3A5MC

Crystal structure of a dictyostelium p109i mg2+-actin in complex with human gelsolin segment 1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
370
structure length
364
Chain Sequence
QALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAILNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAAAAIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Gelsolin
publication title Structural basis for actin assembly, activation of ATP hydrolysis, and delayed phosphate release
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 364
sequence length 370
ec nomenclature
pdb deposition date 2009-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5mC01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3a5mC02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3a5mC03
1HUXA 3ZX0A 2NLXA 4WQ4C 4EAHD 4EHTA 5FPNA 5BN9A 4H0YB 2V52B 2EWSA 4RWTA 3WXJA 3L0QA 4K42A 2CH5A 2I7PA 4BRHA 2Q2RA 3EO3A 3L6QA 2P9NB 3ULEA 3U9DA 2V7ZA 2P9NA 3H3OB 4EFHA 2GUPA 2E1YA 2V51B 1LCUA 3EKUA 1NGFA 1SZ2A 3R6MA 4PKHA 4BG9A 5F0XA 4E1JA 3EL2A 4PL8A 3CETA 4BR2A 4FOIA 3A8YA 4FPBA 4BVOA 3MN6A 3SJHA 3WT0A 4BR9A 1GLCG 4BRCA 1BG3A 5AQVA 3FLCO 4CD3A 3HM8A 2P9KA 3R9PA 3UE5A 1BUPA 3HBTA 4IJAA 5JICA 3KZBA 1GLLO 2CH6A 1ATSA 2CGKA 3A5LC 3CHWA 4GY2B 4JAXA 4FWMA 2IVNA 1GLAG 4B1XB 4M7XA 1HKCA 4CZLA 2Q36A 3ZEUB 5E84A 5F2RA 4FWKA 1G99A 1NBWA 5FPDA 3EN9A 4BRGA 5EVZA 3ZEUA 5JLHA 3H3NO 3VEWA 3SMPA 1NGGA 3P4IA 1NGBA 4JD2B 1JCEA 4CZEA 5AQXA 1K8KA 5AQPA 1TYQA 4BR7A 3VGLA 1NWKA 4JNEA 1HJOA 3MN5A 4K43A 3H45C 3ZETA 3LDOA 1Z05A 2VYPA 1X9JA 3G25A 1LOTB 2HF3A 4QS9A 5KPTA 5KQ8A 1U2VB 4C23A 3O1BA 1QHAA 3LM2A 4Z94A 1HLUA 1JCFA 4QS7A 2AA4A 3M3ZA 2E20A 3A5MC 3AAPA 5AQQA 2F9WA 4BC4A 3JS6A 3O80A 2ITMA 2E2PA 3I33A 4A61A 3VEZA 2E2QA 4H5NA 3ZX2A 2Q31A 5CE3A 4H5TA 4CD1A 4MLEA 1NGHA 4CZJA 5LJWA 3ATVA 4FWSA 3CQXA 1HKBA 4PKGA 5AQHA 5AQYA 3RSEA 2FSNA 2A40A 3A5OC 5AZIA 1NMDA 3ENHA 2GELA 1NM1A 5AQIA 1NGEA 2A5XA 1BA0A 2GEMA 3DJCA 2CGLA 2QWPA 4CZFA 1QQNA 3CJCA 5BRDA 1IJJA 1XUPO 4BQLA 5AZJB 4B1UB 2QWOA 3WEEB 2FSKA 1DEJA 5EY4A 4RTFD 3U4LA 1GLFO 2UYTA 1V4TA 3CJAA 2IVPA 3WEEA 1HX1A 1YAGA 4I6MB 4K41A 3HI0A 3FZMA 1NGIA 4BRFA 3BF3A 4H0PA 3QFUA 2IVOA 4MO4A 4I6MA 5AQFA 4BRNA 2D0PA 1BU6O 3C7NB 3VF6A 3TU5A 4PKIA 3KHYA 4BQZA 1X3NA 3C7NA 3AY9A 4WYBA 2V7YA 3ULEB 4DCHA 4BRMA 4CBUA 1QQMA 2FF6A 4NO7A 2F9TA 4CJ7A 4BRKA 2WUSA 2A41A 3BP8A 4HTLA 4M7YA 4ISEA 4CZKA 1QZ6A 4L3QA 1V4SA 2Q0RA 2QWLA 4PL7A 3QB0A 3OHRA 4FWRA 2I7NA 5AQSA 4NB4A 1NGCA 5BREA 2IIRA 2PAVA 3GG4A 3LM9A 1ATRA 5BPNA 2VWBA 3O08A 4HWIA 4YDUA 3CQYA 1WOQA 2P9KB 3L4IA 5AQJA 4WQ5A 2QM1A 4EHUA 2Q0UA 4MLHA 3UB5A 1NLVA 3DXKB 3UKRA 3VF4A 5BPLA 1IG8A 3U8XA 3IDHA 5BRHA 4F9OA 3O8MA 2CGJA 2ZF5O 1GLDG 3DXKA 1DKGD 2D4WA 2P9SA 3GOIA 2GWJA 3GL1A 4B1WB 1KAXA 2AP1A 4KBOA 1SAZA 1Q18A 3R8EA 3FFKB 2FF3B 3VENA 5KPRA 3UKUA 3DAWA 4A2BA 2BTFA 2E88A 2PBDA 2NRHA 1K8KB 2QWMA 1TYQB 2P9IA 5AQGA 3CJ9A 3ATUA 4H5WA 3ZETB 2ZGZA 3SLCA 3M1FA 5AQWA 4CZIA 2HF4A 4FWQA 2VCPA 2D0OA 2E8AA 3TPQA 2QW9A 1E4GT 1TUUA 4BVPA 3HTVA 3GE1A 1BWFO 1S22A 3IFRA 1T44A 4FPAA 3LDQA 3DWLA 3HSCA 1ATNA 3SK3A 2W40A 2Q97A 4IO8A 4DHYA 3IMXA 3QICA 3BUZB 4B1VA 4A2AA 4CZGA 3RSEB 2HOEA 1RGIA 3VEYA 5AZIB 1ESVA 3ENOA 3CJ1A 3H1QA 3MK6A 3ID8A 3FR0A 1Z6RA 1ZC6A 2E2OA 3F9MA 1BOTO 4O5FA 5BR9A 2BUPA 5AQTA 5ADXH 3VGKA 3MMVA 1R59O 2QXLA 2ZGYA 2QWRA 4FWPA 4ISFA 4JHDB 5F1XA 3O4WA 4BR0A 4FL9A 2OANA 1X3MA 3EZWA 4BR5A 2D1KA 3J8AA 4JHDA 5BPMA 3VEVA 3M6GA 1GLJO 3QBXA 4FWNA 4IZ9A 3BF1A 1GLBG 3GBTA 4CZHA 2J4RA 1NGDA 3QMLA 5AQKA 3WXLA 4B1ZA 1YVNA 2ASOA 1HKGA 1U6ZA 1EQYA 3FZFA 3LDPA 4BROA 2P9PB 1P8ZA 3A5NC 1SQKA 3FE1A 3VPZA 1WUAA 4CBWA 3QDKA 2P9PA 4XEIA 3JXUA 1E4FT 4YDUC 3LL3A 1JCGA 1MWMA 1XC3A 4H0TB 2A3ZA 2W41A 4WQ5C 3VEOA 4EIAA 5ADXA 4FO0A 4IJNA 3WUHA 2ASPA 5KPZA 3WXKA 2YHXA 3H1VX 4A62A 3QBWA 3VETA 3B8AX 2FSJA 3D2FB 3O5BA 3KVGA 1BDGA 2GWKA 2ASMA 4MO5A 3EKSA 3D2FA 4FWOA 3S41A 4B1YB 4CBXA 5AQUA 4WQ4A 3WQUA 3A0IX 3UKRB 4FWLA 2HMPA 5FPEA 5LY3A 1GLEG 3MDQA 2YCHA 2P9SB 4BC3A 5E26A 4BRQA 2ZWHA 3VEXA 3QFPA 3WXIA 2E2NA 4XH5A 3FZHA 4BC5A 4H5VA 1C0GA 3U9ZA 3CJ7A 4FOEA 4H0XB 3LDNA 4BRPA 1KAZA 2P9LB 4XH4A 5I9EB 4M63C 3UKUB 2H3GX 3CJBA 4AM7A 2GTDA 2P9LA 1D4XA 2P9IB 5ELZA 2KHOA 1NGAA 1QQOA 1KXPA 3ZX3A 4ISGA 3H6EA 2QWQA 4IXCA 4BC2A 1QZ5A 1Y64A 4BGAA 1RDWX 3BEXA 4BRIA 1XQSC 5EOYA 2A6AA 1NGJA 3VERA 1MA9B 4BR4A 3CI5A 5AQNA 1BO5O 5AQOA 4DQ8A 3MN9A 4GNIA 1S3XA 1HPMA 1YUWA 4J8FA 1MDUB 4DB3A 3CIPA 4BRLA 5B8HA 5BRFA 4BG8A 3MN7A 4IWVA 5JLFA 4B9QA 5KQDA 3SMSA 2P9UB 4FSVA 5AQLA 3H46O 2YHYA 1ZXOA 3C0BA 4JD2A 5EX5A 2P9UA 2YJEA 3FZLA 5AFUH 1YXQA 2FXUA 5AR0A 4H5RA 5FPMA 5JMVA 4O8KA 5TKYA 2YI1A 4CI6A 4K25A 3DXMB 1C0FA 1KAYA 3FZKA 2YHWA 3D7EO 1U2VA 5LJVA 3DXMA 3VESA 5EXWA 3VGMA 1J6ZA 2FLOA 3AAQA 5AQMA 4H03B 4BGBA 3O1WA 3W3DA 3HZ6A 1DGKN 1T6CA 4QS8A 2Q1NA 1TUYA 3IUCA 2YJFA 2NZTA 4AM6A 4LC9B 4BREA 1ZBSA 4H0VB 5AQZA 3GDQA 3O6WA 3WQTA 3I8BA 3VF2A 2A42A 4BRAA 3LDLA 2DPNA 5BN8A 4CZMA 1T6DA 2QWNA 4JN4A 3FGUA 1BA1A 1CZAN 1RFQA 5AFUA 5AQRA 4XH1A 3W0LA 3AARA 4RCHA 1OKJA 2E1ZA 3CERA 1H1VA 4Y0WA 3D2EB 3VOVA 1MWKA 5AZJA 4H0OA 3MCPA 4BRDA 3D2EA
chains in the Genus database with same CATH superfamily
4J2AA 2NLXA 4H0YB 4F3TA 2B4JA 1WSJA 1TV6A 1UA0A 3L0QA 2O8EA 1VSFA 3O9QA 1Z26A 1TK0A 4B3SK 3NGYA 1NJWA 1HYSA 3L6QA 4A5BA 4FJHA 2QI2A 3H3OB 1NKBA 3K5NA 4EFHA 2E1YA 2V51B 4U67L 1JKHA 1NGFA 3HOSA 3R6MA 5HRRA 4FVMA 1VSEA 4GVEA 4PL8A 4FOIA 1NK0A 3HJFA 4FPBA 4BVOA 5J2QA 4DTNA 1K8AO 1BG3A 1C6VA 5EU7A 4CD3A 2HBLA 3HM8A 4KFBA 3R9PA 3UE5A 4E7JA 1BUPA 2YKNA 3OYFA 3CHWA 3CMAN 2DFFA 4GY2B 3LP3A 3AO5A 4DFMA 1S1XA 3ZLJA 4DU3A 1GOCA 4DQRA 3ALYA 5M1OA 4FLVA 1WSHA 1NJYA 4BRGA 2NRRA 3OY9A 3RMAA 3MXJA 5JS1A 4Z4GA 4Q5VA 1K8KA 1HJOA 3RR7A 3H45C 3ZETA 2HHTA 2VYPA 2UXBK 1S6PA 5KQ8A 4DSKA 1BQNA 3O1BA 1QHAA 3KJVA 3LM2A 4FK4A 1JCFA 4OPHA 1TK5A 3J7AP 1FJGK 3AAPA 5AQQA 1HNIA 4DV1K 5D3GA 2QKBA 2W6LA 3JS6A 2ITMA 2E2PA 3HK2A 4KREA 4DTPA 3VEZA 1SS6A 3I0SA 4FLTA 3CYMA 4H5TA 4C8MA 5C42A 4CZJA 1YJ9N 3L8BA 1HKBA 5AZIA 3NAEA 1KVAA 4W5RA 1NMDA 1BI4B 3VQCA 1VQMN 4DV4K 2WC9A 4ELUA 5AQIA 1XC9A 3DJCA 2CGLA 1QQNA 3OJSA 2JGUA 4CEFA 1A5XA 3QEPA 3KKSA 3HVRA 1HNVA 4NYNA 3OYGA 2VQFK 1N36K 3VA3A 2HMIA 2XO7A 4CJEA 1ITGA 3VQQA 1YF5L 3M8QA 1IH7A 1HR0K 1KD1O 2QTDA 4H0PA 3QFUA 4BRNA 3U3YA 4WCEL 3IS9A 1VQ4N 2R7YA 4FJKA 4DU1A 4BRMA 3HOTA 3IG1A 3CM6A 3WNHA 1U49A 4BRKA 1SKRA 5FRNA 1HMVA 1NK7A 1QTMA 1B92A 3BP8A 1HNWK 4ISEA 3PY8A 2Q0RA 3TAFA 3G6EN 3OHRA 4O0JA 4FWRA 5AQSA 2QKKA 5BREA 2NNWA 4BDYA 2IOCA 3GG4A 1UA1A 1ATRA 3O08A 4N5SA 4YDUA 3V9SA 2P9KB 2NRXA 3L4IA 2QEXN 1G15A 4E72A 2G8VA 4E89A 1LWEA 3ZT3A 3U8XA 3IDHA 4DR1K 3MX2A 4XJXA 1RCHA 4M3UA 3DXKA 1VQKN 2GWJA 3VQEA 3GL1A 4B1WB 1ILYA 1Q18A 2GV9A 4JI8K 3HYFA 2FF3B 4CIGA 4QOZB 4BWMA 4JLHA 3THXA 4DS4A 2QWMA 4JKAA 1TYQB 3ZSXA 2YNIA 1EP4A 2ZGZA 3C6TA 1J5OA 3F2KA 5DM7L 4CFBA 1VSLA 1VQPN 4CZIA 1N8RO 2VCPA 4JRPA 3EYZA 3TPQA 1TUUA 3HTVA 3HXMA 3GE1A 2E5LK 1VQ6N 4F8RA 3ZT2A 3OS1A 1T44A 2YNHA 4FPAA 1WSIA 3HSCA 4CVNE 3K9KA 3CC2N 1D8YA 4OGEA 1NK8A 4BACA 4KO0A 4C8NA 4IOAL 4K8ZA 4O5BA 1YJNN 2HOEA 3QEVA 3AVBA 4K8XA 2F4VK 2UUCK 5DMRA 3FR0A 4M42A 4RW9A 1ZC6A 3THWA 2E2OA 2WONA 4CEEA 3ZYYX 3VGKA 3MMVA 1R59O 2QXLA 2QWRA 4ISFA 4JHDB 3O4WA 4FL9A 3NGZA 1X3MA 2XY5A 3CFPA 4DV6K 4FZYA 5MLCQ 3M6GA 5HRPA 2JLEA 4K0KK 3BF1A 4LF5K 3GBTA 1T05A 2J4RA 1WSGA 2QA4N 4A59A 1EO1A 1YVNA 4CJ3A 1N34K 2OZSA 3TSPA 1NJZA 1EQYA 4FM2A 3M8SA 3ID6A 3LDPA 3A5NC 4CJ4A 3SNNA 4CBWA 3QDKA 2P9PA 3SQ4A 4FJIA 3LL3A 4BDZA 2A3ZA 2W41A 2OYQA 4Z4IA 1WNSA 3VQ4A 5KRTA 3WXKA 1SUQA 3LP0A 3VETA 2FSJA 3O5BA 1VAZA 2GWKA 2ASMA 4LF6K 1RNHA 3EKSA 4IFEA 4CHZA 3OYEA 4YOXA 4TSXA 2AJQA 4LY7A 3A0IX 3UKRB 5FPEA 1N6QA 4FJGA 4DU4A 3AVHA 3EE8A 1NK6A 5HL7L 1UAXA 4BC3A 4A5AA 5E26A 3FZHA 4BC5A 2HB5A 1RT6A 3CJ7A 4H0XB 4BRPA 5I9EB 4I7FA 4CJWA 2Z1GA 3OW2M 