2P9NB

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
203
structure length
203
Chain Sequence
QAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-like protein 3
total genus 51
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9nB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9nB02
5F2RA 1KXPA 2F9WA 3C7NA 5AZJA 4YDUA 4FWPA 5AQIA 5JICA 4H5NA 4CBUA 3DXMA 2QWLA 3P4IA 1LOTB 3WXLA 2NZTA 1DEJA 4FOIA 3UKUB 4MO4A 5FPMA 5TKYA 5FPNA 1GLBG 2AP1A 3EL2A 4A2BA 1V4TA 3EO3A 2P9NB 4RCHA 1G99A 3R9PA 3M6GA 3VEXA 3CJ7A 3D2EA 4I6MA 3HI0A 4B1VA 2FXUA 1Z6RA 2ASOA 4BRCA 1JCEA 4Y0WA 5AQOA 2CGLA 3CJ1A 1NGCA 4BR7A 2UYTA 1QQNA 4B1WB 3QFUA 2E2PA 1HKBA 4BREA 5AQQA 1HUXA 1RFQA 1X3NA 5KPTA 5LJWA 3AAPA 2DPNA 3A5NC 3CHWA 1P8ZA 2HF4A 1Y64A 3A8YA 1MA9B 1BO5O 2ITMA 3DXKB 3R8EA 4Z94A 1DKGD 4MO5A 1ATSA 4JN4A 5AQKA 1RGIA 1DGKN 3VERA 4ISFA 1GLLO 1K8KB 4QS8A 3FGUA 4FWKA 2Q2RA 4H03B 1EQYA 4IWVA 4A2AA 1GLFO 4NO7A 3SMSA 1TUYA 2ZGZA 1SQKA 2VCPA 1KAXA 4DQ8A 3AY9A 3BEXA 2ZWHA 3ATUA 1C0GA 3WEEB 5AQFA 5AQTA 3FZHA 2E1YA 3VF2A 5BPLA 1NM1A 3ID8A 4IJAA 4BRPA 2F9TA 3CQXA 3W3DA 5AQSA 2CH6A 3QBWA 5AQLA 1T6DA 3UKRA 4IO8A 4XH5A 4AM6A 5LY3A 1S22A 2E2OA 2BUPA 1HX1A 5AFUA 3SMPA 2D1KA 2E8AA 2P9SB 3I8BA 3BF3A 2QWOA 4CD3A 3HTVA 4B1ZA 5FPDA 2FSJA 2J4RA 3MDQA 5LJVA 3LDQA 3QMLA 2QWMA 2Q0UA 4FSVA 2OANA 3CJAA 3VF4A 3GL1A 5AQZA 5KQ8A 3ZX3A 3J8AA 4FPAA 3H3NO 3VEYA 3QB0A 4CD1A 4HWIA 3O1WA 2I7PA 4KBOA 5BN9A 1X3MA 3LL3A 5EXWA 1BU6O 4FWNA 5AFUH 3JXUA 4CZIA 1LCUA 3LDNA 3H46O 3IUCA 4FWLA 3R6MA 4L3QA 5AQUA 1HPMA 1T44A 3SLCA 1YAGA 3GDQA 3VGLA 5EY4A 2P9LA 3VF6A 3BUZB 4JHDB 4C23A 5KPRA 1NGAA 1WOQA 4FWSA 1GLEG 4BR9A 4BR5A 4EHTA 2P9UA 3H6EA 3VEWA 1JCFA 1T6CA 5AQJA 5AZIA 5I9EB 3ZX0A 4H0PA 1K8KA 3UB5A 4JHDA 4K43A 1XC3A 4M63C 1J6ZA 3ZX2A 4M7XA 3ZEUB 3GBTA 5AQRA 3BP8A 3VPZA 4BRHA 2FSKA 2P9PA 3WQUA 2YHYA 2GELA 2HOEA 3EN9A 3RSEB 3LDOA 4GNIA 3H45C 2PBDA 2YJFA 2I7NA 3MN7A 1XQSC 4JD2A 2E88A 2YHWA 3SK3A 1NMDA 1NGGA 4JD2B 3EKUA 4DCHA 2IIRA 3FZLA 3U9DA 4LC9B 4H5TA 2NLXA 3IDHA 1CZAN 3VEVA 1E4FT 1NLVA 5AQGA 1JCGA 1NGFA 4FPBA 4EAHD 3IFRA 5BRHA 1YXQA 4CZMA 4PKGA 3FFKB 5AQNA 2YHXA 3AAQA 2E2QA 1ATNA 3HBTA 3DAWA 3WT0A 4F9OA 2QWQA 1V4SA 3L4IA 4BRIA 4ISGA 1RDWX 3MCPA 5AQXA 1BUPA 3EZWA 4O8KA 5F0XA 2H3GX 1C0FA 1QHAA 1MWMA 4FWMA 1TUUA 2A5XA 3FZMA 1U6ZA 2A42A 4PKIA 1NGEA 2P9IA 3S41A 2FF3B 4BRGA 5AQPA 3QDKA 4O5FA 4BGBA 2YCHA 1QZ5A 1YUWA 4H5RA 2A40A 4BVOA 2QM1A 2NRHA 4ISEA 1NGDA 3CJBA 3HSCA 4QS7A 2A3ZA 3FZFA 1QQOA 4BRLA 4WQ4C 4CBXA 1D4XA 1BA0A 2Q31A 2KHOA 3LM2A 3KHYA 5AQHA 3M1FA 4HTLA 4BR2A 3DJCA 2GEMA 4BRFA 1ESVA 3O4WA 3WUHA 5BR9A 2CGKA 5CE3A 1HLUA 1NWKA 3GOIA 2A41A 4FWQA 4BRDA 3WXIA 4AM7A 1TYQA 3G25A 3F9MA 1MWKA 3KVGA 1HJOA 2P9KB 3B8AX 5EOYA 3ZEUA 1YVNA 4JNEA 3OHRA 4H0YB 3O5BA 4H0OA 5E84A 4RWTA 3C0BA 2ZF5O 1BOTO 2W41A 1NBWA 3D7EO 5BRFA 2WUSA 1HKCA 5AZIB 5BREA 1H1VA 3A5LC 2FSNA 1IJJA 2FF6A 3O08A 4NB4A 5KQDA 4IJNA 4K25A 3VEZA 4BRNA 3LM9A 3UE5A 5JLHA 4H5VA 5F1XA 2QWPA 3L6QA 3MMVA 4PL7A 4PKHA 3WQTA 4BC3A 5B8HA 2ASMA 1IG8A 2IVNA 3ZETA 3M3ZA 1NGHA 4CZHA 1Q18A 2HF3A 5E26A 1OKJA 4CZLA 2D0PA 2P9IB 4CI6A 4BRQA 3O6WA 3W0LA 3ULEB 3FLCO 3VETA 4EHUA 2P9SA 3QICA 3UKRB 4E1JA 3QFPA 3O1BA 4K41A 1XUPO 2GWJA 1HKGA 4CZEA 1BG3A 1S3XA 2V7ZA 3JS6A 4BROA 4B1UB 1MDUB 1ZXOA 1GLCG 3GG4A 4CZFA 3ENOA 4XEIA 2D4WA 4BR4A 2W40A 5ADXA 5BPMA 2V51B 3MN6A 2FLOA 2P9UB 2Q97A 1GLJO 4BC4A 4CJ7A 4BGAA 4CZKA 2E20A 2V7YA 4EIAA 2V52B 1ZBSA 4MLEA 5AQMA 2P9KA 4WQ4A 5ELZA 5AR0A 4WQ5C 3U4LA 4CBWA 2P9NA 4EFHA 1BA1A 3FR0A 4H0VB 1KAYA 2Q36A 3L0QA 3BF1A 5EX5A 3VESA 3CQYA 4QS9A 4H0TB 2EWSA 3A5OC 3DXMB 5KPZA 1NGIA 1TYQB 2IVOA 1NGBA 5AQVA 3CERA 3VGMA 4BVPA 3ENHA 3CI5A 2CH5A 5EVZA 3HM8A 3LDLA 1QQMA 2QWRA 3A0IX 3KZBA 3MK6A 4FL9A 3I33A 4CZGA 4DB3A 3SJHA 4K42A 5AZJB 5BN8A 4CZJA 4XH4A 5BRDA 2GUPA 2QWNA 3CJ9A 1KAZA 3IMXA 4MLHA 3H1VX 3MN9A 4A62A 3H1QA 2ASPA 3GE1A 3D2FB 2YI1A 4JAXA 3CJCA 2ZGYA 3C7NB 4WQ5A 3U8XA 2BTFA 3VGKA 4BG8A 3FZKA 2VYPA 4FWOA 3ULEA 4PL8A 1SAZA 5ADXH 2Q0RA 4I6MB 1X9JA 4FWRA 4A61A 3O8MA 4BG9A 3CETA 3TU5A 2CGJA 1U2VB 4J8FA 5JLFA 3TPQA 1NGJA 4H5WA 4IXCA 1WUAA 3DWLA 5FPEA 3MN5A 2HMPA 3O80A 4M7YA 4BRMA 3ZETB 4FOEA 3RSEA 1SZ2A 2AA4A 3VENA 3WXKA 2P9PB 3AARA 3EKSA 4BQLA 3FE1A 4BQZA 3H3OB 2E2NA 3HZ6A 1ATRA 1BDGA 5BPNA 2GTDA 2QXLA 3D2EB 4GY2B 1GLAG 1ZC6A 2VWBA 4FO0A 4RTFD 4B1YB 2YJEA 4BRKA 5JMVA 2E1ZA 3ATVA 4YDUC 2P9LB 3WEEA 1U2VA 2Q1NA 4H0XB 1BWFO 4IZ9A 3VEOA 1Z05A 4DHYA 2D0OA 1E4GT 1QZ6A 2PAVA 3CIPA 3UKUA 3WXJA 2GWKA 1R59O 3QBXA 4WYBA 4XH1A 4BC2A 4BRAA 1GLDG 2QW9A 3VOVA 2A6AA 3A5MC 4B1XB 3DXKA 4BR0A 3D2FA 5AQYA 4B9QA 3LDPA 4BC5A 3U9ZA 5AQWA 2IVPA
chains in the Genus database with same CATH superfamily
3TTCA 5F2RA 3C7NA 5AZJA 1QHTA 5TKWA 3K5MA 2OTLN 4Z4CA 1T05A 4F8RA 4CBUA 3QO9A 4LFCK 3CG7A 1N33K 3CFPA 4DR1K 1TKTA 3TAQA 3UKUB 4KHWA 1V4TA 3TAFA 2HNYA 3TI0A 2ZM6K 2P9NB 3VMFB 1S6QA 4RCHA 3T3FA 3SPYA 3DRRA 1XHXA 1VQMN 1QSYA 4B1VA 5GIPA 4ELUA 1Y97A 4Y0WA 1NGCA 3SV3A 4M3WA 4HCBA 1YHQN 5KPTA 5LJWA 3AAPA 1CLQA 2IC3A 1P8ZA 3CMEN 2HF4A 1Y64A 1MA9B 2I5JA 1BO5O 4FLYA 1R0AA 1ATSA 1NJWA 1NOYA 1DGKN 4ISFA 4ICLA 3KK2A 1EQYA 4F4KA 1ZYQA 1X9MA 1VQ8N 3SCXA 3BZKA 3HYFA 4NO7A 4C8NA 3SMSA 3WNHA 1VQKN 5J2NA 2HHVA 2VCPA 1KAXA 3AY9A 3BEXA 1C0GA 1LW0A 3NHGA 5AQTA 3FZHA 3ID8A 1JXBA 1WLJA 2F9TA 3G6EN 4CF0A 5AQSA 4FJMA 2CH6A 4FZZA 4CJPA 2GUIA 1SL0A 3EE8A 3NF6A 3NGIA 2QWOA 4AH9A 3PX0A 3AA2A 3CQ8A 4BEBA 3LDQA 5GADP 2OANA 1OVYA 3OA9A 2W42A 1VSEA 2A1SA 5KQ8A 1K9MO 3ZX3A 3VEYA 3THWB 3VQ5A 4GW6A 1YTAA 3CCEN 3PLAA 3IRXA 3LL3A 3THWA 1NJXA 2PYLA 4PY5A 3H46O 2JWKA 4AHRA 1EWQA 4EP4A 3H08A 5IT9O 1HPMA 5M1OA 1YAGA 3NH0A 3BUZB 1RILA 4JHDB 4C23A 5C0YA 4DUZK 3H6EA 1JXEA 4DTPA 5AQJA 4DF8A 1Q86O 3VQ6A 3THYA 1D9DA 3ZX0A 4H0PA 4DSEA 3NF8A 4LY7A 4JK9A 3ZEUB 1D9FA 5AJ3K 4I2QA 3AVJA 4BY9C 1C6VA 4IEIA 2QI2A 2HVIA 4WFAL 4E89A 2YV0X 4UY8O 1NU0A 4JV5K 4CHPA 3PIOL 5HROA 4FLXA 4IOAL 4CEFA 3H45C 3NDKA 1TKDA 3ISNC 2YHWA 3S3OA 1NMDA 4B9VA 4IFEA 4DCHA 2IIRA 3FZLA 3U9DA 2O8EB 3L2WA 4DLGA 1D5AA 4H5TA 5AQGA 2O8EA 4FPBA 2O4IA 1N8RO 2O8BA 5BRHA 4DG1A 1BHLA 1LAVA 3TSPA 4JI8K 4OX9K 2B5JA 3KLHA 1ZBLA 3FFKB 2YHXA 4DUYK 3CXCM 3RMDA 4LSNA 4OKEA 4F9OA 2QWQA 5CZ2A 4BRIA 1JJ2M 4ISGA 2ZJRL 1OVQA 5CZ1A 3EZWA 2KZZA 2VQEK 1C0FA 1QHAA 4DSKA 4WF9L 4KB1A 3D0PA 3LAKA 1U6ZA 3AVNA 3AGKA 1X1PA 3RTVA 3NE6A 1NGEA 2P9IA 4C1NI 2FF3B 1VSFA 4BRGA 4FLUA 3QDKA 3L2VA 1U48A 1QZ5A 1DTTA 4OVLA 4O5BA 4DFKA 1VQ7N 2A40A 2NRHA 1RBRA 4LH4A 1NGDA 3QNOA 3CJBA 4DKWA 4QS7A 4CFBA 2A3ZA 1W9HA 3PY8A 1QQOA 1NK0A 4WQ4C 3ZT4A 3R3LA 4K8ZA 3VTIA 3KHYA 4YORA 4BR2A 2HMIA 4DTRA 3QIPA 4BRFA 3WUHA 4B08A 4DU3A 4BRDA 1TAQA 3MX2A 3NBPA 3VQCA 2HHXA 3WNFA 1BI4A 4JLHA 3CFRA 2VG7A 1HJOA 4YFUA 4HTUA 2P9KB 4JI5K 3ZEUA 4H0YB 2E6MA 1KTQA 2ZF5O 4CFCA 1RT2A 1RTIA 3HL8A 4M3YA 2HSTA 2OPPA 4CGJA 1KD1O 1IJJA 1IKYA 1EO1A 4JI1K 4K25A 4Q5VA 3VEZA 2GX9A 3KD5E 1RT7A 3UE5A 5JLHA 5M1FA 3THXA 2QWPA 3MMVA 2WC9A 3WQTA 4BC3A 5J1EA 3C95A 4DR5K 2P51A 4N56A 1Q18A 4O8UA 4N47A 1WNSA 4CZLA 5HL7L 4YOVA 3OBYA 1FJGK 2UUBK 1YJNN 4CI6A 1EETA 3KIOA 1C0TA 3J7AP 3O6WA 4FJ9A 3VETA 2HVHA 4E1JA 3QFPA 3O1BA 4K41A 1RCHA 2D0AA 1QE1A 1X9SA 4CF8A 1S1WA 1WN7A 3SPZA 3QIOA 4CHNA 4KH6A 1MDUB 1ZXOA 3CC4N 1NK9A 3OVNA 2YNFA 4KTQA 4XEIA 3KTQA 2D4WA 4YHHK 3AVIA 5ADXA 1IBKK 2V51B 2FLOA 2P9UB 1EKEA 2G8WA 3ZT1A 4FW2A 4AQYK 4JKGB 3JYTA 3K5NA 2GV9A 2V52B 4N5SA 2C1IA 4MLEA 1EP4A 4GV9A 1SKSA 5AR0A 5KRSA 2XHBA 4WQ5C 4CJ5A 2P9NA 4XIUA 4DTOA 3ZSYA 1M90O 4DV4K 1KAYA 5I3UA 2Q36A 4CFAA 4PHTX 3E01A 3L0QA 3VESA 4H0TB 3A5OC 5KPZA 1NGIA 3E9OA 4DV3K 3KK7A 3OYDA 1NGBA 3NF7A 5C25A 2G8IA 3LPUA 1SL1A 3DLHA 1RDUA 1RT6A 2VGMA 4BVPA 3HM8A 3LDLA 1QQMA 2VGNA 3I33A 4CZGA 3DLRA 3JSMA 4V19S 3ZYYX 4KKOA 4FM0A 2FC0A 3CJ9A 1KAZA 2QKKA 2HHQA 4I7FA 3C6UA 3OYMA 1NK8A 4O44A 4A62A 1O1WA 