3W3DA

Crystal structure of smooth muscle g actin dnase i complex
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
374
structure length
373
Chain Sequence
EEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure and solvent network of chicken gizzard G-actin DNase 1 complex at 1.8A resolution
rcsb
molecule tags Structural protein
molecule keywords Actin, gamma-enteric smooth muscle
total genus 122
structure length 373
sequence length 374
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3w3dA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3w3dA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3w3dA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3w3dA04
1BG3A 4FWKA 5E26A 2CGJA 1GLLO 3CQXA 3ZEUB 5KPTA 4IZ9A 1BA0A 3D2FB 3ATVA 1QHAA 2ASOA 4WYBA 2P9UA 1XC3A 2Q31A 3GBTA 2A3ZA 4FWSA 4H0PA 5AQTA 5BPMA 1NGAA 4DB3A 5AQSA 5AZJA 1NWKA 3HTVA 3ULEA 1C0FA 3UE5A 4BRHA 2D0PA 4CZLA 1WUAA 5F1XA 3DXKB 5JLHA 2KHOA 4A2AA 4B1YB 2VWBA 1T44A 3DJCA 2P9KA 1YAGA 1U6ZA 1NGIA 3IMXA 3ENOA 3O4WA 3U9ZA 1ATSA 1NBWA 3H46O 1GLCG 3EL2A 4H0TB 2YJEA 5LJVA 3VF6A 3VGLA 2PAVA 4I6MA 5KQ8A 1ZC6A 1P8ZA 3I33A 4K42A 1TYQB 2YCHA 1KAXA 2EWSA 4CD1A 2FSNA 2FSJA 2IVOA 3M6GA 3R9PA 1ZBSA 3EZWA 4JN4A 3VEVA 3H3NO 3IUCA 1E4GT 3BEXA 4FSVA 4FWNA 3ZEUA 1MWMA 4H5NA 5AZJB 3D2FA 2W41A 1H1VA 1V4SA 5BRHA 4NO7A 3VGMA 2P9UB 4WQ5C 1K8KA 5BPLA 4B1XB 1HJOA 4PL8A 2ZF5O 4BVOA 5AQWA 4H0VB 3VESA 4GY2B 3M1FA 1HUXA 3VETA 3ZETB 2V52B 1HLUA 3WXLA 3W3DA 2CH5A 1BOTO 1DKGD 1GLAG 4BR5A 1RGIA 1QQOA 4CJ7A 5KQDA 4IO8A 3L0QA 4BR0A 1QZ5A 1NGEA 3C7NA 3VOVA 4BC4A 1BA1A 3LDOA 3ZX2A 2HF4A 4BRQA 1X9JA 4FPBA 1ESVA 1ZXOA 3WEEA 4CI6A 3FLCO 3FZFA 4CZHA 3M3ZA 5AQVA 1GLJO 3GG4A 5AQFA 3VGKA 1NGCA 5AZIB 3WXJA 4BRAA 4KBOA 2V7ZA 5FPDA 5FPNA 1QZ6A 4BGBA 5F0XA 4H03B 4RWTA 2BTFA 3DXKA 2E1YA 3VEWA 3U4LA 3QMLA 3FR0A 2Q0RA 1NGHA 4B1UB 1JCGA 1BDGA 2OANA 4NB4A 5AQKA 3DAWA 5AQMA 5LY3A 1LCUA 2A5XA 3MMVA 4YDUA 4FPAA 1TUYA 2P9IB 3QICA 2QW9A 4I6MB 3QBWA 3AY9A 3HBTA 3MN7A 2E2OA 3O08A 3RSEB 2ASMA 1T6DA 3WEEB 4BRLA 3GDQA 4CD3A 3KVGA 3GE1A 4XH4A 2QWRA 4IJNA 5AQJA 5CE3A 2F9WA 1IG8A 5AQNA 4MLHA 3MDQA 4HTLA 4K43A 4IJAA 4BRMA 2QWLA 4WQ4A 2ASPA 3EO3A 4WQ5A 3VENA 3ZETA 3GOIA 1Z05A 5BRFA 4F9OA 1NGBA 1BUPA 4JHDB 1Q18A 1ATNA 3OHRA 2E2QA 4QS8A 3HZ6A 5AQLA 2W40A 2P9IA 4DHYA 3P4IA 4BROA 2I7NA 1X3NA 4BC2A 3CETA 3A5OC 3UKRA 1LOTB 1GLEG 2D4WA 2FLOA 3O1WA 3LDQA 3CI5A 4PL7A 3D2EA 5AQOA 5LJWA 2P9LB 2Q1NA 4BREA 2F9TA 4BRKA 2D1KA 3A5LC 1OKJA 3VEOA 1HX1A 4BR7A 2H3GX 1KXPA 5AQHA 2IVPA 5AQGA 4BR9A 2V7YA 4H0XB 4ISGA 5JMVA 2CH6A 3O80A 1HKGA 3VERA 2ZGZA 2IVNA 3LL3A 4EHTA 4AM6A 4FO0A 4LC9B 3WT0A 3CJCA 4O8KA 3GL1A 4BQZA 5EVZA 4JAXA 2Q0UA 3H1VX 2D0OA 3F9MA 3VPZA 3AAPA 3R6MA 5AR0A 3WQUA 3R8EA 4BR2A 1DGKN 1IJJA 3D2EB 3KHYA 3SLCA 5I9EB 2A6AA 5AQXA 3B8AX 3ID8A 2PBDA 3FGUA 2QXLA 3KZBA 3RSEA 2J4RA 4PKHA 1KAYA 4MO4A 4FWLA 4BRGA 3DXMA 1U2VA 4GNIA 5E84A 1DEJA 2CGLA 2GTDA 3HI0A 4B9QA 3UKUB 1U2VB 5EXWA 4FWQA 4MLEA 4A2BA 1NGDA 3CERA 4CZJA 3J8AA 2QWQA 3UKUA 3MN9A 5BPNA 2GELA 5F2RA 2YHXA 3WQTA 4C23A 1XQSC 4J8FA 1WOQA 1YUWA 4L3QA 4CBXA 3IDHA 1JCFA 2YHWA 3IFRA 4BG9A 5BN8A 3CJBA 4Y0WA 3L6QA 2GUPA 3FZKA 2ZWHA 5AQQA 5KPZA 4JD2A 3W0LA 3CQYA 3BF1A 2E1ZA 5ELZA 2WUSA 2A40A 1YVNA 3C7NB 1SZ2A 4FWRA 3A5NC 1QQNA 3CJ1A 2GWJA 4B1VA 5EY4A 5BRDA 4MO5A 1X3MA 4FL9A 1GLFO 2QWMA 3SK3A 3DXMB 3UB5A 5JICA 3L4IA 3EN9A 3HSCA 1BU6O 1MWKA 4CZEA 1BWFO 1NM1A 4AM7A 2YI1A 4BR4A 1C0GA 4B1ZA 3MN6A 4A62A 2FF3B 3QBXA 2QM1A 4BRPA 3A0IX 2Q97A 2P9PA 4BC3A 1HKBA 3H45C 1HKCA 3CJAA 4FOIA 2E8AA 1KAZA 5JLFA 4E1JA 3FZMA 4XEIA 3UKRB 4H5VA 1J6ZA 1ATRA 2GWKA 5BN9A 5TKYA 4JNEA 3BP8A 1T6CA 4CBWA 4YDUC 1D4XA 1Z6RA 1YXQA 2ZGYA 3EKSA 2UYTA 2FXUA 2QWOA 3O5BA 3CJ7A 3ZX0A 4BGAA 4RCHA 1EQYA 1TYQA 4FWOA 5AZIA 4CZKA 5BR9A 5KPRA 1MDUB 1NMDA 3FE1A 1CZAN 5AQPA 4M7YA 2AP1A 5AQRA 5AFUH 5EX5A 3H6EA 4QS9A 4BVPA 4BRDA 2CGKA 4EFHA 3WXIA 4JHDA 4CZIA 2P9NB 3QFUA 4JD2B 4BC5A 3LM9A 3SMPA 3LM2A 3O6WA 4H0YB 2GEMA 3VF4A 3SMSA 3JS6A 5FPMA 4BRIA 2FSKA 3QDKA 1K8KB 2NRHA 5FPEA 1BO5O 1JCEA 1NGJA 1QQMA 4K41A 2A41A 2E2NA 5EOYA 4CBUA 4CZGA 4BRFA 4PKIA 2IIRA 4O5FA 5BREA 5AQYA 4IWVA 4FOEA 3FZLA 1RDWX 1NGGA 5AFUA 3CHWA 1GLBG 2Q2RA 3FFKB 3EKUA 4EHUA 3MCPA 3MN5A 1XUPO 1HPMA 4RTFD 3VF2A 2BUPA 1NGFA 3WXKA 2QWPA 5ADXH 3BUZB 4A61A 4DCHA 4DQ8A 2HF3A 3AARA 3H1QA 4PKGA 3FZHA 3O8MA 5B8HA 3SJHA 2YHYA 4EIAA 1G99A 2E20A 3D7EO 2P9PB 3CIPA 3BF3A 4CZFA 3C0BA 2QWNA 2NLXA 1R59O 4H5TA 3QFPA 3CJ9A 3QB0A 3I8BA 4ISEA 3O1BA 2P9LA 4HWIA 3ULEB 3ENHA 4M7XA 3WUHA 5ADXA 2Q36A 4ISFA 4B1WB 2P9SA 3LDLA 4FWPA 3LDNA 2FF6A 5AQIA 2YJFA 1RFQA 4XH1A 5AQUA 2P9SB 3VEZA 1SQKA 3VEXA 4CZMA 1NLVA 2V51B 2A42A 3ATUA 3TPQA 4BRNA 3A5MC 4IXCA 3AAQA 2VCPA 3DWLA 3LDPA 3MK6A 2AA4A 4H5RA 4BG8A 2HOEA 1TUUA 3H3OB 3U8XA 2NZTA 2E2PA 2VYPA 2P9NA 3HM8A 4Z94A 4BQLA 1S22A 3U9DA 4QS7A 4FWMA 4M63C 4XH5A 2DPNA 2P9KB 3VEYA 3JXUA 2E88A 3TU5A 1V4TA 1Y64A 2HMPA 3A8YA 3ZX3A 1SAZA 1MA9B 4H0OA 5AQZA 4H5WA 4WQ4C 3G25A 2ITMA 4BRCA 1E4FT 2I7PA 4EAHD 4K25A 1S3XA 1GLDG 3S41A
chains in the Genus database with same CATH superfamily
4IOXA 4DFKA 4J2AA 3WNFA 2Y1JA 1FXXA 3QEWA 3AVKA 4AHCA 1ZBLA 4E1MA 2OZMA 1SUQA 4KAZA 1XNQK 4WYBA 2P9UA 4DU4A 3GBTA 2A3ZA 4JK9A 3QNNA 2XRIA 1NWKA 4O5BA 3AO5A 4BRHA 4CEDA 1WUAA 5F1XA 2VWBA 2JLEA 1Q81O 3DJCA 1WSJA 1CZ9A 1U6ZA 4GVMA 2E6MA 1NGIA 3IMXA 3MX5A 3ENOA 3SQ4A 1ATSA 3M8RA 3NCIA 3H46O 3O9SA 1KCFA 4Z4IA 2HB5A 5LJVA 5KTQA 5GINA 1ZC6A 4MDAA 2B6AA 5DMRA 2O8CB 1TYQB 3TTDA 1J9AA 4DTSA 3OYAA 1WSHA 1XI1A 1ZBSA 4TSXA 3L3VA 4Z4HA 4BEBA 3ZEUA 2OPSA 4H5NA 3HXMA 2RPIA 3VQ4A 3PX4A 4JKAA 2YKNA 1HJOA 2ZF5O 4BVOA 1D5AA 4H0VB 1E3MA 4E7JA 3WXLA 1HLUA 1X9SA 3W3DA 2FBXA 1HNZK 3SBTA 4J2EA 1IBLK 4KHPK 1QQOA 4CJ7A 3RRHA 5KQDA 1T05A 3L0QA 4GV9A 1VRTA 4BR0A 3VOVA 3ZX2A 1YTAA 4BRQA 4F3OA 4DFPA 2PYJA 1ZXOA 4FK4A 4CIGA 3SAHA 3P38A 5AQFA 3OY9A 3AO4A 1RBTA 5AZIB 3WXJA 3E9OA 3WNGA 4JS4A 3QINA 5FPDA 3THWB 3KK3A 3AA3A 1JJ2M 1XMOK 3B6PA 4DTMA 2HMIA 5DM6L 1Q9XA 3HM9A 3NGYA 4B1UB 1I39A 1BQNA 1JCGA 3SAFA 5LY3A 2UUBK 2A5XA 4YDUA 3O4NA 1QVGM 2QW9A 4CF0A 4CJPA 3MN7A 3RMDA 4DUYK 4AHSA 2E2OA 4PHTX 3GDQA 4JV5K 4CECA 3AVAA 1OVQA 4CJEA 2F9WA 1IG8A 4HTLA 4K43A 3LP0A 4BRMA 1NNEA 4IG0A 4EP4A 4F9OA 1S6PA 4LF7K 3J7YP 2BE2A 4CF2A 4JHDB 3L8BA 4JYAK 4C8KA 1XMQK 4FXDA 3DI6A 4DV5K 4DFMA 1WBBA 2E2QA 2W40A 4MFBA 5HL7L 3V1OA 3L3UA 4CEBA 4DHYA 3N4QA 2OTLN 4GMJB 2Z1HA 3T1HK 4J2DA 3UKRA 4M41A 1NJZA 2Q1NA 4BREA 1C0TA 2F9TA 4BDYA 3KLIA 4CGHA 3A5LC 2IGIA 3VEOA 4BR7A 5C12A 3VQ9A 3AVIA 2ZJQL 4X65K 2AJQA 4BR9A 2JGUA 4KI6A 2CH6A 1QVFM 3VERA 2HVIA 2KQ2A 2IVNA 3LL3A 4EHTA 4AM6A 5HOOA 3P31A 4DMNA 1RT6A 5EVZA 2I5JA 3H1VX 2HHQA 1JXBA 1N36K 5JVGL 4CGGA 3AAPA 3AGRA 2WBNA 3HSTB 3KHYA 5I9EB 3CG7A 3V9UA 3ID8A 3THYB 4FW1A 2QXLA 3KZBA 3B6OA 4CEQA 2J4RA 3V9SA 4NXNK 1WN7A 4FWLA 3DXMA 4PY5A 1TVRA 1VQ7N 1X9WA 1J5EK 4FWQA 4MLEA 4A2BA 1NGDA 1BIUA 1WSGA 4DR1K 3PIPL 1HNIA 3OVNA 5F2RA 3WQTA 1XQSC 4J8FA 1O13A 4NCAA 4YOXA 1JCFA 4YOTA 2YHWA 3ZT0A 2Y1IA 3CCQN 4EP5A 4Y0WA 3TAMA 4B9TA 2LSNA 3KJVA 2UXBK 3VQ8A 2E1ZA 5ELZA 3CC4N 3OJSA 4B1VA 5EY4A 4CEFA 5C2FA 1DTTA 3TR8A 2F96A 2QWMA 3L4IA 1U45A 3EN9A 3ZT3A 5M1FA 1BU6O 1CZBA 1REVA 3H08A 2YKMA 4U7BA 1NM1A 4AM7A 3BY5A 3CCRN 1NK0A 1VQ4N 3V1QA 4RW8A 4BR4A 4B1ZA 2A1RA 1F21A 4F4KA 1ASVA 5GIOA 2DFEA 1RDAA 5HROA 1NOYA 4BRPA 3ZSZA 3A0IX 3CM5A 1HKBA 4FJXA 4B08A 3K5LA 4CJKA 1IH7A 4E1JA 3FZMA 3L2WA 5KGWA 3AVHA 2WONA 3UKRB 1RT5A 4DQQA 1S1TA 1ATRA 1EWRA 1FW6A 3OYFA 5EU7A 4YDUC 2GX9A 4YHHK 3MAQA 2UYTA 3MEGA 3HK2A 2EHGA 4HUGA 3DLKA 3ZX0A 3M5RA 1EQYA 4CZKA 4DUZK 5BR9A 2C1IA 3FE1A 1CZAN 4YOWA 2AP1A 4QS9A 4BRDA 3NH2A 1QS4A 3BZCA 4KHUA 3WXIA 4N41A 3AVGA 4W5RA 4YORA 3LM9A 4CF9A 5BPLA 3O6WA 3QNOA 2IOCA 2NRHA 2W42A 5EOYA 4CZGA 4K41A 2A41A 4BRFA 4PKIA 5CR4A 2IIRA 1S1XA 1KVCA 4CJWA 1T03A 1LAVA 4IWVA 5AQYA 5KGXA 4GKJK 3LPTA 