3UKRB

Crystal structure of bos taurus arp2/3 complex with bound inhibitor ck-666
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
193
structure length
193
Chain Sequence
b'GVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
molecule tags Structural protein
publication title Structural characterization and computer-aided optimization of a small-molecule inhibitor of the Arp2/3 complex, a key regulator of the actin cytoskeleton.
pubmed doi rcsb
total genus 54
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ukrB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3ukrB02
1HX1A 1WOQA 2W40A 5AQLA 3UE5A 1YAGA 3KZBA 3QBWA 3AAPA 1C0GA 3D2FA 3LDPA 3LM2A 4BRGA 4BG8A 1HKBA 2GWKA 1ESVA 1NGAA 2D0OA 3R6MA 5FPMA 5JLFA 4M7YA 3BP8A 1NM1A 1SAZA 1H1VA 1U6ZA 2GEMA 3HI0A 3IDHA 4FWNA 1NGJA 3I33A 3EKSA 4ISFA 1T6DA 4FL9A 5EXWA 2DPNA 3CQXA 2QW9A 1TUYA 2E2QA 2E2OA 3FZHA 5EOYA 4BC2A 5F1XA 1S22A 4B1XB 3R8EA 1MA9B 5TKYA 1K8KB 1NWKA 1GLDG 4PKIA 2IVPA 3FZMA 3WEEB 1GLCG 2HMPA 1BWFO 2P9KA 3QFUA 2P9NA 1QZ5A 2HF3A 3FZFA 4EHUA 2IIRA 4BC3A 4FPAA 1NGFA 5AQVA 2QWOA 3A5OC 1IJJA 5AZJB 1HLUA 3IMXA 1NBWA 1XUPO 2A42A 1QHAA 3M6GA 4CZIA 4A62A 2P9KB 3U8XA 2QXLA 5BRDA 5AFUH 3FLCO 2NZTA 4BRQA 4PL8A 3H1VX 4AM6A 3VETA 4BRFA 1CZAN 4IWVA 4LC9B 4FWPA 4FWKA 4NO7A 1TYQB 1Z6RA 1OKJA 5KQ8A 2YHYA 3H3OB 4EHTA 2CGJA 4M63C 1G99A 1NGBA 5AQPA 3VEVA 2EWSA 2QWRA 3R9PA 3DAWA 5BPNA 2GTDA 2IVOA 4H5TA 3HTVA 1HUXA 2AP1A 3QMLA 5AQZA 3D2FB 5AQFA 4BRKA 1DEJA 5AQIA 3WXLA 5AQJA 3EN9A 3EKUA 3D2EB 2QWMA 3DXKB 5LY3A 4I6MB 4MO5A 1Q18A 3DXMA 4AM7A 3DXKA 2YJFA 2Q2RA 1BA0A 3H6EA 3BF1A 4A61A 2A40A 3ZX0A 3GG4A 3BUZB 4BRCA 4H0TB 4CZHA 4PL7A 4IJNA 4XH5A 1MWMA 4K42A 2FSNA 3ULEB 3WQTA 2FLOA 1EQYA 3VF2A 3A5MC 1BA1A 3VEXA 4FWLA 3ATVA 1J6ZA 4WQ4C 3CJ1A 5BPLA 4EFHA 2H3GX 4B1VA 1TUUA 2P9SB 2ASOA 2E1YA 5I9EB 4H5NA 4C23A 2OANA 3CJBA 1NMDA 2QWLA 1U2VB 3H45C 3WXKA 5F2RA 2GUPA 2QWQA 1SQKA 3CETA 1QZ6A 3MMVA 3VGKA 2E2NA 4CD1A 5BRFA 3CJCA 1GLJO 2E88A 2PBDA 2P9LA 3VEOA 1RFQA 5KPZA 1V4SA 3EL2A 4WYBA 3VGLA 3U9ZA 1KXPA 3L6QA 3M3ZA 1T6CA 4H0OA 4MO4A 2A5XA 5E26A 3WEEA 1E4FT 3ATUA 3O4WA 3HBTA 2ASPA 3CHWA 1K8KA 3VERA 4BRHA 1Y64A 3QBXA 3OHRA 2P9LB 4BRMA 5AQNA 5AQQA 1WUAA 3JS6A 4FPBA 3C0BA 3SK3A 5KPTA 1Z05A 3G25A 3IUCA 3KVGA 3DWLA 4EIAA 5AQMA 3W0LA 4H0XB 3ID8A 4CI6A 3F9MA 3FZKA 4O8KA 1GLBG 2UYTA 2D0PA 5JLHA 2BUPA 4FWSA 3ZX2A 5BN8A 3VESA 5BN9A 2F9WA 1YUWA 3L4IA 1LCUA 4K41A 4QS8A 1ZXOA 1BOTO 2P9UB 3A8YA 4BGAA 1KAXA 4I6MA 4BRPA 4M7XA 4WQ5A 3O08A 3VGMA 1ZC6A 1BG3A 3MDQA 2I7PA 1YVNA 2VYPA 4CZMA 2YHWA 2A3ZA 5JICA 3I8BA 2Q36A 3CJ7A 5AQRA 3RSEA 4QS7A 3A5LC 5AQYA 3VF4A 4A2AA 1BUPA 5AQXA 2ASMA 3ENOA 3S41A 5ADXH 2P9SA 4DQ8A 2A41A 3H1QA 4BR5A 4PKHA 3WQUA 2J4RA 2QM1A 5AZIB 3AARA 3MN9A 3LL3A 3AY9A 4BQZA 4YDUA 3BEXA 4BRIA 3VEWA 3C7NA 4HTLA 2F9TA 3FE1A 4BR4A 1C0FA 3UKUB 4J8FA 4K25A 3MCPA 4BG9A 4CZFA 5AQHA 2HOEA 3L0QA 5BR9A 3WT0A 5AQGA 3WUHA 4RCHA 4DB3A 4RTFD 4FWMA 4XH1A 3GDQA 2ZGYA 2ZWHA 4WQ4A 1XC3A 4XH4A 3U4LA 3LDOA 1NGGA 2FF6A 3SMSA 5AZJA 4JHDB 1GLFO 1S3XA 3AAQA 1XQSC 2ZF5O 1YXQA 3VEZA 1JCEA 3UKRA 2BTFA 3H46O 3ZX3A 3IFRA 4IO8A 1HKCA 1GLEG 2QWPA 4WQ5C 3MN6A 3TU5A 4CD3A 4BR9A 4PKGA 4GY2B 1ATNA 1JCGA 3VOVA 1QQOA 2FSJA 1QQMA 4H5WA 3A0IX 3O1BA 2CH6A 4GNIA 2E1ZA 3B8AX 2Q0RA 2ITMA 4BR2A 1GLAG 4BR7A 3O80A 4BC5A 1NGHA 3VENA 4IXCA 2D4WA 4B1YB 3GL1A 3C7NB 3VPZA 1E4GT 4H03B 3P4IA 2GELA 3GOIA 3CJAA 2Q97A 3FFKB 5AZIA 2VCPA 2V51B 2V52B 4BRAA 3A5NC 1X9JA 1RDWX 2VWBA 5AQSA 4BROA 4CBWA 5AR0A 3LM9A 3M1FA 3MK6A 3O1WA 3SMPA 3HZ6A 4E1JA 4B1ZA 3EZWA 4CBUA 4L3QA 5AQUA 3CI5A 4JD2B 4FO0A 4A2BA 3ZEUA 3BF3A 2P9NB 4BRNA 2V7ZA 2E2PA 4IZ9A 2P9PB 1ATRA 4FWRA 5CE3A 5AQTA 3O8MA 3ZETA 5AFUA 3HSCA 2FF3B 3O5BA 1DGKN 4XEIA 1SZ2A 2ZGZA 1NGCA 4DHYA 1BO5O 4H5RA 2NLXA 2IVNA 4FWOA 1U2VA 5E84A 5EY4A 2D1KA 5AQOA 4BREA 4H5VA 1LOTB 4B1WB 2GWJA 5BPMA 5KPRA 2Q1NA 3FGUA 1X3MA 4YDUC 5AQKA 1R59O 3WXJA 1P8ZA 5F0XA 3QB0A 1NGEA 4H0PA 4Y0WA 3ZEUB 1HPMA 4ISEA 3ULEA 1GLLO 2A6AA 2AA4A 4O5FA 4BQLA 3TPQA 3HM8A 4BGBA 4RWTA 2KHOA 1HKGA 2NRHA 5FPDA 4NB4A 4B1UB 5BRHA 2FSKA 1RGIA 4QS9A 5LJVA 4MLHA 1HJOA 4Z94A 1D4XA 4KBOA 3SJHA 1TYQA 1X3NA 2V7YA 4HWIA 5EVZA 1IG8A 4CZGA 2W41A 3LDNA 2E8AA 3U9DA 3CQYA 3UKUA 3WXIA 2I7NA 1KAZA 5ADXA 3CJ9A 3O6WA 2WUSA 3MN7A 3W3DA 4FWQA 1ATSA 4MLEA 3QICA 4JAXA 4BVOA 4CBXA 3DJCA 4JN4A 5AQWA 4EAHD 4BVPA 4CZJA 2P9IA 5KQDA 1JCFA 3J8AA 3ZETB 4BRLA 2YCHA 3SLCA 1MWKA 4BR0A 3FR0A 3LDQA 4ISGA 5FPEA 1ZBSA 4H0YB 1NGIA 2QWNA 3FZLA 4DCHA 2E20A 4FSVA 2CGLA 2PAVA 3DXMB 5B8HA 2P9UA 2CH5A 4JD2A 4IJAA 1DKGD 2YI1A 3D2EA 3UB5A 1BDGA 3LDLA 4FOEA 1KAYA 3JXUA 5LJWA 2HF4A 2YJEA 4BC4A 3GE1A 3VEYA 2P9PA 4H0VB 3ENHA 4BRDA 3QDKA 1BU6O 2FXUA 3D7EO 2P9IB 5FPNA 1V4TA 4B9QA 1NGDA 3UKRB 3GBTA 1NLVA 3CERA 5EX5A 1MDUB 4K43A 4CZKA 4CJ7A 5BREA 2CGKA 4FOIA 1QQNA 3KHYA 4F9OA 4CZEA 3QFPA 5ELZA 3EO3A 3H3NO 4CZLA 4JNEA 5JMVA 1T44A 2YHXA 3VF6A 3MN5A 3RSEB 4JHDA 2Q0UA 2Q31A 3CIPA
chains in the Genus database with same CATH superfamily
1VSEA 2IDOA 3K58A 3VTIA 3UE5A 3O4NA 2G8WA 1C0TA 3AAPA 2F4VK 3CCUN 1C0GA 3D2FA 4NCGA 3RMCA 5DM7L 2GWKA 1JLCA 2D0OA 5JLFA 4GKKK 1Q86O 3S3OA 5IWAK 4FYDA 1DLOA 2QEXN 4KH4A 1U6ZA 4FWNA 4JI3K 3I33A 3EKSA 4ISFA 4FL9A 4DFJA 4DV7K 2QTDA 2XY8A 4KB0A 4WF9L 1N6QA 1TUYA 3OYKA 5EOYA 4HTUA 1OVYA 5F1XA 1VSDA 1TK5A 1NWKA 1GLDG 4CEZA 2VG5A 3WEEB 1C0MA 3QFUA 1QZ5A 2FC0A 1VQPN 2HF3A 1YHQN 3FZFA 3HM9A 4KPYA 4BC3A 5M1QA 3LZIA 1IJJA 5C2FA 3KWIA 3M6GA 1UAXA 3AO4A 4FJMA 5M1PA 1HNXK 3M5RA 5HBMA 4DTXA 2VG6A 5KGXA 2HSTA 4DTOA 1S72N 2HMIA 1J53A 4RW9A 4AM6A 4IFYA 1RDBA 4YOWA 1OVQA 3DM2A 3CM5A 1Z25A 4LC9B 4FWPA 4FWKA 3ZSOA 1RT2A 2KW4A 1OKJA 2YHYA 3H3OB 4YOVA 3SUQA 4CGHA 5FLXO 4CK1A 4CVNE 4DV5K 4DR3K 4IOAL 1I94K 2O4IA 2HVHA 2WOMA 3I0SA 1ASWA 1HPZA 1KVAA 4OKJA 1S1XA 1S6PA 2E4LA 5AQIA 3Q7CA 3PSIA 4IDHA 4MO5A 2DFFA 2WFBA 3KTQA 4KHQA 1BHLA 1UA0A 4BACA 1NK8A 3ZX0A 4YY3K 3BUZB 3ZSXA 4GMJB 4BRCA 4PL7A 2XY7A 2YNGA 1EQYA 3VF2A 1RT4A 1BA1A 4E7KA 4B3SK 4IEEA 1J6ZA 3CJ1A 4AILC 4EFHA 3TTFA 4N56A 4OLAA 2P9SB 3TTCA 4DR7K 3CJBA 2OZMA 1NK5A 3AVKA 4LH4A 3NE6A 1JL2A 3OYAA 2JWLA 3EL2A 4WYBA 3U9ZA 4FJLA 4KHNA 3CC7N 4H0OA 1B92A 4OGEA 4FM2A 1T03A 3LPTA 2ASPA 4E19A 3MX5A 4BRHA 4I7FA 1Y64A 4RW4A 4CJTA 3OHRA 4BRMA 3THXB 1W2BM 4OJRA 3MX2A 4M45A 4FPBA 3C0BA 4B9NA 3CFRA 3G25A 3KVGA 3W0LA 4Z4HA 1L3UA 4H0XB 4CJLA 4JKFA 4PQUA 5JLHA 4CEFA 1WBDA 3ZX2A 3F73A 2XY5A 2IAJA 4QS8A 3TABA 1ZXOA 4Z4IA 4LSLA 1KAXA 1IH7A 4JK9A 4ELUA 3N4QA 2I7PA 2VYPA 2A3ZA 4C1NI 4Y1DA 2KFNA 4B8CA 1T7PA 4CHYA 5M1NA 2OCEA 3D45A 3E01A 2RKIA 4AQYK 2DY4A 2ASMA 2ZM6K 2HHWA 3RMDA 4BR5A 3WQUA 1BCMA 3J7AP 5AZIB 2Y1IA 3AARA 1YJNN 3QEXA 4YDUA 5FROA 3K5MA 2O8CB 3DLLL 4HTLA 3KWGA 1QSSA 3HVTA 2HVIA 3M8PA 5HRSA 4K25A 4BG9A 3NVKA 4CZFA 5AQHA 3L0QA 5BR9A 4JK8A 5C10A 3THWB 3NGZA 4B3OA 5D3GA 2ZWHA 4CF1A 4WQ4A 1TAUA 1XC3A 3U4LA 3LDOA 1E3MA 2G8VA 3ZT1A 4EZ9A 2RF2A 1GLFO 4B9VA 3AAQA 3M8SA 1RBUA 2VQFK 1JCEA 1UA1A 1NU0A 3IFRA 4IO8A 2G8FA 1HKCA 4GV9A 4A59A 3PX4A 3T69A 2QWPA 3WNHA 3SQ2A 4CD3A 3MWPA 4JRQA 4CJSA 3OYEA 1P90A 1ATNA 1JCGA 4LD0A 4C8OA 1QQMA 3DOKA 4B9MA 4H5WA 2O8BB 3A0IX 3V81A 5CYMA 3CC4N 1HR0K 4FXDA 4H4OA 3J7YP 4DR2K 1VQON 1WBBA 4BR7A 4WFBL 4DKWA 3VENA 3CPEA 4CEBA 4DLGA 2D4WA 4I2PA 1C1CA 3C7NB 3LAKA 2YHBA 1WSIA 3DI6A 4DQPA 2Q97A 2NRRA 1WNSA 1NJWA 4BRAA 3DLBA 2ZD1A 5IT9O 1RDWX 4BROA 4FW2A 1IO2A 5AR0A 5M1FA 1KD1O 3V9ZA 1ZBFA 4C8LA 1BCOA 3O1WA 2FBTA 3EZWA 4JD2B 1OH5A 3ZCMA 3NGYA 3TAEA 3NCIA 5HRNA 3V9WA 2V7ZA 3OA9A 1WAFA 4WE1A 4B9LA 1ATRA 3BZKA 3ZETA 5AFUA 2FF3B 3V4IA 3QEPA 4KHSA 1DGKN 1UWBA 4ILHA 3ZLJA 1S1WA 2ZGZA 1NGCA 2HBLA 1CXQA 3TI0A 1FXXA 2NLXA 4AF1A 1QS4A 3QLHA 3AA4A 4X66K 1M1KO 1TKTA 4H5VA 3HP9A 4IG0A 2HHHK 5GADP 3T1YK 5GAHP 4OKEA 5BPMA 5KPRA 1KRPA 1RT5A 3CCEN 1RT3A 3AVBA 3EY1A 1RDAA 4YDUC 1VRTA 3OJSA 1J9AA 1P8ZA 2X6SA 3QB0A 4CHOA 