4DU1A 2YI1A 3CJCA 2HHSA 3OS2A 2XY5A 3C7NB 4Z4FA 4DR4K 3VGKA 3FZKA 3TSUA 1HYVA 4FWRA 1QTMA 3L2UA 3D6RA 4A59A 1WSIA 2CGJA 4J8FA 3TPQA 1HNVA 2YKMA 3MN5A 5FROA 3ZT0A 4FK4A 3LZJA 2UXDK 1IBLK 3ZETB 3QINA 4FOEA 3RVCA 3AARA 3EKSA 4BQLA 4E7LA 3OYIA 1TV6A 3H3OB 2ZJPL 1KRPA 3HPHA 3ZSOA 1C0UA 1QS4A 2GTDA 1D8YA 3D2EB 2HHHK 4W5NA 1ZC6A 2VWBA 1TK0A 5C12A 2Z1IA 4CERA 3NVMA 1Q82O 3WEEA 1U2VA 3SBGA 4KI6A 1TK5A 1VAZA 4PUOA 1E4GT 2DTUA 3CIPA 1TVRA 2UXCK 4WFNL 2GWKA 1K6YA 2HBJA 1QSSA 4XH1A 4BC2A 2RPIA 3VOVA 4JS5A 3M8RA 3LANA 2Y1IA 3DXKA 3D2FA 4B9QA 1L3SA 4NXMK 3VQ4A 4CJWA 2F9WA 3AVBA 3MAQA 4YDUA 2R7YA 4CEOA 4AF1A 1JL1A 3KLIA 3DXMA 1F21A 2HHTA 2XY6A 3THYB 1GLBG 3EL2A 4A2BA 3EO3A 4LH5A 3MXJA 1LV5A 3LALA 3K9JA 5HP1A 4I6MA 4CEZA 3RRGA 2CGLA 2UYTA 4B1WB 2QEXN 2E2PA 3SYZA 4HVJA 1HKBA 1U49A 3L2RA 3LP0A 4Z94A 3DXKB 4AILC 4MO5A 5AQKA 1VSMA 1EXQA 1GLLO 1K8KB 3I0SA 3V6DA 4FWKA 2Q2RA 3VA0A 1VQ5N 4A2AA 3ZLJA 3O9UA 3BGRA 1GLFO 3QEPA 1XC9A 3OJUA 4FJNA 4CF2A 3TTDA 1SQKA 1XNQK 2ZWHA 3ATUA 1ILYA 2E1YA 3DOKA 4G1QA 4BRPA 3W3DA 4C8KA 3QBWA 3NVKA 3CCUN 4AM6A 2E2OA 1WBDA 1YJ9N 3SMPA 2D1KA 2E8AA 1BGXT 4KH5A 4B1ZA 2AJQA 4JI0K 2J4RA 3O4QA 4RW6A 4YNQA 4GKJK 2OYQA 3MDQA 4M45A 2ETJA 3O3GA 5T7BA 3CC7N 2Q0UA 3AVLA 2F7TA 1N34K 1T3VA 3CJAA 1UAXA 3CCSN 3GL1A 1CZ9A 3KKSA 3PSFA 4FPAA 4CJFA 1XHZA 4JRQA 2G8HA 4OGEA 1J5OA 1KLMA 5EXWA 1Z25A 3JXUA 2E5LK 1LCUA 1YVUA 3LDNA 5GIOA 3PUFA 4Z4EA 4F2SA 4FWLA 3ZCMA 4IFYA 5AQUA 3P31A 3SLCA 4CGFA 5GAEP 5FRNA 3GDQA 3HRGA 4KREA 2OZSA 4H4OA 4DSLA 1NGAA 3M5RA 1WOQA 1GLEG 4BR5A 3U6FA 4KFBA 4FVMA 2P9UA 3VEWA 3ZSQA 3AO5A 4CE9A 3T1AA 1OH7A 1JLFA 4W5TA 1C1AA 2VG5A 2EX3A 4K43A 1J6ZA 3GBTA 3OY9A 2HBKA 1BIUA 3VPZA 1BCOA 4DF4A 3OYHA 4CIEA 2P9PA 2KLAA 2WTUA 2YNIA 4OPAA 3LZIA 5DMRA 2GELA 2HOEA 3LDOA 3PV8A 3ZSZA 4FM2A 2YJFA 2YX6A 2I7NA 4GVEA 4ID1A 4CVNE 3TAPA 1NKCA 3ZT2A 3TAGA 2O8DB 2Z1JA 3P5JA 5M1QA 3HP6A 1NGGA 3D45A 4BE1A 1Q9XA 2D0BA 4LC9B 5DM7L 4E3SA 4BE0A 2FBVA 2NLXA 3IDHA 3HPGA 2IGIA 1JCGA 3NF9A 3HXMA 3B6OA 4CW7B 4C1NK 1NGFA 1KFSA 2HNDA 1XWLA 4B3OA 4CZMA 5AQNA 3HP9A 5FDLA 4Q0BA 2E2QA 1ATNA 3DAWA 1J54A 1V4SA 3L4IA 4KTWA 3HM9A 1KVBA 3KLEA 2H3GX 3IG1A 2OTJN 2UXBK 4XJXA 2W6LA 4JRPA 1C0MA 3FZMA 1WSEA 3OW2M 1HQEA 2KZMA 3CCVN 1B92A 5AQPA 2QKBA 2RE2A 4B9MA 4DTJA 4BVOA 2P5GA 4ISEA 4JK7A 4DTXA 4W5QA 1NK6A 4BACA 4DTMA 2G8KA 3FZFA 4F2RA 2Q31A 4MFBA 3K59A 3CM6A 3LWLA 4HTLA 4FW1A 4IKFA 2GEMA 4E0DA 2CGKA 4FWQA 3NCIA 3GOIA 2A41A 4DR3K 4KAZA 3O9SA 3WXIA 3SAFA 1TYQA 4HUGA 3ZSVA 4DV1K 3DMJA 5EOYA 3K5LA 4WCEL 5LMUK 3KD1E 3OYFA 1VQ4N 4NCGA 1HYSA 1BL3A 1WSJA 3OHRA 4IG0A 3AVCA 3O5BA 4IG3A 5KGXA 4JKAA 4MDBA 4JI7K 5BRFA 2WUSA 5AZIB 1L3TA 1H1VA 3KLGA 1GOBA 3OS1A 3N4QA 5HRSA 3THXB 2FF6A 3E1YA 3SAGA 4IJNA 3C94A 1S6PA 3P1GA 1K73O 3NMUA 3LM9A 2UUCK 4BWMA 4FJIA 4DWIA 4BE7B 3AV9A 2NRZA 4WE1A 1NMNA 2IVNA 1GOAA 4B3TK 4OLAA 3ZETA 3M3ZA 2Y1JA 4CZHA 1YT3A 2YHAA 2HF3A 3TR8A 3PO4A 5E26A 3L8BA 4LF9K 4Z4HA 3BY5A 1RDDA 4Y1DA 3V9XA 3SZ2A 1XI1A 3QEWA 4EHUA 4YOYA 4CJRA 3F2KA 3F73A 4DSJA 3OBWA 5DM6L 2VWJA 1W97L 5LL6Z 1HKGA 4CZEA 4BROA 4B1UB 3MXIA 1BCMA 1I3AA 2WOMA 3SI6A 1GLCG 5J2PA 3ENOA 2X74A 1T03A 4DS5A 1CXQA 4DTSA 1NJYA 5JENA 2O8CB 3MEDA 4BC4A 4U7BA 2P5OA 3T69A 2E20A 5AQMA 4AHCA 1S1TA 5ELZA 3V1QA 3TSQA 4CJQA 3HPOA 1I39A 2LSNA 4DQRA 1BA1A 4H0VB 2ATQA 1ASVA 1OH6A 3R1XA 4JI3K 3BF1A 5EX5A 4C8MA 4J2EA 1IKXA 4FXDA 1TYQB 1KQSM 1HPZA 1EX4A 2IVOA 5AQVA 1WSHA 2YNGA 3CI5A 3NFAA 4KH4A 5GAGP 3A0IX 2OPQA 4ILHA 1SL2A 2PYJA 3VQAA 4FJHA 5SZTA 5CY4A 5AZJB 2GUPA 4LD0A 3C6HA 3KWIA 3V9WA 1FK9A 3MN9A 2ASPA 3GE1A 2ZGYA 2O8FB 3EYZA 3CFOA 2FBXA 2F8TA 4M3TA 3OYEA 3CCMN 4CJTA 2VYPA 4FLVA 1SAZA 2Q0RA 2A1RA 1X9JA 4A61A 3O8MA 5MLCQ 4AHSA 3CETA 1FXXA 4KI4A 4AHTA 3G71N 1ITGA 2HMPA 4M7YA 5KI6A 3RSEA 4B9SA 2AA4A 3VENA 3F9KA 3K5OA 4FJJA 2P9PB 3FE1A 4BQZA 3ZSWA 5J2QA 1BIZA 1VQ9N 4FK0A 1ATRA 1BDGA 1XNRK 4JKEA 4GY2B 1W2BM 2IOCA 3IS9A 1WB9A 2E1ZA 4YDUC 4FJKA 4IOXA 4DV5K 4A5BA 4CEEA 3DLEA 3VEOA 1RT5A 4DHYA 1VQON 2HHUA 1U04A 1L5UA 1VQ6N 1N6QA 4O55A 4M3UA 1QZ6A 4DV6K 3UKUA 3Q7CA 3Q7BA 4BRAA 3AO3A 1YITN 1S1VA 2QW9A 2A6AA 3A5MC 3PSIA 4CIGA 3U9ZA 4NYNA 2B6AA 2GWJA 3O3FA 1KXPA 2ZE2A 3TAEA 3ZSXA 4FWPA 5AQIA 4H5NA 4GVMA 3DM2A 1LOTB 3WXLA 4YOXA 4KHUA 3SUOA 4X62K 3DRPA 1WSFA 4JKCA 3ULDA 1DEJA 4FOIA 4AHVA 5CYMA 3EE9A 2AP1A 3OYKA 4CHQA 3R9PA 3M6GA 3VEXA 3CJ7A 3D2EA 3U3YA 3MXMA 3HI0A 2FXUA 1S1XA 1A5VA 4I9QA 2ASOA 4KHQA 3G10A 3CJ1A 4FJ8A 4BR7A 1B9FA 4FVUA 3V1RA 1QQNA 3QFUA 1I94K 3KLFA 5AQQA 1HUXA 1RFQA 1X3NA 2BE2A 1X9WA 3U3GA 3A5NC 3CHWA 3A8YA 3S9HA 5HRRA 2ITMA 3K57A 1DKGD 4JN4A 4ZTFA 3VQBA 1RGIA 3TWHA 4KHSA 4QS8A 4H03B 3TANA 4ELVA 5C15A 4IO9L 1A5XA 5M1KA 3VQQA 1TUYA 2ZGZA 3CF5L 4B9NA 1WSGA 1NKBA 4DQ8A 3AA3A 2PY5A 4KPYA 5AQFA 3VF2A 3ID6A 4IJAA 1S9EA 4GKKK 5AQLA 3BDPA 4CHYA 1T6DA 4XH5A 1S22A 5C42A 2BUPA 1ASWA 4OLBA 1HQUA 4CESA 3MCAB 2P9SB 3I8BA 4JKGA 5K14A 3BF3A 4JEPA 5JS1A 3HTVA 4JI4K 4F3OA 4OO1J 3OYGA 2HBMA 4MQ3A 5LJVA 2XY8A 3QMLA 4FSVA 3F5TA 4Z4GA 2X6NA 3VF4A 5KTQA 5AQZA 2F4VK 3J8AA 3VA3A 4CD1A 4HWIA 3O1WA 2I7PA 4KBOA 2BANA 5BN9A 1X3MA 1CXUA 3I8DA 3IUCA 4NXNK 3R6MA 1T44A 1FKOA 4DV7K 3E66A 5EY4A 5H1SQ 4AHUA 2P9LA 2ZD1A 3ASMA 1N36K 5HOOA 3HSTB 2XY7A 3P38A 4FWSA 1T7PA 4EHTA 4R5PA 4CF9A 3V81A 1JCFA 4E1MA 3THVA 4OKJA 2DFFA 1U45A 3UB5A 3AGRA 4M63C 1YF5L 3J7ZO 3LPTA 3ALYA 5CYQA 1VRUA 3TARA 3EZ5A 5AQRA 3V1OA 4B9TA 3BP8A 5GINA 2O8DA 1QVFM 4CJVA 1UOCA 2WONA 2FSKA 3WQUA 4CFDA 4FLZA 2YHYA 1TL1A 3DLLL 1EWRA 4GNIA 5FLXO 2PBDA 3CYMA 4E7HA 3SUNA 2E88A 1J9AA 1NK7A 2QK9A 4LF4K 4FK2A 3SK3A 2IDOA 2GBZA 3AVHA 3DLGA 3AA4A 4CF1A 3CMAN 1TGOA 4JD2B 3OYAA 2NNWA 1LWFA 4O0JA 4CEBA 1CZAN 1YI2N 1NLVA 3IKMA 4YOUA 3AVAA 4OPHA 3MWPA 4ZHRA 1RBVA 4F3TA 4FCYA 3RMBA 4PKGA 5C2FA 4W5RA 4I9LA 3AAQA 1IO2A 3HBTA 1KC8O 1J5EK 4A57A 1HYZA 2RF2A 2O4GA 1B9DA 4FWMA 4CJKA 4EZ9A 4DU4A 2A42A 2NUBA 4PKIA 2D5RA 3M8SA 3HVTA 2JLEA 2ITGA 4BGBA 4O5FA 2YCHA 4TSXA 4J2AA 4H5RA 4DFMA 1W7AA 4JK8A 2G8FA 1C1BA 1BA0A 1A5WA 2FBYA 2KHOA 4DMNA 3LM2A 5AQHA 3OYCA 3TABA 1KSPA 1P90A 3DJCA 1ESVA 3O4WA 1N32K 3HJFA 4K0KK 4JI2K 1JLCA 3NGYA 4RW9A 1HLUA 3MX5A 4ID5A 4CGHA 1Z26A 2VQFK 1HMVA 3HOSA 3F9MA 1MWKA 1KCFA 1S72N 2YNHA 3B8AX 3L3VA 5I42A 1RT1A 5BR8K 1YVNA 4Z0UA 4H0OA 1DT9A 3C0BA 1BOTO 3OYBA 1NBWA 4X66K 5BREA 1HKCA 4O0IA 3SAHA 3A5LC 3O9TA 2E6LA 5KQDA 3N4PA 3AVFA 4BRNA 4BWJA 2JGUA 5GAHP 4LSLA 3PO5A 3C6TA 3K2PA 4PKHA 5B8HA 2ASMA 4BECA 1IG8A 4CK1A 4DR6K 4CK2A 4DTNA 4HUFA 1VHXA 1OKJA 3WXMB 4B9UA 4HUEA 2P9IB 4B3SK 1HNIA 3W0LA 3ULEB 3AO2A 3FLCO 2P9SA 3UKRB 4JKFA 5EU7A 4M3XA 4Z4IA 2XO7A 1LWCA 2V7ZA 3JS6A 4CZFA 1RTDA 3MECA 4BR4A 1NK5A 5BPMA 3MN6A 4M3RA 2Q97A 1TKXA 4YY3K 4FLWA 5FRMA 4CJ7A 4BGAA 1VQNN 4DFPA 4IFVA 4EIAA 3S3MA 2P9KA 1HR0K 3U4LA 2RHKA 4EZ6A 3FR0A 1S9GA 3VQ8A 3JAMO 1FKPA 2OCEA 2E4LA 3CQYA 1SKRA 2EWSA 3SQ1A 3DLBA 1JL2A 1T8EA 4L8RB 4CIFA 3OYNA 1XMQK 1JLQA 4OKKA 4DQQA 1SKWA 3ENHA 1KVCA 2CH5A 1U4BA 4LF8K 2QWRA 4KHNA 2HHIA 1JLBA 4FL9A 2W00A 4DB3A 3RRHA 5BN8A 4KRFA 2QWNA 4GV6A 1TKZA 2KQ2A 2KTQA 4MLHA 5C24A 1G15A 3H1QA 3SQ2A 3D2FB 4MDAA 1ZBUA 3NAEA 1HRHA 4EP5A 4WQ5A 3U8XA 4BG8A 2F8SA 4CJSA 4OPJA 4FWOA 4JYAK 3TAMA 3K0SA 2NRXA 3TU5A 1U2VB 5HRPA 5JLFA 4DS4A 4FZXC 1NGJA 4H5WA 4IXCA 1WUAA 2HBLA 3DWLA 4HHTA 3FFIA 5FPEA 4U67L 4BRMA 3RWUA 2VG6A 1S1UA 1ASUA 2PZSA 1IKWA 3WXKA 1OH5A 4BDYA 4E1NA 5BPNA 3WNGA 3HOTA 2QXLA 3VN5A 1GLAG 4FO0A 4RTFD 4B1YB 1O13A 1VSJA 1ZBIA 2BH1A 3ATVA 4DQPA 1VSLA 1NKEA 2Q1NA 1BWFO 1Z05A 5JVHL 2D0OA 2HNZA 1RBUA 1UWBA 3O9RA 2PAVA 1BQNA 3J7YP 4WYBA 1GLDG 2NRVA 3QEIA 4B3MK 4N41A 5AQYA 1LWEA 3NH1A 2NRWA 1IBMK 4FJ5A 3ITHA 2C1GA 1KVAA 3AVMA 1RBSA 4DSIA 3E9PA 4BDPA 1SV5A 2BDPA 1OH8A 4J2DA 1KLNA 3A2FA 2Z1GA 4DQIA 5JICA 3T1HK 2QWLA 3P4IA 4FJLA 2NZTA 4CCHA 2JWLA 1M1KO 4MO4A 5FPMA 5TKYA 1NJIO 5FPNA 3CYGA 4LF5K 4KTZA 1G99A 3J80O 4CEDA 