2P9KA

Crystal structure of bovine arp2/3 complex co-crystallized with atp and crosslinked with glutaraldehyde
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
411
structure length
393
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 126
structure length 393
sequence length 411
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9kA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9kA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9kA03
5ELZA 3ULEA 5AQMA 4CZIA 3R6MA 4XH4A 2A5XA 4MO4A 4CZKA 5AQXA 1QHAA 3SMSA 1HKCA 1NLVA 3CI5A 4H0PA 5ADXA 4RWTA 1GLAG 2QWLA 3L0QA 4WYBA 3VF2A 3ZEUB 2P9PB 3A5LC 3FZLA 1JCGA 3FR0A 4RTFD 5E84A 2HF3A 5BRHA 2V52B 2P9UA 4CJ7A 1ATNA 5AQGA 3CJ1A 4JD2B 5BREA 2GWKA 1NBWA 4C23A 1QZ6A 3UKRB 5E26A 2YI1A 3VETA 1YUWA 3QFUA 3U8XA 3O80A 3SK3A 4ISFA 3ZEUA 2I7NA 2P9PA 4CZLA 5AQYA 4A61A 1LOTB 1RFQA 5F0XA 4EFHA 4PL7A 4MLHA 3LDPA 4FOIA 4YDUA 5AQIA 1NGEA 3R9PA 1K8KB 4WQ5C 3EKSA 1P8ZA 4EHTA 3AARA 5AQTA 3BP8A 2FSJA 3VESA 2ASOA 2QM1A 1V4SA 1HKGA 1NM1A 3H46O 1TUUA 2QWNA 3P4IA 4A62A 1XUPO 4B1UB 4CBUA 4FPBA 4HWIA 1XQSC 1QQOA 2IVOA 3ID8A 4IO8A 5JICA 2AP1A 2HF4A 2YHWA 4BQZA 2D0OA 3DWLA 4PKIA 3R8EA 2Q0RA 4M63C 4FWSA 1K8KA 4CBXA 4F9OA 3DXMA 5BN8A 1TUYA 2F9TA 3BF3A 4B9QA 4A2BA 4BR5A 5AQLA 4FWPA 2P9IB 4CZJA 2A6AA 3WXKA 2CGKA 4H5VA 3LDLA 1U6ZA 4DHYA 3SMPA 3VOVA 1CZAN 2Q1NA 2ITMA 3ZX2A 4DQ8A 1T6CA 4IJNA 1NGGA 3S41A 3ZX3A 4BVOA 4ISEA 3CERA 2FF3B 4BRCA 4MO5A 1BUPA 3O6WA 3AY9A 1BU6O 2GWJA 3TPQA 3FLCO 3CJ9A 3O1BA 3WXLA 4BRKA 3H3NO 2P9IA 3D2FB 2CGLA 3WQUA 3CIPA 2E88A 3W0LA 2FXUA 2QW9A 3VEXA 5LJVA 4K42A 2CH5A 3QBWA 1E4FT 3BUZB 3A0IX 1V4TA 5CE3A 1G99A 4H5NA 4BRDA 5AQSA 3VEZA 2VWBA 4BRMA 1NGIA 3W3DA 1BOTO 1HJOA 2HMPA 4FWKA 3LDOA 3VEYA 4XH1A 4B1XB 5EXWA 2FF6A 3L6QA 4JN4A 4CZMA 3D2FA 1GLJO 3HSCA 1DEJA 4BVPA 1DGKN 4DB3A 2AA4A 4H0TB 1GLEG 2W40A 4H5RA 1D4XA 1NGCA 3D7EO 2NRHA 3IMXA 4BRIA 3CJAA 3FGUA 1NGBA 1U2VB 5EVZA 3LM2A 4A2AA 2ASPA 4CZGA 5EX5A 1GLLO 2E8AA 4Y0WA 2P9KA 4BC3A 2PAVA 2QXLA 1KXPA 4FL9A 4H5TA 4PL8A 4Z94A 3ATUA 4BREA 2A42A 2F9WA 5LJWA 3VF6A 5JLHA 1X9JA 3IFRA 3L4IA 1NGDA 5FPEA 1GLFO 1ESVA 4HTLA 4JHDB 1E4GT 1U2VA 1C0GA 2W41A 3VEOA 2YHXA 2D1KA 4KBOA 4FSVA 3MN5A 1BDGA 4FOEA 2IVNA 5AZJB 2FSNA 2OANA 2QWQA 3QICA 1HX1A 3HTVA 4WQ4A 2WUSA 5AQRA 3VENA 1SQKA 4FWRA 4IXCA 4BQLA 1WUAA 4BROA 3I8BA 1ATSA 1GLCG 3ENOA 3H3OB 3H6EA 5AQVA 4XEIA 3DXMB 3WT0A 3UKUB 4JHDA 5AQOA 3RSEB 4BRHA 3DJCA 1HKBA 1JCEA 4DCHA 3CHWA 2A3ZA 4CZHA 4BR9A 4PKGA 1NGFA 2DPNA 5KQDA 5AZJA 5KQ8A 3QFPA 5ADXH 4EHUA 4O5FA 5BRDA 2V51B 2BTFA 3U9DA 1S3XA 4BRGA 2QWPA 4FWNA 1NGJA 3BF1A 3MK6A 1OKJA 5AQZA 1QQMA 3BEXA 3LDQA 3O1WA 4BC2A 3CJBA 5F2RA 3UKUA 4BR0A 1BG3A 3RSEA 1NMDA 3VGLA 5I9EB 1QZ5A 2Q2RA 2GEMA 3C7NA 1BA1A 4AM6A 1RGIA 2IIRA 4RCHA 4FPAA 3F9MA 3MN9A 3UB5A 3U4LA 4I6MA 1XC3A 2E20A 2ZGZA 4L3QA 4H0VB 3EO3A 3M3ZA 4B1ZA 3HI0A 3G25A 1WOQA 4B1VA 5BPNA 3EN9A 4O8KA 3IDHA 1MA9B 2E2PA 4BGAA 4B1YB 2VCPA 3O4WA 2QWOA 1T44A 3QMLA 4CZFA 1X3NA 3U9ZA 1ATRA 4FWMA 4QS9A 2P9SA 1MWKA 3KZBA 4BRPA 2GTDA 1KAYA 1KAXA 1KAZA 3GOIA 1JCFA 1GLBG 4QS8A 2D4WA 3QDKA 3QBXA 3H1QA 3ENHA 3CJ7A 3MDQA 5AZIA 2HOEA 2P9KB 3JS6A 4CZEA 1NWKA 2CGJA 1Z05A 2YJEA 3GL1A 3AAQA 4H5WA 1QQNA 4JNEA 1ZC6A 2UYTA 3VGMA 5FPDA 2EWSA 2ZF5O 2V7YA 2GUPA 4FWQA 1DKGD 3O8MA 2D0PA 1Z6RA 3AAPA 1YAGA 4IJAA 5EOYA 1J6ZA 4JAXA 3VPZA 5AQUA 3FFKB 1LCUA 3O08A 2ASMA 3FZHA 3LM9A 5BPMA 5AQHA 3FE1A 1MWMA 2NLXA 5JMVA 3GBTA 4M7XA 3WXJA 3A8YA 4BG8A 3DAWA 3WEEB 5AQWA 4BR2A 5B8HA 3MCPA 4NO7A 1SZ2A 2Q36A 5AQJA 3VERA 5AR0A 1RDWX 3HZ6A 3I33A 5AQKA 3VEWA 2PBDA 2Q97A 5BPLA 3D2EA 1IG8A 4WQ4C 2P9LB 5FPNA 1C0FA 4EIAA 1IJJA 4EAHD 1NGAA 5JLFA 1HPMA 4K25A 2YJFA 4YDUC 3WEEA 2J4RA 1HLUA 3GE1A 4BRAA 4GY2B 4J8FA 4BRQA 2YCHA 4K43A 3FZKA 3GG4A 1H1VA 3WXIA 2A40A 2NZTA 2H3GX 3KVGA 3IUCA 1R59O 3CQXA 4B1WB 3C7NB 5BN9A 5AQNA 2P9LA 3LDNA 3H1VX 4ISGA 5KPRA 5EY4A 3H45C 3J8AA 1Y64A 2KHOA 3MN6A 1BA0A 3OHRA 4H0OA 4FWLA 3GDQA 4I6MB 3DXKB 4CI6A 4BGBA 3ZETB 4BG9A 4QS7A 4BC5A 5BRFA 4JD2A 3CETA 3HM8A 1BO5O 3UKRA 4WQ5A 3VEVA 5LY3A 2VYPA 2E2NA 4BRNA 1TYQB 3O5BA 3SLCA 1HUXA 3SJHA 1Q18A 3M1FA 2P9SB 5AFUA 3MMVA 2E2OA 3VGKA 3A5NC 4PKHA 3UE5A 3DXKA 4H03B 3HBTA 3ZETA 4LC9B 4BR4A 5AZIB 2CH6A 2IVPA 4BR7A 1BWFO 1YXQA 1GLDG 3MN7A 4NB4A 1ZXOA 4FWOA 5AQQA 4H0XB 2P9NB 1X3MA 4IZ9A 3EL2A 1TYQA 2QWRA 4BRLA 3VF4A 2ZGYA 2E1YA 2I7PA 1T6DA 3FZFA 3EZWA 2BUPA 3C0BA 3A5MC 3M6GA 3EKUA 3A5OC 1S22A 1ZBSA 4FO0A 1MDUB 2FLOA 3ZX0A 4XH5A 4CD3A 2V7ZA 3LL3A 1SAZA 3QB0A 5BR9A 4E1JA 3CQYA 2FSKA 2Q31A 3KHYA 2QWMA 2P9NA 2GELA 3B8AX 3JXUA 1EQYA 3CJCA 3WUHA 4H0YB 3FZMA 4IWVA 4CBWA 5AFUH 2A41A 2E2QA 3ULEB 4K41A 2YHYA 3TU5A 5KPZA 2ZWHA 4M7YA 4GNIA 3ATVA 5KPTA 4MLEA 3D2EB 5TKYA 4CD1A 2Q0UA 5AQPA 2E1ZA 4AM7A 1NGHA 4BRFA 3WQTA 4BC4A 1YVNA 2P9UB 5AQFA 5F1XA 5FPMA
chains in the Genus database with same CATH superfamily