4Y1CA 1YI2N 4ISEA 1QVFM 3L3VA 4BY9C 3HOTA 3JSMA 3BGRA 1JXEA 2WTUA 4BGBA 4DQQA 1EWQA 2KHOA 2HHVA 2NRHA 2ZQBA 4R79A 3OS0A 2QXFA 3NH2A 5GAEP 2V7YA 1YVUA 2A1SA 5EVZA 3O3HA 4QCLA 4YORA 3SPZA 3P1GA 3TAGA 2DFEA 1IKVA 2Z1IA 3U9DA 2P5OA 2IGIA 2C1IA 3KK1A 4JAXA 2QI2A 4DV6K 3HRGA 4CGDA 5AQWA 4EAHD 5FRNA 1O1WA 4BRLA 2YCHA 1TGOA 3ULDA 4B08A 3SLCA 4K8ZA 3TARA 1EO1A 4CERA 5FPEA 3L8BA 4OO1J 1NGIA 2QWNA 4M3WA 1WSHA 4YOYA 2CGLA 2HNZA 4CCHA 4IOXA 3AVIA 4NYNA 3UB5A 1VK0A 3F2KA 4FOEA 2VGNA 4B9UA 3GE1A 3OBYA 4H0VB 2ETJA 3KD1E 3G71N 2VG7A 3AVMA 4NXMK 4B9QA 1NGDA 3CERA 3TAQA 1MDUB 1LAWA 5C42A 2HHXA 3AGKA 5BREA 2HB5A 4FOIA 1F21A 4CZEA 4IFEA 3T19A 2KTQA 3HVRA 3LP0A 3V1OA 4U67L 4A57A 5JMVA 2HBKA 1HQEA 2E6MA 4Q0BA 4BEBA 3RSEB 4JHDA 2Q31A 4EP5A 1U48A 3CCMN 2Z1HA 1HX1A 2JWKA 1KC8O 4CEEA 4N5SA 3TWHA 4KAZA 4DTSA 2W40A 3K0SA 4JI5K 4A5AA 5AQLA 3E9OA 4L8RB 3QNOA 3KZBA 4DU3A 1T05A 2HHSA 3DLGA 4NLCA 2OPPA 3LM2A 3LDPA 1XHXA 4DQSA 3VQAA 4E1MA 3L2UA 4DV2K 3RMAA 4M7YA 1SAZA 2KLAA 3NH1A 3AV9A 2EHGA 3IDHA 3PY8A 1LV5A 2DPNA 3K9JA 4FM1A 2QW9A 2XHBA 2NRTA 4FJ8A 2E2OA 3FZHA 4FJXA 4B1XB 3I8DA 1MA9B 4C8MA 1K8KB 4PKIA 3CCVN 3E1YA 4JV5K 1GLCG 1K73O 3O9RA 3PO5A 1WSGA 5C25A 4EHUA 2IIRA 3PIOL 1N5YA 3B6PA 4WCEL 5AQVA 4XJXA 3O4QA 1HLUA 5AZJB 3D0PA 2OTLN 1O13A 3WNFA 4A62A 2P9KB 5AFUH 3NVMA 2NZTA 2O8CA 4PL8A 4LH5A 3NF7A 1JKHA 2UUAK 3AO3A 4IWVA 4CF2A 2GBZA 1N33K 1Z6RA 1K6YA 4EHTA 2CGJA 3ZSWA 2EWSA 2QWRA 1RBTA 4DQIA 2DFHA 4B9TA 4B3RK 2IVOA 2IS3A 4DTRA 1TKDA 3HTVA 3QMLA 4BRKA 2KFZA 3EN9A 1D9FA 3D2EB 1FKPA 3TANA 3CM6A 3DXKB 2X6NA 5GINA 4LFCK 2OPRA 1TAQA 3THWA 3IG1A 2RN2A 4O44A 4I2QA 5J2QA 3BF1A 1WLJA 4NYFA 4A61A 1QSLA 5DMRA 1BL3A 3GG4A 4CJEA 1RBVA 3CD6N 4IJNA 3C65A 4GV3A 4CIGA 5E41A 2OTJN 4CE9A 4CGIA 4CHQA 4O8UA 5EU7A 1KVCA 1HYSA 1L3VA 4EP4A 4WQ4C 5KTQA 4BDPA 4CJVA 1KTQA 3QERA 4RW8A 4AHVA 3NF6A 1HNZK 4C23A 3P31A 2QWLA 5BR8K 1U2VB 4RW6A 4KH6A 2GUPA 1SQKA 1QZ6A 3VGKA 5GAGP 3NH0A 4DUZK 2E2NA 4JI8K 5BRFA 1Q9YA 3CJCA 5KPZA 4H8KA 3VEOA 4IEIA 1W97L 4G1QA 3AVFA 4RW7A 3SQ4A 3MAQA 3RR7A 1DTQA 4MO4A 3WEEA 2Y1JA 3HBTA 3LWMA 5AQNA 1WUAA 3JS6A 2LSNA 3WNGA 5KPTA 3UIQA 3V9SA 3IUCA 3R3LA 5AQMA 4O8KA 3ZSQA 4BE7B 4FWSA 1X9WA 2F9WA 1YUWA 3L4IA 1LCUA 3V9XA 4K41A 2WONA 3O3GA 4ILGB 4DQRA 3G0ZA 3QO9A 4BRPA 3CCRN 1KLMA 1XMQK 4FLWA 4DS5A 3VGMA 3VQ7A 3VN5A 2YHWA 1VRUA 1KFDA 5JICA 2KKZA 3I8BA 2Q36A 4ZTFA 3K5LA 3QIPA 1HRHA 4JI4K 3OYHA 2O8FB 2DTUA 3OYNA 1CZ9A 1ZBLA 1K9MO 5AQXA 3O3FA 3LANA 1GOBA 3S41A 5ADXH 1X9MA 4LFBK 2UXBK 3RRHA 2OYQA 2HW3A 2QM1A 4LSNA 1JLQA 4CF8A 3LL3A 1ZBHA 3AY9A 4BRIA 1RCHA 4CIFA 1QTMA 4IG3A 4DSFA 3QIOA 4BR4A 1C0FA 3J7ZO 3DOLA 4BE0A 4KI6A 2KQ2A 4CHZA 3MXMA 2HOEA 4JS5A 1A5WA 4PUOA 3WUHA 3VQ4A 2O8EB 5C2DA 4FWMA 2ZGYA 4TSXA 3CC2N 4LF7K 2O4GA 4CJUA 1SKRA 4GV6A 3KK2A 1KCFA 2FF6A 4JHDB 2P51A 1XQSC 2ZF5O 3RR8A 1FKOA 1YXQA 3VEZA 3UKRA 2BTFA 4DFKA 2F7TA 3ZX3A 4DV3K 5CHIA 1VSMA 1GLEG 1NJYA 4FCYA 1NK7A 4WQ5C 1C1BA 3MN6A 4BR9A 2PZSA 3KLGA 4NCAA 1IG9A 3CQ8A 5HP1A 1EX4A 1JL1A 1SKSA 4CK2A 3AVCA 1G15A 2CH6A 1TL1A 1L3TA 4GNIA 4FJ7A 3K5NA 4JI0K 4E3SA 1GLAG 2BANA 1VSHA 4CJKA 3CFPA 4CEAA 4K8XA 3O80A 3NHGA 4IXCA 4GW6A 3K9KA 4B1YB 2B4JA 3GOIA 2UXDK 3KLHA 2V52B 4FJJA 4FJIA 3BZCA 3MEGA 3LP2A 2VWBA 4DV0K 1JLBA 3M1FA 3MK6A 3SJJA 3KK7A 3SMPA 3HZ6A 4E1JA 3U3GA 3OBWA 2AJQA 5TKWA 4CBUA 5AQUA 4BE2A 4YFUA 3CI5A 1CLQA 1NNEA 4JS4A 2UUBK 1SV5A 3HPHA 3NF8A 3V1RA 4ICLA 3AO5A 3O8MA 4KTZA 1YTAA 1LWFA 1SL2A 2BDPA 4KHPK 2YHAA 4MDBA 3AVGA 3OYLA 1U04A 2IVNA 4FWOA 3ISNC 5EY4A 4O0JA 5FDLA 4M3RA 4JKCA 3CCSN 1LOTB 1CXUA 3RWUA 4CGGA 4CEQA 3FGUA 4CJWA 4MDAA 2B6AA 5CYQA 4OVLA 5JVHL 4DR4K 1REVA 1R59O 3WXJA 2WBNA 5F0XA 3KJVA 4H0PA 1SL1A 4Y0WA 1WN7A 1CZBA 1HPMA 1RBRA 3ULEA 3ZEUB 4O5FA 3O9UA 2HHQA 4Z0UA 2E5LK 1YT3A 4JLHA 2P5GA 2A1RA 1HKGA 4CGJA 1A5VA 1NKCA 3OS2A 5HL7L 1EKEA 1HJOA 2E6LA 4Z94A 3OYGA 3HK2A 4LF9K 2VWJA 4HWIA 3C6HA 4CFCA 4FJHA 1NJXA 4CZGA 2R7YA 3UKUA 2W42A 3O6WA 2ZJPL 1HNVA 4M3TA 3DRPA 4CBXA 3DJCA 5SWMA 4JN4A 1VQ4N 4DSLA 4CEDA 4CFAA 3EE8A 1EETA 3ASMA 1VQLN 4BR0A 1BIUA 3LDQA 4ISGA 1ZBSA 4H0YB 3DXMB 1NK4A 4IJAA 3D2EA 3HP6A 1KAYA 3JXUA 1BISA 4CJRA 4BC4A 3VEYA 1TV6A 3ENHA 4BRDA 3QDKA 1VQMN 1NJIO 1NOYA 3QEWA 3OW2M 2UUCK 1V4TA 4JKEA 4MFBA 3JYTA 3GBTA 3VTHA 1I39A 4JKDA 4K43A 3SV4A 1QQNA 4LF6K 4KRFA 4FJGA 3SI6A 4JKAA 1Q7YO 3DLEA 2YHXA 3C6UA 3VF6A 5A2QO 2Q0UA 1VSJA 4DU4A 1IV0A 3J80O 5I42A 3MECA 4E89A 3IAYA 3CMEN 1WOQA 1XNQK 1YAGA 3S3MA 4FJKA 4CJ3A 3QBWA 3LWLA 3AO2A 3VMFB 1HKBA 2NNWA 3R6MA 5FPMA 4J2AA 4ZHRA 4FM0A 1VAZA 2ITGA 1NM1A 3THYA 5J2PA 4BECA 2GEMA 5M1KA 4HUEA 4AHCA 4HUFA 1SUQA 1W9HA 3SUNA 1LW0A 3AO1A 2E2QA 3IS9A 3U3YA 1S22A 1BGXT 1JLGA 3ZSVA 3L2QA 5TKYA 4DR5K 1VQ5N 3KIOA 3AA2A 4JKHA 5JENA 2HMPA 1YITN 2Z1JA 4AH9A 4FPAA 1NGFA 3A5OC 4OPKA 4DFMA 3HYFA 3IMXA 1NBWA 2A42A 3C95A 4CZIA 1S1TA 1TL3A 3U8XA 3FLCO 5AJ3K 1M90O 3H1VX 3VQDA 3VETA 3SUOA 1ASUA 4BRFA 1RNHA 5GIPA 3RVCA 2QKKA 4JI6K 4FZXC 4BDYA 4X65K 1NGBA 2RPIA 3SZ2A 2HNDA 3HJFA 4JKGB 3R9PA 5BPNA 2GTDA 5H1SQ 3THYB 4YNQA 4H5TA 2QK9A 1HUXA 2AP1A 2F8TA 1ITGA 5AQZA 3D2FB 5AQFA 3PX6A 3WXLA 4BWMA 2QWMA 4I6MB 1Q18A 1NKBA 3DXKA 2O8EA 2Q2RA 3HSTB 1L3SA 4OLBA 1VQ7N 3AVNA 2A40A 4E0DA 2HBMA 5HROA 3OYBA 1VQKN 4XH5A 2G8UA 3KK3A 1MWMA 4K42A 2FSNA 3ULEB 3WQTA 3MXIA 4MQ3A 4ELVA 5SZTA 5J2MA 1TKZA 3A5MC 3BY5A 4QAGA 4X62K 4H4MA 3ATVA 2ATQA 4LF5K 2HHIA 2B5JA 5BPLA 3P39A 2NUBA 1QSYA 4KREA 1TUUA 4E1NA 5I9EB 1HMVA 4H5NA 4CJQA 1D9DA 3H45C 2RE2A 2QWQA 3MMVA 4FJ9A 4FLYA 1BQMA 1GLJO 2JGUA 3ID6A 3THXA 1HQUA 3VGLA 4O5BA 4PY5A 3L6QA 3VQ6A 3LP3A 3CCJN 4F3OA 1RBSA 3ZSZA 2A5XA 4CIEA 1E4FT 3O4WA 3VERA 3CHWA 1K8KA 3SBGA 1DTTA 4I9LA 2ZJQL 3QBXA 4BDZA 1RTDA 5AQQA 4E7IA 4AHSA 3SK3A 4CW7B 1S1VA 3DWLA 3B6OA 1R0AA 1RILA 1YJWN 2YKMA 3ID8A 4CI6A 3F9MA 3FZKA 1LAVA 2D0BA 2OPSA 2UYTA 5BN8A 1TK8A 3VQPA 3AA5X 2P9UB 3PUFA 4PWDA 4M7XA 4WQ5A 4K0KK 5HRRA 3O08A 1ZC6A 1BG3A 3MDQA 3LAMA 4CZMA 1YVNA 4JI7K 3RSEA 4QS7A 3C6AA 5AQYA 5I3UA 4A2AA 4Z4EA 4HCBA 1VQ8N 4B3MK 1EP4A 4OPJA 4DTPA 5JS1A 4LF8K 3ENOA 1S9EA 1HYZA 1RDUA 3H1QA 1GOAA 3O9QA 4PKHA 3HT3A 4ELTA 1RT6A 3CYMA 4BQZA 1D8YA 3G4SN 1JLAA 2OA8A 3VEWA 3C7NA 4QOZB 1BQNA 2I5JA 3UKUB 1SL0A 4FLZA 3EEQA 4J8FA 5CZ1A 3E66A 4JKBA 2F96A 4KKOA 3WT0A 5AQGA 4JRPA 3RTVA 3D6RA 5KI6A 4RCHA 4RTFD 3ZYYX 1NK9A 3OYJA 4CGFA 3HL8A 4O4GA 5HLFA 1NGGA 3SMSA 4HUGA 1EWRA 3LPUA 2PYLA 4LY7A 4JEPA 1IBKK 1HNWK 1Z26A 3TAPA 3PV8A 4ZTJA 3VA3A 2FBYA 4O0IA 5K14A 1J5OA 4GY2B 1U4BA 1DT9A 2GX9A 3OJUA 1N8RO 1X1PA 1QQOA 2FSJA 3H08A 1N32K 1B9DA 1X9SA 3DLHA 3B8AX 4F8RA 3CPWM 3SYZA 3HO1A 2Q0RA 2ITMA 1A5XA 4KO0A 4BR2A 4GKJK 4BC5A 3ZSYA 2GUIA 4FLTA 3GL1A 4A5BA 1ZBUA 3VPZA 1E4GT 3SPYA 2GELA 2YX6A 3CJAA 5AZIA 4U7BA 2IOCA 2V51B 3R1XA 2C1GA 4N76A 3A5NC 1X9JA 3NMUA 2HHTA 4FZZA 3F9KA 3T3FA 4AHUA 3I0RA 3S9HA 1VQNN 3EYZA 2ZE2A 4B1ZA 4FO0A 3T1HK 1EXQA 1YJ9N 3ZEUA 2IC3A 1XC9A 1VSFA 1N36K 4KHWA 4FK2A 2E2PA 4IZ9A 2P9PB 5CE3A 1I3AA 3LDSA 4OX9K 5AQTA 4J2DA 3HSCA 1WSEA 2G8IA 1BI4B 1Y97A 1YIJN 4GVMA 4DHYA 3OYCA 3NDKA 3S3NA 4DSKA 1BO5O 4IFVA 3CF5L 4X64K 3IRXA 1Q8IA 3RMBA 1U2VA 2D5RA 2D1KA 4JYAK 5AQOA 4CESA 3SQ0A 3PSFA 4B1WB 1JLFA 3G6EN 1S1UA 3FFIA 4YOUA 4DSIA 1X3MA 5DM6L 5AQKA 3JAMO 3TAMA 5C12A 4C8KA 1NGEA 4JK7A 1UOCA 1GLLO 2A6AA 5LMUK 4BQLA 3TPQA 3K57A 1XI1A 3WNEA 4RWTA 4DMNA 5FPDA 3N4PA 4DTNA 4GVEA 2D0AA 1S5JA 2FSKA 3LALA 1RGIA 1T3VA 5LJVA 4KBOA 3SJHA 4FJ5A 5LMNK 3A2FA 3LDNA 3CQYA 3WXIA 4F4KA 4Z4CA 5ADXA 3CJ9A 1BIZA 3W3DA 3VQ8A 1ATSA 3QICA 4B3TK 1VSKA 2PYJA 2W6LA 4BVOA 3SAFA 5C24A 4BVPA 1VHXA 3DLRA 5CR4A 3MEDA 4CZJA 5KQDA 3MWTA 3J8AA 3T1AA 3ZETB 3OS1A 3L2RA 1ILYA 1MWKA 2Z1GA 3FR0A 4DV4K 3IKMA 4DR6K 4J2BA 4DCHA 3FZLA 3EZ5A 2E20A 4FSVA 2PAVA 5B8HA 3OYFA 2P9UA 2CH5A 4JD2A 4DSEA 1DKGD 2YI1A 1BDGA 3AVLA 1FW6A 4O55A 5LJWA 4E7LA 5KRTA 1IKWA 1BU6O 3K2PA 5J1EA 4LF4K 4CJ4A 2D0CA 2FXUA 3QEVA 3CMAN 1IBMK 2P9IB 5FPNA 