3UKRB

Crystal structure of bos taurus arp2/3 complex with bound inhibitor ck-666
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
193
structure length
193
Chain Sequence
GVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structural characterization and computer-aided optimization of a small-molecule inhibitor of the Arp2/3 complex, a key regulator of the actin cytoskeleton.
pubmed doi rcsb
molecule tags Structural protein
total genus 54
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ukrB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3ukrB02
1GLLO 5BREA 3D2EB 3BUZB 5ADXH 3EKUA 4H0VB 2A3ZA 4KBOA 3HI0A 4BRFA 3FE1A 4BRAA 2VCPA 1YXQA 2E1YA 3HM8A 4HWIA 5AQQA 4CZHA 5AQYA 4BG8A 5AZJB 2FLOA 3D2FA 1C0FA 1NGAA 3FGUA 3BF1A 1RGIA 4MO4A 3M6GA 1BG3A 5AQNA 4BR9A 4DCHA 1V4SA 3SK3A 3U8XA 1JCEA 3GDQA 3DWLA 4PKIA 2OANA 3GL1A 5BRDA 3O08A 1NM1A 3ATVA 3DXKB 4XH4A 1BUPA 1EQYA 1KAYA 2Q0RA 3O8MA 4FWMA 4NB4A 4EHTA 1K8KA 2FXUA 2I7NA 3LM2A 4B1ZA 3EN9A 4CD3A 4FWQA 4CZEA 3VEXA 1XQSC 2EWSA 5KQ8A 4K41A 3FZHA 4IJAA 2NLXA 3DAWA 3UB5A 1TYQB 2YJEA 4BVPA 4H0PA 1HUXA 2DPNA 2E2NA 5KPRA 3DXMB 4MLEA 4WQ4A 5BPLA 5BRFA 4BGAA 1BA1A 3QDKA 3SLCA 2V7YA 5E26A 3LDLA 4CZLA 2E2QA 3M1FA 5FPDA 4YDUA 1HPMA 3IDHA 1QQNA 3O4WA 4BRGA 1XUPO 4WYBA 1ZXOA 2IVNA 4CZJA 1NBWA 4FL9A 1KAXA 2KHOA 1BA0A 3VEZA 2ZWHA 4LC9B 3TU5A 1QQOA 4NO7A 2ZF5O 3BF3A 2D1KA 3A5MC 4DB3A 4CJ7A 4A61A 4H5WA 3MN6A 2HOEA 4BRQA 1KAZA 2AA4A 2P9UA 3FLCO 3MN9A 2W41A 3QFPA 2HF4A 2HF3A 3EZWA 4BRHA 4JD2A 2VYPA 2QWNA 5AFUH 1NGFA 3U9DA 4PL8A 3FR0A 3VF6A 4CBXA 1ZC6A 2P9NA 1NGDA 3CJCA 4B1YB 3AAPA 1MDUB 4H03B 4M7YA 4RCHA 3UKRA 3H6EA 3JXUA 4B1WB 3AY9A 4FWSA 2GUPA 1LCUA 3F9MA 4CBUA 3QB0A 2A42A 1GLDG 1J6ZA 5JICA 3WXJA 3D2FB 2E88A 1X3NA 4H0TB 5AQIA 3WQTA 3W0LA 3WEEA 1U2VA 4BQZA 4AM7A 4RTFD 1BU6O 3RSEA 3O1BA 3CQXA 4CZIA 1QZ6A 2H3GX 4BC4A 4H5RA 2QWOA 2FF6A 4MLHA 3U9ZA 3EL2A 3ULEB 3VOVA 1IJJA 3ENOA 4ISFA 1NGEA 5AQVA 3AAQA 1NLVA 4I6MB 3H45C 3U4LA 4FO0A 4JN4A 5TKYA 4BC2A 3SJHA 3VEOA 2QXLA 1JCGA 1WUAA 1JCFA 4A2AA 2ZGYA 2FSJA 4IO8A 3ZETA 5KQDA 1NMDA 1IG8A 3ZEUB 5JMVA 2P9KA 1NWKA 3CI5A 2D0OA 3LDPA 3A0IX 4EAHD 4EIAA 3OHRA 2ZGZA 1RDWX 4CD1A 4WQ5C 5ELZA 1G99A 2UYTA 3CJAA 3W3DA 3HZ6A 4Z94A 3EO3A 3VESA 5F2RA 1LOTB 4H5NA 5AQOA 5AQGA 4BVOA 5BRHA 3LDNA 3C7NA 4FWOA 2QM1A 4RWTA 5FPEA 3I33A 4M7XA 3KVGA 5CE3A 5B8HA 3D2EA 4EHUA 4GNIA 4EFHA 3H1VX 4BRKA 3MN5A 5EVZA 4BRDA 4IJNA 2V52B 2CH5A 1ZBSA 5LJWA 2E1ZA 4B1UB 1E4FT 4FPAA 1X9JA 5F0XA 1NGHA 2GELA 1ATRA 5F1XA 1HLUA 4JHDB 2P9IB 2P9PB 3HTVA 3GG4A 2QWQA 2YJFA 5FPMA 3ZX0A 4BR2A 3H3NO 3SMSA 2A5XA 2GEMA 4CZKA 2W40A 4IZ9A 2PBDA 4J8FA 4Y0WA 2V7ZA 3H1QA 3AARA 3VETA 3WXKA 3J8AA 3L0QA 4BRIA 3DXKA 3VF4A 1HJOA 2P9SB 5BPNA 4BQLA 1Z6RA 3G25A 3UKUB 2IVOA 2QW9A 2IIRA 1TUYA 5BPMA 2YCHA 3P4IA 2P9LB 2CGLA 4PKHA 1Q18A 2YHYA 3ID8A 4H0YB 1HKBA 5AR0A 3R9PA 3A5NC 5AQZA 1SZ2A 5AZIA 3WT0A 3LL3A 1TYQA 4CBWA 4FWRA 3QBXA 4CZFA 2QWRA 3R6MA 1T6CA 4HTLA 1S22A 1QHAA 1HKCA 1P8ZA 1GLJO 2YHXA 2BTFA 3DXMA 3R8EA 1DKGD 1MA9B 2I7PA 1KXPA 2ASPA 4CZMA 3WQUA 4BR0A 4O8KA 4BC3A 4XH5A 3IMXA 5AQWA 1MWMA 5AQUA 5AFUA 3WUHA 3A8YA 2YHWA 3KHYA 3LM9A 4FWPA 1OKJA 3CJ1A 1HX1A 3FZKA 5E84A 1U6ZA 1E4GT 2ASMA 1YUWA 1S3XA 3GE1A 3QFUA 4M63C 3VGMA 3GOIA 3MCPA 2FSKA 4MO5A 4BRPA 1GLFO 1QQMA 1Z05A 2Q1NA 3KZBA 2CH6A 2QWMA 2E2PA 3CQYA 2BUPA 4BRLA 4BR4A 1GLEG 1K8KB 3A5LC 4O5FA 3QMLA 4F9OA 3O6WA 4FWKA 3CJ7A 1V4TA 3S41A 3JS6A 3FZLA 2GWJA 4BC5A 4WQ5A 4ISEA 1NGJA 2VWBA 2A41A 4JNEA 3L6QA 4ISGA 5BN8A 2PAVA 3LDQA 3I8BA 3TPQA 1ATNA 1DGKN 1GLAG 3VGLA 2J4RA 3MN7A 3MK6A 2QWPA 2F9TA 5ADXA 4DHYA 3VEVA 3C0BA 3CERA 3WXLA 1H1VA 1HKGA 1SAZA 4FSVA 3BP8A 3MMVA 4AM6A 2WUSA 4XH1A 1T6DA 1BO5O 5LY3A 1X3MA 4IWVA 3A5OC 5AQRA 2F9WA 4FOEA 3FZMA 1BDGA 4FPBA 2IVPA 3BEXA 2FF3B 5AQTA 1YVNA 4JAXA 5BR9A 4BREA 5BN9A 4BR7A 4C23A 4K25A 1GLCG 3VENA 3O5BA 3QBWA 3HBTA 3O80A 3FZFA 2AP1A 4PL7A 3ULEA 2NZTA 2P9UB 4BRNA 4BRCA 1T44A 4JD2B 5AQKA 4FOIA 4I6MA 5EX5A 4B1VA 4CI6A 5KPTA 5EXWA 5AZIB 5AZJA 4BG9A 1SQKA 5LJVA 1NGBA 2P9NB 4BRMA 2CGJA 5AQMA 3ZX2A 2QWLA 3IFRA 4QS8A 3VGKA 4H0OA 3O1WA 3UKRB 1C0GA 4FWLA 4B1XB 1NGGA 3L4IA 3ZEUA 4H0XB 3CETA 3IUCA 1ESVA 2E20A 2V51B 1XC3A 4GY2B 1DEJA 2ITMA 2FSNA 2D0PA 3FFKB 2A40A 1WOQA 4K42A 3LDOA 4QS9A 4BGBA 3WEEB 1U2VB 2Q2RA 3QICA 3VEYA 3RSEB 5I9EB 3CJBA 3VEWA 5FPNA 4BROA 1GLBG 5AQFA 2Q36A 1TUUA 1Y64A 4CZGA 4WQ4C 4IXCA 2ASOA 1MWKA 1BOTO 2Q0UA 2Q31A 4FWNA 5AQHA 3SMPA 3ZX3A 1NGCA 4PKGA 2CGKA 1R59O 5AQSA 1NGIA 4DQ8A 4YDUC 2YI1A 4BR5A 3EKSA 5EOYA 3HSCA 4L3QA 1ATSA 3CIPA 2E8AA 3MDQA 2NRHA 4QS7A 2A6AA 5EY4A 3DJCA 3CJ9A 4A62A 5KPZA 1CZAN 3VERA 3M3ZA 5AQJA 2HMPA 3ZETB 4JHDA 2E2OA 2P9IA 2P9PA 3GBTA 5JLFA 3B8AX 2GTDA 5AQPA 3H3OB 1RFQA 2P9KB 4H5VA 2Q97A 3D7EO 2GWKA 1BWFO 2P9SA 2D4WA 5AQXA 5JLHA 3UKUA 1D4XA 4XEIA 2P9LA 1QZ5A 4A2BA 5AQLA 3CHWA 1YAGA 3WXIA 4B9QA 3C7NB 3ATUA 3H46O 4H5TA 3ENHA 3VF2A 4K43A 3VPZA 3UE5A 4E1JA
chains in the Genus database with same CATH superfamily
1S9GA 5BREA 1VQPN 1HQEA 3LANA 2F96A 3QNOA 3EKUA 4H0VB 4KBOA 3V81A 3R3LA 3FE1A 5EU7A 2VCPA 4HWIA 4CZHA 4BG8A 2FLOA 3EYZA 3K5MA 4OPHA 1NGAA 3SBGA 3CCVN 1N5YA 4FJ8A 2G8WA 2KQ2A 2X6NA 4PKIA 1S5JA 4LSLA 4DU3A 1YF5L 4IEIA 1J9AA 4CHZA 1BUPA 4FWMA 5AJ3K 4A59A 4CZEA 1ZBIA 3QETA 1JLFA 1WAJA 4K41A 3FZHA 4IJAA 3CF5L 3VMFB 3NF6A 2PY5A 5GAHP 4K0KK 1HUXA 3P1GA 4CEOA 4DQIA 1S72N 4G1QA 5KPRA 4MLEA 3TSUA 4CEBA 5E26A 3LDSA 1HPMA 4OKEA 1QQNA 4DSFA 3O4WA 1JLQA 1ZXOA 1IBLK 2PYLA 1NBWA 1FJGK 3T19A 3VEZA 4JKFA 3VA0A 1QQOA 2HBJA 3A5MC 5JS2A 3KWIA 5FROA 4CJ7A 1IKYA 2XO7A 4FXDA 2ETJA 4MDAA 4BRQA 4B3OA 4KPYA 3QFPA 5LL6Z 3EZWA 2FC0A 2QWNA 4HHTA 3U9DA 1LWCA 3FR0A 1RTHA 3CMEN 1TL1A 4GW6A 3AAPA 1C1AA 1MDUB 3PUFA 1C1BA 3H6EA 3I0SA 1YHQN 2OYQA 3AO5A 3F9MA 3M5RA 1J6ZA 2O8EA 3KLGA 3WXJA 4BEBA 4NCGA 1JLCA 3O9UA 4MFBA 4DSLA 3WEEA 1JL2A 2O4GA 4BQZA 1B9DA 1BU6O 3RSEA 3O1BA 4KHQA 3K9KA 1FKOA 4CZIA 1EO1A 2UUBK 4MDBA 3B6OA 4IOXA 4B8AB 2OPPA 3ULEB 4W5OA 1NGEA 4YOYA 2Z1IA 1TK0A 1X9MA 4DFJA 1HJRA 3AVGA 3H45C 3U4LA 4FO0A 4NCBA 4JK7A 2HHWA 3KTQA 2XHBA 2BH1A 2O8BB 1IBMK 2IGIA 5LMNK 4CJPA 4KB1A 5SWMA 2ZGYA 1JKHA 4O0JA 4CJEA 1U4BA 3HXMA 4JI1K 1NWKA 4FJNA 3CI5A 3HPHA 2VWKA 4BDYA 4F2RA 4O44A 1D5AA 1G99A 4U67L 3V9WA 3CJAA 3OA9A 4KH5A 3OTOK 1QVGM 1FK9A 5C15A 4DTUA 3VQBA 3ITHA 1I94K 3C95A 3HPOA 5MLCQ 1REVA 4LFCK 2YNFA 2QK9A 3BY5A 3MN5A 4BRDA 2V52B 2CH5A 5D3GA 1RT5A 1E4FT 1W97L 4FPAA 3KD1E 4X64K 2HBLA 5F0XA 3QIOA 5J2NA 3KLFA 4B9UA 5GAGP 4CW7B 4CIEA 3QESA 4BR2A 3F73A 1NJWA 4CF0A 3QLHA 2PBDA 3VETA 2V7ZA 3H1QA 3AARA 3WXKA 4YOUA 3J8AA 3L0QA 4WFNL 3IG1A 3DXKA 2O8EB 3VF4A 1HJOA 4DR2K 1Z6RA 2HW3A 3UKUB 3V9SA 1TUYA 2YHYA 3ULDA 3ID8A 2QEXN 1XMQK 5AR0A 3R9PA 3A5NC 3L2RA 1WN7A 3HYFA 5CY4A 1QHAA 3C6HA 1IBKK 1P8ZA 3LP3A 2YHXA 2BTFA 3R8EA 3OS0A 1WAFA 1QSSA 1LW0A 3E1YA 2QA4N 4RW4A 4BC3A 3R1XA 1VQKN 1N33K 1Q86O 5AFUA 4CJ4A 4CCHA 1RBSA 3ZSQA 1U6ZA 3DLRA 1E4GT 2P5GA 1EWQA 1L3UA 1P90A 4FW1A 3NH0A 2A1RA 3CXCM 4MO5A 4BRPA 1GLFO 1X9SA 4LFBK 1S1XA 1GLEG 4JKCA 4J2AA 3O6WA 3OBWA 3CJ7A 3JS6A 4DQSA 3HL8A 4BC5A 3CCJN 4WQ5A 4ISEA 3OYBA 4OPAA 2YKNA 4FW2A 3MWPA 3TTFA 3V9ZA 1QE1A 4OGCA 5BN8A 5HP1A 2B4JA 3LDQA 3I8BA 2D5RA 1Q9YA 1ATNA 1DGKN 4BACA 2O8DA 1UOCA 4JLHA 1NOYA 2QWPA 2F9TA 4JKGA 4AF1A 4B3RK 3C0BA 4Z4CA 2LSNA 1CXQA 4FSVA 4JK8A 3VQAA 3MMVA 4DU1A 4Z4FA 4CFAA 5KGWA 3OW2M 3Q7CA 1EP4A 5AQRA 3HM9A 2W00A 5JENA 4FJKA 1WBBA 3FZMA 1NK5A 2GUIA 4CVNE 1B9FA 4K25A 2NRVA 3NH2A 3QBWA 3HBTA 4PL7A 3VQQA 2P9UB 2QI2A 3PX6A 4JD2B 5AQKA 3CFRA 3ZSWA 3AA5X 5AZJA 1SQKA 4I9LA 4RG8A 5HROA 3O1WA 4B1XB 4J2BA 1QHTA 3CETA 5JS1A 2HHSA 1XC3A 4GY2B 1DEJA 3P83D 2WC9A 2A40A 3WNGA 1WOQA 4K42A 3TABA 4B3MK 4QS9A 3MXIA 3CPEA 3O4NA 1RT7A 5I9EB 4JKBA 3VEWA 5AQFA 3AGRA 2Q36A 1RT6A 1LWEA 4CZGA 5BR8K 2QKKA 1VSJA 5HRPA 1BISA 1N36K 5HL7L 2Q0UA 3SMPA 3PIPL 1NGCA 4DTPA 2HNZA 