4CBWA

Crystal structure of plasmodium berghei actin i with d-loop from muscle actin
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
372
structure length
367
Chain Sequence
EVQALVIDNGSGNVKAGVAGDDAPRSVFPSIVGRPRHGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRAAPEEHPVLLTEAPLNPKGNRERMTQIMFESFNVPAMYVAIQAVLSLYSSGRTTGIVLDSGDGVSHTVPIYEGYALPHAIMRLDLAGRDLTEYLMKILHERGYGFSTSAEKEIVRDIKEKLCYIALNFDEEMKTSEQSSDIEKSYELPDGNIITVGNERFRCPEALFQPSFLGKEAAGIHTTTFNSIKKCDVDIRKDLYGNIVLSGGTTMYEGIGERLTRDITTLAPSTMKIKVVAPPERKYSVWIGGSILSSLSTFQQMWITKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Motor protein
molecule keywords ACTIN, ALPHA SKELETAL MUSCLE, ACTIN
publication title Structural Differences Explain Diverse Functions of Plasmodium Actins.
pubmed doi rcsb
source organism Plasmodium berghei
total genus 108
structure length 367
sequence length 372
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4cbwA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4cbwA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4cbwA03
4WQ5C 4EFHA 4H0VB 2D1KA 4J8FA 4FPAA 3CIPA 2YI1A 3BEXA 2VYPA 1LOTB 4Y0WA 5KPRA 2Q2RA 4IO8A 3D2EB 3CJ9A 4QS8A 3JXUA 2P9LA 1NGBA 3CJBA 1U2VB 1GLJO 5AQRA 3AARA 2I7NA 5BREA 4A62A 5AQKA 3WXKA 3VF2A 1C0FA 4L3QA 2VCPA 1SZ2A 3VEXA 3VF4A 4BGBA 3DXMA 4I6MA 3DXKA 3FLCO 4AM6A 5KPZA 5ADXH 3GOIA 4B1ZA 3D2FB 5AQXA 1BWFO 4FWLA 1J6ZA 3O8MA 2GUPA 3CJ1A 4FWPA 2FSJA 3TPQA 2P9NB 3SLCA 1MA9B 4WQ4C 3MN7A 1U6ZA 2P9IA 2NLXA 2FSKA 3FZMA 3QBWA 5BRDA 3EZWA 3RSEA 4FOIA 2P9KB 3CHWA 4MO5A 1ATRA 3HBTA 4H0PA 2VWBA 4HTLA 2ZGYA 5LY3A 2FSNA 3O6WA 3GE1A 3A5NC 4FWKA 4NB4A 1T6DA 1X3MA 3CERA 4FPBA 1GLCG 3AAPA 2QWMA 5AR0A 4CZMA 4ISGA 3A8YA 1IG8A 2D4WA 4B1VA 2V7ZA 3VPZA 3U4LA 3D2EA 3VOVA 5F1XA 2QWQA 2GEMA 3UKRA 3H46O 5EX5A 1OKJA 2P9PB 1KAYA 1LCUA 1U2VA 2NRHA 4WYBA 1TUYA 4B1XB 3FFKB 5AQLA 3J8AA 4CZLA 4H0OA 2HF3A 4BRKA 2E2OA 3LDOA 4H0TB 4H5NA 3D2FA 4FWMA 1KXPA 3GL1A 3BF3A 3C0BA 3D7EO 4H5TA 1X9JA 1NWKA 4E1JA 1NGJA 2P9LB 1NGIA 1SQKA 2IVOA 3ATUA 3HSCA 3QMLA 3ID8A 2A40A 3H3OB 3EL2A 3O1WA 2W40A 3OHRA 3L0QA 4H03B 4BC5A 4DB3A 3JS6A 1E4GT 3WEEA 1BO5O 3AY9A 3DXMB 3DXKB 3WQUA 5AQFA 3VESA 1GLBG 1XQSC 4FWRA 1BU6O 1NGAA 3AAQA 1GLDG 4XH1A 5AQPA 5AQYA 4CZIA 3M1FA 4XEIA 5KQ8A 5AQOA 4BRQA 2E8AA 2YHYA 3LDPA 3RSEB 3DJCA 3GDQA 2A6AA 3CJCA 2E2PA 4YDUC 3IDHA 4EHTA 5FPEA 2P9PA 2QXLA 4BG8A 3EKSA 3LDNA 3F9MA 1V4TA 5AQGA 1T44A 3MDQA 4C23A 3SK3A 3TU5A 3I8BA 1GLEG 3QFPA 4BRGA 1RGIA 2ASMA 3LL3A 5AQHA 3LM2A 4CD1A 3VF6A 2KHOA 5KQDA 5BRHA 2P9SB 4BR7A 1JCGA 4A2BA 5LJWA 4PKIA 4WQ5A 4EHUA 3UKRB 4CD3A 3VGKA 1QQOA 4BRCA 4A61A 5AQTA 4MLHA 1YVNA 3VGLA 1H1VA 4K25A 5FPDA 4H5WA 4BR4A 1YUWA 3QB0A 1BUPA 3SMPA 4CJ7A 3MN6A 1Q18A 4DQ8A 4IZ9A 3ATVA 4BRMA 1XUPO 3WT0A 2ASPA 1BA1A 1YXQA 1HKGA 3O80A 4FWQA 3C7NA 1P8ZA 1WOQA 2CH6A 5AFUH 2E88A 2FF3B 2Q97A 3WQTA 1GLLO 1HJOA 1ESVA 2E1ZA 1JCEA 5ADXA 3WXJA 3R6MA 3SMSA 1WUAA 4WQ4A 2HMPA 2ASOA 1MWMA 5FPMA 4F9OA 3M6GA 1NGFA 3WEEB 5AQVA 4IXCA 5KPTA 3U8XA 2BUPA 5JMVA 3QDKA 2QWLA 2E2NA 2QWPA 3H1VX 3SJHA 3MMVA 4BRHA 5E84A 4GY2B 5BN8A 2P9SA 4FSVA 3VEWA 5BPNA 2FXUA 5E26A 3FZHA 4CBWA 3VETA 3ENHA 3H3NO 5AZIA 1NMDA 4O5FA 1SAZA 5JLHA 2YCHA 3L6QA 3A5OC 4BG9A 2CH5A 1IJJA 4PKGA 1S22A 3KHYA 4BRDA 4CZGA 1ATNA 4H5VA 2D0PA 3HI0A 3UKUA 4BC4A 4JNEA 1DKGD 2F9WA 4XH4A 4BRIA 3DAWA 1ZXOA 1HKBA 4CZEA 4FL9A 3ZX3A 4K43A 3GG4A 4CZFA 1HLUA 1NBWA 3R9PA 3WXIA 3ZETA 4CZKA 1ZC6A 2A5XA 2FF6A 3U9ZA 1ATSA 1D4XA 4MLEA 4RWTA 3VERA 1DGKN 3A0IX 1X3NA 4BQZA 2Q36A 4PL8A 1RFQA 4IJAA 3FGUA 3QBXA 3BUZB 2PAVA 4EIAA 1HUXA 1HX1A 3VEZA 3IUCA 5B8HA 4IWVA 1HKCA 5AZJA 4CBUA 3C7NB 1NM1A 4RCHA 3ENOA 4ISFA 5LJVA 5AQIA 4MO4A 5FPNA 1XC3A 3MN5A 2GELA 3WXLA 2V51B 3VEVA 3BF1A 2Q31A 2NZTA 1KAXA 3GBTA 1QZ5A 1BDGA 3B8AX 2FLOA 3G25A 2IVNA 4JN4A 5EXWA 5F0XA 2CGJA 4B1UB 1DEJA 1NGGA 3MK6A 1NLVA 2E2QA 4NO7A 5BRFA 1NGCA 2YHXA 5BPLA 4GNIA 5AQNA 1CZAN 5AZIB 3ULEA 1MWKA 1TUUA 2ZWHA 3EKUA 3L4IA 3VEOA 2V7YA 2H3GX 4HWIA 4BRAA 4B1WB 1K8KA 4QS7A 4CZJA 3A5LC 5I9EB 4M7YA 3UKUB 2P9UA 4B9QA 3FZLA 3ZEUB 3O4WA 4M63C 4BC3A 1BOTO 5AQSA 3O5BA 4FWSA 4BC2A 4B1YB 4BGAA 4AM7A 4DCHA 4BR9A 1G99A 3ZETB 3MN9A 1QZ6A 3O1BA 3EO3A 4KBOA 1ZBSA 2OANA 3HM8A 3UE5A 3VEYA 3O08A 5AQZA 2GTDA 1R59O 4H0YB 2E1YA 4FOEA 5AFUA 2QWOA 1MDUB 4PL7A 3LM9A 2A41A 2QWNA 2YJEA 1TYQB 1T6CA 4BR2A 4FO0A 1BG3A 1HPMA 5AZJB 5ELZA 2WUSA 2BTFA 4K41A 3KZBA 4JHDA 2GWKA 3FZKA 1Z6RA 1GLAG 2J4RA 4FWNA 1YAGA 3CI5A 5EVZA 4BROA 2I7PA 3DWLA 4CI6A 5BR9A 5F2RA 3QFUA 1BA0A 2A3ZA 4M7XA 3S41A 3A5MC 4QS9A 1C0GA 4RTFD 3VGMA 2QWRA 2Q0RA 3R8EA 1QQNA 1RDWX 3H45C 3ZX2A 4BRNA 5JLFA 4BRLA 3I33A 3ZEUA 4FWOA 5AQUA 4BVPA 4BREA 2CGLA 2GWJA 3FZFA 3CETA 2YJFA 3HZ6A 3LDQA 3CQYA 2ZF5O 4H0XB 5JICA 5BPMA 4BR5A 3ULEB 4H5RA 1NGHA 1S3XA 5AQQA 1NGEA 2D0OA 2Q0UA 4EAHD 1JCFA 5EY4A 2PBDA 4JD2B 3BP8A 1K8KB 2IVPA 4LC9B 4BQLA 2HF4A 3KVGA 3HTVA 3ZX0A 4Z94A 3UB5A 2P9UB 4BVOA 1Z05A 3QICA 3H6EA 1KAZA 5TKYA 2A42A 2UYTA 3FR0A 1TYQA 3LDLA 1QHAA 3CJAA 5BN9A 2P9NA 1EQYA 3FE1A 2ITMA 2IIRA 3EN9A 4O8KA 5AQMA 5CE3A 2P9KA 2QM1A 4BR0A 2F9TA 3MCPA 3H1QA 1GLFO 3W0LA 2E20A 2YHWA 3IMXA 4I6MB 1V4SA 2QW9A 5AQJA 4CBXA 2AA4A 4YDUA 4DHYA 2V52B 1QQMA 3CJ7A 2CGKA 4BRFA 3WUHA 1NGDA 4PKHA 3W3DA 2P9IB 4JHDB 5EOYA 2AP1A 4A2AA 2W41A 3IFRA 4XH5A 2HOEA 4ISEA 4IJNA 3VENA 1Y64A 5AQWA 2EWSA 4BRPA 2Q1NA 4K42A 3M3ZA 3U9DA 2ZGZA 3CQXA 3P4IA 4JD2A 4JAXA 4CZHA 1E4FT 2DPNA
chains in the Genus database with same CATH superfamily
2YKNA 4EFHA 4H0VB 3THWA 4J8FA 3CIPA 4OPAA 3BEXA 5DM6L 4FJGA 3OBWA 4Y0WA 5KPRA 2BGGA 4IO8A 4QS8A 1RDUA 3O4QA 4W5TA 3QEPA 1LW0A 5AQKA 2VCPA 4EZ9A 3DXMA 4DQRA 3FLCO 4GVEA 3ZT0A 4AM6A 3CCLN 2RE2A 1NJYA 3VQEA 1BWFO 4UY8O 2GUPA 2O4GA 2O8BA 4FWPA 2FSJA 3C94A 2P9NB 1ITGA 1RDCA 3FZMA 5BRDA 3EZWA 1J5EK 1WLJA 1Z26A 3HBTA 5LY3A 2FSNA 4CJ3A 3J80O 3NGYA 3MCAB 4YHHK 4FWKA 3A5NC 3OYBA 3P31A 1T6DA 2G8HA 2OZSA 1Q8IA 2G8KA 5KGWA 3QO9A 3F5TA 1VQON 3K5LA 5F1XA 3HVRA 3UKRA 5EX5A 2P9PB 2EHGA 4JKFA 2NRHA 4FW1A 1HQEA 4WYBA 1TUYA 2HNYA 4DTMA 3HP9A 3KKRA 3FFKB 5AQLA 4KREA 4IDKA 1TVRA 1OH8A 1N36K 4H0OA 3HVTA 2HF3A 3TSQA 2E2OA 3LDOA 4H5NA 3ZSWA 4NCGA 3GL1A 3HYFA 2ZJPL 5HRRA 3CFRA 1NWKA 2O8DA 3V9SA 2IVOA 3OY9A 3BGRA 2QI2A 3ID8A 3H3OB 5GINA 1YITN 4RW7A 3P5JA 3L0QA 3V1QA 5J2MA 3NH1A 1U47A 4WCEL 3QIOA 4DB3A 3T1HK 4GV9A 3AY9A 3DXKB 3WQUA 2P5GA 4W5RA 5AQFA 4HVJA 4OJRA 1NOYA 1GLBG 4FWRA 1NGAA 5AQPA 5AQYA 4CEQA 1SL2A 1HYZA 1NKEA 4IG3A 2E8AA 3GDQA 3T1AA 3KKSA 1DTQA 4MDBA 4EHTA 2P9PA 5KTQA 3LDNA 1T44A 3SK3A 1GLEG 3LL3A 3V9UA 5KGXA 4M3UA 1S6PA 2GBZA 3AVKA 4CHOA 4G9ZA 3SQ1A 4BR7A 1T7PA 1JCGA 4KHQA 4PKIA 4FZZA 4WQ5A 2GX9A 3L8BA 1QQOA 3LP1A 4A61A 3VGLA 3RTVA 2E4LA 3QEVA 3TAFA 5I42A 3QB0A 1BUPA 3THXB 3OS2A 1LWFA 4IG0A 4Z4IA 2ASPA 2OTLN 1BA1A 1A5VA 1GOCA 3C7NA 5AFUH 5T7BA 4YOVA 2Q97A 4LFAK 1GLLO 4O0JA 1HJOA 1K73O 3OS1A 2E1ZA 3F2KA 3BZCA 2E6MA 3R6MA 2OYQA 4FM0A 3SMSA 2HMPA 3ASMA 1EX4A 3WEEB 4JI0K 4M3ZA 1U4BA 3DLHA 3U8XA 4CEDA 4E7LA 2QWPA 3NHGA 5JVHL 1EWQA 4AF1A 5BN8A 1N34K 2FXUA 1J9AA 3MX2A 4YOWA 2Z1JA 3ENHA 3H3NO 1NMDA 2IAJA 4OPHA 1YJ9N 4O5FA 5HRSA 3KLIA 1I3AA 4CHYA 2FBXA 1Q9YA 4BG9A 3QEWA 4Z4CA 3K9KA 3F9KA 3VQAA 1IJJA 1G15A 4PKGA 1WSIA 4O5BA 5HRPA 2W6LA 2FBVA 3THXA 3LWMA 3LAKA 1DKGD 2F9WA 1QTMA 2XO7A 3DAWA 1HKBA 2DFFA 4ZTFA 4CZFA 1BHLA 4R79A 2NUBA 4F4KA 2VG5A 4CZKA 1IKYA 3N4PA 1ZC6A 2A5XA 2FF6A 3U9ZA 4F2SA 4DSLA 3U3YA 1FK9A 1HMVA 1I39A 4C8MA 3KLFA 1O13A 2UUBK 4BQZA 4DTUA 2Q36A 1IKVA 3LALA 1RFQA 4FJKA 3FGUA 4LSNA 1NJWA 4IWVA 5AZJA 1Y97A 4LH4A 4FLUA 4I9QA 3ENOA 3E9PA 3NF9A 1XC9A 5AQIA 5FPNA 4RW6A 3WXLA 3BY5A 2D0CA 2Q31A 3LWLA 1QZ5A 3CFOA 2NRZA 1BDGA 4FJIA 5C0YA 3RVCA 2JGUA 4LY7A 3G25A 4DSEA 2EX3A 3AA2A 1DEJA 3MK6A 1VQPN 1NLVA 2E2QA 3HL8A 3T7ZA 4OLBA 3TTCA 4B3SK 1VQ9N 2KFNA 5DMRA 5AZIB 1P90A 5JVGL 1XNRK 1WN7A 3EE8A 2QEXN 1MWKA 3V6DA 2ZWHA 3L4IA 3VMFB 4B3OA 4CIFA 4YY3K 2ETJA 1RT4A 3A5LC 3L2QA 5D3GA 