3W3DA

Crystal structure of smooth muscle g actin dnase i complex
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
374
structure length
373
Chain Sequence
EEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin, gamma-enteric smooth muscle
publication title Refined structure and solvent network of chicken gizzard G-actin DNase 1 complex at 1.8A resolution
rcsb
molecule tags Structural protein
total genus 122
structure length 373
sequence length 374
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3w3dA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3w3dA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3w3dA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3w3dA04
4PL8A 1E4GT 1BO5O 1NGIA 3ULEB 1XUPO 2J4RA 5ADXH 2YHWA 1OKJA 3FGUA 3EL2A 1R59O 4B1VA 1V4SA 3SK3A 3AARA 2A40A 1KAXA 4A61A 3JS6A 3VEVA 4B9QA 2QWPA 3CQYA 2GUPA 4QS8A 3WEEB 3QICA 1MWMA 4K25A 3SMPA 4BGAA 2PAVA 3R6MA 4Y0WA 3O4WA 2A5XA 1TYQA 2P9LB 4O8KA 2ZF5O 2FLOA 4FPBA 3QB0A 5F0XA 2E20A 3U8XA 5EX5A 4MLEA 2KHOA 1TUUA 5AZJB 2W40A 5AQZA 4BC5A 2D4WA 4BVPA 1GLDG 1GLLO 2IVOA 4NB4A 4DQ8A 1BG3A 3A5OC 3VF4A 1D4XA 3A5LC 1HLUA 4RCHA 5JLFA 3H46O 2VYPA 4BR4A 4BREA 3D2EB 3C7NB 2Q0RA 3ZEUA 3VEYA 4A2BA 4CZKA 3LDNA 3VPZA 3A8YA 1C0GA 1BOTO 2F9TA 3H3NO 4YDUC 5AQOA 4H5RA 3WXKA 3C0BA 4RWTA 2QWRA 5AQMA 4M7YA 5ADXA 3SJHA 4MO4A 5JMVA 3LDPA 2FF6A 3DAWA 5AQQA 1KXPA 4H0OA 1XQSC 3UKUB 1NGDA 4BG8A 4FWKA 2YJFA 3CIPA 2IIRA 1K8KA 3CJCA 5BN9A 5AQYA 4IXCA 5EXWA 4JD2B 1RGIA 3MN7A 5AQWA 4CD1A 5BPNA 4ISEA 3BF1A 1NBWA 3ENOA 4B1XB 3IMXA 5AQRA 2E2QA 3KZBA 2CGJA 2FXUA 1HUXA 3I33A 3P4IA 3CJ9A 1SQKA 2D1KA 2GELA 2QWQA 4PL7A 3QFPA 2AA4A 5BREA 3ZETA 3LM9A 4IJNA 3CERA 4BRAA 3M1FA 4EAHD 2HF3A 1ZXOA 3ATVA 1G99A 2GWKA 2OANA 2P9PA 3WQUA 3O80A 5TKYA 3BF3A 2CH6A 3HM8A 1TYQB 5EVZA 2Q2RA 2H3GX 1NGJA 4H0VB 2CGKA 4BGBA 3CJBA 4FWOA 3MK6A 4H0YB 3LDOA 3O5BA 3WXJA 5JICA 3I8BA 5AQKA 5FPDA 2E1ZA 5BRFA 4WYBA 4WQ4C 5CE3A 4QS7A 4ISFA 3VEWA 1T44A 3IDHA 1QQOA 4M7XA 1TUYA 3VGLA 3FR0A 4FL9A 3RSEA 4BROA 4BG9A 2P9KA 1C0FA 2E2PA 2QXLA 1Y64A 2QW9A 4FO0A 1U6ZA 3ZEUB 1X9JA 4HTLA 3O6WA 4CZJA 2CH5A 5AQGA 2Q0UA 1NMDA 4PKIA 3SLCA 3L6QA 5LJVA 2WUSA 3MN6A 4L3QA 3IUCA 3S41A 4FWLA 2ITMA 2IVPA 3D2FA 1NWKA 2CGLA 5BRHA 4PKGA 1IG8A 2V7YA 4XH4A 3ZX3A 3QFUA 2P9SA 1Z05A 2Q31A 4BR9A 1RDWX 4FWSA 3HTVA 5AQIA 5ELZA 4FWPA 5EOYA 4B1WB 5AQUA 4FOIA 4CD3A 1BA1A 2VWBA 3H3OB 3ID8A 1T6CA 4BR7A 5BR9A 4BRIA 4FPAA 3W3DA 3A5MC 4CBXA 1NLVA 3D7EO 4YDUA 4BC2A 1BU6O 1YAGA 3WXLA 1QQNA 3VENA 3CJ7A 1H1VA 5AQFA 3LDQA 2UYTA 2P9NA 3ZETB 3FZMA 4BRKA 3L0QA 3GL1A 1P8ZA 5F2RA 1NGFA 1LCUA 1LOTB 3ENHA 4FWNA 2P9PB 1QHAA 3CHWA 4A62A 2FF3B 1JCGA 4DCHA 3MDQA 1S3XA 3GOIA 4BRPA 3O1WA 4CBUA 3GDQA 1YUWA 3LL3A 3O1BA 4K42A 1U2VA 3UKRA 3A0IX 3B8AX 2I7PA 3HI0A 2E88A 3BUZB 1YXQA 4JHDA 4BC3A 3CJAA 1HPMA 1DGKN 2YHYA 4IJAA 4H5TA 1QZ5A 2P9KB 2NZTA 1GLBG 4MLHA 1BUPA 4EFHA 1YVNA 1S22A 4B1YB 2A42A 4QS9A 3QBXA 5AR0A 4CJ7A 1QQMA 3FZKA 4HWIA 5KPRA 3LM2A 3UB5A 3D2FB 2Q36A 3O08A 3LDLA 4EIAA 3BEXA 1ESVA 2P9SB 4WQ4A 1CZAN 4WQ5C 2NLXA 3R9PA 1DEJA 2E8AA 2FSNA 2YJEA 5AQPA 4B1UB 1X3NA 1J6ZA 1MDUB 3WEEA 2E2NA 2F9WA 2P9UA 5BPMA 4BR5A 3ZX2A 3R8EA 5LJWA 5JLHA 1NGGA 1MWKA 1GLJO 3GBTA 3VESA 3FFKB 3U9DA 4H0XB 3J8AA 2VCPA 3EO3A 2ASMA 3VGMA 1V4TA 2P9NB 3EKUA 1HJOA 4RTFD 4FWQA 2ASPA 1KAYA 3VETA 2YHXA 3AY9A 2D0PA 3VGKA 1RFQA 4M63C 2GTDA 2Q97A 4I6MA 4XEIA 1BDGA 5AZIA 1ZC6A 4EHTA 1NGEA 4BC4A 1U2VB 3UKRB 3SMSA 2YCHA 3MN9A 4H5VA 2V7ZA 3A5NC 3M3ZA 5AQLA 4BR0A 2I7NA 3CJ1A 4FWMA 4LC9B 2P9IA 3BP8A 5AQXA 3DXKA 1K8KB 4GY2B 3WUHA 4BQZA 3AAPA 1SAZA 3VF6A 3EZWA 2QM1A 4CZEA 4IO8A 4J8FA 4JAXA 1KAZA 3VF2A 2QWMA 2W41A 3ATUA 4B1ZA 4IWVA 4CZFA 2E1YA 4CZHA 5B8HA 3KHYA 4H03B 3HSCA 2GEMA 4BRFA 2FSKA 4BRDA 4NO7A 3H6EA 3OHRA 5AQHA 5I9EB 2V52B 2YI1A 4FWRA 5F1XA 4BRCA 1T6DA 2AP1A 2D0OA 3KVGA 3MMVA 3VOVA 2P9UB 4H5NA 5BRDA 1GLCG 3FZLA 5FPMA 3MN5A 2E2OA 3U9ZA 5AQVA 1WOQA 3EKSA 3HBTA 3WXIA 3EN9A 2BUPA 1BA0A 4BRHA 1E4FT 1GLEG 1GLAG 1JCEA 2ZWHA 3DXMA 4BR2A 5E26A 1IJJA 4XH1A 2BTFA 4BRLA 3QMLA 3CI5A 4WQ5A 2ZGYA 3FZFA 3HZ6A 3FLCO 3CETA 1ATSA 3RSEB 4CBWA 5AQJA 4I6MB 4MO5A 2IVNA 5AQSA 1ATRA 3QDKA 4K43A 4KBOA 1WUAA 5E84A 1JCFA 1GLFO 2A6AA 1HX1A 5AZIB 5AFUH 3GG4A 5FPNA 2V51B 3TPQA 4H0TB 4CZIA 1SZ2A 1NGBA 5KPTA 4CZLA 3AAQA 4K41A 2HMPA 3ULEA 3TU5A 4BVOA 2P9IB 3H1VX 5KQDA 1QZ6A 1EQYA 3L4IA 4PKHA 4BRNA 2A41A 1DKGD 3VEOA 3DXKB 2NRHA 2DPNA 1ATNA 3G25A 5BN8A 3VERA 4BQLA 3F9MA 3IFRA 4O5FA 3UE5A 4BRMA 5AQNA 4XH5A 2P9LA 3W0LA 3U4LA 4GNIA 4FOEA 2Q1NA 2ZGZA 4H0PA 2EWSA 3DJCA 3FE1A 1NGAA 3GE1A 5AZJA 2FSJA 1Q18A 3JXUA 5AQTA 4E1JA 4H5WA 1NGHA 5LY3A 3CQXA 3H45C 4C23A 1NGCA 5AFUA 1ZBSA 4FSVA 3D2EA 5KPZA 1X3MA 3C7NA 4Z94A 3O8MA 4CZMA 2QWNA 2QWLA 1BWFO 2GWJA 4JN4A 2HF4A 3VEZA 3FZHA 2PBDA 3DXMB 4ISGA 3M6GA 5BPLA 3WT0A 4DHYA 4JHDB 4JNEA 1Z6RA 2QWOA 4F9OA 4IZ9A 4BRGA 4AM7A 4A2AA 3H1QA 1HKGA 3UKUA 3ZX0A 1MA9B 1XC3A 2ASOA 5KQ8A 1NM1A 4CZGA 3WQTA 3DWLA 4EHUA 4BRQA 3MCPA 4CI6A 4JD2A 5FPEA 5EY4A 4DB3A 2A3ZA 3VEXA 1HKCA 2HOEA 4AM6A 1HKBA 3QBWA
chains in the Genus database with same CATH superfamily
3ULEB 1E4GT 2J4RA 3HOSA 1RTDA 3THYA 1R59O 4C1NK 2HHUA 1V4SA 4DV3K 3E66A 3NAEA 1VHXA 2HHXA 1XC9A 2A40A 1KAXA 5KGWA 3RMCA 1LWCA 4A61A 2Z1HA 2GUPA 4Y1DA 3LWMA 3WEEB 3D6RA 4K25A 4E72A 5AJ3K 3R6MA 5GIPA 3O4WA 2O8DB 3MX2A 5J1EA 1VSMA 2FLOA 4FPBA 4JI2K 2NRWA 3TTFA 4GKJK 1BGXT 4JI1K 4K8ZA 4KAZA 4YOVA 3ZSWA 1N32K 4PA1A 2KHOA 3SPZA 2NNWA 3PIPL 4BVPA 1GLDG 2IVOA 3A5OC 3SAHA 5KGXA 3A5LC 1HLUA 2VYPA 1B9DA 3VEYA 4CJPA 3I0SA 3WNGA 5JVHL 4FXDA 1VK0A 5AQOA 2WC9A 1TGOA 4RWTA 4I9QA 4M3TA 4M7YA 5ADXA 5JMVA 2WONA 5AQQA 1VSJA 3UKUB 4JKGA 1NGDA 4BG8A 3LAKA 2YJFA 2GX9A 3NCIA 2IIRA 4DU1A 1VQON 4Y1CA 1RDUA 5EXWA 4C8KA 4JD2B 3DLRA 3TAFA 4ISEA 3ENOA 1N6QA 1KVAA 2YKMA 3IMXA 4C8NA 3OJSA 4LF5K 3OYBA 4DV1K 2E2QA 3TAPA 3CFPA 1S6PA 3T7ZA 1UA1A 3I33A 4DFPA 4E19A 3CJ9A 4CERA 1Q9YA 3RMBA 1HQEA 4KO0A 4E0DA 4KHNA 3V9XA 1C0UA 4BRAA 4DSEA 4Z4IA 3M1FA 1U04A 3VQQA 1ZXOA 3RWUA 4WF9L 2GWKA 2OANA 3WQUA 3O80A 1S72N 3HM8A 1TYQB 1Q81O 3K57A 2CGKA 1VQ7N 3QEPA 3WXJA 3AVBA 4CJ3A 2E1ZA 5BRFA 1RILA 4WYBA 2EX3A 1JL2A 5T7BA 4ISFA 4DWIA 4KPYA 4FVMA 5JVGL 3IDHA 2O4IA 1EX4A 3T69A 3I8DA 4FL9A 3AO3A 4BROA 2P9KA 1C0FA 3MECA 1RBUA 1Y64A 2QW9A 4FO0A 1QVGM 3ZEUB 4M3YA 1C6VA 3CCMN 2CH5A 2ZQBA 2Y1JA 1NMDA 3AVKA 2WUSA 3U6FA 4B9MA 3MXJA 3VQ9A 1UA0A 1YVUA 3CD6N 3RMAA 4DTPA 4PKGA 4OPKA 2V7YA 4XH4A 3ZX3A 2Q31A 3MWPA 3F73A 4JI6K 4E7IA 4FWPA 4IEIA 3C65A 1ZBLA 4E7KA 4CCHA 3NE6A 1RBSA 3ID8A 4CJWA 2VG6A 4R79A 4K8XA 3KWGA 3S5TA 5BR9A 2RKIA 1U47A 4PY5A 3A5MC 3M8RA 3D7EO 4DTRA 4LF4K 1XWLA 2HHHK 1HMVA 4B8AB 4JYAK 2OPPA 1RBVA 2IDOA 3VQPA 2UYTA 4AHCA 1M1KO 3WNFA 4J2BA 4DFMA 1LOTB 3ENHA 4FWNA 3T1HK 1QHAA 4CEQA 4A62A 3SV3A 1JCGA 1GOAA 4DCHA 3BZCA 3GOIA 3O1WA 3ASMA 2VGMA 3UKRA 3A0IX 1VQ5N 1XHXA 1DLOA 1U4BA 4NLBA 3CJAA 3DRSA 3OW2M 4CGFA 4KB0A 4IJAA 3LPTA 3KKRA 2UXCK 1BUPA 4ILJA 1S1TA 1W97L 4B3TK 4WFBL 2YX6A 4PQUA 1D5AA 1L3UA 3LWLA 3CCUN 4B9SA 3L4QA 4G9ZA 5CR4A 1DTTA 3LM2A 1YJWN 3D2FB 3LPUA 5M1PA 2B6AA 4WQ4A 4DTUA 3ZT4A 3P39A 3SCXA 2E8AA 2E6MA 5AQPA 2FBXA 3ZT3A 1QHTA 1MDUB 3WEEA 2F9WA 2P9UA 1WLJA 4Z4EA 3GBTA 2E6LA 4BDPA 3FFKB 1EXQA 2O8FA 3V6DA 4XJXA 1V4TA 2P9NB 1NJXA 2ASPA 1KAYA 3OY9A 2P5GA 3VETA 4EP5A 3LP3A 3QNOA 1SV5A 4AQYK 1RDCA 1NOZA 1NU0A 4DR5K 4M63C 1JXBA 4XEIA 3TR8A 3OYCA 2KKZA 1UAXA 3HSTB 1BHLA 4X66K 1L3SA 4H5VA 4IG3A 3G71N 3SJJA 4BDYA 4PUOA 1IKXA 5AQLA 4BR0A 2QA4N 4FWMA 5DMRA 3BP8A 5AQXA 4HCBA 3DXKA 4A5BA 4ELUA 3LZJA 1K8KB 4DQIA 5SZTA 2HVHA 4OPHA 4L8RB 3AAPA 3VF6A 3EZWA 1JLFA 4OX9K 5J2QA 3HPHA 3OS2A 2G8VA 4ICLA 1ITGA 3CCRN 4ID1A 4RW4A 1NKCA 4KV8A 4B1ZA 3J7ZO 3KTQA 4CZFA 2E1YA 2VWKA 4H03B 4YOXA 4BRFA 4FJNA 4NO7A 3PSIA 2V52B 1KVCA 1JJ2M 1EETA 1GOBA 1T6DA 2AP1A 2X6SA 4E7HA 3ALYA 3QEIA 5BRDA 3QETA 3KK7A 3FZLA 2YHBA 3OVNA 