4PL7A

Structure of komagataella pastoris actin-thymosin beta4 hybrid
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
425
structure length
382
Chain Sequence
VAALVIDNGSGMCKAGYAGDDAPHTVFPSVVGSFVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRLAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYASGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYTFSTSAEREIVRDIKEKLCYVALDFDQELQTSSQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEASGIDQTTYNSIMKCDVDVRKELYSNIVMSGGTTMFPGIAERMQKELTALAPSSMKVKISAPPERKYSVWIGGSILASLGTFQQMWISKQEYDESDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin,Thymosin beta-4
publication title Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
pubmed doi rcsb
source organism Komagataella pastoris
molecule tags Structural protein, contractile protein
total genus 126
structure length 382
sequence length 425
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01290 Thymosin Thymosin beta-4 family
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4pl7A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4pl7A01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4pl7A03
3CHWA 1C0FA 3O08A 4L3QA 3EKUA 3KZBA 3LDLA 4H0XB 3VF4A 3WQUA 1ZBSA 4FWLA 5AQGA 4CBUA 3WQTA 4H5NA 3C7NB 1C0GA 1U2VA 3QFPA 4BGAA 3H3NO 2P9SB 4H0VB 4K42A 2V7YA 3MN5A 5AQLA 3C7NA 1TUUA 3IFRA 3SMSA 1BO5O 5AQVA 3UE5A 5FPNA 4IWVA 3QFUA 2P9PA 5ELZA 4K43A 5BPMA 5BPNA 5AQWA 2AA4A 3O80A 4IZ9A 1GLFO 1WOQA 2YJFA 2P9NB 1NGJA 4BRKA 4JHDB 4H5WA 5KPTA 4CBXA 4H5VA 4PKGA 1T44A 1JCEA 2QXLA 2P9NA 4H5RA 4QS8A 1R59O 4H0PA 3A0IX 4PKHA 3IMXA 1NGEA 3AAQA 1RDWX 2VCPA 5AQOA 3CJ9A 5LY3A 2Q36A 1G99A 1K8KB 1ATSA 4IJAA 3DAWA 4K41A 2ZF5O 3WXJA 3H46O 1K8KA 3BUZB 4BRMA 2VYPA 4Z94A 1JCFA 3O5BA 5AQQA 2PAVA 2D0PA 2Q31A 4HWIA 4BGBA 5AQHA 4BRCA 2V52B 2F9WA 2FSNA 1S3XA 2ZGYA 2FXUA 3WEEB 3HM8A 5KPZA 1GLAG 4BVOA 1RGIA 4BC5A 1KAXA 2FF6A 3WEEA 2E1ZA 2UYTA 1D4XA 3FZLA 3KHYA 3UKUA 4MLHA 5EY4A 2V7ZA 3D2EB 4CD1A 4FPAA 3CETA 1DGKN 1BA1A 3HSCA 5AFUA 3ZX0A 4MO4A 3UKRB 1NGCA 3FZFA 2BUPA 3AY9A 4CZMA 3UKRA 2QWQA 4EAHD 3VEVA 2VWBA 1TYQB 2D4WA 3U9ZA 3UB5A 4C23A 3ZETA 4BC3A 1NGHA 5FPDA 1TYQA 2YCHA 3TPQA 4BRPA 1P8ZA 2ZGZA 2F9TA 5F2RA 1OKJA 2ZWHA 4A61A 1LCUA 2QWLA 4NB4A 5AR0A 3GL1A 3CQXA 2E8AA 4A62A 1LOTB 2IVOA 2A5XA 3FGUA 3ZEUB 3CQYA 2A40A 3W0LA 3MK6A 3OHRA 1KAZA 5AZJA 3FFKB 1S22A 5EXWA 3QICA 4FWKA 3ZEUA 2OANA 5AFUH 1NGAA 5F0XA 1SAZA 1V4SA 5FPEA 1QZ6A 3M3ZA 4A2AA 2D0OA 4FWRA 4RWTA 5JLFA 5EX5A 3JS6A 1NBWA 5KQDA 4M63C 4DB3A 4PL7A 3VEWA 1H1VA 3GBTA 3FZMA 4GY2B 4B1UB 2YHXA 2FSJA 2QW9A 3FR0A 4FWOA 4H5TA 3VESA 5E26A 5TKYA 1MDUB 4MLEA 3A5MC 3LDPA 3A5OC 2Q2RA 2ITMA 4B9QA 3EKSA 3MCPA 2QWNA 4GNIA 3VGMA 1U2VB 4WQ5A 4CZHA 4JNEA 4IXCA 4BC4A 3LM9A 3SMPA 3O1WA 4BRIA 4ISGA 1EQYA 3SLCA 3IDHA 3BF3A 2WUSA 1NGIA 2Q1NA 5AQZA 1WUAA 2FF3B 2P9PB 3CJCA 4RCHA 3TU5A 1J6ZA 4BRQA 3LM2A 1ATNA 4H0OA 4QS9A 1GLCG 1QZ5A 5FPMA 3HI0A 4XH5A 1Q18A 3KVGA 3H1QA 5KQ8A 4BRHA 4CBWA 1HKBA 5AQPA 4WQ5C 4ISEA 1GLDG 1E4FT 3VENA 4B1VA 3L4IA 2YI1A 1ZXOA 4EHUA 4A2BA 3EN9A 1IG8A 1HLUA 3FZKA 4FOEA 1BOTO 3BEXA 5LJVA 2J4RA 1E4GT 3CJ1A 4BR4A 1X9JA 3QBWA 5AQMA 4H0TB 1BDGA 1NGBA 3RSEA 1NMDA 3VPZA 4CZLA 1IJJA 2YHWA 2HF4A 3D2FA 4JN4A 3D7EO 3FZHA 4BQZA 3CI5A 3VF6A 1GLBG 5AQYA 1V4TA 3O4WA 4FWQA 4BROA 3UKUB 4EFHA 1ESVA 5AQNA 4I6MA 3SK3A 2HF3A 5EOYA 5ADXA 3HZ6A 2BTFA 4XH4A 5BN9A 3U9DA 4BVPA 5AQTA 3CIPA 3VEOA 4BG8A 4BRDA 5KPRA 2KHOA 3ATVA 1BUPA 1MWKA 2D1KA 4CZEA 3DWLA 3VEYA 5AQJA 5BREA 2QM1A 3VGLA 3LDNA 4BRAA 2CGLA 1TUYA 4BR5A 4JAXA 3ULEA 3ZETB 5BRFA 3GOIA 3CJBA 3L6QA 3O8MA 1KAYA 3EZWA 1YXQA 2ASMA 4BG9A 3CJAA 2Q0UA 1SZ2A 3J8AA 3BP8A 1HPMA 1ATRA 1KXPA 2P9LA 4BR7A 4NO7A 2ASPA 2P9KB 2QWRA 5AZIA 2CGJA 1BWFO 4DQ8A 3ZX2A 3F9MA 3B8AX 3CJ7A 5AZJB 2A3ZA 2P9KA 4K25A 3DXKA 2NZTA 4CJ7A 4H0YB 3WXLA 5ADXH 3FLCO 3MN9A 4BR9A 1QQOA 5I9EB 3VEXA 4CD3A 3H45C 2YJEA 1HJOA 3I8BA 4RTFD 5B8HA 2QWPA 5AQIA 4DCHA 3P4IA 4BRGA 3ID8A 1NGDA 1ZC6A 4JD2B 1GLEG 3AARA 2NRHA 1X3MA 4FWMA 3EO3A 4AM6A 4JD2A 3ENOA 4FSVA 4AM7A 2P9UB 4CI6A 3SJHA 4DHYA 3LL3A 4WQ4A 1YUWA 4CZFA 2P9UA 2DPNA 5BRDA 2E2NA 1QQMA 5LJWA 2AP1A 5F1XA 1YVNA 1MA9B 1NM1A 4B1XB 4O5FA 2V51B 1T6CA 3GG4A 4ISFA 3H6EA 1T6DA 5EVZA 2IIRA 1QHAA 3LDQA 5JMVA 1HKCA 2E20A 3MN7A 4H03B 4IJNA 4M7XA 4CZGA 4B1WB 2A42A 1XUPO 3MMVA 4WQ4C 2I7PA 4EHTA 2EWSA 2GELA 4F9OA 2W41A 1Y64A 4FWSA 4BREA 2FSKA 2IVNA 1HUXA 3M6GA 3C0BA 3VGKA 5BN8A 5AQKA 1RFQA 2P9SA 4B1ZA 3VOVA 2QWMA 2GTDA 4HTLA 3GDQA 4FPBA 4BC2A 3RSEB 3W3DA 1SQKA 3FE1A 1U6ZA 3DXMB 3U4LA 3GE1A 3D2FB 2A6AA 4JHDA 2Q0RA 3DXMA 4QS7A 3WUHA 4BRNA 1NGGA 2A41A 2HOEA 3VETA 3A8YA 4I6MB 4YDUA 3WXKA 3H3OB 3ATUA 2I7NA 1BG3A 1YAGA 5BRHA 2Q97A 5BPLA 2NLXA 3R9PA 1NLVA 2E2QA 1XQSC 2E1YA 1DEJA 2E88A 3L0QA 4CZJA 3QDKA 5JLHA 2CH5A 3ULEB 4M7YA 3A5NC 2HMPA 5AQXA 2GUPA 4KBOA 3A5LC 4LC9B 3O6WA 2FLOA 1MWMA 2GWKA 5AQRA 1NGFA 1HKGA 2PBDA 4PKIA 1XC3A 3MN6A 2E2OA 3O1BA 2P9LB 5AQFA 2ASOA 1NWKA 4YDUC 3R8EA 5AZIB 3R6MA 4CZKA 4CZIA 3M1FA 3DXKB 4B1YB 3EL2A 4XH1A 1DKGD 3D2EA 3VF2A 3WXIA 3QBXA 4BR2A 4MO5A 3CERA 2YHYA 2CH6A 3U8XA 4FWPA 5AQSA 1JCGA 3JXUA 3ZX3A 1GLJO 4XEIA 4BRLA 3VEZA 2GWJA 4EIAA 3AAPA 2IVPA 3I33A 3IUCA 4FL9A 1X3NA 3H1VX 4WYBA 3HBTA 4IO8A 3LDOA 5E84A 4FO0A 3BF1A 3WT0A 3QB0A 4FWNA 3ENHA 4E1JA 1Z6RA 1HX1A 4BQLA 4J8FA 4FOIA 3MDQA 2GEMA 1QQNA 4BR0A 3QMLA 5AQUA 4O8KA 2H3GX 2W40A 3VERA 2QWOA 1GLLO 1CZAN 2E2PA 3S41A 1Z05A 5JICA 4PL8A 1BA0A 4Y0WA 2P9IB 3DJCA 4BRFA 2CGKA 3HTVA 2P9IA 5CE3A 3G25A 5BR9A 1BU6O
chains in the Genus database with same CATH superfamily
4JI6K 1C0FA 2BH1A 4DTPA 1CZBA 5C0YA 1JXBA 3WQUA 3CYGA 3VF4A 3CCUN 3CPWM 4CBUA 3SAFA 1U2VA 3H3NO 2ZQBA 4H0VB 5C24A 1BO5O 3O4QA 3EZ5A 4G1QA 5FPNA 5BPNA 1JXEA 4K43A 4E7JA 4IEEA 1LAVA 1Q9XA 2P9NB 4FM2A 3T69A 4CBXA 3QNNA 2FBVA 1DLOA 4DV1K 4H0PA 5IWAK 3A0IX 3IMXA 2ITGA 2Q36A 3K9KA 1EP4A 3V9UA 1C1AA 1ATSA 3DAWA 1LW2A 3BUZB 4M3UA 5JS2A 3CQ8A 2VYPA 4Z94A 3O5BA 4DTNA 5HRSA 4DTUA 3BGRA 4C8OA 2F9WA 3S3MA 1S3XA 1NJIO 1BCMA 3HM8A 3BDPA 1GLAG 1FKOA 4JS4A 1VQ9N 2FF6A 3WEEA 4YY3K 4G9ZA 2AJQA 3P38A 3SNNA 3V1QA 3SUQA 2OZSA 3BY5A 3I8DA 4X65K 1A5VA 4BWMA 5EY4A 4GV9A 4CD1A 3CETA 3HSCA 1BA1A 4MO4A 3TAFA 2P5OA 2IDOA 1NGCA 5M1NA 1VK0A 1TKTA 3LALA 1I39A 1T3VA 3DLGA 2QWQA 1I3AA 3ZETA 3DRSA 2IGIA 2D0BA 1NGHA 5FPDA 1VQPN 4FZYA 3M8QA 3K5LA 3VQQA 4R5PA 1P8ZA 2ZGZA 5F2RA 1OKJA 4JKAA 5DK5A 4BDZA 5AR0A 3CQXA 4A62A 2IVOA 2A5XA 3ZEUB 2A40A 5AZJA 1KAZA 2YHBA 3FFKB 4KI4A 3QICA 1QSLA 4MQ3A 2HHHK 4CJQA 3QNOA 5LL6Z 3ZT3A 4CJ3A 1UA1A 4EZ6A 1C0MA 1SAZA 1JKHA 2HBKA 3CM6A 3DLLL 4YORA 3T1HK 5EX5A 2Y1IA 4M3TA 3NGIA 4EP5A 1VQ8N 4JYAK 4JKGB 4LF4K 1VQ5N 2HHXA 3PX0A 5CZ2A 1H1VA 3ISNC 4GY2B 4NLCA 4NLBA 4B1UB 3M8SA 3VQDA 5HOOA 1NG9A 2QW9A 4O0IA 3P1GA 4FJNA 5CY4A 5TKYA 1D5AA 3A5OC 1LW0A 4B9QA 3L2RA 2EX3A 1WB9A 1LAWA 4AILC 3KLFA 5KTQA 4RW4A 4BRIA 4DSEA 3O9SA 1EQYA 3SLCA 3C6TA 2WOMA 1NGIA 2FF3B 3CJCA 4JK8A 4OX9K 3LM2A 4FJMA 3K58A 4F2RA 1TKXA 3MX2A 1QZ5A 5FPMA 1QVGM 1SKWA 4GKKK 2JGUA 5C12A 1KCFA 1Q18A 4JRQA 3UIQA 3KVGA 3H1QA 1YF5L 3OYNA 4JK7A 4O55A 2G8WA 4IBNA 4BECA 1RNHA 1NK6A 2NRZA 4NCGA 5I42A 1HNVA 4FZXC 2W6LA 3G4SN 2E6MA 3AO1A 3EN9A 1EO1A 4CF8A 2XHBA 4C8KA 2BE2A 3CJ1A 3THWA 4K8ZA 3AVMA 4CIFA 1NMDA 4CFAA 4Y1DA 4JV5K 1YJ9N 4JN4A 5DM6L 3D7EO 1XI1A 4BQZA 3CI5A 1GLBG 5AQYA 3QINA 3UKUB 2KW4A 3SBTA 1NOZA 4EFHA 1XC9A 5HL7L 1NOYA 3SK3A 4XJXA 3B6OA 1RBRA 3HZ6A 2BTFA 4O44A 4B9TA 4IDKA 5HRRA 2OTJN 4BG8A 4KHWA 4Q0BA 4BRDA 5KPRA 3VQAA 1BUPA 4B9LA 1MWKA 1VQ6N 4CZEA 3WXMB 1VQON 5BREA 4DWIA 4IOXA 2QM1A 3LDNA 1T03A 4BRAA 3QO9A 4W5OA 5BRFA 3V6DA 4HTUA 5LMUK 3L6QA 1JLBA 4JI7K 1ITGA 1KAYA 1N36K 2JWKA 4FJ5A 3EZWA 1YXQA 2ASMA 4KREA 2HSTA 3J8AA 1VSFA 4FJ9A 4OPJA 2X6NA 2ASPA 2P9KB 3CCSN 5AZIA 3K5MA 3JAMO 1TKDA 2A3ZA 4YOYA 4JS5A 1VSJA 1ZBUA 4CJ7A 2ATQA 4YFUA 4WFBL 3SV4A 4CF2A 3FLCO 3MN9A 4BR9A 2HHQA 4B9UA 5KRSA 1WSFA 4LD0A 4IFVA 1RBUA 1RDCA 5B8HA 