3UKRB 4CZKA 4HVJA 2CGKA 3QINA 1LW2A 1HJRA 3KHYA 1U47A 4JNEA 4W5NA 1T44A 4FZYA 3MN5A 4DTJA 3CIPA 1XHZA 3KLEA 1VSLA 1RDDA 3TSUA 3ALYA 4WFNL 3V9UA 2P1JA 4AHTA 2O8BA 1LWEA 3QESA 4BRGA 4BG8A 1ESVA 1NGAA 3BP8A 3L2VA 1H1VA 3THVA 4OKKA 4B9SA 3HI0A 1NGJA 1TVRA 3OYMA 1T6DA 5EXWA 3CQXA 4KHUA 3OYIA 4BC2A 3R8EA 4PHTX 3OY9A 3DLKA 4R5PA 3M8QA 4M42A 2O8DA 1RTIA 2IVPA 3FZMA 4LFAK 3ITHA 1BWFO 2P9KA 3NAEA 2P9NA 2QA4N 3SAHA 4M41A 3NBPA 4OPHA 4JI1K 4DF4A 2QWOA 2VGMA 4J2EA 2X78A 1XUPO 2QKBA 1QHAA 2VWKA 5BRDA 2QXLA 3M8RA 2PY5A 4BRQA 3SV3A 2NRWA 3L2WA 3KKSA 2FBXA 1C0UA 4Z4FA 3VQQA 1CZAN 4W5RA 4EZ6A 1SS6A 3I56N 4NO7A 1C1AA 1TYQB 3AA3A 5KQ8A 3S5TA 4M63C 1G99A 3E9PA 3TTDA 5AQPA 3VEVA 2KZMA 5KRSA 3DAWA 4M3YA 1RT1A 2W6KA 4KTWA 3SCXA 4V19S 4Z4GA 1U45A 4IKFA 1DEJA 4CJ5A 5AQJA 3CG7A 3EKUA 4BWJA 4FLXA 5LY3A 3DXMA 1TK0A 4AM7A 1NG9A 2YJFA 4YHHK 1BA0A 3H6EA 4FK0A 4FLUA 3MXJA 2F8SA 4W5OA 4H0TB 4CZHA 1T8EA 5LL6Z 4DR1K 3V6DA 2FLOA 4UQGA 1J54A 2OZSA 2BH1A 3VEXA 4FWLA 3QNNA 3CFOA 3VQBA 2KZZA 4NXNK 2H3GX 4B1VA 3J81O 1Q82O 2RHKA 2ASOA 2E1YA 1OH8A 1FK9A 4KB1A 1LWCA 3SAGA 2OANA 3PX0A 4DTUA 1NMDA 4NLBA 4XIUA 3WXKA 5F2RA 2NRVA 3CETA 3TSQA 3VQ9A 3TAFA 4CD1A 4DUYK 4ILJA 2PBDA 2E88A 2P9LA 1RFQA 2G8HA 1V4SA 4M3XA 4YOXA 3KKRA 3SUPA 1KXPA 3M3ZA 1GOCA 1MU2A 1T6CA 3NF9A 3PO4A 4M3ZA 3TR8A 3AVAA 5E26A 3ATUA 4YOTA 4CF9A 3L4QA 5CY4A 1KSPA 2P9LB 2JLEA 3AGRA 1OH6A 1Z05A 3O9TA 5GIOA 3I55N 4EIAA 3PIPL 4HHTA 3O9SA 1GLBG 2D0PA 3K5OA 2BUPA 4OPAA 3VESA 5BN9A 1NK0A 3ENBA 1BOTO 4BGAA 3A8YA 1KQSM 1VQ6N 4I6MA 4IO9L 3RRGA 4DU1A 4F2SA 3HOSA 1XMOK 2UXCK 4Q5VA 3CJ7A 5AQRA 3A5LC 1U49A 3BDPA 3VF4A 4IDKA 4FVMA 1BUPA 4E7HA 4DFPA 3CCQN 2YV0X 4M3UA 1RDCA 2BE2A 2P9SA 4DQ8A 2A41A 4KHYA 1ZYQA 2YKNA 4WFAL 2J4RA 4KH5A 3MN9A 4C8NA 3BEXA 1IBLK 2NRXA 5DK5A 2F9TA 3U6FA 4CFDA 3FE1A 3HXMA 4DV1K 1TKXA 5C0YA 3MCPA 4KTQA 3SBTA 1W0HA 4DB3A 3ZT4A 4ID5A 4XH1A 3GDQA 5HRPA 1QVGM 4KFBA 1NK6A 4XH4A 1YTUA 5AZJA 4FJNA 4KI4A 1S3XA 2Q3SA 3ZT2A 3QEIA 1ZBIA 1WSJA 3DRSA 3H46O 5JVGL 5T7BA 3CXCM 3TU5A 4PKGA 4DTMA 4PA1A 4ID1A 1IKYA 3VOVA 4CK3A 1NKEA 4BE1A 4F2RA 2YNIA 1D5AA 2XRIA 3P83D 2X74A 1RTJA 3MEEA 3O1BA 3LZJA 2NRZA 2XY6A 4C1NK 5KGWA 4N47A 3VQCA 3KLFA 4B8AB 2E1ZA 1OH7A 5FRMA 4CJFA 2YNHA 1ASVA 4HCCA 1S9GA 1NGHA 1KLNA 1JLEA 3VA0A 2PFUA 1KVBA 4H03B 3AVHA 3G10A 3P4IA 3FFKB 3P5JA 1S6QA 5JS2A 2VCPA 5M1OA 2OPQA 4N41A 3VQEA 4CBWA 5AQSA 4DF8A 2GV9A 3E9LA 3LM9A 3SNNA 3DYAA 4FW1A 1JXBA 4DWIA 1QHTA 1WSFA 4IBNA 4FVUA 3HPOA 1WAJA 3V1QA 4CHNA 4L3QA 1NMNA 4A2BA 1QQCA 3BF3A 3SQ1A 2P9NB 4BRNA 5J2NA 3C6TA 1JJ2M 2W00A 4FWRA 4CHPA 4CJPA 3ZT0A 3QETA 3ZT3A 4DS4A 1K8AO 3O5BA 4XEIA 4DLEA 1SZ2A 2VQEK 4W5QA 3DRRA 4H5RA 4JKGA 4RG8A 5E84A 4E72A 3T7ZA 2O8DB 1YF5L 4BREA 2GWJA 4JI2K 1KFSA 3CYGA 1QE1A 2Q1NA 3LP1A 4IOCL 1BI4A 4CF0A 1N34K 1VSIA 1IKXA 4E7JA 3VQ5A 3WXMB 2AA4A 3P38A 3HM8A 2HNYA 5HOOA 4G9ZA 4NB4A 4B1UB 5BRHA 3L3UA 4QS9A 3OTOK 3F5TA 3OVNA 4MLHA 4F3TA 1FJGK 1D4XA 1TYQA 2G8KA 2BGGA 1X3NA 4W5TA 1WB9A 3AVJA 4KV8A 1L5UA 1IG8A 3Q7BA 2W41A 2E8AA 2I7NA 1NOZA 1KAZA 5MLCQ 4FK4A 3PLAA 2WUSA 3MN7A 3ZSRA 2UU9K 4FWQA 4DG1A 4MLEA 1J5EK 1W7AA 1HNIA 4CEOA 5CZ2A 1VQ9N 2P9IA 4CECA 3HPGA 1JCFA 4I9QA 5C15A 3KD5E 4CFBA 2HBJA 4AHRA 3MCAB 1Q81O 1XNRK 2YNFA 3LDLA 3NFAA 1RT7A 2HF4A 2XO7A 2YJEA 2WC9A 2P9PA 3KLIA 4UY8O 2EX3A 1C6VA 3OYDA 4DSJA 1SKWA 2ZJRL 1HYVA 3EE9A 3D7EO 1NJZA 5EX5A 1NLVA 3K59A 3TSPA 4CJ7A 1RTHA 1B9FA 2HHUA 3NGIA 4F9OA 3QFPA 5ELZA 3EO3A 3H3NO 3CCLN 4CZLA 1Q9XA 2O8FA 3DMJA 4NCBA 4OGCA 1XWLA 3C94A 4FLVA 2FBVA
chains in the Genus database with same CATH topology
1HX1A 2JWKA 1KC8O 3CMEN 1WOQA 2W40A 3VTIA 4A5AA 5AQLA 3UE5A 1YAGA 3E9OA 3TSUA 4WFNL 3KZBA 3QBWA 3AAPA 4NLCA 3CCUN 1C0GA 3D2FA 3LDPA 3LM2A 3VMFB 4BRGA 4BG8A 5DM7L 1HKBA 2GWKA 1ESVA 1NGAA 2D0OA 2NNWA 3R6MA 5FPMA 5JLFA 1Q86O 4M7YA 3BP8A 1VAZA 1NM1A 1SAZA 1H1VA 2KLAA 4BECA 2QEXN 4KH4A 1U6ZA 2GEMA 5M1KA 3HI0A 3IDHA 4FWNA 1NGJA 3I33A 3EKSA 4ISFA 1T6DA 4FL9A 5EXWA 2QTDA 2DPNA 3K9JA 3CQXA 4WF9L 2QW9A 1TUYA 2NRTA 2E2QA 2E2OA 1OVYA 3FZHA 5EOYA 4BC2A 1S22A 4B1XB 3R8EA 5F1XA 1MA9B 4PHTX 5TKYA 1K8KB 1NWKA 1GLDG 4PKIA 2IVPA 3E1YA 3FZMA 3CCVN 1VQ5N 4JKHA 3WEEB 1GLCG 2HMPA 1K73O 1BWFO 2P9KA 3O9RA 3QFUA 1YITN 2P9NA 1QZ5A 2QA4N 1VQPN 2HF3A 1YHQN 3FZFA 3SAHA 4EHUA 2IIRA 3PIOL 4BC3A 4FPAA 4WCEL 1NGFA 5M1QA 4OPHA 5AQVA 2QWOA 2VGMA 3A5OC 4XJXA 1IJJA 5AZJB 1HLUA 3IMXA 5C2FA 1NBWA 1XUPO 2A42A 3KWIA 1QHAA 3M6GA 4CZIA 1O13A 5M1PA 2OTLN 3M5RA 4A62A 2P9KB 3U8XA 2QXLA 5BRDA 5AFUH 3FLCO 3NVMA 2HSTA 2NZTA 4BRQA 1M90O 2NRWA 1S72N 4PL8A 3H1VX 4AM6A 3VETA 4YOWA 4BRFA 1CZAN 4IWVA 5GIPA 1SS6A 3I56N 3RVCA 4LC9B 4FWPA 4FWKA 4NO7A 1TYQB 1Z6RA 1OKJA 5KQ8A 2YHYA 3H3OB 4YOVA 4EHTA 2CGJA 4M63C 1G99A 1NGBA 3E9PA 3TTDA 5AQPA 3VEVA 4JKGB 2EWSA 2QWRA 3R9PA 3DAWA 5BPNA 2GTDA 5H1SQ 4IOAL 2IVOA 4H5TA 3HTVA 1HUXA 2AP1A 3QMLA 5AQZA 3D2FB 5AQFA 4BRKA 1DEJA 5AQIA 3WXLA 5AQJA 3EN9A 3Q7CA 3EKUA 3D2EB 4IDHA 2QWMA 3DXKB 5LY3A 4I6MB 4MO5A 4BE7B 1Q18A 3DXMA 5GINA 4AM7A 2WFBA 3DXKA 2YJFA 2Q2RA 1BA0A 3H6EA 3BF1A 1VQ7N 4A61A 2A40A 3ZX0A 3GG4A 2HBMA 3BUZB 4BRCA 4H0TB 4CZHA 4PL7A 4IJNA 1VQKN 4XH5A 3CD6N 3C65A 1MWMA 4K42A 2FSNA 3ULEB 3WQTA 4GV3A 2FLOA 2OTJN 4O8UA 1EQYA 3VF2A 3A5MC 1BA1A 2BH1A 3VEXA 4FWLA 3ATVA 4IEEA 1J6ZA 4WQ4C 3CJ1A 5BPLA 3P39A 4EFHA 2H3GX 3TTFA 4B1VA 1Q82O 1TUUA 2P9SB 2RHKA 2ASOA 2E1YA 5I9EB 3TTCA 4H5NA 4C23A 3SAGA 2OANA 3CJBA 1NMDA 3P31A 4NLBA 2QWLA 1U2VB 3H45C 2RE2A 3WXKA 4KH6A 5F2RA 2GUPA 2QWQA 1SQKA 2NRVA 3CETA 1QZ6A 3MMVA 3VGKA 3TSQA 5GAGP 2E2NA 4CD1A 5BRFA 4ILJA 3CJCA 1GLJO 2E88A 2PBDA 2P9LA 3ID6A 1RFQA 3VEOA 5KPZA 1V4SA 2JWLA 3EL2A 4IEIA 4WYBA 3VGLA 3U9ZA 4YOXA 1W97L 1KXPA 3L6QA 3M3ZA 3CCJN 1T6CA 3CC7N 4H0OA 4MO4A 2A5XA 5E26A 3WEEA 1E4FT 3ATUA 3O4WA 3HBTA 4YOTA 2ASPA 3CHWA 1K8KA 3L4QA 3MX5A 3SBGA 1Y64A 3VERA 3QBXA 3OHRA 2P9LB 4BRMA 5AQNA 4BRHA 5AQQA 3MX2A 2ZJQL 1WUAA 3JS6A 3AGRA 4FPBA 3C0BA 3SK3A 5KPTA 1Z05A 3G25A 3O9TA 3IUCA 5GIOA 3R3LA 3I55N 3KVGA 3DWLA 4EIAA 5AQMA 3W0LA 3PIPL 1YJWN 4H0XB 3ID8A 4CI6A 3F9MA 3FZKA 4O8KA 3O9SA 4JKFA 1GLBG 2UYTA 2D0PA 5JLHA 2BUPA 4FWSA 3ZX2A 5BN8A 4OPAA 3VESA 5BN9A 2F9WA 1YUWA 3L4IA 1LCUA 4K41A 4QS8A 3ENBA 1ZXOA 1BOTO 2P9UB 3A8YA 4ILGB 4BGAA 1KQSM 1KAXA 4I6MA 4IO9L 1VQ6N 4BRPA 3CCRN 4M7XA 4JK9A 4WQ5A 3O08A 3VGMA 1ZC6A 1BG3A 3MDQA 3HOSA 3N4QA 2I7PA 1YVNA 2VYPA 4CZMA 2YHWA 2A3ZA 5JICA 2KKZA 3I8BA 2Q36A 3CJ7A 5AQRA 3RSEA 4QS7A 3A5LC 3C6AA 4C1NI 5AQYA 5M1NA 3VF4A 4A2AA 1VQ8N 1BUPA 1K9MO 5AQXA 3CCQN 2ASMA 3ENOA 3S41A 5ADXH 2P9SA 4DQ8A 2A41A 1RDUA 3H1QA 3O9QA 4BR5A 4PKHA 3WQUA 4WFAL 2J4RA 2QM1A 4KH5A 5AZIB 3AARA 3MN9A 3LL3A 1YJNN 3AY9A 4BQZA 4YDUA 3BEXA 3G4SN 4BRIA 3VEWA 3C7NA 2NRXA 3DLLL 4HTLA 2F9TA 3KWGA 3FE1A 4BR4A 1C0FA 3J7ZO 3UKUB 4J8FA 3E66A 4K25A 4JKBA 5C0YA 3MCPA 4BG9A 3NVKA 4CZFA 5AQHA 2HOEA 3L0QA 5BR9A 4JK8A 5AQGA 3WT0A 3WUHA 3SBTA 3D6RA 5C10A 4RCHA 4DB3A 4RTFD 5C2DA 3ZYYX 4FWMA 4XH1A 3GDQA 2ZGYA 1QVGM 3CC2N 2ZWHA 4WQ4A 1XC3A 4XH4A 4GV6A 3U4LA 3LDOA 1NGGA 2FF6A 3SMSA 5AZJA 4JHDB 1GLFO 1S3XA 3AAQA 1XQSC 2ZF5O 1YXQA 3VEZA 1JCEA 3UKRA 4JEPA 2BTFA 3H46O 5JVGL 2F7TA 3ZX3A 3IFRA 4IO8A 1HKCA 5CHIA 4GV9A 4A59A 1GLEG 3T69A 2QWPA 4WQ5C 3CXCM 3MN6A 3TU5A 3MWPA 4BR9A 4CD3A 4PKGA 4GY2B 1P90A 1DT9A 1ATNA 1JCGA 2GX9A 1N8RO 3VOVA 1QQOA 2FSJA 1QQMA 4H5WA 3A0IX 3O1BA 1W2BM 2NRZA 2CH6A 4C1NK 3CC4N 4GNIA 2E1ZA 3B8AX 3CPWM 1VQON 2Q0RA 2ITMA 4BR2A 1GLAG 4BR7A 4WFBL 3O80A 4DKWA 4BC5A 1NGHA 3VENA 3CPEA 4IXCA 2D4WA 2PFUA 3K9KA 4B1YB 3GL1A 4A5BA 3C7NB 3VPZA 1E4GT 4H03B 3P4IA 2GELA 3GOIA 2YX6A 3CJAA 2Q97A 3FFKB 5AZIA 4U7BA 2NRRA 2VCPA 2V51B 2V52B 3R1XA 2C1GA 4BRAA 3A5NC 1X9JA 5M1OA 3NMUA 1RDWX 2VWBA 5AQSA 4BROA 4CBWA 5AR0A 5M1FA 1KD1O 1VQNN 3E9LA 3LM9A 3M1FA 3MK6A 4FVUA 3KK7A 3O1WA 3SMPA 3HZ6A 4E1JA 3OBWA 4B1ZA 3EZWA 5TKWA 4L3QA 5AQUA 4CBUA 3CI5A 4JD2B 4FO0A 4A2BA 1YJ9N 3ZEUA 3BF3A 