4CBWA

Crystal structure of plasmodium berghei actin i with d-loop from muscle actin
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
372
structure length
367
Chain Sequence
b'EVQALVIDNGSGNVKAGVAGDDAPRSVFPSIVGRPRHGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRAAPEEHPVLLTEAPLNPKGNRERMTQIMFESFNVPAMYVAIQAVLSLYSSGRTTGIVLDSGDGVSHTVPIYEGYALPHAIMRLDLAGRDLTEYLMKILHERGYGFSTSAEKEIVRDIKEKLCYIALNFDEEMKTSEQSSDIEKSYELPDGNIITVGNERFRCPEALFQPSFLGKEAAGIHTTTFNSIKKCDVDIRKDLYGNIVLSGGTTMYEGIGERLTRDITTLAPSTMKIKVVAPPERKYSVWIGGSILSSLSTFQQMWITKEEYDESGPSIVHRKCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN, ALPHA SKELETAL MUSCLE, ACTIN
publication title Structural Differences Explain Diverse Functions of Plasmodium Actins.
pubmed doi rcsb
source organism Plasmodium berghei
molecule tags Motor protein
total genus 108
structure length 367
sequence length 372
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4cbwA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4cbwA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4cbwA03
1HKGA 3VPZA 4CD1A 1ATRA 2V7ZA 4FWSA 1C0FA 1EQYA 2BTFA 3O8MA 4PKHA 3A5OC 4I6MB 2D4WA 4RCHA 4NO7A 2DPNA 1NBWA 1GLDG 1NWKA 5AQQA 4FWPA 3C7NB 4BRMA 3C7NA 3GDQA 2YI1A 4BC5A 2A41A 4B1VA 3MDQA 2OANA 1NGAA 2Q97A 4FL9A 3O4WA 1HPMA 4FWLA 1IG8A 4BR7A 4EHTA 1V4SA 3VF2A 2P9PB 3MN9A 5EOYA 4CZKA 2P9PA 3M1FA 4JHDB 1LOTB 4BR2A 1YXQA 4JHDA 3L6QA 2J4RA 3JS6A 4BRLA 1V4TA 2A40A 3FZHA 1TUYA 4BR9A 1E4FT 3BP8A 4M7XA 1NGBA 1K8KB 2HMPA 5AQIA 4QS7A 5AFUA 1R59O 1K8KA 3CHWA 4K41A 3FGUA 2FSKA 2QWPA 3U8XA 3ZX0A 4JN4A 1NMDA 1U2VA 3I33A 1JCGA 4IO8A 2ITMA 4A61A 2YHYA 1DEJA 4LC9B 4O5FA 5AQFA 3ATUA 2FSNA 3ATVA 5JMVA 3B8AX 3ZETB 3M3ZA 3LDPA 3ZETA 3DXKB 2GUPA 4H5NA 5AR0A 2ZGZA 2CH6A 4FPBA 3DXKA 2QXLA 4C23A 5ADXH 1BA0A 3EKSA 4XH1A 2IVNA 4WYBA 3WT0A 1QHAA 4BR4A 5LY3A 5FPNA 3AARA 1YUWA 2FF6A 2E20A 2GEMA 2V7YA 3QFPA 4BR0A 3MCPA 5AQNA 4BRIA 1ZC6A 5EX5A 1GLCG 1HLUA 1BG3A 4K42A 3P4IA 4BRHA 3MN6A 5JLFA 4PL8A 3D7EO 4J8FA 3AAQA 2ZF5O 3VEZA 4A2BA 3CERA 4M7YA 3MN5A 3QBXA 4MO5A 1DKGD 4FWMA 3QFUA 3VENA 3MN7A 3GOIA 1BA1A 3LDLA 2W41A 2QWOA 3O80A 4BR5A 3VOVA 3CJ9A 2Q1NA 5AFUH 3SMPA 2QW9A 1MWMA 5AQGA 4O8KA 1P8ZA 3VEXA 2Q31A 1NGCA 3FLCO 3CETA 5TKYA 3J8AA 5AQTA 2IVPA 3A5MC 4H0YB 3ZX3A 2A5XA 3LM2A 2H3GX 5I9EB 3EN9A 2PBDA 3O08A 3WEEA 4FOEA 3GG4A 3GE1A 3MMVA 4RTFD 3CQXA 2P9IA 4FWKA 1GLAG 4EFHA 2I7PA 3QDKA 4BVPA 1Z6RA 3A5LC 4BRQA 5KPZA 2E2QA 3U9DA 2D0OA 1NGGA 2FSJA 3UE5A 4WQ5A 5BREA 4DQ8A 5ADXA 4BVOA 3KZBA 1YVNA 4WQ5C 5F0XA 4GY2B 1MWKA 1KAYA 3O6WA 2E1YA 5AZIB 1D4XA 3DXMA 5AZIA 4H0XB 1HUXA 4BRPA 2QM1A 3ZX2A 2HOEA 4JD2B 3MK6A 2IIRA 3UB5A 4AM7A 1ATNA 4BG8A 4JD2A 4B1ZA 3CJCA 2Q36A 5AQXA 2NZTA 3IMXA 1U6ZA 4DHYA 3M6GA 3CQYA 4BC4A 4WQ4A 4BRKA 2YJFA 3QB0A 4ISGA 2P9LA 2F9TA 1TUUA 3VGLA 4CJ7A 4WQ4C 3TPQA 1X3NA 1X3MA 2E2NA 4EAHD 1BWFO 3VEVA 2CH5A 4IXCA 1HX1A 3BUZB 4CBUA 1ESVA 4M63C 2E88A 2CGKA 2HF4A 3O5BA 1H1VA 4K25A 5AQSA 3EKUA 2CGJA 3W3DA 3ID8A 1WOQA 4JNEA 2A3ZA 1S22A 1YAGA 2YJEA 4FSVA 4A2AA 4CBWA 2GTDA 5JICA 1LCUA 2NLXA 5E26A 1SZ2A 4BGBA 1Y64A 3R9PA 3H3NO 4H5VA 1U2VB 4B1XB 3A8YA 3HBTA 1ATSA 1GLJO 3VETA 3EO3A 5AQYA 3FZFA 3WXKA 1WUAA 1GLFO 2ASOA 2VCPA 2PAVA 5F2RA 3VEOA 1QZ5A 3QMLA 4FOIA 1BU6O 3S41A 3VEYA 2HF3A 2QWRA 3H1QA 3F9MA 3C0BA 5AQUA 5B8HA 2V51B 3CI5A 4Y0WA 4MO4A 4H5WA 5AQLA 4DCHA 4FWQA 4CZMA 3GL1A 3TU5A 3O1WA 3H45C 3VGKA 3EZWA 1OKJA 3IFRA 4PKGA 2Q0RA 4H0VB 1NGHA 4BRCA 1XUPO 3SK3A 2I7NA 3FFKB 5ELZA 3R8EA 4BRAA 5BPLA 2P9NB 1NM1A 5AQRA 4CD3A 2P9NA 3AAPA 2F9WA 1BO5O 4B1WB 4ISFA 1NGDA 2AP1A 2E2OA 3DWLA 2E1ZA 4BRDA 5BRHA 3UKUA 2ZWHA 2QWMA 4ISEA 2ASPA 1HKCA 2GWKA 1GLEG 4B9QA 3IUCA 5AQHA 5F1XA 5AQJA 4F9OA 1G99A 2YHWA 2EWSA 5FPDA 4FWRA 4CZHA 2V52B 2QWLA 3FZLA 5BRFA 3D2EB 4XH5A 3WEEB 4CZEA 3CJ1A 3D2EA 3UKRB 4JAXA 2P9IB 3UKRA 5EY4A 4HTLA 1C0GA 2WUSA 3ULEB 1X9JA 5BN9A 2P9SA 3ULEA 2QWQA 3CIPA 3O1BA 4QS9A 3IDHA 1TYQB 5AQZA 1TYQA 3AY9A 3HI0A 1BUPA 1QQOA 2IVOA 3VF6A 1ZBSA 1T44A 2P9UB 3GBTA 4GNIA 3DXMB 4IWVA 2P9UA 5AQVA 4YDUA 3VESA 3WQUA 4MLEA 5FPEA 1NGJA 3VF4A 4YDUC 1MDUB 2FLOA 3HTVA 3DJCA 3FE1A 1HKBA 2P9LB 3KVGA 1RGIA 1JCEA 1J6ZA 3FR0A 4H0TB 4FPAA 1SAZA 5KPRA 3QBWA 2VWBA 4BG9A 5LJWA 4I6MA 3WQTA 3ENOA 2KHOA 3L0QA 5JLHA 2D1KA 1DGKN 4MLHA 3KHYA 5AQWA 3VGMA 3VERA 2ZGYA 1KAXA 4BC3A 1BOTO 1CZAN 3H1VX 5BR9A 2GWJA 4BREA 4L3QA 2Q2RA 4BRNA 4QS8A 2NRHA 4H5RA 1SQKA 4XH4A 3WXIA 3ZEUB 5FPMA 3ZEUA 5KQ8A 3QICA 4RWTA 4FO0A 3H46O 3W0LA 1KXPA 4BRFA 3L4IA 1NGFA 4CZLA 5BPMA 1KAZA 1MA9B 3HSCA 2GELA 4IJAA 3OHRA 2YCHA 4E1JA 4BROA 3FZMA 5BN8A 4Z94A 1NLVA 2YHXA 3A0IX 2QWNA 3BF3A 3LL3A 4K43A 3WXLA 4BC2A 1RFQA 5BPNA 3D2FB 4CZIA 2BUPA 3D2FA 4KBOA 4AM6A 3LDQA 3FZKA 3SLCA 1T6DA 2FF3B 1XC3A 4XEIA 4NB4A 2FXUA 4H5TA 3HZ6A 2E2PA 1NGIA 4CZGA 4DB3A 4B1UB 2A42A 3A5NC 4EIAA 4IZ9A 1JCFA 3LDNA 3LDOA 4H03B 1HJOA 4IJNA 1Q18A 3WUHA 3G25A 3UKUB 3CJBA 5CE3A 5AQOA 3U9ZA 3CJ7A 1E4GT 5BRDA 3LM9A 5AQPA 1XQSC 3EL2A 1T6CA 2D0PA 2CGLA 5AQMA 4BQLA 4CBXA 2Q0UA 1IJJA 2ASMA 1GLLO 3VEWA 3SMSA 4H0PA 3SJHA 1Z05A 3U4LA 4BRGA 5AZJB 5EVZA 1S3XA 3I8BA 5AZJA 1RDWX 4HWIA 5AQKA 5E84A 3RSEB 1QQNA 3RSEA 2E8AA 2P9KB 2P9SB 1GLBG 2P9KA 4H0OA 5KQDA 3H3OB 3WXJA 3JXUA 1NGEA 3ENHA 3BEXA 1QQMA 4EHUA 3R6MA 3CJAA 1QZ6A 3BF1A 4BGAA 3HM8A 1ZXOA 2W40A 4FWOA 3DAWA 2VYPA 3H6EA 5EXWA 4CI6A 2AA4A 2A6AA 5KPTA 4PKIA 4PL7A 4B1YB 2UYTA 4BQZA 4CZJA 4CZFA 5LJVA 4FWNA 1BDGA 4A62A
chains in the Genus database with same CATH superfamily
1HKGA 3HOTA 1C0TA 4Z4FA 3THYA 2HBJA 1Z25A 3O8MA 1EQYA 4JLHA 2D4WA 5C2FA 4DR7K 3D0PA 3HJFA 4CJ4A 2X6NA 1NBWA 4C8KA 2OTJN 5CYQA 3L8BA 4BRMA 3GDQA 5I42A 4O5BA 4B1VA 2LSNA 3MDQA 2OANA 3PO5A 3J7AP 2XY8A 4FWLA 1SL1A 4EHTA 5GIOA 4YOXA 4ELVA 4CZKA 2P9PA 3M1FA 1D8YA 4Y1CA 3T1YK 3JS6A 4CZGA 3BP8A 4KFBA 3ZSXA 1NGBA 2HMPA 5AQIA 2QKKA 5CY4A 5FROA 4CFDA 4HUGA 4GMJB 1RCHA 3U8XA 3SUOA 3ZX0A 4JK9A 3B6PA 1DEJA 1NK0A 3SI6A 3CFRA 2O8BA 4LF7K 3ATVA 5JMVA 3B8AX 2B4JA 3LDPA 3DXKB 4W5QA 3L2UA 2QXLA 3KKSA 2UXCK 3V9SA 4O44A 1S6PA 3HRGA 3S9HA 3QFPA 2JGUA 1ZC6A 5EX5A 4AHUA 1BG3A 2F7TA 4K42A 2ETJA 1XNRK 4GKKK 2DFHA 3C95A 3TTCA 2C1GA 3LZIA 4E19A 2XRIA 4IFEA 2ZF5O 2E6MA 3QEPA 2KTQA 2YNIA 3ZSOA 1JLEA 3MN5A 3CPEA 3QEVA 3WNGA 4LH4A 1FKOA 3GOIA 3D6RA 4JKGB 3VOVA 3SMPA 3ZT0A 3RWUA 1NGCA 3FLCO 4DTJA 4LFBK 4A59A 4CF9A 1ZBHA 2O8DB 4RG8A 4O8UA 1P90A 3NGZA 5AQTA 1RBSA 4QAGA 5HRPA 2IVPA 4FJ9A 2O8CA 3TR8A 4KO0A 4LY7A 1B9FA 2O8EA 1KFSA 5I9EB 3EN9A 3V9ZA 3WEEA 1YVUA 3V4IA 3MMVA 3ZSQA 2KFNA 2P9IA 2ATQA 2I7PA 4CK3A 1JLCA 5KPZA 3BGRA 3U9DA 4CFAA 4CEFA 2FSJA 4X66K 4WQ5A 4DQ8A 1CZ9A 1QQCA 3NF7A 3KK2A 4WQ5C 5F0XA 5EU7A 1FK9A 4O4GA 1KAYA 3ZLJA 5GAHP 1VQON 2WONA 4DV3K 4KHYA 2QM1A 3ZX2A 2HOEA 3QINA 3VQ6A 4LFAK 4BG8A 3V81A 3CJCA 2XY5A 5BR8K 3I0SA 4JI4K 1DTQA 1VRTA 3CQYA 2Q3SA 1KQSM 4KB1A 1X3MA 3K5NA 3VEVA 2CH5A 3BUZB 1CXUA 4M63C 2CGKA 3RRGA 1EXQA 5AQSA 4CF1A 4FLUA 3U3YA 1S1TA 1YITN 4FLXA 3AO3A 3S3NA 1WSGA 2JWKA 4CHZA 2A3ZA 1S22A 2OPQA 5M1OA 2YJEA 1EP4A 3OJUA 4JKCA 2GTDA 4KHNA 2NLXA 1Y64A 3R9PA 4DFKA 4B1XB 1J53A 3HBTA 5AQYA 1RT3A 3WXKA 3VEOA 5I3UA 4WCEL 1YT3A 3S41A 2QWRA 3H1QA 1IBLK 3CI5A 4OGCA 1RTDA 1KRPA 5AQLA 5GIPA 1KC8O 3IKMA 4FWQA 3AA3A 3GL1A 2QKBA 2YX6A 5IT9O 3H45C 4PKGA 1OKJA 2Z1IA 3IFRA 4GV9A 4G9ZA 3TTDA 3SK3A 5ELZA 4BRAA 1NM1A 4U67L 4CD3A 4ZHRA 3A2FA 4KI4A 2F9WA 4B1WB 3J81O 3PY8A 3ZT2A 1NGDA 2E2OA 4AHSA 3LPUA 4GV3A 1XC9A 3OJSA 5FLXO 3PIOL 3DRPA 4OPKA 1HKCA 3JSMA 4CCHA 3KLHA 4K8ZA 4E7KA 5F1XA 3SQ0A 5AQJA 4F9OA 1Q9XA 1IKWA 4F4KA 1WAJA 2PY5A 1BQMA 2V52B 3KWIA 1YI2N 4YY3K 4LF9K 3D2EA 3UKRB 3MWTA 3O3HA 1C0GA 3ULEB 1TKDA 2QWQA 4LFCK 3O1BA 4M45A 3IDHA 4JS5A 3EYZA 1ZBUA 1VQLN 3P5JA 1TYQA 4R79A 1KVBA 3AY9A 2NRWA 4FJ7A 3J7ZO 4DQPA 3OTOK 3VF6A 3DXMB 1NJYA 3VESA 2B6AA 5FPEA 1NGJA 4RW6A 1JLAA 3VF4A 1A5VA 1QSSA 2QK9A 3FE1A 4IOAL 1I94K 1RGIA 1LV5A 3T3FA 1JCEA 4WE1A 4IG0A 3QBWA 4B8AB 3S3OA 3WQTA 1I3AA 4DKWA 