1DTQA 5KRTA 3CC2N 4FYDA 3MEGA 1Z6RA 1ZBFA 4BRCA 3KK1A 1JCEA 5AQOA 1NNEA 2EHGA 1VQPN 1W0HA 4G9ZA 2WFBA 3HO1A 2RKIA 4BREA 2DPNA 4NLBA 4C8OA 1VSHA 3R8EA 4IBNA 4X65K 3S3NA 3VERA 3FGUA 4IWVA 4RW8A 4FZYA 4B8CA 3OYLA 3WEEB 3RR7A 1JLAA 5BPLA 1NM1A 4N76A 3SV4A 3DOLA 2KKZA 3CQXA 1HJRA 2X78A 2W6KA 4RW7A 3UKRA 2KFZA 4IO8A 5LY3A 4BDZA 1RTHA 1SUQA 3QEVA 2OA8A 2O8BB 3B6PA 1HX1A 5AFUA 1C1CA 1VSIA 3M8PA 4LFBK 4W5OA 5D3GA 4H4MA 3LP1A 4J2BA 4CD3A 1GOCA 5FPDA 2FSJA 5DK5A 1RNHA 1K8AO 2QWMA 3O3HA 4CECA 2UUAK 2F96A 3QNNA 3HT3A 3SJJA 4DV2K 1S5JA 2D0CA 3SQ0A 3VQPA 3H3NO 3QB0A 4QAGA 4DR7K 4ELTA 3O9QA 3RR8A 1L3UA 3MEEA 1BU6O 4FWNA 5AFUH 4CZIA 3CCQN 4CK3A 3LDSA 2YKNA 4L3QA 2P1JA 4CHZA 5E41A 3SUQA 4ILJA 2UU9K 3VGLA 3VF6A 1IKVA 5KPRA 1JLEA 4BR9A 4CJUA 5HLFA 1T6CA 5AZIA 5LMNK 4NCAA 3P83D 5I9EB 2XRIA 1K8KA 4JHDA 1XC3A 3ZX2A 4M7XA 4PA1A 3I56N 1NJZA 4JS4A 4CEAA 4K8XA 4BRHA 4GMJB 3K58A 5CHIA 2ZQBA 4E19A 4ILGB 1Q81O 3EN9A 1QVGM 3RSEB 3CCLN 1XMOK 5KGWA 1QQCA 1TAUA 1Q9YA 5M1PA 1VQLN 3AO1A 3MN7A 3SQ4A 1XQSC 4JD2A 3O4NA 3BZCA 3AVKA 4R79A 1E3MA 1WAFA 3E9LA 3EKUA 1QSLA 1RTJA 3VEVA 3OJSA 1E4FT 4KHPK 1NOZA 5A2QO 4EAHD 4PWDA 4GV3A 3IFRA 4YOTA 1YXQA 1RDAA 3LWMA 3HVRA 2G8VA 4H8KA 1BI4B 4CJLA 4RG8A 3WT0A 1YIJN 5IWAK 3NGZA 1RDWX 3MCPA 3CPEA 5AQXA 1BUPA 4O8KA 3KJVA 5F0XA 1U47A 1MWMA 1TUUA 4KB0A 2A5XA 1MU2A 4ZTJA 3AVGA 1VRTA 3L4QA 2IS3A 3ZSRA 2NRRA 4JI6K 3S41A 4I2PA 3QLHA 3QERA 1YUWA 3SNNA 2QM1A 1WBBA 4FM1A 3LP2A 3HSCA 4JKHA 2OZMA 1BISA 4HCCA 4BRLA 4CBXA 1D4XA 4CGDA 1Q8IA 3M1FA 2PFUA 5C10A 3I55N 1NG9A 4DTUA 1YTUA 4M41A 5BR9A 2BGGA 5CE3A 1NWKA 2Q3SA 1KFDA 4NLCA 3J81O 3CCRN 1HNWK 4AM7A 3SBTA 1HNXK 4M3ZA 3G25A 1IV0A 4JKBA 3QESA 3V4IA 2DFHA 3KVGA 3P39A 4KHYA 4KO0A 3V9ZA 3CD6N 2DY4A 4E72A 2HW3A 1JKHA 4JNEA 4NYFA 3EEQA 3G0ZA 2ZJQL 5SWMA 5E84A 4RWTA 1Q7YO 2X6SA 2RN2A 2W41A 2QA4N 3D7EO 3CCJN 2FSNA 3T19A 1SS6A 4E7KA 4IEEA 3O08A 4NB4A 4IDHA 3PX4A 4CGGA 2YHBA 3VTHA 2QTDA 4H5VA 5F1XA 3L6QA 4DFJA 2KW4A 4PL7A 4YOWA 4CHOA 4DV0K 3QEXA 3RMCA 3VQ7A 1NGHA 3UIQA 4FJGA 2O8CA 2D0PA 3I0RA 2O8FA 3LP3A 4PQUA 4CJ4A 3V9UA 1L3VA 4JKDA 4BRQA 3VQDA 3C65A 3KK3A 1HNZK 4M42A 4X64K 2Z1HA 3QICA 1DLOA 3AO4A 1XUPO 4CGIA 3L3UA 1BG3A 4WFBL 1S3XA 3CPWM 1JLGA 5JVGL 3CM5A 5HRNA 3GG4A 1RDCA 3ENBA 2W40A 4NCBA 3M8QA 3IAYA 1UA1A 3S5TA 4C8LA 4KV8A 1GLJO 2NRTA 1VSKA 4O4GA 1LW2A 4CZKA 2V7YA 1ZBSA 3NH2A 3K9KA 4B3RK 2QXFA 4WQ4A 3QETA 1TK8A 3LAMA 1IG9A 4CBWA 3MWTA 4EFHA 4LFAK 1RBTA 3KKRA 3AA5X 5C2DA 3OTOK 3PX6A 3HK2A 3V9SA 3KWGA 4QS9A 4DR2K 4CEQA 1WAJA 3DXMB 4QCLA 2FBTA 4IOCL 3DYAA 1VK0A 3T1YK 3CERA 3VGMA 4OJRA 3L2QA 5EVZA 4E7IA 3KZBA 1VSDA 3MK6A 1RT3A 3SJHA 4K42A 2HHWA 4CZJA 4XH4A 5BRDA 4Y1CA 3VQ9A 4QOZB 3IMXA 3ZT3A 4FJXA 3H1VX 3DLKA 4B9LA 1IH7A 3C6AA 1RT4A 3PIPL 5JS2A 4RW4A 3DRSA 4JAXA 3OYJA 1TL3A 2OPRA 3T7ZA 5HBMA 2BTFA 4A5AA 4OPKA 4BE2A 3ULEA 4PL8A 4CJ3A 5ADXH 3VQEA 5CR4A 4I6MB 3WNEA 1YJWN 1FW6A 5M1NA 4BG9A 4UQGA 5J2MA 3RMAA 1RDBA 1UA0A 2DFEA 3O80A 3TTFA 3G4SN 4DLEA 1SZ2A 4LF6K 2HB5A 2VWKA 1BQMA 2E2NA 4IDKA 4CJEA 3HZ6A 1LAWA 1NK4A 1N5YA 2YJEA 4BRKA 5JMVA 2P9LB 1CZBA 4E7JA 4FJ7A 4B8AB 1REVA 3SUPA 4H0XB 4IZ9A 1ZBHA 4LF7K 4DSFA 2IAJA 2OPSA 3WXJA 2WBNA 2G8UA 1R59O 3QBXA 3EY1A 4DQSA 4OGCA 2KFNA 1J53A 4B1XB 3DI6A 4BR0A 2B4JA 3OS0A 3LDPA 4BC5A 4FLTA 5AQWA 2IVPA
chains in the Genus database with same CATH topology
3TTCA 5F2RA 1KXPA 2F9WA 3C7NA 3E9PA 5AZJA 5TKWA 4YDUA 2OTLN 4FWPA 5AQIA 5JICA 4H5NA 4AF1A 4CBUA 3DXMA 2QWLA 3P4IA 1LOTB 3WXLA 4YOXA 2NZTA 4JKCA 1DEJA 4FOIA 3UKUB 2JWLA 1M1KO 4MO4A 5FPMA 5TKYA 1NJIO 3EE9A 1GLBG 2AP1A 5FPNA 3EL2A 4A2BA 1V4TA 3EO3A 2P9NB 3VMFB 4RCHA 1G99A 3R9PA 3M6GA 3VEXA 3CJ7A 3D2EA 3K9JA 1VQMN 4I6MA 3HI0A 3CC2N 4B1VA 5GIPA 2FXUA 1Z6RA 2ASOA 4BRCA 1JCEA 4Y0WA 5AQOA 2CGLA 3CJ1A 1NGCA 1VQPN 4BR7A 4FVUA 4G9ZA 2WFBA 2UYTA 1QQNA 4B1WB 2QEXN 3QFUA 2E2PA 1HKBA 4BREA 1YHQN 5AQQA 1HUXA 1RFQA 1X3NA 5KPTA 5LJWA 3AAPA 2DPNA 3A5NC 3CHWA 1P8ZA 4NLBA 3CMEN 2HF4A 1Y64A 3A8YA 1MA9B 1BO5O 2ITMA 3DXKB 3R8EA 4Z94A 1DKGD 4MO5A 1ATSA 4JN4A 5AQKA 1RGIA 1DGKN 3VERA 4ISFA 1GLLO 1K8KB 4QS8A 3FGUA 4FWKA 2Q2RA 4H03B 1EQYA 4IWVA 1VQ5N 4A2AA 5C15A 3O9UA 1GLFO 1VQ8N 4IO9L 4NO7A 1VQKN 3SMSA 5M1KA 1TUYA 2ZGZA 3TTDA 3CF5L 1SQKA 2VCPA 1KAXA 4DQ8A 3AY9A 3BEXA 2ZWHA 3ATUA 1C0GA 3WEEB 5AQFA 1ILYA 5AQTA 3FZHA 2E1YA 3VF2A 5BPLA 1NM1A 3ID6A 3ID8A 4IJAA 4BRPA 2F9TA 2KKZA 3G6EN 3CQXA 3W3DA 5AQSA 2CH6A 3QBWA 3NVKA 3CCUN 5AQLA 1T6DA 3UKRA 4IO8A 4XH5A 4AM6A 5LY3A 1S22A 2E2OA 2BUPA 1HX1A 5AFUA 1YJ9N 3MCAB 2D1KA 2E8AA 2P9SB 3EE8A 3I8BA 4JKGA 3SMPA 3BF3A 2QWOA 4JEPA 4KH5A 4CD3A 3HTVA 4B1ZA 5FPDA 4OO1J 2FSJA 2J4RA 3MDQA 1K8AO 2HBMA 5LJVA 4BEBA 3LDQA 3QMLA 3CC7N 2QWMA 2Q0UA 4FSVA 2F7TA 2OANA 1T3VA 5GADP 3CJAA 1OVYA 3OA9A 3F5TA 3CCSN 3VF4A 3GL1A 5AQZA 5KQ8A 1K9MO 3ZX3A 3J8AA 4FPAA 3H3NO 3VEYA 3QB0A 4CD1A 4HWIA 3O1WA 2I7PA 3CCEN 4KBOA 3PLAA 5BN9A 3O9QA 1X3MA 3LL3A 5EXWA 1BU6O 4FWNA 5AFUH 3JXUA 4CZIA 1LCUA 3LDNA 3H46O 3IUCA 5GIOA 2JWKA 3CCQN 4FWLA 3R6MA 4L3QA 5AQUA 1HPMA 1T44A 3P31A 4ILJA 3SLCA 5GAEP 5M1OA 1YAGA 3E66A 3GDQA 3HRGA 3VGLA 5EY4A 5H1SQ 2P9LA 3VF6A 3BUZB 4JHDB 4C23A 5KPRA 5HOOA 5C0YA 1NGAA 3M5RA 1WOQA 3P38A 4FWSA 1GLEG 4BR9A 4BR5A 4EHTA 2P9UA 3H6EA 3VEWA 1JCFA 1T6CA 5AQJA 5AZIA 1Q86O 5I9EB 3ZX0A 4H0PA 1K8KA 3UB5A 3AGRA 4JHDA 4K43A 1XC3A 4M63C 1YF5L 1J6ZA 4JK9A 3ZX2A 3J7ZO 4M7XA 3ZEUB 3GBTA 3I56N 2HBKA 5AQRA 3BP8A 5GINA 4BY9C 4IEIA 3VPZA 4BRHA 1QVFM 2QI2A 5CHIA 2FSKA 2P9PA 2KLAA 4WFAL 4OPAA 3WQUA 4UY8O 4ILGB 2YHYA 2GELA 2HOEA 1Q81O 3EN9A 3PIOL 1QVGM 3RSEB 3CCLN 3DLLL 3LDOA 4IOAL 4GNIA 5M1PA 3H45C 1VQLN 2PBDA 2YJFA 2YX6A 2I7NA 3MN7A 4GVEA 1XQSC 4JD2A 2E88A 2YHWA 3SK3A 1NMDA 5M1QA 1NGGA 4R79A 3CMAN 4IFEA 4JD2B 3E9LA 3EKUA 4DCHA 2IIRA 3FZLA 3U9DA 2NNWA 4LC9B 4H5TA 5DM7L 2NLXA 3IDHA 1YI2N 1CZAN 3VEVA 1E4FT 1NLVA 3IKMA 1JCGA 4YOUA 5AQGA 4OPHA 4C1NK 1NGFA 3MWPA 4FPBA 1N8RO 4EAHD 4GV3A 3IFRA 5BRHA 4YOTA 1YXQA 3TSPA 4CZMA 4PKGA 5C2FA 3FFKB 5AQNA 2YHXA 3AAQA 3CXCM 2E2QA 1ATNA 3HBTA 3DAWA 1KC8O 3WT0A 4F9OA 1YIJN 4A57A 2QWQA 1V4SA 3L4IA 4BRIA 4ISGA 1JJ2M 2ZJRL 1RDWX 3MCPA 3CPEA 5AQXA 1BUPA 3EZWA 4O8KA 5F0XA 2H3GX 1C0FA 1QHAA 1MWMA 4FWMA 1TUUA 4WF9L 2OTJN 2A5XA 4XJXA 3FZMA 1U6ZA 3AGKA 2A42A 3L4QA 4PKIA 1NGEA 2NRRA 2P9IA 3OW2M 3S41A 4C1NI 2FF3B 3CCVN 4BRGA 5AQPA 3QDKA 2RE2A 4O5FA 2YCHA 4BGBA 1QZ5A 1YUWA 4H5RA 1VQ7N 2A40A 4BVOA 2QM1A 2NRHA 4ISEA 4JK7A 1NGDA 3CJBA 4JK8A 4DKWA 3HSCA 4QS7A 4JKHA 2A3ZA 3FZFA 1QQOA 4BRLA 4WQ4C 4CBXA 1D4XA 1BA0A 3R3LA 2Q31A 3VTIA 2KHOA 3LM2A 3KHYA 5AQHA 3M1FA 4HTLA 4YORA 4BR2A 2PFUA 5C10A 3I55N 1P90A 3DJCA 2GEMA 4BRFA 1ESVA 3O4WA 3WUHA 5BR9A 2CGKA 5CE3A 1HLUA 1NWKA 3GOIA 2A41A 4FWQA 4NLCA 4BRDA 3MX5A 3MX2A 3O9SA 3WXIA 4AM7A 3SAFA 3SBTA 1TYQA 3G25A 3HOSA 3F9MA 1MWKA 4JKBA 1S72N 3KVGA 3P39A 1HJOA 2P9KB 3B8AX 5EOYA 3CD6N 3ZEUA 4WCEL 1YVNA 1VQ4N 4JNEA 3OHRA 4H0YB 3O5BA 4H0OA 2C1GA 1DT9A 2ZJQL 5E84A 4RWTA 1Q7YO 3C0BA 2ZF5O 1BOTO 4JKAA 2W41A 1NBWA 4MDBA 2QA4N 3D7EO 2HSTA 2WUSA 1HKCA 5AZIB 5BREA 1H1VA 5BRFA 3SAHA 3CCJN 3A5LC 3N4QA 2FSNA 3O9TA 1KD1O 1SS6A 1IJJA 2FF6A 3E1YA 4IEEA 3O08A 4NB4A 5KQDA 3SAGA 1EO1A 3N4PA 4IJNA 4IDHA 4K25A 3VEZA 1K73O 2GX9A 4BRNA 3VTHA 3NMUA 3LM9A 3UE5A 5JLHA 5M1FA 5GAHP 2QTDA 4H5VA 2QWPA 3L6QA 3MMVA 5F1XA 2WC9A 4PL7A 4PKHA 4BE7B 3WQTA 2NRZA 4YOWA 4BC3A 5B8HA 2ASMA 4BECA 1IG8A 2IVNA 3ZETA 3M3ZA 1NGHA 4CZHA 1Q18A 4O8UA 2HF3A 5E26A 1OKJA 3WXMB 4CZLA 5HL7L 2D0PA 4YOVA 3OBYA 1YJNN 2P9IB 4JKDA 4CI6A 4BRQA 3C65A 3O6WA 3W0LA 3ULEB 3FLCO 3VETA 4EHUA 2P9SA 3QICA 3UKRB 4E1JA 3QFPA 4YOYA 3F2KA 3O1BA 4JKFA 3OBWA 4K41A 5DM6L 1XUPO 2GWJA 1W97L 1HKGA 4CZEA 1BG3A 4WFBL 1S3XA 2V7ZA 3CPWM 3JS6A 5JVGL 4KH6A 4BROA 4B1UB 1MDUB 1ZXOA 3CC4N 1GLCG 3GG4A 4CZFA 3ENOA 4XEIA 3ENBA 2D4WA 4BR4A 2W40A 5ADXA 5BPMA 2V51B 3MN6A 2FLOA 2P9UB 2Q97A 1GLJO 2NRTA 