3G10A 3M8PA 4DU1A 1KSPA 3CHWA 3EKUA 2Q2RA 3QEVA 3S3OA 3HP6A 3AV9A 4KKOA 3ZSXA 1Q8IA 3BUZB 3RTVA 4DQ8A 3H1QA 4PKGA 2E20A 3DMJA 5HRSA 4CJVA 5K14A 3K58A 4YOYA 3NF6A 4E19A 2NLXA 4H5TA 2VG5A 1I94K 4E1NA 2P9LA 4CHOA 3ENHA 4KTWA 4B9MA 1X1PA 1JXEA 5ADXA 4O55A 4CFAA 4FZXC 3LDLA 4FWPA 3LDNA 2QTDA 4F2RA 4AHRA 3R1XA 4FJKA 1DT9A 3F5TA 4N76A 4DV3K 1WAJA 1J5OA 1WNSA 4BRNA 3A5MC 3AAQA 4LF5K 3ZLJA 3RR7A 3OYLA 4AH9A 3LDPA 3CD6N 1W2BM 4FJJA 2WTUA 3F9KA 2HOEA 3U8XA 3VQ7A 2P9NA 2QKKA 1GOCA 4FW2A 2KKZA 4QS7A 4JK7A 3K5MA 4B9UA 4BWJA 3JAMO 1L5UA 2QKBA 4M63C 1S1WA 1C1CA 2P9KB 3IKMA 1OH5A 3JXUA 3ZX3A 4DR5K 1KQSM 4UY8O 1RBVA 1DTQA 4JI3K 4JKGA 4DQRA 1QQCA 3LZJA 1VQLN 4BRCA 4EAHD 3KLFA 1GLDG 2HHTA 2HNZA 3NAEA 3KK1A 1GLLO 3CQXA 3E1YA 5KPTA 3C95A 1VSFA 1QHAA 1NK5A 5LL6Z 1XC3A 2Q31A 4FWSA 4W5NA 3SI6A 1Z25A 4MQ3A 4KPYA 2XY7A 3DOKA 4KO0A 2D0PA 4CZLA 4DFJA 3VQAA 5KI6A 2KHOA 3K0SA 4DF4A 3PLAA 2RF2A 3KLEA 1YAGA 2D0CA 3NF9A 3O4WA 4LH4A 1ASUA 4H0TB 4DG1A 4HCCA 3SYZA 3VQEA 4I6MA 4CERA 1N6QA 4JKEA 4DV7K 3I33A 4B3TK 2KFNA 2OA8A 1A5XA 4M3RA 2YCHA 3HOSA 2EWSA 2IVOA 1M1KO 4KHQA 4A59A 4JN4A 3VEVA 4ILJA 3IUCA 3BEXA 4FSVA 5J2NA 4IO9L 4DKWA 3BZKA 3D2FA 2G8IA 1H1VA 3V9ZA 2VWJA 3KD5E 5MLCQ 4WQ5C 1RILA 4M3ZA 2HBJA 4CESA 1ASWA 3MEEA 1YHQN 2O4IA 4LY7A 5AQWA 3VESA 1A5VA 3M1FA 4CGFA 4M3XA 4DTOA 3VETA 3OYBA 3CCSN 4JRQA 3EE8A 1CXQA 3IS9A 3TARA 3O9QA 1RT1A 1SL1A 4CJRA 4ZHRA 1JLQA 1NGEA 1YIJN 3BDPA 2OPPA 3ALYA 5CHIA 3MXMA 3KTQA 4IDHA 4FPBA 3WEEA 4CI6A 3FLCO 3CM6A 2OTJN 3DLHA 3HO1A 3FZFA 4RW7A 4CZHA 4B8AB 4JKBA 4B9LA 1GLJO 3HT3A 3NGZA 4E72A 3J80O 4FJGA 4BRAA 2V7ZA 1Z26A 5DM7L 1BI4A 2YX6A 3TABA 3NVKA 4IKFA 4QCLA 4Q5VA 2GV9A 2BDPA 3U4LA 4NLBA 4CJTA 3U6FA 1NGHA 1O1WA 4NB4A 1U04A 5AQKA 4BDPA 5AQMA 2FC0A 1P90A 2HVHA 1U47A 4B9SA 4I6MB 3KWIA 2KW4A 1VQ5N 3DLBA 3HBTA 1VQPN 4FLTA 3L2VA 1BL3A 3G71N 5AQNA 1FKPA 4WQ4A 2ASPA 3EO3A 3ZETA 2WOMA 5BRFA 1Z05A 3SAGA 5M1PA 4FM1A 3SQ1A 3OHRA 2NRZA 4QS8A 5AQLA 3HZ6A 5JENA 5SWMA 1T3VA 2O8BB 1HR0K 2I7NA 5TKWA 2ZM6K 4KHYA 3CETA 3P5JA 4OKEA 1LOTB 2FLOA 5HBMA 3CI5A 5AQOA 1NK4A 1HYVA 1U49A 1ZYQA 3KKRA 4AQYK 4OLBA 5HLFA 1HQEA 4JI2K 3F73A 1Q7YO 2QXFA 2V7YA 3HYFA 4H0XB 2ZGZA 4IFEA 1TAQA 4O0JA 2HHVA 3VQCA 1SL2A 1A5WA 1S5JA 4EZ6A 3T1YK 2Q0UA 1KLNA 3NDKA 3F9MA 3VPZA 4B9VA 2X6SA 4A5AA 1SKWA 3R6MA 4E7KA 3R8EA 1DGKN 1IJJA 3SLCA 4B3RK 2VQEK 4OGEA 4I9QA 2PBDA 3FGUA 4KTQA 1FJGK 1S9EA 1KAYA 2VG6A 4MO4A 4FJMA 4JI4K 1U2VA 2FBTA 5E84A 4R79A 3CQ8A 4N5SA 2X74A 3CMAN 3UIQA 3HI0A 4JEPA 5EXWA 3QESA 1RTHA 3V4IA 3CERA 4FJ8A 3EY1A 2PZSA 3UKUA 3MN9A 3AVLA 2GELA 3AVCA 3O9RA 2HSTA 4L3QA 5J1EA 4QOZB 4IFYA 1NK7A 1TKZA 4BG9A 3RRGA 4FJHA 4CEZA 1RTDA 3ZYYX 3L6QA 5DK5A 3FZKA 2ZWHA 1VK0A 5AQQA 5KPZA 4O44A 3AA4A 1VSMA 3F2KA 2WUSA 4CHQA 5FRMA 4PUOA 3C7NB 2WFBA 3CJ1A 2PYLA 2GWJA 5KRTA 1M90O 2ZD1A 4DSEA 2HBLA 4FL9A 1GLFO 3SQ0A 3DXMB 1XWLA 2NUBA 4YY3K 4JI7K 4O8UA 4CJQA 4CCHA 3HSCA 2VWKA 1MWKA 1BGXT 3ZT2A 2O8CA 1EETA 4CZEA 1BWFO 4I7FA 4CGDA 3KD1E 4A62A 3TAEA 1T8EA 4M42A 4ILGB 1UA1A 4Z4GA 2QM1A 4DR6K 4H8KA 3OJUA 1HKCA 3OYIA 4LFAK 1KVAA 1YVUA 3ZSVA 5JLFA 1OH7A 4AF1A 3O3FA 3AA5X 4GVEA 4H5VA 1S1VA 5BN9A 3TTCA 5TKYA 4CBWA 1T6CA 4JI8K 1Z6RA 1YXQA 1WLJA 3EKSA 2FXUA 3SPYA 3OA9A 4E7LA 5CYMA 2UU9K 4RCHA 1TYQA 4OPAA 1K73O 4HTUA 5KPRA 1TKTA 4DSFA 1NMDA 1XNRK 5AQPA 5AFUH 5EX5A 4OVLA 2Q3SA 2HW3A 1TGOA 3NF7A 1EO1A 4CZIA 3I55N 4BWMA 4BE0A 2KZZA 3SMPA 4JKHA 2JWLA 3JS6A 5FPMA 1EP4A 3QDKA 5FPEA 3HPHA 1IG9A 5LMUK 3TAQA 2PY5A 1RBSA 4CJFA 3MECA 5J2QA 3THVA 4FOEA 3FZLA 3L4QA 3MN5A 4DV6K 4DR3K 4C8LA 1XUPO 1HPMA 4RTFD 5GIPA 3WXKA 3DOLA 4EZ9A 3N4PA 4CF1A 2HF3A 4C1NK 2E5LK 2ZJRL 3O9TA 5B8HA 2YHYA 3OW2M 3I8DA 3D7EO 4H4MA 1Q9YA 4C8OA 2DFFA 3CIPA 2ITGA 3BF3A 4JI6K 4WFAL 3C0BA 2QWNA 3DLGA 4KH4A 3O3GA 3QFPA 4KHNA 3CJ9A 4KB0A 4WFBL 4DWIA 3QB0A 3RR8A 4DTXA 3L2UA 2HNDA 3P39A 3SJJA 1UAXA 4B1WB 3OYDA 4H4OA 3CF5L 3CCMN 2FF6A 2YJFA 1RFQA 4XH1A 2P9SB 3VEXA 1SQKA 5JVHL 1ZBUA 3ID6A 2YNIA 4CHZA 1N8RO 1TK5A 3TTFA 1IKYA 2VCPA 3MK6A 1D8YA 3C6UA 1QSYA 4FJ7A 4XIUA 1TUUA 3H3OB 2VYPA 3HM8A 4YOUA 4E0DA 2O8FB 4Z94A 3NGIA 3ZSRA 4DV0K 3VQBA 3CCLN 4LF8K 2G8KA 4XH5A 3DLRA 5FLXO 4E89A 2Z1GA 4OGCA 1HYZA 3ZCMA 4ZTJA 4NCGA 4FK0A 2HMPA 1JLCA 1NU0A 3J7AP 4FK2A 3S9HA 3KIOA 1RBRA 5M1QA 4H0OA 4H5WA 2I7PA 4Z4FA 3CYGA 4ISGA 4RW4A 1LWEA 1N34K 1BG3A 4OO1J 3AA2A 4CJ5A 2O8EA 2YNHA 1ZBFA 5E26A 4N56A 4DU3A 2CGJA 4MDBA 3CCUN 1VQON 3RMAA 1LWCA 4F8RA 3ATVA 3HVTA 4RW9A 5BPMA 5AQTA 1SKSA 2KFZA 4OPJA 4PWDA 1NGAA 2NRVA 4LF4K 1N5YA 4AHTA 3UE5A 4WCEL 1HJRA 3LWMA 3DXKB 4DQSA 5JLHA 4DTJA 3E9PA 3VQPA 2P9KA 1QTMA 3AVNA 3O4QA 3AO3A 4I2PA 4F2SA 4CHNA 3U9ZA 4DTNA 1NBWA 4DV4K 5J2MA 4V19S 3EL2A 1JKHA 3NE6A 5HRRA 3VF6A 2PAVA 5KRSA 1I3AA 1P8ZA 3MEDA 4HUFA 4IEEA 1TK0A 3ITHA 3S3NA 4FVUA 2FSJA 3M6GA 1YF5L 1LW0A 1NKBA 4KB1A 3H3NO 4FLVA 4NYFA 3SUQA 4FWNA 2UUCK 1VQNN 1VQ8N 1YTUA 4IEIA 2HHWA 3VGMA 2P9UB 3DLEA 1WSEA 2ZE2A 1L3UA 3NFAA 1VSJA 4B3SK 4DR2K 5AJ3K 2BANA 4M45A 2RE2A 3VQ5A 3ZETB 2V52B 3G0ZA 4LF9K 3JSMA 4JS5A 5HRNA 2CH5A 3C6HA 1BOTO 4BR5A 4C8NA 1RGIA 3CCJN 2F4VK 3HP9A 4IO8A 3Q7CA 1QZ5A 3C7NA 5C2DA 1X9JA 1TKDA 4JK8A 4KHSA 4CK1A 1LWFA 3M3ZA 4FCYA 3E66A 3LPUA 1W0HA 2OCEA 1NGCA 5IWAK 1SS6A 4I2QA 4W5QA 4FYDA 3SNNA 4BGBA 3TI0A 4H03B 4RWTA 4CIEA 3JYTA 3DXKA 1XHZA 4IBNA 2E1YA 3AVBA 4LD0A 3PY8A 3FR0A 2RKIA 2Q0RA 1HMVA 1XHXA 1TV6A 4OJRA 2ZJPL 2W6LA 3CYMA 1U4BA 1LCUA 3Q7BA 4FZZA 4Z4EA 3MMVA 5HRPA 2HHUA 1TUYA 2P9IB 3AO2A 3QICA 1U48A 4NYNA 3QBWA 3DYAA 4CW7B 3HJFA 3T7ZA 5C42A 3KVGA 5AQJA 4IJNA 4YNQA 5CE3A 4IFVA 3MDQA 4IJAA 1Y97A 4WQ5A 3DRRA 2HBKA 4LFBK 1NGBA 1BUPA 1Q18A 1QSLA 1BQMA 3MXJA 2XY8A 1JL1A 1WB9A 1CXUA 3CPWM 2FBYA 4PA1A 4KRFA 2P5OA 1YI2N 4BROA 2OZSA 1X3NA 3A5OC 1GLEG 2D4WA 3O1WA 4PL7A 4FJ9A 3D2EA 4E3SA 2P9LB 3EYZA 4CHPA 3VQDA 3LAKA 4W5TA 4YFUA 2D1KA 3AVMA 1RT2A 4JKFA 1B9FA 2H3GX 3OYJA 3VA0A 4ELTA 3K5NA 2BH1A 3DM2A 3O80A 2VGMA 2DTUA 1J53A 4DTPA 4DQPA 4CK3A 1NG9A 4FM0A 3CCEN 4OX9K 3WT0A 3PX0A 3NHGA 2BGGA 4O8KA 3GL1A 4BQZA 1N33K 2W00A 2A1SA 5C24A 2D0OA 4DSJA 3T1AA 2RHKA 3J7ZO 2VQFK 4BR2A 4DLGA 3D2EB 3MWPA 1KFSA 2A6AA 2YHAA 3RSEA 3I56N 4PKHA 4FVMA 4BRGA 1BIZA 4CJ3A 4GNIA 2P1JA 1LAWA 4OKKA 5GADP 4CK2A 5M1OA 4B9QA 3V1RA 1NJYA 1Q86O 4FLYA 5M1KA 4FJ5A 3J81O 4IOCL 4CZJA 3J8AA 4CE9A 4C23A 2KLAA 2D0AA 3TSPA 1YUWA 2GBZA 3CMEN 3DLLL 4CBXA 5HP1A 3LP2A 4WE1A 4O0IA 1VQKN 1W97L 4JI5K 3OBWA 3W0LA 4AILC 3CQYA 3BF1A 1MU2A 3QEXA 1BCMA 3ZSQA 1YVNA 1SZ2A 4FWRA 3A5NC 3OBYA 4LSLA 3EEQA 4JKCA 3C65A 4LF6K 4B8CA 1KTQA 1RDDA 2XY6A 4KI4A 5BRDA 1TAUA 3KK2A 3OYMA 1X3MA 1KD1O 3SK3A 3UB5A 5JICA 3MXIA 2KZMA 1JLGA 1LW2A 4LSNA 1D9FA 1C0GA 2G8FA 2KTQA 4M3YA 1WAFA 4QAGA 2F8TA 3E01A 3G6EN 4RG8A 1NMNA 5GAEP 2Q97A 1T7PA 3H45C 1VQ6N 4N47A 3CJAA 4GKKK 2E8AA 1JLAA 1KAZA 4Y1CA 2G8HA 5I42A 4DS4A 2QI2A 3U3YA 2B4JA 3PIOL 1VHXA 2XY5A 1HNXK 4JNEA 3BP8A 1IKWA 3OYKA 1KRPA 4FJNA 5C0YA 1HPZA 1RDUA 4DF8A 3KLGA 1RT3A 3CJ7A 2E6LA 3TSQA 5AZIA 4FWOA 1S1UA 3SUNA 3AVJA 1OH6A 3CC7N 2CGKA 4EFHA 1C1AA 4JHDA 4J2BA 3C94A 1SKRA 1GOBA 3QFUA 1RTIA 4JD2B 4NLCA 4BACA 4CEOA 3LM2A 4BRIA 4E7HA 1YJNN 3LP3A 4KHWA 1BO5O 1JCEA 3BGRA 1QQMA 4CBUA 3LALA 5SZTA 4CEEA 2JWKA 3PV8A 1ZBHA 3CCVN 3NBPA 1NGGA 3I0SA 5CZ1A 3SBGA 5AFUA 3HPOA 1EKEA 1NK8A 4EHUA 1GOAA 1VSDA 4CF8A 2UUAK 3ZSWA 3V9WA 2BUPA 1NGFA 1BCOA 2X6NA 1C0MA 3VTHA 1YITN 5FRNA 4DCHA 3S3MA 3OTOK 1KLMA 4PQUA 1TL1A 3WXMB 3SJHA 3TWHA 3T3FA 3CFRA 1VQMN 4Q0BA 1R59O 4HHTA 3V81A 2B5JA 3I8BA 3TAPA 1LV5A 1EXQA 3SV4A 4M7XA 2O8DA 2FBVA 3WUHA 5D3GA 2Q36A 4IG3A 1ITGA 2P9SA 5LMNK 4OPKA 4WFNL 4DSKA 1YJ9N 1VSKA 4RW6A 2GUIA 1WBDA 3HRGA 4CZMA 3ULDA 2YV0X 1NJWA 3TPQA 3P1GA 4IXCA 2IDOA 3VQQA 3T19A 3RWUA 3DWLA 2XHBA 2AA4A 3QO9A 4H5RA 4XJXA 3HVRA 4JI1K 3IAYA 2E2PA 2HHXA 2OPQA 5T7BA 1SL0A 4BQLA 3U9DA 3ENBA 2G8UA 4BECA 2OPRA 4FWMA 1D9DA 2X78A 2O8DB 3K5OA 3ZT1A 2UXCK 3VEYA 2E88A 3TU5A 1YJWN 4K8ZA 1Y64A 