3W3DA

Crystal structure of smooth muscle g actin dnase i complex
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
374
structure length
373
Chain Sequence
EEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin, gamma-enteric smooth muscle
publication title Refined structure and solvent network of chicken gizzard G-actin DNase 1 complex at 1.8A resolution
rcsb
total genus 122
structure length 373
sequence length 374
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3w3dA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3w3dA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3w3dA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3w3dA04
1YAGA 5EVZA 4EIAA 2F9WA 1GLJO 2QWQA 2E88A 3CJBA 3VERA 2GWKA 5AQQA 2I7PA 3U8XA 1BWFO 5AQHA 3ULEA 5AQWA 4CD1A 2YI1A 1XUPO 1U6ZA 3O4WA 4CZMA 1V4TA 3HZ6A 4JHDA 4BRKA 2YJFA 4IJAA 2GELA 3ATUA 4BRNA 5KPZA 4CZIA 3QB0A 4BQZA 2ASOA 1NGGA 3BEXA 3ULEB 1HKCA 3SLCA 2PAVA 2NRHA 3CIPA 3R9PA 4BR9A 4BR0A 3LDNA 5LY3A 4JHDB 4MLHA 4NB4A 1DEJA 4PKIA 4BRHA 3IUCA 4WQ4A 1KAZA 5ADXA 2IIRA 2AP1A 5BPLA 2J4RA 3WQUA 3CETA 2WUSA 5AQSA 1NWKA 2E2PA 3ENOA 3QICA 3AARA 3G25A 4JN4A 3VF4A 2D0OA 2Q1NA 3BP8A 4J8FA 1YXQA 2P9LB 5E26A 1C0GA 3MCPA 3A5NC 5AQVA 3ENHA 3VGMA 3WEEA 1MA9B 4I6MA 3H3NO 3OHRA 3I8BA 3M6GA 4IZ9A 3F9MA 4EFHA 1X3MA 3FZLA 1U2VB 4XEIA 4BRCA 4B1WB 5FPNA 4M7YA 2E1YA 4BRQA 3WEEB 4DQ8A 2CH5A 1KAXA 5BRHA 3GG4A 4YDUA 3VF6A 3GL1A 3O1BA 3CJAA 1BA0A 4H0TB 3H1VX 4H0PA 4BRAA 4NO7A 4CZLA 4FPBA 2Q31A 5AQKA 4IJNA 4ISFA 5I9EB 2YHYA 5KQDA 4XH5A 3WT0A 4BC5A 3WXLA 1NGFA 3AAPA 3QBXA 3P4IA 1GLCG 5KQ8A 2W41A 1E4FT 2HMPA 5F2RA 5BN9A 1SQKA 4FWNA 3VEVA 3O8MA 2F9TA 4BQLA 4K42A 2GTDA 3FZFA 4CI6A 2P9NA 2P9UB 4C23A 5AR0A 2D1KA 2PBDA 4BRPA 1K8KB 4KBOA 5AQFA 4B1UB 4BGAA 3O08A 4BREA 1X3NA 2A3ZA 4RWTA 4RTFD 4B1YB 3A5OC 5B8HA 4JNEA 3KZBA 3QMLA 1HKBA 1KXPA 3WXKA 2FF3B 3H3OB 3ZETA 5E84A 3RSEA 1DGKN 2Q2RA 3AY9A 5EX5A 4H5NA 4XH4A 1GLFO 3LDQA 2CH6A 3QBWA 1NGJA 3QDKA 4CZEA 3MDQA 5AZJA 3FZMA 5BRDA 3ATVA 1MWKA 3D2EA 3KHYA 5F0XA 3BF1A 3FGUA 3VPZA 3VEOA 3FLCO 5EOYA 3RSEB 3O6WA 1NGAA 4IO8A 3QFPA 1T44A 4F9OA 3A0IX 5AQIA 2QWNA 3ZX2A 3CJ7A 4FOIA 5AQZA 4MLEA 2E20A 3D2EB 2Q97A 1MWMA 4BRDA 4M7XA 4CZKA 3DXMA 4FWSA 4B1XB 2NLXA 4H0YB 2GWJA 2E2OA 4M63C 3M1FA 3VETA 3QFUA 1KAYA 4JAXA 2D4WA 3R6MA 3CJ1A 5FPMA 4A61A 5AFUA 3CQXA 2QW9A 1GLBG 3DXMB 3LDPA 1S3XA 5LJVA 4EHTA 5JLHA 2H3GX 2A42A 3CJ9A 2P9SA 3B8AX 5AQPA 5CE3A 2IVNA 3L4IA 4FWKA 4PL8A 3O80A 1ESVA 1EQYA 2A6AA 5AFUH 4BC4A 3LL3A 1XC3A 2VYPA 1HUXA 3CHWA 3SMSA 2E1ZA 1HX1A 3BUZB 2P9SB 1IG8A 3HSCA 1TYQA 3MN6A 3UKRA 1T6CA 1Y64A 5ADXH 3MMVA 1ZBSA 2YHWA 4CBXA 4PKGA 4JD2A 3CQYA 1H1VA 3C7NA 4BRLA 1RFQA 4ISEA 3WXJA 3UKUA 1D4XA 4B1ZA 2ASPA 4CBUA 2Q0UA 1TYQB 4FPAA 3UKRB 2P9PA 2CGJA 1C0FA 1ZXOA 4BRIA 5BPMA 3MN7A 4CZGA 3ZEUA 1NGHA 1NGCA 4I6MB 4JD2B 4QS7A 4EHUA 5AQYA 3SMPA 1J6ZA 1RDWX 3UKUB 3LM2A 3ZX0A 3GBTA 4WQ5A 5AQNA 4K43A 3U9ZA 1QQOA 3ZEUB 4AM6A 1JCFA 3LDLA 5AQGA 1QQMA 5FPEA 4H0XB 3I33A 2CGKA 4H0VB 4AM7A 2HOEA 3D2FA 3LDOA 5KPRA 1QQNA 3IDHA 4WQ4C 4BRMA 4H03B 3DJCA 3UB5A 4Z94A 4CZHA 3H6EA 4O8KA 5BREA 3L6QA 4FWQA 4BR4A 4BRGA 2E8AA 5AZIA 1XQSC 2E2QA 5AQOA 4BVOA 3CJCA 4CZFA 5BRFA 3D2FB 2P9IA 4IXCA 2P9NB 4CD3A 1MDUB 2BUPA 1JCEA 1NLVA 4MO5A 4CZJA 1YUWA 2V7ZA 3A8YA 2QWRA 1QZ5A 4B9QA 4H5RA 3EL2A 2I7NA 3VENA 3WXIA 1BG3A 1V4SA 1QHAA 4H5WA 1BO5O 1SAZA 4BGBA 4Y0WA 3SJHA 4BR5A 2UYTA 4A62A 4FWPA 3S41A 4BC3A 2A40A 3ZX3A 3ZETB 4BC2A 4FWLA 5BR9A 2QWLA 2Q0RA 2QM1A 2ZGZA 4BRFA 4BVPA 4PL7A 3D7EO 4DHYA 4B1VA 4HWIA 5AZJB 4GY2B 2FSNA 3A5MC 4CBWA 4DCHA 3VEXA 2CGLA 4BR7A 2QXLA 1BOTO 1Z05A 5AQXA 3EZWA 5AQMA 3EKSA 4FL9A 4H0OA 3TU5A 3FR0A 5BN8A 3U4LA 1TUUA 2BTFA 3DAWA 4EAHD 4DB3A 3EKUA 4CJ7A 2ZWHA 1SZ2A 1TUYA 3W3DA 2QWPA 1BU6O 2FF6A 2V7YA 1X9JA 4FWOA 3HM8A 3O5BA 1E4GT 2E2NA 3VESA 5TKYA 2QWOA 4PKHA 3FZKA 2FXUA 2Q36A 1QZ6A 3IMXA 5AQLA 2EWSA 3H45C 1BDGA 1NMDA 3HTVA 4E1JA 5JMVA 5FPDA 1BA1A 5ELZA 2QWMA 5F1XA 1YVNA 1OKJA 3FE1A 5AQRA 3JXUA 2P9LA 1GLLO 5AQUA 3L0QA 5AQJA 3VEYA 4QS9A 4ISGA 2ZGYA 3VF2A 3AAQA 1Q18A 4FWRA 4K25A 2IVOA 4HTLA 5EXWA 3MN9A 4FWMA 3H46O 2FSJA 2P9KA 1NGIA 1NGBA 3MK6A 3SK3A 3U9DA 3ID8A 3O1WA 2ITMA 1WOQA 4IWVA 3EO3A 2YHXA 3FZHA 2A41A 1U2VA 1R59O 2FSKA 3C7NB 2KHOA 1Z6RA 2YCHA 2VCPA 1WUAA 2P9KB 2P9PB 1G99A 4BG8A 3IFRA 3KVGA 4QS8A 4BR2A 3BF3A 4GNIA 2NZTA 2D0PA 3H1QA 3A5LC 4A2AA 5JICA 3M3ZA 5AQTA 5EY4A 1JCGA 4FSVA 2OANA 2VWBA 4H5VA 3TPQA 4RCHA 1BUPA 3WQTA 5KPTA 1P8ZA 3MN5A 1IJJA 3VEWA 3DXKA 2HF4A 2AA4A 4FO0A 1NGDA 1RGIA 3GDQA 2FLOA 4BROA 3UE5A 4BG9A 1HLUA 1GLAG 2DPNA 5JLFA 2A5XA 2P9UA 4WYBA 4L3QA 3WUHA 3J8AA 1ATRA 1LCUA 1T6DA 1K8KA 1NM1A 4O5FA 3DXKB 1NGEA 2W40A 3C0BA 3LM9A 1GLEG 5BPNA 2HF3A 5AZIB 3VOVA 1HJOA 2GEMA 1ATSA 1LOTB 2P9IB 3GOIA 3R8EA 2V52B 3VGKA 4LC9B 1CZAN 1NBWA 3CERA 3EN9A 4FOEA 2V51B 1GLDG 3HI0A 2ASMA 4YDUC 3VGLA 4MO4A 1S22A 4K41A 3DWLA 1HKGA 5LJWA 2YJEA 4H5TA 4WQ5C 3FFKB 1ZC6A 1ATNA 1HPMA 2IVPA 3CI5A 4XH1A 4A2BA 2ZF5O 2GUPA 3VEZA 3HBTA 3W0LA 3GE1A 1DKGD 3JS6A
chains in the Genus database with same CATH superfamily
4EIAA 4LF4K 1BL3A 1WB9A 4E19A 4CIFA 2E88A 4FJNA 4BECA 3OYNA 2BE2A 4N56A 3MAQA 4HUFA 1BWFO 3AVAA 2YI1A 4JS5A 4JHDA 1IBLK 3VTIA 4IJAA 1T8EA 4DSKA 4CZIA 2G8WA 3AO2A 3AGRA 3DRSA 3ULEB 3SLCA 2JGUA 4BR9A 1B9DA 2F7TA 5SWMA 2ITGA 2FC0A 3T1HK 1FW6A 4X62K 3TAPA 2XY8A 3VMFB 4BRHA 3G6EN 3PO5A 1NMNA 3AVLA 2J4RA 2E2PA 3ENOA 4GKKK 4ILHA 2Q1NA 3BP8A 3G4SN 4NXNK 3VQAA 1CXQA 3OTOK 1C0GA 3A5NC 4KKOA 1KLNA 1Q9XA 2JWLA 1VQPN 4PWDA 3WEEA 3HVTA 3C6TA 3S3MA 3TTDA 3KLGA 2PFUA 2HVHA 4WCEL 3VQ7A 4KTWA 3I8BA 1HYZA 1X3MA 4CEDA 1IKXA 4CEEA 4OKJA 1D8YA 4DFMA 5FPNA 4BRQA 3DM2A 2CH5A 4FJGA 3V9WA 5JS2A 3HOTA 4FLXA 2A1SA 4YDUA 3P1GA 2G8IA 1VSFA 5HBMA 3Q7CA 3VF6A 3ZT3A 4CERA 3CC4N 1TK5A 3O1BA 1HNWK 1W0HA 1BA0A 3DRRA 1SKRA 1YVUA 3H1VX 1U47A 1EXQA 3OYJA 4BY9C 4J2EA 2YHYA 5J2QA 4DTOA 2YNIA 3QBXA 4CHPA 3CCMN 3RRHA 1E4FT 2QXFA 3HL8A 4BQLA 4K42A 4CI6A 3FZFA 3OS0A 1Q9YA 4C23A 3AVCA 2PBDA 1RTJA 1K8KB 2R7YA 2GUIA 2YNGA 5AQFA 4DV4K 1X3NA 2A3ZA 1I3AA 4RWTA 4CVNE 1UA1A 3C94A 4B1YB 3RR8A 3KD5E 4PHTX 4FJ8A 3WNGA 2W00A 3HRGA 3ZETA 4J2DA 3BZKA 4JK8A 4J2AA 3VQDA 2ZM6K 3HPGA 4XH4A 3J7ZO 3LDQA 3QBWA 1L3SA 3MDQA 4JI1K 3D2EA 3L3VA 3FGUA 3VPZA 3VEOA 4H8KA 5T7BA 3RSEB 3O6WA 4DTXA 4KTQA 3AA3A 4F9OA 3CYGA 5AQIA 5DK5A 4FOIA 3LALA 5AQZA 4MLEA 2Q97A 1N5YA 3PX4A 2OCEA 3QFUA 4JKEA 4OGEA 4W5NA 1SUQA 4G1QA 5DM6L 1EKEA 3DXMB 1JLAA 2F4VK 2XY7A 3CMAN 3CJ9A 2W42A 2P9SA 2VWJA 3QNOA 3MCAB 5CE3A 1VQON 4B3RK 1ESVA 1EQYA 1X9MA 5AFUH 4KI6A 2YV0X 4DTJA 1QVGM 2GBZA 3HT3A 1X9WA 3SMSA 1UAXA 2E1ZA 4B9LA 3BUZB 2C1IA 3OYHA 1TYQA 3MN6A 5ADXH 1NG9A 4CF2A 2O8FA 4CBXA 4PKGA 4JD2A 3CQYA 3AGKA 2O8BA 1NJIO 4M45A 3CQ8A 3DLLL 3UKRB 4EP4A 4Z4FA 3ZSVA 4CZGA 4ELVA 4DF4A 3BDPA 4Q5VA 1RTDA 3UKUB 3U9ZA 3ZEUB 3VQEA 4AM6A 1RDCA 5C10A 1XI1A 1Q8IA 1QQMA 5FPEA 4H0XB 4FLTA 3NF6A 3CCUN 4AM7A 3D2FA 4CJ3A 4M3RA 1QQNA 3IG1A 5FRMA 5C42A 3TAQA 1EETA 2OPPA 5BREA 4JI8K 4FJ5A 4Z4GA 5AZIA 4H4MA 3EY1A 3CJCA 3QERA 4M3WA 4JI0K 2P1JA 4IXCA 1VQ4N 4CHQA 3AO1A 3A8YA 4DTUA 2ATQA 1HNIA 4JI5K 1VSMA 4H5RA 2I7NA 3VENA 1TK8A 1KCFA 1BG3A 2WC9A 4AHVA 1BO5O 5CYQA 1ASUA 1DTTA 1LAVA 3E01A 3CG7A 4BR5A 3THXB 3SBTA 5JVGL 3S41A 1DTQA 2A40A 3V1RA 3NF9A 2YX6A 2QWLA 5BR9A 1J5OA 4DTNA 1S1TA 4CHZA 4RW8A 4PL7A 3G71N 4L8RB 4B1VA 4N76A 5AZJB 2FSNA 3A5MC 2DTUA 1HJRA 2YNHA 4DCHA 4AH9A 3QETA 4CEFA 4FL9A 3KLIA 3FFIA 1TKZA 3FR0A 5BN8A 2B4JA 3IKMA 1TUUA 1VQ6N 2BTFA 4EAHD 3KWIA 3VQ4A 4WFNL 4YOXA 1JL2A 3SNNA 3M5RA 3V9UA 2QWPA 1BU6O 4BE7B 4W5OA 4BEBA 1RT4A 5TKYA 2QWOA 1KQSM 4PKHA 2VGMA 5IWAK 1W97L 3SUPA 1EX4A 3NVMA 3CXCM 4DFJA 3IMXA 3H45C 1BDGA 1F21A 1O1WA 5C0YA 3NGIA 4E1JA 4F2RA 4FXDA 3F5TA 2FBXA 5JMVA 4Y1DA 4CJPA 3QINA 3VQ6A 5I42A 3P38A 3RMAA 1NJZA 4OVLA 3L0QA 2HMIA 2OA8A 2KKZA 5E41A 3HXMA 4OPKA 3MN9A 3H46O 3WNFA 3QLHA 