4CBWA

Crystal structure of plasmodium berghei actin i with d-loop from muscle actin
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
372
structure length
367
Chain Sequence
EVQALVIDNGSGNVKAGVAGDDAPRSVFPSIVGRPRHGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRAAPEEHPVLLTEAPLNPKGNRERMTQIMFESFNVPAMYVAIQAVLSLYSSGRTTGIVLDSGDGVSHTVPIYEGYALPHAIMRLDLAGRDLTEYLMKILHERGYGFSTSAEKEIVRDIKEKLCYIALNFDEEMKTSEQSSDIEKSYELPDGNIITVGNERFRCPEALFQPSFLGKEAAGIHTTTFNSIKKCDVDIRKDLYGNIVLSGGTTMYEGIGERLTRDITTLAPSTMKIKVVAPPERKYSVWIGGSILSSLSTFQQMWITKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN, ALPHA SKELETAL MUSCLE, ACTIN
publication title Structural Differences Explain Diverse Functions of Plasmodium Actins.
pubmed doi rcsb
source organism Plasmodium berghei
molecule tags Motor protein
total genus 108
structure length 367
sequence length 372
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4cbwA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4cbwA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4cbwA03
2V7ZA 2BTFA 2E2NA 4BRMA 1DEJA 2A42A 4QS7A 2F9TA 3IDHA 3R8EA 4JN4A 2QXLA 2ZGYA 4FOIA 1NGHA 4XH4A 2P9PA 3EO3A 3MN5A 5ELZA 3ZX2A 1NGAA 2P9KA 3FFKB 2WUSA 2VWBA 3RSEA 3M6GA 1NM1A 3A5MC 3WXIA 3LDLA 4FWSA 1MDUB 1E4GT 4DHYA 5AQFA 3EZWA 2PAVA 4WYBA 4BR4A 3ZX0A 3VPZA 3VEXA 1TYQB 3BUZB 3CERA 4BVOA 2FSKA 4B1WB 2QWNA 4H5VA 5AFUA 4KBOA 4WQ5A 4DQ8A 5EXWA 4BRCA 5AQTA 3LM9A 4I6MB 2GWKA 2P9IB 5EVZA 1CZAN 3ATUA 1QHAA 4FWOA 4CZLA 2E2QA 4AM7A 3J8AA 3WUHA 1WOQA 5FPEA 5F2RA 1BO5O 3EKSA 3ULEA 2P9NA 1QZ6A 2NZTA 4FWMA 2E1ZA 4H5TA 4IJAA 3UKRA 4M7XA 1BA0A 1U6ZA 3HZ6A 1OKJA 3GG4A 1BG3A 1Z05A 3DXKB 3H46O 4BR2A 1ZC6A 2GWJA 3UKUB 3I8BA 4BRHA 2P9SA 5KQDA 3FZFA 5JLFA 4DB3A 4GY2B 3WXKA 5I9EB 3U4LA 2PBDA 3AAQA 1RDWX 1T44A 3O6WA 3H3NO 5AQQA 4CZIA 3C0BA 5E26A 4CZKA 2I7PA 3KVGA 4O8KA 3DJCA 1H1VA 2CGKA 3UB5A 2IVPA 5AQXA 3UE5A 3WQUA 2I7NA 4FWRA 5KPZA 4BRPA 5EX5A 1KXPA 3H45C 3D2FB 2F9WA 3DAWA 4CBWA 4H0OA 3WEEA 1K8KA 1HKGA 3ZX3A 4CZJA 3VF6A 1ESVA 3M3ZA 4A61A 4Y0WA 1KAYA 2GELA 1P8ZA 4B1YB 5LJVA 4CI6A 1G99A 3KZBA 3HSCA 3QBWA 4K41A 3VENA 2E8AA 4BREA 4WQ4A 5AQMA 3HTVA 2FSNA 1GLFO 2P9LA 3D7EO 5AR0A 2VCPA 2YJFA 1V4SA 2Q0UA 3MDQA 4DCHA 2E2PA 3TPQA 1NGEA 1HKCA 4ISFA 5FPDA 3O08A 4A62A 3A8YA 4BROA 2BUPA 4B9QA 4PKIA 2D1KA 3DWLA 3MN9A 3WXJA 4CD1A 4BC5A 3ZETB 4MO5A 3A5OC 1HJOA 2CH5A 2FXUA 3JS6A 3VF4A 5EY4A 3R6MA 1NGJA 1HPMA 2V51B 3VGKA 3SMPA 4CBUA 1U2VB 3F9MA 1QQNA 2DPNA 3GDQA 4LC9B 4BC3A 2HF4A 2E88A 2D4WA 4PKHA 5BR9A 5AQKA 5TKYA 3FE1A 3QICA 3VESA 1X9JA 1BWFO 2HF3A 2QWMA 2A3ZA 3AARA 2GUPA 5LY3A 3DXMB 3VGMA 1QQOA 3CETA 4PKGA 4XH1A 5AZJB 4BGAA 2IVNA 4CJ7A 3QBXA 1TYQA 1BDGA 4K42A 5BPLA 2AP1A 5JMVA 1BA1A 2Q31A 4XH5A 2GEMA 1ATRA 2E20A 5KQ8A 2Q36A 4RWTA 4WQ4C 4BC4A 3LL3A 2ASMA 1YVNA 4I6MA 5B8HA 2IVOA 4MLHA 3LM2A 1KAZA 2J4RA 3O80A 2P9IA 1NLVA 3BP8A 3H1VX 4IO8A 3B8AX 4PL8A 5BN9A 2YHXA 3CI5A 2QWPA 2YJEA 3S41A 2A40A 4RCHA 4H0TB 4BRLA 3O1BA 4F9OA 2QWLA 1HKBA 3VEZA 5LJWA 4XEIA 2EWSA 3VGLA 1LCUA 3DXKA 2E2OA 5ADXA 1NGGA 3UKUA 4CZFA 1T6DA 3A0IX 4A2AA 1YXQA 4ISGA 4FSVA 3GOIA 1JCFA 3D2EB 2NRHA 3M1FA 3IFRA 1SZ2A 3LDPA 2HOEA 4B1XB 1MWKA 2W41A 3ENHA 2YHWA 3LDOA 1HUXA 3MN6A 3LDQA 4H5WA 4H0XB 2QM1A 5BRHA 2ITMA 4CZGA 5BRFA 2NLXA 3D2FA 3SK3A 3VEYA 3H1QA 2H3GX 1SQKA 5AFUH 3FLCO 5FPNA 4BRNA 5BRDA 1BU6O 1NGIA 4H0YB 3QMLA 2ZF5O 3FZMA 3AAPA 3SLCA 1MA9B 3SJHA 3JXUA 1NGDA 4BRKA 1LOTB 4K25A 4JD2B 5AZIB 1D4XA 1XUPO 5KPRA 4H0VB 4FWNA 1V4TA 4IJNA 5AQVA 5AQYA 4BRAA 2AA4A 5AQSA 3VF2A 1X3MA 4E1JA 1BUPA 4FO0A 2E1YA 3W0LA 5AQNA 4H5RA 4CD3A 2Q0RA 2QWRA 4JHDB 4HWIA 4BRDA 1S3XA 3ZETA 3CJ7A 1JCGA 4B1UB 5AQUA 1X3NA 2HMPA 1ZXOA 3CJAA 3WT0A 3FZHA 2ZGZA 3HBTA 2UYTA 5BREA 1NWKA 3W3DA 4BR0A 1U2VA 4IWVA 3MCPA 1ATSA 1GLJO 3A5LC 1NGBA 1IG8A 4FPBA 2A5XA 3OHRA 3EN9A 4J8FA 4FWPA 5AQRA 4QS9A 3IMXA 3VEVA 3CJ9A 1J6ZA 1S22A 3C7NB 2YCHA 3QB0A 4CZMA 1BOTO 3MMVA 3DXMA 5AZJA 1ZBSA 1R59O 3KHYA 4PL7A 1NMDA 4A2BA 4EHTA 2D0OA 2KHOA 4BR5A 3EKUA 2OANA 2P9UB 1WUAA 2V52B 4BQZA 1RFQA 3VEWA 3BF1A 4EAHD 3L4IA 1GLEG 2VYPA 1T6CA 1C0GA 4FPAA 1XC3A 4L3QA 3CQXA 1RGIA 3ZEUB 3CJCA 4MLEA 2FF6A 3QDKA 4MO4A 3ID8A 2D0PA 5JICA 1IJJA 1KAXA 4M7YA 3FZKA 3CJBA 3GE1A 4H5NA 2CGLA 1QZ5A 3CJ1A 4H0PA 3LDNA 5F0XA 3O8MA 3H3OB 4EFHA 2P9PB 3I33A 5AQIA 2QWQA 5BN8A 2Q97A 1HLUA 1NGFA 5AQZA 2P9KB 4FWQA 1EQYA 5AQGA 5JLHA 1MWMA 3RSEB 3WXLA 3D2EA 4BR7A 2FSJA 3O4WA 3FGUA 3SMSA 3GL1A 1GLDG 4JAXA 1HX1A 2YHYA 4IXCA 1NBWA 3VERA 4RTFD 3QFPA 4FWLA 1GLBG 2A41A 4FOEA 5FPMA 4BR9A 4BQLA 3QFUA 3FR0A 4O5FA 3U9DA 3HM8A 4NO7A 4ISEA 5AQOA 3VOVA 4YDUC 4AM6A 4Z94A 4B1ZA 5CE3A 2Q1NA 1NGCA 3IUCA 2QW9A 2A6AA 3L6QA 3VEOA 4EHUA 4BGBA 3ATVA 1Y64A 3ULEB 2P9NB 3EL2A 3G25A 3BF3A 5F1XA 3UKRB 4JD2A 4BRQA 2CGJA 5AZIA 3FZLA 4FL9A 4HTLA 4B1VA 2ZWHA 4QS8A 3TU5A 3VETA 3WQTA 1YUWA 2V7YA 4CZEA 4K43A 3AY9A 3CIPA 3HI0A 1TUYA 2P9SB 4BG9A 3R9PA 1ATNA 5ADXH 4IZ9A 4EIAA 3MN7A 4JHDA 2W40A 4BVPA 1GLAG 1C0FA 3O5BA 5BPNA 5KPTA 1QQMA 3BEXA 4FWKA 4H03B 1DKGD 4JNEA 4CBXA 2QWOA 1GLLO 1YAGA 4CZHA 4WQ5C 3O1WA 4BRGA 2CH6A 3GBTA 3CHWA 4BRFA 3WEEB 1SAZA 5AQHA 2ASOA 4NB4A 2FF3B 2Q2RA 2YI1A 3L0QA 3MK6A 2IIRA 1K8KB 1Q18A 3P4IA 5AQJA 3C7NA 2GTDA 3U8XA 3H6EA 4BC2A 1Z6RA 3U9ZA 5BPMA 4GNIA 1JCEA 5AQPA 2P9LB 4BRIA 1GLCG 5AQWA 1TUUA 1E4FT 5AQLA 4YDUA 2P9UA 1XQSC 4BG8A 4C23A 3ENOA 1DGKN 3A5NC 4M63C 5EOYA 2FLOA 2ASPA 5E84A 3CQYA 3ZEUA
chains in the Genus database with same CATH superfamily
5C25A 2D5RA 1D9DA 3J7ZO 2A42A 3CM6A 3IDHA 2QXLA 1G15A 4FOIA 1TKXA 1WLJA 2P9PA 4KHWA 1EWRA 3H08A 3MN5A 2O8FA 1NK5A 3KD1E 3KLHA 3ZX2A 2P9KA 1IBKK 3FFKB 4I9QA 2KW4A 1T05A 3A5MC 3C94A 1VSFA 1LV5A 2NNWA 3T3FA 1EWQA 1U4BA 1DTQA 2FSKA 2QWNA 1N36K 1RBRA 3KWIA 1T8EA 5AQTA 3LM9A 3I0SA 1JLFA 1WN7A 3ATUA 4FWOA 4AM7A 5FPEA 1ZBHA 5C0YA 4CK1A 4N56A 4FWMA 1Q9YA 1U6ZA 3HZ6A 5HRSA 3CYMA 3EZ5A 1Z05A 4CJWA 1ITGA 2P9SA 5KQDA 5JLFA 3CFPA 1ASWA 3MECA 4C8KA 3AAQA 4CZIA 3O6WA 4Z4IA 2W6LA 4OPAA 2I7PA 5C2FA 3O9TA 5C42A 3UB5A 2IVPA 2IC3A 4CE9A 1X9WA 3WQUA 2I7NA 3AO3A 3K5NA 4ZTFA 4GV6A 3EYZA 1SL1A 4CJ4A 3TAQA 4CBWA 3AVGA 4H0OA 3TAPA 3V1QA 4GW6A 1QE1A 3ZX3A 1HKGA 3ZT1A 3LWLA 1U47A 4KTWA 1OH8A 1G99A 3KZBA 2E8AA 4WQ4A 1S6PA 1WSJA 4WF9L 3QLHA 2P5OA 4RG8A 2P9LA 2VCPA 3HPOA 2YJFA 5K14A 1V4SA 2OYQA 2Q0UA 3HRGA 4DCHA 4OPKA 2VGMA 3QINA 3QESA 1NJIO 5MLCQ 4K8ZA 2HBKA 1HKCA 1XHXA 3O3GA 1VSJA 1TV6A 1Q86O 3OYLA 4XIUA 1KC8O 2D1KA 3MXJA 2DTUA 2JLEA 3D0PA 4FXDA 3OY9A 5BR8K 1IO2A 1HJOA 4DWIA 3B6PA 1HPMA 1HYZA 2V51B 5J2MA 5JVGL 4CBUA 4FM2A 3OYHA 4BC3A 1E3MA 1SUQA 4CIGA 2E88A 3DOKA 2D4WA 1YTUA 4CFDA 4DKWA 5TKYA 3VESA 2B5JA 2F8TA 2BGGA 3V1OA 4DV6K 3K59A 4JRPA 2OA8A 3VGMA 4PKGA 1NJYA 2IVNA 1MU2A 4FVMA 2UXBK 3OVNA 4CJ7A 1TYQA 5JMVA 2Q31A 3OTOK 4CGIA 4DR5K 2E20A 3RMCA 4DTNA 4WQ4C 4CEBA 2ASMA 3I56N 1KAZA 1UAXA 3O80A 1B9FA 1EO1A 1L5UA 1XI1A 2O8BB 3BP8A 1BI4A 3H1VX 3KJVA 2YHXA 4H0TB 1WSIA 4F9OA 4DTUA 2QWLA 3DYAA 2Q3SA 4XEIA 4IFYA 4E7KA 1LCUA 3OYGA 1T6DA 4RW8A 2ITGA 3QO9A 4JI4K 2NRWA 4FSVA 4LY7A 1YF5L 1SKWA 4KH5A 4O4GA 2NRHA 3S3NA 3VMFB 4CJSA 2HOEA 2YHWA 3LDOA 1BQMA 4CJVA 4IOAL 3AVCA 4CJFA 3P83D 4KFBA 2FBTA 4NLBA 3IS9A 4YNQA 4W5NA 1NK6A 2C1IA 4MDBA 4E7LA 1VSLA 1HQUA 4KKOA 2UUCK 5BRDA 4DQIA 4DV2K 1XMQK 1K73O 3QMLA 4Z4CA 2ZF5O 1HPZA 3KTQA 4CHQA 4DV4K 1VQ6N 1YJNN 2HNDA 3K0SA 3EEQA 3AGKA 3O4QA 4H0VB 1VSDA 4BRAA 2AA4A 3HXMA 1QVFM 1RTDA 3TTDA 1YT3A 1YJ9N 4DU3A 3F9KA 4B3RK 5AQNA 4C8NA 5GAHP 1R0AA 4HWIA 2VWKA 1ZBLA 3QIPA 3MWTA 2ETJA 2HMPA 5C10A 3VQPA 2X74A 1XWLA 2ZGZA 4X66K 1ATSA 1NU0A 3A5LC 4B3TK 2E5LK 1IG8A 4M3WA 1VQNN 3VN5A 1VQ4N 2YNIA 4QS9A 3ZSOA 2XRIA 3SCXA 1IKYA 2ZM6K 3C7NB 3G4SN 3V6DA 5E41A 1IKWA 4DS4A 2F8SA 4BWJA 3KHYA 1LWEA 1NMDA 3EE9A 3VQEA 4EHTA 4ELVA 4BR5A 1HNZK 1T7PA 1OVQA 3NDKA 2VGNA 4EAHD 2GBZA 3VEWA 4BQZA 3AVKA 4JRQA 3OW2M 4W5TA 4YOYA 3LPUA 4MLEA 4OKKA 4M45A 4K8XA 2G8WA 3HOSA 3RWUA 3LP1A 1QZ5A 3NF9A 4OPJA 