3A5MC

Crystal structure of a dictyostelium p109i mg2+-actin in complex with human gelsolin segment 1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
370
structure length
364
Chain Sequence
b'QALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAILNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAAAAIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gelsolin
publication title Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 113
structure length 364
sequence length 370
ec nomenclature
pdb deposition date 2009-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5mC01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5mC02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3a5mC03
2EWSA 1NGJA 1DGKN 3J8AA 2NRHA 4JNEA 2FF6A 4BG9A 3LM9A 1BA1A 4IJAA 1T6DA 3I33A 3ZX2A 3BF1A 5AQRA 4H5WA 2ZGYA 2FSJA 3A0IX 4RTFD 5AQJA 3VF6A 3VGMA 2V7YA 3R8EA 3LDNA 4K42A 4NO7A 5AQXA 2CGLA 1YAGA 3TU5A 2A3ZA 3CJ9A 3KZBA 2P9IB 1BOTO 1NGAA 1K8KA 5JMVA 1J6ZA 2D0PA 2IVOA 2YHXA 3QBWA 1K8KB 1C0GA 4IO8A 3GE1A 5BRFA 5LY3A 3FLCO 2QWMA 2W40A 2A40A 4H0OA 1XC3A 1EQYA 3ENOA 5EOYA 4XH5A 2ZWHA 2H3GX 5KPZA 3O80A 4BRMA 1V4TA 1C0FA 3L6QA 4CD1A 4MLHA 5ELZA 1E4GT 3JXUA 1NM1A 1U2VA 4BRDA 3VEXA 2QWOA 4AM7A 1NBWA 3FZLA 3CQYA 4BRIA 1U2VB 4K41A 4FWRA 1X3NA 4BR7A 4A61A 3M3ZA 1BO5O 4BRNA 5AQSA 2D0OA 4K43A 2P9NA 4BC4A 4BR5A 4BR0A 3S41A 3UE5A 3GDQA 4BRQA 5EX5A 5BN8A 2P9NB 4DB3A 2V52B 3ZX3A 4WQ5C 4FWOA 3CJ7A 4PKGA 3WXJA 3MN9A 4CZGA 5BPNA 1V4SA 3BF3A 3CERA 4BR4A 2GELA 2CGJA 1RFQA 1JCGA 3H1VX 5AR0A 5LJWA 3EKSA 3ZETA 4BC3A 4JAXA 1HKCA 3WEEA 1ZC6A 4WQ4C 4FOEA 2Q1NA 1QQOA 2Q2RA 4EIAA 3WXIA 5LJVA 3ZETB 3ULEA 3VENA 3WEEB 3CIPA 2AA4A 3VEVA 1HX1A 3C0BA 3ULEB 3ATUA 2PAVA 4B9QA 4EAHD 4FOIA 5JICA 2E2NA 3EO3A 2E88A 2GWJA 5AQQA 5JLHA 1GLCG 5KQ8A 1TUYA 4H5NA 4CZEA 4IXCA 4FSVA 2KHOA 1QZ5A 3GBTA 4YDUC 3SMSA 4EFHA 4AM6A 2F9TA 2IVPA 4XH1A 2FXUA 4FO0A 3R9PA 4F9OA 5TKYA 4HWIA 3FR0A 3O1BA 4FWMA 4I6MA 3VETA 1NGHA 2QWLA 3BUZB 4XH4A 5AQIA 4BRPA 2OANA 4I6MB 4ISEA 4BRKA 1MA9B 4QS9A 3O08A 1NGFA 1YXQA 3HSCA 4PKIA 4B1YB 3VEOA 3U4LA 2V51B 3GG4A 4A2BA 3VPZA 1NGDA 3ID8A 4B1VA 3H3OB 3M6GA 5EXWA 4CZHA 2YJFA 2D1KA 2YHYA 4BRLA 4QS8A 1SQKA 2YCHA 2P9IA 3KHYA 5AQFA 4GNIA 4BRGA 1Y64A 3ATVA 3G25A 4MLEA 4M63C 5FPEA 4H0PA 4Y0WA 4JHDA 2Q0RA 3HTVA 2CH6A 3SJHA 3D2EA 3SLCA 4BRCA 4JHDB 3BP8A 3MCPA 1QQMA 1YVNA 3A5OC 3D2EB 2HOEA 4CI6A 2QW9A 3VGLA 1HKGA 3W3DA 1ESVA 3FFKB 5AQUA 1NGIA 2HF3A 3WT0A 1HPMA 3CJAA 4H03B 1E4FT 3FE1A 3LDOA 2E1YA 5BRDA 2GWKA 2ASPA 4BQLA 4A62A 3TPQA 1NGBA 5AZIA 1S22A 3FZFA 2VYPA 5AZIB 4O5FA 2ZGZA 5ADXH 3CHWA 1X3MA 4MO5A 1DKGD 1NGGA 3SK3A 2QWNA 1GLDG 3WUHA 4BVOA 4C23A 5FPNA 3ZX0A 4BGAA 5KPTA 4CZIA 1Z6RA 4M7XA 4WQ5A 4BGBA 2P9KA 2E2PA 4BREA 3IUCA 4FWPA 1XUPO 2Q36A 1MDUB 2P9KB 2FLOA 2GEMA 4PKHA 4ISGA 4CZFA 3HZ6A 1KAXA 4WQ4A 2A6AA 4H5VA 5ADXA 1OKJA 3CQXA 4CBXA 3FZKA 4FWKA 2HF4A 3A5MC 3LL3A 4JD2A 3JS6A 4BRAA 1QZ6A 2P9UA 1BG3A 5AFUA 2ASOA 3DWLA 4L3QA 4JD2B 1HJOA 4NB4A 2P9UB 1ATSA 3HBTA 1XQSC 3O1WA 5BPLA 2E8AA 1SZ2A 4PL8A 1BUPA 1GLEG 2UYTA 1CZAN 3H3NO 4YDUA 5KQDA 4BC2A 5AQPA 2A42A 4H0VB 4BR2A 3H6EA 4FWLA 4XEIA 3MDQA 3QFPA 4BVPA 3H46O 4DHYA 1LCUA 5AQGA 3U9DA 3EZWA 1H1VA 3VGKA 4CZJA 4Z94A 1NMDA 3AAPA 3F9MA 3D2FA 3QFUA 1GLBG 3WQUA 2QWPA 1KAYA 1G99A 3D2FB 2I7NA 4DQ8A 4B1XB 4BG8A 4DCHA 4CZKA 1NGEA 1HKBA 1JCEA 3RSEA 2IVNA 3MN7A 3MN5A 5F1XA 3B8AX 4GY2B 5EVZA 2GUPA 2QWQA 3RSEB 2QXLA 2AP1A 4B1ZA 5E26A 2V7ZA 3EL2A 2I7PA 1Z05A 2Q0UA 1YUWA 3MK6A 4QS7A 2A5XA 3QMLA 4FWSA 3CJBA 1GLFO 3DXMA 4CJ7A 3U9ZA 3IFRA 3L0QA 3ZEUA 4FWQA 4RCHA 4B1UB 3MMVA 3DXMB 3O4WA 3A5NC 1ATNA 3QB0A 5AQHA 3ZEUB 4H0TB 3R6MA 3C7NA 5AQZA 5F2RA 3QDKA 3LDLA 4WYBA 4BR9A 5AZJA 3C7NB 3A8YA 3CI5A 5AQNA 5BR9A 1Q18A 5AZJB 1WUAA 3QICA 2E1ZA 2QWRA 4A2AA 3IDHA 2WUSA 2J4RA 1BA0A 4JN4A 5CE3A 4CD3A 3WXKA 2GTDA 2PBDA 3CETA 4FPAA 3GL1A 2FSNA 3UB5A 4BROA 1MWMA 3FGUA 3ENHA 1X9JA 1RGIA 4BQZA 3FZHA 1NGCA 1U6ZA 3VEZA 4CBWA 1BU6O 2E2QA 4BC5A 3OHRA 3DXKA 3VOVA 1BWFO 5AQMA 3WQTA 1LOTB 1IJJA 3A5LC 3EKUA 3LDQA 3DXKB 5BN9A 5AFUH 1DEJA 5AQKA 2ITMA 2ZF5O 4H0YB 2W41A 1S3XA 2QM1A 3O5BA 5BREA 3HM8A 1T6CA 3H45C 4FWNA 1IG8A 1TYQA 2NLXA 3GOIA 3VF4A 3DJCA 4IWVA 3L4IA 3MN6A 2D4WA 1HLUA 3BEXA 3QBXA 5KPRA 1TYQB 5AQYA 3LM2A 4CBUA 5FPDA 3CJCA 3H1QA 2BUPA 4HTLA 4IJNA 4CZLA 1ATRA 2VWBA 5JLFA 5BRHA 5AQOA 2CH5A 2E20A 1QQNA 4M7YA 1GLAG 2Q31A 4LC9B 2Q97A 2E2OA 2YJEA 1WOQA 3AAQA 1GLJO 3EN9A 3CJ1A 3I8BA 5AQWA 3WXLA 3VEWA 1T44A 1JCFA 1KXPA 2ASMA 3M1FA 4RWTA 3UKRA 4H0XB 1NLVA 3O6WA 4FL9A 2BTFA 4KBOA 3UKRB 4B1WB 3W0LA 2P9PA 2CGKA 1GLLO 5AQTA 4BRFA 3FZMA 2HMPA 4MO4A 2P9PB 3P4IA 1TUUA 2P9SA 1MWKA 1QHAA 1P8ZA 5I9EB 3AARA 1HUXA 4FPBA 5F0XA 1R59O 1ZBSA 2P9SB 2A41A 2VCPA 3KVGA 4E1JA 2FF3B 4O8KA 2FSKA 1RDWX 4EHUA 2YI1A 3HI0A 3D7EO 5BPMA 2DPNA 1BDGA 4H5TA 3O8MA 3DAWA 2IIRA 1KAZA 1D4XA 3VEYA 4EHTA 5AQLA 1ZXOA 5E84A 5FPMA 3UKUA 3SMPA 4H5RA 3VERA 4PL7A 5B8HA 3UKUB 3AY9A 3VF2A 1SAZA 2F9WA 4BRHA 2YHWA 3IMXA 3U8XA 2P9LA 5EY4A 2NZTA 3LDPA 5AQVA 4ISFA 4IZ9A 3VESA 4J8FA 1NWKA 4K25A 4CZMA 2P9LB
chains in the Genus database with same CATH superfamily
2EWSA 1NGJA 3VA0A 3J7AP 1C6VA 2XO7A 1LWCA 1GOCA 3VTHA 4JKFA 2G8FA 1BA1A 4NCBA 3OJUA 3ZX2A 3BF1A 4DV5K 1N36K 1BGXT 3TWHA 3CCEN 2KKZA 2FSJA 5AQJA 1S72N 1S9GA 1KVBA 4PWDA 4DR5K 1DLOA 3VQCA 3J81O 1VSIA 4I7FA 3O3FA 4ELTA 5JMVA 3RMDA 4DTJA 3QBWA 1KFDA 1RTIA 3SI6A 4FK0A 4DFKA 3FLCO 1NJYA 1TV6A 4DTSA 3DLEA 1JXEA 4YORA 4JI8K 1SUQA 4XH5A 1IV0A 3T69A 4KH5A 4R5PA 3IKMA 4LY7A 4C8OA 1E4GT 1IKXA 4FVMA 4DU4A 3CQYA 3V1RA 4OJRA 1RBUA 3I8DA 1ASWA 3NVKA 3M3ZA 1BO5O 4BRNA 4EP4A 3C94A 3L2WA 2P9NA 4BC4A 4KTZA 4NYNA 5HROA 2P9NB 2B5JA 4HUGA 2V52B 5J2NA 4WQ5C 2F7TA 3WNFA 4CHQA 3WXJA 3T7ZA 3MN9A 1T3VA 5BPNA 1V4SA 3MX2A 3M8PA 4DR7K 1JCGA 3H1VX 5AR0A 5LJWA 3EKSA 4BC3A 3OYLA 4WQ4C 2Q1NA 3SAHA 1QQOA 3WNHA 3RMCA 3CIPA 3VEVA 3LZJA 1EP4A 4M3RA 4DV0K 1KTQA 1T03A 4DR6K 3K0SA 3LANA 5KQ8A 1JLFA 4FSVA 3RR8A 3ZT0A 4UY8O 3SUNA 2UXCK 2YNHA 4YDUC 3LZIA 2NUBA 4FJLA 3SMSA 4EFHA 1WSGA 5CR4A 3CCMN 2G8HA 3OBYA 2F9TA 3DMJA 1KQSM 4C8LA 2XRIA 4LF8K 4HWIA 3FR0A 3O1BA 4BRPA 3OYMA 2QI2A 4BRKA 1MA9B 1NGFA 3HSCA 1EWRA 4AHUA 4B1YB 4CJUA 4KHPK 5M1NA 2V51B 3GG4A 4B1VA 3H3OB 2EX3A 4CZHA 4CHPA 1XMQK 4AHVA 2YJFA 3ID6A 3B6OA 5AQFA 1IKYA 4YFUA 5JS2A 4DTUA 2X6NA 4MLEA 3OS0A 1S1TA 4CHOA 5M1OA 3F2KA 1S1VA 2ZJRL 4KRFA 4JHDA 4CEZA 2Q0RA 4B3SK 2X6SA 1K8AO 4JHDB 3BP8A 2BE2A 4OLAA 2HVHA 2HOEA 2HNZA 4CJVA 3QEIA 3AA5X 1QTMA 3SBGA 3VGLA 1Q81O 4DLEA 4R79A 2HF3A 1HPMA 4QOZB 2ASPA 3KKRA 1M90O 3ZT4A 2HNYA 2VG6A 5J2QA 1X3MA 2PYJA 1DKGD 1NGGA 4YOXA 4PQUA 4BVOA 1IKWA 2YKMA 4C23A 2HW3A 4NCGA 1KFSA 2O8EB 4CF2A 2Z1GA 4CJKA 4O55A 1ASVA 3QNNA 2OPQA 3LDSA 4FWPA 4KPYA 1MDUB 5CZ2A 1VHXA 3MX5A 2ATQA 1YTAA 3HZ6A 1KAXA 1YHQN 4H5VA 3KLFA 1OKJA 1N34K 1GOBA 4CBXA 5HL7L 1I94K 4I2PA 4JD2A 4CESA 4FVUA 2HHHK 4BDZA 2IC3A 1YTUA 1QSLA 4JD2B 4CFDA 4NB4A 2NRTA 1XQSC 5C0YA 3NCIA 2XY6A 2YNGA 5KGXA 3V1OA 2E8AA 3OVNA 4PL8A 4KHUA 1BQNA 3H3NO 3SQ0A 5DK5A 4BC2A 1NK8A 4FK4A 4H0VB 4IFEA 3H6EA 1RDBA 3H46O 3CXCM 1VQMN 5AQGA 3U9DA 1VSJA 1BI4A 1W0HA 5IT9O 4CE9A 4FLTA 4B9LA 3NGZA 4FW1A 1KLMA 4CF0A 3M8QA 5EU7A 2E5LK 1G99A 1JKHA 3QNOA 2W00A 4B1XB 4FJKA 4JI5K 3CYGA 1TKZA 1QVGM 1NGEA 2ZJPL 3IG1A 5F1XA 1IKVA 3AVKA 3O9UA 1RT6A 2QWQA 4AHTA 4JKCA 4CJRA 1VQON 1SKRA 4I2QA 3HPHA 3NDKA 5KTQA 2A5XA 4CEFA 4CGJA 3MCAB 1O1WA 4FLVA 3IFRA 3ZEUA 1BL3A 1VQNN 2QXFA 4RCHA 3HXMA 4U67L 5LMNK 1NOZA 1RILA 4JEPA 4CGHA 3ZEUB 4FM0A 3RWUA 3CPWM 4WYBA 4BE0A 4C1NI 5M1PA 3TSPA 3A8YA 3ASMA 1HPZA 3CI5A 1EKEA 4ELVA 1NJIO 5BR9A 3QERA 1QHTA 1WUAA 4LH5A 3IDHA 2KZMA 1ZBFA 2J4RA 3SAGA 1XNRK 1BA0A 5D3GA 4JN4A 5CE3A 1X1PA 3PX6A 1JJ2M 4J2DA 5KGWA 2OZSA 4CFCA 1X9JA 4BQZA 1U6ZA 4CBWA 4BEBA 4YHHK 4H4MA 1BU6O 5HRSA 1KLNA 1TAUA 4BC5A 2G8VA 4FZZA 3VOVA 1L3VA 3PX0A 5AQMA 3WQTA 1IJJA 2BH1A 1U49A 