4PL7A

Structure of komagataella pastoris actin-thymosin beta4 hybrid
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
425
structure length
382
Chain Sequence
VAALVIDNGSGMCKAGYAGDDAPHTVFPSVVGSFVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRLAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYASGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYTFSTSAEREIVRDIKEKLCYVALDFDQELQTSSQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEASGIDQTTYNSIMKCDVDVRKELYSNIVMSGGTTMFPGIAERMQKELTALAPSSMKVKISAPPERKYSVWIGGSILASLGTFQQMWISKQEYDESDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein, contractile protein
molecule keywords Actin,Thymosin beta-4
publication title Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
pubmed doi rcsb
source organism Komagataella pastoris
total genus 126
structure length 382
sequence length 425
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01290 Thymosin Thymosin beta-4 family
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4pl7A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4pl7A01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4pl7A03
3BF1A 2NZTA 1BDGA 4BRAA 1SZ2A 3GDQA 3ZX3A 2P9NA 1BU6O 4JD2A 4H0YB 2ZF5O 5BN8A 4YDUC 3H46O 5AQFA 5F2RA 3O1BA 2PAVA 2V51B 3WXKA 4BGBA 4CD1A 2A6AA 4LC9B 3VF6A 4MLHA 4E1JA 3U9DA 4B1XB 4XH4A 1QQMA 3BP8A 1T6CA 4PKHA 3EN9A 3C7NA 3GL1A 3VETA 4XEIA 4IZ9A 3SK3A 2P9IB 2QWOA 1NGHA 4FPAA 3HBTA 4BR2A 3R8EA 1QHAA 4CZEA 5AZIA 4H0TB 3L0QA 1S3XA 3WXIA 2ASPA 2CH6A 3KHYA 1ATSA 4QS9A 4WQ5A 1HJOA 4K43A 3WXJA 4FOEA 2PBDA 3R6MA 5FPEA 2BUPA 1CZAN 4PKGA 1MWKA 4B1VA 2FF3B 1V4SA 4I6MB 4H0VB 1TUUA 2QWMA 1E4FT 4BC2A 1J6ZA 1LCUA 5AQKA 4FWPA 4DCHA 3VEYA 3EO3A 3J8AA 4RCHA 1XC3A 5AZJB 5E26A 4H0OA 3MN6A 2Q1NA 1Z6RA 5CE3A 3UKUA 3QFPA 3VEWA 4JAXA 3MCPA 2D0OA 4BVOA 3H1QA 4M7XA 4CJ7A 1NGCA 3L6QA 3I8BA 5AR0A 4FWRA 3UB5A 2A3ZA 5AQLA 4F9OA 4BRLA 1V4TA 5AQZA 2HF3A 2A41A 2I7NA 4BRFA 4CZFA 5BPNA 1SQKA 5BRFA 1QQOA 4JHDB 3ULEB 3ZEUA 3CQYA 3RSEB 1G99A 5EX5A 2AP1A 3BF3A 3D2FA 4BREA 4MLEA 3VGKA 3CJAA 1ATRA 3WQTA 4MO5A 1TYQA 1YVNA 4WQ4C 1YAGA 4O8KA 3FFKB 3IDHA 4FOIA 1KAXA 4IJNA 2BTFA 2CGKA 1BA1A 5AQTA 3IUCA 2ZGYA 3D7EO 3H3NO 2E2PA 1D4XA 1JCGA 5AQNA 3HTVA 2E1ZA 4H5RA 1YXQA 4BRGA 4J8FA 3QDKA 1XQSC 2F9WA 2QW9A 1BA0A 4CZLA 4O5FA 1NGIA 4JNEA 2P9SB 4NO7A 2P9LB 3S41A 1NGBA 3CJ7A 4RWTA 1Z05A 4CZGA 2E2NA 3QICA 4H5VA 3VERA 3QB0A 4CZJA 1U2VA 3ZX0A 3CJBA 1X3NA 5EY4A 2Q0RA 1IJJA 2YJFA 1K8KB 4WQ4A 2GEMA 3CERA 2QWLA 3VESA 2CGLA 2ZGZA 5AQQA 3VEVA 2P9KB 3ATUA 3FZMA 3O80A 3ZETA 1KAZA 2VCPA 3LM9A 2VYPA 4GNIA 1LOTB 3DWLA 3AY9A 4KBOA 4WQ5C 4A2BA 2GWKA 1GLAG 3LDNA 4M63C 4ISEA 2CH5A 5I9EB 4H5TA 3FE1A 2H3GX 3A5LC 3WEEA 4BGAA 5AQGA 2GWJA 5ELZA 4BG9A 1NWKA 2HMPA 3EL2A 4FWKA 2QWRA 3EZWA 4AM7A 1T6DA 2E8AA 4CD3A 4FWLA 1ZBSA 4PKIA 1T44A 3W3DA 5AQUA 3CJ9A 3M6GA 2P9UA 3QBWA 3TU5A 4WYBA 5FPNA 5BRDA 4EFHA 3KVGA 3O08A 1NGFA 5ADXH 1KAYA 3H3OB 5JICA 3UKRB 2Q36A 4CBXA 4IJAA 5AQWA 3VF2A 4DHYA 3AAQA 3UKUB 5LJWA 2Q97A 3ZX2A 1P8ZA 2E1YA 4BC4A 3B8AX 4IXCA 3O1WA 4Z94A 5BN9A 5JMVA 1DEJA 3GOIA 3IFRA 2AA4A 2GTDA 4AM6A 3R9PA 2I7PA 4FWNA 1IG8A 2CGJA 2IVPA 4PL8A 3EKUA 4L3QA 3I33A 3HSCA 1TUYA 1E4GT 2KHOA 1ZC6A 3DXMB 3A5OC 4HTLA 3BUZB 3WXLA 4BQZA 2J4RA 2FSJA 3D2EB 5BPLA 5F1XA 3MN5A 3UE5A 1TYQB 4BRPA 4Y0WA 3G25A 5AQRA 3QBXA 5AQXA 2NLXA 2OANA 1HUXA 1ATNA 3FLCO 4BR4A 1C0FA 4PL7A 4BVPA 4I6MA 1NM1A 4FL9A 4H03B 2P9PB 3CJ1A 1XUPO 4EHUA 3LDQA 4FWOA 3W0LA 3SMSA 3DXKB 5AZJA 3VGMA 3VENA 2A42A 4ISGA 1JCEA 3CHWA 3SMPA 5KPRA 3BEXA 3VEZA 2FSNA 1R59O 1NGAA 2UYTA 3MMVA 2E2OA 5AQPA 4IO8A 2HF4A 2QWQA 5AQMA 2P9NB 4JD2B 3SLCA 4B1UB 4BRMA 1GLCG 1BG3A 3C0BA 3O8MA 1KXPA 2E2QA 2IVNA 4JHDA 4A62A 3WEEB 4CBWA 4EIAA 3RSEA 1DKGD 2EWSA 4BR5A 4BRDA 4EHTA 4B1ZA 2QWPA 2FLOA 3IMXA 3SJHA 4JN4A 2ZWHA 3P4IA 3C7NB 3H45C 1BUPA 4FWMA 1S22A 2A40A 2QM1A 5BR9A 5AFUH 4QS8A 4B1YB 2ITMA 3VEOA 3WT0A 2FF6A 3VPZA 5AZIB 3FZHA 4BRKA 4BR0A 4EAHD 3OHRA 5LY3A 1WOQA 4C23A 2P9SA 3QFUA 4BRNA 3GE1A 5F0XA 2P9LA 4BC3A 2YJEA 5EXWA 5ADXA 3FZLA 1SAZA 3MDQA 3M3ZA 5AQHA 4BQLA 3L4IA 1GLLO 2ASOA 2DPNA 1NGGA 1JCFA 3VGLA 4BRQA 4B1WB 5AQOA 4H5WA 3WQUA 4FWSA 1K8KA 3A5NC 3ENOA 1ZXOA 5BPMA 2E88A 2P9KA 5AQIA 4FWQA 2V52B 3MN7A 4FPBA 2A5XA 3ENHA 3LDLA 1GLBG 1BO5O 1WUAA 2W41A 5FPDA 1MDUB 4FO0A 1OKJA 2VWBA 4M7YA 2YI1A 5AQJA 1HKGA 4A2AA 2QWNA 4CZMA 1MA9B 2GUPA 1HKCA 5BRHA 2YHWA 4ISFA 5AQYA 4RTFD 1DGKN 3H6EA 5KQDA 1QZ6A 4YDUA 2QXLA 1HKBA 5JLFA 1NMDA 2P9IA 3FR0A 2Q31A 3ZEUB 1NGEA 4CZHA 3D2FB 3CIPA 3LM2A 1HLUA 1X9JA 2IVOA 4DQ8A 5BREA 1GLFO 4XH5A 2ASMA 5B8HA 3FZFA 4QS7A 5KPTA 2Q0UA 2V7ZA 3VF4A 3AARA 2WUSA 3A8YA 4CI6A 3WUHA 3F9MA 3H1VX 4IWVA 1NGJA 3A0IX 3A5MC 3EKSA 3HM8A 3U9ZA 3UKRA 2HOEA 4BRHA 1H1VA 3O6WA 4CZKA 5KQ8A 3GBTA 4BR9A 3CETA 3O5BA 1QZ5A 1NBWA 4B9QA 5JLHA 5LJVA 1BOTO 4CBUA 4XH1A 2YHXA 1HX1A 3FGUA 4K41A 4A61A 4DB3A 3DJCA 3HI0A 3CQXA 5KPZA 3JS6A 4BG8A 4H5NA 4CZIA 4GY2B 5TKYA 5AQVA 1RDWX 2IIRA 2YCHA 3AAPA 1U2VB 1QQNA 2GELA 1NGDA 1RFQA 3CJCA 1Q18A 1HPMA 3DXMA 5EVZA 1RGIA 2V7YA 3FZKA 5AQSA 4BR7A 3D2EA 3ATVA 3ZETB 5EOYA 3DAWA 3ID8A 3LDPA 4K42A 4BRCA 4BRIA 1C0GA 4HWIA 3LDOA 1GLEG 3GG4A 2E20A 3VOVA 1MWMA 2FSKA 3O4WA 3ULEA 5AFUA 4MO4A 3VEXA 3HZ6A 1GLJO 5FPMA 2P9PA 5E84A 3JXUA 2Q2RA 1NLVA 2D1KA 2YHYA 3MN9A 4H0PA 1EQYA 3QMLA 1U6ZA 3MK6A 1GLDG 3DXKA 2NRHA 1Y64A 3U4LA 4BC5A 2FXUA 3M1FA 2W40A 4BROA 2D4WA 3CI5A 1ESVA 3U8XA 3TPQA 4FSVA 4H0XB 3KZBA 2D0PA 1X3MA 2P9UB 2F9TA 4K25A 1YUWA 3LL3A 4NB4A 1BWFO
chains in the Genus database with same CATH superfamily
3LZIA 2ATQA 3D45A 4X65K 2NZTA 3WXMB 1SZ2A 3E01A 2P9NA 1BCOA 4NYFA 4H0YB 4CHPA 4YDUC 4F8RA 3QIOA 4M42A 5AQFA 5FRMA 4RW7A 4U7BA 2OTLN 1FJGK 2V51B 3WXKA 4NCBA 3C6TA 5FRNA 3OYKA 4E1JA 2JWLA 4B1XB 5LMNK 1U48A 3BP8A 1C0TA 1T6CA 2ETJA 4FJMA 2YKNA 3C95A 2VWKA 1A5VA 2QWOA 3OYHA 1HYZA 3N4PA 3N4QA 1QHAA 1VQKN 3LP3A 3O3HA 4B8AB 2ASPA 3AA5X 3EYZA 3AO5A 4JS5A 3ZT2A 4WQ5A 4O0IA 1NKBA 5KRTA 1EXQA 4CEOA 4Z4HA 4PKGA 3NVMA 2FF3B 1TUUA 3I0SA 3L3UA 2WBNA 1XMOK 4C1NI 3OYCA 2HHQA 3EO3A 4RCHA 5AZJB 4IFYA 5E26A 4CEDA 4CEEA 3MN6A 3SUQA 5CYMA 1NK7A 5CE3A 3KKSA 3VEWA 2W6LA 4CJ7A 4O44A 2W6KA 5AR0A 2G8IA 1YF5L 5M1KA 2A3ZA 1R0AA 4F9OA 3DRSA 1C6VA 1EP4A 5AQZA 3CM5A 4ICLA 2XY8A 2A41A 2I7NA 4BRFA 4CZFA 3OYAA 3V9XA 1VQNN 1NG9A 4CESA 3CQYA 4G1QA 3RSEB 3D2FA 3BF3A 4BREA 1VSKA 3IS9A 4MQ3A 4Y1CA 1TKZA 3HVRA 3SQ1A 3WQTA 1VSDA 4MO5A 3F5TA 1TYQA 4DSEA 3P31A 1YAGA 3DLEA 4DV2K 2BTFA 5AQTA 4GMJB 2E2PA 3BZCA 2O4GA 5AQNA 4CJTA 5C42A 4BE7B 4LF7K 4H5RA 5KRSA 4J8FA 4HUFA 1XQSC 3QIPA 4DS4A 2QW9A 3S3MA 1BA0A 3QEVA 1C1AA 4JNEA 4NO7A 4KAZA 3AVCA 3S41A 1NGBA 4IBNA 2WONA 1RT6A 3QICA 1QVFM 4H5VA 3QB0A 3O9SA 1SS6A 3ITHA 4KO0A 5M1NA 1IBLK 4B08A 3VESA 3CERA 2KW4A 4DV6K 4J2BA 3CFPA 2P9KB 3FZMA 3O80A 3ZETA 4FJHA 4JKFA 4J2DA 2JLEA 3KWIA 2VYPA 4BE1A 4GNIA 4CF0A 2B4JA 3SV4A 2BDPA 4O0JA 4YOVA 3QESA 2CH5A 5DM6L 3WEEA 4KFBA 2X74A 1KCFA 3AVFA 3KK3A 4FYDA 3C6UA 4CF9A 3AVJA 1HNXK 2HMPA 1RT1A 4DSIA 3EZWA 1T6DA 4N41A 3EE8A 1OVQA 2VG6A 4B9LA 1G15A 3KD1E 3W3DA 3K58A 2IS3A 2VQEK 3TARA 1RTJA 1XHZA 1NK6A 1RDAA 4EP4A 1YT3A 1Q9YA 1RTHA 1S6QA 2D0AA 3OA9A 5BRDA 3KVGA 2QA4N 1OH6A 2G8HA 1HQUA 4WE1A 5C15A 4DFMA 5JICA 4IJAA 1VSLA 3UKUB 3ZX2A 1P8ZA 2QXFA 4IXCA 3NGYA 3HXMA 4Z94A 2UUCK 1DEJA 1LWEA 2I7PA 1FKPA 4FWNA 3SJJA 4FJGA 1IG8A 4KI6A 4M3YA 4FK2A 2IVPA 3LP2A 3EKUA 2VWJA 5M1PA 3F73A 4DTSA 2WTUA 1E4GT 1JLCA 1IH7A 1N36K 3MWPA 4HTLA 3BUZB 3WXLA 3ENBA 4BQZA 2NRVA 1BISA 5BPLA 3MN5A 2RHKA 3DRPA 1VK0A 1ASWA 4FJKA 2HHXA 1S1WA 3P39A 1ATNA 4BR4A 4I7FA 4DWIA 3CD6N 3KJVA 1RTDA 4KI4A 1S9EA 4CHYA 1S1UA 1VSEA 1NM1A 1IKYA 2P9PB 3AO3A 3O9TA 2IGIA 3LDQA 4BDYA 3LPTA 4LY7A 1TAUA 1VQ8N 1KFSA 4M3ZA 2G8FA 1RDBA 3TTCA 4EZ6A 5AZJA 5DM7L 2A42A 1HYVA 1JCEA 4W5QA 3CHWA 3PX6A 5EU7A 5HLFA 5CZ2A 4PY5A 3KIOA 3DYAA 4DTMA 4KKOA 4IO8A 2YNFA 2QWQA 4IG0A 3OTOK 1C0UA 4CFCA 1W9HA 4BECA 1K9MO 1GLCG 