2E2OA 3EN9A 3THWA 4OKKA 1YI2N 1BA0A 2HBJA 2KQ2A 3C6UA 3DXMA 1IBMK 4XH1A 1XMOK 5GADP 3AVFA 3KLIA 4HUGA 2DTUA 1ATSA 5AQJA 3OYDA 3O3HA 1WN7A 1W7AA 4IFVA 4QAGA 4BWJA 4FZXC 5E84A 1MU2A 4CEAA 1BIZA 2NRRA 1GLFO 4M42A 1BI4A 1OH6A 5FPNA 2V51B 1WBBA 4FJHA 4IDHA 1VQNN 1SZ2A 5KPTA 1KC8O 1A5WA 3MWTA 2BANA 2ZJPL 1QZ6A 1EQYA 3VEOA 1JLGA 2XRIA 4DMNA 3DRRA 1OH5A 5BN8A 4KHSA 4CF8A 3DLBA 3BDPA 3UE5A 4W5RA 1RTJA 4OPJA 1TAQA 2YNIA 2HSTA 5HP1A 2Q3SA 4YY3K 3V4IA 1K9MO 3Q7BA 4H0PA 3OYLA 4DU3A 2F7TA 3TANA 3FE1A 2BDPA 3VQ5A 1QSYA 3CQXA 3H45C 1NMNA 2FC0A 1WSJA 4YHHK 1RT4A 1ZBSA 4FSVA 3C7NA 4Z94A 3O8MA 4CZMA 1X9MA 3CYMA 2QWLA 3VEZA 4OJRA 4FLUA 3THVA 2D0BA 1FKOA 1C0TA 2BE2A 3AA5X 4NCGA 1TL3A 4WFAL 4CJTA 3LP2A 4YNQA 1HR0K 3TSPA 1BQNA 3WQTA 4DV4K 4B9UA 4W5QA 1J5EK 4YOTA 3IAYA 1QE1A 2HOEA 2O8BB 1TK0A 4AM6A 3KLGA 4PL8A 1NGIA 2XO7A 1ZBIA 1XUPO 3HK2A 5ADXH 5HOOA 4M45A 3FGUA 3EL2A 1SL1A 3AO1A 3SK3A 4BY9C 3VQCA 2VGNA 2O8EA 1S5JA 1JLQA 3CQYA 3PX0A 4DTJA 4I7FA 3SMPA 4BGAA 1LV5A 1RDDA 2P9LB 4OO1J 2ZF5O 3K59A 5F0XA 3SUQA 4RG8A 5JS2A 3QO9A 1NNEA 3AVLA 5AZJB 2ITGA 3F2KA 4FM2A 3SYZA 4NB4A 1GLLO 3H08A 1BG3A 3VF4A 4GW6A 4F3TA 5GAGP 4BREA 4YOWA 3D2EB 2Q0RA 4ID5A 4A2BA 4CFDA 4DTXA 4B3RK 3LDNA 4DSKA 1YJ9N 1TV6A 3TAMA 1BOTO 4FLXA 3SI6A 3WXKA 2HVIA 3UIQA 1HNZK 3VN5A 5AQMA 4MO4A 3V1QA 1KCFA 2LSNA 4I2QA 5J2PA 4F3OA 1KXPA 4E1MA 4GV9A 1XQSC 4KI6A 3RVCA 3CIPA 4TSXA 4DR2K 3KK2A 1K8KA 3O9TA 3OJUA 2QKBA 5DK5A 1KRPA 2HHWA 3MN7A 5AQWA 3AVIA 4CD1A 4LF6K 1L3TA 1NBWA 5AQRA 4GKKK 4HTUA 4OGEA 3KZBA 2HBKA 2FXUA 1HUXA 4ILGB 2GELA 2QWQA 4B9NA 4CK1A 3LM9A 2QTDA 3CERA 3VQDA 1GOCA 4JKDA 4EAHD 2HF3A 4KI4A 2P9PA 3AO2A 1WSFA 5TKYA 4DF8A 2CH6A 5M1NA 4DV7K 3DLGA 5EVZA 4CJLA 2Q2RA 2H3GX 1NGJA 3NDKA 4H0YB 1NK9A 3LDOA 4DV0K 4M3ZA 5AQKA 4MFBA 1FJGK 5FPDA 4JI7K 3THXA 4WQ4C 4JKAA 5CE3A 4QS7A 3C94A 3VEWA 2W42A 1TAUA 1TUYA 4WE1A 4X62K 3OBWA 2E2PA 2QXLA 2YV0X 4IFEA 3S9HA 4DR4K 3HOTA 2ZM6K 1SL2A 3KK1A 5CZ2A 4LSNA 4CZJA 5J2MA 1LAWA 3J81O 3QINA 1TKZA 3J80O 4PKIA 3SLCA 5LJVA 4N56A 3IUCA 2NRZA 2IVPA 3E1YA 1NWKA 4OPAA 4YFUA 1UWBA 4BR9A 3LANA 3HJFA 3VQEA 4W5TA 3K0SA 3TAGA 5AQIA 5ELZA 2C1GA 1ZBFA 2KZMA 3KIOA 1T3VA 4M3UA 1T6CA 4DQSA 3EE8A 4BR7A 4N41A 3VQBA 2ZJQL 5KRTA 3OS0A 2XY6A 3NVKA 3DOLA 1ZYQA 3CPWM 1I3AA 1YAGA 3O9UA 1QQNA 4ELTA 3ZETB 3TSUA 1NOYA 3FZMA 4FCYA 3L0QA 1BCOA 3ISNC 5F2RA 1P8ZA 1LCUA 4DSLA 4FJ9A 1WAJA 4FJMA 2O8CA 3CCQN 4CBUA 4LSLA 2X78A 5LMUK 1YUWA 3LL3A 4K42A 4N5SA 2HNZA 3B8AX 4AHSA 4AHRA 3VQ6A 4BC3A 4BACA 3CC2N 4NCBA 4FZZA 4E1NA 1QZ5A 1B92A 2NZTA 4MLHA 1RDBA 3AA4A 2VQFK 3U3GA 1YVNA 1S22A 4E7LA 1KFSA 4BE7B 3HP6A 3M8SA 5AR0A 1P90A 3DLEA 4H4OA 4CJ7A 3G4SN 1S1UA 3ZSZA 1Z26A 4BECA 1EWRA 3UB5A 4JV5K 3CQ8A 4CHZA 4NYFA 2GBZA 2ATQA 1RTIA 4CGDA 3HPGA 4U67L 1ESVA 2P9SB 3OS1A 1CZAN 2NLXA 4BE1A 3NH0A 3LALA 1X3NA 3K9JA 4I9LA 1OH7A 1FW6A 3MEDA 5BPMA 1RT7A 4BR5A 3SBTA 4CJKA 1GLJO 5LMNK 1QSLA 4CE9A 4X65K 3N4PA 1RT5A 4RTFD 3NF7A 3QESA 1C0MA 1LW0A 4CJFA 3V9ZA 2YHXA 1EP4A 3AY9A 1J9AA 2QK9A 3EEQA 1RFQA 4I6MA 3I0RA 5AZIA 1G15A 1NGEA 1U2VB 3D45A 3PO5A 2V7ZA 3A5NC 4CFCA 3SQ1A 1HNXK 1TVRA 3CJ1A 2FBTA 4DV2K 4R5PA 3QERA 4FZYA 3J7AP 1BL3A 2RE2A 3WUHA 1CXQA 4NCAA 4CZEA 5MLCQ 3DLHA 3HO1A 1KAZA 4IG0A 1VSKA 5LL6Z 2WTUA 4M3WA 1YHQN 4KH5A 4CZHA 3AO4A 2GEMA 3HSCA 2FSKA 4BRDA 1K8AO 3OHRA 4KREA 5AQHA 1S1WA 2YKNA 4FK0A 5GAHP 4BRCA 4RW8A 4FLTA 4JLHA 3BY5A 1GLCG 3CYGA 3MN5A 3K5MA 2F8SA 2BUPA 1F21A 4B9TA 1VSIA 1JCEA 2ZWHA 1EKEA 4BR2A 2QI2A 3OYGA 5E41A 2BTFA 2EHGA 3DI6A 4BRLA 3CI5A 3FZFA 3HZ6A 3FLCO 4CESA 5AQSA 1ATRA 3QDKA 4K43A 4FLWA 1WUAA 4FLZA 2IGIA 4FVUA 4WFNL 2A6AA 3B6PA 3GG4A 1KVBA 4O0IA 2PFUA 3VTHA 2IAJA 4C8LA 4DTMA 1VQ9N 4IKFA 3AAQA 4K41A 5C15A 2HMPA 4Z4FA 1C1AA 3V9WA 1WB9A 3ULEA 2P9IB 3H1VX 3NGIA 1S9EA 3O4QA 2A41A 1DKGD 4JI0K 4KTZA 2NRHA 3E9LA 2YNFA 2WOMA 3F9MA 3IFRA 1RCHA 2NUBA 1XNRK 4CW7B 4KHUA 5AQNA 3M8QA 2O8DA 4JRPA 3W0LA 5I42A 3U4LA 2UUAK 4GNIA 4FOEA 3HPOA 4HHTA 4YOYA 2EWSA 1ILYA 1NGAA 1RT2A 3GE1A 3IKMA 2FSJA 1NK6A 4B9VA 4DSJA 3R1XA 2E4LA 2HHTA 1Q18A 3JXUA 5AQTA 4H5WA 3ZT0A 5DM6L 4KHWA 1NGHA 2UXBK 3HYFA 5KPZA 1X3MA 5CY4A 2F4VK 3Q7CA 4CFBA 4BDZA 1BWFO 3LDSA 5CYQA 2XY5A 2X6NA 3DLKA 4ISGA 1W9HA 4A57A 3WT0A 4DHYA 4JHDB 3J7YP 1ASUA 4BRGA 4AM7A 4A2AA 4CFAA 3O9RA 3UKUA 5CHIA 2ASOA 1YJNN 5KQ8A 1NM1A 2XY7A 4BRQA 3AVNA 4JD2A 5M1QA 4LD0A 5HROA 5EY4A 4EZ6A 2A3ZA 3VEXA 1HKCA 4CGHA 4DV6K 4FK2A 3VQ7A 1HKBA 3ZSXA 5FLXO 3JAMO 1BO5O 1LAVA 3M5RA 1ZBUA 2YHWA 3TARA 1RNHA 4B1VA 2RPIA 1LW2A 4F2SA 3AARA 2ETJA 3E9OA 3HXMA 3P1GA 4KTWA 4JKFA 4ZHRA 2OCEA 3MEEA 3ZLJA 3VEVA 1Q7YO 3T19A 3DOKA 1JLAA 4CJUA 4LH4A 1KD1O 1TYQA 4O8KA 3CXCM 2HHIA 3TAEA 4M3XA 3P83D 2E20A 5GINA 4CJ5A 4FJ5A 4MLEA 4O44A 4W5OA 5AQZA 4V19S 2YNGA 4O0JA 2JLEA 5HRPA 3AGKA 1L5UA 1D4XA 4RCHA 1Y97A 5JLFA 1KSPA 3VA0A 3V81A 1QQCA 1JKHA 3ZEUA 4FW2A 4CZKA 4U7BA 1C0GA 2F9TA 4O4GA 1VQPN 3VQ4A 1U48A 3ENBA 4H4MA 4CECA 3SJHA 2X74A 4JS4A 1TK5A 4H0OA 1BQMA 3JSMA 4CJVA 2A1SA 4FWKA 4JKHA 3AVHA 4F2RA 3NHGA 4DQRA 1J53A 1NK5A 3F5TA 2DFHA 4GV6A 2OPRA 3EE9A 3RRHA 1Q86O 1NJIO 1RT6A 3SPYA 1CZ9A 4KTQA 2CGJA 1T8EA 3PSFA 1VSEA 3P4IA 3L2RA 3THYB 4G1QA 5C2FA 4PL7A 3PV8A 4DKWA 3QFPA 5GIOA 5BREA 2Z1IA 4IJNA 4KKOA 4KH6A 4CIGA 1SUQA 1TL1A 3ZSQA 4OGCA 2NRTA 5C24A 4B3SK 3NFAA 3ATVA 1G99A 3SUNA 2JWKA 3TAQA 4BGBA 4Z4CA 4FWOA 1SKRA 1D8YA 3I8BA 3QEVA 4FM1A 3HM9A 4M41A 1T44A 3KJVA 3VGLA 2PYJA 1NJYA 3PO4A 1U6ZA 1X9SA 1X9JA 4B8CA 2AJQA 3CCVN 4CGJA 3DRPA 5H1SQ 1XNQK 3L6QA 3MN6A 3PLAA 3G10A 3S41A 4FWLA 3TSQA 4GVMA 1VAZA 4MDBA 3D2FA 1RBTA 2CGLA 4IOCL 5BRHA 1IG8A 5IWAK 4JKGB 3AVMA 3QFUA 4HUFA 4GVEA 4CJRA 2RN2A 4O55A 1RDWX 4PHTX 1HYZA 4FWSA 4CHPA 3I55N 3MXMA 1EO1A 5FRNA 2OTJN 4B1WB 3ZSOA 4CJQA 1BA1A 2VWBA 3H3OB 2YNHA 4E89A 1W2BM 1IBLK 4FPAA 3W3DA 3NGZA 4JK8A 4YDUA 4LFBK 1M90O 5HRNA 3QIOA 4OKJA 3WXLA 4KH4A 3VENA 1H1VA 5AQFA 3LDQA 2P9NA 3K9KA 4BRKA 4B3OA 3GL1A 3SUPA 1N33K 3L8BA 3TWHA 3SQ4A 2UUBK 1IKYA 3CCLN 3S3OA 1S3XA 2D0AA 4BRPA 4CHYA 1S9GA 3GDQA 3TI0A 2I7PA 3HI0A 4UY8O 2E88A 1SS6A 3BUZB 3RR7A 2G8FA 3NF6A 4JHDA 1TKTA 3FFIA 4IBNA 2P9KB 4O8UA 2VQEK 4EFHA 2A42A 2VG7A 3QBXA 1R0AA 3L2QA 3RR8A 1QQMA 3FZKA 4HWIA 5KPRA 4HVJA 4DLEA 1BISA 2RHKA 3O08A 3O3GA 3K2PA 4ELVA 5CZ1A 3BEXA 3VQAA 3NH1A 1IKVA 1DEJA 3NVMA 3R3LA 1XMQK 1A5XA 2P5OA 2FSNA 2YJEA 4UQGA 1HYVA 4B1UB 5EU7A 1J6ZA 1WAFA 3WNHA 4FJXA 2E2NA 5HRSA 3O9SA 5LJWA 5JLHA 1NGGA 3ZT2A 2OZSA 4X64K 3VESA 3U9DA 3L3UA 3PX6A 2VCPA 3LZIA 3EO3A 2ASMA 3NF8A 3CMEN 1HJOA 5JS1A 3OYHA 3OYJA 2NRXA 3P31A 2D0PA 4AHVA 3V9UA 1N34K 3ULDA 3HVRA 5D3GA 3G0ZA 1ZC6A 4EHTA 4BC4A 5HRRA 2IOCA 3UKRB 1OVYA 3MN9A 4PWDA 4FJJA 3M3ZA 3V9SA 2G8UA 3LP0A 4LC9B 1IH7A 1NKEA 2HW3A 1L3VA 3RTVA 1Q8IA 1DTQA 1YTUA 2P1JA 2KFNA 2VWJA 3OA9A 1JL1A 2WFBA 4GY2B 4W5NA 4BQZA 2QM1A 4IO8A 4J8FA 4JAXA 3NBPA 3VF2A 2QWMA 1TKXA 2FBVA 3NF9A 3ATUA 3EYZA 4IWVA 3HL8A 3OYNA 4BE2A 5B8HA 3KHYA 4JEPA 3H6EA 1CLQA 4B3MK 5I9EB 4KB1A 4FWRA 4HCCA 5F1XA 1IV0A 3PY8A 3PX4A 2D0OA 2RF2A 3KVGA 2G8KA 3MMVA 4JI3K 3VOVA 2P9UB 4FM0A 3KWIA 1C1CA 2XHBA 1NKBA 4O5BA 1HNVA 4CHOA 3D0PA 5FPMA 2O8FB 1WOQA 2W6LA 3HBTA 3WXIA 4DF4A 4BRHA 2F96A 3VA3A 4DR7K 4NYNA 1OVQA 3QMLA 4WQ5A 2ZGYA 4JK9A 3CETA 3RSEB 2KLAA 4MO5A 2IVNA 3K5OA 4KBOA 1K6YA 3MX5A 4DFJA 3MXIA 3SZ2A 3TPQA 2JWLA 3OBYA 3O3FA 3C6TA 4OKEA 4CZIA 1NGBA 2O8BA 4AILC 4MQ3A 2Y1IA 3E01A 3OYEA 2UUCK 4BVOA 4FJIA 3C6HA 5KQDA 3L4IA 4PKHA 4BRNA 3DXKB 4B08A 2DPNA 2ZJRL 2HHQA 2GUIA 3VERA 4BQLA 2NRVA 4FK4A 3L2VA 3OYMA 3AA3A 2HMIA 2P9LA 3NMUA 4MDAA 2A1RA 4JKEA 2Q1NA 4I2PA 2ZGZA 2IC3A 2IS3A 3ID6A 5AZJA 4JI8K 3SQ2A 4B9LA 4E1JA 3KLEA 5JENA 2XY8A 3VQ8A 5LY3A 3KLFA 4C23A 5AFUA 4CEDA 4DG1A 3D2EA 4CHNA 3V1OA 1QS4A 2GWJA 1QVFM 4JN4A 3CC7N 1VSHA 3THWB 3FZHA 2HNYA 2PBDA 3DXMB 1U45A 4CIFA 3WXMB 5BPLA 3OYFA 4JNEA 3MEGA 5C25A 1Z6RA 1RTHA 2KTQA 4BEBA 1D9DA 1B9FA 2HBLA 4IOAL 3H1QA 4JKCA 4CEBA 3T3FA 3CG7A 3V1RA 3ZX0A 