3UKRB

Crystal structure of bos taurus arp2/3 complex with bound inhibitor ck-666
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
193
structure length
193
Chain Sequence
GVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-related protein 3
publication title Structural characterization and computer-aided optimization of a small-molecule inhibitor of the Arp2/3 complex, a key regulator of the actin cytoskeleton.
pubmed doi rcsb
total genus 54
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ukrB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3ukrB02
3D2FB 3U8XA 2EWSA 4A61A 2QWNA 3EN9A 2GWKA 1DGKN 2HMPA 2P9SB 3D2FA 4H0OA 2YI1A 3MCPA 2VYPA 2P9SA 4H5NA 1XUPO 1GLFO 4BR7A 3CJCA 5KQ8A 3MN7A 4BR0A 3G25A 3VF2A 4A62A 4H0XB 5EOYA 1HKCA 2YJFA 4WQ5A 3CETA 1IG8A 5AFUA 4CBWA 4WQ4C 3BEXA 4GY2B 5JMVA 3H1QA 1Y64A 4PKHA 3CJ7A 4FWSA 1V4SA 1NGJA 2E2OA 5BPMA 1ZXOA 4H5WA 4Y0WA 1ATSA 2YCHA 4BRDA 1BWFO 4WQ4A 1HPMA 2ZGZA 3ATVA 3WEEB 1JCFA 1T44A 5AZIB 3VPZA 3O1BA 5BREA 3VEOA 3HM8A 2ITMA 3EZWA 2QWPA 3FLCO 3WT0A 5AZIA 3VF6A 1GLAG 4HWIA 3IMXA 4JNEA 1HKBA 5ELZA 2V7YA 1R59O 2D0PA 1YVNA 3VENA 2FXUA 1QQNA 1Z6RA 4BRNA 1LOTB 2Q36A 3ZEUB 1H1VA 2CGJA 4BRIA 2QWRA 5F0XA 2GWJA 3MN9A 4BR5A 4EHUA 1GLEG 3I8BA 3ZEUA 1NGFA 5FPNA 4QS7A 4BRMA 2Q0UA 2A42A 3F9MA 1MWMA 2HF3A 3D7EO 3ENHA 3ZX2A 4MLEA 3M6GA 1BOTO 3VESA 3C7NB 1WOQA 5AQFA 1IJJA 1E4GT 3A5LC 3U9DA 3RSEB 1C0FA 2QWOA 3VEYA 4DHYA 1Q18A 4YDUC 3LM9A 3HTVA 3ULEB 3RSEA 4FWQA 3EKSA 2QWQA 4CD1A 2D0OA 1GLBG 4MO4A 1NGGA 2E8AA 4K25A 1NBWA 3ULEA 4BC4A 2F9WA 3R9PA 3O08A 2GEMA 3WXLA 4YDUA 2YHXA 3D2EB 5AQKA 3GE1A 3VGMA 3L0QA 3LDLA 1QQOA 4H5VA 1BDGA 4FWPA 1TUUA 4BG9A 4BRKA 5BR9A 4B1YB 3C0BA 3A5NC 1TUYA 1YUWA 5AQXA 3H45C 4PL7A 4BGAA 4XH4A 4O5FA 1K8KB 4DQ8A 4H0VB 1NGEA 2NRHA 1GLJO 3VEWA 5AQOA 1BA0A 1G99A 2CH6A 3HI0A 1NGBA 1XQSC 3HSCA 3H3OB 1Z05A 2Q0RA 4I6MA 5E26A 3IFRA 4CI6A 1QHAA 1HLUA 5JLFA 1QZ5A 3WQUA 3A0IX 1RGIA 5AQZA 4BG8A 3FZHA 3FZFA 5LJVA 2CH5A 4Z94A 1QZ6A 4EIAA 2IIRA 2I7NA 4BC5A 5KPZA 1NGAA 4RWTA 3A8YA 3AARA 2P9KB 4BROA 3UKRB 4FL9A 1SZ2A 1TYQB 2P9IB 2ZGYA 5E84A 1GLDG 2P9KA 3VGKA 1KAZA 3UKRA 4FWMA 1TYQA 2A40A 2P9IA 2V52B 5AQRA 4CZLA 4WQ5C 3U4LA 5BPLA 5AQPA 3SMPA 3CI5A 5CE3A 4FSVA 3CJ1A 2AA4A 2IVPA 1ATNA 5AR0A 4MLHA 4B1UB 5AQQA 4M7XA 2A5XA 4BQZA 1T6DA 2YJEA 5F1XA 3LDOA 1BU6O 3H6EA 2QW9A 2NZTA 4ISEA 3FE1A 3UE5A 2DPNA 4ISGA 1NGCA 2FF6A 2E20A 3KVGA 3CQYA 3ID8A 1OKJA 4RTFD 5AZJB 3VETA 3WEEA 3CJ9A 3GL1A 4AM6A 4CZJA 4BRAA 1KAXA 3LDNA 4A2AA 5AZJA 2HOEA 4H03B 2Q31A 4CZKA 1RDWX 4K41A 2PBDA 3VERA 4XH1A 2BTFA 4FOEA 2W41A 2ASPA 4MO5A 2CGKA 4K42A 4NO7A 1QQMA 5AQNA 2A3ZA 3ATUA 3VEVA 1ZC6A 1JCGA 5JLHA 4BRFA 3EKUA 2V7ZA 4B1XB 4CZMA 4WYBA 2WUSA 4BRPA 3DWLA 5BPNA 3B8AX 4AM7A 3O80A 4BR4A 4CJ7A 2UYTA 3C7NA 2GUPA 5AQYA 2E1ZA 2QWLA 1MDUB 3M3ZA 1MA9B 4FWRA 1V4TA 3DXMB 4H5TA 3LDQA 1X9JA 4IJAA 1HKGA 1NGDA 4O8KA 2OANA 2P9NB 5LY3A 2VCPA 4JN4A 4PL8A 3U9ZA 3AY9A 1NGIA 3A5OC 4BRLA 3ZX0A 3H1VX 3W0LA 2E1YA 3DAWA 3D2EA 2Q1NA 2E2NA 4H5RA 3KHYA 3CIPA 4C23A 3BUZB 4FPAA 4B9QA 1EQYA 1YXQA 3I33A 3VF4A 4XH5A 2IVNA 4CBUA 3MN5A 4M63C 1DEJA 1C0GA 5FPMA 2P9UB 1K8KA 1NWKA 5EXWA 3QMLA 3TPQA 1GLCG 2GTDA 3VEXA 2A41A 4BVPA 3FZMA 2YHYA 3DJCA 4H0TB 4BC2A 4BVOA 5FPEA 1LCUA 4RCHA 2FLOA 3P4IA 2E2QA 5EVZA 5B8HA 2P9LB 4BC3A 5TKYA 3MN6A 4HTLA 3L4IA 3CQXA 2V51B 4BREA 5BRFA 3IDHA 2P9LA 5AQHA 1BG3A 1BUPA 3MMVA 3JXUA 5EX5A 3O4WA 4JD2B 1XC3A 3GBTA 3FZKA 2FSKA 5EY4A 3QB0A 2E88A 1NGHA 5KPTA 2AP1A 3DXKB 3CJAA 4H0YB 5LJWA 4BR2A 3WXIA 4K43A 4DCHA 3DXKA 1NM1A 4BRCA 4B1WB 3QDKA 1ESVA 2D4WA 4XEIA 2I7PA 3AAQA 3IUCA 1X3MA 4FPBA 1KXPA 5AQUA 1BA1A 3R8EA 3O6WA 4BR9A 1KAYA 3ZETB 3J8AA 1P8ZA 3JS6A 5ADXH 3ZETA 2QWMA 4EFHA 2KHOA 3KZBA 2Q2RA 3MDQA 1ATRA 3HBTA 1S22A 1CZAN 2ZF5O 4FO0A 1GLLO 4QS9A 4CD3A 2PAVA 3UKUB 5JICA 2QM1A 2ASMA 2FSNA 3AAPA 4IJNA 4B1ZA 4CZFA 3UKUA 2FSJA 5BN8A 1S3XA 4BRGA 2ZWHA 4EHTA 3L6QA 4NB4A 4FWOA 3QFPA 3SMSA 1ZBSA 4CZIA 3WQTA 3O5BA 3H46O 5AQVA 2ASOA 2W40A 5AQWA 1SQKA 5AQMA 4J8FA 3GDQA 4EAHD 4CBXA 1U6ZA 5ADXA 2QXLA 5FPDA 3BP8A 4FWNA 4ISFA 2VWBA 3VEZA 4IXCA 4GNIA 3VOVA 3ENOA 3QBWA 2J4RA 4CZHA 4CZGA 4IO8A 4FWKA 3EO3A 2FF3B 5KQDA 2CGLA 3BF1A 2F9TA 3M1FA 1SAZA 3GOIA 4IWVA 2A6AA 1D4XA 5AQLA 3CERA 3DXMA 3WUHA 4BGBA 3LL3A 4FOIA 1HJOA 1DKGD 3UB5A 4QS8A 3HZ6A 5AQIA 5BRDA 2P9NA 4BRQA 4B1VA 1YAGA 3MK6A 3CJBA 5AQTA 3SK3A 5I9EB 5BRHA 3LM2A 2H3GX 5AQJA 1NMDA 4BQLA 1U2VB 3OHRA 4L3QA 4E1JA 2Q97A 2GELA 3O8MA 1U2VA 3S41A 3LDPA 5BN9A 1E4FT 4IZ9A 4LC9B 3ZX3A 3SJHA 3A5MC 3WXKA 2P9UA 1J6ZA 3H3NO 4H0PA 4A2BA 5AQGA 2IVOA 4JHDB 3SLCA 4BRHA 2BUPA 1HX1A 4FWLA 3FGUA 4DB3A 2P9PB 4JHDA 1MWKA 3FR0A 1BO5O 4F9OA 3BF3A 2P9PA 3GG4A 2HF4A 1T6CA 4I6MB 1WUAA 3FFKB 3O1WA 3QBXA 3R6MA 1RFQA 1X3NA 5F2RA 1JCEA 5AQSA 4JD2A 2YHWA 3CHWA 1NLVA 4KBOA 4PKIA 4M7YA 3WXJA 4JAXA 5AFUH 3FZLA 5KPRA 3TU5A 2D1KA 3EL2A 3QFUA 4PKGA 3VGLA 2E2PA 2NLXA 1HUXA 3W3DA 3QICA 4CZEA
chains in the Genus database with same CATH superfamily
3D2FB 2C1IA 2GWKA 1DGKN 2YI1A 3MCPA 5JENA 4RW8A 2VYPA 2P9SA 1TAUA 4DFPA 3VQEA 3OS0A 2PYJA 4DV5K 1NG9A 1B92A 3DOLA 3V1RA 4OLAA 3MN7A 3VF2A 4NCBA 4A62A 3L2UA 3QNOA 4WQ5A 5AFUA 4CK3A 4JI5K 3H1QA 4PKHA 4N5SA 5GAHP 1ATSA 2YCHA 3K57A 4EZ9A 4J2AA 4KHNA 3K0SA 3WXMB 2ZGZA 5AZIB 4CGHA 3O1BA 4KHWA 2HHHK 4DQPA 3WT0A 1GLAG 4IDHA 4HTUA 4FZYA 3IMXA 2HHUA 5ELZA 1YJNN 3H08A 1Z6RA 4DR5K 3DRPA 2Q36A 4IFYA 1S1VA 4LF4K 1H1VA 4BRIA 5F0XA 2GWJA 1GLEG 4I7FA 4DR6K 4DF4A 4LSLA 3QESA 1C0TA 4ZTFA 4BRMA 3TAGA 3AA3A 1RT1A 3THXB 4FJIA 2A42A 4FJLA 2HF3A 3ENHA 3SPZA 4KTZA 4MLEA 3NGIA 1O13A 5AQFA 2AJQA 3THVA 3RSEB 2QWOA 3K5NA 1D9FA 3LM9A 4CFAA 4W5QA 4KREA 3HTVA 4DTXA 3OYDA 3UIQA 4MO4A 1RBTA 1VSKA 1NK6A 1WSIA 1D5AA 3NAEA 4K25A 1N33K 4BC4A 4OGCA 1G15A 3PIOL 4YDUA 3VGMA 4H5VA 1BDGA 2D0CA 4FJNA 5BR9A 3AVNA 2DY4A 1TUYA 1JLGA 5HRPA 3BDPA 1QVGM 2HHTA 3S9HA 1VSJA 4AHTA 1G99A 3S3NA 3SAFA 1WSFA 5LL6Z 1A5WA 1YIJN 3N4QA 3DYAA 5E26A 4CHZA 3RWUA 2NUBA 5JLFA 4DTJA 2UXBK 4AQYK 1S5JA 4BG8A 4IBNA 5LJVA 1NKCA 3KK3A 4L8RB 4CJLA 4EIAA 3OJSA 1BIZA 3HOSA 1CZ9A 3T19A 3SQ1A 3AARA 2P9IB 5M1OA 1VQ9N 4A5BA 1GLDG 2P9KA 2BH1A 4FJ7A 4WQ5C 4DLGA 2WOMA 1Q82O 1VSEA 3SMPA 3TSPA 2IVPA 3CCVN 4B1UB 5CR4A 1IKWA 3ISNC 4KB0A 2DFEA 3NVMA 4O0JA 4B3SK 4BDZA 1ZBHA 5KI6A 4LF8K 2O8CA 1DTQA 2PFUA 3KWIA 4ISEA 4BWMA 3UE5A 5IT9O 4HVJA 4DKWA 1L3SA 3CQYA 1Q9XA 3ID8A 3SUPA 1RTHA 4RTFD 5AZJB 3VETA 4BE0A 2WFBA 1RCHA 3LDSA 3ZYYX 1Q81O 3P31A 4BRAA 1KAXA 3LDNA 2HOEA 5C10A 4GKKK 1O1WA 2QTDA 3V81A 1SKWA 1VSFA 4R79A 2CGKA 4K42A 4FLXA 5HLFA 3SAGA 4NO7A 4W5TA 4DR2K 4NLBA 1KSPA 1IBMK 4JKGB 3LWMA 3P1GA 4F3OA 1FJGK 4KAZA 5JLHA 1S9GA 5MLCQ 4JEPA 1OH5A 2V7ZA 4B1XB 4CZMA 2P5GA 4LF5K 1S6QA 4Z4GA 3KK7A 3LZJA 2OCEA 1BI4A 3QNNA 4BR4A 3KLHA 4CJ7A 3C7NA 2E1ZA 1XI1A 2QWLA 3M3ZA 3AVAA 4BWJA 1Y97A 1NK5A 3O4QA 3DXMB 2UUBK 3F5TA 1X9JA 4IJAA 5HRSA 1HKGA 3C6UA 2OPSA 4JN4A 4PL8A 4E1MA 1U45A 1NGIA 3A5OC 3ZX0A 4CIGA 2E1YA 2VGMA 1LW2A 3D2EA 5FROA 1BHLA 4A5AA 1C0UA 3P5JA 1EQYA 2A1RA 4XH5A 3K2PA 2UXDK 1ITGA 4M63C 4E7IA 1JLEA 1TGOA 5FPMA 1K8KA 3OYLA 1NKBA 5EXWA 4B3TK 4AHUA 3TAFA 4BVPA 3AA2A 2KLAA 4DSIA 1C6VA 4BVOA 2NRXA 1GOAA 1Q86O 4BACA 4JI8K 4RCHA 2YV0X 3O9QA 5EVZA 4BC3A 2OZSA 1NJXA 2NRTA 4G1QA 4DFKA 2V51B 4BREA 5BRFA 3NGZA 1BG3A 3TAPA 1J53A 4LH5A 3MMVA 4EZ6A 3ZSRA 3S3MA 3O4WA 2ZJQL 1KD1O 3GBTA 2FSKA 3QB0A 5K14A 3VA0A 2BDPA 3F73A 3KD1E 4CHYA 5LJWA 4BR2A 3SV4A 3J81O 3WXIA 1XHXA 1EP4A 4PQUA 4B1WB 4DF8A 4DTRA 4XEIA 1C0MA 5C0YA 3C95A 3VTHA 1B9DA 1KXPA 3V9XA 4W5RA 1HYVA 3AGRA 3R8EA 2OYQA 5CYMA 1KAYA 5C2FA 3ZETB 2F4VK 3JS6A 5ADXH 1YTUA 3D45A 4EFHA 3OYKA 3KZBA 1IH7A 3MDQA 2X6NA 2QK9A 5GINA 5I42A 3NF7A 4FO0A 1GLLO 2PAVA 1NJYA 2QM1A 3HPOA 3AAPA 4MFBA 4B1ZA 3B6PA 1RBRA 3UKUA 4NXNK 3CCLN 1JXBA 5FDLA 1YI2N 3F2KA 3L6QA 2UUCK 3CPWM 2FC0A 1TL1A 4JLHA 3SMSA 5C25A 3DLGA 2KKZA 1S1WA 