2P9KA

Crystal structure of bovine arp2/3 complex co-crystallized with atp and crosslinked with glutaraldehyde
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
411
structure length
393
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-like protein 3
total genus 126
structure length 393
sequence length 411
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9kA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9kA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9kA03
1NGBA 2ZF5O 4FWMA 4IO8A 3H46O 3WUHA 1SZ2A 1HKBA 1V4TA 4CBUA 4JD2A 4CZLA 1NM1A 5KQ8A 1NGHA 2CGKA 1C0FA 2GELA 5EX5A 4O5FA 3GL1A 2FF6A 5LJWA 1TUYA 2YJFA 4BRCA 4CZHA 3P4IA 2E1YA 3GG4A 2AP1A 4BC2A 4XH1A 4BR0A 2QWQA 3QBWA 4BRMA 1P8ZA 3O80A 3DAWA 3SMSA 4BRHA 5KPRA 4WYBA 1JCGA 1KAYA 2YHWA 3LDLA 3A5OC 5JLHA 2V7ZA 4BGAA 5F0XA 4BRGA 5EXWA 2A41A 2A40A 1BA0A 3VESA 2FSJA 4M7XA 5AQXA 5ADXH 5AQLA 1SAZA 4PL7A 4BRPA 3H3OB 4K41A 1KAZA 1XC3A 3VEYA 1V4SA 2GUPA 4A2BA 2GEMA 2P9IA 4BREA 5BREA 2FSKA 1NWKA 3ENHA 5AQVA 1ATRA 4FWSA 3CJBA 3A5LC 3ULEA 2Q1NA 4IXCA 2ZGZA 4B1XB 3UKUA 4EHUA 2IVPA 3EZWA 3EKSA 1NGAA 1DEJA 2ASPA 2Q36A 3KZBA 2D0OA 5AQIA 5AQJA 2V7YA 4BRNA 3BF3A 3ATUA 4K25A 2IIRA 4LC9B 3U9DA 4BR5A 5AQNA 5AQMA 3KHYA 1G99A 4M63C 3CJ9A 4FWOA 4BRQA 3LDNA 4BRKA 1BWFO 3O4WA 4QS8A 5AFUA 4BVPA 3S41A 4CD3A 4EAHD 2CGLA 4PKHA 4FWRA 2KHOA 3O6WA 4I6MA 2I7PA 1Z05A 4BVOA 4JD2B 3FZLA 2Q0UA 1HJOA 3D2EB 1K8KB 2E2NA 3ZX2A 3FZKA 1LCUA 1U6ZA 1BDGA 3O08A 1TYQA 1TUUA 1YXQA 3C7NB 3M1FA 3QMLA 2P9SA 4WQ4C 4BG8A 4BRFA 1DGKN 3WXKA 3ZX0A 1C0GA 5AQPA 3MK6A 4BGBA 2ZGYA 4FSVA 4BR9A 2F9TA 1MWMA 4CI6A 1H1VA 2YI1A 3VEVA 3VF2A 1GLLO 2P9UB 3U8XA 3SMPA 4WQ5A 2YHXA 3EN9A 1D4XA 1K8KA 2FXUA 1QHAA 2P9KB 5AQZA 2QWRA 4BQLA 5ADXA 3LL3A 2CH6A 1MWKA 4ISGA 4BROA 3WT0A 4MO4A 4CZGA 4RTFD 3D2FA 2HOEA 1GLCG 4FOEA 3CHWA 2P9UA 2P9NA 2CGJA 3EO3A 5EY4A 3VPZA 3MN5A 5EVZA 4CZFA 3D2EA 3G25A 4O8KA 3ZX3A 4CZKA 3UE5A 3FZMA 3I8BA 2P9LA 3CI5A 4H5WA 3H45C 2ZWHA 2PAVA 3A0IX 5BPMA 2VYPA 3VF6A 5AQKA 2GTDA 5BRDA 3TU5A 2QWPA 1U2VB 4CZJA 1BG3A 2A3ZA 3GBTA 4BC3A 2YJEA 1RDWX 3ENOA 3CJ1A 4A61A 3LM2A 1GLBG 3VENA 3I33A 3RSEB 5AQTA 3U9ZA 3LDPA 3C0BA 3FZFA 3HZ6A 2Q97A 5JMVA 2V52B 4DQ8A 2ASOA 1HKCA 4BRLA 4FPBA 3VGLA 1XUPO 2E88A 3FFKB 3O8MA 4A2AA 3CJ7A 3QFPA 4BR2A 5BRFA 4FL9A 1EQYA 1ZBSA 3MDQA 3GE1A 2PBDA 3ULEB 2FLOA 3MN9A 5BRHA 1NGIA 3MN7A 2VCPA 1GLEG 1GLJO 1TYQB 2QWLA 3IDHA 2QM1A 5FPEA 1ATSA 2AA4A 2E2OA 3M6GA 4IJAA 1ZC6A 4XH5A 3L0QA 3DXMA 5AQSA 5AR0A 1KXPA 4RCHA 4NB4A 4BG9A 2GWJA 5EOYA 1U2VA 1YAGA 4BQZA 3H1QA 1HX1A 4WQ4A 4B1ZA 4JHDA 2E1ZA 2NLXA 4A62A 5AQUA 1IJJA 5JLFA 5KQDA 3IUCA 4I6MB 3FR0A 4H5VA 5CE3A 3DWLA 1NBWA 3JXUA 3QICA 1NGGA 4YDUA 3VGKA 4AM6A 4F9OA 5AQOA 3QB0A 2IVOA 3AAPA 3KVGA 5FPMA 3LDOA 2A6AA 2QXLA 2UYTA 3OHRA 3CERA 3CIPA 4K43A 1NGEA 1J6ZA 2P9SB 2NZTA 4BRIA 5AQGA 4ISFA 2CH5A 4PL8A 5AQQA 3VEXA 1ZXOA 3L4IA 4CZEA 3UKRA 3HI0A 2QWNA 2QWOA 3WXJA 3EKUA 4H0OA 3VOVA 4BRDA 5BN8A 5AFUH 1QQOA 2A5XA 2P9KA 3LDQA 2QWMA 5AZIA 5F2RA 3HSCA 3B8AX 4EIAA 1ESVA 5BPNA 2NRHA 1YVNA 3UKRB 3WEEA 3WXLA 4RWTA 1NGCA 3VERA 5AQHA 2P9NB 3L6QA 3O5BA 1NGDA 4PKGA 3BF1A 3HTVA 1T6CA 1HLUA 3LM9A 1BOTO 2P9PA 2A42A 3C7NA 4H0TB 4B1YB 4CZIA 3J8AA 3CQXA 4JNEA 3GOIA 3A5MC 4XH4A 1BU6O 1HUXA 1QZ6A 3WEEB 1JCFA 1JCEA 2J4RA 4KBOA 5I9EB 3FZHA 4MLEA 5AQWA 1Q18A 3AARA 3ATVA 3IMXA 3ZETB 5JICA 4FWKA 4CBWA 3CETA 4DCHA 3SK3A 2E2PA 4CJ7A 2E8AA 5E84A 2D0PA 3UKUB 4BRAA 4H0YB 4H5TA 1QQMA 3FLCO 2BTFA 2D4WA 3QBXA 3SJHA 2Q2RA 4Y0WA 4AM7A 5F1XA 4BR4A 2W40A 4FWPA 4MLHA 4H5NA 3AY9A 4M7YA 2E2QA 3W0LA 5FPDA 2F9WA 1T44A 3DXKA 3CJCA 3F9MA 3O1WA 4DB3A 2HF4A 2P9PB 3U4LA 4PKIA 1RFQA 4YDUC 4H0XB 1HKGA 3CQYA 3VEWA 5AZJB 2QW9A 4GY2B 5AQYA 4HTLA 3M3ZA 5LY3A 1X3NA 4BR7A 3DJCA 3SLCA 2V51B 1QQNA 3CJAA 1GLFO 3BUZB 3DXKB 4JN4A 3WQUA 3A5NC 3W3DA 1NGJA 4B1VA 5KPZA 4EFHA 2YHYA 4FO0A 2E20A 4QS7A 5AZIB 2EWSA 2H3GX 3HBTA 1HPMA 1T6DA 4H0PA 3TPQA 2D1KA 1LOTB 4FWLA 4L3QA 4CZMA 4FWQA 3A8YA 1E4GT 3IFRA 4QS9A 5BPLA 1Y64A 3HM8A 3BP8A 5BN9A 1GLDG 3H3NO 2W41A 3R8EA 2BUPA 3WXIA 3VF4A 3VETA 4JHDB 4DHYA 2Q31A 3FE1A 4H0VB 4E1JA 1WUAA 4C23A 1NLVA 2HF3A 3JS6A 3FGUA 1S3XA 3H1VX 3DXMB 2FSNA 3ZEUA 4BC5A 4H03B 1BO5O 5ELZA 4MO5A 2GWKA 4XEIA 1SQKA 1MA9B 2VWBA 5TKYA 1ATNA 3VEOA 3ID8A 2HMPA 5LJVA 4J8FA 2P9LB 1E4FT 1DKGD 2YCHA 4FWNA 1X3MA 5AZJA 1Z6RA 1GLAG 1CZAN 4IWVA 5E26A 1IG8A 1R59O 5AQFA 4B1WB 3D2FB 4BC4A 1XQSC 5FPNA 4CD1A 5BR9A 5KPTA 1BUPA 4CBXA 3QDKA 1QZ5A 3R6MA 2ASMA 4EHTA 4B1UB 4ISEA 4FPAA 1BA1A 4NO7A 4Z94A 3VGMA 1NMDA 3AAQA 2Q0RA 1X9JA 1WOQA 3GDQA 4JAXA 2IVNA 3MCPA 3O1BA 4B9QA 5B8HA 1YUWA 4FOIA 3WQTA 2P9IB 4GNIA 2OANA 3EL2A 3VEZA 3ZEUB 1KAXA 4IZ9A 3MN6A 4HWIA 2I7NA 1S22A 3R9PA 4K42A 3ZETA 4WQ5C 1RGIA 2FF3B 3BEXA 3MMVA 2DPNA 1NGFA 5AQRA 4IJNA 4H5RA 3RSEA 3UB5A 3D7EO 2ITMA 1MDUB 3H6EA 3QFUA 1OKJA 2WUSA
chains in the Genus database with same CATH superfamily
2ZF5O 3T7ZA 2FBXA 1HKBA 1V4TA 4KB1A 4CZLA 4DR1K 4HUGA 4M41A 1IH7A 2VGNA 3SCXA 2D0AA 1NGHA 3OYMA 3THWB 2A1RA 2FC0A 1HNXK 2FF6A 2QEXN 2YJFA 3DRRA 2QWQA 1P8ZA 1XHZA 2UUAK 1KAYA 3LDLA 4CJLA 5JLHA 2V7ZA 4IO9L 4DSFA 5EXWA 3LALA 4I9LA 4O8UA 3TSUA 3VESA 4LH4A 2FSJA 4XIUA 3V9XA 3ALYA 4PL7A 4LY7A 3H3OB 4J2BA 3PSIA 4K41A 1KAZA 1XC3A 3SUQA 3KLFA 1RDAA 3WNFA 4C8NA 1VQ5N 2FSKA 4JKEA 1ATRA 3QNOA 3I8DA 3ID6A 3A5LC 4B3RK 1EETA 3J80O 3DLKA 1QSSA 3ZCMA 2ZGZA 3KLIA 3TI0A 4B1XB 2O8EA 3LP2A 3WXMB 3EY1A 3C6HA 3LP1A 2ASPA 2D0OA 4Y1DA 5AQIA 1RILA 1UA0A 3SNNA 3EE9A 3KLGA 2BH1A 3DRPA 3G0ZA 5AQNA 2ZJPL 1RT4A 3PY8A 3CJ9A 5E41A 1HYZA 3AA5X 3O4WA 2C1IA 5AFUA 4AH9A 3S3NA 4M3ZA 1HNVA 2X78A 4ELVA 2CGLA 5IWAK 4FWRA 2ATQA 3ITHA 4OPKA 1NK8A 1L5UA 1CXQA 1Z26A 4BVOA 3AVBA 3AO5A 2O8CA 1ZBLA 2Q0UA 4CEEA 2E5LK 3D2EB 1LWFA 3FZKA 4JYAK 1U6ZA 2P5OA 2FBYA 1TUUA 1YXQA 3M1FA 3F2KA 4BG8A 4IG3A 4B9MA 3NDKA 4CJ3A 4BGBA 4JKHA 2F9TA 2HBJA 2G8WA 4CI6A 3MWTA 1VQMN 4CEZA 2G8KA 3TAFA 1EWRA 4V19S 1RTHA 1RT2A 4A5AA 3TANA 3L2RA 5ADXA 2WTUA 1MWKA 4ID1A 1U49A 4I2PA 4ID5A 3O9QA 4FK0A 3OJSA 1GLCG 4OPAA 3NE6A 5HRSA 1VSLA 3SUOA 2RE2A 3VPZA 5EVZA 1Y97A 3ZX3A 5LMNK 3UE5A 4F3OA 2ZWHA 3KIOA 2PAVA 5FROA 5GAEP 4RW8A 5AQKA 2GTDA 4DFKA 5LL6Z 4CZJA 1LW2A 5TKWA 4GKKK 1EO1A 4A61A 3DMJA 4GW6A 1VSEA 4GV9A 3U9ZA 3C0BA 5DK5A 3HZ6A 4FPBA 3FFKB 3O8MA 4B9UA 1NK6A 2I5JA 2Z1HA 4FL9A 2HB5A 3MEDA 3RWUA 4JKBA 3BZKA 1E3MA 2PBDA 4DR3K 2FLOA 4KB0A 3AV9A 4CJUA 5HRRA 4KHWA 4KHYA 2HNZA 3T69A 1A5WA 5FPEA 2E2OA 4DTMA 3DLLL 3M6GA 1ZC6A 3L0QA 3OYLA 5I42A 1JL2A 1KXPA 4RCHA 4FW1A 2BANA 2PZSA 1U2VA 3SUNA 3SQ0A 4DFJA 1J53A 2YNFA 4CJRA 1HX1A 4JHDA 1OH5A 4Q0BA 4FJJA 1ASVA 5AQUA 5DM7L 2KW4A 3SJJA 3QEXA 1YJ9N 3R1XA 4I6MB 5CE3A 4N47A 1RT6A 3PV8A 3AAPA 4B8AB 2F7TA 3KVGA 5EU7A 2UYTA 1HNZK 4DLGA 3OHRA 1ZBHA 4KH5A 1J6ZA 3HXMA 1HR0K 3SQ2A 5AQGA 4H4MA 3VEXA 2KLAA 1ITGA 4CZEA 1BI4B 3WXJA 4KHNA 3EKUA 1TVRA 3U3YA 1XC9A 5AFUH 3TAPA 4OPJA 3HVRA 3SYZA 4GV6A 5AZIA 1G15A 3B8AX 5C25A 5SZTA 3DI6A 1YVNA 1TKTA 3ZLJA 3ZT3A 5HLFA 3WEEA 3WXLA 5J2NA 4RWTA 3VERA 5AQHA 1X9MA 3QIOA 4CF0A 4FYDA 4FJMA 4PKGA 4YOTA 2P9PA 5M1PA 3S3MA 1I94K 4RW4A 3CYGA 3BZCA 4H0TB 4B1YB 4CZIA 4NYFA 4JRQA 4Z4FA 5M1FA 4G1QA 3KJVA 4FJGA 1JCEA 2GBZA 2J4RA 1TAQA 1SL0A 1WSHA 3ASMA 4LF5K 3FZHA 3MXIA 4CJPA 3AARA 4YFUA 4FJXA 4CBWA 4DCHA 2E2PA 5HBMA 5K14A 3FLCO 4CJEA 4YOUA 4RW7A 3HRGA 3T19A 1VSJA 4AM7A 4BR4A 1RT3A 2W40A 4WFAL 4W5NA 3DLEA 1VQLN 3AY9A 5FPDA 1HJRA 3S5TA 3LAMA 2HF4A 3E66A 3TTCA 1RFQA 4CVNE 3OTOK 2VG5A 1S1VA 1TL1A 4E7HA 3SLCA 4M42A 2V51B 3EEQA 1QQNA 1TK8A 3I0RA 2F8TA 3W3DA 4B1VA 2OZMA 1KLMA 2YHYA 2E20A 3CQ8A 3LP0A 1HPMA 4W5RA 1S6PA 4AHTA 3C6UA 4PWDA 1WSFA 4CFDA 1K6YA 4DR6K 1Y64A 2YV0X 3TAQA 3KD1E 2EHGA 3H3NO 1T05A 2W41A 2BUPA 4JK7A 4F2SA 4E1JA 3CCMN 2HF3A 3KKRA 4KKOA 3H1VX 3MX2A 2FSNA 3ZEUA 4CJKA 1U04A 1FKOA 2OTLN 4DV7K 3PO5A 1LWCA 3C6TA 4BC5A 3CPWM 1BO5O 1Z25A 5ELZA 