4OPHA 1SAZA 5GAGP 1MA9B 4NXMK 3G25A 1W9HA 5H1SQ 2ITMA 1E4FT 2O8EB 1JL2A 4K25A 3K57A 1RT7A 4X66K 4JKDA 4CVNE 3QEPA 3SZ2A 4FWKA 2EX3A 4ELUA 3ZEUB 4M3WA 4IZ9A 1BA0A 3D2FB 3DRSA 1HNWK 3O9UA 2ASOA 4C8MA 4H0PA 4M3UA 4DB3A 5AQSA 5AZJA 3HTVA 2P51A 4DV2K 3ULEA 3OS2A 1C0FA 3SQ2A 3SUOA 1C0UA 4A2AA 4B1YB 3AO1A 5A2QO 1XC9A 1UOCA 3MCAB 1T44A 3PO5A 4Z0UA 1IV0A 2IS3A 4B9NA 3HL8A 4KTZA 4JI0K 4C1NI 1RTJA 3D6RA 2UXDK 2QK9A 1N32K 1GLCG 4YOVA 1EX4A 3PSFA 2YJEA 1IBMK 4NCBA 3VGLA 3NF8A 3KKSA 5KQ8A 4K42A 1KAXA 3S5TA 3HPGA 4CD1A 1UWBA 2FSNA 3R9PA 1TL3A 3EZWA 4BE1A 1E4GT 2WC9A 1MWMA 3NVMA 5CYQA 5AZJB 3ZSYA 2W41A 3CFOA 4DTRA 4ICLA 1V4SA 5BRHA 4NO7A 2D5RA 1K8KA 2NRRA 3M8SA 4B1XB 4PL8A 3IG1A 4G9ZA 5C15A 1KVBA 1WSIA 4GY2B 4F3TA 1HUXA 1G15A 2HNYA 4CEAA 1VRUA 3AGKA 3LZIA 3OYNA 4M3TA 5CZ2A 1DKGD 1GLAG 1IKXA 3E9LA 4FJLA 2RN2A 4BDZA 4BC4A 1BA1A 3LDOA 1K9MO 2HF4A 4FZYA 4B3OA 4GV6A 4ILHA 1ESVA 2E4LA 3HOTA 3CPEA 4KV8A 4HUEA 4AHVA 3PX6A 5AQVA 3GG4A 5FROA 3VGKA 1VAZA 4DS5A 4KBOA 1VSEA 5FPNA 3SPZA 1QZ6A 2P5GA 5F0XA 2G8VA 4HCBA 2BTFA 3EZ5A 4CJ4A 4OKJA 4DV1K 3VEWA 1RNHA 3QMLA 3LDSA 1BDGA 2OANA 1TKXA 2F7TA 3K2PA 3DAWA 3SUPA 4FPAA 1HNVA 1NK9A 1RBUA 3AY9A 4AHUA 4FJIA 3O08A 3RSEB 2ASMA 1T6DA 3WEEB 4BRLA 1VSHA 4CD3A 4K0KK 3GE1A 4XH4A 2QWRA 3LAMA 4MLHA 4ZTFA 2QWLA 3VENA 3MWTA 1IO2A 3NH0A 3GOIA 1RT4A 2DY4A 1ATNA 3QLHA 1QSSA 5J2PA 1L3TA 1S72N 1HQUA 1NKEA 2P9IA 3P4IA 2YHBA 4BC2A 3IRXA 5CY4A 3VTIA 3D0PA 3LDQA 4ID1A 5LJWA 3CC2N 4BRKA 4LFCK 1BISA 4KH5A 1OKJA 1HX1A 3THWA 4KREA 1KXPA 5AQHA 2NRXA 2IVPA 5AQGA 3VA3A 5JMVA 1HKGA 3R3LA 4GW6A 1HYSA 3TANA 2VGNA 4E7IA 4X64K 1RDBA 3LP1A 4FO0A 4LC9B 3NMUA 3CJCA 3KK7A 3KLHA 4A57A 5GAHP 4JAXA 1WSFA 3PUFA 1B9DA 5M1NA 4FM2A 3LWLA 5AR0A 3WQUA 4OLAA 3ZT4A 2D0BA 4CFBA 1Q82O 1UA0A 5AQXA 3PO4A 3B8AX 2PFUA 2DFHA 1W7AA 2ZQBA 3V6DA 1DLOA 3ISNC 2ETJA 3M8QA 4JRPA 1DEJA 2CGLA 2GTDA 3QIOA 3UKUB 1U2VB 2QEXN 1VSIA 1X9MA 2YNFA 1ILYA 2QWQA 5BPNA 3RMCA 4FLUA 2YHXA 1WOQA 3THXB 2NNWA 4G1QA 3OS0A 3IDHA 3C6AA 2YNGA 4Y1DA 4CFCA 1J54A 3IFRA 2O8FA 5BN8A 1NK6A 1HRHA 3CJBA 2GUPA 2C1GA 4FLWA 3L2RA 1IKVA 5C25A 3TAFA 4JD2A 1NKCA 4Z4CA 2A40A 4DLEA 5IT9O 1IBKK 1JLBA 1QQNA 2IAJA 3K9KA 3OS1A 3OYGA 4CJLA 1RCHA 3L2QA 1VSLA 4MO5A 2NRTA 1QHTA 1TK8A 4JLHA 2W6KA 3THXA 3T69A 1S9GA 4R5PA 2HHSA 2YI1A 3MN6A 3O3HA 3A2FA 5FDLA 4BE2A 1FKOA 3ZSOA 3K59A 2FF3B 3ASMA 4X62K 3QBXA 1NOZA 4FLXA 4A5BA 2P9PA 4BC3A 1L3SA 4KFBA 4FOIA 1R0AA 4DR4K 2Z1IA 1NJIO 3SV3A 1OVYA 1K8AO 3P83D 4CGIA 4XEIA 3WNHA 1J6ZA 2GWKA 4DQIA 5JS2A 3CXCM 1JLFA 1B92A 1D4XA 2ZGYA 3CFPA 4BY9C 1SV5A 3TSUA 1KFDA 3VMFB 2Z1JA 2QWOA 3O5BA 4BGAA 3NH1A 2G8WA 4L8RB 3SCXA 1MDUB 5C10A 4FLZA 3QERA 4M7YA 5AQRA 3G4SN 1BI4B 1KC8O 3H6EA 4BVPA 4HVJA 1VQ9N 4U67L 4W5OA 2P9NB 1K6YA 3MX2A 4BC5A 5JS1A 3VF4A 4H0YB 2GEMA 4UQGA 3SMSA 4K8XA 2FSKA 1K8KB 1NGJA 1QE1A 3VQ6A 3EE9A 3OYHA 2E2NA 3OYEA 2QA4N 1BHLA 2R7YA 2HBMA 3THYA 4O5FA 5BREA 3C6TA 2HHHK 3I0RA 1RDWX 4CIFA 4CJSA 1GLBG 3FFKB 3PSIA 3RVCA 3MCPA 3QIPA 1FK9A 3VF2A 1JLEA 4B3MK 4ELVA 2HHIA 2QWPA 5ADXH 3QEIA 4WF9L 4DSLA 4A61A 1C1BA 5BR8K 3AARA 4LH5A 3FZHA 3O8MA 4KH6A 4EIAA 3TAGA 1G99A 1CLQA 2P9PB 2O8BA 1NJXA 4CZFA 4DSIA 2F8SA 1RDCA 4ISEA 3O1BA 3U3GA 4HWIA 3ULEB 3K9JA 4CJUA 4I9LA 3QETA 4ISFA 3VN5A 3KWGA 3RMBA 1S6QA 5AQIA 2OYQA 5AQUA 3VEZA 4ID5A 1EWQA 1NLVA 2V51B 2A42A 2XO7A 3ATUA 5I3UA 2VG7A 4DR7K 4DTUA 1C6VA 3WNEA 3LANA 4GV3A 4BG8A 1YT3A 2NZTA 4BE7B 1S22A 4O4GA 3D45A 5E41A 2DPNA 2ATQA 4CGJA 4IDKA 2O4GA 1OH8A 4IOAL 3DRPA 2NRWA 1L3VA 1V4TA 3A8YA 4CFDA 3FFIA 4CHYA 3AVFA 3V9XA 5AQZA 4WQ4C 3OYCA 4JKGB 2IC3A 1S3XA 1ZBIA 3S41A
chains in the Genus database with same CATH topology
4OO1J 1BG3A 4IOXA 4JKDA 4FWKA 5E26A 2CGJA 4MDBA 1GLLO 3CQXA 3E1YA 3ZEUB 5KPTA 3CCUN 1VQON 4IZ9A 1BA0A 3D2FB 3ATVA 1QHAA 3O9UA 2ASOA 4WYBA 2P9UA 1XC3A 2Q31A 3GBTA 2A3ZA 4FWSA 4H0PA 5AQTA 5BPMA 4JK9A 1NGAA 2NRVA 4DB3A 5AQSA 5AZJA 1NWKA 3HTVA 3ULEA 1C0FA 3UE5A 4BRHA 2D0PA 4CZLA 4WCEL 1WUAA 5F1XA 3DXKB 5JLHA 2KHOA 3E9PA 4A2AA 2VWBA 4B1YB 1Q81O 3MCAB 1T44A 3DJCA 2P9KA 3PLAA 1YAGA 1U6ZA 1NGIA 3IMXA 3MX5A 3ENOA 3O4WA 3U9ZA 4C1NI 3D6RA 1ATSA 1NBWA 3H46O 1GLCG 3O9SA 4YOVA 3EL2A 4H0TB 2YJEA 5LJVA 3VF6A 3VGLA 2PAVA 4I6MA 5KQ8A 5GINA 1ZC6A 4JKEA 4MDAA 1P8ZA 3I33A 4K42A 4IEEA 1TYQB 2YCHA 1KAXA 3TTDA 4FVUA 3HOSA 2EWSA 4CD1A 2FSNA 2FSJA 1YF5L 2IVOA 3M6GA 3R9PA 1M1KO 4A59A 1ZBSA 3EZWA 4JN4A 4ILJA 3H3NO 3VEVA 3IUCA 1E4GT 3BEXA 2WC9A 4FSVA 4FWNA 3ZEUA 4BEBA 1MWMA 4H5NA 3NVMA 4IO9L 4DKWA 5AZJB 3D2FA 2W41A 1VQNN 1H1VA 1VQ8N 1V4SA 5BRHA 4NO7A 4IEIA 3VGMA 2P9UB 5MLCQ 4WQ5C 1K8KA 2NRRA 4JKAA 5BPLA 2HBJA 4B1XB 1HJOA 4PL8A 2ZF5O 1YHQN 4G9ZA 4BVOA 5C15A 5AQWA 4H0VB 3VESA 4GY2B 3M1FA 2RE2A 1HUXA 3VETA 3ZETB 2V52B 1HLUA 3WXLA 3CCSN 3AGKA 3EE8A 3W3DA 2CH5A 3O9QA 3SBTA 3C6HA 1BOTO 1DKGD 1GLAG 4BR5A 1RGIA 1QQOA 4CJ7A 5KQDA 3CCJN 3E9LA 4IO8A 3L0QA 4GV9A 3Q7CA 4BR0A 1QZ5A 1NGEA 3C7NA 3VOVA 1YIJN 4BC4A 1BA1A 3LDOA 3ZX2A 5CHIA 1K9MO 2HF4A 5C2DA 4BRQA 1X9JA 4GV6A 4JK8A 4IDHA 4FPBA 4ILHA 1ESVA 1ZXOA 3WEEA 4CI6A 3FLCO 3HOTA 2OTJN 3CPEA 3FZFA 4CZHA 3M3ZA 4JKBA 5AQVA 1GLJO 3GG4A 3P38A 5AQFA 3SAHA 3E66A 2C1IA 3VGKA 1NGCA 1SS6A 1VAZA 5AZIB 3WXJA 4BRAA 4KBOA 2V7ZA 3E9OA 5FPDA 5FPNA 1QZ6A 5DM7L 4BGBA 5F0XA 1JJ2M 4H03B 2YX6A 4RWTA 2BTFA 3DXKA 3NVKA 2E1YA 3VEWA 5DM6L 3U4LA 3QMLA 4NLBA 3FR0A 2Q0RA 1NGHA 4B1UB 2ZJPL 1JCGA 1BDGA 3SAFA 2OANA 4NB4A 2F7TA 5AQKA 3DAWA 5AQMA 5LY3A 1LCUA 3Q7BA 2A5XA 3MMVA 4YDUA 4FPAA 1TUYA 2P9IB 1P90A 1QVGM 3QICA 2QW9A 4I6MB 3KWIA 3QBWA 1VQ5N 3AY9A 3HBTA 3MN7A 1VQPN 2E2OA 3O08A 3RSEB 2ASMA 3T7ZA 1T6DA 3WEEB 4PHTX 4BRLA 3GDQA 3G71N 4CD3A 3KVGA 3GE1A 4XH4A 2QWRA 4IJNA 5AQJA 5CE3A 2F9WA 1IG8A 5AQNA 4MLHA 3MDQA 4HTLA 4K43A 4IJAA 4BRMA 2QWLA 4WQ4A 2ASPA 3EO3A 4WQ5A 3VENA 3MWTA 3ZETA 3GOIA 1Z05A 5BRFA 4F9OA 2HBKA 1NGBA 1BUPA 4JHDB 1Q18A 3SAGA 5M1PA 1ATNA 3OHRA 2NRZA 2E2QA 4QS8A 3HZ6A 5AQLA 2W40A 3CPWM 1S72N 5HL7L 1T3VA 1YI2N 2P9IA 4DHYA 3P4IA 4BROA 2I7NA 3N4QA 5TKWA 2OTLN 1X3NA 4BC2A 3CETA 3A5OC 3VTIA 3UKRA 1LOTB 1GLEG 2D4WA 2FLOA 3O1WA 3LDQA 3CI5A 4PL7A 3D2EA 5AQOA 5LJWA 2P9LB 2Q1NA 4BREA 3CC2N 2F9TA 4BRKA 2D1KA 3A5LC 4KH5A 1OKJA 4JKFA 3VEOA 1HX1A 4BR7A 5C12A 2H3GX 2ZJQL 1KXPA 5AQHA 2NRXA 2IVPA 5AQGA 2BH1A 4BR9A 1Q7YO 2V7YA 4H0XB 4ISGA 5JMVA 2CH6A 3O80A 1HKGA 2VGMA 1QVFM 3R3LA 3VERA 2ZGZA 2IVNA 4IFEA 2VGNA 3LL3A 4EHTA 3CCEN 4AM6A 4FO0A 4LC9B 3WT0A 3P31A 5HOOA 3NMUA 3CJCA 4O8KA 3GL1A 3KK7A 4BQZA 5EVZA 4A57A 5GAHP 4JAXA 2Q0UA 3H1VX 2W00A 2D0OA 5JVGL 3F9MA 3VPZA 5M1NA 2RHKA 3AAPA 4A5AA 3R6MA 5AR0A 3AGRA 3WQUA 3J7ZO 3R8EA 4BR2A 1DGKN 1IJJA 2WBNA 3D2EB 3KHYA 3SLCA 3MWPA 5I9EB 1Q82O 2A6AA 5AQXA 3B8AX 3ID8A 2PBDA 2PFUA 3FGUA 2QXLA 3KZBA 3RSEA 3I56N 2J4RA 4PKHA 1KAYA 4MO4A 4FWLA 4BRGA 3DXMA 1U2VA 4GNIA 5E84A 4R79A 1VQ7N 5GADP 1DEJA 3CMAN 2CGLA 2GTDA 3HI0A 4JEPA 5M1OA 3UKUB 1U2VB 5EXWA 4B9QA 2QEXN 1Q86O 4FWQA 4MLEA 5M1KA 4A2BA 1NGDA 1ILYA 3CERA 4IOCL 4CZJA 3J8AA 2QWQA 3UKUA 3MN9A 5BPNA 3PIPL 2GELA 5F2RA 2YHXA 3WQTA 4C23A 1XQSC 2KLAA 3TSPA 4J8FA 1WOQA 1YUWA 1O13A 3CMEN 2NNWA 3O9RA 2HSTA 4L3QA 4CBXA 3IDHA 3C6AA 4YOXA 1JCFA 3DLLL 4YOTA 2YHWA 3IFRA 4BG9A 5BN8A 3CCQN 3CJBA 4Y0WA 3ZYYX 3L6QA 2GUPA 2C1GA 3FZKA 1VQKN 2ZWHA 1W97L 5AQQA 5KPZA 4JD2A 3OBWA 3W0LA 3CQYA 3BF1A 2E1ZA 3F2KA 2WUSA 2A40A 5ELZA 3CC4N 1YVNA 3C7NB 1SZ2A 4FWRA 2WFBA 3A5NC 1QQNA 3OBYA 3K9KA 3CJ1A 2GWJA 4JKCA 3C65A 1M90O 4B1VA 5EY4A 5BRDA 5C2FA 4MO5A 1X3MA 2HBLA 1GLFO 2QWMA 4FL9A 2NRTA 3DXMB 3SK3A 3UB5A 5JICA 3L4IA 4O8UA 3EN9A 3HSCA 5M1FA 1BU6O 1MWKA 4U7BA 3T69A 4CZEA 1BWFO 1NM1A 4AM7A 3CCRN 1VQ4N 2YI1A 4BR4A 1C0GA 4B1ZA 3MN6A 4A62A 5GIOA 2FF3B 4ILGB 3G6EN 3QBXA 2QM1A 4BRPA 3A0IX 4A5BA 2Q97A 2P9PA 4BC3A 5GAEP 1HKBA 3H45C 1VQ6N 1HKCA 3CJAA 4FOIA 2E8AA 1KAZA 2QI2A 1NJIO 5JLFA 4E1JA 1OVYA 3FZMA 1K8AO 4XEIA 4AF1A 3PIOL 4GVEA 4H5VA 3UKRB 1J6ZA 1ATRA 2GWKA 5BN9A 3TTCA 5TKYA 