2QWPA 5AQIA 4CEEA 4FJIA 4FK0A 4CIGA 4PUOA 4BACA 3V4IA 1HNWK 1NGDA 4FW1A 1ZBIA 1ZC6A 2RN2A 3LP3A 1X9WA 1GLEG 4LF7K 3CCLN 3OYCA 4IFEA 4FWMA 2GV9A 2HNDA 4PHTX 2YKNA 4DR7K 3VQ6A 1KTQA 1BGXT 3S3NA 4FSVA 3MCAB 3DRRA 1YJWN 3ZT2A 1RT5A 1IKYA 2KKZA 1ZBFA 3E1YA 4CZFA 3HP6A 3MECA 1C0TA 5GIPA 5LJWA 2AP1A 1ZYQA 3QIPA 4F3OA 3CMAN 1NM1A 4O5FA 5KGWA 1XWLA 3TSPA 2V51B 1T6CA 2NRXA 1KLNA 3H6EA 3WNHA 4OLAA 4CF9A 4H03B 2E20A 2NNWA 4M7XA 3MXIA 1BI4B 3TTDA 4CZGA 4OKKA 2DTUA 1NMNA 1KRPA 3MMVA 3OS0A 2I7PA 2EWSA 3C6UA 2W41A 3HK2A 5D3GA 4BREA 1QHTA 4HCBA 4I2QA 3VN5A 1BHLA 4DFKA 3C0BA 5BN8A 3TAPA 1DTTA 3OYFA 4JI8K 1RTDA 1RT7A 1VRUA 3VOVA 2HNZA 2QWMA 4FJLA 5J2PA 4A5AA 2YNGA 4FPBA 4C1NK 3RSEB 3FE1A 3D2FB 2Z1JA 3KK7A 3I55N 3WUHA 3AVFA 3RMBA 3JSMA 1KVBA 3ZSZA 3J7ZO 4FJHA 2Q97A 4YOVA 5BPLA 1TL1A 3KLEA 3HM9A 4DLGA 4H4MA 1WSEA 4KTZA 4CJVA 4CGFA 4IKFA 2XY7A 4DV5K 4KBOA 1IKWA 4LC9B 2RE2A 1N34K 2UUCK 3O6WA 1YTAA 1HKGA 2VQFK 1XC3A 1T05A 3O1BA 3KLHA 2ASOA 1NWKA 3R8EA 4CEZA 4YOXA 3MEEA 3HYFA 4CZIA 5KRTA 3C94A 1KD1O 4B9SA 4N56A 4XH1A 2KZMA 2KTQA 4IOAL 1E3MA 4JKBA 4FLXA 4BR2A 1CZ9A 3C6AA 3CERA 1S72N 3U8XA 4E3SA 3JXUA 2E6LA 4CECA 3O3FA 2GWJA 3I33A 5JENA 2OPPA 4FJ7A 2I5JA 3OS2A 1HNZK 4NYFA 4LH5A 1J54A 4LFCK 4FWNA 2OA8A 1Z6RA 4FJKA 4PY5A 1NK5A 4DV2K 3N4PA 3O9RA 1QQNA 2O8CB 3TSQA 4DF4A 3CFOA 3AV9A 4KTWA 1WAJA 2H3GX 4QAGA 3M5RA 4B08A 3HO1A 4H8KA 4DF8A 1S6PA 2P9IB 3L2QA 4GW6A 3ZSWA 1JLAA 1GOCA 4BRFA 4JKGA 1BL3A 3HTVA 3C65A 4AQYK 4F8RA 1Q8IA 3ENBA 2PY5A 4GVMA 1BU6O 3CHWA 1L3TA 3OYIA 1KQSM 3J7AP 4H0XB 3LDLA 4MDBA 5AQGA 3P31A 2FBYA 2QI2A 2HHTA 3THYA 1U48A 4BGAA 3QEIA 3T3FA 2V7YA 1EKEA 4JKFA 3C7NA 1TUUA 4OGEA 1NJZA 3UE5A 1QTMA 5ELZA 3TAMA 3EY1A 4CHQA 1WOQA 2YJFA 1C1BA 2QKBA 4W5NA 4W5RA 4CJKA 1LWFA 1T44A 1SL0A 4AHCA 2WFBA 4L8RB 3PSFA 4WFNL 4PKHA 3OJUA 1RDWX 1B9DA 3CJ9A 1SL1A 2QK9A 4AHVA 3MWTA 1G99A 2HHUA 1K8KB 4IJAA 1SUQA 4K41A 5M1QA 5BR8K 3J81O 3H46O 4CEOA 4X62K 4B9VA 1RDBA 2PAVA 2Q31A 4FJJA 5AQHA 1VSKA 3KKSA 2OYQA 2FSNA 3MXJA 3HVRA 3SUOA 1RGIA 4BC5A 1JLQA 3FFIA 1KAXA 4DKWA 3NAEA 2UYTA 3BZKA 1QVFM 2X78A 1XNQK 3UKUA 2OZMA 3CCJN 1U47A 1S1VA 3D2EB 4FPAA 1HQUA 2G8IA 3HP9A 2VGMA 2O8FB 4E0DA 5C10A 1RDDA 1L3UA 4B3RK 3PLAA 1S1WA 3ZSVA 1N6QA 1C0UA 3UKRA 4CW7B 4EAHD 1A5WA 3Q7BA 4U7BA 3VEVA 1TYQB 3N4QA 2D4WA 3UB5A 3SAGA 4BC3A 4E7LA 4BRPA 3PV8A 1RTIA 4BE2A 1HYVA 4Z4IA 1ASVA 4A59A 1BQMA 4NB4A 1VQNN 3GL1A 2E8AA 4CEAA 3FGUA 3ASMA 2NRWA 1YTUA 1S22A 2OCEA 4FWKA 3QERA 1J5EK 3OYKA 4O0JA 2OANA 1NGAA 4HUFA 4BEBA 5F0XA 3OVNA 2RF2A 4DG1A 5FPEA 1QZ6A 4A2AA 4RWTA 3E9PA 1NK9A 3JS6A 1IH7A 4JI1K 1YHQN 1K9MO 1D9FA 4DFPA 1YIJN 3NVKA 2YHXA 2FSJA 4FWOA 4H5TA 3VESA 5E26A 3DLKA 4KPYA 2G8UA 1VSLA 2PYJA 3VGMA 4Y1CA 4CGGA 4JNEA 3TAGA 3LM9A 4ISGA 4IOCL 3DOKA 3QEVA 4ILGB 1NJXA 3CCVN 3TU5A 2G8HA 1ASUA 5A2QO 3HXMA 4DFMA 4WCEL 3HI0A 2HHVA 3L3VA 5KQ8A 4CK1A 4M45A 1GLDG 1E4FT 1KFDA 2P5GA 4CCHA 4DSFA 1VQ7N 1JLFA 2KZZA 3VQ4A 1IG8A 4DR4K 3CD6N 1TL3A 1YI2N 1BOTO 3BEXA 3KTQA 3KLGA 3ZT4A 4BR4A 1NK0A 4KHPK 4H0TB 3G71N 3RSEA 4ELTA 5DM7L 1IJJA 2YHWA 3D2FA 3FZHA 1LV5A 1ASWA 1BQNA 3VF6A 3THXA 1V4TA 2Z1HA 3O4WA 4BROA 1UOCA 3HJFA 4DSJA 4CGDA 2HF3A 4CVNE 3RR8A 4QOZB 3U9DA 4IG0A 1W97L 3CCMN 5HLFA 3ALYA 3LPUA 4K8XA 4JKHA 4J2BA 4FK4A 4DR2K 3CG7A 3H08A 4IFYA 4CJTA 4E19A 3BP8A 1KXPA 3KD1E 4NO7A 3RWUA 3CJ7A 4YHHK 3HT3A 4KI6A 4RW9A 2PFUA 1QQOA 1GOAA 3AGKA 3VEXA 4CD3A 3AVBA 3NDKA 4CJRA 5GAEP 3I8BA 4RTFD 1TVRA 3P4IA 1FK9A 3ID8A 2NRHA 4AM6A 4JD2A 2QXFA 4FZZA 1T7PA 1IO2A 2O8BB 3AVNA 3SZ2A 2F96A 4WQ4A 3NF8A 4YOUA 2NRTA 3B6PA 4EZ9A 2P9UA 4JI3K 2DPNA 2O8CA 1QQMA 4O4GA 4JI2K 4A5BA 4B1XB 4CK2A 1S1TA 3I0SA 3AO2A 4F2SA 4HUGA 4FVMA 4ISFA 4CFDA 1T6DA 1CXQA 2YKMA 2IIRA 3OA9A 4F3TA 3VA3A 1KLMA 5JMVA 1HKCA 3MN7A 4ID5A 4WQ4C 2GELA 4F9OA 2D0AA 5FDLA 3ZCMA 4CE9A 3M6GA 3VGKA 1B9FA 3P39A 4FM0A 2XO7A 3CC4N 4KTQA 5MLCQ 4DTRA 2BANA 2GTDA 4GVEA 1NNEA 4Z4HA 4Z4CA 3ZSXA 3K9JA 4BC2A 4CEFA 2ZM6K 3ID6A 1U6ZA 3DXMB 3I0RA 2A6AA 1JL1A 5M1PA 2Q0RA 4OGCA 3K2PA 3A2FA 2C1IA 1NJYA 3THVA 3HOTA 4DQRA 1NK7A 4DSIA 1WSGA 5CHIA 1TAQA 1WLJA 2I7NA 1IG9A 2NLXA 3R9PA 3KWGA 2E1YA 3CM5A 1DEJA 1IKVA 2X6SA 3L0QA 4CZJA 3TI0A 5C42A 1WBBA 4KB0A 4M3WA 4KH4A 3MX5A 4M7YA 4GV6A 2HMPA 5AQXA 2UXCK 3AVAA 4E7HA 2FLOA 1MWMA 5GINA 3SJJA 3QIOA 4E72A 2PBDA 1WN7A 1QS4A 2FC0A 4E7IA 3HL8A 5E41A 3R6MA 1L5UA 4N76A 3BZCA 1HR0K 3JYTA 3DXKB 1JJ2M 3VQ8A 3LAMA 4N5SA 3NGZA 4ELVA 1VHXA 3D2EA 1XHZA 1REVA 3MWPA 4ICLA 3QBXA 3G0ZA 2O8FA 2VWKA 3KD5E 1S1XA 2YHYA 2CH6A 2GX9A 4C8MA 1JCGA 3ITHA 3ZX3A 3AVCA 4OJRA 4XEIA 4BRLA 4CEQA 4EIAA 2IVPA 1TK0A 4DU3A 4M3YA 3IUCA 4FL9A 4WYBA 3HBTA 3L8BA 2XRIA 3LDOA 1XHXA 4E1JA 2B4JA 1HX1A 1BIZA 2EHGA 3TARA 2OTLN 4I7FA 1Z25A 3MDQA 2GEMA 2D0CA 5M1FA 4C8NA 2ZJQL 1J53A 3QMLA 2ETJA 1RT6A 3NH1A 1L3VA 2HNYA 4O8KA 4DS4A 3SI6A 3MAQA 4CERA 3VERA 1WAFA 2QWOA 3VQCA 3AA4A 1GLLO 5HBMA 3AA5X 1Z05A 4LF6K 4CJEA 4FM1A 2IOCA 1WBDA 2HBJA 2CGKA 2VQEK 4LF8K 5CE3A 3G25A 3HOSA 1TV6A 4BWJA 3SQ1A 3EKUA 3KZBA 4FW2A 2HVIA 1RILA 3ZSYA 4CESA 3WQTA 4DQQA 1C0GA 2P9SB 3MN5A 5AQLA 1NK8A 3SMSA 3IKMA 4RW7A 5AQVA 4WF9L 4IWVA 1OH6A 5BPMA 5C15A 1NKBA 5J2MA 2BDPA 1P90A 4NXMK 3O80A 4MFBA 1GLFO 4CJ5A 1M90O 4BRKA 4I2PA 1HRHA 4JHDB 4H5WA 4H5VA 4PKGA 4QS8A 2QXLA 2P9NA 4H5RA 5AJ3K 1UAXA 1SKRA 4AHUA 4BE1A 4CFBA 1R59O 3NE6A 1NGEA 3AAQA 3VMFB 2P51A 1S1UA 1Q9YA 3SUPA 4ZHRA 3SCXA 2ZF5O 3EE9A 4OKJA 4X64K 5TKWA 4KAZA 1WSHA 5AQQA 2D0PA 4HWIA 4BGBA 5JVGL 4BRCA 4DS5A 3U3YA 1Q82O 1O13A 2ZGYA 3WEEB 5KPZA 3LP1A 3NF9A 2E1ZA 4KRFA 4CEBA 4K0KK 1D4XA 3FZLA 4B3MK 3KHYA 3IS9A 1HQEA 5AFUA 3IAYA 2ZJRL 3AO5A 4HUEA 3L2VA 4CZMA 1K8AO 2HVHA 2GUIA 3U9ZA 1C6VA 4CJPA 2YV0X 1SS6A 3TPQA 2VG5A 2F9TA 3QEWA 2ZWHA 4A61A 4CGJA 3NH0A 3LZIA 1LCUA 2QWLA 3DYAA 1VSMA 3KK3A 3CQYA 3W0LA 3MK6A 3OHRA 1I94K 4DTJA 3VQ9A 3ZEUA 4NCBA 5AFUH 1MU2A 3CCEN 1V4SA 3PO4A 3M3ZA 3K57A 2D0OA 4FWRA 3SPZA 5JLFA 4WFAL 5KQDA 5GAGP 1XMOK 4DR5K 4J2AA 4EP4A 2W42A 4PL7A 4CJLA 3OYDA 3V81A 4NXNK 2FBXA 4N47A 3FZMA 3S9HA 3NCIA 3FR0A 3DM2A 1MDUB 2ZD1A 3SPYA 1W0HA 3A5MC 3LDPA 2Q2RA 2ITMA 4DQIA 4GNIA 2QWNA 4WQ5A 1QQCA 1TK8A 4IXCA 4BC4A 1Q86O 3ZSOA 4FJXA 2UXBK 3BF3A 4CIEA 2WUSA 2VWJA 1WUAA 2P9PB 3SAHA 3OYHA 4DTMA 1J6ZA 3V9XA 1QSSA 4BRQA 4CJWA 4BY9C 4H0OA 1VQ4N 3J80O 3OYJA 1S9GA 4N41A 3SQ2A 1RBTA 2VG7A 1XMQK 3D6RA 4NCAA 3VTHA 4E1MA 4WQ5C 1ILYA 2O8DB 3PX4A 3LDSA 4B1VA 3L4IA 3ZSRA 1ZXOA 3KK1A 3KK2A 3VQPA 1YITN 4A2BA 1HLUA 3FZKA 5HRPA 3THWB 5LJVA 4DU1A 2J4RA 1E4GT 3QBWA 2DFEA 5AQMA 1BDGA 1NGBA 3VPZA 3LZJA 4FLWA 5JS1A 1WSJA 4B3OA 3K5NA 1VSHA 4FLUA 2YHAA 4JK9A 2UXDK 4CHZA 5AQNA 3HSTB 5EOYA 5ADXA 4F4KA 5EU7A 3QEXA 5AQTA 3CCRN 4LF9K 3U3GA 2B6AA 1VRTA 2KHOA 3ATVA 2UUBK 4IO9L 4I9LA 3O4NA 1TUYA 4BR5A 4KV8A 4CF0A 4JAXA 3LAKA 3NFAA 5DMRA 4JI5K 4KFBA 5FROA 3O8MA 1K6YA 3CJAA 2Q0UA 1SZ2A 1HPMA 1ATRA 4BR7A 3KKRA 3SQ4A 1KC8O 2GBZA 2P9KA 4K25A 3DXKA 2NZTA 3AVIA 3WXLA 5ADXH 1IV0A 1JLGA 3TR8A 5I9EB 4RW8A 3H45C 2VG6A 4FLYA 3CF5L 1HJOA 4AHSA 4UY8O 2HBMA 2O4GA 4DCHA 4LY7A 2KQ2A 2C1GA 3DLRA 4PQUA 4ILHA 1JLCA 4A57A 1J5OA 4FJ8A 3QETA 3OBYA 1RCHA 2WC9A 4AM7A 5GAHP 5T7BA 3SJHA 1VAZA 2FBTA 3O9QA 3PIPL 4UQGA 5BRDA 3G6EN 4FLZA 2E2NA 1Q81O 3NF6A 4CHYA 1ZBLA 4B9MA 4Z4FA 1YVNA 4B3TK 1MA9B 5SZTA 2R7YA 4B8CA 3PX6A 1YJNN 3GG4A 3PY8A 4DR1K 4GMJB 5M1OA 3ZSQA 4PA1A 4RG8A 4B1WB 3F2KA 2HHSA 3AA3A 1BI4A 4M42A 4EHTA 2YX6A 4X66K 4ID1A 1TKZA 4ZTFA 1Y64A 1HUXA 1NU0A 5GADP 3V1OA 3LANA 1HMVA 2Q3SA 4DV7K 2P9SA 3SUNA 1U45A 3AO3A 4HTLA 1U49A 5FRNA 3GDQA 1SQKA 5FLXO 4DUZK 3PSIA 1M1KO 4JHDA 1KFSA 4QS7A 1NGGA 1OVQA 1RBSA 2A41A 2HOEA 4JKCA 5H1SQ 1WNSA 4FLTA 2F8TA 3VETA 4I6MB 3LPTA 4YDUA 1S5JA 3H3OB 3ATUA 4JKDA 3HVTA 3QESA 4CJSA 2E2QA 3AVHA 3LP2A 1B92A 1OH8A 2E88A 3S3OA 3QDKA 2CH5A 2DFHA 3EE8A 3ULEB 3A5NC 2GUPA 3K5OA 5HROA 1EX4A 4ELUA 1DT9A 4LFBK 3VQBA 1CLQA 1SV5A 2E2OA 2P9LB 5AQFA 4YDUC 3ZYYX 4DLEA 4KHYA 3HRGA 3DLBA 4CZKA 2O4IA 3D0PA 2JWLA 3QLHA 2A1RA 1SKSA 2G8VA 4LSNA 4CEDA 