2P9NB

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
203
structure length
203
Chain Sequence
QAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
total genus 51
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9nB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9nB02
5KPRA 5B8HA 4I6MA 4K25A 4FWMA 3C0BA 2OANA 2E88A 4AM6A 4F9OA 3M6GA 1U2VA 1G99A 2A40A 3OHRA 3R9PA 1BO5O 2DPNA 3C7NA 4IXCA 4AM7A 5FPEA 2YI1A 1NLVA 2D4WA 3MN9A 3GDQA 5AZIB 4B9QA 5AQQA 1HJOA 4BRKA 2V7YA 3A5OC 5KPTA 2GWKA 1HKBA 1QZ5A 4LC9B 1Q18A 5AQIA 4CZMA 2FXUA 3D2EA 4M7XA 4BRCA 3LM9A 2VYPA 5BPLA 3ID8A 3ZETB 1S3XA 3D7EO 3FGUA 3HSCA 3IFRA 3EZWA 2HF4A 3VF6A 1C0GA 1XC3A 4WQ5A 1KAZA 5AQHA 4BG9A 3U4LA 3FZHA 3CI5A 3M3ZA 1TYQB 3IDHA 3EKUA 1JCGA 4BRDA 2A41A 4JNEA 2P9KA 3CJ9A 2V51B 1SAZA 4O8KA 3CJCA 3H1VX 4O5FA 2CGKA 3SLCA 1K8KB 3FZLA 3LDLA 3HM8A 2ITMA 2CGLA 4PL8A 5AQOA 3B8AX 3VOVA 1QQOA 4GNIA 1P8ZA 4WYBA 1HKCA 3FR0A 3LDPA 4BRQA 3D2FB 4IO8A 3H46O 5AQGA 2GWJA 3WQTA 5FPDA 1OKJA 3AY9A 5AZJB 4H5RA 3MK6A 4BRFA 4WQ4C 4CD1A 1X3NA 3LDQA 3WXLA 4IJAA 1RDWX 1TYQA 3KVGA 3LM2A 2P9IB 2FF3B 1YAGA 4H0PA 5I9EB 4K43A 5EY4A 5BRDA 3R6MA 2V7ZA 4H0OA 2Q36A 3DXMB 1NGDA 1YVNA 4FWSA 3ZX2A 2FF6A 3D2FA 1ZC6A 3QBWA 2W40A 4BR7A 4CZKA 1E4FT 5AR0A 3H45C 3O6WA 5AFUH 3UB5A 3UKUB 1MWKA 1GLLO 3SJHA 3GL1A 3ZEUA 1LOTB 4MLEA 3BP8A 3R8EA 3VEVA 3WQUA 3VPZA 4H5WA 2ZF5O 3VGLA 4H5VA 3KZBA 1BOTO 3O8MA 3KHYA 2Q2RA 1GLJO 5JLFA 4BRAA 1H1VA 3A5NC 5AQJA 1BA1A 1U2VB 2IVOA 2P9UA 1D4XA 2Q0UA 2Q1NA 3LL3A 4FWLA 4NB4A 3J8AA 3C7NB 2AP1A 2D1KA 4FWRA 3HBTA 5AFUA 2QWLA 4BVPA 2E1YA 1T6DA 1U6ZA 1DGKN 4CZFA 5BN9A 3QFUA 3WT0A 2QM1A 1NGFA 4FPAA 3DXKA 3A0IX 4YDUC 2YCHA 4MO4A 1WOQA 4H5TA 2PBDA 3CQYA 3QDKA 4FL9A 2QWPA 4KBOA 2UYTA 4B1WB 5ADXH 2AA4A 2Q97A 4BR0A 4B1ZA 4CBUA 5BN8A 1MWMA 3CJ7A 5LJWA 3HTVA 4DCHA 4QS9A 3AAQA 2A5XA 4H5NA 3WXIA 3VGMA 1ESVA 2FLOA 4RCHA 4MO5A 4BRGA 4CZEA 3BF3A 4BREA 4WQ4A 3EO3A 2CGJA 4FPBA 1WUAA 2P9KB 1NGHA 1NBWA 2EWSA 2ASMA 4J8FA 2V52B 5TKYA 1GLEG 3DAWA 4RWTA 1NGIA 4BRPA 2E2NA 3A5LC 3W0LA 1GLFO 1TUUA 1YXQA 3MDQA 3ENHA 3LDOA 5BRHA 3QB0A 3WXKA 5KQ8A 4RTFD 5BR9A 1GLCG 2IVPA 2CH6A 3U8XA 2D0OA 5JMVA 2W41A 3UE5A 5AQTA 1NGCA 3L0QA 3FFKB 3FZMA 3P4IA 3A5MC 2Q0RA 1C0FA 4HTLA 3GOIA 4B1VA 5AQNA 4EHUA 1ZXOA 3BUZB 4QS8A 4BVOA 4A2AA 3CIPA 3WUHA 5AQFA 2ZGZA 4H0VB 5AQLA 2HMPA 3ATUA 2NLXA 2YJFA 2QWNA 4NO7A 3U9ZA 3ZX3A 5F1XA 2F9WA 4CI6A 3ATVA 1ATNA 4IJNA 4CZJA 2YJEA 5JICA 4EFHA 3ZEUB 4ISFA 5CE3A 2P9NA 4HWIA 4DHYA 1BWFO 3O1BA 4YDUA 4E1JA 3GE1A 4MLHA 1HUXA 3L6QA 4BC4A 4JD2A 3UKRB 3TU5A 1GLAG 5AQRA 2NZTA 2P9UB 4Z94A 1QHAA 3O5BA 4BRNA 4BR9A 3EKSA 4FOIA 1E4GT 3WEEA 4DB3A 3JS6A 1JCFA 1NGAA 3RSEB 3VEYA 2FSJA 4PKGA 4CJ7A 5AQXA 3SMSA 3O1WA 5FPMA 3O4WA 4BQLA 3DXKB 3H6EA 4C23A 3MN6A 4FWPA 3ULEA 4M63C 3HI0A 4BC2A 3FE1A 1ZBSA 3FZKA 2HOEA 3AARA 1MDUB 1LCUA 3UKRA 3SMPA 4CBXA 5AQSA 2GEMA 5AQMA 5AQYA 2GELA 3H1QA 4IZ9A 1KAYA 3VERA 3VETA 3ZX0A 1R59O 3RSEA 2A42A 2HF3A 4FWKA 3CJBA 4CBWA 1J6ZA 5E26A 2P9PA 4XEIA 3I33A 3QMLA 1CZAN 2IVNA 3CETA 1ATSA 4BR2A 4EAHD 1KAXA 2J4RA 3VESA 5EX5A 4PKHA 2CH5A 1BA0A 1BDGA 3O08A 2A6AA 4ISEA 3VEZA 1S22A 4B1YB 4BGAA 1X3MA 2E20A 3AAPA 4FWNA 5EOYA 1DEJA 5AQWA 1T6CA 5EXWA 4BGBA 1NGBA 5KPZA 2D0PA 2FSNA 2ASOA 2YHXA 3VGKA 3H3NO 5AQVA 2QWRA 4FO0A 4EIAA 5KQDA 4A61A 2Q31A 3SK3A 4ISGA 2ZWHA 1GLBG 5ELZA 2QWMA 5AQPA 2E2OA 5BPNA 1HLUA 5ADXA 2FSKA 4H0YB 5EVZA 1QQNA 1QQMA 3MN7A 5BREA 1KXPA 2NRHA 4DQ8A 2E2QA 3MCPA 3QBXA 4QS7A 4CZHA 5FPNA 1Y64A 4JHDB 4B1UB 4A62A 4BR4A 2I7PA 3FLCO 3L4IA 1BG3A 4B1XB 3VEWA 4PL7A 1IJJA 2P9NB 2QWQA 4CZGA 3ENOA 1NGEA 1HPMA 4JN4A 4PKIA 1NGGA 2H3GX 4CZLA 4JD2B 3IMXA 5JLHA 3CQXA 3S41A 1NGJA 4K42A 4BC3A 1NWKA 4H0XB 5BPMA 5AZIA 3DWLA 3BF1A 2QW9A 3WEEB 1MA9B 1ATRA 1HKGA 3A8YA 4JHDA 5F0XA 1YUWA 4FSVA 4FWOA 2E1ZA 1Z6RA 4CZIA 2YHYA 4A2BA 3EN9A 4M7YA 5LY3A 3ULEB 3I8BA 3DJCA 4BG8A 3O80A 4BQZA 5F2RA 5E84A 3QFPA 1BU6O 4H03B 1SQKA 4BROA 3ZETA 3IUCA 1HX1A 2ASPA 1IG8A 3GG4A 1V4SA 2I7NA 3H3OB 1RFQA 2VCPA 5LJVA 2P9LB 1NMDA 3MMVA 4IWVA 3VF4A 2GUPA 3CHWA 4JAXA 2KHOA 4BRMA 2QXLA 2P9PB 3EL2A 2ZGYA 2A3ZA 3CJ1A 1V4TA 2GTDA 3LDNA 2BTFA 4H0TB 5AQZA 1K8KA 4FOEA 4BC5A 1SZ2A 2P9SB 4GY2B 3U9DA 4BRHA 4BRIA 3F9MA 2IIRA 1T44A 3GBTA 1X9JA 2YHWA 3VEOA 1GLDG 5BRFA 2PAVA 2E8AA 3BEXA 3JXUA 4WQ5C 5AZJA 2P9LA 1TUYA 4EHTA 2F9TA 1Z05A 4L3QA 3MN5A 1XUPO 3W3DA 3VENA 4Y0WA 5AQUA 1EQYA 2P9IA 4BRLA 4FWQA 2WUSA 4I6MB 1QZ6A 3HZ6A 3QICA 5AQKA 3FZFA 3CERA 4CD3A 3M1FA 1RGIA 2P9SA 3VEXA 4XH1A 1XQSC 3DXMA 1DKGD 3CJAA 2E2PA 1NM1A 2VWBA 1BUPA 4K41A 2BUPA 1JCEA 2QWOA 4XH5A 4BR5A 3WXJA 3G25A 4XH4A 3VF2A 3UKUA 3D2EB 3TPQA
chains in the Genus database with same CATH superfamily
4OPHA 5B8HA 4K25A 1WB9A 3I8DA 4KB1A 4YOYA 2OPQA 2F7TA 4FZZA 1U2VA 1BO5O 3TSPA 4FLVA 2DPNA 4IXCA 4AM7A 3E1YA 2D4WA 4Z4EA 3GDQA 3PSFA 4DR2K 1SKSA 4DV7K 4BRKA 3A5OC 3CCMN 5J2MA 5CYMA 1XC9A 4B9VA 4DTNA 3OVNA 5BPLA 1K8AO 4LF9K 4KB0A 4O5BA 3K5MA 3HSCA 3IFRA 4CIGA 3OBWA 1C0GA 2ZJPL 4KHSA 2KKZA 5AQHA 5C15A 1QSLA 2A41A 2V51B 3V9SA 4NLBA 1Q86O 3FZLA 1S1XA 4PL8A 4I2PA 4WYBA 4BRQA 1Q81O 3H46O 2O8CB 3WQTA 4B9MA 5FPDA 3QLHA 1HPZA 4HVJA 4BRFA 4CD1A 4JI0K 4DQRA 5D3GA 5KRTA 4BEBA 2XY5A 3CCJN 2OTLN 4KH6A 3V1QA 1YAGA 3EYZA 4H0PA 5I9EB 1RT4A 4KREA 4IFYA 5BRDA 3RMAA 3N4PA 1O1WA 3OYAA 1NGDA 2E5LK 4JKFA 3ZX2A 4X64K 2FF6A 3D2FA 1ZC6A 3QBWA 4DQIA 1SKRA 4JYAK 1E4FT 2G8KA 3SZ2A 1WSHA 4KPYA 3SUNA 1S6QA 4DTRA 5MLCQ 1W2BM 2NRZA 3QINA 3ZEUA 3AVKA 4H5VA 2Q2RA 1M90O 1DTTA 1QTMA 4DFJA 3FFIA 1L3TA 1BA1A 1U2VB 3C95A 1D4XA 2Q0UA 2Q1NA 4FWLA 4DV5K 4RW4A 3THXB 3VQ8A 3OBYA 3AVNA 2GV9A 1HNXK 1U6ZA 3QFUA 3V1RA 3K5OA 4ZTJA 4N56A 2QM1A 3SV4A 1NGFA 4FPAA 1QSYA 2UU9K 2UUBK 4CGDA 1WOQA 4CERA 3DRPA 3AA4A 3T1YK 1TAQA 3QDKA 4KBOA 2QWPA 3L3UA 4LSLA 2UYTA 1BGXT 4B1WB 5ADXH 3G4SN 1YJ9N 4B1ZA 3BZCA 4IG3A 4AHSA 3HVTA 3V9XA 4DCHA 3F73A 5C2FA 1ASWA 1C1AA 2FLOA 3BGRA 4J2AA 4NYFA 3G71N 3BF3A 3LZJA 2WOMA 4WQ4A 2EX3A 4DR1K 1TGOA 4G1QA 1WUAA 1NBWA 2ASMA 5TKYA 2HHSA 4JS4A 3O9QA 4GVMA 3JYTA 1BISA 4FK2A 2E2NA 1YXQA 3LDOA 5BRHA 4RTFD 4GMJB 4JLHA 2CH6A 2UXDK 5JMVA 4FM1A 1VQON 3VQAA 1W0HA 1NGCA 2QEXN 3FZMA 1J9AA 1C0FA 4ZTFA 2NRVA 2WTUA 4N41A 1ZXOA 3SYZA 1CZBA 4BVOA 4OLAA 4DSLA 1EXQA 1IBMK 4H0VB 5CY4A 1TV6A 2XO7A 1XI1A 3ATUA 4FCYA 4NO7A 3G6EN 3O9SA 1JL1A 4MQ3A 2WFBA 3NF6A 4IJNA 4CZJA 2NNWA 1RT6A 3M8QA 4EFHA 3ZEUB 3ZSYA 4M3UA 4CJRA 4HWIA 4DHYA 4PUOA 1BWFO 3GE1A 3MEEA 1QHTA 3L6QA 4H4OA 4DKWA 3TU5A 1GLAG 5AQRA 2NZTA 4H4MA 1TKDA 3O4QA 1KFSA 2PYLA 4BR9A 1IBKK 1RDDA 4YFUA 4XIUA 1OVQA 1NGAA 4KI4A 3C65A 4OJRA 4X62K 4PKGA 4CCHA 5AQXA 3VQ6A 4CJQA 2P5OA 1RBTA 3TTFA 1HQUA 4DV4K 3MN6A 4FWPA 3ULEA 4CEAA 1W7AA 4RW8A 4FM2A 1ZBSA 3FZKA 4DU4A 2HOEA 3AARA 4F2RA 1LCUA 3M8SA 3UKRA 3KK2A 3SMPA 3OYJA 3J80O 4L8RB 4KTQA 1E3MA 3R3LA 3HRGA 1HRHA 3HPGA 2FC0A 4E0DA 4O4GA 2HF3A 4CBWA 3SBGA 3BDPA 4E1MA 5E26A 1DTQA 2NUBA 4XEIA 4DV1K 4EP5A 4M3WA 3CETA 1D9FA 3C6UA 5I42A 1NG9A 4F4KA 3K59A 3THWA 4OPAA 4A57A 5EX5A 1BHLA 2O8DA 4JK8A 5JVGL 4Z4IA 2UUAK 1N36K 3KIOA 3VEZA 1S22A 3HT3A 3T3FA 2E20A 3AAPA 5LL6Z 3ID6A 4AHTA 1T6CA 2P5GA 1NMNA 2OYQA 1VSMA 5C42A 1K6YA 2ASOA 4UQGA 1OH5A 4Z4GA 4EIAA 1I3AA 3OYFA 4K0KK 4A61A 4NXMK 3Q7BA 3TARA 4CVNE 3KKSA 2ZWHA 1TK8A 5AQPA 2E2OA 5BPNA 1N34K 1HLUA 1EWQA 3AA5X 1KVBA 3CFPA 4DU1A 1VQNN 4CJSA 1NK5A 1QQNA 2OA8A 1KXPA 4CHOA 3SAHA 1ZBUA 2WBNA 3QO9A 4DSJA 2I7PA 1VQKN 3VEWA 2Q3SA 3TABA 4CJVA 5KGXA 3LWMA 5CZ2A 4JN4A 1NGGA 4MFBA 4CJ4A 4KHUA 2YNGA 3IMXA 1NNEA 4DR7K 4K42A 3LP0A 3MECA 4KV8A 3HYFA 2OTJN 4FJHA 3BF1A 2QW9A 1NK7A 2ZE2A 3D45A 1HKGA 2JLEA 1YUWA 4FSVA 1Z6RA 5C25A 2YHYA 4F3OA 3O4NA 4M7YA 1Q7YO 4CEQA 3V9WA 3ULEB 3I8BA 4CECA 1IBLK 2IOCA 3SAFA 3O80A 4KHPK 5SWMA 2NRRA 3LANA 4DTJA 3O3GA 4Q0BA 3QFPA 1SQKA 4AF1A 3ZETA 4KTZA 4YOUA 2X6NA 3IUCA 1HX1A 2ASPA 2I7NA 2VCPA 1EP4A 