4JNEA 3BP8A 1T6CA 4CBWA 4YDUC 3CXCM 1D4XA 1Z6RA 2GX9A 1YXQA 2ZGYA 3EKSA 2UYTA 2FXUA 4BY9C 3TSUA 5C0YA 3OA9A 3VMFB 1RDUA 2QWOA 3O5BA 3CJ7A 3ZX0A 4BGAA 3TSQA 3M5RA 1EQYA 1TYQA 4FWOA 4OPAA 4RCHA 5AZIA 4CZKA 1MDUB 5BR9A 1NMDA 5KPRA 1K73O 3FE1A 1CZAN 5AQPA 5C10A 4YOWA 4M7YA 2AP1A 5AQRA 5AFUH 3G4SN 1KC8O 5EX5A 3CC7N 3H6EA 4QS9A 4BVPA 4BRDA 2CGKA 4EFHA 3WXIA 4JHDA 1VQ9N 4U67L 4CZIA 1EO1A 2P9NB 3QFUA 4YORA 3I55N 1KD1O 3MX2A 4JD2B 4NLCA 4BC5A 3LM9A 3SMPA 3LM2A 3O6WA 4H0YB 2GEMA 4JKHA 2JWLA 3JS6A 5FPMA 3SMSA 3VF4A 4BRIA 1YJNN 2FSKA 3QDKA 1K8KB 2NRHA 5FPEA 1BO5O 1JCEA 1NGJA 1QQMA 3EE9A 2A41A 2E2NA 4K41A 5EOYA 4CBUA 4CZGA 2QA4N 4BRFA 4PKIA 2HBMA 2JWKA 5CR4A 2IIRA 4O5FA 5BREA 5AQYA 4IWVA 4FOEA 3CCVN 3FZLA 1RDWX 1NGGA 3SBGA 5AFUA 3CHWA 1GLBG 2Q2RA 3FFKB 3EKUA 3RVCA 4EHUA 3MCPA 3L4QA 3MN5A 1XUPO 1HPMA 4RTFD 3VF2A 2BUPA 5GIPA 1NGFA 3VTHA 1YITN 3WXKA 2QWPA 5ADXH 3BUZB 3N4PA 4WF9L 4A61A 4DCHA 4DQ8A 2HF3A 4C1NK 3AARA 3H1QA 2ZJRL 4PKGA 3O9TA 3FZHA 3O8MA 3WXMB 5B8HA 3SJHA 2YHYA 4KH6A 4EIAA 3OW2M 1G99A 2E20A 3D7EO 2P9PB 3CIPA 3BF3A 1VQMN 4YOYA 4WFAL 4CZFA 3C0BA 2QWNA 2NLXA 1R59O 4H5TA 4KH4A 3QFPA 3CJ9A 4WFBL 3QB0A 3I8BA 4ISEA 3O1BA 2P9LA 4HWIA 3ULEB 3ENHA 3K9JA 4M7XA 3WUHA 5ADXA 2Q36A 3P39A 4ISFA 4B1WB 2P9SA 3KWGA 3LDLA 3CF5L 4FWPA 3CCMN 3LDNA 4WFNL 1YJ9N 2QTDA 2FF6A 5AQIA 2YJFA 1RFQA 4XH1A 3R1XA 5AQUA 2P9SB 3VEZA 1SQKA 3VEXA 1DT9A 3F5TA 3HRGA 4CZMA 5JVHL 1NLVA 2V51B 2A42A 3ATUA 3ID6A 3TPQA 4BRNA 3A5MC 4IXCA 3AAQA 1N8RO 3TTFA 2VCPA 3DWLA 3LDPA 3MK6A 2AA4A 4H5RA 3CD6N 1W2BM 4GV3A 4XJXA 4BG8A 2HOEA 1TUUA 3H3OB 3U8XA 2NZTA 2E2PA 2VYPA 2P9NA 3HM8A 4YOUA 4BE7B 4Z94A 4BQLA 1S22A 2KKZA 3U9DA 3ENBA 4QS7A 4JK7A 3CCLN 4FWMA 4BECA 4M63C 4XH5A 2DPNA 2P9KB 3VEYA 3IKMA 3JXUA 2E88A 3TU5A 2NRWA 1YJWN 4IOAL 1V4TA 1Y64A 2HMPA 3A8YA 4OPHA 3ZX3A 1KQSM 1SAZA 5GAGP 1MA9B 4UY8O 4JKGA 5M1QA 4H0OA 5AQZA 4H5WA 4WQ4C 3G25A 5H1SQ 2ITMA 1VQLN 4BRCA 1E4FT 4JKGB 2I7PA 4EAHD 4K25A 1S3XA 1GLDG 3S41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BG3 A;  4FWK A;  5E26 A;  2CGJ A;  1GLL O;  3CQX A;  3ZEU B;  5KPT A;  4IZ9 A;  1BA0 A;  3D2F B;  3ATV A;  1QHA A;  2ASO A;  4WYB A;  2P9U A;  1XC3 A;  2Q31 A;  3GBT A;  2A3Z A;  4FWS A;  4H0P A;  5AQT A;  5BPM A;  1NGA A;  4DB3 A;  5AQS A;  5AZJ A;  1NWK A;  3HTV A;  3ULE A;  1C0F A;  3UE5 A;  4BRH A;  2D0P A;  4CZL A;  1WUA A;  5F1X A;  3DXK B;  5JLH A;  2KHO A;  4A2A A;  4B1Y B;  2VWB A;  1T44 A;  3DJC A;  2P9K A;  1YAG A;  1U6Z A;  1NGI A;  3IMX A;  3ENO A;  3O4W A;  3U9Z A;  1ATS A;  1NBW A;  3H46 O;  1GLC G;  3EL2 A;  4H0T B;  2YJE A;  5LJV A;  3VF6 A;  3VGL A;  2PAV A;  4I6M A;  5KQ8 A;  1ZC6 A;  1P8Z A;  3I33 A;  4K42 A;  1TYQ B;  2YCH A;  1KAX A;  2EWS A;  4CD1 A;  2FSN A;  2FSJ A;  2IVO A;  3M6G A;  3R9P A;  1ZBS A;  3EZW A;  4JN4 A;  3VEV A;  3H3N O;  3IUC A;  1E4G T;  3BEX A;  4FSV A;  4FWN A;  3ZEU A;  1MWM A;  4H5N A;  5AZJ B;  3D2F A;  2W41 A;  1H1V A;  1V4S A;  5BRH A;  4NO7 A;  3VGM A;  2P9U B;  4WQ5 C;  1K8K A;  5BPL A;  4B1X B;  1HJO A;  4PL8 A;  2ZF5 O;  4BVO A;  5AQW A;  4H0V B;  3VES A;  4GY2 B;  3M1F A;  1HUX A;  3VET A;  3ZET B;  2V52 B;  1HLU A;  3WXL A;  3W3D A;  2CH5 A;  1BOT O;  1DKG D;  1GLA G;  4BR5 A;  1RGI A;  1QQO A;  4CJ7 A;  5KQD A;  4IO8 A;  3L0Q A;  4BR0 A;  1QZ5 A;  1NGE A;  3C7N A;  3VOV A;  4BC4 A;  1BA1 A;  3LDO A;  3ZX2 A;  2HF4 A;  4BRQ A;  1X9J A;  4FPB A;  1ESV A;  1ZXO A;  3WEE A;  4CI6 A;  3FLC O;  3FZF A;  4CZH A;  3M3Z A;  5AQV A;  1GLJ O;  3GG4 A;  5AQF A;  3VGK A;  1NGC A;  5AZI B;  3WXJ A;  4BRA A;  4KBO A;  2V7Z A;  5FPD A;  5FPN A;  1QZ6 A;  4BGB A;  5F0X A;  4H03 B;  4RWT A;  2BTF A;  3DXK A;  2E1Y A;  3VEW A;  3U4L A;  3QML A;  3FR0 A;  2Q0R A;  1NGH A;  4B1U B;  1JCG A;  1BDG A;  2OAN A;  4NB4 A;  5AQK A;  3DAW A;  5AQM A;  5LY3 A;  1LCU A;  2A5X A;  3MMV A;  4YDU A;  4FPA A;  1TUY A;  2P9I B;  3QIC A;  2QW9 A;  4I6M B;  3QBW A;  3AY9 A;  3HBT A;  3MN7 A;  2E2O A;  3O08 A;  3RSE B;  2ASM A;  1T6D A;  3WEE B;  4BRL A;  3GDQ A;  4CD3 A;  3KVG A;  3GE1 A;  4XH4 A;  2QWR A;  4IJN A;  5AQJ A;  5CE3 A;  2F9W A;  1IG8 A;  5AQN A;  4MLH A;  3MDQ A;  4HTL A;  4K43 A;  4IJA A;  4BRM A;  2QWL A;  4WQ4 A;  2ASP A;  3EO3 A;  4WQ5 A;  3VEN A;  3ZET A;  3GOI A;  1Z05 A;  5BRF A;  4F9O A;  1NGB A;  1BUP A;  4JHD B;  1Q18 A;  1ATN A;  3OHR A;  2E2Q A;  4QS8 A;  3HZ6 A;  5AQL A;  2W40 A;  2P9I A;  4DHY A;  3P4I A;  4BRO A;  2I7N A;  1X3N A;  4BC2 A;  3CET A;  3A5O C;  3UKR A;  1LOT B;  1GLE G;  2D4W A;  2FLO A;  3O1W A;  3LDQ A;  3CI5 A;  4PL7 A;  3D2E A;  5AQO A;  5LJW A;  2P9L B;  2Q1N A;  4BRE A;  2F9T A;  4BRK A;  2D1K A;  3A5L C;  1OKJ A;  3VEO A;  1HX1 A;  4BR7 A;  2H3G X;  1KXP A;  5AQH A;  2IVP A;  5AQG A;  4BR9 A;  2V7Y A;  4H0X B;  4ISG A;  5JMV A;  2CH6 A;  3O80 A;  1HKG A;  3VER A;  2ZGZ A;  2IVN A;  3LL3 A;  4EHT A;  4AM6 A;  4FO0 A;  4LC9 B;  3WT0 A;  3CJC A;  4O8K A;  3GL1 A;  4BQZ A;  5EVZ A;  4JAX A;  2Q0U A;  3H1V X;  2D0O A;  3F9M A;  3VPZ A;  3AAP A;  3R6M A;  5AR0 A;  3WQU A;  3R8E A;  4BR2 A;  1DGK N;  1IJJ A;  3D2E B;  3KHY A;  3SLC A;  5I9E B;  2A6A A;  5AQX A;  3B8A X;  3ID8 A;  2PBD A;  3FGU A;  2QXL A;  3KZB A;  3RSE A;  2J4R A;  4PKH A;  1KAY A;  4MO4 A;  4FWL A;  4BRG A;  3DXM A;  1U2V A;  4GNI A;  5E84 A;  1DEJ A;  2CGL A;  2GTD A;  3HI0 A;  4B9Q A;  3UKU B;  1U2V B;  5EXW A;  4FWQ A;  4MLE A;  4A2B A;  1NGD A;  3CER A;  4CZJ A;  3J8A A;  2QWQ A;  3UKU A;  3MN9 A;  5BPN A;  2GEL A;  5F2R A;  2YHX A;  3WQT A;  4C23 A;  1XQS C;  4J8F A;  1WOQ A;  1YUW A;  4L3Q A;  4CBX A;  3IDH A;  1JCF A;  2YHW A;  3IFR A;  4BG9 A;  5BN8 A;  3CJB A;  4Y0W A;  3L6Q A;  2GUP A;  3FZK A;  2ZWH A;  5AQQ A;  5KPZ A;  4JD2 A;  3W0L A;  3CQY A;  3BF1 A;  2E1Z A;  5ELZ A;  2WUS A;  2A40 A;  1YVN A;  3C7N B;  1SZ2 A;  4FWR A;  3A5N C;  1QQN A;  3CJ1 A;  2GWJ A;  4B1V A;  5EY4 A;  5BRD A;  4MO5 A;  1X3M A;  4FL9 A;  1GLF O;  2QWM A;  3SK3 A;  3DXM B;  3UB5 A;  5JIC A;  3L4I A;  3EN9 A;  3HSC A;  1BU6 O;  1MWK A;  4CZE A;  1BWF O;  1NM1 A;  4AM7 A;  2YI1 A;  4BR4 A;  1C0G A;  4B1Z A;  3MN6 A;  4A62 A;  2FF3 B;  3QBX A;  2QM1 A;  4BRP A;  3A0I X;  2Q97 A;  2P9P A;  4BC3 A;  1HKB A;  3H45 C;  1HKC A;  3CJA A;  4FOI A;  2E8A A;  1KAZ A;  5JLF A;  4E1J A;  3FZM A;  4XEI A;  3UKR B;  4H5V A;  1J6Z A;  1ATR A;  2GWK A;  5BN9 A;  5TKY A;  4JNE A;  3BP8 A;  1T6C A;  4CBW A;  4YDU C;  1D4X A;  1Z6R A;  1YXQ A;  2ZGY A;  3EKS A;  2UYT A;  2FXU A;  2QWO A;  3O5B A;  3CJ7 A;  3ZX0 A;  4BGA A;  4RCH A;  1EQY A;  1TYQ A;  4FWO A;  5AZI A;  4CZK A;  5BR9 A;  5KPR A;  1MDU B;  1NMD A;  3FE1 A;  1CZA N;  5AQP A;  4M7Y A;  2AP1 A;  5AQR A;  5AFU H;  5EX5 A;  3H6E A;  4QS9 A;  4BVP A;  4BRD A;  2CGK A;  4EFH A;  3WXI A;  4JHD A;  4CZI A;  2P9N B;  3QFU A;  4JD2 B;  4BC5 A;  3LM9 A;  3SMP A;  3LM2 A;  3O6W A;  4H0Y B;  2GEM A;  3VF4 A;  3SMS A;  3JS6 A;  5FPM A;  4BRI A;  2FSK A;  3QDK A;  1K8K B;  2NRH A;  5FPE A;  1BO5 O;  1JCE A;  1NGJ A;  1QQM A;  4K41 A;  2A41 A;  2E2N A;  5EOY A;  4CBU A;  4CZG A;  4BRF A;  4PKI A;  2IIR A;  4O5F A;  5BRE A;  5AQY A;  4IWV A;  4FOE A;  3FZL A;  1RDW X;  1NGG A;  5AFU A;  3CHW A;  1GLB G;  2Q2R A;  3FFK B;  3EKU A;  4EHU A;  3MCP A;  3MN5 A;  1XUP O;  1HPM A;  4RTF D;  3VF2 A;  2BUP A;  1NGF A;  3WXK A;  2QWP A;  5ADX H;  3BUZ B;  4A61 A;  4DCH A;  4DQ8 A;  2HF3 A;  3AAR A;  3H1Q A;  4PKG A;  3FZH A;  3O8M A;  5B8H A;  3SJH A;  2YHY A;  4EIA A;  1G99 A;  2E20 A;  3D7E O;  2P9P B;  3CIP A;  3BF3 A;  4CZF A;  3C0B A;  2QWN A;  2NLX A;  1R59 O;  4H5T A;  3QFP A;  3CJ9 A;  3QB0 A;  3I8B A;  4ISE A;  3O1B A;  2P9L A;  4HWI A;  3ULE B;  3ENH A;  4M7X A;  3WUH A;  5ADX A;  2Q36 A;  4ISF A;  4B1W B;  2P9S A;  3LDL A;  4FWP A;  3LDN A;  2FF6 A;  5AQI A;  2YJF A;  1RFQ A;  4XH1 A;  5AQU A;  2P9S B;  3VEZ A;  1SQK A;  3VEX A;  4CZM A;  1NLV A;  2V51 B;  2A42 A;  3ATU A;  3TPQ A;  4BRN A;  3A5M C;  4IXC A;  3AAQ A;  2VCP A;  3DWL A;  3LDP A;  3MK6 A;  2AA4 A;  4H5R A;  4BG8 A;  2HOE A;  1TUU A;  3H3O B;  3U8X A;  2NZT A;  2E2P A;  2VYP A;  2P9N A;  3HM8 A;  4Z94 A;  4BQL A;  1S22 A;  3U9D A;  4QS7 A;  4FWM A;  4M63 C;  4XH5 A;  2DPN A;  2P9K B;  3VEY A;  3JXU A;  2E88 A;  3TU5 A;  1V4T A;  1Y64 A;  2HMP A;  3A8Y A;  3ZX3 A;  1SAZ A;  1MA9 B;  4H0O A;  5AQZ A;  4H5W A;  4WQ4 C;  3G25 A;  2ITM A;  4BRC A;  1E4F T;  2I7P A;  4EAH D;  4K25 A;  1S3X A;  1GLD G;  3S41 A; 