1DEJA 2ITMA 3ZSQA 3HOSA 2XY7A 4B08A 5CZ1A 3QEXA 1TYQA 4WFBL 1C1BA 3AO1A 3PSFA 3QBXA 5KPRA 1TYQB 3OYJA 3HYFA 5FPDA 3CJCA 3H1QA 3DI6A 3LAKA 4AHSA 4OO1J 4JKGA 4LD0A 3P1GA 1ATRA 3FFIA 3R3LA 5BRHA 5JLFA 2G8KA 4JKGB 5GAHP 1VQ9N 2Q31A 1RNHA 1X9MA 2PZSA 3NMUA 2E2OA 3PO5A 1WBBA 4PY5A 1VRUA 3EN9A 5AQWA 1T44A 3M1FA 3J7YP 4K0KK 3S5TA 2BTFA 3TAPA 4B3MK 4OVLA 4DV4K 4KKOA 1S6QA 2P9PA 2CGKA 4M3WA 4DV1K 4BRFA 4IDKA 3JAMO 2GUIA 3THYA 4MO4A 2P9PB 4FPBA 3THYB 4CCHA 4Z0UA 2XHBA 1ZBSA 2VCPA 4CGDA 3ZYYX 4J2BA 3WNGA 3AV9A 2F96A 2YI1A 4AF1A 2RHKA 1VSMA 3MEDA 3AVBA 4FJ5A 1EWQA 3KLIA 2DPNA 4B9NA 1BDGA 1TAQA 3SUOA 4TSXA 4A59A 3SNNA 4GV9A 5E84A 3UKUA 5LL6Z 2YNIA 3AGRA 3CFRA 3AVAA 1A5WA 1TL3A 1IH7A 3UKUB 3VF2A 1NJZA 3O9RA 1VSKA 2WBNA 4FM2A 5HOOA 2YHWA 3VQBA 2UUCK 3U8XA 2NZTA 3LDPA 2DFFA 4ISFA 5AQVA 3VESA 2QK9A 4CZMA 4DQPA 2IOCA 3J8AA 3L2VA 4CIEA 3LM9A 1T6DA 3I33A 3U3YA 3EY1A 4LSNA 5AQRA 3SQ2A 1VSHA 1WN7A 1HRHA 4KHSA 4M42A 2YV0X 1TK5A 2V7YA 3R8EA 4K42A 3NFAA 4NO7A 5AQXA 3V9ZA 4KHQA 2P9IB 2ZD1A 3E1YA 2QKKA 4CJ4A 2ITGA 3VQ6A 2BANA 3A2FA 1WB9A 2RF2A 2JLEA 1RT2A 2IVOA 2YHXA 4ILHA 2VQEK 4CJLA 4B9VA 4RW6A 2FBVA 5BRFA 3C6AA 4DR3K 1J5EK 3KK3A 4WE1A 2A40A 4H0OA 2OPRA 3AA4A 1HYSA 5C2FA 2H3GX 5KPZA 4KHYA 4DFMA 3EE8A 1KSPA 3G10A 4MLHA 5ELZA 4BWMA 2O8DB 3OYIA 3CCVN 3V9WA 1NBWA 4KHWA 3AVCA 2AJQA 4FWRA 4CJ3A 2X74A 3KWIA 3D0PA 1I39A 4NXMK 3SV4A 4M3UA 4J2AA 1OH7A 3KLEA 1UA0A 3GDQA 5EX5A 3PO4A 2OPPA 3WXMB 4KTWA 4QAGA 3ZX3A 5J1EA 3CC2N 1CLQA 3CJ7A 3O3HA 5I3UA 4DSJA 1TKDA 4OPKA 4N76A 2CGJA 5K14A 4CF9A 4JYAK 4JAXA 1HKCA 3MXMA 2KFZA 3NF9A 2HMIA 1VQKN 4ILGB 3VQ4A 3C6HA 5LJVA 2FBTA 3ULEA 1W7AA 1R0AA 3TAMA 3PUFA 4YOWA 2VG7A 1HX1A 1JLBA 3ULEB 4YOVA 4BDYA 3ATUA 2E88A 3SAFA 1JLQA 2GWJA 4B9UA 3VQDA 4DTRA 4CZEA 4IXCA 1Q86O 4OKKA 3NVMA 4NXNK 1CXUA 3OY9A 4DSKA 4AM6A 4DKWA 3THVA 4XH1A 1LV5A 4LF4K 4ID1A 4I6MA 1NGHA 5AQIA 2OANA 4I6MB 4ISEA 4CFAA 1YXQA 2YNFA 1A5VA 4KAZA 4PKIA 3U4LA 4CJFA 2GX9A 2D0BA 4CJPA 2QKBA 5EXWA 3AA2A 2HBLA 2YHYA 4QS8A 4G1QA 4FXDA 3KHYA 3KLGA 4DFPA 4O4GA 4BRGA 3K5LA 1C1AA 1U4BA 1TGOA 4O8UA 3VQPA 3OYFA 1QS4A 2HBJA 4FK2A 1RT1A 3D2EA 3SLCA 4BRCA 3I56N 3CMAN 1QQMA 3NAEA 3D2EB 5KRSA 4CI6A 2QW9A 3RTVA 4DUZK 1IBLK 1ESVA 2W6KA 3FFKB 1NGIA 3AO5A 3OA9A 2R7YA 3CJAA 4H03B 4JI0K 4DV3K 2GWKA 4W5OA 4DMNA 2HB5A 3E01A 2YX6A 4F3OA 3MECA 3CM6A 2ZGZA 4CGFA 4B9TA 3OYNA 2C1IA 1QE1A 3SK3A 1ZYQA 2QWNA 3WUHA 4LF5K 1XNQK 3ITHA 5FPNA 1IBMK 4BGAA 5KPTA 3HJFA 1QVFM 1Z6RA 1KVAA 1LW2A 4M7XA 4WQ5A 2HBMA 2P9KA 4X65K 4BE7B 2YHAA 1EXQA 3BZCA 2P9KB 2GEMA 1J53A 4ISGA 4PKHA 3AVNA 4WQ4A 2DFEA 2I5JA 3EEQA 5ADXA 3QESA 4YOYA 4JV5K 1VQ6N 4PA1A 3DM2A 4GMJB 5C24A 2VWJA 3FZKA 2HHQA 2HF4A 3A5MC 4N56A 3RRGA 4Z4EA 1JL2A 3T1AA 4HHTA 4MDAA 4L3QA 1Q82O 1YITN 1XHZA 4RW8A 3O4NA 3O1WA 4Y1CA 4J2EA 3P39A 3TI0A 4YOUA 1GLEG 2UYTA 4YDUA 2HBKA 3CYMA 5AQPA 1UOCA 2A42A 4KO0A 4FWLA 4CIFA 1D5AA 3U3GA 5C10A 3LPUA 4CEBA 2P51A 1VAZA 4DHYA 4FJ8A 1FKOA 2A1RA 3EZWA 1H1VA 5C2DA 1VK0A 3E9PA 4CZJA 2XY8A 3K5OA 1NMDA 4W5TA 3CQ8A 4OGEA 4X62K 1GLBG 2NRXA 4PHTX 2QWPA 1BCMA 4PUOA 5M1KA 3ZLJA 4DQ8A 2E6LA 4E7JA 4DSLA 3D6RA 2OTLN 3PLAA 2F4VK 3ZSWA 2QEXN 3PIPL 3RSEA 1ZBUA 3JYTA 4BY9C 5EVZA 3RSEB 1RT4A 4B1ZA 4KI4A 1SL2A 4NYFA 1N8RO 4OKEA 4XIUA 3CCQN 2Q0UA 1YUWA 3IS9A 3MK6A 4IOAL 1P90A 2O4GA 3QMLA 2OYQA 4IFVA 3SQ4A 4B1UB 4FWQA 4IO9L 1WSHA 4DTXA 1ZBLA 3O4WA 3A5NC 1ATNA 5AQHA 4LF9K 4H8KA 3OBWA 5DM7L 1HNZK 3R6MA 3C7NA 4O5BA 4M3XA 5AQZA 3SUPA 4GV6A 4BR9A 4DSIA 3HPOA 1TKTA 3K9JA 3MXIA 2D0AA 3C7NB 5AQNA 3THWA 1Q18A 3I0SA 3NE6A 3QICA 1HJRA 2BGGA 2G8WA 1W9HA 2WUSA 3THWB 1FW6A 3MWTA 1YJWN 4JKAA 3F9KA 4JKDA 1ASUA 4RW4A 3GL1A 2FSNA 3UB5A 3FGUA 1RGIA 4YY3K 4GKJK 1NGCA 3VEZA 3KD5E 4LF7K 4GKKK 4CJWA 4DG1A 5C42A 3SV3A 2Y1JA 2O8EA 3S9HA 4IG0A 2IAJA 3S3OA 1BWFO 1LOTB 5GADP 3DLBA 4WF9L 3EKUA 3LDQA 5AFUH 5AQKA 3CFOA 3P38A 1S3XA 2QM1A 3VQ5A 5BREA 3QINA 1D9DA 1IG8A 3VF4A 3L4IA 3NHGA 4N41A 5AQYA 3V81A 3LM2A 4O44A 4CBUA 2BUPA 2Q3SA 1RDUA 3OYHA 4IJNA 4CZLA 3VN5A 2KW4A 1TK0A 4DR2K 4DF8A 2VWBA 2Z1HA 4CFBA 1VRTA 5AQOA 1J5OA 3I0RA 1QQNA 4GV3A 4A5BA 3LWMA 3QEVA 1GLAG 4F4KA 5M1FA 2Q97A 1S9EA 1WOQA 1HNXK 1NJWA 4EP5A 4W5NA 4K8XA 1JCFA 4H0XB 1JLAA 4HUEA 1U47A 4KBOA 3CCUN 2WTUA 4RW7A 3W0LA 4E7IA 3E9OA 3FZMA 3ALYA 4HTUA 1TUUA 1YF5L 1LAWA 5F0XA 1R59O 3AVHA 5LMUK 3TAFA 3CCSN 2HHXA 4O8KA 2FSKA 4Y1DA 2WC9A 3HRGA 4JKEA 2JWKA 3HI0A 3D7EO 4I9LA 1KC8O 3VEYA 1D4XA 3QLHA 1XMOK 3DRSA 5AQLA 1IO2A 3K5NA 5M1QA 1HNWK 5A2QO 1RTJA 3SMPA 4E1NA 2O8CA 4WFNL 3AY9A 1HNIA 1SAZA 2F9WA 2VGNA 2O8CB 2RN2A 3IMXA 4OPHA 2P9LA 4A5AA 4IZ9A 4DV6K 4W5QA 4X66K 3VQQA 2P9LB 1WNSA 4E89A 2NRHA 3QETA 2FF6A 4G9ZA 4NLCA 4BWJA 2Z1IA 3L3UA 3Q7CA 4CF8A 1OVYA 5DM6L 4FW2A 4C1NK 4Z4GA 1ZBIA 4H5WA 1CZ9A 2ZGYA 3A0IX 4RTFD 3VGMA 3JSMA 3LDNA 1YAGA 4ID5A 5J2MA 2P1JA 4B3RK 3KZBA 1BOTO 3M5RA 1NGAA 3O3GA 1J6ZA 3V9XA 3V4IA 3TARA 3AVJA 3OYGA 2JGUA 3GE1A 1IG9A 4WFAL 1S5JA 5FROA 4OLBA 2E4LA 3BY5A 3EZ5A 3PV8A 3DLHA 1BIUA 3ZSRA 4DSEA 3CD6N 3C95A 1XC3A 3ENOA 3OYBA 2O4IA 3S3NA 3O80A 3CC7N 2B6AA 4BRMA 4U7BA 1C0FA 4DFJA 4CD1A 4QCLA 2IS3A 4JS4A 1Q9YA 1FKPA 5HBMA 3JXUA 1U2VA 2D5RA 4HCBA 3VEXA 2XY5A 3FZLA 4B9MA 3TSQA 4DTPA 1U2VB 4K41A 3RMBA 3T19A 1X3NA 4M3TA 4BR7A 4A61A 1O13A 4ZTFA 2HHSA 4LH4A 4IG3A 4BR5A 3S41A 3UE5A 1SL1A 4LFBK 4BRQA 4K8ZA 5BN8A 4DB3A 3RMAA 3KWGA 3ENBA 4FWOA 5HRRA 3VQEA 4PKGA 4CJTA 2QTDA 4CJEA 3TABA 4CZGA 3ZT1A 3BF3A 4BR4A 3BDPA 2GELA 3DLKA 1ZC6A 5KI6A 5CYMA 2Q2RA 4CEQA 4EIAA 3WXIA 2AA4A 3AGKA 3BZKA 1NOYA 1G15A 2PAVA 4B9QA 2E2NA 2KQ2A 2RKIA 3CC4N 3NGIA 5AJ3K 5AQQA 1NJXA 1GLCG 1TUYA 4H5NA 3TR8A 4AHCA 3NH0A 3GBTA 1NNEA 4JKHA 1ILYA 1Z25A 2LSNA 1NK0A 2IVPA 2FXUA 4FO0A 3R9PA 5TKYA 3TAGA 1NK7A 4F3TA 4FWMA 1WAFA 3VETA 2QWLA 4EZ6A 3AVMA 4AH9A 1I3AA 3O08A 3VEOA 4DV7K 4A2BA 4ELUA 5GIPA 1NGDA 3ID8A 1N33K 4IEEA 3LP0A 1SQKA 2P9IA 2FBXA 2EHGA 4GNIA 1SS6A 5KRTA 1Y64A 3ATVA 5JS1A 3G25A 4M63C 4IEIA 5FPEA 3LP2A 5CYQA 1ZBHA 3OYEA 3HTVA 3SJHA 3QIPA 3MCPA 4FJ7A 3CCLN 1RDDA 1NKCA 1OVQA 1HKGA 3W3DA 4DR4K 3WT0A 1JL1A 4JKBA 4KFBA 1E4FT 3FE1A 3LDOA 4BQLA 3TPQA 5AZIA 3FZFA 4OX9K 5JVGL 4ICLA 2O8DA 4B3OA 3DLLL 5AZIB 4O5FA 4FM1A 4Q0BA 4Z4CA 5ADXH 3OTOK 3L3VA 3C6UA 1NG9A 4DQRA 4WCEL 4LSLA 4CEDA 4KI6A 1K73O 4CZIA 4BGBA 4DLGA 2E2PA 3VA3A 1XUPO 2Q36A 1LW0A 4CK2A 4CZFA 2KTQA 2A6AA 3KTQA 1KD1O 3ZSOA 4JK9A 1K6YA 4RW9A 1GOAA 4FJIA 4FWKA 1YVUA 3ISNC 3JS6A 4KH4A 4E0DA 2ZM6K 1QZ6A 1BG3A 2ASOA 4FZYA 1KCFA 2YHBA 1HJOA 1ATSA 1RT7A 2OA8A 3HBTA 3WNEA 5BPLA 2JWLA 1WSEA 2VQFK 3K59A 1NK5A 3DRPA 1SZ2A 1BUPA 3J7ZO 1X9SA 2F8TA 1CZAN 5KQDA 4B8CA 1LWEA 4AILC 3VQ7A 3LP1A 3ZSVA 4XEIA 4BVPA 4DS5A 3G4SN 4FJHA 4BE2A 1LCUA 4CEAA 2OZMA 4FJ9A 4Z94A 3M8SA 4FJMA 3V9UA 5TKWA 1KAYA 2PYLA 4FLUA 4N47A 3RRHA 1J9AA 4NLBA 4BG8A 4L8RB 4CZKA 2WONA 3TTFA 4FJXA 3MN7A 4YOTA 3MN5A 5JVHL 2E6MA 3B8AX 4GY2B 1HR0K 2GUPA 4N5SA 2AP1A 3BGRA 2V7ZA 2KFNA 3NF8A 4M45A 3EL2A 3PIOL 2I7PA 1Z05A 4QS7A 1BQMA 3NH1A 3CJBA 1GLFO 3DXMA 1REVA 4CW7B 3IRXA 1TKXA 3MMVA 3DXMB 2F8SA 1UWBA 3OW2M 4H0TB 4B8AB 3V9SA 1K9MO 4MDBA 3QDKA 3LDLA 4M3YA 4IBNA 3OS1A 4FCYA 3OS2A 3F73A 3N4QA 3O9SA 3RR7A 4CD3A 3LWLA 3AVGA 2PBDA 4MQ3A 1U04A 4BROA 1MWMA 4CHNA 3HT3A 4M3ZA 3FZHA 1QSYA 3O9TA 2E2QA 4JI1K 3OHRA 1E3MA 5C15A 1WSFA 1EO1A 3DXKA 5GIOA 3P5JA 1C0UA 3A5LC 3HK2A 1IBKK 4F8RA 3DXKB 5BN9A 2VWKA 4DF4A 3LP3A 1MU2A 4H0YB 2W41A 3SQ1A 3O5BA 1RCHA 2UUBK 3HM8A 1T6CA 1VSLA 3H45C 5HRNA 4E7KA 3DJCA 1X9WA 2OTJN 3L4QA 4KTQA 2D4WA 3BEXA 5FRNA 4C8KA 1VQ8N 1J54A 4KB1A 4HTLA 4NCAA 3ZCMA 1YT3A 3P83D 2FBYA 2CH5A 2E20A 4M7YA 4LC9B 1HQUA 2YJEA 3AAQA 1GLJO 4HUFA 3WXLA 3CJ1A 3HP9A 2ASMA 3O6WA 3OYAA 1VQLN 1L5UA 1XC9A 3DOLA 4HCCA 3V6DA 1HNVA 1L3SA 1GLLO 1RT5A 5AQTA 3K2PA 2O8FA 2HMPA 4BECA 3P4IA 2P9SA 5I9EB 3AARA 1HUXA 2O8FB 2P9SB 2A41A 3LAMA 3RVCA 4EHUA 1RDWX 1BHLA 1RDAA 3QEWA 3KKSA 4H5TA 3CFPA 3EYZA 5E41A 3CM5A 3DAWA 1LAVA 2IIRA 1KAZA 