3W3DA

Crystal structure of smooth muscle g actin dnase i complex
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
374
structure length
373
Chain Sequence
EEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin, gamma-enteric smooth muscle
publication title Refined structure and solvent network of chicken gizzard G-actin DNase 1 complex at 1.8A resolution
rcsb
molecule tags Structural protein
total genus 122
structure length 373
sequence length 374
ec nomenclature
pdb deposition date 2012-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.36.70 Mainly Beta Roll Actin; Chain A, domain 2 Actin; Chain A, domain 2 3w3dA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3w3dA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3w3dA03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3w3dA04
3U9DA 3CETA 2NLXA 3TPQA 5AR0A 4QS9A 4RWTA 2ZGZA 4B1XB 4BQZA 3D7EO 3MN5A 4HWIA 4K41A 4BVOA 4FWOA 4E1JA 4M7YA 2VWBA 3QBWA 4H5VA 4PKHA 2VCPA 3VGMA 1BU6O 2E2PA 2E20A 4WYBA 1NBWA 3FZKA 4BROA 4BRPA 3BP8A 2CGLA 2A42A 2HOEA 5FPEA 1HLUA 3A0IX 3TU5A 4JNEA 1YXQA 4CD1A 3CJ7A 4B9QA 1X3NA 1YUWA 5AQUA 5AZIB 3CJAA 4CZGA 3H3NO 4JAXA 2P9KA 5AQKA 4CD3A 1GLCG 3ZEUA 4EAHD 1ZC6A 4XH5A 3I33A 3MN7A 4WQ5A 3QMLA 4JN4A 3VETA 4BRNA 4DQ8A 3MN9A 1NGGA 3IMXA 2V52B 5EOYA 1NGFA 2IIRA 3DWLA 2QXLA 4RTFD 3O5BA 5ADXH 1ZBSA 1K8KB 2Q2RA 3H1QA 3ZETB 1JCGA 4K43A 3HI0A 4H5NA 2YHWA 3WXJA 3CQYA 4CZJA 2YHXA 2IVNA 3RSEA 4H5TA 4FWSA 1XC3A 3LL3A 4WQ5C 3VPZA 4CBUA 2NZTA 5AFUA 2IVOA 3R9PA 4ISEA 1U2VB 4XH1A 3JXUA 2FLOA 1GLJO 2D0PA 1Q18A 2P9KB 5AQOA 1G99A 1NM1A 3ZEUB 3EZWA 4KBOA 4BRIA 4QS7A 5BN9A 2PAVA 1MWKA 4MO4A 4RCHA 4BRDA 1U6ZA 2E8AA 4PKGA 4MO5A 1DGKN 2ZF5O 2QW9A 1BOTO 2ASMA 4IXCA 4Z94A 2A3ZA 4IJAA 5LY3A 3RSEB 4A2BA 3ZX3A 3P4IA 2J4RA 4K25A 4BRCA 1BA0A 1QQMA 2CGJA 2WUSA 3C7NA 3O08A 5AQFA 4B1UB 4DCHA 2HMPA 3B8AX 2I7NA 5AQGA 3UKRA 3SJHA 4L3QA 3O1WA 3IFRA 2P9NA 1HPMA 3A5LC 1J6ZA 4CZIA 1IG8A 5BRDA 4IZ9A 4EHTA 3BUZB 4CBWA 1GLLO 1OKJA 1LOTB 4YDUC 3A8YA 3VF6A 1HX1A 3W3DA 3BF3A 5AQZA 3EO3A 3ATVA 3F9MA 5JLFA 4CI6A 4B1VA 3ZX0A 1LCUA 3OHRA 2GEMA 5AQWA 3VOVA 1QHAA 4BRQA 3L0QA 4PKIA 4PL8A 4BC2A 3C7NB 3I8BA 1HKCA 1NWKA 3KVGA 1NGCA 3LDQA 1BG3A 2Q0RA 3UKRB 2FF3B 4JD2A 1NLVA 4CZHA 2P9NB 3HSCA 2V7ZA 2ITMA 5AQXA 3O1BA 1HJOA 3O8MA 2OANA 2Q31A 4FL9A 1NGDA 1HUXA 3CQXA 3VEWA 4CBXA 3M6GA 3WUHA 5E26A 2P9LA 3VEYA 3GOIA 1S3XA 4BQLA 4CZFA 1SQKA 4FWRA 3BEXA 4H0XB 2H3GX 3L6QA 1CZAN 1KXPA 3HBTA 1Z6RA 4IO8A 4WQ4A 4K42A 3AY9A 4CZEA 3A5NC 5AQSA 4FPBA 4CJ7A 4CZLA 3GL1A 4BR5A 2IVPA 3VESA 5EY4A 3CJCA 2V51B 4ISFA 4JD2B 4HTLA 2Q36A 2ZWHA 1T6DA 3EKSA 4H0VB 2AA4A 2HF4A 4BG8A 3H6EA 4H0PA 4BRFA 4A2AA 4WQ4C 5AQRA 4BGBA 1GLDG 4FWPA 2ASPA 3CIPA 3LDNA 2FSNA 4EFHA 4I6MA 4FWQA 1E4FT 3WEEA 2P9LB 3WQTA 4BR4A 3FZHA 3CI5A 4JHDA 4FOIA 2FSJA 5BPMA 2GWKA 3KZBA 5BR9A 2D1KA 3O80A 3WXKA 2E88A 4H03B 3AAPA 5EVZA 5AQTA 3UKUA 3GBTA 3U9ZA 4C23A 3WT0A 4QS8A 2Q97A 1GLBG 4BR7A 3A5MC 5ADXA 4YDUA 1X3MA 2YI1A 4BREA 4B1YB 2YJFA 5AQPA 4BR2A 2BTFA 2AP1A 5AQVA 5KPZA 1WUAA 1DEJA 1V4SA 1GLAG 4A62A 3VF2A 3VF4A 3ID8A 2HF3A 2W40A 1C0FA 4FWMA 4EIAA 5JMVA 3EKUA 1ZXOA 2CH6A 4BC4A 3VEOA 2P9IA 4I6MB 3DAWA 3HTVA 3WEEB 3AAQA 3CJ1A 5CE3A 2I7PA 4BRGA 2Q0UA 5KQDA 4JHDB 2PBDA 1JCFA 2ASOA 3FLCO 1H1VA 4PL7A 2P9PA 1MDUB 2Q1NA 3MN6A 4FPAA 1S22A 1C0GA 1BDGA 2NRHA 3QDKA 3GG4A 1EQYA 2FXUA 3UKUB 2QM1A 3DXKA 4AM7A 2VYPA 1SZ2A 4FWNA 2E1ZA 1Y64A 5ELZA 3ENHA 1KAXA 3SMSA 4A61A 3LDPA 4BC3A 5AQYA 3CERA 5AQHA 5JICA 3D2FA 3AARA 3VGLA 2QWLA 1BWFO 1R59O 2EWSA 4DB3A 1YAGA 3A5OC 2YHYA 1NGAA 5F1XA 3LM9A 2W41A 3HZ6A 4XH4A 3J8AA 2QWOA 3SMPA 3FZMA 3VERA 2GTDA 4CZMA 4EHUA 1YVNA 5E84A 1QZ6A 4ISGA 2P9IB 1NMDA 4B1WB 4FO0A 3H46O 2D4WA 3LDLA 1NGHA 1DKGD 4FWKA 4O5FA 4DHYA 5FPMA 4MLHA 3UB5A 3QFPA 3JS6A 3KHYA 2UYTA 5F0XA 1NGEA 2P9PB 1XUPO 3O6WA 4MLEA 5EXWA 1RFQA 3U8XA 3SK3A 3MDQA 4BC5A 2A6AA 1Z05A 4BR9A 4J8FA 3VEXA 2FF6A 1U2VA 1ATSA 3VEZA 3DXKB 3L4IA 3ULEA 1P8ZA 3ATUA 1NGJA 3WXLA 1TUUA 3EL2A 2D0OA 2DPNA 3WXIA 3M1FA 3D2FB 3FE1A 3QB0A 1RGIA 3FR0A 1IJJA 4H5RA 5JLHA 5AQMA 1T6CA 5FPDA 5BN8A 5I9EB 3U4LA 2GELA 1BUPA 1TUYA 4BRMA 3D2EA 1ESVA 3QFUA 3FFKB 1MA9B 4FOEA 4H0YB 4FWLA 1GLFO 3DJCA 3DXMA 5LJVA 3G25A 1BA1A 1WOQA 2E2QA 2QWNA 4BVPA 3M3ZA 2E1YA 3HM8A 1RDWX 1NGBA 4M63C 2F9TA 2QWMA 2GWJA 3H3OB 4IJNA 5AQNA 4BGAA 5KPTA 2ZGYA 5BPLA 2YJEA 3LM2A 5AZJA 3ULEB 2P9SA 4LC9B 3W0LA 5AQIA 2CH5A 5F2RA 4BRLA 4O8KA 4Y0WA 2QWRA 3IDHA 4XEIA 1QQOA 4BRHA 4GY2B 3R6MA 3C0BA 4BG9A 1QQNA 5FPNA 3VGKA 3MMVA 5TKYA 4B1ZA 3GDQA 2A5XA 3UE5A 4NO7A 2A40A 4FSVA 3D2EB 4IWVA 4F9OA 3ENOA 2A41A 1E4GT 3O4WA 4M7XA 5AQQA 5AQLA 4H0OA 1TYQA 4H5WA 5BREA 3DXMB 2F9WA 4BRAA 4BRKA 4GNIA 5KPRA 5BRHA 3SLCA 5EX5A 2P9UA 4NB4A 4H0TB 3VENA 5KQ8A 1SAZA 1D4XA 3VEVA 3S41A 5AZJB 1ATNA 1GLEG 2P9SB 1MWMA 1ATRA 3BF1A 3QBXA 3MCPA 3ZX2A 3IUCA 1NGIA 2QWQA 2YCHA 1T44A 1BO5O 1HKBA 2BUPA 5AZIA 1HKGA 5AQJA 3WQUA 2CGKA 3QICA 1XQSC 2KHOA 3CJBA 2E2OA 1QZ5A 1JCEA 1KAZA 5LJWA 2V7YA 5BRFA 3LDOA 3GE1A 3H1VX 2FSKA 2QWPA 1X9JA 3EN9A 2GUPA 1KAYA 1TYQB 3H45C 3MK6A 4AM6A 3CHWA 3FGUA 3FZFA 1K8KA 1V4TA 3CJ9A 3FZLA 2P9UB 3R8EA 5AFUH 4BR0A 4CZKA 5BPNA 3ZETA 2E2NA 5B8HA
chains in the Genus database with same CATH superfamily
3CETA 5AR0A 3OYMA 1RBTA 4BQZA 3DRRA 3THWB 2G8HA 4H5VA 4PKHA 3VQ4A 3SNNA 3CQ8A 3U6FA 1D8YA 4BRPA 3MXMA 2A42A 1RDAA 4GW6A 3CCSN 3TU5A 1MU2A 3L2UA 4B9QA 4M3ZA 4IDHA 4NCGA 2G8UA 1I3AA 4CJFA 4JAXA 3UIQA 1ZYQA 4DR7K 2R7YA 1RTDA 3ZEUA 4IG0A 2DY4A 1YF5L 3I33A 4WQ5A 3O3FA 4KKOA 3RMAA 3MN9A 2DFFA 1NGGA 1NK5A 3V81A 1SKWA 1OVQA 4RTFD 4BEBA 3PSFA 1HNZK 5ADXH 3ZETB 4K43A 4NXNK 1X1PA 2Y1IA 1VAZA 1D9DA 1QQCA 3MCAB 2YHXA 4N5SA 4AQYK 4H5TA 4KAZA 4FWSA 3B6OA 1XC3A 2FBTA 3DOKA 1HJRA 3LL3A 3VPZA 3VA0A 1N6QA 2NZTA 2VG7A 3R9PA 4ISEA 1U2VB 2F8TA 4HUGA 5SWMA 4CFAA 1L3SA 2KQ2A 1GLJO 4CECA 1Q18A 3D0PA 4JK9A 5AQOA 1NM1A 3ZEUB 3EZWA 4QS7A 4DTRA 1JLFA 1WBDA 3CMAN 2E8AA 4PKGA 4JKBA 4YNQA 1WSJA 3E9OA 1HR0K 1REVA 4ELVA 4O44A 4F2SA 4E3SA 5HOOA 2F8SA 4A2BA 2J4RA 3RWUA 3QNOA 3DLKA 2OCEA 3BDPA 2D0AA 5A2QO 4CGFA 3TI0A 4DSKA 3M8QA 5E41A 3S9HA 3UKRA 4FM2A 3SJHA 1NKCA 1IBKK 3T1HK 1IG8A 4NLBA 3M8PA 4KH6A 1VSEA 1GOAA 1GLLO 1OKJA 2ZJQL 1E3MA 1HNIA 3EO3A 4LF6K 2HHQA 1T05A 4Z0UA 3F9MA 3EYZA 1RILA 2F96A 1VQ8N 4LD0A 3VOVA 2HW3A 3BZCA 3L0QA 4FJ5A 3SV4A 4BDPA 2P5OA 3HP9A 2D0BA 4CJSA 2XHBA 1IKVA 1IG9A 1ZBFA 2OPQA 5M1OA 3KJVA 4WFNL 3L2WA 5EU7A 3UKRB 2FF3B 1J53A 1NLVA 2GV9A 2ITMA 4KHWA 1TAUA 3C6UA 1VHXA 2OANA 5B8HA 2E6MA 1NGDA 1ASUA 3CQXA 4DU4A 5E26A 3G0ZA 2P9LA 3VEYA 4EZ9A 2UXCK 3QIPA 4B9UA 4FWRA 3NGYA 1YITN 5K14A 4JYAK 3HK2A 4ZHRA 4DV6K 2G8VA 4CJ7A 4KFBA 1YTUA 2IVPA 4BWJA 4DU3A 1RBVA 1F21A 4CFCA 1WSIA 5HL7L 4DQIA 4GV3A 4HTLA 2ZD1A 1VSKA 4N76A 3OBWA 4K0KK 1WSFA 3SBTA 2RF2A 3L2RA 3CCJN 2ASPA 4CJ3A 2HHXA 3WEEA 2IOCA 4B9MA 4Z4EA 2P9LB 5DK5A 1BISA 3V1QA 4FOIA 5BPMA 4NLCA 2GWKA 2KW4A 2HHIA 1NU0A 5EVZA 5AQTA 3GBTA 1NK9A 2ZQBA 3K59A 4I2QA 4BR7A 5ADXA 2B5JA 4BREA 1RBUA 4DF8A 5KRSA 2YJFA 5AQPA 1U4BA 1NK6A 2AP1A 4Q5VA 1LW2A 1DEJA 3LAMA 3O3HA 3MXIA 3NH1A 3VF2A 4EIAA 1W97L 5JMVA 1ZXOA 1KC8O 3VEOA 3SCXA 1J5OA 3WEEB 2XRIA 4CEZA 4U7BA 3SPYA 2HVIA 3CFPA 2ASOA 1WSGA 4LH4A 4B8CA 3GG4A 3CCVN 3MEGA 2QM1A 4AM7A 4LFBK 5ELZA 2YNGA 3ENHA 1KAXA 4CHNA 1QS4A 3SMSA 5HRPA 3LDPA 1L3TA 1KQSM 3CERA 1TL3A 3RRGA 2G8IA 2YNHA 3D2FA 4F4KA 3AARA 3VGLA 1QVFM 4CVNE 1BWFO 3MECA 4AHSA 1P90A 5M1FA 4JK7A 4DR6K 1KSPA 3VERA 2O8BA 3H08A 4FO0A 3LDLA 1NGHA 4FWKA 4DHYA 3SUOA 5FPMA 3ZT1A 5GIOA 4AHCA 2OZMA 3UB5A 4E1MA 4HUEA 5F0XA 1NGEA 1RFQA 4JS5A 1BQMA 1Z05A 3ZT3A 1TL1A 2B6AA 5HRSA 1ATSA 3KD5E 4FVMA 3VEZA 3L4IA 1RT3A 1TK0A 1XNQK 3OYAA 4N41A 1TUUA 1EETA 3D2FB 4WE1A 3FR0A 1IJJA 4JI6K 4PWDA 4ZTFA 1T6CA 4EZ6A 3DLEA 5KGWA 3ZSZA 1KVBA 1TUYA 3QFUA 4KO0A 3J7AP 2O8BB 4JRPA 4FLTA 3SJJA 3VQ8A 3E9PA 4CGDA 4HCBA 3DJCA 3NDKA 5LMNK 4GV6A 2E1YA 3HM8A 2WC9A 