3W3DA

Crystal structure of smooth muscle g actin dnase i complex
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
374
structure length
373
Chain Sequence
EEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure and solvent network of chicken gizzard G-actin DNase 1 complex at 1.8A resolution
rcsb
molecule tags Structural protein
molecule keywords Actin, gamma-enteric smooth muscle
total genus 122
structure length 373
sequence length 374
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3w3dA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3w3dA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3w3dA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3w3dA04
3WUHA 3CJAA 2GTDA 3CERA 1HKBA 3CJ1A 3U8XA 1TUYA 3AARA 4WQ5C 1TYQB 5F0XA 3VGLA 3KVGA 1NGAA 3TPQA 5AQWA 3D2EA 3WQUA 3W0LA 3EKUA 5FPMA 4B1YB 3HBTA 1BO5O 4A61A 3UKUB 3F9MA 4Y0WA 3WT0A 3L4IA 2YHXA 4BRCA 4IZ9A 5AQVA 3MN9A 4M63C 3ID8A 4WQ4C 1DGKN 3H3OB 3AAPA 2Q2RA 2YCHA 3LDQA 2ITMA 1JCFA 2YJFA 1X3NA 4O8KA 3R8EA 3VF6A 5ADXH 4H0OA 1QQOA 2ZWHA 1MDUB 5AZIB 3IMXA 3BF3A 2YHWA 4BRGA 1BDGA 1NGCA 1S3XA 3CJBA 1T6DA 3JS6A 1GLFO 4JHDA 1X9JA 5AQOA 2PBDA 2CH6A 5AFUA 4BR7A 2QWPA 1H1VA 3M3ZA 3ZETB 1NWKA 3IDHA 5TKYA 4CZHA 3A0IX 1QZ6A 4PKHA 3EZWA 2FF6A 3FZKA 4CJ7A 3GBTA 4CZIA 4CI6A 1Z6RA 1BA0A 4J8FA 3VEZA 2P9PB 2CGKA 1NGFA 3C7NB 1BUPA 5CE3A 3A5LC 1IG8A 3BEXA 3UKRB 4C23A 3S41A 5BPNA 4RWTA 4RTFD 1XQSC 2AP1A 2FSJA 4FL9A 3FZHA 3ULEA 1SZ2A 4BRIA 4BRFA 4BREA 2W41A 2H3GX 1GLBG 3CJ7A 4JHDB 2PAVA 3VEVA 1EQYA 3ENOA 5EXWA 5JMVA 3H45C 4KBOA 3WEEA 3TU5A 1G99A 3ATUA 4NO7A 4BR2A 1NGGA 5AZJA 2FLOA 3ZX2A 3A5MC 2I7NA 3AY9A 2EWSA 3LL3A 4PL8A 1IJJA 5JICA 3ATVA 1P8ZA 3DXKB 4DHYA 3GG4A 5AFUH 4HWIA 1GLEG 4BC4A 2FF3B 1KAXA 3VEOA 5ELZA 1T44A 2A3ZA 4IWVA 1HPMA 2Q0RA 4B9QA 4MLHA 3LDLA 3GE1A 4DCHA 3MK6A 1QHAA 3J8AA 1OKJA 4FWQA 5AQGA 3UE5A 4BRHA 1V4SA 4BRNA 1NBWA 3SMSA 5AQQA 1YUWA 4B1ZA 2IIRA 4BRLA 1HKGA 4FWNA 3ZX3A 5AZIA 1DKGD 2FSNA 3O8MA 3B8AX 5BREA 1GLCG 2W40A 2E2QA 3QFUA 5AZJB 5JLFA 5FPDA 4WQ5A 3QB0A 5AR0A 3O80A 2VYPA 3FLCO 4B1UB 2P9UA 3CETA 3FGUA 2GWKA 4H0XB 3BUZB 1BU6O 2IVPA 3UB5A 1X3MA 5BRDA 5KQ8A 4B1WB 5JLHA 3IUCA 5KPZA 4CZLA 4H5VA 4M7YA 1NGBA 3WXKA 3C0BA 3VEWA 5BN9A 3CQYA 3HZ6A 4QS9A 3WEEB 3RSEB 3KHYA 4XEIA 1E4FT 3L0QA 3VOVA 4ISEA 3VEYA 1BA1A 2QWRA 2YJEA 3HI0A 2OANA 3CIPA 4BRMA 3MCPA 5BN8A 2J4RA 3A8YA 3QDKA 3WXIA 2CGLA 3R9PA 5AQNA 1E4GT 2A41A 3VENA 2I7PA 4BGBA 4FWRA 3M1FA 3CQXA 2P9IA 4AM6A 1ESVA 2GUPA 2P9UB 1J6ZA 4H5TA 3CJCA 3I33A 3SLCA 2E20A 2VCPA 2P9KB 3OHRA 1ATSA 2FSKA 4BVOA 4JN4A 4F9OA 4IJAA 3L6QA 1MWKA 3R6MA 1HLUA 2ZGZA 3EO3A 1BOTO 4BQLA 4H5NA 4BRDA 3DXMA 2QWNA 4QS8A 1GLJO 3FZMA 4IXCA 2CH5A 4IJNA 3U9ZA 2QWOA 1DEJA 4H0TB 2E88A 2ASMA 1HKCA 4I6MA 3EN9A 3UKRA 3A5NC 5AQPA 4AM7A 1T6CA 3VERA 3W3DA 2YI1A 2WUSA 3I8BA 3VPZA 4FSVA 4A62A 3SK3A 4CBWA 5BPLA 4CZGA 5AQKA 3IFRA 4BRPA 4BVPA 3P4IA 1ZBSA 3JXUA 2Q36A 4CZEA 3DXKA 3VGMA 5AQFA 3DJCA 1SQKA 2P9NA 4CBXA 4E1JA 3CJ9A 3C7NA 2HF3A 4L3QA 2A5XA 3DXMB 2P9LB 5EX5A 3WXLA 4LC9B 1NGHA 2ZGYA 2HOEA 4BGAA 1YVNA 4B1XB 1NMDA 4O5FA 5AQTA 2GWJA 2E8AA 2D0PA 4CD3A 3H6EA 4H5RA 4M7XA 4XH1A 1NGJA 4ISFA 3O1WA 5AQSA 1ZXOA 1WOQA 2F9TA 2BUPA 3D7EO 2A40A 4H5WA 3HM8A 1RFQA 4MO5A 1RGIA 3ENHA 1NLVA 3FZFA 5AQIA 5KQDA 4BQZA 2E2PA 2V7ZA 5BRHA 2Q1NA 3D2FA 4FOIA 5EY4A 3ZX0A 1SAZA 2GELA 1D4XA 1TUUA 2UYTA 2Q97A 4FOEA 4CZFA 5F1XA 1LOTB 3SMPA 4BRKA 2A42A 3H1QA 3QBWA 1CZAN 5F2RA 3LDPA 4FO0A 2P9NB 4RCHA 4BG9A 4BR4A 5B8HA 5BPMA 5AQHA 3WXJA 3FFKB 3A5OC 5EVZA 3AAQA 3KZBA 3G25A 1MA9B 1JCEA 3DWLA 1NM1A 4K42A 4JAXA 5AQLA 4BG8A 3VETA 5I9EB 4H0YB 2P9IB 4NB4A 4BRAA 1KAYA 4MLEA 4PKIA 1BWFO 1KXPA 2QM1A 3O08A 4Z94A 2AA4A 4BRQA 5ADXA 3MMVA 4I6MB 3LM2A 3SJHA 4H0PA 3QBXA 2E2OA 4FPBA 4H03B 4CD1A 2ZF5O 3RSEA 1YXQA 5AQJA 4GY2B 3MDQA 5BRFA 3MN6A 1QQMA 4FWOA 3MN5A 4BC3A 1NGEA 1HJOA 1GLAG 2QWQA 1K8KB 1NGDA 1XUPO 4PL7A 4EHTA 1QQNA 3ZEUB 3O1BA 4FWLA 1MWMA 2Q31A 2QWLA 5KPRA 5FPEA 3VGKA 1Q18A 2QXLA 4BC5A 4CZKA 2E2NA 4WYBA 4FWKA 4B1VA 3U9DA 3GOIA 2P9KA 4DB3A 1V4TA 2F9WA 2CGJA 1LCUA 1Y64A 2D1KA 3M6GA 4FWMA 1NGIA 1HX1A 1U2VB 5LJVA 4EHUA 1ATRA 4DQ8A 3O6WA 2NRHA 2IVOA 3GL1A 5E26A 4CZMA 3LDOA 5AQUA 1TYQA 3LM9A 4BROA 5AQYA 2GEMA 3U4LA 3HTVA 3DAWA 3D2EB 3VF4A 3ULEB 2VWBA 2P9LA 1KAZA 4BC2A 4CZJA 3ZEUA 3EKSA 4FWPA 4GNIA 3QFPA 4XH4A 1WUAA 1Z05A 4PKGA 2V52B 4QS7A 2YHYA 4EAHD 1QZ5A 2D4WA 2ASPA 3LDNA 4EFHA 4JD2B 4MO4A 2NZTA 4H0VB 4K41A 3FR0A 3H3NO 2P9PA 4BR0A 3CHWA 2P9SB 4K25A 4JNEA 3ZETA 4K43A 2FXUA 4A2AA 1HUXA 4CBUA 5LY3A 3EL2A 1K8KA 1R59O 2DPNA 4HTLA 3VEXA 2IVNA 2D0OA 2KHOA 4FWSA 2E1YA 5EOYA 5BR9A 3CI5A 1GLLO 1ZC6A 5AQRA 3WQTA 4YDUA 4XH5A 4A2BA 5AQMA 2V51B 4ISGA 3FZLA 3HSCA 2BTFA 1JCGA 2ASOA 2QW9A 4BR5A 4WQ4A 3VF2A 3H46O 1BG3A 3QICA 3MN7A 4BR9A 2A6AA 2HMPA 2NLXA 4EIAA 3GDQA 1ATNA 4YDUC 1U6ZA 4JD2A 3UKUA 3D2FB 1YAGA 4IO8A 1RDWX 1XC3A 5KPTA 2P9SA 2E1ZA 5AQZA 2QWMA 1S22A 5LJWA 2V7YA 5FPNA 2Q0UA 5E84A 4FPAA 3H1VX 3O4WA 3FE1A 3VESA 3O5BA 5AQXA 1GLDG 1C0GA 3QMLA 3BP8A 1C0FA 1U2VA 3BF1A 2HF4A
chains in the Genus database with same CATH superfamily
4OO1J 3VQ6A 3OYNA 3ZSRA 3TARA 4JI5K 4WQ5C 1BI4A 3AA2A 4FJ8A 3TAQA 5F0XA 3RVCA 3KVGA 1QS4A 3VTIA 3K57A 4A61A 4FJMA 1NK5A 4QAGA 4Y0WA 4C8NA 3L4IA 3WT0A 3OJUA 4M63C 3NVMA 4WQ4C 2G8KA 3I56N 1JCFA 4O8KA 1X3NA 3VQAA 3IAYA 1IBKK 3VF6A 1ASVA 2ZWHA 4CGDA 3DOLA 3BF3A 4CEFA 1EETA 4DV3K 3JS6A 4JHDA 4W5OA 1M90O 1WNSA 2PBDA 2CH6A 5AFUA 2HHIA 4DQIA 1OVQA 4BR7A 1BCMA 1C1CA 1WN7A 2QWPA 1ZBIA 1NNEA 4FJ5A 2BGGA 4IFEA 2G8WA 4OPJA 3C95A 2WOMA 4PKHA 1D9DA 3ULDA 2DFEA 5FROA 3WNEA 3SZ2A 4M41A 4IOXA 5LL6Z 3QETA 3MXIA 1NJIO 3L2WA 3OVNA 5J2MA 4XIUA 2QTDA 3A5LC 2P5OA 3UKRB 3NHGA 1QE1A 4C23A 4FXDA 4OVLA 4RTFD 1XQSC 3V4IA 1IO2A 4YOTA 1HRHA 1NMNA 3NH1A 5JMVA 5SWMA 3ENOA 3AVCA 5TKWA 3TU5A 3SQ1A 4NO7A 5MLCQ 3MEEA 3SCXA 1RILA 5IWAK 5C0YA 3D45A 3SAHA 2HNZA 3ASMA 1I39A 3AY9A 4B9TA 4DR1K 3ISNC 3HPGA 3DXKB 4DR7K 4OKKA 4AH9A 3GG4A 2O8BB 3SUNA 3SBGA 1J5EK 3D0PA 3THYB 3TI0A 2A3ZA 1HPMA 2Q0RA 4MLHA 3TAGA 3DRRA 3KK7A 3SUOA 4FWQA 3BZCA 5C12A 1NBWA 4CGFA 5M1NA 3NGYA 3J80O 2HHUA 4BRLA 1Z26A 1VQLN 2QK9A 5AZIA 2FSNA 3O8MA 5CR4A 4YHHK 3C6HA 1A5XA 1LAWA 3AO3A 3QFUA 2ZD1A 1VK0A 2VYPA 2VWJA 3CETA 3QNNA 4KTZA 1LWFA 4K8ZA 4FK4A 4CEAA 2IVPA 3CCRN 1N33K 4W5NA 4YORA 5KPZA 1NKBA 2G8HA 3CCEN 4DTOA 2HHTA 3LP2A 3VEWA 5FDLA 4GV6A 3CQYA 3WEEB 3VA0A 3RSEB 4B3MK 4XEIA 3KKRA 3PIOL 3ZSVA 1BA1A 1KSPA 2OANA 4KHWA 3QEIA 1Q9XA 3TAMA 3A8YA 4YOUA 4FJXA 5M1OA 2E6LA 2A41A 4BGBA 4FWRA 2IAJA 4MQ3A 2KQ2A 3AA5X 4OKJA 3HOSA 4DU3A 1HQEA 2P9UB 3KK1A 3CJCA 3I55N 4JRPA 3CCSN 2E20A 3OHRA 4BVOA 1ATSA 2FSKA 1RTHA 3LPUA 4JN4A 4F9OA 4KRFA 4OJRA 3KK2A 4JKFA 2WONA 4X65K 4YNQA 3WNFA 1KVAA 4IO9L 3AVGA 4CHOA 2P5GA 4DMNA 2QWNA 4IXCA 3AO2A 3P1GA 4IJNA 4CGJA 3ZSXA 4BWJA 1S9GA 3D6RA 3ZT4A 2XY5A 4I6MA 3UKRA 4FK0A 3ZSOA 1WSHA 1L3UA 2YI1A 1CZ9A 1SS6A 4A62A 4HVJA 5BPLA 4PQUA 1F21A 1MU2A 3SBTA 1CXQA 3TTDA 1LW2A 3DXKA 5CY4A 1SKSA 5AQFA 3OYCA 1SQKA 4CBXA 1IG9A 2X74A 2WC9A 4E89A 3J7AP 3C7NA 1VSIA 3AVMA 3TAPA 4KPYA 1WAFA 1OH8A 1S6QA 1YVNA 2LSNA 3IRXA 4B1XB 3KLHA 3L2UA 4CW7B 4B9VA 3I0SA 4KI4A 4M3UA 3H6EA 4PWDA 1YJNN 5J2QA 1NK9A 4N76A 5AQSA 1WOQA 1HYSA 2A40A 1RFQA 2DY4A 4E19A 1RGIA 1NLVA 5AQIA 5KQDA 2E2PA 2Q1NA 3ZX0A 2UUBK 3SMPA 3LDSA 4CFDA 1NJZA 4DS5A 5BPMA 2D0CA 3LDPA 4BG9A 2HHXA 1SL2A 3OYIA 4ILHA 4EP5A 1RBTA 1C0MA 2P1JA 3O9SA 1MA9B 1YJ9N 1J54A 3LAMA 4DLGA 1NM1A 3M5RA 4JAXA 5I9EB 4NB4A 1KAYA 5C2FA 1BI4B 2O8EA 1BHLA 1KXPA 4WFNL 4FLVA 4CF8A 3MMVA 2X6SA 3LM2A 4RW6A 3NF9A 4DLEA 2RE2A 1KLMA 3LANA 1VSHA 4N56A 2E2OA 4FPBA 4Z4IA 2YHAA 3CG7A 3BGRA 3OYDA 1TV6A 4GY2B 5BRFA 2HBLA 1QQMA 3MN6A 4CJ3A 1N6QA 3P38A 3BZKA 1Q8IA 1HJOA 1REVA 1GLAG 2QWQA 1NGDA 4WCEL 4V19S 4FWLA 2PZSA 2Q31A 2VGMA 4LF8K 2UXDK 2QWLA 1W0HA 1EXQA 4IFVA 4DV5K 1HPZA 4WFAL 3OTOK 4DV0K 2UU9K 4DB3A 