#chains in the Genus database with same CATH topology
 4IOX A;  4DFK A;  4J2A A;  3WNF A;  2Y1J A;  1FXX A;  3QEW A;  3AVK A;  4AHC A;  1ZBL A;  4E1M A;  2OZM A;  1SUQ A;  4KAZ A;  1XNQ K;  4WYB A;  2P9U A;  4DU4 A;  3GBT A;  2A3Z A;  4JK9 A;  3QNN A;  2XRI A;  1NWK A;  4O5B A;  3AO5 A;  4BRH A;  4CED A;  1WUA A;  5F1X A;  2VWB A;  2JLE A;  1Q81 O;  3DJC A;  1WSJ A;  1CZ9 A;  1U6Z A;  4GVM A;  2E6M A;  1NGI A;  3IMX A;  3MX5 A;  3ENO A;  3SQ4 A;  1ATS A;  3M8R A;  3NCI A;  3H46 O;  3O9S A;  1KCF A;  4Z4I A;  2HB5 A;  5LJV A;  5KTQ A;  5GIN A;  1ZC6 A;  4MDA A;  2B6A A;  5DMR A;  2O8C B;  1TYQ B;  3TTD A;  1J9A A;  4DTS A;  3OYA A;  1WSH A;  1XI1 A;  1ZBS A;  4TSX A;  3L3V A;  4Z4H A;  4BEB A;  3ZEU A;  2OPS A;  4H5N A;  3HXM A;  2RPI A;  3VQ4 A;  3PX4 A;  4JKA A;  2YKN A;  1HJO A;  2ZF5 O;  4BVO A;  1D5A A;  4H0V B;  1E3M A;  4E7J A;  3WXL A;  1HLU A;  1X9S A;  3W3D A;  2FBX A;  1HNZ K;  3SBT A;  4J2E A;  1IBL K;  4KHP K;  1QQO A;  4CJ7 A;  3RRH A;  5KQD A;  1T05 A;  3L0Q A;  4GV9 A;  1VRT A;  4BR0 A;  3VOV A;  3ZX2 A;  1YTA A;  4BRQ A;  4F3O A;  4DFP A;  2PYJ A;  1ZXO A;  4FK4 A;  4CIG A;  3SAH A;  3P38 A;  5AQF A;  3OY9 A;  3AO4 A;  1RBT A;  5AZI B;  3WXJ A;  3E9O A;  3WNG A;  4JS4 A;  3QIN A;  5FPD A;  3THW B;  3KK3 A;  3AA3 A;  1JJ2 M;  1XMO K;  3B6P A;  4DTM A;  2HMI A;  5DM6 L;  1Q9X A;  3HM9 A;  3NGY A;  4B1U B;  1I39 A;  1BQN A;  1JCG A;  3SAF A;  5LY3 A;  2UUB K;  2A5X A;  4YDU A;  3O4N A;  1QVG M;  2QW9 A;  4CF0 A;  4CJP A;  3MN7 A;  3RMD A;  4DUY K;  4AHS A;  2E2O A;  4PHT X;  3GDQ A;  4JV5 K;  4CEC A;  3AVA A;  1OVQ A;  4CJE A;  2F9W A;  1IG8 A;  4HTL A;  4K43 A;  3LP0 A;  4BRM A;  1NNE A;  4IG0 A;  4EP4 A;  4F9O A;  1S6P A;  4LF7 K;  3J7Y P;  2BE2 A;  4CF2 A;  4JHD B;  3L8B A;  4JYA K;  4C8K A;  1XMQ K;  4FXD A;  3DI6 A;  4DV5 K;  4DFM A;  1WBB A;  2E2Q A;  2W40 A;  4MFB A;  5HL7 L;  3V1O A;  3L3U A;  4CEB A;  4DHY A;  3N4Q A;  2OTL N;  4GMJ B;  2Z1H A;  3T1H K;  4J2D A;  3UKR A;  4M41 A;  1NJZ A;  2Q1N A;  4BRE A;  1C0T A;  2F9T A;  4BDY A;  3KLI A;  4CGH A;  3A5L C;  2IGI A;  3VEO A;  4BR7 A;  5C12 A;  3VQ9 A;  3AVI A;  2ZJQ L;  4X65 K;  2AJQ A;  4BR9 A;  2JGU A;  4KI6 A;  2CH6 A;  1QVF M;  3VER A;  2HVI A;  2KQ2 A;  2IVN A;  3LL3 A;  4EHT A;  4AM6 A;  5HOO A;  3P31 A;  4DMN A;  1RT6 A;  5EVZ A;  2I5J A;  3H1V X;  2HHQ A;  1JXB A;  1N36 K;  5JVG L;  4CGG A;  3AAP A;  3AGR A;  2WBN A;  3HST B;  3KHY A;  5I9E B;  3CG7 A;  3V9U A;  3ID8 A;  3THY B;  4FW1 A;  2QXL A;  3KZB A;  3B6O A;  4CEQ A;  2J4R A;  3V9S A;  4NXN K;  1WN7 A;  4FWL A;  3DXM A;  4PY5 A;  1TVR A;  1VQ7 N;  1X9W A;  1J5E K;  4FWQ A;  4MLE A;  4A2B A;  1NGD A;  1BIU A;  1WSG A;  4DR1 K;  3PIP L;  1HNI A;  3OVN A;  5F2R A;  3WQT A;  1XQS C;  4J8F A;  1O13 A;  4NCA A;  4YOX A;  1JCF A;  4YOT A;  2YHW A;  3ZT0 A;  2Y1I A;  3CCQ N;  4EP5 A;  4Y0W A;  3TAM A;  4B9T A;  2LSN A;  3KJV A;  2UXB K;  3VQ8 A;  2E1Z A;  5ELZ A;  3CC4 N;  3OJS A;  4B1V A;  5EY4 A;  4CEF A;  5C2F A;  1DTT A;  3TR8 A;  2F96 A;  2QWM A;  3L4I A;  1U45 A;  3EN9 A;  3ZT3 A;  5M1F A;  1BU6 O;  1CZB A;  1REV A;  3H08 A;  2YKM A;  4U7B A;  1NM1 A;  4AM7 A;  3BY5 A;  3CCR N;  1NK0 A;  1VQ4 N;  3V1Q A;  4RW8 A;  4BR4 A;  4B1Z A;  2A1R A;  1F21 A;  4F4K A;  1ASV A;  5GIO A;  2DFE A;  1RDA A;  5HRO A;  1NOY A;  4BRP A;  3ZSZ A;  3A0I X;  3CM5 A;  1HKB A;  4FJX A;  4B08 A;  3K5L A;  4CJK A;  1IH7 A;  4E1J A;  3FZM A;  3L2W A;  5KGW A;  3AVH A;  2WON A;  3UKR B;  1RT5 A;  4DQQ A;  1S1T A;  1ATR A;  1EWR A;  1FW6 A;  3OYF A;  5EU7 A;  4YDU C;  2GX9 A;  4YHH K;  3MAQ A;  2UYT A;  3MEG A;  3HK2 A;  2EHG A;  4HUG A;  3DLK A;  3ZX0 A;  3M5R A;  1EQY A;  4CZK A;  4DUZ K;  5BR9 A;  2C1I A;  3FE1 A;  1CZA N;  4YOW A;  2AP1 A;  4QS9 A;  4BRD A;  3NH2 A;  1QS4 A;  3BZC A;  4KHU A;  3WXI A;  4N41 A;  3AVG A;  4W5R A;  4YOR A;  3LM9 A;  4CF9 A;  5BPL A;  3O6W A;  3QNO A;  2IOC A;  2NRH A;  2W42 A;  5EOY A;  4CZG A;  4K41 A;  2A41 A;  4BRF A;  4PKI A;  5CR4 A;  2IIR A;  1S1X A;  1KVC A;  4CJW A;  1T03 A;  1LAV A;  4IWV A;  5AQY A;  5KGX A;  4GKJ K;  3LPT A;  3G10 A;  3M8P A;  4DU1 A;  1KSP A;  3CHW A;  3EKU A;  2Q2R A;  3QEV A;  3S3O A;  3HP6 A;  3AV9 A;  4KKO A;  3ZSX A;  1Q8I A;  3BUZ B;  3RTV A;  4DQ8 A;  3H1Q A;  4PKG A;  2E20 A;  3DMJ A;  5HRS A;  4CJV A;  5K14 A;  3K58 A;  4YOY A;  3NF6 A;  4E19 A;  2NLX A;  4H5T A;  2VG5 A;  1I94 K;  4E1N A;  2P9L A;  4CHO A;  3ENH A;  4KTW A;  4B9M A;  1X1P A;  1JXE A;  5ADX A;  4O55 A;  4CFA A;  4FZX C;  3LDL A;  4FWP A;  3LDN A;  2QTD A;  4F2R A;  4AHR A;  3R1X A;  4FJK A;  1DT9 A;  3F5T A;  4N76 A;  4DV3 K;  1WAJ A;  1J5O A;  1WNS A;  4BRN A;  3A5M C;  3AAQ A;  4LF5 K;  3ZLJ A;  3RR7 A;  3OYL A;  4AH9 A;  3LDP A;  3CD6 N;  1W2B M;  4FJJ A;  2WTU A;  3F9K A;  2HOE A;  3U8X A;  3VQ7 A;  2P9N A;  2QKK A;  1GOC A;  4FW2 A;  2KKZ A;  4QS7 A;  4JK7 A;  3K5M A;  4B9U A;  4BWJ A;  3JAM O;  1L5U A;  2QKB A;  4M63 C;  1S1W A;  1C1C A;  2P9K B;  3IKM A;  1OH5 A;  3JXU A;  3ZX3 A;  4DR5 K;  1KQS M;  4UY8 O;  1RBV A;  1DTQ A;  4JI3 K;  4JKG A;  4DQR A;  1QQC A;  3LZJ A;  1VQL N;  4BRC A;  4EAH D;  3KLF A;  1GLD G;  2HHT A;  2HNZ A;  3NAE A;  3KK1 A;  1GLL O;  3CQX A;  3E1Y A;  5KPT A;  3C95 A;  1VSF A;  1QHA A;  1NK5 A;  5LL6 Z;  1XC3 A;  2Q31 A;  4FWS A;  4W5N A;  3SI6 A;  1Z25 A;  4MQ3 A;  4KPY A;  2XY7 A;  3DOK A;  4KO0 A;  2D0P A;  4CZL A;  4DFJ A;  3VQA A;  5KI6 A;  2KHO A;  3K0S A;  4DF4 A;  3PLA A;  2RF2 A;  3KLE A;  1YAG A;  2D0C A;  3NF9 A;  3O4W A;  4LH4 A;  1ASU A;  4H0T B;  4DG1 A;  4HCC A;  3SYZ A;  3VQE A;  4I6M A;  4CER A;  1N6Q A;  4JKE A;  4DV7 K;  3I33 A;  4B3T K;  2KFN A;  2OA8 A;  1A5X A;  4M3R A;  2YCH A;  3HOS A;  2EWS A;  2IVO A;  1M1K O;  4KHQ A;  4A59 A;  4JN4 A;  3VEV A;  4ILJ A;  3IUC A;  3BEX A;  4FSV A;  5J2N A;  4IO9 L;  4DKW A;  3BZK A;  3D2F A;  2G8I A;  1H1V A;  3V9Z A;  2VWJ A;  3KD5 E;  5MLC Q;  4WQ5 C;  1RIL A;  4M3Z A;  2HBJ A;  4CES A;  1ASW A;  3MEE A;  1YHQ N;  2O4I A;  4LY7 A;  5AQW A;  3VES A;  1A5V A;  3M1F A;  4CGF A;  4M3X A;  4DTO A;  3VET A;  3OYB A;  3CCS N;  4JRQ A;  3EE8 A;  1CXQ A;  3IS9 A;  3TAR A;  3O9Q A;  1RT1 A;  1SL1 A;  4CJR A;  4ZHR A;  1JLQ A;  1NGE A;  1YIJ N;  3BDP A;  2OPP A;  3ALY A;  5CHI A;  3MXM A;  3KTQ A;  4IDH A;  4FPB A;  3WEE A;  4CI6 A;  3FLC O;  3CM6 A;  2OTJ N;  3DLH A;  3HO1 A;  3FZF A;  4RW7 A;  4CZH A;  4B8A B;  4JKB A;  4B9L A;  1GLJ O;  3HT3 A;  3NGZ A;  4E72 A;  3J80 O;  4FJG A;  4BRA A;  2V7Z A;  1Z26 A;  5DM7 L;  1BI4 A;  2YX6 A;  3TAB A;  3NVK A;  4IKF A;  4QCL A;  4Q5V A;  2GV9 A;  2BDP A;  3U4L A;  4NLB A;  4CJT A;  3U6F A;  1NGH A;  1O1W A;  4NB4 A;  1U04 A;  5AQK A;  4BDP A;  5AQM A;  2FC0 A;  1P90 A;  2HVH A;  1U47 A;  4B9S A;  4I6M B;  3KWI A;  2KW4 A;  1VQ5 N;  3DLB A;  3HBT A;  1VQP N;  4FLT A;  3L2V A;  1BL3 A;  3G71 N;  5AQN A;  1FKP A;  4WQ4 A;  2ASP A;  3EO3 A;  3ZET A;  2WOM A;  5BRF A;  1Z05 A;  3SAG A;  5M1P A;  4FM1 A;  3SQ1 A;  3OHR A;  2NRZ A;  4QS8 A;  5AQL A;  3HZ6 A;  5JEN A;  5SWM A;  1T3V A;  2O8B B;  