1WB9A 3OYLA 3LALA 1CXUA 3SAFA 4XH4A 5FLXO 1YVUA 4NCGA 1KTQA 2A5XA 4CZKA 5A2QO 4R5PA 4X66K 1NLVA 4FJHA 3L0QA 4WYBA 3ZEUB 1ZBLA 2P9PB 3FZLA 4B9LA 3FR0A 2ZQBA 5E84A 4OKEA 4AQYK 3RWUA 2HF3A 5BRHA 4KHPK 3VQ7A 4CJ7A 1ATNA 2DFEA 2VWJA 4JD2B 5K14A 3OYKA 2VG7A 4C23A 1WBDA 3LDSA 3DLHA 4CEQA 4EZ9A 2YI1A 3U8XA 1U48A 4ILHA 4ISFA 3O9UA 5AQYA 4JKGB 4CVNE 1QS4A 4GW6A 4JRQA 3LDPA 1TAUA 4IEIA 3G71N 4M3TA 3T1YK 3MCAB 4WQ5C 4FK2A 1TKDA 1SUQA 4DQQA 4OPJA 2NUBA 1BQNA 4RW4A 1XMQK 4FZYA 4DSEA 1V4SA 3U6FA 4KHSA 4E1MA 4B1UB 1N33K 3CD6N 4HWIA 2IVOA 3D6RA 2AP1A 4CJUA 1BCMA 4DF4A 1T3VA 1K8KA 2OZMA 1RTDA 1TUYA 2F9TA 1EETA 4FWPA 4PWDA 4FXDA 2G8IA 3KK3A 3B6PA 3SAHA 4I9LA 2Q1NA 2ITMA 3ZX2A 1FJGK 4Z4EA 5C2DA 3ZX3A 4BVOA 1RT7A 2HNZA 4BRCA 4B3MK 1BUPA 4AILC 1D9FA 3TPQA 2XRIA 3E01A 1YHQN 1BGXT 3O1BA 1VSJA 2ZE2A 3CYGA 2O8EB 3VQ8A 1QVFM 3Q7CA 2OZSA 1B9FA 3HYFA 4M3UA 3WQUA 4DTOA 2FXUA 2QW9A 1Q7YO 4F8RA 5GIOA 2CH5A 2P1JA 4O5BA 1VQON 4Z4IA 3SV3A 1SKRA 4JI0K 4BRMA 4ELTA 2P51A 4Z4HA 2VQEK 3OJUA 2HMPA 2E5LK 4FWKA 3LDOA 3QESA 2FF6A 4DF8A 4CZMA 2O8FB 3D2FA 4BECA 4KHWA 4DR4K 4NLCA 4DB3A 2AA4A 2W40A 1D4XA 1NGCA 3DRPA 3KIOA 2JWKA 2C1IA 3IMXA 4CJEA 3FGUA 3IRXA 2VQFK 4E0DA 5EX5A 4Y0WA 4DV1K 2PAVA 1KRPA 1RDCA 4H5TA 3QNOA 4HTUA 2A42A 5C2FA 4I2PA 4N41A 1NJZA 1NGDA 3WNGA 5FPEA 4CF1A 1S1VA 1EX4A 3CMEN 5CR4A 1C0GA 3KLIA 1NK9A 2D1KA 3QLHA 1Q86O 4CJ3A 4KHQA 4ZHRA 4E72A 1GOCA 4DU3A 1Q81O 4FWRA 3V1RA 1HNIA 4IXCA 1HRHA 5KGWA 4BQLA 4E1NA 1NOYA 1RTJA 2JLEA 3OA9A 1B92A 3ENOA 1G15A 1X9MA 4W5QA 3MX5A 4U7BA 3LP1A 3UKUB 4JHDA 3RSEB 4BRHA 3HPGA 3DJCA 4DCHA 1RBRA 4NCBA 2DPNA 5FRMA 4CJFA 2UXBK 1HNZK 5KQ8A 1YITN 4H4OA 3ZT4A 4CGGA 4FLVA 4Z4CA 5BRDA 2BTFA 3OYFA 1S3XA 4YOTA 4FWNA 3BF1A 3MK6A 3OYDA 3G4SN 4XIUA 5F2RA 4FLZA 3AO2A 1NMDA 3DLBA 5I9EB 3KK2A 5T7BA 3TI0A 1NOZA 1BA1A 4F4KA 4FLXA 5I3UA 1TGOA 4RCHA 3VTIA 1I3AA 2G8UA 2FBXA 3DRRA 3DOLA 2QI2A 4H8KA 4L3QA 4M3ZA 4H0VB 3RR7A 3M3ZA 1L3VA 2HHWA 4B1ZA 1DLOA 3HI0A 4CJQA 4X62K 2HNDA 3EN9A 3IDHA 4CHQA 3O4WA 4CZFA 4DLGA 3U9ZA 3CCVN 3QERA 1WSGA 4FWMA 4K0KK 2X78A 3KZBA 4PA1A 3AGRA 3AVKA 2D4WA 3J81O 5SWMA 3VQDA 3QBXA 3H1QA 3O3FA 3TARA 3CJ7A 3ASMA 4O44A 3JS6A 4Y1DA 2I5JA 3QEPA 1Z05A 2VGNA 1RT2A 3SQ1A 1FKPA 1S5JA 4JK9A 2UYTA 4KTQA 5FPDA 2EWSA 4X65K 5HROA 2UU9K 1Z6RA 3HPHA 1YAGA 4BDPA 3AO4A 2ASMA 5KRSA 3FZHA 3LM9A 4A59A 1OH8A 3TABA 1KLNA 4CCHA 3HK2A 4CE9A 1N34K 4BG8A 3O4NA 3OYEA 3WEEB 3K9JA 2IOCA 4DSLA 1SZ2A 1I39A 4FJMA 2PY5A 4OPKA 5HP1A 2AJQA 4H4MA 3VERA 5AR0A 3ZT0A 3VQAA 1S1TA 3S3NA 5AQKA 2OCEA 3PX4A 4CHNA 5BPLA 3MECA 1NK6A 4LF5K 4IDHA 3SI6A 1C0FA 2VG5A 2B4JA 4LFCK 4K25A 3AA5X 4YDUC 4C1NI 3O9TA 1JLGA 3BY5A 3SQ0A 3CM5A 3VQEA 2EX3A 1H1VA 2UUBK 3CPEA 2NZTA 3QEIA 4OPHA 4ELVA 3TTCA 5SZTA 4YOYA 3IUCA 4CEAA 3CQXA 3U3YA 5BN9A 4HVJA 4CJ5A 2KFZA 1Y64A 2DTUA 2KHOA 3PUFA 3MN6A 3OHRA 4JI3K 1JLQA 4H0OA 1IH7A 3GDQA 4N76A 3CFPA 3ZETB 3NH1A 1IV0A 1KVBA 4QS7A 5BRFA 1YJNN 1CZBA 4CHYA 1C6VA 3CETA 1UA0A 4DSFA 1UOCA 3V9XA 4C1NK 2HNYA 2HBMA 1TYQB 4N56A 1QHTA 1T7PA 3J7ZO 2HVHA 1Q18A 3M1FA 4KB1A 3SJJA 1IKVA 3MMVA 1KCFA 3VQCA 4B9NA 1VQ6N 3KLGA 5KRTA 3L2VA 3P5JA 3UE5A 3DXKA 4X64K 5MLCQ 2RHKA 4YFUA 3SAGA 1GLDG 1WSJA 4NB4A 4FWOA 4NCAA 3SNNA 2P9NB 1X3MA 3EL2A 2QWRA 4BRLA 2QK9A 2E1YA 2I7PA 2W6LA 3EZWA 3C0BA 1K9MO 3V81A 3K5OA 3A5OC 3AO3A 2Y1JA 1OH5A 3ZX0A 4XH5A 2PYLA 3IG1A 5GIPA 4BDZA 1SAZA 3AVNA 1HPZA 5CZ1A 4E1JA 3THWB 3CQYA 4LD0A 3KHYA 4DR6K 4JS4A 4ID5A 1Y97A 2OPPA 3P1GA 1S1XA 3OYHA 1EQYA 4BE1A 3QNNA 3WUHA 2O8DA 3S5TA 4H0YB 3V1OA 4DU1A 4CBWA 2KLAA 3ULEB 4KPYA 2ZWHA 2HHHK 1NJIO 3NAEA 4GNIA 3ATVA 2WONA 2XO7A 1GOAA 3SQ2A 3A2FA 5IT9O 2W00A 5AQPA 4BRFA 3ZCMA 1YVNA 5FPMA 1N5YA 2F4VK 1XMOK 4CGIA 5ELZA 4A5BA 3AO5A 1S9GA 3K5LA 4DV3K 3ZSVA 3HPOA 1U4BA 2P5GA 4MO4A 5AQXA 1QHAA 2O8CA 3HL8A 1HKCA 1GLAG 5AJ3K 3VF2A 3VQ4A 3A5LC 4KB0A 5CYQA 2W6KA 3AVBA 3OYAA 3C65A 2P9UA 1S6QA 1P90A 3KWGA 3CJ1A 4PQUA 4CGHA 1M1KO 1NBWA 3ZYYX 1ASVA 3ZSQA 3TTFA 1RT3A 5E26A 1XHXA 4K8ZA 4JRPA 1IKYA 3VETA 4EP4A 4FJ8A 3IS9A 2DFHA 1EXQA 3VQQA 3ZEUA 2P9PA 4A61A 1LOTB 1RFQA 3MWTA 1C0UA 3O9SA 3CCQN 4FOIA 4YDUA 5AQIA 1NNEA 3NF7A 3BGRA 4FJXA 2NRVA 3SUNA 1VQPN 3PSFA 3BP8A 1FKOA 1SS6A 2FSJA 1TKXA 1S72N 1KVCA 2QM1A 2G8WA 1HKGA 1TUUA 1IBKK 4CW7B 3F5TA 3CCEN 1XUPO 3K57A 3D45A 4JKGA 4YOWA 4IO8A 5JICA 2ZM6K 2HF4A 4BQZA 2D0OA 4CBXA 2Q0RA 3KLFA 5BN8A 5M1PA 4FLYA 4W5OA 4CZJA 4I2QA 3WXKA 3OS0A 3LDLA 4DHYA 2OTLN 3SMPA 3VOVA 2O8DB 2XY6A 4DR3K 1TKZA 3PIOL 3S41A 4ISEA 1IKWA 4O4GA 5CZ2A 1YI2N 3L8BA 1QQCA 3O6WA 4AHTA 1C1BA 2KZZA 2GWJA 2Z1GA 3PSIA 4F3TA 3SYZA 1TL3A 3CJ9A 1YTUA 3OYIA 1UWBA 2HHUA 3W0LA 1J5EK 3KLEA 4DG1A 5LJVA 4K42A 1VQMN 1N6QA 3DI6A 1E4FT 3QBWA 2DY4A 1G99A 3JSMA 5AQSA 3VEZA 3W3DA 1BOTO 1HJOA 1ZBHA 2YKMA 1NJYA 3RMCA 4O0JA 2KFNA 2Z1JA 1YT3A 4XH1A 4DMNA 2O8EA 4JN4A 4CJTA 1D5AA 3T1HK 4RW6A 4C8MA 2VG6A 1DGKN 4Q5VA 4B3RK 1XNQK 4BRIA 1VQLN 3CJAA 1O13A 3EY1A 4A2AA 4CZGA 3VA0A 3P39A 3DLKA 1GLLO 2E8AA 2Q3SA 4IG3A 3VQ9A 4DSJA 1E3MA 4PL8A 3CMAN 1JL2A 4DFPA 4FJJA 2O8FA 2E6MA 1JLCA 3MEGA 5LJWA 5DM7L 1KSPA 3M8PA 3VF6A 1RILA 1Z26A 4DR7K 1HNWK 2XY7A 5JVGL 2NRXA 5M1KA 2GX9A 1WN7A 4DSKA 4DV5K 1J53A 2ZJRL 3MN5A 1NKCA 4GKJK 5AZJB 2FSNA 1IBLK 2OANA 4ZTFA 3HTVA 2NRZA 2WUSA 4LF7K 3VENA 2PZSA 1WUAA 1A5VA 1BIUA 3I8BA 4KHUA 3QEWA 4FZZA 1ATSA 1GLCG 4IG0A 3H6EA 5AQVA 4BDYA 4IOXA 3ISNC 5AQOA 