2ITGA 3QETA 4Y1CA 2JWLA 1EKEA 2P9IB 1KXPA 2GUIA 1T7PA 3VTIA 3EZ5A 4FCYA 4FK2A 3VQ9A 1NGJA 3L2QA 5C10A 4DFPA 1HPZA 4CEOA 1MA9B 3TSQA 2G8KA 1SV5A 3AVAA 4Z4FA 3MN9A 1S3XA 1YUWA 3MAQA 3SUOA 5DK5A 1FK9A 3MECA 3CIPA 4NLCA 4ID5A 3RTVA 1LW0A 5EX5A 3C0BA 4DR4K 1S9EA 2P9UA 3OBWA 3T1HK 4HUEA 1Q7YO 4C1NI 3ITHA 5AR0A 3P83D 4CJVA 2BANA 5FPMA 4O8KA 3LZJA 2YI1A 3P38A 1SL1A 4K25A 1C0FA 1JLCA 4J2DA 2YHWA 4CF8A 5HRNA 4AHSA 4DTJA 2O8BB 2PYJA 5A2QO 1JXBA 4RW4A 4BGBA 3O1WA 3CXCM 4DQIA 4C8LA 3W3DA 1DGKN 4DR3K 3ZT0A 4QS8A 2BGGA 3CC4N 1TUYA 1OVQA 3C65A 3KIOA 1F21A 1XNQK 2RKIA 4DR5K 4CCHA 4BREA 4GV6A 4YHHK 2E4LA 3LAKA 2OTLN 2A42A 1CXQA 2DPNA 2VWJA 1X9SA 3SAHA 3LDSA 4JN4A 4I9LA 5FLXO 1BA1A 1CZAN 5E41A 4XH1A 3W0LA 3AARA 4RCHA 4AHUA 3CERA 4IEEA 4LSLA 1MWKA 4M3RA 3K5MA 1QSSA 3KD5E 3N4PA 4BE7B 2FLOA 3ZX0A 4EAHD 5FPNA 1OH8A 1QVFM 2O8EB 3OYNA 4RWTA 2FBTA 3V9ZA 4JKCA 4CJKA 3L2WA 4BRHA 3NBPA 4NLBA 2Q2RA 3EO3A 1WSFA 1QVGM 3CCSN 5TKWA 4GMJB 4CJUA 4IKFA 5M1QA 1ASVA 1S1VA 4YOUA 4FJ5A 5C2FA 4FM1A 3VA0A 1LCUA 1SZ2A 4E1JA 3CETA 1VSMA 1S6QA 2P1JA 3A8YA 3PSIA 3SJHA 2F7TA 4DR7K 3M8PA 2IGIA 3FLCO 4X66K 2VG5A 5JICA 3KZBA 1GLLO 1UOCA 3O9TA 4CGFA 1ATSA 2JWKA 4NYFA 4HUGA 3ULDA 1RT3A 4B3MK 4JAXA 4BE1A 4B1XB 4M7XA 4FW2A 3F73A 4IOXA 3OYAA 4CFDA 1KRPA 3PIPL 1A5VA 5F2RA 5KRSA 2HHIA 4KI6A 5FPDA 3EN9A 3ZEUA 5C2DA 2YHAA 3H3NO 3VEWA 1ASWA 3SMPA 1NGGA 1NGBA 4B9SA 2ZM6K 4CK2A 3OYJA 2OPQA 5AQPA 2UUAK 1KLNA 4BR7A 3MN5A 1HNXK 1Q86O 4IOCL 3TANA 1I94K 4EP4A 3HP9A 2EX3A 3DMJA 1X9JA 3G25A 2HF3A 1S1WA 1A5WA 1LV5A 1C0UA 3O3GA 2B6AA 2AA4A 1QHTA 1C1BA 3LPTA 4JI1K 4KI4A 4E1NA 3EY1A 2ATQA 4JRQA 3O80A 4C8OA 4A61A 4H5NA 3PV8A 3IRXA 4CHPA 1FXXA 3MXIA 1NGHA 4LSNA 4ILJA 3ATVA 5T7BA 1KFDA 2HHWA 5AQHA 4OGCA 3D6RA 3CMEN 5FRMA 2FSNA 1U45A 3ENHA 3HSTB 2GELA 3DRSA 1NM1A 1NGEA 2GEMA 1XWLA 1R0AA 2QWPA 2P5OA 3LAMA 4KTZA 1Q9XA 5BRDA 3KWIA 1IJJA 1IKYA 5AZJB 2FBVA 3L4QA 3ZT1A 2X78A 3LWLA 2FSKA 1DEJA 1RBUA 5EY4A 4RTFD 3TI0A 4LFBK 3WEEA 2PY5A 1NOZA 1YAGA 1FKOA 3HI0A 3FZMA 2D0AA 3G4SN 4MO4A 3TWHA 3SAGA 3A2FA 4X64K 1HYVA 4IEIA 4E7LA 3KHYA 3KK3A 4Q0BA 3C7NA 1KLMA 1WN7A 3CPEA 3HPHA 4OLBA 2V7YA 3ULEB 4DCHA 4HTUA 1QQMA 2YNGA 4NO7A 3V1QA 4CEQA 3OTOK 3BY5A 1NMNA 4PHTX 3VMFB 5GAHP 4HTLA 1U04A 5CYMA 3T3FA 3RMDA 3S3NA 1V4SA 3PUFA 1RBVA 4GV3A 1HQEA 4KTQA 1J5EK 3PO5A 3NF7A 2QK9A 2PAVA 3K0SA 1JLFA 4HUFA 2O8FA 5HLFA 1WOQA 4WQ5A 2QM1A 4Z4CA 3EEQA 1Q8IA 4EHUA 2DY4A 4DUZK 2DFHA 4MLHA 3OS0A 3CCUN 4KPYA 3DXKB 5BPLA 1IG8A 3RMCA 4F9OA 1IKWA 2ZF5O 1XHZA 1CLQA 1GLDG 1DKGD 2D4WA 2P9SA 1DLOA 2AP1A 3DYAA 4KBOA 1OH5A 4IFVA 1KVCA 3QIPA 3R3LA 4RW7A 4CGJA 3THXB 4EP5A 3VENA 1DTTA 3U3GA 5KPRA 5CHIA 1T8EA 4PWDA 2PBDA 3OYKA 3PX0A 4H5WA 3DLBA 4DQQA 3M1FA 5HROA 4UQGA 3SV3A 3U6FA 4ZTFA 3T69A 4BVPA 1BWFO 3IFRA 3OS2A 1EX4A 3NF8A 1L3VA 3LDQA 3DWLA 1ATNA 4B3OA 1TVRA 1X1PA 4PQUA 2Q97A 4DR6K 3S3MA 3O4QA 3QICA 4W5OA 3BUZB 3V1OA 3KTQA 4B1VA 3WXMB 4AHRA 3RSEB 1S1TA 1RGIA 3THWB 1BGXT 3ENOA 3CJ1A 3H1QA 3MK6A 2PYLA 4A57A 1BOTO 4DFKA 3NVKA 4O5FA 5BR9A 3AVLA 1LW2A 3NH1A 4AH9A 2ZGYA 4FWPA 1HNZK 1N32K 1YI2N 1TGOA 4IDHA 2NUBA 1NK9A 1KSPA 2GX9A 3AVJA 3EZWA 4N47A 3ZSWA 3T1AA 3V9WA 1WB9A 5BPMA 1UWBA 3QBXA 2RN2A 1N5YA 3IAYA 2O8DA 4O55A 3K59A 1JLAA 2VQEK 1HKGA 4IO9L 2C1IA 3THVA 3SQ1A 4DV3K 3FZFA 2P9PB 3LZIA 1Q9YA 1XNRK 3MXMA 4B9MA 1WLJA 3VPZA 1E4FT 3AVCA 1JCGA 5I3UA 1MWMA 1XC3A 4NCGA 4O4GA 1EXQA 4EIAA 3WUHA 3NDKA 4A62A 4NCAA 1GOBA 4CFAA 4CJTA 1EWRA 3D2FA 2NRZA 4B1YB 4KTWA 1VQ8N 1RILA 4OVLA 4L8RB 5HOOA 1IBMK 3SQ2A 4M3ZA 2ZWHA 3QFPA 4KHWA 2RHKA 4FJLA 3TSUA 3SBGA 4YY3K 1VQ7N 3LDNA 1KAZA 3UKUB 4YOVA 3I55N 3CPWM 2H3GX 1L3UA 3LPUA 2P9LA 4WFNL 1NKEA 4M45A 4AHCA 3C6HA 4KH6A 4KV8A 4MDAA 2KHOA 4ISGA 2QWQA 2HVHA 4YNQA 3BGRA 1XQSC 5C0YA 4KB0A 3CI5A 2HBJA 5AQNA 2KTQA 5AQOA 5M1NA 4GNIA 1HPMA 4JI2K 4DB3A 1TKZA 4FW1A 5B8HA 4FLWA 1YTUA 4IWVA 3NFAA 2KKZA 4B9QA 3OYIA 4LF9K 2P9UB 3H46O 2YHYA 1RDBA 1GOAA 3L2RA 1JLBA 2G8WA 5JS2A 1YXQA 4OX9K 2OZMA 5HRSA 3G0ZA 4CI6A 1TK8A 4CF2A 1KAYA 4LFAK 3TR8A 1I39A 3TABA 3AA3A 4JKHA 1RTJA 4KB1A 1J6ZA 1BHLA 4DSIA 4H03B 4F4KA 1C1CA 3T7ZA 3VN5A 2D0CA 4DTSA 4B9VA 3HP6A 5I42A 4DTMA 4E7IA 1TAUA 4E1MA 4AM6A 1IV0A 4YFUA 5KI6A 4DTUA 2DTUA 1RTDA 4OPKA 3KK1A 2HHXA 1ZBSA 5M1KA 4GVMA 3K58A 4HCBA 3CCMN 5CY4A 3F5TA 3OYLA 4CZMA 3TAPA 1W7AA 3N4QA 4DUYK 4F2SA 4KH4A 2E1ZA 2YV0X 1BQMA 3SYZA 4CHOA 5DM6L 4JI7K 1VSHA 1VSDA 4Y0WA 3KLIA 5JVGL 3LP2A 4H0OA 4BRDA 4YOYA 4ILGB 3D2EA 1HUXA 4M3YA 4WQ4C 1JL1A 5BN9A 2EWSA 3DLLL 3SZ2A 3MX5A 4K42A 2CH5A 4FM0A 2I7PA 4IG3A 3NGIA 2IDOA 3G71N 2KQ2A 3U9DA 3AVGA 3UIQA 2V7ZA 4BEBA 3SAFA 2P9NA 2XY6A 1ZBLA 2IS3A 1O1WA 1BIZA 2Y1IA 3HO1A 4OKEA 3EKUA 2W00A 1XI1A 4PKHA 5F0XA 4DV7K 3EL2A 4BR2A 4OKJA 4FJ8A 5GINA 3WT0A 4MDBA 4G1QA 1GLCG 2HNDA 4B08A 3D0PA 1S72N 5AQVA 3VQ6A 3PO4A 3THYB 2P9KA 3I0RA 1VQ5N 3HBTA 3V4IA 1J53A 1C0TA 4MQ3A 2VG7A 2A1RA 4JS4A 4CJLA 3SV4A 3CCQN 4FWMA 5C15A 2IVNA 2UUBK 4PUOA 5KTQA 3RVCA 3B6OA 1LAWA 1TAQA 1CZ9A 3ZEUB 5E84A 2OA8A 3OYDA 4MFBA 1NBWA 3TARA 3OVNA 4GKKK 5JLHA 1KTQA 1M90O 3PX6A 4UY8O 3P4IA 4JD2B 1TYQA 2DFEA 4K43A 1U47A 4X62K 1BCMA 4I2QA 2KLAA 1WAFA 5KPTA 3QESA 1U2VB 4C23A 3VQ5A 4Z94A 4LH5A 1HLUA 3KK2A 3SQ0A 3M3ZA 1Q82O 3F9KA 3JYTA 5C25A 2NRWA 2F9WA 4JI6K 3I33A 4B9LA 4O0IA 1YTAA 2E2QA 4ZTJA 3ZX2A 4DF8A 5CE3A 4CD1A 4MLEA 2YHBA 4PKGA 5AQYA 3VQDA 2G8IA 3L2VA 4JI4K 2HNZA 2A40A 4FXDA 2HVIA 2A5XA 1BA0A 3CCEN 2O8CA 2P51A 4CZFA 3NE6A 1L3TA 1YT3A 3CJCA 2UXCK 4B1UB 4B9TA 3P39A 1SL2A 1XMOK 1IBKK 2QWOA 1VSJA 3WEEB 2KW4A 4RG8A 3U4LA 1GLFO 1ZBIA 1V4TA 2IVPA 1HX1A 4K41A 4BRFA 3BF3A 4DLEA 4H4MA 2IVOA 2HHUA 4I6MA 4DV2K 5AQFA 2D0PA 1BU6O 3C7NB 3TU5A 3KLEA 3NH2A 1W9HA 2X6NA 4PKIA 4BQZA 3AGRA 2KFNA 1Q81O 3S3OA 4F2RA 1VSIA 2F9TA 3KWGA 2A41A 5C24A 3AVNA 3PSFA 4M7YA 2ZE2A 1QZ6A 3SPYA 3NHGA 1OH7A 2FBYA 2QWLA 1SKSA 1VQNN 3OA9A 2IIRA 3R1XA 4M41A 4KH5A 3LM9A 2P5GA 3MWTA 3ZCMA 3CQYA 1VK0A 1C0MA 3HPGA 3K5OA 5AQJA 3DOKA 3HPOA 3I56N 2HHHK 3MEDA 3CM5A 3UB5A 1NLVA 5JENA 2BDPA 3UKRA 3VF4A 3SJJA 3O8MA 4DQPA 4R79A 4LFCK 3GOIA 1BL3A 1KAXA 1SAZA 3WNEA 4QAGA 3R8EA 3RMBA 1CZBA 4FJJA 3O9SA 1BCOA 3DAWA 2YNFA 4DWIA 1K8KB 1D9FA 2P9IA 5AQGA 3CJ9A 3ATUA 3ZETB 5KGXA 3SLCA 2FBXA 3TAMA 3CD6N 2VG6A 5AQWA 2HF4A 2EHGA 5CZ2A 2D0OA 3AVMA 2E8AA 3ZSOA 1FW6A 1E4GT 1VQ9N 3J80O 4PY5A 3KLGA 3NMUA 1OH6A 4ELTA 3QLHA 2E6LA 2OPPA 1JLQA 3HRGA 4PA1A 3SK3A 4IO8A 5J2PA 2XY8A 2F96A 4DTRA 3AO2A 3VEYA 5AZIB 3E66A 4W5QA 1ESVA 3BDPA 3ID8A 2D5RA 3ENBA 4BE2A 3QEIA 2LSNA 2ZQBA 4E3SA 2BUPA 1M1KO 3CC7N 5AQTA 5ADXH 4LF8K 1IBLK 4CJQA 4DV5K 1S1UA 4BR0A 2OANA 3AA4A 4BR5A 2D1KA 3J8AA 5SZTA 4FYDA 1YIJN 3P1GA 3VEVA 1GLJO 1RBRA 4IZ9A 4CW7B 4KHPK 1NK5A 3ZSVA 1NGDA 5AQKA 4B1ZA 4FLYA 2WFBA 4DSLA 3J7ZO 1NJXA 1RT2A 1U6ZA 1X9WA 1JLGA 3P31A 1P8ZA 1TL3A 2OPRA 3FE1A 2XRIA 1DTQA 5HP1A 3SUPA 3AO1A 3O9RA 3ZSRA 4R5PA 3O3HA 1EETA 3CCRN 4YDUC 3L2UA 4DR2K 4N76A 3V9XA 3VEOA 5ADXA 4X65K 3PX4A 2HHSA 1B9FA 5J2MA 4JKGA 3D45A 3OYMA 2E6MA 3H1VX 1VRUA 3QBWA 3ZSQA 3VQ8A 3D2FB 3IKMA 3WNFA 3KD1E 3KVGA 1S9GA 1TKXA 5FDLA 3NH0A 1JXEA 4ICLA 4CEAA 3O3FA 4FWOA 3AVKA 5AQUA 1QE1A 4FJ9A 1ZYQA 3TAGA 3BZKA 1GLEG 3ISNC 3MDQA 1VHXA 2B5JA 3SBTA 2YCHA 1KQSM 3VEXA 2YX6A 2E2NA 2UU9K 4DG1A 4H5VA 1C0GA 3J7YP 4FOEA 2P9LB 4XH4A 3DI6A 3TTFA 4LD0A 1TKTA 1ASUA 3DLGA 4J2EA 3KLHA 1VQON 1K73O 4NXNK 1J54A 4OO1J 1YHQN 2X6SA 3MWPA 3AGKA 5ELZA 1NGAA 1IG9A 3ZX3A 1QZ5A 1K9MO 3BEXA 5EOYA 2A6AA 2VGNA 3S9HA 4E19A 4IG0A 4RW8A 3VERA 3C94A 4H4OA 3DOLA 3NCIA 3C6UA 4J8FA 4CJFA 3TTDA 1VQLN 4BRLA 3QERA 4BG8A 5JLFA 1KFSA 3HM9A 2I5JA 4CJPA 3ASMA 1NU0A 4YORA 3V1RA 1ZXOA 2YJEA 2W42A 4KAZA 4B8AB 1RT7A 1W2BM 4FJNA 3QNOA 4H5RA 5JMVA 5CZ1A 5TKYA 4KHQA 2X74A 1WBBA 3D7EO 4I9QA 1RT1A 2IC3A 3J81O 2WOMA 3DXMA 5LJVA 4V19S 3VESA 5EXWA 4N41A 3NF6A 3HZ6A 2KZZA 3CYGA 2FC0A 4EZ9A 4EZ6A 1RDAA 2Q1NA 3IUCA 2C1GA 2YJFA 1C1AA 1CXUA 1RDCA 4LC9B 4DKWA 1QSLA 3V6DA 4H0VB 5AQZA 3GDQA 