1IBLK 3I8DA 4LD0A 4X62K 2ASOA 3AO2A 4J8FA 4FK2A 1N32K 2O8BB 2I5JA 2E4LA 4CBXA 4GV3A 3PX0A 2XY8A 4LSNA 5ADXA 2QXLA 2BANA 3VMFB 1JJ2M 4DWIA 4CJWA 5HP1A 2GV9A 4IXCA 4JK8A 4GNIA 2VWJA 2XY5A 4ILGB 4KHSA 4JKCA 3QBWA 4FJHA 4CZGA 4C8OA 3EO3A 3VQ4A 3GOIA 2QKKA 1RTJA 4Z4CA 3SUOA 2HNYA 4ILHA 4BGBA 3LL3A 4FOIA 2ATQA 1GOBA 3HZ6A 4CIFA 1YAGA 3AVCA 4A59A 3OJUA 1TK5A 4BQLA 3OHRA 1CZBA 3VA3A 4FM0A 3AVMA 2GELA 2NRWA 1TAQA 4Z4HA 3LDPA 5BN9A 1VQ7N 3SJHA 4YOWA 1I94K 2P9UA 3E01A 3EEQA 3H3NO 5M1PA 5AQGA 1ZBIA 1FK9A 2IVOA 1KVBA 2R7YA 2HHVA 4DSJA 1VRUA 3FGUA 3LANA 3KTQA 1MWKA 1QQCA 3QETA 2P9PA 1VQKN 3GG4A 2Z1GA 4I6MB 2HBMA 2EHGA 3TSUA 4DQQA 2VQFK 2YHWA 2NRRA 1VQNN 4JKBA 4FVMA 4O44A 2LSNA 3WXJA 4JAXA 4GKJK 3BZCA 5KPRA 2ZJRL 3EL2A 3RMAA 4CHOA 2NLXA 3AVBA 1FXXA 1IG9A 4MDBA 1HUXA 2BGGA 1U48A 3KLIA 1NJWA 4YORA 3ZT0A 4A61A 3VQDA 3EN9A 4DTMA 1Q8IA 1W0HA 3D2FA 3CMEN 4PY5A 4JKAA 3CQ8A 2RHKA 1X9WA 1JLQA 1GLFO 3OYGA 4DV2K 4X65K 3CJCA 5KQ8A 1C1BA 4IDKA 4FK4A 5EOYA 2YJFA 4K8XA 4GW6A 3DLHA 1L3UA 3CJ7A 4AILC 2IOCA 5GIPA 3WNFA 2E2OA 5BPMA 4O5BA 1ZXOA 4Y0WA 1LW0A 4BRDA 1BWFO 1S6PA 1QVFM 2JGUA 4LY7A 1T44A 3VPZA 5BREA 3VEOA 2VWKA 5DK5A 3V9SA 2OPQA 3C94A 5AZIA 3OVNA 5H1SQ 4E72A 3CXCM 2V7YA 1R59O 1YVNA 3VENA 2D0BA 2FXUA 1Z25A 4BRNA 1BIUA 2NNWA 1NU0A 3VQ7A 4B9UA 3MN9A 3PLAA 1NGFA 4ICLA 3PO5A 4DUYK 2Q0UA 1NOYA 3QO9A 5LMNK 2WONA 3AVHA 1IBKK 1EETA 1MWMA 3D7EO 3ZSQA 4WF9L 3THYB 3F9KA 2ZE2A 3THXA 3VESA 3L2WA 2HB5A 4GMJB 4M41A 4RW6A 2Q3SA 3U9DA 4E7LA 3RRGA 3VN5A 5M1FA 3I56N 1NK9A 3RSEA 4FWQA 1S1XA 2QWQA 2A1SA 1HPZA 2F9WA 4YOTA 4BECA 3TTFA 3O08A 4UY8O 1N8RO 3L0QA 4CJKA 1YT3A 4LF6K 4KI6A 4FWPA 4KKOA 4BG9A 4W5OA 4FJJA 4Y1DA 3C0BA 3P83D 3NH0A 4M3YA 4RG8A 1YUWA 5AQXA 2G8IA 4BDYA 2RN2A 4PL7A 2OPPA 5LMUK 1WLJA 2NRHA 4DSLA 1BA0A 3T7ZA 4HUEA 3CCUN 1XQSC 3H3OB 4JRPA 1RDDA 3DLBA 3P38A 1HLUA 3T3FA 1HQUA 1QZ5A 1LAWA 5HROA 1XWLA 3A0IX 3FZFA 3QLHA 2CH5A 3OS2A 1QZ6A 4XJXA 3ZSVA 2FBYA 4CJVA 1QE1A 4CHPA 5KPZA 3T69A 4IOCL 4DR3K 1K73O 4CEZA 3KLEA 4BROA 4FL9A 1SZ2A 2Y1IA 3MEEA 5E84A 3V9WA 1CXUA 4JI0K 2P9IA 1U04A 5J2QA 4CZLA 3NVKA 5HBMA 1HNVA 3JYTA 3MWPA 1DLOA 2WTUA 1S1TA 5AQPA 3CI5A 4DS5A 4HHTA 1ATNA 4ELVA 4MLHA 4CEFA 3L3VA 4M7XA 4BQZA 5F1XA 3M5RA 4CCHA 4N47A 2NZTA 1YITN 1SL2A 1NGCA 1YJWN 5AJ3K 4DQIA 3KVGA 3HP6A 3KJVA 4CE9A 1W2BM 4DR4K 3WEEA 1VSLA 5AZJA 4A2AA 5J1EA 4CZKA 4K41A 1FKPA 4XH1A 3NHGA 4J2BA 1KTQA 2B5JA 2HHWA 4FXDA 1QQMA 4CGDA 1VSMA 3OYHA 3V9UA 4CJUA 2VG7A 3CFPA 4CF2A 3EKUA 4HUFA 4JKGA 3S3OA 5BPNA 1BGXT 4B8AB 4FJXA 3B8AX 4AM7A 3O80A 3DLRA 2PZSA 1MDUB 4OPAA 1S72N 4DR7K 1HNXK 1JKHA 3ZT4A 4JKHA 4FJ8A 2KFNA 3PUFA 1EKEA 2P9NB 4JS5A 1RBSA 1WAFA 3AY9A 2QEXN 4FM2A 4R5PA 1LV5A 2E2NA 1K6YA 2G8VA 4ZHRA 3CIPA 4OKEA 4JI4K 4B9QA 2RF2A 2FBVA 1YXQA 3I33A 4DQRA 4I2PA 1NK8A 4CBUA 5JVHL 1IKYA 4JV5K 1DEJA 4QAGA 1SKSA 1X9MA 3QMLA 3DRRA 3TPQA 1GLCG 4CEQA 4RW9A 5M1QA 1N34K 1BQNA 2QKBA 2A41A 4GVEA 3DJCA 1ZBUA 3OYIA 4C1NK 1LCUA 3QIOA 2FLOA 4W5NA 2E2QA 5B8HA 2P9LB 5TKYA 4HTLA 3VQQA 1XNQK 2ETJA 3SPYA 4FJ9A 3DMJA 4KFBA 1JLAA 2GUIA 1VQ8N 2GBZA 4JD2B 4FVUA 3AVGA 3MWTA 3FZKA 3Q7BA 3NH1A 3E66A 4IOXA 1ZBFA 5IWAK 4CIEA 3HJFA 4FCYA 5CY4A 4K43A 4CJSA 4GVMA 4DCHA 3LALA 4KH5A 3QDKA 3CM5A 2I7PA 1QSLA 3AO1A 3WNGA 1VHXA 2IAJA 1BA1A 3U3YA 3O6WA 4YOYA 4BR9A 1JLFA 1P8ZA 4JYAK 5C15A 3ZETA 4FLVA 2OTJN 2Q2RA 1WSGA 4FJMA 3HBTA 3JSMA 5JS1A 4IG0A 3K5LA 1J5OA 3IG1A 3LZIA 5JICA 4FLWA 4DSEA 4CZFA 4IFEA 1TKXA 3D0PA 4ZTJA 5HRRA 2D0AA 5BN8A 1T03A 4BRGA 1WSEA 3OY9A 5HOOA 5J2NA 4I9QA 4FWOA 2Z1IA 4CZIA 3RMCA 2FBXA 4H4MA 5AQVA 4KTWA 1ASUA 1XMQK 5AQWA 1KC8O 1SQKA 4LF7K 3T1YK 3NCIA 3GDQA 4EAHD 4CFBA 1EXQA 4C8NA 4DU3A 2O8BA 3BP8A 3EE9A 3OYEA 3VOVA 2RPIA 4DUZK 2IDOA 5KGXA 2O8DA 3AVIA 4CJRA 3KIOA 2OA8A 2HBKA 1BQMA 2FF3B 3NH2A 3BF1A 2F9TA 3DI6A 1RTIA 2A6AA 4CHNA 3CERA 4CFDA 5A2QO 3RMDA 4TSXA 3UB5A 4QS8A 5AQIA 1LAVA 4JK9A 2O8EA 1SKRA 4V19S 5I9EB 3EYZA 3LM2A 1JL1A 4H8KA 4Q5VA 4L3QA 4CJEA 1JXEA 3O8MA 3AO4A 1TKDA 5FRNA 3S41A 4A57A 5SWMA 1LWFA 4DTUA 1NNEA 2G8UA 4F2SA 2O8FB 4H0PA 3SNNA 1WB9A 4JHDB 3CM6A 2BUPA 4FJ5A 1HX1A 3K5MA 3M8QA 4IOAL 4KH4A 5CZ1A 3ENBA 4B9TA 3WNEA 4JS4A 1QS4A 2HF4A 1D9DA 5KTQA 1HJRA 4FW1A 4H4OA 3OYFA 3CMAN 1RFQA 4DV0K 3MX5A 4DTSA 3CHWA 3TABA 1NLVA 4CEOA 4KBOA 3I0SA 5J2PA 2D1KA 3G4SN 3VGLA 4PUOA 4CK1A 3QICA 4CZEA 4M3ZA 1P90A 4ELUA 2QWNA 1I3AA 4OKJA 2XRIA 3O3FA 3MXJA 1WN7A 4CEDA 4OO1J 3NF8A 3LPTA 4JI3K 4H5NA 4Y1CA 1WNSA 1SL1A 4ID1A 4BR7A 3QEPA 1VQ4N 3CC2N 3ULDA 4C8LA 3DLEA 4BR0A 3G25A 1UWBA 3L4QA 5C42A 3CETA 1IG8A 2HVHA 2KW4A 4CBWA 1K8AO 4WQ4C 3CCJN 4GY2B 4QCLA 1BL3A 5JMVA 2JWLA 1OH8A 3MXIA 5GIOA 4IEIA 4H5WA 3L3UA 1HPMA 3CG7A 3KWGA 1Z26A 3ZT1A 2VG5A 4JRQA 2YHBA 1BCOA 3HM8A 3KLGA 2QWPA 1TL3A 5GAGP 3I0RA 2E6LA 3O4NA 1QQNA 4BE1A 1LOTB 3SAHA 3ZEUB 2CGJA 4OPHA 4CFCA 2QWRA 4BR5A 4JKFA 1XHZA 4DV4K 3NDKA 3I8BA 4YFUA 5FPNA 1XC9A 4O55A 4QS7A 3AO5A 2YNGA 3THWB 4DV6K 4B9SA 3PIPL 3M6GA 4ILJA 2GX9A 4CEEA 4IG3A 4LF9K 3C7NB 3THYA 4BY9C 4AHCA 4CJ3A 1C0FA 3VEYA 4X64K 3ULEB 4CVNE 4CD1A 2D0OA 2PY5A 1NGGA 2E8AA 3SV3A 1A5XA 4YHHK 2GEMA 3WXLA 2YHXA 3D2EB 3LDLA 3BGRA 4KV8A 2HMIA 2NRVA 3A5NC 1C1AA 1SUQA 3VQ9A 1LWCA 5KRSA 3HYFA 2WBNA 3LP2A 3KK2A 4XH4A 2O4GA 1K8KB 1R0AA 4DQ8A 1NGEA 4Z4IA 1GLJO 3AVLA 5AQOA 1I39A 4MQ3A 3VEWA 4IKFA 2CH6A 3HI0A 1NGBA 3HSCA 3RVCA 3KKSA 4CJPA 2Q0RA 4QOZB 4OJRA 4CI6A 3L2QA 1QHAA 3LP3A 3SUNA 1N6QA 1RGIA 3AGKA 1VQON 4LFBK 3SQ2A 3J7YP 3EY1A 2VGNA 4N76A 2IIRA 4BC5A 5CYQA 3ZSZA 1KVAA 5M1KA 2QI2A 3TI0A 4AHVA 1NGAA 4RWTA 3A8YA 1NJZA 4ELTA 4KI4A 4BDPA 3U3GA 1OH7A 3UKRB 4KB1A 1TYQB 3MECA 4G9ZA 3LP1A 3VGKA 2A40A 2V52B 4I9LA 5AQRA 4DR1K 4DG1A 3U4LA 4CGIA 1C1CA 3HO1A 3A2FA 3Q7CA 5CE3A 4FSVA 2AA4A 5AR0A 3TSQA 4E0DA 5AQQA 2YJEA 3ZSWA 3LAMA 2ITGA 1WBBA 3LDOA 5FRMA 1BU6O 2FBTA 3K9JA 3O9TA 2QW9A 2DTUA 3WNHA 3FE1A 3VQPA 2DPNA 4M42A 4GV6A 2FF6A 4KPYA 4NYFA 4KHUA 1OH6A 1OKJA 3OA9A 4CECA 3CJ9A 3GL1A 3J7AP 4CJTA 1ASVA 4KHPK 5SZTA 1RT2A 4KHQA 4B9NA 2XHBA 2Q31A 1EO1A 1RDWX 2PBDA 1VK0A 4DSKA 4FOEA 5HL7L 3FFIA 2D5RA 2W41A 2ASPA 4MO5A 3EE8A 3EZ5A 3E9OA 3DLLL 3TARA 1XMOK 3O9SA 2A3ZA 3ATUA 4JI6K 4Z4EA 4CF1A 4FJKA 4BRFA 3N4PA 4Q0BA 4WYBA 2UUAK 3CCSN 1T7PA 5GADP 3DWLA 3MEGA 4E89A 3O9UA 4K8ZA 2UYTA 5C2DA 4F4KA 4LFAK 3VQCA 1JLBA 4H5TA 3LDQA 4B9VA 4EP5A 3RMBA 2KFZA 3KKRA 2OANA 5LY3A 2VCPA 3U9ZA 4MDAA 3H1VX 1NOZA 3D6RA 4E19A 2G8WA 2IGIA 4H5RA 4YY3K 3AVKA 3KHYA 3SQ4A 4C23A 1MU2A 1KVCA 4OVLA 1J9AA 2OTLN 4O4GA 2QA4N 1C0GA 2P9UB 1NWKA 5CZ2A 1S9EA 2GTDA 1WAJA 1W7AA 3VEXA 1KLNA 3FZMA 4N41A 4YOUA 1VSIA 4BC2A 4FZXC 5FLXO 4O8UA 3E1YA 1KFSA 3P4IA 1J5EK 4E7HA 1Q7YO 3K5OA 3PSIA 3MN6A 1U49A 3L4IA 3CQXA 3TWHA 3ID6A 1YHQN 3IDHA 2P9LA 1BISA 1BUPA 4DMNA 3JXUA 4FZZA 1QSSA 3VQAA 2G8KA 2HHIA 3VQBA 1NK0A 1TKZA 3TAMA 3ASMA 3OYJA 2E88A 3RR8A 1NGHA 5KPTA 4UQGA 1KQSM 4JI7K 3QEIA 4KH6A 3DXKB 4H0YB 3HOTA 4B3MK 1HNIA 4BRCA 5T7BA 1ESVA 2YNIA 4CHQA 3V9ZA 4DTNA 3AAQA 4B3RK 4FPBA 1VQ5N 3AV9A 3CPEA 5AQUA 1EWRA 3MEDA 2WC9A 1HYSA 4DS4A 2XO7A 2QWMA 4WFBL 4NXMK 3CYGA 1HNZK 3SCXA 1N36K 1YJ9N 1VQLN 1S22A 1CZAN 4QS9A 4BEBA 4DSFA 2ASMA 2KTQA 2ZJPL 3IS9A 1W9HA 4DTPA 1HNWK 3HVTA 4HCBA 2FSJA 4JI2K 3IKMA 3ZLJA 1S1UA 2YKMA 2QXFA 3QFPA 5GAEP 1ZBSA 3DLKA 1TK0A 3WQTA 1FW6A 2DFFA 3MAQA 5AQMA 3PY8A 2ZQBA 5FPDA 1T8EA 3NBPA 4FWNA 1RBVA 3K58A 2VWBA 3VEZA 2F8TA 4DU1A 1X9SA 5EU7A 1L3VA 4CZHA 3MX2A 4KO0A 4FWKA 2CGLA 1YVUA 5AQLA 3ZCMA 3DXMA 3R1XA 3WUHA 1HJOA 3AVJA 4M3WA 3VQ6A 4F3TA 3NGYA 4BRQA 4B1VA 3HVRA 3PV8A 1BCMA 3MK6A 5AQTA 3SK3A 5BRHA 3ITHA 4FK0A 1NMDA 1U2VB 2Q97A 4X66K 3PX4A 4CJQA 4B9MA 3SBTA 4DLEA 1QSYA 4LC9B 3SZ2A 3ZX3A 3A5MC 1J6ZA 3ZSYA 3TAQA 4IO9L 2O8FA 1NK4A 4FWLA 1J54A 4JHDA 2XY6A 4CEBA 3FR0A 1BO5O 4F9OA 4DV3K 1T6CA 3G6EN 3SQ0A 4AHSA 4CESA 1NMNA 1WUAA 3FFKB 3O1WA 3R6MA 4FYDA 1X3NA 2EX3A 1DT9A 2B6AA 5AQSA 1RT7A 4C8KA 4PKIA 1M1KO 4DU4A 1VQMN 3FZLA 1RTDA 3TU5A 