4DQ8A 3TAQA 4J2EA 2YI1A 3DYAA 1RT2A 4IG3A 3MDQA 5KTQA 3HP9A 4JI0K 3RR8A 1Z25A 3OYIA 4DSIA 1DLOA 2HMPA 1IKVA 3M8QA 3EE8A 3MCAB 2W42A 3ZETB 4FLUA 2NRXA 5IWAK 4JKDA 4FLWA 3WNHA 1YTAA 3H3OB 2JWLA 1RFQA 2P51A 3NF9A 2P9KB 1SS6A 2IOCA 1BIZA 4CEAA 4YORA 2Q97A 5GINA 1O13A 4LH4A 4JI8K 3CCEN 1RNHA 2X78A 2RN2A 5AQXA 5JLHA 4FJGA 2P9LA 3HK2A 2HBMA 4A2BA 4ID1A 4W5RA 3T69A 4XIUA 3ENHA 4HCCA 1NMNA 3WXMB 1VQON 1GLLO 5DK5A 3RMBA 4JI7K 2A3ZA 1XMOK 2JGUA 2BANA 2OCEA 4MQ3A 1YXQA 3O4QA 1TGOA 3QO9A 4CIGA 5AQYA 1NG9A 3SAHA 3AO4A 5AZJB 2X6SA 4DUYK 4O8UA 1C0FA 3THXB 4CJ5A 3LPUA 3M8SA 1OH5A 3MX2A 2O8CB 1RGIA 1SL1A 3U8XA 3THWA 3DWLA 3ID6A 3GL1A 5BRDA 4NB4A 3O8MA 4C8NA 4LF8K 4ZTJA 2HHQA 3EN9A 4CD3A 4AHUA 3CD6N 4G9ZA 5FRMA 1XQSC 2EWSA 5KQ8A 4X65K 2O4IA 3UB5A 4IKFA 1YJWN 5KRTA 4BY9C 4LF7K 4DLEA 1RBVA 2E2NA 3DXMB 5BPLA 3CPWM 1BA1A 3QDKA 2OPSA 3M1FA 5FPDA 3UIQA 3P38A 2IVNA 1TAUA 3LP1A 4FL9A 4AILC 4FK2A 2VGNA 1KAXA 2HB5A 3P31A 1YI2N 2Z1GA 3TU5A 4RW9A 4GV9A 2D1KA 4A5AA 1XHXA 3WNFA 4DB3A 4A61A 4H5WA 3MN6A 2JLEA 5C10A 3KLEA 2UXBK 3FLCO 3MN9A 2W41A 3THYB 1KD1O 2G8UA 3TAFA 4KTWA 2VYPA 4JKEA 1HNXK 2G8KA 2P5OA 3NDKA 3KJVA 1EX4A 3E9OA 3TANA 3HVRA 3V1QA 3CJCA 4DV6K 1RCHA 5SZTA 3O9RA 1TAQA 3ZT3A 2OZMA 4M7YA 1XWLA 4NXNK 1SL2A 4JKAA 3JXUA 4FWSA 1LCUA 2A42A 1GLDG 3CCQN 2QXFA 4B08A 4Q5VA 3LZJA 3RR7A 2A1SA 1RDDA 1ITGA 3PSFA 2HBKA 1FW6A 5JVGL 3WQTA 1U2VA 4B9MA 4RTFD 4CFDA 5FRNA 1QZ6A 4CEEA 3HPGA 3SPZA 4BC4A 3DRSA 1G15A 3J81O 1NKEA 3RRHA 2OPRA 5C25A 3EL2A 1WLJA 3ENOA 4ISFA 4CFCA 2KZZA 5AQVA 1O1WA 1NLVA 4FVMA 4CF1A 4I6MB 1EETA 3SUOA 2W6KA 1NK6A 3OYKA 4KI6A 1VSMA 3KD5E 3SAFA 3ZSRA 1VQ4N 4C8MA 3EEQA 2QXLA 3C6UA 1WUAA 5C2DA 4PA1A 4A2AA 2FSJA 2DFEA 5KQDA 3JSMA 1NMDA 1IG8A 3ZEUB 3CFPA 1NK8A 4CJWA 4CJSA 2O8FA 4EAHD 4EIAA 1JLAA 4NCAA 4W5QA 4DV7K 4CJUA 3N4PA 3KIOA 4FJLA 1LOTB 5BRHA 3LDNA 4BECA 3VQEA 3PO5A 4KHYA 2QM1A 2E5LK 3I33A 3KK1A 4B9NA 4UY8O 4E1MA 3OYLA 3K0SA 3D2EA 3DMJA 4X62K 3EY1A 4Z4EA 4B1UB 4CESA 3VQPA 3SI6A 3SYZA 4CEDA 1X9JA 4AHVA 3MEGA 1BCMA 2GELA 3MX5A 1VQ5N 1KCFA 2P9IB 2P9PB 4ILGB 2VG7A 3ZX0A 3SMSA 1J5OA 2GEMA 3TAGA 3K5NA 1Q7YO 4OPKA 1RTJA 4J8FA 2VQFK 4BRIA 1NOZA 1VHXA 2P9SB 2NRZA 3DM2A 1T7PA 3S5TA 4LFAK 4PKHA 4WE1A 1BI4B 4PUOA 4DMNA 3D45A 4X66K 1ASUA 3ZYYX 5AQZA 4ZHRA 5AZIA 1SKWA 1TYQA 3QBXA 3LAMA 4CEQA 3A2FA 1T6CA 3SJJA 2BDPA 1UWBA 3L2WA 4M3WA 3U6FA 3VQ5A 3LZIA 3O3FA 1DKGD 1FKPA 5H1SQ 2ATQA 2XY5A 4CZMA 1ZYQA 4HCBA 3OYFA 2YNHA 4BR0A 4O8KA 4IDHA 5AQWA 5GAEP 5M1NA 1JXBA 3K58A 4DF8A 3WUHA 1W2BM 2WBNA 3LM9A 4FWPA 3CJ1A 3VQ6A 1OH7A 1SKRA 4OO1J 1C0MA 4JS5A 4DQQA 1YUWA 4M42A 2KFZA 2I5JA 4N76A 2FSKA 1C1CA 2UXCK 4DSJA 1QQMA 4BE0A 1Z05A 2HHTA 2CH6A 2QWMA 4BRLA 2BUPA 4OX9K 3QMLA 4BWMA 1V4TA 3S41A 4PWDA 3FZLA 5GADP 3SZ2A 2RHKA 1NGJA 4CGGA 1S6QA 3L6QA 5CZ1A 2PAVA 3BDPA 4PQUA 3MN7A 1U45A 2RKIA 3E01A 3TTCA 3CC4N 1CZBA 4JV5K 3SQ2A 3WXLA 1H1VA 1HKGA 1SAZA 5K14A 3V6DA 1OH6A 2D0AA 2WUSA 4XH1A 1T6DA 3AVHA 3L2UA 4PHTX 1X3MA 3LWLA 3A5OC 3RRGA 1T03A 1LV5A 4FLXA 4B3SK 2UUCK 1RBTA 2F7TA 2ZM6K 2IVPA 1YVNA 2C1GA 5BN9A 4C23A 1UAXA 2GX9A 4CJRA 1N32K 3O5BA 3O9TA 3NHGA 1NJXA 4LF6K 2NZTA 3MECA 1T44A 4AHTA 4FOIA 1SL0A 4KHNA 5EX5A 4B1VA 4B9SA 5AZIB 4YOTA 4Z4GA 2CGJA 2QWLA 3PX4A 1I39A 3IFRA 1BIUA 4QS8A 3VGKA 4LH5A 3VQDA 1NK7A 3CYGA 1KVAA 5HRNA 4CJFA 2OPQA 3L4IA 4DTSA 4H0XB 2W6LA 3IUCA 2E20A 1C0TA 3PX0A 2FSNA 3THVA 3TTDA 3SUQA 3LALA 1NK9A 2FBYA 4BGBA 3WEEB 3HSTB 2Q2RA 3VEYA 4M3RA 3RSEB 1XNQK 3TAEA 4BWJA 1GLBG 4EZ6A 3KWGA 3ZSZA 4ELUA 3OYCA 4WQ4C 3ALYA 4ELTA 2ASOA 1MWKA 1BOTO 3CC2N 2YNGA 2HHIA 2YKMA 4YDUC 3G71N 3HSCA 4L3QA 2E8AA 4QS7A 4BE1A 5DM7L 3DJCA 4CGJA 4A62A 1CZAN 4IOAL 3M3ZA 3EE9A 4H4OA 3OYMA 4JHDA 2E2OA 5M1PA 4NLBA 3VQ7A 4W5NA 1K6YA 1JJ2M 3T1AA 4DLGA 2VWJA 1KQSM 3LAKA 2AJQA 3K5OA 4M3YA 3RMCA 4EP5A 3VTIA 4DS4A 2IDOA 3O3HA 4KH4A 4XEIA 4KHSA 4IO9L 1Z26A 5AQLA 3CHWA 3U3YA 1J5EK 1W9HA 5A2QO 3I56N 4CIFA 3ATUA 3H46O 3VF2A 3VPZA 3IRXA 3T1HK 3CMAN 1HYSA 2YV0X 3BUZB 4C1NI 4JI6K 5CZ2A 3AVAA 3TARA 2E1YA 1L3VA 2YX6A 4E1NA 4FZXC 4CFBA 1RILA 3D2FA 1XC9A 3FGUA 5J1EA 2F8TA 3HRGA 3BF1A 4MO4A 4BR9A 1ZBUA 4DTXA 3AA3A 4KHWA 3SK3A 3OS2A 2BE2A 3GDQA 1HYZA 2OANA 4M3XA 3O08A 1IKWA 1SKSA 3DXKB 4XH4A 3G4SN 4DR3K 1K8KA 2IC3A 2WFBA 3HO1A 3LM2A 4B1ZA 1WSJA 4FJHA 3D6RA 3VEXA 1N6QA 3BGRA 4KHUA 4XJXA 1RT4A 2NLXA 1DT9A 4DU4A 4F3TA 4IOCL 4E0DA 3L8BA 1TV6A 4H0PA 3OVNA 4IG0A 1EWRA 3OYEA 2KKZA 3HT3A 3AVIA 5BRFA 1Q82O 4DFPA 3SLCA 2V7YA 3SPYA 3DOLA 4CZLA 2E2QA 3F9KA 3F5TA 3NVKA 4LF9K 4BRGA 1XUPO 3AVJA 4WYBA 4CHOA 1KC8O 2G8FA 2QTDA 5HRRA 3CCUN 1X1PA 2KHOA 5J2PA 1RT3A 3C65A 1QSLA 2FBVA 4IDKA 4LC9B 1WB9A 3BF3A 1HNVA 3OYHA 1YIJN 2HOEA 1KAZA 3T1YK 2HF4A 4R5PA 2XY7A 5AFUH 3KKSA 1S9EA 1U47A 4PL8A 1JXEA 3VF6A 2P9NA 4IFYA 3ZT1A 4OKKA 2O8DB 4CF8A 3ZSVA 4RCHA 1VSLA 3UKRA 4B1WB 3SQ4A 4JKGB 4DR5K 2GUPA 4CBUA 4O0IA 4JI5K 1NJZA 5JICA 4CGHA 5FLXO 3D2FB 2E88A 4M3ZA 4O4GA 4H0TB 4DTRA 3C6TA 3CCLN 1B92A 3OYJA 3W0LA 5CHIA 1T8EA 1YJ9N 3K57A 3ZT4A 1TVRA 3AVLA 4DSKA 4M45A 3V9XA 2C1IA 2QWOA 2FF6A 2DFFA 3SBTA 3U9ZA 4CGFA 4AH9A 3VOVA 3S3MA 5JVHL 1IJJA 1ZBLA 3DLKA 3HJFA 3TAMA 3NCIA 3ZLJA 3BZKA 1LAWA 3NAEA 4JN4A 3QEXA 1E3MA 5TKYA 4FM0A 1JCGA 1JCFA 4CGIA 4WFAL 4IO8A 4DQPA 3M8PA 3S3OA 3AVKA 3V1OA 4OGEA 3L2VA 4OVLA 3E66A 4B8CA 3LDPA 5M1QA 3OHRA 4DWIA 1BHLA 4CD1A 2VQEK 2UYTA 3W3DA 1VSIA 1WSIA 1W7AA 3ASMA 4Z94A 3OYGA 1IKXA 3VESA 2F8SA 5F2RA 2YNIA 5AQOA 4BVOA 3PY8A 3C7NA 4B9TA 3O3GA 3PSIA 4CJVA 4J2DA 1WSGA 2E4LA 2UUAK 4M7XA 4DV2K 4HTUA 4I7FA 1MU2A 3CM5A 4EHUA 4GNIA 2E6MA 4FLYA 3K9JA 1TKZA 4BRKA 5EVZA 1KLMA 4IJNA 2XY6A 3PLAA 3NBPA 4EP4A 2E1ZA 4DS5A 4HUEA 2IAJA 3J7YP 4QOZB 1NGHA 1ATRA 4CEFA 5F1XA 1BCOA 4EZ9A 4RW8A 2EHGA 2G8HA 2A5XA 4CZKA 3DRRA 4F3OA 4IZ9A 1A5WA 1LAVA 1VAZA 3RTVA 4BQLA 3G25A 2IVOA 3RWUA 2IIRA 5BPMA 4RW6A 4AHSA 3DRPA 3P4IA 2P9LB 2CGLA 4FLZA 1Q18A 3JYTA 4H0YB 1HKBA 3ZT2A 3KLIA 3WT0A 3LL3A 3MAQA 4CBWA 4FWRA 3C6AA 1S1WA 2QWRA 4HTLA 3AVCA 4OLBA 1GLJO 3CFOA 2XRIA 1RDAA 3KK3A 3SQ1A 1MA9B 3SV3A 2I7PA 1NJIO 1KXPA 2ASPA 1OVQA 3WQUA 3SUNA 2GBZA 3T3FA 3IMXA 3SNNA 1MWMA 5AQUA 4DTMA 2RF2A 4H4MA 3S9HA 3E9LA 1IG9A 3A8YA 3CCRN 4KI4A 2NRRA 3DI6A 3VQCA 1C0UA 5E84A 3PV8A 3THWB 4DR7K 2ASMA 3GE1A 4M63C 2Z1HA 3GOIA 3MCPA 4DV1K 3KZBA 1WNSA 1D9FA 2E2PA 1BQMA 3ZT0A 4O5FA 3L3VA 4BR4A 3MEEA 4F9OA 3AA4A 3G10A 4FWKA 5C12A 4FK4A 1RT1A 1XI1A 4WCEL 1EXQA 3J7ZO 3NVMA 4FJ9A 2A41A 4JNEA 3SV4A 3RVCA 5C24A 3QIPA 4ISGA 4LSNA 3K2PA 3KKRA 4JKHA 5CR4A 4A57A 5LMUK 4CJKA 3VGLA 1YJNN 2WOMA 3SQ0A 2J4RA 4JI3K 5ADXA 5KRSA 3OJSA 3DOKA 3N4QA 4RW7A 3VEVA 1NKBA 4C8OA 1L3SA 3BP8A 4M41A 4KAZA 4ZTFA 3BZCA 2RPIA 1TK8A 1BO5O 5LY3A 2F9WA 4NLCA 4HUFA 2HVHA 4FOEA 2HSTA 4GMJB 1BDGA 1JLEA 4FPBA 1T05A 1GOBA 3BEXA 2FF3B 2KLAA 4KTZA 4JAXA 3AVMA 4KRFA 1GLCG 4DTJA 1U49A 3VENA 4DTOA 1Q8IA 3CYMA 3FZFA 2D0BA 2HMIA 3ULEA 3RMAA 4BRNA 3MXJA 3SUPA 5KPTA 1K73O 2EX3A 1R0AA 5EXWA 4BG9A 5LJVA 2HHUA 4BRMA 3NGIA 5AQMA 2O8BA 3ISNC 1D9DA 4DTNA 3L4QA 4H0OA 1CLQA 4FWLA 5DMRA 3HVTA 2V51B 2ITMA 4KHPK 3NFAA 3TWHA 3FFKB 3AVFA 1VRTA 3LDOA 1DTTA 1U2VB 2Y1JA 1VSFA 2HHVA 4DG1A 3NMUA 4DR1K 1TKXA 1C6VA 2R7YA 1TUUA 4K8XA 4W5TA 4Q0BA 5FDLA 2Q31A 5AQHA 4FWNA 1HRHA 4PKGA 1R59O 5AQSA 1NGIA 5M1FA 3P5JA 1UA0A 5EOYA 3DLLL 3NF8A 3CIPA 4I2QA 1JLGA 4OLAA 1X9WA 1A5XA 4JI2K 3K5LA 3CJ9A 4JK9A 2YHBA 2DFHA 4FM1A 5AQJA 2ZJQL 4FJJA 2IS3A 3OYDA 2PZSA 5JLFA 3GBTA 4KB0A 1NNEA 1Y97A 2GTDA 5AQPA 4U7BA 3DLEA 1XNRK 2O8FB 4H5VA 3ZSOA 1WSEA 4Z4IA 3D7EO 2GWKA 5M1OA 1BWFO 2D4WA 4CK1A 2JWKA 3UKUA 3J7AP 3CCMN 1J54A 4GV6A 3KK2A 1GOAA 3LP2A 3WXIA 4FLTA 4HVJA 3VN5A 4H5TA 4E1JA 1ASVA 5I3UA 1HNWK 3D2EB 3DLGA 5ADXH 4DR6K 3HI0A 4BRFA 4BRAA 2ZE2A 3HM8A 5AQQA 4CHPA 3ZCMA 4AHCA 1M90O 4KTQA 3CCSN 3M6GA 1BG3A 5AQNA 4DCHA 3IKMA 3HOTA 2HHXA 1V4SA 1JCEA 5J2MA 1NM1A 3WNEA 3ATVA 4ID5A 1Q9XA 4WF9L 1EQYA 1KAYA 2Q0RA 1VSEA 4EHTA 1N8RO 2I7NA 2FXUA 