3L2VA 3RMBA 4KI6A 1SQKA 1MA9B 4CGJA 2VWBA 4CIGA 3D0PA 5M1QA 1VSKA 1WNSA 3PUFA 1WBDA 5T7BA 5AZJA 1X3MA 3SAGA 5CHIA 1Z6RA 2UXCK 1CZAN 3CCEN 1RNHA 5E26A 3MAQA 1IG8A 1R59O 5AQFA 4B9SA 3MXJA 5FPNA 1BUPA 3QDKA 1QZ5A 2HHXA 3R6MA 1BIUA 4O0JA 3TWHA 1IO2A 4N76A 4C8KA 3VQ6A 1BA1A 4Z94A 5C2DA 1RTIA 4B9VA 3JSMA 2G8HA 2Q0RA 3GDQA 1S5JA 4FLYA 5HROA 3O1BA 3ZYYX 4CHYA 4AQYK 1Q81O 4B9QA 3CD6N 1NK7A 3MXMA 5DM6L 2UUCK 1WSGA 3SV4A 4IG0A 2VQEK 3NH0A 1KTQA 4NCBA 3VQ8A 2HHQA 1S22A 2NRZA 2NRTA 4K42A 3RMDA 3AVGA 1RGIA 2QA4N 5AQRA 4DTPA 3UB5A 4OKEA 2RPIA 3H6EA 1VQ4N 2OTJN 4OLBA 3OBWA 4FWMA 4DQQA 4IO8A 3WUHA 1SZ2A 4DSKA 1VSIA 3I55N 4FK4A 4NCAA 1C0FA 1WLJA 4O5FA 3ZSRA 3VQDA 1T7PA 5LJWA 4BRCA 4CZHA 1F21A 2AP1A 1S9GA 2RKIA 3VQ4A 4YORA 4MDBA 1LAVA 3DAWA 4WYBA 1JCGA 3QESA 2YHWA 4GV3A 4JKFA 1LWEA 1TL3A 4BWMA 4BGAA 3PSFA 4BWJA 4BRGA 4IBNA 3VQAA 4M3XA 2A40A 1BA0A 2HHVA 4B9LA 5ADXH 2KQ2A 3H08A 1D5AA 3ZSYA 3L2QA 4R79A 3KK3A 1UWBA 2GUPA 2XY6A 2GEMA 4HHTA 3CCRN 5BREA 4DU3A 1YITN 3KK1A 1N34K 1U48A 3ENHA 4IOCL 1IKVA 4DUYK 3CJBA 3HJFA 3CF5L 3D6RA 1HYSA 3ULEA 5GADP 3NCIA 1JLFA 2Q1NA 3M8PA 4EHUA 2IVPA 3EZWA 4AHCA 1DEJA 3AO4A 3OYIA 3NH2A 2Q36A 2IAJA 3DOKA 3HL8A 1L3UA 2XRIA 3BF3A 3ATUA 3C65A 4LFAK 4DTNA 3KHYA 4BRQA 3LDNA 4BVPA 4EAHD 4PKHA 4IOAL 4WE1A 3CFPA 4C8MA 2KHOA 4I6MA 5IT9O 1NJIO 3E9LA 1Z05A 2Z1IA 1B9DA 1FKPA 3K57A 4NXNK 4JD2B 1L3VA 3FZLA 3MWPA 4DV2K 3VQPA 3AA4A 2IGIA 3TAGA 5KGXA 4JV5K 2YKMA 3C7NB 3QMLA 4F8RA 4OPHA 1DGKN 4CGDA 1BISA 5MLCQ 1C0GA 4FSVA 4BR9A 1MWMA 3OS0A 3EYZA 1IBLK 5GINA 4LF4K 2P9UB 2O4GA 4JI1K 3EN9A 1D4XA 1VQ8N 1K8KA 1KFDA 2FXUA 1TV6A 3TAEA 4DV1K 4DF8A 3ZSWA 4DSIA 2CH6A 5JENA 4BROA 3AO1A 3QEPA 3CYMA 4ICLA 1MU2A 4B3TK 1XNRK 3D2FA 4DFPA 4FOEA 3CHWA 1A5XA 4CK2A 1OH7A 2KZZA 2CGJA 3K5OA 3SI6A 1YJWN 4CERA 3L2WA 2O8CB 3AA2A 3CPEA 4MDAA 2O8DB 4YOWA 4CEFA 2WOMA 3A0IX 5BPMA 1NK4A 3V1OA 4CECA 4JS4A 2NRXA 4DV0K 2QWPA 4E19A 2UU9K 3N4QA 1U2VB 1UOCA 3GBTA 3HYFA 2F96A 3ENOA 3CC7N 2DFHA 4DMNA 1GLBG 2AJQA 3I33A 3P5JA 3LZIA 5AQTA 1WN7A 3LDPA 1A5VA 2Q97A 5JMVA 4FJ5A 4WF9L 4BRLA 1VAZA 1XUPO 3CJ7A 3QFPA 1DTQA 4MQ3A 3GE1A 4GMJB 2HNYA 4O55A 3MN9A 3RRGA 4DFMA 1GLEG 1TYQB 1DLOA 1U45A 2LSNA 1ATSA 3RMAA 1S6QA 4IJAA 3SBTA 4Z0UA 4AHVA 3DXMA 4QOZB 5AQSA 5AR0A 2HBKA 4BEBA 2GWJA 5EOYA 4CFAA 4I2QA 4BQZA 4DQPA 4B1ZA 1O1WA 4CEQA 2NLXA 1IJJA 5JLFA 1Q86O 2PYJA 4FLXA 4H5VA 2WBNA 4RW6A 3VA0A 1NBWA 4YDUA 1RBVA 1REVA 4AM6A 4F9OA 2OPPA 5AQOA 3QB0A 5A2QO 4DU1A 3EE8A 3CIPA 2O4IA 1TAUA 1NGEA 4R5PA 1U47A 5C10A 2NZTA 4ISFA 3G71N 2OPSA 4M3UA 5JS1A 3KWGA 3L4IA 4W5TA 3HI0A 5AJ3K 2QWNA 2QWOA 4ZHRA 4H0OA 3VOVA 4JRPA 1GOCA 1IKYA 1UAXA 4O4GA 5CYMA 3PLAA 4M45A 4FLZA 1W2BM 1S1TA 4AILC 3VQCA 3CM6A 3P31A 5BPNA 2VG7A 4LFCK 3UKRB 1D9FA 4FJKA 2P9NB 3HP6A 2KZMA 3DYAA 3CMAN 1GOBA 2D5RA 3MECA 1BCOA 3KWIA 1IV0A 2Z1GA 3LM9A 4RG8A 3RR8A 2A42A 1SKWA 3V9ZA 4KHSA 1KVCA 3J8AA 2ZD1A 3NMUA 1XHXA 4OGEA 3A5MC 3F5TA 4XH4A 3PX4A 1BU6O 1QZ6A 3HOSA 4X66K 1K9MO 2BDPA 2IS3A 5I9EB 2PFUA 4MLEA 1Q18A 3HVTA 3OYBA 1RDCA 1T3VA 5JICA 4DTRA 1IBKK 3SK3A 4DTJA 4FK2A 2E8AA 3THXB 1JLGA 2O8EB 3K0SA 4H5TA 3OYEA 4M3RA 3SAHA 4OKKA 3QBXA 4HUFA 4N41A 1RT1A 2QTDA 5KI6A 2ZE2A 4M7YA 1KD1O 3W0LA 1ASUA 1XI1A 2F9WA 3P1GA 4PA1A 3DXKA 4GVEA 3K5MA 3SQ1A 1VK0A 3O1WA 3AVKA 5FRMA 2P9PB 4E89A 5FDLA 4PKIA 4EP4A 5C2FA 3RVCA 4H0XB 1TK0A 1YVUA 4PY5A 4FXDA 1HKGA 3CQYA 2IDOA 2QW9A 5AQYA 3LP3A 2BE2A 4HTLA 1LW0A 4MFBA 4BR7A 3DJCA 4LSLA 1JL1A 3DXKB 4JN4A 3WQUA 4ILJA 4C1NI 2HHIA 3V9UA 4KTWA 5AZIB 3CFOA 2YHAA 1SL2A 4YHHK 1WAFA 4H0PA 3TPQA 4CJSA 2D1KA 3AGKA 5HP1A 1XMQK 3ZT4A 4C8OA 3HPHA 4QS9A 5GAGP 3M8RA 5BPLA 1RCHA 4CIFA 1KQSM 2OPQA 3VTIA 1GLDG 2G8FA 4IEEA 3NH1A 3JAMO 4DHYA 3OW2M 1WUAA 4C23A 1VSMA 3FGUA 3OA9A 2ETJA 4DQIA 3DXMB 5M1KA 1Q9YA 2ZM6K 4WFNL 1NK0A 2WFBA 1KVBA 4MO5A 2GWKA 4XEIA 1NKEA 3CCUN 5TKYA 4CEBA 3CG7A 3LPTA 3LANA 1WB9A 2HMPA 5C15A 5LJVA 2P9LB 4CFCA 1DKGD 1NG9A 1OVQA 2YCHA 2VG6A 4IWVA 2PYLA 1YJNN 4B1WB 4PHTX 4BC4A 4KHPK 4CD1A 5BR9A 2EX3A 3AA3A 1BIZA 2F8SA 5HRPA 3OYNA 4DQSA 4KHQA 2D0BA 1EP4A 1RDDA 3AAQA 5SWMA 2Q3SA 1X9JA 3SBGA 4FJ8A 3MCPA 2DFEA 1RDUA 4CESA 4LF8K 1Q8IA 3VN5A 1QTMA 1KAXA 1EWQA 4UY8O 5C24A 3R9PA 1K8AO 1JXBA 3BEXA 2HVHA 4FLWA 3CC4N 4J2AA 4UQGA 4H5RA 2QKBA 3LWMA 2HW3A 4TSXA 3QFUA 2X6NA 1OKJA 1HPZA 3HSTB 1SV5A 2D0CA 4CBUA 4JD2A 2OA8A 1NM1A 3QERA 3QNNA 4DTSA 1YIJN 1RBRA 2NRRA 4JKAA 3G4SN 2GELA 5EX5A 1NK9A 4LH5A 3C95A 1TUYA 2C1GA 3P4IA 4BC2A 3NFAA 4XH1A 1C1BA 4BR0A 3ENBA 1NJXA 3NHGA 4BRMA 1JLCA 1HMVA 3O80A 1HQUA 3SMSA 5KPRA 3ZSXA 1QSLA 1XNQK 3NVKA 3CCLN 1BQNA 1NMNA 3O9SA 3THWA 2A41A 4DS5A 1I39A 3KKSA 2UUBK 3AVCA 4LSNA 2WC9A 5HL7L 3KK2A 4BRPA 3VEYA 1V4SA 1NNEA 3T1AA 4A2BA 2P9IA 4BACA 3RRHA 3SPYA 3P83D 5AQVA 4BDZA 3OYAA 2FBTA 3SQ4A 1BCMA 2RN2A 4IXCA 3HO1A 4XJXA 3UKUA 3EKSA 1NGAA 4DTUA 3OVNA 3ZSQA 2B4JA 4Z4HA 3DM2A 2V7YA 4LD0A 4BRNA 3U9DA 2NRVA 4FLUA 5AQMA 1SUQA 1G99A 4M63C 4FJHA 4FWOA 4BRKA 1BWFO 4DU4A 2JWKA 3S41A 2QI2A 4B9TA 4CJ5A 5BR8K 4DG1A 3O6WA 4JS5A 1QS4A 3L4QA 4BDPA 3K58A 1TK5A 4BE1A 1RTJA 4G9ZA 3ZX2A 1LCUA 1XMOK 1WSJA 3O08A 1TYQA 5CR4A 2P9SA 4WQ4C 5J2MA 4HCCA 4BRFA 4IFEA 3I0SA 3KK7A 3WXKA 3ZX0A 2W6LA 2ZGYA 5GIPA 4A57A 3F9KA 1RTDA 4NYNA 2ZJQL 3U6FA 4DKWA 1GLLO 3DLGA 3SMPA 4WQ5A 4EZ9A 3NF8A 4KI4A 4OLAA 3AO3A 3E9OA 4CJTA 4OX9K 1W7AA 1JLBA 3AVMA 3E9PA 4BQLA 3LL3A 4ISGA 5GIOA 1J5OA 2P51A 2R7YA 4MO4A 3IRXA 1T03A 2YHBA 1NOZA 2P9NA 4E7LA 4FZZA 3QETA 2VWKA 5EY4A 3O9UA 3MN5A 2O8BA 1T8EA 3T3FA 3G25A 3C6AA 3DLHA 3OYJA 3FZMA 2P9LA 3VTHA 4H5WA 4YY3K 3ZSOA 1YT3A 4CCHA 3MEGA 2VYPA 3VF6A 1X9WA 2NUBA 3THYB 2QXFA 3B6PA 2A3ZA 1KSPA 5CY4A 4BC3A 1J9AA 3CJ1A 4OVLA 3LM2A 5CYQA 3K5LA 3RSEB 4E1MA 5KTQA 2V52B 4BE2A 4I7FA 3BGRA 3CMEN 2VQFK 3T1YK 1EQYA 3MDQA 1NOYA 4AHUA 3ULEB 3M8SA 1IBMK 1QVGM 1VRUA 3MN7A 2VCPA 4KTQA 3RMCA 1KFSA 1L3SA 2QWLA 3IDHA 1QVFM 2HBMA 1S72N 3NVMA 1C1CA 2AA4A 5C42A 2OYQA 4KH6A 1ASWA 4DV5K 4XH5A 3OS1A 2YNIA 1Q7YO 4BG9A 4NB4A 3DRSA 4IEIA 3I56N 4LF7K 1ILYA 1RBTA 3H1QA 1EKEA 2P1JA 4WQ4A 1NK5A 4JI3K 1HNWK 2G8UA 2E1ZA 4DR5K 1KVAA 4CHQA 4OKJA 3V1RA 3VQ5A 5KQDA 3IUCA 1BI4A 3QICA 3VGKA 1NGGA 2RF2A 3F73A 1FW6A 2IVOA 5FPMA 2X6SA 3LDOA 2QXLA 4RW9A 4K8ZA 4CJVA 3QEWA 3HOTA 2NNWA 4BRIA 2CH5A 4PL8A 5AQQA 1S1XA 4U67L 3BDPA 4GKJK 2DFFA 2RHKA 2NRWA 2F4VK 3TSQA 1O13A 1QQOA 1VHXA 1P90A 2P9KA 4NLBA 3KLEA 5F2RA 4BY9C 3SPZA 4B08A 1YTUA 1NGCA 1JLAA 3L6QA 4DWIA 1QE1A 1VQON 1NGDA 1T6CA 1HLUA 1BOTO 3L2UA 3CC2N 3G10A 3AVAA 3M5RA 3CCSN 2JWLA 3WEEB 1JCFA 1ZYQA 1B92A 4CHNA 2Y1JA 4E7JA 3U3GA 1C0TA 1SS6A 4Q5VA 3VQBA 3AVIA 3ATVA 2FBVA 1ZBFA 1VSDA 3ZETB 4FWKA 1M90O 2E4LA 3HPOA 3CETA 3SZ2A 2WONA 4CJ7A 4X64K 4H0YB 3ZSVA 2OCEA 5DMRA 1QQMA 4J2EA 5C12A 3J7ZO 4EZ6A 3SJHA 2Q2RA 4DV6K 4MLHA 4FWPA 3AGRA 1N5YA 4ZTJA 4H5NA 2E2QA 1W9HA 3AVLA 4FJ7A 4CK3A 4CF8A 1S9EA 3F9MA 4DB3A 1FK9A 4JK9A 1GOAA 4F4KA 4M3TA 4BECA 4JKCA 3VEWA 2B6AA 5AZJB 4GY2B 4FJLA 4X62K 3M3ZA 1X3NA 1W0HA 4E0DA 1VQ6N 3CJAA 3BUZB 2BGGA 1YTAA 3A5NC 3ZT2A 1NGJA 5KPZA 3VA3A 1W97L 2YNGA 4EFHA 4FO0A 4N56A 4CEOA 4W5OA 4FZXC 3O4NA 1B9FA 1YF5L 2EWSA 2H3GX 3HBTA 2JLEA 3V9SA 3THXA 1VQKN 3PX6A 1U4BA 4FWLA 4CZMA 4F2RA 3LAKA 3K59A 1EXQA 3KLHA 3A8YA 3MCAB 1E4GT 1C1AA 3QLHA 3HM8A 3ISNC 3G6EN 1DTTA 1VSHA 4FJNA 2YNHA 5I3UA 3VF4A 4JHDB 1TGOA 4H0VB 1NLVA 2G8IA 3JS6A 1S3XA 2W6KA 4L8RB 3IKMA 3O4QA 1FXXA 3AO2A 1Q9XA 4JI2K 2ZJRL 3P38A 3PX0A 3JYTA 3ZSZA 4E72A 3BY5A 1S1WA 1ATNA 3VEOA 3ID8A 1NJYA 3CM5A 2ITGA 1UA1A 4JKGA 4I9QA 2OZSA 3LZJA 3WNEA 3IAYA 3D2FB 4C1NK 1ZBUA 1N33K 2GUIA 3CCJN 4CBXA 2OPRA 4FM1A 2ASMA 4B1UB 2HNDA 4FPAA 4NO7A 3K2PA 2IC3A 4CF1A 3THVA 2IVNA 2VWJA 5B8HA 3N4PA 4IFVA 2HHHK 4FOIA 3WQTA 3R3LA 2OANA 4GNIA 3EL2A 5CZ2A 3VEZA 3PIPL 3OYGA 3QEIA 1VQNN 5KRTA 2I7NA 4YNQA 2O8DA 4WQ5C 4KREA 4HTUA 2DPNA 4LF9K 4IJNA 1WAJA 2YX6A 3D7EO 4A5BA 3AVFA 3IS9A 1NGBA 1S1UA 4JLHA 3V81A 3H46O 5KQ8A 