3C0BA 2HMIA 3BGRA 3T1YK 4CBWA 4EIAA 4OPJA 4A5BA 1KLMA 3RSEA 1D9DA 5CY4A 3DLRA 4Q0BA 3SJHA 2KLAA 5CR4A 2IDOA 3HM9A 3UIQA 2A40A 2Y1IA 4FCYA 1K73O 5J2QA 4DV4K 3VPZA 3DLHA 4CJFA 2G8UA 1WOQA 4C23A 2P1JA 5CYQA 5F0XA 5GIOA 4RW8A 1O13A 5ADXA 5JVGL 4CK1A 3T19A 4CGHA 1CZBA 1WSGA 3M8SA 4B1WB 5AQOA 3CYMA 3A5NC 4KV8A 3AVAA 3CPEA 3AA2A 3ENOA 2YNHA 4CGFA 5BPMA 1SKWA 1HNZK 2P9KA 4FWQA 2P5GA 4FPBA 1CLQA 4DR4K 4HHTA 1BO5O 5FPDA 4ZHRA 4KH5A 4A2AA 4DQPA 4JI2K 1N33K 4DTUA 4W5TA 2GUPA 5BRHA 1HKCA 2YHWA 5AQYA 2GUIA 4ILJA 4CCHA 2QXLA 1UA0A 3QNOA 1U47A 4PHTX 1Q9XA 1NGEA 4DTOA 4KHWA 3LPUA 3LM2A 4K0KK 4O5BA 2IVOA 3NBPA 4DQ8A 1QSSA 3AA3A 4M3RA 3VQDA 3FZFA 4QS7A 4NXNK 1XNQK 2UXCK 3A8YA 4F4KA 4FZZA 3V4IA 4CEFA 2XY7A 3TANA 1NGJA 2O8CA 2HB5A 4DR3K 2HOEA 2X78A 4BRHA 3O6WA 5KQ8A 1QZ5A 1SUQA 4B9QA 5JLHA 5LJVA 1NKEA 4CBUA 5C12A 4DB3A 3CQXA 3MEEA 1IBMK 3SUPA 2OZSA 2IIRA 1QQNA 2GELA 4DF8A 4AF1A 4JYAK 4JEPA 2GBZA 5AQSA 3SUNA 1FXXA 4W5OA 4OO1J 3EY1A 2HHTA 2OPPA 4C1NK 3P1GA 3LDPA 3SUOA 2QKKA 3RWUA 3LDOA 4DQQA 2E20A 5FROA 3G6EN 2FSKA 5AFUA 4MO4A 3HZ6A 1GLJO 3AVHA 4AHRA 3MX5A 4DFJA 3OYIA 5FPMA 4FZYA 2P9PA 2QEXN 5M1OA 1EWRA 4M41A 3VTHA 4CIEA 4M3UA 2OYQA 1U6ZA 4I9LA 1Y64A 3QEIA 5HROA 4JKCA 3E9PA 1LV5A 3CI5A 1ESVA 1VQ4N 2KTQA 1W7AA 4O4GA 2ZE2A 2P9UB 4NB4A 1BWFO 3VMFB 3PSFA 1ZBHA 3GDQA 2UU9K 3ZSWA 3OBYA 2ZF5O 3OY9A 2O8FB 4JKGB 4E89A 2PZSA 2Z1IA 3ISNC 1QE1A 5F2RA 3O9QA 4BGBA 4CIGA 1QQCA 3SV3A 4MLHA 4I9QA 5C2DA 3DLLL 1EWQA 3RR7A 3SNNA 4YOUA 1L3SA 2UUAK 3LDSA 3CFRA 5SZTA 3HBTA 3LAKA 1WBBA 1VQMN 1CZ9A 3KLIA 4H0TB 3TAPA 1S3XA 2CH6A 3KHYA 4QS9A 3THXA 1YTUA 2PYJA 3L8BA 5TKWA 4ZTFA 3OYEA 1UWBA 1IV0A 2BUPA 3CCSN 1HR0K 1V4SA 4H0VB 3V9ZA 1NU0A 2QWMA 1RBRA 2Z1GA 1E4FT 4BC2A 4YORA 4CF2A 4GV3A 1LCUA 4BWJA 4DCHA 4YOYA 3NFAA 3CCJN 3J8AA 1XC3A 4YOXA 1O1WA 3C6HA 3LWMA 1Z6RA 4Z4EA 3ASMA 3QFPA 4JAXA 3MCPA 4BVOA 3VQ6A 4M7XA 2NRWA 4LFAK 1NGCA 4I2QA 4FWRA 3UB5A 3DM2A 3ZYYX 5C25A 4BRLA 3DOKA 4AHUA 4E0DA 4FJXA 1V4TA 4MDBA 1M90O 1RT5A 3HO1A 2Z1HA 4DSFA 1G99A 4Z4IA 4MLEA 2RN2A 1HNVA 1ATRA 3TAMA 4FJLA 1QTMA 4DR5K 4O8KA 3NAEA 3FFKB 3IDHA 4M3XA 1KAXA 2CGKA 2O8BB 2C1IA 3H3NO 1D4XA 3THYA 4CJLA 4CK2A 3TAFA 2E1ZA 4KH4A 3E9OA 3VA3A 4B3TK 1NGIA 4JI6K 1WBDA 2P9LB 1Z26A 2HNYA 2E2NA 3HPGA 1IJJA 1K8KB 4WQ4A 3SCXA 2ZGZA 3AO4A 3VEVA 3R1XA 1KAZA 1QSLA 4KHYA 4JI4K 4EZ9A 3DWLA 3AY9A 4CJKA 5J2NA 2F8SA 2GWKA 4FLYA 3LDNA 4FLZA 4M63C 4E7IA 3V81A 2BH1A 4ISEA 5I9EB 4DTNA 4H5TA 3FE1A 4YOTA 3A5LC 2ZJQL 4LF4K 1T3VA 3PX0A 5ELZA 1TK8A 3E66A 4E19A 2UXBK 4FWKA 1VSHA 1VSFA 4AM7A 3OYGA 1SKRA 2UXDK 3HYFA 4W5RA 5AQUA 3CJ9A 3M6GA 4LH5A 4DV5K 3VQPA 1L5UA 2C1GA 3THWB 2P9UA 3QBWA 4GV9A 4DSKA 3DLKA 3TU5A 1RDUA 3VQBA 1TK0A 5FPNA 4EFHA 1HRHA 3ZSQA 3OJUA 5ADXH 5FDLA 4IDKA 3CQ8A 4Z0UA 3RR8A 3UKRB 2O8FA 3AAQA 4JKGA 3L2VA 5GADP 3D0PA 2Q97A 3OS2A 1X9WA 3O1WA 4KRFA 5BR8K 5BN9A 5JMVA 3IFRA 4AM6A 2GTDA 3R9PA 3B6OA 4E7LA 4CJ3A 2CGJA 4PL8A 3HPOA 3LANA 1TUYA 4IEEA 2KHOA 2KQ2A 1KFDA 3PX4A 5M1QA 3NVKA 1KVAA 1L3VA 2FSJA 3D2EB 1BI4A 5F1XA 3UE5A 4U67L 3MAQA 4KPYA 4B9MA 5I3UA 5AQRA 3QBXA 1A5WA 3G71N 4F2SA 1WSIA 3OBWA 5I42A 4CFDA 2OANA 1HUXA 3K59A 2OA8A 4GW6A 3KK1A 4JI1K 2G8VA 3LP0A 4ZTJA 2HBMA 4JRQA 1JL1A 3DXKB 4Y1DA 4DU4A 3VENA 4ISGA 3JYTA 4KTQA 5K14A 5KPRA 3RTVA 3BEXA 2ZM6K 3VEZA 3MMVA 4M3TA 1HNWK 1RDCA 1LAVA 2F7TA 4E1NA 5E41A 1D8YA 3C6AA 4JD2B 4CEAA 5JS2A 4FJ5A 3SLCA 4B9TA 4BRMA 4O55A 4KHNA 3O8MA 4PWDA 4FJNA 2E2QA 2IVNA 4JK8A 1ASVA 4DV0K 4B3MK 3PLAA 4YNQA 4B1ZA 2FLOA 2X6NA 3CCQN 1ITGA 4JI7K 3H45C 2HNDA 2E6MA 3I55N 4BEBA 2O8BA 4FW2A 5AFUH 2ITMA 3VEOA 3WT0A 1XMQK 1P90A 5AZIB 3FZHA 3VQ4A 4JI5K 4KHQA 1JLBA 3VQEA 1FKOA 5LY3A 3SBGA 3SQ0A 4DQRA 2P9LA 1NK8A 3ZSXA 4WFNL 2NRXA 4QOZB 2ZQBA 3FZLA 3QERA 4V19S 3VN5A 4DSLA 3ZSOA 1BQNA 2DPNA 5DK5A 5KGWA 1NGGA 1JCFA 2FC0A 4FLTA 3WQUA 1K8KA 4B9VA 1JLEA 1UA1A 4C8OA 4Z4GA 3S3NA 4ID1A 4FLWA 5GAEP 3KLGA 4GKKK 2WOMA 3IKMA 3TSQA 2YI1A 1UAXA 3QNNA 2QWNA 5SWMA 3HPHA 3OS0A 2PY5A 2NRTA 4CW7B 4RW9A 4RTFD 2VQFK 4YDUA 1J54A 1HKBA 1N5YA 4CJEA 4BDZA 3FR0A 2Q31A 1NNEA 2RPIA 3THWA 3CC2N 1HLUA 4XH5A 2ASMA 3PUFA 3RRHA 2Q0UA 2V7ZA 3VF4A 1TGOA 3AARA 2WUSA 4CJ5A 1BGXT 1HNIA 4CI6A 1JKHA 3DLGA 3H1VX 4IWVA 2O8EB 1VQ7N 1I3AA 3UKRA 3HM8A 3U9ZA 4GVEA 2Z1JA 1EO1A 1WN7A 4OPAA 4CZKA 4AH9A 3GBTA 3CETA 3O5BA 1NBWA 3O4NA 1WB9A 4K41A 3WNGA 3HI0A 4WFBL 5GIPA 5JS1A 1L3TA 2O4IA 1RDWX 1OH7A 1U2VB 5C10A 1NGDA 2FBVA 5EVZA 1RNHA 4FVMA 3ZT1A 2KKZA 3FZKA 4OGCA 4AHVA 3D2EA 3ATVA 1M1KO 1TK5A 3DAWA 3DLBA 4BRCA 3RVCA 2RF2A 2YNGA 3PY8A 4HWIA 1BQMA 2FBTA 3K9JA 3VOVA 1MWMA 2G8KA 2HHHK 1SV5A 5M1FA 5E84A 3I56N 1NLVA 2D1KA 2YHYA 4AHSA 3MN9A 4H0PA 1B92A 3QMLA 5JENA 4FLUA 3DXKA 3PSIA 1ASUA 4BC5A 2FXUA 1S1XA 3IRXA 3P83D 4FJJA 2D4WA 1HQEA 3K5NA 4UY8O 2BGGA 4RW4A 4FSVA 3CM6A 4CJVA 3V1OA 4W5NA 3G10A 1X3MA 3TSUA 4K8ZA 2HVHA 2F9TA 2GV9A 4K25A 1YIJN 1WSJA 1J53A 4IFEA 3BF1A 1NK9A 4DLEA 4BRAA 4KB0A 1T03A 1BU6O 4JD2A 3AGRA 5BN8A 3SPYA 4CEQA 2YNIA 3H46O 4DG1A 1X9SA 4KB1A 1HJRA 3NGIA 4ID5A 2A6AA 4LC9B 2FBYA 3HOSA 2KFNA 4IKFA 4LD0A 1K6YA 3AO2A 4XH4A 4FJ7A 3R3LA 3VETA 4PKHA 1Y97A 3GL1A 2DFEA 3V9SA 4X66K 2X6SA 4LSLA 3SK3A 2P9IB 1L3UA 1NGHA 4CHQA 2P5OA 2HBLA 2HBJA 3JAMO 4BR2A 3R8EA 4AHTA 1E3MA 2IC3A 5AZIA 3L0QA 5GAGP 3CMEN 3WXIA 4LH4A 4HUEA 3QO9A 4FOEA 3O4QA 1QVGM 1MWKA 3SAHA 3QETA 2R7YA 2HHWA 1MU2A 2LSNA 2ZJPL 4NCGA 4FWPA 1RT4A 3OYBA 4E72A 3VEYA 5J1EA 4FW1A 1Q81O 4B3OA 1Q7YO 3J81O 4H0OA 3TR8A 1W2BM 4C8LA 1J5EK 5HRNA 3UKUA 3PO5A 3NH1A 3H1QA 1JLAA 1KRPA 3OW2M 1NJYA 4CHNA 4JRPA 1JLGA 4IO9L 3SQ4A 4KTZA 4DS5A 1SL0A 5BPNA 1QQOA 4JHDB 3ULEB 4C8NA 5EX5A 2AP1A 3EEQA 1QS4A 3VGKA 2EX3A 3MXJA 4CGDA 1VRUA 4DKWA 5KTQA 1NJWA 4WQ4C 4FOIA 4IJNA 4HCCA 2O8DB 3PV8A 4BE2A 1BA1A 2NRZA 3OYMA 2ZGYA 1S6PA 3D7EO 5LMUK 2O8EA 1TKTA 3NF9A 3T3FA 3MEGA 3CCLN 5JVHL 1U4BA 4YY3K 1T8EA 3T1AA 4CECA 4CZLA 2P9SB 5H1SQ 1EX4A 1IKXA 4RWTA 4A5AA 1NK4A 2XY6A 1Z05A 3E9LA 4CZGA 4E7KA 3VERA 3K0SA 1HMVA 4CZJA 1U2VA 3ZX0A 3J7YP 2E4LA 5EY4A 2Q0RA 3AVBA 4B9NA 2E6LA 2QWLA 1XWLA 5AQQA 2YKMA 5HRPA 3KLHA 2PYLA 3LM9A 1N6QA 1W0HA 3T1HK 4WQ5C 3VQ8A 4A2BA 4M45A 2GX9A 2JWKA 1RCHA 1ZBLA 3U3GA 4BG9A 5CHIA 1ZBUA 4JKBA 1TKXA 3EL2A 2DY4A 3K5OA 2E8AA 4CD3A 4FM2A 4FWLA 3NF8A 1NJIO 1VSIA 4X64K 4I2PA 1VSJA 2RKIA 1VQ5N 4ILGB 5T7BA 3KLEA 3Q7BA 2Q3SA 5KI6A 2HBKA 3D6RA 5GAHP 3AVNA 3O08A 1N32K 1KAYA 3H3OB 2VGNA 3HP6A 3LP1A 4OKEA 2Q36A 5AQWA 3VF2A 4CGJA 4CFBA 3VQ5A 5LJWA 2E1YA 4BC4A 1ZYQA 3B8AX 3V6DA 2OCEA 4JS4A 4K8XA 4DTXA 3L2QA 1LWFA 2AA4A 2VG5A 3VA0A 3EZ5A 4L3QA 4CHZA 1RBVA 3TTDA 3I33A 1TAQA 3DXMB 4FJ9A 2J4RA 5FLXO 4H4OA 2F96A 3M8RA 1TYQB 4BRPA 3NCIA 4DU3A 3RRGA 4GVMA 3VQQA 1Q86O 4LF9K 3CG7A 1U04A 1S1VA 3S3OA 1ILYA 4PL7A 1N34K 1VQLN 4CIFA 2W42A 1OVYA 2HNZA 4BVPA 4KHPK 3ZCMA 4JKAA 4OKKA 4FL9A 4ELUA 4H03B 2AJQA 3PO4A 2OPRA 1XUPO 4KHSA 1BCMA 1NK5A 3P38A 3W0LA 1QSYA 4NCAA 3ZLJA 4H4MA 4LSNA 4IG3A 4JKDA 4JI3K 2FSNA 1NGAA 2E2OA 3G4SN 4L8RB 4DV3K 1XI1A 2HF4A 4LFCK 1A5XA 5AQMA 4BWMA 3AVMA 4FVUA 1TKDA 2RE2A 1RT7A 4F3TA 3AGKA 4C8KA 1VQ9N 4N56A 3F9KA 1BG3A 3ID6A 5CZ1A 1KXPA 4JHDA 4A62A 3WEEB 1RBUA 1RBSA 2EWSA 2OPQA 4BR5A 5J2MA 4BACA 3KTQA 4BRDA 4EHTA 4LF5K 4LFBK 1S5JA 2P51A 2ZWHA 3P4IA 3C7NB 1LW2A 1BUPA 4CJUA 4FWMA 3SPZA 3J7AP 2O8DA 2QM1A 1D5AA 5BR9A 4FLXA 3LAMA 3KK2A 4CE9A 3OYNA 4JKHA 4BRKA 4EAHD 2P9SA 3QFUA 4BRNA 3GE1A 4RW6A 2YJEA 1WSHA 1SAZA 3M3ZA 1RTIA 5AQHA 2OTJN 4BQLA 1WSEA 3VQ9A 2ASOA 3VGLA 4BRQA 1TL3A 4H5WA 4DR1K 1C1CA 1ZXOA 4JLHA 2E88A 2V52B 4B9UA 3MN7A 3S9HA 3NMUA 3ENHA 1KTQA 4OLBA 4YOWA 2W41A 3HSTB 3TTFA 3HL8A 4O8UA 2A1SA 2B6AA 2VWBA 3NF7A 2FBXA 1KSPA 4EP5A 5AQJA 1NOYA 3IAYA 2KZMA 1MA9B 2W00A 1BHLA 4ISFA 4M3WA 4B3RK 3P5JA 1DGKN 5KQDA 1VRTA 4CGGA 3NDKA 4B3SK 3ZEUB 1KC8O 1KQSM 3WNEA 2DTUA 3CIPA 3SAFA 2YHBA 4HTUA 5BREA 4H8KA 1GLFO 5B8HA 1OH8A 1JL2A 5KPTA 3A0IX 1WLJA 2QKBA 4WCEL 3SZ2A 1U49A 4A57A 4BR9A 4FJ8A 3TSPA 1BOTO 1KVBA 1XC9A 1T7PA 4YHHK 1HX1A 3FGUA 4N5SA 4DV7K 3DJCA 