5H1SQ 3VF2A 4BRAA 3T19A 4DTOA 4IBNA 5BN8A 3SPZA 4CEZA 2G8FA 1T6DA 3FGUA 4H8KA 4HCCA 1VSKA 2OCEA 3SUNA 5AQRA 4E7HA 5K14A 1MU2A 4M3TA 1H1VA 1LWFA 3HT3A 1KCFA 3D2EB 3KK7A 4CGIA 5AZJA 4I2PA 4JI5K 1NK4A 4EHTA 2KFZA 1IKXA 2V52B 2UXDK 3OYCA 1NOYA 4LF4K 4J2BA 3WXJA 4CE9A 4CK1A 3LWMA 2P9NB 1HQUA 3ULEA 3BZCA 3RRHA 3K9JA 4Z4EA 2GUPA 1DT9A 3WNGA 3Q7CA 4CJSA 4WF9L 4KHNA 3CCVN 5GADP 4BG9A 3SI6A 5J1EA 4YOTA 4FLXA 2ZD1A 2YKMA 3MN6A 4FJ7A 4BR9A 4ILHA 4BRCA 4OPAA 1RDUA 4FVUA 5JVHL 3P5JA 4W5NA 1W0HA 4CFCA 3CFOA 4CGDA 4IJAA 5KGWA 1U48A 2CH6A 3AA2A 3SUQA 2CGKA 3O9UA 3A5LC 3ZSZA 3CF5L 1GLAG 3S5TA 1HKCA 4KHUA 4CZLA 4B8CA 2Q36A 3KKRA 3M5RA 4FWKA 1G99A 4CF1A 5EVZA 1RBSA 3QEWA 4JKBA 5LMUK 3CCLN 1JCEA 4CZEA 5AQXA 1VRTA 3OJUA 4F3OA 3L3VA 3VGLA 1NWKA 4JNEA 4AF1A 3LDOA 1Z05A 2ZJRL 1LOTB 4QS9A 2OPSA 4CF9A 2NRVA 4QS7A 3K5LA 4DV0K 2PZSA 2E20A 3A5MC 3VQBA 1LWCA 3RRGA 4BC4A 1J9AA 1YVUA 4AHTA 3SCXA 2Q31A 1P90A 1RTHA 2IAJA 1K6YA 1JL2A 2D0BA 4JK9A 4Z0UA 5LJWA 4FWSA 3CQXA 3RSEA 2O8CB 3A5OC 4DLGA 2GBZA 2XHBA 3AVFA 4BY9C 3QO9A 1BI4A 4CERA 1NKCA 4JS5A 2F8TA 4FK0A 3VTHA 1REVA 1XUPO 4BQLA 4KHSA 3MCAB 4LH4A 2BH1A 2UYTA 2RF2A 3CJAA 3AVIA 4JEPA 4I6MB 2G8HA 1NGIA 1IO2A 1L5UA 1BIUA 4JV5K 3VF6A 1XHXA 4AHVA 2Z1HA 1X3NA 3AY9A 5M1FA 4WYBA 4CBUA 3DLKA 2FF6A 4CJ7A 2WUSA 4M3WA 1ZBUA 2WBNA 4CZKA 4CJ5A 4L3QA 3AA5X 2XY7A 1HRHA 3QB0A 4PL7A 2I7NA 4HHTA 3E9PA 4CIEA 4NB4A 1NGCA 3E9OA 5LMNK 5BPNA 2VWBA 4HWIA 4CHNA 1T03A 2Q0UA 1YITN 4GW6A 3CQ8A 5GAGP 5BRHA 2CGJA 4DSJA 4M3XA 4WFAL 3EE9A 1D9DA 4JKFA 3FFKB 1HYZA 4Z4HA 3AO3A 3E1YA 1WAJA 3DLRA 3UKUA 3LALA 1W97L 3H08A 4A2BA 5IWAK 2KZMA 5CYQA 2BTFA 2E88A 3LANA 2NRHA 4N56A 3CCJN 4B3RK 3DLHA 1XMQK 4FLUA 4JK7A 5SWMA 4FWQA 4CGGA 5CR4A 2QW9A 4XIUA 2NRTA 1IKVA 1S22A 5LL6Z 5BR8K 3JSMA 1EWQA 1WSEA 1D5AA 3V9UA 2W40A 1TKDA 3E01A 4NCBA 3DRRA 4DHYA 3IMXA 1X9MA 4HVJA 4E0DA 4JI3K 5FROA 4A2AA 4KHYA 4CZGA 4GKJK 4CF0A 4JYAK 5M1PA 1B9DA 2HNYA 4W5TA 4DTXA 3LP1A 2QXFA 4G9ZA 2O4IA 1RDDA 3QNNA 1Z6RA 3F9MA 4BE0A 3DM2A 1OVYA 4FJXA 2G8UA 2ZJQL 4O8UA 3TAEA 4GV9A 3DRPA 5F1XA 3K2PA 3QEXA 1KVBA 1FKPA 5C12A 4OJRA 4CHYA 1RBTA 4JHDA 4YOWA 4QCLA 4JK8A 2O4GA 1Y97A 4CIFA 2Z1JA 4JI0K 1I3AA 3C95A 3L3UA 1L3SA 1QSYA 4FZZA 4FWNA 1SL0A 5GIOA 1S5JA 1GLBG 4CZHA 4B3TK 3MEGA 3VQAA 1NJIO 3QMLA 4U7BA 3WXLA 2ASOA 4ID1A 4B9UA 3V81A 4C1NK 1ZBHA 4BROA 2WTUA 2Y1JA 1SQKA 4CESA 1RT5A 2BE2A 1KC8O 1WUAA 4XEIA 3OBYA 4NXMK 3JXUA 2OTJN 4JKGB 3ZSYA 4B9NA 2RPIA 4H0TB 4WQ5C 4FO0A 4AILC 4IJNA 4KKOA 2ASPA 5KPZA 4DSEA 2YHXA 5HBMA 3B8AX 2O8FB 1O13A 3OYHA 5GAEP 1BDGA 3HL8A 4MO5A 4CJRA 3S41A 4CBXA 3VQPA 4WQ4A 3WQUA 3KLFA 4FWLA 2HMPA 5LY3A 4ZHRA 1U4BA 1TL1A 3Q7BA 4BECA 3TTCA 1NNEA 2P9SB 3C6AA 4BRQA 3WXIA 3PIOL 4XH5A 4WE1A 1RT4A 3VQ7A 3U9ZA 3AV9A 4M63C 4FJMA 1JJ2M 3TAQA 3CJBA 4AM7A 4DF4A 2GTDA 1D4XA 4BWJA 1QQOA 2HW3A 3H6EA 4BC2A 4IXCA 3CG7A 3CFRA 2HBMA 1RTIA 1Y64A 4CK3A 3THYA 1SKWA 4Y1DA 4BGAA 1RDWX 4BRIA 3O4NA 3AO4A 1Z25A 3NF9A 4WFBL 3OYBA 4BR4A 4AQYK 4CHQA 4DS5A 3QIOA 3ZT4A 1BO5O 4ELVA 2HBKA 4CEDA 5GIPA 4DQ8A 4OLAA 3DLEA 1MDUB 4O44A 4CECA 5BRFA 2HHQA 4BDPA 3MN7A 4DMNA 3MEEA 4C8KA 2VGMA 5KQDA 3SMSA 4FSVA 3E9LA 4CEBA 2W6KA 5AQLA 3T1YK 5AJ3K 4JD2A 4DSFA 2HSTA 2RE2A 1QS4A 3FZLA 5AFUH 2FXUA 3FFIA 3G10A 4OPJA 2ETJA 3K57A 1NG9A 2A1SA 4E7KA 3NVMA 3PLAA 1BISA 3DXMB 3I8DA 3FZKA 4RW6A 1U2VA 4DFJA 3RWUA 2ZJPL 3VGMA 3M8RA 5AQMA 3AAQA 5IT9O 4DQSA 4IFYA 2O8BA 1HJRA 4OKKA 4JKEA 1T6CA 2Q3SA 2F8SA 1JLEA 2NZTA 4CGHA 2PFUA 1YJWN 1T3VA 4IDKA 4FLZA 2O8DB 3O6WA 3WQTA 3I8BA 1QQCA 3LDLA 2Z1IA 1LAVA 5J2NA 3QINA 3B6PA 4FZXC 4KRFA 2QWNA 3RR8A 1RFQA 5AFUA 2HHVA 2VWKA 3HVTA 1OKJA 4LF7K 4JKDA 1WBDA 3JAMO 1ZBFA 3VOVA 1N33K 1E3MA 3MCPA
chains in the Genus database with same CATH topology
1HUXA 3ZX0A 2NLXA 4WQ4C 4EAHD 4EHTA 5FPNA 5BN9A 4H0YB 1QVFM 2V52B 2EWSA 3DLLL 4RWTA 3WXJA 3L0QA 3O9QA 3MX5A 4JKCA 4K42A 2CH5A 2I7PA 4BRHA 4NLBA 2Q2RA 3EO3A 3L6QA 2P9NB 3G71N 4A5BA 3ULEA 1QVGM 3CCSN 3U9DA 5TKWA 2QI2A 2V7ZA 4BEBA 5M1QA 2P9NA 3H3OB 4YOUA 3K9JA 3SAFA 4EFHA 2GUPA 2E1YA 1DT9A 2V51B 5C2FA 3Q7CA 4U67L 1LCUA 3EKUA 2W00A 1NGFA 3HOSA 1SZ2A 3R6MA 4WF9L 3CCVN 4PKHA 4BG9A 5F0XA 4E1JA 5GADP 4GVEA 3EL2A 4PL8A 3CETA 4YOTA 4BR2A 4FOIA 3A8YA 4FPBA 4BVOA 5GINA 3MN6A 3SJHA 2F7TA 3WT0A 4MDBA 1K8AO 4BR9A 4ILHA 1GLCG 4BRCA 1BG3A 1S72N 4OPAA 1RDUA 5AQVA 4FVUA 5JVHL 3FLCO 4CD3A 2HBLA 3HM8A 2P9KA 3R9PA 3UE5A 1VQ5N 1BUPA 3HBTA 4IJAA 5JICA 3KZBA 1GLLO 2CH6A 3O9TA 1ATSA 2JWKA 2CGKA 3O9UA 3A5LC 3CHWA 3CMAN 4GY2B 4JAXA 3CCQN 3CF5L 4FWMA 5C15A 2IVNA 1GLAG 4B1XB 4M7XA 1HKCA 3RVCA 4IOXA 4CZLA 2Q36A 3M5RA 3ZEUB 5E84A 5M1OA 3PIPL 5F2RA 4FWKA 1G99A 1NBWA 5FPDA 3EN9A 4BRGA 2NRRA 5EVZA 3ZEUA 5JLHA 1M90O 5C2DA 3H3NO 3VEWA 4UY8O 4JKBA 3SMPA 1NGGA 3P4IA 1NGBA 4JD2B 1JCEA 4CZEA 3CCLN 5AQXA 1K8KA 5AQPA 1TYQA 4BR7A 3VGLA 1NWKA 4JNEA 1HJOA 3MN5A 4K43A 3H45C 4AF1A 3ZETA 3LDOA 4IOCL 1Q86O 1Z05A 2VYPA 2ZJRL 1X9JA 3G25A 2KLAA 1LOTB 2HF3A 4QS9A 5KPTA 5KQ8A 1U2VB 2NRVA 4C23A 3O1BA 1QHAA 3LM2A 4Z94A 1HLUA 1JCFA 4QS7A 4OPHA 2AA4A 3M3ZA 2E20A 1Q82O 3A5MC 3AAPA 5AQQA 2NRWA 2F9WA 4BC4A 3JS6A 3O80A 2ITMA 2E2PA 3I33A 4A61A 3VEZA 2E2QA 4H5NA 3ZX2A 2Q31A 1SS6A 1P90A 5CE3A 4H5TA 4CD1A 4MLEA 4JK9A 1NGHA 4CZJA 5LJWA 4ILJA 1YJ9N 3ATVA 4FWSA 3CQXA 1HKBA 4PKGA 5AQHA 3D6RA 5AQYA 3RSEA 3CMEN 2FSNA 2A40A 3A5OC 5AZIA 1NMDA 3ENHA 1VQMN 2GELA 2WC9A 1NM1A 5AQIA 1NGEA 2A5XA 1BA0A 2GEMA 3CCEN 3DJCA 2CGLA 2QWPA 4CZFA 4BY9C 1QQNA 3CJCA 5BRDA 3KWIA 1IJJA 3VTHA 1XUPO 4BQLA 5AZJB 4B1UB 3L4QA 3P39A 2QWOA 3MCAB 3WEEB 2FSKA 1DEJA 2BH1A 5EY4A 4RTFD 3U4LA 1GLFO 2UYTA 1V4TA 3CJAA 2IVPA 4JEPA 3WEEA 1HX1A 1YAGA 4I6MB 4K41A 1YF5L 3HI0A 3FZMA 1KD1O 1NGIA 2QTDA 4BRFA 3BF3A 4H0PA 3QFUA 2IVOA 4MO4A 4I6MA 3G4SN 5AQFA 4BRNA 2D0PA 1BU6O 3C7NB 3SAGA 3VF6A 3TU5A 4WCEL 4IEIA 4PKIA 1VQ4N 3KHYA 4BQZA 3AGRA 1X3NA 3C7NA 3AY9A 5M1FA 1Q81O 3CPEA 4WYBA 2V7YA 3ULEB 4DCHA 4BRMA 4CBUA 3HOTA 1QQMA 2FF6A 4NO7A 2F9TA 4CJ7A 4BRKA 2WUSA 3KWGA 2A41A 4PHTX 3VMFB 3BP8A 2WBNA 5GAHP 4HTLA 4M7YA 4ISEA 4CZKA 1QZ6A 4L3QA 1V4SA 2Q0RA 4GV3A 2QWLA 4PL7A 3QB0A 3G6EN 3OHRA 4FWRA 2I7NA 1VQNN 5AQSA 3E9PA 4NB4A 1NGCA 5BREA 2NNWA 3OA9A 2IIRA 2PAVA 3R1XA 3E9OA 4KH5A 3GG4A 3LM9A 1ATRA 3MWTA 5BPNA 2VWBA 3O08A 4HWIA 4YDUA 3CQYA 1WOQA 2P9KB 2NRXA 3L4IA 5AQJA 4WQ5A 3I56N 2QEXN 2QM1A 4EHUA 2Q0UA 1YITN 4MLHA 3UB5A 1NLVA 3CCUN 5GAGP 3DXKB 3UKRA 3VF4A 5BPLA 1IG8A 3U8XA 3IDHA 5BRHA 3MX2A 4F9OA 3O8MA 2CGJA 2ZF5O 4XJXA 1GLDG 3DXKA 1DKGD 4R79A 2D4WA 2P9SA 3GOIA 1VQKN 2GWJA 3GL1A 4B1WB 1KAXA 2AP1A 4KBOA 1SAZA 4WFAL 1Q18A 1ILYA 3EE9A 3R3LA 4JKFA 3R8EA 3FFKB 2FF3B 3E1YA 3VENA 5CHIA 5KPRA 3O9SA 3UKUA 1W97L 3DAWA 4A2BA 2BTFA 2E88A 2PBDA 2NRHA 1K8KB 2QWMA 3CCJN 4JKAA 1TYQB 2P9IA 5AQGA 3CJ9A 3ATUA 4H5WA 3ZETB 4JK7A 2ZGZA 3F2KA 3SLCA 5DM7L 3CD6N 3M1FA 1VQPN 5AQWA 4CZIA 2HF4A 1N8RO 4FWQA 2VCPA 2D0OA 2E8AA 3TPQA 5CR4A 2QW9A 2NRTA 1E4GT 3T69A 1TUUA 4BVPA 3HTVA 1VQ9N 3GE1A 1VQ6N 1BWFO 1S22A 3NMUA 3IFRA 1T44A 4FPAA 3LDQA 3DWLA 3HSCA 1ATNA 3K9KA 3CC2N 3HRGA 3SK3A 2W40A 2Q97A 4IO8A 4DHYA 4IOAL 3IMXA 3QICA 3BUZB 4B1VA 4A2AA 3WXMB 4CZGA 3RSEB 1YJNN 2HOEA 1RGIA 3VEYA 5M1PA 5AZIB 3E66A 1ESVA 4G9ZA 3ENOA 3CJ1A 3H1QA 3MK6A 3ID8A 3FR0A 3ENBA 1Z6RA 4A57A 1ZC6A 2E2OA 3F9MA 1BOTO 3NVKA 4O5FA 5BR9A 2BUPA 1M1KO 1OVYA 5AQTA 3ZYYX 3CC7N 5ADXH 3VGKA 3MMVA 1R59O 2ZJQL 2QXLA 4O8UA 4GV9A 2ZGYA 2QWRA 4FWPA 4ISFA 4JHDB 5F1XA 4IDHA 1YI2N 3O4WA 4BR0A 4FL9A 5C12A 2OANA 2GX9A 1X3MA 3EZWA 4BR5A 2D1KA 3J8AA 4JHDA 4JK8A 5BPMA 4YOWA 1YIJN 5MLCQ 3VEVA 3M6GA 1GLJO 3QBXA 4FWNA 4IZ9A 3BF1A 5GIOA 1GLBG 3GBTA 4CZHA 2J4RA 2QA4N 1NJIO 1NGDA 3QMLA 4A59A 4U7BA 1EO1A 5AQKA 3WXLA 4B1ZA 1YVNA 2ASOA 3TSPA 2WFBA 3J7ZO 1HKGA 1U6ZA 4IO9L 2C1IA 1EQYA 4C1NK 3FZFA 3ID6A 3LDPA 3P31A 4BROA 2P9PB 1P8ZA 3A5NC 1SQKA 3FE1A 3VPZA 1KC8O 1WUAA 4CBWA 3QDKA 2P9PA 3OBYA 3O9RA 4XEIA 3JXUA 2OTJN 1E4FT 4JKGB 4YDUC 3LL3A 1JCGA 3CCRN 