2P9NB

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
203
structure length
203
Chain Sequence
QAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 51
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9nB01
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9nB02
3BP8A 3UE5A 1KAXA 2A5XA 4CD1A 2A42A 2GTDA 3IFRA 4BGBA 1EQYA 3D2FA 5AQKA 3SK3A 3ENHA 4FWPA 3GE1A 1X9JA 2D0OA 1T6DA 5AR0A 4EAHD 4PL8A 1NGIA 3HSCA 3QDKA 2ASOA 3WEEA 4B1YB 5AQFA 3C7NA 3J8AA 5ADXA 5ADXH 2E1YA 4ISFA 2ASPA 4FOEA 3UKUA 2J4RA 3VEOA 5BRDA 3VETA 5AFUA 5AZIA 4BVOA 5F0XA 3O4WA 3AAPA 5AQRA 5AFUH 5AQXA 1NGAA 3MN9A 4B1VA 3CJAA 2IVNA 4H0TB 3FZKA 4B1ZA 1GLDG 1CZAN 3QBWA 3LL3A 3MN6A 4BG9A 2FXUA 1RFQA 3VGMA 1DKGD 3MK6A 4O5FA 3OHRA 4FWLA 5BRHA 4CZHA 4JAXA 3H3NO 5EY4A 5AQSA 3FLCO 2E2OA 1NMDA 3VPZA 3I33A 1V4SA 3GG4A 1K8KB 1D4XA 4FWKA 3S41A 4BRIA 4GY2B 2YHXA 3QICA 4CZEA 5E84A 1HKCA 4BRAA 3ULEB 3CI5A 2NLXA 4BRKA 1JCGA 1TYQA 4BC5A 2A40A 4PKGA 3I8BA 4BRDA 5BREA 1ZXOA 1SAZA 2KHOA 3CJ7A 4BQZA 4B1XB 3CJ1A 3FZMA 4H0VB 1DEJA 4CZJA 4H5NA 3H1VX 3IDHA 4WYBA 5AQOA 4BRGA 2VYPA 2P9NA 4B1WB 3A5LC 1QZ5A 4CZMA 1P8ZA 3VEZA 3GOIA 1J6ZA 3EZWA 2YJEA 3CQYA 3EN9A 4BRNA 3WUHA 4CZLA 3FGUA 2E2NA 4H5TA 3M3ZA 3WXKA 5AZJB 5B8HA 1QZ6A 3CETA 3EL2A 3KZBA 3ZX3A 4FO0A 3A5NC 4FWSA 1NGFA 1ATNA 4FWOA 3ZEUA 3HBTA 1ATRA 2ITMA 1QHAA 4CZGA 5JLFA 3VESA 1HPMA 1WUAA 5BR9A 2P9LA 1C0FA 4LC9B 2IVOA 4DCHA 4EFHA 1BG3A 2CGLA 3M1FA 4DB3A 3U9DA 2D4WA 1GLAG 1WOQA 2Q2RA 4HTLA 1XQSC 5KPRA 3RSEB 3LDPA 2E2PA 5JICA 3MN5A 2E8AA 3A0IX 4I6MB 5FPMA 2BTFA 1LOTB 2D0PA 2HOEA 2E2QA 3H46O 3U9ZA 5F1XA 4KBOA 1RDWX 4QS8A 5I9EB 4MLEA 3DXKB 3H6EA 1U2VA 3M6GA 2QWOA 3UKRB 3L0QA 1GLLO 4AM6A 1DGKN 4XEIA 3U4LA 1Y64A 4JD2A 3VEVA 4BC4A 3SJHA 4JHDA 2HF4A 2P9PB 2A3ZA 2FSJA 2P9UB 1KXPA 2Q36A 1X3MA 2E88A 2UYTA 2GWJA 1QQOA 3DXMB 3WQTA 2QWPA 1E4GT 2FF6A 4A61A 4EHTA 4Z94A 2HF3A 2W40A 3DWLA 3H45C 1QQMA 3R6MA 5BPNA 2ZWHA 3D2EB 3O8MA 3O80A 2FLOA 1GLBG 5AQYA 4BROA 4XH5A 3WT0A 4FOIA 5AZJA 3MDQA 1NM1A 3MMVA 3A5OC 4FWMA 2P9SB 3GL1A 2F9WA 3VF4A 1LCUA 2EWSA 2WUSA 2CH5A 2E1ZA 4B9QA 1E4FT 1NGEA 1C0GA 2HMPA 1Z6RA 5FPNA 4H0OA 1NGHA 1ATSA 4A2AA 1V4TA 3ZETB 1SQKA 1SZ2A 5AQWA 5KQ8A 2W41A 3QBXA 4F9OA 1S3XA 3DJCA 5CE3A 3G25A 4BREA 3UB5A 1HKGA 4BRHA 3ZX2A 3FZFA 5AQZA 4J8FA 5LY3A 2I7PA 4BRFA 2YJFA 2P9KB 4CZKA 3CQXA 3DAWA 1BA0A 2F9TA 5ELZA 1BA1A 4RCHA 4RTFD 4WQ5C 4BR5A 3F9MA 3D2FB 3VGKA 3VERA 1HX1A 5FPEA 3QFPA 4IO8A 4O8KA 4QS9A 3O5BA 3QFUA 1HLUA 2YHYA 4Y0WA 3CJ9A 3LDQA 3WEEB 1GLJO 4BVPA 1YXQA 1ZC6A 3C7NB 3VEWA 2QWNA 2QWQA 4JN4A 2ZF5O 3BF1A 4BR0A 2Q0UA 4QS7A 1TUYA 2I7NA 4DHYA 5AQVA 2P9PA 2P9IB 1BU6O 4ISGA 2V51B 4GNIA 5AQUA 4CBWA 1ESVA 5AQHA 3KVGA 5TKYA 3GDQA 5EX5A 3ENOA 5BN9A 5AQTA 4K42A 3R9PA 1YVNA 3VEYA 4CI6A 1NGGA 1NBWA 2QWRA 1R59O 5LJWA 1BDGA 1KAZA 2CGKA 3D2EA 4IJNA 3VOVA 3O1BA 5AQJA 2AA4A 4WQ4C 4AM7A 2ASMA 4FPBA 1BUPA 4M63C 2P9SA 3ATUA 3FFKB 3W3DA 1XUPO 2V7YA 3BEXA 3CHWA 4YDUC 5EXWA 3EO3A 4A2BA 3MCPA 2FF3B 5KPZA 2DPNA 4H0PA 2BUPA 1YAGA 2E20A 1K8KA 3HZ6A 4C23A 4HWIA 3SLCA 3TU5A 2NRHA 2AP1A 2VCPA 4A62A 4BR9A 3U8XA 3ULEA 3ATVA 3O6WA 1QQNA 3VF2A 3BF3A 2PBDA 4BRLA 3FZLA 2QXLA 2OANA 4MO5A 1T6CA 3TPQA 1S22A 3B8AX 2P9NB 4K41A 4IWVA 3KHYA 3D7EO 3BUZB 3VEXA 1MWKA 5FPDA 3EKSA 2ZGZA 3HI0A 4FWQA 4CBUA 2FSKA 5AQMA 3HTVA 1GLEG 1Q18A 3W0LA 4BC2A 2VWBA 3H1QA 3FE1A 3A8YA 3A5MC 5KPTA 3ZEUB 3FR0A 4IJAA 3ID8A 1XC3A 5E26A 5JLHA 1MDUB 4BRCA 4H5VA 4B1UB 5EVZA 4FPAA 2P9LB 3CERA 4M7XA 5AQNA 3P4IA 2P9IA 2QM1A 3WQUA 4BG8A 4NO7A 2IIRA 3VGLA 3IMXA 4DQ8A 4CZIA 4IZ9A 1BWFO 3GBTA 4ISEA 3SMPA 4PL7A 3IUCA 4H0YB 2Q31A 1YUWA 2Q0RA 4K43A 4RWTA 4EHUA 4CJ7A 1MA9B 2QWMA 5AQPA 1U6ZA 2FSNA 3QMLA 1NLVA 3WXLA 3LDOA 2IVPA 1BO5O 2A41A 1GLCG 1ZBSA 3HM8A 4H0XB 3RSEA 3CIPA 1U2VB 3FZHA 4FSVA 1Z05A 1GLFO 4FWRA 4I6MA 4BGAA 1JCEA 4BC3A 4JD2B 3AY9A 1MWMA 4JHDB 2GEMA 3DXKA 3MN7A 2YHWA 5AQLA 5BRFA 4L3QA 5EOYA 4BRQA 3UKRA 2PAVA 2QWLA 4BR2A 3EKUA 4XH4A 3UKUB 4FWNA 1TUUA 3QB0A 3ZX0A 4CZFA 3JS6A 4BR7A 1OKJA 1NGBA 5AZIB 4CBXA 4WQ5A 2Q1NA 4IXCA 3LM2A 2P9UA 4BR4A 2CH6A 2V7ZA 3H3OB 4K25A 3SMSA 3DXMA 4EIAA 2QW9A 3LM9A 4BRMA 3R8EA 1JCFA 3AARA 4MLHA 4PKIA 4NB4A 5AQQA 4MO4A 2YI1A 4PKHA 3CJCA 5AQIA 1HUXA 1NGCA 1IJJA 1H1VA 5LJVA 3C0BA 1G99A 1RGIA 2H3GX 5JMVA 5KQDA 3LDNA 4CD3A 2D1KA 3O08A 2GUPA 1HJOA 4H5RA 5BPMA 1NGJA 2YCHA 4E1JA 2A6AA 1TYQB 5AQGA 1NWKA 1NGDA 3VF6A 4M7YA 1X3NA 1T44A 3JXUA 3ZETA 3L6QA 3O1WA 4XH1A 4JNEA 2NZTA 4FL9A 5F2RA 2GWKA 1HKBA 1KAYA 3WXJA 2ZGYA 4WQ4A 3WXIA 5BPLA 1IG8A 4H03B 4BQLA 2P9KA 1BOTO 3VENA 5BN8A 3LDLA 2GELA 3L4IA 4BRPA 4YDUA 3CJBA 2CGJA 3AAQA 2V52B 4H5WA 2Q97A
chains in the Genus database with same CATH superfamily
4C1NI 4YOWA 4GV3A 4CJ5A 4R79A 2GTDA 4DSLA 4BGBA 1EQYA 2OPQA 3SK3A 4CEDA 4FWPA 4EAHD 3NVMA 3N4PA 3V1QA 1BCOA 3HSCA 3QDKA 2ASOA 3WEEA 2W00A 4R5PA 4DTNA 5BRDA 1NK0A 2OZSA 4ID1A 3O4WA 2FBTA 1Q86O 4FCYA 4BE2A 1NKEA 3CJAA 3KLFA 4H0TB 4GKKK 3J7ZO 2E6MA 3QNOA 1GLDG 4J2DA 1EO1A 3R1XA 4Z4FA 5C2DA 4BDPA 2FXUA 1DKGD 1SS6A 2Z1JA 4KHPK 4AILC 3OHRA 5BRHA 2W6KA 1NJXA 4B9NA 4BE1A 4KH6A 4I9QA 1VQ4N 1NMDA 3J81O 3KD5E 3EEQA 4JI6K 3I33A 3GG4A 1K8KB 4ZTFA 2UXBK 4ICLA 3S41A 4B8AB 4BRIA 4GY2B 4OKKA 5E84A 4EP5A 4DV7K 3CI5A 3ULDA 1ZBHA 2HHSA 3QNNA 4UY8O 4DV5K 1SUQA 3S3NA 4DTSA 4BRDA 5BREA 1ZXOA 5C0YA 2ZD1A 3TAGA 4DQRA 4BQZA 1K9MO 2QEXN 4JI7K 4FZZA 3ID6A 3KK1A 3DOKA 4YHHK 4H0VB 2BANA 4CZJA 2NNWA 1NKBA 4BRGA 3C94A 2P9NA 4ELTA 4B1WB 3EE9A 3AVLA 2HBMA 4TSXA 4BRNA 3EN9A 3ZT1A 4GKJK 2B5JA 3U3YA 4Q0BA 3TWHA 2E2NA 4H5TA 3P38A 3M3ZA 4E3SA 3KWGA 5AZJB 5B8HA 3SYZA 1YJWN 2O8FB 2QXFA 2HBJA 3CFOA 4ILHA 3KZBA 4CK1A 4FO0A 5MLCQ 3NVKA 3LP0A 1ATRA 2EHGA 4CEEA 4C1NK 3VESA 3OTOK 4DR5K 1BQMA 1GOCA 1C0FA 3V6DA 3M1FA 3E9OA 4DB3A 3OYAA 2W6LA 3U9DA 4CJTA 1GLAG 3NGYA 1WOQA 3UIQA 2UXCK 4M3WA 3HJFA 4W5NA 3MN5A 4CEZA 4CF1A 3HK2A 2WC9A 5FPMA 2YKMA 4BE0A 4WFBL 3V4IA 1RDWX 4QS8A 3DXKB 1U2VA 1SL1A 2QWOA 4OKEA 4N41A 4CGDA 3AV9A 4XEIA 1QSSA 1HMVA 3KK7A 3VEVA 4CGFA 2D0CA 3J7AP 1C0UA 4C8NA 4E19A 2A3ZA 5DMRA 1KXPA 2Q36A 2E88A 4CJKA 5C24A 3DXMB 3OJSA 1S1XA 1KLNA 3HRGA 2QWPA 1E4GT 5J2MA 3ISNC 1BQNA 3ZT4A 1HPZA 4Q5VA 1KFSA 1U47A 1G15A 3O80A 2RN2A 3LZJA 3G71N 2FLOA 4CCHA 1K6YA 1GLBG 1WLJA 5AQYA 3BGRA 5EU7A 4XH5A 4CK3A 4FOIA 4FJ9A 5AZJA 3MXIA 2G8UA 3MMVA 2X6NA 4FWMA 3SBTA 2O8FA 4MQ3A 4OPKA 2F9WA 3VF4A 1C1CA 2EWSA 2E1ZA 3SJJA 1NGEA 2HMPA 4CJUA 4H0OA 2VQFK 1ZBLA 1NGHA 2KTQA 5KQ8A 3QBXA 4F9OA 1S3XA 3DJCA 3G25A 4FYDA 3ZT3A 1HKGA 3ZSOA 3FZFA 4DR4K 5AQZA 1OVYA 3CPEA 4O8UA 2P9KB 3CQXA 3SAFA 4Z4EA 1A5VA 1CZ9A 5KRTA 2HSTA 3SUQA 2F9TA 5ELZA 2GX9A 2DY4A 1RTDA 3TTCA 4FLXA 1NK7A 2Y1IA 1SKRA 2IAJA 1J9AA 1WNSA 4L8RB 1HX1A 1IKVA 4IO8A 4O8KA 3O5BA 2YHYA 4Y0WA 4FJMA 1WB9A 3TI0A 3CYGA 3SUNA 3C7NB 1VQMN 2VGMA 5I42A 3K5OA 1Q9YA 4CJSA 3CC2N 3RVCA 4GV6A 3DLHA 4KREA 5HRSA 1ZYQA 3MXJA 2V51B 3THWA 3SI6A 3PIPL 3OS0A 1ESVA 3AVFA 2BE2A 5EX5A 2FBYA 3EE8A 3ENOA 1VSKA 5AQTA 4K42A 4B9UA 4FJ5A 1NGGA 4BDYA 1J5EK 1BDGA 3VQCA 2CGKA 3V1OA 2YNGA 4NXMK 2X6SA 3AO5A 4WQ4C 2WONA 3DI6A 2ASMA 3FFKB 3ATUA 1IH7A 5CYMA 3ZYYX 4YDUC 3K5NA 1N5YA 4E7KA 2ZE2A 2D0BA 3VQDA 5KPZA 4DTXA 2DPNA 4H0PA 3VTIA 1J5OA 2XHBA 2E20A 3HZ6A 4F2SA 4CESA 1TKTA 2NRHA 2VCPA 3WNFA 2KLAA 3U8XA 4KV8A 4DLEA 3QEXA 1QQNA 3CC7N 3BF3A 2QK9A 4Z4HA 2QXLA 3HP9A 1VQ8N 1S22A 3B8AX 2HHIA 1JL1A 3DRPA 3F2KA 4JS5A 1S1UA 4A5BA 5FPDA 2ZGZA 4FWQA 1VSEA 3ZSQA 1Q18A 2IC3A 4E7HA 2B6AA 3H1QA 3FE1A 4DUZK 4XIUA 3ZEUB 1EXQA 2HB5A 1WAJA 2XY6A 2YX6A 3CCSN 1WSGA 4O0IA 4E1MA 1S1WA 4FPAA 3VQPA 3P4IA 3AO1A 3ENBA 4NO7A 2IIRA 3R3LA 1I94K 4E72A 1KCFA 4JI4K 3MAQA 1C1AA 3VGLA 3OYNA 1VQLN 1BWFO 3GBTA 4AHVA 5LMNK 3BZKA 3IUCA 2UU9K 3SUOA 4H0YB 4FJ7A 1GOAA 3AO2A 2Q0RA 3I8DA 4QCLA 4EHUA 1U6ZA 2YKNA 4N47A 1BI4A 3QMLA 2IVPA 2A41A 1ZBSA 3DLGA 4YOXA 1LAWA 2F8SA 5M1FA 1GLFO 2QKKA 1ASUA 