4CGDA 4OPJA 1RBUA 2VG5A 4GKJK 4IFVA 4FWQA 4CJ3A 3I8DA 4FK0A 3NGYA 1HPZA 3DAWA 1YITN 4E7KA 1TYQB 2YJEA 1KTQA 4BVPA 3QNNA 4GKKK 4CHQA 2ZJRL 4GVMA 2DPNA 1IH7A 4OKJA 4LY7A 3LWMA 4WQ4A 5HOOA 4BGAA 3O9QA 3DLBA 4DV5K 1A5VA 5CYMA 5DM6L 3LDLA 5C42A 3G0ZA 4YDUA 3IDHA 4R79A 3TAPA 1TK5A 2KW4A 4C8LA 2NNWA 1N34K 3B6PA 4CZJA 1HR0K 4KO0A 5CYQA 1BA0A 4E72A 4AQYK 1K9MO 2ZWHA 4B9VA 4NO7A 2ZF5O 5GIPA 1T3VA 4GVEA 1YT3A 1NJYA 2Q3SA 4JS4A 2AA4A 1RDUA 2P9UA 1KFSA 1QQCA 4IBNA 2OZSA 2HF3A 4BRHA 4JD2A 1NGFA 4V19S 4JYAK 4CBXA 1ZC6A 4ELVA 4FJ7A 3SCXA 4DR4K 1NGDA 4B1YB 3OBYA 5KGXA 3QERA 4YY3K 3MXMA 4H03B 4FJMA 2VG6A 3LPTA 3AY9A 3MWTA 1ZBHA 1EKEA 1WSHA 4Y1CA 4DV3K 3QB0A 4IEEA 3MEDA 1X3NA 3TSPA 4F4KA 1NK0A 5AQIA 1S1UA 3I0RA 4CHNA 2KTQA 4AM7A 1OH8A 5IT9O 4CJLA 3CQXA 3QEWA 4BE7B 4C1NK 2QKBA 2H3GX 4H5RA 2VGMA 3FFIA 4MLHA 1XHZA 2G8VA 1ZBFA 2GV9A 1RTDA 4CHYA 3M8RA 3IAYA 3AAQA 1S1TA 1TL3A 4DV4K 3ZSXA 3ENBA 1LW2A 1ILYA 4YOWA 4BC2A 4E7HA 2HNYA 3SJHA 3KK7A 3CC7N 3VEOA 1BL3A 1YTUA 3ZETA 3O9SA 4YOXA 4M3TA 5JMVA 3OYAA 4CEZA 1VSHA 2P9KA 2Z1JA 1RTIA 3AV9A 1CZ9A 3V9UA 2P1JA 2B6AA 2D0OA 2RE2A 5HRSA 3A0IX 4CJTA 1LWFA 4ICLA 4DKWA 4C8KA 2ZGZA 1BGXT 1RDWX 5C2FA 3QEVA 4WQ5C 5ELZA 3VTHA 3Q7BA 1U48A 4JRQA 1J53A 3HZ6A 3EO3A 4JI4K 2NRWA 1JL1A 4KV8A 5HLFA 3TI0A 4H5NA 5AQGA 1QTMA 4DSEA 4FWOA 3QEIA 1Q81O 2NUBA 2HNDA 4RWTA 4N47A 5J2QA 1VQMN 5FPEA 2OTLN 4Z0UA 3KVGA 5CE3A 1VSDA 5B8HA 4DFMA 4EFHA 4E89A 1F21A 3H1VX 4BE2A 3PO4A 1ZBSA 5LJWA 4QAGA 4YHHK 4CK3A 1IV0A 1KVBA 4BDPA 3THXA 3NH1A 1BQNA 4N5SA 1HMVA 4WFBL 1HLUA 2O8CA 4JHDB 1UA1A 3HTVA 3GG4A 4DV0K 2QWQA 2YJFA 5FPMA 3H3NO 2X74A 3HP6A 1D8YA 2W40A 1KLNA 4Y0WA 3V4IA 5TKWA 2PYJA 4KFBA 4FJXA 3NE6A 5KI6A 5BPNA 1VQLN 4L8RB 2QW9A 1NU0A 2YCHA 3E9PA 4E19A 1QSYA 1S6PA 3T7ZA 1VQ7N 4O55A 4PY5A 4F8RA 1SZ2A 4CERA 2XY8A 4DF4A 4K8ZA 4E3SA 4CZFA 1K8AO 3R6MA 3AO2A 3QINA 1S22A 1HKCA 2BGGA 1U04A 1WSFA 3TSQA 3JAMO 5M1KA 3DXMA 3KLHA 4ILHA 4FZZA 5T7BA 3VA3A 2KZMA 3VQ8A 4XH5A 4F2SA 1ASWA 4NXMK 3I55N 4N56A 2B5JA 4FM2A 3S3NA 2YHWA 3KHYA 1OKJA 3FZKA 1HX1A 4E7LA 3EZ5A 4OJRA 1S3XA 3QFUA 3VGMA 2WTUA 4E7JA 1TKDA 3IS9A 1HNIA 3F2KA 3AVBA 4CE9A 3VQ4A 2Q1NA 3AO3A 3P39A 3CQYA 2HHHK 1K8KB 3A5LC 5HBMA 2PFUA 4FVUA 4B9LA 1HYVA 1VQ6N 3L2QA 3QEPA 2GWJA 3THYA 4LF4K 1KFDA 2VWBA 4CJQA 3K59A 2OTJN 3TR8A 2D0CA 4Z4HA 5C0YA 1FXXA 3CQ8A 4AHRA 3TPQA 4CK2A 1GLAG 3MK6A 3AVNA 4DHYA 3CERA 1OVYA 3RMDA 1SV5A 3G6EN 1KVCA 1VQ8N 2NRTA 4AM6A 5I42A 3PIOL 5GIOA 1CXUA 4B3TK 4IWVA 1RDCA 4FLVA 2G8IA 2F4VK 4H8KA 4CF2A 5AQTA 4GV3A 4YOVA 5BR9A 4BREA 1TKTA 4BR7A 4YFUA 1JLBA 3L3UA 3O80A 4TSXA 2AP1A 4UQGA 4NYFA 4I9QA 2FBXA 4ILJA 4BRCA 1HQUA 4I6MA 4IFEA 4CI6A 1I3AA 1NGBA 3H08A 2Y1IA 2P9NB 4KKOA 1NKCA 4A5BA 1L5UA 1VQNN 3ZX2A 4DFKA 4CECA 4JEPA 2DTUA 1YVUA 1KSPA 3OY9A 3VQ9A 3UKRB 3AGKA 1C0GA 3AA2A 1KRPA 1NGGA 3ZEUA 4FJ5A 1QVFM 1ESVA 1W0HA 4FYDA 4KH6A 4O5BA 4HUGA 2ZJPL 2UXDK 1M1KO 1NK4A 2D0PA 4KREA 2KFNA 2E6LA 1GOCA 4I2PA 4Y1DA 2UU9K 3QICA 1VSKA 3HOSA 3CJBA 1VQ9N 4N41A 5FPNA 4CF9A 4BROA 1S1VA 3DLHA 1L3TA 3OYNA 4JRPA 1Y64A 4IXCA 3ZX3A 1HNZK 2CGKA 1VRUA 3CM6A 3NF7A 4BR5A 3EKSA 4LF5K 1ATSA 2NRHA 4QCLA 4DUZK 1SUQA 4M3UA 2A6AA 5EY4A 3LP0A 5KPZA 2FBTA 3VERA 3U3GA 2WONA 3V1RA 2ZD1A 1DTQA 1RBRA 1VK0A 4LD0A 1IO2A 4NYNA 3J80O 3OJUA 2P9IA 2P9PA 3B8AX 5E41A 4DQRA 2HVIA 2DY4A 3ZSYA 1WBDA 2P9SA 3CG7A 1D4XA 2YHAA 3OS1A 1RDBA 2OA8A 4FCYA 1QZ5A 4E7IA 4FJIA 1BI4A 1YAGA 3SAGA 4YNQA 4FZYA 2ITGA 4B9QA 3NGZA 3C7NB 1QS4A 4BDZA 3D0PA 2ZQBA 4K43A 3UE5A 3C94A 3AO1A
chains in the Genus database with same CATH topology
1GLLO 3CMAN 5BREA 1VQPN 3D2EB 3BUZB 5ADXH 4C1NI 3EKUA 4H0VB 2A3ZA 4KBOA 3HI0A 3R3LA 4BRFA 3FE1A 4BRAA 2VCPA 1YXQA 2E1YA 3HM8A 4HWIA 5AQQA 2YX6A 4CZHA 5AQYA 4BG8A 3SAHA 5AZJB 2FLOA 3D2FA 4O8UA 1C0FA 4OPHA 1NGAA 3FGUA 3SBGA 3HRGA 1M90O 3CCSN 3MX2A 3BF1A 1RGIA 4MO4A 3M6GA 1BG3A 5AQNA 4BR9A 3CCVN 4DCHA 3IKMA 3HOTA 1V4SA 3SK3A 3U8XA 1JCEA 3GDQA 3DWLA 3ID6A 4PKIA 2OANA 3GL1A 5BRDA 1YF5L 3O08A 1NM1A 3ATVA 3DXKB 4IEIA 4XH4A 3G4SN 1BUPA 4WF9L 1EQYA 1KAYA 2Q0RA 3O8MA 4FWMA 4NB4A 4EHTA 1N8RO 1K8KA 2FXUA 2I7NA 2WFBA 3LM2A 4B1ZA 3EN9A 4A59A 4CD3A 3CD6N 4FWQA 4G9ZA 4CZEA 3D6RA 3VEXA 1XQSC 2EWSA 5KQ8A 4XJXA 4K41A 3FZHA 4IJAA 2NLXA 3DAWA 3CF5L 1DT9A 3UB5A 3VMFB 4IOCL 1YITN 1TYQB 2YJEA 4BVPA 5GAHP 4H0PA 1YJWN 1HUXA 2ZJRL 2DPNA 4BY9C 1S72N 2KKZA 2E2NA 5KPRA 3DXMB 4MLEA 4WQ4A 5BPLA 5BRFA 4BGAA 5HOOA 1BA1A 3CPWM 3TSUA 3O9QA 3QDKA 1Q82O 3SLCA 2V7YA 5E26A 5DM6L 3LDLA 4CZLA 2E2QA 3M1FA 5FPDA 4YDUA 1HPMA 3IDHA 4R79A 3F5TA 3NVKA 1QQNA 3O4WA 4BRGA 1XUPO 3P38A 4WYBA 1ZXOA 2IVNA 2NNWA 1KC8O 4CZJA 1NBWA 2QTDA 4FL9A 2VGNA 1KAXA 3CCUN 2KHOA 1BA0A 3VEZA 3C65A 3P31A 1K9MO 2ZWHA 4JKFA 4LC9B 1YI2N 3TU5A 1QQOA 4NO7A 2ZF5O 2HBJA 2D1KA 3BF3A 4A5AA 4GV9A 3A5MC 3KWIA 1YIJN 4DB3A 4CJ7A 5GIPA 4A61A 4H5WA 3MN6A 1T3VA 2HOEA 4MDAA 4GVEA 5C10A 4BRQA 1KAZA 2AA4A 1RDUA 2P9UA 3FLCO 3MN9A 2W41A 1KD1O 3QFPA 2HF4A 2HF3A 3EZWA 4BRHA 4JD2A 2VYPA 4JKEA 2QWNA 5AFUH 1NGFA 3E9OA 3U9DA 4PL8A 3FR0A 3VF6A 4CBXA 3CMEN 1ZC6A 2P9NA 1NGDA 3CJCA 4B1YB 3AAPA 3OBYA 3O9RA 1MDUB 4H03B 4M7YA 4RCHA 3UKRA 3H6EA 4JKAA 1YHQN 3JXUA 4B1WB 3AY9A 3MWTA 4JKGB 4FWSA 2GUPA 1LCUA 3F9MA 4CBUA 3QB0A 2A42A 3M5RA 1GLDG 4IEEA 1J6ZA 3CCQN 5JICA 3WXJA 3D2FB 4BEBA 2E88A 1X3NA 3TSPA 3O9UA 4H0TB 5AQIA 2HBKA 5JVGL 3CCLN 3WQTA 3W0LA 3WEEA 1U2VA 4BQZA 4AM7A 5CHIA 1YJ9N 4RTFD 1BU6O 3RSEA 3O1BA 3CQXA 3K9KA 4BE7B 4CZIA 1QZ6A 1EO1A 4C1NK 2C1IA 4MDBA 2H3GX 4BC4A 4H5RA 4IOXA 2QWOA 2FF6A 2VGMA 4MLHA 3SBTA 3U9ZA 3EL2A 3ULEB 3VOVA 5JVHL 1IJJA 3ENOA 4ISFA 1NGEA 5AQVA 4YOYA 3AAQA 1NLVA 3ENBA 4I6MB 3H45C 3U4LA 1ILYA 4FO0A 4YOWA 4JN4A 4JK7A 5TKYA 4BC2A 3SAFA 3SJHA 3KK7A 3CC7N 1VQ4N 2BH1A 3VEOA 2QXLA 1JCGA 1WUAA 5C2DA 1JCFA 4A2AA 2ZGYA 2FSJA 4IO8A 3ZETA 4WFAL 3O9SA 5KQDA 1NMDA 4YOXA 1IG8A 3ZEUB 5JMVA 2P9KA 1NWKA 1VQON 3E66A 3CI5A 2D0OA 2RE2A 3LDPA 5M1QA 3A0IX 4EAHD 4EIAA 3OHRA 4DKWA 2ZGZA 5C2FA 1RDWX 4CD1A 4WQ5C 5ELZA 3VTHA 3Q7BA 1G99A 4U67L 2UYTA 3CJAA 3OA9A 4KH5A 3W3DA 3N4PA 3HZ6A 4Z94A 3EO3A 3VESA 2NRWA 1QVGM 5F2RA 1LOTB 4H5NA 5AQOA 5AQGA 4BVOA 5BRHA 3LDNA 3C7NA 5C15A 4BECA 4FWOA 1Q81O 2QM1A 4RWTA 1VQMN 5FPEA 3I33A 2OTLN 4M7XA 4UY8O 3KVGA 5CE3A 5B8HA 5MLCQ 3D2EA 4EHUA 4GNIA 4EFHA 3H1VX 3K9JA 4BRKA 3MN5A 5EVZA 4BRDA 4IJNA 2V52B 3PLAA 2CH5A 1ZBSA 5LJWA 2E1ZA 4B1UB 1E4FT 1W97L 4FPAA 1X9JA 2HBLA 5F0XA 1NGHA 2GELA 1ATRA 3MX5A 5F1XA 1HLUA 4WFBL 4JHDB 1VQ5N 5GAGP 2P9IB 2P9PB 3HTVA 3GG4A 4ILGB 2QWQA 2YJFA 5FPMA 3ZX0A 4BR2A 3H3NO 3SMSA 2A5XA 2GEMA 4CZKA 2W40A 4IZ9A 2PBDA 1Q7YO 4J8FA 4Y0WA 2V7ZA 3H1QA 3AARA 3VETA 3WXKA 1VAZA 3J8AA 3L0QA 4YOUA 5TKWA 4BRIA 5JLFA 4WFNL 3DXKA 3VF4A 1HJOA 2P9SB 5BPNA 1VQLN 2NRZA 4BQLA 1Z6RA 3G25A 3UKUB 2IVOA 2QW9A 2IIRA 1TUYA 5BPMA 2YCHA 3E9PA 3P4IA 2P9LB 2CGLA 4PKHA 1Q18A 2YHYA 3T7ZA 3ID8A 4H0YB 1VQ7N 2QEXN 1HKBA 5AR0A 3R9PA 3A5NC 3ZYYX 5AQZA 1SZ2A 5AZIA 3WT0A 3LL3A 1TYQA 4CBWA 4FWRA 3QBXA 3C6AA 4CZFA 1K8AO 2QWRA 3R6MA 1T6CA 4HTLA 1S22A 1QHAA 3C6HA 1HKCA 1P8ZA 1GLJO 2YHXA 3TSQA 5M1KA 2BTFA 3DXMA 3R8EA 1DKGD 1MA9B 4ILHA 5H1SQ 2I7PA 1NJIO 1KXPA 2ASPA 4CZMA 3E1YA 3WQUA 4BR0A 4O8KA 4IDHA 4BC3A 2QA4N 4XH5A 3IMXA 3R1XA 5AQWA 5GAEP 5M1NA 1VQKN 1MWMA 5AQUA 3I55N 1Q86O 5AFUA 3WUHA 1W2BM 3E9LA 2WBNA 3A8YA 3CCRN 2NRRA 2YHWA 3KHYA 3LM9A 4FWPA 1OKJA 3CJ1A 1HX1A 3FZKA 5E84A 1U6ZA 4OO1J 1E4GT 2ASMA 1YUWA 1S3XA 3GE1A 3QFUA 4M63C 3VGMA 3GOIA 1P90A 3F2KA 3MCPA 2FSKA 4MO5A 3CXCM 4BRPA 1GLFO 1QQMA 1Z05A 2Q1NA 3KZBA 2CH6A 2QWMA 2E2PA 3CQYA 2BUPA 3P39A 4BRLA 4BR4A 1GLEG 1K8KB 3A5LC 4O5FA 3QMLA 2PFUA 4F9OA 4FVUA 4JKCA 3O6WA 4FWKA 3OBWA 5C12A 3CJ7A 1V4TA 3S41A 3JS6A 1VQ6N 3FZLA 4WCEL 5GADP 2GWJA 3J7ZO 4BC5A 3NVMA 4WQ5A 2RHKA 4ISEA 3CCJN 1NGJA 4OPAA 2VWBA 2A41A 4JNEA 3RVCA 3MWPA 3TTFA 2OTJN 3L6QA 4ISGA 5BN8A 2PAVA 5C0YA 4JKHA 3LDQA 3I8BA 5CR4A 4A57A 3TPQA 1ATNA 1DGKN 1GLAG 