4KTWA 1NMNA 4CJWA 3CCRN 3BDPA 4GV6A 5TKYA 5AQVA 2VG7A 2YCHA 3H08A 4J2AA 2A1RA 1YJWN 3O9RA 3CJCA 3DXMA 1WNSA 4NLBA 4R79A 1RGIA 4CJQA 4BR7A 3OYFA 3KWGA 5EOYA 1X1PA 3RMAA 3NF6A 3NH0A 2QI2A 1C0GA 1GLEG 4F2RA 3LWLA 4PA1A 3A2FA 4OPKA 2HHUA 1B9DA 4BY9C 3NGZA 4E1MA 1I39A 2WFBA 1Z25A 2NRHA 3U4LA 3M1FA 2BE2A 2W40A 3KK7A 1EKEA 4CJ4A 4H0XB 3KZBA 2D0PA 4IOAL 3S5TA 5HRRA 3ZSYA 1S9GA 3LL3A 4KBOA 3LZJA 1BDGA 4YFUA 5J2PA 2G8WA 3ZX3A 1FW6A 2F4VK 3MEDA 1DTQA 4FK0A 3O1BA 2PAVA 1BL3A 2OPSA 3WNHA 4FXDA 4CD1A 3VF6A 4CEZA 3L2RA 3U9DA 1I94K 1QQMA 3EN9A 3C7NA 4XEIA 3OYLA 4IZ9A 4N76A 1GOCA 2NNWA 2HW3A 4FPAA 3HRGA 1KLNA 3CYGA 3T69A 3T7ZA 4CZEA 3HT3A 3IG1A 4DUYK 2NUBA 1ATSA 4DFPA 1HJOA 4K43A 3TAQA 3WXJA 1Q8IA 2PBDA 3R6MA 5FPEA 3C94A 2QK9A 3CF5L 1CZAN 4JK9A 2O8CB 4B1VA 4PQUA 3O9UA 2ITGA 4CFAA 4I6MB 3AA4A 4IOXA 4XIUA 1J6ZA 1B9FA 3EE9A 5AQKA 3SBTA 1X9MA 3E1YA 4FJIA 3ZT3A 2ZJRL 4IDHA 2Q1NA 4TSXA 1QHTA 1DT9A 3K2PA 2JGUA 3HVTA 2D0OA 3RMCA 1CXQA 1YJ9N 3CC7N 3AVGA 4CK3A 3L6QA 3I8BA 3L2UA 2D5RA 3U3YA 1IKWA 1ZBIA 4MFBA 2WC9A 5AQLA 3VQ7A 1NJXA 4FZXC 3M8PA 2HF3A 5MLCQ 5C0YA 1SQKA 4Q5VA 1LAWA 5BRFA 3ZEUA 5D3GA 1NKCA 5A2QO 3CJAA 5C2FA 5HL7L 1WSFA 1SL1A 1YVNA 3DRRA 3IUCA 3KD5E 3ZT4A 4E3SA 2XO7A 1JCGA 3HTVA 2B5JA 4PUOA 1YXQA 4BRGA 3ZSRA 1W97L 3QDKA 2F9WA 4CGIA 4WFAL 1YTAA 4O5FA 1IKVA 3CJ7A 1CXUA 1IG9A 2D0BA 1YI2N 3PIPL 1XNRK 2EHGA 3L3VA 1RBTA 4Z4FA 2ZD1A 1X3NA 3CJBA 2YJFA 1U45A 2GEMA 2CGLA 3I0RA 4CJPA 2YX6A 3ATUA 3WNFA 3DI6A 3CXCM 1VQPN 4IEIA 4OX9K 3TAEA 2VCPA 3L4QA 3J7ZO 4F3OA 1LOTB 4DSJA 3MXIA 1JJ2M 1GLAG 1WAFA 2H3GX 4A59A 1J9AA 4BGAA 4B9SA 1TVRA 5AQGA 2GWJA 4KHUA 4JK7A 1DTTA 1NWKA 5C24A 2QWRA 3THXB 3QLHA 4MDAA 4OLAA 1ZBSA 4PKIA 1T44A 3HP9A 4RG8A 3DMJA 4OPHA 4X62K 3TABA 2BANA 5DMRA 1K8AO 4CJRA 3QEPA 5HOOA 4UQGA 4WYBA 1NGFA 3QEWA 4Z4CA 3G0ZA 3U6FA 4C8MA 2D0CA 1IBKK 4CBXA 4DHYA 1SKSA 3NHGA 3GOIA 3FFIA 3V1RA 3PIOL 1BIUA 4G9ZA 1VAZA 5HRSA 3HSCA 3MWTA 1J5OA 1C1BA 3L2WA 1ZC6A 2HVIA 3A5OC 1C0MA 4DUZK 3M8QA 1WAJA 3TAGA 2PFUA 2Y1JA 1F21A 2HHVA 1SL2A 4CJSA 4DQIA 1RDDA 2VGMA 4Y0WA 3G25A 4DQSA 4JI0K 5AQXA 4HCBA 2NLXA 4DTRA 3ALYA 3VQCA 3FLCO 1C0FA 1NK0A 3THYB 3BY5A 3CCVN 1DLOA 2OZMA 4I6MA 1FK9A 4N47A 3CJ1A 4EHUA 4DR7K 3BZKA 4FWOA 4KREA 3SMSA 3HK2A 2YV0X 3VGMA 4CF8A 4ELVA 1RILA 2DFFA 1REVA 3SMPA 4HUGA 4FK4A 4NXMK 1R59O 1HPZA 2UYTA 2XRIA 3AO1A 5AQPA 4CERA 4E7HA 3CC4N 3Q7CA 2DFHA 3SI6A 2P9NB 3MX2A 3K5MA 4LF6K 3AVLA 4B8CA 4B1UB 3NE6A 5AJ3K 3DOLA 4ILHA 4DLGA 1IO2A 3HOTA 2XHBA 3OJSA 3VQAA 1DKGD 1EETA 2QWPA 2E5LK 3IMXA 4JN4A 3MECA 1VQ6N 1JXEA 2IOCA 1ZBFA 1S22A 4XJXA 4QS8A 4B1YB 4JKEA 2FF6A 4CHOA 1YJNN 4OKJA 1S1TA 1Q82O 4BR0A 3K57A 3OHRA 3RMDA 4FM1A 4DR6K 3I8DA 3RMBA 1D9FA 3V9WA 4BC3A 5EXWA 2QTDA 3MDQA 4IFVA 4AHCA 4E7JA 3OYDA 4DMNA 3AVKA 2IAJA 3L4IA 1GLLO 3ZSVA 1BIZA 5KGXA 4QAGA 1VHXA 4FWSA 1TV6A 4QCLA 5AQIA 3M5RA 3KLFA 4CEBA 2A5XA 4FLVA 4ELTA 3LDLA 4OJRA 4DFKA 1GLBG 4DF4A 1NOZA 1WUAA 2HHIA 3LALA 3TI0A 3SAGA 1MDUB 2NRRA 4FO0A 1OKJA 4M7YA 4DTJA 1HKGA 3ULDA 1LW0A 4CZMA 4CF1A 3ZSZA 1BI4B 1KVCA 3CCMN 4NYNA 3H6EA 3CPWM 1QZ6A 3C65A 3O3FA 3V9UA 4OGEA 5JLFA 2HSTA 1NMDA 2P9IA 3HJFA 4CZHA 3D2FB 3OYJA 3AV9A 1N8RO 4DTPA 4BDPA 3QINA 4GKJK 4HVJA 1T05A 1X9JA 1VSMA 1RT3A 3WUHA 3AVIA 3F9MA 3JSMA 1KD1O 3A5MC 3EKSA 4LF8K 1H1VA 5LL6Z 1YITN 3K9KA 3SYZA 5HBMA 2KFZA 1JXBA 3TWHA 4XH1A 2YHXA 4OVLA 4A61A 4J2EA 3J80O 3MCAB 4DR2K 5KPZA 3JS6A 3KKRA 4BG8A 4BE0A 4H5NA 4CZIA 4GY2B 1UOCA 3AAPA 4R5PA 3F2KA 3B6PA 4CVNE 5GINA 1RFQA 3CCUN 1YVUA 1Q18A 1HPMA 1NJZA 1GOAA 2HHSA 2V7YA 1S72N 3NH2A 3ZETB 3SQ2A 3K5LA 4IOCL 3ID8A 4K42A 3CMAN 4BRIA 1TL1A 3OVNA 4KH6A 3GG4A 3THVA 1GOBA 1LWCA 3MXMA 3O4WA 5IWAK 3ULEA 1YHQN 3VEXA 3OS1A 4NLCA 2I5JA 3JXUA 2YHAA 4DU1A 3O3GA 2Q2RA 1VQON 1OH5A 2F8TA 1EQYA 3VTIA 4FM0A 2KZZA 5HP1A 1JLQA 4JI8K 3V1QA 3ZT0A 3MK6A 1GLDG 3QEXA 3CCEN 2UUBK 3CFOA 4AILC 1HYSA 1RT2A 4BROA 3U8XA 4AQYK 3TPQA 2XY5A 1XHXA 4DV1K 1JLFA 4WF9L 1YUWA 5IT9O 4JV5K
chains in the Genus database with same CATH topology
3VMFB 4IFEA 3BF1A 2NZTA 1BDGA 3WXMB 4BRAA 1SZ2A 3GDQA 3ZX3A 2P9NA 1BU6O 3OBYA 4JD2A 3AGRA 4H0YB 2ZF5O 5BN8A 4YDUC 3H46O 4JKGB 5AQFA 5F2RA 3O1BA 4U7BA 2OTLN 2PAVA 2V51B 3WXKA 3O9QA 4BGBA 4CD1A 2A6AA 4LC9B 3VF6A 4MLHA 5C2DA 3HOSA 4E1JA 3U9DA 2JWLA 4B1XB 3DLLL 4XH4A 1QQMA 3BP8A 3R3LA 1T6CA 4PKHA 3EN9A 3C7NA 3GL1A 3VETA 4XEIA 4YOUA 4IZ9A 3SK3A 2P9IB 2QWOA 1NGHA 2NNWA 2HBLA 4FPAA 2HBJA 3HBTA 3N4PA 4BR2A 3N4QA 1QHAA 3HRGA 3R8EA 1VQKN 1VQMN 3T69A 3T7ZA 4CZEA 5AZIA 4H0TB 3L0QA 5GAGP 1S3XA 3WXIA 3CMEN 2ASPA 2CH6A 3KHYA 1ATSA 4QS9A 4WQ5A 1HJOA 4K43A 5TKWA 3WXJA 4FOEA 2PBDA 3R6MA 5FPEA 2BUPA 3CF5L 1CZAN 4JK9A 3CCSN 4PKGA 1QVGM 1MWKA 4B1VA 3O9UA 3SAHA 3NVMA 2FF3B 1V4SA 4I6MB 4IOXA 4H0VB 1TUUA 2QWMA 1E4FT 2WBNA 4BC2A 2ZJPL 4YORA 1J6ZA 4C1NI 4GV3A 1LCUA 3EE9A 4FWPA 5AQKA 4DCHA 3SBTA 4YOYA 3CCJN 3VEYA 3EO3A 3E1YA 3J8AA 1Q81O 4RCHA 1XC3A 5AZJB 4YOXA 5E26A 1W2BM 4H0OA 3C6HA 2ZJRL 1Q7YO 3MN6A 4IDHA 2Q1NA 1Z6RA 5CE3A 1DT9A 3UKUA 3QFPA 3VEWA 4JAXA 3MCPA 2D0OA 4BVOA 3H1QA 4M7XA 4CJ7A 2NRWA 1YJ9N 3CC7N 1NGCA 3L6QA 3I8BA 5AR0A 4FWRA 3OW2M 1YF5L 3UB5A 5M1KA 2WC9A 2A3ZA 5AQLA 3ZYYX 4F9OA 4BRLA 4IO9L 1V4TA 5AQZA 2HF3A 4MDBA 5MLCQ 5C0YA 1M90O 2A41A 2I7NA 4BRFA 4CZFA 5BPNA 1SQKA 1VQNN 5BRFA 1QQOA 4JHDB 3ULEB 3ZEUA 3CQYA 3RSEB 1G99A 5EX5A 2AP1A 3BF3A 3D2FA 4BREA 4MLEA 3VGKA 3CJAA 1ATRA 5C2FA 3WQTA 4MO5A 3F5TA 4DKWA 1TYQA 5HL7L 1YVNA 3P31A 1YAGA 4O8KA 4WQ4C 3FFKB 3IDHA 4FOIA 1KAXA 4IJNA 2BTFA 2CGKA 1BA1A 2NRZA 3IUCA 5AQTA 2ZGYA 2C1IA 3D7EO 3H3NO 2E2PA 1D4XA 1JCGA 5AQNA 3HTVA 3CCLN 5JVHL 4BE7B 2E1ZA 4H5RA 1YXQA 4KH4A 4J8FA 4BRGA 1W97L 3E9OA 3QDKA 1XQSC 2F9WA 2QW9A 1BA0A 4WFAL 4CZLA 4O5FA 1NGIA 4JNEA 2P9SB 4NO7A 5H1SQ 2P9LB 3S41A 1NGBA 3CJ7A 4RWTA 4A5AA 1Z05A 3E9LA 1YI2N 3PIPL 4CZGA 2E2NA 3QICA 1QVFM 4H5VA 3VERA 3QB0A 3O9SA 4CZJA 1SS6A 1U2VA 3ZX0A 5M1NA 3CJBA 1X3NA 5EY4A 2Q0RA 1IJJA 2YJFA 1K8KB 4WQ4A 2GEMA 3CERA 2QWLA 3VESA 2CGLA 2ZGZA 5AQQA 3VEVA 2P9KB 2YX6A 3R1XA 3ATUA 3FZMA 3O80A 3ZETA 4JKFA 3CXCM 1VQPN 4IEIA 1KAZA 3KWIA 2VCPA 3L4QA 2VYPA 3LM9A 4GNIA 3J7ZO 1LOTB 3DWLA 3AY9A 4KBOA 4WQ5C 4A2BA 2GWKA 1GLAG 3LDNA 2GX9A 4M63C 1JJ2M 4YOVA 2BH1A 2JWKA 4ISEA 2CH5A 5I9EB 5DM6L 4H5TA 3FE1A 2H3GX 3A5LC 4YOTA 3WEEA 4A59A 4BGAA 5AQGA 2GWJA 2ZJQL 1T3VA 5ELZA 4JK7A 4BG9A 5CHIA 3E66A 4JKBA 1NWKA 2HMPA 3EL2A 4FWKA 2QWRA 3EZWA 4AM7A 1T6DA 3EE8A 2E8AA 4CD3A 4FWLA 1NJIO 4MDAA 1ZBSA 4PKIA 1T44A 3W3DA 5AQUA 4OPHA 3CJ9A 3M6GA 1K8AO 2C1GA 1VQ5N 4ILGB 2P9UA 3QBWA 3Q7BA 5HOOA 4GV9A 3TU5A 2HBKA 4WYBA 1RDUA 3D6RA 3OA9A 5FPNA 5BRDA 4EFHA 3KVGA 3O08A 1NGFA 5GAHP 2QA4N 5ADXH 1KAYA 3H3OB 2VGNA 5C15A 5JICA 3UKRB 2Q36A 4CBXA 4IJAA 5AQWA 3VF2A 4DHYA 3AAQA 4JKGA 5GADP 3UKUB 5LJWA 2Q97A 3ZX2A 1P8ZA 2E1YA 4BC4A 3B8AX 4IXCA 3O1WA 4Z94A 5BN9A 5JMVA 1DEJA 3GOIA 3IFRA 2AA4A 2GTDA 4AM6A 3R9PA 2I7PA 3PIOL 4FWNA 1IG8A 2CGJA 4G9ZA 2IVPA 4PL8A 3EKUA 4L3QA 1VAZA 3TTDA 5M1PA 3I33A 3HSCA 3MWTA 1TUYA 4IEEA 1E4GT 2KHOA 1ZC6A 3DXMB 3A5OC 3MWPA 5M1QA 4HTLA 3BUZB 3WXLA 3ENBA 4BQZA 3NVKA 2NRVA 2J4RA 2FSJA 2PFUA 3D2EB 5BPLA 5F1XA 3MN5A 3UE5A 1TYQB 4BRPA 2RHKA 4U67L 4Y0WA 2VGMA 3G25A 5AQRA 1Q86O 3QBXA 3P39A 3G71N 5AQXA 3OBWA 2NLXA 2OANA 1HUXA 1ILYA 1ATNA 3FLCO 4BR4A 1C0FA 4PL7A 1VQLN 3CD6N 1OVYA 4BVPA 3CCVN 4I6MA 4JKAA 1NM1A 4FL9A 4H03B 2P9PB 3CJ1A 1XUPO 3O9TA 3LDQA 4EHUA 4FWOA 2HBMA 3P38A 3W0LA 3SMSA 3DXKB 1VQ8N 3TTCA 5AZJA 5DM7L 3VGMA 3VENA 2A42A 4ISGA 1JCEA 3CHWA 3SMPA 4JKDA 5KPRA 3BEXA 3VEZA 2FSNA 1R59O 1NGAA 2UYTA 3MMVA 2E2OA 3G4SN 5AQPA 3CC4N 4IO8A 2HF4A 3Q7CA 2QWQA 2F7TA 5AQMA 4FVUA 2P9NB 3MX2A 2RE2A 3C6AA 4JD2B 4BECA 3AGKA 3SLCA 1VQ9N 4B1UB 4BRMA 1K9MO 1GLCG 1BG3A 3ID6A 4ILHA 3C0BA 3O8MA 1KXPA 2E2QA 2IVNA 4JHDA 4A62A 4JK8A 3WEEB 4A5BA 4CBWA 4EIAA 3HOTA 3RSEA 1DKGD 2EWSA 4BR5A 4BRDA 4EHTA 3PLAA 4B1ZA 2QWPA 2FLOA 3IMXA 3CCQN 3SJHA 4JN4A 2KLAA 5CR4A 2ZWHA 3P4IA 1VQ6N 3C7NB 3H45C 1BUPA 4FWMA 3I55N 4BEBA 1S22A 