3MWPA 4EHTA 1WAJA 1ZXOA 5FPMA 1FK9A 4H5RA 1YI2N 4PL7A 3PSIA 4BRHA 2B4JA 2P5GA 3AVFA 1S6PA 1SKSA 5CHIA 3CMEN 2HNDA 3NF7A 4K25A 4GW6A 5LY3A 4BE1A 1DGKN 2DTUA 4CGGA 4JNEA 1WBDA 4JS5A 4BG9A 1S1XA 3G71N 4IJAA 4JK7A 3CCJN 1RT3A 5HP1A 4FZXC 2RPIA 3TSUA 3VQ9A 1XWLA 3VF6A 1B92A 4DS4A 4JI3K 2CGLA 3TU5A 2A3ZA 3CJ9A 3L2RA 3H08A 3T1HK 1K8KA 4Z4HA 2D0PA 5T7BA 1RTDA 1K8KB 1YIJN 4CVNE 1C0GA 4CEEA 1VSEA 4IO8A 5J2PA 4I9QA 3HVRA 3AO2A 2QWMA 3SUQA 1TK8A 2D0CA 2W40A 3SYZA 4FJNA 1EQYA 5EOYA 1RBVA 5DMRA 1Q7YO 3HVTA 3TTCA 4E72A 2ZWHA 1V4TA 3L6QA 4JK8A 2RE2A 4DTOA 1NM1A 4BRDA 3LALA 3OYDA 3AVLA 2HHWA 4ILJA 1F21A 3SPZA 2QWOA 4AM7A 1BCOA 4Z4IA 4KV8A 4BRIA 4F2SA 1L3UA 2P5OA 3SCXA 1VSFA 5JENA 3VMFB 1C1CA 4IDHA 5AQSA 3J80O 1JXBA 2D0OA 4K43A 1EETA 1D8YA 4BR0A 4C8NA 2KLAA 1SV5A 1XI1A 3K5MA 1T05A 1QSSA 5GINA 5CY4A 2VGMA 4X64K 3CPEA 4DR1K 3CERA 4AHRA 3AO3A 1T8EA 4B3TK 1RFQA 4HVJA 3ZETA 3WEEA 4FOEA 4A57A 3QIOA 3ZETB 3VENA 3WEEB 2DY4A 4CF1A 2W6LA 3C0BA 4EAHD 3T1YK 1WLJA 4FOIA 5JICA 3EO3A 3OYCA 3SZ2A 5JLHA 2O8BA 2KHOA 1HYVA 1QZ5A 2IGIA 3NBPA 5HLFA 4CK1A 2O8BB 4Z4FA 4DQQA 1BI4B 4CHYA 1RDCA 4IOXA 3G6EN 2UU9K 1CZBA 4CK3A 1N5YA 4JI2K 4F9OA 1LWFA 4FJGA 2UXBK 3U6FA 5SWMA 3BUZB 4AQYK 4XH4A 4M41A 4FLWA 4LFCK 4V19S 1VQ7N 1QQCA 4BDPA 3DLGA 4QS9A 1B9DA 2X78A 4CECA 3VPZA 3DOKA 3K58A 3M6GA 3AO4A 1NKEA 2D1KA 3NGYA 4BRLA 3ZSYA 2YCHA 3HO1A 2ETJA 4LF6K 2KZZA 2HHVA 2OCEA 4CJ5A 3PX4A 3DLRA 4H0PA 4DU3A 4Y0WA 3E9LA 4IKFA 5GAGP 2CH6A 1JLEA 3KJVA 4JLHA 1CXQA 2PFUA 4KHNA 1YVNA 3A5OC 4OPAA 3VTIA 2G8IA 1M1KO 2OPSA 1W2BM 1DT9A 4CJQA 5AQUA 4CHZA 3KIOA 4DUYK 2DFHA 4EZ9A 4W5RA 1DTQA 1FJGK 2E1YA 2WFBA 5BRDA 4A62A 1NGBA 2W42A 1S22A 2VYPA 5C12A 1BISA 5IWAK 2ZQBA 3ZT2A 5GAEP 3O4QA 1NK4A 4KREA 3CHWA 4H4OA 1D9FA 4MO5A 4CGIA 4E19A 3L2UA 1GLDG 4RG8A 3NF6A 3ZX0A 4OPJA 3HPGA 4O0JA 3M8RA 5FLXO 4GVMA 4B9SA 4BREA 1S1UA 3IUCA 3UIQA 2FLOA 1UA1A 4JRQA 3CCRN 3SBTA 4MFBA 3CQXA 4CJSA 4UQGA 1SKWA 3LL3A 4JI7K 4BRAA 2P9UA 5AFUA 3KD1E 1RBSA 1HMVA 3DWLA 3VQ8A 4E3SA 2P9UB 1B9FA 2UXDK 3KK2A 1HQEA 2Y1IA 4BACA 4F2RA 1Y97A 4BR2A 5C25A 3MDQA 3QFPA 5FRMA 1HYZA 1C0MA 4GVEA 4DSFA 5MLCQ 3VGKA 3D45A 1RTHA 3Q7BA 3AAPA 3F9MA 3CF5L 3SJJA 3D2FA 3QFUA 3WQUA 4FLZA 1VQPN 1OH8A 3D2FB 2I7NA 4DCHA 1Z26A 1HKBA 1JCEA 3C6TA 3KLHA 2IVNA 4KH6A 4ZHRA 2HSTA 5SZTA 2QXLA 3MEEA 3MXJA 5E26A 1XHXA 3O9QA 3DRRA 4DV2K 3THXA 1SL0A 3C65A 1NK6A 1OH6A 1NKBA 3THXB 3HM9A 4FWSA 3G0ZA 4FLYA 4JRPA 4CJ7A 1RBRA 3U9ZA 3L0QA 3CG7A 3QB0A 3HOTA 1OH5A 4FJJA 1NK9A 4E7LA 5F2RA 4YNQA 4ZTJA 5AZJA 4DTMA 1Q8IA 2QA4N 4CERA 5AZJB 2E1ZA 2QWRA 4A2AA 3N4PA 3HSTB 2GV9A 1JLGA 3V1QA 3TTDA 3WXKA 2GTDA 3CETA 4FPAA 1Q9XA 3EE9A 2PY5A 3T3FA 4DWIA 3ENHA 3SPYA 1L3TA 3I55N 3L2QA 1JLCA 2NRRA 5H1SQ 3AA3A 1YJNN 2UUAK 1VQ4N 4E1MA 2VG5A 2NRVA 3ULDA 2HHIA 1W97L 4XJXA 1U45A 3PY8A 1TVRA 1FXXA 2ZF5O 4KB0A 2YKNA 3VQAA 3OJSA 4O0IA 4FWNA 2NLXA 1KRPA 3GOIA 3R1XA 4IWVA 1U48A 3IAYA 2HHTA 3MN6A 4DU1A 3KK7A 2HVIA 1HLUA 2BDPA 4JI6K 4LFAK 5I42A 1RBTA 3TANA 1DTTA 3ZT3A 1TL1A 3E66A 3OYKA 2NRZA 1T7PA 4C8MA 1VSDA 1NMNA 2A1SA 2HHUA 3MEGA 3S3MA 1A5XA 4OKJA 1WSJA 3LPTA 4OGCA 1BIZA 1YJ9N 3I8BA 4IFYA 4E7HA 3VEWA 1KXPA 4RWTA 1KVCA 3UKRA 1NLVA 4DQSA 3HP6A 4FL9A 3UKRB 4B1WB 1S1WA 1ITGA 2NRWA 3KK1A 1NU0A 4FYDA 2IDOA 3MAQA 1MWKA 1QHAA 2ZE2A 1P8ZA 4Q5VA 1N6QA 2C1GA 4FLXA 3KVGA 4E1JA 3K9KA 2FF3B 2ZJQL 3P31A 4CIGA 3TAEA 3AVIA 5BPMA 3TAQA 3K57A 4CEOA 2G8UA 3O8MA 3QEPA 1UAXA 5FDLA 4IOCL 3B6PA 3ZSXA 4JI4K 5BR8K 1EX4A 1WSIA 3VERA 1N32K 3ZSZA 5B8HA 3F5TA 2NNWA 2WOMA 5HRPA 4DQIA 4DTNA 3QO9A 2GBZA 1VQ5N 3HL8A 1C0TA 2Z1JA 3L8BA 5EY4A 3DYAA 3NH2A 2FC0A 4J8FA 1NWKA
chains in the Genus database with same CATH topology
2EWSA 1NGJA 1DGKN 3J8AA 2NRHA 4JNEA 3VTHA 4JKFA 2FF6A 4G9ZA 4BG9A 3LM9A 4NLCA 3G71N 1BA1A 4IJAA 1T6DA 3I33A 4JK7A 3Q7CA 3BF1A 3ZX2A 3CCJN 5AQRA 1OVYA 5DM6L 4C1NK 3TSUA 3CCEN 4H5WA 2KKZA 2FSJA 2ZGYA 3A0IX 4RTFD 5AQJA 3VF6A 3VGMA 2V7YA 3R8EA 1S72N 3LDNA 4K42A 4NO7A 5AQXA 2CGLA 1YAGA 3TU5A 2A3ZA 3CJ9A 3KZBA 2P9IB 1BOTO 3E1YA 3M5RA 1NGAA 1K8KA 5JMVA 1J6ZA 2D0PA 2IVOA 2YHXA 3QBWA 1K8KB 4ILHA 1YIJN 1C0GA 4IO8A 3GE1A 5BRFA 3C6AA 5LY3A 4WFAL 3FLCO 2QWMA 2W40A 2A40A 3CD6N 4H0OA 1XC3A 1EQYA 3ENOA 5EOYA 4YORA 1Q7YO 3TTCA 4XH5A 5C2FA 2ZWHA 3T69A 2H3GX 4KH5A 5KPZA 3O80A 3CC7N 3EE8A 4BRMA 4U7BA 3IKMA 1V4TA 1C0FA 3L6QA 4CD1A 4JK8A 4MLHA 5ELZA 2RE2A 1E4GT 3JXUA 1NM1A 1U2VA 4BRDA 4ILJA 3CCVN 3VEXA 2QWOA 4AM7A 1NBWA 3CQYA 3FZLA 3TSQA 4BRIA 1U2VB 4K41A 4FWRA 1X3NA 4BR7A 4A61A 3KWIA 3VMFB 4IDHA 1O13A 3M3ZA 3NVKA 1BO5O 4BRNA 5AQSA 2D0OA 4K43A 2P9NA 4BC4A 4BR5A 4BR0A 3S41A 3UE5A 3GDQA 4BRQA 5EX5A 2KLAA 5BN8A 2P9NB 3WXMB 4DB3A 3KWGA 2V52B 3ZX3A 3ENBA 4WQ5C 2F7TA 4FWOA 3CC2N 5GINA 3CJ7A 4PKGA 3WXJA 2VGMA 3T7ZA 3MN9A 2QTDA 1T3VA 4CZGA 3CPEA 5BPNA 1V4SA 3BF3A 3CERA 3MX2A 4BR4A 2GELA 2CGJA 1RFQA 1JCGA 3H1VX 5AR0A 5LJWA 3EKSA 3ZETA 4BC3A 4JAXA 1HKCA 3WEEA 1ZC6A 4WQ4C 4FOEA 2Q1NA 4A57A 3SAHA 1VQKN 4ILGB 1QQOA 2Q2RA 4EIAA 3WXIA 3C6HA 3ZETB 5LJVA 3ULEA 3VENA 3WEEB 3CIPA 2AA4A 3AGKA 3VEVA 4YOWA 1HX1A 3C0BA 3ULEB 4YOVA 3ATUA 2PAVA 4B9QA 4EAHD 4FOIA 5JICA 2E2NA 3CC4N 3EO3A 2E88A 3SAFA 2GWJA 5AQQA 5JLHA 1GLCG 5KQ8A 1TUYA 4H5NA 4CZEA 4IXCA 4FSVA 2KHOA 1Q86O 4UY8O 1QZ5A 3GBTA 4YDUC 3NVMA 3SMSA 4JKHA 4EFHA 5CR4A 3CCMN 1ILYA 3OBYA 4IOXA 4AM6A 4DKWA 2F9TA 3G6EN 1KQSM 2IVPA 4XH1A 2FXUA 4FO0A 3R9PA 4F9OA 5TKYA 4HWIA 3FR0A 3O1BA 4FWMA 4I6MA 3VETA 1NGHA 2QWLA 3BUZB 4XH4A 5AQIA 4BRPA 2QI2A 2OANA 4I6MB 4ISEA 4BRKA 1MA9B 1VQ7N 4QS9A 3O08A 1NGFA 1YXQA 3HSCA 4PKIA 4B1YB 3VEOA 3U4LA 5M1NA 2V51B 3GG4A 4A2BA 3VPZA 1NGDA 3ID8A 2GX9A 4B1VA 5GIPA 3H3OB 3M6GA 4IEEA 5EXWA 4CZHA 2HBLA 2YJFA 2D1KA 3ID6A 2YHYA 4BRLA 4QS8A 1SQKA 2YCHA 2P9IA 3KHYA 5AQFA 4GNIA 4BRGA 1SS6A 1Y64A 3ATVA 3G25A 4MLEA 4M63C 4IEIA 4O8UA 5FPEA 4H0PA 5M1OA 3F2KA 2ZJRL 4Y0WA 2HBJA 3E9LA 4JHDA 2Q0RA 5GAGP 3HTVA 2CH6A 3SJHA 1K8AO 3D2EA 3SLCA 4BRCA 3I56N 4JHDB 3BP8A 2PFUA 3MCPA 3CCLN 3CMAN 1QQMA 1YVNA 3A5OC 4OPAA 3D2EB 3VTIA 2HOEA 1M1KO 4CI6A 2QW9A 1W2BM 1DT9A 3SBGA 3VGLA 1Q81O 1HKGA 3W3DA 1ESVA 4R79A 3FFKB 5AQUA 1NGIA 2HF3A 3OA9A 3WT0A 1HPMA 4JKBA 3CJAA 4H03B 1E4FT 3FE1A 3LDOA 2E1YA 2WFBA 5BRDA 2GWKA 2ASPA 4BQLA 4A62A 3TPQA 1NGBA 5AZIA 1S22A 1M90O 3FZFA 2YX6A 2VYPA 5C12A 5JVGL 3DLLL 5AZIB 4O5FA 5GAEP 2ZGZA 5ADXH 2C1IA 3CHWA 1X3MA 4MO5A 1DKGD 1NGGA 3SK3A 4YOXA 4WCEL 2QWNA 1GLDG 3WUHA 4BVOA 4C23A 5FPNA 3ZX0A 4BGAA 5KPTA 1K73O 1QVFM 4CZIA 1Z6RA 4M7XA 4WQ5A 4BGBA 2HBMA 2P9KA 2E2PA 4BREA 3IUCA 4FWPA 1XUPO 2Q36A 1MDUB 4BE7B 2P9KB 2FLOA 2GEMA 4PKHA 3MX5A 4ISGA 4CZFA 3CCRN 3HZ6A 1KAXA 4WQ4A 2A6AA 3SBTA 1YHQN 4H5VA 5ADXA 1OKJA 4YOYA 1KD1O 3CQXA 1VQ6N 4CBXA 5HL7L 4JK9A 3FZKA 4FWKA 2HF4A 3A5MC 3LL3A 4JD2A 4FVUA 3JS6A 4KH4A 4BRAA 4MDAA 1QZ6A 2P9UA 1BG3A 5AFUA 2ASOA 3DWLA 4L3QA 4JD2B 1Q82O 1HJOA 4NB4A 1YITN 2P9UB 1ATSA 2NRTA 3HBTA 1XQSC 3O1WA 5C0YA 5BPLA 2JWLA 3P39A 2E8AA 1SZ2A 4PL8A 4YOUA 1BUPA 3J7ZO 1GLEG 2UYTA 1CZAN 3H3NO 4YDUA 2HBKA 5KQDA 4BC2A 5AQPA 2A42A 4H0VB 4IFEA 4BR2A 3H6EA 4FWLA 4XEIA 3MDQA 3QFPA 4BVPA 3H46O 5C10A 3G4SN 1VAZA 4DHYA 1LCUA 3CXCM 1VQMN 5AQGA 3U9DA 4GVEA 5MLCQ 3EZWA 1H1VA 3Q7BA 3VGKA 3E9PA 4CZJA 4Z94A 5C2DA 1NMDA 3AAPA 3F9MA 3CF5L 3D2FA 3QFUA 1GLBG 2NRXA 5TKWA 2QWPA 1KAYA 3WQUA 1G99A 4PHTX 1VQPN 2W00A 5M1KA 3D2FB 2I7NA 4DQ8A 4B1XB 4NLBA 4BG8A 4DCHA 4CZKA 3D6RA 1QVGM 3TTFA 2OTLN 3PLAA 1NGEA 1HKBA 2QEXN 1JCEA 3PIPL 2ZJPL 3RSEA 2IVNA 3MN7A 4KH6A 4YOTA 3MN5A 5F1XA 5JVHL 3B8AX 4GY2B 4BY9C 5EVZA 2HSTA 2GUPA 3O9UA 2QWQA 3RSEB 2QXLA 2AP1A 4B1ZA 4JKCA 2V7ZA 5E26A 3O9QA 1VQON 3EL2A 3PIOL 2I7PA 3C65A 1N8RO 1Z05A 3CCQN 2Q0UA 1YUWA 3MK6A 4QS7A 4IOAL 1P90A 2A5XA 3QMLA 4FWSA 3CJBA 1GLFO 3DXMA 3MCAB 4CJ7A 3U9ZA 3IFRA 3L0QA 3ZEUA 4FWQA 4RCHA 4B1UB 3MMVA 4IO9L 4U67L 1VQNN 4JEPA 3DXMB 3O4WA 3A5NC 1ATNA 3QB0A 5AQHA 3ZEUB 3HOTA 3OW2M 3OBWA 4H0TB 5DM7L 3R6MA 3C7NA 1K9MO 4MDBA 5AQZA 