1MA9B 1XC3A 4FW1A 3F9KA 1RDAA 4YORA 3MCPA 4CEEA 4CI6A 1BI4B 1RBRA 2OZMA 1WSIA 3O4NA 4CF2A 5FPEA 1O1WA 5KTQA 1D9FA 3K5NA 1WSHA 3DLLL 3T1YK 5M1FA 3I56N 4HUEA 1WSEA 1BIUA 3RMDA 4AH9A 2C1IA 1OKJA 3DM2A 5C42A 4KHPK 1YTAA 5K14A 5BR8K 4CGIA 3VMFB 4DTSA 3JS6A 4B9QA 2QWPA 2HBMA 4QS8A 3QEWA 4DLGA 3QICA 1MWMA 2PAVA 3N4QA 4CJ4A 4Y0WA 3B6OA 2A5XA 1UOCA 1N5YA 3QB0A 2ZD1A 3K58A 1WSGA 3U8XA 4DSIA 5EX5A 1VQ8N 1TUUA 2W40A 4LF8K 4KFBA 4BC5A 2D4WA 4DTOA 4DQ8A 3AA2A 1HYSA 2UU9K 1CXUA 4QCLA 1VRUA 4JKBA 3H46O 4BR4A 1J5OA 3DMJA 4F8RA 3MAQA 3C7NB 4DQQA 1RT1A 3VPZA 2OYQA 3A8YA 3M8PA 4CF0A 5I3UA 3H3NO 4YDUC 1SL0A 1KTQA 3TABA 4H5RA 2VG5A 3C0BA 2G8WA 3OTOK 2QWRA 4DU4A 1SKSA 1HNIA 3LDPA 2FF6A 2QEXN 3DAWA 2QKKA 3HP9A 5TKWA 2OPSA 4CF1A 2W6KA 3C95A 3CJCA 1J54A 5AQYA 4IXCA 5BN9A 1RGIA 4IEEA 1HQUA 4RW7A 5BPNA 3AVAA 1NK0A 1QTMA 3BF1A 4B1XB 4DUZK 4EZ9A 3P38A 3AO5A 3OYAA 2OA8A 1SQKA 2D1KA 3CCSN 4Q5VA 2AA4A 1YIJN 3ZETA 1N8RO 2ZE2A 3BZKA 2O8EB 5KI6A 4Z0UA 3NGYA 3U3YA 1BCMA 3L2WA 3BF3A 3BGRA 3TTDA 1S1VA 4H0VB 3CJBA 3MK6A 1NK7A 1KQSM 3PIOL 3O5BA 5JICA 5IT9O 1HRHA 2Z1JA 1NK8A 3L2UA 3MCAB 4JK7A 1VQMN 3IG1A 1N36K 3A2FA 1QQOA 4M7XA 3FR0A 4J2EA 3RSEA 4BG9A 3WNEA 4OLBA 4FLYA 3PUFA 4GV3A 3CM6A 4LF9K 3KD1E 4HTLA 2OTLN 3O6WA 3K5LA 5AQGA 2Q0UA 3OYKA 2HNDA 3HRGA 4DQPA 4L3QA 1VSDA 2ITMA 4E7JA 5C10A 5C12A 3T1AA 1ZBHA 2P9SA 1Z05A 2DFEA 4OVLA 3LAMA 4LF7K 2YHAA 3HTVA 1X1PA 3EZ5A 5EOYA 4DS5A 5AQUA 4FOIA 1KLMA 2BH1A 4NXMK 4CD3A 4DR1K 3IRXA 4BRIA 4E3SA 4DR3K 4CBXA 1NLVA 1T05A 1VQ4N 4BC2A 1BU6O 1NK4A 4DS4A 1FK9A 2JGUA 4ILHA 3CJ7A 1C1BA 4FYDA 1KFDA 1NGFA 5DM7L 2P9PB 4XIUA 4N76A 2E5LK 3CHWA 2FF3B 3MDQA 4CJEA 5C2DA 2WBNA 3O1BA 1U2VA 4OLAA 3AV9A 3CF5L 3AVGA 1JLEA 3SAGA 1YXQA 3THXB 3RRGA 4DUYK 5HL7L 1HPMA 4N47A 1DGKN 3KK3A 2YHYA 1VQ6N 4C8MA 3KLHA 4CJSA 4H5TA 4LH5A 2D5RA 1GLBG 4RW9A 4M3RA 4B1YB 3ITHA 4QS9A 4LY7A 2UXDK 4K0KK 4AF1A 2B5JA 3DYAA 4CIEA 1NG9A 2G8HA 2Q36A 1HNWK 3LDLA 4EIAA 5A2QO 3P5JA 4KHYA 5SWMA 1I39A 4WQ5C 3R9PA 2I5JA 4CF9A 3QLHA 2KW4A 3AVCA 4DFKA 5FDLA 4GMJB 2DY4A 1KLNA 5FRMA 1ASWA 3ZX2A 3R8EA 2HHSA 1MWKA 3L3VA 4H0XB 3J8AA 1YITN 3ZYYX 4JS5A 1TK8A 1WNSA 3LP1A 3AVJA 3VGMA 4FJKA 4NXNK 3EKUA 1JLBA 4FWQA 4JRQA 3S3NA 1IO2A 4F4KA 4QOZB 2PZSA 3KKSA 5GAEP 2O8CB 3VGKA 1JXEA 2DFFA 2GTDA 2Q97A 2P51A 1IG9A 4IO9L 3CCJN 1BDGA 2GV9A 1IBKK 4CGGA 5FROA 3IS9A 3C6AA 3TTCA 3SMSA 4DR6K 2O4GA 2HHVA 2YCHA 1OH8A 4IFYA 5KRSA 1Z25A 5CYMA 3QEXA 2I7NA 2Z1GA 4DTNA 2P9IA 5J2NA 4ZTJA 4KRFA 1SAZA 4WCEL 3NH2A 3CC4N 1XI1A 1Q9XA 3OYIA 1FKPA 2W41A 4JI4K 4FJ8A 1Q82O 2PY5A 1CZBA 3E9PA 1SKWA 1TKDA 4ZTFA 4IDKA 1S1XA 2YI1A 3SAFA 3SBGA 3O9QA 1NJWA 1I94K 3ZSYA 4H5NA 3JYTA 2KFZA 1E3MA 3SNNA 3ZCMA 5HLFA 1YF5L 3G6EN 1NJZA 1WBDA 3U9ZA 5AQVA 3EKSA 1LWFA 4DV5K 2W00A 1E4FT 1GLEG 1GLAG 3CCEN 5E26A 2F8TA 1IJJA 4CEFA 4Z4HA 4FJGA 5HBMA 4YOUA 4C8OA 1EWQA 5C0YA 4CBWA 3AGRA 4I6MB 4CEOA 1REVA 4J2AA 4CHQA 3CM5A 4BE0A 1JCFA 5AZIB 1HX1A 5AFUH 1YT3A 1T03A 4H0TB 3QNNA 3ZT1A 1VSLA 4CZLA 4IOXA 1VQLN 3VTIA 3CFOA 3HT3A 3TU5A 4DSFA 2PYLA 2BGGA 4RW6A 4KHQA 1VSFA 4FJLA 1ATNA 3G25A 3QIPA 4CK3A 4BWMA 1T7PA 3HVTA 4Q0BA 4O5FA 4BRMA 1O13A 4XH5A 1JLCA 3CPEA 4AHTA 2G8IA 4H8KA 4FJ7A 1VQKN 2D0CA 3DJCA 4EP4A 2HB5A 1U49A 3ZSRA 4AHUA 1NGCA 1HJRA 2QXFA 1A5VA 2OPQA 1FXXA 4LFAK 1K73O 2QWNA 5M1KA 2HF4A 4FLVA 1ASVA 1QSSA 3M6GA 4LFCK 3S3MA 4JI5K 2FBYA 2QWOA 4F9OA 3SV4A 4IZ9A 4A5AA 1VRTA 4C1NI 4J2DA 1HKGA 5M1OA 3ZSVA 3KD5E 1XHZA 4Z4GA 3SQ0A 4CZGA 4NLCA 3DWLA 4CK2A 1RT3A 1DT9A 4EHUA 1LWEA 3EY1A 3SUOA 3CFRA 4A59A 1IKWA 3CMAN 1X9WA 1HPZA 2R7YA 4DB3A 1W0HA 4CEZA 4CVNE 2B4JA 2KZZA 3QBWA 1S6QA
chains in the Genus database with same CATH topology
4PL8A 1E4GT 1BO5O 1NGIA 3ULEB 1XUPO 3I56N 3M5RA 2J4RA 3HOSA 5ADXH 5HOOA 2YHWA 2C1IA 1OKJA 3FGUA 3EL2A 1R59O 4C1NK 4B1VA 1V4SA 3E66A 3SK3A 3AARA 2A40A 1KAXA 3E9OA 2VGNA 4BY9C 3VMFB 4JKFA 4A61A 3JS6A 3VEVA 4B9QA 2QWPA 2HBMA 3CQYA 2GUPA 4QS8A 1Q7YO 3WEEB 3QICA 1MWMA 3D6RA 4K25A 3SMPA 4BGAA 2PAVA 3N4QA 3R6MA 4Y0WA 5GIPA 1KD1O 3O4WA 2A5XA 1TYQA 2P9LB 4O8KA 3MX2A 3CXCM 2ZF5O 2FLOA 4FPBA 4OO1J 3QB0A 5F0XA 2NRWA 3TTFA 2E20A 3U8XA 5GINA 4YOVA 5EX5A 1VQ8N 4MLEA 2KHOA 1TUUA 2NNWA 5AZJB 2W40A 5AQZA 3PIPL 3F2KA 4BC5A 2D4WA 4BVPA 1GLDG 1GLLO 2IVOA 4NB4A 4DQ8A 1BG3A 3A5OC 3AGKA 3VF4A 3SAHA 1D4XA 3A5LC 1HLUA 4RCHA 5JLFA 4JKBA 3H46O 2VYPA 5GAGP 4BR4A 4BREA 4YOWA 3D2EB 3C7NB 2Q0RA 3ZEUA 3VEYA 4A2BA 4CZKA 3LDNA 3VPZA 4U7BA 1YJ9N 3A8YA 1C0GA 1BOTO 5JVHL 2F9TA 3H3NO 4YDUC 5AQOA 2WC9A 1VQPN 4H5RA 3WXKA 3C0BA 4RWTA 2QWRA 3ENBA 5AQMA 4M7YA 5ADXA 3SJHA 4MO4A 5JMVA 3LDPA 2FF6A 2QEXN 3DAWA 5AQQA 1KXPA 4H0OA 1XQSC 3UKUB 4JKGA 3RVCA 4GV9A 1NGDA 4BG8A 5TKWA 4FWKA 4JKHA 2YJFA 3CIPA 2GX9A 2IIRA 1K8KA 3O9TA 3CJCA 5BN9A 5AQYA 4IXCA 1RDUA 3F5TA 5EXWA 1VQON 4GV6A 4JD2B 1RGIA 4IEEA 3MN7A 5AQWA 3EE9A 4CD1A 5BPNA 4ISEA 1Q86O 3BF1A 1NBWA 1NJIO 3ENOA 4B1XB 3IMXA 5AQRA 3P38A 2E2QA 3KZBA 2CGJA 2HBKA 2FXUA 1HUXA 3T7ZA 4ILGB 3I33A 3P4IA 3CJ9A 1SQKA 2D1KA 3CCSN 5C2FA 2GELA 2QWQA 4PL7A 4DKWA 3QFPA 2AA4A 5GIOA 5BREA 1YIJN 3ZETA 1N8RO 3LM9A 4IJNA 4KH6A 2QTDA 3CERA 4BRAA 3M1FA 2NRTA 4JKDA 4EAHD 2HF3A 1ZXOA 3ATVA 1G99A 4WF9L 2GWKA 2OANA 2P9PA 3WQUA 2JWKA 3O80A 5TKYA 3BF3A 2CH6A 5M1NA 1S72N 3HM8A 3TTDA 1TYQB 5EVZA 1Q81O 2Q2RA 2H3GX 1NGJA 4H0VB 2CGKA 4BGBA 3CJBA 4FWOA 3MK6A 4H0YB 1VQ7N 1KQSM 3LDOA 3PIOL 3O5BA 3WXJA 5JICA 3I8BA 5AQKA 5FPDA 2E1ZA 5BRFA 4WYBA 3MCAB 4JK7A 4WQ4C 4JKAA 1VQMN 5CE3A 4QS7A 4ISFA 3VEWA 1T44A 5JVGL 3IDHA 1QQOA 4M7XA 1TUYA 3T69A 3VGLA 3FR0A 4FL9A 3OBWA 3RSEA 4BROA 4BG9A 2P9KA 1C0FA 2E2PA 2QXLA 1Y64A 2QW9A 4FO0A 4IFEA 1U6ZA 1QVGM 3HOTA 3ZEUB 4GV3A 1X9JA 4HTLA 2OTLN 3CCMN 3O6WA 4CZJA 3CCVN 2CH5A 5AQGA 2Q0UA 1NMDA 5H1SQ 4PKIA 3HRGA 3SLCA 3L6QA 5LJVA 2WUSA 3MN6A 4L3QA 3PLAA 3IUCA 3S41A 4FWLA 3TSQA 2ITMA 1VAZA 2IVPA 2NRZA 3D2FA 4MDBA 3E1YA 1NWKA 2CGLA 3CD6N 5C10A 4IOCL 5C12A 5BRHA 4OPAA 4PKGA 1IG8A 2V7YA 4XH4A 3ZX3A 4JKGB 3QFUA 2P9SA 1Z05A 2Q31A 4GVEA 4BR9A 3MWPA 1RDWX 4PHTX 1EO1A 4FWSA 3HTVA 5AQIA 5ELZA 3I55N 4FWPA 2C1GA 2OTJN 5EOYA 4IEIA 3C65A 4B1WB 5AQUA 4FOIA 2BH1A 4CD3A 1BA1A 2VWBA 1T3VA 3H3OB 3ID8A 1T6CA 4R79A 3EE8A 3KWGA 4BR7A 5BR9A 4BRIA 2ZJQL 1W2BM 4FPAA 3W3DA 3A5MC 4JK8A 4CBXA 1NLVA 3NVKA 3D7EO 1VQ4N 4YDUA 1M90O 4BC2A 1BU6O 3CPWM 1YAGA 3WXLA 3O9UA 4KH4A 1QQNA 3VENA 4ILHA 3CJ7A 1H1VA 5AQFA 3LDQA 2UYTA 2P9NA 3K9KA 3ZETB 3TSUA 3FZMA 4BRKA 3L0QA 1M1KO 3GL1A 1P8ZA 5F2RA 1NGFA 1LCUA 1LOTB 3ENHA 4FWNA 5DM7L 2P9PB 1QHAA 3CHWA 4A62A 3CCLN 2FF3B 1JCGA 3CCQN 4DCHA 3MDQA 1S3XA 3GOIA 4BRPA 3O1WA 4CBUA 5C2DA 2WBNA 3GDQA 1YUWA 3LL3A 3O1BA 4K42A 2VGMA 1U2VA 3UKRA 3A0IX 3B8AX 3CF5L 1VQ5N 2I7PA 3HI0A 4UY8O 2E88A 1SS6A 3BUZB 3SAGA 1YXQA 4JHDA 4BC3A 4NLBA 3CJAA 3CC2N 5HL7L 1HPMA 3OW2M 1DGKN 2YHYA 4IJAA 1VQ6N 4H5TA 1QZ5A 2P9KB 2NZTA 1GLBG 4MLHA 4O8UA 1BUPA 4EFHA 4ILJA 1YVNA 1S22A 4B1YB 4BE7B 2A42A 1W97L 4QS9A 3QBXA 5AR0A 1P90A 2YX6A 4WFBL 4CJ7A 3G4SN 3CCUN 1QQMA 4BECA 3FZKA 4HWIA 4AF1A 5KPRA 3L4QA 4G9ZA 5CR4A 1YJWN 3LM2A 3UB5A 3D2FB 2RHKA 2Q36A 3O08A 3LDLA 5M1PA 4EIAA 3BEXA 4U67L 1ESVA 2P9SB 4WQ4A 1CZAN 4WQ5C 2NLXA 3R9PA 3P39A 3NVMA 1DEJA 3R3LA 2E8AA 2FSNA 2YJEA 5AQPA 4B1UB 1X3NA 3K9JA 1J6ZA 1MDUB 3WEEA 2E2NA 2F9WA 2P9UA 5BPMA 4BR5A 3ZX2A 3O9SA 3R8EA 5LJWA 3SBTA 5JLHA 1NGGA 1MWKA 1GLJO 3GBTA 3VESA 3FFKB 3U9DA 4H0XB 3J8AA 1YITN 3ZYYX 2VCPA 3EO3A 4XJXA 2ASMA 3VGMA 1V4TA 2P9NB 3CMEN 3EKUA 1HJOA 3N4PA 4RTFD 4FWQA 2ASPA 1KAYA 2NRXA 3VETA 3P31A 2YHXA 3AY9A 2D0PA 5GAEP 3VGKA 1RFQA 4M63C 2GTDA 2Q97A 4I6MA 4XEIA 4IO9L 3CCJN 1BDGA 5AZIA 1ZC6A 4EHTA 1NGEA 4BC4A 1U2VB 2KKZA 3C6AA 3TTCA 1OVYA 3UKRB 3SMSA 2YCHA 3MN9A 4H5VA 3G71N 2V7ZA 3A5NC 3M3ZA 5AQLA 4BR0A 2I7NA 3CJ1A 2QA4N 4FWMA 4LC9B 2P9IA 3BP8A 5AQXA 3DXKA 4A5BA 3OA9A 1K8KB 2WFBA 4GY2B 2RE2A 3WUHA 4BQZA 4OPHA 3AAPA 1SAZA 3VF6A 4WCEL 3EZWA 2QM1A 4CZEA 5MLCQ 4IO8A 4J8FA 3CC4N 4JAXA 1KAZA 3VF2A 