2A40A 4XJXA 2QM1A 5BR9A 5AFUH 4QS8A 4B1YB 1EO1A 2ITMA 3VEOA 3WT0A 4JKEA 1K73O 2FF6A 3VPZA 1P90A 4JKHA 5AZIB 3FZHA 1YJNN 1Q82O 4BRKA 4BR0A 4EAHD 3OHRA 5LY3A 3SBGA 1WOQA 4C23A 2P9SA 3QFUA 4BRNA 3GE1A 5F0XA 5GIOA 2P9LA 4BC3A 2YJEA 1O13A 4WFNL 2NRXA 5EXWA 5ADXA 5JVGL 2QTDA 3FZLA 1SAZA 3MDQA 3M3ZA 5AQHA 2OTJN 4BQLA 3L4IA 1GLLO 2ASOA 2DPNA 1NGGA 1JCFA 3VGLA 4BRQA 4B1WB 5AQOA 4H5WA 3WQUA 4FWSA 1K8KA 3A5NC 3CPEA 3ENOA 1ZXOA 5BPMA 2E88A 2P9KA 5AQIA 3M5RA 4FWQA 2V52B 3MN7A 4FPBA 2A5XA 3NMUA 3ENHA 5GAEP 3LDLA 1GLBG 1BO5O 4YOWA 1WUAA 2W41A 3TTFA 5FPDA 4KH5A 1MDUB 2NRRA 4O8UA 3SAGA 4FO0A 3IKMA 1OKJA 2VWBA 3TSQA 4M7YA 2YI1A 5AQJA 1HKGA 4A2AA 2QWNA 4CZMA 1MA9B 2GUPA 1HKCA 5BRHA 2W00A 2YHWA 3CCMN 4ISFA 2NRTA 5AQYA 4ILJA 4RTFD 1DGKN 3H6EA 5KQDA 1QZ6A 4YDUA 3CPWM 3C65A 2QXLA 1HKBA 5JLFA 2HSTA 1NMDA 2P9IA 3FR0A 4PHTX 2Q31A 3ZEUB 1KC8O 1KQSM 1NGEA 4CZHA 3D2FB 3CIPA 3SAFA 1N8RO 3LM2A 3CC2N 1HLUA 1X9JA 2IVOA 4DQ8A 5BREA 1GLFO 4XH5A 2ASMA 5B8HA 3FZFA 4QS7A 5KPTA 2Q0UA 2V7ZA 3VF4A 3AARA 2WUSA 3A8YA 4CI6A 3WUHA 3F9MA 3H1VX 4IWVA 1VQ7N 1NGJA 1KD1O 3A0IX 3A5MC 3EKSA 3HM8A 3U9ZA 3UKRA 4GVEA 2HOEA 4WCEL 4BRHA 1H1VA 3O6WA 4OPAA 4CZKA 4A57A 3K9KA 3GBTA 4BR9A 5KQ8A 1YITN 3CETA 3O5BA 1QZ5A 1NBWA 3TSPA 4B9QA 5JLHA 5LJVA 1BOTO 4CBUA 4XH1A 2YHXA 1HX1A 3FGUA 4K41A 4A61A 5C12A 4DB3A 3DJCA 3HI0A 3MCAB 4WFBL 3CQXA 5GIPA 5KPZA 3JS6A 4BG8A 3CCRN 4H5NA 4CZIA 4GY2B 4GV6A 5TKYA 5AQVA 1RDWX 2IIRA 2YCHA 3AAPA 1U2VB 1QQNA 3F2KA 5C10A 2GELA 5GINA 1NGDA 1RFQA 3O9RA 3CCUN 4AF1A 3CJCA 1Q18A 1HPMA 3DXMA 5EVZA 1YJWN 4NLBA 4R79A 1RGIA 2KKZA 4JEPA 2V7YA 3FZKA 5AQSA 4BR7A 3D2EA 1S72N 3ATVA 3KWGA 3ZETB 4OO1J 5EOYA 1M1KO 4C1NK 4IOCL 3DAWA 3ID8A 3LDPA 2QI2A 4K42A 3RVCA 4BRIA 1C0GA 4KH6A 4BRCA 3CMAN 4HWIA 3LDOA 1GLEG 3GG4A 2E20A 3K9JA 3VOVA 3G6EN 1MWMA 2FSKA 3O4WA 3ULEA 5AFUA 4MO4A 1YHQN 3VEXA 3HZ6A 1GLJO 3MX5A 4NLCA 5FPMA 4BY9C 5M1FA 2P9PA 5E84A 3JXUA 2QEXN 3I56N 2Q2RA 1NLVA 2D1KA 2YHYA 5M1OA 1VQON 3MN9A 4H0PA 1EQYA 2WFBA 3VTIA 3VTHA 3QMLA 1U6ZA 3MK6A 1GLDG 3DXKA 3CCEN 2NRHA 1Y64A 3U4LA 4BC5A 2FXUA 3M1FA 2W40A 4JKCA 4BROA 2D4WA 3E9PA 1VQ4N 3CI5A 1ESVA 3KK7A 3U8XA 3TPQA 4UY8O 4FSVA 4H0XB 3KZBA 2D0PA 4IOAL 1X3MA 3TSUA 2P9UB 2F9TA 4WF9L 4K25A 1YIJN 1YUWA 3LL3A 4NB4A 1BWFO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BF1 A;  2NZT A;  1BDG A;  4BRA A;  1SZ2 A;  3GDQ A;  3ZX3 A;  2P9N A;  1BU6 O;  4JD2 A;  4H0Y B;  2ZF5 O;  5BN8 A;  4YDU C;  3H46 O;  5AQF A;  5F2R A;  3O1B A;  2PAV A;  2V51 B;  3WXK A;  4BGB A;  4CD1 A;  2A6A A;  4LC9 B;  3VF6 A;  4MLH A;  4E1J A;  3U9D A;  4B1X B;  4XH4 A;  1QQM A;  3BP8 A;  1T6C A;  4PKH A;  3EN9 A;  3C7N A;  3GL1 A;  3VET A;  4XEI A;  4IZ9 A;  3SK3 A;  2P9I B;  2QWO A;  1NGH A;  4FPA A;  3HBT A;  4BR2 A;  3R8E A;  1QHA A;  4CZE A;  5AZI A;  4H0T B;  3L0Q A;  1S3X A;  3WXI A;  2ASP A;  2CH6 A;  3KHY A;  1ATS A;  4QS9 A;  4WQ5 A;  1HJO A;  4K43 A;  3WXJ A;  4FOE A;  2PBD A;  3R6M A;  5FPE A;  2BUP A;  1CZA N;  4PKG A;  1MWK A;  4B1V A;  2FF3 B;  1V4S A;  4I6M B;  4H0V B;  1TUU A;  2QWM A;  1E4F T;  4BC2 A;  1J6Z A;  1LCU A;  5AQK A;  4FWP A;  4DCH A;  3VEY A;  3EO3 A;  3J8A A;  4RCH A;  1XC3 A;  5AZJ B;  5E26 A;  4H0O A;  3MN6 A;  2Q1N A;  1Z6R A;  5CE3 A;  3UKU A;  3QFP A;  3VEW A;  4JAX A;  3MCP A;  2D0O A;  4BVO A;  3H1Q A;  4M7X A;  4CJ7 A;  1NGC A;  3L6Q A;  3I8B A;  5AR0 A;  4FWR A;  3UB5 A;  2A3Z A;  5AQL A;  4F9O A;  4BRL A;  1V4T A;  5AQZ A;  2HF3 A;  2A41 A;  2I7N A;  4BRF A;  4CZF A;  5BPN A;  1SQK A;  5BRF A;  1QQO A;  4JHD B;  3ULE B;  3ZEU A;  3CQY A;  3RSE B;  1G99 A;  5EX5 A;  2AP1 A;  3BF3 A;  3D2F A;  4BRE A;  4MLE A;  3VGK A;  3CJA A;  1ATR A;  3WQT A;  4MO5 A;  1TYQ A;  1YVN A;  4WQ4 C;  1YAG A;  4O8K A;  3FFK B;  3IDH A;  4FOI A;  1KAX A;  4IJN A;  2BTF A;  2CGK A;  1BA1 A;  5AQT A;  3IUC A;  2ZGY A;  3D7E O;  3H3N O;  2E2P A;  1D4X A;  1JCG A;  5AQN A;  3HTV A;  2E1Z A;  4H5R A;  1YXQ A;  4BRG A;  4J8F A;  3QDK A;  1XQS C;  2F9W A;  2QW9 A;  1BA0 A;  4CZL A;  4O5F A;  1NGI A;  4JNE A;  2P9S B;  4NO7 A;  2P9L B;  3S41 A;  1NGB A;  3CJ7 A;  4RWT A;  1Z05 A;  4CZG A;  2E2N A;  3QIC A;  4H5V A;  3VER A;  3QB0 A;  4CZJ A;  1U2V A;  3ZX0 A;  3CJB A;  1X3N A;  5EY4 A;  2Q0R A;  1IJJ A;  2YJF A;  1K8K B;  4WQ4 A;  2GEM A;  3CER A;  2QWL A;  3VES A;  2CGL A;  2ZGZ A;  5AQQ A;  3VEV A;  2P9K B;  3ATU A;  3FZM A;  3O80 A;  3ZET A;  1KAZ A;  2VCP A;  3LM9 A;  2VYP A;  4GNI A;  1LOT B;  3DWL A;  3AY9 A;  4KBO A;  4WQ5 C;  4A2B A;  2GWK A;  1GLA G;  3LDN A;  4M63 C;  4ISE A;  2CH5 A;  5I9E B;  4H5T A;  3FE1 A;  2H3G X;  3A5L C;  3WEE A;  4BGA A;  5AQG A;  2GWJ A;  5ELZ A;  4BG9 A;  1NWK A;  2HMP A;  3EL2 A;  4FWK A;  2QWR A;  3EZW A;  4AM7 A;  1T6D A;  2E8A A;  4CD3 A;  4FWL A;  1ZBS A;  4PKI A;  1T44 A;  3W3D A;  5AQU A;  3CJ9 A;  3M6G A;  2P9U A;  3QBW A;  3TU5 A;  4WYB A;  5FPN A;  5BRD A;  4EFH A;  3KVG A;  3O08 A;  1NGF A;  5ADX H;  1KAY A;  3H3O B;  5JIC A;  3UKR B;  2Q36 A;  4CBX A;  4IJA A;  5AQW A;  3VF2 A;  4DHY A;  3AAQ A;  3UKU B;  5LJW A;  2Q97 A;  3ZX2 A;  1P8Z A;  2E1Y A;  4BC4 A;  3B8A X;  4IXC A;  3O1W A;  4Z94 A;  5BN9 A;  5JMV A;  1DEJ A;  3GOI A;  3IFR A;  2AA4 A;  2GTD A;  4AM6 A;  3R9P A;  2I7P A;  4FWN A;  1IG8 A;  2CGJ A;  2IVP A;  4PL8 A;  3EKU A;  4L3Q A;  3I33 A;  3HSC A;  1TUY A;  1E4G T;  2KHO A;  1ZC6 A;  3DXM B;  3A5O C;  4HTL A;  3BUZ B;  3WXL A;  4BQZ A;  2J4R A;  2FSJ A;  3D2E B;  5BPL A;  5F1X A;  3MN5 A;  3UE5 A;  1TYQ B;  4BRP A;  4Y0W A;  3G25 A;  5AQR A;  3QBX A;  5AQX A;  2NLX A;  2OAN A;  1HUX A;  1ATN A;  3FLC O;  4BR4 A;  1C0F A;  4PL7 A;  4BVP A;  4I6M A;  1NM1 A;  4FL9 A;  4H03 B;  2P9P B;  3CJ1 A;  1XUP O;  4EHU A;  3LDQ A;  4FWO A;  3W0L A;  3SMS A;  3DXK B;  5AZJ A;  3VGM A;  3VEN A;  2A42 A;  4ISG A;  1JCE A;  3CHW A;  3SMP A;  5KPR A;  3BEX A;  3VEZ A;  2FSN A;  1R59 O;  1NGA A;  2UYT A;  3MMV A;  2E2O A;  5AQP A;  4IO8 A;  2HF4 A;  2QWQ A;  5AQM A;  2P9N B;  4JD2 B;  3SLC A;  4B1U B;  4BRM A;  1GLC G;  1BG3 A;  3C0B A;  3O8M A;  1KXP A;  2E2Q A;  2IVN A;  4JHD A;  4A62 A;  3WEE B;  4CBW A;  4EIA A;  3RSE A;  1DKG D;  2EWS A;  4BR5 A;  4BRD A;  4EHT A;  4B1Z A;  2QWP A;  2FLO A;  3IMX A;  3SJH A;  4JN4 A;  2ZWH A;  3P4I A;  3C7N B;  3H45 C;  1BUP A;  4FWM A;  1S22 A;  2A40 A;  2QM1 A;  5BR9 A;  5AFU H;  4QS8 A;  4B1Y B;  2ITM A;  3VEO A;  3WT0 A;  2FF6 A;  3VPZ A;  5AZI B;  3FZH A;  4BRK A;  4BR0 A;  4EAH D;  3OHR A;  5LY3 A;  1WOQ A;  4C23 A;  2P9S A;  3QFU A;  4BRN A;  3GE1 A;  5F0X A;  2P9L A;  4BC3 A;  2YJE A;  5EXW A;  5ADX A;  3FZL A;  1SAZ A;  3MDQ A;  3M3Z A;  5AQH A;  4BQL A;  3L4I A;  1GLL O;  2ASO A;  2DPN A;  1NGG A;  1JCF A;  3VGL A;  4BRQ A;  4B1W B;  5AQO A;  4H5W A;  3WQU A;  4FWS A;  1K8K A;  3A5N C;  3ENO A;  1ZXO A;  5BPM A;  2E88 A;  2P9K A;  5AQI A;  4FWQ A;  2V52 B;  3MN7 A;  4FPB A;  2A5X A;  3ENH A;  3LDL A;  1GLB G;  1BO5 O;  1WUA A;  2W41 A;  5FPD A;  1MDU B;  4FO0 A;  1OKJ A;  2VWB A;  4M7Y A;  2YI1 A;  5AQJ A;  1HKG A;  4A2A A;  2QWN A;  4CZM A;  1MA9 B;  2GUP A;  1HKC A;  5BRH A;  2YHW A;  4ISF A;  5AQY A;  4RTF D;  1DGK N;  3H6E A;  5KQD A;  1QZ6 A;  4YDU A;  2QXL A;  1HKB A;  5JLF A;  1NMD A;  2P9I A;  3FR0 A;  2Q31 A;  3ZEU B;  1NGE A;  4CZH A;  3D2F B;  3CIP A;  3LM2 A;  1HLU A;  1X9J A;  2IVO A;  4DQ8 A;  5BRE A;  1GLF O;  4XH5 A;  2ASM A;  5B8H A;  3FZF A;  4QS7 A;  5KPT A;  2Q0U A;  2V7Z A;  3VF4 A;  3AAR A;  2WUS A;  3A8Y A;  4CI6 A;  3WUH A;  3F9M A;  3H1V X;  4IWV A;  1NGJ A;  3A0I X;  3A5M C;  3EKS A;  3HM8 A;  3U9Z A;  3UKR A;  2HOE A;  4BRH A;  1H1V A;  3O6W A;  4CZK A;  5KQ8 A;  3GBT A;  4BR9 A;  3CET A;  3O5B A;  1QZ5 A;  1NBW A;  4B9Q A;  5JLH A;  5LJV A;  1BOT O;  4CBU A;  4XH1 A;  2YHX A;  1HX1 A;  3FGU A;  4K41 A;  4A61 A;  4DB3 A;  3DJC A;  3HI0 A;  3CQX A;  5KPZ A;  3JS6 A;  4BG8 A;  4H5N A;  4CZI A;  4GY2 B;  5TKY A;  5AQV A;  1RDW X;  2IIR A;  2YCH A;  3AAP A;  1U2V B;  1QQN A;  2GEL A;  1NGD A;  1RFQ A;  3CJC A;  1Q18 A;  1HPM A;  3DXM A;  5EVZ A;  1RGI A;  2V7Y A;  3FZK A;  5AQS A;  4BR7 A;  3D2E A;  3ATV A;  3ZET B;  5EOY A;  3DAW A;  3ID8 A;  3LDP A;  4K42 A;  4BRC A;  4BRI A;  1C0G A;  4HWI A;  3LDO A;  1GLE G;  3GG4 A;  2E20 A;  3VOV A;  1MWM A;  2FSK A;  3O4W A;  3ULE A;  5AFU A;  4MO4 A;  3VEX A;  3HZ6 A;  1GLJ O;  5FPM A;  2P9P A;  5E84 A;  3JXU A;  2Q2R A;  1NLV A;  2D1K A;  2YHY A;  3MN9 A;  4H0P A;  1EQY A;  3QML A;  1U6Z A;  3MK6 A;  1GLD G;  3DXK A;  2NRH A;  1Y64 A;  3U4L A;  4BC5 A;  2FXU A;  3M1F A;  2W40 A;  4BRO A;  2D4W A;  3CI5 A;  1ESV A;  3U8X A;  3TPQ A;  4FSV A;  4H0X B;  3KZB A;  2D0P A;  1X3M A;  2P9U B;  2F9T A;  4K25 A;  1YUW A;  3LL3 A;  4NB4 A;  1BWF O; 