3VQCA 4FCYA 1VQ7N 1WSIA 4MLHA 3IRXA 5AQWA 4BDZA 1REVA 3VERA 4HVJA 1KAXA 3ZYYX 4BC3A 1NKBA 4B9UA 3E1YA 4I2PA 4W5NA 3EEQA 2F8TA 1Y97A 4DQQA 3THXA 4E89A 4DTNA 3T19A 4CK1A 2RN2A 1QTMA 3WNEA 3QICA 1Q9YA 4JYAK 3H46O 3W0LA 1KXPA 4B9VA 2XY7A 4FJMA 3RMCA 4B3RK 3RRHA 1XHXA 1JLBA 3BDPA 1F21A 3K5OA 2UXBK 5BN8A 2YHXA 3A0IX 1JL1A 3LL3A 1X9SA 1VSKA 2PYLA 3JAMO 1X9WA 3D2FB 2BUPA 4OO1J 4DTSA 4KBOA 2WC9A 3I55N 3VQBA 1XC3A 4NB4A 2FXUA 3C6UA 1CXQA 3HZ6A 3SCXA 3TAQA 3V9UA 1NGIA 4WFNL 4B1UB 3HXMA 4DV2K 4EIAA 4XIUA 2RKIA 1ILYA 2VG5A 4IBNA 4DV1K 1A5XA 4H03B 1VSMA 5CE3A 1KTQA 3U9ZA 3TARA 5CZ2A 4JEPA 3V1QA 1T6CA 3VN5A 4CBXA 4V19S 1GLLO 3E9PA 3AO5A 3KIOA 4M3WA 1RBVA 3O3GA 3NAEA 4H0PA 1RDAA 4DV6K 1UA1A 1HNWK 3CM5A 5AZJB 4JKBA 1NK6A 1RT4A 5AQKA 5E84A 3L2WA 1UOCA 4PWDA 1O1WA 4AHCA 4HTUA 4HCBA 4F2RA 3N4QA 3O3FA 5KQDA 3WXJA 3OYIA 1J9AA 1NGEA 1Q86O 1N36K 1NOZA 4HUFA 3QEWA 4ID5A 5M1NA 4B9MA 3BF1A 3QNOA 4FWOA 4IOCL 3SAGA 1TKZA 4CHNA 3DAWA 2VYPA 2A6AA 3TWHA 2HHXA 1IO2A 4CGGA 3KK3A 4K8XA 3LALA 4CZFA 4KI6A 2O8FA 2G8UA 2D0CA 3C94A 1ATRA 1HNVA 1KCFA 4JI6K 3A5OC 4RCHA 2JLEA 4DV7K 4BWMA 4JI5K 5DMRA 4KHSA 3SAHA 4CEBA 1C1CA 2PFUA 4RW7A 4FWPA 4B9TA 2VGMA 3C7NB 4DSIA 4OLBA 2YI1A 4H4OA 3K59A 3NGIA 3ISNC 3TANA 4EP5A 3VQAA 4FL9A 1HPMA 3EE8A 1IG8A 3HSTB 4BR7A 4CGDA 1V4SA 2VG7A 2D0BA 3VF2A 3MN9A 4DTMA 4JRPA 3MXIA 4C8LA 4BR2A 4JHDA 2J4RA 3VQDA 3VTHA 4CEZA 4BR9A 4OLAA 3VTIA 4M7XA 5M1FA 4H8KA 4QS7A 5AFUA 3OY9A 3ID6A 1K8KA 3CC7N 1TKXA 4YOTA 5DM7L 3VQQA 1VQ8N 3IS9A 4DSEA 2HBKA 3AVBA 1NMDA 4A61A 2ITMA 4X65K 2YHYA 4DFJA 1EWRA 5AQFA 1Q8IA 2FSNA 3ATUA 3ZETB 4FZXC 1JLGA 1VQKN 4CEEA 2GUPA 3NMUA 1JL2A 2ZGZA 3G71N 4C23A 2IVNA 4WYBA 1WBDA 1BISA 3V9XA 1QHAA 1T3VA 5LY3A 3MAQA 3AARA 2FF6A 3LAMA 3MCPA 4ZTFA 2HVIA 1GLCG 3OYLA 3P4IA 3ZSYA 4YOWA 5HROA 2R7YA 3DOLA 3D7EO 3NCIA 4CJ5A 4WF9L 1T03A 3NE6A 4A2BA 3CERA 2RHKA 5LL6Z 4FJKA 4E72A 1TV6A 3MN7A 1BCOA 1BA1A 3LDLA 2W41A 2QWOA 4BR5A 1BI4B 1RBRA 4KTQA 1ASUA 4CERA 1NK8A 3N4PA 4O8KA 2Q31A 1VQ6N 2NRZA 4IEEA 5TKYA 3MXMA 3AVLA 4M3XA 3A5MC 4N47A 4CJKA 1LWCA 4DF4A 2VQEK 4RW4A 1FW6A 3T69A 4CFBA 3ZSRA 3O08A 4FOEA 1OVYA 4RTFD 3CQXA 4CFCA 4B9LA 3A5LC 5MLCQ 4YOVA 4NLCA 5J2NA 2WOMA 1NGGA 3UE5A 3CC2N 3M5RA 2HHSA 4BVOA 3KZBA 4CEDA 1SKSA 2RPIA 1MWKA 4CF0A 4WFAL 5C0YA 2FBVA 3DXMA 5AZIA 3K9JA 2HHVA 1UAXA 1HUXA 3G10A 4KHWA 5A2QO 4JD2B 2IIRA 3AO4A 2Q36A 3THWB 3IMXA 3VA3A 3M6GA 1FJGK 2KLAA 3AGKA 4BRKA 1XHZA 1LAVA 3VGLA 1X3NA 3CFOA 3LWMA 4EAHD 1BWFO 3CM6A 5DK5A 3MXJA 1ESVA 1KFDA 1RDUA 2IOCA 2E88A 3L2QA 4DR6K 2HF4A 3NDKA 4AHTA 4DQRA 3U6FA 3EKUA 2CGJA 3E66A 3S5TA 1IG9A 1SL0A 1RT1A 2HBMA 4F3TA 4DV0K 1CZBA 4DFPA 4MDBA 3OYAA 4DLGA 3QERA 2WFBA 3H3NO 4H5VA 3RMBA 1U2VB 3A8YA 1ATSA 2O4IA 1KSPA 3K2PA 4CJRA 4JI0K 3VQ4A 3SJJA 4B08A 1WUAA 3AVCA 1BIZA 1GLFO 3OYJA 2PAVA 3QEIA 5C10A 1B9DA 3U3GA 1TAUA 2HF3A 3PUFA 2I5JA 1XMOK 3DRSA 4CHYA 3LZJA 4E7LA 3AO1A 4PHTX 4MO4A 4OPAA 4EP4A 1W0HA 1M90O 5TKWA 4DCHA 4C8OA 4CZMA 3SAFA 1TL1A 1RTIA 3SQ4A 4ILJA 4C8MA 3SBGA 3TU5A 5J2MA 3O1WA 4DR3K 4FJ8A 3EZWA 2Q0RA 2YHBA 2OCEA 4OGEA 1LW2A 3OS1A 1NK5A 2I7NA 3FFKB 4A5AA 3OYHA 3RMAA 3LP1A 4MDAA 2P9NB 5AQRA 4W5TA 1LAWA 5SZTA 2NNWA 1HMVA 3DWLA 4FZYA 4PUOA 4ISEA 1VSEA 1YF5L 1HPZA 4OKJA 1N5YA 4XJXA 1GLEG 4B9QA 3NF8A 3CQ8A 1NJZA 4C1NI 3MEGA 4J2AA 2YHWA 5JVGL 4IO9L 4DWIA 4FWRA 4CGIA 3HM9A 4CHQA 3EY1A 2HHQA 4IDKA 4CHPA 4CZEA 3OYDA 3NH1A 4JAXA 2OZMA 1S5JA 1RNHA 1X9JA 5BN9A 4ID1A 3CCJN 2QI2A 3CIPA 4PA1A 4QS9A 3KJVA 3CCQN 4BE2A 1HNZK 3AO2A 5AQZA 4B9SA 1TAQA 2NRXA 1VQNN 1ZYQA 3QNNA 4R5PA 2OPRA 3Q7CA 3GBTA 4IFYA 2P9UA 2P1JA 5FRNA 5HL7L 3LANA 3CCEN 1VQ5N 3O9RA 1UA0A 3CFPA 3VA0A 4KTZA 2Y1JA 2FLOA 3HTVA 2DFEA 1HYSA 1QS4A 1Z26A 2P9LB 2X6SA 3KVGA 2W00A 4DV5K 4FM0A 1WBBA 4FPAA 1SAZA 5KPRA 4GV6A 3JYTA 3ENOA 4DSFA 3KLIA 1SV5A 4KH6A 1DGKN 4FW1A 4NCBA 2ZE2A 2HNZA 5HRNA 3DLRA 4JKHA 1CZAN 1NJXA 3CYGA 4M3UA 4L3QA 4BRNA 2WBNA 4H5RA 4DLEA 4CJSA 1SQKA 4CJTA 3L4QA 3ZEUA 3TAPA 1BL3A 1U48A 1RBTA 4FO0A 4DSJA 4BRFA 1NGFA 3AV9A 1MA9B 1B92A 4N5SA 2PYJA 2YCHA 4E1JA 4BROA 3AA2A 4E7IA 1NLVA 3BF3A 3WXLA 4BC2A 4I9LA 5CHIA 4NXNK 4CGJA 5JVHL 3LDQA 5JENA 3O9QA 4XEIA 4H5TA 4BEBA 1TKTA 2E2PA 4E1NA 2ZJPL 4B3MK 2VWKA 1U47A 4FVUA 2QEXN 5KI6A 1VQ9N 1OH6A 4NLBA 3K5LA 3LDOA 3V1RA 2UUBK 4BDPA 1Q18A 3G25A 1K73O 1QE1A 3ZT3A 3VQEA 4LSLA 3T1AA 3ZSVA 1HYVA 1T7PA 4BQLA 2Q0UA 1IJJA 1M1KO 2ASMA 1Z05A 1L3VA 3OS2A 1EO1A 4DUZK 1RDWX 4CJPA 1NK7A 2YKMA 3KLGA 3RSEA 2P9KB 3AVFA 2P9SB 1BI4A 3ZT4A 1C6VA 2OPSA 4A5BA 4CESA 4E1MA 4NXMK 3MECA 3O9TA 3SQ2A 1SKWA 1K9MO 2YV0X 1YTAA 3O4QA 1DTTA 4X62K 2FBTA 3KTQA 1VQ4N 1QZ6A 1S1UA 1ZXOA 1QVGM 4CI6A 5GAGP 4F3OA 1X9MA 3MX5A 3PX6A 1NK4A 1IBKK 1BDGA 3CF5L 1FXXA 3RR8A 1RT5A 4N76A 4BE7B 4FLYA 5LMUK 1N33K 1RILA 4LF5K 3ZT1A 4NO7A 1IKVA 1IKXA 4JI2K 2DPNA 5HOOA 1GLDG 1HNIA 4HUEA 1C0MA 4ZTJA 5M1QA 2FBYA 5AQQA 3WNFA 3F9KA 2FBXA 2A41A 4W5RA 3L2VA 1J5EK 4DTXA 3LP0A 5C12A 4FJGA 4PY5A 3DLLL 1J54A 1WAFA 3CMAN 2P9PB 5EOYA 3VQ8A 5T7BA 1YXQA 2HB5A 5GINA 3TSUA 1TUYA 1E4FT 1NJWA 4FJNA 4M3ZA 1C1AA 1R59O 1OH8A 3CHWA 4DU3A 2W42A 4K41A 1S9GA 2QWPA 5J2QA 1YJ9N 1U2VA 3THVA 4DG1A 4LC9B 4O5FA 1VQPN 4FLWA 1HNXK 4CJQA 4CF8A 5C15A 1NKCA 3SPZA 2DTUA 4H5NA 5AR0A 3OYGA 3DXKA 5ADXH 4FM1A 1YHQN 1VQMN 1BCMA 3PSIA 3QETA 1VRUA 5DM6L 1IH7A 1L5UA 5SWMA 3OYBA 4W5OA 2E20A 2V7YA 4BR0A 3TAEA 5AQNA 1KLMA 4BRHA 3HP6A 3TAGA 4JV5K 3QLHA 4JK8A 2PZSA 3LPTA 1Q82O 3AAQA 4CF2A 4BE0A 3QBXA 4MO5A 1KVAA 4FWMA 3NHGA 5H1SQ 3NGYA 1RT7A 2OZSA 5J1EA 2X74A 1HQEA 2F96A 3O80A 3VQ7A 1D5AA 4JKGA 5AFUH 2QW9A 1MWMA 1XWLA 5AQGA 3VEXA 1P8ZA 2X78A 3CPWM 2HHWA 1JJ2M 4J2BA 2YHAA 4UQGA 3J8AA 4YNQA 4JS4A 2O8DA 3HPOA 4H0YB 1NK9A 4FJIA 4HCCA 4LD0A 3LM2A 2H3GX 4Z4IA 3GE1A 3TSQA 4DR1K 3WNHA 4FWKA 1GLAG 3QDKA 4BRQA 2E2QA 1GOCA 4M42A 2D0OA 3G0ZA 3RVCA 5ADXA 1YVNA 2F8SA 1VSHA 1K8AO 3RR7A 4B3OA 4GY2B 3O6WA 2EX3A 4BRPA 4AM7A 1VHXA 3MK6A 1ATNA 4IKFA 2NZTA 4FLTA 1U6ZA 4DHYA 5C25A 2NRVA 3E9OA 4BC4A 4WQ4A 2OYQA 2GX9A 3DLBA 3QB0A 2P9LA 2F9TA 1TUUA 2DY4A 4WQ4C 5C24A 2E2NA 3OBWA 4BECA 1NJIO 1HX1A 4CBUA 3O4NA 3SNNA 1TVRA 4DTUA 3TAFA 4L8RB 3O5BA 1H1VA 4K25A 2D5RA 4JI1K 4CK2A 3ID8A 4BE1A 1WOQA 2IS3A 1YAGA 4KH4A 1ASVA 4A2AA 4CBWA 3TI0A 1LCUA 5E26A 4BGBA 2KFZA 2NUBA 1NKEA 4OVLA 1VK0A 3PX0A 3NH2A 5HRRA 3EO3A 1Q81O 1BQNA 1IKYA 5CYMA 3FZFA 2Z1HA 2ASOA 2VCPA 4OKEA 5J2PA 1QZ5A 3QMLA 3LP2A 3VEYA 1K6YA 1TK5A 3C0BA 4CJEA 2V51B 3NBPA 3H08A 1QSLA 3CCLN 4Y0WA 5C2DA 2P5OA 5IWAK 3QIOA 4Z4HA 1WSFA 3VGKA 2KQ2A 2YKNA 3RTVA 1NGHA 4BRCA 4YORA 4B8CA 5BPLA 1Q7YO 1L3TA 4CJVA 3ALYA 2IGIA 4ISFA 3NH0A 4CIEA 3SUQA 1S1VA 2AP1A 1SS6A 2E1ZA 2QTDA 4BRDA 3SPYA 2QWMA 1BHLA 4FJHA 3M8RA 3NFAA 2G8FA 4B9NA 5KGWA 3C65A 3CCSN 5FPDA 4CZHA 1ITGA 2XY6A 1DT9A 1OH5A 4FYDA 3VMFB 1C1BA 3FZLA 4ICLA 3D2EB 4XH5A 3CJ1A 2FC0A 3SBTA 3KLFA 3UKRA 5EY4A 3K5MA 4HTLA 3OVNA 1KVCA 4F2SA 2ZM6K 5JS1A 4ELTA 2P9SA 3ULEA 3CYMA 1TYQB 4CW7B 1XMQK 4Q5VA 1WNSA 1S1XA 4YOYA 3SUPA 1KLNA 1QQOA 3F2KA 4G1QA 2IVOA 1LWFA 1ZBSA 4Z4EA 3QESA 1GOAA 5KTQA 1W97L 4FJ5A 5AQVA 4YDUA 4DTRA 3AVIA 4YDUC 3HVTA 4DU4A 2RE2A 1JXBA 3MCAB 3MWPA 2VGNA 3OA9A 3P31A 3KK1A 4MFBA 4CJUA 4FJXA 1J6ZA 3L3UA 1S1WA 4H0TB 2BANA 4NYNA 4U7BA 4MQ3A 5LJWA 4BG9A 1CLQA 2HMIA 2KHOA 3L0QA 4HHTA 2BH1A 5GADP 4Q0BA 1FKPA 4OKKA 3VQ5A 4OJRA 2ZGYA 3EZ5A 1BOTO 5BR9A 3H1VX 4CEAA 4GVEA 4BREA 3AVKA 2A1SA 2ZD1A 3THXB 1SKRA 3QO9A 5AJ3K 2A1RA 1NMNA 4RWTA 3ENBA 5M1PA 3NVKA 1VSIA 3DOKA 3HSCA 3SV3A 1JKHA 1EWQA 2D0AA 4IJAA 1L3UA 3OHRA 4I2QA 1EETA 3PO4A 3FZMA 4Z94A 2QWNA 3CMEN 2KZZA 1WSJA 1RTJA 4RW8A 5BPNA 3OS0A 4CZIA 3D2FA 3F73A 4AM6A 3V1OA 3SLCA 3MEDA 2FF3B 4AQYK 3ZCMA 2ZQBA 4IOXA 1HRHA 4KTWA 1C0UA 3OYFA 2GV9A 4Z0UA 3I0RA 4GVMA 2E4LA 3D45A 4JI3K 4AHRA 3LDNA 4FZZA 1A5WA 3TABA 4JKDA 3UKUB 3CJBA 3CJ7A 5BRDA 4BDYA 2HHUA 3PLAA 1XQSC 3EL2A 4O0IA 3CCMN 3PV8A 2IDOA 1S72N 2D0PA 1E3MA 5AQMA 4AILC 5LMNK 3E9LA 1RDDA 3M8QA 3VEWA 3AVAA 4FJJA 3SV4A 3DLGA 3OYEA 2QXFA 4DMNA 