5J1EA 2P9UA 3DRPA 4BE1A 2BH1A 1VHXA 3O4WA 3QEXA 5AQSA 3O5BA 2VWJA 1R0AA 4CJTA 4FWSA 1KFSA 3BZKA 1G99A 3L4QA 3MN9A 3O1BA 3LAMA 1S9GA 1WNSA 1DT9A 4HCCA 3HM8A 3JSMA 5IWAK 1VSHA 4CFCA 1R59O 4H0YB 3HXMA 3THYB 3RR7A 1QHTA 2G8UA 2O8FA 1IH7A 3F73A 1C1BA 4DTNA 1Q7YO 2IGIA 1TYQB 1YTAA 3KK1A 2WUSA 4U67L 1OVYA 1IV0A 1GLAG 4NCAA 4IEIA 2I7PA 3KWIA 5BR9A 5F2RA 4NYFA 1BA0A 3AVMA 2A3ZA 3S41A 1LWEA 3A5MC 4DF8A 1C6VA 2Q0RA 5MLCQ 4OGEA 3ZSZA 4DU4A 2QK9A 2E5LK 4J2BA 1JLFA 1HNVA 1KFDA 4FWOA 4FLZA 3TI0A 1T8EA 5AQUA 3KLHA 4BVPA 5SWMA 3HM9A 1HQUA 4DR6K 3K5OA 3LDQA 4AQYK 3CCUN 3V9WA 3ULEB 4H5RA 1JXBA 3NH2A 2D0OA 1JCFA 3DYAA 2PBDA 5GAEP 3DLEA 2IVPA 4JKGB 4DS5A 3ZT1A 3QICA 4DU1A 4E7KA 4C8OA 4IOCL 4LFBK 3NVMA 2UYTA 2OTJN 1TYQA 1BIZA 1X9MA 5BN9A 1EQYA 1UAXA 2F7TA 1VSJA 3CCQN 3FE1A 1BGXT 2ITMA 4YOYA 3EE9A 1BQNA 3V9XA 3SCXA 3EN9A 4W5QA 4M42A 4BR0A 2F9TA 3G4SN 2UXBK 1TL3A 3L2VA 4I6MB 1NK4A 4FW2A 2X74A 1D8YA 4DTJA 4CGFA 5E41A 3RRGA 2HVIA 4OO1J 5FROA 3ZSVA 3HP6A 3K2PA 4PKHA 2P9IB 2AP1A 2W41A 1HYVA 4ISEA 5AQWA 4ID1A 3M3ZA 4QAGA 1S72N 4JAXA 3OYJA 4CHPA 4J2AA 5AJ3K 1E4FT 2HHHK 4IFEA 4F2RA 4DTPA 1RT5A 1YT3A 4V19S 2P9LA 1NGBA 3PIOL 1QSYA 1VSLA 1B9DA 3CJBA 4KTWA 3JYTA 1U2VB 3O9QA 3CCRN 5BREA 4A62A 3WXKA 4C1NK 4L3QA 3OYEA 3TTFA 4JV5K 3VEXA 1Q81O 4I6MA 4JKHA 3OYHA 4DUZK 4LF7K 5ADXH 3GOIA 5M1OA 5AQXA 4KHPK 3CC4N 3O8MA 4J2EA 3SLCA 1MA9B 4WQ4C 4B3MK 3MN7A 2P9IA 2G8FA 2NLXA 2G8IA 2D5RA 3AVCA 3RSEA 4FOIA 4MO5A 1ATRA 3MEGA 3VA3A 3O6WA 4NB4A 3PLAA 1X3MA 4FM2A 4CK2A 3CERA 4KKOA 5M1PA 1GLCG 1KLNA 4ILGB 4KFBA 4ISGA 3A8YA 2D0BA 4B1VA 2V7ZA 3VQPA 3VPZA 3K5MA 3PY8A 1WB9A 3VOVA 2GEMA 4CFBA 4E89A 4GV3A 4LH5A 1KAYA 2OPQA 3RMDA 1U2VA 2NRRA 3E9LA 3AVJA 3J8AA 4CK3A 1D9DA 4B9LA 2Q3SA 3THWB 2HNDA 3R1XA 1EO1A 2VGNA 2RF2A 4CJ5A 1JLQA 1VQ6N 3BF3A 2O4IA 1CZ9A 1RT6A 1E3MA 1IG9A 2GUIA 2GV9A 2IOCA 3ATUA 1UOCA 4Z4EA 3JAMO 3EL2A 1T05A 5HP1A 3OHRA 4OLAA 3QNNA 3AVIA 3JS6A 3DXMB 3VESA 1GLDG 1W97L 4CZIA 2O8BB 1JKHA 5GAHP 1EXQA 2A1SA 3LDPA 1JXEA 1RTHA 3IKMA 4FYDA 3CJCA 3H08A 3IDHA 3DOLA 2HBMA 3KJVA 5AQGA 1S9EA 1NK5A 3MDQA 4C23A 4DV4K 3QFPA 2A1RA 3TAGA 2ASMA 1C0UA 1OH5A 4CD1A 5KQDA 4E1MA 1GOBA 5BRHA 2PYLA 4M3YA 4Y1DA 3ZSRA 2XHBA 4EHUA 3U3GA 3LZJA 3UKRB 1KRPA 5C12A 4DLEA 4BRCA 5CHIA 4E0DA 3OYDA 5AQTA 3QESA 1YHQN 1H1VA 2KKZA 4OKKA 4NXMK 1HRHA 1VSDA 4BR4A 1YUWA 1KQSM 2WOMA 4A59A 4BRMA 4AHTA 1ASVA 4B8AB 4KI4A 1YXQA 1HKGA 3RMBA 4FWQA 2XY6A 4FCYA 2CH6A 4YOTA 1TGOA 2O8DB 2E88A 4OPJA 4CEFA 3WQTA 1WBBA 1VQ8N 1BIUA 4CF0A 1JCEA 3WXJA 3J7YP 4BWMA 4JI3K 1WUAA 5FPMA 4IKFA 1X9WA 4KRFA 1NGFA 3VQ5A 1ASWA 3CM6A 5KPTA 2BUPA 4E7JA 2XY8A 3MMVA 4BRHA 1RTDA 4GY2B 2Z1GA 1GOAA 2F4VK 4NYNA 5E26A 1NJXA 3D45A 4ZHRA 3VQ7A 1BQMA 3KD5E 2OPRA 2C1IA 1SAZA 1C1AA 3EEQA 4DSJA 2HSTA 4KHWA 3A5OC 2CH5A 3WNHA 1TKDA 3PV8A 4CZGA 4H5VA 3UKUA 4N56A 4BC4A 3WXMB 4DQSA 4O4GA 4XH4A 4BRIA 4GW6A 5C24A 1IKWA 3AA3A 4CZEA 1TK8A 3ZX3A 4K43A 1Q86O 3GG4A 1S6QA 3WXIA 3PO5A 4DQIA 3NF8A 4A57A 1D4XA 4MLEA 1TKZA 2YHAA 4RWTA 3KLEA 1NMNA 1SV5A 3VERA 1X3NA 4LD0A 4PL8A 1HNWK 3QBXA 4M45A 4PHTX 2PAVA 4GVMA 4EIAA 2O8EB 4CIEA 4DFJA 4DUYK 1RBTA 4DV7K 1HKCA 3C7NB 1NM1A 4RCHA 3E1YA 4KH6A 4CVNE 5LJVA 3MN5A 1RBVA 3VA0A 3SAGA 2WTUA 3GBTA 3K0SA 3SPYA 2W42A 4B08A 2P5OA 2XY5A 1QVGM 1NK8A 4GV6A 4CJ4A 4KHNA 3M8QA 4BEBA 1CZAN 3QIPA 4FJLA 4YOUA 4Q0BA 4U7BA 4FK4A 2V7YA 2H3GX 1EETA 1ILYA 1W9HA 4QS7A 5I9EB 4M7YA 1HJRA 1TAQA 4DR1K 3QINA 4CESA 4BC3A 3QEIA 1BOTO 4FJMA 2O8EA 3LPUA 3THVA 4PA1A 1W2BM 1RT7A 2IDOA 4DCHA 3I8DA 4BR9A 2X6NA 3AA4A 3UE5A 3LANA 3LP2A 1S1VA 1YJWN 4PUOA 2E1YA 5BR8K 3AO3A 3OJUA 4BE2A 3NGZA 3TABA 2JWKA 5AFUA 4KO0A 4PL7A 1ZBFA 1HYSA 3CCEN 1QQCA 2A41A 3SAFA 3SUOA 1T6CA 4FLTA 4I2PA 3OYGA 4M3XA 4FO0A 1HPMA 5AZJB 2BTFA 2GWKA 1REVA 4CEEA 1IBLK 2J4RA 1YAGA 3DWLA 4CI6A 4FJ7A 4C8NA 1O1WA 1BL3A 1JLBA 4CIGA 3NCIA 1WAJA 3PSFA 3VGMA 3KLGA 3O4NA 4HTUA 4DF4A 5EU7A 1QQNA 2FBTA 1RDWX 1FKPA 3H45C 5KRSA 3ZX2A 1TK0A 3KK3A 4WE1A 3S5TA 3M8SA 4DFPA 1BCMA 3V81A 4EP5A 3O9UA 4Y1CA 2GWJA 3FZFA 3ZLJA 1RBUA 3TWHA 2YJFA 5I3UA 4PQUA 5C42A 2VG6A 5CZ2A 3K5NA 1M1KO 2AJQA 4E3SA 4MFBA 1NGEA 4DV5K 2Q0UA 4FJHA 4EAHD 1M90O 5EY4A 4JD2B 4LC9B 2HF4A 1C1CA 4XIUA 2HHIA 4CF1A 3E66A 4H8KA 2P9UB 3H6EA 5TKYA 4AHCA 2F8TA 1IBKK 3CJAA 3HPOA 4IOAL 2IIRA 2PYJA 3S3OA 2VG7A 5CE3A 2P9KA 3MCPA 4BWJA 2YHWA 2PZSA 3IMXA 4JI7K 1V4SA 1NK7A 4X64K 2O8FB 3PX0A 5AQJA 4CBXA 4OGCA 3ZT4A 2AA4A 4WFNL 4CJQA 1QQMA 2CGKA 2C1GA 5GIPA 2NRXA 1NJIO 5EOYA 4XH5A 4DV2K 3VQDA 2HOEA 3VENA 2EWSA 4BRPA 4BE0A 4K42A 4FM1A 3U9DA 4JD2A 4A5BA 4Z0UA 4DS4A 4CF2A 4WQ5C 2D1KA 2HBKA 4CCHA 2YI1A 3CFPA 4CHNA 3OYIA 3SBGA 4KHYA 3AGKA 2VQFK 1DLOA 1VQ5N 4KAZA 3D2EB 3CJ9A 3C95A 3TARA 3LZIA 5HROA 2OCEA 5AQRA 4FLWA 1C0FA 1CXQA 4LF6K 1SZ2A 4BGBA 4Z4HA 1VSFA 1RT1A 2WBNA 2YX6A 4C8LA 4FWLA 3SAHA 4MDAA 3ZCMA 1YJNN 3TAEA 3TPQA 1KSPA 5LMUK 1U6ZA 3PSIA 2YHBA 3QBWA 1JL1A 4F8RA 1J54A 4H0PA 1NG9A 2OZMA 2ZGYA 3E01A 2BDPA 1SL1A 3B6OA 3CCJN 1RBRA 2HHSA 2HMIA 1F21A 1BCOA 2KLAA 4N41A 3AAPA 5AR0A 4CZMA 3WNFA 1SKSA 4FLVA 2NNWA 3U4LA 3D2EA 4RG8A 3I56N 3PX4A 3H46O 1A5XA 2HHUA 2YV0X 1LCUA 4FJ5A 2OA8A 4CZLA 4BDPA 3CC2N 4BRKA 4B9TA 1S1WA 1KCFA 4H0TB 4Q5VA 2WC9A 4FWMA 1KXPA 3C0BA 4H5TA 4CJFA 4CHQA 4KH5A 4HUFA 1NGJA 4XJXA 2P9LB 1NGIA 1SQKA 3OYNA 3O1WA 1JLAA 4O55A 3K59A 2VWKA 4JS5A 2IC3A 1U04A 3AVBA 5LL6Z 4DR4K 1XQSC 4ZTJA 1BU6O 3AAQA 4J2DA 5FRNA 4CEZA 4LSLA 3E9OA 3M1FA 4XEIA 5C2DA 5KQ8A 4DV6K 3AA5X 3AO2A 4CGHA 2YNIA 2YHYA 3IS9A 5JS1A 3RSEB 3LPTA 3HOSA 2A6AA 2Z1IA 5JENA 3AVAA 4GMJB 1ZBUA 3I0SA 2QXLA 4BG8A 1J53A 2X6SA 1L3SA 3F9MA 1V4TA 4JKCA 1EWRA 2LSNA 3TU5A 4BRGA 1RGIA 4DR5K 5JS2A 3MEEA 4FLXA 3VF6A 1SKRA 2P9SB 4DQQA 5M1KA 3ENBA 1VAZA 3L2UA 4IDHA 1KC8O 2Y1IA 3HK2A 4FJJA 2DFHA 2PY5A 2KFZA 1WSHA 3HPGA 5K14A 1YVNA 4K25A 1N32K 3ZT3A 4OPKA 4E7HA 4AH9A 1RCHA 4H5WA 3ZSOA 3CQ8A 3DRSA 3L2RA 4CJWA 1BI4A 2NRWA 5CZ1A 4CJ7A 1LWCA 1Q18A 4DQ8A 4H4MA 4IZ9A 1XUPO 3WT0A 1VQ7N 2X78A 4DWIA 4CFDA 1WOQA 3AVGA 3C6HA 4N76A 3DOKA 4L8RB 3SV3A 4JRPA 3P1GA 1ESVA 3RWUA 4FK2A 5ADXA 2W00A 4TSXA 3TSUA 5J2QA 2ASOA 4R5PA 4F9OA 1ZYQA 1VSKA 3SNNA 3IAYA 4IXCA 4DMNA 3MECA 4DV1K 4H4OA 5JMVA 1IKXA 3QDKA 2QWLA 2E2NA 3H1VX 3SJHA 3MXMA 4DTSA 4LFCK 5E84A 4AILC 2P9SA 4FSVA 3VEWA 5BPNA 4CBWA 3UIQA 3VETA 3OYAA 4BE7B 5JLHA 2YCHA 3SUNA 1VQLN 1JJ2M 2RHKA 3KHYA 3MWPA 1ATNA 4N47A 5M1NA 3T1YK 3HI0A 4YNQA 3OYMA 5C25A 4JNEA 3P83D 1RTIA 3C6TA 4E19A 2F96A 3LP0A 3S9HA 1HLUA 1NBWA 3G0ZA 3HRGA 3R9PA 4M3TA 3ZETA 1SL0A 4ELVA 4O44A 1NU0A 4E7IA 5H1SQ 3KTQA 2JWLA 4IFYA 2OPSA 3ZYYX 4DR2K 3NF7A 3PX6A 3QERA 4DV0K 3BUZB 1W0HA 1EKEA 1VSEA 1WSJA 3V1OA 2HHWA 2BANA 5CR4A 1HX1A 1X9SA 3VEZA 3IUCA 4DSKA 1LW2A 4G1QA 5B8HA 4CBUA 1S5JA 3A2FA 1KLMA 3TAMA 4DFKA 1XWLA 3VQBA 4ISFA 1C0MA 4X66K 4B9MA 1XC3A 1XHZA 2FBYA 2GELA 4KTQA 3CM5A 3AVLA 1NKBA 3R3LA 2V51B 3BF1A 3CCSN 1A5WA 4CGDA 2NZTA 3J81O 1QVFM 3OTOK 4DQPA 4NLBA 4W5OA 1ZBHA 4X65K 2FLOA 2IVNA 4JN4A 3CMEN 3OS0A 2CGJA 2D0AA 4B1UB 3VQQA 1NGGA 1N5YA 4NO7A 5BRFA 3DLKA 2YHXA 2NRTA 4GNIA 3CCVN 4DG1A 5AQNA 4CE9A 2WONA 4CGGA 1RILA 2QA4N 3HPHA 4KV8A 1TUUA 4A5AA 4BRAA 4HWIA 1K8KA 3SQ0A 4OKEA 4CZJA 1MU2A 1Q82O 3UKUB 3NMUA 4F3TA 2UXDK 3ZEUB 4M63C 1L3VA 1U49A 2ZE2A 2YNFA 4CFAA 3CMAN 3MXIA 4BC2A 2YNGA 2P1JA 3VQ8A 4B1YB 4BGAA 1QZ6A 4CJUA 3OYLA 1C0TA 3ID6A 3EZ5A 1ZBSA 3VEYA 3O08A 4AHSA 5AQZA 2GTDA 3M5RA 5SZTA 4B9UA 4M41A 4CJEA 4FOEA 3AO5A 2QWOA 1MDUB 4CGJA 4QOZB 4JKEA 3DLBA 2ZQBA 2QWNA 4CECA 4BR2A 2ZJRL 4ELUA 3P39A 1NK6A 1BG3A 3KWGA 4K41A 3KZBA 3VN5A 4JHDA 3CG7A 3PUFA 5IT9O 3OJSA 4FWNA 3CI5A 4AHRA 5EVZA 1N33K 3NF6A 4EZ6A 1S1UA 1TK5A 4QS9A 3O3GA 1NK0A 4RTFD 1JLGA 3KK2A 2QWRA 3C6UA 3CYGA 3R8EA 4JRQA 3DMJA 3AVFA 1LV5A 3CYMA 4FLYA 4BRNA 1HNXK 5JLFA 3IRXA 4BRLA 1UA0A 3I33A 3ZEUA 3SQ2A 4B9NA 3N4QA 2NRVA 5HLFA 2UUCK 4NCBA 4OVLA 4BREA 2CGLA 2KQ2A 2DFEA 3CETA 3HZ6A 4ILHA 4CJPA 3ULDA 3CQYA 2ZF5O 4H0XB 1VSIA 1JLCA 5J2NA 1NGHA 2YNHA 3K57A 4JI5K 4JYAK 