1MWMA 1XC3A 4H0TB 2A3ZA 2W41A 3D2EA 4WQ5C 3VEOA 4EIAA 5ADXA 4FO0A 4JKGA 4IJNA 3WUHA 2ASPA 5KPZA 3WXKA 2YHXA 3H1VX 4A62A 3QBWA 3VETA 3B8AX 1O13A 2FSJA 3D2FB 3IKMA 3O5BA 1VAZA 3KVGA 1BDGA 2GWKA 5GAEP 2ASMA 4MO5A 3EKSA 4IFEA 3D2FA 4YOXA 4FWOA 2NRZA 3S41A 4B1YB 4CBXA 1VQ8N 5AQUA 4WQ4A 3WQUA 3A0IX 3UKRB 4FWLA 2HMPA 5FPEA 5LY3A 1GLEG 3MDQA 5HOOA 3Q7BA 3EE8A 3SBTA 3TTCA 5HL7L 2YCHA 4BECA 2P9SB 4BC3A 4A5AA 1KQSM 3C6AA 5E26A 2ZWHA 3VEXA 3QFPA 2YX6A 2E2NA 2RHKA 3WXIA 4XH5A 4BRQA 3PIOL 3FZHA 3TSUA 4BC5A 4H5VA 3SBGA 1C0GA 3U9ZA 1VQ7N 4BE7B 3CJ7A 4FOEA 4H0XB 3LDNA 4BRPA 1KAZA 2P9LB 4XH4A 5I9EB 4M63C 3UKUB 4YOVA 1JJ2M 3I55N 3TTFA 3CPWM 2H3GX 3CJBA 4AM7A 1K73O 2GTDA 1VQON 2P9LA 4WFNL 3OW2M 4OO1J 1D4XA 2JWLA 1YHQN 2P9IB 3C6HA 3MWPA 4KH6A 3AGKA 4MDAA 2KHOA 1NGAA 1QQOA 5ELZA 1KXPA 3ZX3A 4ISGA 3H6EA 2QWQA 4IXCA 3VTIA 4BC2A 2HBMA 1QZ5A 1Y64A 1K9MO 4BGAA 1RDWX 3BEXA 4BRIA 1XQSC 5EOYA 2A6AA 2VGNA 1NGJA 5C0YA 5C10A 3VERA 4WFBL 1MA9B 3TSQA 4BR4A 3CI5A 2HBJA 5AQNA 1BO5O 5AQOA 5M1NA 2HBKA 5GIPA 4DQ8A 3MN9A 4GNIA 1S3XA 1HPMA 1YUWA 4J8FA 1MDUB 4DB3A 3TTDA 1VQLN 3CIPA 4BRLA 5B8HA 5BRFA 4NLCA 3MN7A 4BG8A 4IWVA 5JLFA 2VGMA 2KKZA 4B9QA 3SMSA 5KQDA 2P9UB 4FSVA 3E9LA 5AQLA 3H46O 4YORA 2YHYA 1ZXOA 3C0BA 4JD2A 5EX5A 2P9UA 2HSTA 2YJEA 2RE2A 3FZLA 3OBWA 1YXQA 2FXUA 5AFUH 1Q7YO 4C1NI 1W2BM 5AR0A 4H5RA 5FPMA 5JMVA 4O8KA 5TKYA 2YI1A 4CI6A 3NVMA 3P38A 3PLAA 4K25A 3DXMB 1C0FA 1KAYA 3FZKA 2YHWA 3D7EO 1U2VA 5LJVA 3DXMA 4JKHA 2ZJPL 3VESA 5EXWA 3VGMA 1J6ZA 5AQMA 3AAQA 4H03B 3CXCM 4BGBA 3O1WA 3W3DA 3HZ6A 1DGKN 3T7ZA 4JKEA 1T6CA 4QS8A 3CC4N 2Q1NA 1TUYA 3IUCA 3C65A 2C1GA 2YJFA 2NZTA 4AM6A 4DKWA 4LC9B 2PFUA 4BREA 1YJWN 4GV6A 1T3VA 1ZBSA 4H0VB 5AQZA 3GDQA 3O6WA 3WQTA 5H1SQ 5M1KA 3I8BA 3VF2A 2OTLN 2A42A 4BRAA 3LDLA 2DPNA 5BN8A 3CCMN 3F5TA 4CZMA 3SAHA 1T6DA 2QWNA 4JN4A 3FGUA 1BA1A 1CZAN 1RFQA 3N4QA 5AFUA 5AQRA 4XH1A 3W0LA 3AARA 4RCHA 1OKJA 4KH4A 2E1ZA 3CERA 4IEEA 1H1VA 4JKDA 5DM6L 4Y0WA 3KK7A 3D2EB 3VOVA 1MWKA 5AZJA 5JVGL 4H0OA 3MCPA 3N4PA 4BRDA 4YOYA 4ILGB 2FLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUX A;  3ZX0 A;  2NLX A;  4WQ4 C;  4EAH D;  4EHT A;  5FPN A;  5BN9 A;  4H0Y B;  2V52 B;  2EWS A;  4RWT A;  3WXJ A;  3L0Q A;  4K42 A;  2CH5 A;  2I7P A;  4BRH A;  2Q2R A;  3EO3 A;  3L6Q A;  2P9N B;  3ULE A;  3U9D A;  2V7Z A;  2P9N A;  3H3O B;  4EFH A;  2GUP A;  2E1Y A;  2V51 B;  1LCU A;  3EKU A;  1NGF A;  1SZ2 A;  3R6M A;  4PKH A;  4BG9 A;  5F0X A;  4E1J A;  3EL2 A;  4PL8 A;  3CET A;  4BR2 A;  4FOI A;  3A8Y A;  4FPB A;  4BVO A;  3MN6 A;  3SJH A;  3WT0 A;  4BR9 A;  1GLC G;  4BRC A;  1BG3 A;  5AQV A;  3FLC O;  4CD3 A;  3HM8 A;  2P9K A;  3R9P A;  3UE5 A;  1BUP A;  3HBT A;  4IJA A;  5JIC A;  3KZB A;  1GLL O;  2CH6 A;  1ATS A;  2CGK A;  3A5L C;  3CHW A;  4GY2 B;  4JAX A;  4FWM A;  2IVN A;  1GLA G;  4B1X B;  4M7X A;  1HKC A;  4CZL A;  2Q36 A;  3ZEU B;  5E84 A;  5F2R A;  4FWK A;  1G99 A;  1NBW A;  5FPD A;  3EN9 A;  4BRG A;  5EVZ A;  3ZEU A;  5JLH A;  3H3N O;  3VEW A;  3SMP A;  1NGG A;  3P4I A;  1NGB A;  4JD2 B;  1JCE A;  4CZE A;  5AQX A;  1K8K A;  5AQP A;  1TYQ A;  4BR7 A;  3VGL A;  1NWK A;  4JNE A;  1HJO A;  3MN5 A;  4K43 A;  3H45 C;  3ZET A;  3LDO A;  1Z05 A;  2VYP A;  1X9J A;  3G25 A;  1LOT B;  2HF3 A;  4QS9 A;  5KPT A;  5KQ8 A;  1U2V B;  4C23 A;  3O1B A;  1QHA A;  3LM2 A;  4Z94 A;  1HLU A;  1JCF A;  4QS7 A;  2AA4 A;  3M3Z A;  2E20 A;  3A5M C;  3AAP A;  5AQQ A;  2F9W A;  4BC4 A;  3JS6 A;  3O80 A;  2ITM A;  2E2P A;  3I33 A;  4A61 A;  3VEZ A;  2E2Q A;  4H5N A;  3ZX2 A;  2Q31 A;  5CE3 A;  4H5T A;  4CD1 A;  4MLE A;  1NGH A;  4CZJ A;  5LJW A;  3ATV A;  4FWS A;  3CQX A;  1HKB A;  4PKG A;  5AQH A;  5AQY A;  3RSE A;  2FSN A;  2A40 A;  3A5O C;  5AZI A;  1NMD A;  3ENH A;  2GEL A;  1NM1 A;  5AQI A;  1NGE A;  2A5X A;  1BA0 A;  2GEM A;  3DJC A;  2CGL A;  2QWP A;  4CZF A;  1QQN A;  3CJC A;  5BRD A;  1IJJ A;  1XUP O;  4BQL A;  5AZJ B;  4B1U B;  2QWO A;  3WEE B;  2FSK A;  1DEJ A;  5EY4 A;  4RTF D;  3U4L A;  1GLF O;  2UYT A;  1V4T A;  3CJA A;  2IVP A;  3WEE A;  1HX1 A;  1YAG A;  4I6M B;  4K41 A;  3HI0 A;  3FZM A;  1NGI A;  4BRF A;  3BF3 A;  4H0P A;  3QFU A;  2IVO A;  4MO4 A;  4I6M A;  5AQF A;  4BRN A;  2D0P A;  1BU6 O;  3C7N B;  3VF6 A;  3TU5 A;  4PKI A;  3KHY A;  4BQZ A;  1X3N A;  3C7N A;  3AY9 A;  4WYB A;  2V7Y A;  3ULE B;  4DCH A;  4BRM A;  4CBU A;  1QQM A;  2FF6 A;  4NO7 A;  2F9T A;  4CJ7 A;  4BRK A;  2WUS A;  2A41 A;  3BP8 A;  4HTL A;  4M7Y A;  4ISE A;  4CZK A;  1QZ6 A;  4L3Q A;  1V4S A;  2Q0R A;  2QWL A;  4PL7 A;  3QB0 A;  3OHR A;  4FWR A;  2I7N A;  5AQS A;  4NB4 A;  1NGC A;  5BRE A;  2IIR A;  2PAV A;  3GG4 A;  3LM9 A;  1ATR A;  5BPN A;  2VWB A;  3O08 A;  4HWI A;  4YDU A;  3CQY A;  1WOQ A;  2P9K B;  3L4I A;  5AQJ A;  4WQ5 A;  2QM1 A;  4EHU A;  2Q0U A;  4MLH A;  3UB5 A;  1NLV A;  3DXK B;  3UKR A;  3VF4 A;  5BPL A;  1IG8 A;  3U8X A;  3IDH A;  5BRH A;  4F9O A;  3O8M A;  2CGJ A;  2ZF5 O;  1GLD G;  3DXK A;  1DKG D;  2D4W A;  2P9S A;  3GOI A;  2GWJ A;  3GL1 A;  4B1W B;  1KAX A;  2AP1 A;  4KBO A;  1SAZ A;  1Q18 A;  3R8E A;  3FFK B;  2FF3 B;  3VEN A;  5KPR A;  3UKU A;  3DAW A;  4A2B A;  2BTF A;  2E88 A;  2PBD A;  2NRH A;  1K8K B;  2QWM A;  1TYQ B;  2P9I A;  5AQG A;  3CJ9 A;  3ATU A;  4H5W A;  3ZET B;  2ZGZ A;  3SLC A;  3M1F A;  5AQW A;  4CZI A;  2HF4 A;  4FWQ A;  2VCP A;  2D0O A;  2E8A A;  3TPQ A;  2QW9 A;  1E4G T;  1TUU A;  4BVP A;  3HTV A;  3GE1 A;  1BWF O;  1S22 A;  3IFR A;  1T44 A;  4FPA A;  3LDQ A;  3DWL A;  3HSC A;  1ATN A;  3SK3 A;  2W40 A;  2Q97 A;  4IO8 A;  4DHY A;  3IMX A;  3QIC A;  3BUZ B;  4B1V A;  4A2A A;  4CZG A;  3RSE B;  2HOE A;  1RGI A;  3VEY A;  5AZI B;  1ESV A;  3ENO A;  3CJ1 A;  3H1Q A;  3MK6 A;  3ID8 A;  3FR0 A;  1Z6R A;  1ZC6 A;  2E2O A;  3F9M A;  1BOT O;  4O5F A;  5BR9 A;  2BUP A;  5AQT A;  5ADX H;  3VGK A;  3MMV A;  1R59 O;  2QXL A;  2ZGY A;  2QWR A;  4FWP A;  4ISF A;  4JHD B;  5F1X A;  3O4W A;  4BR0 A;  4FL9 A;  2OAN A;  1X3M A;  3EZW A;  4BR5 A;  2D1K A;  3J8A A;  4JHD A;  5BPM A;  3VEV A;  3M6G A;  1GLJ O;  3QBX A;  4FWN A;  4IZ9 A;  3BF1 A;  1GLB G;  3GBT A;  4CZH A;  2J4R A;  1NGD A;  3QML A;  5AQK A;  3WXL A;  4B1Z A;  1YVN A;  2ASO A;  1HKG A;  1U6Z A;  1EQY A;  3FZF A;  3LDP A;  4BRO A;  2P9P B;  1P8Z A;  3A5N C;  1SQK A;  3FE1 A;  3VPZ A;  1WUA A;  4CBW A;  3QDK A;  2P9P A;  4XEI A;  3JXU A;  1E4F T;  4YDU C;  3LL3 A;  1JCG A;  1MWM A;  1XC3 A;  4H0T B;  2A3Z A;  2W41 A;  4WQ5 C;  3VEO A;  4EIA A;  5ADX A;  4FO0 A;  4IJN A;  3WUH A;  2ASP A;  5KPZ A;  3WXK A;  2YHX A;  3H1V X;  4A62 A;  3QBW A;  3VET A;  3B8A X;  2FSJ A;  3D2F B;  3O5B A;  3KVG A;  1BDG A;  2GWK A;  2ASM A;  4MO5 A;  3EKS A;  3D2F A;  4FWO A;  3S41 A;  4B1Y B;  4CBX A;  5AQU A;  4WQ4 A;  3WQU A;  3A0I X;  3UKR B;  4FWL A;  2HMP A;  5FPE A;  5LY3 A;  1GLE G;  3MDQ A;  2YCH A;  2P9S B;  4BC3 A;  5E26 A;  4BRQ A;  2ZWH A;  3VEX A;  3QFP A;  3WXI A;  2E2N A;  4XH5 A;  3FZH A;  4BC5 A;  4H5V A;  1C0G A;  3U9Z A;  3CJ7 A;  4FOE A;  4H0X B;  3LDN A;  4BRP A;  1KAZ A;  2P9L B;  4XH4 A;  5I9E B;  4M63 C;  3UKU B;  2H3G X;  3CJB A;  4AM7 A;  2GTD A;  2P9L A;  1D4X A;  2P9I B;  5ELZ A;  2KHO A;  1NGA A;  1QQO A;  1KXP A;  3ZX3 A;  4ISG A;  3H6E A;  2QWQ A;  4IXC A;  4BC2 A;  1QZ5 A;  1Y64 A;  4BGA A;  1RDW X;  3BEX A;  4BRI A;  1XQS C;  5EOY A;  2A6A A;  1NGJ A;  3VER A;  1MA9 B;  4BR4 A;  3CI5 A;  5AQN A;  1BO5 O;  5AQO A;  4DQ8 A;  3MN9 A;  4GNI A;  1S3X A;  1HPM A;  1YUW A;  4J8F A;  1MDU B;  4DB3 A;  3CIP A;  4BRL A;  5B8H A;  5BRF A;  4BG8 A;  3MN7 A;  4IWV A;  5JLF A;  4B9Q A;  5KQD A;  3SMS A;  2P9U B;  4FSV A;  5AQL A;  3H46 O;  2YHY A;  1ZXO A;  3C0B A;  4JD2 A;  5EX5 A;  2P9U A;  2YJE A;  3FZL A;  5AFU H;  1YXQ A;  2FXU A;  5AR0 A;  4H5R A;  5FPM A;  5JMV A;  4O8K A;  5TKY A;  2YI1 A;  4CI6 A;  4K25 A;  3DXM B;  1C0F A;  1KAY A;  3FZK A;  2YHW A;  3D7E O;  1U2V A;  5LJV A;  3DXM A;  3VES A;  5EXW A;  3VGM A;  1J6Z A;  2FLO A;  3AAQ A;  5AQM A;  4H03 B;  4BGB A;  3O1W A;  3W3D A;  3HZ6 A;  1DGK N;  1T6C A;  4QS8 A;  2Q1N A;  1TUY A;  3IUC A;  2YJF A;  2NZT A;  4AM6 A;  4LC9 B;  4BRE A;  1ZBS A;  4H0V B;  5AQZ A;  3GDQ A;  3O6W A;  3WQT A;  3I8B A;  3VF2 A;  2A42 A;  4BRA A;  3LDL A;  2DPN A;  5BN8 A;  4CZM A;  1T6D A;  2QWN A;  4JN4 A;  3FGU A;  1BA1 A;  1CZA N;  1RFQ A;  5AFU A;  5AQR A;  4XH1 A;  3W0L A;  3AAR A;  4RCH A;  1OKJ A;  2E1Z A;  3CER A;  1H1V A;  4Y0W A;  3D2E B;  3VOV A;  1MWK A;  5AZJ A;  4H0O A;  3MCP A;  4BRD A;  3D2E A; 