3K58A 3H3OB 1N33K 3TTFA 3I33A 5AQIA 5CHIA 4G1QA 1QSLA 3D6RA 1EQYA 4E7HA 4DU1A 5JLHA 5J2PA 3RSEB 3C65A 5GAEP 2BE2A 4B9TA 4JAXA 1HX1A 3P39A 1NBWA 4CF2A 1VK0A 4OLAA 3QFPA 3QNOA 1GLBG 3ZT2A 2YX6A 1NJXA 3S3OA 4KV8A 1NJZA 2UUBK 4KHQA 1JLGA 4EP5A 3SJJA 3OS2A 1XMOK 1NK0A 3U9DA 3KK3A 2OTJN 4ELTA 2HB5A 3VOVA 1Y97A 4Z94A 1NK8A 1NMNA 2Q1NA 4DF4A 4JKGA 1RDCA 1TKZA 4J2DA 3L6QA 4CEOA 4C8LA 4BGBA 4FW1A 2P9NB 1S1TA 3G25A 3BF3A 4YOTA 4KREA 3J81O 4JD2A 2CGJA 2ZQBA 3FZLA 5FRNA 2ZWHA 1RTJA 3VETA 4BDYA 3O4NA 4CZEA 4K43A 3R3LA 3ZT4A 3CIPA 2Y1JA 1VQ8N 3OYCA 1S9GA 4CJUA 4EIAA 3MN7A 3JAMO 2VQFK 1JLCA 4YOWA 4JYAK 5C24A 2W40A 3QNNA 5CY4A 5KPTA 3PUFA 2YV0X 4CHPA 4IDKA 4TSXA 3KLIA 3OYIA 1DKGD 5CZ1A 4CBXA 1RTIA 1GLLO 1Z25A 4DUYK 3O1WA 4BRGA 3MX2A 3J80O 2WOMA 3DOLA 3LANA 2O8EB 1SAZA 5AQHA 2ASOA 4NB4A 4CW7B 2FF3B 2YI1A 2HBJA 1Q82O 2IIRA 1K8KB 3P4IA 5I3UA 4U7BA 4Z4FA 4CGHA 1RILA 3KK2A 5BPMA 4CHOA 3RMDA 1JCEA 4BRIA 4IFVA 1RDBA 1N6QA 4ELUA 1DLOA 4WFNL 1XQSC 3IKMA 3A5NC 2ASPA 4HUFA 3RRGA 3K9KA 2PYLA 4GV9A 5SZTA 3T1HK 2V7ZA 2BTFA 4DFJA 5J2NA 3AVBA 3PX6A 3NVKA 4QS7A 3R8EA 4WFBL 2ZGYA 4O0IA 3THXB 4HCBA 2OZSA 4FLVA 4JKEA 4CF9A 2OPQA 4E72A 2IS3A 3LAMA 4KH6A 2WUSA 3QIOA 3VQDA 3U6FA 4I2PA 4JI0K 3HT3A 3WXIA 3LDLA 4FJMA 1BHLA 1MDUB 1E4GT 1IKVA 3EZWA 5AQFA 3CCRN 3SPYA 4KHPK 3VPZA 5KGXA 4B9MA 2XY5A 4B9UA 3F73A 1RDDA 4WQ5A 1DT9A 1RBSA 1JXBA 4BRCA 3OBYA 2HHQA 4KHYA 2P9IB 4FJ7A 5GIOA 2O8DB 1QHAA 2JGUA 3T19A 3J8AA 3WUHA 1Z26A 4J2AA 3O9UA 3ULEA 1U04A 2KTQA 2NZTA 2E1ZA 4IJAA 4H4OA 4M7XA 3HK2A 3K5MA 3L2VA 4E19A 3DXKB 3H46O 2NRXA 3UKUB 4I9LA 4DFMA 3FZFA 4DSJA 4BEBA 4N76A 3WXKA 2PBDA 1GOCA 1JLAA 1VQKN 4A59A 3C0BA 4BDPA 4OGEA 4LSNA 3CM5A 3G10A 2KQ2A 4O8KA 1H1VA 1ZYQA 4FJIA 3THWB 3EE8A 4FM0A 3VQ9A 3UE5A 1VQLN 3G71N 2Y1IA 2HMIA 3K2PA 3AVNA 4FZZA 2EHGA 5EX5A 4WFAL 3OBWA 4FJLA 4CGFA 3V1RA 2WONA 5KRSA 2P51A 4ZHRA 1XNRK 3ITHA 3WEEA 3VA0A 5M1KA 4DQRA 3CC2N 5LL6Z 4CZJA 1ESVA 4Y0WA 1JLEA 1P8ZA 4B1YB 5LJVA 1W0HA 3HSCA 3ZSYA 2BH1A 1J5EK 2O8CA 3C6TA 3D7EO 5AR0A 1KQSM 3C6UA 4HTUA 4CGJA 2E2PA 4RW6A 3TAMA 4PQUA 1VSIA 1YI2N 1XNQK 4A62A 4BROA 4Z4GA 2BUPA 4PKIA 5HP1A 1C0TA 4BC5A 3KKSA 4ZTJA 4BY9C 3JS6A 3VF4A 3R6MA 3PIOL 1VHXA 3CCUN 5SWMA 4CK3A 4LC9B 1QTMA 4O5BA 5JS2A 5BR9A 3PX4A 3FE1A 3T7ZA 4OKEA 3RTVA 1OH6A 2QWMA 2A3ZA 2HNZA 1RT3A 3NVMA 2WTUA 4FLYA 4CFCA 2GUPA 3DXMB 1QQOA 3CETA 5AZJB 1YJWN 3CCEN 4BACA 3CCLN 4C1NK 3QBXA 2AP1A 5AJ3K 4XH5A 1Q9XA 2ZJRL 3ZLJA 1HNWK 3Q7CA 3LL3A 4I6MA 1YVNA 5JVHL 2IVOA 3HP6A 4B3SK 1NLVA 4DFPA 4R79A 4OKJA 5BN9A 4FJJA 3CI5A 2XHBA 2QWPA 4QOZB 4BECA 1EETA 4PWDA 1REVA 3BY5A 3PSFA 5LJWA 1CLQA 2OPPA 2Z1HA 3ID6A 4W5QA 4CGGA 3NF6A 5ADXA 2E2OA 4DTSA 1LAVA 4IEEA 4FJXA 3THYA 3SQ4A 4CJRA 1YXQA 4W5OA 2QKKA 4LF5K 3GOIA 3D2EB 4OVLA 3NHGA 5KTQA 4B1XB 1MWKA 4OLBA 3L2QA 2HNYA 1NKCA 1N34K 4CZGA 3O3HA 3D2FA 3H1QA 1SQKA 5AFUH 1NGIA 4MDAA 4O44A 3FFIA 5DMRA 4M3UA 5FLXO 1BL3A 5HRRA 3V9WA 1WBBA 4M41A 4JK8A 3SLCA 3J7AP 2OTLN 1J54A 1NGDA 4QAGA 4RW9A 4V19S 2IAJA 3V9UA 1LOTB 2OCEA 2KFZA 3LZIA 1XUPO 1S1UA 5KPRA 3VQ6A 2GUIA 5AQSA 4FLZA 3VF2A 4E1JA 3SAHA 2E1YA 1HNIA 5TKWA 3NFAA 2FBYA 4CECA 4JKAA 3B6OA 4LF7K 1S1VA 3HP9A 3DLEA 3ZETA 3CJ7A 1S6QA 4E1NA 4CK2A 3TWHA 3CJAA 3WT0A 3KD5E 2P5GA 1NWKA 5HROA 1U2VA 3O9SA 3CFOA 1GLJO 3TR8A 5IT9O 1NGBA 3Q7BA 4CEQA 3HM9A 4C1NI 3EN9A 5AQRA 4F8RA 3VEVA 1VQ7N 3L2RA 3CJ9A 3WXMB 1S22A 4FJ9A 3K57A 1IG9A 4FJKA 4CZMA 1KFSA 3MMVA 1ZBSA 4ILGB 3SBTA 2O4IA 4FJ8A 1EX4A 4KB0A 3SAGA 4EZ6A 3BDPA 2KHOA 3ISNC 3TABA 4YFUA 1VQMN 1WUAA 3AA2A 3NBPA 3NCIA 4FLXA 4CFBA 3L4IA 4Z4EA 4ILHA 4AHCA 4FPAA 3ZEUB 3CJCA 2G8VA 5LMUK 2BANA 1NOZA 4HCCA 4M7YA 4H5NA 4FJHA 1DTTA 5C12A 2PY5A 1X9SA 1HRHA 4FM1A 4EFHA 2P9PB 2O8FB 3NF8A 2Q97A 4JKCA 5AQZA 4UY8O 2P9KB 4FWQA 3SI6A 3F5TA 5GADP 4NCAA 1MWMA 3WXLA 3DLLL 3ZSQA 2RPIA 4HUEA 1W2BM 1RDUA 2YHYA 4FWLA 3AVAA 3LZJA 3VQQA 4FOEA 1JLQA 5FPMA 3NH1A 4JEPA 3QFUA 4NO7A 2YHAA 4B1ZA 1NGCA 3VQCA 3ZSVA 4CIFA 4GV3A 4KRFA 3VEOA 3TARA 3CYGA 2OPRA 1Y64A 2W00A 5F1XA 5GIPA 2XY6A 5AZIA 3MAQA 2UUAK 1KLNA 1HNVA 4B1VA 3OYJA 4GKJK 1YUWA 1HYSA 1KCFA 2P9SB 4CF1A 3V9XA 3OJUA 3VQ4A 3DRPA 3R9PA 1ATNA 4IZ9A 4CEAA 4LF6K 4N41A 1KTQA 3C95A 3RMBA 3OYMA 1XHZA 4JHDA 2C1GA 3QEWA 4H03B 2HHVA 3LP3A 3SUQA 1YVUA 3DRRA 4M3ZA 3E9OA 3PV8A 2CH6A 2QI2A 3GBTA 4DSLA 3CHWA 4FZXC 2O4GA 1M90O 3L0QA 5GINA 2B6AA 1Q18A 1RNHA 1J9AA 3LP0A 4CGDA 2GTDA 3H6EA 1LAWA 3U9ZA 3BZCA 4GNIA 3SZ2A 1N32K 2P9LB 4CCHA 4JI7K 3IG1A 1JL2A 4ID5A 4DR7K 4BE2A 2HVIA 2P9UA 1JLBA 4M63C 2FLOA 4GVEA 4O55A 3QERA 3DRSA 5M1OA 3LALA 5HOOA 3C6HA 4BRMA 4JI8K 1VQ5N 2F9TA 3OYAA 1C1CA 1D5AA 4JN4A 3VQ7A 1A5WA 1NGHA 4DF8A 4XH4A 3KK7A 3EO3A 5KGWA 1TVRA 2DY4A 3M8RA 1IBLK 3CMEN 4H4MA 1KLMA 4DFKA 1C6VA 3OA9A 5I42A 1NM1A 3L3VA 4JKHA 1RTHA 4DR3K 4ILJA 3ASMA 2VWJA 2F4VK 4WYBA 4BR4A 4DSEA 3L3UA 4KPYA 3ZYYX 1ZBFA 3VQ5A 1TYQB 3BUZB 1YTAA 3AVMA 3CERA 2QEXN 1LW0A 4B1WB 2HHWA 4H5VA 4YORA 4KBOA 4DQ8A 1QSYA 4R5PA 2ZJPL 4F3OA 5EVZA 3LAKA 4CZLA 1VRTA 1BI4B 4DTOA 1WOQA 5F2RA 2XO7A 4KHNA 3EKSA 1IH7A 1BQNA 1QZ6A 3PLAA 1C1BA 1NKBA 2F7TA 3UKRA 4H5TA 3DI6A 1BA0A 1UWBA 3E9LA 3HL8A 1OKJA 2FC0A 3GG4A 1L3TA 4CFAA 4YOUA 4DTMA 4XJXA 2W6KA 4DB3A 4CJPA 1TAUA 1EP4A 4GY2B 5I9EB 1RDWX 1T44A 5AQQA 1HR0K 1TK0A 5HRPA 4C8MA 3A2FA 5E26A 3TSQA 4BWMA 1C0MA 3KVGA 4IFEA 3QETA 5AQXA 1VSKA 2HVHA 5KPZA 4FWRA 4BRPA 3CC7N 1TK5A 3DAWA 1IV0A 2HHSA 3TANA 5EU7A 4CHYA 3AA3A 4AHVA 1C0UA 3VQAA 2HHTA 5A2QO 3VF6A 4AILC 4FJGA 4A61A 2GELA 3VENA 3HPHA 4JV5K 3TTCA 3DM2A 4IO9L 1A5XA 4NXNK 5AQMA 3HTVA 4IG0A 4J2BA 2FSNA 3MDQA 3OYDA 5T7BA 2XY7A 3RR8A 4AH9A 1NGEA 4A57A 3LP2A 3CD6N 5FPDA 2KKZA 4NYNA 2GV9A 3A8YA 4W5RA 1VQ9N 3DWLA 3MN9A 4LFAK 4CD1A 1JL1A 4DQQA 4DQSA 3A5OC 3PO4A 3AVFA 2CH5A 2JWKA 5EY4A 3OYKA 1WSGA 3SMPA 1VSMA 3F9MA 1QQNA 2DPNA 3GDQA 2Z1IA 2HF4A 1J5OA 1VAZA 3NAEA 3NGZA 5AQKA 4IOXA 1X9JA 1BWFO 2HF3A 4CJ3A 3AARA 4DV5K 2KZMA 3CCQN 4CJTA 1YHQN 2KZZA 4BGAA 4YOVA 3CCMN 4B9SA 1LWFA 4KAZA 1BDGA 4K42A 4IG3A 3RMAA 1ATRA 5KQ8A 1VQON 2ZD1A 3OYBA 3CXCM 1M1KO 1X1PA 3LM2A 2J4RA 4BE7B 1N5YA 4BE0A 4CJEA 1ZBUA 2NUBA 4PL8A 1HNXK 4N47A 1Q8IA 3S41A 3WNEA 4WCEL 4E7JA 4BRLA 3O1BA 3VEZA 5M1PA 4FK2A 3T1YK 4LD0A 1A5VA 3V9SA 4JS4A 3NF7A 4CZFA 5D3GA 3A0IX 4A2AA 1QQCA 4CESA 2NRTA 4U67L 2E6LA 2ZJQL 1IKXA 4JKBA 1LW2A 1JCFA 3U3GA 3QEXA 1RT1A 3CC4N 2UXCK 3IFRA 1D8YA 3LDPA 2W41A 3ENHA 1KD1O 1OVYA 3NGIA 2IOCA 5CYQA 3E9PA 1WNSA 3AVHA 2ITMA 1NK9A 4Z0UA 3V9ZA 2PYJA 5BRFA 2A1SA 3SK3A 4E3SA 1BU6O 1TKTA 1TAQA 4H0YB 4JKGB 4YHHK 4KI4A 4CJ5A 4DR4K 3FZMA 4DV7K 1OH5A 1RT4A 4AHTA 1EKEA 3CF5L 3UIQA 1S1WA 3KK1A 4JD2B 1D4XA 2HHXA 3L4QA 4JKFA 3CPWM 4FWNA 1V4TA 4IJNA 5AQVA 5DM6L 4M42A 4PUOA 2VG5A 4YY3K 1X3MA 3WNHA 1CXUA 3W0LA 3HJFA 4Z4HA 1S9EA 2YKNA 3AO4A 4H5RA 4CD3A 4FVUA 2W42A 2QWRA 3ZSZA 1FXXA 1WAFA 4GMJB 3M8QA 4X64K 2RKIA 1S3XA 3M8SA 1JCGA 1QVGM 4B1UB 1WAJA 1ZXOA 1BISA 2E4LA 3SV3A 1L3SA 3J7YP 1NKEA 3SNNA 3NGYA 3W3DA 4IWVA 1KVCA 3MCPA 4DR1K 2QKBA 5M1QA 4DTPA 2A5XA 1S5JA 3OHRA 1CZ9A 4J8FA 4FWPA 3IMXA 1J6ZA 4B9LA 4C8OA 3QB0A 3DLKA 3RVCA 2ATQA 5J1EA 1R59O 2GX9A 2HBMA 3AV9A 4PL7A 3DLGA 4CEZA 3M8PA 2D0OA 3MX5A 1SV5A 4JS5A 2OANA 4F2SA 3BF1A 4DMNA 3P31A 1J53A 1GLEG 2E6MA 2VYPA 1T6CA 1RBVA 4L3QA 2O8BA 1RGIA 4CERA 2FF6A 4MO4A 1D9FA 2KLAA 4YOXA 1ILYA 1IJJA 3CCVN 1YIJN 3FZKA 3CJBA 2CGLA 3OS1A 4CEFA 3CJ1A 4H0PA 3BZKA 1F21A 4N5SA 4KTZA 3O8MA 1SS6A 3C6AA 2KFNA 4DSIA 4KTQA 2HHIA 2YNFA 1B92A 5AQGA 4B9VA 3OYNA 1WB9A 3KIOA 4G9ZA 4OO1J 4DV3K 4BR7A 3O4WA 3O3FA 3SMSA 1GLDG 1S1XA 4B8AB 3CQ8A 1WBDA 4NLCA 4CEEA 4JI5K 2A41A 2G8IA 3N4QA 1RCHA 4BR9A 2D0AA 4JI1K 4O5FA 3S5TA 4ISEA 4YDUC 4AM6A 2Z1JA 2AJQA 1N8RO 5CYMA 3IUCA 4B08A 4FYDA 2A6AA 4EHUA 3ATVA 3ULEB 3LPTA 3OJSA 3HO1A 3EL2A 4CEDA 4L8RB 4LF9K 4Y1DA 3CPEA 5KRTA 4DTRA 3WQTA 4F4KA 2V7YA 4ICLA 3AY9A 4BG9A 4F3TA 1TUYA 1VSEA 1HMVA 2FBXA 1FKPA 4OJRA 3VQBA 1JKHA 4BVPA 4Q0BA 3O5BA 4AQYK 5BPNA 2X6SA 1BCMA 4JKDA 2HHHK 4DG1A 4HVJA 1QQMA 