3CCRN 2QWMA 2W41A 3ATUA 4B1ZA 1Q82O 3J7ZO 4IWVA 1YHQN 4CZFA 4KH5A 2E1YA 4CZHA 5B8HA 3KHYA 4H03B 3HSCA 2GEMA 4BRFA 2FSKA 3E9PA 4NO7A 4BRDA 4JEPA 4YOXA 3H6EA 1K8AO 3OHRA 5AQHA 5I9EB 2V52B 2YI1A 4FWRA 1JJ2M 5F1XA 5GAHP 3SAFA 4BRCA 1T6DA 2AP1A 2D0OA 3SBGA 3KVGA 3O9QA 3MMVA 3VOVA 2P9UB 3KWIA 4H5NA 5BRDA 1GLCG 3KK7A 1YF5L 3FZLA 3G6EN 5FPMA 3MN5A 2E2OA 3U9ZA 5AQVA 1WOQA 3EKSA 3HBTA 3WXIA 3EN9A 1YI2N 2BUPA 1BA0A 4BRHA 2W00A 1E4FT 1GLEG 1GLAG 1JCEA 2ZWHA 3DXMA 2HBJA 4BR2A 3CCEN 2QI2A 5E26A 1IJJA 4XH1A 2BTFA 4BRLA 3QMLA 3CI5A 4WQ5A 5GADP 2ZGYA 4JK9A 3FZFA 3HZ6A 3FLCO 4YOUA 3CETA 1ATSA 3RSEB 4CBWA 5C0YA 3AGRA 2KLAA 5AQJA 4I6MB 4MO5A 2IVNA 5AQSA 1ATRA 3QDKA 4K43A 4KBOA 1WUAA 5E84A 3MX5A 4FVUA 2NRRA 1JCFA 1GLFO 2A6AA 1HX1A 5AZIB 5AFUH 4WFNL 3GG4A 5FPNA 2V51B 3TPQA 2JWLA 3OBYA 4H0TB 4IDHA 1VQNN 2PFUA 3VTHA 4CZIA 1SZ2A 1NGBA 5KPTA 4CZLA 1KC8O 1VQ9N 3AAQA 4K41A 4IOXA 5C15A 2HMPA 1VQLN 3ULEA 3VTIA 3TU5A 3MWTA 4BVOA 2ZJPL 2P9IB 3C6HA 3H1VX 5KQDA 1QZ6A 1EQYA 3L4IA 4PKHA 4BRNA 2A41A 1DKGD 3VEOA 3DXKB 2NRHA 2DPNA 3E9LA 2ZJRL 1ATNA 3G25A 5BN8A 3VERA 4BQLA 3F9MA 2NRVA 3IFRA 4O5FA 3UE5A 4BRMA 1O13A 5AQNA 2HSTA 4XH5A 2P9LA 3NMUA 3CPEA 3W0LA 3U4LA 1K9MO 4MDAA 4JKEA 4GNIA 4FOEA 2Q1NA 3Q7BA 1VQKN 2ZGZA 4H0PA 4YOYA 2F7TA 2EWSA 3DJCA 3ID6A 1ILYA 3FE1A 1NGAA 3GE1A 3IKMA 2FSJA 5AZJA 3R1XA 1Q18A 3JXUA 5AQTA 4E1JA 4H5WA 5DM6L 1NGHA 5LY3A 3CQXA 3H45C 4C23A 1NGCA 5AFUA 1ZBSA 4FSVA 3D2EA 5KPZA 1X3MA 3C7NA 4Z94A 3O8MA 4CZMA 1K73O 3Q7CA 2QWNA 2QWLA 1BWFO 2GWJA 1QVFM 4JN4A 5M1KA 3CC7N 2HF4A 3VEZA 3FZHA 2PBDA 3DXMB 4ISGA 3WXMB 3M6GA 4A57A 3WT0A 4DHYA 5BPLA 4JHDB 4JNEA 4BEBA 1Z6RA 2QWOA 4F9OA 4IZ9A 4BRGA 4A5AA 4AM7A 2HBLA 4C1NI 4A2AA 4IOAL 3H1QA 4JKCA 3O9RA 1HKGA 3UKUA 5M1OA 5CHIA 4WFAL 3ZX0A 1MA9B 1XC3A 2ASOA 1YJNN 5KQ8A 1NM1A 4CZGA 3TSPA 3WQTA 4NLCA 3DWLA 4EHUA 4YORA 1DT9A 3MCPA 4BRQA 4CI6A 4JD2A 5M1QA 4A59A 5FPEA 4YOTA 3CMAN 5EY4A 3DLLL 4DB3A 2A3ZA 3VEXA 1HKCA 2HOEA 5M1FA 4AM6A 1HKBA 3QBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PL8 A;  1E4G T;  1BO5 O;  1NGI A;  3ULE B;  1XUP O;  2J4R A;  5ADX H;  2YHW A;  1OKJ A;  3FGU A;  3EL2 A;  1R59 O;  4B1V A;  1V4S A;  3SK3 A;  3AAR A;  2A40 A;  1KAX A;  4A61 A;  3JS6 A;  3VEV A;  4B9Q A;  2QWP A;  3CQY A;  2GUP A;  4QS8 A;  3WEE B;  3QIC A;  1MWM A;  4K25 A;  3SMP A;  4BGA A;  2PAV A;  3R6M A;  4Y0W A;  3O4W A;  2A5X A;  1TYQ A;  2P9L B;  4O8K A;  2ZF5 O;  2FLO A;  4FPB A;  3QB0 A;  5F0X A;  2E20 A;  3U8X A;  5EX5 A;  4MLE A;  2KHO A;  1TUU A;  5AZJ B;  2W40 A;  5AQZ A;  4BC5 A;  2D4W A;  4BVP A;  1GLD G;  1GLL O;  2IVO A;  4NB4 A;  4DQ8 A;  1BG3 A;  3A5O C;  3VF4 A;  1D4X A;  3A5L C;  1HLU A;  4RCH A;  5JLF A;  3H46 O;  2VYP A;  4BR4 A;  4BRE A;  3D2E B;  3C7N B;  2Q0R A;  3ZEU A;  3VEY A;  4A2B A;  4CZK A;  3LDN A;  3VPZ A;  3A8Y A;  1C0G A;  1BOT O;  2F9T A;  3H3N O;  4YDU C;  5AQO A;  4H5R A;  3WXK A;  3C0B A;  4RWT A;  2QWR A;  5AQM A;  4M7Y A;  5ADX A;  3SJH A;  4MO4 A;  5JMV A;  3LDP A;  2FF6 A;  3DAW A;  5AQQ A;  1KXP A;  4H0O A;  1XQS C;  3UKU B;  1NGD A;  4BG8 A;  4FWK A;  2YJF A;  3CIP A;  2IIR A;  1K8K A;  3CJC A;  5BN9 A;  5AQY A;  4IXC A;  5EXW A;  4JD2 B;  1RGI A;  3MN7 A;  5AQW A;  4CD1 A;  5BPN A;  4ISE A;  3BF1 A;  1NBW A;  3ENO A;  4B1X B;  3IMX A;  5AQR A;  2E2Q A;  3KZB A;  2CGJ A;  2FXU A;  1HUX A;  3I33 A;  3P4I A;  3CJ9 A;  1SQK A;  2D1K A;  2GEL A;  2QWQ A;  4PL7 A;  3QFP A;  2AA4 A;  5BRE A;  3ZET A;  3LM9 A;  4IJN A;  3CER A;  4BRA A;  3M1F A;  4EAH D;  2HF3 A;  1ZXO A;  3ATV A;  1G99 A;  2GWK A;  2OAN A;  2P9P A;  3WQU A;  3O80 A;  5TKY A;  3BF3 A;  2CH6 A;  3HM8 A;  1TYQ B;  5EVZ A;  2Q2R A;  2H3G X;  1NGJ A;  4H0V B;  2CGK A;  4BGB A;  3CJB A;  4FWO A;  3MK6 A;  4H0Y B;  3LDO A;  3O5B A;  3WXJ A;  5JIC A;  3I8B A;  5AQK A;  5FPD A;  2E1Z A;  5BRF A;  4WYB A;  4WQ4 C;  5CE3 A;  4QS7 A;  4ISF A;  3VEW A;  1T44 A;  3IDH A;  1QQO A;  4M7X A;  1TUY A;  3VGL A;  3FR0 A;  4FL9 A;  3RSE A;  4BRO A;  4BG9 A;  2P9K A;  1C0F A;  2E2P A;  2QXL A;  1Y64 A;  2QW9 A;  4FO0 A;  1U6Z A;  3ZEU B;  1X9J A;  4HTL A;  3O6W A;  4CZJ A;  2CH5 A;  5AQG A;  2Q0U A;  1NMD A;  4PKI A;  3SLC A;  3L6Q A;  5LJV A;  2WUS A;  3MN6 A;  4L3Q A;  3IUC A;  3S41 A;  4FWL A;  2ITM A;  2IVP A;  3D2F A;  1NWK A;  2CGL A;  5BRH A;  4PKG A;  1IG8 A;  2V7Y A;  4XH4 A;  3ZX3 A;  3QFU A;  2P9S A;  1Z05 A;  2Q31 A;  4BR9 A;  1RDW X;  4FWS A;  3HTV A;  5AQI A;  5ELZ A;  4FWP A;  5EOY A;  4B1W B;  5AQU A;  4FOI A;  4CD3 A;  1BA1 A;  2VWB A;  3H3O B;  3ID8 A;  1T6C A;  4BR7 A;  5BR9 A;  4BRI A;  4FPA A;  3W3D A;  3A5M C;  4CBX A;  1NLV A;  3D7E O;  4YDU A;  4BC2 A;  1BU6 O;  1YAG A;  3WXL A;  1QQN A;  3VEN A;  3CJ7 A;  1H1V A;  5AQF A;  3LDQ A;  2UYT A;  2P9N A;  3ZET B;  3FZM A;  4BRK A;  3L0Q A;  3GL1 A;  1P8Z A;  5F2R A;  1NGF A;  1LCU A;  1LOT B;  3ENH A;  4FWN A;  2P9P B;  1QHA A;  3CHW A;  4A62 A;  2FF3 B;  1JCG A;  4DCH A;  3MDQ A;  1S3X A;  3GOI A;  4BRP A;  3O1W A;  4CBU A;  3GDQ A;  1YUW A;  3LL3 A;  3O1B A;  4K42 A;  1U2V A;  3UKR A;  3A0I X;  3B8A X;  2I7P A;  3HI0 A;  2E88 A;  3BUZ B;  1YXQ A;  4JHD A;  4BC3 A;  3CJA A;  1HPM A;  1DGK N;  2YHY A;  4IJA A;  4H5T A;  1QZ5 A;  2P9K B;  2NZT A;  1GLB G;  4MLH A;  1BUP A;  4EFH A;  1YVN A;  1S22 A;  4B1Y B;  2A42 A;  4QS9 A;  3QBX A;  5AR0 A;  4CJ7 A;  1QQM A;  3FZK A;  4HWI A;  5KPR A;  3LM2 A;  3UB5 A;  3D2F B;  2Q36 A;  3O08 A;  3LDL A;  4EIA A;  3BEX A;  1ESV A;  2P9S B;  4WQ4 A;  1CZA N;  4WQ5 C;  2NLX A;  3R9P A;  1DEJ A;  2E8A A;  2FSN A;  2YJE A;  5AQP A;  4B1U B;  1X3N A;  1J6Z A;  1MDU B;  3WEE A;  2E2N A;  2F9W A;  2P9U A;  5BPM A;  4BR5 A;  3ZX2 A;  3R8E A;  5LJW A;  5JLH A;  1NGG A;  1MWK A;  1GLJ O;  3GBT A;  3VES A;  3FFK B;  3U9D A;  4H0X B;  3J8A A;  2VCP A;  3EO3 A;  2ASM A;  3VGM A;  1V4T A;  2P9N B;  3EKU A;  1HJO A;  4RTF D;  4FWQ A;  2ASP A;  1KAY A;  3VET A;  2YHX A;  3AY9 A;  2D0P A;  3VGK A;  1RFQ A;  4M63 C;  2GTD A;  2Q97 A;  4I6M A;  4XEI A;  1BDG A;  5AZI A;  1ZC6 A;  4EHT A;  1NGE A;  4BC4 A;  1U2V B;  3UKR B;  3SMS A;  2YCH A;  3MN9 A;  4H5V A;  2V7Z A;  3A5N C;  3M3Z A;  5AQL A;  4BR0 A;  2I7N A;  3CJ1 A;  4FWM A;  4LC9 B;  2P9I A;  3BP8 A;  5AQX A;  3DXK A;  1K8K B;  4GY2 B;  3WUH A;  4BQZ A;  3AAP A;  1SAZ A;  3VF6 A;  3EZW A;  2QM1 A;  4CZE A;  4IO8 A;  4J8F A;  4JAX A;  1KAZ A;  3VF2 A;  2QWM A;  2W41 A;  3ATU A;  4B1Z A;  4IWV A;  4CZF A;  2E1Y A;  4CZH A;  5B8H A;  3KHY A;  4H03 B;  3HSC A;  2GEM A;  4BRF A;  2FSK A;  4BRD A;  4NO7 A;  3H6E A;  3OHR A;  5AQH A;  5I9E B;  2V52 B;  2YI1 A;  4FWR A;  5F1X A;  4BRC A;  1T6D A;  2AP1 A;  2D0O A;  3KVG A;  3MMV A;  3VOV A;  2P9U B;  4H5N A;  5BRD A;  1GLC G;  3FZL A;  5FPM A;  3MN5 A;  2E2O A;  3U9Z A;  5AQV A;  1WOQ A;  3EKS A;  3HBT A;  3WXI A;  3EN9 A;  2BUP A;  1BA0 A;  4BRH A;  1E4F T;  1GLE G;  1GLA G;  1JCE A;  2ZWH A;  3DXM A;  4BR2 A;  5E26 A;  1IJJ A;  4XH1 A;  2BTF A;  4BRL A;  3QML A;  3CI5 A;  4WQ5 A;  2ZGY A;  3FZF A;  3HZ6 A;  3FLC O;  3CET A;  1ATS A;  3RSE B;  4CBW A;  5AQJ A;  4I6M B;  4MO5 A;  2IVN A;  5AQS A;  1ATR A;  3QDK A;  4K43 A;  4KBO A;  1WUA A;  5E84 A;  1JCF A;  1GLF O;  2A6A A;  1HX1 A;  5AZI B;  5AFU H;  3GG4 A;  5FPN A;  2V51 B;  3TPQ A;  4H0T B;  4CZI A;  1SZ2 A;  1NGB A;  5KPT A;  4CZL A;  3AAQ A;  4K41 A;  2HMP A;  3ULE A;  3TU5 A;  4BVO A;  2P9I B;  3H1V X;  5KQD A;  1QZ6 A;  1EQY A;  3L4I A;  4PKH A;  4BRN A;  2A41 A;  1DKG D;  3VEO A;  3DXK B;  2NRH A;  2DPN A;  1ATN A;  3G25 A;  5BN8 A;  3VER A;  4BQL A;  3F9M A;  3IFR A;  4O5F A;  3UE5 A;  4BRM A;  5AQN A;  4XH5 A;  2P9L A;  3W0L A;  3U4L A;  4GNI A;  4FOE A;  2Q1N A;  2ZGZ A;  4H0P A;  2EWS A;  3DJC A;  3FE1 A;  1NGA A;  3GE1 A;  5AZJ A;  2FSJ A;  1Q18 A;  3JXU A;  5AQT A;  4E1J A;  4H5W A;  1NGH A;  5LY3 A;  3CQX A;  3H45 C;  4C23 A;  1NGC A;  5AFU A;  1ZBS A;  4FSV A;  3D2E A;  5KPZ A;  1X3M A;  3C7N A;  4Z94 A;  3O8M A;  4CZM A;  2QWN A;  2QWL A;  1BWF O;  2GWJ A;  4JN4 A;  2HF4 A;  3VEZ A;  3FZH A;  2PBD A;  3DXM B;  4ISG A;  3M6G A;  5BPL A;  3WT0 A;  4DHY A;  4JHD B;  4JNE A;  1Z6R A;  2QWO A;  4F9O A;  4IZ9 A;  4BRG A;  4AM7 A;  4A2A A;  3H1Q A;  1HKG A;  3UKU A;  3ZX0 A;  1MA9 B;  1XC3 A;  2ASO A;  5KQ8 A;  1NM1 A;  4CZG A;  3WQT A;  3DWL A;  4EHU A;  4BRQ A;  3MCP A;  4CI6 A;  4JD2 A;  5FPE A;  5EY4 A;  4DB3 A;  2A3Z A;  3VEX A;  1HKC A;  2HOE A;  4AM6 A;  1HKB A;  3QBW A; 