1UOCA 4RW4A 3HT3A 4PKGA 3SUQA 2E2PA 2W42A 1KFDA 1W97L 4B9LA 2KQ2A 2Y1JA 3U8XA 2EWSA 4Z0UA 2HMPA 4CGJA 2P9SB 4H0OA 4U7BA 3RTVA 2ZM6K 3CCEN 3G0ZA 1XUPO 4NLCA 3CFRA 4CGFA 1HMVA 4CJFA 3L8BA 5JVGL 1UA0A 4H0XB 4JKEA 1T3VA 1HKCA 2Z1JA 4B08A 4DFMA 3BEXA 1Y64A 4FWSA 3C6HA 1V4SA 4HCCA 1NGJA 3DM2A 3LAKA 3ZT3A 1RT3A 4WQ4A 3ATVA 3WEEB 1JCFA 2BE2A 1JL2A 2G8FA 3I55N 5E41A 2ITMA 3TAEA 1LWEA 3EZWA 3FLCO 3TTDA 3VF6A 4HWIA 3K59A 4E1NA 4JNEA 1HKBA 3OBWA 3NMUA 3CCQN 2F96A 2D0PA 1B9FA 4FLUA 4CK2A 3J7ZO 3L2VA 3OYAA 3CYMA 4CF9A 2HHQA 3U6FA 4EHUA 1T05A 3ZEUA 1N5YA 3PX6A 3M8SA 3B6OA 3RR7A 3F9MA 3HPHA 3ZX2A 3THWA 2OPRA 1BOTO 5M1NA 1WOQA 3S5TA 1IJJA 2HBJA 1E4GT 3A5LC 3KLFA 2G8HA 3OYNA 4DHYA 1Q18A 3NE6A 2F7TA 1REVA 4YDUC 1IKVA 4KRFA 2HHSA 2RKIA 3EKSA 1GLBG 3CC7N 1NBWA 3ULEA 4DQSA 3R9PA 5AQKA 3GE1A 1RDUA 1QQOA 2O4IA 5DM6L 1TUUA 4BRKA 4B1YB 1UAXA 1YF5L 3V4IA 3H45C 1QTMA 3CF5L 4BGAA 3QINA 3TR8A 4CEAA 3OS1A 4DV7K 4O5FA 1RDBA 4H0VB 2W6LA 2B4JA 4M3RA 4RW7A 1K9MO 2P1JA 4OKKA 4OPKA 4KTQA 3TANA 3QEWA 1Z05A 2RE2A 1ZYQA 3T1HK 3OYCA 2YNFA 2VQEK 1IV0A 2JWKA 4I6MA 3IFRA 1HQEA 1L5UA 3NF9A 3WQUA 4DFJA 2HVIA 5AQZA 1RT5A 3FZHA 4Z94A 4N56A 2I7NA 4DV1K 1L3TA 3AA5X 2P9KB 4JKDA 1RBUA 2ZGYA 4F2RA 4HUGA 1D8YA 4OLBA 1KAZA 3UKRA 4FWMA 1TYQA 2KZMA 1EWQA 4CJ4A 3CC4N 3DOKA 5BPLA 2F8SA 1WBDA 3OYMA 3CJ1A 3AVFA 2JLEA 4OX9K 2UU9K 2XY7A 3TTCA 2A5XA 1T6DA 3BY5A 2O8CB 3G71N 2HBLA 4WFNL 3HXMA 3H6EA 4CGGA 4OGEA 2VG6A 4ISGA 4DTOA 1Q9YA 2E20A 4LFCK 3M8PA 1WSHA 3CCMN 1KCFA 3ALYA 4WCEL 1HRHA 1SS6A 1QHTA 3M8RA 4AH9A 4AM6A 3AO3A 1CLQA 4CZJA 1TVRA 4H03B 1SL0A 4CF0A 5JS2A 4NCGA 3V6DA 2E5LK 3VERA 4B8CA 4JI1K 2BTFA 4KHYA 2HW3A 2P5OA 1VAZA 4FM1A 3LPUA 4CW7B 2OZMA 5AQNA 1OVYA 3OTOK 3HSTB 3SBGA 3VEVA 1ZC6A 4J2EA 1JCGA 4ID5A 4K0KK 1BI4B 2ZD1A 2WUSA 4BRPA 2O8DB 4NYNA 1EX4A 4YOVA 4YOXA 1KRPA 2W00A 2GUPA 5AQYA 3SI6A 4B3OA 1MA9B 4FWRA 3L2RA 1V4TA 4BE7B 3K9KA 3HK2A 1VSHA 3KD5E 1NGDA 5KRTA 1RDCA 4O8KA 4Z4FA 3HL8A 2Z1HA 3NF6A 4C1NI 3RRHA 2O8EB 4BRLA 2HSTA 3W0LA 3DAWA 3HM9A 3OW2M 2Q1NA 3QEVA 4NCAA 3VQ8A 3V1QA 4XIUA 3BUZB 4FPAA 2YHAA 3CD6N 3V1OA 4JK7A 3T1AA 3VF4A 1HR0K 2IVNA 3SJJA 3MN5A 4J2DA 5C12A 2NRZA 2YHYA 1GOCA 1RDAA 4H0TB 5FPEA 1YTAA 3HRGA 3QIPA 1IKXA 1RNHA 1U4BA 4IFVA 4FW2A 4IEEA 4M3XA 4CF8A 5AQHA 5EX5A 3ZSOA 5DM7L 1XC3A 3SYZA 2P51A 4PHTX 2W6KA 3VTIA 5EY4A 1ZBLA 1X1PA 3CCRN 2AP1A 3CJAA 1OVQA 4E7KA 1KLMA 4C8MA 1NM1A 3DXKA 3MCAB 2YX6A 2PYLA 2D4WA 4M3UA 3IUCA 1ILYA 1X3MA 3O3GA 3CFOA 2HNZA 4O0IA 4YNQA 3PSFA 1VQ6N 3E9LA 3LWLA 1NK7A 3MXMA 2HNDA 3C6AA 3J8AA 3IRXA 3HPGA 1IO2A 2KHOA 1ATRA 4FLZA 3QERA 1VSDA 1U47A 1ASWA 2ZF5O 4CD3A 4GV9A 2KZZA 3UKUB 2FSNA 3OYBA 4IJNA 1A5VA 1TK8A 1S3XA 2ZWHA 4EHTA 4NB4A 3C65A 3O5BA 4CERA 1WSJA 2X6SA 3H46O 1DTTA 2W40A 3E9PA 1U6ZA 3JAMO 5DMRA 3HP9A 1JLCA 4ISFA 2DFHA 1VQPN 5D3GA 2IC3A 3ENOA 4FLTA 4WFAL 3J80O 4PWDA 2X74A 2J4RA 4IO8A 4E7JA 5KQDA 5CHIA 3C6TA 3M1FA 1SAZA 2IS3A 5BR8K 1HYZA 1NJIO 2C1GA 4IWVA 1FKOA 1D4XA 3PO4A 3P39A 1UA1A 1DKGD 1CXQA 4FLYA 1SV5A 4M45A 5BRDA 4BE2A 2P9NA 3AA4A 3NFAA 3O9RA 2E6MA 4WE1A 3CJBA 1M90O 2H3GX 5AQJA 5C24A 3BZKA 4E1JA 2YNHA 2HHXA 4PA1A 5TKWA 1VRTA 1U2VA 4CJ5A 3ZSXA 5J2MA 1E4FT 3KK1A 4AF1A 4IZ9A 1E3MA 3WXKA 4F8RA 3QEXA 1NKEA 4A2BA 4E3SA 4M3TA 3VQ5A 3LP0A 3DRSA 5KGWA 3SLCA 4BRHA 4OPJA 4DB3A 2P9PB 1F21A 4U67L 2X78A 3OBYA 3BF3A 3ZT2A 4AHRA 4I2QA 4LH4A 3QBXA 1TV6A 5F2RA 1JCEA 3R3LA 4JD2A 3G10A 4EP4A 4M7YA 5HRNA 5AFUH 3O3HA 5I3UA 1XNRK 4FJGA 3QFUA 1TKTA 3IAYA 2YKNA 1RILA 1RT4A 3W3DA 1RT6A 2UXCK
chains in the Genus database with same CATH topology
3D2FB 3U8XA 2C1IA 2EWSA 4A61A 2QWNA 3EN9A 2GWKA 1DGKN 2HMPA 4OO1J 2P9SB 3D2FA 3CMEN 4H0OA 4U7BA 2YI1A 4JKAA 3MCPA 2RHKA 2VYPA 2P9SA 4H5NA 3CCEN 1XUPO 1GLFO 4NLCA 4BR7A 3CJCA 5KQ8A 5JVGL 1VQ4N 3CC2N 3MN7A 4BR0A 3G25A 3VF2A 4A62A 4H0XB 3L4QA 4JKEA 1T3VA 1HKCA 5EOYA 2YJFA 4WQ5A 3CETA 1IG8A 5AFUA 4CBWA 1K8AO 4WQ4C 3BEXA 4GY2B 3CCJN 5JMVA 3H1QA 1Y64A 2JWLA 4PKHA 3CJ7A 4FWSA 3C6HA 1V4SA 5GAHP 5GIPA 1NGJA 2E2OA 5BPMA 5GIOA 4IEIA 1ZXOA 4H5WA 4Y0WA 1ATSA 2YCHA 4BRDA 1BWFO 4WQ4A 1HPMA 1QVFM 3KWGA 3WXMB 2ZGZA 3ATVA 3WEEB 1JCFA 1T44A 5AZIB 3VPZA 3O1BA 5BREA 3VEOA 3HM8A 3I55N 2ITMA 3EZWA 2QWPA 3FLCO 3TTDA 5AZIA 3WT0A 3VF6A 1GLAG 4IDHA 4HWIA 5H1SQ 5GAGP 3IMXA 4JNEA 1HKBA 5ELZA 3OBWA 2V7YA 3CXCM 1YJNN 3CCQN 3NMUA 1R59O 2D0PA 1YVNA 3VENA 2FXUA 1QQNA 1Z6RA 4BRNA 2NNWA 1LOTB 3SAHA 3J7ZO 2Q36A 3ZEUB 1H1VA 2CGJA 4OPHA 4BRIA 2QWRA 5F0XA 2GWJA 3MN9A 4BR5A 4EHUA 1GLEG 4JKFA 3I8BA 3ZEUA 3PLAA 1NGFA 5FPNA 4QS7A 4BRMA 2Q0UA 2A42A 3F9MA 4WF9L 1MWMA 2HF3A 3D7EO 3ENHA 3ZX2A 4MLEA 3PIPL 3M6GA 1BOTO 4ILJA 2GX9A 3VESA 5M1NA 3C7NB 1WOQA 1O13A 5AQFA 4BY9C 1IJJA 2HBJA 1E4GT 3A5LC 3U9DA 3RSEB 1C0FA 2QWOA 3VEYA 4DHYA 1Q18A 2F7TA 4YDUC 3LM9A 5M1FA 3HTVA 3ULEB 3I56N 3RSEA 4FWQA 3EKSA 2QWQA 4CD1A 2D0OA 1GLBG 4MO4A 3CC7N 1NGGA 2E8AA 4K25A 1NBWA 3ULEA 4BC4A 2F9WA 4YOTA 3R9PA 4BECA 3TTFA 3O08A 2GEMA 3WXLA 4YDUA 3PIOL 2YHXA 3D2EB 5AQKA 3GE1A 3VGMA 4UY8O 1N8RO 3L0QA 1RDUA 3LDLA 1QQOA 4H5VA 1BDGA 4FWPA 1TUUA 4BG9A 5DM6L 4BRKA 2NRVA 4B1YB 3C0BA 3A5NC 5BR9A 1YF5L 1TUYA 1YUWA 5AQXA 3H45C 3CF5L 4PL7A 2WBNA 4BGAA 4XH4A 4O5FA 1K8KB 4DQ8A 4H0VB 1NGEA 1QVGM 2NRHA 1GLJO 3VEWA 5AQOA 1BA0A 3T7ZA 1G99A 1K9MO 2CH6A 3HI0A 3SAFA 1NGBA 1XQSC 3HSCA 3RVCA 3H3OB 1Z05A 3CCUN 1YIJN 2RE2A 2Q0RA 3N4QA 2JWKA 4I6MA 5E26A 3IFRA 4CI6A 3P38A 1QHAA 1HLUA 5JLFA 1QZ5A 3WQUA 3A0IX 1RGIA 3AGKA 1VQON 5AQZA 4BG8A 3FZHA 3FZFA 5LJVA 2CH5A 2VGNA 4Z94A 1QZ6A 4XJXA 4EIAA 2IIRA 2I7NA 4BC5A 5KPZA 5M1KA 2QI2A 3T69A 3HOSA 1NGAA 4RWTA 4IOCL 3A8YA 1K73O 3AARA 2P9KB 4JKDA 4BROA 3UKRB 4FL9A 1SZ2A 1TYQB 2P9IB 5M1OA 1VQ9N 2ZGYA 5E84A 4A5BA 4G9ZA 1GLDG 2P9KA 3VGKA 1KAZA 3UKRA 4FWMA 1TYQA 2A40A 2P9IA 2V52B 5AQRA 4CZLA 3NVKA 2BH1A 3MWPA 3CC4N 4WQ5C 3U4LA 5BPLA 5AQPA 1Q82O 3SMPA 3CI5A 3Q7CA 5CE3A 3TSPA 4FSVA 3CJ1A 2AA4A 2IVPA 1ATNA 5AR0A 3TSQA 4MLHA 5CR4A 4B1UB 3CCVN 3TTCA 5AQQA 4M7XA 2A5XA 4BQZA 1T6DA 2YJEA 5F1XA 3NVMA 3M5RA 3G71N 3LDOA 1BU6O 2HBLA 4WFNL 3H6EA 3K9JA 3O9TA 2QW9A 2PFUA 2NZTA 1YITN 3KWIA 4ISEA 3FE1A 3UE5A 2DPNA 4ISGA 1NGCA 4GV6A 2FF6A 1YJWN 2E20A 4DKWA 3KVGA 3CQYA 3ID8A 3CCMN 1OKJA 4RTFD 4WCEL 3OA9A 5AZJB 3VETA 1W2BM 2WFBA 3WEEA 1SS6A 3CJ9A 3GL1A 3ZYYX 4AM6A 4CZJA 3P31A 1Q81O 4BRAA 1KAXA 3LDNA 4A2AA 5AZJA 2HOEA 4H03B 5C10A 2Q31A 4CZKA 1EO1A 1RDWX 2QTDA 2PBDA 4K41A 3VERA 4XH1A 2BTFA 4FOEA 4R79A 5HL7L 2W41A 2ASPA 4MO5A 2CGKA 4K42A 3EE8A 1VAZA 3SAGA 4NO7A 1QQMA 3E9OA 5AQNA 3DLLL 3O9SA 1OVYA 4NLBA 2A3ZA 3ATUA 4JKGB 3SBGA 1ZC6A 3VEVA 1JCGA 5JLHA 5MLCQ 4BRFA 4JEPA 3EKUA 2V7ZA 3N4PA 4JKGA 4B1XB 4CZMA 4WYBA 3CCSN 2WUSA 4BRPA 3DWLA 5BPNA 3KK7A 5GADP 3B8AX 4AM7A 3O9UA 3O80A 4BR4A 4YOVA 4YOXA 4CJ7A 2W00A 2UYTA 3C7NA 2GUPA 5AQYA 2E1ZA 5C2DA 2QWLA 1MDUB 3M3ZA 4OPAA 1S72N 1MA9B 4FWRA 1V4TA 3DXMB 4BE7B 3K9KA 4H5TA 3F5TA 3LDQA 1X9JA 4IJAA 1HKGA 1NGDA 4JKHA 4O8KA 2OANA 2P9NB 5LY3A 2VCPA 4JN4A 4PL8A 3U9ZA 3AY9A 4C1NI 2QEXN 1NGIA 3A5OC 4BRLA 4MDAA 3ZX0A 2HSTA 3H1VX 3W0LA 2E1YA 2VGMA 3DAWA 3D2EA 2Q1NA 3OW2M 3D6RA 2E2NA 4H5RA 3KHYA 4A5AA 3CIPA 4C23A 3BUZB 4FPAA 4B9QA 1EQYA 1YXQA 3I33A 2OTLN 3CD6N 4JK7A 3VF4A 4XH5A 2IVNA 4CBUA 3MN5A 5JVHL 2QA4N 4M63C 1DEJA 1C0GA 5FPMA 2P9UB 1K8KA 1NWKA 5EXWA 3QMLA 3TPQA 1GLCG 2GTDA 3VEXA 5M1QA 5C12A 2A41A 4BVPA 3FZMA 4GVEA 2NRZA 4YOUA 2KLAA 2YHYA 3DJCA 4H0TB 4BC2A 4BVOA 5FPEA 2NRXA 3HRGA 1Q86O 4C1NK 1LCUA 4O8UA 4RCHA 3E1YA 2FLOA 3P4IA 2E2QA 3O9QA 5EVZA 1Q7YO 5B8HA 2P9LB 4BC3A 4IEEA 3MN6A 2NRTA 3L4IA 4HTLA 5TKYA 3CQXA 2V51B 4BREA 3ID6A 5BRFA 1YHQN 3IDHA 2P9LA 5AQHA 1BG3A 1BUPA 3MMVA 3JXUA 5EX5A 1VQ8N 3O4WA 4JD2B 5DM7L 1XC3A 4FVUA 2ZJQL 4PHTX 1KD1O 3MWTA 3GBTA 3VTIA 3FZKA 2FSKA 5EY4A 3Q7BA 3QB0A 2E88A 3CCRN 1NGHA 5KPTA 3E66A 1KQSM 4IOXA 2AP1A 4KH6A 3DXKB 3CJAA 4H0YB 5LJWA 4BR2A 3HOTA 3WXIA 4K43A 4DCHA 3DXKA 1NM1A 4BRCA 4KH5A 4B1WB 3MCAB 