4CHZA 2X78A 4FWKA 4CJKA 3OS0A 2A1RA 4PA1A 2QWOA 2LSNA 1YAGA 3P1GA 3SBGA 1K6YA 4CF8A 3HVTA 3WEEB 4DSFA 3JYTA 4KHUA 2Q2RA 3KLEA 3DLBA 3ZCMA 5AQJA 3OYEA 3T69A 3C7NA 3DMJA 4Q5VA 1SL2A 2Z1GA 4BC2A 1Z6RA 2O8CB 3PO5A 5AQPA 1NG9A 1GLCG 5C15A 4DQPA 5AQLA 3L2UA 2QXFA 3VA3A 4AF1A 4LSLA 2WFBA 4C23A 4E0DA 5EOYA 1UA0A 3SQ1A 3V81A 3IRXA 2QA4N 2E2NA 1DEJA 3SQ2A 1FJGK 4WE1A 2VG7A 4JLHA 3ZT3A 2VQEK 1L3UA 1TL3A 3HYFA 3O9RA 5ELZA 1NGAA 2HHUA 3MEEA 3S9HA 4JK7A 3K5OA 1C1AA 2VWBA 3RSEA 3M6GA 3TSPA 2BDPA 4M3YA 4IKFA 1S72N 5HBMA 4FJ5A 1EXQA 4OGCA 1KSPA 4KO0A 4FWSA 4DHYA 2PAVA 3ZX0A 3D45A 2NRRA 3VEXA 4BVOA 5AFUA 5EXWA 2D0BA 2F96A 4I7FA 3VTIA 1NJWA 3SQ0A 3L2WA 4I6MB 1NK7A 1FKOA 3RRHA 2DFHA 4A5AA 4O0JA 2GWKA 1CZBA 1CZAN 3ULDA 1FK9A 2E2QA 3ENBA 3E01A 1P90A 4X65K 3NE6A 4KB1A 4DTXA 4PY5A 1BO5O 2X6NA 2P9NA 5DM7L 3HOTA 3SV4A 4LF4K 1BG3A 4K0KK 1U49A 1RBUA 4BR2A 1ZC6A 2GWJA 2OZMA 3I8BA 4BRHA 3MEDA 3THYB 1T03A 4E7IA 3SUNA 3U4LA 2YNHA 1TGOA 2FBVA 2JWLA 3H3NO 4BE1A 4CZKA 4CVNE 3DJCA 1GOAA 2CGKA 4DR6K 4B9NA 1B9DA 4NYFA 4IEIA 1GOBA 3AVJA 4FZYA 1KXPA 3H45C 3D2FB 2F9WA 1TK8A 1T3VA 2PZSA 5M1NA 1JJ2M 2HW3A 3O9QA 2O8EA 4MFBA 1K8KA 5FRMA 3M3ZA 1KAYA 4CI6A 3CG7A 4K41A 3QBWA 4CHNA 4JI6K 4BREA 3MWPA 1CXQA 3IAYA 5J2QA 1GLFO 2D0CA 4M3TA 3THVA 5JS1A 1K8AO 4FJNA 4E1MA 3TPQA 1QS4A 2OPSA 4HUGA 4ISFA 3O08A 1BIUA 3ZSWA 3SPZA 4DS5A 1U45A 4B9QA 3WXJA 3E66A 1SKRA 1ZBIA 4LF8K 3F2KA 4MO5A 3ZETB 5HRNA 1I94K 2FXUA 2YHBA 3THXA 1NGJA 5M1FA 3VGKA 2RHKA 1U2VB 4IOCL 1WSEA 2G8HA 4PKHA 4CF0A 4FK0A 1BIZA 3PY8A 3E1YA 3QICA 4FCYA 3LDSA 1ASUA 4DTJA 5LY3A 2I5JA 2DFFA 4XH1A 4A5BA 4GKKK 2RF2A 4LFBK 1NNEA 4IDHA 1SL0A 5BPLA 4DU4A 1OH7A 1BA1A 1RT7A 2GEMA 2QTDA 2Q36A 4RWTA 3I0RA 2B4JA 4BC4A 5B8HA 3P38A 4PHTX 4MLHA 1RT2A 2P9IA 2DFEA 4GVMA 2O8DA 1BGXT 4IO8A 3CCJN 4BDZA 3B8AX 2YJEA 2A40A 4RCHA 4HHTA 3KLFA 1QSSA 1HKBA 4EZ9A 3MCAB 3ZSXA 4FLUA 4FK4A 2EWSA 1FW6A 3VGLA 3L8BA 3DXKA 3AO1A 1NGGA 4OX9K 3UKUA 1TL1A 1UA1A 4ISGA 4B3OA 2QK9A 2HSTA 3M1FA 1VSHA 1SZ2A 3TI0A 4DV1K 3AO5A 1L3VA 3WNGA 4NCGA 2WBNA 4KH4A 1SKSA 1HUXA 3ZSRA 3MN6A 3LDQA 3THWA 4H5WA 5H1SQ 1KFDA 5C2DA 4H0XB 2QM1A 5BRHA 5GAGP 2NLXA 1YITN 3VTHA 3VEYA 1X9MA 4B3MK 2H3GX 3CMAN 4BRNA 3FLCO 3R1XA 5FPNA 1RT5A 3DLHA 3NH2A 3RR7A 3I8DA 1KVBA 1WSFA 3AAPA 1MA9B 3SJHA 3JXUA 4BRKA 4K25A 4O8UA 5AZIB 3I55N 2HBLA 4NCBA 5AQYA 4AHUA 2IDOA 3PSIA 1BUPA 1IBMK 4FO0A 1O1WA 2RE2A 4J2EA 5KI6A 1RT6A 2Q0RA 4JHDB 1TKDA 4X62K 4DLEA 2ZE2A 4CJLA 4BRDA 3SYZA 3G0ZA 3PX0A 2UU9K 2EX3A 5AQUA 1X3NA 4AHRA 3FZHA 3PIPL 3HBTA 3EY1A 2UYTA 5BREA 3V4IA 4BR0A 3K5LA 2YKMA 1BCOA 4H8KA 5LMNK 1ASVA 3T1AA 3HSTB 4FPBA 4CJQA 5IWAK 3NMUA 4FLWA 3QEVA 4E89A 3HPGA 3S3MA 1KVAA 2YCHA 1Q7YO 1BOTO 3DXMA 5AZJA 3U3YA 4A2BA 4I2QA 4RW7A 4LFCK 3JSMA 3EKUA 1W9HA 3KWGA 1W7AA 3TAFA 2P9UB 3QEPA 2V52B 1RFQA 1RDAA 4B8CA 1C0GA 1XC3A 1W97L 3CQXA 4QCLA 4AHSA 3KLGA 2PFUA 3QDKA 1NOYA 3ID8A 2D0PA 5JICA 1KAXA 3GE1A 4M3RA 3WNFA 4DV0K 5HLFA 3LDNA 1Q81O 1I3AA 5F0XA 5FDLA 1K9MO 3AA4A 3AVLA 2UXDK 4M3XA 3QEIA 1HQEA 2QWQA 5BN8A 4JK9A 1HLUA 1NGFA 1WSHA 4FW2A 3G6EN 3HVRA 4UQGA 3CFRA 3K9JA 3NH0A 3D2EA 1HYVA 2FSJA 2YNGA 3FGUA 3GL1A 4LH4A 4IXCA 3VERA 2G8KA 3MXIA 3SAFA 4RTFD 3LWMA 2G8UA 2NRZA 4BQLA 3FR0A 4RW4A 3VQ8A 2NRVA 3HM8A 1O13A 5AQOA 3TSUA 3OYFA 4JI3K 5CE3A 1XC9A 4IBNA 5CZ2A 2QW9A 4Y1CA 3SUPA 2IGIA 3UKRB 1JXEA 2P1JA 4BRQA 3AA5X 2VG6A 4FLTA 4FL9A 4HTLA 4QS8A 3TU5A 1RBTA 1VRUA 3HI0A 4CIEA 2G8FA 5FROA 5ADXH 2RN2A 1U48A 1GLAG 1C0FA 3KKRA 1NK4A 1QHTA 2XY8A 3BEXA 3P5JA 3AVIA 4JNEA 4KHSA 4NXMK 3N4PA 4ID1A 1VQPN 4CZHA 3AGRA 4WQ5C 1LWCA 5DK5A 3CCSN 4DLGA 4BRFA 3M5RA 5HL7L 4LH5A 4KI6A 3MK6A 2R7YA 4DSKA 4EP4A 3U8XA 1I39A 1KRPA 3TAGA 1HJRA 4JI2K 2WC9A 4F2RA 3ZT0A 3TAEA 3ALYA 5AQWA 1TUUA 4DR2K 1E4FT 4DUZK 3SUOA 4OPHA 4YDUA 3MEGA 5JENA 4MQ3A 4BG8A 3MXMA 3ENOA 1DGKN 5CR4A 3DLRA 3AO2A 3BGRA 5E84A 3CQYA 3ZEUA 1UOCA
chains in the Genus database with same CATH topology
2V7ZA 2BTFA 2QA4N 2E2NA 5M1OA 5HOOA 3C6HA 4BRMA 1DEJA 3J7ZO 3NVKA 2A42A 4QS7A 1VQ5N 2F9TA 3IDHA 3R8EA 4JN4A 2QXLA 2ZGYA 4WFBL 4FOIA 1NGHA 4XH4A 3KK7A 2P9PA 3EO3A 4JKEA 3MN5A 3O9RA 3CMEN 5ELZA 3ZX2A 1NGAA 2P9KA 3FFKB 4KH6A 2WUSA 4JK7A 2VWBA 3RSEA 3M6GA 3TSPA 3OA9A 1NM1A 3A5MC 3WXIA 1S72N 3LDLA 4JKHA 4FWSA 1MDUB 1E4GT 4ILJA 2NNWA 5AQFA 3EZWA 4DHYA 3CCRN 2PAVA 4WYBA 4BR4A 3ZX0A 3VPZA 2NRRA 3ZYYX 3VEXA 1TYQB 3BUZB 3CERA 4BVOA 2QEXN 2FSKA 4B1WB 2QWNA 4H5VA 4YORA 3KWIA 5AFUA 4KBOA 4WQ5A 4DQ8A 1DT9A 5EXWA 4BRCA 3VTIA 5AQTA 3LM9A 3OBYA 4I6MB 2ZJPL 4A5AA 2GWKA 2P9IB 5EVZA 1CZAN 5GIOA 3ATUA 1QHAA 4FWOA 4CZLA 2E2QA 3ENBA 4AM7A 1P90A 3J8AA 3WUHA 1WOQA 5FPEA 5F2RA 1BO5O 3O9UA 3EKSA 3ULEA 2P9NA 1QZ6A 5C0YA 3PLAA 2F7TA 2NZTA 2E1ZA 4FWMA 4H5TA 4IJAA 3UKRA 5DM7L 3HOTA 4M7XA 1BA0A 1U6ZA 3HZ6A 3E9LA 1OKJA 3GG4A 1BG3A 4YOUA 1Z05A 3DXKB 4XJXA 3H46O 4BR2A 2NRXA 1ZC6A 2GWJA 3UKUB 3I8BA 4BRHA 2P9SA 5KQDA 3FZFA 5JLFA 4BEBA 4DB3A 4GY2B 3WXKA 5I9EB 3U4LA 2PBDA 3AAQA 1RDWX 1T44A 2JWLA 3H3NO 3O6WA 5AQQA 3C0BA 4A59A 4CZIA 1VQKN 4OPAA 5E26A 3TSQA 4CZKA 2I7PA 5C2FA 3O9TA 3KVGA 4O8KA 3DJCA 1H1VA 4IFEA 2CGKA 3UB5A 2IVPA 3EE8A 5AQXA 3UE5A 3WQUA 2I7NA 4FWRA 5KPZA 3G71N 1VQLN 4BRPA 3CC7N 4IEIA 4GV6A 5EX5A 1KXPA 3H45C 4WFAL 3D2FB 2F9WA 3OBWA 3DAWA 4CBWA 4H0OA 1T3VA 5M1NA 1JJ2M 3O9QA 3WEEA 5M1KA 3CC2N 1K8KA 1HKGA 3ZX3A 4CZJA 3VF6A 1ESVA 3M3ZA 4A61A 4Y0WA 1KAYA 2GELA 1P8ZA 4B1YB 5LJVA 4CI6A 1G99A 3KZBA 3HSCA 3QBWA 4K41A 3TTCA 3VENA 2E8AA 2BH1A 4IO9L 4BREA 4WQ4A 5AQMA 3MWPA 3HTVA 4WF9L 2FSNA 1GLFO 2P9LA 3D7EO 5AR0A 2VCPA 1KQSM 2YJFA 1ILYA 1V4SA 1M1KO 2Q0UA 3MDQA 3HRGA 4DCHA 1K8AO 2VGMA 2E2PA 3TPQA 1NGEA 5MLCQ 1NJIO 2HBKA 1HKCA 4A57A 4ISFA 1YI2N 5FPDA 3CD6N 3O08A 2KKZA 4A62A 3A8YA 4BROA 1Q86O 2BUPA 1VQ9N 4B9QA 4PKIA 1KC8O 2D1KA 3DWLA 3E66A 3MN9A 3WXJA 4CD1A 4BC5A 3F2KA 4MO5A 3ZETB 3A5OC 4BY9C 1HJOA 2CH5A 2FXUA 3JS6A 3VF4A 2JWKA 5EY4A 3R6MA 1NGJA 1HPMA 2V51B 3VGKA 5M1FA 3SMPA 3PIOL 5JVGL 3CCUN 2RHKA 1U2VB 3F9MA 4CBUA 4IOCL 1QQNA 2DPNA 3GDQA 4LC9B 4BC3A 2HF4A 2E88A 2D4WA 4PKHA 1VAZA 5BR9A 4DKWA 5AQKA 4IOXA 5TKYA 3E1YA 3FE1A 3QICA 3VESA 3T7ZA 1X9JA 1BWFO 2HF3A 2QWMA 2A3ZA 3AARA 3NVMA 3CCQN 1YHQN 2GUPA 5LY3A 3DXMB 3VGMA 1QQOA 3CETA 4PKGA 4XH1A 5AZJB 4BGAA 4YOVA 2IVNA 3CCMN 4A5BA 1YJWN 3CCEN 3CCLN 4C1NK 4CJ7A 3QBXA 1TYQA 1BDGA 4IDHA 4K42A 5BPLA 2AP1A 5JMVA 1BA1A 2Q31A 4XH5A 2GEMA 2QTDA 1ATRA 2E20A 2ZJRL 5KQ8A 2Q36A 4RWTA 1VQON 3CXCM 4WQ4C 3Q7CA 3LL3A 2ASMA 1YVNA 3P38A 4I6MA 2IVOA 4BC4A 4PHTX 5B8HA 4MLHA 3I56N 3LM2A 1KAZA 2J4RA 3O80A 4BE7B 2P9IA 1NLVA 1EO1A 3BP8A 3H1VX 4IO8A 4R79A 3B8AX 4PL8A 3CCJN 5BN9A 2YHXA 3CI5A 2QWPA 2YJEA 3S41A 4BECA 4WCEL 2A40A 4RCHA 4H0TB 4BRLA 3O1BA 4F9OA 2QWLA 1HKBA 3VEZA 5M1PA 3MCAB 5LJWA 4XEIA 3ID6A 2EWSA 3VGLA 1LCUA 3DXKA 2E2OA 5ADXA 1NGGA 3UKUA 4CZFA 1T6DA 3A0IX 4IEEA 4A2AA 2ZJQL 2NRTA 4U67L 1YXQA 4ISGA 2NRWA 4FSVA 4JKBA 1YF5L 3GOIA 1JCFA 3D2EB 4KH5A 2HSTA 2NRHA 3VMFB 3M1FA 3CC4N 3IFRA 1SZ2A 3LDPA 2HOEA 4B1XB 1MWKA 2W41A 3ENHA 2YHWA 3LDOA 1KD1O 2WBNA 4KH4A 1OVYA 1HUXA 4IOAL 3MN6A 3E9PA 5JVHL 3LDQA 4H5WA 5H1SQ 5C2DA 4H0XB 2QM1A 4NLBA 5BRHA 2ITMA 4CZGA 5GAGP 2C1IA 4MDBA 5BRFA 2NLXA 1YITN 3D2FA 3VTHA 3SK3A 3VEYA 3H1QA 2H3GX 1SQKA 3CMAN 5AFUH 3FLCO 3R1XA 5FPNA 4BRNA 1BU6O 1NGIA 4H0YB 4MDAA 5BRDA 1K73O 4JKGB 3QMLA 2ZF5O 3FZMA 4JK8A 3AAPA 3SLCA 1VQ6N 1MA9B 3SJHA 3JXUA 3CF5L 1YJNN 2OTLN 1NGDA 4BRKA 1LOTB 4K25A 4JD2B 4O8UA 5AZIB 1D4XA 3I55N 3L4QA 1XUPO 2HBLA 4JKFA 5KPRA 3CPWM 3AGKA 4FWNA 1V4TA 4H0VB 4IJNA 5AQVA 5AQYA 5DM6L 4BRAA 2AA4A 1QVFM 5AQSA 3VF2A 3TTDA 1X3MA 4E1JA 1YJ9N 1BUPA 3SAHA 4FO0A 2RE2A 2E1YA 5TKWA 3W0LA 5AQNA 4H5RA 4CD3A 4FVUA 2Q0RA 2QWRA 4JHDB 5GAHP 4JKAA 4HWIA 4BRDA 1S3XA 3MWTA 3CJ7A 3ZETA 1JCGA 1QVGM 4B1UB 5AQUA 1X3NA 2HMPA 1ZXOA 5C10A 3CJAA 3WT0A 3FZHA 3PIPL 2ZGZA 3HBTA 2UYTA 5BREA 1NWKA 3W3DA 4BR0A 1U2VA 3O9SA 4IWVA 3MCPA 1ATSA 1GLJO 3A5LC 1NGBA 1IG8A 3Q7BA 4FPBA 5M1QA 1VQNN 2A5XA 3OHRA 1VQ4N 