1JCEA 4WFNL 1T03A 2GEMA 4DQPA 1TVRA 3ZLJA 5AQLA 5HLFA 1DLOA 3L8BA 1RILA 5J2QA 2QWLA 4BR2A 4DR1K 3EKUA 3SQ4A 4XH4A 5HP1A 1JLAA 1TUUA 3C6UA 3JS6A 3OYEA 2B4JA 1B9DA 3MEGA 4JV5K 4WQ5A 3CQ8A 1KVAA 4ZTJA 2V7ZA 3MWPA 2QW9A 1JCFA 1ZBIA 4MLHA 3OYIA 1W2BM 3CCEN 3O4NA 1RBRA 4MO4A 3RR8A 2IOCA 4CJQA 1EWRA 4AHCA 2HNYA 5J1EA 1HUXA 1NGCA 1RGIA 2R7YA 4LF4K 4CD3A 2D1KA 1IBMK 4CW7B 4H5RA 3LALA 3M8PA 2YCHA 1RT7A 4YY3K 1NJIO 2A6AA 1TYQB 5M1QA 3VF6A 3OJUA 1T44A 1VQ6N 3ZETA 1C0MA 3O1WA 4KB0A 4CGIA 3C6HA 4JKCA 5LMUK 2GWKA 4E7IA 1HKBA 1KAYA 3MWTA 1IG8A 2DFFA 4BQLA 4J2BA 4DR6K 5BN8A 3OYFA 2GELA 4BRPA 3CJBA 4FLUA 5M1NA 3AAQA 4C8MA 2V52B 3BP8A 1KAXA 2A5XA 5KI6A 2C1IA 3IFRA 3D2FA 2X74A 3QEPA 1QE1A 3DLLL 1X9JA 4DF8A 4FJIA 1NGIA 4B1YB 3J8AA 3T3FA 1K8AO 1EETA 3VQ5A 1VK0A 5AFUA 4DS5A 4BVOA 5F0XA 1WSJA 5AQRA 5AFUH 1NGAA 1YJNN 4B1VA 4CVNE 1OH6A 4HUEA 4JS4A 3FZKA 4B1ZA 4KHWA 1WN7A 5FDLA 4A5AA 1RFQA 3VGMA 4N76A 2P1JA 1VSMA 4YOVA 3WNGA 1L3UA 4LY7A 3K9KA 4I7FA 4FWLA 3V9XA 3QETA 3THVA 5EY4A 1F21A 1UOCA 3VN5A 3PO4A 2NRZA 3FLCO 1SKSA 2G8KA 4M3ZA 3EYZA 1V4SA 4PQUA 1QSLA 2YHXA 3QICA 4YOYA 3K58A 1HKCA 2KQ2A 4BRAA 4CJ3A 1TYQA 4B3TK 2A40A 1SV5A 4PKGA 3RTVA 1TK0A 1RT3A 3O4QA 3AVNA 2ZJQL 3CF5L 2RPIA 4B1XB 3AO3A 4KO0A 3FZMA 3J7YP 1DEJA 4H5NA 4LSNA 3KK3A 1VSJA 5AQOA 3WNEA 3NCIA 1QZ5A 1P8ZA 3VEZA 2WOMA 1J6ZA 3CQYA 4U67L 1S6QA 1XHXA 4MDBA 2IS3A 4DKWA 1N33K 4WFAL 1MU2A 4NLCA 3HPGA 3PSFA 3CFPA 1ATNA 3HBTA 1KQSM 2VG6A 2HVIA 4JKDA 4FW1A 5JLFA 3NMUA 1WUAA 3L3UA 3O9QA 2VWJA 3TSUA 1XC9A 4CE9A 4QOZB 4LC9B 2IVOA 1Q7YO 4DCHA 4X66K 4EFHA 1BG3A 3HP6A 2CGLA 1HQUA 2E5LK 3E66A 4AQYK 3VQQA 2NRTA 3ZT2A 4XJXA 4KAZA 2OPRA 1N8RO 4NYFA 3RSEB 4DQIA 2E2PA 5IWAK 3A0IX 1KSPA 1LWCA 2BGGA 4CJEA 3OYHA 3FFIA 5F1XA 3H46O 2F96A 4KBOA 5I9EB 4MLEA 1E3MA 3NE6A 3TARA 2O8DB 4RW6A 2PZSA 1CXUA 3M6GA 3UKRB 4AF1A 4JKBA 4DS4A 3U4LA 2G8WA 1Y64A 3DRRA 2HHHK 4NYNA 3F5TA 3NF7A 3K2PA 1X3MA 4M3XA 3WQTA 3F73A 4DU3A 4FM1A 4W5TA 4A61A 4EHTA 4HVJA 5D3GA 2W40A 3LP2A 2E4LA 3HVRA 4FJKA 1QTMA 2ZWHA 4B9TA 2QA4N 4NCAA 4B9MA 3MDQA 3NBPA 4KHQA 4CIEA 3G0ZA 3GL1A 4M3YA 2UUCK 3LP3A 5HOOA 4DV4K 1C0GA 3AVIA 1RCHA 4CHQA 2UUAK 1SQKA 1SZ2A 5AQWA 1J53A 2W41A 4OGCA 4OPHA 4GV9A 4H4MA 3V1RA 2UUBK 3O9SA 1U04A 5LY3A 1RNHA 2YJFA 4CZKA 1XNQK 3DAWA 4Z4IA 1VSDA 3KK2A 1YI2N 1N6QA 1NG9A 4ID5A 4RCHA 3AA3A 3SQ0A 3KJVA 3NH0A 4CGHA 4BWJA 3T19A 3VERA 2RHKA 4DV0K 4DU4A 3CJ9A 4NCGA 3CCRN 3RMAA 2QWQA 4JN4A 3PIOL 2Q0UA 2KZZA 2YHAA 1NJYA 4DHYA 4CFBA 4ISGA 4GNIA 5DK5A 3T1AA 4CF9A 1IBLK 2P5OA 5FRNA 4RW4A 3TSQA 3JYTA 3HPOA 5K14A 4YNQA 1TGOA 4K0KK 5BN9A 1HNWK 3R9PA 4CI6A 3VEYA 5M1KA 4GVEA 1KAZA 2O4IA 4IJNA 4DV3K 3O1BA 2XO7A 1BUPA 4M63C 3W3DA 4B3MK 3P1GA 3CHWA 5EXWA 4CJFA 2YNIA 1IKWA 1YAGA 1K8KA 1QVFM 1ASVA 2IDOA 2Z1HA 1RDCA 2AP1A 1ASWA 3QEWA 3KLEA 3FZLA 4WE1A 2G8HA 2OANA 4MO5A 2OTJN 1T6CA 3ZSZA 3TPQA 4DUYK 3KHYA 2O8CB 2RKIA 3I0RA 4HUGA 3EZ5A 2D5RA 3TTFA 3HI0A 3HPHA 2FSKA 4OPAA 5AQMA 3HTVA 1KRPA 3QIOA 3ALYA 2IGIA 3A8YA 3A5MC 4Z4GA 1XC3A 1VSIA 5JLHA 4OVLA 3CCUN 4IFEA 2VQEK 4DFMA 4H5VA 5EVZA 2OPSA 2P9LB 1HYVA 1YITN 4DQ8A 4IZ9A 4ISEA 4PL7A 5J2PA 4DSJA 4FJXA 4K43A 4RWTA 1VQON 3NAEA 1MA9B 3HM9A 4OGEA 1Q9XA 1GLCG 4CEOA 1HYSA 1W7AA 2VG7A 4JKFA 3CIPA 3FZHA 1L3VA 4CK2A 1EKEA 3KKRA 4FWRA 4JI8K 4BC3A 4JD2B 3AY9A 4JHDB 3LAKA 3DXKA 1TL1A 3K5LA 4FJGA 4L3QA 4BRQA 3UKUB 4JI2K 4FWNA 1JLEA 1EX4A 3L2VA 3CM6A 4BR7A 3KLGA 1NGBA 4AH9A 1JKHA 4DQQA 2Q1NA 4IXCA 3LM2A 4BR4A 3CPWM 2CH6A 4K25A 3H3OB 3DXMA 2OA8A 4C8LA 2O8CA 1YF5L 3ZSWA 3OYCA 2ZQBA 3AARA 3QO9A 4JRQA 1QSYA 2YI1A 1IO2A 4H4OA 3ZSXA 4K8XA 4B8CA 1G99A 3CC4N 3V9WA 1TL3A 1TK8A 5CHIA 1S1TA 4J2AA 3O3GA 4FK2A 3E01A 1NWKA 1NGDA 1RTHA 1JXBA 4M7YA 5J2NA 4F8RA 1X3NA 2HNZA 3IRXA 3K57A 3L6QA 5SZTA 4FLZA 4XH1A 2NZTA 3DM2A 4FL9A 4O4GA 3PV8A 4KHYA 1KVCA 4WQ4A 4DQSA 4FK0A 2P9KA 3VENA 3SQ1A 4YDUA 4B3OA 1HJRA 3NHGA 1YTUA 4CEAA 3UE5A 4CD1A 2HHVA 1XMQK 1KFDA 3QLHA 3HOTA 1JLQA 1YT3A 4M3RA 4CJRA 5AQKA 2A1RA 3ENHA 4CIFA 1ITGA 1T6DA 3K59A 5ADXA 5AQFA 3C7NA 1OH5A 5ADXH 4H8KA 4ISFA 2ASPA 1KC8O 3UKUA 2J4RA 1U49A 4OLBA 1CLQA 4AHSA 4B3SK 3C95A 1HNVA 2XY8A 4GMJB 5AQXA 1HYZA 4JKHA 5KGXA 1FW6A 3S5TA 4FLVA 4FLTA 1CZAN 3QBWA 1LAVA 3LL3A 5JVGL 3LWMA 3OY9A 1U48A 3MEEA 1SKWA 1JJ2M 3IAYA 1LWFA 3MK6A 1IV0A 3AVBA 3CM5A 4O5FA 4W5QA 3QINA 4CZHA 4LF5K 4I9LA 3H3NO 4AHRA 3PSIA 2E2OA 3VPZA 1UA0A 1WSHA 4IFYA 1IKYA 3NF8A 4CJPA 4E1NA 3O3HA 3OS2A 1NK8A 3ULEB 3D0PA 4JKGB 3ZSVA 2NLXA 4BRKA 1JCGA 1M1KO 3LAMA 2D0AA 2PFUA 1SAZA 2KHOA 3CJ7A 3RMBA 4KB1A 4RW9A 5C2FA 1A5WA 3KLHA 4BEBA 1VRTA 1NOYA 1RBTA 3H1VX 1WBBA 5C42A 2VYPA 4JYAK 1R0AA 3A5LC 3L2WA 4LFCK 3GOIA 4KH5A 4DV2K 2F8TA 3WUHA 4C8OA 3FGUA 4GVMA 3SBGA 3HVTA 4KPYA 2HHTA 2Q3SA 3CETA 3I56N 3G6EN 1TKZA 3SPYA 2Y1JA 1RT4A 3ZX3A 5C25A 3A5NC 3C6AA 1BGXT 3L2UA 2LSNA 2DFHA 3ZEUA 1FKPA 1REVA 2HHXA 2P51A 2ITMA 2G8IA 4CZGA 3M8QA 3O9UA 3Q7CA 1HPMA 3TAQA 3SUPA 1TAQA 1XNRK 3SAHA 4LH4A 3CXCM 2D4WA 1HNXK 2HMIA 4LH5A 4RG8A 1NMNA 1NJZA 4A57A 5JICA 5HBMA 4CJLA 2E8AA 3T1HK 4I6MB 1LOTB 2D0PA 5TKWA 5JVHL 3VQBA 3AA5X 2RF2A 5KGWA 2Z1IA 3L0QA 1DGKN 3JSMA 1RDUA 1RTJA 4JKGA 4DMNA 3SJHA 4KHUA 4G9ZA 2P9PB 2NRRA 2FSJA 1Y97A 2P9UB 3DLRA 1VQKN 2UYTA 2GWJA 4DSKA 2FF6A 3AA2A 2HF3A 5I3UA 5LL6Z 2HHQA 3H45C 4B9SA 3HYFA 1QQMA 5GAHP 3D2EB 3O8MA 3S9HA 4CHNA 3QEIA 4BROA 4IEIA 1D8YA 4O0JA 3AVKA 4DV6K 3P39A 1YJ9N 1NM1A 1P90A 4C8KA 4DTRA 4M45A 4B9QA 3LANA 5FPNA 1UWBA 1ATSA 4A2AA 1V4TA 3SCXA 4LF9K 2KW4A 4BREA 4BRHA 4Y1CA 1W9HA 2NUBA 5JS2A 2I7PA 4BRFA 4CHOA 4DFJA 1FXXA 4IKFA 1NNEA 1BA0A 5CZ1A 4DSFA 3L4QA 4RTFD 5SWMA 4LF6K 3CMEN 4EP4A 3KIOA 3F9MA 1LW2A 4QAGA 1B92A 3VGKA 1X1PA 5FPEA 4QS9A 4ILGB 4KTQA 1VSFA 3LDQA 3WEEB 1GLJO 1BIUA 1YXQA 3DMJA 3VEWA 2ZF5O 3BF1A 4JKEA 4QS7A 3TTDA 4WCEL 3SV3A 1NK4A 3ZSYA 2ZJPL 1TAUA 1KLMA 5AQVA 2P9PA 1YVUA 1KTQA 5CR4A 2OYQA 4FZXC 2E6LA 5AQUA 4CBWA 4HHTA 5AQHA 3KVGA 5TKYA 1BIZA 3GDQA 4GW6A 3LPUA 1S6PA 4DSIA 1NBWA 2QWRA 5CZ2A 4KHNA 1CXQA 1W0HA 3D2EA 3B6PA 2PY5A 4BACA 1EP4A 4KRFA 5AQJA 3SPZA 2AA4A 3O3FA 3NDKA 2JGUA 4AM7A 1IBKK 3THXB 3CCLN 2V7YA 3TAFA 4FVUA 1Q82O 4A2BA 4JKAA 2FF3B 3K0SA 3JAMO 4FJHA 3IS9A 3PLAA 4HWIA 3SLCA 4DTOA 3VA3A 4BR9A 1WSFA 3O9RA 3VF2A 2PBDA 4BRLA 4CEFA 2P9NB 4F3TA 3MEDA 3CG7A 2JWKA 3IG1A 1BL3A 3VEXA 3BY5A 2GUIA 3P5JA 4X65K 4W5RA 1I3AA 4DWIA 4JK8A 3W0LA 4BC2A 2VWBA 3MX2A 3VQ9A 3L3VA 5IT9O 3OA9A 4KHSA 5KPTA 4LF7K 3FR0A 3DYAA 4IJAA 3ID8A 1S1VA 3TSPA 1MDUB 2HW3A 3HSTB 5AQNA 2QM1A 3WQUA 3J80O 4U7BA 3D45A 4MDAA 1U4BA 1RT1A 3SMPA 1WSIA 5GIPA 4FLYA 1LW0A 5FROA 2AJQA 2Q31A 3WNHA 1YUWA 4DR7K 3OYDA 4CJ7A 3T1YK 1B9FA 2FSNA 4WF9L 3AVHA 3ZT0A 1NLVA 3WXLA 4AHUA 1UAXA 1XHZA 1HNZK 1BO5O 4V19S 4CJ4A 3L2RA 4FK4A 4H0XB 3RSEA 3LZIA 4Z4CA 3DLKA 1U2VB 2O8EB 3OYGA 4E89A 4F2RA 4FSVA 1Z05A 3M5RA 3THXA 3MCAB 1VQ9N 4NCBA 3VQ8A 3NFAA 4O5BA 4DR3K 2O4GA 4JI0K 2O8DA 3MN7A 3AVMA 1Q81O 5EOYA 3UKRA 1NJWA 2RE2A 4W5OA 1JL2A 4IG0A 3ZX0A 4CZFA 4FJNA 5HRPA 1TV6A 1OKJA 4OLAA 5H1SQ 5AZIB 1YTAA 3Q7BA 2ZJRL 3CD6N 2FC0A 3O9TA 5C10A 1ZBFA 2FBVA 4PKIA 4I2PA 3OYBA 3DLBA 4E0DA 5GAGP 1I39A 4FJLA 4KI4A 4IDHA 3OYKA 4PY5A 2JLEA 4Y1DA 4CF0A 1RBSA 5AQIA 3HT3A 4IOAL 1IJJA 1T7PA 4HCCA 1N34K 1H1VA 5C12A 3OS1A 3CFRA 2HNDA 5KQDA 1SL0A 5KRSA 3LDNA 1HJOA 3SV4A 5BPMA 1NK5A 2G8VA 1NGJA 4J2EA 3OYJA 3NGZA 3M8SA 3PUFA 3BDPA 3JXUA 3RWUA 1JLFA 4JNEA 4YFUA 4E7LA 3QEVA 3E1YA 2VG5A 3WXIA 4N56A 1RDAA 5BPLA 1X9SA 2WFBA 2KFZA 3LDLA 4NXNK 3L4IA 4FJJA 3NGIA 2CGJA 4LD0A 3VQEA 1GOBA 4CHZA 4H5WA 4IOCL 1Q8IA 2O8EA 2A42A 3TR8A 3C65A 3VQAA 3KLIA 3V9SA 3V9ZA 4EZ9A 3GE1A 1Z25A 2D0OA 5AR0A 4PL8A 1K73O 1QS4A 3THWB 1RT6A 3AA4A 3S3OA 2E1YA 1TKXA 3THYB 1DTQA 4FOEA 3VEOA 4LSLA 4B3RK 3VETA 3EY1A 5AZIA 3AAPA 3TABA 4X64K 3MN9A 2IVNA 4PUOA 4FM2A 3VQ7A 1ILYA 5GIOA 4UQGA 3MN6A 4IG3A 1XMOK 4BG9A 5AJ3K 4EZ6A 4OX9K 2YHBA 1QHTA 4JAXA 2QI2A 