4K8XA 3BP8A 2BE2A 4BQLA 3HTVA 1KTQA 4BVOA 2YKMA 1Z05A 5DK5A 2WFBA 3TSPA 2A42A 2ITGA 3QETA 3O9SA 2P9NA 3OBYA 4KPYA 4O8KA 2I5JA 4FJXA 4FJNA 2O8CB 1GLFO 2E20A 5M1FA 4LF5K 2XRIA 3BDPA 1DTTA 3Q7BA 4YDUA 3ZSQA 4B3RK 3S3NA 3AO4A 3TR8A 4FVUA 1NGDA 3W3DA 4PWDA 1B92A 1VSMA 4CGIA 4CJKA 1Y64A 3D0PA 3NH0A 4K0KK 4BDZA 2XY7A 1TL1A 3CQXA 4C8KA 1XNQK 3AV9A 5CY4A 4WFBL 4LF4K 2DPNA 3RMAA 4FPAA 2UXCK 2VYPA 1LOTB 4QCLA 4FJ8A 4RW8A 1CXUA 4B9VA 2KZMA 2Q2RA 3ZT2A 4CJLA 3JXUA 4I2QA 3TTDA 4Z4GA 3OYCA 4Z4FA 3T19A 4I7FA 1GLJO 2O8CA 3AARA 2I7NA 3LP3A 3VF2A 4IOXA 4BDYA 1NJZA 3WNGA 3CD6N 1VQKN 2HNZA 3QLHA 3VF4A 5C2FA 3DXKA 4DTXA 3MXJA 1QS4A 5KPZA 1CLQA 4B1ZA 3D2FB 3L3UA 1K8AO 4W5NA 4RW9A 1J6ZA 4E1NA 3K9JA 3CJ1A 4CEBA 4IO9L 4IFVA 1U48A 3RR8A 3G6EN 2FSKA 5M1QA 1D5AA 1S1XA 1LAWA 3QNOA 3U6FA 4WF9L 2P9KB 3CHWA 3KIOA 4KI6A 2VWBA 3O9TA 4HTLA 4E72A 3C65A 4OKJA 4GKKK 3GE1A 4IEEA 1FW6A 2OPPA 5CYMA 4FPBA 2QWMA 3TAPA 1XMQK 1VQMN 1TKXA 1IG8A 1FJGK 2D4WA 1U45A 2RKIA 2QWQA 4NLCA 5TKWA 4ILJA 4KTZA 4CW7B 1OKJA 2B4JA 4DSFA 2QKKA 3HJFA 3EYZA 4B1XB 4ICLA 1NOZA 1CZBA 1WSGA 3AVHA 1N8RO 2JLEA 1TKTA 3ZSXA 2PFUA 1NNEA 3I55N 3D2FA 4DSIA 5HOOA 4B9SA 4JEPA 3ZSYA 3D7EO 3SBTA 1SKWA 2KZZA 1X9JA 4E1JA 1KVBA 3TANA 1ZBIA 3HSCA 3QMLA 2A40A 5LMNK 4ID5A 2P51A 4FXDA 4BECA 3ALYA 2W40A 3LDSA 1X1PA 4BACA 4JI6K 4JK8A 4H03B 4BC5A 1RNHA 1T3VA 3WEEA 1E4GT 1BO5O 1VQNN 1YVUA 4JI4K 4XH1A 3DLLL 4CJRA 3VQCA 3CF5L 4JK7A 5AQOA 2Z1HA 2B5JA 3P38A 4BRQA 3DJCA 3CPWM 2E2PA 4YDUC 5FPEA 1KVAA 4CK1A 3EKSA 3K58A 4JLHA 3WNEA 3I8BA 4MQ3A 5HL7L 5AQHA 3LM2A 2KHOA 5HRNA 3OYKA 1K6YA 4KHUA 5LJWA 4A2BA 4YOXA 1XMOK 3NAEA 1RBSA 4CD3A 3VGKA 5FRMA 3SYZA 4MLHA 3AGRA 5A2QO 5FPDA 1L3UA 4CJSA 4O8UA 3SMPA 3MN6A 1RT3A 1VQ4N 3ATVA 4WFAL 3FFIA 3SI6A 3VQ4A 3C6AA 4KB1A 3O80A 2ZD1A 1P8ZA 4BY9C 5J2PA 2FF3B 3V1RA 1OVQA 2HBJA 1HPZA 3SQ4A 4JK9A 4C1NI 1QSLA 4WQ4A 4JKDA 1MWMA 4CHZA 3MAQA 3M6GA 1L3TA 4CF9A 5AQVA 1HNIA 1XHXA 3CCMN 1W7AA 4X62K 4CJVA 5GAGP 1XI1A 1IBMK 3NVKA 1N6QA 3FZHA 5KRTA 5AZIA 3G10A 1YIJN 3VTHA 1LAVA 2DY4A 1TAUA 3AVNA 3DLRA 3L6QA 4FK0A 4B3TK 1KVCA 4YFUA 3EY1A 3KK7A 5C10A 3CXCM 1S22A 3HSTB 4BRDA 4DLGA 4B8CA 2D0PA 4RW4A 2QXFA 3AO1A 2VQEK 1ZXOA 2QKBA 3PIPL 1KD1O 4FL9A 1SS6A 1HNZK 3NDKA 5GIOA 3J7ZO 4K8ZA 1ATSA 4LF8K 3VTIA 1RDDA 3PO4A 1UWBA 1OH6A 3RRHA 1DGKN 3THYA 3A0IX 1BI4B 3NBPA 4IJAA 3DI6A 4HHTA 1FXXA 3HOTA 1HUXA 2HVHA 2HHVA 4DTRA 1NKCA 5GADP 2E6LA 3VQ6A 3VQ9A 4JKBA 4EP4A 4PY5A 3NGIA 1QE1A 1TV6A 3HT3A 4JI1K 1HR0K 4DFMA 4GKJK 4M3RA 4MO4A 3T69A 1ZBLA 1YTUA 4UQGA 3VEVA 1FKOA 1K9MO 1KAXA 2QTDA 2W6KA 3B8AX 3DM2A 3M8PA 1J5OA 5F0XA 5EXWA 2HW3A 4FVMA 1Z25A 1T03A 1SUQA 3B6PA 1NGCA 4AHUA 4CEOA 5BPLA 3ULEA 3DRRA 3O9RA 1VRUA 3D6RA 3EKUA 3VEOA 4HCBA 4DTOA 4F3OA 4B1WB 1D9FA 4JKGA 4JI2K 5KI6A 1YF5L 3TAQA 1WBDA 3IG1A 4FJ9A 1EP4A 4B9QA 1RT2A 3FZLA 2ZM6K 4KH4A 4DKWA 3MX5A 4DR7K 4AM7A 3V9ZA 3ZETB 4KHSA 3OA9A 4ELTA 4DV3K 3OVNA 3EO3A 4KBOA 1RDAA 2OANA 4FZYA 2HHQA 1VK0A 2RN2A 4CF8A 1IO2A 3MWTA 3LM9A 2YJEA 1S1TA 1RDBA 2G8VA 1BISA 5ELZA 1WSFA 1YI2N 3FZKA 1Z6RA 4O0IA 4NXNK 4BROA 3I0RA 1OH7A 4M3WA 2KTQA 3QFUA 4M7XA 3HO1A 3Q7CA 1C0GA 3ISNC 3S3MA 1WAFA 3L2WA 4DU3A 3OYFA 3SUPA 5DM7L 2ZJQL 2HHXA 3G71N 4IBNA 3O3HA 5JICA 5BPMA 2UUAK 4BR5A 1WSEA 4CERA 4JI8K 1S3XA 5AQQA 3ITHA 3V4IA 3M8RA 2UU9K 5FDLA 4YORA 4HUGA 5CYQA 1K8KB 3CC7N 3KVGA 4I9LA 4AHVA 3ZX0A 4Z94A 1NK9A 3UB5A 2IS3A 1I94K 2F8SA 3CPEA 2VGMA 4CEAA 2Y1JA 3DLGA 1KAZA 3FR0A 3LDLA 3KD1E 1QHAA 2KW4A 3O3FA 3SZ2A 5HBMA 4JS4A 2HHTA 3SUQA 3T3FA 1QSSA 5AQMA 2QM1A 3H1QA 3W0LA 1VRTA 2G8WA 2HB5A 2QW9A 2FC0A 2HBLA 2B6AA 3RMCA 3J7AP 3NE6A 4DHYA 2V52B 4OX9K 3NFAA 3CJ7A 3OW2M 3SV4A 4BRFA 1ASUA 3WUHA 3L3VA 1UA1A 4FZXC 4DR3K 4JHDB 4HUEA 1JLEA 3MEDA 4A2AA 3IFRA 3SJJA 4IJNA 1L5UA 1RTJA 2Q1NA 1Q9XA 2ATQA 5FLXO 2ZGZA 2R7YA 4LF9K 1B9FA 4JKAA 3P4IA 4CZHA 4N5SA 3SPZA 2DTUA 2RPIA 4KB0A 5C15A 1JL2A
chains in the Genus database with same CATH topology
4WQ5C 4EFHA 4H0VB 2D1KA 2HBKA 4J8FA 4FPAA 3CIPA 4IFEA 2YI1A 4OPAA 3BEXA 5DM6L 2VYPA 1LOTB 3OBWA 4Y0WA 3SBGA 5KPRA 3AGKA 2Q2RA 1VQ5N 4IO8A 3D2EB 3CJ9A 4QS8A 3JXUA 2P9LA 3TTDA 1RDUA 1NGBA 3PIOL 3CJBA 1U2VB 1GLJO 5AQRA 3O9QA 3AARA 3CCRN 2I7NA 5BREA 4A62A 5AQKA 3WXKA 3VF2A 1C0FA 4L3QA 4C1NK 4IOXA 2VCPA 3CD6N 3TTFA 1SZ2A 1VQKN 3VEXA 1Q81O 3VF4A 4BGBA 5C2FA 3DXMA 4I6MA 4JKHA 3DXKA 3FLCO 4GVEA 2WBNA 4AM6A 3CCLN 2RE2A 5KPZA 2YX6A 3GOIA 5ADXH 4B1ZA 3D2FB 5M1OA 1K8AO 5AQXA 1BWFO 4FWLA 3CC4N 1J6ZA 4UY8O 3O8MA 3SAHA 2GUPA 4MDAA 1YJNN 3K9JA 3CJ1A 4FWPA 2FSJA 3TPQA 2P9NB 3SLCA 4IO9L 1MA9B 4WQ4C 3MN7A 1U6ZA 3G6EN 2P9IA 2NLXA 2FSKA 5M1QA 3FZMA 3QBWA 5BRDA 3EZWA 3RSEA 4FOIA 4WF9L 2P9KB 3CHWA 4MO5A 1ATRA 3HBTA 4H0PA 2VWBA 3O9TA 4HTLA 2ZGYA 5LY3A 2FSNA 3C65A 3O6WA 3CCJN 3MCAB 3GE1A 3A5NC 4FWKA 4NB4A 3P31A 4IEEA 1T6DA 1X3MA 3PLAA 3CERA 4FPBA 2KLAA 5M1PA 1GLCG 3AAPA 2QWMA 5AR0A 4ILGB 4CZMA 4ISGA 1VQMN 3A8YA 1IG8A 3F5TA 2D4WA 4B1VA 2V7ZA 2NNWA 1VQON 3VPZA 3U4LA 3D2EA 3VOVA 5F1XA 2QWQA 4NLCA 3I56N 2GEMA 3UKRA 3H46O 5EX5A 5TKWA 4ILJA 4GV3A 1OKJA 2P9PB 1KAYA 1LCUA 1U2VA 2NRRA 4JKFA 2NRHA 3E9LA 4WYBA 1TUYA 4B1XB 3FFKB 5AQLA 3J8AA 1N8RO 4CZLA 3CC2N 4H0OA 2HF3A 3TSQA 4BRKA 2PFUA 3R1XA 1EO1A 2E2OA 2VGNA 3LDOA 4H0TB 4H5NA 3I55N 2WC9A 3D2FA 4FWMA 5HOOA 1VQ6N 1KXPA 3GL1A 3BF3A 4JEPA 3C0BA 3D7EO 4H5TA 3SBTA 2ZJPL 4KH5A 1X9JA 1NWKA 4E1JA 1NGJA 4XJXA 2P9LB 1NGIA 1SQKA 2IVOA 3ATUA 3HSCA 3QMLA 2QI2A 3ID8A 2A40A 3H3OB 5GINA 1YITN 3EL2A 4BECA 3O1WA 2W40A 3OHRA 3L0QA 4JK8A 4H03B 4BC5A 4WCEL 1T3VA 4DB3A 4GV9A 3JS6A 1E4GT 3WEEA 1BO5O 3AY9A 3DXMB 1VQNN 3DXKB 3WQUA 5AQFA 3VESA 1GLBG 1XQSC 4FWRA 1BU6O 1NGAA 3AAQA 1GLDG 4XH1A 5AQPA 3DLLL 1W97L 5AQYA 4CZIA 3E9OA 3M1FA 4XEIA 5C2DA 5KQ8A 5GAHP 3CF5L 4JK7A 5AQOA 4BRQA 2E8AA 2YHYA 3LDPA 3P38A 3RSEB 3HOSA 3DJCA 3GDQA 3IKMA 2A6AA 3CJCA 2E2PA 3CPWM 4YDUC 3IDHA 4MDBA 4EHTA 5FPEA 2P9PA 2HBMA 2QXLA 4BG8A 3EKSA 3LDNA 3F9MA 1V4TA 5AQGA 4JKCA 1T44A 3MDQA 4C23A 3SK3A 3TU5A 3I8BA 1GLEG 3QFPA 4BRGA 1RGIA 2ASMA 3LL3A 5HL7L 5AQHA 3LM2A 4CD1A 3VF6A 2KHOA 5KQDA 4G9ZA 5BRHA 2P9SB 5M1KA 4BR7A 3ENBA 1VAZA 4IDHA 1JCGA 4A2BA 5LJWA 4YOXA 4PKIA 4WQ5A 1KC8O 2GX9A 4EHUA 3UKRB 4CD3A 3VGKA 5C12A 1QQOA 4BRCA 5CHIA 4A61A 5AQTA 4MLHA 1YVNA 3AGRA 3VGLA 1YHQN 1H1VA 2KKZA 4K25A 5FPDA 4H5WA 4BR4A 4O8UA 1YUWA 2NRWA 3QB0A 1BUPA 3SMPA 4CJ7A 1KQSM 3MN6A 1Q18A 4DQ8A 1VQ4N 4IZ9A 3ATVA 4A59A 4BRMA 4WFAL 1XUPO 3WT0A 2ASPA 3C6AA 1VQ7N 2OTLN 1BA1A 1YXQA 1HKGA 3O80A 4FWQA 3C7NA 1P8ZA 1WOQA 2CH6A 5AFUH 4YOTA 4YOVA 4BY9C 2E88A 2FF3B 2Q97A 3C6HA 2HBJA 3WQTA 1VQ8N 4JK9A 1GLLO 1K73O 1HJOA 1ESVA 2E1ZA 3F2KA 1JCEA 4C1NI 5ADXA 3WXJA 2W00A 3R6MA 3TSUA 3SMSA 1WUAA 4WQ4A 2HMPA 2ASOA 4JKDA 1MWMA 5FPMA 4F9OA 3M6GA 1NGFA 3WEEB 5AQVA 4IXCA 5KPTA 3U8XA 2BUPA 5JMVA 3QDKA 2QWLA 2E2NA 2QWPA 3H1VX 5JVHL 3SJHA 3MMVA 4AF1A 4BRHA 3CCMN 5E84A 4GY2B 5BN8A 2P9SA 4FSVA 3VEWA 5GAGP 5BPNA 3NVKA 2FXUA 5E26A 3FZHA 4CBWA 3MX2A 3VETA 4YOWA 3ENHA 3H3NO 5AZIA 1NMDA 4BE7B 4OPHA 3VTHA 4O5FA 1YIJN 1YJ9N 1SAZA 2C1IA 5JLHA 2YCHA 3L6QA 2HSTA 3A5OC 4BG9A 1VQLN 3K9KA 2CH5A 1JJ2M 1IJJA 4PKGA 3KK7A 5C10A 3CXCM 1S22A 2RHKA 3KHYA 3MWPA 4BRDA 4CZGA 1ATNA 4H5VA 2D0PA 3HI0A 5M1NA 3UKUA 4BC4A 4JNEA 3WXMB 1DKGD 2F9WA 4XH4A 4BRIA 3DAWA 1ZXOA 3PIPL 1HKBA 4CZEA 4FL9A 1KD1O 3ZX3A 4K43A 1Q86O 3GG4A 4CZFA 1HLUA 1NBWA 1SS6A 3HRGA 3R9PA 3WXIA 3ZETA 4R79A 4CZKA 5GIOA 3N4PA 1ZC6A 2A5XA 2FF6A 3U9ZA 3J7ZO 1ATSA 4A57A 1D4XA 3VTIA 4MLEA 4RWTA 3VERA 5H1SQ 1DGKN 1O13A 2JWLA 3A0IX 1X3NA 4BQZA 3ZYYX 2Q36A 4PL8A 1RFQA 4IJAA 3FGUA 3QBXA 3HOTA 4PHTX 3BUZB 2PAVA 4EIAA 1HUXA 5CR4A 1HX1A 5GADP 3VEZA 3IUCA 5B8HA 4IWVA 1HKCA 5AZJA 4CBUA 3C7NB 1NM1A 4JKBA 4RCHA 3E1YA 4KH6A 3ENOA 4ISFA 3E9PA 5LJVA 5AQIA 4MO4A 5FPNA 1XC3A 3MN5A 2GELA 3T69A 3WXLA 3SAGA 3R3LA 2V51B 3VEVA 3BF1A 3CCSN 2Q31A 2NZTA 1K9MO 1KAXA 3GBTA 1QZ5A 1QVFM 2NRZA 1BDGA 2QTDA 5C0YA 4NLBA 3B8AX 2FLOA 3RVCA 3G25A 2IVNA 4JN4A 5EXWA 5F0XA 3CMEN 