1HR0 K;  2I7N A;  5TKW A;  2ZM6 K;  4KHY A;  3CET A;  3P5J A;  4OKE A;  1LOT B;  2FLO A;  5HBM A;  3CI5 A;  5AQO A;  1NK4 A;  1HYV A;  1U49 A;  1ZYQ A;  3KKR A;  4AQY K;  4OLB A;  5HLF A;  1HQE A;  4JI2 K;  3F73 A;  1Q7Y O;  2QXF A;  2V7Y A;  3HYF A;  4H0X B;  2ZGZ A;  4IFE A;  1TAQ A;  4O0J A;  2HHV A;  3VQC A;  1SL2 A;  1A5W A;  1S5J A;  4EZ6 A;  3T1Y K;  2Q0U A;  1KLN A;  3NDK A;  3F9M A;  3VPZ A;  4B9V A;  2X6S A;  4A5A A;  1SKW A;  3R6M A;  4E7K A;  3R8E A;  1DGK N;  1IJJ A;  3SLC A;  4B3R K;  2VQE K;  4OGE A;  4I9Q A;  2PBD A;  3FGU A;  4KTQ A;  1FJG K;  1S9E A;  1KAY A;  2VG6 A;  4MO4 A;  4FJM A;  4JI4 K;  1U2V A;  2FBT A;  5E84 A;  4R79 A;  3CQ8 A;  4N5S A;  2X74 A;  3CMA N;  3UIQ A;  3HI0 A;  4JEP A;  5EXW A;  3QES A;  1RTH A;  3V4I A;  3CER A;  4FJ8 A;  3EY1 A;  2PZS A;  3UKU A;  3MN9 A;  3AVL A;  2GEL A;  3AVC A;  3O9R A;  2HST A;  4L3Q A;  5J1E A;  4QOZ B;  4IFY A;  1NK7 A;  1TKZ A;  4BG9 A;  3RRG A;  4FJH A;  4CEZ A;  1RTD A;  3ZYY X;  3L6Q A;  5DK5 A;  3FZK A;  2ZWH A;  1VK0 A;  5AQQ A;  5KPZ A;  4O44 A;  3AA4 A;  1VSM A;  3F2K A;  2WUS A;  4CHQ A;  5FRM A;  4PUO A;  3C7N B;  2WFB A;  3CJ1 A;  2PYL A;  2GWJ A;  5KRT A;  1M90 O;  2ZD1 A;  4DSE A;  2HBL A;  4FL9 A;  1GLF O;  3SQ0 A;  3DXM B;  1XWL A;  2NUB A;  4YY3 K;  4JI7 K;  4O8U A;  4CJQ A;  4CCH A;  3HSC A;  2VWK A;  1MWK A;  1BGX T;  3ZT2 A;  2O8C A;  1EET A;  4CZE A;  1BWF O;  4I7F A;  4CGD A;  3KD1 E;  4A62 A;  3TAE A;  1T8E A;  4M42 A;  4ILG B;  1UA1 A;  4Z4G A;  2QM1 A;  4DR6 K;  4H8K A;  3OJU A;  1HKC A;  3OYI A;  4LFA K;  1KVA A;  1YVU A;  3ZSV A;  5JLF A;  1OH7 A;  4AF1 A;  3O3F A;  3AA5 X;  4GVE A;  4H5V A;  1S1V A;  5BN9 A;  3TTC A;  5TKY A;  4CBW A;  1T6C A;  4JI8 K;  1Z6R A;  1YXQ A;  1WLJ A;  3EKS A;  2FXU A;  3SPY A;  3OA9 A;  4E7L A;  5CYM A;  2UU9 K;  4RCH A;  1TYQ A;  4OPA A;  1K73 O;  4HTU A;  5KPR A;  1TKT A;  4DSF A;  1NMD A;  1XNR K;  5AQP A;  5AFU H;  5EX5 A;  4OVL A;  2Q3S A;  2HW3 A;  1TGO A;  3NF7 A;  1EO1 A;  4CZI A;  3I55 N;  4BWM A;  4BE0 A;  2KZZ A;  3SMP A;  4JKH A;  2JWL A;  3JS6 A;  5FPM A;  1EP4 A;  3QDK A;  5FPE A;  3HPH A;  1IG9 A;  5LMU K;  3TAQ A;  2PY5 A;  1RBS A;  4CJF A;  3MEC A;  5J2Q A;  3THV A;  4FOE A;  3FZL A;  3L4Q A;  3MN5 A;  4DV6 K;  4DR3 K;  4C8L A;  1XUP O;  1HPM A;  4RTF D;  5GIP A;  3WXK A;  3DOL A;  4EZ9 A;  3N4P A;  4CF1 A;  2HF3 A;  4C1N K;  2E5L K;  2ZJR L;  3O9T A;  5B8H A;  2YHY A;  3OW2 M;  3I8D A;  3D7E O;  4H4M A;  1Q9Y A;  4C8O A;  2DFF A;  3CIP A;  2ITG A;  3BF3 A;  4JI6 K;  4WFA L;  3C0B A;  2QWN A;  3DLG A;  4KH4 A;  3O3G A;  3QFP A;  4KHN A;  3CJ9 A;  4KB0 A;  4WFB L;  4DWI A;  3QB0 A;  3RR8 A;  4DTX A;  3L2U A;  2HND A;  3P39 A;  3SJJ A;  1UAX A;  4B1W B;  3OYD A;  4H4O A;  3CF5 L;  3CCM N;  2FF6 A;  2YJF A;  1RFQ A;  4XH1 A;  2P9S B;  3VEX A;  1SQK A;  5JVH L;  1ZBU A;  3ID6 A;  2YNI A;  4CHZ A;  1N8R O;  1TK5 A;  3TTF A;  1IKY A;  2VCP A;  3MK6 A;  1D8Y A;  3C6U A;  1QSY A;  4FJ7 A;  4XIU A;  1TUU A;  3H3O B;  2VYP A;  3HM8 A;  4YOU A;  4E0D A;  2O8F B;  4Z94 A;  3NGI A;  3ZSR A;  4DV0 K;  3VQB A;  3CCL N;  4LF8 K;  2G8K A;  4XH5 A;  3DLR A;  5FLX O;  4E89 A;  2Z1G A;  4OGC A;  1HYZ A;  3ZCM A;  4ZTJ A;  4NCG A;  4FK0 A;  2HMP A;  1JLC A;  1NU0 A;  3J7A P;  4FK2 A;  3S9H A;  3KIO A;  1RBR A;  5M1Q A;  4H0O A;  4H5W A;  2I7P A;  4Z4F A;  3CYG A;  4ISG A;  4RW4 A;  1LWE A;  1N34 K;  1BG3 A;  4OO1 J;  3AA2 A;  4CJ5 A;  2O8E A;  2YNH A;  1ZBF A;  5E26 A;  4N56 A;  4DU3 A;  2CGJ A;  4MDB A;  3CCU N;  1VQO N;  3RMA A;  1LWC A;  4F8R A;  3ATV A;  3HVT A;  4RW9 A;  5BPM A;  5AQT A;  1SKS A;  2KFZ A;  4OPJ A;  4PWD A;  1NGA A;  2NRV A;  4LF4 K;  1N5Y A;  4AHT A;  3UE5 A;  4WCE L;  1HJR A;  3LWM A;  3DXK B;  4DQS A;  5JLH A;  4DTJ A;  3E9P A;  3VQP A;  2P9K A;  1QTM A;  3AVN A;  3O4Q A;  3AO3 A;  4I2P A;  4F2S A;  4CHN A;  3U9Z A;  4DTN A;  1NBW A;  4DV4 K;  5J2M A;  4V19 S;  3EL2 A;  1JKH A;  3NE6 A;  5HRR A;  3VF6 A;  2PAV A;  5KRS A;  1I3A A;  1P8Z A;  3MED A;  4HUF A;  4IEE A;  1TK0 A;  3ITH A;  3S3N A;  4FVU A;  2FSJ A;  3M6G A;  1YF5 L;  1LW0 A;  1NKB A;  4KB1 A;  3H3N O;  4FLV A;  4NYF A;  3SUQ A;  4FWN A;  2UUC K;  1VQN N;  1VQ8 N;  1YTU A;  4IEI A;  2HHW A;  3VGM A;  2P9U B;  3DLE A;  1WSE A;  2ZE2 A;  1L3U A;  3NFA A;  1VSJ A;  4B3S K;  4DR2 K;  5AJ3 K;  2BAN A;  4M45 A;  2RE2 A;  3VQ5 A;  3ZET B;  2V52 B;  3G0Z A;  4LF9 K;  3JSM A;  4JS5 A;  5HRN A;  2CH5 A;  3C6H A;  1BOT O;  4BR5 A;  4C8N A;  1RGI A;  3CCJ N;  2F4V K;  3HP9 A;  4IO8 A;  3Q7C A;  1QZ5 A;  3C7N A;  5C2D A;  1X9J A;  1TKD A;  4JK8 A;  4KHS A;  4CK1 A;  1LWF A;  3M3Z A;  4FCY A;  3E66 A;  3LPU A;  1W0H A;  2OCE A;  1NGC A;  5IWA K;  1SS6 A;  4I2Q A;  4W5Q A;  4FYD A;  3SNN A;  4BGB A;  3TI0 A;  4H03 B;  4RWT A;  4CIE A;  3JYT A;  3DXK A;  1XHZ A;  4IBN A;  2E1Y A;  3AVB A;  4LD0 A;  3PY8 A;  3FR0 A;  2RKI A;  2Q0R A;  1HMV A;  1XHX A;  1TV6 A;  4OJR A;  2ZJP L;  2W6L A;  3CYM A;  1U4B A;  1LCU A;  3Q7B A;  4FZZ A;  4Z4E A;  3MMV A;  5HRP A;  2HHU A;  1TUY A;  2P9I B;  3AO2 A;  3QIC A;  1U48 A;  4NYN A;  3QBW A;  3DYA A;  4CW7 B;  3HJF A;  3T7Z A;  5C42 A;  3KVG A;  5AQJ A;  4IJN A;  4YNQ A;  5CE3 A;  4IFV A;  3MDQ A;  4IJA A;  1Y97 A;  4WQ5 A;  3DRR A;  2HBK A;  4LFB K;  1NGB A;  1BUP A;  1Q18 A;  1QSL A;  1BQM A;  3MXJ A;  2XY8 A;  1JL1 A;  1WB9 A;  1CXU A;  3CPW M;  2FBY A;  4PA1 A;  4KRF A;  2P5O A;  1YI2 N;  4BRO A;  2OZS A;  1X3N A;  3A5O C;  1GLE G;  2D4W A;  3O1W A;  4PL7 A;  4FJ9 A;  3D2E A;  4E3S A;  2P9L B;  3EYZ A;  4CHP A;  3VQD A;  3LAK A;  4W5T A;  4YFU A;  2D1K A;  3AVM A;  1RT2 A;  4JKF A;  1B9F A;  2H3G X;  3OYJ A;  3VA0 A;  4ELT A;  3K5N A;  2BH1 A;  3DM2 A;  3O80 A;  2VGM A;  2DTU A;  1J53 A;  4DTP A;  4DQP A;  4CK3 A;  1NG9 A;  4FM0 A;  3CCE N;  4OX9 K;  3WT0 A;  3PX0 A;  3NHG A;  2BGG A;  4O8K A;  3GL1 A;  4BQZ A;  1N33 K;  2W00 A;  2A1S A;  5C24 A;  2D0O A;  4DSJ A;  3T1A A;  2RHK A;  3J7Z O;  2VQF K;  4BR2 A;  4DLG A;  3D2E B;  3MWP A;  1KFS A;  2A6A A;  2YHA A;  3RSE A;  3I56 N;  4PKH A;  4FVM A;  4BRG A;  1BIZ A;  4CJ3 A;  4GNI A;  2P1J A;  1LAW A;  4OKK A;  5GAD P;  4CK2 A;  5M1O A;  4B9Q A;  3V1R A;  1NJY A;  1Q86 O;  4FLY A;  5M1K A;  4FJ5 A;  3J81 O;  4IOC L;  4CZJ A;  3J8A A;  4CE9 A;  4C23 A;  2KLA A;  2D0A A;  3TSP A;  1YUW A;  2GBZ A;  3CME N;  3DLL L;  4CBX A;  5HP1 A;  3LP2 A;  4WE1 A;  4O0I A;  1VQK N;  1W97 L;  4JI5 K;  3OBW A;  3W0L A;  4AIL C;  3CQY A;  3BF1 A;  1MU2 A;  3QEX A;  1BCM A;  3ZSQ A;  1YVN A;  1SZ2 A;  4FWR A;  3A5N C;  3OBY A;  4LSL A;  3EEQ A;  4JKC A;  3C65 A;  4LF6 K;  4B8C A;  1KTQ A;  1RDD A;  2XY6 A;  4KI4 A;  5BRD A;  1TAU A;  3KK2 A;  3OYM A;  1X3M A;  1KD1 O;  3SK3 A;  3UB5 A;  5JIC A;  3MXI A;  2KZM A;  1JLG A;  1LW2 A;  4LSN A;  1D9F A;  1C0G A;  2G8F A;  2KTQ A;  4M3Y A;  1WAF A;  4QAG A;  2F8T A;  3E01 A;  3G6E N;  4RG8 A;  1NMN A;  5GAE P;  2Q97 A;  1T7P A;  3H45 C;  1VQ6 N;  4N47 A;  3CJA A;  4GKK K;  2E8A A;  1JLA A;  1KAZ A;  4Y1C A;  2G8H A;  5I42 A;  4DS4 A;  2QI2 A;  3U3Y A;  2B4J A;  3PIO L;  1VHX A;  2XY5 A;  1HNX K;  4JNE A;  3BP8 A;  1IKW A;  3OYK A;  1KRP A;  4FJN A;  5C0Y A;  1HPZ A;  1RDU A;  4DF8 A;  3KLG A;  1RT3 A;  3CJ7 A;  2E6L A;  3TSQ A;  5AZI A;  4FWO A;  1S1U A;  3SUN A;  3AVJ A;  1OH6 A;  3CC7 N;  2CGK A;  4EFH A;  1C1A A;  4JHD A;  4J2B A;  3C94 A;  1SKR A;  1GOB A;  3QFU A;  1RTI A;  4JD2 B;  4NLC A;  4BAC A;  4CEO A;  3LM2 A;  4BRI A;  4E7H A;  1YJN N;  3LP3 A;  4KHW A;  1BO5 O;  1JCE A;  3BGR A;  1QQM A;  4CBU A;  3LAL A;  5SZT A;  4CEE A;  2JWK A;  3PV8 A;  1ZBH A;  3CCV N;  3NBP A;  1NGG A;  3I0S A;  5CZ1 A;  3SBG A;  5AFU A;  3HPO A;  1EKE A;  1NK8 A;  4EHU A;  1GOA A;  1VSD A;  4CF8 