2D0CA 2GUPA 4K8ZA 2HSTA 4JAXA 2QXLA 3A2FA 2NRWA 1JLAA 3CJ1A 4F3TA 4JI8K 2HHQA 1CXQA 3LDNA 3THWB 1K8KA 1S9GA 4FOEA 3VTIA 5J2PA 3CCRN 2O8DB 1C1CA 3T7ZA 2IIRA 2Z1JA 3VEOA 3AVAA 3U6FA 1GLDG 1VQ7N 2JGUA 4IFEA 4CFAA 1RT7A 4DLGA 5AZJA 1Z05A 2G8WA 2IGIA 3AVFA 4LF7K 4DMNA 1XUPO 2HBJA 2O8EA 5AQUA 2P9IA 4Z0UA 4AHUA 2WUSA 3G0ZA 3AVBA 1VSIA 1VRUA 2RPIA 4CEOA 5HROA 1LWEA 3M1FA 2P9SA 2QKKA 3DXMA 3SV3A 3ZLJA 1DKGD 2G8IA 1BUPA 1NJWA 1SUQA 4W5RA 4AHCA 4XH4A 3CFRA 3TPQA 4YNQA 3OYGA 2O8FA 2HHVA 2OANA 1BL3A 4H8KA 1ZBHA 3M6GA 4X65K 1G99A 2B6AA 3QNOA 3HSTB 1JXEA 1WN7A 1U47A 1VSLA 3MN9A 1OH7A 2HVHA 4B9QA 3NMUA 4FZYA 2GX9A 3CC4N 4C8MA 1A5VA 2IAJA 2FXUA 3D2EA 3DLBA 3HOTA 4BRCA 3LM9A 1GOCA 4Z4HA 1WAFA 4CIFA 4DSEA 5C12A 4ID5A 3OYCA 1RTDA 3ZETB 3KLGA 4M42A 3FGUA 4OGCA 3I56N 4CGJA 2O8BB 1VK0A 1TK0A 4WQ5A 4BG9A 3U4LA 4LSNA 4GV3A 3FZHA 3CI5A 1TYQB 4E7LA 3IDHA 3EKUA 4BRDA 3NVMA 1P90A 4OKEA 3PV8A 2A1SA 3CJCA 3H1VX 4KFBA 4O5FA 3SLCA 3EY1A 1K8KB 4BDZA 4JI5K 3LDLA 1VQLN 1RCHA 5AQOA 3VOVA 1ASUA 1QQOA 1P8ZA 3EE8A 1HKCA 3FR0A 2OPRA 4DSFA 4IO8A 2GWJA 4ZHRA 5AZJB 1I94K 4KO0A 4DTXA 3PLAA 4H5RA 1BQNA 1X3NA 3MXMA 2O8EB 3WXLA 3ULDA 1WSGA 3QEPA 4JK9A 3LM2A 2P9IB 1IG9A 3VQBA 2FF3B 3M8RA 1YITN 3OS2A 3QEIA 3KLEA 5JS1A 1XNRK 2ZD1A 4K43A 3R6MA 1WNSA 2Q36A 3DXMB 1YVNA 5I3UA 4X66K 4ELUA 4BR7A 4DSIA 2QXFA 3VQ4A 5AR0A 3J7ZO 3O6WA 5CZ1A 3UB5A 2D0AA 1KLNA 3SJHA 3BP8A 3R8EA 3SNNA 1LV5A 3SBTA 3SUPA 3MCAB 4M3XA 3AV9A 1X1PA 1UA1A 1H1VA 1TL3A 5AQJA 2UXCK 2NRTA 4CFDA 2IVOA 4KI6A 2P9UA 3HPOA 3U3GA 1ZBLA 4JK7A 4OKJA 2ZM6K 3OTOK 4IFVA 2AP1A 2D1KA 2WONA 4B8CA 1DGKN 4CZFA 1RDUA 3V1OA 4YDUC 4CF9A 4KRFA 2HVIA 2HHTA 3SJJA 4HUGA 3DOLA 5M1OA 3AVCA 3T1HK 4FL9A 1UAXA 4CFBA 1BIZA 2HNDA 1MWMA 2XY6A 3S9HA 3CCUN 2KQ2A 3B6OA 4DV6K 3L2QA 4CIEA 3THXA 4H5NA 1RBVA 3DLGA 4RCHA 2YHAA 4E7KA 4CJFA 3PX0A 3CMEN 3MEDA 4Z4FA 4FVUA 2EWSA 4J8FA 3KK3A 4CJ5A 1S1VA 4CJPA 1NGIA 4BRPA 3ZT1A 3W0LA 5CR4A 1HNIA 1NK4A 2ITGA 3LP1A 4OVLA 4ELVA 1TVRA 5AQTA 3UIQA 2E6LA 3L0QA 2HBKA 3NCIA 4B3MK 4CFCA 3P4IA 5M1PA 5LMNK 1XHXA 3HXMA 1SL0A 2C1IA 3GOIA 1QVFM 3BUZB 4LF8K 1K9MO 2JWKA 4M3ZA 1SS6A 2O4GA 4CK3A 3WUHA 4LFCK 4WCEL 5IT9O 2ZGZA 5AQLA 4AH9A 1NKEA 3CFOA 4KHYA 1NK9A 3ZX3A 3V6DA 5F1XA 1LAWA 4FJ9A 4JRQA 2YJEA 1K73O 3K0SA 3ZT4A 3TAQA 5JICA 1HYZA 5CE3A 4CGGA 4FM0A 3O1BA 5K14A 4CHPA 4E1JA 1RT3A 2HHIA 3EEQA 2HMIA 4JD2A 4BE2A 4BE1A 3SUQA 2P9UB 4Z94A 5JS2A 2I5JA 3KK1A 3ISNC 3O5BA 3WEEA 4DB3A 3JS6A 5JVHL 1Q9YA 3VA3A 3DRSA 3SMSA 3O1WA 3HJFA 4IDKA 3DLHA 4C23A 2XHBA 4YY3K 3OYEA 1VSFA 4WFAL 1ASVA 4QCLA 3HI0A 4BC2A 3FE1A 3MWPA 1MDUB 3RTVA 4IBNA 4HUEA 3TANA 1KLMA 1UOCA 3ITHA 4Y1DA 4GVEA 5AQMA 5AQYA 3H1QA 3R1XA 3MWTA 1KAYA 1RBRA 3VETA 4CF0A 2A42A 4JKEA 3QNNA 4FWKA 4JI4K 4EP4A 2P9PA 2NRXA 2IC3A 4BR2A 1ATSA 4DQSA 1ILYA 3LDSA 3D6RA 4YOVA 3VESA 4CHZA 1IKVA 4CEDA 5HRPA 1BDGA 5IWAK 5C2DA 4B1YB 3I0RA 3PY8A 2VQFK 3OYKA 2PFUA 4W5TA 5EXWA 1LAVA 2HNZA 4FJIA 2X74A 1M1KO 3D0PA 4ELTA 2D0PA 3J81O 5KQDA 3E9LA 1QQCA 3BZKA 4JKHA 1BIUA 4B3RK 3SQ0A 4CHNA 2QWMA 1QVGM 5HLFA 2FSKA 4H0YB 4J2EA 1CZ9A 4XJXA 4CGFA 4AILC 3ZSOA 4FW1A 4DQ8A 3MCPA 1DT9A 1JLFA 4AQYK 3QBXA 1KCFA 4CZHA 5FPNA 3K9JA 4WFNL 1JL2A 4QAGA 3PSIA 4I9LA 4JHDB 4BDPA 1W9HA 4A62A 3T1AA 4BR4A 1OH6A 5FROA 1YJWN 2HNYA 4PL7A 1UWBA 2VGMA 2YNFA 2QWQA 5FDLA 4FJNA 1NGEA 1HYVA 1LWFA 1VQ8N 3AO4A 4WFBL 4FXDA 2DFHA 4JD2B 3OJSA 3CQXA 3IRXA 3S41A 4BC3A 4RG8A 4C1NK 3BY5A 2LSNA 3VA0A 3PIOL 1VAZA 3WEEB 1XMOK 5LMUK 3CCEN 1ATRA 2YHBA 3PO4A 4EZ9A 3AVIA 3NF8A 5F0XA 2Y1JA 4CZIA 3EN9A 4ILGB 3TI0A 3CF5L 3TR8A 4HHTA 4B3TK 1EX4A 1KRPA 5E84A 1RDAA 4I2QA 4JI2K 3OYLA 4BROA 3WXMB 3AVHA 1SKWA 3CD6N 4W5QA 2P9LB 1NMDA 4IWVA 3VF4A 3OS1A 3CHWA 2KHOA 4BRMA 2P9PB 2Z1HA 2ZGYA 4FJ8A 3LP3A 3K9KA 2BTFA 3U9DA 2GUIA 1FKOA 3LAKA 3C6AA 1X9JA 2YHWA 3KKRA 4JS5A 4FJLA 5BRFA 2E8AA 3SUOA 5FLXO 5AJ3K 3MN5A 4FZXC 3HPHA 3W3DA 3VENA 4TSXA 4YORA 1NU0A 4ILHA 1KSPA 4BRLA 1IKWA 4FWQA 1NOYA 4I6MB 4M3RA 4YOWA 2IS3A 5AQKA 3FZFA 1HR0K 4CD3A 1JXBA 3THYA 1RGIA 3VEXA 2HHWA 4AHRA 2VWBA 1YF5L 4XH5A 2YX6A 3WXJA 4LF4K 4RW9A 2VQEK 3UKUA 4B9LA 1JLBA 3AGRA 4FVMA 4CK1A 3ZSZA 4I9QA 2HB5A 3VQEA 4EZ6A 3TAFA 4AM6A 2YKNA 3L3VA 4F9OA 3E9PA 1ZYQA 3OHRA 5A2QO 1LW0A 3NGZA 3NGIA 3C7NA 2YI1A 5TKWA 5DMRA 1WSFA 5AQQA 4A5BA 3CC2N 4NCBA 2RKIA 4NLCA 2V7YA 4CGHA 2GWKA 1HKBA 5GIPA 2F8TA 1QZ5A 5E41A 4LC9B 3K58A 4B8AB 4BACA 4IOXA 4DLEA 1NK8A 1WBBA 3P39A 4CE9A 3TSUA 3KD1E 1NKCA 3ID8A 1S3XA 3NF7A 4IOAL 3S3MA 4CW7B 2HF4A 2DFEA 1XC3A 1KAZA 3VQCA 3ZCMA 4DQPA 4C1NI 3VMFB 5M1QA 1JCGA 1T05A 3P38A 5JENA 4C8KA 1YTUA 1YTAA 1S6PA 1RDBA 5GIOA 3HM8A 5H1SQ 3B8AX 2D5RA 3CXCM 4CESA 5AQGA 1N33K 4WE1A 2DY4A 4CJUA 3AY9A 4KTWA 2O8BA 2FBVA 3MK6A 3KWGA 4WQ4C 1S1UA 2XY8A 3MX2A 2VG5A 1RT1A 2YV0X 1C0UA 1TYQA 3KVGA 5GAGP 3IAYA 2AJQA 5EY4A 2F96A 1HNWK 3THYB 1OH8A 4FWSA 1JLGA 5DK5A 4CEBA 3ZSQA 4CZKA 1OVYA 1D8YA 5AFUH 1ITGA 3UKUB 1N5YA 5BR8K 1QSSA 4MLEA 3VEVA 4H5WA 2ZF5O 4DF8A 3KZBA 3O8MA 1L5UA 3KHYA 1GLJO 5JLFA 4BRAA 3A5NC 5CHIA 4E7JA 1WAJA 2BH1A 2VWKA 1LWCA 3MX5A 3LL3A 4CJWA 3V4IA 3C7NB 3OJUA 4FWRA 2KFZA 2HHUA 5KRSA 2W6KA 2E1YA 3DI6A 3CPWM 5BN9A 4A59A 4CEZA 2BANA 4FLUA 3NBPA 2XRIA 1VSKA 4MO4A 4BE0A 3QEVA 2P1JA 1U04A 4FJGA 3CYGA 3K57A 2IDOA 1U48A 3LALA 5HOOA 1TKXA 1T7PA 4DV2K 4IEIA 4DQQA 5LJWA 3TSQA 4LFAK 4QS9A 3AAQA 2A5XA 3WXIA 1W97L 1ESVA 3OYIA 2HW3A 1R0AA 4V19S 4MO5A 4CZEA 3RRGA 5C24A 4A5AA 4BREA 3EO3A 3EZ5A 1NGHA 2V52B 3L2WA 4HCBA 3DAWA 1NJIO 1GLFO 4OPKA 3RR8A 3KD5E 3WXKA 1ZBIA 5BR9A 3O3FA 1A5XA 2D0OA 4BDYA 2BE2A 3UE5A 2HHXA 4RW7A 3OYNA 3IS9A 3FFKB 3DLKA 3A5MC 4HTLA 1D9DA 3QEXA 3KLFA 5AQNA 4EHUA 4QS8A 1REVA 5DM7L 1VSEA 3TAPA 4FLZA 4A2AA 3CIPA 3P1GA 1RBSA 1EO1A 3DLLL 3OYMA 4Q5VA 4DTOA 2NLXA 2YJFA 1S1TA 2QTDA 3U9ZA 1FW6A 4JRPA 4E3SA 2F9WA 2QKBA 1X9SA 4O8UA 3V9ZA 4GKKK 2P9NA 3P31A 1YIJN 1X9WA 1YT3A 2BGGA 3NF9A 4MLHA 4E19A 4HTUA 3OW2M 1RT2A 4DS4A 4BE7B 4DTMA 2X78A 1VSHA 3SQ1A 4FOIA 1E4GT 2OZSA 4HCCA 4YOTA 3RSEB 3VEYA 4FK4A 1IH7A 3VN5A 2ATQA 3PO5A 3LPTA 3HOSA 1NJYA 1FJGK 1RILA 3O4WA 3NH0A 3H6EA 5EU7A 5GAHP 3RMCA 4GV6A 1WSJA 4M63C 3QEWA 4IKFA 4OO1J 3AO3A 2G8VA 3J7YP 4M41A 4DFMA 1SL2A 4DU3A 3NGYA 4LF5K 4CBXA 4CHYA 2GEMA 3DOKA 4IZ9A 3VERA 1WBDA 1I39A 3S3OA 4DSKA 3MXJA 2E6MA 3IG1A 4JI1K 4KKOA 4EAHD 1B9FA 4BY9C 1KAXA 2J4RA 3E01A 4NXNK 1VQ5N 4PKHA 2CH5A 4PY5A 1EETA 3O08A 3NVKA 1VQMN 4ISEA 4HUFA 1Z26A 3PX6A 3VQ9A 4BWMA 4BGAA 1L3SA 4FWNA 1D5AA 4E72A 5AQWA 4BGBA 2OPSA 3CPEA 4U67L 2QWRA 4O55A 4FJ7A 2Q31A 2Y1IA 4LD0A 4DG1A 1GLBG 5ELZA 3VQDA 4E89A 5ADXA 4CGIA 5KTQA 3MN7A 3HL8A 3VQ5A 1NK0A 3LPUA 4B1UB 4DR6K 1JLCA 3QIPA 1IJJA 1J5EK 2P9NB 4CZGA 3ENOA 1BQMA 3I0SA 4R5PA 4PKIA 4KHNA 4M3YA 3T69A 1U4BA 2H3GX 4CZLA 3TWHA 1BI4A 3HM9A 5M1KA 4CEEA 4DTUA 1NGJA 1NWKA 1TKZA 4H0XB 5BPMA 4FJ5A 5KGWA 5AZIA 3DWLA 1KTQA 3SCXA 4JKGB 3A8YA 4JHDA 4JKCA 4FWOA 4JKDA 5GAEP 3DJCA 5GINA 4BQZA 3O9RA 3ASMA 1QS4A 4FK0A 4OX9K 4K8XA 1L3UA 3VQ7A 3GG4A 1V4SA 1Y97A 4OKKA 5LJVA 2KTQA 1VSDA 3MMVA 1IKXA 4B3OA 1NKBA 5HBMA 3DMJA 4CF8A 1HQEA 2Z1GA 4NYNA 1V4TA 2GTDA 1YHQN 3O3HA 4KAZA 2B5JA 4H0TB 4DWIA 5AQZA 2VG7A 3DRRA 3F9KA 4CJLA 3G10A 4BRHA 2KW4A 4LY7A 1JKHA 1XMQK 3RVCA 3GBTA 4JI6K 3ZSWA 5CYQA 2PAVA 4WQ5C 3HK2A 2P9LA 1TUYA 4EHTA 1EKEA 4E7HA 3HVRA 2F8SA 4W5NA 3F5TA 4IOCL 2RF2A 2ETJA 4Y0WA 1EQYA 1QZ6A 3HZ6A 1KFDA 3QICA 1C0TA 3VTHA 3CQ8A 5KI6A 3PX4A 4XH1A 3SQ2A 1CXUA 3E66A 2E2PA 3TTDA 2BUPA 1JCEA 2QWOA 4CK2A 4MDAA 3T19A 4BR5A 3ZSVA 3KJVA 3J7AP 3G25A 3VF2A 3Q7CA 1C0MA 1TKTA 1EWRA 1FK9A 3O9UA 2RN2A 3I55N 4IEEA 3VQPA 3C6TA 3V9UA 5SZTA 5KPRA 4I6MA 4M3TA 1X9MA 4FWMA 3C0BA 2E88A 3NH2A 3K2PA 3CYMA 1BI4B 5T7BA 2A40A 3R9PA 5FPEA 2D0BA 3CM6A 1RT5A 4QOZB 1NLVA 5AZIB 4OPJA 1KVAA 4M45A 1G15A 3CCQN 3ZT0A 1HJOA 4CF2A 5KPTA 1N8RO 4ILJA 3AO1A 2BDPA 2KZMA 3NDKA 3DLEA 1Q18A 4MDBA 5AQIA 3ZT2A 4CZMA 1S72N 2QA4N 4M7XA 