZA 3CFOA 4CEFA 3TTDA 1JL1A 3O5BA 3VN5A 5AQUA 1S1VA 4KB1A 3P1GA 4CBWA 4CFBA 2OPPA 3LAKA 3E9LA 3WEEB 4BRMA 3S5TA 4CHYA 4BRCA 5FPMA 2QTDA 1W9HA 4ID5A 4BECA 4FW1A 4CEQA 4CEEA 4CJUA 4A59A 3NAEA 1BIZA 2FF3B 3OYEA 3CC2N 4JKEA 4O55A 4CJ3A 3HT3A 1WSHA 4YORA 2BTFA 4HTLA 3L2VA 4CFDA 5KRSA 4CF1A 4IO9L 3O3FA 3GBTA 3NF8A 5BR9A 4LC9B 3T19A 3QIPA 2IS3A 3EE9A 3P83D 3AA4A 3SCXA 3VQEA 3VQCA 1O13A 4IEEA 5BRDA 4LH5A 3BDPA 1O1WA 3M5RA 4N76A 3VEVA 3EZWA 2X6NA 3P38A 2CH5A 4W5QA 5LL6Z 3EKUA 4X64K 1KFDA 1U2VA 2YNIA 1XNRK 4WQ5A 1VHXA 3THYA 3T1YK 3SLCA 3VERA 5ADXA 1HX1A 3ZETA 5JLFA 1SL0A 3QEVA 1VQON 1DLOA 2QM1A 4GY2B 1T44A 3FE1A 4GKJK 3CIPA 3MEEA 2ZD1A 2Z1JA 3KKSA 1ZBSA 3CJ9A 3OYIA 2P9SA 3GOIA 5F2RA 2O8CA 3GE1A 3RMBA 2A40A 3EE8A 1SL1A 3N4QA 1HNVA 3VQ9A 3PIOL 1XMOK 3F73A 1NGHA 5AQZA 3K5NA 3ENHA 3V1RA 4FZYA 4DR5K 4J2EA 2QXFA 3ALYA 1T03A 3DYAA 4W5TA 1L3TA 4G1QA 2P9LA 3MEDA 3AO1A 3PV8A 1I3AA 5AQGA 3FZKA 3O9UA 1LW0A 3ZX0A 1B9DA 4PKIA 4BRIA 3HBTA 3PO4A 3R8EA 2Q36A 1U6ZA 4BE0A 3L6QA 3DXKA 1BIUA 3DLGA 4KH4A 1J5EK 4O8KA 4OGEA 3HSCA 4KKOA 5F1XA 2OYQA 1XMQK 3NVKA 2UUCK 4F2RA 3H6EA 4DU4A 1X9JA 2C1IA 3FFKB 1EP4A 2XRIA 1SQKA 4MDAA 3V1QA 3QEXA 1XI1A 3WEEA 4N56A 1JXBA 4H5TA 3MWPA 3CJ1A 4CHZA 4BEBA 3C6AA 4KO0A 1HJRA 2P51A 4QS9A 3RMCA 2QA4N 2E5LK 1A5WA 3VTHA 5E41A 4WFAL 3VEWA 2VCPA 1C1AA 4BDPA 1L3UA 1NK4A 2P9NB 4FJHA 1JLBA 1ZXOA 3W3DA 3JS6A 4ZTJA 4HUGA 4EP5A 1K6YA 4CJSA 4FLVA 4ISGA 5AQQA 5JVHL 3KLFA 1S72N 3H1VX 5C25A 2FBVA 4JI5K 2JLEA 4JHDB 3AAQA 1XC9A 4KHNA 2A6AA 3TABA 3RSEA 4DTOA 2Q2RA 3RMDA 2P9IB 3R1XA 3NBPA 3C94A 3NF6A 5M1KA 4M7YA 2KHOA 4DTUA 1RDUA 4RW7A 5AQSA 3VQBA 4WCEL 5SZTA 3U8XA 1VSEA 4DQPA 4I2PA 1T6DA 3O80A 3IG1A 3IUCA 4LFAK 2ZGYA 3AO2A 1QQNA 1NGDA 5BN9A 4BREA 2E1ZA 3OYJA 2G8IA 1HYZA 4BE7B 3TSQA 5HBMA 3LWMA 2ZJRL 1NMNA 4NLCA 4LF7K 5KRTA 2OTLN 3T1AA 3KD1E 4JKFA 2E6LA 4FVMA 4FJNA 5AQMA 2NRZA 4CFAA 3T69A 4K8XA 4FJIA 4JNEA 4FLWA 1WUAA 3S3OA 1GLAG 4TSXA 3A5MC 4FK0A 3AVBA 4BQLA 4CI6A 1IO2A 1P90A 5AFUH 4A62A 1YAGA 1OVQA 3J80O 4GMJB 4QS7A 4CGDA 4QOZB 2V7ZA 3HPHA 2ZE2A 4OO1J 3OYDA 5JENA 3U9ZA 1SKRA 3MK6A 2RHKA 4Q0BA 5AZIB 5GADP 1CZ9A 3KK7A 5AQVA 3MN5A 3VQPA 2IVNA 3T3FA 4IZ9A 2GUPA 1NGEA 2X74A 2E4LA 2NRTA 4E7KA 1NG9A 3WXMB 4Z4FA 3LPTA 2XY8A 3CYGA 2HHSA 2OZSA 4OKKA 3H45C 1BOTO 4FPBA 3QDKA 4FWLA 2B6AA 1WAFA 4CJPA 1V4TA 2OPQA 1MDUB 4WF9L 3MWTA 4E7LA 3SQ0A 3VQ5A 4YOWA 5JS2A 5LMNK 4ILHA 4Y1CA 2E20A 5FDLA 3SAHA 3D2FB 3MMVA 2E1YA 1RDCA 4RTFD 1GLLO 4A57A 1E4GT 3JSMA 3KIOA 2A1RA 3PLAA 5HL7L 3QINA 4Q5VA 3C6HA 4JHDA 3DOLA 3SAFA 3VQQA 3EL2A 1TAUA 3RRGA 4PY5A 3H08A 2HBJA 2XY6A 2JGUA 4BC3A 2VQEK 1YVUA 2G8FA 3CQYA 5DK5A 3J7ZO 5KPTA 1ZBIA 4BRQA 1IBLK 3E9OA 3CCRN 3ZSRA 1MWMA 2E88A 3QBWA 3C0BA 4GV3A 4F3OA 5HRNA 1LWFA 2ITGA 3M8RA 4FLTA 4NYFA 2I7PA 3FZLA 3OYAA 2F4VK 2Q31A 3AVJA 4CEOA 2DY4A 2WOMA 2YJFA 4FL9A 4RW4A 1QSYA 3OBWA 2NZTA 4JK8A 4J2AA 1LCUA 3CETA 1HKCA 4BACA 1X1PA 1NK0A 3CF5L 4DWIA 4IOAL 2GBZA 4EIAA 1EX4A 5I3UA 1LW2A 1RBTA 5AQWA 3EEQA 4MLEA 1IG8A 1Z05A 2OANA 4BR4A 3FZMA 1HRHA 2ITMA 1FKOA 3VGLA 1J54A 3OYBA 3EYZA 1NK7A 5KI6A 4JRPA 2CGJA 4PWDA 4FM1A 2H3GX 3LDNA 1GLDG 4DSEA 4G9ZA 1EETA 4FLZA 5HOOA 2FSKA 3CC4N 3AA5X 3AA3A 2NLXA 1NGGA 2HMPA 2P9UB 1KLNA 3KLIA 3DMJA 1CXQA 1RT6A 4CJVA 1KLMA 5J2QA 3TTCA 4B3SK 3WQTA 1VK0A 4X65K 1KXPA 2G8VA 4KFBA 2YKMA 1MWKA 1BA1A 3EY1A 2BH1A 3L4IA 1TK0A 2HHUA 3C7NB 5EXWA 4W5RA 1VQ5N 2QI2A 2YI1A 4CD1A 3R9PA 5AFUA 4FJ5A 4IKFA 4V19S 3CXCM 2EX3A 3SV3A 4YDUA 2OPRA 3OYLA 4MFBA 1BI4A 3AO5A 5TKWA 4AM6A 2HVHA 1BGXT 1JCEA 3OTOK 1RTIA 4CEDA 1VSHA 3HTVA 1BCMA 4JS4A 5C42A 2DFEA 3DRPA 1U04A 4DS5A 5CYMA 4DTMA 1VQ6N 1KCFA 3DRSA 4LD0A 5JLHA 4OLBA 2HBKA 3DJCA 4FWSA 1LAWA 3D7EO 4MQ3A 1FKPA 1HPZA 1RDAA 2YNFA 4BVOA 1CZBA 4AHCA 1KSPA 3L3UA 1ASUA 4CJ7A 2HHWA 4YFUA 4PKHA 4FLUA 3S9HA 3MEGA 3CMAN 4E7JA 1S1TA 3G0ZA 5J1EA 2WFBA 2KTQA 1HMVA 3AO3A 2HOEA 1U49A 4WQ4C 3FZHA 4IXCA 4CZHA 4FSVA 4WFBL 1VQLN 4CBXA 1N8RO 4LF8K 3SV4A 4IG0A 4ILGB 3O1BA 3MX2A 2IVPA 3AVMA 3AVNA 1XHZA 4ELUA 2AP1A 3M6GA 1U2VB 1T05A 4B9UA 2ASPA 1NJWA 1JL2A 1GLBG 3CM6A 3SPYA 4E7HA 4CZKA 1ZC6A 2VWJA 3R3LA 4L8RB 3BZKA 3ZETB 3ZSZA 1YI2N 2GWJA 5BPMA 4GV6A 3L2WA 4RW8A 3VF2A 4Z0UA 2GELA 4QAGA 4KBOA 4CIFA 5A2QO 4Y0WA 2IDOA 4KHPK 3PX0A 4RW9A 3LZJA 5AQFA 3QB0A 1HKGA 2RPIA 3TI0A 3SUPA 2ATQA 4GNIA 3VEYA 2P9SB 4FLXA 2O8CB 1XQSC 3QMLA 4FWMA 2FXUA 2W6LA 1A5VA 1NNEA 3LP1A 3SBTA 3QETA 4ID1A 2Y1IA 1HPMA 3TAEA 4ZTFA 3AVCA 2KZMA 3CFPA 1Z25A 3RR7A 1NGFA 4WQ5C 4AF1A 1A5XA 3LP0A 4N41A 2VG7A 3FFIA 5C0YA 4KV8A 3P5JA 3HPOA 2UU9K 4R79A 4H0TB 3DXKB 3J8AA 4DLEA 2YKNA 1J53A 4B3OA 2X78A 1C6VA 2RF2A 4XH1A 3EN9A 1Q7YO 3VF4A 4AH9A 3SZ2A 2DFFA 4LFBK 4YNQA 1ESVA 3LANA 4OPHA 4I9LA 4E1JA 1KTQA 1VQKN 3MXMA 2CH6A 3QBXA 4IDHA 4O8UA 4O0JA 4KREA 4ICLA 1TGOA 4Z4CA 1VAZA 1NK5A 3V9UA 4KI6A 5DM7L 1KVCA 5HP1A 1SS6A 1S5JA 2I7NA 3VQ6A 1TV6A 4X62K 4I9QA 3A5LC 4OJRA 4M63C 2UYTA 4KTWA 5DM6L 3SUOA 4CJLA 5J2NA 1D9FA 3DLEA 3SQ2A 2KZZA 2HMIA 4Z4HA 1RDWX 3O4WA 3D45A 4CBUA 3EO3A 2A41A 3O4QA 3VQ4A 4BRPA 3FZFA 4FPAA 3L2RA 3THXB 5AQHA 4FXDA 3I0SA 1JLEA 4CZEA 2IOCA 3PY8A 2O8FA 3KLGA 3FGUA 2IVOA 2BUPA 4GVMA 2WBNA 2F9WA 2P5OA 1S6QA 3RSEB 4DLGA 4FZXC 4MO5A 1S22A 3WUHA 3ZT2A 5LMUK 3HRGA 3HP9A 2G8HA 1NGAA 4BROA 3LM9A 1K73O 2Q1NA 3AGKA 4KHSA 3A8YA 1TK5A 3G10A 3T7ZA 1KRPA 4NCAA 4UQGA 1HNXK 3VQAA 4ELTA 2BDPA 4NCBA 4PKGA 3OS1A 1VSMA 4HUEA 1HNWK 2NRRA 3HK2A 1NU0A 3V9XA 1WBDA 2D0PA 3K9JA 4H5RA 2W00A 1VSDA 1N5YA 5GINA 1HQUA 1TK8A 4FLYA 5J2MA 4BDYA 3HOTA 2GV9A 1W0HA 3CCSN 1ZBLA 2PZSA 1YTAA 4F4KA 4DG1A 3O9SA 1ZBHA 4DR6K 3QERA 2ZWHA 3OYFA 2FBXA 4KTQA 2PFUA 3IDHA 3O08A 4CESA 3KD5E 2EHGA 1ATSA 1UAXA 2YCHA 2F96A 3WXIA 5TKYA 4CZMA 3BP8A 4HTUA 3U3YA 4EHUA 1WBBA 3AVGA 3ENBA 4JKAA 1Y64A 4FOEA 3U6FA 1HJOA 3QFPA 1QQCA 4DMNA 4CJKA 1DT9A 2VG5A 4Y1DA 2F9TA 4Z4EA 4B9TA 1HLUA 3NHGA 1C0TA 4NO7A 4XH5A 5HRSA 4H5WA 3L8BA 4PQUA 1NK6A 2O8EB 4E19A 4OKEA 2XY5A 3O8MA 4NB4A 3VMFB 4CF8A 4JK7A 1IKYA 2Y1JA 3ZT1A 1D9DA 1MU2A 1VQNN 5CY4A 3Q7BA 3UIQA 3SI6A 3THVA 3A5NC 4DTXA 3HP6A 1S9EA 4UY8O 3PIPL 4CECA 1Z6RA 1G15A 2JWLA 4CCHA 2O4GA 2P9PB 1XUPO 4BQZA 1VQMN 4ZHRA 4HUFA 3E66A 4DS4A 1W7AA 4KHUA 5J2PA 2WC9A 3NMUA 3I56N 2W42A 1WLJA 4B8CA 4IFYA 5KGWA 5ELZA 2UUBK 1SKSA 5C24A 2E2QA 3THXA 3CJBA 1H1VA 1HNIA 1EKEA 2G8UA 4DTSA 3QLHA 4CERA 1WSEA 2ZF5O 4DV1K 3HSTB 1JLCA 3MCPA 2NUBA 1VSFA 5C10A 2HSTA 4DSLA 1TL1A 5EX5A 3A0IX 3FR0A 5AQLA 4CK3A 2I5JA 4E1MA 3KK1A 4A5AA 3CJAA 4O5BA 3MAQA 2IC3A 4B8AB 1VSIA 3M8PA 1QHTA 5C12A 1BQNA 3ZX3A 3AVIA 1LWEA 4H4MA 3NH1A 4B9LA 4FYDA 3UKUB 3GG4A 1NJXA 4CGGA 2J4RA 4I6MA 1DTQA 4WFNL 4H03B 4CF9A 4CJQA 1NWKA 4KHQA 3S41A 1NLVA 2Q97A 4M3YA 1T8EA 4AHUA 1D4XA 2YHBA 3HXMA 2O8DB 4B08A 4H0YB 1HYVA 3IRXA 2V52B 1M90O 4PL7A 2FBTA 4BWMA 4NXMK 2FC0A 4JI7K 1Q8IA 1NGIA 4H0OA 1NKEA 1R59O 2HVIA 4JYAK 5FPEA 2HHQA 3VGKA 3CCEN 3J7YP 3NF9A 4JI2K 4BR2A 3MXIA 2W41A 4BRGA 3K57A 1TKZA 3HYFA 3CCJN 1QE1A 5BPLA 3ID6A 3DLKA 1YITN 5AQTA 1LWCA 3SQ1A 2IGIA 2O8EA 1RBUA 5BN8A 4K43A 4CJFA 4DQRA 3F2KA 4JKHA 3CCQN 1RCHA 4DR2K 3TAPA 4GV9A 4EAHD 3TAFA 2Q3SA 3TARA 4IWVA 3FLCO 4CEBA 3O6WA 3JXUA 1X3MA 1R0AA 1WB9A 2GEMA 3E9PA 5HRPA 2WTUA 2D0BA 1LAVA 3LDSA 2YJEA 2P9PA 5CZ2A 1SKWA 3M8QA 4CF0A 1F21A 2VGMA 3BEXA 3ZT4A 1RTHA 3MN6A