3OYFA 4CK1A 4PUOA 2CGKA 4YOVA 3K9KA 3GL1A 3B6OA 2E1YA 3GG4A 1Q82O 3RTVA 1BHLA 3QBWA 1NKCA 3NF9A 4BRHA 4Y1CA 3MX5A 3A5OC 2ZQBA 5F0XA 2HHUA 1CZBA 1C6VA 4CJQA 3DLBA 3D45A 4ILGB 4M7XA 4K8XA 1RT7A 3VQ7A 1I3AA 4O5BA 5AQXA 5AQLA 2HVIA 4DR2K 1SAZA 3OS2A 4NCGA 4BREA 1NWKA 4IFYA 1LAWA 4AHRA 4FWSA 1D9DA 1M1KO 3WNGA 1EX4A 3CCQN 3AVHA 5M1NA 3NAEA 2JGUA 2E6LA 2GX9A 4PQUA 4DLEA 4CGHA 3KZBA 5KGWA 4CEDA 1LV5A 5AQJA 3V6DA 4K25A 4LC9B 4FM2A 2IIRA 3SV3A 4BR5A 3SAFA 4JI8K 5FRNA 4KTZA 4QS8A 4X65K 4OGCA 4CF9A 1C0UA 4KH4A 4CD3A 2Y1IA 4FCYA 2I7PA 1K73O 3VMFB 2HMIA 3NGIA 3OYDA 3K9JA 1JJ2M 1HJOA 4H8KA 1K8KB 2E2NA 4IDHA 4DV4K 1BDGA 3UIQA 3TAMA 2XO7A 5AQPA 3MK6A 2VGMA 4KHUA 1SKSA 1H1VA 2YI1A 3VEVA 3VF2A 5J2PA 3NGZA 4KO0A 3U8XA 2YHXA 1BGXT 3S3OA 1QHAA 2P9KB 3OYKA 4DSJA 5AQZA 4WFBL 4FLTA 2QWRA 4N5SA 4M3YA 5FLXO 1HQEA 3WT0A 2PY5A 4CZGA 4DUZK 1KLNA 4RTFD 4C8LA 4YOXA 3TTDA 4BE0A 2HOEA 1HRHA 4B8CA 2P9UA 4DSLA 2O8FA 3EO3A 3O3HA 4CZFA 4CGIA 3D2EA 4O8KA 4CZKA 4ELUA 2XHBA 1RDBA 3I8BA 4JI4K 3CI5A 3KD5E 3H45C 1KC8O 5D3GA 5BRDA 3TU5A 4F3TA 2Z1JA 1OH6A 5JS2A 1BG3A 3C94A 2YJEA 4Z4GA 1RDWX 4ILHA 1IG9A 1JLEA 3VENA 2KTQA 4QAGA 4J2DA 3TABA 3FZFA 4DQ8A 4W5QA 4HUEA 2ASOA 1HKCA 3VGLA 4FM0A 2E88A 4E7KA 4JI6K 4A2AA 4BR2A 1J54A 5BRFA 3O9TA 2W42A 2XY5A 3CFRA 2X74A 1ZBSA 3L8BA 4U7BA 4WCEL 2HHSA 3ZT1A 3VQ9A 5BRHA 1NGIA 4OO1J 1GLJO 1VRTA 4HCBA 2QM1A 4EP5A 4CIEA 1N6QA 4CGGA 1HNIA 1BL3A 3J7AP 5HOOA 3J7YP 1J5EK 4E1NA 4IOXA 3HK2A 1CZ9A 5M1OA 4DTOA 4O44A 2DY4A 1IKWA 3VQEA 3DOLA 3S9HA 4K0KK 4QCLA 1YAGA 5KRSA 1WSEA 4CJFA 4Z4IA 4DV3K 4KFBA 4H4OA 4A62A 4CHZA 2HBLA 3NF7A 1NJZA 4JI5K 4LFBK 3FR0A 3DWLA 3KTQA 3PIOL 3JXUA 4CE9A 3LPUA 3L3VA 4CFBA 4JEPA 3AVJA 4KRFA 3ZT0A 2A6AA 4K43A 3CERA 3V4IA 1OH8A 4CHOA 4Z4EA 2P9SB 4B9NA 4JK8A 4CJWA 1ZXOA 3QINA 3UKRA 2GV9A 3V1QA 3ULDA 5LMUK 3HP9A 4FZYA 2E6MA 4BRDA 5BN8A 1KRPA 4NXMK 4ZTFA 2A5XA 3WNHA 1KCFA 3LDQA 1TKDA 2QWMA 1HYVA 3QIPA 3O3GA 4EIAA 3HSCA 1ESVA 5GAHP 3E1YA 2NRHA 4DSEA 1VSFA 4DR4K 1JLQA 2W00A 1YHQN 3QEVA 4AF1A 3RR7A 4DR7K 3O5BA 2QKKA 1VQ9N 1QSYA 5H1SQ 1IKXA 3BF1A 3HTVA 4A59A 4E3SA 3C7NA 1N8RO 3NBPA 4YOYA 3CQXA 2KKZA 3Q7BA 3GOIA 4JNEA 4JI0K 1HUXA 5C0YA 4KBOA 4FJIA 4KV8A 4M3WA 3NGYA 5AQWA 3TSPA 4ELTA 1C0MA 3IMXA 2P5GA 4DQRA 2G8VA 1RBUA 4KPYA 3Q7CA 1X1PA 4BRAA 2D0PA 5E84A 3UKUB 4KAZA 4JKGB 2BTFA 2D4WA 1NU0A 2KFNA 4Y0WA 3LWLA 3P39A 5F1XA 4DF4A 4FVUA 1DT9A 3OY9A 1BQMA 1TKXA 1QQCA 3V9WA 1T44A 3J81O 1VQPN 3CJCA 4NLCA 4CHPA 2A1SA 3U4LA 4YDUC 3OJUA 3HM9A 1CLQA 3L3UA 3CXCM 5JVGL 5LY3A 4DS4A 1X9SA 2HHWA 2XY7A 2O8FB 1GLFO 2XY8A 2UXBK 2HHTA 3TR8A 1QHTA 3TARA 4B3MK 4QS7A 1T6DA 4BDYA 1LOTB 4L3QA 3AVNA 3K5NA 4CEAA 4FWQA 1XWLA 3IFRA 2YKNA 3LDSA 3VQQA 5J2QA 4B3OA 1NJWA 2IOCA 1N32K 3E01A 3BP8A 5JVHL 5BN9A 2UXDK 1VQ7N 3MEEA 1YI2N 3R8EA 3WXIA 4CF2A 3QO9A 3VETA 4DTXA 4BE7B 2Q31A 3FE1A 1SKRA 1L3TA 3OYHA 1WSIA 3CCVN 2B5JA 1WBBA 1NKBA 1JKHA 4H03B 4CGFA 5CZ1A 2KFZA 3T1HK 4JKDA 3HT3A 4J8FA 1E4FT 3SUPA 4OJRA 4IDKA 4FWNA 3TTFA 3DLRA 1GLAG 1RBSA 1RT5A 3THYA 3O3FA 5J1EA 3O9RA 1XQSC 1JXEA 3A2FA 5KPTA 1TKZA 3OBYA 2HSTA 4AHSA 4EHTA 4FLVA 4ISEA 4CJ4A 4JI7K 3VGMA 3NF6A 1NMDA 5HRNA 4LF6K 1WOQA 1N36K 4JAXA 4CW7B 2QK9A 4FW2A 1CXUA 4E7IA 2DTUA 1YUWA 1SL1A 1D8YA 4HVJA 2P9IB 3HPGA 4FJ9A 4FVMA 3ZEUB 3PO4A 4IZ9A 3MN6A 4HWIA 4O0IA 3OYCA 2O8BB 4Z4CA 3EZ5A 3ZETA 3IG1A 2FF3B 4IKFA 3MMVA 4GVMA 1NGFA 1ZBIA 1FJGK 1R0AA 3M8QA 3RSEA 2ITMA 1MDUB 1OVYA 3FFIA 4B3SK 2WUSA
chains in the Genus database with same CATH topology
1NGBA 2ZF5O 4FWMA 3T7ZA 4IO8A 3H46O 3WUHA 1SZ2A 1HKBA 1V4TA 4CBUA 3I55N 4JD2A 4CZLA 1NM1A 5KQ8A 2VGNA 1YIJN 1NGHA 2CGKA 2NRRA 4JKAA 1C0FA 4YOVA 2GELA 5EX5A 3G4SN 3K9KA 4O5FA 3GL1A 2FF6A 5LJWA 1TUYA 2YJFA 2QEXN 4BRCA 4CZHA 3P4IA 2E1YA 2C1GA 3GG4A 2AP1A 4BC2A 4XH1A 4BR0A 1Q82O 2QWQA 3ENBA 3QBWA 4YORA 1P8ZA 4MDBA 4BRMA 3O80A 3DAWA 3SMSA 4BRHA 5KPRA 4WYBA 1JCGA 1KAYA 2YHWA 3LDLA 4JKFA 3MX5A 4GV3A 3A5OC 5JLHA 2V7ZA 4BGAA 4IO9L 3NVKA 5F0XA 4BRGA 5EXWA 3CCLN 4O8UA 3O9SA 3TSUA 2A41A 2A40A 1BA0A 3VESA 4ILGB 2FSJA 4M7XA 2WC9A 5AQXA 5ADXH 5AQLA 5HL7L 1SAZA 4PL7A 4BRPA 3H3OB 4R79A 4K41A 1KAZA 1XC3A 3VEYA 1V4SA 2GUPA 4A2BA 2GEMA 2P9IA 3CCRN 1VQ5N 4BREA 5BREA 1YITN 2FSKA 1NWKA 4JKEA 3ENHA 5AQVA 4IOCL 1ATRA 4FWSA 3CJBA 3CF5L 3D6RA 3ID6A 3A5LC 1M1KO 3ULEA 5GADP 3CCQN 2Q1NA 4IXCA 4XJXA 5M1NA 2ZGZA 4B1XB 3UKUA 4EHUA 2GX9A 2IVPA 3EZWA 3WXMB 3EKSA 1NGAA 3C6HA 1DEJA 2ASPA 2Q36A 3KZBA 2D0OA 5AQIA 5AQJA 2V7YA 4BRNA 3BF3A 3ATUA 4K25A 2IIRA 3EE9A 4LC9B 3U9DA 3C65A 4BR5A 3SAFA 2BH1A 2NRVA 5AQNA 2ZJPL 5AQMA 3KHYA 1G99A 4M63C 3CJ9A 4FWOA 4BRQA 3LDNA 4BRKA 1BWFO 3O4WA 4QS8A 2JWKA 2C1IA 5AFUA 4BVPA 3S41A 2QI2A 4KH4A 4CD3A 4EAHD 2CGLA 4PKHA 4IOAL 4FWRA 2KHOA 3O6WA 4I6MA 2I7PA 1NJIO 3E9LA 3L4QA 3VMFB 1Z05A 1K73O 4BVOA 4JD2B 3FZLA 3K9JA 2Q0UA 3MWPA 1JJ2M 1HJOA 3D2EB 1K8KB 4G9ZA 2E2NA 3ZX2A 3FZKA 1LCUA 1U6ZA 4IDHA 1BDGA 3O08A 1TYQA 1TUUA 1YXQA 3C7NB 3M1FA 3F2KA 2P9SA 3QMLA 4OPHA 4WQ4C 5CR4A 4BG8A 4BRFA 4IFEA 1DGKN 3KK7A 3WXKA 3ZX0A 5MLCQ 1C0GA 5AQPA 3MK6A 2VGMA 4JKHA 2ZGYA 4FSVA 4BGBA 2HBJA 2F9TA 1MWMA 4BR9A 5GIPA 4A57A 4CI6A 2ZJQL 3MWTA 5GINA 1VQMN 1H1VA 2YI1A 3VEVA 3VF2A 4DKWA 1GLLO 2P9UB 3U8XA 3SMPA 4WQ5A 2YHXA 3EN9A 1D4XA 1VQ8N 1K8KA 3E9OA 2FXUA 4A5AA 1QHAA 2P9KB 5AQZA 4WFBL 2QWRA 3E9PA 4BQLA 3LL3A 5ADXA 2CH6A 1MWKA 4ISGA 4BROA 5GIOA 3WT0A 4MO4A 4CZGA 4RTFD 4YOXA 3TTDA 3O9QA 3D2FA 2HOEA 1GLCG 4OPAA 4FOEA 3CHWA 2P9UA 2P9NA 2CGJA 2RE2A 3EO3A 5EY4A 3VPZA 3O9UA 1YJWN 3MN5A 5EVZA 4CZFA 3CPEA 3D2EA 3G25A 4MDAA 4O8KA 3C6AA 3ZX3A 4CZKA 3UE5A 3FZMA 3I8BA 2P9LA 3CI5A 3VTHA 4H5WA 4YOWA 3H45C 2ZWHA 1KC8O 2PAVA 3A0IX 5BPMA 5GAEP 2VYPA 3VF6A 5AQKA 2GTDA 2NRXA 5BRDA 3TU5A 2QWPA 3N4QA 1U2VB 4CZJA 1BG3A 2A3ZA 5TKWA 3GBTA 4BC3A 2YJEA 1RDWX 3ENOA 4ILHA 1EO1A 3CC7N 3CJ1A 4A61A 3LM2A 1GLBG 3VENA 3I33A 4GV9A 3RSEB 5AQTA 3U9ZA 3LDPA 3C0BA 3FZFA 2Q97A 3HZ6A 5JMVA 2V52B 4DQ8A 2ASOA 1HKCA 4BRLA 4FPBA 3VGLA 4WF9L 1VAZA 1XUPO 2E88A 3FFKB 3O8MA 4A2AA 3CMEN 3CJ7A 3QFPA 4BR2A 3O9TA 5BRFA 4FL9A 1EQYA 1ZBSA 4JKBA 3MDQA 3GE1A 2PBDA 4U7BA 3ULEB 4WCEL 2FLOA 3MN9A 1QVGM 5BRHA 1NGIA 3MN7A 2VCPA 4OO1J 1GLEG 1GLJO 1TYQB 2QWLA 3IDHA 2QM1A 1QVFM 2HBMA 3T69A 5FPEA 3NVMA 1ATSA 2AA4A 2E2OA 3DLLL 1S72N 4KH6A 3M6GA 4IJAA 3SBTA 1ZC6A 4XH5A 3L0QA 5HOOA 4IOXA 3DXMA 1Q7YO 5AQSA 5AR0A 1KXPA 2HBKA 4NB4A 4RCHA 5M1OA 2GWJA 5EOYA 4BG9A 4BEBA 4IEIA 1U2VA 1YAGA 4BQZA 3I56N 1ILYA 3H1QA 1HX1A 4WQ4A 4B1ZA 4JHDA 2E1ZA 2NLXA 4A62A 5DM7L 5AQUA 2HBLA 1IJJA 5JLFA 1YJ9N 1Q86O 3R1XA 5KQDA 3IUCA 4I6MB 3FR0A 4H5VA 2WBNA 5CE3A 3DWLA 3PIOL 1NBWA 3JXUA 3QICA 1NGGA 4YDUA 3VGKA 4AM6A 4F9OA 5AQOA 3QB0A 4JEPA 2IVOA 3AAPA 2F7TA 3KVGA 5FPMA 3EE8A 3LDOA 2A6AA 2QXLA 2UYTA 3OHRA 3CERA 3CIPA 4K43A 1NGEA 4KH5A 1J6ZA 2P9SB 3HOTA 5C10A 2NNWA 2NZTA 4BRIA 5AQGA 4ISFA 4JK8A 2CH5A 2KLAA 4PL8A 5AQQA 1ZXOA 3KWGA 3VEXA 4U67L 3G71N 3L4IA 4CZEA 3UKRA 3HI0A 2RHKA 2QWNA 2NRWA 2QWOA 3WXJA 3EKUA 4H0OA 3TSQA 3VOVA 4BRDA 5BN8A 5AFUH 1O13A 1QQOA 2A5XA 1P90A 2P9KA 3LDQA 3PLAA 4NLBA 1W2BM 2QWMA 4GV6A 5AZIA 5F2RA 3HSCA 3B8AX 3P31A 4EIAA 4BY9C 1ESVA 5GAHP 5BPNA 3E1YA 2NRHA 1YVNA 3UKRB 2W00A 3WEEA 1YHQN 3WXLA 4RWTA 1NGCA 3VERA 5AQHA 2P9NB 4AF1A 3L6QA 3O5BA 3CMAN 1VQON 1VQ9N 5H1SQ 1NGDA 4PKGA 3BF1A 3HTVA 4A59A 4YOTA 1T6CA 3KWIA 1HLUA 3LM9A 1BOTO 2P9PA 5M1PA 3CC2N 2A42A 3C7NA 4H0TB 4B1YB 1N8RO 4CZIA 4YOYA 3J8AA 3CQXA 3NMUA 2KKZA 3Q7BA 3GOIA 3M5RA 4JNEA 3CCSN 3A5MC 3F5TA 4XH4A 5M1FA 1BU6O 1HUXA 1QZ6A 3HOSA 2JWLA 3WEEB 1JCFA 1JCEA 2J4RA 1K9MO 5C0YA 4KBOA 5I9EB 1SS6A 2PFUA 3FZHA 4MLEA 5AQWA 3TSPA 1Q18A 3AARA 3ATVA 3IMXA 1T3VA 3ZETB 5JICA 4FWKA 1M90O 4CBWA 3CETA 4DCHA 3SK3A 3Q7CA 2E2PA 4CJ7A 2E8AA 5E84A 2D0PA 3UKUB 4BRAA 4H0YB 4H5TA 4JKGB 1QQMA 3FLCO 5C12A 2BTFA 2D4WA 3QBXA 4YOUA 3SJHA 3SAHA 3HRGA 3J7ZO 2Q2RA 2QTDA 4Y0WA 3P39A 4AM7A 5F1XA 4FVUA 1DT9A 2W40A 