#chains in the Genus database with same CATH topology
 3ULE B;  1E4G T;  2J4R A;  3HOS A;  1RTD A;  3THY A;  1R59 O;  4C1N K;  2HHU A;  1V4S A;  4DV3 K;  3E66 A;  3NAE A;  1VHX A;  2HHX A;  1XC9 A;  2A40 A;  1KAX A;  5KGW A;  3RMC A;  1LWC A;  4A61 A;  2Z1H A;  2GUP A;  4Y1D A;  3LWM A;  3WEE B;  3D6R A;  4K25 A;  4E72 A;  5AJ3 K;  3R6M A;  5GIP A;  3O4W A;  2O8D B;  3MX2 A;  5J1E A;  1VSM A;  2FLO A;  4FPB A;  4JI2 K;  2NRW A;  3TTF A;  4GKJ K;  1BGX T;  4JI1 K;  4K8Z A;  4KAZ A;  4YOV A;  3ZSW A;  1N32 K;  4PA1 A;  2KHO A;  3SPZ A;  2NNW A;  3PIP L;  4BVP A;  1GLD G;  2IVO A;  3A5O C;  3SAH A;  5KGX A;  3A5L C;  1HLU A;  2VYP A;  1B9D A;  3VEY A;  4CJP A;  3I0S A;  3WNG A;  5JVH L;  4FXD A;  1VK0 A;  5AQO A;  2WC9 A;  1TGO A;  4RWT A;  4I9Q A;  4M3T A;  4M7Y A;  5ADX A;  5JMV A;  2WON A;  5AQQ A;  1VSJ A;  3UKU B;  4JKG A;  1NGD A;  4BG8 A;  3LAK A;  2YJF A;  2GX9 A;  3NCI A;  2IIR A;  4DU1 A;  1VQO N;  4Y1C A;  1RDU A;  5EXW A;  4C8K A;  4JD2 B;  3DLR A;  3TAF A;  4ISE A;  3ENO A;  1N6Q A;  1KVA A;  2YKM A;  3IMX A;  4C8N A;  3OJS A;  4LF5 K;  3OYB A;  4DV1 K;  2E2Q A;  3TAP A;  3CFP A;  1S6P A;  3T7Z A;  1UA1 A;  3I33 A;  4DFP A;  4E19 A;  3CJ9 A;  4CER A;  1Q9Y A;  3RMB A;  1HQE A;  4KO0 A;  4E0D A;  4KHN A;  3V9X A;  1C0U A;  4BRA A;  4DSE A;  4Z4I A;  3M1F A;  1U04 A;  3VQQ A;  1ZXO A;  3RWU A;  4WF9 L;  2GWK A;  2OAN A;  3WQU A;  3O80 A;  1S72 N;  3HM8 A;  1TYQ B;  1Q81 O;  3K57 A;  2CGK A;  1VQ7 N;  3QEP A;  3WXJ A;  3AVB A;  4CJ3 A;  2E1Z A;  5BRF A;  1RIL A;  4WYB A;  2EX3 A;  1JL2 A;  5T7B A;  4ISF A;  4DWI A;  4KPY A;  4FVM A;  5JVG L;  3IDH A;  2O4I A;  1EX4 A;  3T69 A;  3I8D A;  4FL9 A;  3AO3 A;  4BRO A;  2P9K A;  1C0F A;  3MEC A;  1RBU A;  1Y64 A;  2QW9 A;  4FO0 A;  1QVG M;  3ZEU B;  4M3Y A;  1C6V A;  3CCM N;  2CH5 A;  2ZQB A;  2Y1J A;  1NMD A;  3AVK A;  2WUS A;  3U6F A;  4B9M A;  3MXJ A;  3VQ9 A;  1UA0 A;  1YVU A;  3CD6 N;  3RMA A;  4DTP A;  4PKG A;  4OPK A;  2V7Y A;  4XH4 A;  3ZX3 A;  2Q31 A;  3MWP A;  3F73 A;  4JI6 K;  4E7I A;  4FWP A;  4IEI A;  3C65 A;  1ZBL A;  4E7K A;  4CCH A;  3NE6 A;  1RBS A;  3ID8 A;  4CJW A;  2VG6 A;  4R79 A;  4K8X A;  3KWG A;  3S5T A;  5BR9 A;  2RKI A;  1U47 A;  4PY5 A;  3A5M C;  3M8R A;  3D7E O;  4DTR A;  4LF4 K;  1XWL A;  2HHH K;  1HMV A;  4B8A B;  4JYA K;  2OPP A;  1RBV A;  2IDO A;  3VQP A;  2UYT A;  4AHC A;  1M1K O;  3WNF A;  4J2B A;  4DFM A;  1LOT B;  3ENH A;  4FWN A;  3T1H K;  1QHA A;  4CEQ A;  4A62 A;  3SV3 A;  1JCG A;  1GOA A;  4DCH A;  3BZC A;  3GOI A;  3O1W A;  3ASM A;  2VGM A;  3UKR A;  3A0I X;  1VQ5 N;  1XHX A;  1DLO A;  1U4B A;  4NLB A;  3CJA A;  3DRS A;  3OW2 M;  4CGF A;  4KB0 A;  4IJA A;  3LPT A;  3KKR A;  2UXC K;  1BUP A;  4ILJ A;  1S1T A;  1W97 L;  4B3T K;  4WFB L;  2YX6 A;  4PQU A;  1D5A A;  1L3U A;  3LWL A;  3CCU N;  4B9S A;  3L4Q A;  4G9Z A;  5CR4 A;  1DTT A;  3LM2 A;  1YJW N;  3D2F B;  3LPU A;  5M1P A;  2B6A A;  4WQ4 A;  4DTU A;  3ZT4 A;  3P39 A;  3SCX A;  2E8A A;  2E6M A;  5AQP A;  2FBX A;  3ZT3 A;  1QHT A;  1MDU B;  3WEE A;  2F9W A;  2P9U A;  1WLJ A;  4Z4E A;  3GBT A;  2E6L A;  4BDP A;  3FFK B;  1EXQ A;  2O8F A;  3V6D A;  4XJX A;  1V4T A;  2P9N B;  1NJX A;  2ASP A;  1KAY A;  3OY9 A;  2P5G A;  3VET A;  4EP5 A;  3LP3 A;  3QNO A;  1SV5 A;  4AQY K;  1RDC A;  1NOZ A;  1NU0 A;  4DR5 K;  4M63 C;  1JXB A;  4XEI A;  3TR8 A;  3OYC A;  2KKZ A;  1UAX A;  3HST B;  1BHL A;  4X66 K;  1L3S A;  4H5V A;  4IG3 A;  3G71 N;  3SJJ A;  4BDY A;  4PUO A;  1IKX A;  5AQL A;  4BR0 A;  2QA4 N;  4FWM A;  5DMR A;  3BP8 A;  5AQX A;  4HCB A;  3DXK A;  4A5B A;  4ELU A;  3LZJ A;  1K8K B;  4DQI A;  5SZT A;  2HVH A;  4OPH A;  4L8R B;  3AAP A;  3VF6 A;  3EZW A;  1JLF A;  4OX9 K;  5J2Q A;  3HPH A;  3OS2 A;  2G8V A;  4ICL A;  1ITG A;  3CCR N;  4ID1 A;  4RW4 A;  1NKC A;  4KV8 A;  4B1Z A;  3J7Z O;  3KTQ A;  4CZF A;  2E1Y A;  2VWK A;  4H03 B;  4YOX A;  4BRF A;  4FJN A;  4NO7 A;  3PSI A;  2V52 B;  1KVC A;  1JJ2 M;  1EET A;  1GOB A;  1T6D A;  2AP1 A;  2X6S A;  4E7H A;  3ALY A;  3QEI A;  5BRD A;  3QET A;  3KK7 A;  3FZL A;  2YHB A;  3OVN A;  2E2O A;  3EN9 A;  3THW A;  4OKK A;  1YI2 N;  1BA0 A;  2HBJ A;  2KQ2 A;  3C6U A;  3DXM A;  1IBM K;  4XH1 A;  1XMO K;  5GAD P;  3AVF A;  3KLI A;  4HUG A;  2DTU A;  1ATS A;  5AQJ A;  3OYD A;  3O3H A;  1WN7 A;  1W7A A;  4IFV A;  4QAG A;  4BWJ A;  4FZX C;  5E84 A;  1MU2 A;  4CEA A;  1BIZ A;  2NRR A;  1GLF O;  4M42 A;  1BI4 A;  1OH6 A;  5FPN A;  2V51 B;  1WBB A;  4FJH A;  4IDH A;  1VQN N;  1SZ2 A;  5KPT A;  1KC8 O;  1A5W A;  3MWT A;  2BAN A;  2ZJP L;  1QZ6 A;  1EQY A;  3VEO A;  1JLG A;  2XRI A;  4DMN A;  3DRR A;  1OH5 A;  5BN8 A;  4KHS A;  4CF8 A;  3DLB A;  3BDP A;  3UE5 A;  4W5R A;  1RTJ A;  4OPJ A;  1TAQ A;  2YNI A;  2HST A;  5HP1 A;  2Q3S A;  4YY3 K;  3V4I A;  1K9M O;  3Q7B A;  4H0P A;  3OYL A;  4DU3 A;  2F7T A;  3TAN A;  3FE1 A;  2BDP A;  3VQ5 A;  1QSY A;  3CQX A;  3H45 C;  1NMN A;  2FC0 A;  1WSJ A;  4YHH K;  1RT4 A;  1ZBS A;  4FSV A;  3C7N A;  4Z94 A;  3O8M A;  4CZM A;  1X9M A;  3CYM A;  2QWL A;  3VEZ A;  4OJR A;  4FLU A;  3THV A;  2D0B A;  1FKO A;  1C0T A;  2BE2 A;  3AA5 X;  4NCG A;  1TL3 A;  4WFA L;  4CJT A;  3LP2 A;  4YNQ A;  1HR0 K;  3TSP A;  1BQN A;  3WQT A;  4DV4 K;  4B9U A;  4W5Q A;  1J5E K;  4YOT A;  3IAY A;  1QE1 A;  2HOE A;  2O8B B;  1TK0 A;  4AM6 A;  3KLG A;  4PL8 A;  1NGI A;  2XO7 A;  1ZBI A;  1XUP O;  3HK2 A;  5ADX H;  5HOO A;  4M45 A;  3FGU A;  3EL2 A;  1SL1 A;  3AO1 A;  3SK3 A;  4BY9 C;  3VQC A;  2VGN A;  2O8E A;  1S5J A;  1JLQ A;  3CQY A;  3PX0 A;  4DTJ A;  4I7F A;  3SMP A;  4BGA A;  1LV5 A;  1RDD A;  2P9L B;  4OO1 J;  2ZF5 O;  3K59 A;  5F0X A;  3SUQ A;  4RG8 A;  5JS2 A;  3QO9 A;  1NNE A;  3AVL A;  5AZJ B;  2ITG A;  3F2K A;  4FM2 A;  3SYZ A;  4NB4 A;  1GLL O;  3H08 A;  1BG3 A;  3VF4 A;  4GW6 A;  4F3T A;  5GAG P;  4BRE A;  4YOW A;  3D2E B;  2Q0R A;  4ID5 A;  4A2B A;  4CFD A;  4DTX A;  4B3R K;  3LDN A;  4DSK A;  1YJ9 N;  1TV6 A;  3TAM A;  1BOT O;  4FLX A;  3SI6 A;  3WXK A;  2HVI A;  3UIQ A;  1HNZ K;  3VN5 A;  5AQM A;  4MO4 A;  3V1Q A;  1KCF A;  2LSN A;  4I2Q A;  5J2P A;  4F3O A;  1KXP A;  4E1M A;  4GV9 A;  1XQS C;  4KI6 A;  3RVC A;  3CIP A;  4TSX A;  4DR2 K;  3KK2 A;  1K8K A;  3O9T A;  3OJU A;  2QKB A;  5DK5 A;  1KRP A;  2HHW A;  3MN7 A;  5AQW A;  3AVI A;  4CD1 A;  4LF6 K;  1L3T A;  1NBW A;  5AQR A;  4GKK K;  4HTU A;  4OGE A;  3KZB A;  2HBK A;  2FXU A;  1HUX A;  4ILG B;  2GEL A;  2QWQ A;  4B9N A;  4CK1 A;  3LM9 A;  2QTD A;  3CER A;  3VQD A;  1GOC A;  4JKD A;  4EAH D;  2HF3 A;  4KI4 A;  2P9P A;  3AO2 A;  1WSF A;  5TKY A;  4DF8 A;  2CH6 A;  5M1N A;  4DV7 K;  3DLG A;  5EVZ A;  4CJL A;  2Q2R A;  2H3G X;  1NGJ A;  3NDK A;  4H0Y B;  1NK9 A;  3LDO A;  4DV0 K;  4M3Z A;  5AQK A;  4MFB A;  1FJG K;  5FPD A;  4JI7 K;  3THX A;  4WQ4 C;  4JKA A;  5CE3 A;  4QS7 A;  3C94 A;  3VEW A;  2W42 A;  1TAU A;  1TUY A;  4WE1 A;  4X62 K;  3OBW A;  2E2P A;  2QXL A;  2YV0 X;  4IFE A;  3S9H A;  4DR4 K;  3HOT A;  2ZM6 K;  1SL2 A;  3KK1 A;  5CZ2 A;  4LSN A;  4CZJ A;  5J2M A;  1LAW A;  3J81 O;  3QIN A;  1TKZ A;  3J80 