3K58A 4F2RA 3VQDA 3MX5A 4OLBA 1K73O 1X9WA 1IV0A 3LM2A 1N32K 3OYDA 4E7JA 1D5AA 3OA9A 1M90O 3P5JA 4KV8A 5D3GA 2HBMA 3IDHA 3DRSA 4XEIA 3ZSOA 4YOUA 4GY2B 5I3UA 3R6MA 4CJPA 4ID5A 4BG9A 3SI6A 5TKYA 2FBVA 4LH5A 1IO2A 4FSVA 3CPEA 4F9OA 3ENOA 2A41A 3O4WA 1EWRA 4YOXA 4M7XA 1RTIA 5AQLA 3D45A 4H0OA 1BIUA 4JI2K 1TYQA 4H5WA 4IKFA 3LPTA 2OTLN 1HYZA 4W5NA 1C1CA 1YTAA 4E1NA 1HYVA 3SLCA 3CG7A 1W7AA 4DTSA 3NH0A 1D4XA 3AO3A 4CHOA 2HHSA 3MCPA 4K8ZA 3ZCMA 4DQRA 1NGIA 2QWQA 2E4LA 4FJHA 1BO5O 1S1XA 4U67L 4EP4A 4JS4A 4Z4HA 3QICA 3NGIA 3HM9A 1YIJN 4JKGA 3OYHA 4IDKA 1S1VA 3NMUA 2V7YA 3LDOA 1J9AA 1XMQK 2P51A 3HVTA 3P1GA 3T1AA 1TYQB 3TSQA 1NK0A 4G9ZA 1SS6A 2JWKA 4CHYA 4ICLA 1K8KA 1VQMN 3OYCA 4FW1A 3U9DA 4GVMA 4DFKA 1Q81O 4QS9A 2ZGZA 4B1XB 5BR8K 4JI5K 4BVOA 4E1JA 4M7YA 4FVUA 2VCPA 2E20A 4KTWA 3FZKA 5FPEA 3V9ZA 2HOEA 3MXJA 1HLUA 4CEOA 4JNEA 1N36K 4X62K 4IFYA 3CJ7A 1KRPA 3OVNA 1X3NA 1YUWA 4FM0A 5AQUA 4M3RA 4O8UA 4MDBA 2OPSA 4CEEA 3NE6A 1RT5A 2P9KA 3AA3A 3LALA 4JKGB 4EAHD 3ASMA 3QMLA 4DFJA 1L3VA 4DQ8A 3V9WA 1KFDA 3OBYA 5HRRA 2V52B 3QERA 3OYGA 3DWLA 1Z26A 2ITGA 1K8KB 4MQ3A 3H1QA 4E89A 4C8MA 1JLBA 5H1SQ 4H5NA 4GKKK 1WN7A 3CQYA 2Z1GA 4DTOA 1BCMA 5I42A 3PIOL 4BACA 4CF1A 5AFUA 1CLQA 4FJNA 3LP1A 3NFAA 3O9UA 2QTDA 4NCAA 4N47A 3OYJA 3TAEA 2FLOA 3DMJA 4PUOA 1B92A 2IC3A 2P9KB 3MEDA 1G99A 5M1KA 4KBOA 3I0RA 1LWFA 3NBPA 4MO4A 4DKWA 2A1RA 3F2KA 4IG3A 2HHWA 1DGKN 3AVHA 1I94K 1UOCA 3CC4N 1BOTO 4E19A 5J2MA 4DSIA 2W6KA 4CERA 4IJAA 2JWLA 3ZX3A 1BA0A 2CGJA 2WUSA 4C8LA 4GMJB 2BDPA 1IKYA 4B1UB 4L8RB 1QVGM 3C65A 1Y97A 2QXFA 1QE1A 2HHHK 4FXDA 4DV5K 2QEXN 4L3QA 3O1WA 2PYJA 2P9NA 4DFMA 4F3TA 1J6ZA 3MX2A 4CJQA 3CFRA 4FZZA 4B9SA 5BRDA 3CD6N 4CBWA 3RTVA 4YDUC 3A8YA 2Q3SA 3BF3A 2ZJPL 2NNWA 2DTUA 1Q7YO 4IOXA 3I0SA 5JLFA 1KVCA 3SQ2A 4PHTX 4CI6A 3CFOA 4B1VA 4E72A 3ZX0A 2GEMA 1KLNA 4CEBA 1J5EK 4BRQA 5HP1A 3E01A 4PL8A 1QSSA 2YKNA 4OJRA 1Q9YA 3QO9A 4O5BA 2HBKA 1NGCA 4B9VA 1C1AA 3TWHA 4CCHA 4CGJA 2JLEA 1XI1A 1U04A 4JD2A 1TKDA 4KHSA 2P9NB 3HSCA 2V7ZA 4DF4A 2QKBA 1WBBA 1S1WA 3P38A 5AQXA 3PX0A 4DSLA 4LF4K 1S1UA 3O1BA 1HJOA 2Q31A 3KWIA 3RMDA 3V6DA 3VEWA 4DTNA 1VQ4N 1TAQA 1Q9XA 4WFAL 4CZFA 1SQKA 4CJUA 4YOYA 3BEXA 1SKSA 3CCEN 2H3GX 3L6QA 1HNXK 1KXPA 3CCUN 1Z6RA 4E7KA 3I55N 4K42A 4KI6A 1KVAA 4CZEA 3QEVA 3A5NC 5AQSA 3ULDA 4FPBA 4ILGB 4CZLA 3AVGA 4BR5A 1FW6A 1UWBA 3VESA 3KK3A 3V4IA 4BDYA 3LP0A 4JD2B 2ZWHA 4CGIA 2HF4A 4IEEA 4B3RK 1YJ9N 3U3YA 3PY8A 1QSLA 4WQ4C 1U49A 4AHUA 4FWPA 3DI6A 3LDNA 4EFHA 4FWQA 4Y1DA 4DR3K 3FZHA 3K5LA 2KFNA 3CI5A 2WOMA 4ID1A 4DUZK 2GX9A 1W2BM 2E88A 3AAPA 3VMFB 3UKUA 3U9ZA 4QS8A 2Q97A 1GLBG 4CEFA 3A5MC 5TKWA 4DQPA 2DFHA 4MFBA 5AQVA 1VQ9N 3OJSA 3AGRA 3AGKA 4A62A 1FKOA 4M3XA 4OKEA 2HF3A 2W40A 4JK8A 3EKUA 1VRTA 1KFSA 2WTUA 3HTVA 3AAQA 3OS1A 3CCLN 3QEIA 2I7PA 3ZSXA 4PL7A 3FLCO 4IEIA 4W5OA 1MDUB 3ZT4A 3MN6A 2EHGA 1LAVA 1S22A 1C0GA 3QDKA 5IWAK 3CYGA 1EQYA 4LSLA 3UKUB 2PFUA 4KREA 1K6YA 2UU9K 2VYPA 4HTUA 4W5QA 4A61A 3O4QA 3ISNC 3WNGA 4NYFA 5C10A 4LFCK 3O9RA 1R59O 2EWSA 5GAEP 3P31A 2W41A 4XH4A 4NCBA 3ZSYA 2O4IA 1G15A 1NOYA 3SMPA 4PY5A 1VQ6N 4CZMA 4EHUA 1YVNA 2X78A 4IBNA 1NMDA 4JLHA 4B1WB 3I8DA 3H46O 3A2FA 4BE2A 1DKGD 3TABA 3SUNA 4MLHA 1A5VA 3QFPA 3JS6A 2O8CA 3KHYA 4DR2K 1VK0A 5EXWA 1T3VA 4UQGA 1W9HA 3AVMA 2A6AA 5KTQA 2UUBK 4CJ5A 3LPUA 2HBJA 3KLHA 1SUQA 3ULEA 4C8OA 1P8ZA 2HB5A 3ATUA 4DS4A 4CJRA 3VTHA 4H5RA 4JI1K 2KTQA 3HP6A 3RR7A 4B9LA 2QK9A 3ZSRA 5FPDA 2KFZA 5BN8A 3SUQA 1RBSA 2GELA 4CHQA 5SZTA 1VQON 4H0YB 3QLHA 1BHLA 3J81O 4DSEA 3IS9A 2HNDA 1NOZA 2O8CB 4LSNA 1GOBA 3M3ZA 2PY5A 1QTMA 4E7HA 1NGBA 2F9TA 2QWMA 2GWJA 1HQUA 3DLGA 3H3OB 5AQNA 1O1WA 5KPTA 2ZGYA 2JGUA 5BPLA 1RDCA 3O9TA 5AZJA 3CXCM 1YI2N 3ULEB 2P9SA 3WNEA 4OPHA 3W0LA 2RN2A 1FKPA 3K5OA 1OVYA 4Y0WA 2QWRA 2WONA 4YOTA 3SAGA 1QQOA 5LL6Z 3KLEA 3VGKA 2G8KA 3GDQA 3QINA 2NRWA 1OH5A 4DWIA 1JLCA 5CZ2A 3SAFA 3CPWM 3UE5A 3JAMO 2XY6A 1X9MA 2XY8A 4RW6A 4FLZA 5BREA 3Q7BA 5KPRA 4DR1K 4GNIA 2Z1HA 4DV7K 2E5LK 5EX5A 4Z4GA 3TAMA 2OPRA 2XY7A 1OH8A 2UXDK 1EWQA 5AZJB 1ATNA 3NCIA 4O0JA 2P9SB 1MWMA 1ATRA 2VWKA 4CF8A 4B9NA 4KH5A 3ZX2A 3SAHA 2ETJA 4B3SK 2BUPA 4X66K 4DTJA 3KD1E 2CGKA 2YNIA 1XQSC 2KHOA 4J2DA 5CR4A 1K9MO 2NUBA 1QZ5A 4WFBL 3ENBA 3I56N 4CFDA 5BRFA 1SL0A 4Q0BA 5IT9O 3JYTA 1HNWK 4OGEA 3NF7A 3TTFA 1X9JA 2NRRA 3CC7N 3PO4A 2HHUA 2GUPA 1NJWA 1KAYA 3ZSQA 3FGUA 4FJLA 1V4TA 4BR0A 3R8EA 4KHPK 5AFUH 1S6QA 5M1PA 2NLXA 1S6PA 3EZ5A 4HWIA 4FWOA 4V19S 5J1EA 3QBWA 4B8AB 1DT9A 1RT7A 1BU6O 4BROA 3BP8A 2CGLA 3K0SA 4DU1A 5LMUK 3HXMA 3CCRN 4CD1A 1BGXT 3CJAA 5GIPA 3G4SN 4O0IA 1JL1A 4JKCA 3H3NO 4CZGA 4DV4K 1NG9A 5DMRA 1U48A 4FK2A 5AQKA 1VQ5N 4CD3A 3WNHA 2OPPA 1ZC6A 4XH5A 3OTOK 3NGZA 1QHTA 3MN7A 4RW9A 3KLFA 3RMCA 4IOCL 1XWLA 1JKHA 3VQPA 5EOYA 3PSIA 2QXLA 4PQUA 1JCGA 5MLCQ 3HI0A 3KTQA 1CZ9A 2YHWA 4CZJA 1EO1A 4C8KA 3AVFA 4CIFA 4J2EA 3OYKA 4XH1A 2VGMA 3K5NA 4YOVA 5CZ1A 3HPOA 1S5JA 3B6PA 1ZBIA 4XJXA 1JLQA 2OTJN 4BRIA 4CK2A 4IO9L 3VN5A 4Y1CA 2PAVA 1TV6A 4AHTA 3HPGA 1MWKA 1TKZA 4RCHA 4OPAA 3CCMN 3HOSA 4JV5K 3L3VA 1U6ZA 1LW0A 4JKFA 1VSJA 1S9GA 1UA0A 4M45A 3QEPA 3DOLA 4MO5A 4FJIA 4DLGA 3IRXA 1C0TA 2QW9A 4KH4A 3QEXA 4Z94A 2A3ZA 1BCOA 5DM6L 2VG5A 5KRTA 2O4GA 4K25A 4BRCA 3L3UA 3K2PA 4FK0A 3JSMA 3C7NA 3O08A 4DTPA 5AQFA 2E6LA 3V9UA 2HMPA 3B8AX 5AQGA 3QESA 3THVA 2X6SA 5CHIA 1I39A 1NK7A 3OYBA 4YOWA 3A5LC 4CW7B 3IAYA 4OPJA 4CZIA 2C1IA 3L2QA 3C6TA 3SUPA 1N34K 3MAQA 4EHTA 3BUZB 1NNEA 1DTTA 1LOTB 2PYLA 4FJKA 3VF6A 4HCCA 3KLIA 2BH1A 1YJWN 4F3OA 1BQNA 5AQZA 2YNFA 3TTCA 4CE9A 4ELTA 4BE0A 1C0MA 3HSTB 1S72N 5AQWA 1QHAA 4FLUA 1K8AO 4PKIA 2HMIA 4DR4K 4BC2A 3HVRA 4FYDA 3C7NB 3DM2A 3I8BA 1RTJA 4CEQA 2YHAA 3CMEN 4JKAA 3KVGA 3LDQA 4BWMA 3OYEA 3C95A 3F9KA 4CZHA 3E9LA 3VQ7A 4HHTA 1YJNN 2HVHA 3CC2N 4JEPA 4W5RA 1HUXA 3QETA 1X9SA 3M6GA 3WUHA 2ATQA 5JVHL 3GOIA 4I2PA 4DUYK 1UA1A 4ILHA 4BQLA 3M5RA 4HUFA 1NJYA 3THYA 4H0XB 1CZAN 2LSNA 3HBTA 3PIPL 4IO8A 4WQ4A 2G8WA 4CJWA 3HOTA 4BECA 2IDOA 3ALYA 1WSEA 4JKEA 3AO4A 4CHZA 4CGHA 3WNFA 2W00A 1JLGA 2Z1IA 3OJUA 5JENA 1C6VA 4JKHA 4E7IA 2V51B 4ISFA 3OYFA 3OYIA 1T6DA 4H0VB 2AA4A 2BE2A 1TGOA 4IFEA 3H6EA 4J2BA 3N4QA 3TSPA 1DTQA 4H0PA 5AQRA 3CIPA 3O3GA 2ZM6K 3AA2A 4I6MA 5DM7L 3NF8A 1E4FT 1B9FA 4CJ4A 3HRGA 2KLAA 2DFEA 3WQTA 4BR4A 3OS2A 3THYB 2QA4N 1JXBA 4FZYA 2D1KA 4CFBA 1RTHA 2XO7A 4FLYA 4C23A 3WT0A 2FC0A 4DSJA 1Z25A 1XMOK 3OYLA 3DYAA 4FJ8A 1X3MA 2YI1A 4B1YB 3QEWA 3DRPA 1RDDA 4DQSA 1SV5A 3HPHA 4BR2A 2FBXA 3NVKA 4B08A 2OZSA 1WUAA 3P83D 1V4SA 1SL1A 1GLAG 1NJIO 5FROA 1LWCA 3VF4A 3ID8A 2RE2A 4DS5A 1C0FA 4FWMA 2YX6A 2HSTA 4AH9A 3TANA 1UAXA 2CH6A 4W5TA 2P9IA 4I6MB 3DAWA 3KKSA 4KI4A 1CXQA 3C6AA 3AA4A 3AO5A 3CM6A 4QCLA 4WF9L 4BRGA 1ZBLA 1RT4A 1TKTA 4A5BA 2PBDA 1JCFA 1H1VA 2Q1NA 5CYMA 4FPAA 3SQ1A 1RDUA 2NRHA 3EE9A 3AO2A 4CGGA 3LWMA 2IGIA 3MWPA 1IH7A 2FXUA 3DXKA 3KK7A 1SZ2A 3AVLA 3V1OA 3ZSVA 4BC3A 1VQPN 2QWLA 3NVMA 4JI7K 1YAGA 2YHYA 1NGAA 4XIUA 3LM9A 1NKBA 3QNNA 3FZMA 2HHTA 1LAWA 2GTDA 5JS1A 3R1XA 2P9IB 4ISGA 2HNZA 2D4WA 4O5FA 1EKEA 3BY5A 2VG6A 3O6WA 3U8XA 3SK3A 4BC5A 4CJLA 4BR9A 4J8FA 4AHRA 3VEXA 1U2VA 3HT3A 3DXKB 3NAEA 3RR8A 4KB0A 4LF8K 3WXLA 5FLXO 2W6LA 3VQCA 5C2FA 4FCYA 3EL2A 2D0OA 2XY5A 3MWTA 3T1YK 3M1FA 4TSXA 4CK1A 1W0HA 2AJQA 1RGIA 4EP5A 5M1NA 2NRXA 3PUFA 4PA1A 4LF5K 4YHHK 3RVCA 1Q82O 1BUPA 4A59A 3D2EA 4CJVA 1ESVA 2G8FA 4AHVA 3J80O 1MA9B 4FOEA 4R79A 3TAFA 4OLAA 2P1JA 5T7BA 4KB1A 2FBYA 4KPYA 4Z4IA 3DXMA 1BA1A 2E2QA 1HPZA 4BVPA 2O8DA 4KRFA 1RDWX 4BGAA 2IS3A 2YJEA 3DLBA 3EE8A 5AQIA 2CH5A 4O8KA 4JRQA 4IOAL 1FJGK 5KI6A 1DLOA 5C2DA 4DV2K 4FJ7A 2KZZA 4B9TA 3MMVA 3OYNA 2A5XA 3HJFA 4NO7A 4CEDA 3PX4A 3D2EB 1KD1O 3J7YP 4IFVA 1E4GT 1WLJA 5AQQA 3TAPA 4HVJA 2IAJA 3DXMB 2F9WA 3KKRA 4BRKA 1QSYA 2O8DB 2P9UA 1SL2A 4CJTA 4LY7A 4H0TB 3RRHA 1SAZA 3AA5X 3S41A 1GLEG 3IUCA 3CM5A 2NRVA 4CF9A 2YCHA 3WXMB 3V9XA 4FLWA 3THXA 2A1SA 2D0CA 5AZIA 1HKGA 2OA8A 5J2NA 3TARA 1XC9A 5HBMA 