2YNIA 3AVGA 1RTJA 2VYPA 4ICLA 5M1FA 4O0IA 1S9EA 3D7EO 4GV9A 4KH5A 4DF4A 5DM6L 3NE6A 3AVLA 3EZWA 4IDHA 3ZSRA 1J5OA 4N76A 3AA2A 3VF6A 2G8HA 4CJTA 4B9NA 1IO2A 1VRTA 4N47A 2QI2A 1JLEA 3M3ZA 4LF6K 1FXXA 3M5RA 1JJ2M 4JNEA 2P9KA 3CJ9A 1NOZA 3L2VA 1SAZA 4O8KA 2CGKA 3EE9A 2ITMA 1QE1A 2CGLA 3C94A 4GNIA 3LDPA 1O13A 3D2FB 3WNGA 3KLHA 3QETA 5FRMA 1OKJA 2PY5A 3WNFA 3K5LA 2VGNA 4LH4A 2G8FA 1Q9XA 3LDQA 3O9TA 3THVA 3TAMA 3RR7A 4IJAA 1RDWX 3DM2A 4FJMA 3AA3A 3LZIA 4YHHK 4DUZK 2FBXA 4J2DA 1BCMA 1JLQA 2FBYA 2V7ZA 4H0OA 2DFFA 2WC9A 4F2SA 3IKMA 5HRNA 2W40A 2OZMA 4CF1A 3MXIA 4CHQA 2JWLA 1CLQA 3H45C 4OGEA 4BWJA 1MWKA 4PA1A 1GLLO 3GL1A 1LOTB 4C8LA 4PWDA 3WQUA 3VPZA 2HHHK 3VGLA 1BOTO 1MU2A 3QIOA 1RNHA 3AO2A 3TAGA 4KHWA 1HMVA 3V81A 5HP1A 3LWLA 4NB4A 3LP2A 3J8AA 3OYBA 3HBTA 5AFUA 2QWLA 4BVPA 1T6DA 2X6SA 3CM5A 4E7IA 1VHXA 3SQ4A 3WT0A 2Z1IA 3A0IX 3AO5A 3DXKA 2YCHA 1DLOA 4H5TA 4FLXA 4DR3K 1TL1A 3L2RA 4JI7K 2PBDA 3CQYA 4AHVA 2AA4A 2Q97A 2W42A 3KWIA 4BR0A 4CBUA 5BN8A 3CJ7A 3HTVA 3WNHA 4JV5K 4NCAA 3VGMA 3E9OA 4BRGA 1HYSA 5GADP 5C10A 3TTCA 3AVMA 2CGJA 4U7BA 4FPBA 1LW2A 2P9KB 3CCVN 1T8EA 2A1RA 1GLEG 1J53A 4RWTA 3RMDA 3NHGA 1NJZA 1XNQK 3A5LC 4DV0K 1TUUA 4B9SA 3MDQA 3ENHA 3QB0A 4FLTA 5KQ8A 2KZZA 1GLCG 2IVPA 1KD1O 3U8XA 2ZJRL 4GKJK 1A5WA 2YKMA 4DR5K 2W41A 4ID1A 3B6PA 4FYDA 4BECA 3NFAA 3HO1A 4CEFA 2HBLA 1TAUA 2Q0RA 2G8UA 2E4LA 4B1VA 2HBMA 1KC8O 4LFBK 3CG7A 5AQFA 2FBTA 1N32K 3QERA 4JKAA 2HMPA 1U45A 1YVUA 4DUYK 2QWNA 3KK7A 1B9DA 2GBZA 2ZQBA 4CI6A 3ATVA 3F2KA 1ATNA 1VQ9N 4PQUA 3N4QA 1ZBFA 4ISFA 3TAEA 3L8BA 4YDUA 4C8OA 5M1NA 3QESA 1HUXA 4BC4A 1SL1A 3UKRB 3DLRA 4B9TA 1QHAA 4BRNA 3EKSA 4O0JA 4DS5A 3PIPL 1JCFA 1L3VA 1FKPA 2FSJA 4CJ7A 4JI3K 3OS0A 2O4IA 1N6QA 5FPMA 4B9UA 4BQLA 3KLIA 3DXKB 4JKBA 2OCEA 3AVJA 4E1NA 3ZT3A 3MAQA 1WSIA 4RW6A 2KFNA 3S3NA 4N5SA 1YI2N 3VQQA 4DR4K 1WLJA 5AQSA 4PHTX 2GELA 4O44A 3ZX0A 1J54A 1R59O 3RSEA 1KQSM 3CJBA 1NJXA 1J6ZA 3KTQA 3OA9A 1GOAA 3I33A 3QMLA 1CZAN 2IVNA 1HJRA 3LAMA 3OYHA 1S1WA 4DFKA 3ZSXA 1Q82O 1BA0A 2A6AA 3MEGA 2ZJQL 3JSMA 1X3MA 5EOYA 1WSEA 1DEJA 3RRHA 4FJKA 3U3YA 2VWJA 1VQ6N 4IO9L 1NGBA 5KPZA 1KVCA 2FSNA 3VGKA 2YHXA 2OPPA 3H3NO 1Z25A 3OY9A 5AQVA 4FO0A 2C1GA 1XHZA 2RE2A 3S5TA 3SK3A 4ISGA 5HRSA 5J1EA 1F21A 5EVZA 3ALYA 1UA0A 1VQ4N 4IG0A 1QQMA 5BREA 2NRHA 4Y1CA 2E2QA 2DTUA 2UUCK 2UXBK 4QS7A 3HP6A 1RTIA 3CMAN 4C8NA 4FJXA 1VSJA 1Y64A 4G9ZA 2PZSA 1C6VA 1IKYA 3FLCO 1BG3A 3L4IA 4YOXA 3PUFA 4B1XB 3ENBA 3HP9A 3WNEA 4CJKA 4F8RA 3H08A 1YJNN 1HPMA 3C6HA 4KH4A 3ZYYX 3SI6A 3L4QA 5JLHA 3SPZA 1GOBA 1XWLA 1VQPN 3L2UA 1MA9B 1U49A 4FW2A 4OLBA 1IV0A 4JEPA 3RMBA 4J2BA 1RBUA 4I7FA 2E1ZA 2W6LA 4A2BA 2W00A 4CJEA 5LY3A 4FLYA 2XY7A 3JAMO 5HL7L 4BG8A 5HRRA 5F2RA 4DV3K 4CJ3A 1T3VA 1BU6O 4H03B 3SPYA 2EHGA 4LH5A 2F4VK 1IG8A 5J2QA 5FRNA 1RTHA 1HNZK 3H3OB 1RFQA 2VG6A 2RHKA 1Q8IA 4NCGA 4JKGA 2QK9A 1S5JA 4W5OA 3EL2A 2A3ZA 4DTSA 1HNVA 1B92A 2KLAA 2B4JA 3NAEA 3P83D 3NH1A 4BC5A 1SZ2A 3CCSN 2P9SB 4B3SK 4GY2B 4BRIA 3F9MA 3CCLN 1T44A 3CC7N 5C0YA 2O8CA 4UY8O 4GW6A 3DYAA 3M8PA 3BEXA 1BCOA 3JXUA 4FLWA 2F9TA 2YNHA 4L3QA 4B08A 4KHQA 1NK6A 1SV5A 3AGKA 4FJJA 3RWUA 2O8FB 4R79A 3CERA 1T03A 1C1BA 1XQSC 3CJAA 1NM1A 4K41A 2PYJA 4WF9L 3K5NA 2R7YA 3SAGA 1TK5A 4DFPA 2P51A 5J2NA 4DTPA 1RDCA 3P5JA 3D2EB 3OYDA 4Z4CA
chains in the Genus database with same CATH topology
5KPRA 4OPHA 5B8HA 4I6MA 4K25A 4YOYA 4FWMA 3C0BA 2OANA 2E88A 2F7TA 4AM6A 4F9OA 3E9PA 3M6GA 1U2VA 1G99A 2A40A 3OHRA 3R9PA 1BO5O 3TSPA 2DPNA 3C7NA 4IXCA 4AM7A 5FPEA 2YI1A 1NLVA 3E1YA 5TKWA 2D4WA 3MN9A 3GDQA 5AZIB 4B9QA 3CCQN 5AQQA 4A5BA 3NMUA 3CC2N 2GX9A 1HJOA 3CC4N 4NLCA 2V7YA 3A5OC 4BRKA 5KPTA 1N8RO 2GWKA 1HKBA 4ILJA 5GIPA 1QZ5A 4LC9B 1Q18A 4MDBA 5AQIA 4CZMA 4IOXA 3CCMN 2FXUA 3D2EA 4M7XA 2QA4N 1S72N 3HOTA 4BRCA 3P39A 3LM9A 3TSUA 2VYPA 5BPLA 5C12A 5M1FA 3ID8A 3ZETB 1K8AO 1S3XA 3D7EO 4IOAL 4GV9A 4KH5A 3FGUA 3HSCA 3IFRA 5DM6L 3EZWA 2HF4A 4IDHA 3OBWA 3I56N 3VF6A 1C0GA 2ZJPL 1XC3A 2KKZA 4WQ5A 1KAZA 5AQHA 5C15A 4BG9A 3U4LA 4C1NI 3VMFB 4GV3A 3FZHA 3CI5A 2QI2A 3M3ZA 1TYQB 5M1QA 3M5RA 3IDHA 3EKUA 1JCGA 4BRDA 3NVMA 2A41A 3P38A 4JNEA 1P90A 1JJ2M 2P9KA 2V51B 3CJ9A 4NLBA 1SAZA 4O8KA 1Q86O 3CJCA 3H1VX 4O5FA 2CGKA 3SLCA 1K8KB 3FZLA 5GIOA 3LDLA 1VQLN 3HM8A 3EE9A 2ITMA 2CGLA 4PL8A 5AQOA 3B8AX 3VOVA 1QQOA 3EE8A 1P8ZA 4GNIA 1HKCA 3FR0A 1O13A 3LDPA 4WYBA 3D2FB 4BRQA 1Q81O 4IO8A 3H46O 5AQGA 2GWJA 3WQTA 5FPDA 5H1SQ 1OKJA 3AY9A 5AZJB 2VGNA 3CXCM 3PLAA 4H5RA 3MK6A 3KWGA 4WQ4C 4BRFA 1X3NA 4CD1A 3LDQA 3O9TA 3MX2A 3WXLA 4BEBA 4IJAA 1RDWX 1TYQA 3CCJN 3KVGA 4JK9A 3LM2A 2OTLN 2P9IB 4KH6A 5GAGP 2FF3B 1YITN 1YAGA 4H0PA 5I9EB 4K43A 5EY4A 5BRDA 3R6MA 3N4PA 2V7ZA 4H0OA 2Q36A 3DXMB 1NGDA 1YVNA 4FWSA 4JKFA 2FF6A 2WC9A 3D2FA 3ZX2A 3IKMA 1ZC6A 3QBWA 2W40A 1OVYA 4BR7A 4CZKA 1E4FT 5AR0A 3J7ZO 2JWLA 3H45C 3O6WA 5AFUH 3UB5A 3UKUB 1MWKA 1GLLO 5MLCQ 3SJHA 3GL1A 2NRZA 1W2BM 3ZEUA 1LOTB 4MLEA 3BP8A 3R8EA 3VEVA 3WQUA 3VPZA 4H5WA 2ZF5O 3SBTA 4H5VA 3VGLA 3KZBA 1BOTO 3MCAB 3O8MA 3KHYA 2Q2RA 1GLJO 1M90O 5JLFA 4BRAA 1H1VA 3A5NC 5AQJA 5CHIA 2NRTA 1BA1A 1U2VB 2IVOA 2BH1A 1D4XA 2P9UA 2Q0UA 4JK7A 3MX5A 2Q1NA 3LL3A 4FWLA 4NB4A 3J8AA 3C7NB 2AP1A 2D1KA 4FWRA 3OBYA 3HBTA 5AFUA 2QWLA 4BVPA 2E1YA 1T6DA 1U6ZA 1DGKN 4CZFA 3CPWM 5BN9A 4A59A 3QFUA 1RDUA 3WT0A 2QM1A 1NGFA 4FPAA 3DXKA 3A0IX 4YDUC 2YCHA 4MO4A 1WOQA 4H5TA 2PBDA 5M1OA 3CQYA 3QDKA 4FL9A 2QWPA 4KBOA 2UYTA 4B1WB 5ADXH 2AA4A 3G4SN 1YJ9N 2Q97A 3KWIA 5HOOA 4BR0A 4B1ZA 4CBUA 5BN8A 1MWMA 3CCUN 3CJ7A 4IEIA 5LJWA 3TSQA 3HTVA 4DCHA 4QS9A 3AAQA 2A5XA 4H5NA 3WXIA 1W97L 3VGMA 5C2FA 1ESVA 2FLOA 4RCHA 3E9OA 4MO5A 4BRGA 4CZEA 5GADP 5C10A 3G71N 3BF3A 4BREA 4A5AA 4WQ4A 3TTCA 3EO3A 2CGJA 4U7BA 3CMEN 4FPBA 1WUAA 2P9KB 1NGHA 1NBWA 3CCVN 2EWSA 2ASMA 4J8FA 2V52B 5TKYA 4FVUA 3O9QA 1GLEG 3DAWA 4RWTA 1NJIO 1NGIA 4BRPA 2E2NA 3A5LC 3W0LA 1GLFO 1TUUA 1YXQA 3MDQA 5CR4A 3ENHA 3LDOA 5BRHA 3QB0A 3WXKA 5KQ8A 4RTFD 5BR9A 1GLCG 2IVPA 1KD1O 2CH6A 3U8XA 2ZJRL 2D0OA 5JMVA 2W41A 1VQON 3UE5A 5AQTA 1NGCA 4BECA 3L0QA 2HBKA 2QEXN 2HBLA 3FFKB 3FZMA 3P4IA 5M1PA 3A5MC 2Q0RA 1C0FA 4HTLA 2NRVA 3GOIA 2C1IA 1QVFM 4B1VA 2HBMA 5AQNA 1ZXOA 4EHUA 3BUZB 4QS8A 1KC8O 5DM7L 1K9MO 2JWKA 4BVOA 4A2AA 1SS6A 3CIPA 3WUHA 5AQFA 4WCEL 2ZGZA 4H0VB 1EO1A 3DLLL 5AQLA 4JKAA 2HMPA 3ATUA 2NLXA 2YJFA 2QTDA 2QWNA 4NO7A 3G6EN 3KK7A 3O9SA 3U9ZA 3ZX3A 2WFBA 5F1XA 2F9WA 4CI6A 3ATVA 3F2KA 1ATNA 4IJNA 1VQ9N 4CZJA 2YJEA 2NNWA 3N4QA 1K73O 4O8UA 5JICA 4EFHA 3ZEUB 4ISFA 5CE3A 2P9NA 4HWIA 3P31A 4DHYA 1YIJN 1BWFO 3O1BA 4YDUA 5M1NA 4E1JA 3GE1A 4MLHA 1HUXA 3L6QA 4BC4A 4DKWA 3OW2M 4JD2A 3UKRB 3TU5A 1GLAG 5AQRA 2NZTA 4BE7B 2P9UB 4Z94A 1QHAA 3O5BA 4BRNA 4BR9A 3EKSA 4FOIA 1E4GT 3PIPL 3WEEA 4YOTA 3JS6A 1JCFA 1NGAA 3RSEB 4DB3A 3VEYA 3C65A 5JVHL 2FSJA 4PKGA 4CJ7A 5AQXA 3SMSA 3O1WA 3HOSA 5FPMA 3O4WA 4BQLA 3DXKB 4JKBA 3H6EA 3TTFA 4C23A 5GAHP 3MN6A 4FWPA 3ULEA 4GV6A 4WFAL 4M63C 4OO1J 3HI0A 4BC2A 3FE1A 1ZBSA 3FZKA 3MWPA 2HOEA 3AARA 1MDUB 1LCUA 1YI2N 3UKRA 3SMPA 3R3LA 5AQSA 4CBXA 3HRGA 2GEMA 4PHTX 4GVEA 5AQMA 5AQYA 2GELA 3H1QA 3R1XA 4IZ9A 3MWTA 1KAYA 3VERA 3VETA 3ZX0A 1R59O 3RSEA 2A42A 4JKEA 2HF3A 4FWKA 3CJBA 3SBGA 4CBWA 1KQSM 1J6ZA 3OA9A 5E26A 2P9PA 2NRXA 4XEIA 3I33A 3QMLA 1CZAN 2IVNA 3CETA 1ATSA 4BR2A 1ILYA 4EAHD 3D6RA 4YOVA 4BY9C 4OPAA 1KAXA 2J4RA 3VESA 4A57A 5EX5A 3CF5L 4PKHA 2CH5A 1VQ5N 1Q82O 1BA0A 1BDGA 3O08A 4JK8A 2A6AA 5JVGL 1VQMN 3NVKA 4ISEA 5C2DA 3VEZA 1S22A 4B1YB 2ZJQL 4BGAA 1X3MA 2E20A 2PFUA 3AAPA 4FWNA 5EOYA 3ID6A 1DEJA 5AQWA 1T6CA 5EXWA 1VQ6N 4BGBA 4IO9L 1M1KO 1NGBA 5KPZA 3CPEA 2D0PA 2FSNA 2ASOA 2YHXA 3VGKA 4U67L 3H3NO 2C1GA 5AQVA 2QWRA 4FO0A 4EIAA 5KQDA 2RE2A 3E9LA 2Q31A 3SK3A 4A61A 4JKHA 3Q7BA 4ISGA 2ZWHA 1GLBG 5ELZA 2QWMA 5AQPA 2E2OA 5BPNA 1QVGM 1HLUA 5ADXA 2FSKA 4H0YB 5EVZA 1VQ4N 1VQNN 4XJXA 1QQNA 1QQMA 3MN7A 5BREA 1KXPA 2NRHA 