1NGIA 4JI6K 3NAEA 3PSIA 3ZLJA 2ITMA 3EO3A 3K9KA 3AA5X 2VGNA 1R59O 2G8UA 4TSXA 2KHOA 2YCHA 4LSLA 4BDZA 4E0DA 2O8EA 1JL1A 2P9KB 2P9PB 1WAJA 1UOCA 4DS5A 3ZT1A 3JAMO 2NNWA 4DG1A 2UUBK 2VG5A 4BR2A 4GV6A 3O9QA 3ZSOA 4KFBA 5AQTA 4WFBL 5C2DA 2VWBA 4KH4A 2UXDK 4FJJA 2Z1HA 3VEWA 3OYAA 1VHXA 4AF1A 1RGIA 3GDQA 3CF5L 4BROA 3AVFA 3HVRA 1GLAG 4K0KK 2NRVA 1K8KA 3DXKB 2W40A 3C65A 5C2FA 3SYZA 1GLEG 1LWEA 4F4KA 4FVMA 2VWKA 5EU7A 3HPOA 1HJOA 2GEMA 3KD1E 1ATSA 3O9SA 1RTHA 1M90O 4IFYA 1RBRA 3NDKA 3R8EA 1A5VA 4LC9B 5CR4A 3NHGA 5KRTA 2Q3SA 4NLBA 3V9XA 4FOEA 4DSFA 3LP1A 1KD1O 1GLDG 3LZJA 3HI0A 4FLWA 2ASMA 4DQRA 1KFDA 3VQQA 2YJEA 2B5JA 1ZC6A 3F9KA 1ATNA 3EE9A 3VEZA 3HBTA 1DKGD 3QO9A 1RDUA 2F9WA 1VSDA 3CJBA 3E9PA 2I7PA 3C95A 1VSEA 2PYJA 4ID5A 3K5NA 5C24A 3O4WA 4E7IA 1V4TA 2YJFA 4E7LA 3ATUA 5KPZA 1QQCA 3MEDA 4ILGB 1HKCA 1JXBA 4M41A 4K8ZA 4KRFA 4ELUA 1ITGA 3R9PA 3NH0A 5HRRA 3LDNA 4FCYA 2FBTA 2YHAA 4CJUA 4CJSA 5HRPA 4DFPA 2ZJPL 3DLGA 5CZ1A 4Z0UA 3IUCA 4DMNA 1KAZA 2HHHK 2IIRA 3OYIA 5BPLA 1ASWA 4KI4A 1EP4A 5AQSA 3VF4A 3QICA 3AARA 4JN4A 4DU4A 4J2BA 3I0RA 1QE1A 4DR1K 1YXQA 2P9LB 1M1KO 3MCPA 3KLFA 1N34K 1KFSA 1XHZA 1HQEA 1RTIA 3ENHA 3MEGA 4NYNA 3VGMA 4B9VA 2HHXA 3PSFA 4WE1A 3VQ9A 1IO2A 3G10A 4LD0A 1S1VA 3M6GA 2RKIA 3FZLA 4CJVA 4XEIA 5MLCQ 3ZCMA 1EWRA 3OYGA 1KAXA 4F3OA 1R0AA 2X78A 1CZ9A 4G9ZA 4DV5K 2KFNA 4M42A 1FJGK 3U3YA 4H0TB 5JENA 4H0PA 4XIUA 4FLUA 4CZLA 5AQKA 4ISFA 3SAGA 5KQDA 4BC5A 3T3FA 1NGFA 3AAPA 1BIUA 4M3YA 3P4IA 3RVCA 2XHBA 3M8PA 3DLRA 4FWNA 4OPHA 2IC3A 3SQ0A 4KHPK 3L2WA 2UUAK 2P9UB 4KHSA 3EE8A 3PIOL 1IH7A 3CYMA 4KBOA 4B1UB 4GV9A 4CGIA 2IGIA 3SZ2A 1KVBA 3I56N 4RTFD 3L2UA 5B8HA 3KZBA 1HQUA 1HKBA 4CHOA 2E6MA 1TL1A 3K2PA 4B8CA 1DGKN 1REVA 3AVNA 1NGJA 2HSTA 4CEOA 4CCHA 5AZJA 3PX0A 1ZYQA 1MWKA 3AVGA 4CJFA 2RHKA 1W2BM 3FLCO 5HLFA 3K58A 4GKJK 4MQ3A 3QFPA 4JKHA 2XO7A 3RR7A 2QTDA 5CZ2A 4X64K 3AA2A 5M1OA 3E66A 3O4NA 4CJ5A 4FWSA 1Z26A 4M3XA 2NLXA 4H0YB 2GWJA 2E2OA 3DRPA 1TKTA 3VETA 1KAYA 2OPRA 1L3VA 3CQXA 2QW9A 1GLBG 3EEQA 1S3XA 5LJVA 3RWUA 2WONA 3OYMA 1ILYA 5JLHA 4NCAA 2A42A 1RT1A 2GX9A 4KH6A 5GADP 1W7AA 1QTMA 1VQKN 1HNZK 4KHWA 3ZSXA 1XMOK 3L4IA 3OYCA 4PL8A 4FZYA 2A6AA 4BC4A 3LL3A 1HUXA 1QSYA 1WSIA 1Y97A 4AQYK 5HROA 1IG8A 1L3UA 1VSHA 1HYSA 1ZBUA 1ZBSA 2UXBK 3KK3A 1T3VA 1NK5A 2HBMA 1H1VA 4N5SA 3R3LA 5KTQA 4DSEA 5J2NA 4ISEA 1QSLA 1D4XA 2Q0UA 4V19S 4DQPA 2P9PA 4BRIA 5BPMA 2PY5A 3O3FA 1WSJA 3V1QA 1Q86O 2YKMA 1HYVA 1WSGA 4B9MA 3NGZA 1NGHA 3LAMA 4I6MB 4FK4A 4QS7A 4YOYA 1CLQA 3LP0A 3PLAA 1VAZA 3KWGA 4U7BA 5AQYA 1YIJN 1RDWX 2OPQA 2VG6A 3LM2A 2GV9A 1N8RO 4WQ5A 3BGRA 4RW4A 5FRNA 4CIEA 4DSLA 3LDLA 5AQGA 1WBDA 1CZBA 4JKAA 1C0TA 4C1NK 1VQ5N 1U04A 1EWQA 1RBSA 4LFAK 1XHXA 3THWA 4H03B 4XJXA 4O55A 4DQSA 3H6EA 5M1PA 2OPSA 4PQUA 3CPEA 4LFCK 4BRGA 2E8AA 3C6AA 5AQOA 3DOLA 5HP1A 3TI0A 1RT7A 1VQ9N 2O8DB 4LFBK 3OS2A 4M3ZA 2P9NB 3HM9A 3H08A 1JCEA 4MO5A 3OW2M 3DOKA 1N6QA 4F8RA 4DTSA 1C1AA 4MDAA 1XNRK 1QZ5A 5LMNK 3AV9A 4B9QA 1K6YA 4JI7K 3TSUA 3WXIA 2O8CA 3QIOA 2G8HA 1SAZA 4RG8A 4KB0A 4Y0WA 3KK1A 3CCVN 4FWPA 4FM1A 4Z4CA 4CW7B 4LF5K 4JKGB 3ISNC 2ZGZA 5I3UA 4CF1A 2DFFA 3D7EO 4DHYA 5DMRA 4GY2B 3ZT4A 4BR7A 4QAGA 1BOTO 5AQXA 3EZWA 4QOZB 1S5JA 5AQMA 4JYAK 2JLEA 3ZSZA 3KJVA 1NKEA 1C1BA 4DV0K 3HP9A 2ZWHA 2P5GA 1N36K 1JKHA 4DLEA 3W3DA 1WSFA 4HHTA 2LSNA 3VESA 2WFBA 4HCBA 4FZZA 2FXUA 1JLBA 4EZ6A 4LY7A 2EWSA 3NVKA 1MU2A 3D0PA 3LZIA 4AHUA 4I2QA 2F8TA 2QKKA 4CF0A 5F1XA 4X66K 1YVNA 1OKJA 5AQRA 3PV8A 4DUYK 2P9LA 3VEYA 2BGGA 1EO1A 2ZGYA 4C1NI 4K25A 3MEEA 4OLAA 1NU0A 2WBNA 3V9ZA 5EXWA 4IBNA 4O4GA 2FSJA 1NGBA 4DU3A 3OBWA 1NJYA 3O1WA 1WOQA 4IWVA 2E6LA 2ETJA 3OYKA 2YHXA 3WNEA 3MWTA 1Z6RA 4NYFA 4Q0BA 4CK2A 3OYBA 3TTCA 3VQ5A 3IRXA 4LH4A 5SZTA 3BF3A 1TV6A 4O44A 1WBBA 5EY4A 5D3GA 3HK2A 1JCGA 2ZJQL 3F2KA 1KVCA 3V1OA 4YOVA 5KPTA 1P8ZA 1NK6A 3SBGA 4CK1A 5KGXA 1LWFA 2AA4A 4FO0A 4FLZA 1XMQK 2Y1JA 2FLOA 4RW9A 3RMDA 3TR8A 2DPNA 3HO1A 5KI6A 2P9UA 4JI2K 1ATRA 1HRHA 1YJWN 1CXUA 4HVJA 1YT3A 3E9LA 1FXXA 3NGYA 4IO9L 3DLKA 1NNEA 1BISA 1BHLA 3ZT0A 2YNFA 1B92A 5BPNA 3KLHA 3K9JA 1Z25A 2DFEA 3VOVA 2BANA 3SAHA 2Y1IA 3C6UA 3J7YP 2P9IB 4JRQA 5CHIA 1LW2A 1KC8O 1B9FA 1D5AA 3LP2A 4OKKA 3CFOA 1P90A 4E7HA 4C8OA 3VTHA 1GOAA 5DM7L 2QA4N 1S22A 1ZBLA 3V9SA 4CEQA 2D0AA 2GUPA 3W0LA 3PY8A 4CJEA 3JS6A 1YAGA 1NKBA 3IAYA 1GLJO 2QWQA 3VERA 1L3TA 4CJTA 4DR7K 3U8XA 4W5RA 2KQ2A 2RPIA 5AQHA 2HBJA 2I5JA 3ULEA 4CD1A 1U6ZA 4JS4A 4DFKA 1D9DA 1TKXA 4OPAA 1WLJA 3DYAA 3AVIA 4W5QA 2IAJA 1NOZA 3TWHA 1ASVA 3NF8A 3QB0A 4CGFA 4BQZA 3AA4A 3OJUA 3BEXA 1NGGA 3D45A 2WTUA 2PAVA 2NRHA 4UQGA 4BR0A 5LY3A 4JHDB 4DV2K 4NB4A 3MXMA 1DEJA 4PKIA 4WQ4A 5ADXA 2WOMA 5HRNA 2AP1A 4E89A 3CC2N 4CJ4A 4FJ9A 2PYLA 4Y1CA 3S5TA 1X9SA 4CF9A 1VRUA 3G25A 4KO0A 3RTVA 5E26A 3TSPA 3JSMA 2HNYA 4CGDA 3LPTA 5AQVA 4PA1A 2OTLN 4CESA 4AHRA 5FDLA 2QEXN 1MA9B 4I6MA 3LPUA 3H3NO 3OHRA 3AVBA 4N47A 4IZ9A 3F9MA 1U2VB 3A2FA 4BRCA 2W6KA 3P5JA 4IOXA 3WEEB 3OA9A 1DLOA 3GG4A 4JLHA 5HOOA 1OVQA 3GL1A 3CFPA 3NH2A 3CJAA 4WFAL 5J2MA 4CJRA 4NO7A 5GAGP 1D9FA 2HW3A 2Q31A 4IJNA 5I9EB 4DS4A 3WT0A 4A5AA 4OKEA 5KQ8A 3DLHA 4IFEA 4HUGA 2W41A 2O8DA 2HMPA 3VA3A 1SQKA 3VEVA 4DSIA 3O8MA 4E3SA 1HNXK 4CJLA 2GTDA 2P9NA 2XRIA 2D1KA 1FKPA 3QNNA 3I55N 2NRXA 4BGAA 3O08A 1IBMK 4BREA 2G8KA 1SL1A 3A5OC 4B3SK 4JNEA 2OTJN 5CYMA 2HHIA 3SUNA 1KXPA 1HMVA 3SQ2A 4FJMA 3WXKA 1C6VA 4I9QA 4JKGA 5E84A 3RSEA 5GAEP 2C1GA 3AY9A 1YF5L 5EX5A 1GLFO 4AHCA 3QDKA 5GIOA 4OPJA 3M8QA 3ATVA 4CK3A 1OH5A 3KHYA 4OO1J 5F0XA 2XY6A 3LDSA 1VSLA 1NGAA 3LWMA 1T44A 3D6RA 2HBLA 1WSHA 2QWNA 3ZX2A 3O9TA 2ZD1A 3CJ7A 1G15A 3OS1A 3D2EB 3CM6A 1A5WA 1MWMA 4NXMK 4CZKA 3OYLA 3DXMA 4RW7A 1Q7YO 1BCMA 4M63C 3M1FA 2VQFK 1VSKA 2QK9A 4JAXA 2D4WA 3TAEA 3T69A 3R6MA 4HCCA 5FPMA 4AILC 4A61A 4FK2A 2D0BA 3LDPA 4DLGA 5BR8K 4C8LA 3DLEA 4ID1A 2H3GX 1RT6A 3B8AX 3OVNA 2DFHA 3KIOA 3V81A 4EP5A 2XY5A 4FWKA 4I9LA 3O80A 1TL3A 4JI4K 4DKWA 2VYPA 1E3MA 4YNQA 1VRTA 3KTQA 3TAGA 4F2SA 4OLBA 1HX1A 1JLQA 2UU9K 2P9SB 3CCJN 4FK0A 3UKRA 1Y64A 3B6OA 3AO4A 4BACA 2YHWA 1A5XA 1JLEA 4CGHA 3OYDA 4BRLA 3WXJA 1S1WA 3UKUA 4B1ZA 4CBUA 2ASPA 1TYQB 1C0FA 4E72A 1I94K 1OH8A 3LAKA 3ZEUA 3IS9A 4W5TA 1N32K 1NGCA 4JD2B 2YHBA 2O8BB 1J6ZA 3SQ4A 4KREA 3ZX0A 4LF7K 1RILA 5J1EA 3RRGA 4K43A 1QQOA 1HPZA 4FLYA 3V6DA 4M3UA 1HNVA 2NRRA 4FJ7A 1KLMA 3LDOA 4MDBA 4BRMA 4JEPA 4Z94A 3THYB 2ZQBA 2HHSA 1SKWA 4IKFA 4CFBA 4NLCA 2E2QA 4CZFA 5BRFA 3D2FB 1K73O 2P9IA 4DR3K 4CD3A 1MDUB 2BUPA 4CZJA 4FW2A 3THXA 1NK8A 2QWRA 4YORA 5IT9O 2IS3A 4GMJB 3HPHA 2OZSA 4H5WA 4IG0A 4CEZA 5A2QO 1T7PA 4BGBA 3SJHA 1RBTA 1WNSA 4A62A 4BC3A 2KFZA 3TAFA 2EX3A 3ZX3A 4BC2A 1IKYA 1VQ7N 4FJHA 1LV5A 2Q0RA 4BRFA 2ZJRL 4HWIA 3TAMA 4C8MA 1RT2A 4CBWA 3OJSA 2CGLA 3MWPA 3L2RA 2KZMA 1Z05A 4YOWA 1L5UA 2HVIA 3MX5A 4E1NA 1XNQK 4H0OA 3TU5A 4LF8K 4JKBA 4FJXA 4DB3A 3O4QA 1TVRA 1JXEA 3BY5A 3K59A 2KLAA 4CJ7A 3ZYYX 1SZ2A 1TUYA 4FWOA 3O5BA 1E4GT 4BWMA 1LAWA 4YY3K 3KKSA 1O13A 4A59A 3G0ZA 3TANA 1NMDA 5JS1A 4CFAA 5FPDA 1BA1A 1UA0A 2JWKA 5CY4A 4PY5A 1U48A 1GLLO 5AQJA 4QS9A 1LWCA 4N41A 3L3UA 2IVOA 4NCGA 4FWMA 4DR5K 3ZSWA 2P9KA 3MK6A 2Z1IA 3U9DA 3ID8A 3SAFA 4R5PA 1K8AO 3FZHA 4E1MA 2A41A 1U2VA 4CEBA 5M1KA 3C7NB 3CCEN 2HHTA 1JLFA 4CF8A 3SV4A 1NKCA 4BE0A 4H4OA 3SJJA 2VCPA 3T1AA 3TARA 5M1FA 4HTUA 1RDBA 3IFRA 1NK9A 3RMBA 3QIPA 2UXCK 4PUOA 2D0PA 3CCRN 3H1QA 3A5LC 1SL0A 2O8EB 5GINA 4FSVA 5M1NA 2X6NA 5KRSA 1IBKK 4DR6K 1VQ8N 3CFRA 4A5BA 1IJJA 3DXKA 2HF4A 4R79A 2HB5A 4CIGA 1U45A 2KTQA 4JKCA 1SV5A 1TAUA 4JKFA 3WUHA 3K5LA 3J8AA 4IDHA 1RCHA 1T6DA 1NM1A 4O5FA 1QVFM 2AJQA 3KK2A 1ZBHA 3C0BA 3ID6A 2YKNA 4Z4IA 2HF3A 3ZSRA 1T05A 4K8XA 1LOTB 3EZ5A 4KHYA 1YJ9N 1NJWA 1TKDA 3VGKA 2Z1GA 1CZAN 3CERA 3E9OA 3EN9A 3NFAA 4DU1A 3NE6A 4FLVA 2G8FA 4YDUC 3NMUA 4IFVA 3P39A 4MO4A 1SS6A 1YHQN 4K41A 4CHYA 5LJWA 2B6AA 1IG9A 3SI6A 4WQ5C 1S72N 4DQIA 3J81O 2UUCK 2IVPA 4XH1A 4A2BA 4FW1A 4BE2A 3GE1A 