A;  2UUA K;  3ZSW A;  3V9W A;  2BUP A;  1NGF A;  1BCO A;  2X6N A;  1C0M A;  3VTH A;  1YIT N;  5FRN A;  4DCH A;  3S3M A;  3OTO K;  1KLM A;  4PQU A;  1TL1 A;  3WXM B;  3SJH A;  3TWH A;  3T3F A;  3CFR A;  1VQM N;  4Q0B A;  1R59 O;  4HHT A;  3V81 A;  2B5J A;  3I8B A;  3TAP A;  1LV5 A;  1EXQ A;  3SV4 A;  4M7X A;  2O8D A;  2FBV A;  3WUH A;  5D3G A;  2Q36 A;  4IG3 A;  1ITG A;  2P9S A;  5LMN K;  4OPK A;  4WFN L;  4DSK A;  1YJ9 N;  1VSK A;  4RW6 A;  2GUI A;  1WBD A;  3HRG A;  4CZM A;  3ULD A;  2YV0 X;  1NJW A;  3TPQ A;  3P1G A;  4IXC A;  2IDO A;  3VQQ A;  3T19 A;  3RWU A;  3DWL A;  2XHB A;  2AA4 A;  3QO9 A;  4H5R A;  4XJX A;  3HVR A;  4JI1 K;  3IAY A;  2E2P A;  2HHX A;  2OPQ A;  5T7B A;  1SL0 A;  4BQL A;  3U9D A;  3ENB A;  2G8U A;  4BEC A;  2OPR A;  4FWM A;  1D9D A;  2X78 A;  2O8D B;  3K5O A;  3ZT1 A;  2UXC K;  3VEY A;  2E88 A;  3TU5 A;  1YJW N;  4K8Z A;  1Y64 A;  4OPH A;  1SAZ A;  5GAG P;  1MA9 B;  4NXM K;  3G25 A;  1W9H A;  5H1S Q;  2ITM A;  1E4F T;  2O8E B;  1JL2 A;  4K25 A;  3K57 A;  1RT7 A;  4X66 K;  4JKD A;  4CVN E;  3QEP A;  3SZ2 A;  4FWK A;  2EX3 A;  4ELU A;  3ZEU B;  4M3W A;  4IZ9 A;  1BA0 A;  3D2F B;  3DRS A;  1HNW K;  3O9U A;  2ASO A;  4C8M A;  4H0P A;  4M3U A;  4DB3 A;  5AQS A;  5AZJ A;  3HTV A;  2P51 A;  4DV2 K;  3ULE A;  3OS2 A;  1C0F A;  3SQ2 A;  3SUO A;  1C0U A;  4A2A A;  4B1Y B;  3AO1 A;  5A2Q O;  1XC9 A;  1UOC A;  3MCA B;  1T44 A;  3PO5 A;  4Z0U A;  1IV0 A;  2IS3 A;  4B9N A;  3HL8 A;  4KTZ A;  4JI0 K;  4C1N I;  1RTJ A;  3D6R A;  2UXD K;  2QK9 A;  1N32 K;  1GLC G;  4YOV A;  1EX4 A;  3PSF A;  2YJE A;  1IBM K;  4NCB A;  3VGL A;  3NF8 A;  3KKS A;  5KQ8 A;  4K42 A;  1KAX A;  3S5T A;  3HPG A;  4CD1 A;  1UWB A;  2FSN A;  3R9P A;  1TL3 A;  3EZW A;  4BE1 A;  1E4G T;  2WC9 A;  1MWM A;  3NVM A;  5CYQ A;  5AZJ B;  3ZSY A;  2W41 A;  3CFO A;  4DTR A;  4ICL A;  1V4S A;  5BRH A;  4NO7 A;  2D5R A;  1K8K A;  2NRR A;  3M8S A;  4B1X B;  4PL8 A;  3IG1 A;  4G9Z A;  5C15 A;  1KVB A;  1WSI A;  4GY2 B;  4F3T A;  1HUX A;  1G15 A;  2HNY A;  4CEA A;  1VRU A;  3AGK A;  3LZI A;  3OYN A;  4M3T A;  5CZ2 A;  1DKG D;  1GLA G;  1IKX A;  3E9L A;  4FJL A;  2RN2 A;  4BDZ A;  4BC4 A;  1BA1 A;  3LDO A;  1K9M O;  2HF4 A;  4FZY A;  4B3O A;  4GV6 A;  4ILH A;  1ESV A;  2E4L A;  3HOT A;  3CPE A;  4KV8 A;  4HUE A;  4AHV A;  3PX6 A;  5AQV A;  3GG4 A;  5FRO A;  3VGK A;  1VAZ A;  4DS5 A;  4KBO A;  1VSE A;  5FPN A;  3SPZ A;  1QZ6 A;  2P5G A;  5F0X A;  2G8V A;  4HCB A;  2BTF A;  3EZ5 A;  4CJ4 A;  4OKJ A;  4DV1 K;  3VEW A;  1RNH A;  3QML A;  3LDS A;  1BDG A;  2OAN A;  1TKX A;  2F7T A;  3K2P A;  3DAW A;  3SUP A;  4FPA A;  1HNV A;  1NK9 A;  1RBU A;  3AY9 A;  4AHU A;  4FJI A;  3O08 A;  3RSE B;  2ASM A;  1T6D A;  3WEE B;  4BRL A;  1VSH A;  4CD3 A;  4K0K K;  3GE1 A;  4XH4 A;  2QWR A;  3LAM A;  4MLH A;  4ZTF A;  2QWL A;  3VEN A;  3MWT A;  1IO2 A;  3NH0 A;  3GOI A;  1RT4 A;  2DY4 A;  1ATN A;  3QLH A;  1QSS A;  5J2P A;  1L3T A;  1S72 N;  1HQU A;  1NKE A;  2P9I A;  3P4I A;  2YHB A;  4BC2 A;  3IRX A;  5CY4 A;  3VTI A;  3D0P A;  3LDQ A;  4ID1 A;  5LJW A;  3CC2 N;  4BRK A;  4LFC K;  1BIS A;  4KH5 A;  1OKJ A;  1HX1 A;  3THW A;  4KRE A;  1KXP A;  5AQH A;  2NRX A;  2IVP A;  5AQG A;  3VA3 A;  5JMV A;  1HKG A;  3R3L A;  4GW6 A;  1HYS A;  3TAN A;  2VGN A;  4E7I A;  4X64 K;  1RDB A;  3LP1 A;  4FO0 A;  4LC9 B;  3NMU A;  3CJC A;  3KK7 A;  3KLH A;  4A57 A;  5GAH P;  4JAX A;  1WSF A;  3PUF A;  1B9D A;  5M1N A;  4FM2 A;  3LWL A;  5AR0 A;  3WQU A;  4OLA A;  3ZT4 A;  2D0B A;  4CFB A;  1Q82 O;  1UA0 A;  5AQX A;  3PO4 A;  3B8A X;  2PFU A;  2DFH A;  1W7A A;  2ZQB A;  3V6D A;  1DLO A;  3ISN C;  2ETJ A;  3M8Q A;  4JRP A;  1DEJ A;  2CGL A;  2GTD A;  3QIO A;  3UKU B;  1U2V B;  2QEX N;  1VSI A;  1X9M A;  2YNF A;  1ILY A;  2QWQ A;  5BPN A;  3RMC A;  4FLU A;  2YHX A;  1WOQ A;  3THX B;  2NNW A;  4G1Q A;  3OS0 A;  3IDH A;  3C6A A;  2YNG A;  4Y1D A;  4CFC A;  1J54 A;  3IFR A;  2O8F A;  5BN8 A;  1NK6 A;  1HRH A;  3CJB A;  2GUP A;  2C1G A;  4FLW A;  3L2R A;  1IKV A;  5C25 A;  3TAF A;  4JD2 A;  1NKC A;  4Z4C A;  2A40 A;  4DLE A;  5IT9 O;  1IBK K;  1JLB A;  1QQN A;  2IAJ A;  3K9K A;  3OS1 A;  3OYG A;  4CJL A;  1RCH A;  3L2Q A;  1VSL A;  4MO5 A;  2NRT A;  1QHT A;  1TK8 A;  4JLH A;  2W6K A;  3THX A;  3T69 A;  1S9G A;  4R5P A;  2HHS A;  2YI1 A;  3MN6 A;  3O3H A;  3A2F A;  5FDL A;  4BE2 A;  1FKO A;  3ZSO A;  3K59 A;  2FF3 B;  3ASM A;  4X62 K;  3QBX A;  1NOZ A;  4FLX A;  4A5B A;  2P9P A;  4BC3 A;  1L3S A;  4KFB A;  4FOI A;  1R0A A;  4DR4 K;  2Z1I A;  1NJI O;  3SV3 A;  1OVY A;  1K8A O;  3P83 D;  4CGI A;  4XEI A;  3WNH A;  1J6Z A;  2GWK A;  4DQI A;  5JS2 A;  3CXC M;  1JLF A;  1B92 A;  1D4X A;  2ZGY A;  3CFP A;  4BY9 C;  1SV5 A;  3TSU A;  1KFD A;  3VMF B;  2Z1J A;  2QWO A;  3O5B A;  4BGA A;  3NH1 A;  2G8W A;  4L8R B;  3SCX A;  1MDU B;  5C10 A;  4FLZ A;  3QER A;  4M7Y A;  5AQR A;  3G4S N;  1BI4 B;  1KC8 O;  3H6E A;  4BVP A;  4HVJ A;  1VQ9 N;  4U67 L;  4W5O A;  2P9N B;  1K6Y A;  3MX2 A;  4BC5 A;  5JS1 A;  3VF4 A;  4H0Y B;  2GEM A;  4UQG A;  3SMS A;  4K8X A;  2FSK A;  1K8K B;  1NGJ A;  1QE1 A;  3VQ6 A;  3EE9 A;  3OYH A;  2E2N A;  3OYE A;  2QA4 N;  1BHL A;  2R7Y A;  2HBM A;  3THY A;  4O5F A;  5BRE A;  3C6T A;  2HHH K;  3I0R A;  1RDW X;  4CIF A;  4CJS A;  1GLB G;  3FFK B;  3PSI A;  3RVC A;  3MCP A;  3QIP A;  1FK9 A;  3VF2 A;  1JLE A;  4B3M K;  4ELV A;  2HHI A;  2QWP A;  5ADX H;  3QEI A;  4WF9 L;  4DSL A;  4A61 A;  1C1B A;  5BR8 K;  3AAR A;  4LH5 A;  3FZH A;  3O8M A;  4KH6 A;  4EIA A;  3TAG A;  1G99 A;  1CLQ A;  2P9P B;  2O8B A;  1NJX A;  4CZF A;  4DSI A;  2F8S A;  1RDC A;  4ISE A;  3O1B A;  3U3G A;  4HWI A;  3ULE B;  3K9J A;  4CJU A;  4I9L A;  3QET A;  4ISF A;  3VN5 A;  3KWG A;  3RMB A;  1S6Q A;  5AQI A;  2OYQ A;  5AQU A;  3VEZ A;  4ID5 A;  1EWQ A;  1NLV A;  2V51 B;  2A42 A;  2XO7 A;  3ATU A;  5I3U A;  2VG7 A;  4DR7 K;  4DTU A;  1C6V A;  3WNE A;  3LAN A;  4GV3 A;  4BG8 A;  1YT3 A;  2NZT A;  4BE7 B;  1S22 A;  4O4G A;  3D45 A;  5E41 A;  2DPN A;  2ATQ A;  4CGJ A;  4IDK A;  2O4G A;  1OH8 A;  4IOA L;  3DRP A;  2NRW A;  1L3V A;  1V4T A;  3A8Y A;  4CFD A;  3FFI A;  4CHY A;  3AVF A;  3V9X A;  5AQZ A;  4WQ4 C;  3OYC A;  4JKG B;  2IC3 A;  1S3X A;  1ZBI A;  3S41 A; 
#chains in the Genus database with same CATH homology
 4OO1 J;  1BG3 A;  4IOX A;  4JKD A;  4FWK A;  5E26 A;  2CGJ A;  4MDB A;  1GLL O;  3CQX A;  3E1Y A;  3ZEU B;  5KPT A;  3CCU N;  1VQO N;  4IZ9 A;  1BA0 A;  3D2F B;  3ATV A;  1QHA A;  3O9U A;  2ASO A;  4WYB A;  2P9U A;  1XC3 A;  2Q31 A;  3GBT A;  2A3Z A;  4FWS A;  4H0P A;  5AQT A;  5BPM A;  4JK9 A;  1NGA A;  2NRV A;  4DB3 A;  5AQS A;  5AZJ A;  1NWK A;  3HTV A;  3ULE A;  1C0F A;  3UE5 A;  4BRH A;  2D0P A;  4CZL A;  4WCE L;  1WUA A;  5F1X A;  3DXK B;  5JLH A;  2KHO A;  3E9P A;  4A2A A;  2VWB A;  4B1Y B;  1Q81 O;  3MCA B;  1T44 A;  3DJC A;  2P9K A;  3PLA A;  1YAG A;  1U6Z A;  1NGI A;  3IMX A;  3MX5 A;  3ENO A;  3O4W A;  3U9Z A;  4C1N I;  3D6R A;  1ATS A;  1NBW A;  3H46 O;  1GLC G;  3O9S A;  4YOV A;  3EL2 A;  4H0T B;  2YJE A;  5LJV A;  3VF6 A;  3VGL A;  2PAV A;  4I6M A;  5KQ8 A;  5GIN A;  1ZC6 A;  4JKE A;  4MDA A;  1P8Z A;  3I33 A;  4K42 A;  4IEE A;  1TYQ B;  2YCH A;  1KAX A;  3TTD A;  4FVU A;  3HOS A;  2EWS A;  4CD1 A;  2FSN A;  2FSJ A;  1YF5 L;  2IVO A;  3M6G A;  3R9P A;  1M1K O;  4A59 A;  1ZBS A;  3EZW A;  4JN4 A;  4ILJ A;  3H3N O;  3VEV A;  3IUC A;  1E4G T;  3BEX A;  2WC9 A;  4FSV A;  4FWN A;  3ZEU A;  4BEB A;  1MWM A;  4H5N A;  3NVM A;  4IO9 L;  4DKW A;  5AZJ B;  3D2F A;  2W41 A;  1VQN N;  1H1V A;  1VQ8 N;  1V4S A;  5BRH A;  4NO7 A;  4IEI A;  3VGM A;  2P9U B;  5MLC Q;  4WQ5 C;  1K8K A;  2NRR A;  4JKA A;  5BPL A;  2HBJ A;  4B1X B;  1HJO A;  4PL8 A;  2ZF5 O;  1YHQ N;  4G9Z A;  