#chains in the Genus database with same CATH topology
 4J2A A;  2NLX A;  4H0Y B;  4F3T A;  2B4J A;  1WSJ A;  1TV6 A;  1UA0 A;  3L0Q A;  2O8E A;  1VSF A;  3O9Q A;  1Z26 A;  1TK0 A;  4B3S K;  3NGY A;  1NJW A;  1HYS A;  3L6Q A;  4A5B A;  4FJH A;  2QI2 A;  3H3O B;  1NKB A;  3K5N A;  4EFH A;  2E1Y A;  2V51 B;  4U67 L;  1JKH A;  1NGF A;  3HOS A;  3R6M A;  5HRR A;  4FVM A;  1VSE A;  4GVE A;  4PL8 A;  4FOI A;  1NK0 A;  3HJF A;  4FPB A;  4BVO A;  5J2Q A;  4DTN A;  1K8A O;  1BG3 A;  1C6V A;  5EU7 A;  4CD3 A;  2HBL A;  3HM8 A;  4KFB A;  3R9P A;  3UE5 A;  4E7J A;  1BUP A;  2YKN A;  3OYF A;  3CHW A;  3CMA N;  2DFF A;  4GY2 B;  3LP3 A;  3AO5 A;  4DFM A;  1S1X A;  3ZLJ A;  4DU3 A;  1GOC A;  4DQR A;  3ALY A;  5M1O A;  4FLV A;  1WSH A;  1NJY A;  4BRG A;  2NRR A;  3OY9 A;  3RMA A;  3MXJ A;  5JS1 A;  4Z4G A;  4Q5V A;  1K8K A;  1HJO A;  3RR7 A;  3H45 C;  3ZET A;  2HHT A;  2VYP A;  2UXB K;  1S6P A;  5KQ8 A;  4DSK A;  1BQN A;  3O1B A;  1QHA A;  3KJV A;  3LM2 A;  4FK4 A;  1JCF A;  4OPH A;  1TK5 A;  3J7A P;  1FJG K;  3AAP A;  5AQQ A;  1HNI A;  4DV1 K;  5D3G A;  2QKB A;  2W6L A;  3JS6 A;  2ITM A;  2E2P A;  3HK2 A;  4KRE A;  4DTP A;  3VEZ A;  1SS6 A;  3I0S A;  4FLT A;  3CYM A;  4H5T A;  4C8M A;  5C42 A;  4CZJ A;  1YJ9 N;  3L8B A;  1HKB A;  5AZI A;  3NAE A;  1KVA A;  4W5R A;  1NMD A;  1BI4 B;  3VQC A;  1VQM N;  4DV4 K;  2WC9 A;  4ELU A;  5AQI A;  1XC9 A;  3DJC A;  2CGL A;  1QQN A;  3OJS A;  2JGU A;  4CEF A;  1A5X A;  3QEP A;  3KKS A;  3HVR A;  1HNV A;  4NYN A;  3OYG A;  2VQF K;  1N36 K;  3VA3 A;  2HMI A;  2XO7 A;  4CJE A;  1ITG A;  3VQQ A;  1YF5 L;  3M8Q A;  1IH7 A;  1HR0 K;  1KD1 O;  2QTD A;  4H0P A;  3QFU A;  4BRN A;  3U3Y A;  4WCE L;  3IS9 A;  1VQ4 N;  2R7Y A;  4FJK A;  4DU1 A;  4BRM A;  3HOT A;  3IG1 A;  3CM6 A;  3WNH A;  1U49 A;  4BRK A;  1SKR A;  5FRN A;  1HMV A;  1NK7 A;  1QTM A;  1B92 A;  3BP8 A;  1HNW K;  4ISE A;  3PY8 A;  2Q0R A;  3TAF A;  3G6E N;  3OHR A;  4O0J A;  4FWR A;  5AQS A;  2QKK A;  5BRE A;  2NNW A;  4BDY A;  2IOC A;  3GG4 A;  1UA1 A;  1ATR A;  3O08 A;  4N5S A;  4YDU A;  3V9S A;  2P9K B;  2NRX A;  3L4I A;  2QEX N;  1G15 A;  4E72 A;  2G8V A;  4E89 A;  1LWE A;  3ZT3 A;  3U8X A;  3IDH A;  4DR1 K;  3MX2 A;  4XJX A;  1RCH A;  4M3U A;  3DXK A;  1VQK N;  2GWJ A;  3VQE A;  3GL1 A;  4B1W B;  1ILY A;  1Q18 A;  2GV9 A;  4JI8 K;  3HYF A;  2FF3 B;  4CIG A;  4QOZ B;  4BWM A;  4JLH A;  3THX A;  4DS4 A;  2QWM A;  4JKA A;  1TYQ B;  3ZSX A;  2YNI A;  1EP4 A;  2ZGZ A;  3C6T A;  1J5O A;  3F2K A;  5DM7 L;  4CFB A;  1VSL A;  1VQP N;  4CZI A;  1N8R O;  2VCP A;  4JRP A;  3EYZ A;  3TPQ A;  1TUU A;  3HTV A;  3HXM A;  3GE1 A;  2E5L K;  1VQ6 N;  4F8R A;  3ZT2 A;  3OS1 A;  1T44 A;  2YNH A;  4FPA A;  1WSI A;  3HSC A;  4CVN E;  3K9K A;  3CC2 N;  1D8Y A;  4OGE A;  1NK8 A;  4BAC A;  4KO0 A;  4C8N A;  4IOA L;  4K8Z A;  4O5B A;  1YJN N;  2HOE A;  3QEV A;  3AVB A;  4K8X A;  2F4V K;  2UUC K;  5DMR A;  3FR0 A;  4M42 A;  4RW9 A;  1ZC6 A;  3THW A;  2E2O A;  2WON A;  4CEE A;  3ZYY X;  3VGK A;  3MMV A;  1R59 O;  2QXL A;  2QWR A;  4ISF A;  4JHD B;  3O4W A;  4FL9 A;  3NGZ A;  1X3M A;  2XY5 A;  3CFP A;  4DV6 K;  4FZY A;  5MLC Q;  3M6G A;  5HRP A;  2JLE A;  4K0K K;  3BF1 A;  4LF5 K;  3GBT A;  1T05 A;  2J4R A;  1WSG A;  2QA4 N;  4A59 A;  1EO1 A;  1YVN A;  4CJ3 A;  1N34 K;  2OZS A;  3TSP A;  1NJZ A;  1EQY A;  4FM2 A;  3M8S A;  3ID6 A;  3LDP A;  3A5N C;  4CJ4 A;  3SNN A;  4CBW A;  3QDK A;  2P9P A;  3SQ4 A;  4FJI A;  3LL3 A;  4BDZ A;  2A3Z A;  2W41 A;  2OYQ A;  4Z4I A;  1WNS A;  3VQ4 A;  5KRT A;  3WXK A;  1SUQ A;  3LP0 A;  3VET A;  2FSJ A;  3O5B A;  1VAZ A;  2GWK A;  2ASM A;  4LF6 K;  1RNH A;  3EKS A;  4IFE A;  4CHZ A;  3OYE A;  4YOX A;  4TSX A;  2AJQ A;  4LY7 A;  3A0I X;  3UKR B;  5FPE A;  1N6Q A;  4FJG A;  4DU4 A;  3AVH A;  3EE8 A;  1NK6 A;  5HL7 L;  1UAX A;  4BC3 A;  4A5A A;  5E26 A;  3FZH A;  4BC5 A;  2HB5 A;  1RT6 A;  3CJ7 A;  4H0X B;  4BRP A;  5I9E B;  4I7F A;  4CJW A;  2Z1G A;  3OW2 M;  2ITG A;  3QET A;  4Y1C A;  2JWL A;  1EKE A;  2P9I B;  1KXP A;  2GUI A;  1T7P A;  3VTI A;  3EZ5 A;  4FCY A;  4FK2 A;  3VQ9 A;  1NGJ A;  3L2Q A;  5C10 A;  4DFP A;  1HPZ A;  4CEO A;  1MA9 B;  3TSQ A;  2G8K A;  1SV5 A;  3AVA A;  4Z4F A;  3MN9 A;  1S3X A;  1YUW A;  3MAQ A;  3SUO A;  5DK5 A;  1FK9 A;  3MEC A;  3CIP A;  4NLC A;  4ID5 A;  3RTV A;  1LW0 A;  5EX5 A;  3C0B A;  4DR4 K;  1S9E A;  2P9U A;  3OBW A;  3T1H K;  4HUE A;  1Q7Y O;  4C1N I;  3ITH A;  5AR0 A;  3P83 D;  4CJV A;  2BAN A;  5FPM A;  4O8K A;  3LZJ A;  2YI1 A;  3P38 A;  1SL1 A;  4K25 A;  1C0F A;  1JLC A;  4J2D A;  2YHW A;  4CF8 A;  5HRN A;  4AHS A;  4DTJ A;  2O8B B;  2PYJ A;  5A2Q O;  1JXB A;  4RW4 A;  4BGB A;  3O1W A;  3CXC M;  4DQI A;  4C8L A;  3W3D A;  1DGK N;  4DR3 K;  3ZT0 A;  4QS8 A;  2BGG A;  3CC4 N;  1TUY A;  1OVQ A;  3C65 A;  3KIO A;  1F21 A;  1XNQ K;  2RKI A;  4DR5 K;  4CCH A;  4BRE A;  4GV6 A;  4YHH K;  2E4L A;  3LAK A;  2OTL N;  2A42 A;  1CXQ A;  2DPN A;  2VWJ A;  1X9S A;  3SAH A;  3LDS A;  4JN4 A;  4I9L A;  5FLX O;  1BA1 A;  1CZA N;  5E41 A;  4XH1 A;  3W0L A;  3AAR A;  4RCH A;  4AHU A;  3CER A;  4IEE A;  4LSL A;  1MWK A;  4M3R A;  3K5M A;  1QSS A;  3KD5 E;  3N4P A;  4BE7 B;  2FLO A;  3ZX0 A;  4EAH D;  5FPN A;  1OH8 A;  1QVF M;  2O8E B;  3OYN A;  4RWT A;  2FBT A;  3V9Z A;  4JKC A;  4CJK A;  3L2W A;  4BRH A;  3NBP A;  4NLB A;  2Q2R A;  3EO3 A;  1WSF A;  1QVG M;  3CCS N;  5TKW A;  4GMJ B;  4CJU A;  4IKF A;  5M1Q A;  1ASV A;  1S1V A;  4YOU A;  4FJ5 A;  5C2F A;  4FM1 A;  3VA0 A;  1LCU A;  1SZ2 A;  4E1J A;  3CET A;  1VSM A;  1S6Q A;  2P1J A;  3A8Y A;  3PSI A;  3SJH A;  2F7T A;  4DR7 K;  3M8P A;  2IGI A;  3FLC O;  4X66 K;  2VG5 A;  5JIC A;  3KZB A;  1GLL O;  1UOC A;  3O9T A;  4CGF A;  1ATS A;  2JWK A;  4NYF A;  4HUG A;  3ULD A;  1RT3 A;  4B3M K;  4JAX A;  4BE1 A;  4B1X B;  4M7X A;  4FW2 A;  3F73 A;  4IOX A;  3OYA A;  4CFD A;  1KRP A;  3PIP L;  1A5V A;  5F2R A;  5KRS A;  2HHI A;  4KI6 A;  5FPD A;  3EN9 A;  3ZEU A;  5C2D A;  2YHA A;  3H3N O;  3VEW A;  1ASW A;  3SMP A;  1NGG A;  1NGB A;  4B9S A;  2ZM6 K;  4CK2 A;  3OYJ A;  2OPQ A;  5AQP A;  2UUA K;  1KLN A;  4BR7 A;  3MN5 A;  1HNX K;  1Q86 O;  4IOC L;  3TAN A;  1I94 K;  4EP4 A;  3HP9 A;  2EX3 A;  3DMJ A;  1X9J A;  3G25 A;  2HF3 A;  1S1W A;  1A5W A;  1LV5 A;  1C0U A;  3O3G A;  2B6A A;  2AA4 A;  1QHT A;  1C1B A;  3LPT A;  4JI1 K;  4KI4 A;  4E1N A;  3EY1 A;  2ATQ A;  4JRQ A;  3O80 A;  4C8O A;  4A61 A;  4H5N A;  3PV8 A;  3IRX A;  4CHP A;  1FXX A;  3MXI A;  1NGH A;  4LSN A;  4ILJ A;  3ATV A;  5T7B A;  1KFD A;  2HHW A;  5AQH A;  4OGC A;  3D6R A;  3CME N;  5FRM A;  2FSN A;  1U45 A;  3ENH A;  3HST B;  2GEL A;  3DRS A;  1NM1 A;  1NGE A;  2GEM A;  1XWL A;  1R0A A;  2QWP A;  2P5O A;  3LAM A;  4KTZ A;  1Q9X A;  5BRD A;  3KWI A;  1IJJ A;  1IKY A;  5AZJ B;  2FBV A;  3L4Q A;  3ZT1 A;  2X78 A;  3LWL A;  2FSK A;  1DEJ A;  1RBU A;  5EY4 A;  4RTF D;  3TI0 A;  4LFB K;  3WEE A;  2PY5 A;  1NOZ A;  1YAG A;  1FKO A;  3HI0 A;  3FZM A;  2D0A A;  3G4S N;  4MO4 A;  3TWH A;  3SAG A;  3A2F A;  4X64 K;  1HYV