4DQ8A 2E2QA 3MCPA 1DT9A 3QBXA 4QS7A 4CZHA 3SAHA 5FPNA 3K9JA 4WFNL 2WBNA 3CMAN 1Y64A 4JHDB 4B1UB 4A62A 4BR4A 4G9ZA 2I7PA 3FLCO 3L4IA 1BG3A 4YOXA 1VQKN 4B1XB 3VEWA 3ENBA 1YJWN 4PL7A 1IJJA 2VGMA 2P9NB 2QWQA 4CZGA 3ENOA 1YJNN 1NGEA 1HPMA 3C6HA 4KH4A 3ZYYX 4JN4A 4PKIA 1NGGA 3T69A 1VQ8N 2H3GX 4WFBL 4CZLA 3L4QA 4JD2B 3IMXA 5JLHA 3CQXA 5M1KA 3S41A 1NGJA 4K42A 4BC3A 1NWKA 4H0XB 4C1NK 5BPMA 5AZIA 1VQPN 2OTJN 3DWLA 1VAZA 3BF1A 2QW9A 3WEEB 3PIOL 3CCEN 1MA9B 1ATRA 1HKGA 3A8YA 4JHDA 4JKGB 4JEPA 4JKCA 5F0XA 1YUWA 4FSVA 4FWOA 2E1ZA 1Z6RA 4CZIA 2YHYA 4A2BA 3EN9A 4ILGB 2W00A 4M7YA 5LY3A 1Q7YO 4JKDA 3ULEB 3I8BA 3DJCA 5GAEP 4BG8A 5HL7L 3SAFA 5GINA 3O80A 4BQZA 3O9RA 5F2RA 2NRRA 5E84A 1T3VA 1BU6O 3QFPA 1SQKA 4H03B 4AF1A 4BROA 3ZETA 3WXMB 4YOUA 3IUCA 1HX1A 2ASPA 1IG8A 3GG4A 1V4SA 2I7NA 3H3OB 3CD6N 1RFQA 2VCPA 5LJVA 2P9LB 1NMDA 2RHKA 3MMVA 4IWVA 3VF4A 2GUPA 2HSTA 3CHWA 4JAXA 2KHOA 4JKGA 2QXLA 4BRMA 2P9PB 3EL2A 2NRWA 2ZGYA 2A3ZA 3CJ1A 1V4TA 2GTDA 1YHQN 2KLAA 3K9KA 2BTFA 3LDNA 4H0TB 5AQZA 1K8KA 4FOEA 3TPQA 3VTIA 4BC5A 1SZ2A 3CCRN 3CCSN 2P9SB 4GY2B 3U9DA 4BRHA 4BRIA 3F9MA 3T7ZA 3CCLN 3RVCA 2IIRA 1T44A 3GBTA 3CC7N 3C6AA 1X9JA 2YHWA 3VEOA 1GLDG 5C0YA 1VQ7N 4UY8O 4IFEA 5BRFA 2PAVA 2E8AA 3BEXA 3JXUA 4WQ5C 5AZJA 2P9LA 1TUYA 4EHTA 2F9TA 1Z05A 3F5TA 4L3QA 4IOCL 3MN5A 1XUPO 2HBJA 3W3DA 3VENA 3AGKA 4YORA 4ILHA 4Y0WA 5AQUA 1EQYA 2P9IA 4BRLA 4FWQA 2WUSA 4I6MB 1QZ6A 3HZ6A 3QICA 4YOWA 5AQKA 4R79A 3FZFA 3CERA 3VTHA 4CD3A 3M1FA 1RGIA 2P9SA 3VEXA 4XH1A 1XQSC 3DXMA 1DKGD 3CJAA 3E66A 2E2PA 1NM1A 2VWBA 1BUPA 4K41A 3TTDA 2BUPA 1JCEA 2QWOA 1YF5L 4WF9L 4MDAA 2YX6A 4XH5A 4BR5A 3WXJA 3SAGA 3G25A 4XH4A 3VF2A 3Q7CA 3UKUA 3O9UA 3I55N 4IEEA 3D2EB 3AGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KPR A;  5B8H A;  4I6M A;  4K25 A;  4FWM A;  3C0B A;  2OAN A;  2E88 A;  4AM6 A;  4F9O A;  3M6G A;  1U2V A;  1G99 A;  2A40 A;  3OHR A;  3R9P A;  1BO5 O;  2DPN A;  3C7N A;  4IXC A;  4AM7 A;  5FPE A;  2YI1 A;  1NLV A;  2D4W A;  3MN9 A;  3GDQ A;  5AZI B;  4B9Q A;  5AQQ A;  1HJO A;  4BRK A;  2V7Y A;  3A5O C;  5KPT A;  2GWK A;  1HKB A;  1QZ5 A;  4LC9 B;  1Q18 A;  5AQI A;  4CZM A;  2FXU A;  3D2E A;  4M7X A;  4BRC A;  3LM9 A;  2VYP A;  5BPL A;  3ID8 A;  3ZET B;  1S3X A;  3D7E O;  3FGU A;  3HSC A;  3IFR A;  3EZW A;  2HF4 A;  3VF6 A;  1C0G A;  1XC3 A;  4WQ5 A;  1KAZ A;  5AQH A;  4BG9 A;  3U4L A;  3FZH A;  3CI5 A;  3M3Z A;  1TYQ B;  3IDH A;  3EKU A;  1JCG A;  4BRD A;  2A41 A;  4JNE A;  2P9K A;  3CJ9 A;  2V51 B;  1SAZ A;  4O8K A;  3CJC A;  3H1V X;  4O5F A;  2CGK A;  3SLC A;  1K8K B;  3FZL A;  3LDL A;  3HM8 A;  2ITM A;  2CGL A;  4PL8 A;  5AQO A;  3B8A X;  3VOV A;  1QQO A;  4GNI A;  1P8Z A;  4WYB A;  1HKC A;  3FR0 A;  3LDP A;  4BRQ A;  3D2F B;  4IO8 A;  3H46 O;  5AQG A;  2GWJ A;  3WQT A;  5FPD A;  1OKJ A;  3AY9 A;  5AZJ B;  4H5R A;  3MK6 A;  4BRF A;  4WQ4 C;  4CD1 A;  1X3N A;  3LDQ A;  3WXL A;  4IJA A;  1RDW X;  1TYQ A;  3KVG A;  3LM2 A;  2P9I B;  2FF3 B;  1YAG A;  4H0P A;  5I9E B;  4K43 A;  5EY4 A;  5BRD A;  3R6M A;  2V7Z A;  4H0O A;  2Q36 A;  3DXM B;  1NGD A;  1YVN A;  4FWS A;  3ZX2 A;  2FF6 A;  3D2F A;  1ZC6 A;  3QBW A;  2W40 A;  4BR7 A;  4CZK A;  1E4F T;  5AR0 A;  3H45 C;  3O6W A;  5AFU H;  3UB5 A;  3UKU B;  1MWK A;  1GLL O;  3SJH A;  3GL1 A;  3ZEU A;  1LOT B;  4MLE A;  3BP8 A;  3R8E A;  3VEV A;  3WQU A;  3VPZ A;  4H5W A;  2ZF5 O;  3VGL A;  4H5V A;  3KZB A;  1BOT O;  3O8M A;  3KHY A;  2Q2R A;  1GLJ O;  5JLF A;  4BRA A;  1H1V A;  3A5N C;  5AQJ A;  1BA1 A;  1U2V B;  2IVO A;  2P9U A;  1D4X A;  2Q0U A;  2Q1N A;  3LL3 A;  4FWL A;  4NB4 A;  3J8A A;  3C7N B;  2AP1 A;  2D1K A;  4FWR A;  3HBT A;  5AFU A;  2QWL A;  4BVP A;  2E1Y A;  1T6D A;  1U6Z A;  1DGK N;  4CZF A;  5BN9 A;  3QFU A;  3WT0 A;  2QM1 A;  1NGF A;  4FPA A;  3DXK A;  3A0I X;  4YDU C;  2YCH A;  4MO4 A;  1WOQ A;  4H5T A;  2PBD A;  3CQY A;  3QDK A;  4FL9 A;  2QWP A;  4KBO A;  2UYT A;  4B1W B;  5ADX H;  2AA4 A;  2Q97 A;  4BR0 A;  4B1Z A;  4CBU A;  5BN8 A;  1MWM A;  3CJ7 A;  5LJW A;  3HTV A;  4DCH A;  4QS9 A;  3AAQ A;  2A5X A;  4H5N A;  3WXI A;  3VGM A;  1ESV A;  2FLO A;  4RCH A;  4MO5 A;  4BRG A;  4CZE A;  3BF3 A;  4BRE A;  4WQ4 A;  3EO3 A;  2CGJ A;  4FPB A;  1WUA A;  2P9K B;  1NGH A;  1NBW A;  2EWS A;  2ASM A;  4J8F A;  2V52 B;  5TKY A;  1GLE G;  3DAW A;  4RWT A;  1NGI A;  4BRP A;  2E2N A;  3A5L C;  3W0L A;  1GLF O;  1TUU A;  1YXQ A;  3MDQ A;  3ENH A;  3LDO A;  5BRH A;  3QB0 A;  3WXK A;  5KQ8 A;  4RTF D;  5BR9 A;  1GLC G;  2IVP A;  2CH6 A;  3U8X A;  2D0O A;  5JMV A;  2W41 A;  3UE5 A;  5AQT A;  1NGC A;  3L0Q A;  3FFK B;  3FZM A;  3P4I A;  3A5M C;  2Q0R A;  1C0F A;  4HTL A;  3GOI A;  4B1V A;  5AQN A;  4EHU A;  1ZXO A;  3BUZ B;  4QS8 A;  4BVO A;  4A2A A;  3CIP A;  3WUH A;  5AQF A;  2ZGZ A;  4H0V B;  5AQL A;  2HMP A;  3ATU A;  2NLX A;  2YJF A;  2QWN A;  4NO7 A;  3U9Z A;  3ZX3 A;  5F1X A;  2F9W A;  4CI6 A;  3ATV A;  1ATN A;  4IJN A;  4CZJ A;  2YJE A;  5JIC A;  4EFH A;  3ZEU B;  4ISF A;  5CE3 A;  2P9N A;  4HWI A;  4DHY A;  1BWF O;  3O1B A;  4YDU A;  4E1J A;  3GE1 A;  4MLH A;  1HUX A;  3L6Q A;  4BC4 A;  4JD2 A;  3UKR B;  3TU5 A;  1GLA G;  5AQR A;  2NZT A;  2P9U B;  4Z94 A;  1QHA A;  3O5B A;  4BRN A;  4BR9 A;  3EKS A;  4FOI A;  1E4G T;  3WEE A;  4DB3 A;  3JS6 A;  1JCF A;  1NGA A;  3RSE B;  3VEY A;  2FSJ A;  4PKG A;  4CJ7 A;  5AQX A;  3SMS A;  3O1W A;  5FPM A;  3O4W A;  4BQL A;  3DXK B;  3H6E A;  4C23 A;  3MN6 A;  4FWP A;  3ULE A;  4M63 C;  3HI0 A;  4BC2 A;  3FE1 A;  1ZBS A;  3FZK A;  2HOE A;  3AAR A;  1MDU B;  1LCU A;  3UKR A;  3SMP A;  4CBX A;  5AQS A;  2GEM A;  5AQM A;  5AQY A;  2GEL A;  3H1Q A;  4IZ9 A;  1KAY A;  3VER A;  3VET A;  3ZX0 A;  1R59 O;  3RSE A;  2A42 A;  2HF3 A;  4FWK A;  3CJB A;  4CBW A;  1J6Z A;  5E26 A;  2P9P A;  4XEI A;  3I33 A;  3QML A;  1CZA N;  2IVN A;  3CET A;  1ATS A;  4BR2 A;  4EAH D;  1KAX A;  2J4R A;  3VES A;  5EX5 A;  4PKH A;  2CH5 A;  1BA0 A;  1BDG A;  3O08 A;  2A6A A;  4ISE A;  3VEZ A;  1S22 A;  4B1Y B;  4BGA A;  1X3M A;  2E20 A;  3AAP A;  4FWN A;  5EOY A;  1DEJ A;  5AQW A;  1T6C A;  5EXW A;  4BGB A;  1NGB A;  5KPZ A;  2D0P A;  2FSN A;  2ASO A;  2YHX A;  3VGK A;  3H3N O;  5AQV A;  2QWR A;  4FO0 A;  4EIA A;  5KQD A;  4A61 A;  2Q31 A;  3SK3 A;  4ISG A;  2ZWH A;  1GLB G;  5ELZ A;  2QWM A;  5AQP A;  2E2O A;  5BPN A;  1HLU A;  5ADX A;  2FSK A;  4H0Y B;  5EVZ A;  1QQN A;  1QQM A;  3MN7 A;  5BRE A;  1KXP A;  2NRH A;  4DQ8 A;  2E2Q A;  3MCP A;  3QBX A;  4QS7 A;  4CZH A;  5FPN A;  1Y64 A;  4JHD B;  4B1U B;  4A62 A;  4BR4 A;  2I7P A;  3FLC O;  3L4I A;  1BG3 A;  4B1X B;  3VEW A;  4PL7 A;  1IJJ A;  2P9N B;  2QWQ A;  4CZG A;  3ENO A;  1NGE A;  1HPM A;  4JN4 A;  4PKI A;  1NGG A;  2H3G X;  4CZL A;  4JD2 B;  3IMX A;  5JLH A;  3CQX A;  3S41 A;  1NGJ A;  4K42 A;  4BC3 A;  1NWK A;  4H0X B;  5BPM A;  5AZI A;  3DWL A;  3BF1 A;  2QW9 A;  3WEE B;  1MA9 B;  1ATR A;  1HKG A;  3A8Y A;  4JHD A;  5F0X A;  1YUW A;  4FSV A;  4FWO A;  2E1Z A;  1Z6R A;  4CZI A;  2YHY A;  4A2B A;  3EN9 A;  4M7Y A;  5LY3 A;  3ULE B;  3I8B A;  3DJC A;  4BG8 A;  3O80 A;  4BQZ A;  5F2R A;  5E84 A;  3QFP A;  1BU6 O;  4H03 B;  1SQK A;  4BRO A;  3ZET A;  3IUC A;  1HX1 A;  2ASP A;  1IG8 A;  3GG4 A;  1V4S A;  2I7N A;  3H3O B;  1RFQ A;  2VCP A;  5LJV A;  2P9L B;  1NMD A;  3MMV A;  4IWV A;  3VF4 A;  2GUP A;  3CHW A;  4JAX A;  2KHO A;  4BRM A;  2QXL A;  2P9P B;  3EL2 A;  2ZGY A;  2A3Z A;  3CJ1 A;  1V4T A;  2GTD A;  3LDN A;  2BTF A;  4H0T B;  5AQZ A;  1K8K A;  4FOE A;  4BC5 A;  1SZ2 A;  2P9S B;  4GY2 B;  3U9D A;  4BRH A;  4BRI A;  3F9M A;  2IIR A;  1T44 A;  3GBT A;  1X9J A;  2YHW A;  3VEO A;  1GLD G;  5BRF A;  2PAV A;  2E8A A;  3BEX A;  3JXU A;  4WQ5 C;  5AZJ A;  2P9L A;  1TUY A;  4EHT A;  2F9T A;  1Z05 A;  4L3Q A;  3MN5 A;  1XUP O;  3W3D A;  3VEN A;  4Y0W A;  5AQU A;  1EQY A;  2P9I A;  4BRL A;  4FWQ A;  2WUS A;  4I6M B;  1QZ6 A;  3HZ6 A;  3QIC A;  5AQK A;  3FZF A;  3CER A;  4CD3 A;  3M1F A;  1RGI A;  2P9S A;  3VEX A;  4XH1 A;  1XQS C;  3DXM A;  1DKG D;  3CJA A;  2E2P A;  1NM1 A;  2VWB A;  1BUP A;  4K41 A;  2BUP A;  1JCE A;  2QWO A;  4XH5 A;  4BR5 A;  3WXJ A;  3G25 A;  4XH4 A;  3VF2 A;  3UKU A;  3D2E B;  3TPQ A; 