4BC4A 4U7BA 4JKGB 3T69A 4CJ7A 4BGAA 1VQNN 4CZKA 2E20A 2V7YA 4EIAA 2V52B 1ZBSA 4MLEA 3K9KA 2C1IA 5AQMA 2P9KA 4WQ4A 4GV9A 5ELZA 5AR0A 3TSQA 4WQ5C 3U4LA 4CBWA 3MWTA 2P9NA 2RHKA 4EFHA 1BA1A 3FR0A 1M90O 4H0VB 1KAYA 5C2DA 2Q36A 3R1XA 4PHTX 3L0QA 3BF1A 3KWGA 5EX5A 3VESA 3CQYA 4QS9A 4H0TB 2EWSA 3A5OC 3DXMB 5KPZA 1NGIA 3E9OA 4IOCL 1TYQB 1KQSM 3KK7A 2IVOA 1NGBA 5AQVA 3CERA 3VGMA 1RDUA 2VGMA 4BVPA 3ENHA 3CI5A 4KH4A 5GAGP 2CH5A 5EVZA 3HM8A 3LDLA 1QQMA 2QWRA 3A0IX 3KZBA 4ILHA 2VGNA 3MK6A 4FL9A 2W00A 3I33A 4CZGA 4DB3A 3SJHA 4K42A 5AZJB 3ZYYX 5BN8A 4CZJA 4XH4A 5BRDA 2GUPA 2QWNA 3C6HA 1KAZA 3CJ9A 4GV6A 3IMXA 3KWIA 4MLHA 3H1VX 3MN9A 4A62A 3H1QA 2ASPA 3GE1A 3D2FB 4MDAA 3C6AA 3PIPL 2YI1A 4JAXA 3CJCA 2ZGYA 3T7ZA 3C7NB 4WQ5A 3U8XA 2BTFA 3VGKA 4BG8A 4A5AA 3FZKA 3CCMN 3TSUA 2VYPA 4FWOA 3ULEA 4PL8A 1SAZA 5ADXH 2Q0RA 5CR4A 4I6MB 1X9JA 4FWRA 4A61A 1YJWN 3O8MA 4BG9A 5M1NA 5MLCQ 3CETA 3D6RA 4A59A 2NRXA 2CGJA 1U2VB 4J8FA 3TU5A 5JLFA 3TPQA 1NGJA 4H5WA 4IXCA 1WUAA 3G71N 2HBLA 3DWLA 5FPEA 3MN5A 2HMPA 4U67L 3O80A 4M7YA 4BRMA 3TTFA 3G4SN 3ZETB 4FOEA 3RSEA 1SZ2A 2AA4A 3VENA 3RVCA 3WXKA 2P9PB 3AARA 3EKSA 4BQLA 3CCRN 3FE1A 4BQZA 3H3OB 2E2NA 2ZJPL 1VQ9N 3HZ6A 1ATRA 1BDGA 4JKEA 5BPNA 2GTDA 3HOTA 2QXLA 3D2EB 4GY2B 1GLAG 1ZC6A 2VWBA 4FO0A 4RTFD 4B1YB 2YJEA 5C12A 4BRKA 5JMVA 1O13A 1W2BM 2E1ZA 2BH1A 3ATVA 2P9LB 4YDUC 3NVMA 4IOXA 1Q82O 3WEEA 4A5BA 1U2VA 2Q1NA 4H0XB 1BWFO 4IZ9A 3VEOA 1Z05A 4DHYA 1VQON 3SBGA 5JVHL 2D0OA 1VQ6N 1VAZA 3O9RA 1E4GT 1QZ6A 2PAVA 3CIPA 2WBNA 3UKUA 3Q7CA 3WXJA 2GWKA 4WFNL 2HBJA 1R59O 3QBXA 4WYBA 3Q7BA 4XH1A 4BC2A 4BRAA 1GLDG 2NRVA 1YITN 2QW9A 3VOVA 2A6AA 3A5MC 4B1XB 3DXKA 4BR0A 3D2FA 5AQYA 4B9QA 3LDPA 4BC5A 2NRWA 3U9ZA 5AQWA 2IVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F2R A;  1KXP A;  2F9W A;  3C7N A;  5AZJ A;  4YDU A;  4FWP A;  5AQI A;  5JIC A;  4H5N A;  4CBU A;  3DXM A;  2QWL A;  3P4I A;  1LOT B;  3WXL A;  2NZT A;  1DEJ A;  4FOI A;  3UKU B;  4MO4 A;  5FPM A;  5TKY A;  5FPN A;  1GLB G;  2AP1 A;  3EL2 A;  4A2B A;  1V4T A;  3EO3 A;  2P9N B;  4RCH A;  1G99 A;  3R9P A;  3M6G A;  3VEX A;  3CJ7 A;  3D2E A;  4I6M A;  3HI0 A;  4B1V A;  2FXU A;  1Z6R A;  2ASO A;  4BRC A;  1JCE A;  4Y0W A;  5AQO A;  2CGL A;  3CJ1 A;  1NGC A;  4BR7 A;  2UYT A;  1QQN A;  4B1W B;  3QFU A;  2E2P A;  1HKB A;  4BRE A;  5AQQ A;  1HUX A;  1RFQ A;  1X3N A;  5KPT A;  5LJW A;  3AAP A;  2DPN A;  3A5N C;  3CHW A;  1P8Z A;  2HF4 A;  1Y64 A;  3A8Y A;  1MA9 B;  1BO5 O;  2ITM A;  3DXK B;  3R8E A;  4Z94 A;  1DKG D;  4MO5 A;  1ATS A;  4JN4 A;  5AQK A;  1RGI A;  1DGK N;  3VER A;  4ISF A;  1GLL O;  1K8K B;  4QS8 A;  3FGU A;  4FWK A;  2Q2R A;  4H03 B;  1EQY A;  4IWV A;  4A2A A;  1GLF O;  4NO7 A;  3SMS A;  1TUY A;  2ZGZ A;  1SQK A;  2VCP A;  1KAX A;  4DQ8 A;  3AY9 A;  3BEX A;  2ZWH A;  3ATU A;  1C0G A;  3WEE B;  5AQF A;  5AQT A;  3FZH A;  2E1Y A;  3VF2 A;  5BPL A;  1NM1 A;  3ID8 A;  4IJA A;  4BRP A;  2F9T A;  3CQX A;  3W3D A;  5AQS A;  2CH6 A;  3QBW A;  5AQL A;  1T6D A;  3UKR A;  4IO8 A;  4XH5 A;  4AM6 A;  5LY3 A;  1S22 A;  2E2O A;  2BUP A;  1HX1 A;  5AFU A;  3SMP A;  2D1K A;  2E8A A;  2P9S B;  3I8B A;  3BF3 A;  2QWO A;  4CD3 A;  3HTV A;  4B1Z A;  5FPD A;  2FSJ A;  2J4R A;  3MDQ A;  5LJV A;  3LDQ A;  3QML A;  2QWM A;  2Q0U A;  4FSV A;  2OAN A;  3CJA A;  3VF4 A;  3GL1 A;  5AQZ A;  5KQ8 A;  3ZX3 A;  3J8A A;  4FPA A;  3H3N O;  3VEY A;  3QB0 A;  4CD1 A;  4HWI A;  3O1W A;  2I7P A;  4KBO A;  5BN9 A;  1X3M A;  3LL3 A;  5EXW A;  1BU6 O;  4FWN A;  5AFU H;  3JXU A;  4CZI A;  1LCU A;  3LDN A;  3H46 O;  3IUC A;  4FWL A;  3R6M A;  4L3Q A;  5AQU A;  1HPM A;  1T44 A;  3SLC A;  1YAG A;  3GDQ A;  3VGL A;  5EY4 A;  2P9L A;  3VF6 A;  3BUZ B;  4JHD B;  4C23 A;  5KPR A;  1NGA A;  1WOQ A;  4FWS A;  1GLE G;  4BR9 A;  4BR5 A;  4EHT A;  2P9U A;  3H6E A;  3VEW A;  1JCF A;  1T6C A;  5AQJ A;  5AZI A;  5I9E B;  3ZX0 A;  4H0P A;  1K8K A;  3UB5 A;  4JHD A;  4K43 A;  1XC3 A;  4M63 C;  1J6Z A;  3ZX2 A;  4M7X A;  3ZEU B;  3GBT A;  5AQR A;  3BP8 A;  3VPZ A;  4BRH A;  2FSK A;  2P9P A;  3WQU A;  2YHY A;  2GEL A;  2HOE A;  3EN9 A;  3RSE B;  3LDO A;  4GNI A;  3H45 C;  2PBD A;  2YJF A;  2I7N A;  3MN7 A;  1XQS C;  4JD2 A;  2E88 A;  2YHW A;  3SK3 A;  1NMD A;  1NGG A;  4JD2 B;  3EKU A;  4DCH A;  2IIR A;  3FZL A;  3U9D A;  4LC9 B;  4H5T A;  2NLX A;  3IDH A;  1CZA N;  3VEV A;  1E4F T;  1NLV A;  5AQG A;  1JCG A;  1NGF A;  4FPB A;  4EAH D;  3IFR A;  5BRH A;  1YXQ A;  4CZM A;  4PKG A;  3FFK B;  5AQN A;  2YHX A;  3AAQ A;  2E2Q A;  1ATN A;  3HBT A;  3DAW A;  3WT0 A;  4F9O A;  2QWQ A;  1V4S A;  3L4I A;  4BRI A;  4ISG A;  1RDW X;  3MCP A;  5AQX A;  1BUP A;  3EZW A;  4O8K A;  5F0X A;  2H3G X;  1C0F A;  1QHA A;  1MWM A;  4FWM A;  1TUU A;  2A5X A;  3FZM A;  1U6Z A;  2A42 A;  4PKI A;  1NGE A;  2P9I A;  3S41 A;  2FF3 B;  4BRG A;  5AQP A;  3QDK A;  4O5F A;  4BGB A;  2YCH A;  1QZ5 A;  1YUW A;  4H5R A;  2A40 A;  4BVO A;  2QM1 A;  2NRH A;  4ISE A;  1NGD A;  3CJB A;  3HSC A;  4QS7 A;  2A3Z A;  3FZF A;  1QQO A;  4BRL A;  4WQ4 C;  4CBX A;  1D4X A;  1BA0 A;  2Q31 A;  2KHO A;  3LM2 A;  3KHY A;  5AQH A;  3M1F A;  4HTL A;  4BR2 A;  3DJC A;  2GEM A;  4BRF A;  1ESV A;  3O4W A;  3WUH A;  5BR9 A;  2CGK A;  5CE3 A;  1HLU A;  1NWK A;  3GOI A;  2A41 A;  4FWQ A;  4BRD A;  3WXI A;  4AM7 A;  1TYQ A;  3G25 A;  3F9M A;  1MWK A;  3KVG A;  1HJO A;  2P9K B;  3B8A X;  5EOY A;  3ZEU A;  1YVN A;  4JNE A;  3OHR A;  4H0Y B;  3O5B A;  4H0O A;  5E84 A;  4RWT A;  3C0B A;  2ZF5 O;  1BOT O;  2W41 A;  1NBW A;  3D7E O;  5BRF A;  2WUS A;  1HKC A;  5AZI B;  5BRE A;  1H1V A;  3A5L C;  2FSN A;  1IJJ A;  2FF6 A;  3O08 A;  4NB4 A;  5KQD A;  4IJN A;  4K25 A;  3VEZ A;  4BRN A;  3LM9 A;  3UE5 A;  5JLH A;  4H5V A;  5F1X A;  2QWP A;  3L6Q A;  3MMV A;  4PL7 A;  4PKH A;  3WQT A;  4BC3 A;  5B8H A;  2ASM A;  1IG8 A;  2IVN A;  3ZET A;  3M3Z A;  1NGH A;  4CZH A;  1Q18 A;  2HF3 A;  5E26 A;  1OKJ A;  4CZL A;  2D0P A;  2P9I B;  4CI6 A;  4BRQ A;  3O6W A;  3W0L A;  3ULE B;  3FLC O;  3VET A;  4EHU A;  2P9S A;  3QIC A;  3UKR B;  4E1J A;  3QFP A;  3O1B A;  4K41 A;  1XUP O;  2GWJ A;  1HKG A;  4CZE A;  1BG3 A;  1S3X A;  2V7Z A;  3JS6 A;  4BRO A;  4B1U B;  1MDU B;  1ZXO A;  1GLC G;  3GG4 A;  4CZF A;  3ENO A;  4XEI A;  2D4W A;  4BR4 A;  2W40 A;  5ADX A;  5BPM A;  2V51 B;  3MN6 A;  2FLO A;  2P9U B;  2Q97 A;  1GLJ O;  4BC4 A;  4CJ7 A;  4BGA A;  4CZK A;  2E20 A;  2V7Y A;  4EIA A;  2V52 B;  1ZBS A;  4MLE A;  5AQM A;  2P9K A;  4WQ4 A;  5ELZ A;  5AR0 A;  4WQ5 C;  3U4L A;  4CBW A;  2P9N A;  4EFH A;  1BA1 A;  3FR0 A;  4H0V B;  1KAY A;  2Q36 A;  3L0Q A;  3BF1 A;  5EX5 A;  3VES A;  3CQY A;  4QS9 A;  4H0T B;  2EWS A;  3A5O C;  3DXM B;  5KPZ A;  1NGI A;  1TYQ B;  2IVO A;  1NGB A;  5AQV A;  3CER A;  3VGM A;  4BVP A;  3ENH A;  3CI5 A;  2CH5 A;  5EVZ A;  3HM8 A;  3LDL A;  1QQM A;  2QWR A;  3A0I X;  3KZB A;  3MK6 A;  4FL9 A;  3I33 A;  4CZG A;  4DB3 A;  3SJH A;  4K42 A;  5AZJ B;  5BN8 A;  4CZJ A;  4XH4 A;  5BRD A;  2GUP A;  2QWN A;  3CJ9 A;  1KAZ A;  3IMX A;  4MLH A;  3H1V X;  3MN9 A;  4A62 A;  3H1Q A;  2ASP A;  3GE1 A;  3D2F B;  2YI1 A;  4JAX A;  3CJC A;  2ZGY A;  3C7N B;  4WQ5 A;  3U8X A;  2BTF A;  3VGK A;  4BG8 A;  3FZK A;  2VYP A;  4FWO A;  3ULE A;  4PL8 A;  1SAZ A;  5ADX H;  2Q0R A;  4I6M B;  1X9J A;  4FWR A;  4A61 A;  3O8M A;  4BG9 A;  3CET A;  3TU5 A;  2CGJ A;  1U2V B;  4J8F A;  5JLF A;  3TPQ A;  1NGJ A;  4H5W A;  4IXC A;  1WUA A;  3DWL A;  5FPE A;  3MN5 A;  2HMP A;  3O80 A;  4M7Y A;  4BRM A;  3ZET B;  4FOE A;  3RSE A;  1SZ2 A;  2AA4 A;  3VEN A;  3WXK A;  2P9P B;  3AAR A;  3EKS A;  4BQL A;  3FE1 A;  4BQZ A;  3H3O B;  2E2N A;  3HZ6 A;  1ATR A;  1BDG A;  5BPN A;  2GTD A;  2QXL A;  3D2E B;  4GY2 B;  1GLA G;  1ZC6 A;  2VWB A;  4FO0 A;  4RTF D;  4B1Y B;  2YJE A;  4BRK A;  5JMV A;  2E1Z A;  3ATV A;  4YDU C;  2P9L B;  3WEE A;  1U2V A;  2Q1N A;  4H0X B;  1BWF O;  4IZ9 A;  3VEO A;  1Z05 A;  4DHY A;  2D0O A;  1E4G T;  1QZ6 A;  2PAV A;  3CIP A;  3UKU A;  3WXJ A;  2GWK A;  1R59 O;  3QBX A;  4WYB A;  4XH1 A;  4BC2 A;  4BRA A;  1GLD G;  2QW9 A;  3VOV A;  2A6A A;  3A5M C;  4B1X B;  3DXK A;  4BR0 A;  3D2F A;  5AQY A;  4B9Q A;  3LDP A;  4BC5 A;  3U9Z A;  5AQW A;  2IVP A; 
