2P9NA

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
415
structure length
397
Chain Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
total genus 123
structure length 397
sequence length 415
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9nA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9nA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9nA03
5E26A 4AM6A 3D2FB 3VEVA 4QS8A 2E2PA 4CZMA 1KAZA 1BA0A 3MN9A 3MN5A 5AQNA 2KHOA 1XQSC 4BRAA 5ADXH 2P9KA 4KBOA 1HKCA 4FOIA 4ISEA 2CGJA 4H0XB 2P9SA 3GL1A 4JAXA 4MLEA 1X9JA 3GE1A 1NGCA 3EL2A 4BRHA 2Q1NA 3QFUA 3L0QA 1U6ZA 3UKRB 4B1UB 2ZWHA 4FWRA 1TUYA 4H03B 1BWFO 2QWRA 1E4FT 4BVOA 3M1FA 2QWOA 4BRIA 4H5TA 2YHXA 4XH1A 4A2AA 4BC4A 2ASMA 4JD2A 2IVOA 2HMPA 3LM9A 2P9LA 5BPLA 2QWQA 5AZJB 3SJHA 4WQ5C 1MA9B 4PKHA 3LDQA 3R9PA 2ASPA 3SLCA 3VEWA 3FLCO 5F2RA 1JCEA 3FFKB 3P4IA 4FWSA 4GY2B 2HOEA 2VYPA 3MDQA 3CHWA 4BR9A 5FPNA 3VEXA 1MWMA 3O5BA 4K43A 4BC2A 5KPRA 2ZF5O 3SK3A 3ZEUB 3AAPA 2CH6A 4CBUA 2V7YA 2W40A 1XC3A 1LCUA 4AM7A 1HKBA 4H5WA 4FWPA 4IXCA 3CQXA 3QB0A 5AFUA 3RSEA 4IO8A 4FWKA 3LDPA 3CJ9A 4H0OA 4HWIA 5BRDA 2P9IB 4CBXA 3D7EO 2ITMA 4BR2A 3KZBA 4DQ8A 4NO7A 2YJEA 3GOIA 5AQYA 2NRHA 5BPNA 5AFUH 4FPAA 2E2OA 2H3GX 3EZWA 3ZEUA 4B1XB 4H5NA 3WUHA 1NGEA 2FSNA 4QS7A 2IIRA 3BF1A 3A5OC 2FF6A 4IJNA 4PKGA 5BR9A 4BRGA 3VEZA 1TYQA 2FSKA 2Q97A 5LY3A 4B9QA 4BREA 1HKGA 3VEOA 4CJ7A 1C0GA 4CZGA 4M63C 1NMDA 3ENHA 2FSJA 4B1YB 1LOTB 3OHRA 4L3QA 3O6WA 4BROA 4JHDB 1NGJA 5BPMA 3WXKA 5AQWA 3HBTA 2E88A 5FPMA 2VWBA 4DCHA 1H1VA 5JLHA 1QHAA 4XEIA 4M7YA 3WQTA 4WQ4A 4BG9A 1X3NA 3DAWA 3O1BA 3IMXA 4ISGA 4BQLA 2D1KA 4BRPA 5EVZA 1X3MA 4FO0A 2QW9A 3A0IX 3LL3A 2D0OA 5KQ8A 3IUCA 3L4IA 5JMVA 4DHYA 2DPNA 1NBWA 3AAQA 1YVNA 3CERA 3LDNA 3UKUA 4FWMA 2BUPA 4H0YB 1YAGA 1HX1A 2CH5A 5ADXA 2W41A 4YDUA 3I33A 3WXLA 3QDKA 4CZHA 4RCHA 2BTFA 3C0BA 3EN9A 1ZC6A 2YI1A 3WXJA 3WXIA 4CZEA 5AQOA 2QWNA 4FOEA 1SQKA 1YXQA 4BR4A 4E1JA 3HSCA 4EFHA 3VPZA 1JCFA 1KXPA 5AR0A 5BN9A 5BRHA 1GLJO 3W3DA 3DJCA 2P9NB 1HUXA 2V52B 5B8HA 2I7PA 4MO5A 3D2FA 3ZX3A 3O8MA 1SAZA 3CJBA 2ASOA 4FWNA 4BRMA 4O8KA 2GUPA 2AP1A 3SMPA 1WOQA 3CQYA 3TPQA 1KAYA 5KPTA 1U2VB 1ATNA 3HI0A 4BVPA 1NWKA 3CIPA 2P9NA 3LM2A 3ULEB 3VF2A 3CJ7A 4HTLA 2FXUA 3KVGA 1RFQA 1XUPO 1RDWX 1GLFO 1IG8A 2CGLA 3UKRA 1DKGD 1HLUA 3H46O 3HTVA 4WYBA 1DGKN 1NGGA 1NLVA 4BR0A 4BRQA 3O80A 4GNIA 4MO4A 4NB4A 2A41A 1NGFA 2PBDA 3DXKB 1T44A 3VGKA 2GWKA 4XH4A 3H1QA 4B1WB 3GBTA 5FPEA 1BOTO 2EWSA 4CZKA 5F1XA 3A5LC 1HPMA 3FGUA 5AZJA 3FZLA 2E1ZA 5BRFA 2GWJA 3FZHA 1GLCG 3U9ZA 2Q0RA 2V51B 2P9PB 3BUZB 3O1WA 5BN8A 3H3NO 4K25A 4BC5A 4ISFA 3ZX0A 4FSVA 4CD3A 5AQXA 4EHUA 1NGBA 1ESVA 2QWLA 1G99A 4BG8A 4B1ZA 2YHWA 4LC9B 2J4RA 3AY9A 3M3ZA 2P9PA 1S3XA 3WEEB 2Q0UA 3FZFA 3QBXA 2P9IA 3R6MA 4Z94A 3J8AA 2P9UB 4H5VA 3DXMB 3QICA 2I7NA 3EKSA 5EY4A 4H0TB 2E20A 3BP8A 3I8BA 3D2EB 5AQRA 3MN7A 3QBWA 5TKYA 3WT0A 3CETA 3QFPA 4A2BA 1NM1A 3H45C 1IJJA 2GTDA 1YUWA 3UB5A 1DEJA 4H5RA 4JN4A 5AQFA 3UE5A 2PAVA 2QWMA 5AQGA 3VGLA 3GG4A 1Y64A 3ATUA 5AZIB 3DXMA 4PL8A 1P8ZA 4JHDA 3VGMA 4FPBA 1JCGA 3VETA 3BEXA 3A8YA 2QXLA 1GLLO 3CJCA 1KAXA 4QS9A 1QQOA 3H1VX 2YHYA 4BGBA 5JICA 3FE1A 5AQIA 1CZAN 1BG3A 4FWQA 2A3ZA 5LJVA 3EO3A 1Z6RA 3H6EA 4JNEA 5AQUA 2CGKA 2OANA 4K41A 2P9KB 1GLDG 4FWLA 4Y0WA 1S22A 3ID8A 5EX5A 2ZGZA 5BREA 1J6ZA 3QMLA 4CD1A 4I6MB 3HZ6A 4BRNA 3ZX2A 2YCHA 3CI5A 3G25A 4K42A 1K8KB 2FF3B 3VF6A 3U4LA 1D4XA 4O5FA 5AQMA 3IFRA 3FR0A 3M6GA 1GLBG 1NGHA 4IJAA 4EHTA 1MDUB 3U9DA 2FLOA 4I6MA 3A5MC 4JD2B 4FL9A 3VF4A 2P9LB 2E8AA 1K8KA 2A6AA 1BU6O 4CBWA 2NZTA 3HM8A 5I9EB 5AQKA 4H0VB 4CI6A 5CE3A 2WUSA 1QQMA 1ZXOA 2AA4A 4RTFD 2NLXA 1Z05A 1U2VA 4IWVA 3U8XA 4BRFA 5JLFA 4B1VA 4H0PA 3GDQA 4WQ5A 1GLEG 3ULEA 2A5XA 2D4WA 1ZBSA 2QM1A 3EKUA 1MWKA 1C0FA 4M7XA 3BF3A 1ATRA 2IVPA 3AARA 5KPZA 3MCPA 1T6DA 2E2QA 2V7ZA 2HF3A 2E2NA 3LDOA 1R59O 3H3OB 1BO5O 1OKJA 3JS6A 1SZ2A 3DXKA 2ZGYA 3VESA 3SMSA 3RSEB 2A42A 4IZ9A 3C7NB 3L6QA 4C23A 1EQYA 4DB3A 3WQUA 1NGIA 1V4TA 4EAHD 5FPDA 4FWOA 3O4WA 4BRCA 2VCPA 1BUPA 3TU5A 5ELZA 2GELA 2GEMA 1QQNA 3KHYA 4BRDA 3W0LA 4BR5A 4EIAA 1Q18A 1TYQB 3LDLA 5E84A 4A61A 5AQTA 2F9WA 2IVNA 3MMVA 2E1YA 3C7NA 2A40A 4PL7A 3R8EA 2D0PA 1TUUA 1BDGA 2Q31A 3ENOA 3MN6A 5AQQA 1WUAA 2UYTA 5EOYA 1BA1A 3A5NC 1T6CA 5AQLA 3ZETB 3JXUA 4CZFA 4RWTA 3WEEA 4XH5A 3VENA 1V4SA 4A62A 1QZ5A 2P9UA 3FZKA 4BRKA 1E4GT 5AQJA 2QWPA 3MK6A 5AQZA 3S41A 5F0XA 4WQ4C 3B8AX 3D2EA 5EXWA 4CZLA 5AQPA 3ZETA 4BRLA 1NGDA 4PKIA 3UKUB 4BC3A 4CZIA 1ATSA 2YJFA 4BQZA 3VERA 1QZ6A 1GLAG 5AQVA 5AQSA 1NGAA 3DWLA 3VOVA 5AZIA 2HF4A 4CZJA 5AQHA 3FZMA 1RGIA 3CJ1A 2F9TA 5KQDA 4BGAA 3ATVA 4J8FA 4YDUC 3CJAA 4MLHA 3IDHA 4F9OA 3VEYA 2Q2RA 2Q36A 2P9SB 3F9MA 3O08A 1HJOA 5LJWA 4BR7A
chains in the Genus database with same CATH superfamily
3VQ4A 3MX2A 4DF4A 2D0AA 3ASMA 4QS8A 4CZMA 3QEPA 1NK5A 4BRAA 4CEFA 4FJ5A 4R5PA 4CF9A 4N56A 3CPWM 5GAEP 4CF0A 1JLQA 1SL2A 1ASVA 2XY5A 4KH6A 1NGCA 4CGJA 4W5QA 2NRVA 2OTLN 4JKAA 3UKRB 2ZWHA 3VQAA 2EHGA 4DFKA 3J81O 1Y97A 1TVRA 3DLHA 3M1FA 2QWOA 4WF9L 4FZZA 2HHWA 4XH1A 1T03A 4BC4A 4H4OA 3TARA 4JD2A 1QE1A 3VQBA 4CJPA 4GVEA 4UY8O 2G8VA 5BPLA 4DTUA 4DTOA 2HHXA 2VQFK 4IEEA 5AZJB 2BGGA 4WQ5C 3G4SN 2HHUA 3QETA 2P1JA 4YFUA 2ASPA 3LANA 1JCEA 2UXBK 2R7YA 1NKEA 2Z1GA 4JI7K 1BL3A 4BC2A 5KPRA 1SL0A 1TAUA 3HXMA 1B92A 4DTXA 1GOCA 4AILC 4L8RB 1HRHA 4AM7A 5HROA 3RSEA 4IO8A 4FWKA 4X64K 4H0OA 4HWIA 4YOUA 2P9IB 4HUEA 3ZSYA 5KGXA 4CBXA 3D7EO 3PY8A 4BR2A 3PUFA 4DUZK 3GOIA 3EZWA 2B4JA 3ZEUA 4B1XB 5M1KA 3M8RA 3WUHA 3PO5A 4Y1CA 3D6RA 3KLEA 1QQCA 3A5OC 3DLBA 3VQ5A 2FSKA 4NCAA 4AHUA 3CCEN 4B9QA 1BIZA 1KLNA 4CJ7A 3PX6A 1NMDA 2FSJA 4KAZA 3OHRA 4L3QA 3WXMB 1EKEA 3AVGA 5BPMA 4YOYA 4FYDA 5C10A 3CCUN 1HNIA 1P90A 5FPMA 3HBTA 2E88A 4I2PA 4XEIA 1VRUA 4M3RA 1VSDA 2PZSA 1X3NA 1L3SA 2IS3A 4IOCL 3JYTA 2VG5A 4XIUA 4YOVA 4A5BA 4BRPA 1S1UA 5EVZA 4CJSA 3PIOL 2W6LA 4U7BA 1HYSA 4CFDA 4DKWA 2OA8A 2P5GA 4DHYA 1NBWA 4EP5A 2G8IA 3THYB 3HVTA 2P5OA 2HVIA 4OPJA 4KB0A 2QI2A 3QDKA 3K9JA 5HRRA 4DLGA 4CZHA 3LAKA 3EN9A 3NF7A 3SYZA 2YI1A 3WXJA 3WXIA 3NDKA 2HBMA 4FOEA 4B9MA 3O3HA 1JCFA 4HUGA 3AVBA 2DTUA 5BRHA 3IG1A 4JKBA 4X66K 3DJCA 4JK9A 5K14A 5C15A 2V52B 2NRWA 3O9TA 3BDPA 3KD1E 1T05A 3V81A 4LF8K 1RT2A 3OYDA 3TPQA 4AQYK 3EE8A 3OJUA 3HPOA 4QAGA 2HNYA 4LF9K 3H08A 4JS4A 3CD6N 3LM2A 3O4QA 4HTLA 4BE1A 3RRGA 2X6SA 4I9QA 3OA9A 1N5YA 4A57A 3DLLL 2FBYA 4IFVA 3ITHA 1NLVA 4BR0A 5JENA 1BI4B 3ZCMA 4BRQA 4W5TA 1NK7A 3P83D 3O80A 1FJGK 5JVGL 3I0RA 1NGFA 3MXMA 3VGKA 1RTHA 3OS2A 4DU3A 3QEVA 3H1QA 4B1WB 2RKIA 1BOTO 4RW6A 3AVCA 4CZKA 4CEEA 3BGRA 3TAGA 1X9SA 3SNNA 3HPHA 3SQ1A 1XWLA 2E1ZA 4M41A 4IBNA 4W5NA 3FZHA 1YJ9N 1LWCA 2P9PB 4EZ9A 2FC0A 2QTDA 3F5TA 4N41A 2PFUA 4CHPA 4EHUA 2QWLA 1ESVA 3TSUA 4CJRA 4AF1A 4B1ZA 2XO7A 2OZSA 2YHWA 1C1BA 3L2WA 2X6NA 3C95A 3M3ZA 4HHTA 1S3XA 2Y1IA 4FZYA 2OPSA 3E9LA 2NNWA 5E41A 4E7KA 1J5EK 4A5AA 1RNHA 3AA4A 2VGMA 2KTQA 2FBVA 1SKSA 3AA3A 5EY4A 1EXQA 4H0TB 4GV6A 3RMDA 3CFRA 1LV5A 1I3AA 3MN7A 1VQNN 3CETA 3QFPA 4OGEA 3RR7A 3M5RA 2AJQA 1DEJA 1RBSA 4H5RA 4RW9A 5AQFA 5C0YA 5AQGA 3CCVN 1ZYQA 3L8BA 4DWIA 3VGMA 2HHIA 2ITGA 1JCGA 3S5TA 3BEXA 3CJCA 1GLLO 4WCEL 4QS9A 4DR7K 1N6QA 1B9DA 2YHYA 4IDKA 4F8RA 2JWLA 1D5AA 2WOMA 2A3ZA 4LH5A 3HVRA 1TGOA 3EO3A 1Z6RA 1YHQN 2O8BA 2CGKA 3DRSA 4FWLA 4BE2A 4M42A 4DLEA 5EX5A 2ZGZA 4I6MB 1VQ5N 3S3OA 1JL2A 3KJVA 3O9SA 4JKGA 3VF6A 3NBPA 3PSFA 2YNFA 4Y1DA 2KQ2A 1Q9XA 4WE1A 4FLYA 1N36K 4FJXA 4C8LA 1MDUB 2FLOA 3A5MC 3VN5A 1IG9A 4FL9A 4CEDA 5MLCQ 4FM2A 4FJMA 1BU6O 3HM8A 5DM7L 3T1HK 1ZXOA 3DLKA 4EZ6A 2NLXA 1U2VA 1Z05A 3U8XA 2ZJQL 2KZZA 4CJUA 4DTRA 4B1VA 4H0PA 3GDQA 2WONA 2Z1IA 4WQ5A 1GLEG 4FK4A 2KZMA 2D4WA 4ID1A 2WC9A 4I7FA 4Z4CA 3BF3A 1S9GA 2YV0X 1T6DA 2E2QA 3T1YK 4M3XA 3LDOA 4CK2A 3H3OB 1YTAA 2JWKA 1BHLA 2HNDA 2YKMA 4CGHA 3SMSA 3V9SA 4B3RK 1BCOA 1EQYA 4HUFA 