chains in the Genus database with same CATH topology
3CXCM 1YIJN 3O5BA 4YDUA 1YUWA 1Q86O 3LDOA 4IEIA 5AQUA 4AM6A 4CBWA 5TKWA 3WT0A 3ZX2A 3E9LA 1JCEA 3WEEB 3SAGA 2A5XA 1BA0A 4MLHA 4CZJA 3HTVA 1NM1A 4BRMA 3G71N 3ZYYX 4BRCA 5FPMA 2QTDA 3ATVA 1KQSM 1VQ6N 3M1FA 4BECA 5JLHA 2HBKA 3DJCA 4A59A 2QWRA 4FWSA 3I8BA 1J6ZA 3ZEUA 2FF3B 3D7EO 2RE2A 3CC2N 4XJXA 4JKEA 3H3OB 1KD1O 2NNWA 4YORA 2BTFA 3KVGA 4HTLA 1Q82O 2D4WA 4BVOA 4K25A 2QEXN 5CR4A 4IO9L 2FLOA 3GBTA 1NGBA 5BR9A 4CJ7A 3TPQA 4PKHA 4LC9B 3N4PA 3OW2M 3EE9A 4CZIA 1X3NA 3CMAN 4RWTA 3UKUA 3SBGA 1O13A 2WFBA 5GIPA 4IEEA 5BRDA 5JICA 3M5RA 2HOEA 4DB3A 3AAPA 3IFRA 4WQ4C 3VEVA 3EZWA 3FZHA 4IXCA 5BRHA 1VQ8N 4CZHA 4FSVA 3P38A 4WFBL 3CCUN 2GTDA 1VQLN 2CH5A 3EKUA 3MX5A 4CBXA 1N8RO 3BF3A 3UE5A 1U2VA 4WQ5A 4FWRA 3WXKA 4ILGB 5GIOA 3O1BA 3MX2A 2IVPA 1RFQA 3CCLN 4YDUC 1YJ9N 4JEPA 3SLCA 1QVGM 2AP1A 3HOSA 4JKBA 3M6GA 1HX1A 3VERA 1U2VB 5ADXA 3ZETA 5JLFA 1C0GA 4IFEA 1VQON 2ASPA 4JD2A 1NMDA 1GLBG 3MN7A 5AQRA 1TYQA 3ULEA 2QM1A 4GY2B 1T44A 1QQMA 3FE1A 3CIPA 1ZC6A 2NRWA 3R3LA 3VENA 4CZKA 1GLEG 5H1SQ 3ZETB 4FVUA 3GL1A 4JD2B 4YOVA 1YI2N 2GWJA 3UB5A 5BPMA 4GV6A 3ULEB 1TYQB 3VOVA 3VF2A 1ZBSA 1YHQN 4K41A 2GELA 1BDGA 4KBOA 3CJ9A 4BVPA 2P9SA 3GOIA 4DCHA 2IIRA 5F2RA 3GE1A 4Y0WA 2JWKA 2A40A 3EE8A 3N4QA 1VQ9N 3PIOL 5AQFA 4BG9A 3QB0A 1HKGA 1QQOA 3L4QA 2CGKA 1NGHA 3VEYA 1ATRA 4GNIA 2P9SB 4FOIA 2A42A 5AQZA 5FPDA 4XEIA 1YJNN 3KZBA 3LDQA 3ENHA 3VPZA 1XQSC 3QMLA 2NRHA 3HZ6A 4FWMA 2FXUA 4CD3A 5CE3A 2P9LA 3SBTA 2QWLA 5E26A 3DWLA 3D2EA 2A3ZA 3FZKA 1HPMA 5AQGA 3O9UA 2VWBA 1MA9B 4PKIA 3ZX0A 4O5FA 3ENOA 3HBTA 3OBYA 4BRIA 2E2NA 2QWQA 3D2EB 2ZJPL 3R8EA 2Q36A 2GX9A 4J8FA 1NGFA 1U6ZA 4WQ5C 4AF1A 5F0XA 1YF5L 2V51B 3L6QA 3DXKA 1K8KA 4KH4A 4RCHA 5LY3A 2WUSA 4O8KA 2F7TA 5C0YA 3HSCA 5F1XA 5LJVA 1M1KO 3NVKA 4R79A 4H0TB 3DXKB 5EVZA 1K8KB 3H6EA 1G99A 3J8AA 1X9JA 3L0QA 2C1IA 3KWIA 5AQNA 3FFKB 3OHRA 2NRVA 5JVGL 1XC3A 1SQKA 2YHYA 3EN9A 1GLCG 1S3XA 3GDQA 4MDAA 4XH1A 3VF4A 2D0OA 1Q7YO 3WEEA 2QWMA 5C2FA 4H5TA 3MWPA 4B1WB 3CJ1A 4BEBA 4IJNA 1ESVA 1BG3A 3C6AA 5AQKA 3SJHA 3NVMA 3IMXA 4IOXA 1LOTB 4OPHA 2HBMA 3LDLA 4E1JA 4QS9A 1T3VA 2P9NA 1VQKN 2QA4N 3TTFA 3CPWM 1JCFA 1W2BM 5EOYA 3VTHA 2CH6A 3QBXA 2PBDA 3VEWA 4A2AA 5CHIA 2ASMA 2VCPA 2QWNA 4IDHA 4O8UA 4B1UB 4BC2A 2P9NB 1VAZA 3CERA 5I9EB 1ZXOA 3W3DA 3JS6A 3E1YA 4KH6A 3MN9A 3F5TA 4FWQA 3VEOA 5DM7L 1SS6A 2I7NA 4ISGA 4JK9A 5AQQA 5JVHL 2W40A 3A5LC 3G25A 5ADXH 1KC8O 4BGBA 4M63C 2UYTA 5DM6L 3LDPA 2HF4A 1S72N 3H1VX 3H46O 1RDWX 3O4WA 4XH4A 4CBUA 3EO3A 5AZJB 2ASOA 2P9IA 2A41A 5FPNA 4JHDB 2OTJN 3AAQA 4BRPA 2A6AA 3FZFA 4FPAA 4JAXA 5AQHA 1QZ5A 3WQUA 3RSEA 4CZEA 3CJCA 1BUPA 3VGMA 2E2PA 2Q2RA 4DKWA 2P9IB 3R1XA 3RVCA 4C23A 3FGUA 4WFAL 2IVOA 5M1KA 2BUPA 2WBNA 4M7YA 2F9WA 4NLBA 3RSEB 2KHOA 3CI5A 1SAZA 1RDUA 4MO5A 1BU6O 4QS8A 1S22A 1YVNA 3QFUA 5AQSA 3WUHA 4WCEL 1VQ7N 3U8XA 3HRGA 5M1QA 1T6DA 3O80A 2YX6A 3TSPA 1NGAA 4BROA 2NRXA 3IUCA 3LM9A 3CC7N 2ZGYA 1K73O 1QQNA 2Q1NA 3AGKA 5LJWA 1NGDA 1T6CA 3A8YA 5BN9A 3IKMA 4BREA 4JN4A 5JMVA 3P31A 2E1ZA 2QW9A 3T7ZA 4ISFA 3CPEA 3SMPA 4BC4A 4BC5A 4BE7B 5KPRA 3TSQA 2FF6A 3DXMA 4IJAA 5M1NA 2ZJRL 4NLCA 3SK3A 4YOTA 4MDBA 1KAYA 2OTLN 4PKGA 3DXMB 4JKFA 5EY4A 4BGAA 5AQMA 2NRZA 1Q18A 3T69A 2NRRA 4H0PA 5AQYA 2D0PA 3K9JA 4CZFA 4H5RA 2W00A 3P4IA 4BG8A 5GINA 5KQDA 4JNEA 1WUAA 1GLAG 3A5MC 3CHWA 3LL3A 4B9QA 4B1VA 4BQLA 3HI0A 4MO4A 4C1NK 4CI6A 1P90A 2E2OA 5AFUH 3HOTA 2ZJQL 4A62A 1YAGA 3CCSN 3I55N 4BY9C 3O9SA 2FSJA 4QS7A 4FO0A 2ZWHA 4JKCA 5AZIA 2V7ZA 2PFUA 3IDHA 3O08A 3O9RA 3CD6N 4OO1J 1ATSA 4IO8A 3U9ZA 2YCHA 3WXIA 3AY9A 5TKYA 4CZMA 3BP8A 3MK6A 2RHKA 1YJWN 4C1NI 4EHUA 5AZIB 3ENBA 3P39A 5GADP 4JKAA 4IOCL 1Y64A 2E8AA 3R6MA 4FOEA 3Q7CA 1HJOA 3KK7A 3QFPA 5AQVA 4U67L 4BR7A 2VYPA 3MN5A 3WXJA 1VQPN 3VESA 1DT9A 1E4FT 2IVNA 2F9TA 2HF3A 2GUPA 4IZ9A 1QHAA 1HLUA 1NGEA 5AR0A 1SZ2A 3VEXA 4NO7A 4A61A 4XH5A 2NRTA 3AARA 4H5WA 3WXMB 3A5OC 1WOQA 3O8MA 4NB4A 3VMFB 4JK7A 4BR0A 4H0XB 3H45C 1BOTO 4FPBA 3QDKA 1Q81O 4FWLA 4FWPA 4YOXA 1VQNN 3Q7BA 4DQ8A 1C0FA 3U9DA 1HUXA 3AGRA 3A5NC 4JKGB 5M1PA 3D2FA 1OKJA 4UY8O 1V4TA 2HBLA 4Z94A 1MDUB 4OPAA 5MLCQ 1NGCA 3MWTA 4WF9L 2ZGZA 4BRLA 3PIPL 1Z6RA 3OA9A 4YOWA 1P8ZA 2JWLA 3F9MA 4ILHA 1K9MO 2E20A 4HWIA 3SAHA 2P9PB 1XUPO 3D2FB 1DEJA 2GWKA 1NBWA 3MMVA 3UKRB 4BQZA 1VQMN 2E1YA 1QZ6A 4FWNA 3W0LA 3E66A 3ID8A 4RTFD 1GLLO 4A57A 1E4GT 2WC9A 4CZGA 3I56N 3NMUA 5AZJA 5ELZA 3PLAA 5HL7L 4B1YB 2QXLA 4A2BA 1HKBA 3C6HA 3M3ZA 4JHDA 2E2QA 3G6EN 3DLLL 3SAFA 1BWFO 2FSNA 5AQJA 3EL2A 3CJBA 1H1VA 4ISEA 4BRHA 1DGKN 2HBJA 4KH5A 4L3QA 1IJJA 2ZF5O 3VTIA 4BC3A 3HM8A 3MCPA 3H1QA 4K42A 3CQYA 2Q0UA 1JCGA 5C10A 5AQIA 2HSTA 5KPTA 3J7ZO 4BRQA 5EX5A 4B1ZA 3A0IX 2EWSA 3ZEUB 3E9OA 3CCRN 3FR0A 5AQLA 5BPNA 5BRFA 1KAZA 5GAGP 4A5BA 1MWMA 2E88A 4A5AA 3QBWA 3C0BA 3CJAA 4BRKA 4GV3A 4M7XA 2QWPA 3VETA 1JJ2M 3CCVN 5C12A 2KLAA 3D6RA 4YOUA 3ZX3A 1K8AO 4BRAA 3UKUB 3GG4A 2I7PA 4BRDA 3FZLA 2PAVA 1V4SA 4DHYA 2Q31A 1NJIO 2J4RA 3BUZB 1DKGD 3KHYA 5M1OA 4H5NA 2YJFA 4I6MA 3LM2A 4FL9A 4WFNL 3OBWA 2NZTA 4H03B 4JK8A 3SMSA 2Q0RA 1NWKA 5AQXA 4BRNA 1QVFM 1LCUA 3S41A 1NLVA 3CETA 1HKCA 2Q97A 3WXLA 5M1FA 3O9TA 1YXQA 3U4LA 4I6MB 3MDQA 4EHTA 2V7YA 2P9KA 3CF5L 1D4XA 4IOAL 5KPZA 4PL8A 4EIAA 3CMEN 4H0YB 5B8HA 4BR5A 2V52B 1M90O 4GVEA 3H3NO 4PL7A 5BREA 2KKZA 5GAHP 2P9KB 1OVYA 3C65A 5AQWA 3TU5A 1TUYA 3TSUA 1NGIA 1IG8A 1KAXA 1Z05A 2OANA 3CQXA 4MLEA 4H0OA 4BR4A 3DAWA 1R59O 1RGIA 4H0VB 5AQPA 5FPEA 3FZMA 3O1WA 2ITMA 