3VGLA 1YJNN 2J4RA 3MN7A 3MK6A 2QWPA 2F9TA 3TTCA 5ADXA 3CC4N 4DHYA 4JKGA 4AF1A 3N4QA 3VEVA 3C0BA 3CERA 1OVYA 3WXLA 1H1VA 1HKGA 1SAZA 3G6EN 1VQ8N 4JK8A 4FSVA 3BP8A 2NRTA 3MMVA 4AM6A 2WUSA 4XH1A 1T6DA 3PIOL 5GIOA 4PHTX 1BO5O 5LY3A 1X3MA 4IWVA 3Q7CA 3A5OC 3OW2M 5AQRA 2F9WA 2W00A 4NLCA 4FOEA 2HSTA 3FZMA 1BDGA 4FPBA 2F7TA 2IVPA 3BEXA 2FF3B 2KLAA 5AQTA 1YVNA 4JAXA 4YOVA 5BR9A 4GV3A 2C1GA 4BREA 5BN9A 4BR7A 4C23A 2GX9A 4K25A 1GLCG 3VENA 3O5BA 2NRVA 3O9TA 3QBWA 3HBTA 3O80A 3FZFA 2AP1A 4PL7A 3ULEA 2NZTA 2P9UB 4BRNA 2QI2A 4ILJA 1T44A 4BRCA 4JD2B 5AQKA 4FOIA 4I6MA 5EX5A 4B1VA 4IFEA 4CI6A 5KPTA 1K73O 5EXWA 5AZIB 5AZJA 4BG9A 1SQKA 4YOTA 1NGBA 5LJVA 2P9NB 4BRMA 4A5BA 1VQNN 2CGJA 5AQMA 3ZX2A 2QWLA 4JEPA 3IFRA 4QS8A 3L4QA 4H0OA 3VGKA 3O1WA 3UKRB 3AGKA 1C0GA 4FWLA 4B1XB 1NGGA 3L4IA 3ZEUA 1QVFM 4H0XB 3CETA 3IUCA 1ESVA 2E20A 2V51B 4KH6A 2ZJPL 1XC3A 4GY2B 1DEJA 2ITMA 2FSNA 1M1KO 2D0PA 3FFKB 2WC9A 3TTDA 2A40A 1WOQA 4K42A 3LDOA 4QS9A 4BGBA 3WEEB 1U2VB 2Q2RA 3QICA 3VEYA 3CPEA 3RSEB 3NMUA 5I9EB 3CJBA 3HOSA 1VQ9N 4JKBA 3VEWA 5FPNA 4BROA 1GLBG 5AQFA 3KWGA 3AGRA 2Q36A 1TUUA 1Y64A 4CZGA 4WQ4C 4IXCA 2ASOA 1MWKA 1BOTO 2Q0UA 2Q31A 4FWNA 5AQHA 3SMPA 3ZX3A 5HL7L 3PIPL 1NGCA 4PKGA 3CC2N 2CGKA 1R59O 5AQSA 1NGIA 4DQ8A 5M1FA 4YDUC 2YI1A 4BR5A 3EKSA 5EOYA 3DLLL 3G71N 3HSCA 4L3QA 1ATSA 3CIPA 2E8AA 3MDQA 2NRHA 4QS7A 2A6AA 5DM7L 5EY4A 3DJCA 3CJ9A 4A62A 5KPZA 1CZAN 4IOAL 4JK9A 3VERA 3M3ZA 3EE9A 5AQJA 2ZJQL 2HMPA 3MCAB 3EE8A 3ZETB 2NRXA 4JHDA 2E2OA 2P9IA 2P9PA 3GBTA 4JKDA 3B8AX 4NLBA 2GTDA 5M1PA 5AQPA 3H3OB 4U7BA 2JWLA 1JJ2M 1RFQA 2P9KB 1SS6A 4H5VA 4YORA 2Q97A 1KQSM 5GINA 1O13A 3D7EO 2GWKA 3CCEN 5M1OA 3VTIA 1BWFO 2P9SA 2D4WA 2JWKA 5AQXA 5JLHA 3UKUA 1D4XA 4KH4A 4XEIA 3CCMN 2P9LA 4IO9L 2HBMA 1QZ5A 4A2BA 4GV6A 5AQLA 3CHWA 1YAGA 3SAGA 3WXIA 3I56N 4B9QA 3C7NB 3ATUA 3T69A 3H46O 4H5TA 3ENHA 3VF2A 4K43A 3VPZA 3UE5A 3WXMB 4E1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GLL O;  5BRE A;  3D2E B;  3BUZ B;  5ADX H;  3EKU A;  4H0V B;  2A3Z A;  4KBO A;  3HI0 A;  4BRF A;  3FE1 A;  4BRA A;  2VCP A;  1YXQ A;  2E1Y A;  3HM8 A;  4HWI A;  5AQQ A;  4CZH A;  5AQY A;  4BG8 A;  5AZJ B;  2FLO A;  3D2F A;  1C0F A;  1NGA A;  3FGU A;  3BF1 A;  1RGI A;  4MO4 A;  3M6G A;  1BG3 A;  5AQN A;  4BR9 A;  4DCH A;  1V4S A;  3SK3 A;  3U8X A;  1JCE A;  3GDQ A;  3DWL A;  4PKI A;  2OAN A;  3GL1 A;  5BRD A;  3O08 A;  1NM1 A;  3ATV A;  3DXK B;  4XH4 A;  1BUP A;  1EQY A;  1KAY A;  2Q0R A;  3O8M A;  4FWM A;  4NB4 A;  4EHT A;  1K8K A;  2FXU A;  2I7N A;  3LM2 A;  4B1Z A;  3EN9 A;  4CD3 A;  4FWQ A;  4CZE A;  3VEX A;  1XQS C;  2EWS A;  5KQ8 A;  4K41 A;  3FZH A;  4IJA A;  2NLX A;  3DAW A;  3UB5 A;  1TYQ B;  2YJE A;  4BVP A;  4H0P A;  1HUX A;  2DPN A;  2E2N A;  5KPR A;  3DXM B;  4MLE A;  4WQ4 A;  5BPL A;  5BRF A;  4BGA A;  1BA1 A;  3QDK A;  3SLC A;  2V7Y A;  5E26 A;  3LDL A;  4CZL A;  2E2Q A;  3M1F A;  5FPD A;  4YDU A;  1HPM A;  3IDH A;  1QQN A;  3O4W A;  4BRG A;  1XUP O;  4WYB A;  1ZXO A;  2IVN A;  4CZJ A;  1NBW A;  4FL9 A;  1KAX A;  2KHO A;  1BA0 A;  3VEZ A;  2ZWH A;  4LC9 B;  3TU5 A;  1QQO A;  4NO7 A;  2ZF5 O;  3BF3 A;  2D1K A;  3A5M C;  4DB3 A;  4CJ7 A;  4A61 A;  4H5W A;  3MN6 A;  2HOE A;  4BRQ A;  1KAZ A;  2AA4 A;  2P9U A;  3FLC O;  3MN9 A;  2W41 A;  3QFP A;  2HF4 A;  2HF3 A;  3EZW A;  4BRH A;  4JD2 A;  2VYP A;  2QWN A;  5AFU H;  1NGF A;  3U9D A;  4PL8 A;  3FR0 A;  3VF6 A;  4CBX A;  1ZC6 A;  2P9N A;  1NGD A;  3CJC A;  4B1Y B;  3AAP A;  1MDU B;  4H03 B;  4M7Y A;  4RCH A;  3UKR A;  3H6E A;  3JXU A;  4B1W B;  3AY9 A;  4FWS A;  2GUP A;  1LCU A;  3F9M A;  4CBU A;  3QB0 A;  2A42 A;  1GLD G;  1J6Z A;  5JIC A;  3WXJ A;  3D2F B;  2E88 A;  1X3N A;  4H0T B;  5AQI A;  3WQT A;  3W0L A;  3WEE A;  1U2V A;  4BQZ A;  4AM7 A;  4RTF D;  1BU6 O;  3RSE A;  3O1B A;  3CQX A;  4CZI A;  1QZ6 A;  2H3G X;  4BC4 A;  4H5R A;  2QWO A;  2FF6 A;  4MLH A;  3U9Z A;  3EL2 A;  3ULE B;  3VOV A;  1IJJ A;  3ENO A;  4ISF A;  1NGE A;  5AQV A;  3AAQ A;  1NLV A;  4I6M B;  3H45 C;  3U4L A;  4FO0 A;  4JN4 A;  5TKY A;  4BC2 A;  3SJH A;  3VEO A;  2QXL A;  1JCG A;  1WUA A;  1JCF A;  4A2A A;  2ZGY A;  2FSJ A;  4IO8 A;  3ZET A;  5KQD A;  1NMD A;  1IG8 A;  3ZEU B;  5JMV A;  2P9K A;  1NWK A;  3CI5 A;  2D0O A;  3LDP A;  3A0I X;  4EAH D;  4EIA A;  3OHR A;  2ZGZ A;  1RDW X;  4CD1 A;  4WQ5 C;  5ELZ A;  1G99 A;  2UYT A;  3CJA A;  3W3D A;  3HZ6 A;  4Z94 A;  3EO3 A;  3VES A;  5F2R A;  1LOT B;  4H5N A;  5AQO A;  5AQG A;  4BVO A;  5BRH A;  3LDN A;  3C7N A;  4FWO A;  2QM1 A;  4RWT A;  5FPE A;  3I33 A;  4M7X A;  3KVG A;  5CE3 A;  5B8H A;  3D2E A;  4EHU A;  4GNI A;  4EFH A;  3H1V X;  4BRK A;  3MN5 A;  5EVZ A;  4BRD A;  4IJN A;  2V52 B;  2CH5 A;  1ZBS A;  5LJW A;  2E1Z A;  4B1U B;  1E4F T;  4FPA A;  1X9J A;  5F0X A;  1NGH A;  2GEL A;  1ATR A;  5F1X A;  1HLU A;  4JHD B;  2P9I B;  2P9P B;  3HTV A;  3GG4 A;  2QWQ A;  2YJF A;  5FPM A;  3ZX0 A;  4BR2 A;  3H3N O;  3SMS A;  2A5X A;  2GEM A;  4CZK A;  2W40 A;  4IZ9 A;  2PBD A;  4J8F A;  4Y0W A;  2V7Z A;  3H1Q A;  3AAR A;  3VET A;  3WXK A;  3J8A A;  3L0Q A;  4BRI A;  3DXK A;  3VF4 A;  1HJO A;  2P9S B;  5BPN A;  4BQL A;  1Z6R A;  3G25 A;  3UKU B;  2IVO A;  2QW9 A;  2IIR A;  1TUY A;  5BPM A;  2YCH A;  3P4I A;  2P9L B;  2CGL A;  4PKH A;  1Q18 A;  2YHY A;  3ID8 A;  4H0Y B;  1HKB A;  5AR0 A;  3R9P A;  3A5N C;  5AQZ A;  1SZ2 A;  5AZI A;  3WT0 A;  3LL3 A;  1TYQ A;  4CBW A;  4FWR A;  3QBX A;  4CZF A;  2QWR A;  3R6M A;  1T6C A;  4HTL A;  1S22 A;  1QHA A;  1HKC A;  1P8Z A;  1GLJ O;  2YHX A;  2BTF A;  3DXM A;  3R8E A;  1DKG D;  1MA9 B;  2I7P A;  1KXP A;  2ASP A;  4CZM A;  3WQU A;  4BR0 A;  4O8K A;  4BC3 A;  4XH5 A;  3IMX A;  5AQW A;  1MWM A;  5AQU A;  5AFU A;  3WUH A;  3A8Y A;  2YHW A;  3KHY A;  3LM9 A;  4FWP A;  1OKJ A;  3CJ1 A;  1HX1 A;  3FZK A;  5E84 A;  1U6Z A;  1E4G T;  2ASM A;  1YUW A;  1S3X A;  3GE1 A;  3QFU A;  4M63 C;  3VGM A;  3GOI A;  3MCP A;  2FSK A;  4MO5 A;  4BRP A;  1GLF O;  1QQM A;  1Z05 A;  2Q1N A;  3KZB A;  2CH6 A;  2QWM A;  2E2P A;  3CQY A;  2BUP A;  4BRL A;  4BR4 A;  1GLE G;  1K8K B;  3A5L C;  4O5F A;  3QML A;  4F9O A;  3O6W A;  4FWK A;  3CJ7 A;  1V4T A;  3S41 A;  3JS6 A;  3FZL A;  2GWJ A;  4BC5 A;  4WQ5 A;  4ISE A;  1NGJ A;  2VWB A;  2A41 A;  4JNE A;  3L6Q A;  4ISG A;  5BN8 A;  2PAV A;  3LDQ A;  3I8B A;  3TPQ A;  1ATN A;  1DGK N;  1GLA G;  3VGL A;  2J4R A;  3MN7 A;  3MK6 A;  2QWP A;  2F9T A;  5ADX A;  4DHY A;  3VEV A;  3C0B A;  3CER A;  3WXL A;  1H1V A;  1HKG A;  1SAZ A;  4FSV A;  3BP8 A;  3MMV A;  4AM6 A;  2WUS A;  4XH1 A;  1T6D A;  1BO5 O;  5LY3 A;  1X3M A;  4IWV A;  3A5O C;  5AQR A;  2F9W A;  4FOE A;  3FZM A;  1BDG A;  4FPB A;  2IVP A;  3BEX A;  2FF3 B;  5AQT A;  1YVN A;  4JAX A;  5BR9 A;  4BRE A;  5BN9 A;  4BR7 A;  4C23 A;  4K25 A;  1GLC G;  3VEN A;  3O5B A;  3QBW A;  3HBT A;  3O80 A;  3FZF A;  2AP1 A;  4PL7 A;  3ULE A;  2NZT A;  2P9U B;  4BRN A;  4BRC A;  1T44 A;  4JD2 B;  5AQK A;  4FOI A;  4I6M A;  5EX5 A;  4B1V A;  4CI6 A;  5KPT A;  5EXW A;  5AZI B;  5AZJ A;  4BG9 A;  1SQK A;  5LJV A;  1NGB A;  2P9N B;  4BRM A;  2CGJ A;  5AQM A;  3ZX2 A;  2QWL A;  3IFR A;  4QS8 A;  3VGK A;  4H0O A;  3O1W A;  3UKR B;  1C0G A;  4FWL A;  4B1X B;  1NGG A;  3L4I A;  3ZEU A;  4H0X B;  3CET A;  3IUC A;  1ESV A;  2E20 A;  2V51 B;  1XC3 A;  4GY2 B;  1DEJ A;  2ITM A;  2FSN A;  2D0P A;  3FFK B;  2A40 A;  1WOQ A;  4K42 A;  3LDO A;  4QS9 A;  4BGB A;  3WEE B;  1U2V B;  2Q2R A;  3QIC A;  3VEY A;  3RSE B;  5I9E B;  3CJB A;  3VEW A;  5FPN A;  4BRO A;  1GLB G;  5AQF A;  2Q36 A;  1TUU A;  1Y64 A;  4CZG A;  4WQ4 C;  4IXC A;  2ASO A;  1MWK A;  1BOT O;  2Q0U A;  2Q31 A;  4FWN A;  5AQH A;  3SMP A;  3ZX3 A;  1NGC A;  4PKG A;  2CGK A;  1R59 O;  5AQS A;  1NGI A;  4DQ8 A;  4YDU C;  2YI1 A;  4BR5 A;  3EKS A;  5EOY A;  3HSC A;  4L3Q A;  1ATS A;  3CIP A;  2E8A A;  3MDQ A;  2NRH A;  4QS7 A;  2A6A A;  5EY4 A;  3DJC A;  3CJ9 A;  4A62 A;  5KPZ A;  1CZA N;  3VER A;  3M3Z A;  5AQJ A;  2HMP A;  3ZET B;  4JHD A;  2E2O A;  2P9I A;  2P9P A;  3GBT A;  5JLF A;  3B8A X;  2GTD A;  5AQP A;  3H3O B;  1RFQ A;  2P9K B;  4H5V A;  2Q97 A;  3D7E O;  2GWK A;  1BWF O;  2P9S A;  2D4W A;  5AQX A;  5JLH A;  3UKU A;  1D4X A;  4XEI A;  2P9L A;  1QZ5 A;  4A2B A;  5AQL A;  3CHW A;  1YAG A;  3WXI A;  4B9Q A;  3C7N B;  3ATU A;  3H46 O;  4H5T A;  3ENH A;  3VF2 A;  4K43 A;  3VPZ A;  3UE5 A;  4E1J A; 