3LP0A 1JLEA 1HYSA 3OYCA 4WE1A 4DTNA 5CHIA 2O4GA 5HRSA 4JS5A 5CYMA 1NJXA 4FW1A 1S1UA 1REVA 1EWRA 2QWPA 3PIPL 1OKJA 5AQZA 1QQMA 3HO1A 4YHHK 4KH6A 3LDQA 3PLAA 3CJBA 1SKWA 1VSLA 3UKUA 1KQSM 3RSEA 2JWLA 1SL0A 3TWHA 1BHLA 2GEMA 2X6NA 3LP3A 1LWCA 4AM6A 4XJXA 1RGIA 4WFNL 4L8RB 3TAPA 3CYMA 1RDAA 4I6MA 4Y1CA 2ZGZA 3C6HA 3NE6A 3NF8A 3FFIA 2UUAK 3K59A 3G25A 4O8KA 4DQPA 4OVLA 1MA9B 5C12A 2VCPA 4OPAA 1T44A 3QMLA 4JKEA 2QKBA 1X3NA 4Z4GA 2Z1IA 3K0SA 2P9SA 2YX6A 4AHUA 1C1CA 5JS1A 1GLBG 4QS8A 2FBVA 1OH6A 2IC3A 3MDQA 2HOEA 4FM0A 3AVMA 4B3TK 4HCCA 4B9SA 4CGJA 1N32K 3AO1A 4FM1A 4JNEA 3ZT2A 4M45A 3I0RA 3VGMA 4JK8A 4FWQA 1RT5A 4IKFA 2B5JA 4M3WA 3CC7N 1J6ZA 4DV7K 2FBTA 4JAXA 3VPZA 3V4IA 4JI2K 3FFKB 4F2RA 1LCUA 4W5TA 4B3SK 3TSUA 1WAFA 2OPRA 3RVCA 5BPMA 3TANA 4EP5A 3RRGA 4JEPA 4DQRA 2HHIA 1MWMA 3ALYA 3CG7A 4M7XA 3T1AA 3A8YA 1QTMA 3ZT3A 3LZJA 4KI4A 4DSIA 4NO7A 3UIQA 3Q7BA 4FJKA 4QOZB 3PO4A 2X6SA 4C8LA 4J2BA 1XI1A 4CHOA 4CEDA 2A1RA 3I33A 1VHXA 1LAWA 3VEWA 1CXQA 3AVIA 2Q97A 3D2EA 1IG8A 4WQ4C 3PX0A 2XY5A 4CEZA 4EIAA 4EAHD 1NGAA 5JLFA 1HPMA 3E9LA 1ASWA 1BIZA 4JKHA 3WEEA 4DR1K 2HMIA 4LY7A 1F21A 4KRFA 4Q0BA 3QEXA 2O4IA 1BL3A 2YCHA 3DM2A 4K43A 4R79A 1QSSA 3GG4A 3TAMA 1W9HA 4NYNA 2NRTA 3KVGA 4OLBA 1T05A 4KKOA 4BWJA 4B1WB 1C0TA 2BANA 3KTQA 3H1VX 4B8AB 3L2WA 3H45C 3J8AA 3MWPA 4IBNA 4I6MB 5M1FA 4CIGA 2YNHA 3AA2A 3E9OA 4BEBA 3L3VA 1BO5O 4WQ5A 5LY3A 2E6LA 3C6TA 2WTUA 4BRNA 3J7AP 1WAJA 1HUXA 4DUZK 5FROA 3U3GA 2P9SB 4IOCL 3V6DA 4DUYK 2E2OA 4DV4K 3VGKA 1ZBFA 3A5NC 2X74A 1FXXA 4CF0A 3ZETA 5DM6L 4LC9B 5HRPA 4BR7A 1U47A 3MN7A 3HVRA 2XY8A 4FJ7A 3LAKA 4JLHA 4DV2K 2QTDA 4LF6K 3PY8A 4N5SA 3THVA 2A1SA 2ATQA 1TYQA 3HRGA 3VF4A 2ZGYA 3KKSA 4CJWA 1VQ8N 3SUQA 3R1XA 3M6GA 4FO0A 1ZBSA 2YNIA 1MDUB 3HOTA 1SKSA 3MEDA 4CD3A 3SV4A 1VK0A 2NRWA 1EKEA 3CFOA 1R0AA 5I42A 2Q31A 4CHPA 5TKWA 4OKJA 2QWMA 5GAGP 3CCLN 2P9NA 3NGIA 3B8AX 4M3YA 1JKHA 3CJCA 5GINA 5DK5A 2KTQA 1BI4A 4IWVA 2HHQA 4C8NA 5AFUH 3O9RA 2RN2A 3NH0A 3S3OA 4K41A 3TU5A 4BWMA 4MDAA 1JLBA 1TK5A 3THWA 2F96A 3D2EB 3TR8A 1JL1A 4ELUA 4CFAA 3E1YA 3WQTA 1L5UA 1Q9YA 4CGDA 4JI1K 5F1XA 3CC2N 1XWLA 3NMUA 4LH4A 3JYTA 3ULEA 3I55N 1A5WA 4IO9L 3NFAA 2JGUA 3SMSA 4FCYA 5C25A 1XNRK 4E7LA 3CI5A 3T19A 4RWTA 1N36K 4KAZA 4KREA 4RTFD 3WNEA 1TK0A 1UAXA 5FRNA 4DWIA 3WNHA 2V52B 3SBTA 5AQGA 1LAVA 4O8UA 3ITHA 3WNFA 1W7AA 1VQ5N 5BREA 1HNXK 1HQEA 3O80A 2QEXN 4G9ZA 3ZSXA 3L3UA 4CZLA 1B9DA 3OTOK 5F0XA 1LWEA 1HYVA 4EFHA 4YOVA 4MLHA 2F8TA 4DFKA 1WBBA 3R9PA 4CFBA 2P5OA 5JVHL 1P8ZA 4RW9A 4EHTA 3AARA 1NK5A 5IWAK 3C94A 3CCMN 2ASOA 3HVTA 3DRSA 3CPWM 4KFBA 3P4IA 4A62A 3AGKA 4FPBA 4KH5A 4I9QA 1NK4A 1XQSC 2YHWA 4PKIA 4F9OA 4FJLA 4M63C 4FWSA 4E7HA 4CJPA 4LF4K 4PY5A 3C95A 3DXMA 4B9QA 4A2BA 1IO2A 4BR5A 5AQLA 5FDLA 2P9IB 3OYNA 1U6ZA 4A57A 4DQ8A 1BI4B 1RBVA 4TSXA 1KFSA 2YNFA 4CFDA 3CERA 2FF3B 4B9MA 1BU6O 3DLEA 3NH2A 3HJFA 4FLUA 3TAQA 1M90O 2FBYA 1VRUA 3DLLL 2CGLA 3CIPA 2C1GA 3NVMA 4CK2A 3BUZB 3ZT1A 4KO0A 3A0IX 1V4TA 5CE3A 3MXMA 4H5NA 1TV6A 2VWBA 1IKXA 2RPIA 3ENBA 3O4QA 2O8BA 2G8HA 3VEYA 4JI4K 1Q9XA 2UXDK 4FJIA 4CF2A 1YJWN 3HSCA 1TAQA 1CLQA 4H5RA 3RMDA 5D3GA 2HHVA 3G6EN 1NGBA 1U2VB 5EVZA 3NF6A 4CEOA 3HXMA 2ASPA 4YY3K 3SQ4A 4DS4A 1VQ4N 3AVHA 2BE2A 3C6AA 1KXPA 3LPTA 2HBLA 1VQKN 3KD1E 4Z94A 4CF8A 3ATUA 3MXJA 4BREA 2YHAA 1RBTA 1RT1A 3IFRA 3SPYA 2G8FA 3KK1A 4B9UA 3K5NA 3PX6A 2WBNA 1E4GT 3IKMA 2R7YA 2W41A 3VEOA 2YHXA 3OJSA 4O0IA 3VQ5A 4FSVA 4UY8O 3N4PA 4LFAK 2IVNA 3AVGA 4KHNA 2QWQA 3QICA 1HX1A 2FC0A 5AQRA 1SQKA 2PYJA 4GKKK 4FK0A 2OPSA 4JKBA 4BROA 1VQNN 4CJSA 3K5MA 4JV5K 4IFYA 4IDKA 3H3OB 3P38A 4B08A 3CF5L 1HQUA 1T8EA 3DXMB 3WT0A 3C6UA 4CIEA 1JCEA 3HT3A 1U45A 4IOAL 3AA3A 3NCIA 1W2BM 2B6AA 4BR9A 1NGFA 5AZJA 3KLHA 1TKTA 5E41A 3DOKA 3AV9A 1SV5A 2G8VA 2ITGA 2V51B 3U9DA 4ICLA 3O3HA 3K58A 1NGJA 1QSYA 3ZSYA 1NG9A 3BEXA 3O1WA 1VSKA 4I7FA 1LWFA 1KC8O 4BR0A 1BG3A 2ETJA 3VGLA 3K2PA 2Q2RA 3C7NA 1ITGA 2IIRA 4DTXA 1OH7A 4W5NA 4FPAA 2HB5A 3UB5A 2NRRA 4HUEA 4DFJA 1XC3A 4G1QA 2E20A 2VGMA 4NLBA 4DR2K 1DTTA 2O8BB 2QA4N 1WOQA 4B1VA 5BPNA 3RR8A 4RW8A 4OGCA 2LSNA 2YV0X 1VSEA 3RTVA 4RG8A 1XC9A 2GTDA 4GV9A 4K8XA 1KAXA 2XHBA 2HBKA 1IBMK 3QDKA 3ENHA 1L3SA 1C1AA 5AZIA 4LH5A 1NK7A 2HBJA 2KW4A 4DTJA 1JJ2M 4CZEA 1Q8IA 4JKDA 2CGJA 3IAYA 5KGXA 1ZBUA 2YJEA 3K9KA 3QETA 1ZC6A 3MEEA 3SZ2A 4DKWA 2V7YA 2GUPA 3O9QA 1DKGD 3MXIA 2KQ2A 1K73O 4M42A 3OYGA 5J2QA 4JKAA 1RCHA 3AA4A 1KLMA 3WXMB 1HJRA 3O08A 4KH4A 5AQHA 5JENA 1VSMA 1W0HA 3GBTA 2UXCK 3KJVA 5AQWA 1X9WA 3ZSOA 4BR2A 3MCPA 4CIFA 2Q36A 5LMNK 3T3FA 3QIOA 1ZYQA 3N4QA 2QKKA 1RTIA 3HZ6A 3OYMA 5C24A 3B6OA 2P9LB 5FPNA 4B9VA 4DTUA 3AVAA 2J4RA 4CERA 1QVGM 1HLUA 3GE1A 1TL1A 4BRAA 4GY2B 5HRRA 3FZKA 3MX2A 3WXIA 2H3GX 4BE7B 1SL2A 5HLFA 1R59O 1U49A 3C7NB 4KTWA 4M3XA 5AQNA 3LDNA 5EY4A 1J54A 3NVKA 4DS5A 4FWLA 5HOOA 4FJNA 3VQ6A 4BE2A 1A5XA 4CI6A 4BGBA 5C10A 3MAQA 1NK0A 4WCEL 5J2PA 4CHZA 3M5RA 3CXCM 3LWLA 3UKRA 1RTHA 5CY4A 3KKRA 3ID6A 3O5BA 2Z1HA 1ZBIA 5AFUA 4A5AA 4EZ6A 2OTJN 3L2QA 3KK7A 3S3MA 4PKHA 4FZXC 2HSTA 3TSQA 5AZIB 2CH6A 2IVPA 3EE9A 1BWFO 2IDOA 1D9DA 1YXQA 4WF9L 4WFAL 1ZXOA 5AQQA 4KHYA 