3VGKA 2AA4A 3VF6A 5C2DA 3CCEN 3K9KA 3VGLA 3I33A 3EKSA 4BR2A 2YHXA 1W97L 3QICA 2C1GA 2W41A 1GLJO 4WYBA 4BRGA 2CGJA 1VQ4N 4CZLA 1NGJA 2H3GX 3LDNA 1GLDG 2DPNA 5AQOA 4FWOA 3CCJN 5BPLA 2P9UA 5KQ8A 3ID6A 4G9ZA 2QWOA 1YITN 1CZAN 4PHTX 5AQTA 5HOOA 2FSKA 3CC4N 3KWGA 2NLXA 1NGGA 1GLFO 2HMPA 5BN8A 4K43A 1TUUA 2P9UB 1ATNA 4BR9A 5E84A 3F2KA 4ILJA 4JKHA 3CCQN 2P9LB 3CCMN 3TTCA 3MCAB 3WQTA 4GV9A 4EAHD 1KXPA 1EO1A 3BF1A 4F9OA 3O9QA 4IWVA 2YHWA 4JKGA 3FLCO 1MWKA 3B8AX 4AM7A 3G4SN 4FWKA 1ILYA 4U7BA 3C7NA 3O6WA 1BA1A 1X3MA 2D1KA 3JXUA 5C15A 2BH1A 2GEMA 3L4IA 3E9PA 3CJ7A 1EQYA 2VGNA 4JKDA 2YJEA 2P9PA 4WQ4A 3C7NB 3UKRA 5EXWA 4BRFA 2CGLA 4YOYA 4EFHA 3ATUA 1VQ5N 2VGMA 1BO5O 2QI2A 3BEXA 3VEZA 5GAEP 2YI1A 4CD1A 3R9PA 4H5VA 5AFUA 3MN6A 4B1XB 3TTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5B A;  4YDU A;  1YUW A;  3LDO A;  5AQU A;  4AM6 A;  4CBW A;  3WT0 A;  3ZX2 A;  1JCE A;  3WEE B;  2A5X A;  1BA0 A;  4MLH A;  4CZJ A;  3HTV A;  1NM1 A;  4BRM A;  4BRC A;  5FPM A;  3ATV A;  3M1F A;  5JLH A;  3DJC A;  2QWR A;  4FWS A;  3I8B A;  1J6Z A;  3ZEU A;  2FF3 B;  3D7E O;  3H3O B;  2BTF A;  3KVG A;  4HTL A;  2D4W A;  4BVO A;  4K25 A;  2FLO A;  3GBT A;  1NGB A;  5BR9 A;  4CJ7 A;  3TPQ A;  4PKH A;  4LC9 B;  4CZI A;  1X3N A;  4RWT A;  3UKU A;  5BRD A;  5JIC A;  2HOE A;  4DB3 A;  3AAP A;  3IFR A;  4WQ4 C;  3VEV A;  3EZW A;  3FZH A;  4IXC A;  5BRH A;  4CZH A;  4FSV A;  2GTD A;  2CH5 A;  3EKU A;  4CBX A;  3BF3 A;  3UE5 A;  1U2V A;  4WQ5 A;  4FWR A;  3WXK A;  3O1B A;  2IVP A;  1RFQ A;  4YDU C;  3SLC A;  2AP1 A;  3VER A;  3M6G A;  1HX1 A;  5ADX A;  1U2V B;  3ZET A;  5JLF A;  1C0G A;  2ASP A;  4JD2 A;  1NMD A;  1GLB G;  3MN7 A;  5AQR A;  1TYQ A;  3ULE A;  2QM1 A;  4GY2 B;  1T44 A;  3FE1 A;  1QQM A;  3CIP A;  1ZC6 A;  3VEN A;  4CZK A;  1GLE G;  3ZET B;  3GL1 A;  4JD2 B;  2GWJ A;  3UB5 A;  5BPM A;  3ULE B;  1TYQ B;  3VOV A;  3VF2 A;  1ZBS A;  4K41 A;  2GEL A;  1BDG A;  4KBO A;  3CJ9 A;  4BVP A;  2P9S A;  3GOI A;  4DCH A;  2IIR A;  5F2R A;  3GE1 A;  4Y0W A;  2A40 A;  5AQF A;  4BG9 A;  3QB0 A;  1HKG A;  1QQO A;  2CGK A;  1NGH A;  3VEY A;  1ATR A;  4GNI A;  2P9S B;  4FOI A;  2A42 A;  5AQZ A;  5FPD A;  4XEI A;  3KZB A;  3LDQ A;  3ENH A;  3VPZ A;  1XQS C;  3QML A;  2NRH A;  3HZ6 A;  4FWM A;  2FXU A;  4CD3 A;  5CE3 A;  2P9L A;  2QWL A;  5E26 A;  3DWL A;  3D2E A;  2A3Z A;  3FZK A;  1HPM A;  5AQG A;  2VWB A;  1MA9 B;  4PKI A;  3ZX0 A;  4O5F A;  3ENO A;  3HBT A;  4BRI A;  2E2N A;  2QWQ A;  3D2E B;  3R8E A;  2Q36 A;  4J8F A;  1NGF A;  1U6Z A;  4WQ5 C;  5F0X A;  2V51 B;  3L6Q A;  3DXK A;  1K8K A;  4RCH A;  5LY3 A;  2WUS A;  4O8K A;  3HSC A;  5F1X A;  5LJV A;  4H0T B;  3DXK B;  5EVZ A;  1K8K B;  3H6E A;  1G99 A;  3J8A A;  1X9J A;  3L0Q A;  5AQN A;  3FFK B;  3OHR A;  1XC3 A;  1SQK A;  2YHY A;  3EN9 A;  1GLC G;  1S3X A;  3GDQ A;  4XH1 A;  3VF4 A;  2D0O A;  3WEE A;  2QWM A;  4H5T A;  4B1W B;  3CJ1 A;  4IJN A;  1ESV A;  1BG3 A;  5AQK A;  3SJH A;  3IMX A;  1LOT B;  3LDL A;  4E1J A;  4QS9 A;  2P9N A;  1JCF A;  5EOY A;  2CH6 A;  3QBX A;  2PBD A;  3VEW A;  4A2A A;  2ASM A;  2VCP A;  2QWN A;  4B1U B;  4BC2 A;  2P9N B;  3CER A;  5I9E B;  1ZXO A;  3W3D A;  3JS6 A;  3MN9 A;  4FWQ A;  3VEO A;  2I7N A;  4ISG A;  5AQQ A;  2W40 A;  3A5L C;  3G25 A;  5ADX H;  4BGB A;  4M63 C;  2UYT A;  3LDP A;  2HF4 A;  3H1V X;  3H46 O;  1RDW X;  3O4W A;  4XH4 A;  4CBU A;  3EO3 A;  5AZJ B;  2ASO A;  2P9I A;  2A41 A;  5FPN A;  4JHD B;  3AAQ A;  4BRP A;  2A6A A;  3FZF A;  4FPA A;  4JAX A;  5AQH A;  1QZ5 A;  3WQU A;  3RSE A;  4CZE A;  3CJC A;  1BUP A;  3VGM A;  2E2P A;  2Q2R A;  2P9I B;  4C23 A;  3FGU A;  2IVO A;  2BUP A;  4M7Y A;  2F9W A;  3RSE B;  2KHO A;  3CI5 A;  1SAZ A;  4MO5 A;  1BU6 O;  4QS8 A;  1S22 A;  1YVN A;  3QFU A;  5AQS A;  3WUH A;  3U8X A;  1T6D A;  3O80 A;  1NGA A;  4BRO A;  3IUC A;  3LM9 A;  2ZGY A;  1QQN A;  2Q1N A;  5LJW A;  1NGD A;  1T6C A;  3A8Y A;  5BN9 A;  4BRE A;  5JMV A;  4JN4 A;  2E1Z A;  2QW9 A;  4ISF A;  3SMP A;  4BC4 A;  4BC5 A;  5KPR A;  2FF6 A;  3DXM A;  4IJA A;  3SK3 A;  1KAY A;  4PKG A;  3DXM B;  5EY4 A;  4BGA A;  5AQM A;  1Q18 A;  4H0P A;  5AQY A;  2D0P A;  4CZF A;  4H5R A;  3P4I A;  4BG8 A;  5KQD A;  4JNE A;  1WUA A;  1GLA G;  3A5M C;  3CHW A;  3LL3 A;  4B9Q A;  4B1V A;  4BQL A;  3HI0 A;  4MO4 A;  4CI6 A;  2E2O A;  5AFU H;  4A62 A;  1YAG A;  2FSJ A;  4QS7 A;  4FO0 A;  2ZWH A;  5AZI A;  2V7Z A;  3IDH A;  3O08 A;  1ATS A;  4IO8 A;  3U9Z A;  2YCH A;  3WXI A;  3AY9 A;  5TKY A;  4CZM A;  3BP8 A;  3MK6 A;  4EHU A;  5AZI B;  1Y64 A;  2E8A A;  3R6M A;  4FOE A;  1HJO A;  3QFP A;  5AQV A;  4BR7 A;  2VYP A;  3MN5 A;  3WXJ A;  3VES A;  1E4F T;  2IVN A;  2F9T A;  2HF3 A;  2GUP A;  4IZ9 A;  1QHA A;  1HLU A;  1NGE A;  5AR0 A;  1SZ2 A;  3VEX A;  4NO7 A;  4A61 A;  4XH5 A;  3AAR A;  4H5W A;  3A5O C;  1WOQ A;  3O8M A;  4NB4 A;  4BR0 A;  4H0X B;  3H45 C;  1BOT O;  4FPB A;  3QDK A;  4FWL A;  4FWP A;  4DQ8 A;  1C0F A;  3U9D A;  1HUX A;  3A5N C;  3D2F A;  1OKJ A;  1V4T A;  4Z94 A;  1MDU B;  1NGC A;  2ZGZ A;  4BRL A;  1Z6R A;  1P8Z A;  3F9M A;  2E20 A;  4HWI A;  2P9P B;  1XUP O;  3D2F B;  1DEJ A;  2GWK A;  1NBW A;  3MMV A;  3UKR B;  4BQZ A;  2E1Y A;  1QZ6 A;  4FWN A;  3W0L A;  3ID8 A;  4RTF D;  1GLL O;  1E4G T;  4CZG A;  5AZJ A;  5ELZ A;  4B1Y B;  2QXL A;  4A2B A;  1HKB A;  3M3Z A;  4JHD A;  2E2Q A;  1BWF O;  2FSN A;  5AQJ A;  3EL2 A;  3CJB A;  1H1V A;  4ISE A;  4BRH A;  1DGK N;  4L3Q A;  1IJJ A;  2ZF5 O;  4BC3 A;  3HM8 A;  3MCP A;  3H1Q A;  4K42 A;  3CQY A;  2Q0U A;  1JCG A;  5AQI A;  5KPT A;  4BRQ A;  5EX5 A;  4B1Z A;  3A0I X;  2EWS A;  3ZEU B;  3FR0 A;  5AQL A;  5BPN A;  5BRF A;  1KAZ A;  1MWM A;  2E88 A;  3QBW A;  3C0B A;  3CJA A;  4BRK A;  4M7X A;  2QWP A;  3VET A;  3ZX3 A;  4BRA A;  3UKU B;  3GG4 A;  2I7P A;  4BRD A;  3FZL A;  2PAV A;  1V4S A;  4DHY A;  2Q31 A;  2J4R A;  3BUZ B;  1DKG D;  3KHY A;  4H5N A;  2YJF A;  4I6M A;  3LM2 A;  4FL9 A;  2NZT A;  4H03 B;  3SMS A;  2Q0R A;  1NWK A;  5AQX A;  4BRN A;  1LCU A;  3S41 A;  1NLV A;  3CET A;  1HKC A;  2Q97 A;  3WXL A;  1YXQ A;  3U4L A;  4I6M B;  3MDQ A;  4EHT A;  2V7Y A;  2P9K A;  1D4X A;  5KPZ A;  4PL8 A;  4EIA A;  4H0Y B;  5B8H A;  4BR5 A;  2V52 B;  4PL7 A;  3H3N O;  5BRE A;  2P9K B;  3TU5 A;  5AQW A;  