5CY4A 5AQSA 2FBXA 4OKJA 4DG1A 1RT5A 1O1WA 1ZBUA 1D4XA 4FWKA 5KTQA 4CZEA 2ATQA 4MFBA 1HR0K 3AVAA 4BC5A 1VQPN 4CJWA 3RR7A 3I8BA 4CFCA 2GBZA 4RW7A 4CEQA 1Z26A 1IG9A 3K5MA 1J54A 3VA0A 3AGRA 3CJ1A 1RDDA 3IDHA 4WYBA 1O13A 3VTHA 4DTPA 4CIGA 4JI3K 4CZMA 3SQ2A 3EZWA 3NF9A 2YJEA 4CJVA 4CZLA 3WXKA 1WSEA 4DFPA 2VGNA 1KVBA 1L5UA 1QZ6A 3EL2A 2YNHA 2QTDA 1KD1O 4FWSA 3LPTA 1NGFA 3AO4A 4FWOA 1DT9A 1FK9A 1QHAA 3THYA 2DFEA 3VQ6A 3PX0A 2EX3A 4LFAK 5BR9A 2P9LA 4B9VA 2G8FA 2XY7A 3SAGA 1C0TA 4OPJA 1BI4B 4DTUA 3T7ZA 4ELUA 2Q2RA 3CCJN 4HTLA 4BY9C 1XQSC 5KPRA 1TK5A 3LDPA 3ITHA 1QQCA 1SL2A 1VQNN 2KFNA 3AVCA 3PY8A 3CYMA 4KTWA 2BTFA 2HOEA 3U9ZA 4CFDA 2E2QA 4I2QA 5JENA 2QKBA 3H6EA 4NLBA 2Z1GA 1NU0A 2HVHA 3CCQN 1OVQA 1S9EA 3CCVN 1GLLO 4AM6A 3LWLA 1YIJN 4JD2A 4BC4A 3TANA 4JHDA 2HF4A 1VQ7N 2O8BB 1U45A 1VAZA 1CZBA 1QQOA 4YORA 4FW2A 4K8ZA 4Z94A 5E41A 4CF8A 4CHYA 1M90O 3ZCMA 3DWLA 4B9LA 1RT2A 3AVGA 4OO1J 3R6MA 2HHUA 5BPNA 3KWIA 5GAEP 4FXDA 3E9LA 3P83D 4KH4A 3TAEA 3WT0A 3QESA 3U6FA 1IKXA 3A5OC 3ASMA 3OVNA 2P9SB 1HQEA 3AVJA 5A2QO 1LCUA 3MXMA 2WUSA 2CH5A 3K9JA 4CEBA 3RMDA 4CGJA 1E4FT 4YOTA 1BHLA 1Z6RA 3MECA 2P5GA 5HRNA 5BR8K 3ZETB 2OZMA 5CE3A 5DM7L 3UB5A 2ZM6K 3ZX2A 2DTUA 4CGGA 4FM0A 4J8FA 3V9UA 3NH1A 3OYLA 3OBYA 1NOZA 4BWMA 2JWLA 4PHTX 1BA1A 4JLHA 3OYMA 3RRGA 2YNFA 4B08A 4BE7B 4WQ5C 4BR5A 1VQ5N 2KKZA 2NRWA 1X9WA 4DFKA 5FRMA 3D2FB 4O44A 2HBKA 4KKOA 3CMAN 3QFPA 3QFUA 1HLUA 1VSLA 2HHWA 4OJRA 1JXEA 3QERA 4JK7A 3RRHA 4BVPA 1ZC6A 1W97L 3N4QA 2HBLA 2QWNA 3TAPA 1D9FA 1BCMA 1N32K 3TAMA 5GINA 5M1PA 4BR0A 4M42A 1NK6A 1TUYA 1HRHA 2I7NA 4RW8A 3C6TA 2O8BA 4DSEA 2P9IB 1BU6O 4JI5K 4Z0UA 1QVGM 3SZ2A 2F4VK 1OH8A 1VHXA 2BDPA 3T69A 1T8EA 1YVNA 4IBNA 1WBDA 3P31A 2KZMA 1R59O 1L3TA 5LJWA 3KD1E 5C15A 4E7JA 1RTIA 3VOVA 1BISA 4FPBA 2NRXA 2P9SA 3PX6A 1XUPO 4G1QA 3BEXA 5T7BA 3I0SA 3EO3A 1C6VA 4JI1K 3MCPA 2BUPA 1JLBA 4KTZA 4A59A 4C23A 1EWQA 3TU5A 4DU1A 4CF2A 4CERA 3HXMA 4A62A 3NF6A 3L2QA 3ULEA 3ATVA 3O6WA 3SNNA 2W42A 3DRSA 5HRRA 3G4SN 2OCEA 2WTUA 1D9DA 4FZYA 4K41A 4IWVA 3HOSA 3D7EO 3BUZB 1NKCA 1MWKA 2XRIA 3EKSA 4M3TA 4CBUA 3CCMN 3RMCA 4ZHRA 1GLEG 4YOUA 4IOXA 1VSHA 4KFBA 3D6RA 3QIPA 2I5JA 3VQ4A 1T3VA 4HTUA 4O55A 5E26A 3WXMB 3AGKA 1S5JA 4BECA 3G10A 4BRCA 4B1UB 4JRPA 4IO9L 1A5XA 3CERA 4M7XA 5FLXO 2WBNA 2P9IA 4JEPA 4BG8A 1LV5A 4DR2K 1JLGA 3BZCA 3DOLA 3IMXA 4CFAA 3LP1A 4CZIA 4FJ8A 2UXDK 2PYLA 2A1SA 1OH7A 3F9KA 2OTLN 3OBWA 2QWMA 4IEEA 5AQPA 3LDOA 3MX5A 3B6OA 4X62K 4DF4A 5HROA 4IDKA 2OPPA 3HM8A 3PX4A 4PA1A 1YHQN 1NK9A 1FJGK 4F3OA 4I6MA 4BGAA 4N5SA 4DTMA 3KTQA 2X78A 5JS1A 1MWMA 2ITGA 3KKSA 3HO1A 3HL8A 1D5AA 2YHWA 4DLGA 5BRFA 4DV1K 2PAVA 5M1OA 5DM6L 3M8RA 3H08A 1HNIA 3QB0A 2NRVA 4M3UA 4JK9A 3OW2M 4CBXA 2C1GA 2P9UA 4FVMA 1LWEA 3SMSA 1RBVA 4EIAA 3LM9A 4BRMA 1XI1A 1RBUA 3R8EA 4HCBA 4NB4A 5GADP 5AQQA 1TKDA 4ILJA 3NH2A 1S72N 3E9PA 4LFBK 3IKMA 4PKHA 4BDZA 3CJCA 1S9GA 1WAFA 1N36K 2PYJA 5LJVA 3C0BA 1T05A 1VRUA 2H3GX 5JMVA 5HL7L 4CHPA 3VMFB 3O08A 4CECA 2GUPA 4F4KA 4M41A 4FLWA 1XWLA 1X9MA 3LDSA 4E1JA 1UA1A 3U3GA 2YV0X 5AQGA 4DTJA 3I55N 4PWDA 1FKOA 4KI6A 4AHTA 4HUFA 2BH1A 1JLCA 4ELVA 2XY5A 1C1BA 5F2RA 3DLEA 3A2FA 3WXJA 2ZGYA 2VWKA 5CYQA 2ETJA 2GV9A 3ZSRA 4H03B 1DTTA 4IFVA 1RDBA 3S3MA 1BOTO 3PO5A 1L3SA 2F7TA 3V81A 4LF8K 2Q97A
chains in the Genus database with same CATH topology
4C1NI 4YOWA 3BP8A 3UE5A 1KAXA 2A5XA 4CD1A 4GV3A 4R79A 2A42A 2GTDA 2C1IA 3C65A 3HOTA 3IFRA 4BGBA 1EQYA 3D2FA 5AQKA 3SK3A 3ENHA 4FWPA 3DLLL 3GE1A 1X9JA 2D0OA 1T6DA 5AR0A 3NVMA 4EAHD 4PL8A 1K73O 1NGIA 3N4PA 3HSCA 3QDKA 2ASOA 3WEEA 4B1YB 5AQFA 3C7NA 3J8AA 5ADXA 1K8AO 5ADXH 2E1YA 2W00A 4ISFA 2ASPA 1KC8O 4FOEA 3UKUA 2J4RA 3VEOA 5BRDA 3VETA 5AFUA 5AZIA 4BVOA 5F0XA 3O4WA 3AAPA 5AQRA 5AFUH 5AQXA 1NGAA 1Q86O 4JKHA 3MN9A 4B1VA 3CJAA 2IVNA 1YJNN 4H0TB 3J7ZO 3FZKA 4B1ZA 5GIOA 1ILYA 1GLDG 1CZAN 3QBWA 1EO1A 3LL3A 3R1XA 5JVGL 3MN6A 5C2DA 4A5AA 1JJ2M 4BG9A 2FXUA 1RFQA 3VGMA 1DKGD 1SS6A 3MK6A 4YOVA 4O5FA 3K9KA 3OHRA 4FWLA 5BRHA 4CZHA 4JAXA 2QI2A 3H3NO 4KH6A 5EY4A 5AQSA 2NRZA 3FLCO 1VQ4N 2E2OA 1NMDA 3VPZA 3I33A 1V4SA 3GG4A 1K8KB 1D4XA 4FWKA 3S41A 4BRIA 4GY2B 2YHXA 3QICA 4CZEA 4YOYA 5E84A 1HKCA 4BRAA 3ULEB 4JKGB 3CI5A 2NLXA 4BRKA 1JCGA 1TYQA 4BC5A 1M1KO 1VQPN 2A40A 4PKGA 4UY8O 3I8BA 4BRDA 5BREA 1ZXOA 2PFUA 5C0YA 1SAZA 2KHOA 3CJ7A 2ZJQL 3CF5L 4BQZA 1K9MO 2QEXN 3ID6A 4B1XB 5C2FA 3AGRA 4BEBA 3CJ1A 3FZMA 4H0VB 1DEJA 4CZJA 4H5NA 3H1VX 2NNWA 3IDHA 4WYBA 5AQOA 1O13A 4BRGA 2VYPA 3VTHA 2P9NA 4B1WB 3EE9A 3A5LC 1QZ5A 4CZMA 1P8ZA 2HBMA 3GOIA 4KH5A 1J6ZA 3VEZA 3EZWA 2YJEA 3CQYA 3EN9A 4BRNA 3WUHA 4U67L 4CZLA 3FGUA 2E2NA 4H5TA 3P38A 3SBGA 3M3ZA 4MDBA 3WXKA 3KWGA 5AZJB 2VGNA 5B8HA 1YJWN 4DKWA 1QZ6A 3CETA 3I56N 3G6EN 3EL2A 2HBJA 4WFAL 4ILHA 4NLCA 3KZBA 2QTDA 1KD1O 3ZX3A 4FO0A 3A5NC 3C6AA 4FWSA 5MLCQ 3NVKA 1NGFA 1ATNA 4FWOA 3ZEUA 1DT9A 3HBTA 1KQSM 1ATRA 2ITMA 1QHAA 4CZGA 4JKDA 5JLFA 3Q7CA 3O9UA 3VESA 4C1NK 3NMUA 1HPMA 1WUAA 5BR9A 2P9LA 3O9QA 3TSUA 1C0FA 4LC9B 2IVOA 1Q7YO 4DCHA 4EFHA 3SAGA 1BG3A 2CGLA 3M1FA 3E9OA 4DB3A 3SAHA 3U9DA 3CXCM 2D4WA 3T7ZA 1GLAG 3E66A 1WOQA 2NRTA 2Q2RA 4XJXA 3CCJN 4HTLA 1N8RO 4BY9C 1XQSC 5KPRA 3RSEB 3LDPA 2E2PA 4A57A 5JICA 1VQNN 3MN5A 2E8AA 3A0IX 2WC9A 4I6MB 5FPMA 2BTFA 1LOTB 2D0PA 2HOEA 2E2QA 3H46O 5TKWA 3U9ZA 4KBOA 5F1XA 4WFBL 1RDWX 4QS8A 5I9EB 5JVHL 4MLEA 3DXKB 3H6EA 4NLBA 1U2VA 3M6GA 2QWOA 3CCQN 3UKRB 3L0QA 1GLLO 4JKBA 4AF1A 1DGKN 4AM6A 4XEIA 3U4LA 3CCVN 1RDUA 1YIJN 4JKGA 3KK7A 1Y64A 4JD2A 3VEVA 4BC4A 3SJHA 4JHDA 2HF4A 1VQ7N 4G9ZA 2P9PB 2A3ZA 2NRRA 2FSJA 3F5TA 2P9UB 1KXPA 2Q36A 1X3MA 1VAZA 2E88A 2GWJA 2UYTA 1VQKN 1QQOA 4YORA 3DXMB 3WQTA 3HRGA 2QWPA 1E4GT 2FF6A 4A61A 4EHTA 4Z94A 2HF3A 1M90O 2W40A 3DWLA 3H45C 1QQMA 5GAHP 4OO1J 3R6MA 5BPNA 2ZWHA 3D2EB 3KWIA 3O8MA 3O80A 2QA4N 5GAEP 3G71N 2FLOA 1GLBG 3E9LA 5AQYA 4KH4A 4BROA 4XH5A 3WT0A 4FOIA 4IEIA 5AZJA 3MDQA 3P39A 1YJ9N 1NM1A 3MMVA 3A5OC 4FWMA 3SBTA 1P90A 2P9SB 3GL1A 2F9WA 3VF4A 1LCUA 2EWSA 2WUSA 2CH5A 3K9JA 2E1ZA 4B9QA 5HOOA 1E4FT 1NGEA 1C0GA 2HMPA 4YOTA 1Z6RA 5FPNA 4H0OA 1NGHA 1ATSA 4A2AA 1V4TA 3ZETB 1SQKA 1SZ2A 5AQWA 5KQ8A 2W41A 3QBXA 4F9OA 1S3XA 3DJCA 4OPHA 3G25A 4BREA 5CE3A 5DM7L 3UB5A 1HKGA 4GV9A 4BRHA 3ZX2A 3FZFA 5AQZA 1OVYA 4J8FA 3CPEA 3O9SA 5LY3A 2I7PA 3OBYA 4BRFA 2YJFA 2P9KB 4O8UA 3CQXA 3DAWA 4CZKA 3SAFA 2HSTA 1BA0A 2JWLA 2F9TA 4PHTX 5ELZA 2GX9A 1BA1A 3L4QA 1YI2N 4RCHA 4RTFD 3TTCA 4BE7B 4WQ5C 4BR5A 1VQ5N 2KKZA 3CMEN 2NRWA 3F9MA 3D2FB 3VGKA 2HBKA 3VERA 1HX1A 2RHKA 5FPEA 3CMAN 3QFPA 4IO8A 4O8KA 4QS9A 3O5BA 3QFUA 1HLUA 2YHYA 4ILGB 4Y0WA 3CJ9A 3LDQA 4JK7A 3CCRN 3WEEB 1GLJO 4BVPA 1YXQA 1W97L 1ZC6A 3C7NB 2VGMA 2HBLA 2QWNA 3N4QA 3VEWA 1VQMN 2QWQA 4JN4A 5GINA 2ZF5O 3BF1A 5M1PA 4BR0A 3PIOL 2Q0UA 4JKEA 4QS7A 3TTDA 4WCEL 1TUYA 3CC2N 3RVCA 4GV6A 2I7NA 2ZJPL 4DHYA 5AQVA 2P9PA 2P9IB 1BU6O 4ISGA 2V51B 4GNIA 5CR4A 3PIPL 1QVGM 5AQUA 4CBWA 1ESVA 5AQHA 3KVGA 3TSQA 5TKYA 3GDQA 5EX5A 3EE8A 3ENOA 3T69A 5BN9A 5AQTA 4K42A 3R9PA 1YVNA 3VEYA 4CI6A 1NGGA 5M1KA 1NBWA 2QWRA 3P31A 4GVEA 1R59O 5LJWA 1BDGA 5C15A 1KAZA 2CGKA 3D2EA 4IJNA 3VOVA 3O1BA 5AQJA 2AA4A 4WQ4C 4AM7A 2ASMA 4FPBA 1BUPA 4M63C 2NRXA 2P9SA 3ATUA 3FFKB 3W3DA 3CCLN 1XUPO 2V7YA 4FVUA 3BEXA 3CHWA 4YDUC 5EXWA 3ZYYX 3EO3A 1Q82O 4A2BA 4JKAA 3MCPA 2FF3B 5KPZA 2DPNA 4H0PA 3VTIA 3PLAA 2BUPA 1YAGA 2E20A 1K8KA 3HZ6A 4A59A 4HWIA 3SLCA 4C23A 1QVFM 3TU5A 2NRHA 2AP1A 2VCPA 2KLAA 4A62A 4BR9A 3U8XA 3ULEA 3ATVA 3O9RA 3O6WA 1QQNA 3VF2A 3CC7N 3BF3A 2PBDA 3G4SN 4BRLA 3FZLA 2QXLA 2OANA 4MO5A 2OTJN 1T6CA 1VQ8N 3TPQA 1S22A 3B8AX 2P9NB 4K41A 4IWVA 3KHYA 2JWKA 3HOSA 3D7EO 3BUZB 3VEXA 1MWKA 3F2KA 4A5BA 5FPDA 3TTFA 2ZGZA 3EKSA 3HI0A 4FWQA 4CBUA 2FSKA 4OPAA 5AQMA 3CCMN 3HTVA 1GLEG 1Q18A 4JK8A 4YOUA 4IOXA 3D6RA 3W0LA 4BC2A 2VWBA 3H1QA 3MX2A 3FE1A 3A8YA 3A5MC 3OA9A 4IOCL 5KPTA 3ZEUB 3FR0A 1T3VA 