3CC2N 5BR8K 1LCUA 1KCFA 2GV9A 4ILGB 1QSLA 4FJKA 2D1KA 3U3YA 1HX1A 1NK8A 1LWEA 2UUAK 4B3SK 5LJVA 3TANA 3HP6A 4CEEA 1IH7A 3MX5A 5E26A 4CZMA 5AQUA 3LM9A 4BROA 2QKBA 1KRPA 3OYKA 3K0SA 3DAWA 1XWLA 4DSLA 4DG1A 3D2EB 2NRTA 3SUQA 3ZSZA 4BC2A 4I9QA 4CZJA 4JKEA 3ZEUA 1U49A 4GNIA 4LF4K 1WUAA 3SAGA 1Z05A 2V52B 4FZYA 2YHYA 1QZ5A 4EFHA 1OH6A 4H0VB 1SV5A 2P9PA 3H3NO 4BR0A 1Q9YA 3K59A 4J2AA 4CBUA 3CCLN 4JK8A 4JI2K 3VEXA 2DPNA 2IVNA 1GOAA 2BANA 2D0OA 2OPQA 3AGKA 4CHQA 1NJWA 4M3XA 3CD6N 3OBYA 3ZSYA 5AQMA 4CVNE 3KLFA 2HBMA 3VF2A 3LWMA 1RBSA 2HHSA 1JLFA 3MN7A 4DTMA 1W97L 4J2DA 5HROA 3I8DA 2NLXA 4W5TA 4AHUA 1ATNA 1U6ZA 4JD2A 2O8EB 1RDWX 5KPTA 1XNQK 1U47A 5AQZA 2QWMA 3V1QA 1S22A 1U48A 4NXMK 2Q3SA 5LMUK 2ATQA 4FPAA 5C25A 3VQPA 3O5BA 5AQXA 4IG0A 1WLJA 3QO9A 4DR4K 1K8AO 4DV7K 1VQ8N 3BF1A 2HF4A 3OYBA 1WSIA 2GTDA 1ASUA 4FJHA 3VQDA 2OTLN 3AO1A 4Q0BA 5JS1A 4LSNA 5AQWA 3WQUA 5HRPA 3EKUA 1ZBFA 4CECA 5HL7L 1RT5A 4CE9A 2FBXA 2OA8A 3ID8A 4FM0A 1O13A 3H3OB 5DK5A 2YCHA 3LDQA 2YJFA 1RBUA 3LZJA 1XNRK 1EX4A 4FYDA 4FJ9A 4H0OA 4IDHA 1QQOA 3DRSA 4CERA 3FFIA 3F2KA 2Z1JA 2YHWA 3DLBA 4BRGA 4BDZA 3VQ5A 1S3XA 3P5JA 4CGIA 3V9XA 3CJBA 1T6DA 3I0RA 3C6UA 1GLFO 5AQOA 3E9LA 4FLXA 3PLAA 4DQSA 3ZETB 1NWKA 3DLRA 3QEWA 4B3RK 4CZHA 4CJLA 4DFMA 1QZ6A 1D5AA 1G15A 3EE9A 3NBPA 1IBMK 5GINA 3BY5A 4BECA 4CZIA 3SI6A 1Z6RA 1BA0A 4J8FA 2GX9A 2P9PB 1VQPN 4JI7K 1NGFA 3C7NB 2F7TA 4LF9K 4GW6A 3AVNA 3BEXA 4TSXA 4RW8A 2WBNA 3S41A 2F96A 1GOCA 1ILYA 3HVRA 2HVHA 4BRIA 4BRFA 4JS5A 1W2BM 3VEVA 2DTUA 4JYAK 5EXWA 3H45C 3WEEA 2KFNA 4DR6K 4DFJA 1NGGA 2HHHK 4H4OA 1B9DA 1R0AA 2ITGA 3A5MC 5JVHL 5CZ1A 3LL3A 4OGCA 1EKEA 3O3GA 4IEIA 3SQ0A 1YT3A 4JI0K 5AFUH 1TKTA 4HWIA 3N4PA 4ELVA 2O8DA 4FJGA 4B9QA 3L2QA 3GE1A 1W9HA 5AQGA 4BRHA 1V4SA 4BRNA 2QI2A 5C2DA 5AQQA 4JLHA 2IIRA 3AVAA 3HL8A 4FWNA 2XY8A 3QIOA 3K58A 3M8QA 1T7PA 3CCQN 1VSFA 3B8AX 5BREA 3C65A 4IDKA 2VWKA 4BDPA 3O80A 4HCCA 2P9UA 3FGUA 4KH6A 3KLEA 1KVCA 4H0XB 3E1YA 3BUZB 4NCGA 2JWKA 3P39A 2R7YA 4FW1A 3IUCA 1EWRA 3ALYA 4H5VA 4EP4A 3CYGA 4M7YA 3WXKA 2A1RA 3C0BA 1N36K 5BN9A 1WB9A 1JL1A 3KHYA 3L0QA 5EU7A 3V9WA 5GAEP 2YJEA 3HI0A 2VG7A 4DFKA 3MCPA 1YIJN 3K5OA 4Z4EA 3R9PA 3CCUN 3VENA 2I7PA 2RN2A 3DRPA 3MAQA 4OLAA 2W42A 1S1XA 2NNWA 3M1FA 1YITN 1J53A 3ZLJA 1DLOA 2HBJA 3I33A 3HYFA 2VCPA 2ZJPL 4IJAA 4IG3A 4M3ZA 4KB0A 1HLUA 1RDCA 2ZGZA 3CCMN 4I9LA 3EO3A 4CIGA 2O8CB 4BQLA 4WF9L 4H5NA 4CGGA 4BACA 3FZMA 3SNNA 4M3TA 2IC3A 1DEJA 3NCIA 3AVKA 3EN9A 3HPOA 1IV0A 4DF8A 1ZBHA 3E01A 3KJVA 3A5NC 4O0IA 3QEVA 4AM7A 1T6CA 3CMEN 3TABA 2GUIA 1VSLA 4CHZA 1NK0A 2WUSA 1X1PA 3VPZA 4FSVA 3SK3A 2RKIA 2W00A 3SV4A 3IKMA 4BVPA 4DR2K 3HJFA 1ZBSA 1YJWN 3NE6A 4DFPA 3DJCA 4O0JA 3KD5E 4E1JA 3T1AA 2F8SA 4CHPA 1Q7YO 4IOAL 3DXMB 5KGXA 2P9LB 4CFAA 3OYJA 3THWA 1NOYA 4CIFA 1YTAA 4DU1A 3MXMA 2ZGYA 4LFAK 4PA1A 1K6YA 2D0PA 4FJIA 4H5RA 4QOZB 4XH1A 1NGJA 3HK2A 1ZXOA 4BE2A 1I3AA 4E1MA 3S3NA 4FJ7A 4BQZA 4CJEA 1JXEA 4FOIA 1D4XA 2Q97A 4FOEA 3R3LA 1LOTB 3OBWA 4BRKA 3H1QA 2I5JA 3QBWA 4FO0A 1B92A 2P9NB 3B6PA 1CLQA 1NK7A 4LF6K 3FFKB 2EX3A 1DTTA 1WSFA 1RT7A 3PX4A 1KVBA 1VQON 2Z1HA 2WFBA 2XHBA 5IT9O 1JCEA 4AHTA 3NMUA 3CF5L 3OYMA 4W5RA 3DWLA 3OW2M 3QIPA 1XMOK 3CM5A 4MLEA 4PKIA 4BE7B 2QM1A 3VQBA 3P31A 3O08A 1J5OA 1VQ6N 2IDOA 3DLEA 3C6AA 3AVLA 3SJHA 5KRSA 1WBDA 3KWIA 3V6DA 3TWHA 4BEBA 4E1NA 1NJYA 1OVYA 3AGRA 3V1RA 5C42A 1FJGK 3TTCA 1B9FA 3WNGA 4X64K 3LP1A 1GOBA 3ZT0A 3RWUA 2KZZA 5DM7L 1RDAA 3MN5A 2OTJN 3AVFA 3THVA 5HP1A 1XUPO 3VQEA 1RBVA 2NRRA 5KRTA 3ZEUB 4JS4A 4CF1A 2UUCK 3O1BA 4NLBA 2YNFA 2QXLA 3TTFA 4CZKA 1QHTA 4B1VA 3K5LA 1Y97A 4DV4K 2P9KA 1O1WA 1A5WA 1V4TA 5KGWA 2CGJA 2C1GA 1RT3A 4I7FA 4F4KA 1NGIA 4C8LA 1U2VB 2W6LA 1TGOA 3GL1A 2F8TA 4RW9A 3H08A 2GEMA 3U4LA 3HTVA 4YOWA 1FKPA 3O9UA 4DR5K 4FLYA 1TAUA 2VG5A 3CC7N 4N47A 2JLEA 3AO4A 3VF4A 3DLHA 3T1HK 2P9LA 4CJWA 4FWPA 1W7AA 4XH4A 3OYGA 2VQEK 4PKGA 1QVGM 2D4WA 2ASPA 4JD2B 3K5MA 2NZTA 4LH4A 4KV8A 4K25A 4JNEA 4K43A 2YNGA 4JEPA 1K8KA 2HNDA 2JWLA 3E9OA 1NU0A 3V9UA 1BGXT 1UA0A 4U7BA 4EZ6A 1NG9A 3K9JA 3ZSWA 3VQ9A 4KO0A 1JL2A 4ISGA 3FZLA 3SPYA 1N34K 3TSQA 3U3GA 2ASOA 4BWMA 1BG3A 3QICA 4BR9A 4CEBA 1NKCA 2PY5A 3GDQA 2B4JA 3CCJN 5FLXO 2FBYA 1YAGA 3HSTB 4DV2K 4BDYA 1T03A 4MFBA 2ZQBA 4NXNK 3DOKA 5FPNA 3KTQA 2UXBK 1JLQA 2Q0UA 4R79A 2OCEA 4IBNA 3RRHA 3QMLA 4GV3A 1FKOA 3CJAA 3PSIA 5HRSA 1HKBA 3CJ1A 1TUYA 3AARA 2DFHA 4Z4GA 2O4GA 1NJXA 3HO1A 1TYQB 4FVMA 3S5TA 4KREA 3DLLL 1NGAA 3TPQA 4JRQA 4CJPA 5FPMA 2NRWA 3HBTA 3DM2A 1BO5O 5GIOA 1QQCA 2VQFK 3UKUB 4K8XA 2G8FA 3F9MA 3OS2A 1Q82O 4LFCK 2YHXA 4BRCA 4CIEA 5AQVA 3MN9A 2D0BA 4AHVA 3J7ZO 3AAPA 5FRNA 3LPTA 1BIUA 2FBVA 3MCAB 3R8EA 2NRXA 2VGNA 4C1NK 1EWQA 5AZIB 3IMXA 1D8YA 3LZIA 5JVGL 1ZBLA 2YHBA 3ID6A 4FZXC 4B9MA 1RCHA 1IBLK 5GIPA 1VQNN 1RBRA 4Z4CA 3M3ZA 1YVUA 4YY3K 3TSPA 3IDHA 5TKYA 3A0IX 2FF6A 1HR0K 3FZKA 4CJ7A 2HB5A 2E4LA 4E7LA 3PV8A 3NAEA 2CGKA 4F8RA 5CZ2A 4CEZA 4Q5VA 1BUPA 4FZZA 1Z25A 1IG8A 4B8AB 4BE0A 4DTPA 2JGUA 4FL9A 2H3GX 2KKZA 4KHQA 4KBOA 2NRVA 1G99A 4BR2A 1ITGA 3JAMO 2FLOA 4DTJA 1DT9A 2HNYA 4JKBA 5DM6L 2I7NA 4ID1A 2XO7A 3F73A 1WBBA 2YNHA 1S6PA 4PL8A 1E3MA 5JICA 3ATVA 4C8MA 3TAFA 1VSEA 2RHKA 3PO5A 4BC4A 2FF3B 3AVBA 3DI6A 4ZTFA 1VSMA 4K0KK 4IWVA 4QCLA 4DS4A 4DCHA 4HCBA 3M8PA 5HLFA 3E66A 4JKAA 3SUPA 4CK3A 1U04A 3EE8A 3PIPL 5K14A 1BISA 1LW0A 2DFFA 2YX6A 3SMSA 4J2EA 1ZBUA 1HNZK 4B1ZA 1HKGA 4LFBK 1RTDA 3QERA 1DKGD 5LMNK 4FLTA 1VSJA 3NF8A 5M1KA 5AZJB 4WQ5A 3QB0A 1L5UA 3FLCO 3L2VA 4IOCL 2HSTA 1XMQK 3KIOA 1BU6O 5DMRA 4M45A 3CFOA 1S5JA 2OPSA 4AQYK 1RTJA 3OYEA 1NGBA 3KK3A 1S1VA 3HZ6A 4QS9A 4CEQA 1E4FT 4ISEA 4CJQA 4NCBA 4F3TA 2QWRA 3CIPA 3VQ7A 2HW3A 3NDKA 2J4RA 2RF2A 1WSEA 3QDKA 4O5BA 2CGLA 3WXIA 3ZT2A 1E4GT 3SYZA 2RPIA 1S1TA 3SV3A 1VQKN 2P9IA 3KWGA 5M1FA 4AM6A 1ESVA 2GUPA 3S3MA 4H5TA 4R5PA 4JKDA 3SLCA 2P9KB 3F9KA 3LP0A 1JJ2M 1TAQA 4CK2A 3R6MA 1HNWK 3AVHA 3DLKA 3C94A 5D3GA 1Q81O 1BOTO 3QNOA 4BRDA 3DXMA 4QS8A 4DV6K 1XHXA 1JLEA 2QWOA 4JKCA 4H0TB 1K73O 2ASMA 1HKCA 1VSKA 4O8UA 4I2QA 1U45A 4AHCA 1NK6A 1L3SA 4Z0UA 4ELTA 3L2RA 3VMFB 3W3DA 2NUBA 1RDDA 4F2SA 4WFBL 1YHQN 3VQCA 4CBWA 5AQKA 5SZTA 2OZSA 5M1QA 4BRPA 2QA4N 3F5TA 2WTUA 3JXUA 4A57A 5FRMA 4DWIA 2P9NA 4DTSA 1L3VA 1T3VA 2HF3A 4L3QA 3MX2A 3OY9A 1KTQA 5EX5A 3PX0A 1VQMN 4M3YA 3WXLA 4LC9B 1NGHA 1C6VA 4FLWA 4Z4FA 2X78A 4CEDA 4O5FA 4FM1A 4OLBA 2E8AA 4KTQA 4KKOA 3VA3A 3MWPA 4M7XA 3O1WA 4F2RA 3HOTA 2F9TA 2BUPA 3HM8A 4MO5A 3ENHA 1KC8O 2ZJQL 5BRHA 2W6KA 3AVIA 3ZSQA 2UYTA 1TUUA 4RG8A 4LY7A 4DSJA 4EZ9A 3EYZA 3HXMA 5F2RA 4RCHA 3THXB 1KFSA 3PY8A 5B8HA 5AQHA 1X9SA 2OPRA 3AAQA 3G25A 3CCVN 2G8VA 4RW4A 2X6NA 4CF9A 4FM2A 4K42A 4BG8A 5AQLA 3IG1A 3RMDA 1TVRA 3SPZA 4ZTJA 5GAHP 4XJXA 1BL3A 1BWFO 4M3RA 3HRGA 4UY8O 4BRQA 5H1SQ 3G0ZA 5ADXA 4I6MB 3L8BA 4B9SA 4LF5K 2ZJRL 4H0PA 1RT1A 3ZT3A 3MEGA 4CF2A 1HYVA 5CYQA 4H03B 3LP3A 2ZF5O 1VQ5N 1U4BA 2ETJA 4JK7A 3KLGA 3P83D 4ZHRA 4JV5K 4ILJA 5AQJA 3MWTA 3OS0A 5I42A 3RMAA 1IKXA 1VSDA 1OH5A 4BC3A 1NGEA 2UXCK 1TKZA 4FLZA 3HT3A 1K8KB 4CJKA 1QQNA 4GVMA 4LD0A 5C10A 4L8RB 1TKDA 5KPRA 5C15A 3VGKA 5FPEA 1RDUA 4JK9A 3NGIA 4B9UA 1YI2N 3SQ2A 3MEDA 3GOIA 2B5JA 3HM9A 2F9WA 2PYLA 1Y64A 3OYAA 4DU4A 4YOXA 3C6TA 1HMVA 1FW6A 1ATRA 3CMAN 1LAVA 1IKYA 3O6WA 1S9EA 2IVOA 4CJRA 4GV9A 5AQYA 3ENBA 1HNIA 3AO5A 4AHSA 1LWCA 1RT4A 1WAJA 1C0UA 4JI8K 1KAZA 3CYMA 3U6FA 3EKSA 3QFPA 1SKWA 4DQRA 3NGZA 4KHYA 4B3OA 4EAHD 3LDNA 4MO4A 3RTVA 3TAEA 4K41A 1HJRA 3FR0A 3CHWA 3PO4A 5LY3A 3EL2A 3Q7BA 1R59O 1UOCA 4HTLA 4GKKK 1UWBA 3CFRA 4HHTA 4KAZA 3V81A 2KHOA 3TR8A 3LWLA 4BE1A 4E7IA 3WXMB 5J2NA 5EOYA 3SJJA 3CI5A 3HPHA 1JLBA 3WQTA 3QINA 4XH5A 4E0DA 2HBKA 3HSCA 4CJ5A 2BTFA 1CZBA 1JCGA 4BR5A 4WQ4A 4ELUA 1WSGA 4LH5A 2KZMA 1VRTA 2A6AA 4FJJA 3L3VA 2KTQA 4EIAA 4YDUC 4BY9C 3UKUA 3D2FB 3PSFA 4HUGA 4IO8A 3O9QA 3IS9A 2P9SA 4E72A 2E1ZA 3MECA 1FXXA 3CQ8A 5HRNA 3V9SA 3OYHA 3K2PA 2O8BA 3H1VX 3O4WA 3FE1A 4E7JA 3VESA 