1TUY A;  1NGI A;  3CQX A;  1IG8 A;  1KAX A;  1Z05 A;  2OAN A;  4MLE A;  4H0O A;  4BR4 A;  3DAW A;  1R59 O;  1RGI A;  4H0V B;  5AQP A;  5FPE A;  3FZM A;  3O1W A;  2ITM A;  3VGK A;  2AA4 A;  3VF6 A;  3VGL A;  3I33 A;  3EKS A;  4BR2 A;  2YHX A;  3QIC A;  2W41 A;  1GLJ O;  4WYB A;  4BRG A;  2CGJ A;  4CZL A;  1NGJ A;  2H3G X;  3LDN A;  1GLD G;  2DPN A;  5AQO A;  4FWO A;  5BPL A;  2P9U A;  5KQ8 A;  2QWO A;  1CZA N;  5AQT A;  2FSK A;  2NLX A;  1NGG A;  1GLF O;  2HMP A;  5BN8 A;  4K43 A;  1TUU A;  2P9U B;  1ATN A;  4BR9 A;  5E84 A;  2P9L B;  3WQT A;  4EAH D;  1KXP A;  3BF1 A;  4F9O A;  4IWV A;  2YHW A;  3FLC O;  1MWK A;  3B8A X;  4AM7 A;  4FWK A;  3C7N A;  3O6W A;  1BA1 A;  1X3M A;  2D1K A;  3JXU A;  2GEM A;  3L4I A;  3CJ7 A;  1EQY A;  2YJE A;  2P9P A;  4WQ4 A;  3C7N B;  3UKR A;  5EXW A;  4BRF A;  2CGL A;  4EFH A;  3ATU A;  1BO5 O;  3BEX A;  3VEZ A;  2YI1 A;  4CD1 A;  3R9P A;  4H5V A;  5AFU A;  3MN6 A;  4B1X B; 
#chains in the Genus database with same CATH topology
 3I8D A;  2ZM6 K;  4IEI A;  3WT0 A;  4FM2 A;  4YY3 K;  1BA0 A;  4MLH A;  3AVF A;  1ZYQ A;  1NM1 A;  3L3V A;  2BAN A;  1YT3 A;  3ZYY X;  3ATV A;  3B6O A;  1KQS M;  1BI4 B;  3M1F A;  4DTR A;  1X9M A;  4DUZ K;  2RE2 A;  4XJX A;  3PUF A;  1RT3 A;  3H3O B;  3ISN C;  1KD1 O;  4LFC K;  2NNW A;  3KVG A;  5AJ3 K;  2Z1I A;  4K25 A;  4CHQ A;  1JLF A;  3QES A;  1NJZ A;  3CG7 A;  4DUY K;  2PYJ A;  1NGB A;  3TPQ A;  3OW2 M;  4CZI A;  1X3N A;  4FJ9 A;  3UKU A;  1C0U A;  1QSL A;  2O8B B;  3SBG A;  4CHO A;  5GIP A;  3NGI A;  3AAP A;  3IFR A;  4AQY K;  5BRH A;  3CCU N;  1CXU A;  1RBR A;  3AVK A;  3MX5 A;  3BF3 A;  1XNQ K;  3THW B;  1HQE A;  2OPS A;  1CLQ A;  4FWR A;  2O8D A;  3WXK A;  2P1J A;  5GIO A;  3KLE A;  4YDU C;  1OH5 A;  4JEP A;  2LSN A;  2YNH A;  3HOS A;  5HRO A;  4DSI A;  4CJ4 A;  1C0G A;  4JD2 A;  1NMD A;  4CW7 B;  3MN7 A;  5AQR A;  1TYQ A;  2BE2 A;  3ULE A;  1QQM A;  5H1S Q;  2NRW A;  4C8M A;  3KLH A;  1GLE G;  4JS5 A;  4FVU A;  4JLH A;  4YOV A;  2ZQB A;  1YHQ N;  1REV A;  4K41 A;  4FK4 A;  4B9V A;  4DCH A;  2IIR A;  3ZCM A;  1N33 K;  3U3G A;  3L4Q A;  2CGK A;  3WNE A;  2Z1H A;  2A42 A;  3KZB A;  3LDQ A;  4M3T A;  3VPZ A;  2KFZ A;  4OX9 K;  3HZ6 A;  3D2E A;  5BR8 K;  2VWB A;  1MA9 B;  3AA2 A;  4CVN E;  4O5F A;  3OBY A;  4H4O A;  2YV0 X;  3SYZ A;  3SQ4 A;  4J8F A;  5F0X A;  5DMR A;  1YF5 L;  2V51 B;  1RT2 A;  1K8K A;  3VQD A;  1L3V A;  1WN7 A;  3NF7 A;  4RCH A;  1N34 K;  5SWM A;  1NKB A;  5LJV A;  3KKR A;  1M1K O;  5FRN A;  4CIE A;  1NK8 A;  1ZBF A;  5EVZ A;  3L0Q A;  4CE9 A;  4DFP A;  1C1B A;  3OYG A;  5JVG L;  1XC3 A;  3GDQ A;  3DI6 A;  5C2F A;  4B1W B;  1HYS A;  4IJN A;  1BG3 A;  2VWK A;  5AQK A;  3SJH A;  3NVM A;  4IOX A;  1LOT B;  2HBM A;  4LSL A;  3VA3 A;  3DM2 A;  3TTF A;  3CPW M;  3RTV A;  5EOY A;  4K8Z A;  3LAM A;  2PBD A;  3ZSX A;  2ASM A;  4ELV A;  4B1U B;  3KK2 A;  4BC2 A;  5I9E B;  3MN9 A;  4FWQ A;  1EWR A;  3VEO A;  4BE1 A;  4YHH K;  3OJS A;  5ADX H;  1KC8 O;  2O8B A;  1JXE A;  4E1N A;  2P5G A;  2HF4 A;  3H46 O;  5AZJ B;  4KHW A;  1UA0 A;  4GKK K;  5FPN A;  4JAX A;  3DRR A;  3V1O A;  3THW A;  3HPG A;  5EU7 A;  4CJW A;  4FCY A;  3CI5 A;  1SAZ A;  2O8F B;  1BU6 O;  3OYN A;  1YVN A;  2D0C A;  1VQ7 N;  5M1Q A;  4KHY A;  4B3T K;  4FJ7 A;  3TSP A;  1N6Q A;  3LZI A;  3WNG A;  3PO5 A;  1T6C A;  5JMV A;  4JN4 A;  3P31 A;  4W5N A;  2QW9 A;  4BC4 A;  5KPR A;  1DTT A;  2FF6 A;  1BIS A;  3DXM A;  5M1N A;  4FJM A;  3OS0 A;  4MDB A;  4DV2 K;  2UXB K;  1L3S A;  1WAJ A;  1RDB A;  1Z26 A;  5EY4 A;  4C8N A;  4CGH A;  2UUA K;  3VQ8 A;  3OVN A;  3P4I A;  3C6U A;  4BG8 A;  5KQD A;  1RT4 A;  1U45 A;  4B1V A;  3HI0 A;  4C1N K;  1FK9 A;  2E2O A;  2ZJQ L;  1B9F A;  4BY9 C;  4DTN A;  3I55 N;  1OH6 A;  3TAQ A;  4CIG A;  2FSJ A;  3CFR A;  4DQS A;  1IG9 A;  4CGI A;  1X9S A;  4LH4 A;  1GOB A;  3LP2 A;  4M3X A;  3AY9 A;  4DR3 K;  4DR4 K;  2YHA A;  3R6M A;  3Q7C A;  2F8S A;  2W6K A;  5CZ1 A;  4U67 L;  2VYP A;  5KGX A;  1VQP N;  1RBS A;  3VES A;  1E4F T;  1QHA A;  3J7A P;  5AR0 A;  3VEX A;  4IFV A;  4A61 A;  4C8K A;  4OPK A;  4IDK A;  1EWQ A;  1IKX A;  3A5O C;  3ASM A;  3HO1 A;  1XHX A;  4H0X B;  4E72 A;  4E0D A;  1S1U A;  3V9Z A;  4DR7 K;  1IH7 A;  1HUX A;  3K58 A;  2G8W A;  5M1P A;  4GW6 A;  1BCO A;  1OKJ A;  2HBL A;  4Z94 A;  4OPA A;  5MLC Q;  1NGC A;  1YTU A;  2ZGZ A;  3OA9 A;  1P8Z A;  3EZ5 A;  4OKJ A;  4HWI A;  1DEJ A;  2GWK A;  3F9K A;  3WNH A;  3S3M A;  1QZ6 A;  4FWN A;  3W0L A;  4CZG A;  5AZJ A;  1RNH A;  2VQF K;  3ZSO A;  3ITH A;  3G6E N;  2HHH K;  2FSN A;  5FRM A;  5AQJ A;  1KVA A;  4KH5 A;  4L3Q A;  1VRT A;  3VTI A;  3RRH A;  4AIL C;  4N5S A;  2QKB A;  4K42 A;  2Q0U A;  1JCG A;  1D5A A;  4B1Z A;  4EP4 A;  2EWS A;  3ZEU B;  5BRF A;  5BPN A;  3NDK A;  2QKK A;  1KAZ A;  5GAG P;  4A5B A;  4IBN A;  3MEC A;  4BRK A;  4HCB A;  4M7X A;  4XIU A;  2QWP A;  3VET A;  4JRQ A;  3M8S A;  2KLA A;  3D6R A;  2AJQ A;  1K8A O;  4FJ8 A;  3NH2 A;  4BRA A;  3T1H K;  4C8O A;  1J5O A;  4HHT A;  4LSN A;  3KHY A;  1DKG D;  5M1O A;  4H5N A;  4CEA A;  3LM2 A;  3SMS A;  1HR0 K;  4BRN A;  3TWH A;  4CEZ A;  3U4L A;  4I6M B;  4CFC A;  3MDQ A;  4M3U A;  2P9K A;  4B9M A;  1ITG A;  4CGF A;  5KPZ A;  1U4B A;  4OGC A;  3CME N;  1IKV A;  3S3N A;  3H3N O;  3KK3 A;  1J9A A;  2HHT A;  1OH8 A;  3C65 A;  3SNN A;  3ZLJ A;  3NCI A;  3TSU A;  1KAX A;  3CQX A;  3K5M A;  3K5L A;  1QTM A;  1RGI A;  1LV5 A;  5AQP A;  2HW3 A;  4LF9 K;  2HNZ A;  2AA4 A;  3VF6 A;  1TKD A;  3K9K A;  3OYH A;  4DSF A;  3I33 A;  1RTD A;  4N47 A;  3EKS A;  3HVT A;  2YHX A;  1W97 L;  1VQ4 N;  4CZL A;  1WSF A;  3SJJ A;  3O4N A;  5AQO A;  3AV9 A;  3CYM A;  1CZA N;  4FJL A;  3QIO A;  1GLF O;  4BE2 A;  1TUU A;  3B6P A;  4DV4 K;  4BR9 A;  5E84 A;  3AVA A;  4ILJ A;  3TR8 A;  1EO1 A;  3B8A X;  1GOA A;  3G4S N;  1ILY A;  1TAQ A;  4CJ5 A;  3AVH A;  4U7B A;  2D1K A;  4F3T A;  3QEI A;  1KVB A;  3NFA A;  1RT7 A;  1JLG A;  1I39 A;  3CJ7 A;  1EQY A;  4CK1 A;  4JKD A;  2CGL A;  1I94 K;  4EFH A;  3ATU A;  1BO5 O;  4NXN K;  5GAE P;  4B1X B;  4CHP A;  1YIJ N;  3NH0 A;  1YUW A;  1Q86 O;  4R5P A;  3LDO A;  3KTQ A;  3TAN A;  2QK9 A;  3ZX2 A;  1RT5 A;  3SAG A;  2A5X A;  4CZJ A;  4FW2 A;  3G71 N;  3V9W A;  4KTZ A;  1D8Y A;  4PUO A;  4DV7 K;  