5F2RA 3QDKA 3LDLA 4WYBA 3CPWM 4BR9A 4C1NI 5AZJA 5M1PA 4GV6A 3K9JA 3TSPA 3C7NB 3A8YA 3CI5A 5AQNA 2QA4N 1NJIO 3N4QA 5BR9A 1Q18A 5AZJB 1WUAA 3QICA 2E1ZA 2QWRA 4A2AA 3IDHA 2WUSA 3N4PA 2J4RA 3MWTA 3SAGA 1BA0A 1YJWN 3O9SA 4JN4A 5CE3A 4JKAA 4CD3A 3TTDA 1JJ2M 3WXKA 4JKDA 2GTDA 2PBDA 3CETA 4FPAA 3GL1A 3EE9A 2FSNA 3UB5A 4BROA 1MWMA 3FGUA 3ENHA 1X9JA 1RGIA 4BQZA 3I55N 3FZHA 1NGCA 3O9TA 1U6ZA 2NRRA 3VEZA 4CBWA 5H1SQ 4BEBA 1BU6O 1YJNN 2E2QA 4BC5A 3OHRA 5C15A 1VQ4N 1EO1A 3DXKA 5GIOA 3VOVA 1BWFO 5AQMA 3WQTA 1LOTB 2NRVA 5GADP 4WF9L 1IJJA 3A5LC 1W97L 3EKUA 2BH1A 3LDQA 3DXKB 5BN9A 5AFUH 4XJXA 1DEJA 5AQKA 2ITMA 3HOSA 2ZF5O 3P38A 4H0YB 2W41A 1S3XA 2QM1A 3O5BA 5BREA 3HM8A 1T6CA 3H45C 4FWNA 1IG8A 1TYQA 2NLXA 4WFBL 3GOIA 3R1XA 3DJCA 4IWVA 3VF4A 3L4QA 3L4IA 2OTJN 3MN6A 3KK7A 2D4WA 1HLUA 3BEXA 3QBXA 5KPRA 1TYQB 5AQYA 3LM2A 1VQ8N 4CBUA 5FPDA 3CJCA 3H1QA 2BUPA 1RDUA 3E66A 4HTLA 4IJNA 4CZLA 2NRZA 4OO1J 4JKGA 1ATRA 2VWBA 3R3LA 5BRHA 5JLFA 5AQOA 2CH5A 2E20A 1QQNA 4JKGB 4M7YA 4A5BA 5GAHP 4GV3A 1GLAG 1VQ9N 2Q31A 4LC9B 2Q97A 5M1FA 3NMUA 2E2OA 2YJEA 1WOQA 3AAQA 1YJ9N 1GLJO 3EN9A 3CJ1A 3I8BA 5AQWA 3WXLA 3VEWA 1T44A 1JCFA 1KXPA 2ASMA 3M1FA 4RWTA 3UKRA 4H0XB 1NLVA 3O6WA 1VQLN 4FL9A 2BTFA 4KBOA 3UKRB 3CCUN 4B1WB 3W0LA 2P9PA 2CGKA 2NRWA 1GLLO 3E9OA 5AQTA 4BRFA 3FZMA 2HMPA 4BECA 4MO4A 2P9PB 3P4IA 1TUUA 2P9SA 1MWKA 1QHAA 1P8ZA 1YF5L 5I9EB 3AARA 1HUXA 4FPBA 2C1GA 5F0XA 2P9SB 1R59O 1ZBSA 2A41A 2VCPA 3KVGA 3ZYYX 3K9KA 4E1JA 3CCSN 3RVCA 2FF3B 4O8KA 2FSKA 1RDWX 4EHUA 4AF1A 2WC9A 2YI1A 3HRGA 3P31A 2ZJQL 4JKEA 2JWKA 3HI0A 3D7EO 2RHKA 5BPMA 1KC8O 2DPNA 1BDGA 4H5TA 3O8MA 4A59A 3DAWA 2IIRA 1KAZA 1D4XA 3MWPA 3VEYA 4EHTA 4IOCL 5AQLA 1ZXOA 4GV9A 5E84A 5M1QA 5FPMA 3UKUA 3SMPA 1YI2N 3AGRA 4H5RA 3VERA 4PL7A 4WFNL 5B8HA 3F5TA 2NNWA 3UKUB 3AY9A 3VF2A 1SAZA 3O9RA 2F9WA 4BRHA 2WBNA 1VQ5N 2VGNA 2YHWA 5HOOA 3IMXA 4OPHA 3U8XA 2P9LA 5EY4A 2NZTA 3LDPA 4A5AA 5AQVA 4ISFA 4IZ9A 3VESA 5CHIA 4J8FA 1NWKA 3CMEN 4K25A 4CZMA 2P9LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWS A;  1NGJ A;  1DGK N;  3J8A A;  2NRH A;  4JNE A;  2FF6 A;  4BG9 A;  3LM9 A;  1BA1 A;  4IJA A;  1T6D A;  3I33 A;  3ZX2 A;  3BF1 A;  5AQR A;  4H5W A;  2ZGY A;  2FSJ A;  3A0I X;  4RTF D;  5AQJ A;  3VF6 A;  3VGM A;  2V7Y A;  3R8E A;  3LDN A;  4K42 A;  4NO7 A;  5AQX A;  2CGL A;  1YAG A;  3TU5 A;  2A3Z A;  3CJ9 A;  3KZB A;  2P9I B;  1BOT O;  1NGA A;  1K8K A;  5JMV A;  1J6Z A;  2D0P A;  2IVO A;  2YHX A;  3QBW A;  1K8K B;  1C0G A;  4IO8 A;  3GE1 A;  5BRF A;  5LY3 A;  3FLC O;  2QWM A;  2W40 A;  2A40 A;  4H0O A;  1XC3 A;  1EQY A;  3ENO A;  5EOY A;  4XH5 A;  2ZWH A;  2H3G X;  5KPZ A;  3O80 A;  4BRM A;  1V4T A;  1C0F A;  3L6Q A;  4CD1 A;  4MLH A;  5ELZ A;  1E4G T;  3JXU A;  1NM1 A;  1U2V A;  4BRD A;  3VEX A;  2QWO A;  4AM7 A;  1NBW A;  3FZL A;  3CQY A;  4BRI A;  1U2V B;  4K41 A;  4FWR A;  1X3N A;  4BR7 A;  4A61 A;  3M3Z A;  1BO5 O;  4BRN A;  5AQS A;  2D0O A;  4K43 A;  2P9N A;  4BC4 A;  4BR5 A;  4BR0 A;  3S41 A;  3UE5 A;  3GDQ A;  4BRQ A;  5EX5 A;  5BN8 A;  2P9N B;  4DB3 A;  2V52 B;  3ZX3 A;  4WQ5 C;  4FWO A;  3CJ7 A;  4PKG A;  3WXJ A;  3MN9 A;  4CZG A;  5BPN A;  1V4S A;  3BF3 A;  3CER A;  4BR4 A;  2GEL A;  2CGJ A;  1RFQ A;  1JCG A;  3H1V X;  5AR0 A;  5LJW A;  3EKS A;  3ZET A;  4BC3 A;  4JAX A;  1HKC A;  3WEE A;  1ZC6 A;  4WQ4 C;  4FOE A;  2Q1N A;  1QQO A;  2Q2R A;  4EIA A;  3WXI A;  5LJV A;  3ZET B;  3ULE A;  3VEN A;  3WEE B;  3CIP A;  2AA4 A;  3VEV A;  1HX1 A;  3C0B A;  3ULE B;  3ATU A;  2PAV A;  4B9Q A;  4EAH D;  4FOI A;  5JIC A;  2E2N A;  3EO3 A;  2E88 A;  2GWJ A;  5AQQ A;  5JLH A;  1GLC G;  5KQ8 A;  1TUY A;  4H5N A;  4CZE A;  4IXC A;  4FSV A;  2KHO A;  1QZ5 A;  3GBT A;  4YDU C;  3SMS A;  4EFH A;  4AM6 A;  2F9T A;  2IVP A;  4XH1 A;  2FXU A;  4FO0 A;  3R9P A;  4F9O A;  5TKY A;  4HWI A;  3FR0 A;  3O1B A;  4FWM A;  4I6M A;  3VET A;  1NGH A;  2QWL A;  3BUZ B;  4XH4 A;  5AQI A;  4BRP A;  2OAN A;  4I6M B;  4ISE A;  4BRK A;  1MA9 B;  4QS9 A;  3O08 A;  1NGF A;  1YXQ A;  3HSC A;  4PKI A;  4B1Y B;  3VEO A;  3U4L A;  2V51 B;  3GG4 A;  4A2B A;  3VPZ A;  1NGD A;  3ID8 A;  4B1V A;  3H3O B;  3M6G A;  5EXW A;  4CZH A;  2YJF A;  2D1K A;  2YHY A;  4BRL A;  4QS8 A;  1SQK A;  2YCH A;  2P9I A;  3KHY A;  5AQF A;  4GNI A;  4BRG A;  1Y64 A;  3ATV A;  3G25 A;  4MLE A;  4M63 C;  5FPE A;  4H0P A;  4Y0W A;  4JHD A;  2Q0R A;  3HTV A;  2CH6 A;  3SJH A;  3D2E A;  3SLC A;  4BRC A;  4JHD B;  3BP8 A;  3MCP A;  1QQM A;  1YVN A;  3A5O C;  3D2E B;  2HOE A;  4CI6 A;  2QW9 A;  3VGL A;  1HKG A;  3W3D A;  1ESV A;  3FFK B;  5AQU A;  1NGI A;  2HF3 A;  3WT0 A;  1HPM A;  3CJA A;  4H03 B;  1E4F T;  3FE1 A;  3LDO A;  2E1Y A;  5BRD A;  2GWK A;  2ASP A;  4BQL A;  4A62 A;  3TPQ A;  1NGB A;  5AZI A;  1S22 A;  3FZF A;  2VYP A;  5AZI B;  4O5F A;  2ZGZ A;  5ADX H;  3CHW A;  1X3M A;  4MO5 A;  1DKG D;  1NGG A;  3SK3 A;  2QWN A;  1GLD G;  3WUH A;  4BVO A;  4C23 A;  5FPN A;  3ZX0 A;  4BGA A;  5KPT A;  4CZI A;  1Z6R A;  4M7X A;  4WQ5 A;  4BGB A;  2P9K A;  2E2P A;  4BRE A;  3IUC A;  4FWP A;  1XUP O;  2Q36 A;  1MDU B;  2P9K B;  2FLO A;  2GEM A;  4PKH A;  4ISG A;  4CZF A;  3HZ6 A;  1KAX A;  4WQ4 A;  2A6A A;  4H5V A;  5ADX A;  1OKJ A;  3CQX A;  4CBX A;  3FZK A;  4FWK A;  2HF4 A;  3A5M C;  3LL3 A;  4JD2 A;  3JS6 A;  4BRA A;  1QZ6 A;  2P9U A;  1BG3 A;  5AFU A;  2ASO A;  3DWL A;  4L3Q A;  4JD2 B;  1HJO A;  4NB4 A;  2P9U B;  1ATS A;  3HBT A;  1XQS C;  3O1W A;  5BPL A;  2E8A A;  1SZ2 A;  4PL8 A;  1BUP A;  1GLE G;  2UYT A;  1CZA N;  3H3N O;  4YDU A;  5KQD A;  4BC2 A;  5AQP A;  2A42 A;  4H0V B;  4BR2 A;  3H6E A;  4FWL A;  4XEI A;  3MDQ A;  3QFP A;  4BVP A;  3H46 O;  4DHY A;  1LCU A;  5AQG A;  3U9D A;  3EZW A;  1H1V A;  3VGK A;  4CZJ A;  4Z94 A;  1NMD A;  3AAP A;  3F9M A;  3D2F A;  3QFU A;  1GLB G;  3WQU A;  2QWP A;  1KAY A;  1G99 A;  3D2F B;  2I7N A;  4DQ8 A;  4B1X B;  4BG8 A;  4DCH A;  4CZK A;  1NGE A;  1HKB A;  1JCE A;  3RSE A;  2IVN A;  3MN7 A;  3MN5 A;  5F1X A;  3B8A X;  4GY2 B;  5EVZ A;  2GUP A;  2QWQ A;  3RSE B;  2QXL A;  2AP1 A;  4B1Z A;  5E26 A;  2V7Z A;  3EL2 A;  2I7P A;  1Z05 A;  2Q0U A;  1YUW A;  3MK6 A;  4QS7 A;  2A5X A;  3QML A;  4FWS A;  3CJB A;  1GLF O;  3DXM A;  4CJ7 A;  3U9Z A;  3IFR A;  3L0Q A;  3ZEU A;  4FWQ A;  4RCH A;  4B1U B;  3MMV A;  3DXM B;  3O4W A;  3A5N C;  1ATN A;  3QB0 A;  5AQH A;  3ZEU B;  4H0T B;  3R6M A;  3C7N A;  5AQZ A;  5F2R A;  3QDK A;  3LDL A;  4WYB A;  4BR9 A;  5AZJ A;  3C7N B;  3A8Y A;  3CI5 A;  5AQN A;  5BR9 A;  1Q18 A;  5AZJ B;  1WUA A;  3QIC A;  2E1Z A;  2QWR A;  4A2A A;  3IDH A;  2WUS A;  2J4R A;  1BA0 A;  4JN4 A;  5CE3 A;  4CD3 A;  3WXK A;  2GTD A;  2PBD A;  3CET A;  4FPA A;  3GL1 A;  2FSN A;  3UB5 A;  4BRO A;  1MWM A;  3FGU A;  3ENH A;  1X9J A;  1RGI A;  4BQZ A;  3FZH A;  1NGC A;  1U6Z A;  3VEZ A;  4CBW A;  1BU6 O;  2E2Q A;  4BC5 A;  3OHR A;  3DXK A;  3VOV A;  1BWF O;  5AQM A;  3WQT A;  1LOT B;  1IJJ A;  3A5L C;  3EKU A;  3LDQ A;  3DXK B;  5BN9 A;  5AFU H;  1DEJ A;  5AQK A;  2ITM A;  2ZF5 O;  4H0Y B;  2W41 A;  1S3X A;  2QM1 A;  3O5B A;  5BRE A;  3HM8 A;  1T6C A;  3H45 C;  4FWN A;  1IG8 A;  1TYQ A;  2NLX A;  3GOI A;  3VF4 A;  3DJC A;  4IWV A;  3L4I A;  3MN6 A;  2D4W A;  1HLU A;  3BEX A;  3QBX A;  5KPR A;  1TYQ B;  5AQY A;  3LM2 A;  4CBU A;  5FPD A;  3CJC A;  3H1Q A;  2BUP A;  4HTL A;  4IJN A;  4CZL A;  1ATR A;  2VWB A;  5JLF A;  5BRH A;  5AQO A;  2CH5 A;  2E20 A;  1QQN A;  4M7Y A;  1GLA G;  2Q31 A;  4LC9 B;  2Q97 A;  2E2O A;  2YJE A;  1WOQ A;  3AAQ A;  1GLJ O;  3EN9 A;  3CJ1 A;  3I8B A;  5AQW A;  3WXL A;  3VEW A;  1T44 A;  1JCF A;  1KXP A;  2ASM A;  3M1F A;  4RWT A;  3UKR A;  4H0X B;  1NLV A;  3O6W A;  4FL9 A;  2BTF A;  4KBO A;  3UKR B;  4B1W B;  3W0L A;  2P9P A;  2CGK A;  1GLL O;  5AQT A;  4BRF A;  3FZM A;  2HMP A;  4MO4 A;  2P9P B;  3P4I A;  1TUU A;  2P9S A;  1MWK A;  1QHA A;  1P8Z A;  5I9E B;  3AAR A;  1HUX A;  4FPB A;  5F0X A;  1R59 O;  1ZBS A;  2P9S B;  2A41 A;  2VCP A;  3KVG A;  4E1J A;  2FF3 B;  4O8K A;  2FSK A;  1RDW X;  4EHU A;  2YI1 A;  3HI0 A;  3D7E O;  5BPM A;  2DPN A;  1BDG A;  4H5T A;  3O8M A;  3DAW A;  2IIR A;  1KAZ A;  1D4X A;  3VEY A;  4EHT A;  5AQL A;  1ZXO A;  5E84 A;  5FPM A;  3UKU A;  3SMP A;  4H5R A;  3VER A;  4PL7 A;  5B8H A;  3UKU B;  3AY9 A;  3VF2 A;  1SAZ A;  2F9W A;  4BRH A;  2YHW A;  3IMX A;  3U8X A;  2P9L A;  5EY4 A;  2NZT A;  3LDP A;  5AQV A;  4ISF A;  4IZ9 A;  3VES A;  4J8F A;  1NWK A;  4K25 A;  4CZM A;  2P9L B; 