4FWPA 4MLHA 3AGRA 4BR4A 4WFAL 4H5NA 1VQLN 3AY9A 4M7YA 1KD1O 2E2QA 3W0LA 5FPDA 2F9WA 1T44A 3DXKA 4GVEA 1VQPN 3CJCA 3F9MA 4NLCA 3O1WA 4DB3A 2HF4A 3E66A 2P9PB 3U4LA 4PKIA 1RFQA 4JK9A 4YDUC 3TTCA 5C2FA 3RVCA 4H0XB 1HKGA 4BECA 3CQYA 4JKCA 3VEWA 3CXCM 5AZJB 5JVGL 2QW9A 4GY2B 5AQYA 4HTLA 3M3ZA 5LY3A 1X3NA 4BR7A 3DJCA 3SLCA 2V51B 1VQ6N 1QQNA 3CJAA 1GLFO 3BUZB 3DXKB 4JN4A 3WQUA 3A5NC 3W3DA 1NGJA 4B1VA 5KPZA 4ILJA 4C1NI 1W97L 4EFHA 2YHYA 4FO0A 2E20A 4QS7A 1YF5L 2EWSA 2H3GX 3HBTA 5AZIB 1HPMA 1T6DA 1VQKN 4H0PA 3TPQA 2D1KA 3AGKA 1LOTB 4FWLA 4L3QA 4CZMA 4FWQA 3A8YA 3MCAB 1E4GT 3IFRA 4QS9A 5GAGP 5BPLA 1KQSM 1Y64A 3HM8A 3G6EN 3BP8A 5JVHL 5BN9A 3VTIA 1GLDG 3H3NO 1VQ7N 2W41A 1YI2N 3R8EA 2BUPA 3WXIA 4IEEA 3VF4A 3VETA 3OW2M 4JHDB 4DHYA 4BE7B 4JK7A 2Q31A 3FE1A 4H0VB 4E1JA 1WUAA 4C23A 3CCMN 1NLVA 2HF3A 3JS6A 3OA9A 3FGUA 1S3XA 3H1VX 3DXMB 3MX2A 5M1KA 2FSNA 3ZEUA 3CCVN 2OTLN 3IKMA 4WFNL 3CPWM 4BC5A 4H03B 2WFBA 2ZJRL 1BO5O 3P38A 5ELZA 4MO5A 2GWKA 4XEIA 1SQKA 1MA9B 3CCUN 2VWBA 5TKYA 1ATNA 5M1QA 3ID8A 3VEOA 4JKDA 2HMPA 5C15A 5LJVA 4J8FA 2P9LB 1E4FT 1DKGD 2YCHA 4FWNA 1X3MA 4JKGA 5AZJA 3SAGA 3TTFA 5CHIA 1Z6RA 1GLAG 1CZAN 4IWVA 3CCEN 5E26A 1YJNN 1IG8A 1R59O 5AQFA 4B1WB 3D2FB 4PHTX 4BC4A 3O9RA 1XQSC 5FPNA 4CD1A 5BR9A 4C1NK 5KPTA 3CCJN 1BUPA 4CBXA 3QDKA 1QZ5A 3R6MA 3OBYA 2ASMA 2HSTA 4EHTA 4B1UB 4ISEA 4FPAA 1BA1A 4NO7A 4Z94A 3VGMA 1NMDA 3AAQA 5C2DA 2Q0RA 1X9JA 3SBGA 1WOQA 3GDQA 4JAXA 2IVNA 3MCPA 3O1BA 3ZYYX 1Q81O 4B9QA 5B8HA 3N4PA 3CD6N 1RDUA 1YUWA 4FOIA 5DM6L 3WQTA 2P9IB 3R3LA 2OANA 4GNIA 3EL2A 3PIPL 3VEZA 3ZEUB 1KAXA 1VQNN 4IZ9A 3MN6A 4UY8O 4HWIA 2I7NA 1S22A 3R9PA 1K8AO 2NRZA 2NRTA 4K42A 3ZETA 4WQ5C 1RGIA 2FF3B 3BEXA 2QA4N 3MMVA 2DPNA 1NGFA 5AQRA 3CC4N 4IJNA 2YX6A 4H5RA 3RSEA 3UB5A 3D7EO 2ITMA 4A5BA 1OVYA 1MDUB 3H6EA 1VQ4N 3QFUA 1OKJA 2OTJN 2WUSA 3OBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGB A;  2ZF5 O;  4FWM A;  4IO8 A;  3H46 O;  3WUH A;  1SZ2 A;  1HKB A;  1V4T A;  4CBU A;  4JD2 A;  4CZL A;  1NM1 A;  5KQ8 A;  1NGH A;  2CGK A;  1C0F A;  2GEL A;  5EX5 A;  4O5F A;  3GL1 A;  2FF6 A;  5LJW A;  1TUY A;  2YJF A;  4BRC A;  4CZH A;  3P4I A;  2E1Y A;  3GG4 A;  2AP1 A;  4BC2 A;  4XH1 A;  4BR0 A;  2QWQ A;  3QBW A;  4BRM A;  1P8Z A;  3O80 A;  3DAW A;  3SMS A;  4BRH A;  5KPR A;  4WYB A;  1JCG A;  1KAY A;  2YHW A;  3LDL A;  3A5O C;  5JLH A;  2V7Z A;  4BGA A;  5F0X A;  4BRG A;  5EXW A;  2A41 A;  2A40 A;  1BA0 A;  3VES A;  2FSJ A;  4M7X A;  5AQX A;  5ADX H;  5AQL A;  1SAZ A;  4PL7 A;  4BRP A;  3H3O B;  4K41 A;  1KAZ A;  1XC3 A;  3VEY A;  1V4S A;  2GUP A;  4A2B A;  2GEM A;  2P9I A;  4BRE A;  5BRE A;  2FSK A;  1NWK A;  3ENH A;  5AQV A;  1ATR A;  4FWS A;  3CJB A;  3A5L C;  3ULE A;  2Q1N A;  4IXC A;  2ZGZ A;  4B1X B;  3UKU A;  4EHU A;  2IVP A;  3EZW A;  3EKS A;  1NGA A;  1DEJ A;  2ASP A;  2Q36 A;  3KZB A;  2D0O A;  5AQI A;  5AQJ A;  2V7Y A;  4BRN A;  3BF3 A;  3ATU A;  4K25 A;  2IIR A;  4LC9 B;  3U9D A;  4BR5 A;  5AQN A;  5AQM A;  3KHY A;  1G99 A;  4M63 C;  3CJ9 A;  4FWO A;  4BRQ A;  3LDN A;  4BRK A;  1BWF O;  3O4W A;  4QS8 A;  5AFU A;  4BVP A;  3S41 A;  4CD3 A;  4EAH D;  2CGL A;  4PKH A;  4FWR A;  2KHO A;  3O6W A;  4I6M A;  2I7P A;  1Z05 A;  4BVO A;  4JD2 B;  3FZL A;  2Q0U A;  1HJO A;  3D2E B;  1K8K B;  2E2N A;  3ZX2 A;  3FZK A;  1LCU A;  1U6Z A;  1BDG A;  3O08 A;  1TYQ A;  1TUU A;  1YXQ A;  3C7N B;  3M1F A;  3QML A;  2P9S A;  4WQ4 C;  4BG8 A;  4BRF A;  1DGK N;  3WXK A;  3ZX0 A;  1C0G A;  5AQP A;  3MK6 A;  4BGB A;  2ZGY A;  4FSV A;  4BR9 A;  2F9T A;  1MWM A;  4CI6 A;  1H1V A;  2YI1 A;  3VEV A;  3VF2 A;  1GLL O;  2P9U B;  3U8X A;  3SMP A;  4WQ5 A;  2YHX A;  3EN9 A;  1D4X A;  1K8K A;  2FXU A;  1QHA A;  2P9K B;  5AQZ A;  2QWR A;  4BQL A;  5ADX A;  3LL3 A;  2CH6 A;  1MWK A;  4ISG A;  4BRO A;  3WT0 A;  4MO4 A;  4CZG A;  4RTF D;  3D2F A;  2HOE A;  1GLC G;  4FOE A;  3CHW A;  2P9U A;  2P9N A;  2CGJ A;  3EO3 A;  5EY4 A;  3VPZ A;  3MN5 A;  5EVZ A;  4CZF A;  3D2E A;  3G25 A;  4O8K A;  3ZX3 A;  4CZK A;  3UE5 A;  3FZM A;  3I8B A;  2P9L A;  3CI5 A;  4H5W A;  3H45 C;  2ZWH A;  2PAV A;  3A0I X;  5BPM A;  2VYP A;  3VF6 A;  5AQK A;  2GTD A;  5BRD A;  3TU5 A;  2QWP A;  1U2V B;  4CZJ A;  1BG3 A;  2A3Z A;  3GBT A;  4BC3 A;  2YJE A;  1RDW X;  3ENO A;  3CJ1 A;  4A61 A;  3LM2 A;  1GLB G;  3VEN A;  3I33 A;  3RSE B;  5AQT A;  3U9Z A;  3LDP A;  3C0B A;  3FZF A;  3HZ6 A;  2Q97 A;  5JMV A;  2V52 B;  4DQ8 A;  2ASO A;  1HKC A;  4BRL A;  4FPB A;  3VGL A;  1XUP O;  2E88 A;  3FFK B;  3O8M A;  4A2A A;  3CJ7 A;  3QFP A;  4BR2 A;  5BRF A;  4FL9 A;  1EQY A;  1ZBS A;  3MDQ A;  3GE1 A;  2PBD A;  3ULE B;  2FLO A;  3MN9 A;  5BRH A;  1NGI A;  3MN7 A;  2VCP A;  1GLE G;  1GLJ O;  1TYQ B;  2QWL A;  3IDH A;  2QM1 A;  5FPE A;  1ATS A;  2AA4 A;  2E2O A;  3M6G A;  4IJA A;  1ZC6 A;  4XH5 A;  3L0Q A;  3DXM A;  5AQS A;  5AR0 A;  1KXP A;  4RCH A;  4NB4 A;  4BG9 A;  2GWJ A;  5EOY A;  1U2V A;  1YAG A;  4BQZ A;  3H1Q A;  1HX1 A;  4WQ4 A;  4B1Z A;  4JHD A;  2E1Z A;  2NLX A;  4A62 A;  5AQU A;  1IJJ A;  5JLF A;  5KQD A;  3IUC A;  4I6M B;  3FR0 A;  4H5V A;  5CE3 A;  3DWL A;  1NBW A;  3JXU A;  3QIC A;  1NGG A;  4YDU A;  3VGK A;  4AM6 A;  4F9O A;  5AQO A;  3QB0 A;  2IVO A;  3AAP A;  3KVG A;  5FPM A;  3LDO A;  2A6A A;  2QXL A;  2UYT A;  3OHR A;  3CER A;  3CIP A;  4K43 A;  1NGE A;  1J6Z A;  2P9S B;  2NZT A;  4BRI A;  5AQG A;  4ISF A;  2CH5 A;  4PL8 A;  5AQQ A;  3VEX A;  1ZXO A;  3L4I A;  4CZE A;  3UKR A;  3HI0 A;  2QWN A;  2QWO A;  3WXJ A;  3EKU A;  4H0O A;  3VOV A;  4BRD A;  5BN8 A;  5AFU H;  1QQO A;  2A5X A;  2P9K A;  3LDQ A;  2QWM A;  5AZI A;  5F2R A;  3HSC A;  3B8A X;  4EIA A;  1ESV A;  5BPN A;  2NRH A;  1YVN A;  3UKR B;  3WEE A;  3WXL A;  4RWT A;  1NGC A;  3VER A;  5AQH A;  2P9N B;  3L6Q A;  3O5B A;  1NGD A;  4PKG A;  3BF1 A;  3HTV A;  1T6C A;  1HLU A;  3LM9 A;  1BOT O;  2P9P A;  2A42 A;  3C7N A;  4H0T B;  4B1Y B;  4CZI A;  3J8A A;  3CQX A;  4JNE A;  3GOI A;  3A5M C;  4XH4 A;  1BU6 O;  1HUX A;  1QZ6 A;  3WEE B;  1JCF A;  1JCE A;  2J4R A;  4KBO A;  5I9E B;  3FZH A;  4MLE A;  5AQW A;  1Q18 A;  3AAR A;  3ATV A;  3IMX A;  3ZET B;  5JIC A;  4FWK A;  4CBW A;  3CET A;  4DCH A;  3SK3 A;  2E2P A;  4CJ7 A;  2E8A A;  5E84 A;  2D0P A;  3UKU B;  4BRA A;  4H0Y B;  4H5T A;  1QQM A;  3FLC O;  2BTF A;  2D4W A;  3QBX A;  3SJH A;  2Q2R A;  4Y0W A;  4AM7 A;  5F1X A;  4BR4 A;  2W40 A;  4FWP A;  4MLH A;  4H5N A;  3AY9 A;  4M7Y A;  2E2Q A;  3W0L A;  5FPD A;  2F9W A;  1T44 A;  3DXK A;  3CJC A;  3F9M A;  3O1W A;  4DB3 A;  2HF4 A;  2P9P B;  3U4L A;  4PKI A;  1RFQ A;  4YDU C;  4H0X B;  1HKG A;  3CQY A;  3VEW A;  5AZJ B;  2QW9 A;  4GY2 B;  5AQY A;  4HTL A;  3M3Z A;  5LY3 A;  1X3N A;  4BR7 A;  3DJC A;  3SLC A;  2V51 B;  1QQN A;  3CJA A;  1GLF O;  3BUZ B;  3DXK B;  4JN4 A;  3WQU A;  3A5N C;  3W3D A;  1NGJ A;  4B1V A;  5KPZ A;  4EFH A;  2YHY A;  4FO0 A;  2E20 A;  4QS7 A;  5AZI B;  2EWS A;  2H3G X;  3HBT A;  1HPM A;  1T6D A;  4H0P A;  3TPQ A;  2D1K A;  1LOT B;  4FWL A;  4L3Q A;  4CZM A;  4FWQ A;  3A8Y A;  1E4G T;  3IFR A;  4QS9 A;  5BPL A;  1Y64 A;  3HM8 A;  3BP8 A;  5BN9 A;  1GLD G;  3H3N O;  2W41 A;  3R8E A;  2BUP A;  3WXI A;  3VF4 A;  3VET A;  4JHD B;  4DHY A;  2Q31 A;  3FE1 A;  4H0V B;  4E1J A;  1WUA A;  4C23 A;  1NLV A;  2HF3 A;  3JS6 A;  3FGU A;  1S3X A;  3H1V X;  3DXM B;  2FSN A;  3ZEU A;  4BC5 A;  4H03 B;  1BO5 O;  5ELZ A;  4MO5 A;  2GWK A;  4XEI A;  1SQK A;  1MA9 B;  2VWB A;  5TKY A;  1ATN A;  3VEO A;  3ID8 A;  2HMP A;  5LJV A;  4J8F A;  2P9L B;  1E4F T;  1DKG D;  2YCH A;  4FWN A;  1X3M A;  5AZJ A;  1Z6R A;  1GLA G;  1CZA N;  4IWV A;  5E26 A;  1IG8 A;  1R59 O;  5AQF A;  4B1W B;  3D2F B;  4BC4 A;  1XQS C;  5FPN A;  4CD1 A;  5BR9 A;  5KPT A;  1BUP A;  4CBX A;  3QDK A;  1QZ5 A;  3R6M A;  2ASM A;  4EHT A;  4B1U B;  4ISE A;  4FPA A;  1BA1 A;  4NO7 A;  4Z94 A;  3VGM A;  1NMD A;  3AAQ A;  2Q0R A;  1X9J A;  1WOQ A;  3GDQ A;  4JAX A;  2IVN A;  3MCP A;  3O1B A;  4B9Q A;  5B8H A;  1YUW A;  4FOI A;  3WQT A;  2P9I B;  4GNI A;  2OAN A;  3EL2 A;  3VEZ A;  3ZEU B;  1KAX A;  4IZ9 A;  3MN6 A;  4HWI A;  2I7N A;  1S22 A;  3R9P A;  4K42 A;  3ZET A;  4WQ5 C;  1RGI A;  2FF3 B;  3BEX A;  3MMV A;  2DPN A;  1NGF A;  5AQR A;  4IJN A;  4H5R A;  3RSE A;  3UB5 A;  3D7E O;  2ITM A;  1MDU B;  3H6E A;  3QFU A;  1OKJ A;  2WUS A; 