A;  4IEI A;  4E7L A;  3KHY A;  3KK3 A;  4Q0B A;  3C7N A;  1KLM A;  1WN7 A;  3CPE A;  3HPH A;  4OLB A;  2V7Y A;  3ULE B;  4DCH A;  4HTU A;  1QQM A;  2YNG A;  4NO7 A;  3V1Q A;  4CEQ A;  3OTO K;  3BY5 A;  1NMN A;  4PHT X;  3VMF B;  5GAH P;  4HTL A;  1U04 A;  5CYM A;  3T3F A;  3RMD A;  3S3N A;  1V4S A;  3PUF A;  1RBV A;  4GV3 A;  1HQE A;  4KTQ A;  1J5E K;  3PO5 A;  3NF7 A;  2QK9 A;  2PAV A;  3K0S A;  1JLF A;  4HUF A;  2O8F A;  5HLF A;  1WOQ A;  4WQ5 A;  2QM1 A;  4Z4C A;  3EEQ A;  1Q8I A;  4EHU A;  2DY4 A;  4DUZ K;  2DFH A;  4MLH A;  3OS0 A;  3CCU N;  4KPY A;  3DXK B;  5BPL A;  1IG8 A;  3RMC A;  4F9O A;  1IKW A;  2ZF5 O;  1XHZ A;  1CLQ A;  1GLD G;  1DKG D;  2D4W A;  2P9S A;  1DLO A;  2AP1 A;  3DYA A;  4KBO A;  1OH5 A;  4IFV A;  1KVC A;  3QIP A;  3R3L A;  4RW7 A;  4CGJ A;  3THX B;  4EP5 A;  3VEN A;  1DTT A;  3U3G A;  5KPR A;  5CHI A;  1T8E A;  4PWD A;  2PBD A;  3OYK A;  3PX0 A;  4H5W A;  3DLB A;  4DQQ A;  3M1F A;  5HRO A;  4UQG A;  3SV3 A;  3U6F A;  4ZTF A;  3T69 A;  4BVP A;  1BWF O;  3IFR A;  3OS2 A;  1EX4 A;  3NF8 A;  1L3V A;  3LDQ A;  3DWL A;  1ATN A;  4B3O A;  1TVR A;  1X1P A;  4PQU A;  2Q97 A;  4DR6 K;  3S3M A;  3O4Q A;  3QIC A;  4W5O A;  3BUZ B;  3V1O A;  3KTQ A;  4B1V A;  3WXM B;  4AHR A;  3RSE B;  1S1T A;  1RGI A;  3THW B;  1BGX T;  3ENO A;  3CJ1 A;  3H1Q A;  3MK6 A;  2PYL A;  4A57 A;  1BOT O;  4DFK A;  3NVK A;  4O5F A;  5BR9 A;  3AVL A;  1LW2 A;  3NH1 A;  4AH9 A;  2ZGY A;  4FWP A;  1HNZ K;  1N32 K;  1YI2 N;  1TGO A;  4IDH A;  2NUB A;  1NK9 A;  1KSP A;  2GX9 A;  3AVJ A;  3EZW A;  4N47 A;  3ZSW A;  3T1A A;  3V9W A;  1WB9 A;  5BPM A;  1UWB A;  3QBX A;  2RN2 A;  1N5Y A;  3IAY A;  2O8D A;  4O55 A;  3K59 A;  1JLA A;  2VQE K;  1HKG A;  4IO9 L;  2C1I A;  3THV A;  3SQ1 A;  4DV3 K;  3FZF A;  2P9P B;  3LZI A;  1Q9Y A;  1XNR K;  3MXM A;  4B9M A;  1WLJ A;  3VPZ A;  1E4F T;  3AVC A;  1JCG A;  5I3U A;  1MWM A;  1XC3 A;  4NCG A;  4O4G A;  1EXQ A;  4EIA A;  3WUH A;  3NDK A;  4A62 A;  4NCA A;  1GOB A;  4CFA A;  4CJT A;  1EWR A;  3D2F A;  2NRZ A;  4B1Y B;  4KTW A;  1VQ8 N;  1RIL A;  4OVL A;  4L8R B;  5HOO A;  1IBM K;  3SQ2 A;  4M3Z A;  2ZWH A;  3QFP A;  4KHW A;  2RHK A;  4FJL A;  3TSU A;  3SBG A;  4YY3 K;  1VQ7 N;  3LDN A;  1KAZ A;  3UKU B;  4YOV A;  3I55 N;  3CPW M;  2H3G X;  1L3U A;  3LPU A;  2P9L A;  4WFN L;  1NKE A;  4M45 A;  4AHC A;  3C6H A;  4KH6 A;  4KV8 A;  4MDA A;  2KHO A;  4ISG A;  2QWQ A;  2HVH A;  4YNQ A;  3BGR A;  1XQS C;  5C0Y A;  4KB0 A;  3CI5 A;  2HBJ A;  5AQN A;  2KTQ A;  5AQO A;  5M1N A;  4GNI A;  1HPM A;  4JI2 K;  4DB3 A;  1TKZ A;  4FW1 A;  5B8H A;  4FLW A;  1YTU A;  4IWV A;  3NFA A;  2KKZ A;  4B9Q A;  3OYI A;  4LF9 K;  2P9U B;  3H46 O;  2YHY A;  1RDB A;  1GOA A;  3L2R A;  1JLB A;  2G8W A;  5JS2 A;  1YXQ A;  4OX9 K;  2OZM A;  5HRS A;  3G0Z A;  4CI6 A;  1TK8 A;  4CF2 A;  1KAY A;  4LFA K;  3TR8 A;  1I39 A;  3TAB A;  3AA3 A;  4JKH A;  1RTJ A;  4KB1 A;  1J6Z A;  1BHL A;  4DSI A;  4H03 B;  4F4K A;  1C1C A;  3T7Z A;  3VN5 A;  2D0C A;  4DTS A;  4B9V A;  3HP6 A;  5I42 A;  4DTM A;  4E7I A;  1TAU A;  4E1M A;  4AM6 A;  1IV0 A;  4YFU A;  5KI6 A;  4DTU A;  2DTU A;  1RTD A;  4OPK A;  3KK1 A;  2HHX A;  1ZBS A;  5M1K A;  4GVM A;  3K58 A;  4HCB A;  3CCM N;  5CY4 A;  3F5T A;  3OYL A;  4CZM A;  3TAP A;  1W7A A;  3N4Q A;  4DUY K;  4F2S A;  4KH4 A;  2E1Z A;  2YV0 X;  1BQM A;  3SYZ A;  4CHO A;  5DM6 L;  4JI7 K;  1VSH A;  1VSD A;  4Y0W A;  3KLI A;  5JVG L;  3LP2 A;  4H0O A;  4BRD A;  4YOY A;  4ILG B;  3D2E A;  1HUX A;  4M3Y A;  4WQ4 C;  1JL1 A;  5BN9 A;  2EWS A;  3DLL L;  3SZ2 A;  3MX5 A;  4K42 A;  2CH5 A;  4FM0 A;  2I7P A;  4IG3 A;  3NGI A;  2IDO A;  3G71 N;  2KQ2 A;  3U9D A;  3AVG A;  3UIQ A;  2V7Z A;  4BEB A;  3SAF A;  2P9N A;  2XY6 A;  1ZBL A;  2IS3 A;  1O1W A;  1BIZ A;  2Y1I A;  3HO1 A;  4OKE A;  3EKU A;  2W00 A;  1XI1 A;  4PKH A;  5F0X A;  4DV7 K;  3EL2 A;  4BR2 A;  4OKJ A;  4FJ8 A;  5GIN A;  3WT0 A;  4MDB A;  4G1Q A;  1GLC G;  2HND A;  4B08 A;  3D0P A;  1S72 N;  5AQV A;  3VQ6 A;  3PO4 A;  3THY B;  2P9K A;  3I0R A;  1VQ5 N;  3HBT A;  3V4I A;  1J53 A;  1C0T A;  4MQ3 A;  2VG7 A;  2A1R A;  4JS4 A;  4CJL A;  3SV4 A;  3CCQ N;  4FWM A;  5C15 A;  2IVN A;  2UUB K;  4PUO A;  5KTQ A;  3RVC A;  3B6O A;  1LAW A;  1TAQ A;  1CZ9 A;  3ZEU B;  5E84 A;  2OA8 A;  3OYD A;  4MFB A;  1NBW A;  3TAR A;  3OVN A;  4GKK K;  5JLH A;  1KTQ A;  1M90 O;  3PX6 A;  4UY8 O;  3P4I A;  4JD2 B;  1TYQ A;  2DFE A;  4K43 A;  1U47 A;  4X62 K;  1BCM A;  4I2Q A;  2KLA A;  1WAF A;  5KPT A;  3QES A;  1U2V B;  4C23 A;  3VQ5 A;  4Z94 A;  4LH5 A;  1HLU A;  3KK2 A;  3SQ0 A;  3M3Z A;  1Q82 O;  3F9K A;  3JYT A;  5C25 A;  2NRW A;  2F9W A;  4JI6 K;  3I33 A;  4B9L A;  4O0I A;  1YTA A;  2E2Q A;  4ZTJ A;  3ZX2 A;  4DF8 A;  5CE3 A;  4CD1 A;  4MLE A;  2YHB A;  4PKG A;  5AQY A;  3VQD A;  2G8I A;  3L2V A;  4JI4 K;  2HNZ A;  2A40 A;  4FXD A;  2HVI A;  2A5X A;  1BA0 A;  3CCE N;  2O8C A;  2P51 A;  4CZF A;  3NE6 A;  1L3T A;  1YT3 A;  3CJC A;  2UXC K;  4B1U B;  4B9T A;  3P39 A;  1SL2 A;  1XMO K;  1IBK K;  2QWO A;  1VSJ A;  3WEE B;  2KW4 A;  4RG8 A;  3U4L A;  1GLF O;  1ZBI A;  1V4T A;  2IVP A;  1HX1 A;  4K41 A;  4BRF A;  3BF3 A;  4DLE A;  4H4M A;  2IVO A;  2HHU A;  4I6M A;  4DV2 K;  5AQF A;  2D0P A;  1BU6 O;  3C7N B;  3TU5 A;  3KLE A;  3NH2 A;  1W9H A;  2X6N A;  4PKI A;  4BQZ A;  3AGR A;  2KFN A;  1Q81 O;  3S3O A;  4F2R A;  1VSI A;  2F9T A;  3KWG A;  2A41 A;  5C24 A;  3AVN A;  3PSF A;  4M7Y A;  2ZE2 A;  1QZ6 A;  3SPY A;  3NHG A;  1OH7 A;  2FBY A;  2QWL A;  1SKS A;  1VQN N;  3OA9 A;  2IIR A;  3R1X A;  4M41 A;  4KH5 A;  3LM9 A;  2P5G A;  3MWT A;  3ZCM A;  3CQY A;  1VK0 A;  1C0M A;  3HPG A;  3K5O A;  5AQJ A;  3DOK A;  3HPO A;  3I56 N;  2HHH K;  3MED A;  3CM5 A;  3UB5 A;  1NLV A;  5JEN A;  2BDP A;  3UKR A;  3VF4 A;  3SJJ A;  3O8M A;  4DQP A;  4R79 A;  4LFC K;  3GOI A;  1BL3 A;  1KAX A;  1SAZ A;  3WNE A;  4QAG A;  3R8E A;  3RMB A;  1CZB A;  4FJJ A;  3O9S A;  1BCO A;  3DAW A;  2YNF A;  4DWI A;  1K8K B;  1D9F A;  2P9I A;  5AQG A;  3CJ9 A;  3ATU A;  3ZET B;  5KGX A;  3SLC A;  2FBX A;  3TAM A;  3CD6 N;  2VG6 A;  5AQW A;  2HF4 A;  2EHG A;  5CZ2 A;  2D0O A;  3AVM A;  2E8A A;  3ZSO A;  1FW6 A;  1E4G T;  1VQ9 N;  3J80 O;  4PY5 A;  3KLG A;  3NMU A;  1OH6 A;  4ELT A;  3QLH A;  2E6L A;  2OPP A;  1JLQ A;  3HRG A;  4PA1 A;  3SK3 A;  4IO8 A;  5J2P A;  2XY8 A;  2F96 A;  4DTR A;  3AO2 A;  3VEY A;  5AZI B;  3E66 A;  4W5Q A;  1ESV A;  3BDP A;  3ID8 A;  2D5R A;  3ENB A;  4BE2 A;  3QEI A;  2LSN A;  2ZQB A;  4E3S A;  2BUP A;  1M1K O;  3CC7 N;  5AQT A;  5ADX H;  4LF8 K;  1IBL K;  4CJQ A;  4DV5 K;  1S1U A;  4BR0 A;  2OAN A;  3AA4 A;  4BR5 A;  2D1K A;  3J8A A;  5SZT A;  4FYD A;  1YIJ N;  3P1G A;  3VEV A;  1GLJ O;  1RBR A;  4IZ9 A;  4CW7 B;  4KHP K;  1NK5 A;  3ZSV A;  1NGD A;  5AQK A;  4B1Z A;  4FLY A;  2WFB A;  4DSL A;  3J7Z O;  1NJX A;  1RT2 A;  1U6Z A;  1X9W A;  1JLG A;  3P31 A;  1P8Z A;  1TL3 A;  2OPR A;  3FE1 A;  2XRI A;  1DTQ A;  5HP1 A;  3SUP A;  3AO1 A;  3O9R A;  3ZSR A;  4R5P A;  3O3H A;  1EET A;  3CCR N;  4YDU C;  3L2U A;  4DR2 K;  4N76 A;  3V9X A;  3VEO A;  5ADX A;  4X65 K;  3PX4 A;  2HHS A;  1B9F A;  5J2M A;  4JKG A;  3D45 A;  3OYM A;  2E6M A;  3H1V X;  1VRU A;  3QBW A;  3ZSQ A;  3VQ8 A;  3D2F B;  3IKM A;  3WNF A;  3KD1 E;  3KVG A;  1S9G A;  1TKX A;  5FDL A;  3NH0 A;  1JXE A;  4ICL A;  4CEA A;  3O3F A;  4FWO A;  3AVK A;  5AQU A;  1QE1 A;  4FJ9 A;  1ZYQ A;  3TAG A;  3BZK A;  1GLE G;  3ISN C;  3MDQ A;  1VHX A;  2B5J A;  3SBT A;  2YCH A;  1KQS M;  3VEX A;  2YX6 A;  2E2N A;  2UU9 K;  4DG1 A;  4H5V A;  1C0G A;  3J7Y P;  4FOE A;  2P9L B;  4XH4 A;  3DI6 A;  3TTF A;  4LD0 A;  1TKT A;  1ASU A;  3DLG A;  4J2E A;  3KLH A;  1VQO N;  1K73 O;  4NXN K;  1J54 A;  4OO1 J;  1YHQ N;  2X6S A;  3MWP A;  3AGK