4IJAA 3ID8A 1XC3A 5E26A 3WXMB 5JLHA 3CCUN 3AGKA 3TSPA 1MDUB 2YX6A 4IFEA 3CCSN 4BECA 4BRCA 4H5VA 4B1UB 5EVZA 4FPAA 4IO9L 2P9LB 3CERA 4M7XA 5AQNA 3P4IA 2WBNA 2P9IA 2QM1A 3ENBA 4JEPA 4NO7A 2IIRA 3R3LA 3WQUA 4BG8A 4U7BA 1YITN 3VGLA 4MDAA 3IMXA 4DQ8A 4CZIA 1VQLN 4IZ9A 1BWFO 3GBTA 4ISEA 3SMPA 2OTLN 4PL7A 3IUCA 5GIPA 4H0YB 2Q31A 3OBWA 1YUWA 2Q0RA 4K43A 4RWTA 1VQON 4EHUA 4CJ7A 1MA9B 2QWMA 4IEEA 5AQPA 1U6ZA 2FSNA 4WF9L 3QMLA 1NLVA 3WXLA 3LDOA 2IVPA 1BO5O 2A41A 3MX5A 1GLCG 1ZBSA 4YOXA 3HM8A 4H0XB 3RSEA 4JKFA 1YHQN 3CIPA 1U2VB 3FZHA 5M1FA 4FSVA 1Z05A 3M5RA 1GLFO 4FWRA 4I6MA 3MCAB 4BGAA 1VQ9N 1JCEA 4BC3A 4JD2B 4WFNL 3AY9A 1MWMA 4JHDB 2GEMA 3DXKA 3MN7A 2YHWA 5AQLA 5BRFA 1Q81O 4L3QA 5EOYA 4BRQA 3UKRA 2PAVA 2QWLA 4BR2A 3EKUA 4XH4A 2RE2A 5M1OA 4FWNA 3UKUB 5DM6L 1TUUA 3QB0A 2NRVA 3ZX0A 3JS6A 4CZFA 4JK9A 1OKJA 4BR7A 3OW2M 1NGBA 5H1SQ 5AZIB 4CBXA 4WQ5A 2Q1NA 4IXCA 3LM2A 3Q7BA 2P9UA 2C1GA 4BR4A 3CPWM 2CH6A 2V7ZA 3H3OB 3MWPA 4K25A 3SMSA 2ZJRL 3CD6N 3DXMA 4EIAA 2QW9A 1YF5L 3LM9A 3R8EA 4BRMA 3O9TA 5C10A 1JCFA 3AARA 4MLHA 4PKIA 4NB4A 5GADP 1W2BM 3CCEN 5AQQA 4ILJA 1S72N 3E9PA 4MO4A 2YI1A 5GAGP 3IKMA 4PKHA 4IDHA 3CJCA 5AQIA 1HUXA 1NGCA 4IOAL 1IJJA 1H1VA 5C12A 5LJVA 3C0BA 1G99A 1RGIA 2H3GX 5JMVA 5KQDA 5HL7L 3CC4N 3LDNA 4CD3A 2D1KA 3O08A 3VMFB 2GUPA 1HJOA 5CHIA 4H5RA 5BPMA 1NGJA 2YCHA 4E1JA 1NJIO 2A6AA 1TYQB 5AQGA 1NWKA 1NGDA 5M1QA 4M7YA 3VF6A 3I55N 1X3NA 1T44A 3JXUA 1VQ6N 2BH1A 3ZETA 3L6QA 3O1WA 4XH1A 3C6HA 4JNEA 4JKCA 2NZTA 4FL9A 5F2RA 2GWKA 1HKBA 3E1YA 1KAYA 3WXJA 2ZGYA 4WQ4A 3WXIA 3MWTA 5BPLA 1IG8A 4H03B 4BQLA 2P9KA 1BOTO 3VENA 2WFBA 5BN8A 3LDLA 2GELA 3L4IA 4BRPA 4YDUA 3CJBA 5M1NA 2CGJA 2F7TA 3AAQA 2V52B 4H5WA 2Q97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP8 A;  3UE5 A;  1KAX A;  2A5X A;  4CD1 A;  2A42 A;  2GTD A;  3IFR A;  4BGB A;  1EQY A;  3D2F A;  5AQK A;  3SK3 A;  3ENH A;  4FWP A;  3GE1 A;  1X9J A;  2D0O A;  1T6D A;  5AR0 A;  4EAH D;  4PL8 A;  1NGI A;  3HSC A;  3QDK A;  2ASO A;  3WEE A;  4B1Y B;  5AQF A;  3C7N A;  3J8A A;  5ADX A;  5ADX H;  2E1Y A;  4ISF A;  2ASP A;  4FOE A;  3UKU A;  2J4R A;  3VEO A;  5BRD A;  3VET A;  5AFU A;  5AZI A;  4BVO A;  5F0X A;  3O4W A;  3AAP A;  5AQR A;  5AFU H;  5AQX A;  1NGA A;  3MN9 A;  4B1V A;  3CJA A;  2IVN A;  4H0T B;  3FZK A;  4B1Z A;  1GLD G;  1CZA N;  3QBW A;  3LL3 A;  3MN6 A;  4BG9 A;  2FXU A;  1RFQ A;  3VGM A;  1DKG D;  3MK6 A;  4O5F A;  3OHR A;  4FWL A;  5BRH A;  4CZH A;  4JAX A;  3H3N O;  5EY4 A;  5AQS A;  3FLC O;  2E2O A;  1NMD A;  3VPZ A;  3I33 A;  1V4S A;  3GG4 A;  1K8K B;  1D4X A;  4FWK A;  3S41 A;  4BRI A;  4GY2 B;  2YHX A;  3QIC A;  4CZE A;  5E84 A;  1HKC A;  4BRA A;  3ULE B;  3CI5 A;  2NLX A;  4BRK A;  1JCG A;  1TYQ A;  4BC5 A;  2A40 A;  4PKG A;  3I8B A;  4BRD A;  5BRE A;  1ZXO A;  1SAZ A;  2KHO A;  3CJ7 A;  4BQZ A;  4B1X B;  3CJ1 A;  3FZM A;  4H0V B;  1DEJ A;  4CZJ A;  4H5N A;  3H1V X;  3IDH A;  4WYB A;  5AQO A;  4BRG A;  2VYP A;  2P9N A;  4B1W B;  3A5L C;  1QZ5 A;  4CZM A;  1P8Z A;  3VEZ A;  3GOI A;  1J6Z A;  3EZW A;  2YJE A;  3CQY A;  3EN9 A;  4BRN A;  3WUH A;  4CZL A;  3FGU A;  2E2N A;  4H5T A;  3M3Z A;  3WXK A;  5AZJ B;  5B8H A;  1QZ6 A;  3CET A;  3EL2 A;  3KZB A;  3ZX3 A;  4FO0 A;  3A5N C;  4FWS A;  1NGF A;  1ATN A;  4FWO A;  3ZEU A;  3HBT A;  1ATR A;  2ITM A;  1QHA A;  4CZG A;  5JLF A;  3VES A;  1HPM A;  1WUA A;  5BR9 A;  2P9L A;  1C0F A;  4LC9 B;  2IVO A;  4DCH A;  4EFH A;  1BG3 A;  2CGL A;  3M1F A;  4DB3 A;  3U9D A;  2D4W A;  1GLA G;  1WOQ A;  2Q2R A;  4HTL A;  1XQS C;  5KPR A;  3RSE B;  3LDP A;  2E2P A;  5JIC A;  3MN5 A;  2E8A A;  3A0I X;  4I6M B;  5FPM A;  2BTF A;  1LOT B;  2D0P A;  2HOE A;  2E2Q A;  3H46 O;  3U9Z A;  5F1X A;  4KBO A;  1RDW X;  4QS8 A;  5I9E B;  4MLE A;  3DXK B;  3H6E A;  1U2V A;  3M6G A;  2QWO A;  3UKR B;  3L0Q A;  1GLL O;  4AM6 A;  1DGK N;  4XEI A;  3U4L A;  1Y64 A;  4JD2 A;  3VEV A;  4BC4 A;  3SJH A;  4JHD A;  2HF4 A;  2P9P B;  2A3Z A;  2FSJ A;  2P9U B;  1KXP A;  2Q36 A;  1X3M A;  2E88 A;  2UYT A;  2GWJ A;  1QQO A;  3DXM B;  3WQT A;  2QWP A;  1E4G T;  2FF6 A;  4A61 A;  4EHT A;  4Z94 A;  2HF3 A;  2W40 A;  3DWL A;  3H45 C;  1QQM A;  3R6M A;  5BPN A;  2ZWH A;  3D2E B;  3O8M A;  3O80 A;  2FLO A;  1GLB G;  5AQY A;  4BRO A;  4XH5 A;  3WT0 A;  4FOI A;  5AZJ A;  3MDQ A;  1NM1 A;  3MMV A;  3A5O C;  4FWM A;  2P9S B;  3GL1 A;  2F9W A;  3VF4 A;  1LCU A;  2EWS A;  2WUS A;  2CH5 A;  2E1Z A;  4B9Q A;  1E4F T;  1NGE A;  1C0G A;  2HMP A;  1Z6R A;  5FPN A;  4H0O A;  1NGH A;  1ATS A;  4A2A A;  1V4T A;  3ZET B;  1SQK A;  1SZ2 A;  5AQW A;  5KQ8 A;  2W41 A;  3QBX A;  4F9O A;  1S3X A;  3DJC A;  5CE3 A;  3G25 A;  4BRE A;  3UB5 A;  1HKG A;  4BRH A;  3ZX2 A;  3FZF A;  5AQZ A;  4J8F A;  5LY3 A;  2I7P A;  4BRF A;  2YJF A;  2P9K B;  4CZK A;  3CQX A;  3DAW A;  1BA0 A;  2F9T A;  5ELZ A;  1BA1 A;  4RCH A;  4RTF D;  4WQ5 C;  4BR5 A;  3F9M A;  3D2F B;  3VGK A;  3VER A;  1HX1 A;  5FPE A;  3QFP A;  4IO8 A;  4O8K A;  4QS9 A;  3O5B A;  3QFU A;  1HLU A;  2YHY A;  4Y0W A;  3CJ9 A;  3LDQ A;  3WEE B;  1GLJ O;  4BVP A;  1YXQ A;  1ZC6 A;  3C7N B;  3VEW A;  2QWN A;  2QWQ A;  4JN4 A;  2ZF5 O;  3BF1 A;  4BR0 A;  2Q0U A;  4QS7 A;  1TUY A;  2I7N A;  4DHY A;  5AQV A;  2P9P A;  2P9I B;  1BU6 O;  4ISG A;  2V51 B;  4GNI A;  5AQU A;  4CBW A;  1ESV A;  5AQH A;  3KVG A;  5TKY A;  3GDQ A;  5EX5 A;  3ENO A;  5BN9 A;  5AQT A;  4K42 A;  3R9P A;  1YVN A;  3VEY A;  4CI6 A;  1NGG A;  1NBW A;  2QWR A;  1R59 O;  5LJW A;  1BDG A;  1KAZ A;  2CGK A;  3D2E A;  4IJN A;  3VOV A;  3O1B A;  5AQJ A;  2AA4 A;  4WQ4 C;  4AM7 A;  2ASM A;  4FPB A;  1BUP A;  4M63 C;  2P9S A;  3ATU A;  3FFK B;  3W3D A;  1XUP O;  2V7Y A;  3BEX A;  3CHW A;  4YDU C;  5EXW A;  3EO3 A;  4A2B A;  3MCP A;  2FF3 B;  5KPZ A;  2DPN A;  4H0P A;  2BUP A;  1YAG A;  2E20 A;  1K8K A;  3HZ6 A;  4C23 A;  4HWI A;  3SLC A;  3TU5 A;  2NRH A;  2AP1 A;  2VCP A;  4A62 A;  4BR9 A;  3U8X A;  3ULE A;  3ATV A;  3O6W A;  1QQN A;  3VF2 A;  3BF3 A;  2PBD A;  4BRL A;  3FZL A;  2QXL A;  2OAN A;  4MO5 A;  1T6C A;  3TPQ A;  1S22 A;  3B8A X;  2P9N B;  4K41 A;  4IWV A;  3KHY A;  3D7E O;  3BUZ B;  3VEX A;  1MWK A;  5FPD A;  3EKS A;  2ZGZ A;  3HI0 A;  4FWQ A;  4CBU A;  2FSK A;  5AQM A;  3HTV A;  1GLE G;  1Q18 A;  3W0L A;  4BC2 A;  2VWB A;  3H1Q A;  3FE1 A;  3A8Y A;  3A5M C;  5KPT A;  3ZEU B;  3FR0 A;  4IJA A;  3ID8 A;  1XC3 A;  5E26 A;  5JLH A;  1MDU B;  4BRC A;  4H5V A;  4B1U B;  5EVZ A;  4FPA A;  2P9L B;  3CER A;  4M7X A;  5AQN A;  3P4I A;  2P9I A;  2QM1 A;  3WQU A;  4BG8 A;  4NO7 A;  2IIR A;  3VGL A;  3IMX A;  4DQ8 A;  4CZI A;  4IZ9 A;  1BWF O;  3GBT A;  4ISE A;  3SMP A;  4PL7 A;  3IUC A;  4H0Y B;  2Q31 A;  1YUW A;  2Q0R A;  4K43 A;  4RWT A;  4EHU A;  4CJ7 A;  1MA9 B;  2QWM A;  5AQP A;  1U6Z A;  2FSN A;  3QML A;  1NLV A;  3WXL A;  3LDO A;  2IVP A;  1BO5 O;  2A41 A;  1GLC G;  1ZBS A;  3HM8 A;  4H0X B;  3RSE A;  3CIP A;  1U2V B;  3FZH A;  4FSV A;  1Z05 A;  1GLF O;  4FWR A;  4I6M A;  4BGA A;  1JCE A;  4BC3 A;  4JD2 B;  3AY9 A;  1MWM A;  4JHD B;  2GEM A;  3DXK A;  3MN7 A;  2YHW A;  5AQL A;  5BRF A;  4L3Q A;  5EOY A;  4BRQ A;  3UKR A;  2PAV A;  2QWL A;  4BR2 A;  3EKU A;  4XH4 A;  3UKU B;  4FWN A;  1TUU A;  3QB0 A;  3ZX0 A;  4CZF A;  3JS6 A;  4BR7 A;  1OKJ A;  1NGB A;  5AZI B;  4CBX A;  4WQ5 A;  2Q1N A;  4IXC A;  3LM2 A;  2P9U A;  4BR4 A;  2CH6 A;  2V7Z A;  3H3O B;  4K25 A;  3SMS A;  3DXM A;  4EIA A;  2QW9 A;  3LM9 A;  4BRM A;  3R8E A;  1JCF A;  3AAR A;  4MLH A;  4PKI A;  4NB4 A;  5AQQ A;  4MO4 A;  2YI1 A;  4PKH A;  3CJC A;  5AQI A;  1HUX A;  1NGC A;  1IJJ A;  1H1V A;  5LJV A;  3C0B A;  1G99 A;  1RGI A;  2H3G X;  5JMV A;  5KQD A;  3LDN A;  4CD3 A;  2D1K A;  3O08 A;  2GUP A;  1HJO A;  4H5R A;  5BPM A;  1NGJ A;  2YCH A;  4E1J A;  2A6A A;  1TYQ B;  5AQG A;  1NWK A;  1NGD A;  3VF6 A;  4M7Y A;  1X3N A;  1T44 A;  3JXU A;  3ZET A;  3L6Q A;  3O1W A;  4XH1 A;  4JNE A;  2NZT A;  4FL9 A;  5F2R A;  2GWK A;  1HKB A;  1KAY A;  3WXJ A;  2ZGY A;  4WQ4 A;  3WXI A;  5BPL A;  1IG8 A;  4H03 B;  4BQL A;  2P9K A;  1BOT O;  3VEN A;  5BN8 A;  3LDL A;  2GEL A;  3L4I A;  4BRP A;  4YDU A;  3CJB A;  2CGJ A;  3AAQ A;  2V52 B;  4H5W A;  2Q97 A; 