1ZBHA 4FWOA 1VSHA 1XC9A 2QA4N 3O4WA 4BRCA 3S9HA 1YIJN 1BUPA 2RF2A 5ELZA 3KHYA 3W0LA 4FK0A 1FW6A 1U04A 2BANA 1ASWA 2A40A 4CHNA 3R8EA 2D0PA 3MN6A 1UOCA 2G8KA 1K6YA 1RT1A 4Z4HA 4I2QA 5EOYA 4AHVA 1NK4A 1N33K 2YNIA 4FJKA 5FRMA 4A62A 4IOAL 3DLGA 2P9UA 3THXA 4G9ZA 3DMJA 1QVFM 1VSFA 4JI3K 1LWFA 1EETA 4BE7B 3NAEA 3AVFA 3SQ4A 3D2EA 3KWGA 4CZLA 3AO4A 4LH4A 3ZLJA 2RE2A 3UKUB 5I42A 4CZIA 3IAYA 5JS2A 1QTMA 1NGAA 1IO2A 5AZIA 4KKOA 1KVBA 3SI6A 3IRXA 3TI0A 3ATVA 3CJAA 4MLHA 1ZBIA 1VQ6N 4F9OA 2IAJA 2VWKA 3F9MA 3Q7BA 5E26A 4AM6A 4DSIA 1ASUA 3VMFB 1RDDA 4DV3K 3RMAA 1KAZA 5AQNA 3MN9A 3RVCA 1DTQA 1VSLA 4O55A 2HNZA 4HCCA 4ISEA 1J54A 3GL1A 1ZBFA 4CEQA 4ZHRA 4OLBA 3I56N 4B1UB 4TSXA 4KH4A 1QHTA 4DR3K 2QWRA 2KW4A 4MFBA 4ILHA 4FJGA 3O3FA 4QCLA 1YT3A 4LFAK 4E7LA 4H5TA 1TK8A 1XNRK 4CJ5A 2XY7A 4LY7A 3C94A 2QKBA 2HMPA 4CK1A 4HCBA 1G15A 3S3MA 2DFHA 2O8EA 2QWQA 4JKCA 4PKHA 4ZTFA 3LDQA 3MEDA 4LF5K 1S1TA 4V19S 1S6PA 4DR5K 1WSJA 3FFKB 3SV4A 2ZQBA 5HBMA 4E7JA 3CC7N 1W7AA 5FPNA 3O5BA 3QNNA 5M1OA 1WAJA 3BZKA 2ZF5O 4KFBA 4IOXA 1LCUA 1XMQK 5AFUA 3AVLA 3LDPA 3CJ9A 2KLAA 1K9MO 3KZBA 4MDBA 4DQ8A 1GOAA 4NO7A 2YJEA 4O0IA 2W42A 4O8UA 5LL6Z 2E2OA 2H3GX 2HHSA 1NKBA 4H5NA 4M45A 5GAHP 2BE2A 4YY3K 3LWLA 1EX4A 4QS7A 2IIRA 1WSFA 1NJYA 2FF6A 4PKGA 4CERA 1IBLK 3V9WA 2Q97A 3QEIA 1C0GA 4CZGA 4M63C 1KVAA 4KH5A 3K58A 3ZT0A 3HPGA 1TKZA 2OPPA 4BWMA 3CCSN 3TAEA 1SS6A 1NGJA 1J53A 3WXKA 3MEEA 2VG6A 3B6OA 5AQWA 4JI1K 3SUOA 3EYZA 4DCHA 1QHAA 4M7YA 3K0SA 3HP9A 4NYNA 3NH0A 4LSLA 3TAMA 3LP0A 4Z4IA 3IMXA 4BDPA 4JI0K 2WFBA 1FK9A 1UWBA 4DS5A 2HSTA 5GAGP 1X3MA 3TR8A 5JMVA 2RHKA 4Z4EA 2HHQA 1HNVA 4KHYA 1YVNA 2O8CB 4FWMA 4JI6K 1VQ9N 1FXXA 4H0YB 3V9ZA 1HX1A 2CH5A 4LF4K 3I33A 4DSEA 4AHSA 3Q7CA 2NRRA 2UXDK 3M8PA 4NXNK 2BTFA 3C0BA 4DR4K 1RT6A 3TAFA 4CZEA 2QWNA 3TSQA 4E1JA 4EFHA 4DU4A 3VPZA 5AR0A 3MX5A 3THYA 3EY1A 3NVKA 1NMNA 2P9NB 4IG0A 3FFIA 1HUXA 1JLEA 5B8HA 4DV1K 2I7PA 4MO5A 3D2FA 3PIPL 1KSPA 3SUQA 4KPYA 4BRMA 3MECA 4JLHA 3VQEA 3CQYA 3OYGA 1TL3A 1KAYA 3HOTA 3MEGA 3CCMN 1O1WA 4F2RA 1JLFA 3CIPA 3QNOA 3DRRA 3HM9A 4NCBA 3QESA 1IKWA 2FXUA 1RFQA 1XUPO 1GLFO 2CGLA 1DKGD 3H46O 1D9FA 2DFFA 5FLXO 1DGKN 1D9DA 1NGGA 3P1GA 3PX0A 3ZT3A 3NE6A 3OYLA 4GNIA 4MO4A 2A41A 3DXKB 1T44A 4FLZA 1WAFA 2GWKA 4XH4A 2E5LK 3AV9A 2C1IA 1KD1O 3G10A 4M3ZA 3NH2A 1Q9YA 2HVHA 3FGUA 3FZLA 2UXCK 5BRFA 2JGUA 4CF8A 5M1NA 1ITGA 1BI4A 4CW7B 1TK5A 4KTQA 1S1WA 3TAQA 1OH5A 2YNHA 2O8FB 3BUZB 1VAZA 4K25A 3CC4N 1EP4A 4DQPA 4GV9A 3THWB 1IBMK 3WNFA 5TKWA 1X9MA 1G99A 4B08A 3KKRA 3TWHA 1L5UA 3PLAA 1EWQA 1IBKK 1HQEA 4LC9B 2J4RA 3AY9A 4CJTA 2P9PA 4KI4A 4NCGA 5DM6L 4E19A 1EO1A 1RTDA 3UIQA 2Q0UA 3SV3A 3R6MA 4U67L 5J2PA 4NLCA 3J8AA 4B3MK 1C0TA 3LZIA 4Z0UA 4YOXA 3QICA 3EKSA 2EX3A 2FBTA 1REVA 3BP8A 4B9VA 1RDUA 4WFAL 1HYZA 5TKYA 4FJNA 5AQRA 3QBWA 5J1EA 2WBNA 1KFDA 4CJKA 3PV8A 1FKOA 3H45C 2GTDA 3NF8A 3QO9A 4CEZA 4E0DA 1Q8IA 3UE5A 3ZSVA 2GV9A 2PAVA 1Y64A 3ATUA 4DR2K 4E7IA 3LP1A 3HL8A 4PL8A 4JHDA 3LALA 4FPBA 4CHYA 1U4BA 3CMAN 3A8YA 1KAXA 4JK8A 1WN7A 1CXUA 2PY5A 4B9SA 3ZT1A 4O44A 1Z26A 3FE1A 3KTQA 1CZAN 1NU0A 1BG3A 4FWQA 5LJVA 3T69A 4PWDA 3I55N 3H6EA 2UU9K 1KFSA 2OZMA 4JNEA 1RILA 1VSJA 3K9KA 4F4KA 3AA2A 1GLDG 1S22A 1NK8A 5BREA 2GBZA 1J6ZA 3AO5A 4GMJB 3N4PA 4BRNA 1SL1A 3ZX2A 1VQ7N 2DY4A 3CI5A 3G25A 4K42A 1K8KB 1NKCA 1TKXA 3VTIA 4DTSA 2HBKA 3ZSWA 3SUPA 5JVHL 4O5FA 5AQMA 1GLBG 4FJ9A 3NF6A 5CHIA 4IEIA 3PSIA 4I6MA 4JD2B 4DV7K 1NG9A 1L3VA 3VA3A 4CI6A 1VQON 4DV4K 3TTDA 2AA4A 4CF1A 3EE9A 4Q0BA 3C65A 2IOCA 3ULEA 4OVLA 5C2FA 1N8RO 2D5RA 3CM6A 2B6AA 1ZBSA 1NNEA 1MWKA 1C0FA 3JSMA 3SCXA 4F3OA 4DTPA 3MCPA 3SUNA 3QEXA 2V7ZA 4FJHA 4KHWA 3SBGA 1OKJA 2ZGYA 3IKMA 3RSEB 2ZJPL 3A2FA 5J2MA 3HT3A 4IZ9A 3C7NB 3L6QA 3MWTA 4OGCA 3QEWA 4CJLA 1V4TA 4IDHA 4EAHD 3OYEA 2VCPA 3TU5A 3OYIA 5EU7A 3LP2A 3ZSQA 1LW2A 3OBYA 4BRDA 4BR5A 3K5LA 4EIAA 4MQ3A 1Q18A 4E7HA 2E4LA 5E84A 5AQTA 3MMVA 4H4MA 2E1YA 1YITN 3HRGA 1RBRA 1TUUA 1WLJA 1RCHA 2Q31A 2YHBA 1RT3A 4E89A 4PY5A 3EEQA 4DSLA 4F2SA 1W9HA 3OYBA 3CFOA 1CXQA 5AQLA 3JXUA 3WEEA 3S3NA 1VRTA 2NRZA 3K57A 2HMIA 3V4IA 1C1AA 2XY8A 4CCHA 1E4GT 2QWPA 3MXJA 3CCJN 5AQZA 2B5JA 3OVNA 2F96A 3VA0A 4J2BA 5EXWA 4BRLA 3CCLN 1NGDA 2O8DB 4PKIA 4K0KK 4BQZA 4KHQA 3E9PA 3VERA 1QZ6A 3LDSA 4JI4K 4AH9A 3IS9A 2F8SA 1RGIA 3CJ1A 5GADP 4N47A 2Z1HA 4BGAA 4DSJA 2OPRA 2P9SB 5CYMA 4CIGA 1HJOA 1KRPA 1JLCA 2F8TA 3VEVA 1D8YA 3AO2A 1WSHA 2E2PA 1Q86O 2W6KA 4CESA 3PX4A 3MN5A 2KHOA 1XQSC 1M90O 4B9TA 4E1NA 2P9KA 1K8AO 2A1RA 3OY9A 5KGWA 3KD5E 2E6LA 4FOIA 2CGJA 4H0XB 1SV5A 3SAHA 1X9JA 2Q3SA 4BRHA 2Q1NA 3NMUA 3L0QA 1U6ZA 2QXFA 4FWRA 1OH7A 4DV0K 4OJRA 1TUYA 3V1QA 4BVOA 5IT9O 3WNEA 3CC2N 4CEOA 3KWIA 4C8MA 3E1YA 4ILJA 3B6PA 2P9LA 3KIOA 4PHTX 1J5OA 3ULDA 3V6DA 3ZSXA 2UUAK 1MA9B 4PA1A 1TK0A 4HVJA 5HP1A 4IG3A 4OPHA 3VEWA 4X65K 3LWMA 4B8CA 3P4IA 4GY2B 1RT4A 3SZ2A 3CHWA 4BR9A 1X9WA 1MWMA 2HB5A 3QIPA 2YKNA 3HP6A 2XY6A 5CYQA 3G6EN 3ALYA 3AVNA 1XC3A 4JRPA 3CG7A 1HKBA 4H5WA 4DS4A 4FWPA 3CQXA 3QB0A 3OYNA 1A5WA 3JAMO 1IKYA 4FM0A 3RRHA 1I94K 1BQMA 4E1MA 5M1QA 1KTQA 5BPNA 1RTJA 2NRHA 5AQYA 4FPAA 3NGZA 3AGKA 2UUCK 1A5VA 3RR8A 2FSNA 5BR9A 4IJNA 3CXCM 4BRGA 1TYQA 1JXEA 5LY3A 1C1CA 3VQ8A 4B3TK 3L2RA 1BGXT 5KI6A 4B1YB 2KFZA 1LOTB 3L2VA 4M3UA 3O6WA 4BROA 3TTFA 3D45A 2VGNA 3NF9A 4BACA 4KHUA 1H1VA 2XRIA 3QINA 5JLHA 4YHHK 4BG9A 1UA1A 3LZJA 3CCRN 3DAWA 3C6AA 3O1BA 1JXBA 2D1KA 1QSYA 1NK6A 2O8BB 4BDYA 3TAPA 4FO0A 2QW9A 3A0IX 5KQ8A 3L4IA 4DTJA 3CERA 3LDNA 4CHZA 2BUPA 1YAGA 1JLGA 5ADXA 2ZJRL 4YDUA 3TABA 1HR0K 4H8KA 1U49A 3VQ6A 3T1AA 5CZ2A 4JKGB 1RBVA 1ZC6A 1C0UA 1JLAA 4YOWA 5AQOA 1SQKA 4BR4A 3SPYA 4C1NI 1KXPA 5BN9A 2O8CA 4FK2A 4FJ8A 1GLJO 3OW2M 3J7YP 1IKVA 5KRTA 4RG8A 4W5OA 3O8MA 1SAZA 4OKEA 2ASOA 1GOBA 4O8KA 2GUPA 1Q7YO 2AP1A 4B3OA 4C8NA 1VQ8N 1YVUA 3QERA 5KPTA 3THVA 2NRXA 1U2VB 1WSIA 1ATNA 4FW1A 1VHXA 1NWKA 2HHTA 1J9AA 3OYFA 3CF5L 4DQRA 3C6TA 2P9NA 3VF2A 4LF6K 3CJ7A 3KLGA 5C25A 3G71N 4PUOA 3UKRA 2P51A 3SJJA 5HLFA 1OVYA 4CGDA 3T3FA 4JYAK 4CFAA 3DRPA 3J80O 1W0HA 2G8HA 4J2EA 4NB4A 5GINA 2PBDA 3BZCA 5FPEA 1QSLA 5F1XA 3A5LC 5AZJA 4EP4A 3N4QA 3OS1A 1L3TA 4FLTA 1SKWA 1KVCA 2GWJA 3OYJA 1GLCG 3U9ZA 2Q0RA 2V51B 1Q82O 4CHOA 5GIOA 3M8SA 3AVIA 3O1WA 4J2AA 1XHZA 4BC5A 4ISFA 5CY4A 1HPZA 1S9EA 4G1QA 4CD3A 1NGBA 3OTOK 4BG8A 1BISA 4CF2A 1A5XA 2FBXA 4DFMA 3FZFA 3QBXA 2P9IA 4Z94A 2P9UB 3E9OA 3THXB 1SUQA 4H5VA 3DXMB 1Q81O 2I7NA 4ELUA 5J2QA 1S1XA 3ZT2A 2E20A 1XHXA 3I8BA 3D2EB 3DM2A 3WT0A 4BEBA 1C0MA 1VK0A 3L2QA 3ZYYX 2ETJA 4CIFA 5JS1A 3WNHA 1IJJA 4AHRA 4E3SA 3UB5A 4ELTA 4JN4A 4OPAA 2QWMA 3VGLA 4IKFA 1YF5L 5AZIB 2A1SA 4HTUA 1P8ZA 3KLIA 4W5RA 5H1SQ 3OYMA 3VETA 3L3VA 5J2NA 2QXLA 1QQOA 4F3TA 3H1VX 4GVMA 4BGBA 4YOTA 1Z25A 1HYVA 4DQIA 1VSEA 1UAXA 1HQUA 3OYHA 4N76A 4IFYA 1TL1A 4K41A 4Y0WA 5CZ1A 4Z4GA 3ID8A 4CJQA 2IC3A 3QMLA 1B9FA 3K2PA 4BDZA 4GV3A 4KRFA 1HJRA 4KHPK 3AVJA 1TKDA 4BY9C 2FF3B 2G8UA 3U4LA 3KKSA 3VTHA 1NGHA 4EHTA 5I3UA 3K5MA 4FJ7A 5A2QO 1NOZA 3C6HA 3AGRA 3DOLA 4JKHA 3HJFA 1U47A 4CHQA 4WFNL 4JKFA 1K8KA 4CBWA 1YJNN 5I9EB 3O9RA 5CE3A 4DUYK 1WB9A 2O8EB 4M3WA 4KB1A 3F2KA 4IWVA 1T7PA 2YHAA 3ISNC 1YI2N 3C6UA 4JEPA 3QLHA 3F73A 2A5XA 2QM1A 4OLAA 3MWPA 2ZD1A 5KRSA 2NUBA 3ZSZA 4M7XA 5C42A 1ATRA 2IVPA 4CFBA 4JKDA 3MXIA 2HF3A 5HRNA 1BO5O 5SWMA 1SZ2A 3VESA 2A42A 4C23A 1IV0A 3EZ5A 3V1OA 1ZBUA 1ZBLA 1VSIA 2GELA 2GEMA 2BDPA 3O4NA 4CJVA 4JS5A 1TKTA 1NJWA 2IVNA 3V1RA 3NFAA 3C7NA 3K5OA 1IKXA 4DQQA 3ENOA 3KK1A 4DMNA 3P5JA 1WUAA 3AO3A 1BA1A 4ID5A 3CPEA 3A5NC 1M1KO 3ZETB 4RWTA 4FLXA 2ZM6K 1V4SA 4Q5VA 1QZ5A 5BR8K 1NOYA 3NGYA 1WNSA 3J7ZO 1NJXA 1NJZA 3AVKA 3MK6A 4XJXA 3S41A 5DK5A 3CM5A 1HMVA 3L4QA 4ILGB 4LFBK 2VG7A 3B8AX 3NHGA 4BC3A 1ATSA 4DTMA 1U48A 5AQVA 1N34K 4JV5K 1KCFA 1JL1A 3DWLA 1OH8A 4KI6A 3BY5A 2HF4A 1HNWK 3FZMA 1T3VA 4FJJA 2F9TA 3ENBA 5KQDA 1RBTA 4J8FA 1QSSA 4YDUC 2OPQA 3VEYA 