4JI8K 1VSLA 2E2OA 1JCEA 2QKKA 4FLVA 3P39A 3GE1A 3H1VX 5CYQA 4O55A 4LFAK 3EN9A 4N56A 4B3MK 3H45C 1WNSA 4AM6A 4QAGA 2YV0X 1YT3A 4I9LA 1R0AA 3FZFA 3FZLA 3CJ9A 2P9UB 4FJMA 2I5JA 3TPQA 1VQKN 4RWTA 4RW7A 3D7EO 3MN5A 4K41A 3T3FA 1TK5A 2VWBA 3IKMA 3VGMA 4I7FA 4WCEL 2PZSA 2E2PA 2UXBK 4WYBA 1NBWA 3CCQN 5GAGP 2VQEK 3Q7CA 2WFBA 3A0IX 3THXB 1YXQA 1B9DA 5AZIB 3LZIA 3BZKA 3U3GA 3ZYYX 1ASVA 1XHXA 4B3TK 1A5WA 1GLCG 2Z1JA 2HHVA 3KIOA 3VTIA 3HO1A 1VSMA 1WSHA 4O4GA 2RPIA 4JN4A 3VETA 4BRNA 4X64K 1JJ2M 3EY1A 3LAKA 4C1NI 3IMXA 3ITHA 4CJKA 1NGFA 2IIRA 3O5BA 1ZBSA 2Q2RA 5C42A 4OX9K 3SPZA 3WXJA 3SV3A 5C24A 2IVNA 3RSEA 1FXXA 2VWJA 5AJ3K 4WQ5C 3L8BA 4B3OA 4CBUA 1RNHA 2O8EA 4RG8A 4YFUA 1LWEA 1JXEA 2IVOA 3PX6A 3JXUA 3VQ9A 4H4OA 2BANA 4CEAA 4OVLA 4FJGA 2RKIA 2D0PA 4DTXA 4LF7K 3T69A 1S1TA 1YVUA 3AVNA 5BN9A 4F8RA 3AVKA 1IBMK 4OO1J 2KZMA 4BRDA 2GUIA 2BGGA 3AO1A 4BE1A 3O9QA 3PO5A 3KK2A 4I9QA 3F5TA 3E66A 2ZF5O 4FJXA 2ASMA 1XHZA 4IXCA 3S3OA 3J7ZO 1KTQA 3D6RA 1BL3A 5KGXA 3RSEB 1WAJA 3P4IA 3NF6A 3C6HA 3C94A 1QQMA 3NH2A 2O8EB 4GVEA 4JI3K 1RT1A 1J54A 3CYMA 4DCHA 1ILYA 4AILC 3ZT0A 2I7NA 4FK4A 3TTDA 4E7LA 3IFRA 1HPMA 5HRNA 4CJEA 5FRMA 1BIZA 4IZ9A 2QI2A 1C0UA 4JKDA 4FW2A 3M8RA 1HX1A 3W3DA 5J2QA 2P5GA 4MDAA 3ATVA 1Q8IA 3ID6A 4FJJA 1L5UA 2O8FA 4QOZB 1KLMA 3G6EN 1LCUA 2D5RA 3OHRA 2W42A 4Z4FA 1VSFA 5FRNA 3SYZA 3NF9A 1HKCA 1N5YA 4RW4A 1NWKA 3LP2A 3L2VA 2OYQA 3E1YA 3SQ4A 5GINA 1BG3A 2Q0RA 2F4VK 1NJZA 3VQAA 2GBZA 4CK3A 4UY8O 4CHPA 4JI4K 3CF5L 3OW2M 3LWLA 2X6NA 2KKZA 1NJXA 4JI0K 3O8MA 4A57A 1FK9A 4FL9A 4GV9A 3VQEA 3SBGA 2UUCK 1WAFA 1LV5A 5CY4A 4CBXA 4YORA 4ELUA 3ZT2A 2UUAK 5GAHP 4DG1A 1S3XA 3TSUA 2Y1JA 2ZJRL 2O8FB 3VA3A 4Z4CA 1TKXA 3AY9A 1JL2A 2B4JA 2VQFK 3TAGA 4DQQA 4H8KA 4M3YA 3GL1A 5JVGL 5GADP 3PLAA 1HYSA 5EY4A 3CJCA 1VRUA 4G1QA 2Q36A 3DLLL 1WB9A 3EKSA 3TR8A 4BG8A 4KHNA 2X74A 1S9EA 4YY3K 4BRFA 4DLEA 4A2AA 1T7PA 3K5MA 4BGBA 4KHUA 1GLDG 2FSNA 1RT6A 3V1RA 2YKMA 4JHDA 1TK8A 2FSJA 5C0YA 4DV0K 3KZBA 5BR9A 3O80A 3WXKA 4H03B 3DLRA 4ZTJA 1SKRA 2WBNA 4NYNA 3S3NA 1CXUA 3OY9A 3KLGA 1O13A 2ZE2A 3S3MA 3VQBA 4ILJA 4DV1K 4YDUA 3R3LA 2BTFA 1N33K 4DTUA 5KPZA 4DTMA 4J2AA 4GKJK 5HLFA 1EX4A 3LZJA 1RDBA 4KTZA 4BC4A 3AVIA 1C1BA 4M41A 1L3UA 5JS2A 3CJ1A 3DLHA 2RHKA 4FJ9A 5CE3A 3ZLJA 5KQDA 2Q0UA 4JHDB 5C15A 2P9PA 3KWGA 3G71N 4OPKA 1BDGA 1HNVA 3AVCA 4BE7B 4M3UA 1VQNN 3AVBA 4DSFA 4FWNA 2E1ZA 5M1QA 1Y64A 1EXQA 3OS0A 4M3TA 5AQYA 3G10A 4CESA 1NMNA 5AQHA 5JICA 2HNYA 4M3WA 4DB3A 4DV3K 3A5OC 4NXMK 5F1XA 3MEEA 4C8NA 3HZ6A 3J8AA 3AV9A 4K8XA 2QWOA 4FZXC 1HRHA 3VQQA 5E84A 1QZ6A 4M42A 4FM1A 1U47A 1XNRK 1VSHA 3VQ5A 2UYTA 2P9PB 3FFIA 1XUPO 1D9FA 4MLEA 1T8EA 3PV8A 3MDQA 2FF6A 4DR5K 4CIEA 1NGJA 1IBLK 2NRZA 3SZ2A 3LP3A 2DPNA 1Q86O 1JLAA 3HL8A 3WXIA 5C25A 3QB0A 3FE1A 5JLHA 4RW8A 5AQMA 3L4QA 3V9SA 3M8SA 4AF1A 2HBLA 5I9EB 1VQ7N 1BI4A 3U4LA 1IKWA 3T19A 1GOCA 4H4MA 3T7ZA 4BRMA 1NKEA 1OH6A 1ITGA 3FFKB 2NRTA 4FWLA 1GLFO 4BDZA 3AVJA 1T03A 5FDLA 1NK4A 5LJVA 3G25A 1ASWA 1WOQA 2QWNA 3K9KA 3SQ0A 4FLXA 4M63C 2EX3A 4LF9K 4IJNA 2YHBA 1A5XA 1HMVA 1JLEA 1RT2A 4LC9B 5F2RA 3HYFA 4BRLA 1EP4A 1CZBA 3AVAA 4A5AA 1RBRA 4BY9C 4BRHA 3NHGA 3IG1A 3C0BA 1QQNA 5FPNA 4B1ZA 4CIGA 1IKXA 4X65K 3LDSA 3EEQA 1BI4B 2A40A 4IWVA 4KHYA 1VSIA 4OKJA 1KCFA 3ZSWA 5HROA 4KHQA 4C1NK 4DFPA 1N8RO 1ZBUA 4BRAA 5BRHA 5C12A 3K9JA 1HQEA 1RCHA 3BGRA 1VQLN 4NB4A 4OKKA 3VENA 5KQ8A 3K57A 4KTQA 3VEVA 3THWA 4CF2A 3BF1A 1VSDA 3QBXA 3F73A 4OGCA 1T44A 5J2PA 2VGNA 1HKBA 5AQJA 3WQUA 3O4NA 3S5TA 3O9SA 3CJBA 4E0DA 1KAZA 3LANA 4DMNA 1NK8A 3TAQA 2FSKA 3RMBA 1OH7A 2QWPA 4R5PA 1U45A 2C1GA 1M1KO 3VQ6A 4CF0A 2F7TA 1TVRA 1ZBHA 3MK6A 3CHWA 1YHQN 3QIOA 5LJWA 5LY3A 4CZKA 5BPNA 3KK1A 3ZETA 2E2NA 3N4PA
chains in the Genus database with same CATH topology
3U9DA 3CETA 2NLXA 3TPQA 1VQKN 1Q81O 5AR0A 4QS9A 4RWTA 2ZGZA 4B1XB 4BQZA 3D7EO 3MN5A 4HWIA 4K41A 4BVOA 4FWOA 4E1JA 4M7YA 2VWBA 3QBWA 3IKMA 4H5VA 4PKHA 4FVUA 2VCPA 1DT9A 3VGMA 4WCEL 1BU6O 2E2PA 2E20A 4WYBA 1NBWA 3FZKA 4BROA 4BRPA 3BP8A 2CGLA 2A42A 2HOEA 5FPEA 1HLUA 5GAGP 3Q7CA 2WFBA 3CCQN 3CCSN 3A0IX 3TU5A 4JNEA 1YXQA 3CCRN 4CD1A 3CJ7A 4B9QA 1X3NA 1YUWA 5AQUA 5AZIB 3CJAA 5GIPA 3G4SN 4IDHA 4O8UA 4JKCA 4CZGA 3H3NO 4MDBA 4JAXA 3ZYYX 2P9KA 4JKGB 5AQKA 4CD3A 1GLCG 1VQ5N 3ZEUA 4EAHD 1ZC6A 4XH5A 1YF5L 3I33A 3VTIA 3MN7A 4WQ5A 3QMLA 4JN4A 3VETA 4BRNA 4DQ8A 3MN9A 1JJ2M 1NGGA 4C1NI 4IOCL 3IMXA 3OBYA 2V52B 5EOYA 1NGFA 2IIRA 3DWLA 2QXLA 4RTFD 3O5BA 4BEBA 5ADXH 1ZBSA 1K8KB 2Q2RA 3H1QA 3ZETB 1JCGA 4K43A 5MLCQ 5H1SQ 3HI0A 4H5NA 1VAZA 2YHWA 3WXJA 3CQYA 3MCAB 4CZJA 2YHXA 1EO1A 2IVNA 3RSEA 3PIOL 4H5TA 4FWSA 1XC3A 3LL3A 4WQ5C 3VPZA 4CBUA 2NZTA 5AFUA 2IVOA 3R9PA 4ISEA 1U2VB 4XH1A 2VGMA 3O9UA 2QTDA 4YOVA 3JXUA 2FLOA 1GLJO 2D0PA 1Q18A 4XJXA 2P9KB 4JK9A 5AQOA 1G99A 1NM1A 3ZEUB 5M1KA 3EZWA 3T69A 4KBOA 4BRIA 4IO9L 2OTJN 4QS7A 5BN9A 2PAVA 1MWKA 4MO4A 4RCHA 4OO1J 4OPAA 4DKWA 3HOSA 3CCMN 3CMAN 4BRDA 1U6ZA 2E8AA 3F2KA 4JKFA 4PKGA 4JKBA 3O9QA 4MO5A 1DGKN 3F5TA 3E66A 2ZF5O 3E9OA 3CC4N 2QW9A 1BOTO 4KH4A 2ASMA 4IXCA 4Z94A 2A3ZA 3D6RA 4IJAA 5DM6L 3J7ZO 2JWLA 5LY3A 5HOOA 3RSEB 4A2BA 3ZX3A 3P4IA 2J4RA 3C6HA 4K25A 4BRCA 1BA0A 1QQMA 2CGJA 4GVEA 2WUSA 3C7NA 3O08A 5AQFA 4B1UB 4DCHA 1ILYA 1QVGM 3C65A 2HMPA 3B8AX 2I7NA 5AQGA 3UKRA 3TTDA 3SJHA 2QEXN 4L3QA 3O1WA 5CHIA 3IFRA 2P9NA 1HPMA 4YOWA 3A5LC 1J6ZA 3MX2A 4CZIA 2C1IA 1IG8A 5BRDA 4NLBA 4IZ9A 4EHTA 4KH6A 3CD6N 3BUZB 2QI2A 1GLLO 1OKJA 1LOTB 4CBWA 4YDUC 3A8YA 2ZJQL 4JKDA 3VF6A 2BH1A 1YJWN 1HX1A 3W3DA 3BF3A 2ZJPL 4MDAA 2NNWA 5AQZA 3EO3A 3ATVA 1Q7YO 3ID6A 3F9MA 4IOXA 1VQ8N 3TTCA 5JLFA 4PHTX 4CI6A 4B1VA 3ZX0A 1S72N 3G6EN 1LCUA 3OHRA 2GEMA 5AQWA 3VOVA 1QHAA 1K8AO 4BRQA 3L0QA 4PKIA 4PL8A 4BC2A 3C7NB 3I8BA 1HKCA 3CMEN 2HBKA 1NWKA 4JKAA 3KVGA 1NGCA 3LDQA 3E1YA 5M1OA 5GINA 4WFNL 1BG3A 2Q0RA 3UKRB 2FF3B 4JD2A 1NLVA 4UY8O 4CZHA 2P9NB 3HSCA 2V7ZA 3CF5L 2ITMA 3P38A 5AQXA 3E9LA 3OW2M 3O1BA 2KKZA 1HJOA 3O8MA 2OANA 2Q31A 5B8HA 4A57A 1YJNN 4FL9A 3CC2N 4GV9A 3KWIA 4JEPA 1NGDA 3SBGA 1HUXA 3CQXA 3VEWA 4CBXA 3M6GA 4YORA 5E26A 3WUHA 1VQ4N 5GAHP 2P9LA 3VEYA 5JVHL 3GOIA 1S3XA 4ILHA 4BQLA 4WFAL 3M5RA 4CZFA 1SQKA 3TSUA 2ZJRL 4FWRA 4YOYA 3BEXA 3CCEN 4H0XB 2H3GX 3L6QA 1YITN 1CZAN 1KXPA 3CCUN 3HBTA 3PIPL 1Z6RA 4IO8A 4WQ4A 3I55N 4K42A 3HOTA 3AY9A 4BECA 4CZEA 3A5NC 5AQSA 4FPBA 4JKEA 4ILGB 4CJ7A 4CZLA 3GL1A 5JVGL 5GADP 3PLAA 4BR5A 2IVPA 2W00A 3VESA 4JKHA 5HL7L 5EY4A 3CJCA 2V51B 4ISFA 4JD2B 4GV3A 4HTLA 2Q36A 3DLLL 2ZWHA 1T6DA 3EKSA 4H0VB 2AA4A 2HF4A 4BG8A 4IEEA 3OBWA 4IFEA 3H6EA 1YJ9N 3N4QA 3TSPA 3SBTA 4H0PA 4BRFA 4A2AA 4WQ4C 5AQRA 4BGBA 1GLDG 4FWPA 3CCJN 2ASPA 3CIPA 3LDNA 2FSNA 4EFHA 4I6MA 4FWQA 5DM7L 1E4FT 3WEEA 3HRGA 2P9LB 2KLAA 3WQTA 4BR4A 3FZHA 3CI5A 4JHDA 4FOIA 2FSJA 5C0YA 5BPMA 4NLCA 2GWKA 2QA4N 2GX9A 3KZBA 5BR9A 2D1KA 3O80A 1W2BM 3WXKA 2E88A 4H03B 3AAPA 2WBNA 3VMFB 5EVZA 5AQTA 3UKUA 3GBTA 3U9ZA 4C23A 3WT0A 4QS8A 2Q97A 1GLBG 1O13A 4BR7A 4ILJA 3A5MC 5ADXA 4YDUA 1X3MA 5TKWA 2YI1A 4BREA 4B1YB 2YJFA 5AQPA 3R3LA 4BR2A 2BTFA 2AP1A 5AQVA 1VQ9N 3NVKA 3AGRA 5KPZA 1WUAA 1DEJA 1V4SA 1GLAG 3AGKA 4A62A 1NJIO 3VF2A 3VF4A 3ID8A 2RE2A 2HF3A 2W40A 1C0FA 4FWMA 4EIAA 4JK8A 1W97L 2HSTA 2YX6A 3EKUA 1ZXOA 5JMVA 2CH6A 4BC4A 3VEOA 1KC8O 2P9IA 4I6MB 3DAWA 3HTVA 3WEEB 3AAQA 3CJ1A 2RHKA 3C6AA 5CE3A 3CCLN 4U7BA 2I7PA 4WF9L 4BRGA 2Q0UA 5KQDA 4JHDB 4A5BA 2PBDA 1JCFA 2ASOA 3FLCO 1H1VA 4IEIA 5C15A 2P9PA 3KWGA 4PL7A 3G71N 1MDUB 2Q1NA 3MN6A 4FPAA 1RDUA 1S22A 1C0GA 1BDGA 2NRHA 3EE9A 3QDKA 4BE7B 3GG4A 3CCVN 1VQNN 1EQYA 3MWPA 2FXUA 3UKUB 2PFUA 3DXKA 2QM1A 4AM7A 3KK7A 2VYPA 1SZ2A 4FWNA 2E1ZA 5M1QA 1Y64A 5ELZA 3ENHA 1KAXA 3SMSA 4A61A 3LDPA 4BC3A 1KQSM 5AQYA 3CERA 1VQPN 5AQHA 5JICA 3D2FA 5C10A 3AARA 3VGLA 1QVFM 2QWLA 3NVMA 3O9RA 1BWFO 1R59O 2EWSA 4DB3A 1YAGA 3A5OC 1P90A 1NGAA 2YHYA 5GAEP 5F1XA 3LM9A 3P31A 5M1FA 2W41A 3HZ6A 4JK7A 4XH4A 3J8AA 2QWOA 3SMPA 3FZMA 3VERA 2GTDA 1VQ6N 