5M1QA 5EVZA 4KPYA 1SL2A 1YTAA 1UWBA 3F73A 3CMEN 5HL7L 2GWKA 5AQQA 1FKOA 4DUZK 3OY9A 2HNDA 1NK7A 5AQWA 4QCLA 1XUPO 4DV1K 4CZMA 1BQMA 1RNHA 3THVA 4FZXC 3ZT2A 1VQLN 3HZ6A 3E1YA 4CFCA 4BRKA 2GELA 4BRNA 3AVKA 4A57A 4FJKA 3OYFA 2ASOA 3MECA 3LP3A 1X1PA 3CIPA 1RT5A 4GVEA 3U3GA 1C0MA 4MLHA 1KTQA 4HUEA 3LANA 1BQNA 3LWLA 4YOUA 5LMUK 3WQUA 3CETA 2WUSA 1NWKA 3I0SA 2A1RA 2D0OA 5LL6Z 4O0IA 2HHVA 4J8FA 1KSPA 1ZBFA 2VG7A 3ITHA 4CJQA 2EHGA 2RN2A 4AHTA 4ZTJA 1Q81O 1DT9A 4EFHA 1WAFA 4B3OA 3CCLN 2OYQA 4B1WB 4DTRA 4M7YA 3L4QA 5H1SQ 2E1YA 4DQ8A 4YFUA 3DI6A 5BRHA 1S6PA 4FVUA 1IKVA 3M8RA 4GV3A 1TAQA 4CJWA 4E7JA 3AVMA 1TK0A 4I2PA 4BRAA 4FYDA 3THYA 2P5OA 4FPBA 3L2VA 4XH5A 4CFDA 3WXLA 1GLCG 3HP6A 4E7KA 2DY4A 5F2RA 5BN9A 3KKRA 4IG3A 1U4BA 2F9TA 2P51A 4DTPA 3R1XA 1BI4B 5AR0A 2VQEK 4B9TA 4DSJA 4BRPA 4CEAA 1WN7A 3CCSN 1BGXT 3T7ZA 4RW6A 4OGCA 4AHSA 3SUOA 3TSQA 3QMLA 3KK7A 4ICLA 5C12A 4C8NA 4FM0A 3N4PA 2FF3B 4B3TK 3HSTB 3H3OB 3O3HA 4KTZA 3PO4A 2Q2RA 4IEIA 4H5NA 1S1XA 2CH6A 4CZEA 4KHQA 3FZMA 5BRDA 1S9GA 1J53A 3S3OA 3BF1A 4B9SA 4BDYA 5EOYA 4CJKA 4IO8A 1Q82O 3A0IX 3K5MA 4Z4EA 2IOCA 4CECA 4DR2K 4EZ9A 1S1UA 2E20A 2KZZA 5AJ3K 2NRZA 4BRDA 4M7XA 2Z1JA 3QESA 4B1XB 2O4GA 1K9MO 1JLGA 3CJ1A 1OVYA 5AFUA 3DLBA 3SPZA 4EHTA 3ZSQA 3RMCA 1SKSA 1QS4A 3N4QA 5AQPA 4JRPA 2IVNA 4DV6K 3OBYA 1XC3A 3ZSYA 3KLEA 3CHWA 1WSEA 5GIPA 3ALYA 4IOAL 3HSCA 4GW6A 1T6CA 3MMVA 1FK9A 2F96A 3QEVA 2E4LA 1U49A 3C7NA 1KRPA 2BDPA 1RFQA 3Q7BA 1OH6A 1RDDA 3HYFA 4FPAA 2CGJA 1ZXOA 3QEXA 1VSJA 2RF2A 1RBVA 3MN7A 5JVHL 2FBYA 4DTMA 3V4IA 3BZCA 4EHUA 3QEPA 3SMPA 3SQ1A 4O0JA 3GBTA 3TABA 4KHUA 5AQNA 3CC7N 3MXIA 2D5RA 1RDAA 4X65K 4CGGA 1YITN 1JCFA 2X74A 4U67L 4BWJA 3VA0A 3I33A 4CGJA 2CGKA 2X6SA 4H0VB 2HOEA 3B6PA 4O5BA 5KPRA 4DWIA 3IDHA 3MX2A 4WQ4C 4CZHA 3DJCA 3UB5A 4JKDA 1VQNN 2RE2A 4O8KA 4B9UA 3L6QA 3QEIA 5GAHP 2QI2A 4FWQA 5K14A 3L8BA 1BCOA 4BR4A 1XQSC 4BVOA 2ZE2A 3CPWM 1NK4A 2HBKA 5KGWA 1HR0K 3THWB 4B08A 1VQMN 1YTUA 3ASMA 3S9HA 1NLVA 1YUWA 2V7ZA 4B3MK 2D0CA 1ZBIA 3I8DA 1XC9A 1QSSA 3WXMB 4B8AB 3VN5A 3EL2A 3J80O 4IEEA 5HRSA 1V4SA 1QHAA 1NOYA 3EYZA 4MFBA 2O4IA 1S9EA 4KHNA 3C6HA 2UYTA 5C15A 1I39A 3ZETB 1S6QA 4FWLA 1IV0A 2W6LA 2QM1A 3O9UA 2O8CB 4BVPA 3VQPA 3P31A 3VEXA 4CHNA 1TGOA 2QXLA 4KV8A 3ENBA 3NH1A 4DV3K 1IKWA 2G8VA 3EKSA 1JLCA 2HHWA 3AO5A 3U4LA 3VQ8A 4LSNA 3DAWA 3M8SA 1C0UA 3EKUA 4ZHRA 4OX9K 4LH5A 4IDKA 2FF6A 2V7YA 1T03A 1X9JA 4FJLA 3HM8A 2NRWA 2E2NA 4JK7A 4B9NA 4FJIA 3FZKA 3HOSA 3T19A 2Q36A 4LF9K 1QZ6A 1YJNN 5AQLA 3HTVA 1VK0A 5TKWA 1J5EK 5ELZA 2QWMA 2IDOA 3JYTA 4JK9A 3DMJA 3SV3A 3FE1A 4GVMA 4DV7K 3JXUA 5C25A 5AQUA 4ELTA 4DR4K 4CE9A 1YI2N 4ISGA 3CD6N 3VF2A 3ULDA 3AAQA 1Q18A 4FWRA 4HTLA 4O8UA 3SUQA 3SK3A 4JI3K 4I7FA 4ILJA 3U6FA 2O8FB 3NCIA 4KB1A 2FSKA 4KAZA 4UY8O 1BIZA 1RBUA 3NF7A 3HJFA 1XWLA 2PZSA 3VQBA 1WUAA 3QEWA 4FM2A 1N33K 1VSIA 1G99A 4BG8A 1QHTA 4ZTFA 3KVGA 4QS8A 1OH7A 1GOBA 4GNIA 2NZTA 2E5LK 4A2AA 5JICA 3M3ZA 1GOCA 4JV5K 2OANA 4H5VA 3TPQA 2NUBA 4RCHA 4YHHK 2OZMA 1BUPA 3WQTA 3AO3A 3MN5A 3K57A 1KVAA 1JJ2M 3PIPL 3CM5A 1J9AA 1NGDA 3AVJA 4C8KA 3CCQN 3UE5A 4IOCL 4NCBA 3PX6A 1LW0A 4BG9A 1HLUA 1C1CA 1NK0A 2BH1A 5JLFA 2A5XA 4WYBA 4L3QA 3T1YK 1BI4A 2QKBA 1NJXA 4BE1A 1LCUA 1NGEA 3S3NA 2NRTA 5J2PA 3LM9A 3TTFA 3WNHA 5AZIB 4Z4HA 3UIQA 4KH5A 3NBPA 3O9RA 4BDPA 3OYEA 3L2QA 4LF6K 4M3TA 4F3TA 3PUFA 3GOIA 2FBVA 2V52B 5FLXO 3P83D 1NBWA 2HHUA 4DF8A 4YOTA 2V51B 3AVHA 3SCXA 3J7AP 2KW4A 3VGLA 3K0SA 1RT3A 3MXJA 2HNZA 1J54A 3DWLA 5FROA 1HKGA 4WF9L 3SPYA 2HHQA 1W9HA 4H5TA 3FFKB 3O3GA 1HPMA 4OJRA 3CI5A 2F8SA 2ZF5O 3VQCA 4DQQA 3K5OA
chains in the Genus database with same CATH topology
1YAGA 5EVZA 5M1QA 4EIAA 1RDUA 2F9WA 1GLJO 2QWQA 2E88A 3CJBA 4BECA 3E9PA 3VERA 3CMEN 5HL7L 2GWKA 5AQQA 2I7PA 3U8XA 1BWFO 5AQHA 2HBJA 3ULEA 5AQWA 4CD1A 2YI1A 1XUPO 1U6ZA 3O4WA 4CZMA 1V4TA 4OPAA 1VQLN 3HZ6A 3E1YA 4JHDA 4BRKA 3VTIA 2YJFA 4IJAA 2GELA 3ATUA 4BRNA 5KPZA 4CZIA 4A57A 3QB0A 4ILGB 4BQZA 2ASOA 1NGGA 3AGRA 3BEXA 3ULEB 1HKCA 3SLCA 2PAVA 2NRHA 3CIPA 4GVEA 3R9PA 4BR9A 3LDNA 4BR0A 5LY3A 4JHDB 2F7TA 4MLHA 4NB4A 1DEJA 4PKIA 2ZJPL 3VMFB 3IUCA 4WQ4A 4BRHA 3G6EN 1KAZA 5ADXA 2IIRA 2AP1A 4YOUA 3CC2N 5BPLA 2J4RA 3WQUA 3CETA 2WUSA 5AQSA 1NWKA 2E2PA 3ENOA 3QICA 3AARA 3G25A 4JN4A 3VF4A 4ILHA 2D0OA 2Q1NA 3BP8A 3G4SN 4J8FA 1YXQA 2P9LB 5E26A 1C0GA 3TSPA 1M1KO 3MCPA 3A5NC 5AQVA 2OTLN 3ENHA 2JWLA 3VGMA 1VQPN 3WEEA 2QEXN 1MA9B 4I6MA 3TTDA 2PFUA 1Q81O 3H3NO 1DT9A 3OHRA 4WCEL 3I8BA 3M6GA 4IZ9A 3F9MA 4EFHA 1X3MA 3CCLN 3FZLA 1U2VB 4XEIA 4BRCA 5MLCQ 4B1WB 5FPNA 4M7YA 3L4QA 5H1SQ 2E1YA 4BRQA 4IOXA 3WEEB 4DQ8A 2CH5A 1KAXA 3OA9A 5BRHA 3HOTA 3GG4A 4FVUA 4YDUA 5HOOA 4G9ZA 4GV3A 3Q7CA 3VF6A 3GL1A 3CC4N 3O1BA 3CJAA 1BA0A 4WFAL 4H0TB 3H1VX 4H0PA 4BRAA 4NO7A 4CZLA 5GAGP 4BY9C 4FPBA 2Q31A 5AQKA 4IJNA 4ISFA 3SAGA 5I9EB 2YHYA 5KQDA 4XH5A 3WT0A 4A5AA 4BC5A 3WXLA 1NGFA 3AAPA 3QBXA 3P4IA 1GLCG 5KQ8A 3RVCA 3CCMN 4IFEA 2W41A 1E4FT 2HMPA 5F2RA 5BN9A 1SQKA 4FWNA 4OPHA 3VEVA 3O8MA 2F9TA 4BQLA 4K42A 2GTDA 3FZFA 4CI6A 2P9NA 2P9UB 3R1XA 4C23A 5AR0A 2D1KA 2PBDA 3EE8A 3PIOL 4BRPA 1K8KB 3I55N 2NRXA 4KBOA 5AQFA 4B1UB 3CCSN 4GV9A 4BGAA 3O08A 4BREA 1X3NA 3T7ZA 2A3ZA 4RWTA 3I56N 4RTFD 4B1YB 3A5OC 3TSQA 5B8HA 4JNEA 3KZBA 2OTJN 3QMLA 1HKBA 1KXPA 4PHTX 3KK7A 5C12A 2W00A 3WXKA 3N4PA 2FF3B 3HRGA 3H3OB 3ZETA 4JKGA 5E84A 3RSEA 4JK8A 5GAEP 2C1GA 1DGKN 2Q2RA 4IEIA 3AY9A 1YF5L 5EX5A 4H5NA 4XH4A 1GLFO 3LDQA 3J7ZO 2CH6A 3QBWA 1NGJA 2HSTA 3QDKA 4CZEA 5GIOA 3MDQA 5AZJA 1EO1A 3FZMA 5BRDA 3ATVA 1MWKA 3D2EA 3KHYA 4OO1J 5F0XA 2RHKA 3BF1A 3FGUA 3VPZA 3VEOA 1W2BM 3FLCO 5EOYA 3RSEB 3O6WA 1NGAA 4IO8A 3QFPA 1T44A 4F9OA 4JKHA 1Q82O 3A0IX 3D6RA 2HBLA 5AQIA 2QWNA 2QTDA 3ZX2A 3O9TA 3CJ7A 4FOIA 5AQZA 5M1OA 4MLEA 2E20A 3D2EB 3E66A 2Q97A 1MWMA 2NRZA 4BRDA 4M7XA 4CZKA 3DXMA 4FWSA 4B1XB 2NLXA 4H0YB 2GWJA 2E2OA 1Q7YO 4M63C 3M1FA 3VETA 1K9MO 3QFUA 1KAYA 4JKEA 4JAXA 2D4WA 3T69A 3R6MA 3CJ1A 5FPMA 1OVYA 4A61A 5AFUA 3CQXA 5DM6L 2QW9A 1GLBG 3DXMB 3LDPA 1S3XA 5LJVA 4EHTA 1ILYA 5JLHA 3CMAN 2H3GX 2A42A 3CJ9A 2P9SA 3B8AX 3N4QA 2GX9A 4KH6A 5GADP 1VQKN 5AQPA 3MCAB 5CE3A 2IVNA 1VQON 3L4IA 3OBYA 4FWKA 4PL8A 3O80A 1ESVA 1EQYA 2A6AA 5AFUH 4BC4A 3LL3A 1XC3A 2VYPA 4DKWA 1HUXA 1QVGM 3CHWA 3SMSA 5GIPA 2E1ZA 1HX1A 3BUZB 2P9SB 3CCJN 4IOAL 1IG8A 2C1IA 3HSCA 1TYQA 3MN6A 3UKRA 1T6CA 1Y64A 5ADXH 3MMVA 1ZBSA 1T3VA 2HBMA 2YHWA 4CBXA 4PKGA 4JD2A 3CQYA 1H1VA 3AGKA 3C7NA 3R3LA 4BRLA 1NJIO 1RFQA 3Q7BA 4ISEA 3WXJA 3UKUA 1D4XA 4B1ZA 2ASPA 4CBUA 2Q0UA 1TYQB 4FPAA 3UKRB 2P9PA 3DLLL 2CGJA 1C0FA 1ZXOA 4BRIA 5BPMA 1Q86O 3MN7A 4CZGA 3ZEUA 5JVHL 1NGHA 1NGCA 4I6MB 4JD2B 4QS7A 4YOYA 3PLAA 1VAZA 3KWGA 4EHUA 5AQYA 4U7BA 1YIJN 3SMPA 1J6ZA 1RDWX 3UKUB 3LM2A 3ZX0A 1N8RO 3GBTA 4WQ5A 5AQNA 4K43A 3CC7N 3U9ZA 1QQOA 3ZEUB 4AM6A 1YITN 1JCFA 3LDLA 5AQGA 5C10A 1QQMA 4JKAA 4U67L 5FPEA 4C1NK 4H0XB 3I33A 2NRRA 1VQ5N 3CCUN 2CGKA 4H0VB 4AM7A 2HOEA 3D2FA 3LDOA 4MDBA 5KPRA 1QQNA 3IDHA 3MX2A 4WQ4C 4BRMA 4JEPA 4H03B 3DJCA 3UB5A 4Z94A 4JKDA 4CZHA 1VQNN 4XJXA 2RE2A 3H6EA 4O8KA 5M1PA 5BREA 3L6QA 5GAHP 3CPEA 2QI2A 4FWQA 4BR4A 4BRGA 2E8AA 3C6AA 5AZIA 4NLCA 1XQSC 2E2QA 5AQOA 4BVOA 3CJCA 4CZFA 5BRFA 3CPWM 1VQ9N 3D2FB 2HBKA 1K73O 2P9IA 4IXCA 1VQMN 1VQ4N 2P9NB 4CD3A 1MDUB 2BUPA 1JCEA 1NLVA 4MO5A 4CZJA 1YUWA 2V7ZA 3OW2M 3A8YA 3WXMB 4MDAA 2QWRA 1QZ5A 4YORA 4B9QA 4H5RA 3EL2A 3TSUA 2I7NA 3VENA 3WXIA 4IEEA 1BG3A 1V4SA 1QHAA 2WC9A 4H5WA 1BO5O 1SAZA 4BGBA 4Y0WA 3SJHA 3C6HA 4BR5A 2UYTA 4A62A 3CCVN 3SBTA 4FWPA 3S41A 4BC3A 5C15A 5JVGL 2A40A 3ZX3A 3ZETB 4JKGB 4FWLA 4BC2A 2YX6A 2QWLA 5BR9A 2Q0RA 1VQ7N 3O9UA 2QM1A 2ZGZA 4BRFA 4BVPA 4PL7A 3G71N 2ZJRL 3D7EO 4DHYA 4B1VA 4HWIA 5AZJB 4GY2B 2FSNA 3A5MC 4CBWA 3P31A 4DCHA 3VEXA 2CGLA 3MWPA 4BR7A 2QXLA 3ENBA 1BOTO 1Z05A 5AQXA 4YOWA 3EZWA 3MX5A 5AQMA 3EKSA 4FL9A 4H0OA 3TU5A 3FR0A 5BN8A 3U4LA 3IKMA 1TUUA 1VQ6N 2BTFA 3DAWA 4EAHD 3KWIA 