2BGGA 3I8BA 3P83D 5AZJA 2G8WA 4M3TA 1QQNA 2E8AA 2EHGA 3DI6A 3AA5X 4A57A 1N8RO 1RTHA 2WTUA 4Z4GA 2P5GA 3KLEA 3ENHA 2ITGA 2GBZA 3BEXA 1QQMA 5FDLA 3KD1E 3HPGA 4KH5A 1ZBLA 4BGAA 3HM8A 3MX2A 4KHPK 2W40A 2KW4A 5EXWA 2HHIA 4PL7A 3SQ1A 4B1YB 4GKJK 4ILGB 5E41A 5LJVA 2O8FB 2P51A 4A62A 3AVJA 3WXMB 3VPZA 5CZ1A 1QHTA 1SUQA 4C1NK 4CD1A 2V7ZA 2QA4N 4IDHA 2KZMA 4FWSA 1C0FA 3LAKA 2BTFA 4PKHA 5D3GA 3I56N 2HNDA 4I6MB 5KGXA 1JXEA 1NU0A 1D9FA 4FW2A 4I7FA 1NWKA 1I39A 5KRSA 2JWLA 1L3SA 3G4SN 3C7NA 4BC5A 1EKEA 1HJRA 2KKZA 3FFIA 2UU9K 4DTOA 1NGAA 2Q97A 4CIFA 4K0KK 3K9KA 2OPPA 3O4WA 4RW9A 1TK8A 1QSYA 3ASMA 4YFUA 2Z1JA 1DLOA 2VWJA 2HVHA 4CJLA 1TL3A 4JHDB 1LOTB 3BZKA 1VSLA 3L6QA 4BRLA 1V4TA 2A40A 3FZHA 4LF6K 3AGRA 3AVGA 1K8KB 3HOSA 4OPJA 1VSJA 3CC4N 3DMJA 3C6HA 3NVMA 1BGXT 3FGUA 2HHTA 2FSKA 1O13A 4JN4A 1MU2A 3C6AA 1JCGA 3I33A 4IO8A 3AVMA 1YJWN 4JKAA 3M3ZA 1W2BM 3M8PA 3ZETA 4TSXA 2E6LA 2CH6A 4FPBA 1BA0A 1JLFA 3EKSA 4XH1A 4DSLA 5C42A 3CCRN 1EX4A 3WT0A 4CIGA 3C6TA 2NRRA 4DUYK 1WSHA 4BR4A 5FPNA 3T1HK 3HPHA 1YUWA 4ELUA 2GEMA 1NG9A 5HBMA 4BRIA 2HSTA 1HLUA 2IAJA 3MN6A 5JLFA 2IC3A 1RBUA 4PL8A 3L3VA 4KPYA 4LSNA 4J8FA 4CJFA 3VEZA 3QIPA 1YTUA 2G8HA 3DLHA 3LP3A 4M7YA 1J5OA 1ASWA 4KB0A 1DKGD 3QFUA 3VENA 1RT2A 1OH7A 1N34K 2NRTA 3DLEA 3VQ9A 2Q1NA 3CJ9A 3UIQA 3DLKA 4M41A 5HP1A 3IG1A 4DFMA 3KWGA 3CETA 3BY5A 2XO7A 3OW2M 4OPHA 2ZJRL 2YNHA 2GUIA 5K14A 3G6EN 3DRRA 5JS2A 3ZX3A 4FLZA 2A5XA 1WSEA 1KD1O 2PBDA 1S9EA 3DM2A 4JKEA 3GG4A 2XHBA 4O55A 2HBLA 4EFHA 4BVPA 1Z6RA 1W7AA 3PSFA 4DR5K 4JK7A 1HQUA 1XNQK 4BY9C 4KAZA 5BREA 4DR2K 5M1KA 2B5JA 2UXDK 3THYB 2E5LK 1YJNN 2RF2A 3AVHA 5FRMA 2E1YA 4IFVA 1D4XA 5AZIB 3J80O 4DQIA 4H0XB 2G8KA 3OYMA 3AVNA 3UB5A 3LWLA 4JD2A 4B1ZA 4LF8K 5AQXA 4AF1A 1TK0A 3THWA 4KHQA 4CE9A 5HLFA 1NNEA 2YJFA 3LDSA 4ISGA 4DTPA 1WB9A 4NCGA 4CJ7A 2YNGA 3TPQA 1T05A 4FLVA 1W9HA 4KHUA 2AJQA 4IEIA 4IXCA 4FK4A 3HK2A 4CGFA 3HYFA 4CJ3A 2W6LA 4DU1A 2UUAK 3W3DA 3OYNA 4PQUA 4CJWA 4YOUA 4JNEA 4WFBL 4FSVA 3F5TA 3J7YP 2C1IA 3O9SA 4J2EA 4DQSA 5JICA 1X1PA 1SZ2A 1IBMK 3K57A 3KKRA 1GLJO 3NF6A 3VETA 2O8BB 3VQPA 4F8RA 4DV4K 5F2RA 3SUNA 2Y1IA 2F4VK 1GOBA 4FOIA 1BU6O 4DS5A 3F9MA 1N32K 5AQUA 5B8HA 4E7JA 3HP9A 3S3MA 3EE9A 4H5WA 3NF9A 4Y1DA 3HT3A 1HR0K 4H0VB 4X64K 1XUPO 3O9UA 1NOYA 4GW6A 3R8EA 2Z1GA 3HVRA 4IG3A 2OA8A 2P9NA 4YHHK 2BDPA 3AAPA 2OTLN 1QVFM 4CEOA 1BO5O 5BRHA 3UKUA 2ZWHA 1VSDA 2ASPA 2GWKA 3AA4A 4B3SK 3DYAA 3IUCA 5AQHA 4FM2A 2VG6A 4DR4K 3P39A 1G99A 4DF8A 2EWSA 4CECA 2O8CB 4FK2A 3OYCA 2O8EB 2QWLA 5BRFA 3WEEB 4BACA 1OVQA 2P9IB 2WUSA 2W6KA 3P38A 3ULDA 1RDCA 3KK7A 3T7ZA 1WN7A 1TGOA 3HI0A 1BUPA 4CEQA 4FK0A 1T44A 2P9UB 4GNIA 4IWVA 1R0AA 3TAMA 3WQUA 4JI8K 4MLEA 3I8DA 1XI1A 3CD6N 3QEXA 1MDUB 3DJCA 3OBYA 1HKBA 4AH9A 1S6QA 4OX9K 3CCVN 3FR0A 3OYKA 1IV0A 4CVNE 2VWBA 3PX4A 4DS4A 4I6MA 5JLHA 2D1KA 4QCLA 3IAYA 1ZBIA 3KHYA 3VGMA 1G15A 3CXCM 3CG7A 3R3LA 2GWJA 2Q2RA 4QS8A 1N6QA 2NRHA 3TSPA 4XH4A 3WXIA 3ZEUB 3KD5E 4JI7K 4ILHA 5FPMA 4KREA 5KQ8A 4CHOA 5HRSA 4KKOA 3TTFA 3L4IA 4UY8O 4H4MA 4CZLA 5BPMA 1KAZA 1U45A 3ZSZA 2GELA 3PIPL 3R1XA 3ZSWA 4E7HA 2HNYA 4DSKA 4K43A 4AHVA 1RFQA 4NCAA 4FXDA 4EZ9A 3E01A 2UUCK 4LH5A 3M8SA 1HYZA 1VAZA 3FZKA 1T6DA 4C8NA 1U04A 4N56A 4DB3A 4B3TK 3P1GA 4CGHA 2A42A 3A5NC 4NYFA 4IZ9A 2YNFA 1LW0A 1JCFA 2ZJQL 4IJNA 1HJOA 3V6DA 4O0JA 3WUHA 1BIUA 5AQOA 2O4GA 3HL8A 1E4GT 2G8IA 3LM9A 3BZCA 3K58A 5AQPA 3V9WA 3B6OA 1ZBFA 2CGLA 2DFFA 1SL2A 1VSFA 4BWJA 1U49A 3K0SA 4LF4K 4J2DA 3SMSA 3SJHA 3U4LA 4M3RA 4BRGA 3SZ2A 4FVMA 3Q7BA 5EVZA 1S3XA 2HHHK 4KRFA 4HWIA 1U4BA 1LWEA 3RSEB 1RT6A 3L2RA 3HO1A 3CCUN 5GAEP 5KRTA 4I9QA 3RMDA 4JRQA 1GLBG 2P9KA 4H0OA 1YIJN 2BE2A 3H3OB 4N41A 1RDBA 3JXUA 4E3SA 1T8EA 3MEEA 1D9DA 4KV8A 4E0DA 1UWBA 5CR4A 3ITHA 4EHUA 3R6MA 2G8VA 3CJAA 3SYZA 4Z4CA 4FJLA 3H6EA 2VQFK 2AA4A 4EZ6A 4JKFA 5KPTA 4PKIA 1JLQA 4BQZA 2UYTA 1WLJA 4QOZB 4CZJA 4FWNA 2HW3A 4M3YA
chains in the Genus database with same CATH topology
1HKGA 3WXMB 3VPZA 3HOTA 3CF5L 4C1NK 1ATRA 4CD1A 2HBJA 2V7ZA 2QA4N 4IDHA 4BE7B 4FWSA 1C0FA 1EQYA 2BTFA 3O8MA 4PKHA 3A5OC 4I6MB 3I56N 2D4WA 5C2FA 4RCHA 4NO7A 2DPNA 1NBWA 3SAHA 5HOOA 1GLDG 1NWKA 2OTJN 2PFUA 5M1QA 5AQQA 4FWPA 2VGMA 3C7NB 2JWLA 4BRMA 3G4SN 3C7NA 3GDQA 2YI1A 4BC5A 2A41A 4B1VA 2KKZA 3MDQA 2OANA 1NGAA 2Q97A 4FL9A 3K9KA 3O4WA 5C12A 1HPMA 3EE8A 1IG8A 4FWLA 4BR7A 4EHTA 1V4SA 3DLLL 3VF2A 3CMAN 5GIOA 2P9PB 4YOXA 3MN9A 5EOYA 4CZKA 2P9PA 3M1FA 4JHDB 1LOTB 4BR2A 1YXQA 4JHDA 3L6QA 2J4RA 3VTHA 5GINA 3JS6A 4BRLA 1V4TA 2A40A 3FZHA 1TUYA 3TSUA 1E4FT 3BP8A 4M7XA 3VTIA 4BR9A 5M1FA 3AGRA 1NGBA 1K8KB 2HMPA 5AQIA 4QS7A 5AFUA 3HOSA 3CC7N 1R59O 1K8KA 3ID6A 3CC4N 4YOTA 3C6HA 3CHWA 3NVMA 5DM7L 4K41A 3FGUA 1VQ8N 2FSKA 2QWPA 1O13A 3U8XA 3ZX0A 2HBKA 4JN4A 1NMDA 1U2VA 3C6AA 1JCGA 3I33A 4IO8A 4JK9A 2ITMA 2YHYA 4A61A 1DEJA 4LC9B 4O5FA 1VQPN 5AQFA 3ATUA 2FSNA 3ATVA 5C15A 3B8AX 3ZETB 5JMVA 4JKAA 3M3ZA 1YJWN 1W2BM 3LDPA 1VQKN 3ZETA 2GUPA 3DXKB 4H5NA 5AR0A 3NMUA 2ZGZA 2CH6A 4FPBA 3DXKA 2QXLA 4C23A 5ADXH 1BA0A 3EKSA 4XH1A 3G71N 1YHQN 2IVNA 1VQMN 4WYBA 3CCRN 5DM6L 3WT0A 2NRRA 1QHAA 1T3VA 4BR4A 5FPNA 5LY3A 3AARA 1YUWA 2FF6A 3HRGA 2E20A 2GEMA 2V7YA 3QFPA 4BR0A 3MCPA 5AQNA 4BRIA 1ZC6A 2HSTA 5EX5A 1GLCG 1HLUA 1BG3A 2F7TA 4K42A 3P4IA 4BRHA 3MN6A 5JLFA 4YOWA 4PL8A 3TTCA 2C1GA 4JK8A 3D7EO 4J8FA 1Q82O 4IFEA 3AAQA 2ZF5O 4WF9L 3VEZA 4A2BA 3CERA 4M7YA 3MN5A 3QBXA 4MO5A 2RHKA 3CPEA 1DKGD 4FWMA 5H1SQ 3QFUA 3VENA 3MN7A 3GOIA 1BA1A 3LDLA 2W41A 3D6RA 2QWOA 2NRTA 3O80A 4JKGB 4BR5A 3VOVA 2Q1NA 3CJ9A 4JKGA 5AFUH 3SMPA 2QW9A 1MWMA 3N4PA 5AQGA 4O8KA 1P8ZA 3VEXA 3CPWM 2Q31A 1JJ2M 1NGCA 3FLCO 1VQ6N 3KWGA 2NRZA 3CETA 4IEEA 5TKYA 4A59A 3J8AA 4O8UA 1P90A 4OPHA 5AQTA 2ZJRL 3OW2M 2IVPA 3A5MC 4H0YB 3G6EN 3ZX3A 2A5XA 3LM2A 2H3GX 3T69A 5I9EB 1KD1O 3EN9A 2PBDA 3O08A 3WEEA 4JKEA 4FOEA 3GG4A 1OVYA 3GE1A 3MMVA 4RTFD 3TSQA 3CQXA 2HBLA 2P9IA 1GLAG 4FWKA 2I7PA 3QDKA 4BVPA 1Z6RA 3A5LC 4BRQA 5KPZA 5MLCQ 4YOVA 2E2QA 4NLCA 4JK7A 3U9DA 2D0OA 4BY9C 1NGGA 2FSJA 3UE5A 4WQ5A 5BREA 3RVCA 3M5RA 3CC2N 4DQ8A 5M1KA 5ADXA 4BVOA 3KZBA 1YVNA 4WQ5C 1YJNN 5F0XA 1K8AO 4GY2B 1MWKA 1KAYA 3O6WA 2E1YA 5AZIB 1D4XA 3DXMA 4WFAL 5C0YA 5AZIA 4H0XB 5GAHP 3K9JA 1HUXA 4BRPA 1VQON 2QM1A 3ZX2A 2HOEA 4JD2B 3MK6A 2IIRA 3UB5A 4AM7A 1ATNA 4BG8A 4JD2A 4B1ZA 3CJCA 2Q36A 5AQXA 4AF1A 2NZTA 3IMXA 1U6ZA 4DHYA 3M6GA 2NRVA 3E9OA 3CQYA 4BC4A 4WQ4A 2KLAA 3AGKA 2GX9A 4BRKA 2YJFA 3QB0A 4ISGA 1KQSM 2P9LA 2F9TA 1TUUA 3VGLA 4CJ7A 4WQ4C 3TPQA 1X3NA 1X3MA 2E2NA 3OBWA 1BWFO 4EAHD 1NJIO 3VEVA 4BECA 2CH5A 4IEIA 4IXCA 1HX1A 3BUZB 4CBUA 1ESVA 1RDUA 4M63C 2E88A 2CGKA 2HF4A 3O5BA 1H1VA 4K25A 5AQSA 3EKUA 2CGJA 3E66A 3W3DA 3ID8A 1YITN 1WOQA 2HBMA 4YOUA 4JNEA 2JWKA 2A3ZA 1S22A 1YAGA 2YJEA 3F5TA 4FSVA 4KH4A 5M1OA 4A2AA 4WFBL 4MDBA 4CBWA 2C1IA 4JKCA 3O9SA 2GTDA 5JICA 1LCUA 2NLXA 5E26A 1SZ2A 2WFBA 4BGBA 1Y64A 3R9PA 3H3NO 4H5VA 1U2VB 4B1XB 3A8YA 3HBTA 1ATSA 1GLJO 3VETA 3EO3A 5AQYA 1Q81O 3FZFA 3WXKA 1WUAA 1GLFO 2ASOA 2VCPA 2PAVA 5F2RA 3VEOA 5GIPA 5C10A 4WCEL 1QZ5A 3QMLA 4FOIA 1BU6O 3S41A 3VEYA 2HF3A 2QWRA 3H1QA 3F9MA 3C0BA 5AQUA 5B8HA 2V51B 3CI5A 4PHTX 3EE9A 3CCLN 4Y0WA 4MO4A 4H5WA 4OPAA 5AQLA 3IKMA 5C2DA 5TKWA 4DCHA 4FWQA 4CZMA 3SAFA 1M90O 3GL1A 4ILJA 3TU5A 3SBGA 2YX6A 3O1WA 3H45C 3VGKA 3EZWA 1OKJA 3IFRA 4PKGA 2Q0RA 4H0VB 4GV9A 1NGHA 3TTDA 4G9ZA 4BRCA 1XUPO 3O9UA 4YORA 3SK3A 2I7NA 3FFKB 5ELZA 3R8EA 4BRAA 4A5AA 4MDAA 5BPLA 2P9NB 1NM1A 1Q7YO 4U67L 5AQRA 4CD3A 2P9NA 3AAPA 2OTLN 1QVFM 2NNWA 2F9WA 1BO5O 4B1WB 4ISFA 1NGDA 2AP1A 2E2OA 3DWLA 1SS6A 2E1ZA 2QTDA 4GV3A 4BRDA 5BRHA 3UKUA 2ZWHA 2QWMA 4ISEA 1YF5L 3PIOL 2ASPA 1HKCA 2GWKA 4XJXA 1GLEG 4B9QA 3IUCA 5AQHA 4C1NI 5F1XA 5AQJA 3P39A 4F9OA 1G99A 3C65A 2YHWA 5JVGL 4IO9L 2EWSA 1KC8O 3CCSN 5FPDA 4FWRA 4CZHA 1DT9A 2V52B 3VMFB 3KWIA 2QWLA 3FZLA 1YI2N 5BRFA 3D2EB 4XH5A 3WEEB 4CZEA 3CJ1A 3D2EA 3UKRB 4JAXA 3SBTA 3MWTA 2P9IB 3UKRA 5EY4A 4HTLA 1C0GA 2WUSA 3ULEB 1X9JA 5BN9A 