4PL7A

Structure of komagataella pastoris actin-thymosin beta4 hybrid
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
425
structure length
382
Chain Sequence
VAALVIDNGSGMCKAGYAGDDAPHTVFPSVVGSFVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRLAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYASGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYTFSTSAEREIVRDIKEKLCYVALDFDQELQTSSQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEASGIDQTTYNSIMKCDVDVRKELYSNIVMSGGTTMFPGIAERMQKELTALAPSSMKVKISAPPERKYSVWIGGSILASLGTFQQMWISKQEYDESDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
pubmed doi rcsb
source organism Komagataella pastoris
molecule tags Structural protein, contractile protein
molecule keywords Actin,Thymosin beta-4
total genus 126
structure length 382
sequence length 425
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01290 Thymosin Thymosin beta-4 family
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4pl7A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4pl7A01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4pl7A03
3SJHA 2E1YA 2ZWHA 2D0OA 2HOEA 3QDKA 3GBTA 4FWQA 2WUSA 1J6ZA 3O80A 3VGKA 4RCHA 3MN6A 3U9ZA 5AQQA 4EHTA 2YCHA 4ISEA 3VGMA 3M1FA 1GLCG 1NGBA 4H5VA 2VYPA 2Q0UA 3L0QA 5EY4A 2GELA 4PKHA 3QB0A 1NGJA 5AQKA 2YJFA 1H1VA 4BC4A 4BG8A 5FPEA 4JN4A 4BR0A 2PBDA 3O08A 2DPNA 2GWKA 5E26A 2NRHA 4B1VA 2AP1A 3JXUA 3VEOA 5AQOA 3VENA 4E1JA 1IG8A 3QFUA 4FL9A 1X9JA 3GG4A 2YHYA 5FPNA 1NLVA 1ATRA 4H5NA 1RFQA 5AFUA 3VF2A 1E4FT 5ADXH 2V52B 3KZBA 4WQ5C 3WEEB 3WUHA 4CZEA 2I7PA 2P9NA 5KPTA 1NWKA 3H3NO 1C0GA 2QWNA 2W40A 4O5FA 3CI5A 4H0TB 4YDUA 3MCPA 2PAVA 4CZGA 4BRQA 3ATVA 1NM1A 3UE5A 4H0VB 1WOQA 1TYQA 3O8MA 1MWMA 2F9TA 1G99A 3H46O 3GE1A 3IMXA 2BUPA 4CZIA 1BUPA 4BRDA 1D4XA 4BRPA 1T6CA 4EIAA 1Y64A 2FSJA 1MA9B 1BO5O 2ASMA 2VWBA 3HTVA 3QICA 4BRFA 4H5TA 5ADXA 1NGEA 2P9UA 3W0LA 1ZBSA 1XC3A 3BF1A 3A5LC 5BN9A 2QWQA 3BUZB 5LY3A 3ZETB 3WEEA 2HF4A 4KBOA 3VOVA 4A2AA 2YHXA 2P9NB 3LDNA 4LC9B 3DXKA 2Q97A 3A5NC 2AA4A 2W41A 1JCEA 5KPRA 5AQSA 4NO7A 2GTDA 3CJ1A 3H1QA 3W3DA 2Q36A 5AZIB 4BC3A 3R6MA 4BRCA 1IJJA 1SAZA 1Z05A 3HBTA 5AQUA 3ZEUA 3UKRB 3VETA 2ITMA 4BRNA 5CE3A 3LM9A 4I6MA 3H3OB 4CZLA 4B1XB 2QWLA 3SMPA 5AQNA 4BROA 1KXPA 1NMDA 2A3ZA 2FF3B 4XH1A 3VERA 2NLXA 3I33A 4H03B 1YVNA 5F0XA 1BDGA 2I7NA 4CZJA 3UB5A 3A0IX 3QBXA 4FWRA 3VESA 3FLCO 4BRIA 2BTFA 1T6DA 4CD3A 1E4GT 2D4WA 3ZEUB 4NB4A 5AQVA 2P9PB 3WXJA 3R8EA 4JNEA 5AQRA 5FPMA 4AM6A 4Z94A 1BU6O 3O5BA 1LCUA 3DAWA 4FPAA 1BG3A 1U6ZA 3KHYA 3MN5A 3WXIA 3ZX2A 3H1VX 1YXQA 2P9KB 3OHRA 4C23A 1QQMA 4FWLA 3DXKB 1K8KB 2P9IB 2GWJA 1HPMA 1SZ2A 3G25A 4XEIA 4BRHA 4F9OA 4RTFD 2V51B 4BRLA 3KVGA 5BRHA 1SQKA 1ZC6A 4IZ9A 3CJCA 2ASPA 4CZHA 3CJ7A 1GLDG 3R9PA 2E2NA 5AQWA 1NGCA 5KQDA 3ZX0A 4FSVA 4ISFA 5AQGA 4BQZA 1X3MA 3GL1A 3WQUA 3CETA 3VGLA 3BF3A 3AY9A 3H45C 4BR2A 4B1UB 3MN9A 4BC2A 4EHUA 4DHYA 1TUUA 4EFHA 4ISGA 4O8KA 5EXWA 4BRMA 1RDWX 4FOEA 4CZKA 5BRDA 4MO4A 3UKUB 3FZHA 1JCGA 3O4WA 4H5RA 1X3NA 2CGJA 4A2BA 1GLEG 3RSEA 1NGIA 1Z6RA 2FXUA 3BEXA 3UKRA 4MO5A 3BP8A 2V7ZA 4DB3A 4B9QA 2P9KA 3VF6A 1MWKA 3VEVA 1YUWA 3U8XA 5BPNA 3DXMB 5ELZA 4IO8A 3FE1A 4XH4A 3A5MC 4CD1A 2E1ZA 2P9SB 2QW9A 4BREA 1NGAA 4YDUC 4FWNA 3DXMA 4CZFA 3LDLA 4CZMA 2GUPA 3EL2A 4DCHA 5EVZA 5EOYA 4IWVA 1BA1A 2QWMA 1ATNA 1CZAN 3WQTA 3ENOA 1GLLO 2P9PA 1S3XA 5F1XA 2Q2RA 4H0PA 4GNIA 4CBXA 1ZXOA 4FOIA 2E20A 4BRKA 2P9UB 2IVPA 5FPDA 4K43A 3LDQA 3FGUA 4BVOA 3JS6A 2FSKA 1V4SA 2HF3A 2YJEA 4FWMA 2OANA 4H0XB 1DKGD 3FFKB 3M3ZA 3LM2A 1KAXA 3B8AX 3GOIA 1HX1A 4A62A 3CJAA 3TPQA 2GEMA 5AZIA 1QZ6A 3DJCA 2CGKA 4K25A 4CI6A 5JMVA 4JD2A 3ULEB 3M6GA 1XUPO 4RWTA 2QXLA 3IDHA 5BR9A 5BPMA 5LJWA 3U9DA 3D2EA 2CGLA 2Q0RA 4JD2B 3ULEA 3CQXA 1BOTO 3DWLA 1HKGA 2A40A 2D0PA 2ZGZA 1DEJA 1NBWA 2YI1A 3D2FB 4DQ8A 4MLHA 1NGHA 4J8FA 3WXKA 1C0FA 2E2OA 3CERA 1DGKN 5AQXA 4BR9A 5KQ8A 3C0BA 5AQHA 4B1ZA 3CQYA 3VPZA 3EN9A 5LJVA 1R59O 4M7YA 3UKUA 4H0OA 3TU5A 4Y0WA 1S22A 5AR0A 3EO3A 4WYBA 3IFRA 2IVNA 1QZ5A 2UYTA 4PKIA 4H0YB 3MK6A 5AQPA 3L6QA 5AQLA 3IUCA 2IVOA 4JAXA 3D7EO 4PKGA 3S41A 2ASOA 2P9SA 2QWOA 2ZF5O 4CBUA 4PL8A 3O1BA 4BQLA 4WQ4C 3RSEB 1HKCA 4BVPA 3LDPA 2QWRA 2A5XA 1HKBA 3A5OC 4IJNA 2QWPA 1OKJA 2YHWA 3AAQA 3VF4A 4M63C 4WQ4A 4BG9A 3D2EB 5JICA 4AM7A 4PL7A 3VEZA 3HSCA 1KAZA 4MLEA 3SMSA 4B1WB 5JLHA 5AQYA 3EKSA 4CJ7A 2E2PA 3GDQA 1Q18A 1XQSC 3ZETA 1NGGA 5KPZA 4BGAA 3HI0A 1TUYA 2H3GX 4H5WA 1U2VB 5TKYA 3I8BA 1HLUA 2FF6A 1NGDA 2VCPA 4BC5A 3MMVA 3QFPA 4CBWA 3FZLA 3EKUA 5AQMA 2CH5A 4QS8A 2Q1NA 2FSNA 5EX5A 3U4LA 3LDOA 5AQIA 5JLFA 3ID8A 3J8AA 2P9LA 3EZWA 3FZMA 5AZJB 3HZ6A 3WT0A 5AFUH 5BN8A 3QBWA 1P8ZA 4FWOA 1QHAA 4A61A 1V4TA 5AQTA 4BRAA 3FZFA 3D2FA 1NGFA 5F2RA 3AAPA 4IJAA 2A6AA 2P9IA 4K42A 4B1YB 1BA0A 2QM1A 4HTLA 1QQNA 2CH6A 2V7YA 4JHDA 4QS7A 4XH5A 3CHWA 3AARA 2E8AA 3C7NB 1K8KA 2ZGYA 4IXCA 3P4IA 2F9WA 1BWFO 3F9MA 3LL3A 1QQOA 3H6EA 4FPBA 4BR7A 4JHDB 1GLAG 5BRFA 4L3QA 3CIPA 2IIRA 2NZTA 1T44A 3VEWA 2Q31A 3CJBA 4FWKA 3WXLA 3SK3A 1EQYA 3O6WA 3ZX3A 5BREA 4WQ5A 1GLFO 1YAGA 4BGBA 4K41A 2EWSA 3VEYA 4EAHD 1JCFA 1LOTB 4QS9A 5E84A 2D1KA 3MN7A 5B8HA 2P9LB 1U2VA 5AZJA 3FR0A 2E88A 2HMPA 3ENHA 3MDQA 4FWSA 1ESVA 3SLCA 4FWPA 2A42A 3O1WA 4M7XA 1ATSA 3L4IA 1KAYA 1TYQB 3CJ9A 2J4RA 3FZKA 2FLOA 2E2QA 5BPLA 4I6MB 3VEXA 1GLBG 4GY2B 4BRGA 4BR4A 4HWIA 1RGIA 3C7NA 1HUXA 4BR5A 1HJOA 5AQJA 4FO0A 3HM8A 3ATUA 5AQFA 1MDUB 1GLJO 1WUAA 5I9EB 3A8YA 3QMLA 2A41A 2KHOA 5AQZA
chains in the Genus database with same CATH superfamily
1L3SA 3SJHA 3T3FA 4C1NI 1CZ9A 1RT6A 1NJYA 3HPOA 3UIQA 4JKHA 2HMIA 4RCHA 3MN6A 4HUGA 3O3FA 5AQQA 4EHTA 3TAMA 1BISA 4ISEA 4OVLA 4IEIA 1ZYQA 1N32K 4H5VA 3J7AP 2VYPA 4E1NA 2KQ2A 3OYFA 2HBKA 1KC8O 4WCEL 5LMNK 4JN4A 4IOXA 1RDBA 3O08A 2O8FA 4CERA 1M90O 4FJ5A 4ELVA 4KHPK 1TK0A 2NRHA 3BZKA 3JXUA 3VEOA 5GIPA 3GG4A 5JENA 4B9UA 1NLVA 2QI2A 3G10A 1K8AO 5AFUA 3D6RA 1SL2A 3OYCA 4PA1A 5E41A 3WUHA 4G1QA 4NYNA 1DT9A 1BQNA 2P9NA 5KPTA 3H3NO 3ZT4A 1HNVA 4DTPA 1NK4A 1N33K 2R7YA 1OVQA 4O5FA 2E5LK 4CJEA 4DFJA 3BZCA 4OGCA 1U49A 3AA2A 4YOVA 1TV6A 1LAWA 3O8MA 3K5OA 4M41A 2GBZA 3H46O 3D0PA 2UUBK 1L3TA 5J2MA 4FLYA 4LF4K 4BRPA 1N6QA 4O55A 2FSJA 4H5TA 1YTAA 4DQSA 1KFSA 2JWKA 3HXMA 4CEBA 3B6OA 3I8DA 4CJQA 5GAEP 3BUZB 4CK1A 5LY3A 3ZETB 4O5BA 4OX9K 4N56A 3NHGA 2YHXA 1HMVA 1W7AA 3TARA 1OH7A 1JLQA 2D5RA 3DRRA 3AV9A 3AVIA 3VN5A 1XC9A 2GTDA 5FLXO 3R6MA 5HLFA 3CC4N 3WNGA 3TR8A 3LP0A 3VETA 4EP4A 3O9RA 4ZTJA 4W5NA 1CXQA 3SMPA 4BROA 3KKRA 4N76A 2FF3B 4WE1A 1XNQK 2NLXA 1Y97A 3I33A 1SKRA 1YVNA 1VSMA 1BIUA 3JYTA 3FLCO 2BTFA 4CD3A 4Z4IA 5HP1A 3NGZA 4O8UA 3F9KA 2XO7A 2ZJRL 5AQRA 4AM6A 2YNIA 4Z94A 3EYZA 3F5TA 2OPSA 4FPAA 1BG3A 1U6ZA 2HNYA 3AO5A 3KHYA 3MN5A 3WXIA 3LANA 2NRTA 3CMAN 3LAKA 1CZBA 4F2RA 4JYAK 3T1HK 1FKPA 4Y1CA 1HNZK 1FKOA 1LWEA 1SQKA 3HPHA 3CCLN 4AHRA 4PY5A 4CZHA 3SPYA 3CJ7A 4LSNA 3HO1A 1NJXA 1NGCA 1RTJA 5KQDA 3KD5E 2W6KA 3QETA 3KJVA 4WFAL 3SUOA 2FBTA 3WQUA 3CCJN 1WAFA 3SYZA 3PIPL 4CFAA 3C6AA 1VQLN 2P1JA 4B1UB 3AA5X 3CFRA 2O8BB 4EFHA 3MEDA 4O8KA 4BDZA 1W97L 1NOZA 5BRDA 5LMUK 4B3TK 3UKUB 3FZHA 2KTQA 4OJRA 2VG7A 3L4QA 4H5RA 4RW6A 1LV5A 2CGJA 4B9SA 1ASVA 1YJNN 3MAQA 1L3UA 1NGIA 3BEXA 4KFBA 3BP8A 2HHVA 2P9KA 1MWKA 3OVNA 5ELZA 3NVMA 2A1RA 4XH4A 4CD1A 3K57A 2P9SB 5HRRA 1T3VA 4YDUC 3RMAA 3BY5A 3LP2A 1TKZA 2OPPA 1JLFA 4J2BA 2QWMA 3QEVA 4FZXC 3TSPA 1GLLO 5FRMA 2Q2RA 1NK0A 4GNIA 1ZXOA 5CHIA 4AHUA 2E20A 4BRKA 5JS2A 2HBMA 5FPDA 4DSKA 3JS6A 2OTLN 5HL7L 4DV0K 3U6FA 4IFYA 4A5AA 3OTOK 4UY8O 3CG7A 2O8EB 1KAXA 3GOIA 1HX1A 4H8KA 3CJAA 3TPQA 3PX6A 5DK5A 1BL3A 2IS3A 4DV5K 2ZM6K 1SKWA 2Z1HA 2IC3A 4M3TA 1XUPO 3CFOA 4FJHA 1BHLA 3U9DA 3D2EA 2CGLA 3R1XA 3OYIA 3CQXA 1YI2N 1HKGA 4CJSA 4DR5K 4KAZA 1DEJA 2YI1A 4BWMA 4DTRA 4MLHA 4IKFA 4J8FA 3K5NA 4KRFA 4JKEA 1LWCA 4BR9A 3C0BA 5AQHA 4B1ZA 1FW6A 1R59O 4Y1DA 3UKUA 4LF8K 4Y0WA 1S22A 5AR0A 4F8RA 1JJ2M 4JS5A 1RBVA 1UOCA 1VQON 4IG3A 