2QWR A;  3ZEU A;  3I8B A;  1J6Z A;  4I7F A;  1IBK K;  4OLA A;  5FRO A;  3DLR A;  3PSI A;  1Q82 O;  2D4W A;  2QEX N;  3QNO A;  5CR4 A;  4M3W A;  2FLO A;  3CQ8 A;  3HVR A;  4RW6 A;  2HHV A;  3N4P A;  3CM5 A;  1B92 A;  2B5J A;  3OYM A;  4RWT A;  1HNZ K;  4JI0 K;  1JKH A;  5JIC A;  3ZSY A;  1BL3 A;  1ASV A;  1UOC A;  3O3H A;  4DB3 A;  3MXJ A;  3OYK A;  1VQ8 N;  3L2Q A;  1IKW A;  3BGR A;  2GTD A;  3UE5 A;  1SUQ A;  4DFK A;  3PX6 A;  4O0I A;  4FK2 A;  4DF4 A;  3LPU A;  3L2U A;  1RFQ A;  3CCL N;  1YJ9 N;  1UA1 A;  4OVL A;  1QVG M;  4JKB A;  4CJT A;  1WSI A;  4IFE A;  2KQ2 A;  1WNS A;  2XHB A;  4NYN A;  3NGZ A;  3VEN A;  1NJY A;  3GL1 A;  4JD2 B;  4AHS A;  3QO9 A;  3HM9 A;  3UB5 A;  3IS9 A;  3ULE B;  1TYQ B;  3VOV A;  2RKI A;  4CK2 A;  2HND A;  1BDG A;  4OPJ A;  4BVP A;  1NOY A;  4KB0 A;  4Z4I A;  4B9N A;  1WSJ A;  1JLQ A;  2JWK A;  2YNG A;  1VQ9 N;  4BG9 A;  3K59 A;  1QQO A;  4JI4 K;  5FPD A;  1ATR A;  4J2B A;  4FOI A;  4EZ9 A;  4XEI A;  1YJN N;  1C1C A;  3VA0 A;  2NRH A;  4CD3 A;  5CE3 A;  3AO4 A;  2QWL A;  5E26 A;  3DWL A;  2A3Z A;  4IG3 A;  3ENO A;  1NKC A;  2E2N A;  2QWQ A;  4LY7 A;  3D2E B;  2ZJP L;  2GX9 A;  1VRU A;  4B3M K;  3NGY A;  4CHN A;  4FZZ A;  3JAM O;  4M42 A;  5LY3 A;  2WUS A;  2F7T A;  3JYT A;  4DR1 K;  1VSK A;  3SUN A;  1K8K B;  1G99 A;  3IAY A;  3KWI A;  3E01 A;  5AQN A;  3OHR A;  1WSG A;  2NRV A;  4DU1 A;  2YHY A;  1GLC G;  1S3X A;  4DFJ A;  1NOZ A;  2D0O A;  4JI8 K;  2QWM A;  1FW6 A;  3ZT0 A;  3OYC A;  3IMX A;  3LDL A;  1T3V A;  2P9N A;  2UXD K;  1EXQ A;  1JCF A;  1W2B M;  4RG8 A;  1RBV A;  4A2A A;  5CHI A;  2QWN A;  4I2Q A;  2XO7 A;  3CER A;  3E1Y A;  1T7P A;  4KH6 A;  1IV0 A;  3F5T A;  4DV0 K;  2D5R A;  4AHV A;  4JK9 A;  4CGJ A;  2UXC K;  2W40 A;  3G25 A;  4F8R A;  4BGB A;  2HHX A;  3LDP A;  4XH4 A;  2ASO A;  1SL2 A;  4LF6 K;  2O4I A;  3ZSQ A;  2P9I A;  2OTJ N;  2E6M A;  1QZ5 A;  3WQU A;  3CJC A;  1BUP A;  3VGM A;  2G8K A;  2E2P A;  3WNF A;  4DKW A;  5I42 A;  3RVC A;  4C23 A;  2HB5 A;  3ZSV A;  4NLB A;  1N32 K;  4QS8 A;  3V6D A;  3QFU A;  4O44 A;  1S6P A;  4C8L A;  4BWJ A;  3RR8 A;  1FXX A;  1S1X A;  3SUQ A;  2YX6 A;  4X66 K;  4EZ6 A;  2NRX A;  3CC7 N;  1S9G A;  3VQ7 A;  5JS1 A;  5LJW A;  1X9W A;  3ZSW A;  3RMA A;  3IKM A;  3OJU A;  4DF8 A;  4DV5 K;  4DFM A;  2GUI A;  4ISF A;  3CPE A;  3SMP A;  4BC5 A;  4J2D A;  4JV5 K;  4IJA A;  4B9S A;  3SK3 A;  4YOT A;  1KAY A;  1GOC A;  3C95 A;  3PX4 A;  3DXM B;  4DU3 A;  1ZBU A;  4LF5 K;  3HL8 A;  4BGA A;  2KW4 A;  1Q18 A;  4PA1 A;  4FJJ A;  3LP3 A;  4H0P A;  5AQY A;  4CZF A;  1OH7 A;  3QNN A;  3CHW A;  3LL3 A;  5HLF A;  4B9Q A;  3OY9 A;  4JI1 K;  4MO4 A;  2D0A A;  4M3R A;  1RDD A;  3V81 A;  4QCL A;  4FO0 A;  4E3S A;  4JKC A;  5AZI A;  1TVR A;  3O9R A;  3J81 O;  3ULD A;  3CD6 N;  1TKT A;  4IO8 A;  3OS2 A;  1IBM K;  1YJW N;  4C1N I;  2WON A;  3P39 A;  4CJR A;  4IOC L;  2E8A A;  4W5O A;  3DLH A;  3K2P A;  2OZM A;  4BR7 A;  3WXJ A;  1BHL A;  3HJF A;  2RN2 A;  1NK9 A;  2HF3 A;  4KI4 A;  1SZ2 A;  4M45 A;  1C0M A;  3AAR A;  4DV6 K;  2OA8 A;  1WOQ A;  1UWB A;  4E89 A;  4F2S A;  5K14 A;  4BR0 A;  1Q81 O;  4FJG A;  3V4I A;  4H8K A;  3DLB A;  4FWP A;  4YOX A;  4DQ8 A;  4B3R K;  1C0F A;  3QEP A;  3U9D A;  3AGR A;  4JKG B;  3NE6 A;  2F8T A;  1L5U A;  3D2F A;  1TKX A;  4LF4 K;  2IAJ A;  3A2F A;  3PSF A;  4BRL A;  3AVL A;  3F9M A;  1K9M O;  3UKR B;  1NBW A;  4KAZ A;  3ID8 A;  3LWL A;  4DSK A;  4B1Y B;  4JI3 K;  2QXL A;  4A2B A;  5IWA K;  1HKB A;  3M3Z A;  3DLL L;  1BWF O;  3RWU A;  4ISE A;  4BRH A;  1DGK N;  1IJJ A;  1SV5 A;  3HM8 A;  3BZC A;  3D0P A;  3H1Q A;  3K5O A;  1VSL A;  5AQI A;  1Q9Y A;  1RIL A;  2X6S A;  3LAL A;  2B4J A;  3QEW A;  2BGG A;  2VG6 A;  5KTQ A;  3TAM A;  1TL3 A;  1JJ2 M;  3CCV N;  4CJE A;  4YOU A;  2DTU A;  4BRD A;  4HVJ A;  1U47 A;  2PAV A;  4M41 A;  4NCG A;  1V4S A;  4DHY A;  1NJI O;  3BUZ B;  2PY5 A;  5T7B A;  3KJV A;  3BY5 A;  4FM0 A;  1VSJ A;  2Q0R A;  5AQX A;  4BDZ A;  1QVF M;  1BQM A;  3WXL A;  3O3G A;  5M1F A;  2FBY A;  3O9T A;  1YXQ A;  3V9S A;  4EHT A;  2V7Y A;  4PL8 A;  4FJX A;  3THY B;  5FLX O;  1KFS A;  5HRR A;  5B8H A;  4BR5 A;  4GVE A;  5BRE A;  2KKZ A;  5GAH P;  2P9K B;  1OVY A;  3TU5 A;  1TUY A;  1U48 A;  4AHT A;  4O4G A;  3DAW A;  1QS4 A;  4H0V B;  3ZT3 A;  4M3Z A;  3O1W A;  5D3G A;  2XY7 A;  5C2D A;  2HNY A;  1RT1 A;  4DTJ A;  3I0R A;  1FJG K;  3QIC A;  2C1G A;  1GLJ O;  4WYB A;  4Z4G A;  4CF2 A;  3C6T A;  1Q9X A;  2KFN A;  5CYQ A;  4HCC A;  1S1W A;  1NGJ A;  2DPN A;  4DQQ A;  4FWO A;  2Z1G A;  2P9U A;  1N36 K;  5KQ8 A;  4DV3 K;  2QWO A;  4PHT X;  4KPY A;  3KWG A;  1Y97 A;  1ATN A;  2DFH A;  4AHR A;  4E7I A;  3DOK A;  2P9L B;  3CCM N;  3MCA B;  1QSS A;  2A1S A;  4DTP A;  5IT9 O;  4DSJ A;  3BF1 A;  4F9O A;  3O9Q A;  1XWL A;  2PYL A;  4JI6 K;  4DQI A;  2YHW A;  4JKG A;  4AM7 A;  4FWK A;  4K0K K;  1JLA A;  1E3M A;  3C7N A;  5C15 A;  3K0S A;  1RTJ A;  2VGN A;  2R7Y A;  2HHI A;  4WQ4 A;  4KRF A;  3TAG A;  3UKR A;  4BRF A;  4YOY A;  4FJK A;  2OCE A;  2ETJ A;  1ASW A;  3VEZ A;  4WE1 A;  4H5V A;  3SPZ A;  3CFO A;  4CEF A;  3TTD A;  1JL1 A;  3O5B A;  3VN5 A;  5AQU A;  1S1V A;  4KB1 A;  3P1G A;  4CBW A;  4CFB A;  2OPP A;  3LAK A;  3E9L A;  3WEE B;  4BRM A;  3S5T A;  4CHY A;  4BRC A;  5FPM A;  2QTD A;  1W9H A;  4ID5 A;  4BEC A;  4FW1 A;  4CEQ A;  4CEE A;  4CJU A;  4A59 A;  3NAE A;  1BIZ A;  2FF3 B;  3OYE A;  3CC2 N;  4JKE A;  4O55 A;  4CJ3 A;  3HT3 A;  1WSH A;  4YOR A;  2BTF A;  4HTL A;  3L2V A;  4CFD A;  5KRS A;  4CF1 A;  4IO9 L;  3O3F A;  3GBT A;  3NF8 A;  5BR9 A;  4LC9 B;  3T19 A;  3QIP A;  2IS3 A;  3EE9 A;  3P83 D;  3AA4 A;  3SCX A;  3VQE A;  3VQC A;  1O13 A;  4IEE A;  5BRD A;  4LH5 A;  3BDP A;  1O1W A;  3M5R A;  4N76 A;  3VEV A;  3EZW A;  2X6N A;  3P38 A;  2CH5 A;  4W5Q A;  5LL6 Z;  3EKU A;  4X64 K;  1KFD A;  1U2V A;  2YNI A;  1XNR K;  4WQ5 A;  1VHX A;  3THY A;  3T1Y K;  3SLC A;  3VER A;  5ADX A;  1HX1 A;  3ZET A;  5JLF A;  1SL0 A;  3QEV A;  1VQO N;  1DLO A;  2QM1 A;  4GY2 B;  1T44 A;  3FE1 A;  4GKJ K;  3CIP A;  3MEE A;  2ZD1 A;  2Z1J A;  3KKS A;  1ZBS A;  3CJ9 A;  3OYI A;  2P9S A;  3GOI A;  5F2R A;  2O8C A;  3GE1 A;  3RMB A;  2A40 A;  3EE8 A;  1SL1 A;  3N4Q A;  1HNV A;  3VQ9 A;  3PIO L;  1XMO K;  3F73 A;  