#chains in the Genus database with same CATH topology
 2ZF5 O;  3T7Z A;  2FBX A;  1HKB A;  1V4T A;  4KB1 A;  4CZL A;  4DR1 K;  4HUG A;  4M41 A;  1IH7 A;  2VGN A;  3SCX A;  2D0A A;  1NGH A;  3OYM A;  3THW B;  2A1R A;  2FC0 A;  1HNX K;  2FF6 A;  2QEX N;  2YJF A;  3DRR A;  2QWQ A;  1P8Z A;  1XHZ A;  2UUA K;  1KAY A;  3LDL A;  4CJL A;  5JLH A;  2V7Z A;  4IO9 L;  4DSF A;  5EXW A;  3LAL A;  4I9L A;  4O8U A;  3TSU A;  3VES A;  4LH4 A;  2FSJ A;  4XIU A;  3V9X A;  3ALY A;  4PL7 A;  4LY7 A;  3H3O B;  4J2B A;  3PSI A;  4K41 A;  1KAZ A;  1XC3 A;  3SUQ A;  3KLF A;  1RDA A;  3WNF A;  4C8N A;  1VQ5 N;  2FSK A;  4JKE A;  1ATR A;  3QNO A;  3I8D A;  3ID6 A;  3A5L C;  4B3R K;  1EET A;  3J80 O;  3DLK A;  1QSS A;  3ZCM A;  2ZGZ A;  3KLI A;  3TI0 A;  4B1X B;  2O8E A;  3LP2 A;  3WXM B;  3EY1 A;  3C6H A;  3LP1 A;  2ASP A;  2D0O A;  4Y1D A;  5AQI A;  1RIL A;  1UA0 A;  3SNN A;  3EE9 A;  3KLG A;  2BH1 A;  3DRP A;  3G0Z A;  5AQN A;  2ZJP L;  1RT4 A;  3PY8 A;  3CJ9 A;  5E41 A;  1HYZ A;  3AA5 X;  3O4W A;  2C1I A;  5AFU A;  4AH9 A;  3S3N A;  4M3Z A;  1HNV A;  2X78 A;  4ELV A;  2CGL A;  5IWA K;  4FWR A;  2ATQ A;  3ITH A;  4OPK A;  1NK8 A;  1L5U A;  1CXQ A;  1Z26 A;  4BVO A;  3AVB A;  3AO5 A;  2O8C A;  1ZBL A;  2Q0U A;  4CEE A;  2E5L K;  3D2E B;  1LWF A;  3FZK A;  4JYA K;  1U6Z A;  2P5O A;  2FBY A;  1TUU A;  1YXQ A;  3M1F A;  3F2K A;  4BG8 A;  4IG3 A;  4B9M A;  3NDK A;  4CJ3 A;  4BGB A;  4JKH A;  2F9T A;  2HBJ A;  2G8W A;  4CI6 A;  3MWT A;  1VQM N;  4CEZ A;  2G8K A;  3TAF A;  1EWR A;  4V19 S;  1RTH A;  1RT2 A;  4A5A A;  3TAN A;  3L2R A;  5ADX A;  2WTU A;  1MWK A;  4ID1 A;  1U49 A;  4I2P A;  4ID5 A;  3O9Q A;  4FK0 A;  3OJS A;  1GLC G;  4OPA A;  3NE6 A;  5HRS A;  1VSL A;  3SUO A;  2RE2 A;  3VPZ A;  5EVZ A;  1Y97 A;  3ZX3 A;  5LMN K;  3UE5 A;  4F3O A;  2ZWH A;  3KIO A;  2PAV A;  5FRO A;  5GAE P;  4RW8 A;  5AQK A;  2GTD A;  4DFK A;  5LL6 Z;  4CZJ A;  1LW2 A;  5TKW A;  4GKK K;  1EO1 A;  4A61 A;  3DMJ A;  4GW6 A;  1VSE A;  4GV9 A;  3U9Z A;  3C0B A;  5DK5 A;  3HZ6 A;  4FPB A;  3FFK B;  3O8M A;  4B9U A;  1NK6 A;  2I5J A;  2Z1H A;  4FL9 A;  2HB5 A;  3MED A;  3RWU A;  4JKB A;  3BZK A;  1E3M A;  2PBD A;  4DR3 K;  2FLO A;  4KB0 A;  3AV9 A;  4CJU A;  5HRR A;  4KHW A;  4KHY A;  2HNZ A;  3T69 A;  1A5W A;  5FPE A;  2E2O A;  4DTM A;  3DLL L;  3M6G A;  1ZC6 A;  3L0Q A;  3OYL A;  5I42 A;  1JL2 A;  1KXP A;  4RCH A;  4FW1 A;  2BAN A;  2PZS A;  1U2V A;  3SUN A;  3SQ0 A;  4DFJ A;  1J53 A;  2YNF A;  4CJR A;  1HX1 A;  4JHD A;  1OH5 A;  4Q0B A;  4FJJ A;  1ASV A;  5AQU A;  5DM7 L;  2KW4 A;  3SJJ A;  3QEX A;  1YJ9 N;  3R1X A;  4I6M B;  5CE3 A;  4N47 A;  1RT6 A;  3PV8 A;  3AAP A;  4B8A B;  2F7T A;  3KVG A;  5EU7 A;  2UYT A;  1HNZ K;  4DLG A;  3OHR A;  1ZBH A;  4KH5 A;  1J6Z A;  3HXM A;  1HR0 K;  3SQ2 A;  5AQG A;  4H4M A;  3VEX A;  2KLA A;  1ITG A;  4CZE A;  1BI4 B;  3WXJ A;  4KHN A;  3EKU A;  1TVR A;  3U3Y A;  1XC9 A;  5AFU H;  3TAP A;  4OPJ A;  3HVR A;  3SYZ A;  4GV6 A;  5AZI A;  1G15 A;  3B8A X;  5C25 A;  5SZT A;  3DI6 A;  1YVN A;  1TKT A;  3ZLJ A;  3ZT3 A;  5HLF A;  3WEE A;  3WXL A;  5J2N A;  4RWT A;  3VER A;  5AQH A;  1X9M A;  3QIO A;  4CF0 A;  4FYD A;  4FJM A;  4PKG A;  4YOT A;  2P9P A;  5M1P A;  3S3M A;  1I94 K;  4RW4 A;  3CYG A;  3BZC A;  4H0T B;  4B1Y B;  4CZI A;  4NYF A;  4JRQ A;  4Z4F A;  5M1F A;  4G1Q A;  3KJV A;  4FJG A;  1JCE A;  2GBZ A;  2J4R A;  1TAQ A;  1SL0 A;  1WSH A;  3ASM A;  4LF5 K;  3FZH A;  3MXI A;  4CJP A;  3AAR A;  4YFU A;  4FJX A;  4CBW A;  4DCH A;  2E2P A;  5HBM A;  5K14 A;  3FLC O;  4CJE A;  4YOU A;  4RW7 A;  3HRG A;  3T19 A;  1VSJ A;  4AM7 A;  4BR4 A;  1RT3 A;  2W40 A;  4WFA L;  4W5N A;  3DLE A;  1VQL N;  3AY9 A;  5FPD A;  1HJR A;  3S5T A;  3LAM A;  2HF4 A;  3E66 A;  3TTC A;  1RFQ A;  4CVN E;  3OTO K;  2VG5 A;  1S1V A;  1TL1 A;  4E7H A;  3SLC A;  4M42 A;  2V51 B;  3EEQ A;  1QQN A;  1TK8 A;  3I0R A;  2F8T A;  3W3D A;  4B1V A;  2OZM A;  1KLM A;  2YHY A;  2E20 A;  3CQ8 A;  3LP0 A;  1HPM A;  4W5R A;  1S6P A;  4AHT A;  3C6U A;  4PWD A;  1WSF A;  4CFD A;  1K6Y A;  4DR6 K;  1Y64 A;  2YV0 X;  3TAQ A;  3KD1 E;  2EHG A;  3H3N O;  1T05 A;  2W41 A;  2BUP A;  4JK7 A;  4F2S A;  4E1J A;  3CCM N;  2HF3 A;  3KKR A;  4KKO A;  3H1V X;  3MX2 A;  2FSN A;  3ZEU A;  4CJK A;  1U04 A;  1FKO A;  2OTL N;  4DV7 K;  3PO5 A;  1LWC A;  3C6T A;  4BC5 A;  3CPW M;  1BO5 O;  1Z25 A;  5ELZ A;  3L2V A;  3RMB A;  4KI6 A;  1SQK A;  1MA9 B;  4CGJ A;  2VWB A;  4CIG A;  3D0P A;  5M1Q A;  1VSK A;  1WNS A;  3PUF A;  1WBD A;  5T7B A;  5AZJ A;  1X3M A;  3SAG A;  5CHI A;  1Z6R A;  2UXC K;  1CZA N;  3CCE N;  1RNH A;  5E26 A;  3MAQ A;  1IG8 A;  1R59 O;  5AQF A;  4B9S A;  3MXJ A;  5FPN A;  1BUP A;  3QDK A;  1QZ5 A;  2HHX A;  3R6M A;  1BIU A;  4O0J A;  3TWH A;  1IO2 A;  4N76 A;  4C8K A;  3VQ6 A;  1BA1 A;  4Z94 A;  5C2D A;  1RTI A;  4B9V A;  3JSM A;  2G8H A;  2Q0R A;  3GDQ A;  1S5J A;  4FLY A;  5HRO A;  3O1B A;  3ZYY X;  4CHY A;  4AQY K;  1Q81 O;  4B9Q A;  3CD6 N;  1NK7 A;  3MXM A;  5DM6 L;  2UUC K;  1WSG A;  3SV4 A;  4IG0 A;  2VQE K;  3NH0 A;  1KTQ A;  4NCB A;  3VQ8 A;  2HHQ A;  1S22 A;  2NRZ A;  2NRT A;  4K42 A;  3RMD A;  3AVG A;  1RGI A;  2QA4 N;  5AQR A;  4DTP A;  3UB5 A;  4OKE A;  2RPI A;  3H6E A;  1VQ4 N;  2OTJ N;  4OLB A;  3OBW A;  4FWM A;  4DQQ A;  4IO8 A;  3WUH A;  1SZ2 A;  4DSK A;  1VSI A;  3I55 N;  4FK4 A;  4NCA A;  1C0F A;  1WLJ A;  4O5F A;  3ZSR A;  3VQD A;  1T7P A;  5LJW A;  4BRC A;  4CZH A;  1F21 A;  2AP1 A;  1S9G A;  2RKI A;  3VQ4 A;  4YOR A;  4MDB A;  1LAV A;  3DAW A;  4WYB A;  1JCG A;  3QES A;  2YHW A;  4GV3 A;  4JKF A;  1LWE A;  1TL3 A;  4BWM A;  4BGA A;  3PSF A;  4BWJ A;  4BRG A;  4IBN A;  3VQA A;  4M3X A;  2A40 A;  1BA0 A;  2HHV A;  4B9L A;  5ADX H;  2KQ2 A;  3H08 A;  1D5A A;  3ZSY A;  3L2Q A;  4R79 A;  3KK3 A;  1UWB A;  2GUP A;  2XY6 A;  2GEM A;  4HHT A;  3CCR N;  5BRE A;  4DU3 A;  1YIT N;  3KK1 A;  1N34 K;  1U48 A;  3ENH A;  4IOC L;  1IKV A;  4DUY K;  3CJB A;  3HJF A;  3CF5 L;  3D6R A;  1HYS A;  3ULE A;  5GAD P;  3NCI A;  1JLF A;  2Q1N A;  3M8P A;  4EHU A;  2IVP A;  3EZW A;  4AHC A;  1DEJ A;  3AO4 A;  3OYI A;  3NH2 A;  2Q36 A;  2IAJ A;  3DOK A;  3HL8 A;  1L3U A;  2XRI A;  3BF3 A;  3ATU A;  3C65 A;  4LFA K;  4DTN A;  3KHY A;  4BRQ A;  3LDN A;  4BVP A;  4EAH D;  4PKH A;  4IOA L;  4WE1 A;  3CFP A;  4C8M A;  2KHO A;  4I6M A;  5IT9 O;  1NJI O;  3E9L A;  1Z05 A;  2Z1I A;  1B9D A;  1FKP A;  3K57 A;  4NXN K;  4JD2 B;  1L3V A;  3FZL A;  3MWP A;  4DV2 K;  3VQP A;  3AA4 A;  2IGI A;  3TAG A;  5KGX A;  4JV5 K;  2YKM A;  3C7N B;  3QML A;  4F8R A;  4OPH A;  1DGK N;  4CGD A;  1BIS A;  5MLC Q;  1C0G A;  4FSV A;  4BR9 A;  1MWM A;  3OS0 A;  3EYZ A;  1IBL K;  5GIN A;  4LF4 K;  2P9U B;  2O4G A;  4JI1 K;  3EN9 A;  1D4X A;  1VQ8 N;  1K8K A;  1KFD A;  2FXU A;  1TV6 A;  3TAE A;  4DV1 K;  4DF8 A;  3ZSW A;  4DSI A;  2CH6 A;  5JEN A;  4BRO A;  3AO1 A;  3QEP A;  3CYM A;  4ICL A;  1MU2 A;  4B3T K;  1XNR K;  3D2F A;  4DFP A;  4FOE A;  3CHW A;  1A5X A;  4CK2 A;  1OH7 A;  2KZZ A;  2CGJ A;  3K5O A;  3SI6 A;  1YJW N;  4CER A;  3L2W A;  2O8C B;  3AA2 A;  3CPE A;  4MDA A;  2O8D B;  4YOW A;  4CEF A;  2WOM A;  3A0I X;  5BPM A;  1NK4 