2YX6A 3QDKA 1ESVA 2D4WA 4XEIA 2I7PA 5C0YA 3AAQA 3IUCA 3VTHA 1X3MA 4FPBA 1ILYA 1KXPA 1VQ5N 3CPEA 5AQUA 1BA1A 3AGRA 3R8EA 3O6WA 4YOYA 4BR9A 2WC9A 1VQ6N 3E9LA 1KAYA 3C6AA 5C2FA 3ZETB 3J8AA 1P8ZA 3JS6A 5ADXH 5C15A 3ZETA 2QWMA 4EFHA 2KHOA 4WFBL 2OTJN 3KZBA 2Q2RA 3MDQA 1ATRA 3HBTA 1YJ9N 5GINA 1VQLN 1S22A 1CZAN 2ZF5O 4FO0A 1GLLO 4QS9A 4CD3A 4GV9A 2PAVA 3UKUB 4BEBA 5JICA 2QM1A 2ASMA 2FSNA 3AAPA 4IJNA 4B1ZA 4CZFA 2ZJPL 4IFEA 3UKUA 2FSJA 5BN8A 3CCLN 1S3XA 4BRGA 1YI2N 2ZWHA 3IKMA 4EHTA 3F2KA 3L6QA 5HOOA 3CPWM 4NB4A 4FWOA 3QFPA 5GAEP 3SMSA 1ZBSA 3C65A 4CZIA 2KKZA 3WQTA 3O5BA 3H46O 5AQVA 2ASOA 2W40A 5AQWA 1SQKA 3E9PA 5AQMA 4J8FA 1KC8O 3GDQA 4EAHD 4CBXA 4GV3A 1U6ZA 5ADXA 2QXLA 3VMFB 3BP8A 3EE9A 5FPDA 4FWNA 1JJ2M 4ISFA 2VWBA 3VEZA 1VQPN 4IXCA 4JK8A 4GNIA 3VOVA 3ENOA 4ILGB 4JKCA 3QBWA 4WFAL 2J4RA 4CZHA 4CZGA 4IO8A 3MX2A 2HBKA 4FWKA 3EO3A 2FF3B 5KQDA 2CGLA 3BF1A 5CHIA 2F9TA 3M1FA 1SAZA 1NJIO 3GOIA 2C1GA 4IWVA 2A6AA 1D4XA 5AQLA 4ILHA 3CERA 3DXMA 3R1XA 3WUHA 4BGBA 3LL3A 3P39A 4FOIA 1HJOA 1DKGD 3UB5A 4QS8A 3HZ6A 5AQIA 5BRDA 2P9NA 3O9RA 4BRQA 4B1VA 1YAGA 4JK9A 3MK6A 4A59A 3CJBA 1M90O 5AQTA 3SK3A 5I9EB 5BRHA 3LM2A 2H3GX 5AQJA 1NMDA 4BQLA 1U2VB 3OHRA 4L3QA 4E1JA 2Q97A 2GELA 5TKWA 3O8MA 2NRWA 1U2VA 3S41A 3SBTA 4A57A 3LDPA 5BN9A 1E4FT 4AF1A 4IZ9A 4LC9B 3ZX3A 1VQ7N 3SJHA 4YOWA 3A5MC 3WXKA 2P9UA 1J6ZA 3H3NO 4H0PA 5M1PA 4A2BA 5AQGA 2IVOA 4JHDB 4IO9L 3SLCA 4BRHA 2BUPA 1HX1A 4FWLA 3FGUA 4DB3A 2P9PB 4U67L 4JHDA 4KH4A 4IOAL 3ENBA 1MWKA 3FR0A 1BO5O 3OBYA 4F9OA 3BF3A 2P9PA 1VQKN 3GG4A 2HF4A 1T6CA 3G6EN 4I6MB 1WUAA 3FFKB 2HBMA 3O1WA 3QBXA 3R6MA 3TSUA 3CMAN 1RFQA 1X3NA 3MX5A 5F2RA 1DT9A 1JCEA 3R3LA 5AQSA 4JD2A 2YHWA 2NRRA 1NLVA 3CHWA 4KBOA 1VQNN 4PKIA 4M7YA 4JKBA 1M1KO 3WXJA 4JAXA 5AFUH 1VQMN 3FZLA 5KPRA 2ZJRL 3TU5A 2D1KA 3EL2A 3QFUA 3G4SN 4PKGA 3VGLA 2E2PA 2NLXA 4MDBA 1HUXA 3W3DA 3QICA 1W97L 4CZEA 1P90A 4YORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2F B;  3U8X A;  2EWS A;  4A61 A;  2QWN A;  3EN9 A;  2GWK A;  1DGK N;  2HMP A;  2P9S B;  3D2F A;  4H0O A;  2YI1 A;  3MCP A;  2VYP A;  2P9S A;  4H5N A;  1XUP O;  1GLF O;  4BR7 A;  3CJC A;  5KQ8 A;  3MN7 A;  4BR0 A;  3G25 A;  3VF2 A;  4A62 A;  4H0X B;  5EOY A;  1HKC A;  2YJF A;  4WQ5 A;  3CET A;  1IG8 A;  5AFU A;  4CBW A;  4WQ4 C;  3BEX A;  4GY2 B;  5JMV A;  3H1Q A;  1Y64 A;  4PKH A;  3CJ7 A;  4FWS A;  1V4S A;  1NGJ A;  2E2O A;  5BPM A;  1ZXO A;  4H5W A;  4Y0W A;  1ATS A;  2YCH A;  4BRD A;  1BWF O;  4WQ4 A;  1HPM A;  2ZGZ A;  3ATV A;  3WEE B;  1JCF A;  1T44 A;  5AZI B;  3VPZ A;  3O1B A;  5BRE A;  3VEO A;  3HM8 A;  2ITM A;  3EZW A;  2QWP A;  3FLC O;  3WT0 A;  5AZI A;  3VF6 A;  1GLA G;  4HWI A;  3IMX A;  4JNE A;  1HKB A;  5ELZ A;  2V7Y A;  1R59 O;  2D0P A;  1YVN A;  3VEN A;  2FXU A;  1QQN A;  1Z6R A;  4BRN A;  1LOT B;  2Q36 A;  3ZEU B;  1H1V A;  2CGJ A;  4BRI A;  2QWR A;  5F0X A;  2GWJ A;  3MN9 A;  4BR5 A;  4EHU A;  1GLE G;  3I8B A;  3ZEU A;  1NGF A;  5FPN A;  4QS7 A;  4BRM A;  2Q0U A;  2A42 A;  3F9M A;  1MWM A;  2HF3 A;  3D7E O;  3ENH A;  3ZX2 A;  4MLE A;  3M6G A;  1BOT O;  3VES A;  3C7N B;  1WOQ A;  5AQF A;  1IJJ A;  1E4G T;  3A5L C;  3U9D A;  3RSE B;  1C0F A;  2QWO A;  3VEY A;  4DHY A;  1Q18 A;  4YDU C;  3LM9 A;  3HTV A;  3ULE B;  3RSE A;  4FWQ A;  3EKS A;  2QWQ A;  4CD1 A;  2D0O A;  1GLB G;  4MO4 A;  1NGG A;  2E8A A;  4K25 A;  1NBW A;  3ULE A;  4BC4 A;  2F9W A;  3R9P A;  3O08 A;  2GEM A;  3WXL A;  4YDU A;  2YHX A;  3D2E B;  5AQK A;  3GE1 A;  3VGM A;  3L0Q A;  3LDL A;  1QQO A;  4H5V A;  1BDG A;  4FWP A;  1TUU A;  4BG9 A;  4BRK A;  5BR9 A;  4B1Y B;  3C0B A;  3A5N C;  1TUY A;  1YUW A;  5AQX A;  3H45 C;  4PL7 A;  4BGA A;  4XH4 A;  4O5F A;  1K8K B;  4DQ8 A;  4H0V B;  1NGE A;  2NRH A;  1GLJ O;  3VEW A;  5AQO A;  1BA0 A;  1G99 A;  2CH6 A;  3HI0 A;  1NGB A;  1XQS C;  3HSC A;  3H3O B;  1Z05 A;  2Q0R A;  4I6M A;  5E26 A;  3IFR A;  4CI6 A;  1QHA A;  1HLU A;  5JLF A;  1QZ5 A;  3WQU A;  3A0I X;  1RGI A;  5AQZ A;  4BG8 A;  3FZH A;  3FZF A;  5LJV A;  2CH5 A;  4Z94 A;  1QZ6 A;  4EIA A;  2IIR A;  2I7N A;  4BC5 A;  5KPZ A;  1NGA A;  4RWT A;  3A8Y A;  3AAR A;  2P9K B;  4BRO A;  3UKR B;  4FL9 A;  1SZ2 A;  1TYQ B;  2P9I B;  2ZGY A;  5E84 A;  1GLD G;  2P9K A;  3VGK A;  1KAZ A;  3UKR A;  4FWM A;  1TYQ A;  2A40 A;  2P9I A;  2V52 B;  5AQR A;  4CZL A;  4WQ5 C;  3U4L A;  5BPL A;  5AQP A;  3SMP A;  3CI5 A;  5CE3 A;  4FSV A;  3CJ1 A;  2AA4 A;  2IVP A;  1ATN A;  5AR0 A;  4MLH A;  4B1U B;  5AQQ A;  4M7X A;  2A5X A;  4BQZ A;  1T6D A;  2YJE A;  5F1X A;  3LDO A;  1BU6 O;  3H6E A;  2QW9 A;  2NZT A;  4ISE A;  3FE1 A;  3UE5 A;  2DPN A;  4ISG A;  1NGC A;  2FF6 A;  2E20 A;  3KVG A;  3CQY A;  3ID8 A;  1OKJ A;  4RTF D;  5AZJ B;  3VET A;  3WEE A;  3CJ9 A;  3GL1 A;  4AM6 A;  4CZJ A;  4BRA A;  1KAX A;  3LDN A;  4A2A A;  5AZJ A;  2HOE A;  4H03 B;  2Q31 A;  4CZK A;  1RDW X;  4K41 A;  2PBD A;  3VER A;  4XH1 A;  2BTF A;  4FOE A;  2W41 A;  2ASP A;  4MO5 A;  2CGK A;  4K42 A;  4NO7 A;  1QQM A;  5AQN A;  2A3Z A;  3ATU A;  3VEV A;  1ZC6 A;  1JCG A;  5JLH A;  4BRF A;  3EKU A;  2V7Z A;  4B1X B;  4CZM A;  4WYB A;  2WUS A;  4BRP A;  3DWL A;  5BPN A;  3B8A X;  4AM7 A;  3O80 A;  4BR4 A;  4CJ7 A;  2UYT A;  3C7N A;  2GUP A;  5AQY A;  2E1Z A;  2QWL A;  1MDU B;  3M3Z A;  1MA9 B;  4FWR A;  1V4T A;  3DXM B;  4H5T A;  3LDQ A;  1X9J A;  4IJA A;  1HKG A;  1NGD A;  4O8K A;  2OAN A;  2P9N B;  5LY3 A;  2VCP A;  4JN4 A;  4PL8 A;  3U9Z A;  3AY9 A;  1NGI A;  3A5O C;  4BRL A;  3ZX0 A;  3H1V X;  3W0L A;  2E1Y A;  3DAW A;  3D2E A;  2Q1N A;  2E2N A;  4H5R A;  3KHY A;  3CIP A;  4C23 A;  3BUZ B;  4FPA A;  4B9Q A;  1EQY A;  1YXQ A;  3I33 A;  3VF4 A;  4XH5 A;  2IVN A;  4CBU A;  3MN5 A;  4M63 C;  1DEJ A;  1C0G A;  5FPM A;  2P9U B;  1K8K A;  1NWK A;  5EXW A;  3QML A;  3TPQ A;  1GLC G;  2GTD A;  3VEX A;  2A41 A;  4BVP A;  3FZM A;  2YHY A;  3DJC A;  4H0T B;  4BC2 A;  4BVO A;  5FPE A;  1LCU A;  4RCH A;  2FLO A;  3P4I A;  2E2Q A;  5EVZ A;  5B8H A;  2P9L B;  4BC3 A;  5TKY A;  3MN6 A;  4HTL A;  3L4I A;  3CQX A;  2V51 B;  4BRE A;  5BRF A;  3IDH A;  2P9L A;  5AQH A;  1BG3 A;  1BUP A;  3MMV A;  3JXU A;  5EX5 A;  3O4W A;  4JD2 B;  1XC3 A;  3GBT A;  3FZK A;  2FSK A;  5EY4 A;  3QB0 A;  2E88 A;  1NGH A;  5KPT A;  2AP1 A;  3DXK B;  3CJA A;  4H0Y B;  5LJW A;  4BR2 A;  3WXI A;  4K43 A;  4DCH A;  3DXK A;  1NM1 A;  4BRC A;  4B1W B;  3QDK A;  1ESV A;  2D4W A;  4XEI A;  2I7P A;  3AAQ A;  3IUC A;  1X3M A;  4FPB A;  1KXP A;  5AQU A;  1BA1 A;  3R8E A;  3O6W A;  4BR9 A;  1KAY A;  3ZET B;  3J8A A;  1P8Z A;  3JS6 A;  5ADX H;  3ZET A;  2QWM A;  4EFH A;  2KHO A;  3KZB A;  2Q2R A;  3MDQ A;  1ATR A;  3HBT A;  1S22 A;  1CZA N;  2ZF5 O;  4FO0 A;  1GLL O;  4QS9 A;  4CD3 A;  2PAV A;  3UKU B;  5JIC A;  2QM1 A;  2ASM A;  2FSN A;  3AAP A;  4IJN A;  4B1Z A;  4CZF A;  3UKU A;  2FSJ A;  5BN8 A;  1S3X A;  4BRG A;  2ZWH A;  4EHT A;  3L6Q A;  4NB4 A;  4FWO A;  3QFP A;  3SMS A;  1ZBS A;  4CZI A;  3WQT A;  3O5B A;  3H46 O;  5AQV A;  2ASO A;  2W40 A;  5AQW A;  1SQK A;  5AQM A;  4J8F A;  3GDQ A;  4EAH D;  4CBX A;  1U6Z A;  5ADX A;  2QXL A;  5FPD A;  3BP8 A;  4FWN A;  4ISF A;  2VWB A;  3VEZ A;  4IXC A;  4GNI A;  3VOV A;  3ENO A;  3QBW A;  2J4R A;  4CZH A;  4CZG A;  4IO8 A;  4FWK A;  3EO3 A;  2FF3 B;  5KQD A;  2CGL A;  3BF1 A;  2F9T A;  3M1F A;  1SAZ A;  3GOI A;  4IWV A;  2A6A A;  1D4X A;  5AQL A;  3CER A;  3DXM A;  3WUH A;  4BGB A;  3LL3 A;  4FOI A;  1HJO A;  1DKG D;  3UB5 A;  4QS8 A;  3HZ6 A;  5AQI A;  5BRD A;  2P9N A;  4BRQ A;  4B1V A;  1YAG A;  3MK6 A;  3CJB A;  5AQT A;  3SK3 A;  5I9E B;  5BRH A;  3LM2 A;  2H3G X;  5AQJ A;  1NMD A;  4BQL A;  1U2V B;  3OHR A;  4L3Q A;  4E1J A;  2Q97 A;  2GEL A;  3O8M A;  1U2V A;  3S41 A;  3LDP A;  5BN9 A;  1E4F T;  4IZ9 A;  4LC9 B;  3ZX3 A;  3SJH A;  3A5M C;  3WXK A;  2P9U A;  1J6Z A;  3H3N O;  4H0P A;  4A2B A;  5AQG A;  2IVO A;  4JHD B;  3SLC A;  4BRH A;  2BUP A;  1HX1 A;  4FWL A;  3FGU A;  4DB3 A;  2P9P B;  4JHD A;  1MWK A;  3FR0 A;  1BO5 O;  4F9O A;  3BF3 A;  2P9P A;  3GG4 A;  2HF4 A;  1T6C A;  4I6M B;  1WUA A;  3FFK B;  3O1W A;  3QBX A;  3R6M A;  1RFQ A;  1X3N A;  5F2R A;  1JCE A;  5AQS A;  4JD2 A;  2YHW A;  3CHW A;  1NLV A;  4KBO A;  4PKI A;  4M7Y A;  3WXJ A;  4JAX A;  5AFU H;  3FZL A;  5KPR A;  3TU5 A;  2D1K A;  3EL2 A;  3QFU A;  4PKG A;  3VGL A;  2E2P A;  2NLX A;  1HUX A;  3W3D A;  3QIC A;  4CZE A; 