2CGJA 4B1UB 1DEJA 1NGGA 3MK6A 1VQPN 1NLVA 2E2QA 4NO7A 5BRFA 1QVGM 3T7ZA 4GV6A 1NGCA 3TTCA 2YHXA 2NRTA 5BPLA 1VQ9N 4GNIA 3CCVN 5AQNA 1CZAN 4BEBA 5AZIB 4YOUA 1P90A 5JVGL 2QA4N 3EE8A 3ULEA 2QEXN 1MWKA 1TUUA 4U7BA 3O9RA 2ZWHA 3D6RA 3EKUA 4A5AA 3L4IA 3VEOA 2V7YA 2H3GX 4HWIA 3VMFB 4BRAA 1ILYA 4B1WB 1K8KA 4JKGA 4QS7A 4CZJA 1Q82O 3A5LC 5I9EB 1YF5L 4M7YA 3UKUB 3NMUA 2P9UA 4B9QA 3FZLA 3ZEUB 2BH1A 3O4WA 4M63C 4KH4A 4BC3A 4DKWA 1BOTO 5AQSA 3O5BA 3MX5A 3CMAN 4FWSA 4BC2A 1W2BM 4B1YB 4BGAA 4AM7A 4DCHA 4BR9A 1G99A 3ZETB 3L4QA 3OA9A 3MN9A 1QZ6A 3O1BA 3EO3A 3ID6A 4KBOA 1DT9A 1ZBSA 2OANA 3HM8A 3UE5A 3VEYA 3O08A 5AQZA 2GTDA 3M5RA 1YJWN 1R59O 4H0YB 2E1YA 3MWTA 4FOEA 2JWKA 5AFUA 2QWOA 1MDUB 4PL7A 3LM9A 3CCEN 2A41A 4JKEA 1Q7YO 2QWNA 2YJEA 3SAFA 1TYQB 1T6CA 4BR2A 2ZJRL 3P39A 4FO0A 1BG3A 1HPMA 5AZJB 5ELZA 2WUSA 2BTFA 3KWGA 4K41A 3KZBA 4U67L 4JHDA 1OVYA 2GWKA 3FZKA 1YI2N 1Z6RA 1GLAG 2J4RA 4FWNA 1YAGA 3CI5A 5EVZA 4BROA 4IEIA 2I7PA 3DWLA 3KWIA 4CI6A 5BR9A 5F2RA 3QFUA 1BA0A 2A3ZA 4M7XA 3S41A 3A5MC 4QS9A 3Q7CA 1C0GA 4RTFD 3VGMA 2QWRA 2Q0RA 5MLCQ 3R8EA 1QQNA 1RDWX 3H45C 3ZX2A 4BRNA 5JLFA 4BRLA 3I33A 3ZEUA 4FWOA 3N4QA 2NRVA 5AQUA 5DM7L 4BVPA 2ZJQL 3O9UA 4BREA 2CGLA 2GWJA 3FZFA 3G71N 3CETA 2YJFA 3HZ6A 3LDQA 4ILHA 3CCUN 3CQYA 2ZF5O 4H0XB 5JICA 5BPMA 1M1KO 4BR5A 3ULEB 4H5RA 1NGHA 1S3XA 5AQQA 1NGEA 2D0OA 2Q0UA 4EAHD 1JCFA 5EY4A 1M90O 2PBDA 4JD2B 5GAEP 3BP8A 4YORA 1K8KB 2IVPA 4LC9B 4BQLA 4JKGB 2HF4A 3CC7N 3KVGA 3HTVA 3ZX0A 4Z94A 3E66A 3UB5A 2P9UB 4BVOA 1Z05A 3QICA 3CPEA 2VGMA 4IOCL 2WFBA 3H6EA 1KAZA 3NVMA 5TKYA 3TSPA 2A42A 2UYTA 3FR0A 2OTJN 1TYQA 3LDLA 1QHAA 3CJAA 3O9SA 5BN9A 2P9NA 1EQYA 2F7TA 3CCQN 3OBYA 3FE1A 2ITMA 4YOYA 4IOAL 3EE9A 2IIRA 3EN9A 4O8KA 5AQMA 5CE3A 2P9KA 2QM1A 4BR0A 2F9TA 3MCPA 3H1QA 1GLFO 3W0LA 3G4SN 2E20A 2YHWA 5M1FA 3IMXA 4I6MB 1V4SA 2QW9A 2HBLA 3Q7BA 5AQJA 4CBXA 2AA4A 4YDUA 4DHYA 2V52B 4WFNL 4OO1J 1QQMA 3CJ7A 2CGKA 3OW2M 2C1GA 4BRFA 5GIPA 2NRXA 4FVUA 3WUHA 1NGDA 4PKHA 1NJIO 3W3DA 2P9IB 4JHDB 5EOYA 2AP1A 4A2AA 2W41A 3IFRA 4XH5A 2HOEA 4ISEA 4IJNA 3VENA 1Y64A 5AQWA 2EWSA 4BRPA 2Q1NA 4K42A 3M3ZA 3U9DA 2ZGZA 1S72N 4JKAA 3CQXA 3P4IA 4JD2A 4JAXA 4A5BA 4CZHA 4WFBL 5C15A 1E4FT 2DPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WQ5 C;  4EFH A;  4H0V B;  2D1K A;  4J8F A;  4FPA A;  3CIP A;  2YI1 A;  3BEX A;  2VYP A;  1LOT B;  4Y0W A;  5KPR A;  2Q2R A;  4IO8 A;  3D2E B;  3CJ9 A;  4QS8 A;  3JXU A;  2P9L A;  1NGB A;  3CJB A;  1U2V B;  1GLJ O;  5AQR A;  3AAR A;  2I7N A;  5BRE A;  4A62 A;  5AQK A;  3WXK A;  3VF2 A;  1C0F A;  4L3Q A;  2VCP A;  1SZ2 A;  3VEX A;  3VF4 A;  4BGB A;  3DXM A;  4I6M A;  3DXK A;  3FLC O;  4AM6 A;  5KPZ A;  5ADX H;  3GOI A;  4B1Z A;  3D2F B;  5AQX A;  1BWF O;  4FWL A;  1J6Z A;  3O8M A;  2GUP A;  3CJ1 A;  4FWP A;  2FSJ A;  3TPQ A;  2P9N B;  3SLC A;  1MA9 B;  4WQ4 C;  3MN7 A;  1U6Z A;  2P9I A;  2NLX A;  2FSK A;  3FZM A;  3QBW A;  5BRD A;  3EZW A;  3RSE A;  4FOI A;  2P9K B;  3CHW A;  4MO5 A;  1ATR A;  3HBT A;  4H0P A;  2VWB A;  4HTL A;  2ZGY A;  5LY3 A;  2FSN A;  3O6W A;  3GE1 A;  3A5N C;  4FWK A;  4NB4 A;  1T6D A;  1X3M A;  3CER A;  4FPB A;  1GLC G;  3AAP A;  2QWM A;  5AR0 A;  4CZM A;  4ISG A;  3A8Y A;  1IG8 A;  2D4W A;  4B1V A;  2V7Z A;  3VPZ A;  3U4L A;  3D2E A;  3VOV A;  5F1X A;  2QWQ A;  2GEM A;  3UKR A;  3H46 O;  5EX5 A;  1OKJ A;  2P9P B;  1KAY A;  1LCU A;  1U2V A;  2NRH A;  4WYB A;  1TUY A;  4B1X B;  3FFK B;  5AQL A;  3J8A A;  4CZL A;  4H0O A;  2HF3 A;  4BRK A;  2E2O A;  3LDO A;  4H0T B;  4H5N A;  3D2F A;  4FWM A;  1KXP A;  3GL1 A;  3BF3 A;  3C0B A;  3D7E O;  4H5T A;  1X9J A;  1NWK A;  4E1J A;  1NGJ A;  2P9L B;  1NGI A;  1SQK A;  2IVO A;  3ATU A;  3HSC A;  3QML A;  3ID8 A;  2A40 A;  3H3O B;  3EL2 A;  3O1W A;  2W40 A;  3OHR A;  3L0Q A;  4H03 B;  4BC5 A;  4DB3 A;  3JS6 A;  1E4G T;  3WEE A;  1BO5 O;  3AY9 A;  3DXM B;  3DXK B;  3WQU A;  5AQF A;  3VES A;  1GLB G;  1XQS C;  4FWR A;  1BU6 O;  1NGA A;  3AAQ A;  1GLD G;  4XH1 A;  5AQP A;  5AQY A;  4CZI A;  3M1F A;  4XEI A;  5KQ8 A;  5AQO A;  4BRQ A;  2E8A A;  2YHY A;  3LDP A;  3RSE B;  3DJC A;  3GDQ A;  2A6A A;  3CJC A;  2E2P A;  4YDU C;  3IDH A;  4EHT A;  5FPE A;  2P9P A;  2QXL A;  4BG8 A;  3EKS A;  3LDN A;  3F9M A;  1V4T A;  5AQG A;  1T44 A;  3MDQ A;  4C23 A;  3SK3 A;  3TU5 A;  3I8B A;  1GLE G;  3QFP A;  4BRG A;  1RGI A;  2ASM A;  3LL3 A;  5AQH A;  3LM2 A;  4CD1 A;  3VF6 A;  2KHO A;  5KQD A;  5BRH A;  2P9S B;  4BR7 A;  1JCG A;  4A2B A;  5LJW A;  4PKI A;  4WQ5 A;  4EHU A;  3UKR B;  4CD3 A;  3VGK A;  1QQO A;  4BRC A;  4A61 A;  5AQT A;  4MLH A;  1YVN A;  3VGL A;  1H1V A;  4K25 A;  5FPD A;  4H5W A;  4BR4 A;  1YUW A;  3QB0 A;  1BUP A;  3SMP A;  4CJ7 A;  3MN6 A;  1Q18 A;  4DQ8 A;  4IZ9 A;  3ATV A;  4BRM A;  1XUP O;  3WT0 A;  2ASP A;  1BA1 A;  1YXQ A;  1HKG A;  3O80 A;  4FWQ A;  3C7N A;  1P8Z A;  1WOQ A;  2CH6 A;  5AFU H;  2E88 A;  2FF3 B;  2Q97 A;  3WQT A;  1GLL O;  1HJO A;  1ESV A;  2E1Z A;  1JCE A;  5ADX A;  3WXJ A;  3R6M A;  3SMS A;  1WUA A;  4WQ4 A;  2HMP A;  2ASO A;  1MWM A;  5FPM A;  4F9O A;  3M6G A;  1NGF A;  3WEE B;  5AQV A;  4IXC A;  5KPT A;  3U8X A;  2BUP A;  5JMV A;  3QDK A;  2QWL A;  2E2N A;  2QWP A;  3H1V X;  3SJH A;  3MMV A;  4BRH A;  5E84 A;  4GY2 B;  5BN8 A;  2P9S A;  4FSV A;  3VEW A;  5BPN A;  2FXU A;  5E26 A;  3FZH A;  4CBW A;  3VET A;  3ENH A;  3H3N O;  5AZI A;  1NMD A;  4O5F A;  1SAZ A;  5JLH A;  2YCH A;  3L6Q A;  3A5O C;  4BG9 A;  2CH5 A;  1IJJ A;  4PKG A;  1S22 A;  3KHY A;  4BRD A;  4CZG A;  1ATN A;  4H5V A;  2D0P A;  3HI0 A;  3UKU A;  4BC4 A;  4JNE A;  1DKG D;  2F9W A;  4XH4 A;  4BRI A;  3DAW A;  1ZXO A;  1HKB A;  4CZE A;  4FL9 A;  3ZX3 A;  4K43 A;  3GG4 A;  4CZF A;  1HLU A;  1NBW A;  3R9P A;  3WXI A;  3ZET A;  4CZK A;  1ZC6 A;  2A5X A;  2FF6 A;  3U9Z A;  1ATS A;  1D4X A;  4MLE A;  4RWT A;  3VER A;  1DGK N;  3A0I X;  1X3N A;  4BQZ A;  2Q36 A;  4PL8 A;  1RFQ A;  4IJA A;  3FGU A;  3QBX A;  3BUZ B;  2PAV A;  4EIA A;  1HUX A;  1HX1 A;  3VEZ A;  3IUC A;  5B8H A;  4IWV A;  1HKC A;  5AZJ A;  4CBU A;  3C7N B;  1NM1 A;  4RCH A;  3ENO A;  4ISF A;  5LJV A;  5AQI A;  4MO4 A;  5FPN A;  1XC3 A;  3MN5 A;  2GEL A;  3WXL A;  2V51 B;  3VEV A;  3BF1 A;  2Q31 A;  2NZT A;  1KAX A;  3GBT A;  1QZ5 A;  1BDG A;  3B8A X;  2FLO A;  3G25 A;  2IVN A;  4JN4 A;  5EXW A;  5F0X A;  2CGJ A;  4B1U B;  1DEJ A;  1NGG A;  3MK6 A;  1NLV A;  2E2Q A;  4NO7 A;  5BRF A;  1NGC A;  2YHX A;  5BPL A;  4GNI A;  5AQN A;  1CZA N;  5AZI B;  3ULE A;  1MWK A;  1TUU A;  2ZWH A;  3EKU A;  3L4I A;  3VEO A;  2V7Y A;  2H3G X;  4HWI A;  4BRA A;  4B1W B;  1K8K A;  4QS7 A;  4CZJ A;  3A5L C;  5I9E B;  4M7Y A;  3UKU B;  2P9U A;  4B9Q A;  3FZL A;  3ZEU B;  3O4W A;  4M63 C;  4BC3 A;  1BOT O;  5AQS A;  3O5B A;  4FWS A;  4BC2 A;  4B1Y B;  4BGA A;  4AM7 A;  4DCH A;  4BR9 A;  1G99 A;  3ZET B;  3MN9 A;  1QZ6 A;  3O1B A;  3EO3 A;  4KBO A;  1ZBS A;  2OAN A;  3HM8 A;  3UE5 A;  3VEY A;  3O08 A;  5AQZ A;  2GTD A;  1R59 O;  4H0Y B;  2E1Y A;  4FOE A;  5AFU A;  2QWO A;  1MDU B;  4PL7 A;  3LM9 A;  2A41 A;  2QWN A;  2YJE A;  1TYQ B;  1T6C A;  4BR2 A;  4FO0 A;  1BG3 A;  1HPM A;  5AZJ B;  5ELZ A;  2WUS A;  2BTF A;  4K41 A;  3KZB A;  4JHD A;  2GWK A;  3FZK A;  1Z6R A;  1GLA G;  2J4R A;  4FWN A;  1YAG A;  3CI5 A;  5EVZ A;  4BRO A;  2I7P A;  3DWL A;  4CI6 A;  5BR9 A;  5F2R A;  3QFU A;  1BA0 A;  2A3Z A;  4M7X A;  3S41 A;  3A5M C;  4QS9 A;  1C0G A;  4RTF D;  3VGM A;  2QWR A;  2Q0R A;  3R8E A;  1QQN A;  1RDW X;  3H45 C;  3ZX2 A;  4BRN A;  5JLF A;  4BRL A;  3I33 A;  3ZEU A;  4FWO A;  5AQU A;  4BVP A;  4BRE A;  2CGL A;  2GWJ A;  3FZF A;  3CET A;  2YJF A;  3HZ6 A;  3LDQ A;  3CQY A;  2ZF5 O;  4H0X B;  5JIC A;  5BPM A;  4BR5 A;  3ULE B;  4H5R A;  1NGH A;  1S3X A;  5AQQ A;  1NGE A;  2D0O A;  2Q0U A;  4EAH D;  1JCF A;  5EY4 A;  2PBD A;  4JD2 B;  3BP8 A;  1K8K B;  2IVP A;  4LC9 B;  4BQL A;  2HF4 A;  3KVG A;  3HTV A;  3ZX0 A;  4Z94 A;  3UB5 A;  2P9U B;  4BVO A;  1Z05 A;  3QIC A;  3H6E A;  1KAZ A;  5TKY A;  2A42 A;  2UYT A;  3FR0 A;  1TYQ A;  3LDL A;  1QHA A;  3CJA A;  5BN9 A;  2P9N A;  1EQY A;  3FE1 A;  2ITM A;  2IIR A;  3EN9 A;  4O8K A;  5AQM A;  5CE3 A;  2P9K A;  2QM1 A;  4BR0 A;  2F9T A;  3MCP A;  3H1Q A;  1GLF O;  3W0L A;  2E20 A;  2YHW A;  3IMX A;  4I6M B;  1V4S A;  2QW9 A;  5AQJ A;  4CBX A;  2AA4 A;  4YDU A;  4DHY A;  2V52 B;  1QQM A;  3CJ7 A;  2CGK A;  4BRF A;  3WUH A;  1NGD A;  4PKH A;  3W3D A;  2P9I B;  4JHD B;  5EOY A;  2AP1 A;  4A2A A;  2W41 A;  3IFR A;  4XH5 A;  2HOE A;  4ISE A;  4IJN A;  3VEN A;  1Y64 A;  5AQW A;  2EWS A;  4BRP A;  2Q1N A;  4K42 A;  3M3Z A;  3U9D A;  2ZGZ A;  3CQX A;  3P4I A;  4JD2 A;  4JAX A;  4CZH A;  1E4F T;  2DPN A; 
