2P9NA

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
415
structure length
397
Chain Sequence
AGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 123
structure length 397
sequence length 415
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9nA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9nA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9nA03
4RCHA 2GEMA 2PAVA 2NZTA 2QWQA 4B1UB 2A3ZA 2GWJA 4CZLA 5BRDA 3CJCA 3O6WA 4IXCA 2GELA 1QZ6A 4H0YB 4RWTA 4FWOA 3VF4A 1S22A 2GUPA 4BR9A 4CBUA 4MLHA 3C0BA 1K8KB 4BG9A 1GLDG 3VF2A 3A5NC 4BG8A 3ATUA 2DPNA 2P9IB 1BDGA 1ZBSA 2FF3B 4BVPA 2KHOA 5KPRA 3UB5A 1LCUA 3O80A 4CZIA 4MO4A 4M7YA 3FZFA 1WUAA 4H03B 4EHUA 4EIAA 2H3GX 3LDNA 4EFHA 3QICA 2D0OA 5E26A 1C0FA 4IZ9A 3U9DA 3LDPA 5AQVA 2YJFA 3BEXA 1P8ZA 2CH5A 4FWKA 4BREA 2Q2RA 4BRLA 1V4TA 3MDQA 5FPDA 3W0LA 1E4GT 5AQRA 3WXIA 4DCHA 3TPQA 1G99A 2NRHA 3BF1A 3HBTA 1HKBA 2I7PA 3HTVA 5LJWA 3GL1A 3EKSA 2Q31A 4PKHA 4O8KA 3O4WA 1GLJO 1T6DA 1R59O 3ZETA 2VWBA 2W41A 1RGIA 2YHWA 3U8XA 3AAQA 5EVZA 4CZJA 4F9OA 5EOYA 5BN8A 5BRHA 3D2EB 1XC3A 1DKGD 3UKUA 4YDUA 4BGAA 5AZJB 5B8HA 2HF4A 3BUZB 3IDHA 4ISEA 4BR5A 2A5XA 2VYPA 4DHYA 3LDQA 3VOVA 3VENA 1BA0A 2Q1NA 1Q18A 3M6GA 4ISFA 4I6MB 2P9NB 3VEZA 4NO7A 5F0XA 2A6AA 4BR7A 2IVOA 3WQUA 2QW9A 1IJJA 3TU5A 3MK6A 4O5FA 3VETA 4DQ8A 2P9SB 1DGKN 1Z6RA 5FPEA 4BRIA 3GBTA 2FSJA 1NGDA 3M1FA 5EX5A 3DXMA 5E84A 1SQKA 3D2FB 1HX1A 5BPLA 4QS8A 2D4WA 3EKUA 4XEIA 1NWKA 1RFQA 4H5NA 1QZ5A 3ENHA 4HTLA 4BRCA 3VESA 2P9LA 1KXPA 3CJ7A 3CJBA 5AQJA 4CZKA 3KVGA 4QS7A 3B8AX 3CQXA 3ZX2A 5KQ8A 2ITMA 1XUPO 2P9PB 1NGFA 5LJVA 3FFKB 1ATRA 1NGJA 1SAZA 3SMPA 5AQLA 4BVOA 1QQOA 3GG4A 3SMSA 2P9UB 3U4LA 1SZ2A 2FXUA 2QWPA 5AZIA 4B1ZA 2E2QA 1NGIA 1C0GA 3RSEB 1BA1A 3EZWA 2AA4A 4JD2A 4JHDA 3VEWA 1YAGA 3FZKA 4MO5A 1HKGA 4BRHA 5AQPA 2V51B 3ZEUB 3A8YA 4PL8A 4JN4A 3QFUA 1V4SA 1Y64A 2OANA 2D1KA 3HZ6A 3R9PA 3C7NB 2V7YA 3GDQA 3CETA 4YDUC 1NGCA 4PKIA 3A5OC 3AAPA 1K8KA 1BO5O 4FOIA 1U2VA 3VGLA 2E1ZA 3O08A 4CZMA 2YCHA 5FPMA 2YHXA 4IJNA 1TYQA 3H45C 3R8EA 5AQWA 4BRFA 2ZF5O 1NGAA 3D7EO 1XQSC 1EQYA 1GLFO 1YUWA 5AQZA 3WXJA 4A62A 5LY3A 5ADXA 3CHWA 4CI6A 3DAWA 4XH1A 3J8AA 2VCPA 1Z05A 3FZLA 1KAZA 3A5MC 4C23A 2FF6A 4BQZA 3LL3A 3KZBA 2CGJA 1U6ZA 3WEEA 2FSNA 2A41A 2QWMA 2P9KB 1DEJA 5EXWA 4A61A 4FWRA 4XH4A 2Q0UA 2F9TA 5FPNA 3L6QA 3VGMA 4BRQA 1T6CA 4H5WA 4BC4A 3QFPA 4RTFD 4BC5A 4BGBA 5BPNA 4PKGA 2QWOA 3EO3A 5BR9A 3L4IA 2YHYA 2FSKA 1X9JA 4GY2B 2ZGYA 4HWIA 1GLBG 2ASMA 4LC9B 4MLEA 4EAHD 2FLOA 1ESVA 3IUCA 4PL7A 3VGKA 2I7NA 3ULEB 1ATSA 4H0TB 3LDOA 2HF3A 1NGHA 4Y0WA 4L3QA 2E8AA 2A42A 4KBOA 1BU6O 4FWNA 3QBXA 2BTFA 3O1BA 5AQNA 3HSCA 4B9QA 5KPZA 3SLCA 3ENOA 4FSVA 4BRNA 3GE1A 2AP1A 3R6MA 3H1VX 1GLEG 3W3DA 2CGLA 4DB3A 2ZWHA 2IVNA 2PBDA 2E2PA 1TUUA 4ISGA 3UKUB 5ADXH 5TKYA 3MN7A 1NGGA 1WOQA 4H0XB 3SK3A 2HOEA 4M7XA 3QBWA 4XH5A 1X3NA 2Q97A 4K25A 1HJOA 4FWLA 4BRAA 2BUPA 2GWKA 3FGUA 1T44A 4FO0A 3WT0A 1KAXA 3UKRB 2A40A 2IVPA 1QQMA 3DXKA 3MN9A 3H3NO 4FWSA 4H0VB 5AQHA 2P9UA 3AARA 3HM8A 3JXUA 5BREA 5I9EB 3GOIA 3MMVA 4H0PA 3FR0A 3I33A 3I8BA 1E4FT 3DXMB 2ZGZA 5AQGA 4JNEA 3MN6A 4AM7A 2V52B 3F9MA 4H5TA 4CD1A 5F2RA 3ZEUA 1GLAG 3AY9A 1HLUA 5JLHA 2P9LB 3JS6A 4J8FA 3G25A 3ID8A 1S3XA 4FWQA 5AQIA 3C7NA 3DWLA 4B1WB 4H5VA 1JCFA 4QS9A 4BRDA 5BPMA 3LM2A 1MDUB 3O5BA 4CD3A 2QXLA 1QHAA 3EN9A 1ZC6A 4FWMA 4BQLA 4BRGA 3H6EA 4JD2B 4JHDB 2Q0RA 3ZX3A 2P9IA 4WQ5A 4K43A 4FOEA 2QWLA 1OKJA 3A0IX 3FLCO 3VERA 1BWFO 1HUXA 1QQNA 3BP8A 3SJHA 3H46O 4BR2A 4CBWA 1TUYA 1J6ZA 3VF6A 4CZGA 5AQOA 4K42A 3UE5A 2E2NA 4FPAA 3KHYA 5AQSA 3VEVA 4BRPA 1H1VA 1BOTO 1U2VB 3QMLA 5AQXA 1NBWA 1ZXOA 4B1VA 2E2OA 1TYQB 2QWRA 3M3ZA 5AFUA 2E1YA 2P9KA 1RDWX 2YI1A 4FL9A 1ATNA 4WQ4C 1X3MA 2W40A 3WQTA 3CQYA 5AQKA 2D0PA 1NMDA 2E88A 1NLVA 3ATVA 1KAYA 1NM1A 5JLFA 2WUSA 3FZMA 4BROA 2UYTA 1JCEA 2IIRA 3WEEB 3LDLA 4K41A 4H5RA 1MWKA 3O8MA 3LM9A 3D2EA 5AQMA 3ULEA 3WUHA 4E1JA 5AQFA 2ASOA 5AZJA 2F9WA 1HPMA 3MN5A 1HKCA 5AR0A 3S41A 5AQTA 4BRMA 4I6MA 2P9NA 2Q36A 5F1XA 2NLXA 2V7ZA 3L0QA 4CJ7A 5BRFA 3VEXA 2YJEA 4NB4A 5KPTA 4BC3A 4WQ5C 2ASPA 3IFRA 3ZETB 4B1YB 1D4XA 5AQQA 3CERA 3BF3A 4Z94A 2P9SA 4BRKA 3DJCA 3FE1A 5EY4A 3H3OB 5KQDA 3FZHA 1MWMA 3D2FA 1IG8A 3CI5A 3QB0A 4BR0A 1JCGA 3CIPA 3EL2A 3UKRA 4CZEA 3ZX0A 4IO8A 4H0OA 5AQUA 1MA9B 1BG3A 1YVNA 4IJAA 1YXQA 4WYBA 2P9PA 3CJAA 2E20A 3MCPA 5AFUH 4WQ4A 3VEYA 2GTDA 2CGKA 5AQYA 5CE3A 4B1XB 1LOTB 2J4RA 1GLCG 1CZAN 1NGEA 3P4IA 3U9ZA 4EHTA 4CZFA 4M63C 4BR4A 3H1QA 3RSEA 3HI0A 3CJ1A 5BN9A 4BC2A 2HMPA 3A5LC 5JMVA 3OHRA 3DXKB 4CZHA 4FPBA 2CH6A 4IWVA 3WXKA 1BUPA 3VPZA 3WXLA 4A2AA 1NGBA 4CBXA 4JAXA 4A2BA 1GLLO 3CJ9A 5AZIB 3QDKA 3IMXA 2QWNA 2QM1A 4GNIA 5ELZA 3O1WA 5JICA 4FWPA 2EWSA 4AM6A 3VEOA
chains in the Genus database with same CATH superfamily
2NZTA 1NK9A 4A57A 1EO1A 1L5UA 4KRFA 1C0TA 4IXCA 4B9VA 4I2PA 3AVIA 3CCRN 3QINA 3A5NC 4IEIA 1QSSA 4KHWA 3AVAA 5KTQA 4FK4A 4JI8K 1BDGA 1VHXA 1ZBSA 2FF3B 3CXCM 3O80A 4CZIA 2PFUA 1JLFA 3MEDA 4ILJA 2BE2A 4IOAL 2D5RA 4FM1A 2G8VA 3VQ4A 3IG1A 3V9ZA 4AHVA 4FJMA 5AQVA 3AGKA 4IDHA 4H4OA 2YJFA 3OBYA 4E3SA 2YX6A 1P8ZA 3RWUA 2DFEA 2Q2RA 1V4TA 5FPDA 4BACA 1RT6A 1D5AA 3HXMA 4LF7K 1S6QA 4DU4A 5JVGL 3C6HA 3AA5X 3O4WA 4JKAA 1HYVA 2LSNA 4CGJA 4XJXA 3U8XA 1TK8A 3E9OA 3ULDA 4CZJA 2FBXA 3O3HA 5CYQA 5EOYA 1Q8IA 3HYFA 3CM6A 4YDUA 2HF4A 3BUZB 3SV4A 3LDQA 4PY5A 3VOVA 4BE7B 3R3LA 1WSHA 4ISFA 3QEIA 1TKDA 3OYJA 2P9NB 4ELTA 1KVCA 2HHVA 3TU5A 4O5BA 4UQGA 3MK6A 5GAGP 3TTDA 1HYZA 1Z6RA 5FPEA 1JL2A 3AVNA 1XMOK 4ILGB 4KHNA 1NGDA 3M1FA 3CCUN 3OS2A 5E84A 3SUNA 1HX1A 4QS8A 4PUOA 3P5JA 4CHOA 2NRXA 3AVJA 3C95A 1KXPA 4JLHA 4CJ4A 3ALYA 3KVGA 4QS7A 3CQXA 3ZX2A 1XUPO 5HOOA 3IRXA 1ATRA 5HLFA 3THWA 5AQLA 4BVOA 3GG4A 3SMSA 1OVYA 2P9UB 1SZ2A 4CEEA 1NGIA 2E5LK 1TL1A 2DTUA 1U04A 2G8WA 4JD2A 2AA4A 1SKSA 3K5OA 4MQ3A 3VN5A 1HKGA 4B3SK 3ZEUB 1RT4A 5C2FA 2OANA 2D1KA 3R9PA 4CK1A 3C7NB 3GDQA 4DQRA 3M8RA 3CETA 1JXBA 2DFHA 4PKIA 3IAYA 5KRTA 3SPZA 3VGLA 3O08A 4DV5K 3P31A 5FPMA 4WF9L 4IJNA 1NOYA 4E7JA 4JI1K 4YOTA 1NG9A 1RT5A 4CIGA 1GLFO 3KKSA 4MDAA 5FDLA 3CHWA 1UA1A 4CI6A 3PSFA 2NRTA 5CZ2A 3SI6A 4OO1J 3J8AA 4GKKK 3FZLA 4DTUA 3A5MC 2FF6A 3HSTB 4BQZA 3LL3A 1VSDA 5AJ3K 5IWAK 4CGFA 3WEEA 5T7BA 4GV6A 4MDBA 2P9KB 2IGIA 4OKEA 4FWRA 1DTTA 3CG7A 1KTQA 3K9JA 4F4KA 2Z1HA 3KIOA 3QFPA 4BGBA 1SS6A 5BPNA 4PKGA 2IAJA 3AVBA 2QWOA 3EO3A 2HBMA 4HUFA 4I7FA 4KFBA 2ZGYA 2ASMA 4NYNA 4DV4K 3MX2A 4EAHD 3NHGA 1ESVA 1LW2A 3VGKA 2HHUA 1LWEA 4H0TB 4L3QA 3NDKA 4X65K 4CF1A 3VQ8A 4BWMA 4KB0A 2BTFA 5KPZA 4FLYA 4BRNA 4WFBL 1JLGA 5I42A 3HM9A 2VQEK 1BCMA 4DB3A 4HVJA 2E2PA 4ISGA 3UKUB 5ADXH 5TKYA 4H0XB 4CJFA 4FLUA 2HOEA 4M7XA 2E4LA 1D9DA 1IBMK 1XMQK 3CMAN 1T44A 1VQ7N 5IT9O 4CJUA 3MX5A 3KD5E 1HNIA 4IOCL 1C1AA 3H3NO 3V1QA 4FVUA 2P9UA 5JVHL 4DSLA 3AARA 3JXUA 5BREA 3MMVA 4YY3K 2HW3A 3V9UA 3V9WA 2HBJA 3NGZA 2V52B 3F9MA 4DV6K 4CD1A 3K2PA 5FRNA 3ZEUA 2RN2A 1GLAG 1N33K 3AY9A 5JLHA 3V81A 4KH4A 3JS6A 4FM2A 4CK2A 3D0PA 1S3XA 4FWQA 4C1NI 3VTIA 1NKCA 3C7NA 1RCHA 4CFAA 1Q81O 4H5VA 4CF8A 3OTOK 4M3ZA 3LM2A 3O5BA 4M41A 2QXLA 1HYSA 2UXBK 1QHAA 3EN9A 4BRGA 1XHZA 4CFBA 4J2DA 4EZ9A 2Z1JA 2OA8A 4LF4K 4AF1A 1WN7A 4FOEA 3VERA 3C6UA 1W7AA 1KSPA 1EP4A 1QQNA 1S1VA 4CBWA 3VF6A 3KJVA 1JJ2M 5AQOA 4X66K 3UE5A 4E72A 2E2NA 1VSMA 1EWRA 5AQSA 3VEVA 2QTDA 4CGHA 1RT1A 3LPTA 3N4PA 3ISNC 1NK5A 4JK7A 3M3ZA 2P9KA 4F3OA 2Y1IA 4FJKA 1VRUA 2X74A 4WQ4C 4M3XA 3WQTA 4OX9K 1JXEA 3QEVA 3HT3A 2XHBA 3SCXA 3HPHA 3M8QA 1ZBIA 1Z26A 5JLFA 2UXDK 3SUPA 4FJJA 3KKRA 3K5MA 1YITN 2IIRA 5DM7L 3QNNA 4R5PA 2IOCA 5H1SQ 3K0SA 1VQ5N 4H5RA 3O8MA 3VQ5A 3CCMN 4DMNA 4E1JA 2ASOA 4E1MA 3MN5A 1HKCA 3Q7CA 3K5LA 1QQCA 2JGUA 4DS4A 4BRMA 4I6MA 3VQBA 1J9AA 3VEXA 2YJEA 4NB4A 3KK2A 1VRTA 4WQ5C 1RBUA 2ASPA 3ZETB 5HRPA 3QIOA 3SUQA 4B1YB 2X78A 3T7ZA 3CERA 1RTHA 3BF3A 1WBBA 4DR4K 1RDDA 4BRKA 3FE1A 