#chains in the Genus database with same CATH topology
 4OPH A;  5B8H A;  4K25 A;  1WB9 A;  3I8D A;  4KB1 A;  4YOY A;  2OPQ A;  2F7T A;  4FZZ A;  1U2V A;  1BO5 O;  3TSP A;  4FLV A;  2DPN A;  4IXC A;  4AM7 A;  3E1Y A;  2D4W A;  4Z4E A;  3GDQ A;  3PSF A;  4DR2 K;  1SKS A;  4DV7 K;  4BRK A;  3A5O C;  3CCM N;  5J2M A;  5CYM A;  1XC9 A;  4B9V A;  4DTN A;  3OVN A;  5BPL A;  1K8A O;  4LF9 K;  4KB0 A;  4O5B A;  3K5M A;  3HSC A;  3IFR A;  4CIG A;  3OBW A;  1C0G A;  2ZJP L;  4KHS A;  2KKZ A;  5AQH A;  5C15 A;  1QSL A;  2A41 A;  2V51 B;  3V9S A;  4NLB A;  1Q86 O;  3FZL A;  1S1X A;  4PL8 A;  4I2P A;  4WYB A;  4BRQ A;  1Q81 O;  3H46 O;  2O8C B;  3WQT A;  4B9M A;  5FPD A;  3QLH A;  1HPZ A;  4HVJ A;  4BRF A;  4CD1 A;  4JI0 K;  4DQR A;  5D3G A;  5KRT A;  4BEB A;  2XY5 A;  3CCJ N;  2OTL N;  4KH6 A;  3V1Q A;  1YAG A;  3EYZ A;  4H0P A;  5I9E B;  1RT4 A;  4KRE A;  4IFY A;  5BRD A;  3RMA A;  3N4P A;  1O1W A;  3OYA A;  1NGD A;  2E5L K;  4JKF A;  3ZX2 A;  4X64 K;  2FF6 A;  3D2F A;  1ZC6 A;  3QBW A;  4DQI A;  1SKR A;  4JYA K;  1E4F T;  2G8K A;  3SZ2 A;  1WSH A;  4KPY A;  3SUN A;  1S6Q A;  4DTR A;  5MLC Q;  1W2B M;  2NRZ A;  3QIN A;  3ZEU A;  3AVK A;  4H5V A;  2Q2R A;  1M90 O;  1DTT A;  1QTM A;  4DFJ A;  3FFI A;  1L3T A;  1BA1 A;  1U2V B;  3C95 A;  1D4X A;  2Q0U A;  2Q1N A;  4FWL A;  4DV5 K;  4RW4 A;  3THX B;  3VQ8 A;  3OBY A;  3AVN A;  2GV9 A;  1HNX K;  1U6Z A;  3QFU A;  3V1R A;  3K5O A;  4ZTJ A;  4N56 A;  2QM1 A;  3SV4 A;  1NGF A;  4FPA A;  1QSY A;  2UU9 K;  2UUB K;  4CGD A;  1WOQ A;  4CER A;  3DRP A;  3AA4 A;  3T1Y K;  1TAQ A;  3QDK A;  4KBO A;  2QWP A;  3L3U A;  4LSL A;  2UYT A;  1BGX T;  4B1W B;  5ADX H;  3G4S N;  1YJ9 N;  4B1Z A;  3BZC A;  4IG3 A;  4AHS A;  3HVT A;  3V9X A;  4DCH A;  3F73 A;  5C2F A;  1ASW A;  1C1A A;  2FLO A;  3BGR A;  4J2A A;  4NYF A;  3G71 N;  3BF3 A;  3LZJ A;  2WOM A;  4WQ4 A;  2EX3 A;  4DR1 K;  1TGO A;  4G1Q A;  1WUA A;  1NBW A;  2ASM A;  5TKY A;  2HHS A;  4JS4 A;  3O9Q A;  4GVM A;  3JYT A;  1BIS A;  4FK2 A;  2E2N A;  1YXQ A;  3LDO A;  5BRH A;  4RTF D;  4GMJ B;  4JLH A;  2CH6 A;  2UXD K;  5JMV A;  4FM1 A;  1VQO N;  3VQA A;  1W0H A;  1NGC A;  2QEX N;  3FZM A;  1J9A A;  1C0F A;  4ZTF A;  2NRV A;  2WTU A;  4N41 A;  1ZXO A;  3SYZ A;  1CZB A;  4BVO A;  4OLA A;  4DSL A;  1EXQ A;  1IBM K;  4H0V B;  5CY4 A;  1TV6 A;  2XO7 A;  1XI1 A;  3ATU A;  4FCY A;  4NO7 A;  3G6E N;  3O9S A;  1JL1 A;  4MQ3 A;  2WFB A;  3NF6 A;  4IJN A;  4CZJ A;  2NNW A;  1RT6 A;  3M8Q A;  4EFH A;  3ZEU B;  3ZSY A;  4M3U A;  4CJR A;  4HWI A;  4DHY A;  4PUO A;  1BWF O;  3GE1 A;  3MEE A;  1QHT A;  3L6Q A;  4H4O A;  4DKW A;  3TU5 A;  1GLA G;  5AQR A;  2NZT A;  4H4M A;  1TKD A;  3O4Q A;  1KFS A;  2PYL A;  4BR9 A;  1IBK K;  1RDD A;  4YFU A;  4XIU A;  1OVQ A;  1NGA A;  4KI4 A;  3C65 A;  4OJR A;  4X62 K;  4PKG A;  4CCH A;  5AQX A;  3VQ6 A;  4CJQ A;  2P5O A;  1RBT A;  3TTF A;  1HQU A;  4DV4 K;  3MN6 A;  4FWP A;  3ULE A;  4CEA A;  1W7A A;  4RW8 A;  4FM2 A;  1ZBS A;  3FZK A;  4DU4 A;  2HOE A;  3AAR A;  4F2R A;  1LCU A;  3M8S A;  3UKR A;  3KK2 A;  3SMP A;  3OYJ A;  3J80 O;  4L8R B;  4KTQ A;  1E3M A;  3R3L A;  3HRG A;  1HRH A;  3HPG A;  2FC0 A;  4E0D A;  4O4G A;  2HF3 A;  4CBW A;  3SBG A;  3BDP A;  4E1M A;  5E26 A;  1DTQ A;  2NUB A;  4XEI A;  4DV1 K;  4EP5 A;  4M3W A;  3CET A;  1D9F A;  3C6U A;  5I42 A;  1NG9 A;  4F4K A;  3K59 A;  3THW A;  4OPA A;  4A57 A;  5EX5 A;  1BHL A;  2O8D A;  4JK8 A;  5JVG L;  4Z4I A;  2UUA K;  1N36 K;  3KIO A;  3VEZ A;  1S22 A;  3HT3 A;  3T3F A;  2E20 A;  3AAP A;  5LL6 Z;  3ID6 A;  4AHT A;  1T6C A;  2P5G A;  1NMN A;  2OYQ A;  1VSM A;  5C42 A;  1K6Y A;  2ASO A;  4UQG A;  1OH5 A;  4Z4G A;  4EIA A;  1I3A A;  3OYF A;  4K0K K;  4A61 A;  4NXM K;  3Q7B A;  3TAR A;  4CVN E;  3KKS A;  2ZWH A;  1TK8 A;  5AQP A;  2E2O A;  5BPN A;  1N34 K;  1HLU A;  1EWQ A;  3AA5 X;  1KVB A;  3CFP A;  4DU1 A;  1VQN N;  4CJS A;  1NK5 A;  1QQN A;  2OA8 A;  1KXP A;  4CHO A;  3SAH A;  1ZBU A;  2WBN A;  3QO9 A;  4DSJ A;  2I7P A;  1VQK N;  3VEW A;  2Q3S A;  3TAB A;  4CJV A;  5KGX A;  3LWM A;  5CZ2 A;  4JN4 A;  1NGG A;  4MFB A;  4CJ4 A;  4KHU A;  2YNG A;  3IMX A;  1NNE A;  4DR7 K;  4K42 A;  3LP0 A;  3MEC A;  4KV8 A;  3HYF A;  2OTJ N;  4FJH A;  3BF1 A;  2QW9 A;  1NK7 A;  2ZE2 A;  3D45 A;  1HKG A;  2JLE A;  1YUW A;  4FSV A;  1Z6R A;  5C25 A;  2YHY A;  4F3O A;  3O4N A;  4M7Y A;  1Q7Y O;  4CEQ A;  3V9W A;  3ULE B;  3I8B A;  4CEC A;  1IBL K;  2IOC A;  3SAF A;  3O80 A;  4KHP K;  5SWM A;  2NRR A;  3LAN A;  4DTJ A;  3O3G A;  4Q0B A;  3QFP A;  1SQK A;  4AF1 A;  3ZET A;  4KTZ A;  4YOU A;  2X6N A;  3IUC A;  1HX1 A;  2ASP A;  2I7N A;  2VCP A;  1EP4 A;  2D0C A;  2GUP A;  4K8Z A;  2HST A;  4JAX A;  2QXL A;  3A2F A;  2NRW A;  1JLA A;  3CJ1 A;  4F3T A;  4JI8 K;  2HHQ A;  1CXQ A;  3LDN A;  3THW B;  1K8K A;  1S9G A;  4FOE A;  3VTI A;  5J2P A;  3CCR N;  2O8D B;  1C1C A;  3T7Z A;  2IIR A;  2Z1J A;  3VEO A;  3AVA A;  3U6F A;  1GLD G;  1VQ7 N;  2JGU A;  4IFE A;  4CFA A;  1RT7 A;  4DLG A;  5AZJ A;  1Z05 A;  2G8W A;  2IGI A;  3AVF A;  4LF7 K;  4DMN A;  1XUP O;  2HBJ A;  2O8E A;  5AQU A;  2P9I A;  4Z0U A;  4AHU A;  2WUS A;  3G0Z A;  3AVB A;  1VSI A;  1VRU A;  2RPI A;  4CEO A;  5HRO A;  1LWE A;  3M1F A;  2P9S A;  2QKK A;  3DXM A;  3SV3 A;  3ZLJ A;  1DKG D;  2G8I A;  1BUP A;  1NJW A;  1SUQ A;  4W5R A;  4AHC A;  4XH4 A;  3CFR A;  3TPQ A;  4YNQ A;  3OYG A;  2O8F A;  2HHV A;  2OAN A;  1BL3 A;  4H8K A;  1ZBH A;  3M6G A;  4X65 K;  1G99 A;  2B6A A;  3QNO A;  3HST B;  1JXE A;  1WN7 A;  1U47 A;  1VSL A;  3MN9 A;  1OH7 A;  2HVH A;  4B9Q A;  3NMU A;  4FZY A;  2GX9 A;  3CC4 N;  4C8M A;  1A5V A;  2IAJ A;  2FXU A;  3D2E A;  3DLB A;  3HOT A;  4BRC A;  3LM9 A;  1GOC A;  4Z4H A;  1WAF A;  4CIF A;  4DSE A;  5C12 A;  4ID5 A;  3OYC A;  1RTD A;  3ZET B;  3KLG A;  4M42 A;  3FGU A;  4OGC A;  3I56 N;  4CGJ A;  2O8B B;  1VK0 A;  1TK0 A;  4WQ5 A;  4BG9 A;  3U4L A;  4LSN A;  4GV3 A;  3FZH A;  3CI5 A;  1TYQ B;  4E7L A;  3IDH A;  3EKU A;  4BRD A;  3NVM A;  1P90 A;  4OKE A;  3PV8 A;  2A1S A;  3CJC A;  3H1V X;  4KFB A;  4O5F A;  3SLC A;  3EY1 A;  1K8K B;  4BDZ A;  4JI5 K;  3LDL A;  1VQL N;  1RCH A;  5AQO A;  3VOV A;  1ASU A;  1QQO A;  1P8Z A;  3EE8 A;  1HKC A;  3FR0 A;  2OPR A;  4DSF A;  4IO8 A;  2GWJ A;  4ZHR A;  5AZJ B;  1I94 K;  4KO0 A;  4DTX A;  3PLA A;  4H5R A;  1BQN A;  1X3N A;  3MXM A;  2O8E B;  3WXL A;  3ULD A;  1WSG A;  3QEP A;  4JK9 A;  3LM2 A;  2P9I B;  1IG9 A;  3VQB A;  2FF3 B;  3M8R A;  1YIT N;  3OS2 A;  3QEI A;  3KLE A;  5JS1 A;  1XNR K;  2ZD1 A;  4K43 A;  3R6M A;  1WNS A;  2Q36 A;  3DXM B;  1YVN A;  5I3U A;  4X66 K;  4ELU A;  4BR7 A;  4DSI A;  2QXF A;  3VQ4 A;  5AR0 A;  3J7Z O;  3O6W A;  5CZ1 A;  3UB5 A;  2D0A A;  1KLN A;  3SJH A;  3BP8 A;  3R8E A;  3SNN A;  1LV5 A;  3SBT A;  3SUP A;  3MCA B;  4M3X A;  3AV9 A;  1X1P A;  1UA1 A;  1H1V A;  1TL3 A;  5AQJ A;  2UXC K;  2NRT A;  4CFD A;  2IVO A;  4KI6 A;  2P9U A;  3HPO A;  3U3G A;  1ZBL A;  4JK7 A;  4OKJ A;  2ZM6 K;  3OTO K;  4IFV A;  2AP1 A;  2D1K A;  2WON A;  4B8C A;  1DGK N;  4CZF A;  1RDU A;  3V1O A;  4YDU C;  4CF9 A;  4KRF A;  2HVI A;  2HHT A;  3SJJ A;  4HUG A;  3DOL A;  5M1O A;  3AVC A;  3T1H K;  4FL9 A;  1UAX A;  4CFB A;  1BIZ A;  2HND A;  1MWM A;  2XY6 