3CCJN 2P9SA 3P38A 2QWQA 3ULEA 2QI2A 3CIPA 3O1BA 4QS9A 3CCQN 3IDHA 1TYQB 3KK7A 1VQLN 5AQZA 1TYQA 3T7ZA 4R79A 3AY9A 2NRWA 4YOYA 3J7ZO 2NRXA 3HI0A 1BUPA 1QQOA 1VQNN 3F2KA 2IVOA 3VF6A 1ZBSA 3Q7CA 1T44A 2P9UB 3GBTA 4GNIA 3DXMB 4IWVA 1W97L 2P9UA 5AQVA 4YDUA 3VESA 3WQUA 4MLEA 5HL7L 3CCEN 5FPEA 1VQ5N 1NGJA 3O9RA 3VF4A 4YDUC 3CD6N 2RE2A 3MCAB 3MWPA 1MDUB 2FLOA 3HTVA 2VGNA 3DJCA 3OA9A 3P31A 3FE1A 3OBYA 1HKBA 4IOAL 2P9LB 3KVGA 2W00A 1RGIA 1JCEA 3CCVN 1J6ZA 3FR0A 4H0TB 4FPAA 1SAZA 5KPRA 4GV6A 3QBWA 4U7BA 2VWBA 4BG9A 5LJWA 4I6MA 3WQTA 3ENOA 2KHOA 3L0QA 5JLHA 2D1KA 2BH1A 4DKWA 5GADP 4KH6A 1DGKN 1VQ7N 4MLHA 3KHYA 5AQWA 4EFHA 3VGMA 3VERA 2ZGYA 1KAXA 3ZYYX 4BC3A 3CXCM 4JKHA 1BOTO 1CZAN 3H1VX 3R3LA 2GWJA 4GVEA 4BREA 5BR9A 4L3QA 2Q2RA 3E1YA 4BRNA 4QS8A 2NRHA 2WBNA 4H5RA 3TSPA 1SQKA 4XH4A 3WXIA 3ZEUB 3L4QA 4ILHA 5FPMA 3ZEUA 5KQ8A 3QICA 4RWTA 4FO0A 3ENBA 3H46O 5M1PA 3NVKA 3W0LA 1KXPA 3TTFA 4BRFA 3L4IA 4UY8O 1NGFA 4CZLA 5BPMA 1KAZA 1MA9B 3HSCA 2GELA 3PIPL 4IJAA 3R1XA 3OHRA 2YCHA 4E1JA 4BROA 3FZMA 5BN8A 4Z94A 1NLVA 2YHXA 3A0IX 2QWNA 3BF3A 3LL3A 4K43A 3WXLA 4BC2A 3CMEN 1RFQA 5BPNA 3D2FB 5CHIA 4CZIA 2BUPA 3D2FA 4OO1J 4KBOA 4AM6A 5JVHL 1VAZA 2WC9A 3LDQA 3FZKA 3SLCA 1T6DA 3I55N 2FF3B 1XC3A 3O9QA 4XEIA 4NB4A 2FXUA 4H5TA 4BEBA 3HZ6A 4IOXA 2E2PA 1NGIA 4CZGA 4DB3A 4WFNL 2ZJPL 4FVUA 4B1UB 2QEXN 2A42A 3A5NC 4EIAA 1VQ9N 4IZ9A 1ILYA 4NLBA 1JCFA 3LDNA 3LDOA 2ZJQL 4H03B 1HJOA 4IJNA 1Q18A 3WUHA 3G25A 4JKDA 3UKUB 3CJBA 5CE3A 5AQOA 1K73O 3U9ZA 3CJ7A 1E4GT 5BRDA 3LM9A 4JEPA 3PLAA 5AQPA 1XQSC 3EL2A 3CCMN 1S72N 1T6CA 2D0PA 2CGLA 5AQMA 4BQLA 4CBXA 2Q0UA 1IJJA 1M1KO 2ASMA 1GLLO 3E9LA 3E9PA 3VEWA 3SMSA 4H0PA 3SJHA 1Z05A 3U4LA 4BRGA 1EO1A 5AZJB 3Q7BA 4JKBA 5EVZA 1S3XA 3I8BA 5AZJA 1RDWX 4HWIA 5AQKA 5E84A 3RSEB 3CCUN 1QQNA 3RSEA 2E8AA 5GAEP 2P9KB 2P9SB 1GLBG 2P9KA 4H0OA 1YIJN 3N4QA 1YJ9N 4A57A 5KQDA 1N8RO 3H3OB 4A5BA 3WXJA 3JXUA 3O9TA 1NGEA 1Q86O 3ENHA 1K9MO 3BEXA 5CR4A 1QQMA 4EHUA 5M1NA 3R6MA 1VQ4N 3CJAA 4KH5A 1QZ6A 3BF1A 4BGAA 3HM8A 3MX2A 1ZXOA 2W40A 4FWOA 4IOCL 3SAGA 3DAWA 2VYPA 3H6EA 5EXWA 4CI6A 1QVGM 2AA4A 2A6AA 4JKFA 5KPTA 4PKIA 4PL7A 5GAGP 4B1YB 2UYTA 4BQZA 4ILGB 4CZJA 3MX5A 4CZFA 5LJVA 4FWNA 1BDGA 4A62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HKG A;  3VPZ A;  4CD1 A;  1ATR A;  2V7Z A;  4FWS A;  1C0F A;  1EQY A;  2BTF A;  3O8M A;  4PKH A;  3A5O C;  4I6M B;  2D4W A;  4RCH A;  4NO7 A;  2DPN A;  1NBW A;  1GLD G;  1NWK A;  5AQQ A;  4FWP A;  3C7N B;  4BRM A;  3C7N A;  3GDQ A;  2YI1 A;  4BC5 A;  2A41 A;  4B1V A;  3MDQ A;  2OAN A;  1NGA A;  2Q97 A;  4FL9 A;  3O4W A;  1HPM A;  4FWL A;  1IG8 A;  4BR7 A;  4EHT A;  1V4S A;  3VF2 A;  2P9P B;  3MN9 A;  5EOY A;  4CZK A;  2P9P A;  3M1F A;  4JHD B;  1LOT B;  4BR2 A;  1YXQ A;  4JHD A;  3L6Q A;  2J4R A;  3JS6 A;  4BRL A;  1V4T A;  2A40 A;  3FZH A;  1TUY A;  4BR9 A;  1E4F T;  3BP8 A;  4M7X A;  1NGB A;  1K8K B;  2HMP A;  5AQI A;  4QS7 A;  5AFU A;  1R59 O;  1K8K A;  3CHW A;  4K41 A;  3FGU A;  2FSK A;  2QWP A;  3U8X A;  3ZX0 A;  4JN4 A;  1NMD A;  1U2V A;  3I33 A;  1JCG A;  4IO8 A;  2ITM A;  4A61 A;  2YHY A;  1DEJ A;  4LC9 B;  4O5F A;  5AQF A;  3ATU A;  2FSN A;  3ATV A;  5JMV A;  3B8A X;  3ZET B;  3M3Z A;  3LDP A;  3ZET A;  3DXK B;  2GUP A;  4H5N A;  5AR0 A;  2ZGZ A;  2CH6 A;  4FPB A;  3DXK A;  2QXL A;  4C23 A;  5ADX H;  1BA0 A;  3EKS A;  4XH1 A;  2IVN A;  4WYB A;  3WT0 A;  1QHA A;  4BR4 A;  5LY3 A;  5FPN A;  3AAR A;  1YUW A;  2FF6 A;  2E20 A;  2GEM A;  2V7Y A;  3QFP A;  4BR0 A;  3MCP A;  5AQN A;  4BRI A;  1ZC6 A;  5EX5 A;  1GLC G;  1HLU A;  1BG3 A;  4K42 A;  3P4I A;  4BRH A;  3MN6 A;  5JLF A;  4PL8 A;  3D7E O;  4J8F A;  3AAQ A;  2ZF5 O;  3VEZ A;  4A2B A;  3CER A;  4M7Y A;  3MN5 A;  3QBX A;  4MO5 A;  1DKG D;  4FWM A;  3QFU A;  3VEN A;  3MN7 A;  3GOI A;  1BA1 A;  3LDL A;  2W41 A;  2QWO A;  3O80 A;  4BR5 A;  3VOV A;  3CJ9 A;  2Q1N A;  5AFU H;  3SMP A;  2QW9 A;  1MWM A;  5AQG A;  4O8K A;  1P8Z A;  3VEX A;  2Q31 A;  1NGC A;  3FLC O;  3CET A;  5TKY A;  3J8A A;  5AQT A;  2IVP A;  3A5M C;  4H0Y B;  3ZX3 A;  2A5X A;  3LM2 A;  2H3G X;  5I9E B;  3EN9 A;  2PBD A;  3O08 A;  3WEE A;  4FOE A;  3GG4 A;  3GE1 A;  3MMV A;  4RTF D;  3CQX A;  2P9I A;  4FWK A;  1GLA G;  4EFH A;  2I7P A;  3QDK A;  4BVP A;  1Z6R A;  3A5L C;  4BRQ A;  5KPZ A;  2E2Q A;  3U9D A;  2D0O A;  1NGG A;  2FSJ A;  3UE5 A;  4WQ5 A;  5BRE A;  4DQ8 A;  5ADX A;  4BVO A;  3KZB A;  1YVN A;  4WQ5 C;  5F0X A;  4GY2 B;  1MWK A;  1KAY A;  3O6W A;  2E1Y A;  5AZI B;  1D4X A;  3DXM A;  5AZI A;  4H0X B;  1HUX A;  4BRP A;  2QM1 A;  3ZX2 A;  2HOE A;  4JD2 B;  3MK6 A;  2IIR A;  3UB5 A;  4AM7 A;  1ATN A;  4BG8 A;  4JD2 A;  4B1Z A;  3CJC A;  2Q36 A;  5AQX A;  2NZT A;  3IMX A;  1U6Z A;  4DHY A;  3M6G A;  3CQY A;  4BC4 A;  4WQ4 A;  4BRK A;  2YJF A;  3QB0 A;  4ISG A;  2P9L A;  2F9T A;  1TUU A;  3VGL A;  4CJ7 A;  4WQ4 C;  3TPQ A;  1X3N A;  1X3M A;  2E2N A;  4EAH D;  1BWF O;  3VEV A;  2CH5 A;  4IXC A;  1HX1 A;  3BUZ B;  4CBU A;  1ESV A;  4M63 C;  2E88 A;  2CGK A;  2HF4 A;  3O5B A;  1H1V A;  4K25 A;  5AQS A;  3EKU A;  2CGJ A;  3W3D A;  3ID8 A;  1WOQ A;  4JNE A;  2A3Z A;  1S22 A;  1YAG A;  2YJE A;  4FSV A;  4A2A A;  4CBW A;  2GTD A;  5JIC A;  1LCU A;  2NLX A;  5E26 A;  1SZ2 A;  4BGB A;  1Y64 A;  3R9P A;  3H3N O;  4H5V A;  1U2V B;  4B1X B;  3A8Y A;  3HBT A;  1ATS A;  1GLJ O;  3VET A;  3EO3 A;  5AQY A;  3FZF A;  3WXK A;  1WUA A;  1GLF O;  2ASO A;  2VCP A;  2PAV A;  5F2R A;  3VEO A;  1QZ5 A;  3QML A;  4FOI A;  1BU6 O;  3S41 A;  3VEY A;  2HF3 A;  2QWR A;  3H1Q A;  3F9M A;  3C0B A;  5AQU A;  5B8H A;  2V51 B;  3CI5 A;  4Y0W A;  4MO4 A;  4H5W A;  5AQL A;  4DCH A;  4FWQ A;  4CZM A;  3GL1 A;  3TU5 A;  3O1W A;  3H45 C;  3VGK A;  3EZW A;  1OKJ A;  3IFR A;  4PKG A;  2Q0R A;  4H0V B;  1NGH A;  4BRC A;  1XUP O;  3SK3 A;  2I7N A;  3FFK B;  5ELZ A;  3R8E A;  4BRA A;  5BPL A;  2P9N B;  1NM1 A;  5AQR A;  4CD3 A;  2P9N A;  3AAP A;  2F9W A;  1BO5 O;  4B1W B;  4ISF A;  1NGD A;  2AP1 A;  2E2O A;  3DWL A;  2E1Z A;  4BRD A;  5BRH A;  3UKU A;  2ZWH A;  2QWM A;  4ISE A;  2ASP A;  1HKC A;  2GWK A;  1GLE G;  4B9Q A;  3IUC A;  5AQH A;  5F1X A;  5AQJ A;  4F9O A;  1G99 A;  2YHW A;  2EWS A;  5FPD A;  4FWR A;  4CZH A;  2V52 B;  2QWL A;  3FZL A;  5BRF A;  3D2E B;  4XH5 A;  3WEE B;  4CZE A;  3CJ1 A;  3D2E A;  3UKR B;  4JAX A;  2P9I B;  3UKR A;  5EY4 A;  4HTL A;  1C0G A;  2WUS A;  3ULE B;  1X9J A;  5BN9 A;  2P9S A;  3ULE A;  2QWQ A;  3CIP A;  3O1B A;  4QS9 A;  3IDH A;  1TYQ B;  5AQZ A;  1TYQ A;  3AY9 A;  3HI0 A;  1BUP A;  1QQO A;  2IVO A;  3VF6 A;  1ZBS A;  1T44 A;  2P9U B;  3GBT A;  4GNI A;  3DXM B;  4IWV A;  2P9U A;  5AQV A;  4YDU A;  3VES A;  3WQU A;  4MLE A;  5FPE A;  1NGJ A;  3VF4 A;  4YDU C;  1MDU B;  2FLO A;  3HTV A;  3DJC A;  3FE1 A;  1HKB A;  2P9L B;  3KVG A;  1RGI A;  1JCE A;  1J6Z A;  3FR0 A;  4H0T B;  4FPA A;  1SAZ A;  5KPR A;  3QBW A;  2VWB A;  4BG9 A;  5LJW A;  4I6M A;  3WQT A;  3ENO A;  2KHO A;  3L0Q A;  5JLH A;  2D1K A;  1DGK N;  4MLH A;  3KHY A;  5AQW A;  3VGM A;  3VER A;  2ZGY A;  1KAX A;  4BC3 A;  1BOT O;  1CZA N;  3H1V X;  5BR9 A;  2GWJ A;  4BRE A;  4L3Q A;  2Q2R A;  4BRN A;  4QS8 A;  2NRH A;  4H5R A;  1SQK A;  4XH4 A;  3WXI A;  3ZEU B;  5FPM A;  3ZEU A;  5KQ8 A;  3QIC A;  4RWT A;  4FO0 A;  3H46 O;  3W0L A;  1KXP A;  4BRF A;  3L4I A;  1NGF A;  4CZL A;  5BPM A;  1KAZ A;  1MA9 B;  3HSC A;  2GEL A;  4IJA A;  3OHR A;  2YCH A;  4E1J A;  4BRO A;  3FZM A;  5BN8 A;  4Z94 A;  1NLV A;  2YHX A;  3A0I X;  2QWN A;  3BF3 A;  3LL3 A;  4K43 A;  3WXL A;  4BC2 A;  1RFQ A;  5BPN A;  3D2F B;  4CZI A;  2BUP A;  3D2F A;  4KBO A;  4AM6 A;  3LDQ A;  3FZK A;  3SLC A;  1T6D A;  2FF3 B;  1XC3 A;  4XEI A;  4NB4 A;  2FXU A;  4H5T A;  3HZ6 A;  2E2P A;  1NGI A;  4CZG A;  4DB3 A;  4B1U B;  2A42 A;  3A5N C;  4EIA A;  4IZ9 A;  1JCF A;  3LDN A;  3LDO A;  4H03 B;  1HJO A;  4IJN A;  1Q18 A;  3WUH A;  3G25 A;  3UKU B;  3CJB A;  5CE3 A;  5AQO A;  3U9Z A;  3CJ7 A;  1E4G T;  5BRD A;  3LM9 A;  5AQP A;  1XQS C;  3EL2 A;  1T6C A;  2D0P A;  2CGL A;  5AQM A;  4BQL A;  4CBX A;  2Q0U A;  1IJJ A;  2ASM A;  1GLL O;  3VEW A;  3SMS A;  4H0P A;  3SJH A;  1Z05 A;  3U4L A;  4BRG A;  5AZJ B;  5EVZ A;  1S3X A;  3I8B A;  5AZJ A;  1RDW X;  4HWI A;  5AQK A;  5E84 A;  3RSE B;  1QQN A;  3RSE A;  2E8A A;  2P9K B;  2P9S B;  1GLB G;  2P9K A;  4H0O A;  5KQD A;  3H3O B;  3WXJ A;  3JXU A;  1NGE A;  3ENH A;  3BEX A;  1QQM A;  4EHU A;  3R6M A;  3CJA A;  1QZ6 A;  3BF1 A;  4BGA A;  3HM8 A;  1ZXO A;  2W40 A;  4FWO A;  3DAW A;  2VYP A;  3H6E A;  5EXW A;  4CI6 A;  2AA4 A;  2A6A A;  5KPT A;  4PKI A;  4PL7 A;  4B1Y B;  2UYT A;  4BQZ A;  4CZJ A;  4CZF A;  5LJV A;  4FWN A;  1BDG A;  4A62 A; 