4Y1CA 3SQ4A 3H3OB 3D2FA 4NCBA 1IG8A 4FYDA 3NFAA 1TK0A 4C8OA 4IO8A 1EKEA 4CJLA 1BG3A 1YVNA 1FXXA 5TKWA 4Q0BA 3OYHA 1XI1A 4WQ4A 3M5RA 4Z0UA 2P51A 2J4RA 4BDYA 4DLEA 4IBNA 1NKBA 2RE2A 2RHKA 3TSUA 3CJ1A 2JWKA 1C6VA 1JLAA 3QNOA 1N34K 3DOLA 1N6QA 4B9TA 1YIJN 4DR5K 5J2NA 3DXKB 1NJXA 1X1PA 4HHTA 4FPBA 2CH6A 3E01A 3WXKA 4A2AA 3VPZA 1P90A 1T05A 2O8DB 4JAXA 4A2BA 4DTMA 4BEBA 3CJ9A 3QDKA 2IC3A 3IMXA 1WB9A 4GNIA 2QM1A 3L8BA 3QIPA 4CJ5A 2EWSA 2HHTA 4CFDA 1GOAA 5GAHP 4BE2A 2A3ZA 1VK0A 4CZLA 3AO4A 2KTQA 3CCQN 4B9SA 3WNGA 2GELA 4A5AA 4DTPA 4O8UA 4FWOA 3VF4A 3MWPA 4FJIA 4FZZA 4MLHA 5DM6L 3C0BA 2OPSA 1GLDG 4YFUA 4BG8A 4AHTA 3VMFB 3ATUA 4B3OA 1GOBA 4W5QA 1HMVA 1HPZA 4BVPA 5KPRA 1LCUA 3PIPL 4MO4A 2FC0A 4M7YA 1WUAA 2WONA 3ID6A 4CJSA 2H3GX 1QSLA 4EFHA 4BDPA 3L4QA 3C6AA 2YHAA 2O8EA 4CERA 5E26A 1C0FA 1TVRA 3U9DA 3LDPA 3OVNA 2B6AA 4B8CA 1S5JA 1WSEA 3DLRA 4CEFA 5HRSA 3KWGA 4FWKA 1M90O 4ID5A 3I8DA 4FJGA 2HNYA 3W0LA 1WAJA 4CJRA 1E4GT 3TPQA 1G99A 2VWKA 5JENA 2NRHA 4E7LA 1A5WA 1S1XA 3HBTA 4FZXC 2I7PA 5LJWA 3GL1A 3EKSA 2R7YA 4JKGB 3E66A 3ZETA 2W41A 4JKBA 1U4BA 2YHWA 4YHHK 4TSXA 4CGDA 4M3YA 3CCSN 3OYEA 2BANA 3HP9A 4E7HA 3IDHA 4BR5A 2A5XA 2VYPA 3BZKA 3Q7BA 5BR8K 1X9MA 1KD1O 4QCLA 3J7ZO 1BA0A 2Q1NA 3M6GA 4NO7A 5C24A 2NRZA 4OPJA 3WQUA 3OS1A 2WFBA 4JI5K 4C8KA 2A1SA 4GVEA 4N41A 3HO1A 3ASMA 4FK0A 3TAMA 4O5FA 1TKTA 2O8FA 4BRIA 1EWQA 4J2BA 1U47A 3CD6N 5EX5A 1HQUA 3PY8A 1VQ9N 2UUAK 4DF8A 1QTMA 2VGNA 5BPLA 4FJXA 2D4WA 3EKUA 4C8NA 1B9DA 2ZE2A 4HTLA 4BRCA 5AQJA 3CJBA 1XWLA 2ITMA 4DFMA 1VSIA 1SAZA 3SMPA 2O8DA 1L3TA 2WC9A 1ZBHA 2FXUA 3AO5A 1BI4B 1UOCA 2KLAA 4B9NA 3G0ZA 1XC9A 3DLEA 3VEWA 3CFRA 3TANA 1RNHA 1YAGA 2NRRA 4MO5A 4BRHA 3OYDA 2V51B 4PWDA 2FBYA 4LSNA 3CCJN 4DQPA 3NMUA 4W5TA 2EX3A 1W97L 3P38A 1Y64A 4JV5K 4YDUC 1NGCA 3A5OC 4AHRA 1G15A 3AAPA 4U7BA 4RW4A 1NNEA 3LZJA 3CYGA 1UA0A 1BCOA 4CEDA 1NU0A 1HNXK 2E1ZA 4CZMA 1KLMA 4FW1A 2YHXA 1Z25A 3T69A 3M8SA 4BRFA 1NGAA 1VSFA 4CHPA 3LWLA 3D7EO 1FK9A 4OGCA 1XQSC 1EQYA 4B9MA 2KQ2A 5M1NA 4JI7K 5AQZA 4A62A 4CEOA 5ADXA 3LP1A 3RTVA 4CESA 4DV1K 3O9QA 1Z05A 3DMJA 4KHYA 3F73A 4CJPA 4RW8A 2W42A 3NF8A 2CGJA 2FSNA 1J5EK 2EHGA 1TL3A 3WNFA 4FJLA 4A61A 4XH4A 2Q0UA 2HMIA 4E0DA 5FPNA 1IKXA 1RDCA 1T6CA 3ZCMA 4RTFD 1ASUA 1TAQA 3ZYYX 3J80O 3T1AA 4B08A 2HHXA 3QLHA 5BR9A 3L4IA 2YHYA 1X9JA 4HWIA 1GLBG 4LC9B 4E19A 4WE1A 3NF9A 1C1CA 4PL7A 3IUCA 3AA2A 2I7NA 1NK6A 3O4NA 2OCEA 2HF3A 4KH5A 4Y0WA 1K73O 3THXB 2VQFK 1HR0K 3P39A 4FWNA 1K9MO 3HJFA 2D0CA 3O1BA 3PX4A 3K9KA 2NNWA 4IDKA 3AO2A 3LPUA 2AP1A 3R6MA 1K8AO 1A5VA 3H1VX 3S9HA 4N5SA 2HHQA 3KTQA 2ZWHA 4X62K 3WXMB 2PBDA 2JWLA 4DR1K 3F5TA 4O0IA 1VQMN 3DOKA 2G8KA 3MN7A 3KK3A 1VSLA 4LH4A 4XH5A 1X3NA 2Q97A 4K25A 1HJOA 4CJEA 4NLCA 2GWKA 3FGUA 3WT0A 1L3VA 3RRGA 1S1TA 3ZSOA 3FFIA 3MN9A 1S9EA 4JK9A 4HUEA 2UUBK 3AO3A 3OBWA 3KLEA 4DWIA 1BQNA 1O13A 3I8BA 4KHSA 3AVKA 1E4FT 3DXMB 3DYAA 4OVLA 4AM7A 3V1OA 3OYKA 4DSEA 1NJYA 4FM0A 4GV3A 3JYTA 4YOWA 1I94K 2P9LB 3VQQA 3LAMA 4J8FA 4GMJB 1FW6A 3JSMA 3DWLA 4G1QA 4W5RA 1ZBUA 5SWMA 3LP0A 4V19S 3O4QA 5BPMA 1MDUB 3J81O 3D45A 3CM5A 4IKFA 1YT3A 2PYLA 3KLIA 1BHLA 3EE9A 4FWMA 4LSLA 4BQLA 4JHDB 3VQEA 2YNGA 1IG9A 3ZX3A 1OH8A 3BY5A 2VWJA 2QWLA 1OKJA 3FLCO 5I3UA 1HUXA 2YV0X 3BP8A 3H46O 2UUCK 1TUYA 1J6ZA 4K42A 3I0RA 2ATQA 3VQCA 4FLZA 1BOTO 4CGIA 1U2VB 1ZXOA 1RBSA 1TYQB 1ILYA 4YORA 1KVBA 1RDWX 4BECA 1J53A 4W5NA 3KLGA 1X3MA 3PIOL 5CR4A 5AQKA 3PO4A 1NLVA 1IKVA 3ATVA 3LANA 3NBPA 5J2PA 1NM1A 1N32K 3OYNA 3RMCA 4CEAA 2UYTA 1NK7A 1YI2N 5GAEP 2D0BA 4FK2A 4LY7A 3LM9A 1LV5A 1VQ8N 1QS4A 3ZSXA 3B6PA 1WBDA 2F9WA 1A5XA 1LWFA 3OYMA 4A59A 1IBKK 3PX6A 3S41A 2P9NA 5F1XA 4B3MK 3VQ9A 2FBVA 4CJ7A 3MXMA 4JI4K 4DKWA 3V9XA 1YF5L 1BISA 3KK1A 1JLBA 5KI6A 1D4XA 3SBTA 5AQQA 4Z94A 1CZBA 3PO5A 1LAWA 1XNQK 3DJCA 1QVFM 1LWCA 1ZBFA 3CYMA 4FJNA 1O1WA 1MWMA 2OTLN 4K8XA 1W9HA 3CI5A 3QB0A 4OPHA 5HRRA 3HL8A 3SZ2A 4DUZK 2QKKA 3SV3A 4B8AB 2O8CB 3KWIA 2GBZA 3R1XA 4B9LA 3CJAA 3MCPA 5AFUH 1FJGK 4CJ3A 1IKWA 2CGKA 5CE3A 1QHTA 1GLCG 1NGEA 3DM2A 4CZFA 4M63C 4FLWA 1Q7YO 4BR4A 3H1QA 3HOSA 4JI2K 1S72N 5BN9A 1W0HA 1S9GA 3TAFA 3MXIA 2HHHK 2HMPA 4KHUA 1SL0A 4IG3A 3A5LC 5SZTA 3OHRA 3C65A 4LF9K 5CHIA 2NUBA 4HCBA 1NKEA 4IWVA 1BUPA 3P1GA 3WXLA 1NGBA 4JKCA 4DUYK 4DSJA 5AZIB 3CQ8A 4CCHA 4OJRA 3CPWM 3TARA 5JICA 4AM6A 4CF0A 4DQIA 5C15A 3DRRA 1ASWA 1RT7A 2B4JA 4DR6K 1VQON 2QK9A 3NCIA 2GEMA 4EP5A 1KRPA 2PAVA 2QWQA 4B1UB 2P1JA 4AHSA 1VQ4N 3C6TA 3SQ2A 2GWJA 1SV5A 4C8LA 2G8FA 4Z4EA 5BRDA 3CJCA 2HNZA 3G4SN 4H0YB 4RWTA 4DTRA 2GUPA 4BR9A 2XY8A 4FJHA 1KCFA 4FW2A 4BG9A 3DLGA 4E89A 2HSTA 1S1WA 2P9IB 4YOXA 2KHOA 5JS1A 4OLAA 4CJWA 3QO9A 3HK2A 1KC8O 4LFCK 4CW7B 3FZFA 4H03B 3NVKA 4EIAA 3LDNA 3C94A 2PZSA 3CFPA 2D0OA 4H8KA 4IZ9A 5EU7A 4F2RA 3CFOA 3HOTA 4O4GA 2F4VK 4CK3A 4RG8A 3BEXA 2CH5A 1ZBLA 1Q9YA 4BREA 5CYMA 4KI6A 3CC4N 3N4QA 2XY7A 3MDQA 3SYZA 1YTUA 4DCHA 3WXIA 3PSIA 3BF1A 3HTVA 1CLQA 3TAEA 1QE1A 4FZYA 2QA4N 4O8KA 3CMEN 1GLJO 1R59O 4RW6A 1RGIA 3ZSYA 3AAQA 3LZIA 5EVZA 1KQSM 4PHTX 4F9OA 3IKMA 5BRHA 3D2EB 1XC3A 4CFCA 3L2RA 1DKGD 3UKUA 5AZJB 5B8HA 4ISEA 1RTJA 4O44A 4CECA 4DHYA 2ZM6K 4C1NK 3VENA 1Q18A 4WFNL 4I9QA 4JK8A 3MXJA 3TAPA 5F0XA 2A6AA 2F8TA 4KPYA 2KFZA 1XNRK 3P83D 1HQEA 4JI6K 1SKRA 3VETA 2P9SB 1DGKN 1RBRA 1T8EA 2Z1GA 4FXDA 3GBTA 3AV9A 2NRWA 2D0AA 1Q9XA 1NWKA 1RFQA 4H5NA 1REVA 4KREA 3VESA 3CJ7A 4NXMK 4CZKA 1KLNA 3B8AX 2P9PB 4JI0K 3HRGA 5LJVA 3FFKB 1YJNN 3NVMA 4GKJK 3U4LA 2QWPA 5AZIA 2NRVA 3DRPA 3RSEB 4GVMA 4FCYA 5E41A 3FZKA 3OW2M 5FLXO 3UIQA 4W5OA 3ZT2A 3EZ5A 2O8BB 3A8YA 4NYFA 3BGRA 3NH0A 4JN4A 3QFUA 3HZ6A 2QXFA 1R0AA 2V7YA 3OYFA 4KHQA 1RBVA 4NLBA 1BL3A 2RPIA 5KGWA 5HP1A 4AQYK 5M1FA 3QESA 1BO5O 1JLQA 3LP2A 4FOIA 1J5OA 4AH9A 3O9RA 2KZMA 3R8EA 3K58A 4KB1A 5FROA 4I2QA 2BH1A 4KAZA 3HVRA 3WXJA 1VSKA 1OH6A 4DR3K 3DAWA 4XH1A 3VQPA 4DS5A 3NE6A 4C23A 5C10A 1U45A 1U6ZA 2OZMA 3AVMA 4NCGA 1EETA 2QWMA 3WNEA 4DQQA 5LMNK 4X64K 3J7AP 2G8UA 4M3UA 2YNFA 4BRQA 4BC4A 1T3VA 3SNNA 5CY4A 5GADP 4CEBA 3VA0A 5GIPA 1DLOA 2E6LA 4Q5VA 1ATSA 3LDOA 2YKMA 3L2VA 3PLAA 4ELVA 3RMDA 1E3MA 1RTIA 1FKPA 3QBXA 4E7KA 2ITGA 3HVTA 4KTZA 4FSVA 3ZSVA 1NK4A 2VG6A 3GE1A 1YJ9N 2HVIA 3CCEN 2XO7A 1GLEG 3SBGA 2O4GA 2CGLA 3VQDA 3RMAA 3SQ0A 1TUUA 4BY9C 3BZCA 3RRHA 3U6FA 3ZSZA 3PV8A 2PY5A 4OKKA 1VSEA 4FWLA 2C1IA 4BRAA 2BUPA 5A2QO 4FO0A 4CIFA 3UKRB 3AVFA 2IVPA 1SL2A 3DXKA 4JKFA 3DLHA 4FWSA 4FVMA 4AILC 4DV3K 4H0VB 5AQHA 1N5YA 2O4IA 3HM8A 5I9EB 1JLEA 4H4MA 3I33A 2W00A 1RILA 2ZGZA 4JNEA 3OYCA 3MN6A 4DR7K 2RF2A 3AO1A 4LD0A 1VSJA 5GINA 5F2RA 2OPPA 3L3UA 3ZT3A 3AVLA 1HLUA 3ZSQA 3OJSA 4HTUA 4JYAK 3SQ1A 2ZJQL 3G25A 3L2UA 1SUQA 5AQIA 2QI2A 1ZYQA 3THWB 4E1NA 2DY4A 4DTXA 3TI0A 1OH7A 2RKIA 4CHQA 4CD3A 3G10A 4BDZA 3TSPA 2ETJA 4DFJA 3MWTA 1ZC6A 4CE9A 2HB5A 4JD2B 4KH6A 5KGXA 2Q0RA 3E9PA 1HNVA 3A0IX 4O55A 1YHQN 1BWFO 4YOVA 4KKOA 5C12A 4CZGA 1HJRA 3ZT0A 4FPAA 3KHYA 4BRPA 1H1VA 3QMLA 5AQXA 4O0JA 2GUIA 4QAGA 4KTWA 5AFUA 2P5OA 4E7IA 3SPYA 1N8RO 2YI1A 3ZLJA 2QKBA 3AVHA 3EYZA 3OYBA 3EE8A 1K6YA 2D0PA 1NMDA 4KI4A 2E88A 3OJUA 4JRPA 2WUSA 3FZMA 3PX0A 4JKGA 1JLCA 1YVUA 4B3TK 1B92A 4PA1A 2X6SA 3V9SA 5K14A 2UU9K 2JLEA 3WEEB 3LDLA 4K41A 1C0UA 1MWKA 1MU2A 1OH5A 1IO2A 5AQMA 5HL7L 4FLXA 5AQFA 1JKHA 3O3FA 3L2WA 2P5GA 1ASVA 2OZSA 1HNZK 4Z4IA 1HPMA 4ZHRA 4Z4GA 1VQLN 1BIUA 2ZQBA 3DLBA 1XHXA 2KW4A 4LF5K 5AQTA 3ENBA 2V7ZA 5KRSA 2ZJRL 5HROA 3QERA 2YKNA 5KPTA 4BC3A 1NJIO 1I3AA 3K57A 4AHUA 3L2QA 3HPGA 5DK5A 3WNHA 3F2KA 3ZSWA 3TWHA 5M1QA 4U67L 1BGXT 3FZHA 4J2EA 1TKXA 3IS9A 3CCVN 3ITHA 3EL2A 3UKRA 4CZEA 3SAGA 3ZX0A 5AQUA 1MA9B 4FLTA 3U3GA 4N56A 4IJAA 1YXQA 2XY5A 1NK8A 2GTDA 4Z4HA 4WCEL 4YNQA 4F3TA 4B1XB 3NF6A 2HHWA 1M1KO 1CZAN 3U9ZA 1C1BA 4EHTA 3T19A 3KD1E 1BI4A 3K59A 3O3GA 3HI0A 4NCAA 3V4IA 4CIEA 4M3WA 4BC2A 4IO9L 3VQAA 4FLVA 4B3RK 5JMVA 1RT2A 4DG1A 4CF2A 3THYB 1FKOA 3AA3A 1GLLO 