A;  5ELZ A;  1NGA A;  1IG9 A;  3ZX3 A;  1QZ5 A;  1K9M O;  3BEX A;  5EOY A;  2A6A A;  2VGN A;  3S9H A;  4E19 A;  4IG0 A;  4RW8 A;  3VER A;  3C94 A;  4H4O A;  3DOL A;  3NCI A;  3C6U A;  4J8F A;  4CJF A;  3TTD A;  1VQL N;  4BRL A;  3QER A;  4BG8 A;  5JLF A;  1KFS A;  3HM9 A;  2I5J A;  4CJP A;  3ASM A;  1NU0 A;  4YOR A;  3V1R A;  1ZXO A;  2YJE A;  2W42 A;  4KAZ A;  4B8A B;  1RT7 A;  1W2B M;  4FJN A;  3QNO A;  4H5R A;  5JMV A;  5CZ1 A;  5TKY A;  4KHQ A;  2X74 A;  1WBB A;  3D7E O;  4I9Q A;  1RT1 A;  2IC3 A;  3J81 O;  2WOM A;  3DXM A;  5LJV A;  4V19 S;  3VES A;  5EXW A;  4N41 A;  3NF6 A;  3HZ6 A;  2KZZ A;  3CYG A;  2FC0 A;  4EZ9 A;  4EZ6 A;  1RDA A;  2Q1N A;  3IUC A;  2C1G A;  2YJF A;  1C1A A;  1CXU A;  1RDC A;  4LC9 B;  4DKW A;  1QSL A;  3V6D A;  4H0V B;  5AQZ A;  3GDQ A;  5H1S Q;  3VF2 A;  4BRA A;  3T19 A;  4DTO A;  4IBN A;  5BN8 A;  3SPZ A;  4CEZ A;  2G8F A;  1T6D A;  3FGU A;  4H8K A;  4HCC A;  1VSK A;  2OCE A;  3SUN A;  5AQR A;  4E7H A;  5K14 A;  1MU2 A;  4M3T A;  1H1V A;  1LWF A;  3HT3 A;  1KCF A;  3D2E B;  3KK7 A;  4CGI A;  5AZJ A;  4I2P A;  4JI5 K;  1NK4 A;  4EHT A;  2KFZ A;  1IKX A;  2V52 B;  2UXD K;  3OYC A;  1NOY A;  4LF4 K;  4J2B A;  3WXJ A;  4CE9 A;  4CK1 A;  3LWM A;  2P9N B;  1HQU A;  3ULE A;  3BZC A;  3RRH A;  3K9J A;  4Z4E A;  2GUP A;  1DT9 A;  3WNG A;  3Q7C A;  4CJS A;  4WF9 L;  4KHN A;  3CCV N;  5GAD P;  4BG9 A;  3SI6 A;  5J1E A;  4YOT A;  4FLX A;  2ZD1 A;  2YKM A;  3MN6 A;  4FJ7 A;  4BR9 A;  4ILH A;  4BRC A;  4OPA A;  1RDU A;  4FVU A;  5JVH L;  3P5J A;  4W5N A;  1W0H A;  4CFC A;  3CFO A;  4CGD A;  4IJA A;  5KGW A;  1U48 A;  2CH6 A;  3AA2 A;  3SUQ A;  2CGK A;  3O9U A;  3A5L C;  3ZSZ A;  3CF5 L;  1GLA G;  3S5T A;  1HKC A;  4KHU A;  4CZL A;  4B8C A;  2Q36 A;  3KKR A;  3M5R A;  4FWK A;  1G99 A;  4CF1 A;  5EVZ A;  1RBS A;  3QEW A;  4JKB A;  5LMU K;  3CCL N;  1JCE A;  4CZE A;  5AQX A;  1VRT A;  3OJU A;  4F3O A;  3L3V A;  3VGL A;  1NWK A;  4JNE A;  4AF1 A;  3LDO A;  1Z05 A;  2ZJR L;  1LOT B;  4QS9 A;  2OPS A;  4CF9 A;  2NRV A;  4QS7 A;  3K5L A;  4DV0 K;  2PZS A;  2E20 A;  3A5M C;  3VQB A;  1LWC A;  3RRG A;  4BC4 A;  1J9A A;  1YVU A;  4AHT A;  3SCX A;  2Q31 A;  1P90 A;  1RTH A;  2IAJ A;  1K6Y A;  1JL2 A;  2D0B A;  4JK9 A;  4Z0U A;  5LJW A;  4FWS A;  3CQX A;  3RSE A;  2O8C B;  3A5O C;  4DLG A;  2GBZ A;  2XHB A;  3AVF A;  4BY9 C;  3QO9 A;  1BI4 A;  4CER A;  1NKC A;  4JS5 A;  2F8T A;  4FK0 A;  3VTH A;  1REV A;  1XUP O;  4BQL A;  4KHS A;  3MCA B;  4LH4 A;  2BH1 A;  2UYT A;  2RF2 A;  3CJA A;  3AVI A;  4JEP A;  4I6M B;  2G8H A;  1NGI A;  1IO2 A;  1L5U A;  1BIU A;  4JV5 K;  3VF6 A;  1XHX A;  4AHV A;  2Z1H A;  1X3N A;  3AY9 A;  5M1F A;  4WYB A;  4CBU A;  3DLK A;  2FF6 A;  4CJ7 A;  2WUS A;  4M3W A;  1ZBU A;  2WBN A;  4CZK A;  4CJ5 A;  4L3Q A;  3AA5 X;  2XY7 A;  1HRH A;  3QB0 A;  4PL7 A;  2I7N A;  4HHT A;  3E9P A;  4CIE A;  4NB4 A;  1NGC A;  3E9O A;  5LMN K;  5BPN A;  2VWB A;  4HWI A;  4CHN A;  1T03 A;  2Q0U A;  1YIT N;  4GW6 A;  3CQ8 A;  5GAG P;  5BRH A;  2CGJ A;  4DSJ A;  4M3X A;  4WFA L;  3EE9 A;  1D9D A;  4JKF A;  3FFK B;  1HYZ A;  4Z4H A;  3AO3 A;  3E1Y A;  1WAJ A;  3DLR A;  3UKU A;  3LAL A;  1W97 L;  3H08 A;  4A2B A;  5IWA K;  2KZM A;  5CYQ A;  2BTF A;  2E88 A;  3LAN A;  2NRH A;  4N56 A;  3CCJ N;  4B3R K;  3DLH A;  1XMQ K;  4FLU A;  4JK7 A;  5SWM A;  4FWQ A;  4CGG A;  5CR4 A;  2QW9 A;  4XIU A;  2NRT A;  1IKV A;  1S22 A;  5LL6 Z;  5BR8 K;  3JSM A;  1EWQ A;  1WSE A;  1D5A A;  3V9U A;  2W40 A;  1TKD A;  3E01 A;  4NCB A;  3DRR A;  4DHY A;  3IMX A;  1X9M A;  4HVJ A;  4E0D A;  4JI3 K;  5FRO A;  4A2A A;  4KHY A;  4CZG A;  4GKJ K;  4CF0 A;  4JYA K;  5M1P A;  1B9D A;  2HNY A;  4W5T A;  4DTX A;  3LP1 A;  2QXF A;  4G9Z A;  2O4I A;  1RDD A;  3QNN A;  1Z6R A;  3F9M A;  4BE0 A;  3DM2 A;  1OVY A;  4FJX A;  2G8U A;  2ZJQ L;  4O8U A;  3TAE A;  4GV9 A;  3DRP A;  5F1X A;  3K2P A;  3QEX A;  1KVB A;  1FKP A;  5C12 A;  4OJR A;  4CHY A;  1RBT A;  4JHD A;  4YOW A;  4QCL A;  4JK8 A;  2O4G A;  1Y97 A;  4CIF A;  2Z1J A;  4JI0 K;  1I3A A;  3C95 A;  3L3U A;  1L3S A;  1QSY A;  4FZZ A;  4FWN A;  1SL0 A;  5GIO A;  1S5J A;  1GLB G;  4CZH A;  4B3T K;  3MEG A;  3VQA A;  1NJI O;  3QML A;  4U7B A;  3WXL A;  2ASO A;  4ID1 A;  4B9U A;  3V81 A;  4C1N K;  1ZBH A;  4BRO A;  2WTU A;  2Y1J A;  1SQK A;  4CES A;  1RT5 A;  2BE2 A;  1KC8 O;  1WUA A;  4XEI A;  3OBY A;  4NXM K;  3JXU A;  2OTJ N;  4JKG B;  3ZSY A;  4B9N A;  2RPI A;  4H0T B;  4WQ5 C;  4FO0 A;  4AIL C;  4IJN A;  4KKO A;  2ASP A;  5KPZ A;  4DSE A;  2YHX A;  5HBM A;  3B8A X;  2O8F B;  1O13 A;  3OYH A;  5GAE P;  1BDG A;  3HL8 A;  4MO5 A;  4CJR A;  3S41 A;  4CBX A;  3VQP A;  4WQ4 A;  3WQU A;  3KLF A;  4FWL A;  2HMP A;  5LY3 A;  4ZHR A;  1U4B A;  1TL1 A;  3Q7B A;  4BEC A;  3TTC A;  1NNE A;  2P9S B;  3C6A A;  4BRQ A;  3WXI A;  3PIO L;  4XH5 A;  4WE1 A;  1RT4 A;  3VQ7 A;  3U9Z A;  3AV9 A;  4M63 C;  4FJM A;  1JJ2 M;  3TAQ A;  3CJB A;  4AM7 A;  4DF4 A;  2GTD A;  1D4X A;  4BWJ A;  1QQO A;  2HW3 A;  3H6E A;  4BC2 A;  4IXC A;  3CG7 A;  3CFR A;  2HBM A;  1RTI A;  1Y64 A;  4CK3 A;  3THY A;  1SKW A;  4Y1D A;  4BGA A;  1RDW X;  4BRI A;  3O4N A;  3AO4 A;  1Z25 A;  3NF9 A;  4WFB L;  3OYB A;  4BR4 A;  4AQY K;  4CHQ A;  4DS5 A;  3QIO A;  3ZT4 A;  1BO5 O;  4ELV A;  2HBK A;  4CED A;  5GIP A;  4DQ8 A;  4OLA A;  3DLE A;  1MDU B;  4O44 A;  4CEC A;  5BRF A;  2HHQ A;  4BDP A;  3MN7 A;  4DMN A;  3MEE A;  4C8K A;  2VGM A;  5KQD A;  3SMS A;  4FSV A;  3E9L A;  4CEB A;  2W6K A;  5AQL A;  3T1Y K;  5AJ3 K;  4JD2 A;  4DSF A;  2HST A;  2RE2 A;  1QS4 A;  3FZL A;  5AFU H;  2FXU A;  3FFI A;  3G10 A;  4OPJ A;  2ETJ A;  3K57 A;  1NG9 A;  2A1S A;  4E7K A;  3NVM A;  3PLA A;  1BIS A;  3DXM B;  3I8D A;  3FZK A;  4RW6 A;  1U2V A;  4DFJ A;  3RWU A;  2ZJP L;  3VGM A;  3M8R A;  5AQM A;  3AAQ A;  5IT9 O;  4DQS A;  4IFY A;  2O8B A;  1HJR A;  4OKK A;  4JKE A;  1T6C A;  2Q3S A;  2F8S A;  1JLE A;  2NZT A;  4CGH A;  2PFU A;  1YJW N;  1T3V A;  4IDK A;  4FLZ A;  2O8D B;  3O6W A;  3WQT A;  3I8B A;  1QQC A;  3LDL A;  2Z1I A;  1LAV A;  5J2N A;  3QIN A;  3B6P A;  4FZX C;  4KRF A;  2QWN A;  3RR8 A;  1RFQ A;  5AFU A;  2HHV A;  2VWK A;  3HVT A;  1OKJ A;  4LF7 K;  4JKD A;  1WBD A;  3JAM O;  1ZBF A;  3VOV A;  1N33 K;  1E3M A;  3MCP A; 
#chains in the Genus database with same CATH homology
 1HUX A;  3ZX0 A;  2NLX A;  4WQ4 C;  4EAH D;  4EHT A;  5FPN A;  5BN9 A;  4H0Y B;  1QVF M;  2V52 B;  2EWS A;  3DLL L;  4RWT A;  3WXJ A;  3L0Q A;  3O9Q A;  3MX5 A;  4JKC A;  4K42 A;  2CH5 A;  2I7P A;  4BRH A;  4NLB A;  2Q2R A;  3EO3 A;  3L6Q A;  2P9N B;  3G71 N;  4A5B A;  3ULE A;  1QVG M;  3CCS N;  3U9D A;  5TKW A;  2QI2 A;  2V7Z A;  4BEB A;  5M1Q A;  2P9N A;  3H3O B;  4YOU A;  3K9J A;  3SAF A;  4EFH A;  2GUP A;  2E1Y A;  1DT9 A;  2V51 B;  5C2F A;  3Q7C A;  4U67 L;  1LCU A;  3EKU A;  2W00 A;  1NGF A;  3HOS A;  1SZ2 A;  3R6M A;  4WF9 L;  3CCV N;  4PKH A;  4BG9 A;  5F0X A;  4E1J A;  5GAD P;  4GVE A;  3EL2 A;  4PL8 A;  3CET A;  4YOT A;  4BR2 A;  4FOI A;  3A8Y A;  4FPB A;  4BVO A;  5GIN A;  3MN6 A;  3SJH A;  2F7T A;  3WT0 A;  4MDB A;  1K8A O;  4BR9 A;  4ILH A;  1GLC G;  4BRC A;  1BG3 A;  1S72 N;  4OPA A;  1RDU A;  5AQV A;  4FVU A;  5JVH L;  3FLC O;  4CD3 A;  2HBL A;  3HM8 A;  2P9K A;  3R9P A;  3UE5 A;  1VQ5 N;  1BUP A;  3HBT A;  4IJA A;  5JIC A;  3KZB A;  1GLL O;  2CH6 A;  3O9T A;  1ATS A;  2JWK A;  2CGK A;  3O9U A;  3A5L C;  3CHW A;  3CMA N;  4GY2 B;  4JAX A;  3CCQ N;  3CF5 L;  4FWM A;  5C15 A;  2IVN A;  1GLA G;  4B1X B;  4M7X A;  1HKC A;  3RVC A;  4IOX A;  4CZL A;  2Q36 A;  3M5R A;  3ZEU B;  5E84 A;  5M1O A;  3PIP L;  5F2R A;  4FWK A;  1G99 A;  1NBW A;  5FPD A;  3EN9 A;  4BRG A;  2NRR A;  5EVZ A;  3ZEU A;  5JLH A;  1M90 O;  5C2D A;  3H3N O;  3VEW A;  4UY8 O;  4JKB