#chains in the Genus database with same CATH topology
 1HKG A;  3HOT A;  1C0T A;  4Z4F A;  3THY A;  2HBJ A;  1Z25 A;  3O8M A;  1EQY A;  4JLH A;  2D4W A;  5C2F A;  4DR7 K;  3D0P A;  3HJF A;  4CJ4 A;  2X6N A;  1NBW A;  4C8K A;  2OTJ N;  5CYQ A;  3L8B A;  4BRM A;  3GDQ A;  5I42 A;  4O5B A;  4B1V A;  2LSN A;  3MDQ A;  2OAN A;  3PO5 A;  3J7A P;  2XY8 A;  4FWL A;  1SL1 A;  4EHT A;  5GIO A;  4YOX A;  4ELV A;  4CZK A;  2P9P A;  3M1F A;  1D8Y A;  4Y1C A;  3T1Y K;  3JS6 A;  4CZG A;  3BP8 A;  4KFB A;  3ZSX A;  1NGB A;  2HMP A;  5AQI A;  2QKK A;  5CY4 A;  5FRO A;  4CFD A;  4HUG A;  4GMJ B;  1RCH A;  3U8X A;  3SUO A;  3ZX0 A;  4JK9 A;  3B6P A;  1DEJ A;  1NK0 A;  3SI6 A;  3CFR A;  2O8B A;  4LF7 K;  3ATV A;  5JMV A;  3B8A X;  2B4J A;  3LDP A;  3DXK B;  4W5Q A;  3L2U A;  2QXL A;  3KKS A;  2UXC K;  3V9S A;  4O44 A;  1S6P A;  3HRG A;  3S9H A;  3QFP A;  2JGU A;  1ZC6 A;  5EX5 A;  4AHU A;  1BG3 A;  2F7T A;  4K42 A;  2ETJ A;  1XNR K;  4GKK K;  2DFH A;  3C95 A;  3TTC A;  2C1G A;  3LZI A;  4E19 A;  2XRI A;  4IFE A;  2ZF5 O;  2E6M A;  3QEP A;  2KTQ A;  2YNI A;  3ZSO A;  1JLE A;  3MN5 A;  3CPE A;  3QEV A;  3WNG A;  4LH4 A;  1FKO A;  3GOI A;  3D6R A;  4JKG B;  3VOV A;  3SMP A;  3ZT0 A;  3RWU A;  1NGC A;  3FLC O;  4DTJ A;  4LFB K;  4A59 A;  4CF9 A;  1ZBH A;  2O8D B;  4RG8 A;  4O8U A;  1P90 A;  3NGZ A;  5AQT A;  1RBS A;  4QAG A;  5HRP A;  2IVP A;  4FJ9 A;  2O8C A;  3TR8 A;  4KO0 A;  4LY7 A;  1B9F A;  2O8E A;  1KFS A;  5I9E B;  3EN9 A;  3V9Z A;  3WEE A;  1YVU A;  3V4I A;  3MMV A;  3ZSQ A;  2KFN A;  2P9I A;  2ATQ A;  2I7P A;  4CK3 A;  1JLC A;  5KPZ A;  3BGR A;  3U9D A;  4CFA A;  4CEF A;  2FSJ A;  4X66 K;  4WQ5 A;  4DQ8 A;  1CZ9 A;  1QQC A;  3NF7 A;  3KK2 A;  4WQ5 C;  5F0X A;  5EU7 A;  1FK9 A;  4O4G A;  1KAY A;  3ZLJ A;  5GAH P;  1VQO N;  2WON A;  4DV3 K;  4KHY A;  2QM1 A;  3ZX2 A;  2HOE A;  3QIN A;  3VQ6 A;  4LFA K;  4BG8 A;  3V81 A;  3CJC A;  2XY5 A;  5BR8 K;  3I0S A;  4JI4 K;  1DTQ A;  1VRT A;  3CQY A;  2Q3S A;  1KQS M;  4KB1 A;  1X3M A;  3K5N A;  3VEV A;  2CH5 A;  3BUZ B;  1CXU A;  4M63 C;  2CGK A;  3RRG A;  1EXQ A;  5AQS A;  4CF1 A;  4FLU A;  3U3Y A;  1S1T A;  1YIT N;  4FLX A;  3AO3 A;  3S3N A;  1WSG A;  2JWK A;  4CHZ A;  2A3Z A;  1S22 A;  2OPQ A;  5M1O A;  2YJE A;  1EP4 A;  3OJU A;  4JKC A;  2GTD A;  4KHN A;  2NLX A;  1Y64 A;  3R9P A;  4DFK A;  4B1X B;  1J53 A;  3HBT A;  5AQY A;  1RT3 A;  3WXK A;  3VEO A;  5I3U A;  4WCE L;  1YT3 A;  3S41 A;  2QWR A;  3H1Q A;  1IBL K;  3CI5 A;  4OGC A;  1RTD A;  1KRP A;  5AQL A;  5GIP A;  1KC8 O;  3IKM A;  4FWQ A;  3AA3 A;  3GL1 A;  2QKB A;  2YX6 A;  5IT9 O;  3H45 C;  4PKG A;  1OKJ A;  2Z1I A;  3IFR A;  4GV9 A;  4G9Z A;  3TTD A;  3SK3 A;  5ELZ A;  4BRA A;  1NM1 A;  4U67 L;  4CD3 A;  4ZHR A;  3A2F A;  4KI4 A;  2F9W A;  4B1W B;  3J81 O;  3PY8 A;  3ZT2 A;  1NGD A;  2E2O A;  4AHS A;  3LPU A;  4GV3 A;  1XC9 A;  3OJS A;  5FLX O;  3PIO L;  3DRP A;  4OPK A;  1HKC A;  3JSM A;  4CCH A;  3KLH A;  4K8Z A;  4E7K A;  5F1X A;  3SQ0 A;  5AQJ A;  4F9O A;  1Q9X A;  1IKW A;  4F4K A;  1WAJ A;  2PY5 A;  1BQM A;  2V52 B;  3KWI A;  1YI2 N;  4YY3 K;  4LF9 K;  3D2E A;  3UKR B;  3MWT A;  3O3H A;  1C0G A;  3ULE B;  1TKD A;  2QWQ A;  4LFC K;  3O1B A;  4M45 A;  3IDH A;  4JS5 A;  3EYZ A;  1ZBU A;  1VQL N;  3P5J A;  1TYQ A;  4R79 A;  1KVB A;  3AY9 A;  2NRW A;  4FJ7 A;  3J7Z O;  4DQP A;  3OTO K;  3VF6 A;  3DXM B;  1NJY A;  3VES A;  2B6A A;  5FPE A;  1NGJ A;  4RW6 A;  1JLA A;  3VF4 A;  1A5V A;  1QSS A;  2QK9 A;  3FE1 A;  4IOA L;  1I94 K;  1RGI A;  1LV5 A;  3T3F A;  1JCE A;  4WE1 A;  4IG0 A;  3QBW A;  4B8A B;  3S3O A;  3WQT A;  1I3A A;  4DKW A;  3VQC A;  4FCY A;  1VQ7 N;  1WSI A;  4MLH A;  3IRX A;  5AQW A;  4BDZ A;  1REV A;  3VER A;  4HVJ A;  1KAX A;  3ZYY X;  4BC3 A;  1NKB A;  4B9U A;  3E1Y A;  4I2P A;  4W5N A;  3EEQ A;  2F8T A;  1Y97 A;  4DQQ A;  3THX A;  4E89 A;  4DTN A;  3T19 A;  4CK1 A;  2RN2 A;  1QTM A;  3WNE A;  3QIC A;  1Q9Y A;  4JYA K;  3H46 O;  3W0L A;  1KXP A;  4B9V A;  2XY7 A;  4FJM A;  3RMC A;  4B3R K;  3RRH A;  1XHX A;  1JLB A;  3BDP A;  1F21 A;  3K5O A;  2UXB K;  5BN8 A;  2YHX A;  3A0I X;  1JL1 A;  3LL3 A;  1X9S A;  1VSK A;  2PYL A;  3JAM O;  1X9W A;  3D2F B;  2BUP A;  4OO1 J;  4DTS A;  4KBO A;  2WC9 A;  3I55 N;  3VQB A;  1XC3 A;  4NB4 A;  2FXU A;  3C6U A;  1CXQ A;  3HZ6 A;  3SCX A;  3TAQ A;  3V9U A;  1NGI A;  4WFN L;  4B1U B;  3HXM A;  4DV2 K;  4EIA A;  4XIU A;  2RKI A;  1ILY A;  2VG5 A;  4IBN A;  4DV1 K;  1A5X A;  4H03 B;  1VSM A;  5CE3 A;  1KTQ A;  3U9Z A;  3TAR A;  5CZ2 A;  4JEP A;  3V1Q A;  1T6C A;  3VN5 A;  4CBX A;  4V19 S;  1GLL O;  3E9P A;  3AO5 A;  3KIO A;  4M3W A;  1RBV A;  3O3G A;  3NAE A;  4H0P A;  1RDA A;  4DV6 K;  1UA1 A;  1HNW K;  3CM5 A;  5AZJ B;  4JKB A;  1NK6 A;  1RT4 A;  5AQK A;  5E84 A;  3L2W A;  1UOC A;  4PWD A;  1O1W A;  4AHC A;  4HTU A;  4HCB A;  4F2R A;  3N4Q A;  3O3F A;  5KQD A;  3WXJ A;  3OYI A;  1J9A A;  1NGE A;  1Q86 O;  1N36 K;  1NOZ A;  4HUF A;  3QEW A;  4ID5 A;  5M1N A;  4B9M A;  3BF1 A;  3QNO A;  4FWO A;  4IOC L;  3SAG A;  1TKZ A;  4CHN A;  3DAW A;  2VYP A;  2A6A A;  3TWH A;  2HHX A;  1IO2 A;  4CGG A;  3KK3 A;  4K8X A;  3LAL A;  4CZF A;  4KI6 A;  2O8F A;  2G8U A;  2D0C A;  3C94 A;  1ATR A;  1HNV A;  1KCF A;  4JI6 K;  3A5O C;  4RCH A;  2JLE A;  4DV7 K;  4BWM A;  4JI5 K;  5DMR A;  4KHS A;  3SAH A;  4CEB A;  1C1C A;  2PFU A;  4RW7 A;  4FWP A;  4B9T A;  2VGM A;  3C7N B;  4DSI A;  4OLB A;  2YI1 A;  4H4O A;  3K59 A;  3NGI A;  3ISN C;  3TAN A;  4EP5 A;  3VQA A;  4FL9 A;  1HPM A;  3EE8 A;  1IG8 A;  3HST B;  4BR7 A;  4CGD A;  1V4S A;  2VG7 A;  2D0B A;  3VF2 A;  3MN9 A;  4DTM A;  4JRP A;  3MXI A;  4C8L A;  4BR2 A;  4JHD A;  2J4R A;  3VQD A;  3VTH A;  4CEZ A;  4BR9 A;  4OLA A;  3VTI A;  4M7X A;  5M1F A;  4H8K A;  4QS7 A;  5AFU A;  3OY9 A;  3ID6 A;  1K8K A;  3CC7 N;  1TKX A;  4YOT A;  5DM7 L;  3VQQ A;  1VQ8 N;  3IS9 A;  4DSE A;  2HBK A;  3AVB A;  1NMD A;  4A61 A;  2ITM A;  4X65 K;  2YHY A;  4DFJ A;  1EWR A;  5AQF A;  1Q8I A;  2FSN A;  3ATU A;  3ZET B;  4FZX C;  1JLG A;  1VQK N;  4CEE A;  2GUP A;  3NMU A;  1JL2 A;  2ZGZ A;  3G71 N;  4C23 A;  2IVN A;  4WYB A;  1WBD A;  1BIS A;  3V9X A;  1QHA A;  1T3V A;  5LY3 A;  3MAQ A;  3AAR A;  2FF6 A;  3LAM A;  3MCP A;  4ZTF A;  2HVI A;  1GLC G;  3OYL A;  3P4I A;  3ZSY A;  4YOW A;  5HRO A;  2R7Y A;  3DOL A;  3D7E O;  3NCI A;  4CJ5 A;  4WF9 L;  1T03 A;  3NE6 A;  4A2B A;  3CER A;  2RHK A;  5LL6 Z;  4FJK A;  4E72 A;  1TV6 A;  3MN7 A;  1BCO A;  1BA1 A;  3LDL A;  2W41 A;  2QWO A;  4BR5 A;  1BI4 B;  1RBR A;  4KTQ A;  1ASU A;  4CER A;  1NK8 A;  3N4P A;  4O8K A;  2Q31 A;  1VQ6 N;  2NRZ A;  4IEE A;  5TKY A;  3MXM A;  3AVL A;  4M3X A;  3A5M C;  4N47 A;  4CJK A;  1LWC A;  4DF4 A;  2VQE K;  4RW4 A;  1FW6 A;  3T69 A;  4CFB A;  3ZSR A;  3O08 A;  4FOE A;  1OVY A;  4RTF D;  3CQX A;  4CFC A;  4B9L A;  3A5L C;  5MLC Q;  4YOV A;  4NLC A;  5J2N A;  2WOM A;  1NGG A;  3UE5 A;  3CC2 N;  3M5R A;  2HHS A;  