#chains in the Genus database with same CATH topology
 2YKN A;  4EFH A;  4H0V B;  3THW A;  4J8F A;  3CIP A;  4OPA A;  3BEX A;  5DM6 L;  4FJG A;  3OBW A;  4Y0W A;  5KPR A;  2BGG A;  4IO8 A;  4QS8 A;  1RDU A;  3O4Q A;  4W5T A;  3QEP A;  1LW0 A;  5AQK A;  2VCP A;  4EZ9 A;  3DXM A;  4DQR A;  3FLC O;  4GVE A;  3ZT0 A;  4AM6 A;  3CCL N;  2RE2 A;  1NJY A;  3VQE A;  1BWF O;  4UY8 O;  2GUP A;  2O4G A;  2O8B A;  4FWP A;  2FSJ A;  3C94 A;  2P9N B;  1ITG A;  1RDC A;  3FZM A;  5BRD A;  3EZW A;  1J5E K;  1WLJ A;  1Z26 A;  3HBT A;  5LY3 A;  2FSN A;  4CJ3 A;  3J80 O;  3NGY A;  3MCA B;  4YHH K;  4FWK A;  3A5N C;  3OYB A;  3P31 A;  1T6D A;  2G8H A;  2OZS A;  1Q8I A;  2G8K A;  5KGW A;  3QO9 A;  3F5T A;  1VQO N;  3K5L A;  5F1X A;  3HVR A;  3UKR A;  5EX5 A;  2P9P B;  2EHG A;  4JKF A;  2NRH A;  4FW1 A;  1HQE A;  4WYB A;  1TUY A;  2HNY A;  4DTM A;  3HP9 A;  3KKR A;  3FFK B;  5AQL A;  4KRE A;  4IDK A;  1TVR A;  1OH8 A;  1N36 K;  4H0O A;  3HVT A;  2HF3 A;  3TSQ A;  2E2O A;  3LDO A;  4H5N A;  3ZSW A;  4NCG A;  3GL1 A;  3HYF A;  2ZJP L;  5HRR A;  3CFR A;  1NWK A;  2O8D A;  3V9S A;  2IVO A;  3OY9 A;  3BGR A;  2QI2 A;  3ID8 A;  3H3O B;  5GIN A;  1YIT N;  4RW7 A;  3P5J A;  3L0Q A;  3V1Q A;  5J2M A;  3NH1 A;  1U47 A;  4WCE L;  3QIO A;  4DB3 A;  3T1H K;  4GV9 A;  3AY9 A;  3DXK B;  3WQU A;  2P5G A;  4W5R A;  5AQF A;  4HVJ A;  4OJR A;  1NOY A;  1GLB G;  4FWR A;  1NGA A;  5AQP A;  5AQY A;  4CEQ A;  1SL2 A;  1HYZ A;  1NKE A;  4IG3 A;  2E8A A;  3GDQ A;  3T1A A;  3KKS A;  1DTQ A;  4MDB A;  4EHT A;  2P9P A;  5KTQ A;  3LDN A;  1T44 A;  3SK3 A;  1GLE G;  3LL3 A;  3V9U A;  5KGX A;  4M3U A;  1S6P A;  2GBZ A;  3AVK A;  4CHO A;  4G9Z A;  3SQ1 A;  4BR7 A;  1T7P A;  1JCG A;  4KHQ A;  4PKI A;  4FZZ A;  4WQ5 A;  2GX9 A;  3L8B A;  1QQO A;  3LP1 A;  4A61 A;  3VGL A;  3RTV A;  2E4L A;  3QEV A;  3TAF A;  5I42 A;  3QB0 A;  1BUP A;  3THX B;  3OS2 A;  1LWF A;  4IG0 A;  4Z4I A;  2ASP A;  2OTL N;  1BA1 A;  1A5V A;  1GOC A;  3C7N A;  5AFU H;  5T7B A;  4YOV A;  2Q97 A;  4LFA K;  1GLL O;  4O0J A;  1HJO A;  1K73 O;  3OS1 A;  2E1Z A;  3F2K A;  3BZC A;  2E6M A;  3R6M A;  2OYQ A;  4FM0 A;  3SMS A;  2HMP A;  3ASM A;  1EX4 A;  3WEE B;  4JI0 K;  4M3Z A;  1U4B A;  3DLH A;  3U8X A;  4CED A;  4E7L A;  2QWP A;  3NHG A;  5JVH L;  1EWQ A;  4AF1 A;  5BN8 A;  1N34 K;  2FXU A;  1J9A A;  3MX2 A;  4YOW A;  2Z1J A;  3ENH A;  3H3N O;  1NMD A;  2IAJ A;  4OPH A;  1YJ9 N;  4O5F A;  5HRS A;  3KLI A;  1I3A A;  4CHY A;  2FBX A;  1Q9Y A;  4BG9 A;  3QEW A;  4Z4C A;  3K9K A;  3F9K A;  3VQA A;  1IJJ A;  1G15 A;  4PKG A;  1WSI A;  4O5B A;  5HRP A;  2W6L A;  2FBV A;  3THX A;  3LWM A;  3LAK A;  1DKG D;  2F9W A;  1QTM A;  2XO7 A;  3DAW A;  1HKB A;  2DFF A;  4ZTF A;  4CZF A;  1BHL A;  4R79 A;  2NUB A;  4F4K A;  2VG5 A;  4CZK A;  1IKY A;  3N4P A;  1ZC6 A;  2A5X A;  2FF6 A;  3U9Z A;  4F2S A;  4DSL A;  3U3Y A;  1FK9 A;  1HMV A;  1I39 A;  4C8M A;  3KLF A;  1O13 A;  2UUB K;  4BQZ A;  4DTU A;  2Q36 A;  1IKV A;  3LAL A;  1RFQ A;  4FJK A;  3FGU A;  4LSN A;  1NJW A;  4IWV A;  5AZJ A;  1Y97 A;  4LH4 A;  4FLU A;  4I9Q A;  3ENO A;  3E9P A;  3NF9 A;  1XC9 A;  5AQI A;  5FPN A;  4RW6 A;  3WXL A;  3BY5 A;  2D0C A;  2Q31 A;  3LWL A;  1QZ5 A;  3CFO A;  2NRZ A;  1BDG A;  4FJI A;  5C0Y A;  3RVC A;  2JGU A;  4LY7 A;  3G25 A;  4DSE A;  2EX3 A;  3AA2 A;  1DEJ A;  3MK6 A;  1VQP N;  1NLV A;  2E2Q A;  3HL8 A;  3T7Z A;  4OLB A;  3TTC A;  4B3S K;  1VQ9 N;  2KFN A;  5DMR A;  5AZI B;  1P90 A;  5JVG L;  1XNR K;  1WN7 A;  3EE8 A;  2QEX N;  1MWK A;  3V6D A;  2ZWH A;  3L4I A;  3VMF B;  4B3O A;  4CIF A;  4YY3 K;  2ETJ A;  1RT4 A;  3A5L C;  3L2Q A;  5D3G A;  5J1E A;  2P9U A;  3DRP A;  4BE1 A;  2BH1 A;  1VHX A;  3O4W A;  3QEX A;  5AQS A;  3O5B A;  2VWJ A;  1R0A A;  4CJT A;  4FWS A;  1KFS A;  3BZK A;  1G99 A;  3L4Q A;  3MN9 A;  3O1B A;  3LAM A;  1S9G A;  1WNS A;  1DT9 A;  4HCC A;  3HM8 A;  3JSM A;  5IWA K;  1VSH A;  4CFC A;  1R59 O;  4H0Y B;  3HXM A;  3THY B;  3RR7 A;  1QHT A;  2G8U A;  2O8F A;  1IH7 A;  3F73 A;  1C1B A;  4DTN A;  1Q7Y O;  2IGI A;  1TYQ B;  1YTA A;  3KK1 A;  2WUS A;  4U67 L;  1OVY A;  1IV0 A;  1GLA G;  4NCA A;  4IEI A;  2I7P A;  3KWI A;  5BR9 A;  5F2R A;  4NYF A;  1BA0 A;  3AVM A;  2A3Z A;  3S41 A;  1LWE A;  3A5M C;  4DF8 A;  1C6V A;  2Q0R A;  5MLC Q;  4OGE A;  3ZSZ A;  4DU4 A;  2QK9 A;  2E5L K;  4J2B A;  1JLF A;  1HNV A;  1KFD A;  4FWO A;  4FLZ A;  3TI0 A;  1T8E A;  5AQU A;  3KLH A;  4BVP A;  5SWM A;  3HM9 A;  1HQU A;  4DR6 K;  3K5O A;  3LDQ A;  4AQY K;  3CCU N;  3V9W A;  3ULE B;  4H5R A;  1JXB A;  3NH2 A;  2D0O A;  1JCF A;  3DYA A;  2PBD A;  5GAE P;  3DLE A;  2IVP A;  4JKG B;  4DS5 A;  3ZT1 A;  3QIC A;  4DU1 A;  4E7K A;  4C8O A;  4IOC L;  4LFB K;  3NVM A;  2UYT A;  2OTJ N;  1TYQ A;  1BIZ A;  1X9M A;  5BN9 A;  1EQY A;  1UAX A;  2F7T A;  1VSJ A;  3CCQ N;  3FE1 A;  1BGX T;  2ITM A;  4YOY A;  3EE9 A;  1BQN A;  3V9X A;  3SCX A;  3EN9 A;  4W5Q A;  4M42 A;  4BR0 A;  2F9T A;  3G4S N;  2UXB K;  1TL3 A;  3L2V A;  4I6M B;  1NK4 A;  4FW2 A;  2X74 A;  1D8Y A;  4DTJ A;  4CGF A;  5E41 A;  3RRG A;  2HVI A;  4OO1 J;  5FRO A;  3ZSV A;  3HP6 A;  3K2P A;  4PKH A;  2P9I B;  2AP1 A;  2W41 A;  1HYV A;  4ISE A;  5AQW A;  4ID1 A;  3M3Z A;  4QAG A;  1S72 N;  4JAX A;  3OYJ A;  4CHP A;  4J2A A;  5AJ3 K;  1E4F T;  2HHH K;  4IFE A;  4F2R A;  4DTP A;  1RT5 A;  1YT3 A;  4V19 S;  2P9L A;  1NGB A;  3PIO L;  1QSY A;  1VSL A;  1B9D A;  3CJB A;  4KTW A;  3JYT A;  1U2V B;  3O9Q A;  3CCR N;  5BRE A;  4A62 A;  3WXK A;  4C1N K;  4L3Q A;  3OYE A;  3TTF A;  4JV5 K;  3VEX A;  1Q81 O;  4I6M A;  4JKH A;  3OYH A;  4DUZ K;  4LF7 K;  5ADX H;  3GOI A;  5M1O A;  5AQX A;  4KHP K;  3CC4 N;  3O8M A;  4J2E A;  3SLC A;  1MA9 B;  4WQ4 C;  4B3M K;  3MN7 A;  2P9I A;  2G8F A;  2NLX A;  2G8I A;  2D5R A;  3AVC A;  3RSE A;  4FOI A;  4MO5 A;  1ATR A;  3MEG A;  3VA3 A;  3O6W A;  4NB4 A;  3PLA A;  1X3M A;  4FM2 A;  4CK2 A;  3CER A;  4KKO A;  5M1P A;  1GLC G;  1KLN A;  4ILG B;  4KFB A;  4ISG A;  3A8Y A;  2D0B A;  4B1V A;  2V7Z A;  3VQP A;  3VPZ A;  3K5M A;  3PY8 A;  1WB9 A;  3VOV A;  2GEM A;  4CFB A;  4E89 A;  4GV3 A;  4LH5 A;  1KAY A;  2OPQ A;  3RMD A;  1U2V A;  2NRR A;  3E9L A;  3AVJ A;  3J8A A;  4CK3 A;  1D9D A;  4B9L A;  2Q3S A;  3THW B;  2HND A;  3R1X A;  1EO1 A;  2VGN A;  2RF2 A;  4CJ5 A;  1JLQ A;  1VQ6 N;  3BF3 A;  2O4I A;  1CZ9 A;  1RT6 A;  1E3M A;  1IG9 A;  2GUI A;  2GV9 A;  2IOC A;  3ATU A;  1UOC A;  4Z4E A;  3JAM O;  3EL2 A;  1T05 A;  5HP1 A;  3OHR A;  4OLA A;  3QNN A;  3AVI A;  3JS6 A;  3DXM B;  3VES A;  1GLD G;  1W97 L;  4CZI A;  2O8B B;  1JKH A;  5GAH P;  1EXQ A;  2A1S A;  3LDP A;  1JXE A;  1RTH A;  3IKM A;  4FYD A;  3CJC A;  3H08 A;  3IDH A;  3DOL A;  2HBM A;  3KJV A;  5AQG A;  1S9E A;  1NK5 A;  3MDQ A;  4C23 A;  4DV4 K;  3QFP A;  2A1R A;  3TAG A;  2ASM A;  1C0U A;  1OH5 A;  4CD1 A;  5KQD A;  4E1M A;  1GOB A;  5BRH A;  2PYL A;  4M3Y A;  4Y1D A;  3ZSR A;  2XHB A;  4EHU A;  3U3G A;  3LZJ A;  3UKR