4B9TA 3EZ5A 4H0XB 3TAGA 1YIJN 2YKNA 1T6DA 2BUPA 1U04A 4OX9K 4FM2A 2RE2A 3EKUA 1CZ9A 1S22A 1W97L 2V7ZA 2WFBA 5BR9A 5J2MA 2FSKA 1RBSA 2IGIA 3JXUA 1VSIA 4LFBK 3VQPA 3M8RA 2RKIA 4DTMA 2WC9A 4AHRA 3OYJA 2A41A 3CCJN 4J2AA 1QSLA 2YHYA 5C42A 1ASUA 1RNHA 1O1WA 3ULDA 3NGZA 1S6PA 4HUFA 3SUOA 4CJ4A 2IAJA 2E4LA 3OYBA 5TKYA 1T03A 1DTQA 1N8RO 5HRNA 5C0YA 3VMFB 4BC4A 2YNGA 1LV5A 2OPQA 2IS3A 5AQFA 4QAGA 5AQMA 4CZIA 3R6MA 5J2NA 2UUCK 3VQBA 4KTZA 1J5OA 4N47A 5ADXA 4H0PA 2QWLA 1VQ9N 1RBUA 1TK8A 4QCLA 1GOBA 4BE0A 1JCGA 4Z4FA 3ZSWA 4DQIA 1EO1A 1ILYA 2D0AA 3CCSN 5M1OA 1MU2A 5KTQA 3ZLJA 1SL1A 2GWKA 4CFCA 3KWIA 1QZ6A 3UKRB 1JLFA 2ZJQL 4FJ9A 2GV9A 2W42A 1YUWA 3QFUA 4GMJB 3SK3A 3CM6A 3E66A 1NU0A 3JAMO 4CJLA 5GAHP 2I7NA 3CQ8A 4JI5K 4JKCA 4PL7A 4DU4A 1RT4A 1XHZA 4OO1J 3THYA 3NDKA 3O3GA 1NGEA 1K8KB 3QINA 1NKBA 4B3OA 3EKSA 1WSEA 1WSFA 4MDBA 2ZJPL 5AQTA 4MQ3A 3VESA 3V1QA 4JYAK 1NK8A 3H46O 1NM1A 4ID1A 2QWNA 3OBWA 1OVYA 2Y1IA 3RMAA 4CBUA 1QQOA 1RDDA 3ID8A 3DWLA 3R8EA 4KI6A 1NJWA 1LW2A 4ILJA 3BF3A 2VWKA 3VA3A 4CECA 3NHGA 3BZKA 3EEQA 4CJVA 1YJ9N 3NGYA 2A6AA 3R3LA 2CGKA 4H5VA 1CZAN 1T6CA 4IJNA 1NGGA 1NKEA 4CESA 4OGEA 4CF9A 4MO5A 3G0ZA 1VRTA 3AY9A 5EU7A 4B8CA 3CFRA 3FLCO 1OVQA 4YOUA 3WXLA 4BRKA 4WFBL 3H3NO 2P9IA 1NMNA 3D2FB 4YNQA 4IFEA 2E88A 3KD5E 3L4QA 4E89A 3VEXA 1EP4A 1BISA 1VSDA 5LL6Z 4BRDA 3E9PA 1VQ7N 1NGIA 1LW0A 5KI6A 4FVUA 4C8OA 3ZSRA 3SPZA 4DTSA 4B1XB 3CCUN 5EXWA 3L6QA 1L3UA 1FW6A 1GLJO 4OJRA 3J7YP 4JI7K 4DTPA 4F2SA 1DEJA 4BVPA 4NXNK 4H0TB 1GLEG 3G10A 3F73A 3D7EO 3VN5A 2NRHA 3T7ZA 3I0SA 1Q82O 2WOMA 3LPUA 2KKZA 3LM2A 4IFVA 4DFMA 3V9UA 2P9KA 4BC3A 2QXLA 1RDBA 4RW7A 4FL9A 4Z0UA 1BQMA 3HM9A 3VTHA 1YF5L 2F9WA 5JLHA 1X9JA 3L4IA 3V9WA 3THYB 3TSPA 2QXFA 1JXEA 1GLFO 4V19S 1ESVA 4UQGA 4HTLA 1S1WA 4JHDB 1U2VA 1K8AO 4AF1A 3RRHA 3AVLA 4KBOA 5LMUK 4DTRA 2G8KA 4AHVA 1BDGA 4FOEA 4FJ5A 3M8SA 4WQ4A 3TAFA 3CCRN 3SUPA 2GUIA 4AHCA 4JI6K 3OS1A 4J2DA 4E7IA 3SBGA 4ILGB 4DLEA 2EHGA 4XEIA 4LSNA 4HHTA 1HR0K 4GV6A 2HVIA 1HKBA 3M8QA 3CHWA 2A3ZA 3EE8A 2HW3A 4CZHA 1WNSA 4PKGA 4W5RA 5KQDA 4YOXA 2HHXA 1HYZA 3QFPA 5ADXH 4EHUA 4O5FA 4JI8K 4BRGA 3P31A 4M41A 1VSHA 4BC2A 3I8DA 3PO5A 3TTDA 3DLRA 4LF8K 4O55A 1QZ5A 2F7TA 3QIPA 3RMBA 2OA8A 4KV8A 1WSIA 3F9MA 3MN9A 3U4LA 3EO3A 3NF9A 2BDPA 4BACA 2KZMA 4YORA 1YTAA 3SCXA 4OLAA 3LP2A 2E2PA 4BGAA 4B1YB 4DQSA 3DMJA 2QWOA 1ATRA 3NBPA 3CC4N 4QS9A 1MWKA 4BRPA 1KAYA 1KAZA 5C15A 3GOIA 1JCFA 3LZIA 1KFDA 4CGFA 2P9KB 5M1NA 1HMVA 5HL7L 4CJRA 1NWKA 4JK7A 3GL1A 3L2RA 3AAQA 4H5WA 1QQNA 1X1PA 3D0PA 2PFUA 3AVCA 1TVRA 5HBMA 4DV0K 2ZF5O 3DLGA 2F8SA 2ZD1A 3O8MA 2D0PA 4GVEA 2BH1A 3AAPA 4IJAA 5EOYA 4CK3A 5AQUA 3HP6A 1WLJA 3HOSA 4FLTA 2HHSA 3FE1A 2RF2A 2NLXA 5JMVA 4CEBA 3WXJA 2HHTA 3DAWA 5B8HA 3THXA 4FJGA 5AQJA 4E3SA 3HP9A 3AVFA 1EWQA 1RDWX 1RDUA 4FYDA 1D8YA 3I56N 2PBDA 4E7JA 4U67L 1IJJA 4J2EA 1IG9A 2YJFA 4FW2A 5H1SQ 3PV8A 4DR5K 4J8FA 4BRQA 2OYQA 2A40A 4MFBA 1BCOA 4IEEA 3P83D 4F3OA 2D5RA 2P9LA 4CEEA 4FLWA 4ISGA 5KPRA 5M1QA 1BA0A 3J80O 3AVJA 4CK1A 3DXKB 2DFFA 4BG9A 2GBZA 4BC5A 4JD2A 4CEFA 3HM8A 1VAZA 1C0MA 5JS2A 1X9SA 3VEVA 1KD1O 2VYPA 2E2NA 4HCBA 4LF9K 5GADP 1HNVA 1JLAA 3SLCA 1S9EA 3SJHA 3EYZA 4E19A 3S9HA 1VSFA 4H03B 3HBTA 4BR4A 3F2KA 1Z25A 3BZCA 3DYAA 3T69A 4NYFA 3OW2M 4BY9C 1KVAA 4FVMA 3V9ZA 1L3TA 3BDPA 4IZ9A 4DV6K 2BGGA 4M3RA 4JKFA 4GVMA 3FZFA 3HSTB 4PUOA 4FK4A 3V9SA 4GV3A 1DT9A 4OKKA 3A5MC 1J9AA 4NXMK 2FLOA 3LL3A 3QO9A 3QB0A 4C8KA 3QEVA 1QE1A 4E7KA 2NNWA 3L2UA 3ZSZA 2GELA 1JXBA 3LWMA 3TAEA 1I94K 1RT6A 3THXB 3FZMA 5J1EA 2E2QA 1WSHA 5KPZA 3LANA 3OBYA 3OY9A 4M7YA 2D0BA 4PHTX 5DMRA 4CJKA 4HUGA 5BR8K 2O8CB 2YHBA 5KPTA 4MLEA 1FK9A 4ZTJA 1UA1A 4CD1A 3LAMA 3F9KA 2D0CA 2Q0UA 5GAEP 2E1ZA 1K6YA 1NGHA 3H08A 4LSLA 4AHSA 3OVNA 4AM7A 3OS2A 2P9UB 4AH9A
chains in the Genus database with same CATH topology
3NMUA 5ELZA 3ULEA 4A5BA 3I55N 5AQMA 4CZIA 3SAFA 3R6MA 4XH4A 4IO9L 2A5XA 4MO4A 4CZKA 5AQXA 1QHAA 3SMSA 1HKCA 1NLVA 3CI5A 4H0PA 5ADXA 4RWTA 1GLAG 2QWLA 3L0QA 1VQ9N 4WYBA 3VF2A 3ZEUB 2P9PB 3A5LC 3FZLA 1JCGA 3FR0A 4RTFD 5E84A 2HF3A 1EO1A 5BRHA 2V52B 3C65A 1ILYA 2P9UA 4CJ7A 3CCSN 1P90A 1ATNA 3KWGA 5AQGA 5M1OA 4O8UA 3CJ1A 4JD2B 3SBTA 1VQ5N 5BREA 2GWKA 1NBWA 1M1KO 3ZYYX 4C23A 3KWIA 1QZ6A 3UKRB 3TTFA 5E26A 2ZJQL 2YI1A 3VETA 1YUWA 3QFUA 3U8XA 3O80A 3SK3A 3E66A 2QEXN 4G9ZA 4ILHA 4ISFA 3ZEUA 5GAHP 2I7NA 2P9PA 4CZLA 3O9UA 4JKCA 5AQYA 4A61A 1LOTB 1RFQA 3MWTA 4JKGB 5F0XA 4EFHA 4PL7A 3O9SA 4YOVA 4MLHA 3CCQN 3LDPA 4FOIA 4YDUA 4OO1J 5AQIA 4IEIA 3G71N 1NGEA 3R9PA 1K8KB 2NRVA 3MCAB 4WQ5C 3EKSA 5JVHL 1P8ZA 4EHTA 1VQPN 4MDBA 2ZJPL 3AARA 5AQTA 3BP8A 1SS6A 3CCMN 2FSJA 3VESA 1S72N 2ASOA 2QM1A 1V4SA 3CPWM 1HKGA 1NM1A 3H46O 1TUUA 2QWNA 3P4IA 4A62A 3F5TA 3CCEN 1XUPO 1OVYA 3OBWA 4B1UB 3CD6N 3AGKA 4JKGA 4CBUA 4FPBA 4KH5A 4YOWA 4HWIA 1XQSC 1QQOA 2IVOA 3D6RA 3ID8A 4IO8A 5JICA 2AP1A 2HF4A 2YHWA 4BQZA 2D0OA 3DWLA 4PKIA 3R8EA 2Q0RA 1T3VA 4FWSA 1K8KA 4M63C 4CBXA 4F9OA 3DXMA 5BN8A 1TUYA 2F9TA 3BF3A 4ILJA 4B9QA 4A2BA 4BR5A 5AQLA 5M1PA 4FWPA 2P9IB 1YJ9N 4CZJA 2A6AA 3R3LA 3WXKA 2CGKA 4H5VA 3LDLA 1U6ZA 4DHYA 2OTLN 3SMPA 3VOVA 3SAHA 