#chains in the Genus database with same CATH topology
 2EWS A;  1NGJ A;  3VA0 A;  3J7A P;  1C6V A;  2XO7 A;  1LWC A;  1GOC A;  3VTH A;  4JKF A;  2G8F A;  1BA1 A;  4NCB A;  3OJU A;  3ZX2 A;  3BF1 A;  4DV5 K;  1N36 K;  1BGX T;  3TWH A;  3CCE N;  2KKZ A;  2FSJ A;  5AQJ A;  1S72 N;  1S9G A;  1KVB A;  4PWD A;  4DR5 K;  1DLO A;  3VQC A;  3J81 O;  1VSI A;  4I7F A;  3O3F A;  4ELT A;  5JMV A;  3RMD A;  4DTJ A;  3QBW A;  1KFD A;  1RTI A;  3SI6 A;  4FK0 A;  4DFK A;  3FLC O;  1NJY A;  1TV6 A;  4DTS A;  3DLE A;  1JXE A;  4YOR A;  4JI8 K;  1SUQ A;  4XH5 A;  1IV0 A;  3T69 A;  4KH5 A;  4R5P A;  3IKM A;  4LY7 A;  4C8O A;  1E4G T;  1IKX A;  4FVM A;  4DU4 A;  3CQY A;  3V1R A;  4OJR A;  1RBU A;  3I8D A;  1ASW A;  3NVK A;  3M3Z A;  1BO5 O;  4BRN A;  4EP4 A;  3C94 A;  3L2W A;  2P9N A;  4BC4 A;  4KTZ A;  4NYN A;  5HRO A;  2P9N B;  2B5J A;  4HUG A;  2V52 B;  5J2N A;  4WQ5 C;  2F7T A;  3WNF A;  4CHQ A;  3WXJ A;  3T7Z A;  3MN9 A;  1T3V A;  5BPN A;  1V4S A;  3MX2 A;  3M8P A;  4DR7 K;  1JCG A;  3H1V X;  5AR0 A;  5LJW A;  3EKS A;  4BC3 A;  3OYL A;  4WQ4 C;  2Q1N A;  3SAH A;  1QQO A;  3WNH A;  3RMC A;  3CIP A;  3VEV A;  3LZJ A;  1EP4 A;  4M3R A;  4DV0 K;  1KTQ A;  1T03 A;  4DR6 K;  3K0S A;  3LAN A;  5KQ8 A;  1JLF A;  4FSV A;  3RR8 A;  3ZT0 A;  4UY8 O;  3SUN A;  2UXC K;  2YNH A;  4YDU C;  3LZI A;  2NUB A;  4FJL A;  3SMS A;  4EFH A;  1WSG A;  5CR4 A;  3CCM N;  2G8H A;  3OBY A;  2F9T A;  3DMJ A;  1KQS M;  4C8L A;  2XRI A;  4LF8 K;  4HWI A;  3FR0 A;  3O1B A;  4BRP A;  3OYM A;  2QI2 A;  4BRK A;  1MA9 B;  1NGF A;  3HSC A;  1EWR A;  4AHU A;  4B1Y B;  4CJU A;  4KHP K;  5M1N A;  2V51 B;  3GG4 A;  4B1V A;  3H3O B;  2EX3 A;  4CZH A;  4CHP A;  1XMQ K;  4AHV A;  2YJF A;  3ID6 A;  3B6O A;  5AQF A;  1IKY A;  4YFU A;  5JS2 A;  4DTU A;  2X6N A;  4MLE A;  3OS0 A;  1S1T A;  4CHO A;  5M1O A;  3F2K A;  1S1V A;  2ZJR L;  4KRF A;  4JHD A;  4CEZ A;  2Q0R A;  4B3S K;  2X6S A;  1K8A O;  4JHD B;  3BP8 A;  2BE2 A;  4OLA A;  2HVH A;  2HOE A;  2HNZ A;  4CJV A;  3QEI A;  3AA5 X;  1QTM A;  3SBG A;  3VGL A;  1Q81 O;  4DLE A;  4R79 A;  2HF3 A;  1HPM A;  4QOZ B;  2ASP A;  3KKR A;  1M90 O;  3ZT4 A;  2HNY A;  2VG6 A;  5J2Q A;  1X3M A;  2PYJ A;  1DKG D;  1NGG A;  4YOX A;  4PQU A;  4BVO A;  1IKW A;  2YKM A;  4C23 A;  2HW3 A;  4NCG A;  1KFS A;  2O8E B;  4CF2 A;  2Z1G A;  4CJK A;  4O55 A;  1ASV A;  3QNN A;  2OPQ A;  3LDS A;  4FWP A;  4KPY A;  1MDU B;  5CZ2 A;  1VHX A;  3MX5 A;  2ATQ A;  1YTA A;  3HZ6 A;  1KAX A;  1YHQ N;  4H5V A;  3KLF A;  1OKJ A;  1N34 K;  1GOB A;  4CBX A;  5HL7 L;  1I94 K;  4I2P A;  4JD2 A;  4CES A;  4FVU A;  2HHH K;  4BDZ A;  2IC3 A;  1YTU A;  1QSL A;  4JD2 B;  4CFD A;  4NB4 A;  2NRT A;  1XQS C;  5C0Y A;  3NCI A;  2XY6 A;  2YNG A;  5KGX A;  3V1O A;  2E8A A;  3OVN A;  4PL8 A;  4KHU A;  1BQN A;  3H3N O;  3SQ0 A;  5DK5 A;  4BC2 A;  1NK8 A;  4FK4 A;  4H0V B;  4IFE A;  3H6E A;  1RDB A;  3H46 O;  3CXC M;  1VQM N;  5AQG A;  3U9D A;  1VSJ A;  1BI4 A;  1W0H A;  5IT9 O;  4CE9 A;  4FLT A;  4B9L A;  3NGZ A;  4FW1 A;  1KLM A;  4CF0 A;  3M8Q A;  5EU7 A;  2E5L K;  1G99 A;  1JKH A;  3QNO A;  2W00 A;  4B1X B;  4FJK A;  4JI5 K;  3CYG A;  1TKZ A;  1QVG M;  1NGE A;  2ZJP L;  3IG1 A;  5F1X A;  1IKV A;  3AVK A;  3O9U A;  1RT6 A;  2QWQ A;  4AHT A;  4JKC A;  4CJR A;  1VQO N;  1SKR A;  4I2Q A;  3HPH A;  3NDK A;  5KTQ A;  2A5X A;  4CEF A;  4CGJ A;  3MCA B;  1O1W A;  4FLV A;  3IFR A;  3ZEU A;  1BL3 A;  1VQN N;  2QXF A;  4RCH A;  3HXM A;  4U67 L;  5LMN K;  1NOZ A;  1RIL A;  4JEP A;  4CGH A;  3ZEU B;  4FM0 A;  3RWU A;  3CPW M;  4WYB A;  4BE0 A;  4C1N I;  5M1P A;  3TSP A;  3A8Y A;  3ASM A;  1HPZ A;  3CI5 A;  1EKE A;  4ELV A;  1NJI O;  5BR9 A;  3QER A;  1QHT A;  1WUA A;  4LH5 A;  3IDH A;  2KZM A;  1ZBF A;  2J4R A;  3SAG A;  1XNR K;  1BA0 A;  5D3G A;  4JN4 A;  5CE3 A;  1X1P A;  3PX6 A;  1JJ2 M;  4J2D A;  5KGW A;  2OZS A;  4CFC A;  1X9J A;  4BQZ A;  1U6Z A;  4CBW A;  4BEB A;  4YHH K;  4H4M A;  1BU6 O;  5HRS A;  1KLN A;  1TAU A;  4BC5 A;  2G8V A;  4FZZ A;  3VOV A;  1L3V A;  3PX0 A;  5AQM A;  3WQT A;  1IJJ A;  2BH1 A;  1U49 A;  1DEJ A;  2ITM A;  3ZSQ A;  3HOS A;  2XY7 A;  4B08 A;  5CZ1 A;  3QEX A;  1TYQ A;  4WFB L;  1C1B A;  3AO1 A;  3PSF A;  3QBX A;  5KPR A;  1TYQ B;  3OYJ A;  3HYF A;  5FPD A;  3CJC A;  3H1Q A;  3DI6 A;  3LAK A;  4AHS A;  4OO1 J;  4JKG A;  4LD0 A;  3P1G A;  1ATR A;  3FFI A;  3R3L A;  5BRH A;  5JLF A;  2G8K A;  4JKG B;  5GAH P;  1VQ9 N;  2Q31 A;  1RNH A;  1X9M A;  2PZS A;  3NMU A;  2E2O A;  3PO5 A;  1WBB A;  4PY5 A;  1VRU A;  3EN9 A;  5AQW A;  1T44 A;  3M1F A;  3J7Y P;  4K0K K;  3S5T A;  2BTF A;  3TAP A;  4B3M K;  4OVL A;  4DV4 K;  4KKO A;  1S6Q A;  2P9P A;  2CGK A;  4M3W A;  4DV1 K;  4BRF A;  4IDK A;  3JAM O;  2GUI A;  3THY A;  4MO4 A;  2P9P B;  4FPB A;  3THY B;  4CCH A;  4Z0U A;  2XHB A;  1ZBS A;  2VCP A;  4CGD A;  3ZYY X;  4J2B A;  3WNG A;  3AV9 A;  2F96 A;  2YI1 A;  4AF1 A;  2RHK A;  1VSM A;  3MED A;  3AVB A;  4FJ5 A;  1EWQ A;  3KLI A;  2DPN A;  4B9N A;  1BDG A;  1TAQ A;  3SUO A;  4TSX A;  4A59 A;  3SNN A;  4GV9 A;  5E84 A;  3UKU A;  5LL6 Z;  2YNI A;  3AGR A;  3CFR A;  3AVA A;  1A5W A;  1TL3 A;  1IH7 A;  3UKU B;  3VF2 A;  1NJZ A;  3O9R A;  1VSK A;  2WBN A;  4FM2 A;  5HOO A;  2YHW A;  3VQB A;  2UUC K;  3U8X A;  2NZT A;  3LDP A;  2DFF A;  4ISF A;  5AQV A;  3VES A;  2QK9 A;  4CZM A;  4DQP A;  2IOC A;  3J8A A;  3L2V A;  4CIE A;  3LM9 A;  1T6D A;  3I33 A;  3U3Y A;  3EY1 A;  4LSN A;  5AQR A;  3SQ2 A;  1VSH A;  1WN7 A;  1HRH A;  4KHS A;  4M42 A;  2YV0 X;  1TK5 A;  2V7Y A;  3R8E A;  4K42 A;  3NFA A;  4NO7 A;  5AQX A;  3V9Z A;  4KHQ A;  2P9I B;  2ZD1 A;  3E1Y A;  2QKK A;  4CJ4 A;  2ITG A;  3VQ6 A;  2BAN A;  3A2F A;  1WB9 A;  2RF2 A;  2JLE A;  1RT2 A;  2IVO A;  2YHX A;  4ILH A;  2VQE K;  4CJL A;  4B9V A;  4RW6 A;  2FBV A;  5BRF A;  3C6A A;  4DR3 K;  1J5E K;  3KK3 A;  4WE1 A;  2A40 A;  4H0O A;  2OPR A;  3AA4 A;  1HYS A;  5C2F A;  2H3G X;  5KPZ A;  4KHY A;  4DFM A;  3EE8 A;  1KSP A;  3G10 A;  4MLH A;  5ELZ A;  4BWM A;  2O8D B;  3OYI A;  3CCV N;  3V9W A;  1NBW A;  4KHW A;  3AVC A;  2AJQ A;  4FWR A;  4CJ3 A;  2X74 A;  3KWI A;  3D0P A;  1I39 A;  4NXM K;  3SV4 A;  4M3U A;  4J2A A;  1OH7 A;  3KLE A;  1UA0 A;  3GDQ A;  5EX5 A;  3PO4 A;  2OPP A;  3WXM B;  4KTW A;  4QAG A;  3ZX3 A;  5J1E A;  3CC2 N;  1CLQ A;  3CJ7 A;  3O3H A;  5I3U A;  4DSJ A;  1TKD A;  4OPK A;  4N76 A;  2CGJ A;  5K14 A;  4CF9 A;  4JYA K;  4JAX A;  1HKC A;  3MXM A;  2KFZ A;  3NF9 A;  2HMI A;  1VQK N;  4ILG B;  3VQ4 A;  3C6H A;  5LJV A;  2FBT A;  3ULE A;  1W7A A;  1R0A A;  3TAM A;  3PUF A;  4YOW A;  2VG7 A;  1HX1 A;  1JLB A;  3ULE B;  4YOV A;  4BDY A;  3ATU A;  2E88 A;  3SAF A;  1JLQ A;  2GWJ A;  4B9U A;  3VQD A;  4DTR A;  4CZE A;  4IXC A;  1Q86 O;  4OKK A;  3NVM A;  4NXN K;  1CXU A;  3OY9 A;  4DSK A;  4AM6 A;  4DKW A;  3THV A;  4XH1 A;  1LV5 A;  4LF4 K;  4ID1 A;  4I6M A;  1NGH A;  5AQI A;  2OAN A;  4I6M B;  4ISE A;  4CFA A;  1YXQ A;  2YNF A;  1A5V A;  4KAZ A;  4PKI A;  3U4L A;  4CJF A;  2GX9 A;  2D0B A;  4CJP A;  2QKB A;  5EXW A;  3AA2 A;  2HBL A;  2YHY A;  4QS8 A;  