2P9NB 4BRNA 2V7ZA 3OA9A 2E2PA 4IZ9A 2P9PB 1JJ2M 2W00A 1ATRA 4FWRA 5CE3A 5AQTA 3O8MA 3ZETA 5AFUA 3HSCA 2FF3B 1K8AO 3O5BA 1DGKN 4XEIA 1SZ2A 4ILHA 2ZGZA 1NGCA 4DHYA 1YIJN 2HBLA 4MDBA 1BO5O 3CF5L 4H5RA 2NLXA 4JKGA 4AF1A 2IVNA 4FWOA 1U2VA 5E84A 5EY4A 2D1KA 3T7ZA 4JKCA 1YF5L 5AQOA 1M1KO 4BREA 4H5VA 3CCSN 1LOTB 4B1WB 2GWJA 5GADP 5GAHP 5BPMA 5KPRA 2Q1NA 3FGUA 3G6EN 4MDAA 4IOCL 3CCEN 4YOUA 1X3MA 5JVHL 5DM6L 4YDUC 5AQKA 1R59O 3WXJA 1P8ZA 2WBNA 5F0XA 5C12A 3QB0A 1NGEA 4JK7A 4H0PA 1YI2N 4Y0WA 3ZEUB 1HPMA 4ISEA 3ULEA 1QVFM 1GLLO 2A6AA 4BY9C 3WXMB 3HOTA 2AA4A 4O5FA 4BQLA 3P38A 3TPQA 3O9UA 3HM8A 4BGBA 4RWTA 2KHOA 5HOOA 1HKGA 2NRHA 5FPDA 3N4PA 4G9ZA 4NB4A 4GVEA 4R79A 4B1UB 5BRHA 2FSKA 1RGIA 4QS9A 1T3VA 5LJVA 3F5TA 4MLHA 5HL7L 1HJOA 5GAEP 4Z94A 1D4XA 4KBOA 3SJHA 1TYQA 1X3NA 2V7YA 4HWIA 3C6HA 5EVZA 4YORA 1IG8A 4CZGA 3Q7BA 2W41A 3LDNA 2E8AA 3U9DA 3CQYA 3UKUA 3WXIA 2I7NA 1KAZA 5ADXA 3CJ9A 3O6WA 5MLCQ 2WUSA 3MN7A 2ZJPL 3W3DA 3PLAA 4FWQA 1ATSA 4MLEA 3QICA 2C1IA 4JAXA 2QI2A 3HRGA 4BVOA 4CBXA 3DJCA 3SAFA 4JN4A 5AQWA 4EAHD 4BVPA 1VQ9N 1VQ4N 4CZJA 2P9IA 5CR4A 5KQDA 1JCFA 3J8AA 3EE8A 3MWTA 3ZETB 2YCHA 4BRLA 3SLCA 5C15A 1ILYA 1MWKA 1VQLN 4BR0A 1EO1A 3FR0A 3LDQA 4ISGA 5FPEA 1ZBSA 3IKMA 4H0YB 1NGIA 4OO1J 2QWNA 3FZLA 4DCHA 2HBJA 2E20A 4FSVA 4YOYA 2CGLA 2PAVA 3DXMB 5B8HA 2P9UA 2CH5A 4JD2A 4IJAA 3MCAB 1DKGD 2YI1A 3D2EA 4IOXA 1Q81O 3UB5A 1BDGA 3LDLA 3F2KA 4FOEA 1KAYA 2VGNA 3JXUA 5LJWA 2HF4A 2YJEA 4BC4A 3GE1A 3VEYA 2WC9A 2P9PA 4UY8O 3OBYA 4H0VB 3ENHA 4BRDA 3QDKA 2ZJRL 1VQMN 1BU6O 3G71N 2FXUA 1NJIO 3EE9A 3CMAN 3D7EO 3OW2M 2P9IB 5FPNA 1V4TA 4JKEA 1NGDA 3UKRB 4B9QA 3GBTA 1NLVA 3CERA 5EX5A 1MDUB 4JKDA 3VTHA 3TSPA 4K43A 4CZKA 3AGKA 4CJ7A 5BREA 2CGKA 4FOIA 1QQNA 3KHYA 4F9OA 4CZEA 3QFPA 5ELZA 3EO3A 3H3NO 4IFEA 3CCLN 4JKAA 4CZLA 4JNEA 4U67L 5JMVA 1Q7YO 4A57A 2HBKA 1T44A 2YHXA 3VF6A 3MN5A 4BEBA 3RSEB 4JHDA 2Q0UA 2Q31A 3CCMN 3CIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HX1 A;  1WOQ A;  2W40 A;  5AQL A;  3UE5 A;  1YAG A;  3KZB A;  3QBW A;  3AAP A;  1C0G A;  3D2F A;  3LDP A;  3LM2 A;  4BRG A;  4BG8 A;  1HKB A;  2GWK A;  1ESV A;  1NGA A;  2D0O A;  3R6M A;  5FPM A;  5JLF A;  4M7Y A;  3BP8 A;  1NM1 A;  1SAZ A;  1H1V A;  1U6Z A;  2GEM A;  3HI0 A;  3IDH A;  4FWN A;  1NGJ A;  3I33 A;  3EKS A;  4ISF A;  1T6D A;  4FL9 A;  5EXW A;  2DPN A;  3CQX A;  2QW9 A;  1TUY A;  2E2Q A;  2E2O A;  3FZH A;  5EOY A;  4BC2 A;  5F1X A;  1S22 A;  4B1X B;  3R8E A;  1MA9 B;  5TKY A;  1K8K B;  1NWK A;  1GLD G;  4PKI A;  2IVP A;  3FZM A;  3WEE B;  1GLC G;  2HMP A;  1BWF O;  2P9K A;  3QFU A;  2P9N A;  1QZ5 A;  2HF3 A;  3FZF A;  4EHU A;  2IIR A;  4BC3 A;  4FPA A;  1NGF A;  5AQV A;  2QWO A;  3A5O C;  1IJJ A;  5AZJ B;  1HLU A;  3IMX A;  1NBW A;  1XUP O;  2A42 A;  1QHA A;  3M6G A;  4CZI A;  4A62 A;  2P9K B;  3U8X A;  2QXL A;  5BRD A;  5AFU H;  3FLC O;  2NZT A;  4BRQ A;  4PL8 A;  3H1V X;  4AM6 A;  3VET A;  4BRF A;  1CZA N;  4IWV A;  4LC9 B;  4FWP A;  4FWK A;  4NO7 A;  1TYQ B;  1Z6R A;  1OKJ A;  5KQ8 A;  2YHY A;  3H3O B;  4EHT A;  2CGJ A;  4M63 C;  1G99 A;  1NGB A;  5AQP A;  3VEV A;  2EWS A;  2QWR A;  3R9P A;  3DAW A;  5BPN A;  2GTD A;  2IVO A;  4H5T A;  3HTV A;  1HUX A;  2AP1 A;  3QML A;  5AQZ A;  3D2F B;  5AQF A;  4BRK A;  1DEJ A;  5AQI A;  3WXL A;  5AQJ A;  3EN9 A;  3EKU A;  3D2E B;  2QWM A;  3DXK B;  5LY3 A;  4I6M B;  4MO5 A;  1Q18 A;  3DXM A;  4AM7 A;  3DXK A;  2YJF A;  2Q2R A;  1BA0 A;  3H6E A;  3BF1 A;  4A61 A;  2A40 A;  3ZX0 A;  3GG4 A;  3BUZ B;  4BRC A;  4H0T B;  4CZH A;  4PL7 A;  4IJN A;  4XH5 A;  1MWM A;  4K42 A;  2FSN A;  3ULE B;  3WQT A;  2FLO A;  1EQY A;  3VF2 A;  3A5M C;  1BA1 A;  3VEX A;  4FWL A;  3ATV A;  1J6Z A;  4WQ4 C;  3CJ1 A;  5BPL A;  4EFH A;  2H3G X;  4B1V A;  1TUU A;  2P9S B;  2ASO A;  2E1Y A;  5I9E B;  4H5N A;  4C23 A;  2OAN A;  3CJB A;  1NMD A;  2QWL A;  1U2V B;  3H45 C;  3WXK A;  5F2R A;  2GUP A;  2QWQ A;  1SQK A;  3CET A;  1QZ6 A;  3MMV A;  3VGK A;  2E2N A;  4CD1 A;  5BRF A;  3CJC A;  1GLJ O;  2E88 A;  2PBD A;  2P9L A;  3VEO A;  1RFQ A;  5KPZ A;  1V4S A;  3EL2 A;  4WYB A;  3VGL A;  3U9Z A;  1KXP A;  3L6Q A;  3M3Z A;  1T6C A;  4H0O A;  4MO4 A;  2A5X A;  5E26 A;  3WEE A;  1E4F T;  3ATU A;  3O4W A;  3HBT A;  2ASP A;  3CHW A;  1K8K A;  3VER A;  4BRH A;  1Y64 A;  3QBX A;  3OHR A;  2P9L B;  4BRM A;  5AQN A;  5AQQ A;  1WUA A;  3JS6 A;  4FPB A;  3C0B A;  3SK3 A;  5KPT A;  1Z05 A;  3G25 A;  3IUC A;  3KVG A;  3DWL A;  4EIA A;  5AQM A;  3W0L A;  4H0X B;  3ID8 A;  4CI6 A;  3F9M A;  3FZK A;  4O8K A;  1GLB G;  2UYT A;  2D0P A;  5JLH A;  2BUP A;  4FWS A;  3ZX2 A;  5BN8 A;  3VES A;  5BN9 A;  2F9W A;  1YUW A;  3L4I A;  1LCU A;  4K41 A;  4QS8 A;  1ZXO A;  1BOT O;  2P9U B;  3A8Y A;  4BGA A;  1KAX A;  4I6M A;  4BRP A;  4M7X A;  4WQ5 A;  3O08 A;  3VGM A;  1ZC6 A;  1BG3 A;  3MDQ A;  2I7P A;  1YVN A;  2VYP A;  4CZM A;  2YHW A;  2A3Z A;  5JIC A;  3I8B A;  2Q36 A;  3CJ7 A;  5AQR A;  3RSE A;  4QS7 A;  3A5L C;  5AQY A;  3VF4 A;  4A2A A;  1BUP A;  5AQX A;  2ASM A;  3ENO A;  3S41 A;  5ADX H;  2P9S A;  4DQ8 A;  2A41 A;  3H1Q A;  4BR5 A;  4PKH A;  3WQU A;  2J4R A;  2QM1 A;  5AZI B;  3AAR A;  3MN9 A;  3LL3 A;  3AY9 A;  4BQZ A;  4YDU A;  3BEX A;  4BRI A;  3VEW A;  3C7N A;  4HTL A;  2F9T A;  3FE1 A;  4BR4 A;  1C0F A;  3UKU B;  4J8F A;  4K25 A;  3MCP A;  4BG9 A;  4CZF A;  5AQH A;  2HOE A;  3L0Q A;  5BR9 A;  3WT0 A;  5AQG A;  3WUH A;  4RCH A;  4DB3 A;  4RTF D;  4FWM A;  4XH1 A;  3GDQ A;  2ZGY A;  2ZWH A;  4WQ4 A;  1XC3 A;  4XH4 A;  3U4L A;  3LDO A;  1NGG A;  2FF6 A;  3SMS A;  5AZJ A;  4JHD B;  1GLF O;  1S3X A;  3AAQ A;  1XQS C;  2ZF5 O;  1YXQ A;  3VEZ A;  1JCE A;  3UKR A;  2BTF A;  3H46 O;  3ZX3 A;  3IFR A;  4IO8 A;  1HKC A;  1GLE G;  2QWP A;  4WQ5 C;  3MN6 A;  3TU5 A;  4CD3 A;  4BR9 A;  4PKG A;  4GY2 B;  1ATN A;  1JCG A;  3VOV A;  1QQO A;  2FSJ A;  1QQM A;  4H5W A;  3A0I X;  3O1B A;  2CH6 A;  4GNI A;  2E1Z A;  3B8A X;  2Q0R A;  2ITM A;  4BR2 A;  1GLA G;  4BR7 A;  3O80 A;  4BC5 A;  1NGH A;  3VEN A;  4IXC A;  2D4W A;  4B1Y B;  3GL1 A;  3C7N B;  3VPZ A;  1E4G T;  4H03 B;  3P4I A;  2GEL A;  3GOI A;  3CJA A;  2Q97 A;  3FFK B;  5AZI A;  2VCP A;  2V51 B;  2V52 B;  4BRA A;  3A5N C;  1X9J A;  1RDW X;  2VWB A;  5AQS A;  4BRO A;  4CBW A;  5AR0 A;  3LM9 A;  3M1F A;  3MK6 A;  3O1W A;  3SMP A;  3HZ6 A;  4E1J A;  4B1Z A;  3EZW A;  4CBU A;  4L3Q A;  5AQU A;  3CI5 A;  4JD2 B;  4FO0 A;  4A2B A;  3ZEU A;  3BF3 A;  2P9N B;  4BRN A;  2V7Z A;  2E2P A;  4IZ9 A;  2P9P B;  1ATR A;  4FWR A;  5CE3 A;  5AQT A;  3O8M A;  3ZET A;  5AFU A;  3HSC A;  2FF3 B;  3O5B A;  1DGK N;  4XEI A;  1SZ2 A;  2ZGZ A;  1NGC A;  4DHY A;  1BO5 O;  4H5R A;  2NLX A;  2IVN A;  4FWO A;  1U2V A;  5E84 A;  5EY4 A;  2D1K A;  5AQO A;  4BRE A;  4H5V A;  1LOT B;  4B1W B;  2GWJ A;  5BPM A;  5KPR A;  2Q1N A;  3FGU A;  1X3M A;  4YDU C;  5AQK A;  1R59 O;  3WXJ A;  1P8Z A;  5F0X A;  3QB0 A;  1NGE A;  4H0P A;  4Y0W A;  3ZEU B;  1HPM A;  4ISE A;  3ULE A;  1GLL O;  2A6A A;  2AA4 A;  4O5F A;  4BQL A;  3TPQ A;  3HM8 A;  4BGB A;  4RWT A;  2KHO A;  1HKG A;  2NRH A;  5FPD A;  4NB4 A;  4B1U B;  5BRH A;  2FSK A;  1RGI A;  4QS9 A;  5LJV A;  4MLH A;  1HJO A;  4Z94 A;  1D4X A;  4KBO A;  3SJH A;  1TYQ A;  1X3N A;  2V7Y A;  4HWI A;  5EVZ A;  1IG8 A;  4CZG A;  2W41 A;  3LDN A;  2E8A A;  3U9D A;  3CQY A;  3UKU A;  3WXI A;  2I7N A;  1KAZ A;  5ADX A;  3CJ9 A;  3O6W A;  2WUS A;  3MN7 A;  3W3D A;  4FWQ A;  1ATS A;  4MLE A;  3QIC A;  4JAX A;  4BVO A;  4CBX A;  3DJC A;  4JN4 A;  5AQW A;  4EAH D;  4BVP A;  4CZJ A;  2P9I A;  5KQD A;  1JCF A;  3J8A A;  3ZET B;  4BRL A;  2YCH A;  3SLC A;  1MWK A;  4BR0 A;  3FR0 A;  3LDQ A;  4ISG A;  5FPE A;  1ZBS A;  4H0Y B;  1NGI A;  2QWN A;  3FZL A;  4DCH A;  2E20 A;  4FSV A;  2CGL A;  2PAV A;  3DXM B;  5B8H A;  2P9U A;  2CH5 A;  4JD2 A;  4IJA A;  1DKG D;  2YI1 A;  3D2E A;  3UB5 A;  1BDG A;  3LDL A;  4FOE A;  1KAY A;  3JXU A;  5LJW A;  2HF4 A;  2YJE A;  4BC4 A;  3GE1 A;  3VEY A;  2P9P A;  4H0V B;  3ENH A;  4BRD A;  3QDK A;  1BU6 O;  2FXU A;  3D7E O;  2P9I B;  5FPN A;  1V4T A;  4B9Q A;  1NGD A;  3UKR B;  3GBT A;  1NLV A;  3CER A;  5EX5 A;  1MDU B;  4K43 A;  4CZK A;  4CJ7 A;  5BRE A;  2CGK A;  4FOI A;  1QQN A;  3KHY A;  4F9O A;  4CZE A;  3QFP A;  5ELZ A;  3EO3 A;  3H3N O;  4CZL A;  4JNE A;  5JMV A;  1T44 A;  2YHX A;  3VF6 A;  3MN5 A;  3RSE B;  4JHD A;  2Q0U A;  2Q31 A;  3CIP A; 