4JKBA 4DB3A 4WFNL 3EKUA 4YOXA 2KLAA 4CJ7A 2ZWHA 3ZYYX 1SZ2A 3M5RA 1TUYA 3W3DA 2QWPA 1BU6O 2FF6A 2V7YA 4BE7B 1X9JA 4FWOA 3HM8A 2NRWA 1E4GT 2E2NA 2WFBA 3O5BA 4JK7A 5TKYA 2QWOA 3VESA 1KQSM 4PKHA 2VGMA 3FZKA 3HOSA 1W97L 2FXUA 2Q36A 3NVMA 3CXCM 1QZ6A 1YJNN 3IMXA 5AQLA 2EWSA 3H45C 3NVKA 1BDGA 1O13A 4A59A 1NMDA 3HTVA 5C0YA 5TKWA 4E1JA 3F5TA 5JMVA 5FPDA 1BA1A 2JWKA 5ELZA 2QWMA 5F1XA 4JK9A 1YVNA 1OKJA 3P38A 3FE1A 5AQRA 3JXUA 2P9LA 1GLLO 5AQUA 3L0QA 5AQJA 3VEYA 4QS9A 4ISGA 2ZGYA 4C1NI 1YI2N 3CD6N 3VF2A 2KKZA 3AAQA 1Q18A 4FWRA 4K25A 2IVOA 2WBNA 4HTLA 4O8UA 5EXWA 3MN9A 4FWMA 3H46O 2FSJA 2P9KA 1NGIA 1NGBA 3MK6A 3SK3A 3OBWA 3U9DA 3ID8A 3O1WA 2ITMA 1WOQA 4IWVA 3EO3A 3SAFA 4ILJA 3K9KA 1K8AO 2YHXA 3FZHA 2VGNA 2A41A 1U2VA 1R59O 2FSKA 5M1KA 3MWTA 3C7NB 3CCEN 2KHOA 1Z6RA 4UY8O 2YCHA 2VCPA 1WUAA 2P9KB 2P9PB 5M1FA 3TTCA 1G99A 4BG8A 3IFRA 3KVGA 4QS8A 2NNWA 4BR2A 4GV6A 3BF3A 4GNIA 3O9QA 2NZTA 2D0PA 3CCRN 3H1QA 3A5LC 4A2AA 5JICA 3M3ZA 5AQTA 5EY4A 5GINA 4WFBL 1JCGA 2ZJQL 4FSVA 5M1NA 5C2DA 2OANA 2VWBA 3F2KA 4H5VA 4KH4A 4RCHA 3TPQA 4YOVA 1BUPA 3WQTA 5KPTA 1P8ZA 3MN5A 1VQ8N 4A5BA 3SBGA 1JJ2M 3PIPL 1IJJA 3VEWA 3DXKA 2HF4A 2AA4A 4FO0A 1NGDA 4AF1A 4R79A 1RGIA 3GDQA 3CF5L 2FLOA 4BROA 3UE5A 3CCQN 4IOCL 4BG9A 1HLUA 4JKCA 1GLAG 2DPNA 2BH1A 4JKFA 5JLFA 2A5XA 4BEBA 2P9UA 4WYBA 4L3QA 3WUHA 3J8AA 1ATRA 2NRVA 4IDHA 1LCUA 1T6DA 1K8KA 1YJWN 1NM1A 4O5FA 3DXKB 1QVFM 1NGEA 2W40A 3C65A 3E9LA 4IO9L 5C2FA 2NRTA 3C0BA 3ID6A 3LM9A 1GLEG 3TTFA 5BPNA 3K9JA 2HF3A 5AZIB 3VOVA 3SAHA 1HJOA 2GEMA 4KH5A 3O9RA 1ATSA 1LOTB 2P9IB 3O9SA 1M90O 5CHIA 3GOIA 3R8EA 1YJ9N 1KC8O 2V52B 3VGKA 4LC9B 5CR4A 1CZAN 1NBWA 4NLBA 3CERA 3E9OA 3EN9A 1P90A 4FOEA 4YOTA 2V51B 1GLDG 3VTHA 3HI0A 1KD1O 2ASMA 4YDUC 3NMUA 3VGLA 5DM7L 3P39A 4MO4A 2QA4N 1SS6A 1YHQN 1S22A 4K41A 3DWLA 4WF9L 1HKGA 5LJWA 2YJEA 4H5TA 4WQ5C 3FFKB 1ZC6A 1S72N 1ATNA 1HPMA 2IVPA 3CI5A 3EE9A 4XH1A 4A2BA 2ZF5O 2GUPA 3VEZA 3HBTA 3W0LA 3GE1A 1DKGD 3JS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAG A;  5EVZ A;  4EIA A;  2F9W A;  1GLJ O;  2QWQ A;  2E88 A;  3CJB A;  3VER A;  2GWK A;  5AQQ A;  2I7P A;  3U8X A;  1BWF O;  5AQH A;  3ULE A;  5AQW A;  4CD1 A;  2YI1 A;  1XUP O;  1U6Z A;  3O4W A;  4CZM A;  1V4T A;  3HZ6 A;  4JHD A;  4BRK A;  2YJF A;  4IJA A;  2GEL A;  3ATU A;  4BRN A;  5KPZ A;  4CZI A;  3QB0 A;  4BQZ A;  2ASO A;  1NGG A;  3BEX A;  3ULE B;  1HKC A;  3SLC A;  2PAV A;  2NRH A;  3CIP A;  3R9P A;  4BR9 A;  4BR0 A;  3LDN A;  5LY3 A;  4JHD B;  4MLH A;  4NB4 A;  1DEJ A;  4PKI A;  4BRH A;  3IUC A;  4WQ4 A;  1KAZ A;  5ADX A;  2IIR A;  2AP1 A;  5BPL A;  2J4R A;  3WQU A;  3CET A;  2WUS A;  5AQS A;  1NWK A;  2E2P A;  3ENO A;  3QIC A;  3AAR A;  3G25 A;  4JN4 A;  3VF4 A;  2D0O A;  2Q1N A;  3BP8 A;  4J8F A;  1YXQ A;  2P9L B;  5E26 A;  1C0G A;  3MCP A;  3A5N C;  5AQV A;  3ENH A;  3VGM A;  3WEE A;  1MA9 B;  4I6M A;  3H3N O;  3OHR A;  3I8B A;  3M6G A;  4IZ9 A;  3F9M A;  4EFH A;  1X3M A;  3FZL A;  1U2V B;  4XEI A;  4BRC A;  4B1W B;  5FPN A;  4M7Y A;  2E1Y A;  4BRQ A;  3WEE B;  4DQ8 A;  2CH5 A;  1KAX A;  5BRH A;  3GG4 A;  4YDU A;  3VF6 A;  3GL1 A;  3O1B A;  3CJA A;  1BA0 A;  4H0T B;  3H1V X;  4H0P A;  4BRA A;  4NO7 A;  4CZL A;  4FPB A;  2Q31 A;  5AQK A;  4IJN A;  4ISF A;  5I9E B;  2YHY A;  5KQD A;  4XH5 A;  3WT0 A;  4BC5 A;  3WXL A;  1NGF A;  3AAP A;  3QBX A;  3P4I A;  1GLC G;  5KQ8 A;  2W41 A;  1E4F T;  2HMP A;  5F2R A;  5BN9 A;  1SQK A;  4FWN A;  3VEV A;  3O8M A;  2F9T A;  4BQL A;  4K42 A;  2GTD A;  3FZF A;  4CI6 A;  2P9N A;  2P9U B;  4C23 A;  5AR0 A;  2D1K A;  2PBD A;  4BRP A;  1K8K B;  4KBO A;  5AQF A;  4B1U B;  4BGA A;  3O08 A;  4BRE A;  1X3N A;  2A3Z A;  4RWT A;  4RTF D;  4B1Y B;  3A5O C;  5B8H A;  4JNE A;  3KZB A;  3QML A;  1HKB A;  1KXP A;  3WXK A;  2FF3 B;  3H3O B;  3ZET A;  5E84 A;  3RSE A;  1DGK N;  2Q2R A;  3AY9 A;  5EX5 A;  4H5N A;  4XH4 A;  1GLF O;  3LDQ A;  2CH6 A;  3QBW A;  1NGJ A;  3QDK A;  4CZE A;  3MDQ A;  5AZJ A;  3FZM A;  5BRD A;  3ATV A;  1MWK A;  3D2E A;  3KHY A;  5F0X A;  3BF1 A;  3FGU A;  3VPZ A;  3VEO A;  3FLC O;  5EOY A;  3RSE B;  3O6W A;  1NGA A;  4IO8 A;  3QFP A;  1T44 A;  4F9O A;  3A0I X;  5AQI A;  2QWN A;  3ZX2 A;  3CJ7 A;  4FOI A;  5AQZ A;  4MLE A;  2E20 A;  3D2E B;  2Q97 A;  1MWM A;  4BRD A;  4M7X A;  4CZK A;  3DXM A;  4FWS A;  4B1X B;  2NLX A;  4H0Y B;  2GWJ A;  2E2O A;  4M63 C;  3M1F A;  3VET A;  3QFU A;  1KAY A;  4JAX A;  2D4W A;  3R6M A;  3CJ1 A;  5FPM A;  4A61 A;  5AFU A;  3CQX A;  2QW9 A;  1GLB G;  3DXM B;  3LDP A;  1S3X A;  5LJV A;  4EHT A;  5JLH A;  2H3G X;  2A42 A;  3CJ9 A;  2P9S A;  3B8A X;  5AQP A;  5CE3 A;  2IVN A;  3L4I A;  4FWK A;  4PL8 A;  3O80 A;  1ESV A;  1EQY A;  2A6A A;  5AFU H;  4BC4 A;  3LL3 A;  1XC3 A;  2VYP A;  1HUX A;  3CHW A;  3SMS A;  2E1Z A;  1HX1 A;  3BUZ B;  2P9S B;  1IG8 A;  3HSC A;  1TYQ A;  3MN6 A;  3UKR A;  1T6C A;  1Y64 A;  5ADX H;  3MMV A;  1ZBS A;  2YHW A;  4CBX A;  4PKG A;  4JD2 A;  3CQY A;  1H1V A;  3C7N A;  4BRL A;  1RFQ A;  4ISE A;  3WXJ A;  3UKU A;  1D4X A;  4B1Z A;  2ASP A;  4CBU A;  2Q0U A;  1TYQ B;  4FPA A;  3UKR B;  2P9P A;  2CGJ A;  1C0F A;  1ZXO A;  4BRI A;  5BPM A;  3MN7 A;  4CZG A;  3ZEU A;  1NGH A;  1NGC A;  4I6M B;  4JD2 B;  4QS7 A;  4EHU A;  5AQY A;  3SMP A;  1J6Z A;  1RDW X;  3UKU B;  3LM2 A;  3ZX0 A;  3GBT A;  4WQ5 A;  5AQN A;  4K43 A;  3U9Z A;  1QQO A;  3ZEU B;  4AM6 A;  1JCF A;  3LDL A;  5AQG A;  1QQM A;  5FPE A;  4H0X B;  3I33 A;  2CGK A;  4H0V B;  4AM7 A;  2HOE A;  3D2F A;  3LDO A;  5KPR A;  1QQN A;  3IDH A;  4WQ4 C;  4BRM A;  4H03 B;  3DJC A;  3UB5 A;  4Z94 A;  4CZH A;  3H6E A;  4O8K A;  5BRE A;  3L6Q A;  4FWQ A;  4BR4 A;  4BRG A;  2E8A A;  5AZI A;  1XQS C;  2E2Q A;  5AQO A;  4BVO A;  3CJC A;  4CZF A;  5BRF A;  3D2F B;  2P9I A;  4IXC A;  2P9N B;  4CD3 A;  1MDU B;  2BUP A;  1JCE A;  1NLV A;  4MO5 A;  4CZJ A;  1YUW A;  2V7Z A;  3A8Y A;  2QWR A;  1QZ5 A;  4B9Q A;  4H5R A;  3EL2 A;  2I7N A;  3VEN A;  3WXI A;  1BG3 A;  1V4S A;  1QHA A;  4H5W A;  1BO5 O;  1SAZ A;  4BGB A;  4Y0W A;  3SJH A;  4BR5 A;  2UYT A;  4A62 A;  4FWP A;  3S41 A;  4BC3 A;  2A40 A;  3ZX3 A;  3ZET B;  4BC2 A;  4FWL A;  5BR9 A;  2QWL A;  2Q0R A;  2QM1 A;  2ZGZ A;  4BRF A;  4BVP A;  4PL7 A;  3D7E O;  4DHY A;  4B1V A;  4HWI A;  5AZJ B;  4GY2 B;  2FSN A;  3A5M C;  4CBW A;  4DCH A;  3VEX A;  2CGL A;  4BR7 A;  2QXL A;  1BOT O;  1Z05 A;  5AQX A;  3EZW A;  5AQM A;  3EKS A;  4FL9 A;  4H0O A;  3TU5 A;  3FR0 A;  5BN8 A;  3U4L A;  1TUU A;  2BTF A;  3DAW A;  4EAH D;  4DB3 A;  3EKU A;  4CJ7 A;  2ZWH A;  1SZ2 A;  1TUY A;  3W3D A;  2QWP A;  1BU6 O;  2FF6 A;  2V7Y A;  1X9J A;  4FWO A;  3HM8 A;  3O5B A;  1E4G T;  2E2N A;  3VES A;  5TKY A;  2QWO A;  4PKH A;  3FZK A;  2FXU A;  2Q36 A;  1QZ6 A;  3IMX A;  5AQL A;  2EWS A;  3H45 C;  1BDG A;  1NMD A;  3HTV A;  4E1J A;  5JMV A;  5FPD A;  1BA1 A;  5ELZ A;  2QWM A;  5F1X A;  1YVN A;  1OKJ A;  3FE1 A;  5AQR A;  3JXU A;  2P9L A;  1GLL O;  5AQU A;  3L0Q A;  5AQJ A;  3VEY A;  4QS9 A;  4ISG A;  2ZGY A;  3VF2 A;  3AAQ A;  1Q18 A;  4FWR A;  4K25 A;  2IVO A;  4HTL A;  5EXW A;  3MN9 A;  4FWM A;  3H46 O;  2FSJ A;  2P9K A;  1NGI A;  1NGB A;  3MK6 A;  3SK3 A;  3U9D A;  3ID8 A;  3O1W A;  2ITM A;  1WOQ A;  4IWV A;  3EO3 A;  2YHX A;  3FZH A;  2A41 A;  1U2V A;  1R59 O;  2FSK A;  3C7N B;  2KHO A;  1Z6R A;  2YCH A;  2VCP A;  1WUA A;  2P9K B;  2P9P B;  1G99 A;  4BG8 A;  3IFR A;  3KVG A;  4QS8 A;  4BR2 A;  3BF3 A;  4GNI A;  2NZT A;  2D0P A;  3H1Q A;  3A5L C;  4A2A A;  5JIC A;  3M3Z A;  5AQT A;  5EY4 A;  1JCG A;  4FSV A;  2OAN A;  2VWB A;  4H5V A;  3TPQ A;  4RCH A;  1BUP A;  3WQT A;  5KPT A;  1P8Z A;  3MN5 A;  1IJJ A;  3VEW A;  3DXK A;  2HF4 A;  2AA4 A;  4FO0 A;  1NGD A;  1RGI A;  3GDQ A;  2FLO A;  4BRO A;  3UE5 A;  4BG9 A;  1HLU A;  1GLA G;  2DPN A;  5JLF A;  2A5X A;  2P9U A;  4WYB A;  4L3Q A;  3WUH A;  3J8A A;  1ATR A;  1LCU A;  1T6D A;  1K8K A;  1NM1 A;  4O5F A;  3DXK B;  1NGE A;  2W40 A;  3C0B A;  3LM9 A;  1GLE G;  5BPN A;  2HF3 A;  5AZI B;  3VOV A;  1HJO A;  2GEM A;  1ATS A;  1LOT B;  2P9I B;  3GOI A;  3R8E A;  2V52 B;  3VGK A;  4LC9 B;  1CZA N;  1NBW A;  3CER A;  3EN9 A;  4FOE A;  2V51 B;  1GLD G;  3HI0 A;  2ASM A;  4YDU C;  3VGL A;  4MO4 A;  1S22 A;  4K41 A;  3DWL A;  1HKG A;  5LJW A;  2YJE A;  4H5T A;  4WQ5 C;  3FFK B;  1ZC6 A;  1ATN A;  1HPM A;  2IVP A;  3CI5 A;  4XH1 A;  4A2B A;  2ZF5 O;  2GUP A;  3VEZ A;  3HBT A;  3W0L A;  3GE1 A;  1DKG D;  3JS6 A; 