#chains in the Genus database with same CATH topology
 3LZI A;  2ATQ A;  3D45 A;  4X65 K;  2NZT A;  3WXM B;  1SZ2 A;  3E01 A;  2P9N A;  1BCO A;  4NYF A;  4H0Y B;  4CHP A;  4YDU C;  4F8R A;  3QIO A;  4M42 A;  5AQF A;  5FRM A;  4RW7 A;  4U7B A;  2OTL N;  1FJG K;  2V51 B;  3WXK A;  4NCB A;  3C6T A;  5FRN A;  3OYK A;  4E1J A;  2JWL A;  4B1X B;  5LMN K;  1U48 A;  3BP8 A;  1C0T A;  1T6C A;  2ETJ A;  4FJM A;  2YKN A;  3C95 A;  2VWK A;  1A5V A;  2QWO A;  3OYH A;  1HYZ A;  3N4P A;  3N4Q A;  1QHA A;  1VQK N;  3LP3 A;  3O3H A;  4B8A B;  2ASP A;  3AA5 X;  3EYZ A;  3AO5 A;  4JS5 A;  3ZT2 A;  4WQ5 A;  4O0I A;  1NKB A;  5KRT A;  1EXQ A;  4CEO A;  4Z4H A;  4PKG A;  3NVM A;  2FF3 B;  1TUU A;  3I0S A;  3L3U A;  2WBN A;  1XMO K;  4C1N I;  3OYC A;  2HHQ A;  3EO3 A;  4RCH A;  5AZJ B;  4IFY A;  5E26 A;  4CED A;  4CEE A;  3MN6 A;  3SUQ A;  5CYM A;  1NK7 A;  5CE3 A;  3KKS A;  3VEW A;  2W6L A;  4CJ7 A;  4O44 A;  2W6K A;  5AR0 A;  2G8I A;  1YF5 L;  5M1K A;  2A3Z A;  1R0A A;  4F9O A;  3DRS A;  1C6V A;  1EP4 A;  5AQZ A;  3CM5 A;  4ICL A;  2XY8 A;  2A41 A;  2I7N A;  4BRF A;  4CZF A;  3OYA A;  3V9X A;  1VQN N;  1NG9 A;  4CES A;  3CQY A;  4G1Q A;  3RSE B;  3D2F A;  3BF3 A;  4BRE A;  1VSK A;  3IS9 A;  4MQ3 A;  4Y1C A;  1TKZ A;  3HVR A;  3SQ1 A;  3WQT A;  1VSD A;  4MO5 A;  3F5T A;  1TYQ A;  4DSE A;  3P31 A;  1YAG A;  3DLE A;  4DV2 K;  2BTF A;  5AQT A;  4GMJ B;  2E2P A;  3BZC A;  2O4G A;  5AQN A;  4CJT A;  5C42 A;  4BE7 B;  4LF7 K;  4H5R A;  5KRS A;  4J8F A;  4HUF A;  1XQS C;  3QIP A;  4DS4 A;  2QW9 A;  3S3M A;  1BA0 A;  3QEV A;  1C1A A;  4JNE A;  4NO7 A;  4KAZ A;  3AVC A;  3S41 A;  1NGB A;  4IBN A;  2WON A;  1RT6 A;  3QIC A;  1QVF M;  4H5V A;  3QB0 A;  3O9S A;  1SS6 A;  3ITH A;  4KO0 A;  5M1N A;  1IBL K;  4B08 A;  3VES A;  3CER A;  2KW4 A;  4DV6 K;  4J2B A;  3CFP A;  2P9K B;  3FZM A;  3O80 A;  3ZET A;  4FJH A;  4JKF A;  4J2D A;  2JLE A;  3KWI A;  2VYP A;  4BE1 A;  4GNI A;  4CF0 A;  2B4J A;  3SV4 A;  2BDP A;  4O0J A;  4YOV A;  3QES A;  2CH5 A;  5DM6 L;  3WEE A;  4KFB A;  2X74 A;  1KCF A;  3AVF A;  3KK3 A;  4FYD A;  3C6U A;  4CF9 A;  3AVJ A;  1HNX K;  2HMP A;  1RT1 A;  4DSI A;  3EZW A;  1T6D A;  4N41 A;  3EE8 A;  1OVQ A;  2VG6 A;  4B9L A;  1G15 A;  3KD1 E;  3W3D A;  3K58 A;  2IS3 A;  2VQE K;  3TAR A;  1RTJ A;  1XHZ A;  1NK6 A;  1RDA A;  4EP4 A;  1YT3 A;  1Q9Y A;  1RTH A;  1S6Q A;  2D0A A;  3OA9 A;  5BRD A;  3KVG A;  2QA4 N;  1OH6 A;  2G8H A;  1HQU A;  4WE1 A;  5C15 A;  4DFM A;  5JIC A;  4IJA A;  1VSL A;  3UKU B;  3ZX2 A;  1P8Z A;  2QXF A;  4IXC A;  3NGY A;  3HXM A;  4Z94 A;  2UUC K;  1DEJ A;  1LWE A;  2I7P A;  1FKP A;  4FWN A;  3SJJ A;  4FJG A;  1IG8 A;  4KI6 A;  4M3Y A;  4FK2 A;  2IVP A;  3LP2 A;  3EKU A;  2VWJ A;  5M1P A;  3F73 A;  4DTS A;  2WTU A;  1E4G T;  1JLC A;  1IH7 A;  1N36 K;  3MWP A;  4HTL A;  3BUZ B;  3WXL A;  3ENB A;  4BQZ A;  2NRV A;  1BIS A;  5BPL A;  3MN5 A;  2RHK A;  3DRP A;  1VK0 A;  1ASW A;  4FJK A;  2HHX A;  1S1W A;  3P39 A;  1ATN A;  4BR4 A;  4I7F A;  4DWI A;  3CD6 N;  3KJV A;  1RTD A;  4KI4 A;  1S9E A;  4CHY A;  1S1U A;  1VSE A;  1NM1 A;  1IKY A;  2P9P B;  3AO3 A;  3O9T A;  2IGI A;  3LDQ A;  4BDY A;  3LPT A;  4LY7 A;  1TAU A;  1VQ8 N;  1KFS A;  4M3Z A;  2G8F A;  1RDB A;  3TTC A;  4EZ6 A;  5AZJ A;  5DM7 L;  2A42 A;  1HYV A;  1JCE A;  4W5Q A;  3CHW A;  3PX6 A;  5EU7 A;  5HLF A;  5CZ2 A;  4PY5 A;  3KIO A;  3DYA A;  4DTM A;  4KKO A;  4IO8 A;  2YNF A;  2QWQ A;  4IG0 A;  3OTO K;  1C0U A;  4CFC A;  1W9H A;  4BEC A;  1K9M O;  1GLC G;  3C0B A;  2HMI A;  3BGR A;  3T1Y K;  4CBW A;  4EIA A;  4OPJ A;  4A5B A;  1KLM A;  3RSE A;  1D9D A;  5CY4 A;  3DLR A;  4Q0B A;  3SJH A;  2KLA A;  5CR4 A;  2IDO A;  3HM9 A;  3UIQ A;  2A40 A;  2Y1I A;  4FCY A;  1K73 O;  5J2Q A;  4DV4 K;  3VPZ A;  3DLH A;  4CJF A;  2G8U A;  1WOQ A;  4C23 A;  2P1J A;  5CYQ A;  5F0X A;  5GIO A;  4RW8 A;  1O13 A;  5ADX A;  5JVG L;  4CK1 A;  3T19 A;  4CGH A;  1CZB A;  1WSG A;  3M8S A;  4B1W B;  5AQO A;  3CYM A;  3A5N C;  4KV8 A;  3AVA A;  3CPE A;  3AA2 A;  3ENO A;  2YNH A;  4CGF A;  5BPM A;  1SKW A;  1HNZ K;  2P9K A;  4FWQ A;  2P5G A;  4FPB A;  1CLQ A;  4DR4 K;  4HHT A;  1BO5 O;  5FPD A;  4ZHR A;  4KH5 A;  4A2A A;  4DQP A;  4JI2 K;  1N33 K;  4DTU A;  4W5T A;  2GUP A;  5BRH A;  1HKC A;  2YHW A;  5AQY A;  2GUI A;  4ILJ A;  4CCH A;  2QXL A;  1UA0 A;  3QNO A;  1U47 A;  4PHT X;  1Q9X A;  1NGE A;  4DTO A;  4KHW A;  3LPU A;  3LM2 A;  4K0K K;  4O5B A;  2IVO A;  3NBP A;  4DQ8 A;  1QSS A;  3AA3 A;  4M3R A;  3VQD A;  3FZF A;  4QS7 A;  4NXN K;  1XNQ K;  2UXC K;  3A8Y A;  4F4K A;  4FZZ A;  3V4I A;  4CEF A;  2XY7 A;  3TAN A;  1NGJ A;  2O8C A;  2HB5 A;  4DR3 K;  2HOE A;  2X78 A;  4BRH A;  3O6W A;  5KQ8 A;  1QZ5 A;  1SUQ A;  4B9Q A;  5JLH A;  5LJV A;  1NKE A;  4CBU A;  5C12 A;  4DB3 A;  3CQX A;  3MEE A;  1IBM K;  3SUP A;  2OZS A;  2IIR A;  1QQN A;  2GEL A;  4DF8 A;  4AF1 A;  4JYA K;  4JEP A;  2GBZ A;  5AQS A;  3SUN A;  1FXX A;  4W5O A;  4OO1 J;  3EY1 A;  2HHT A;  2OPP A;  4C1N K;  3P1G A;  3LDP A;  3SUO A;  2QKK A;  3RWU A;  3LDO A;  4DQQ A;  2E20 A;  5FRO A;  3G6E N;  2FSK A;  5AFU A;  4MO4 A;  3HZ6 A;  1GLJ O;  3AVH A;  4AHR A;  3MX5 A;  4DFJ A;  3OYI A;  5FPM A;  4FZY A;  2P9P A;  2QEX N;  5M1O A;  1EWR A;  4M41 A;  3VTH A;  4CIE A;  4M3U A;  2OYQ A;  1U6Z A;  4I9L A;  1Y64 A;  3QEI A;  5HRO A;  4JKC A;  3E9P A;  1LV5 A;  3CI5 A;  1ESV A;  1VQ4 N;  2KTQ A;  1W7A A;  4O4G A;  2ZE2 A;  2P9U B;  4NB4 A;  1BWF O;  3VMF B;  3PSF A;  1ZBH A;  3GDQ A;  2UU9 K;  3ZSW A;  3OBY A;  2ZF5 O;  3OY9 A;  2O8F B;  4JKG B;  4E89 A;  2PZS A;  2Z1I A;  3ISN C;  1QE1 A;  5F2R A;  3O9Q A;  4BGB A;  4CIG A;  1QQC A;  3SV3 A;  4MLH A;  4I9Q A;  5C2D A;  3DLL L;  1EWQ A;  3RR7 A;  3SNN A;  4YOU A;  1L3S A;  2UUA K;  3LDS A;  3CFR A;  5SZT A;  3HBT A;  3LAK A;  1WBB A;  1VQM N;  1CZ9 A;  3KLI A;  4H0T B;  3TAP A;  1S3X A;  2CH6 A;  3KHY A;  4QS9 A;  3THX A;  1YTU A;  2PYJ A;  3L8B A;  5TKW A;  4ZTF A;  3OYE A;  1UWB A;  1IV0 A;  2BUP A;  3CCS N;  1HR0 K;  1V4S A;  4H0V B;  3V9Z A;  1NU0 A;  2QWM A;  1RBR A;  2Z1G A;  1E4F T;  4BC2 A;  4YOR A;  4CF2 A;  4GV3 A;  1LCU A;  4BWJ A;  4DCH A;  4YOY A;  3NFA A;  3CCJ N;  3J8A A;  1XC3 A;  4YOX A;  1O1W A;  3C6H A;  3LWM A;  1Z6R A;  4Z4E A;  3ASM A;  3QFP A;  4JAX A;  3MCP A;  4BVO A;  3VQ6 A;  4M7X A;  2NRW A;  4LFA K;  1NGC A;  4I2Q A;  4FWR A;  3UB5 A;  3DM2 A;  3ZYY X;  5C25 A;  4BRL A;  3DOK A;  4AHU A;  4E0D A;  4FJX A;  1V4T A;  4MDB A;  1M90 O;  1RT5 A;  3HO1 A;  2Z1H A;  4DSF A;  1G99 A;  4Z4I A;  4MLE A;  2RN2 A;  1HNV A;  1ATR A;  3TAM A;  4FJL A;  1QTM A;  4DR5 K;  4O8K A;  3NAE A;  3FFK B;  3IDH A;  4M3X A;  1KAX A;  2CGK A;  2O8B B;  2C1I A;  3H3N O;  1D4X A;  3THY A;  4CJL A;  4CK2 A;  3TAF A;  2E1Z A;  4KH4 A;  3E9O A;  3VA3 A;  4B3T K;  1NGI A;  4JI6 K;  1WBD A;  2P9L B;  1Z26 A;  2HNY A;  2E2N A;  3HPG A;  1IJJ A;  1K8K B;  4WQ4 A;  3SCX A;  