O;  4PKI A;  3SLC A;  5LJV A;  4N56 A;  3IUC A;  2NRZ A;  2IVP A;  3E1Y A;  1NWK A;  4OPA A;  4YFU A;  1UWB A;  4BR9 A;  3LAN A;  3HJF A;  3VQE A;  4W5T A;  3K0S A;  3TAG A;  5AQI A;  5ELZ A;  2C1G A;  1ZBF A;  2KZM A;  3KIO A;  1T3V A;  4M3U A;  1T6C A;  4DQS A;  3EE8 A;  4BR7 A;  4N41 A;  3VQB A;  2ZJQ L;  5KRT A;  3OS0 A;  2XY6 A;  3NVK A;  3DOL A;  1ZYQ A;  3CPW M;  1I3A A;  1YAG A;  3O9U A;  1QQN A;  4ELT A;  3ZET B;  3TSU A;  1NOY A;  3FZM A;  4FCY A;  3L0Q A;  1BCO A;  3ISN C;  5F2R A;  1P8Z A;  1LCU A;  4DSL A;  4FJ9 A;  1WAJ A;  4FJM A;  2O8C A;  3CCQ N;  4CBU A;  4LSL A;  2X78 A;  5LMU K;  1YUW A;  3LL3 A;  4K42 A;  4N5S A;  2HNZ A;  3B8A X;  4AHS A;  4AHR A;  3VQ6 A;  4BC3 A;  4BAC A;  3CC2 N;  4NCB A;  4FZZ A;  4E1N A;  1QZ5 A;  1B92 A;  2NZT A;  4MLH A;  1RDB A;  3AA4 A;  2VQF K;  3U3G A;  1YVN A;  1S22 A;  4E7L A;  1KFS A;  4BE7 B;  3HP6 A;  3M8S A;  5AR0 A;  1P90 A;  3DLE A;  4H4O A;  4CJ7 A;  3G4S N;  1S1U A;  3ZSZ A;  1Z26 A;  4BEC A;  1EWR A;  3UB5 A;  4JV5 K;  3CQ8 A;  4CHZ A;  4NYF A;  2GBZ A;  2ATQ A;  1RTI A;  4CGD A;  3HPG A;  4U67 L;  1ESV A;  2P9S B;  3OS1 A;  1CZA N;  2NLX A;  4BE1 A;  3NH0 A;  3LAL A;  1X3N A;  3K9J A;  4I9L A;  1OH7 A;  1FW6 A;  3MED A;  5BPM A;  1RT7 A;  4BR5 A;  3SBT A;  4CJK A;  1GLJ O;  5LMN K;  1QSL A;  4CE9 A;  4X65 K;  3N4P A;  1RT5 A;  4RTF D;  3NF7 A;  3QES A;  1C0M A;  1LW0 A;  4CJF A;  3V9Z A;  2YHX A;  1EP4 A;  3AY9 A;  1J9A A;  2QK9 A;  3EEQ A;  1RFQ A;  4I6M A;  3I0R A;  5AZI A;  1G15 A;  1NGE A;  1U2V B;  3D45 A;  3PO5 A;  2V7Z A;  3A5N C;  4CFC A;  3SQ1 A;  1HNX K;  1TVR A;  3CJ1 A;  2FBT A;  4DV2 K;  4R5P A;  3QER A;  4FZY A;  3J7A P;  1BL3 A;  2RE2 A;  3WUH A;  1CXQ A;  4NCA A;  4CZE A;  5MLC Q;  3DLH A;  3HO1 A;  1KAZ A;  4IG0 A;  1VSK A;  5LL6 Z;  2WTU A;  4M3W A;  1YHQ N;  4KH5 A;  4CZH A;  3AO4 A;  2GEM A;  3HSC A;  2FSK A;  4BRD A;  1K8A O;  3OHR A;  4KRE A;  5AQH A;  1S1W A;  2YKN A;  4FK0 A;  5GAH P;  4BRC A;  4RW8 A;  4FLT A;  4JLH A;  3BY5 A;  1GLC G;  3CYG A;  3MN5 A;  3K5M A;  2F8S A;  2BUP A;  1F21 A;  4B9T A;  1VSI A;  1JCE A;  2ZWH A;  1EKE A;  4BR2 A;  2QI2 A;  3OYG A;  5E41 A;  2BTF A;  2EHG A;  3DI6 A;  4BRL A;  3CI5 A;  3FZF A;  3HZ6 A;  3FLC O;  4CES A;  5AQS A;  1ATR A;  3QDK A;  4K43 A;  4FLW A;  1WUA A;  4FLZ A;  2IGI A;  4FVU A;  4WFN L;  2A6A A;  3B6P A;  3GG4 A;  1KVB A;  4O0I A;  2PFU A;  3VTH A;  2IAJ A;  4C8L A;  4DTM A;  1VQ9 N;  4IKF A;  3AAQ A;  4K41 A;  5C15 A;  2HMP A;  4Z4F A;  1C1A A;  3V9W A;  1WB9 A;  3ULE A;  2P9I B;  3H1V X;  3NGI A;  1S9E A;  3O4Q A;  2A41 A;  1DKG D;  4JI0 K;  4KTZ A;  2NRH A;  3E9L A;  2YNF A;  2WOM A;  3F9M A;  3IFR A;  1RCH A;  2NUB A;  1XNR K;  4CW7 B;  4KHU A;  5AQN A;  3M8Q A;  2O8D A;  4JRP A;  3W0L A;  5I42 A;  3U4L A;  2UUA K;  4GNI A;  4FOE A;  3HPO A;  4HHT A;  4YOY A;  2EWS A;  1ILY A;  1NGA A;  1RT2 A;  3GE1 A;  3IKM A;  2FSJ A;  1NK6 A;  4B9V A;  4DSJ A;  3R1X A;  2E4L A;  2HHT A;  1Q18 A;  3JXU A;  5AQT A;  4H5W A;  3ZT0 A;  5DM6 L;  4KHW A;  1NGH A;  2UXB K;  3HYF A;  5KPZ A;  1X3M A;  5CY4 A;  2F4V K;  3Q7C A;  4CFB A;  4BDZ A;  1BWF O;  3LDS A;  5CYQ A;  2XY5 A;  2X6N A;  3DLK A;  4ISG A;  1W9H A;  4A57 A;  3WT0 A;  4DHY A;  4JHD B;  3J7Y P;  1ASU A;  4BRG A;  4AM7 A;  4A2A A;  4CFA A;  3O9R A;  3UKU A;  5CHI A;  2ASO A;  1YJN N;  5KQ8 A;  1NM1 A;  2XY7 A;  4BRQ A;  3AVN A;  4JD2 A;  5M1Q A;  4LD0 A;  5HRO A;  5EY4 A;  4EZ6 A;  2A3Z A;  3VEX A;  1HKC A;  4CGH A;  4DV6 K;  4FK2 A;  3VQ7 A;  1HKB A;  3ZSX A;  5FLX O;  3JAM O;  1BO5 O;  1LAV A;  3M5R A;  1ZBU A;  2YHW A;  3TAR A;  1RNH A;  4B1V A;  2RPI A;  1LW2 A;  4F2S A;  3AAR A;  2ETJ A;  3E9O A;  3HXM A;  3P1G A;  4KTW A;  4JKF A;  4ZHR A;  2OCE A;  3MEE A;  3ZLJ A;  3VEV A;  1Q7Y O;  3T19 A;  3DOK A;  1JLA A;  4CJU A;  4LH4 A;  1KD1 O;  1TYQ A;  4O8K A;  3CXC M;  2HHI A;  3TAE A;  4M3X A;  3P83 D;  2E20 A;  5GIN A;  4CJ5 A;  4FJ5 A;  4MLE A;  4O44 A;  4W5O A;  5AQZ A;  4V19 S;  2YNG A;  4O0J A;  2JLE A;  5HRP A;  3AGK A;  1L5U A;  1D4X A;  4RCH A;  1Y97 A;  5JLF A;  1KSP A;  3VA0 A;  3V81 A;  1QQC A;  1JKH A;  3ZEU A;  4FW2 A;  4CZK A;  4U7B A;  1C0G A;  2F9T A;  4O4G A;  1VQP N;  3VQ4 A;  1U48 A;  3ENB A;  4H4M A;  4CEC A;  3SJH A;  2X74 A;  4JS4 A;  1TK5 A;  4H0O A;  1BQM A;  3JSM A;  4CJV A;  2A1S A;  4FWK A;  4JKH A;  3AVH A;  4F2R A;  3NHG A;  4DQR A;  1J53 A;  1NK5 A;  3F5T A;  2DFH A;  4GV6 A;  2OPR A;  3EE9 A;  3RRH A;  1Q86 O;  1NJI O;  1RT6 A;  3SPY A;  1CZ9 A;  4KTQ A;  2CGJ A;  1T8E A;  3PSF A;  1VSE A;  3P4I A;  3L2R A;  3THY B;  4G1Q A;  5C2F A;  4PL7 A;  3PV8 A;  4DKW A;  3QFP A;  5GIO A;  5BRE A;  2Z1I A;  4IJN A;  4KKO A;  4KH6 A;  4CIG A;  1SUQ A;  1TL1 A;  3ZSQ A;  4OGC A;  2NRT A;  5C24 A;  4B3S K;  3NFA A;  3ATV A;  1G99 A;  3SUN A;  2JWK A;  3TAQ A;  4BGB A;  4Z4C A;  4FWO A;  1SKR A;  1D8Y A;  3I8B A;  3QEV A;  4FM1 A;  3HM9 A;  4M41 A;  1T44 A;  3KJV A;  3VGL A;  2PYJ A;  1NJY A;  3PO4 A;  1U6Z A;  1X9S A;  1X9J A;  4B8C A;  2AJQ A;  3CCV N;  4CGJ A;  3DRP A;  5H1S Q;  1XNQ K;  3L6Q A;  3MN6 A;  3PLA A;  3G10 A;  3S41 A;  4FWL A;  3TSQ A;  4GVM A;  1VAZ A;  4MDB A;  3D2F A;  1RBT A;  2CGL A;  4IOC L;  5BRH A;  1IG8 A;  5IWA K;  4JKG B;  3AVM A;  3QFU A;  4HUF A;  4GVE A;  4CJR A;  2RN2 A;  4O55 A;  1RDW X;  4PHT X;  1HYZ A;  4FWS A;  4CHP A;  3I55 N;  3MXM A;  1EO1 A;  5FRN A;  2OTJ N;  4B1W B;  3ZSO A;  4CJQ A;  1BA1 A;  2VWB A;  3H3O B;  2YNH A;  4E89 A;  1W2B M;  1IBL K;  4FPA A;  3W3D A;  3NGZ A;  4JK8 A;  4YDU A;  4LFB K;  1M90 O;  5HRN A;  3QIO A;  4OKJ A;  3WXL A;  4KH4 A;  3VEN A;  1H1V A;  5AQF A;  3LDQ A;  2P9N A;  3K9K A;  4BRK A;  4B3O A;  3GL1 A;  3SUP A;  1N33 K;  3L8B A;  3TWH A;  3SQ4 A;  2UUB K;  1IKY A;  3CCL N;  3S3O A;  1S3X A;  2D0A A;  4BRP A;  4CHY A;  1S9G A;  3GDQ A;  3TI0 A;  2I7P A;  3HI0 A;  4UY8 O;  2E88 A;  1SS6 A;  3BUZ B;  3RR7 A;  2G8F A;  3NF6 A;  4JHD A;  1TKT A;  3FFI A;  4IBN A;  2P9K B;  4O8U A;  2VQE K;  4EFH A;  2A42 A;  2VG7 A;  3QBX A;  1R0A A;  3L2Q A;  3RR8 A;  1QQM A;  3FZK A;  4HWI A;  5KPR A;  4HVJ A;  4DLE A;  1BIS A;  2RHK A;  3O08 A;  3O3G A;  3K2P A;  4ELV A;  5CZ1 A;  3BEX A;  3VQA A;  3NH1 A;  1IKV A;  1DEJ A;  3NVM A;  3R3L A;  1XMQ K;  1A5X A;  2P5O A;  2FSN A;  2YJE A;  4UQG A;  1HYV A;  4B1U B;  5EU7 A;  1J6Z A;  1WAF A;  3WNH A;  4FJX A;  2E2N A;  5HRS A;  3O9S A;  5LJW A;  5JLH A;  1NGG A;  3ZT2 A;  2OZS A;  4X64 K;  3VES A;  3U9D A;  3L3U A;  3PX6 A;  2VCP A;  3LZI A;  3EO3 A;  2ASM A;  3NF8 A;  3CME N;  1HJO A;  5JS1 A;  3OYH A;  3OYJ A;  2NRX A;  3P31 A;  2D0P A;  4AHV A;  3V9U A;  1N34 K;  3ULD A;  3HVR A;  5D3G A;  3G0Z A;  1ZC6 A;  4EHT A;  4BC4 A;  5HRR A;  2IOC A;  3UKR B;  1OVY A;  3MN9 A;  4PWD A;  4FJJ A;  3M3Z A;  3V9S A;  2G8U A;  3LP0 A;  4LC9 B;  1IH7 A;  1NKE A;  2HW3 A;  1L3V A;  3RTV A;  1Q8I A;  1DTQ A;  1YTU A;  2P1J A;  2KFN A;  2VWJ A;  3OA9 A;  1JL1 A;  2WFB A;  4GY2 B;  4W5N A;  4BQZ A;  2QM1 A;  4IO8 A;  4J8F A;  4JAX A;  3NBP A;  3VF2 A;  2QWM A;  1TKX A;  2FBV A;  3NF9 A;  3ATU A;  3EYZ A;  4IWV A;  3HL8 A;  3OYN A;  4BE2 A;  5B8H A;  3KHY A;  4JEP A;  3H6E A;  1CLQ A;  4B3M K;  5I9E B;  4KB1 A;  4FWR A;  4HCC A;  5F1X A;  1IV0 A;  3PY8 A;  3PX4 A;  2D0O A;  2RF2 A;  3KVG A;  2G8K A;  3MMV A;  4JI3 K;  3VOV A;  2P9U B;  4FM0 A;  3KWI A;  1C1C A;  2XHB A;  1NKB A;  4O5B A;  1HNV A;  4CHO A;  3D0P A;  5FPM A;  2O8F B;  1WOQ A;  2W6L A;  3HBT A;  3WXI A;  4DF4 A;  4BRH A;  2F96 A;  3VA3 A;  4DR7 K;  4NYN A;  1OVQ A;  3QML A;  4WQ5 A;  2ZGY A;  4JK9 A;  3CET A;  3RSE B;  2KLA A;  4MO5 A;  2IVN A;  3K5O A;  4KBO A;  1K6Y A;  3MX5 A;  4DFJ A;  3MXI A;  3SZ2 A;  3TPQ A;  2JWL A;  3OBY A;  