A;  3V1O A;  4CEC A;  4JS4 A;  2NRX A;  4DV0 K;  2QWP A;  4E19 A;  2UU9 K;  3N4Q A;  1U2V B;  1UOC A;  3GBT A;  3HYF A;  2F96 A;  3ENO A;  3CC7 N;  2DFH A;  4DMN A;  1GLB G;  2AJQ A;  3I33 A;  3P5J A;  3LZI A;  5AQT A;  1WN7 A;  3LDP A;  1A5V A;  2Q97 A;  5JMV A;  4FJ5 A;  4WF9 L;  4BRL A;  1VAZ A;  1XUP O;  3CJ7 A;  3QFP A;  1DTQ A;  4MQ3 A;  3GE1 A;  4GMJ B;  2HNY A;  4O55 A;  3MN9 A;  3RRG A;  4DFM A;  1GLE G;  1TYQ B;  1DLO A;  1U45 A;  2LSN A;  1ATS A;  3RMA A;  1S6Q A;  4IJA A;  3SBT A;  4Z0U A;  4AHV A;  3DXM A;  4QOZ B;  5AQS A;  5AR0 A;  2HBK A;  4BEB A;  2GWJ A;  5EOY A;  4CFA A;  4I2Q A;  4BQZ A;  4DQP A;  4B1Z A;  1O1W A;  4CEQ A;  2NLX A;  1IJJ A;  5JLF A;  1Q86 O;  2PYJ A;  4FLX A;  4H5V A;  2WBN A;  4RW6 A;  3VA0 A;  1NBW A;  4YDU A;  1RBV A;  1REV A;  4AM6 A;  4F9O A;  2OPP A;  5AQO A;  3QB0 A;  5A2Q O;  4DU1 A;  3EE8 A;  3CIP A;  2O4I A;  1TAU A;  1NGE A;  4R5P A;  1U47 A;  5C10 A;  2NZT A;  4ISF A;  3G71 N;  2OPS A;  4M3U A;  5JS1 A;  3KWG A;  3L4I A;  4W5T A;  3HI0 A;  5AJ3 K;  2QWN A;  2QWO A;  4ZHR A;  4H0O A;  3VOV A;  4JRP A;  1GOC A;  1IKY A;  1UAX A;  4O4G A;  5CYM A;  3PLA A;  4M45 A;  4FLZ A;  1W2B M;  1S1T A;  4AIL C;  3VQC A;  3CM6 A;  3P31 A;  5BPN A;  2VG7 A;  4LFC K;  3UKR B;  1D9F A;  4FJK A;  2P9N B;  3HP6 A;  2KZM A;  3DYA A;  3CMA N;  1GOB A;  2D5R A;  3MEC A;  1BCO A;  3KWI A;  1IV0 A;  2Z1G A;  3LM9 A;  4RG8 A;  3RR8 A;  2A42 A;  1SKW A;  3V9Z A;  4KHS A;  1KVC A;  3J8A A;  2ZD1 A;  3NMU A;  1XHX A;  4OGE A;  3A5M C;  3F5T A;  4XH4 A;  3PX4 A;  1BU6 O;  1QZ6 A;  3HOS A;  4X66 K;  1K9M O;  2BDP A;  2IS3 A;  5I9E B;  2PFU A;  4MLE A;  1Q18 A;  3HVT A;  3OYB A;  1RDC A;  1T3V A;  5JIC A;  4DTR A;  1IBK K;  3SK3 A;  4DTJ A;  4FK2 A;  2E8A A;  3THX B;  1JLG A;  2O8E B;  3K0S A;  4H5T A;  3OYE A;  4M3R A;  3SAH A;  4OKK A;  3QBX A;  4HUF A;  4N41 A;  1RT1 A;  2QTD A;  5KI6 A;  2ZE2 A;  4M7Y A;  1KD1 O;  3W0L A;  1ASU A;  1XI1 A;  2F9W A;  3P1G A;  4PA1 A;  3DXK A;  4GVE A;  3K5M A;  3SQ1 A;  1VK0 A;  3O1W A;  3AVK A;  5FRM A;  2P9P B;  4E89 A;  5FDL A;  4PKI A;  4EP4 A;  5C2F A;  3RVC A;  4H0X B;  1TK0 A;  1YVU A;  4PY5 A;  4FXD A;  1HKG A;  3CQY A;  2IDO A;  2QW9 A;  5AQY A;  3LP3 A;  2BE2 A;  4HTL A;  1LW0 A;  4MFB A;  4BR7 A;  3DJC A;  4LSL A;  1JL1 A;  3DXK B;  4JN4 A;  3WQU A;  4ILJ A;  4C1N I;  2HHI A;  3V9U A;  4KTW A;  5AZI B;  3CFO A;  2YHA A;  1SL2 A;  4YHH K;  1WAF A;  4H0P A;  3TPQ A;  4CJS A;  2D1K A;  3AGK A;  5HP1 A;  1XMQ K;  3ZT4 A;  4C8O A;  3HPH A;  4QS9 A;  5GAG P;  3M8R A;  5BPL A;  1RCH A;  4CIF A;  1KQS M;  2OPQ A;  3VTI A;  1GLD G;  2G8F A;  4IEE A;  3NH1 A;  3JAM O;  4DHY A;  3OW2 M;  1WUA A;  4C23 A;  1VSM A;  3FGU A;  3OA9 A;  2ETJ A;  4DQI A;  3DXM B;  5M1K A;  1Q9Y A;  2ZM6 K;  4WFN L;  1NK0 A;  2WFB A;  1KVB A;  4MO5 A;  2GWK A;  4XEI A;  1NKE A;  3CCU N;  5TKY A;  4CEB A;  3CG7 A;  3LPT A;  3LAN A;  1WB9 A;  2HMP A;  5C15 A;  5LJV A;  2P9L B;  4CFC A;  1DKG D;  1NG9 A;  1OVQ A;  2YCH A;  2VG6 A;  4IWV A;  2PYL A;  1YJN N;  4B1W B;  4PHT X;  4BC4 A;  4KHP K;  4CD1 A;  5BR9 A;  2EX3 A;  3AA3 A;  1BIZ A;  2F8S A;  5HRP A;  3OYN A;  4DQS A;  4KHQ A;  2D0B A;  1EP4 A;  1RDD A;  3AAQ A;  5SWM A;  2Q3S A;  1X9J A;  3SBG A;  4FJ8 A;  3MCP A;  2DFE A;  1RDU A;  4CES A;  4LF8 K;  1Q8I A;  3VN5 A;  1QTM A;  1KAX A;  1EWQ A;  4UY8 O;  5C24 A;  3R9P A;  1K8A O;  1JXB A;  3BEX A;  2HVH A;  4FLW A;  3CC4 N;  4J2A A;  4UQG A;  4H5R A;  2QKB A;  3LWM A;  2HW3 A;  4TSX A;  3QFU A;  2X6N A;  1OKJ A;  1HPZ A;  3HST B;  1SV5 A;  2D0C A;  4CBU A;  4JD2 A;  2OA8 A;  1NM1 A;  3QER A;  3QNN A;  4DTS A;  1YIJ N;  1RBR A;  2NRR A;  4JKA A;  3G4S N;  2GEL A;  5EX5 A;  1NK9 A;  4LH5 A;  3C95 A;  1TUY A;  2C1G A;  3P4I A;  4BC2 A;  3NFA A;  4XH1 A;  1C1B A;  4BR0 A;  3ENB A;  1NJX A;  3NHG A;  4BRM A;  1JLC A;  1HMV A;  3O80 A;  1HQU A;  3SMS A;  5KPR A;  3ZSX A;  1QSL A;  1XNQ K;  3NVK A;  3CCL N;  1BQN A;  1NMN A;  3O9S A;  3THW A;  2A41 A;  4DS5 A;  1I39 A;  3KKS A;  2UUB K;  3AVC A;  4LSN A;  2WC9 A;  5HL7 L;  3KK2 A;  4BRP A;  3VEY A;  1V4S A;  1NNE A;  3T1A A;  4A2B A;  2P9I A;  4BAC A;  3RRH A;  3SPY A;  3P83 D;  5AQV A;  4BDZ A;  3OYA A;  2FBT A;  3SQ4 A;  1BCM A;  2RN2 A;  4IXC A;  3HO1 A;  4XJX A;  3UKU A;  3EKS A;  1NGA A;  4DTU A;  3OVN A;  3ZSQ A;  2B4J A;  4Z4H A;  3DM2 A;  2V7Y A;  4LD0 A;  4BRN A;  3U9D A;  2NRV A;  4FLU A;  5AQM A;  1SUQ A;  1G99 A;  4M63 C;  4FJH A;  4FWO A;  4BRK A;  1BWF O;  4DU4 A;  2JWK A;  3S41 A;  2QI2 A;  4B9T A;  4CJ5 A;  5BR8 K;  4DG1 A;  3O6W A;  4JS5 A;  1QS4 A;  3L4Q A;  4BDP A;  3K58 A;  1TK5 A;  4BE1 A;  1RTJ A;  4G9Z A;  3ZX2 A;  1LCU A;  1XMO K;  1WSJ A;  3O08 A;  1TYQ A;  5CR4 A;  2P9S A;  4WQ4 C;  5J2M A;  4HCC A;  4BRF A;  4IFE A;  3I0S A;  3KK7 A;  3WXK A;  3ZX0 A;  2W6L A;  2ZGY A;  5GIP A;  4A57 A;  3F9K A;  1RTD A;  4NYN A;  2ZJQ L;  3U6F A;  4DKW A;  1GLL O;  3DLG A;  3SMP A;  4WQ5 A;  4EZ9 A;  3NF8 A;  4KI4 A;  4OLA A;  3AO3 A;  3E9O A;  4CJT A;  4OX9 K;  1W7A A;  1JLB A;  3AVM A;  3E9P A;  4BQL A;  3LL3 A;  4ISG A;  5GIO A;  1J5O A;  2P51 A;  2R7Y A;  4MO4 A;  3IRX A;  1T03 A;  2YHB A;  1NOZ A;  2P9N A;  4E7L A;  4FZZ A;  3QET A;  2VWK A;  5EY4 A;  3O9U A;  3MN5 A;  2O8B A;  1T8E A;  3T3F A;  3G25 A;  3C6A A;  3DLH A;  3OYJ A;  3FZM A;  2P9L A;  3VTH A;  4H5W A;  4YY3 K;  3ZSO A;  1YT3 A;  4CCH A;  3MEG A;  2VYP A;  3VF6 A;  1X9W A;  2NUB A;  3THY B;  2QXF A;  3B6P A;  2A3Z A;  1KSP A;  5CY4 A;  4BC3 A;  1J9A A;  3CJ1 A;  4OVL A;  3LM2 A;  5CYQ A;  3K5L A;  3RSE B;  4E1M A;  5KTQ A;  2V52 B;  4BE2 A;  4I7F A;  3BGR A;  3CME N;  2VQF K;  3T1Y K;  1EQY A;  3MDQ A;  1NOY A;  4AHU A;  3ULE B;  3M8S A;  1IBM K;  1QVG M;  1VRU A;  3MN7 A;  2VCP A;  4KTQ A;  3RMC A;  1KFS A;  1L3S A;  2QWL A;  3IDH A;  1QVF M;  2HBM A;  1S72 N;  3NVM A;  1C1C A;  2AA4 A;  5C42 A;  2OYQ A;  4KH6 A;  1ASW A;  4DV5 K;  4XH5 A;  3OS1 A;  2YNI A;  1Q7Y O;  4BG9 A;  4NB4 A;  3DRS A;  4IEI A;  3I56 N;  4LF7 K;  1ILY A;  1RBT A;  3H1Q A;  1EKE A;  2P1J A;  4WQ4 A;  1NK5 A;  4JI3 K;  1HNW K;  2G8U A;  2E1Z A;  4DR5 K;  1KVA A;  4CHQ A;  4OKJ A;  3V1R A;  3VQ5 A;  5KQD A;  3IUC A;  1BI4 A;  3QIC A;  3VGK A;  1NGG A;  2RF2 A;  3F73 A;  1FW6 A;  2IVO A;  5FPM A;  2X6S A;  3LDO A;  2QXL A;  4RW9 A;  4K8Z A;  4CJV A;  3QEW A;  3HOT A;  2NNW A;  4BRI A;  2CH5 A;  4PL8 A;  5AQQ A;  1S1X A;  4U67 L;  3BDP A;  4GKJ K;  2DFF A;  2RHK A;  2NRW A;  2F4V K;  3TSQ A;  1O13 A;  1QQO A;  1VHX A;  1P90 A;  2P9K A;  4NLB A;  3KLE A;  5F2R A;  4BY9 C;  3SPZ A;  4B08 A;  1YTU A;  1NGC A;  1JLA A;  3L6Q A;  4DWI A;  1QE1 A;  1VQO N;  1NGD A;  1T6C A;  1HLU A;  1BOT O;  3L2U A;  3CC2 N;  3G10 A;  3AVA A;  3M5R A;  3CCS N;  2JWL A;  3WEE B;  1JCF A;  1ZYQ A;  1B92 A;  4CHN A;  2Y1J A;  4E7J A;  3U3G A;  1C0T A;  1SS6 A;  4Q5V A;  3VQB A;  3AVI A;  3ATV A;  2FBV A;  1ZBF A;  1VSD A;  3ZET B;  4FWK A;  1M90 O;  2E4L A;  3HPO A;  3CET A;  3SZ2 A;  2WON A;  4CJ7 A;  4X64 K;  4H0Y B;  3ZSV A;  2OCE A;  5DMR A;  1QQM A;  4J2E A;  5C12 A;  3J7Z O;  4EZ6 A;  3SJH A;  2Q2R A;  4DV6 K;  4MLH A;  4FWP A;  3AGR A;  1N5Y A;  4ZTJ A;  4H5N A;  2E2Q A;  1W9H A;  3AVL A;  4FJ7 A;  4CK3 A;  4CF8 A;  1S9E A;  3F9M A;  4DB3 A;  1FK9 A;  4JK9 A;  1GOA A;  4F4K A;  4M3T A;  4BEC A;  4JKC A;  3VEW A;  2B6A A;  5AZJ B;  4GY2 B;  4FJL A;  4X62 K;  3M3Z A;  1X3N A;  1W0H A;  4E0D A;  1VQ6 N;  3CJA A;  3BUZ B;  2BGG A;  1YTA A;  3A5N C;  3ZT2 A;  1NGJ A;  5KPZ A;  3VA3 A;  1W97 L;  2YNG A;  4EFH A;  4FO0 A;  4N56 A;  4CEO A;  4W5O A;  4FZX C;  3O4N A;  1B9F A;  1YF5 L;  2EWS A;  2H3G X;  3HBT A;  2JLE A;  3V9S A;  3THX A;  1VQK N;  3PX6 A;  