4OKJA 3AVCA 3CC2N 2QWNA 5ELZA 3O1WA 4JRQA 3NH2A 4FWPA 3VEOA 4RCHA 4FJ5A 4CJQA 1DT9A 5C2DA 5C25A 2FBTA 3O6WA 1Y97A 4LF8K 1QZ6A 3THVA 3O9UA 3T1HK 1S22A 4CBUA 4C8MA 4CHZA 1K8KB 2PYJA 3S3OA 3VF2A 1CXUA 1EXQA 4DR2K 3LP3A 2DPNA 3SJJA 2IS3A 1LW0A 2F96A 3UB5A 4L8RB 3B6OA 3TABA 4CHNA 4KO0A 4EHUA 3LDSA 3D6RA 3QICA 1WSGA 4J2AA 3TAQA 4CEZA 3RVCA 4Z4FA 1TK5A 1GOCA 4ICLA 4M45A 2G8IA 3BDPA 4BRLA 4ZTJA 3THXA 5AQRA 3PUFA 1HKBA 3QEWA 2Q31A 1HNWK 4UY8O 4PKHA 1Q86O 2HBKA 1T6DA 3T1YK 3NGIA 3TTFA 2VWBA 3DLLL 4HCCA 4BWJA 4R79A 2KFNA 5BN8A 1N36K 1X9WA 4BGAA 1W2BM 1S1UA 1JL1A 3O9TA 1UWBA 3VQ7A 1RT3A 3U3YA 3QEPA 3DLKA 4I6MB 4CHYA 4WFAL 3VEZA 1CXQA 3QETA 4BR7A 4NXNK 2IVOA 4PQUA 2QW9A 1U48A 1IJJA 2KKZA 4DQ8A 4DV2K 3SUOA 4DFPA 2FSJA 1UAXA 3DXMA 5J2QA 2YNHA 1SQKA 3D2FB 3LAKA 4DU3A 4XEIA 4DSFA 1NMNA 2HBLA 1QZ5A 4IOXA 3ENHA 2WOMA 2P9LA 5MLCQ 4YOUA 5KQ8A 3JAMO 3TR8A 3AGRA 1NGFA 1NGJA 3THYA 1QQOA 4Y1DA 1B9FA 3KK7A 1CZ9A 3HPOA 3NAEA 4B1ZA 2E2QA 1WAFA 3MECA 4BE0A 1U49A 3MAQA 1C0GA 1BA1A 3EZWA 4JHDA 2YHBA 3H08A 3KLFA 4Z4CA 5CZ1A 5AQPA 5D3GA 1QSYA 3ZT1A 4PL8A 4ID1A 1V4SA 4JS5A 1C0MA 4RW7A 4DLGA 1EX4A 1K8KA 4CJKA 1U2VA 5HRNA 4ELUA 4FJ8A 2YCHA 5JS2A 2OPQA 4CEQA 1T03A 3OYAA 1TYQA 3H45C 5AQWA 2ZF5O 1SKWA 1YUWA 5LY3A 1NJWA 2VGMA 4EZ6A 3OYGA 1RDBA 1I39A 2VCPA 1KAZA 3DRSA 2I5JA 3KZBA 4LH5A 1F21A 2A41A 5J2MA 2HHSA 1WLJA 2AJQA 2WTUA 3ZT4A 1DEJA 1VAZA 2OTJN 5EXWA 1IH7A 2F7TA 3G6EN 4KV8A 1WNSA 2F9TA 2Y1JA 3I55N 1IKYA 3L6QA 3VGMA 4H5WA 3RR7A 4LFBK 4BC5A 4G9ZA 1RDUA 2O8EB 2FSKA 3TSQA 4GY2B 2VG7A 2W6LA 4K8ZA 4MLEA 2FLOA 3TAGA 3OYIA 3ULEB 4CGGA 1D9FA 1NGHA 4CVNE 4AHCA 2Q3SA 2E8AA 4DTJA 1WSIA 2A42A 3LWMA 4KBOA 1BU6O 4DTNA 2HVHA 4JKEA 5AQNA 2O8CA 1RDAA 3HSCA 1NK0A 4B9QA 4KHPK 1L3SA 5FRMA 3SLCA 3ENOA 2XY6A 3CC7N 5M1OA 2KZZA 5J1EA 4N47A 2X6NA 1WSFA 3W3DA 4K0KK 2IVNA 1NGGA 1WOQA 2ZD1A 3SK3A 4IFVA 4FJ9A 3QBWA 5LMUK 1KAXA 5GIOA 4M3RA 4DU1A 1DTQA 4LFAK 2A40A 3MEEA 5DMRA 3NGYA 1TKZA 1QQMA 1NOZA 4DFKA 3AA4A 1VQKN 2XRIA 5HBMA 3RMBA 4I9LA 2UXCK 2O8FB 3GOIA 3VTHA 2VG5A 3FR0A 4H0PA 4XIUA 1OVQA 4JS4A 3I56N 5AQGA 4H5TA 1VQNN 4A5BA 3J7YP 3MEGA 3KLHA 2IDOA 3ID8A 1Q82O 4B1WB 3OA9A 3OS0A 2HNDA 1JCFA 1BQMA 4QS9A 4BRDA 3S3NA 2HHIA 3E9LA 5C0YA 1YJWN 1LAVA 1KFSA 3H6EA 1X9SA 3CPEA 2P9IA 4WQ5A 3NH1A 3SAFA 1L3UA 4K43A 4DF4A 4F2SA 2BDPA 4CJTA 1HRHA 2G8HA 4OLBA 3SJHA 4BR2A 1TGOA 1IBLK 2B5JA 4MFBA 4HUGA 1BIZA 3EEQA 5M1PA 3A2FA 4EP4A 4IEEA 4KTQA 4FJ7A 1NBWA 1S6PA 4B1VA 4B9UA 2E2OA 4OPAA 2QWRA 3T3FA 3RR8A 2WBNA 2E1YA 3DI6A 3NF7A 4FL9A 2F8SA 1RTDA 4ILHA 1ATNA 3CF5L 4DTSA 3MCAB 2W40A 4JKHA 3CQYA 4LF6K 2ZJPL 1KAYA 2A1RA 2OPRA 3OYLA 4BROA 3VA3A 4CF9A 3OY9A 1JCEA 1VSHA 3AVGA 1ITGA 4DSIA 3D2EA 3ULEA 4JI3K 3TTCA 3WUHA 3LALA 3I0SA 5AZJA 3S3MA 4JEPA 2Z1IA 2BGGA 3E1YA 5AR0A 1WSJA 3S5TA 2Q36A 2NLXA 3L0QA 3F9KA 5BRFA 4YOYA 3IFRA 4DTOA 1TV6A 4DQSA 4N76A 2P9SA 4BE1A 4ZTFA 1KVAA 2OYQA 5EY4A 5LL6Z 3V1RA 1VQ6N 1RBTA 5KQDA 2GX9A 2W6KA 1T7PA 4IG0A 4BR0A 1JCGA 1KFDA 3CIPA 3EY1A 4RW9A 2GV9A 4H0OA 3HP6A 4WYBA 1D8YA 2P9PA 4CJVA 2E20A 3ZSRA 3VEYA 3G71N 1NJZA 4GW6A 5M1KA 4QOZB 2QEXN 5AQYA 1LOTB 3P4IA 4OGEA 3K5NA 3V6DA 4OPKA 4DV0K 3SAHA 5C42A 4IFYA 3RSEA 4M42A 3QEXA 3L3VA 2DFFA 4F8RA 1VQPN 3O9SA 3VQ6A 2O8BA 1YTAA 3M8PA 4CZHA 1TAUA 4M3TA 3CCLN 2C1GA 2E6MA 4CBXA 2YNIA 4DV7K 4DSKA 4GV9A 1QVGM 1J54A 1IV0A 4IFEA 4JKDA 1SL1A
chains in the Genus database with same CATH topology
4RCHA 1VQON 2GEMA 5GAHP 2PAVA 2NZTA 2QWQA 4B1UB 1DT9A 5C2DA 2A3ZA 1VQ4N 4A57A 1EO1A 2GWJA 4CZLA 5BRDA 3CJCA 3G4SN 3CCQN 3O6WA 4IXCA 2GELA 4A5AA 1QZ6A 4H0YB 4RWTA 3O9UA 4O8UA 4FWOA 3VF4A 3MWPA 1S22A 2GUPA 4BR9A 4CBUA 4MLHA 5DM6L 3C0BA 3CCRN 1K8KB 4BG9A 1GLDG 3VF2A 3A5NC 4BG8A 4IEIA 3VMFB 3ATUA 2DPNA 2HSTA 2P9IB 1BDGA 1ZBSA 2FF3B 4BVPA 2KHOA 4YOXA 3CXCM 5KPRA 3UB5A 1LCUA 3O80A 1KC8O 3PIPL 4CZIA 4MO4A 2PFUA 4M7YA 3FZFA 1WUAA 3ID6A 4H03B 4ILJA 4EHUA 3NVKA 4IOAL 4EIAA 2H3GX 3LDNA 4EFHA 3L4QA 3C6AA 3D6RA 3QICA 2D0OA 5E26A 1C0FA 4IZ9A 3U9DA 3LDPA 5AQVA 3AGKA 3RVCA 4IDHA 3HOTA 2YJFA 3OBYA 2YX6A 1P8ZA 2CH5A 3BEXA 3KWGA 4FWKA 1M90O 4BREA 2Q2RA 4BRLA 3CC4N 3N4QA 1V4TA 3MDQA 5FPDA 3W0LA 1E4GT 5AQRA 3WXIA 4DCHA 3TPQA 1G99A 2NRHA 3BF1A 3HBTA 1HKBA 2I7PA 3HTVA 5LJWA 3GL1A 3EKSA 2Q31A 2QA4N 4PKHA 4UY8O 5JVGL 3C6HA 4O8KA 4JKGB 3O4WA 2HBKA 1Q86O 3CMEN 1GLJO 1T6DA 3E66A 4JKAA 1R59O 3ZETA 3TTFA 2VWBA 2W41A 4JKBA 1RGIA 4XJXA 2YHWA 3U8XA 3AAQA 3E9OA 5EVZA 3DLLL 4CZJA 1KQSM 4PHTX 4R79A 4F9OA 5EOYA 3IKMA 5BN8A 5BRHA 3CCSN 3D2EB 1XC3A 1DKGD 3UKUA 4YDUA 4BGAA 5AZJB 5B8HA 2HF4A 3BUZB 3IDHA 4ISEA 4BR5A 1W2BM 2A5XA 2VYPA 3Q7BA 4DHYA 1KD1O 3LDQA 4C1NK 3O9TA 3VENA 3VOVA 3J7ZO 3R3LA 1BA0A 2Q1NA 4BE7B 1Q18A 3M6GA 4ISFA 4WFNL 4JK8A 4I6MB 2P9NB 4WFAL 3VEZA 4NO7A 5F0XA 2A6AA 4BR7A 2NRZA 2IVOA 3WQUA 2WFBA 2QW9A 1IJJA 2KKZA 4GVEA 3TU5A 3MK6A 5GAGP 3TTDA 4O5FA 3VETA 4DQ8A 2P9SB 1DGKN 1Z6RA 5FPEA 4BRIA 3GBTA 4ILGB 2FSJA 3CD6N 1NGDA 3M1FA 5EX5A 3CCUN 2NRWA 3DXMA 5E84A 1VQ9N 2VGNA 1SQKA 1HX1A 3D2FB 5BPLA 4QS8A 2D4WA 3EKUA 4XEIA 1NWKA 2NRXA 1RFQA 2HBLA 4H5NA 1QZ5A 4IOXA 3ENHA 4HTLA 4BRCA 3VESA 2P9LA 1KXPA 3CJ7A 3CJBA 4YOUA 5AQJA 3KVGA 4QS7A 3B8AX 3CQXA 3ZX2A 4CZKA 5KQ8A 2ITMA 1XUPO 2P9PB 3AGRA 5HOOA 1NGFA 3HRGA 5LJVA 3FFKB 1ATRA 1NGJA 1SAZA 3SMPA 1YJNN 5AQLA 3NVMA 4BVOA 1QQOA 3GG4A 2WC9A 3SMSA 1OVYA 2P9UB 3KK7A 3U4LA 1SZ2A 2FXUA 2QWPA 5AZIA 2NRVA 4B1ZA 2E2QA 1NGIA 2KLAA 1C0GA 3RSEB 1BA1A 3EZWA 2AA4A 4JD2A 4JHDA 3VEWA 1YAGA 2NRRA 3FZKA 4MO5A 3OW2M 1HKGA 4BRHA 5AQPA 2V51B 3ZEUB 3A8YA 5C2FA 3CCJN 3NMUA 4PL8A 4JN4A 3QFUA 1W97L 1V4SA 3P38A 1Y64A 2OANA 2D1KA 3HZ6A 3R9PA 3C7NB 2V7YA 3GDQA 3CETA 4YDUC 1NGCA 4NLBA 3A5OC 4PKIA 3AAPA 4U7BA 5M1FA 1K8KA 1BO5O 4FOIA 1U2VA 3VGLA 2E1ZA 3O08A 4CZMA 2YCHA 3P31A 5FPMA 2YHXA 4WF9L 4IJNA 1TYQA 3O9RA 3T69A 3H45C 3R8EA 5AQWA 4BRFA 2ZF5O 1NGAA 4YOTA 3D7EO 1XQSC 1EQYA 2BH1A 1GLFO 5M1NA 4MDAA 1YUWA 5AQZA 3WXJA 4A62A 5LY3A 2VGMA 5ADXA 3CHWA 4CI6A 2NRTA 3DAWA 4XH1A 4OO1J 3J8AA 3O9QA 2VCPA 1Z05A 3FZLA 1KAZA 3A5MC 4C23A 2FF6A 4BQZA 3LL3A 3KZBA 5C10A 2CGJA 1U6ZA 3WEEA 2FSNA 4GV6A 2A41A 2QWMA 4MDBA 2P9KB 1DEJA 1VAZA 2OTJN 5EXWA 2F7TA 3G6EN 4A61A 4FWRA 4XH4A 2Q0UA 2F9TA 3I55N 5FPNA 3L6QA 3VGMA 3K9JA 4BRQA 1T6CA 4H5WA 4BC4A 1T3VA 3QFPA 4RTFD 4BC5A 4BGBA 4G9ZA 3ZYYX 5GADP 1RDUA 1SS6A 5BPNA 4PKGA 2QWOA 3EO3A 5BR9A 3L4IA 2HBMA 2FSKA 2YHYA 3TSQA 1X9JA 4GY2B 2ZGYA 4HWIA 1GLBG 2ASMA 4LC9B 4MLEA 3MX2A 4EAHD 2FLOA 1ESVA 3IUCA 4PL7A 3VGKA 5GIPA 2I7NA 3ULEB 1ATSA 4H0TB 3LDOA 3PLAA 2HF3A 1NGHA 4KH5A 4Y0WA 4L3QA 2E8AA 1K73O 2A42A 4KBOA 1BU6O 3P39A 4FWNA 3QBXA 1K9MO 2BTFA 3O1BA 4JKEA 5AQNA 3HSCA 3K9KA 2NNWA 4B9QA 5KPZA 3SLCA 3ENOA 4FSVA 3CC7N 4BRNA 3GE1A 2AP1A 4WFBL 3R6MA 5M1OA 1YJ9N 1K8AO 3CCEN 3H1VX 1GLEG 3SBGA 3W3DA 2CGLA 4DB3A 2ZWHA 2IVNA 2PBDA 3WXMB 2E2PA 2JWLA 1TUUA 4BY9C 3F5TA 4ISGA 3UKUB 1VQMN 5ADXH 5TKYA 3MN7A 1NGGA 1WOQA 4H0XB 3SK3A 2HOEA 4M7XA 3QBWA 4XH5A 1X3NA 2Q97A 4K25A 1HJOA 4FWLA 2C1IA 4BRAA 4NLCA 3CMAN 2BUPA 2GWKA 3FGUA 1T44A 4FO0A 3WT0A 5MLCQ 1VQ7N 1KAXA 5GIOA 3UKRB 2A40A 3MX5A 2IVPA 1QQMA 3DXKA 4JKFA 4IOCL 1VQKN 3MN9A 3H3NO 4FWSA 4JK9A 4FVUA 4H0VB 5AQHA 2P9UA 5JVHL 3AARA 3HM8A 3JXUA 5BREA 5I9EB 3OBWA 3GOIA 3MMVA 3VTHA 4H0PA 3FR0A 3I33A 2W00A 1O13A 3I8BA 1E4FT 3DXMB 2ZGZA 3I56N 2HBJA 5AQGA 4JNEA 3MN6A 4AM7A 2V52B 3F9MA 4H5TA 1VQNN 4A5BA 4CD1A 5GINA 4GV3A 5F2RA 3ZEUA 1GLAG 3AY9A 1HLUA 5JLHA 4YOWA 2P9LB 4KH4A 3JS6A 4J8FA 2ZJQL 3G25A 3ID8A 1S3XA 4FWQA 4C1NI 5AQIA 3VTIA 1Q82O 3C7NA 2QI2A 3DWLA 4B1WB 3OA9A 1Q81O 4H5VA 1JCFA 4QS9A 4BRDA 5BPMA 3LM2A 1MDUB 3O5BA 4CD3A 2QXLA 3E9LA 1QHAA 3EN9A 3TSPA 5C0YA 1YJWN 3MWTA 1ZC6A 3EE9A 4FWMA 4BQLA 4BRGA 4KH6A 3H6EA 4JD2B 4JHDB 2Q0RA 3ZX3A 3E9PA 3CPEA 2P9IA 4AF1A 4WQ5A 3SAFA 4K43A 4FOEA 2QWLA 1OKJA 3A0IX 3FLCO 1YHQN 3VERA 1BWFO 4YOVA 1HUXA 1QQNA 3BP8A 3SJHA 3H46O 4BR2A 5C12A 