4CZMA 4EHUA 1YVNA 5E84A 1QZ6A 3R1XA 2P9IB 1NMDA 4ISGA 4B1WB 4FO0A 3H46O 2D4WA 3LDLA 1NGHA 1DKGD 4FWKA 4O5FA 4DHYA 5FPMA 5M1PA 5GIOA 4MLHA 3UB5A 3QFPA 3JS6A 3KHYA 2UYTA 5F0XA 1NGEA 2P9PB 1XUPO 3O6WA 4MLEA 5EXWA 1RFQA 3U8XA 1T3VA 3SK3A 3MDQA 4BC5A 2A6AA 1Z05A 4BR9A 4J8FA 2HBJA 3VEXA 2FF6A 1U2VA 1ATSA 3VEZA 3DXKB 3L4IA 3ULEA 1P8ZA 3ATUA 1NGJA 3WXLA 2NRZA 5C2FA 1TUUA 3EL2A 2D0OA 2DPNA 1Q86O 3WXIA 3MWTA 3M1FA 3D2FB 3FE1A 3QB0A 3VTHA 1RGIA 3FR0A 1IJJA 4H5RA 5JLHA 5M1NA 5AQMA 1T6CA 3L4QA 2NRXA 5FPDA 5BN8A 4AF1A 3RVCA 2HBLA 5I9EB 1VQ7N 3U4LA 2GELA 1Q82O 3T7ZA 1BUPA 4A59A 1VQON 1TUYA 4BRMA 3D2EA 1ESVA 3QFUA 3FFKB 1MA9B 2NRTA 4FOEA 4H0YB 4FWLA 1GLFO 4R79A 3E9PA 3DJCA 3DXMA 5LJVA 3G25A 1BA1A 1WOQA 2E2QA 2QWNA 4BVPA 4GV6A 3K9KA 3M3ZA 2E1YA 3HM8A 1RDWX 2WC9A 1NGBA 3MX5A 4M63C 2F9TA 2QWMA 2GWJA 3H3OB 4IJNA 5AQNA 4BGAA 5KPTA 2ZGYA 5BPLA 2YJEA 3O9TA 3LM2A 5AZJA 3CXCM 1YI2N 1K73O 3ULEB 2P9SA 4LC9B 4OPHA 3W0LA 3OA9A 3EE8A 5AQIA 1M90O 2CH5A 5F2RA 4BRLA 4O8KA 1OVYA 2HBMA 4IOAL 4Y0WA 2QWRA 3IDHA 4YOTA 4A5AA 3SAGA 5C2DA 4BY9C 4XEIA 1QQOA 4YOUA 4BRHA 4GY2B 3R6MA 3C0BA 4BG9A 1QQNA 5FPNA 3VGKA 3MMVA 5TKYA 4B1ZA 3GDQA 2A5XA 2NRWA 3SAFA 3CPWM 3UE5A 4NO7A 2A40A 4FSVA 3D2EB 3CPEA 4IWVA 4F9OA 3ENOA 1KD1O 2A41A 1E4GT 3O4WA 4YOXA 4M7XA 5AQQA 5AQLA 4H0OA 1TYQA 4H5WA 5BREA 2OTLN 4C1NK 3DXMB 3Q7BA 1N8RO 2F9WA 4BRAA 4BRKA 4GNIA 5KPRA 5BRHA 3SLCA 5EX5A 5C12A 3K9JA 2P9UA 1VQLN 4NB4A 4H0TB 3VENA 5KQ8A 1SAZA 1D4XA 3VEVA 3S41A 5AZJB 1ATNA 1GLEG 2P9SB 1MWMA 1ATRA 3BF1A 3QBXA 3MCPA 4KH5A 3ZX2A 3IUCA 1NGIA 2NRVA 2QWQA 2YCHA 3WXMB 3SAHA 1T44A 1BO5O 2VGNA 1HKBA 2BUPA 4U67L 5AZIA 1HKGA 5AQJA 3WQUA 2CGKA 3QICA 1YIJN 1XQSC 2KHOA 3O9SA 3CJBA 5CR4A 1K9MO 4JKGA 2E2OA 1QZ5A 4WFBL 1JCEA 1KAZA 3ENBA 3I56N 5LJWA 3NMUA 2V7YA 3P39A 5BRFA 3LDOA 3GE1A 3H1VX 2FSKA 2QWPA 3TTFA 1X9JA 2C1GA 2NRRA 1M1KO 3CC7N 3EN9A 2GUPA 1KAYA 1TYQB 3TSQA 2F7TA 4G9ZA 3H45C 1SS6A 3MK6A 4AM6A 3CHWA 2JWKA 3FGUA 1YHQN 3FZFA 1K8KA 1V4TA 3CJ9A 3FZLA 2P9UB 3R8EA 5AFUH 4BR0A 4CZKA 5BPNA 1VQMN 3ZETA 2E2NA 3N4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9D A;  3CET A;  2NLX A;  3TPQ A;  5AR0 A;  4QS9 A;  4RWT A;  2ZGZ A;  4B1X B;  4BQZ A;  3D7E O;  3MN5 A;  4HWI A;  4K41 A;  4BVO A;  4FWO A;  4E1J A;  4M7Y A;  2VWB A;  3QBW A;  4H5V A;  4PKH A;  2VCP A;  3VGM A;  1BU6 O;  2E2P A;  2E20 A;  4WYB A;  1NBW A;  3FZK A;  4BRO A;  4BRP A;  3BP8 A;  2CGL A;  2A42 A;  2HOE A;  5FPE A;  1HLU A;  3A0I X;  3TU5 A;  4JNE A;  1YXQ A;  4CD1 A;  3CJ7 A;  4B9Q A;  1X3N A;  1YUW A;  5AQU A;  5AZI B;  3CJA A;  4CZG A;  3H3N O;  4JAX A;  2P9K A;  5AQK A;  4CD3 A;  1GLC G;  3ZEU A;  4EAH D;  1ZC6 A;  4XH5 A;  3I33 A;  3MN7 A;  4WQ5 A;  3QML A;  4JN4 A;  3VET A;  4BRN A;  4DQ8 A;  3MN9 A;  1NGG A;  3IMX A;  2V52 B;  5EOY A;  1NGF A;  2IIR A;  3DWL A;  2QXL A;  4RTF D;  3O5B A;  5ADX H;  1ZBS A;  1K8K B;  2Q2R A;  3H1Q A;  3ZET B;  1JCG A;  4K43 A;  3HI0 A;  4H5N A;  2YHW A;  3WXJ A;  3CQY A;  4CZJ A;  2YHX A;  2IVN A;  3RSE A;  4H5T A;  4FWS A;  1XC3 A;  3LL3 A;  4WQ5 C;  3VPZ A;  4CBU A;  2NZT A;  5AFU A;  2IVO A;  3R9P A;  4ISE A;  1U2V B;  4XH1 A;  3JXU A;  2FLO A;  1GLJ O;  2D0P A;  1Q18 A;  2P9K B;  5AQO A;  1G99 A;  1NM1 A;  3ZEU B;  3EZW A;  4KBO A;  4BRI A;  4QS7 A;  5BN9 A;  2PAV A;  1MWK A;  4MO4 A;  4RCH A;  4BRD A;  1U6Z A;  2E8A A;  4PKG A;  4MO5 A;  1DGK N;  2ZF5 O;  2QW9 A;  1BOT O;  2ASM A;  4IXC A;  4Z94 A;  2A3Z A;  4IJA A;  5LY3 A;  3RSE B;  4A2B A;  3ZX3 A;  3P4I A;  2J4R A;  4K25 A;  4BRC A;  1BA0 A;  1QQM A;  2CGJ A;  2WUS A;  3C7N A;  3O08 A;  5AQF A;  4B1U B;  4DCH A;  2HMP A;  3B8A X;  2I7N A;  5AQG A;  3UKR A;  3SJH A;  4L3Q A;  3O1W A;  3IFR A;  2P9N A;  1HPM A;  3A5L C;  1J6Z A;  4CZI A;  1IG8 A;  5BRD A;  4IZ9 A;  4EHT A;  3BUZ B;  4CBW A;  1GLL O;  1OKJ A;  1LOT B;  4YDU C;  3A8Y A;  3VF6 A;  1HX1 A;  3W3D A;  3BF3 A;  5AQZ A;  3EO3 A;  3ATV A;  3F9M A;  5JLF A;  4CI6 A;  4B1V A;  3ZX0 A;  1LCU A;  3OHR A;  2GEM A;  5AQW A;  3VOV A;  1QHA A;  4BRQ A;  3L0Q A;  4PKI A;  4PL8 A;  4BC2 A;  3C7N B;  3I8B A;  1HKC A;  1NWK A;  3KVG A;  1NGC A;  3LDQ A;  1BG3 A;  2Q0R A;  3UKR B;  2FF3 B;  4JD2 A;  1NLV A;  4CZH A;  2P9N B;  3HSC A;  2V7Z A;  2ITM A;  5AQX A;  3O1B A;  1HJO A;  3O8M A;  2OAN A;  2Q31 A;  4FL9 A;  1NGD A;  1HUX A;  3CQX A;  3VEW A;  4CBX A;  3M6G A;  3WUH A;  5E26 A;  2P9L A;  3VEY A;  3GOI A;  1S3X A;  4BQL A;  4CZF A;  1SQK A;  4FWR A;  3BEX A;  4H0X B;  2H3G X;  3L6Q A;  1CZA N;  1KXP A;  3HBT A;  1Z6R A;  4IO8 A;  4WQ4 A;  4K42 A;  3AY9 A;  4CZE A;  3A5N C;  5AQS A;  4FPB A;  4CJ7 A;  4CZL A;  3GL1 A;  4BR5 A;  2IVP A;  3VES A;  5EY4 A;  3CJC A;  2V51 B;  4ISF A;  4JD2 B;  4HTL A;  2Q36 A;  2ZWH A;  1T6D A;  3EKS A;  4H0V B;  2AA4 A;  2HF4 A;  4BG8 A;  3H6E A;  4H0P A;  4BRF A;  4A2A A;  4WQ4 C;  5AQR A;  4BGB A;  1GLD G;  4FWP A;  2ASP A;  3CIP A;  3LDN A;  2FSN A;  4EFH A;  4I6M A;  4FWQ A;  1E4F T;  3WEE A;  2P9L B;  3WQT A;  4BR4 A;  3FZH A;  3CI5 A;  4JHD A;  4FOI A;  2FSJ A;  5BPM A;  2GWK A;  3KZB A;  5BR9 A;  2D1K A;  3O80 A;  3WXK A;  2E88 A;  4H03 B;  3AAP A;  5EVZ A;  5AQT A;  3UKU A;  3GBT A;  3U9Z A;  4C23 A;  3WT0 A;  4QS8 A;  2Q97 A;  1GLB G;  4BR7 A;  3A5M C;  5ADX A;  4YDU A;  1X3M A;  2YI1 A;  4BRE A;  4B1Y B;  2YJF A;  5AQP A;  4BR2 A;  2BTF A;  2AP1 A;  5AQV A;  5KPZ A;  1WUA A;  1DEJ A;  1V4S A;  1GLA G;  4A62 A;  3VF2 A;  3VF4 A;  3ID8 A;  2HF3 A;  2W40 A;  1C0F A;  4FWM A;  4EIA A;  5JMV A;  3EKU A;  1ZXO A;  2CH6 A;  4BC4 A;  3VEO A;  2P9I A;  4I6M B;  3DAW A;  3HTV A;  3WEE B;  3AAQ A;  3CJ1 A;  5CE3 A;  2I7P A;  4BRG A;  2Q0U A;  5KQD A;  4JHD B;  2PBD A;  1JCF A;  2ASO A;  3FLC O;  1H1V A;  4PL7 A;  2P9P A;  1MDU B;  2Q1N A;  3MN6 A;  4FPA A;  1S22 A;  1C0G A;  1BDG A;  2NRH A;  3QDK A;  3GG4 A;  1EQY A;  2FXU A;  3UKU B;  2QM1 A;  3DXK A;  4AM7 A;  2VYP A;  1SZ2 A;  4FWN A;  2E1Z A;  1Y64 A;  5ELZ A;  3ENH A;  1KAX A;  3SMS A;  4A61 A;  3LDP A;  4BC3 A;  5AQY A;  3CER A;  5AQH A;  5JIC A;  3D2F A;  3AAR A;  3VGL A;  2QWL A;  1BWF O;  1R59 O;  2EWS A;  4DB3 A;  1YAG A;  3A5O C;  2YHY A;  1NGA A;  5F1X A;  3LM9 A;  2W41 A;  3HZ6 A;  4XH4 A;  3J8A A;  2QWO A;  3SMP A;  3FZM A;  3VER A;  2GTD A;  4CZM A;  4EHU A;  1YVN A;  5E84 A;  1QZ6 A;  4ISG A;  2P9I B;  1NMD A;  4B1W B;  4FO0 A;  3H46 O;  2D4W A;  3LDL A;  1NGH A;  1DKG D;  4FWK A;  4O5F A;  4DHY A;  5FPM A;  4MLH A;  3UB5 A;  3QFP A;  3JS6 A;  3KHY A;  2UYT A;  5F0X A;  1NGE A;  2P9P B;  1XUP O;  3O6W A;  4MLE A;  5EXW A;  1RFQ A;  3U8X A;  3SK3 A;  3MDQ A;  4BC5 A;  2A6A A;  1Z05 A;  4BR9 A;  4J8F A;  3VEX A;  2FF6 A;  1U2V A;  1ATS A;  3VEZ A;  3DXK B;  3L4I A;  3ULE A;  1P8Z A;  3ATU A;  1NGJ A;  3WXL A;  1TUU A;  3EL2 A;  2D0O A;  2DPN A;  3WXI A;  3M1F A;  3D2F B;  3FE1 A;  3QB0 A;  1RGI A;  3FR0 A;  1IJJ A;  4H5R A;  5JLH A;  5AQM A;  1T6C A;  5FPD A;  5BN8 A;  5I9E B;  3U4L A;  2GEL A;  1BUP A;  1TUY A;  4BRM A;  3D2E A;  1ESV A;  3QFU A;  3FFK B;  1MA9 B;  4FOE A;  4H0Y B;  4FWL A;  1GLF O;  3DJC A;  3DXM A;  5LJV A;  3G25 A;  1BA1 A;  1WOQ A;  2E2Q A;  2QWN A;  4BVP A;  3M3Z A;  2E1Y A;  3HM8 A;  1RDW X;  1NGB A;  4M63 C;  2F9T A;  2QWM A;  2GWJ A;  3H3O B;  4IJN A;  5AQN A;  4BGA A;  5KPT A;  2ZGY A;  5BPL A;  2YJE A;  3LM2 A;  5AZJ A;  3ULE B;  2P9S A;  4LC9 B;  3W0L A;  5AQI A;  2CH5 A;  5F2R A;  4BRL A;  4O8K A;  4Y0W A;  2QWR A;  3IDH A;  4XEI A;  1QQO A;  4BRH A;  4GY2 B;  3R6M A;  3C0B A;  4BG9 A;  1QQN A;  5FPN A;  3VGK A;  3MMV A;  5TKY A;  4B1Z A;  3GDQ A;  2A5X A;  3UE5 A;  4NO7 A;  2A40 A;  4FSV A;  3D2E B;  4IWV A;  4F9O A;  3ENO A;  2A41 A;  1E4G T;  3O4W A;  4M7X A;  5AQQ A;  5AQL A;  4H0O A;  1TYQ A;  4H5W A;  5BRE A;  3DXM B;  2F9W A;  4BRA A;  4BRK A;  4GNI A;  5KPR A;  5BRH A;  3SLC A;  5EX5 A;  2P9U A;  4NB4 A;  4H0T B;  3VEN A;  5KQ8 A;  1SAZ A;  1D4X A;  3VEV A;  3S41 A;  5AZJ B;  1ATN A;  1GLE G;  2P9S B;  1MWM A;  1ATR A;  3BF1 A;  3QBX A;  3MCP A;  3ZX2 A;  3IUC A;  1NGI A;  2QWQ A;  2YCH A;  1T44 A;  1BO5 O;  1HKB A;  2BUP A;  5AZI A;  1HKG A;  5AQJ A;  3WQU A;  2CGK A;  3QIC A;  1XQS C;  2KHO A;  3CJB A;  2E2O A;  1QZ5 A;  1JCE A;  1KAZ A;  5LJW A;  2V7Y A;  5BRF A;  3LDO A;  3GE1 A;  3H1V X;  2FSK A;  2QWP A;  1X9J A;  3EN9 A;  2GUP A;  1KAY A;  1TYQ B;  3H45 C;  3MK6 A;  4AM6 A;  3CHW A;  3FGU A;  3FZF A;  1K8K A;  1V4T A;  3CJ9 A;  3FZL A;  2P9U B;  3R8E A;  5AFU H;  4BR0 A;  4CZK A;  5BPN A;  3ZET A;  2E2N A;  5B8H A; 
#chains in the Genus database with same CATH topology
 3CET A;  5AR0 A;  3OYM A;  1RBT A;  4BQZ A;  3DRR A;  3THW B;  2G8H A;  4H5V A;  4PKH A;  3VQ4 A;  3SNN A;  3CQ8 A;  3U6F A;  1D8Y A;  4BRP A;  3MXM A;  2A42 A;  1RDA A;  4GW6 A;  3CCS N;  3TU5 A;  1MU2 A;  3L2U A;  4B9Q A;  4M3Z A;  4IDH A;  4NCG A;  2G8U A;  1I3A A;  4CJF A;  4JAX A;  3UIQ A;  1ZYQ A;  4DR7 K;  2R7Y A;  1RTD A;  3ZEU A;  4IG0 A;  2DY4 A;  1YF5 L;  3I33 A;  4WQ5 A;  3O3F A;  4KKO A;  3RMA A;  3MN9 A;  2DFF A;  1NGG A;  1NK5 A;  3V81 A;  1SKW A;  1OVQ A;  4RTF D;  4BEB A;  3PSF A;  1HNZ K;  5ADX H;  3ZET B;  4K43 A;  4NXN K;  1X1P A;  2Y1I A;  1VAZ A;  1D9D A;  1QQC A;  3MCA B;  2YHX A;  4N5S A;  4AQY K;  4H5T A;  4KAZ A;  4FWS A;  3B6O A;  1XC3 A;  2FBT A;  3DOK A;  1HJR A;  3LL3 A;  3VPZ A;  3VA0 A;  1N6Q A;  2NZT A;  2VG7 A;  3R9P A;  4ISE A;  1U2V B;  2F8T A;  4HUG A;  5SWM A;  4CFA A;  1L3S A;  2KQ2 A;  1GLJ O;  4CEC A;  1Q18 A;  3D0P A;  4JK9 A;  5AQO A;  1NM1 A;  3ZEU B;  3EZW A;  4QS7 A;  4DTR A;  1JLF A;  1WBD A;  3CMA N;  2E8A A;  4PKG A;  4JKB A;  4YNQ A;  1WSJ A;  3E9O A;  1HR0 K;  1REV A;  4ELV A;  4O44 A;  4F2S A;  4E3S A;  5HOO A;  2F8S A;  4A2B A;  2J4R A;  3RWU A;  3QNO A;  3DLK A;  2OCE A;  3BDP A;  2D0A A;  5A2Q O;  4CGF A;  3TI0 A;  4DSK A;  3M8Q A;  5E41 A;  3S9H A;  3UKR A;  4FM2 A;  3SJH A;  1NKC A;  1IBK K;  3T1H K;  1IG8 A;  4NLB A;  3M8P A;  4KH6 A;  1VSE A;  1GOA A;  1GLL O;  1OKJ A;  2ZJQ L;  1E3M A;  1HNI A;  3EO3 A;  4LF6 K;  2HHQ A;  1T05 A;  4Z0U A;  3F9M A;  3EYZ A;  1RIL A;  2F96 A;  1VQ8 N;  4LD0 A;  3VOV A;  2HW3 A;  3BZC A;  3L0Q A;  4FJ5 A;  3SV4 A;  4BDP A;  2P5O A;  3HP9 A;  2D0B A;  4CJS A;  2XHB A;  1IKV A;  1IG9 A;  1ZBF A;  2OPQ A;  5M1O A;  3KJV A;  4WFN L;  3L2W A;  5EU7 A;  3UKR B;  2FF3 B;  1J53 A;  1NLV A;  2GV9 A;  2ITM A;  4KHW A;  1TAU A;  3C6U A;  1VHX A;  2OAN A;  5B8H A;  2E6M A;  1NGD A;  1ASU A;  3CQX A;  4DU4 A;  5E26 A;  3G0Z A;  2P9L A;  3VEY A;  4EZ9 A;  2UXC K;  3QIP A;  4B9U A;  4FWR A;  3NGY A;  1YIT N;  5K14 A;  4JYA K;  3HK2 A;  4ZHR A;  4DV6 K;  2G8V A;  4CJ7 A;  4KFB A;  1YTU A;  2IVP A;  4BWJ A;  4DU3 A;  1RBV A;  1F21 A;  4CFC A;  1WSI A;  5HL7 L;  4DQI A;  4GV3 A;  4HTL A;  2ZD1 A;  1VSK A;  4N76 A;  3OBW A;  4K0K K;  1WSF A;  3SBT A;  2RF2 A;  3L2R A;  3CCJ N;  2ASP A;  4CJ3 A;  2HHX A;  3WEE A;  2IOC A;  4B9M A;  4Z4E A;  2P9L B;  5DK5 A;  1BIS A;  3V1Q A;  4FOI A;  5BPM A;  4NLC A;  2GWK A;  2KW4 A;  2HHI A;  1NU0 A;  5EVZ A;  5AQT A;  3GBT A;  1NK9 A;  2ZQB A;  3K59 A;  4I2Q A;  4BR7 A;  5ADX A;  2B5J A;  4BRE A;  1RBU A;  4DF8 A;  5KRS A;  2YJF A;  5AQP A;  1U4B A;  1NK6 A;  2AP1 A;  4Q5V A;  1LW2 A;  1DEJ A;  3LAM A;  3O3H A;  3MXI A;  3NH1 A;  3VF2 A;  4EIA A;  1W97 L;  5JMV A;  1ZXO A;  1KC8 O;  3VEO A;  3SCX A;  1J5O A;  3WEE B;  2XRI A;  4CEZ A;  4U7B A;  3SPY A;  2HVI A;  3CFP A;  2ASO A;  1WSG A;  4LH4 A;  4B8C A;  3GG4 A;  3CCV N;  3MEG A;  2QM1 A;  4AM7 A;  4LFB K;  5ELZ A;  2YNG A;  3ENH A;  1KAX A;  4CHN A;  1QS4 A;  3SMS A;  5HRP A;  3LDP A;  1L3T A;  1KQS M;  3CER A;  1TL3 A;  3RRG A;  2G8I A;  2YNH A;  3D2F A;  4F4K A;  3AAR A;  3VGL A;  1QVF M;  4CVN E;  1BWF O;  3MEC A;  4AHS A;  1P90 A;  5M1F A;  4JK7 A;  4DR6 K;  1KSP A;  3VER A;  2O8B A;  3H08 A;  4FO0 A;  3LDL A;  1NGH A;  4FWK A;  4DHY A;  3SUO A;  5FPM A;  3ZT1 A;  5GIO A;  4AHC A;  2OZM A;  3UB5 A;  4E1M A;  4HUE A;  5F0X A;  1NGE A;  1RFQ A;  4JS5 A;  1BQM A;  1Z05 A;  3ZT3 A;  1TL1 A;  2B6A A;  5HRS A;  1ATS A;  3KD5 E;  4FVM A;  3VEZ A;  3L4I A;  1RT3 A;  1TK0 A;  1XNQ K;  3OYA A;  4N41 A;  1TUU A;  1EET A;  3D2F B;  4WE1 A;  3FR0 A;  1IJJ A;  4JI6 K;  4PWD A;  4ZTF A;  1T6C A;  4EZ6 A;  3DLE A;  5KGW A;  3ZSZ A;  1KVB A;  1TUY A;  3QFU A;  4KO0 A;  3J7A P;  2O8B B;  4JRP A;  4FLT A;  3SJJ A;  3VQ8 A;  3E9P A;  4CGD A;  4HCB A;  3DJC A;  3NDK A;  5LMN K;  4GV6 A;  2E1Y A;  3HM8 A;  2WC9 A;  3K58 A;  4F2R A;  3VQD A;  3MX5 A;  4OLB A;  1K73 O;  1X9W A;  1IV0 A;  3LM2 A;  1N32 K;  3OYD A;  4E7J A;  1D5A A;  3OA9 A;  1M90 O;  3P5J A;  4KV8 A;  5D3G A;  2HBM A;  3IDH A;  3DRS A;  4XEI A;  3ZSO A;  4YOU A;  4GY2 B;  5I3U A;  3R6M A;  4CJP A;  4ID5 A;  4BG9 A;  3SI6 A;  5TKY A;  2FBV A;  4LH5 A;  1IO2 A;  4FSV A;  3CPE A;  4F9O A;  3ENO A;  2A41 A;  3O4W A;  1EWR A;  4YOX A;  4M7X A;  1RTI A;  5AQL A;  3D45 A;  4H0O A;  1BIU A;  4JI2 K;  1TYQ A;  4H5W A;  4IKF A;  3LPT A;  2OTL N;  1HYZ A;  4W5N A;  1C1C A;  1YTA A;  4E1N A;  1HYV A;  3SLC A;  3CG7 A;  1W7A A;  4DTS A;  3NH0 A;  1D4X A;  3AO3 A;  4CHO A;  2HHS A;  3MCP A;  4K8Z A;  3ZCM A;  4DQR A;  1NGI A;  2QWQ A;  2E4L A;  4FJH A;  1BO5 O;  1S1X A;  4U67 L;  4EP4 A;  4JS4 A;  4Z4H A;  3QIC A;  3NGI A;  3HM9 A;  1YIJ N;  4JKG A;  3OYH A;  4IDK A;  1S1V A;  3NMU A;  2V7Y A;  3LDO A;  1J9A A;  1XMQ K;  2P51 A;  3HVT A;  3P1G A;  3T1A A;  1TYQ B;  3TSQ A;  1NK0 A;  4G9Z A;  1SS6 A;  2JWK A;  4CHY A;  4ICL A;  1K8K A;  1VQM N;  3OYC A;  4FW1 A;  3U9D A;  4GVM A;  4DFK A;  1Q81 O;  4QS9 A;  2ZGZ A;  4B1X B;  5BR8 K;  4JI5 K;  4BVO A;  4E1J A;  4M7Y A;  4FVU A;  2VCP A;  2E20 A;  4KTW A;  3FZK A;  5FPE A;  3V9Z A;  2HOE A;  3MXJ A;  1HLU A;  4CEO A;  4JNE A;  1N36 K;  4X62 K;  4IFY A;  3CJ7 A;  1KRP A;  3OVN A;  1X3N A;  1YUW A;  4FM0 A;  5AQU A;  4M3R A;  4O8U A;  4MDB A;  2OPS A;  4CEE A;  3NE6 A;  1RT5 A;  2P9K A;  3AA3 A;  3LAL A;  4JKG B;  4EAH D;  3ASM A;  3QML A;  4DFJ A;  1L3V A;  4DQ8 A;  3V9W A;  1KFD A;  3OBY A;  5HRR A;  2V52 B;  3QER A;  3OYG A;  3DWL A;  1Z26 A;  2ITG A;  1K8K B;  4MQ3 A;  3H1Q A;  4E89 A;  4C8M A;  1JLB A;  5H1S Q;  4H5N A;  4GKK K;  1WN7 A;  3CQY A;  2Z1G A;  4DTO A;  1BCM A;  5I42 A;  3PIO L;  4BAC A;  4CF1 A;  5AFU A;  1CLQ A;  4FJN A;  3LP1 A;  3NFA A;  3O9U A;  2QTD A;  4NCA A;  4N47 A;  3OYJ A;  3TAE A;  2FLO A;  3DMJ A;  4PUO A;  1B92 A;  2IC3 A;  2P9K B;  3MED A;  1G99 A;  5M1K A;  4KBO A;  3I0R A;  1LWF A;  3NBP A;  4MO4 A;  4DKW A;  2A1R A;  3F2K A;  4IG3 A;  2HHW A;  1DGK N;  3AVH A;  1I94 K;  1UOC A;  3CC4 N;  1BOT O;  4E19 A;  5J2M A;  4DSI A;  2W6K A;  4CER A;  4IJA A;  2JWL A;  3ZX3 A;  1BA0 A;  2CGJ A;  2WUS A;  4C8L A;  4GMJ B;  2BDP A;  1IKY A;  4B1U B;  4L8R B;  1QVG M;  3C65 A;  1Y97 A;  2QXF A;  1QE1 A;  2HHH K;  4FXD A;  4DV5 K;  2QEX N;  4L3Q A;  3O1W A;  2PYJ A;  2P9N A;  4DFM A;  4F3T A;  1J6Z A;  3MX2 A;  4CJQ A;  3CFR A;  4FZZ A;  4B9S A;  5BRD A;  3CD6 N;  4CBW A;  3RTV A;  4YDU C;  3A8Y A;  2Q3S A;  3BF3 A;  2ZJP L;  2NNW A;  2DTU A;  1Q7Y O;  4IOX A;  3I0S A;  5JLF A;  1KVC A;  3SQ2 A;  4PHT X;  4CI6 A;  3CFO A;  4B1V A;  4E72 A;  3ZX0 A;  2GEM A;  1KLN A;  4CEB A;  1J5E K;  4BRQ A;  5HP1 A;  3E01 A;  4PL8 A;  1QSS A;  2YKN A;  4OJR A;  1Q9Y A;  3QO9 A;  4O5B A;  2HBK A;  1NGC A;  4B9V A;  1C1A A;  3TWH A;  4CCH A;  4CGJ A;  2JLE A;  1XI1 A;  1U04 A;  4JD2 A;  1TKD A;  4KHS A;  2P9N B;  3HSC A;  2V7Z A;  4DF4 A;  2QKB A;  1WBB A;  1S1W A;  3P38 A;  5AQX A;  3PX0 A;  4DSL A;  4LF4 K;  1S1U