2Q36A 2O8DA 3CFPA 1KLMA 2YX6A 5LJWA 5HRPA 4BR7A 2ZE2A 4JI8K 1RDBA 3D2FB 3O3GA 1BA0A 3M8QA 3AVHA 5ADXH 4KBOA 1HKCA 2ATQA 4CJWA 4GW6A 2P9SA 3TANA 1W2BM 4JAXA 4CJ4A 1HNXK 4MLEA 3GE1A 1XNQK 3EL2A 1R0AA 3QFUA 4NLBA 3K5NA 2HHVA 4H03B 1BWFO 4FM1A 1JLBA 1E4FT 3HO1A 3NGIA 4GKKK 3VQPA 3NVMA 4BRIA 2YHXA 4A2AA 4C8OA 2ASMA 2G8FA 2IVOA 2VWJA 3R1XA 4C8KA 5FDLA 3LM9A 3LPUA 2RPIA 2OTJN 4DR1K 1FKPA 4PQUA 3SJHA 4LFCK 3ZSRA 5HRSA 2QEXN 4FZXC 4C1NK 4DV5K 2O4GA 1VSMA 3R9PA 3SLCA 4ICLA 1RT5A 3TSPA 3FLCO 5F2RA 3P31A 4LF7K 4FWSA 3L3UA 3P39A 4NXMK 4AHCA 2HOEA 2VYPA 3MDQA 3AVAA 4FJIA 3VEXA 4K43A 2D0CA 4CEAA 1MU2A 1RT7A 3SK3A 3ZEUB 3AAPA 1RBUA 1O13A 2CH6A 4CBUA 4OX9K 2V7YA 2W40A 4IXCA 4FLVA 1XMOK 4B9UA 5BRDA 4CGIA 2ITMA 1VQKN 4OPKA 3DLRA 4M3TA 1QS4A 5AFUH 3CMEN 4DF8A 1NGEA 3D0PA 4WFBL 4N5SA 3BF1A 1X1PA 4RW8A 4JI5K 1TAQA 3VEZA 4KHSA 4BREA 1HKGA 3VEOA 3R3LA 3E66A 3ENHA 1NK0A 4GKJK 4KTWA 2WTUA 4JHDB 1N32K 1L3UA 4FXDA 2VWBA 2OCEA 3G0ZA 3WQTA 4WQ4A 1S5JA 3O9UA 4ISGA 4B8AB 3MCAB 4BQLA 5LMUK 4B9NA 3LL3A 2D0OA 3IUCA 4DFJA 1IH7A 2DPNA 3AAQA 3UKUA 2KKZA 1CZBA 4KHNA 2W41A 3HYFA 4CK3A 3WXLA 4OO1J 4RCHA 2JLEA 3SAGA 4FVMA 1W97L 1E3MA 3DOKA 1YXQA 3AA5X 3HSCA 2E6MA 3W3DA 3T19A 4FLWA 4DSKA 5KTQA 3ZX3A 1EWRA 1I39A 3CJBA 1S6QA 2Z1JA 4FWNA 3SMPA 1WOQA 4UQGA 3MAQA 3ZT4A 3V9UA 5CR4A 3AO1A 3U3YA 1DT9A 2YNGA 4CECA 3HI0A 4BVPA 3SQ2A 3ULEB 4O4GA 3KVGA 2X74A 1RDWX 1WBDA 1IG8A 2F7TA 1OVQA 1HLUA 2BH1A 3OBWA 3HTVA 4WYBA 3KLFA 3ZSOA 1JJ2M 4MDAA 5LMNK 4CFCA 1U45A 4LSNA 4CGGA 3RWUA 5C24A 2G8WA 2IDOA 3GBTA 2EWSA 4CVNE 2QK9A 1HPMA 3LAMA 4K8ZA 4ZTJA 3OYAA 1LW0A 1HNZK 4IFEA 5BN8A 1DTTA 3H3NO 1C6VA 3ZX0A 3I0SA 3PO4A 4FSVA 5AQXA 5T7BA 1NJIO 3KLHA 3CCQN 2UUBK 2IGIA 3SAFA 1SKRA 3WEEB 4IO9L 3P38A 1VSKA 5DMRA 3VQQA 3VQ7A 1BCMA 1OH6A 3DI6A 4O5BA 3LPTA 4DTNA 4QOZB 4A2BA 1NM1A 2OYQA 3DYAA 1YUWA 3GG4A 4CIEA 3VQCA 4FLUA 3DXMA 4NYFA 3VQDA 4OKKA 3AVMA 1RDAA 3SPZA 3LP3A 3ID6A 3OYKA 5JICA 5M1PA 4X62K 5AQIA 2X78A 4I9LA 1BIUA 5AJ3K 2QKKA 3V9XA 1YTUA 4A59A 3DLEA 4O0JA 5AQUA 4DQSA 2OANA 4FW2A 2P9KB 1TV6A 1RTIA 2O4IA 4CEBA 2C1GA 4CJFA 3SBTA 4CD1A 4YORA 3HZ6A 3K59A 2LSNA 3F9KA 4ELVA 2YCHA 2D0BA 4B9LA 1UA0A 4AHTA 5FRNA 1D4XA 3IFRA 3FR0A 3M6GA 4IJAA 5C2DA 1BQNA 1JKHA 3U9DA 3OJSA 4FCYA 3I8DA 4KO0A 4KREA 3VF4A 5IWAK 2GUIA 4J2DA 1ILYA 2P9LB 2E8AA 4E72A 2A6AA 4JKEA 3SQ0A 2NZTA 4CE9A 5AQKA 4H0VB 2PYJA 2I5JA 2WUSA 4OKJA 3T7ZA 1QQMA 4Z4FA 1KC8O 4RTFD 4KV8A 1QVGM 4BRFA 2GX9A 5JLFA 2VQEK 4BECA 4K8XA 4YNQA 5HL7L 3EKUA 1K73O 1VQMN 4CJ3A 3HOSA 4DV2K 3AARA 5KPZA 4BWJA 3U3GA 4JK7A 4LD0A 3NH1A 2E2NA 3CYGA 1R59O 3JS6A 3CQ8A 4RW4A 3DXKA 3VQ9A 3CYMA 2RN2A 2Y1JA 4CJEA 4DB3A 1S72N 3WQUA 1NGIA 2HBJA 4DFPA 2DFEA 5FROA 5FPDA 5D3GA 4B3SK 3NCIA 4R79A 4JI2K 1QQNA 1S1VA 4BE0A 3L2UA 2HBLA 3KK7A 3KK2A 4DV6K 1LWEA 1TYQB 3LDLA 4A61A 5C12A 1T8EA 4DR6K 2O8FA 2F9WA 4FJLA 2XHBA 4PL7A 3J7AP 3OS0A 3THWA 1RDCA 1BDGA 5M1FA 5AQQA 1YJWN 4JRQA 3RMCA 2UYTA 4RW7A 4KTZA 1KQSM 4DU1A 1T6CA 2KFNA 5GIPA 1WSGA 4CZFA 4DSFA 4XH5A 1CZ9A 3VENA 3TTCA 2HHHK 2PYLA 1F21A 3FZKA 4BRKA 5AQJA 1WSEA 3WNGA 2HW3A 1VQ4N 5F0XA 4WQ4C 3KK3A 5AQPA 3ZETA 1NK9A 3HK2A 4M3YA 3HSTB 1WBBA 3QIOA 2NRTA 3E01A 2YJFA 3RMBA 2F4VK 1VQLN 1LAVA 4DG1A 3U6FA 1GLAG 1DLOA 5AQSA 3VOVA 3O9QA 4CZJA 5AQHA 4FVUA 4CGFA 1LAWA 1CLQA 3IDHA 2Q2RA 3OYCA 5HOOA 3RTVA 1VQPN 1XI1A 5SZTA 3O08A 2W00A
chains in the Genus database with same CATH topology
5E26A 4AM6A 3MX2A 3D2FB 3VEVA 4QS8A 2E2PA 3VMFB 1Q86O 4CZMA 1KAZA 1BA0A 3MN9A 3MN5A 5AQNA 3RVCA 2KHOA 1XQSC 1M90O 4BRAA 1YJNN 5ADXH 2P9KA 4KBOA 1K8AO 1HKCA 4FOIA 4ISEA 2CGJA 4H0XB 3CPWM 2P9SA 5GAEP 3GL1A 3SAHA 4JAXA 1W2BM 1VQKN 4MLEA 1X9JA 3GE1A 1NGCA 4KH6A 3EL2A 4BRHA 2Q1NA 3QFUA 3NMUA 3L0QA 1U6ZA 3I56N 2NRVA 4NLBA 2OTLN 4JKAA 3UKRB 4B1UB 2ZWHA 4FWRA 4KH4A 1TUYA 4H03B 1BWFO 2QWRA 1E4FT 4ILHA 4BVOA 3M1FA 2QWOA 4WF9L 3NVMA 4BRIA 4H5TA 2YHXA 4XH1A 4A2AA 4BC4A 2ASMA 4JD2A 3CC2N 2IVOA 4GVEA 2HMPA 3KWIA 4UY8O 3R1XA 3E1YA 4ILJA 3LM9A 2P9LA 4PHTX 5BPLA 2OTJN 4IEEA 2QWQA 5AZJB 3SJHA 4JKCA 4WQ5C 2QEXN 1MA9B 4PKHA 4C1NK 3G4SN 3LDQA 3R9PA 2ASPA 3SLCA 4OPHA 3TSPA 3VEWA 3FLCO 5F2RA 1JCEA 3FFKB 3P31A 3P4IA 4FWSA 3P39A 3CC7N 4GY2B 2HOEA 2VYPA 3MDQA 3CHWA 4BR9A 5FPNA 3VEXA 1MWMA 3O5BA 4K43A 4BC2A 5M1OA 5KPRA 2ZF5O 3SK3A 3ZEUB 3AAPA 2CH6A 1O13A 4CBUA 3G6EN 2V7YA 2W40A 4IOXA 1XC3A 1LCUA 4AM7A 1HKBA 4H5WA 4FWPA 4IXCA 3CQXA 3QB0A 5AFUA 3RSEA 4IO8A 4FWKA 3LDPA 3CJ9A 4H0OA 2KLAA 4HWIA 5BRDA 4YOUA 2P9IB 4CBXA 3D7EO 1K9MO 2ITMA 4BR2A 3KZBA 4MDBA 4DQ8A 5M1QA 4NO7A 2YJEA 3GOIA 5AQYA 2NRHA 4O8UA 5BPNA 5AFUH 4FPAA 2E2OA 3CMEN 2H3GX 3EZWA 3ZEUA 4B1XB 5M1KA 4H5NA 3WUHA 5GAHP 1NGEA 3AGKA 4WFBL 2FSNA 4QS7A 2IIRA 3BF1A 3A5OC 2FF6A 3D6RA 4IJNA 4PKGA 4BRGA 5BR9A 3VEZA 1TYQA 3CXCM 2FSKA 2Q97A 5LY3A 4B9QA 3CCEN 4BREA 1HKGA 3VEOA 4CJ7A 1C0GA 4CZGA 3R3LA 4M63C 4KH5A 3E66A 1NMDA 3ENHA 2FSJA 4B1YB 1LOTB 3OHRA 4L3QA 3WXMB 3CCSN 3O6WA 4BROA 1SS6A 3TTFA 4JHDB 1NGJA 5BPMA 4YOYA 3WXKA 2VGNA 5C10A 3CCUN 1P90A 5AQWA 3HBTA 2E88A 5FPMA 2VWBA 4DCHA 1H1VA 5JLHA 1QHAA 4XEIA 4M7YA 3WQTA 4WQ4A 4BG9A 1X3NA 3CCRN 3DAWA 4IOCL 3C6AA 3O1BA 3O9UA 3IMXA 4ISGA 4YOVA 2WFBA 3MCAB 4BQLA 2D1KA 4A5BA 2HSTA 4BRPA 5EVZA 5GAGP 3PIOL 1X3MA 4FO0A 2QW9A 3A0IX 3LL3A 2D0OA 4DKWA 5KQ8A 3IUCA 2RHKA 3L4IA 5JMVA 4DHYA 2DPNA 1NBWA 3AAQA 1YVNA 3CERA 3LDNA 3UKUA 4FWMA 2KKZA 2BUPA 1VQ9N 4H0YB 1YAGA 1HX1A 2CH5A 5ADXA 2W41A 2ZJRL 4YDUA 3I33A 3WXLA 2QI2A 3QDKA 3K9JA 3Q7CA 2NRRA 4OO1J 4CZHA 4RCHA 4JKGB 2BTFA 3C0BA 3SAGA 3EN9A 1ZC6A 1W97L 2YI1A 3WXJA 3WXIA 4YOWA 4CZEA 2HBMA 5AQOA 2QWNA 4FOEA 1SQKA 1YXQA 3TSQA 4BR4A 3HSCA 4E1JA 3VPZA 4C1NI 4EFHA 1JCFA 1KXPA 5AR0A 5BN9A 3MX5A 5BRHA 4JKBA 1GLJO 3W3DA 3DJCA 3NVKA 4U7BA 2P9NB 4JK9A 3OW2M 1HUXA 5C15A 2V52B 2NRWA 3O9TA 5B8HA 2I7PA 4MO5A 3D2FA 3ZX3A 3O8MA 3PIPL 1SAZA 3CJBA 2ASOA 4FWNA 4BRMA 4O8KA 2GUPA 1Q7YO 2AP1A 3SMPA 1WOQA 3CQYA 3TPQA 1VQ8N 3HOTA 1KAYA 5KPTA 2NRXA 1U2VB 3EE8A 5CR4A 1ATNA 1DT9A 3HI0A 4BVPA 3CCMN 1NWKA 3CF5L 3CD6N 3CIPA 2P9NA 3LM2A 3ULEB 3VF2A 3CJ7A 4HTLA 2FXUA 3KVGA 1RFQA 1XUPO 3OA9A 3G71N 1RDWX 1GLFO 1IG8A 2CGLA 3UKRA 1DKGD 2BH1A 1HLUA 2F7TA 3OBWA 3H46O 3HTVA 4WYBA 4A57A 1DGKN 3DLLL 1NGGA 1OVYA 1JJ2M 1NLVA 4BR0A 4MDAA 4BRQA 3O80A 4GNIA 4MO4A 5JVGL 4NB4A 5GINA 2A41A 1NGFA 2PBDA 3DXKB 1T44A 3VGKA 2C1IA 2GWKA 4XH4A 3H1QA 4B1WB 3GBTA 1KD1O 5FPEA 1BOTO 2EWSA 4CZKA 5F1XA 3A5LC 1HPMA 3FGUA 5AZJA 3FZLA 3N4QA 2E1ZA 5BRFA 2GWJA 5M1NA 3FZHA 1GLCG 1YJ9N 3U9ZA 2Q0RA 2V51B 4IFEA 2P9PB 1Q82O 2QTDA 5GIOA 3F5TA 3BUZB 2PFUA 3O1WA 5BN8A 1VAZA 3H3NO 4K25A 3CC4N 4BC5A 4ISFA 3ZX0A 4GV9A 4FSVA 4CD3A 5AQXA 4EHUA 1NGBA 1ESVA 2QWLA 5TKWA 1NJIO 3TSUA 1G99A 4AF1A 4B1ZA 4BG8A 3PLAA 2YHWA 3CCQN 4LC9B 2J4RA 3SAFA 3AY9A 3M3ZA 2P9PA 1S3XA 3WEEB 4IO9L 5DM6L 1EO1A 3P38A 2Q0UA 3FZFA 3QBXA 2P9IA 3R6MA 4U67L 4Z94A 4NLCA 3J8AA 2P9UB 3E9OA 3E9LA 2NNWA 4H5VA 4A5AA 4YOXA 3DXMB 3QICA 2I7NA 1Q81O 3EKSA 2VGMA 5EY4A 4GV6A 4H0TB 2E20A 3BP8A 1RDUA 4WFAL 3I8BA 3D2EB 5AQRA 3MN7A 3QBWA 5TKYA 3WT0A 1VQNN 4BEBA 3ZYYX 3CETA 3QFPA 2WBNA 4A2BA 1NM1A 3M5RA 3H45C 1IJJA 2GTDA 1YUWA 3UB5A 1DEJA 4H5RA 4JN4A 4OPAA 5AQFA 3UE5A 2PAVA 2QWMA 5AQGA 3VGLA 5C0YA 3GG4A 1Y64A 1YF5L 3ATUA 5AZIB 3CCVN 3DXMA 4PL8A 1P8ZA 4JHDA 3VGMA 4FPBA 5H1SQ 1JCGA 3VETA 3BEXA 3CMAN 3A8YA 2QXLA 1GLLO 3CJCA 4WCEL 1KAXA 4JK8A 4QS9A 1QQOA 3ID6A 3H1VX 2YHYA 4BGBA 4YOTA 5JICA 5M1PA 3FE1A 5AQIA 2JWLA 1CZAN 1BG3A 4FWQA 2A3ZA 5LJVA 3T69A 4A59A 3I55N 3EO3A 1Z6RA 3H6EA 1YHQN 4JNEA 5AQUA 3K9KA 2CGKA 2OANA 4K41A 2P9KB 1GLDG 4FWLA 4Y0WA 1S22A 3ID8A 5EX5A 2ZGZA 5BREA 1J6ZA 3QMLA 2C1GA 3SBTA 4CD1A 4I6MB 4GV3A 3N4PA 1VQ5N 4YORA 3HZ6A 4BRNA 3ZX2A 1VQ7N 2YCHA 3CI5A 3G25A 4K42A 4BY9C 1K8KB 3O9SA 4JKGA 2FF3B 3VF6A 3VTIA 2HBKA 5JVHL 3U4LA 1D4XA 4O5FA 5AQMA 3IFRA 3FR0A 3M6GA 1GLBG 3VTHA 1NGHA 4IJAA 5C2DA 4EHTA 1MDUB 5CHIA 