1TK0A 1EP4A 2HHQA 1XI1A 5A2QO 1RT2A 4X66K 3WUHA 2GBZA 1TK8A 1YTUA 3CERA 1BQMA 3U8XA 1VQ9N 1N32K 3N4QA 4OKEA 1UAXA 4B3TK 3VGLA 3D2EA 3W0LA 4B1YB 1ZYQA 4DR3K 3KD1E 5CHIA 3L3UA 4IZ9A 3NVKA 1DGKN 5JS2A 2Q2RA 4ICLA 2ITMA 1NOZA 2O4IA 3K5NA 5GADP 1ASWA 3RR8A 5ADXH 3AA4A 1MDUB 4FLUA 2YKNA 1BDGA 4H4MA 4M42A 1RTIA 4H8KA 2F4VK 1NGCA 1BIZA 4DSFA 1OH7A 2QKKA 1X9JA 3SAFA 4B9LA 2OPPA 1H1VA 5C24A 4OPKA 4OPAA 2YKMA 3KKSA 3EZWA 3OS1A 4FVUA 2Z1GA 2FBTA 2IS3A 3GBTA 1N8RO 4CI6A 3ZCMA 4JI4K 3TSUA 3VEZA 3S9HA 4A59A 5CYMA 1SL0A 3G71N 1JKHA 5CE3A 1HNXK 1VQ4N 5BPNA 4RWTA 3DLGA 3V9ZA 2AP1A 2FSJA 3PUFA 3FZHA 3ULEA 1SZ2A 4BREA 2W41A 1GLBG 3CJ7A 4JHDB 2PAVA 4DTRA 1EQYA 3R1XA 1X9MA 4J2BA 3ATUA 4FJNA 4Z4HA 3Q7CA 5AZJA 3CC4N 3ZX2A 2EWSA 4AILC 1IJJA 1P8ZA 1RT6A 4CHYA 2Z1IA 4KFBA 4DHYA 2OZMA 4PY5A 4CHNA 1GLEG 1KAXA 1TKXA 3VEOA 1M1KO 5ELZA 2QXFA 1T44A 3T3FA 4YOYA 3LAKA 3CFPA 4CJFA 3LDLA 1VHXA 3MK6A 4NYNA 1QHAA 3J8AA 1OKJA 3UE5A 4C1NI 1YUWA 2YNIA 3CPWM 2XRIA 1KFDA 4KH4A 4CK1A 3ZX3A 1T05A 4KHSA 4CF0A 2B6AA 3BDPA 1GLCG 2W40A 1S1UA 2E2QA 4LF7K 5JLFA 5FPDA 4I2PA 5AR0A 1EO1A 2O8FB 1LV5A 4B1UB 3T19A 4CEOA 4DSIA 2GWKA 3UB5A 1X3MA 2EHGA 4IFYA 5BRDA 5KQ8A 4B1WB 3HVTA 1C1AA 5JLHA 4X62K 3LALA 1HQUA 4CZLA 3UIQA 4N41A 2E5LK 1QVFM 4MDBA 1RNHA 3CM6A 2IOCA 3VOVA 1DTQA 3VEYA 4Y1CA 1HYZA 1L3TA 4BRMA 5BN8A 3A2FA 3O9TA 1A5VA 5AQNA 4JI6K 3JSMA 3RMBA 1JLAA 3CQXA 3RMCA 3J81O 2KW4A 1J6ZA 4DQPA 3L6QA 1MWKA 4KB1A 4G9ZA 4KTWA 1IKVA 4FW2A 3G4SN 4JI3K 3DYAA 4HUFA 4CJSA 2ZM6K 1NKEA 2ZE2A 2KLAA 2XY7A 2HVIA 1IKWA 5T7BA 1GLJO 3NH2A 2CH5A 3U9ZA 4W5QA 2OYQA 4NYFA 4NLCA 1QSYA 2E88A 3OYFA 3J7YP 3O4QA 1NK4A 3T69A 3K9KA 1QTMA 2VG6A 3VQ8A 3M8SA 4KHUA 5AQPA 5HOOA 4DTNA 3JYTA 4WE1A 1C1BA 3VERA 1JLCA 1K9MO 4F3OA 4ID5A 3I8BA 1FK9A 1SUQA 4CZGA 3IFRA 1XHZA 4Y1DA 3P4IA 4LSLA 5J1EA 4CZEA 2Q36A 5E41A 3VGMA 2NRZA 3KLIA 1Q86O 4FJLA 3THXA 3CJ9A 2E6MA 3AA3A 2A5XA 1N5YA 4B8CA 1P90A 4M3WA 2YV0X 4O4GA 2HOEA 4IEEA 4BGAA 2G8IA 3S3OA 3T1YK 2O8FA 1NMDA 5AQTA 2QEXN 2GWJA 3VTHA 4CD3A 1I94K 4AF1A 4ISFA 3CXCM 3D7EO 4H5WA 2HHWA 4HUEA 4DQQA 3OYLA 3FZFA 4DSEA 4JI1K 2V7ZA 3D2FA 3VQ4A 2BH1A 3NF7A 5EY4A 4GKJK 1SAZA 4PUOA 2GELA 4CZFA 5F1XA 4DF4A 4PHTX 2A42A 4E3SA 2G8UA 1CZAN 4BR4A 4CJVA 5AJ3K 3WXJA 3A5OC 2FC0A 3EZ5A 4IKFA 5EVZA 3KZBA 4CGHA 5I3UA 4E7HA 4GMJB 2O8CA 3E9PA 3O9RA 3VETA 4H0YB 2AJQA 1S1WA 2P9IB 4HTUA 2PYJA 4BRAA 5GAGP 4A5BA 3ITHA 3VQQA 1X9WA 4Z94A 2AA4A 3RR7A 1JXBA 1TL1A 3G10A 4B08A 4U67L 4JKGA 5HBMA 3QBXA 4CJTA 3G6EN 4CD1A 4FCYA 1BQNA 2IGIA 3RSEA 3AVJA 3MXJA 1YXQA 3MDQA 1XC9A 1KQSM 3QEPA 1KD1O 4OGEA 4JKHA 4FWOA 4N5SA 3B6OA 3NFAA 4AHRA 1UA1A 4CJUA 3AV9A 3V1OA 1WSJA 5HRRA 3O4NA 4MDAA 4PL7A 4EHTA 4UQGA 1BCOA 1T8EA 3PX6A 4RW7A 1MWMA 4A5AA 1QSSA 1Q18A 3DMJA 2HMIA 4BC5A 2E2NA 2BDPA 4WYBA 4FWKA 3U9DA 4KH5A 4CFCA 1TK5A 2Y1IA 3VN5A 3M6GA 4FWMA 5J2PA 4E7KA 4CJ4A 4EHUA 3NF6A 4DTUA 2A1SA 4DQ8A 2XY6A 2NRHA 3LDOA 1TYQA 4DUZK 3RRGA 4DV1K 3O3FA 3M8RA 3ULEB 2VWBA 4CCHA 4KHPK 3QLHA 4O44A 4QS7A 1D9FA 3O3HA 2KFZA 1TL3A 1VRUA 2D0AA 2P9SB 1KLNA 1CXUA 3ZETA 2Y1JA 2FXUA 4A2AA 1HUXA 2BE2A 4C8OA 4CFBA 4DSKA 4FK2A 1JLGA 4FWSA 1VQ7N 4OPHA 2E1YA 4DKWA 1SL1A 3T7ZA 5BR9A 1S72N 1YF5L 1SKRA 1GLLO 2D5RA 1RDBA 1ZC6A 2PFUA 5AQRA 4YDUA 4A2BA 2V51B 4KHNA 5KTQA 3HP9A 4NCAA 2QW9A 3OA9A 3SQ4A 3H46O 3QESA 4YFUA 3ZYYX 4JKGB 4OX9K 2HMPA 3L4QA 3WNHA 3EY1A 3THYA 3NH0A 3OJSA 3THWB 4G1QA 2P51A 5M1PA 3QEXA 4GVEA 1XC3A 3CPEA 5KI6A 4DTXA 1J9AA 4DUYK 4YOVA 4CESA 3EEQA 5LJWA 1VAZA 4C8KA 2V7YA 3ZT1A 5E84A 4O55A 4B9NA 1C0TA 4KI6A 2HHVA 1GLDG 2O8DB 1C0GA 2C1IA 5JENA 3BP8A 1C0FA 1U2VA 1HNVA
chains in the Genus database with same CATH topology
4OO1J 3WUHA 3CJAA 2GTDA 3CERA 1HKBA 3CJ1A 3U8XA 1VQ9N 1TUYA 3AARA 4WQ5C 1TYQB 3N4QA 5F0XA 3RVCA 3VGLA 3KVGA 3DLLL 2OTLN 1NGAA 3TPQA 5AQWA 3D2EA 3WQUA 3W0LA 3VTIA 3EKUA 5FPMA 2NRWA 3HBTA 4B1YB 1BO5O 5GIOA 4A61A 3UKUB 5HL7L 3F9MA 1Q82O 4Y0WA 3WT0A 3L4IA 2YHXA 5CHIA 4BRCA 4IZ9A 3NVKA 5AQVA 3MN9A 4M63C 3ID8A 3NVMA 4WQ4C 1O13A 1DGKN 3H3OB 3I56N 3J7ZO 3AAPA 2Q2RA 2YCHA 3LDQA 2ITMA 1JCFA 2YJFA 1X3NA 4O8KA 3MCAB 5GADP 3R8EA 2NRXA 3VF6A 5ADXH 2VGNA 4H0OA 4IDHA 4C1NK 1QQOA 2ZWHA 1MDUB 5AZIB 3F2KA 3IMXA 3BF3A 2YHWA 4BRGA 5JVGL 1BDGA 1NGCA 1S3XA 3ID6A 3CJBA 1T6DA 3JS6A 1GLFO 4JHDA 1X9JA 5AQOA 5GIPA 1M90O 3E9LA 3SAFA 2PBDA 2CH6A 5AFUA 1VQNN 4BR7A 2QWPA 3PLAA 1H1VA 3M3ZA 4IFEA 3TSPA 3ZETB 1NWKA 4OPAA 3IDHA 5TKYA 4CZHA 3A0IX 1QZ6A 3EE9A 4PKHA 3EZWA 5GINA 4FVUA 2FF6A 3FZKA 4CJ7A 4BECA 3GBTA 4CZIA 1N8RO 4CI6A 4IOXA 1Z6RA 1BA0A 4J8FA 2GX9A 3TSUA 2P9PB 3VEZA 1VQPN 1NJIO 4A59A 2CGKA 1NGFA 3G71N 3C7NB 1BUPA 2F7TA 2QTDA 3A5LC 5CE3A 1IG8A 1VQ4N 3BEXA 3UKRB 2WBNA 4C23A 3S41A 5BPNA 4RWTA 1ILYA 4RTFD 1XQSC 2AP1A 2FSJA 4FL9A 3FZHA 3ULEA 4YOTA 1SZ2A 4BRIA 4BRFA 4BREA 2W41A 2H3GX 3CJ7A 1GLBG 2KKZA 4JHDB 2PAVA 3VEVA 1EQYA 3ENOA 3R1XA 5EXWA 5JMVA 1W2BM 3H45C 4KBOA 5TKWA 3WEEA 3TU5A 2NRVA 1G99A 3ATUA 4NO7A 5MLCQ 3Q7CA 1NGGA 4BR2A 5AZJA 3CC4N 5C0YA 2FLOA 3SAHA 1DT9A 3ZX2A 3A5MC 4JKBA 2I7NA 3AY9A 5DM6L 5JVHL 2EWSA 3LL3A 4PL8A 1IJJA 5JICA 3ATVA 1P8ZA 3DXKB 4DHYA 4IEIA 3GG4A 5AFUH 2RHKA 3SBGA 4HWIA 1GLEG 3N4PA 2FF3B 4BC4A 1KAXA 3VEOA 1M1KO 5ELZA 1T44A 2A3ZA 4IWVA 1HPMA 2Q0RA 4YOYA 4B9QA 4MLHA 3LDLA 3GE1A 4DCHA 3MK6A 3KK7A 1QHAA 3J8AA 1OKJA 3E66A 4FWQA 4JKAA 5AQGA 3UE5A 4BRHA 4C1NI 3EE8A 1V4SA 4BRNA 2QI2A 3PIPL 5C12A 1NBWA 5C2DA 2YX6A 5M1NA 3SMSA 5AQQA 1YUWA 4B1ZA 2IIRA 3CPWM 4BRLA 1HKGA 4KH4A 4FWNA 3ZX3A 1VQLN 5AZIA 1DKGD 3CCQN 2FSNA 3O8MA 3B8AX 5CR4A 5BREA 1GLCG 3C6HA 2W40A 3C65A 2E2QA 3QFUA 5M1KA 5AZJB 5JLFA 5FPDA 4WQ5A 3QB0A 5AR0A 3O80A 2VYPA 3FLCO 1EO1A 4B1UB 2P9UA 3CETA 3FGUA 4KH6A 4IOCL 2GWKA 2HSTA 4H0XB 3E1YA 3BUZB 1BU6O 2IVPA 3UB5A 3CCRN 2JWKA 1X3MA 5BRDA 3P39A 5KQ8A 4B1WB 5JLHA 4YORA 3IUCA 5KPZA 4CZLA 3CCEN 4H5VA 4M7YA 1NGBA 3WXKA 3C0BA 3VEWA 4MDBA 5BN9A 3CQYA 3HZ6A 4QS9A 3WEEB 1QVFM 4GV6A 3RSEB 3KHYA 4XEIA 1E4FT 3L0QA 3PIOL 3VOVA 4ISEA 3VEYA 1BA1A 2QWRA 5GAEP 2YJEA 3HI0A 2OANA 3CIPA 4BRMA 3MCPA 5BN8A 1YIJN 2J4RA 3A8YA 3O9TA 3QDKA 4YOUA 3WXIA 2CGLA 5M1OA 3R9PA 5AQNA 1E4GT 2A41A 3VENA 3CCUN 2I7PA 4BGBA 4FWRA 3M1FA 2NNWA 3CQXA 1VQKN 1YITN 2P9IA 3KWGA 5M1FA 4AM6A 3HOSA 1ESVA 2GUPA 2P9UB 2HBJA 1J6ZA 4H5TA 3CJCA 3I55N 3I33A 4JKDA 3SLCA 3CCSN 2E20A 2VCPA 2P9KB 3OHRA 1ATSA 2FSKA 4BVOA 4JN4A 4F9OA 4IJAA 2ZJPL 3L6QA 1MWKA 4JKFA 1JJ2M 4G9ZA 3R6MA 3G4SN 1HLUA 2ZGZA 3CCMN 4IO9L 3EO3A 1Q81O 1BOTO 4BQLA 4WF9L 4H5NA 2KLAA 3DXMA 4BRDA 2QWNA 4QS8A 1GLJO 3FZMA 4IXCA 2CH5A 4IJNA 3U9ZA 2QWOA 4JKCA 1DEJA 4H0TB 4NLCA 1K73O 2E88A 2ASMA 1HKCA 3D6RA 4I6MA 3EN9A 3T69A 3UKRA 3K9KA 4O8UA 3A5NC 5AQPA 5HOOA 4AM7A 1T6CA 3CMEN 3VERA 3VMFB 3W3DA 1K9MO 2YI1A 1SS6A 2WUSA 3I8BA 4WFBL 1YHQN 3VPZA 4FSVA 4A62A 3SK3A 4CBWA 5BPLA 4CZGA 2W00A 5AQKA 3IKMA 3IFRA 5M1QA 4BRPA 2QA4N 4BVPA 3P4IA 3SBTA 3F5TA 1ZBSA 3TTDA 3JXUA 2Q36A 4A57A 4CZEA 3DXKA 3VGMA 1YJWN 2NRZA 1Q86O 5AQFA 3DJCA 1SQKA 2P9NA 4CBXA 2WC9A 4E1JA 3CJ9A 3C7NA 1T3VA 2HF3A 4L3QA 2A5XA 1Q7YO 3MX2A 4IOAL 3DXMB 1P90A 2P9LB 5EX5A 1VQMN 3WXLA 4LC9B 1NGHA 2ZGYA 2HOEA 4IEEA 4BGAA 1YVNA 4B1XB 1NMDA 4O5FA 5AQTA 2QEXN 2GWJA 2E8AA 3VTHA 2D0PA 4CD3A 3MWPA 3H6EA 4H5RA 4M7XA 4XH1A 1NGJA 4ISFA 3O1WA 4AF1A 3HOTA 1YJNN 5AQSA 1ZXOA 3CXCM 1WOQA 2F9TA 2BUPA 3D7EO 2A40A 4H5WA 3HM8A 1RFQA 4MO5A 1RGIA 3ENHA 1NLVA 3FZFA 5AQIA 5KQDA 1KC8O 2ZJQL 4BQZA 2E2PA 2V7ZA 5BRHA 2Q1NA 3D2FA 2BH1A 4FOIA 5EY4A 3ZX0A 1SAZA 2GELA 1D4XA 1TUUA 2UYTA 2Q97A 4FOEA 4CZFA 5F1XA 3R3LA 4PHTX 1LOTB 3SMPA 3OBWA 4BRKA 2A42A 3H1QA 3QBWA 1CZAN 5F2RA 4FO0A 3LDPA 2P9NB 4RCHA 4BG9A 4BR4A 5B8HA 5BPMA 5AQHA 3WXJA 3FFKB 3A5OC 4ILHA 5EVZA 1VQON 3AAQA 2WFBA 3KZBA 3G25A 3O9SA 3CCVN 1MA9B 1JCEA 1YJ9N 3NMUA 3CF5L 3DWLA 3OW2M 1NM1A 3M5RA 4JAXA 4K42A 3E9PA 3O9RA 5AQLA 4H0YB 3VETA 4BG8A 5I9EB 2P9IB 5GAHP 4NB4A 4BRAA 1KAYA 5C2FA 4MLEA 4XJXA 4PKIA 4BE7B 5GAGP 1BWFO 1KXPA 