4BVO A;  3KZB A;  4CED A;  1SKS A;  2RPI A;  1MWK A;  4CF0 A;  4WFA L;  5C0Y A;  2FBV A;  3DXM A;  5AZI A;  3K9J A;  2HHV A;  1UAX A;  1HUX A;  3G10 A;  4KHW A;  5A2Q O;  4JD2 B;  2IIR A;  3AO4 A;  2Q36 A;  3THW B;  3IMX A;  3VA3 A;  3M6G A;  1FJG K;  2KLA A;  3AGK A;  4BRK A;  1XHZ A;  1LAV A;  3VGL A;  1X3N A;  3CFO A;  3LWM A;  4EAH D;  1BWF O;  3CM6 A;  5DK5 A;  3MXJ A;  1ESV A;  1KFD A;  1RDU A;  2IOC A;  2E88 A;  3L2Q A;  4DR6 K;  2HF4 A;  3NDK A;  4AHT A;  4DQR A;  3U6F A;  3EKU A;  2CGJ A;  3E66 A;  3S5T A;  1IG9 A;  1SL0 A;  1RT1 A;  2HBM A;  4F3T A;  4DV0 K;  1CZB A;  4DFP A;  4MDB A;  3OYA A;  4DLG A;  3QER A;  2WFB A;  3H3N O;  4H5V A;  3RMB A;  1U2V B;  3A8Y A;  1ATS A;  2O4I A;  1KSP A;  3K2P A;  4CJR A;  4JI0 K;  3VQ4 A;  3SJJ A;  4B08 A;  1WUA A;  3AVC A;  1BIZ A;  1GLF O;  3OYJ A;  2PAV A;  3QEI A;  5C10 A;  1B9D A;  3U3G A;  1TAU A;  2HF3 A;  3PUF A;  2I5J A;  1XMO K;  3DRS A;  4CHY A;  3LZJ A;  4E7L A;  3AO1 A;  4PHT X;  4MO4 A;  4OPA A;  4EP4 A;  1W0H A;  1M90 O;  5TKW A;  4DCH A;  4C8O A;  4CZM A;  3SAF A;  1TL1 A;  1RTI A;  3SQ4 A;  4ILJ A;  4C8M A;  3SBG A;  3TU5 A;  5J2M A;  3O1W A;  4DR3 K;  4FJ8 A;  3EZW A;  2Q0R A;  2YHB A;  2OCE A;  4OGE A;  1LW2 A;  3OS1 A;  1NK5 A;  2I7N A;  3FFK B;  4A5A A;  3OYH A;  3RMA A;  3LP1 A;  4MDA A;  2P9N B;  5AQR A;  4W5T A;  1LAW A;  5SZT A;  2NNW A;  1HMV A;  3DWL A;  4FZY A;  4PUO A;  4ISE A;  1VSE A;  1YF5 L;  1HPZ A;  4OKJ A;  1N5Y A;  4XJX A;  1GLE G;  4B9Q A;  3NF8 A;  3CQ8 A;  1NJZ A;  4C1N I;  3MEG A;  4J2A A;  2YHW A;  5JVG L;  4IO9 L;  4DWI A;  4FWR A;  4CGI A;  3HM9 A;  4CHQ A;  3EY1 A;  2HHQ A;  4IDK A;  4CHP A;  4CZE A;  3OYD A;  3NH1 A;  4JAX A;  2OZM A;  1S5J A;  1RNH A;  1X9J A;  5BN9 A;  4ID1 A;  3CCJ N;  2QI2 A;  3CIP A;  4PA1 A;  4QS9 A;  3KJV A;  3CCQ N;  4BE2 A;  1HNZ K;  3AO2 A;  5AQZ A;  4B9S A;  1TAQ A;  2NRX A;  1VQN N;  1ZYQ A;  3QNN A;  4R5P A;  2OPR A;  3Q7C A;  3GBT A;  4IFY A;  2P9U A;  2P1J A;  5FRN A;  5HL7 L;  3LAN A;  3CCE N;  1VQ5 N;  3O9R A;  1UA0 A;  3CFP A;  3VA0 A;  4KTZ A;  2Y1J A;  2FLO A;  3HTV A;  2DFE A;  1HYS A;  1QS4 A;  1Z26 A;  2P9L B;  2X6S A;  3KVG A;  2W00 A;  4DV5 K;  4FM0 A;  1WBB A;  4FPA A;  1SAZ A;  5KPR A;  4GV6 A;  3JYT A;  3ENO A;  4DSF A;  3KLI A;  1SV5 A;  4KH6 A;  1DGK N;  4FW1 A;  4NCB A;  2ZE2 A;  2HNZ A;  5HRN A;  3DLR A;  4JKH A;  1CZA N;  1NJX A;  3CYG A;  4M3U A;  4L3Q A;  4BRN A;  2WBN A;  4H5R A;  4DLE A;  4CJS A;  1SQK A;  4CJT A;  3L4Q A;  3ZEU A;  3TAP A;  1BL3 A;  1U48 A;  1RBT A;  4FO0 A;  4DSJ A;  4BRF A;  1NGF A;  3AV9 A;  1MA9 B;  1B92 A;  4N5S A;  2PYJ A;  2YCH A;  4E1J A;  4BRO A;  3AA2 A;  4E7I A;  1NLV A;  3BF3 A;  3WXL A;  4BC2 A;  4I9L A;  5CHI A;  4NXN K;  4CGJ A;  5JVH L;  3LDQ A;  5JEN A;  3O9Q A;  4XEI A;  4H5T A;  4BEB A;  1TKT A;  2E2P A;  4E1N A;  2ZJP L;  4B3M K;  2VWK A;  1U47 A;  4FVU A;  2QEX N;  5KI6 A;  1VQ9 N;  1OH6 A;  4NLB A;  3K5L A;  3LDO A;  3V1R A;  2UUB K;  4BDP A;  1Q18 A;  3G25 A;  1K73 O;  1QE1 A;  3ZT3 A;  3VQE A;  4LSL A;  3T1A A;  3ZSV A;  1HYV A;  1T7P A;  4BQL A;  2Q0U A;  1IJJ A;  1M1K O;  2ASM A;  1Z05 A;  1L3V A;  3OS2 A;  1EO1 A;  4DUZ K;  1RDW X;  4CJP A;  1NK7 A;  2YKM A;  3KLG A;  3RSE A;  2P9K B;  3AVF A;  2P9S B;  1BI4 A;  3ZT4 A;  1C6V A;  2OPS A;  4A5B A;  4CES A;  4E1M A;  4NXM K;  3MEC A;  3O9T A;  3SQ2 A;  1SKW A;  1K9M O;  2YV0 X;  1YTA A;  3O4Q A;  1DTT A;  4X62 K;  2FBT A;  3KTQ A;  1VQ4 N;  1QZ6 A;  1S1U A;  1ZXO A;  1QVG M;  4CI6 A;  5GAG P;  4F3O A;  1X9M A;  3MX5 A;  3PX6 A;  1NK4 A;  1IBK K;  1BDG A;  3CF5 L;  1FXX A;  3RR8 A;  1RT5 A;  4N76 A;  4BE7 B;  4FLY A;  5LMU K;  1N33 K;  1RIL A;  4LF5 K;  3ZT1 A;  4NO7 A;  1IKV A;  1IKX A;  4JI2 K;  2DPN A;  5HOO A;  1GLD G;  1HNI A;  4HUE A;  1C0M A;  4ZTJ A;  5M1Q A;  2FBY A;  5AQQ A;  3WNF A;  3F9K A;  2FBX A;  2A41 A;  4W5R A;  3L2V A;  1J5E K;  4DTX A;  3LP0 A;  5C12 A;  4FJG A;  4PY5 A;  3DLL L;  1J54 A;  1WAF A;  3CMA N;  2P9P B;  5EOY A;  3VQ8 A;  5T7B A;  1YXQ A;  2HB5 A;  5GIN A;  3TSU A;  1TUY A;  1E4F T;  1NJW A;  4FJN A;  4M3Z A;  1C1A A;  1R59 O;  1OH8 A;  3CHW A;  4DU3 A;  2W42 A;  4K41 A;  1S9G A;  2QWP A;  5J2Q A;  1YJ9 N;  1U2V A;  3THV A;  4DG1 A;  4LC9 B;  4O5F A;  1VQP N;  4FLW A;  1HNX K;  4CJQ A;  4CF8 A;  5C15 A;  1NKC A;  3SPZ A;  2DTU A;  4H5N A;  5AR0 A;  3OYG A;  3DXK A;  5ADX H;  4FM1 A;  1YHQ N;  1VQM N;  1BCM A;  3PSI A;  3QET A;  1VRU A;  5DM6 L;  1IH7 A;  1L5U A;  5SWM A;  3OYB A;  4W5O A;  2E20 A;  2V7Y A;  4BR0 A;  3TAE A;  5AQN A;  1KLM A;  4BRH A;  3HP6 A;  3TAG A;  4JV5 K;  3QLH A;  4JK8 A;  2PZS A;  3LPT A;  1Q82 O;  3AAQ A;  4CF2 A;  4BE0 A;  3QBX A;  4MO5 A;  1KVA A;  4FWM A;  3NHG A;  5H1S Q;  3NGY A;  1RT7 A;  2OZS A;  5J1E A;  2X74 A;  1HQE A;  2F96 A;  3O80 A;  3VQ7 A;  1D5A A;  4JKG A;  5AFU H;  2QW9 A;  1MWM A;  1XWL A;  5AQG A;  3VEX A;  1P8Z A;  2X78 A;  3CPW M;  2HHW A;  1JJ2 M;  4J2B A;  2YHA A;  4UQG A;  3J8A A;  4YNQ A;  4JS4 A;  2O8D A;  3HPO A;  4H0Y B;  1NK9 A;  4FJI A;  4HCC A;  4LD0 A;  3LM2 A;  2H3G X;  4Z4I A;  3GE1 A;  3TSQ A;  4DR1 K;  3WNH A;  4FWK A;  1GLA G;  3QDK A;  4BRQ A;  2E2Q A;  1GOC A;  4M42 A;  2D0O A;  3G0Z A;  3RVC A;  5ADX A;  1YVN A;  2F8S A;  1VSH A;  1K8A O;  3RR7 A;  4B3O A;  4GY2 B;  3O6W A;  2EX3 A;  4BRP A;  4AM7 A;  1VHX A;  3MK6 A;  1ATN A;  4IKF A;  2NZT A;  4FLT A;  1U6Z A;  4DHY A;  5C25 A;  2NRV A;  3E9O A;  4BC4 A;  4WQ4 A;  2OYQ A;  2GX9 A;  3DLB A;  3QB0 A;  2P9L A;  2F9T A;  1TUU A;  2DY4 A;  4WQ4 C;  5C24 A;  2E2N A;  3OBW A;  4BEC A;  1NJI O;  1HX1 A;  4CBU A;  3O4N A;  3SNN A;  1TVR A;  4DTU A;  3TAF A;  4L8R B;  3O5B A;  1H1V A;  4K25 A;  2D5R A;  4JI1 K;  4CK2 A;  3ID8 A;  4BE1 A;  1WOQ A;  2IS3 A;  1YAG A;  4KH4 A;  1ASV A;  4A2A A;  4CBW A;  3TI0 A;  1LCU A;  5E26 A;  4BGB A;  2KFZ A;  2NUB A;  1NKE A;  4OVL A;  1VK0 A;  3PX0 A;  3NH2 A;  5HRR A;  3EO3 A;  1Q81 O;  1BQN A;  1IKY A;  5CYM A;  3FZF A;  2Z1H A;  2ASO A;  2VCP A;  4OKE A;  5J2P A;  1QZ5 A;  3QML A;  3LP2 A;  3VEY A;  1K6Y A;  1TK5 A;  3C0B A;  4CJE A;  2V51 B;  3NBP A;  3H08 A;  1QSL A;  3CCL N;  4Y0W A;  5C2D A;  2P5O A;  5IWA K;  3QIO A;  4Z4H A;  1WSF A;  3VGK A;  2KQ2 A;  2YKN A;  3RTV A;  1NGH A;  4BRC A;  4YOR A;  4B8C A;  5BPL A;  1Q7Y O;  1L3T A;  4CJV A;  3ALY A;  2IGI A;  4ISF A;  3NH0 A;  4CIE A;  3SUQ A;  1S1V A;  2AP1 A;  1SS6 A;  2E1Z A;  2QTD A;  4BRD A;  3SPY A;  2QWM A;  1BHL A;  4FJH A;  3M8R A;  3NFA A;  2G8F A;  4B9N A;  5KGW A;  3C65 A;  3CCS N;  5FPD A;  4CZH A;  1ITG A;  2XY6 A;  1DT9 A;  1OH5 A;  4FYD A;  3VMF B;  1C1B A;  3FZL A;  4ICL A;  3D2E B;  4XH5 A;  3CJ1 A;  2FC0 A;  3SBT A;  3KLF A;  3UKR A;  5EY4 A;  3K5M A;  4HTL A;  3OVN A;  1KVC A;  4F2S A;  2ZM6 K;  5JS1 A;  4ELT A;  2P9S A;  3ULE A;  3CYM A;  1TYQ B;  4CW7 B;  1XMQ K;  4Q5V A;  1WNS A;  1S1X A;  4YOY A;  3SUP A;  1KLN A;  1QQO A;  3F2K A;  4G1Q A;  2IVO A;  1LWF A;  1ZBS A;  4Z4E A;  3QES A;  1GOA A;  5KTQ A;  1W97 L;  4FJ5 A;  5AQV A;  4YDU A;  4DTR A;  3AVI A;  4YDU C;  3HVT A;  4DU4 A;  2RE2 A;  1JXB A;  3MCA B;  3MWP A;  2VGN A;  3OA9 A;  3P31 A;  3KK1 A;  4MFB A;  4CJU A;  4FJX A;  1J6Z A;  3L3U A;  1S1W A;  4H0T B;  2BAN A;  4NYN A;  4U7B A;  4MQ3 A;  5LJW A;  4BG9 A;  1CLQ A;  2HMI A;  2KHO A;  3L0Q A;  4HHT A;  2BH1 A;  5GAD P;  4Q0B A;  1FKP A;  4OKK A;  3VQ5 A;  4OJR A;  2ZGY A;  3EZ5 A;  1BOT O;  5BR9 A;  3H1V X;  4CEA A;  4GVE A;  4BRE A;  3AVK A;  2A1S A;  2ZD1 A;  3THX B;  1SKR A;  3QO9 A;  5AJ3 K;  2A1R A;  1NMN A;  4RWT A;  3ENB A;  5M1P A;  3NVK A;  1VSI A;  3DOK A;  3HSC A;  3SV3 A;  1JKH A;  1EWQ A;  2D0A A;  4IJA A;  1L3U A;  3OHR A;  4I2Q A;  1EET A;  3PO4 A;  3FZM A;  4Z94 A;  2QWN A;  3CME N;  2KZZ A;  1WSJ A;  1RTJ A;  4RW8 A;  5BPN A;  3OS0 A;  4CZI A;  3D2F A;  3F73 A;  4AM6 A;  3V1O A;  3SLC A;  3MED A;  2FF3 B;  4AQY K;  3ZCM A;  2ZQB A;  4IOX A;  1HRH A;  4KTW A;  1C0U A;  3OYF A;  2GV9 A;  4Z0U A;  3I0R A;  4GVM A;  2E4L A;  3D45 A;  4JI3 K;  4AHR A;  3LDN A;  4FZZ A;  1A5W A;  3TAB A;  4JKD A;  3UKU B;  3CJB A;  3CJ7 A;  5BRD A;  4BDY A;  2HHU A;  3PLA A;  1XQS C;  3EL2 A;  4O0I A;  3CCM N;  3PV8 A;  2IDO A;  1S72 N;  2D0P A;  1E3M A;  5AQM A;  4AIL C;  5LMN K;  3E9L A;  1RDD A;  3M8Q A;  3VEW A;  3AVA A;  4FJJ A;  3SV4 A;  3DLG A;  3OYE A;  2QXF A;  4DMN A;  2BGG A;  3I8B A;  3P83 D;  5AZJ A;  2G8W A;  4M3T A;  1QQN A;  2E8A A;  2EHG A;  3DI6 A;  3AA5 X;  4A57 A;  1N8R O;  1RTH A;  2WTU A;  4Z4G A;  2P5G A;  3KLE A;  3ENH A;  2ITG A;  2GBZ A;  3BEX A;  1QQM A;  5FDL A;  3KD1 E;  3HPG A;  4KH5 A;  1ZBL A;  4BGA A;  3HM8 A;  3MX2 A;  4KHP K;  2W40 A;  2KW4 A;  5EXW A;  2HHI A;  4PL7 A;  3SQ1 A;  4B1Y B;  4GKJ K;  4ILG B;  5E41 A;  5LJV A;  2O8F B;  2P51 A;  4A62 A;  3AVJ A;  3WXM B;  3VPZ A;  5CZ1 A;  1QHT A;  1SUQ A;  4C1N K;  4CD1 A;  2V7Z A;  2QA4 N;  4IDH A;  2KZM A;  4FWS A;  1C0F A;  3LAK A;  2BTF A;  4PKH A;  5D3G A;  3I56 N;  2HND A;  4I6M B;  5KGX A;  1JXE A;  1NU0 A;  1D9F A;  4FW2 A;  4I7F A;  1NWK A;  1I39 A;  5KRS A;  2JWL A;  1L3S A;  3G4S N;  3C7N A;  4BC5 A;  1EKE A;  1HJR A;  2KKZ A;  3FFI A;  2UU9 K;  4DTO A;  1NGA A;  2Q97 A;  4CIF A;  4K0K K;  3K9K A;  2OPP A;  3O4W A;  4RW9 A;  1TK8 A;  1QSY A;  3ASM A;  4YFU A;  2Z1J A;  1DLO A;  2VWJ A;  2HVH A;  4CJL A;  1TL3 A;  4JHD B;  1LOT B;  3BZK A;  1VSL A;  3L6Q A;  4BRL A;  1V4T A;  2A40 A;  3FZH A;  4LF6 K;  3AGR A;  3AVG A;  1K8K B;  3HOS A;  4OPJ A;  1VSJ A;  3CC4 N;  3DMJ A;  3C6H A;  3NVM A;  1BGX T;  3FGU A;  2HHT A;  2FSK A;  1O13 A;  4JN4 A;  1MU2 A;  3C6A A;  1JCG A;  3I33 A;  4IO8 A;  3AVM A;  1YJW N;  4JKA A;  3M3Z A;  1W2B M;  3M8P A;  3ZET A;  4TSX A;  2E6L A;  2CH6 A;  4FPB A;  1BA0 A;  1JLF A;  3EKS A;  4XH1 A;  4DSL A;  5C42 A;  3CCR N;  1EX4 A;  3WT0 A;  4CIG A;  3C6T A;  2NRR A;  4DUY K;  1WSH A;  4BR4 A;  5FPN A;  3T1H K;  3HPH A;  1YUW A;  4ELU A;  2GEM A;  1NG9 A;  5HBM A;  4BRI A;  2HST A;  1HLU A;  2IAJ A;  3MN6 A;  5JLF A;  2IC3 A;  1RBU A;  4PL8 A;  3L3V A;  4KPY A;  4LSN A;  4J8F A;  4CJF A;  3VEZ A;  3QIP A;  1YTU A;  2G8H A;  3DLH A;  3LP3 A;  4M7Y A;  1J5O A;  1ASW A;  4KB0 A;  1DKG D;  3QFU A;  3VEN A;  1RT2 A;  1OH7 A;  1N34 K;  2NRT A;  3DLE A;  3VQ9 A;  2Q1N A;  3CJ9 A;  3UIQ A;  3DLK A;  4M41 A;  5HP1 A;  3IG1 A;  4DFM A;  3KWG A;  3CET A;  3BY5 A;  2XO7 A;  3OW2 M;  4OPH A;  2ZJR L;  2YNH A;  2GUI A;  5K14 A;  3G6E N;  3DRR A;  5JS2 A;  3ZX3 A;  4FLZ A;  2A5X A;  1WSE A;  1KD1 O;  2PBD A;  1S9E A;  3DM2 A;  4JKE A;  3GG4 A;  2XHB A;  4O55 A;  2HBL A;  4EFH A;  4BVP A;  1Z6R A;  1W7A A;  3PSF A;  4DR5 K;  4JK7 A;  1HQU A;  1XNQ K;  4BY9 C;  4KAZ A;  5BRE A;  4DR2 K;  5M1K A;  2B5J A;  2UXD K;  3THY B;  2E5L K;  1YJN N;  2RF2 A;  3AVH A;  5FRM A;  2E1Y A;  4IFV A;  1D4X A;  5AZI B;  3J80 O;  4DQI A;  4H0X B;  2G8K A;  3OYM A;  3AVN A;  3UB5 A;  3LWL A;  4JD2 A;  4B1Z A;  4LF8 K;  5AQX A;  4AF1 A;  1TK0 A;  3THW A;  4KHQ A;  4CE9 A;  5HLF A;  1NNE A;  2YJF A;  3LDS A;  4ISG A;  4DTP A;  1WB9 A;  4NCG A;  4CJ7 A;  2YNG A;  3TPQ A;  1T05 A;  4FLV A;  1W9H A;  4KHU A;  2AJQ A;  4IEI A;  4IXC A;  4FK4 A;  3HK2 A;  4CGF A;  3HYF A;  4CJ3 A;  2W6L A;  4DU1 A;  2UUA K;  3W3D A;  3OYN A;  4PQU A;  4CJW A;  4YOU A;  4JNE A;  4WFB L;  4FSV A;  3F5T A;  3J7Y P;  2C1I A;  3O9S A;  4J2E A;  4DQS A;  5JIC A;  1X1P A;  1SZ2 A;  1IBM K;  3K57 A;  3KKR A;  1GLJ O;  3NF6 A;  3VET A;  2O8B B;  3VQP A;  4F8R A;  4DV4 K;  5F2R A;  3SUN A;  2Y1I A;  2F4V K;  1GOB A;  4FOI A;  1BU6 O;  4DS5 A;  3F9M A;  1N32 K;  5AQU A;  5B8H A;  4E7J A;  3HP9 A;  3S3M A;  3EE9 A;  4H5W A;  3NF9 A;  4Y1D A;  3HT3 A;  1HR0 K;  4H0V B;  4X64 K;  1XUP O;  3O9U A;  1NOY A;  4GW6 A;  3R8E A;  2Z1G A;  3HVR A;  4IG3 A;  2OA8 A;  2P9N A;  4YHH K;  2BDP A;  3AAP A;  2OTL N;  1QVF M;  4CEO A;  1BO5 O;  5BRH A;  3UKU A;  2ZWH A;  1VSD A;  2ASP A;  2GWK A;  3AA4 A;  4B3S K;  3DYA A;  3IUC A;  5AQH A;  4FM2 A;  2VG6 A;  4DR4 K;  3P39 A;  1G99 A;  4DF8 A;  2EWS A;  4CEC A;  2O8C B;  4FK2 A;  3OYC A;  2O8E B;  2QWL A;  5BRF A;  3WEE B;  4BAC A;  1OVQ A;  2P9I B;  2WUS A;  2W6K A;  3P38 A;  3ULD A;  1RDC A;  3KK7 A;  3T7Z A;  1WN7 A;  1TGO A;  3HI0 A;  1BUP A;  4CEQ A;  4FK0 A;  1T44 A;  2P9U B;  4GNI A;  4IWV A;  1R0A A;  3TAM A;  3WQU A;  4JI8 K;  4MLE A;  3I8D A;  1XI1 A;  3CD6 N;  3QEX A;  1MDU B;  3DJC A;  3OBY A;  1HKB A;  4AH9 A;  1S6Q A;  4OX9 K;  3CCV N;  3FR0 A;  3OYK A;  1IV0 A;  4CVN E;  2VWB A;  3PX4 A;  4DS4 A;  4I6M A;  5JLH A;  2D1K A;  4QCL A;  3IAY A;  1ZBI A;  3KHY A;  3VGM A;  1G15 A;  3CXC M;  3CG7 A;  3R3L A;  2GWJ A;  2Q2R A;  4QS8 A;  1N6Q A;  2NRH A;  3TSP A;  4XH4 A;  3WXI A;  3ZEU B;  3KD5 E;  4JI7 K;  4ILH A;  5FPM A;  4KRE A;  5KQ8 A;  4CHO A;  5HRS A;  4KKO A;  3TTF A;  3L4I A;  4UY8 O;  4H4M A;  4CZL A;  5BPM A;  1KAZ A;  1U45 A;  3ZSZ A;  2GEL A;  3PIP L;  3R1X A;  3ZSW A;  4E7H A;  2HNY A;  4DSK A;  4K43 A;  4AHV A;  1RFQ A;  4NCA A;  4FXD A;  4EZ9 A;  3E01 A;  2UUC K;  4LH5 A;  3M8S A;  1HYZ A;  1VAZ A;  3FZK A;  1T6D A;  4C8N A;  1U04 A;  4N56 A;  4DB3 A;  4B3T K;  3P1G A;  4CGH A;  2A42 A;  3A5N C;  4NYF A;  4IZ9 A;  2YNF A;  1LW0 A;  1JCF A;  2ZJQ L;  4IJN A;  1HJO A;  3V6D A;  4O0J A;  3WUH A;  1BIU A;  5AQO A;  2O4G A;  3HL8 A;  1E4G T;  2G8I A;  3LM9 A;  3BZC A;  3K58 A;  5AQP A;  3V9W A;  3B6O A;  1ZBF A;  2CGL A;  2DFF A;  1SL2 A;  1VSF A;  4BWJ A;  1U49 A;  3K0S A;  4LF4 K;  4J2D A;  3SMS A;  3SJH A;  3U4L A;  4M3R A;  4BRG A;  3SZ2 A;  4FVM A;  3Q7B A;  5EVZ A;  1S3X A;  2HHH K;  4KRF A;  4HWI A;  1U4B A;  1LWE A;  3RSE B;  1RT6 A;  3L2R A;  3HO1 A;  3CCU N;  5GAE P;  5KRT A;  4I9Q A;  3RMD A;  4JRQ A;  1GLB G;  2P9K A;  4H0O A;  1YIJ N;  2BE2 A;  3H3O B;  4N41 A;  1RDB A;  3JXU A;  4E3S A;  1T8E A;  3MEE A;  1D9D A;  4KV8 A;  4E0D A;  1UWB A;  5CR4 A;  3ITH A;  4EHU A;  3R6M A;  2G8V A;  3CJA A;  3SYZ A;  4Z4C A;  4FJL A;  3H6E A;  2VQF K;  2AA4 A;  4EZ6 A;  4JKF A;  5KPT A;  4PKI A;  1JLQ A;  4BQZ A;  2UYT A;  1WLJ A;  4QOZ B;  4CZJ A;  4FWN A;  2HW3 A;  4M3Y A; 
#chains in the Genus database with same CATH homology
 1HKG A;  3WXM B;  3VPZ A;  3HOT A;  3CF5 L;  4C1N K;  1ATR A;  4CD1 A;  2HBJ A;  2V7Z A;  2QA4 N;  4IDH A;  4BE7 B;  4FWS A;  1C0F A;  1EQY A;  2BTF A;  3O8M A;  4PKH A;  3A5O C;  4I6M B;  3I56 N;  2D4W A;  5C2F A;  4RCH A;  4NO7 A;  2DPN A;  1NBW A;  3SAH A;  5HOO A;  1GLD G;  1NWK A;  2OTJ N;  2PFU A;  5M1Q A;  5AQQ A;  4FWP A;  2VGM A;  3C7N B;  2JWL A;  4BRM A;  3G4S N;  3C7N A;  3GDQ A;  2YI1 A;  4BC5 A;  2A41 A;  4B1V A;  2KKZ A;  3MDQ A;  2OAN A;  1NGA A;  2Q97 A;  4FL9 A;  3K9K A;  3O4W A;  5C12 A;  1HPM A;  3EE8 A;  1IG8 A;  4FWL A;  4BR7 A;  4EHT A;  1V4S A;  3DLL L;  3VF2 A;  3CMA N;  5GIO A;  2P9P B;  4YOX A;  3MN9 A;  5EOY A;  4CZK A;  2P9P A;  3M1F A;  4JHD B;  1LOT B;  4BR2 A;  1YXQ A;  4JHD A;  3L6Q A;  2J4R A;  3VTH A;  5GIN A;  3JS6 A;  4BRL A;  1V4T A;  2A40 A;  3FZH A;  1TUY A;  3TSU A;  1E4F T;  3BP8 A;  4M7X A;  3VTI A;  4BR9 A;  5M1F A;  3AGR A;  1NGB A;  1K8K B;  2HMP A;  5AQI A;  4QS7 A;  5AFU A;  3HOS A;  3CC7 N;  1R59 O;  1K8K A;  3ID6 A;  3CC4 N;  4YOT A;  3C6H A;  3CHW A;  3NVM A;  5DM7 L;  4K41 A;  3FGU A;  1VQ8 N;  2FSK A;  2QWP A;  1O13 A;  3U8X A;  3ZX0 A;  2HBK A;  4JN4 A;  1NMD A;  1U2V A;  3C6A A;  1JCG A;  3I33 A;  4IO8 A;  4JK9 A;  2ITM A;  2YHY A;  4A61 A;  1DEJ A;  4LC9 B;  4O5F A;  1VQP N;  5AQF A;  3ATU A;  2FSN A;  3ATV A;  5C15 A;  3B8A X;  3ZET B;  5JMV A;  4JKA A;  3M3Z A;  1YJW N;  