4G1Q A;  4FXD A;  3KHY A;  3KLG A;  4DFP A;  4O4G A;  4BRG A;  3K5L A;  1C1A A;  1U4B A;  1TGO A;  4O8U A;  3VQP A;  3OYF A;  1QS4 A;  2HBJ A;  4FK2 A;  1RT1 A;  3D2E A;  3SLC A;  4BRC A;  3I56 N;  3CMA N;  1QQM A;  3NAE A;  3D2E B;  5KRS A;  4CI6 A;  2QW9 A;  3RTV A;  4DUZ K;  1IBL K;  1ESV A;  2W6K A;  3FFK B;  1NGI A;  3AO5 A;  3OA9 A;  2R7Y A;  3CJA A;  4H03 B;  4JI0 K;  4DV3 K;  2GWK A;  4W5O A;  4DMN A;  2HB5 A;  3E01 A;  2YX6 A;  4F3O A;  3MEC A;  3CM6 A;  2ZGZ A;  4CGF A;  4B9T A;  3OYN A;  2C1I A;  1QE1 A;  3SK3 A;  1ZYQ A;  2QWN A;  3WUH A;  4LF5 K;  1XNQ K;  3ITH A;  5FPN A;  1IBM K;  4BGA A;  5KPT A;  3HJF A;  1QVF M;  1Z6R A;  1KVA A;  1LW2 A;  4M7X A;  4WQ5 A;  2HBM A;  2P9K A;  4X65 K;  4BE7 B;  2YHA A;  1EXQ A;  3BZC A;  2P9K B;  2GEM A;  1J53 A;  4ISG A;  4PKH A;  3AVN A;  4WQ4 A;  2DFE A;  2I5J A;  3EEQ A;  5ADX A;  3QES A;  4YOY A;  4JV5 K;  1VQ6 N;  4PA1 A;  3DM2 A;  4GMJ B;  5C24 A;  2VWJ A;  3FZK A;  2HHQ A;  2HF4 A;  3A5M C;  4N56 A;  3RRG A;  4Z4E A;  1JL2 A;  3T1A A;  4HHT A;  4MDA A;  4L3Q A;  1Q82 O;  1YIT N;  1XHZ A;  4RW8 A;  3O4N A;  3O1W A;  4Y1C A;  4J2E A;  3P39 A;  3TI0 A;  4YOU A;  1GLE G;  2UYT A;  4YDU A;  2HBK A;  3CYM A;  5AQP A;  1UOC A;  2A42 A;  4KO0 A;  4FWL A;  4CIF A;  1D5A A;  3U3G A;  5C10 A;  3LPU A;  4CEB A;  2P51 A;  1VAZ A;  4DHY A;  4FJ8 A;  1FKO A;  2A1R A;  3EZW A;  1H1V A;  5C2D A;  1VK0 A;  3E9P A;  4CZJ A;  2XY8 A;  3K5O A;  1NMD A;  4W5T A;  3CQ8 A;  4OGE A;  4X62 K;  1GLB G;  2NRX A;  4PHT X;  2QWP A;  1BCM A;  4PUO A;  5M1K A;  3ZLJ A;  4DQ8 A;  2E6L A;  4E7J A;  4DSL A;  3D6R A;  2OTL N;  3PLA A;  2F4V K;  3ZSW A;  2QEX N;  3PIP L;  3RSE A;  1ZBU A;  3JYT A;  4BY9 C;  5EVZ A;  3RSE B;  1RT4 A;  4B1Z A;  4KI4 A;  1SL2 A;  4NYF A;  1N8R O;  4OKE A;  4XIU A;  3CCQ N;  2Q0U A;  1YUW A;  3IS9 A;  3MK6 A;  4IOA L;  1P90 A;  2O4G A;  3QML A;  2OYQ A;  4IFV A;  3SQ4 A;  4B1U B;  4FWQ A;  4IO9 L;  1WSH A;  4DTX A;  1ZBL A;  3O4W A;  3A5N C;  1ATN A;  5AQH A;  4LF9 K;  4H8K A;  3OBW A;  5DM7 L;  1HNZ K;  3R6M A;  3C7N A;  4O5B A;  4M3X A;  5AQZ A;  3SUP A;  4GV6 A;  4BR9 A;  4DSI A;  3HPO A;  1TKT A;  3K9J A;  3MXI A;  2D0A A;  3C7N B;  5AQN A;  3THW A;  1Q18 A;  3I0S A;  3NE6 A;  3QIC A;  1HJR A;  2BGG A;  2G8W A;  1W9H A;  2WUS A;  3THW B;  1FW6 A;  3MWT A;  1YJW N;  4JKA A;  3F9K A;  4JKD A;  1ASU A;  4RW4 A;  3GL1 A;  2FSN A;  3UB5 A;  3FGU A;  1RGI A;  4YY3 K;  4GKJ K;  1NGC A;  3VEZ A;  3KD5 E;  4LF7 K;  4GKK K;  4CJW A;  4DG1 A;  5C42 A;  3SV3 A;  2Y1J A;  2O8E A;  3S9H A;  4IG0 A;  2IAJ A;  3S3O A;  1BWF O;  1LOT B;  5GAD P;  3DLB A;  4WF9 L;  3EKU A;  3LDQ A;  5AFU H;  5AQK A;  3CFO A;  3P38 A;  1S3X A;  2QM1 A;  3VQ5 A;  5BRE A;  3QIN A;  1D9D A;  1IG8 A;  3VF4 A;  3L4I A;  3NHG A;  4N41 A;  5AQY A;  3V81 A;  3LM2 A;  4O44 A;  4CBU A;  2BUP A;  2Q3S A;  1RDU A;  3OYH A;  4IJN A;  4CZL A;  3VN5 A;  2KW4 A;  1TK0 A;  4DR2 K;  4DF8 A;  2VWB A;  2Z1H A;  4CFB A;  1VRT A;  5AQO A;  1J5O A;  3I0R A;  1QQN A;  4GV3 A;  4A5B A;  3LWM A;  3QEV A;  1GLA G;  4F4K A;  5M1F A;  2Q97 A;  1S9E A;  1WOQ A;  1HNX K;  1NJW A;  4EP5 A;  4W5N A;  4K8X A;  1JCF A;  4H0X B;  1JLA A;  4HUE A;  1U47 A;  4KBO A;  3CCU N;  2WTU A;  4RW7 A;  3W0L A;  4E7I A;  3E9O A;  3FZM A;  3ALY A;  4HTU A;  1TUU A;  1YF5 L;  1LAW A;  5F0X A;  1R59 O;  3AVH A;  5LMU K;  3TAF A;  3CCS N;  2HHX A;  4O8K A;  2FSK A;  4Y1D A;  2WC9 A;  3HRG A;  4JKE A;  2JWK A;  3HI0 A;  3D7E O;  4I9L A;  1KC8 O;  3VEY A;  1D4X A;  3QLH A;  1XMO K;  3DRS A;  5AQL A;  1IO2 A;  3K5N A;  5M1Q A;  1HNW K;  5A2Q O;  1RTJ A;  3SMP A;  4E1N A;  2O8C A;  4WFN L;  3AY9 A;  1HNI A;  1SAZ A;  2F9W A;  2VGN A;  2O8C B;  2RN2 A;  3IMX A;  4OPH A;  2P9L A;  4A5A A;  4IZ9 A;  4DV6 K;  4W5Q A;  4X66 K;  3VQQ A;  2P9L B;  1WNS A;  4E89 A;  2NRH A;  3QET A;  2FF6 A;  4G9Z A;  4NLC A;  4BWJ A;  2Z1I A;  3L3U A;  3Q7C A;  4CF8 A;  1OVY A;  5DM6 L;  4FW2 A;  4C1N K;  4Z4G A;  1ZBI A;  4H5W A;  1CZ9 A;  2ZGY A;  3A0I X;  4RTF D;  3VGM A;  3JSM A;  3LDN A;  1YAG A;  4ID5 A;  5J2M A;  2P1J A;  4B3R K;  3KZB A;  1BOT O;  3M5R A;  1NGA A;  3O3G A;  1J6Z A;  3V9X A;  3V4I A;  3TAR A;  3AVJ A;  3OYG A;  2JGU A;  3GE1 A;  1IG9 A;  4WFA L;  1S5J A;  5FRO A;  4OLB A;  2E4L A;  3BY5 A;  3EZ5 A;  3PV8 A;  3DLH A;  1BIU A;  3ZSR A;  4DSE A;  3CD6 N;  3C95 A;  1XC3 A;  3ENO A;  3OYB A;  2O4I A;  3S3N A;  3O80 A;  3CC7 N;  2B6A A;  4BRM A;  4U7B A;  1C0F A;  4DFJ A;  4CD1 A;  4QCL A;  2IS3 A;  4JS4 A;  1Q9Y A;  1FKP A;  5HBM A;  3JXU A;  1U2V A;  2D5R A;  4HCB A;  3VEX A;  2XY5 A;  3FZL A;  4B9M A;  3TSQ A;  4DTP A;  1U2V B;  4K41 A;  3RMB A;  3T19 A;  1X3N A;  4M3T A;  4BR7 A;  4A61 A;  1O13 A;  4ZTF A;  2HHS A;  4LH4 A;  4IG3 A;  4BR5 A;  3S41 A;  3UE5 A;  1SL1 A;  4LFB K;  4BRQ A;  4K8Z A;  5BN8 A;  4DB3 A;  3RMA A;  3KWG A;  3ENB A;  4FWO A;  5HRR A;  3VQE A;  4PKG A;  4CJT A;  2QTD A;  4CJE A;  3TAB A;  4CZG A;  3ZT1 A;  3BF3 A;  4BR4 A;  3BDP A;  2GEL A;  3DLK A;  1ZC6 A;  5KI6 A;  5CYM A;  2Q2R A;  4CEQ A;  4EIA A;  3WXI A;  2AA4 A;  3AGK A;  3BZK A;  1NOY A;  1G15 A;  2PAV A;  4B9Q A;  2E2N A;  2KQ2 A;  2RKI A;  3CC4 N;  3NGI A;  5AJ3 K;  5AQQ A;  1NJX A;  1GLC G;  1TUY A;  4H5N A;  3TR8 A;  4AHC A;  3NH0 A;  3GBT A;  1NNE A;  4JKH A;  1ILY A;  1Z25 A;  2LSN A;  1NK0 A;  2IVP A;  2FXU A;  4FO0 A;  3R9P A;  5TKY A;  3TAG A;  1NK7 A;  4F3T A;  4FWM A;  1WAF A;  3VET A;  2QWL A;  4EZ6 A;  3AVM A;  4AH9 A;  1I3A A;  3O08 A;  3VEO A;  4DV7 K;  4A2B A;  4ELU A;  5GIP A;  1NGD A;  3ID8 A;  1N33 K;  4IEE A;  3LP0 A;  1SQK A;  2P9I A;  2FBX A;  2EHG A;  4GNI A;  1SS6 A;  5KRT A;  1Y64 A;  3ATV A;  5JS1 A;  3G25 A;  4M63 C;  4IEI A;  5FPE A;  3LP2 A;  5CYQ A;  1ZBH A;  3OYE A;  3HTV A;  3SJH A;  3QIP A;  3MCP A;  4FJ7 A;  3CCL N;  1RDD A;  1NKC A;  1OVQ A;  1HKG A;  3W3D A;  4DR4 K;  3WT0 A;  1JL1 A;  4JKB A;  4KFB A;  1E4F T;  3FE1 A;  3LDO A;  4BQL A;  3TPQ A;  5AZI A;  3FZF A;  4OX9 K;  5JVG L;  4ICL A;  2O8D A;  4B3O A;  3DLL L;  5AZI B;  4O5F A;  4FM1 A;  4Q0B A;  4Z4C A;  5ADX H;  3OTO K;  3L3V A;  3C6U A;  1NG9 A;  4DQR A;  4WCE L;  4LSL A;  4CED A;  4KI6 A;  1K73 O;  4CZI A;  4BGB A;  4DLG A;  2E2P A;  3VA3 A;  1XUP O;  2Q36 A;  1LW0 A;  4CK2 A;  4CZF A;  2KTQ A;  2A6A A;  3KTQ A;  1KD1 O;  3ZSO A;  4JK9 A;  1K6Y A;  4RW9 A;  1GOA A;  4FJI A;  4FWK A;  1YVU A;  3ISN C;  3JS6 A;  4KH4 A;  4E0D A;  2ZM6 K;  1QZ6 A;  1BG3 A;  2ASO A;  4FZY A;  1KCF A;  2YHB A;  1HJO A;  1ATS A;  1RT7 A;  2OA8 A;  3HBT A;  3WNE A;  5BPL A;  2JWL A;  1WSE A;  2VQF K;  3K59 A;  1NK5 A;  3DRP A;  1SZ2 A;  1BUP A;  3J7Z O;  1X9S A;  2F8T A;  1CZA N;  5KQD A;  4B8C A;  1LWE A;  4AIL C;  3VQ7 A;  3LP1 A;  3ZSV A;  4XEI A;  4BVP A;  4DS5 A;  3G4S N;  4FJH A;  4BE2 A;  1LCU A;  4CEA A;  2OZM A;  4FJ9 A;  4Z94 A;  3M8S A;  4FJM A;  3V9U A;  5TKW A;  1KAY A;  2PYL A;  4FLU A;  4N47 A;  3RRH A;  1J9A A;  4NLB A;  4BG8 A;  4L8R B;  4CZK A;  2WON A;  3TTF A;  4FJX A;  3MN7 A;  4YOT A;  3MN5 A;  5JVH L;  2E6M A;  3B8A X;  4GY2 B;  1HR0 K;  2GUP A;  4N5S A;  2AP1 A;  3BGR A;  2V7Z A;  2KFN A;  3NF8 A;  4M45 A;  3EL2 A;  3PIO L;  2I7P A;  1Z05 A;  4QS7 A;  1BQM A;  3NH1 A;  3CJB A;  1GLF O;  3DXM A;  1REV A;  4CW7 B;  3IRX A;  1TKX A;  3MMV A;  3DXM B;  2F8S A;  1UWB A;  3OW2 M;  4H0T B;  4B8A B;  3V9S A;  1K9M O;  4MDB A;  3QDK A;  3LDL A;  4M3Y A;  4IBN A;  3OS1 A;  4FCY A;  3OS2 A;  3F73 A;  3N4Q A;  3O9S A;  3RR7 A;  4CD3 A;  3LWL A;  3AVG A;  2PBD A;  4MQ3 A;  1U04 A;  4BRO A;  1MWM A;  4CHN A;  3HT3 A;  4M3Z A;  3FZH A;  1QSY A;  3O9T A;  2E2Q A;  4JI1 K;  3OHR A;  1E3M A;  5C15 A;  1WSF A;  1EO1 A;  3DXK A;  5GIO A;  3P5J A;  1C0U A;  3A5L C;  