4B1YB 4B3SK 4IG3A 3VF2A 3WXIA 3F73A 3EEQA 4MO5A 3VTIA 4LSLA 4YNQA 4NYNA 1HJRA 1GLJO 4OKEA 1U04A 4IEIA 3AAPA 5C2DA 1JLEA 4BE0A 2QKKA 1OVYA 2QEXN 5KI6A 1X3NA 3O3GA 3LP0A 5FRMA 4IO8A 5E84A 3QB0A 3WNGA 4CF1A 1IBMK 4E89A 3CC2N 2HW3A 3OYGA 4BQLA 1TGOA 4J8FA 2WBNA 1RTJA 2IC3A 5HRNA 2F7TA 3VA0A 2E5LK 4M3ZA 3L2UA 1UWBA 5AQUA 4W5TA 2O8EB 1QE1A 3F5TA 4DU4A 2W40A 1RT3A 3S41A 3S5TA 4CK3A 4DTOA 1F21A 4IDHA 3NF7A 2RKIA 1IKXA 2P9IA 3DI6A 4DV0K 1YVUA 4Z4GA 3O08A 4L3QA 4JI0K 2F8SA 4KB1A 1KVAA 3THYB 2ZE2A 1ZBSA 1HYZA 4FWLA 4H5NA 3F9KA 3C7NB 4CJFA 5CYMA 3QFPA 2OPQA 4K42A 3IFRA 1Q7YO 1RDUA 3D45A 3T19A 3QFUA 2P9PA 1N33K 5AQWA 3DRPA 4KHQA 5CZ1A 3TTFA 2AA4A 4IZ9A 4DTSA 1NGJA 3NH2A 3RMCA 2XY8A 5KPTA 2UUAK 3AVJA 3I56N 1JCEA 3V9WA 3E9OA 4YOWA 2YNHA 3PO5A 2VCPA 4DV4K 5AQOA 2IS3A 3RTVA 5LY3A 2O8DA 4BDYA 3LWMA 3OY9A 3O9TA 1Z26A 3WXJA 1K8KA 4BRMA 4ILJA 3ZLJA 4JI4K 2Y1JA 2YNIA 1JCFA 3E9LA 2YNFA 3RRGA 4DSLA 2V52B 4U67L 2B5JA 2FXUA 3CMEN 3OTOK 4DV3K 4BVOA 4MDAA 1D9DA 3VQ5A 1W9HA 1S6QA 4DR6K 1X1PA 5K14A 4QCLA 4MLHA 2V7ZA 2QTDA 2OPRA 2F4VK 3OJSA 1DGKN 4ZTJA 4FVUA 3TSUA 3LWLA 3ZX0A 3UKRB 3FZFA 2BUPA 3AY9A 4CJUA 3J7YP 3HPGA 1VSIA 2BGGA 4Z0UA 4PWDA 3TTCA 1N32K 4DMNA 2HHIA 3OYLA 2VWBA 4C23A 5J2NA 1TYQA 3CFPA 2YCHA 5JVHL 1NKCA 3RRHA 3C6HA 2HHWA 2KFZA 1EETA 3P5JA 1LOTB 4OPHA 1JL2A 4OPKA 2UU9K 5EXWA 4O8UA 1T8EA 2PZSA 3O3HA 3NHGA 3TAEA 1WSIA 4FXDA 2PYLA 4B8AB 1VSEA 3KIOA 3DOLA 4LF5K 1NBWA 3OYMA 3ULDA 4M63C 4DB3A 3VEWA 3GBTA 3NBPA 1HYSA 3NGYA 3IRXA 3U6FA 1G15A 5KGXA 4J2DA 4MLEA 5HP1A 1QSYA 1A5XA 3EKSA 2XY6A 3KLIA 3MCPA 1U2VB 3C95A 3VQEA 4CZHA 3SMPA 3O1WA 1FXXA 4JLHA 4FCYA 1GOBA 1D8YA 1XNRK 3IDHA 5AQZA 2Q1NA 4KH6A 3T7ZA 4RCHA 4FK2A 4HHTA 1ATNA 1LWEA 4LH4A 4QS9A 4JRPA 4V19S 3R3LA 1GLCG 2A1SA 3SBGA 4JEPA 2P1JA 3CCQN 2NRRA 4XH5A 1FJGK 1HPZA 2D5RA 4BRHA 4CBWA 4CHPA 1HKBA 5AQPA 3PUFA 3P83D 4ISEA 3AGRA 3VENA 4AF1A 4TSXA 3HPHA 4WE1A 4OO1J 4HVJA 2YI1A 3TABA 3MXMA 1ZBHA 3RR7A 4EHUA 3WNEA 4JKEA 1TK5A 4FOEA 1X9JA 1UA0A 1U4BA 1RTHA 2NRVA 4CZLA 3M8RA 3THXB 3HPOA 2HF4A 4OPAA 3CXCM 1IBLK 5CYQA 3DLHA 4FJGA 1L3SA 4KO0A 4FWQA 3AVKA 1ESVA 2OPSA 4OLBA 3V9ZA 4FLVA 4I6MA 4CHOA 4HCCA 4XH4A 4BVPA 5BN9A 3CIPA 3VEOA 4LFAK 2KFNA 2D1KA 3DWLA 5CR4A 5AQJA 3VEYA 4BE7B 1W2BM 3VGLA 3WNFA 2HMIA 2CGLA 4BDPA 2G8FA 3L2WA 3ULEA 3ZETB 2WONA 4AH9A 4RW6A 3TANA 3GOIA 3CJBA 4DV6K 2DFFA 1EWRA 3O9UA 4BG9A 4DQPA 2P9LA 2QWRA 2E4LA 2WTUA 2CGJA 1BWFO 2Z1GA 4DQ8A 3ZX2A 3F9MA 3B8AX 5AZJB 3K59A 3L4QA 3OW2M 3OS1A 4H0YB 3KJVA 1EXQA 3T1YK 4J2EA 4CFCA 3OYBA 2YJEA 2ZJPL 3AVGA 3NVMA 5J1EA 4GKJK 4CJ4A 3AA2A 1VQMN 2XY5A 1OH7A 4BRGA 1IBKK 4M3RA 4JD2B 4W5QA 5SWMA 3AARA 1X3MA 4XIUA 3EO3A 4C8LA 3QEPA 3ENOA 1KVCA 5J2QA 4FYDA 3RMDA 2P9UB 4CI6A 3AVLA 4DHYA 3OBWA 3TWHA 5LMNK 3DLEA 3LL3A 2O8BA 1YUWA 5C25A 4AHRA 5C2FA 3SQ0A 1OH5A 4R79A 4KKOA 2O8EA 5F1XA 3ZT1A 2X74A 5M1KA 2JLEA 5EVZA 1QHAA 1NK4A 2G8KA 3LDQA 3CYMA 4IJNA 2KLAA 5GIOA 3SV3A 2Z1IA 3RMAA 4M41A 4E1NA 1SL2A 2A42A 2HBLA 1XUPO 3PIOL 4DUYK 3Q7CA 1RT1A 3CPEA 3CC7N 3TAQA 2RPIA 4FWSA 2FSKA 2IVNA 4DFJA 1HNXK 5AQKA 1RFQA 2LSNA 1Y97A 1RT4A 2W00A 4B1ZA 4DTXA 5IT9O 1VQKN 1VSDA 4O5BA 4CGHA 5I3UA 3W3DA 3IG1A 4I9QA 3U4LA 3GE1A 1X9SA 4OVLA 3DXMA 4BRNA 2QA4N 3OYEA 2VGNA 4KHUA 3A8YA 3KWIA 3WXKA 4CGIA 1BG3A 1YAGA 2HB5A 1N5YA 5BRHA 1YT3A 1NLVA 1XQSC 4YOTA 3E01A 3MEGA 5JLHA 3OYAA 4Q5VA 3R1XA 1NJWA 3A5LC 1R0AA 1VQLN 3NMUA 3CFRA 2GWKA 5AQRA 1NGFA 1FKPA 4M3XA 4PKIA 3MN6A 4KHSA 4AHTA 5AZIB 1NKEA 3EYZA 3M1FA 3M8PA 3V1RA 2NUBA 4E7KA 1BIUA 3DMJA 4C1NI 1CXUA 1FW6A 3EL2A 1DKGD 3K0SA 1TAUA 1LWCA 3L3UA 4DSKA 1EWQA 4FWPA 5AQSA 4Z4EA 1HNIA 1C1CA 1S9EA 1J9AA 3VEZA 2W6KA 3MEDA 1RBVA 4CHNA 1X9MA 2IAJA 1KSPA 3H1VX 4FO0A 3BF1A 3WT0A 3ENHA 4DR3K 3V9SA 1K73O 1BCOA 1RT2A 1RDAA 4FOIA 1DTQA 4KH5A 4BR0A 1N8RO 3VQ7A 3ZT0A 4KHNA 4B9NA 2RHKA 1CZAN 2E2PA 4GV3A 5JICA 3E66A 4PL8A 1BA0A 4Y0WA 3SYZA 4DQSA 1O1WA 3DJCA 3RVCA 2DY4A 3AO4A 1BISA 3G10A 1W7AA 5BR9A 4H4OA 3T1AA
chains in the Genus database with same CATH topology
3CHWA 1C0FA 3O08A 4L3QA 2BH1A 1KQSM 5C0YA 3EKUA 3KZBA 3LDLA 4H0XB 4MDBA 3VF4A 3WQUA 1ZBSA 4FWLA 3CCUN 5AQGA 3CPWM 3P31A 4CBUA 3WQTA 4H5NA 3C7NB 3SAFA 2QI2A 1C0GA 1U2VA 3QFPA 4BGAA 3H3NO 2P9SB 4H0VB 4K42A 2V7YA 3MN5A 5AQLA 4JKFA 3C7NA 1TUUA 3IFRA 3SMSA 1BO5O 3IKMA 1Q7YO 5AQVA 3UE5A 1RDUA 4WF9L 5FPNA 4IWVA 3QFUA 2P9PA 5ELZA 4K43A 5BPMA 5BPNA 5AQWA 5C15A 4IEEA 1P90A 2AA4A 3O80A 4IZ9A 3TTFA 1GLFO 1WOQA 2YJFA 2P9NB 1NGJA 1M90O 4BRKA 3T69A 4JHDB 4H5WA 5KPTA 4CBXA 4H5VA 4PKGA 1T44A 3I56N 1JCEA 2QXLA 2P9NA 4H5RA 2WFBA 4QS8A 3E9OA 1R59O 4H0PA 3A0IX 4WFNL 4PKHA 3IMXA 4YOWA 1NGEA 3AAQA 3VMFB 1RDWX 2VCPA 5AQOA 3CJ9A 5LY3A 2Q36A 3K9KA 3MWTA 1G99A 1K8KB 1ATSA 4IJAA 3O9TA 3DAWA 4K41A 5M1QA 2ZF5O 3WXJA 3EE9A 3H46O 1K8KA 3BUZB 5TKWA 4BRMA 4ILJA 2VYPA 4Z94A 1JCFA 3O5BA 5AQQA 3E9LA 2PAVA 2D0PA 2Q31A 4HWIA 4BGBA 5JVGL 5AQHA 4BRCA 2V52B 4U67L 2F9WA 1Q82O 1O13A 2FSNA 1S3XA 1NJIO 2ZGYA 2FXUA 3WEEB 3HM8A 3CMEN 5KPZA 1GLAG 4BVOA 1RGIA 4MDAA 4BC5A 1VQ9N 1KAXA 4DKWA 2FF6A 3WEEA 4G9ZA 2E1ZA 3P38A 2UYTA 1D4XA 3FZLA 1QVFM 3KHYA 3UKUA 3CCJN 4MLHA 5EY4A 2V7ZA 4GV9A 3D2EB 4CD1A 2QTDA 4FPAA 3CETA 1DGKN 1BA1A 3HSCA 2VGMA 3TSUA 5AFUA 4FVUA 3ZX0A 5C10A 4MO4A 2ZJRL 3UKRB 1NGCA 5M1NA 3PLAA 3FZFA 2BUPA 3AY9A 1T3VA 4CZMA 1K8AO 3UKRA 3TTCA 2QWQA 3Q7BA 4EAHD 4U7BA 3VEVA 2VWBA 1TYQB 3N4QA 2D4WA 3U9ZA 3UB5A 4C23A 3ZETA 3SAGA 4BC3A 1NGHA 1SS6A 5FPDA 1VQPN 1TYQA 2YCHA 3TPQA 4BRPA 5JVHL 1P8ZA 2ZGZA 2F9TA 5F2RA 3ZEUB 1OKJA 3C6HA 4JKAA 2ZWHA 4A61A 1LCUA 2QWLA 4A59A 4NB4A 1VQNN 5AR0A 3GL1A 3CQXA 2E8AA 4A62A 1LOTB 2IVOA 2A5XA 3FGUA 4OPHA 3CQYA 2A40A 3W0LA 2NRWA 3MK6A 1KAZA 3OHRA 5AZJA 3FFKB 1S22A 5EXWA 3QICA 4O8UA 4FWKA 3ZEUA 2OANA 5AFUH 1NGAA 4BEBA 5F0XA 3CCEN 1SAZA 1V4SA 2HBKA 5FPEA 1QZ6A 3M3ZA 4A2AA 2D0OA 4FWRA 4RWTA 4YORA 5JLFA 3E9PA 5EX5A 3DLLL 3JS6A 4WFAL 1NBWA 1YHQN 5KQDA 5GAGP 1K9MO 1VQ8N 4JKGB 4M63C 4DB3A 4PL7A 1VQ5N 1YIJN 3VEWA 1H1VA 3GBTA 3FZMA 4GY2B 4NLCA 4NLBA 4B1UB 3NVKA 2YHXA 2FSJA 5HOOA 2QW9A 3FR0A 4FWOA 4H5TA 3VESA 5E26A 5TKYA 1MDUB 4MLEA 3A5MC 3LDPA 3A5OC 2Q2RA 2ITMA 4B9QA 3EKSA 3MCPA 2QWNA 4GNIA 3VGMA 1U2VB 4WQ5A 4CZHA 4JNEA 4IXCA 4BC4A 3LM9A 3SMPA 1Q86O 3O1WA 4BRIA 4ISGA 3O9SA 1EQYA 4IOCL 3SLCA 3IDHA 3BF3A 4ILGB 2WUSA 1NGIA 2Q1NA 4KH6A 1WUAA 2FF3B 2P9PB 3CJCA 4RCHA 5AQZA 3T7ZA 4JK8A 3TU5A 3SAHA 1J6ZA 4BRQA 3LM2A 1ATNA 4BY9C 4H0OA 4QS9A 1VQ4N 4WCEL 3R3LA 1GLCG 3SBGA 3MX2A 1QZ5A 5FPMA 1QVGM 4JEPA 3HI0A 5C12A 3CCQN 2NRRA 4XH5A 1Q18A 3KVGA 3D6RA 3H1QA 1YF5L 5KQ8A 4JK7A 4BRHA 4CBWA 3VTHA 4BECA 1HKBA 5AQPA 4WQ5C 1ILYA 4ISEA 3AGRA 1GLDG 1E4FT 3VENA 4AF1A 2NRZA 4B1VA 3L4IA 4OO1J 1VQ7N 2YI1A 1ZXOA 3CCVN 3G4SN 1YITN 4EHUA 4A2BA 4JKEA 3EN9A 1IG8A 1HLUA 3FZKA 3CD6N 1EO1A 4FOEA 1YI2N 1BOTO 3BEXA 5LJVA 2J4RA 1E4GT 3CJ1A 4BR4A 1X9JA 3QBWA 5AQMA 2NRVA 1BDGA 4H0TB 1NGBA 3RSEA 3G71N 1NMDA 3VPZA 4CZLA 5DM7L 1IJJA 2YHWA 2HF4A 3D2FA 4JN4A 1YJ9N 5DM6L 3D7EO 3FZHA 4OPAA 3CXCM 4BQZA 3CI5A 3VF6A 1GLBG 4JK9A 5AQYA 1V4TA 3O4WA 4FWQA 4BROA 3UKUB 4EFHA 3SBTA 1ESVA 5AQNA 5HL7L 4I6MA 3SK3A 4XJXA 2HF3A 5EOYA 5ADXA 3HZ6A 2BTFA 4XH4A 5BN9A 3U9DA 4BVPA 2OTJN 5AQTA 3CIPA 3VEOA 4BG8A 3CCRN 4BRDA 5KPRA 2KHOA 3ATVA 1BUPA 1VQ6N 1MWKA 2D1KA 4CZEA 1W97L 3WXMB 3DWLA 5CR4A 5AQJA 3VEYA 3CCMN 5BREA 4IO9L 1VQON 4IOXA 2QM1A 3VGLA 3LDNA 1W2BM 4BE7B 4BRAA 2CGLA 1TUYA 4BR5A 4JKHA 4JAXA 3ULEA 3ZETB 5BRFA 3GOIA 3CJBA 3L6QA 3O8MA 1KAYA 3O9UA 2JWKA 3EZWA 1YXQA 2ASMA 4BG9A 3CJAA 2Q0UA 1SZ2A 2HSTA 3BP8A 1HPMA 3J8AA 1ATRA 1KXPA 2P9LA 4BR7A 4NO7A 2ASPA 2P9KB 3CCSN 2QWRA 5AZIA 2CGJA 1BWFO 4DQ8A 1KC8O 3ZX2A 3F9MA 3B8AX 3CJ7A 5AZJB 2A3ZA 2P9KA 3L4QA 4K25A 4YOYA 3DXKA 3OW2M 2NZTA 4CJ7A 4H0YB 4WFBL 3WXLA 5ADXH 3FLCO 3MN9A 4BR9A 2PFUA 1QQOA 3AGKA 5I9EB 3VEXA 4CD3A 3H45C 3CF5L 2YJEA 1HJOA 2ZJPL 3NVMA 5GAEP 3I8BA 4RTFD 5B8HA 2QWPA 5AQIA 1VQMN 4UY8O 2HBMA 4DCHA 3P4IA 4BRGA 3ID8A 1NGDA 1ZC6A 4JD2B 2C1GA 1GLEG 3AARA 3CCLN 