3MK6A 3IUCA 3G4SN 1QQCA 3HPGA 4CHZA 4Q5VA 3D7EO 1IV0A 1VSJA 2QWOA 4CGFA 3NAEA 3C95A 3EY1A 4CBUA 1RBUA 4DSLA 4CGHA 2OZSA 3O1BA 2VQEK 2XY5A 3RR8A 1JXEA 3CCEN 3A5OC 2QWPA 4JKGA 3TTCA 1GOCA 3VF4A 4WQ4A 4HTUA 4FJKA 1WSJA 1B9DA 4PL7A 4Z0UA 3HSCA 4JKCA 4KB1A 4CJ7A 4PQUA 3GDQA 3ZSOA 4O4GA 5EU7A 4BACA 1XMOK 4YOUA 1QSYA 1NGGA 3HI0A 1TUYA 1U2VB 1RBTA 1LWFA 4NYFA 4RW9A 4JI4K 3QFPA 3OA9A 2AJQA 1QE1A 3EKUA 1I39A 3J80O 5CY4A 3K9KA 4M3ZA 5EX5A 4H4OA 4B3RK 3V1QA 2P9LA 2YKMA 4DQRA 2BDPA 3EZWA 4FM2A 1VQ5N 3WT0A 2Y1IA 5BN8A 3B6PA 2VWJA 3ITHA 3TABA 4CFDA 3MXJA 2O8DA 1CXUA 1IKYA 1NGFA 2UXBK 4IJAA 4KHQA 2P9IA 3SUNA 1QQNA 1ZBUA 4JHDA 4CE9A 1NJIO 4QS7A 1A5XA 3C7NB 1S9GA 5CYMA 4BE7B 3E9OA 4HUEA 1BWFO 1C0TA 1GLAG 3CJBA 4FWKA 2W42A 3RVCA 5BREA 4WQ5A 4BGBA 4K41A 1LOTB 3M8SA 1KVBA 1RT3A 5B8HA 4IDKA 2B5JA 1B92A 3SI6A 3FR0A 3RMBA 3ENHA 3MDQA 3L2WA 2G8WA 1I94K 3SLCA 3O1WA 4DU1A 3C6HA 1IKXA 5J2PA 4U67L 1VQNN 4CGGA 2KZZA 1TVRA 1X9SA 4CF1A 5C24A 3G6EN 4DWIA 4RW8A 3SZ2A 1HJRA 3AO2A 4CEQA 3ATUA 5AQFA 1MDUB 1GLJO 5HBMA 1WUAA 5I9EB 3A8YA 3V1RA 4E19A 3AVHA 4CJWA 3CC7N 1J5OA 3ZT1A 3QDKA 3GBTA 1J6ZA 3AVLA 4FJGA 4N5SA 4B8CA 2GUIA 3M1FA 3EEQA 4CJKA 4DQQA 4OLBA 4JI3K 3KWGA 3ZLJA 2GELA 3DOLA 3S3MA 1NGJA 4ELUA 5FRNA 1H1VA 4BG8A 3KLEA 3NH0A 2PBDA 3RRGA 2DTUA 1KVAA 2DPNA 3CD6N 4ZHRA 4Z4GA 4CJVA 1S1WA 2AP1A 3ENBA 3IRXA 3QFUA 4FL9A 3EZ5A 1X9JA 2OZMA 1RBSA 3DLRA 3T7ZA 2PZSA 3K5MA 2UXCK 5KI6A 3KKSA 3OY9A 2HBLA 1SS6A 3C94A 1VQ4N 3TAQA 4DUZK 2JGUA 3CI5A 3Q7CA 4CZGA 4J2DA 1QVGM 2ZJQL 1FK9A 4X66K 4GVEA 1WOQA 4LFCK 3F2KA 3ISNC 1U04A 3VQDA 2F9TA 1C1CA 1G99A 3GE1A 3IMXA 3DRSA 2BANA 1KTQA 1T6CA 4MDAA 4JI1K 4EIAA 4DTOA 1Y64A 1BO5O 2VWBA 3HTVA 5ADXA 1NGEA 3KTQA 5CR4A 1VRUA 4KV8A 3BF1A 1W2BM 3A5LC 5BN9A 4YY3K 3WEEA 2HF4A 2OCEA 3TTFA 3VOVA 3HP6A 4N41A 3LAMA 3VQ7A 2VGMA 4AHCA 4JI8K 4FJNA 2Z1JA 4CJ5A 5M1PA 4O0IA 4CF2A 2W41A 1WN7A 5KPRA 3AVGA 3QIPA 4NO7A 4ELTA 5AZIB 4BC3A 3TAPA 1JLBA 1IJJA 1ASUA 1SAZA 4M3RA 4BRCA 3VA0A 1Z05A 3HBTA 4Z4EA 3JAMO 5AQUA 3UKRB 4TSXA 3I0RA 3ZSRA 4DFPA 3VQ8A 5LL6Z 5CE3A 1IKWA 3O9SA 4JKFA 4CEDA 4CZLA 4B1XB 2G8VA 2QWLA 4WF9L 4DTSA 4J2EA 4K8ZA 3WNFA 1QHTA 4JS4A 4XH1A 5HOOA 2ZE2A 5F0XA 4AQYK 1X9WA 3QBXA 4E7KA 3VESA 4KHUA 1T6DA 2HHQA 3KD1E 1E4GT 3ZEUB 4NB4A 4CVNE 2JWLA 4CEZA 3R8EA 4NCBA 4KB0A 1LCUA 1Q82O 3LALA 2D0AA 4GV3A 1Z25A 1YXQA 2P9KB 4CHNA 3DXKB 1RTDA 4LH5A 1F21A 1WSHA 4DV4K 3CYGA 1SZ2A 3G25A 3THWB 4BRHA 4F9OA 5H1SQ 2V51B 2HSTA 5C10A 3VA3A 2HVIA 1K6YA 3KVGA 5BRHA 5HROA 1WSIA 4I9QA 4HCBA 4KHSA 3QIOA 1GLDG 2WC9A 3OYKA 3QLHA 5AQWA 2WFBA 4BY9C 1J54A 4BQZA 3GL1A 1UA1A 2I5JA 3VGLA 3AY9A 1HNXK 5C42A 3MN9A 4BC2A 1BI4A 2NRVA 4EHUA 4DR1K 3DMJA 1NNEA 1TUUA 3PIOL 5EXWA 1RDWX 4FOEA 4CZKA 2NRWA 3ZSZA 1KVCA 4PWDA 4DSFA 2P5GA 3KK1A 3NH2A 4KHNA 4DG1A 1JCGA 1S6QA 3O4WA 2RPIA 1KCFA 1WLJA 3KLFA 4DFKA 3UKRA 4U7BA 4MO5A 3AVBA 4DB3A 3VF6A 2HHXA 3U8XA 5BPNA 5KGXA 1TKTA 2E1ZA 4BREA 1NGAA 3S3NA 4KHWA 4FWNA 4CZFA 4WFNL 2O4GA 2GUPA 3EL2A 1LW0A 4DCHA 3ZYYX 4CEFA 5EVZA 5EOYA 4WFBL 2E6LA 3WQTA 1KFDA 1JLAA 2P9PA 2OTJN 1S3XA 3P5JA 4H0PA 4IOCL 4CBXA 1OH5A 4CK3A 1VQ8N 4FLVA 1IH7A 3NDKA 2IVPA 4K43A 4E7IA 2NNWA 2HF3A 4FWMA 2OANA 3DYAA 4C8LA 1DTQA 2O8CB 3V9ZA 4MQ3A 3B8AX 4OKJA 4CFBA 4A62A 3TSQA 4I2PA 4DR7K 3CPWM 1Q81O 3PX4A 3QO9A 4CI6A 5JMVA 4JD2A 2QXLA 2PY5A 1HQEA 3OYAA 4BWJA 4JI0K 4CIGA 3ULEA 4AH9A 1JLCA 1BOTO 4YORA 4DLEA 3VMFB 3C6TA 4BECA 2ZQBA 1NBWA 3ZCMA 1KQSM 4DLGA 3SQ2A 3CERA 4M42A 1QTMA 5AQXA 5KQ8A 3ZSQA 5LJVA 3TTDA 3NF7A 4H0OA 5GINA 2IVNA 1SL1A 1QZ5A 4ID5A 3BDPA 4M3YA 3E01A 2RF2A 3NFAA 3L6QA 4CW7B 1D5AA 1NKBA 1RTIA 3THYB 1C6VA 4MFBA 3S41A 2ASOA 3CYMA 4LF6K 1NG9A 3AGRA 4WQ4C 1JLEA 3NBPA 4FJ9A 4CCHA 1EWQA 1RT2A 3RSEB 5M1FA 1BIZA 2QWRA 1HKBA 1NU0A 1HYZA 4IJNA 3V1OA 4Z4CA 1KD1O 1KLMA 2JLEA 4FW1A 4DF8A 4IFVA 5AQYA 3ZT0A 5SZTA 1XI1A 3K2PA 4UQGA 1Q18A 2O8CA 4BGAA 4BE1A 3OYDA 2H3GX 4A57A 2EHGA 4DSEA 2FF6A 1RCHA 3AO4A 4CBWA 3DLKA 2CH5A 3ALYA 4QS8A 4KKOA 2Q1NA 2FSNA 4FW2A 3U4LA 3LDOA 5AQIA 3J8AA 3J7ZO 3ID6A 2BE2A 5AFUH 4E1MA 1P8ZA 1QHAA 4A61A 3HOTA 2KZMA 4FJ8A 3FZFA 2A1SA 5F2RA 3OYHA 1HR0K 1VRTA 4B1YB 1N5YA 3P83D 4KI6A 1BA0A 2Q3SA 2QM1A 2G8UA 1TKDA 1OH8A 3ZSYA 4XH5A 3AA3A 3CHWA 2XY7A 2E8AA 1YIJN 3L2UA 4C8MA 1IBMK 3SJJA 4IXCA 3V9UA 3F9MA 3LL3A 1QQOA 1S1UA 3H6EA 4LF9K 4X62K 5BRFA 2B4JA 2F4VK 2F96A 2Q31A 1YJWN 1SUQA 3AGKA 4C1NK 4CJFA 3QESA 4NCGA 3O6WA 3ZX3A 4E7JA 3VEYA 2D1KA 1D9FA 4FZZA 1OVYA 4M3XA 5AZJA 3HSTB 4FLZA 3VQ9A 2E88A 2HMPA 4FWSA 4KH4A 2ATQA 4FWPA 3SAFA 4NLCA 1XNRK 1TYQB 1RDUA 2J4RA 3FZKA 2FLOA 2E2QA 3OYJA 3VEXA 1GLBG 2F7TA 4GY2B 1TGOA 4DUYK 4BR4A 4HWIA 2WBNA 1RGIA 1HUXA 4BR5A 2HHUA 1HJOA 4B9LA 2G8IA 5AQJA 4FO0A 3WXMB 1O1WA 1ASWA 2VG5A 1NOYA 2KHOA 1TK8A 2E1YA 2ZWHA 4FWQA 4B9TA 4JEPA 3TI0A 1W9HA 4JI6K 3O80A 3Q7BA 3VGKA 4DV3K 2YCHA 5A2QO 2OA8A 4R5PA 3VGMA 1WB9A 4C8KA 2NRRA 1QVFM 3T1YK 1NGBA 1P90A 1UA0A 4I7FA 4E0DA 3J7YP 1I3AA 3SQ4A 4PKHA 1RT1A 5AQKA 4DQPA 3CM5A 4AILC 5FPEA 3ASMA 2W6LA 3O9TA 2PYLA 1TL1A 5E26A 3HVRA 4KHYA 3VENA 4DQIA 1T03A 4RG8A 5JVGL 4BE0A 2F8SA 2YHYA 4CEEA 3MXIA 1ATRA 3OS2A 4H5NA 3K5LA 1RFQA 4FJMA 4YNQA 1E4FT 1RBRA 3CCSN 4WQ5C 4CHOA 4DFMA 4FLXA 3QERA 1L5UA 1NWKA 4CEOA 4JK9A 4CGDA 3KLGA 1IBKK 2W40A 3SNNA 3LPTA 4H0TB 4YDUA 3MCPA 2PAVA 1L3VA 4BRQA 3ATVA 1NM1A 4GKJK 4CIEA 1VSKA 3OBYA 3DRPA 1A5VA 3V81A 1TYQA 1D9DA 1VAZA 3RTVA 4GKKK 3TAFA 5K14A 4B3MK 2BUPA 3R3LA 1BUPA 3KLIA 4BRDA 4CZIA 3THYA 4IEEA 1D8YA 1UWBA 1MA9B 2RKIA 2ASMA 2KLAA 3QICA 3P1GA 4KREA 2P9UA 2P51A 3T69A 4BDYA 3CCUN 2BH1A 4JK8A 3VTHA 4W5TA 1EETA 1NK8A 4KBOA 4A2AA 2P9NB 3O9UA 5CZ1A 3DXKA 2AA4A 1JCEA 1SKSA 2Y1JA 4CJ4A 3RRHA 3TANA 3W3DA 2Q36A 5DM6L 3AVCA 3ZEUA 2OYQA 4DSIA 4I6MA 3H3OB 4LFBK 3OS1A 4EZ9A 4B08A 5AQNA 2A3ZA 3VERA 2OPQA 3OYMA 3AVAA 3HP9A 4JRPA 4H03B 3DLBA 3IKMA 4FJ7A 3RR7A 2I7NA 4X65K 3UB5A 1XWLA 4FWRA 3ZT3A 3DM2A 3MWPA 1KSPA 5AQVA 2P9PB 4JI2K 1NJWA 4JNEA 5FPMA 1BU6O 4JKAA 1T7PA 3DAWA 3VQ4A 1EP4A 1WAJA 3OYLA 4O44A 1Q7YO 3H1VX 2YNHA 4Q0BA 3SBTA 4FJJA 1A5WA 3G0ZA 1K8KB 2P9IB 4DMNA 2GWJA 1HPMA 4XEIA 2LSNA 3KIOA 3T1AA 2WONA 2WOMA 4IZ9A 3CJCA 4DU3A 1VK0A 1WBDA 4FXDA 2O8EA 3R9PA 2E2NA 3KWIA 3KLHA 1N34K 3HVTA 2W00A 4HVJA 3ZX0A 4ISFA 5AQGA 1DLOA 4RW4A 4DTMA 4DS4A 1ITGA 3I55N 5M1OA 3SPZA 5BR8K 1GOBA 3H45C 4BR2A 4F3OA 3AVMA 3E1YA 1UAXA 2HHHK 5J2NA 1HYSA 2HNZA 4BRMA 2IAJA 4K0KK 3V6DA 4DF4A 3K9JA 3M8PA 3P31A 4HHTA 3KK7A 2XRIA 3S3OA 3IAYA 3SV3A 3SAHA 2QK9A 2DFEA 3RSEA 1Z6RA 2FXUA 4OLAA 3NMUA 3LZJA 4JLHA 1YUWA 3NE6A 1ZBLA 3DXMB 4IO8A 1RILA 1DTTA 3A5MC 4DKWA 2QW9A 3PX0A 2YHBA 5C15A 3LDLA 2X78A 4FK4A 3LWMA 1JL2A 3MEEA 4IWVA 1BA1A 1ATNA 1CZAN 4NXNK 1E3MA 3DI6A 4E89A 1HRHA 3ZSXA 1EKEA 4DTXA 3RWUA 4LFAK 5I42A 1BGXT 2P9UB 1N36K 4AHTA 4DV1K 4HCCA 3VQPA 3LDQA 4CESA 4R79A 2FSKA 3CCMN 2YJEA 2HNDA 3HYFA 5DM7L 3M3ZA 1YTUA 3U3YA 4K8XA 1S72N 3LP3A 4FM1A 1NK5A 2PYJA 3AVFA 5AZIA 3OYBA 1QZ6A 3DJCA 2CGKA 4MDBA 3PO5A 2X74A 1U4BA 3P38A 4RWTA 4X64K 3IDHA 3HM9A 2UXDK 4E3SA 2D0BA 4ILHA 2Q0RA 3CQ8A 5J1EA 1VQ9N 2GV9A 2QEXN 3DWLA 1S1TA 1C1BA 2A40A 4LSLA 1Q9XA 2HHIA 2D0PA 3E9PA 5GAHP 1K73O 1HNIA 3N4PA 1NGHA 4Z4HA 1C0FA 2E2OA 2HHSA 4GMJB 4YOXA 3ZSVA 4OPHA 2Z1IA 3VPZA 3EN9A 1QSSA 4DS5A 2YKNA 3TU5A 3NF6A 4WYBA 3L3UA 3IFRA 3NF9A 2UYTA 1TKXA 5AQPA 3CMEN 3SUQA 2IVOA 3E66A 4JAXA 2XHBA 1M1KO 4DR4K 1BCOA 3RMDA 5HRNA 1VQ6N 4DR3K 2IDOA 3AO1A 1EWRA 3KK3A 1XHZA 4BVPA 3LDPA 3DLGA 2YHWA 4M45A 3PLAA 3MECA 4M63C 5JVHL 1ILYA 2YV0X 2O8DB 3VEZA 3TAGA 4B1WB 5JLHA 2E2PA 3SCXA 3I56N 1S6PA 1XQSC 3ZETA 1HNWK 4GV6A 1MU2A 4OPJA 4H5WA 5TKYA 4CHPA 3NCIA 3I8BA 1HLUA 4YOWA 4GV9A 1NGDA 2VCPA 4BC5A 3QEXA 3FZLA 5AQMA 1X1PA 3ID8A 4XJXA 4ZTFA 4NXMK 5M1QA 3HZ6A 4QCLA 1YHQN 1J5EK 1GOAA 3QBWA 4YOYA 4FWOA 4B9NA 5D3GA 3V9WA 4BRAA 4BDPA 3P39A 3QNOA 4DR6K 4F4KA 4CJUA 2A6AA 2YX6A 4HTLA 1T05A 2V7YA 5HRPA 3SQ0A 3CCQN 3V9XA 4CJPA 4JKDA 1ZBIA 3AARA 3C65A 2F9WA 1HPZA 3THWA 3V4IA 4FPBA 4JHDB 2QA4N 3LZIA 3CIPA 