1W2B M;  3LDP A;  1VQK N;  3ZET A;  2GUP A;  3DXK B;  4H5N A;  5AR0 A;  3NMU A;  2ZGZ A;  2CH6 A;  4FPB A;  3DXK A;  2QXL A;  4C23 A;  5ADX H;  1BA0 A;  3EKS A;  4XH1 A;  3G71 N;  1YHQ N;  2IVN A;  1VQM N;  4WYB A;  3CCR N;  5DM6 L;  3WT0 A;  2NRR A;  1QHA A;  1T3V A;  4BR4 A;  5FPN A;  5LY3 A;  3AAR A;  1YUW A;  2FF6 A;  3HRG A;  2E20 A;  2GEM A;  2V7Y A;  3QFP A;  4BR0 A;  3MCP A;  5AQN A;  4BRI A;  1ZC6 A;  2HST A;  5EX5 A;  1GLC G;  1HLU A;  1BG3 A;  2F7T A;  4K42 A;  3P4I A;  4BRH A;  3MN6 A;  5JLF A;  4YOW A;  4PL8 A;  3TTC A;  2C1G A;  4JK8 A;  3D7E O;  4J8F A;  1Q82 O;  4IFE A;  3AAQ A;  2ZF5 O;  4WF9 L;  3VEZ A;  4A2B A;  3CER A;  4M7Y A;  3MN5 A;  3QBX A;  4MO5 A;  2RHK A;  3CPE A;  1DKG D;  4FWM A;  5H1S Q;  3QFU A;  3VEN A;  3MN7 A;  3GOI A;  1BA1 A;  3LDL A;  2W41 A;  3D6R A;  2QWO A;  2NRT A;  3O80 A;  4JKG B;  4BR5 A;  3VOV A;  2Q1N A;  3CJ9 A;  4JKG A;  5AFU H;  3SMP A;  2QW9 A;  1MWM A;  3N4P A;  5AQG A;  4O8K A;  1P8Z A;  3VEX A;  3CPW M;  2Q31 A;  1JJ2 M;  1NGC A;  3FLC O;  1VQ6 N;  3KWG A;  2NRZ A;  3CET A;  4IEE A;  5TKY A;  4A59 A;  3J8A A;  4O8U A;  1P90 A;  4OPH A;  5AQT A;  2ZJR L;  3OW2 M;  2IVP A;  3A5M C;  4H0Y B;  3G6E N;  3ZX3 A;  2A5X A;  3LM2 A;  2H3G X;  3T69 A;  5I9E B;  1KD1 O;  3EN9 A;  2PBD A;  3O08 A;  3WEE A;  4JKE A;  4FOE A;  3GG4 A;  1OVY A;  3GE1 A;  3MMV A;  4RTF D;  3TSQ A;  3CQX A;  2HBL A;  2P9I A;  1GLA G;  4FWK A;  2I7P A;  3QDK A;  4BVP A;  1Z6R A;  3A5L C;  4BRQ A;  5KPZ A;  5MLC Q;  4YOV A;  2E2Q A;  4NLC A;  4JK7 A;  3U9D A;  2D0O A;  4BY9 C;  1NGG A;  2FSJ A;  3UE5 A;  4WQ5 A;  5BRE A;  3RVC A;  3M5R A;  3CC2 N;  4DQ8 A;  5M1K A;  5ADX A;  4BVO A;  3KZB A;  1YVN A;  4WQ5 C;  1YJN N;  5F0X A;  1K8A O;  4GY2 B;  1MWK A;  1KAY A;  3O6W A;  2E1Y A;  5AZI B;  1D4X A;  3DXM A;  4WFA L;  5C0Y A;  5AZI A;  4H0X B;  5GAH P;  3K9J A;  1HUX A;  4BRP A;  1VQO N;  2QM1 A;  3ZX2 A;  2HOE A;  4JD2 B;  3MK6 A;  2IIR A;  3UB5 A;  4AM7 A;  1ATN A;  4BG8 A;  4JD2 A;  4B1Z A;  3CJC A;  2Q36 A;  5AQX A;  4AF1 A;  2NZT A;  3IMX A;  1U6Z A;  4DHY A;  3M6G A;  2NRV A;  3E9O A;  3CQY A;  4BC4 A;  4WQ4 A;  2KLA A;  3AGK A;  2GX9 A;  4BRK A;  2YJF A;  3QB0 A;  4ISG A;  1KQS M;  2P9L A;  2F9T A;  1TUU A;  3VGL A;  4CJ7 A;  4WQ4 C;  3TPQ A;  1X3N A;  1X3M A;  2E2N A;  3OBW A;  1BWF O;  4EAH D;  1NJI O;  3VEV A;  4BEC A;  2CH5 A;  4IEI A;  4IXC A;  1HX1 A;  3BUZ B;  4CBU A;  1ESV A;  1RDU A;  4M63 C;  2E88 A;  2CGK A;  2HF4 A;  3O5B A;  1H1V A;  4K25 A;  5AQS A;  3EKU A;  2CGJ A;  3E66 A;  3W3D A;  3ID8 A;  1YIT N;  1WOQ A;  2HBM A;  4YOU A;  4JNE A;  2JWK A;  2A3Z A;  1S22 A;  1YAG A;  2YJE A;  3F5T A;  4FSV A;  4KH4 A;  5M1O A;  4A2A A;  4WFB L;  4MDB A;  4CBW A;  2C1I A;  4JKC A;  3O9S A;  2GTD A;  5JIC A;  1LCU A;  2NLX A;  5E26 A;  1SZ2 A;  2WFB A;  4BGB A;  1Y64 A;  3R9P A;  3H3N O;  4H5V A;  1U2V B;  4B1X B;  3A8Y A;  3HBT A;  1ATS A;  1GLJ O;  3VET A;  3EO3 A;  5AQY A;  1Q81 O;  3FZF A;  3WXK A;  1WUA A;  1GLF O;  2ASO A;  2VCP A;  2PAV A;  5F2R A;  3VEO A;  5GIP A;  5C10 A;  4WCE L;  1QZ5 A;  3QML A;  4FOI A;  1BU6 O;  3S41 A;  3VEY A;  2HF3 A;  2QWR A;  3H1Q A;  3F9M A;  3C0B A;  5AQU A;  5B8H A;  2V51 B;  3CI5 A;  4PHT X;  3EE9 A;  3CCL N;  4Y0W A;  4MO4 A;  4H5W A;  4OPA A;  5AQL A;  3IKM A;  5C2D A;  5TKW A;  4DCH A;  4FWQ A;  4CZM A;  3SAF A;  1M90 O;  3GL1 A;  4ILJ A;  3TU5 A;  3SBG A;  2YX6 A;  3O1W A;  3H45 C;  3VGK A;  3EZW A;  1OKJ A;  3IFR A;  4PKG A;  2Q0R A;  4H0V B;  4GV9 A;  1NGH A;  3TTD A;  4G9Z A;  4BRC A;  1XUP O;  3O9U A;  4YOR A;  3SK3 A;  2I7N A;  3FFK B;  5ELZ A;  3R8E A;  4BRA A;  4A5A A;  4MDA A;  5BPL A;  2P9N B;  1NM1 A;  1Q7Y O;  4U67 L;  5AQR A;  4CD3 A;  2P9N A;  3AAP A;  2OTL N;  1QVF M;  2NNW A;  2F9W A;  1BO5 O;  4B1W B;  4ISF A;  1NGD A;  2AP1 A;  2E2O A;  3DWL A;  1SS6 A;  2E1Z A;  2QTD A;  4GV3 A;  4BRD A;  5BRH A;  3UKU A;  2ZWH A;  2QWM A;  4ISE A;  1YF5 L;  3PIO L;  2ASP A;  1HKC A;  2GWK A;  4XJX A;  1GLE G;  4B9Q A;  3IUC A;  5AQH A;  4C1N I;  5F1X A;  5AQJ A;  3P39 A;  4F9O A;  1G99 A;  3C65 A;  2YHW A;  5JVG L;  4IO9 L;  2EWS A;  1KC8 O;  3CCS N;  5FPD A;  4FWR A;  4CZH A;  1DT9 A;  2V52 B;  3VMF B;  3KWI A;  2QWL A;  3FZL A;  1YI2 N;  5BRF A;  3D2E B;  4XH5 A;  3WEE B;  4CZE A;  3CJ1 A;  3D2E A;  3UKR B;  4JAX A;  3SBT A;  3MWT A;  2P9I B;  3UKR A;  5EY4 A;  4HTL A;  1C0G A;  2WUS A;  3ULE B;  1X9J A;  5BN9 A;  3CCJ N;  2P9S A;  3P38 A;  2QWQ A;  3ULE A;  2QI2 A;  3CIP A;  3O1B A;  4QS9 A;  3CCQ N;  3IDH A;  1TYQ B;  3KK7 A;  1VQL N;  5AQZ A;  1TYQ A;  3T7Z A;  4R79 A;  3AY9 A;  2NRW A;  4YOY A;  3J7Z O;  2NRX A;  3HI0 A;  1BUP A;  1QQO A;  1VQN N;  3F2K A;  2IVO A;  3VF6 A;  1ZBS A;  3Q7C A;  1T44 A;  2P9U B;  3GBT A;  4GNI A;  3DXM B;  4IWV A;  1W97 L;  2P9U A;  5AQV A;  4YDU A;  3VES A;  3WQU A;  4MLE A;  5HL7 L;  3CCE N;  5FPE A;  1VQ5 N;  1NGJ A;  3O9R A;  3VF4 A;  4YDU C;  3CD6 N;  2RE2 A;  3MCA B;  3MWP A;  1MDU B;  2FLO A;  3HTV A;  2VGN A;  3DJC A;  3OA9 A;  3P31 A;  3FE1 A;  3OBY A;  1HKB A;  4IOA L;  2P9L B;  3KVG A;  2W00 A;  1RGI A;  1JCE A;  3CCV N;  1J6Z A;  3FR0 A;  4H0T B;  4FPA A;  1SAZ A;  5KPR A;  4GV6 A;  3QBW A;  4U7B A;  2VWB A;  4BG9 A;  5LJW A;  4I6M A;  3WQT A;  3ENO A;  2KHO A;  3L0Q A;  5JLH A;  2D1K A;  2BH1 A;  4DKW A;  5GAD P;  4KH6 A;  1DGK N;  1VQ7 N;  4MLH A;  3KHY A;  5AQW A;  4EFH A;  3VGM A;  3VER A;  2ZGY A;  1KAX A;  3ZYY X;  4BC3 A;  3CXC M;  4JKH A;  1BOT O;  1CZA N;  3H1V X;  3R3L A;  2GWJ A;  4GVE A;  4BRE A;  5BR9 A;  4L3Q A;  2Q2R A;  3E1Y A;  4BRN A;  4QS8 A;  2NRH A;  2WBN A;  4H5R A;  3TSP A;  1SQK A;  4XH4 A;  3WXI A;  3ZEU B;  3L4Q A;  4ILH A;  5FPM A;  3ZEU A;  5KQ8 A;  3QIC A;  4RWT A;  4FO0 A;  3ENB A;  3H46 O;  5M1P A;  3NVK A;  3W0L A;  1KXP A;  3TTF A;  4BRF A;  3L4I A;  4UY8 O;  1NGF A;  4CZL A;  5BPM A;  1KAZ A;  1MA9 B;  3HSC A;  2GEL A;  3PIP L;  4IJA A;  3R1X A;  3OHR A;  2YCH A;  4E1J A;  4BRO A;  3FZM A;  5BN8 A;  4Z94 A;  1NLV A;  2YHX A;  3A0I X;  2QWN A;  3BF3 A;  3LL3 A;  4K43 A;  3WXL A;  4BC2 A;  3CME N;  1RFQ A;  5BPN A;  3D2F B;  5CHI A;  4CZI A;  2BUP A;  3D2F A;  4OO1 J;  4KBO A;  4AM6 A;  5JVH L;  1VAZ A;  2WC9 A;  3LDQ A;  3FZK A;  3SLC A;  1T6D A;  3I55 N;  2FF3 B;  1XC3 A;  3O9Q A;  4XEI A;  4NB4 A;  2FXU A;  4H5T A;  4BEB A;  3HZ6 A;  4IOX A;  2E2P A;  1NGI A;  4CZG A;  4DB3 A;  4WFN L;  2ZJP L;  4FVU A;  4B1U B;  2QEX N;  2A42 A;  3A5N C;  4EIA A;  1VQ9 N;  4IZ9 A;  1ILY A;  4NLB A;  1JCF A;  3LDN A;  3LDO A;  2ZJQ L;  4H03 B;  1HJO A;  4IJN A;  1Q18 A;  3WUH A;  3G25 A;  4JKD A;  3UKU B;  3CJB A;  5CE3 A;  5AQO A;  1K73 O;  3U9Z A;  3CJ7 A;  1E4G T;  5BRD A;  3LM9 A;  4JEP A;  3PLA A;  5AQP A;  1XQS C;  3EL2 A;  3CCM N;  1S72 N;  1T6C A;  2D0P A;  2CGL A;  5AQM A;  4BQL A;  4CBX A;  2Q0U A;  1IJJ A;  1M1K O;  2ASM A;  1GLL O;  3E9L A;  3E9P A;  3VEW A;  3SMS A;  4H0P A;  3SJH A;  1Z05 A;  3U4L A;  4BRG A;  1EO1 A;  5AZJ B;  3Q7B A;  4JKB A;  5EVZ A;  1S3X A;  3I8B A;  5AZJ A;  1RDW X;  4HWI A;  5AQK A;  5E84 A;  3RSE B;  3CCU N;  1QQN A;  3RSE A;  2E8A A;  5GAE P;  2P9K B;  2P9S B;  1GLB G;  2P9K A;  4H0O A;  1YIJ N;  3N4Q A;  1YJ9 N;  4A57 A;  5KQD A;  1N8R O;  3H3O B;  4A5B A;  3WXJ A;  3JXU A;  3O9T A;  1NGE A;  1Q86 O;  3ENH A;  1K9M O;  3BEX A;  5CR4 A;  1QQM A;  4EHU A;  5M1N A;  3R6M A;  1VQ4 N;  3CJA A;  4KH5 A;  1QZ6 A;  3BF1 A;  4BGA A;  3HM8 A;  3MX2 A;  1ZXO A;  2W40 A;  4FWO A;  4IOC L;  3SAG A;  3DAW A;  2VYP A;  3H6E A;  5EXW A;  4CI6 A;  1QVG M;  2AA4 A;  2A6A A;  4JKF A;  5KPT A;  4PKI A;  4PL7 A;  5GAG P;  4B1Y B;  2UYT A;  4BQZ A;  4ILG B;  4CZJ A;  3MX5 A;  4CZF A;  5LJV A;  4FWN A;  1BDG A;  4A62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...