2NRHA 1X3MA 4FWMA 4IFEA 4ILHA 3EO3A 4A57A 4AM6A 4PHTX 4JD2A 3OBYA 2WC9A 3ENOA 4FSVA 3MCAB 4AM7A 5GAHP 2P9UB 4CI6A 1YJWN 3SJHA 1VAZA 4DHYA 3OBWA 3LL3A 4WQ4A 4YOUA 3O9QA 1YUWA 2KKZA 2NRTA 3E1YA 4CZFA 2P9UA 5C2FA 2DPNA 5BRDA 3PIPL 3G6EN 5GIPA 2E2NA 1Q81O 1QQMA 4R79A 2AP1A 5LJWA 5F1XA 1YVNA 4A5BA 1MA9B 1NM1A 4B1XB 3CMAN 4O5FA 5M1KA 3TSPA 2V51B 1YJNN 1T6CA 3GG4A 2NRXA 4ISFA 3H6EA 1T6DA 5EVZA 2IIRA 3OA9A 5M1OA 1QHAA 3LDQA 5JMVA 1HKCA 2E20A 2NNWA 3MN7A 2KLAA 4H03B 4IJNA 4M7XA 5GIOA 3TTDA 4CZGA 4B1WB 3F2KA 2A42A 2HBLA 1XUPO 3MMVA 3PIOL 4WQ4C 3Q7CA 2I7PA 4EHTA 2EWSA 2YX6A 2GELA 4F9OA 3CPEA 2W41A 3CC7N 1Y64A 4FWSA 4BREA 2FSKA 2IVNA 1HUXA 3M6GA 5GADP 3C0BA 3VGKA 3P39A 5BN8A 5AQKA 1RFQA 2P9SA 3CC4N 2W00A 4B1ZA 5MLCQ 3VOVA 2QWMA 2GTDA 4GVEA 1VQKN 4HTLA 4A5AA 3GDQA 4FPBA 3K9JA 4BC2A 4C1NK 3RSEB 3W3DA 1SQKA 3FE1A 1U6ZA 3DXMB 3ID6A 3U4LA 3GE1A 3D2FB 2A6AA 1M1KO 5M1PA 4JHDA 2Q0RA 3KK7A 3I55N 2C1IA 3DXMA 4QS7A 3WUHA 4BRNA 1NGGA 2A41A 4JKCA 2HOEA 2QA4N 5H1SQ 3HOTA 2VGNA 3VETA 3A8YA 3KWIA 4I6MB 4YDUA 3WXKA 5CHIA 3H3OB 3ATUA 2I7NA 1BG3A 1YAGA 4JKDA 5BRHA 3J7ZO 2Q97A 4YOVA 5BPLA 2NLXA 3R9PA 1NLVA 2E2QA 1XQSC 4YOTA 3KWGA 2E1YA 1DEJA 2E88A 3L0QA 4CZJA 3QDKA 5JLHA 2CH5A 4KH4A 3EE8A 3MX5A 4M7YA 3ULEB 4GV6A 3A5NC 2HMPA 3R1XA 2GUPA 5AQXA 4KBOA 3A5LC 1DT9A 4LC9B 1VQLN 2RE2A 3NMUA 3O6WA 2FLOA 1MWMA 5GINA 2GWKA 5AQRA 1NGFA 1HKGA 2PBDA 4PKIA 1XC3A 3MN6A 2E2OA 3O1BA 2P9LB 5AQFA 2ASOA 1NWKA 4YDUC 3R8EA 3ZYYX 5AZIB 3R6MA 3HRGA 4YOXA 4CZKA 4CZIA 3M1FA 1KD1O 3DXKB 1JJ2M 2JWLA 4C1NI 4B1YB 3EL2A 4XH1A 1DKGD 3D2EA 4IOAL 3VF2A 3WXIA 3MWPA 3QBXA 4JKBA 4BR2A 3C6AA 4MO5A 3CERA 3VTIA 1S72N 2YHYA 2CH6A 3U8XA 4FWPA 5AQSA 2GX9A 1JCGA 3JXUA 3ZX3A 1GLJO 4XEIA 4BRLA 3VEZA 2GWJA 4EIAA 4IEIA 3AAPA 5C2DA 2IVPA 2QEXN 1OVYA 3I33A 3IUCA 4FL9A 1X3NA 3H1VX 4WYBA 3HBTA 4IO8A 3LDOA 5E84A 4FO0A 3BF1A 3WT0A 3QB0A 4FWNA 3ENHA 3CC2N 4E1JA 1K73O 1Z6RA 1HX1A 4BQLA 4J8FA 2OTLN 2WBNA 4FOIA 3MDQA 3N4PA 3O9RA 2GEMA 1QQNA 2F7TA 4KH5A 3TSQA 5M1FA 2ZJQL 4BR0A 3QMLA 1N8RO 5AQUA 4O8KA 3F5TA 2H3GX 2W40A 3VERA 2RHKA 2QWOA 1GLLO 1CZAN 2E2PA 3S41A 4GV3A 1Z05A 5JICA 3E66A 3M5RA 4PL8A 1BA0A 4Y0WA 2P9IB 3DJCA 3RVCA 4IDHA 2HBJA 4BRFA 2CGKA 4JKGA 3HTVA 3C65A 2P9IA 5CE3A 3ENBA 3G25A 5BR9A 1BU6O 3HOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CHW A;  1C0F A;  3O08 A;  4L3Q A;  3EKU A;  3KZB A;  3LDL A;  4H0X B;  3VF4 A;  3WQU A;  1ZBS A;  4FWL A;  5AQG A;  4CBU A;  3WQT A;  4H5N A;  3C7N B;  1C0G A;  1U2V A;  3QFP A;  4BGA A;  3H3N O;  2P9S B;  4H0V B;  4K42 A;  2V7Y A;  3MN5 A;  5AQL A;  3C7N A;  1TUU A;  3IFR A;  3SMS A;  1BO5 O;  5AQV A;  3UE5 A;  5FPN A;  4IWV A;  3QFU A;  2P9P A;  5ELZ A;  4K43 A;  5BPM A;  5BPN A;  5AQW A;  2AA4 A;  3O80 A;  4IZ9 A;  1GLF O;  1WOQ A;  2YJF A;  2P9N B;  1NGJ A;  4BRK A;  4JHD B;  4H5W A;  5KPT A;  4CBX A;  4H5V A;  4PKG A;  1T44 A;  1JCE A;  2QXL A;  2P9N A;  4H5R A;  4QS8 A;  1R59 O;  4H0P A;  3A0I X;  4PKH A;  3IMX A;  1NGE A;  3AAQ A;  1RDW X;  2VCP A;  5AQO A;  3CJ9 A;  5LY3 A;  2Q36 A;  1G99 A;  1K8K B;  1ATS A;  4IJA A;  3DAW A;  4K41 A;  2ZF5 O;  3WXJ A;  3H46 O;  1K8K A;  3BUZ B;  4BRM A;  2VYP A;  4Z94 A;  1JCF A;  3O5B A;  5AQQ A;  2PAV A;  2D0P A;  2Q31 A;  4HWI A;  4BGB A;  5AQH A;  4BRC A;  2V52 B;  2F9W A;  2FSN A;  1S3X A;  2ZGY A;  2FXU A;  3WEE B;  3HM8 A;  5KPZ A;  1GLA G;  4BVO A;  1RGI A;  4BC5 A;  1KAX A;  2FF6 A;  3WEE A;  2E1Z A;  2UYT A;  1D4X A;  3FZL A;  3KHY A;  3UKU A;  4MLH A;  5EY4 A;  2V7Z A;  3D2E B;  4CD1 A;  4FPA A;  3CET A;  1DGK N;  1BA1 A;  3HSC A;  5AFU A;  3ZX0 A;  4MO4 A;  3UKR B;  1NGC A;  3FZF A;  2BUP A;  3AY9 A;  4CZM A;  3UKR A;  2QWQ A;  4EAH D;  3VEV A;  2VWB A;  1TYQ B;  2D4W A;  3U9Z A;  3UB5 A;  4C23 A;  3ZET A;  4BC3 A;  1NGH A;  5FPD A;  1TYQ A;  2YCH A;  3TPQ A;  4BRP A;  1P8Z A;  2ZGZ A;  2F9T A;  5F2R A;  1OKJ A;  2ZWH A;  4A61 A;  1LCU A;  2QWL A;  4NB4 A;  5AR0 A;  3GL1 A;  3CQX A;  2E8A A;  4A62 A;  1LOT B;  2IVO A;  2A5X A;  3FGU A;  3ZEU B;  3CQY A;  2A40 A;  3W0L A;  3MK6 A;  3OHR A;  1KAZ A;  5AZJ A;  3FFK B;  1S22 A;  5EXW A;  3QIC A;  4FWK A;  3ZEU A;  2OAN A;  5AFU H;  1NGA A;  5F0X A;  1SAZ A;  1V4S A;  5FPE A;  1QZ6 A;  3M3Z A;  4A2A A;  2D0O A;  4FWR A;  4RWT A;  5JLF A;  5EX5 A;  3JS6 A;  1NBW A;  5KQD A;  4M63 C;  4DB3 A;  4PL7 A;  3VEW A;  1H1V A;  3GBT A;  3FZM A;  4GY2 B;  4B1U B;  2YHX A;  2FSJ A;  2QW9 A;  3FR0 A;  4FWO A;  4H5T A;  3VES A;  5E26 A;  5TKY A;  1MDU B;  4MLE A;  3A5M C;  3LDP A;  3A5O C;  2Q2R A;  2ITM A;  4B9Q A;  3EKS A;  3MCP A;  2QWN A;  4GNI A;  3VGM A;  1U2V B;  4WQ5 A;  4CZH A;  4JNE A;  4IXC A;  4BC4 A;  3LM9 A;  3SMP A;  3O1W A;  4BRI A;  4ISG A;  1EQY A;  3SLC A;  3IDH A;  3BF3 A;  2WUS A;  1NGI A;  2Q1N A;  5AQZ A;  1WUA A;  2FF3 B;  2P9P B;  3CJC A;  4RCH A;  3TU5 A;  1J6Z A;  4BRQ A;  3LM2 A;  1ATN A;  4H0O A;  4QS9 A;  1GLC G;  1QZ5 A;  5FPM A;  3HI0 A;  4XH5 A;  1Q18 A;  3KVG A;  3H1Q A;  5KQ8 A;  4BRH A;  4CBW A;  1HKB A;  5AQP A;  4WQ5 C;  4ISE A;  1GLD G;  1E4F T;  3VEN A;  4B1V A;  3L4I A;  2YI1 A;  1ZXO A;  4EHU A;  4A2B A;  3EN9 A;  1IG8 A;  1HLU A;  3FZK A;  4FOE A;  1BOT O;  3BEX A;  5LJV A;  2J4R A;  1E4G T;  3CJ1 A;  4BR4 A;  1X9J A;  3QBW A;  5AQM A;  4H0T B;  1BDG A;  1NGB A;  3RSE A;  1NMD A;  3VPZ A;  4CZL A;  1IJJ A;  2YHW A;  2HF4 A;  3D2F A;  4JN4 A;  3D7E O;  3FZH A;  4BQZ A;  3CI5 A;  3VF6 A;  1GLB G;  5AQY A;  1V4T A;  3O4W A;  4FWQ A;  4BRO A;  3UKU B;  4EFH A;  1ESV A;  5AQN A;  4I6M A;  3SK3 A;  2HF3 A;  5EOY A;  5ADX A;  3HZ6 A;  2BTF A;  4XH4 A;  5BN9 A;  3U9D A;  4BVP A;  5AQT A;  3CIP A;  3VEO A;  4BG8 A;  4BRD A;  5KPR A;  2KHO A;  3ATV A;  1BUP A;  1MWK A;  2D1K A;  4CZE A;  3DWL A;  3VEY A;  5AQJ A;  5BRE A;  2QM1 A;  3VGL A;  3LDN A;  4BRA A;  2CGL A;  1TUY A;  4BR5 A;  4JAX A;  3ULE A;  3ZET B;  5BRF A;  3GOI A;  3CJB A;  3L6Q A;  3O8M A;  1KAY A;  3EZW A;  1YXQ A;  2ASM A;  4BG9 A;  3CJA A;  2Q0U A;  1SZ2 A;  3J8A A;  3BP8 A;  1HPM A;  1ATR A;  1KXP A;  2P9L A;  4BR7 A;  4NO7 A;  2ASP A;  2P9K B;  2QWR A;  5AZI A;  2CGJ A;  1BWF O;  4DQ8 A;  3ZX2 A;  3F9M A;  3B8A X;  3CJ7 A;  5AZJ B;  2A3Z A;  2P9K A;  4K25 A;  3DXK A;  2NZT A;  4CJ7 A;  4H0Y B;  3WXL A;  5ADX H;  3FLC O;  3MN9 A;  4BR9 A;  1QQO A;  5I9E B;  3VEX A;  4CD3 A;  3H45 C;  2YJE A;  1HJO A;  3I8B A;  4RTF D;  5B8H A;  2QWP A;  5AQI A;  4DCH A;  3P4I A;  4BRG A;  3ID8 A;  1NGD A;  1ZC6 A;  4JD2 B;  1GLE G;  3AAR A;  2NRH A;  1X3M A;  4FWM A;  3EO3 A;  4AM6 A;  4JD2 A;  3ENO A;  4FSV A;  4AM7 A;  2P9U B;  4CI6 A;  3SJH A;  4DHY A;  3LL3 A;  4WQ4 A;  1YUW A;  4CZF A;  2P9U A;  2DPN A;  5BRD A;  2E2N A;  1QQM A;  5LJW A;  2AP1 A;  5F1X A;  1YVN A;  1MA9 B;  1NM1 A;  4B1X B;  4O5F A;  2V51 B;  1T6C A;  3GG4 A;  4ISF A;  3H6E A;  1T6D A;  5EVZ A;  2IIR A;  1QHA A;  3LDQ A;  5JMV A;  1HKC A;  2E20 A;  3MN7 A;  4H03 B;  4IJN A;  4M7X A;  4CZG A;  4B1W B;  2A42 A;  1XUP O;  3MMV A;  4WQ4 C;  2I7P A;  4EHT A;  2EWS A;  2GEL A;  4F9O A;  2W41 A;  1Y64 A;  4FWS A;  4BRE A;  2FSK A;  2IVN A;  1HUX A;  3M6G A;  3C0B A;  3VGK A;  5BN8 A;  5AQK A;  1RFQ A;  2P9S A;  4B1Z A;  3VOV A;  2QWM A;  2GTD A;  4HTL A;  3GDQ A;  4FPB A;  4BC2 A;  3RSE B;  3W3D A;  1SQK A;  3FE1 A;  1U6Z A;  3DXM B;  3U4L A;  3GE1 A;  3D2F B;  2A6A A;  4JHD A;  2Q0R A;  3DXM A;  4QS7 A;  3WUH A;  4BRN A;  1NGG A;  2A41 A;  2HOE A;  3VET A;  3A8Y A;  4I6M B;  4YDU A;  3WXK A;  3H3O B;  3ATU A;  2I7N A;  1BG3 A;  1YAG A;  5BRH A;  2Q97 A;  5BPL A;  2NLX A;  3R9P A;  1NLV A;  2E2Q A;  1XQS C;  2E1Y A;  1DEJ A;  2E88 A;  3L0Q A;  4CZJ A;  3QDK A;  5JLH A;  2CH5 A;  3ULE B;  4M7Y A;  3A5N C;  2HMP A;  5AQX A;  2GUP A;  4KBO A;  3A5L C;  4LC9 B;  3O6W A;  2FLO A;  1MWM A;  2GWK A;  5AQR A;  1NGF A;  1HKG A;  2PBD A;  4PKI A;  1XC3 A;  3MN6 A;  2E2O A;  3O1B A;  2P9L B;  5AQF A;  2ASO A;  1NWK A;  4YDU C;  3R8E A;  5AZI B;  3R6M A;  4CZK A;  4CZI A;  3M1F A;  3DXK B;  4B1Y B;  3EL2 A;  4XH1 A;  1DKG D;  3D2E A;  3VF2 A;  3WXI A;  3QBX A;  4BR2 A;  4MO5 A;  3CER A;  2YHY A;  2CH6 A;  3U8X A;  4FWP A;  5AQS A;  1JCG A;  3JXU A;  3ZX3 A;  1GLJ O;  4XEI A;  4BRL A;  3VEZ A;  2GWJ A;  4EIA A;  3AAP A;  2IVP A;  3I33 A;  3IUC A;  4FL9 A;  1X3N A;  3H1V X;  4WYB A;  3HBT A;  4IO8 A;  3LDO A;  5E84 A;  4FO0 A;  3BF1 A;  3WT0 A;  3QB0 A;  4FWN A;  3ENH A;  4E1J A;  1Z6R A;  1HX1 A;  4BQL A;  4J8F A;  4FOI A;  3MDQ A;  2GEM A;  1QQN A;  4BR0 A;  3QML A;  5AQU A;  4O8K A;  2H3G X;  2W40 A;  3VER A;  2QWO A;  1GLL O;  1CZA N;  2E2P A;  3S41 A;  1Z05 A;  5JIC A;  4PL8 A;  1BA0 A;  4Y0W A;  2P9I B;  3DJC A;  4BRF A;  2CGK A;  3HTV A;  2P9I A;  5CE3 A;  3G25 A;  5BR9 A;  1BU6 O; 