#chains in the Genus database with same CATH topology
 1VSE A;  2IDO A;  3K58 A;  3VTI A;  3UE5 A;  3O4N A;  2G8W A;  1C0T A;  3AAP A;  2F4V K;  3CCU N;  1C0G A;  3D2F A;  4NCG A;  3RMC A;  5DM7 L;  2GWK A;  1JLC A;  2D0O A;  5JLF A;  4GKK K;  1Q86 O;  3S3O A;  5IWA K;  4FYD A;  1DLO A;  2QEX N;  4KH4 A;  1U6Z A;  4FWN A;  4JI3 K;  3I33 A;  3EKS A;  4ISF A;  4FL9 A;  4DFJ A;  4DV7 K;  2QTD A;  2XY8 A;  4KB0 A;  4WF9 L;  1N6Q A;  1TUY A;  3OYK A;  5EOY A;  4HTU A;  1OVY A;  5F1X A;  1VSD A;  1TK5 A;  1NWK A;  1GLD G;  4CEZ A;  2VG5 A;  3WEE B;  1C0M A;  3QFU A;  1QZ5 A;  2FC0 A;  1VQP N;  2HF3 A;  1YHQ N;  3FZF A;  3HM9 A;  4KPY A;  4BC3 A;  5M1Q A;  3LZI A;  1IJJ A;  5C2F A;  3KWI A;  3M6G A;  1UAX A;  3AO4 A;  4FJM A;  5M1P A;  1HNX K;  3M5R A;  5HBM A;  4DTX A;  2VG6 A;  5KGX A;  2HST A;  4DTO A;  1S72 N;  2HMI A;  1J53 A;  4RW9 A;  4AM6 A;  4IFY A;  1RDB A;  4YOW A;  1OVQ A;  3DM2 A;  3CM5 A;  1Z25 A;  4LC9 B;  4FWP A;  4FWK A;  3ZSO A;  1RT2 A;  2KW4 A;  1OKJ A;  2YHY A;  3H3O B;  4YOV A;  3SUQ A;  4CGH A;  5FLX O;  4CK1 A;  4CVN E;  4DV5 K;  4DR3 K;  4IOA L;  1I94 K;  2O4I A;  2HVH A;  2WOM A;  3I0S A;  1ASW A;  1HPZ A;  1KVA A;  4OKJ A;  1S1X A;  1S6P A;  2E4L A;  5AQI A;  3Q7C A;  3PSI A;  4IDH A;  4MO5 A;  2DFF A;  2WFB A;  3KTQ A;  4KHQ A;  1BHL A;  1UA0 A;  4BAC A;  1NK8 A;  3ZX0 A;  4YY3 K;  3BUZ B;  3ZSX A;  4GMJ B;  4BRC A;  4PL7 A;  2XY7 A;  2YNG A;  1EQY A;  3VF2 A;  1RT4 A;  1BA1 A;  4E7K A;  4B3S K;  4IEE A;  1J6Z A;  3CJ1 A;  4AIL C;  4EFH A;  3TTF A;  4N56 A;  4OLA A;  2P9S B;  3TTC A;  4DR7 K;  3CJB A;  2OZM A;  1NK5 A;  3AVK A;  4LH4 A;  3NE6 A;  1JL2 A;  3OYA A;  2JWL A;  3EL2 A;  4WYB A;  3U9Z A;  4FJL A;  4KHN A;  3CC7 N;  4H0O A;  1B92 A;  4OGE A;  4FM2 A;  1T03 A;  3LPT A;  2ASP A;  4E19 A;  3MX5 A;  4BRH A;  4I7F A;  1Y64 A;  4RW4 A;  4CJT A;  3OHR A;  4BRM A;  3THX B;  1W2B M;  4OJR A;  3MX2 A;  4M45 A;  4FPB A;  3C0B A;  4B9N A;  3CFR A;  3G25 A;  3KVG A;  3W0L A;  4Z4H A;  1L3U A;  4H0X B;  4CJL A;  4JKF A;  4PQU A;  5JLH A;  4CEF A;  1WBD A;  3ZX2 A;  3F73 A;  2XY5 A;  2IAJ A;  4QS8 A;  3TAB A;  1ZXO A;  4Z4I A;  4LSL A;  1KAX A;  1IH7 A;  4JK9 A;  4ELU A;  3N4Q A;  2I7P A;  2VYP A;  2A3Z A;  4C1N I;  4Y1D A;  2KFN A;  4B8C A;  1T7P A;  4CHY A;  5M1N A;  2OCE A;  3D45 A;  3E01 A;  2RKI A;  4AQY K;  2DY4 A;  2ASM A;  2ZM6 K;  2HHW A;  3RMD A;  4BR5 A;  3WQU A;  1BCM A;  3J7A P;  5AZI B;  2Y1I A;  3AAR A;  1YJN N;  3QEX A;  4YDU A;  5FRO A;  3K5M A;  2O8C B;  3DLL L;  4HTL A;  3KWG A;  1QSS A;  3HVT A;  2HVI A;  3M8P A;  5HRS A;  4K25 A;  4BG9 A;  3NVK A;  4CZF A;  5AQH A;  3L0Q A;  5BR9 A;  4JK8 A;  5C10 A;  3THW B;  3NGZ A;  4B3O A;  5D3G A;  2ZWH A;  4CF1 A;  4WQ4 A;  1TAU A;  1XC3 A;  3U4L A;  3LDO A;  1E3M A;  2G8V A;  3ZT1 A;  4EZ9 A;  2RF2 A;  1GLF O;  4B9V A;  3AAQ A;  3M8S A;  1RBU A;  2VQF K;  1JCE A;  1UA1 A;  1NU0 A;  3IFR A;  4IO8 A;  2G8F A;  1HKC A;  4GV9 A;  4A59 A;  3PX4 A;  3T69 A;  2QWP A;  3WNH A;  3SQ2 A;  4CD3 A;  3MWP A;  4JRQ A;  4CJS A;  3OYE A;  1P90 A;  1ATN A;  1JCG A;  4LD0 A;  4C8O A;  1QQM A;  3DOK A;  4B9M A;  4H5W A;  2O8B B;  3A0I X;  3V81 A;  5CYM A;  3CC4 N;  1HR0 K;  4FXD A;  4H4O A;  3J7Y P;  4DR2 K;  1VQO N;  1WBB A;  4BR7 A;  4WFB L;  4DKW A;  3VEN A;  3CPE A;  4CEB A;  4DLG A;  2D4W A;  4I2P A;  1C1C A;  3C7N B;  3LAK A;  2YHB A;  1WSI A;  3DI6 A;  4DQP A;  2Q97 A;  2NRR A;  1WNS A;  1NJW A;  4BRA A;  3DLB A;  2ZD1 A;  5IT9 O;  1RDW X;  4BRO A;  4FW2 A;  1IO2 A;  5AR0 A;  5M1F A;  1KD1 O;  3V9Z A;  1ZBF A;  4C8L A;  1BCO A;  3O1W A;  2FBT A;  3EZW A;  4JD2 B;  1OH5 A;  3ZCM A;  3NGY A;  3TAE A;  3NCI A;  5HRN A;  3V9W A;  2V7Z A;  3OA9 A;  1WAF A;  4WE1 A;  4B9L A;  1ATR A;  3BZK A;  3ZET A;  5AFU A;  2FF3 B;  3V4I A;  3QEP A;  4KHS A;  1DGK N;  1UWB A;  4ILH A;  3ZLJ A;  1S1W A;  2ZGZ A;  1NGC A;  2HBL A;  1CXQ A;  3TI0 A;  1FXX A;  2NLX A;  4AF1 A;  1QS4 A;  3QLH A;  3AA4 A;  4X66 K;  1M1K O;  1TKT A;  4H5V A;  3HP9 A;  4IG0 A;  2HHH K;  5GAD P;  3T1Y K;  5GAH P;  4OKE A;  5BPM A;  5KPR A;  1KRP A;  1RT5 A;  3CCE N;  1RT3 A;  3AVB A;  3EY1 A;  1RDA A;  4YDU C;  1VRT A;  3OJS A;  1J9A A;  1P8Z A;  2X6S A;  3QB0 A;  4CHO A;  4Y1C A;  1YI2 N;  4ISE A;  1QVF M;  3L3V A;  4BY9 C;  3HOT A;  3JSM A;  3BGR A;  1JXE A;  2WTU A;  4BGB A;  4DQQ A;  1EWQ A;  2KHO A;  2HHV A;  2NRH A;  2ZQB A;  4R79 A;  3OS0 A;  2QXF A;  3NH2 A;  5GAE P;  2V7Y A;  1YVU A;  2A1S A;  5EVZ A;  3O3H A;  4QCL A;  4YOR A;  3SPZ A;  3P1G A;  3TAG A;  2DFE A;  1IKV A;  2Z1I A;  3U9D A;  2P5O A;  2IGI A;  2C1I A;  3KK1 A;  4JAX A;  2QI2 A;  4DV6 K;  3HRG A;  4CGD A;  5AQW A;  4EAH D;  5FRN A;  1O1W A;  4BRL A;  2YCH A;  1TGO A;  3ULD A;  4B08 A;  3SLC A;  4K8Z A;  3TAR A;  1EO1 A;  4CER A;  5FPE A;  3L8B A;  4OO1 J;  1NGI A;  2QWN A;  4M3W A;  1WSH A;  4YOY A;  2CGL A;  2HNZ A;  4CCH A;  4IOX A;  3AVI A;  4NYN A;  3UB5 A;  1VK0 A;  3F2K A;  4FOE A;  2VGN A;  4B9U A;  3GE1 A;  3OBY A;  4H0V B;  2ETJ A;  3KD1 E;  3G71 N;  2VG7 A;  3AVM A;  4NXM K;  4B9Q A;  1NGD A;  3CER A;  3TAQ A;  1MDU B;  1LAW A;  5C42 A;  2HHX A;  3AGK A;  5BRE A;  2HB5 A;  4FOI A;  1F21 A;  4CZE A;  4IFE A;  3T19 A;  2KTQ A;  3HVR A;  3LP0 A;  3V1O A;  4U67 L;  4A57 A;  5JMV A;  2HBK A;  1HQE A;  2E6M A;  4Q0B A;  4BEB A;  3RSE B;  4JHD A;  2Q31 A;  4EP5 A;  1U48 A;  3CCM N;  2Z1H A;  1HX1 A;  2JWK A;  1KC8 O;  4CEE A;  4N5S A;  3TWH A;  4KAZ A;  4DTS A;  2W40 A;  3K0S A;  4JI5 K;  4A5A A;  5AQL A;  3E9O A;  4L8R B;  3QNO A;  3KZB A;  4DU3 A;  1T05 A;  2HHS A;  3DLG A;  4NLC A;  2OPP A;  3LM2 A;  3LDP A;  1XHX A;  4DQS A;  3VQA A;  4E1M A;  3L2U A;  4DV2 K;  3RMA A;  4M7Y A;  1SAZ A;  2KLA A;  3NH1 A;  3AV9 A;  2EHG A;  3IDH A;  3PY8 A;  1LV5 A;  2DPN A;  3K9J A;  4FM1 A;  2QW9 A;  2XHB A;  2NRT A;  4FJ8 A;  2E2O A;  3FZH A;  4FJX A;  4B1X B;  3I8D A;  1MA9 B;  4C8M A;  1K8K B;  4PKI A;  3CCV N;  3E1Y A;  4JV5 K;  1GLC G;  1K73 O;  3O9R A;  3PO5 A;  1WSG A;  5C25 A;  4EHU A;  2IIR A;  3PIO L;  1N5Y A;  3B6P A;  4WCE L;  5AQV A;  4XJX A;  3O4Q A;  1HLU A;  5AZJ B;  3D0P A;  2OTL N;  1O13 A;  3WNF A;  4A62 A;  2P9K B;  5AFU H;  3NVM A;  2NZT A;  2O8C A;  4PL8 A;  4LH5 A;  3NF7 A;  1JKH A;  2UUA K;  3AO3 A;  4IWV A;  4CF2 A;  2GBZ A;  1N33 K;  1Z6R A;  1K6Y A;  4EHT A;  2CGJ A;  3ZSW A;  2EWS A;  2QWR A;  1RBT A;  4DQI A;  2DFH A;  4B9T A;  4B3R K;  2IVO A;  2IS3 A;  4DTR A;  1TKD A;  3HTV A;  3QML A;  4BRK A;  2KFZ A;  3EN9 A;  1D9F A;  3D2E B;  1FKP A;  3TAN A;  3CM6 A;  3DXK B;  2X6N A;  5GIN A;  4LFC K;  2OPR A;  1TAQ A;  3THW A;  3IG1 A;  2RN2 A;  4O44 A;  4I2Q A;  5J2Q A;  3BF1 A;  1WLJ A;  4NYF A;  4A61 A;  1QSL A;  5DMR A;  1BL3 A;  3GG4 A;  4CJE A;  1RBV A;  3CD6 N;  4IJN A;  3C65 A;  4GV3 A;  4CIG A;  5E41 A;  2OTJ N;  4CE9 A;  4CGI A;  4CHQ A;  4O8U A;  5EU7 A;  1KVC A;  1HYS A;  1L3V A;  4EP4 A;  4WQ4 C;  5KTQ A;  4BDP A;  4CJV A;  1KTQ A;  3QER A;  4RW8 A;  4AHV A;  3NF6 A;  1HNZ K;  4C23 A;  3P31 A;  2QWL A;  5BR8 K;  1U2V B;  4RW6 A;  4KH6 A;  2GUP A;  1SQK A;  1QZ6 A;  3VGK A;  