1U4B A;  4FWL A;  4CZM A;  4F2R A;  3LAK A;  3K59 A;  1EXQ A;  3KLH A;  3A8Y A;  3MCA B;  1E4G T;  1C1A A;  3QLH A;  3HM8 A;  3ISN C;  3G6E N;  1DTT A;  1VSH A;  4FJN A;  2YNH A;  5I3U A;  3VF4 A;  4JHD B;  1TGO A;  4H0V B;  1NLV A;  2G8I A;  3JS6 A;  1S3X A;  2W6K A;  4L8R B;  3IKM A;  3O4Q A;  1FXX A;  3AO2 A;  1Q9X A;  4JI2 K;  2ZJR L;  3P38 A;  3PX0 A;  3JYT A;  3ZSZ A;  4E72 A;  3BY5 A;  1S1W A;  1ATN A;  3VEO A;  3ID8 A;  1NJY A;  3CM5 A;  2ITG A;  1UA1 A;  4JKG A;  4I9Q A;  2OZS A;  3LZJ A;  3WNE A;  3IAY A;  3D2F B;  4C1N K;  1ZBU A;  1N33 K;  2GUI A;  3CCJ N;  4CBX A;  2OPR A;  4FM1 A;  2ASM A;  4B1U B;  2HND A;  4FPA A;  4NO7 A;  3K2P A;  2IC3 A;  4CF1 A;  3THV A;  2IVN A;  2VWJ A;  5B8H A;  3N4P A;  4IFV A;  2HHH K;  4FOI A;  3WQT A;  3R3L A;  2OAN A;  4GNI A;  3EL2 A;  5CZ2 A;  3VEZ A;  3PIP L;  3OYG A;  3QEI A;  1VQN N;  5KRT A;  2I7N A;  4YNQ A;  2O8D A;  4WQ5 C;  4KRE A;  4HTU A;  2DPN A;  4LF9 K;  4IJN A;  1WAJ A;  2YX6 A;  3D7E O;  4A5B A;  3AVF A;  3IS9 A;  1NGB A;  1S1U A;  4JLH A;  3V81 A;  3H46 O;  5KQ8 A;  3OYF A;  4CK1 A;  4PUO A;  2CGK A;  4YOV A;  3K9K A;  3GL1 A;  3B6O A;  2E1Y A;  3GG4 A;  1Q82 O;  3RTV A;  1BHL A;  3QBW A;  1NKC A;  3NF9 A;  4BRH A;  4Y1C A;  3MX5 A;  3A5O C;  2ZQB A;  5F0X A;  2HHU A;  1CZB A;  1C6V A;  4CJQ A;  3DLB A;  3D45 A;  4ILG B;  4M7X A;  4K8X A;  1RT7 A;  3VQ7 A;  1I3A A;  4O5B A;  5AQX A;  5AQL A;  2HVI A;  4DR2 K;  1SAZ A;  3OS2 A;  4NCG A;  4BRE A;  1NWK A;  4IFY A;  1LAW A;  4AHR A;  4FWS A;  1D9D A;  1M1K O;  3WNG A;  1EX4 A;  3CCQ N;  3AVH A;  5M1N A;  3NAE A;  2JGU A;  2E6L A;  2GX9 A;  4PQU A;  4DLE A;  4CGH A;  3KZB A;  5KGW A;  4CED A;  1LV5 A;  5AQJ A;  3V6D A;  4K25 A;  4LC9 B;  4FM2 A;  2IIR A;  3SV3 A;  4BR5 A;  3SAF A;  4JI8 K;  5FRN A;  4KTZ A;  4QS8 A;  4X65 K;  4OGC A;  4CF9 A;  1C0U A;  4KH4 A;  4CD3 A;  2Y1I A;  4FCY A;  2I7P A;  1K73 O;  3VMF B;  2HMI A;  3NGI A;  3OYD A;  3K9J A;  1JJ2 M;  1HJO A;  4H8K A;  1K8K B;  2E2N A;  4IDH A;  4DV4 K;  1BDG A;  3UIQ A;  3TAM A;  2XO7 A;  5AQP A;  3MK6 A;  2VGM A;  4KHU A;  1SKS A;  1H1V A;  2YI1 A;  3VEV A;  3VF2 A;  5J2P A;  3NGZ A;  4KO0 A;  3U8X A;  2YHX A;  1BGX T;  3S3O A;  1QHA A;  2P9K B;  3OYK A;  4DSJ A;  5AQZ A;  4WFB L;  4FLT A;  2QWR A;  4N5S A;  4M3Y A;  5FLX O;  1HQE A;  3WT0 A;  2PY5 A;  4CZG A;  4DUZ K;  1KLN A;  4RTF D;  4C8L A;  4YOX A;  3TTD A;  4BE0 A;  2HOE A;  1HRH A;  4B8C A;  2P9U A;  4DSL A;  2O8F A;  3EO3 A;  3O3H A;  4CZF A;  4CGI A;  3D2E A;  4O8K A;  4CZK A;  4ELU A;  2XHB A;  1RDB A;  3I8B A;  4JI4 K;  3CI5 A;  3KD5 E;  3H45 C;  1KC8 O;  5D3G A;  5BRD A;  3TU5 A;  4F3T A;  2Z1J A;  1OH6 A;  5JS2 A;  1BG3 A;  3C94 A;  2YJE A;  4Z4G A;  1RDW X;  4ILH A;  1IG9 A;  1JLE A;  3VEN A;  2KTQ A;  4QAG A;  4J2D A;  3TAB A;  3FZF A;  4DQ8 A;  4W5Q A;  4HUE A;  2ASO A;  1HKC A;  3VGL A;  4FM0 A;  2E88 A;  4E7K A;  4JI6 K;  4A2A A;  4BR2 A;  1J54 A;  5BRF A;  3O9T A;  2W42 A;  2XY5 A;  3CFR A;  2X74 A;  1ZBS A;  3L8B A;  4U7B A;  4WCE L;  2HHS A;  3ZT1 A;  3VQ9 A;  5BRH A;  1NGI A;  4OO1 J;  1GLJ O;  1VRT A;  4HCB A;  2QM1 A;  4EP5 A;  4CIE A;  1N6Q A;  4CGG A;  1HNI A;  1BL3 A;  3J7A P;  5HOO A;  3J7Y P;  1J5E K;  4E1N A;  4IOX A;  3HK2 A;  1CZ9 A;  5M1O A;  4DTO A;  4O44 A;  2DY4 A;  1IKW A;  3VQE A;  3DOL A;  3S9H A;  4K0K K;  4QCL A;  1YAG A;  5KRS A;  1WSE A;  4CJF A;  4Z4I A;  4DV3 K;  4KFB A;  4H4O A;  4A62 A;  4CHZ A;  2HBL A;  3NF7 A;  1NJZ A;  4JI5 K;  4LFB K;  3FR0 A;  3DWL A;  3KTQ A;  3PIO L;  3JXU A;  4CE9 A;  3LPU A;  3L3V A;  4CFB A;  4JEP A;  3AVJ A;  4KRF A;  3ZT0 A;  2A6A A;  4K43 A;  3CER A;  3V4I A;  1OH8 A;  4CHO A;  4Z4E A;  2P9S B;  4B9N A;  4JK8 A;  4CJW A;  1ZXO A;  3QIN A;  3UKR A;  2GV9 A;  3V1Q A;  3ULD A;  5LMU K;  3HP9 A;  4FZY A;  2E6M A;  4BRD A;  5BN8 A;  1KRP A;  4NXM K;  4ZTF A;  2A5X A;  3WNH A;  1KCF A;  3LDQ A;  1TKD A;  2QWM A;  1HYV A;  3QIP A;  3O3G A;  4EIA A;  3HSC A;  1ESV A;  5GAH P;  3E1Y A;  2NRH A;  4DSE A;  1VSF A;  4DR4 K;  1JLQ A;  2W00 A;  1YHQ N;  3QEV A;  4AF1 A;  3RR7 A;  4DR7 K;  3O5B A;  2QKK A;  1VQ9 N;  1QSY A;  5H1S Q;  1IKX A;  3BF1 A;  3HTV A;  4A59 A;  4E3S A;  3C7N A;  1N8R O;  3NBP A;  4YOY A;  3CQX A;  2KKZ A;  3Q7B A;  3GOI A;  4JNE A;  4JI0 K;  1HUX A;  5C0Y A;  4KBO A;  4FJI A;  4KV8 A;  4M3W A;  3NGY A;  5AQW A;  3TSP A;  4ELT A;  1C0M A;  3IMX A;  2P5G A;  4DQR A;  2G8V A;  1RBU A;  4KPY A;  3Q7C A;  1X1P A;  4BRA A;  2D0P A;  5E84 A;  3UKU B;  4KAZ A;  4JKG B;  2BTF A;  2D4W A;  1NU0 A;  2KFN A;  4Y0W A;  3LWL A;  3P39 A;  5F1X A;  4DF4 A;  4FVU A;  1DT9 A;  3OY9 A;  1BQM A;  1TKX A;  1QQC A;  3V9W A;  1T44 A;  3J81 O;  1VQP N;  3CJC A;  4NLC A;  4CHP A;  2A1S A;  3U4L A;  4YDU C;  3OJU A;  3HM9 A;  1CLQ A;  3L3U A;  3CXC M;  5JVG L;  5LY3 A;  4DS4 A;  1X9S A;  2HHW A;  2XY7 A;  2O8F B;  1GLF O;  2XY8 A;  2UXB K;  2HHT A;  3TR8 A;  1QHT A;  3TAR A;  4B3M K;  4QS7 A;  1T6D A;  4BDY A;  1LOT B;  4L3Q A;  3AVN A;  3K5N A;  4CEA A;  4FWQ A;  1XWL A;  3IFR A;  2YKN A;  3LDS A;  3VQQ A;  5J2Q A;  4B3O A;  1NJW A;  2IOC A;  1N32 K;  3E01 A;  3BP8 A;  5JVH L;  5BN9 A;  2UXD K;  1VQ7 N;  3MEE A;  1YI2 N;  3R8E A;  3WXI A;  4CF2 A;  3QO9 A;  3VET A;  4DTX A;  4BE7 B;  2Q31 A;  3FE1 A;  1SKR A;  1L3T A;  3OYH A;  1WSI A;  3CCV N;  2B5J A;  1WBB A;  1NKB A;  1JKH A;  4H03 B;  4CGF A;  5CZ1 A;  2KFZ A;  3T1H K;  4JKD A;  3HT3 A;  4J8F A;  1E4F T;  3SUP A;  4OJR A;  4IDK A;  4FWN A;  3TTF A;  3DLR A;  1GLA G;  1RBS A;  1RT5 A;  3THY A;  3O3F A;  5J1E A;  3O9R A;  1XQS C;  1JXE A;  3A2F A;  5KPT A;  1TKZ A;  3OBY A;  2HST A;  4AHS A;  4EHT A;  4FLV A;  4ISE A;  4CJ4 A;  4JI7 K;  3VGM A;  3NF6 A;  1NMD A;  5HRN A;  4LF6 K;  1WOQ A;  1N36 K;  4JAX A;  4CW7 B;  2QK9 A;  4FW2 A;  1CXU A;  4E7I A;  2DTU A;  1YUW A;  1SL1 A;  1D8Y A;  4HVJ A;  2P9I B;  3HPG A;  4FJ9 A;  4FVM A;  3ZEU B;  3PO4 A;  4IZ9 A;  3MN6 A;  4HWI A;  4O0I A;  3OYC A;  2O8B B;  4Z4C A;  3EZ5 A;  3ZET A;  3IG1 A;  2FF3 B;  4IKF A;  3MMV A;  4GVM A;  1NGF A;  1ZBI A;  1FJG K;  1R0A A;  3M8Q A;  3RSE A;  2ITM A;  1MDU B;  1OVY A;  3FFI A;  4B3S K;  2WUS A; 
#chains in the Genus database with same CATH homology
 1NGB A;  2ZF5 O;  4FWM A;  3T7Z A;  4IO8 A;  3H46 O;  3WUH A;  1SZ2 A;  1HKB A;  1V4T A;  4CBU A;  3I55 N;  4JD2 A;  4CZL A;  1NM1 A;  5KQ8 A;  2VGN A;  1YIJ N;  1NGH A;  2CGK A;  2NRR A;  4JKA A;  1C0F A;  4YOV A;  2GEL A;  5EX5 A;  3G4S N;  3K9K A;  4O5F A;  3GL1 A;  2FF6 A;  5LJW A;  1TUY A;  2YJF A;  2QEX N;  4BRC A;  4CZH A;  3P4I A;  2E1Y A;  2C1G A;  3GG4 A;  2AP1 A;  4BC2 A;  4XH1 A;  4BR0 A;  1Q82 O;  2QWQ A;  3ENB A;  3QBW A;  4YOR A;  1P8Z A;  4MDB A;  4BRM A;  3O80 A;  3DAW A;  3SMS A;  4BRH A;  5KPR A;  4WYB A;  1JCG A;  1KAY A;  2YHW A;  3LDL A;  4JKF A;  3MX5 A;  4GV3 A;  3A5O C;  5JLH A;  2V7Z A;  4BGA A;  4IO9 L;  3NVK A;  5F0X A;  4BRG A;  5EXW A;  3CCL N;  4O8U A;  3O9S A;  3TSU A;  2A41 A;  2A40 A;  1BA0 A;  3VES A;  4ILG B;  2FSJ A;  4M7X A;  2WC9 A;  5AQX A;  5ADX H;  5AQL A;  5HL7 L;  1SAZ A;  4PL7 A;  4BRP A;  3H3O B;  4R79 A;  4K41 A;  1KAZ A;  1XC3 A;  3VEY A;  1V4S A;  2GUP A;  4A2B A;  2GEM A;  2P9I A;  3CCR N;  1VQ5 N;  4BRE A;  5BRE A;  1YIT N;  2FSK A;  1NWK A;  4JKE A;  3ENH A;  5AQV A;  4IOC L;  1ATR A;  4FWS A;  3CJB A;  3CF5 L;  3D6R A;  3ID6 A;  3A5L C;  1M1K O;  3ULE A;  5GAD P;  3CCQ N;  2Q1N A;  4IXC A;  4XJX A;  5M1N A;  2ZGZ A;  4B1X B;  3UKU A;  4EHU A;  2GX9 A;  2IVP A;  3EZW A;  3WXM B;  3EKS A;  1NGA A;  3C6H A;  1DEJ A;  2ASP A;  2Q36 A;  3KZB A;  2D0O A;  5AQI A;  5AQJ A;  2V7Y A;  4BRN A;  3BF3 A;  3ATU A;  4K25 A;  2IIR A;  3EE9 A;  4LC9 B;  3U9D