A;  3O1B A;  1HJO A;  2Q31 A;  3KWI A;  3RMD A;  3V6D A;  3VEW A;  4DTN A;  1VQ4 N;  1TAQ A;  1Q9X A;  4WFA L;  4CZF A;  1SQK A;  4CJU A;  4YOY A;  3BEX A;  1SKS A;  3CCE N;  2H3G X;  3L6Q A;  1HNX K;  1KXP A;  3CCU N;  1Z6R A;  4E7K A;  3I55 N;  4K42 A;  4KI6 A;  1KVA A;  4CZE A;  3QEV A;  3A5N C;  5AQS A;  3ULD A;  4FPB A;  4ILG B;  4CZL A;  3AVG A;  4BR5 A;  1FW6 A;  1UWB A;  3VES A;  3KK3 A;  3V4I A;  4BDY A;  3LP0 A;  4JD2 B;  2ZWH A;  4CGI A;  2HF4 A;  4IEE A;  4B3R K;  1YJ9 N;  3U3Y A;  3PY8 A;  1QSL A;  4WQ4 C;  1U49 A;  4AHU A;  4FWP A;  3DI6 A;  3LDN A;  4EFH A;  4FWQ A;  4Y1D A;  4DR3 K;  3FZH A;  3K5L A;  2KFN A;  3CI5 A;  2WOM A;  4ID1 A;  4DUZ K;  2GX9 A;  1W2B M;  2E88 A;  3AAP A;  3VMF B;  3UKU A;  3U9Z A;  4QS8 A;  2Q97 A;  1GLB G;  4CEF A;  3A5M C;  5TKW A;  4DQP A;  2DFH A;  4MFB A;  5AQV A;  1VQ9 N;  3OJS A;  3AGR A;  3AGK A;  4A62 A;  1FKO A;  4M3X A;  4OKE A;  2HF3 A;  2W40 A;  4JK8 A;  3EKU A;  1VRT A;  1KFS A;  2WTU A;  3HTV A;  3AAQ A;  3OS1 A;  3CCL N;  3QEI A;  2I7P A;  3ZSX A;  4PL7 A;  3FLC O;  4IEI A;  4W5O A;  1MDU B;  3ZT4 A;  3MN6 A;  2EHG A;  1LAV A;  1S22 A;  1C0G A;  3QDK A;  5IWA K;  3CYG A;  1EQY A;  4LSL A;  3UKU B;  2PFU A;  4KRE A;  1K6Y A;  2UU9 K;  2VYP A;  4HTU A;  4W5Q A;  4A61 A;  3O4Q A;  3ISN C;  3WNG A;  4NYF A;  5C10 A;  4LFC K;  3O9R A;  1R59 O;  2EWS A;  5GAE P;  3P31 A;  2W41 A;  4XH4 A;  4NCB A;  3ZSY A;  2O4I A;  1G15 A;  1NOY A;  3SMP A;  4PY5 A;  1VQ6 N;  4CZM A;  4EHU A;  1YVN A;  2X78 A;  4IBN A;  1NMD A;  4JLH A;  4B1W B;  3I8D A;  3H46 O;  3A2F A;  4BE2 A;  1DKG D;  3TAB A;  3SUN A;  4MLH A;  1A5V A;  3QFP A;  3JS6 A;  2O8C A;  3KHY A;  4DR2 K;  1VK0 A;  5EXW A;  1T3V A;  4UQG A;  1W9H A;  3AVM A;  2A6A A;  5KTQ A;  2UUB K;  4CJ5 A;  3LPU A;  2HBJ A;  3KLH A;  1SUQ A;  3ULE A;  4C8O A;  1P8Z A;  2HB5 A;  3ATU A;  4DS4 A;  4CJR A;  3VTH A;  4H5R A;  4JI1 K;  2KTQ A;  3HP6 A;  3RR7 A;  4B9L A;  2QK9 A;  3ZSR A;  5FPD A;  2KFZ A;  5BN8 A;  3SUQ A;  1RBS A;  2GEL A;  4CHQ A;  5SZT A;  1VQO N;  4H0Y B;  3QLH A;  1BHL A;  3J81 O;  4DSE A;  3IS9 A;  2HND A;  1NOZ A;  2O8C B;  4LSN A;  1GOB A;  3M3Z A;  2PY5 A;  1QTM A;  4E7H A;  1NGB A;  2F9T A;  2QWM A;  2GWJ A;  1HQU A;  3DLG A;  3H3O B;  5AQN A;  1O1W A;  5KPT A;  2ZGY A;  2JGU A;  5BPL A;  1RDC A;  3O9T A;  5AZJ A;  3CXC M;  1YI2 N;  3ULE B;  2P9S A;  3WNE A;  4OPH A;  3W0L A;  2RN2 A;  1FKP A;  3K5O A;  1OVY A;  4Y0W A;  2QWR A;  2WON A;  4YOT A;  3SAG A;  1QQO A;  5LL6 Z;  3KLE A;  3VGK A;  2G8K A;  3GDQ A;  3QIN A;  2NRW A;  1OH5 A;  4DWI A;  1JLC A;  5CZ2 A;  3SAF A;  3CPW M;  3UE5 A;  3JAM O;  2XY6 A;  1X9M A;  2XY8 A;  4RW6 A;  4FLZ A;  5BRE A;  3Q7B A;  5KPR A;  4DR1 K;  4GNI A;  2Z1H A;  4DV7 K;  2E5L K;  5EX5 A;  4Z4G A;  3TAM A;  2OPR A;  2XY7 A;  1OH8 A;  2UXD K;  1EWQ A;  5AZJ B;  1ATN A;  3NCI A;  4O0J A;  2P9S B;  1MWM A;  1ATR A;  2VWK A;  4CF8 A;  4B9N A;  4KH5 A;  3ZX2 A;  3SAH A;  2ETJ A;  4B3S K;  2BUP A;  4X66 K;  4DTJ A;  3KD1 E;  2CGK A;  2YNI A;  1XQS C;  2KHO A;  4J2D A;  5CR4 A;  1K9M O;  2NUB A;  1QZ5 A;  4WFB L;  3ENB A;  3I56 N;  4CFD A;  5BRF A;  1SL0 A;  4Q0B A;  5IT9 O;  3JYT A;  1HNW K;  4OGE A;  3NF7 A;  3TTF A;  1X9J A;  2NRR A;  3CC7 N;  3PO4 A;  2HHU A;  2GUP A;  1NJW A;  1KAY A;  3ZSQ A;  3FGU A;  4FJL A;  1V4T A;  4BR0 A;  3R8E A;  4KHP K;  5AFU H;  1S6Q A;  5M1P A;  2NLX A;  1S6P A;  3EZ5 A;  4HWI A;  4FWO A;  4V19 S;  5J1E A;  3QBW A;  4B8A B;  1DT9 A;  1RT7 A;  1BU6 O;  4BRO A;  3BP8 A;  2CGL A;  3K0S A;  4DU1 A;  5LMU K;  3HXM A;  3CCR N;  4CD1 A;  1BGX T;  3CJA A;  5GIP A;  3G4S N;  4O0I A;  1JL1 A;  4JKC A;  3H3N O;  4CZG A;  4DV4 K;  1NG9 A;  5DMR A;  1U48 A;  4FK2 A;  5AQK A;  1VQ5 N;  4CD3 A;  3WNH A;  2OPP A;  1ZC6 A;  4XH5 A;  3OTO K;  3NGZ A;  1QHT A;  3MN7 A;  4RW9 A;  3KLF A;  3RMC A;  4IOC L;  1XWL A;  1JKH A;  3VQP A;  5EOY A;  3PSI A;  2QXL A;  4PQU A;  1JCG A;  5MLC Q;  3HI0 A;  3KTQ A;  1CZ9 A;  2YHW A;  4CZJ A;  1EO1 A;  4C8K A;  3AVF A;  4CIF A;  4J2E A;  3OYK A;  4XH1 A;  2VGM A;  3K5N A;  4YOV A;  5CZ1 A;  3HPO A;  1S5J A;  3B6P A;  1ZBI A;  4XJX A;  1JLQ A;  2OTJ N;  4BRI A;  4CK2 A;  4IO9 L;  3VN5 A;  4Y1C A;  2PAV A;  1TV6 A;  4AHT A;  3HPG A;  1MWK A;  1TKZ A;  4RCH A;  4OPA A;  3CCM N;  3HOS A;  4JV5 K;  3L3V A;  1U6Z A;  1LW0 A;  4JKF A;  1VSJ A;  1S9G A;  1UA0 A;  4M45 A;  3QEP A;  3DOL A;  4MO5 A;  4FJI A;  4DLG A;  3IRX A;  1C0T A;  2QW9 A;  4KH4 A;  3QEX A;  4Z94 A;  2A3Z A;  1BCO A;  5DM6 L;  2VG5 A;  5KRT A;  2O4G A;  4K25 A;  4BRC A;  3L3U A;  3K2P A;  4FK0 A;  3JSM A;  3C7N A;  3O08 A;  4DTP A;  5AQF A;  2E6L A;  3V9U A;  2HMP A;  3B8A X;  5AQG A;  3QES A;  3THV A;  2X6S A;  5CHI A;  1I39 A;  1NK7 A;  3OYB A;  4YOW A;  3A5L C;  4CW7 B;  3IAY A;  4OPJ A;  4CZI A;  2C1I A;  3L2Q A;  3C6T A;  3SUP A;  1N34 K;  3MAQ A;  4EHT A;  3BUZ B;  1NNE A;  1DTT A;  1LOT B;  2PYL A;  4FJK A;  3VF6 A;  4HCC A;  3KLI A;  2BH1 A;  1YJW N;  4F3O A;  1BQN A;  5AQZ A;  2YNF A;  3TTC A;  4CE9 A;  4ELT A;  4BE0 A;  1C0M A;  3HST B;  1S72 N;  5AQW A;  1QHA A;  4FLU A;  1K8A O;  4PKI A;  2HMI A;  4DR4 K;  4BC2 A;  3HVR A;  4FYD A;  3C7N B;  3DM2 A;  3I8B A;  1RTJ A;  4CEQ A;  2YHA A;  3CME N;  4JKA A;  3KVG A;  3LDQ A;  4BWM A;  3OYE A;  3C95 A;  3F9K A;  4CZH A;  3E9L A;  3VQ7 A;  4HHT A;  1YJN N;  2HVH A;  3CC2 N;  4JEP A;  4W5R A;  1HUX A;  3QET A;  1X9S A;  3M6G A;  3WUH A;  2ATQ A;  5JVH L;  3GOI A;  4I2P A;  4DUY K;  1UA1 A;  4ILH A;  4BQL A;  3M5R A;  4HUF A;  1NJY A;  3THY A;  4H0X B;  1CZA N;  2LSN A;  3HBT A;  3PIP L;  4IO8 A;  4WQ4 A;  2G8W A;  4CJW A;  3HOT A;  4BEC A;  2IDO A;  3ALY A;  1WSE A;  4JKE A;  3AO4 A;  4CHZ A;  4CGH A;  3WNF A;  2W00 A;  1JLG A;  2Z1I A;  3OJU A;  5JEN A;  1C6V A;  4JKH A;  4E7I A;  2V51 B;  4ISF A;  3OYF A;  3OYI A;  1T6D A;  4H0V B;  2AA4 A;  2BE2 A;  1TGO A;  4IFE A;  3H6E A;  4J2B A;  3N4Q A;  3TSP A;  1DTQ A;  4H0P A;  5AQR A;  3CIP A;  3O3G A;  2ZM6 K;  3AA2 A;  4I6M A;  5DM7 L;  3NF8 A;  1E4F T;  1B9F A;  4CJ4 A;  3HRG A;  2KLA A;  2DFE A;  3WQT A;  4BR4 A;  3OS2 A;  3THY B;  2QA4 N;  1JXB A;  4FZY A;  2D1K A;  4CFB A;  1RTH A;  2XO7 A;  4FLY A;  4C23 A;  3WT0 A;  2FC0 A;  4DSJ A;  1Z25 A;  1XMO K;  3OYL A;  3DYA A;  4FJ8 A;  1X3M A;  2YI1 A;  4B1Y B;  3QEW A;  3DRP A;  1RDD A;  4DQS A;  1SV5 A;  3HPH A;  4BR2 A;  2FBX A;  3NVK A;  4B08 A;  2OZS A;  1WUA A;  3P83 D;  1V4S A;  1SL1 A;  1GLA G;  1NJI O;  5FRO A;  1LWC A;  3VF4 A;  3ID8 A;  2RE2 A;  4DS5 A;  1C0F A;  4FWM A;  2YX6 A;  2HST A;  4AH9 A;  3TAN A;  1UAX A;  2CH6 A;  4W5T A;  2P9I A;  4I6M B;  3DAW A;  3KKS A;  4KI4 A;  1CXQ A;  3C6A A;  3AA4 A;  3AO5 A;  3CM6 A;  4QCL A;  4WF9 L;  4BRG A;  1ZBL A;  1RT4 A;  1TKT A;  4A5B A;  2PBD A;  1JCF A;  1H1V A;  2Q1N A;  5CYM A;  4FPA A;  3SQ1 A;  1RDU A;  2NRH A;  3EE9 A;  3AO2 A;  4CGG A;  3LWM A;  2IGI A;  3MWP A;  1IH7 A;  2FXU A;  3DXK A;  3KK7 A;  1SZ2 A;  3AVL A;  3V1O A;  3ZSV A;  4BC3 A;  1VQP N;  2QWL A;  3NVM A;  4JI7 K;  1YAG A;  2YHY A;  1NGA A;  4XIU A;  3LM9 A;  1NKB A;  3QNN A;  3FZM A;  2HHT A;  1LAW A;  2GTD A;  5JS1 A;  3R1X A;  2P9I B;  4ISG A;  2HNZ A;  2D4W A;  4O5F A;  1EKE A;  3BY5 A;  2VG6 A;  3O6W A;  3U8X A;  3SK3 A;  4BC5 A;  4CJL A;  4BR9 A;  4J8F A;  4AHR A;  3VEX A;  1U2V A;  3HT3 A;  3DXK B;  3NAE A;  3RR8 A;  4KB0 A;  4LF8 K;  3WXL A;  5FLX O;  2W6L A;  3VQC A;  5C2F A;  4FCY A;  3EL2 A;  2D0O A;  2XY5 A;  3MWT A;  3T1Y K;  3M1F A;  4TSX A;  4CK1 A;  1W0H A;  2AJQ A;  1RGI A;  4EP5 A;  5M1N A;  2NRX A;  3PUF A;  4PA1 A;  4LF5 K;  4YHH K;  3RVC A;  1Q82 O;  1BUP A;  4A59 A;  3D2E A;  4CJV A;  1ESV A;  2G8F A;  4AHV A;  3J80 O;  1MA9 B;  4FOE A;  4R79 A;  3TAF A;  