1CZAN 2Q1NA 2ITMA 3ZX2A 4A57A 1T6CA 4DQ8A 5C2DA 3PIOL 4IJNA 1NGGA 3S41A 3ZX3A 4BVOA 4ISEA 3CERA 2FF3B 4BRCA 4MO5A 1YI2N 1BUPA 3O6WA 3AY9A 1BU6O 2GWJA 3TPQA 1YHQN 3FLCO 3CJ9A 3O1BA 4YOUA 3WXLA 4BRKA 4WFBL 1M90O 1QVFM 3H3NO 2P9IA 3Q7CA 3DLLL 3D2FB 4IFEA 2CGLA 3WQUA 2E88A 3CIPA 2C1GA 3W0LA 2FXUA 3L4QA 3NVMA 2QW9A 3VEXA 1Q7YO 5LJVA 5GIOA 4K42A 2CH5A 1VQMN 3QBWA 1E4FT 1VQON 3BUZB 3A0IX 1V4TA 5CE3A 1G99A 4H5NA 4BRDA 3E9PA 5AQSA 2VWBA 3VEZA 4BRMA 1VQ7N 1NGIA 3W3DA 1BOTO 1HJOA 3ENBA 2HMPA 4FVUA 4FWKA 3LDOA 3VEYA 4XH1A 4B1XB 3CCUN 5EXWA 2FF6A 3L6QA 4JN4A 4CZMA 3D2FA 4BECA 1GLJO 1YJWN 3HSCA 1DEJA 4BVPA 1DGKN 4NLCA 2AA4A 4H0TB 1GLEG 2W40A 4H5RA 1D4XA 1NGCA 4DB3A 2JWKA 2C1IA 3D7EO 2NRHA 3IMXA 4BRIA 3T7ZA 3G6EN 1Q82O 1VQLN 3CJAA 1O13A 3FGUA 1NGBA 1U2VB 2KKZA 5EVZA 3LM2A 4A2AA 2ASPA 4CZGA 1VQ4N 3P39A 5EX5A 1GLLO 2E8AA 4Y0WA 2P9KA 4BC3A 2PAVA 2QXLA 3C6AA 1KXPA 2HBLA 1VQKN 4FL9A 4H5TA 4PL8A 3CMAN 4Z94A 3ATUA 1YF5L 3VTHA 2A42A 2F9WA 4BREA 5C2FA 3VF6A 5JLHA 5LJWA 1X9JA 5DM7L 3IFRA 3L4IA 3TSPA 1NGDA 5FPEA 5JVGL 2NRXA 1GLFO 2WBNA 1ESVA 5M1KA 2GX9A 4HTLA 4JHDB 5CR4A 1E4GT 1U2VA 3IKMA 1C0GA 1K8AO 2W41A 3CMEN 3VEOA 2YHXA 4AF1A 2D1KA 4KBOA 4FSVA 2ZJRL 3N4PA 4UY8O 3MN5A 1BDGA 4FOEA 2IVNA 5AZJB 2FSNA 1Q86O 2OANA 2QWQA 3QICA 1HX1A 3HTVA 2NRZA 2WUSA 4WQ4A 3CCRN 5AQRA 3VENA 1SQKA 1Q81O 4FWRA 4IXCA 4BQLA 4JKBA 1WUAA 4BROA 3OA9A 3I8BA 1VQNN 1ATSA 1GLCG 3ENOA 3H3OB 3SBGA 3H6EA 4ILGB 3MX5A 3P38A 5AQVA 4U7BA 3CF5L 4XEIA 4IOXA 3DXMB 3WT0A 3UKUB 4JHDA 5AQOA 3RSEB 4BRHA 4GV6A 3DJCA 1HKBA 1JCEA 4DCHA 4IOAL 3CHWA 2A3ZA 1W2BM 3EE8A 4CZHA 4BR9A 4PKGA 1NGFA 2DPNA 5CHIA 5KQDA 5AZJA 4YOXA 5KQ8A 3QFPA 5ADXH 1YITN 4EHUA 4O5FA 5BRDA 2V51B 2BTFA 3U9DA 1S3XA 4YOTA 2QWPA 4FWNA 4BRGA 3PIPL 1NGJA 3BF1A 3MK6A 3P31A 1OKJA 5AQZA 1QQMA 4KH6A 3BEXA 3LDQA 3O1WA 4BC2A 3G4SN 3CJBA 3PLAA 5F2RA 3TTDA 3UKUA 1KC8O 1KQSM 4BR0A 1BG3A 3RSEA 1NMDA 2JWLA 3VGLA 5I9EB 1QZ5A 2F7TA 2GEMA 2Q2RA 3C7NA 1BA1A 4AM6A 4XJXA 1RGIA 2IIRA 4WFNL 4RCHA 3VTIA 4FPAA 3F9MA 3MN9A 3UB5A 3U4LA 2NRRA 4I6MA 1XC3A 2E20A 2QI2A 2ZGZA 4L3QA 3C6HA 2VGMA 3EO3A 4H0VB 4NLBA 3M3ZA 4B1ZA 4YORA 3HI0A 2QA4N 3G25A 1WOQA 4B1VA 5BPNA 3EN9A 4O8KA 3IDHA 1MA9B 2E2PA 4BGAA 4B1YB 5C12A 2VCPA 4OPAA 3O4WA 2QWOA 1T44A 3QMLA 4JKEA 4CZFA 1X3NA 3U9ZA 3CCVN 1ATRA 4FWMA 3CC4N 4QS9A 2P9SA 2YX6A 1MWKA 3KZBA 4BRPA 2GTDA 4GV9A 1KAYA 1KAXA 1KAZA 5C15A 3GOIA 1JCFA 1GLBG 3AGRA 4QS8A 2HBKA 2D4WA 3QDKA 3QBXA 3H1QA 3ENHA 3CJ7A 3MDQA 5AZIA 2HOEA 2P9KB 5M1NA 5HL7L 2HBJA 3JS6A 4CZEA 1JJ2M 1NWKA 4JKDA 2CGJA 4JK7A 1Z05A 2VGNA 2YJEA 3GL1A 3AAQA 3K9KA 1QQNA 4H5WA 4JNEA 4JK9A 1ZC6A 2PFUA 2UYTA 3VGMA 5FPDA 2EWSA 4JK8A 4DKWA 2ZF5O 2V7YA 2GUPA 4FWQA 3O9QA 1DKGD 3O8MA 2D0PA 4GVEA 2BH1A 1K73O 3CC7N 1Z6RA 3AAPA 1YAGA 4JKAA 4IJAA 5EOYA 1J6ZA 4JAXA 3VPZA 3WXMB 5AQUA 3FFKB 1LCUA 3O08A 2ASMA 3FZHA 3LM9A 3TSUA 4A59A 5BPMA 3RVCA 4KH4A 3HOSA 5AQHA 4JEPA 3FE1A 1MWMA 2NLXA 5JMVA 3GBTA 4M7XA 3WXJA 3A8YA 4BG8A 3DAWA 3WEEB 3K9JA 5AQWA 4BR2A 5B8HA 3MCPA 4NO7A 1SZ2A 2Q36A 3Q7BA 5AQJA 3VERA 5AR0A 1RDWX 3N4QA 1RDUA 3HZ6A 3I33A 5AQKA 3VEWA 3I56N 2PBDA 2Q97A 5BPLA 3D2EA 1IG8A 4WQ4C 2P9LB 4IDHA 5FPNA 1C0FA 4EIAA 4U67L 1IJJA 4EAHD 1NGAA 5JLFA 1HPMA 3E9LA 4K25A 2YJFA 4YDUC 5H1SQ 4JKHA 3WEEA 2J4RA 4C1NI 3O9TA 1QVGM 1HLUA 3GE1A 4BRAA 4GY2B 4J8FA 4BRQA 2YCHA 4K43A 3FZKA 4R79A 3MX2A 3GG4A 1H1VA 3WXIA 2A40A 3CPEA 2NZTA 2H3GX 4BE7B 4OPHA 4IEEA 2NRTA 3KVGA 3TTCA 4YOYA 3IUCA 1R59O 3CQXA 4B1WB 3C7NB 5BN9A 5AQNA 2P9LA 3LDNA 3H1VX 4ISGA 5KPRA 5EY4A 3H45C 3J8AA 1Y64A 5M1QA 2KHOA 3NVKA 3MN6A 1BA0A 3MWPA 3OHRA 4H0OA 4FWLA 3GDQA 4I6MB 5HOOA 3DXKB 4CI6A 4BGBA 3ZETB 5C10A 5M1FA 4BG9A 4QS7A 4BC5A 4WCEL 5BRFA 1YJNN 4JD2A 3E9OA 3CETA 3M5RA 3HM8A 3CXCM 4BEBA 1VAZA 1BO5O 3UKRA 4WQ5A 3VEVA 5LY3A 4C1NK 1KD1O 2VYPA 2E2NA 4BRNA 2HBMA 1TYQB 3ID6A 3O5BA 5GADP 3SLCA 3J7ZO 1HUXA 3SJHA 1Q18A 3M1FA 2P9SB 4IOCL 5AFUA 4A5AA 2OTJN 3MMVA 2E2OA 1VQ6N 3KK7A 3VGKA 3A5NC 4PKHA 3UE5A 3DXKA 4H03B 5MLCQ 2RHKA 3HBTA 3ZETA 5DM6L 2HSTA 4LC9B 3TSQA 5AZIB 2CH6A 2IVPA 3EE9A 3F2KA 4BR4A 1BWFO 4BR7A 3SAGA 1YXQA 1GLDG 3MN7A 3T69A 4WF9L 4NB4A 4WFAL 1ZXOA 3OW2M 4FWOA 5AQQA 4BY9C 2QTDA 4H0XB 2P9NB 1X3MA 4IZ9A 1YIJN 3EL2A 1TYQA 2QWRA 4BRLA 3HRGA 3VF4A 2ZGYA 2E1YA 2I7PA 1VQ8N 1T6DA 4JKFA 3FZFA 3EZWA 2BUPA 3C0BA 4GV3A 3R1XA 1DT9A 2RE2A 3A5MC 3M6GA 3EKUA 1K9MO 3A5OC 1S22A 1ZBSA 4FO0A 1MDUB 3HOTA 1W97L 2FLOA 3ZX0A 4XH5A 4CD3A 2V7ZA 3LL3A 2WFBA 5GIPA 1SAZA 3QB0A 2NRWA 5BR9A 4E1JA 3CQYA 2FSKA 2Q31A 3KHYA 2NNWA 5TKWA 2QWMA 5GAGP 3CCLN 2P9NA 2GELA 3B8AX 3JXUA 1EQYA 3CJCA 5GINA 3WUHA 2WC9A 4H0YB 3FZMA 4IWVA 4CBWA 5AFUH 2A41A 2E2QA 3O9RA 3CCJN 2KLAA 3ULEB 4K41A 2YHYA 3TU5A 5KPZA 3OBYA 2ZWHA 4M7YA 4MDAA 4PHTX 1NJIO 4GNIA 3ATVA 5KPTA 4MLEA 3D2EB 5TKYA 1N8RO 4CD1A 5GAEP 2Q0UA 2W00A 3E1YA 5C0YA 5AQPA 2E1ZA 4AM7A 1NGHA 4BRFA 3VMFB 3WQTA 4BC4A 1YVNA 2P9UB 5AQFA 5F1XA 3CC2N 5FPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELZ A;  3ULE A;  5AQM A;  4CZI A;  3R6M A;  4XH4 A;  2A5X A;  4MO4 A;  4CZK A;  5AQX A;  1QHA A;  3SMS A;  1HKC A;  1NLV A;  3CI5 A;  4H0P