2QM1A 3P31A 4A5BA 3O08A 3HRGA 4WFNL 4UY8O 4Z94A 2AA4A 4BRQA 5H1SQ 1VQ6N 5ADXA 3MMVA 4I6MB 3C6AA 4U67L 3LM2A 3SJHA 4JKGA 2RE2A 4H0PA 2ZJRL 3KWIA 3QBXA 4BEBA 3G6EN 1OVYA 3AGRA 2E2OA 4FPBA 4H03B 4CD1A 2ZF5O 1VQ5N 4JK7A 3RSEA 3TTCA 4ILJA 1YXQA 5AQJA 4GY2B 3MWTA 3MDQA 1KQSM 1KD1O 5BRFA 5DM7L 2HBLA 1QQMA 3MN6A 4JKHA 4FWOA 3MN5A 3P38A 2OTJN 4BC3A 1NGEA 1HJOA 1GLAG 2QWQA 1K8KB 1NGDA 1XUPO 4MDAA 4PL7A 4EHTA 1QQNA 4WCEL 2NRRA 3ZEUB 3O1BA 4FWLA 1MWMA 2Q31A 2VGMA 5C10A 4A5AA 2QWLA 5KPRA 4NLBA 3VGKA 5C15A 1RDUA 5FPEA 1Q18A 4JK9A 2QXLA 4WFAL 3TTFA 4BC5A 4CZKA 2E2NA 4WYBA 1YI2N 4FWKA 4B1VA 3U9DA 3GOIA 4KH5A 2P9KA 4DB3A 3CC2N 1V4TA 2F9WA 2CGJA 1LCUA 2C1GA 4ILGB 1Y64A 2D1KA 3M6GA 4FWMA 1NGIA 1HX1A 1U2VB 5LJVA 4EHUA 4YOXA 1ATRA 3MX5A 3CMAN 4DQ8A 3O6WA 2NRHA 2IVOA 3GL1A 5E26A 4CZMA 3LDOA 5AQUA 1TYQA 3LM9A 4BROA 5AQYA 2GEMA 3U4LA 4GV9A 3ENBA 3HTVA 4YOWA 3O9UA 3DAWA 3CC7N 3D2EB 2NRTA 3ULEB 2VWBA 3VF4A 2P9LA 1KAZA 4BC2A 4CZJA 4JKEA 3ZEUA 3EKSA 4FWPA 4GNIA 3QFPA 4XH4A 1WUAA 3SAGA 1Z05A 4PKGA 2V52B 4QS7A 2YHYA 1QVGM 4EAHD 1QZ5A 2D4WA 2ASPA 3LDNA 4EFHA 4JD2B 4MO4A 2NZTA 4H0VB 4K41A 3FR0A 3H3NO 2P9PA 4BR0A 3CHWA 2P9SB 4K25A 4JNEA 3ZETA 4K43A 2FXUA 4A2AA 1HUXA 4CBUA 3CCLN 5LY3A 3EL2A 1K8KA 3Q7BA 1R59O 2DPNA 4HTLA 4JK8A 2IVNA 2JWLA 4JEPA 3E9OA 3VEXA 2D0OA 4U7BA 2KHOA 4FWSA 3AGKA 1VQ7N 4OPHA 2E1YA 3WXMB 5EOYA 4DKWA 3T7ZA 5BR9A 3CI5A 1S72N 3CD6N 1YF5L 3OBYA 1GLLO 1ZC6A 2PFUA 5AQRA 3WQTA 4YDUA 4XH5A 2HBKA 3K9JA 4A2BA 5AQMA 2V51B 4ISGA 3FZLA 2HBMA 3HSCA 2BTFA 3TSQA 1JCGA 2ASOA 2QW9A 4BR5A 3OA9A 4WQ4A 3VF2A 3H46O 3ZYYX 4JKGB 1BG3A 3QICA 3MN7A 4BR9A 2A6AA 2HMPA 3L4QA 1W97L 2NLXA 4EIAA 1ATNA 3GDQA 3CCJN 4YDUC 5M1PA 4BY9C 1U6ZA 4JD2A 3UKUA 3D2FB 1YAGA 4IO8A 1RDWX 1XC3A 4GVEA 5KPTA 3CPEA 3O9QA 2P9SA 2E1ZA 5AQZA 4YOVA 2QWMA 1S22A 5LJWA 1VAZA 2V7YA 5FPNA 2Q0UA 5E84A 4FPAA 4R79A 3H1VX 3O4WA 3FE1A 3VESA 3O5BA 5AQXA 1GLDG 1C0GA 2C1IA 3QMLA 1K8AO 3BP8A 4GV3A 1VQ8N 1C0FA 1U2VA 3BF1A 2HF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WUH A;  3CJA A;  2GTD A;  3CER A;  1HKB A;  3CJ1 A;  3U8X A;  1TUY A;  3AAR A;  4WQ5 C;  1TYQ B;  5F0X A;  3VGL A;  3KVG A;  1NGA A;  3TPQ A;  5AQW A;  3D2E A;  3WQU A;  3W0L A;  3EKU A;  5FPM A;  4B1Y B;  3HBT A;  1BO5 O;  4A61 A;  3UKU B;  3F9M A;  4Y0W A;  3WT0 A;  3L4I A;  2YHX A;  4BRC A;  4IZ9 A;  5AQV A;  3MN9 A;  4M63 C;  3ID8 A;  4WQ4 C;  1DGK N;  3H3O B;  3AAP A;  2Q2R A;  2YCH A;  3LDQ A;  2ITM A;  1JCF A;  2YJF A;  1X3N A;  4O8K A;  3R8E A;  3VF6 A;  5ADX H;  4H0O A;  1QQO A;  2ZWH A;  1MDU B;  5AZI B;  3IMX A;  3BF3 A;  2YHW A;  4BRG A;  1BDG A;  1NGC A;  1S3X A;  3CJB A;  1T6D A;  3JS6 A;  1GLF O;  4JHD A;  1X9J A;  5AQO A;  2PBD A;  2CH6 A;  5AFU A;  4BR7 A;  2QWP A;  1H1V A;  3M3Z A;  3ZET B;  1NWK A;  3IDH A;  5TKY A;  4CZH A;  3A0I X;  1QZ6 A;  4PKH A;  3EZW A;  2FF6 A;  3FZK A;  4CJ7 A;  3GBT A;  4CZI A;  4CI6 A;  1Z6R A;  1BA0 A;  4J8F A;  3VEZ A;  2P9P B;  2CGK A;  1NGF A;  3C7N B;  1BUP A;  5CE3 A;  3A5L C;  1IG8 A;  3BEX A;  3UKR B;  4C23 A;  3S41 A;  5BPN A;  4RWT A;  4RTF D;  1XQS C;  2AP1 A;  2FSJ A;  4FL9 A;  3FZH A;  3ULE A;  1SZ2 A;  4BRI A;  4BRF A;  4BRE A;  2W41 A;  2H3G X;  1GLB G;  3CJ7 A;  4JHD B;  2PAV A;  3VEV A;  1EQY A;  3ENO A;  5EXW A;  5JMV A;  3H45 C;  4KBO A;  3WEE A;  3TU5 A;  1G99 A;  3ATU A;  4NO7 A;  4BR2 A;  1NGG A;  5AZJ A;  2FLO A;  3ZX2 A;  3A5M C;  2I7N A;  3AY9 A;  2EWS A;  3LL3 A;  4PL8 A;  1IJJ A;  5JIC A;  3ATV A;  1P8Z A;  3DXK B;  4DHY A;  3GG4 A;  5AFU H;  4HWI A;  1GLE G;  4BC4 A;  2FF3 B;  1KAX A;  3VEO A;  5ELZ A;  1T44 A;  2A3Z A;  4IWV A;  1HPM A;  2Q0R A;  4B9Q A;  4MLH A;  3LDL A;  3GE1 A;  4DCH A;  3MK6 A;  1QHA A;  3J8A A;  1OKJ A;  4FWQ A;  5AQG A;  3UE5 A;  4BRH A;  1V4S A;  4BRN A;  1NBW A;  3SMS A;  5AQQ A;  1YUW A;  4B1Z A;  2IIR A;  4BRL A;  1HKG A;  4FWN A;  3ZX3 A;  5AZI A;  1DKG D;  2FSN A;  3O8M A;  3B8A X;  5BRE A;  1GLC G;  2W40 A;  2E2Q A;  3QFU A;  5AZJ B;  5JLF A;  5FPD A;  4WQ5 A;  3QB0 A;  5AR0 A;  3O80 A;  2VYP A;  3FLC O;  4B1U B;  2P9U A;  3CET A;  3FGU A;  2GWK A;  4H0X B;  3BUZ B;  1BU6 O;  2IVP A;  3UB5 A;  1X3M A;  5BRD A;  5KQ8 A;  4B1W B;  5JLH A;  3IUC A;  5KPZ A;  4CZL A;  4H5V A;  4M7Y A;  1NGB A;  3WXK A;  3C0B A;  3VEW A;  5BN9 A;  3CQY A;  3HZ6 A;  4QS9 A;  3WEE B;  3RSE B;  3KHY A;  4XEI A;  1E4F T;  3L0Q A;  3VOV A;  4ISE A;  3VEY A;  1BA1 A;  2QWR A;  2YJE A;  3HI0 A;  2OAN A;  3CIP A;  4BRM A;  3MCP A;  5BN8 A;  2J4R A;  3A8Y A;  3QDK A;  3WXI A;  2CGL A;  3R9P A;  5AQN A;  1E4G T;  2A41 A;  3VEN A;  2I7P A;  4BGB A;  4FWR A;  3M1F A;  3CQX A;  2P9I A;  4AM6 A;  1ESV A;  2GUP A;  2P9U B;  1J6Z A;  4H5T A;  3CJC A;  3I33 A;  3SLC A;  2E20 A;  2VCP A;  2P9K B;  3OHR A;  1ATS A;  2FSK A;  4BVO A;  4JN4 A;  4F9O A;  4IJA A;  3L6Q A;  1MWK A;  3R6M A;  1HLU A;  2ZGZ A;  3EO3 A;  1BOT O;  4BQL A;  4H5N A;  4BRD A;  3DXM A;  2QWN A;  4QS8 A;  1GLJ O;  3FZM A;  4IXC A;  2CH5 A;  4IJN A;  3U9Z A;  2QWO A;  1DEJ A;  4H0T B;  2E88 A;  2ASM A;  1HKC A;  4I6M A;  3EN9 A;  3UKR A;  3A5N C;  5AQP A;  4AM7 A;  1T6C A;  3VER A;  3W3D A;  2YI1 A;  2WUS A;  3I8B A;  3VPZ A;  4FSV A;  4A62 A;  3SK3 A;  4CBW A;  5BPL A;  4CZG A;  5AQK A;  3IFR A;  4BRP A;  4BVP A;  3P4I A;  1ZBS A;  3JXU A;  2Q36 A;  4CZE A;  3DXK A;  3VGM A;  5AQF A;  3DJC A;  1SQK A;  2P9N A;  4CBX A;  4E1J A;  3CJ9 A;  3C7N A;  2HF3 A;  4L3Q A;  2A5X A;  3DXM B;  2P9L B;  5EX5 A;  3WXL A;  4LC9 B;  1NGH A;  2ZGY A;  2HOE A;  4BGA A;  1YVN A;  4B1X B;  1NMD A;  4O5F A;  5AQT A;  2GWJ A;  2E8A A;  2D0P A;  4CD3 A;  3H6E A;  4H5R A;  4M7X A;  4XH1 A;  1NGJ A;  4ISF A;  3O1W A;  5AQS A;  1ZXO A;  1WOQ A;  2F9T A;  2BUP A;  3D7E O;  2A40 A;  4H5W A;  3HM8 A;  1RFQ A;  4MO5 A;  1RGI A;  3ENH A;  1NLV A;  3FZF A;  5AQI A;  5KQD A;  4BQZ A;  2E2P A;  2V7Z A;  5BRH A;  2Q1N A;  3D2F A;  4FOI A;  5EY4 A;  3ZX0 A;  1SAZ A;  2GEL A;  1D4X A;  1TUU A;  2UYT A;  2Q97 A;  4FOE A;  4CZF A;  5F1X A;  1LOT B;  3SMP A;  4BRK A;  2A42 A;  3H1Q A;  3QBW A;  1CZA N;  5F2R A;  3LDP A;  4FO0 A;  2P9N B;  4RCH A;  4BG9 A;  4BR4 A;  5B8H A;  5BPM A;  5AQH A;  3WXJ A;  3FFK B;  3A5O C;  5EVZ A;  3AAQ A;  3KZB A;  3G25 A;  1MA9 B;  1JCE A;  3DWL A;  1NM1 A;  4K42 A;  4JAX A;  5AQL A;  4BG8 A;  3VET A;  5I9E B;  4H0Y B;  2P9I B;  4NB4 A;  4BRA A;  1KAY A;  4MLE A;  4PKI A;  1BWF O;  1KXP A;  2QM1 A;  3O08 A;  4Z94 A;  2AA4 A;  4BRQ A;  5ADX A;  3MMV A;  4I6M B;  3LM2 A;  3SJH A;  4H0P A;  3QBX A;  2E2O A;  4FPB A;  4H03 B;  4CD1 A;  2ZF5 O;  3RSE A;  1YXQ A;  5AQJ A;  4GY2 B;  3MDQ A;  5BRF A;  3MN6 A;  1QQM A;  4FWO A;  3MN5 A;  4BC3 A;  1NGE A;  1HJO A;  1GLA G;  2QWQ A;  1K8K B;  1NGD A;  1XUP O;  4PL7 A;  4EHT A;  1QQN A;  3ZEU B;  3O1B A;  4FWL A;  1MWM A;  2Q31 A;  2QWL A;  5KPR A;  5FPE A;  3VGK A;  1Q18 A;  2QXL A;  4BC5 A;  4CZK A;  2E2N A;  4WYB A;  4FWK A;  4B1V A;  3U9D A;  3GOI A;  2P9K A;  4DB3 A;  1V4T A;  2F9W A;  2CGJ A;  1LCU A;  1Y64 A;  2D1K A;  3M6G A;  4FWM A;  1NGI A;  1HX1 A;  1U2V B;  5LJV A;  4EHU A;  1ATR A;  4DQ8 A;  3O6W A;  2NRH A;  2IVO A;  3GL1 A;  5E26 A;  4CZM A;  3LDO A;  5AQU A;  1TYQ A;  3LM9 A;  4BRO A;  5AQY A;  2GEM A;  3U4L A;  3HTV A;  3DAW A;  3D2E B;  3VF4 A;  3ULE B;  2VWB A;  2P9L A;  1KAZ A;  4BC2 A;  4CZJ A;  3ZEU A;  3EKS A;  4FWP A;  4GNI A;  3QFP A;  4XH4 A;  1WUA A;  1Z05 A;  4PKG A;  2V52 B;  4QS7 A;  2YHY A;  4EAH D;  1QZ5 A;  2D4W A;  2ASP A;  3LDN A;  4EFH A;  4JD2 B;  4MO4 A;  2NZT A;  4H0V B;  4K41 A;  3FR0 A;  3H3N O;  2P9P A;  4BR0 A;  3CHW A;  2P9S B;  4K25 A;  4JNE A;  3ZET A;  4K43 A;  2FXU A;  4A2A A;  1HUX A;  4CBU A;  5LY3 A;  3EL2 A;  1K8K A;  1R59 O;  2DPN A;  4HTL A;  3VEX A;  2IVN A;  2D0O A;  2KHO A;  4FWS A;  2E1Y A;  5EOY A;  5BR9 A;  3CI5 A;  1GLL O;  1ZC6 A;  5AQR A;  3WQT A;  4YDU A;  4XH5 A;  4A2B A;  5AQM A;  2V51 B;  4ISG A;  3FZL A;  3HSC A;  2BTF A;  1JCG A;  2ASO A;  2QW9 A;  4BR5 A;  4WQ4 A;  3VF2 A;  3H46 O;  1BG3 A;  3QIC A;  3MN7 A;  4BR9 A;  2A6A A;  2HMP A;  2NLX A;  4EIA A;  3GDQ A;  1ATN A;  4YDU C;  1U6Z A;  4JD2 A;  3UKU A;  3D2F B;  1YAG A;  4IO8 A;  1RDW X;  1XC3 A;  5KPT A;  2P9S A;  2E1Z A;  5AQZ A;  2QWM A;  1S22 A;  5LJW A;  2V7Y A;  5FPN A;  2Q0U A;  5E84 A;  4FPA A;  3H1V X;  3O4W A;  3FE1 A;  3VES A;  3O5B A;  5AQX A;  1GLD G;  1C0G A;  3QML A;  3BP8 A;  1C0F A;  1U2V A;  3BF1 A;  2HF4 A; 