#chains in the Genus database with same CATH topology
 4EIA A;  4LF4 K;  1BL3 A;  1WB9 A;  4E19 A;  4CIF A;  2E88 A;  4FJN A;  4BEC A;  3OYN A;  2BE2 A;  4N56 A;  3MAQ A;  4HUF A;  1BWF O;  3AVA A;  2YI1 A;  4JS5 A;  4JHD A;  1IBL K;  3VTI A;  4IJA A;  1T8E A;  4DSK A;  4CZI A;  2G8W A;  3AO2 A;  3AGR A;  3DRS A;  3ULE B;  3SLC A;  2JGU A;  4BR9 A;  1B9D A;  2F7T A;  5SWM A;  2ITG A;  2FC0 A;  3T1H K;  1FW6 A;  4X62 K;  3TAP A;  2XY8 A;  3VMF B;  4BRH A;  3G6E N;  3PO5 A;  1NMN A;  3AVL A;  2J4R A;  2E2P A;  3ENO A;  4GKK K;  4ILH A;  2Q1N A;  3BP8 A;  3G4S N;  4NXN K;  3VQA A;  1CXQ A;  3OTO K;  1C0G A;  3A5N C;  4KKO A;  1KLN A;  1Q9X A;  2JWL A;  1VQP N;  4PWD A;  3WEE A;  3HVT A;  3C6T A;  3S3M A;  3TTD A;  3KLG A;  2PFU A;  2HVH A;  4WCE L;  3VQ7 A;  4KTW A;  3I8B A;  1HYZ A;  1X3M A;  4CED A;  1IKX A;  4CEE A;  4OKJ A;  1D8Y A;  4DFM A;  5FPN A;  4BRQ A;  3DM2 A;  2CH5 A;  4FJG A;  3V9W A;  5JS2 A;  3HOT A;  4FLX A;  2A1S A;  4YDU A;  3P1G A;  2G8I A;  1VSF A;  5HBM A;  3Q7C A;  3VF6 A;  3ZT3 A;  4CER A;  3CC4 N;  1TK5 A;  3O1B A;  1HNW K;  1W0H A;  1BA0 A;  3DRR A;  1SKR A;  1YVU A;  3H1V X;  1U47 A;  1EXQ A;  3OYJ A;  4BY9 C;  4J2E A;  2YHY A;  5J2Q A;  4DTO A;  2YNI A;  3QBX A;  4CHP A;  3CCM N;  3RRH A;  1E4F T;  2QXF A;  3HL8 A;  4BQL A;  4K42 A;  4CI6 A;  3FZF A;  3OS0 A;  1Q9Y A;  4C23 A;  3AVC A;  2PBD A;  1RTJ A;  1K8K B;  2R7Y A;  2GUI A;  2YNG A;  5AQF A;  4DV4 K;  1X3N A;  2A3Z A;  1I3A A;  4RWT A;  4CVN E;  1UA1 A;  3C94 A;  4B1Y B;  3RR8 A;  3KD5 E;  4PHT X;  4FJ8 A;  3WNG A;  2W00 A;  3HRG A;  3ZET A;  4J2D A;  3BZK A;  4JK8 A;  4J2A A;  3VQD A;  2ZM6 K;  3HPG A;  4XH4 A;  3J7Z O;  3LDQ A;  3QBW A;  1L3S A;  3MDQ A;  4JI1 K;  3D2E A;  3L3V A;  3FGU A;  3VPZ A;  3VEO A;  4H8K A;  5T7B A;  3RSE B;  3O6W A;  4DTX A;  4KTQ A;  3AA3 A;  4F9O A;  3CYG A;  5AQI A;  5DK5 A;  4FOI A;  3LAL A;  5AQZ A;  4MLE A;  2Q97 A;  1N5Y A;  3PX4 A;  2OCE A;  3QFU A;  4JKE A;  4OGE A;  4W5N A;  1SUQ A;  4G1Q A;  5DM6 L;  1EKE A;  3DXM B;  1JLA A;  2F4V K;  2XY7 A;  3CMA N;  3CJ9 A;  2W42 A;  2P9S A;  2VWJ A;  3QNO A;  3MCA B;  5CE3 A;  1VQO N;  4B3R K;  1ESV A;  1EQY A;  1X9M A;  5AFU H;  4KI6 A;  2YV0 X;  4DTJ A;  1QVG M;  2GBZ A;  3HT3 A;  1X9W A;  3SMS A;  1UAX A;  2E1Z A;  4B9L A;  3BUZ B;  2C1I A;  3OYH A;  1TYQ A;  3MN6 A;  5ADX H;  1NG9 A;  4CF2 A;  2O8F A;  4CBX A;  4PKG A;  4JD2 A;  3CQY A;  3AGK A;  2O8B A;  1NJI O;  4M45 A;  3CQ8 A;  3DLL L;  3UKR B;  4EP4 A;  4Z4F A;  3ZSV A;  4CZG A;  4ELV A;  4DF4 A;  3BDP A;  4Q5V A;  1RTD A;  3UKU B;  3U9Z A;  3ZEU B;  3VQE A;  4AM6 A;  1RDC A;  5C10 A;  1XI1 A;  1Q8I A;  1QQM A;  5FPE A;  4H0X B;  4FLT A;  3NF6 A;  3CCU N;  4AM7 A;  3D2F A;  4CJ3 A;  4M3R A;  1QQN A;  3IG1 A;  5FRM A;  5C42 A;  3TAQ A;  1EET A;  2OPP A;  5BRE A;  4JI8 K;  4FJ5 A;  4Z4G A;  5AZI A;  4H4M A;  3EY1 A;  3CJC A;  3QER A;  4M3W A;  4JI0 K;  2P1J A;  4IXC A;  1VQ4 N;  4CHQ A;  3AO1 A;  3A8Y A;  4DTU A;  2ATQ A;  1HNI A;  4JI5 K;  1VSM A;  4H5R A;  2I7N A;  3VEN A;  1TK8 A;  1KCF A;  1BG3 A;  2WC9 A;  4AHV A;  1BO5 O;  5CYQ A;  1ASU A;  1DTT A;  1LAV A;  3E01 A;  3CG7 A;  4BR5 A;  3THX B;  3SBT A;  5JVG L;  3S41 A;  1DTQ A;  2A40 A;  3V1R A;  3NF9 A;  2YX6 A;  2QWL A;  5BR9 A;  1J5O A;  4DTN A;  1S1T A;  4CHZ A;  4RW8 A;  4PL7 A;  3G71 N;  4L8R B;  4B1V A;  4N76 A;  5AZJ B;  2FSN A;  3A5M C;  2DTU A;  1HJR A;  2YNH A;  4DCH A;  4AH9 A;  3QET A;  4CEF A;  4FL9 A;  3KLI A;  3FFI A;  1TKZ A;  3FR0 A;  5BN8 A;  2B4J A;  3IKM A;  1TUU A;  1VQ6 N;  2BTF A;  4EAH D;  3KWI A;  3VQ4 A;  4WFN L;  4YOX A;  1JL2 A;  3SNN A;  3M5R A;  3V9U A;  2QWP A;  1BU6 O;  4BE7 B;  4W5O A;  4BEB A;  1RT4 A;  5TKY A;  2QWO A;  1KQS M;  4PKH A;  2VGM A;  5IWA K;  1W97 L;  3SUP A;  1EX4 A;  3NVM A;  3CXC M;  4DFJ A;  3IMX A;  3H45 C;  1BDG A;  1F21 A;  1O1W A;  5C0Y A;  3NGI A;  4E1J A;  4F2R A;  4FXD A;  3F5T A;  2FBX A;  5JMV A;  4Y1D A;  4CJP A;  3QIN A;  3VQ6 A;  5I42 A;  3P38 A;  3RMA A;  1NJZ A;  4OVL A;  3L0Q A;  2HMI A;  2OA8 A;  2KKZ A;  5E41 A;  3HXM A;  4OPK A;  3MN9 A;  3H46 O;  3WNF A;  3QLH A;  1NGI A;  4JI6 K;  3NAE A;  3PSI A;  3ZLJ A;  2ITM A;  3EO3 A;  3K9K A;  3AA5 X;  2VGN A;  1R59 O;  2G8U A;  4TSX A;  2KHO A;  2YCH A;  4LSL A;  4BDZ A;  4E0D A;  2O8E A;  1JL1 A;  2P9K B;  2P9P B;  1WAJ A;  1UOC A;  4DS5 A;  3ZT1 A;  3JAM O;  2NNW A;  4DG1 A;  2UUB K;  2VG5 A;  4BR2 A;  4GV6 A;  3O9Q A;  3ZSO A;  4KFB A;  5AQT A;  4WFB L;  5C2D A;  2VWB A;  4KH4 A;  2UXD K;  4FJJ A;  2Z1H A;  3VEW A;  3OYA A;  1VHX A;  4AF1 A;  1RGI A;  3GDQ A;  3CF5 L;  4BRO A;  3AVF A;  3HVR A;  1GLA G;  4K0K K;  2NRV A;  1K8K A;  3DXK B;  2W40 A;  3C65 A;  5C2F A;  3SYZ A;  1GLE G;  1LWE A;  4F4K A;  4FVM A;  2VWK A;  5EU7 A;  3HPO A;  1HJO A;  2GEM A;  3KD1 E;  1ATS A;  3O9S A;  1RTH A;  1M90 O;  4IFY A;  1RBR A;  3NDK A;  3R8E A;  1A5V A;  4LC9 B;  5CR4 A;  3NHG A;  5KRT A;  2Q3S A;  4NLB A;  3V9X A;  4FOE A;  4DSF A;  3LP1 A;  1KD1 O;  1GLD G;  3LZJ A;  3HI0 A;  4FLW A;  2ASM A;  4DQR A;  1KFD A;  3VQQ A;  2YJE A;  2B5J A;  1ZC6 A;  3F9K A;  1ATN A;  3EE9 A;  3VEZ A;  3HBT A;  1DKG D;  3QO9 A;  1RDU A;  2F9W A;  1VSD A;  3CJB A;  3E9P A;  2I7P A;  3C95 A;  1VSE A;  2PYJ A;  4ID5 A;  3K5N A;  5C24 A;  3O4W A;  4E7I A;  1V4T A;  2YJF A;  4E7L A;  3ATU A;  5KPZ A;  1QQC A;  3MED A;  4ILG B;  1HKC A;  1JXB A;  4M41 A;  4K8Z A;  4KRF A;  4ELU A;  1ITG A;  3R9P A;  3NH0 A;  5HRR A;  3LDN A;  4FCY A;  2FBT A;  2YHA A;  4CJU A;  4CJS A;  5HRP A;  4DFP A;  2ZJP L;  3DLG A;  5CZ1 A;  4Z0U A;  3IUC A;  4DMN A;  1KAZ A;  2HHH K;  2IIR A;  3OYI A;  5BPL A;  1ASW A;  4KI4 A;  1EP4 A;  5AQS A;  3VF4 A;  3QIC A;  3AAR A;  4JN4 A;  4DU4 A;  4J2B A;  3I0R A;  1QE1 A;  4DR1 K;  1YXQ A;  2P9L B;  1M1K O;  3MCP A;  3KLF A;  1N34 K;  1KFS A;  1XHZ A;  1HQE A;  1RTI A;  3ENH A;  3MEG A;  4NYN A;  3VGM A;  4B9V A;  2HHX A;  3PSF A;  4WE1 A;  3VQ9 A;  1IO2 A;  3G10 A;  4LD0 A;  1S1V A;  3M6G A;  2RKI A;  3FZL A;  4CJV A;  4XEI A;  5MLC Q;  3ZCM A;  1EWR A;  3OYG A;  1KAX A;  4F3O A;  1R0A A;  2X78 A;  1CZ9 A;  4G9Z A;  4DV5 K;  2KFN A;  4M42 A;  1FJG K;  3U3Y A;  4H0T B;  5JEN A;  4H0P A;  4XIU A;  4FLU A;  4CZL A;  5AQK A;  4ISF A;  3SAG A;  5KQD A;  4BC5 A;  3T3F A;  1NGF A;  3AAP A;  1BIU A;  4M3Y A;  3P4I A;  3RVC A;  2XHB A;  3M8P A;  3DLR A;  4FWN A;  4OPH A;  2IC3 A;  3SQ0 A;  4KHP K;  3L2W A;  2UUA K;  2P9U B;  4KHS A;  3EE8 A;  3PIO L;  1IH7 A;  3CYM A;  4KBO A;  4B1U B;  4GV9 A;  4CGI A;  2IGI A;  3SZ2 A;  1KVB A;  3I56 N;  4RTF D;  3L2U A;  5B8H A;  3KZB A;  1HQU A;  1HKB A;  4CHO A;  2E6M A;  1TL1 A;  3K2P A;  4B8C A;  1DGK N;  1REV A;  3AVN A;  1NGJ A;  2HST A;  4CEO A;  4CCH A;  5AZJ A;  3PX0 A;  1ZYQ A;  1MWK A;  3AVG A;  4CJF A;  2RHK A;  1W2B M;  3FLC O;  5HLF A;  3K58 A;  4GKJ K;  4MQ3 A;  3QFP A;  4JKH A;  2XO7 A;  3RR7 A;  2QTD A;  5CZ2 A;  4X64 K;  3AA2 A;  5M1O A;  3E66 A;  3O4N A;  4CJ5 A;  4FWS A;  1Z26 A;  4M3X A;  2NLX A;  4H0Y B;  2GWJ A;  2E2O A;  3DRP A;  1TKT A;  3VET A;  