5GAG P;  3NH0 A;  4DUZ K;  2E2N A;  4JI8 K;  5BRF A;  1Q9Y A;  3CJC A;  5KPZ A;  4H8K A;  3VEO A;  4IEI A;  1W97 L;  4G1Q A;  3AVF A;  4RW7 A;  3SQ4 A;  3MAQ A;  3RR7 A;  1DTQ A;  4MO4 A;  3WEE A;  2Y1J A;  3HBT A;  3LWM A;  5AQN A;  1WUA A;  3JS6 A;  2LSN A;  3WNG A;  5KPT A;  3UIQ A;  3V9S A;  3IUC A;  3R3L A;  5AQM A;  4O8K A;  3ZSQ A;  4BE7 B;  4FWS A;  1X9W A;  2F9W A;  1YUW A;  3L4I A;  1LCU A;  3V9X A;  4K41 A;  2WON A;  3O3G A;  4ILG B;  4DQR A;  3G0Z A;  3QO9 A;  4BRP A;  3CCR N;  1KLM A;  1XMQ K;  4FLW A;  4DS5 A;  3VGM A;  3VQ7 A;  3VN5 A;  2YHW A;  1VRU A;  1KFD A;  5JIC A;  2KKZ A;  3I8B A;  2Q36 A;  4ZTF A;  3K5L A;  3QIP A;  1HRH A;  4JI4 K;  3OYH A;  2O8F B;  2DTU A;  3OYN A;  1CZ9 A;  1ZBL A;  1K9M O;  5AQX A;  3O3F A;  3LAN A;  1GOB A;  3S41 A;  5ADX H;  1X9M A;  4LFB K;  2UXB K;  3RRH A;  2OYQ A;  2HW3 A;  2QM1 A;  4LSN A;  1JLQ A;  4CF8 A;  3LL3 A;  1ZBH A;  3AY9 A;  4BRI A;  1RCH A;  4CIF A;  1QTM A;  4IG3 A;  4DSF A;  3QIO A;  4BR4 A;  1C0F A;  3J7Z O;  3DOL A;  4BE0 A;  4KI6 A;  2KQ2 A;  4CHZ A;  3MXM A;  2HOE A;  4JS5 A;  1A5W A;  4PUO A;  3WUH A;  3VQ4 A;  2O8E B;  5C2D A;  4FWM A;  2ZGY A;  4TSX A;  3CC2 N;  4LF7 K;  2O4G A;  4CJU A;  1SKR A;  4GV6 A;  3KK2 A;  1KCF A;  2FF6 A;  4JHD B;  2P51 A;  1XQS C;  2ZF5 O;  3RR8 A;  1FKO A;  1YXQ A;  3VEZ A;  3UKR A;  2BTF A;  4DFK A;  2F7T A;  3ZX3 A;  4DV3 K;  5CHI A;  1VSM A;  1GLE G;  1NJY A;  4FCY A;  1NK7 A;  4WQ5 C;  1C1B A;  3MN6 A;  4BR9 A;  2PZS A;  3KLG A;  4NCA A;  1IG9 A;  3CQ8 A;  5HP1 A;  1EX4 A;  1JL1 A;  1SKS A;  4CK2 A;  3AVC A;  1G15 A;  2CH6 A;  1TL1 A;  1L3T A;  4GNI A;  4FJ7 A;  3K5N A;  4JI0 K;  4E3S A;  1GLA G;  2BAN A;  1VSH A;  4CJK A;  3CFP A;  4CEA A;  4K8X A;  3O80 A;  3NHG A;  4IXC A;  4GW6 A;  3K9K A;  4B1Y B;  2B4J A;  3GOI A;  2UXD K;  3KLH A;  2V52 B;  4FJJ A;  4FJI A;  3BZC A;  3MEG A;  3LP2 A;  2VWB A;  4DV0 K;  1JLB A;  3M1F A;  3MK6 A;  3SJJ A;  3KK7 A;  3SMP A;  3HZ6 A;  4E1J A;  3U3G A;  3OBW A;  2AJQ A;  5TKW A;  4CBU A;  5AQU A;  4BE2 A;  4YFU A;  3CI5 A;  1CLQ A;  1NNE A;  4JS4 A;  2UUB K;  1SV5 A;  3HPH A;  3NF8 A;  3V1R A;  4ICL A;  3AO5 A;  3O8M A;  4KTZ A;  1YTA A;  1LWF A;  1SL2 A;  2BDP A;  4KHP K;  2YHA A;  4MDB A;  3AVG A;  3OYL A;  1U04 A;  2IVN A;  4FWO A;  3ISN C;  5EY4 A;  4O0J A;  5FDL A;  4M3R A;  4JKC A;  3CCS N;  1LOT B;  1CXU A;  3RWU A;  4CGG A;  4CEQ A;  3FGU A;  4CJW A;  4MDA A;  2B6A A;  5CYQ A;  4OVL A;  5JVH L;  4DR4 K;  1REV A;  1R59 O;  3WXJ A;  2WBN A;  5F0X A;  3KJV A;  4H0P A;  1SL1 A;  4Y0W A;  1WN7 A;  1CZB A;  1HPM A;  1RBR A;  3ULE A;  3ZEU B;  4O5F A;  3O9U A;  2HHQ A;  4Z0U A;  2E5L K;  1YT3 A;  4JLH A;  2P5G A;  2A1R A;  1HKG A;  4CGJ A;  1A5V A;  1NKC A;  3OS2 A;  5HL7 L;  1EKE A;  1HJO A;  2E6L A;  4Z94 A;  3OYG A;  3HK2 A;  4LF9 K;  2VWJ A;  4HWI A;  3C6H A;  4CFC A;  4FJH A;  1NJX A;  4CZG A;  2R7Y A;  3UKU A;  2W42 A;  3O6W A;  2ZJP L;  1HNV A;  4M3T A;  3DRP A;  4CBX A;  3DJC A;  5SWM A;  4JN4 A;  1VQ4 N;  4DSL A;  4CED A;  4CFA A;  3EE8 A;  1EET A;  3ASM A;  1VQL N;  4BR0 A;  1BIU A;  3LDQ A;  4ISG A;  1ZBS A;  4H0Y B;  3DXM B;  1NK4 A;  4IJA A;  3D2E A;  3HP6 A;  1KAY A;  3JXU A;  1BIS A;  4CJR A;  4BC4 A;  3VEY A;  1TV6 A;  3ENH A;  4BRD A;  3QDK A;  1VQM N;  1NJI O;  1NOY A;  3QEW A;  3OW2 M;  2UUC K;  1V4T A;  4JKE A;  4MFB A;  3JYT A;  3GBT A;  3VTH A;  1I39 A;  4JKD A;  4K43 A;  3SV4 A;  1QQN A;  4LF6 K;  4KRF A;  4FJG A;  3SI6 A;  4JKA A;  1Q7Y O;  3DLE A;  2YHX A;  3C6U A;  3VF6 A;  5A2Q O;  2Q0U A;  1VSJ A;  4DU4 A;  1IV0 A;  3J80 O;  5I42 A;  3MEC A;  4E89 A;  3IAY A;  3CME N;  1WOQ A;  1XNQ K;  1YAG A;  3S3M A;  4FJK A;  4CJ3 A;  3QBW A;  3LWL A;  3AO2 A;  3VMF B;  1HKB A;  2NNW A;  3R6M A;  5FPM A;  4J2A A;  4ZHR A;  4FM0 A;  1VAZ A;  2ITG A;  1NM1 A;  3THY A;  5J2P A;  4BEC A;  2GEM A;  5M1K A;  4HUE A;  4AHC A;  4HUF A;  1SUQ A;  1W9H A;  3SUN A;  1LW0 A;  3AO1 A;  2E2Q A;  3IS9 A;  3U3Y A;  1S22 A;  1BGX T;  1JLG A;  3ZSV A;  3L2Q A;  5TKY A;  4DR5 K;  1VQ5 N;  3KIO A;  3AA2 A;  4JKH A;  5JEN A;  2HMP A;  1YIT N;  2Z1J A;  4AH9 A;  4FPA A;  1NGF A;  3A5O C;  4OPK A;  4DFM A;  3HYF A;  3IMX A;  1NBW A;  2A42 A;  3C95 A;  4CZI A;  1S1T A;  1TL3 A;  3U8X A;  3FLC O;  5AJ3 K;  1M90 O;  3H1V X;  3VQD A;  3VET A;  3SUO A;  1ASU A;  4BRF A;  1RNH A;  5GIP A;  3RVC A;  2QKK A;  4JI6 K;  4FZX C;  4BDY A;  4X65 K;  1NGB A;  2RPI A;  3SZ2 A;  2HND A;  3HJF A;  4JKG B;  3R9P A;  5BPN A;  2GTD A;  5H1S Q;  3THY B;  4YNQ A;  4H5T A;  2QK9 A;  1HUX A;  2AP1 A;  2F8T A;  1ITG A;  5AQZ A;  3D2F B;  5AQF A;  3PX6 A;  3WXL A;  4BWM A;  2QWM A;  4I6M B;  1Q18 A;  1NKB A;  3DXK A;  2O8E A;  2Q2R A;  3HST B;  1L3S A;  4OLB A;  1VQ7 N;  3AVN A;  2A40 A;  4E0D A;  2HBM A;  5HRO A;  3OYB A;  1VQK N;  4XH5 A;  2G8U A;  3KK3 A;  1MWM A;  4K42 A;  2FSN A;  3ULE B;  3WQT A;  3MXI A;  4MQ3 A;  4ELV A;  5SZT A;  5J2M A;  1TKZ A;  3A5M C;  3BY5 A;  4QAG A;  4X62 K;  4H4M A;  3ATV A;  2ATQ A;  4LF5 K;  2HHI A;  2B5J A;  5BPL A;  3P39 A;  2NUB A;  1QSY A;  4KRE A;  1TUU A;  4E1N A;  5I9E B;  1HMV A;  4H5N A;  4CJQ A;  1D9D A;  3H45 C;  2RE2 A;  2QWQ A;  3MMV A;  4FJ9 A;  4FLY A;  1BQM A;  1GLJ O;  2JGU A;  3ID6 A;  3THX A;  1HQU A;  3VGL A;  4O5B A;  4PY5 A;  3L6Q A;  3VQ6 A;  3LP3 A;  3CCJ N;  4F3O A;  1RBS A;  3ZSZ A;  2A5X A;  4CIE A;  1E4F T;  3O4W A;  3VER A;  3CHW A;  1K8K A;  3SBG A;  1DTT A;  4I9L A;  2ZJQ L;  3QBX A;  4BDZ A;  1RTD A;  5AQQ A;  4E7I A;  4AHS A;  3SK3 A;  4CW7 B;  1S1V A;  3DWL A;  3B6O A;  1R0A A;  1RIL A;  1YJW N;  2YKM A;  3ID8 A;  4CI6 A;  3F9M A;  3FZK A;  1LAV A;  2D0B A;  2OPS A;  2UYT A;  5BN8 A;  1TK8 A;  3VQP A;  3AA5 X;  2P9U B;  3PUF A;  4PWD A;  4M7X A;  4WQ5 A;  4K0K K;  5HRR A;  3O08 A;  1ZC6 A;  1BG3 A;  3MDQ A;  3LAM A;  4CZM A;  1YVN A;  4JI7 K;  3RSE A;  4QS7 A;  3C6A A;  5AQY A;  5I3U A;  4A2A A;  4Z4E A;  4HCB A;  1VQ8 N;  4B3M K;  1EP4 A;  4OPJ A;  4DTP A;  5JS1 A;  4LF8 K;  3ENO A;  1S9E A;  1HYZ A;  1RDU A;  3H1Q A;  1GOA A;  3O9Q A;  4PKH A;  3HT3 A;  4ELT A;  1RT6 A;  3CYM A;  4BQZ A;  1D8Y A;  3G4S N;  1JLA A;  2OA8 A;  3VEW A;  3C7N A;  4QOZ B;  1BQN A;  2I5J A;  3UKU B;  1SL0 A;  4FLZ A;  3EEQ A;  4J8F A;  5CZ1 A;  3E66 A;  4JKB A;  2F96 A;  4KKO A;  3WT0 A;  5AQG A;  4JRP A;  3RTV A;  3D6R A;  5KI6 A;  4RCH A;  4RTF D;  3ZYY X;  1NK9 A;  3OYJ A;  4CGF A;  3HL8 A;  4O4G A;  5HLF A;  1NGG A;  3SMS A;  4HUG A;  1EWR A;  3LPU A;  2PYL A;  4LY7 A;  4JEP A;  1IBK K;  1HNW K;  1Z26 A;  3TAP A;  3PV8 A;  4ZTJ A;  3VA3 A;  2FBY A;  4O0I A;  5K14 A;  1J5O A;  4GY2 B;  1U4B A;  1DT9 A;  2GX9 A;  3OJU A;  1N8R O;  1X1P A;  1QQO A;  2FSJ A;  3H08 A;  1N32 K;  1B9D A;  1X9S A;  3DLH A;  3B8A X;  4F8R A;  3CPW M;  3SYZ A;  3HO1 A;  2Q0R A;  2ITM A;  1A5X A;  4KO0 A;  4BR2 A;  4GKJ K;  4BC5 A;  3ZSY A;  2GUI A;  4FLT A;  3GL1 A;  4A5B A;  1ZBU A;  3VPZ A;  1E4G T;  3SPY A;  2GEL A;  2YX6 A;  3CJA A;  5AZI A;  4U7B A;  2IOC A;  2V51 B;  3R1X A;  2C1G A;  4N76 A;  3A5N C;  1X9J A;  3NMU A;  2HHT A;  4FZZ A;  3F9K A;  3T3F A;  4AHU A;  3I0R A;  3S9H A;  1VQN N;  3EYZ A;  2ZE2 A;  4B1Z A;  4FO0 A;  3T1H K;  1EXQ A;  1YJ9 N;  3ZEU A;  2IC3 A;  1XC9 A;  1VSF A;  1N36 K;  4KHW A;  4FK2 A;  2E2P A;  4IZ9 A;  2P9P B;  5CE3 A;  1I3A A;  3LDS A;  4OX9 K;  5AQT A;  4J2D A;  3HSC A;  1WSE A;  2G8I A;  1BI4 B;  1Y97 A;  1YIJ N;  4GVM A;  4DHY A;  3OYC A;  3NDK A;  3S3N A;  4DSK A;  1BO5 O;  4IFV A;  3CF5 L;  4X64 K;  3IRX A;  1Q8I A;  3RMB A;  1U2V A;  2D5R A;  2D1K A;  4JYA K;  5AQO A;  4CES A;  3SQ0 A;  3PSF A;  4B1W B;  1JLF A;  3G6E N;  1S1U A;  3FFI A;  4YOU A;  4DSI A;  1X3M A;  5DM6 L;  5AQK A;  3JAM O;  