B;  1KRP A;  5C12 A;  4DLE A;  4BRC A;  5CHI A;  4E0D A;  3OYD A;  5AQT A;  3QES A;  1YHQ N;  1H1V A;  2KKZ A;  4OKK A;  4NXM K;  1HRH A;  1VSD A;  4BR4 A;  1YUW A;  1KQS M;  2WOM A;  4A59 A;  4BRM A;  4AHT A;  1ASV A;  4B8A B;  4KI4 A;  1YXQ A;  1HKG A;  3RMB A;  4FWQ A;  2XY6 A;  4FCY A;  2CH6 A;  4YOT A;  1TGO A;  2O8D B;  2E88 A;  4OPJ A;  4CEF A;  3WQT A;  1WBB A;  1VQ8 N;  1BIU A;  4CF0 A;  1JCE A;  3WXJ A;  3J7Y P;  4BWM A;  4JI3 K;  1WUA A;  5FPM A;  4IKF A;  1X9W A;  4KRF A;  1NGF A;  3VQ5 A;  1ASW A;  3CM6 A;  5KPT A;  2BUP A;  4E7J A;  2XY8 A;  3MMV A;  4BRH A;  1RTD A;  4GY2 B;  2Z1G A;  1GOA A;  2F4V K;  4NYN A;  5E26 A;  1NJX A;  3D45 A;  4ZHR A;  3VQ7 A;  1BQM A;  3KD5 E;  2OPR A;  2C1I A;  1SAZ A;  1C1A A;  3EEQ A;  4DSJ A;  2HST A;  4KHW A;  3A5O C;  2CH5 A;  3WNH A;  1TKD A;  3PV8 A;  4CZG A;  4H5V A;  3UKU A;  4N56 A;  4BC4 A;  3WXM B;  4DQS A;  4O4G A;  4XH4 A;  4BRI A;  4GW6 A;  5C24 A;  1IKW A;  3AA3 A;  4CZE A;  1TK8 A;  3ZX3 A;  4K43 A;  1Q86 O;  3GG4 A;  1S6Q A;  3WXI A;  3PO5 A;  4DQI A;  3NF8 A;  4A57 A;  1D4X A;  4MLE A;  1TKZ A;  2YHA A;  4RWT A;  3KLE A;  1NMN A;  1SV5 A;  3VER A;  1X3N A;  4LD0 A;  4PL8 A;  1HNW K;  3QBX A;  4M45 A;  4PHT X;  2PAV A;  4GVM A;  4EIA A;  2O8E B;  4CIE A;  4DFJ A;  4DUY K;  1RBT A;  4DV7 K;  1HKC A;  3C7N B;  1NM1 A;  4RCH A;  3E1Y A;  4KH6 A;  4CVN E;  5LJV A;  3MN5 A;  1RBV A;  3VA0 A;  3SAG A;  2WTU A;  3GBT A;  3K0S A;  3SPY A;  2W42 A;  4B08 A;  2P5O A;  2XY5 A;  1QVG M;  1NK8 A;  4GV6 A;  4CJ4 A;  4KHN A;  3M8Q A;  4BEB A;  1CZA N;  3QIP A;  4FJL A;  4YOU A;  4Q0B A;  4U7B A;  4FK4 A;  2V7Y A;  2H3G X;  1EET A;  1ILY A;  1W9H A;  4QS7 A;  5I9E B;  4M7Y A;  1HJR A;  1TAQ A;  4DR1 K;  3QIN A;  4CES A;  4BC3 A;  3QEI A;  1BOT O;  4FJM A;  2O8E A;  3LPU A;  3THV A;  4PA1 A;  1W2B M;  1RT7 A;  2IDO A;  4DCH A;  3I8D A;  4BR9 A;  2X6N A;  3AA4 A;  3UE5 A;  3LAN A;  3LP2 A;  1S1V A;  1YJW N;  4PUO A;  2E1Y A;  5BR8 K;  3AO3 A;  3OJU A;  4BE2 A;  3NGZ A;  3TAB A;  2JWK A;  5AFU A;  4KO0 A;  4PL7 A;  1ZBF A;  1HYS A;  3CCE N;  1QQC A;  2A41 A;  3SAF A;  3SUO A;  1T6C A;  4FLT A;  4I2P A;  3OYG A;  4M3X A;  4FO0 A;  1HPM A;  5AZJ B;  2BTF A;  2GWK A;  1REV A;  4CEE A;  1IBL K;  2J4R A;  1YAG A;  3DWL A;  4CI6 A;  4FJ7 A;  4C8N A;  1O1W A;  1BL3 A;  1JLB A;  4CIG A;  3NCI A;  1WAJ A;  3PSF A;  3VGM A;  3KLG A;  3O4N A;  4HTU A;  4DF4 A;  5EU7 A;  1QQN A;  2FBT A;  1RDW X;  1FKP A;  3H45 C;  5KRS A;  3ZX2 A;  1TK0 A;  3KK3 A;  4WE1 A;  3S5T A;  3M8S A;  4DFP A;  1BCM A;  3V81 A;  4EP5 A;  3O9U A;  4Y1C A;  2GWJ A;  3FZF A;  3ZLJ A;  1RBU A;  3TWH A;  2YJF A;  5I3U A;  4PQU A;  5C42 A;  2VG6 A;  5CZ2 A;  3K5N A;  1M1K O;  2AJQ A;  4E3S A;  4MFB A;  1NGE A;  4DV5 K;  2Q0U A;  4FJH A;  4EAH D;  1M90 O;  5EY4 A;  4JD2 B;  4LC9 B;  2HF4 A;  1C1C A;  4XIU A;  2HHI A;  4CF1 A;  3E66 A;  4H8K A;  2P9U B;  3H6E A;  5TKY A;  4AHC A;  2F8T A;  1IBK K;  3CJA A;  3HPO A;  4IOA L;  2IIR A;  2PYJ A;  3S3O A;  2VG7 A;  5CE3 A;  2P9K A;  3MCP A;  4BWJ A;  2YHW A;  2PZS A;  3IMX A;  4JI7 K;  1V4S A;  1NK7 A;  4X64 K;  2O8F B;  3PX0 A;  5AQJ A;  4CBX A;  4OGC A;  3ZT4 A;  2AA4 A;  4WFN L;  4CJQ A;  1QQM A;  2CGK A;  2C1G A;  5GIP A;  2NRX A;  1NJI O;  5EOY A;  4XH5 A;  4DV2 K;  3VQD A;  2HOE A;  3VEN A;  2EWS A;  4BRP A;  4BE0 A;  4K42 A;  4FM1 A;  3U9D A;  4JD2 A;  4A5B A;  4Z0U A;  4DS4 A;  4CF2 A;  4WQ5 C;  2D1K A;  2HBK A;  4CCH A;  2YI1 A;  3CFP A;  4CHN A;  3OYI A;  3SBG A;  4KHY A;  3AGK A;  2VQF K;  1DLO A;  1VQ5 N;  4KAZ A;  3D2E B;  3CJ9 A;  3C95 A;  3TAR A;  3LZI A;  5HRO A;  2OCE A;  5AQR A;  4FLW A;  1C0F A;  1CXQ A;  4LF6 K;  1SZ2 A;  4BGB A;  4Z4H A;  1VSF A;  1RT1 A;  2WBN A;  2YX6 A;  4C8L A;  4FWL A;  3SAH A;  4MDA A;  3ZCM A;  1YJN N;  3TAE A;  3TPQ A;  1KSP A;  5LMU K;  1U6Z A;  3PSI A;  2YHB A;  3QBW A;  1JL1 A;  4F8R A;  1J54 A;  4H0P A;  1NG9 A;  2OZM A;  2ZGY A;  3E01 A;  2BDP A;  1SL1 A;  3B6O A;  3CCJ N;  1RBR A;  2HHS A;  2HMI A;  1F21 A;  1BCO A;  2KLA A;  4N41 A;  3AAP A;  5AR0 A;  4CZM A;  3WNF A;  1SKS A;  4FLV A;  2NNW A;  3U4L A;  3D2E A;  4RG8 A;  3I56 N;  3PX4 A;  3H46 O;  1A5X A;  2HHU A;  2YV0 X;  1LCU A;  4FJ5 A;  2OA8 A;  4CZL A;  4BDP A;  3CC2 N;  4BRK A;  4B9T A;  1S1W A;  1KCF A;  4H0T B;  4Q5V A;  2WC9 A;  4FWM A;  1KXP A;  3C0B A;  4H5T A;  4CJF A;  4CHQ A;  4KH5 A;  4HUF A;  1NGJ A;  4XJX A;  2P9L B;  1NGI A;  1SQK A;  3OYN A;  3O1W A;  1JLA A;  4O55 A;  3K59 A;  2VWK A;  4JS5 A;  2IC3 A;  1U04 A;  3AVB A;  5LL6 Z;  4DR4 K;  1XQS C;  4ZTJ A;  1BU6 O;  3AAQ A;  4J2D A;  5FRN A;  4CEZ A;  4LSL A;  3E9O A;  3M1F A;  4XEI A;  5C2D A;  5KQ8 A;  4DV6 K;  3AA5 X;  3AO2 A;  4CGH A;  2YNI A;  2YHY A;  3IS9 A;  5JS1 A;  3RSE B;  3LPT A;  3HOS A;  2A6A A;  2Z1I A;  5JEN A;  3AVA A;  4GMJ B;  1ZBU A;  3I0S A;  2QXL A;  4BG8 A;  1J53 A;  2X6S A;  1L3S A;  3F9M A;  1V4T A;  4JKC A;  1EWR A;  2LSN A;  3TU5 A;  4BRG A;  1RGI A;  4DR5 K;  5JS2 A;  3MEE A;  4FLX A;  3VF6 A;  1SKR A;  2P9S B;  4DQQ A;  5M1K A;  3ENB A;  1VAZ A;  3L2U A;  4IDH A;  1KC8 O;  2Y1I A;  3HK2 A;  4FJJ A;  2DFH A;  2PY5 A;  2KFZ A;  1WSH A;  3HPG A;  5K14 A;  1YVN A;  4K25 A;  1N32 K;  3ZT3 A;  4OPK A;  4E7H A;  4AH9 A;  1RCH A;  4H5W A;  3ZSO A;  3CQ8 A;  3DRS A;  3L2R A;  4CJW A;  1BI4 A;  2NRW A;  5CZ1 A;  4CJ7 A;  1LWC A;  1Q18 A;  4DQ8 A;  4H4M A;  4IZ9 A;  1XUP O;  3WT0 A;  1VQ7 N;  2X78 A;  4DWI A;  4CFD A;  1WOQ A;  3AVG A;  3C6H A;  4N76 A;  3DOK A;  4L8R B;  3SV3 A;  4JRP A;  3P1G A;  1ESV A;  3RWU A;  4FK2 A;  5ADX A;  2W00 A;  4TSX A;  3TSU A;  5J2Q A;  2ASO A;  4R5P A;  4F9O A;  1ZYQ A;  1VSK A;  3SNN A;  3IAY A;  4IXC A;  4DMN A;  3MEC A;  4DV1 K;  4H4O A;  5JMV A;  1IKX A;  3QDK A;  2QWL A;  2E2N A;  3H1V X;  3SJH A;  3MXM A;  4DTS A;  4LFC K;  5E84 A;  4AIL C;  2P9S A;  4FSV A;  3VEW A;  5BPN A;  4CBW A;  3UIQ A;  3VET A;  3OYA A;  4BE7 B;  5JLH A;  2YCH A;  3SUN A;  1VQL N;  1JJ2 M;  2RHK A;  3KHY A;  3MWP A;  1ATN A;  4N47 A;  5M1N A;  3T1Y K;  3HI0 A;  4YNQ A;  3OYM A;  5C25 A;  4JNE A;  3P83 D;  1RTI A;  3C6T A;  4E19 A;  2F96 A;  3LP0 A;  3S9H A;  1HLU A;  1NBW A;  3G0Z A;  3HRG A;  3R9P A;  4M3T A;  3ZET A;  1SL0 A;  4ELV A;  4O44 A;  1NU0 A;  4E7I A;  5H1S Q;  3KTQ A;  2JWL A;  4IFY A;  2OPS A;  3ZYY X;  4DR2 K;  3NF7 A;  3PX6 A;  3QER A;  4DV0 K;  3BUZ B;  1W0H A;  1EKE A;  1VSE A;  1WSJ A;  3V1O A;  2HHW A;  2BAN A;  5CR4 A;  1HX1 A;  1X9S A;  3VEZ A;  3IUC A;  4DSK A;  1LW2 A;  4G1Q A;  5B8H A;  4CBU A;  1S5J A;  3A2F A;  1KLM A;  3TAM A;  4DFK A;  1XWL A;  3VQB A;  4ISF A;  1C0M A;  4X66 K;  4B9M A;  1XC3 A;  1XHZ A;  2FBY A;  2GEL A;  4KTQ A;  3CM5 A;  3AVL A;  1NKB A;  3R3L A;  2V51 B;  3BF1 A;  3CCS N;  1A5W A;  4CGD A;  2NZT A;  3J81 O;  1QVF M;  3OTO K;  4DQP A;  4NLB A;  4W5O A;  1ZBH A;  4X65 K;  2FLO A;  2IVN A;  4JN4 A;  3CME N;  3OS0 A;  2CGJ A;  2D0A A;  4B1U B;  3VQQ A;  1NGG A;  1N5Y A;  4NO7 A;  5BRF A;  3DLK A;  2YHX A;  2NRT A;  4GNI A;  3CCV N;  4DG1 A;  5AQN A;  4CE9 A;  2WON A;  4CGG A;  1RIL A;  2QA4 N;  3HPH A;  4KV8 A;  1TUU A;  4A5A A;  4BRA A;  4HWI A;  1K8K A;  3SQ0 A;  4OKE A;  4CZJ A;  1MU2 A;  1Q82 O;  3UKU B;  3NMU A;  4F3T A;  2UXD K;  3ZEU B;  4M63 C;  1L3V A;  1U49 A;  2ZE2 A;  2YNF A;  4CFA A;  3CMA N;  3MXI A;  4BC2 A;  2YNG A;  2P1J A;  3VQ8 A;  4B1Y B;  4BGA A;  1QZ6 A;  4CJU A;  3OYL A;  1C0T A;  3ID6 A;  3EZ5 A;  1ZBS A;  3VEY A;  3O08 A;  4AHS A;  5AQZ A;  2GTD A;  3M5R A;  5SZT A;  4B9U A;  4M41 A;  4CJE A;  4FOE A;  3AO5 A;  2QWO A;  1MDU B;  4CGJ A;  4QOZ B;  4JKE A;  3DLB A;  2ZQB A;  2QWN A;  4CEC A;  4BR2 A;  2ZJR L;  4ELU A;  3P39 A;  1NK6 A;  1BG3 A;  3KWG A;  4K41 A;  3KZB A;  3VN5 A;  4JHD A;  3CG7 A;  3PUF A;  