3O3F A;  3C6T A;  4OKE A;  4CZI A;  1NGB A;  2O8B A;  4AIL C;  4MQ3 A;  2Y1I A;  3E01 A;  3OYE A;  2UUC K;  4BVO A;  4FJI A;  3C6H A;  5KQD A;  3L4I A;  4PKH A;  4BRN A;  3DXK B;  4B08 A;  2DPN A;  2ZJR L;  2HHQ A;  2GUI A;  3VER A;  4BQL A;  2NRV A;  4FK4 A;  3L2V A;  3OYM A;  3AA3 A;  2HMI A;  2P9L A;  3NMU A;  4MDA A;  2A1R A;  4JKE A;  2Q1N A;  4I2P A;  2ZGZ A;  2IC3 A;  2IS3 A;  3ID6 A;  5AZJ A;  4JI8 K;  3SQ2 A;  4B9L A;  4E1J A;  3KLE A;  5JEN A;  2XY8 A;  3VQ8 A;  5LY3 A;  3KLF A;  4C23 A;  5AFU A;  4CED A;  4DG1 A;  3D2E A;  4CHN A;  3V1O A;  1QS4 A;  2GWJ A;  1QVF M;  4JN4 A;  3CC7 N;  1VSH A;  3THW B;  3FZH A;  2HNY A;  2PBD A;  3DXM B;  1U45 A;  4CIF A;  3WXM B;  5BPL A;  3OYF A;  4JNE A;  3MEG A;  5C25 A;  1Z6R A;  1RTH A;  2KTQ A;  4BEB A;  1D9D A;  1B9F A;  2HBL A;  4IOA L;  3H1Q A;  4JKC A;  4CEB A;  3T3F A;  3CG7 A;  3V1R A;  3ZX0 A;  1MA9 B;  1XC3 A;  4FW1 A;  3F9K A;  1RDA A;  4YOR A;  3MCP A;  4CEE A;  4CI6 A;  1BI4 B;  1RBR A;  2OZM A;  1WSI A;  3O4N A;  4CF2 A;  5FPE A;  1O1W A;  5KTQ A;  1D9F A;  3K5N A;  1WSH A;  3DLL L;  3T1Y K;  5M1F A;  3I56 N;  4HUE A;  1WSE A;  1BIU A;  3RMD A;  4AH9 A;  2C1I A;  1OKJ A;  3DM2 A;  5C42 A;  4KHP K;  1YTA A;  5K14 A;  5BR8 K;  4CGI A;  3VMF B;  4DTS A;  3JS6 A;  4B9Q A;  2QWP A;  2HBM A;  4QS8 A;  3QEW A;  4DLG A;  3QIC A;  1MWM A;  2PAV A;  3N4Q A;  4CJ4 A;  4Y0W A;  3B6O A;  2A5X A;  1UOC A;  1N5Y A;  3QB0 A;  2ZD1 A;  3K58 A;  1WSG A;  3U8X A;  4DSI A;  5EX5 A;  1VQ8 N;  1TUU A;  2W40 A;  4LF8 K;  4KFB A;  4BC5 A;  2D4W A;  4DTO A;  4DQ8 A;  3AA2 A;  1HYS A;  2UU9 K;  1CXU A;  4QCL A;  1VRU A;  4JKB A;  3H46 O;  4BR4 A;  1J5O A;  3DMJ A;  4F8R A;  3MAQ A;  3C7N B;  4DQQ A;  1RT1 A;  3VPZ A;  2OYQ A;  3A8Y A;  3M8P A;  4CF0 A;  5I3U A;  3H3N O;  4YDU C;  1SL0 A;  1KTQ A;  3TAB A;  4H5R A;  2VG5 A;  3C0B A;  2G8W A;  3OTO K;  2QWR A;  4DU4 A;  1SKS A;  1HNI A;  3LDP A;  2FF6 A;  2QEX N;  3DAW A;  2QKK A;  3HP9 A;  5TKW A;  2OPS A;  4CF1 A;  2W6K A;  3C95 A;  3CJC A;  1J54 A;  5AQY A;  4IXC A;  5BN9 A;  1RGI A;  4IEE A;  1HQU A;  4RW7 A;  5BPN A;  3AVA A;  1NK0 A;  1QTM A;  3BF1 A;  4B1X B;  4DUZ K;  4EZ9 A;  3P38 A;  3AO5 A;  3OYA A;  2OA8 A;  1SQK A;  2D1K A;  3CCS N;  4Q5V A;  2AA4 A;  1YIJ N;  3ZET A;  1N8R O;  2ZE2 A;  3BZK A;  2O8E B;  5KI6 A;  4Z0U A;  3NGY A;  3U3Y A;  1BCM A;  3L2W A;  3BF3 A;  3BGR A;  3TTD A;  1S1V A;  4H0V B;  3CJB A;  3MK6 A;  1NK7 A;  1KQS M;  3PIO L;  3O5B A;  5JIC A;  5IT9 O;  1HRH A;  2Z1J A;  1NK8 A;  3L2U A;  3MCA B;  4JK7 A;  1VQM N;  3IG1 A;  1N36 K;  3A2F A;  1QQO A;  4M7X A;  3FR0 A;  4J2E A;  3RSE A;  4BG9 A;  3WNE A;  4OLB A;  4FLY A;  3PUF A;  4GV3 A;  3CM6 A;  4LF9 K;  3KD1 E;  4HTL A;  2OTL N;  3O6W A;  3K5L A;  5AQG A;  2Q0U A;  3OYK A;  2HND A;  3HRG A;  4DQP A;  4L3Q A;  1VSD A;  2ITM A;  4E7J A;  5C10 A;  5C12 A;  3T1A A;  1ZBH A;  2P9S A;  1Z05 A;  2DFE A;  4OVL A;  3LAM A;  4LF7 K;  2YHA A;  3HTV A;  1X1P A;  3EZ5 A;  5EOY A;  4DS5 A;  5AQU A;  4FOI A;  1KLM A;  2BH1 A;  4NXM K;  4CD3 A;  4DR1 K;  3IRX A;  4BRI A;  4E3S A;  4DR3 K;  4CBX A;  1NLV A;  1T05 A;  1VQ4 N;  4BC2 A;  1BU6 O;  1NK4 A;  4DS4 A;  1FK9 A;  2JGU A;  4ILH A;  3CJ7 A;  1C1B A;  4FYD A;  1KFD A;  1NGF A;  5DM7 L;  2P9P B;  4XIU A;  4N76 A;  2E5L K;  3CHW A;  2FF3 B;  3MDQ A;  4CJE A;  5C2D A;  2WBN A;  3O1B A;  1U2V A;  4OLA A;  3AV9 A;  3CF5 L;  3AVG A;  1JLE A;  3SAG A;  1YXQ A;  3THX B;  3RRG A;  4DUY K;  5HL7 L;  1HPM A;  4N47 A;  1DGK N;  3KK3 A;  2YHY A;  1VQ6 N;  4C8M A;  3KLH A;  4CJS A;  4H5T A;  4LH5 A;  2D5R A;  1GLB G;  4RW9 A;  4M3R A;  4B1Y B;  3ITH A;  4QS9 A;  4LY7 A;  2UXD K;  4K0K K;  4AF1 A;  2B5J A;  3DYA A;  4CIE A;  1NG9 A;  2G8H A;  2Q36 A;  1HNW K;  3LDL A;  4EIA A;  5A2Q O;  3P5J A;  4KHY A;  5SWM A;  1I39 A;  4WQ5 C;  3R9P A;  2I5J A;  4CF9 A;  3QLH A;  2KW4 A;  3AVC A;  4DFK A;  5FDL A;  4GMJ B;  2DY4 A;  1KLN A;  5FRM A;  1ASW A;  3ZX2 A;  3R8E A;  2HHS A;  1MWK A;  3L3V A;  4H0X B;  3J8A A;  1YIT N;  3ZYY X;  4JS5 A;  1TK8 A;  1WNS A;  3LP1 A;  3AVJ A;  3VGM A;  4FJK A;  4NXN K;  3EKU A;  1JLB A;  4FWQ A;  4JRQ A;  3S3N A;  1IO2 A;  4F4K A;  4QOZ B;  2PZS A;  3KKS A;  5GAE P;  2O8C B;  3VGK A;  1JXE A;  2DFF A;  2GTD A;  2Q97 A;  2P51 A;  1IG9 A;  4IO9 L;  3CCJ N;  1BDG A;  2GV9 A;  1IBK K;  4CGG A;  5FRO A;  3IS9 A;  3C6A A;  3TTC A;  3SMS A;  4DR6 K;  2O4G A;  2HHV A;  2YCH A;  1OH8 A;  4IFY A;  5KRS A;  1Z25 A;  5CYM A;  3QEX A;  2I7N A;  2Z1G A;  4DTN A;  2P9I A;  5J2N A;  4ZTJ A;  4KRF A;  1SAZ A;  4WCE L;  3NH2 A;  3CC4 N;  1XI1 A;  1Q9X A;  3OYI A;  1FKP A;  2W41 A;  4JI4 K;  4FJ8 A;  1Q82 O;  2PY5 A;  1CZB A;  3E9P A;  1SKW A;  1TKD A;  4ZTF A;  4IDK A;  1S1X A;  2YI1 A;  3SAF A;  3SBG A;  3O9Q A;  1NJW A;  1I94 K;  3ZSY A;  4H5N A;  3JYT A;  2KFZ A;  1E3M A;  3SNN A;  3ZCM A;  5HLF A;  1YF5 L;  3G6E N;  1NJZ A;  1WBD A;  3U9Z A;  5AQV A;  3EKS A;  1LWF A;  4DV5 K;  2W00 A;  1E4F T;  1GLE G;  1GLA G;  3CCE N;  5E26 A;  2F8T A;  1IJJ A;  4CEF A;  4Z4H A;  4FJG A;  5HBM A;  4YOU A;  4C8O A;  1EWQ A;  5C0Y A;  4CBW A;  3AGR A;  4I6M B;  4CEO A;  1REV A;  4J2A A;  4CHQ A;  3CM5 A;  4BE0 A;  1JCF A;  5AZI B;  1HX1 A;  5AFU H;  1YT3 A;  1T03 A;  4H0T B;  3QNN A;  3ZT1 A;  1VSL A;  4CZL A;  4IOX A;  1VQL N;  3VTI A;  3CFO A;  3HT3 A;  3TU5 A;  4DSF A;  2PYL A;  2BGG A;  4RW6 A;  4KHQ A;  1VSF A;  4FJL A;  1ATN A;  3G25 A;  3QIP A;  4CK3 A;  4BWM A;  1T7P A;  3HVT A;  4Q0B A;  4O5F A;  4BRM A;  1O13 A;  4XH5 A;  1JLC A;  3CPE A;  4AHT A;  2G8I A;  4H8K A;  4FJ7 A;  1VQK N;  2D0C A;  3DJC A;  4EP4 A;  2HB5 A;  1U49 A;  3ZSR A;  4AHU A;  1NGC A;  1HJR A;  2QXF A;  1A5V A;  2OPQ A;  1FXX A;  4LFA K;  1K73 O;  2QWN A;  5M1K A;  2HF4 A;  4FLV A;  1ASV A;  1QSS A;  3M6G A;  4LFC K;  3S3M A;  4JI5 K;  2FBY A;  2QWO A;  4F9O A;  3SV4 A;  4IZ9 A;  4A5A A;  1VRT A;  4C1N I;  4J2D A;  1HKG A;  5M1O A;  3ZSV A;  3KD5 E;  1XHZ A;  4Z4G A;  3SQ0 A;  4CZG A;  4NLC A;  3DWL A;  4CK2 A;  1RT3 A;  1DT9 A;  4EHU A;  1LWE A;  3EY1 A;  3SUO A;  3CFR A;  4A59 A;  1IKW A;  3CMA N;  1X9W A;  1HPZ A;  2R7Y A;  4DB3 A;  1W0H A;  4CEZ A;  4CVN E;  2B4J A;  2KZZ A;  3QBW A;  1S6Q A; 
#chains in the Genus database with same CATH homology
 4PL8 A;  1E4G T;  1BO5 O;  1NGI A;  3ULE B;  1XUP O;  3I56 N;  3M5R A;  2J4R A;  3HOS A;  5ADX H;  5HOO A;  2YHW A;  2C1I A;  1OKJ A;  3FGU A;  3EL2 A;  1R59 O;  4C1N K;  4B1V A;  1V4S A;  3E66 A;  3SK3 A;  3AAR A;  2A40 A;  1KAX A;  3E9O A;  2VGN A;  4BY9 C;  3VMF B;  4JKF A;  4A61 A;  3JS6 A;  3VEV A;  4B9Q A;  2QWP A;  2HBM A;  3CQY A;  2GUP A;  4QS8 A;  1Q7Y O;  3WEE B;  3QIC A;  1MWM A;  3D6R A;  4K25 A;  3SMP A;  4BGA A;  2PAV A;  3N4Q A;  3R6M A;  4Y0W A;  5GIP A;  1KD1 O;  3O4W A;  2A5X A;  1TYQ A;  2P9L B;  4O8K A;  3MX2 A;  3CXC M;  2ZF5 O;  2FLO A;  4FPB A;  4OO1 J;  3QB0 A;  5F0X A;  2NRW A;  3TTF A;  2E20 A;  3U8X A;  5GIN A;  4YOV A;  5EX5 A;  1VQ8 N;  4MLE A;  2KHO A;  1TUU A;  2NNW A;  5AZJ B;  2W40 A;  5AQZ A;  3PIP L;  3F2K A;  4BC5 A;  2D4W A;  4BVP A;  1GLD G;  1GLL O;  2IVO A;  4NB4 A;  4DQ8 A;  1BG3 A;  3A5O C;  3AGK A;  3VF4 A;  3SAH A;  1D4X A;  3A5L C;  1HLU A;  4RCH A;  5JLF A;  4JKB A;  3H46 O;  2VYP A;  5GAG P;  4BR4 A;  4BRE A;  4YOW A;  3D2E B;  3C7N B;  2Q0R A;  3ZEU A;  3VEY A;  4A2B A;  4CZK A;  3LDN A;  3VPZ A;  4U7B A;  1YJ9 N;  3A8Y A;  1C0G A;  1BOT O;  5JVH L;  2F9T A;  3H3N O;  4YDU C;  5AQO A;  2WC9 A;  1VQP N;  4H5R A;  3WXK A;  3C0B A;  4RWT A;  2QWR A;  3ENB A;  5AQM A;  4M7Y A;  5ADX A;  3SJH A;  4MO4 A;  5JMV A;  3LDP A;  2FF6 A;  2QEX N;  3DAW A;  5AQQ A;  1KXP A;  4H0O A;  1XQS C;  3UKU B;  4JKG A;  3RVC A;  4GV9 A;  1NGD A;  