#chains in the Genus database with same CATH topology
 4OO1 J;  3VQ6 A;  3OYN A;  3ZSR A;  3TAR A;  4JI5 K;  4WQ5 C;  1BI4 A;  3AA2 A;  4FJ8 A;  3TAQ A;  5F0X A;  3RVC A;  3KVG A;  1QS4 A;  3VTI A;  3K57 A;  4A61 A;  4FJM A;  1NK5 A;  4QAG A;  4Y0W A;  4C8N A;  3L4I A;  3WT0 A;  3OJU A;  4M63 C;  3NVM A;  4WQ4 C;  2G8K A;  3I56 N;  1JCF A;  4O8K A;  1X3N A;  3VQA A;  3IAY A;  1IBK K;  3VF6 A;  1ASV A;  2ZWH A;  4CGD A;  3DOL A;  3BF3 A;  4CEF A;  1EET A;  4DV3 K;  3JS6 A;  4JHD A;  4W5O A;  1M90 O;  1WNS A;  2PBD A;  2CH6 A;  5AFU A;  2HHI A;  4DQI A;  1OVQ A;  4BR7 A;  1BCM A;  1C1C A;  1WN7 A;  2QWP A;  1ZBI A;  1NNE A;  4FJ5 A;  2BGG A;  4IFE A;  2G8W A;  4OPJ A;  3C95 A;  2WOM A;  4PKH A;  1D9D A;  3ULD A;  2DFE A;  5FRO A;  3WNE A;  3SZ2 A;  4M41 A;  4IOX A;  5LL6 Z;  3QET A;  3MXI A;  1NJI O;  3L2W A;  3OVN A;  5J2M A;  4XIU A;  2QTD A;  3A5L C;  2P5O A;  3UKR B;  3NHG A;  1QE1 A;  4C23 A;  4FXD A;  4OVL A;  4RTF D;  1XQS C;  3V4I A;  1IO2 A;  4YOT A;  1HRH A;  1NMN A;  3NH1 A;  5JMV A;  5SWM A;  3ENO A;  3AVC A;  5TKW A;  3TU5 A;  3SQ1 A;  4NO7 A;  5MLC Q;  3MEE A;  3SCX A;  1RIL A;  5IWA K;  5C0Y A;  3D45 A;  3SAH A;  2HNZ A;  3ASM A;  1I39 A;  3AY9 A;  4B9T A;  4DR1 K;  3ISN C;  3HPG A;  3DXK B;  4DR7 K;  4OKK A;  4AH9 A;  3GG4 A;  2O8B B;  3SUN A;  3SBG A;  1J5E K;  3D0P A;  3THY B;  3TI0 A;  2A3Z A;  1HPM A;  2Q0R A;  4MLH A;  3TAG A;  3DRR A;  3KK7 A;  3SUO A;  4FWQ A;  3BZC A;  5C12 A;  1NBW A;  4CGF A;  5M1N A;  3NGY A;  3J80 O;  2HHU A;  4BRL A;  1Z26 A;  1VQL N;  2QK9 A;  5AZI A;  2FSN A;  3O8M A;  5CR4 A;  4YHH K;  3C6H A;  1A5X A;  1LAW A;  3AO3 A;  3QFU A;  2ZD1 A;  1VK0 A;  2VYP A;  2VWJ A;  3CET A;  3QNN A;  4KTZ A;  1LWF A;  4K8Z A;  4FK4 A;  4CEA A;  2IVP A;  3CCR N;  1N33 K;  4W5N A;  4YOR A;  5KPZ A;  1NKB A;  2G8H A;  3CCE N;  4DTO A;  2HHT A;  3LP2 A;  3VEW A;  5FDL A;  4GV6 A;  3CQY A;  3WEE B;  3VA0 A;  3RSE B;  4B3M K;  4XEI A;  3KKR A;  3PIO L;  3ZSV A;  1BA1 A;  1KSP A;  2OAN A;  4KHW A;  3QEI A;  1Q9X A;  3TAM A;  3A8Y A;  4YOU A;  4FJX A;  5M1O A;  2E6L A;  2A41 A;  4BGB A;  4FWR A;  2IAJ A;  4MQ3 A;  2KQ2 A;  3AA5 X;  4OKJ A;  3HOS A;  4DU3 A;  1HQE A;  2P9U B;  3KK1 A;  3CJC A;  3I55 N;  4JRP A;  3CCS N;  2E20 A;  3OHR A;  4BVO A;  1ATS A;  2FSK A;  1RTH A;  3LPU A;  4JN4 A;  4F9O A;  4KRF A;  4OJR A;  3KK2 A;  4JKF A;  2WON A;  4X65 K;  4YNQ A;  3WNF A;  1KVA A;  4IO9 L;  3AVG A;  4CHO A;  2P5G A;  4DMN A;  2QWN A;  4IXC A;  3AO2 A;  3P1G A;  4IJN A;  4CGJ A;  3ZSX A;  4BWJ A;  1S9G A;  3D6R A;  3ZT4 A;  2XY5 A;  4I6M A;  3UKR A;  4FK0 A;  3ZSO A;  1WSH A;  1L3U A;  2YI1 A;  1CZ9 A;  1SS6 A;  4A62 A;  4HVJ A;  5BPL A;  4PQU A;  1F21 A;  1MU2 A;  3SBT A;  1CXQ A;  3TTD A;  1LW2 A;  3DXK A;  5CY4 A;  1SKS A;  5AQF A;  3OYC A;  1SQK A;  4CBX A;  1IG9 A;  2X74 A;  2WC9 A;  4E89 A;  3J7A P;  3C7N A;  1VSI A;  3AVM A;  3TAP A;  4KPY A;  1WAF A;  1OH8 A;  1S6Q A;  1YVN A;  2LSN A;  3IRX A;  4B1X B;  3KLH A;  3L2U A;  4CW7 B;  4B9V A;  3I0S A;  4KI4 A;  4M3U A;  3H6E A;  4PWD A;  1YJN N;  5J2Q A;  1NK9 A;  4N76 A;  5AQS A;  1WOQ A;  1HYS A;  2A40 A;  1RFQ A;  2DY4 A;  4E19 A;  1RGI A;  1NLV A;  5AQI A;  5KQD A;  2E2P A;  2Q1N A;  3ZX0 A;  2UUB K;  3SMP A;  3LDS A;  4CFD A;  1NJZ A;  4DS5 A;  5BPM A;  2D0C A;  3LDP A;  4BG9 A;  2HHX A;  1SL2 A;  3OYI A;  4ILH A;  4EP5 A;  1RBT A;  1C0M A;  2P1J A;  3O9S A;  1MA9 B;  1YJ9 N;  1J54 A;  3LAM A;  4DLG A;  1NM1 A;  3M5R A;  4JAX A;  5I9E B;  4NB4 A;  1KAY A;  5C2F A;  1BI4 B;  2O8E A;  1BHL A;  1KXP A;  4WFN L;  4FLV A;  4CF8 A;  3MMV A;  2X6S A;  3LM2 A;  4RW6 A;  3NF9 A;  4DLE A;  2RE2 A;  1KLM A;  3LAN A;  1VSH A;  4N56 A;  2E2O A;  4FPB A;  4Z4I A;  2YHA A;  3CG7 A;  3BGR A;  3OYD A;  1TV6 A;  4GY2 B;  5BRF A;  2HBL A;  1QQM A;  3MN6 A;  4CJ3 A;  1N6Q A;  3P38 A;  3BZK A;  1Q8I A;  1HJO A;  1REV A;  1GLA G;  2QWQ A;  1NGD A;  4WCE L;  4V19 S;  4FWL A;  2PZS A;  2Q31 A;  2VGM A;  4LF8 K;  2UXD K;  2QWL A;  1W0H A;  1EXQ A;  4IFV A;  4DV5 K;  1HPZ A;  4WFA L;  3OTO K;  4DV0 K;  2UU9 K;  4DB3 A;  3CC2 N;  5BR8 K;  1LCU A;  1KCF A;  2GV9 A;  4ILG B;  1QSL A;  4FJK A;  2D1K A;  3U3Y A;  1HX1 A;  1NK8 A;  1LWE A;  2UUA K;  4B3S K;  5LJV A;  3TAN A;  3HP6 A;  4CEE A;  1IH7 A;  3MX5 A;  5E26 A;  4CZM A;  5AQU A;  3LM9 A;  4BRO A;  2QKB A;  1KRP A;  3OYK A;  3K0S A;  3DAW A;  1XWL A;  4DSL A;  4DG1 A;  3D2E B;  2NRT A;  3SUQ A;  3ZSZ A;  4BC2 A;  4I9Q A;  4CZJ A;  4JKE A;  3ZEU A;  1U49 A;  4GNI A;  4LF4 K;  1WUA A;  3SAG A;  1Z05 A;  2V52 B;  4FZY A;  2YHY A;  1QZ5 A;  4EFH A;  1OH6 A;  4H0V B;  1SV5 A;  2P9P A;  3H3N O;  4BR0 A;  1Q9Y A;  3K59 A;  4J2A A;  4CBU A;  3CCL N;  4JK8 A;  4JI2 K;  3VEX A;  2DPN A;  2IVN A;  1GOA A;  2BAN A;  2D0O A;  2OPQ A;  3AGK A;  4CHQ A;  1NJW A;  4M3X A;  3CD6 N;  3OBY A;  3ZSY A;  5AQM A;  4CVN E;  3KLF A;  2HBM A;  3VF2 A;  3LWM A;  1RBS A;  2HHS A;  1JLF A;  3MN7 A;  4DTM A;  1W97 L;  4J2D A;  5HRO A;  3I8D A;  2NLX A;  4W5T A;  4AHU A;  1ATN A;  1U6Z A;  4JD2 A;  2O8E B;  1RDW X;  5KPT A;  1XNQ K;  1U47 A;  5AQZ A;  2QWM A;  3V1Q A;  1S22 A;  1U48 A;  4NXM K;  2Q3S A;  5LMU K;  2ATQ A;  4FPA A;  5C25 A;  3VQP A;  3O5B A;  5AQX A;  4IG0 A;  1WLJ A;  3QO9 A;  4DR4 K;  1K8A O;  4DV7 K;  1VQ8 N;  3BF1 A;  2HF4 A;  3OYB A;  1WSI A;  2GTD A;  1ASU A;  4FJH A;  3VQD A;  2OTL N;  3AO1 A;  4Q0B A;  5JS1 A;  4LSN A;  5AQW A;  3WQU A;  5HRP A;  3EKU A;  1ZBF A;  4CEC A;  5HL7 L;  1RT5 A;  4CE9 A;  2FBX A;  2OA8 A;  3ID8 A;  4FM0 A;  1O13 A;  3H3O B;  5DK5 A;  2YCH A;  3LDQ A;  2YJF A;  1RBU A;  3LZJ A;  1XNR K;  1EX4 A;  4FYD A;  4FJ9 A;  4H0O A;  4IDH A;  1QQO A;  3DRS A;  4CER A;  3FFI A;  3F2K A;  2Z1J A;  2YHW A;  3DLB A;  4BRG A;  4BDZ A;  3VQ5 A;  1S3X A;  3P5J A;  4CGI A;  3V9X A;  3CJB A;  1T6D A;  3I0R A;  3C6U A;  1GLF O;  5AQO A;  3E9L A;  4FLX A;  3PLA A;  4DQS A;  3ZET B;  1NWK A;  3DLR A;  3QEW A;  4B3R K;  4CZH A;  4CJL A;  4DFM A;  1QZ6 A;  1D5A A;  1G15 A;  3EE9 A;  3NBP A;  1IBM K;  5GIN A;  3BY5 A;  4BEC A;  4CZI A;  3SI6 A;  1Z6R A;  1BA0 A;  4J8F A;  2GX9 A;  2P9P B;  1VQP N;  4JI7 K;  1NGF A;  3C7N B;  2F7T A;  4LF9 K;  4GW6 A;  3AVN A;  3BEX A;  4TSX A;  4RW8 A;  2WBN A;  3S41 A;  2F96 A;  1GOC A;  1ILY A;  3HVR A;  2HVH A;  4BRI A;  4BRF A;  4JS5 A;  1W2B M;  3VEV A;  2DTU A;  4JYA K;  5EXW A;  3H45 C;  3WEE A;  2KFN A;  4DR6 K;  4DFJ A;  1NGG A;  2HHH K;  4H4O A;  1B9D A;  1R0A A;  2ITG A;  3A5M C;  5JVH L;  5CZ1 A;  3LL3 A;  4OGC A;  1EKE A;  3O3G A;  4IEI A;  3SQ0 A;  1YT3 A;  4JI0 K;  5AFU H;  1TKT A;  4HWI A;  3N4P A;  4ELV A;  2O8D A;  4FJG A;  4B9Q A;  3L2Q A;  3GE1 A;  1W9H A;  5AQG A;  4BRH A;  1V4S A;  4BRN A;  2QI2 A;  5C2D A;  5AQQ A;  4JLH A;  2IIR A;  3AVA A;  3HL8 A;  4FWN A;  2XY8 A;  3QIO A;  3K58 A;  3M8Q A;  1T7P A;  3CCQ N;  1VSF A;  3B8A X;  5BRE A;  3C65 A;  4IDK A;  2VWK A;  4BDP A;  3O80 A;  4HCC A;  2P9U A;  3FGU A;  4KH6 A;  3KLE A;  1KVC A;  4H0X B;  3E1Y A;  3BUZ B;  4NCG A;  2JWK A;  3P39 A;  2R7Y A;  4FW1 A;  