A;  5ADX A;  4RWT A;  1GLA G;  2QWL A;  3L0Q A;  4WYB A;  3VF2 A;  3ZEU B;  2P9P B;  3A5L C;  3FZL A;  1JCG A;  3FR0 A;  4RTF D;  5E84 A;  2HF3 A;  5BRH A;  2V52 B;  2P9U A;  4CJ7 A;  1ATN A;  5AQG A;  3CJ1 A;  4JD2 B;  5BRE A;  2GWK A;  1NBW A;  4C23 A;  1QZ6 A;  3UKR B;  5E26 A;  2YI1 A;  3VET A;  1YUW A;  3QFU A;  3U8X A;  3O80 A;  3SK3 A;  4ISF A;  3ZEU A;  2I7N A;  2P9P A;  4CZL A;  5AQY A;  4A61 A;  1LOT B;  1RFQ A;  5F0X A;  4EFH A;  4PL7 A;  4MLH A;  3LDP A;  4FOI A;  4YDU A;  5AQI A;  1NGE A;  3R9P A;  1K8K B;  4WQ5 C;  3EKS A;  1P8Z A;  4EHT A;  3AAR A;  5AQT A;  3BP8 A;  2FSJ A;  3VES A;  2ASO A;  2QM1 A;  1V4S A;  1HKG A;  1NM1 A;  3H46 O;  1TUU A;  2QWN A;  3P4I A;  4A62 A;  1XUP O;  4B1U B;  4CBU A;  4FPB A;  4HWI A;  1XQS C;  1QQO A;  2IVO A;  3ID8 A;  4IO8 A;  5JIC A;  2AP1 A;  2HF4 A;  2YHW A;  4BQZ A;  2D0O A;  3DWL A;  4PKI A;  3R8E A;  2Q0R A;  4M63 C;  4FWS A;  1K8K A;  4CBX A;  4F9O A;  3DXM A;  5BN8 A;  1TUY A;  2F9T A;  3BF3 A;  4B9Q A;  4A2B A;  4BR5 A;  5AQL A;  4FWP A;  2P9I B;  4CZJ A;  2A6A A;  3WXK A;  2CGK A;  4H5V A;  3LDL A;  1U6Z A;  4DHY A;  3SMP A;  3VOV A;  1CZA N;  2Q1N A;  2ITM A;  3ZX2 A;  4DQ8 A;  1T6C A;  4IJN A;  1NGG A;  3S41 A;  3ZX3 A;  4BVO A;  4ISE A;  3CER A;  2FF3 B;  4BRC A;  4MO5 A;  1BUP A;  3O6W A;  3AY9 A;  1BU6 O;  2GWJ A;  3TPQ A;  3FLC O;  3CJ9 A;  3O1B A;  3WXL A;  4BRK A;  3H3N O;  2P9I A;  3D2F B;  2CGL A;  3WQU A;  3CIP A;  2E88 A;  3W0L A;  2FXU A;  2QW9 A;  3VEX A;  5LJV A;  4K42 A;  2CH5 A;  3QBW A;  1E4F T;  3BUZ B;  3A0I X;  1V4T A;  5CE3 A;  1G99 A;  4H5N A;  4BRD A;  5AQS A;  3VEZ A;  2VWB A;  4BRM A;  1NGI A;  3W3D A;  1BOT O;  1HJO A;  2HMP A;  4FWK A;  3LDO A;  3VEY A;  4XH1 A;  4B1X B;  5EXW A;  2FF6 A;  3L6Q A;  4JN4 A;  4CZM A;  3D2F A;  1GLJ O;  3HSC A;  1DEJ A;  4BVP A;  1DGK N;  4DB3 A;  2AA4 A;  4H0T B;  1GLE G;  2W40 A;  4H5R A;  1D4X A;  1NGC A;  3D7E O;  2NRH A;  3IMX A;  4BRI A;  3CJA A;  3FGU A;  1NGB A;  1U2V B;  5EVZ A;  3LM2 A;  4A2A A;  2ASP A;  4CZG A;  5EX5 A;  1GLL O;  2E8A A;  4Y0W A;  2P9K A;  4BC3 A;  2PAV A;  2QXL A;  1KXP A;  4FL9 A;  4H5T A;  4PL8 A;  4Z94 A;  3ATU A;  4BRE A;  2A42 A;  2F9W A;  5LJW A;  3VF6 A;  5JLH A;  1X9J A;  3IFR A;  3L4I A;  1NGD A;  5FPE A;  1GLF O;  1ESV A;  4HTL A;  4JHD B;  1E4G T;  1U2V A;  1C0G A;  2W41 A;  3VEO A;  2YHX A;  2D1K A;  4KBO A;  4FSV A;  3MN5 A;  1BDG A;  4FOE A;  2IVN A;  5AZJ B;  2FSN A;  2OAN A;  2QWQ A;  3QIC A;  1HX1 A;  3HTV A;  4WQ4 A;  2WUS A;  5AQR A;  3VEN A;  1SQK A;  4FWR A;  4IXC A;  4BQL A;  1WUA A;  4BRO A;  3I8B A;  1ATS A;  1GLC G;  3ENO A;  3H3O B;  3H6E A;  5AQV A;  4XEI A;  3DXM B;  3WT0 A;  3UKU B;  4JHD A;  5AQO A;  3RSE B;  4BRH A;  3DJC A;  1HKB A;  1JCE A;  4DCH A;  3CHW A;  2A3Z A;  4CZH A;  4BR9 A;  4PKG A;  1NGF A;  2DPN A;  5KQD A;  5AZJ A;  5KQ8 A;  3QFP A;  5ADX H;  4EHU A;  4O5F A;  5BRD A;  2V51 B;  2BTF A;  3U9D A;  1S3X A;  4BRG A;  2QWP A;  4FWN A;  1NGJ A;  3BF1 A;  3MK6 A;  1OKJ A;  5AQZ A;  1QQM A;  3BEX A;  3LDQ A;  3O1W A;  4BC2 A;  3CJB A;  5F2R A;  3UKU A;  4BR0 A;  1BG3 A;  3RSE A;  1NMD A;  3VGL A;  5I9E B;  1QZ5 A;  2Q2R A;  2GEM A;  3C7N A;  1BA1 A;  4AM6 A;  1RGI A;  2IIR A;  4RCH A;  4FPA A;  3F9M A;  3MN9 A;  3UB5 A;  3U4L A;  4I6M A;  1XC3 A;  2E20 A;  2ZGZ A;  4L3Q A;  4H0V B;  3EO3 A;  3M3Z A;  4B1Z A;  3HI0 A;  3G25 A;  1WOQ A;  4B1V A;  5BPN A;  3EN9 A;  4O8K A;  3IDH A;  1MA9 B;  2E2P A;  4BGA A;  4B1Y B;  2VCP A;  3O4W A;  2QWO A;  1T44 A;  3QML A;  4CZF A;  1X3N A;  3U9Z A;  1ATR A;  4FWM A;  4QS9 A;  2P9S A;  1MWK A;  3KZB A;  4BRP A;  2GTD A;  1KAY A;  1KAX A;  1KAZ A;  3GOI A;  1JCF A;  1GLB G;  4QS8 A;  2D4W A;  3QDK A;  3QBX A;  3H1Q A;  3ENH A;  3CJ7 A;  3MDQ A;  5AZI A;  2HOE A;  2P9K B;  3JS6 A;  4CZE A;  1NWK A;  2CGJ A;  1Z05 A;  2YJE A;  3GL1 A;  3AAQ A;  4H5W A;  1QQN A;  4JNE A;  1ZC6 A;  2UYT A;  3VGM A;  5FPD A;  2EWS A;  2ZF5 O;  2V7Y A;  2GUP A;  4FWQ A;  1DKG D;  3O8M A;  2D0P A;  1Z6R A;  3AAP A;  1YAG A;  4IJA A;  5EOY A;  1J6Z A;  4JAX A;  3VPZ A;  5AQU A;  3FFK B;  1LCU A;  3O08 A;  2ASM A;  3FZH A;  3LM9 A;  5BPM A;  5AQH A;  3FE1 A;  1MWM A;  2NLX A;  5JMV A;  3GBT A;  4M7X A;  3WXJ A;  3A8Y A;  4BG8 A;  3DAW A;  3WEE B;  5AQW A;  4BR2 A;  5B8H A;  3MCP A;  4NO7 A;  1SZ2 A;  2Q36 A;  5AQJ A;  3VER A;  5AR0 A;  1RDW X;  3HZ6 A;  3I33 A;  5AQK A;  3VEW A;  2PBD A;  2Q97 A;  5BPL A;  3D2E A;  1IG8 A;  4WQ4 C;  2P9L B;  5FPN A;  1C0F A;  4EIA A;  1IJJ A;  4EAH D;  1NGA A;  5JLF A;  1HPM A;  4K25 A;  2YJF A;  4YDU C;  3WEE A;  2J4R A;  1HLU A;  3GE1 A;  4BRA A;  4GY2 B;  4J8F A;  4BRQ A;  2YCH A;  4K43 A;  3FZK A;  3GG4 A;  1H1V A;  3WXI A;  2A40 A;  2NZT A;  2H3G X;  3KVG A;  3IUC A;  1R59 O;  3CQX A;  4B1W B;  3C7N B;  5BN9 A;  5AQN A;  2P9L A;  3LDN A;  3H1V X;  4ISG A;  5KPR A;  5EY4 A;  3H45 C;  3J8A A;  1Y64 A;  2KHO A;  3MN6 A;  1BA0 A;  3OHR A;  4H0O A;  4FWL A;  3GDQ A;  4I6M B;  3DXK B;  4CI6 A;  4BGB A;  