4IEIA 3U9DA 2FLOA 4I6MA 3C6HA 3A5MC 4JD2B 4FL9A 3VF4A 5MLCQ 3AGRA 4JKHA 1ILYA 2P9LB 2E8AA 4WFNL 4JKFA 1K8KA 2A6AA 1BU6O 4JKEA 4CBWA 2NZTA 3HM8A 5I9EB 5DM7L 5AQKA 3O9RA 4H0VB 4CI6A 5CE3A 2WUSA 1VQON 3T7ZA 1QQMA 1ZXOA 3TTDA 1KC8O 2AA4A 4RTFD 2NLXA 3F2KA 1Z05A 1U2VA 4IWVA 3U8XA 4BRFA 2GX9A 3EE9A 1QVGM 5JLFA 2ZJQL 1YI2N 4B1VA 4H0PA 3C65A 3GDQA 4BECA 4WQ5A 1GLEG 4JEPA 3ULEA 5C2FA 1N8RO 2A5XA 2D4WA 5HL7L 1ZBSA 2QM1A 3EKUA 2WC9A 3MWPA 1K73O 1MWKA 1C0FA 4M7XA 1VQMN 3BF3A 1ATRA 3HOSA 2IVPA 3AARA 4JKDA 5KPZA 3MCPA 1T6DA 2E2QA 4JK7A 2V7ZA 2HF3A 2E2NA 3LDOA 1R59O 3SBGA 3H3OB 1BO5O 1OKJA 2JWKA 3JS6A 1SZ2A 3DXKA 2ZGYA 3IKMA 3VESA 3SMSA 3RSEB 2ZJPL 2A42A 4IZ9A 3C7NB 3L6QA 4C23A 1EQYA 3MWTA 4DB3A 1S72N 3WQUA 1NGIA 1V4TA 2HBJA 4IDHA 4EAHD 5FPDA 4FWOA 2QA4N 3O4WA 4BRCA 1YIJN 2VCPA 1BUPA 3TU5A 5ELZA 4R79A 2GELA 2GEMA 1QQNA 3KHYA 3OBYA 3W0LA 4BRDA 4BR5A 4EIAA 2HBLA 1Q18A 3KK7A 1TYQB 3LDLA 5E84A 4A61A 5AQTA 5C12A 2F9WA 2IVNA 3MMVA 2E1YA 3C7NA 1YITN 2A40A 4PL7A 3HRGA 3R8EA 2D0PA 1TUUA 1BDGA 2Q31A 3ENOA 3MN6A 5AQQA 5M1FA 1YJWN 1WUAA 2UYTA 5EOYA 1KQSM 1BA1A 3CPEA 3A5NC 1T6CA 1M1KO 5GIPA 5AQLA 3ZETB 3JXUA 4CZFA 4RWTA 3WEEA 4XH5A 3VENA 3TTCA 1V4SA 4A62A 1QZ5A 2NRZA 4IOAL 2P9UA 3J7ZO 3FZKA 4G9ZA 4BRKA 1E4GT 5AQJA 1QVFM 2QWPA 3CCJN 3MK6A 4BE7B 5AQZA 4XJXA 3S41A 1VQ4N 5F0XA 4WQ4C 3L4QA 4ILGB 3B8AX 3D2EA 3KWGA 5EXWA 4CZLA 5AQPA 3ZETA 4BRLA 3CCLN 1NGDA 2RE2A 4PKIA 3UKUB 4BC3A 4CZIA 1ATSA 2NRTA 2YJFA 4BQZA 3E9PA 3VERA 1QZ6A 1VQLN 1GLAG 5AQVA 5AQSA 1NGAA 3DWLA 3VOVA 5AZIA 2HF4A 3O9QA 4CZJA 5AQHA 3FZMA 4FVUA 1RGIA 1T3VA 3CJ1A 5GADP 2F9TA 3ENBA 4BGAA 5KQDA 3ATVA 4J8FA 4YDUC 3CJAA 4MLHA 3IDHA 1VQ6N 4F9OA 3VEYA 2Q2RA 2Q36A 5HOOA 2P9SB 1VQPN 3F9MA 3Q7BA 3O08A 2W00A 1HJOA 2YX6A 5LJWA 4BR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E26 A;  4AM6 A;  3D2F B;  3VEV A;  4QS8 A;  2E2P A;  4CZM A;  1KAZ A;  1BA0 A;  3MN9 A;  3MN5 A;  5AQN A;  2KHO A;  1XQS C;  4BRA A;  5ADX H;  2P9K A;  4KBO A;  1HKC A;  4FOI A;  4ISE A;  2CGJ A;  4H0X B;  2P9S A;  3GL1 A;  4JAX A;  4MLE A;  1X9J A;  3GE1 A;  1NGC A;  3EL2 A;  4BRH A;  2Q1N A;  3QFU A;  3L0Q A;  1U6Z A;  3UKR B;  4B1U B;  2ZWH A;  4FWR A;  1TUY A;  4H03 B;  1BWF O;  2QWR A;  1E4F T;  4BVO A;  3M1F A;  2QWO A;  4BRI A;  4H5T A;  2YHX A;  4XH1 A;  4A2A A;  4BC4 A;  2ASM A;  4JD2 A;  2IVO A;  2HMP A;  3LM9 A;  2P9L A;  5BPL A;  2QWQ A;  5AZJ B;  3SJH A;  4WQ5 C;  1MA9 B;  4PKH A;  3LDQ A;  3R9P A;  2ASP A;  3SLC A;  3VEW A;  3FLC O;  5F2R A;  1JCE A;  3FFK B;  3P4I A;  4FWS A;  4GY2 B;  2HOE A;  2VYP A;  3MDQ A;  3CHW A;  4BR9 A;  5FPN A;  3VEX A;  1MWM A;  3O5B A;  4K43 A;  4BC2 A;  5KPR A;  2ZF5 O;  3SK3 A;  3ZEU B;  3AAP A;  2CH6 A;  4CBU A;  2V7Y A;  2W40 A;  1XC3 A;  1LCU A;  4AM7 A;  1HKB A;  4H5W A;  4FWP A;  4IXC A;  3CQX A;  3QB0 A;  5AFU A;  3RSE A;  4IO8 A;  4FWK A;  3LDP A;  3CJ9 A;  4H0O A;  4HWI A;  5BRD A;  2P9I B;  4CBX A;  3D7E O;  2ITM A;  4BR2 A;  3KZB A;  4DQ8 A;  4NO7 A;  2YJE A;  3GOI A;  5AQY A;  2NRH A;  5BPN A;  5AFU H;  4FPA A;  2E2O A;  2H3G X;  3EZW A;  3ZEU A;  4B1X B;  4H5N A;  3WUH A;  1NGE A;  2FSN A;  4QS7 A;  2IIR A;  3BF1 A;  3A5O C;  2FF6 A;  4IJN A;  4PKG A;  5BR9 A;  4BRG A;  3VEZ A;  1TYQ A;  2FSK A;  2Q97 A;  5LY3 A;  4B9Q A;  4BRE A;  1HKG A;  3VEO A;  4CJ7 A;  1C0G A;  4CZG A;  4M63 C;  1NMD A;  3ENH A;  2FSJ A;  4B1Y B;  1LOT B;  3OHR A;  4L3Q A;  3O6W A;  4BRO A;  4JHD B;  1NGJ A;  5BPM A;  3WXK A;  5AQW A;  3HBT A;  2E88 A;  5FPM A;  2VWB A;  4DCH A;  1H1V A;  5JLH A;  1QHA A;  4XEI A;  4M7Y A;  3WQT A;  4WQ4 A;  4BG9 A;  1X3N A;  3DAW A;  3O1B A;  3IMX A;  4ISG A;  4BQL A;  2D1K A;  4BRP A;  5EVZ A;  1X3M A;  4FO0 A;  2QW9 A;  3A0I X;  3LL3 A;  2D0O A;  5KQ8 A;  3IUC A;  3L4I A;  5JMV A;  4DHY A;  2DPN A;  1NBW A;  3AAQ A;  1YVN A;  3CER A;  3LDN A;  3UKU A;  4FWM A;  2BUP A;  4H0Y B;  1YAG A;  1HX1 A;  2CH5 A;  5ADX A;  2W41 A;  4YDU A;  3I33 A;  3WXL A;  3QDK A;  4CZH A;  4RCH A;  2BTF A;  3C0B A;  3EN9 A;  1ZC6 A;  2YI1 A;  3WXJ A;  3WXI A;  4CZE A;  5AQO A;  2QWN A;  4FOE A;  1SQK A;  1YXQ A;  4BR4 A;  4E1J A;  3HSC A;  4EFH A;  3VPZ A;  1JCF A;  1KXP A;  5AR0 A;  5BN9 A;  5BRH A;  1GLJ O;  3W3D A;  3DJC A;  2P9N B;  1HUX A;  2V52 B;  5B8H A;  2I7P A;  4MO5 A;  3D2F A;  3ZX3 A;  3O8M A;  1SAZ A;  3CJB A;  2ASO A;  4FWN A;  4BRM A;  4O8K A;  2GUP A;  2AP1 A;  3SMP A;  1WOQ A;  3CQY A;  3TPQ A;  1KAY A;  5KPT A;  1U2V B;  1ATN A;  3HI0 A;  4BVP A;  1NWK A;  3CIP A;  2P9N A;  3LM2 A;  3ULE B;  3VF2 A;  3CJ7 A;  4HTL A;  2FXU A;  3KVG A;  1RFQ A;  1XUP O;  1RDW X;  1GLF O;  1IG8 A;  2CGL A;  3UKR A;  1DKG D;  1HLU A;  3H46 O;  3HTV A;  4WYB A;  1DGK N;  1NGG A;  1NLV A;  4BR0 A;  4BRQ A;  3O80 A;  4GNI A;  4MO4 A;  4NB4 A;  2A41 A;  1NGF A;  2PBD A;  3DXK B;  1T44 A;  3VGK A;  2GWK A;  4XH4 A;  3H1Q A;  4B1W B;  3GBT A;  5FPE A;  1BOT O;  2EWS A;  4CZK A;  5F1X A;  3A5L C;  1HPM A;  3FGU A;  5AZJ A;  3FZL A;  2E1Z A;  5BRF A;  2GWJ A;  3FZH A;  1GLC G;  3U9Z A;  2Q0R A;  2V51 B;  2P9P B;  3BUZ B;  3O1W A;  5BN8 A;  3H3N O;  4K25 A;  4BC5 A;  4ISF A;  3ZX0 A;  4FSV A;  4CD3 A;  5AQX A;  4EHU A;  1NGB A;  1ESV A;  2QWL A;  1G99 A;  4BG8 A;  4B1Z A;  2YHW A;  4LC9 B;  2J4R A;  3AY9 A;  3M3Z A;  2P9P A;  1S3X A;  3WEE B;  2Q0U A;  3FZF A;  3QBX A;  2P9I A;  3R6M A;  4Z94 A;  3J8A A;  2P9U B;  4H5V A;  3DXM B;  3QIC A;  2I7N A;  3EKS A;  5EY4 A;  4H0T B;  2E20 A;  3BP8 A;  3I8B A;  3D2E B;  5AQR A;  3MN7 A;  3QBW A;  5TKY A;  3WT0 A;  3CET A;  3QFP A;  4A2B A;  1NM1 A;  3H45 C;  1IJJ A;  2GTD A;  1YUW A;  3UB5 A;  1DEJ A;  4H5R A;  4JN4 A;  5AQF A;  3UE5 A;  2PAV A;  2QWM A;  5AQG A;  3VGL A;  3GG4 A;  1Y64 A;  3ATU A;  5AZI B;  3DXM A;  4PL8 A;  1P8Z A;  4JHD A;  3VGM A;  4FPB A;  1JCG A;  3VET A;  3BEX A;  3A8Y A;  2QXL A;  1GLL O;  3CJC A;  1KAX A;  4QS9 A;  1QQO A;  3H1V X;  2YHY A;  4BGB A;  5JIC A;  3FE1 A;  5AQI A;  1CZA N;  1BG3 A;  4FWQ A;  2A3Z A;  5LJV A;  3EO3 A;  1Z6R A;  3H6E A;  4JNE A;  5AQU A;  2CGK A;  2OAN A;  4K41 A;  2P9K B;  1GLD G;  4FWL A;  4Y0W A;  1S22 A;  3ID8 A;  5EX5 A;  2ZGZ A;  5BRE A;  1J6Z A;  3QML A;  4CD1 A;  4I6M B;  3HZ6 A;  4BRN A;  3ZX2 A;  2YCH A;  3CI5 A;  3G25 A;  4K42 A;  1K8K B;  2FF3 B;  3VF6 A;  3U4L A;  1D4X A;  4O5F A;  5AQM A;  3IFR A;  3FR0 A;  3M6G A;  1GLB G;  1NGH A;  4IJA A;  4EHT A;  1MDU B;  3U9D A;  2FLO A;  4I6M A;  3A5M C;  4JD2 B;  4FL9 A;  3VF4 A;  2P9L B;  2E8A A;  1K8K A;  2A6A A;  1BU6 O;  4CBW A;  2NZT A;  3HM8 A;  5I9E B;  5AQK A;  4H0V B;  4CI6 A;  5CE3 A;  2WUS A;  1QQM A;  1ZXO A;  2AA4 A;  4RTF D;  2NLX A;  1Z05 A;  1U2V A;  4IWV A;  3U8X A;  4BRF A;  5JLF A;  4B1V A;  4H0P A;  3GDQ A;  4WQ5 A;  1GLE G;  3ULE A;  2A5X A;  2D4W A;  1ZBS A;  2QM1 A;  3EKU A;  1MWK A;  1C0F A;  4M7X A;  3BF3 A;  1ATR A;  2IVP A;  3AAR A;  5KPZ A;  3MCP A;  1T6D A;  2E2Q A;  2V7Z A;  2HF3 A;  2E2N A;  3LDO A;  1R59 O;  3H3O B;  1BO5 O;  1OKJ A;  3JS6 A;  1SZ2 A;  3DXK A;  2ZGY A;  3VES A;  3SMS A;  3RSE B;  2A42 A;  4IZ9 A;  3C7N B;  3L6Q A;  4C23 A;  1EQY A;  4DB3 A;  3WQU A;  1NGI A;  1V4T A;  4EAH D;  5FPD A;  4FWO A;  3O4W A;  4BRC A;  2VCP A;  1BUP A;  3TU5 A;  5ELZ A;  2GEL A;  2GEM A;  1QQN A;  3KHY A;  4BRD A;  3W0L A;  4BR5 A;  4EIA A;  1Q18 A;  1TYQ B;  3LDL A;  5E84 A;  4A61 A;  5AQT A;  2F9W A;  2IVN A;  3MMV A;  2E1Y A;  3C7N A;  2A40 A;  4PL7 A;  3R8E A;  2D0P A;  1TUU A;  1BDG A;  2Q31 A;  3ENO A;  3MN6 A;  5AQQ A;  1WUA A;  2UYT A;  5EOY A;  1BA1 A;  3A5N C;  1T6C A;  5AQL A;  3ZET B;  3JXU A;  4CZF A;  4RWT A;  3WEE A;  4XH5 A;  3VEN A;  1V4S A;  4A62 A;  1QZ5 A;  2P9U A;  3FZK A;  4BRK A;  1E4G T;  5AQJ A;  2QWP A;  3MK6 A;  5AQZ A;  3S41 A;  5F0X A;  4WQ4 C;  3B8A X;  3D2E A;  5EXW A;  4CZL A;  5AQP A;  3ZET A;  4BRL A;  1NGD A;  4PKI A;  3UKU B;  4BC3 A;  4CZI A;  1ATS A;  2YJF A;  4BQZ A;  3VER A;  1QZ6 A;  1GLA G;  5AQV A;  5AQS A;  1NGA A;  3DWL A;  3VOV A;  5AZI A;  2HF4 A;  4CZJ A;  5AQH A;  3FZM A;  1RGI A;  3CJ1 A;  2F9T A;  5KQD A;  4BGA A;  3ATV A;  4J8F A;  4YDU C;  3CJA A;  4MLH A;  3IDH A;  4F9O A;  3VEY A;  2Q2R A;  2Q36 A;  2P9S B;  3F9M A;  3O08 A;  1HJO A;  5LJW A;  4BR7 A; 