3IUC A;  1EWR A;  3ALY A;  4H5V A;  4EP4 A;  3CYG A;  4M7Y A;  3WXK A;  2A1R A;  3C0B A;  1N36 K;  5BN9 A;  1WB9 A;  1JL1 A;  3KHY A;  3L0Q A;  5EU7 A;  3V9W A;  5GAE P;  2YJE A;  3HI0 A;  2VG7 A;  4DFK A;  3MCP A;  1YIJ N;  3K5O A;  4Z4E A;  3R9P A;  3CCU N;  3VEN A;  2I7P A;  2RN2 A;  3DRP A;  3MAQ A;  4OLA A;  2W42 A;  1S1X A;  2NNW A;  3M1F A;  1YIT N;  1J53 A;  3ZLJ A;  1DLO A;  2HBJ A;  3I33 A;  3HYF A;  2VCP A;  2ZJP L;  4IJA A;  4IG3 A;  4M3Z A;  4KB0 A;  1HLU A;  1RDC A;  2ZGZ A;  3CCM N;  4I9L A;  3EO3 A;  4CIG A;  2O8C B;  4BQL A;  4WF9 L;  4H5N A;  4CGG A;  4BAC A;  3FZM A;  3SNN A;  4M3T A;  2IC3 A;  1DEJ A;  3NCI A;  3AVK A;  3EN9 A;  3HPO A;  1IV0 A;  4DF8 A;  1ZBH A;  3E01 A;  3KJV A;  3A5N C;  4O0I A;  3QEV A;  4AM7 A;  1T6C A;  3CME N;  3TAB A;  2GUI A;  1VSL A;  4CHZ A;  1NK0 A;  2WUS A;  1X1P A;  3VPZ A;  4FSV A;  3SK3 A;  2RKI A;  2W00 A;  3SV4 A;  3IKM A;  4BVP A;  4DR2 K;  3HJF A;  1ZBS A;  1YJW N;  3NE6 A;  4DFP A;  3DJC A;  4O0J A;  3KD5 E;  4E1J A;  3T1A A;  2F8S A;  4CHP A;  1Q7Y O;  4IOA L;  3DXM B;  5KGX A;  2P9L B;  4CFA A;  3OYJ A;  3THW A;  1NOY A;  4CIF A;  1YTA A;  4DU1 A;  3MXM A;  2ZGY A;  4LFA K;  4PA1 A;  1K6Y A;  2D0P A;  4FJI A;  4H5R A;  4QOZ B;  4XH1 A;  1NGJ A;  3HK2 A;  1ZXO A;  4BE2 A;  1I3A A;  4E1M A;  3S3N A;  4FJ7 A;  4BQZ A;  4CJE A;  1JXE A;  4FOI A;  1D4X A;  2Q97 A;  4FOE A;  3R3L A;  1LOT B;  3OBW A;  4BRK A;  3H1Q A;  2I5J A;  3QBW A;  4FO0 A;  1B92 A;  2P9N B;  3B6P A;  1CLQ A;  1NK7 A;  4LF6 K;  3FFK B;  2EX3 A;  1DTT A;  1WSF A;  1RT7 A;  3PX4 A;  1KVB A;  1VQO N;  2Z1H A;  2WFB A;  2XHB A;  5IT9 O;  1JCE A;  4AHT A;  3NMU A;  3CF5 L;  3OYM A;  4W5R A;  3DWL A;  3OW2 M;  3QIP A;  1XMO K;  3CM5 A;  4MLE A;  4PKI A;  4BE7 B;  2QM1 A;  3VQB A;  3P31 A;  3O08 A;  1J5O A;  1VQ6 N;  2IDO A;  3DLE A;  3C6A A;  3AVL A;  3SJH A;  5KRS A;  1WBD A;  3KWI A;  3V6D A;  3TWH A;  4BEB A;  4E1N A;  1NJY A;  1OVY A;  3AGR A;  3V1R A;  5C42 A;  1FJG K;  3TTC A;  1B9F A;  3WNG A;  4X64 K;  3LP1 A;  1GOB A;  3ZT0 A;  3RWU A;  2KZZ A;  5DM7 L;  1RDA A;  3MN5 A;  2OTJ N;  3AVF A;  3THV A;  5HP1 A;  1XUP O;  3VQE A;  1RBV A;  2NRR A;  5KRT A;  3ZEU B;  4JS4 A;  4CF1 A;  2UUC K;  3O1B A;  4NLB A;  2YNF A;  2QXL A;  3TTF A;  4CZK A;  1QHT A;  4B1V A;  3K5L A;  1Y97 A;  4DV4 K;  2P9K A;  1O1W A;  1A5W A;  1V4T A;  5KGW A;  2CGJ A;  2C1G A;  1RT3 A;  4I7F A;  4F4K A;  1NGI A;  4C8L A;  1U2V B;  2W6L A;  1TGO A;  3GL1 A;  2F8T A;  4RW9 A;  3H08 A;  2GEM A;  3U4L A;  3HTV A;  4YOW A;  1FKP A;  3O9U A;  4DR5 K;  4FLY A;  1TAU A;  2VG5 A;  3CC7 N;  4N47 A;  2JLE A;  3AO4 A;  3VF4 A;  3DLH A;  3T1H K;  2P9L A;  4CJW A;  4FWP A;  1W7A A;  4XH4 A;  3OYG A;  2VQE K;  4PKG A;  1QVG M;  2D4W A;  2ASP A;  4JD2 B;  3K5M A;  2NZT A;  4LH4 A;  4KV8 A;  4K25 A;  4JNE A;  4K43 A;  2YNG A;  4JEP A;  1K8K A;  2HND A;  2JWL A;  3E9O A;  1NU0 A;  3V9U A;  1BGX T;  1UA0 A;  4U7B A;  4EZ6 A;  1NG9 A;  3K9J A;  3ZSW A;  3VQ9 A;  4KO0 A;  1JL2 A;  4ISG A;  3FZL A;  3SPY A;  1N34 K;  3TSQ A;  3U3G A;  2ASO A;  4BWM A;  1BG3 A;  3QIC A;  4BR9 A;  4CEB A;  1NKC A;  2PY5 A;  3GDQ A;  2B4J A;  3CCJ N;  5FLX O;  2FBY A;  1YAG A;  3HST B;  4DV2 K;  4BDY A;  1T03 A;  4MFB A;  2ZQB A;  4NXN K;  3DOK A;  5FPN A;  3KTQ A;  2UXB K;  1JLQ A;  2Q0U A;  4R79 A;  2OCE A;  4IBN A;  3RRH A;  3QML A;  4GV3 A;  1FKO A;  3CJA A;  3PSI A;  5HRS A;  1HKB A;  3CJ1 A;  1TUY A;  3AAR A;  2DFH A;  4Z4G A;  2O4G A;  1NJX A;  3HO1 A;  1TYQ B;  4FVM A;  3S5T A;  4KRE A;  3DLL L;  1NGA A;  3TPQ A;  4JRQ A;  4CJP A;  5FPM A;  2NRW A;  3HBT A;  3DM2 A;  1BO5 O;  5GIO A;  1QQC A;  2VQF K;  3UKU B;  4K8X A;  2G8F A;  3F9M A;  3OS2 A;  1Q82 O;  4LFC K;  2YHX A;  4BRC A;  4CIE A;  5AQV A;  3MN9 A;  2D0B A;  4AHV A;  3J7Z O;  3AAP A;  5FRN A;  3LPT A;  1BIU A;  2FBV A;  3MCA B;  3R8E A;  2NRX A;  2VGN A;  4C1N K;  1EWQ A;  5AZI B;  3IMX A;  1D8Y A;  3LZI A;  5JVG L;  1ZBL A;  2YHB A;  3ID6 A;  4FZX C;  4B9M A;  1RCH A;  1IBL K;  5GIP A;  1VQN N;  1RBR A;  4Z4C A;  3M3Z A;  1YVU A;  4YY3 K;  3TSP A;  3IDH A;  5TKY A;  3A0I X;  2FF6 A;  1HR0 K;  3FZK A;  4CJ7 A;  2HB5 A;  2E4L A;  4E7L A;  3PV8 A;  3NAE A;  2CGK A;  4F8R A;  5CZ2 A;  4CEZ A;  4Q5V A;  1BUP A;  4FZZ A;  1Z25 A;  1IG8 A;  4B8A B;  4BE0 A;  4DTP A;  2JGU A;  4FL9 A;  2H3G X;  2KKZ A;  4KHQ A;  4KBO A;  2NRV A;  1G99 A;  4BR2 A;  1ITG A;  3JAM O;  2FLO A;  4DTJ A;  1DT9 A;  2HNY A;  4JKB A;  5DM6 L;  2I7N A;  4ID1 A;  2XO7 A;  3F73 A;  1WBB A;  2YNH A;  1S6P A;  4PL8 A;  1E3M A;  5JIC A;  3ATV A;  4C8M A;  3TAF A;  1VSE A;  2RHK A;  3PO5 A;  4BC4 A;  2FF3 B;  3AVB A;  3DI6 A;  4ZTF A;  1VSM A;  4K0K K;  4IWV A;  4QCL A;  4DS4 A;  4DCH A;  4HCB A;  3M8P A;  5HLF A;  3E66 A;  4JKA A;  3SUP A;  4CK3 A;  1U04 A;  3EE8 A;  3PIP L;  5K14 A;  1BIS A;  1LW0 A;  2DFF A;  2YX6 A;  3SMS A;  4J2E A;  1ZBU A;  1HNZ K;  4B1Z A;  1HKG A;  4LFB K;  1RTD A;  3QER A;  1DKG D;  5LMN K;  4FLT A;  1VSJ A;  3NF8 A;  5M1K A;  5AZJ B;  4WQ5 A;  3QB0 A;  1L5U A;  3FLC O;  3L2V A;  4IOC L;  2HST A;  1XMQ K;  3KIO A;  1BU6 O;  5DMR A;  4M45 A;  3CFO A;  1S5J A;  2OPS A;  4AQY K;  1RTJ A;  3OYE A;  1NGB A;  3KK3 A;  1S1V A;  3HZ6 A;  4QS9 A;  4CEQ A;  1E4F T;  4ISE A;  4CJQ A;  4NCB A;  4F3T A;  2QWR A;  3CIP A;  3VQ7 A;  2HW3 A;  3NDK A;  2J4R A;  2RF2 A;  1WSE A;  3QDK A;  4O5B A;  2CGL A;  3WXI A;  3ZT2 A;  1E4G T;  3SYZ A;  2RPI A;  1S1T A;  3SV3 A;  1VQK N;  2P9I A;  3KWG A;  5M1F A;  4AM6 A;  1ESV A;  2GUP A;  3S3M A;  4H5T A;  4R5P A;  4JKD A;  3SLC A;  2P9K B;  3F9K A;  3LP0 A;  1JJ2 M;  1TAQ A;  4CK2 A;  3R6M A;  1HNW K;  3AVH A;  3DLK A;  3C94 A;  5D3G A;  1Q81 O;  1BOT O;  3QNO A;  4BRD A;  3DXM A;  4QS8 A;  4DV6 K;  1XHX A;  1JLE A;  2QWO A;  4JKC A;  4H0T B;  1K73 O;  2ASM A;  1HKC A;  1VSK A;  4O8U A;  4I2Q A;  1U45 A;  4AHC A;  1NK6 A;  1L3S A;  4Z0U A;  4ELT A;  3L2R A;  3VMF B;  3W3D A;  2NUB A;  1RDD A;  4F2S A;  4WFB L;  1YHQ N;  3VQC A;  4CBW A;  5AQK A;  5SZT A;  2OZS A;  5M1Q A;  4BRP A;  2QA4 N;  3F5T A;  2WTU A;  3JXU A;  4A57 A;  5FRM A;  4DWI A;  2P9N A;  4DTS A;  1L3V A;  1T3V A;  2HF3 A;  4L3Q A;  3MX2 A;  3OY9 A;  1KTQ A;  5EX5 A;  3PX0 A;  1VQM N;  4M3Y A;  3WXL A;  4LC9 B;  1NGH A;  1C6V A;  4FLW A;  4Z4F A;  2X78 A;  4CED A;  4O5F A;  4FM1 A;  4OLB A;  2E8A A;  4KTQ A;  4KKO A;  3VA3 A;  3MWP A;  4M7X A;  3O1W A;  4F2R A;  3HOT A;  2F9T A;  2BUP A;  3HM8 A;  4MO5 A;  3ENH A;  1KC8 O;  2ZJQ L;  5BRH A;  2W6K A;  3AVI A;  3ZSQ A;  2UYT A;  1TUU A;  4RG8 A;  4LY7 A;  4DSJ A;  4EZ9 A;  3EYZ A;  3HXM A;  5F2R A;  4RCH A;  3THX B;  1KFS A;  3PY8 A;  5B8H A;  5AQH A;  1X9S A;  2OPR A;  3AAQ A;  3G25 A;  3CCV N;  2G8V A;  4RW4 A;  2X6N A;  4CF9 A;  4FM2 A;  4K42 A;  4BG8 A;  5AQL A;  3IG1 A;  3RMD A;  1TVR A;  3SPZ A;  4ZTJ A;  5GAH P;  4XJX A;  1BL3 A;  1BWF O;  4M3R A;  3HRG A;  4UY8 O;  4BRQ A;  5H1S Q;  3G0Z A;  5ADX A;  4I6M B;  3L8B A;  4B9S A;  4LF5 K;  2ZJR L;  4H0P A;  1RT1 A;  3ZT3 A;  3MEG A;  4CF2 A;  1HYV A;  5CYQ A;  4H03 B;  3LP3 A;  2ZF5 O;  1VQ5 N;  1U4B A;  2ETJ A;  4JK7 A;  3KLG A;  3P83 D;  4ZHR A;  4JV5 K;  4ILJ A;  5AQJ A;  3MWT A;  3OS0 A;  5I42 A;  3RMA A;  1IKX A;  1VSD A;  1OH5 A;  4BC3 A;  1NGE A;  2UXC K;  1TKZ A;  4FLZ A;  3HT3 A;  1K8K B;  4CJK A;  1QQN A;  4GVM A;  4LD0 A;  5C10 A;  4L8R B;  1TKD A;  5KPR A;  5C15 A;  3VGK A;  5FPE A;  1RDU A;  4JK9 A;  3NGI A;  4B9U A;  1YI2 N;  3SQ2 A;  3MED A;  3GOI A;  2B5J A;  3HM9 A;  2F9W A;  2PYL A;  1Y64 A;  3OYA A;  4DU4 A;  4YOX A;  3C6T A;  1HMV A;  1FW6 A;  1ATR A;  3CMA N;  1LAV A;  1IKY A;  3O6W A;  1S9E A;  2IVO A;  4CJR A;  4GV9 A;  5AQY A;  3ENB A;  1HNI A;  3AO5 A;  4AHS