4BG8 A;  5TKW A;  4FWK A;  4JKH A;  2YJF A;  3CIP A;  2GX9 A;  2IIR A;  1K8K A;  3O9T A;  3CJC A;  5BN9 A;  5AQY A;  4IXC A;  1RDU A;  3F5T A;  5EXW A;  1VQO N;  4GV6 A;  4JD2 B;  1RGI A;  4IEE A;  3MN7 A;  5AQW A;  3EE9 A;  4CD1 A;  5BPN A;  4ISE A;  1Q86 O;  3BF1 A;  1NBW A;  1NJI O;  3ENO A;  4B1X B;  3IMX A;  5AQR A;  3P38 A;  2E2Q A;  3KZB A;  2CGJ A;  2HBK A;  2FXU A;  1HUX A;  3T7Z A;  4ILG B;  3I33 A;  3P4I A;  3CJ9 A;  1SQK A;  2D1K A;  3CCS N;  5C2F A;  2GEL A;  2QWQ A;  4PL7 A;  4DKW A;  3QFP A;  2AA4 A;  5GIO A;  5BRE A;  1YIJ N;  3ZET A;  1N8R O;  3LM9 A;  4IJN A;  4KH6 A;  2QTD A;  3CER A;  4BRA A;  3M1F A;  2NRT A;  4JKD A;  4EAH D;  2HF3 A;  1ZXO A;  3ATV A;  1G99 A;  4WF9 L;  2GWK A;  2OAN A;  2P9P A;  3WQU A;  2JWK A;  3O80 A;  5TKY A;  3BF3 A;  2CH6 A;  5M1N A;  1S72 N;  3HM8 A;  3TTD A;  1TYQ B;  5EVZ A;  1Q81 O;  2Q2R A;  2H3G X;  1NGJ A;  4H0V B;  2CGK A;  4BGB A;  3CJB A;  4FWO A;  3MK6 A;  4H0Y B;  1VQ7 N;  1KQS M;  3LDO A;  3PIO L;  3O5B A;  3WXJ A;  5JIC A;  3I8B A;  5AQK A;  5FPD A;  2E1Z A;  5BRF A;  4WYB A;  3MCA B;  4JK7 A;  4WQ4 C;  4JKA A;  1VQM N;  5CE3 A;  4QS7 A;  4ISF A;  3VEW A;  1T44 A;  5JVG L;  3IDH A;  1QQO A;  4M7X A;  1TUY A;  3T69 A;  3VGL A;  3FR0 A;  4FL9 A;  3OBW A;  3RSE A;  4BRO A;  4BG9 A;  2P9K A;  1C0F A;  2E2P A;  2QXL A;  1Y64 A;  2QW9 A;  4FO0 A;  4IFE A;  1U6Z A;  1QVG M;  3HOT A;  3ZEU B;  4GV3 A;  1X9J A;  4HTL A;  2OTL N;  3CCM N;  3O6W A;  4CZJ A;  3CCV N;  2CH5 A;  5AQG A;  2Q0U A;  1NMD A;  5H1S Q;  4PKI A;  3HRG A;  3SLC A;  3L6Q A;  5LJV A;  2WUS A;  3MN6 A;  4L3Q A;  3PLA A;  3IUC A;  3S41 A;  4FWL A;  3TSQ A;  2ITM A;  1VAZ A;  2IVP A;  2NRZ A;  3D2F A;  4MDB A;  3E1Y A;  1NWK A;  2CGL A;  3CD6 N;  5C10 A;  4IOC L;  5C12 A;  5BRH A;  4OPA A;  4PKG A;  1IG8 A;  2V7Y A;  4XH4 A;  3ZX3 A;  4JKG B;  3QFU A;  2P9S A;  1Z05 A;  2Q31 A;  4GVE A;  4BR9 A;  3MWP A;  1RDW X;  4PHT X;  1EO1 A;  4FWS A;  3HTV A;  5AQI A;  5ELZ A;  3I55 N;  4FWP A;  2C1G A;  2OTJ N;  5EOY A;  4IEI A;  3C65 A;  4B1W B;  5AQU A;  4FOI A;  2BH1 A;  4CD3 A;  1BA1 A;  2VWB A;  1T3V A;  3H3O B;  3ID8 A;  1T6C A;  4R79 A;  3EE8 A;  3KWG A;  4BR7 A;  5BR9 A;  4BRI A;  2ZJQ L;  1W2B M;  4FPA A;  3W3D A;  3A5M C;  4JK8 A;  4CBX A;  1NLV A;  3NVK A;  3D7E O;  1VQ4 N;  4YDU A;  1M90 O;  4BC2 A;  1BU6 O;  3CPW M;  1YAG A;  3WXL A;  3O9U A;  4KH4 A;  1QQN A;  3VEN A;  4ILH A;  3CJ7 A;  1H1V A;  5AQF A;  3LDQ A;  2UYT A;  2P9N A;  3K9K A;  3ZET B;  3TSU A;  3FZM A;  4BRK A;  3L0Q A;  1M1K O;  3GL1 A;  1P8Z A;  5F2R A;  1NGF A;  1LCU A;  1LOT B;  3ENH A;  4FWN A;  5DM7 L;  2P9P B;  1QHA A;  3CHW A;  4A62 A;  3CCL N;  2FF3 B;  1JCG A;  3CCQ N;  4DCH A;  3MDQ A;  1S3X A;  3GOI A;  4BRP A;  3O1W A;  4CBU A;  5C2D A;  2WBN A;  3GDQ A;  1YUW A;  3LL3 A;  3O1B A;  4K42 A;  2VGM A;  1U2V A;  3UKR A;  3A0I X;  3B8A X;  3CF5 L;  1VQ5 N;  2I7P A;  3HI0 A;  4UY8 O;  2E88 A;  1SS6 A;  3BUZ B;  3SAG A;  1YXQ A;  4JHD A;  4BC3 A;  4NLB A;  3CJA A;  3CC2 N;  5HL7 L;  1HPM A;  3OW2 M;  1DGK N;  2YHY A;  4IJA A;  1VQ6 N;  4H5T A;  1QZ5 A;  2P9K B;  2NZT A;  1GLB G;  4MLH A;  4O8U A;  1BUP A;  4EFH A;  4ILJ A;  1YVN A;  1S22 A;  4B1Y B;  4BE7 B;  2A42 A;  1W97 L;  4QS9 A;  3QBX A;  5AR0 A;  1P90 A;  2YX6 A;  4WFB L;  4CJ7 A;  3G4S N;  3CCU N;  1QQM A;  4BEC A;  3FZK A;  4HWI A;  4AF1 A;  5KPR A;  3L4Q A;  4G9Z A;  5CR4 A;  1YJW N;  3LM2 A;  3UB5 A;  3D2F B;  2RHK A;  2Q36 A;  3O08 A;  3LDL A;  5M1P A;  4EIA A;  3BEX A;  4U67 L;  1ESV A;  2P9S B;  4WQ4 A;  1CZA N;  4WQ5 C;  2NLX A;  3R9P A;  3P39 A;  3NVM A;  1DEJ A;  3R3L A;  2E8A A;  2FSN A;  2YJE A;  5AQP A;  4B1U B;  1X3N A;  3K9J A;  1J6Z A;  1MDU B;  3WEE A;  2E2N A;  2F9W A;  2P9U A;  5BPM A;  4BR5 A;  3ZX2 A;  3O9S A;  3R8E A;  5LJW A;  3SBT A;  5JLH A;  1NGG A;  1MWK A;  1GLJ O;  3GBT A;  3VES A;  3FFK B;  3U9D A;  4H0X B;  3J8A A;  1YIT N;  3ZYY X;  2VCP A;  3EO3 A;  4XJX A;  2ASM A;  3VGM A;  1V4T A;  2P9N B;  3CME N;  3EKU A;  1HJO A;  3N4P A;  4RTF D;  4FWQ A;  2ASP A;  1KAY A;  2NRX A;  3VET A;  3P31 A;  2YHX A;  3AY9 A;  2D0P A;  5GAE P;  3VGK A;  1RFQ A;  4M63 C;  2GTD A;  2Q97 A;  4I6M A;  4XEI A;  4IO9 L;  3CCJ N;  1BDG A;  5AZI A;  1ZC6 A;  4EHT A;  1NGE A;  4BC4 A;  1U2V B;  2KKZ A;  3C6A A;  3TTC A;  1OVY A;  3UKR B;  3SMS A;  2YCH A;  3MN9 A;  4H5V A;  3G71 N;  2V7Z A;  3A5N C;  3M3Z A;  5AQL A;  4BR0 A;  2I7N A;  3CJ1 A;  2QA4 N;  4FWM A;  4LC9 B;  2P9I A;  3BP8 A;  5AQX A;  3DXK A;  4A5B A;  3OA9 A;  1K8K B;  2WFB A;  4GY2 B;  2RE2 A;  3WUH A;  4BQZ A;  4OPH A;  3AAP A;  1SAZ A;  3VF6 A;  4WCE L;  3EZW A;  2QM1 A;  4CZE A;  5MLC Q;  4IO8 A;  4J8F A;  3CC4 N;  4JAX A;  1KAZ A;  3VF2 A;  3CCR N;  2QWM A;  2W41 A;  3ATU A;  4B1Z A;  1Q82 O;  3J7Z O;  4IWV A;  1YHQ N;  4CZF A;  4KH5 A;  2E1Y A;  4CZH A;  5B8H A;  3KHY A;  4H03 B;  3HSC A;  2GEM A;  4BRF A;  2FSK A;  3E9P A;  4NO7 A;  4BRD A;  4JEP A;  4YOX A;  3H6E A;  1K8A O;  3OHR A;  5AQH A;  5I9E B;  2V52 B;  2YI1 A;  4FWR A;  1JJ2 M;  5F1X A;  5GAH P;  3SAF A;  4BRC A;  1T6D A;  2AP1 A;  2D0O A;  3SBG A;  3KVG A;  3O9Q A;  3MMV A;  3VOV A;  2P9U B;  3KWI A;  4H5N A;  5BRD A;  1GLC G;  3KK7 A;  1YF5 L;  3FZL A;  3G6E N;  5FPM A;  3MN5 A;  2E2O A;  3U9Z A;  5AQV A;  1WOQ A;  3EKS A;  3HBT A;  3WXI A;  3EN9 A;  1YI2 N;  2BUP A;  1BA0 A;  4BRH A;  2W00 A;  1E4F T;  1GLE G;  1GLA G;  1JCE A;  2ZWH A;  3DXM A;  2HBJ A;  4BR2 A;  3CCE N;  2QI2 A;  5E26 A;  1IJJ A;  4XH1 A;  2BTF A;  4BRL A;  3QML A;  3CI5 A;  4WQ5 A;  5GAD P;  2ZGY A;  4JK9 A;  3FZF A;  3HZ6 A;  3FLC O;  4YOU A;  3CET A;  1ATS A;  3RSE B;  4CBW A;  5C0Y A;  3AGR A;  2KLA A;  5AQJ A;  4I6M B;  4MO5 A;  2IVN A;  5AQS A;  1ATR A;  3QDK A;  4K43 A;  4KBO A;  1WUA A;  5E84 A;  3MX5 A;  4FVU A;  2NRR A;  1JCF A;  1GLF O;  2A6A A;  1HX1 A;  5AZI B;  5AFU H;  4WFN L;  3GG4 A;  5FPN A;  2V51 B;  3TPQ A;  2JWL A;  3OBY A;  4H0T B;  4IDH A;  1VQN N;  2PFU A;  3VTH A;  4CZI A;  1SZ2 A;  1NGB A;  5KPT A;  4CZL A;  1KC8 O;  1VQ9 N;  3AAQ A;  4K41 A;  4IOX A;  5C15 A;  2HMP A;  1VQL N;  3ULE A;  3VTI A;  3TU5 A;  3MWT A;  4BVO A;  2ZJP L;  2P9I B;  3C6H A;  3H1V X;  5KQD A;  1QZ6 A;  1EQY A;  3L4I A;  4PKH A;  4BRN A;  2A41 A;  1DKG D;  3VEO A;  3DXK B;  2NRH A;  2DPN A;  3E9L A;  2ZJR L;  1ATN A;  3G25 A;  5BN8 A;  3VER A;  4BQL A;  3F9M A;  2NRV A;  3IFR A;  4O5F A;  3UE5 A;  4BRM A;  1O13 A;  5AQN A;  2HST A;  4XH5 A;  2P9L A;  3NMU A;  3CPE A;  3W0L A;  3U4L A;  1K9M O;  4MDA A;  4JKE A;  4GNI A;  4FOE A;  2Q1N A;  3Q7B A;  1VQK N;  2ZGZ A;  4H0P A;  4YOY A;  2F7T A;  2EWS A;  3DJC A;  3ID6 A;  1ILY A;  3FE1 A;  1NGA A;  3GE1 A;  3IKM A;  2FSJ A;  5AZJ A;  3R1X A;  1Q18 A;  3JXU A;  5AQT A;  4E1J A;  4H5W A;  5DM6 L;  1NGH A;  5LY3 A;  3CQX A;  3H45 C;  4C23 A;  1NGC A;  5AFU A;  1ZBS A;  4FSV A;  3D2E A;  5KPZ A;  1X3M A;  3C7N A;  4Z94 A;  3O8M A;  4CZM A;  1K73 O;  3Q7C A;  2QWN A;  2QWL A;  1BWF O;  2GWJ A;  1QVF M;  4JN4 A;  5M1K A;  3CC7 N;  2HF4 A;  3VEZ A;  3FZH A;  2PBD A;  3DXM B;  4ISG A;  3WXM B;  3M6G A;  4A57 A;  3WT0 A;  4DHY A;  5BPL A;  4JHD B;  4JNE A;  4BEB A;  1Z6R A;  2QWO A;  4F9O A;  4IZ9 A;  4BRG A;  4A5A A;  4AM7 A;  2HBL A;  4C1N I;  4A2A A;  4IOA L;  3H1Q A;  4JKC A;  3O9R A;  1HKG A;  3UKU A;  5M1O A;  5CHI A;  4WFA L;  3ZX0 A;  1MA9 B;  1XC3 A;  2ASO A;  1YJN N;  5KQ8 A;  1NM1 A;  4CZG A;  3TSP A;  3WQT A;  4NLC A;  3DWL A;  4EHU A;  4YOR A;  1DT9 A;  3MCP A;  4BRQ A;  4CI6 A;  4JD2 A;  5M1Q A;  4A59 A;  5FPE A;  4YOT A;  3CMA N;  5EY4 A;  3DLL L;  4DB3 A;  2A3Z A;  3VEX A;  1HKC A;  2HOE A;  5M1F A;  4AM6 A;  1HKB A;  3QBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...