3ZET B;  4BG9 A;  4QS7 A;  4BC5 A;  5BRF A;  4JD2 A;  3CET A;  3HM8 A;  1BO5 O;  3UKR A;  4WQ5 A;  3VEV A;  5LY3 A;  2VYP A;  2E2N A;  4BRN A;  1TYQ B;  3O5B A;  3SLC A;  1HUX A;  3SJH A;  1Q18 A;  3M1F A;  2P9S B;  5AFU A;  3MMV A;  2E2O A;  3VGK A;  3A5N C;  4PKH A;  3UE5 A;  3DXK A;  4H03 B;  3HBT A;  3ZET A;  4LC9 B;  4BR4 A;  5AZI B;  2CH6 A;  2IVP A;  4BR7 A;  1BWF O;  1YXQ A;  1GLD G;  3MN7 A;  4NB4 A;  1ZXO A;  4FWO A;  5AQQ A;  4H0X B;  2P9N B;  1X3M A;  4IZ9 A;  3EL2 A;  1TYQ A;  2QWR A;  4BRL A;  3VF4 A;  2ZGY A;  2E1Y A;  2I7P A;  1T6D A;  3FZF A;  3EZW A;  2BUP A;  3C0B A;  3A5M C;  3M6G A;  3EKU A;  3A5O C;  1S22 A;  1ZBS A;  4FO0 A;  1MDU B;  2FLO A;  3ZX0 A;  4XH5 A;  4CD3 A;  2V7Z A;  3LL3 A;  1SAZ A;  3QB0 A;  5BR9 A;  4E1J A;  3CQY A;  2FSK A;  2Q31 A;  3KHY A;  2QWM A;  2P9N A;  2GEL A;  3B8A X;  3JXU A;  1EQY A;  3CJC A;  3WUH A;  4H0Y B;  3FZM A;  4IWV A;  4CBW A;  5AFU H;  2A41 A;  2E2Q A;  3ULE B;  4K41 A;  2YHY A;  3TU5 A;  5KPZ A;  2ZWH A;  4M7Y A;  4GNI A;  3ATV A;  5KPT A;  4MLE A;  3D2E B;  5TKY A;  4CD1 A;  2Q0U A;  5AQP A;  2E1Z A;  4AM7 A;  1NGH A;  4BRF A;  3WQT A;  4BC4 A;  1YVN A;  2P9U B;  5AQF A;  5F1X A;  5FPM A; 
#chains in the Genus database with same CATH topology
 1WB9 A;  3OYL A;  3LAL A;  1CXU A;  3SAF A;  4XH4 A;  5FLX O;  1YVU A;  4NCG A;  1KTQ A;  2A5X A;  4CZK A;  5A2Q O;  4R5P A;  4X66 K;  1NLV A;  4FJH A;  3L0Q A;  4WYB A;  3ZEU B;  1ZBL A;  2P9P B;  3FZL A;  4B9L A;  3FR0 A;  2ZQB A;  5E84 A;  4OKE A;  4AQY K;  3RWU A;  2HF3 A;  5BRH A;  4KHP K;  3VQ7 A;  4CJ7 A;  1ATN A;  2DFE A;  2VWJ A;  4JD2 B;  5K14 A;  3OYK A;  2VG7 A;  4C23 A;  1WBD A;  3LDS A;  3DLH A;  4CEQ A;  4EZ9 A;  2YI1 A;  3U8X A;  1U48 A;  4ILH A;  4ISF A;  3O9U A;  5AQY A;  4JKG B;  4CVN E;  1QS4 A;  4GW6 A;  4JRQ A;  3LDP A;  1TAU A;  4IEI A;  3G71 N;  4M3T A;  3T1Y K;  3MCA B;  4WQ5 C;  4FK2 A;  1TKD A;  1SUQ A;  4DQQ A;  4OPJ A;  2NUB A;  1BQN A;  4RW4 A;  1XMQ K;  4FZY A;  4DSE A;  1V4S A;  3U6F A;  4KHS A;  4E1M A;  4B1U B;  1N33 K;  3CD6 N;  4HWI A;  2IVO A;  3D6R A;  2AP1 A;  4CJU A;  1BCM A;  4DF4 A;  1T3V A;  1K8K A;  2OZM A;  1RTD A;  1TUY A;  2F9T A;  1EET A;  4FWP A;  4PWD A;  4FXD A;  2G8I A;  3KK3 A;  3B6P A;  3SAH A;  4I9L A;  2Q1N A;  2ITM A;  3ZX2 A;  1FJG K;  4Z4E A;  5C2D A;  3ZX3 A;  4BVO A;  1RT7 A;  2HNZ A;  4BRC A;  4B3M K;  1BUP A;  4AIL C;  1D9F A;  3TPQ A;  2XRI A;  3E01 A;  1YHQ N;  1BGX T;  3O1B A;  1VSJ A;  2ZE2 A;  3CYG A;  2O8E B;  3VQ8 A;  1QVF M;  3Q7C A;  2OZS A;  1B9F A;  3HYF A;  4M3U A;  3WQU A;  4DTO A;  2FXU A;  2QW9 A;  1Q7Y O;  4F8R A;  5GIO A;  2CH5 A;  2P1J A;  4O5B A;  1VQO N;  4Z4I A;  3SV3 A;  1SKR A;  4JI0 K;  4BRM A;  4ELT A;  2P51 A;  4Z4H A;  2VQE K;  3OJU A;  2HMP A;  2E5L K;  4FWK A;  3LDO A;  3QES A;  2FF6 A;  4DF8 A;  4CZM A;  2O8F B;  3D2F A;  4BEC A;  4KHW A;  4DR4 K;  4NLC A;  4DB3 A;  2AA4 A;  2W40 A;  1D4X A;  1NGC A;  3DRP A;  3KIO A;  2JWK A;  2C1I A;  3IMX A;  4CJE A;  3FGU A;  3IRX A;  2VQF K;  4E0D A;  5EX5 A;  4Y0W A;  4DV1 K;  2PAV A;  1KRP A;  1RDC A;  4H5T A;  3QNO A;  4HTU A;  2A42 A;  5C2F A;  4I2P A;  4N41 A;  1NJZ A;  1NGD A;  3WNG A;  5FPE A;  4CF1 A;  1S1V A;  1EX4 A;  3CME N;  5CR4 A;  1C0G A;  3KLI A;  1NK9 A;  2D1K A;  3QLH A;  1Q86 O;  4CJ3 A;  4KHQ A;  4ZHR A;  4E72 A;  1GOC A;  4DU3 A;  1Q81 O;  4FWR A;  3V1R A;  1HNI A;  4IXC A;  1HRH A;  5KGW A;  4BQL A;  4E1N A;  1NOY A;  1RTJ A;  2JLE A;  3OA9 A;  1B92 A;  3ENO A;  1G15 A;  1X9M A;  4W5Q A;  3MX5 A;  4U7B A;  3LP1 A;  3UKU B;  4JHD A;  3RSE B;  4BRH A;  3HPG A;  3DJC A;  4DCH A;  1RBR A;  4NCB A;  2DPN A;  5FRM A;  4CJF A;  2UXB K;  1HNZ K;  5KQ8 A;  1YIT N;  4H4O A;  3ZT4 A;  4CGG A;  4FLV A;  4Z4C A;  5BRD A;  2BTF A;  3OYF A;  1S3X A;  4YOT A;  4FWN A;  3BF1 A;  3MK6 A;  3OYD A;  3G4S N;  4XIU A;  5F2R A;  4FLZ A;  3AO2 A;  1NMD A;  3DLB A;  5I9E B;  3KK2 A;  5T7B A;  3TI0 A;  1NOZ A;  1BA1 A;  4F4K A;  4FLX A;  5I3U A;  1TGO A;  4RCH A;  3VTI A;  1I3A A;  2G8U A;  2FBX A;  3DRR A;  3DOL A;  2QI2 A;  4H8K A;  4L3Q A;  4M3Z A;  4H0V B;  3RR7 A;  3M3Z A;  1L3V A;  2HHW A;  4B1Z A;  1DLO A;  3HI0 A;  4CJQ A;  4X62 K;  2HND A;  3EN9 A;  3IDH A;  4CHQ A;  3O4W A;  4CZF A;  4DLG A;  3U9Z A;  3CCV N;  3QER A;  1WSG A;  4FWM A;  4K0K K;  2X78 A;  3KZB A;  4PA1 A;  3AGR A;  3AVK A;  2D4W A;  3J81 O;  5SWM A;  3VQD A;  3QBX A;  3H1Q A;  3O3F A;  3TAR A;  3CJ7 A;  3ASM A;  4O44 A;  3JS6 A;  4Y1D A;  2I5J A;  3QEP A;  1Z05 A;  2VGN A;  1RT2 A;  3SQ1 A;  1FKP A;  1S5J A;  4JK9 A;  2UYT A;  4KTQ A;  5FPD A;  2EWS A;  4X65 K;  5HRO A;  2UU9 K;  1Z6R A;  3HPH A;  1YAG A;  4BDP A;  3AO4 A;  2ASM A;  5KRS A;  3FZH A;  3LM9 A;  4A59 A;  1OH8 A;  3TAB A;  1KLN A;  4CCH A;  3HK2 A;  4CE9 A;  1N34 K;  4BG8 A;  3O4N A;  3OYE A;  3WEE B;  3K9J A;  2IOC A;  4DSL A;  1SZ2 A;  1I39 A;  4FJM A;  2PY5 A;  4OPK A;  5HP1 A;  2AJQ A;  4H4M A;  3VER A;  5AR0 A;  3ZT0 A;  3VQA A;  1S1T A;  3S3N A;  5AQK A;  2OCE A;  