#chains in the Genus database with same CATH topology
 3TTC A;  5F2R A;  3C7N A;  5AZJ A;  1QHT A;  5TKW A;  3K5M A;  2OTL N;  4Z4C A;  1T05 A;  4F8R A;  4CBU A;  3QO9 A;  4LFC K;  3CG7 A;  1N33 K;  3CFP A;  4DR1 K;  1TKT A;  3TAQ A;  3UKU B;  4KHW A;  1V4T A;  3TAF A;  2HNY A;  3TI0 A;  2ZM6 K;  2P9N B;  3VMF B;  1S6Q A;  4RCH A;  3T3F A;  3SPY A;  3DRR A;  1XHX A;  1VQM N;  1QSY A;  4B1V A;  5GIP A;  4ELU A;  1Y97 A;  4Y0W A;  1NGC A;  3SV3 A;  4M3W A;  4HCB A;  1YHQ N;  5KPT A;  5LJW A;  3AAP A;  1CLQ A;  2IC3 A;  1P8Z A;  3CME N;  2HF4 A;  1Y64 A;  1MA9 B;  2I5J A;  1BO5 O;  4FLY A;  1R0A A;  1ATS A;  1NJW A;  1NOY A;  1DGK N;  4ISF A;  4ICL A;  3KK2 A;  1EQY A;  4F4K A;  1ZYQ A;  1X9M A;  1VQ8 N;  3SCX A;  3BZK A;  3HYF A;  4NO7 A;  4C8N A;  3SMS A;  3WNH A;  1VQK N;  5J2N A;  2HHV A;  2VCP A;  1KAX A;  3AY9 A;  3BEX A;  1C0G A;  1LW0 A;  3NHG A;  5AQT A;  3FZH A;  3ID8 A;  1JXB A;  1WLJ A;  2F9T A;  3G6E N;  4CF0 A;  5AQS A;  4FJM A;  2CH6 A;  4FZZ A;  4CJP A;  2GUI A;  1SL0 A;  3EE8 A;  3NF6 A;  3NGI A;  2QWO A;  4AH9 A;  3PX0 A;  3AA2 A;  3CQ8 A;  4BEB A;  3LDQ A;  5GAD P;  2OAN A;  1OVY A;  3OA9 A;  2W42 A;  1VSE A;  2A1S A;  5KQ8 A;  1K9M O;  3ZX3 A;  3VEY A;  3THW B;  3VQ5 A;  4GW6 A;  1YTA A;  3CCE N;  3PLA A;  3IRX A;  3LL3 A;  3THW A;  1NJX A;  2PYL A;  4PY5 A;  3H46 O;  2JWK A;  4AHR A;  1EWQ A;  4EP4 A;  3H08 A;  5IT9 O;  1HPM A;  5M1O A;  1YAG A;  3NH0 A;  3BUZ B;  1RIL A;  4JHD B;  4C23 A;  5C0Y A;  4DUZ K;  3H6E A;  1JXE A;  4DTP A;  5AQJ A;  4DF8 A;  1Q86 O;  3VQ6 A;  3THY A;  1D9D A;  3ZX0 A;  4H0P A;  4DSE A;  3NF8 A;  4LY7 A;  4JK9 A;  3ZEU B;  1D9F A;  5AJ3 K;  4I2Q A;  3AVJ A;  4BY9 C;  1C6V A;  4IEI A;  2QI2 A;  2HVI A;  4WFA L;  4E89 A;  2YV0 X;  4UY8 O;  1NU0 A;  4JV5 K;  4CHP A;  3PIO L;  5HRO A;  4FLX A;  4IOA L;  4CEF A;  3H45 C;  3NDK A;  1TKD A;  3ISN C;  2YHW A;  3S3O A;  1NMD A;  4B9V A;  4IFE A;  4DCH A;  2IIR A;  3FZL A;  3U9D A;  2O8E B;  3L2W A;  4DLG A;  1D5A A;  4H5T A;  5AQG A;  2O8E A;  4FPB A;  2O4I A;  1N8R O;  2O8B A;  5BRH A;  4DG1 A;  1BHL A;  1LAV A;  3TSP A;  4JI8 K;  4OX9 K;  2B5J A;  3KLH A;  1ZBL A;  3FFK B;  2YHX A;  4DUY K;  3CXC M;  3RMD A;  4LSN A;  4OKE A;  4F9O A;  2QWQ A;  5CZ2 A;  4BRI A;  1JJ2 M;  4ISG A;  2ZJR L;  1OVQ A;  5CZ1 A;  3EZW A;  2KZZ A;  2VQE K;  1C0F A;  1QHA A;  4DSK A;  4WF9 L;  4KB1 A;  3D0P A;  3LAK A;  1U6Z A;  3AVN A;  3AGK A;  1X1P A;  3RTV A;  3NE6 A;  1NGE A;  2P9I A;  4C1N I;  2FF3 B;  1VSF A;  4BRG A;  4FLU A;  3QDK A;  3L2V A;  1U48 A;  1QZ5 A;  1DTT A;  4OVL A;  4O5B A;  4DFK A;  1VQ7 N;  2A40 A;  2NRH A;  1RBR A;  4LH4 A;  1NGD A;  3QNO A;  3CJB A;  4DKW A;  4QS7 A;  4CFB A;  2A3Z A;  1W9H A;  3PY8 A;  1QQO A;  1NK0 A;  4WQ4 C;  3ZT4 A;  3R3L A;  4K8Z A;  3VTI A;  3KHY A;  4YOR A;  4BR2 A;  2HMI A;  4DTR A;  3QIP A;  4BRF A;  3WUH A;  4B08 A;  4DU3 A;  4BRD A;  1TAQ A;  3MX2 A;  3NBP A;  3VQC A;  2HHX A;  3WNF A;  1BI4 A;  4JLH A;  3CFR A;  2VG7 A;  1HJO A;  4YFU A;  4HTU A;  2P9K B;  4JI5 K;  3ZEU A;  4H0Y B;  2E6M A;  1KTQ A;  2ZF5 O;  4CFC A;  1RT2 A;  1RTI A;  3HL8 A;  4M3Y A;  2HST A;  2OPP A;  4CGJ A;  1KD1 O;  1IJJ A;  1IKY A;  1EO1 A;  4JI1 K;  4K25 A;  4Q5V A;  3VEZ A;  2GX9 A;  3KD5 E;  1RT7 A;  3UE5 A;  5JLH A;  5M1F A;  3THX A;  2QWP A;  3MMV A;  2WC9 A;  3WQT A;  4BC3 A;  5J1E A;  3C95 A;  4DR5 K;  2P51 A;  4N56 A;  1Q18 A;  4O8U A;  4N47 A;  1WNS A;  4CZL A;  5HL7 L;  4YOV A;  3OBY A;  1FJG K;  2UUB K;  1YJN N;  4CI6 A;  1EET A;  3KIO A;  1C0T A;  3J7A P;  3O6W A;  4FJ9 A;  3VET A;  2HVH A;  4E1J A;  3QFP A;  3O1B A;  4K41 A;  1RCH A;  2D0A A;  1QE1 A;  1X9S A;  4CF8 A;  1S1W A;  1WN7 A;  3SPZ A;  3QIO A;  4CHN A;  4KH6 A;  1MDU B;  1ZXO A;  3CC4 N;  1NK9 A;  3OVN A;  2YNF A;  4KTQ A;  4XEI A;  3KTQ A;  2D4W A;  4YHH K;  3AVI A;  5ADX A;  1IBK K;  2V51 B;  2FLO A;  2P9U B;  1EKE A;  2G8W A;  3ZT1 A;  4FW2 A;  4AQY K;  4JKG B;  3JYT A;  3K5N A;  2GV9 A;  2V52 B;  4N5S A;  2C1I A;  4MLE A;  1EP4 A;  4GV9 A;  1SKS A;  5AR0 A;  5KRS A;  2XHB A;  4WQ5 C;  4CJ5 A;  2P9N A;  4XIU A;  4DTO A;  3ZSY A;  1M90 O;  4DV4 K;  1KAY A;  5I3U A;  2Q36 A;  4CFA A;  4PHT X;  3E01 A;  3L0Q A;  3VES A;  4H0T B;  3A5O C;  5KPZ A;  1NGI A;  3E9O A;  4DV3 K;  3KK7 A;  3OYD A;  1NGB A;  3NF7 A;  5C25 A;  2G8I A;  3LPU A;  1SL1 A;  3DLH A;  1RDU A;  1RT6 A;  2VGM A;  4BVP A;  3HM8 A;  3LDL A;  1QQM A;  2VGN A;  3I33 A;  4CZG A;  3DLR A;  3JSM A;  4V19 S;  3ZYY X;  4KKO A;  4FM0 A;  2FC0 A;  3CJ9 A;  1KAZ A;  2QKK A;  2HHQ A;  4I7F A;  3C6U A;  3OYM A;  1NK8 A;  4O44 A;  4A62 A;  1O1W A;  4DU1 A;  2YI1 A;  3CJC A;  2HHS A;  3OS2 A;  2XY5 A;  3C7N B;  4Z4F A;  4DR4 K;  3VGK A;  3FZK A;  3TSU A;  1HYV A;  4FWR A;  1QTM A;  3L2U A;  3D6R A;  4A59 A;  1WSI A;  2CGJ A;  4J8F A;  3TPQ A;  1HNV A;  2YKM A;  3MN5 A;  5FRO A;  3ZT0 A;  4FK4 A;  3LZJ A;  2UXD K;  1IBL K;  3ZET B;  3QIN A;  4FOE A;  3RVC A;  3AAR A;  3EKS A;  4BQL A;  4E7L A;  3OYI A;  1TV6 A;  3H3O B;  2ZJP L;  1KRP A;  3HPH A;  3ZSO A;  1C0U A;  1QS4 A;  2GTD A;  1D8Y A;  3D2E B;  2HHH K;  4W5N A;  1ZC6 A;  2VWB A;  1TK0 A;  5C12 A;  2Z1I A;  4CER A;  3NVM A;  1Q82 O;  3WEE A;  1U2V A;  3SBG A;  4KI6 A;  1TK5 A;  1VAZ A;  4PUO A;  1E4G T;  2DTU A;  3CIP A;  1TVR A;  2UXC K;  4WFN L;  2GWK A;  1K6Y A;  2HBJ A;  1QSS A;  4XH1 A;  4BC2 A;  2RPI A;  3VOV A;  4JS5 A;  3M8R A;  3LAN A;  2Y1I A;  3DXK A;  3D2F A;  4B9Q A;  1L3S A;  4NXM K;  3VQ4 A;  4CJW A;  2F9W A;  3AVB A;  3MAQ A;  4YDU A;  2R7Y A;  4CEO A;  4AF1 A;  1JL1 A;  3KLI A;  3DXM A;  1F21 A;  2HHT A;  2XY6 A;  3THY B;  1GLB G;  3EL2 A;  4A2B A;  3EO3 A;  4LH5 A;  3MXJ A;  1LV5 A;  3LAL A;  3K9J A;  5HP1 A;  4I6M A;  4CEZ A;  3RRG A;  2CGL A;  2UYT A;  4B1W B;  2QEX N;  2E2P A;  3SYZ A;  4HVJ A;  1HKB A;  1U49 A;  3L2R A;  3LP0 A;  4Z94 A;  3DXK B;  4AIL C;  4MO5 A;  5AQK A;  1VSM A;  1EXQ A;  1GLL O;  1K8K B;  3I0S A;  3V6D A;  4FWK A;  2Q2R A;  3VA0 A;  1VQ5 N;  4A2A A;  3ZLJ A;  3O9U A;  3BGR A;  1GLF O;  3QEP A;  1XC9 A;  3OJU A;  4FJN A;  4CF2 A;  3TTD A;  1SQK A;  1XNQ K;  2ZWH A;  3ATU A;  1ILY A;  2E1Y A;  3DOK A;  4G1Q A;  4BRP A;  3W3D A;  4C8K A;  3QBW A;  3NVK A;  3CCU N;  4AM6 A;  2E2O A;  1WBD A;  1YJ9 N;  3SMP A;  2D1K A;  2E8A A;  1BGX T;  4KH5 A;  4B1Z A;  2AJQ A;  4JI0 K;  2J4R A;  3O4Q A;  4RW6 A;  4YNQ A;  4GKJ K;  2OYQ A;  3MDQ A;  4M45 A;  2ETJ A;  3O3G A;  5T7B A;  3CC7 N;  2Q0U A;  3AVL A;  2F7T A;  1N34 K;  1T3V A;  3CJA A;  1UAX A;  3CCS N;  3GL1 A;  1CZ9 A;  3KKS A;  3PSF A;  4FPA A;  4CJF A;  1XHZ A;  4JRQ A;  2G8H A;  4OGE A;  1J5O A;  1KLM A;  5EXW A;  1Z25 A;  3JXU A;  2E5L K;  1LCU A;  1YVU A;  3LDN A;  5GIO A;  3PUF A;  4Z4E A;  4F2S A;  4FWL A;  3ZCM A;  4IFY A;  5AQU A;  3P31 A;  3SLC A;  4CGF A;  5GAE P;  5FRN A;  3GDQ A;  3HRG A;  4KRE A;  2OZS A;  4H4O A;  4DSL A;  1NGA A;  3M5R A;  1WOQ A;  1GLE G;  4BR5 A;  3U6F A;  4KFB A;  4FVM A;  2P9U A;  3VEW A;  3ZSQ A;  3AO5 A;  4CE9 A;  3T1A A;  1OH7 A;  1JLF A;  4W5T A;  1C1A A;  2VG5 A;  2EX3 A;  4K43 A;  1J6Z A;  3GBT A;  3OY9 A;  2HBK A;  1BIU A;  3VPZ A;  1BCO A;  4DF4 A;  3OYH A;  4CIE A;  2P9P A;  2KLA A;  2WTU A;  2YNI A;  