1NGH A;  5AQZ A;  3K5N A;  3ENH A;  3V1R A;  4FZY A;  4DR5 K;  4J2E A;  2QXF A;  3ALY A;  1T03 A;  3DYA A;  4W5T A;  1L3T A;  4G1Q A;  2P9L A;  3MED A;  3AO1 A;  3PV8 A;  1I3A A;  5AQG A;  3FZK A;  3O9U A;  1LW0 A;  3ZX0 A;  1B9D A;  4PKI A;  4BRI A;  3HBT A;  3PO4 A;  3R8E A;  2Q36 A;  1U6Z A;  4BE0 A;  3L6Q A;  3DXK A;  1BIU A;  3DLG A;  4KH4 A;  1J5E K;  4O8K A;  4OGE A;  3HSC A;  4KKO A;  5F1X A;  2OYQ A;  1XMQ K;  3NVK A;  2UUC K;  4F2R A;  3H6E A;  4DU4 A;  1X9J A;  2C1I A;  3FFK B;  1EP4 A;  2XRI A;  1SQK A;  4MDA A;  3V1Q A;  3QEX A;  1XI1 A;  3WEE A;  4N56 A;  1JXB A;  4H5T A;  3MWP A;  3CJ1 A;  4CHZ A;  4BEB A;  3C6A A;  4KO0 A;  1HJR A;  2P51 A;  4QS9 A;  3RMC A;  2QA4 N;  2E5L K;  1A5W A;  3VTH A;  5E41 A;  4WFA L;  3VEW A;  2VCP A;  1C1A A;  4BDP A;  1L3U A;  1NK4 A;  2P9N B;  4FJH A;  1JLB A;  1ZXO A;  3W3D A;  3JS6 A;  4ZTJ A;  4HUG A;  4EP5 A;  1K6Y A;  4CJS A;  4FLV A;  4ISG A;  5AQQ A;  5JVH L;  3KLF A;  1S72 N;  3H1V X;  5C25 A;  2FBV A;  4JI5 K;  2JLE A;  4JHD B;  3AAQ A;  1XC9 A;  4KHN A;  2A6A A;  3TAB A;  3RSE A;  4DTO A;  2Q2R A;  3RMD A;  2P9I B;  3R1X A;  3NBP A;  3C94 A;  3NF6 A;  5M1K A;  4M7Y A;  2KHO A;  4DTU A;  1RDU A;  4RW7 A;  5AQS A;  3VQB A;  4WCE L;  5SZT A;  3U8X A;  1VSE A;  4DQP A;  4I2P A;  1T6D A;  3O80 A;  3IG1 A;  3IUC A;  4LFA K;  2ZGY A;  3AO2 A;  1QQN A;  1NGD A;  5BN9 A;  4BRE A;  2E1Z A;  3OYJ A;  2G8I A;  1HYZ A;  4BE7 B;  3TSQ A;  5HBM A;  3LWM A;  2ZJR L;  1NMN A;  4NLC A;  4LF7 K;  5KRT A;  2OTL N;  3T1A A;  3KD1 E;  4JKF A;  2E6L A;  4FVM A;  4FJN A;  5AQM A;  2NRZ A;  4CFA A;  3T69 A;  4K8X A;  4FJI A;  4JNE A;  4FLW A;  1WUA A;  3S3O A;  1GLA G;  4TSX A;  3A5M C;  4FK0 A;  3AVB A;  4BQL A;  4CI6 A;  1IO2 A;  1P90 A;  5AFU H;  4A62 A;  1YAG A;  1OVQ A;  3J80 O;  4GMJ B;  4QS7 A;  4CGD A;  4QOZ B;  2V7Z A;  3HPH A;  2ZE2 A;  4OO1 J;  3OYD A;  5JEN A;  3U9Z A;  1SKR A;  3MK6 A;  2RHK A;  4Q0B A;  5AZI B;  5GAD P;  1CZ9 A;  3KK7 A;  5AQV A;  3MN5 A;  3VQP A;  2IVN A;  3T3F A;  4IZ9 A;  2GUP A;  1NGE A;  2X74 A;  2E4L A;  2NRT A;  4E7K A;  1NG9 A;  3WXM B;  4Z4F A;  3LPT A;  2XY8 A;  3CYG A;  2HHS A;  2OZS A;  4OKK A;  3H45 C;  1BOT O;  4FPB A;  3QDK A;  4FWL A;  2B6A A;  1WAF A;  4CJP A;  1V4T A;  2OPQ A;  1MDU B;  4WF9 L;  3MWT A;  4E7L A;  3SQ0 A;  3VQ5 A;  4YOW A;  5JS2 A;  5LMN K;  4ILH A;  4Y1C A;  2E20 A;  5FDL A;  3SAH A;  3D2F B;  3MMV A;  2E1Y A;  1RDC A;  4RTF D;  1GLL O;  4A57 A;  1E4G T;  3JSM A;  3KIO A;  2A1R A;  3PLA A;  5HL7 L;  3QIN A;  4Q5V A;  3C6H A;  4JHD A;  3DOL A;  3SAF A;  3VQQ A;  3EL2 A;  1TAU A;  3RRG A;  4PY5 A;  3H08 A;  2HBJ A;  2XY6 A;  2JGU A;  4BC3 A;  2VQE K;  1YVU A;  2G8F A;  3CQY A;  5DK5 A;  3J7Z O;  5KPT A;  1ZBI A;  4BRQ A;  1IBL K;  3E9O A;  3CCR N;  3ZSR A;  1MWM A;  2E88 A;  3QBW A;  3C0B A;  4GV3 A;  4F3O A;  5HRN A;  1LWF A;  2ITG A;  3M8R A;  4FLT A;  4NYF A;  2I7P A;  3FZL A;  3OYA A;  2F4V K;  2Q31 A;  3AVJ A;  4CEO A;  2DY4 A;  2WOM A;  2YJF A;  4FL9 A;  4RW4 A;  1QSY A;  3OBW A;  2NZT A;  4JK8 A;  4J2A A;  1LCU A;  3CET A;  1HKC A;  4BAC A;  1X1P A;  1NK0 A;  3CF5 L;  4DWI A;  4IOA L;  2GBZ A;  4EIA A;  1EX4 A;  5I3U A;  1LW2 A;  1RBT A;  5AQW A;  3EEQ A;  4MLE A;  1IG8 A;  1Z05 A;  2OAN A;  4BR4 A;  3FZM A;  1HRH A;  2ITM A;  1FKO A;  3VGL A;  1J54 A;  3OYB A;  3EYZ A;  1NK7 A;  5KI6 A;  4JRP A;  2CGJ A;  4PWD A;  4FM1 A;  2H3G X;  3LDN A;  1GLD G;  4DSE A;  4G9Z A;  1EET A;  4FLZ A;  5HOO A;  2FSK A;  3CC4 N;  3AA5 X;  3AA3 A;  2NLX A;  1NGG A;  2HMP A;  2P9U B;  1KLN A;  3KLI A;  3DMJ A;  1CXQ A;  1RT6 A;  4CJV A;  1KLM A;  5J2Q A;  3TTC A;  4B3S K;  3WQT A;  1VK0 A;  4X65 K;  1KXP A;  2G8V A;  4KFB A;  2YKM A;  1MWK A;  1BA1 A;  3EY1 A;  2BH1 A;  3L4I A;  1TK0 A;  2HHU A;  3C7N B;  5EXW A;  4W5R A;  1VQ5 N;  2QI2 A;  2YI1 A;  4CD1 A;  3R9P A;  5AFU A;  4FJ5 A;  4IKF A;  4V19 S;  3CXC M;  2EX3 A;  3SV3 A;  4YDU A;  2OPR A;  3OYL A;  4MFB A;  1BI4 A;  3AO5 A;  5TKW A;  4AM6 A;  2HVH A;  1BGX T;  1JCE A;  3OTO K;  1RTI A;  4CED A;  1VSH A;  3HTV A;  1BCM A;  4JS4 A;  5C42 A;  2DFE A;  3DRP A;  1U04 A;  4DS5 A;  5CYM A;  4DTM A;  1VQ6 N;  1KCF A;  3DRS A;  4LD0 A;  5JLH A;  4OLB A;  2HBK A;  3DJC A;  4FWS A;  1LAW A;  3D7E O;  4MQ3 A;  1FKP A;  1HPZ A;  1RDA A;  2YNF A;  4BVO A;  1CZB A;  4AHC A;  1KSP A;  3L3U A;  1ASU A;  4CJ7 A;  2HHW A;  4YFU A;  4PKH A;  4FLU A;  3S9H A;  3MEG A;  3CMA N;  4E7J A;  1S1T A;  3G0Z A;  5J1E A;  2WFB A;  2KTQ A;  1HMV A;  3AO3 A;  2HOE A;  1U49 A;  4WQ4 C;  3FZH A;  4IXC A;  4CZH A;  4FSV A;  4WFB L;  1VQL N;  4CBX A;  1N8R O;  4LF8 K;  3SV4 A;  4IG0 A;  4ILG B;  3O1B A;  3MX2 A;  2IVP A;  3AVM A;  3AVN A;  1XHZ A;  4ELU A;  2AP1 A;  3M6G A;  1U2V B;  1T05 A;  4B9U A;  2ASP A;  1NJW A;  1JL2 A;  1GLB G;  3CM6 A;  3SPY A;  4E7H A;  4CZK A;  1ZC6 A;  2VWJ A;  3R3L A;  4L8R B;  3BZK A;  3ZET B;  3ZSZ A;  1YI2 N;  2GWJ A;  5BPM A;  4GV6 A;  3L2W A;  4RW8 A;  3VF2 A;  4Z0U A;  2GEL A;  4QAG A;  4KBO A;  4CIF A;  5A2Q O;  4Y0W A;  2IDO A;  4KHP K;  3PX0 A;  4RW9 A;  3LZJ A;  5AQF A;  3QB0 A;  1HKG A;  2RPI A;  3TI0 A;  3SUP A;  2ATQ A;  4GNI A;  3VEY A;  2P9S B;  4FLX A;  2O8C B;  1XQS C;  3QML A;  4FWM A;  2FXU A;  2W6L A;  1A5V A;  1NNE A;  3LP1 A;  3SBT A;  3QET A;  4ID1 A;  2Y1I A;  1HPM A;  3TAE A;  4ZTF A;  3AVC A;  2KZM A;  3CFP A;  1Z25 A;  3RR7 A;  1NGF A;  4WQ5 C;  4AF1 A;  1A5X A;  3LP0 A;  4N41 A;  2VG7 A;  3FFI A;  5C0Y A;  4KV8 A;  3P5J A;  3HPO A;  2UU9 K;  4R79 A;  4H0T B;  3DXK B;  3J8A A;  4DLE A;  2YKN A;  1J53 A;  4B3O A;  2X78 A;  1C6V A;  2RF2 A;  4XH1 A;  3EN9 A;  1Q7Y O;  3VF4 A;  4AH9 A;  3SZ2 A;  2DFF A;  4LFB K;  4YNQ A;  1ESV A;  3LAN A;  4OPH A;  4I9L A;  4E1J A;  1KTQ A;  1VQK N;  3MXM A;  2CH6 A;  3QBX A;  4IDH A;  4O8U A;  4O0J A;  4KRE A;  4ICL A;  1TGO A;  4Z4C A;  1VAZ A;  1NK5 A;  3V9U A;  4KI6 A;  5DM7 L;  1KVC A;  5HP1 A;  1SS6 A;  1S5J A;  2I7N A;  3VQ6 A;  1TV6 A;  4X62 K;  4I9Q A;  3A5L C;  4OJR A;  4M63 C;  2UYT A;  4KTW A;  5DM6 L;  3SUO A;  4CJL A;  5J2N A;  1D9F A;  3DLE A;  3SQ2 A;  2KZZ A;  2HMI A;  4Z4H A;  1RDW X;  3O4W A;  3D45 A;  4CBU A;  3EO3 A;  2A41 A;  3O4Q A;  3VQ4 A;  4BRP A;  3FZF A;  4FPA