4C1NI 3EN9A 4J8FA 4FWPA 5AQRA 4QS9A 3IMXA 3VEVA 3NMUA 1VQ7N 3CJ9A 1J6ZA 3WXMB 1S22A 3C7NB 3G4SN 2YCHA 3QB0A 1Q7YO 3RVCA 4CZMA 1BOTO 3MMVA 3DXMA 5AZJA 1ZBSA 4ILGB 3SBTA 1R59O 3KHYA 2GX9A 2HBMA 4PL7A 1NMDA 4A2BA 3SAGA 3EE9A 4EHTA 2D0OA 3MX5A 2KHOA 4BR5A 3EKUA 2OANA 3KWGA 1VQMN 2P9UB 1WUAA 2VGNA 2V52B 4BQZA 1RFQA 3VEWA 3BF1A 4EAHD 3L4IA 3P31A 1GLEG 4ILHA 2VYPA 1T6CA 3OW2M 1C0GA 4FPAA 1XC3A 4L3QA 1W97L 3CQXA 1RGIA 3ZEUB 4YOYA 3CJCA 4MLEA 2PFUA 2FF6A 3QDKA 4MO4A 3ID8A 2D0PA 2KLAA 4YOXA 5JICA 1IJJA 1KAXA 3HOSA 4M7YA 3FZKA 3CJBA 3GE1A 4H5NA 3CCVN 1YIJN 2CGLA 1QZ5A 3CJ1A 4H0PA 3LDNA 5C12A 5F0XA 1Q81O 1K9MO 3O8MA 3H3OB 1SS6A 3C6AA 3TTFA 2P9PB 3I33A 5AQIA 4EFHA 2QWQA 5BN8A 2Q97A 1HLUA 4JK9A 4JKCA 1NGFA 5AQZA 5CHIA 4UY8O 2P9KB 3D6RA 4FWQA 1EQYA 5AQGA 3G6EN 3F5TA 4G9ZA 3K9JA 4OO1J 5GADP 5JLHA 1MWMA 3RSEB 3WXLA 3C65A 3D2EA 5GAEP 3DLLL 4BR7A 2FSJA 3O4WA 3FGUA 3SMSA 3GL1A 1GLDG 1W2BM 1RDUA 4JAXA 1HX1A 2YHYA 3P39A 1NBWA 4IXCA 3VERA 3SAFA 4RTFD 3QFPA 4FWLA 1GLBG 2YX6A 4NLCA 2A41A 2NRZA 4FOEA 3N4QA 5FPMA 4BR9A 4JEPA 4BQLA 3QFUA 3FR0A 2NRVA 4O5FA 3U9DA 3HM8A 4NO7A 2OTJN 1O13A 4ISEA 5AQOA 3TSUA 3VOVA 4YDUC 4AM6A 4Z94A 4B1ZA 5CE3A 2Q1NA 1NGCA 1N8RO 4JKGA 3IUCA 4GV3A 2QW9A 2A6AA 3L6QA 3VEOA 4EHUA 4BGBA 3ATVA 1Y64A 3ULEB 2P9NB 3EL2A 3G25A 2W00A 3BF3A 5F1XA 3UKRB 4YOTA 5GIPA 4JD2A 4BRQA 2CGJA 5AZIA 3FZLA 3CPEA 4FL9A 4HTLA 2ZWHA 4B1VA 4QS8A 3TU5A 3VETA 3WQTA 1YUWA 2V7YA 4CZEA 4K43A 3R3LA 3AY9A 3CIPA 3HI0A 1TUYA 2P9SB 4BG9A 1VQ8N 3R9PA 1ATNA 5ADXH 4IZ9A 4EIAA 3MN7A 4YOWA 4JHDA 2W40A 4BVPA 1GLAG 1C0FA 2C1GA 3O5BA 5BPNA 5KPTA 4JKDA 1QQMA 3BEXA 4FWKA 4H03B 1DKGD 4JNEA 4CBXA 3N4PA 2QWOA 1GLLO 1VQPN 1YAGA 3AGRA 4WQ5C 4CZHA 3E9OA 3O1WA 3SBGA 4BRGA 3MX2A 2CH6A 3CCSN 2QI2A 3GBTA 3CHWA 4BRFA 3WEEB 3M5RA 5HL7L 1SAZA 5AQHA 2ASOA 4NB4A 2FF3B 2Q2RA 2YI1A 2HBJA 3L0QA 2IIRA 1K8KB 1Q18A 3MK6A 3P4IA 5GINA 1Q82O 5AQJA 3T69A 3C7NA 4U7BA 2GTDA 3U8XA 3H6EA 1M90O 4BC2A 1Z6RA 2WC9A 3U9ZA 5BPMA 4GNIA 1JCEA 5AQPA 2P9LB 4BRIA 1GLCG 5AQWA 5C15A 1TUUA 1E4FT 4OPHA 4YDUA 5AQLA 2P9UA 4AF1A 4WFNL 1XQSC 2WFBA 3IKMA 4BG8A 4C23A 3ENOA 1DGKN 5CR4A 3A5NC 4M63C 5EOYA 2FLOA 2ASPA 5E84A 3CQYA 4GVEA 3ZEUA 3K9KA 4GV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V7Z A;  2BTF A;  2E2N A;  4BRM A;  1DEJ A;  2A42 A;  4QS7 A;  2F9T A;  3IDH A;  3R8E A;  4JN4 A;  2QXL A;  2ZGY A;  4FOI A;  1NGH A;  4XH4 A;  2P9P A;  3EO3 A;  3MN5 A;  5ELZ A;  3ZX2 A;  1NGA A;  2P9K A;  3FFK B;  2WUS A;  2VWB A;  3RSE A;  3M6G A;  1NM1 A;  3A5M C;  3WXI A;  3LDL A;  4FWS A;  1MDU B;  1E4G T;  4DHY A;  5AQF A;  3EZW A;  2PAV A;  4WYB A;  4BR4 A;  3ZX0 A;  3VPZ A;  3VEX A;  1TYQ B;  3BUZ B;  3CER A;  4BVO A;  2FSK A;  4B1W B;  2QWN A;  4H5V A;  5AFU A;  4KBO A;  4WQ5 A;  4DQ8 A;  5EXW A;  4BRC A;  5AQT A;  3LM9 A;  4I6M B;  2GWK A;  2P9I B;  5EVZ A;  1CZA N;  3ATU A;  1QHA A;  4FWO A;  4CZL A;  2E2Q A;  4AM7 A;  3J8A A;  3WUH A;  1WOQ A;  5FPE A;  5F2R A;  1BO5 O;  3EKS A;  3ULE A;  2P9N A;  1QZ6 A;  2NZT A;  4FWM A;  2E1Z A;  4H5T A;  4IJA A;  3UKR A;  4M7X A;  1BA0 A;  1U6Z A;  3HZ6 A;  1OKJ A;  3GG4 A;  1BG3 A;  1Z05 A;  3DXK B;  3H46 O;  4BR2 A;  1ZC6 A;  2GWJ A;  3UKU B;  3I8B A;  4BRH A;  2P9S A;  5KQD A;  3FZF A;  5JLF A;  4DB3 A;  4GY2 B;  3WXK A;  5I9E B;  3U4L A;  2PBD A;  3AAQ A;  1RDW X;  1T44 A;  3O6W A;  3H3N O;  5AQQ A;  4CZI A;  3C0B A;  5E26 A;  4CZK A;  2I7P A;  3KVG A;  4O8K A;  3DJC A;  1H1V A;  2CGK A;  3UB5 A;  2IVP A;  5AQX A;  3UE5 A;  3WQU A;  2I7N A;  4FWR A;  5KPZ A;  4BRP A;  5EX5 A;  1KXP A;  3H45 C;  3D2F B;  2F9W A;  3DAW A;  4CBW A;  4H0O A;  3WEE A;  1K8K A;  1HKG A;  3ZX3 A;  4CZJ A;  3VF6 A;  1ESV A;  3M3Z A;  4A61 A;  4Y0W A;  1KAY A;  2GEL A;  1P8Z A;  4B1Y B;  5LJV A;  4CI6 A;  1G99 A;  3KZB A;  3HSC A;  3QBW A;  4K41 A;  3VEN A;  2E8A A;  4BRE A;  4WQ4 A;  5AQM A;  3HTV A;  2FSN A;  1GLF O;  2P9L A;  3D7E O;  5AR0 A;  2VCP A;  2YJF A;  1V4S A;  2Q0U A;  3MDQ A;  4DCH A;  2E2P A;  3TPQ A;  1NGE A;  1HKC A;  4ISF A;  5FPD A;  3O08 A;  4A62 A;  3A8Y A;  4BRO A;  2BUP A;  4B9Q A;  4PKI A;  2D1K A;  3DWL A;  3MN9 A;  3WXJ A;  4CD1 A;  4BC5 A;  3ZET B;  4MO5 A;  3A5O C;  1HJO A;  2CH5 A;  2FXU A;  3JS6 A;  3VF4 A;  5EY4 A;  3R6M A;  1NGJ A;  1HPM A;  2V51 B;  3VGK A;  3SMP A;  4CBU A;  1U2V B;  3F9M A;  1QQN A;  2DPN A;  3GDQ A;  4LC9 B;  4BC3 A;  2HF4 A;  2E88 A;  2D4W A;  4PKH A;  5BR9 A;  5AQK A;  5TKY A;  3FE1 A;  3QIC A;  3VES A;  1X9J A;  1BWF O;  2HF3 A;  2QWM A;  2A3Z A;  3AAR A;  2GUP A;  5LY3 A;  3DXM B;  3VGM A;  1QQO A;  3CET A;  4PKG A;  4XH1 A;  5AZJ B;  4BGA A;  2IVN A;  4CJ7 A;  3QBX A;  1TYQ A;  1BDG A;  4K42 A;  5BPL A;  2AP1 A;  5JMV A;  1BA1 A;  2Q31 A;  4XH5 A;  2GEM A;  1ATR A;  2E20 A;  5KQ8 A;  2Q36 A;  4RWT A;  4WQ4 C;  4BC4 A;  3LL3 A;  2ASM A;  1YVN A;  4I6M A;  5B8H A;  2IVO A;  4MLH A;  3LM2 A;  1KAZ A;  2J4R A;  3O80 A;  2P9I A;  1NLV A;  3BP8 A;  3H1V X;  4IO8 A;  3B8A X;  4PL8 A;  5BN9 A;  2YHX A;  3CI5 A;  2QWP A;  2YJE A;  3S41 A;  2A40 A;  4RCH A;  4H0T B;  4BRL A;  3O1B A;  4F9O A;  2QWL A;  1HKB A;  3VEZ A;  5LJW A;  4XEI A;  2EWS A;  3VGL A;  1LCU A;  3DXK A;  2E2O A;  5ADX A;  1NGG A;  3UKU A;  4CZF A;  1T6D A;  3A0I X;  4A2A A;  1YXQ A;  4ISG A;  4FSV A;  3GOI A;  1JCF A;  3D2E B;  2NRH A;  3M1F A;  3IFR A;  1SZ2 A;  3LDP A;  2HOE A;  4B1X B;  1MWK A;  2W41 A;  3ENH A;  2YHW A;  3LDO A;  1HUX A;  3MN6 A;  3LDQ A;  4H5W A;  4H0X B;  2QM1 A;  5BRH A;  2ITM A;  4CZG A;  5BRF A;  2NLX A;  3D2F A;  3SK3 A;  3VEY A;  3H1Q A;  2H3G X;  1SQK A;  5AFU H;  3FLC O;  5FPN A;  4BRN A;  5BRD A;  1BU6 O;  1NGI A;  4H0Y B;  3QML A;  2ZF5 O;  3FZM A;  3AAP A;  3SLC A;  1MA9 B;  3SJH A;  3JXU A;  1NGD A;  4BRK A;  1LOT B;  4K25 A;  4JD2 B;  5AZI B;  1D4X A;  1XUP O;  5KPR A;  4H0V B;  4FWN A;  1V4T A;  4IJN A;  5AQV A;  5AQY A;  4BRA A;  2AA4 A;  5AQS A;  3VF2 A;  1X3M A;  4E1J A;  1BUP A;  4FO0 A;  2E1Y A;  3W0L A;  5AQN A;  4H5R A;  4CD3 A;  2Q0R A;  2QWR A;  4JHD B;  4HWI A;  4BRD A;  1S3X A;  3ZET A;  3CJ7 A;  1JCG A;  4B1U B;  5AQU A;  1X3N A;  2HMP A;  1ZXO A;  3CJA A;  3WT0 A;  3FZH A;  2ZGZ A;  3HBT A;  2UYT A;  5BRE A;  1NWK A;  3W3D A;  4BR0 A;  1U2V A;  4IWV A;  3MCP A;  1ATS A;  1GLJ O;  3A5L C;  1NGB A;  1IG8 A;  4FPB A;  2A5X A;  3OHR A;  3EN9 A;  4J8F A;  4FWP A;  5AQR A;  4QS9 A;  3IMX A;  3VEV A;  3CJ9 A;  1J6Z A;  1S22 A;  3C7N B;  2YCH A;  3QB0 A;  4CZM A;  1BOT O;  3MMV A;  3DXM A;  5AZJ A;  1ZBS A;  1R59 O;  3KHY A;  4PL7 A;  1NMD A;  4A2B A;  4EHT A;  2D0O A;  2KHO A;  4BR5 A;  3EKU A;  2OAN A;  2P9U B;  1WUA A;  2V52 B;  4BQZ A;  1RFQ A;  3VEW A;  3BF1 A;  4EAH D;  3L4I A;  1GLE G;  2VYP A;  1T6C A;  1C0G A;  4FPA A;  1XC3 A;  4L3Q A;  3CQX A;  1RGI A;  3ZEU B;  3CJC A;  4MLE A;  2FF6 A;  3QDK A;  4MO4 A;  3ID8 A;  2D0P A;  5JIC A;  1IJJ A;  1KAX A;  4M7Y A;  3FZK A;  3CJB A;  3GE1 A;  4H5N A;  2CGL A;  1QZ5 A;  3CJ1 A;  4H0P A;  3LDN A;  5F0X A;  3O8M A;  3H3O B;  4EFH A;  2P9P B;  3I33 A;  5AQI A;  2QWQ A;  5BN8 A;  2Q97 A;  1HLU A;  1NGF A;  5AQZ A;  2P9K B;  4FWQ A;  1EQY A;  5AQG A;  5JLH A;  1MWM A;  3RSE B;  3WXL A;  3D2E A;  4BR7 A;  2FSJ A;  3O4W A;  3FGU A;  3SMS A;  3GL1 A;  1GLD G;  4JAX A;  1HX1 A;  2YHY A;  4IXC A;  1NBW A;  3VER A;  4RTF D;  3QFP A;  4FWL A;  1GLB G;  2A41 A;  4FOE A;  5FPM A;  4BR9 A;  4BQL A;  3QFU A;  3FR0 A;  4O5F A;  3U9D A;  3HM8 A;  4NO7 A;  4ISE A;  5AQO A;  3VOV A;  4YDU C;  4AM6 A;  4Z94 A;  4B1Z A;  5CE3 A;  2Q1N A;  1NGC A;  3IUC A;  2QW9 A;  2A6A A;  3L6Q A;  3VEO A;  4EHU A;  4BGB A;  3ATV A;  1Y64 A;  3ULE B;  2P9N B;  3EL2 A;  3G25 A;  3BF3 A;  5F1X A;  3UKR B;  4JD2 A;  4BRQ A;  2CGJ A;  5AZI A;  3FZL A;  4FL9 A;  4HTL A;  4B1V A;  2ZWH A;  4QS8 A;  3TU5 A;  3VET A;  3WQT A;  1YUW A;  2V7Y A;  4CZE A;  4K43 A;  3AY9 A;  3CIP A;  3HI0 A;  1TUY A;  2P9S B;  4BG9 A;  3R9P A;  1ATN A;  5ADX H;  4IZ9 A;  4EIA A;  3MN7 A;  4JHD A;  2W40 A;  4BVP A;  1GLA G;  1C0F A;  3O5B A;  5BPN A;  5KPT A;  1QQM A;  3BEX A;  4FWK A;  4H03 B;  1DKG D;  4JNE A;  4CBX A;  2QWO A;  1GLL O;  1YAG A;  4CZH A;  4WQ5 C;  3O1W A;  4BRG A;  2CH6 A;  3GBT A;  3CHW A;  4BRF A;  3WEE B;  1SAZ A;  5AQH A;  2ASO A;  4NB4 A;  2FF3 B;  2Q2R A;  2YI1 A;  3L0Q A;  3MK6 A;  2IIR A;  1K8K B;  1Q18 A;  3P4I A;  5AQJ A;  3C7N A;  2GTD A;  3U8X A;  3H6E A;  4BC2 A;  1Z6R A;  3U9Z A;  5BPM A;  4GNI A;  1JCE A;  5AQP A;  2P9L B;  4BRI A;  1GLC G;  5AQW A;  1TUU A;  1E4F T;  5AQL A;  4YDU A;  2P9U A;  1XQS C;  4BG8 A;  4C23 A;  3ENO A;  1DGK N;  3A5N C;  4M63 C;  5EOY A;  2FLO A;  2ASP A;  5E84 A;  3CQY A;  3ZEU A; 