1T44A 3A2FA 4JV5K 3WXLA 1S1VA 1WSGA 1EQYA 1GLFO 4EAHD 4QS9A 5E84A 3JSMA 4DTNA 1Q86O 2P9LB 1WNSA 1S1XA 4ILJA 3MWTA 3L2VA 3M8QA 4OKEA 2Z1GA 2E6MA 4DU4A 2ETJA 1SV5A 1ATSA 3L4IA 1KAYA 4CEAA 1Q9YA 4JI7K 3DOKA 5BPLA 1WBBA 4I6MB 3SUPA 2E4LA 4BRGA 2IOCA 3H08A 3I0SA 3C7NA 4CJTA 3AVNA 1LW2A 3HM8A 4E72A 2X6NA 3QMLA 1CLQA 5AQZA 5J2QA 1JL1A 4DV7K 2G8KA 2D0OA 2HOEA 3M8RA 1J53A 1U48A 1RDCA 2WUSA 4QAGA 4CIFA 4Z4FA 4E7HA 2FC0A 4B3OA 3U9ZA 1VQPN 3LDSA 3L3VA 3NF8A 2XY6A 3HT3A 1GLCG 2RE2A 1ZBFA 4KTQA 2Q0UA 3SV4A 3L0QA 5EY4A 3RMCA 3QB0A 3OS0A 1S5JA 2YJFA 4BC4A 4BR0A 4O0JA 1OH6A 3M5RA 4AF1A 2GWKA 1KLNA 3OBWA 2NRZA 4B1VA 3VQ6A 1NK6A 3O9QA 5AQOA 4E1JA 1IG8A 3QINA 1U47A 1RT5A 1NKEA 4XIUA 4M3UA 4OGEA 5FPNA 3VF2A 1ZBHA 4CK2A 5ADXH 5I3UA 2V52B 3KZBA 2DY4A 3WEEB 4CZEA 2I7PA 3WNEA 1C0GA 3L2QA 4CFCA 2QWNA 3O4NA 1YT3A 1EX4A 4DTUA 4OPAA 4YHHK 3UE5A 5C2DA 3ZT2A 4ID1A 2YHAA 4H0VB 2ITGA 2NUBA 1MWMA 3AO3A 1RDAA 1D4XA 1VSEA 2HB5A 5AJ3K 1RT7A 4BRFA 3HOSA 1JLGA 3W0LA 1TK5A 1ZBSA 2VG6A 4L8RB 2HW3A 1XC3A 1FXXA 5IT9O 1X9MA 1BQMA 4B9VA 2KW4A 1IG9A 2QWQA 3NGIA 4FLWA 1VSDA 1XMQK 4FCYA 5KRTA 1XHXA 3LDNA 4LH4A 4LC9B 4I9LA 4NCAA 2Q97A 3A5NC 5AQSA 1G15A 4KPYA 5M1NA 3CJ1A 3H1QA 4CHQA 1KRPA 3THXA 3AA4A 3CC2N 4CF9A 3HJFA 3CXCM 3AVJA 3VQEA 2ITMA 4BRNA 1VHXA 4FVUA 1K9MO 3PSFA 2D0CA 3LM9A 3LP1A 2G8FA 1IKVA 4FJLA 1JKHA 3KK2A 2FBXA 1KXPA 1NMDA 2QTDA 4KH5A 4FK0A 3L2RA 4G9ZA 2HBJA 3QEWA 5TKWA 1BDGA 1IO2A 4CZJA 3A0IX 1YVUA 4BRIA 4OPKA 4BEBA 2D4WA 3NGYA 3QEIA 3WXJA 3K58A 3PV8A 3TWHA 5C25A 3O5BA 4M3WA 4LD0A 3C6UA 1HQUA 5CZ2A 4FJXA 2EX3A 3S9HA 3ZX2A 2G8HA 3OHRA 4C23A 1QQMA 4FWLA 4GW6A 2P5OA 2YNFA 3SQ1A 4RTFD 4CJ3A 4BRLA 4CJRA 3QNNA 3OYGA 4IO9L 2YNGA 2VGNA 1J9AA 1ZC6A 4J2AA 1NKCA 2ASPA 4LY7A 2O8FB 3NH1A 4DSJA 2FBYA 5FDLA 1C1AA 4FSVA 1RT4A 1RTHA 3U3GA 1X3MA 3T19A 2O8BA 2B6AA 3SBGA 3CETA 3BF3A 4F3TA 3PSIA 4DHYA 4LF5K 2KFZA 4ISGA 2XY8A 3CCRN 3OW2M 4MO4A 2OPRA 3BGRA 4NLBA 4N47A 3VTIA 3TSUA 3N4QA 2UUCK 2C1GA 1X3NA 4JK7A 1GLEG 4A2BA 2QKKA 3EE8A 5JS1A 1WSEA 4B9MA 2V7ZA 4B9QA 3VEVA 3IG1A 4W5OA 5GAGP 5MLCQ 3FE1A 3VQBA 2KFNA 4FK2A 3O3GA 3DXMA 4IFEA 3PO4A 1RNHA 1VQKN 4CZMA 4GVMA 3LPUA 4CF8A 1VQMN 5C2FA 3ENOA 1VSHA 1U45A 2BGGA 4IOAL 3F73A 5F1XA 4FOIA 4KO0A 3OYEA 2DFFA 4A59A 4CJLA 1EXQA 3FGUA 4BVOA 4E7LA 1V4SA 4W5RA 2VQFK 4DTJA 1O13A 4B3SK 4H0XB 4FJIA 1DKGD 5IWAK 3FFKB 3LM2A 3L8BA 4W5QA 3QEPA 2X6SA 2GEMA 4AHVA 4FVMA 4CECA 1REVA 4K25A 3O4QA 3ULEB 3M6GA 4KI4A 3K59A 4DV2K 2O4IA 5BR9A 3OJUA 4CGIA 5BPMA 3VQ5A 5LJWA 2ZJPL 2ZD1A 4FLTA 4JD2B 3WNHA 4ILGB 1TAQA 4IG0A 4ICLA 2QKBA 1YF5L 5GIOA 2ZGZA 3D2FB 4DQ8A 3OYNA 1JXBA 4KTZA 3WXKA 2VWKA 3V9SA 4H4MA 1DGKN 3O3HA 3PY8A 2IGIA 3CQYA 1NMNA 3D45A 4M7YA 1BCMA 3MX2A 3EO3A 3CPEA 4IDHA 2HVHA 4PKIA 4H0YB 4QOZB 3VQCA 1VSFA 5AQLA 4DR2K 4C8OA 1LAVA 4F2SA 4PUOA 5C12A 4FZYA 4PKGA 3HRGA 2P9SA 2ZF5O 1C0UA 3LWLA 3ULDA 1YITN 4PL8A 4CGJA 1TAUA 5KRSA 4BQLA 3E9LA 3CM6A 4JKGB 2WTUA 3VQAA 1HKCA 3J81O 4FM0A 3THXB 2A5XA 3IS9A 1C0MA 4EP5A 1OKJA 3AAQA 4BG9A 3D2EB 5JICA 4AM7A 4CF0A 3DLLL 1KAZA 4MLEA 1TL3A 3SMSA 2HHTA 1VSLA 4RW7A 3EKSA 2UU9K 1SL0A 1NJZA 3K0SA 3CF5L 1RDDA 5KPZA 4KTWA 1R0AA 3TAEA 2NRXA 3PUFA 4B8AB 4HUFA 1Z26A 1FJGK 1Q8IA 3MMVA 5M1KA 2GX9A 4EZ6A 4YOTA 5JLFA 3G71N 5CYQA 1WSFA 1W0HA 3FZMA 5AZJB 2KKZA 3MX5A 4C8NA 5HRSA 3CFPA 4FLUA 4OO1J 3OJSA 4BE2A 5GADP 2RHKA 1V4TA 5AQTA 4V19S 3HL8A 2PFUA 3D2FA 3AAPA 2RN2A 4K42A 3AVKA 3DLEA 3DLHA 1NK7A 2CH6A 3HK2A 4FYDA 4OKKA 4CHYA 1T8EA 5C0YA 1EO1A 1S9EA 1K8KA 5DMRA 2ZGYA 2F8TA 1VQ7N 3P4IA 4AHSA 3THVA 4BR7A 4I2QA 4L3QA 4JI5K 1YJ9N 2IIRA 4KH6A 2NZTA 3EE9A 3VEWA 4DV6K 1NK9A 4JKBA 3SK3A 1YAGA 2EWSA 1JCFA 3S5TA 4A5BA 1VSIA 3MN7A 5SWMA 1U2VA 2DFHA 1BI4B 4JRQA 2UUAK 4LF7K 1ESVA 1QSLA 3MXMA 3SAGA 2A42A 4M7XA 3ZSWA 3CJ9A 3CCVN 5KTQA 1N8RO 3FFIA 3MCAB 4PHTX 5KGWA 5T7BA 3MEGA 4YFUA 4IBNA 5FROA 2C1IA 2QXFA 2HHWA 1HYVA 3VQQA 1QS4A 2FBVA 1IBLK 2A41A 1B9FA 3NVKA
chains in the Genus database with same CATH topology
3SJHA 3CC7N 4C1NI 2E1YA 2ZWHA 2D0OA 2HOEA 3QDKA 3GBTA 4FWQA 2WUSA 4JEPA 4JKHA 1J6ZA 3O80A 3Q7BA 3VGKA 4RCHA 3MN6A 3U9ZA 5AQQA 1VQPN 4EHTA 2YCHA 4ISEA 3VGMA 3M1FA 4IEIA 2NRRA 1QVFM 1GLCG 2RE2A 1NGBA 1P90A 4H5VA 2VYPA 3KWGA 2Q0UA 3L0QA 5EY4A 2GELA 4PKHA 3QB0A 1NGJA 2HBKA 5AQKA 1KC8O 2YJFA 1H1VA 4BC4A 4BG8A 4WCEL 5FPEA 4JN4A 4BR0A 4IOXA 2PBDA 3O08A 3M5RA 1M90O 4AF1A 2DPNA 2GWKA 3O9TA 5E26A 3OBWA 3CD6N 2NRHA 2NRZA 4B1VA 2AP1A 3ENBA 3JXUA 3O9QA 5AQOA 3VEOA 3VENA 4E1JA 5GIPA 5JVGL 1IG8A 3QFUA 4FL9A 1X9JA 3GG4A 2YHYA 5FPNA 1NLVA 1ATRA 2QI2A 4H5NA 1K8AO 1RFQA 3T7ZA 5AFUA 3D6RA 3VF2A 1E4FT 5ADXH 2V52B 3KZBA 3CCSN 4WQ5C 3WEEB 3WUHA 2HBLA 4CZEA 1SS6A 1DT9A 2I7PA 2P9NA 5KPTA 1VQ4N 1NWKA 3H3NO 1C0GA 4JK9A 2QWNA 2W40A 4O5FA 3CI5A 4H0TB 4YDUA 3MCPA 3Q7CA 4OPAA 2PAVA 4CZGA 4BRQA 3ATVA 1NM1A 3UE5A 5C2DA 1QVGM 2ZJQL 3OBYA 4H0VB 4YOVA 4GVEA 1WOQA 1TYQA 3O8MA 3F2KA 1VAZA 1MWMA 2F9TA 1G99A 3H46O 3GE1A 3IMXA 2BUPA 3R3LA 1BUPA 4BRDA 4CZIA 1D4XA 4BRPA 4IEEA 4MDAA 1T6CA 4EIAA 1Y64A 2FSJA 1MA9B 1BO5O 2ASMA 2KLAA 2VWBA 3HTVA 3QICA 4H5TA 4BRFA 5ADXA 1NGEA 2P9UA 3HOSA 2JWKA 5CR4A 1ZBSA 3W0LA 1XC3A 3T69A 3BF1A 3CCUN 1W2BM 3A5LC 5BN9A 2QWQA 2BH1A 5GAEP 3BUZB 4JK8A 3VTHA 5LY3A 3ZETB 3WEEA 2HF4A 3TTFA 4KBOA 3VOVA 4A2AA 2YHXA 2P9NB 3LDNA 2VGMA 3O9UA 4LC9B 3DXKA 5M1PA 2Q97A 3A5NC 2AA4A 2W41A 1JCEA 5KPRA 5AQSA 4NO7A 2GTDA 5M1NA 3CJ1A 3H1QA 3W3DA 2Q36A 5AZIB 4BC3A 3R6MA 5DM6L 3CC2N 4BRCA 1IJJA 1SAZA 3CC4N 1Z05A 3CXCM 3HBTA 5AQUA 3ZEUA 3UKRB 3VETA 2ITMA 4BRNA 4FVUA 1K9MO 5CE3A 3LM9A 3O9RA 3O9SA 4I6MA 3H3OB 4JKFA 4CZLA 4B1XB 2QWLA 3SMPA 4WF9L 5AQNA 4BROA 1KXPA 1NMDA 2A3ZA 2FF3B 2QTDA 4KH5A 4XH1A 2NLXA 3VERA 5HOOA 3I33A 4H03B 4G9ZA 1YVNA 3IKMA 5F0XA 2HBJA 5TKWA 1BDGA 2I7NA 4CZJA 3UB5A 3A0IX 3QBXA 4FWRA 3VESA 3FLCO 4BRIA 2BTFA 1T6DA 4CD3A 4BEBA 1E4GT 2D4WA 3MWPA 3ZEUB 4NB4A 5AQVA 2JWLA 2P9PB 4O8UA 3WXJA 2ZJRL 3R8EA 4JNEA 5AQRA 5FPMA 4AM6A 4Z94A 1BU6O 3F5TA 3O5BA 4JKAA 1LCUA 3DAWA 1Q82O 4FPAA 1BG3A 1U6ZA 3KHYA 3MN5A 3WXIA 4GV3A 3ZX2A 1Q7YO 2NRTA 3H1VX 3CMAN 1YXQA 2P9KB 3SBTA 3OHRA 4C23A 1QQMA 4FWLA 3DXKB 1K8KB 2P9IB 3NVKA 2GWJA 1HPMA 1SZ2A 3G25A 4XEIA 4BRHA 4F9OA 4RTFD 5H1SQ 2V51B 2HSTA 5C10A 4BRLA 3KVGA 5BRHA 1SQKA 4IO9L 3CCLN 2VGNA 1ZC6A 4IZ9A 3CJCA 2ASPA 4CZHA 3CJ7A 1GLDG 2WC9A 3R9PA 2E2NA 3KWIA 5AQWA 1NGCA 2W00A 5KQDA 3ZX0A 4FSVA 2WFBA 4BY9C 4ISFA 5AQGA 4BQZA 4WFAL 1X3MA 3GL1A 3WQUA 3CCJN 3PIPL 3I55N 5M1OA 3SBGA 3CETA 3VGLA 3BF3A 3AY9A 3C6AA 1VQLN 3H45C 4BR2A 4B1UB 3MN9A 4BC2A 4EHUA 2NRVA 4DHYA 3E1YA 1TUUA 4EFHA 3PIOL 4ISGA 4O8KA 5EXWA 4BRMA 1RDWX 4FOEA 4CZKA 3CCRN 3OW2M 1W97L 2NRWA 5BRDA 3K9JA 3P31A 4MO4A 4NLBA 3UKUB 3KK7A 3VTIA 3TSUA 3FZHA 1JCGA 3N4QA 3SAHA 2C1GA 3O4WA 3L4QA 4H5RA 1X3NA 2CGJA 4JK7A 1GLEG 4A2BA 1YJNN 3RSEA 1NGIA 1Z6RA 2FXUA 3BEXA 3EE8A 3UKRA 4MO5A 4U7BA 3BP8A 2V7ZA 3NMUA 4DB3A 4B9QA 2P9KA 3VF6A 1MWKA 3VEVA 1YUWA 3U8XA 5BPNA 3DXMB 5ELZA 3NVMA 4IO8A 5GAGP 5MLCQ 3FE1A 4XH4A 3A5MC 4CD1A 2E1ZA 2P9SB 2QW9A 4DKWA 4BREA 1NGAA 1T3VA 4YDUC 4FWNA 5C15A 3DXMA 4CZFA 4IFEA 3LDLA 4WFNL 1VQKN 4CZMA 2GUPA 3EL2A 4DCHA 3ZYYX 5EVZA 5EOYA 4IWVA 1BA1A 1VQMN 2QWMA 4WFBL 1ATNA 1CZAN 3TSPA 3WQTA 5C2FA 3ENOA 1GLLO 2P9PA 4IOAL 1S3XA 5F1XA 2OTJN 2Q2RA 4H0PA 4IOCL 4GNIA 4CBXA 1ZXOA 4FOIA 5CHIA 2E20A 1VQ8N 4A59A 4BRKA 2P9UB 2IVPA 2HBMA 4K43A 4R79A 3LDQA 3FGUA 4BVOA 3JS6A 2NNWA 2FSKA 5FPDA 3CCMN 1V4SA 2OTLN 2HF3A 2YJEA 5HL7L 1O13A 4FWMA 2OANA 4H0XB 4A5AA 1DKGD 4UY8O 3FFKB 5DM7L 3M3ZA 3LM2A 1KAXA 3B8AX 3GOIA 1HX1A 4A62A 3CJAA 3TPQA 3TSQA 1S72N 2GEMA 5AZIA 3CPWM 1Q81O 1QZ6A 3DJCA 2CGKA 4MDBA 4K25A 4CI6A 5JMVA 4JD2A 3ULEB 3M6GA 3P38A 1XUPO 4RWTA 2QXLA 3IDHA 5BR9A 5BPMA 5LJWA 2ZJPL 3U9DA 3D2EA 2CGLA 2Q0RA 3R1XA 4ILHA 4JD2B 3ULEA 3CQXA 1VQ9N 4ILGB 1YI2N 2QEXN 1BOTO 4YORA 3DWLA 1HKGA 2A40A 3VMFB 1YF5L 4BECA 5GIOA 2D0PA 2ZGZA 1DEJA 1NBWA 3E9PA 2YI1A 3D2FB 3N4PA 4MLHA 1NGHA 4DQ8A 5GAHP 4J8FA 1K73O 3WXKA 1C0FA 2E2OA 3CERA 1DGKN 4JKEA 4YOXA 5AQXA 4BR9A 5KQ8A 3C0BA 4OPHA 5AQHA 4B1ZA 3CQYA 3VPZA 3EN9A 5LJVA 3TTDA 1R59O 4M7YA 3MX2A 4H0OA 3UKUA 3TU5A 5GINA 4Y0WA 1S22A 5AR0A 3EO3A 3CPEA 4IDHA 4WYBA 1JJ2M 3IFRA 2IVNA 1QZ5A 1VQON 2UYTA 4PKIA 4H0YB 3MK6A 5AQPA 3CMEN 3L6QA 5AQLA 3IUCA 2IVOA 3E66A 3G4SN 4JAXA 1M1KO 3D7EO 5C12A 4PKGA 3HRGA 3S41A 2ASOA 2P9SA 2QWOA 2ZF5O 1VQ6N 4CBUA 1YITN 4PL8A 3AGRA 3O1BA 4BQLA 4WQ4C 3E9LA 4JKGB 3RSEB 1HKCA 4BVPA 3LDPA 5M1FA 2QWRA 2A5XA 1HKBA 3A5OC 4IJNA 3CCEN 2QWPA 1OKJA 2YHWA 3AAQA 3PLAA 4JKGA 3TTCA 3VF4A 4M63C 4WQ4A 5JVHL 4BG9A 1KD1O 3D2EB 5JICA 1ILYA 4AM7A 3DLLL 4PL7A 3VEZA 3HSCA 1KAZA 4MLEA 4JKCA 3SMSA 1KQSM 4B1WB 5JLHA 5AQYA 3EKSA 4CJ7A 2E2PA 3GDQA 1Q18A 3I56N 3CF5L 1XQSC 3ZETA 4YOUA 1NGGA 5KPZA 4BGAA 4GV6A 3HI0A 1TUYA 2NRXA 2H3GX 4H5WA 4A57A 1U2VB 5TKYA 3I8BA 1HLUA 2FF6A 4YOWA 4GV9A 1NGDA 2VCPA 4BC5A 3MMVA 3QFPA 4CBWA 3OA9A 5M1KA 3FZLA 2GX9A 3EKUA 5AQMA 2CH5A 4QS8A 4YOTA 2Q1NA 3K9KA 2FSNA 5EX5A 3U4LA 3LDOA 5AQIA 5JLFA 3ID8A 3J8AA 4XJXA 3G71N 3J7ZO 2P9LA 3EZWA 3FZMA 3ID6A 5AZJB 3HZ6A 5M1QA 2KKZA 3MX5A 3WT0A 1VQ5N 1YHQN 5AFUH 5BN8A 3QBWA 1P8ZA 4YOYA 4FWOA 1QHAA 4OO1J 4A61A 5GADP 2RHKA 3HOTA 1V4TA 5AQTA 4BRAA 3FZFA 2PFUA 3D2FA 3P39A 1NGFA 5F2RA 3AAPA 4IJAA 2A6AA 2P9IA 4K42A 4B1YB 1BA0A 2QM1A 2YX6A 4HTLA 1QQNA 2CH6A 2V7YA 4JHDA 3CCQN 4QS7A 1NJIO 4JKDA 3CHWA 4XH5A 5C0YA 1EO1A 3AARA 2E8AA 1YIJN 3C7NB 1K8KA 4BE7B 2ZGYA 1VQ7N 4IXCA 3C65A 2F9WA 3E9OA 3P4IA 1BWFO 3F9MA 3LL3A 1QQOA 3H6EA 4FPBA 4BR7A 4JHDB 2QA4N 1GLAG 5BRFA 4L3QA 3CIPA 1YJ9N 2IIRA 4KH6A 2NZTA 1T44A 3EE9A 2Q31A 3VEWA 1YJWN 4JKBA 3CJBA 3AGKA 4FWKA 3WXLA 4C1NK 3SK3A 1EQYA 3O6WA 3RVCA 3ZX3A 4WQ5A 5BREA 1GLFO 1YAGA 4BGBA 4K41A 2EWSA 3VEYA 4EAHD 1JCFA 1LOTB 4QS9A 5E84A 4A5BA 2D1KA 1Q86O 3MN7A 5B8HA 2P9LB 1U2VA 1OVYA 4ILJA 5AZJA 3FR0A 2E88A 3MWTA 2HMPA 3ENHA 3MDQA 4FWSA 4KH4A 1ESVA 3SLCA 4FWPA 3SAFA 4NLCA 3SAGA 2A42A 3O1WA 3C6HA 4M7XA 1ATSA 3L4IA 1KAYA 1TYQB 1RDUA 3CJ9A 3CCVN 2J4RA 3FZKA 2FLOA 2E2QA 4U67L 4I6MB 3VEXA 3MCAB 5BPLA 1N8RO 1VQNN 4PHTX 1GLBG 2F7TA 4GY2B 4BRGA 4BR4A 4HWIA 2WBNA 3G6EN 1RGIA 3C7NA 1HUXA 4BR5A 1HJOA 2C1IA 5AQJA 4FO0A 3WXMB 3HM8A 3ATUA 5AQFA 1MDUB 1GLJO 1WUAA 5I9EB 3A8YA 3QMLA 2A41A 2KHOA 5AQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJH A;  2E1Y A;  2ZWH A;  2D0O A;  2HOE A;  3QDK A;  3GBT A;  4FWQ A;  2WUS A;  1J6Z A;  3O80 A;  3VGK A;  4RCH A;  3MN6 A;  3U9Z A;  5AQQ A;  4EHT A;  2YCH A;  4ISE A;  3VGM A;  3M1F A;  1GLC G;  1NGB A;  4H5V A;  2VYP A;  2Q0U A;  3L0Q A;  5EY4 A;  2GEL A;  4PKH A;  3QB0 A;  1NGJ A;  5AQK A;  2YJF A;  1H1V A;  4BC4 A;  4BG8 A;  5FPE A;  4JN4 A;  4BR0 A;  2PBD A;  3O08 A;  2DPN A;  2GWK A;  5E26 A;  2NRH A;  4B1V A;  2AP1 A;  3JXU A;  3VEO A;  5AQO A;  3VEN A;  4E1J A;  1IG8 A;  3QFU A;  4FL9 A;  1X9J A;  3GG4 A;  2YHY A;  5FPN A;  1NLV A;  1ATR A;  4H5N A;  1RFQ A;  5AFU A;  3VF2 A;  1E4F T;  5ADX H;  2V52 B;  3KZB A;  4WQ5 C;  3WEE B;  3WUH A;  4CZE A;  2I7P A;  2P9N A;  5KPT A;  1NWK A;  3H3N O;  1C0G A;  2QWN A;  2W40 A;  4O5F A;  3CI5 A;  4H0T B;  4YDU A;  3MCP A;  2PAV A;  4CZG A;  4BRQ A;  3ATV A;  1NM1 A;  3UE5 A;  4H0V B;  1WOQ A;  1TYQ A;  3O8M A;  1MWM A;  2F9T A;  1G99 A;  3H46 O;  3GE1 A;  3IMX A;  2BUP A;  4CZI A;  1BUP A;  4BRD A;  1D4X A;  4BRP A;  1T6C A;  4EIA A;  1Y64 A;  2FSJ A;  1MA9 B;  1BO5 O;  2ASM A;  2VWB A;  3HTV A;  3QIC A;  4BRF A;  4H5T A;  5ADX A;  1NGE A;  2P9U A;  3W0L A;  1ZBS A;  1XC3 A;  3BF1 A;  3A5L C;  5BN9 A;  2QWQ A;  3BUZ B;  5LY3 A;  3ZET B;  3WEE A;  2HF4 A;  4KBO A;  3VOV A;  4A2A A;  2YHX A;  2P9N B;  3LDN A;  4LC9 B;  3DXK A;  2Q97 A;  3A5N C;  2AA4 A;  2W41 A;  1JCE A;  5KPR A;  5AQS A;  4NO7 A;  2GTD A;  3CJ1 A;  3H1Q A;  3W3D A;  2Q36 A;  5AZI B;  4BC3 A;  3R6M A;  4BRC A;  1IJJ A;  1SAZ A;  1Z05 A;  3HBT A;  5AQU A;  3ZEU A;  3UKR B;  3VET A;  2ITM A;  4BRN A;  5CE3 A;  3LM9 A;  4I6M A;  3H3O B;  4CZL A;  4B1X B;  2QWL A;  3SMP A;  5AQN A;  4BRO A;  1KXP A;  1NMD A;  2A3Z A;  2FF3 B;  4XH1 A;  3VER A;  2NLX A;  3I33 A;  4H03 B;  1YVN A;  5F0X A;  1BDG A;  2I7N A;  4CZJ A;  3UB5 A;  3A0I X;  3QBX A;  4FWR A;  3VES A;  3FLC O;  4BRI A;  2BTF A;  1T6D A;  4CD3 A;  1E4G T;  2D4W A;  3ZEU B;  4NB4 A;  5AQV A;  2P9P B;  3WXJ A;  3R8E A;  4JNE A;  5AQR A;  5FPM A;  4AM6 A;  4Z94 A;  1BU6 O;  3O5B A;  1LCU A;  3DAW A;  4FPA A;  1BG3 A;  1U6Z A;  3KHY A;  3MN5 A;  3WXI A;  3ZX2 A;  3H1V X;  1YXQ A;  2P9K B;  3OHR A;  4C23 A;  1QQM A;  4FWL A;  3DXK B;  1K8K B;  2P9I B;  2GWJ A;  1HPM A;  1SZ2 A;  3G25 A;  4XEI A;  4BRH A;  4F9O A;  4RTF D;  2V51 B;  4BRL A;  3KVG A;  5BRH A;  1SQK A;  1ZC6 A;  4IZ9 A;  3CJC A;  2ASP A;  4CZH A;  3CJ7 A;  1GLD G;  3R9P A;  2E2N A;  5AQW A;  1NGC A;  5KQD A;  3ZX0 A;  4FSV A;  4ISF A;  5AQG A;  4BQZ A;  1X3M A;  3GL1 A;  3WQU A;  3CET A;  3VGL A;  3BF3 A;  3AY9 A;  3H45 C;  4BR2 A;  4B1U B;  3MN9 A;  4BC2 A;  4EHU A;  4DHY A;  1TUU A;  4EFH A;  4ISG A;  4O8K A;  5EXW A;  4BRM A;  1RDW X;  4FOE A;  4CZK A;  5BRD A;  4MO4 A;  3UKU B;  3FZH A;  1JCG A;  3O4W A;  4H5R A;  1X3N A;  2CGJ A;  4A2B A;  1GLE G;  3RSE A;  1NGI A;  1Z6R A;  2FXU A;  3BEX A;  3UKR A;  4MO5 A;  3BP8 A;  2V7Z A;  4DB3 A;  4B9Q A;  2P9K A;  3VF6 A;  1MWK A;  3VEV A;  1YUW A;  3U8X A;  5BPN A;  3DXM B;  5ELZ A;  4IO8 A;  3FE1 A;  4XH4 A;  3A5M C;  4CD1 A;  2E1Z A;  2P9S B;  2QW9 A;  4BRE A;  1NGA A;  4YDU C;  4FWN A;  3DXM A;  4CZF A;  3LDL A;  4CZM A;  2GUP A;  3EL2 A;  4DCH A;  5EVZ A;  5EOY A;  4IWV A;  1BA1 A;  2QWM A;  1ATN A;  1CZA N;  3WQT A;  3ENO A;  1GLL O;  2P9P A;  1S3X A;  5F1X A;  2Q2R A;  4H0P A;  4GNI A;  4CBX A;  1ZXO A;  4FOI A;  2E20 A;  4BRK A;  2P9U B;  2IVP A;  5FPD A;  4K43 A;  3LDQ A;  3FGU A;  4BVO A;  3JS6 A;  2FSK A;  1V4S A;  2HF3 A;  2YJE A;  4FWM A;  2OAN A;  4H0X B;  1DKG D;  3FFK B;  3M3Z A;  3LM2 A;  1KAX A;  3B8A X;  3GOI A;  1HX1 A;  4A62 A;  3CJA A;  3TPQ A;  2GEM A;  5AZI A;  1QZ6 A;  3DJC A;  2CGK A;  4K25 A;  4CI6 A;  5JMV A;  4JD2 A;  3ULE B;  3M6G A;  1XUP O;  4RWT A;  2QXL A;  3IDH A;  5BR9 A;  5BPM A;  5LJW A;  3U9D A;  3D2E A;  2CGL A;  2Q0R A;  4JD2 B;  3ULE A;  3CQX A;  1BOT O;  3DWL A;  1HKG A;  2A40 A;  2D0P A;  2ZGZ A;  1DEJ A;  1NBW A;  2YI1 A;  3D2F B;  4DQ8 A;  4MLH A;  1NGH A;  4J8F A;  3WXK A;  1C0F A;  2E2O A;  3CER A;  1DGK N;  5AQX A;  4BR9 A;  5KQ8 A;  3C0B A;  5AQH A;  4B1Z A;  3CQY A;  3VPZ A;  3EN9 A;  5LJV A;  1R59 O;  4M7Y A;  3UKU A;  4H0O A;  3TU5 A;  4Y0W A;  1S22 A;  5AR0 A;  3EO3 A;  4WYB A;  3IFR A;  2IVN A;  1QZ5 A;  2UYT A;  4PKI A;  4H0Y B;  3MK6 A;  5AQP A;  3L6Q A;  5AQL A;  3IUC A;  2IVO A;  4JAX A;  3D7E O;  4PKG A;  3S41 A;  2ASO A;  2P9S A;  2QWO A;  2ZF5 O;  4CBU A;  4PL8 A;  3O1B A;  4BQL A;  4WQ4 C;  3RSE B;  1HKC A;  4BVP A;  3LDP A;  2QWR A;  2A5X A;  1HKB A;  3A5O C;  4IJN A;  2QWP A;  1OKJ A;  2YHW A;  3AAQ A;  3VF4 A;  4M63 C;  4WQ4 A;  4BG9 A;  3D2E B;  5JIC A;  4AM7 A;  4PL7 A;  3VEZ A;  3HSC A;  1KAZ A;  4MLE A;  3SMS A;  4B1W B;  5JLH A;  5AQY A;  3EKS A;  4CJ7 A;  2E2P A;  3GDQ A;  1Q18 A;  1XQS C;  3ZET A;  1NGG A;  5KPZ A;  4BGA A;  3HI0 A;  1TUY A;  2H3G X;  4H5W A;  1U2V B;  5TKY A;  3I8B A;  1HLU A;  2FF6 A;  1NGD A;  2VCP A;  4BC5 A;  3MMV A;  3QFP A;  4CBW A;  3FZL A;  3EKU A;  5AQM A;  2CH5 A;  4QS8 A;  2Q1N A;  2FSN A;  5EX5 A;  3U4L A;  3LDO A;  5AQI A;  5JLF A;  3ID8 A;  3J8A A;  2P9L A;  3EZW A;  3FZM A;  5AZJ B;  3HZ6 A;  3WT0 A;  5AFU H;  5BN8 A;  3QBW A;  1P8Z A;  4FWO A;  1QHA A;  4A61 A;  1V4T A;  5AQT A;  4BRA A;  3FZF A;  3D2F A;  1NGF A;  5F2R A;  3AAP A;  4IJA A;  2A6A A;  2P9I A;  4K42 A;  4B1Y B;  1BA0 A;  2QM1 A;  4HTL A;  1QQN A;  2CH6 A;  2V7Y A;  4JHD A;  4QS7 A;  4XH5 A;  3CHW A;  3AAR A;  2E8A A;  3C7N B;  1K8K A;  2ZGY A;  4IXC A;  3P4I A;  2F9W A;  1BWF O;  3F9M A;  3LL3 A;  1QQO A;  3H6E A;  4FPB A;  4BR7 A;  4JHD B;  1GLA G;  5BRF A;  4L3Q A;  3CIP A;  2IIR A;  2NZT A;  1T44 A;  3VEW A;  2Q31 A;  3CJB A;  4FWK A;  3WXL A;  3SK3 A;  1EQY A;  3O6W A;  3ZX3 A;  5BRE A;  4WQ5 A;  1GLF O;  1YAG A;  4BGB A;  4K41 A;  2EWS A;  3VEY A;  4EAH D;  1JCF A;  1LOT B;  4QS9 A;  5E84 A;  2D1K A;  3MN7 A;  5B8H A;  2P9L B;  1U2V A;  5AZJ A;  3FR0 A;  2E88 A;  2HMP A;  3ENH A;  3MDQ A;  4FWS A;  1ESV A;  3SLC A;  4FWP A;  2A42 A;  3O1W A;  4M7X A;  1ATS A;  3L4I A;  1KAY A;  1TYQ B;  3CJ9 A;  2J4R A;  3FZK A;  2FLO A;  2E2Q A;  5BPL A;  4I6M B;  3VEX A;  1GLB G;  4GY2 B;  4BRG A;  4BR4 A;  4HWI A;  1RGI A;  3C7N A;  1HUX A;  4BR5 A;  1HJO A;  5AQJ A;  4FO0 A;  3HM8 A;  3ATU A;  5AQF A;  1MDU B;  1GLJ O;  1WUA A;  5I9E B;  3A8Y A;  3QML A;  2A41 A;  2KHO A;  5AQZ A; 