A;  3S9H A;  3CCU N;  2KQ2 A;  3B6O A;  4DV6 K;  3L2Q A;  4CIE A;  3THX A;  4H5N A;  1RBV A;  3DLG A;  4RCH A;  2YHA A;  4E7K A;  4CJF A;  3PX0 A;  3CME N;  3MED A;  4Z4F A;  4FVU A;  2EWS A;  4J8F A;  3KK3 A;  4CJ5 A;  1S1V A;  4CJP A;  1NGI A;  4BRP A;  3ZT1 A;  3W0L A;  5CR4 A;  1HNI A;  1NK4 A;  2ITG A;  3LP1 A;  4OVL A;  4ELV A;  1TVR A;  5AQT A;  3UIQ A;  2E6L A;  3L0Q A;  2HBK A;  3NCI A;  4B3M K;  4CFC A;  3P4I A;  5M1P A;  5LMN K;  1XHX A;  3HXM A;  1SL0 A;  2C1I A;  3GOI A;  1QVF M;  3BUZ B;  4LF8 K;  1K9M O;  2JWK A;  4M3Z A;  1SS6 A;  2O4G A;  4CK3 A;  3WUH A;  4LFC K;  4WCE L;  5IT9 O;  2ZGZ A;  5AQL A;  4AH9 A;  1NKE A;  3CFO A;  4KHY A;  1NK9 A;  3ZX3 A;  3V6D A;  5F1X A;  1LAW A;  4FJ9 A;  4JRQ A;  2YJE A;  1K73 O;  3K0S A;  3ZT4 A;  3TAQ A;  5JIC A;  1HYZ A;  5CE3 A;  4CGG A;  4FM0 A;  3O1B A;  5K14 A;  4CHP A;  4E1J A;  1RT3 A;  2HHI A;  3EEQ A;  2HMI A;  4JD2 A;  4BE2 A;  4BE1 A;  3SUQ A;  2P9U B;  4Z94 A;  5JS2 A;  2I5J A;  3KK1 A;  3ISN C;  3O5B A;  3WEE A;  4DB3 A;  3JS6 A;  5JVH L;  1Q9Y A;  3VA3 A;  3DRS A;  3SMS A;  3O1W A;  3HJF A;  4IDK A;  3DLH A;  4C23 A;  2XHB A;  4YY3 K;  3OYE A;  1VSF A;  4WFA L;  1ASV A;  4QCL A;  3HI0 A;  4BC2 A;  3FE1 A;  3MWP A;  1MDU B;  3RTV A;  4IBN A;  4HUE A;  3TAN A;  1KLM A;  1UOC A;  3ITH A;  4Y1D A;  4GVE A;  5AQM A;  5AQY A;  3H1Q A;  3R1X A;  3MWT A;  1KAY A;  1RBR A;  3VET A;  4CF0 A;  2A42 A;  4JKE A;  3QNN A;  4FWK A;  4JI4 K;  4EP4 A;  2P9P A;  2NRX A;  2IC3 A;  4BR2 A;  1ATS A;  4DQS A;  1ILY A;  3LDS A;  3D6R A;  4YOV A;  3VES A;  4CHZ A;  1IKV A;  4CED A;  5HRP A;  1BDG A;  5IWA K;  5C2D A;  4B1Y B;  3I0R A;  3PY8 A;  2VQF K;  3OYK A;  2PFU A;  4W5T A;  5EXW A;  1LAV A;  2HNZ A;  4FJI A;  2X74 A;  1M1K O;  3D0P A;  4ELT A;  2D0P A;  3J81 O;  5KQD A;  3E9L A;  1QQC A;  3BZK A;  4JKH A;  1BIU A;  4B3R K;  3SQ0 A;  4CHN A;  2QWM A;  1QVG M;  5HLF A;  2FSK A;  4H0Y B;  4J2E A;  1CZ9 A;  4XJX A;  4CGF A;  4AIL C;  3ZSO A;  4FW1 A;  4DQ8 A;  3MCP A;  1DT9 A;  1JLF A;  4AQY K;  3QBX A;  1KCF A;  4CZH A;  5FPN A;  3K9J A;  4WFN L;  1JL2 A;  4QAG A;  3PSI A;  4I9L A;  4JHD B;  4BDP A;  1W9H A;  4A62 A;  3T1A A;  4BR4 A;  1OH6 A;  5FRO A;  1YJW N;  2HNY A;  4PL7 A;  1UWB A;  2VGM A;  2YNF A;  2QWQ A;  5FDL A;  4FJN A;  1NGE A;  1HYV A;  1LWF A;  1VQ8 N;  3AO4 A;  4WFB L;  4FXD A;  2DFH A;  4JD2 B;  3OJS A;  3CQX A;  3IRX A;  3S41 A;  4BC3 A;  4RG8 A;  4C1N K;  3BY5 A;  2LSN A;  3VA0 A;  3PIO L;  1VAZ A;  3WEE B;  1XMO K;  5LMU K;  3CCE N;  1ATR A;  2YHB A;  3PO4 A;  4EZ9 A;  3AVI A;  3NF8 A;  5F0X A;  2Y1J A;  4CZI A;  3EN9 A;  4ILG B;  3TI0 A;  3CF5 L;  3TR8 A;  4HHT A;  4B3T K;  1EX4 A;  1KRP A;  5E84 A;  1RDA A;  4I2Q A;  4JI2 K;  3OYL A;  4BRO A;  3WXM B;  3AVH A;  1SKW A;  3CD6 N;  4W5Q A;  2P9L B;  1NMD A;  4IWV A;  3VF4 A;  3OS1 A;  3CHW A;  2KHO A;  4BRM A;  2P9P B;  2Z1H A;  2ZGY A;  4FJ8 A;  3LP3 A;  3K9K A;  2BTF A;  3U9D A;  2GUI A;  1FKO A;  3LAK A;  3C6A A;  1X9J A;  2YHW A;  3KKR A;  4JS5 A;  4FJL A;  5BRF A;  2E8A A;  3SUO A;  5FLX O;  5AJ3 K;  3MN5 A;  4FZX C;  3HPH A;  3W3D A;  3VEN A;  4TSX A;  4YOR A;  1NU0 A;  4ILH A;  1KSP A;  4BRL A;  1IKW A;  4FWQ A;  1NOY A;  4I6M B;  4M3R A;  4YOW A;  2IS3 A;  5AQK A;  3FZF A;  1HR0 K;  4CD3 A;  1JXB A;  3THY A;  1RGI A;  3VEX A;  2HHW A;  4AHR A;  2VWB A;  1YF5 L;  4XH5 A;  2YX6 A;  3WXJ A;  4LF4 K;  4RW9 A;  2VQE K;  3UKU A;  4B9L A;  1JLB A;  3AGR A;  4FVM A;  4CK1 A;  3ZSZ A;  4I9Q A;  2HB5 A;  3VQE A;  4EZ6 A;  3TAF A;  4AM6 A;  2YKN A;  3L3V A;  4F9O A;  3E9P A;  1ZYQ A;  3OHR A;  5A2Q O;  1LW0 A;  3NGZ A;  3NGI A;  3C7N A;  2YI1 A;  5TKW A;  5DMR A;  1WSF A;  5AQQ A;  4A5B A;  3CC2 N;  4NCB A;  2RKI A;  4NLC A;  2V7Y A;  4CGH A;  2GWK A;  1HKB A;  5GIP A;  2F8T A;  1QZ5 A;  5E41 A;  4LC9 B;  3K58 A;  4B8A B;  4BAC A;  4IOX A;  4DLE A;  1NK8 A;  1WBB A;  3P39 A;  4CE9 A;  3TSU A;  3KD1 E;  1NKC A;  3ID8 A;  1S3X A;  3NF7 A;  4IOA L;  3S3M A;  4CW7 B;  2HF4 A;  2DFE A;  1XC3 A;  1KAZ A;  3VQC A;  3ZCM A;  4DQP A;  4C1N I;  3VMF B;  5M1Q A;  1JCG A;  1T05 A;  3P38 A;  5JEN A;  4C8K A;  1YTU A;  1YTA A;  1S6P A;  1RDB A;  5GIO A;  3HM8 A;  5H1S Q;  3B8A X;  2D5R A;  3CXC M;  4CES A;  5AQG A;  1N33 K;  4WE1 A;  2DY4 A;  4CJU A;  3AY9 A;  4KTW A;  2O8B A;  2FBV A;  3MK6 A;  3KWG A;  4WQ4 C;  1S1U A;  2XY8 A;  3MX2 A;  2VG5 A;  1RT1 A;  2YV0 X;  1C0U A;  1TYQ A;  3KVG A;  5GAG P;  3IAY A;  2AJQ A;  5EY4 A;  2F96 A;  1HNW K;  3THY B;  1OH8 A;  4FWS A;  1JLG A;  5DK5 A;  4CEB A;  3ZSQ A;  4CZK A;  1OVY A;  1D8Y A;  5AFU H;  1ITG A;  3UKU B;  1N5Y A;  5BR8 K;  1QSS A;  4MLE A;  3VEV A;  4H5W A;  2ZF5 O;  4DF8 A;  3KZB A;  3O8M A;  1L5U A;  3KHY A;  1GLJ O;  5JLF A;  4BRA A;  3A5N C;  5CHI A;  4E7J A;  1WAJ A;  2BH1 A;  2VWK A;  1LWC A;  3MX5 A;  3LL3 A;  4CJW A;  3V4I A;  3C7N B;  3OJU A;  4FWR A;  2KFZ A;  2HHU A;  5KRS A;  2W6K A;  2E1Y A;  3DI6 A;  3CPW M;  5BN9 A;  4A59 A;  4CEZ A;  2BAN A;  4FLU A;  3NBP A;  2XRI A;  1VSK A;  4MO4 A;  4BE0 A;  3QEV A;  2P1J A;  1U04 A;  4FJG A;  3CYG A;  3K57 A;  2IDO A;  1U48 A;  3LAL A;  5HOO A;  1TKX A;  1T7P A;  4DV2 K;  4IEI A;  4DQQ A;  5LJW A;  3TSQ A;  4LFA K;  4QS9 A;  3AAQ A;  2A5X A;  3WXI A;  1W97 L;  1ESV A;  3OYI A;  2HW3 A;  1R0A A;  4V19 S;  4MO5 A;  4CZE A;  3RRG A;  5C24 A;  4A5A A;  4BRE A;  3EO3 A;  3EZ5 A;  1NGH A;  2V52 B;  3L2W A;  4HCB A;  3DAW A;  1NJI O;  1GLF O;  4OPK A;  3RR8 A;  3KD5 E;  3WXK A;  1ZBI A;  5BR9 A;  3O3F A;  1A5X A;  2D0O A;  4BDY A;  2BE2 A;  3UE5 A;  2HHX A;  4RW7 A;  3OYN A;  3IS9 A;  3FFK B;  3DLK A;  3A5M C;  4HTL A;  1D9D A;  3QEX A;  3KLF A;  5AQN A;  4EHU A;  4QS8 A;  1REV A;  5DM7 L;  1VSE A;  3TAP A;  4FLZ A;  4A2A A;  3CIP A;  3P1G A;  1RBS A;  1EO1 A;  3DLL L;  3OYM A;  4Q5V A;  4DTO A;  2NLX A;  2YJF A;  1S1T A;  2QTD A;  3U9Z A;  1FW6 A;  4JRP A;  4E3S A;  2F9W A;  2QKB A;  1X9S A;  4O8U A;  3V9Z A;  4GKK K;  2P9N A;  3P31 A;  1YIJ N;  1X9W A;  1YT3 A;  2BGG A;  3NF9 A;  4MLH A;  4E19 A;  4HTU A;  3OW2 M;  1RT2 A;  4DS4 A;  4BE7 B;  4DTM A;  2X78 A;  1VSH A;  3SQ1 A;  4FOI A;  1E4G T;  2OZS A;  4HCC A;  4YOT A;  3RSE B;  3VEY A;  4FK4 A;  1IH7 A;  3VN5 A;  2ATQ A;  3PO5 A;  3LPT A;  3HOS A;  1NJY A;  1FJG K;  1RIL A;  3O4W A;  3NH0 A;  3H6E A;  5EU7 A;  5GAH P;  3RMC A;  4GV6 A;  1WSJ A;  4M63 C;  3QEW A;  4IKF A;  4OO1 J;  3AO3 A;  2G8V A;  3J7Y P;  4M41 A;  4DFM A;  1SL2 A;  4DU3 A;  3NGY A;  4LF5 K;  4CBX A;  4CHY A;  2GEM A;  3DOK A;  4IZ9 A;  3VER A;  1WBD A;  1I39 A;  3S3O A;  4DSK A;  3MXJ A;  2E6M A;  3IG1 A;  4JI1 K;  4KKO A;  4EAH D;  1B9F A;  4BY9 C;  1KAX A;  2J4R A;  3E01 A;  4NXN K;  1VQ5 N;  4PKH A;  2CH5 A;  4PY5 A;  1EET A;  3O08 A;  3NVK A;  1VQM N;  4ISE A;  4HUF A;  1Z26 A;  3PX6 A;  3VQ9 A;  4BWM A;  4BGA A;  1L3S A;  4FWN A;  1D5A A;  4E72 A;  5AQW A;  4BGB A;  2OPS A;  3CPE A;  4U67 L;  2QWR A;  4O55 A;  4FJ7 A;  2Q31 A;  2Y1I A;  4LD0 A;  4DG1 A;  1GLB G;  5ELZ A;  3VQD A;  4E89 A;  5ADX A;  4CGI A;  5KTQ A;  3MN7 A;  3HL8 A;  3VQ5 A;  1NK0 A;  3LPU A;  4B1U B;  4DR6 K;  1JLC A;  3QIP A;  1IJJ A;  1J5E K;  2P9N B;  4CZG A;  3ENO A;  1BQM A;  3I0S A;  4R5P A;  4PKI A;  4KHN A;  4M3Y A;  3T69 A;  1U4B A;  2H3G X;  4CZL A;  3TWH A;  1BI4 A;  3HM9 A;  5M1K A;  4CEE A;  4DTU A;  1NGJ A;  1NWK A;  1TKZ A;  4H0X B;  5BPM A;  4FJ5 A;  5KGW A;  5AZI A;  3DWL A;  1KTQ A;  3SCX A;  4JKG B;  3A8Y A;  4JHD A;  4JKC A;  4FWO A;  4JKD A;  5GAE P;  3DJC A;  5GIN A;  4BQZ A;  3O9R A;  3ASM A;  1QS4 A;  4FK0 A;  4OX9 K;  4K8X A;  1L3U A;  3VQ7 A;  3GG4 A;  1V4S A;  1Y97 A;  4OKK A;  5LJV A;  2KTQ A;  1VSD A;  3MMV