#chains in the Genus database with same CATH topology
 3VQ4 A;  3MX2 A;  4DF4 A;  2D0A A;  3ASM A;  4QS8 A;  4CZM A;  3QEP A;  1NK5 A;  4BRA A;  4CEF A;  4FJ5 A;  4R5P A;  4CF9 A;  4N56 A;  3CPW M;  5GAE P;  4CF0 A;  1JLQ A;  1SL2 A;  1ASV A;  2XY5 A;  4KH6 A;  1NGC A;  4CGJ A;  4W5Q A;  2NRV A;  2OTL N;  4JKA A;  3UKR B;  2ZWH A;  3VQA A;  2EHG A;  4DFK A;  3J81 O;  1Y97 A;  1TVR A;  3DLH A;  3M1F A;  2QWO A;  4WF9 L;  4FZZ A;  2HHW A;  4XH1 A;  1T03 A;  4BC4 A;  4H4O A;  3TAR A;  4JD2 A;  1QE1 A;  3VQB A;  4CJP A;  4GVE A;  4UY8 O;  2G8V A;  5BPL A;  4DTU A;  4DTO A;  2HHX A;  2VQF K;  4IEE A;  5AZJ B;  2BGG A;  4WQ5 C;  3G4S N;  2HHU A;  3QET A;  2P1J A;  4YFU A;  2ASP A;  3LAN A;  1JCE A;  2UXB K;  2R7Y A;  1NKE A;  2Z1G A;  4JI7 K;  1BL3 A;  4BC2 A;  5KPR A;  1SL0 A;  1TAU A;  3HXM A;  1B92 A;  4DTX A;  1GOC A;  4AIL C;  4L8R B;  1HRH A;  4AM7 A;  5HRO A;  3RSE A;  4IO8 A;  4FWK A;  4X64 K;  4H0O A;  4HWI A;  4YOU A;  2P9I B;  4HUE A;  3ZSY A;  5KGX A;  4CBX A;  3D7E O;  3PY8 A;  4BR2 A;  3PUF A;  4DUZ K;  3GOI A;  3EZW A;  2B4J A;  3ZEU A;  4B1X B;  5M1K A;  3M8R A;  3WUH A;  3PO5 A;  4Y1C A;  3D6R A;  3KLE A;  1QQC A;  3A5O C;  3DLB A;  3VQ5 A;  2FSK A;  4NCA A;  4AHU A;  3CCE N;  4B9Q A;  1BIZ A;  1KLN A;  4CJ7 A;  3PX6 A;  1NMD A;  2FSJ A;  4KAZ A;  3OHR A;  4L3Q A;  3WXM B;  1EKE A;  3AVG A;  5BPM A;  4YOY A;  4FYD A;  5C10 A;  3CCU N;  1HNI A;  1P90 A;  5FPM A;  3HBT A;  2E88 A;  4I2P A;  4XEI A;  1VRU A;  4M3R A;  1VSD A;  2PZS A;  1X3N A;  1L3S A;  2IS3 A;  4IOC L;  3JYT A;  2VG5 A;  4XIU A;  4YOV A;  4A5B A;  4BRP A;  1S1U A;  5EVZ A;  4CJS A;  3PIO L;  2W6L A;  4U7B A;  1HYS A;  4CFD A;  4DKW A;  2OA8 A;  2P5G A;  4DHY A;  1NBW A;  4EP5 A;  2G8I A;  3THY B;  3HVT A;  2P5O A;  2HVI A;  4OPJ A;  4KB0 A;  2QI2 A;  3QDK A;  3K9J A;  5HRR A;  4DLG A;  4CZH A;  3LAK A;  3EN9 A;  3NF7 A;  3SYZ A;  2YI1 A;  3WXJ A;  3WXI A;  3NDK A;  2HBM A;  4FOE A;  4B9M A;  3O3H A;  1JCF A;  4HUG A;  3AVB A;  2DTU A;  5BRH A;  3IG1 A;  4JKB A;  4X66 K;  3DJC A;  4JK9 A;  5K14 A;  5C15 A;  2V52 B;  2NRW A;  3O9T A;  3BDP A;  3KD1 E;  1T05 A;  3V81 A;  4LF8 K;  1RT2 A;  3OYD A;  3TPQ A;  4AQY K;  3EE8 A;  3OJU A;  3HPO A;  4QAG A;  2HNY A;  4LF9 K;  3H08 A;  4JS4 A;  3CD6 N;  3LM2 A;  3O4Q A;  4HTL A;  4BE1 A;  3RRG A;  2X6S A;  4I9Q A;  3OA9 A;  1N5Y A;  4A57 A;  3DLL L;  2FBY A;  4IFV A;  3ITH A;  1NLV A;  4BR0 A;  5JEN A;  1BI4 B;  3ZCM A;  4BRQ A;  4W5T A;  1NK7 A;  3P83 D;  3O80 A;  1FJG K;  5JVG L;  3I0R A;  1NGF A;  3MXM A;  3VGK A;  1RTH A;  3OS2 A;  4DU3 A;  3QEV A;  3H1Q A;  4B1W B;  2RKI A;  1BOT O;  4RW6 A;  3AVC A;  4CZK A;  4CEE A;  3BGR A;  3TAG A;  1X9S A;  3SNN A;  3HPH A;  3SQ1 A;  1XWL A;  2E1Z A;  4M41 A;  4IBN A;  4W5N A;  3FZH A;  1YJ9 N;  1LWC A;  2P9P B;  4EZ9 A;  2FC0 A;  2QTD A;  3F5T A;  4N41 A;  2PFU A;  4CHP A;  4EHU A;  2QWL A;  1ESV A;  3TSU A;  4CJR A;  4AF1 A;  4B1Z A;  2XO7 A;  2OZS A;  2YHW A;  1C1B A;  3L2W A;  2X6N A;  3C95 A;  3M3Z A;  4HHT A;  1S3X A;  2Y1I A;  4FZY A;  2OPS A;  3E9L A;  2NNW A;  5E41 A;  4E7K A;  1J5E K;  4A5A A;  1RNH A;  3AA4 A;  2VGM A;  2KTQ A;  2FBV A;  1SKS A;  3AA3 A;  5EY4 A;  1EXQ A;  4H0T B;  4GV6 A;  3RMD A;  3CFR A;  1LV5 A;  1I3A A;  3MN7 A;  1VQN N;  3CET A;  3QFP A;  4OGE A;  3RR7 A;  3M5R A;  2AJQ A;  1DEJ A;  1RBS A;  4H5R A;  4RW9 A;  5AQF A;  5C0Y A;  5AQG A;  3CCV N;  1ZYQ A;  3L8B A;  4DWI A;  3VGM A;  2HHI A;  2ITG A;  1JCG A;  3S5T A;  3BEX A;  3CJC A;  1GLL O;  4WCE L;  4QS9 A;  4DR7 K;  1N6Q A;  1B9D A;  2YHY A;  4IDK A;  4F8R A;  2JWL A;  1D5A A;  2WOM A;  2A3Z A;  4LH5 A;  3HVR A;  1TGO A;  3EO3 A;  1Z6R A;  1YHQ N;  2O8B A;  2CGK A;  3DRS A;  4FWL A;  4BE2 A;  4M42 A;  4DLE A;  5EX5 A;  2ZGZ A;  4I6M B;  1VQ5 N;  3S3O A;  1JL2 A;  3KJV A;  3O9S A;  4JKG A;  3VF6 A;  3NBP A;  3PSF A;  2YNF A;  4Y1D A;  2KQ2 A;  1Q9X A;  4WE1 A;  4FLY A;  1N36 K;  4FJX A;  4C8L A;  1MDU B;  2FLO A;  3A5M C;  3VN5 A;  1IG9 A;  4FL9 A;  4CED A;  5MLC Q;  4FM2 A;  4FJM A;  1BU6 O;  3HM8 A;  5DM7 L;  3T1H K;  1ZXO A;  3DLK A;  4EZ6 A;  2NLX A;  1U2V A;  1Z05 A;  3U8X A;  2ZJQ L;  2KZZ A;  4CJU A;  4DTR A;  4B1V A;  4H0P A;  3GDQ A;  2WON A;  2Z1I A;  4WQ5 A;  1GLE G;  4FK4 A;  2KZM A;  2D4W A;  4ID1 A;  2WC9 A;  4I7F A;  4Z4C A;  3BF3 A;  1S9G A;  2YV0 X;  1T6D A;  2E2Q A;  3T1Y K;  4M3X A;  3LDO A;  4CK2 A;  3H3O B;  1YTA A;  2JWK A;  1BHL A;  2HND A;  2YKM A;  4CGH A;  3SMS A;  3V9S A;  4B3R K;  1BCO A;  1EQY A;  4HUF A;  1ZBH A;  4FWO A;  1VSH A;  1XC9 A;  2QA4 N;  3O4W A;  4BRC A;  3S9H A;  1YIJ N;  1BUP A;  2RF2 A;  5ELZ A;  3KHY A;  3W0L A;  4FK0 A;  1FW6 A;  1U04 A;  2BAN A;  1ASW A;  2A40 A;  4CHN A;  3R8E A;  2D0P A;  3MN6 A;  1UOC A;  2G8K A;  1K6Y A;  1RT1 A;  4Z4H A;  4I2Q A;  5EOY A;  4AHV A;  1NK4 A;  1N33 K;  2YNI A;  4FJK A;  5FRM A;  4A62 A;  4IOA L;  3DLG A;  2P9U A;  3THX A;  4G9Z A;  3DMJ A;  1QVF M;  1VSF A;  4JI3 K;  1LWF A;  1EET A;  4BE7 B;  3NAE A;  3AVF A;  3SQ4 A;  3D2E A;  3KWG A;  4CZL A;  3AO4 A;  4LH4 A;  3ZLJ A;  2RE2 A;  3UKU B;  5I42 A;  4CZI A;  3IAY A;  5JS2 A;  1QTM A;  1NGA A;  1IO2 A;  5AZI A;  4KKO A;  1KVB A;  3SI6 A;  3IRX A;  3TI0 A;  3ATV A;  3CJA A;  4MLH A;  1ZBI A;  1VQ6 N;  4F9O A;  2IAJ A;  2VWK A;  3F9M A;  3Q7B A;  5E26 A;  4AM6 A;  4DSI A;  1ASU A;  3VMF B;  1RDD A;  4DV3 K;  3RMA A;  1KAZ A;  5AQN A;  3MN9 A;  3RVC A;  1DTQ A;  1VSL A;  4O55 A;  2HNZ A;  4HCC A;  4ISE A;  1J54 A;  3GL1 A;  1ZBF A;  4CEQ A;  4ZHR A;  4OLB A;  3I56 N;  4B1U B;  4TSX A;  4KH4 A;  1QHT A;  4DR3 K;  2QWR A;  2KW4 A;  4MFB A;  4ILH A;  4FJG A;  3O3F A;  4QCL A;  1YT3 A;  4LFA K;  4E7L A;  4H5T A;  1TK8 A;  1XNR K;  4CJ5 A;  2XY7 A;  4LY7 A;  3C94 A;  2QKB A;  2HMP A;  4CK1 A;  4HCB A;  1G15 A;  3S3M A;  2DFH A;  2O8E A;  2QWQ A;  4JKC A;  4PKH A;  4ZTF A;  3LDQ A;  3MED A;  4LF5 K;  1S1T A;  4V19 S;  1S6P A;  4DR5 K;  1WSJ A;  3FFK B;  3SV4 A;  2ZQB A;  5HBM A;  4E7J A;  3CC7 N;  1W7A A;  5FPN A;  3O5B A;  3QNN A;  5M1O A;  1WAJ A;  3BZK A;  2ZF5 O;  4KFB A;  4IOX A;  1LCU A;  1XMQ K;  5AFU A;  3AVL A;  3LDP A;  3CJ9 A;  2KLA A;  1K9M O;  3KZB A;  4MDB A;  4DQ8 A;  1GOA A;  4NO7 A;  2YJE A;  4O0I A;  2W42 A;  4O8U A;  5LL6 Z;  2E2O A;  2H3G X;  2HHS A;  1NKB A;  4H5N A;  4M45 A;  5GAH P;  2BE2 A;  4YY3 K;  3LWL A;  1EX4 A;  4QS7 A;  2IIR A;  1WSF A;  1NJY A;  2FF6 A;  4PKG A;  4CER A;  1IBL K;  3V9W A;  2Q97 A;  3QEI A;  1C0G A;  4CZG A;  4M63 C;  1KVA A;  4KH5 A;  3K58 A;  3ZT0 A;  3HPG A;  1TKZ A;  2OPP A;  4BWM A;  3CCS N;  3TAE A;  1SS6 A;  1NGJ A;  1J53 A;  3WXK A;  3MEE A;  2VG6 A;  3B6O A;  5AQW A;  4JI1 K;  3SUO A;  3EYZ A;  4DCH A;  1QHA A;  4M7Y A;  3K0S A;  3HP9 A;  4NYN A;  3NH0 A;  4LSL A;  3TAM A;  3LP0 A;  4Z4I A;  3IMX A;  4BDP A;  4JI0 K;  2WFB A;  1FK9 A;  1UWB A;  4DS5 A;  2HST A;  5GAG P;  1X3M A;  3TR8 A;  5JMV A;  2RHK A;  4Z4E A;  2HHQ A;  1HNV A;  4KHY A;  1YVN A;  2O8C B;  4FWM A;  4JI6 K;  1VQ9 N;  1FXX A;  4H0Y B;  3V9Z A;  1HX1 A;  2CH5 A;  4LF4 K;  3I33 A;  4DSE A;  4AHS A;  3Q7C A;  2NRR A;  2UXD K;  3M8P A;  4NXN K;  2BTF A;  3C0B A;  4DR4 K;  1RT6 A;  3TAF A;  