3HK2 A;  1IBK K;  4F8R A;  3DXK B;  5BN9 A;  2VWK A;  4DF4 A;  3LP3 A;  1MU2 A;  4H0Y B;  2W41 A;  3SQ1 A;  3O5B A;  1RCH A;  2UUB K;  3HM8 A;  1T6C A;  1VSL A;  3H45 C;  5HRN A;  4E7K A;  3DJC A;  1X9W A;  2OTJ N;  3L4Q A;  4KTQ A;  2D4W A;  3BEX A;  5FRN A;  4C8K A;  1VQ8 N;  1J54 A;  4KB1 A;  4HTL A;  4NCA A;  3ZCM A;  1YT3 A;  3P83 D;  2FBY A;  2CH5 A;  2E20 A;  4M7Y A;  4LC9 B;  1HQU A;  2YJE A;  3AAQ A;  1GLJ O;  4HUF A;  3WXL A;  3CJ1 A;  3HP9 A;  2ASM A;  3O6W A;  3OYA A;  1VQL N;  1L5U A;  1XC9 A;  3DOL A;  4HCC A;  3V6D A;  1HNV A;  1L3S A;  1GLL O;  1RT5 A;  5AQT A;  3K2P A;  2O8F A;  2HMP A;  4BEC A;  3P4I A;  2P9S A;  5I9E B;  3AAR A;  1HUX A;  2O8F B;  2P9S B;  2A41 A;  3LAM A;  3RVC A;  4EHU A;  1RDW X;  1BHL A;  1RDA A;  3QEW A;  3KKS A;  4H5T A;  3CFP A;  3EYZ A;  5E41 A;  3CM5 A;  3DAW A;  1LAV A;  2IIR A;  1KAZ A;  3MWP A;  4EHT A;  1WAJ A;  1ZXO A;  5FPM A;  1FK9 A;  4H5R A;  1YI2 N;  4PL7 A;  3PSI A;  4BRH A;  2B4J A;  2P5G A;  3AVF A;  1S6P A;  1SKS A;  5CHI A;  3CME N;  2HND A;  3NF7 A;  4K25 A;  4GW6 A;  5LY3 A;  4BE1 A;  1DGK N;  2DTU A;  4CGG A;  4JNE A;  1WBD A;  4JS5 A;  4BG9 A;  1S1X A;  3G71 N;  4IJA A;  4JK7 A;  3CCJ N;  1RT3 A;  5HP1 A;  4FZX C;  2RPI A;  3TSU A;  3VQ9 A;  1XWL A;  3VF6 A;  1B92 A;  4DS4 A;  4JI3 K;  2CGL A;  3TU5 A;  2A3Z A;  3CJ9 A;  3L2R A;  3H08 A;  3T1H K;  1K8K A;  4Z4H A;  2D0P A;  5T7B A;  1RTD A;  1K8K B;  1YIJ N;  4CVN E;  1C0G A;  4CEE A;  1VSE A;  4IO8 A;  5J2P A;  4I9Q A;  3HVR A;  3AO2 A;  2QWM A;  3SUQ A;  1TK8 A;  2D0C A;  2W40 A;  3SYZ A;  4FJN A;  1EQY A;  5EOY A;  1RBV A;  5DMR A;  1Q7Y O;  3HVT A;  3TTC A;  4E72 A;  2ZWH A;  1V4T A;  3L6Q A;  4JK8 A;  2RE2 A;  4DTO A;  1NM1 A;  4BRD A;  3LAL A;  3OYD A;  3AVL A;  2HHW A;  4ILJ A;  1F21 A;  3SPZ A;  2QWO A;  4AM7 A;  1BCO A;  4Z4I A;  4KV8 A;  4BRI A;  4F2S A;  1L3U A;  2P5O A;  3SCX A;  1VSF A;  5JEN A;  3VMF B;  1C1C A;  4IDH A;  5AQS A;  3J80 O;  1JXB A;  2D0O A;  4K43 A;  1EET A;  1D8Y A;  4BR0 A;  4C8N A;  2KLA A;  1SV5 A;  1XI1 A;  3K5M A;  1T05 A;  1QSS A;  5GIN A;  5CY4 A;  2VGM A;  4X64 K;  3CPE A;  4DR1 K;  3CER A;  4AHR A;  3AO3 A;  1T8E A;  4B3T K;  1RFQ A;  4HVJ A;  3ZET A;  3WEE A;  4FOE A;  4A57 A;  3QIO A;  3ZET B;  3VEN A;  3WEE B;  2DY4 A;  4CF1 A;  2W6L A;  3C0B A;  4EAH D;  3T1Y K;  1WLJ A;  4FOI A;  5JIC A;  3EO3 A;  3OYC A;  3SZ2 A;  5JLH A;  2O8B A;  2KHO A;  1HYV A;  1QZ5 A;  2IGI A;  3NBP A;  5HLF A;  4CK1 A;  2O8B B;  4Z4F A;  4DQQ A;  1BI4 B;  4CHY A;  1RDC A;  4IOX A;  3G6E N;  2UU9 K;  1CZB A;  4CK3 A;  1N5Y A;  4JI2 K;  4F9O A;  1LWF A;  4FJG A;  2UXB K;  3U6F A;  5SWM A;  3BUZ B;  4AQY K;  4XH4 A;  4M41 A;  4FLW A;  4LFC K;  4V19 S;  1VQ7 N;  1QQC A;  4BDP A;  3DLG A;  4QS9 A;  1B9D A;  2X78 A;  4CEC A;  3VPZ A;  3DOK A;  3K58 A;  3M6G A;  3AO4 A;  1NKE A;  2D1K A;  3NGY A;  4BRL A;  3ZSY A;  2YCH A;  3HO1 A;  2ETJ A;  4LF6 K;  2KZZ A;  2HHV A;  2OCE A;  4CJ5 A;  3PX4 A;  3DLR A;  4H0P A;  4DU3 A;  4Y0W A;  3E9L A;  4IKF A;  5GAG P;  2CH6 A;  1JLE A;  3KJV A;  4JLH A;  1CXQ A;  2PFU A;  4KHN A;  1YVN A;  3A5O C;  4OPA A;  3VTI A;  2G8I A;  1M1K O;  2OPS A;  1W2B M;  1DT9 A;  4CJQ A;  5AQU A;  4CHZ A;  3KIO A;  4DUY K;  2DFH A;  4EZ9 A;  4W5R A;  1DTQ A;  1FJG K;  2E1Y A;  2WFB A;  5BRD A;  4A62 A;  1NGB A;  2W42 A;  1S22 A;  2VYP A;  5C12 A;  1BIS A;  5IWA K;  2ZQB A;  3ZT2 A;  5GAE P;  3O4Q A;  1NK4 A;  4KRE A;  3CHW A;  4H4O A;  1D9F A;  4MO5 A;  4CGI A;  4E19 A;  3L2U A;  1GLD G;  4RG8 A;  3NF6 A;  3ZX0 A;  4OPJ A;  3HPG A;  4O0J A;  3M8R A;  5FLX O;  4GVM A;  4B9S A;  4BRE A;  1S1U A;  3IUC A;  3UIQ A;  2FLO A;  1UA1 A;  4JRQ A;  3CCR N;  3SBT A;  4MFB A;  3CQX A;  4CJS A;  4UQG A;  1SKW A;  3LL3 A;  4JI7 K;  4BRA A;  2P9U A;  5AFU A;  3KD1 E;  1RBS A;  1HMV A;  3DWL A;  3VQ8 A;  4E3S A;  2P9U B;  1B9F A;  2UXD K;  3KK2 A;  1HQE A;  2Y1I A;  4BAC A;  4F2R A;  1Y97 A;  4BR2 A;  5C25 A;  3MDQ A;  3QFP A;  5FRM A;  1HYZ A;  1C0M A;  4GVE A;  4DSF A;  5MLC Q;  3VGK A;  3D45 A;  1RTH A;  3Q7B A;  3AAP A;  3F9M A;  3CF5 L;  3SJJ A;  3D2F A;  3QFU A;  3WQU A;  4FLZ A;  1VQP N;  1OH8 A;  3D2F B;  2I7N A;  4DCH A;  1Z26 A;  1HKB A;  1JCE A;  3C6T A;  3KLH A;  2IVN A;  4KH6 A;  4ZHR A;  2HST A;  5SZT A;  2QXL A;  3MEE A;  3MXJ A;  5E26 A;  1XHX A;  3O9Q A;  3DRR A;  4DV2 K;  3THX A;  1SL0 A;  3C65 A;  1NK6 A;  1OH6 A;  1NKB A;  3THX B;  3HM9 A;  4FWS A;  3G0Z A;  4FLY A;  4JRP A;  4CJ7 A;  1RBR A;  3U9Z A;  3L0Q A;  3CG7 A;  3QB0 A;  3HOT A;  1OH5 A;  4FJJ A;  1NK9 A;  4E7L A;  5F2R A;  4YNQ A;  4ZTJ A;  5AZJ A;  4DTM A;  1Q8I A;  2QA4 N;  4CER A;  5AZJ B;  2E1Z A;  2QWR A;  4A2A A;  3N4P A;  3HST B;  2GV9 A;  1JLG A;  3V1Q A;  3TTD A;  3WXK A;  2GTD A;  3CET A;  4FPA A;  1Q9X A;  3EE9 A;  2PY5 A;  3T3F A;  4DWI A;  3ENH A;  3SPY A;  1L3T A;  3I55 N;  3L2Q A;  1JLC A;  2NRR A;  5H1S Q;  3AA3 A;  1YJN N;  2UUA K;  1VQ4 N;  4E1M A;  2VG5 A;  2NRV A;  3ULD A;  2HHI A;  1W97 L;  4XJX A;  1U45 A;  3PY8 A;  1TVR A;  1FXX A;  2ZF5 O;  4KB0 A;  2YKN A;  3VQA A;  3OJS A;  4O0I A;  4FWN A;  2NLX A;  1KRP A;  3GOI A;  3R1X A;  4IWV A;  1U48 A;  3IAY A;  2HHT A;  3MN6 A;  4DU1 A;  3KK7 A;  2HVI A;  1HLU A;  2BDP A;  4JI6 K;  4LFA K;  5I42 A;  1RBT A;  3TAN A;  1DTT A;  3ZT3 A;  1TL1 A;  3E66 A;  3OYK A;  2NRZ A;  1T7P A;  4C8M A;  1VSD A;  1NMN A;  2A1S A;  2HHU A;  3MEG A;  3S3M A;  1A5X A;  4OKJ A;  1WSJ A;  3LPT A;  4OGC A;  1BIZ A;  1YJ9 N;  3I8B A;  4IFY A;  4E7H A;  3VEW A;  1KXP A;  4RWT A;  1KVC A;  3UKR A;  1NLV A;  4DQS A;  3HP6 A;  4FL9 A;  3UKR B;  4B1W B;  1S1W A;  1ITG A;  2NRW A;  3KK1 A;  1NU0 A;  4FYD A;  2IDO A;  3MAQ A;  1MWK A;  1QHA A;  2ZE2 A;  1P8Z A;  4Q5V A;  1N6Q A;  2C1G A;  4FLX A;  3KVG A;  4E1J A;  3K9K A;  2FF3 B;  2ZJQ L;  3P31 A;  4CIG A;  3TAE A;  3AVI A;  5BPM A;  3TAQ A;  3K57 A;  4CEO A;  2G8U A;  3O8M A;  3QEP A;  1UAX A;  5FDL A;  4IOC L;  3B6P A;  3ZSX A;  4JI4 K;  5BR8 K;  1EX4 A;  1WSI A;  3VER A;  1N32 K;  3ZSZ A;  5B8H A;  3F5T A;  2NNW A;  2WOM A;  5HRP A;  4DQI A;  4DTN A;  3QO9 A;  2GBZ A;  1VQ5 N;  3HL8 A;  1C0T A;  2Z1J A;  3L8B A;  5EY4 A;  3DYA A;  3NH2 A;  2FC0 A;  4J8F A;  1NWK A; 
#chains in the Genus database with same CATH homology
 2EWS A;  1NGJ A;  1DGK N;  3J8A A;  2NRH A;  4JNE A;  3VTH A;  4JKF A;  2FF6 A;  4G9Z A;  4BG9 A;  3LM9 A;  4NLC A;  3G71 N;  1BA1 A;  4IJA A;  1T6D A;  3I33 A;  4JK7 A;  3Q7C A;  3BF1 A;  3ZX2 A;  3CCJ N;  5AQR A;  1OVY A;  5DM6 L;  4C1N K;  3TSU A;  3CCE N;  4H5W A;  2KKZ A;  2FSJ A;  2ZGY A;  3A0I X;  4RTF D;  5AQJ A;  3VF6 A;  3VGM A;  2V7Y A;  3R8E A;  1S72 N;  3LDN A;  4K42 A;  4NO7 A;  5AQX A;  2CGL A;  1YAG A;  3TU5 A;  2A3Z A;  3CJ9 A;  3KZB A;  2P9I B;  1BOT O;  3E1Y A;  3M5R A;  1NGA A;  1K8K A;  5JMV A;  1J6Z A;  2D0P A;  2IVO A;  2YHX A;  3QBW A;  1K8K B;  4ILH A;  1YIJ N;  1C0G A;  4IO8 A;  3GE1 A;  5BRF A;  3C6A A;  5LY3 A;  4WFA L;  3FLC O;  2QWM A;  2W40 A;  2A40 A;  3CD6 N;  4H0O A;  1XC3 A;  1EQY A;  3ENO A;  5EOY A;  4YOR A;  1Q7Y O;  3TTC A;  4XH5 A;  5C2F A;  2ZWH A;  3T69 A;  2H3G X;  4KH5 A;  5KPZ A;  3O80 A;  3CC7 N;  3EE8 A;  4BRM A;  4U7B A;  3IKM A;  1V4T A;  1C0F A;  3L6Q A;  4CD1 A;  4JK8 A;  4MLH A;  5ELZ A;  2RE2 A;  1E4G T;  3JXU A;  1NM1 A;  1U2V A;  4BRD A;  4ILJ A;  3CCV N;  3VEX A;  2QWO A;  4AM7 A;  1NBW A;  3CQY A;  3FZL A;  3TSQ A;  4BRI A;  1U2V B;  4K41 A;  4FWR A;  1X3N A;  4BR7 A;  4A61 A;  3KWI A;  3VMF B;  4IDH A;  1O13 A;  3M3Z A;  3NVK A;  1BO5 O;  4BRN A;  5AQS A;  2D0O A;  4K43 A;  2P9N A;  4BC4 A;  4BR5 A;  4BR0 A;  3S41 A;  3UE5 A;  3GDQ A;  4BRQ A;  5EX5 A;  2KLA A;  5BN8 A;  2P9N B;  3WXM B;  4DB3 A;  3KWG A;  2V52 