A;  1IKX A;  4B3O A;  1NKB A;  5HBM A;  3DMJ A;  4CF8 A;  1HQE A;  2Z1G A;  4NYN A;  1V4T A;  2GTD A;  1YHQ N;  3O3H A;  4KAZ A;  2B5J A;  4H0T B;  4DWI A;  5AQZ A;  2VG7 A;  3DRR A;  3F9K A;  4CJL A;  3G10 A;  4BRH A;  2KW4 A;  4LY7 A;  1JKH A;  1XMQ K;  3RVC A;  3GBT A;  4JI6 K;  3ZSW A;  5CYQ A;  2PAV A;  4WQ5 C;  3HK2 A;  2P9L A;  1TUY A;  4EHT A;  1EKE A;  4E7H A;  3HVR A;  2F8S A;  4W5N A;  3F5T A;  4IOC L;  2RF2 A;  2ETJ A;  4Y0W A;  1EQY A;  1QZ6 A;  3HZ6 A;  1KFD A;  3QIC A;  1C0T A;  3VTH A;  3CQ8 A;  5KI6 A;  3PX4 A;  4XH1 A;  3SQ2 A;  1CXU A;  3E66 A;  2E2P A;  3TTD A;  2BUP A;  1JCE A;  2QWO A;  4CK2 A;  4MDA A;  3T19 A;  4BR5 A;  3ZSV A;  3KJV A;  3J7A P;  3G25 A;  3VF2 A;  3Q7C A;  1C0M A;  1TKT A;  1EWR A;  1FK9 A;  3O9U A;  2RN2 A;  3I55 N;  4IEE A;  3VQP A;  3C6T A;  3V9U A;  5SZT A;  5KPR A;  4I6M A;  4M3T A;  1X9M A;  4FWM A;  3C0B A;  2E88 A;  3NH2 A;  3K2P A;  3CYM A;  1BI4 B;  5T7B A;  2A40 A;  3R9P A;  5FPE A;  2D0B A;  3CM6 A;  1RT5 A;  4QOZ B;  1NLV A;  5AZI B;  4OPJ A;  1KVA A;  4M45 A;  1G15 A;  3CCQ N;  3ZT0 A;  1HJO A;  4CF2 A;  5KPT A;  1N8R O;  4ILJ A;  3AO1 A;  2BDP A;  2KZM A;  3NDK A;  3DLE A;  1Q18 A;  4MDB A;  5AQI A;  3ZT2 A;  4CZM A;  1S72 N;  2QA4 N;  4M7X A;  2YNI A;  3AVG A;  1RTJ A;  2VYP A;  4ICL A;  5M1F A;  4O0I A;  1S9E A;  3D7E O;  4GV9 A;  4KH5 A;  4DF4 A;  5DM6 L;  3NE6 A;  3AVL A;  3EZW A;  4IDH A;  3ZSR A;  1J5O A;  4N76 A;  3AA2 A;  3VF6 A;  2G8H A;  4CJT A;  4B9N A;  1IO2 A;  1VRT A;  4N47 A;  2QI2 A;  1JLE A;  3M3Z A;  4LF6 K;  1FXX A;  3M5R A;  1JJ2 M;  4JNE A;  2P9K A;  3CJ9 A;  1NOZ A;  3L2V A;  1SAZ A;  4O8K A;  2CGK A;  3EE9 A;  2ITM A;  1QE1 A;  2CGL A;  3C94 A;  4GNI A;  3LDP A;  1O13 A;  3D2F B;  3WNG A;  3KLH A;  3QET A;  5FRM A;  1OKJ A;  2PY5 A;  3WNF A;  3K5L A;  2VGN A;  4LH4 A;  2G8F A;  1Q9X A;  3LDQ A;  3O9T A;  3THV A;  3TAM A;  3RR7 A;  4IJA A;  1RDW X;  3DM2 A;  4FJM A;  3AA3 A;  3LZI A;  4YHH K;  4DUZ K;  2FBX A;  4J2D A;  1BCM A;  1JLQ A;  2FBY A;  2V7Z A;  4H0O A;  2DFF A;  2WC9 A;  4F2S A;  3IKM A;  5HRN A;  2W40 A;  2OZM A;  4CF1 A;  3MXI A;  4CHQ A;  2JWL A;  1CLQ A;  3H45 C;  4OGE A;  4BWJ A;  1MWK A;  4PA1 A;  1GLL O;  3GL1 A;  1LOT B;  4C8L A;  4PWD A;  3WQU A;  3VPZ A;  2HHH K;  3VGL A;  1BOT O;  1MU2 A;  3QIO A;  1RNH A;  3AO2 A;  3TAG A;  4KHW A;  1HMV A;  3V81 A;  5HP1 A;  3LWL A;  4NB4 A;  3LP2 A;  3J8A A;  3OYB A;  3HBT A;  5AFU A;  2QWL A;  4BVP A;  1T6D A;  2X6S A;  3CM5 A;  4E7I A;  1VHX A;  3SQ4 A;  3WT0 A;  2Z1I A;  3A0I X;  3AO5 A;  3DXK A;  2YCH A;  1DLO A;  4H5T A;  4FLX A;  4DR3 K;  1TL1 A;  3L2R A;  4JI7 K;  2PBD A;  3CQY A;  4AHV A;  2AA4 A;  2Q97 A;  2W42 A;  3KWI A;  4BR0 A;  4CBU A;  5BN8 A;  3CJ7 A;  3HTV A;  3WNH A;  4JV5 K;  4NCA A;  3VGM A;  3E9O A;  4BRG A;  1HYS A;  5GAD P;  5C10 A;  3TTC A;  3AVM A;  2CGJ A;  4U7B A;  4FPB A;  1LW2 A;  2P9K B;  3CCV N;  1T8E A;  2A1R A;  1GLE G;  1J53 A;  4RWT A;  3RMD A;  3NHG A;  1NJZ A;  1XNQ K;  3A5L C;  4DV0 K;  1TUU A;  4B9S A;  3MDQ A;  3ENH A;  3QB0 A;  4FLT A;  5KQ8 A;  2KZZ A;  1GLC G;  2IVP A;  1KD1 O;  3U8X A;  2ZJR L;  4GKJ K;  1A5W A;  2YKM A;  4DR5 K;  2W41 A;  4ID1 A;  3B6P A;  4FYD A;  4BEC A;  3NFA A;  3HO1 A;  4CEF A;  2HBL A;  1TAU A;  2Q0R A;  2G8U A;  2E4L A;  4B1V A;  2HBM A;  1KC8 O;  4LFB K;  3CG7 A;  5AQF A;  2FBT A;  1N32 K;  3QER A;  4JKA A;  2HMP A;  1U45 A;  1YVU A;  4DUY K;  2QWN A;  3KK7 A;  1B9D A;  2GBZ A;  2ZQB A;  4CI6 A;  3ATV A;  3F2K A;  1ATN A;  1VQ9 N;  4PQU A;  3N4Q A;  1ZBF A;  4ISF A;  3TAE A;  3L8B A;  4YDU A;  4C8O A;  5M1N A;  3QES A;  1HUX A;  4BC4 A;  1SL1 A;  3UKR B;  3DLR A;  4B9T A;  1QHA A;  4BRN A;  3EKS A;  4O0J A;  4DS5 A;  3PIP L;  1JCF A;  1L3V A;  1FKP A;  2FSJ A;  4CJ7 A;  4JI3 K;  3OS0 A;  2O4I A;  1N6Q A;  5FPM A;  4B9U A;  4BQL A;  3KLI A;  3DXK B;  4JKB A;  2OCE A;  3AVJ A;  4E1N A;  3ZT3 A;  3MAQ A;  1WSI A;  4RW6 A;  2KFN A;  3S3N A;  4N5S A;  1YI2 N;  3VQQ A;  4DR4 K;  1WLJ A;  5AQS A;  4PHT X;  2GEL A;  4O44 A;  3ZX0 A;  1J54 A;  1R59 O;  3RSE A;  1KQS M;  3CJB A;  1NJX A;  1J6Z A;  3KTQ A;  3OA9 A;  1GOA A;  3I33 A;  3QML A;  1CZA N;  2IVN A;  1HJR A;  3LAM A;  3OYH A;  1S1W A;  4DFK A;  3ZSX A;  1Q82 O;  1BA0 A;  2A6A A;  3MEG A;  2ZJQ L;  3JSM A;  1X3M A;  5EOY A;  1WSE A;  1DEJ A;  3RRH A;  4FJK A;  3U3Y A;  2VWJ A;  1VQ6 N;  4IO9 L;  1NGB A;  5KPZ A;  1KVC A;  2FSN A;  3VGK A;  2YHX A;  2OPP A;  3H3N O;  1Z25 A;  3OY9 A;  5AQV A;  4FO0 A;  2C1G A;  1XHZ A;  2RE2 A;  3S5T A;  3SK3 A;  4ISG A;  5HRS A;  5J1E A;  1F21 A;  5EVZ A;  3ALY A;  1UA0 A;  1VQ4 N;  4IG0 A;  1QQM A;  5BRE A;  2NRH A;  4Y1C A;  2E2Q A;  2DTU A;  2UUC K;  2UXB K;  4QS7 A;  3HP6 A;  1RTI A;  3CMA N;  4C8N A;  4FJX A;  1VSJ A;  1Y64 A;  4G9Z A;  2PZS A;  1C6V A;  1IKY A;  3FLC O;  1BG3 A;  3L4I A;  4YOX A;  3PUF A;  4B1X B;  3ENB A;  3HP9 A;  3WNE A;  4CJK A;  4F8R A;  3H08 A;  1YJN N;  1HPM A;  3C6H A;  4KH4 A;  3ZYY X;  3SI6 A;  3L4Q A;  5JLH A;  3SPZ A;  1GOB A;  1XWL A;  1VQP N;  3L2U A;  1MA9 B;  1U49 A;  4FW2 A;  4OLB A;  1IV0 A;  4JEP A;  3RMB A;  4J2B A;  1RBU A;  4I7F A;  2E1Z A;  2W6L A;  4A2B A;  2W00 A;  4CJE A;  5LY3 A;  4FLY A;  2XY7 A;  3JAM O;  5HL7 L;  4BG8 A;  5HRR A;  5F2R A;  4DV3 K;  4CJ3 A;  1T3V A;  1BU6 O;  4H03 B;  3SPY A;  2EHG A;  4LH5 A;  2F4V K;  1IG8 A;  5J2Q A;  5FRN A;  1RTH A;  1HNZ K;  3H3O B;  1RFQ A;  2VG6 A;  2RHK A;  1Q8I A;  4NCG A;  4JKG A;  2QK9 A;  1S5J A;  4W5O A;  3EL2 A;  2A3Z A;  4DTS A;  1HNV A;  1B92 A;  2KLA A;  2B4J A;  3NAE A;  3P83 D;  3NH1 A;  4BC5 A;  1SZ2 A;  3CCS N;  2P9S B;  4B3S K;  4GY2 B;  4BRI A;  3F9M A;  3CCL N;  1T44 A;  3CC7 N;  5C0Y A;  2O8C A;  4UY8 O;  4GW6 A;  3DYA A;  3M8P A;  3BEX A;  1BCO A;  3JXU A;  4FLW A;  2F9T A;  2YNH A;  4L3Q A;  4B08 A;  4KHQ A;  1NK6 A;  1SV5 A;  3AGK A;  4FJJ A;  3RWU A;  2O8F B;  4R79 A;  3CER A;  1T03 A;  1C1B A;  1XQS C;  3CJA A;  1NM1 A;  4K41 A;  2PYJ A;  4WF9 L;  3K5N A;  2R7Y A;  3SAG A;  1TK5 A;  4DFP A;  2P51 A;  5J2N A;  4DTP A;  1RDC A;  3P5J A;  3D2E B;  3OYD A;  4Z4C A; 
#chains in the Genus database with same CATH homology
 5KPR A;  4OPH A;  5B8H A;  4I6M A;  4K25 A;  4YOY A;  4FWM A;  3C0B A;  2OAN A;  2E88 A;  2F7T A;  4AM6 A;  4F9O A;  3E9P A;  3M6G A;  1U2V A;  1G99 A;  2A40 A;  3OHR A;  3R9P A;  1BO5 O;  3TSP A;  2DPN A;  3C7N A;  4IXC A;  4AM7 A;  5FPE A;  2YI1 A;  1NLV A;  3E1Y A;  5TKW A;  2D4W A;  3MN9 A;  3GDQ A;  5AZI B;  4B9Q A;  3CCQ N;  5AQQ A;  4A5B A;  3NMU A;  3CC2 N;  2GX9 A;  1HJO A;  3CC4 N;  4NLC A;  2V7Y A;  3A5O C;  4BRK A;  5KPT A;  1N8R O;  2GWK A;  1HKB A;  4ILJ A;  5GIP A;  1QZ5 A;  4LC9 B;  1Q18 A;  4MDB A;  5AQI A;  4CZM A;  4IOX A;  3CCM N;  2FXU A;  3D2E A;  4M7X A;  2QA4 N;  1S72 N;  3HOT A;  4BRC A;  3P39 A;  3LM9 A;  3TSU A;  2VYP A;  5BPL A;  5C12 A;  5M1F A;  3ID8 A;  3ZET B;  1K8A O;  1S3X A;  3D7E O;  4IOA L;  4GV9 A;  4KH5 A;  3FGU A;  3HSC A;  3IFR A;  5DM6 L;  3EZW A;  2HF4 A;  4IDH A;  3OBW A;  3I56 N;  3VF6 A;  1C0G A;  2ZJP L;  1XC3 A;  2KKZ A;  4WQ5 A;  1KAZ A;  5AQH A;  5C15 A;  4BG9 A;  3U4L A;  4C1N I;  3VMF B;  4GV3 A;  3FZH A;  3CI5 A;  2QI2 A;  3M3Z A;  1TYQ B;  5M1Q A;  3M5R A;  3IDH A;  3EKU A;  1JCG A;  4BRD A;  3NVM A;  2A41 A;  3P38 A;  4JNE A;  1P90 A;  1JJ2 M;  2P9K A;  2V51 B;  3CJ9 A;  4NLB A;  1SAZ A;  4O8K A;  1Q86 O;  3CJC A;  3H1V X;  4O5F A;  2CGK A;  3SLC A;  1K8K B;  3FZL A;  5GIO A;  3LDL A;  1VQL N;  3HM8 A;  3EE9 A;  2ITM A;  2CGL A;  4PL8 A;  5AQO A;  3B8A X;  3VOV A;  1QQO A;  3EE8 A;  1P8Z A;  4GNI A;  1HKC A;  3FR0 A;  1O13 A;  3LDP A;  4WYB A;  3D2F B;  4BRQ A;  1Q81 