4CZE A;  2QWN A;  3TSQ A;  4E1J A;  4EFH A;  4DU4 A;  3VPZ A;  5AR0 A;  3MX5 A;  3THY A;  3EY1 A;  3NVK A;  1NMN A;  2P9N B;  4IG0 A;  3FFI A;  1HUX A;  1JLE A;  5B8H A;  4DV1 K;  2I7P A;  4MO5 A;  3D2F A;  3PIP L;  1KSP A;  3SUQ A;  4KPY A;  4BRM A;  3MEC A;  4JLH A;  3VQE A;  3CQY A;  3OYG A;  1TL3 A;  1KAY A;  3HOT A;  3MEG A;  3CCM N;  1O1W A;  4F2R A;  1JLF A;  3CIP A;  3QNO A;  3DRR A;  3HM9 A;  4NCB A;  3QES A;  1IKW A;  2FXU A;  1RFQ A;  1XUP O;  1GLF O;  2CGL A;  1DKG D;  3H46 O;  1D9F A;  2DFF A;  5FLX O;  1DGK N;  1D9D A;  1NGG A;  3P1G A;  3PX0 A;  3ZT3 A;  3NE6 A;  3OYL A;  4GNI A;  4MO4 A;  2A41 A;  3DXK B;  1T44 A;  4FLZ A;  1WAF A;  2GWK A;  4XH4 A;  2E5L K;  3AV9 A;  2C1I A;  1KD1 O;  3G10 A;  4M3Z A;  3NH2 A;  1Q9Y A;  2HVH A;  3FGU A;  3FZL A;  2UXC K;  5BRF A;  2JGU A;  4CF8 A;  5M1N A;  1ITG A;  1BI4 A;  4CW7 B;  1TK5 A;  4KTQ A;  1S1W A;  3TAQ A;  1OH5 A;  2YNH A;  2O8F B;  3BUZ B;  1VAZ A;  4K25 A;  3CC4 N;  1EP4 A;  4DQP A;  4GV9 A;  3THW B;  1IBM K;  3WNF A;  5TKW A;  1X9M A;  1G99 A;  4B08 A;  3KKR A;  3TWH A;  1L5U A;  3PLA A;  1EWQ A;  1IBK K;  1HQE A;  4LC9 B;  2J4R A;  3AY9 A;  4CJT A;  2P9P A;  4KI4 A;  4NCG A;  5DM6 L;  4E19 A;  1EO1 A;  1RTD A;  3UIQ A;  2Q0U A;  3SV3 A;  3R6M A;  4U67 L;  5J2P A;  4NLC A;  3J8A A;  4B3M K;  1C0T A;  3LZI A;  4Z0U A;  4YOX A;  3QIC A;  3EKS A;  2EX3 A;  2FBT A;  1REV A;  3BP8 A;  4B9V A;  1RDU A;  4WFA L;  1HYZ A;  5TKY A;  4FJN A;  5AQR A;  3QBW A;  5J1E A;  2WBN A;  1KFD A;  4CJK A;  3PV8 A;  1FKO A;  3H45 C;  2GTD A;  3NF8 A;  3QO9 A;  4CEZ A;  4E0D A;  1Q8I A;  3UE5 A;  3ZSV A;  2GV9 A;  2PAV A;  1Y64 A;  3ATU A;  4DR2 K;  4E7I A;  3LP1 A;  3HL8 A;  4PL8 A;  4JHD A;  3LAL A;  4FPB A;  4CHY A;  1U4B A;  3CMA N;  3A8Y A;  1KAX A;  4JK8 A;  1WN7 A;  1CXU A;  2PY5 A;  4B9S A;  3ZT1 A;  4O44 A;  1Z26 A;  3FE1 A;  3KTQ A;  1CZA N;  1NU0 A;  1BG3 A;  4FWQ A;  5LJV A;  3T69 A;  4PWD A;  3I55 N;  3H6E A;  2UU9 K;  1KFS A;  2OZM A;  4JNE A;  1RIL A;  1VSJ A;  3K9K A;  4F4K A;  3AA2 A;  1GLD G;  1S22 A;  1NK8 A;  5BRE A;  2GBZ A;  1J6Z A;  3AO5 A;  4GMJ B;  3N4P A;  4BRN A;  1SL1 A;  3ZX2 A;  1VQ7 N;  2DY4 A;  3CI5 A;  3G25 A;  4K42 A;  1K8K B;  1NKC A;  1TKX A;  3VTI A;  4DTS A;  2HBK A;  3ZSW A;  3SUP A;  5JVH L;  4O5F A;  5AQM A;  1GLB G;  4FJ9 A;  3NF6 A;  5CHI A;  4IEI A;  3PSI A;  4I6M A;  4JD2 B;  4DV7 K;  1NG9 A;  1L3V A;  3VA3 A;  4CI6 A;  1VQO N;  4DV4 K;  3TTD A;  2AA4 A;  4CF1 A;  3EE9 A;  4Q0B A;  3C65 A;  2IOC A;  3ULE A;  4OVL A;  5C2F A;  1N8R O;  2D5R A;  3CM6 A;  2B6A A;  1ZBS A;  1NNE A;  1MWK A;  1C0F A;  3JSM A;  3SCX A;  4F3O A;  4DTP A;  3MCP A;  3SUN A;  3QEX A;  2V7Z A;  4FJH A;  4KHW A;  3SBG A;  1OKJ A;  2ZGY A;  3IKM A;  3RSE B;  2ZJP L;  3A2F A;  5J2M A;  3HT3 A;  4IZ9 A;  3C7N B;  3L6Q A;  3MWT A;  4OGC A;  3QEW A;  4CJL A;  1V4T A;  4IDH A;  4EAH D;  3OYE A;  2VCP A;  3TU5 A;  3OYI A;  5EU7 A;  3LP2 A;  3ZSQ A;  1LW2 A;  3OBY A;  4BRD A;  4BR5 A;  3K5L A;  4EIA A;  4MQ3 A;  1Q18 A;  4E7H A;  2E4L A;  5E84 A;  5AQT A;  3MMV A;  4H4M A;  2E1Y A;  1YIT N;  3HRG A;  1RBR A;  1TUU A;  1WLJ A;  1RCH A;  2Q31 A;  2YHB A;  1RT3 A;  4E89 A;  4PY5 A;  3EEQ A;  4DSL A;  4F2S A;  1W9H A;  3OYB A;  3CFO A;  1CXQ A;  5AQL A;  3JXU A;  3WEE A;  3S3N A;  1VRT A;  2NRZ A;  3K57 A;  2HMI A;  3V4I A;  1C1A A;  2XY8 A;  4CCH A;  1E4G T;  2QWP A;  3MXJ A;  3CCJ N;  5AQZ A;  2B5J A;  3OVN A;  2F96 A;  3VA0 A;  4J2B A;  5EXW A;  4BRL A;  3CCL N;  1NGD A;  2O8D B;  4PKI A;  4K0K K;  4BQZ A;  4KHQ A;  3E9P A;  3VER A;  1QZ6 A;  3LDS A;  4JI4 K;  4AH9 A;  3IS9 A;  2F8S A;  1RGI A;  3CJ1 A;  5GAD P;  4N47 A;  2Z1H A;  4BGA A;  4DSJ A;  2OPR A;  2P9S B;  5CYM A;  4CIG A;  1HJO A;  1KRP A;  1JLC A;  2F8T A;  3VEV A;  1D8Y A;  3AO2 A;  1WSH A;  2E2P A;  1Q86 O;  2W6K A;  4CES A;  3PX4 A;  3MN5 A;  2KHO A;  1XQS C;  1M90 O;  4B9T A;  4E1N A;  2P9K A;  1K8A O;  2A1R A;  3OY9 A;  5KGW A;  3KD5 E;  2E6L A;  4FOI A;  2CGJ A;  4H0X B;  1SV5 A;  3SAH A;  1X9J A;  2Q3S A;  4BRH A;  2Q1N A;  3NMU A;  3L0Q A;  1U6Z A;  2QXF A;  4FWR A;  1OH7 A;  4DV0 K;  4OJR A;  1TUY A;  3V1Q A;  4BVO A;  5IT9 O;  3WNE A;  3CC2 N;  4CEO A;  3KWI A;  4C8M A;  3E1Y A;  4ILJ A;  3B6P A;  2P9L A;  3KIO A;  4PHT X;  1J5O A;  3ULD A;  3V6D A;  3ZSX A;  2UUA K;  1MA9 B;  4PA1 A;  1TK0 A;  4HVJ A;  5HP1 A;  4IG3 A;  4OPH A;  3VEW A;  4X65 K;  3LWM A;  4B8C A;  3P4I A;  4GY2 B;  1RT4 A;  3SZ2 A;  3CHW A;  4BR9 A;  1X9W A;  1MWM A;  2HB5 A;  3QIP A;  2YKN A;  3HP6 A;  2XY6 A;  5CYQ A;  3G6E N;  3ALY A;  3AVN A;  1XC3 A;  4JRP A;  3CG7 A;  1HKB A;  4H5W A;  4DS4 A;  4FWP A;  3CQX A;  3QB0 A;  3OYN A;  1A5W A;  3JAM O;  1IKY A;  4FM0 A;  3RRH A;  1I94 K;  1BQM A;  4E1M A;  5M1Q A;  1KTQ A;  5BPN A;  1RTJ A;  2NRH A;  5AQY A;  4FPA A;  3NGZ A;  3AGK A;  2UUC K;  1A5V A;  3RR8 A;  2FSN A;  5BR9 A;  4IJN A;  3CXC M;  4BRG A;  1TYQ A;  1JXE A;  5LY3 A;  1C1C A;  3VQ8 A;  4B3T K;  3L2R A;  1BGX T;  5KI6 A;  4B1Y B;  2KFZ A;  1LOT B;  3L2V A;  4M3U A;  3O6W A;  4BRO A;  3TTF A;  3D45 A;  2VGN A;  3NF9 A;  4BAC A;  4KHU A;  1H1V A;  2XRI A;  3QIN A;  5JLH A;  4YHH K;  4BG9 A;  1UA1 A;  3LZJ A;  3CCR N;  3DAW A;  3C6A A;  3O1B A;  1JXB A;  2D1K A;  1QSY A;  1NK6 A;  2O8B B;  4BDY A;  3TAP A;  4FO0 A;  2QW9 A;  3A0I X;  5KQ8 A;  3L4I A;  4DTJ A;  3CER A;  3LDN A;  4CHZ A;  2BUP A;  1YAG A;  1JLG A;  5ADX A;  2ZJR L;  4YDU A;  3TAB A;  1HR0 K;  4H8K A;  1U49 A;  3VQ6 A;  3T1A A;  5CZ2 A;  4JKG B;  1RBV A;  1ZC6 A;  1C0U A;  1JLA A;  4YOW A;  5AQO A;  1SQK A;  4BR4 A;  3SPY A;  4C1N I;  1KXP A;  5BN9 A;  2O8C A;  4FK2 A;  4FJ8 A;  1GLJ O;  3OW2 M;  3J7Y P;  1IKV A;  5KRT A;  4RG8 A;  4W5O A;  3O8M A;  1SAZ A;  4OKE A;  2ASO A;  1GOB A;  4O8K A;  2GUP A;  1Q7Y O;  2AP1 A;  4B3O A;  4C8N A;  1VQ8 N;  1YVU A;  3QER A;  5KPT A;  3THV A;  2NRX A;  1U2V B;  1WSI A;  1ATN A;  4FW1 A;  1VHX A;  1NWK A;  2HHT A;  1J9A A;  3OYF A;  3CF5 L;  4DQR A;  3C6T A;  2P9N A;  3VF2 A;  4LF6 K;  3CJ7 A;  3KLG A;  5C25 A;  3G71 N;  4PUO A;  3UKR A;  2P51 A;  3SJJ A;  5HLF A;  1OVY A;  4CGD A;  3T3F A;  4JYA K;  4CFA A;  3DRP A;  3J80 O;  1W0H A;  2G8H A;  4J2E A;  4NB4 A;  5GIN A;  2PBD A;  3BZC A;  5FPE A;  1QSL A;  5F1X A;  3A5L C;  5AZJ A;  4EP4 A;  3N4Q A;  3OS1 A;  1L3T A;  4FLT A;  1SKW A;  1KVC A;  2GWJ A;  3OYJ A;  1GLC G;  3U9Z A;  2Q0R A;  2V51 B;  1Q82 O;  4CHO A;  5GIO A;  3M8S A;  3AVI A;  3O1W A;  4J2A A;  1XHZ A;  4BC5 A;  4ISF A;  5CY4 A;  1HPZ A;  1S9E A;  4G1Q A;  4CD3 A;  1NGB A;  3OTO K;  4BG8 A;  1BIS A;  4CF2 A;  1A5X A;  2FBX A;  4DFM A;  3FZF A;  3QBX A;  2P9I A;  4Z94 A;  2P9U B;  3E9O A;  3THX B;  1SUQ A;  4H5V A;  3DXM B;  1Q81 O;  2I7N A;  4ELU A;  5J2Q A;  1S1X A;  3ZT2 A;  2E20 A;  1XHX A;  3I8B A;  3D2E B;  3DM2 A;  3WT0 A;  4BEB A;  1C0M A;  1VK0 A;  3L2Q A;  3ZYY X;  2ETJ A;  4CIF A;  5JS1 A;  3WNH A;  1IJJ A;  4AHR A;  4E3S A;  3UB5 A;  4ELT A;  4JN4 A;  4OPA A;  2QWM A;  3VGL A;  4IKF A;  1YF5 L;  5AZI B;  2A1S A;  4HTU A;  1P8Z A;  3KLI A;  4W5R A;  5H1S Q;  3OYM A;  3VET A;  3L3V A;  5J2N A;  2QXL A;  1QQO A;  4F3T A;  3H1V X;  4GVM A;  4BGB A;  4YOT A;  1Z25 A;  1HYV A;  4DQI A;  1VSE A;  1UAX A;  1HQU A;  3OYH A;  4N76 A;  4IFY A;  1TL1 A;  4K41 A;  4Y0W A;  5CZ1 A;  4Z4G A;  3ID8 A;  4CJQ A;  2IC3 A;  3QML A;  1B9F A;  3K2P A;  4BDZ A;  4GV3 A;  4KRF A;  1HJR A;  4KHP K;  3AVJ A;  1TKD A;  4BY9 C;  2FF3 B;  2G8U A;  3U4L A;  3KKS A;  3VTH A;  1NGH A;  4EHT A;  5I3U A;  3K5M A;  4FJ7 A;  5A2Q O;  1NOZ A;  3C6H A;  3AGR A;  3DOL A;  4JKH A;  3HJF A;  1U47 A;  4CHQ A;  4WFN L;  4JKF A;  1K8K A;  4CBW A;  1YJN N;  