A;  3L2R A;  3THX B;  5AQH A;  4FXD A;  3I0S A;  1JLE A;  4CZE A;  2IOC A;  3PY8 A;  2O8F A;  3KLG A;  3FGU A;  2IVO A;  2BUP A;  4GVM A;  2WBN A;  2F9W A;  2P5O A;  1S6Q A;  3RSE B;  4DLG A;  4FZX C;  4MO5 A;  1S22 A;  3WUH A;  3ZT2 A;  5LMU K;  3HRG A;  3HP9 A;  2G8H A;  1NGA A;  4BRO A;  3LM9 A;  1K73 O;  2Q1N A;  3AGK A;  4KHS A;  3A8Y A;  1TK5 A;  3G10 A;  3T7Z A;  1KRP A;  4NCA A;  4UQG A;  1HNX K;  3VQA A;  4ELT A;  2BDP A;  4NCB A;  4PKG A;  3OS1 A;  1VSM A;  4HUE A;  1HNW K;  2NRR A;  3HK2 A;  1NU0 A;  3V9X A;  1WBD A;  2D0P A;  3K9J A;  4H5R A;  2W00 A;  1VSD A;  1N5Y A;  5GIN A;  1HQU A;  1TK8 A;  4FLY A;  5J2M A;  4BDY A;  3HOT A;  2GV9 A;  1W0H A;  3CCS N;  1ZBL A;  2PZS A;  1YTA A;  4F4K A;  4DG1 A;  3O9S A;  1ZBH A;  4DR6 K;  3QER A;  2ZWH A;  3OYF A;  2FBX A;  4KTQ A;  2PFU A;  3IDH A;  3O08 A;  4CES A;  3KD5 E;  2EHG A;  1ATS A;  1UAX A;  2YCH A;  2F96 A;  3WXI A;  5TKY A;  4CZM A;  3BP8 A;  4HTU A;  3U3Y A;  4EHU A;  1WBB A;  3AVG A;  3ENB A;  4JKA A;  1Y64 A;  4FOE A;  3U6F A;  1HJO A;  3QFP A;  1QQC A;  4DMN A;  4CJK A;  1DT9 A;  2VG5 A;  4Y1D A;  2F9T A;  4Z4E A;  4B9T A;  1HLU A;  3NHG A;  1C0T A;  4NO7 A;  4XH5 A;  5HRS A;  4H5W A;  3L8B A;  4PQU A;  1NK6 A;  2O8E B;  4E19 A;  4OKE A;  2XY5 A;  3O8M A;  4NB4 A;  3VMF B;  4CF8 A;  4JK7 A;  1IKY A;  2Y1J A;  3ZT1 A;  1D9D A;  1MU2 A;  1VQN N;  5CY4 A;  3Q7B A;  3UIQ A;  3SI6 A;  3THV A;  3A5N C;  4DTX A;  3HP6 A;  1S9E A;  4UY8 O;  3PIP L;  4CEC A;  1Z6R A;  1G15 A;  2JWL A;  4CCH A;  2O4G A;  2P9P B;  1XUP O;  4BQZ A;  1VQM N;  4ZHR A;  4HUF A;  3E66 A;  4DS4 A;  1W7A A;  4KHU A;  5J2P A;  2WC9 A;  3NMU A;  3I56 N;  2W42 A;  1WLJ A;  4B8C A;  4IFY A;  5KGW A;  5ELZ A;  2UUB K;  1SKS A;  5C24 A;  2E2Q A;  3THX A;  3CJB A;  1H1V A;  1HNI A;  1EKE A;  2G8U A;  4DTS A;  3QLH A;  4CER A;  1WSE A;  2ZF5 O;  4DV1 K;  3HST B;  1JLC A;  3MCP A;  2NUB A;  1VSF A;  5C10 A;  2HST A;  4DSL A;  1TL1 A;  5EX5 A;  3A0I X;  3FR0 A;  5AQL A;  4CK3 A;  2I5J A;  4E1M A;  3KK1 A;  4A5A A;  3CJA A;  4O5B A;  3MAQ A;  2IC3 A;  4B8A B;  1VSI A;  3M8P A;  1QHT A;  5C12 A;  1BQN A;  3ZX3 A;  3AVI A;  1LWE A;  4H4M A;  3NH1 A;  4B9L A;  4FYD A;  3UKU B;  3GG4 A;  1NJX A;  4CGG A;  2J4R A;  4I6M A;  1DTQ A;  4WFN L;  4H03 B;  4CF9 A;  4CJQ A;  1NWK A;  4KHQ A;  3S41 A;  1NLV A;  2Q97 A;  4M3Y A;  1T8E A;  4AHU A;  1D4X A;  2YHB A;  3HXM A;  2O8D B;  4B08 A;  4H0Y B;  1HYV A;  3IRX A;  2V52 B;  1M90 O;  4PL7 A;  2FBT A;  4BWM A;  4NXM K;  2FC0 A;  4JI7 K;  1Q8I A;  1NGI A;  4H0O A;  1NKE A;  1R59 O;  2HVI A;  4JYA K;  5FPE A;  2HHQ A;  3VGK A;  3CCE N;  3J7Y P;  3NF9 A;  4JI2 K;  4BR2 A;  3MXI A;  2W41 A;  4BRG A;  3K57 A;  1TKZ A;  3HYF A;  3CCJ N;  1QE1 A;  5BPL A;  3ID6 A;  3DLK A;  1YIT N;  5AQT A;  1LWC A;  3SQ1 A;  2IGI A;  2O8E A;  1RBU A;  5BN8 A;  4K43 A;  4CJF A;  4DQR A;  3F2K A;  4JKH A;  3CCQ N;  1RCH A;  4DR2 K;  3TAP A;  4GV9 A;  4EAH D;  3TAF A;  2Q3S A;  3TAR A;  4IWV A;  3FLC O;  4CEB A;  3O6W A;  3JXU A;  1X3M A;  1R0A A;  1WB9 A;  2GEM A;  3E9P A;  5HRP A;  2WTU A;  2D0B A;  1LAV A;  3LDS A;  2YJE A;  2P9P A;  5CZ2 A;  1SKW A;  3M8Q A;  4CF0 A;  1F21 A;  2VGM A;  3BEX A;  3ZT4 A;  1RTH A;  3MN6 A; 
#chains in the Genus database with same CATH homology
 3CXC M;  1YIJ N;  3O5B A;  4YDU A;  1YUW A;  1Q86 O;  3LDO A;  4IEI A;  5AQU A;  4AM6 A;  4CBW A;  5TKW A;  3WT0 A;  3ZX2 A;  3E9L A;  1JCE A;  3WEE B;  3SAG A;  2A5X A;  1BA0 A;  4MLH A;  4CZJ A;  3HTV A;  1NM1 A;  4BRM A;  3G71 N;  3ZYY X;  4BRC A;  5FPM A;  2QTD A;  3ATV A;  1KQS M;  1VQ6 N;  3M1F A;  4BEC A;  5JLH A;  2HBK A;  3DJC A;  4A59 A;  2QWR A;  4FWS A;  3I8B A;  1J6Z A;  3ZEU A;  2FF3 B;  3D7E O;  2RE2 A;  3CC2 N;  4XJX A;  4JKE A;  3H3O B;  1KD1 O;  2NNW A;  4YOR A;  2BTF A;  3KVG A;  4HTL A;  1Q82 O;  2D4W A;  4BVO A;  4K25 A;  2QEX N;  5CR4 A;  4IO9 L;  2FLO A;  3GBT A;  1NGB A;  5BR9 A;  4CJ7 A;  3TPQ A;  4PKH A;  4LC9 B;  3N4P A;  3OW2 M;  3EE9 A;  4CZI A;  1X3N A;  3CMA N;  4RWT A;  3UKU A;  3SBG A;  1O13 A;  2WFB A;  5GIP A;  4IEE A;  5BRD A;  5JIC A;  3M5R A;  2HOE A;  4DB3 A;  3AAP A;  3IFR A;  4WQ4 C;  3VEV A;  3EZW A;  3FZH A;  4IXC A;  5BRH A;  1VQ8 N;  4CZH A;  4FSV A;  3P38 A;  4WFB L;  3CCU N;  2GTD A;  1VQL N;  2CH5 A;  3EKU A;  3MX5 A;  4CBX A;  1N8R O;  3BF3 A;  3UE5 A;  1U2V A;  4WQ5 A;  4FWR A;  3WXK A;  4ILG B;  5GIO A;  3O1B A;  3MX2 A;  2IVP A;  1RFQ A;  3CCL N;  4YDU C;  1YJ9 N;  4JEP A;  3SLC A;  1QVG M;  2AP1 A;  3HOS A;  4JKB A;  3M6G A;  1HX1 A;  3VER A;  1U2V B;  5ADX A;  3ZET A;  5JLF A;  1C0G A;  4IFE A;  1VQO N;  2ASP A;  4JD2 A;  1NMD A;  1GLB G;  3MN7 A;  5AQR A;  1TYQ A;  3ULE A;  2QM1 A;  4GY2 B;  1T44 A;  1QQM A;  3FE1 A;  3CIP A;  1ZC6 A;  2NRW A;  3R3L A;  3VEN A;  4CZK A;  1GLE G;  5H1S Q;  3ZET B;  4FVU A;  3GL1 A;  4JD2 B;  4YOV A;  1YI2 N;  2GWJ A;  3UB5 A;  5BPM A;  4GV6 A;  3ULE B;  1TYQ B;  3VOV A;  3VF2 A;  1ZBS A;  1YHQ N;  4K41 A;  2GEL A;  1BDG A;  4KBO A;  3CJ9 A;  4BVP A;  2P9S A;  3GOI A;  4DCH A;  2IIR A;  5F2R A;  3GE1 A;  4Y0W A;  2JWK A;  2A40 A;  3EE8 A;  3N4Q A;  1VQ9 N;  3PIO L;  5AQF A;  4BG9 A;  3QB0 A;  1HKG A;  1QQO A;  3L4Q A;  2CGK A;  1NGH A;  3VEY A;  1ATR A;  4GNI A;  2P9S B;  4FOI A;  2A42 A;  5AQZ A;  5FPD A;  4XEI A;  1YJN N;  3KZB A;  3LDQ A;  3ENH A;  3VPZ A;  1XQS C;  3QML A;  2NRH A;  3HZ6 A;  4FWM A;  2FXU A;  4CD3 A;  5CE3 A;  2P9L A;  3SBT A;  2QWL A;  5E26 A;  3DWL A;  3D2E A;  2A3Z A;  3FZK A;  1HPM A;  5AQG A;  3O9U A;  2VWB A;  1MA9 B;  4PKI A;  3ZX0 A;  4O5F A;  3ENO A;  3HBT A;  3OBY A;  4BRI A;  2E2N A;  2QWQ A;  3D2E B;  2ZJP L;  3R8E A;  2Q36 A;  2GX9 A;  4J8F A;  1NGF A;  1U6Z A;  4WQ5 C;  4AF1 A;  5F0X A;  1YF5 L;  2V51 B;  3L6Q A;  3DXK A;  1K8K A;  4KH4 A;  4RCH A;  5LY3 A;  2WUS A;  4O8K A;  2F7T A;  5C0Y A;  3HSC A;  5F1X A;  5LJV A;  1M1K O;  3NVK A;  4R79 A;  4H0T B;  3DXK B;  5EVZ A;  1K8K B;  3H6E A;  1G99 A;  3J8A A;  1X9J A;  3L0Q A;  2C1I A;  3KWI A;  5AQN A;  3FFK B;  3OHR A;  2NRV A;  5JVG L;  1XC3 A;  1SQK A;  2YHY A;  3EN9 A;  1GLC G;  1S3X A;  3GDQ A;  4MDA A;  4XH1 A;  3VF4 A;  2D0O A;  1Q7Y O;  3WEE A;  2QWM A;  5C2F A;  4H5T A;  3MWP A;  4B1W B;  3CJ1 