4CBWA 1TUYA 1J6ZA 3VF6A 4CZGA 1JJ2M 5AQOA 4K42A 3UE5A 2E2NA 5M1PA 4FPAA 3KHYA 5AQSA 3VEVA 2QTDA 1H1VA 4IEEA 4BRPA 1BOTO 1U2VB 3QMLA 5AQXA 1NBWA 1ZXOA 4B1VA 2E2OA 3N4PA 4OPAA 1TYQB 2QWRA 4JK7A 4YORA 1ILYA 3M3ZA 2WBNA 2E1YA 5AFUA 2P9KA 1N8RO 1RDWX 4BECA 2YI1A 4FL9A 4ILHA 1ATNA 3CF5L 4WQ4C 3MCAB 1X3MA 2W40A 3WQTA 3PIOL 3EE8A 4JKHA 3CQYA 5CR4A 5AQKA 2ZJPL 2D0PA 1NMDA 2E88A 1NLVA 3ATVA 1KAYA 1NM1A 5JLFA 2WUSA 3FZMA 4JKGA 4BROA 2UYTA 1JCEA 2IIRA 5DM7L 1YITN 1YI2N 5GAEP 5H1SQ 3WEEB 3LDLA 4K41A 1VQ5N 4H5RA 1MWKA 3O8MA 3LM9A 3D2EA 5AQMA 3ULEA 5HL7L 3CCMN 3TTCA 3WUHA 1VQ8N 4E1JA 5AQFA 2ASOA 5AZJA 4JEPA 2F9WA 1HPMA 3MN5A 1VQLN 1HKCA 3E1YA 3Q7CA 5AR0A 4A59A 3S41A 5AQTA 4BRMA 4I6MA 2P9NA 2Q36A 5F1XA 3ENBA 2NLXA 2V7ZA 3L0QA 4CJ7A 5BRFA 2ZJRL 3VEXA 2YJEA 4NB4A 5KPTA 4DKWA 4BC3A 1YF5L 4WQ5C 2ASPA 3IFRA 3ZETB 4YOYA 1NJIO 4B1YB 1D4XA 3SBTA 5AQQA 3CERA 3T7ZA 3BF3A 4Z94A 2P9SA 3F2KA 4BRKA 3DJCA 3FE1A 1QVFM 5M1QA 5EY4A 4U67L 1VQ6N 3H3OB 5KQDA 3FZHA 1MWMA 3D2FA 2GX9A 2OTLN 1IG8A 3CCVN 3CI5A 3QB0A 4OPHA 4BR0A 1JCGA 3SAGA 3CIPA 3EL2A 3UKRA 4CZEA 3ZX0A 4IO8A 4H0OA 3KWIA 1MA9B 5AQUA 1BG3A 1YVNA 4IJAA 1YXQA 3R1XA 4WYBA 5TKWA 2P9PA 3CJAA 2E20A 3MCPA 5AFUH 4WQ4A 3M5RA 3VEYA 3G71N 2GTDA 5M1KA 4WCEL 2CGKA 2QEXN 5AQYA 5CE3A 4B1XB 1LOTB 2J4RA 1GLCG 1M1KO 1CZAN 1NGEA 3P4IA 3U9ZA 4EHTA 4CZFA 4M63C 3SAHA 1Q7YO 4BR4A 3H1QA 2RE2A 3HI0A 3RSEA 3HOSA 2RHKA 3TSUA 3CJ1A 2JWKA 1S72N 5BN9A 4BC2A 4IO9L 1VQPN 3O9SA 1YIJN 2HMPA 3A5LC 5JMVA 3OHRA 3DXKB 3C65A 4CZHA 4FPBA 5CHIA 2CH6A 3CCLN 2C1GA 4IWVA 3WXKA 1BUPA 3VPZA 1P90A 3WXLA 1NGBA 4A2AA 4CBXA 4JKCA 4JAXA 4A2BA 4BEBA 1GLLO 3CJ9A 5AZIB 4GV9A 3QDKA 3CC2N 3IMXA 1QVGM 2QWNA 2QM1A 4GNIA 5ELZA 3O1WA 4IFEA 3CPWM 4JKDA 4FWPA 2EWSA 4AM6A 5JICA 5C15A 3VEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RCH A;  2GEM A;  2PAV A;  2NZT A;  2QWQ A;  4B1U B;  2A3Z A;  2GWJ A;  4CZL A;  5BRD A;  3CJC A;  3O6W A;  4IXC A;  2GEL A;  1QZ6 A;  4H0Y B;  4RWT A;  4FWO A;  3VF4 A;  1S22 A;  2GUP A;  4BR9 A;  4CBU A;  4MLH A;  3C0B A;  1K8K B;  4BG9 A;  1GLD G;  3VF2 A;  3A5N C;  4BG8 A;  3ATU A;  2DPN A;  2P9I B;  1BDG A;  1ZBS A;  2FF3 B;  4BVP A;  2KHO A;  5KPR A;  3UB5 A;  1LCU A;  3O80 A;  4CZI A;  4MO4 A;  4M7Y A;  3FZF A;  1WUA A;  4H03 B;  4EHU A;  4EIA A;  2H3G X;  3LDN A;  4EFH A;  3QIC A;  2D0O A;  5E26 A;  1C0F A;  4IZ9 A;  3U9D A;  3LDP A;  5AQV A;  2YJF A;  3BEX A;  1P8Z A;  2CH5 A;  4FWK A;  4BRE A;  2Q2R A;  4BRL A;  1V4T A;  3MDQ A;  5FPD A;  3W0L A;  1E4G T;  5AQR A;  3WXI A;  4DCH A;  3TPQ A;  1G99 A;  2NRH A;  3BF1 A;  3HBT A;  1HKB A;  2I7P A;  3HTV A;  5LJW A;  3GL1 A;  3EKS A;  2Q31 A;  4PKH A;  4O8K A;  3O4W A;  1GLJ O;  1T6D A;  1R59 O;  3ZET A;  2VWB A;  2W41 A;  1RGI A;  2YHW A;  3U8X A;  3AAQ A;  5EVZ A;  4CZJ A;  4F9O A;  5EOY A;  5BN8 A;  5BRH A;  3D2E B;  1XC3 A;  1DKG D;  3UKU A;  4YDU A;  4BGA A;  5AZJ B;  5B8H A;  2HF4 A;  3BUZ B;  3IDH A;  4ISE A;  4BR5 A;  2A5X A;  2VYP A;  4DHY A;  3LDQ A;  3VOV A;  3VEN A;  1BA0 A;  2Q1N A;  1Q18 A;  3M6G A;  4ISF A;  4I6M B;  2P9N B;  3VEZ A;  4NO7 A;  5F0X A;  2A6A A;  4BR7 A;  2IVO A;  3WQU A;  2QW9 A;  1IJJ A;  3TU5 A;  3MK6 A;  4O5F A;  3VET A;  4DQ8 A;  2P9S B;  1DGK N;  1Z6R A;  5FPE A;  4BRI A;  3GBT A;  2FSJ A;  1NGD A;  3M1F A;  5EX5 A;  3DXM A;  5E84 A;  1SQK A;  3D2F B;  1HX1 A;  5BPL A;  4QS8 A;  2D4W A;  3EKU A;  4XEI A;  1NWK A;  1RFQ A;  4H5N A;  1QZ5 A;  3ENH A;  4HTL A;  4BRC A;  3VES A;  2P9L A;  1KXP A;  3CJ7 A;  3CJB A;  5AQJ A;  4CZK A;  3KVG A;  4QS7 A;  3B8A X;  3CQX A;  3ZX2 A;  5KQ8 A;  2ITM A;  1XUP O;  2P9P B;  1NGF A;  5LJV A;  3FFK B;  1ATR A;  1NGJ A;  1SAZ A;  3SMP A;  5AQL A;  4BVO A;  1QQO A;  3GG4 A;  3SMS A;  2P9U B;  3U4L A;  1SZ2 A;  2FXU A;  2QWP A;  5AZI A;  4B1Z A;  2E2Q A;  1NGI A;  1C0G A;  3RSE B;  1BA1 A;  3EZW A;  2AA4 A;  4JD2 A;  4JHD A;  3VEW A;  1YAG A;  3FZK A;  4MO5 A;  1HKG A;  4BRH A;  5AQP A;  2V51 B;  3ZEU B;  3A8Y A;  4PL8 A;  4JN4 A;  3QFU A;  1V4S A;  1Y64 A;  2OAN A;  2D1K A;  3HZ6 A;  3R9P A;  3C7N B;  2V7Y A;  3GDQ A;  3CET A;  4YDU C;  1NGC A;  4PKI A;  3A5O C;  3AAP A;  1K8K A;  1BO5 O;  4FOI A;  1U2V A;  3VGL A;  2E1Z A;  3O08 A;  4CZM A;  2YCH A;  5FPM A;  2YHX A;  4IJN A;  1TYQ A;  3H45 C;  3R8E A;  5AQW A;  4BRF A;  2ZF5 O;  1NGA A;  3D7E O;  1XQS C;  1EQY A;  1GLF O;  1YUW A;  5AQZ A;  3WXJ A;  4A62 A;  5LY3 A;  5ADX A;  3CHW A;  4CI6 A;  3DAW A;  4XH1 A;  3J8A A;  2VCP A;  1Z05 A;  3FZL A;  1KAZ A;  3A5M C;  4C23 A;  2FF6 A;  4BQZ A;  3LL3 A;  3KZB A;  2CGJ A;  1U6Z A;  3WEE A;  2FSN A;  2A41 A;  2QWM A;  2P9K B;  1DEJ A;  5EXW A;  4A61 A;  4FWR A;  4XH4 A;  2Q0U A;  2F9T A;  5FPN A;  3L6Q A;  3VGM A;  4BRQ A;  1T6C A;  4H5W A;  4BC4 A;  3QFP A;  4RTF D;  4BC5 A;  4BGB A;  5BPN A;  4PKG A;  2QWO A;  3EO3 A;  5BR9 A;  3L4I A;  2YHY A;  2FSK A;  1X9J A;  4GY2 B;  2ZGY A;  4HWI A;  1GLB G;  2ASM A;  4LC9 B;  4MLE A;  4EAH D;  2FLO A;  1ESV A;  3IUC A;  4PL7 A;  3VGK A;  2I7N A;  3ULE B;  1ATS A;  4H0T B;  3LDO A;  2HF3 A;  1NGH A;  4Y0W A;  4L3Q A;  2E8A A;  2A42 A;  4KBO A;  1BU6 O;  4FWN A;  3QBX A;  2BTF A;  3O1B A;  5AQN A;  3HSC A;  4B9Q A;  5KPZ A;  3SLC A;  3ENO A;  4FSV A;  4BRN A;  3GE1 A;  2AP1 A;  3R6M A;  3H1V X;  1GLE G;  3W3D A;  2CGL A;  4DB3 A;  2ZWH A;  2IVN A;  2PBD A;  2E2P A;  1TUU A;  4ISG A;  3UKU B;  5ADX H;  5TKY A;  3MN7 A;  1NGG A;  1WOQ A;  4H0X B;  3SK3 A;  2HOE A;  4M7X A;  3QBW A;  4XH5 A;  1X3N A;  2Q97 A;  4K25 A;  1HJO A;  4FWL A;  4BRA A;  2BUP A;  2GWK A;  3FGU A;  1T44 A;  4FO0 A;  3WT0 A;  1KAX A;  3UKR B;  2A40 A;  2IVP A;  1QQM A;  3DXK A;  3MN9 A;  3H3N O;  4FWS A;  4H0V B;  5AQH A;  2P9U A;  3AAR A;  3HM8 A;  3JXU A;  5BRE A;  5I9E B;  3GOI A;  3MMV A;  4H0P A;  3FR0 A;  3I33 A;  3I8B A;  1E4F T;  3DXM B;  2ZGZ A;  5AQG A;  4JNE A;  3MN6 A;  4AM7 A;  2V52 B;  3F9M A;  4H5T A;  4CD1 A;  5F2R A;  3ZEU A;  1GLA G;  3AY9 A;  1HLU A;  5JLH A;  2P9L B;  3JS6 A;  4J8F A;  3G25 A;  3ID8 A;  1S3X A;  4FWQ A;  5AQI A;  3C7N A;  3DWL A;  4B1W B;  4H5V A;  1JCF A;  4QS9 A;  4BRD A;  5BPM A;  3LM2 A;  1MDU B;  3O5B A;  4CD3 A;  2QXL A;  1QHA A;  3EN9 A;  1ZC6 A;  4FWM A;  4BQL A;  4BRG A;  3H6E A;  4JD2 B;  4JHD B;  2Q0R A;  3ZX3 A;  2P9I A;  4WQ5 A;  4K43 A;  4FOE A;  2QWL A;  1OKJ A;  3A0I X;  3FLC O;  3VER A;  1BWF O;  1HUX A;  1QQN A;  3BP8 A;  3SJH A;  3H46 O;  4BR2 A;  4CBW A;  1TUY A;  1J6Z A;  3VF6 A;  4CZG A;  5AQO A;  4K42 A;  3UE5 A;  2E2N A;  4FPA A;  3KHY A;  5AQS A;  3VEV A;  4BRP A;  1H1V A;  1BOT O;  1U2V B;  3QML A;  5AQX A;  1NBW A;  1ZXO A;  4B1V A;  2E2O A;  1TYQ B;  2QWR A;  3M3Z A;  5AFU A;  2E1Y A;  2P9K A;  1RDW X;  2YI1 A;  4FL9 A;  1ATN A;  4WQ4 C;  1X3M A;  2W40 A;  3WQT A;  3CQY A;  5AQK A;  2D0P A;  1NMD A;  2E88 A;  1NLV A;  3ATV A;  1KAY A;  1NM1 A;  5JLF A;  2WUS A;  3FZM A;  4BRO A;  2UYT A;  1JCE A;  2IIR A;  3WEE B;  3LDL A;  4K41 A;  4H5R A;  1MWK A;  3O8M A;  3LM9 A;  3D2E A;  5AQM A;  3ULE A;  3WUH A;  4E1J A;  5AQF A;  2ASO A;  5AZJ A;  2F9W A;  1HPM A;  3MN5 A;  1HKC A;  5AR0 A;  3S41 A;  5AQT A;  4BRM A;  4I6M A;  2P9N A;  2Q36 A;  5F1X A;  2NLX A;  2V7Z A;  3L0Q A;  4CJ7 A;  5BRF A;  3VEX A;  2YJE A;  4NB4 A;  5KPT A;  4BC3 A;  4WQ5 C;  2ASP A;  3IFR A;  3ZET B;  4B1Y B;  1D4X A;  5AQQ A;  3CER A;  3BF3 A;  4Z94 A;  2P9S A;  4BRK A;  3DJC A;  3FE1 A;  5EY4 A;  3H3O B;  5KQD A;  3FZH A;  1MWM A;  3D2F A;  1IG8 A;  3CI5 A;  3QB0 A;  4BR0 A;  1JCG A;  3CIP A;  3EL2 A;  3UKR A;  4CZE A;  3ZX0 A;  4IO8 A;  4H0O A;  5AQU A;  1MA9 B;  1BG3 A;  1YVN A;  4IJA A;  1YXQ A;  4WYB A;  2P9P A;  3CJA A;  2E20 A;  3MCP A;  5AFU H;  4WQ4 A;  3VEY A;  2GTD A;  2CGK A;  5AQY A;  5CE3 A;  4B1X B;  1LOT B;  2J4R A;  1GLC G;  1CZA N;  1NGE A;  3P4I A;  3U9Z A;  4EHT A;  4CZF A;  4M63 C;  4BR4 A;  3H1Q A;  3RSE A;  3HI0 A;  3CJ1 A;  5BN9 A;  4BC2 A;  2HMP A;  3A5L C;  5JMV A;  3OHR A;  3DXK B;  4CZH A;  4FPB A;  2CH6 A;  4IWV A;  3WXK A;  1BUP A;  3VPZ A;  3WXL A;  4A2A A;  1NGB A;  4CBX A;  4JAX A;  4A2B A;  1GLL O;  3CJ9 A;  5AZI B;  3QDK A;  3IMX A;  2QWN A;  2QM1 A;  4GNI A;  5ELZ A;  3O1W A;  5JIC A;  4FWP A;  2EWS A;  4AM6 A;  3VEO A; 