#chains in the Genus database with same CATH topology
 4C1N I;  4YOW A;  4GV3 A;  4CJ5 A;  4R79 A;  2GTD A;  4DSL A;  4BGB A;  1EQY A;  2OPQ A;  3SK3 A;  4CED A;  4FWP A;  4EAH D;  3NVM A;  3N4P A;  3V1Q A;  1BCO A;  3HSC A;  3QDK A;  2ASO A;  3WEE A;  2W00 A;  4R5P A;  4DTN A;  5BRD A;  1NK0 A;  2OZS A;  4ID1 A;  3O4W A;  2FBT A;  1Q86 O;  4FCY A;  4BE2 A;  1NKE A;  3CJA A;  3KLF A;  4H0T B;  4GKK K;  3J7Z O;  2E6M A;  3QNO A;  1GLD G;  4J2D A;  1EO1 A;  3R1X A;  4Z4F A;  5C2D A;  4BDP A;  2FXU A;  1DKG D;  1SS6 A;  2Z1J A;  4KHP K;  4AIL C;  3OHR A;  5BRH A;  2W6K A;  1NJX A;  4B9N A;  4BE1 A;  4KH6 A;  4I9Q A;  1VQ4 N;  1NMD A;  3J81 O;  3KD5 E;  3EEQ A;  4JI6 K;  3I33 A;  3GG4 A;  1K8K B;  4ZTF A;  2UXB K;  4ICL A;  3S41 A;  4B8A B;  4BRI A;  4GY2 B;  4OKK A;  5E84 A;  4EP5 A;  4DV7 K;  3CI5 A;  3ULD A;  1ZBH A;  2HHS A;  3QNN A;  4UY8 O;  4DV5 K;  1SUQ A;  3S3N A;  4DTS A;  4BRD A;  5BRE A;  1ZXO A;  5C0Y A;  2ZD1 A;  3TAG A;  4DQR A;  4BQZ A;  1K9M O;  2QEX N;  4JI7 K;  4FZZ A;  3ID6 A;  3KK1 A;  3DOK A;  4YHH K;  4H0V B;  2BAN A;  4CZJ A;  2NNW A;  1NKB A;  4BRG A;  3C94 A;  2P9N A;  4ELT A;  4B1W B;  3EE9 A;  3AVL A;  2HBM A;  4TSX A;  4BRN A;  3EN9 A;  3ZT1 A;  4GKJ K;  2B5J A;  3U3Y A;  4Q0B A;  3TWH A;  2E2N A;  4H5T A;  3P38 A;  3M3Z A;  4E3S A;  3KWG A;  5AZJ B;  5B8H A;  3SYZ A;  1YJW N;  2O8F B;  2QXF A;  2HBJ A;  3CFO A;  4ILH A;  3KZB A;  4CK1 A;  4FO0 A;  5MLC Q;  3NVK A;  3LP0 A;  1ATR A;  2EHG A;  4CEE A;  4C1N K;  3VES A;  3OTO K;  4DR5 K;  1BQM A;  1GOC A;  1C0F A;  3V6D A;  3M1F A;  3E9O A;  4DB3 A;  3OYA A;  2W6L A;  3U9D A;  4CJT A;  1GLA G;  3NGY A;  1WOQ A;  3UIQ A;  2UXC K;  4M3W A;  3HJF A;  4W5N A;  3MN5 A;  4CEZ A;  4CF1 A;  3HK2 A;  2WC9 A;  5FPM A;  2YKM A;  4BE0 A;  4WFB L;  3V4I A;  1RDW X;  4QS8 A;  3DXK B;  1U2V A;  1SL1 A;  2QWO A;  4OKE A;  4N41 A;  4CGD A;  3AV9 A;  4XEI A;  1QSS A;  1HMV A;  3KK7 A;  3VEV A;  4CGF A;  2D0C A;  3J7A P;  1C0U A;  4C8N A;  4E19 A;  2A3Z A;  5DMR A;  1KXP A;  2Q36 A;  2E88 A;  4CJK A;  5C24 A;  3DXM B;  3OJS A;  1S1X A;  1KLN A;  3HRG A;  2QWP A;  1E4G T;  5J2M A;  3ISN C;  1BQN A;  3ZT4 A;  1HPZ A;  4Q5V A;  1KFS A;  1U47 A;  1G15 A;  3O80 A;  2RN2 A;  3LZJ A;  3G71 N;  2FLO A;  4CCH A;  1K6Y A;  1GLB G;  1WLJ A;  5AQY A;  3BGR A;  5EU7 A;  4XH5 A;  4CK3 A;  4FOI A;  4FJ9 A;  5AZJ A;  3MXI A;  2G8U A;  3MMV A;  2X6N A;  4FWM A;  3SBT A;  2O8F A;  4MQ3 A;  4OPK A;  2F9W A;  3VF4 A;  1C1C A;  2EWS A;  2E1Z A;  3SJJ A;  1NGE A;  2HMP A;  4CJU A;  4H0O A;  2VQF K;  1ZBL A;  1NGH A;  2KTQ A;  5KQ8 A;  3QBX A;  4F9O A;  1S3X A;  3DJC A;  3G25 A;  4FYD A;  3ZT3 A;  1HKG A;  3ZSO A;  3FZF A;  4DR4 K;  5AQZ A;  1OVY A;  3CPE A;  4O8U A;  2P9K B;  3CQX A;  3SAF A;  4Z4E A;  1A5V A;  1CZ9 A;  5KRT A;  2HST A;  3SUQ A;  2F9T A;  5ELZ A;  2GX9 A;  2DY4 A;  1RTD A;  3TTC A;  4FLX A;  1NK7 A;  2Y1I A;  1SKR A;  2IAJ A;  1J9A A;  1WNS A;  4L8R B;  1HX1 A;  1IKV A;  4IO8 A;  4O8K A;  3O5B A;  2YHY A;  4Y0W A;  4FJM A;  1WB9 A;  3TI0 A;  3CYG A;  3SUN A;  3C7N B;  1VQM N;  2VGM A;  5I42 A;  3K5O A;  1Q9Y A;  4CJS A;  3CC2 N;  3RVC A;  4GV6 A;  3DLH A;  4KRE A;  5HRS A;  1ZYQ A;  3MXJ A;  2V51 B;  3THW A;  3SI6 A;  3PIP L;  3OS0 A;  1ESV A;  3AVF A;  2BE2 A;  5EX5 A;  2FBY A;  3EE8 A;  3ENO A;  1VSK A;  5AQT A;  4K42 A;  4B9U A;  4FJ5 A;  1NGG A;  4BDY A;  1J5E K;  1BDG A;  3VQC A;  2CGK A;  3V1O A;  2YNG A;  4NXM K;  2X6S A;  3AO5 A;  4WQ4 C;  2WON A;  3DI6 A;  2ASM A;  3FFK B;  3ATU A;  1IH7 A;  5CYM A;  3ZYY X;  4YDU C;  3K5N A;  1N5Y A;  4E7K A;  2ZE2 A;  2D0B A;  3VQD A;  5KPZ A;  4DTX A;  2DPN A;  4H0P A;  3VTI A;  1J5O A;  2XHB A;  2E20 A;  3HZ6 A;  4F2S A;  4CES A;  1TKT A;  2NRH A;  2VCP A;  3WNF A;  2KLA A;  3U8X A;  4KV8 A;  4DLE A;  3QEX A;  1QQN A;  3CC7 N;  3BF3 A;  2QK9 A;  4Z4H A;  2QXL A;  3HP9 A;  1VQ8 N;  1S22 A;  3B8A X;  2HHI A;  1JL1 A;  3DRP A;  3F2K A;  4JS5 A;  1S1U A;  4A5B A;  5FPD A;  2ZGZ A;  4FWQ A;  1VSE A;  3ZSQ A;  1Q18 A;  2IC3 A;  4E7H A;  2B6A A;  3H1Q A;  3FE1 A;  4DUZ K;  4XIU A;  3ZEU B;  1EXQ A;  2HB5 A;  1WAJ A;  2XY6 A;  2YX6 A;  3CCS N;  1WSG A;  4O0I A;  4E1M A;  1S1W A;  4FPA A;  3VQP A;  3P4I A;  3AO1 A;  3ENB A;  4NO7 A;  2IIR A;  3R3L A;  1I94 K;  4E72 A;  1KCF A;  4JI4 K;  3MAQ A;  1C1A A;  3VGL A;  3OYN A;  1VQL N;  1BWF O;  3GBT A;  4AHV A;  5LMN K;  3BZK A;  3IUC A;  2UU9 K;  3SUO A;  4H0Y B;  4FJ7 A;  1GOA A;  3AO2 A;  2Q0R A;  3I8D A;  4QCL A;  4EHU A;  1U6Z A;  2YKN A;  4N47 A;  1BI4 A;  3QML A;  2IVP A;  2A41 A;  1ZBS A;  3DLG A;  4YOX A;  1LAW A;  2F8S A;  5M1F A;  1GLF O;  2QKK A;  1ASU A;  1JCE A;  4WFN L;  1T03 A;  2GEM A;  4DQP A;  1TVR A;  3ZLJ A;  5AQL A;  5HLF A;  1DLO A;  3L8B A;  1RIL A;  5J2Q A;  2QWL A;  4BR2 A;  4DR1 K;  3EKU A;  3SQ4 A;  4XH4 A;  5HP1 A;  1JLA A;  1TUU A;  3C6U A;  3JS6 A;  3OYE A;  2B4J A;  1B9D A;  3MEG A;  4JV5 K;  4WQ5 A;  3CQ8 A;  1KVA A;  4ZTJ A;  2V7Z A;  3MWP A;  2QW9 A;  1JCF A;  1ZBI A;  4MLH A;  3OYI A;  1W2B M;  3CCE N;  3O4N A;  1RBR A;  4MO4 A;  3RR8 A;  2IOC A;  4CJQ A;  1EWR A;  4AHC A;  2HNY A;  5J1E A;  1HUX A;  1NGC A;  1RGI A;  2R7Y A;  4LF4 K;  4CD3 A;  2D1K A;  1IBM K;  4CW7 B;  4H5R A;  3LAL A;  3M8P A;  2YCH A;  1RT7 A;  4YY3 K;  1NJI O;  2A6A A;  1TYQ B;  5M1Q A;  3VF6 A;  3OJU A;  1T44 A;  1VQ6 N;  3ZET A;  1C0M A;  3O1W A;  4KB0 A;  4CGI A;  3C6H A;  4JKC A;  5LMU K;  2GWK A;  4E7I A;  1HKB A;  1KAY A;  3MWT A;  1IG8 A;  2DFF A;  4BQL A;  4J2B A;  4DR6 K;  5BN8 A;  3OYF A;  2GEL A;  4BRP A;  3CJB A;  4FLU A;  5M1N A;  3AAQ A;  4C8M A;  2V52 B;  3BP8 A;  1KAX A;  2A5X A;  5KI6 A;  2C1I A;  3IFR A;  3D2F A;  2X74 A;  3QEP A;  1QE1 A;  3DLL L;  1X9J A;  4DF8 A;  4FJI A;  1NGI A;  4B1Y B;  3J8A A;  3T3F A;  1K8A O;  1EET A;  3VQ5 A;  1VK0 A;  5AFU A;  4DS5 A;  4BVO A;  5F0X A;  1WSJ A;  5AQR A;  5AFU H;  1NGA A;  1YJN N;  4B1V A;  4CVN E;  1OH6 A;  4HUE A;  4JS4 A;  3FZK A;  4B1Z A;  4KHW A;  1WN7 A;  5FDL A;  4A5A A;  1RFQ A;  3VGM A;  4N76 A;  2P1J A;  1VSM A;  4YOV A;  3WNG A;  1L3U A;  4LY7 A;  3K9K A;  4I7F A;  4FWL A;  3V9X A;  3QET A;  3THV A;  5EY4 A;  1F21 A;  1UOC A;  3VN5 A;  3PO4 A;  2NRZ A;  3FLC O;  1SKS A;  2G8K A;  4M3Z A;  3EYZ A;  1V4S A;  4PQU A;  1QSL A;  2YHX A;  3QIC A;  4YOY A;  3K58 A;  1HKC A;  2KQ2 A;  4BRA A;  4CJ3 A;  1TYQ A;  4B3T K;  2A40 A;  1SV5 A;  4PKG A;  3RTV A;  1TK0 A;  1RT3 A;  3O4Q A;  3AVN A;  2ZJQ L;  3CF5 L;  2RPI A;  4B1X B;  3AO3 A;  4KO0 A;  3FZM A;  3J7Y P;  1DEJ A;  4H5N A;  4LSN A;  3KK3 A;  1VSJ A;  5AQO A;  3WNE A;  3NCI A;  1QZ5 A;  1P8Z A;  3VEZ A;  2WOM A;  1J6Z A;  3CQY A;  4U67 L;  1S6Q A;  1XHX A;  4MDB A;  2IS3 A;  4DKW A;  1N33 K;  4WFA L;  1MU2 A;  4NLC A;  3HPG A;  3PSF A;  3CFP A;  1ATN A;  3HBT A;  1KQS M;  2VG6 A;  2HVI A;  4JKD A;  4FW1 A;  5JLF A;  3NMU A;  1WUA A;  3L3U A;  3O9Q A;  2VWJ A;  3TSU A;  1XC9 A;  4CE9 A;  4QOZ B;  4LC9 B;  2IVO A;  1Q7Y O;  4DCH A;  4X66 K;  4EFH A;  1BG3 A;  3HP6 A;  2CGL A;  1HQU A;  2E5L K;  3E66 A;  4AQY K;  3VQQ A;  2NRT A;  3ZT2 A;  4XJX A;  4KAZ A;  2OPR A;  1N8R O;  4NYF A;  3RSE B;  4DQI A;  2E2P A;  5IWA K;  3A0I X;  1KSP A;  1LWC A;  2BGG A;  