4OPA A;  3LZI A;  5DMR A;  2GEL A;  2HOE A;  3LDO A;  3PV8 A;  3ZSZ A;  4FM2 A;  2YJF A;  2YX6 A;  2I7N A;  4GVE A;  4ID1 A;  4CVN E;  3TAP A;  1NKC A;  3ZT2 A;  3TAG A;  2O8D B;  2Z1J A;  3P5J A;  5M1Q A;  3HP6 A;  1NGG A;  3D45 A;  4BE1 A;  1Q9X A;  2D0B A;  4LC9 B;  5DM7 L;  4E3S A;  4BE0 A;  2FBV A;  2NLX A;  3IDH A;  3HPG A;  2IGI A;  1JCG A;  3NF9 A;  3HXM A;  3B6O A;  4CW7 B;  4C1N K;  1NGF A;  1KFS A;  2HND A;  1XWL A;  4B3O A;  4CZM A;  5AQN A;  3HP9 A;  5FDL A;  4Q0B A;  2E2Q A;  1ATN A;  3DAW A;  1J54 A;  1V4S A;  3L4I A;  4KTW A;  3HM9 A;  1KVB A;  3KLE A;  2H3G X;  3IG1 A;  2OTJ N;  2UXB K;  4XJX A;  2W6L A;  4JRP A;  1C0M A;  3FZM A;  1WSE A;  3OW2 M;  1HQE A;  2KZM A;  3CCV N;  1B92 A;  5AQP A;  2QKB A;  2RE2 A;  4B9M A;  4DTJ A;  4BVO A;  2P5G A;  4ISE A;  4JK7 A;  4DTX A;  4W5Q A;  1NK6 A;  4BAC A;  4DTM A;  2G8K A;  3FZF A;  4F2R A;  2Q31 A;  4MFB A;  3K59 A;  3CM6 A;  3LWL A;  4HTL A;  4FW1 A;  4IKF A;  2GEM A;  4E0D A;  2CGK A;  4FWQ A;  3NCI A;  3GOI A;  2A41 A;  4DR3 K;  4KAZ A;  3O9S A;  3WXI A;  3SAF A;  1TYQ A;  4HUG A;  3ZSV A;  4DV1 K;  3DMJ A;  5EOY A;  3K5L A;  4WCE L;  5LMU K;  3KD1 E;  3OYF A;  1VQ4 N;  4NCG A;  1HYS A;  1BL3 A;  1WSJ A;  3OHR A;  4IG0 A;  3AVC A;  3O5B A;  4IG3 A;  5KGX A;  4JKA A;  4MDB A;  4JI7 K;  5BRF A;  2WUS A;  5AZI B;  1L3T A;  1H1V A;  3KLG A;  1GOB A;  3OS1 A;  3N4Q A;  5HRS A;  3THX B;  2FF6 A;  3E1Y A;  3SAG A;  4IJN A;  3C94 A;  1S6P A;  3P1G A;  1K73 O;  3NMU A;  3LM9 A;  2UUC K;  4BWM A;  4FJI A;  4DWI A;  4BE7 B;  3AV9 A;  2NRZ A;  4WE1 A;  1NMN A;  2IVN A;  1GOA A;  4B3T K;  4OLA A;  3ZET A;  3M3Z A;  2Y1J A;  4CZH A;  1YT3 A;  2YHA A;  2HF3 A;  3TR8 A;  3PO4 A;  5E26 A;  3L8B A;  4LF9 K;  4Z4H A;  3BY5 A;  1RDD A;  4Y1D A;  3V9X A;  3SZ2 A;  1XI1 A;  3QEW A;  4EHU A;  4YOY A;  4CJR A;  3F2K A;  3F73 A;  4DSJ A;  3OBW A;  5DM6 L;  2VWJ A;  1W97 L;  5LL6 Z;  1HKG A;  4CZE A;  4BRO A;  4B1U B;  3MXI A;  1BCM A;  1I3A A;  2WOM A;  3SI6 A;  1GLC G;  5J2P A;  3ENO A;  2X74 A;  1T03 A;  4DS5 A;  1CXQ A;  4DTS A;  1NJY A;  5JEN A;  2O8C B;  3MED A;  4BC4 A;  4U7B A;  2P5O A;  3T69 A;  2E20 A;  5AQM A;  4AHC A;  1S1T A;  5ELZ A;  3V1Q A;  3TSQ A;  4CJQ A;  3HPO A;  1I39 A;  2LSN A;  4DQR A;  1BA1 A;  4H0V B;  2ATQ A;  1ASV A;  1OH6 A;  3R1X A;  4JI3 K;  3BF1 A;  5EX5 A;  4C8M A;  4J2E A;  1IKX A;  4FXD A;  1TYQ B;  1KQS M;  1HPZ A;  1EX4 A;  2IVO A;  5AQV A;  1WSH A;  2YNG A;  3CI5 A;  3NFA A;  4KH4 A;  5GAG P;  3A0I X;  2OPQ A;  4ILH A;  1SL2 A;  2PYJ A;  3VQA A;  4FJH A;  5SZT A;  5CY4 A;  5AZJ B;  2GUP A;  4LD0 A;  3C6H A;  3KWI A;  3V9W A;  1FK9 A;  3MN9 A;  2ASP A;  3GE1 A;  2ZGY A;  2O8F B;  3EYZ A;  3CFO A;  2FBX A;  2F8T A;  4M3T A;  3OYE A;  3CCM N;  4CJT A;  2VYP A;  4FLV A;  1SAZ A;  2Q0R A;  2A1R A;  1X9J A;  4A61 A;  3O8M A;  5MLC Q;  4AHS A;  3CET A;  1FXX A;  4KI4 A;  4AHT A;  3G71 N;  1ITG A;  2HMP A;  4M7Y A;  5KI6 A;  3RSE A;  4B9S A;  2AA4 A;  3VEN A;  3F9K A;  3K5O A;  4FJJ A;  2P9P B;  3FE1 A;  4BQZ A;  3ZSW A;  5J2Q A;  1BIZ A;  1VQ9 N;  4FK0 A;  1ATR A;  1BDG A;  1XNR K;  4JKE A;  4GY2 B;  1W2B M;  2IOC A;  3IS9 A;  1WB9 A;  2E1Z A;  4YDU C;  4FJK A;  4IOX A;  4DV5 K;  4A5B A;  4CEE A;  3DLE A;  3VEO A;  1RT5 A;  4DHY A;  1VQO N;  2HHU A;  1U04 A;  1L5U A;  1VQ6 N;  1N6Q A;  4O55 A;  4M3U A;  1QZ6 A;  4DV6 K;  3UKU A;  3Q7C A;  3Q7B A;  4BRA A;  3AO3 A;  1YIT N;  1S1V A;  2QW9 A;  2A6A A;  3A5M C;  3PSI A;  4CIG A;  3U9Z A;  4NYN A;  2B6A A;  2GWJ A;  3O3F A;  1KXP A;  2ZE2 A;  3TAE A;  3ZSX A;  4FWP A;  5AQI A;  4H5N A;  4GVM A;  3DM2 A;  1LOT B;  3WXL A;  4YOX A;  4KHU A;  3SUO A;  4X62 K;  3DRP A;  1WSF A;  4JKC A;  3ULD A;  1DEJ A;  4FOI A;  4AHV A;  5CYM A;  3EE9 A;  2AP1 A;  3OYK A;  4CHQ A;  3R9P A;  3M6G A;  3VEX A;  3CJ7 A;  3D2E A;  3U3Y A;  3MXM A;  3HI0 A;  2FXU A;  1S1X A;  1A5V A;  4I9Q A;  2ASO A;  4KHQ A;  3G10 A;  3CJ1 A;  4FJ8 A;  4BR7 A;  1B9F A;  4FVU A;  3V1R A;  1QQN A;  3QFU A;  1I94 K;  3KLF A;  5AQQ A;  1HUX A;  1RFQ A;  1X3N A;  2BE2 A;  1X9W A;  3U3G A;  3A5N C;  3CHW A;  3A8Y A;  3S9H A;  5HRR A;  2ITM A;  3K57 A;  1DKG D;  4JN4 A;  4ZTF A;  3VQB A;  1RGI A;  3TWH A;  4KHS A;  4QS8 A;  4H03 B;  3TAN A;  4ELV A;  5C15 A;  4IO9 L;  1A5X A;  5M1K A;  3VQQ A;  1TUY A;  2ZGZ A;  3CF5 L;  4B9N A;  1WSG A;  1NKB A;  4DQ8 A;  3AA3 A;  2PY5 A;  4KPY A;  5AQF A;  3VF2 A;  3ID6 A;  4IJA A;  1S9E A;  4GKK K;  5AQL A;  3BDP A;  4CHY A;  1T6D A;  4XH5 A;  1S22 A;  5C42 A;  2BUP A;  1ASW A;  4OLB A;  1HQU A;  4CES A;  3MCA B;  2P9S B;  3I8B A;  4JKG A;  5K14 A;  3BF3 A;  4JEP A;  5JS1 A;  3HTV A;  4JI4 K;  4F3O A;  4OO1 J;  3OYG A;  2HBM A;  4MQ3 A;  5LJV A;  2XY8 A;  3QML A;  4FSV A;  3F5T A;  4Z4G A;  2X6N A;  3VF4 A;  5KTQ A;  5AQZ A;  2F4V K;  3J8A A;  3VA3 A;  4CD1 A;  4HWI A;  3O1W A;  2I7P A;  4KBO A;  2BAN A;  5BN9 A;  1X3M A;  1CXU A;  3I8D A;  3IUC A;  4NXN K;  3R6M A;  1T44 A;  1FKO A;  4DV7 K;  3E66 A;  5EY4 A;  5H1S Q;  4AHU A;  2P9L A;  2ZD1 A;  3ASM A;  1N36 K;  5HOO A;  3HST B;  2XY7 A;  3P38 A;  4FWS A;  1T7P A;  4EHT A;  4R5P A;  4CF9 A;  3V81 A;  1JCF A;  4E1M A;  3THV A;  4OKJ A;  2DFF A;  1U45 A;  3UB5 A;  3AGR A;  4M63 C;  1YF5 L;  3J7Z O;  3LPT A;  3ALY A;  5CYQ A;  1VRU A;  3TAR A;  3EZ5 A;  5AQR A;  3V1O A;  4B9T A;  3BP8 A;  5GIN A;  2O8D A;  1QVF M;  4CJV A;  1UOC A;  2WON A;  2FSK A;  3WQU A;  4CFD A;  4FLZ A;  2YHY A;  1TL1 A;  3DLL L;  1EWR A;  4GNI A;  5FLX O;  2PBD A;  3CYM A;  4E7H A;  3SUN A;  2E88 A;  1J9A A;  1NK7 A;  2QK9 A;  4LF4 K;  4FK2 A;  3SK3 A;  2IDO A;  2GBZ A;  3AVH A;  3DLG A;  3AA4 A;  4CF1 A;  3CMA N;  1TGO A;  4JD2 B;  3OYA A;  2NNW A;  1LWF A;  4O0J A;  4CEB A;  1CZA N;  1YI2 N;  1NLV A;  3IKM A;  4YOU A;  3AVA A;  4OPH A;  3MWP A;  4ZHR A;  1RBV A;  4F3T A;  4FCY A;  3RMB A;  4PKG A;  5C2F A;  4W5R A;  4I9L A;  3AAQ A;  1IO2 A;  3HBT A;  1KC8 O;  1J5E K;  4A57 A;  1HYZ A;  2RF2 A;  2O4G A;  1B9D A;  4FWM A;  4CJK A;  4EZ9 A;  4DU4 A;  2A42 A;  2NUB A;  4PKI A;  2D5R A;  3M8S A;  3HVT A;  2JLE A;  2ITG A;  4BGB A;  4O5F A;  2YCH A;  4TSX A;  4J2A A;  4H5R A;  4DFM A;  1W7A A;  4JK8 A;  2G8F A;  1C1B A;  1BA0 A;  1A5W A;  2FBY A;  2KHO A;  4DMN A;  3LM2 A;  5AQH A;  3OYC A;  3TAB A;  1KSP A;  1P90 A;  3DJC A;  1ESV A;  3O4W A;  1N32 K;  3HJF A;  4K0K K;  4JI2 K;  1JLC A;  3NGY A;  4RW9 A;  1HLU A;  3MX5 A;  4ID5 A;  4CGH A;  1Z26 A;  2VQF K;  1HMV A;  3HOS A;  3F9M A;  1MWK A;  1KCF A;  1S72 N;  2YNH A;  3B8A X;  3L3V A;  5I42 A;  1RT1 A;  5BR8 K;  1YVN A;  4Z0U A;  4H0O A;  1DT9 A;  3C0B A;  1BOT O;  3OYB A;  1NBW A;  4X66 K;  5BRE A;  1HKC A;  4O0I A;  3SAH A;  3A5L C;  3O9T A;  2E6L A;  5KQD A;  3N4P A;  3AVF A;  4BRN A;  4BWJ A;  2JGU A;  5GAH P;  4LSL A;  3PO5 A;  3C6T A;  3K2P A;  4PKH A;  5B8H A;  2ASM A;  4BEC A;  1IG8 A;  4CK1 A;  4DR6 K;  4CK2 A;  4DTN A;  4HUF A;  1VHX A;  1OKJ A;  3WXM B;  4B9U A;  4HUE A;  2P9I B;  4B3S K;  1HNI A;  3W0L A;  3ULE B;  3AO2 A;  3FLC O;  2P9S A;  3UKR B;  4JKF A;  5EU7 A;  4M3X A;  4Z4I A;  2XO7 A;  1LWC A;  2V7Z A;  3JS6 A;  4CZF A;  1RTD A;  3MEC A;  4BR4 A;  1NK5 A;  5BPM A;  3MN6 A;  4M3R A;  2Q97 A;  1TKX A;  4YY3 K;  4FLW A;  5FRM A;  4CJ7 A;  4BGA A;  1VQN N;  4DFP A;  4IFV A;  4EIA A;  3S3M A;  2P9K A;  1HR0 K;  3U4L A;  2RHK A;  4EZ6 A;  3FR0 A;  1S9G A;  3VQ8 A;  3JAM O;  1FKP A;  2OCE A;  2E4L A;  3CQY A;  1SKR A;  2EWS A;  3SQ1 A;  3DLB A;  1JL2 A;  1T8E A;  4L8R B;  4CIF A;  3OYN A;  1XMQ K;  1JLQ A;  4OKK A;  4DQQ A;  1SKW A;  3ENH A;  1KVC A;  2CH5 A;  1U4B A;  4LF8 K;  2QWR A;  4KHN A;  2HHI A;  1JLB A;  4FL9 A;  2W00 A;  4DB3 A;  