4OLA A;  2P1J A;  5T7B A;  4KB1 A;  2FBY A;  4KPY A;  4Z4I A;  3DXM A;  1BA1 A;  2E2Q A;  1HPZ A;  4BVP A;  2O8D A;  4KRF A;  1RDW X;  4BGA A;  2IS3 A;  2YJE A;  3DLB A;  3EE8 A;  5AQI A;  2CH5 A;  4O8K A;  4JRQ A;  4IOA L;  1FJG K;  5KI6 A;  1DLO A;  5C2D A;  4DV2 K;  4FJ7 A;  2KZZ A;  4B9T A;  3MMV A;  3OYN A;  2A5X A;  3HJF A;  4NO7 A;  4CED A;  3PX4 A;  3D2E B;  1KD1 O;  3J7Y P;  4IFV A;  1E4G T;  1WLJ A;  5AQQ A;  3TAP A;  4HVJ A;  2IAJ A;  3DXM B;  2F9W A;  3KKR A;  4BRK A;  1QSY A;  2O8D B;  2P9U A;  1SL2 A;  4CJT A;  4LY7 A;  4H0T B;  3RRH A;  1SAZ A;  3AA5 X;  3S41 A;  1GLE G;  3IUC A;  3CM5 A;  2NRV A;  4CF9 A;  2YCH A;  3WXM B;  3V9X A;  4FLW A;  3THX A;  2A1S A;  2D0C A;  5AZI A;  1HKG A;  2OA8 A;  5J2N A;  3TAR A;  1XC9 A;  5HBM A;  4JI8 K;  1VSL A;  2E2O A;  1JCE A;  2QKK A;  4FLV A;  3P39 A;  3GE1 A;  3H1V X;  5CYQ A;  4O55 A;  4LFA K;  3EN9 A;  4N56 A;  4B3M K;  3H45 C;  1WNS A;  4AM6 A;  4QAG A;  2YV0 X;  1YT3 A;  4I9L A;  1R0A A;  3FZF A;  3FZL A;  3CJ9 A;  2P9U B;  4FJM A;  2I5J A;  3TPQ A;  1VQK N;  4RWT A;  4RW7 A;  3D7E O;  3MN5 A;  4K41 A;  3T3F A;  1TK5 A;  2VWB A;  3IKM A;  3VGM A;  4I7F A;  4WCE L;  2PZS A;  2E2P A;  2UXB K;  4WYB A;  1NBW A;  3CCQ N;  5GAG P;  2VQE K;  3Q7C A;  2WFB A;  3A0I X;  3THX B;  1YXQ A;  1B9D A;  5AZI B;  3LZI A;  3BZK A;  3U3G A;  3ZYY X;  1ASV A;  1XHX A;  4B3T K;  1A5W A;  1GLC G;  2Z1J A;  2HHV A;  3KIO A;  3VTI A;  3HO1 A;  1VSM A;  1WSH A;  4O4G A;  2RPI A;  4JN4 A;  3VET A;  4BRN A;  4X64 K;  1JJ2 M;  3EY1 A;  3LAK A;  4C1N I;  3IMX A;  3ITH A;  4CJK A;  1NGF A;  2IIR A;  3O5B A;  1ZBS A;  2Q2R A;  5C42 A;  4OX9 K;  3SPZ A;  3WXJ A;  3SV3 A;  5C24 A;  2IVN A;  3RSE A;  1FXX A;  2VWJ A;  5AJ3 K;  4WQ5 C;  3L8B A;  4B3O A;  4CBU A;  1RNH A;  2O8E A;  4RG8 A;  4YFU A;  1LWE A;  1JXE A;  2IVO A;  3PX6 A;  3JXU A;  3VQ9 A;  4H4O A;  2BAN A;  4CEA A;  4OVL A;  4FJG A;  2RKI A;  2D0P A;  4DTX A;  4LF7 K;  3T69 A;  1S1T A;  1YVU A;  3AVN A;  5BN9 A;  4F8R A;  3AVK A;  1IBM K;  4OO1 J;  2KZM A;  4BRD A;  2GUI A;  2BGG A;  3AO1 A;  4BE1 A;  3O9Q A;  3PO5 A;  3KK2 A;  4I9Q A;  3F5T A;  3E66 A;  2ZF5 O;  4FJX A;  2ASM A;  1XHZ A;  4IXC A;  3S3O A;  3J7Z O;  1KTQ A;  3D6R A;  1BL3 A;  5KGX A;  3RSE B;  1WAJ A;  3P4I A;  3NF6 A;  3C6H A;  3C94 A;  1QQM A;  3NH2 A;  2O8E B;  4GVE A;  4JI3 K;  1RT1 A;  1J54 A;  3CYM A;  4DCH A;  1ILY A;  4AIL C;  3ZT0 A;  2I7N A;  4FK4 A;  3TTD A;  4E7L A;  3IFR A;  1HPM A;  5HRN A;  4CJE A;  5FRM A;  1BIZ A;  4IZ9 A;  2QI2 A;  1C0U A;  4JKD A;  4FW2 A;  3M8R A;  1HX1 A;  3W3D A;  5J2Q A;  2P5G A;  4MDA A;  3ATV A;  1Q8I A;  3ID6 A;  4FJJ A;  1L5U A;  2O8F A;  4QOZ B;  1KLM A;  3G6E N;  1LCU A;  2D5R A;  3OHR A;  2W42 A;  4Z4F A;  1VSF A;  5FRN A;  3SYZ A;  3NF9 A;  1HKC A;  1N5Y A;  4RW4 A;  1NWK A;  3LP2 A;  3L2V A;  2OYQ A;  3E1Y A;  3SQ4 A;  5GIN A;  1BG3 A;  2Q0R A;  2F4V K;  1NJZ A;  3VQA A;  2GBZ A;  4CK3 A;  4UY8 O;  4CHP A;  4JI4 K;  3CF5 L;  3OW2 M;  3LWL A;  2X6N A;  2KKZ A;  1NJX A;  4JI0 K;  3O8M A;  4A57 A;  1FK9 A;  4FL9 A;  4GV9 A;  3VQE A;  3SBG A;  2UUC K;  1WAF A;  1LV5 A;  5CY4 A;  4CBX A;  4YOR A;  4ELU A;  3ZT2 A;  2UUA K;  5GAH P;  4DG1 A;  1S3X A;  3TSU A;  2Y1J A;  2ZJR L;  2O8F B;  3VA3 A;  4Z4C A;  1TKX A;  3AY9 A;  1JL2 A;  2B4J A;  2VQF K;  3TAG A;  4DQQ A;  4H8K A;  4M3Y A;  3GL1 A;  5JVG L;  5GAD P;  3PLA A;  1HYS A;  5EY4 A;  3CJC A;  1VRU A;  4G1Q A;  2Q36 A;  3DLL L;  1WB9 A;  3EKS A;  3TR8 A;  4BG8 A;  4KHN A;  2X74 A;  1S9E A;  4YY3 K;  4BRF A;  4DLE A;  4A2A A;  1T7P A;  3K5M A;  4BGB A;  4KHU A;  1GLD G;  2FSN A;  1RT6 A;  3V1R A;  2YKM A;  4JHD A;  1TK8 A;  2FSJ A;  5C0Y A;  4DV0 K;  3KZB A;  5BR9 A;  3O80 A;  3WXK A;  4H03 B;  3DLR A;  4ZTJ A;  1SKR A;  2WBN A;  4NYN A;  3S3N A;  1CXU A;  3OY9 A;  3KLG A;  1O13 A;  2ZE2 A;  3S3M A;  3VQB A;  4ILJ A;  4DV1 K;  4YDU A;  3R3L A;  2BTF A;  1N33 K;  4DTU A;  5KPZ A;  4DTM A;  4J2A A;  4GKJ K;  5HLF A;  1EX4 A;  3LZJ A;  1RDB A;  4KTZ A;  4BC4 A;  3AVI A;  1C1B A;  4M41 A;  1L3U A;  5JS2 A;  3CJ1 A;  3DLH A;  2RHK A;  4FJ9 A;  5CE3 A;  3ZLJ A;  5KQD A;  2Q0U A;  4JHD B;  5C15 A;  2P9P A;  3KWG A;  3G71 N;  4OPK A;  1BDG A;  1HNV A;  3AVC A;  4BE7 B;  4M3U A;  1VQN N;  3AVB A;  4DSF A;  4FWN A;  2E1Z A;  5M1Q A;  1Y64 A;  1EXQ A;  3OS0 A;  4M3T A;  5AQY A;  3G10 A;  4CES A;  1NMN A;  5AQH A;  5JIC A;  2HNY A;  4M3W A;  4DB3 A;  4DV3 K;  3A5O C;  4NXM K;  5F1X A;  3MEE A;  4C8N A;  3HZ6 A;  3J8A A;  3AV9 A;  4K8X A;  2QWO A;  4FZX C;  1HRH A;  3VQQ A;  5E84 A;  1QZ6 A;  4M42 A;  4FM1 A;  1U47 A;  1XNR K;  1VSH A;  3VQ5 A;  2UYT A;  2P9P B;  3FFI A;  1XUP O;  1D9F A;  4MLE A;  1T8E A;  3PV8 A;  3MDQ A;  2FF6 A;  4DR5 K;  4CIE A;  1NGJ A;  1IBL K;  2NRZ A;  3SZ2 A;  3LP3 A;  2DPN A;  1Q86 O;  1JLA A;  3HL8 A;  3WXI A;  5C25 A;  3QB0 A;  3FE1 A;  5JLH A;  4RW8 A;  5AQM A;  3L4Q A;  3V9S A;  3M8S A;  4AF1 A;  2HBL A;  5I9E B;  1VQ7 N;  1BI4 A;  3U4L A;  1IKW A;  3T19 A;  1GOC A;  4H4M A;  3T7Z A;  4BRM A;  1NKE A;  1OH6 A;  1ITG A;  3FFK B;  2NRT A;  4FWL A;  1GLF O;  4BDZ A;  3AVJ A;  1T03 A;  5FDL A;  1NK4 A;  5LJV A;  3G25 A;  1ASW A;  1WOQ A;  2QWN A;  3K9K A;  3SQ0 A;  4FLX A;  4M63 C;  2EX3 A;  4LF9 K;  4IJN A;  2YHB A;  1A5X A;  1HMV A;  1JLE A;  1RT2 A;  4LC9 B;  5F2R A;  3HYF A;  4BRL A;  1EP4 A;  1CZB A;  3AVA A;  4A5A A;  1RBR A;  4BY9 C;  4BRH A;  3NHG A;  3IG1 A;  3C0B A;  1QQN A;  5FPN A;  4B1Z A;  4CIG A;  1IKX A;  4X65 K;  3LDS A;  3EEQ A;  1BI4 B;  2A40 A;  4IWV A;  4KHY A;  1VSI A;  4OKJ A;  1KCF A;  3ZSW A;  5HRO A;  4KHQ A;  4C1N K;  4DFP A;  1N8R O;  1ZBU A;  4BRA A;  5BRH A;  5C12 A;  3K9J A;  1HQE A;  1RCH A;  3BGR A;  1VQL N;  4NB4 A;  4OKK A;  3VEN A;  5KQ8 A;  3K57 A;  4KTQ A;  3VEV A;  3THW A;  4CF2 A;  3BF1 A;  1VSD A;  3QBX A;  3F73 A;  4OGC A;  1T44 A;  5J2P A;  2VGN A;  1HKB A;  5AQJ A;  3WQU A;  3O4N A;  3S5T A;  3O9S A;  3CJB A;  4E0D A;  1KAZ A;  3LAN A;  4DMN A;  1NK8 A;  3TAQ A;  2FSK A;  3RMB A;  1OH7 A;  2QWP A;  4R5P A;  1U45 A;  2C1G A;  1M1K O;  3VQ6 A;  4CF0 A;  2F7T A;  1TVR A;  1ZBH A;  3MK6 A;  3CHW A;  1YHQ N;  3QIO A;  5LJW A;  5LY3 A;  4CZK A;  5BPN A;  3KK1 A;  3ZET A;  2E2N A;  3N4P A; 
#chains in the Genus database with same CATH homology
 3U9D A;  3CET A;  2NLX A;  3TPQ A;  1VQK N;  1Q81 O;  5AR0 A;  4QS9 A;  4RWT A;  2ZGZ A;  4B1X B;  4BQZ A;  3D7E O;  3MN5 A;  4HWI A;  4K41 A;  4BVO A;  4FWO A;  4E1J A;  4M7Y A;  2VWB A;  3QBW A;  3IKM A;  4H5V A;  4PKH A;  4FVU A;  2VCP A;  1DT9 A;  3VGM A;  4WCE L;  1BU6 O;  2E2P A;  2E20 A;  4WYB A;  1NBW A;  3FZK A;  4BRO A;  4BRP A;  3BP8 A;  2CGL A;  2A42 A;  2HOE A;  5FPE A;  1HLU A;  5GAG P;  3Q7C A;  2WFB A;  3CCQ N;  3CCS N;  3A0I X;  3TU5 A;  4JNE A;  1YXQ A;  3CCR N;  4CD1 A;  3CJ7 A;  4B9Q A;  1X3N A;  1YUW A;  5AQU A;  5AZI B;  3CJA A;  5GIP A;  3G4S N;  4IDH A;  4O8U A;  4JKC A;  4CZG A;  3H3N O;  4MDB A;  4JAX A;  3ZYY X;  2P9K A;  4JKG B;  5AQK A;  4CD3 A;  1GLC G;  1VQ5 N;  3ZEU A;  4EAH D;  1ZC6 A;  4XH5 A;  1YF5 L;  3I33 A;  3VTI A;  3MN7 A;  4WQ5 A;  3QML A;  4JN4 A;  3VET A;  4BRN A;  4DQ8 A;  3MN9 A;  1JJ2 M;  1NGG A;  4C1N I;  4IOC L;  3IMX A;  3OBY A;  2V52 B;  5EOY A;  1NGF A;  2IIR A;  3DWL A;  2QXL A;  4RTF D;  3O5B A;  4BEB A;  5ADX H;  1ZBS A;  1K8K B;  2Q2R A;  3H1Q A;  3ZET B;  1JCG A;  4K43 A;  5MLC Q;  5H1S Q;  3HI0 A;  4H5N A;  1VAZ A;  2YHW A;  3WXJ A;  3CQY A;  3MCA B;  4CZJ A;  2YHX A;  1EO1 A;  2IVN A;  3RSE A;  3PIO L;  4H5T A;  4FWS A;  1XC3 A;  3LL3 A;  4WQ5 C;  3VPZ A;  4CBU A;  2NZT A;  5AFU A;  2IVO A;  3R9P A;  4ISE A;  1U2V B;  4XH1 A;  2VGM A;  3O9U A;  2QTD A;  4YOV A;  3JXU A;  2FLO A;  1GLJ O;  2D0P A;  