O;  4IO8 A;  3H46 O;  5AQG A;  2GWJ A;  3WQT A;  5FPD A;  5H1S Q;  1OKJ A;  3AY9 A;  5AZJ B;  2VGN A;  3CXC M;  3PLA A;  4H5R A;  3MK6 A;  3KWG A;  4WQ4 C;  4BRF A;  1X3N A;  4CD1 A;  3LDQ A;  3O9T A;  3MX2 A;  3WXL A;  4BEB A;  4IJA A;  1RDW X;  1TYQ A;  3CCJ N;  3KVG A;  4JK9 A;  3LM2 A;  2OTL N;  2P9I B;  4KH6 A;  5GAG P;  2FF3 B;  1YIT N;  1YAG A;  4H0P A;  5I9E B;  4K43 A;  5EY4 A;  5BRD A;  3R6M A;  3N4P A;  2V7Z A;  4H0O A;  2Q36 A;  3DXM B;  1NGD A;  1YVN A;  4FWS A;  4JKF A;  2FF6 A;  2WC9 A;  3D2F A;  3ZX2 A;  3IKM A;  1ZC6 A;  3QBW A;  2W40 A;  1OVY A;  4BR7 A;  4CZK A;  1E4F T;  5AR0 A;  3J7Z O;  2JWL A;  3H45 C;  3O6W A;  5AFU H;  3UB5 A;  3UKU B;  1MWK A;  1GLL O;  5MLC Q;  3SJH A;  3GL1 A;  2NRZ A;  1W2B M;  3ZEU A;  1LOT B;  4MLE A;  3BP8 A;  3R8E A;  3VEV A;  3WQU A;  3VPZ A;  4H5W A;  2ZF5 O;  3SBT A;  4H5V A;  3VGL A;  3KZB A;  1BOT O;  3MCA B;  3O8M A;  3KHY A;  2Q2R A;  1GLJ O;  1M90 O;  5JLF A;  4BRA A;  1H1V A;  3A5N C;  5AQJ A;  5CHI A;  2NRT A;  1BA1 A;  1U2V B;  2IVO A;  2BH1 A;  1D4X A;  2P9U A;  2Q0U A;  4JK7 A;  3MX5 A;  2Q1N A;  3LL3 A;  4FWL A;  4NB4 A;  3J8A A;  3C7N B;  2AP1 A;  2D1K A;  4FWR A;  3OBY A;  3HBT A;  5AFU A;  2QWL A;  4BVP A;  2E1Y A;  1T6D A;  1U6Z A;  1DGK N;  4CZF A;  3CPW M;  5BN9 A;  4A59 A;  3QFU A;  1RDU A;  3WT0 A;  2QM1 A;  1NGF A;  4FPA A;  3DXK A;  3A0I X;  4YDU C;  2YCH A;  4MO4 A;  1WOQ A;  4H5T A;  2PBD A;  5M1O A;  3CQY A;  3QDK A;  4FL9 A;  2QWP A;  4KBO A;  2UYT A;  4B1W B;  5ADX H;  2AA4 A;  3G4S N;  1YJ9 N;  2Q97 A;  3KWI A;  5HOO A;  4BR0 A;  4B1Z A;  4CBU A;  5BN8 A;  1MWM A;  3CCU N;  3CJ7 A;  4IEI A;  5LJW A;  3TSQ A;  3HTV A;  4DCH A;  4QS9 A;  3AAQ A;  2A5X A;  4H5N A;  3WXI A;  1W97 L;  3VGM A;  5C2F A;  1ESV A;  2FLO A;  4RCH A;  3E9O A;  4MO5 A;  4BRG A;  4CZE A;  5GAD P;  5C10 A;  3G71 N;  3BF3 A;  4BRE A;  4A5A A;  4WQ4 A;  3TTC A;  3EO3 A;  2CGJ A;  4U7B A;  3CME N;  4FPB A;  1WUA A;  2P9K B;  1NGH A;  1NBW A;  3CCV N;  2EWS A;  2ASM A;  4J8F A;  2V52 B;  5TKY A;  4FVU A;  3O9Q A;  1GLE G;  3DAW A;  4RWT A;  1NJI O;  1NGI A;  4BRP A;  2E2N A;  3A5L C;  3W0L A;  1GLF O;  1TUU A;  1YXQ A;  3MDQ A;  5CR4 A;  3ENH A;  3LDO A;  5BRH A;  3QB0 A;  3WXK A;  5KQ8 A;  4RTF D;  5BR9 A;  1GLC G;  2IVP A;  1KD1 O;  2CH6 A;  3U8X A;  2ZJR L;  2D0O A;  5JMV A;  2W41 A;  1VQO N;  3UE5 A;  5AQT A;  1NGC A;  4BEC A;  3L0Q A;  2HBK A;  2QEX N;  2HBL A;  3FFK B;  3FZM A;  3P4I A;  5M1P A;  3A5M C;  2Q0R A;  1C0F A;  4HTL A;  2NRV A;  3GOI A;  2C1I A;  1QVF M;  4B1V A;  2HBM A;  5AQN A;  1ZXO A;  4EHU A;  3BUZ B;  4QS8 A;  1KC8 O;  5DM7 L;  1K9M O;  2JWK A;  4BVO A;  4A2A A;  1SS6 A;  3CIP A;  3WUH A;  5AQF A;  4WCE L;  2ZGZ A;  4H0V B;  1EO1 A;  3DLL L;  5AQL A;  4JKA A;  2HMP A;  3ATU A;  2NLX A;  2YJF A;  2QTD A;  2QWN A;  4NO7 A;  3G6E N;  3KK7 A;  3O9S A;  3U9Z A;  3ZX3 A;  2WFB A;  5F1X A;  2F9W A;  4CI6 A;  3ATV A;  3F2K A;  1ATN A;  4IJN A;  1VQ9 N;  4CZJ A;  2YJE A;  2NNW A;  3N4Q A;  1K73 O;  4O8U A;  5JIC A;  4EFH A;  3ZEU B;  4ISF A;  5CE3 A;  2P9N A;  4HWI A;  3P31 A;  4DHY A;  1YIJ N;  1BWF O;  3O1B A;  4YDU A;  5M1N A;  4E1J A;  3GE1 A;  4MLH A;  1HUX A;  3L6Q A;  4BC4 A;  4DKW A;  3OW2 M;  4JD2 A;  3UKR B;  3TU5 A;  1GLA G;  5AQR A;  2NZT A;  4BE7 B;  2P9U B;  4Z94 A;  1QHA A;  3O5B A;  4BRN A;  4BR9 A;  3EKS A;  4FOI A;  1E4G T;  3PIP L;  3WEE A;  4YOT A;  3JS6 A;  1JCF A;  1NGA A;  3RSE B;  4DB3 A;  3VEY A;  3C65 A;  5JVH L;  2FSJ A;  4PKG A;  4CJ7 A;  5AQX A;  3SMS A;  3O1W A;  3HOS A;  5FPM A;  3O4W A;  4BQL A;  3DXK B;  4JKB A;  3H6E A;  3TTF A;  4C23 A;  5GAH P;  3MN6 A;  4FWP A;  3ULE A;  4GV6 A;  4WFA L;  4M63 C;  4OO1 J;  3HI0 A;  4BC2 A;  3FE1 A;  1ZBS A;  3FZK A;  3MWP A;  2HOE A;  3AAR A;  1MDU B;  1LCU A;  1YI2 N;  3UKR A;  3SMP A;  3R3L A;  5AQS A;  4CBX A;  3HRG A;  2GEM A;  4PHT X;  4GVE A;  5AQM A;  5AQY A;  2GEL A;  3H1Q A;  3R1X A;  4IZ9 A;  3MWT A;  1KAY A;  3VER A;  3VET A;  3ZX0 A;  1R59 O;  3RSE A;  2A42 A;  4JKE A;  2HF3 A;  4FWK A;  3CJB A;  3SBG A;  4CBW A;  1KQS M;  1J6Z A;  3OA9 A;  5E26 A;  2P9P A;  2NRX A;  4XEI A;  3I33 A;  3QML A;  1CZA N;  2IVN A;  3CET A;  1ATS A;  4BR2 A;  1ILY A;  4EAH D;  3D6R A;  4YOV A;  4BY9 C;  4OPA A;  1KAX A;  2J4R A;  3VES A;  4A57 A;  5EX5 A;  3CF5 L;  4PKH A;  2CH5 A;  1VQ5 N;  1Q82 O;  1BA0 A;  1BDG A;  3O08 A;  4JK8 A;  2A6A A;  5JVG L;  1VQM N;  3NVK A;  4ISE A;  5C2D A;  3VEZ A;  1S22 A;  4B1Y B;  2ZJQ L;  4BGA A;  1X3M A;  2E20 A;  2PFU A;  3AAP A;  4FWN A;  5EOY A;  3ID6 A;  1DEJ A;  5AQW A;  1T6C A;  5EXW A;  1VQ6 N;  4BGB A;  4IO9 L;  1M1K O;  1NGB A;  5KPZ A;  3CPE A;  2D0P A;  2FSN A;  2ASO A;  2YHX A;  3VGK A;  4U67 L;  3H3N O;  2C1G A;  5AQV A;  2QWR A;  4FO0 A;  4EIA A;  5KQD A;  2RE2 A;  3E9L A;  2Q31 A;  3SK3 A;  4A61 A;  4JKH A;  3Q7B A;  4ISG A;  2ZWH A;  1GLB G;  5ELZ A;  2QWM A;  5AQP A;  2E2O A;  5BPN A;  1QVG M;  1HLU A;  5ADX A;  2FSK A;  4H0Y B;  5EVZ A;  1VQ4 N;  1VQN N;  4XJX A;  1QQN A;  1QQM A;  3MN7 A;  5BRE A;  1KXP A;  2NRH A;  4DQ8 A;  2E2Q A;  3MCP A;  1DT9 A;  3QBX A;  4QS7 A;  4CZH A;  3SAH A;  5FPN A;  3K9J A;  4WFN L;  2WBN A;  3CMA N;  1Y64 A;  4JHD B;  4B1U B;  4A62 A;  4BR4 A;  4G9Z A;  2I7P A;  3FLC O;  3L4I A;  1BG3 A;  4YOX A;  1VQK N;  4B1X B;  3VEW A;  3ENB A;  1YJW N;  4PL7 A;  1IJJ A;  2VGM A;  2P9N B;  2QWQ A;  4CZG A;  3ENO A;  1YJN N;  1NGE A;  1HPM A;  3C6H A;  4KH4 A;  3ZYY X;  4JN4 A;  4PKI A;  1NGG A;  3T69 A;  1VQ8 N;  2H3G X;  4WFB L;  4CZL A;  3L4Q A;  4JD2 B;  3IMX A;  5JLH A;  3CQX A;  5M1K A;  3S41 A;  1NGJ A;  4K42 A;  4BC3 A;  1NWK A;  4H0X B;  4C1N K;  5BPM A;  5AZI A;  1VQP N;  2OTJ N;  3DWL A;  1VAZ A;  3BF1 A;  2QW9 A;  3WEE B;  3PIO L;  3CCE N;  1MA9 B;  1ATR A;  1HKG A;  3A8Y A;  4JHD A;  4JKG B;  4JEP A;  4JKC A;  5F0X A;  1YUW A;  4FSV A;  4FWO A;  2E1Z A;  1Z6R A;  4CZI A;  2YHY A;  4A2B A;  3EN9 A;  4ILG B;  2W00 A;  4M7Y A;  5LY3 A;  1Q7Y O;  4JKD A;  3ULE B;  3I8B A;  3DJC A;  5GAE P;  4BG8 A;  5HL7 L;  3SAF A;  5GIN A;  3O80 A;  4BQZ A;  3O9R A;  5F2R A;  2NRR A;  5E84 A;  1T3V A;  1BU6 O;  3QFP A;  1SQK A;  4H03 B;  4AF1 A;  4BRO A;  3ZET A;  3WXM B;  4YOU A;  3IUC A;  1HX1 A;  2ASP A;  1IG8 A;  3GG4 A;  1V4S A;  2I7N A;  3H3O B;  3CD6 N;  1RFQ A;  2VCP A;  5LJV A;  2P9L B;  1NMD A;  2RHK A;  3MMV A;  4IWV A;  3VF4 A;  2GUP A;  2HST A;  3CHW A;  4JAX A;  2KHO A;  4JKG A;  2QXL A;  4BRM A;  2P9P B;  3EL2 A;  2NRW A;  2ZGY A;  2A3Z A;  3CJ1 A;  1V4T A;  2GTD A;  1YHQ N;  2KLA A;  3K9K A;  2BTF A;  3LDN A;  4H0T B;  5AQZ A;  1K8K A;  4FOE A;  3TPQ A;  3VTI A;  4BC5 A;  1SZ2 A;  3CCR N;  3CCS N;  2P9S B;  4GY2 B;  3U9D A;  4BRH A;  4BRI A;  3F9M A;  3T7Z A;  3CCL N;  3RVC A;  2IIR A;  1T44 A;  3GBT A;  3CC7 N;  3C6A A;  1X9J A;  2YHW A;  3VEO A;  1GLD G;  5C0Y A;  1VQ7 N;  4UY8 O;  4IFE A;  5BRF A;  2PAV A;  2E8A A;  3BEX A;  3JXU A;  4WQ5 C;  5AZJ A;  2P9L A;  1TUY A;  4EHT A;  2F9T A;  1Z05 A;  3F5T A;  4L3Q A;  4IOC L;  3MN5 A;  1XUP O;  2HBJ A;  3W3D A;  3VEN A;  3AGK A;  4YOR A;  4ILH A;  4Y0W A;  5AQU A;  1EQY A;  2P9I A;  4BRL A;  4FWQ A;  2WUS A;  4I6M B;  1QZ6 A;  3HZ6 A;  3QIC A;  4YOW A;  5AQK A;  4R79 A;  3FZF A;  3CER A;  3VTH A;  4CD3 A;  3M1F A;  1RGI A;  2P9S A;  3VEX A;  4XH1 A;  1XQS C;  3DXM A;  1DKG D;  3CJA A;  3E66 A;  2E2P A;  1NM1 A;  2VWB A;  1BUP A;  4K41 A;  3TTD A;  2BUP A;  1JCE A;  2QWO A;  1YF5 L;  4WF9 L;  4MDA A;  2YX6 A;  4XH5 A;  4BR5 A;  3WXJ A;  3SAG A;  3G25 A;  4XH4 A;  3VF2 A;  3Q7C A;  3UKU A;  3O9U A;  3I55 N;  4IEE A;  3D2E B;  3AGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...