2ZGZ A;  3AO4 A;  3VEV A;  3R1X A;  1KAZ A;  1QSL A;  4KHY A;  4JI4 K;  4EZ9 A;  3DWL A;  3AY9 A;  4CJK A;  5J2N A;  2F8S A;  2GWK A;  4FLY A;  3LDN A;  4FLZ A;  4M63 C;  4E7I A;  3V81 A;  2BH1 A;  4ISE A;  5I9E B;  4DTN A;  4H5T A;  3FE1 A;  4YOT A;  3A5L C;  2ZJQ L;  4LF4 K;  1T3V A;  3PX0 A;  5ELZ A;  1TK8 A;  3E66 A;  4E19 A;  2UXB K;  4FWK A;  1VSH A;  1VSF A;  4AM7 A;  3OYG A;  1SKR A;  2UXD K;  3HYF A;  4W5R A;  5AQU A;  3CJ9 A;  3M6G A;  4LH5 A;  4DV5 K;  3VQP A;  1L5U A;  2C1G A;  3THW B;  2P9U A;  3QBW A;  4GV9 A;  4DSK A;  3DLK A;  3TU5 A;  1RDU A;  3VQB A;  1TK0 A;  5FPN A;  4EFH A;  1HRH A;  3ZSQ A;  3OJU A;  5ADX H;  5FDL A;  4IDK A;  3CQ8 A;  4Z0U A;  3RR8 A;  3UKR B;  2O8F A;  3AAQ A;  4JKG A;  3L2V A;  5GAD P;  3D0P A;  2Q97 A;  3OS2 A;  1X9W A;  3O1W A;  4KRF A;  5BR8 K;  5BN9 A;  5JMV A;  3IFR A;  4AM6 A;  2GTD A;  3R9P A;  3B6O A;  4E7L A;  4CJ3 A;  2CGJ A;  4PL8 A;  3HPO A;  3LAN A;  1TUY A;  4IEE A;  2KHO A;  2KQ2 A;  1KFD A;  3PX4 A;  5M1Q A;  3NVK A;  1KVA A;  1L3V A;  2FSJ A;  3D2E B;  1BI4 A;  5F1X A;  3UE5 A;  4U67 L;  3MAQ A;  4KPY A;  4B9M A;  5I3U A;  5AQR A;  3QBX A;  1A5W A;  3G71 N;  4F2S A;  1WSI A;  3OBW A;  5I42 A;  4CFD A;  2OAN A;  1HUX A;  3K59 A;  2OA8 A;  4GW6 A;  3KK1 A;  4JI1 K;  2G8V A;  3LP0 A;  4ZTJ A;  2HBM A;  4JRQ A;  1JL1 A;  3DXK B;  4Y1D A;  4DU4 A;  3VEN A;  4ISG A;  3JYT A;  4KTQ A;  5K14 A;  5KPR A;  3RTV A;  3BEX A;  2ZM6 K;  3VEZ A;  3MMV A;  4M3T A;  1HNW K;  1RDC A;  1LAV A;  2F7T A;  4E1N A;  5E41 A;  1D8Y A;  3C6A A;  4JD2 B;  4CEA A;  5JS2 A;  4FJ5 A;  3SLC A;  4B9T A;  4BRM A;  4O55 A;  4KHN A;  3O8M A;  4PWD A;  4FJN A;  2E2Q A;  2IVN A;  4JK8 A;  1ASV A;  4DV0 K;  4B3M K;  3PLA A;  4YNQ A;  4B1Z A;  2FLO A;  2X6N A;  3CCQ N;  1ITG A;  4JI7 K;  3H45 C;  2HND A;  2E6M A;  3I55 N;  4BEB A;  2O8B A;  4FW2 A;  5AFU H;  2ITM A;  3VEO A;  3WT0 A;  1XMQ K;  1P90 A;  5AZI B;  3FZH A;  3VQ4 A;  4JI5 K;  4KHQ A;  1JLB A;  3VQE A;  1FKO A;  5LY3 A;  3SBG A;  3SQ0 A;  4DQR A;  2P9L A;  1NK8 A;  3ZSX A;  4WFN L;  2NRX A;  4QOZ B;  2ZQB A;  3FZL A;  3QER A;  4V19 S;  3VN5 A;  4DSL A;  3ZSO A;  1BQN A;  2DPN A;  5DK5 A;  5KGW A;  1NGG A;  1JCF A;  2FC0 A;  4FLT A;  3WQU A;  1K8K A;  4B9V A;  1JLE A;  1UA1 A;  4C8O A;  4Z4G A;  3S3N A;  4ID1 A;  4FLW A;  5GAE P;  3KLG A;  4GKK K;  2WOM A;  3IKM A;  3TSQ A;  2YI1 A;  1UAX A;  3QNN A;  2QWN A;  5SWM A;  3HPH A;  3OS0 A;  2PY5 A;  2NRT A;  4CW7 B;  4RW9 A;  4RTF D;  2VQF K;  4YDU A;  1J54 A;  1HKB A;  1N5Y A;  4CJE A;  4BDZ A;  3FR0 A;  2Q31 A;  1NNE A;  2RPI A;  3THW A;  3CC2 N;  1HLU A;  4XH5 A;  2ASM A;  3PUF A;  3RRH A;  2Q0U A;  2V7Z A;  3VF4 A;  1TGO A;  3AAR A;  2WUS A;  4CJ5 A;  1BGX T;  1HNI A;  4CI6 A;  1JKH A;  3DLG A;  3H1V X;  4IWV A;  2O8E B;  1VQ7 N;  1I3A A;  3UKR A;  3HM8 A;  3U9Z A;  4GVE A;  2Z1J A;  1EO1 A;  1WN7 A;  4OPA A;  4CZK A;  4AH9 A;  3GBT A;  3CET A;  3O5B A;  1NBW A;  3O4N A;  1WB9 A;  4K41 A;  3WNG A;  3HI0 A;  4WFB L;  5GIP A;  5JS1 A;  1L3T A;  2O4I A;  1RDW X;  1OH7 A;  1U2V B;  5C10 A;  1NGD A;  2FBV A;  5EVZ A;  1RNH A;  4FVM A;  3ZT1 A;  2KKZ A;  3FZK A;  4OGC A;  4AHV A;  3D2E A;  3ATV A;  1M1K O;  1TK5 A;  3DAW A;  3DLB A;  4BRC A;  3RVC A;  2RF2 A;  2YNG A;  3PY8 A;  4HWI A;  1BQM A;  2FBT A;  3K9J A;  3VOV A;  1MWM A;  2G8K A;  2HHH K;  1SV5 A;  5M1F A;  5E84 A;  3I56 N;  1NLV A;  2D1K A;  2YHY A;  4AHS A;  3MN9 A;  4H0P A;  1B92 A;  3QML A;  5JEN A;  4FLU A;  3DXK A;  3PSI A;  1ASU A;  4BC5 A;  2FXU A;  1S1X A;  3IRX A;  3P83 D;  4FJJ A;  2D4W A;  1HQE A;  3K5N A;  4UY8 O;  2BGG A;  4RW4 A;  4FSV A;  3CM6 A;  4CJV A;  3V1O A;  4W5N A;  3G10 A;  1X3M A;  3TSU A;  4K8Z A;  2HVH A;  2F9T A;  2GV9 A;  4K25 A;  1YIJ N;  1WSJ A;  1J53 A;  4IFE A;  3BF1 A;  1NK9 A;  4DLE A;  4BRA A;  4KB0 A;  1T03 A;  1BU6 O;  4JD2 A;  3AGR A;  5BN8 A;  3SPY A;  4CEQ A;  2YNI A;  3H46 O;  4DG1 A;  1X9S A;  4KB1 A;  1HJR A;  3NGI A;  4ID5 A;  2A6A A;  4LC9 B;  2FBY A;  3HOS A;  2KFN A;  4IKF A;  4LD0 A;  1K6Y A;  3AO2 A;  4XH4 A;  4FJ7 A;  3R3L A;  3VET A;  4PKH A;  1Y97 A;  3GL1 A;  2DFE A;  3V9S A;  4X66 K;  2X6S A;  4LSL A;  3SK3 A;  2P9I B;  1L3U A;  1NGH A;  4CHQ A;  2P5O A;  2HBL A;  2HBJ A;  3JAM O;  4BR2 A;  3R8E A;  4AHT A;  1E3M A;  2IC3 A;  5AZI A;  3L0Q A;  5GAG P;  3CME N;  3WXI A;  4LH4 A;  4HUE A;  3QO9 A;  4FOE A;  3O4Q A;  1QVG M;  1MWK A;  3SAH A;  3QET A;  2R7Y A;  2HHW A;  1MU2 A;  2LSN A;  2ZJP L;  4NCG A;  4FWP A;  1RT4 A;  3OYB A;  4E72 A;  3VEY A;  5J1E A;  4FW1 A;  1Q81 O;  4B3O A;  1Q7Y O;  3J81 O;  4H0O A;  3TR8 A;  1W2B M;  4C8L A;  1J5E K;  5HRN A;  3UKU A;  3PO5 A;  3NH1 A;  3H1Q A;  1JLA A;  1KRP A;  3OW2 M;  1NJY A;  4CHN A;  4JRP A;  1JLG A;  4IO9 L;  3SQ4 A;  4KTZ A;  4DS5 A;  1SL0 A;  5BPN A;  1QQO A;  4JHD B;  3ULE B;  4C8N A;  5EX5 A;  2AP1 A;  3EEQ A;  1QS4 A;  3VGK A;  2EX3 A;  3MXJ A;  4CGD A;  1VRU A;  4DKW A;  5KTQ A;  1NJW A;  4WQ4 C;  4FOI A;  4IJN A;  4HCC A;  2O8D B;  3PV8 A;  4BE2 A;  1BA1 A;  2NRZ A;  3OYM A;  2ZGY A;  1S6P A;  3D7E O;  5LMU K;  2O8E A;  1TKT A;  3NF9 A;  3T3F A;  3MEG A;  3CCL N;  5JVH L;  1U4B A;  4YY3 K;  1T8E A;  3T1A A;  4CEC A;  4CZL A;  2P9S B;  5H1S Q;  1EX4 A;  1IKX A;  4RWT A;  4A5A A;  1NK4 A;  2XY6 A;  1Z05 A;  3E9L A;  4CZG A;  4E7K A;  3VER A;  3K0S A;  1HMV A;  4CZJ A;  1U2V A;  3ZX0 A;  3J7Y P;  2E4L A;  5EY4 A;  2Q0R A;  3AVB A;  4B9N A;  2E6L A;  2QWL A;  1XWL A;  5AQQ A;  2YKM A;  5HRP A;  3KLH A;  2PYL A;  3LM9 A;  1N6Q A;  1W0H A;  3T1H K;  4WQ5 C;  3VQ8 A;  4A2B A;  4M45 A;  2GX9 A;  2JWK A;  1RCH A;  1ZBL A;  3U3G A;  4BG9 A;  5CHI A;  1ZBU A;  4JKB A;  1TKX A;  3EL2 A;  2DY4 A;  3K5O A;  2E8A A;  4CD3 A;  4FM2 A;  4FWL A;  3NF8 A;  1NJI O;  1VSI A;  4X64 K;  4I2P A;  1VSJ A;  2RKI A;  1VQ5 N;  4ILG B;  5T7B A;  3KLE A;  3Q7B A;  2Q3S A;  5KI6 A;  2HBK A;  3D6R A;  5GAH P;  3AVN A;  3O08 A;  1N32 K;  1KAY A;  3H3O B;  2VGN A;  3HP6 A;  3LP1 A;  4OKE A;  2Q36 A;  5AQW A;  3VF2 A;  4CGJ A;  4CFB A;  3VQ5 A;  5LJW A;  2E1Y A;  4BC4 A;  1ZYQ A;  3B8A X;  3V6D A;  2OCE A;  4JS4 A;  4K8X A;  4DTX A;  3L2Q A;  1LWF A;  2AA4 A;  2VG5 A;  3VA0 A;  3EZ5 A;  4L3Q A;  4CHZ A;  1RBV A;  3TTD A;  3I33 A;  1TAQ A;  3DXM B;  4FJ9 A;  2J4R A;  5FLX O;  4H4O A;  2F96 A;  3M8R A;  1TYQ B;  4BRP A;  3NCI A;  4DU3 A;  3RRG A;  4GVM A;  3VQQ A;  1Q86 O;  4LF9 K;  3CG7 A;  1U04 A;  1S1V A;  3S3O A;  1ILY A;  4PL7 A;  1N34 K;  1VQL N;  4CIF A;  2W42 A;  1OVY A;  2HNZ A;  4BVP A;  4KHP K;  3ZCM A;  4JKA A;  4OKK A;  4FL9 A;  4ELU A;  4H03 B;  2AJQ A;  3PO4 A;  2OPR A;  1XUP O;  4KHS A;  1BCM A;  1NK5 A;  3P38 A;  3W0L A;  1QSY A;  4NCA A;  3ZLJ A;  4H4M A;  4LSN A;  4IG3 A;  4JKD A;  4JI3 K;  2FSN A;  1NGA A;  2E2O A;  3G4S N;  4L8R B;  4DV3 K;  1XI1 A;  2HF4 A;  4LFC K;  1A5X A;  5AQM A;  4BWM A;  3AVM A;  4FVU A;  1TKD A;  2RE2 A;  1RT7 A;  4F3T A;  3AGK A;  4C8K A;  1VQ9 N;  4N56 A;  3F9K A;  1BG3 A;  3ID6 A;  5CZ1 A;  1KXP A;  4JHD A;  4A62 A;  3WEE B;  1RBU A;  1RBS A;  2EWS A;  2OPQ A;  4BR5 A;  5J2M A;  4BAC A;  3KTQ A;  4BRD A;  4EHT A;  4LF5 K;  4LFB K;  1S5J A;  2P51 A;  2ZWH A;  3P4I A;  3C7N B;  1LW2 A;  1BUP A;  4CJU A;  4FWM A;  3SPZ A;  3J7A P;  2O8D A;  2QM1 A;  1D5A A;  5BR9 A;  4FLX A;  3LAM A;  3KK2 A;  4CE9 A;  3OYN A;  4JKH A;  4BRK A;  4EAH D;  2P9S A;  3QFU A;  4BRN A;  3GE1 A;  4RW6 A;  2YJE A;  1WSH A;  1SAZ A;  3M3Z A;  1RTI A;  5AQH A;  2OTJ N;  4BQL A;  1WSE A;  3VQ9 A;  2ASO A;  3VGL A;  4BRQ A;  1TL3 A;  4H5W A;  4DR1 K;  1C1C A;  1ZXO A;  4JLH A;  2E88 A;  2V52 B;  4B9U A;  3MN7 A;  3S9H A;  3NMU A;  3ENH A;  1KTQ A;  4OLB A;  4YOW A;  2W41 A;  3HST B;  3TTF A;  3HL8 A;  4O8U A;  2A1S A;  2B6A A;  2VWB A;  3NF7 A;  2FBX A;  1KSP