1Q18 A;  4XJX A;  2P9K B;  4JK9 A;  5AQO A;  1G99 A;  1NM1 A;  3ZEU B;  5M1K A;  3EZW A;  3T69 A;  4KBO A;  4BRI A;  4IO9 L;  2OTJ N;  4QS7 A;  5BN9 A;  2PAV A;  1MWK A;  4MO4 A;  4RCH A;  4OO1 J;  4OPA A;  4DKW A;  3HOS A;  3CCM N;  3CMA N;  4BRD A;  1U6Z A;  2E8A A;  3F2K A;  4JKF A;  4PKG A;  4JKB A;  3O9Q A;  4MO5 A;  1DGK N;  3F5T A;  3E66 A;  2ZF5 O;  3E9O A;  3CC4 N;  2QW9 A;  1BOT O;  4KH4 A;  2ASM A;  4IXC A;  4Z94 A;  2A3Z A;  3D6R A;  4IJA A;  5DM6 L;  3J7Z O;  2JWL A;  5LY3 A;  5HOO A;  3RSE B;  4A2B A;  3ZX3 A;  3P4I A;  2J4R A;  3C6H A;  4K25 A;  4BRC A;  1BA0 A;  1QQM A;  2CGJ A;  4GVE A;  2WUS A;  3C7N A;  3O08 A;  5AQF A;  4B1U B;  4DCH A;  1ILY A;  1QVG M;  3C65 A;  2HMP A;  3B8A X;  2I7N A;  5AQG A;  3UKR A;  3TTD A;  3SJH A;  2QEX N;  4L3Q A;  3O1W A;  5CHI A;  3IFR A;  2P9N A;  1HPM A;  4YOW A;  3A5L C;  1J6Z A;  3MX2 A;  4CZI A;  2C1I A;  1IG8 A;  5BRD A;  4NLB A;  4IZ9 A;  4EHT A;  4KH6 A;  3CD6 N;  3BUZ B;  2QI2 A;  1GLL O;  1OKJ A;  1LOT B;  4CBW A;  4YDU C;  3A8Y A;  2ZJQ L;  4JKD A;  3VF6 A;  2BH1 A;  1YJW N;  1HX1 A;  3W3D A;  3BF3 A;  2ZJP L;  4MDA A;  2NNW A;  5AQZ A;  3EO3 A;  3ATV A;  1Q7Y O;  3ID6 A;  3F9M A;  4IOX A;  1VQ8 N;  3TTC A;  5JLF A;  4PHT X;  4CI6 A;  4B1V A;  3ZX0 A;  1S72 N;  3G6E N;  1LCU A;  3OHR A;  2GEM A;  5AQW A;  3VOV A;  1QHA A;  1K8A O;  4BRQ A;  3L0Q A;  4PKI A;  4PL8 A;  4BC2 A;  3C7N B;  3I8B A;  1HKC A;  3CME N;  2HBK A;  1NWK A;  4JKA A;  3KVG A;  1NGC A;  3LDQ A;  3E1Y A;  5M1O A;  5GIN A;  4WFN L;  1BG3 A;  2Q0R A;  3UKR B;  2FF3 B;  4JD2 A;  1NLV A;  4UY8 O;  4CZH A;  2P9N B;  3HSC A;  2V7Z A;  3CF5 L;  2ITM A;  3P38 A;  5AQX A;  3E9L A;  3OW2 M;  3O1B A;  2KKZ A;  1HJO A;  3O8M A;  2OAN A;  2Q31 A;  5B8H A;  4A57 A;  1YJN N;  4FL9 A;  3CC2 N;  4GV9 A;  3KWI A;  4JEP A;  1NGD A;  3SBG A;  1HUX A;  3CQX A;  3VEW A;  4CBX A;  3M6G A;  4YOR A;  5E26 A;  3WUH A;  1VQ4 N;  5GAH P;  2P9L A;  3VEY A;  5JVH L;  3GOI A;  1S3X A;  4ILH A;  4BQL A;  4WFA L;  3M5R A;  4CZF A;  1SQK A;  3TSU A;  2ZJR L;  4FWR A;  4YOY A;  3BEX A;  3CCE N;  4H0X B;  2H3G X;  3L6Q A;  1YIT N;  1CZA N;  1KXP A;  3CCU N;  3HBT A;  3PIP L;  1Z6R A;  4IO8 A;  4WQ4 A;  3I55 N;  4K42 A;  3HOT A;  3AY9 A;  4BEC A;  4CZE A;  3A5N C;  5AQS A;  4FPB A;  4JKE A;  4ILG B;  4CJ7 A;  4CZL A;  3GL1 A;  5JVG L;  5GAD P;  3PLA A;  4BR5 A;  2IVP A;  2W00 A;  3VES A;  4JKH A;  5HL7 L;  5EY4 A;  3CJC A;  2V51 B;  4ISF A;  4JD2 B;  4GV3 A;  4HTL A;  2Q36 A;  3DLL L;  2ZWH A;  1T6D A;  3EKS A;  4H0V B;  2AA4 A;  2HF4 A;  4BG8 A;  4IEE A;  3OBW A;  4IFE A;  3H6E A;  1YJ9 N;  3N4Q A;  3TSP A;  3SBT A;  4H0P A;  4BRF A;  4A2A A;  4WQ4 C;  5AQR A;  4BGB A;  1GLD G;  4FWP A;  3CCJ N;  2ASP A;  3CIP A;  3LDN A;  2FSN A;  4EFH A;  4I6M A;  4FWQ A;  5DM7 L;  1E4F T;  3WEE A;  3HRG A;  2P9L B;  2KLA A;  3WQT A;  4BR4 A;  3FZH A;  3CI5 A;  4JHD A;  4FOI A;  2FSJ A;  5C0Y A;  5BPM A;  4NLC A;  2GWK A;  2QA4 N;  2GX9 A;  3KZB A;  5BR9 A;  2D1K A;  3O80 A;  1W2B M;  3WXK A;  2E88 A;  4H03 B;  3AAP A;  2WBN A;  3VMF B;  5EVZ A;  5AQT A;  3UKU A;  3GBT A;  3U9Z A;  4C23 A;  3WT0 A;  4QS8 A;  2Q97 A;  1GLB G;  1O13 A;  4BR7 A;  4ILJ A;  3A5M C;  5ADX A;  4YDU A;  1X3M A;  5TKW A;  2YI1 A;  4BRE A;  4B1Y B;  2YJF A;  5AQP A;  3R3L A;  4BR2 A;  2BTF A;  2AP1 A;  5AQV A;  1VQ9 N;  3NVK A;  3AGR A;  5KPZ A;  1WUA A;  1DEJ A;  1V4S A;  1GLA G;  3AGK A;  4A62 A;  1NJI O;  3VF2 A;  3VF4 A;  3ID8 A;  2RE2 A;  2HF3 A;  2W40 A;  1C0F A;  4FWM A;  4EIA A;  4JK8 A;  1W97 L;  2HST A;  2YX6 A;  3EKU A;  1ZXO A;  5JMV A;  2CH6 A;  4BC4 A;  3VEO A;  1KC8 O;  2P9I A;  4I6M B;  3DAW A;  3HTV A;  3WEE B;  3AAQ A;  3CJ1 A;  2RHK A;  3C6A A;  5CE3 A;  3CCL N;  4U7B A;  2I7P A;  4WF9 L;  4BRG A;  2Q0U A;  5KQD A;  4JHD B;  4A5B A;  2PBD A;  1JCF A;  2ASO A;  3FLC O;  1H1V A;  4IEI A;  5C15 A;  2P9P A;  3KWG A;  4PL7 A;  3G71 N;  1MDU B;  2Q1N A;  3MN6 A;  4FPA A;  1RDU A;  1S22 A;  1C0G A;  1BDG A;  2NRH A;  3EE9 A;  3QDK A;  4BE7 B;  3GG4 A;  3CCV N;  1VQN N;  1EQY A;  3MWP A;  2FXU A;  3UKU B;  2PFU A;  3DXK A;  2QM1 A;  4AM7 A;  3KK7 A;  2VYP A;  1SZ2 A;  4FWN A;  2E1Z A;  5M1Q A;  1Y64 A;  5ELZ A;  3ENH A;  1KAX A;  3SMS A;  4A61 A;  3LDP A;  4BC3 A;  1KQS M;  5AQY A;  3CER A;  1VQP N;  5AQH A;  5JIC A;  3D2F A;  5C10 A;  3AAR A;  3VGL A;  1QVF M;  2QWL A;  3NVM A;  3O9R A;  1BWF O;  1R59 O;  2EWS A;  4DB3 A;  1YAG A;  3A5O C;  1P90 A;  1NGA A;  2YHY A;  5GAE P;  5F1X A;  3LM9 A;  3P31 A;  5M1F A;  2W41 A;  3HZ6 A;  4JK7 A;  4XH4 A;  3J8A A;  2QWO A;  3SMP A;  3FZM A;  3VER A;  2GTD A;  1VQ6 N;  4CZM A;  4EHU A;  1YVN A;  5E84 A;  1QZ6 A;  3R1X A;  2P9I B;  1NMD A;  4ISG A;  4B1W B;  4FO0 A;  3H46 O;  2D4W A;  3LDL A;  1NGH A;  1DKG D;  4FWK A;  4O5F A;  4DHY A;  5FPM A;  5M1P A;  5GIO A;  4MLH A;  3UB5 A;  3QFP A;  3JS6 A;  3KHY A;  2UYT A;  5F0X A;  1NGE A;  2P9P B;  1XUP O;  3O6W A;  4MLE A;  5EXW A;  1RFQ A;  3U8X A;  1T3V A;  3SK3 A;  3MDQ A;  4BC5 A;  2A6A A;  1Z05 A;  4BR9 A;  4J8F A;  2HBJ A;  3VEX A;  2FF6 A;  1U2V A;  1ATS A;  3VEZ A;  3DXK B;  3L4I A;  3ULE A;  1P8Z A;  3ATU A;  1NGJ A;  3WXL A;  2NRZ A;  5C2F A;  1TUU A;  3EL2 A;  2D0O A;  2DPN A;  1Q86 O;  3WXI A;  3MWT A;  3M1F A;  3D2F B;  3FE1 A;  3QB0 A;  3VTH A;  1RGI A;  3FR0 A;  1IJJ A;  4H5R A;  5JLH A;  5M1N A;  5AQM A;  1T6C A;  3L4Q A;  2NRX A;  5FPD A;  5BN8 A;  4AF1 A;  3RVC A;  2HBL A;  5I9E B;  1VQ7 N;  3U4L A;  2GEL A;  1Q82 O;  3T7Z A;  1BUP A;  4A59 A;  1VQO N;  1TUY A;  4BRM A;  3D2E A;  1ESV A;  3QFU A;  3FFK B;  1MA9 B;  2NRT A;  4FOE A;  4H0Y B;  4FWL A;  1GLF O;  4R79 A;  3E9P A;  3DJC A;  3DXM A;  5LJV A;  3G25 A;  1BA1 A;  1WOQ A;  2E2Q A;  2QWN A;  4BVP A;  4GV6 A;  3K9K A;  3M3Z A;  2E1Y A;  3HM8 A;  1RDW X;  2WC9 A;  1NGB A;  3MX5 A;  4M63 C;  2F9T A;  2QWM A;  2GWJ A;  3H3O B;  4IJN A;  5AQN A;  4BGA A;  5KPT A;  2ZGY A;  5BPL A;  2YJE A;  3O9T A;  3LM2 A;  5AZJ A;  3CXC M;  1YI2 N;  1K73 O;  3ULE B;  2P9S A;  4LC9 B;  4OPH A;  3W0L A;  3OA9 A;  3EE8 A;  5AQI A;  1M90 O;  2CH5 A;  5F2R A;  4BRL A;  4O8K A;  1OVY A;  2HBM A;  4IOA L;  4Y0W A;  2QWR A;  3IDH A;  4YOT A;  4A5A A;  3SAG A;  5C2D A;  4BY9 C;  4XEI A;  1QQO A;  4YOU A;  4BRH A;  4GY2 B;  3R6M A;  3C0B A;  4BG9 A;  1QQN A;  5FPN A;  3VGK A;  3MMV A;  5TKY A;  4B1Z A;  3GDQ A;  2A5X A;  2NRW A;  3SAF A;  3CPW M;  3UE5 A;  4NO7 A;  2A40 A;  4FSV A;  3D2E B;  3CPE A;  4IWV A;  4F9O A;  3ENO A;  1KD1 O;  2A41 A;  1E4G T;  3O4W A;  4YOX A;  4M7X A;  5AQQ A;  5AQL A;  4H0O A;  1TYQ A;  4H5W A;  5BRE A;  2OTL N;  4C1N K;  3DXM B;  3Q7B A;  1N8R O;  2F9W A;  4BRA A;  4BRK A;  4GNI A;  5KPR A;  5BRH A;  3SLC A;  5EX5 A;  5C12 A;  3K9J A;  2P9U A;  1VQL N;  4NB4 A;  4H0T B;  3VEN A;  5KQ8 A;  1SAZ A;  1D4X A;  3VEV A;  3S41 A;  5AZJ B;  1ATN A;  1GLE G;  2P9S B;  1MWM A;  1ATR A;  3BF1 A;  3QBX A;  3MCP A;  4KH5 A;  3ZX2 A;  3IUC A;  1NGI A;  2NRV A;  2QWQ A;  2YCH A;  3WXM B;  3SAH A;  1T44 A;  1BO5 O;  2VGN A;  1HKB A;  2BUP A;  4U67 L;  5AZI A;  1HKG A;  5AQJ A;  3WQU A;  2CGK A;  3QIC A;  1YIJ N;  1XQS C;  2KHO A;  3O9S A;  3CJB A;  5CR4 A;  1K9M O;  4JKG A;  2E2O A;  1QZ5 A;  4WFB L;  1JCE A;  1KAZ A;  3ENB A;  3I56 N;  5LJW A;  3NMU A;  2V7Y A;  3P39 A;  5BRF A;  3LDO A;  3GE1 A;  3H1V X;  2FSK A;  2QWP A;  3TTF A;  1X9J A;  2C1G A;  2NRR A;  1M1K O;  3CC7 N;  3EN9 A;  2GUP A;  1KAY A;  1TYQ B;  3TSQ A;  2F7T A;  4G9Z A;  3H45 C;  1SS6 A;  3MK6 A;  4AM6 A;  3CHW A;  2JWK A;  3FGU A;  1YHQ N;  3FZF A;  1K8K A;  1V4T A;  3CJ9 A;  3FZL A;  2P9U B;  3R8E A;  5AFU H;  4BR0 A;  4CZK A;  5BPN A;  1VQM N;  3ZET A;  2E2N A;  3N4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...