#chains in the Genus database with same CATH topology
 1S9G A;  5BRE A;  1VQP N;  1HQE A;  3LAN A;  2F96 A;  3QNO A;  3EKU A;  4H0V B;  4KBO A;  3V81 A;  3R3L A;  3FE1 A;  5EU7 A;  2VCP A;  4HWI A;  4CZH A;  4BG8 A;  2FLO A;  3EYZ A;  3K5M A;  4OPH A;  1NGA A;  3SBG A;  3CCV N;  1N5Y A;  4FJ8 A;  2G8W A;  2KQ2 A;  2X6N A;  4PKI A;  1S5J A;  4LSL A;  4DU3 A;  1YF5 L;  4IEI A;  1J9A A;  4CHZ A;  1BUP A;  4FWM A;  5AJ3 K;  4A59 A;  4CZE A;  1ZBI A;  3QET A;  1JLF A;  1WAJ A;  4K41 A;  3FZH A;  4IJA A;  3CF5 L;  3VMF B;  3NF6 A;  2PY5 A;  5GAH P;  4K0K K;  1HUX A;  3P1G A;  4CEO A;  4DQI A;  1S72 N;  4G1Q A;  5KPR A;  4MLE A;  3TSU A;  4CEB A;  5E26 A;  3LDS A;  1HPM A;  4OKE A;  1QQN A;  4DSF A;  3O4W A;  1JLQ A;  1ZXO A;  1IBL K;  2PYL A;  1NBW A;  1FJG K;  3T19 A;  3VEZ A;  4JKF A;  3VA0 A;  1QQO A;  2HBJ A;  3A5M C;  5JS2 A;  3KWI A;  5FRO A;  4CJ7 A;  1IKY A;  2XO7 A;  4FXD A;  2ETJ A;  4MDA A;  4BRQ A;  4B3O A;  4KPY A;  3QFP A;  5LL6 Z;  3EZW A;  2FC0 A;  2QWN A;  4HHT A;  3U9D A;  1LWC A;  3FR0 A;  1RTH A;  3CME N;  1TL1 A;  4GW6 A;  3AAP A;  1C1A A;  1MDU B;  3PUF A;  1C1B A;  3H6E A;  3I0S A;  1YHQ N;  2OYQ A;  3AO5 A;  3F9M A;  3M5R A;  1J6Z A;  2O8E A;  3KLG A;  3WXJ A;  4BEB A;  4NCG A;  1JLC A;  3O9U A;  4MFB A;  4DSL A;  3WEE A;  1JL2 A;  2O4G A;  4BQZ A;  1B9D A;  1BU6 O;  3RSE A;  3O1B A;  4KHQ A;  3K9K A;  1FKO A;  4CZI A;  1EO1 A;  2UUB K;  4MDB A;  3B6O A;  4IOX A;  4B8A B;  2OPP A;  3ULE B;  4W5O A;  1NGE A;  4YOY A;  2Z1I A;  1TK0 A;  1X9M A;  4DFJ A;  1HJR A;  3AVG A;  3H45 C;  3U4L A;  4FO0 A;  4NCB A;  4JK7 A;  2HHW A;  3KTQ A;  2XHB A;  2BH1 A;  2O8B B;  1IBM K;  2IGI A;  5LMN K;  4CJP A;  4KB1 A;  5SWM A;  2ZGY A;  1JKH A;  4O0J A;  4CJE A;  1U4B A;  3HXM A;  4JI1 K;  1NWK A;  4FJN A;  3CI5 A;  3HPH A;  2VWK A;  4BDY A;  4F2R A;  4O44 A;  1D5A A;  1G99 A;  4U67 L;  3V9W A;  3CJA A;  3OA9 A;  4KH5 A;  3OTO K;  1QVG M;  1FK9 A;  5C15 A;  4DTU A;  3VQB A;  3ITH A;  1I94 K;  3C95 A;  3HPO A;  5MLC Q;  1REV A;  4LFC K;  2YNF A;  2QK9 A;  3BY5 A;  3MN5 A;  4BRD A;  2V52 B;  2CH5 A;  5D3G A;  1RT5 A;  1E4F T;  1W97 L;  4FPA A;  3KD1 E;  4X64 K;  2HBL A;  5F0X A;  3QIO A;  5J2N A;  3KLF A;  4B9U A;  5GAG P;  4CW7 B;  4CIE A;  3QES A;  4BR2 A;  3F73 A;  1NJW A;  4CF0 A;  3QLH A;  2PBD A;  3VET A;  2V7Z A;  3H1Q A;  3AAR A;  3WXK A;  4YOU A;  3J8A A;  3L0Q A;  4WFN L;  3IG1 A;  3DXK A;  2O8E B;  3VF4 A;  1HJO A;  4DR2 K;  1Z6R A;  2HW3 A;  3UKU B;  3V9S A;  1TUY A;  2YHY A;  3ULD A;  3ID8 A;  2QEX N;  1XMQ K;  5AR0 A;  3R9P A;  3A5N C;  3L2R A;  1WN7 A;  3HYF A;  5CY4 A;  1QHA A;  3C6H A;  1IBK K;  1P8Z A;  3LP3 A;  2YHX A;  2BTF A;  3R8E A;  3OS0 A;  1WAF A;  1QSS A;  1LW0 A;  3E1Y A;  2QA4 N;  4RW4 A;  4BC3 A;  3R1X A;  1VQK N;  1N33 K;  1Q86 O;  5AFU A;  4CJ4 A;  4CCH A;  1RBS A;  3ZSQ A;  1U6Z A;  3DLR A;  1E4G T;  2P5G A;  1EWQ A;  1L3U A;  1P90 A;  4FW1 A;  3NH0 A;  2A1R A;  3CXC M;  4MO5 A;  4BRP A;  1GLF O;  1X9S A;  4LFB K;  1S1X A;  1GLE G;  4JKC A;  4J2A A;  3O6W A;  3OBW A;  3CJ7 A;  3JS6 A;  4DQS A;  3HL8 A;  4BC5 A;  3CCJ N;  4WQ5 A;  4ISE A;  3OYB A;  4OPA A;  2YKN A;  4FW2 A;  3MWP A;  3TTF A;  3V9Z A;  1QE1 A;  4OGC A;  5BN8 A;  5HP1 A;  2B4J A;  3LDQ A;  3I8B A;  2D5R A;  1Q9Y A;  1ATN A;  1DGK N;  4BAC A;  2O8D A;  1UOC A;  4JLH A;  1NOY A;  2QWP A;  2F9T A;  4JKG A;  4AF1 A;  4B3R K;  3C0B A;  4Z4C A;  2LSN A;  1CXQ A;  4FSV A;  4JK8 A;  3VQA A;  3MMV A;  4DU1 A;  4Z4F A;  4CFA A;  5KGW A;  3OW2 M;  3Q7C A;  1EP4 A;  5AQR A;  3HM9 A;  2W00 A;  5JEN A;  4FJK A;  1WBB A;  3FZM A;  1NK5 A;  2GUI A;  4CVN E;  1B9F A;  4K25 A;  2NRV A;  3NH2 A;  3QBW A;  3HBT A;  4PL7 A;  3VQQ A;  2P9U B;  2QI2 A;  3PX6 A;  4JD2 B;  5AQK A;  3CFR A;  3ZSW A;  3AA5 X;  5AZJ A;  1SQK A;  4I9L A;  4RG8 A;  5HRO A;  3O1W A;  4B1X B;  4J2B A;  1QHT A;  3CET A;  5JS1 A;  2HHS A;  1XC3 A;  4GY2 B;  1DEJ A;  3P83 D;  2WC9 A;  2A40 A;  3WNG A;  1WOQ A;  4K42 A;  3TAB A;  4B3M K;  4QS9 A;  3MXI A;  3CPE A;  3O4N A;  1RT7 A;  5I9E B;  4JKB A;  3VEW A;  5AQF A;  3AGR A;  2Q36 A;  1RT6 A;  1LWE A;  4CZG A;  5BR8 K;  2QKK A;  1VSJ A;  5HRP A;  1BIS A;  1N36 K;  5HL7 L;  2Q0U A;  3SMP A;  3PIP L;  1NGC A;  4DTP A;  2HNZ A;  4DQ8 A;  3TAQ A;  4J2E A;  2YI1 A;  3DYA A;  1RT2 A;  4IG3 A;  3MDQ A;  5KTQ A;  3HP9 A;  4JI0 K;  3RR8 A;  1Z25 A;  3OYI A;  4DSI A;  1DLO A;  2HMP A;  1IKV A;  3M8Q A;  3EE8 A;  3MCA B;  2W42 A;  3ZET B;  4FLU A;  2NRX A;  5IWA K;  4JKD A;  4FLW A;  3WNH A;  1YTA A;  3H3O B;  2JWL A;  1RFQ A;  2P51 A;  3NF9 A;  2P9K B;  1SS6 A;  2IOC A;  1BIZ A;  4CEA A;  4YOR A;  2Q97 A;  5GIN A;  1O13 A;  4LH4 A;  4JI8 K;  3CCE N;  1RNH A;  2X78 A;  2RN2 A;  5AQX A;  5JLH A;  4FJG A;  2P9L A;  3HK2 A;  2HBM A;  4A2B A;  4ID1 A;  4W5R A;  3T69 A;  4XIU A;  3ENH A;  4HCC A;  1NMN A;  3WXM B;  1VQO N;  1GLL O;  5DK5 A;  3RMB A;  4JI7 K;  2A3Z A;  1XMO K;  2JGU A;  2BAN A;  2OCE A;  4MQ3 A;  1YXQ A;  3O4Q A;  1TGO A;  3QO9 A;  4CIG A;  5AQY A;  1NG9 A;  3SAH A;  3AO4 A;  5AZJ B;  2X6S A;  4DUY K;  4O8U A;  1C0F A;  3THX B;  4CJ5 A;  3LPU A;  3M8S A;  1OH5 A;  3MX2 A;  2O8C B;  1RGI A;  1SL1 A;  3U8X A;  3THW A;  3DWL A;  3ID6 A;  3GL1 A;  5BRD A;  4NB4 A;  3O8M A;  4C8N A;  4LF8 K;  4ZTJ A;  2HHQ A;  3EN9 A;  4CD3 A;  4AHU A;  3CD6 N;  4G9Z A;  5FRM A;  1XQS C;  2EWS A;  5KQ8 A;  4X65 K;  2O4I A;  3UB5 A;  4IKF A;  1YJW N;  5KRT A;  4BY9 C;  4LF7 K;  4DLE A;  1RBV A;  2E2N A;  3DXM B;  5BPL A;  3CPW M;  1BA1 A;  3QDK A;  2OPS A;  3M1F A;  5FPD A;  3UIQ A;  3P38 A;  2IVN A;  1TAU A;  3LP1 A;  4FL9 A;  4AIL C;  4FK2 A;  2VGN A;  1KAX A;  2HB5 A;  3P31 A;  1YI2 N;  2Z1G A;  3TU5 A;  4RW9 A;  4GV9 A;  2D1K A;  4A5A A;  1XHX A;  3WNF A;  4DB3 A;  4A61 A;  4H5W A;  3MN6 A;  2JLE A;  5C10 A;  3KLE A;  2UXB K;  3FLC O;  3MN9 A;  2W41 A;  3THY B;  1KD1 O;  2G8U A;  3TAF A;  4KTW A;  2VYP A;  4JKE A;  1HNX K;  2G8K A;  2P5O A;  3NDK A;  3KJV A;  1EX4 A;  3E9O A;  3TAN A;  3HVR A;  3V1Q A;  3CJC A;  4DV6 K;  1RCH A;  5SZT A;  3O9R A;  1TAQ A;  3ZT3 A;  2OZM A;  4M7Y A;  1XWL A;  4NXN K;  1SL2 A;  4JKA A;  3JXU A;  4FWS A;  1LCU A;  2A42 A;  1GLD G;  3CCQ N;  2QXF A;  4B08 A;  4Q5V A;  3LZJ A;  3RR7 A;  2A1S A;  1RDD A;  1ITG A;  3PSF A;  2HBK A;  1FW6 A;  5JVG L;  3WQT A;  1U2V A;  4B9M A;  4RTF D;  4CFD A;  5FRN A;  1QZ6 A;  4CEE A;  3HPG A;  3SPZ A;  4BC4 A;  3DRS A;  1G15 A;  3J81 O;  1NKE A;  3RRH A;  2OPR A;  5C25 A;  3EL2 A;  1WLJ A;  3ENO A;  4ISF A;  4CFC A;  2KZZ A;  5AQV A;  1O1W A;  1NLV A;  4FVM A;  4CF1 A;  4I6M B;  1EET A;  3SUO A;  2W6K A;  1NK6 A;  3OYK A;  4KI6 A;  1VSM A;  3KD5 E;  3SAF A;  3ZSR A;  1VQ4 N;  4C8M A;  3EEQ A;  2QXL A;  3C6U A;  1WUA A;  5C2D A;  4PA1 A;  4A2A A;  2FSJ A;  2DFE A;  5KQD A;  3JSM A;  1NMD A;  1IG8 A;  3ZEU B;  3CFP A;  1NK8 A;  4CJW A;  4CJS A;  2O8F A;  4EAH D;  4EIA A;  1JLA A;  4NCA A;  4W5Q A;  4DV7 K;  4CJU A;  3N4P A;  3KIO A;  4FJL A;  1LOT B;  5BRH A;  3LDN A;  4BEC A;  3VQE A;  3PO5 A;  4KHY A;  2QM1 A;  2E5L K;  3I33 A;  3KK1 A;  4B9N A;  4UY8 O;  4E1M A;  