B;  3ZX3 A;  3ENB A;  4WQ5 C;  2F7T A;  4FWO A;  3CC2 N;  5GIN A;  3CJ7 A;  4PKG A;  3WXJ A;  2VGM A;  3T7Z A;  3MN9 A;  2QTD A;  1T3V A;  4CZG A;  3CPE A;  5BPN A;  1V4S A;  3BF3 A;  3CER A;  3MX2 A;  4BR4 A;  2GEL A;  2CGJ A;  1RFQ A;  1JCG A;  3H1V X;  5AR0 A;  5LJW A;  3EKS A;  3ZET A;  4BC3 A;  4JAX A;  1HKC A;  3WEE A;  1ZC6 A;  4WQ4 C;  4FOE A;  2Q1N A;  4A57 A;  3SAH A;  1VQK N;  4ILG B;  1QQO A;  2Q2R A;  4EIA A;  3WXI A;  3C6H A;  3ZET B;  5LJV A;  3ULE A;  3VEN A;  3WEE B;  3CIP A;  2AA4 A;  3AGK A;  3VEV A;  4YOW A;  1HX1 A;  3C0B A;  3ULE B;  4YOV A;  3ATU A;  2PAV A;  4B9Q A;  4EAH D;  4FOI A;  5JIC A;  2E2N A;  3CC4 N;  3EO3 A;  2E88 A;  3SAF A;  2GWJ A;  5AQQ A;  5JLH A;  1GLC G;  5KQ8 A;  1TUY A;  4H5N A;  4CZE A;  4IXC A;  4FSV A;  2KHO A;  1Q86 O;  4UY8 O;  1QZ5 A;  3GBT A;  4YDU C;  3NVM A;  3SMS A;  4JKH A;  4EFH A;  5CR4 A;  3CCM N;  1ILY A;  3OBY A;  4IOX A;  4AM6 A;  4DKW A;  2F9T A;  3G6E N;  1KQS M;  2IVP A;  4XH1 A;  2FXU A;  4FO0 A;  3R9P A;  4F9O A;  5TKY A;  4HWI A;  3FR0 A;  3O1B A;  4FWM A;  4I6M A;  3VET A;  1NGH A;  2QWL A;  3BUZ B;  4XH4 A;  5AQI A;  4BRP A;  2QI2 A;  2OAN A;  4I6M B;  4ISE A;  4BRK A;  1MA9 B;  1VQ7 N;  4QS9 A;  3O08 A;  1NGF A;  1YXQ A;  3HSC A;  4PKI A;  4B1Y B;  3VEO A;  3U4L A;  5M1N A;  2V51 B;  3GG4 A;  4A2B A;  3VPZ A;  1NGD A;  3ID8 A;  2GX9 A;  4B1V A;  5GIP A;  3H3O B;  3M6G A;  4IEE A;  5EXW A;  4CZH A;  2HBL A;  2YJF A;  2D1K A;  3ID6 A;  2YHY A;  4BRL A;  4QS8 A;  1SQK A;  2YCH A;  2P9I A;  3KHY A;  5AQF A;  4GNI A;  4BRG A;  1SS6 A;  1Y64 A;  3ATV A;  3G25 A;  4MLE A;  4M63 C;  4IEI A;  4O8U A;  5FPE A;  4H0P A;  5M1O A;  3F2K A;  2ZJR L;  4Y0W A;  2HBJ A;  3E9L A;  4JHD A;  2Q0R A;  5GAG P;  3HTV A;  2CH6 A;  3SJH A;  1K8A O;  3D2E A;  3SLC A;  4BRC A;  3I56 N;  4JHD B;  3BP8 A;  2PFU A;  3MCP A;  3CCL N;  3CMA N;  1QQM A;  1YVN A;  3A5O C;  4OPA A;  3D2E B;  3VTI A;  2HOE A;  1M1K O;  4CI6 A;  2QW9 A;  1W2B M;  1DT9 A;  3SBG A;  3VGL A;  1Q81 O;  1HKG A;  3W3D A;  1ESV A;  4R79 A;  3FFK B;  5AQU A;  1NGI A;  2HF3 A;  3OA9 A;  3WT0 A;  1HPM A;  4JKB A;  3CJA A;  4H03 B;  1E4F T;  3FE1 A;  3LDO A;  2E1Y A;  2WFB A;  5BRD A;  2GWK A;  2ASP A;  4BQL A;  4A62 A;  3TPQ A;  1NGB A;  5AZI A;  1S22 A;  1M90 O;  3FZF A;  2YX6 A;  2VYP A;  5C12 A;  5JVG L;  3DLL L;  5AZI B;  4O5F A;  5GAE P;  2ZGZ A;  5ADX H;  2C1I A;  3CHW A;  1X3M A;  4MO5 A;  1DKG D;  1NGG A;  3SK3 A;  4YOX A;  4WCE L;  2QWN A;  1GLD G;  3WUH A;  4BVO A;  4C23 A;  5FPN A;  3ZX0 A;  4BGA A;  5KPT A;  1K73 O;  1QVF M;  4CZI A;  1Z6R A;  4M7X A;  4WQ5 A;  4BGB A;  2HBM A;  2P9K A;  2E2P A;  4BRE A;  3IUC A;  4FWP A;  1XUP O;  2Q36 A;  1MDU B;  4BE7 B;  2P9K B;  2FLO A;  2GEM A;  4PKH A;  3MX5 A;  4ISG A;  4CZF A;  3CCR N;  3HZ6 A;  1KAX A;  4WQ4 A;  2A6A A;  3SBT A;  1YHQ N;  4H5V A;  5ADX A;  1OKJ A;  4YOY A;  1KD1 O;  3CQX A;  1VQ6 N;  4CBX A;  5HL7 L;  4JK9 A;  3FZK A;  4FWK A;  2HF4 A;  3A5M C;  3LL3 A;  4JD2 A;  4FVU A;  3JS6 A;  4KH4 A;  4BRA A;  4MDA A;  1QZ6 A;  2P9U A;  1BG3 A;  5AFU A;  2ASO A;  3DWL A;  4L3Q A;  4JD2 B;  1Q82 O;  1HJO A;  4NB4 A;  1YIT N;  2P9U B;  1ATS A;  2NRT A;  3HBT A;  1XQS C;  3O1W A;  5C0Y A;  5BPL A;  2JWL A;  3P39 A;  2E8A A;  1SZ2 A;  4PL8 A;  4YOU A;  1BUP A;  3J7Z O;  1GLE G;  2UYT A;  1CZA N;  3H3N O;  4YDU A;  2HBK A;  5KQD A;  4BC2 A;  5AQP A;  2A42 A;  4H0V B;  4IFE A;  4BR2 A;  3H6E A;  4FWL A;  4XEI A;  3MDQ A;  3QFP A;  4BVP A;  3H46 O;  5C10 A;  3G4S N;  1VAZ A;  4DHY A;  1LCU A;  3CXC M;  1VQM N;  5AQG A;  3U9D A;  4GVE A;  5MLC Q;  3EZW A;  1H1V A;  3Q7B A;  3VGK A;  3E9P A;  4CZJ A;  4Z94 A;  5C2D A;  1NMD A;  3AAP A;  3F9M A;  3CF5 L;  3D2F A;  3QFU A;  1GLB G;  2NRX A;  5TKW A;  2QWP A;  1KAY A;  3WQU A;  1G99 A;  4PHT X;  1VQP N;  2W00 A;  5M1K A;  3D2F B;  2I7N A;  4DQ8 A;  4B1X B;  4NLB A;  4BG8 A;  4DCH A;  4CZK A;  3D6R A;  1QVG M;  3TTF A;  2OTL N;  3PLA A;  1NGE A;  1HKB A;  2QEX N;  1JCE A;  3PIP L;  2ZJP L;  3RSE A;  2IVN A;  3MN7 A;  4KH6 A;  4YOT A;  3MN5 A;  5F1X A;  5JVH L;  3B8A X;  4GY2 B;  4BY9 C;  5EVZ A;  2HST A;  2GUP A;  3O9U A;  2QWQ A;  3RSE B;  2QXL A;  2AP1 A;  4B1Z A;  4JKC A;  2V7Z A;  5E26 A;  3O9Q A;  1VQO N;  3EL2 A;  3PIO L;  2I7P A;  3C65 A;  1N8R O;  1Z05 A;  3CCQ N;  2Q0U A;  1YUW A;  3MK6 A;  4QS7 A;  4IOA L;  1P90 A;  2A5X A;  3QML A;  4FWS A;  3CJB A;  1GLF O;  3DXM A;  3MCA B;  4CJ7 A;  3U9Z A;  3IFR A;  3L0Q A;  3ZEU A;  4FWQ A;  4RCH A;  4B1U B;  3MMV A;  4IO9 L;  4U67 L;  1VQN N;  4JEP A;  3DXM B;  3O4W A;  3A5N C;  1ATN A;  3QB0 A;  5AQH A;  3ZEU B;  3HOT A;  3OW2 M;  3OBW A;  4H0T B;  5DM7 L;  3R6M A;  3C7N A;  1K9M O;  4MDB A;  5AQZ A;  5F2R A;  3QDK A;  3LDL A;  4WYB A;  3CPW M;  4BR9 A;  4C1N I;  5AZJ A;  5M1P A;  4GV6 A;  3K9J A;  3TSP A;  3C7N B;  3A8Y A;  3CI5 A;  5AQN A;  2QA4 N;  1NJI O;  3N4Q A;  5BR9 A;  1Q18 A;  5AZJ B;  1WUA A;  3QIC A;  2E1Z A;  2QWR A;  4A2A A;  3IDH A;  2WUS A;  3N4P A;  2J4R A;  3MWT A;  3SAG A;  1BA0 A;  1YJW N;  3O9S A;  4JN4 A;  5CE3 A;  4JKA A;  4CD3 A;  3TTD A;  1JJ2 M;  3WXK A;  4JKD A;  2GTD A;  2PBD A;  3CET A;  4FPA A;  3GL1 A;  3EE9 A;  2FSN A;  3UB5 A;  4BRO A;  1MWM A;  3FGU A;  3ENH A;  1X9J A;  1RGI A;  4BQZ A;  3I55 N;  3FZH A;  1NGC A;  3O9T A;  1U6Z A;  2NRR A;  3VEZ A;  4CBW A;  5H1S Q;  4BEB A;  1BU6 O;  1YJN N;  2E2Q A;  4BC5 A;  3OHR A;  5C15 A;  1VQ4 N;  1EO1 A;  3DXK A;  5GIO A;  3VOV A;  1BWF O;  5AQM A;  3WQT A;  1LOT B;  2NRV A;  5GAD P;  4WF9 L;  1IJJ A;  3A5L C;  1W97 L;  3EKU A;  2BH1 A;  3LDQ A;  3DXK B;  5BN9 A;  5AFU H;  4XJX A;  1DEJ A;  5AQK A;  2ITM A;  3HOS A;  2ZF5 O;  3P38 A;  4H0Y B;  2W41 A;  1S3X A;  2QM1 A;  3O5B A;  5BRE A;  3HM8 A;  1T6C A;  3H45 C;  4FWN A;  1IG8 A;  1TYQ A;  2NLX A;  4WFB L;  3GOI A;  3R1X A;  3DJC A;  4IWV A;  3VF4 A;  3L4Q A;  3L4I A;  2OTJ N;  3MN6 A;  3KK7 A;  2D4W A;  1HLU A;  3BEX A;  3QBX A;  5KPR A;  1TYQ B;  5AQY A;  3LM2 A;  1VQ8 N;  4CBU A;  5FPD A;  3CJC A;  3H1Q A;  2BUP A;  1RDU A;  3E66 A;  4HTL A;  4IJN A;  4CZL A;  2NRZ A;  4OO1 J;  4JKG A;  1ATR A;  2VWB A;  3R3L A;  5BRH A;  5JLF A;  5AQO A;  2CH5 A;  2E20 A;  1QQN A;  4JKG B;  4M7Y A;  4A5B A;  5GAH P;  4GV3 A;  1GLA G;  1VQ9 N;  2Q31 A;  4LC9 B;  2Q97 A;  5M1F A;  3NMU A;  2E2O A;  2YJE A;  1WOQ A;  3AAQ A;  1YJ9 N;  1GLJ O;  3EN9 A;  3CJ1 A;  3I8B A;  5AQW A;  3WXL A;  3VEW A;  1T44 A;  1JCF A;  1KXP A;  2ASM A;  3M1F A;  4RWT A;  3UKR A;  4H0X B;  1NLV A;  3O6W A;  1VQL N;  4FL9 A;  2BTF A;  4KBO A;  3UKR B;  3CCU N;  4B1W B;  3W0L A;  2P9P A;  2CGK A;  2NRW A;  1GLL O;  3E9O A;  5AQT A;  4BRF A;  3FZM A;  2HMP A;  4BEC A;  4MO4 A;  2P9P B;  3P4I A;  1TUU A;  2P9S A;  1MWK A;  1QHA A;  1P8Z A;  1YF5 L;  5I9E B;  3AAR A;  1HUX A;  4FPB A;  2C1G A;  5F0X A;  2P9S B;  1R59 O;  1ZBS A;  2A41 A;  2VCP A;  3KVG A;  3ZYY X;  3K9K A;  4E1J A;  3CCS N;  3RVC A;  2FF3 B;  4O8K A;  2FSK A;  1RDW X;  4EHU A;  4AF1 A;  2WC9 A;  2YI1 A;  3HRG A;  3P31 A;  2ZJQ L;  4JKE A;  2JWK A;  3HI0 A;  3D7E O;  2RHK A;  5BPM A;  1KC8 O;  2DPN A;  1BDG A;  4H5T A;  3O8M A;  4A59 A;  3DAW A;  2IIR A;  1KAZ A;  1D4X A;  3MWP A;  3VEY A;  4EHT A;  4IOC L;  5AQL A;  1ZXO A;  4GV9 A;  5E84 A;  5M1Q A;  5FPM A;  3UKU A;  3SMP A;  1YI2 N;  3AGR A;  4H5R A;  3VER A;  4PL7 A;  4WFN L;  5B8H A;  3F5T A;  2NNW A;  3UKU B;  3AY9 A;  3VF2 A;  1SAZ A;  3O9R A;  2F9W A;  4BRH A;  2WBN A;  1VQ5 N;  2VGN A;  2YHW A;  5HOO A;  3IMX A;  4OPH A;  3U8X A;  2P9L A;  5EY4 A;  2NZT A;  3LDP A;  4A5A A;  5AQV A;  4ISF A;  4IZ9 A;  3VES A;  5CHI A;  4J8F A;  1NWK A;  3CME N;  4K25 A;  4CZM A;  2P9L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...