3TAM A;  5C12 A;  4C8K A;  1NGE A;  4JK7 A;  1UOC A;  1GLL O;  2A6A A;  5LMU K;  4BQL A;  3TPQ A;  3K57 A;  1XI1 A;  3WNE A;  4RWT A;  4DMN A;  5FPD A;  3N4P A;  4DTN A;  4GVE A;  2D0A A;  1S5J A;  2FSK A;  3LAL A;  1RGI A;  1T3V A;  5LJV A;  4KBO A;  3SJH A;  4FJ5 A;  5LMN K;  3A2F A;  3LDN A;  3CQY A;  3WXI A;  4F4K A;  4Z4C A;  5ADX A;  3CJ9 A;  1BIZ A;  3W3D A;  3VQ8 A;  1ATS A;  3QIC A;  4B3T K;  1VSK A;  2PYJ A;  2W6L A;  4BVO A;  3SAF A;  5C24 A;  4BVP A;  1VHX A;  3DLR A;  5CR4 A;  3MED A;  4CZJ A;  5KQD A;  3MWT A;  3J8A A;  3T1A A;  3ZET B;  3OS1 A;  3L2R A;  1ILY A;  1MWK A;  2Z1G A;  3FR0 A;  4DV4 K;  3IKM A;  4DR6 K;  4J2B A;  4DCH A;  3FZL A;  3EZ5 A;  2E20 A;  4FSV A;  2PAV A;  5B8H A;  3OYF A;  2P9U A;  2CH5 A;  4JD2 A;  4DSE A;  1DKG D;  2YI1 A;  1BDG A;  3AVL A;  1FW6 A;  4O55 A;  5LJW A;  4E7L A;  5KRT A;  1IKW A;  1BU6 O;  3K2P A;  5J1E A;  4LF4 K;  4CJ4 A;  2D0C A;  2FXU A;  3QEV A;  3CMA N;  1IBM K;  2P9I B;  5FPN A;  3UKR B;  4CZK A;  4HVJ A;  2CGK A;  3QIN A;  1LW2 A;  1HJR A;  3KHY A;  1U47 A;  4JNE A;  4W5N A;  1T44 A;  4FZY A;  3MN5 A;  4DTJ A;  3CIP A;  1XHZ A;  3KLE A;  1VSL A;  1RDD A;  3TSU A;  3ALY A;  4WFN L;  3V9U A;  2P1J A;  4AHT A;  2O8B A;  1LWE A;  3QES A;  4BRG A;  4BG8 A;  1ESV A;  1NGA A;  3BP8 A;  3L2V A;  1H1V A;  3THV A;  4OKK A;  4B9S A;  3HI0 A;  1NGJ A;  1TVR A;  3OYM A;  1T6D A;  5EXW A;  3CQX A;  4KHU A;  3OYI A;  4BC2 A;  3R8E A;  4PHT X;  3OY9 A;  3DLK A;  4R5P A;  3M8Q A;  4M42 A;  2O8D A;  1RTI A;  2IVP A;  3FZM A;  4LFA K;  3ITH A;  1BWF O;  2P9K A;  3NAE A;  2P9N A;  2QA4 N;  3SAH A;  4M41 A;  3NBP A;  4OPH A;  4JI1 K;  4DF4 A;  2QWO A;  2VGM A;  4J2E A;  2X78 A;  1XUP O;  2QKB A;  1QHA A;  2VWK A;  5BRD A;  2QXL A;  3M8R A;  2PY5 A;  4BRQ A;  3SV3 A;  2NRW A;  3L2W A;  3KKS A;  2FBX A;  1C0U A;  4Z4F A;  3VQQ A;  1CZA N;  4W5R A;  4EZ6 A;  1SS6 A;  3I56 N;  4NO7 A;  1C1A A;  1TYQ B;  3AA3 A;  5KQ8 A;  3S5T A;  4M63 C;  1G99 A;  3E9P A;  3TTD A;  5AQP A;  3VEV A;  2KZM A;  5KRS A;  3DAW A;  4M3Y A;  1RT1 A;  2W6K A;  4KTW A;  3SCX A;  4V19 S;  4Z4G A;  1U45 A;  4IKF A;  1DEJ A;  4CJ5 A;  5AQJ A;  3CG7 A;  3EKU A;  4BWJ A;  4FLX A;  5LY3 A;  3DXM A;  1TK0 A;  4AM7 A;  1NG9 A;  2YJF A;  4YHH K;  1BA0 A;  3H6E A;  4FK0 A;  4FLU A;  3MXJ A;  2F8S A;  4W5O A;  4H0T B;  4CZH A;  1T8E A;  5LL6 Z;  4DR1 K;  3V6D A;  2FLO A;  4UQG A;  1J54 A;  2OZS A;  2BH1 A;  3VEX A;  4FWL A;  3QNN A;  3CFO A;  3VQB A;  2KZZ A;  4NXN K;  2H3G X;  4B1V A;  3J81 O;  1Q82 O;  2RHK A;  2ASO A;  2E1Y A;  1OH8 A;  1FK9 A;  4KB1 A;  1LWC A;  3SAG A;  2OAN A;  3PX0 A;  4DTU A;  1NMD A;  4NLB A;  4XIU A;  3WXK A;  5F2R A;  2NRV A;  3CET A;  3TSQ A;  3VQ9 A;  3TAF A;  4CD1 A;  4DUY K;  4ILJ A;  2PBD A;  2E88 A;  2P9L A;  1RFQ A;  2G8H A;  1V4S A;  4M3X A;  4YOX A;  3KKR A;  3SUP A;  1KXP A;  3M3Z A;  1GOC A;  1MU2 A;  1T6C A;  3NF9 A;  3PO4 A;  4M3Z A;  3TR8 A;  3AVA A;  5E26 A;  3ATU A;  4YOT A;  4CF9 A;  3L4Q A;  5CY4 A;  1KSP A;  2P9L B;  2JLE A;  3AGR A;  1OH6 A;  1Z05 A;  3O9T A;  5GIO A;  3I55 N;  4EIA A;  3PIP L;  4HHT A;  3O9S A;  1GLB G;  2D0P A;  3K5O A;  2BUP A;  4OPA A;  3VES A;  5BN9 A;  1NK0 A;  3ENB A;  1BOT O;  4BGA A;  3A8Y A;  1KQS M;  1VQ6 N;  4I6M A;  4IO9 L;  3RRG A;  4DU1 A;  4F2S A;  3HOS A;  1XMO K;  2UXC K;  4Q5V A;  3CJ7 A;  5AQR A;  3A5L C;  1U49 A;  3BDP A;  3VF4 A;  4IDK A;  4FVM A;  1BUP A;  4E7H A;  4DFP A;  3CCQ N;  2YV0 X;  4M3U A;  1RDC A;  2BE2 A;  2P9S A;  4DQ8 A;  2A41 A;  4KHY A;  1ZYQ A;  2YKN A;  4WFA L;  2J4R A;  4KH5 A;  3MN9 A;  4C8N A;  3BEX A;  1IBL K;  2NRX A;  5DK5 A;  2F9T A;  3U6F A;  4CFD A;  3FE1 A;  3HXM A;  4DV1 K;  1TKX A;  5C0Y A;  3MCP A;  4KTQ A;  3SBT A;  1W0H A;  4DB3 A;  3ZT4 A;  4ID5 A;  4XH1 A;  3GDQ A;  5HRP A;  1QVG M;  4KFB A;  1NK6 A;  4XH4 A;  1YTU A;  5AZJ A;  4FJN A;  4KI4 A;  1S3X A;  2Q3S A;  3ZT2 A;  3QEI A;  1ZBI A;  1WSJ A;  3DRS A;  3H46 O;  5JVG L;  5T7B A;  3CXC M;  3TU5 A;  4PKG A;  4DTM A;  4PA1 A;  4ID1 A;  1IKY A;  3VOV A;  4CK3 A;  1NKE A;  4BE1 A;  4F2R A;  2YNI A;  1D5A A;  2XRI A;  3P83 D;  2X74 A;  1RTJ A;  3MEE A;  3O1B A;  3LZJ A;  2NRZ A;  2XY6 A;  4C1N K;  5KGW A;  4N47 A;  3VQC A;  3KLF A;  4B8A B;  2E1Z A;  1OH7 A;  5FRM A;  4CJF A;  2YNH A;  1ASV A;  4HCC A;  1S9G A;  1NGH A;  1KLN A;  1JLE A;  3VA0 A;  2PFU A;  1KVB A;  4H03 B;  3AVH A;  3G10 A;  3P4I A;  3FFK B;  3P5J A;  1S6Q A;  5JS2 A;  2VCP A;  5M1O A;  2OPQ A;  4N41 A;  3VQE A;  4CBW A;  5AQS A;  4DF8 A;  2GV9 A;  3E9L A;  3LM9 A;  3SNN A;  3DYA A;  4FW1 A;  1JXB A;  4DWI A;  1QHT A;  1WSF A;  4IBN A;  4FVU A;  3HPO A;  1WAJ A;  3V1Q A;  4CHN A;  4L3Q A;  1NMN A;  4A2B A;  1QQC A;  3BF3 A;  3SQ1 A;  2P9N B;  4BRN A;  5J2N A;  3C6T A;  1JJ2 M;  2W00 A;  4FWR A;  4CHP A;  4CJP A;  3ZT0 A;  3QET A;  3ZT3 A;  4DS4 A;  1K8A O;  3O5B A;  4XEI A;  4DLE A;  1SZ2 A;  2VQE K;  4W5Q A;  3DRR A;  4H5R A;  4JKG A;  4RG8 A;  5E84 A;  4E72 A;  3T7Z A;  2O8D B;  1YF5 L;  4BRE A;  2GWJ A;  4JI2 K;  1KFS A;  3CYG A;  1QE1 A;  2Q1N A;  3LP1 A;  4IOC L;  1BI4 A;  4CF0 A;  1N34 K;  1VSI A;  1IKX A;  4E7J A;  3VQ5 A;  3WXM B;  2AA4 A;  3P38 A;  3HM8 A;  2HNY A;  5HOO A;  4G9Z A;  4NB4 A;  4B1U B;  5BRH A;  3L3U A;  4QS9 A;  3OTO K;  3F5T A;  3OVN A;  4MLH A;  4F3T A;  1FJG K;  1D4X A;  1TYQ A;  2G8K A;  2BGG A;  1X3N A;  4W5T A;  1WB9 A;  3AVJ A;  4KV8 A;  1L5U A;  1IG8 A;  3Q7B A;  2W41 A;  2E8A A;  2I7N A;  1NOZ A;  1KAZ A;  5MLC Q;  4FK4 A;  3PLA A;  2WUS A;  3MN7 A;  3ZSR A;  2UU9 K;  4FWQ A;  4DG1 A;  4MLE A;  1J5E K;  1W7A A;  1HNI A;  4CEO A;  5CZ2 A;  1VQ9 N;  2P9I A;  4CEC A;  3HPG A;  1JCF A;  4I9Q A;  5C15 A;  3KD5 E;  4CFB A;  2HBJ A;  4AHR A;  3MCA B;  1Q81 O;  1XNR K;  2YNF A;  3LDL A;  3NFA A;  1RT7 A;  2HF4 A;  2XO7 A;  2YJE A;  2WC9 A;  2P9P A;  3KLI A;  4UY8 O;  2EX3 A;  1C6V A;  3OYD A;  4DSJ A;  1SKW A;  2ZJR L;  1HYV A;  3EE9 A;  3D7E O;  1NJZ A;  5EX5 A;  1NLV A;  3K59 A;  3TSP A;  4CJ7 A;  1RTH A;  1B9F A;  2HHU A;  3NGI A;  4F9O A;  3QFP A;  5ELZ A;  3EO3 A;  3H3N O;  3CCL N;  4CZL A;  1Q9X A;  2O8F A;  3DMJ A;  4NCB A;  4OGC A;  1XWL A;  3C94 A;  4FLV A;  2FBV A; 
#chains in the Genus database with same CATH homology
 1HX1 A;  2JWK A;  1KC8 O;  3CME N;  1WOQ A;  2W40 A;  3VTI A;  4A5A A;  5AQL A;  3UE5 A;  1YAG A;  3E9O A;  3TSU A;  4WFN L;  3KZB A;  3QBW A;  3AAP A;  4NLC A;  3CCU N;  1C0G A;  3D2F A;  3LDP A;  3LM2 A;  3VMF B;  4BRG A;  4BG8 A;  5DM7 L;  1HKB A;  2GWK A;  1ESV A;  1NGA A;  2D0O A;  2NNW A;  3R6M A;  5FPM A;  5JLF A;  1Q86 O;  4M7Y A;  3BP8 A;  1VAZ A;  1NM1 A;  1SAZ A;  1H1V A;  2KLA A;  4BEC A;  2QEX N;  4KH4 A;  1U6Z A;  2GEM A;  5M1K A;  3HI0 A;  3IDH A;  4FWN A;  1NGJ A;  3I33 A;  3EKS A;  4ISF A;  1T6D A;  4FL9 A;  5EXW A;  2QTD A;  2DPN A;  3K9J A;  3CQX A;  4WF9 L;  2QW9 A;  1TUY A;  2NRT A;  2E2Q A;  2E2O A;  1OVY A;  3FZH A;  5EOY A;  4BC2 A;  1S22 A;  4B1X B;  3R8E A;  5F1X A;  1MA9 B;  4PHT X;  5TKY A;  1K8K B;  1NWK A;  1GLD G;  4PKI A;  2IVP A;  3E1Y A;  3FZM A;  3CCV N;  1VQ5 N;  4JKH A;  3WEE B;  1GLC G;  2HMP A;  1K73 O;  1BWF O;  2P9K A;  3O9R A;  3QFU A;  1YIT N;  2P9N A;  1QZ5 A;  2QA4 N;  1VQP N;  2HF3 A;  1YHQ N;  3FZF A;  3SAH A;  4EHU A;  2IIR A;  3PIO L;  4BC3 A;  4FPA A;  4WCE L;  1NGF A;  5M1Q A;  4OPH A;  5AQV A;  2QWO A;  2VGM A;  3A5O C;  4XJX A;  1IJJ A;  5AZJ B;  1HLU A;  3IMX A;  5C2F A;  1NBW A;  1XUP O;  2A42 A;  3KWI A;  1QHA A;  3M6G A;  4CZI A;  1O13 A;  5M1P A;  2OTL N;  3M5R A;  4A62 A;  2P9K B;  3U8X A;  2QXL A;  5BRD A;  5AFU H;  3FLC O;  3NVM A;  2HST A;  2NZT A;  4BRQ A;  1M90 O;  2NRW A;  1S72 N;  4PL8 A;  3H1V X;  4AM6 A;  3VET A;  4YOW