#chains in the Genus database with same CATH topology
 2NZT A;  1NK9 A;  4A57 A;  1EO1 A;  1L5U A;  4KRF A;  1C0T A;  4IXC A;  4B9V A;  4I2P A;  3AVI A;  3CCR N;  3QIN A;  3A5N C;  4IEI A;  1QSS A;  4KHW A;  3AVA A;  5KTQ A;  4FK4 A;  4JI8 K;  1BDG A;  1VHX A;  1ZBS A;  2FF3 B;  3CXC M;  3O80 A;  4CZI A;  2PFU A;  1JLF A;  3MED A;  4ILJ A;  2BE2 A;  4IOA L;  2D5R A;  4FM1 A;  2G8V A;  3VQ4 A;  3IG1 A;  3V9Z A;  4AHV A;  4FJM A;  5AQV A;  3AGK A;  4IDH A;  4H4O A;  2YJF A;  3OBY A;  4E3S A;  2YX6 A;  1P8Z A;  3RWU A;  2DFE A;  2Q2R A;  1V4T A;  5FPD A;  4BAC A;  1RT6 A;  1D5A A;  3HXM A;  4LF7 K;  1S6Q A;  4DU4 A;  5JVG L;  3C6H A;  3AA5 X;  3O4W A;  4JKA A;  1HYV A;  2LSN A;  4CGJ A;  4XJX A;  3U8X A;  1TK8 A;  3E9O A;  3ULD A;  4CZJ A;  2FBX A;  3O3H A;  5CYQ A;  5EOY A;  1Q8I A;  3HYF A;  3CM6 A;  4YDU A;  2HF4 A;  3BUZ B;  3SV4 A;  3LDQ A;  4PY5 A;  3VOV A;  4BE7 B;  3R3L A;  1WSH A;  4ISF A;  3QEI A;  1TKD A;  3OYJ A;  2P9N B;  4ELT A;  1KVC A;  2HHV A;  3TU5 A;  4O5B A;  4UQG A;  3MK6 A;  5GAG P;  3TTD A;  1HYZ A;  1Z6R A;  5FPE A;  1JL2 A;  3AVN A;  1XMO K;  4ILG B;  4KHN A;  1NGD A;  3M1F A;  3CCU N;  3OS2 A;  5E84 A;  3SUN A;  1HX1 A;  4QS8 A;  4PUO A;  3P5J A;  4CHO A;  2NRX A;  3AVJ A;  3C95 A;  1KXP A;  4JLH A;  4CJ4 A;  3ALY A;  3KVG A;  4QS7 A;  3CQX A;  3ZX2 A;  1XUP O;  5HOO A;  3IRX A;  1ATR A;  5HLF A;  3THW A;  5AQL A;  4BVO A;  3GG4 A;  3SMS A;  1OVY A;  2P9U B;  1SZ2 A;  4CEE A;  1NGI A;  2E5L K;  1TL1 A;  2DTU A;  1U04 A;  2G8W A;  4JD2 A;  2AA4 A;  1SKS A;  3K5O A;  4MQ3 A;  3VN5 A;  1HKG A;  4B3S K;  3ZEU B;  1RT4 A;  5C2F A;  2OAN A;  2D1K A;  3R9P A;  4CK1 A;  3C7N B;  3GDQ A;  4DQR A;  3M8R A;  3CET A;  1JXB A;  2DFH A;  4PKI A;  3IAY A;  5KRT A;  3SPZ A;  3VGL A;  3O08 A;  4DV5 K;  3P31 A;  5FPM A;  4WF9 L;  4IJN A;  1NOY A;  4E7J A;  4JI1 K;  4YOT A;  1NG9 A;  1RT5 A;  4CIG A;  1GLF O;  3KKS A;  4MDA A;  5FDL A;  3CHW A;  1UA1 A;  4CI6 A;  3PSF A;  2NRT A;  5CZ2 A;  3SI6 A;  4OO1 J;  3J8A A;  4GKK K;  3FZL A;  4DTU A;  3A5M C;  2FF6 A;  3HST B;  4BQZ A;  3LL3 A;  1VSD A;  5AJ3 K;  5IWA K;  4CGF A;  3WEE A;  5T7B A;  4GV6 A;  4MDB A;  2P9K B;  2IGI A;  4OKE A;  4FWR A;  1DTT A;  3CG7 A;  1KTQ A;  3K9J A;  4F4K A;  2Z1H A;  3KIO A;  3QFP A;  4BGB A;  1SS6 A;  5BPN A;  4PKG A;  2IAJ A;  3AVB A;  2QWO A;  3EO3 A;  2HBM A;  4HUF A;  4I7F A;  4KFB A;  2ZGY A;  2ASM A;  4NYN A;  4DV4 K;  3MX2 A;  4EAH D;  3NHG A;  1ESV A;  1LW2 A;  3VGK A;  2HHU A;  1LWE A;  4H0T B;  4L3Q A;  3NDK A;  4X65 K;  4CF1 A;  3VQ8 A;  4BWM A;  4KB0 A;  2BTF A;  5KPZ A;  4FLY A;  4BRN A;  4WFB L;  1JLG A;  5I42 A;  3HM9 A;  2VQE K;  1BCM A;  4DB3 A;  4HVJ A;  2E2P A;  4ISG A;  3UKU B;  5ADX H;  5TKY A;  4H0X B;  4CJF A;  4FLU A;  2HOE A;  4M7X A;  2E4L A;  1D9D A;  1IBM K;  1XMQ K;  3CMA N;  1T44 A;  1VQ7 N;  5IT9 O;  4CJU A;  3MX5 A;  3KD5 E;  1HNI A;  4IOC L;  1C1A A;  3H3N O;  3V1Q A;  4FVU A;  2P9U A;  5JVH L;  4DSL A;  3AAR A;  3JXU A;  5BRE A;  3MMV A;  4YY3 K;  2HW3 A;  3V9U A;  3V9W A;  2HBJ A;  3NGZ A;  2V52 B;  3F9M A;  4DV6 K;  4CD1 A;  3K2P A;  5FRN A;  3ZEU A;  2RN2 A;  1GLA G;  1N33 K;  3AY9 A;  5JLH A;  3V81 A;  4KH4 A;  3JS6 A;  4FM2 A;  4CK2 A;  3D0P A;  1S3X A;  4FWQ A;  4C1N I;  3VTI A;  1NKC A;  3C7N A;  1RCH A;  4CFA A;  1Q81 O;  4H5V A;  4CF8 A;  3OTO K;  4M3Z A;  3LM2 A;  3O5B A;  4M41 A;  2QXL A;  1HYS A;  2UXB K;  1QHA A;  3EN9 A;  4BRG A;  1XHZ A;  4CFB A;  4J2D A;  4EZ9 A;  2Z1J A;  2OA8 A;  4LF4 K;  4AF1 A;  1WN7 A;  4FOE A;  3VER A;  3C6U A;  1W7A A;  1KSP A;  1EP4 A;  1QQN A;  1S1V A;  4CBW A;  3VF6 A;  3KJV A;  1JJ2 M;  5AQO A;  4X66 K;  3UE5 A;  4E72 A;  2E2N A;  1VSM A;  1EWR A;  5AQS A;  3VEV A;  2QTD A;  4CGH A;  1RT1 A;  3LPT A;  3N4P A;  3ISN C;  1NK5 A;  4JK7 A;  3M3Z A;  2P9K A;  4F3O A;  2Y1I A;  4FJK A;  1VRU A;  2X74 A;  4WQ4 C;  4M3X A;  3WQT A;  4OX9 K;  1JXE A;  3QEV A;  3HT3 A;  2XHB A;  3SCX A;  3HPH A;  3M8Q A;  1ZBI A;  1Z26 A;  5JLF A;  2UXD K;  3SUP A;  4FJJ A;  3KKR A;  3K5M A;  1YIT N;  2IIR A;  5DM7 L;  3QNN A;  4R5P A;  2IOC A;  5H1S Q;  3K0S A;  1VQ5 N;  4H5R A;  3O8M A;  3VQ5 A;  3CCM N;  4DMN A;  4E1J A;  2ASO A;  4E1M A;  3MN5 A;  1HKC A;  3Q7C A;  3K5L A;  1QQC A;  2JGU A;  4DS4 A;  4BRM A;  4I6M A;  3VQB A;  1J9A A;  3VEX A;  2YJE A;  4NB4 A;  3KK2 A;  1VRT A;  4WQ5 C;  1RBU A;  2ASP A;  3ZET B;  5HRP A;  3QIO A;  3SUQ A;  4B1Y B;  2X78 A;  3T7Z A;  3CER A;  1RTH A;  3BF3 A;  1WBB A;  4DR4 K;  1RDD A;  4BRK A;  3FE1 A;  4Y1C A;  3SQ4 A;  3H3O B;  3D2F A;  4NCB A;  1IG8 A;  4FYD A;  3NFA A;  1TK0 A;  4C8O A;  4IO8 A;  1EKE A;  4CJL A;  1BG3 A;  1YVN A;  1FXX A;  5TKW A;  4Q0B A;  3OYH A;  1XI1 A;  4WQ4 A;  3M5R A;  4Z0U A;  2P51 A;  2J4R A;  4BDY A;  4DLE A;  4IBN A;  1NKB A;  2RE2 A;  2RHK A;  3TSU A;  3CJ1 A;  2JWK A;  1C6V A;  1JLA A;  3QNO A;  1N34 K;  3DOL A;  1N6Q A;  4B9T A;  1YIJ N;  4DR5 K;  5J2N A;  3DXK B;  1NJX A;  1X1P A;  4HHT A;  4FPB A;  2CH6 A;  3E01 A;  3WXK A;  4A2A A;  3VPZ A;  1P90 A;  1T05 A;  2O8D B;  4JAX A;  4A2B A;  4DTM A;  4BEB A;  3CJ9 A;  3QDK A;  2IC3 A;  3IMX A;  1WB9 A;  4GNI A;  2QM1 A;  3L8B A;  3QIP A;  4CJ5 A;  2EWS A;  2HHT A;  4CFD A;  1GOA A;  5GAH P;  4BE2 A;  2A3Z A;  1VK0 A;  4CZL A;  3AO4 A;  2KTQ A;  3CCQ N;  4B9S A;  3WNG A;  2GEL A;  4A5A A;  4DTP A;  4O8U A;  4FWO A;  3VF4 A;  3MWP A;  4FJI A;  4FZZ A;  4MLH A;  5DM6 L;  3C0B A;  2OPS A;  1GLD G;  4YFU A;  4BG8 A;  4AHT A;  3VMF B;  3ATU A;  4B3O A;  1GOB A;  4W5Q A;  1HMV A;  1HPZ A;  4BVP A;  5KPR A;  1LCU A;  3PIP L;  4MO4 A;  2FC0 A;  4M7Y A;  1WUA A;  2WON A;  3ID6 A;  4CJS A;  2H3G X;  1QSL A;  4EFH A;  4BDP A;  3L4Q A;  3C6A A;  2YHA A;  2O8E A;  4CER A;  5E26 A;  1C0F A;  1TVR A;  3U9D A;  3LDP A;  3OVN A;  2B6A A;  4B8C A;  1S5J A;  1WSE A;  3DLR A;  4CEF A;  5HRS A;  3KWG A;  4FWK A;  1M90 O;  4ID5 A;  3I8D A;  4FJG A;  2HNY A;  3W0L A;  1WAJ A;  4CJR A;  1E4G T;  3TPQ A;  1G99 A;  2VWK A;  5JEN A;  2NRH A;  4E7L A;  1A5W A;  1S1X A;  3HBT A;  4FZX C;  2I7P A;  5LJW A;  3GL1 A;  3EKS A;  2R7Y A;  4JKG B;  3E66 A;  3ZET A;  2W41 A;  4JKB A;  1U4B A;  2YHW A;  4YHH K;  4TSX A;  4CGD A;  4M3Y A;  3CCS N;  3OYE A;  2BAN A;  3HP9 A;  4E7H A;  3IDH A;  4BR5 A;  2A5X A;  2VYP A;  3BZK A;  3Q7B A;  5BR8 K;  1X9M A;  1KD1 O;  4QCL A;  3J7Z O;  1BA0 A;  2Q1N A;  3M6G A;  4NO7 A;  5C24 A;  2NRZ A;  4OPJ A;  3WQU A;  3OS1 A;  2WFB A;  4JI5 K;  4C8K A;  2A1S A;  4GVE A;  4N41 A;  3HO1 A;  3ASM A;  4FK0 A;  3TAM A;  4O5F A;  1TKT A;  2O8F A;  4BRI A;  1EWQ A;  4J2B A;  1U47 A;  3CD6 N;  5EX5 A;  1HQU A;  3PY8 A;  1VQ9 N;  2UUA K;  4DF8 A;  1QTM A;  2VGN A;  5BPL A;  4FJX A;  2D4W A;  3EKU A;  4C8N A;  1B9D A;  2ZE2 A;  4HTL A;  4BRC A;  5AQJ A;  3CJB A;  1XWL A;  2ITM A;  4DFM A;  1VSI A;  1SAZ A;  3SMP A;  2O8D A;  1L3T A;  2WC9 A;  1ZBH A;  2FXU A;  3AO5 A;  1BI4 B;  1UOC A;  2KLA A;  4B9N A;  3G0Z A;  1XC9 A;  3DLE A;  3VEW A;  3CFR A;  3TAN A;  1RNH A;  1YAG A;  2NRR A;  4MO5 A;  4BRH A;  3OYD A;  2V51 B;  4PWD A;  2FBY A;  4LSN A;  3CCJ N;  4DQP A;  3NMU A;  4W5T A;  2EX3 A;  1W97 L;  3P38 A;  1Y64 A;  4JV5 K;  4YDU C;  