4CJE A;  3OYH A;  3FFI A;  5F1X A;  3H46 O;  2F96 A;  4KBO A;  5I9E B;  4MLE A;  1E3M A;  3NE6 A;  3TAR A;  2O8D B;  4RW6 A;  2PZS A;  1CXU A;  3M6G A;  3UKR B;  4AF1 A;  4JKB A;  4DS4 A;  3U4L A;  2G8W A;  1Y64 A;  3DRR A;  2HHH K;  4NYN A;  3F5T A;  3NF7 A;  3K2P A;  1X3M A;  4M3X A;  3WQT A;  3F73 A;  4DU3 A;  4FM1 A;  4W5T A;  4A61 A;  4EHT A;  4HVJ A;  5D3G A;  2W40 A;  3LP2 A;  2E4L A;  3HVR A;  4FJK A;  1QTM A;  2ZWH A;  4B9T A;  2QA4 N;  4NCA A;  4B9M A;  3MDQ A;  3NBP A;  4KHQ A;  4CIE A;  3G0Z A;  3GL1 A;  4M3Y A;  2UUC K;  3LP3 A;  5HOO A;  4DV4 K;  1C0G A;  3AVI A;  1RCH A;  4CHQ A;  2UUA K;  1SQK A;  1SZ2 A;  5AQW A;  1J53 A;  2W41 A;  4OGC A;  4OPH A;  4GV9 A;  4H4M A;  3V1R A;  2UUB K;  3O9S A;  1U04 A;  5LY3 A;  1RNH A;  2YJF A;  4CZK A;  1XNQ K;  3DAW A;  4Z4I A;  1VSD A;  3KK2 A;  1YI2 N;  1N6Q A;  1NG9 A;  4ID5 A;  4RCH A;  3AA3 A;  3SQ0 A;  3KJV A;  3NH0 A;  4CGH A;  4BWJ A;  3T19 A;  3VER A;  2RHK A;  4DV0 K;  4DU4 A;  3CJ9 A;  4NCG A;  3CCR N;  3RMA A;  2QWQ A;  4JN4 A;  3PIO L;  2Q0U A;  2KZZ A;  2YHA A;  1NJY A;  4DHY A;  4CFB A;  4ISG A;  4GNI A;  5DK5 A;  3T1A A;  4CF9 A;  1IBL K;  2P5O A;  5FRN A;  4RW4 A;  3TSQ A;  3JYT A;  3HPO A;  5K14 A;  4YNQ A;  1TGO A;  4K0K K;  5BN9 A;  1HNW K;  3R9P A;  4CI6 A;  3VEY A;  5M1K A;  4GVE A;  1KAZ A;  2O4I A;  4IJN A;  4DV3 K;  3O1B A;  2XO7 A;  1BUP A;  4M63 C;  3W3D A;  4B3M K;  3P1G A;  3CHW A;  5EXW A;  4CJF A;  2YNI A;  1IKW A;  1YAG A;  1K8K A;  1QVF M;  1ASV A;  2IDO A;  2Z1H A;  1RDC A;  2AP1 A;  1ASW A;  3QEW A;  3KLE A;  3FZL A;  4WE1 A;  2G8H A;  2OAN A;  4MO5 A;  2OTJ N;  1T6C A;  3ZSZ A;  3TPQ A;  4DUY K;  3KHY A;  2O8C B;  2RKI A;  3I0R A;  4HUG A;  3EZ5 A;  2D5R A;  3TTF A;  3HI0 A;  3HPH A;  2FSK A;  4OPA A;  5AQM A;  3HTV A;  1KRP A;  3QIO A;  3ALY A;  2IGI A;  3A8Y A;  3A5M C;  4Z4G A;  1XC3 A;  1VSI A;  5JLH A;  4OVL A;  3CCU N;  4IFE A;  2VQE K;  4DFM A;  4H5V A;  5EVZ A;  2OPS A;  2P9L B;  1HYV A;  1YIT N;  4DQ8 A;  4IZ9 A;  4ISE A;  4PL7 A;  5J2P A;  4DSJ A;  4FJX A;  4K43 A;  4RWT A;  1VQO N;  3NAE A;  1MA9 B;  3HM9 A;  4OGE A;  1Q9X A;  1GLC G;  4CEO A;  1HYS A;  1W7A A;  2VG7 A;  4JKF A;  3CIP A;  3FZH A;  1L3V A;  4CK2 A;  1EKE A;  3KKR A;  4FWR A;  4JI8 K;  4BC3 A;  4JD2 B;  3AY9 A;  4JHD B;  3LAK A;  3DXK A;  1TL1 A;  3K5L A;  4FJG A;  4L3Q A;  4BRQ A;  3UKU B;  4JI2 K;  4FWN A;  1JLE A;  1EX4 A;  3L2V A;  3CM6 A;  4BR7 A;  3KLG A;  1NGB A;  4AH9 A;  1JKH A;  4DQQ A;  2Q1N A;  4IXC A;  3LM2 A;  4BR4 A;  3CPW M;  2CH6 A;  4K25 A;  3H3O B;  3DXM A;  2OA8 A;  4C8L A;  2O8C A;  1YF5 L;  3ZSW A;  3OYC A;  2ZQB A;  3AAR A;  3QO9 A;  4JRQ A;  1QSY A;  2YI1 A;  1IO2 A;  4H4O A;  3ZSX A;  4K8X A;  4B8C A;  1G99 A;  3CC4 N;  3V9W A;  1TL3 A;  1TK8 A;  5CHI A;  1S1T A;  4J2A A;  3O3G A;  4FK2 A;  3E01 A;  1NWK A;  1NGD A;  1RTH A;  1JXB A;  4M7Y A;  5J2N A;  4F8R A;  1X3N A;  2HNZ A;  3IRX A;  3K57 A;  3L6Q A;  5SZT A;  4FLZ A;  4XH1 A;  2NZT A;  3DM2 A;  4FL9 A;  4O4G A;  3PV8 A;  4KHY A;  1KVC A;  4WQ4 A;  4DQS A;  4FK0 A;  2P9K A;  3VEN A;  3SQ1 A;  4YDU A;  4B3O A;  1HJR A;  3NHG A;  1YTU A;  4CEA A;  3UE5 A;  4CD1 A;  2HHV A;  1XMQ K;  1KFD A;  3QLH A;  3HOT A;  1JLQ A;  1YT3 A;  4M3R A;  4CJR A;  5AQK A;  2A1R A;  3ENH A;  4CIF A;  1ITG A;  1T6D A;  3K59 A;  5ADX A;  5AQF A;  3C7N A;  1OH5 A;  5ADX H;  4H8K A;  4ISF A;  2ASP A;  1KC8 O;  3UKU A;  2J4R A;  1U49 A;  4OLB A;  1CLQ A;  4AHS A;  4B3S K;  3C95 A;  1HNV A;  2XY8 A;  4GMJ B;  5AQX A;  1HYZ A;  4JKH A;  5KGX A;  1FW6 A;  3S5T A;  4FLV A;  4FLT A;  1CZA N;  3QBW A;  1LAV A;  3LL3 A;  5JVG L;  3LWM A;  3OY9 A;  1U48 A;  3MEE A;  1SKW A;  1JJ2 M;  3IAY A;  1LWF A;  3MK6 A;  1IV0 A;  3AVB A;  3CM5 A;  4O5F A;  4W5Q A;  3QIN A;  4CZH A;  4LF5 K;  4I9L A;  3H3N O;  4AHR A;  3PSI A;  2E2O A;  3VPZ A;  1UA0 A;  1WSH A;  4IFY A;  1IKY A;  3NF8 A;  4CJP A;  4E1N A;  3O3H A;  3OS2 A;  1NK8 A;  3ULE B;  3D0P A;  4JKG B;  3ZSV A;  2NLX A;  4BRK A;  1JCG A;  1M1K O;  3LAM A;  2D0A A;  2PFU A;  1SAZ A;  2KHO A;  3CJ7 A;  3RMB A;  4KB1 A;  4RW9 A;  5C2F A;  1A5W A;  3KLH A;  4BEB A;  1VRT A;  1NOY A;  1RBT A;  3H1V X;  1WBB A;  5C42 A;  2VYP A;  4JYA K;  1R0A A;  3A5L C;  3L2W A;  4LFC K;  3GOI A;  4KH5 A;  4DV2 K;  2F8T A;  3WUH A;  4C8O A;  3FGU A;  4GVM A;  3SBG A;  3HVT A;  4KPY A;  2HHT A;  2Q3S A;  3CET A;  3I56 N;  3G6E N;  1TKZ A;  3SPY A;  2Y1J A;  1RT4 A;  3ZX3 A;  5C25 A;  3A5N C;  3C6A A;  1BGX T;  3L2U A;  2LSN A;  2DFH A;  3ZEU A;  1FKP A;  1REV A;  2HHX A;  2P51 A;  2ITM A;  2G8I A;  4CZG A;  3M8Q A;  3O9U A;  3Q7C A;  1HPM A;  3TAQ A;  3SUP A;  1TAQ A;  1XNR K;  3SAH A;  4LH4 A;  3CXC M;  2D4W A;  1HNX K;  2HMI A;  4LH5 A;  4RG8 A;  1NMN A;  1NJZ A;  4A57 A;  5JIC A;  5HBM A;  4CJL A;  2E8A A;  3T1H K;  4I6M B;  1LOT B;  2D0P A;  5TKW A;  5JVH L;  3VQB A;  3AA5 X;  2RF2 A;  5KGW A;  2Z1I A;  3L0Q A;  1DGK N;  3JSM A;  1RDU A;  1RTJ A;  4JKG A;  4DMN A;  3SJH A;  4KHU A;  4G9Z A;  2P9P B;  2NRR A;  2FSJ A;  1Y97 A;  2P9U B;  3DLR A;  1VQK N;  2UYT A;  2GWJ A;  4DSK A;  2FF6 A;  3AA2 A;  2HF3 A;  5I3U A;  5LL6 Z;  2HHQ A;  3H45 C;  4B9S A;  3HYF A;  1QQM A;  5GAH P;  3D2E B;  3O8M A;  3S9H A;  4CHN A;  3QEI A;  4BRO A;  4IEI A;  1D8Y A;  4O0J A;  3AVK A;  4DV6 K;  3P39 A;  1YJ9 N;  1NM1 A;  1P90 A;  4C8K A;  4DTR A;  4M45 A;  4B9Q A;  3LAN A;  5FPN A;  1UWB A;  1ATS A;  4A2A A;  1V4T A;  3SCX A;  4LF9 K;  2KW4 A;  4BRE A;  4BRH A;  4Y1C A;  1W9H A;  2NUB A;  5JS2 A;  2I7P A;  4BRF A;  4CHO A;  4DFJ A;  1FXX A;  4IKF A;  1NNE A;  1BA0 A;  5CZ1 A;  4DSF A;  3L4Q A;  4RTF D;  5SWM A;  4LF6 K;  3CME N;  4EP4 A;  3KIO A;  3F9M A;  1LW2 A;  4QAG A;  1B92 A;  3VGK A;  1X1P A;  5FPE A;  4QS9 A;  4ILG B;  4KTQ A;  1VSF A;  3LDQ A;  3WEE B;  1GLJ O;  1BIU A;  1YXQ A;  3DMJ A;  3VEW A;  2ZF5 O;  3BF1 A;  4JKE A;  4QS7 A;  3TTD A;  4WCE L;  3SV3 A;  1NK4 A;  3ZSY A;  2ZJP L;  1TAU A;  1KLM A;  5AQV A;  2P9P A;  1YVU A;  1KTQ A;  5CR4 A;  2OYQ A;  4FZX C;  2E6L A;  5AQU A;  4CBW A;  4HHT A;  5AQH A;  3KVG A;  5TKY A;  1BIZ A;  3GDQ A;  4GW6 A;  3LPU A;  1S6P A;  4DSI A;  1NBW A;  2QWR A;  5CZ2 A;  4KHN A;  1CXQ A;  1W0H A;  3D2E A;  3B6P A;  2PY5 A;  4BAC A;  1EP4 A;  4KRF A;  5AQJ A;  3SPZ A;  2AA4 A;  3O3F A;  3NDK A;  2JGU A;  4AM7 A;  1IBK K;  3THX B;  3CCL N;  2V7Y A;  3TAF A;  4FVU A;  1Q82 O;  4A2B A;  4JKA A;  2FF3 B;  3K0S A;  3JAM O;  4FJH A;  3IS9 A;  3PLA A;  4HWI A;  3SLC A;  4DTO A;  3VA3 A;  4BR9 A;  1WSF A;  3O9R A;  3VF2 A;  2PBD A;  4BRL A;  4CEF A;  2P9N B;  4F3T A;  3MED A;  3CG7 A;  2JWK A;  3IG1 A;  1BL3 A;  3VEX A;  3BY5 A;  2GUI A;  3P5J A;  4X65 K;  4W5R A;  1I3A A;  4DWI A;  4JK8 A;  3W0L A;  4BC2 A;  2VWB A;  3MX2 A;  3VQ9 A;  3L3V A;  5IT9 O;  3OA9 A;  4KHS A;  5KPT A;  4LF7 K;  3FR0 A;  3DYA A;  4IJA A;  3ID8 A;  1S1V A;  3TSP A;  1MDU B;  2HW3 A;  3HST B;  5AQN A;  2QM1 A;  3WQU A;  3J80 O;  4U7B A;  3D45 A;  4MDA A;  1U4B A;  1RT1 A;  3SMP A;  1WSI A;  5GIP A;  4FLY A;  1LW0 A;  5FRO A;  2AJQ A;  2Q31 A;  3WNH A;  1YUW A;  4DR7 K;  3OYD A;  4CJ7 A;  3T1Y K;  1B9F A;  2FSN A;  4WF9 L;  3AVH A;  3ZT0 A;  1NLV A;  3WXL A;  4AHU A;  1UAX A;  1XHZ A;  1HNZ K;  1BO5 O;  4V19 S;  4CJ4 A;  3L2R A;  4FK4 A;  4H0X B;  3RSE A;  3LZI A;  4Z4C A;  3DLK A;  1U2V B;  2O8E B;  3OYG A;  4E89 A;  4F2R A;  4FSV A;  1Z05 A;  3M5R A;  3THX A;  3MCA B;  1VQ9 N;  4NCB A;  3VQ8 A;  3NFA A;  4O5B A;  4DR3 K;  2O4G A;  4JI0 K;  2O8D A;  3MN7 A;  3AVM A;  1Q81 O;  5EOY A;  3UKR A;  1NJW A;  2RE2 A;  4W5O A;  1JL2 A;  4IG0 A;  3ZX0 A;  4CZF A;  4FJN A;  5HRP A;  1TV6 A;  1OKJ A;  4OLA A;  5H1S Q;  