A;  3C65 A;  4BR5 A;  3SAF A;  2BH1 A;  2NRV A;  5AQN A;  2ZJP L;  5AQM A;  3KHY A;  1G99 A;  4M63 C;  3CJ9 A;  4FWO A;  4BRQ A;  3LDN A;  4BRK A;  1BWF O;  3O4W A;  4QS8 A;  2JWK A;  2C1I A;  5AFU A;  4BVP A;  3S41 A;  2QI2 A;  4KH4 A;  4CD3 A;  4EAH D;  2CGL A;  4PKH A;  4IOA L;  4FWR A;  2KHO A;  3O6W A;  4I6M A;  2I7P A;  1NJI O;  3E9L A;  3L4Q A;  3VMF B;  1Z05 A;  1K73 O;  4BVO A;  4JD2 B;  3FZL A;  3K9J A;  2Q0U A;  3MWP A;  1JJ2 M;  1HJO A;  3D2E B;  1K8K B;  4G9Z A;  2E2N A;  3ZX2 A;  3FZK A;  1LCU A;  1U6Z A;  4IDH A;  1BDG A;  3O08 A;  1TYQ A;  1TUU A;  1YXQ A;  3C7N B;  3M1F A;  3F2K A;  2P9S A;  3QML A;  4OPH A;  4WQ4 C;  5CR4 A;  4BG8 A;  4BRF A;  4IFE A;  1DGK N;  3KK7 A;  3WXK A;  3ZX0 A;  5MLC Q;  1C0G A;  5AQP A;  3MK6 A;  2VGM A;  4JKH A;  2ZGY A;  4FSV A;  4BGB A;  2HBJ A;  2F9T A;  1MWM A;  4BR9 A;  5GIP A;  4A57 A;  4CI6 A;  2ZJQ L;  3MWT A;  5GIN A;  1VQM N;  1H1V A;  2YI1 A;  3VEV A;  3VF2 A;  4DKW A;  1GLL O;  2P9U B;  3U8X A;  3SMP A;  4WQ5 A;  2YHX A;  3EN9 A;  1D4X A;  1VQ8 N;  1K8K A;  3E9O A;  2FXU A;  4A5A A;  1QHA A;  2P9K B;  5AQZ A;  4WFB L;  2QWR A;  3E9P A;  4BQL A;  3LL3 A;  5ADX A;  2CH6 A;  1MWK A;  4ISG A;  4BRO A;  5GIO A;  3WT0 A;  4MO4 A;  4CZG A;  4RTF D;  4YOX A;  3TTD A;  3O9Q A;  3D2F A;  2HOE A;  1GLC G;  4OPA A;  4FOE A;  3CHW A;  2P9U A;  2P9N A;  2CGJ A;  2RE2 A;  3EO3 A;  5EY4 A;  3VPZ A;  3O9U A;  1YJW N;  3MN5 A;  5EVZ A;  4CZF A;  3CPE A;  3D2E A;  3G25 A;  4MDA A;  4O8K A;  3C6A A;  3ZX3 A;  4CZK A;  3UE5 A;  3FZM A;  3I8B A;  2P9L A;  3CI5 A;  3VTH A;  4H5W A;  4YOW A;  3H45 C;  2ZWH A;  1KC8 O;  2PAV A;  3A0I X;  5BPM A;  5GAE P;  2VYP A;  3VF6 A;  5AQK A;  2GTD A;  2NRX A;  5BRD A;  3TU5 A;  2QWP A;  3N4Q A;  1U2V B;  4CZJ A;  1BG3 A;  2A3Z A;  5TKW A;  3GBT A;  4BC3 A;  2YJE A;  1RDW X;  3ENO A;  4ILH A;  1EO1 A;  3CC7 N;  3CJ1 A;  4A61 A;  3LM2 A;  1GLB G;  3VEN A;  3I33 A;  4GV9 A;  3RSE B;  5AQT A;  3U9Z A;  3LDP A;  3C0B A;  3FZF A;  2Q97 A;  3HZ6 A;  5JMV A;  2V52 B;  4DQ8 A;  2ASO A;  1HKC A;  4BRL A;  4FPB A;  3VGL A;  4WF9 L;  1VAZ A;  1XUP O;  2E88 A;  3FFK B;  3O8M A;  4A2A A;  3CME N;  3CJ7 A;  3QFP A;  4BR2 A;  3O9T A;  5BRF A;  4FL9 A;  1EQY A;  1ZBS A;  4JKB A;  3MDQ A;  3GE1 A;  2PBD A;  4U7B A;  3ULE B;  4WCE L;  2FLO A;  3MN9 A;  1QVG M;  5BRH A;  1NGI A;  3MN7 A;  2VCP A;  4OO1 J;  1GLE G;  1GLJ O;  1TYQ B;  2QWL A;  3IDH A;  2QM1 A;  1QVF M;  2HBM A;  3T69 A;  5FPE A;  3NVM A;  1ATS A;  2AA4 A;  2E2O A;  3DLL L;  1S72 N;  4KH6 A;  3M6G A;  4IJA A;  3SBT A;  1ZC6 A;  4XH5 A;  3L0Q A;  5HOO A;  4IOX A;  3DXM A;  1Q7Y O;  5AQS A;  5AR0 A;  1KXP A;  2HBK A;  4NB4 A;  4RCH A;  5M1O A;  2GWJ A;  5EOY A;  4BG9 A;  4BEB A;  4IEI A;  1U2V A;  1YAG A;  4BQZ A;  3I56 N;  1ILY A;  3H1Q A;  1HX1 A;  4WQ4 A;  4B1Z A;  4JHD A;  2E1Z A;  2NLX A;  4A62 A;  5DM7 L;  5AQU A;  2HBL A;  1IJJ A;  5JLF A;  1YJ9 N;  1Q86 O;  3R1X A;  5KQD A;  3IUC A;  4I6M B;  3FR0 A;  4H5V A;  2WBN A;  5CE3 A;  3DWL A;  3PIO L;  1NBW A;  3JXU A;  3QIC A;  1NGG A;  4YDU A;  3VGK A;  4AM6 A;  4F9O A;  5AQO A;  3QB0 A;  4JEP A;  2IVO A;  3AAP A;  2F7T A;  3KVG A;  5FPM A;  3EE8 A;  3LDO A;  2A6A A;  2QXL A;  2UYT A;  3OHR A;  3CER A;  3CIP A;  4K43 A;  1NGE A;  4KH5 A;  1J6Z A;  2P9S B;  3HOT A;  5C10 A;  2NNW A;  2NZT A;  4BRI A;  5AQG A;  4ISF A;  4JK8 A;  2CH5 A;  2KLA A;  4PL8 A;  5AQQ A;  1ZXO A;  3KWG A;  3VEX A;  4U67 L;  3G71 N;  3L4I A;  4CZE A;  3UKR A;  3HI0 A;  2RHK A;  2QWN A;  2NRW A;  2QWO A;  3WXJ A;  3EKU A;  4H0O A;  3TSQ A;  3VOV A;  4BRD A;  5BN8 A;  5AFU H;  1O13 A;  1QQO A;  2A5X A;  1P90 A;  2P9K A;  3LDQ A;  3PLA A;  4NLB A;  1W2B M;  2QWM A;  4GV6 A;  5AZI A;  5F2R A;  3HSC A;  3B8A X;  3P31 A;  4EIA A;  4BY9 C;  1ESV A;  5GAH P;  5BPN A;  3E1Y A;  2NRH A;  1YVN A;  3UKR B;  2W00 A;  3WEE A;  1YHQ N;  3WXL A;  4RWT A;  1NGC A;  3VER A;  5AQH A;  2P9N B;  4AF1 A;  3L6Q A;  3O5B A;  3CMA N;  1VQO N;  1VQ9 N;  5H1S Q;  1NGD A;  4PKG A;  3BF1 A;  3HTV A;  4A59 A;  4YOT A;  1T6C A;  3KWI A;  1HLU A;  3LM9 A;  1BOT O;  2P9P A;  5M1P A;  3CC2 N;  2A42 A;  3C7N A;  4H0T B;  4B1Y B;  1N8R O;  4CZI A;  4YOY A;  3J8A A;  3CQX A;  3NMU A;  2KKZ A;  3Q7B A;  3GOI A;  3M5R A;  4JNE A;  3CCS N;  3A5M C;  3F5T A;  4XH4 A;  5M1F A;  1BU6 O;  1HUX A;  1QZ6 A;  3HOS A;  2JWL A;  3WEE B;  1JCF A;  1JCE A;  2J4R A;  1K9M O;  5C0Y A;  4KBO A;  5I9E B;  1SS6 A;  2PFU A;  3FZH A;  4MLE A;  5AQW A;  3TSP A;  1Q18 A;  3AAR A;  3ATV A;  3IMX A;  1T3V A;  3ZET B;  5JIC A;  4FWK A;  1M90 O;  4CBW A;  3CET A;  4DCH A;  3SK3 A;  3Q7C A;  2E2P A;  4CJ7 A;  2E8A A;  5E84 A;  2D0P A;  3UKU B;  4BRA A;  4H0Y B;  4H5T A;  4JKG B;  1QQM A;  3FLC O;  5C12 A;  2BTF A;  2D4W A;  3QBX A;  4YOU A;  3SJH A;  3SAH A;  3HRG A;  3J7Z O;  2Q2R A;  2QTD A;  4Y0W A;  3P39 A;  4AM7 A;  5F1X A;  4FVU A;  1DT9 A;  2W40 A;  4FWP A;  4MLH A;  3AGR A;  4BR4 A;  4WFA L;  4H5N A;  1VQL N;  3AY9 A;  4M7Y A;  1KD1 O;  2E2Q A;  3W0L A;  5FPD A;  2F9W A;  1T44 A;  3DXK A;  4GVE A;  1VQP N;  3CJC A;  3F9M A;  4NLC A;  3O1W A;  4DB3 A;  2HF4 A;  3E66 A;  2P9P B;  3U4L A;  4PKI A;  1RFQ A;  4JK9 A;  4YDU C;  3TTC A;  5C2F A;  3RVC A;  4H0X B;  1HKG A;  4BEC A;  3CQY A;  4JKC A;  3VEW A;  3CXC M;  5AZJ B;  5JVG L;  2QW9 A;  4GY2 B;  5AQY A;  4HTL A;  3M3Z A;  5LY3 A;  1X3N A;  4BR7 A;  3DJC A;  3SLC A;  2V51 B;  1VQ6 N;  1QQN A;  3CJA A;  1GLF O;  3BUZ B;  3DXK B;  4JN4 A;  3WQU A;  3A5N C;  3W3D A;  1NGJ A;  4B1V A;  5KPZ A;  4ILJ A;  4C1N I;  1W97 L;  4EFH A;  2YHY A;  4FO0 A;  2E20 A;  4QS7 A;  1YF5 L;  2EWS A;  2H3G X;  3HBT A;  5AZI B;  1HPM A;  1T6D A;  1VQK N;  4H0P A;  3TPQ A;  2D1K A;  3AGK A;  1LOT B;  4FWL A;  4L3Q A;  4CZM A;  4FWQ A;  3A8Y A;  3MCA B;  1E4G T;  3IFR A;  4QS9 A;  5GAG P;  5BPL A;  1KQS M;  1Y64 A;  3HM8 A;  3G6E N;  3BP8 A;  5JVH L;  5BN9 A;  3VTI A;  1GLD G;  3H3N O;  1VQ7 N;  2W41 A;  1YI2 N;  3R8E A;  2BUP A;  3WXI A;  4IEE A;  3VF4 A;  3VET A;  3OW2 M;  4JHD B;  4DHY A;  4BE7 B;  4JK7 A;  2Q31 A;  3FE1 A;  4H0V B;  4E1J A;  1WUA A;  4C23 A;  3CCM N;  1NLV A;  2HF3 A;  3JS6 A;  3OA9 A;  3FGU A;  1S3X A;  3H1V X;  3DXM B;  3MX2 A;  5M1K A;  2FSN A;  3ZEU A;  3CCV N;  2OTL N;  3IKM A;  4WFN L;  3CPW M;  4BC5 A;  4H03 B;  2WFB A;  2ZJR L;  1BO5 O;  3P38 A;  5ELZ A;  4MO5 A;  2GWK A;  4XEI A;  1SQK A;  1MA9 B;  3CCU N;  2VWB A;  5TKY A;  1ATN A;  5M1Q A;  3ID8 A;  3VEO A;  4JKD A;  2HMP A;  5C15 A;  5LJV A;  4J8F A;  2P9L B;  1E4F T;  1DKG D;  2YCH A;  4FWN A;  1X3M A;  4JKG A;  5AZJ A;  3SAG A;  3TTF A;  5CHI A;  1Z6R A;  1GLA G;  1CZA N;  4IWV A;  3CCE N;  5E26 A;  1YJN N;  1IG8 A;  1R59 O;  5AQF A;  4B1W B;  3D2F B;  4PHT X;  4BC4 A;  3O9R A;  1XQS C;  5FPN A;  4CD1 A;  5BR9 A;  4C1N K;  5KPT A;  3CCJ N;  1BUP A;  4CBX A;  3QDK A;  1QZ5 A;  3R6M A;  3OBY A;  2ASM A;  2HST A;  4EHT A;  4B1U B;  4ISE A;  4FPA A;  1BA1 A;  4NO7 A;  4Z94 A;  3VGM A;  1NMD A;  3AAQ A;  5C2D A;  2Q0R A;  1X9J A;  3SBG A;  1WOQ A;  3GDQ A;  4JAX A;  2IVN A;  3MCP A;  3O1B A;  3ZYY X;  1Q81 O;  4B9Q A;  5B8H A;  3N4P A;  3CD6 N;  1RDU A;  1YUW A;  4FOI A;  5DM6 L;  3WQT A;  2P9I B;  3R3L A;  2OAN A;  4GNI A;  3EL2 A;  3PIP L;  3VEZ A;  3ZEU B;  1KAX A;  1VQN N;  4IZ9 A;  3MN6 A;  4UY8 O;  4HWI A;  2I7N A;  1S22 A;  3R9P A;  1K8A O;  2NRZ A;  2NRT A;  4K42 A;  3ZET A;  4WQ5 C;  1RGI A;  2FF3 B;  3BEX A;  2QA4 N;  3MMV A;  2DPN A;  1NGF A;  5AQR A;  3CC4 N;  4IJN A;  2YX6 A;  4H5R A;  3RSE A;  3UB5 A;  3D7E O;  2ITM A;  4A5B A;  1OVY A;  1MDU B;  3H6E A;  1VQ4 N;  3QFU A;  1OKJ A;  2OTJ N;  2WUS A;  3OBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...