5I9E B;  3O9R A;  5CE3 A;  4DUY K;  1WB9 A;  2O8E B;  4M3W A;  4KB1 A;  3F2K A;  4IWV A;  1T7P A;  2YHA A;  3ISN C;  1YI2 N;  3C6U A;  4JEP A;  3QLH A;  3F73 A;  2A5X A;  2QM1 A;  4OLA A;  3MWP A;  2ZD1 A;  5KRS A;  2NUB A;  3ZSZ A;  4M7X A;  5C42 A;  1ATR A;  2IVP A;  4CFB A;  4JKD A;  3MXI A;  2HF3 A;  5HRN A;  1BO5 O;  5SWM A;  1SZ2 A;  3VES A;  2A42 A;  4C23 A;  1IV0 A;  3EZ5 A;  3V1O A;  1ZBU A;  1ZBL A;  1VSI A;  2GEL A;  2GEM A;  2BDP A;  3O4N A;  4CJV A;  4JS5 A;  1TKT A;  1NJW A;  2IVN A;  3V1R A;  3NFA A;  3C7N A;  3K5O A;  1IKX A;  4DQQ A;  3ENO A;  3KK1 A;  4DMN A;  3P5J A;  1WUA A;  3AO3 A;  1BA1 A;  4ID5 A;  3CPE A;  3A5N C;  1M1K O;  3ZET B;  4RWT A;  4FLX A;  2ZM6 K;  1V4S A;  4Q5V A;  1QZ5 A;  5BR8 K;  1NOY A;  3NGY A;  1WNS A;  3J7Z O;  1NJX A;  1NJZ A;  3AVK A;  3MK6 A;  4XJX A;  3S41 A;  5DK5 A;  3CM5 A;  1HMV A;  3L4Q A;  4ILG B;  4LFB K;  2VG7 A;  3B8A X;  3NHG A;  4BC3 A;  1ATS A;  4DTM A;  1U48 A;  5AQV A;  1N34 K;  4JV5 K;  1KCF A;  1JL1 A;  3DWL A;  1OH8 A;  4KI6 A;  3BY5 A;  2HF4 A;  1HNW K;  3FZM A;  1T3V A;  4FJJ A;  2F9T A;  3ENB A;  5KQD A;  1RBT A;  4J8F A;  1QSS A;  4YDU C;  2OPQ A;  3VEY A;  2Q36 A;  2O8D A;  3CFP A;  1KLM A;  2YX6 A;  5LJW A;  5HRP A;  4BR7 A;  2ZE2 A;  4JI8 K;  1RDB A;  3D2F B;  3O3G A;  1BA0 A;  3M8Q A;  3AVH A;  5ADX H;  4KBO A;  1HKC A;  2ATQ A;  4CJW A;  4GW6 A;  2P9S A;  3TAN A;  1W2B M;  4JAX A;  4CJ4 A;  1HNX K;  4MLE A;  3GE1 A;  1XNQ K;  3EL2 A;  1R0A A;  3QFU A;  4NLB A;  3K5N A;  2HHV A;  4H03 B;  1BWF O;  4FM1 A;  1JLB A;  1E4F T;  3HO1 A;  3NGI A;  4GKK K;  3VQP A;  3NVM A;  4BRI A;  2YHX A;  4A2A A;  4C8O A;  2ASM A;  2G8F A;  2IVO A;  2VWJ A;  3R1X A;  4C8K A;  5FDL A;  3LM9 A;  3LPU A;  2RPI A;  2OTJ N;  4DR1 K;  1FKP A;  4PQU A;  3SJH A;  4LFC K;  3ZSR A;  5HRS A;  2QEX N;  4FZX C;  4C1N K;  4DV5 K;  2O4G A;  1VSM A;  3R9P A;  3SLC A;  4ICL A;  1RT5 A;  3TSP A;  3FLC O;  5F2R A;  3P31 A;  4LF7 K;  4FWS A;  3L3U A;  3P39 A;  4NXM K;  4AHC A;  2HOE A;  2VYP A;  3MDQ A;  3AVA A;  4FJI A;  3VEX A;  4K43 A;  2D0C A;  4CEA A;  1MU2 A;  1RT7 A;  3SK3 A;  3ZEU B;  3AAP A;  1RBU A;  1O13 A;  2CH6 A;  4CBU A;  4OX9 K;  2V7Y A;  2W40 A;  4IXC A;  4FLV A;  1XMO K;  4B9U A;  5BRD A;  4CGI A;  2ITM A;  1VQK N;  4OPK A;  3DLR A;  4M3T A;  1QS4 A;  5AFU H;  3CME N;  4DF8 A;  1NGE A;  3D0P A;  4WFB L;  4N5S A;  3BF1 A;  1X1P A;  4RW8 A;  4JI5 K;  1TAQ A;  3VEZ A;  4KHS A;  4BRE A;  1HKG A;  3VEO A;  3R3L A;  3E66 A;  3ENH A;  1NK0 A;  4GKJ K;  4KTW A;  2WTU A;  4JHD B;  1N32 K;  1L3U A;  4FXD A;  2VWB A;  2OCE A;  3G0Z A;  3WQT A;  4WQ4 A;  1S5J A;  3O9U A;  4ISG A;  4B8A B;  3MCA B;  4BQL A;  5LMU K;  4B9N A;  3LL3 A;  2D0O A;  3IUC A;  4DFJ A;  1IH7 A;  2DPN A;  3AAQ A;  3UKU A;  2KKZ A;  1CZB A;  4KHN A;  2W41 A;  3HYF A;  4CK3 A;  3WXL A;  4OO1 J;  4RCH A;  2JLE A;  3SAG A;  4FVM A;  1W97 L;  1E3M A;  3DOK A;  1YXQ A;  3AA5 X;  3HSC A;  2E6M A;  3W3D A;  3T19 A;  4FLW A;  4DSK A;  5KTQ A;  3ZX3 A;  1EWR A;  1I39 A;  3CJB A;  1S6Q A;  2Z1J A;  4FWN A;  3SMP A;  1WOQ A;  4UQG A;  3MAQ A;  3ZT4 A;  3V9U A;  5CR4 A;  3AO1 A;  3U3Y A;  1DT9 A;  2YNG A;  4CEC A;  3HI0 A;  4BVP A;  3SQ2 A;  3ULE B;  4O4G A;  3KVG A;  2X74 A;  1RDW X;  1WBD A;  1IG8 A;  2F7T A;  1OVQ A;  1HLU A;  2BH1 A;  3OBW A;  3HTV A;  4WYB A;  3KLF A;  3ZSO A;  1JJ2 M;  4MDA A;  5LMN K;  4CFC A;  1U45 A;  4LSN A;  4CGG A;  3RWU A;  5C24 A;  2G8W A;  2IDO A;  3GBT A;  2EWS A;  4CVN E;  2QK9 A;  1HPM A;  3LAM A;  4K8Z A;  4ZTJ A;  3OYA A;  1LW0 A;  1HNZ K;  4IFE A;  5BN8 A;  1DTT A;  3H3N O;  1C6V A;  3ZX0 A;  3I0S A;  3PO4 A;  4FSV A;  5AQX A;  5T7B A;  1NJI O;  3KLH A;  3CCQ N;  2UUB K;  2IGI A;  3SAF A;  1SKR A;  3WEE B;  4IO9 L;  3P38 A;  1VSK A;  5DMR A;  3VQQ A;  3VQ7 A;  1BCM A;  1OH6 A;  3DI6 A;  4O5B A;  3LPT A;  4DTN A;  4QOZ B;  4A2B A;  1NM1 A;  2OYQ A;  3DYA A;  1YUW A;  3GG4 A;  4CIE A;  3VQC A;  4FLU A;  3DXM A;  4NYF A;  3VQD A;  4OKK A;  3AVM A;  1RDA A;  3SPZ A;  3LP3 A;  3ID6 A;  3OYK A;  5JIC A;  5M1P A;  4X62 K;  5AQI A;  2X78 A;  4I9L A;  1BIU A;  5AJ3 K;  2QKK A;  3V9X A;  1YTU A;  4A59 A;  3DLE A;  4O0J A;  5AQU A;  4DQS A;  2OAN A;  4FW2 A;  2P9K B;  1TV6 A;  1RTI A;  2O4I A;  4CEB A;  2C1G A;  4CJF A;  3SBT A;  4CD1 A;  4YOR A;  3HZ6 A;  3K59 A;  2LSN A;  3F9K A;  4ELV A;  2YCH A;  2D0B A;  4B9L A;  1UA0 A;  4AHT A;  5FRN A;  1D4X A;  3IFR A;  3FR0 A;  3M6G A;  4IJA A;  5C2D A;  1BQN A;  1JKH A;  3U9D A;  3OJS A;  4FCY A;  3I8D A;  4KO0 A;  4KRE A;  3VF4 A;  5IWA K;  2GUI A;  4J2D A;  1ILY A;  2P9L B;  2E8A A;  4E72 A;  2A6A A;  4JKE A;  3SQ0 A;  2NZT A;  4CE9 A;  5AQK A;  4H0V B;  2PYJ A;  2I5J A;  2WUS A;  4OKJ A;  3T7Z A;  1QQM A;  4Z4F A;  1KC8 O;  4RTF D;  4KV8 A;  1QVG M;  4BRF A;  2GX9 A;  5JLF A;  2VQE K;  4BEC A;  4K8X A;  4YNQ A;  5HL7 L;  3EKU A;  1K73 O;  1VQM N;  4CJ3 A;  3HOS A;  4DV2 K;  3AAR A;  5KPZ A;  4BWJ A;  3U3G A;  4JK7 A;  4LD0 A;  3NH1 A;  2E2N A;  3CYG A;  1R59 O;  3JS6 A;  3CQ8 A;  4RW4 A;  3DXK A;  3VQ9 A;  3CYM A;  2RN2 A;  2Y1J A;  4CJE A;  4DB3 A;  1S72 N;  3WQU A;  1NGI A;  2HBJ A;  4DFP A;  2DFE A;  5FRO A;  5FPD A;  5D3G A;  4B3S K;  3NCI A;  4R79 A;  4JI2 K;  1QQN A;  1S1V A;  4BE0 A;  3L2U A;  2HBL A;  3KK7 A;  3KK2 A;  4DV6 K;  1LWE A;  1TYQ B;  3LDL A;  4A61 A;  5C12 A;  1T8E A;  4DR6 K;  2O8F A;  2F9W A;  4FJL A;  2XHB A;  4PL7 A;  3J7A P;  3OS0 A;  3THW A;  1RDC A;  1BDG A;  5M1F A;  5AQQ A;  1YJW N;  4JRQ A;  3RMC A;  2UYT A;  4RW7 A;  4KTZ A;  1KQS M;  4DU1 A;  1T6C A;  2KFN A;  5GIP A;  1WSG A;  4CZF A;  4DSF A;  4XH5 A;  1CZ9 A;  3VEN A;  3TTC A;  2HHH K;  2PYL A;  1F21 A;  3FZK A;  4BRK A;  5AQJ A;  1WSE A;  3WNG A;  2HW3 A;  1VQ4 N;  5F0X A;  4WQ4 C;  3KK3 A;  5AQP A;  3ZET A;  1NK9 A;  3HK2 A;  4M3Y A;  3HST B;  1WBB A;  3QIO A;  2NRT A;  3E01 A;  2YJF A;  3RMB A;  2F4V K;  1VQL N;  1LAV A;  4DG1 A;  3U6F A;  1GLA G;  1DLO A;  5AQS A;  3VOV A;  3O9Q A;  4CZJ A;  5AQH A;  4FVU A;  4CGF A;  1LAW A;  1CLQ A;  3IDH A;  2Q2R A;  3OYC A;  5HOO A;  3RTV A;  1VQP N;  1XI1 A;  5SZT A;  3O08 A;  2W00 A; 
#chains in the Genus database with same CATH homology
 5E26 A;  4AM6 A;  3MX2 A;  3D2F B;  3VEV A;  4QS8 A;  2E2P A;  3VMF B;  1Q86 O;  4CZM A;  1KAZ A;  1BA0 A;  3MN9 A;  3MN5 A;  5AQN A;  3RVC A;  2KHO A;  1XQS C;  1M90 O;  4BRA A;  1YJN N;  5ADX H;  2P9K A;  4KBO A;  1K8A O;  1HKC A;  4FOI A;  4ISE A;  2CGJ A;  4H0X B;  3CPW M;  2P9S A;  5GAE P;  3GL1 A;  3SAH A;  4JAX A;  1W2B M;  1VQK N;  4MLE A;  1X9J A;  3GE1 A;  1NGC A;  4KH6 A;  3EL2 A;  4BRH A;  2Q1N A;  3QFU A;  3NMU A;  3L0Q A;  1U6Z A;  3I56 N;  2NRV A;  4NLB A;  2OTL N;  4JKA A;  3UKR B;  4B1U B;  2ZWH A;  4FWR A;  4KH4 A;  1TUY A;  4H03 B;  1BWF O;  2QWR A;  1E4F T;  4ILH A;  4BVO A;  3M1F A;  2QWO A;  4WF9 L;  3NVM A;  4BRI A;  4H5T A;  2YHX A;  4XH1 A;  4A2A A;  4BC4 A;  2ASM A;  4JD2 A;  3CC2 N;  2IVO A;  4GVE A;  2HMP A;  3KWI A;  4UY8 O;  3R1X A;  3E1Y A;  4ILJ A;  3LM9 A;  2P9L A;  4PHT X;  5BPL A;  2OTJ N;  4IEE A;  2QWQ A;  5AZJ B;  3SJH A;  4JKC A;  4WQ5 C;  2QEX N;  1MA9 B;  4PKH A;  4C1N K;  3G4S N;  3LDQ A;  3R9P A;  2ASP A;  3SLC A;  4OPH A;  3TSP A;  3VEW A;  3FLC O;  5F2R A;  1JCE A;  3FFK B;  3P31 A;  3P4I A;  4FWS A;  3P39 A;  3CC7 N;  4GY2 B;  2HOE A;  2VYP A;  3MDQ A;  3CHW A;  4BR9 A;  5FPN A;  3VEX A;  1MWM A;  3O5B A;  4K43 A;  4BC2 A;  5M1O A;  5KPR A;  2ZF5 O;  3SK3 A;  3ZEU B;  3AAP A;  2CH6 A;  1O13 A;  4CBU A;  3G6E N;  2V7Y A;  2W40 A;  4IOX A;  1XC3 A;  1LCU A;  4AM7 A;  1HKB A;  4H5W A;  4FWP A;  4IXC A;  3CQX A;  3QB0 A;  5AFU A;  3RSE A;  4IO8 A;  4FWK A;  3LDP A;  3CJ9 