#chains in the Genus database with same CATH topology
 1L3S A;  3SJH A;  3T3F A;  4C1N I;  1CZ9 A;  1RT6 A;  1NJY A;  3HPO A;  3UIQ A;  4JKH A;  2HMI A;  4RCH A;  3MN6 A;  4HUG A;  3O3F A;  5AQQ A;  4EHT A;  3TAM A;  1BIS A;  4ISE A;  4OVL A;  4IEI A;  1ZYQ A;  1N32 K;  4H5V A;  3J7A P;  2VYP A;  4E1N A;  2KQ2 A;  3OYF A;  2HBK A;  1KC8 O;  4WCE L;  5LMN K;  4JN4 A;  4IOX A;  1RDB A;  3O08 A;  2O8F A;  4CER A;  1M90 O;  4FJ5 A;  4ELV A;  4KHP K;  1TK0 A;  2NRH A;  3BZK A;  3JXU A;  3VEO A;  5GIP A;  3GG4 A;  5JEN A;  4B9U A;  1NLV A;  2QI2 A;  3G10 A;  1K8A O;  5AFU A;  3D6R A;  1SL2 A;  3OYC A;  4PA1 A;  5E41 A;  3WUH A;  4G1Q A;  4NYN A;  1DT9 A;  1BQN A;  2P9N A;  5KPT A;  3H3N O;  3ZT4 A;  1HNV A;  4DTP A;  1NK4 A;  1N33 K;  2R7Y A;  1OVQ A;  4O5F A;  2E5L K;  4CJE A;  4DFJ A;  3BZC A;  4OGC A;  1U49 A;  3AA2 A;  4YOV A;  1TV6 A;  1LAW A;  3O8M A;  3K5O A;  4M41 A;  2GBZ A;  3H46 O;  3D0P A;  2UUB K;  1L3T A;  5J2M A;  4FLY A;  4LF4 K;  4BRP A;  1N6Q A;  4O55 A;  2FSJ A;  4H5T A;  1YTA A;  4DQS A;  1KFS A;  2JWK A;  3HXM A;  4CEB A;  3B6O A;  3I8D A;  4CJQ A;  5GAE P;  3BUZ B;  4CK1 A;  5LY3 A;  3ZET B;  4O5B A;  4OX9 K;  4N56 A;  3NHG A;  2YHX A;  1HMV A;  1W7A A;  3TAR A;  1OH7 A;  1JLQ A;  2D5R A;  3DRR A;  3AV9 A;  3AVI A;  3VN5 A;  1XC9 A;  2GTD A;  5FLX O;  3R6M A;  5HLF A;  3CC4 N;  3WNG A;  3TR8 A;  3LP0 A;  3VET A;  4EP4 A;  3O9R A;  4ZTJ A;  4W5N A;  1CXQ A;  3SMP A;  4BRO A;  3KKR A;  4N76 A;  2FF3 B;  4WE1 A;  1XNQ K;  2NLX A;  1Y97 A;  3I33 A;  1SKR A;  1YVN A;  1VSM A;  1BIU A;  3JYT A;  3FLC O;  2BTF A;  4CD3 A;  4Z4I A;  5HP1 A;  3NGZ A;  4O8U A;  3F9K A;  2XO7 A;  2ZJR L;  5AQR A;  4AM6 A;  2YNI A;  4Z94 A;  3EYZ A;  3F5T A;  2OPS A;  4FPA A;  1BG3 A;  1U6Z A;  2HNY A;  3AO5 A;  3KHY A;  3MN5 A;  3WXI A;  3LAN A;  2NRT A;  3CMA N;  3LAK A;  1CZB A;  4F2R A;  4JYA K;  3T1H K;  1FKP A;  4Y1C A;  1HNZ K;  1FKO A;  1LWE A;  1SQK A;  3HPH A;  3CCL N;  4AHR A;  4PY5 A;  4CZH A;  3SPY A;  3CJ7 A;  4LSN A;  3HO1 A;  1NJX A;  1NGC A;  1RTJ A;  5KQD A;  3KD5 E;  2W6K A;  3QET A;  3KJV A;  4WFA L;  3SUO A;  2FBT A;  3WQU A;  3CCJ N;  1WAF A;  3SYZ A;  3PIP L;  4CFA A;  3C6A A;  1VQL N;  2P1J A;  4B1U B;  3AA5 X;  3CFR A;  2O8B B;  4EFH A;  3MED A;  4O8K A;  4BDZ A;  1W97 L;  1NOZ A;  5BRD A;  5LMU K;  4B3T K;  3UKU B;  3FZH A;  2KTQ A;  4OJR A;  2VG7 A;  3L4Q A;  4H5R A;  4RW6 A;  1LV5 A;  2CGJ A;  4B9S A;  1ASV A;  1YJN N;  3MAQ A;  1L3U A;  1NGI A;  3BEX A;  4KFB A;  3BP8 A;  2HHV A;  2P9K A;  1MWK A;  3OVN A;  5ELZ A;  3NVM A;  2A1R A;  4XH4 A;  4CD1 A;  3K57 A;  2P9S B;  5HRR A;  1T3V A;  4YDU C;  3RMA A;  3BY5 A;  3LP2 A;  1TKZ A;  2OPP A;  1JLF A;  4J2B A;  2QWM A;  3QEV A;  4FZX C;  3TSP A;  1GLL O;  5FRM A;  2Q2R A;  1NK0 A;  4GNI A;  1ZXO A;  5CHI A;  4AHU A;  2E20 A;  4BRK A;  5JS2 A;  2HBM A;  5FPD A;  4DSK A;  3JS6 A;  2OTL N;  5HL7 L;  4DV0 K;  3U6F A;  4IFY A;  4A5A A;  3OTO K;  4UY8 O;  3CG7 A;  2O8E B;  1KAX A;  3GOI A;  1HX1 A;  4H8K A;  3CJA A;  3TPQ A;  3PX6 A;  5DK5 A;  1BL3 A;  2IS3 A;  4DV5 K;  2ZM6 K;  1SKW A;  2Z1H A;  2IC3 A;  4M3T A;  1XUP O;  3CFO A;  4FJH A;  1BHL A;  3U9D A;  3D2E A;  2CGL A;  3R1X A;  3OYI A;  3CQX A;  1YI2 N;  1HKG A;  4CJS A;  4DR5 K;  4KAZ A;  1DEJ A;  2YI1 A;  4BWM A;  4DTR A;  4MLH A;  4IKF A;  4J8F A;  3K5N A;  4KRF A;  4JKE A;  1LWC A;  4BR9 A;  3C0B A;  5AQH A;  4B1Z A;  1FW6 A;  1R59 O;  4Y1D A;  3UKU A;  4LF8 K;  4Y0W A;  1S22 A;  5AR0 A;  4F8R A;  1JJ2 M;  4JS5 A;  1RBV A;  1UOC A;  1VQO N;  4IG3 A;  3MK6 A;  3IUC A;  3G4S N;  1QQC A;  3HPG A;  4CHZ A;  4Q5V A;  3D7E O;  1IV0 A;  1VSJ A;  2QWO A;  4CGF A;  3NAE A;  3C95 A;  3EY1 A;  4CBU A;  1RBU A;  4DSL A;  4CGH A;  2OZS A;  3O1B A;  2VQE K;  2XY5 A;  3RR8 A;  1JXE A;  3CCE N;  3A5O C;  2QWP A;  4JKG A;  3TTC A;  1GOC A;  3VF4 A;  4WQ4 A;  4HTU A;  4FJK A;  1WSJ A;  1B9D A;  4PL7 A;  4Z0U A;  3HSC A;  4JKC A;  4KB1 A;  4CJ7 A;  4PQU A;  3GDQ A;  3ZSO A;  4O4G A;  5EU7 A;  4BAC A;  1XMO K;  4YOU A;  1QSY A;  1NGG A;  3HI0 A;  1TUY A;  1U2V B;  1RBT A;  1LWF A;  4NYF A;  4RW9 A;  4JI4 K;  3QFP A;  3OA9 A;  2AJQ A;  1QE1 A;  3EKU A;  1I39 A;  3J80 O;  5CY4 A;  3K9K A;  4M3Z A;  5EX5 A;  4H4O A;  4B3R K;  3V1Q A;  2P9L A;  2YKM A;  4DQR A;  2BDP A;  3EZW A;  4FM2 A;  1VQ5 N;  3WT0 A;  2Y1I A;  5BN8 A;  3B6P A;  2VWJ A;  3ITH A;  3TAB A;  4CFD A;  3MXJ A;  2O8D A;  1CXU A;  1IKY A;  1NGF A;  2UXB K;  4IJA A;  4KHQ A;  2P9I A;  3SUN A;  1QQN A;  1ZBU A;  4JHD A;  4CE9 A;  1NJI O;  4QS7 A;  1A5X A;  3C7N B;  1S9G A;  5CYM A;  4BE7 B;  3E9O A;  4HUE A;  1BWF O;  1C0T A;  1GLA G;  3CJB A;  4FWK A;  2W42 A;  3RVC A;  5BRE A;  4WQ5 A;  4BGB A;  4K41 A;  1LOT B;  3M8S A;  1KVB A;  1RT3 A;  5B8H A;  4IDK A;  2B5J A;  1B92 A;  3SI6 A;  3FR0 A;  3RMB A;  3ENH A;  3MDQ A;  3L2W A;  2G8W A;  1I94 K;  3SLC A;  3O1W A;  4DU1 A;  3C6H A;  1IKX A;  5J2P A;  4U67 L;  1VQN N;  4CGG A;  2KZZ A;  1TVR A;  1X9S A;  4CF1 A;  5C24 A;  3G6E N;  4DWI A;  4RW8 A;  3SZ2 A;  1HJR A;  3AO2 A;  4CEQ A;  3ATU A;  5AQF A;  1MDU B;  1GLJ O;  5HBM A;  1WUA A;  5I9E B;  3A8Y A;  3V1R A;  4E19 A;  3AVH A;  4CJW A;  3CC7 N;  1J5O A;  3ZT1 A;  3QDK A;  3GBT A;  1J6Z A;  3AVL A;  4FJG A;  4N5S A;  4B8C A;  2GUI A;  3M1F A;  3EEQ A;  4CJK A;  4DQQ A;  4OLB A;  4JI3 K;  3KWG A;  3ZLJ A;  2GEL A;  3DOL A;  3S3M A;  1NGJ A;  4ELU A;  5FRN A;  1H1V A;  4BG8 A;  3KLE A;  3NH0 A;  2PBD A;  3RRG A;  2DTU A;  1KVA A;  2DPN A;  3CD6 N;  4ZHR A;  4Z4G A;  4CJV A;  1S1W A;  2AP1 A;  3ENB A;  3IRX A;  3QFU A;  4FL9 A;  3EZ5 A;  1X9J A;  2OZM A;  1RBS A;  3DLR A;  3T7Z A;  2PZS A;  3K5M A;  2UXC K;  5KI6 A;  3KKS A;  3OY9 A;  2HBL A;  1SS6 A;  3C94 A;  1VQ4 N;  3TAQ A;  4DUZ K;  2JGU A;  3CI5 A;  3Q7C A;  4CZG A;  4J2D A;  1QVG M;  2ZJQ L;  1FK9 A;  4X66 K;  4GVE A;  1WOQ A;  4LFC K;  3F2K A;  3ISN C;  1U04 A;  3VQD A;  2F9T A;  1C1C A;  1G99 A;  3GE1 A;  3IMX A;  3DRS A;  2BAN A;  1KTQ A;  1T6C A;  4MDA A;  4JI1 K;  4EIA A;  4DTO A;  1Y64 A;  1BO5 O;  2VWB A;  3HTV A;  5ADX A;  1NGE A;  3KTQ A;  5CR4 A;  1VRU A;  4KV8 A;  3BF1 A;  1W2B M;  3A5L C;  5BN9 A;  4YY3 K;  3WEE A;  2HF4 A;  2OCE A;  3TTF A;  3VOV A;  3HP6 A;  4N41 A;  3LAM A;  3VQ7 A;  2VGM A;  4AHC A;  4JI8 K;  4FJN A;  2Z1J A;  4CJ5 A;  5M1P A;  4O0I A;  4CF2 A;  2W41 A;  1WN7 A;  5KPR A;  3AVG A;  3QIP A;  4NO7 A;  4ELT A;  5AZI B;  4BC3 A;  3TAP A;  1JLB A;  1IJJ A;  1ASU A;  1SAZ A;  4M3R A;  4BRC A;  3VA0 A;  1Z05 A;  3HBT A;  4Z4E A;  3JAM O;  5AQU A;  3UKR B;  4TSX A;  3I0R A;  3ZSR A;  4DFP A;  3VQ8 A;  5LL6 Z;  5CE3 A;  1IKW A;  3O9S A;  4JKF A;  4CED A;  4CZL A;  4B1X B;  2G8V A;  2QWL A;  4WF9 L;  4DTS A;  4J2E A;  4K8Z A;  3WNF A;  1QHT A;  4JS4 A;  4XH1 A;  5HOO A;  2ZE2 A;  5F0X A;  4AQY K;  1X9W A;  3QBX A;  4E7K A;  3VES A;  4KHU A;  1T6D A;  2HHQ A;  3KD1 E;  1E4G T;  3ZEU