#chains in the Genus database with same CATH topology
 3D2F B;  2C1I A;  2GWK A;  1DGK N;  2YI1 A;  3MCP A;  5JEN A;  4RW8 A;  2VYP A;  2P9S A;  1TAU A;  4DFP A;  3VQE A;  3OS0 A;  2PYJ A;  4DV5 K;  1NG9 A;  1B92 A;  3DOL A;  3V1R A;  4OLA A;  3MN7 A;  3VF2 A;  4NCB A;  4A62 A;  3L2U A;  3QNO A;  4WQ5 A;  5AFU A;  4CK3 A;  4JI5 K;  3H1Q A;  4PKH A;  4N5S A;  5GAH P;  1ATS A;  2YCH A;  3K57 A;  4EZ9 A;  4J2A A;  4KHN A;  3K0S A;  3WXM B;  2ZGZ A;  5AZI B;  4CGH A;  3O1B A;  4KHW A;  2HHH K;  4DQP A;  3WT0 A;  1GLA G;  4IDH A;  4HTU A;  4FZY A;  3IMX A;  2HHU A;  5ELZ A;  1YJN N;  3H08 A;  1Z6R A;  4DR5 K;  3DRP A;  2Q36 A;  4IFY A;  1S1V A;  4LF4 K;  1H1V A;  4BRI A;  5F0X A;  2GWJ A;  1GLE G;  4I7F A;  4DR6 K;  4DF4 A;  4LSL A;  3QES A;  1C0T A;  4ZTF A;  4BRM A;  3TAG A;  3AA3 A;  1RT1 A;  3THX B;  4FJI A;  2A42 A;  4FJL A;  2HF3 A;  3ENH A;  3SPZ A;  4KTZ A;  4MLE A;  3NGI A;  1O13 A;  5AQF A;  2AJQ A;  3THV A;  3RSE B;  2QWO A;  3K5N A;  1D9F A;  3LM9 A;  4CFA A;  4W5Q A;  4KRE A;  3HTV A;  4DTX A;  3OYD A;  3UIQ A;  4MO4 A;  1RBT A;  1VSK A;  1NK6 A;  1WSI A;  1D5A A;  3NAE A;  4K25 A;  1N33 K;  4BC4 A;  4OGC A;  1G15 A;  3PIO L;  4YDU A;  3VGM A;  4H5V A;  1BDG A;  2D0C A;  4FJN A;  5BR9 A;  3AVN A;  2DY4 A;  1TUY A;  1JLG A;  5HRP A;  3BDP A;  1QVG M;  2HHT A;  3S9H A;  1VSJ A;  4AHT A;  1G99 A;  3S3N A;  3SAF A;  1WSF A;  5LL6 Z;  1A5W A;  1YIJ N;  3N4Q A;  3DYA A;  5E26 A;  4CHZ A;  3RWU A;  2NUB A;  5JLF A;  4DTJ A;  2UXB K;  4AQY K;  1S5J A;  4BG8 A;  4IBN A;  5LJV A;  1NKC A;  3KK3 A;  4L8R B;  4CJL A;  4EIA A;  3OJS A;  1BIZ A;  3HOS A;  1CZ9 A;  3T19 A;  3SQ1 A;  3AAR A;  2P9I B;  5M1O A;  1VQ9 N;  4A5B A;  1GLD G;  2P9K A;  2BH1 A;  4FJ7 A;  4WQ5 C;  4DLG A;  2WOM A;  1Q82 O;  1VSE A;  3SMP A;  3TSP A;  2IVP A;  3CCV N;  4B1U B;  5CR4 A;  1IKW A;  3ISN C;  4KB0 A;  2DFE A;  3NVM A;  4O0J A;  4B3S K;  4BDZ A;  1ZBH A;  5KI6 A;  4LF8 K;  2O8C A;  1DTQ A;  2PFU A;  3KWI A;  4ISE A;  4BWM A;  3UE5 A;  5IT9 O;  4HVJ A;  4DKW A;  1L3S A;  3CQY A;  1Q9X A;  3ID8 A;  3SUP A;  1RTH A;  4RTF D;  5AZJ B;  3VET A;  4BE0 A;  2WFB A;  1RCH A;  3LDS A;  3ZYY X;  1Q81 O;  3P31 A;  4BRA A;  1KAX A;  3LDN A;  2HOE A;  5C10 A;  4GKK K;  1O1W A;  2QTD A;  3V81 A;  1SKW A;  1VSF A;  4R79 A;  2CGK A;  4K42 A;  4FLX A;  5HLF A;  3SAG A;  4NO7 A;  4W5T A;  4DR2 K;  4NLB A;  1KSP A;  1IBM K;  4JKG B;  3LWM A;  3P1G A;  4F3O A;  1FJG K;  4KAZ A;  5JLH A;  1S9G A;  5MLC Q;  4JEP A;  1OH5 A;  2V7Z A;  4B1X B;  4CZM A;  2P5G A;  4LF5 K;  1S6Q A;  4Z4G A;  3KK7 A;  3LZJ A;  2OCE A;  1BI4 A;  3QNN A;  4BR4 A;  3KLH A;  4CJ7 A;  3C7N A;  2E1Z A;  1XI1 A;  2QWL A;  3M3Z A;  3AVA A;  4BWJ A;  1Y97 A;  1NK5 A;  3O4Q A;  3DXM B;  2UUB K;  3F5T A;  1X9J A;  4IJA A;  5HRS A;  1HKG A;  3C6U A;  2OPS A;  4JN4 A;  4PL8 A;  4E1M A;  1U45 A;  1NGI A;  3A5O C;  3ZX0 A;  4CIG A;  2E1Y A;  2VGM A;  1LW2 A;  3D2E A;  5FRO A;  1BHL A;  4A5A A;  1C0U A;  3P5J A;  1EQY A;  2A1R A;  4XH5 A;  3K2P A;  2UXD K;  1ITG A;  4M63 C;  4E7I A;  1JLE A;  1TGO A;  5FPM A;  1K8K A;  3OYL A;  1NKB A;  5EXW A;  4B3T K;  4AHU A;  3TAF A;  4BVP A;  3AA2 A;  2KLA A;  4DSI A;  1C6V A;  4BVO A;  2NRX A;  1GOA A;  1Q86 O;  4BAC A;  4JI8 K;  4RCH A;  2YV0 X;  3O9Q A;  5EVZ A;  4BC3 A;  2OZS A;  1NJX A;  2NRT A;  4G1Q A;  4DFK A;  2V51 B;  4BRE A;  5BRF A;  3NGZ A;  1BG3 A;  3TAP A;  1J53 A;  4LH5 A;  3MMV A;  4EZ6 A;  3ZSR A;  3S3M A;  3O4W A;  2ZJQ L;  1KD1 O;  3GBT A;  2FSK A;  3QB0 A;  5K14 A;  3VA0 A;  2BDP A;  3F73 A;  3KD1 E;  4CHY A;  5LJW A;  4BR2 A;  3SV4 A;  3J81 O;  3WXI A;  1XHX A;  1EP4 A;  4PQU A;  4B1W B;  4DF8 A;  4DTR A;  4XEI A;  1C0M A;  5C0Y A;  3C95 A;  3VTH A;  1B9D A;  1KXP A;  3V9X A;  4W5R A;  1HYV A;  3AGR A;  3R8E A;  2OYQ A;  5CYM A;  1KAY A;  5C2F A;  3ZET B;  2F4V K;  3JS6 A;  5ADX H;  1YTU A;  3D45 A;  4EFH A;  3OYK A;  3KZB A;  1IH7 A;  3MDQ A;  2X6N A;  2QK9 A;  5GIN A;  5I42 A;  3NF7 A;  4FO0 A;  1GLL O;  2PAV A;  1NJY A;  2QM1 A;  3HPO A;  3AAP A;  4MFB A;  4B1Z A;  3B6P A;  1RBR A;  3UKU A;  4NXN K;  3CCL N;  1JXB A;  5FDL A;  1YI2 N;  3F2K A;  3L6Q A;  2UUC K;  3CPW M;  2FC0 A;  1TL1 A;  4JLH A;  3SMS A;  5C25 A;  3DLG A;  2KKZ A;  1S1W A;  1IBL K;  3I8D A;  4LD0 A;  4X62 K;  2ASO A;  3AO2 A;  4J8F A;  4FK2 A;  1N32 K;  2O8B B;  2I5J A;  2E4L A;  4CBX A;  4GV3 A;  3PX0 A;  2XY8 A;  4LSN A;  5ADX A;  2QXL A;  2BAN A;  3VMF B;  1JJ2 M;  4DWI A;  4CJW A;  5HP1 A;  2GV9 A;  4IXC A;  4JK8 A;  4GNI A;  2VWJ A;  2XY5 A;  4ILG B;  4KHS A;  4JKC A;  3QBW A;  4FJH A;  4CZG A;  4C8O A;  3EO3 A;  3VQ4 A;  3GOI A;  2QKK A;  1RTJ A;  4Z4C A;  3SUO A;  2HNY A;  4ILH A;  4BGB A;  3LL3 A;  4FOI A;  2ATQ A;  1GOB A;  3HZ6 A;  4CIF A;  1YAG A;  3AVC A;  4A59 A;  3OJU A;  1TK5 A;  4BQL A;  3OHR A;  1CZB A;  3VA3 A;  4FM0 A;  3AVM A;  2GEL A;  2NRW A;  1TAQ A;  4Z4H A;  3LDP A;  5BN9 A;  1VQ7 N;  3SJH A;  4YOW A;  1I94 K;  2P9U A;  3E01 A;  3EEQ A;  3H3N O;  5M1P A;  5AQG A;  1ZBI A;  1FK9 A;  2IVO A;  1KVB A;  2R7Y A;  2HHV A;  4DSJ A;  1VRU A;  3FGU A;  3LAN A;  3KTQ A;  1MWK A;  1QQC A;  3QET A;  2P9P A;  1VQK N;  3GG4 A;  2Z1G A;  4I6M B;  2HBM A;  2EHG A;  3TSU A;  4DQQ A;  2VQF K;  2YHW A;  2NRR A;  1VQN N;  4JKB A;  4FVM A;  4O44 A;  2LSN A;  3WXJ A;  4JAX A;  4GKJ K;  3BZC A;  5KPR A;  2ZJR L;  3EL2 A;  3RMA A;  4CHO A;  2NLX A;  3AVB A;  1FXX A;  1IG9 A;  4MDB A;  1HUX A;  2BGG A;  1U48 A;  3KLI A;  1NJW A;  4YOR A;  3ZT0 A;  4A61 A;  3VQD A;  3EN9 A;  4DTM A;  1Q8I A;  1W0H A;  3D2F A;  3CME N;  4PY5 A;  4JKA A;  3CQ8 A;  2RHK A;  1X9W A;  1JLQ A;  1GLF O;  3OYG A;  4DV2 K;  4X65 K;  3CJC A;  5KQ8 A;  1C1B A;  4IDK A;  4FK4 A;  5EOY A;  2YJF A;  4K8X A;  4GW6 A;  3DLH A;  1L3U A;  3CJ7 A;  4AIL C;  2IOC A;  5GIP A;  3WNF A;  2E2O A;  5BPM A;  4O5B A;  1ZXO A;  4Y0W A;  1LW0 A;  4BRD A;  1BWF O;  1S6P A;  1QVF M;  2JGU A;  4LY7 A;  1T44 A;  3VPZ A;  5BRE A;  3VEO A;  2VWK A;  5DK5 A;  3V9S A;  2OPQ A;  3C94 A;  5AZI A;  3OVN A;  5H1S Q;  4E72 A;  3CXC M;  2V7Y A;  1R59 O;  1YVN A;  3VEN A;  2D0B A;  2FXU A;  1Z25 A;  4BRN A;  1BIU A;  2NNW A;  1NU0 A;  3VQ7 A;  4B9U A;  3MN9 A;  3PLA A;  1NGF A;  4ICL A;  3PO5 A;  4DUY K;  2Q0U A;  1NOY A;  3QO9 A;  5LMN K;  2WON A;  3AVH A;  1IBK K;  1EET A;  1MWM A;  3D7E O;  3ZSQ A;  4WF9 L;  3THY B;  3F9K A;  2ZE2 A;  3THX A;  3VES A;  3L2W A;  2HB5 A;  4GMJ B;  4M41 A;  4RW6 A;  2Q3S A;  3U9D A;  4E7L A;  3RRG A;  3VN5 A;  5M1F A;  3I56 N;  1NK9 A;  3RSE A;  4FWQ A;  1S1X A;  2QWQ A;  2A1S A;  1HPZ A;  2F9W A;  4YOT A;  4BEC A;  3TTF A;  3O08 A;  4UY8 O;  1N8R O;  3L0Q A;  4CJK A;  1YT3 A;  4LF6 K;  4KI6 A;  4FWP A;  4KKO A;  4BG9 A;  4W5O A;  4FJJ A;  4Y1D A;  3C0B A;  3P83 D;  3NH0 A;  4M3Y A;  4RG8 A;  1YUW A;  5AQX A;  2G8I A;  4BDY A;  2RN2 A;  4PL7 A;  2OPP A;  5LMU K;  1WLJ A;  2NRH A;  4DSL A;  1BA0 A;  3T7Z A;  4HUE A;  3CCU N;  1XQS C;  3H3O B;  4JRP A;  1RDD A;  3DLB A;  3P38 A;  1HLU A;  3T3F A;  1HQU A;  1QZ5 A;  1LAW A;  5HRO A;  1XWL A;  3A0I X;  3FZF A;  3QLH A;  2CH5 A;  3OS2 