3OYL A;  3K0S A;  3D2E A;  3DMJ A;  4X62 K;  3EY1 A;  4Z4E A;  4B1U B;  4CES A;  3VQP A;  3SI6 A;  3SYZ A;  4CED A;  1X9J A;  4AHV A;  3MEG A;  1BCM A;  2GEL A;  3MX5 A;  1VQ5 N;  1KCF A;  2P9I B;  2P9P B;  4ILG B;  2VG7 A;  3ZX0 A;  3SMS A;  1J5O A;  2GEM A;  3TAG A;  3K5N A;  1Q7Y O;  4OPK A;  1RTJ A;  4J8F A;  2VQF K;  4BRI A;  1NOZ A;  1VHX A;  2P9S B;  2NRZ A;  3DM2 A;  1T7P A;  3S5T A;  4LFA K;  4PKH A;  4WE1 A;  1BI4 B;  4PUO A;  4DMN A;  3D45 A;  4X66 K;  1ASU A;  3ZYY X;  5AQZ A;  4ZHR A;  5AZI A;  1SKW A;  1TYQ A;  3QBX A;  3LAM A;  4CEQ A;  3A2F A;  1T6C A;  3SJJ A;  2BDP A;  1UWB A;  3L2W A;  4M3W A;  3U6F A;  3VQ5 A;  3LZI A;  3O3F A;  1DKG D;  1FKP A;  5H1S Q;  2ATQ A;  2XY5 A;  4CZM A;  1ZYQ A;  4HCB A;  3OYF A;  2YNH A;  4BR0 A;  4O8K A;  4IDH A;  5AQW A;  5GAE P;  5M1N A;  1JXB A;  3K58 A;  4DF8 A;  3WUH A;  1W2B M;  2WBN A;  3LM9 A;  4FWP A;  3CJ1 A;  3VQ6 A;  1OH7 A;  1SKR A;  4OO1 J;  1C0M A;  4JS5 A;  4DQQ A;  1YUW A;  4M42 A;  2KFZ A;  2I5J A;  4N76 A;  2FSK A;  1C1C A;  2UXC K;  4DSJ A;  1QQM A;  4BE0 A;  1Z05 A;  2HHT A;  2CH6 A;  2QWM A;  4BRL A;  2BUP A;  4OX9 K;  3QML A;  4BWM A;  1V4T A;  3S41 A;  4PWD A;  3FZL A;  5GAD P;  3SZ2 A;  2RHK A;  1NGJ A;  4CGG A;  1S6Q A;  3L6Q A;  5CZ1 A;  2PAV A;  3BDP A;  4PQU A;  3MN7 A;  1U45 A;  2RKI A;  3E01 A;  3TTC A;  3CC4 N;  1CZB A;  4JV5 K;  3SQ2 A;  3WXL A;  1H1V A;  1HKG A;  1SAZ A;  5K14 A;  3V6D A;  1OH6 A;  2D0A A;  2WUS A;  4XH1 A;  1T6D A;  3AVH A;  3L2U A;  4PHT X;  1X3M A;  3LWL A;  3A5O C;  3RRG A;  1T03 A;  1LV5 A;  4FLX A;  4B3S K;  2UUC K;  1RBT A;  2F7T A;  2ZM6 K;  2IVP A;  1YVN A;  2C1G A;  5BN9 A;  4C23 A;  1UAX A;  2GX9 A;  4CJR A;  1N32 K;  3O5B A;  3O9T A;  3NHG A;  1NJX A;  4LF6 K;  2NZT A;  3MEC A;  1T44 A;  4AHT A;  4FOI A;  1SL0 A;  4KHN A;  5EX5 A;  4B1V A;  4B9S A;  5AZI B;  4YOT A;  4Z4G A;  2CGJ A;  2QWL A;  3PX4 A;  1I39 A;  3IFR A;  1BIU A;  4QS8 A;  3VGK A;  4LH5 A;  3VQD A;  1NK7 A;  3CYG A;  1KVA A;  5HRN A;  4CJF A;  2OPQ A;  3L4I A;  4DTS A;  4H0X B;  2W6L A;  3IUC A;  2E20 A;  1C0T A;  3PX0 A;  2FSN A;  3THV A;  3TTD A;  3SUQ A;  3LAL A;  1NK9 A;  2FBY A;  4BGB A;  3WEE B;  3HST B;  2Q2R A;  3VEY A;  4M3R A;  3RSE B;  1XNQ K;  3TAE A;  4BWJ A;  1GLB G;  4EZ6 A;  3KWG A;  3ZSZ A;  4ELU A;  3OYC A;  4WQ4 C;  3ALY A;  4ELT A;  2ASO A;  1MWK A;  1BOT O;  3CC2 N;  2YNG A;  2HHI A;  2YKM A;  4YDU C;  3G71 N;  3HSC A;  4L3Q A;  2E8A A;  4QS7 A;  4BE1 A;  5DM7 L;  3DJC A;  4CGJ A;  4A62 A;  1CZA N;  4IOA L;  3M3Z A;  3EE9 A;  4H4O A;  3OYM A;  4JHD A;  2E2O A;  5M1P A;  4NLB A;  3VQ7 A;  4W5N A;  1K6Y A;  1JJ2 M;  3T1A A;  4DLG A;  2VWJ A;  1KQS M;  3LAK A;  2AJQ A;  3K5O A;  4M3Y A;  3RMC A;  4EP5 A;  3VTI A;  4DS4 A;  2IDO A;  3O3H A;  4KH4 A;  4XEI A;  4KHS A;  4IO9 L;  1Z26 A;  5AQL A;  3CHW A;  3U3Y A;  1J5E K;  1W9H A;  5A2Q O;  3I56 N;  4CIF A;  3ATU A;  3H46 O;  3VF2 A;  3VPZ A;  3IRX A;  3T1H K;  3CMA N;  1HYS A;  2YV0 X;  3BUZ B;  4C1N I;  4JI6 K;  5CZ2 A;  3AVA A;  3TAR A;  2E1Y A;  1L3V A;  2YX6 A;  4E1N A;  4FZX C;  4CFB A;  1RIL A;  3D2F A;  1XC9 A;  3FGU A;  5J1E A;  2F8T A;  3HRG A;  3BF1 A;  4MO4 A;  4BR9 A;  1ZBU A;  4DTX A;  3AA3 A;  4KHW A;  3SK3 A;  3OS2 A;  2BE2 A;  3GDQ A;  1HYZ A;  2OAN A;  4M3X A;  3O08 A;  1IKW A;  1SKS A;  3DXK B;  4XH4 A;  3G4S N;  4DR3 K;  1K8K A;  2IC3 A;  2WFB A;  3HO1 A;  3LM2 A;  4B1Z A;  1WSJ A;  4FJH A;  3D6R A;  3VEX A;  1N6Q A;  3BGR A;  4KHU A;  4XJX A;  1RT4 A;  2NLX A;  1DT9 A;  4DU4 A;  4F3T A;  4IOC L;  4E0D A;  3L8B A;  1TV6 A;  4H0P A;  3OVN A;  4IG0 A;  1EWR A;  3OYE A;  2KKZ A;  3HT3 A;  3AVI A;  5BRF A;  1Q82 O;  4DFP A;  3SLC A;  2V7Y A;  3SPY A;  3DOL A;  4CZL A;  2E2Q A;  3F9K A;  3F5T A;  3NVK A;  4LF9 K;  4BRG A;  1XUP O;  3AVJ A;  4WYB A;  4CHO A;  1KC8 O;  2G8F A;  2QTD A;  5HRR A;  3CCU N;  1X1P A;  2KHO A;  5J2P A;  1RT3 A;  3C65 A;  1QSL A;  2FBV A;  4IDK A;  4LC9 B;  1WB9 A;  3BF3 A;  1HNV A;  3OYH A;  1YIJ N;  2HOE A;  1KAZ A;  3T1Y K;  2HF4 A;  4R5P A;  2XY7 A;  5AFU H;  3KKS A;  1S9E A;  1U47 A;  4PL8 A;  1JXE A;  3VF6 A;  2P9N A;  4IFY A;  3ZT1 A;  4OKK A;  2O8D B;  4CF8 A;  3ZSV A;  4RCH A;  1VSL A;  3UKR A;  4B1W B;  3SQ4 A;  4JKG B;  4DR5 K;  2GUP A;  4CBU A;  4O0I A;  4JI5 K;  1NJZ A;  5JIC A;  4CGH A;  5FLX O;  3D2F B;  2E88 A;  4M3Z A;  4O4G A;  4H0T B;  4DTR A;  3C6T A;  3CCL N;  1B92 A;  3OYJ A;  3W0L A;  5CHI A;  1T8E A;  1YJ9 N;  3K57 A;  3ZT4 A;  1TVR A;  3AVL A;  4DSK A;  4M45 A;  3V9X A;  2C1I A;  2QWO A;  2FF6 A;  2DFF A;  3SBT A;  3U9Z A;  4CGF A;  4AH9 A;  3VOV A;  3S3M A;  5JVH L;  1IJJ A;  1ZBL A;  3DLK A;  3HJF A;  3TAM A;  3NCI A;  3ZLJ A;  3BZK A;  1LAW A;  3NAE A;  4JN4 A;  3QEX A;  1E3M A;  5TKY A;  4FM0 A;  1JCG A;  1JCF A;  4CGI A;  4WFA L;  4IO8 A;  4DQP A;  3M8P A;  3S3O A;  3AVK A;  3V1O A;  4OGE A;  3L2V A;  4OVL A;  3E66 A;  4B8C A;  3LDP A;  5M1Q A;  3OHR A;  4DWI A;  1BHL A;  4CD1 A;  2VQE K;  2UYT A;  3W3D A;  1VSI A;  1WSI A;  1W7A A;  3ASM A;  4Z94 A;  3OYG A;  1IKX A;  3VES A;  2F8S A;  5F2R A;  2YNI A;  5AQO A;  4BVO A;  3PY8 A;  3C7N A;  4B9T A;  3O3G A;  3PSI A;  4CJV A;  4J2D A;  1WSG A;  2E4L A;  2UUA K;  4M7X A;  4DV2 K;  4HTU A;  4I7F A;  1MU2 A;  3CM5 A;  4EHU A;  4GNI A;  2E6M A;  4FLY A;  3K9J A;  1TKZ A;  4BRK A;  5EVZ A;  1KLM A;  4IJN A;  2XY6 A;  3PLA A;  3NBP A;  4EP4 A;  2E1Z A;  4DS5 A;  4HUE A;  2IAJ A;  3J7Y P;  4QOZ B;  1NGH A;  1ATR A;  4CEF A;  5F1X A;  1BCO A;  4EZ9 A;  4RW8 A;  2EHG A;  2G8H A;  2A5X A;  4CZK A;  3DRR A;  4F3O A;  4IZ9 A;  1A5W A;  1LAV A;  1VAZ A;  3RTV A;  4BQL A;  3G25 A;  2IVO A;  3RWU A;  2IIR A;  5BPM A;  4RW6 A;  4AHS A;  3DRP A;  3P4I A;  2P9L B;  2CGL A;  4FLZ A;  1Q18 A;  3JYT A;  4H0Y B;  1HKB A;  3ZT2 A;  3KLI A;  3WT0 A;  3LL3 A;  3MAQ A;  4CBW A;  4FWR A;  3C6A A;  1S1W A;  2QWR A;  4HTL A;  3AVC A;  4OLB A;  1GLJ O;  3CFO A;  2XRI A;  1RDA A;  3KK3 A;  3SQ1 A;  1MA9 B;  3SV3 A;  2I7P A;  1NJI O;  1KXP A;  2ASP A;  1OVQ A;  3WQU A;  3SUN A;  2GBZ A;  3T3F A;  3IMX A;  3SNN A;  1MWM A;  5AQU A;  4DTM A;  2RF2 A;  4H4M A;  3S9H A;  3E9L A;  1IG9 A;  3A8Y A;  3CCR N;  4KI4 A;  2NRR A;  3DI6 A;  3VQC A;  1C0U A;  5E84 A;  3PV8 A;  3THW B;  4DR7 K;  2ASM A;  3GE1 A;  4M63 C;  2Z1H A;  3GOI A;  3MCP A;  4DV1 K;  3KZB A;  1WNS A;  1D9F A;  2E2P A;  1BQM A;  3ZT0 A;  4O5F A;  3L3V A;  4BR4 A;  3MEE A;  4F9O A;  3AA4 A;  3G10 A;  4FWK A;  5C12 A;  4FK4 A;  1RT1 A;  1XI1 A;  4WCE L;  1EXQ A;  3J7Z O;  3NVM A;  4FJ9 A;  2A41 A;  4JNE A;  3SV4 A;  3RVC A;  5C24 A;  3QIP A;  4ISG A;  4LSN A;  3K2P A;  3KKR A;  4JKH A;  5CR4 A;  4A57 A;  5LMU K;  4CJK A;  3VGL A;  1YJN N;  2WOM A;  3SQ0 A;  2J4R A;  4JI3 K;  5ADX A;  5KRS A;  3OJS A;  3DOK A;  3N4Q A;  4RW7 A;  3VEV A;  1NKB A;  4C8O A;  1L3S A;  3BP8 A;  4M41 A;  4KAZ A;  4ZTF A;  3BZC A;  2RPI A;  1TK8 A;  1BO5 O;  5LY3 A;  2F9W A;  4NLC A;  4HUF A;  2HVH A;  4FOE A;  2HST A;  4GMJ B;  1BDG A;  1JLE A;  4FPB A;  1T05 A;  1GOB A;  3BEX A;  2FF3 B;  2KLA A;  4KTZ A;  4JAX A;  3AVM A;  4KRF A;  1GLC G;  4DTJ A;  1U49 A;  3VEN A;  4DTO A;  1Q8I A;  3CYM A;  3FZF A;  2D0B A;  2HMI A;  3ULE A;  3RMA A;  4BRN A;  3MXJ A;  3SUP A;  5KPT A;  1K73 O;  2EX3 A;  1R0A A;  5EXW A;  4BG9 A;  5LJV A;  2HHU A;  4BRM A;  3NGI A;  5AQM A;  2O8B A;  3ISN C;  1D9D A;  4DTN A;  3L4Q A;  4H0O A;  1CLQ A;  4FWL A;  5DMR A;  3HVT A;  2V51 B;  2ITM A;  4KHP K;  3NFA A;  3TWH A;  3FFK B;  3AVF A;  1VRT A;  3LDO A;  1DTT A;  1U2V B;  2Y1J A;  1VSF A;  2HHV A;  4DG1 A;  3NMU A;  4DR1 K;  1TKX A;  1C6V A;  2R7Y A;  1TUU A;  4K8X A;  4W5T A;  4Q0B A;  5FDL A;  2Q31 A;  5AQH A;  4FWN A;  1HRH