1NGC A;  3A5O C;  4AHR A;  1G15 A;  3AAP A;  4U7B A;  4RW4 A;  1NNE A;  3LZJ A;  3CYG A;  1UA0 A;  1BCO A;  4CED A;  1NU0 A;  1HNX K;  2E1Z A;  4CZM A;  1KLM A;  4FW1 A;  2YHX A;  1Z25 A;  3T69 A;  3M8S A;  4BRF A;  1NGA A;  1VSF A;  4CHP A;  3LWL A;  3D7E O;  1FK9 A;  4OGC A;  1XQS C;  1EQY A;  4B9M A;  2KQ2 A;  5M1N A;  4JI7 K;  5AQZ A;  4A62 A;  4CEO A;  5ADX A;  3LP1 A;  3RTV A;  4CES A;  4DV1 K;  3O9Q A;  1Z05 A;  3DMJ A;  4KHY A;  3F73 A;  4CJP A;  4RW8 A;  2W42 A;  3NF8 A;  2CGJ A;  2FSN A;  1J5E K;  2EHG A;  1TL3 A;  3WNF A;  4FJL A;  4A61 A;  4XH4 A;  2Q0U A;  2HMI A;  4E0D A;  5FPN A;  1IKX A;  1RDC A;  1T6C A;  3ZCM A;  4RTF D;  1ASU A;  1TAQ A;  3ZYY X;  3J80 O;  3T1A A;  4B08 A;  2HHX A;  3QLH A;  5BR9 A;  3L4I A;  2YHY A;  1X9J A;  4HWI A;  1GLB G;  4LC9 B;  4E19 A;  4WE1 A;  3NF9 A;  1C1C A;  4PL7 A;  3IUC A;  3AA2 A;  2I7N A;  1NK6 A;  3O4N A;  2OCE A;  2HF3 A;  4KH5 A;  4Y0W A;  1K73 O;  3THX B;  2VQF K;  1HR0 K;  3P39 A;  4FWN A;  1K9M O;  3HJF A;  2D0C A;  3O1B A;  3PX4 A;  3K9K A;  2NNW A;  4IDK A;  3AO2 A;  3LPU A;  2AP1 A;  3R6M A;  1K8A O;  1A5V A;  3H1V X;  3S9H A;  4N5S A;  2HHQ A;  3KTQ A;  2ZWH A;  4X62 K;  3WXM B;  2PBD A;  2JWL A;  4DR1 K;  3F5T A;  4O0I A;  1VQM N;  3DOK A;  2G8K A;  3MN7 A;  3KK3 A;  1VSL A;  4LH4 A;  4XH5 A;  1X3N A;  2Q97 A;  4K25 A;  1HJO A;  4CJE A;  4NLC A;  2GWK A;  3FGU A;  3WT0 A;  1L3V A;  3RRG A;  1S1T A;  3ZSO A;  3FFI A;  3MN9 A;  1S9E A;  4JK9 A;  4HUE A;  2UUB K;  3AO3 A;  3OBW A;  3KLE A;  4DWI A;  1BQN A;  1O13 A;  3I8B A;  4KHS A;  3AVK A;  1E4F T;  3DXM B;  3DYA A;  4OVL A;  4AM7 A;  3V1O A;  3OYK A;  4DSE A;  1NJY A;  4FM0 A;  4GV3 A;  3JYT A;  4YOW A;  1I94 K;  2P9L B;  3VQQ A;  3LAM A;  4J8F A;  4GMJ B;  1FW6 A;  3JSM A;  3DWL A;  4G1Q A;  4W5R A;  1ZBU A;  5SWM A;  3LP0 A;  4V19 S;  3O4Q A;  5BPM A;  1MDU B;  3J81 O;  3D45 A;  3CM5 A;  4IKF A;  1YT3 A;  2PYL A;  3KLI A;  1BHL A;  3EE9 A;  4FWM A;  4LSL A;  4BQL A;  4JHD B;  3VQE A;  2YNG A;  1IG9 A;  3ZX3 A;  1OH8 A;  3BY5 A;  2VWJ A;  2QWL A;  1OKJ A;  3FLC O;  5I3U A;  1HUX A;  2YV0 X;  3BP8 A;  3H46 O;  2UUC K;  1TUY A;  1J6Z A;  4K42 A;  3I0R A;  2ATQ A;  3VQC A;  4FLZ A;  1BOT O;  4CGI A;  1U2V B;  1ZXO A;  1RBS A;  1TYQ B;  1ILY A;  4YOR A;  1KVB A;  1RDW X;  4BEC A;  1J53 A;  4W5N A;  3KLG A;  1X3M A;  3PIO L;  5CR4 A;  5AQK A;  3PO4 A;  1NLV A;  1IKV A;  3ATV A;  3LAN A;  3NBP A;  5J2P A;  1NM1 A;  1N32 K;  3OYN A;  3RMC A;  4CEA A;  2UYT A;  1NK7 A;  1YI2 N;  5GAE P;  2D0B A;  4FK2 A;  4LY7 A;  3LM9 A;  1LV5 A;  1VQ8 N;  1QS4 A;  3ZSX A;  3B6P A;  1WBD A;  2F9W A;  1A5X A;  1LWF A;  3OYM A;  4A59 A;  1IBK K;  3PX6 A;  3S41 A;  2P9N A;  5F1X A;  4B3M K;  3VQ9 A;  2FBV A;  4CJ7 A;  3MXM A;  4JI4 K;  4DKW A;  3V9X A;  1YF5 L;  1BIS A;  3KK1 A;  1JLB A;  5KI6 A;  1D4X A;  3SBT A;  5AQQ A;  4Z94 A;  1CZB A;  3PO5 A;  1LAW A;  1XNQ K;  3DJC A;  1QVF M;  1LWC A;  1ZBF A;  3CYM A;  4FJN A;  1O1W A;  1MWM A;  2OTL N;  4K8X A;  1W9H A;  3CI5 A;  3QB0 A;  4OPH A;  5HRR A;  3HL8 A;  3SZ2 A;  4DUZ K;  2QKK A;  3SV3 A;  4B8A B;  2O8C B;  3KWI A;  2GBZ A;  3R1X A;  4B9L A;  3CJA A;  3MCP A;  5AFU H;  1FJG K;  4CJ3 A;  1IKW A;  2CGK A;  5CE3 A;  1QHT A;  1GLC G;  1NGE A;  3DM2 A;  4CZF A;  4M63 C;  4FLW A;  1Q7Y O;  4BR4 A;  3H1Q A;  3HOS A;  4JI2 K;  1S72 N;  5BN9 A;  1W0H A;  1S9G A;  3TAF A;  3MXI A;  2HHH K;  2HMP A;  4KHU A;  1SL0 A;  4IG3 A;  3A5L C;  5SZT A;  3OHR A;  3C65 A;  4LF9 K;  5CHI A;  2NUB A;  4HCB A;  1NKE A;  4IWV A;  1BUP A;  3P1G A;  3WXL A;  1NGB A;  4JKC A;  4DUY K;  4DSJ A;  5AZI B;  3CQ8 A;  4CCH A;  4OJR A;  3CPW M;  3TAR A;  5JIC A;  4AM6 A;  4CF0 A;  4DQI A;  5C15 A;  3DRR A;  1ASW A;  1RT7 A;  2B4J A;  4DR6 K;  1VQO N;  2QK9 A;  3NCI A;  2GEM A;  4EP5 A;  1KRP A;  2PAV A;  2QWQ A;  4B1U B;  2P1J A;  4AHS A;  1VQ4 N;  3C6T A;  3SQ2 A;  2GWJ A;  1SV5 A;  4C8L A;  2G8F A;  4Z4E A;  5BRD A;  3CJC A;  2HNZ A;  3G4S N;  4H0Y B;  4RWT A;  4DTR A;  2GUP A;  4BR9 A;  2XY8 A;  4FJH A;  1KCF A;  4FW2 A;  4BG9 A;  3DLG A;  4E89 A;  2HST A;  1S1W A;  2P9I B;  4YOX A;  2KHO A;  5JS1 A;  4OLA A;  4CJW A;  3QO9 A;  3HK2 A;  1KC8 O;  4LFC K;  4CW7 B;  3FZF A;  4H03 B;  3NVK A;  4EIA A;  3LDN A;  3C94 A;  2PZS A;  3CFP A;  2D0O A;  4H8K A;  4IZ9 A;  5EU7 A;  4F2R A;  3CFO A;  3HOT A;  4O4G A;  2F4V K;  4CK3 A;  4RG8 A;  3BEX A;  2CH5 A;  1ZBL A;  1Q9Y A;  4BRE A;  5CYM A;  4KI6 A;  3CC4 N;  3N4Q A;  2XY7 A;  3MDQ A;  3SYZ A;  1YTU A;  4DCH A;  3WXI A;  3PSI A;  3BF1 A;  3HTV A;  1CLQ A;  3TAE A;  1QE1 A;  4FZY A;  2QA4 N;  4O8K A;  3CME N;  1GLJ O;  1R59 O;  4RW6 A;  1RGI A;  3ZSY A;  3AAQ A;  3LZI A;  5EVZ A;  1KQS M;  4PHT X;  4F9O A;  3IKM A;  5BRH A;  3D2E B;  1XC3 A;  4CFC A;  3L2R A;  1DKG D;  3UKU A;  5AZJ B;  5B8H A;  4ISE A;  1RTJ A;  4O44 A;  4CEC A;  4DHY A;  2ZM6 K;  4C1N K;  3VEN A;  1Q18 A;  4WFN L;  4I9Q A;  4JK8 A;  3MXJ A;  3TAP A;  5F0X A;  2A6A A;  2F8T A;  4KPY A;  2KFZ A;  1XNR K;  3P83 D;  1HQE A;  4JI6 K;  1SKR A;  3VET A;  2P9S B;  1DGK N;  1RBR A;  1T8E A;  2Z1G A;  4FXD A;  3GBT A;  3AV9 A;  2NRW A;  2D0A A;  1Q9X A;  1NWK A;  1RFQ A;  4H5N A;  1REV A;  4KRE A;  3VES A;  3CJ7 A;  4NXM K;  4CZK A;  1KLN A;  3B8A X;  2P9P B;  4JI0 K;  3HRG A;  5LJV A;  3FFK B;  1YJN N;  3NVM A;  4GKJ K;  3U4L A;  2QWP A;  5AZI A;  2NRV A;  3DRP A;  3RSE B;  4GVM A;  4FCY A;  5E41 A;  3FZK A;  3OW2 M;  5FLX O;  3UIQ A;  4W5O A;  3ZT2 A;  3EZ5 A;  2O8B B;  3A8Y A;  4NYF A;  3BGR A;  3NH0 A;  4JN4 A;  3QFU A;  3HZ6 A;  2QXF A;  1R0A A;  2V7Y A;  3OYF A;  4KHQ A;  1RBV A;  4NLB A;  1BL3 A;  2RPI A;  5KGW A;  5HP1 A;  4AQY K;  5M1F A;  3QES A;  1BO5 O;  1JLQ A;  3LP2 A;  4FOI A;  1J5O A;  4AH9 A;  3O9R A;  2KZM A;  3R8E A;  3K58 A;  4KB1 A;  5FRO A;  4I2Q A;  2BH1 A;  4KAZ A;  3HVR A;  3WXJ A;  1VSK A;  1OH6 A;  4DR3 K;  3DAW A;  4XH1 A;  3VQP A;  4DS5 A;  3NE6 A;  4C23 A;  5C10 A;  1U45 A;  1U6Z A;  2OZM A;  3AVM A;  4NCG A;  1EET A;  2QWM A;  3WNE A;  4DQQ A;  5LMN K;  4X64 K;  3J7A P;  2G8U A;  4M3U A;  2YNF A;  4BRQ A;  4BC4 A;  1T3V A;  3SNN A;  5CY4 A;  5GAD P;  4CEB A;  3VA0 A;  5GIP A;  1DLO A;  2E6L A;  4Q5V A;  1ATS A;  3LDO A;  2YKM A;  3L2V A;  3PLA A;  4ELV A;  3RMD A;  1E3M A;  1RTI A;  1FKP A;  3QBX A;  4E7K A;  2ITG A;  3HVT A;  4KTZ A;  4FSV A;  3ZSV A;  1NK4 A;  2VG6 A;  3GE1 A;  1YJ9 N;  2HVI A;  3CCE N;  2XO7 A;  1GLE G;  3SBG A;  2O4G A;  2CGL A;  3VQD A;  3RMA A;  3SQ0 A;  1TUU A;  4BY9 C;  3BZC A;  3RRH A;  3U6F A;  3ZSZ A;  3PV8 A;  2PY5 A;  4OKK A;  1VSE A;  4FWL A;  2C1I A;  4BRA A;  2BUP A;  5A2Q O;  4FO0 A;  4CIF A;  3UKR B;  3AVF A;  2IVP A;  1SL2 A;  3DXK A;  4JKF A;  3DLH A;  4FWS A;  4FVM A;  4AIL C;  4DV3 K;  4H0V B;  5AQH A;  1N5Y A;  2O4I A;  3HM8 A;  5I9E B;  1JLE A;  4H4M A;  3I33 A;  2W00 A;  1RIL A;  2ZGZ A;  4JNE A;  3OYC A;  3MN6 A;  4DR7 K;  2RF2 A;  3AO1 A;  4LD0 A;  1VSJ A;  5GIN A;  5F2R A;  2OPP A;  3L3U A;  3ZT3 A;  3AVL A;  1HLU A;  3ZSQ A;  3OJS A;  4HTU A;  4JYA K;  3SQ1 A;  2ZJQ L;  3G25 A;  3L2U A;  1SUQ A;  5AQI A;  2QI2 A;  1ZYQ A;  3THW B;  4E1N A;  2DY4 A;  4DTX A;  3TI0 A;  1OH7 A;  2RKI A;  4CHQ A;  4CD3 A;  3G10 A;  4BDZ A;  3TSP A;  2ETJ A;  4DFJ A;  3MWT A;  1ZC6 A;  4CE9 A;  2HB5 A;  4JD2 B;  4KH6 A;  5KGX A;  2Q0R A;  3E9P A;  1HNV A;  3A0I X;  4O55 A;  1YHQ N;  1BWF O;  4YOV A;  4KKO A;  5C12 A;  4CZG A;  1HJR A;  3ZT0 A;  4FPA A;  3KHY A;  4BRP A;  1H1V A;  3QML A;  5AQX A;  4O0J A;  2GUI A;  4QAG A;  4KTW A;  5AFU A;  2P5O A;  4E7I A;  3SPY A;  1N8R O;  2YI1 A;  3ZLJ A;  2QKB A;  3AVH A;  3EYZ A;  3OYB A;  3EE8 A;  1K6Y A;  2D0P A;  1NMD A;  4KI4 A;  