A;  4BEB A;  4IJN A;  1ESV A;  1BG3 A;  3C6A A;  5AQK A;  3SJH A;  3NVM A;  3IMX A;  4IOX A;  1LOT B;  4OPH A;  2HBM A;  3LDL A;  4E1J A;  4QS9 A;  1T3V A;  2P9N A;  1VQK N;  2QA4 N;  3TTF A;  3CPW M;  1JCF A;  1W2B M;  5EOY A;  3VTH A;  2CH6 A;  3QBX A;  2PBD A;  3VEW A;  4A2A A;  5CHI A;  2ASM A;  2VCP A;  2QWN A;  4IDH A;  4O8U A;  4B1U B;  4BC2 A;  2P9N B;  1VAZ A;  3CER A;  5I9E B;  1ZXO A;  3W3D A;  3JS6 A;  3E1Y A;  4KH6 A;  3MN9 A;  3F5T A;  4FWQ A;  3VEO A;  5DM7 L;  1SS6 A;  2I7N A;  4ISG A;  4JK9 A;  5AQQ A;  5JVH L;  2W40 A;  3A5L C;  3G25 A;  5ADX H;  1KC8 O;  4BGB A;  4M63 C;  2UYT A;  5DM6 L;  3LDP A;  2HF4 A;  1S72 N;  3H1V X;  3H46 O;  1RDW X;  3O4W A;  4XH4 A;  4CBU A;  3EO3 A;  5AZJ B;  2ASO A;  2P9I A;  2A41 A;  5FPN A;  4JHD B;  2OTJ N;  3AAQ A;  4BRP A;  2A6A A;  3FZF A;  4FPA A;  4JAX A;  5AQH A;  1QZ5 A;  3WQU A;  3RSE A;  4CZE A;  3CJC A;  1BUP A;  3VGM A;  2E2P A;  2Q2R A;  4DKW A;  2P9I B;  3R1X A;  3RVC A;  4C23 A;  3FGU A;  4WFA L;  2IVO A;  5M1K A;  2BUP A;  2WBN A;  4M7Y A;  2F9W A;  4NLB A;  3RSE B;  2KHO A;  3CI5 A;  1SAZ A;  1RDU A;  4MO5 A;  1BU6 O;  4QS8 A;  1S22 A;  1YVN A;  3QFU A;  5AQS A;  3WUH A;  4WCE L;  1VQ7 N;  3U8X A;  3HRG A;  5M1Q A;  1T6D A;  3O80 A;  2YX6 A;  3TSP A;  1NGA A;  4BRO A;  2NRX A;  3IUC A;  3LM9 A;  3CC7 N;  2ZGY A;  1K73 O;  1QQN A;  2Q1N A;  3AGK A;  5LJW A;  1NGD A;  1T6C A;  3A8Y A;  5BN9 A;  3IKM A;  4BRE A;  4JN4 A;  5JMV A;  3P31 A;  2E1Z A;  2QW9 A;  3T7Z A;  4ISF A;  3CPE A;  3SMP A;  4BC4 A;  4BC5 A;  4BE7 B;  5KPR A;  3TSQ A;  2FF6 A;  3DXM A;  4IJA A;  5M1N A;  2ZJR L;  4NLC A;  3SK3 A;  4YOT A;  4MDB A;  1KAY A;  2OTL N;  4PKG A;  3DXM B;  4JKF A;  5EY4 A;  4BGA A;  5AQM A;  2NRZ A;  1Q18 A;  3T69 A;  2NRR A;  4H0P A;  5AQY A;  2D0P A;  3K9J A;  4CZF A;  4H5R A;  2W00 A;  3P4I A;  4BG8 A;  5GIN A;  5KQD A;  4JNE A;  1WUA A;  1GLA G;  3A5M C;  3CHW A;  3LL3 A;  4B9Q A;  4B1V A;  4BQL A;  3HI0 A;  4MO4 A;  4C1N K;  4CI6 A;  1P90 A;  2E2O A;  5AFU H;  3HOT A;  2ZJQ L;  4A62 A;  1YAG A;  3CCS N;  3I55 N;  4BY9 C;  3O9S A;  2FSJ A;  4QS7 A;  4FO0 A;  2ZWH A;  4JKC A;  5AZI A;  2V7Z A;  2PFU A;  3IDH A;  3O08 A;  3O9R A;  3CD6 N;  4OO1 J;  1ATS A;  4IO8 A;  3U9Z A;  2YCH A;  3WXI A;  3AY9 A;  5TKY A;  4CZM A;  3BP8 A;  3MK6 A;  2RHK A;  1YJW N;  4C1N I;  4EHU A;  5AZI B;  3ENB A;  3P39 A;  5GAD P;  4JKA A;  4IOC L;  1Y64 A;  2E8A A;  3R6M A;  4FOE A;  3Q7C A;  1HJO A;  3KK7 A;  3QFP A;  5AQV A;  4U67 L;  4BR7 A;  2VYP A;  3MN5 A;  3WXJ A;  1VQP N;  3VES A;  1DT9 A;  1E4F T;  2IVN A;  2F9T A;  2HF3 A;  2GUP A;  4IZ9 A;  1QHA A;  1HLU A;  1NGE A;  5AR0 A;  1SZ2 A;  3VEX A;  4NO7 A;  4A61 A;  4XH5 A;  2NRT A;  3AAR A;  4H5W A;  3WXM B;  3A5O C;  1WOQ A;  3O8M A;  4NB4 A;  3VMF B;  4JK7 A;  4BR0 A;  4H0X B;  3H45 C;  1BOT O;  4FPB A;  3QDK A;  1Q81 O;  4FWL A;  4FWP A;  4YOX A;  1VQN N;  3Q7B A;  4DQ8 A;  1C0F A;  3U9D A;  1HUX A;  3AGR A;  3A5N C;  4JKG B;  5M1P A;  3D2F A;  1OKJ A;  4UY8 O;  1V4T A;  2HBL A;  4Z94 A;  1MDU B;  4OPA A;  5MLC Q;  1NGC A;  3MWT A;  4WF9 L;  2ZGZ A;  4BRL A;  3PIP L;  1Z6R A;  3OA9 A;  4YOW A;  1P8Z A;  2JWL A;  3F9M A;  4ILH A;  1K9M O;  2E20 A;  4HWI A;  3SAH A;  2P9P B;  1XUP O;  3D2F B;  1DEJ A;  2GWK A;  1NBW A;  3MMV A;  3UKR B;  4BQZ A;  1VQM N;  2E1Y A;  1QZ6 A;  4FWN A;  3W0L A;  3E66 A;  3ID8 A;  4RTF D;  1GLL O;  4A57 A;  1E4G T;  2WC9 A;  4CZG A;  3I56 N;  3NMU A;  5AZJ A;  5ELZ A;  3PLA A;  5HL7 L;  4B1Y B;  2QXL A;  4A2B A;  1HKB A;  3C6H A;  3M3Z A;  4JHD A;  2E2Q A;  3G6E N;  3DLL L;  3SAF A;  1BWF O;  2FSN A;  5AQJ A;  3EL2 A;  3CJB A;  1H1V A;  4ISE A;  4BRH A;  1DGK N;  2HBJ A;  4KH5 A;  4L3Q A;  1IJJ A;  2ZF5 O;  3VTI A;  4BC3 A;  3HM8 A;  3MCP A;  3H1Q A;  4K42 A;  3CQY A;  2Q0U A;  1JCG A;  5C10 A;  5AQI A;  2HST A;  5KPT A;  3J7Z O;  4BRQ A;  5EX5 A;  4B1Z A;  3A0I X;  2EWS A;  3ZEU B;  3E9O A;  3CCR N;  3FR0 A;  5AQL A;  5BPN A;  5BRF A;  1KAZ A;  5GAG P;  4A5B A;  1MWM A;  2E88 A;  4A5A A;  3QBW A;  3C0B A;  3CJA A;  4BRK A;  4GV3 A;  4M7X A;  2QWP A;  3VET A;  1JJ2 M;  3CCV N;  5C12 A;  2KLA A;  3D6R A;  4YOU A;  3ZX3 A;  1K8A O;  4BRA A;  3UKU B;  3GG4 A;  2I7P A;  4BRD A;  3FZL A;  2PAV A;  1V4S A;  4DHY A;  2Q31 A;  1NJI O;  2J4R A;  3BUZ B;  1DKG D;  3KHY A;  5M1O A;  4H5N A;  2YJF A;  4I6M A;  3LM2 A;  4FL9 A;  4WFN L;  3OBW A;  2NZT A;  4H03 B;  4JK8 A;  3SMS A;  2Q0R A;  1NWK A;  5AQX A;  4BRN A;  1QVF M;  1LCU A;  3S41 A;  1NLV A;  3CET A;  1HKC A;  2Q97 A;  3WXL A;  5M1F A;  3O9T A;  1YXQ A;  3U4L A;  4I6M B;  3MDQ A;  4EHT A;  2V7Y A;  2P9K A;  3CF5 L;  1D4X A;  4IOA L;  5KPZ A;  4PL8 A;  4EIA A;  3CME N;  4H0Y B;  5B8H A;  4BR5 A;  2V52 B;  1M90 O;  4GVE A;  3H3N O;  4PL7 A;  5BRE A;  2KKZ A;  5GAH P;  2P9K B;  1OVY A;  3C65 A;  5AQW A;  3TU5 A;  1TUY A;  3TSU A;  1NGI A;  1IG8 A;  1KAX A;  1Z05 A;  2OAN A;  3CQX A;  4MLE A;  4H0O A;  4BR4 A;  3DAW A;  1R59 O;  1RGI A;  4H0V B;  5AQP A;  5FPE A;  3FZM A;  3O1W A;  2ITM A;  3VGK A;  2AA4 A;  3VF6 A;  5C2D A;  3CCE N;  3K9K A;  3VGL A;  3I33 A;  3EKS A;  4BR2 A;  2YHX A;  1W97 L;  3QIC A;  2C1G A;  2W41 A;  1GLJ O;  4WYB A;  4BRG A;  2CGJ A;  1VQ4 N;  4CZL A;  1NGJ A;  2H3G X;  3LDN A;  1GLD G;  2DPN A;  5AQO A;  4FWO A;  3CCJ N;  5BPL A;  2P9U A;  5KQ8 A;  3ID6 A;  4G9Z A;  2QWO A;  1YIT N;  1CZA N;  4PHT X;  5AQT A;  5HOO A;  2FSK A;  3CC4 N;  3KWG A;  2NLX A;  1NGG A;  1GLF O;  2HMP A;  5BN8 A;  4K43 A;  1TUU A;  2P9U B;  1ATN A;  4BR9 A;  5E84 A;  3F2K A;  4ILJ A;  4JKH A;  3CCQ N;  2P9L B;  3CCM N;  3TTC A;  3MCA B;  3WQT A;  4GV9 A;  4EAH D;  1KXP A;  1EO1 A;  3BF1 A;  4F9O A;  3O9Q A;  4IWV A;  2YHW A;  4JKG A;  3FLC O;  1MWK A;  3B8A X;  4AM7 A;  3G4S N;  4FWK A;  1ILY A;  4U7B A;  3C7N A;  3O6W A;  1BA1 A;  1X3M A;  2D1K A;  3JXU A;  5C15 A;  2BH1 A;  2GEM A;  3L4I A;  3E9P A;  3CJ7 A;  1EQY A;  2VGN A;  4JKD A;  2YJE A;  2P9P A;  4WQ4 A;  3C7N B;  3UKR A;  5EXW A;  4BRF A;  2CGL A;  4YOY A;  4EFH A;  3ATU A;  1VQ5 N;  2VGM A;  1BO5 O;  2QI2 A;  3BEX A;  3VEZ A;  5GAE P;  2YI1 A;  4CD1 A;  3R9P A;  4H5V A;  5AFU A;  3MN6 A;  4B1X B;  3TTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...