5IT9 O;  3OJS A;  4FWN A;  3CI5 A;  4AHR A;  5EVZ A;  1N33 K;  3NF6 A;  4EZ6 A;  1S1U A;  1TK5 A;  4QS9 A;  3O3G A;  1NK0 A;  4RTF D;  1JLG A;  3KK2 A;  2QWR A;  3C6U A;  3CYG A;  3R8E A;  4JRQ A;  3DMJ A;  3AVF A;  1LV5 A;  3CYM A;  4FLY A;  4BRN A;  1HNX K;  5JLF A;  3IRX A;  4BRL A;  1UA0 A;  3I33 A;  3ZEU A;  3SQ2 A;  4B9N A;  3N4Q A;  2NRV A;  5HLF A;  2UUC K;  4NCB A;  4OVL A;  4BRE A;  2CGL A;  2KQ2 A;  2DFE A;  3CET A;  3HZ6 A;  4ILH A;  4CJP A;  3ULD A;  3CQY A;  2ZF5 O;  4H0X B;  1VSI A;  1JLC A;  5J2N A;  1NGH A;  2YNH A;  3K57 A;  4JI5 K;  4JYA K;  4K8X A;  3BP8 A;  2BE2 A;  4BQL A;  3HTV A;  1KTQ A;  4BVO A;  2YKM A;  1Z05 A;  5DK5 A;  2WFB A;  3TSP A;  2A42 A;  2ITG A;  3QET A;  3O9S A;  2P9N A;  3OBY A;  4KPY A;  4O8K A;  2I5J A;  4FJX A;  4FJN A;  2O8C B;  1GLF O;  2E20 A;  5M1F A;  4LF5 K;  2XRI A;  3BDP A;  1DTT A;  3Q7B A;  4YDU A;  3ZSQ A;  4B3R K;  3S3N A;  3AO4 A;  3TR8 A;  4FVU A;  1NGD A;  3W3D A;  4PWD A;  1B92 A;  1VSM A;  4CGI A;  4CJK A;  1Y64 A;  3D0P A;  3NH0 A;  4K0K K;  4BDZ A;  2XY7 A;  1TL1 A;  3CQX A;  4C8K A;  1XNQ K;  3AV9 A;  5CY4 A;  4WFB L;  4LF4 K;  2DPN A;  3RMA A;  4FPA A;  2UXC K;  2VYP A;  1LOT B;  4QCL A;  4FJ8 A;  4RW8 A;  1CXU A;  4B9V A;  2KZM A;  2Q2R A;  3ZT2 A;  4CJL A;  3JXU A;  4I2Q A;  3TTD A;  4Z4G A;  3OYC A;  4Z4F A;  3T19 A;  4I7F A;  1GLJ O;  2O8C A;  3AAR A;  2I7N A;  3LP3 A;  3VF2 A;  4IOX A;  4BDY A;  1NJZ A;  3WNG A;  3CD6 N;  1VQK N;  2HNZ A;  3QLH A;  3VF4 A;  5C2F A;  3DXK A;  4DTX A;  3MXJ A;  1QS4 A;  5KPZ A;  1CLQ A;  4B1Z A;  3D2F B;  3L3U A;  1K8A O;  4W5N A;  4RW9 A;  1J6Z A;  4E1N A;  3K9J A;  3CJ1 A;  4CEB A;  4IO9 L;  4IFV A;  1U48 A;  3RR8 A;  3G6E N;  2FSK A;  5M1Q A;  1D5A A;  1S1X A;  1LAW A;  3QNO A;  3U6F A;  4WF9 L;  2P9K B;  3CHW A;  3KIO A;  4KI6 A;  2VWB A;  3O9T A;  4HTL A;  4E72 A;  3C65 A;  4OKJ A;  4GKK K;  3GE1 A;  4IEE A;  1FW6 A;  2OPP A;  5CYM A;  4FPB A;  2QWM A;  3TAP A;  1XMQ K;  1VQM N;  1TKX A;  1IG8 A;  1FJG K;  2D4W A;  1U45 A;  2RKI A;  2QWQ A;  4NLC A;  5TKW A;  4ILJ A;  4KTZ A;  4CW7 B;  1OKJ A;  2B4J A;  4DSF A;  2QKK A;  3HJF A;  3EYZ A;  4B1X B;  4ICL A;  1NOZ A;  1CZB A;  1WSG A;  3AVH A;  1N8R O;  2JLE A;  1TKT A;  3ZSX A;  2PFU A;  1NNE A;  3I55 N;  3D2F A;  4DSI A;  5HOO A;  4B9S A;  4JEP A;  3ZSY A;  3D7E O;  3SBT A;  1SKW A;  2KZZ A;  1X9J A;  4E1J A;  1KVB A;  3TAN A;  1ZBI A;  3HSC A;  3QML A;  2A40 A;  5LMN K;  4ID5 A;  2P51 A;  4FXD A;  4BEC A;  3ALY A;  2W40 A;  3LDS A;  1X1P A;  4BAC A;  4JI6 K;  4JK8 A;  4H03 B;  4BC5 A;  1RNH A;  1T3V A;  3WEE A;  1E4G T;  1BO5 O;  1VQN N;  1YVU A;  4JI4 K;  4XH1 A;  3DLL L;  4CJR A;  3VQC A;  3CF5 L;  4JK7 A;  5AQO A;  2Z1H A;  2B5J A;  3P38 A;  4BRQ A;  3DJC A;  3CPW M;  2E2P A;  4YDU C;  5FPE A;  1KVA A;  4CK1 A;  3EKS A;  3K58 A;  4JLH A;  3WNE A;  3I8B A;  4MQ3 A;  5HL7 L;  5AQH A;  3LM2 A;  2KHO A;  5HRN A;  3OYK A;  1K6Y A;  4KHU A;  5LJW A;  4A2B A;  4YOX A;  1XMO K;  3NAE A;  1RBS A;  4CD3 A;  3VGK A;  5FRM A;  3SYZ A;  4MLH A;  3AGR A;  5A2Q O;  5FPD A;  1L3U A;  4CJS A;  4O8U A;  3SMP A;  3MN6 A;  1RT3 A;  1VQ4 N;  3ATV A;  4WFA L;  3FFI A;  3SI6 A;  3VQ4 A;  3C6A A;  4KB1 A;  3O80 A;  2ZD1 A;  1P8Z A;  4BY9 C;  5J2P A;  2FF3 B;  3V1R A;  1OVQ A;  2HBJ A;  1HPZ A;  3SQ4 A;  4JK9 A;  4C1N I;  1QSL A;  4WQ4 A;  4JKD A;  1MWM A;  4CHZ A;  3MAQ A;  3M6G A;  1L3T A;  4CF9 A;  5AQV A;  1HNI A;  1XHX A;  3CCM N;  1W7A A;  4X62 K;  4CJV A;  5GAG P;  1XI1 A;  1IBM K;  3NVK A;  1N6Q A;  3FZH A;  5KRT A;  5AZI A;  3G10 A;  1YIJ N;  3VTH A;  1LAV A;  2DY4 A;  1TAU A;  3AVN A;  3DLR A;  3L6Q A;  4FK0 A;  4B3T K;  1KVC A;  4YFU A;  3EY1 A;  3KK7 A;  5C10 A;  3CXC M;  1S22 A;  3HST B;  4BRD A;  4DLG A;  4B8C A;  2D0P A;  4RW4 A;  2QXF A;  3AO1 A;  2VQE K;  1ZXO A;  2QKB A;  3PIP L;  1KD1 O;  4FL9 A;  1SS6 A;  1HNZ K;  3NDK A;  5GIO A;  3J7Z O;  4K8Z A;  1ATS A;  4LF8 K;  3VTI A;  1RDD A;  3PO4 A;  1UWB A;  1OH6 A;  3RRH A;  1DGK N;  3THY A;  3A0I X;  1BI4 B;  3NBP A;  4IJA A;  3DI6 A;  4HHT A;  1FXX A;  3HOT A;  1HUX A;  2HVH A;  2HHV A;  4DTR A;  1NKC A;  5GAD P;  2E6L A;  3VQ6 A;  3VQ9 A;  4JKB A;  4EP4 A;  4PY5 A;  3NGI A;  1QE1 A;  1TV6 A;  3HT3 A;  4JI1 K;  1HR0 K;  4DFM A;  4GKJ K;  4M3R A;  4MO4 A;  3T69 A;  1ZBL A;  1YTU A;  4UQG A;  3VEV A;  1FKO A;  1K9M O;  1KAX A;  2QTD A;  2W6K A;  3B8A X;  3DM2 A;  3M8P A;  1J5O A;  5F0X A;  5EXW A;  2HW3 A;  4FVM A;  1Z25 A;  1T03 A;  1SUQ A;  3B6P A;  1NGC A;  4AHU A;  4CEO A;  5BPL A;  3ULE A;  3DRR A;  3O9R A;  1VRU A;  3D6R A;  3EKU A;  3VEO A;  4HCB A;  4DTO A;  4F3O A;  4B1W B;  1D9F A;  4JKG A;  4JI2 K;  5KI6 A;  1YF5 L;  3TAQ A;  1WBD A;  3IG1 A;  4FJ9 A;  1EP4 A;  4B9Q A;  1RT2 A;  3FZL A;  2ZM6 K;  4KH4 A;  4DKW A;  3MX5 A;  4DR7 K;  4AM7 A;  3V9Z A;  3ZET B;  4KHS A;  3OA9 A;  4ELT A;  4DV3 K;  3OVN A;  3EO3 A;  4KBO A;  1RDA A;  2OAN A;  4FZY A;  2HHQ A;  1VK0 A;  2RN2 A;  4CF8 A;  1IO2 A;  3MWT A;  3LM9 A;  2YJE A;  1S1T A;  1RDB A;  2G8V A;  1BIS A;  5ELZ A;  1WSF A;  1YI2 N;  3FZK A;  1Z6R A;  4O0I A;  4NXN K;  4BRO A;  3I0R A;  1OH7 A;  4M3W A;  2KTQ A;  3QFU A;  4M7X A;  3HO1 A;  3Q7C A;  1C0G A;  3ISN C;  3S3M A;  1WAF A;  3L2W A;  4DU3 A;  3OYF A;  3SUP A;  5DM7 L;  2ZJQ L;  2HHX A;  3G71 N;  4IBN A;  3O3H A;  5JIC A;  5BPM A;  2UUA K;  4BR5 A;  1WSE A;  4CER A;  4JI8 K;  1S3X A;  5AQQ A;  3ITH A;  3V4I A;  3M8R A;  2UU9 K;  5FDL A;  4YOR A;  4HUG A;  5CYQ A;  1K8K B;  3CC7 N;  3KVG A;  4I9L A;  4AHV A;  3ZX0 A;  4Z94 A;  1NK9 A;  3UB5 A;  2IS3 A;  1I94 K;  2F8S A;  3CPE A;  2VGM A;  4CEA A;  2Y1J A;  3DLG A;  1KAZ A;  3FR0 A;  3LDL A;  3KD1 E;  1QHA A;  2KW4 A;  3O3F A;  3SZ2 A;  5HBM A;  4JS4 A;  2HHT A;  3SUQ A;  3T3F A;  1QSS A;  5AQM A;  2QM1 A;  3H1Q A;  3W0L A;  1VRT A;  2G8W A;  2HB5 A;  2QW9 A;  2FC0 A;  2HBL A;  2B6A A;  3RMC A;  3J7A P;  3NE6 A;  4DHY A;  2V52 B;  4OX9 K;  3NFA A;  3CJ7 A;  3OW2 M;  3SV4 A;  4BRF A;  1ASU A;  3WUH A;  3L3V A;  1UA1 A;  4FZX C;  4DR3 K;  4JHD B;  4HUE A;  1JLE A;  3MED A;  4A2A A;  3IFR A;  3SJJ A;  4IJN A;  1L5U A;  1RTJ A;  2Q1N A;  1Q9X A;  2ATQ A;  5FLX O;  2ZGZ A;  2R7Y A;  4LF9 K;  1B9F A;  4JKA A;  3P4I A;  4CZH A;  4N5S A;  3SPZ A;  2DTU A;  2RPI A;  4KB0 A;  5C15 A;  1JL2 A; 
#chains in the Genus database with same CATH homology
 4WQ5 C;  4EFH A;  4H0V B;  2D1K A;  2HBK A;  4J8F A;  4FPA A;  3CIP A;  4IFE A;  2YI1 A;  4OPA A;  3BEX A;  5DM6 L;  2VYP A;  1LOT B;  3OBW A;  4Y0W A;  3SBG A;  5KPR A;  3AGK A;  2Q2R A;  1VQ5 N;  4IO8 A;  3D2E B;  3CJ9 A;  4QS8 A;  3JXU A;  2P9L A;  3TTD A;  1RDU A;  1NGB A;  3PIO L;  3CJB A;  1U2V B;  1GLJ O;  5AQR A;  3O9Q A;  3AAR A;  3CCR N;  2I7N A;  5BRE A;  4A62 A;  5AQK A;  3WXK A;  3VF2 A;  1C0F A;  4L3Q A;  4C1N K;  4IOX A;  2VCP A;  3CD6 N;  3TTF A;  1SZ2 A;  1VQK N;  3VEX A;  1Q81 O;  3VF4 A;  4BGB A;  5C2F A;  3DXM A;  4I6M A;  4JKH A;  3DXK A;  3FLC O;  4GVE A;  2WBN A;  4AM6 A;  3CCL N;  2RE2 A;  5KPZ A;  2YX6 A;  3GOI A;  5ADX H;  4B1Z A;  3D2F B;  5M1O A;  1K8A O;  5AQX A;  1BWF O;  4FWL A;  3CC4 N;  1J6Z A;  4UY8 O;  3O8M A;  3SAH A;  2GUP A;  4MDA A;  1YJN N;  3K9J A;  3CJ1 A;  4FWP A;  2FSJ A;  3TPQ A;  2P9N B;  3SLC A;  4IO9 L;  1MA9 B;  4WQ4 C;  3MN7 A;  1U6Z A;  3G6E N;  2P9I A;  2NLX A;  2FSK A;  5M1Q A;  3FZM A;  3QBW A;  5BRD A;  3EZW A;  3RSE A;  4FOI A;  4WF9 L;  2P9K B;  3CHW A;  4MO5 A;  1ATR A;  3HBT A;  4H0P A;  2VWB A;  3O9T A;  4HTL A;  2ZGY A;  5LY3 A;  2FSN A;  3C65 A;  3O6W A;  3CCJ N;  3MCA B;  3GE1 A;  3A5N C;  4FWK A;  4NB4 A;  3P31 A;  4IEE A;  1T6D A;  1X3M A;  3PLA A;  3CER A;  4FPB A;  2KLA A;  5M1P A;  1GLC G;  3AAP A;  2QWM A;  5AR0 A;  4ILG B;  4CZM A;  4ISG A;  1VQM N;  3A8Y A;  