#chains in the Genus database with same CATH topology
 5C25 A;  2D5R A;  1D9D A;  3J7Z O;  2A42 A;  3CM6 A;  3IDH A;  2QXL A;  1G15 A;  4FOI A;  1TKX A;  1WLJ A;  2P9P A;  4KHW A;  1EWR A;  3H08 A;  3MN5 A;  2O8F A;  1NK5 A;  3KD1 E;  3KLH A;  3ZX2 A;  2P9K A;  1IBK K;  3FFK B;  4I9Q A;  2KW4 A;  1T05 A;  3A5M C;  3C94 A;  1VSF A;  1LV5 A;  2NNW A;  3T3F A;  1EWQ A;  1U4B A;  1DTQ A;  2FSK A;  2QWN A;  1N36 K;  1RBR A;  3KWI A;  1T8E A;  5AQT A;  3LM9 A;  3I0S A;  1JLF A;  1WN7 A;  3ATU A;  4FWO A;  4AM7 A;  5FPE A;  1ZBH A;  5C0Y A;  4CK1 A;  4N56 A;  4FWM A;  1Q9Y A;  1U6Z A;  3HZ6 A;  5HRS A;  3CYM A;  3EZ5 A;  1Z05 A;  4CJW A;  1ITG A;  2P9S A;  5KQD A;  5JLF A;  3CFP A;  1ASW A;  3MEC A;  4C8K A;  3AAQ A;  4CZI A;  3O6W A;  4Z4I A;  2W6L A;  4OPA A;  2I7P A;  5C2F A;  3O9T A;  5C42 A;  3UB5 A;  2IVP A;  2IC3 A;  4CE9 A;  1X9W A;  3WQU A;  2I7N A;  3AO3 A;  3K5N A;  4ZTF A;  4GV6 A;  3EYZ A;  1SL1 A;  4CJ4 A;  3TAQ A;  4CBW A;  3AVG A;  4H0O A;  3TAP A;  3V1Q A;  4GW6 A;  1QE1 A;  3ZX3 A;  1HKG A;  3ZT1 A;  3LWL A;  1U47 A;  4KTW A;  1OH8 A;  1G99 A;  3KZB A;  2E8A A;  4WQ4 A;  1S6P A;  1WSJ A;  4WF9 L;  3QLH A;  2P5O A;  4RG8 A;  2P9L A;  2VCP A;  3HPO A;  2YJF A;  5K14 A;  1V4S A;  2OYQ A;  2Q0U A;  3HRG A;  4DCH A;  4OPK A;  2VGM A;  3QIN A;  3QES A;  1NJI O;  5MLC Q;  4K8Z A;  2HBK A;  1HKC A;  1XHX A;  3O3G A;  1VSJ A;  1TV6 A;  1Q86 O;  3OYL A;  4XIU A;  1KC8 O;  2D1K A;  3MXJ A;  2DTU A;  2JLE A;  3D0P A;  4FXD A;  3OY9 A;  5BR8 K;  1IO2 A;  1HJO A;  4DWI A;  3B6P A;  1HPM A;  1HYZ A;  2V51 B;  5J2M A;  5JVG L;  4CBU A;  4FM2 A;  3OYH A;  4BC3 A;  1E3M A;  1SUQ A;  4CIG A;  2E88 A;  3DOK A;  2D4W A;  1YTU A;  4CFD A;  4DKW A;  5TKY A;  3VES A;  2B5J A;  2F8T A;  2BGG A;  3V1O A;  4DV6 K;  3K59 A;  4JRP A;  2OA8 A;  3VGM A;  4PKG A;  1NJY A;  2IVN A;  1MU2 A;  4FVM A;  2UXB K;  3OVN A;  4CJ7 A;  1TYQ A;  5JMV A;  2Q31 A;  3OTO K;  4CGI A;  4DR5 K;  2E20 A;  3RMC A;  4DTN A;  4WQ4 C;  4CEB A;  2ASM A;  3I56 N;  1KAZ A;  1UAX A;  3O80 A;  1B9F A;  1EO1 A;  1L5U A;  1XI1 A;  2O8B B;  3BP8 A;  1BI4 A;  3H1V X;  3KJV A;  2YHX A;  4H0T B;  1WSI A;  4F9O A;  4DTU A;  2QWL A;  3DYA A;  2Q3S A;  4XEI A;  4IFY A;  4E7K A;  1LCU A;  3OYG A;  1T6D A;  4RW8 A;  2ITG A;  3QO9 A;  4JI4 K;  2NRW A;  4FSV A;  4LY7 A;  1YF5 L;  1SKW A;  4KH5 A;  4O4G A;  2NRH A;  3S3N A;  3VMF B;  4CJS A;  2HOE A;  2YHW A;  3LDO A;  1BQM A;  4CJV A;  4IOA L;  3AVC A;  4CJF A;  3P83 D;  4KFB A;  2FBT A;  4NLB A;  3IS9 A;  4YNQ A;  4W5N A;  1NK6 A;  2C1I A;  4MDB A;  4E7L A;  1VSL A;  1HQU A;  4KKO A;  2UUC K;  5BRD A;  4DQI A;  4DV2 K;  1XMQ K;  1K73 O;  3QML A;  4Z4C A;  2ZF5 O;  1HPZ A;  3KTQ A;  4CHQ A;  4DV4 K;  1VQ6 N;  1YJN N;  2HND A;  3K0S A;  3EEQ A;  3AGK A;  3O4Q A;  4H0V B;  1VSD A;  4BRA A;  2AA4 A;  3HXM A;  1QVF M;  1RTD A;  3TTD A;  1YT3 A;  1YJ9 N;  4DU3 A;  3F9K A;  4B3R K;  5AQN A;  4C8N A;  5GAH P;  1R0A A;  4HWI A;  2VWK A;  1ZBL A;  3QIP A;  3MWT A;  2ETJ A;  2HMP A;  5C10 A;  3VQP A;  2X74 A;  1XWL A;  2ZGZ A;  4X66 K;  1ATS A;  1NU0 A;  3A5L C;  4B3T K;  2E5L K;  1IG8 A;  4M3W A;  1VQN N;  3VN5 A;  1VQ4 N;  2YNI A;  4QS9 A;  3ZSO A;  2XRI A;  3SCX A;  1IKY A;  2ZM6 K;  3C7N B;  3G4S N;  3V6D A;  5E41 A;  1IKW A;  4DS4 A;  2F8S A;  4BWJ A;  3KHY A;  1LWE A;  1NMD A;  3EE9 A;  3VQE A;  4EHT A;  4ELV A;  4BR5 A;  1HNZ K;  1T7P A;  1OVQ A;  3NDK A;  2VGN A;  4EAH D;  2GBZ A;  3VEW A;  4BQZ A;  3AVK A;  4JRQ A;  3OW2 M;  4W5T A;  4YOY A;  3LPU A;  4MLE A;  4OKK A;  4M45 A;  4K8X A;  2G8W A;  3HOS A;  3RWU A;  3LP1 A;  1QZ5 A;  3NF9 A;  4OPJ A;  3K58 A;  3H3O B;  1N33 K;  3TTF A;  3I33 A;  5AQI A;  5CHI A;  4G1Q A;  1QSL A;  3D6R A;  1EQY A;  4E7H A;  4DU1 A;  5JLH A;  5J2P A;  3RSE B;  3C65 A;  5GAE P;  2BE2 A;  4B9T A;  4JAX A;  1HX1 A;  3P39 A;  1NBW A;  4CF2 A;  1VK0 A;  4OLA A;  3QFP A;  3QNO A;  1GLB G;  3ZT2 A;  2YX6 A;  1NJX A;  3S3O A;  4KV8 A;  1NJZ A;  2UUB K;  4KHQ A;  1JLG A;  4EP5 A;  3SJJ A;  3OS2 A;  1XMO K;  1NK0 A;  3U9D A;  3KK3 A;  2OTJ N;  4ELT A;  2HB5 A;  3VOV A;  1Y97 A;  4Z94 A;  1NK8 A;  1NMN A;  2Q1N A;  4DF4 A;  4JKG A;  1RDC A;  1TKZ A;  4J2D A;  3L6Q A;  4CEO A;  4C8L A;  4BGB A;  4FW1 A;  2P9N B;  1S1T A;  3G25 A;  3BF3 A;  4YOT A;  4KRE A;  3J81 O;  4JD2 A;  2CGJ A;  2ZQB A;  3FZL A;  5FRN A;  2ZWH A;  1RTJ A;  3VET A;  4BDY A;  3O4N A;  4CZE A;  4K43 A;  3R3L A;  3ZT4 A;  3CIP A;  2Y1J A;  1VQ8 N;  3OYC A;  1S9G A;  4CJU A;  4EIA A;  3MN7 A;  3JAM O;  2VQF K;  1JLC A;  4YOW A;  4JYA K;  5C24 A;  2W40 A;  3QNN A;  5CY4 A;  5KPT A;  3PUF A;  2YV0 X;  4CHP A;  4IDK A;  4TSX A;  3KLI A;  3OYI A;  1DKG D;  5CZ1 A;  4CBX A;  1RTI A;  1GLL O;  1Z25 A;  4DUY K;  3O1W A;  4BRG A;  3MX2 A;  3J80 O;  2WOM A;  3DOL A;  3LAN A;  2O8E B;  1SAZ A;  5AQH A;  2ASO A;  4NB4 A;  4CW7 B;  2FF3 B;  2YI1 A;  2HBJ A;  1Q82 O;  2IIR A;  1K8K B;  3P4I A;  5I3U A;  4U7B A;  4Z4F A;  4CGH A;  1RIL A;  3KK2 A;  5BPM A;  4CHO A;  3RMD A;  1JCE A;  4BRI A;  4IFV A;  1RDB A;  1N6Q A;  4ELU A;  1DLO A;  4WFN L;  1XQS C;  3IKM A;  3A5N C;  2ASP A;  4HUF A;  3RRG A;  3K9K A;  2PYL A;  4GV9 A;  5SZT A;  3T1H K;  2V7Z A;  2BTF A;  4DFJ A;  5J2N A;  3AVB A;  3PX6 A;  3NVK A;  4QS7 A;  3R8E A;  4WFB L;  2ZGY A;  4O0I A;  3THX B;  4HCB A;  2OZS A;  4FLV A;  4JKE A;  4CF9 A;  2OPQ A;  4E72 A;  2IS3 A;  3LAM A;  4KH6 A;  2WUS A;  3QIO A;  3VQD A;  3U6F A;  4I2P A;  4JI0 K;  3HT3 A;  3WXI A;  3LDL A;  4FJM A;  1BHL A;  1MDU B;  1E4G T;  1IKV A;  3EZW A;  5AQF A;  3CCR N;  3SPY A;  4KHP K;  3VPZ A;  5KGX A;  4B9M A;  2XY5 A;  4B9U A;  3F73 A;  1RDD A;  4WQ5 A;  1DT9 A;  1RBS A;  1JXB A;  4BRC A;  3OBY A;  2HHQ A;  4KHY A;  2P9I B;  4FJ7 A;  5GIO A;  2O8D B;  1QHA A;  2JGU A;  3T19 A;  3J8A A;  3WUH A;  1Z26 A;  4J2A A;  3O9U A;  3ULE A;  1U04 A;  2KTQ A;  2NZT A;  2E1Z A;  4IJA A;  4H4O A;  4M7X A;  3HK2 A;  3K5M A;  3L2V A;  4E19 A;  3DXK B;  3H46 O;  2NRX A;  3UKU B;  4I9L A;  4DFM A;  3FZF A;  4DSJ A;  4BEB A;  4N76 A;  3WXK A;  2PBD A;  1GOC A;  1JLA A;  1VQK N;  4A59 A;  3C0B A;  4BDP A;  4OGE A;  4LSN A;  3CM5 A;  3G10 A;  2KQ2 A;  4O8K A;  1H1V A;  1ZYQ A;  4FJI A;  3THW B;  3EE8 A;  4FM0 A;  3VQ9 A;  3UE5 A;  1VQL N;  3G71 N;  2Y1I A;  2HMI A;  3K2P A;  3AVN A;  4FZZ A;  2EHG A;  5EX5 A;  4WFA L;  3OBW A;  4FJL A;  4CGF A;  3V1R A;  2WON A;  5KRS A;  2P51 A;  4ZHR A;  1XNR K;  3ITH A;  3WEE A;  3VA0 A;  5M1K A;  4DQR A;  3CC2 N;  5LL6 Z;  4CZJ A;  1ESV A;  4Y0W A;  1JLE A;  1P8Z A;  4B1Y B;  5LJV A;  1W0H A;  3HSC A;  3ZSY A;  2BH1 A;  1J5E K;  2O8C A;  3C6T A;  3D7E O;  5AR0 A;  1KQS M;  3C6U A;  4HTU A;  4CGJ A;  2E2P A;  4RW6 A;  3TAM A;  4PQU A;  1VSI A;  1YI2 N;  1XNQ K;  4A62 A;  4BRO A;  4Z4G A;  2BUP A;  4PKI A;  5HP1 A;  1C0T A;  4BC5 A;  3KKS A;  4ZTJ A;  4BY9 C;  3JS6 A;  3VF4 A;  3R6M A;  3PIO L;  1VHX A;  3CCU N;  5SWM A;  4CK3 A;  