#chains in the Genus database with same CATH topology
 4JI6 K;  1C0F A;  2BH1 A;  4DTP A;  1CZB A;  5C0Y A;  1JXB A;  3WQU A;  3CYG A;  3VF4 A;  3CCU N;  3CPW M;  4CBU A;  3SAF A;  1U2V A;  3H3N O;  2ZQB A;  4H0V B;  5C24 A;  1BO5 O;  3O4Q A;  3EZ5 A;  4G1Q A;  5FPN A;  5BPN A;  1JXE A;  4K43 A;  4E7J A;  4IEE A;  1LAV A;  1Q9X A;  2P9N B;  4FM2 A;  3T69 A;  4CBX A;  3QNN A;  2FBV A;  1DLO A;  4DV1 K;  4H0P A;  5IWA K;  3A0I X;  3IMX A;  2ITG A;  2Q36 A;  3K9K A;  1EP4 A;  3V9U A;  1C1A A;  1ATS A;  3DAW A;  1LW2 A;  3BUZ B;  4M3U A;  5JS2 A;  3CQ8 A;  2VYP A;  4Z94 A;  3O5B A;  4DTN A;  5HRS A;  4DTU A;  3BGR A;  4C8O A;  2F9W A;  3S3M A;  1S3X A;  1NJI O;  1BCM A;  3HM8 A;  3BDP A;  1GLA G;  1FKO A;  4JS4 A;  1VQ9 N;  2FF6 A;  3WEE A;  4YY3 K;  4G9Z A;  2AJQ A;  3P38 A;  3SNN A;  3V1Q A;  3SUQ A;  2OZS A;  3BY5 A;  3I8D A;  4X65 K;  1A5V A;  4BWM A;  5EY4 A;  4GV9 A;  4CD1 A;  3CET A;  3HSC A;  1BA1 A;  4MO4 A;  3TAF A;  2P5O A;  2IDO A;  1NGC A;  5M1N A;  1VK0 A;  1TKT A;  3LAL A;  1I39 A;  1T3V A;  3DLG A;  2QWQ A;  1I3A A;  3ZET A;  3DRS A;  2IGI A;  2D0B A;  1NGH A;  5FPD A;  1VQP N;  4FZY A;  3M8Q A;  3K5L A;  3VQQ A;  4R5P A;  1P8Z A;  2ZGZ A;  5F2R A;  1OKJ A;  4JKA A;  5DK5 A;  4BDZ A;  5AR0 A;  3CQX A;  4A62 A;  2IVO A;  2A5X A;  3ZEU B;  2A40 A;  5AZJ A;  1KAZ A;  2YHB A;  3FFK B;  4KI4 A;  3QIC A;  1QSL A;  4MQ3 A;  2HHH K;  4CJQ A;  3QNO A;  5LL6 Z;  3ZT3 A;  4CJ3 A;  1UA1 A;  4EZ6 A;  1C0M A;  1SAZ A;  1JKH A;  2HBK A;  3CM6 A;  3DLL L;  4YOR A;  3T1H K;  5EX5 A;  2Y1I A;  4M3T A;  3NGI A;  4EP5 A;  1VQ8 N;  4JYA K;  4JKG B;  4LF4 K;  1VQ5 N;  2HHX A;  3PX0 A;  5CZ2 A;  1H1V A;  3ISN C;  4GY2 B;  4NLC A;  4NLB A;  4B1U B;  3M8S A;  3VQD A;  5HOO A;  1NG9 A;  2QW9 A;  4O0I A;  3P1G A;  4FJN A;  5CY4 A;  5TKY A;  1D5A A;  3A5O C;  1LW0 A;  4B9Q A;  3L2R A;  2EX3 A;  1WB9 A;  1LAW A;  4AIL C;  3KLF A;  5KTQ A;  4RW4 A;  4BRI A;  4DSE A;  3O9S A;  1EQY A;  3SLC A;  3C6T A;  2WOM A;  1NGI A;  2FF3 B;  3CJC A;  4JK8 A;  4OX9 K;  3LM2 A;  4FJM A;  3K58 A;  4F2R A;  1TKX A;  3MX2 A;  1QZ5 A;  5FPM A;  1QVG M;  1SKW A;  4GKK K;  2JGU A;  5C12 A;  1KCF A;  1Q18 A;  4JRQ A;  3UIQ A;  3KVG A;  3H1Q A;  1YF5 L;  3OYN A;  4JK7 A;  4O55 A;  2G8W A;  4IBN A;  4BEC A;  1RNH A;  1NK6 A;  2NRZ A;  4NCG A;  5I42 A;  1HNV A;  4FZX C;  2W6L A;  3G4S N;  2E6M A;  3AO1 A;  3EN9 A;  1EO1 A;  4CF8 A;  2XHB A;  4C8K A;  2BE2 A;  3CJ1 A;  3THW A;  4K8Z A;  3AVM A;  4CIF A;  1NMD A;  4CFA A;  4Y1D A;  4JV5 K;  1YJ9 N;  4JN4 A;  5DM6 L;  3D7E O;  1XI1 A;  4BQZ A;  3CI5 A;  1GLB G;  5AQY A;  3QIN A;  3UKU B;  2KW4 A;  3SBT A;  1NOZ A;  4EFH A;  1XC9 A;  5HL7 L;  1NOY A;  3SK3 A;  4XJX A;  3B6O A;  1RBR A;  3HZ6 A;  2BTF A;  4O44 A;  4B9T A;  4IDK A;  5HRR A;  2OTJ N;  4BG8 A;  4KHW A;  4Q0B A;  4BRD A;  5KPR A;  3VQA A;  1BUP A;  4B9L A;  1MWK A;  1VQ6 N;  4CZE A;  3WXM B;  1VQO N;  5BRE A;  4DWI A;  4IOX A;  2QM1 A;  3LDN A;  1T03 A;  4BRA A;  3QO9 A;  4W5O A;  5BRF A;  3V6D A;  4HTU A;  5LMU K;  3L6Q A;  1JLB A;  4JI7 K;  1ITG A;  1KAY A;  1N36 K;  2JWK A;  4FJ5 A;  3EZW A;  1YXQ A;  2ASM A;  4KRE A;  2HST A;  3J8A A;  1VSF A;  4FJ9 A;  4OPJ A;  2X6N A;  2ASP A;  2P9K B;  3CCS N;  5AZI A;  3K5M A;  3JAM O;  1TKD A;  2A3Z A;  4YOY A;  4JS5 A;  1VSJ A;  1ZBU A;  4CJ7 A;  2ATQ A;  4YFU A;  4WFB L;  3SV4 A;  4CF2 A;  3FLC O;  3MN9 A;  4BR9 A;  2HHQ A;  4B9U A;  5KRS A;  1WSF A;  4LD0 A;  4IFV A;  1RBU A;  1RDC A;  5B8H A;  2QWP A;  5AQI A;  4CEE A;  4FJI A;  4FK0 A;  4CIG A;  4PUO A;  4BAC A;  3V4I A;  1HNW K;  1NGD A;  4FW1 A;  1ZBI A;  1ZC6 A;  2RN2 A;  3LP3 A;  1X9W A;  1GLE G;  4LF7 K;  3CCL N;  3OYC A;  4IFE A;  4FWM A;  2GV9 A;  2HND A;  4PHT X;  2YKN A;  4DR7 K;  3VQ6 A;  1KTQ A;  1BGX T;  3S3N A;  4FSV A;  3MCA B;  3DRR A;  1YJW N;  3ZT2 A;  1RT5 A;  1IKY A;  2KKZ A;  1ZBF A;  3E1Y A;  4CZF A;  3HP6 A;  3MEC A;  1C0T A;  5GIP A;  5LJW A;  2AP1 A;  1ZYQ A;  3QIP A;  4F3O A;  3CMA N;  1NM1 A;  4O5F A;  5KGW A;  1XWL A;  3TSP A;  2V51 B;  1T6C A;  2NRX A;  1KLN A;  3H6E A;  3WNH A;  4OLA A;  4CF9 A;  4H03 B;  2E20 A;  2NNW A;  4M7X A;  3MXI A;  1BI4 B;  3TTD A;  4CZG A;  4OKK A;  2DTU A;  1NMN A;  1KRP A;  3MMV A;  3OS0 A;  2I7P A;  2EWS A;  3C6U A;  2W41 A;  3HK2 A;  5D3G A;  4BRE A;  1QHT A;  4HCB A;  4I2Q A;  3VN5 A;  1BHL A;  4DFK A;  3C0B A;  5BN8 A;  3TAP A;  1DTT A;  3OYF A;  4JI8 K;  1RTD A;  1RT7 A;  1VRU A;  3VOV A;  2HNZ A;  2QWM A;  4FJL A;  5J2P A;  4A5A A;  2YNG A;  4FPB A;  4C1N K;  3RSE B;  3FE1 A;  3D2F B;  2Z1J A;  3KK7 A;  3I55 N;  3WUH A;  3AVF A;  3RMB A;  3JSM A;  1KVB A;  3ZSZ A;  3J7Z O;  4FJH A;  2Q97 A;  4YOV A;  5BPL A;  1TL1 A;  3KLE A;  3HM9 A;  4DLG A;  4H4M A;  1WSE A;  4KTZ A;  4CJV A;  4CGF A;  4IKF A;  2XY7 A;  4DV5 K;  4KBO A;  1IKW A;  4LC9 B;  2RE2 A;  1N34 K;  2UUC K;  3O6W A;  1YTA A;  1HKG A;  2VQF K;  1XC3 A;  1T05 A;  3O1B A;  3KLH A;  2ASO A;  1NWK A;  3R8E A;  4CEZ A;  4YOX A;  3MEE A;  3HYF A;  4CZI A;  5KRT A;  3C94 A;  1KD1 O;  4B9S A;  4N56 A;  4XH1 A;  2KZM A;  2KTQ A;  4IOA L;  1E3M A;  4JKB A;  4FLX A;  4BR2 A;  1CZ9 A;  3C6A A;  3CER A;  1S72 N;  3U8X A;  4E3S A;  3JXU A;  2E6L A;  4CEC A;  3O3F A;  2GWJ A;  3I33 A;  5JEN A;  2OPP A;  4FJ7 A;  2I5J A;  3OS2 A;  1HNZ K;  4NYF A;  4LH5 A;  1J54 A;  4LFC K;  4FWN A;  2OA8 A;  1Z6R A;  4FJK A;  4PY5 A;  1NK5 A;  4DV2 K;  3N4P A;  3O9R A;  1QQN A;  2O8C B;  3TSQ A;  4DF4 A;  3CFO A;  3AV9 A;  4KTW A;  1WAJ A;  2H3G X;  4QAG A;  3M5R A;  4B08 A;  3HO1 A;  4H8K A;  4DF8 A;  1S6P A;  2P9I B;  3L2Q A;  4GW6 A;  3ZSW A;  1JLA A;  1GOC A;  4BRF A;  4JKG A;  1BL3 A;  3HTV A;  3C65 A;  4AQY K;  4F8R A;  1Q8I A;  3ENB A;  2PY5 A;  4GVM A;  1BU6 O;  3CHW A;  1L3T A;  3OYI A;  1KQS M;  3J7A P;  4H0X B;  3LDL A;  4MDB A;  5AQG A;  3P31 A;  2FBY A;  2QI2 A;  2HHT A;  3THY A;  1U48 A;  4BGA A;  3QEI A;  3T3F A;  2V7Y A;  1EKE A;  4JKF A;  3C7N A;  1TUU A;  4OGE A;  1NJZ A;  3UE5 A;  1QTM A;  5ELZ A;  3TAM A;  3EY1 A;  4CHQ A;  1WOQ A;  2YJF A;  1C1B A;  2QKB A;  4W5N A;  4W5R A;  4CJK A;  1LWF A;  1T44 A;  1SL0 A;  4AHC A;  2WFB A;  4L8R B;  3PSF A;  4WFN L;  4PKH A;  3OJU A;  1RDW X;  1B9D A;  3CJ9 A;  1SL1 A;  2QK9 A;  4AHV A;  3MWT A;  1G99 A;  2HHU A;  1K8K B;  4IJA A;  1SUQ A;  4K41 A;  5M1Q A;  5BR8 K;  3J81 O;  3H46 O;  4CEO A;  4X62 K;  4B9V A;  1RDB A;  2PAV A;  2Q31 A;  4FJJ A;  5AQH A;  1VSK A;  3KKS A;  2OYQ A;  2FSN A;  3MXJ A;  3HVR A;  3SUO A;  1RGI A;  4BC5 A;  1JLQ A;  3FFI A;  1KAX A;  4DKW A;  3NAE A;  2UYT A;  3BZK A;  1QVF M;  2X78 A;  1XNQ K;  3UKU A;  2OZM A;  3CCJ N;  1U47 A;  1S1V A;  3D2E B;  4FPA A;  1HQU A;  2G8I A;  3HP9 A;  2VGM A;  2O8F B;  4E0D A;  5C10 A;  1RDD A;  1L3U A;  4B3R K;  3PLA A;  1S1W A;  3ZSV A;  1N6Q A;  1C0U A;  3UKR A;  4CW7 B;  4EAH D;  1A5W A;  3Q7B A;  4U7B A;  3VEV A;  1TYQ B;  3N4Q A;  2D4W A;  3UB5 A;  3SAG A;  4BC3 A;  4E7L A;  4BRP A;  3PV8 A;  1RTI A;  4BE2 A;  1HYV A;  4Z4I A;  1ASV A;  4A59 A;  1BQM A;  4NB4 A;  1VQN N;  3GL1 A;  2E8A A;  4CEA A;  3FGU A;  3ASM A;  2NRW A;  1YTU A;  1S22 A;  2OCE A;  4FWK A;  3QER A;  1J5E K;  3OYK A;  4O0J A;  2OAN A;  1NGA A;  4HUF A;  4BEB A;  5F0X A;  3OVN A;  2RF2 A;  4DG1 A;  5FPE A;  1QZ6 A;  4A2A A;  4RWT A;  3E9P A;  1NK9 A;  3JS6 A;  1IH7 A;  4JI1 K;  1YHQ N;  1K9M O;  1D9F A;  4DFP A;  1YIJ N;  3NVK A;  2YHX A;  2FSJ A;  4FWO A;  4H5T A;  3VES A;  5E26 A;  3DLK A;  4KPY A;  2G8U A;  1VSL A;  2PYJ A;  3VGM A;  4Y1C A;  4CGG A;  4JNE A;  3TAG A;  3LM9 A;  4ISG A;  4IOC L;  3DOK A;  3QEV A;  4ILG B;  1NJX A;  3CCV N;  3TU5 A;  2G8H A;  1ASU A;  5A2Q O;  3HXM A;  4DFM A;  4WCE L;  3HI0 A;  2HHV A;  3L3V A;  5KQ8 A;  4CK1 A;  4M45 A;  1GLD G;  1E4F T;  1KFD A;  2P5G A;  4CCH A;  4DSF A;  1VQ7 N;  1JLF A;  2KZZ A;  3VQ4 A;  1IG8 A;  4DR4 K;  3CD6 N;  1TL3 A;  1YI2 N;  1BOT O;  3BEX A;  3KTQ A;  3KLG A;  3ZT4 A;  4BR4 A;  1NK0 A;  4KHP K;  4H0T B;  3G71 N;  3RSE A;  4ELT A;  5DM7 L;  1IJJ A;  2YHW A;  3D2F A;  3FZH A;  1LV5 A;  1ASW A;  1BQN A;  3VF6 A;  3THX A;  1V4T A;  2Z1H A;  3O4W A;  4BRO A;  1UOC A;  3HJF A;  4DSJ A;  4CGD A;  2HF3 A;  4CVN E;  3RR8 A;  4QOZ B;  3U9D A;  4IG0 A;  1W97 L;  3CCM N;  5HLF A;  3ALY A;  3LPU A;  4K8X A;  4JKH A;  4J2B A;  4FK4 A;  4DR2 K;  3CG7 A;  3H08 A;  4IFY A;  4CJT A;  4E19 A;  3BP8 A;  1KXP A;  3KD1 E;  4NO7 A;  3RWU A;  3CJ7 A;  4YHH K;  3HT3 A;  4KI6 A;  4RW9 A;  2PFU A;  1QQO A;  1GOA A;  3AGK A;  3VEX A;  4CD3 A;  3AVB A;  3NDK A;  4CJR A;  5GAE P;  3I8B A;  4RTF D;  1TVR A;  3P4I A;  1FK9 A;  3ID8 A;  2NRH A;  4AM6 A;  4JD2 A;  2QXF A;  4FZZ A;  1T7P A;  1IO2 A;  2O8B B;  3AVN A;  3SZ2 A;  2F96 A;  4WQ4 A;  3NF8 A;  4YOU A;  2NRT A;  3B6P A;  4EZ9 A;  2P9U A;  4JI3 K;  2DPN A;  2O8C A;  1QQM A;  4O4G A;  4JI2 K;  4A5B A;  4B1X B;  4CK2 A;  1S1T A;  3I0S A;  3AO2 A;  4F2S A;  4HUG A;  4FVM A;  4ISF A;  4CFD A;  1T6D A;  1CXQ A;  2YKM A;  2IIR A;  3OA9 A;  4F3T A;  3VA3 A;  1KLM A;  5JMV A;  1HKC A;  3MN7 A;  4ID5 A;  4WQ4 C;  2GEL A;  4F9O A;  2D0A A;  5FDL A;  3ZCM A;  4CE9 A;  3M6G A;  3VGK A;  1B9F A;  3P39 A;  4FM0 A;  2XO7 A;  3CC4 N;  4KTQ A;  5MLC Q;  4DTR A;  2BAN A;  2GTD A;  4GVE A;  1NNE A;  4Z4H A;  4Z4C A;  3ZSX A;  3K9J A;  4BC2 A;  4CEF A;  2ZM6 K;  3ID6 A;  1U6Z A;  3DXM B;  3I0R A;  2A6A A;  1JL1 A;  5M1P A;  2Q0R A;  4OGC A;  3K2P A;  3A2F A;  2C1I A;  1NJY A;  3THV A;  3HOT A;  4DQR A;  1NK7 A;  4DSI A;  1WSG A;  5CHI A;  1TAQ A;  1WLJ A;  2I7N A;  1IG9 A;  2NLX A;  3R9P A;  3KWG A;  2E1Y A;  3CM5 A;  1DEJ A;  1IKV A;  2X6S A;  3L0Q A;  4CZJ A;  3TI0 A;  5C42 A;  1WBB A;  4KB0 A;  4M3W A;  4KH4 A;  3MX5 A;  4M7Y A;  4GV6 A;  2HMP A;  5AQX A;  2UXC K;  3AVA A;  4E7H A;  2FLO A;  1MWM A;  5GIN A;  3SJJ A;  3QIO A;  4E72 A;  2PBD A;  1WN7 A;  1QS4 A;  2FC0 A;  4E7I A;  3HL8 A;  5E41 A;  3R6M A;  1L5U A;  4N76 A;  3BZC A;  1HR0 K;  3JYT A;  3DXK B;  1JJ2 M;  3VQ8 A;  3LAM A;  4N5S A;  3NGZ A;  4ELV A;  1VHX A;  3D2E A;  1XHZ A;  1REV A;  3MWP A;  4ICL A;  3QBX A;  3G0Z A;  2O8F A;  2VWK A;  3KD5 E;  1S1X A;  2YHY A;  2CH6 A;  2GX9 A;  4C8M A;  1JCG A;  3ITH A;  3ZX3 A;  3AVC A;  4OJR A;  4XEI A;  4BRL A;  4CEQ A;  4EIA A;  2IVP A;  1TK0 A;  4DU3 A;  4M3Y A;  3IUC A;  4FL9 A;  4WYB A;  3HBT A;  3L8B A;  2XRI A;  3LDO A;  1XHX A;  4E1J A;  2B4J A;  1HX1 A;  1BIZ A;  2EHG A;  3TAR A;  2OTL N;  4I7F A;  1Z25 A;  3MDQ A;  2GEM A;  2D0C A;  5M1F A;  4C8N A;  2ZJQ L;  1J53 A;  3QML A;  2ETJ A;  1RT6 A;  3NH1 A;  1L3V A;  2HNY A;  4O8K A;  4DS4 A;  3SI6 A;  3MAQ A;  4CER A;  3VER A;  1WAF A;  2QWO A;  3VQC A;  3AA4 A;  1GLL O;  5HBM A;  3AA5 X;  1Z05 A;  4LF6 K;  4CJE A;  4FM1 A;  2IOC A;  1WBD A;  2HBJ A;  2CGK A;  2VQE K;  4LF8 K;  5CE3 A;  3G25 A;  3HOS A;  1TV6 A;  4BWJ A;  3SQ1 A;  3EKU A;  3KZB A;  4FW2 A;  2HVI A;  1RIL A;  3ZSY A;  4CES A;  3WQT A;  4DQQ A;  1C0G A;  2P9S B;  3MN5 A;  5AQL A;  1NK8 A;  3SMS A;  3IKM A;  4RW7 A;  5AQV A;  4WF9 L;  4IWV A;  1OH6 A;  5BPM A;  5C15 A;  1NKB A;  5J2M A;  2BDP A;  1P90 A;  4NXM K;  3O80 A;  4MFB A;  1GLF O;  4CJ5 A;  1M90 O;  4BRK A;  4I2P A;  1HRH A;  4JHD B;  4H5W A;  4H5V A;  4PKG A;  4QS8 A;  2QXL A;  2P9N A;  4H5R A;  5AJ3 K;  1UAX A;  1SKR A;  4AHU A;  4BE1 A;  4CFB A;  1R59 O;  3NE6 A;  1NGE A;  3AAQ A;  3VMF B;  2P51 A;  1S1U A;  1Q9Y A;  3SUP A;  4ZHR A;  3SCX A;  2ZF5 O;  3EE9 A;  4OKJ A;  4X64 K;  5TKW A;  4KAZ A;  1WSH A;  5AQQ A;  2D0P A;  4HWI A;  4BGB A;  5JVG L;  4BRC A;  4DS5 A;  3U3Y A;  1Q82 O;  1O13 A;  2ZGY A;  3WEE B;  5KPZ A;  3LP1 A;  3NF9 A;  2E1Z A;  4KRF A;  4CEB A;  4K0K K;  1D4X A;  3FZL A;  4B3M K;  3KHY A;  3IS9 A;  1HQE A;  5AFU A;  3IAY A;  2ZJR L;  3AO5 A;  4HUE A;  3L2V A;  4CZM A;  1K8A O;  2HVH A;  2GUI A;  3U9Z A;  1C6V A;  4CJP A;  2YV0 X;  1SS6 A;  3TPQ A;  2VG5 A;  2F9T A;  3QEW A;  2ZWH A;  4A61 A;  4CGJ A;  3NH0 A;  3LZI A;  1LCU A;  2QWL A;  3DYA A;  1VSM A;  3KK3 A;  3CQY A;  3W0L A;  3MK6 A;  3OHR A;  1I94 K;  4DTJ A;  3VQ9 A;  3ZEU A;  4NCB A;  5AFU H;  1MU2 A;  3CCE N;  1V4S A;  3PO4 A;  3M3Z A;  3K57 A;  2D0O A;  4FWR A;  3SPZ A;  5JLF A;  4WFA L;  5KQD A;  5GAG P;  1XMO K;  4DR5 K;  4J2A A;  4EP4 A;  2W42 A;  4PL7 A;  4CJL A;  3OYD A;  3V81 A;  4NXN K;  2FBX A;  4N47 A;  3FZM A;  3S9H A;  3NCI A;  3FR0 A;  3DM2 A;  1MDU B;  2ZD1 A;  3SPY A;  1W0H A;  3A5M C;  3LDP A;  2Q2R A;  2ITM A;  4DQI A;  4GNI A;  2QWN A;  4WQ5 A;  1QQC A;  1TK8 A;  4IXC A;  4BC4 A;  1Q86 O;  3ZSO A;  4FJX A;  2UXB K;  3BF3 A;  4CIE A;  2WUS A;  2VWJ A;  1WUA A;  2P9P B;  3SAH A;  3OYH A;  4DTM A;  1J6Z A;  3V9X A;  1QSS A;  4BRQ A;  4CJW A;  4BY9 C;  4H0O A;  1VQ4 N;  3J80 O;  3OYJ A;  1S9G A;  4N41 A;  3SQ2 A;  1RBT A;  2VG7 A;  1XMQ K;  3D6R A;  4NCA A;  3VTH A;  4E1M A;  4WQ5 C;  1ILY A;  2O8D B;  3PX4 A;  3LDS A;  4B1V A;  3L4I A;  3ZSR A;  1ZXO A;  3KK1 A;  3KK2 A;  3VQP A;  1YIT N;  4A2B A;  1HLU A;  3FZK A;  5HRP A;  3THW B;  5LJV A;  4DU1 A;  2J4R A;  1E4G T;  3QBW A;  2DFE A;  5AQM A;  1BDG A;  1NGB A;  3VPZ A;  3LZJ A;  4FLW A;  5JS1 A;  1WSJ A;  4B3O A;  3K5N A;  1VSH A;  4FLU A;  2YHA A;  4JK9 A;  2UXD K;  4CHZ A;  5AQN A;  3HST B;  5EOY A;  5ADX A;  4F4K A;  5EU7 A;  3QEX A;  5AQT A;  3CCR N;  4LF9 K;  3U3G A;  2B6A A;  1VRT A;  2KHO A;  3ATV A;  2UUB K;  4IO9 L;  4I9L A;  3O4N A;  1TUY A;  4BR5 A;  4KV8 A;  4CF0 A;  4JAX A;  3LAK A;  3NFA A;  5DMR A;  4JI5 K;  4KFB A;  5FRO A;  3O8M A;  1K6Y A;  3CJA A;  2Q0U A;  1SZ2 A;  1HPM A;  1ATR A;  4BR7 A;  3KKR A;  3SQ4 A;  1KC8 O;  2GBZ A;  2P9K A;  4K25 A;  3DXK A;  2NZT A;  3AVI A;  3WXL A;  5ADX H;  1IV0 A;  1JLG A;  3TR8 A;  5I9E B;  4RW8 A;  3H45 C;  2VG6 A;  4FLY A;  3CF5 L;  1HJO A;  4AHS A;  4UY8 O;  2HBM A;  2O4G A;  4DCH A;  4LY7 A;  2KQ2 A;  2C1G A;  3DLR A;  4PQU A;  4ILH A;  1JLC A;  4A57 A;  1J5O A;  4FJ8 A;  3QET A;  3OBY A;  1RCH A;  2WC9 A;  4AM7 A;  5GAH P;  5T7B A;  3SJH A;  1VAZ A;  2FBT A;  3O9Q A;  3PIP L;  4UQG A;  5BRD A;  3G6E N;  4FLZ A;  2E2N A;  1Q81 O;  3NF6 A;  4CHY A;  1ZBL A;  4B9M A;  4Z4F A;  1YVN A;  4B3T K;  1MA9 B;  5SZT A;  2R7Y A;  4B8C A;  3PX6 A;  1YJN N;  3GG4 A;  3PY8 A;  4DR1 K;  4GMJ B;  5M1O A;  3ZSQ A;  4PA1 A;  4RG8 A;  4B1W B;  3F2K A;  2HHS A;  3AA3 A;  1BI4 A;  4M42 A;  4EHT A;  2YX6 A;  4X66 K;  4ID1 A;  1TKZ A;  4ZTF A;  1Y64 A;  1HUX A;  1NU0 A;  5GAD P;  3V1O A;  3LAN A;  1HMV A;  2Q3S A;  4DV7 K;  2P9S A;  3SUN A;  1U45 A;  3AO3 A;  4HTL A;  1U49 A;  5FRN A;  3GDQ A;  1SQK A;  5FLX O;  4DUZ K;  3PSI A;  1M1K O;  4JHD A;  1KFS A;  4QS7 A;  1NGG A;  1OVQ A;  1RBS A;  2A41 A;  2HOE A;  4JKC A;  5H1S Q;  1WNS A;  4FLT A;  