A;  1QZ6 A;  4XJX A;  3ZSV A;  2FBY A;  4CJV A;  1QE1 A;  4CHP A;  5KPZ A;  3T69 A;  4IOC L;  4DR3 K;  1K73 O;  4CEZ A;  3KLE A;  4BRO A;  4FL9 A;  1SZ2 A;  2Y1I A;  3MEE A;  5E84 A;  3V9W A;  1CXU A;  4JI0 K;  2P9I A;  1U04 A;  5J2Q A;  4CZL A;  3NVK A;  5HBM A;  1HNV A;  3JYT A;  3MWP A;  1DLO A;  2WTU A;  1S1T A;  5AQP A;  3CI5 A;  4DS5 A;  4HHT A;  1ATN A;  4ELV A;  4MLH A;  4CEF A;  3L3V A;  4M7X A;  4BQZ A;  5F1X A;  3M5R A;  4CCH A;  4N47 A;  2NZT A;  1YIT N;  1SL2 A;  1NGC A;  1YJW N;  5AJ3 K;  4DQI A;  3KVG A;  3HP6 A;  3KJV A;  4CE9 A;  1W2B M;  4DR4 K;  3WEE A;  1VSL A;  5AZJ A;  4A2A A;  5J1E A;  4CZK A;  4K41 A;  1FKP A;  4XH1 A;  3NHG A;  4J2B A;  1KTQ A;  2B5J A;  2HHW A;  4FXD A;  1QQM A;  4CGD A;  1VSM A;  3OYH A;  3V9U A;  4CJU A;  2VG7 A;  3CFP A;  4CF2 A;  3EKU A;  4HUF A;  4JKG A;  3S3O A;  5BPN A;  1BGX T;  4B8A B;  4FJX A;  3B8A X;  4AM7 A;  3O80 A;  3DLR A;  2PZS A;  1MDU B;  4OPA A;  1S72 N;  4DR7 K;  1HNX K;  1JKH A;  3ZT4 A;  4JKH A;  4FJ8 A;  2KFN A;  3PUF A;  1EKE A;  2P9N B;  4JS5 A;  1RBS A;  1WAF A;  3AY9 A;  2QEX N;  4FM2 A;  4R5P A;  1LV5 A;  2E2N A;  1K6Y A;  2G8V A;  4ZHR A;  3CIP A;  4OKE A;  4JI4 K;  4B9Q A;  2RF2 A;  2FBV A;  1YXQ A;  3I33 A;  4DQR A;  4I2P A;  1NK8 A;  4CBU A;  5JVH L;  1IKY A;  4JV5 K;  1DEJ A;  4QAG A;  1SKS A;  1X9M A;  3QML A;  3DRR A;  3TPQ A;  1GLC G;  4CEQ A;  4RW9 A;  5M1Q A;  1N34 K;  1BQN A;  2QKB A;  2A41 A;  4GVE A;  3DJC A;  1ZBU A;  3OYI A;  4C1N K;  1LCU A;  3QIO A;  2FLO A;  4W5N A;  2E2Q A;  5B8H A;  2P9L B;  5TKY A;  4HTL A;  3VQQ A;  1XNQ K;  2ETJ A;  3SPY A;  4FJ9 A;  3DMJ A;  4KFB A;  1JLA A;  2GUI A;  1VQ8 N;  2GBZ A;  4JD2 B;  4FVU A;  3AVG A;  3MWT A;  3FZK A;  3Q7B A;  3NH1 A;  3E66 A;  4IOX A;  1ZBF A;  5IWA K;  4CIE A;  3HJF A;  4FCY A;  5CY4 A;  4K43 A;  4CJS A;  4GVM A;  4DCH A;  3LAL A;  4KH5 A;  3QDK A;  3CM5 A;  2I7P A;  1QSL A;  3AO1 A;  3WNG A;  1VHX A;  2IAJ A;  1BA1 A;  3U3Y A;  3O6W A;  4YOY A;  4BR9 A;  1JLF A;  1P8Z A;  4JYA K;  5C15 A;  3ZET A;  4FLV A;  2OTJ N;  2Q2R A;  1WSG A;  4FJM A;  3HBT A;  3JSM A;  5JS1 A;  4IG0 A;  3K5L A;  1J5O A;  3IG1 A;  3LZI A;  5JIC A;  4FLW A;  4DSE A;  4CZF A;  4IFE A;  1TKX A;  3D0P A;  4ZTJ A;  5HRR A;  2D0A A;  5BN8 A;  1T03 A;  4BRG A;  1WSE A;  3OY9 A;  5HOO A;  5J2N A;  4I9Q A;  4FWO A;  2Z1I A;  4CZI A;  3RMC A;  2FBX A;  4H4M A;  5AQV A;  4KTW A;  1ASU A;  1XMQ K;  5AQW A;  1KC8 O;  1SQK A;  4LF7 K;  3T1Y K;  3NCI A;  3GDQ A;  4EAH D;  4CFB A;  1EXQ A;  4C8N A;  4DU3 A;  2O8B A;  3BP8 A;  3EE9 A;  3OYE A;  3VOV A;  2RPI A;  4DUZ K;  2IDO A;  5KGX A;  2O8D A;  3AVI A;  4CJR A;  3KIO A;  2OA8 A;  2HBK A;  1BQM A;  2FF3 B;  3NH2 A;  3BF1 A;  2F9T A;  3DI6 A;  1RTI A;  2A6A A;  4CHN A;  3CER A;  4CFD A;  5A2Q O;  3RMD A;  4TSX A;  3UB5 A;  4QS8 A;  5AQI A;  1LAV A;  4JK9 A;  2O8E A;  1SKR A;  4V19 S;  5I9E B;  3EYZ A;  3LM2 A;  1JL1 A;  4H8K A;  4Q5V A;  4L3Q A;  4CJE A;  1JXE A;  3O8M A;  3AO4 A;  1TKD A;  5FRN A;  3S41 A;  4A57 A;  5SWM A;  1LWF A;  4DTU A;  1NNE A;  2G8U A;  4F2S A;  2O8F B;  4H0P A;  3SNN A;  1WB9 A;  4JHD B;  3CM6 A;  2BUP A;  4FJ5 A;  1HX1 A;  3K5M A;  3M8Q A;  4IOA L;  4KH4 A;  5CZ1 A;  3ENB A;  4B9T A;  3WNE A;  4JS4 A;  1QS4 A;  2HF4 A;  1D9D A;  5KTQ A;  1HJR A;  4FW1 A;  4H4O A;  3OYF A;  3CMA N;  1RFQ A;  4DV0 K;  3MX5 A;  4DTS A;  3CHW A;  3TAB A;  1NLV A;  4CEO A;  4KBO A;  3I0S A;  5J2P A;  2D1K A;  3G4S N;  3VGL A;  4PUO A;  4CK1 A;  3QIC A;  4CZE A;  4M3Z A;  1P90 A;  4ELU A;  2QWN A;  1I3A A;  4OKJ A;  2XRI A;  3O3F A;  3MXJ A;  1WN7 A;  4CED A;  4OO1 J;  3NF8 A;  3LPT A;  4JI3 K;  4H5N A;  4Y1C A;  1WNS A;  1SL1 A;  4ID1 A;  4BR7 A;  3QEP A;  1VQ4 N;  3CC2 N;  3ULD A;  4C8L A;  3DLE A;  4BR0 A;  3G25 A;  1UWB A;  3L4Q A;  5C42 A;  3CET A;  1IG8 A;  2HVH A;  2KW4 A;  4CBW A;  1K8A O;  4WQ4 C;  3CCJ N;  4GY2 B;  4QCL A;  1BL3 A;  5JMV A;  2JWL A;  1OH8 A;  3MXI A;  5GIO A;  4IEI A;  4H5W A;  3L3U A;  1HPM A;  3CG7 A;  3KWG A;  1Z26 A;  3ZT1 A;  2VG5 A;  4JRQ A;  2YHB A;  1BCO A;  3HM8 A;  3KLG A;  2QWP A;  1TL3 A;  5GAG P;  3I0R A;  2E6L A;  3O4N A;  1QQN A;  4BE1 A;  1LOT B;  3SAH A;  3ZEU B;  2CGJ A;  4OPH A;  4CFC A;  2QWR A;  4BR5 A;  4JKF A;  1XHZ A;  4DV4 K;  3NDK A;  3I8B A;  4YFU A;  5FPN A;  1XC9 A;  4O55 A;  4QS7 A;  3AO5 A;  2YNG A;  3THW B;  4DV6 K;  4B9S A;  3PIP L;  3M6G A;  4ILJ A;  2GX9 A;  4CEE A;  4IG3 A;  4LF9 K;  3C7N B;  3THY A;  4BY9 C;  4AHC A;  4CJ3 A;  1C0F A;  3VEY A;  4X64 K;  3ULE B;  4CVN E;  4CD1 A;  2D0O A;  2PY5 A;  1NGG A;  2E8A A;  3SV3 A;  1A5X A;  4YHH K;  2GEM A;  3WXL A;  2YHX A;  3D2E B;  3LDL A;  3BGR A;  4KV8 A;  2HMI A;  2NRV A;  3A5N C;  1C1A A;  1SUQ A;  3VQ9 A;  1LWC A;  5KRS A;  3HYF A;  2WBN A;  3LP2 A;  3KK2 A;  4XH4 A;  2O4G A;  1K8K B;  1R0A A;  4DQ8 A;  1NGE A;  4Z4I A;  1GLJ O;  3AVL A;  5AQO A;  1I39 A;  4MQ3 A;  3VEW A;  4IKF A;  2CH6 A;  3HI0 A;  1NGB A;  3HSC A;  3RVC A;  3KKS A;  4CJP A;  2Q0R A;  4QOZ B;  4OJR A;  4CI6 A;  3L2Q A;  1QHA A;  3LP3 A;  3SUN A;  1N6Q A;  1RGI A;  3AGK A;  1VQO N;  4LFB K;  3SQ2 A;  3J7Y P;  3EY1 A;  2VGN A;  4N76 A;  2IIR A;  4BC5 A;  5CYQ A;  3ZSZ A;  1KVA A;  5M1K A;  2QI2 A;  3TI0 A;  4AHV A;  1NGA A;  4RWT A;  3A8Y A;  1NJZ A;  4ELT A;  4KI4 A;  4BDP A;  3U3G A;  1OH7 A;  3UKR B;  4KB1 A;  1TYQ B;  3MEC A;  4G9Z A;  3LP1 A;  3VGK A;  2A40 A;  2V52 B;  4I9L A;  5AQR A;  4DR1 K;  4DG1 A;  3U4L A;  4CGI A;  1C1C A;  3HO1 A;  3A2F A;  3Q7C A;  5CE3 A;  4FSV A;  2AA4 A;  5AR0 A;  3TSQ A;  4E0D A;  5AQQ A;  2YJE A;  3ZSW A;  3LAM A;  2ITG A;  1WBB A;  3LDO A;  5FRM A;  1BU6 O;  2FBT A;  3K9J A;  3O9T A;  2QW9 A;  2DTU A;  3WNH A;  3FE1 A;  3VQP A;  2DPN A;  4M42 A;  4GV6 A;  2FF6 A;  4KPY A;  4NYF A;  4KHU A;  1OH6 A;  1OKJ A;  3OA9 A;  4CEC A;  3CJ9 A;  3GL1 A;  3J7A P;  4CJT A;  1ASV A;  4KHP K;  5SZT A;  1RT2 A;  4KHQ A;  4B9N A;  2XHB A;  2Q31 A;  1EO1 A;  1RDW X;  2PBD A;  1VK0 A;  4DSK A;  4FOE A;  5HL7 L;  3FFI A;  2D5R A;  2W41 A;  2ASP A;  4MO5 A;  3EE8 A;  3EZ5 A;  3E9O A;  3DLL L;  3TAR A;  1XMO K;  3O9S A;  2A3Z A;  3ATU A;  4JI6 K;  4Z4E A;  4CF1 A;  4FJK A;  4BRF A;  3N4P A;  4Q0B A;  4WYB A;  2UUA K;  3CCS N;  1T7P A;  5GAD P;  3DWL A;  3MEG A;  4E89 A;  3O9U A;  4K8Z A;  2UYT A;  5C2D A;  4F4K A;  4LFA K;  3VQC A;  1JLB A;  4H5T A;  3LDQ A;  4B9V A;  4EP5 A;  3RMB A;  2KFZ A;  3KKR A;  2OAN A;  5LY3 A;  2VCP A;  3U9Z A;  4MDA A;  3H1V X;  1NOZ A;  3D6R A;  4E19 A;  2G8W A;  2IGI A;  4H5R A;  4YY3 K;  3AVK A;  3KHY A;  3SQ4 A;  4C23 A;  1MU2 A;  1KVC A;  4OVL A;  1J9A A;  2OTL N;  4O4G A;  2QA4 N;  1C0G A;  2P9U B;  1NWK A;  5CZ2 A;  1S9E A;  2GTD A;  1WAJ A;  1W7A A;  3VEX A;  1KLN A;  3FZM A;  4N41 A;  4YOU A;  1VSI A;  4BC2 A;  4FZX C;  5FLX O;  4O8U A;  3E1Y A;  1KFS A;  3P4I A;  1J5E K;  4E7H A;  1Q7Y O;  3K5O A;  3PSI A;  3MN6 A;  1U49 A;  3L4I A;  3CQX A;  3TWH A;  3ID6 A;  1YHQ N;  3IDH A;  2P9L A;  1BIS A;  1BUP A;  4DMN A;  3JXU A;  4FZZ A;  1QSS A;  3VQA A;  2G8K A;  2HHI A;  3VQB A;  1NK0 A;  1TKZ A;  3TAM A;  3ASM A;  3OYJ A;  2E88 A;  3RR8 A;  1NGH A;  5KPT A;  4UQG A;  1KQS M;  4JI7 K;  3QEI A;  4KH6 A;  3DXK B;  4H0Y B;  3HOT A;  4B3M K;  1HNI A;  4BRC A;  5T7B A;  1ESV A;  2YNI A;  4CHQ A;  3V9Z A;  4DTN A;  3AAQ A;  4B3R K;  4FPB A;  1VQ5 N;  3AV9 A;  3CPE A;  5AQU A;  1EWR A;  3MED A;  2WC9 A;  1HYS A;  4DS4 A;  2XO7 A;  2QWM A;  4WFB L;  4NXM K;  3CYG A;  1HNZ K;  3SCX A;  1N36 K;  1YJ9 N;  1VQL N;  1S22 A;  1CZA N;  4QS9 A;  4BEB A;  4DSF A;  2ASM A;  2KTQ A;  2ZJP L;  3IS9 A;  1W9H A;  4DTP A;  1HNW K;  3HVT A;  4HCB A;  2FSJ A;  4JI2 K;  3IKM A;  3ZLJ A;  1S1U A;  2YKM A;  2QXF