3RRH A;  5BN8 A;  4KRF A;  2QWN A;  4GV6 A;  1TKZ A;  2KQ2 A;  2KTQ A;  4MLH A;  5C24 A;  1G15 A;  3H1Q A;  3SQ2 A;  3D2F B;  4MDA A;  1ZBU A;  3NAE A;  1HRH A;  4EP5 A;  4WQ5 A;  3U8X A;  4BG8 A;  2F8S A;  4CJS A;  4OPJ A;  4FWO A;  4JYA K;  3TAM A;  3K0S A;  2NRX A;  3TU5 A;  1U2V B;  5HRP A;  5JLF A;  4DS4 A;  4FZX C;  1NGJ A;  4H5W A;  4IXC A;  1WUA A;  2HBL A;  3DWL A;  4HHT A;  3FFI A;  5FPE A;  4U67 L;  4BRM A;  3RWU A;  2VG6 A;  1S1U A;  1ASU A;  2PZS A;  1IKW A;  3WXK A;  1OH5 A;  4BDY A;  4E1N A;  5BPN A;  3WNG A;  3HOT A;  2QXL A;  3VN5 A;  1GLA G;  4FO0 A;  4RTF D;  4B1Y B;  1O13 A;  1VSJ A;  1ZBI A;  2BH1 A;  3ATV A;  4DQP A;  1VSL A;  1NKE A;  2Q1N A;  1BWF O;  1Z05 A;  5JVH L;  2D0O A;  2HNZ A;  1RBU A;  1UWB A;  3O9R A;  2PAV A;  1BQN A;  3J7Y P;  4WYB A;  1GLD G;  2NRV A;  3QEI A;  4B3M K;  4N41 A;  5AQY A;  1LWE A;  3NH1 A;  2NRW A;  1IBM K;  4FJ5 A;  3ITH A;  2C1G A;  1KVA A;  3AVM A;  1RBS A;  4DSI A;  3E9P A;  4BDP A;  1SV5 A;  2BDP A;  1OH8 A;  4J2D A;  1KLN A;  3A2F A;  2Z1G A;  4DQI A;  5JIC A;  3T1H K;  2QWL A;  3P4I A;  4FJL A;  2NZT A;  4CCH A;  2JWL A;  1M1K O;  4MO4 A;  5FPM A;  5TKY A;  1NJI O;  5FPN A;  3CYG A;  4LF5 K;  4KTZ A;  1G99 A;  3J80 O;  4CED A;  1DTQ A;  5KRT A;  3CC2 N;  4FYD A;  3MEG A;  1Z6R A;  1ZBF A;  4BRC A;  3KK1 A;  1JCE A;  5AQO A;  1NNE A;  2EHG A;  1VQP N;  1W0H A;  4G9Z A;  2WFB A;  3HO1 A;  2RKI A;  4BRE A;  2DPN A;  4NLB A;  4C8O A;  1VSH A;  3R8E A;  4IBN A;  4X65 K;  3S3N A;  3VER A;  3FGU A;  4IWV A;  4RW8 A;  4FZY A;  4B8C A;  3OYL A;  3WEE B;  3RR7 A;  1JLA A;  5BPL A;  1NM1 A;  4N76 A;  3SV4 A;  3DOL A;  2KKZ A;  3CQX A;  1HJR A;  2X78 A;  2W6K A;  4RW7 A;  3UKR A;  2KFZ A;  4IO8 A;  5LY3 A;  4BDZ A;  1RTH A;  1SUQ A;  3QEV A;  2OA8 A;  2O8B B;  3B6P A;  1HX1 A;  5AFU A;  1C1C A;  1VSI A;  3M8P A;  4LFB K;  4W5O A;  5D3G A;  4H4M A;  3LP1 A;  4J2B A;  4CD3 A;  1GOC A;  5FPD A;  2FSJ A;  5DK5 A;  1RNH A;  1K8A O;  2QWM A;  3O3H A;  4CEC A;  2UUA K;  2F96 A;  3QNN A;  3HT3 A;  3SJJ A;  4DV2 K;  1S5J A;  2D0C A;  3SQ0 A;  3VQP A;  3H3N O;  3QB0 A;  4QAG A;  4DR7 K;  4ELT A;  3O9Q A;  3RR8 A;  1L3U A;  3MEE A;  1BU6 O;  4FWN A;  5AFU H;  4CZI A;  3CCQ N;  4CK3 A;  3LDS A;  2YKN A;  4L3Q A;  2P1J A;  4CHZ A;  5E41 A;  3SUQ A;  4ILJ A;  2UU9 K;  3VGL A;  3VF6 A;  1IKV A;  5KPR A;  1JLE A;  4BR9 A;  4CJU A;  5HLF A;  1T6C A;  5AZI A;  5LMN K;  4NCA A;  3P83 D;  5I9E B;  2XRI A;  1K8K A;  4JHD A;  1XC3 A;  3ZX2 A;  4M7X A;  4PA1 A;  3I56 N;  1NJZ A;  4JS4 A;  4CEA A;  4K8X A;  4BRH A;  4GMJ B;  3K58 A;  5CHI A;  2ZQB A;  4E19 A;  4ILG B;  1Q81 O;  3EN9 A;  1QVG M;  3RSE B;  3CCL N;  1XMO K;  5KGW A;  1QQC A;  1TAU A;  1Q9Y A;  5M1P A;  1VQL N;  3AO1 A;  3MN7 A;  3SQ4 A;  1XQS C;  4JD2 A;  3O4N A;  3BZC A;  3AVK A;  4R79 A;  1E3M A;  1WAF A;  3E9L A;  3EKU A;  1QSL A;  1RTJ A;  3VEV A;  3OJS A;  1E4F T;  4KHP K;  1NOZ A;  5A2Q O;  4EAH D;  4PWD A;  4GV3 A;  3IFR A;  4YOT A;  1YXQ A;  1RDA A;  3LWM A;  3HVR A;  2G8V A;  4H8K A;  1BI4 B;  4CJL A;  4RG8 A;  3WT0 A;  1YIJ N;  5IWA K;  3NGZ A;  1RDW X;  3MCP A;  3CPE A;  5AQX A;  1BUP A;  4O8K A;  3KJV A;  5F0X A;  1U47 A;  1MWM A;  1TUU A;  4KB0 A;  2A5X A;  1MU2 A;  4ZTJ A;  3AVG A;  1VRT A;  3L4Q A;  2IS3 A;  3ZSR A;  2NRR A;  4JI6 K;  3S41 A;  4I2P A;  3QLH A;  3QER A;  1YUW A;  3SNN A;  2QM1 A;  1WBB A;  4FM1 A;  3LP2 A;  3HSC A;  4JKH A;  2OZM A;  1BIS A;  4HCC A;  4BRL A;  4CBX A;  1D4X A;  4CGD A;  1Q8I A;  3M1F A;  2PFU A;  5C10 A;  3I55 N;  1NG9 A;  4DTU A;  1YTU A;  4M41 A;  5BR9 A;  2BGG A;  5CE3 A;  1NWK A;  2Q3S A;  1KFD A;  4NLC A;  3J81 O;  3CCR N;  1HNW K;  4AM7 A;  3SBT A;  1HNX K;  4M3Z A;  3G25 A;  1IV0 A;  4JKB A;  3QES A;  3V4I A;  2DFH A;  3KVG A;  3P39 A;  4KHY A;  4KO0 A;  3V9Z A;  3CD6 N;  2DY4 A;  4E72 A;  2HW3 A;  1JKH A;  4JNE A;  4NYF A;  3EEQ A;  3G0Z A;  2ZJQ L;  5SWM A;  5E84 A;  4RWT A;  1Q7Y O;  2X6S A;  2RN2 A;  2W41 A;  2QA4 N;  3D7E O;  3CCJ N;  2FSN A;  3T19 A;  1SS6 A;  4E7K A;  4IEE A;  3O08 A;  4NB4 A;  4IDH A;  3PX4 A;  4CGG A;  2YHB A;  3VTH A;  2QTD A;  4H5V A;  5F1X A;  3L6Q A;  4DFJ A;  2KW4 A;  4PL7 A;  4YOW A;  4CHO A;  4DV0 K;  3QEX A;  3RMC A;  3VQ7 A;  1NGH A;  3UIQ A;  4FJG A;  2O8C A;  2D0P A;  3I0R A;  2O8F A;  3LP3 A;  4PQU A;  4CJ4 A;  3V9U A;  1L3V A;  4JKD A;  4BRQ A;  3VQD A;  3C65 A;  3KK3 A;  1HNZ K;  4M42 A;  4X64 K;  2Z1H A;  3QIC A;  1DLO A;  3AO4 A;  1XUP O;  4CGI A;  3L3U A;  1BG3 A;  4WFB L;  1S3X A;  3CPW M;  1JLG A;  5JVG L;  3CM5 A;  5HRN A;  3GG4 A;  1RDC A;  3ENB A;  2W40 A;  4NCB A;  3M8Q A;  3IAY A;  1UA1 A;  3S5T A;  4C8L A;  4KV8 A;  1GLJ O;  2NRT A;  1VSK A;  4O4G A;  1LW2 A;  4CZK A;  2V7Y A;  1ZBS A;  3NH2 A;  3K9K A;  4B3R K;  2QXF A;  4WQ4 A;  3QET A;  1TK8 A;  3LAM A;  1IG9 A;  4CBW A;  3MWT A;  4EFH A;  4LFA K;  1RBT A;  3KKR A;  3AA5 X;  5C2D A;  3OTO K;  3PX6 A;  3HK2 A;  3V9S A;  3KWG A;  4QS9 A;  4DR2 K;  4CEQ A;  1WAJ A;  3DXM B;  4QCL A;  2FBT A;  4IOC L;  3DYA A;  1VK0 A;  3T1Y K;  3CER A;  3VGM A;  4OJR A;  3L2Q A;  5EVZ A;  4E7I A;  3KZB A;  1VSD A;  3MK6 A;  1RT3 A;  3SJH A;  4K42 A;  2HHW A;  4CZJ A;  4XH4 A;  5BRD A;  4Y1C A;  3VQ9 A;  4QOZ B;  3IMX A;  3ZT3 A;  4FJX A;  3H1V X;  3DLK A;  4B9L A;  1IH7 A;  3C6A A;  1RT4 A;  3PIP L;  5JS2 A;  4RW4 A;  3DRS A;  4JAX A;  3OYJ A;  1TL3 A;  2OPR A;  3T7Z A;  5HBM A;  2BTF A;  4A5A A;  4OPK A;  4BE2 A;  3ULE A;  4PL8 A;  4CJ3 A;  5ADX H;  3VQE A;  5CR4 A;  4I6M B;  3WNE A;  1YJW N;  1FW6 A;  5M1N A;  4BG9 A;  4UQG A;  5J2M A;  3RMA A;  1RDB A;  1UA0 A;  2DFE A;  3O80 A;  3TTF A;  3G4S N;  4DLE A;  1SZ2 A;  4LF6 K;  2HB5 A;  2VWK A;  1BQM A;  2E2N A;  4IDK A;  4CJE A;  3HZ6 A;  1LAW A;  1NK4 A;  1N5Y A;  2YJE A;  4BRK A;  5JMV A;  2P9L B;  1CZB A;  4E7J A;  4FJ7 A;  4B8A B;  1REV A;  3SUP A;  4H0X B;  4IZ9 A;  1ZBH A;  4LF7 K;  4DSF A;  2IAJ A;  2OPS A;  3WXJ A;  2WBN A;  2G8U A;  1R59 O;  3QBX A;  3EY1 A;  4DQS A;  4OGC A;  2KFN A;  1J53 A;  4B1X B;  3DI6 A;  4BR0 A;  2B4J A;  3OS0 A;  3LDP A;  4BC5 A;  4FLT A;  5AQW A;  2IVP A; 
#chains in the Genus database with same CATH homology
 3TTC A;  5F2R A;  1KXP A;  2F9W A;  3C7N A;  3E9P A;  5AZJ A;  5TKW A;  4YDU A;  2OTL N;  4FWP A;  5AQI A;  5JIC A;  4H5N A;  4AF1 A;  4CBU A;  3DXM A;  2QWL A;  3P4I A;  1LOT B;  3WXL A;  4YOX A;  2NZT A;  4JKC A;  1DEJ A;  4FOI A;  3UKU B;  2JWL A;  1M1K O;  4MO4 A;  5FPM A;  5TKY A;  1NJI O;  3EE9 A;  1GLB G;  2AP1 A;  5FPN A;  3EL2 A;  4A2B A;  1V4T A;  3EO3 A;  2P9N B;  3VMF B;  4RCH A;  1G99 A;  3R9P A;  3M6G A;  3VEX A;  3CJ7 A;  3D2E A;  3K9J A;  1VQM N;  4I6M A;  3HI0 A;  3CC2 N;  4B1V A;  5GIP A;  2FXU A;  1Z6R A;  2ASO A;  4BRC A;  1JCE A;  4Y0W A;  5AQO A;  2CGL A;  3CJ1 A;  1NGC A;  1VQP N;  4BR7 A;  4FVU A;  4G9Z A;  2WFB A;  2UYT A;  1QQN A;  4B1W B;  2QEX N;  3QFU A;  2E2P A;  1HKB A;  4BRE A;  1YHQ N;  5AQQ A;  1HUX A;  1RFQ A;  1X3N A;  5KPT A;  5LJW A;  3AAP A;  2DPN A;  3A5N C;  3CHW A;  1P8Z A;  4NLB A;  3CME N;  2HF4 A;  1Y64 A;  3A8Y A;  1MA9 B;  1BO5 O;  2ITM A;  3DXK B;  3R8E A;  4Z94 A;  1DKG D;  4MO5 A;  1ATS A;  4JN4 A;  5AQK A;  1RGI A;  1DGK N;  3VER A;  4ISF A;  1GLL O;  1K8K B;  4QS8 A;  3FGU A;  4FWK A;  2Q2R A;  4H03 B;  1EQY A;  4IWV A;  1VQ5 N;  4A2A A;  5C15 A;  3O9U A;  1GLF O;  1VQ8 N;  4IO9 L;  4NO7 A;  1VQK N;  3SMS A;  5M1K A;  1TUY A;  2ZGZ A;  3TTD A;  3CF5 L;  1SQK A;  2VCP A;  1KAX A;  4DQ8 A;  3AY9 A;  3BEX A;  2ZWH A;  3ATU A;  1C0G A;  3WEE B;  5AQF A;  1ILY A;  5AQT A;  3FZH A;  2E1Y A;  3VF2 A;  5BPL A;  1NM1 A;  3ID6 A;  3ID8 A;  4IJA A;  4BRP A;  2F9T A;  2KKZ A;  3G6E