2F8T A;  3VET A;  4I6M B;  3LPT A;  4YDU A;  1S5J A;  3H3O B;  3ATU A;  4JKD A;  3HVT A;  3QES A;  4CJS A;  2E2Q A;  3AVH A;  3LP2 A;  1B92 A;  1OH8 A;  2E88 A;  3S3O A;  3QDK A;  2CH5 A;  2DFH A;  3EE8 A;  3ULE B;  3A5N C;  2GUP A;  3K5O A;  5HRO A;  1EX4 A;  4ELU A;  1DT9 A;  4LFB K;  3VQB A;  1CLQ A;  1SV5 A;  2E2O A;  2P9L B;  5AQF A;  4YDU C;  3ZYY X;  4DLE A;  4KHY A;  3HRG A;  3DLB A;  4CZK A;  2O4I A;  3D0P A;  2JWL A;  3QLH A;  2A1R A;  1SKS A;  2G8V A;  4LSN A;  4CED A;  4B1Y B;  4B3S K;  4IG3 A;  3VF2 A;  3WXI A;  3F73 A;  3EEQ A;  4MO5 A;  3VTI A;  4LSL A;  4YNQ A;  4NYN A;  1HJR A;  1GLJ O;  4OKE A;  1U04 A;  4IEI A;  3AAP A;  5C2D A;  1JLE A;  4BE0 A;  2QKK A;  1OVY A;  2QEX N;  5KI6 A;  1X3N A;  3O3G A;  3LP0 A;  5FRM A;  4IO8 A;  5E84 A;  3QB0 A;  3WNG A;  4CF1 A;  1IBM K;  4E89 A;  3CC2 N;  2HW3 A;  3OYG A;  4BQL A;  1TGO A;  4J8F A;  2WBN A;  1RTJ A;  2IC3 A;  5HRN A;  2F7T A;  3VA0 A;  2E5L K;  4M3Z A;  3L2U A;  1UWB A;  5AQU A;  4W5T A;  2O8E B;  1QE1 A;  3F5T A;  4DU4 A;  2W40 A;  1RT3 A;  3S41 A;  3S5T A;  4CK3 A;  4DTO A;  1F21 A;  4IDH A;  3NF7 A;  2RKI A;  1IKX A;  2P9I A;  3DI6 A;  4DV0 K;  1YVU A;  4Z4G A;  3O08 A;  4L3Q A;  4JI0 K;  2F8S A;  4KB1 A;  1KVA A;  3THY B;  2ZE2 A;  1ZBS A;  1HYZ A;  4FWL A;  4H5N A;  3F9K A;  3C7N B;  4CJF A;  5CYM A;  3QFP A;  2OPQ A;  4K42 A;  3IFR A;  1Q7Y O;  1RDU A;  3D45 A;  3T19 A;  3QFU A;  2P9P A;  1N33 K;  5AQW A;  3DRP A;  4KHQ A;  5CZ1 A;  3TTF A;  2AA4 A;  4IZ9 A;  4DTS A;  1NGJ A;  3NH2 A;  3RMC A;  2XY8 A;  5KPT A;  2UUA K;  3AVJ A;  3I56 N;  1JCE A;  3V9W A;  3E9O A;  4YOW A;  2YNH A;  3PO5 A;  2VCP A;  4DV4 K;  5AQO A;  2IS3 A;  3RTV A;  5LY3 A;  2O8D A;  4BDY A;  3LWM A;  3OY9 A;  3O9T A;  1Z26 A;  3WXJ A;  1K8K A;  4BRM A;  4ILJ A;  3ZLJ A;  4JI4 K;  2Y1J A;  2YNI A;  1JCF A;  3E9L A;  2YNF A;  3RRG A;  4DSL A;  2V52 B;  4U67 L;  2B5J A;  2FXU A;  3CME N;  3OTO K;  4DV3 K;  4BVO A;  4MDA A;  1D9D A;  3VQ5 A;  1W9H A;  1S6Q A;  4DR6 K;  1X1P A;  5K14 A;  4QCL A;  4MLH A;  2V7Z A;  2QTD A;  2OPR A;  2F4V K;  3OJS A;  1DGK N;  4ZTJ A;  4FVU A;  3TSU A;  3LWL A;  3ZX0 A;  3UKR B;  3FZF A;  2BUP A;  3AY9 A;  4CJU A;  3J7Y P;  3HPG A;  1VSI A;  2BGG A;  4Z0U A;  4PWD A;  3TTC A;  1N32 K;  4DMN A;  2HHI A;  3OYL A;  2VWB A;  4C23 A;  5J2N A;  1TYQ A;  3CFP A;  2YCH A;  5JVH L;  1NKC A;  3RRH A;  3C6H A;  2HHW A;  2KFZ A;  1EET A;  3P5J A;  1LOT B;  4OPH A;  1JL2 A;  4OPK A;  2UU9 K;  5EXW A;  4O8U A;  1T8E A;  2PZS A;  3O3H A;  3NHG A;  3TAE A;  1WSI A;  4FXD A;  2PYL A;  4B8A B;  1VSE A;  3KIO A;  3DOL A;  4LF5 K;  1NBW A;  3OYM A;  3ULD A;  4M63 C;  4DB3 A;  3VEW A;  3GBT A;  3NBP A;  1HYS A;  3NGY A;  3IRX A;  3U6F A;  1G15 A;  5KGX A;  4J2D A;  4MLE A;  5HP1 A;  1QSY A;  1A5X A;  3EKS A;  2XY6 A;  3KLI A;  3MCP A;  1U2V B;  3C95 A;  3VQE A;  4CZH A;  3SMP A;  3O1W A;  1FXX A;  4JLH A;  4FCY A;  1GOB A;  1D8Y A;  1XNR K;  3IDH A;  5AQZ A;  2Q1N A;  4KH6 A;  3T7Z A;  4RCH A;  4FK2 A;  4HHT A;  1ATN A;  1LWE A;  4LH4 A;  4QS9 A;  4JRP A;  4V19 S;  3R3L A;  1GLC G;  2A1S A;  3SBG A;  4JEP A;  2P1J A;  3CCQ N;  2NRR A;  4XH5 A;  1FJG K;  1HPZ A;  2D5R A;  4BRH A;  4CBW A;  4CHP A;  1HKB A;  5AQP A;  3PUF A;  3P83 D;  4ISE A;  3AGR A;  3VEN A;  4AF1 A;  4TSX A;  3HPH A;  4WE1 A;  4OO1 J;  4HVJ A;  2YI1 A;  3TAB A;  3MXM A;  1ZBH A;  3RR7 A;  4EHU A;  3WNE A;  4JKE A;  1TK5 A;  4FOE A;  1X9J A;  1UA0 A;  1U4B A;  1RTH A;  2NRV A;  4CZL A;  3M8R A;  3THX B;  3HPO A;  2HF4 A;  4OPA A;  3CXC M;  1IBL K;  5CYQ A;  3DLH A;  4FJG A;  1L3S A;  4KO0 A;  4FWQ A;  3AVK A;  1ESV A;  2OPS A;  4OLB A;  3V9Z A;  4FLV A;  4I6M A;  4CHO A;  4HCC A;  4XH4 A;  4BVP A;  5BN9 A;  3CIP A;  3VEO A;  4LFA K;  2KFN A;  2D1K A;  3DWL A;  5CR4 A;  5AQJ A;  3VEY A;  4BE7 B;  1W2B M;  3VGL A;  3WNF A;  2HMI A;  2CGL A;  4BDP A;  2G8F A;  3L2W A;  3ULE A;  3ZET B;  2WON A;  4AH9 A;  4RW6 A;  3TAN A;  3GOI A;  3CJB A;  4DV6 K;  2DFF A;  1EWR A;  3O9U A;  4BG9 A;  4DQP A;  2P9L A;  2QWR A;  2E4L A;  2WTU A;  2CGJ A;  1BWF O;  2Z1G A;  4DQ8 A;  3ZX2 A;  3F9M A;  3B8A X;  5AZJ B;  3K59 A;  3L4Q A;  3OW2 M;  3OS1 A;  4H0Y B;  3KJV A;  1EXQ A;  3T1Y K;  4J2E A;  4CFC A;  3OYB A;  2YJE A;  2ZJP L;  3AVG A;  3NVM A;  5J1E A;  4GKJ K;  4CJ4 A;  3AA2 A;  1VQM N;  2XY5 A;  1OH7 A;  4BRG A;  1IBK K;  4M3R A;  4JD2 B;  4W5Q A;  5SWM A;  3AAR A;  1X3M A;  4XIU A;  3EO3 A;  4C8L A;  3QEP A;  3ENO A;  1KVC A;  5J2Q A;  4FYD A;  3RMD A;  2P9U B;  4CI6 A;  3AVL A;  4DHY A;  3OBW A;  3TWH A;  5LMN K;  3DLE A;  3LL3 A;  2O8B A;  1YUW A;  5C25 A;  4AHR A;  5C2F A;  3SQ0 A;  1OH5 A;  4R79 A;  4KKO A;  2O8E A;  5F1X A;  3ZT1 A;  2X74 A;  5M1K A;  2JLE A;  5EVZ A;  1QHA A;  1NK4 A;  2G8K A;  3LDQ A;  3CYM A;  4IJN A;  2KLA A;  5GIO A;  3SV3 A;  2Z1I A;  3RMA A;  4M41 A;  4E1N A;  1SL2 A;  2A42 A;  2HBL A;  1XUP O;  3PIO L;  4DUY K;  3Q7C A;  1RT1 A;  3CPE A;  3CC7 N;  3TAQ A;  2RPI A;  4FWS A;  2FSK A;  2IVN A;  4DFJ A;  1HNX K;  5AQK A;  1RFQ A;  2LSN A;  1Y97 A;  1RT4 A;  2W00 A;  4B1Z A;  4DTX A;  5IT9 O;  1VQK N;  1VSD A;  4O5B A;  4CGH A;  5I3U A;  3W3D A;  3IG1 A;  4I9Q A;  3U4L A;  3GE1 A;  1X9S A;  4OVL A;  3DXM A;  4BRN A;  2QA4 N;  3OYE A;  2VGN A;  4KHU A;  3A8Y A;  3KWI A;  3WXK A;  4CGI A;  1BG3 A;  1YAG A;  2HB5 A;  1N5Y A;  5BRH A;  1YT3 A;  1NLV A;  1XQS C;  4YOT A;  3E01 A;  3MEG A;  5JLH A;  3OYA A;  4Q5V A;  3R1X A;  1NJW A;  3A5L C;  1R0A A;  1VQL N;  3NMU A;  3CFR A;  2GWK A;  5AQR A;  1NGF A;  1FKP A;  4M3X A;  4PKI A;  3MN6 A;  4KHS A;  4AHT A;  5AZI B;  1NKE A;  3EYZ A;  3M1F A;  3M8P A;  3V1R A;  2NUB A;  4E7K A;  1BIU A;  3DMJ A;  4C1N I;  1CXU A;  1FW6 A;  3EL2 A;  1DKG D;  3K0S A;  1TAU A;  1LWC A;  3L3U A;  4DSK A;  1EWQ A;  4FWP A;  5AQS A;  4Z4E A;  1HNI A;  1C1C A;  1S9E A;  1J9A A;  3VEZ A;  2W6K A;  3MED A;  1RBV A;  4CHN A;  1X9M A;  2IAJ A;  1KSP A;  3H1V X;  4FO0 A;  3BF1 A;  3WT0 A;  3ENH A;  4DR3 K;  3V9S A;  1K73 O;  1BCO A;  1RT2 A;  1RDA A;  4FOI A;  1DTQ A;  4KH5 A;  4BR0 A;  1N8R O;  3VQ7 A;  3ZT0 A;  4KHN A;  4B9N A;  2RHK A;  1CZA N;  2E2P A;  4GV3 A;  5JIC A;  3E66 A;  4PL8 A;  1BA0 A;  4Y0W A;  3SYZ A;  4DQS A;  1O1W A;  3DJC A;  3RVC A;  2DY4 A;  3AO4 A;  1BIS A;  3G10 A;  1W7A A;  5BR9 A;  4H4O A;  3T1A A; 
#chains in the Genus database with same CATH homology
 3CHW A;  1C0F A;  3O08 A;  4L3Q A;  2BH1 A;  1KQS M;  5C0Y A;  3EKU A;  3KZB A;  3LDL A;  4H0X B;  4MDB A;  3VF4 A;  3WQU A;  1ZBS A;  4FWL A;  3CCU N;  5AQG A;  3CPW M;  3P31 A;  4CBU A;  3WQT A;  4H5N A;  3C7N B;  3SAF A;  2QI2 A;  1C0G A;  1U2V A;  3QFP A;  4BGA A;  3H3N O;  2P9S B;  4H0V B;  4K42 A;  2V7Y A;  3MN5 A;  5AQL A;  4JKF A;  3C7N A;  1TUU A;  3IFR A;  3SMS A;  1BO5 O;  3IKM A;  1Q7Y O;  5AQV A;  3UE5 A;  1RDU A;  4WF9 L;  5FPN A;  4IWV A;  3QFU A;  2P9P A;  5ELZ A;  4K43 A;  5BPM A;  5BPN A;  5AQW A;  5C15 A;  4IEE A;  1P90 A;  2AA4 A;  3O80 A;  4IZ9 A;  3TTF A;  1GLF O;  1WOQ A;  2YJF A;  2P9N B;  1NGJ A;  1M90 O;  4BRK A;  3T69 A;  4JHD B;  4H5W A;  5KPT A;  4CBX A;  4H5V A;  4PKG A;  1T44 A;  3I56 N;  1JCE A;  2QXL A;  2P9N A;  4H5R A;  2WFB A;  4QS8 A;  3E9O A;  1R59 O;  4H0P A;  3A0I X;  4WFN L;  4PKH A;  3IMX A;  4YOW A;  1NGE A;  3AAQ A;  3VMF B;  1RDW X;  2VCP A;  5AQO A;  3CJ9 A;  5LY3 A;  2Q36 A;  3K9K A;  3MWT A;  1G99 A;  1K8K B;  1ATS A;  4IJA A;  3O9T A;  3DAW A;  4K41 A;  5M1Q A;  2ZF5 O;  3WXJ A;  3EE9 A;  3H46 O;  1K8K A;  3BUZ B;  5TKW A;  4BRM A;  4ILJ A;  2VYP A;  4Z94 A;  1JCF A;  3O5B A;  5AQQ A;  3E9L A;  2PAV A;  2D0P A;  2Q31 A;  4HWI A;  4BGB A;  5JVG L;  5AQH A;  4BRC A;  2V52 B;  4U67 L;  2F9W A;  1Q82 O;  1O13 A;  2FSN A;  1S3X A;  1NJI O;  2ZGY A;  2FXU A;  3WEE B;  3HM8 A;  