A;  3QFP A;  5GAE P;  1ZBS A;  3DLK A;  1TK0 A;  3WQT A;  1FW6 A;  2DFF A;  3MAQ A;  5AQM A;  3PY8 A;  2ZQB A;  5FPD A;  1T8E A;  3NBP A;  4FWN A;  1RBV A;  3K58 A;  2VWB A;  3VEZ A;  2F8T A;  4DU1 A;  1X9S A;  5EU7 A;  1L3V A;  4CZH A;  3MX2 A;  4KO0 A;  4FWK A;  2CGL A;  1YVU A;  5AQL A;  3ZCM A;  3DXM A;  3R1X A;  3WUH A;  1HJO A;  3AVJ A;  4M3W A;  3VQ6 A;  4F3T A;  3NGY A;  4BRQ A;  4B1V A;  3HVR A;  3PV8 A;  1BCM A;  3MK6 A;  5AQT A;  3SK3 A;  5BRH A;  3ITH A;  4FK0 A;  1NMD A;  1U2V B;  2Q97 A;  4X66 K;  3PX4 A;  4CJQ A;  4B9M A;  3SBT A;  4DLE A;  1QSY A;  4LC9 B;  3SZ2 A;  3ZX3 A;  3A5M C;  1J6Z A;  3ZSY A;  3TAQ A;  4IO9 L;  2O8F A;  1NK4 A;  4FWL A;  1J54 A;  4JHD A;  2XY6 A;  4CEB A;  3FR0 A;  1BO5 O;  4F9O A;  4DV3 K;  1T6C A;  3G6E N;  3SQ0 A;  4AHS A;  4CES A;  1NMN A;  1WUA A;  3FFK B;  3O1W A;  3R6M A;  4FYD A;  1X3N A;  2EX3 A;  1DT9 A;  2B6A A;  5AQS A;  1RT7 A;  4C8K A;  4PKI A;  1M1K O;  4DU4 A;  1VQM N;  3FZL A;  1RTD A;  3TU5 A;  1UOC A;  4RW4 A;  3HT3 A;  4PKG A;  3SUQ A;  2E2P A;  2W42 A;  1KFD A;  1W97 L;  4B9L A;  2KQ2 A;  2Y1J A;  3U8X A;  2EWS A;  4Z0U A;  2HMP A;  4CGJ A;  2P9S B;  4H0O A;  4U7B A;  3RTV A;  2ZM6 K;  3CCE N;  3G0Z A;  1XUP O;  4NLC A;  3CFR A;  4CGF A;  1HMV A;  4CJF A;  3L8B A;  5JVG L;  1UA0 A;  4H0X B;  4JKE A;  1T3V A;  1HKC A;  2Z1J A;  4B08 A;  4DFM A;  3BEX A;  1Y64 A;  4FWS A;  3C6H A;  1V4S A;  4HCC A;  1NGJ A;  3DM2 A;  3LAK A;  3ZT3 A;  1RT3 A;  4WQ4 A;  3ATV A;  3WEE B;  1JCF A;  2BE2 A;  1JL2 A;  2G8F A;  3I55 N;  5E41 A;  2ITM A;  3TAE A;  1LWE A;  3EZW A;  3FLC O;  3TTD A;  3VF6 A;  4HWI A;  3K59 A;  4E1N A;  4JNE A;  1HKB A;  3OBW A;  3NMU A;  3CCQ N;  2F96 A;  2D0P A;  1B9F A;  4FLU A;  4CK2 A;  3J7Z O;  3L2V A;  3OYA A;  3CYM A;  4CF9 A;  2HHQ A;  3U6F A;  4EHU A;  1T05 A;  3ZEU A;  1N5Y A;  3PX6 A;  3M8S A;  3B6O A;  3RR7 A;  3F9M A;  3HPH A;  3ZX2 A;  3THW A;  2OPR A;  1BOT O;  5M1N A;  1WOQ A;  3S5T A;  1IJJ A;  2HBJ A;  1E4G T;  3A5L C;  3KLF A;  2G8H A;  3OYN A;  4DHY A;  1Q18 A;  3NE6 A;  2F7T A;  1REV A;  4YDU C;  1IKV A;  4KRF A;  2HHS A;  2RKI A;  3EKS A;  1GLB G;  3CC7 N;  1NBW A;  3ULE A;  4DQS A;  3R9P A;  5AQK A;  3GE1 A;  1RDU A;  1QQO A;  2O4I A;  5DM6 L;  1TUU A;  4BRK A;  4B1Y B;  1UAX A;  1YF5 L;  3V4I A;  3H45 C;  1QTM A;  3CF5 L;  4BGA A;  3QIN A;  3TR8 A;  4CEA A;  3OS1 A;  4DV7 K;  4O5F A;  1RDB A;  4H0V B;  2W6L A;  2B4J A;  4M3R A;  4RW7 A;  1K9M O;  2P1J A;  4OKK A;  4OPK A;  4KTQ A;  3TAN A;  3QEW A;  1Z05 A;  2RE2 A;  1ZYQ A;  3T1H K;  3OYC A;  2YNF A;  2VQE K;  1IV0 A;  2JWK A;  4I6M A;  3IFR A;  1HQE A;  1L5U A;  3NF9 A;  3WQU A;  4DFJ A;  2HVI A;  5AQZ A;  1RT5 A;  3FZH A;  4Z94 A;  4N56 A;  2I7N A;  4DV1 K;  1L3T A;  3AA5 X;  2P9K B;  4JKD A;  1RBU A;  2ZGY A;  4F2R A;  4HUG A;  1D8Y A;  4OLB A;  1KAZ A;  3UKR A;  4FWM A;  1TYQ A;  2KZM A;  1EWQ A;  4CJ4 A;  3CC4 N;  3DOK A;  5BPL A;  2F8S A;  1WBD A;  3OYM A;  3CJ1 A;  3AVF A;  2JLE A;  4OX9 K;  2UU9 K;  2XY7 A;  3TTC A;  2A5X A;  1T6D A;  3BY5 A;  2O8C B;  3G71 N;  2HBL A;  4WFN L;  3HXM A;  3H6E A;  4CGG A;  4OGE A;  2VG6 A;  4ISG A;  4DTO A;  1Q9Y A;  2E20 A;  4LFC K;  3M8P A;  1WSH A;  3CCM N;  1KCF A;  3ALY A;  4WCE L;  1HRH A;  1SS6 A;  1QHT A;  3M8R A;  4AH9 A;  4AM6 A;  3AO3 A;  1CLQ A;  4CZJ A;  1TVR A;  4H03 B;  1SL0 A;  4CF0 A;  5JS2 A;  4NCG A;  3V6D A;  2E5L K;  3VER A;  4B8C A;  4JI1 K;  2BTF A;  4KHY A;  2HW3 A;  2P5O A;  1VAZ A;  4FM1 A;  3LPU A;  4CW7 B;  2OZM A;  5AQN A;  1OVY A;  3OTO K;  3HST B;  3SBG A;  3VEV A;  1ZC6 A;  4J2E A;  1JCG A;  4ID5 A;  4K0K K;  1BI4 B;  2ZD1 A;  2WUS A;  4BRP A;  2O8D B;  4NYN A;  1EX4 A;  4YOV A;  4YOX A;  1KRP A;  2W00 A;  2GUP A;  5AQY A;  3SI6 A;  4B3O A;  1MA9 B;  4FWR A;  3L2R A;  1V4T A;  4BE7 B;  3K9K A;  3HK2 A;  1VSH A;  3KD5 E;  1NGD A;  5KRT A;  1RDC A;  4O8K A;  4Z4F A;  3HL8 A;  2Z1H A;  3NF6 A;  4C1N I;  3RRH A;  2O8E B;  4BRL A;  2HST A;  3W0L A;  3DAW A;  3HM9 A;  3OW2 M;  2Q1N A;  3QEV A;  4NCA A;  3VQ8 A;  3V1Q A;  4XIU A;  3BUZ B;  4FPA A;  2YHA A;  3CD6 N;  3V1O A;  4JK7 A;  3T1A A;  3VF4 A;  1HR0 K;  2IVN A;  3SJJ A;  3MN5 A;  4J2D A;  5C12 A;  2NRZ A;  2YHY A;  1GOC A;  1RDA A;  4H0T B;  5FPE A;  1YTA A;  3HRG A;  3QIP A;  1IKX A;  1RNH A;  1U4B A;  4IFV A;  4FW2 A;  4IEE A;  4M3X A;  4CF8 A;  5AQH A;  5EX5 A;  3ZSO A;  5DM7 L;  1XC3 A;  3SYZ A;  2P51 A;  4PHT X;  2W6K A;  3VTI A;  5EY4 A;  1ZBL A;  1X1P A;  3CCR N;  2AP1 A;  3CJA A;  1OVQ A;  4E7K A;  1KLM A;  4C8M A;  1NM1 A;  3DXK A;  3MCA B;  2YX6 A;  2PYL A;  2D4W A;  4M3U A;  3IUC A;  1ILY A;  1X3M A;  3O3G A;  3CFO A;  2HNZ A;  4O0I A;  4YNQ A;  3PSF A;  1VQ6 N;  3E9L A;  3LWL A;  1NK7 A;  3MXM A;  2HND A;  3C6A A;  3J8A A;  3IRX A;  3HPG A;  1IO2 A;  2KHO A;  1ATR A;  4FLZ A;  3QER A;  1VSD A;  1U47 A;  1ASW A;  2ZF5 O;  4CD3 A;  4GV9 A;  2KZZ A;  3UKU B;  2FSN A;  3OYB A;  4IJN A;  1A5V A;  1TK8 A;  1S3X A;  2ZWH A;  4EHT A;  4NB4 A;  3C65 A;  3O5B A;  4CER A;  1WSJ A;  2X6S A;  3H46 O;  1DTT A;  2W40 A;  3E9P A;  1U6Z A;  3JAM O;  5DMR A;  3HP9 A;  1JLC A;  4ISF A;  2DFH A;  1VQP N;  5D3G A;  2IC3 A;  3ENO A;  4FLT A;  4WFA L;  3J80 O;  4PWD A;  2X74 A;  2J4R A;  4IO8 A;  4E7J A;  5KQD A;  5CHI A;  3C6T A;  3M1F A;  1SAZ A;  2IS3 A;  5BR8 K;  1HYZ A;  1NJI O;  2C1G A;  4IWV A;  1FKO A;  1D4X A;  3PO4 A;  3P39 A;  1UA1 A;  1DKG D;  1CXQ A;  4FLY A;  1SV5 A;  4M45 A;  5BRD A;  4BE2 A;  2P9N A;  3AA4 A;  3NFA A;  3O9R A;  2E6M A;  4WE1 A;  3CJB A;  1M90 O;  2H3G X;  5AQJ A;  5C24 A;  3BZK A;  4E1J A;  2YNH A;  2HHX A;  4PA1 A;  5TKW A;  1VRT A;  1U2V A;  4CJ5 A;  3ZSX A;  5J2M A;  1E4F T;  3KK1 A;  4AF1 A;  4IZ9 A;  1E3M A;  3WXK A;  4F8R A;  3QEX A;  1NKE A;  4A2B A;  4E3S A;  4M3T A;  3VQ5 A;  3LP0 A;  3DRS A;  5KGW A;  3SLC A;  4BRH A;  4OPJ A;  4DB3 A;  2P9P B;  1F21 A;  4U67 L;  2X78 A;  3OBY A;  3BF3 A;  3ZT2 A;  4AHR A;  4I2Q A;  4LH4 A;  3QBX A;  1TV6 A;  5F2R A;  1JCE A;  3R3L A;  4JD2 A;  3G10 A;  4EP4 A;  4M7Y A;  5HRN A;  5AFU H;  3O3H A;  5I3U A;  1XNR K;  4FJG A;  3QFU A;  1TKT A;  3IAY A;  2YKN A;  1RIL A;  1RT4 A;  3W3D A;  1RT6 A;  2UXC K; 
#chains in the Genus database with same CATH homology
 3D2F B;  3U8X A;  2C1I A;  2EWS A;  4A61 A;  2QWN A;  3EN9 A;  2GWK A;  1DGK N;  2HMP A;  4OO1 J;  2P9S B;  3D2F A;  3CME N;  4H0O A;  4U7B A;  2YI1 A;  4JKA A;  3MCP A;  2RHK A;  2VYP A;  2P9S A;  4H5N A;  3CCE N;  1XUP O;  1GLF O;  4NLC A;  4BR7 A;  3CJC A;  5KQ8 A;  5JVG L;  1VQ4 N;  3CC2 N;  3MN7 A;  4BR0 A;  3G25 A;  3VF2 A;  4A62 A;  4H0X B;  3L4Q A;  4JKE A;  1T3V A;  1HKC A;  5EOY A;  2YJF A;  4WQ5 A;  3CET A;  1IG8 A;  5AFU A;  4CBW A;  1K8A O;  4WQ4 C;  3BEX A;  4GY2 B;  3CCJ N;  5JMV A;  3H1Q A;  1Y64 A;  2JWL A;  4PKH A;  3CJ7 A;  4FWS A;  3C6H A;  1V4S A;  5GAH P;  5GIP A;  1NGJ A;  2E2O A;  5BPM A;  5GIO A;  4IEI A;  1ZXO A;  4H5W A;  4Y0W A;  1ATS A;  2YCH A;  4BRD A;  1BWF O;  4WQ4 A;  1HPM A;  1QVF M;  3KWG A;  3WXM B;  2ZGZ A;  3ATV A;  3WEE B;  1JCF A;  1T44 A;  5AZI B;  3VPZ A;  3O1B A;  5BRE A;  3VEO A;  3HM8 A;  3I55 N;  2ITM A;  3EZW A;  2QWP A;  3FLC O;  3TTD A;  5AZI A;  3WT0 A;  3VF6 A;  1GLA G;  4IDH A;  4HWI A;  5H1S Q;  5GAG P;  3IMX A;  4JNE A;  1HKB A;  5ELZ A;  3OBW A;  2V7Y A;  3CXC M;  1YJN N;  3CCQ N;  3NMU A;  1R59 O;  2D0P A;  1YVN A;  3VEN A;  2FXU A;  1QQN A;  1Z6R A;  4BRN A;  2NNW A;  1LOT B;  3SAH A;  3J7Z O;  2Q36 A;  3ZEU B;  1H1V A;  2CGJ A;  4OPH A;  4BRI A;  2QWR A;  5F0X A;  2GWJ A;  3MN9 A;  4BR5 A;  4EHU A;  1GLE G;  4JKF A;  3I8B A;  3ZEU A;  3PLA A;  1NGF A;  5FPN A;  4QS7 A;  4BRM A;  2Q0U A;  2A42 A;  3F9M A;  4WF9 L;  1MWM A;  2HF3 