4BVO A;  5C15 A;  5AQW A;  4H0V B;  3VES A;  4GY2 B;  3M1F A;  2RE2 A;  1HUX A;  3VET A;  3ZET B;  2V52 B;  1HLU A;  3WXL A;  3CCS N;  3AGK A;  3EE8 A;  3W3D A;  2CH5 A;  3O9Q A;  3SBT A;  3C6H A;  1BOT O;  1DKG D;  1GLA G;  4BR5 A;  1RGI A;  1QQO A;  4CJ7 A;  5KQD A;  3CCJ N;  3E9L A;  4IO8 A;  3L0Q A;  4GV9 A;  3Q7C A;  4BR0 A;  1QZ5 A;  1NGE A;  3C7N A;  3VOV A;  1YIJ N;  4BC4 A;  1BA1 A;  3LDO A;  3ZX2 A;  5CHI A;  1K9M O;  2HF4 A;  5C2D A;  4BRQ A;  1X9J A;  4GV6 A;  4JK8 A;  4IDH A;  4FPB A;  4ILH A;  1ESV A;  1ZXO A;  3WEE A;  4CI6 A;  3FLC O;  3HOT A;  2OTJ N;  3CPE A;  3FZF A;  4CZH A;  3M3Z A;  4JKB A;  5AQV A;  1GLJ O;  3GG4 A;  3P38 A;  5AQF A;  3SAH A;  3E66 A;  2C1I A;  3VGK A;  1NGC A;  1SS6 A;  1VAZ A;  5AZI B;  3WXJ A;  4BRA A;  4KBO A;  2V7Z A;  3E9O A;  5FPD A;  5FPN A;  1QZ6 A;  5DM7 L;  4BGB A;  5F0X A;  1JJ2 M;  4H03 B;  2YX6 A;  4RWT A;  2BTF A;  3DXK A;  3NVK A;  2E1Y A;  3VEW A;  5DM6 L;  3U4L A;  3QML A;  4NLB A;  3FR0 A;  2Q0R A;  1NGH A;  4B1U B;  2ZJP L;  1JCG A;  1BDG A;  3SAF A;  2OAN A;  4NB4 A;  2F7T A;  5AQK A;  3DAW A;  5AQM A;  5LY3 A;  1LCU A;  3Q7B A;  2A5X A;  3MMV A;  4YDU A;  4FPA A;  1TUY A;  2P9I B;  1P90 A;  1QVG M;  3QIC A;  2QW9 A;  4I6M B;  3KWI A;  3QBW A;  1VQ5 N;  3AY9 A;  3HBT A;  3MN7 A;  1VQP N;  2E2O A;  3O08 A;  3RSE B;  2ASM A;  3T7Z A;  1T6D A;  3WEE B;  4PHT X;  4BRL A;  3GDQ A;  3G71 N;  4CD3 A;  3KVG A;  3GE1 A;  4XH4 A;  2QWR A;  4IJN A;  5AQJ A;  5CE3 A;  2F9W A;  1IG8 A;  5AQN A;  4MLH A;  3MDQ A;  4HTL A;  4K43 A;  4IJA A;  4BRM A;  2QWL A;  4WQ4 A;  2ASP A;  3EO3 A;  4WQ5 A;  3VEN A;  3MWT A;  3ZET A;  3GOI A;  1Z05 A;  5BRF A;  4F9O A;  2HBK A;  1NGB A;  1BUP A;  4JHD B;  1Q18 A;  3SAG A;  5M1P A;  1ATN A;  3OHR A;  2NRZ A;  2E2Q A;  4QS8 A;  3HZ6 A;  5AQL A;  2W40 A;  3CPW M;  1S72 N;  5HL7 L;  1T3V A;  1YI2 N;  2P9I A;  4DHY A;  3P4I A;  4BRO A;  2I7N A;  3N4Q A;  5TKW A;  2OTL N;  1X3N A;  4BC2 A;  3CET A;  3A5O C;  3VTI A;  3UKR A;  1LOT B;  1GLE G;  2D4W A;  2FLO A;  3O1W A;  3LDQ A;  3CI5 A;  4PL7 A;  3D2E A;  5AQO A;  5LJW A;  2P9L B;  2Q1N A;  4BRE A;  3CC2 N;  2F9T A;  4BRK A;  2D1K A;  3A5L C;  4KH5 A;  1OKJ A;  4JKF A;  3VEO A;  1HX1 A;  4BR7 A;  5C12 A;  2H3G X;  2ZJQ L;  1KXP A;  5AQH A;  2NRX A;  2IVP A;  5AQG A;  2BH1 A;  4BR9 A;  1Q7Y O;  2V7Y A;  4H0X B;  4ISG A;  5JMV A;  2CH6 A;  3O80 A;  1HKG A;  2VGM A;  1QVF M;  3R3L A;  3VER A;  2ZGZ A;  2IVN A;  4IFE A;  2VGN A;  3LL3 A;  4EHT A;  3CCE N;  4AM6 A;  4FO0 A;  4LC9 B;  3WT0 A;  3P31 A;  5HOO A;  3NMU A;  3CJC A;  4O8K A;  3GL1 A;  3KK7 A;  4BQZ A;  5EVZ A;  4A57 A;  5GAH P;  4JAX A;  2Q0U A;  3H1V X;  2W00 A;  2D0O A;  5JVG L;  3F9M A;  3VPZ A;  5M1N A;  2RHK A;  3AAP A;  4A5A A;  3R6M A;  5AR0 A;  3AGR A;  3WQU A;  3J7Z O;  3R8E A;  4BR2 A;  1DGK N;  1IJJ A;  2WBN A;  3D2E B;  3KHY A;  3SLC A;  3MWP A;  5I9E B;  1Q82 O;  2A6A A;  5AQX A;  3B8A X;  3ID8 A;  2PBD A;  2PFU A;  3FGU A;  2QXL A;  3KZB A;  3RSE A;  3I56 N;  2J4R A;  4PKH A;  1KAY A;  4MO4 A;  4FWL A;  4BRG A;  3DXM A;  1U2V A;  4GNI A;  5E84 A;  4R79 A;  1VQ7 N;  5GAD P;  1DEJ A;  3CMA N;  2CGL A;  2GTD A;  3HI0 A;  4JEP A;  5M1O A;  3UKU B;  1U2V B;  5EXW A;  4B9Q A;  2QEX N;  1Q86 O;  4FWQ A;  4MLE A;  5M1K A;  4A2B A;  1NGD A;  1ILY A;  3CER A;  4IOC L;  4CZJ A;  3J8A A;  2QWQ A;  3UKU A;  3MN9 A;  5BPN A;  3PIP L;  2GEL A;  5F2R A;  2YHX A;  3WQT A;  4C23 A;  1XQS C;  2KLA A;  3TSP A;  4J8F A;  1WOQ A;  1YUW A;  1O13 A;  3CME N;  2NNW A;  3O9R A;  2HST A;  4L3Q A;  4CBX A;  3IDH A;  3C6A A;  4YOX A;  1JCF A;  3DLL L;  4YOT A;  2YHW A;  3IFR A;  4BG9 A;  5BN8 A;  3CCQ N;  3CJB A;  4Y0W A;  3ZYY X;  3L6Q A;  2GUP A;  2C1G A;  3FZK A;  1VQK N;  2ZWH A;  1W97 L;  5AQQ A;  5KPZ A;  4JD2 A;  3OBW A;  3W0L A;  3CQY A;  3BF1 A;  2E1Z A;  3F2K A;  2WUS A;  2A40 A;  5ELZ A;  3CC4 N;  1YVN A;  3C7N B;  1SZ2 A;  4FWR A;  2WFB A;  3A5N C;  1QQN A;  3OBY A;  3K9K A;  3CJ1 A;  2GWJ A;  4JKC A;  3C65 A;  1M90 O;  4B1V A;  5EY4 A;  5BRD A;  5C2F A;  4MO5 A;  1X3M A;  2HBL A;  1GLF O;  2QWM A;  4FL9 A;  2NRT A;  3DXM B;  3SK3 A;  3UB5 A;  5JIC A;  3L4I A;  4O8U A;  3EN9 A;  3HSC A;  5M1F A;  1BU6 O;  1MWK A;  4U7B A;  3T69 A;  4CZE A;  1BWF O;  1NM1 A;  4AM7 A;  3CCR N;  1VQ4 N;  2YI1 A;  4BR4 A;  1C0G A;  4B1Z A;  3MN6 A;  4A62 A;  5GIO A;  2FF3 B;  4ILG B;  3G6E N;  3QBX A;  2QM1 A;  4BRP A;  3A0I X;  4A5B A;  2Q97 A;  2P9P A;  4BC3 A;  5GAE P;  1HKB A;  3H45 C;  1VQ6 N;  1HKC A;  3CJA A;  4FOI A;  2E8A A;  1KAZ A;  2QI2 A;  1NJI O;  5JLF A;  4E1J A;  1OVY A;  3FZM A;  1K8A O;  4XEI A;  4AF1 A;  3PIO L;  4GVE A;  4H5V A;  3UKR B;  1J6Z A;  1ATR A;  2GWK A;  5BN9 A;  3TTC A;  5TKY A;  4JNE A;  3BP8 A;  1T6C A;  4CBW A;  4YDU C;  3CXC M;  1D4X A;  1Z6R A;  2GX9 A;  1YXQ A;  2ZGY A;  3EKS A;  2UYT A;  2FXU A;  4BY9 C;  3TSU A;  5C0Y A;  3OA9 A;  3VMF B;  1RDU A;  2QWO A;  3O5B A;  3CJ7 A;  3ZX0 A;  4BGA A;  3TSQ A;  3M5R A;  1EQY A;  1TYQ A;  4FWO A;  4OPA A;  4RCH A;  5AZI A;  4CZK A;  1MDU B;  5BR9 A;  1NMD A;  5KPR A;  1K73 O;  3FE1 A;  1CZA N;  5AQP A;  5C10 A;  4YOW A;  4M7Y A;  2AP1 A;  5AQR A;  5AFU H;  3G4S N;  1KC8 O;  5EX5 A;  3CC7 N;  3H6E A;  4QS9 A;  4BVP A;  4BRD A;  2CGK A;  4EFH A;  3WXI A;  4JHD A;  1VQ9 N;  4U67 L;  4CZI A;  1EO1 A;  2P9N B;  3QFU A;  4YOR A;  3I55 N;  1KD1 O;  3MX2 A;  4JD2 B;  4NLC A;  4BC5 A;  3LM9 A;  3SMP A;  3LM2 A;  3O6W A;  4H0Y B;  2GEM A;  4JKH A;  2JWL A;  3JS6 A;  5FPM A;  3SMS A;  3VF4 A;  4BRI A;  1YJN N;  2FSK A;  3QDK A;  1K8K B;  2NRH A;  5FPE A;  1BO5 O;  1JCE A;  1NGJ A;  1QQM A;  3EE9 A;  2A41 A;  2E2N A;  4K41 A;  5EOY A;  4CBU A;  4CZG A;  2QA4 N;  4BRF A;  4PKI A;  2HBM A;  2JWK A;  5CR4 A;  2IIR A;  4O5F A;  5BRE A;  5AQY A;  4IWV A;  4FOE A;  3CCV N;  3FZL A;  1RDW X;  1NGG A;  3SBG A;  5AFU A;  3CHW A;  1GLB G;  2Q2R A;  3FFK B;  3EKU A;  3RVC A;  4EHU A;  3MCP A;  3L4Q A;  3MN5 A;  1XUP O;  1HPM A;  4RTF D;  3VF2 A;  2BUP A;  5GIP A;  1NGF A;  3VTH A;  1YIT N;  3WXK A;  2QWP A;  5ADX H;  3BUZ B;  3N4P A;  4WF9 L;  4A61 A;  4DCH A;  4DQ8 A;  2HF3 A;  4C1N K;  3AAR A;  3H1Q A;  2ZJR L;  4PKG A;  3O9T A;  3FZH A;  3O8M A;  3WXM B;  5B8H A;  3SJH A;  2YHY A;  4KH6 A;  4EIA A;  3OW2 M;  1G99 A;  2E20 A;  3D7E O;  2P9P B;  3CIP A;  3BF3 A;  1VQM N;  4YOY A;  4WFA L;  4CZF A;  3C0B A;  2QWN A;  2NLX A;  1R59 O;  4H5T A;  4KH4 A;  3QFP A;  3CJ9 A;  4WFB L;  3QB0 A;  3I8B A;  4ISE A;  3O1B A;  2P9L A;  4HWI A;  3ULE B;  3ENH A;  3K9J A;  4M7X A;  3WUH A;  5ADX A;  2Q36 A;  3P39 A;  4ISF A;  4B1W B;  2P9S A;  3KWG A;  3LDL A;  3CF5 L;  4FWP A;  3CCM N;  3LDN A;  4WFN L;  1YJ9 N;  2QTD A;  2FF6 A;  5AQI A;  2YJF A;  1RFQ A;  4XH1 A;  3R1X A;  5AQU A;  2P9S B;  3VEZ A;  1SQK A;  3VEX A;  1DT9 A;  3F5T A;  3HRG A;  4CZM A;  5JVH L;  1NLV A;  2V51 B;  2A42 A;  3ATU A;  3ID6 A;  3TPQ A;  4BRN A;  3A5M C;  4IXC A;  3AAQ A;  1N8R O;  3TTF A;  2VCP A;  3DWL A;  3LDP A;  3MK6 A;  2AA4 A;  4H5R A;  3CD6 N;  1W2B M;  4GV3 A;  4XJX A;  4BG8 A;  2HOE A;  1TUU A;  3H3O B;  3U8X A;  2NZT A;  2E2P A;  2VYP A;  2P9N A;  3HM8 A;  4YOU A;  4BE7 B;  4Z94 A;  4BQL A;  1S22 A;  2KKZ A;  3U9D A;  3ENB A;  4QS7 A;  4JK7 A;  3CCL N;  4FWM A;  4BEC A;  4M63 C;  4XH5 A;  2DPN A;  2P9K B;  3VEY A;  3IKM A;  3JXU A;  2E88 A;  3TU5 A;  2NRW A;  1YJW N;  4IOA L;  1V4T A;  1Y64 A;  2HMP A;  3A8Y A;  4OPH A;  3ZX3 A;  1KQS M;  1SAZ A;  5GAG P;  1MA9 B;  4UY8 O;  4JKG A;  5M1Q A;  4H0O A;  5AQZ A;  4H5W A;  4WQ4 C;  3G25 A;  5H1S Q;  2ITM A;  1VQL N;  4BRC A;  1E4F T;  4JKG B;  2I7P A;  4EAH D;  4K25 A;  1S3X A;  1GLD G;  3S41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...