A;  4BRF A;  1CZA N;  4IWV A;  5GIP A;  1SS6 A;  3I56 N;  3RVC A;  4LC9 B;  4FWP A;  4FWK A;  4NO7 A;  1TYQ B;  1Z6R A;  1OKJ A;  5KQ8 A;  2YHY A;  3H3O B;  4YOV A;  4EHT A;  2CGJ A;  4M63 C;  1G99 A;  1NGB A;  3E9P A;  3TTD A;  5AQP A;  3VEV A;  4JKG B;  2EWS A;  2QWR A;  3R9P A;  3DAW A;  5BPN A;  2GTD A;  5H1S Q;  4IOA L;  2IVO A;  4H5T A;  3HTV A;  1HUX A;  2AP1 A;  3QML A;  5AQZ A;  3D2F B;  5AQF A;  4BRK A;  1DEJ A;  5AQI A;  3WXL A;  5AQJ A;  3EN9 A;  3Q7C A;  3EKU A;  3D2E B;  4IDH A;  2QWM A;  3DXK B;  5LY3 A;  4I6M B;  4MO5 A;  4BE7 B;  1Q18 A;  3DXM A;  5GIN A;  4AM7 A;  2WFB A;  3DXK A;  2YJF A;  2Q2R A;  1BA0 A;  3H6E A;  3BF1 A;  1VQ7 N;  4A61 A;  2A40 A;  3ZX0 A;  3GG4 A;  2HBM A;  3BUZ B;  4BRC A;  4H0T B;  4CZH A;  4PL7 A;  4IJN A;  1VQK N;  4XH5 A;  3CD6 N;  3C65 A;  1MWM A;  4K42 A;  2FSN A;  3ULE B;  3WQT A;  4GV3 A;  2FLO A;  2OTJ N;  4O8U A;  1EQY A;  3VF2 A;  3A5M C;  1BA1 A;  2BH1 A;  3VEX A;  4FWL A;  3ATV A;  4IEE A;  1J6Z A;  4WQ4 C;  3CJ1 A;  5BPL A;  3P39 A;  4EFH A;  2H3G X;  3TTF A;  4B1V A;  1Q82 O;  1TUU A;  2P9S B;  2RHK A;  2ASO A;  2E1Y A;  5I9E B;  3TTC A;  4H5N A;  4C23 A;  3SAG A;  2OAN A;  3CJB A;  1NMD A;  3P31 A;  4NLB A;  2QWL A;  1U2V B;  3H45 C;  2RE2 A;  3WXK A;  4KH6 A;  5F2R A;  2GUP A;  2QWQ A;  1SQK A;  2NRV A;  3CET A;  1QZ6 A;  3MMV A;  3VGK A;  3TSQ A;  5GAG P;  2E2N A;  4CD1 A;  5BRF A;  4ILJ A;  3CJC A;  1GLJ O;  2E88 A;  2PBD A;  2P9L A;  3ID6 A;  1RFQ A;  3VEO A;  5KPZ A;  1V4S A;  2JWL A;  3EL2 A;  4IEI A;  4WYB A;  3VGL A;  3U9Z A;  4YOX A;  1W97 L;  1KXP A;  3L6Q A;  3M3Z A;  3CCJ N;  1T6C A;  3CC7 N;  4H0O A;  4MO4 A;  2A5X A;  5E26 A;  3WEE A;  1E4F T;  3ATU A;  3O4W A;  3HBT A;  4YOT A;  2ASP A;  3CHW A;  1K8K A;  3L4Q A;  3MX5 A;  3SBG A;  1Y64 A;  3VER A;  3QBX A;  3OHR A;  2P9L B;  4BRM A;  5AQN A;  4BRH A;  5AQQ A;  3MX2 A;  2ZJQ L;  1WUA A;  3JS6 A;  3AGR A;  4FPB A;  3C0B A;  3SK3 A;  5KPT A;  1Z05 A;  3G25 A;  3O9T A;  3IUC A;  5GIO A;  3R3L A;  3I55 N;  3KVG A;  3DWL A;  4EIA A;  5AQM A;  3W0L A;  3PIP L;  1YJW N;  4H0X B;  3ID8 A;  4CI6 A;  3F9M A;  3FZK A;  4O8K A;  3O9S A;  4JKF A;  1GLB G;  2UYT A;  2D0P A;  5JLH A;  2BUP A;  4FWS A;  3ZX2 A;  5BN8 A;  4OPA A;  3VES A;  5BN9 A;  2F9W A;  1YUW A;  3L4I A;  1LCU A;  4K41 A;  4QS8 A;  3ENB A;  1ZXO A;  1BOT O;  2P9U B;  3A8Y A;  4ILG B;  4BGA A;  1KQS M;  1KAX A;  4I6M A;  4IO9 L;  1VQ6 N;  4BRP A;  3CCR N;  4M7X A;  4JK9 A;  4WQ5 A;  3O08 A;  3VGM A;  1ZC6 A;  1BG3 A;  3MDQ A;  3HOS A;  3N4Q A;  2I7P A;  1YVN A;  2VYP A;  4CZM A;  2YHW A;  2A3Z A;  5JIC A;  2KKZ A;  3I8B A;  2Q36 A;  3CJ7 A;  5AQR A;  3RSE A;  4QS7 A;  3A5L C;  3C6A A;  4C1N I;  5AQY A;  5M1N A;  3VF4 A;  4A2A A;  1VQ8 N;  1BUP A;  1K9M O;  5AQX A;  3CCQ N;  2ASM A;  3ENO A;  3S41 A;  5ADX H;  2P9S A;  4DQ8 A;  2A41 A;  1RDU A;  3H1Q A;  3O9Q A;  4BR5 A;  4PKH A;  3WQU A;  4WFA L;  2J4R A;  2QM1 A;  4KH5 A;  5AZI B;  3AAR A;  3MN9 A;  3LL3 A;  1YJN N;  3AY9 A;  4BQZ A;  4YDU A;  3BEX A;  3G4S N;  4BRI A;  3VEW A;  3C7N A;  2NRX A;  3DLL L;  4HTL A;  2F9T A;  3KWG A;  3FE1 A;  4BR4 A;  1C0F A;  3J7Z O;  3UKU B;  4J8F A;  3E66 A;  4K25 A;  4JKB A;  5C0Y A;  3MCP A;  4BG9 A;  3NVK A;  4CZF A;  5AQH A;  2HOE A;  3L0Q A;  5BR9 A;  4JK8 A;  5AQG A;  3WT0 A;  3WUH A;  3SBT A;  3D6R A;  5C10 A;  4RCH A;  4DB3 A;  4RTF D;  5C2D A;  3ZYY X;  4FWM A;  4XH1 A;  3GDQ A;  2ZGY A;  1QVG M;  3CC2 N;  2ZWH A;  4WQ4 A;  1XC3 A;  4XH4 A;  4GV6 A;  3U4L A;  3LDO A;  1NGG A;  2FF6 A;  3SMS A;  5AZJ A;  4JHD B;  1GLF O;  1S3X A;  3AAQ A;  1XQS C;  2ZF5 O;  1YXQ A;  3VEZ A;  1JCE A;  3UKR A;  4JEP A;  2BTF A;  3H46 O;  5JVG L;  2F7T A;  3ZX3 A;  3IFR A;  4IO8 A;  1HKC A;  5CHI A;  4GV9 A;  4A59 A;  1GLE G;  3T69 A;  2QWP A;  4WQ5 C;  3CXC M;  3MN6 A;  3TU5 A;  3MWP A;  4BR9 A;  4CD3 A;  4PKG A;  4GY2 B;  1P90 A;  1DT9 A;  1ATN A;  1JCG A;  2GX9 A;  1N8R O;  3VOV A;  1QQO A;  2FSJ A;  1QQM A;  4H5W A;  3A0I X;  3O1B A;  1W2B M;  2NRZ A;  2CH6 A;  4C1N K;  3CC4 N;  4GNI A;  2E1Z A;  3B8A X;  3CPW M;  1VQO N;  2Q0R A;  2ITM A;  4BR2 A;  1GLA G;  4BR7 A;  4WFB L;  3O80 A;  4DKW A;  4BC5 A;  1NGH A;  3VEN A;  3CPE A;  4IXC A;  2D4W A;  2PFU A;  3K9K A;  4B1Y B;  3GL1 A;  4A5B A;  3C7N B;  3VPZ A;  1E4G T;  4H03 B;  3P4I A;  2GEL A;  3GOI A;  2YX6 A;  3CJA A;  2Q97 A;  3FFK B;  5AZI A;  4U7B A;  2NRR A;  2VCP A;  2V51 B;  2V52 B;  3R1X A;  2C1G A;  4BRA A;  3A5N C;  1X9J A;  5M1O A;  3NMU A;  1RDW X;  2VWB A;  5AQS A;  4BRO A;  4CBW A;  5AR0 A;  5M1F A;  1KD1 O;  1VQN N;  3E9L A;  3LM9 A;  3M1F A;  3MK6 A;  4FVU A;  3KK7 A;  3O1W A;  3SMP A;  3HZ6 A;  4E1J A;  3OBW A;  4B1Z A;  3EZW A;  5TKW A;  4L3Q A;  5AQU A;  4CBU A;  3CI5 A;  4JD2 B;  4FO0 A;  4A2B A;  1YJ9 N;  3ZEU A;  3BF3 A;  2P9N B;  4BRN A;  2V7Z A;  3OA9 A;  2E2P A;  4IZ9 A;  2P9P B;  1JJ2 M;  2W00 A;  1ATR A;  4FWR A;  5CE3 A;  5AQT A;  3O8M A;  3ZET A;  5AFU A;  3HSC A;  2FF3 B;  1K8A O;  3O5B A;  1DGK N;  4XEI A;  1SZ2 A;  4ILH A;  2ZGZ A;  1NGC A;  4DHY A;  1YIJ N;  2HBL A;  4MDB A;  1BO5 O;  3CF5 L;  4H5R A;  2NLX A;  4JKG A;  4AF1 A;  2IVN A;  4FWO A;  1U2V A;  5E84 A;  5EY4 A;  2D1K A;  3T7Z A;  4JKC A;  1YF5 L;  5AQO A;  1M1K O;  4BRE A;  4H5V A;  3CCS N;  1LOT B;  4B1W B;  2GWJ A;  5GAD P;  5GAH P;  5BPM A;  5KPR A;  2Q1N A;  3FGU A;  3G6E N;  4MDA A;  4IOC L;  3CCE N;  4YOU A;  1X3M A;  5JVH L;  5DM6 L;  4YDU C;  5AQK A;  1R59 O;  3WXJ A;  1P8Z A;  2WBN A;  5F0X A;  5C12 A;  3QB0 A;  1NGE A;  4JK7 A;  4H0P A;  1YI2 N;  4Y0W A;  3ZEU B;  1HPM A;  4ISE A;  3ULE A;  1QVF M;  1GLL O;  2A6A A;  4BY9 C;  3WXM B;  3HOT A;  2AA4 A;  4O5F A;  4BQL A;  3P38 A;  3TPQ A;  3O9U A;  3HM8 A;  4BGB A;  4RWT A;  2KHO A;  5HOO A;  1HKG A;  2NRH A;  5FPD A;  3N4P A;  4G9Z A;  4NB4 A;  4GVE A;  4R79 A;  4B1U B;  5BRH A;  2FSK A;  1RGI A;  4QS9 A;  1T3V A;  5LJV A;  3F5T A;  4MLH A;  5HL7 L;  1HJO A;  5GAE P;  4Z94 A;  1D4X A;  4KBO A;  3SJH A;  1TYQ A;  1X3N A;  2V7Y A;  4HWI A;  3C6H A;  5EVZ A;  4YOR A;  1IG8 A;  4CZG A;  3Q7B A;  2W41 A;  3LDN A;  2E8A A;  3U9D A;  3CQY A;  3UKU A;  3WXI A;  2I7N A;  1KAZ A;  5ADX A;  3CJ9 A;  3O6W A;  5MLC Q;  2WUS A;  3MN7 A;  2ZJP L;  3W3D A;  3PLA A;  4FWQ A;  1ATS A;  4MLE A;  3QIC A;  2C1I A;  4JAX A;  2QI2 A;  3HRG A;  4BVO A;  4CBX A;  3DJC A;  3SAF A;  4JN4 A;  5AQW A;  4EAH D;  4BVP A;  1VQ9 N;  1VQ4 N;  4CZJ A;  2P9I A;  5CR4 A;  5KQD A;  1JCF A;  3J8A A;  3EE8 A;  3MWT A;  3ZET B;  2YCH A;  4BRL A;  3SLC A;  5C15 A;  1ILY A;  1MWK A;  1VQL N;  4BR0 A;  1EO1 A;  3FR0 A;  3LDQ A;  4ISG A;  5FPE A;  1ZBS A;  3IKM A;  4H0Y B;  1NGI A;  4OO1 J;  2QWN A;  3FZL A;  4DCH A;  2HBJ A;  2E20 A;  4FSV A;  4YOY A;  2CGL A;  2PAV A;  3DXM B;  5B8H A;  2P9U A;  2CH5 A;  4JD2 A;  4IJA A;  3MCA B;  1DKG D;  2YI1 A;  3D2E A;  4IOX A;  1Q81 O;  3UB5 A;  1BDG A;  3LDL A;  3F2K A;  4FOE A;  1KAY A;  2VGN A;  3JXU A;  5LJW A;  2HF4 A;  2YJE A;  4BC4 A;  3GE1 A;  3VEY A;  2WC9 A;  2P9P A;  4UY8 O;  3OBY A;  4H0V B;  3ENH A;  4BRD A;  3QDK A;  2ZJR L;  1VQM N;  1BU6 O;  3G71 N;  2FXU A;  1NJI O;  3EE9 A;  3CMA N;  3D7E O;  3OW2 M;  2P9I B;  5FPN A;  1V4T A;  4JKE A;  1NGD A;  3UKR B;  4B9Q A;  3GBT A;  1NLV A;  3CER A;  5EX5 A;  1MDU B;  4JKD A;  3VTH A;  3TSP A;  4K43 A;  4CZK A;  3AGK A;  4CJ7 A;  5BRE A;  2CGK A;  4FOI A;  1QQN A;  3KHY A;  4F9O A;  4CZE A;  3QFP A;  5ELZ A;  3EO3 A;  3H3N O;  4IFE A;  3CCL N;  4JKA A;  4CZL A;  4JNE A;  4U67 L;  5JMV A;  1Q7Y O;  4A57 A;  2HBK A;  1T44 A;  2YHX A;  3VF6 A;  3MN5 A;  4BEB A;  3RSE B;  4JHD A;  2Q0U A;  2Q31 A;  3CCM N;  3CIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...