1IG8 A;  3F5T A;  2D4W A;  4B1V A;  2V7Z A;  2NNW A;  1VQO N;  3VPZ A;  3U4L A;  3D2E A;  3VOV A;  5F1X A;  2QWQ A;  4NLC A;  3I56 N;  2GEM A;  3UKR A;  3H46 O;  5EX5 A;  5TKW A;  4ILJ A;  4GV3 A;  1OKJ A;  2P9P B;  1KAY A;  1LCU A;  1U2V A;  2NRR A;  4JKF A;  2NRH A;  3E9L A;  4WYB A;  1TUY A;  4B1X B;  3FFK B;  5AQL A;  3J8A A;  1N8R O;  4CZL A;  3CC2 N;  4H0O A;  2HF3 A;  3TSQ A;  4BRK A;  2PFU A;  3R1X A;  1EO1 A;  2E2O A;  2VGN A;  3LDO A;  4H0T B;  4H5N A;  3I55 N;  2WC9 A;  3D2F A;  4FWM A;  5HOO A;  1VQ6 N;  1KXP A;  3GL1 A;  3BF3 A;  4JEP A;  3C0B A;  3D7E O;  4H5T A;  3SBT A;  2ZJP L;  4KH5 A;  1X9J A;  1NWK A;  4E1J A;  1NGJ A;  4XJX A;  2P9L B;  1NGI A;  1SQK A;  2IVO A;  3ATU A;  3HSC A;  3QML A;  2QI2 A;  3ID8 A;  2A40 A;  3H3O B;  5GIN A;  1YIT N;  3EL2 A;  4BEC A;  3O1W A;  2W40 A;  3OHR A;  3L0Q A;  4JK8 A;  4H03 B;  4BC5 A;  4WCE L;  1T3V A;  4DB3 A;  4GV9 A;  3JS6 A;  1E4G T;  3WEE A;  1BO5 O;  3AY9 A;  3DXM B;  1VQN N;  3DXK B;  3WQU A;  5AQF A;  3VES A;  1GLB G;  1XQS C;  4FWR A;  1BU6 O;  1NGA A;  3AAQ A;  1GLD G;  4XH1 A;  5AQP A;  3DLL L;  1W97 L;  5AQY A;  4CZI A;  3E9O A;  3M1F A;  4XEI A;  5C2D A;  5KQ8 A;  5GAH P;  3CF5 L;  4JK7 A;  5AQO A;  4BRQ A;  2E8A A;  2YHY A;  3LDP A;  3P38 A;  3RSE B;  3HOS A;  3DJC A;  3GDQ A;  3IKM A;  2A6A A;  3CJC A;  2E2P A;  3CPW M;  4YDU C;  3IDH A;  4MDB A;  4EHT A;  5FPE A;  2P9P A;  2HBM A;  2QXL A;  4BG8 A;  3EKS A;  3LDN A;  3F9M A;  1V4T A;  5AQG A;  4JKC A;  1T44 A;  3MDQ A;  4C23 A;  3SK3 A;  3TU5 A;  3I8B A;  1GLE G;  3QFP A;  4BRG A;  1RGI A;  2ASM A;  3LL3 A;  5HL7 L;  5AQH A;  3LM2 A;  4CD1 A;  3VF6 A;  2KHO A;  5KQD A;  4G9Z A;  5BRH A;  2P9S B;  5M1K A;  4BR7 A;  3ENB A;  1VAZ A;  4IDH A;  1JCG A;  4A2B A;  5LJW A;  4YOX A;  4PKI A;  4WQ5 A;  1KC8 O;  2GX9 A;  4EHU A;  3UKR B;  4CD3 A;  3VGK A;  5C12 A;  1QQO A;  4BRC A;  5CHI A;  4A61 A;  5AQT A;  4MLH A;  1YVN A;  3AGR A;  3VGL A;  1YHQ N;  1H1V A;  2KKZ A;  4K25 A;  5FPD A;  4H5W A;  4BR4 A;  4O8U A;  1YUW A;  2NRW A;  3QB0 A;  1BUP A;  3SMP A;  4CJ7 A;  1KQS M;  3MN6 A;  1Q18 A;  4DQ8 A;  1VQ4 N;  4IZ9 A;  3ATV A;  4A59 A;  4BRM A;  4WFA L;  1XUP O;  3WT0 A;  2ASP A;  3C6A A;  1VQ7 N;  2OTL N;  1BA1 A;  1YXQ A;  1HKG A;  3O80 A;  4FWQ A;  3C7N A;  1P8Z A;  1WOQ A;  2CH6 A;  5AFU H;  4YOT A;  4YOV A;  4BY9 C;  2E88 A;  2FF3 B;  2Q97 A;  3C6H A;  2HBJ A;  3WQT A;  1VQ8 N;  4JK9 A;  1GLL O;  1K73 O;  1HJO A;  1ESV A;  2E1Z A;  3F2K A;  1JCE A;  4C1N I;  5ADX A;  3WXJ A;  2W00 A;  3R6M A;  3TSU A;  3SMS A;  1WUA A;  4WQ4 A;  2HMP A;  2ASO A;  4JKD A;  1MWM A;  5FPM A;  4F9O A;  3M6G A;  1NGF A;  3WEE B;  5AQV A;  4IXC A;  5KPT A;  3U8X A;  2BUP A;  5JMV A;  3QDK A;  2QWL A;  2E2N A;  2QWP A;  3H1V X;  5JVH L;  3SJH A;  3MMV A;  4AF1 A;  4BRH A;  3CCM N;  5E84 A;  4GY2 B;  5BN8 A;  2P9S A;  4FSV A;  3VEW A;  5GAG P;  5BPN A;  3NVK A;  2FXU A;  5E26 A;  3FZH A;  4CBW A;  3MX2 A;  3VET A;  4YOW A;  3ENH A;  3H3N O;  5AZI A;  1NMD A;  4BE7 B;  4OPH A;  3VTH A;  4O5F A;  1YIJ N;  1YJ9 N;  1SAZ A;  2C1I A;  5JLH A;  2YCH A;  3L6Q A;  2HST A;  3A5O C;  4BG9 A;  1VQL N;  3K9K A;  2CH5 A;  1JJ2 M;  1IJJ A;  4PKG A;  3KK7 A;  5C10 A;  3CXC M;  1S22 A;  2RHK A;  3KHY A;  3MWP A;  4BRD A;  4CZG A;  1ATN A;  4H5V A;  2D0P A;  3HI0 A;  5M1N A;  3UKU A;  4BC4 A;  4JNE A;  3WXM B;  1DKG D;  2F9W A;  4XH4 A;  4BRI A;  3DAW A;  1ZXO A;  3PIP L;  1HKB A;  4CZE A;  4FL9 A;  1KD1 O;  3ZX3 A;  4K43 A;  1Q86 O;  3GG4 A;  4CZF A;  1HLU A;  1NBW A;  1SS6 A;  3HRG A;  3R9P A;  3WXI A;  3ZET A;  4R79 A;  4CZK A;  5GIO A;  3N4P A;  1ZC6 A;  2A5X A;  2FF6 A;  3U9Z A;  3J7Z O;  1ATS A;  4A57 A;  1D4X A;  3VTI A;  4MLE A;  4RWT A;  3VER A;  5H1S Q;  1DGK N;  1O13 A;  2JWL A;  3A0I X;  1X3N A;  4BQZ A;  3ZYY X;  2Q36 A;  4PL8 A;  1RFQ A;  4IJA A;  3FGU A;  3QBX A;  3HOT A;  4PHT X;  3BUZ B;  2PAV A;  4EIA A;  1HUX A;  5CR4 A;  1HX1 A;  5GAD P;  3VEZ A;  3IUC A;  5B8H A;  4IWV A;  1HKC A;  5AZJ A;  4CBU A;  3C7N B;  1NM1 A;  4JKB A;  4RCH A;  3E1Y A;  4KH6 A;  3ENO A;  4ISF A;  3E9P A;  5LJV A;  5AQI A;  4MO4 A;  5FPN A;  1XC3 A;  3MN5 A;  2GEL A;  3T69 A;  3WXL A;  3SAG A;  3R3L A;  2V51 B;  3VEV A;  3BF1 A;  3CCS N;  2Q31 A;  2NZT A;  1K9M O;  1KAX A;  3GBT A;  1QZ5 A;  1QVF M;  2NRZ A;  1BDG A;  2QTD A;  5C0Y A;  4NLB A;  3B8A X;  2FLO A;  3RVC A;  3G25 A;  2IVN A;  4JN4 A;  5EXW A;  5F0X A;  3CME N;  2CGJ A;  4B1U B;  1DEJ A;  1NGG A;  3MK6 A;  1VQP N;  1NLV A;  2E2Q A;  4NO7 A;  5BRF A;  1QVG M;  3T7Z A;  4GV6 A;  1NGC A;  3TTC A;  2YHX A;  2NRT A;  5BPL A;  1VQ9 N;  4GNI A;  3CCV N;  5AQN A;  1CZA N;  4BEB A;  5AZI B;  4YOU A;  1P90 A;  5JVG L;  2QA4 N;  3EE8 A;  3ULE A;  2QEX N;  1MWK A;  1TUU A;  4U7B A;  3O9R A;  2ZWH A;  3D6R A;  3EKU A;  4A5A A;  3L4I A;  3VEO A;  2V7Y A;  2H3G X;  4HWI A;  3VMF B;  4BRA A;  1ILY A;  4B1W B;  1K8K A;  4JKG A;  4QS7 A;  4CZJ A;  1Q82 O;  3A5L C;  5I9E B;  1YF5 L;  4M7Y A;  3UKU B;  3NMU A;  2P9U A;  4B9Q A;  3FZL A;  3ZEU B;  2BH1 A;  3O4W A;  4M63 C;  4KH4 A;  4BC3 A;  4DKW A;  1BOT O;  5AQS A;  3O5B A;  3MX5 A;  3CMA N;  4FWS A;  4BC2 A;  1W2B M;  4B1Y B;  4BGA A;  4AM7 A;  4DCH A;  4BR9 A;  1G99 A;  3ZET B;  3L4Q A;  3OA9 A;  3MN9 A;  1QZ6 A;  3O1B A;  3EO3 A;  3ID6 A;  4KBO A;  1DT9 A;  1ZBS A;  2OAN A;  3HM8 A;  3UE5 A;  3VEY A;  3O08 A;  5AQZ A;  2GTD A;  3M5R A;  1YJW N;  1R59 O;  4H0Y B;  2E1Y A;  3MWT A;  4FOE A;  2JWK A;  5AFU A;  2QWO A;  1MDU B;  4PL7 A;  3LM9 A;  3CCE N;  2A41 A;  4JKE A;  1Q7Y O;  2QWN A;  2YJE A;  3SAF A;  1TYQ B;  1T6C A;  4BR2 A;  2ZJR L;  3P39 A;  4FO0 A;  1BG3 A;  1HPM A;  5AZJ B;  5ELZ A;  2WUS A;  2BTF A;  3KWG A;  4K41 A;  3KZB A;  4U67 L;  4JHD A;  1OVY A;  2GWK A;  3FZK A;  1YI2 N;  1Z6R A;  1GLA G;  2J4R A;  4FWN A;  1YAG A;  3CI5 A;  5EVZ A;  4BRO A;  4IEI A;  2I7P A;  3DWL A;  3KWI A;  4CI6 A;  5BR9 A;  5F2R A;  3QFU A;  1BA0 A;  2A3Z A;  4M7X A;  3S41 A;  3A5M C;  4QS9 A;  3Q7C A;  1C0G A;  4RTF D;  3VGM A;  2QWR A;  2Q0R A;  5MLC Q;  3R8E A;  1QQN A;  1RDW X;  3H45 C;  3ZX2 A;  4BRN A;  5JLF A;  4BRL A;  3I33 A;  3ZEU A;  4FWO A;  3N4Q A;  2NRV A;  5AQU A;  5DM7 L;  4BVP A;  2ZJQ L;  3O9U A;  4BRE A;  2CGL A;  2GWJ A;  3FZF A;  3G71 N;  3CET A;  2YJF A;  3HZ6 A;  3LDQ A;  4ILH A;  3CCU N;  3CQY A;  2ZF5 O;  4H0X B;  5JIC A;  5BPM A;  1M1K O;  4BR5 A;  3ULE B;  4H5R A;  1NGH A;  1S3X A;  5AQQ A;  1NGE A;  2D0O A;  2Q0U A;  4EAH D;  1JCF A;  5EY4 A;  1M90 O;  2PBD A;  4JD2 B;  5GAE P;  3BP8 A;  4YOR A;  1K8K B;  2IVP A;  4LC9 B;  4BQL A;  4JKG B;  2HF4 A;  3CC7 N;  3KVG A;  3HTV A;  3ZX0 A;  4Z94 A;  3E66 A;  3UB5 A;  2P9U B;  4BVO A;  1Z05 A;  3QIC A;  3CPE A;  2VGM A;  4IOC L;  2WFB A;  3H6E A;  1KAZ A;  3NVM A;  5TKY A;  3TSP A;  2A42 A;  2UYT A;  3FR0 A;  2OTJ N;  1TYQ A;  3LDL A;  1QHA A;  3CJA A;  3O9S A;  5BN9 A;  2P9N A;  1EQY A;  2F7T A;  3CCQ N;  3OBY A;  3FE1 A;  2ITM A;  4YOY A;  4IOA L;  3EE9 A;  2IIR A;  3EN9 A;  4O8K A;  5AQM A;  5CE3 A;  2P9K A;  2QM1 A;  4BR0 A;  2F9T A;  3MCP A;  3H1Q A;  1GLF O;  3W0L A;  3G4S N;  2E20 A;  2YHW A;  5M1F A;  3IMX A;  4I6M B;  1V4S A;  2QW9 A;  2HBL A;  3Q7B A;  5AQJ A;  4CBX A;  2AA4 A;  4YDU A;  4DHY A;  2V52 B;  4WFN L;  4OO1 J;  1QQM A;  3CJ7 A;  2CGK A;  3OW2 M;  2C1G A;  4BRF A;  5GIP A;  2NRX A;  4FVU A;  3WUH A;  1NGD A;  4PKH A;  1NJI O;  3W3D A;  2P9I B;  4JHD B;  5EOY A;  2AP1 A;  4A2A A;  2W41 A;  3IFR A;  4XH5 A;  2HOE A;  4ISE A;  4IJN A;  3VEN A;  1Y64 A;  5AQW A;  2EWS A;  4BRP A;  2Q1N A;  4K42 A;  3M3Z A;  3U9D A;  2ZGZ A;  1S72 N;  4JKA A;  3CQX A;  3P4I A;  4JD2 A;  4JAX A;  4A5B A;  4CZH A;  4WFB L;  5C15 A;  1E4F T;  2DPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...