A;  1LWC A;  1RT4 A;  1WAJ A;  1C0U A;  4JI8 K;  1KAZ A;  3CYM A;  3U6F A;  3EKS A;  3QFP A;  1SKW A;  4DQR A;  3NGZ A;  4KHY A;  4B3O A;  4EAH D;  3LDN A;  4MO4 A;  3RTV A;  3TAE A;  4K41 A;  1HJR A;  3FR0 A;  3CHW A;  3PO4 A;  5LY3 A;  3EL2 A;  3Q7B A;  1R59 O;  1UOC A;  4HTL A;  4GKK K;  1UWB A;  3CFR A;  4HHT A;  4KAZ A;  3V81 A;  2KHO A;  3TR8 A;  3LWL A;  4BE1 A;  4E7I A;  3WXM B;  5J2N A;  5EOY A;  3SJJ A;  3CI5 A;  3HPH A;  1JLB A;  3WQT A;  3QIN A;  4XH5 A;  4E0D A;  2HBK A;  3HSC A;  4CJ5 A;  2BTF A;  1CZB A;  1JCG A;  4BR5 A;  4WQ4 A;  4ELU A;  1WSG A;  4LH5 A;  2KZM A;  1VRT A;  2A6A A;  4FJJ A;  3L3V A;  2KTQ A;  4EIA A;  4YDU C;  4BY9 C;  3UKU A;  3D2F B;  3PSF A;  4HUG A;  4IO8 A;  3O9Q A;  3IS9 A;  2P9S A;  4E72 A;  2E1Z A;  3MEC A;  1FXX A;  3CQ8 A;  5HRN A;  3V9S A;  3OYH A;  3K2P A;  2O8B A;  3H1V X;  3O4W A;  3FE1 A;  4E7J A;  3VES A;  1TK0 A;  1EP4 A;  2HHQ A;  1XI1 A;  5A2Q O;  1RT2 A;  4X66 K;  3WUH A;  2GBZ A;  1TK8 A;  1YTU A;  3CER A;  1BQM A;  3U8X A;  1VQ9 N;  1N32 K;  3N4Q A;  4OKE A;  1UAX A;  4B3T K;  3VGL A;  3D2E A;  3W0L A;  4B1Y B;  1ZYQ A;  4DR3 K;  3KD1 E;  5CHI A;  3L3U A;  4IZ9 A;  3NVK A;  1DGK N;  5JS2 A;  2Q2R A;  4ICL A;  2ITM A;  1NOZ A;  2O4I A;  3K5N A;  5GAD P;  1ASW A;  3RR8 A;  5ADX H;  3AA4 A;  1MDU B;  4FLU A;  2YKN A;  1BDG A;  4H4M A;  4M42 A;  1RTI A;  4H8K A;  2F4V K;  1NGC A;  1BIZ A;  4DSF A;  1OH7 A;  2QKK A;  1X9J A;  3SAF A;  4B9L A;  2OPP A;  1H1V A;  5C24 A;  4OPK A;  4OPA A;  2YKM A;  3KKS A;  3EZW A;  3OS1 A;  4FVU A;  2Z1G A;  2FBT A;  2IS3 A;  3GBT A;  1N8R O;  4CI6 A;  3ZCM A;  4JI4 K;  3TSU A;  3VEZ A;  3S9H A;  4A59 A;  5CYM A;  1SL0 A;  3G71 N;  1JKH A;  5CE3 A;  1HNX K;  1VQ4 N;  5BPN A;  4RWT A;  3DLG A;  3V9Z A;  2AP1 A;  2FSJ A;  3PUF A;  3FZH A;  3ULE A;  1SZ2 A;  4BRE A;  2W41 A;  1GLB G;  3CJ7 A;  4JHD B;  2PAV A;  4DTR A;  1EQY A;  3R1X A;  1X9M A;  4J2B A;  3ATU A;  4FJN A;  4Z4H A;  3Q7C A;  5AZJ A;  3CC4 N;  3ZX2 A;  2EWS A;  4AIL C;  1IJJ A;  1P8Z A;  1RT6 A;  4CHY A;  2Z1I A;  4KFB A;  4DHY A;  2OZM A;  4PY5 A;  4CHN A;  1GLE G;  1KAX A;  1TKX A;  3VEO A;  1M1K O;  5ELZ A;  2QXF A;  1T44 A;  3T3F A;  4YOY A;  3LAK A;  3CFP A;  4CJF A;  3LDL A;  1VHX A;  3MK6 A;  4NYN A;  1QHA A;  3J8A A;  1OKJ A;  3UE5 A;  4C1N I;  1YUW A;  2YNI A;  3CPW M;  2XRI A;  1KFD A;  4KH4 A;  4CK1 A;  3ZX3 A;  1T05 A;  4KHS A;  4CF0 A;  2B6A A;  3BDP A;  1GLC G;  2W40 A;  1S1U A;  2E2Q A;  4LF7 K;  5JLF A;  5FPD A;  4I2P A;  5AR0 A;  1EO1 A;  2O8F B;  1LV5 A;  4B1U B;  3T19 A;  4CEO A;  4DSI A;  2GWK A;  3UB5 A;  1X3M A;  2EHG A;  4IFY A;  5BRD A;  5KQ8 A;  4B1W B;  3HVT A;  1C1A A;  5JLH A;  4X62 K;  3LAL A;  1HQU A;  4CZL A;  3UIQ A;  4N41 A;  2E5L K;  1QVF M;  4MDB A;  1RNH A;  3CM6 A;  2IOC A;  3VOV A;  1DTQ A;  3VEY A;  4Y1C A;  1HYZ A;  1L3T A;  4BRM A;  5BN8 A;  3A2F A;  3O9T A;  1A5V A;  5AQN A;  4JI6 K;  3JSM A;  3RMB A;  1JLA A;  3CQX A;  3RMC A;  3J81 O;  2KW4 A;  1J6Z A;  4DQP A;  3L6Q A;  1MWK A;  4KB1 A;  4G9Z A;  4KTW A;  1IKV A;  4FW2 A;  3G4S N;  4JI3 K;  3DYA A;  4HUF A;  4CJS A;  2ZM6 K;  1NKE A;  2ZE2 A;  2KLA A;  2XY7 A;  2HVI A;  1IKW A;  5T7B A;  1GLJ O;  3NH2 A;  2CH5 A;  3U9Z A;  4W5Q A;  2OYQ A;  4NYF A;  4NLC A;  1QSY A;  2E88 A;  3OYF A;  3J7Y P;  3O4Q A;  1NK4 A;  3T69 A;  3K9K A;  1QTM A;  2VG6 A;  3VQ8 A;  3M8S A;  4KHU A;  5AQP A;  5HOO A;  4DTN A;  3JYT A;  4WE1 A;  1C1B A;  3VER A;  1JLC A;  1K9M O;  4F3O A;  4ID5 A;  3I8B A;  1FK9 A;  1SUQ A;  4CZG A;  3IFR A;  1XHZ A;  4Y1D A;  3P4I A;  4LSL A;  5J1E A;  4CZE A;  2Q36 A;  5E41 A;  3VGM A;  2NRZ A;  3KLI A;  1Q86 O;  4FJL A;  3THX A;  3CJ9 A;  2E6M A;  3AA3 A;  2A5X A;  1N5Y A;  4B8C A;  1P90 A;  4M3W A;  2YV0 X;  4O4G A;  2HOE A;  4IEE A;  4BGA A;  2G8I A;  3S3O A;  3T1Y K;  2O8F A;  1NMD A;  5AQT A;  2QEX N;  2GWJ A;  3VTH A;  4CD3 A;  1I94 K;  4AF1 A;  4ISF A;  3CXC M;  3D7E O;  4H5W A;  2HHW A;  4HUE A;  4DQQ A;  3OYL A;  3FZF A;  4DSE A;  4JI1 K;  2V7Z A;  3D2F A;  3VQ4 A;  2BH1 A;  3NF7 A;  5EY4 A;  4GKJ K;  1SAZ A;  4PUO A;  2GEL A;  4CZF A;  5F1X A;  4DF4 A;  4PHT X;  2A42 A;  4E3S A;  2G8U A;  1CZA N;  4BR4 A;  4CJV A;  5AJ3 K;  3WXJ A;  3A5O C;  2FC0 A;  3EZ5 A;  4IKF A;  5EVZ A;  3KZB A;  4CGH A;  5I3U A;  4E7H A;  4GMJ B;  2O8C A;  3E9P A;  3O9R A;  3VET A;  4H0Y B;  2AJQ A;  1S1W A;  2P9I B;  4HTU A;  2PYJ A;  4BRA A;  5GAG P;  4A5B A;  3ITH A;  3VQQ A;  1X9W A;  4Z94 A;  2AA4 A;  3RR7 A;  1JXB A;  1TL1 A;  3G10 A;  4B08 A;  4U67 L;  4JKG A;  5HBM A;  3QBX A;  4CJT A;  3G6E N;  4CD1 A;  4FCY A;  1BQN A;  2IGI A;  3RSE A;  3AVJ A;  3MXJ A;  1YXQ A;  3MDQ A;  1XC9 A;  1KQS M;  3QEP A;  1KD1 O;  4OGE A;  4JKH A;  4FWO A;  4N5S A;  3B6O A;  3NFA A;  4AHR A;  1UA1 A;  4CJU A;  3AV9 A;  3V1O A;  1WSJ A;  5HRR A;  3O4N A;  4MDA A;  4PL7 A;  4EHT A;  4UQG A;  1BCO A;  1T8E A;  3PX6 A;  4RW7 A;  1MWM A;  4A5A A;  1QSS A;  1Q18 A;  3DMJ A;  2HMI A;  4BC5 A;  2E2N A;  2BDP A;  4WYB A;  4FWK A;  3U9D A;  4KH5 A;  4CFC A;  1TK5 A;  2Y1I A;  3VN5 A;  3M6G A;  4FWM A;  5J2P A;  4E7K A;  4CJ4 A;  4EHU A;  3NF6 A;  4DTU A;  2A1S A;  4DQ8 A;  2XY6 A;  2NRH A;  3LDO A;  1TYQ A;  4DUZ K;  3RRG A;  4DV1 K;  3O3F A;  3M8R A;  3ULE B;  2VWB A;  4CCH A;  4KHP K;  3QLH A;  4O44 A;  4QS7 A;  1D9F A;  3O3H A;  2KFZ A;  1TL3 A;  1VRU A;  2D0A A;  2P9S B;  1KLN A;  1CXU A;  3ZET A;  2Y1J A;  2FXU A;  4A2A A;  1HUX A;  2BE2 A;  4C8O A;  4CFB A;  4DSK A;  4FK2 A;  1JLG A;  4FWS A;  1VQ7 N;  4OPH A;  2E1Y A;  4DKW A;  1SL1 A;  3T7Z A;  5BR9 A;  1S72 N;  1YF5 L;  1SKR A;  1GLL O;  2D5R A;  1RDB A;  1ZC6 A;  2PFU A;  5AQR A;  4YDU A;  4A2B A;  2V51 B;  4KHN A;  5KTQ A;  3HP9 A;  4NCA A;  2QW9 A;  3OA9 A;  3SQ4 A;  3H46 O;  3QES A;  4YFU A;  3ZYY X;  4JKG B;  4OX9 K;  2HMP A;  3L4Q A;  3WNH A;  3EY1 A;  3THY A;  3NH0 A;  3OJS A;  3THW B;  4G1Q A;  2P51 A;  5M1P A;  3QEX A;  4GVE A;  1XC3 A;  3CPE A;  5KI6 A;  4DTX A;  1J9A A;  4DUY K;  4YOV A;  4CES A;  3EEQ A;  5LJW A;  1VAZ A;  4C8K A;  2V7Y A;  3ZT1 A;  5E84 A;  4O55 A;  4B9N A;  1C0T A;  4KI6 A;  2HHV A;  1GLD G;  2O8D B;  1C0G A;  2C1I A;  5JEN A;  3BP8 A;  1C0F A;  1U2V A;  1HNV A; 
#chains in the Genus database with same CATH homology
 4OO1 J;  3WUH A;  3CJA A;  2GTD A;  3CER A;  1HKB A;  3CJ1 A;  3U8X A;  1VQ9 N;  1TUY A;  3AAR A;  4WQ5 C;  1TYQ B;  3N4Q A;  5F0X A;  3RVC A;  3VGL A;  3KVG A;  3DLL L;  2OTL N;  1NGA A;  3TPQ A;  5AQW A;  3D2E A;  3WQU A;  3W0L A;  3VTI A;  3EKU A;  5FPM A;  2NRW A;  3HBT A;  4B1Y B;  1BO5 O;  5GIO A;  4A61 A;  3UKU B;  5HL7 L;  3F9M A;  1Q82 O;  4Y0W A;  3WT0 A;  3L4I A;  2YHX A;  5CHI A;  4BRC A;  4IZ9 A;  3NVK A;  5AQV A;  3MN9 A;  4M63 C;  3ID8 A;  3NVM A;  4WQ4 C;  1O13 A;  1DGK N;  3H3O B;  3I56 N;  3J7Z O;  3AAP A;  2Q2R A;  2YCH A;  3LDQ A;  2ITM A;  1JCF A;  2YJF A;  1X3N A;  4O8K A;  3MCA B;  5GAD P;  3R8E A;  2NRX A;  3VF6 A;  5ADX H;  2VGN A;  4H0O A;  4IDH A;  4C1N K;  1QQO A;  2ZWH A;  1MDU B;  5AZI B;  3F2K A;  3IMX A;  3BF3 A;  2YHW A;  4BRG A;  5JVG L;  1BDG A;  1NGC A;  1S3X A;  3ID6 A;  3CJB A;  1T6D A;  3JS6 A;  1GLF O;  4JHD A;  1X9J A;  5AQO A;  5GIP A;  1M90 O;  3E9L A;  3SAF A;  2PBD A;  2CH6 A;  5AFU A;  1VQN N;  4BR7 A;  2QWP A;  3PLA A;  1H1V A;  3M3Z A;  4IFE A;  3TSP A;  3ZET B;  1NWK A;  4OPA A;  3IDH A;  5TKY A;  4CZH A;  3A0I X;  1QZ6 A;  3EE9 A;  4PKH A;  3EZW A;  5GIN A;  4FVU A;  2FF6 A;  3FZK A;  4CJ7 A;  4BEC A;  3GBT A;  4CZI A;  1N8R O;  4CI6 A;  4IOX A;  1Z6R A;  1BA0 A;  4J8F A;  2GX9 A;  3TSU A;  2P9P B;  3VEZ A;  1VQP N;  1NJI O;  4A59 A;  2CGK A;  1NGF A;  3G71 N;  3C7N B;  1BUP A;  2F7T A;  2QTD A;  3A5L C;  5CE3 A;  1IG8 A;  