5AZI B;  1YTA A;  3Q7B A;  2ZJR L;  3CD6 N;  2FC0 A;  3O9T A;  5C10 A;  1ZBF A;  2FBV A;  4PKI A;  4I2P A;  3OYB A;  3DLB A;  4E0D A;  5GAG P;  1I39 A;  4FJL A;  4KI4 A;  4IDH A;  3OYK A;  4PY5 A;  2JLE A;  4Y1D A;  4CF0 A;  1RBS A;  5AQI A;  3HT3 A;  4IOA L;  1IJJ A;  1T7P A;  4HCC A;  1N34 K;  1H1V A;  5C12 A;  3OS1 A;  3CFR A;  2HND A;  5KQD A;  1SL0 A;  5KRS A;  3LDN A;  1HJO A;  3SV4 A;  5BPM A;  1NK5 A;  2G8V A;  1NGJ A;  4J2E A;  3OYJ A;  3NGZ A;  3M8S A;  3PUF A;  3BDP A;  3JXU A;  3RWU A;  1JLF A;  4JNE A;  4YFU A;  4E7L A;  3QEV A;  3E1Y A;  2VG5 A;  3WXI A;  4N56 A;  1RDA A;  5BPL A;  1X9S A;  2WFB A;  2KFZ A;  3LDL A;  4NXN K;  3L4I A;  4FJJ A;  3NGI A;  2CGJ A;  4LD0 A;  3VQE A;  1GOB A;  4CHZ A;  4H5W A;  4IOC L;  1Q8I A;  2O8E A;  2A42 A;  3TR8 A;  3C65 A;  3VQA A;  3KLI A;  3V9S A;  3V9Z A;  4EZ9 A;  3GE1 A;  1Z25 A;  2D0O A;  5AR0 A;  4PL8 A;  1K73 O;  1QS4 A;  3THW B;  1RT6 A;  3AA4 A;  3S3O A;  2E1Y A;  1TKX A;  3THY B;  1DTQ A;  4FOE A;  3VEO A;  4LSL A;  4B3R K;  3VET A;  3EY1 A;  5AZI A;  3AAP A;  3TAB A;  4X64 K;  3MN9 A;  2IVN A;  4PUO A;  4FM2 A;  3VQ7 A;  1ILY A;  5GIO A;  4UQG A;  3MN6 A;  4IG3 A;  1XMO K;  4BG9 A;  5AJ3 K;  4EZ6 A;  4OX9 K;  2YHB A;  1QHT A;  4JAX A;  2QI2 A;  5CY4 A;  5AQS A;  2FBX A;  4OKJ A;  4DG1 A;  1RT5 A;  1O1W A;  1ZBU A;  1D4X A;  4FWK A;  5KTQ A;  4CZE A;  2ATQ A;  4MFB A;  1HR0 K;  3AVA A;  4BC5 A;  1VQP N;  4CJW A;  3RR7 A;  3I8B A;  4CFC A;  2GBZ A;  4RW7 A;  4CEQ A;  1Z26 A;  1IG9 A;  3K5M A;  1J54 A;  3VA0 A;  3AGR A;  3CJ1 A;  1RDD A;  3IDH A;  4WYB A;  1O13 A;  3VTH A;  4DTP A;  4CIG A;  4JI3 K;  4CZM A;  3SQ2 A;  3EZW A;  3NF9 A;  2YJE A;  4CJV A;  4CZL A;  3WXK A;  1WSE A;  4DFP A;  2VGN A;  1KVB A;  1L5U A;  1QZ6 A;  3EL2 A;  2YNH A;  2QTD A;  1KD1 O;  4FWS A;  3LPT A;  1NGF A;  3AO4 A;  4FWO A;  1DT9 A;  1FK9 A;  1QHA A;  3THY A;  2DFE A;  3VQ6 A;  3PX0 A;  2EX3 A;  4LFA K;  5BR9 A;  2P9L A;  4B9V A;  2G8F A;  2XY7 A;  3SAG A;  1C0T A;  4OPJ A;  1BI4 B;  4DTU A;  3T7Z A;  4ELU A;  2Q2R A;  3CCJ N;  4HTL A;  4BY9 C;  1XQS C;  5KPR A;  1TK5 A;  3LDP A;  3ITH A;  1QQC A;  1SL2 A;  1VQN N;  2KFN A;  3AVC A;  3PY8 A;  3CYM A;  4KTW A;  2BTF A;  2HOE A;  3U9Z A;  4CFD A;  2E2Q A;  4I2Q A;  5JEN A;  2QKB A;  3H6E A;  4NLB A;  2Z1G A;  1NU0 A;  2HVH A;  3CCQ N;  1OVQ A;  1S9E A;  3CCV N;  1GLL O;  4AM6 A;  3LWL A;  1YIJ N;  4JD2 A;  4BC4 A;  3TAN A;  4JHD A;  2HF4 A;  1VQ7 N;  2O8B B;  1U45 A;  1VAZ A;  1CZB A;  1QQO A;  4YOR A;  4FW2 A;  4K8Z A;  4Z94 A;  5E41 A;  4CF8 A;  4CHY A;  1M90 O;  3ZCM A;  3DWL A;  4B9L A;  1RT2 A;  3AVG A;  4OO1 J;  3R6M A;  2HHU A;  5BPN A;  3KWI A;  5GAE P;  4FXD A;  3E9L A;  3P83 D;  4KH4 A;  3TAE A;  3WT0 A;  3QES A;  3U6F A;  1IKX A;  3A5O C;  3ASM A;  3OVN A;  2P9S B;  1HQE A;  3AVJ A;  5A2Q O;  1LCU A;  3MXM A;  2WUS A;  2CH5 A;  3K9J A;  4CEB A;  3RMD A;  4CGJ A;  1E4F T;  4YOT A;  1BHL A;  1Z6R A;  3MEC A;  2P5G A;  5HRN A;  5BR8 K;  3ZET B;  2OZM A;  5CE3 A;  5DM7 L;  3UB5 A;  2ZM6 K;  3ZX2 A;  2DTU A;  4CGG A;  4FM0 A;  4J8F A;  3V9U A;  3NH1 A;  3OYL A;  3OBY A;  1NOZ A;  4BWM A;  2JWL A;  4PHT X;  1BA1 A;  4JLH A;  3OYM A;  3RRG A;  2YNF A;  4B08 A;  4BE7 B;  4WQ5 C;  4BR5 A;  1VQ5 N;  2KKZ A;  2NRW A;  1X9W A;  4DFK A;  5FRM A;  3D2F B;  4O44 A;  2HBK A;  4KKO A;  3CMA N;  3QFP A;  3QFU A;  1HLU A;  1VSL A;  2HHW A;  4OJR A;  1JXE A;  3QER A;  4JK7 A;  3RRH A;  4BVP A;  1ZC6 A;  1W97 L;  3N4Q A;  2HBL A;  2QWN A;  3TAP A;  1D9F A;  1BCM A;  1N32 K;  3TAM A;  5GIN A;  5M1P A;  4BR0 A;  4M42 A;  1NK6 A;  1TUY A;  1HRH A;  2I7N A;  4RW8 A;  3C6T A;  2O8B A;  4DSE A;  2P9I B;  1BU6 O;  4JI5 K;  4Z0U A;  1QVG M;  3SZ2 A;  2F4V K;  1OH8 A;  1VHX A;  2BDP A;  3T69 A;  1T8E A;  1YVN A;  4IBN A;  1WBD A;  3P31 A;  2KZM A;  1R59 O;  1L3T A;  5LJW A;  3KD1 E;  5C15 A;  4E7J A;  1RTI A;  3VOV A;  1BIS A;  4FPB A;  2NRX A;  2P9S A;  3PX6 A;  1XUP O;  4G1Q A;  3BEX A;  5T7B A;  3I0S A;  3EO3 A;  1C6V A;  4JI1 K;  3MCP A;  2BUP A;  1JLB A;  4KTZ A;  4A59 A;  4C23 A;  1EWQ A;  3TU5 A;  4DU1 A;  4CF2 A;  4CER A;  3HXM A;  4A62 A;  3NF6 A;  3L2Q A;  3ULE A;  3ATV A;  3O6W A;  3SNN A;  2W42 A;  3DRS A;  5HRR A;  3G4S N;  2OCE A;  2WTU A;  1D9D A;  4FZY A;  4K41 A;  4IWV A;  3HOS A;  3D7E O;  3BUZ B;  1NKC A;  1MWK A;  2XRI A;  3EKS A;  4M3T A;  4CBU A;  3CCM N;  3RMC A;  4ZHR A;  1GLE G;  4YOU A;  4IOX A;  1VSH A;  4KFB A;  3D6R A;  3QIP A;  2I5J A;  3VQ4 A;  1T3V A;  4HTU A;  4O55 A;  5E26 A;  3WXM B;  3AGK A;  1S5J A;  4BEC A;  3G10 A;  4BRC A;  4B1U B;  4JRP A;  4IO9 L;  1A5X A;  3CER A;  4M7X A;  5FLX O;  2WBN A;  2P9I A;  4JEP A;  4BG8 A;  1LV5 A;  4DR2 K;  1JLG A;  3BZC A;  3DOL A;  3IMX A;  4CFA A;  3LP1 A;  4CZI A;  4FJ8 A;  2UXD K;  2PYL A;  2A1S A;  1OH7 A;  3F9K A;  2OTL N;  3OBW A;  2QWM A;  4IEE A;  5AQP A;  3LDO A;  3MX5 A;  3B6O A;  4X62 K;  4DF4 A;  5HRO A;  4IDK A;  2OPP A;  3HM8 A;  3PX4 A;  4PA1 A;  1YHQ N;  1NK9 A;  1FJG K;  4F3O A;  4I6M A;  4BGA A;  4N5S A;  4DTM A;  3KTQ A;  2X78 A;  5JS1 A;  1MWM A;  2ITG A;  3KKS A;  3HO1 A;  3HL8 A;  1D5A A;  2YHW A;  4DLG A;  5BRF A;  4DV1 K;  2PAV A;  5M1O A;  5DM6 L;  3M8R A;  3H08 A;  1HNI A;  3QB0 A;  2NRV A;  4M3U A;  4JK9 A;  3OW2 M;  4CBX A;  2C1G A;  2P9U A;  4FVM A;  1LWE A;  3SMS A;  1RBV A;  4EIA A;  3LM9 A;  4BRM A;  1XI1 A;  1RBU A;  3R8E A;  4HCB A;  4NB4 A;  5GAD P;  5AQQ A;  1TKD A;  4ILJ A;  3NH2 A;  1S72 N;  3E9P A;  4LFB K;  3IKM A;  4PKH A;  4BDZ A;  3CJC A;  1S9G A;  1WAF A;  1N36 K;  2PYJ A;  5LJV A;  3C0B A;  1T05 A;  1VRU A;  2H3G X;  5JMV A;  5HL7 L;  4CHP A;  3VMF B;  3O08 A;  4CEC A;  2GUP A;  4F4K A;  4M41 A;  4FLW A;  1XWL A;  1X9M A;  3LDS A;  4E1J A;  1UA1 A;  3U3G A;  2YV0 X;  5AQG A;  4DTJ A;  3I55 N;  4PWD A;  1FKO A;  4KI6 A;  4AHT A;  4HUF A;  2BH1 A;  1JLC A;  4ELV A;  2XY5 A;  1C1B A;  5F2R A;  3DLE A;  3A2F A;  3WXJ A;  2ZGY A;  2VWK A;  5CYQ A;  2ETJ A;  2GV9 A;  3ZSR A;  4H03 B;  1DTT A;  4IFV A;  1RDB A;  3S3M A;  1BOT O;  3PO5 A;  1L3S A;  2F7T A;  3V81 A;  4LF8 K;  2Q97 A; 
#chains in the Genus database with same CATH homology
 4C1N I;  4YOW A;  3BP8 A;  3UE5 A;  1KAX A;  2A5X A;  4CD1 A;  4GV3 A;  4R79 A;  2A42 A;  2GTD A;  2C1I A;  3C65 A;  3HOT A;  3IFR A;  4BGB A;  1EQY A;  3D2F A;  5AQK A;  3SK3 A;  3ENH A;  4FWP A;  3DLL L;  3GE1 A;  1X9J A;  2D0O A;  1T6D A;  5AR0 A;  3NVM A;  4EAH D;  4PL8 A;  1K73 O;  1NGI A;  3N4P A;  3HSC A;  3QDK A;  2ASO A;  3WEE A;  4B1Y B;  5AQF A;  3C7N A;  3J8A A;  5ADX A;  1K8A O;  5ADX H;  2E1Y A;  2W00 A;  4ISF A;  2ASP A;  1KC8 O;  4FOE A;  3UKU A;  2J4R A;  3VEO A;  5BRD A;  3VET A;  5AFU A;  5AZI A;  4BVO A;  5F0X A;  3O4W A;  3AAP A;  5AQR A;  5AFU H;  5AQX A;  1NGA A;  1Q86 O;  4JKH A;  3MN9 A;  4B1V A;  3CJA A;  2IVN A;  1YJN N;  4H0T B;  3J7Z O;  3FZK A;  4B1Z A;  5GIO A;  1ILY A;  1GLD G;  1CZA N;  3QBW A;  1EO1 A;  3LL3 A;  3R1X A;  5JVG L;  3MN6 A;  5C2D A;  4A5A A;  1JJ2 M;  4BG9 A;  2FXU A;  1RFQ A;  3VGM A;  1DKG D;  1SS6 A;  3MK6 A;  4YOV A;  4O5F A;  3K9K A;  3OHR A;  4FWL A;  5BRH A;  4CZH A;  4JAX A;  2QI2 A;  3H3N O;  4KH6 A;  5EY4 A;  5AQS A;  2NRZ A;  3FLC O;  1VQ4 N;  2E2O A;  1NMD A;  3VPZ A;  3I33 A;  1V4S A;  3GG4 A;  1K8K B;  1D4X A;  4FWK A;  3S41 A;  4BRI A;  4GY2 B;  2YHX A;  3QIC A;  4CZE A;  4YOY A;  5E84 A;  1HKC A;  4BRA A;  3ULE B;  4JKG B;  3CI5 A;  2NLX A;  4BRK A;  1JCG A;  1TYQ A;  4BC5 A;  1M1K O;  1VQP N;  2A40 A;  4PKG A;  4UY8 O;  3I8B A;  4BRD A;  5BRE A;  1ZXO A;  2PFU A;  5C0Y A;  1SAZ A;  2KHO A;  3CJ7 A;  2ZJQ L;  3CF5 L;  4BQZ A;  1K9M O;  2QEX N;  3ID6 A;  4B1X