A;  4PKG A;  1R59 O;  5AQS A;  1NGI A;  5M1F A;  3P5J A;  1UA0 A;  5EOY A;  3DLL L;  3NF8 A;  3CIP A;  4I2Q A;  1JLG A;  4OLA A;  1X9W A;  1A5X A;  4JI2 K;  3K5L A;  3CJ9 A;  4JK9 A;  2YHB A;  2DFH A;  4FM1 A;  5AQJ A;  2ZJQ L;  4FJJ A;  2IS3 A;  3OYD A;  2PZS A;  5JLF A;  3GBT A;  4KB0 A;  1NNE A;  1Y97 A;  2GTD A;  5AQP A;  4U7B A;  3DLE A;  1XNR K;  2O8F B;  4H5V A;  3ZSO A;  1WSE A;  4Z4I A;  3D7E O;  2GWK A;  5M1O A;  1BWF O;  2D4W A;  4CK1 A;  2JWK A;  3UKU A;  3J7A P;  3CCM N;  1J54 A;  4GV6 A;  3KK2 A;  1GOA A;  3LP2 A;  3WXI A;  4FLT A;  4HVJ A;  3VN5 A;  4H5T A;  4E1J A;  1ASV A;  5I3U A;  1HNW K;  3D2E B;  3DLG A;  5ADX H;  4DR6 K;  3HI0 A;  4BRF A;  4BRA A;  2ZE2 A;  3HM8 A;  5AQQ A;  4CHP A;  3ZCM A;  4AHC A;  1M90 O;  4KTQ A;  3CCS N;  3M6G A;  1BG3 A;  5AQN A;  4DCH A;  3IKM A;  3HOT A;  2HHX A;  1V4S A;  1JCE A;  5J2M A;  1NM1 A;  3WNE A;  3ATV A;  4ID5 A;  1Q9X A;  4WF9 L;  1EQY A;  1KAY A;  2Q0R A;  1VSE A;  4EHT A;  1N8R O;  2I7N A;  2FXU A;  4CGD A;  4OPJ A;  1RBU A;  2VG5 A;  4GKJ K;  4IFV A;  4FWQ A;  4CJ3 A;  3I8D A;  4FK0 A;  3NGY A;  1HPZ A;  3DAW A;  1YIT N;  4E7K A;  1TYQ B;  2YJE A;  1KTQ A;  4BVP A;  3QNN A;  4GKK K;  4CHQ A;  2ZJR L;  4GVM A;  2DPN A;  1IH7 A;  4OKJ A;  4LY7 A;  3LWM A;  4WQ4 A;  5HOO A;  4BGA A;  3O9Q A;  3DLB A;  4DV5 K;  1A5V A;  5CYM A;  5DM6 L;  3LDL A;  5C42 A;  3G0Z A;  4YDU A;  3IDH A;  4R79 A;  3TAP A;  1TK5 A;  2KW4 A;  4C8L A;  2NNW A;  1N34 K;  3B6P A;  4CZJ A;  1HR0 K;  4KO0 A;  5CYQ A;  1BA0 A;  4E72 A;  4AQY K;  1K9M O;  2ZWH A;  4B9V A;  4NO7 A;  2ZF5 O;  5GIP A;  1T3V A;  4GVE A;  1YT3 A;  1NJY A;  2Q3S A;  4JS4 A;  2AA4 A;  1RDU A;  2P9U A;  1KFS A;  1QQC A;  4IBN A;  2OZS A;  2HF3 A;  4BRH A;  4JD2 A;  1NGF A;  4V19 S;  4JYA K;  4CBX A;  1ZC6 A;  4ELV A;  4FJ7 A;  3SCX A;  4DR4 K;  1NGD A;  4B1Y B;  3OBY A;  5KGX A;  3QER A;  4YY3 K;  3MXM A;  4H03 B;  4FJM A;  2VG6 A;  3LPT A;  3AY9 A;  3MWT A;  1ZBH A;  1EKE A;  1WSH A;  4Y1C A;  4DV3 K;  3QB0 A;  4IEE A;  3MED A;  1X3N A;  3TSP A;  4F4K A;  1NK0 A;  5AQI A;  1S1U A;  3I0R A;  4CHN A;  2KTQ A;  4AM7 A;  1OH8 A;  5IT9 O;  4CJL A;  3CQX A;  3QEW A;  4BE7 B;  4C1N K;  2QKB A;  2H3G X;  4H5R A;  2VGM A;  3FFI A;  4MLH A;  1XHZ A;  2G8V A;  1ZBF A;  2GV9 A;  1RTD A;  4CHY A;  3M8R A;  3IAY A;  3AAQ A;  1S1T A;  1TL3 A;  4DV4 K;  3ZSX A;  3ENB A;  1LW2 A;  1ILY A;  4YOW A;  4BC2 A;  4E7H A;  2HNY A;  3SJH A;  3KK7 A;  3CC7 N;  3VEO A;  1BL3 A;  1YTU A;  3ZET A;  3O9S A;  4YOX A;  4M3T A;  5JMV A;  3OYA A;  4CEZ A;  1VSH A;  2P9K A;  2Z1J A;  1RTI A;  3AV9 A;  1CZ9 A;  3V9U A;  2P1J A;  2B6A A;  2D0O A;  2RE2 A;  5HRS A;  3A0I X;  4CJT A;  1LWF A;  4ICL A;  4DKW A;  4C8K A;  2ZGZ A;  1BGX T;  1RDW X;  5C2F A;  3QEV A;  4WQ5 C;  5ELZ A;  3VTH A;  3Q7B A;  1U48 A;  4JRQ A;  1J53 A;  3HZ6 A;  3EO3 A;  4JI4 K;  2NRW A;  1JL1 A;  4KV8 A;  5HLF A;  3TI0 A;  4H5N A;  5AQG A;  1QTM A;  4DSE A;  4FWO A;  3QEI A;  1Q81 O;  2NUB A;  2HND A;  4RWT A;  4N47 A;  5J2Q A;  1VQM N;  5FPE A;  2OTL N;  4Z0U A;  3KVG A;  5CE3 A;  1VSD A;  5B8H A;  4DFM A;  4EFH A;  4E89 A;  1F21 A;  3H1V X;  4BE2 A;  3PO4 A;  1ZBS A;  5LJW A;  4QAG A;  4YHH K;  4CK3 A;  1IV0 A;  1KVB A;  4BDP A;  3THX A;  3NH1 A;  1BQN A;  4N5S A;  1HMV A;  4WFB L;  1HLU A;  2O8C A;  4JHD B;  1UA1 A;  3HTV A;  3GG4 A;  4DV0 K;  2QWQ A;  2YJF A;  5FPM A;  3H3N O;  2X74 A;  3HP6 A;  1D8Y A;  2W40 A;  1KLN A;  4Y0W A;  3V4I A;  5TKW A;  2PYJ A;  4KFB A;  4FJX A;  3NE6 A;  5KI6 A;  5BPN A;  1VQL N;  4L8R B;  2QW9 A;  1NU0 A;  2YCH A;  3E9P A;  4E19 A;  1QSY A;  1S6P A;  3T7Z A;  1VQ7 N;  4O55 A;  4PY5 A;  4F8R A;  1SZ2 A;  4CER A;  2XY8 A;  4DF4 A;  4K8Z A;  4E3S A;  4CZF A;  1K8A O;  3R6M A;  3AO2 A;  3QIN A;  1S22 A;  1HKC A;  2BGG A;  1U04 A;  1WSF A;  3TSQ A;  3JAM O;  5M1K A;  3DXM A;  3KLH A;  4ILH A;  4FZZ A;  5T7B A;  3VA3 A;  2KZM A;  3VQ8 A;  4XH5 A;  4F2S A;  1ASW A;  4NXM K;  3I55 N;  4N56 A;  2B5J A;  4FM2 A;  3S3N A;  2YHW A;  3KHY A;  1OKJ A;  3FZK A;  1HX1 A;  4E7L A;  3EZ5 A;  4OJR A;  1S3X A;  3QFU A;  3VGM A;  2WTU A;  4E7J A;  1TKD A;  3IS9 A;  1HNI A;  3F2K A;  3AVB A;  4CE9 A;  3VQ4 A;  2Q1N A;  3AO3 A;  3P39 A;  3CQY A;  2HHH K;  1K8K B;  3A5L C;  5HBM A;  2PFU A;  4FVU A;  4B9L A;  1HYV A;  1VQ6 N;  3L2Q A;  3QEP A;  2GWJ A;  3THY A;  4LF4 K;  1KFD A;  2VWB A;  4CJQ A;  3K59 A;  2OTJ N;  3TR8 A;  2D0C A;  4Z4H A;  5C0Y A;  1FXX A;  3CQ8 A;  4AHR A;  3TPQ A;  4CK2 A;  1GLA G;  3MK6 A;  3AVN A;  4DHY A;  3CER A;  1OVY A;  3RMD A;  1SV5 A;  3G6E N;  1KVC A;  1VQ8 N;  2NRT A;  4AM6 A;  5I42 A;  3PIO L;  5GIO A;  1CXU A;  4B3T K;  4IWV A;  1RDC A;  4FLV A;  2G8I A;  2F4V K;  4H8K A;  4CF2 A;  5AQT A;  4GV3 A;  4YOV A;  5BR9 A;  4BRE A;  1TKT A;  4BR7 A;  4YFU A;  1JLB A;  3L3U A;  3O80 A;  4TSX A;  2AP1 A;  4UQG A;  4NYF A;  4I9Q A;  2FBX A;  4ILJ A;  4BRC A;  1HQU A;  4I6M A;  4IFE A;  4CI6 A;  1I3A A;  1NGB A;  3H08 A;  2Y1I A;  2P9N B;  4KKO A;  1NKC A;  4A5B A;  1L5U A;  1VQN N;  3ZX2 A;  4DFK A;  4CEC A;  4JEP A;  2DTU A;  1YVU A;  1KSP A;  3OY9 A;  3VQ9 A;  3UKR B;  3AGK A;  1C0G A;  3AA2 A;  1KRP A;  1NGG A;  3ZEU A;  4FJ5 A;  1QVF M;  1ESV A;  1W0H A;  4FYD A;  4KH6 A;  4O5B A;  4HUG A;  2ZJP L;  2UXD K;  1M1K O;  1NK4 A;  2D0P A;  4KRE A;  2KFN A;  2E6L A;  1GOC A;  4I2P A;  4Y1D A;  2UU9 K;  3QIC A;  1VSK A;  3HOS A;  3CJB A;  1VQ9 N;  4N41 A;  5FPN A;  4CF9 A;  4BRO A;  1S1V A;  3DLH A;  1L3T A;  3OYN A;  4JRP A;  1Y64 A;  4IXC A;  3ZX3 A;  1HNZ K;  2CGK A;  1VRU A;  3CM6 A;  3NF7 A;  4BR5 A;  3EKS A;  4LF5 K;  1ATS A;  2NRH A;  4QCL A;  4DUZ K;  1SUQ A;  4M3U A;  2A6A A;  5EY4 A;  3LP0 A;  5KPZ A;  2FBT A;  3VER A;  3U3G A;  2WON A;  3V1R A;  2ZD1 A;  1DTQ A;  1RBR A;  1VK0 A;  4LD0 A;  1IO2 A;  4NYN A;  3J80 O;  3OJU A;  2P9I A;  2P9P A;  3B8A X;  5E41 A;  4DQR A;  2HVI A;  2DY4 A;  3ZSY A;  1WBD A;  2P9S A;  3CG7 A;  1D4X A;  2YHA A;  3OS1 A;  1RDB A;  2OA8 A;  4FCY A;  1QZ5 A;  4E7I A;  4FJI A;  1BI4 A;  1YAG A;  3SAG A;  4YNQ A;  4FZY A;  2ITG A;  4B9Q A;  3NGZ A;  3C7N B;  1QS4 A;  4BDZ A;  3D0P A;  2ZQB A;  4K43 A;  3UE5 A;  3C94 A;  3AO1 A; 
#chains in the Genus database with same CATH homology
 1GLL O;  3CMA N;  5BRE A;  1VQP N;  3D2E B;  3BUZ B;  5ADX H;  4C1N I;  3EKU A;  4H0V B;  2A3Z A;  4KBO A;  3HI0 A;  3R3L A;  4BRF A;  3FE1 A;  4BRA A;  2VCP A;  1YXQ A;  2E1Y A;  3HM8 A;  4HWI A;  5AQQ A;  2YX6 A;  4CZH A;  5AQY A;  4BG8 A;  3SAH A;  5AZJ B;  2FLO A;  3D2F A;  4O8U A;  1C0F A;  4OPH A;  1NGA A;  3FGU A;  3SBG A;  3HRG A;  1M90 O;  3CCS N;  3MX2 A;  3BF1 A;  1RGI A;  4MO4 A;  3M6G A;  1BG3 A;  5AQN A;  4BR9 A;  3CCV N;  4DCH A;  3IKM A;  3HOT A;  1V4S A;  3SK3 A;  3U8X A;  1JCE A;  3GDQ A;  3DWL A;  3ID6 A;  4PKI A;  2OAN A;  3GL1 A;  5BRD A;  1YF5 L;  3O08 A;  1NM1 A;  3ATV A;  3DXK B;  4IEI A;  4XH4 A;  3G4S N;  1BUP A;  4WF9 L;  1EQY A;  1KAY A;  2Q0R A;  3O8M A;  4FWM A;  4NB4 A;  4EHT A;  1N8R O;  1K8K A;  2FXU A;  2I7N A;  2WFB A;  3LM2 A;  4B1Z A;  3EN9 A;  4A59 A;  4CD3 A;  3CD6 N;  4FWQ A;  4G9Z A;  4CZE A;  3D6R A;  3VEX A;  1XQS C;  2EWS A;  5KQ8 A;  4XJX A;  4K41 A;  3FZH A;  4IJA A;  2NLX A;  3DAW A;  3CF5 L;  1DT9 A;  3UB5 A;  3VMF B;  4IOC L;  1YIT N;  1TYQ B;  2YJE A;  4BVP A;  5GAH P;  4H0P A;  1YJW N;  1HUX A;  2ZJR L;  2DPN A;  4BY9 C;  1S72 N;  2KKZ A;  2E2N A;  5KPR A;  3DXM B;  4MLE A;  4WQ4 A;  5BPL A;  5BRF A;  4BGA A;  5HOO A;  1BA1 A;  3CPW M;  3TSU A;  3O9Q A;  3QDK A;  1Q82 O;  3SLC A;  2V7Y A;  5E26 A;  5DM6 L;  3LDL A;  4CZL A;  2E2Q A;  3M1F A;  5FPD A;  4YDU A;  1HPM A;  3IDH A;  4R79 A;  3F5T A;  3NVK A;  1QQN A;  3O4W A;  4BRG A;  1XUP