1KAY A;  2OPR A;  1L3V A;  3CQX A;  2QW9 A;  1GLB G;  3EEQ A;  1S3X A;  5LJV A;  3RWU A;  2WON A;  3OYM A;  1ILY A;  5JLH A;  4NCA A;  2A42 A;  1RT1 A;  2GX9 A;  4KH6 A;  5GAD P;  1W7A A;  1QTM A;  1VQK N;  1HNZ K;  4KHW A;  3ZSX A;  1XMO K;  3L4I A;  3OYC A;  4PL8 A;  4FZY A;  2A6A A;  4BC4 A;  3LL3 A;  1HUX A;  1QSY A;  1WSI A;  1Y97 A;  4AQY K;  5HRO A;  1IG8 A;  1L3U A;  1VSH A;  1HYS A;  1ZBU A;  1ZBS A;  2UXB K;  3KK3 A;  1T3V A;  1NK5 A;  2HBM A;  1H1V A;  4N5S A;  3R3L A;  5KTQ A;  4DSE A;  5J2N A;  4ISE A;  1QSL A;  1D4X A;  2Q0U A;  4V19 S;  4DQP A;  2P9P A;  4BRI A;  5BPM A;  2PY5 A;  3O3F A;  1WSJ A;  3V1Q A;  1Q86 O;  2YKM A;  1HYV A;  1WSG A;  4B9M A;  3NGZ A;  1NGH A;  3LAM A;  4I6M B;  4FK4 A;  4QS7 A;  4YOY A;  1CLQ A;  3LP0 A;  3PLA A;  1VAZ A;  3KWG A;  4U7B A;  5AQY A;  1YIJ N;  1RDW X;  2OPQ A;  2VG6 A;  3LM2 A;  2GV9 A;  1N8R O;  4WQ5 A;  3BGR A;  4RW4 A;  5FRN A;  4CIE A;  4DSL A;  3LDL A;  5AQG A;  1WBD A;  1CZB A;  4JKA A;  1C0T A;  4C1N K;  1VQ5 N;  1U04 A;  1EWQ A;  1RBS A;  4LFA K;  1XHX A;  3THW A;  4H03 B;  4XJX A;  4O55 A;  4DQS A;  3H6E A;  5M1P A;  2OPS A;  4PQU A;  3CPE A;  4LFC K;  4BRG A;  2E8A A;  3C6A A;  5AQO A;  3DOL A;  5HP1 A;  3TI0 A;  1RT7 A;  1VQ9 N;  2O8D B;  4LFB K;  3OS2 A;  4M3Z A;  2P9N B;  3HM9 A;  3H08 A;  1JCE A;  4MO5 A;  3OW2 M;  3DOK A;  1N6Q A;  4F8R A;  4DTS A;  1C1A A;  4MDA A;  1XNR K;  1QZ5 A;  5LMN K;  3AV9 A;  4B9Q A;  1K6Y A;  4JI7 K;  3TSU A;  3WXI A;  2O8C A;  3QIO A;  2G8H A;  1SAZ A;  4RG8 A;  4KB0 A;  4Y0W A;  3KK1 A;  3CCV N;  4FWP A;  4FM1 A;  4Z4C A;  4CW7 B;  4LF5 K;  4JKG B;  3ISN C;  2ZGZ A;  5I3U A;  4CF1 A;  2DFF A;  3D7E O;  4DHY A;  5DMR A;  4GY2 B;  3ZT4 A;  4BR7 A;  4QAG A;  1BOT O;  5AQX A;  3EZW A;  4QOZ B;  1S5J A;  5AQM A;  4JYA K;  2JLE A;  3ZSZ A;  3KJV A;  1NKE A;  1C1B A;  4DV0 K;  3HP9 A;  2ZWH A;  2P5G A;  1N36 K;  1JKH A;  4DLE A;  3W3D A;  1WSF A;  4HHT A;  2LSN A;  3VES A;  2WFB A;  4HCB A;  4FZZ A;  2FXU A;  1JLB A;  4EZ6 A;  4LY7 A;  2EWS A;  3NVK A;  1MU2 A;  3D0P A;  3LZI A;  4AHU A;  4I2Q A;  2F8T A;  2QKK A;  4CF0 A;  5F1X A;  4X66 K;  1YVN A;  1OKJ A;  5AQR A;  3PV8 A;  4DUY K;  2P9L A;  3VEY A;  2BGG A;  1EO1 A;  2ZGY A;  4C1N I;  4K25 A;  3MEE A;  4OLA A;  1NU0 A;  2WBN A;  3V9Z A;  5EXW A;  4IBN A;  4O4G A;  2FSJ A;  1NGB A;  4DU3 A;  3OBW A;  1NJY A;  3O1W A;  1WOQ A;  4IWV A;  2E6L A;  2ETJ A;  3OYK A;  2YHX A;  3WNE A;  3MWT A;  1Z6R A;  4NYF A;  4Q0B A;  4CK2 A;  3OYB A;  3TTC A;  3VQ5 A;  3IRX A;  4LH4 A;  5SZT A;  3BF3 A;  1TV6 A;  4O44 A;  1WBB A;  5EY4 A;  5D3G A;  3HK2 A;  1JCG A;  2ZJQ L;  3F2K A;  1KVC A;  3V1O A;  4YOV A;  5KPT A;  1P8Z A;  1NK6 A;  3SBG A;  4CK1 A;  5KGX A;  1LWF A;  2AA4 A;  4FO0 A;  4FLZ A;  1XMQ K;  2Y1J A;  2FLO A;  4RW9 A;  3RMD A;  3TR8 A;  2DPN A;  3HO1 A;  5KI6 A;  2P9U A;  4JI2 K;  1ATR A;  1HRH A;  1YJW N;  1CXU A;  4HVJ A;  1YT3 A;  3E9L A;  1FXX A;  3NGY A;  4IO9 L;  3DLK A;  1NNE A;  1BIS A;  1BHL A;  3ZT0 A;  2YNF A;  1B92 A;  5BPN A;  3KLH A;  3K9J A;  1Z25 A;  2DFE A;  3VOV A;  2BAN A;  3SAH A;  2Y1I A;  3C6U A;  3J7Y P;  2P9I B;  4JRQ A;  5CHI A;  1LW2 A;  1KC8 O;  1B9F A;  1D5A A;  3LP2 A;  4OKK A;  3CFO A;  1P90 A;  4E7H A;  4C8O A;  3VTH A;  1GOA A;  5DM7 L;  2QA4 N;  1S22 A;  1ZBL A;  3V9S A;  4CEQ A;  2D0A A;  2GUP A;  3W0L A;  3PY8 A;  4CJE A;  3JS6 A;  1YAG A;  1NKB A;  3IAY A;  1GLJ O;  2QWQ A;  3VER A;  1L3T A;  4CJT A;  4DR7 K;  3U8X A;  4W5R A;  2KQ2 A;  2RPI A;  5AQH A;  2HBJ A;  2I5J A;  3ULE A;  4CD1 A;  1U6Z A;  4JS4 A;  4DFK A;  1D9D A;  1TKX A;  4OPA A;  1WLJ A;  3DYA A;  3AVI A;  4W5Q A;  2IAJ A;  1NOZ A;  3TWH A;  1ASV A;  3NF8 A;  3QB0 A;  4CGF A;  4BQZ A;  3AA4 A;  3OJU A;  3BEX A;  1NGG A;  3D45 A;  2WTU A;  2PAV A;  2NRH A;  4UQG A;  4BR0 A;  5LY3 A;  4JHD B;  4DV2 K;  4NB4 A;  3MXM A;  1DEJ A;  4PKI A;  4WQ4 A;  5ADX A;  2WOM A;  5HRN A;  2AP1 A;  4E89 A;  3CC2 N;  4CJ4 A;  4FJ9 A;  2PYL A;  4Y1C A;  3S5T A;  1X9S A;  4CF9 A;  1VRU A;  3G25 A;  4KO0 A;  3RTV A;  5E26 A;  3TSP A;  3JSM A;  2HNY A;  4CGD A;  3LPT A;  5AQV A;  4PA1 A;  2OTL N;  4CES A;  4AHR A;  5FDL A;  2QEX N;  1MA9 B;  4I6M A;  3LPU A;  3H3N O;  3OHR A;  3AVB A;  4N47 A;  4IZ9 A;  3F9M A;  1U2V B;  3A2F A;  4BRC A;  2W6K A;  3P5J A;  4IOX A;  3WEE B;  3OA9 A;  1DLO A;  3GG4 A;  4JLH A;  5HOO A;  1OVQ A;  3GL1 A;  3CFP A;  3NH2 A;  3CJA A;  4WFA L;  5J2M A;  4CJR A;  4NO7 A;  5GAG P;  1D9F A;  2HW3 A;  2Q31 A;  4IJN A;  5I9E B;  4DS4 A;  3WT0 A;  4A5A A;  4OKE A;  5KQ8 A;  3DLH A;  4IFE A;  4HUG A;  2W41 A;  2O8D A;  2HMP A;  3VA3 A;  1SQK A;  3VEV A;  4DSI A;  3O8M A;  4E3S A;  1HNX K;  4CJL A;  2GTD A;  2P9N A;  2XRI A;  2D1K A;  1FKP A;  3QNN A;  3I55 N;  2NRX A;  4BGA A;  3O08 A;  1IBM K;  4BRE A;  2G8K A;  1SL1 A;  3A5O C;  4B3S K;  4JNE A;  2OTJ N;  5CYM A;  2HHI A;  3SUN A;  1KXP A;  1HMV A;  3SQ2 A;  4FJM A;  3WXK A;  1C6V A;  4I9Q A;  4JKG A;  5E84 A;  3RSE A;  5GAE P;  2C1G A;  3AY9 A;  1YF5 L;  5EX5 A;  1GLF O;  4AHC A;  3QDK A;  5GIO A;  4OPJ A;  3M8Q A;  3ATV A;  4CK3 A;  1OH5 A;  3KHY A;  4OO1 J;  5F0X A;  2XY6 A;  3LDS A;  1VSL A;  1NGA A;  3LWM A;  1T44 A;  3D6R A;  2HBL A;  1WSH A;  2QWN A;  3ZX2 A;  3O9T A;  2ZD1 A;  3CJ7 A;  1G15 A;  3OS1 A;  3D2E B;  3CM6 A;  1A5W A;  1MWM A;  4NXM K;  4CZK A;  3OYL A;  3DXM A;  4RW7 A;  1Q7Y O;  1BCM A;  4M63 C;  3M1F A;  2VQF K;  1VSK A;  2QK9 A;  4JAX A;  2D4W A;  3TAE A;  3T69 A;  3R6M A;  4HCC A;  5FPM A;  4AIL C;  4A61 A;  4FK2 A;  2D0B A;  3LDP A;  4DLG A;  5BR8 K;  4C8L A;  3DLE A;  4ID1 A;  2H3G X;  1RT6 A;  3B8A X;  3OVN A;  2DFH A;  3KIO A;  3V81 A;  4EP5 A;  2XY5 A;  4FWK A;  4I9L A;  3O80 A;  1TL3 A;  4JI4 K;  4DKW A;  2VYP A;  1E3M A;  4YNQ A;  1VRT A;  3KTQ A;  3TAG A;  4F2S A;  4OLB A;  1HX1 A;  1JLQ A;  2UU9 K;  2P9S B;  3CCJ N;  4FK0 A;  3UKR A;  1Y64 A;  3B6O A;  3AO4 A;  4BAC A;  2YHW A;  1A5X A;  1JLE A;  4CGH A;  3OYD A;  4BRL A;  3WXJ A;  1S1W A;  3UKU A;  4B1Z A;  4CBU A;  2ASP A;  1TYQ B;  1C0F A;  4E72 A;  1I94 K;  1OH8 A;  3LAK A;  3ZEU A;  3IS9 A;  4W5T A;  1N32 K;  1NGC A;  4JD2 B;  2YHB A;  2O8B B;  1J6Z A;  3SQ4 A;  4KRE A;  3ZX0 A;  4LF7 K;  1RIL A;  5J1E A;  3RRG A;  4K43 A;  1QQO A;  1HPZ A;  4FLY A;  3V6D A;  4M3U A;  1HNV A;  2NRR A;  4FJ7 A;  1KLM A;  3LDO A;  4MDB A;  4BRM A;  4JEP A;  4Z94 A;  3THY B;  2ZQB A;  2HHS A;  1SKW A;  4IKF A;  4CFB A;  4NLC A;  2E2Q A;  4CZF A;  5BRF A;  3D2F B;  1K73 O;  2P9I A;  4DR3 K;  4CD3 A;  1MDU B;  2BUP A;  4CZJ A;  4FW2 A;  3THX A;  1NK8 A;  2QWR A;  4YOR A;  5IT9 O;  2IS3 A;  4GMJ B;  3HPH A;  2OZS A;  4H5W A;  4IG0 A;  4CEZ A;  5A2Q O;  1T7P A;  4BGB A;  3SJH A;  1RBT A;  1WNS A;  4A62 A;  4BC3 A;  2KFZ A;  3TAF A;  2EX3 A;  3ZX3 A;  4BC2 A;  1IKY A;  1VQ7 N;  4FJH A;  1LV5 A;  2Q0R A;  4BRF A;  2ZJR L;  4HWI A;  3TAM A;  4C8M A;  1RT2 A;  4CBW A;  3OJS A;  2CGL A;  3MWP A;  3L2R A;  2KZM A;  1Z05 A;  4YOW A;  1L5U A;  2HVI A;  3MX5 A;  4E1N A;  1XNQ K;  4H0O A;  3TU5 A;  4LF8 K;  4JKB A;  4FJX A;  4DB3 A;  3O4Q A;  1TVR A;  1JXE A;  3BY5 A;  3K59 A;  2KLA A;  4CJ7 A;  3ZYY X;  1SZ2 A;  1TUY A;  4FWO A;  3O5B A;  1E4G T;  4BWM A;  1LAW A;  4YY3 K;  3KKS A;  1O13 A;  4A59 A;  3G0Z A;  3TAN A;  1NMD A;  5JS1 A;  4CFA A;  5FPD A;  1BA1 A;  1UA0 A;  2JWK A;  5CY4 A;  4PY5 A;  1U48 A;  1GLL O;  5AQJ A;  4QS9 A;  1LWC A;  4N41 A;  3L3U A;  2IVO A;  4NCG A;  4FWM A;  4DR5 K;  3ZSW A;  2P9K A;  3MK6 A;  2Z1I A;  3U9D A;  3ID8 A;  3SAF A;  4R5P A;  1K8A O;  3FZH A;  4E1M A;  2A41 A;  1U2V A;  4CEB A;  5M1K A;  3C7N B;  3CCE N;  2HHT A;  1JLF A;  4CF8 A;  3SV4 A;  1NKC A;  4BE0 A;  4H4O A;  3SJJ A;  2VCP A;  3T1A A;  