3CME N;  5KPZ A;  1GLA G;  4BVO A;  1RGI A;  4MDA A;  4BC5 A;  1VQ9 N;  1KAX A;  4DKW A;  2FF6 A;  3WEE A;  4G9Z A;  2E1Z A;  3P38 A;  2UYT A;  1D4X A;  3FZL A;  1QVF M;  3KHY A;  3UKU A;  3CCJ N;  4MLH A;  5EY4 A;  2V7Z A;  4GV9 A;  3D2E B;  4CD1 A;  2QTD A;  4FPA A;  3CET A;  1DGK N;  1BA1 A;  3HSC A;  2VGM A;  3TSU A;  5AFU A;  4FVU A;  3ZX0 A;  5C10 A;  4MO4 A;  2ZJR L;  3UKR B;  1NGC A;  5M1N A;  3PLA A;  3FZF A;  2BUP A;  3AY9 A;  1T3V A;  4CZM A;  1K8A O;  3UKR A;  3TTC A;  2QWQ A;  3Q7B A;  4EAH D;  4U7B A;  3VEV A;  2VWB A;  1TYQ B;  3N4Q A;  2D4W A;  3U9Z A;  3UB5 A;  4C23 A;  3ZET A;  3SAG A;  4BC3 A;  1NGH A;  1SS6 A;  5FPD A;  1VQP N;  1TYQ A;  2YCH A;  3TPQ A;  4BRP A;  5JVH L;  1P8Z A;  2ZGZ A;  2F9T A;  5F2R A;  3ZEU B;  1OKJ A;  3C6H A;  4JKA A;  2ZWH A;  4A61 A;  1LCU A;  2QWL A;  4A59 A;  4NB4 A;  1VQN N;  5AR0 A;  3GL1 A;  3CQX A;  2E8A A;  4A62 A;  1LOT B;  2IVO A;  2A5X A;  3FGU A;  4OPH A;  3CQY A;  2A40 A;  3W0L A;  2NRW A;  3MK6 A;  1KAZ A;  3OHR A;  5AZJ A;  3FFK B;  1S22 A;  5EXW A;  3QIC A;  4O8U A;  4FWK A;  3ZEU A;  2OAN A;  5AFU H;  1NGA A;  4BEB A;  5F0X A;  3CCE N;  1SAZ A;  1V4S A;  2HBK A;  5FPE A;  1QZ6 A;  3M3Z A;  4A2A A;  2D0O A;  4FWR A;  4RWT A;  4YOR A;  5JLF A;  3E9P A;  5EX5 A;  3DLL L;  3JS6 A;  4WFA L;  1NBW A;  1YHQ N;  5KQD A;  5GAG P;  1K9M O;  1VQ8 N;  4JKG B;  4M63 C;  4DB3 A;  4PL7 A;  1VQ5 N;  1YIJ N;  3VEW A;  1H1V A;  3GBT A;  3FZM A;  4GY2 B;  4NLC A;  4NLB A;  4B1U B;  3NVK A;  2YHX A;  2FSJ A;  5HOO A;  2QW9 A;  3FR0 A;  4FWO A;  4H5T A;  3VES A;  5E26 A;  5TKY A;  1MDU B;  4MLE A;  3A5M C;  3LDP A;  3A5O C;  2Q2R A;  2ITM A;  4B9Q A;  3EKS A;  3MCP A;  2QWN A;  4GNI A;  3VGM A;  1U2V B;  4WQ5 A;  4CZH A;  4JNE A;  4IXC A;  4BC4 A;  3LM9 A;  3SMP A;  1Q86 O;  3O1W A;  4BRI A;  4ISG A;  3O9S A;  1EQY A;  4IOC L;  3SLC A;  3IDH A;  3BF3 A;  4ILG B;  2WUS A;  1NGI A;  2Q1N A;  4KH6 A;  1WUA A;  2FF3 B;  2P9P B;  3CJC A;  4RCH A;  5AQZ A;  3T7Z A;  4JK8 A;  3TU5 A;  3SAH A;  1J6Z A;  4BRQ A;  3LM2 A;  1ATN A;  4BY9 C;  4H0O A;  4QS9 A;  1VQ4 N;  4WCE L;  3R3L A;  1GLC G;  3SBG A;  3MX2 A;  1QZ5 A;  5FPM A;  1QVG M;  4JEP A;  3HI0 A;  5C12 A;  3CCQ N;  2NRR A;  4XH5 A;  1Q18 A;  3KVG A;  3D6R A;  3H1Q A;  1YF5 L;  5KQ8 A;  4JK7 A;  4BRH A;  4CBW A;  3VTH A;  4BEC A;  1HKB A;  5AQP A;  4WQ5 C;  1ILY A;  4ISE A;  3AGR A;  1GLD G;  1E4F T;  3VEN A;  4AF1 A;  2NRZ A;  4B1V A;  3L4I A;  4OO1 J;  1VQ7 N;  2YI1 A;  1ZXO A;  3CCV N;  3G4S N;  1YIT N;  4EHU A;  4A2B A;  4JKE A;  3EN9 A;  1IG8 A;  1HLU A;  3FZK A;  3CD6 N;  1EO1 A;  4FOE A;  1YI2 N;  1BOT O;  3BEX A;  5LJV A;  2J4R A;  1E4G T;  3CJ1 A;  4BR4 A;  1X9J A;  3QBW A;  5AQM A;  2NRV A;  1BDG A;  4H0T B;  1NGB A;  3RSE A;  3G71 N;  1NMD A;  3VPZ A;  4CZL A;  5DM7 L;  1IJJ A;  2YHW A;  2HF4 A;  3D2F A;  4JN4 A;  1YJ9 N;  5DM6 L;  3D7E O;  3FZH A;  4OPA A;  3CXC M;  4BQZ A;  3CI5 A;  3VF6 A;  1GLB G;  4JK9 A;  5AQY A;  1V4T A;  3O4W A;  4FWQ A;  4BRO A;  3UKU B;  4EFH A;  3SBT A;  1ESV A;  5AQN A;  5HL7 L;  4I6M A;  3SK3 A;  4XJX A;  2HF3 A;  5EOY A;  5ADX A;  3HZ6 A;  2BTF A;  4XH4 A;  5BN9 A;  3U9D A;  4BVP A;  2OTJ N;  5AQT A;  3CIP A;  3VEO A;  4BG8 A;  3CCR N;  4BRD A;  5KPR A;  2KHO A;  3ATV A;  1BUP A;  1VQ6 N;  1MWK A;  2D1K A;  4CZE A;  1W97 L;  3WXM B;  3DWL A;  5CR4 A;  5AQJ A;  3VEY A;  3CCM N;  5BRE A;  4IO9 L;  1VQO N;  4IOX A;  2QM1 A;  3VGL A;  3LDN A;  1W2B M;  4BE7 B;  4BRA A;  2CGL A;  1TUY A;  4BR5 A;  4JKH A;  4JAX A;  3ULE A;  3ZET B;  5BRF A;  3GOI A;  3CJB A;  3L6Q A;  3O8M A;  1KAY A;  3O9U A;  2JWK A;  3EZW A;  1YXQ A;  2ASM A;  4BG9 A;  3CJA A;  2Q0U A;  1SZ2 A;  2HST A;  3BP8 A;  1HPM A;  3J8A A;  1ATR A;  1KXP A;  2P9L A;  4BR7 A;  4NO7 A;  2ASP A;  2P9K B;  3CCS N;  2QWR A;  5AZI A;  2CGJ A;  1BWF O;  4DQ8 A;  1KC8 O;  3ZX2 A;  3F9M A;  3B8A X;  3CJ7 A;  5AZJ B;  2A3Z A;  2P9K A;  3L4Q A;  4K25 A;  4YOY A;  3DXK A;  3OW2 M;  2NZT A;  4CJ7 A;  4H0Y B;  4WFB L;  3WXL A;  5ADX H;  3FLC O;  3MN9 A;  4BR9 A;  2PFU A;  1QQO A;  3AGK A;  5I9E B;  3VEX A;  4CD3 A;  3H45 C;  3CF5 L;  2YJE A;  1HJO A;  2ZJP L;  3NVM A;  5GAE P;  3I8B A;  4RTF D;  5B8H A;  2QWP A;  5AQI A;  1VQM N;  4UY8 O;  2HBM A;  4DCH A;  3P4I A;  4BRG A;  3ID8 A;  1NGD A;  1ZC6 A;  4JD2 B;  2C1G A;  1GLE G;  3AAR A;  3CCL N;  2NRH A;  1X3M A;  4FWM A;  4IFE A;  4ILH A;  3EO3 A;  4A57 A;  4AM6 A;  4PHT X;  4JD2 A;  3OBY A;  2WC9 A;  3ENO A;  4FSV A;  3MCA B;  4AM7 A;  5GAH P;  2P9U B;  4CI6 A;  1YJW N;  3SJH A;  1VAZ A;  4DHY A;  3OBW A;  3LL3 A;  4WQ4 A;  4YOU A;  3O9Q A;  1YUW A;  2KKZ A;  2NRT A;  3E1Y A;  4CZF A;  2P9U A;  5C2F A;  2DPN A;  5BRD A;  3PIP L;  3G6E N;  5GIP A;  2E2N A;  1Q81 O;  1QQM A;  4R79 A;  2AP1 A;  5LJW A;  5F1X A;  1YVN A;  4A5B A;  1MA9 B;  1NM1 A;  4B1X B;  3CMA N;  4O5F A;  5M1K A;  3TSP A;  2V51 B;  1YJN N;  1T6C A;  3GG4 A;  2NRX A;  4ISF A;  3H6E A;  1T6D A;  5EVZ A;  2IIR A;  3OA9 A;  5M1O A;  1QHA A;  3LDQ A;  5JMV A;  1HKC A;  2E20 A;  2NNW A;  3MN7 A;  2KLA A;  4H03 B;  4IJN A;  4M7X A;  5GIO A;  3TTD A;  4CZG A;  4B1W B;  3F2K A;  2A42 A;  2HBL A;  1XUP O;  3MMV A;  3PIO L;  4WQ4 C;  3Q7C A;  2I7P A;  4EHT A;  2EWS A;  2YX6 A;  2GEL A;  4F9O A;  3CPE A;  2W41 A;  3CC7 N;  1Y64 A;  4FWS A;  4BRE A;  2FSK A;  2IVN A;  1HUX A;  3M6G A;  5GAD P;  3C0B A;  3VGK A;  3P39 A;  5BN8 A;  5AQK A;  1RFQ A;  2P9S A;  3CC4 N;  2W00 A;  4B1Z A;  5MLC Q;  3VOV A;  2QWM A;  2GTD A;  4GVE A;  1VQK N;  4HTL A;  4A5A A;  3GDQ A;  4FPB A;  3K9J A;  4BC2 A;  4C1N K;  3RSE B;  3W3D A;  1SQK A;  3FE1 A;  1U6Z A;  3DXM B;  3ID6 A;  3U4L A;  3GE1 A;  3D2F B;  2A6A A;  1M1K O;  5M1P A;  4JHD A;  2Q0R A;  3KK7 A;  3I55 N;  2C1I A;  3DXM A;  4QS7 A;  3WUH A;  4BRN A;  1NGG A;  2A41 A;  4JKC A;  2HOE A;  2QA4 N;  5H1S Q;  3HOT A;  2VGN A;  3VET A;  3A8Y A;  3KWI A;  4I6M B;  4YDU A;  3WXK A;  5CHI A;  3H3O B;  3ATU A;  2I7N A;  1BG3 A;  1YAG A;  4JKD A;  5BRH A;  3J7Z O;  2Q97 A;  4YOV A;  5BPL A;  2NLX A;  3R9P A;  1NLV A;  2E2Q A;  1XQS C;  4YOT A;  3KWG A;  2E1Y A;  1DEJ A;  2E88 A;  3L0Q A;  4CZJ A;  3QDK A;  5JLH A;  2CH5 A;  4KH4 A;  3EE8 A;  3MX5 A;  4M7Y A;  3ULE B;  4GV6 A;  3A5N C;  2HMP A;  3R1X A;  2GUP A;  5AQX A;  4KBO A;  3A5L C;  1DT9 A;  4LC9 B;  1VQL N;  2RE2 A;  3NMU A;  3O6W A;  2FLO A;  1MWM A;  5GIN A;  2GWK A;  5AQR A;  1NGF A;  1HKG A;  2PBD A;  4PKI A;  1XC3 A;  3MN6 A;  2E2O A;  3O1B A;  2P9L B;  5AQF A;  2ASO A;  1NWK A;  4YDU C;  3R8E A;  3ZYY X;  5AZI B;  3R6M A;  3HRG A;  4YOX A;  4CZK A;  4CZI A;  3M1F A;  1KD1 O;  3DXK B;  1JJ2 M;  2JWL A;  4C1N I;  4B1Y B;  3EL2 A;  4XH1 A;  1DKG D;  3D2E A;  4IOA L;  3VF2 A;  3WXI A;  3MWP A;  3QBX A;  4JKB A;  4BR2 A;  3C6A A;  4MO5 A;  3CER A;  3VTI A;  1S72 N;  2YHY A;  2CH6 A;  3U8X A;  4FWP A;  5AQS A;  2GX9 A;  1JCG A;  3JXU A;  3ZX3 A;  1GLJ O;  4XEI A;  4BRL A;  3VEZ A;  2GWJ A;  4EIA A;  4IEI A;  3AAP A;  5C2D A;  2IVP A;  2QEX N;  1OVY A;  3I33 A;  3IUC A;  4FL9 A;  1X3N A;  3H1V X;  4WYB A;  3HBT A;  4IO8 A;  3LDO A;  5E84 A;  4FO0 A;  3BF1 A;  3WT0 A;  3QB0 A;  4FWN A;  3ENH A;  3CC2 N;  4E1J A;  1K73 O;  1Z6R A;  1HX1 A;  4BQL A;  4J8F A;  2OTL N;  2WBN A;  4FOI A;  3MDQ A;  3N4P A;  3O9R A;  2GEM A;  1QQN A;  2F7T A;  4KH5 A;  3TSQ A;  5M1F A;  2ZJQ L;  4BR0 A;  3QML A;  1N8R O;  5AQU A;  4O8K A;  3F5T A;  2H3G X;  2W40 A;  3VER A;  2RHK A;  2QWO A;  1GLL O;  1CZA N;  2E2P A;  3S41 A;  4GV3 A;  1Z05 A;  5JIC A;  3E66 A;  3M5R A;  4PL8 A;  1BA0 A;  4Y0W A;  2P9I B;  3DJC A;  3RVC A;  4IDH A;  2HBJ A;  4BRF A;  2CGK A;  4JKG A;  3HTV A;  3C65 A;  2P9I A;  5CE3 A;  3ENB A;  3G25 A;  5BR9 A;  1BU6 O;  3HOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...