O;  3P38 A;  4WYB A;  1ZXO A;  2IVN A;  2NNW A;  1KC8 O;  4CZJ A;  1NBW A;  2QTD A;  4FL9 A;  2VGN A;  1KAX A;  3CCU N;  2KHO A;  1BA0 A;  3VEZ A;  3C65 A;  3P31 A;  1K9M O;  2ZWH A;  4JKF A;  4LC9 B;  1YI2 N;  3TU5 A;  1QQO A;  4NO7 A;  2ZF5 O;  2HBJ A;  2D1K A;  3BF3 A;  4A5A A;  4GV9 A;  3A5M C;  3KWI A;  1YIJ N;  4DB3 A;  4CJ7 A;  5GIP A;  4A61 A;  4H5W A;  3MN6 A;  1T3V A;  2HOE A;  4MDA A;  4GVE A;  5C10 A;  4BRQ A;  1KAZ A;  2AA4 A;  1RDU A;  2P9U A;  3FLC O;  3MN9 A;  2W41 A;  1KD1 O;  3QFP A;  2HF4 A;  2HF3 A;  3EZW A;  4BRH A;  4JD2 A;  2VYP A;  4JKE A;  2QWN A;  5AFU H;  1NGF A;  3E9O A;  3U9D A;  4PL8 A;  3FR0 A;  3VF6 A;  4CBX A;  3CME N;  1ZC6 A;  2P9N A;  1NGD A;  3CJC A;  4B1Y B;  3AAP A;  3OBY A;  3O9R A;  1MDU B;  4H03 B;  4M7Y A;  4RCH A;  3UKR A;  3H6E A;  4JKA A;  1YHQ N;  3JXU A;  4B1W B;  3AY9 A;  3MWT A;  4JKG B;  4FWS A;  2GUP A;  1LCU A;  3F9M A;  4CBU A;  3QB0 A;  2A42 A;  3M5R A;  1GLD G;  4IEE A;  1J6Z A;  3CCQ N;  5JIC A;  3WXJ A;  3D2F B;  4BEB A;  2E88 A;  1X3N A;  3TSP A;  3O9U A;  4H0T B;  5AQI A;  2HBK A;  5JVG L;  3CCL N;  3WQT A;  3W0L A;  3WEE A;  1U2V A;  4BQZ A;  4AM7 A;  5CHI A;  1YJ9 N;  4RTF D;  1BU6 O;  3RSE A;  3O1B A;  3CQX A;  3K9K A;  4BE7 B;  4CZI A;  1QZ6 A;  1EO1 A;  4C1N K;  2C1I A;  4MDB A;  2H3G X;  4BC4 A;  4H5R A;  4IOX A;  2QWO A;  2FF6 A;  2VGM A;  4MLH A;  3SBT A;  3U9Z A;  3EL2 A;  3ULE B;  3VOV A;  5JVH L;  1IJJ A;  3ENO A;  4ISF A;  1NGE A;  5AQV A;  4YOY A;  3AAQ A;  1NLV A;  3ENB A;  4I6M B;  3H45 C;  3U4L A;  1ILY A;  4FO0 A;  4YOW A;  4JN4 A;  4JK7 A;  5TKY A;  4BC2 A;  3SAF A;  3SJH A;  3KK7 A;  3CC7 N;  1VQ4 N;  2BH1 A;  3VEO A;  2QXL A;  1JCG A;  1WUA A;  5C2D A;  1JCF A;  4A2A A;  2ZGY A;  2FSJ A;  4IO8 A;  3ZET A;  4WFA L;  3O9S A;  5KQD A;  1NMD A;  4YOX A;  1IG8 A;  3ZEU B;  5JMV A;  2P9K A;  1NWK A;  1VQO N;  3E66 A;  3CI5 A;  2D0O A;  2RE2 A;  3LDP A;  5M1Q A;  3A0I X;  4EAH D;  4EIA A;  3OHR A;  4DKW A;  2ZGZ A;  5C2F A;  1RDW X;  4CD1 A;  4WQ5 C;  5ELZ A;  3VTH A;  3Q7B A;  1G99 A;  4U67 L;  2UYT A;  3CJA A;  3OA9 A;  4KH5 A;  3W3D A;  3N4P A;  3HZ6 A;  4Z94 A;  3EO3 A;  3VES A;  2NRW A;  1QVG M;  5F2R A;  1LOT B;  4H5N A;  5AQO A;  5AQG A;  4BVO A;  5BRH A;  3LDN A;  3C7N A;  5C15 A;  4BEC A;  4FWO A;  1Q81 O;  2QM1 A;  4RWT A;  1VQM N;  5FPE A;  3I33 A;  2OTL N;  4M7X A;  4UY8 O;  3KVG A;  5CE3 A;  5B8H A;  5MLC Q;  3D2E A;  4EHU A;  4GNI A;  4EFH A;  3H1V X;  3K9J A;  4BRK A;  3MN5 A;  5EVZ A;  4BRD A;  4IJN A;  2V52 B;  3PLA A;  2CH5 A;  1ZBS A;  5LJW A;  2E1Z A;  4B1U B;  1E4F T;  1W97 L;  4FPA A;  1X9J A;  2HBL A;  5F0X A;  1NGH A;  2GEL A;  1ATR A;  3MX5 A;  5F1X A;  1HLU A;  4WFB L;  4JHD B;  1VQ5 N;  5GAG P;  2P9I B;  2P9P B;  3HTV A;  3GG4 A;  4ILG B;  2QWQ A;  2YJF A;  5FPM A;  3ZX0 A;  4BR2 A;  3H3N O;  3SMS A;  2A5X A;  2GEM A;  4CZK A;  2W40 A;  4IZ9 A;  2PBD A;  1Q7Y O;  4J8F A;  4Y0W A;  2V7Z A;  3H1Q A;  3AAR A;  3VET A;  3WXK A;  1VAZ A;  3J8A A;  3L0Q A;  4YOU A;  5TKW A;  4BRI A;  5JLF A;  4WFN L;  3DXK A;  3VF4 A;  1HJO A;  2P9S B;  5BPN A;  1VQL N;  2NRZ A;  4BQL A;  1Z6R A;  3G25 A;  3UKU B;  2IVO A;  2QW9 A;  2IIR A;  1TUY A;  5BPM A;  2YCH A;  3E9P A;  3P4I A;  2P9L B;  2CGL A;  4PKH A;  1Q18 A;  2YHY A;  3T7Z A;  3ID8 A;  4H0Y B;  1VQ7 N;  2QEX N;  1HKB A;  5AR0 A;  3R9P A;  3A5N C;  3ZYY X;  5AQZ A;  1SZ2 A;  5AZI A;  3WT0 A;  3LL3 A;  1TYQ A;  4CBW A;  4FWR A;  3QBX A;  3C6A A;  4CZF A;  1K8A O;  2QWR A;  3R6M A;  1T6C A;  4HTL A;  1S22 A;  1QHA A;  3C6H A;  1HKC A;  1P8Z A;  1GLJ O;  2YHX A;  3TSQ A;  5M1K A;  2BTF A;  3DXM A;  3R8E A;  1DKG D;  1MA9 B;  4ILH A;  5H1S Q;  2I7P A;  1NJI O;  1KXP A;  2ASP A;  4CZM A;  3E1Y A;  3WQU A;  4BR0 A;  4O8K A;  4IDH A;  4BC3 A;  2QA4 N;  4XH5 A;  3IMX A;  3R1X A;  5AQW A;  5GAE P;  5M1N A;  1VQK N;  1MWM A;  5AQU A;  3I55 N;  1Q86 O;  5AFU A;  3WUH A;  1W2B M;  3E9L A;  2WBN A;  3A8Y A;  3CCR N;  2NRR A;  2YHW A;  3KHY A;  3LM9 A;  4FWP A;  1OKJ A;  3CJ1 A;  1HX1 A;  3FZK A;  5E84 A;  1U6Z A;  4OO1 J;  1E4G T;  2ASM A;  1YUW A;  1S3X A;  3GE1 A;  3QFU A;  4M63 C;  3VGM A;  3GOI A;  1P90 A;  3F2K A;  3MCP A;  2FSK A;  4MO5 A;  3CXC M;  4BRP A;  1GLF O;  1QQM A;  1Z05 A;  2Q1N A;  3KZB A;  2CH6 A;  2QWM A;  2E2P A;  3CQY A;  2BUP A;  3P39 A;  4BRL A;  4BR4 A;  1GLE G;  1K8K B;  3A5L C;  4O5F A;  3QML A;  2PFU A;  4F9O A;  4FVU A;  4JKC A;  3O6W A;  4FWK A;  3OBW A;  5C12 A;  3CJ7 A;  1V4T A;  3S41 A;  3JS6 A;  1VQ6 N;  3FZL A;  4WCE L;  5GAD P;  2GWJ A;  3J7Z O;  4BC5 A;  3NVM A;  4WQ5 A;  2RHK A;  4ISE A;  3CCJ N;  1NGJ A;  4OPA A;  2VWB A;  2A41 A;  4JNE A;  3RVC A;  3MWP A;  3TTF A;  2OTJ N;  3L6Q A;  4ISG A;  5BN8 A;  2PAV A;  5C0Y A;  4JKH A;  3LDQ A;  3I8B A;  5CR4 A;  4A57 A;  3TPQ A;  1ATN A;  1DGK N;  1GLA G;  3VGL A;  1YJN N;  2J4R A;  3MN7 A;  3MK6 A;  2QWP A;  2F9T A;  3TTC A;  5ADX A;  3CC4 N;  4DHY A;  4JKG A;  4AF1 A;  3N4Q A;  3VEV A;  3C0B A;  3CER A;  1OVY A;  3WXL A;  1H1V A;  1HKG A;  1SAZ A;  3G6E N;  1VQ8 N;  4JK8 A;  4FSV A;  3BP8 A;  2NRT A;  3MMV A;  4AM6 A;  2WUS A;  4XH1 A;  1T6D A;  3PIO L;  5GIO A;  4PHT X;  1BO5 O;  5LY3 A;  1X3M A;  4IWV A;  3Q7C A;  3A5O C;  3OW2 M;  5AQR A;  2F9W A;  2W00 A;  4NLC A;  4FOE A;  2HST A;  3FZM A;  1BDG A;  4FPB A;  2F7T A;  2IVP A;  3BEX A;  2FF3 B;  2KLA A;  5AQT A;  1YVN A;  4JAX A;  4YOV A;  5BR9 A;  4GV3 A;  2C1G A;  4BRE A;  5BN9 A;  4BR7 A;  4C23 A;  2GX9 A;  4K25 A;  1GLC G;  3VEN A;  3O5B A;  2NRV A;  3O9T A;  3QBW A;  3HBT A;  3O80 A;  3FZF A;  2AP1 A;  4PL7 A;  3ULE A;  2NZT A;  2P9U B;  4BRN A;  2QI2 A;  4ILJ A;  1T44 A;  4BRC A;  4JD2 B;  5AQK A;  4FOI A;  4I6M A;  5EX5 A;  4B1V A;  4IFE A;  4CI6 A;  5KPT A;  1K73 O;  5EXW A;  5AZI B;  5AZJ A;  4BG9 A;  1SQK A;  4YOT A;  1NGB A;  5LJV A;  2P9N B;  4BRM A;  4A5B A;  1VQN N;  2CGJ A;  5AQM A;  3ZX2 A;  2QWL A;  4JEP A;  3IFR A;  4QS8 A;  3L4Q A;  4H0O A;  3VGK A;  3O1W A;  3UKR B;  3AGK A;  1C0G A;  4FWL A;  4B1X B;  1NGG A;  3L4I A;  3ZEU A;  1QVF M;  4H0X B;  3CET A;  3IUC A;  1ESV A;  2E20 A;  2V51 B;  4KH6 A;  2ZJP L;  1XC3 A;  4GY2 B;  1DEJ A;  2ITM A;  2FSN A;  1M1K O;  2D0P A;  3FFK B;  2WC9 A;  3TTD A;  2A40 A;  1WOQ A;  4K42 A;  3LDO A;  4QS9 A;  4BGB A;  3WEE B;  1U2V B;  2Q2R A;  3QIC A;  3VEY A;  3CPE A;  3RSE B;  3NMU A;  5I9E B;  3CJB A;  3HOS A;  1VQ9 N;  4JKB A;  3VEW A;  5FPN A;  4BRO A;  1GLB G;  5AQF A;  3KWG A;  3AGR A;  2Q36 A;  1TUU A;  1Y64 A;  4CZG A;  4WQ4 C;  4IXC A;  2ASO A;  1MWK A;  1BOT O;  2Q0U A;  2Q31 A;  4FWN A;  5AQH A;  3SMP A;  3ZX3 A;  5HL7 L;  3PIP L;  1NGC A;  4PKG A;  3CC2 N;  2CGK A;  1R59 O;  5AQS A;  1NGI A;  4DQ8 A;  5M1F A;  4YDU C;  2YI1 A;  4BR5 A;  3EKS A;  5EOY A;  3DLL L;  3G71 N;  3HSC A;  4L3Q A;  1ATS A;  3CIP A;  2E8A A;  3MDQ A;  2NRH A;  4QS7 A;  2A6A A;  5DM7 L;  5EY4 A;  3DJC A;  3CJ9 A;  4A62 A;  5KPZ A;  1CZA N;  4IOA L;  4JK9 A;  3VER A;  3M3Z A;  3EE9 A;  5AQJ A;  2ZJQ L;  2HMP A;  3MCA B;  3EE8 A;  3ZET B;  2NRX A;  4JHD A;  2E2O A;  2P9I A;  2P9P A;  3GBT A;  4JKD A;  3B8A X;  4NLB A;  2GTD A;  5M1P A;  5AQP A;  3H3O B;  4U7B A;  2JWL A;  1JJ2 M;  1RFQ A;  2P9K B;  1SS6 A;  4H5V A;  4YOR A;  2Q97 A;  1KQS M;  5GIN A;  1O13 A;  3D7E O;  2GWK A;  3CCE N;  5M1O A;  3VTI A;  1BWF O;  2P9S A;  2D4W A;  2JWK A;  5AQX A;  5JLH A;  3UKU A;  1D4X A;  4KH4 A;  4XEI A;  3CCM N;  2P9L A;  4IO9 L;  2HBM A;  1QZ5 A;  4A2B A;  4GV6 A;  5AQL A;  3CHW A;  1YAG A;  3SAG A;  3WXI A;  3I56 N;  4B9Q A;  3C7N B;  3ATU A;  3T69 A;  3H46 O;  4H5T A;  3ENH A;  3VF2 A;  4K43 A;  3VPZ A;  3UE5 A;  3WXM B;  4E1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...