N;  3CQX A;  3W3D A;  5AQS A;  2CH6 A;  3QBW A;  3NVK A;  3CCU N;  5AQL A;  1T6D A;  3UKR A;  4IO8 A;  4XH5 A;  4AM6 A;  5LY3 A;  1S22 A;  2E2O A;  2BUP A;  1HX1 A;  5AFU A;  1YJ9 N;  3MCA B;  2D1K A;  2E8A A;  2P9S B;  3EE8 A;  3I8B A;  4JKG A;  3SMP A;  3BF3 A;  2QWO A;  4JEP A;  4KH5 A;  4CD3 A;  3HTV A;  4B1Z A;  5FPD A;  4OO1 J;  2FSJ A;  2J4R A;  3MDQ A;  1K8A O;  2HBM A;  5LJV A;  4BEB A;  3LDQ A;  3QML A;  3CC7 N;  2QWM A;  2Q0U A;  4FSV A;  2F7T A;  2OAN A;  1T3V A;  5GAD P;  3CJA A;  1OVY A;  3OA9 A;  3F5T A;  3CCS N;  3VF4 A;  3GL1 A;  5AQZ A;  5KQ8 A;  1K9M O;  3ZX3 A;  3J8A A;  4FPA A;  3H3N O;  3VEY A;  3QB0 A;  4CD1 A;  4HWI A;  3O1W A;  2I7P A;  3CCE N;  4KBO A;  3PLA A;  5BN9 A;  3O9Q A;  1X3M A;  3LL3 A;  5EXW A;  1BU6 O;  4FWN A;  5AFU H;  3JXU A;  4CZI A;  1LCU A;  3LDN A;  3H46 O;  3IUC A;  5GIO A;  2JWK A;  3CCQ N;  4FWL A;  3R6M A;  4L3Q A;  5AQU A;  1HPM A;  1T44 A;  3P31 A;  4ILJ A;  3SLC A;  5GAE P;  5M1O A;  1YAG A;  3E66 A;  3GDQ A;  3HRG A;  3VGL A;  5EY4 A;  5H1S Q;  2P9L A;  3VF6 A;  3BUZ B;  4JHD B;  4C23 A;  5KPR A;  5HOO A;  5C0Y A;  1NGA A;  3M5R A;  1WOQ A;  3P38 A;  4FWS A;  1GLE G;  4BR9 A;  4BR5 A;  4EHT A;  2P9U A;  3H6E A;  3VEW A;  1JCF A;  1T6C A;  5AQJ A;  5AZI A;  1Q86 O;  5I9E B;  3ZX0 A;  4H0P A;  1K8K A;  3UB5 A;  3AGR A;  4JHD A;  4K43 A;  1XC3 A;  4M63 C;  1YF5 L;  1J6Z A;  4JK9 A;  3ZX2 A;  3J7Z O;  4M7X A;  3ZEU B;  3GBT A;  3I56 N;  2HBK A;  5AQR A;  3BP8 A;  5GIN A;  4BY9 C;  4IEI A;  3VPZ A;  4BRH A;  1QVF M;  2QI2 A;  5CHI A;  2FSK A;  2P9P A;  2KLA A;  4WFA L;  4OPA A;  3WQU A;  4UY8 O;  4ILG B;  2YHY A;  2GEL A;  2HOE A;  1Q81 O;  3EN9 A;  3PIO L;  1QVG M;  3RSE B;  3CCL N;  3DLL L;  3LDO A;  4IOA L;  4GNI A;  5M1P A;  3H45 C;  1VQL N;  2PBD A;  2YJF A;  2YX6 A;  2I7N A;  3MN7 A;  4GVE A;  1XQS C;  4JD2 A;  2E88 A;  2YHW A;  3SK3 A;  1NMD A;  5M1Q A;  1NGG A;  4R79 A;  3CMA N;  4IFE A;  4JD2 B;  3E9L A;  3EKU A;  4DCH A;  2IIR A;  3FZL A;  3U9D A;  2NNW A;  4LC9 B;  4H5T A;  5DM7 L;  2NLX A;  3IDH A;  1YI2 N;  1CZA N;  3VEV A;  1E4F T;  1NLV A;  3IKM A;  1JCG A;  4YOU A;  5AQG A;  4OPH A;  4C1N K;  1NGF A;  3MWP A;  4FPB A;  1N8R O;  4EAH D;  4GV3 A;  3IFR A;  5BRH A;  4YOT A;  1YXQ A;  3TSP A;  4CZM A;  4PKG A;  5C2F A;  3FFK B;  5AQN A;  2YHX A;  3AAQ A;  3CXC M;  2E2Q A;  1ATN A;  3HBT A;  3DAW A;  1KC8 O;  3WT0 A;  4F9O A;  1YIJ N;  4A57 A;  2QWQ A;  1V4S A;  3L4I A;  4BRI A;  4ISG A;  1JJ2 M;  2ZJR L;  1RDW X;  3MCP A;  3CPE A;  5AQX A;  1BUP A;  3EZW A;  4O8K A;  5F0X A;  2H3G X;  1C0F A;  1QHA A;  1MWM A;  4FWM A;  1TUU A;  4WF9 L;  2OTJ N;  2A5X A;  4XJX A;  3FZM A;  1U6Z A;  3AGK A;  2A42 A;  3L4Q A;  4PKI A;  1NGE A;  2NRR A;  2P9I A;  3OW2 M;  3S41 A;  4C1N I;  2FF3 B;  3CCV N;  4BRG A;  5AQP A;  3QDK A;  2RE2 A;  4O5F A;  2YCH A;  4BGB A;  1QZ5 A;  1YUW A;  4H5R A;  1VQ7 N;  2A40 A;  4BVO A;  2QM1 A;  2NRH A;  4ISE A;  4JK7 A;  1NGD A;  3CJB A;  4JK8 A;  4DKW A;  3HSC A;  4QS7 A;  4JKH A;  2A3Z A;  3FZF A;  1QQO A;  4BRL A;  4WQ4 C;  4CBX A;  1D4X A;  1BA0 A;  3R3L A;  2Q31 A;  3VTI A;  2KHO A;  3LM2 A;  3KHY A;  5AQH A;  3M1F A;  4HTL A;  4YOR A;  4BR2 A;  2PFU A;  5C10 A;  3I55 N;  1P90 A;  3DJC A;  2GEM A;  4BRF A;  1ESV A;  3O4W A;  3WUH A;  5BR9 A;  2CGK A;  5CE3 A;  1HLU A;  1NWK A;  3GOI A;  2A41 A;  4FWQ A;  4NLC A;  4BRD A;  3MX5 A;  3MX2 A;  3O9S A;  3WXI A;  4AM7 A;  3SAF A;  3SBT A;  1TYQ A;  3G25 A;  3HOS A;  3F9M A;  1MWK A;  4JKB A;  1S72 N;  3KVG A;  3P39 A;  1HJO A;  2P9K B;  3B8A X;  5EOY A;  3CD6 N;  3ZEU A;  4WCE L;  1YVN A;  1VQ4 N;  4JNE A;  3OHR A;  4H0Y B;  3O5B A;  4H0O A;  2C1G A;  1DT9 A;  2ZJQ L;  5E84 A;  4RWT A;  1Q7Y O;  3C0B A;  2ZF5 O;  1BOT O;  4JKA A;  2W41 A;  1NBW A;  4MDB A;  2QA4 N;  3D7E O;  2HST A;  2WUS A;  1HKC A;  5AZI B;  5BRE A;  1H1V A;  5BRF A;  3SAH A;  3CCJ N;  3A5L C;  3N4Q A;  2FSN A;  3O9T A;  1KD1 O;  1SS6 A;  1IJJ A;  2FF6 A;  3E1Y A;  4IEE A;  3O08 A;  4NB4 A;  5KQD A;  3SAG A;  1EO1 A;  3N4P A;  4IJN A;  4IDH A;  4K25 A;  3VEZ A;  1K73 O;  2GX9 A;  4BRN A;  3VTH A;  3NMU A;  3LM9 A;  3UE5 A;  5JLH A;  5M1F A;  5GAH P;  2QTD A;  4H5V A;  2QWP A;  3L6Q A;  3MMV A;  5F1X A;  2WC9 A;  4PL7 A;  4PKH A;  4BE7 B;  3WQT A;  2NRZ A;  4YOW A;  4BC3 A;  5B8H A;  2ASM A;  4BEC A;  1IG8 A;  2IVN A;  3ZET A;  3M3Z A;  1NGH A;  4CZH A;  1Q18 A;  4O8U A;  2HF3 A;  5E26 A;  1OKJ A;  3WXM B;  4CZL A;  5HL7 L;  2D0P A;  4YOV A;  3OBY A;  1YJN N;  2P9I B;  4JKD A;  4CI6 A;  4BRQ A;  3C65 A;  3O6W A;  3W0L A;  3ULE B;  3FLC O;  3VET A;  4EHU A;  2P9S A;  3QIC A;  3UKR B;  4E1J A;  3QFP A;  4YOY A;  3F2K A;  3O1B A;  4JKF A;  3OBW A;  4K41 A;  5DM6 L;  1XUP O;  2GWJ A;  1W97 L;  1HKG A;  4CZE A;  1BG3 A;  4WFB L;  1S3X A;  2V7Z A;  3CPW M;  3JS6 A;  5JVG L;  4KH6 A;  4BRO A;  4B1U B;  1MDU B;  1ZXO A;  3CC4 N;  1GLC G;  3GG4 A;  4CZF A;  3ENO A;  4XEI A;  3ENB A;  2D4W A;  4BR4 A;  2W40 A;  5ADX A;  5BPM A;  2V51 B;  3MN6 A;  2FLO A;  2P9U B;  2Q97 A;  1GLJ O;  2NRT A;  4BC4 A;  4U7B A;  4JKG B;  3T69 A;  4CJ7 A;  4BGA A;  1VQN N;  4CZK A;  2E20 A;  2V7Y A;  4EIA A;  2V52 B;  1ZBS A;  4MLE A;  3K9K A;  2C1I A;  5AQM A;  2P9K A;  4WQ4 A;  4GV9 A;  5ELZ A;  5AR0 A;  3TSQ A;  4WQ5 C;  3U4L A;  4CBW A;  3MWT A;  2P9N A;  2RHK A;  4EFH A;  1BA1 A;  3FR0 A;  1M90 O;  4H0V B;  1KAY A;  5C2D A;  2Q36 A;  3R1X A;  4PHT X;  3L0Q A;  3BF1 A;  3KWG A;  5EX5 A;  3VES A;  3CQY A;  4QS9 A;  4H0T B;  2EWS A;  3A5O C;  3DXM B;  5KPZ A;  1NGI A;  3E9O A;  4IOC L;  1TYQ B;  1KQS M;  3KK7 A;  2IVO A;  1NGB A;  5AQV A;  3CER A;  3VGM A;  1RDU A;  2VGM A;  4BVP A;  3ENH A;  3CI5 A;  4KH4 A;  5GAG P;  2CH5 A;  5EVZ A;  3HM8 A;  3LDL A;  1QQM A;  2QWR A;  3A0I X;  3KZB A;  4ILH A;  2VGN A;  3MK6 A;  4FL9 A;  2W00 A;  3I33 A;  4CZG A;  4DB3 A;  3SJH A;  4K42 A;  5AZJ B;  3ZYY X;  5BN8 A;  4CZJ A;  4XH4 A;  5BRD A;  2GUP A;  2QWN A;  3C6H A;  1KAZ A;  3CJ9 A;  4GV6 A;  3IMX A;  3KWI A;  4MLH A;  3H1V X;  3MN9 A;  4A62 A;  3H1Q A;  2ASP A;  3GE1 A;  3D2F B;  4MDA A;  3C6A A;  3PIP L;  2YI1 A;  4JAX A;  3CJC A;  2ZGY A;  3T7Z A;  3C7N B;  4WQ5 A;  3U8X A;  2BTF A;  3VGK A;  4BG8 A;  4A5A A;  3FZK A;  3CCM N;  3TSU A;  2VYP A;  4FWO A;  3ULE A;  4PL8 A;  1SAZ A;  5ADX H;  2Q0R A;  5CR4 A;  4I6M B;  1X9J A;  4FWR A;  4A61 A;  1YJW N;  3O8M A;  4BG9 A;  5M1N A;  5MLC Q;  3CET A;  3D6R A;  4A59 A;  2NRX A;  2CGJ A;  1U2V B;  4J8F A;  3TU5 A;  5JLF A;  3TPQ A;  1NGJ A;  4H5W A;  4IXC A;  1WUA A;  3G71 N;  2HBL A;  3DWL A;  5FPE A;  3MN5 A;  2HMP A;  4U67 L;  3O80 A;  4M7Y A;  4BRM A;  3TTF A;  3G4S N;  3ZET B;  4FOE A;  3RSE A;  1SZ2 A;  2AA4 A;  3VEN A;  3RVC A;  3WXK A;  2P9P B;  3AAR A;  3EKS A;  4BQL A;  3CCR N;  3FE1 A;  4BQZ A;  3H3O B;  2E2N A;  2ZJP L;  1VQ9 N;  3HZ6 A;  1ATR A;  1BDG A;  4JKE A;  5BPN A;  2GTD A;  3HOT A;  2QXL A;  3D2E B;  4GY2 B;  1GLA G;  1ZC6 A;  2VWB A;  4FO0 A;  4RTF D;  4B1Y B;  2YJE A;  5C12 A;  4BRK A;  5JMV A;  1O13 A;  1W2B M;  2E1Z A;  2BH1 A;  3ATV A;  2P9L B;  4YDU C;  3NVM A;  4IOX A;  1Q82 O;  3WEE A;  4A5B A;  1U2V A;  2Q1N A;  4H0X B;  1BWF O;  4IZ9 A;  3VEO A;  1Z05 A;  4DHY A;  1VQO N;  3SBG A;  5JVH L;  2D0O A;  1VQ6 N;  1VAZ A;  3O9R A;  1E4G T;  1QZ6 A;  2PAV A;  3CIP A;  2WBN A;  3UKU A;  3Q7C A;  3WXJ A;  2GWK A;  4WFN L;  2HBJ A;  1R59 O;  3QBX A;  4WYB A;  3Q7B A;  4XH1 A;  4BC2 A;  4BRA A;  1GLD G;  2NRV A;  1YIT N;  2QW9 A;  3VOV A;  2A6A A;  3A5M C;  4B1X B;  3DXK A;  4BR0 A;  3D2F A;  5AQY A;  4B9Q A;  3LDP A;  4BC5 A;  2NRW A;  3U9Z A;  5AQW A;  2IVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...