B;  4NB4 A;  4CVN E;  2JWL A;  4CEZ A;  3R8E A;  4NCB A;  4KB0 A;  1LCU A;  1Q82 O;  3LAL A;  2D0A A;  4GV3 A;  1Z25 A;  1YXQ A;  2P9K B;  4CHN A;  3DXK B;  1RTD A;  4LH5 A;  1F21 A;  1WSH A;  4DV4 K;  3CYG A;  1SZ2 A;  3G25 A;  3THW B;  4BRH A;  4F9O A;  5H1S Q;  2V51 B;  2HST A;  5C10 A;  3VA3 A;  2HVI A;  1K6Y A;  3KVG A;  5BRH A;  5HRO A;  1WSI A;  4I9Q A;  4HCB A;  4KHS A;  3QIO A;  1GLD G;  2WC9 A;  3OYK A;  3QLH A;  5AQW A;  2WFB A;  4BY9 C;  1J54 A;  4BQZ A;  3GL1 A;  1UA1 A;  2I5J A;  3VGL A;  3AY9 A;  1HNX K;  5C42 A;  3MN9 A;  4BC2 A;  1BI4 A;  2NRV A;  4EHU A;  4DR1 K;  3DMJ A;  1NNE A;  1TUU A;  3PIO L;  5EXW A;  1RDW X;  4FOE A;  4CZK A;  2NRW A;  3ZSZ A;  1KVC A;  4PWD A;  4DSF A;  2P5G A;  3KK1 A;  3NH2 A;  4KHN A;  4DG1 A;  1JCG A;  1S6Q A;  3O4W A;  2RPI A;  1KCF A;  1WLJ A;  3KLF A;  4DFK A;  3UKR A;  4U7B A;  4MO5 A;  3AVB A;  4DB3 A;  3VF6 A;  2HHX A;  3U8X A;  5BPN A;  5KGX A;  1TKT A;  2E1Z A;  4BRE A;  1NGA A;  3S3N A;  4KHW A;  4FWN A;  4CZF A;  4WFN L;  2O4G A;  2GUP A;  3EL2 A;  1LW0 A;  4DCH A;  3ZYY X;  4CEF A;  5EVZ A;  5EOY A;  4WFB L;  2E6L A;  3WQT A;  1KFD A;  1JLA A;  2P9P A;  2OTJ N;  1S3X A;  3P5J A;  4H0P A;  4IOC L;  4CBX A;  1OH5 A;  4CK3 A;  1VQ8 N;  4FLV A;  1IH7 A;  3NDK A;  2IVP A;  4K43 A;  4E7I A;  2NNW A;  2HF3 A;  4FWM A;  2OAN A;  3DYA A;  4C8L A;  1DTQ A;  2O8C B;  3V9Z A;  4MQ3 A;  3B8A X;  4OKJ A;  4CFB A;  4A62 A;  3TSQ A;  4I2P A;  4DR7 K;  3CPW M;  1Q81 O;  3PX4 A;  3QO9 A;  4CI6 A;  5JMV A;  4JD2 A;  2QXL A;  2PY5 A;  1HQE A;  3OYA A;  4BWJ A;  4JI0 K;  4CIG A;  3ULE A;  4AH9 A;  1JLC A;  1BOT O;  4YOR A;  4DLE A;  3VMF B;  3C6T A;  4BEC A;  2ZQB A;  1NBW A;  3ZCM A;  1KQS M;  4DLG A;  3SQ2 A;  3CER A;  4M42 A;  1QTM A;  5AQX A;  5KQ8 A;  3ZSQ A;  5LJV A;  3TTD A;  3NF7 A;  4H0O A;  5GIN A;  2IVN A;  1SL1 A;  1QZ5 A;  4ID5 A;  3BDP A;  4M3Y A;  3E01 A;  2RF2 A;  3NFA A;  3L6Q A;  4CW7 B;  1D5A A;  1NKB A;  1RTI A;  3THY B;  1C6V A;  4MFB A;  3S41 A;  2ASO A;  3CYM A;  4LF6 K;  1NG9 A;  3AGR A;  4WQ4 C;  1JLE A;  3NBP A;  4FJ9 A;  4CCH A;  1EWQ A;  1RT2 A;  3RSE B;  5M1F A;  1BIZ A;  2QWR A;  1HKB A;  1NU0 A;  1HYZ A;  4IJN A;  3V1O A;  4Z4C A;  1KD1 O;  1KLM A;  2JLE A;  4FW1 A;  4DF8 A;  4IFV A;  5AQY A;  3ZT0 A;  5SZT A;  1XI1 A;  3K2P A;  4UQG A;  1Q18 A;  2O8C A;  4BGA A;  4BE1 A;  3OYD A;  2H3G X;  4A57 A;  2EHG A;  4DSE A;  2FF6 A;  1RCH A;  3AO4 A;  4CBW A;  3DLK A;  2CH5 A;  3ALY A;  4QS8 A;  4KKO A;  2Q1N A;  2FSN A;  4FW2 A;  3U4L A;  3LDO A;  5AQI A;  3J8A A;  3J7Z O;  3ID6 A;  2BE2 A;  5AFU H;  4E1M A;  1P8Z A;  1QHA A;  4A61 A;  3HOT A;  2KZM A;  4FJ8 A;  3FZF A;  2A1S A;  5F2R A;  3OYH A;  1HR0 K;  1VRT A;  4B1Y B;  1N5Y A;  3P83 D;  4KI6 A;  1BA0 A;  2Q3S A;  2QM1 A;  2G8U A;  1TKD A;  1OH8 A;  3ZSY A;  4XH5 A;  3AA3 A;  3CHW A;  2XY7 A;  2E8A A;  1YIJ N;  3L2U A;  4C8M A;  1IBM K;  3SJJ A;  4IXC A;  3V9U A;  3F9M A;  3LL3 A;  1QQO A;  1S1U A;  3H6E A;  4LF9 K;  4X62 K;  5BRF A;  2B4J A;  2F4V K;  2F96 A;  2Q31 A;  1YJW N;  1SUQ A;  3AGK A;  4C1N K;  4CJF A;  3QES A;  4NCG A;  3O6W A;  3ZX3 A;  4E7J A;  3VEY A;  2D1K A;  1D9F A;  4FZZ A;  1OVY A;  4M3X A;  5AZJ A;  3HST B;  4FLZ A;  3VQ9 A;  2E88 A;  2HMP A;  4FWS A;  4KH4 A;  2ATQ A;  4FWP A;  3SAF A;  4NLC A;  1XNR K;  1TYQ B;  1RDU A;  2J4R A;  3FZK A;  2FLO A;  2E2Q A;  3OYJ A;  3VEX A;  1GLB G;  2F7T A;  4GY2 B;  1TGO A;  4DUY K;  4BR4 A;  4HWI A;  2WBN A;  1RGI A;  1HUX A;  4BR5 A;  2HHU A;  1HJO A;  4B9L A;  2G8I A;  5AQJ A;  4FO0 A;  3WXM B;  1O1W A;  1ASW A;  2VG5 A;  1NOY A;  2KHO A;  1TK8 A;  2E1Y A;  2ZWH A;  4FWQ A;  4B9T A;  4JEP A;  3TI0 A;  1W9H A;  4JI6 K;  3O80 A;  3Q7B A;  3VGK A;  4DV3 K;  2YCH A;  5A2Q O;  2OA8 A;  4R5P A;  3VGM A;  1WB9 A;  4C8K A;  2NRR A;  1QVF M;  3T1Y K;  1NGB A;  1P90 A;  1UA0 A;  4I7F A;  4E0D A;  3J7Y P;  1I3A A;  3SQ4 A;  4PKH A;  1RT1 A;  5AQK A;  4DQP A;  3CM5 A;  4AIL C;  5FPE A;  3ASM A;  2W6L A;  3O9T A;  2PYL A;  1TL1 A;  5E26 A;  3HVR A;  4KHY A;  3VEN A;  4DQI A;  1T03 A;  4RG8 A;  5JVG L;  4BE0 A;  2F8S A;  2YHY A;  4CEE A;  3MXI A;  1ATR A;  3OS2 A;  4H5N A;  3K5L A;  1RFQ A;  4FJM A;  4YNQ A;  1E4F T;  1RBR A;  3CCS N;  4WQ5 C;  4CHO A;  4DFM A;  4FLX A;  3QER A;  1L5U A;  1NWK A;  4CEO A;  4JK9 A;  4CGD A;  3KLG A;  1IBK K;  2W40 A;  3SNN A;  3LPT A;  4H0T B;  4YDU A;  3MCP A;  2PAV A;  1L3V A;  4BRQ A;  3ATV A;  1NM1 A;  4GKJ K;  4CIE A;  1VSK A;  3OBY A;  3DRP A;  1A5V A;  3V81 A;  1TYQ A;  1D9D A;  1VAZ A;  3RTV A;  4GKK K;  3TAF A;  5K14 A;  4B3M K;  2BUP A;  3R3L A;  1BUP A;  3KLI A;  4BRD A;  4CZI A;  3THY A;  4IEE A;  1D8Y A;  1UWB A;  1MA9 B;  2RKI A;  2ASM A;  2KLA A;  3QIC A;  3P1G A;  4KRE A;  2P9U A;  2P51 A;  3T69 A;  4BDY A;  3CCU N;  2BH1 A;  4JK8 A;  3VTH A;  4W5T A;  1EET A;  1NK8 A;  4KBO A;  4A2A A;  2P9N B;  3O9U A;  5CZ1 A;  3DXK A;  2AA4 A;  1JCE A;  1SKS A;  2Y1J A;  4CJ4 A;  3RRH A;  3TAN A;  3W3D A;  2Q36 A;  5DM6 L;  3AVC A;  3ZEU A;  2OYQ A;  4DSI A;  4I6M A;  3H3O B;  4LFB K;  3OS1 A;  4EZ9 A;  4B08 A;  5AQN A;  2A3Z A;  3VER A;  2OPQ A;  3OYM A;  3AVA A;  3HP9 A;  4JRP A;  4H03 B;  3DLB A;  3IKM A;  4FJ7 A;  3RR7 A;  2I7N A;  4X65 K;  3UB5 A;  1XWL A;  4FWR A;  3ZT3 A;  3DM2 A;  3MWP A;  1KSP A;  5AQV A;  2P9P B;  4JI2 K;  1NJW A;  4JNE A;  5FPM A;  1BU6 O;  4JKA A;  1T7P A;  3DAW A;  3VQ4 A;  1EP4 A;  1WAJ A;  3OYL A;  4O44 A;  1Q7Y O;  3H1V X;  2YNH A;  4Q0B A;  3SBT A;  4FJJ A;  1A5W A;  3G0Z A;  1K8K B;  2P9I B;  4DMN A;  2GWJ A;  1HPM A;  4XEI A;  2LSN A;  3KIO A;  3T1A A;  2WON A;  2WOM A;  4IZ9 A;  3CJC A;  4DU3 A;  1VK0 A;  1WBD A;  4FXD A;  2O8E A;  3R9P A;  2E2N A;  3KWI A;  3KLH A;  1N34 K;  3HVT A;  2W00 A;  4HVJ A;  3ZX0 A;  4ISF A;  5AQG A;  1DLO A;  4RW4 A;  4DTM A;  4DS4 A;  1ITG A;  3I55 N;  5M1O A;  3SPZ A;  5BR8 K;  1GOB A;  3H45 C;  4BR2 A;  4F3O A;  3AVM A;  3E1Y A;  1UAX A;  2HHH K;  5J2N A;  1HYS A;  2HNZ A;  4BRM A;  2IAJ A;  4K0K K;  3V6D A;  4DF4 A;  3K9J A;  3M8P A;  3P31 A;  4HHT A;  3KK7 A;  2XRI A;  3S3O A;  3IAY A;  3SV3 A;  3SAH A;  2QK9 A;  2DFE A;  3RSE A;  1Z6R A;  2FXU A;  4OLA A;  3NMU A;  3LZJ A;  4JLH A;  1YUW A;  3NE6 A;  1ZBL A;  3DXM B;  4IO8 A;  1RIL A;  1DTT A;  3A5M C;  4DKW A;  2QW9 A;  3PX0 A;  2YHB A;  5C15 A;  3LDL A;  2X78 A;  4FK4 A;  3LWM A;  1JL2 A;  3MEE A;  4IWV A;  1BA1 A;  1ATN A;  1CZA N;  4NXN K;  1E3M A;  3DI6 A;  4E89 A;  1HRH A;  3ZSX A;  1EKE A;  4DTX A;  3RWU A;  4LFA K;  5I42 A;  1BGX T;  2P9U B;  1N36 K;  4AHT A;  4DV1 K;  4HCC A;  3VQP A;  3LDQ A;  4CES A;  4R79 A;  2FSK A;  3CCM N;  2YJE A;  2HND A;  3HYF A;  5DM7 L;  3M3Z A;  1YTU A;  3U3Y A;  4K8X A;  1S72 N;  3LP3 A;  4FM1 A;  1NK5 A;  2PYJ A;  3AVF A;  5AZI A;  3OYB A;  1QZ6 A;  3DJC A;  2CGK A;  4MDB A;  3PO5 A;  2X74 A;  1U4B A;  3P38 A;  4RWT A;  4X64 K;  3IDH A;  3HM9 A;  2UXD K;  4E3S A;  2D0B A;  4ILH A;  2Q0R A;  3CQ8 A;  5J1E A;  1VQ9 N;  2GV9 A;  2QEX N;  3DWL A;  1S1T A;  1C1B A;  2A40 A;  4LSL A;  1Q9X A;  2HHI A;  2D0P A;  3E9P A;  5GAH P;  1K73 O;  1HNI A;  3N4P A;  1NGH A;  4Z4H A;  1C0F A;  2E2O A;  2HHS A;  4GMJ B;  4YOX A;  3ZSV A;  4OPH A;  2Z1I A;  3VPZ A;  3EN9 A;  1QSS A;  4DS5 A;  2YKN A;  3TU5 A;  3NF6 A;  4WYB A;  3L3U A;  3IFR A;  3NF9 A;  2UYT A;  1TKX A;  5AQP A;  3CME N;  3SUQ A;  2IVO A;  3E66 A;  4JAX A;  2XHB A;  1M1K O;  4DR4 K;  1BCO A;  3RMD A;  5HRN A;  1VQ6 N;  4DR3 K;  2IDO A;  3AO1 A;  1EWR A;  3KK3 A;  1XHZ A;  4BVP A;  3LDP A;  3DLG A;  2YHW A;  4M45 A;  3PLA A;  3MEC A;  4M63 C;  5JVH L;  1ILY A;  2YV0 X;  2O8D B;  3VEZ A;  3TAG A;  4B1W B;  5JLH A;  2E2P A;  3SCX A;  3I56 N;  1S6P A;  1XQS C;  3ZET A;  1HNW K;  4GV6 A;  1MU2 A;  4OPJ A;  4H5W A;  5TKY A;  4CHP