A;  3D7E O;  3ENH A;  3ZX2 A;  4MLE A;  3PIP L;  3M6G A;  1BOT O;  4ILJ A;  2GX9 A;  3VES A;  5M1N A;  3C7N B;  1WOQ A;  1O13 A;  5AQF A;  4BY9 C;  1IJJ A;  2HBJ A;  1E4G T;  3A5L C;  3U9D A;  3RSE B;  1C0F A;  2QWO A;  3VEY A;  4DHY A;  1Q18 A;  2F7T A;  4YDU C;  3LM9 A;  5M1F A;  3HTV A;  3ULE B;  3I56 N;  3RSE A;  4FWQ A;  3EKS A;  2QWQ A;  4CD1 A;  2D0O A;  1GLB G;  4MO4 A;  3CC7 N;  1NGG A;  2E8A A;  4K25 A;  1NBW A;  3ULE A;  4BC4 A;  2F9W A;  4YOT A;  3R9P A;  4BEC A;  3TTF A;  3O08 A;  2GEM A;  3WXL A;  4YDU A;  3PIO L;  2YHX A;  3D2E B;  5AQK A;  3GE1 A;  3VGM A;  4UY8 O;  1N8R O;  3L0Q A;  1RDU A;  3LDL A;  1QQO A;  4H5V A;  1BDG A;  4FWP A;  1TUU A;  4BG9 A;  5DM6 L;  4BRK A;  2NRV A;  4B1Y B;  3C0B A;  3A5N C;  5BR9 A;  1YF5 L;  1TUY A;  1YUW A;  5AQX A;  3H45 C;  3CF5 L;  4PL7 A;  2WBN A;  4BGA A;  4XH4 A;  4O5F A;  1K8K B;  4DQ8 A;  4H0V B;  1NGE A;  1QVG M;  2NRH A;  1GLJ O;  3VEW A;  5AQO A;  1BA0 A;  3T7Z A;  1G99 A;  1K9M O;  2CH6 A;  3HI0 A;  3SAF A;  1NGB A;  1XQS C;  3HSC A;  3RVC A;  3H3O B;  1Z05 A;  3CCU N;  1YIJ N;  2RE2 A;  2Q0R A;  3N4Q A;  2JWK A;  4I6M A;  5E26 A;  3IFR A;  4CI6 A;  3P38 A;  1QHA A;  1HLU A;  5JLF A;  1QZ5 A;  3WQU A;  3A0I X;  1RGI A;  3AGK A;  1VQO N;  5AQZ A;  4BG8 A;  3FZH A;  3FZF A;  5LJV A;  2CH5 A;  2VGN A;  4Z94 A;  1QZ6 A;  4XJX A;  4EIA A;  2IIR A;  2I7N A;  4BC5 A;  5KPZ A;  5M1K A;  2QI2 A;  3T69 A;  3HOS A;  1NGA A;  4RWT A;  4IOC L;  3A8Y A;  1K73 O;  3AAR A;  2P9K B;  4JKD A;  4BRO A;  3UKR B;  4FL9 A;  1SZ2 A;  1TYQ B;  2P9I B;  5M1O A;  1VQ9 N;  2ZGY A;  5E84 A;  4A5B A;  4G9Z A;  1GLD G;  2P9K A;  3VGK A;  1KAZ A;  3UKR A;  4FWM A;  1TYQ A;  2A40 A;  2P9I A;  2V52 B;  5AQR A;  4CZL A;  3NVK A;  2BH1 A;  3MWP A;  3CC4 N;  4WQ5 C;  3U4L A;  5BPL A;  5AQP A;  1Q82 O;  3SMP A;  3CI5 A;  3Q7C A;  5CE3 A;  3TSP A;  4FSV A;  3CJ1 A;  2AA4 A;  2IVP A;  1ATN A;  5AR0 A;  3TSQ A;  4MLH A;  5CR4 A;  4B1U B;  3CCV N;  3TTC A;  5AQQ A;  4M7X A;  2A5X A;  4BQZ A;  1T6D A;  2YJE A;  5F1X A;  3NVM A;  3M5R A;  3G71 N;  3LDO A;  1BU6 O;  2HBL A;  4WFN L;  3H6E A;  3K9J A;  3O9T A;  2QW9 A;  2PFU A;  2NZT A;  1YIT N;  3KWI A;  4ISE A;  3FE1 A;  3UE5 A;  2DPN A;  4ISG A;  1NGC A;  4GV6 A;  2FF6 A;  1YJW N;  2E20 A;  4DKW A;  3KVG A;  3CQY A;  3ID8 A;  3CCM N;  1OKJ A;  4RTF D;  4WCE L;  3OA9 A;  5AZJ B;  3VET A;  1W2B M;  2WFB A;  3WEE A;  1SS6 A;  3CJ9 A;  3GL1 A;  3ZYY X;  4AM6 A;  4CZJ A;  3P31 A;  1Q81 O;  4BRA A;  1KAX A;  3LDN A;  4A2A A;  5AZJ A;  2HOE A;  4H03 B;  5C10 A;  2Q31 A;  4CZK A;  1EO1 A;  1RDW X;  2QTD A;  2PBD A;  4K41 A;  3VER A;  4XH1 A;  2BTF A;  4FOE A;  4R79 A;  5HL7 L;  2W41 A;  2ASP A;  4MO5 A;  2CGK A;  4K42 A;  3EE8 A;  1VAZ A;  3SAG A;  4NO7 A;  1QQM A;  3E9O A;  5AQN A;  3DLL L;  3O9S A;  1OVY A;  4NLB A;  2A3Z A;  3ATU A;  4JKG B;  3SBG A;  1ZC6 A;  3VEV A;  1JCG A;  5JLH A;  5MLC Q;  4BRF A;  4JEP A;  3EKU A;  2V7Z A;  3N4P A;  4JKG A;  4B1X B;  4CZM A;  4WYB A;  3CCS N;  2WUS A;  4BRP A;  3DWL A;  5BPN A;  3KK7 A;  5GAD P;  3B8A X;  4AM7 A;  3O9U A;  3O80 A;  4BR4 A;  4YOV A;  4YOX A;  4CJ7 A;  2W00 A;  2UYT A;  3C7N A;  2GUP A;  5AQY A;  2E1Z A;  5C2D A;  2QWL A;  1MDU B;  3M3Z A;  4OPA A;  1S72 N;  1MA9 B;  4FWR A;  1V4T A;  3DXM B;  4BE7 B;  3K9K A;  4H5T A;  3F5T A;  3LDQ A;  1X9J A;  4IJA A;  1HKG A;  1NGD A;  4JKH A;  4O8K A;  2OAN A;  2P9N B;  5LY3 A;  2VCP A;  4JN4 A;  4PL8 A;  3U9Z A;  3AY9 A;  4C1N I;  2QEX N;  1NGI A;  3A5O C;  4BRL A;  4MDA A;  3ZX0 A;  2HST A;  3H1V X;  3W0L A;  2E1Y A;  2VGM A;  3DAW A;  3D2E A;  2Q1N A;  3OW2 M;  3D6R A;  2E2N A;  4H5R A;  3KHY A;  4A5A A;  3CIP A;  4C23 A;  3BUZ B;  4FPA A;  4B9Q A;  1EQY A;  1YXQ A;  3I33 A;  2OTL N;  3CD6 N;  4JK7 A;  3VF4 A;  4XH5 A;  2IVN A;  4CBU A;  3MN5 A;  5JVH L;  2QA4 N;  4M63 C;  1DEJ A;  1C0G A;  5FPM A;  2P9U B;  1K8K A;  1NWK A;  5EXW A;  3QML A;  3TPQ A;  1GLC G;  2GTD A;  3VEX A;  5M1Q A;  5C12 A;  2A41 A;  4BVP A;  3FZM A;  4GVE A;  2NRZ A;  4YOU A;  2KLA A;  2YHY A;  3DJC A;  4H0T B;  4BC2 A;  4BVO A;  5FPE A;  2NRX A;  3HRG A;  1Q86 O;  4C1N K;  1LCU A;  4O8U A;  4RCH A;  3E1Y A;  2FLO A;  3P4I A;  2E2Q A;  3O9Q A;  5EVZ A;  1Q7Y O;  5B8H A;  2P9L B;  4BC3 A;  4IEE A;  3MN6 A;  2NRT A;  3L4I A;  4HTL A;  5TKY A;  3CQX A;  2V51 B;  4BRE A;  3ID6 A;  5BRF A;  1YHQ N;  3IDH A;  2P9L A;  5AQH A;  1BG3 A;  1BUP A;  3MMV A;  3JXU A;  5EX5 A;  1VQ8 N;  3O4W A;  4JD2 B;  5DM7 L;  1XC3 A;  4FVU A;  2ZJQ L;  4PHT X;  1KD1 O;  3MWT A;  3GBT A;  3VTI A;  3FZK A;  2FSK A;  5EY4 A;  3Q7B A;  3QB0 A;  2E88 A;  3CCR N;  1NGH A;  5KPT A;  3E66 A;  1KQS M;  4IOX A;  2AP1 A;  4KH6 A;  3DXK B;  3CJA A;  4H0Y B;  5LJW A;  4BR2 A;  3HOT A;  3WXI A;  4K43 A;  4DCH A;  3DXK A;  1NM1 A;  4BRC A;  4KH5 A;  4B1W B;  3MCA B;  2YX6 A;  3QDK A;  1ESV A;  2D4W A;  4XEI A;  2I7P A;  5C0Y A;  3AAQ A;  3IUC A;  3VTH A;  1X3M A;  4FPB A;  1ILY A;  1KXP A;  1VQ5 N;  3CPE A;  5AQU A;  1BA1 A;  3AGR A;  3R8E A;  3O6W A;  4YOY A;  4BR9 A;  2WC9 A;  1VQ6 N;  3E9L A;  1KAY A;  3C6A A;  5C2F A;  3ZET B;  3J8A A;  1P8Z A;  3JS6 A;  5ADX H;  5C15 A;  3ZET A;  2QWM A;  4EFH A;  2KHO A;  4WFB L;  2OTJ N;  3KZB A;  2Q2R A;  3MDQ A;  1ATR A;  3HBT A;  1YJ9 N;  5GIN A;  1VQL N;  1S22 A;  1CZA N;  2ZF5 O;  4FO0 A;  1GLL O;  4QS9 A;  4CD3 A;  4GV9 A;  2PAV A;  3UKU B;  4BEB A;  5JIC A;  2QM1 A;  2ASM A;  2FSN A;  3AAP A;  4IJN A;  4B1Z A;  4CZF A;  2ZJP L;  4IFE A;  3UKU A;  2FSJ A;  5BN8 A;  3CCL N;  1S3X A;  4BRG A;  1YI2 N;  2ZWH A;  3IKM A;  4EHT A;  3F2K A;  3L6Q A;  5HOO A;  3CPW M;  4NB4 A;  4FWO A;  3QFP A;  5GAE P;  3SMS A;  1ZBS A;  3C65 A;  4CZI A;  2KKZ A;  3WQT A;  3O5B A;  3H46 O;  5AQV A;  2ASO A;  2W40 A;  5AQW A;  1SQK A;  3E9P A;  5AQM A;  4J8F A;  1KC8 O;  3GDQ A;  4EAH D;  4CBX A;  4GV3 A;  1U6Z A;  5ADX A;  2QXL A;  3VMF B;  3BP8 A;  3EE9 A;  5FPD A;  4FWN A;  1JJ2 M;  4ISF A;  2VWB A;  3VEZ A;  1VQP N;  4IXC A;  4JK8 A;  4GNI A;  3VOV A;  3ENO A;  4ILG B;  4JKC A;  3QBW A;  4WFA L;  2J4R A;  4CZH A;  4CZG A;  4IO8 A;  3MX2 A;  2HBK A;  4FWK A;  3EO3 A;  2FF3 B;  5KQD A;  2CGL A;  3BF1 A;  5CHI A;  2F9T A;  3M1F A;  1SAZ A;  1NJI O;  3GOI A;  2C1G A;  4IWV A;  2A6A A;  1D4X A;  5AQL A;  4ILH A;  3CER A;  3DXM A;  3R1X A;  3WUH A;  4BGB A;  3LL3 A;  3P39 A;  4FOI A;  1HJO A;  1DKG D;  3UB5 A;  4QS8 A;  3HZ6 A;  5AQI A;  5BRD A;  2P9N A;  3O9R A;  4BRQ A;  4B1V A;  1YAG A;  4JK9 A;  3MK6 A;  4A59 A;  3CJB A;  1M90 O;  5AQT A;  3SK3 A;  5I9E B;  5BRH A;  3LM2 A;  2H3G X;  5AQJ A;  1NMD A;  4BQL A;  1U2V B;  3OHR A;  4L3Q A;  4E1J A;  2Q97 A;  2GEL A;  5TKW A;  3O8M A;  2NRW A;  1U2V A;  3S41 A;  3SBT A;  4A57 A;  3LDP A;  5BN9 A;  1E4F T;  4AF1 A;  4IZ9 A;  4LC9 B;  3ZX3 A;  1VQ7 N;  3SJH A;  4YOW A;  3A5M C;  3WXK A;  2P9U A;  1J6Z A;  3H3N O;  4H0P A;  5M1P A;  4A2B A;  5AQG A;  2IVO A;  4JHD B;  4IO9 L;  3SLC A;  4BRH A;  2BUP A;  1HX1 A;  4FWL A;  3FGU A;  4DB3 A;  2P9P B;  4U67 L;  4JHD A;  4KH4 A;  4IOA L;  3ENB A;  1MWK A;  3FR0 A;  1BO5 O;  3OBY A;  4F9O A;  3BF3 A;  2P9P A;  1VQK N;  3GG4 A;  2HF4 A;  1T6C A;  3G6E N;  4I6M B;  1WUA A;  3FFK B;  2HBM A;  3O1W A;  3QBX A;  3R6M A;  3TSU A;  3CMA N;  1RFQ A;  1X3N A;  3MX5 A;  5F2R A;  1DT9 A;  1JCE A;  3R3L A;  5AQS A;  4JD2 A;  2YHW A;  2NRR A;  1NLV A;  3CHW A;  4KBO A;  1VQN N;  4PKI A;  4M7Y A;  4JKB A;  1M1K O;  3WXJ A;  4JAX A;  5AFU H;  1VQM N;  3FZL A;  5KPR A;  2ZJR L;  3TU5 A;  2D1K A;  3EL2 A;  3QFU A;  3G4S N;  4PKG A;  3VGL A;  2E2P A;  2NLX A;  4MDB A;  1HUX A;  3W3D A;  3QIC A;  1W97 L;  4CZE A;  1P90 A;  4YOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...