3TAR A;  5M1F A;  4HTU A;  1RDB A;  3IFR A;  1NK9 A;  3RMB A;  3QIP A;  2UXC K;  4PUO A;  2D0P A;  3CCR N;  3H1Q A;  3A5L C;  1SL0 A;  2O8E B;  5GIN A;  4FSV A;  5M1N A;  2X6N A;  5KRS A;  1IBK K;  4DR6 K;  1VQ8 N;  3CFR A;  4A5B A;  1IJJ A;  3DXK A;  2HF4 A;  4R79 A;  2HB5 A;  4CIG A;  1U45 A;  2KTQ A;  4JKC A;  1SV5 A;  1TAU A;  4JKF A;  3WUH A;  3K5L A;  3J8A A;  4IDH A;  1RCH A;  1T6D A;  1NM1 A;  4O5F A;  1QVF M;  2AJQ A;  3KK2 A;  1ZBH A;  3C0B A;  3ID6 A;  2YKN A;  4Z4I A;  2HF3 A;  3ZSR A;  1T05 A;  4K8X A;  1LOT B;  3EZ5 A;  4KHY A;  1YJ9 N;  1NJW A;  1TKD A;  3VGK A;  2Z1G A;  1CZA N;  3CER A;  3E9O A;  3EN9 A;  3NFA A;  4DU1 A;  3NE6 A;  4FLV A;  2G8F A;  4YDU C;  3NMU A;  4IFV A;  3P39 A;  4MO4 A;  1SS6 A;  1YHQ N;  4K41 A;  4CHY A;  5LJW A;  2B6A A;  1IG9 A;  3SI6 A;  4WQ5 C;  1S72 N;  4DQI A;  3J81 O;  2UUC K;  2IVP A;  4XH1 A;  4A2B A;  4FW1 A;  4BE2 A;  3GE1 A;  5M1Q A;  5EVZ A;  4KPY A;  1SL2 A;  1YTA A;  1UWB A;  3F73 A;  3CME N;  5HL7 L;  2GWK A;  5AQQ A;  1FKO A;  4DUZ K;  3OY9 A;  2HND A;  1NK7 A;  5AQW A;  4QCL A;  1XUP O;  4DV1 K;  4CZM A;  1BQM A;  1RNH A;  3THV A;  4FZX C;  3ZT2 A;  1VQL N;  3HZ6 A;  3E1Y A;  4CFC A;  4BRK A;  2GEL A;  4BRN A;  3AVK A;  4A57 A;  4FJK A;  3OYF A;  2ASO A;  3MEC A;  3LP3 A;  1X1P A;  3CIP A;  1RT5 A;  4GVE A;  3U3G A;  1C0M A;  4MLH A;  1KTQ A;  4HUE A;  3LAN A;  1BQN A;  3LWL A;  4YOU A;  5LMU K;  3WQU A;  3CET A;  2WUS A;  1NWK A;  3I0S A;  2A1R A;  2D0O A;  5LL6 Z;  4O0I A;  2HHV A;  4J8F A;  1KSP A;  1ZBF A;  2VG7 A;  3ITH A;  4CJQ A;  2EHG A;  2RN2 A;  4AHT A;  4ZTJ A;  1Q81 O;  1DT9 A;  4EFH A;  1WAF A;  4B3O A;  3CCL N;  2OYQ A;  4B1W B;  4DTR A;  4M7Y A;  3L4Q A;  5H1S Q;  2E1Y A;  4DQ8 A;  4YFU A;  3DI6 A;  5BRH A;  1S6P A;  4FVU A;  1IKV A;  3M8R A;  4GV3 A;  1TAQ A;  4CJW A;  4E7J A;  3AVM A;  1TK0 A;  4I2P A;  4BRA A;  4FYD A;  3THY A;  2P5O A;  4FPB A;  3L2V A;  4XH5 A;  4CFD A;  3WXL A;  1GLC G;  3HP6 A;  4E7K A;  2DY4 A;  5F2R A;  5BN9 A;  3KKR A;  4IG3 A;  1U4B A;  2F9T A;  2P51 A;  4DTP A;  3R1X A;  1BI4 B;  5AR0 A;  2VQE K;  4B9T A;  4DSJ A;  4BRP A;  4CEA A;  1WN7 A;  3CCS N;  1BGX T;  3T7Z A;  4RW6 A;  4OGC A;  4AHS A;  3SUO A;  3TSQ A;  3QML A;  3KK7 A;  4ICL A;  5C12 A;  4C8N A;  4FM0 A;  3N4P A;  2FF3 B;  4B3T K;  3HST B;  3H3O B;  3O3H A;  4KTZ A;  3PO4 A;  2Q2R A;  4IEI A;  4H5N A;  1S1X A;  2CH6 A;  4CZE A;  4KHQ A;  3FZM A;  5BRD A;  1S9G A;  1J53 A;  3S3O A;  3BF1 A;  4B9S A;  4BDY A;  5EOY A;  4CJK A;  4IO8 A;  1Q82 O;  3A0I X;  3K5M A;  4Z4E A;  2IOC A;  4CEC A;  4DR2 K;  4EZ9 A;  1S1U A;  2E20 A;  2KZZ A;  5AJ3 K;  2NRZ A;  4BRD A;  4M7X A;  2Z1J A;  3QES A;  4B1X B;  2O4G A;  1K9M O;  1JLG A;  3CJ1 A;  1OVY A;  5AFU A;  3DLB A;  3SPZ A;  4EHT A;  3ZSQ A;  3RMC A;  1SKS A;  1QS4 A;  3N4Q A;  5AQP A;  4JRP A;  2IVN A;  4DV6 K;  3OBY A;  1XC3 A;  3ZSY A;  3KLE A;  3CHW A;  1WSE A;  5GIP A;  3ALY A;  4IOA L;  3HSC A;  4GW6 A;  1T6C A;  3MMV A;  1FK9 A;  2F96 A;  3QEV A;  2E4L A;  1U49 A;  3C7N A;  1KRP A;  2BDP A;  1RFQ A;  3Q7B A;  1OH6 A;  1RDD A;  3HYF A;  4FPA A;  2CGJ A;  1ZXO A;  3QEX A;  1VSJ A;  2RF2 A;  1RBV A;  3MN7 A;  5JVH L;  2FBY A;  4DTM A;  3V4I A;  3BZC A;  4EHU A;  3QEP A;  3SMP A;  3SQ1 A;  4O0J A;  3GBT A;  3TAB A;  4KHU A;  5AQN A;  3CC7 N;  3MXI A;  2D5R A;  1RDA A;  4X65 K;  4CGG A;  1YIT N;  1JCF A;  2X74 A;  4U67 L;  4BWJ A;  3VA0 A;  3I33 A;  4CGJ A;  2CGK A;  2X6S A;  4H0V B;  2HOE A;  3B6P A;  4O5B A;  5KPR A;  4DWI A;  3IDH A;  3MX2 A;  4WQ4 C;  4CZH A;  3DJC A;  3UB5 A;  4JKD A;  1VQN N;  2RE2 A;  4O8K A;  4B9U A;  3L6Q A;  3QEI A;  5GAH P;  2QI2 A;  4FWQ A;  5K14 A;  3L8B A;  1BCO A;  4BR4 A;  1XQS C;  4BVO A;  2ZE2 A;  3CPW M;  1NK4 A;  2HBK A;  5KGW A;  1HR0 K;  3THW B;  4B08 A;  1VQM N;  1YTU A;  3ASM A;  3S9H A;  1NLV A;  1YUW A;  2V7Z A;  4B3M K;  2D0C A;  1ZBI A;  3I8D A;  1XC9 A;  1QSS A;  3WXM B;  4B8A B;  3VN5 A;  3EL2 A;  3J80 O;  4IEE A;  5HRS A;  1V4S A;  1QHA A;  1NOY A;  3EYZ A;  4MFB A;  2O4I A;  1S9E A;  4KHN A;  3C6H A;  2UYT A;  5C15 A;  1I39 A;  3ZET B;  1S6Q A;  4FWL A;  1IV0 A;  2W6L A;  2QM1 A;  3O9U A;  2O8C B;  4BVP A;  3VQP A;  3P31 A;  3VEX A;  4CHN A;  1TGO A;  2QXL A;  4KV8 A;  3ENB A;  3NH1 A;  4DV3 K;  1IKW A;  2G8V A;  3EKS A;  1JLC A;  2HHW A;  3AO5 A;  3U4L A;  3VQ8 A;  4LSN A;  3DAW A;  3M8S A;  1C0U A;  3EKU A;  4ZHR A;  4OX9 K;  4LH5 A;  4IDK A;  2FF6 A;  2V7Y A;  1T03 A;  1X9J A;  4FJL A;  3HM8 A;  2NRW A;  2E2N A;  4JK7 A;  4B9N A;  4FJI A;  3FZK A;  3HOS A;  3T19 A;  2Q36 A;  4LF9 K;  1QZ6 A;  1YJN N;  5AQL A;  3HTV A;  1VK0 A;  5TKW A;  1J5E K;  5ELZ A;  2QWM A;  2IDO A;  3JYT A;  4JK9 A;  3DMJ A;  3SV3 A;  3FE1 A;  4GVM A;  4DV7 K;  3JXU A;  5C25 A;  5AQU A;  4ELT A;  4DR4 K;  4CE9 A;  1YI2 N;  4ISG A;  3CD6 N;  3VF2 A;  3ULD A;  3AAQ A;  1Q18 A;  4FWR A;  4HTL A;  4O8U A;  3SUQ A;  3SK3 A;  4JI3 K;  4I7F A;  4ILJ A;  3U6F A;  2O8F B;  3NCI A;  4KB1 A;  2FSK A;  4KAZ A;  4UY8 O;  1BIZ A;  1RBU A;  3NF7 A;  3HJF A;  1XWL A;  2PZS A;  3VQB A;  1WUA A;  3QEW A;  4FM2 A;  1N33 K;  1VSI A;  1G99 A;  4BG8 A;  1QHT A;  4ZTF A;  3KVG A;  4QS8 A;  1OH7 A;  1GOB A;  4GNI A;  2NZT A;  2E5L K;  4A2A A;  5JIC A;  3M3Z A;  1GOC A;  4JV5 K;  2OAN A;  4H5V A;  3TPQ A;  2NUB A;  4RCH A;  4YHH K;  2OZM A;  1BUP A;  3WQT A;  3AO3 A;  3MN5 A;  3K57 A;  1KVA A;  1JJ2 M;  3PIP L;  3CM5 A;  1J9A A;  1NGD A;  3AVJ A;  4C8K A;  3CCQ N;  3UE5 A;  4IOC L;  4NCB A;  3PX6 A;  1LW0 A;  4BG9 A;  1HLU A;  1C1C A;  1NK0 A;  2BH1 A;  5JLF A;  2A5X A;  4WYB A;  4L3Q A;  3T1Y K;  1BI4 A;  2QKB A;  1NJX A;  4BE1 A;  1LCU A;  1NGE A;  3S3N A;  2NRT A;  5J2P A;  3LM9 A;  3TTF A;  3WNH A;  5AZI B;  4Z4H A;  3UIQ A;  4KH5 A;  3NBP A;  3O9R A;  4BDP A;  3OYE A;  3L2Q A;  4LF6 K;  4M3T A;  4F3T A;  3PUF A;  3GOI A;  2FBV A;  2V52 B;  5FLX O;  3P83 D;  1NBW A;  2HHU A;  4DF8 A;  4YOT A;  2V51 B;  3AVH A;  3SCX A;  3J7A P;  2KW4 A;  3VGL A;  3K0S A;  1RT3 A;  3MXJ A;  2HNZ A;  1J54 A;  3DWL A;  5FRO A;  1HKG A;  4WF9 L;  3SPY A;  2HHQ A;  1W9H A;  4H5T A;  3FFK B;  3O3G A;  1HPM A;  4OJR A;  3CI5 A;  2F8S A;  2ZF5 O;  3VQC A;  4DQQ A;  3K5O A; 
#chains in the Genus database with same CATH homology
 1YAG A;  5EVZ A;  5M1Q A;  4EIA A;  1RDU A;  2F9W A;  1GLJ O;  2QWQ A;  2E88 A;  3CJB A;  4BEC A;  3E9P A;  3VER A;  3CME N;  5HL7 L;  2GWK A;  5AQQ A;  2I7P A;  3U8X A;  1BWF O;  5AQH A;  2HBJ A;  3ULE A;  5AQW A;  4CD1 A;  2YI1 A;  1XUP O;  1U6Z A;  3O4W A;  4CZM A;  1V4T A;  4OPA A;  1VQL N;  3HZ6 A;  3E1Y A;  4JHD A;  4BRK A;  3VTI A;  2YJF A;  4IJA A;  2GEL A;  3ATU A;  4BRN A;  5KPZ A;  4CZI A;  4A57 A;  3QB0 A;  4ILG B;  4BQZ A;  2ASO A;  1NGG A;  3AGR A;  3BEX A;  3ULE B;  1HKC A;  3SLC A;  2PAV A;  2NRH A;  3CIP A;  4GVE A;  3R9P A;  4BR9 A;  3LDN A;  4BR0 A;  5LY3 A;  4JHD B;  2F7T A;  4MLH A;  4NB4 A;  1DEJ A;  4PKI A;  2ZJP L;  3VMF B;  3IUC A;  4WQ4 A;  4BRH A;  3G6E N;  1KAZ A;  5ADX A;  2IIR A;  2AP1 A;  4YOU A;  3CC2 N;  5BPL A;  2J4R A;  3WQU A;  3CET A;  2WUS A;  5AQS A;  1NWK A;  2E2P A;  3ENO A;  3QIC A;  3AAR A;  3G25 A;  4JN4 A;  3VF4 A;  4ILH A;  2D0O A;  2Q1N A;  3BP8 A;  3G4S N;  4J8F A;  1YXQ A;  2P9L B;  5E26 A;  1C0G A;  3TSP A;  1M1K O;  3MCP A;  3A5N C;  5AQV A;  2OTL N;  3ENH A;  2JWL A;  3VGM A;  1VQP N;  3WEE A;  2QEX N;  1MA9 B;  4I6M A;  3TTD A;  2PFU A;  1Q81 O;  3H3N O;  1DT9 A;  3OHR A;  4WCE L;  3I8B A;  3M6G A;  4IZ9 A;  3F9M A;  4EFH A;  1X3M A;  3CCL N;  3FZL A;  1U2V B;  4XEI A;  4BRC A;  5MLC Q;  4B1W B;  5FPN A;  4M7Y A;  3L4Q A;  5H1S Q;  2E1Y A;  4BRQ A;  4IOX A;  3WEE B;  4DQ8 A;  2CH5 A;  1KAX A;  3OA9 A;  5BRH A;  3HOT A;  3GG4 