A;  3NCI A;  3I8B A;  1HLU A;  4YOW A;  4GV9 A;  1NGD A;  2VCP A;  4BC5 A;  3QEX A;  3FZL A;  5AQM A;  1X1P A;  3ID8 A;  4XJX A;  4ZTF A;  4NXM K;  5M1Q A;  3HZ6 A;  4QCL A;  1YHQ N;  1J5E K;  1GOA A;  3QBW A;  4YOY A;  4FWO A;  4B9N A;  5D3G A;  3V9W A;  4BRA A;  4BDP A;  3P39 A;  3QNO A;  4DR6 K;  4F4K A;  4CJU A;  2A6A A;  2YX6 A;  4HTL A;  1T05 A;  2V7Y A;  5HRP A;  3SQ0 A;  3CCQ N;  3V9X A;  4CJP A;  4JKD A;  1ZBI A;  3AAR A;  3C65 A;  2F9W A;  1HPZ A;  3THW A;  3V4I A;  4FPB A;  4JHD B;  2QA4 N;  3LZI A;  3CIP A;  1T44 A;  3A2F A;  4JV5 K;  3WXL A;  1S1V A;  1WSG A;  1EQY A;  1GLF O;  4EAH D;  4QS9 A;  5E84 A;  3JSM A;  4DTN A;  1Q86 O;  2P9L B;  1WNS A;  1S1X A;  4ILJ A;  3MWT A;  3L2V A;  3M8Q A;  4OKE A;  2Z1G A;  2E6M A;  4DU4 A;  2ETJ A;  1SV5 A;  1ATS A;  3L4I A;  1KAY A;  4CEA A;  1Q9Y A;  4JI7 K;  3DOK A;  5BPL A;  1WBB A;  4I6M B;  3SUP A;  2E4L A;  4BRG A;  2IOC A;  3H08 A;  3I0S A;  3C7N A;  4CJT A;  3AVN A;  1LW2 A;  3HM8 A;  4E72 A;  2X6N A;  3QML A;  1CLQ A;  5AQZ A;  5J2Q A;  1JL1 A;  4DV7 K;  2G8K A;  2D0O A;  2HOE A;  3M8R A;  1J53 A;  1U48 A;  1RDC A;  2WUS A;  4QAG A;  4CIF A;  4Z4F A;  4E7H A;  2FC0 A;  4B3O A;  3U9Z A;  1VQP N;  3LDS A;  3L3V A;  3NF8 A;  2XY6 A;  3HT3 A;  1GLC G;  2RE2 A;  1ZBF A;  4KTQ A;  2Q0U A;  3SV4 A;  3L0Q A;  5EY4 A;  3RMC A;  3QB0 A;  3OS0 A;  1S5J A;  2YJF A;  4BC4 A;  4BR0 A;  4O0J A;  1OH6 A;  3M5R A;  4AF1 A;  2GWK A;  1KLN A;  3OBW A;  2NRZ A;  4B1V A;  3VQ6 A;  1NK6 A;  3O9Q A;  5AQO A;  4E1J A;  1IG8 A;  3QIN A;  1U47 A;  1RT5 A;  1NKE A;  4XIU A;  4M3U A;  4OGE A;  5FPN A;  3VF2 A;  1ZBH A;  4CK2 A;  5ADX H;  5I3U A;  2V52 B;  3KZB A;  2DY4 A;  3WEE B;  4CZE A;  2I7P A;  3WNE A;  1C0G A;  3L2Q A;  4CFC A;  2QWN A;  3O4N A;  1YT3 A;  1EX4 A;  4DTU A;  4OPA A;  4YHH K;  3UE5 A;  5C2D A;  3ZT2 A;  4ID1 A;  2YHA A;  4H0V B;  2ITG A;  2NUB A;  1MWM A;  3AO3 A;  1RDA A;  1D4X A;  1VSE A;  2HB5 A;  5AJ3 K;  1RT7 A;  4BRF A;  3HOS A;  1JLG A;  3W0L A;  1TK5 A;  1ZBS A;  2VG6 A;  4L8R B;  2HW3 A;  1XC3 A;  1FXX A;  5IT9 O;  1X9M A;  1BQM A;  4B9V A;  2KW4 A;  1IG9 A;  2QWQ A;  3NGI A;  4FLW A;  1VSD A;  1XMQ K;  4FCY A;  5KRT A;  1XHX A;  3LDN A;  4LH4 A;  4LC9 B;  4I9L A;  4NCA A;  2Q97 A;  3A5N C;  5AQS A;  1G15 A;  4KPY A;  5M1N A;  3CJ1 A;  3H1Q A;  4CHQ A;  1KRP A;  3THX A;  3AA4 A;  3CC2 N;  4CF9 A;  3HJF A;  3CXC M;  3AVJ A;  3VQE A;  2ITM A;  4BRN A;  1VHX A;  4FVU A;  1K9M O;  3PSF A;  2D0C A;  3LM9 A;  3LP1 A;  2G8F A;  1IKV A;  4FJL A;  1JKH A;  3KK2 A;  2FBX A;  1KXP A;  1NMD A;  2QTD A;  4KH5 A;  4FK0 A;  3L2R A;  4G9Z A;  2HBJ A;  3QEW A;  5TKW A;  1BDG A;  1IO2 A;  4CZJ A;  3A0I X;  1YVU A;  4BRI A;  4OPK A;  4BEB A;  2D4W A;  3NGY A;  3QEI A;  3WXJ A;  3K58 A;  3PV8 A;  3TWH A;  5C25 A;  3O5B A;  4M3W A;  4LD0 A;  3C6U A;  1HQU A;  5CZ2 A;  4FJX A;  2EX3 A;  3S9H A;  3ZX2 A;  2G8H A;  3OHR A;  4C23 A;  1QQM A;  4FWL A;  4GW6 A;  2P5O A;  2YNF A;  3SQ1 A;  4RTF D;  4CJ3 A;  4BRL A;  4CJR A;  3QNN A;  3OYG A;  4IO9 L;  2YNG A;  2VGN A;  1J9A A;  1ZC6 A;  4J2A A;  1NKC A;  2ASP A;  4LY7 A;  2O8F B;  3NH1 A;  4DSJ A;  2FBY A;  5FDL A;  1C1A A;  4FSV A;  1RT4 A;  1RTH A;  3U3G A;  1X3M A;  3T19 A;  2O8B A;  2B6A A;  3SBG A;  3CET A;  3BF3 A;  4F3T A;  3PSI A;  4DHY A;  4LF5 K;  2KFZ A;  4ISG A;  2XY8 A;  3CCR N;  3OW2 M;  4MO4 A;  2OPR A;  3BGR A;  4NLB A;  4N47 A;  3VTI A;  3TSU A;  3N4Q A;  2UUC K;  2C1G A;  1X3N A;  4JK7 A;  1GLE G;  4A2B A;  2QKK A;  3EE8 A;  5JS1 A;  1WSE A;  4B9M A;  2V7Z A;  4B9Q A;  3VEV A;  3IG1 A;  4W5O A;  5GAG P;  5MLC Q;  3FE1 A;  3VQB A;  2KFN A;  4FK2 A;  3O3G A;  3DXM A;  4IFE A;  3PO4 A;  1RNH A;  1VQK N;  4CZM A;  4GVM A;  3LPU A;  4CF8 A;  1VQM N;  5C2F A;  3ENO A;  1VSH A;  1U45 A;  2BGG A;  4IOA L;  3F73 A;  5F1X A;  4FOI A;  4KO0 A;  3OYE A;  2DFF A;  4A59 A;  4CJL A;  1EXQ A;  3FGU A;  4BVO A;  4E7L A;  1V4S A;  4W5R A;  2VQF K;  4DTJ A;  1O13 A;  4B3S K;  4H0X B;  4FJI A;  1DKG D;  5IWA K;  3FFK B;  3LM2 A;  3L8B A;  4W5Q A;  3QEP A;  2X6S A;  2GEM A;  4AHV A;  4FVM A;  4CEC A;  1REV A;  4K25 A;  3O4Q A;  3ULE B;  3M6G A;  4KI4 A;  3K59 A;  4DV2 K;  2O4I A;  5BR9 A;  3OJU A;  4CGI A;  5BPM A;  3VQ5 A;  5LJW A;  2ZJP L;  2ZD1 A;  4FLT A;  4JD2 B;  3WNH A;  4ILG B;  1TAQ A;  4IG0 A;  4ICL A;  2QKB A;  1YF5 L;  5GIO A;  2ZGZ A;  3D2F B;  4DQ8 A;  3OYN A;  1JXB A;  4KTZ A;  3WXK A;  2VWK A;  3V9S A;  4H4M A;  1DGK N;  3O3H A;  3PY8 A;  2IGI A;  3CQY A;  1NMN A;  3D45 A;  4M7Y A;  1BCM A;  3MX2 A;  3EO3 A;  3CPE A;  4IDH A;  2HVH A;  4PKI A;  4H0Y B;  4QOZ B;  3VQC A;  1VSF A;  5AQL A;  4DR2 K;  4C8O A;  1LAV A;  4F2S A;  4PUO A;  5C12 A;  4FZY A;  4PKG A;  3HRG A;  2P9S A;  2ZF5 O;  1C0U A;  3LWL A;  3ULD A;  1YIT N;  4PL8 A;  4CGJ A;  1TAU A;  5KRS A;  4BQL A;  3E9L A;  3CM6 A;  4JKG B;  2WTU A;  3VQA A;  1HKC A;  3J81 O;  4FM0 A;  3THX B;  2A5X A;  3IS9 A;  1C0M A;  4EP5 A;  1OKJ A;  3AAQ A;  4BG9 A;  3D2E B;  5JIC A;  4AM7 A;  4CF0 A;  3DLL L;  1KAZ A;  4MLE A;  1TL3 A;  3SMS A;  2HHT A;  1VSL A;  4RW7 A;  3EKS A;  2UU9 K;  1SL0 A;  1NJZ A;  3K0S A;  3CF5 L;  1RDD A;  5KPZ A;  4KTW A;  1R0A A;  3TAE A;  2NRX A;  3PUF A;  4B8A B;  4HUF A;  1Z26 A;  1FJG K;  1Q8I A;  3MMV A;  5M1K A;  2GX9 A;  4EZ6 A;  4YOT A;  5JLF A;  3G71 N;  5CYQ A;  1WSF A;  1W0H A;  3FZM A;  5AZJ B;  2KKZ A;  3MX5 A;  4C8N A;  5HRS A;  3CFP A;  4FLU A;  4OO1 J;  3OJS A;  4BE2 A;  5GAD P;  2RHK A;  1V4T A;  5AQT A;  4V19 S;  3HL8 A;  2PFU A;  3D2F A;  3AAP A;  2RN2 A;  4K42 A;  3AVK A;  3DLE A;  3DLH A;  1NK7 A;  2CH6 A;  3HK2 A;  4FYD A;  4OKK A;  4CHY A;  1T8E A;  5C0Y A;  1EO1 A;  1S9E A;  1K8K A;  5DMR A;  2ZGY A;  2F8T A;  1VQ7 N;  3P4I A;  4AHS A;  3THV A;  4BR7 A;  4I2Q A;  4L3Q A;  4JI5 K;  1YJ9 N;  2IIR A;  4KH6 A;  2NZT A;  3EE9 A;  3VEW A;  4DV6 K;  1NK9 A;  4JKB A;  3SK3 A;  1YAG A;  2EWS A;  1JCF A;  3S5T A;  4A5B A;  1VSI A;  3MN7 A;  5SWM A;  1U2V A;  2DFH A;  1BI4 B;  4JRQ A;  2UUA K;  4LF7 K;  1ESV A;  1QSL A;  3MXM A;  3SAG A;  2A42 A;  4M7X A;  3ZSW A;  3CJ9 A;  3CCV N;  5KTQ A;  1N8R O;  3FFI A;  3MCA B;  4PHT X;  5KGW A;  5T7B A;  3MEG A;  4YFU A;  4IBN A;  5FRO A;  2C1I A;  2QXF A;  2HHW A;  1HYV A;  3VQQ A;  1QS4 A;  2FBV A;  1IBL K;  2A41 A;  1B9F A;  3NVK A; 
#chains in the Genus database with same CATH homology
 3SJH A;  3CC7 N;  4C1N I;  2E1Y A;  2ZWH A;  2D0O A;  2HOE A;  3QDK A;  3GBT A;  4FWQ A;  2WUS A;  4JEP A;  4JKH A;  1J6Z A;  3O80 A;  3Q7B A;  3VGK A;  4RCH A;  3MN6 A;  3U9Z A;  5AQQ A;  1VQP N;  4EHT A;  2YCH A;  4ISE A;  3VGM A;  3M1F A;  4IEI A;  2NRR A;  1QVF M;  1GLC G;  2RE2 A;  1NGB A;  1P90 A;  4H5V A;  2VYP A;  3KWG A;  2Q0U A;  3L0Q A;  5EY4 A;  2GEL A;  4PKH A;  3QB0 A;  1NGJ A;  2HBK A;  5AQK A;  1KC8 O;  2YJF A;  1H1V A;  4BC4 A;  4BG8 A;  4WCE L;  5FPE A;  4JN4 A;  4BR0 A;  4IOX A;  2PBD A;  3O08 A;  3M5R A;  1M90 O;  4AF1 A;  2DPN A;  2GWK A;  3O9T A;  5E26 A;  3OBW A;  3CD6 N;  2NRH A;  2NRZ A;  4B1V A;  2AP1 A;  3ENB A;  3JXU A;  3O9Q A;  5AQO A;  3VEO A;  3VEN A;  4E1J A;  5GIP A;  5JVG L;  1IG8 A;  3QFU A;  4FL9 A;  1X9J A;  3GG4 A;  2YHY A;  5FPN A;  1NLV A;  1ATR A;  2QI2 A;  4H5N A;  1K8A O;  1RFQ A;  3T7Z A;  5AFU A;  3D6R A;  3VF2 A;  1E4F T;  5ADX H;  2V52 B;  3KZB A;  3CCS N;  4WQ5 C;  3WEE B;  3WUH A;  2HBL A;  4CZE A;  1SS6 A;  1DT9 A;  2I7P A;  2P9N A;  5KPT A;  1VQ4 N;  1NWK A;  3H3N O;  1C0G A;  4JK9 A;  2QWN A;  2W40 A;  4O5F A;  3CI5 A;  4H0T B;  4YDU A;  3MCP A;  3Q7C A;  4OPA A;  2PAV A;  4CZG A;  4BRQ A;  3ATV A;  1NM1 A;  3UE5 A;  5C2D A;  1QVG M;  2ZJQ L;  3OBY A;  4H0V B;  4YOV A;  4GVE A;  1WOQ A;  1TYQ A;  3O8M A;  3F2K A;  1VAZ A;  1MWM A;  2F9T A;  1G99 A;  3H46 O;  3GE1 A;  3IMX A;  2BUP A;  3R3L A;  1BUP A;  4BRD A;  4CZI A;  1D4X A;  4BRP A;  4IEE A;  4MDA A;  1T6C A;  4EIA A;  1Y64 A;  2FSJ A;  1MA9 B;  1BO5 O;  2ASM A;  2KLA A;  2VWB A;  3HTV A;  3QIC A;  4H5T A;  4BRF A;  5ADX A;  1NGE A;  2P9U A;  3HOS A;  2JWK A;  5CR4 A;  1ZBS A;  3W0L A;  1XC3 A;  3T69 A;  3BF1 A;  3CCU N;  1W2B M;  3A5L C;  5BN9 A;  2QWQ A;  2BH1 A;  5GAE P;  3BUZ B;  4JK8 A;  3VTH A;  5LY3 A;  3ZET B;  3WEE A;  2HF4 A;  3TTF A;  4KBO A;  3VOV A;  4A2A A;  2YHX A;  2P9N B;  3LDN A;  2VGM A;  3O9U A;  4LC9 B;  3DXK A;  5M1P A;  2Q97 A;  3A5N C;  2AA4 A;  2W41 A;  1JCE A;  5KPR A;  5AQS A;  4NO7 A;  2GTD A;  5M1N A;  3CJ1 A;  3H1Q A;  3W3D A;  2Q36 A;  5AZI B;  4BC3 A;  3R6M A;  5DM6 L;  3CC2 N;  4BRC A;  1IJJ A;  1SAZ A;  3CC4 N;  1Z05 A;  3CXC M;  3HBT A;  5AQU A;  3ZEU A;  3UKR B;  3VET A;  2ITM A;  4BRN A;  4FVU A;  1K9M O;  5CE3 A;  3LM9 A;  3O9R A;  3O9S A;  4I6M A;  3H3O B;  4JKF A;  4CZL A;  4B1X B;  2QWL A;  3SMP A;  4WF9 L;  5AQN A;  4BRO A;  1KXP A;  1NMD A;  2A3Z A;  2FF3 B;  2QTD A;  4KH5 A;  4XH1 A;  2NLX A;  3VER A;  5HOO A;  3I33 A;  4H03 B;  4G9Z A;  1YVN A;  3IKM A;  5F0X A;  2HBJ A;  5TKW A;  1BDG A;  2I7N A;  4CZJ A;  3UB5 A;  3A0I X;  3QBX A;  4FWR A;  3VES A;  3FLC O;  4BRI A;  2BTF A;  1T6D A;  4CD3 A;  4BEB A;  1E4G T;  2D4W A;  3MWP A;  3ZEU B;  4NB4 A;  5AQV A;  2JWL A;  2P9P B;  4O8U A;  3WXJ A;  2ZJR L;  3R8E A;  4JNE A;  5AQR A;  5FPM A;  4AM6 A;  4Z94 A;  1BU6 O;  3F5T A;  3O5B A;  4JKA A;  1LCU A;  3DAW A;  1Q82 O;  4FPA A;  1BG3 A;  1U6Z A;  3KHY A;  3MN5 A;  3WXI A;  4GV3 A;  3ZX2 A;  1Q7Y O;  2NRT A;  3H1V X;  3CMA N;  1YXQ A;  2P9K B;  3SBT A;  3OHR A;  4C23 A;  1QQM A;  4FWL A;  3DXK B;  1K8K B;  2P9I B;  3NVK A;  2GWJ A;  1HPM A;  1SZ2 A;  3G25 A;  4XEI A;  4BRH A;  4F9O A;  4RTF D;  5H1S Q;  2V51 B;  2HST A;  5C10 A;  4BRL A;  3KVG A;  5BRH A;  1SQK A;  4IO9 L;  3CCL N;  2VGN A;  1ZC6 A;  4IZ9 A;  3CJC A;  2ASP A;  4CZH A;  3CJ7 A;  1GLD G;  2WC9 A;  3R9P A;  2E2N A;  3KWI A;  5AQW A;  1NGC A;  2W00 A;  5KQD A;  3ZX0 A;  4FSV A;  2WFB A;  4BY9 C;  4ISF A;  5AQG A;  4BQZ A;  4WFA L;  1X3M A;  3GL1 A;  3WQU A;  3CCJ N;  3PIP L;  3I55 N;  5M1O A;  3SBG A;  3CET A;  3VGL A;  3BF3 A;  3AY9 A;  3C6A A;  1VQL N;  3H45 C;  4BR2 A;  4B1U B;  3MN9 A;  4BC2 A;  4EHU A;  2NRV A;  4DHY A;  3E1Y A;  1TUU A;  4EFH A;  3PIO L;  4ISG A;  4O8K A;  5EXW A;  4BRM A;  1RDW X;  4FOE A;  4CZK A;  3CCR N;  3OW2 M;  1W97 L;  2NRW A;  5BRD A;  3K9J A;  3P31 A;  4MO4 A;  4NLB A;  3UKU B;  3KK7 A;  3VTI A;  3TSU A;  3FZH A;  1JCG A;  3N4Q A;  3SAH A;  2C1G A;  3O4W A;  3L4Q A;  4H5R A;  1X3N A;  2CGJ A;  4JK7 A;  1GLE G;  4A2B A;  1YJN N;  3RSE A;  1NGI A;  1Z6R A;  2FXU A;  3BEX A;  3EE8 A;  3UKR A;  4MO5 A;  4U7B A;  3BP8 A;  2V7Z A;  3NMU A;  4DB3 A;  4B9Q A;  2P9K A;  3VF6 A;  1MWK A;  3VEV A;  1YUW A;  3U8X A;  5BPN A;  3DXM B;  5ELZ A;  3NVM A;  4IO8 A;  5GAG P;  5MLC Q;  3FE1 A;  4XH4 A;  3A5M C;  4CD1 A;  2E1Z A;  2P9S B;  2QW9 A;  4DKW A;  4BRE A;  1NGA A;  1T3V A;  4YDU C;  4FWN A;  5C15 A;  3DXM A;  4CZF A;  4IFE A;  3LDL A;  4WFN L;  1VQK N;  4CZM A;  2GUP A;  3EL2 A;  4DCH A;  3ZYY X;  5EVZ A;  5EOY A;  4IWV A;  1BA1 A;  1VQM N;  2QWM A;  4WFB L;  1ATN A;  1CZA N;  3TSP A;  3WQT A;  5C2F A;  3ENO A;  1GLL O;  2P9P A;  4IOA L;  1S3X A;  5F1X A;  2OTJ N;  2Q2R A;  4H0P A;  4IOC L;  4GNI A;  4CBX A;  1ZXO A;  4FOI A;  5CHI A;  2E20 A;  1VQ8 N;  4A59 A;  4BRK A;  2P9U B;  2IVP A;  2HBM A;  4K43 A;  4R79 A;  3LDQ A;  3FGU A;  4BVO A;  3JS6 A;  2NNW A;  2FSK A;  5FPD A;  3CCM N;  1V4S A;  2OTL N;  2HF3 A;  2YJE A;  5HL7 L;  1O13 A;  4FWM A;  2OAN A;  4H0X B;  4A5A A;  1DKG D;  4UY8 O;  3FFK B;  5DM7 L;  3M3Z A;  3LM2 A;  1KAX A;  3B8A X;  3GOI A;  1HX1 A;  4A62 A;  3CJA A;  3TPQ A;  3TSQ A;  1S72 N;  2GEM A;  5AZI A;  3CPW M;  1Q81 O;  1QZ6 A;  3DJC A;  2CGK A;  4MDB A;  4K25 A;  4CI6 A;  5JMV A;  4JD2 A;  3ULE B;  3M6G A;  3P38 A;  1XUP O;  4RWT A;  2QXL A;  3IDH A;  5BR9 A;  5BPM A;  5LJW A;  2ZJP L;  3U9D A;  3D2E A;  2CGL A;  2Q0R A;  3R1X A;  4ILH A;  4JD2 B;  3ULE A;  3CQX A;  1VQ9 N;  4ILG B;  1YI2 N;  2QEX N;  1BOT O;  4YOR A;  3DWL A;  1HKG A;  2A40 A;  3VMF B;  1YF5 L;  4BEC A;  5GIO A;  2D0P A;  2ZGZ A;  1DEJ A;  1NBW A;  3E9P A;  2YI1 A;  3D2F B;  3N4P A;  4MLH A;  1NGH A;  4DQ8 A;  5GAH P;  4J8F A;  1K73 O;  3WXK A;  1C0F A;  2E2O A;  3CER A;  1DGK N;  4JKE A;  4YOX A;  5AQX A;  4BR9 A;  5KQ8 A;  3C0B A;  4OPH A;  5AQH A;  4B1Z A;  3CQY A;  3VPZ A;  3EN9 A;  5LJV A;  3TTD A;  1R59 O;  4M7Y A;  3MX2 A;  4H0O A;  3UKU A;  3TU5 A;  5GIN A;  4Y0W A;  1S22 A;  5AR0 A;  3EO3 A;  3CPE A;  4IDH A;  4WYB A;  1JJ2 M;  3IFR A;  2IVN A;  1QZ5 A;  1VQO N;  2UYT A;  4PKI A;  4H0Y B;  3MK6 A;  5AQP A;  3CME N;  3L6Q A;  5AQL A;  3IUC A;  2IVO A;  3E66 A;  3G4S N;  4JAX A;  1M1K O;  3D7E O;  5C12 A;  4PKG A;  3HRG A;  3S41 A;  2ASO A;  2P9S A;  2QWO A;  2ZF5 O;  1VQ6 N;  4CBU A;  1YIT N;  4PL8 A;  3AGR A;  3O1B A;  4BQL A;  4WQ4 C;  3E9L A;  4JKG B;  3RSE B;  1HKC A;  4BVP A;  3LDP A;  5M1F A;  2QWR A;  2A5X A;  1HKB A;  3A5O C;  4IJN A;  3CCE N;  2QWP A;  1OKJ A;  2YHW A;  3AAQ A;  3PLA A;  4JKG A;  3TTC A;  3VF4 A;  4M63 C;  4WQ4 A;  5JVH L;  4BG9 A;  1KD1 O;  3D2E B;  5JIC A;  1ILY A;  4AM7 A;  3DLL L;  4PL7 A;  3VEZ A;  3HSC A;  1KAZ A;  4MLE A;  4JKC A;  3SMS A;  1KQS M;  4B1W B;  5JLH A;  5AQY A;  3EKS A;  4CJ7 A;  2E2P A;  3GDQ A;  1Q18 A;  3I56 N;  3CF5 L;  1XQS C;  3ZET A;  4YOU A;  1NGG A;  5KPZ A;  4BGA A;  4GV6 A;  3HI0 A;  1TUY A;  2NRX A;  2H3G X;  4H5W A;  4A57 A;  1U2V B;  5TKY A;  3I8B A;  1HLU A;  2FF6 A;  4YOW A;  4GV9 A;  1NGD A;  2VCP A;  4BC5 A;  3MMV A;  3QFP A;  4CBW A;  3OA9 A;  5M1K A;  3FZL A;  2GX9 A;  3EKU A;  5AQM A;  2CH5 A;  4QS8 A;  4YOT A;  2Q1N A;  3K9K A;  2FSN A;  5EX5 A;  3U4L A;  3LDO A;  5AQI A;  5JLF A;  3ID8 A;  3J8A A;  4XJX A;  3G71 N;  3J7Z O;  2P9L A;  3EZW A;  3FZM A;  3ID6 A;  5AZJ B;  3HZ6 A;  5M1Q A;  2KKZ A;  3MX5 A;  3WT0 A;  1VQ5 N;  1YHQ N;  5AFU H;  5BN8 A;  3QBW A;  1P8Z A;  4YOY A;  4FWO A;  1QHA A;  4OO1 J;  4A61 A;  5GAD P;  2RHK A;  3HOT A;  1V4T A;  5AQT A;  4BRA A;  3FZF A;  2PFU A;  3D2F A;  3P39 A;  1NGF A;  5F2R A;  3AAP A;  4IJA A;  2A6A A;  2P9I A;  4K42 A;  4B1Y B;  1BA0 A;  2QM1 A;  2YX6 A;  4HTL A;  1QQN A;  2CH6 A;  2V7Y A;  4JHD A;  3CCQ N;  4QS7 A;  1NJI O;  4JKD A;  3CHW A;  4XH5 A;  5C0Y A;  1EO1 A;  3AAR A;  2E8A A;  1YIJ N;  3C7N B;  1K8K A;  4BE7 B;  2ZGY A;  1VQ7 N;  4IXC A;  3C65 A;  2F9W A;  3E9O A;  3P4I A;  1BWF O;  3F9M A;  3LL3 A;  1QQO A;  3H6E A;  4FPB A;  4BR7 A;  4JHD B;  2QA4 N;  1GLA G;  5BRF A;  4L3Q A;  3CIP A;  1YJ9 N;  2IIR A;  4KH6 A;  2NZT A;  1T44 A;  3EE9 A;  2Q31 A;  3VEW A;  1YJW N;  4JKB A;  3CJB A;  3AGK A;  4FWK A;  3WXL A;  4C1N K;  3SK3 A;  1EQY A;  3O6W A;  3RVC A;  3ZX3 A;  4WQ5 A;  5BRE A;  1GLF O;  1YAG A;  4BGB A;  4K41 A;  2EWS A;  3VEY A;  4EAH D;  1JCF A;  1LOT B;  4QS9 A;  5E84 A;  4A5B A;  2D1K A;  1Q86 O;  3MN7 A;  5B8H A;  2P9L B;  1U2V A;  1OVY A;  4ILJ A;  5AZJ A;  3FR0 A;  2E88 A;  3MWT A;  2HMP A;  3ENH A;  3MDQ A;  4FWS A;  4KH4 A;  1ESV A;  3SLC A;  4FWP A;  3SAF A;  4NLC A;  3SAG A;  2A42 A;  3O1W A;  3C6H A;  4M7X A;  1ATS A;  3L4I A;  1KAY A;  1TYQ B;  1RDU A;  3CJ9 A;  3CCV N;  2J4R A;  3FZK A;  2FLO A;  2E2Q A;  4U67 L;  4I6M B;  3VEX A;  3MCA B;  5BPL A;  1N8R O;  1VQN N;  4PHT X;  1GLB G;  2F7T A;  4GY2 B;  4BRG A;  4BR4 A;  4HWI A;  2WBN A;  3G6E N;  1RGI A;  3C7N A;  1HUX A;  4BR5 A;  1HJO A;  2C1I A;  5AQJ A;  4FO0 A;  3WXM B;  3HM8 A;  3ATU A;  5AQF A;  1MDU B;  1GLJ O;  1WUA A;  5I9E B;  3A8Y A;  3QML A;  2A41 A;  2KHO A;  5AQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...