4LC9 B;  1QTM A;  4O5B A;  5JS2 A;  5BR9 A;  3PX4 A;  3FE1 A;  3T7Z A;  4OKE A;  3RTV A;  1OH6 A;  2QWM A;  2A3Z A;  2HNZ A;  1RT3 A;  3NVM A;  2WTU A;  4FLY A;  4CFC A;  2GUP A;  3DXM B;  1QQO A;  3CET A;  5AZJ B;  1YJW N;  3CCE N;  4BAC A;  3CCL N;  4C1N K;  3QBX A;  2AP1 A;  5AJ3 K;  4XH5 A;  1Q9X A;  2ZJR L;  3ZLJ A;  1HNW K;  3Q7C A;  3LL3 A;  4I6M A;  1YVN A;  5JVH L;  2IVO A;  3HP6 A;  4B3S K;  1NLV A;  4DFP A;  4R79 A;  4OKJ A;  5BN9 A;  4FJJ A;  3CI5 A;  2XHB A;  2QWP A;  4QOZ B;  4BEC A;  1EET A;  4PWD A;  1REV A;  3BY5 A;  3PSF A;  5LJW A;  1CLQ A;  2OPP A;  2Z1H A;  3ID6 A;  4W5Q A;  4CGG A;  3NF6 A;  5ADX A;  2E2O A;  4DTS A;  1LAV A;  4IEE A;  4FJX A;  3THY A;  3SQ4 A;  4CJR A;  1YXQ A;  4W5O A;  2QKK A;  4LF5 K;  3GOI A;  3D2E B;  4OVL A;  3NHG A;  5KTQ A;  4B1X B;  1MWK A;  4OLB A;  3L2Q A;  2HNY A;  1NKC A;  1N34 K;  4CZG A;  3O3H A;  3D2F A;  3H1Q A;  1SQK A;  5AFU H;  1NGI A;  4MDA A;  4O44 A;  3FFI A;  5DMR A;  4M3U A;  5FLX O;  1BL3 A;  5HRR A;  3V9W A;  1WBB A;  4M41 A;  4JK8 A;  3SLC A;  3J7A P;  2OTL N;  1J54 A;  1NGD A;  4QAG A;  4RW9 A;  4V19 S;  2IAJ A;  3V9U A;  1LOT B;  2OCE A;  2KFZ A;  3LZI A;  1XUP O;  1S1U A;  5KPR A;  3VQ6 A;  2GUI A;  5AQS A;  4FLZ A;  3VF2 A;  4E1J A;  3SAH A;  2E1Y A;  1HNI A;  5TKW A;  3NFA A;  2FBY A;  4CEC A;  4JKA A;  3B6O A;  4LF7 K;  1S1V A;  3HP9 A;  3DLE A;  3ZET A;  3CJ7 A;  1S6Q A;  4E1N A;  4CK2 A;  3TWH A;  3CJA A;  3WT0 A;  3KD5 E;  2P5G A;  1NWK A;  5HRO A;  1U2V A;  3O9S A;  3CFO A;  1GLJ O;  3TR8 A;  5IT9 O;  1NGB A;  3Q7B A;  4CEQ A;  3HM9 A;  4C1N I;  3EN9 A;  5AQR A;  4F8R A;  3VEV A;  1VQ7 N;  3L2R A;  3CJ9 A;  3WXM B;  1S22 A;  4FJ9 A;  3K57 A;  1IG9 A;  4FJK A;  4CZM A;  1KFS A;  3MMV A;  1ZBS A;  4ILG B;  3SBT A;  2O4I A;  4FJ8 A;  1EX4 A;  4KB0 A;  3SAG A;  4EZ6 A;  3BDP A;  2KHO A;  3ISN C;  3TAB A;  4YFU A;  1VQM N;  1WUA A;  3AA2 A;  3NBP A;  3NCI A;  4FLX A;  4CFB A;  3L4I A;  4Z4E A;  4ILH A;  4AHC A;  4FPA A;  3ZEU B;  3CJC A;  2G8V A;  5LMU K;  2BAN A;  1NOZ A;  4HCC A;  4M7Y A;  4H5N A;  4FJH A;  1DTT A;  5C12 A;  2PY5 A;  1X9S A;  1HRH A;  4FM1 A;  4EFH A;  2P9P B;  2O8F B;  3NF8 A;  2Q97 A;  4JKC A;  5AQZ A;  4UY8 O;  2P9K B;  4FWQ A;  3SI6 A;  3F5T A;  5GAD P;  4NCA A;  1MWM A;  3WXL A;  3DLL L;  3ZSQ A;  2RPI A;  4HUE A;  1W2B M;  1RDU A;  2YHY A;  4FWL A;  3AVA A;  3LZJ A;  3VQQ A;  4FOE A;  1JLQ A;  5FPM A;  3NH1 A;  4JEP A;  3QFU A;  4NO7 A;  2YHA A;  4B1Z A;  1NGC A;  3VQC A;  3ZSV A;  4CIF A;  4GV3 A;  4KRF A;  3VEO A;  3TAR A;  3CYG A;  2OPR A;  1Y64 A;  2W00 A;  5F1X A;  5GIP A;  2XY6 A;  5AZI A;  3MAQ A;  2UUA K;  1KLN A;  1HNV A;  4B1V A;  3OYJ A;  4GKJ K;  1YUW A;  1HYS A;  1KCF A;  2P9S B;  4CF1 A;  3V9X A;  3OJU A;  3VQ4 A;  3DRP A;  3R9P A;  1ATN A;  4IZ9 A;  4CEA A;  4LF6 K;  4N41 A;  1KTQ A;  3C95 A;  3RMB A;  3OYM A;  1XHZ A;  4JHD A;  2C1G A;  3QEW A;  4H03 B;  2HHV A;  3LP3 A;  3SUQ A;  1YVU A;  3DRR A;  4M3Z A;  3E9O A;  3PV8 A;  2CH6 A;  2QI2 A;  3GBT A;  4DSL A;  3CHW A;  4FZX C;  2O4G A;  1M90 O;  3L0Q A;  5GIN A;  2B6A A;  1Q18 A;  1RNH A;  1J9A A;  3LP0 A;  4CGD A;  2GTD A;  3H6E A;  1LAW A;  3U9Z A;  3BZC A;  4GNI A;  3SZ2 A;  1N32 K;  2P9L B;  4CCH A;  4JI7 K;  3IG1 A;  1JL2 A;  4ID5 A;  4DR7 K;  4BE2 A;  2HVI A;  2P9U A;  1JLB A;  4M63 C;  2FLO A;  4GVE A;  4O55 A;  3QER A;  3DRS A;  5M1O A;  3LAL A;  5HOO A;  3C6H A;  4BRM A;  4JI8 K;  1VQ5 N;  2F9T A;  3OYA A;  1C1C A;  1D5A A;  4JN4 A;  3VQ7 A;  1A5W A;  1NGH A;  4DF8 A;  4XH4 A;  3KK7 A;  3EO3 A;  5KGW A;  1TVR A;  2DY4 A;  3M8R A;  1IBL K;  3CME N;  4H4M A;  1KLM A;  4DFK A;  1C6V A;  3OA9 A;  5I42 A;  1NM1 A;  3L3V A;  4JKH A;  1RTH A;  4DR3 K;  4ILJ A;  3ASM A;  2VWJ A;  2F4V K;  4WYB A;  4BR4 A;  4DSE A;  3L3U A;  4KPY A;  3ZYY X;  1ZBF A;  3VQ5 A;  1TYQ B;  3BUZ B;  1YTA A;  3AVM A;  3CER A;  2QEX N;  1LW0 A;  4B1W B;  2HHW A;  4H5V A;  4YOR A;  4KBO A;  4DQ8 A;  1QSY A;  4R5P A;  2ZJP L;  4F3O A;  5EVZ A;  3LAK A;  4CZL A;  1VRT A;  1BI4 B;  4DTO A;  1WOQ A;  5F2R A;  2XO7 A;  4KHN A;  3EKS A;  1IH7 A;  1BQN A;  1QZ6 A;  3PLA A;  1C1B A;  1NKB A;  2F7T A;  3UKR A;  4H5T A;  3DI6 A;  1BA0 A;  1UWB A;  3E9L A;  3HL8 A;  1OKJ A;  2FC0 A;  3GG4 A;  1L3T A;  4CFA A;  4YOU A;  4DTM A;  4XJX A;  2W6K A;  4DB3 A;  4CJP A;  1TAU A;  1EP4 A;  4GY2 B;  5I9E B;  1RDW X;  1T44 A;  5AQQ A;  1HR0 K;  1TK0 A;  5HRP A;  4C8M A;  3A2F A;  5E26 A;  3TSQ A;  4BWM A;  1C0M A;  3KVG A;  4IFE A;  3QET A;  5AQX A;  1VSK A;  2HVH A;  5KPZ A;  4FWR A;  4BRP A;  3CC7 N;  1TK5 A;  3DAW A;  1IV0 A;  2HHS A;  3TAN A;  5EU7 A;  4CHY A;  3AA3 A;  4AHV A;  1C0U A;  3VQA A;  2HHT A;  5A2Q O;  3VF6 A;  4AIL C;  4FJG A;  4A61 A;  2GEL A;  3VEN A;  3HPH A;  4JV5 K;  3TTC A;  3DM2 A;  4IO9 L;  1A5X A;  4NXN K;  5AQM A;  3HTV A;  4IG0 A;  4J2B A;  2FSN A;  3MDQ A;  3OYD A;  5T7B A;  2XY7 A;  3RR8 A;  4AH9 A;  1NGE A;  4A57 A;  3LP2 A;  3CD6 N;  5FPD A;  2KKZ A;  4NYN A;  2GV9 A;  3A8Y A;  4W5R A;  1VQ9 N;  3DWL A;  3MN9 A;  4LFA K;  4CD1 A;  1JL1 A;  4DQQ A;  4DQS A;  3A5O C;  3PO4 A;  3AVF A;  2CH5 A;  2JWK A;  5EY4 A;  3OYK A;  1WSG A;  3SMP A;  1VSM A;  3F9M A;  1QQN A;  2DPN A;  3GDQ A;  2Z1I A;  2HF4 A;  1J5O A;  1VAZ A;  3NAE A;  3NGZ A;  5AQK A;  4IOX A;  1X9J A;  1BWF O;  2HF3 A;  4CJ3 A;  3AAR A;  4DV5 K;  2KZM A;  3CCQ N;  4CJT A;  1YHQ N;  2KZZ A;  4BGA A;  4YOV A;  3CCM N;  4B9S A;  1LWF A;  4KAZ A;  1BDG A;  4K42 A;  4IG3 A;  3RMA A;  1ATR A;  5KQ8 A;  1VQO N;  2ZD1 A;  3OYB A;  3CXC M;  1M1K O;  1X1P A;  3LM2 A;  2J4R A;  4BE7 B;  1N5Y A;  4BE0 A;  4CJE A;  1ZBU A;  2NUB A;  4PL8 A;  1HNX K;  4N47 A;  1Q8I A;  3S41 A;  3WNE A;  4WCE L;  4E7J A;  4BRL A;  3O1B A;  3VEZ A;  5M1P A;  4FK2 A;  3T1Y K;  4LD0 A;  1A5V A;  3V9S A;  4JS4 A;  3NF7 A;  4CZF A;  5D3G A;  3A0I X;  4A2A A;  1QQC A;  4CES A;  2NRT A;  4U67 L;  2E6L A;  2ZJQ L;  1IKX A;  4JKB A;  1LW2 A;  1JCF A;  3U3G A;  3QEX A;  1RT1 A;  3CC4 N;  2UXC K;  3IFR A;  1D8Y A;  3LDP A;  2W41 A;  3ENH A;  1KD1 O;  1OVY A;  3NGI A;  2IOC A;  5CYQ A;  3E9P A;  1WNS A;  3AVH A;  2ITM A;  1NK9 A;  4Z0U A;  3V9Z A;  2PYJ A;  5BRF A;  2A1S A;  3SK3 A;  4E3S A;  1BU6 O;  1TKT A;  1TAQ A;  4H0Y B;  4JKG B;  4YHH K;  4KI4 A;  4CJ5 A;  4DR4 K;  3FZM A;  4DV7 K;  1OH5 A;  1RT4 A;  4AHT A;  1EKE A;  3CF5 L;  3UIQ A;  1S1W A;  3KK1 A;  4JD2 B;  1D4X A;  2HHX A;  3L4Q A;  4JKF A;  3CPW M;  4FWN A;  1V4T A;  4IJN A;  5AQV A;  5DM6 L;  4M42 A;  4PUO A;  2VG5 A;  4YY3 K;  1X3M A;  3WNH A;  1CXU A;  3W0L A;  3HJF A;  4Z4H A;  1S9E A;  2YKN A;  3AO4 A;  4H5R A;  4CD3 A;  4FVU A;  2W42 A;  2QWR A;  3ZSZ A;  1FXX A;  1WAF A;  4GMJ B;  3M8Q A;  4X64 K;  2RKI A;  1S3X A;  3M8S A;  1JCG A;  1QVG M;  4B1U B;  1WAJ A;  1ZXO A;  1BIS A;  2E4L A;  3SV3 A;  1L3S A;  3J7Y P;  1NKE A;  3SNN A;  3NGY A;  3W3D A;  4IWV A;  1KVC A;  3MCP A;  4DR1 K;  2QKB A;  5M1Q A;  4DTP A;  2A5X A;  1S5J A;  3OHR A;  1CZ9 A;  4J8F A;  4FWP A;  3IMX A;  1J6Z A;  4B9L A;  4C8O A;  3QB0 A;  3DLK A;  3RVC A;  2ATQ A;  5J1E A;  1R59 O;  2GX9 A;  2HBM A;  3AV9 A;  4PL7 A;  3DLG A;  4CEZ A;  3M8P A;  2D0O A;  3MX5 A;  1SV5 A;  4JS5 A;  2OAN A;  4F2S A;  3BF1 A;  4DMN A;  3P31 A;  1J53 A;  1GLE G;  2E6M A;  2VYP A;  1T6C A;  1RBV A;  4L3Q A;  2O8B A;  1RGI A;  4CER A;  2FF6 A;  4MO4 A;  1D9F A;  2KLA A;  4YOX A;  1ILY A;  1IJJ A;  3CCV N;  1YIJ N;  3FZK A;  3CJB A;  2CGL A;  3OS1 A;  4CEF A;  3CJ1 A;  4H0P A;  3BZK A;  1F21 A;  4N5S A;  4KTZ A;  3O8M A;  1SS6 A;  3C6A A;  2KFN A;  4DSI A;  4KTQ A;  2HHI A;  2YNF A;  1B92 A;  5AQG A;  4B9V A;  3OYN A;  1WB9 A;  3KIO A;  4G9Z A;  4OO1 J;  4DV3 K;  4BR7 A;  3O4W A;  3O3F A;  3SMS A;  1GLD G;  1S1X A;  4B8A B;  3CQ8 A;  1WBD A;  