A;  3SMP A;  1NGG A;  3P4I A;  1NGB A;  4JD2 B;  1JCE A;  4CZE A;  3CCL N;  5AQX A;  1K8K A;  5AQP A;  1TYQ A;  4BR7 A;  3VGL A;  1NWK A;  4JNE A;  1HJO A;  3MN5 A;  4K43 A;  3H45 C;  4AF1 A;  3ZET A;  3LDO A;  4IOC L;  1Q86 O;  1Z05 A;  2VYP A;  2ZJR L;  1X9J A;  3G25 A;  2KLA A;  1LOT B;  2HF3 A;  4QS9 A;  5KPT A;  5KQ8 A;  1U2V B;  2NRV A;  4C23 A;  3O1B A;  1QHA A;  3LM2 A;  4Z94 A;  1HLU A;  1JCF A;  4QS7 A;  4OPH A;  2AA4 A;  3M3Z A;  2E20 A;  1Q82 O;  3A5M C;  3AAP A;  5AQQ A;  2NRW A;  2F9W A;  4BC4 A;  3JS6 A;  3O80 A;  2ITM A;  2E2P A;  3I33 A;  4A61 A;  3VEZ A;  2E2Q A;  4H5N A;  3ZX2 A;  2Q31 A;  1SS6 A;  1P90 A;  5CE3 A;  4H5T A;  4CD1 A;  4MLE A;  4JK9 A;  1NGH A;  4CZJ A;  5LJW A;  4ILJ A;  1YJ9 N;  3ATV A;  4FWS A;  3CQX A;  1HKB A;  4PKG A;  5AQH A;  3D6R A;  5AQY A;  3RSE A;  3CME N;  2FSN A;  2A40 A;  3A5O C;  5AZI A;  1NMD A;  3ENH A;  1VQM N;  2GEL A;  2WC9 A;  1NM1 A;  5AQI A;  1NGE A;  2A5X A;  1BA0 A;  2GEM A;  3CCE N;  3DJC A;  2CGL A;  2QWP A;  4CZF A;  4BY9 C;  1QQN A;  3CJC A;  5BRD A;  3KWI A;  1IJJ A;  3VTH A;  1XUP O;  4BQL A;  5AZJ B;  4B1U B;  3L4Q A;  3P39 A;  2QWO A;  3MCA B;  3WEE B;  2FSK A;  1DEJ A;  2BH1 A;  5EY4 A;  4RTF D;  3U4L A;  1GLF O;  2UYT A;  1V4T A;  3CJA A;  2IVP A;  4JEP A;  3WEE A;  1HX1 A;  1YAG A;  4I6M B;  4K41 A;  1YF5 L;  3HI0 A;  3FZM A;  1KD1 O;  1NGI A;  2QTD A;  4BRF A;  3BF3 A;  4H0P A;  3QFU A;  2IVO A;  4MO4 A;  4I6M A;  3G4S N;  5AQF A;  4BRN A;  2D0P A;  1BU6 O;  3C7N B;  3SAG A;  3VF6 A;  3TU5 A;  4WCE L;  4IEI A;  4PKI A;  1VQ4 N;  3KHY A;  4BQZ A;  3AGR A;  1X3N A;  3C7N A;  3AY9 A;  5M1F A;  1Q81 O;  3CPE A;  4WYB A;  2V7Y A;  3ULE B;  4DCH A;  4BRM A;  4CBU A;  3HOT A;  1QQM A;  2FF6 A;  4NO7 A;  2F9T A;  4CJ7 A;  4BRK A;  2WUS A;  3KWG A;  2A41 A;  4PHT X;  3VMF B;  3BP8 A;  2WBN A;  5GAH P;  4HTL A;  4M7Y A;  4ISE A;  4CZK A;  1QZ6 A;  4L3Q A;  1V4S A;  2Q0R A;  4GV3 A;  2QWL A;  4PL7 A;  3QB0 A;  3G6E N;  3OHR A;  4FWR A;  2I7N A;  1VQN N;  5AQS A;  3E9P A;  4NB4 A;  1NGC A;  5BRE A;  2NNW A;  3OA9 A;  2IIR A;  2PAV A;  3R1X A;  3E9O A;  4KH5 A;  3GG4 A;  3LM9 A;  1ATR A;  3MWT A;  5BPN A;  2VWB A;  3O08 A;  4HWI A;  4YDU A;  3CQY A;  1WOQ A;  2P9K B;  2NRX A;  3L4I A;  5AQJ A;  4WQ5 A;  3I56 N;  2QEX N;  2QM1 A;  4EHU A;  2Q0U A;  1YIT N;  4MLH A;  3UB5 A;  1NLV A;  3CCU N;  5GAG P;  3DXK B;  3UKR A;  3VF4 A;  5BPL A;  1IG8 A;  3U8X A;  3IDH A;  5BRH A;  3MX2 A;  4F9O A;  3O8M A;  2CGJ A;  2ZF5 O;  4XJX A;  1GLD G;  3DXK A;  1DKG D;  4R79 A;  2D4W A;  2P9S A;  3GOI A;  1VQK N;  2GWJ A;  3GL1 A;  4B1W B;  1KAX A;  2AP1 A;  4KBO A;  1SAZ A;  4WFA L;  1Q18 A;  1ILY A;  3EE9 A;  3R3L A;  4JKF A;  3R8E A;  3FFK B;  2FF3 B;  3E1Y A;  3VEN A;  5CHI A;  5KPR A;  3O9S A;  3UKU A;  1W97 L;  3DAW A;  4A2B A;  2BTF A;  2E88 A;  2PBD A;  2NRH A;  1K8K B;  2QWM A;  3CCJ N;  4JKA A;  1TYQ B;  2P9I A;  5AQG A;  3CJ9 A;  3ATU A;  4H5W A;  3ZET B;  4JK7 A;  2ZGZ A;  3F2K A;  3SLC A;  5DM7 L;  3CD6 N;  3M1F A;  1VQP N;  5AQW A;  4CZI A;  2HF4 A;  1N8R O;  4FWQ A;  2VCP A;  2D0O A;  2E8A A;  3TPQ A;  5CR4 A;  2QW9 A;  2NRT A;  1E4G T;  3T69 A;  1TUU A;  4BVP A;  3HTV A;  1VQ9 N;  3GE1 A;  1VQ6 N;  1BWF O;  1S22 A;  3NMU A;  3IFR A;  1T44 A;  4FPA A;  3LDQ A;  3DWL A;  3HSC A;  1ATN A;  3K9K A;  3CC2 N;  3HRG A;  3SK3 A;  2W40 A;  2Q97 A;  4IO8 A;  4DHY A;  4IOA L;  3IMX A;  3QIC A;  3BUZ B;  4B1V A;  4A2A A;  3WXM B;  4CZG A;  3RSE B;  1YJN N;  2HOE A;  1RGI A;  3VEY A;  5M1P A;  5AZI B;  3E66 A;  1ESV A;  4G9Z A;  3ENO A;  3CJ1 A;  3H1Q A;  3MK6 A;  3ID8 A;  3FR0 A;  3ENB A;  1Z6R A;  4A57 A;  1ZC6 A;  2E2O A;  3F9M A;  1BOT O;  3NVK A;  4O5F A;  5BR9 A;  2BUP A;  1M1K O;  1OVY A;  5AQT A;  3ZYY X;  3CC7 N;  5ADX H;  3VGK A;  3MMV A;  1R59 O;  2ZJQ L;  2QXL A;  4O8U A;  4GV9 A;  2ZGY A;  2QWR A;  4FWP A;  4ISF A;  4JHD B;  5F1X A;  4IDH A;  1YI2 N;  3O4W A;  4BR0 A;  4FL9 A;  5C12 A;  2OAN A;  2GX9 A;  1X3M A;  3EZW A;  4BR5 A;  2D1K A;  3J8A A;  4JHD A;  4JK8 A;  5BPM A;  4YOW A;  1YIJ N;  5MLC Q;  3VEV A;  3M6G A;  1GLJ O;  3QBX A;  4FWN A;  4IZ9 A;  3BF1 A;  5GIO A;  1GLB G;  3GBT A;  4CZH A;  2J4R A;  2QA4 N;  1NJI O;  1NGD A;  3QML A;  4A59 A;  4U7B A;  1EO1 A;  5AQK A;  3WXL A;  4B1Z A;  1YVN A;  2ASO A;  3TSP A;  2WFB A;  3J7Z O;  1HKG A;  1U6Z A;  4IO9 L;  2C1I A;  1EQY A;  4C1N K;  3FZF A;  3ID6 A;  3LDP A;  3P31 A;  4BRO A;  2P9P B;  1P8Z A;  3A5N C;  1SQK A;  3FE1 A;  3VPZ A;  1KC8 O;  1WUA A;  4CBW A;  3QDK A;  2P9P A;  3OBY A;  3O9R A;  4XEI A;  3JXU A;  2OTJ N;  1E4F T;  4JKG B;  4YDU C;  3LL3 A;  1JCG A;  3CCR N;  1MWM A;  1XC3 A;  4H0T B;  2A3Z A;  2W41 A;  3D2E A;  4WQ5 C;  3VEO A;  4EIA A;  5ADX A;  4FO0 A;  4JKG A;  4IJN A;  3WUH A;  2ASP A;  5KPZ A;  3WXK A;  2YHX A;  3H1V X;  4A62 A;  3QBW A;  3VET A;  3B8A X;  1O13 A;  2FSJ A;  3D2F B;  3IKM A;  3O5B A;  1VAZ A;  3KVG A;  1BDG A;  2GWK A;  5GAE P;  2ASM A;  4MO5 A;  3EKS A;  4IFE A;  3D2F A;  4YOX A;  4FWO A;  2NRZ A;  3S41 A;  4B1Y B;  4CBX A;  1VQ8 N;  5AQU A;  4WQ4 A;  3WQU A;  3A0I X;  3UKR B;  4FWL A;  2HMP A;  5FPE A;  5LY3 A;  1GLE G;  3MDQ A;  5HOO A;  3Q7B A;  3EE8 A;  3SBT A;  3TTC A;  5HL7 L;  2YCH A;  4BEC A;  2P9S B;  4BC3 A;  4A5A A;  1KQS M;  3C6A A;  5E26 A;  2ZWH A;  3VEX A;  3QFP A;  2YX6 A;  2E2N A;  2RHK A;  3WXI A;  4XH5 A;  4BRQ A;  3PIO L;  3FZH A;  3TSU A;  4BC5 A;  4H5V A;  3SBG A;  1C0G A;  3U9Z A;  1VQ7 N;  4BE7 B;  3CJ7 A;  4FOE A;  4H0X B;  3LDN A;  4BRP A;  1KAZ A;  2P9L B;  4XH4 A;  5I9E B;  4M63 C;  3UKU B;  4YOV A;  1JJ2 M;  3I55 N;  3TTF A;  3CPW M;  2H3G X;  3CJB A;  4AM7 A;  1K73 O;  2GTD A;  1VQO N;  2P9L A;  4WFN L;  3OW2 M;  4OO1 J;  1D4X A;  2JWL A;  1YHQ N;  2P9I B;  3C6H A;  3MWP A;  4KH6 A;  3AGK A;  4MDA A;  2KHO A;  1NGA A;  1QQO A;  5ELZ A;  1KXP A;  3ZX3 A;  4ISG A;  3H6E A;  2QWQ A;  4IXC A;  3VTI A;  4BC2 A;  2HBM A;  1QZ5 A;  1Y64 A;  1K9M O;  4BGA A;  1RDW X;  3BEX A;  4BRI A;  1XQS C;  5EOY A;  2A6A A;  2VGN A;  1NGJ A;  5C0Y A;  5C10 A;  3VER A;  4WFB L;  1MA9 B;  3TSQ A;  4BR4 A;  3CI5 A;  2HBJ A;  5AQN A;  1BO5 O;  5AQO A;  5M1N A;  2HBK A;  5GIP A;  4DQ8 A;  3MN9 A;  4GNI A;  1S3X A;  1HPM A;  1YUW A;  4J8F A;  1MDU B;  4DB3 A;  3TTD A;  1VQL N;  3CIP A;  4BRL A;  5B8H A;  5BRF A;  4NLC A;  3MN7 A;  4BG8 A;  4IWV A;  5JLF A;  2VGM A;  2KKZ A;  4B9Q A;  3SMS A;  5KQD A;  2P9U B;  4FSV A;  3E9L A;  5AQL A;  3H46 O;  4YOR A;  2YHY A;  1ZXO A;  3C0B A;  4JD2 A;  5EX5 A;  2P9U A;  2HST A;  2YJE A;  2RE2 A;  3FZL A;  3OBW A;  1YXQ A;  2FXU A;  5AFU H;  1Q7Y O;  4C1N I;  1W2B M;  5AR0 A;  4H5R A;  5FPM A;  5JMV A;  4O8K A;  5TKY A;  2YI1 A;  4CI6 A;  3NVM A;  3P38 A;  3PLA A;  4K25 A;  3DXM B;  1C0F A;  1KAY A;  3FZK A;  2YHW A;  3D7E O;  1U2V A;  5LJV A;  3DXM A;  4JKH A;  2ZJP L;  3VES A;  5EXW A;  3VGM A;  1J6Z A;  5AQM A;  3AAQ A;  4H03 B;  3CXC M;  4BGB A;  3O1W A;  3W3D A;  3HZ6 A;  1DGK N;  3T7Z A;  4JKE A;  1T6C A;  4QS8 A;  3CC4 N;  2Q1N A;  1TUY A;  3IUC A;  3C65 A;  2C1G A;  2YJF A;  2NZT A;  4AM6 A;  4DKW A;  4LC9 B;  2PFU A;  4BRE A;  1YJW N;  4GV6 A;  1T3V A;  1ZBS A;  4H0V B;  5AQZ A;  3GDQ A;  3O6W A;  3WQT A;  5H1S Q;  5M1K A;  3I8B A;  3VF2 A;  2OTL N;  2A42 A;  4BRA A;  3LDL A;  2DPN A;  5BN8 A;  3CCM N;  3F5T A;  4CZM A;  3SAH A;  1T6D A;  2QWN A;  4JN4 A;  3FGU A;  1BA1 A;  1CZA N;  1RFQ A;  3N4Q A;  5AFU A;  5AQR A;  4XH1 A;  3W0L A;  3AAR A;  4RCH A;  1OKJ A;  4KH4 A;  2E1Z A;  3CER A;  4IEE A;  1H1V A;  4JKD A;  5DM6 L;  4Y0W A;  3KK7 A;  3D2E B;  3VOV A;  1MWK A;  5AZJ A;  5JVG L;  4H0O A;  3MCP A;  3N4P A;  4BRD A;  4YOY A;  4ILG B;  2FLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...