1VQ4 N;  3BEX A;  3UKR B;  2WBN A;  4C23 A;  3S41 A;  5BPN A;  4RWT A;  1ILY A;  4RTF D;  1XQS C;  2AP1 A;  2FSJ A;  4FL9 A;  3FZH A;  3ULE A;  4YOT A;  1SZ2 A;  4BRI A;  4BRF A;  4BRE A;  2W41 A;  2H3G X;  3CJ7 A;  1GLB G;  2KKZ A;  4JHD B;  2PAV A;  3VEV A;  1EQY A;  3ENO A;  3R1X A;  5EXW A;  5JMV A;  1W2B M;  3H45 C;  4KBO A;  5TKW A;  3WEE A;  3TU5 A;  2NRV A;  1G99 A;  3ATU A;  4NO7 A;  5MLC Q;  3Q7C A;  1NGG A;  4BR2 A;  5AZJ A;  3CC4 N;  5C0Y A;  2FLO A;  3SAH A;  1DT9 A;  3ZX2 A;  3A5M C;  4JKB A;  2I7N A;  3AY9 A;  5DM6 L;  5JVH L;  2EWS A;  3LL3 A;  4PL8 A;  1IJJ A;  5JIC A;  3ATV A;  1P8Z A;  3DXK B;  4DHY A;  4IEI A;  3GG4 A;  5AFU H;  2RHK A;  3SBG A;  4HWI A;  1GLE G;  3N4P A;  2FF3 B;  4BC4 A;  1KAX A;  3VEO A;  1M1K O;  5ELZ A;  1T44 A;  2A3Z A;  4IWV A;  1HPM A;  2Q0R A;  4YOY A;  4B9Q A;  4MLH A;  3LDL A;  3GE1 A;  4DCH A;  3MK6 A;  3KK7 A;  1QHA A;  3J8A A;  1OKJ A;  3E66 A;  4FWQ A;  4JKA A;  5AQG A;  3UE5 A;  4BRH A;  4C1N I;  3EE8 A;  1V4S A;  4BRN A;  2QI2 A;  3PIP L;  5C12 A;  1NBW A;  5C2D A;  2YX6 A;  5M1N A;  3SMS A;  5AQQ A;  1YUW A;  4B1Z A;  2IIR A;  3CPW M;  4BRL A;  1HKG A;  4KH4 A;  4FWN A;  3ZX3 A;  1VQL N;  5AZI A;  1DKG D;  3CCQ N;  2FSN A;  3O8M A;  3B8A X;  5CR4 A;  5BRE A;  1GLC G;  3C6H A;  2W40 A;  3C65 A;  2E2Q A;  3QFU A;  5M1K A;  5AZJ B;  5JLF A;  5FPD A;  4WQ5 A;  3QB0 A;  5AR0 A;  3O80 A;  2VYP A;  3FLC O;  1EO1 A;  4B1U B;  2P9U A;  3CET A;  3FGU A;  4KH6 A;  4IOC L;  2GWK A;  2HST A;  4H0X B;  3E1Y A;  3BUZ B;  1BU6 O;  2IVP A;  3UB5 A;  3CCR N;  2JWK A;  1X3M A;  5BRD A;  3P39 A;  5KQ8 A;  4B1W B;  5JLH A;  4YOR A;  3IUC A;  5KPZ A;  4CZL A;  3CCE N;  4H5V A;  4M7Y A;  1NGB A;  3WXK A;  3C0B A;  3VEW A;  4MDB A;  5BN9 A;  3CQY A;  3HZ6 A;  4QS9 A;  3WEE B;  1QVF M;  4GV6 A;  3RSE B;  3KHY A;  4XEI A;  1E4F T;  3L0Q A;  3PIO L;  3VOV A;  4ISE A;  3VEY A;  1BA1 A;  2QWR A;  5GAE P;  2YJE A;  3HI0 A;  2OAN A;  3CIP A;  4BRM A;  3MCP A;  5BN8 A;  1YIJ N;  2J4R A;  3A8Y A;  3O9T A;  3QDK A;  4YOU A;  3WXI A;  2CGL A;  5M1O A;  3R9P A;  5AQN A;  1E4G T;  2A41 A;  3VEN A;  3CCU N;  2I7P A;  4BGB A;  4FWR A;  3M1F A;  2NNW A;  3CQX A;  1VQK N;  1YIT N;  2P9I A;  3KWG A;  5M1F A;  4AM6 A;  3HOS A;  1ESV A;  2GUP A;  2P9U B;  2HBJ A;  1J6Z A;  4H5T A;  3CJC A;  3I55 N;  3I33 A;  4JKD A;  3SLC A;  3CCS N;  2E20 A;  2VCP A;  2P9K B;  3OHR A;  1ATS A;  2FSK A;  4BVO A;  4JN4 A;  4F9O A;  4IJA A;  2ZJP L;  3L6Q A;  1MWK A;  4JKF A;  1JJ2 M;  4G9Z A;  3R6M A;  3G4S N;  1HLU A;  2ZGZ A;  3CCM N;  4IO9 L;  3EO3 A;  1Q81 O;  1BOT O;  4BQL A;  4WF9 L;  4H5N A;  2KLA A;  3DXM A;  4BRD A;  2QWN A;  4QS8 A;  1GLJ O;  3FZM A;  4IXC A;  2CH5 A;  4IJN A;  3U9Z A;  2QWO A;  4JKC A;  1DEJ A;  4H0T B;  4NLC A;  1K73 O;  2E88 A;  2ASM A;  1HKC A;  3D6R A;  4I6M A;  3EN9 A;  3T69 A;  3UKR A;  3K9K A;  4O8U A;  3A5N C;  5AQP A;  5HOO A;  4AM7 A;  1T6C A;  3CME N;  3VER A;  3VMF B;  3W3D A;  1K9M O;  2YI1 A;  1SS6 A;  2WUS A;  3I8B A;  4WFB L;  1YHQ N;  3VPZ A;  4FSV A;  4A62 A;  3SK3 A;  4CBW A;  5BPL A;  4CZG A;  2W00 A;  5AQK A;  3IKM A;  3IFR A;  5M1Q A;  4BRP A;  2QA4 N;  4BVP A;  3P4I A;  3SBT A;  3F5T A;  1ZBS A;  3TTD A;  3JXU A;  2Q36 A;  4A57 A;  4CZE A;  3DXK A;  3VGM A;  1YJW N;  2NRZ A;  1Q86 O;  5AQF A;  3DJC A;  1SQK A;  2P9N A;  4CBX A;  2WC9 A;  4E1J A;  3CJ9 A;  3C7N A;  1T3V A;  2HF3 A;  4L3Q A;  2A5X A;  1Q7Y O;  3MX2 A;  4IOA L;  3DXM B;  1P90 A;  2P9L B;  5EX5 A;  1VQM N;  3WXL A;  4LC9 B;  1NGH A;  2ZGY A;  2HOE A;  4IEE A;  4BGA A;  1YVN A;  4B1X B;  1NMD A;  4O5F A;  5AQT A;  2QEX N;  2GWJ A;  2E8A A;  3VTH A;  2D0P A;  4CD3 A;  3MWP A;  3H6E A;  4H5R A;  4M7X A;  4XH1 A;  1NGJ A;  4ISF A;  3O1W A;  4AF1 A;  3HOT A;  1YJN N;  5AQS A;  1ZXO A;  3CXC M;  1WOQ A;  2F9T A;  2BUP A;  3D7E O;  2A40 A;  4H5W A;  3HM8 A;  1RFQ A;  4MO5 A;  1RGI A;  3ENH A;  1NLV A;  3FZF A;  5AQI A;  5KQD A;  1KC8 O;  2ZJQ L;  4BQZ A;  2E2P A;  2V7Z A;  5BRH A;  2Q1N A;  3D2F A;  2BH1 A;  4FOI A;  5EY4 A;  3ZX0 A;  1SAZ A;  2GEL A;  1D4X A;  1TUU A;  2UYT A;  2Q97 A;  4FOE A;  4CZF A;  5F1X A;  3R3L A;  4PHT X;  1LOT B;  3SMP A;  3OBW A;  4BRK A;  2A42 A;  3H1Q A;  3QBW A;  1CZA N;  5F2R A;  4FO0 A;  3LDP A;  2P9N B;  4RCH A;  4BG9 A;  4BR4 A;  5B8H A;  5BPM A;  5AQH A;  3WXJ A;  3FFK B;  3A5O C;  4ILH A;  5EVZ A;  1VQO N;  3AAQ A;  2WFB A;  3KZB A;  3G25 A;  3O9S A;  3CCV N;  1MA9 B;  1JCE A;  1YJ9 N;  3NMU A;  3CF5 L;  3DWL A;  3OW2 M;  1NM1 A;  3M5R A;  4JAX A;  4K42 A;  3E9P A;  3O9R A;  5AQL A;  4H0Y B;  3VET A;  4BG8 A;  5I9E B;  2P9I B;  5GAH P;  4NB4 A;  4BRA A;  1KAY A;  5C2F A;  4MLE A;  4XJX A;  4PKI A;  4BE7 B;  5GAG P;  1BWF O;  1KXP A;  2QM1 A;  3P31 A;  4A5B A;  3O08 A;  3HRG A;  4WFN L;  4UY8 O;  4Z94 A;  2AA4 A;  4BRQ A;  5H1S Q;  1VQ6 N;  5ADX A;  3MMV A;  4I6M B;  3C6A A;  4U67 L;  3LM2 A;  3SJH A;  4JKG A;  2RE2 A;  4H0P A;  2ZJR L;  3KWI A;  3QBX A;  4BEB A;  3G6E N;  1OVY A;  3AGR A;  2E2O A;  4FPB A;  4H03 B;  4CD1 A;  2ZF5 O;  1VQ5 N;  4JK7 A;  3RSE A;  3TTC A;  4ILJ A;  1YXQ A;  5AQJ A;  4GY2 B;  3MWT A;  3MDQ A;  1KQS M;  1KD1 O;  5BRF A;  5DM7 L;  2HBL A;  1QQM A;  3MN6 A;  4JKH A;  4FWO A;  3MN5 A;  3P38 A;  2OTJ N;  4BC3 A;  1NGE A;  1HJO A;  1GLA G;  2QWQ A;  1K8K B;  1NGD A;  1XUP O;  4MDA A;  4PL7 A;  4EHT A;  1QQN A;  4WCE L;  2NRR A;  3ZEU B;  3O1B A;  4FWL A;  1MWM A;  2Q31 A;  2VGM A;  5C10 A;  4A5A A;  2QWL A;  5KPR A;  4NLB A;  3VGK A;  5C15 A;  1RDU A;  5FPE A;  1Q18 A;  4JK9 A;  2QXL A;  4WFA L;  3TTF A;  4BC5 A;  4CZK A;  2E2N A;  4WYB A;  1YI2 N;  4FWK A;  4B1V A;  3U9D A;  3GOI A;  4KH5 A;  2P9K A;  4DB3 A;  3CC2 N;  1V4T A;  2F9W A;  2CGJ A;  1LCU A;  2C1G A;  4ILG B;  1Y64 A;  2D1K A;  3M6G A;  4FWM A;  1NGI A;  1HX1 A;  1U2V B;  5LJV A;  4EHU A;  4YOX A;  1ATR A;  3MX5 A;  3CMA N;  4DQ8 A;  3O6W A;  2NRH A;  2IVO A;  3GL1 A;  5E26 A;  4CZM A;  3LDO A;  5AQU A;  1TYQ A;  3LM9 A;  4BRO A;  5AQY A;  2GEM A;  3U4L A;  4GV9 A;  3ENB A;  3HTV A;  4YOW A;  3O9U A;  3DAW A;  3CC7 N;  3D2E B;  2NRT A;  3ULE B;  2VWB A;  3VF4 A;  2P9L A;  1KAZ A;  4BC2 A;  4CZJ A;  4JKE A;  3ZEU A;  3EKS A;  4FWP A;  4GNI A;  3QFP A;  4XH4 A;  1WUA A;  3SAG A;  1Z05 A;  4PKG A;  2V52 B;  4QS7 A;  2YHY A;  1QVG M;  4EAH D;  1QZ5 A;  2D4W A;  2ASP A;  3LDN A;  4EFH A;  4JD2 B;  4MO4 A;  2NZT A;  4H0V B;  4K41 A;  3FR0 A;  3H3N O;  2P9P A;  4BR0 A;  3CHW A;  2P9S B;  4K25 A;  4JNE A;  3ZET A;  4K43 A;  2FXU A;  4A2A A;  1HUX A;  4CBU A;  3CCL N;  5LY3 A;  3EL2 A;  1K8K A;  3Q7B A;  1R59 O;  2DPN A;  4HTL A;  4JK8 A;  2IVN A;  2JWL A;  4JEP A;  3E9O A;  3VEX A;  2D0O A;  4U7B A;  2KHO A;  4FWS A;  3AGK A;  1VQ7 N;  4OPH A;  2E1Y A;  3WXM B;  5EOY A;  4DKW A;  3T7Z A;  5BR9 A;  3CI5 A;  1S72 N;  3CD6 N;  1YF5 L;  3OBY A;  1GLL O;  1ZC6 A;  2PFU A;  5AQR A;  3WQT A;  4YDU A;  4XH5 A;  2HBK A;  3K9J A;  4A2B A;  5AQM A;  2V51 B;  4ISG A;  3FZL A;  2HBM A;  3HSC A;  2BTF A;  3TSQ A;  1JCG A;  2ASO A;  2QW9 A;  4BR5 A;  3OA9 A;  4WQ4 A;  3VF2 A;  3H46 O;  3ZYY X;  4JKG B;  1BG3 A;  3QIC A;  3MN7 A;  4BR9 A;  2A6A A;  2HMP A;  3L4Q A;  1W97 L;  2NLX A;  4EIA A;  1ATN A;  3GDQ A;  3CCJ N;  4YDU C;  5M1P A;  4BY9 C;  1U6Z A;  4JD2 A;  3UKU A;  3D2F B;  1YAG A;  4IO8 A;  1RDW X;  1XC3 A;  4GVE A;  5KPT A;  3CPE A;  3O9Q A;  2P9S A;  2E1Z A;  5AQZ A;  4YOV A;  2QWM A;  1S22 A;  5LJW A;  1VAZ A;  2V7Y A;  5FPN A;  2Q0U A;  5E84 A;  4FPA A;  4R79 A;  3H1V X;  3O4W A;  3FE1 A;  3VES A;  3O5B A;  5AQX A;  1GLD G;  1C0G A;  2C1I A;  3QML A;  1K8A O;  3BP8 A;  4GV3 A;  1VQ8 N;  1C0F A;  1U2V A;  3BF1 A;  2HF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...