4NLC A;  4CEE A;  4JI5 K;  2A41 A;  2G8I A;  3N4Q A;  1RCH A;  4BR9 A;  2D0A A;  4JI1 K;  4O5F A;  3S5T A;  4ISE A;  4YDU C;  4AM6 A;  2Z1J A;  2AJQ A;  1N8R O;  5CYM A;  3IUC A;  4B08 A;  4FYD A;  2A6A A;  4EHU A;  3ATV A;  3ULE B;  3LPT A;  3OJS A;  3HO1 A;  3EL2 A;  4CED A;  4L8R B;  4LF9 K;  4Y1D A;  3CPE A;  5KRT A;  4DTR A;  3WQT A;  4F4K A;  2V7Y A;  4ICL A;  3AY9 A;  4BG9 A;  4F3T A;  1TUY A;  1VSE A;  1HMV A;  2FBX A;  1FKP A;  4OJR A;  3VQB A;  1JKH A;  4BVP A;  4Q0B A;  3O5B A;  4AQY K;  5BPN A;  2X6S A;  1BCM A;  4JKD A;  2HHH K;  4DG1 A;  4HVJ A;  1QQM A;  4CHZ A;  2X78 A;  4FWK A;  4CJK A;  3OS0 A;  2A1R A;  4PA1 A;  2QWO A;  2LSN A;  1YAG A;  3P1G A;  3SBG A;  1K6Y A;  4CF8 A;  3HVT A;  3WEE B;  4DSF A;  3JYT A;  4KHU A;  2Q2R A;  3KLE A;  3DLB A;  3ZCM A;  5AQJ A;  3OYE A;  3T69 A;  3C7N A;  3DMJ A;  4Q5V A;  1SL2 A;  2Z1G A;  4BC2 A;  1Z6R A;  2O8C B;  3PO5 A;  5AQP A;  1NG9 A;  1GLC G;  5C15 A;  4DQP A;  5AQL A;  3L2U A;  2QXF A;  3VA3 A;  4AF1 A;  4LSL A;  2WFB A;  4C23 A;  4E0D A;  5EOY A;  1UA0 A;  3SQ1 A;  3V81 A;  3IRX A;  2QA4 N;  2E2N A;  1DEJ A;  3SQ2 A;  1FJG K;  4WE1 A;  2VG7 A;  4JLH A;  3ZT3 A;  2VQE K;  1L3U A;  1TL3 A;  3HYF A;  3O9R A;  5ELZ A;  1NGA A;  2HHU A;  3MEE A;  3S9H A;  4JK7 A;  3K5O A;  1C1A A;  2VWB A;  3RSE A;  3M6G A;  3TSP A;  2BDP A;  4M3Y A;  4IKF A;  1S72 N;  5HBM A;  4FJ5 A;  1EXQ A;  4OGC A;  1KSP A;  4KO0 A;  4FWS A;  4DHY A;  2PAV A;  3ZX0 A;  3D45 A;  2NRR A;  3VEX A;  4BVO A;  5AFU A;  5EXW A;  2D0B A;  2F96 A;  4I7F A;  3VTI A;  1NJW A;  3SQ0 A;  3L2W A;  4I6M B;  1NK7 A;  1FKO A;  3RRH A;  2DFH A;  4A5A A;  4O0J A;  2GWK A;  1CZB A;  1CZA N;  3ULD A;  1FK9 A;  2E2Q A;  3ENB A;  3E01 A;  1P90 A;  4X65 K;  3NE6 A;  4KB1 A;  4DTX A;  4PY5 A;  1BO5 O;  2X6N A;  2P9N A;  5DM7 L;  3HOT A;  3SV4 A;  4LF4 K;  1BG3 A;  4K0K K;  1U49 A;  1RBU A;  4BR2 A;  1ZC6 A;  2GWJ A;  2OZM A;  3I8B A;  4BRH A;  3MED A;  3THY B;  1T03 A;  4E7I A;  3SUN A;  3U4L A;  2YNH A;  1TGO A;  2FBV A;  2JWL A;  3H3N O;  4BE1 A;  4CZK A;  4CVN E;  3DJC A;  1GOA A;  2CGK A;  4DR6 K;  4B9N A;  1B9D A;  4NYF A;  4IEI A;  1GOB A;  3AVJ A;  4FZY A;  1KXP A;  3H45 C;  3D2F B;  2F9W A;  1TK8 A;  1T3V A;  2PZS A;  5M1N A;  1JJ2 M;  2HW3 A;  3O9Q A;  2O8E A;  4MFB A;  1K8K A;  5FRM A;  3M3Z A;  1KAY A;  4CI6 A;  3CG7 A;  4K41 A;  3QBW A;  4CHN A;  4JI6 K;  4BRE A;  3MWP A;  1CXQ A;  3IAY A;  5J2Q A;  1GLF O;  2D0C A;  4M3T A;  3THV A;  5JS1 A;  1K8A O;  4FJN A;  4E1M A;  3TPQ A;  1QS4 A;  2OPS A;  4HUG A;  4ISF A;  3O08 A;  1BIU A;  3ZSW A;  3SPZ A;  4DS5 A;  1U45 A;  4B9Q A;  3WXJ A;  3E66 A;  1SKR A;  1ZBI A;  4LF8 K;  3F2K A;  4MO5 A;  3ZET B;  5HRN A;  1I94 K;  2FXU A;  2YHB A;  3THX A;  1NGJ A;  5M1F A;  3VGK A;  2RHK A;  1U2V B;  4IOC L;  1WSE A;  2G8H A;  4PKH A;  4CF0 A;  4FK0 A;  1BIZ A;  3PY8 A;  3E1Y A;  3QIC A;  4FCY A;  3LDS A;  1ASU A;  4DTJ A;  5LY3 A;  2I5J A;  2DFF A;  4XH1 A;  4A5B A;  4GKK K;  2RF2 A;  4LFB K;  1NNE A;  4IDH A;  1SL0 A;  5BPL A;  4DU4 A;  1OH7 A;  1BA1 A;  1RT7 A;  2GEM A;  2QTD A;  2Q36 A;  4RWT A;  3I0R A;  2B4J A;  4BC4 A;  5B8H A;  3P38 A;  4PHT X;  4MLH A;  1RT2 A;  2P9I A;  2DFE A;  4GVM A;  2O8D A;  1BGX T;  4IO8 A;  3CCJ N;  4BDZ A;  3B8A X;  2YJE A;  2A40 A;  4RCH A;  4HHT A;  3KLF A;  1QSS A;  1HKB A;  4EZ9 A;  3MCA B;  3ZSX A;  4FLU A;  4FK4 A;  2EWS A;  1FW6 A;  3VGL A;  3L8B A;  3DXK A;  3AO1 A;  1NGG A;  4OX9 K;  3UKU A;  1TL1 A;  1UA1 A;  4ISG A;  4B3O A;  2QK9 A;  2HST A;  3M1F A;  1VSH A;  1SZ2 A;  3TI0 A;  4DV1 K;  3AO5 A;  1L3V A;  3WNG A;  4NCG A;  2WBN A;  4KH4 A;  1SKS A;  1HUX A;  3ZSR A;  3MN6 A;  3LDQ A;  3THW A;  4H5W A;  5H1S Q;  1KFD A;  5C2D A;  4H0X B;  2QM1 A;  5BRH A;  5GAG P;  2NLX A;  1YIT N;  3VTH A;  3VEY A;  1X9M A;  4B3M K;  2H3G X;  3CMA N;  4BRN A;  3FLC O;  3R1X A;  5FPN A;  1RT5 A;  3DLH A;  3NH2 A;  3RR7 A;  3I8D A;  1KVB A;  1WSF A;  3AAP A;  1MA9 B;  3SJH A;  3JXU A;  4BRK A;  4K25 A;  4O8U A;  5AZI B;  3I55 N;  2HBL A;  4NCB A;  5AQY A;  4AHU A;  2IDO A;  3PSI A;  1BUP A;  1IBM K;  4FO0 A;  1O1W A;  2RE2 A;  4J2E A;  5KI6 A;  1RT6 A;  2Q0R A;  4JHD B;  1TKD A;  4X62 K;  4DLE A;  2ZE2 A;  4CJL A;  4BRD A;  3SYZ A;  3G0Z A;  3PX0 A;  2UU9 K;  2EX3 A;  5AQU A;  1X3N A;  4AHR A;  3FZH A;  3PIP L;  3HBT A;  3EY1 A;  2UYT A;  5BRE A;  3V4I A;  4BR0 A;  3K5L A;  2YKM A;  1BCO A;  4H8K A;  5LMN K;  1ASV A;  3T1A A;  3HST B;  4FPB A;  4CJQ A;  5IWA K;  3NMU A;  4FLW A;  3QEV A;  4E89 A;  3HPG A;  3S3M A;  1KVA A;  2YCH A;  1Q7Y O;  1BOT O;  3DXM A;  5AZJ A;  3U3Y A;  4A2B A;  4I2Q A;  4RW7 A;  4LFC K;  3JSM A;  3EKU A;  1W9H A;  3KWG A;  1W7A A;  3TAF A;  2P9U B;  3QEP A;  2V52 B;  1RFQ A;  1RDA A;  4B8C A;  1C0G A;  1XC3 A;  1W97 L;  3CQX A;  4QCL A;  4AHS A;  3KLG A;  2PFU A;  3QDK A;  1NOY A;  3ID8 A;  2D0P A;  5JIC A;  1KAX A;  3GE1 A;  4M3R A;  3WNF A;  4DV0 K;  5HLF A;  3LDN A;  1Q81 O;  1I3A A;  5F0X A;  5FDL A;  1K9M O;  3AA4 A;  3AVL A;  2UXD K;  4M3X A;  3QEI A;  1HQE A;  2QWQ A;  5BN8 A;  4JK9 A;  1HLU A;  1NGF A;  1WSH A;  4FW2 A;  3G6E N;  3HVR A;  4UQG A;  3CFR A;  3K9J A;  3NH0 A;  3D2E A;  1HYV A;  2FSJ A;  2YNG A;  3FGU A;  3GL1 A;  4LH4 A;  4IXC A;  3VER A;  2G8K A;  3MXI A;  3SAF A;  4RTF D;  3LWM A;  2G8U A;  2NRZ A;  4BQL A;  3FR0 A;  4RW4 A;  3VQ8 A;  2NRV A;  3HM8 A;  1O13 A;  5AQO A;  3TSU A;  3OYF A;  4JI3 K;  5CE3 A;  1XC9 A;  4IBN A;  5CZ2 A;  2QW9 A;  4Y1C A;  3SUP A;  2IGI A;  3UKR B;  1JXE A;  2P1J A;  4BRQ A;  3AA5 X;  2VG6 A;  4FLT A;  4FL9 A;  4HTL A;  4QS8 A;  3TU5 A;  1RBT A;  1VRU A;  3HI0 A;  4CIE A;  2G8F A;  5FRO A;  5ADX H;  2RN2 A;  1U48 A;  1GLA G;  1C0F A;  3KKR A;  1NK4 A;  1QHT A;  2XY8 A;  3BEX A;  3P5J A;  3AVI A;  4JNE A;  4KHS A;  4NXM K;  3N4P A;  4ID1 A;  1VQP N;  4CZH A;  3AGR A;  4WQ5 C;  1LWC A;  5DK5 A;  3CCS N;  4DLG A;  4BRF A;  3M5R A;  5HL7 L;  4LH5 A;  4KI6 A;  3MK6 A;  2R7Y A;  4DSK A;  4EP4 A;  3U8X A;  1I39 A;  1KRP A;  3TAG A;  1HJR A;  4JI2 K;  2WC9 A;  4F2R A;  3ZT0 A;  3TAE A;  3ALY A;  5AQW A;  1TUU A;  4DR2 K;  1E4F T;  4DUZ K;  3SUO A;  4OPH A;  4YDU A;  3MEG A;  5JEN A;  4MQ3 A;  4BG8 A;  3MXM A;  3ENO A;  1DGK N;  5CR4 A;  3DLR A;  3AO2 A;  3BGR A;  5E84 A;  3CQY A;  3ZEU A;  1UOC A; 
#chains in the Genus database with same CATH homology
 2V7Z A;  2BTF A;  2QA4 N;  2E2N A;  5M1O A;  5HOO A;  3C6H A;  4BRM A;  1DEJ A;  3J7Z O;  3NVK A;  2A42 A;  4QS7 A;  1VQ5 N;  2F9T A;  3IDH A;  3R8E A;  4JN4 A;  2QXL A;  2ZGY A;  4WFB L;  4FOI A;  1NGH A;  4XH4 A;  3KK7 A;  2P9P A;  3EO3 A;  4JKE A;  3MN5 A;  3O9R A;  3CME N;  5ELZ A;  3ZX2 A;  1NGA A;  2P9K A;  3FFK B;  4KH6 A;  2WUS A;  4JK7 A;  2VWB A;  3RSE A;  3M6G A;  3TSP A;  3OA9 A;  1NM1 A;  3A5M C;  3WXI A;  1S72 N;  3LDL A;  4JKH A;  4FWS A;  1MDU B;  1E4G T;  4ILJ A;  2NNW A;  5AQF A;  3EZW A;  4DHY A;  3CCR N;  2PAV A;  4WYB A;  4BR4 A;  3ZX0 A;  3VPZ A;  2NRR A;  3ZYY X;  3VEX A;  1TYQ B;  3BUZ B;  3CER A;  4BVO A;  2QEX N;  2FSK A;  4B1W B;  2QWN A;  4H5V A;  4YOR A;  3KWI A;  5AFU A;  4KBO A;  4WQ5 A;  4DQ8 A;  1DT9 A;  5EXW A;  4BRC A;  3VTI A;  5AQT A;  3LM9 A;  3OBY A;  4I6M B;  2ZJP L;  4A5A A;  2GWK A;  2P9I B;  5EVZ A;  1CZA N;  5GIO A;  3ATU A;  1QHA A;  4FWO A;  4CZL A;  2E2Q A;  3ENB A;  4AM7 A;  1P90 A;  3J8A A;  3WUH A;  1WOQ A;  5FPE A;  5F2R A;  1BO5 O;  3O9U A;  3EKS A;  3ULE A;  2P9N A;  1QZ6 A;  5C0Y A;  3PLA A;  2F7T A;  2NZT A;  2E1Z A;  4FWM A;  4H5T A;  4IJA A;  3UKR A;  5DM7 L;  3HOT A;  4M7X A;  1BA0 A;  1U6Z A;  3HZ6 A;  3E9L A;  1OKJ A;  3GG4 A;  1BG3 A;  4YOU A;  1Z05 A;  3DXK B;  4XJX A;  3H46 O;  4BR2 A;  2NRX A;  1ZC6 A;  2GWJ A;  3UKU B;  3I8B A;  4BRH A;  2P9S A;  5KQD A;  3FZF A;  5JLF