A;  4EP5 A;  5AQJ A;  1NOY A;  3IAY A;  2KZM A;  1MA9 B;  2W00 A;  1BHL A;  4ISF A;  4M3W A;  4B3R K;  3P5J A;  1DGK N;  5KQD A;  1VRT A;  4CGG A;  3NDK A;  4B3S K;  3ZEU B;  1KC8 O;  1KQS M;  3WNE A;  2DTU A;  3CIP A;  3SAF A;  2YHB A;  4HTU A;  5BRE A;  4H8K A;  1GLF O;  5B8H A;  1OH8 A;  1JL2 A;  5KPT A;  3A0I X;  1WLJ A;  2QKB A;  4WCE L;  3SZ2 A;  1U49 A;  4A57 A;  4BR9 A;  4FJ8 A;  3TSP A;  1BOT O;  1KVB A;  1XC9 A;  1T7P A;  4YHH K;  1HX1 A;  3FGU A;  4N5S A;  4DV7 K;  3DJC A;  4KTW A;  1NMN A;  4CJW A;  3CCR N;  3BDP A;  4GV6 A;  5TKY A;  5AQV A;  2VG7 A;  2YCH A;  3H08 A;  4J2A A;  2A1R A;  1YJW N;  3O9R A;  3CJC A;  3DXM A;  1WNS A;  4NLB A;  4R79 A;  1RGI A;  4CJQ A;  4BR7 A;  3OYF A;  3KWG A;  5EOY A;  1X1P A;  3RMA A;  3NF6 A;  3NH0 A;  2QI2 A;  1C0G A;  1GLE G;  4F2R A;  3LWL A;  4PA1 A;  3A2F A;  4OPK A;  2HHU A;  1B9D A;  4BY9 C;  3NGZ A;  4E1M A;  1I39 A;  2WFB A;  1Z25 A;  2NRH A;  3U4L A;  3M1F A;  2BE2 A;  2W40 A;  3KK7 A;  1EKE A;  4CJ4 A;  4H0X B;  3KZB A;  2D0P A;  4IOA L;  3S5T A;  5HRR A;  3ZSY A;  1S9G A;  3LL3 A;  4KBO A;  3LZJ A;  1BDG A;  4YFU A;  5J2P A;  2G8W A;  3ZX3 A;  1FW6 A;  2F4V K;  3MED A;  1DTQ A;  4FK0 A;  3O1B A;  2PAV A;  1BL3 A;  2OPS A;  3WNH A;  4FXD A;  4CD1 A;  3VF6 A;  4CEZ A;  3L2R A;  3U9D A;  1I94 K;  1QQM A;  3EN9 A;  3C7N A;  4XEI A;  3OYL A;  4IZ9 A;  4N76 A;  1GOC A;  2NNW A;  2HW3 A;  4FPA A;  3HRG A;  1KLN A;  3CYG A;  3T69 A;  3T7Z A;  4CZE A;  3HT3 A;  3IG1 A;  4DUY K;  2NUB A;  1ATS A;  4DFP A;  1HJO A;  4K43 A;  3TAQ A;  3WXJ A;  1Q8I A;  2PBD A;  3R6M A;  5FPE A;  3C94 A;  2QK9 A;  3CF5 L;  1CZA N;  4JK9 A;  2O8C B;  4B1V A;  4PQU A;  3O9U A;  2ITG A;  4CFA A;  4I6M B;  3AA4 A;  4IOX A;  4XIU A;  1J6Z A;  1B9F A;  3EE9 A;  5AQK A;  3SBT A;  1X9M A;  3E1Y A;  4FJI A;  3ZT3 A;  2ZJR L;  4IDH A;  2Q1N A;  4TSX A;  1QHT A;  1DT9 A;  3K2P A;  2JGU A;  3HVT A;  2D0O A;  3RMC A;  1CXQ A;  1YJ9 N;  3CC7 N;  3AVG A;  4CK3 A;  3L6Q A;  3I8B A;  3L2U A;  2D5R A;  3U3Y A;  1IKW A;  1ZBI A;  4MFB A;  2WC9 A;  5AQL A;  3VQ7 A;  1NJX A;  4FZX C;  3M8P A;  2HF3 A;  5MLC Q;  5C0Y A;  1SQK A;  4Q5V A;  1LAW A;  5BRF A;  3ZEU A;  5D3G A;  1NKC A;  5A2Q O;  3CJA A;  5C2F A;  5HL7 L;  1WSF A;  1SL1 A;  1YVN A;  3DRR A;  3IUC A;  3KD5 E;  3ZT4 A;  4E3S A;  2XO7 A;  1JCG A;  3HTV A;  2B5J A;  4PUO A;  1YXQ A;  4BRG A;  3ZSR A;  1W97 L;  3QDK A;  2F9W A;  4CGI A;  4WFA L;  1YTA A;  4O5F A;  1IKV A;  3CJ7 A;  1CXU A;  1IG9 A;  2D0B A;  1YI2 N;  3PIP L;  1XNR K;  2EHG A;  3L3V A;  1RBT A;  4Z4F A;  2ZD1 A;  1X3N A;  3CJB A;  2YJF A;  1U45 A;  2GEM A;  2CGL A;  3I0R A;  4CJP A;  2YX6 A;  3ATU A;  3WNF A;  3DI6 A;  3CXC M;  1VQP N;  4IEI A;  4OX9 K;  3TAE A;  2VCP A;  3L4Q A;  3J7Z O;  4F3O A;  1LOT B;  4DSJ A;  3MXI A;  1JJ2 M;  1GLA G;  1WAF A;  2H3G X;  4A59 A;  1J9A A;  4BGA A;  4B9S A;  1TVR A;  5AQG A;  2GWJ A;  4KHU A;  4JK7 A;  1DTT A;  1NWK A;  5C24 A;  2QWR A;  3THX B;  3QLH A;  4MDA A;  4OLA A;  1ZBS A;  4PKI A;  1T44 A;  3HP9 A;  4RG8 A;  3DMJ A;  4OPH A;  4X62 K;  3TAB A;  2BAN A;  5DMR A;  1K8A O;  4CJR A;  3QEP A;  5HOO A;  4UQG A;  4WYB A;  1NGF A;  3QEW A;  4Z4C A;  3G0Z A;  3U6F A;  4C8M A;  2D0C A;  1IBK K;  4CBX A;  4DHY A;  1SKS A;  3NHG A;  3GOI A;  3FFI A;  3V1R A;  3PIO L;  1BIU A;  4G9Z A;  1VAZ A;  5HRS A;  3HSC A;  3MWT A;  1J5O A;  1C1B A;  3L2W A;  1ZC6 A;  2HVI A;  3A5O C;  1C0M A;  4DUZ K;  3M8Q A;  1WAJ A;  3TAG A;  2PFU A;  2Y1J A;  1F21 A;  2HHV A;  1SL2 A;  4CJS A;  4DQI A;  1RDD A;  2VGM A;  4Y0W A;  3G25 A;  4DQS A;  4JI0 K;  5AQX A;  4HCB A;  2NLX A;  4DTR A;  3ALY A;  3VQC A;  3FLC O;  1C0F A;  1NK0 A;  3THY B;  3BY5 A;  3CCV N;  1DLO A;  2OZM A;  4I6M A;  1FK9 A;  4N47 A;  3CJ1 A;  4EHU A;  4DR7 K;  3BZK A;  4FWO A;  4KRE A;  3SMS A;  3HK2 A;  2YV0 X;  3VGM A;  4CF8 A;  4ELV A;  1RIL A;  2DFF A;  1REV A;  3SMP A;  4HUG A;  4FK4 A;  4NXM K;  1R59 O;  1HPZ A;  2UYT A;  2XRI A;  3AO1 A;  5AQP A;  4CER A;  4E7H A;  3CC4 N;  3Q7C A;  2DFH A;  3SI6 A;  2P9N B;  3MX2 A;  3K5M A;  4LF6 K;  3AVL A;  4B8C A;  4B1U B;  3NE6 A;  5AJ3 K;  3DOL A;  4ILH A;  4DLG A;  1IO2 A;  3HOT A;  2XHB A;  3OJS A;  3VQA A;  1DKG D;  1EET A;  2QWP A;  2E5L K;  3IMX A;  4JN4 A;  3MEC A;  1VQ6 N;  1JXE A;  2IOC A;  1ZBF A;  1S22 A;  4XJX A;  4QS8 A;  4B1Y B;  4JKE A;  2FF6 A;  4CHO A;  1YJN N;  4OKJ A;  1S1T A;  1Q82 O;  4BR0 A;  3K57 A;  3OHR A;  3RMD A;  4FM1 A;  4DR6 K;  3I8D A;  3RMB A;  1D9F A;  3V9W A;  4BC3 A;  5EXW A;  2QTD A;  3MDQ A;  4IFV A;  4AHC A;  4E7J A;  3OYD A;  4DMN A;  3AVK A;  2IAJ A;  3L4I A;  1GLL O;  3ZSV A;  1BIZ A;  5KGX A;  4QAG A;  1VHX A;  4FWS A;  1TV6 A;  4QCL A;  5AQI A;  3M5R A;  3KLF A;  4CEB A;  2A5X A;  4FLV A;  4ELT A;  3LDL A;  4OJR A;  4DFK A;  1GLB G;  4DF4 A;  1NOZ A;  1WUA A;  2HHI A;  3LAL A;  3TI0 A;  3SAG A;  1MDU B;  2NRR A;  4FO0 A;  1OKJ A;  4M7Y A;  4DTJ A;  1HKG A;  3ULD A;  1LW0 A;  4CZM A;  4CF1 A;  3ZSZ A;  1BI4 B;  1KVC A;  3CCM N;  4NYN A;  3H6E A;  3CPW M;  1QZ6 A;  3C65 A;  3O3F A;  3V9U A;  4OGE A;  5JLF A;  2HST A;  1NMD A;  2P9I A;  3HJF A;  4CZH A;  3D2F B;  3OYJ A;  3AV9 A;  1N8R O;  4DTP A;  4BDP A;  3QIN A;  4GKJ K;  4HVJ A;  1T05 A;  1X9J A;  1VSM A;  1RT3 A;  3WUH A;  3AVI A;  3F9M A;  3JSM A;  1KD1 O;  3A5M C;  3EKS A;  4LF8 K;  1H1V A;  5LL6 Z;  1YIT N;  3K9K A;  3SYZ A;  5HBM A;  2KFZ A;  1JXB A;  3TWH A;  4XH1 A;  2YHX A;  4OVL A;  4A61 A;  4J2E A;  3J80 O;  3MCA B;  4DR2 K;  5KPZ A;  3JS6 A;  3KKR A;  4BG8 A;  4BE0 A;  4H5N A;  4CZI A;  4GY2 B;  1UOC A;  3AAP A;  4R5P A;  3F2K A;  3B6P A;  4CVN E;  5GIN A;  1RFQ A;  3CCU N;  1YVU A;  1Q18 A;  1HPM A;  1NJZ A;  1GOA A;  2HHS A;  2V7Y A;  1S72 N;  3NH2 A;  3ZET B;  3SQ2 A;  3K5L A;  4IOC L;  3ID8 A;  4K42 A;  3CMA N;  4BRI A;  1TL1 A;  3OVN A;  4KH6 A;  3GG4 A;  3THV A;  1GOB A;  1LWC A;  3MXM A;  3O4W A;  5IWA K;  3ULE A;  1YHQ N;  3VEX A;  3OS1 A;  4NLC A;  2I5J A;  3JXU A;  2YHA A;  4DU1 A;  3O3G A;  2Q2R A;  1VQO N;  1OH5 A;  2F8T A;  1EQY A;  3VTI A;  4FM0 A;  2KZZ A;  5HP1 A;  1JLQ A;  4JI8 K;  3V1Q A;  3ZT0 A;  3MK6 A;  1GLD G;  3QEX A;  3CCE N;  2UUB K;  3CFO A;  4AIL C;  1HYS A;  1RT2 A;  4BRO A;  3U8X A;  4AQY K;  3TPQ A;  2XY5 A;  1XHX A;  4DV1 K;  1JLF A;  4WF9 L;  1YUW A;  5IT9 O;  4JV5 K; 
#chains in the Genus database with same CATH homology
 3VMF B;  4IFE A;  3BF1 A;  2NZT A;  1BDG A;  3WXM B;  4BRA A;  1SZ2 A;  3GDQ A;  3ZX3 A;  2P9N A;  1BU6 O;  3OBY A;  4JD2 A;  3AGR A;  4H0Y B;  2ZF5 O;  5BN8 A;  4YDU C;  3H46 O;  4JKG B;  5AQF A;  5F2R A;  3O1B A;  4U7B A;  2OTL N;  2PAV A;  2V51 B;  3WXK A;  3O9Q A;  4BGB A;  4CD1 A;  2A6A A;  4LC9 B;  3VF6 A;  4MLH A;  5C2D A;  3HOS A;  4E1J A;  3U9D A;  2JWL A;  4B1X B;  3DLL L;  4XH4 A;  1QQM A;  3BP8 A;  3R3L A;  1T6C A;  4PKH A;  3EN9 A;  3C7N A;  3GL1 A;  3VET A;  4XEI A;  4YOU A;  4IZ9 A;  3SK3 A;  2P9I B;  2QWO A;  1NGH A;  2NNW A;  2HBL A;  4FPA A;  2HBJ A;  3HBT A;  3N4P A;  4BR2 A;  3N4Q A;  1QHA A;  3HRG A;  3R8E A;  1VQK N;  1VQM N;  3T69 A;  3T7Z A;  4CZE A;  5AZI A;  4H0T B;  3L0Q A;  5GAG P;  1S3X A;  3WXI A;  3CME N;  2ASP A;  2CH6 A;  3KHY A;  1ATS A;  4QS9 A;  4WQ5 A;  1HJO A;  4K43 A;  5TKW A;  3WXJ A;  4FOE A;  2PBD A;  3R6M A;  5FPE A;  2BUP A;  3CF5 L;  1CZA N;  4JK9 A;  3CCS N;  4PKG A;  1QVG M;  1MWK A;  4B1V A;  3O9U A;  3SAH A;  3NVM A;  2FF3 B;  1V4S A;  4I6M B;  4IOX A;  4H0V B;  1TUU A;  2QWM A;  1E4F T;  2WBN A;  4BC2 A;  2ZJP L;  4YOR A;  1J6Z A;  4C1N I;  4GV3 A;  1LCU A;  3EE9 A;  4FWP A;  5AQK A;  4DCH A;  3SBT A;  4YOY A;  3CCJ N;  3VEY A;  3EO3 A;  3E1Y A;  3J8A A;  1Q81 O;  4RCH A;  1XC3 A;  5AZJ B;  4YOX A;  5E26 A;  1W2B M;  4H0O A;  3C6H A;  2ZJR L;  1Q7Y O;  3MN6 A;  4IDH A;  