A;  4H0O A;  2KLA A;  4HWI A;  5BRD A;  4YOU A;  2P9I B;  4CBX A;  3D7E O;  1K9M O;  2ITM A;  4BR2 A;  3KZB A;  4MDB A;  4DQ8 A;  5M1Q A;  4NO7 A;  2YJE A;  3GOI A;  5AQY A;  2NRH A;  4O8U A;  5BPN A;  5AFU H;  4FPA A;  2E2O A;  3CME N;  2H3G X;  3EZW A;  3ZEU A;  4B1X B;  5M1K A;  4H5N A;  3WUH A;  5GAH P;  1NGE A;  3AGK A;  4WFB L;  2FSN A;  4QS7 A;  2IIR A;  3BF1 A;  3A5O C;  2FF6 A;  3D6R A;  4IJN A;  4PKG A;  4BRG A;  5BR9 A;  3VEZ A;  1TYQ A;  3CXC M;  2FSK A;  2Q97 A;  5LY3 A;  4B9Q A;  3CCE N;  4BRE A;  1HKG A;  3VEO A;  4CJ7 A;  1C0G A;  4CZG A;  3R3L A;  4M63 C;  4KH5 A;  3E66 A;  1NMD A;  3ENH A;  2FSJ A;  4B1Y B;  1LOT B;  3OHR A;  4L3Q A;  3WXM B;  3CCS N;  3O6W A;  4BRO A;  1SS6 A;  3TTF A;  4JHD B;  1NGJ A;  5BPM A;  4YOY A;  3WXK A;  2VGN A;  5C10 A;  3CCU N;  1P90 A;  5AQW A;  3HBT A;  2E88 A;  5FPM A;  2VWB A;  4DCH A;  1H1V A;  5JLH A;  1QHA A;  4XEI A;  4M7Y A;  3WQT A;  4WQ4 A;  4BG9 A;  1X3N A;  3CCR N;  3DAW A;  4IOC L;  3C6A A;  3O1B A;  3O9U A;  3IMX A;  4ISG A;  4YOV A;  2WFB A;  3MCA B;  4BQL A;  2D1K A;  4A5B A;  2HST A;  4BRP A;  5EVZ A;  5GAG P;  3PIO L;  1X3M A;  4FO0 A;  2QW9 A;  3A0I X;  3LL3 A;  2D0O A;  4DKW A;  5KQ8 A;  3IUC A;  2RHK A;  3L4I A;  5JMV A;  4DHY A;  2DPN A;  1NBW A;  3AAQ A;  1YVN A;  3CER A;  3LDN A;  3UKU A;  4FWM A;  2KKZ A;  2BUP A;  1VQ9 N;  4H0Y B;  1YAG A;  1HX1 A;  2CH5 A;  5ADX A;  2W41 A;  2ZJR L;  4YDU A;  3I33 A;  3WXL A;  2QI2 A;  3QDK A;  3K9J A;  3Q7C A;  2NRR A;  4OO1 J;  4CZH A;  4RCH A;  4JKG B;  2BTF A;  3C0B A;  3SAG A;  3EN9 A;  1ZC6 A;  1W97 L;  2YI1 A;  3WXJ A;  3WXI A;  4YOW A;  4CZE A;  2HBM A;  5AQO A;  2QWN A;  4FOE A;  1SQK A;  1YXQ A;  3TSQ A;  4BR4 A;  3HSC A;  4E1J A;  3VPZ A;  4C1N I;  4EFH A;  1JCF A;  1KXP A;  5AR0 A;  5BN9 A;  3MX5 A;  5BRH A;  4JKB A;  1GLJ O;  3W3D A;  3DJC A;  3NVK A;  4U7B A;  2P9N B;  4JK9 A;  3OW2 M;  1HUX A;  5C15 A;  2V52 B;  2NRW A;  3O9T A;  5B8H A;  2I7P A;  4MO5 A;  3D2F A;  3ZX3 A;  3O8M A;  3PIP L;  1SAZ A;  3CJB A;  2ASO A;  4FWN A;  4BRM A;  4O8K A;  2GUP A;  1Q7Y O;  2AP1 A;  3SMP A;  1WOQ A;  3CQY A;  3TPQ A;  1VQ8 N;  3HOT A;  1KAY A;  5KPT A;  2NRX A;  1U2V B;  3EE8 A;  5CR4 A;  1ATN A;  1DT9 A;  3HI0 A;  4BVP A;  3CCM N;  1NWK A;  3CF5 L;  3CD6 N;  3CIP A;  2P9N A;  3LM2 A;  3ULE B;  3VF2 A;  3CJ7 A;  4HTL A;  2FXU A;  3KVG A;  1RFQ A;  1XUP O;  3OA9 A;  3G71 N;  1RDW X;  1GLF O;  1IG8 A;  2CGL A;  3UKR A;  1DKG D;  2BH1 A;  1HLU A;  2F7T A;  3OBW A;  3H46 O;  3HTV A;  4WYB A;  4A57 A;  1DGK N;  3DLL L;  1NGG A;  1OVY A;  1JJ2 M;  1NLV A;  4BR0 A;  4MDA A;  4BRQ A;  3O80 A;  4GNI A;  4MO4 A;  5JVG L;  4NB4 A;  5GIN A;  2A41 A;  1NGF A;  2PBD A;  3DXK B;  1T44 A;  3VGK A;  2C1I A;  2GWK A;  4XH4 A;  3H1Q A;  4B1W B;  3GBT A;  1KD1 O;  5FPE A;  1BOT O;  2EWS A;  4CZK A;  5F1X A;  3A5L C;  1HPM A;  3FGU A;  5AZJ A;  3FZL A;  3N4Q A;  2E1Z A;  5BRF A;  2GWJ A;  5M1N A;  3FZH A;  1GLC G;  1YJ9 N;  3U9Z A;  2Q0R A;  2V51 B;  4IFE A;  2P9P B;  1Q82 O;  2QTD A;  5GIO A;  3F5T A;  3BUZ B;  2PFU A;  3O1W A;  5BN8 A;  1VAZ A;  3H3N O;  4K25 A;  3CC4 N;  4BC5 A;  4ISF A;  3ZX0 A;  4GV9 A;  4FSV A;  4CD3 A;  5AQX A;  4EHU A;  1NGB A;  1ESV A;  2QWL A;  5TKW A;  1NJI O;  3TSU A;  1G99 A;  4AF1 A;  4B1Z A;  4BG8 A;  3PLA A;  2YHW A;  3CCQ N;  4LC9 B;  2J4R A;  3SAF A;  3AY9 A;  3M3Z A;  2P9P A;  1S3X A;  3WEE B;  4IO9 L;  5DM6 L;  1EO1 A;  3P38 A;  2Q0U A;  3FZF A;  3QBX A;  2P9I A;  3R6M A;  4U67 L;  4Z94 A;  4NLC A;  3J8A A;  2P9U B;  3E9O A;  3E9L A;  2NNW A;  4H5V A;  4A5A A;  4YOX A;  3DXM B;  3QIC A;  2I7N A;  1Q81 O;  3EKS A;  2VGM A;  5EY4 A;  4GV6 A;  4H0T B;  2E20 A;  3BP8 A;  1RDU A;  4WFA L;  3I8B A;  3D2E B;  5AQR A;  3MN7 A;  3QBW A;  5TKY A;  3WT0 A;  1VQN N;  4BEB A;  3ZYY X;  3CET A;  3QFP A;  2WBN A;  4A2B A;  1NM1 A;  3M5R A;  3H45 C;  1IJJ A;  2GTD A;  1YUW A;  3UB5 A;  1DEJ A;  4H5R A;  4JN4 A;  4OPA A;  5AQF A;  3UE5 A;  2PAV A;  2QWM A;  5AQG A;  3VGL A;  5C0Y A;  3GG4 A;  1Y64 A;  1YF5 L;  3ATU A;  5AZI B;  3CCV N;  3DXM A;  4PL8 A;  1P8Z A;  4JHD A;  3VGM A;  4FPB A;  5H1S Q;  1JCG A;  3VET A;  3BEX A;  3CMA N;  3A8Y A;  2QXL A;  1GLL O;  3CJC A;  4WCE L;  1KAX A;  4JK8 A;  4QS9 A;  1QQO A;  3ID6 A;  3H1V X;  2YHY A;  4BGB A;  4YOT A;  5JIC A;  5M1P A;  3FE1 A;  5AQI A;  2JWL A;  1CZA N;  1BG3 A;  4FWQ A;  2A3Z A;  5LJV A;  3T69 A;  4A59 A;  3I55 N;  3EO3 A;  1Z6R A;  3H6E A;  1YHQ N;  4JNE A;  5AQU A;  3K9K A;  2CGK A;  2OAN A;  4K41 A;  2P9K B;  1GLD G;  4FWL A;  4Y0W A;  1S22 A;  3ID8 A;  5EX5 A;  2ZGZ A;  5BRE A;  1J6Z A;  3QML A;  2C1G A;  3SBT A;  4CD1 A;  4I6M B;  4GV3 A;  3N4P A;  1VQ5 N;  4YOR A;  3HZ6 A;  4BRN A;  3ZX2 A;  1VQ7 N;  2YCH A;  3CI5 A;  3G25 A;  4K42 A;  4BY9 C;  1K8K B;  3O9S A;  4JKG A;  2FF3 B;  3VF6 A;  3VTI A;  2HBK A;  5JVH L;  3U4L A;  1D4X A;  4O5F A;  5AQM A;  3IFR A;  3FR0 A;  3M6G A;  1GLB G;  3VTH A;  1NGH A;  4IJA A;  5C2D A;  4EHT A;  1MDU B;  5CHI A;  4IEI A;  3U9D A;  2FLO A;  4I6M A;  3C6H A;  3A5M C;  4JD2 B;  4FL9 A;  3VF4 A;  5MLC Q;  3AGR A;  4JKH A;  1ILY A;  2P9L B;  2E8A A;  4WFN L;  4JKF A;  1K8K A;  2A6A A;  1BU6 O;  4JKE A;  4CBW A;  2NZT A;  3HM8 A;  5I9E B;  5DM7 L;  5AQK A;  3O9R A;  4H0V B;  4CI6 A;  5CE3 A;  2WUS A;  1VQO N;  3T7Z A;  1QQM A;  1ZXO A;  3TTD A;  1KC8 O;  2AA4 A;  4RTF D;  2NLX A;  3F2K A;  1Z05 A;  1U2V A;  4IWV A;  3U8X A;  4BRF A;  2GX9 A;  3EE9 A;  1QVG M;  5JLF A;  2ZJQ L;  1YI2 N;  4B1V A;  4H0P A;  3C65 A;  3GDQ A;  4BEC A;  4WQ5 A;  1GLE G;  4JEP A;  3ULE A;  5C2F A;  1N8R O;  2A5X A;  2D4W A;  5HL7 L;  1ZBS A;  2QM1 A;  3EKU A;  2WC9 A;  3MWP A;  1K73 O;  1MWK A;  1C0F A;  4M7X A;  1VQM N;  3BF3 A;  1ATR A;  3HOS A;  2IVP A;  3AAR A;  4JKD A;  5KPZ A;  3MCP A;  1T6D A;  2E2Q A;  4JK7 A;  2V7Z A;  2HF3 A;  2E2N A;  3LDO A;  1R59 O;  3SBG A;  3H3O B;  1BO5 O;  1OKJ A;  2JWK A;  3JS6 A;  1SZ2 A;  3DXK A;  2ZGY A;  3IKM A;  3VES A;  3SMS A;  3RSE B;  2ZJP L;  2A42 A;  4IZ9 A;  3C7N B;  3L6Q A;  4C23 A;  1EQY A;  3MWT A;  4DB3 A;  1S72 N;  3WQU A;  1NGI A;  1V4T A;  2HBJ A;  4IDH A;  4EAH D;  5FPD A;  4FWO A;  2QA4 N;  3O4W A;  4BRC A;  1YIJ N;  2VCP A;  1BUP A;  3TU5 A;  5ELZ A;  4R79 A;  2GEL A;  2GEM A;  1QQN A;  3KHY A;  3OBY A;  3W0L A;  4BRD A;  4BR5 A;  4EIA A;  2HBL A;  1Q18 A;  3KK7 A;  1TYQ B;  3LDL A;  5E84 A;  4A61 A;  5AQT A;  5C12 A;  2F9W A;  2IVN A;  3MMV A;  2E1Y A;  3C7N A;  1YIT N;  2A40 A;  4PL7 A;  3HRG A;  3R8E A;  2D0P A;  1TUU A;  1BDG A;  2Q31 A;  3ENO A;  3MN6 A;  5AQQ A;  5M1F A;  1YJW N;  1WUA A;  2UYT A;  5EOY A;  1KQS M;  1BA1 A;  3CPE A;  3A5N C;  1T6C A;  1M1K O;  5GIP A;  5AQL A;  3ZET B;  3JXU A;  4CZF A;  4RWT A;  3WEE A;  4XH5 A;  3VEN A;  3TTC A;  1V4S A;  4A62 A;  1QZ5 A;  2NRZ A;  4IOA L;  2P9U A;  3J7Z O;  3FZK A;  4G9Z A;  4BRK A;  1E4G T;  5AQJ A;  1QVF M;  2QWP A;  3CCJ N;  3MK6 A;  4BE7 B;  5AQZ A;  4XJX A;  3S41 A;  1VQ4 N;  5F0X A;  4WQ4 C;  3L4Q A;  4ILG B;  3B8A X;  3D2E A;  3KWG A;  5EXW A;  4CZL A;  5AQP A;  3ZET A;  4BRL A;  3CCL N;  1NGD A;  2RE2 A;  4PKI A;  3UKU B;  4BC3 A;  4CZI A;  1ATS A;  2NRT A;  2YJF A;  4BQZ A;  3E9P A;  3VER A;  1QZ6 A;  1VQL N;  1GLA G;  5AQV A;  5AQS A;  1NGA A;  3DWL A;  3VOV A;  5AZI A;  2HF4 A;  3O9Q A;  4CZJ A;  5AQH A;  3FZM A;  4FVU A;  1RGI A;  1T3V A;  3CJ1 A;  5GAD P;  2F9T A;  3ENB A;  4BGA A;  5KQD A;  3ATV A;  4J8F A;  4YDU C;  3CJA A;  4MLH A;  3IDH A;  1VQ6 N;  4F9O A;  3VEY A;  2Q2R A;  2Q36 A;  5HOO A;  2P9S B;  1VQP N;  3F9M A;  3Q7B A;  3O08 A;  2W00 A;  1HJO A;  2YX6 A;  5LJW A;  4BR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...