B;  5C2F A;  3AGR A;  4BEB A;  3CJ1 A;  3FZM A;  4H0V B;  1DEJ A;  4CZJ A;  4H5N A;  3H1V X;  2NNW A;  3IDH A;  4WYB A;  5AQO A;  1O13 A;  4BRG A;  2VYP A;  3VTH A;  2P9N A;  4B1W B;  3EE9 A;  3A5L C;  1QZ5 A;  4CZM A;  1P8Z A;  2HBM A;  3GOI A;  4KH5 A;  1J6Z A;  3VEZ A;  3EZW A;  2YJE A;  3CQY A;  3EN9 A;  4BRN A;  3WUH A;  4U67 L;  4CZL A;  3FGU A;  2E2N A;  4H5T A;  3P38 A;  3SBG A;  3M3Z A;  4MDB A;  3WXK A;  3KWG A;  5AZJ B;  2VGN A;  5B8H A;  1YJW N;  4DKW A;  1QZ6 A;  3CET A;  3I56 N;  3G6E N;  3EL2 A;  2HBJ A;  4WFA L;  4ILH A;  4NLC A;  3KZB A;  2QTD A;  1KD1 O;  3ZX3 A;  4FO0 A;  3A5N C;  3C6A A;  4FWS A;  5MLC Q;  3NVK A;  1NGF A;  1ATN A;  4FWO A;  3ZEU A;  1DT9 A;  3HBT A;  1KQS M;  1ATR A;  2ITM A;  1QHA A;  4CZG A;  4JKD A;  5JLF A;  3Q7C A;  3O9U A;  3VES A;  4C1N K;  3NMU A;  1HPM A;  1WUA A;  5BR9 A;  2P9L A;  3O9Q A;  3TSU A;  1C0F A;  4LC9 B;  2IVO A;  1Q7Y O;  4DCH A;  4EFH A;  3SAG A;  1BG3 A;  2CGL A;  3M1F A;  3E9O A;  4DB3 A;  3SAH A;  3U9D A;  3CXC M;  2D4W A;  3T7Z A;  1GLA G;  3E66 A;  1WOQ A;  2NRT A;  2Q2R A;  4XJX A;  3CCJ N;  4HTL A;  1N8R O;  4BY9 C;  1XQS C;  5KPR A;  3RSE B;  3LDP A;  2E2P A;  4A57 A;  5JIC A;  1VQN N;  3MN5 A;  2E8A A;  3A0I X;  2WC9 A;  4I6M B;  5FPM A;  2BTF A;  1LOT B;  2D0P A;  2HOE A;  2E2Q A;  3H46 O;  5TKW A;  3U9Z A;  4KBO A;  5F1X A;  4WFB L;  1RDW X;  4QS8 A;  5I9E B;  5JVH L;  4MLE A;  3DXK B;  3H6E A;  4NLB A;  1U2V A;  3M6G A;  2QWO A;  3CCQ N;  3UKR B;  3L0Q A;  1GLL O;  4JKB A;  4AF1 A;  1DGK N;  4AM6 A;  4XEI A;  3U4L A;  3CCV N;  1RDU A;  1YIJ N;  4JKG A;  3KK7 A;  1Y64 A;  4JD2 A;  3VEV A;  4BC4 A;  3SJH A;  4JHD A;  2HF4 A;  1VQ7 N;  4G9Z A;  2P9P B;  2A3Z A;  2NRR A;  2FSJ A;  3F5T A;  2P9U B;  1KXP A;  2Q36 A;  1X3M A;  1VAZ A;  2E88 A;  2GWJ A;  2UYT A;  1VQK N;  1QQO A;  4YOR A;  3DXM B;  3WQT A;  3HRG A;  2QWP A;  1E4G T;  2FF6 A;  4A61 A;  4EHT A;  4Z94 A;  2HF3 A;  1M90 O;  2W40 A;  3DWL A;  3H45 C;  1QQM A;  5GAH P;  4OO1 J;  3R6M A;  5BPN A;  2ZWH A;  3D2E B;  3KWI A;  3O8M A;  3O80 A;  2QA4 N;  5GAE P;  3G71 N;  2FLO A;  1GLB G;  3E9L A;  5AQY A;  4KH4 A;  4BRO A;  4XH5 A;  3WT0 A;  4FOI A;  4IEI A;  5AZJ A;  3MDQ A;  3P39 A;  1YJ9 N;  1NM1 A;  3MMV A;  3A5O C;  4FWM A;  3SBT A;  1P90 A;  2P9S B;  3GL1 A;  2F9W A;  3VF4 A;  1LCU A;  2EWS A;  2WUS A;  2CH5 A;  3K9J A;  2E1Z A;  4B9Q A;  5HOO A;  1E4F T;  1NGE A;  1C0G A;  2HMP A;  4YOT A;  1Z6R A;  5FPN A;  4H0O A;  1NGH A;  1ATS A;  4A2A A;  1V4T A;  3ZET B;  1SQK A;  1SZ2 A;  5AQW A;  5KQ8 A;  2W41 A;  3QBX A;  4F9O A;  1S3X A;  3DJC A;  4OPH A;  3G25 A;  4BRE A;  5CE3 A;  5DM7 L;  3UB5 A;  1HKG A;  4GV9 A;  4BRH A;  3ZX2 A;  3FZF A;  5AQZ A;  1OVY A;  4J8F A;  3CPE A;  3O9S A;  5LY3 A;  2I7P A;  3OBY A;  4BRF A;  2YJF A;  2P9K B;  4O8U A;  3CQX A;  3DAW A;  4CZK A;  3SAF A;  2HST A;  1BA0 A;  2JWL A;  2F9T A;  4PHT X;  5ELZ A;  2GX9 A;  1BA1 A;  3L4Q A;  1YI2 N;  4RCH A;  4RTF D;  3TTC A;  4BE7 B;  4WQ5 C;  4BR5 A;  1VQ5 N;  2KKZ A;  3CME N;  2NRW A;  3F9M A;  3D2F B;  3VGK A;  2HBK A;  3VER A;  1HX1 A;  2RHK A;  5FPE A;  3CMA N;  3QFP A;  4IO8 A;  4O8K A;  4QS9 A;  3O5B A;  3QFU A;  1HLU A;  2YHY A;  4ILG B;  4Y0W A;  3CJ9 A;  3LDQ A;  4JK7 A;  3CCR N;  3WEE B;  1GLJ O;  4BVP A;  1YXQ A;  1W97 L;  1ZC6 A;  3C7N B;  2VGM A;  2HBL A;  2QWN A;  3N4Q A;  3VEW A;  1VQM N;  2QWQ A;  4JN4 A;  5GIN A;  2ZF5 O;  3BF1 A;  5M1P A;  4BR0 A;  3PIO L;  2Q0U A;  4JKE A;  4QS7 A;  3TTD A;  4WCE L;  1TUY A;  3CC2 N;  3RVC A;  4GV6 A;  2I7N A;  2ZJP L;  4DHY A;  5AQV A;  2P9P A;  2P9I B;  1BU6 O;  4ISG A;  2V51 B;  4GNI A;  5CR4 A;  3PIP L;  1QVG M;  5AQU A;  4CBW A;  1ESV A;  5AQH A;  3KVG A;  3TSQ A;  5TKY A;  3GDQ A;  5EX5 A;  3EE8 A;  3ENO A;  3T69 A;  5BN9 A;  5AQT A;  4K42 A;  3R9P A;  1YVN A;  3VEY A;  4CI6 A;  1NGG A;  5M1K A;  1NBW A;  2QWR A;  3P31 A;  4GVE A;  1R59 O;  5LJW A;  1BDG A;  5C15 A;  1KAZ A;  2CGK A;  3D2E A;  4IJN A;  3VOV A;  3O1B A;  5AQJ A;  2AA4 A;  4WQ4 C;  4AM7 A;  2ASM A;  4FPB A;  1BUP A;  4M63 C;  2NRX A;  2P9S A;  3ATU A;  3FFK B;  3W3D A;  3CCL N;  1XUP O;  2V7Y A;  4FVU A;  3BEX A;  3CHW A;  4YDU C;  5EXW A;  3ZYY X;  3EO3 A;  1Q82 O;  4A2B A;  4JKA A;  3MCP A;  2FF3 B;  5KPZ A;  2DPN A;  4H0P A;  3VTI A;  3PLA A;  2BUP A;  1YAG A;  2E20 A;  1K8K A;  3HZ6 A;  4A59 A;  4HWI A;  3SLC A;  4C23 A;  1QVF M;  3TU5 A;  2NRH A;  2AP1 A;  2VCP A;  2KLA A;  4A62 A;  4BR9 A;  3U8X A;  3ULE A;  3ATV A;  3O9R A;  3O6W A;  1QQN A;  3VF2 A;  3CC7 N;  3BF3 A;  2PBD A;  3G4S N;  4BRL A;  3FZL A;  2QXL A;  2OAN A;  4MO5 A;  2OTJ N;  1T6C A;  1VQ8 N;  3TPQ A;  1S22 A;  3B8A X;  2P9N B;  4K41 A;  4IWV A;  3KHY A;  2JWK A;  3HOS A;  3D7E O;  3BUZ B;  3VEX A;  1MWK A;  3F2K A;  4A5B A;  5FPD A;  3TTF A;  2ZGZ A;  3EKS A;  3HI0 A;  4FWQ A;  4CBU A;  2FSK A;  4OPA A;  5AQM A;  3CCM N;  3HTV A;  1GLE G;  1Q18 A;  4JK8 A;  4YOU A;  4IOX A;  3D6R A;  3W0L A;  4BC2 A;  2VWB A;  3H1Q A;  3MX2 A;  3FE1 A;  3A8Y A;  3A5M C;  3OA9 A;  4IOC L;  5KPT A;  3ZEU B;  3FR0 A;  1T3V A;  4IJA A;  3ID8 A;  1XC3 A;  5E26 A;  3WXM B;  5JLH A;  3CCU N;  3AGK A;  3TSP A;  1MDU B;  2YX6 A;  4IFE A;  3CCS N;  4BEC A;  4BRC A;  4H5V A;  4B1U B;  5EVZ A;  4FPA A;  4IO9 L;  2P9L B;  3CER A;  4M7X A;  5AQN A;  3P4I A;  2WBN A;  2P9I A;  2QM1 A;  3ENB A;  4JEP A;  4NO7 A;  2IIR A;  3R3L A;  3WQU A;  4BG8 A;  4U7B A;  1YIT N;  3VGL A;  4MDA A;  3IMX A;  4DQ8 A;  4CZI A;  1VQL N;  4IZ9 A;  1BWF O;  3GBT A;  4ISE A;  3SMP A;  2OTL N;  4PL7 A;  3IUC A;  5GIP A;  4H0Y B;  2Q31 A;  3OBW A;  1YUW A;  2Q0R A;  4K43 A;  4RWT A;  1VQO N;  4EHU A;  4CJ7 A;  1MA9 B;  2QWM A;  4IEE A;  5AQP A;  1U6Z A;  2FSN A;  4WF9 L;  3QML A;  1NLV A;  3WXL A;  3LDO A;  2IVP A;  1BO5 O;  2A41 A;  3MX5 A;  1GLC G;  1ZBS A;  4YOX A;  3HM8 A;  4H0X B;  3RSE A;  4JKF A;  1YHQ N;  3CIP A;  1U2V B;  3FZH A;  5M1F A;  4FSV A;  1Z05 A;  3M5R A;  1GLF O;  4FWR A;  4I6M A;  3MCA B;  4BGA A;  1VQ9 N;  1JCE A;  4BC3 A;  4JD2 B;  4WFN L;  3AY9 A;  1MWM A;  4JHD B;  2GEM A;  3DXK A;  3MN7 A;  2YHW A;  5AQL A;  5BRF A;  1Q81 O;  4L3Q A;  5EOY A;  4BRQ A;  3UKR A;  2PAV A;  2QWL A;  4BR2 A;  3EKU A;  4XH4 A;  2RE2 A;  5M1O A;  4FWN A;  3UKU B;  5DM6 L;  1TUU A;  3QB0 A;  2NRV A;  3ZX0 A;  3JS6 A;  4CZF A;  4JK9 A;  1OKJ A;  4BR7 A;  3OW2 M;  1NGB A;  5H1S Q;  5AZI B;  4CBX A;  4WQ5 A;  2Q1N A;  4IXC A;  3LM2 A;  3Q7B A;  2P9U A;  2C1G A;  4BR4 A;  3CPW M;  2CH6 A;  2V7Z A;  3H3O B;  3MWP A;  4K25 A;  3SMS A;  2ZJR L;  3CD6 N;  3DXM A;  4EIA A;  2QW9 A;  1YF5 L;  3LM9 A;  3R8E A;  4BRM A;  3O9T A;  5C10 A;  1JCF A;  3AAR A;  4MLH A;  4PKI A;  4NB4 A;  5GAD P;  1W2B M;  3CCE N;  5AQQ A;  4ILJ A;  1S72 N;  3E9P A;  4MO4 A;  2YI1 A;  5GAG P;  3IKM A;  4PKH A;  4IDH A;  3CJC A;  5AQI A;  1HUX A;  1NGC A;  4IOA L;  1IJJ A;  1H1V A;  5C12 A;  5LJV A;  3C0B A;  1G99 A;  1RGI A;  2H3G X;  5JMV A;  5KQD A;  5HL7 L;  3CC4 N;  3LDN A;  4CD3 A;  2D1K A;  3O08 A;  3VMF B;  2GUP A;  1HJO A;  5CHI A;  4H5R A;  5BPM A;  1NGJ A;  2YCH A;  4E1J A;  1NJI O;  2A6A A;  1TYQ B;  5AQG A;  1NWK A;  1NGD A;  5M1Q A;  4M7Y A;  3VF6 A;  3I55 N;  1X3N A;  1T44 A;  3JXU A;  1VQ6 N;  2BH1 A;  3ZET A;  3L6Q A;  3O1W A;  4XH1 A;  3C6H A;  4JNE A;  4JKC A;  2NZT A;  4FL9 A;  5F2R A;  2GWK A;  1HKB A;  3E1Y A;  1KAY A;  3WXJ A;  2ZGY A;  4WQ4 A;  3WXI A;  3MWT A;  5BPL A;  1IG8 A;  4H03 B;  4BQL A;  2P9K A;  1BOT O;  3VEN A;  2WFB A;  5BN8 A;  3LDL A;  2GEL A;  3L4I A;  4BRP A;  4YDU A;  3CJB A;  5M1N A;  2CGJ A;  2F7T A;  3AAQ A;  2V52 B;  4H5W A;  2Q97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...