A;  4FVU A;  4YDU A;  5HOO A;  4G9Z A;  4GV3 A;  3Q7C A;  3VF6 A;  3GL1 A;  3CC4 N;  3O1B A;  3CJA A;  1BA0 A;  4WFA L;  4H0T B;  3H1V X;  4H0P A;  4BRA A;  4NO7 A;  4CZL A;  5GAG P;  4BY9 C;  4FPB A;  2Q31 A;  5AQK A;  4IJN A;  4ISF A;  3SAG A;  5I9E B;  2YHY A;  5KQD A;  4XH5 A;  3WT0 A;  4A5A A;  4BC5 A;  3WXL A;  1NGF A;  3AAP A;  3QBX A;  3P4I A;  1GLC G;  5KQ8 A;  3RVC A;  3CCM N;  4IFE A;  2W41 A;  1E4F T;  2HMP A;  5F2R A;  5BN9 A;  1SQK A;  4FWN A;  4OPH A;  3VEV A;  3O8M A;  2F9T A;  4BQL A;  4K42 A;  2GTD A;  3FZF A;  4CI6 A;  2P9N A;  2P9U B;  3R1X A;  4C23 A;  5AR0 A;  2D1K A;  2PBD A;  3EE8 A;  3PIO L;  4BRP A;  1K8K B;  3I55 N;  2NRX A;  4KBO A;  5AQF A;  4B1U B;  3CCS N;  4GV9 A;  4BGA A;  3O08 A;  4BRE A;  1X3N A;  3T7Z A;  2A3Z A;  4RWT A;  3I56 N;  4RTF D;  4B1Y B;  3A5O C;  3TSQ A;  5B8H A;  4JNE A;  3KZB A;  2OTJ N;  3QML A;  1HKB A;  1KXP A;  4PHT X;  3KK7 A;  5C12 A;  2W00 A;  3WXK A;  3N4P A;  2FF3 B;  3HRG A;  3H3O B;  3ZET A;  4JKG A;  5E84 A;  3RSE A;  4JK8 A;  5GAE P;  2C1G A;  1DGK N;  2Q2R A;  4IEI A;  3AY9 A;  1YF5 L;  5EX5 A;  4H5N A;  4XH4 A;  1GLF O;  3LDQ A;  3J7Z O;  2CH6 A;  3QBW A;  1NGJ A;  2HST A;  3QDK A;  4CZE A;  5GIO A;  3MDQ A;  5AZJ A;  1EO1 A;  3FZM A;  5BRD A;  3ATV A;  1MWK A;  3D2E A;  3KHY A;  4OO1 J;  5F0X A;  2RHK A;  3BF1 A;  3FGU A;  3VPZ A;  3VEO A;  1W2B M;  3FLC O;  5EOY A;  3RSE B;  3O6W A;  1NGA A;  4IO8 A;  3QFP A;  1T44 A;  4F9O A;  4JKH A;  1Q82 O;  3A0I X;  3D6R A;  2HBL A;  5AQI A;  2QWN A;  2QTD A;  3ZX2 A;  3O9T A;  3CJ7 A;  4FOI A;  5AQZ A;  5M1O A;  4MLE A;  2E20 A;  3D2E B;  3E66 A;  2Q97 A;  1MWM A;  2NRZ A;  4BRD A;  4M7X A;  4CZK A;  3DXM A;  4FWS A;  4B1X B;  2NLX A;  4H0Y B;  2GWJ A;  2E2O A;  1Q7Y O;  4M63 C;  3M1F A;  3VET A;  1K9M O;  3QFU A;  1KAY A;  4JKE A;  4JAX A;  2D4W A;  3T69 A;  3R6M A;  3CJ1 A;  5FPM A;  1OVY A;  4A61 A;  5AFU A;  3CQX A;  5DM6 L;  2QW9 A;  1GLB G;  3DXM B;  3LDP A;  1S3X A;  5LJV A;  4EHT A;  1ILY A;  5JLH A;  3CMA N;  2H3G X;  2A42 A;  3CJ9 A;  2P9S A;  3B8A X;  3N4Q A;  2GX9 A;  4KH6 A;  5GAD P;  1VQK N;  5AQP A;  3MCA B;  5CE3 A;  2IVN A;  1VQO N;  3L4I A;  3OBY A;  4FWK A;  4PL8 A;  3O80 A;  1ESV A;  1EQY A;  2A6A A;  5AFU H;  4BC4 A;  3LL3 A;  1XC3 A;  2VYP A;  4DKW A;  1HUX A;  1QVG M;  3CHW A;  3SMS A;  5GIP A;  2E1Z A;  1HX1 A;  3BUZ B;  2P9S B;  3CCJ N;  4IOA L;  1IG8 A;  2C1I A;  3HSC A;  1TYQ A;  3MN6 A;  3UKR A;  1T6C A;  1Y64 A;  5ADX H;  3MMV A;  1ZBS A;  1T3V A;  2HBM A;  2YHW A;  4CBX A;  4PKG A;  4JD2 A;  3CQY A;  1H1V A;  3AGK A;  3C7N A;  3R3L A;  4BRL A;  1NJI O;  1RFQ A;  3Q7B A;  4ISE A;  3WXJ A;  3UKU A;  1D4X A;  4B1Z A;  2ASP A;  4CBU A;  2Q0U A;  1TYQ B;  4FPA A;  3UKR B;  2P9P A;  3DLL L;  2CGJ A;  1C0F A;  1ZXO A;  4BRI A;  5BPM A;  1Q86 O;  3MN7 A;  4CZG A;  3ZEU A;  5JVH L;  1NGH A;  1NGC A;  4I6M B;  4JD2 B;  4QS7 A;  4YOY A;  3PLA A;  1VAZ A;  3KWG A;  4EHU A;  5AQY A;  4U7B A;  1YIJ N;  3SMP A;  1J6Z A;  1RDW X;  3UKU B;  3LM2 A;  3ZX0 A;  1N8R O;  3GBT A;  4WQ5 A;  5AQN A;  4K43 A;  3CC7 N;  3U9Z A;  1QQO A;  3ZEU B;  4AM6 A;  1YIT N;  1JCF A;  3LDL A;  5AQG A;  5C10 A;  1QQM A;  4JKA A;  4U67 L;  5FPE A;  4C1N K;  4H0X B;  3I33 A;  2NRR A;  1VQ5 N;  3CCU N;  2CGK A;  4H0V B;  4AM7 A;  2HOE A;  3D2F A;  3LDO A;  4MDB A;  5KPR A;  1QQN A;  3IDH A;  3MX2 A;  4WQ4 C;  4BRM A;  4JEP A;  4H03 B;  3DJC A;  3UB5 A;  4Z94 A;  4JKD A;  4CZH A;  1VQN N;  4XJX A;  2RE2 A;  3H6E A;  4O8K A;  5M1P A;  5BRE A;  3L6Q A;  5GAH P;  3CPE A;  2QI2 A;  4FWQ A;  4BR4 A;  4BRG A;  2E8A A;  3C6A A;  5AZI A;  4NLC A;  1XQS C;  2E2Q A;  5AQO A;  4BVO A;  3CJC A;  4CZF A;  5BRF A;  3CPW M;  1VQ9 N;  3D2F B;  2HBK A;  1K73 O;  2P9I A;  4IXC A;  1VQM N;  1VQ4 N;  2P9N B;  4CD3 A;  1MDU B;  2BUP A;  1JCE A;  1NLV A;  4MO5 A;  4CZJ A;  1YUW A;  2V7Z A;  3OW2 M;  3A8Y A;  3WXM B;  4MDA A;  2QWR A;  1QZ5 A;  4YOR A;  4B9Q A;  4H5R A;  3EL2 A;  3TSU A;  2I7N A;  3VEN A;  3WXI A;  4IEE A;  1BG3 A;  1V4S A;  1QHA A;  2WC9 A;  4H5W A;  1BO5 O;  1SAZ A;  4BGB A;  4Y0W A;  3SJH A;  3C6H A;  4BR5 A;  2UYT A;  4A62 A;  3CCV N;  3SBT A;  4FWP A;  3S41 A;  4BC3 A;  5C15 A;  5JVG L;  2A40 A;  3ZX3 A;  3ZET B;  4JKG B;  4FWL A;  4BC2 A;  2YX6 A;  2QWL A;  5BR9 A;  2Q0R A;  1VQ7 N;  3O9U A;  2QM1 A;  2ZGZ A;  4BRF A;  4BVP A;  4PL7 A;  3G71 N;  2ZJR L;  3D7E O;  4DHY A;  4B1V A;  4HWI A;  5AZJ B;  4GY2 B;  2FSN A;  3A5M C;  4CBW A;  3P31 A;  4DCH A;  3VEX A;  2CGL A;  3MWP A;  4BR7 A;  2QXL A;  3ENB A;  1BOT O;  1Z05 A;  5AQX A;  4YOW A;  3EZW A;  3MX5 A;  5AQM A;  3EKS A;  4FL9 A;  4H0O A;  3TU5 A;  3FR0 A;  5BN8 A;  3U4L A;  3IKM A;  1TUU A;  1VQ6 N;  2BTF A;  3DAW A;  4EAH D;  3KWI A;  4JKB A;  4DB3 A;  4WFN L;  3EKU A;  4YOX A;  2KLA A;  4CJ7 A;  2ZWH A;  3ZYY X;  1SZ2 A;  3M5R A;  1TUY A;  3W3D A;  2QWP A;  1BU6 O;  2FF6 A;  2V7Y A;  4BE7 B;  1X9J A;  4FWO A;  3HM8 A;  2NRW A;  1E4G T;  2E2N A;  2WFB A;  3O5B A;  4JK7 A;  5TKY A;  2QWO A;  3VES A;  1KQS M;  4PKH A;  2VGM A;  3FZK A;  3HOS A;  1W97 L;  2FXU A;  2Q36 A;  3NVM A;  3CXC M;  1QZ6 A;  1YJN N;  3IMX A;  5AQL A;  2EWS A;  3H45 C;  3NVK A;  1BDG A;  1O13 A;  4A59 A;  1NMD A;  3HTV A;  5C0Y A;  5TKW A;  4E1J A;  3F5T A;  5JMV A;  5FPD A;  1BA1 A;  2JWK A;  5ELZ A;  2QWM A;  5F1X A;  4JK9 A;  1YVN A;  1OKJ A;  3P38 A;  3FE1 A;  5AQR A;  3JXU A;  2P9L A;  1GLL O;  5AQU A;  3L0Q A;  5AQJ A;  3VEY A;  4QS9 A;  4ISG A;  2ZGY A;  4C1N I;  1YI2 N;  3CD6 N;  3VF2 A;  2KKZ A;  3AAQ A;  1Q18 A;  4FWR A;  4K25 A;  2IVO A;  2WBN A;  4HTL A;  4O8U A;  5EXW A;  3MN9 A;  4FWM A;  3H46 O;  2FSJ A;  2P9K A;  1NGI A;  1NGB A;  3MK6 A;  3SK3 A;  3OBW A;  3U9D A;  3ID8 A;  3O1W A;  2ITM A;  1WOQ A;  4IWV A;  3EO3 A;  3SAF A;  4ILJ A;  3K9K A;  1K8A O;  2YHX A;  3FZH A;  2VGN A;  2A41 A;  1U2V A;  1R59 O;  2FSK A;  5M1K A;  3MWT A;  3C7N B;  3CCE N;  2KHO A;  1Z6R A;  4UY8 O;  2YCH A;  2VCP A;  1WUA A;  2P9K B;  2P9P B;  5M1F A;  3TTC A;  1G99 A;  4BG8 A;  3IFR A;  3KVG A;  4QS8 A;  2NNW A;  4BR2 A;  4GV6 A;  3BF3 A;  4GNI A;  3O9Q A;  2NZT A;  2D0P A;  3CCR N;  3H1Q A;  3A5L C;  4A2A A;  5JIC A;  3M3Z A;  5AQT A;  5EY4 A;  5GIN A;  4WFB L;  1JCG A;  2ZJQ L;  4FSV A;  5M1N A;  5C2D A;  2OAN A;  2VWB A;  3F2K A;  4H5V A;  4KH4 A;  4RCH A;  3TPQ A;  4YOV A;  1BUP A;  3WQT A;  5KPT A;  1P8Z A;  3MN5 A;  1VQ8 N;  4A5B A;  3SBG A;  1JJ2 M;  3PIP L;  1IJJ A;  3VEW A;  3DXK A;  2HF4 A;  2AA4 A;  4FO0 A;  1NGD A;  4AF1 A;  4R79 A;  1RGI A;  3GDQ A;  3CF5 L;  2FLO A;  4BRO A;  3UE5 A;  3CCQ N;  4IOC L;  4BG9 A;  1HLU A;  4JKC A;  1GLA G;  2DPN A;  2BH1 A;  4JKF A;  5JLF A;  2A5X A;  4BEB A;  2P9U A;  4WYB A;  4L3Q A;  3WUH A;  3J8A A;  1ATR A;  2NRV A;  4IDH A;  1LCU A;  1T6D A;  1K8K A;  1YJW N;  1NM1 A;  4O5F A;  3DXK B;  1QVF M;  1NGE A;  2W40 A;  3C65 A;  3E9L A;  4IO9 L;  5C2F A;  2NRT A;  3C0B A;  3ID6 A;  3LM9 A;  1GLE G;  3TTF A;  5BPN A;  3K9J A;  2HF3 A;  5AZI B;  3VOV A;  3SAH A;  1HJO A;  2GEM A;  4KH5 A;  3O9R A;  1ATS A;  1LOT B;  2P9I B;  3O9S A;  1M90 O;  5CHI A;  3GOI A;  3R8E A;  1YJ9 N;  1KC8 O;  2V52 B;  3VGK A;  4LC9 B;  5CR4 A;  1CZA N;  1NBW A;  4NLB A;  3CER A;  3E9O A;  3EN9 A;  1P90 A;  4FOE A;  4YOT A;  2V51 B;  1GLD G;  3VTH A;  3HI0 A;  1KD1 O;  2ASM A;  4YDU C;  3NMU A;  3VGL A;  5DM7 L;  3P39 A;  4MO4 A;  2QA4 N;  1SS6 A;  1YHQ N;  1S22 A;  4K41 A;  3DWL A;  4WF9 L;  1HKG A;  5LJW A;  2YJE A;  4H5T A;  4WQ5 C;  3FFK B;  1ZC6 A;  1S72 N;  1ATN A;  1HPM A;  2IVP A;  3CI5 A;  3EE9 A;  4XH1 A;  4A2B A;  2ZF5 O;  2GUP A;  3VEZ A;  3HBT A;  3W0L A;  3GE1 A;  1DKG D;  3JS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...