2E88 A;  3OJU A;  4JRP A;  2WUS A;  3FZM A;  3PX0 A;  4JKG A;  1JLC A;  1YVU A;  4B3T K;  1B92 A;  4PA1 A;  2X6S A;  3V9S A;  5K14 A;  2UU9 K;  2JLE A;  3WEE B;  3LDL A;  4K41 A;  1C0U A;  1MWK A;  1MU2 A;  1OH5 A;  1IO2 A;  5AQM A;  5HL7 L;  4FLX A;  5AQF A;  1JKH A;  3O3F A;  3L2W A;  2P5G A;  1ASV A;  2OZS A;  1HNZ K;  4Z4I A;  1HPM A;  4ZHR A;  4Z4G A;  1VQL N;  1BIU A;  2ZQB A;  3DLB A;  1XHX A;  2KW4 A;  4LF5 K;  5AQT A;  3ENB A;  2V7Z A;  5KRS A;  2ZJR L;  5HRO A;  3QER A;  2YKN A;  5KPT A;  4BC3 A;  1NJI O;  1I3A A;  3K57 A;  4AHU A;  3L2Q A;  3HPG A;  5DK5 A;  3WNH A;  3F2K A;  3ZSW A;  3TWH A;  5M1Q A;  4U67 L;  1BGX T;  3FZH A;  4J2E A;  1TKX A;  3IS9 A;  3CCV N;  3ITH A;  3EL2 A;  3UKR A;  4CZE A;  3SAG A;  3ZX0 A;  5AQU A;  1MA9 B;  4FLT A;  3U3G A;  4N56 A;  4IJA A;  1YXQ A;  2XY5 A;  1NK8 A;  2GTD A;  4Z4H A;  4WCE L;  4YNQ A;  4F3T A;  4B1X B;  3NF6 A;  2HHW A;  1M1K O;  1CZA N;  3U9Z A;  1C1B A;  4EHT A;  3T19 A;  3KD1 E;  1BI4 A;  3K59 A;  3O3G A;  3HI0 A;  4NCA A;  3V4I A;  4CIE A;  4M3W A;  4BC2 A;  4IO9 L;  3VQA A;  4FLV A;  4B3R K;  5JMV A;  1RT2 A;  4DG1 A;  4CF2 A;  3THY B;  1FKO A;  3AA3 A;  1GLL O;  4OKJ A;  3AVC A;  3CC2 N;  2QWN A;  5ELZ A;  3O1W A;  4JRQ A;  3NH2 A;  4FWP A;  3VEO A;  4RCH A;  4FJ5 A;  4CJQ A;  1DT9 A;  5C2D A;  5C25 A;  2FBT A;  3O6W A;  1Y97 A;  4LF8 K;  1QZ6 A;  3THV A;  3O9U A;  3T1H K;  1S22 A;  4CBU A;  4C8M A;  4CHZ A;  1K8K B;  2PYJ A;  3S3O A;  3VF2 A;  1CXU A;  1EXQ A;  4DR2 K;  3LP3 A;  2DPN A;  3SJJ A;  2IS3 A;  1LW0 A;  2F96 A;  3UB5 A;  4L8R B;  3B6O A;  3TAB A;  4CHN A;  4KO0 A;  4EHU A;  3LDS A;  3D6R A;  3QIC A;  1WSG A;  4J2A A;  3TAQ A;  4CEZ A;  3RVC A;  4Z4F A;  1TK5 A;  1GOC A;  4ICL A;  4M45 A;  2G8I A;  3BDP A;  4BRL A;  4ZTJ A;  3THX A;  5AQR A;  3PUF A;  1HKB A;  3QEW A;  2Q31 A;  1HNW K;  4UY8 O;  4PKH A;  1Q86 O;  2HBK A;  1T6D A;  3T1Y K;  3NGI A;  3TTF A;  2VWB A;  3DLL L;  4HCC A;  4BWJ A;  4R79 A;  2KFN A;  5BN8 A;  1N36 K;  1X9W A;  4BGA A;  1W2B M;  1S1U A;  1JL1 A;  3O9T A;  1UWB A;  3VQ7 A;  1RT3 A;  3U3Y A;  3QEP A;  3DLK A;  4I6M B;  4CHY A;  4WFA L;  3VEZ A;  1CXQ A;  3QET A;  4BR7 A;  4NXN K;  2IVO A;  4PQU A;  2QW9 A;  1U48 A;  1IJJ A;  2KKZ A;  4DQ8 A;  4DV2 K;  3SUO A;  4DFP A;  2FSJ A;  1UAX A;  3DXM A;  5J2Q A;  2YNH A;  1SQK A;  3D2F B;  3LAK A;  4DU3 A;  4XEI A;  4DSF A;  1NMN A;  2HBL A;  1QZ5 A;  4IOX A;  3ENH A;  2WOM A;  2P9L A;  5MLC Q;  4YOU A;  5KQ8 A;  3JAM O;  3TR8 A;  3AGR A;  1NGF A;  1NGJ A;  3THY A;  1QQO A;  4Y1D A;  1B9F A;  3KK7 A;  1CZ9 A;  3HPO A;  3NAE A;  4B1Z A;  2E2Q A;  1WAF A;  3MEC A;  4BE0 A;  1U49 A;  3MAQ A;  1C0G A;  1BA1 A;  3EZW A;  4JHD A;  2YHB A;  3H08 A;  3KLF A;  4Z4C A;  5CZ1 A;  5AQP A;  5D3G A;  1QSY A;  3ZT1 A;  4PL8 A;  4ID1 A;  1V4S A;  4JS5 A;  1C0M A;  4RW7 A;  4DLG A;  1EX4 A;  1K8K A;  4CJK A;  1U2V A;  5HRN A;  4ELU A;  4FJ8 A;  2YCH A;  5JS2 A;  2OPQ A;  4CEQ A;  1T03 A;  3OYA A;  1TYQ A;  3H45 C;  5AQW A;  2ZF5 O;  1SKW A;  1YUW A;  5LY3 A;  1NJW A;  2VGM A;  4EZ6 A;  3OYG A;  1RDB A;  1I39 A;  2VCP A;  1KAZ A;  3DRS A;  2I5J A;  3KZB A;  4LH5 A;  1F21 A;  2A41 A;  5J2M A;  2HHS A;  1WLJ A;  2AJQ A;  2WTU A;  3ZT4 A;  1DEJ A;  1VAZ A;  2OTJ N;  5EXW A;  1IH7 A;  2F7T A;  3G6E N;  4KV8 A;  1WNS A;  2F9T A;  2Y1J A;  3I55 N;  1IKY A;  3L6Q A;  3VGM A;  4H5W A;  3RR7 A;  4LFB K;  4BC5 A;  4G9Z A;  1RDU A;  2O8E B;  2FSK A;  3TSQ A;  4GY2 B;  2VG7 A;  2W6L A;  4K8Z A;  4MLE A;  2FLO A;  3TAG A;  3OYI A;  3ULE B;  4CGG A;  1D9F A;  1NGH A;  4CVN E;  4AHC A;  2Q3S A;  2E8A A;  4DTJ A;  1WSI A;  2A42 A;  3LWM A;  4KBO A;  1BU6 O;  4DTN A;  2HVH A;  4JKE A;  5AQN A;  2O8C A;  1RDA A;  3HSC A;  1NK0 A;  4B9Q A;  4KHP K;  1L3S A;  5FRM A;  3SLC A;  3ENO A;  2XY6 A;  3CC7 N;  5M1O A;  2KZZ A;  5J1E A;  4N47 A;  2X6N A;  1WSF A;  3W3D A;  4K0K K;  2IVN A;  1NGG A;  1WOQ A;  2ZD1 A;  3SK3 A;  4IFV A;  4FJ9 A;  3QBW A;  5LMU K;  1KAX A;  5GIO A;  4M3R A;  4DU1 A;  1DTQ A;  4LFA K;  2A40 A;  3MEE A;  5DMR A;  3NGY A;  1TKZ A;  1QQM A;  1NOZ A;  4DFK A;  3AA4 A;  1VQK N;  2XRI A;  5HBM A;  3RMB A;  4I9L A;  2UXC K;  2O8F B;  3GOI A;  3VTH A;  2VG5 A;  3FR0 A;  4H0P A;  4XIU A;  1OVQ A;  4JS4 A;  3I56 N;  5AQG A;  4H5T A;  1VQN N;  4A5B A;  3J7Y P;  3MEG A;  3KLH A;  2IDO A;  3ID8 A;  1Q82 O;  4B1W B;  3OA9 A;  3OS0 A;  2HND A;  1JCF A;  1BQM A;  4QS9 A;  4BRD A;  3S3N A;  2HHI A;  3E9L A;  5C0Y A;  1YJW N;  1LAV A;  1KFS A;  3H6E A;  1X9S A;  3CPE A;  2P9I A;  4WQ5 A;  3NH1 A;  3SAF A;  1L3U A;  4K43 A;  4DF4 A;  4F2S A;  2BDP A;  4CJT A;  1HRH A;  2G8H A;  4OLB A;  3SJH A;  4BR2 A;  1TGO A;  1IBL K;  2B5J A;  4MFB A;  4HUG A;  1BIZ A;  3EEQ A;  5M1P A;  3A2F A;  4EP4 A;  4IEE A;  4KTQ A;  4FJ7 A;  1NBW A;  1S6P A;  4B1V A;  4B9U A;  2E2O A;  4OPA A;  2QWR A;  3T3F A;  3RR8 A;  2WBN A;  2E1Y A;  3DI6 A;  3NF7 A;  4FL9 A;  2F8S A;  1RTD A;  4ILH A;  1ATN A;  3CF5 L;  4DTS A;  3MCA B;  2W40 A;  4JKH A;  3CQY A;  4LF6 K;  2ZJP L;  1KAY A;  2A1R A;  2OPR A;  3OYL A;  4BRO A;  3VA3 A;  4CF9 A;  3OY9 A;  1JCE A;  1VSH A;  3AVG A;  1ITG A;  4DSI A;  3D2E A;  3ULE A;  4JI3 K;  3TTC A;  3WUH A;  3LAL A;  3I0S A;  5AZJ A;  3S3M A;  4JEP A;  2Z1I A;  2BGG A;  3E1Y A;  5AR0 A;  1WSJ A;  3S5T A;  2Q36 A;  2NLX A;  3L0Q A;  3F9K A;  5BRF A;  4YOY A;  3IFR A;  4DTO A;  1TV6 A;  4DQS A;  4N76 A;  2P9S A;  4BE1 A;  4ZTF A;  1KVA A;  2OYQ A;  5EY4 A;  5LL6 Z;  3V1R A;  1VQ6 N;  1RBT A;  5KQD A;  2GX9 A;  2W6K A;  1T7P A;  4IG0 A;  4BR0 A;  1JCG A;  1KFD A;  3CIP A;  3EY1 A;  4RW9 A;  2GV9 A;  4H0O A;  3HP6 A;  4WYB A;  1D8Y A;  2P9P A;  4CJV A;  2E20 A;  3ZSR A;  3VEY A;  3G71 N;  1NJZ A;  4GW6 A;  5M1K A;  4QOZ B;  2QEX N;  5AQY A;  1LOT B;  3P4I A;  4OGE A;  3K5N A;  3V6D A;  4OPK A;  4DV0 K;  3SAH A;  5C42 A;  4IFY A;  3RSE A;  4M42 A;  3QEX A;  3L3V A;  2DFF A;  4F8R A;  1VQP N;  3O9S A;  3VQ6 A;  2O8B A;  1YTA A;  3M8P A;  4CZH A;  1TAU A;  4M3T A;  3CCL N;  2C1G A;  2E6M A;  4CBX A;  2YNI A;  4DV7 K;  4DSK A;  4GV9 A;  1QVG M;  1J54 A;  1IV0 A;  4IFE A;  4JKD A;  1SL1 A; 
#chains in the Genus database with same CATH homology
 4RCH A;  1VQO N;  2GEM A;  5GAH P;  2PAV A;  2NZT A;  2QWQ A;  4B1U B;  1DT9 A;  5C2D A;  2A3Z A;  1VQ4 N;  4A57 A;  1EO1 A;  2GWJ A;  4CZL A;  5BRD A;  3CJC A;  3G4S N;  3CCQ N;  3O6W A;  4IXC A;  2GEL A;  4A5A A;  1QZ6 A;  4H0Y B;  4RWT A;  3O9U A;  4O8U A;  4FWO A;  3VF4 A;  3MWP A;  1S22 A;  2GUP A;  4BR9 A;  4CBU A;  4MLH A;  5DM6 L;  3C0B A;  3CCR N;  1K8K B;  4BG9 A;  1GLD G;  3VF2 A;  3A5N C;  4BG8 A;  4IEI A;  3VMF B;  3ATU A;  2DPN A;  2HST A;  2P9I B;  1BDG A;  1ZBS A;  2FF3 B;  4BVP A;  2KHO A;  4YOX A;  3CXC M;  5KPR A;  3UB5 A;  1LCU A;  3O80 A;  1KC8 O;  3PIP L;  4CZI A;  4MO4 A;  2PFU A;  4M7Y A;  3FZF A;  1WUA A;  3ID6 A;  4H03 B;  4ILJ A;  4EHU A;  3NVK A;  4IOA L;  4EIA A;  2H3G X;  3LDN A;  4EFH A;  3L4Q A;  3C6A A;  3D6R A;  3QIC A;  2D0O A;  5E26 A;  1C0F A;  4IZ9 A;  3U9D A;  3LDP A;  5AQV A;  3AGK A;  3RVC A;  4IDH A;  3HOT A;  2YJF A;  3OBY A;  2YX6 A;  1P8Z A;  2CH5 A;  3BEX A;  3KWG A;  4FWK A;  1M90 O;  4BRE A;  2Q2R A;  4BRL A;  3CC4 N;  3N4Q A;  1V4T A;  3MDQ A;  5FPD A;  3W0L A;  1E4G T;  5AQR A;  3WXI A;  4DCH A;  3TPQ A;  1G99 A;  2NRH A;  3BF1 A;  3HBT A;  1HKB A;  2I7P A;  3HTV A;  5LJW A;  3GL1 A;  3EKS A;  2Q31 A;  2QA4 N;  4PKH A;  4UY8 O;  5JVG L;  3C6H A;  4O8K A;  4JKG B;  3O4W A;  2HBK A;  1Q86 O;  3CME N;  1GLJ O;  1T6D A;  3E66 A;  4JKA A;  1R59 O;  3ZET A;  3TTF A;  2VWB A;  2W41 A;  4JKB A;  1RGI A;  4XJX A;  2YHW A;  3U8X A;  3AAQ A;  3E9O A;  5EVZ A;  3DLL L;  4CZJ A;  1KQS M;  4PHT X;  4R79 A;  4F9O A;  5EOY A;  3IKM A;  5BN8 A;  5BRH A;  3CCS N;  3D2E B;  1XC3 A;  1DKG D;  3UKU A;  4YDU A;  4BGA A;  5AZJ B;  5B8H A;  2HF4 A;  3BUZ B;  3IDH A;  4ISE A;  4BR5 A;  1W2B M;  2A5X A;  2VYP A;  3Q7B A;  4DHY A;  1KD1 O;  3LDQ A;  4C1N K;  3O9T A;  3VEN A;  3VOV A;  3J7Z O;  3R3L A;  1BA0 A;  2Q1N A;  4BE7 B;  1Q18 A;  3M6G A;  4ISF A;  4WFN L;  4JK8 A;  4I6M B;  2P9N B;  4WFA L;  3VEZ A;  4NO7 A;  5F0X A;  2A6A A;  4BR7 A;  2NRZ A;  2IVO A;  3WQU A;  2WFB A;  2QW9 A;  1IJJ A;  2KKZ A;  4GVE A;  3TU5 A;  3MK6 A;  5GAG P;  3TTD A;  4O5F A;  3VET A;  4DQ8 A;  2P9S B;  1DGK N;  1Z6R A;  5FPE A;  4BRI A;  3GBT A;  4ILG B;  2FSJ A;  3CD6 N;  1NGD A;  3M1F A;  5EX5 A;  3CCU N;  2NRW A;  3DXM A;  5E84 A;  1VQ9 N;  2VGN A;  1SQK A;  1HX1 A;  3D2F B;  5BPL A;  4QS8 A;  2D4W A;  3EKU A;  4XEI A;  1NWK A;  2NRX A;  1RFQ A;  2HBL A;  4H5N A;  1QZ5 A;  4IOX A;  3ENH A;  4HTL A;  4BRC A;  3VES A;  2P9L A;  1KXP A;  3CJ7 A;  3CJB A;  4YOU A;  5AQJ A;  3KVG A;  4QS7 A;  3B8A X;  3CQX A;  3ZX2 A;  4CZK A;  5KQ8 A;  2ITM A;  1XUP O;  2P9P B;  3AGR A;  5HOO A;  1NGF A;  3HRG A;  5LJV A;  3FFK B;  1ATR A;  1NGJ A;  1SAZ A;  3SMP A;  1YJN N;  5AQL A;  3NVM A;  4BVO A;  1QQO A;  3GG4 A;  2WC9 A;  3SMS A;  1OVY A;  2P9U B;  3KK7 A;  3U4L A;  1SZ2 A;  2FXU A;  2QWP A;  5AZI A;  2NRV A;  4B1Z A;  2E2Q A;  1NGI A;  2KLA A;  1C0G A;  3RSE B;  1BA1 A;  3EZW A;  2AA4 A;  4JD2 A;  4JHD A;  3VEW A;  1YAG A;  2NRR A;  3FZK A;  4MO5 A;  3OW2 M;  1HKG A;  4BRH A;  5AQP A;  2V51 B;  3ZEU B;  3A8Y A;  5C2F A;  3CCJ N;  3NMU A;  4PL8 A;  4JN4 A;  3QFU A;  1W97 L;  1V4S A;  3P38 A;  1Y64 A;  2OAN A;  2D1K A;  3HZ6 A;  3R9P A;  3C7N B;  2V7Y A;  3GDQ A;  3CET A;  4YDU C;  1NGC A;  4NLB A;  3A5O C;  4PKI A;  3AAP A;  4U7B A;  5M1F A;  1K8K A;  1BO5 O;  4FOI A;  1U2V A;  3VGL A;  2E1Z A;  3O08 A;  4CZM A;  2YCH A;  3P31 A;  5FPM A;  2YHX A;  4WF9 L;  4IJN A;  1TYQ A;  3O9R A;  3T69 A;  3H45 C;  3R8E A;  5AQW A;  4BRF A;  2ZF5 O;  1NGA A;  4YOT A;  3D7E O;  1XQS C;  1EQY A;  2BH1 A;  1GLF O;  5M1N A;  4MDA A;  1YUW A;  5AQZ A;  3WXJ A;  4A62 A;  5LY3 A;  2VGM A;  5ADX A;  3CHW A;  4CI6 A;  2NRT A;  3DAW A;  4XH1 A;  4OO1 J;  3J8A A;  3O9Q A;  2VCP A;  1Z05 A;  3FZL A;  1KAZ A;  3A5M C;  4C23 A;  2FF6 A;  4BQZ A;  3LL3 A;  3KZB A;  5C10 A;  2CGJ A;  1U6Z A;  3WEE A;  2FSN A;  4GV6 A;  2A41 A;  2QWM A;  4MDB A;  2P9K B;  1DEJ A;  1VAZ A;  2OTJ N;  5EXW A;  2F7T A;  3G6E N;  4A61 A;  4FWR A;  4XH4 A;  2Q0U A;  2F9T A;  3I55 N;  5FPN A;  3L6Q A;  3VGM A;  3K9J A;  4BRQ A;  1T6C A;  4H5W A;  4BC4 A;  1T3V A;  3QFP A;  4RTF D;  4BC5 A;  4BGB A;  4G9Z A;  3ZYY X;  5GAD P;  1RDU A;  1SS6 A;  5BPN A;  4PKG A;  2QWO A;  3EO3 A;  5BR9 A;  3L4I A;  2HBM A;  2FSK A;  2YHY A;  3TSQ A;  1X9J A;  4GY2 B;  2ZGY A;  4HWI A;  1GLB G;  2ASM A;  4LC9 B;  4MLE A;  3MX2 A;  4EAH D;  2FLO A;  1ESV A;  3IUC A;  4PL7 A;  3VGK A;  5GIP A;  2I7N A;  3ULE B;  1ATS A;  4H0T B;  3LDO A;  3PLA A;  2HF3 A;  1NGH A;  4KH5 A;  4Y0W A;  4L3Q A;  2E8A A;  1K73 O;  2A42 A;  4KBO A;  1BU6 O;  3P39 A;  4FWN A;  3QBX A;  1K9M O;  2BTF A;  3O1B A;  4JKE A;  5AQN A;  3HSC A;  3K9K A;  2NNW A;  4B9Q A;  5KPZ A;  3SLC A;  3ENO A;  4FSV A;  3CC7 N;  4BRN A;  3GE1 A;  2AP1 A;  4WFB L;  3R6M A;  5M1O A;  1YJ9 N;  1K8A O;  3CCE N;  3H1V X;  1GLE G;  3SBG A;  3W3D A;  2CGL A;  4DB3 A;  2ZWH A;  2IVN A;  2PBD A;  3WXM B;  2E2P A;  2JWL A;  1TUU A;  4BY9 C;  3F5T A;  4ISG A;  3UKU B;  1VQM N;  5ADX H;  5TKY A;  3MN7 A;  1NGG A;  1WOQ A;  4H0X B;  3SK3 A;  2HOE A;  4M7X A;  3QBW A;  4XH5 A;  1X3N A;  2Q97 A;  4K25 A;  1HJO A;  4FWL A;  2C1I A;  4BRA A;  4NLC A;  3CMA N;  2BUP A;  2GWK A;  3FGU A;  1T44 A;  4FO0 A;  3WT0 A;  5MLC Q;  1VQ7 N;  1KAX A;  5GIO A;  3UKR B;  2A40 A;  3MX5 A;  2IVP A;  1QQM A;  3DXK A;  4JKF A;  4IOC L;  1VQK N;  3MN9 A;  3H3N O;  4FWS A;  4JK9 A;  4FVU A;  4H0V B;  5AQH A;  2P9U A;  5JVH L;  3AAR A;  3HM8 A;  3JXU A;  5BRE A;  5I9E B;  3OBW A;  3GOI A;  3MMV A;  3VTH A;  4H0P A;  3FR0 A;  3I33 A;  2W00 A;  1O13 A;  3I8B A;  1E4F T;  3DXM B;  2ZGZ A;  3I56 N;  2HBJ A;  5AQG A;  4JNE A;  3MN6 A;  4AM7 A;  2V52 B;  3F9M A;  4H5T A;  1VQN N;  4A5B A;  4CD1 A;  5GIN A;  4GV3 A;  5F2R A;  3ZEU A;  1GLA G;  3AY9 A;  1HLU A;  5JLH A;  4YOW A;  2P9L B;  4KH4 A;  3JS6 A;  4J8F A;  2ZJQ L;  3G25 A;  3ID8 A;  1S3X A;  4FWQ A;  4C1N I;  5AQI A;  3VTI A;  1Q82 O;  3C7N A;  2QI2 A;  3DWL A;  4B1W B;  3OA9 A;  1Q81 O;  4H5V A;  1JCF A;  4QS9 A;  4BRD A;  5BPM A;  3LM2 A;  1MDU B;  3O5B A;  4CD3 A;  2QXL A;  3E9L A;  1QHA A;  3EN9 A;  3TSP A;  5C0Y A;  1YJW N;  3MWT A;  1ZC6 A;  3EE9 A;  4FWM A;  4BQL A;  4BRG A;  4KH6 A;  3H6E A;  4JD2 B;  4JHD B;  2Q0R A;  3ZX3 A;  3E9P A;  3CPE A;  2P9I A;  4AF1 A;  4WQ5 A;  3SAF A;  4K43 A;  4FOE A;  2QWL A;  1OKJ A;  3A0I X;  3FLC O;  1YHQ N;  3VER A;  1BWF O;  4YOV A;  1HUX A;  1QQN A;  3BP8 A;  3SJH A;  3H46 O;  4BR2 A;  5C12 A;  4CBW A;  1TUY A;  1J6Z A;  3VF6 A;  4CZG A;  1JJ2 M;  5AQO A;  4K42 A;  3UE5 A;  2E2N A;  5M1P A;  4FPA A;  3KHY A;  5AQS A;  3VEV A;  2QTD A;  1H1V A;  4IEE A;  4BRP A;  1BOT O;  1U2V B;  3QML A;  5AQX A;  1NBW A;  1ZXO A;  4B1V A;  2E2O A;  3N4P A;  4OPA A;  1TYQ B;  2QWR A;  4JK7 A;  4YOR A;  1ILY A;  3M3Z A;  2WBN A;  2E1Y A;  5AFU A;  2P9K A;  1N8R O;  1RDW X;  4BEC A;  2YI1 A;  4FL9 A;  4ILH A;  1ATN A;  3CF5 L;  4WQ4 C;  3MCA B;  1X3M A;  2W40 A;  3WQT A;  3PIO L;  3EE8 A;  4JKH A;  3CQY A;  5CR4 A;  5AQK A;  2ZJP L;  2D0P A;  1NMD A;  2E88 A;  1NLV A;  3ATV A;  1KAY A;  1NM1 A;  5JLF A;  2WUS A;  3FZM A;  4JKG A;  4BRO A;  2UYT A;  1JCE A;  2IIR A;  5DM7 L;  1YIT N;  1YI2 N;  5GAE P;  5H1S Q;  3WEE B;  3LDL A;  4K41 A;  1VQ5 N;  4H5R A;  1MWK A;  3O8M A;  3LM9 A;  3D2E A;  5AQM A;  3ULE A;  5HL7 L;  3CCM N;  3TTC A;  3WUH A;  1VQ8 N;  4E1J A;  5AQF A;  2ASO A;  5AZJ A;  4JEP A;  2F9W A;  1HPM A;  3MN5 A;  1VQL N;  1HKC A;  3E1Y A;  3Q7C A;  5AR0 A;  4A59 A;  3S41 A;  5AQT A;  4BRM A;  4I6M A;  2P9N A;  2Q36 A;  5F1X A;  3ENB A;  2NLX A;  2V7Z A;  3L0Q A;  4CJ7 A;  5BRF A;  2ZJR L;  3VEX A;  2YJE A;  4NB4 A;  5KPT A;  4DKW A;  4BC3 A;  1YF5 L;  4WQ5 C;  2ASP A;  3IFR A;  3ZET B;  4YOY A;  1NJI O;  4B1Y B;  1D4X A;  3SBT A;  5AQQ A;  3CER A;  3T7Z A;  3BF3 A;  4Z94 A;  2P9S A;  3F2K A;  4BRK A;  3DJC A;  3FE1 A;  1QVF M;  5M1Q A;  5EY4 A;  4U67 L;  1VQ6 N;  3H3O B;  5KQD A;  3FZH A;  1MWM A;  3D2F A;  2GX9 A;  2OTL N;  1IG8 A;  3CCV N;  3CI5 A;  3QB0 A;  4OPH A;  4BR0 A;  1JCG A;  3SAG A;  3CIP A;  3EL2 A;  3UKR A;  4CZE A;  3ZX0 A;  4IO8 A;  4H0O A;  3KWI A;  1MA9 B;  5AQU A;  1BG3 A;  1YVN A;  4IJA A;  1YXQ A;  3R1X A;  4WYB A;  5TKW A;  2P9P A;  3CJA A;  2E20 A;  3MCP A;  5AFU H;  4WQ4 A;  3M5R A;  3VEY A;  3G71 N;  2GTD A;  5M1K A;  4WCE L;  2CGK A;  2QEX N;  5AQY A;  5CE3 A;  4B1X B;  1LOT B;  2J4R A;  1GLC G;  1M1K O;  1CZA N;  1NGE A;  3P4I A;  3U9Z A;  4EHT A;  4CZF A;  4M63 C;  3SAH A;  1Q7Y O;  4BR4 A;  3H1Q A;  2RE2 A;  3HI0 A;  3RSE A;  3HOS A;  2RHK A;  3TSU A;  3CJ1 A;  2JWK A;  1S72 N;  5BN9 A;  4BC2 A;  4IO9 L;  1VQP N;  3O9S A;  1YIJ N;  2HMP A;  3A5L C;  5JMV A;  3OHR A;  3DXK B;  3C65 A;  4CZH A;  4FPB A;  5CHI A;  2CH6 A;  3CCL N;  2C1G A;  4IWV A;  3WXK A;  1BUP A;  3VPZ A;  1P90 A;  3WXL A;  1NGB A;  4A2A A;  4CBX A;  4JKC A;  4JAX A;  4A2B A;  4BEB A;  1GLL O;  3CJ9 A;  5AZI B;  4GV9 A;  3QDK A;  3CC2 N;  3IMX A;  1QVG M;  2QWN A;  2QM1 A;  4GNI A;  5ELZ A;  3O1W A;  4IFE A;  3CPW M;  4JKD A;  4FWP A;  2EWS A;  4AM6 A;  5JIC A;  5C15 A;  3VEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...