2Q1N A;  1Z6R A;  5CE3 A;  1DT9 A;  3UKU A;  3QFP A;  3VEW A;  4JAX A;  3MCP A;  2D0O A;  4BVO A;  3H1Q A;  4M7X A;  4CJ7 A;  2NRW A;  1YJ9 N;  3CC7 N;  1NGC A;  3L6Q A;  3I8B A;  5AR0 A;  4FWR A;  3OW2 M;  1YF5 L;  3UB5 A;  5M1K A;  2WC9 A;  2A3Z A;  5AQL A;  3ZYY X;  4F9O A;  4BRL A;  4IO9 L;  1V4T A;  5AQZ A;  2HF3 A;  4MDB A;  5MLC Q;  5C0Y A;  1M90 O;  2A41 A;  2I7N A;  4BRF A;  4CZF A;  5BPN A;  1SQK A;  1VQN N;  5BRF A;  1QQO A;  4JHD B;  3ULE B;  3ZEU A;  3CQY A;  3RSE B;  1G99 A;  5EX5 A;  2AP1 A;  3BF3 A;  3D2F A;  4BRE A;  4MLE A;  3VGK A;  3CJA A;  1ATR A;  5C2F A;  3WQT A;  4MO5 A;  3F5T A;  4DKW A;  1TYQ A;  5HL7 L;  1YVN A;  3P31 A;  1YAG A;  4O8K A;  4WQ4 C;  3FFK B;  3IDH A;  4FOI A;  1KAX A;  4IJN A;  2BTF A;  2CGK A;  1BA1 A;  2NRZ A;  3IUC A;  5AQT A;  2ZGY A;  2C1I A;  3D7E O;  3H3N O;  2E2P A;  1D4X A;  1JCG A;  5AQN A;  3HTV A;  3CCL N;  5JVH L;  4BE7 B;  2E1Z A;  4H5R A;  1YXQ A;  4KH4 A;  4J8F A;  4BRG A;  1W97 L;  3E9O A;  3QDK A;  1XQS C;  2F9W A;  2QW9 A;  1BA0 A;  4WFA L;  4CZL A;  4O5F A;  1NGI A;  4JNE A;  2P9S B;  4NO7 A;  5H1S Q;  2P9L B;  3S41 A;  1NGB A;  3CJ7 A;  4RWT A;  4A5A A;  1Z05 A;  3E9L A;  1YI2 N;  3PIP L;  4CZG A;  2E2N A;  3QIC A;  1QVF M;  4H5V A;  3VER A;  3QB0 A;  3O9S A;  4CZJ A;  1SS6 A;  1U2V A;  3ZX0 A;  5M1N A;  3CJB A;  1X3N A;  5EY4 A;  2Q0R A;  1IJJ A;  2YJF A;  1K8K B;  4WQ4 A;  2GEM A;  3CER A;  2QWL A;  3VES A;  2CGL A;  2ZGZ A;  5AQQ A;  3VEV A;  2P9K B;  2YX6 A;  3R1X A;  3ATU A;  3FZM A;  3O80 A;  3ZET A;  4JKF A;  3CXC M;  1VQP N;  4IEI A;  1KAZ A;  3KWI A;  2VCP A;  3L4Q A;  2VYP A;  3LM9 A;  4GNI A;  3J7Z O;  1LOT B;  3DWL A;  3AY9 A;  4KBO A;  4WQ5 C;  4A2B A;  2GWK A;  1GLA G;  3LDN A;  2GX9 A;  4M63 C;  1JJ2 M;  4YOV A;  2BH1 A;  2JWK A;  4ISE A;  2CH5 A;  5I9E B;  5DM6 L;  4H5T A;  3FE1 A;  2H3G X;  3A5L C;  4YOT A;  3WEE A;  4A59 A;  4BGA A;  5AQG A;  2GWJ A;  2ZJQ L;  1T3V A;  5ELZ A;  4JK7 A;  4BG9 A;  5CHI A;  3E66 A;  4JKB A;  1NWK A;  2HMP A;  3EL2 A;  4FWK A;  2QWR A;  3EZW A;  4AM7 A;  1T6D A;  3EE8 A;  2E8A A;  4CD3 A;  4FWL A;  1NJI O;  4MDA A;  1ZBS A;  4PKI A;  1T44 A;  3W3D A;  5AQU A;  4OPH A;  3CJ9 A;  3M6G A;  1K8A O;  2C1G A;  1VQ5 N;  4ILG B;  2P9U A;  3QBW A;  3Q7B A;  5HOO A;  4GV9 A;  3TU5 A;  2HBK A;  4WYB A;  1RDU A;  3D6R A;  3OA9 A;  5FPN A;  5BRD A;  4EFH A;  3KVG A;  3O08 A;  1NGF A;  5GAH P;  2QA4 N;  5ADX H;  1KAY A;  3H3O B;  2VGN A;  5C15 A;  5JIC A;  3UKR B;  2Q36 A;  4CBX A;  4IJA A;  5AQW A;  3VF2 A;  4DHY A;  3AAQ A;  4JKG A;  5GAD P;  3UKU B;  5LJW A;  2Q97 A;  3ZX2 A;  1P8Z A;  2E1Y A;  4BC4 A;  3B8A X;  4IXC A;  3O1W A;  4Z94 A;  5BN9 A;  5JMV A;  1DEJ A;  3GOI A;  3IFR A;  2AA4 A;  2GTD A;  4AM6 A;  3R9P A;  2I7P A;  3PIO L;  4FWN A;  1IG8 A;  2CGJ A;  4G9Z A;  2IVP A;  4PL8 A;  3EKU A;  4L3Q A;  1VAZ A;  3TTD A;  5M1P A;  3I33 A;  3HSC A;  3MWT A;  1TUY A;  4IEE A;  1E4G T;  2KHO A;  1ZC6 A;  3DXM B;  3A5O C;  3MWP A;  5M1Q A;  4HTL A;  3BUZ B;  3WXL A;  3ENB A;  4BQZ A;  3NVK A;  2NRV A;  2J4R A;  2FSJ A;  2PFU A;  3D2E B;  5BPL A;  5F1X A;  3MN5 A;  3UE5 A;  1TYQ B;  4BRP A;  2RHK A;  4U67 L;  4Y0W A;  2VGM A;  3G25 A;  5AQR A;  1Q86 O;  3QBX A;  3P39 A;  3G71 N;  5AQX A;  3OBW A;  2NLX A;  2OAN A;  1HUX A;  1ILY A;  1ATN A;  3FLC O;  4BR4 A;  1C0F A;  4PL7 A;  1VQL N;  3CD6 N;  1OVY A;  4BVP A;  3CCV N;  4I6M A;  4JKA A;  1NM1 A;  4FL9 A;  4H03 B;  2P9P B;  3CJ1 A;  1XUP O;  3O9T A;  3LDQ A;  4EHU A;  4FWO A;  2HBM A;  3P38 A;  3W0L A;  3SMS A;  3DXK B;  1VQ8 N;  3TTC A;  5AZJ A;  5DM7 L;  3VGM A;  3VEN A;  2A42 A;  4ISG A;  1JCE A;  3CHW A;  3SMP A;  4JKD A;  5KPR A;  3BEX A;  3VEZ A;  2FSN A;  1R59 O;  1NGA A;  2UYT A;  3MMV A;  2E2O A;  3G4S N;  5AQP A;  3CC4 N;  4IO8 A;  2HF4 A;  3Q7C A;  2QWQ A;  2F7T A;  5AQM A;  4FVU A;  2P9N B;  3MX2 A;  2RE2 A;  3C6A A;  4JD2 B;  4BEC A;  3AGK A;  3SLC A;  1VQ9 N;  4B1U B;  4BRM A;  1K9M O;  1GLC G;  1BG3 A;  3ID6 A;  4ILH A;  3C0B A;  3O8M A;  1KXP A;  2E2Q A;  2IVN A;  4JHD A;  4A62 A;  4JK8 A;  3WEE B;  4A5B A;  4CBW A;  4EIA A;  3HOT A;  3RSE A;  1DKG D;  2EWS A;  4BR5 A;  4BRD A;  4EHT A;  3PLA A;  4B1Z A;  2QWP A;  2FLO A;  3IMX A;  3CCQ N;  3SJH A;  4JN4 A;  2KLA A;  5CR4 A;  2ZWH A;  3P4I A;  1VQ6 N;  3C7N B;  3H45 C;  1BUP A;  4FWM A;  3I55 N;  4BEB A;  1S22 A;  2A40 A;  4XJX A;  2QM1 A;  5BR9 A;  5AFU H;  4QS8 A;  4B1Y B;  1EO1 A;  2ITM A;  3VEO A;  3WT0 A;  4JKE A;  1K73 O;  2FF6 A;  3VPZ A;  1P90 A;  4JKH A;  5AZI B;  3FZH A;  1YJN N;  1Q82 O;  4BRK A;  4BR0 A;  4EAH D;  3OHR A;  5LY3 A;  3SBG A;  1WOQ A;  4C23 A;  2P9S A;  3QFU A;  4BRN A;  3GE1 A;  5F0X A;  5GIO A;  2P9L A;  4BC3 A;  2YJE A;  1O13 A;  4WFN L;  2NRX A;  5EXW A;  5ADX A;  5JVG L;  2QTD A;  3FZL A;  1SAZ A;  3MDQ A;  3M3Z A;  5AQH A;  2OTJ N;  4BQL A;  3L4I A;  1GLL O;  2ASO A;  2DPN A;  1NGG A;  1JCF A;  3VGL A;  4BRQ A;  4B1W B;  5AQO A;  4H5W A;  3WQU A;  4FWS A;  1K8K A;  3A5N C;  3CPE A;  3ENO A;  1ZXO A;  5BPM A;  2E88 A;  2P9K A;  5AQI A;  3M5R A;  4FWQ A;  2V52 B;  3MN7 A;  4FPB A;  2A5X A;  3NMU A;  3ENH A;  5GAE P;  3LDL A;  1GLB G;  1BO5 O;  4YOW A;  1WUA A;  2W41 A;  3TTF A;  5FPD A;  4KH5 A;  1MDU B;  2NRR A;  4O8U A;  3SAG A;  4FO0 A;  3IKM A;  1OKJ A;  2VWB A;  3TSQ A;  4M7Y A;  2YI1 A;  5AQJ A;  1HKG A;  4A2A A;  2QWN A;  4CZM A;  1MA9 B;  2GUP A;  1HKC A;  5BRH A;  2W00 A;  2YHW A;  3CCM N;  4ISF A;  2NRT A;  5AQY A;  4ILJ A;  4RTF D;  1DGK N;  3H6E A;  5KQD A;  1QZ6 A;  4YDU A;  3CPW M;  3C65 A;  2QXL A;  1HKB A;  5JLF A;  2HST A;  1NMD A;  2P9I A;  3FR0 A;  4PHT X;  2Q31 A;  3ZEU B;  1KC8 O;  1KQS M;  1NGE A;  4CZH A;  3D2F B;  3CIP A;  3SAF A;  1N8R O;  3LM2 A;  3CC2 N;  1HLU A;  1X9J A;  2IVO A;  4DQ8 A;  5BRE A;  1GLF O;  4XH5 A;  2ASM A;  5B8H A;  3FZF A;  4QS7 A;  5KPT A;  2Q0U A;  2V7Z A;  3VF4 A;  3AAR A;  2WUS A;  3A8Y A;  4CI6 A;  3WUH A;  3F9M A;  3H1V X;  4IWV A;  1VQ7 N;  1NGJ A;  1KD1 O;  3A0I X;  3A5M C;  3EKS A;  3HM8 A;  3U9Z A;  3UKR A;  4GVE A;  2HOE A;  4WCE L;  4BRH A;  1H1V A;  3O6W A;  4OPA A;  4CZK A;  4A57 A;  3K9K A;  3GBT A;  4BR9 A;  5KQ8 A;  1YIT N;  3CET A;  3O5B A;  1QZ5 A;  1NBW A;  3TSP A;  4B9Q A;  5JLH A;  5LJV A;  1BOT O;  4CBU A;  4XH1 A;  2YHX A;  1HX1 A;  3FGU A;  4K41 A;  4A61 A;  5C12 A;  4DB3 A;  3DJC A;  3HI0 A;  3MCA B;  4WFB L;  3CQX A;  5GIP A;  5KPZ A;  3JS6 A;  4BG8 A;  3CCR N;  4H5N A;  4CZI A;  4GY2 B;  4GV6 A;  5TKY A;  5AQV A;  1RDW X;  2IIR A;  2YCH A;  3AAP A;  1U2V B;  1QQN A;  3F2K A;  5C10 A;  2GEL A;  5GIN A;  1NGD A;  1RFQ A;  3O9R A;  3CCU N;  4AF1 A;  3CJC A;  1Q18 A;  1HPM A;  3DXM A;  5EVZ A;  1YJW N;  4NLB A;  4R79 A;  1RGI A;  2KKZ A;  4JEP A;  2V7Y A;  3FZK A;  5AQS A;  4BR7 A;  3D2E A;  1S72 N;  3ATV A;  3KWG A;  3ZET B;  4OO1 J;  5EOY A;  1M1K O;  4C1N K;  4IOC L;  3DAW A;  3ID8 A;  3LDP A;  2QI2 A;  4K42 A;  3RVC A;  4BRI A;  1C0G A;  4KH6 A;  4BRC A;  3CMA N;  4HWI A;  3LDO A;  1GLE G;  3GG4 A;  2E20 A;  3K9J A;  3VOV A;  3G6E N;  1MWM A;  2FSK A;  3O4W A;  3ULE A;  5AFU A;  4MO4 A;  1YHQ N;  3VEX A;  3HZ6 A;  1GLJ O;  3MX5 A;  4NLC A;  5FPM A;  4BY9 C;  5M1F A;  2P9P A;  5E84 A;  3JXU A;  2QEX N;  3I56 N;  2Q2R A;  1NLV A;  2D1K A;  2YHY A;  5M1O A;  1VQO N;  3MN9 A;  4H0P A;  1EQY A;  2WFB A;  3VTI A;  3VTH A;  3QML A;  1U6Z A;  3MK6 A;  1GLD G;  3DXK A;  3CCE N;  2NRH A;  1Y64 A;  3U4L A;  4BC5 A;  2FXU A;  3M1F A;  2W40 A;  4JKC A;  4BRO A;  2D4W A;  3E9P A;  1VQ4 N;  3CI5 A;  1ESV A;  3KK7 A;  3U8X A;  3TPQ A;  4UY8 O;  4FSV A;  4H0X B;  3KZB A;  2D0P A;  4IOA L;  1X3M A;  3TSU A;  2P9U B;  2F9T A;  4WF9 L;  4K25 A;  1YIJ N;  1YUW A;  3LL3 A;  4NB4 A;  1BWF O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...