A;  4BEB A;  4DB3 A;  4GY2 B;  3WXK A;  5I9E B;  3U4L A;  2PBD A;  3AAQ A;  1RDW X;  1T44 A;  2JWL A;  3H3N O;  3O6W A;  5AQQ A;  3C0B A;  4A59 A;  4CZI A;  1VQK N;  4OPA A;  5E26 A;  3TSQ A;  4CZK A;  2I7P A;  5C2F A;  3O9T A;  3KVG A;  4O8K A;  3DJC A;  1H1V A;  4IFE A;  2CGK A;  3UB5 A;  2IVP A;  3EE8 A;  5AQX A;  3UE5 A;  3WQU A;  2I7N A;  4FWR A;  5KPZ A;  3G71 N;  1VQL N;  4BRP A;  3CC7 N;  4IEI A;  4GV6 A;  5EX5 A;  1KXP A;  3H45 C;  4WFA L;  3D2F B;  2F9W A;  3OBW A;  3DAW A;  4CBW A;  4H0O A;  1T3V A;  5M1N A;  1JJ2 M;  3O9Q A;  3WEE A;  5M1K A;  3CC2 N;  1K8K A;  1HKG A;  3ZX3 A;  4CZJ A;  3VF6 A;  1ESV A;  3M3Z A;  4A61 A;  4Y0W A;  1KAY A;  2GEL A;  1P8Z A;  4B1Y B;  5LJV A;  4CI6 A;  1G99 A;  3KZB A;  3HSC A;  3QBW A;  4K41 A;  3TTC A;  3VEN A;  2E8A A;  2BH1 A;  4IO9 L;  4BRE A;  4WQ4 A;  5AQM A;  3MWP A;  3HTV A;  4WF9 L;  2FSN A;  1GLF O;  2P9L A;  3D7E O;  5AR0 A;  2VCP A;  1KQS M;  2YJF A;  1ILY A;  1V4S A;  1M1K O;  2Q0U A;  3MDQ A;  3HRG A;  4DCH A;  1K8A O;  2VGM A;  2E2P A;  3TPQ A;  1NGE A;  5MLC Q;  1NJI O;  2HBK A;  1HKC A;  4A57 A;  4ISF A;  1YI2 N;  5FPD A;  3CD6 N;  3O08 A;  2KKZ A;  4A62 A;  3A8Y A;  4BRO A;  1Q86 O;  2BUP A;  1VQ9 N;  4B9Q A;  4PKI A;  1KC8 O;  2D1K A;  3DWL A;  3E66 A;  3MN9 A;  3WXJ A;  4CD1 A;  4BC5 A;  3F2K A;  4MO5 A;  3ZET B;  3A5O C;  4BY9 C;  1HJO A;  2CH5 A;  2FXU A;  3JS6 A;  3VF4 A;  2JWK A;  5EY4 A;  3R6M A;  1NGJ A;  1HPM A;  2V51 B;  3VGK A;  5M1F A;  3SMP A;  3PIO L;  5JVG L;  3CCU N;  2RHK A;  1U2V B;  3F9M A;  4CBU A;  4IOC L;  1QQN A;  2DPN A;  3GDQ A;  4LC9 B;  4BC3 A;  2HF4 A;  2E88 A;  2D4W A;  4PKH A;  1VAZ A;  5BR9 A;  4DKW A;  5AQK A;  4IOX A;  5TKY A;  3E1Y A;  3FE1 A;  3QIC A;  3VES A;  3T7Z A;  1X9J A;  1BWF O;  2HF3 A;  2QWM A;  2A3Z A;  3AAR A;  3NVM A;  3CCQ N;  1YHQ N;  2GUP A;  5LY3 A;  3DXM B;  3VGM A;  1QQO A;  3CET A;  4PKG A;  4XH1 A;  5AZJ B;  4BGA A;  4YOV A;  2IVN A;  3CCM N;  4A5B A;  1YJW N;  3CCE N;  3CCL N;  4C1N K;  4CJ7 A;  3QBX A;  1TYQ A;  1BDG A;  4IDH A;  4K42 A;  5BPL A;  2AP1 A;  5JMV A;  1BA1 A;  2Q31 A;  4XH5 A;  2GEM A;  2QTD A;  1ATR A;  2E20 A;  2ZJR L;  5KQ8 A;  2Q36 A;  4RWT A;  1VQO N;  3CXC M;  4WQ4 C;  3Q7C A;  3LL3 A;  2ASM A;  1YVN A;  3P38 A;  4I6M A;  2IVO A;  4BC4 A;  4PHT X;  5B8H A;  4MLH A;  3I56 N;  3LM2 A;  1KAZ A;  2J4R A;  3O80 A;  4BE7 B;  2P9I A;  1NLV A;  1EO1 A;  3BP8 A;  3H1V X;  4IO8 A;  4R79 A;  3B8A X;  4PL8 A;  3CCJ N;  5BN9 A;  2YHX A;  3CI5 A;  2QWP A;  2YJE A;  3S41 A;  4BEC A;  4WCE L;  2A40 A;  4RCH A;  4H0T B;  4BRL A;  3O1B A;  4F9O A;  2QWL A;  1HKB A;  3VEZ A;  5M1P A;  3MCA B;  5LJW A;  4XEI A;  3ID6 A;  2EWS A;  3VGL A;  1LCU A;  3DXK A;  2E2O A;  5ADX A;  1NGG A;  3UKU A;  4CZF A;  1T6D A;  3A0I X;  4IEE A;  4A2A A;  2ZJQ L;  2NRT A;  4U67 L;  1YXQ A;  4ISG A;  2NRW A;  4FSV A;  4JKB A;  1YF5 L;  3GOI A;  1JCF A;  3D2E B;  4KH5 A;  2HST A;  2NRH A;  3VMF B;  3M1F A;  3CC4 N;  3IFR A;  1SZ2 A;  3LDP A;  2HOE A;  4B1X B;  1MWK A;  2W41 A;  3ENH A;  2YHW A;  3LDO A;  1KD1 O;  2WBN A;  4KH4 A;  1OVY A;  1HUX A;  4IOA L;  3MN6 A;  3E9P A;  5JVH L;  3LDQ A;  4H5W A;  5H1S Q;  5C2D A;  4H0X B;  2QM1 A;  4NLB A;  5BRH A;  2ITM A;  4CZG A;  5GAG P;  2C1I A;  4MDB A;  5BRF A;  2NLX A;  1YIT N;  3D2F A;  3VTH A;  3SK3 A;  3VEY A;  3H1Q A;  2H3G X;  1SQK A;  3CMA N;  5AFU H;  3FLC O;  3R1X A;  5FPN A;  4BRN A;  1BU6 O;  1NGI A;  4H0Y B;  4MDA A;  5BRD A;  1K73 O;  4JKG B;  3QML A;  2ZF5 O;  3FZM A;  4JK8 A;  3AAP A;  3SLC A;  1VQ6 N;  1MA9 B;  3SJH A;  3JXU A;  3CF5 L;  1YJN N;  2OTL N;  1NGD A;  4BRK A;  1LOT B;  4K25 A;  4JD2 B;  4O8U A;  5AZI B;  1D4X A;  3I55 N;  3L4Q A;  1XUP O;  2HBL A;  4JKF A;  5KPR A;  3CPW M;  3AGK A;  4FWN A;  1V4T A;  4H0V B;  4IJN A;  5AQV A;  5AQY A;  5DM6 L;  4BRA A;  2AA4 A;  1QVF M;  5AQS A;  3VF2 A;  3TTD A;  1X3M A;  4E1J A;  1YJ9 N;  1BUP A;  3SAH A;  4FO0 A;  2RE2 A;  2E1Y A;  5TKW A;  3W0L A;  5AQN A;  4H5R A;  4CD3 A;  4FVU A;  2Q0R A;  2QWR A;  4JHD B;  5GAH P;  4JKA A;  4HWI A;  4BRD A;  1S3X A;  3MWT A;  3CJ7 A;  3ZET A;  1JCG A;  1QVG M;  4B1U B;  5AQU A;  1X3N A;  2HMP A;  1ZXO A;  5C10 A;  3CJA A;  3WT0 A;  3FZH A;  3PIP L;  2ZGZ A;  3HBT A;  2UYT A;  5BRE A;  1NWK A;  3W3D A;  4BR0 A;  1U2V A;  3O9S A;  4IWV A;  3MCP A;  1ATS A;  1GLJ O;  3A5L C;  1NGB A;  1IG8 A;  3Q7B A;  4FPB A;  5M1Q A;  1VQN N;  2A5X A;  3OHR A;  1VQ4 N;  4C1N I;  3EN9 A;  4J8F A;  4FWP A;  5AQR A;  4QS9 A;  3IMX A;  3VEV A;  3NMU A;  1VQ7 N;  3CJ9 A;  1J6Z A;  3WXM B;  1S22 A;  3C7N B;  3G4S N;  2YCH A;  3QB0 A;  1Q7Y O;  3RVC A;  4CZM A;  1BOT O;  3MMV A;  3DXM A;  5AZJ A;  1ZBS A;  4ILG B;  3SBT A;  1R59 O;  3KHY A;  2GX9 A;  2HBM A;  4PL7 A;  1NMD A;  4A2B A;  3SAG A;  3EE9 A;  4EHT A;  2D0O A;  3MX5 A;  2KHO A;  4BR5 A;  3EKU A;  2OAN A;  3KWG A;  1VQM N;  2P9U B;  1WUA A;  2VGN A;  2V52 B;  4BQZ A;  1RFQ A;  3VEW A;  3BF1 A;  4EAH D;  3L4I A;  3P31 A;  1GLE G;  4ILH A;  2VYP A;  1T6C A;  3OW2 M;  1C0G A;  4FPA A;  1XC3 A;  4L3Q A;  1W97 L;  3CQX A;  1RGI A;  3ZEU B;  4YOY A;  3CJC A;  4MLE A;  2PFU A;  2FF6 A;  3QDK A;  4MO4 A;  3ID8 A;  2D0P A;  2KLA A;  4YOX A;  5JIC A;  1IJJ A;  1KAX A;  3HOS A;  4M7Y A;  3FZK A;  3CJB A;  3GE1 A;  4H5N A;  3CCV N;  1YIJ N;  2CGL A;  1QZ5 A;  3CJ1 A;  4H0P A;  3LDN A;  5C12 A;  5F0X A;  1Q81 O;  1K9M O;  3O8M A;  3H3O B;  1SS6 A;  3C6A A;  3TTF A;  2P9P B;  3I33 A;  5AQI A;  4EFH A;  2QWQ A;  5BN8 A;  2Q97 A;  1HLU A;  4JK9 A;  4JKC A;  1NGF A;  5AQZ A;  5CHI A;  4UY8 O;  2P9K B;  3D6R A;  4FWQ A;  1EQY A;  5AQG A;  3G6E N;  3F5T A;  4G9Z A;  3K9J A;  4OO1 J;  5GAD P;  5JLH A;  1MWM A;  3RSE B;  3WXL A;  3C65 A;  3D2E A;  5GAE P;  3DLL L;  4BR7 A;  2FSJ A;  3O4W A;  3FGU A;  3SMS A;  3GL1 A;  1GLD G;  1W2B M;  1RDU A;  4JAX A;  1HX1 A;  2YHY A;  3P39 A;  1NBW A;  4IXC A;  3VER A;  3SAF A;  4RTF D;  3QFP A;  4FWL A;  1GLB G;  2YX6 A;  4NLC A;  2A41 A;  2NRZ A;  4FOE A;  3N4Q A;  5FPM A;  4BR9 A;  4JEP A;  4BQL A;  3QFU A;  3FR0 A;  2NRV A;  4O5F A;  3U9D A;  3HM8 A;  4NO7 A;  2OTJ N;  1O13 A;  4ISE A;  5AQO A;  3TSU A;  3VOV A;  4YDU C;  4AM6 A;  4Z94 A;  4B1Z A;  5CE3 A;  2Q1N A;  1NGC A;  1N8R O;  4JKG A;  3IUC A;  4GV3 A;  2QW9 A;  2A6A A;  3L6Q A;  3VEO A;  4EHU A;  4BGB A;  3ATV A;  1Y64 A;  3ULE B;  2P9N B;  3EL2 A;  3G25 A;  2W00 A;  3BF3 A;  5F1X A;  3UKR B;  4YOT A;  5GIP A;  4JD2 A;  4BRQ A;  2CGJ A;  5AZI A;  3FZL A;  3CPE A;  4FL9 A;  4HTL A;  2ZWH A;  4B1V A;  4QS8 A;  3TU5 A;  3VET A;  3WQT A;  1YUW A;  2V7Y A;  4CZE A;  4K43 A;  3R3L A;  3AY9 A;  3CIP A;  3HI0 A;  1TUY A;  2P9S B;  4BG9 A;  1VQ8 N;  3R9P A;  1ATN A;  5ADX H;  4IZ9 A;  4EIA A;  3MN7 A;  4YOW A;  4JHD A;  2W40 A;  4BVP A;  1GLA G;  1C0F A;  2C1G A;  3O5B A;  5BPN A;  5KPT A;  4JKD A;  1QQM A;  3BEX A;  4FWK A;  4H03 B;  1DKG D;  4JNE A;  4CBX A;  3N4P A;  2QWO A;  1GLL O;  1VQP N;  1YAG A;  3AGR A;  4WQ5 C;  4CZH A;  3E9O A;  3O1W A;  3SBG A;  4BRG A;  3MX2 A;  2CH6 A;  3CCS N;  2QI2 A;  3GBT A;  3CHW A;  4BRF A;  3WEE B;  3M5R A;  5HL7 L;  1SAZ A;  5AQH A;  2ASO A;  4NB4 A;  2FF3 B;  2Q2R A;  2YI1 A;  2HBJ A;  3L0Q A;  2IIR A;  1K8K B;  1Q18 A;  3MK6 A;  3P4I A;  5GIN A;  1Q82 O;  5AQJ A;  3T69 A;  3C7N A;  4U7B A;  2GTD A;  3U8X A;  3H6E A;  1M90 O;  4BC2 A;  1Z6R A;  2WC9 A;  3U9Z A;  5BPM A;  4GNI A;  1JCE A;  5AQP A;  2P9L B;  4BRI A;  1GLC G;  5AQW A;  5C15 A;  1TUU A;  1E4F T;  4OPH A;  4YDU A;  5AQL A;  2P9U A;  4AF1 A;  4WFN L;  1XQS C;  2WFB A;  3IKM A;  4BG8 A;  4C23 A;  3ENO A;  1DGK N;  5CR4 A;  3A5N C;  4M63 C;  5EOY A;  2FLO A;  2ASP A;  5E84 A;  3CQY A;  4GVE A;  3ZEU A;  3K9K A;  4GV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...