3PX4 A;  4CHN A;  5BPL A;  3MEC A;  1NK6 A;  4LF5 K;  4IDH A;  3SI6 A;  1C0F A;  2VG5 A;  2B4J A;  4LFC K;  4K25 A;  3AA5 X;  4YDU C;  4C1N I;  3O9T A;  1JLG A;  3BY5 A;  3SQ0 A;  3CM5 A;  3VQE A;  2EX3 A;  1H1V A;  2UUB K;  3CPE A;  2NZT A;  3QEI A;  4OPH A;  4ELV A;  3TTC A;  5SZT A;  4YOY A;  3IUC A;  4CEA A;  3CQX A;  3U3Y A;  5BN9 A;  4HVJ A;  4CJ5 A;  2KFZ A;  1Y64 A;  2DTU A;  2KHO A;  3PUF A;  3MN6 A;  3OHR A;  4JI3 K;  1JLQ A;  4H0O A;  1IH7 A;  3GDQ A;  4N76 A;  3CFP A;  3ZET B;  3NH1 A;  1IV0 A;  1KVB A;  4QS7 A;  5BRF A;  1YJN N;  1CZB A;  4CHY A;  1C6V A;  3CET A;  1UA0 A;  4DSF A;  1UOC A;  3V9X A;  4C1N K;  2HNY A;  2HBM A;  1TYQ B;  4N56 A;  1QHT A;  1T7P A;  3J7Z O;  2HVH A;  1Q18 A;  3M1F A;  4KB1 A;  3SJJ A;  1IKV A;  3MMV A;  1KCF A;  3VQC A;  4B9N A;  1VQ6 N;  3KLG A;  5KRT A;  3L2V A;  3P5J A;  3UE5 A;  3DXK A;  4X64 K;  5MLC Q;  2RHK A;  4YFU A;  3SAG A;  1GLD G;  1WSJ A;  4NB4 A;  4FWO A;  4NCA A;  3SNN A;  2P9N B;  1X3M A;  3EL2 A;  2QWR A;  4BRL A;  2QK9 A;  2E1Y A;  2I7P A;  2W6L A;  3EZW A;  3C0B A;  1K9M O;  3V81 A;  3K5O A;  3A5O C;  3AO3 A;  2Y1J A;  1OH5 A;  3ZX0 A;  4XH5 A;  2PYL A;  3IG1 A;  5GIP A;  4BDZ A;  1SAZ A;  3AVN A;  1HPZ A;  5CZ1 A;  4E1J A;  3THW B;  3CQY A;  4LD0 A;  3KHY A;  4DR6 K;  4JS4 A;  4ID5 A;  1Y97 A;  2OPP A;  3P1G A;  1S1X A;  3OYH A;  1EQY A;  4BE1 A;  3QNN A;  3WUH A;  2O8D A;  3S5T A;  4H0Y B;  3V1O A;  4DU1 A;  4CBW A;  2KLA A;  3ULE B;  4KPY A;  2ZWH A;  2HHH K;  1NJI O;  3NAE A;  4GNI A;  3ATV A;  2WON A;  2XO7 A;  1GOA A;  3SQ2 A;  3A2F A;  5IT9 O;  2W00 A;  5AQP A;  4BRF A;  3ZCM A;  1YVN A;  5FPM A;  1N5Y A;  2F4V K;  1XMO K;  4CGI A;  5ELZ A;  4A5B A;  3AO5 A;  1S9G A;  3K5L A;  4DV3 K;  3ZSV A;  3HPO A;  1U4B A;  2P5G A;  4MO4 A;  5AQX A;  1QHA A;  2O8C A;  3HL8 A;  1HKC A;  1GLA G;  5AJ3 K;  3VF2 A;  3VQ4 A;  3A5L C;  4KB0 A;  5CYQ A;  2W6K A;  3AVB A;  3OYA A;  3C65 A;  2P9U A;  1S6Q A;  1P90 A;  3KWG A;  3CJ1 A;  4PQU A;  4CGH A;  1M1K O;  1NBW A;  3ZYY X;  1ASV A;  3ZSQ A;  3TTF A;  1RT3 A;  5E26 A;  1XHX A;  4K8Z A;  4JRP A;  1IKY A;  3VET A;  4EP4 A;  4FJ8 A;  3IS9 A;  2DFH A;  1EXQ A;  3VQQ A;  3ZEU A;  2P9P A;  4A61 A;  1LOT B;  1RFQ A;  3MWT A;  1C0U A;  3O9S A;  3CCQ N;  4FOI A;  4YDU A;  5AQI A;  1NNE A;  3NF7 A;  3BGR A;  4FJX A;  2NRV A;  3SUN A;  1VQP N;  3PSF A;  3BP8 A;  1FKO A;  1SS6 A;  2FSJ A;  1TKX A;  1S72 N;  1KVC A;  2QM1 A;  2G8W A;  1HKG A;  1TUU A;  1IBK K;  4CW7 B;  3F5T A;  3CCE N;  1XUP O;  3K57 A;  3D45 A;  4JKG A;  4YOW A;  4IO8 A;  5JIC A;  2ZM6 K;  2HF4 A;  4BQZ A;  2D0O A;  4CBX A;  2Q0R A;  3KLF A;  5BN8 A;  5M1P A;  4FLY A;  4W5O A;  4CZJ A;  4I2Q A;  3WXK A;  3OS0 A;  3LDL A;  4DHY A;  2OTL N;  3SMP A;  3VOV A;  2O8D B;  2XY6 A;  4DR3 K;  1TKZ A;  3PIO L;  3S41 A;  4ISE A;  1IKW A;  4O4G A;  5CZ2 A;  1YI2 N;  3L8B A;  1QQC A;  3O6W A;  4AHT A;  1C1B A;  2KZZ A;  2GWJ A;  2Z1G A;  3PSI A;  4F3T A;  3SYZ A;  1TL3 A;  3CJ9 A;  1YTU A;  3OYI A;  1UWB A;  2HHU A;  3W0L A;  1J5E K;  3KLE A;  4DG1 A;  5LJV A;  4K42 A;  1VQM N;  1N6Q A;  3DI6 A;  1E4F T;  3QBW A;  2DY4 A;  1G99 A;  3JSM A;  5AQS A;  3VEZ A;  3W3D A;  1BOT O;  1HJO A;  1ZBH A;  2YKM A;  1NJY A;  3RMC A;  4O0J A;  2KFN A;  2Z1J A;  1YT3 A;  4XH1 A;  4DMN A;  2O8E A;  4JN4 A;  4CJT A;  1D5A A;  3T1H K;  4RW6 A;  4C8M A;  2VG6 A;  1DGK N;  4Q5V A;  4B3R K;  1XNQ K;  4BRI A;  1VQL N;  3CJA A;  1O13 A;  3EY1 A;  4A2A A;  4CZG A;  3VA0 A;  3P39 A;  3DLK A;  1GLL O;  2E8A A;  2Q3S A;  4IG3 A;  3VQ9 A;  4DSJ A;  1E3M A;  4PL8 A;  3CMA N;  1JL2 A;  4DFP A;  4FJJ A;  2O8F A;  2E6M A;  1JLC A;  3MEG A;  5LJW A;  5DM7 L;  1KSP A;  3M8P A;  3VF6 A;  1RIL A;  1Z26 A;  4DR7 K;  1HNW K;  2XY7 A;  5JVG L;  2NRX A;  5M1K A;  2GX9 A;  1WN7 A;  4DSK A;  4DV5 K;  1J53 A;  2ZJR L;  3MN5 A;  1NKC A;  4GKJ K;  5AZJ B;  2FSN A;  1IBL K;  2OAN A;  4ZTF A;  3HTV A;  2NRZ A;  2WUS A;  4LF7 K;  3VEN A;  2PZS A;  1WUA A;  1A5V A;  1BIU A;  3I8B A;  4KHU A;  3QEW A;  4FZZ A;  1ATS A;  1GLC G;  4IG0 A;  3H6E A;  5AQV A;  4BDY A;  4IOX A;  3ISN C;  5AQO A;  3LP0 A;  1JLE A;  1HYS A;  3OYC A;  4WE1 A;  4DTN A;  5CHI A;  2O4G A;  5HRS A;  4JS5 A;  5CYM A;  1NJX A;  4FW1 A;  1S1U A;  1REV A;  1EWR A;  2QWP A;  3PIP L;  1OKJ A;  5AQZ A;  1QQM A;  3HO1 A;  4YHH K;  4KH6 A;  3LDQ A;  3PLA A;  3CJB A;  1SKW A;  1VSL A;  3UKU A;  1KQS M;  3RSE A;  2JWL A;  1SL0 A;  3TWH A;  1BHL A;  2GEM A;  2X6N A;  3LP3 A;  1LWC A;  4AM6 A;  4XJX A;  1RGI A;  4WFN L;  4L8R B;  3TAP A;  3CYM A;  1RDA A;  4I6M A;  4Y1C A;  2ZGZ A;  3C6H A;  3NE6 A;  3NF8 A;  3FFI A;  2UUA K;  3K59 A;  3G25 A;  4O8K A;  4DQP A;  4OVL A;  1MA9 B;  5C12 A;  2VCP A;  4OPA A;  1T44 A;  3QML A;  4JKE A;  2QKB A;  1X3N A;  4Z4G A;  2Z1I A;  3K0S A;  2P9S A;  2YX6 A;  4AHU A;  1C1C A;  5JS1 A;  1GLB G;  4QS8 A;  2FBV A;  1OH6 A;  2IC3 A;  3MDQ A;  2HOE A;  4FM0 A;  3AVM A;  4B3T K;  4HCC A;  4B9S A;  4CGJ A;  1N32 K;  3AO1 A;  4FM1 A;  4JNE A;  3ZT2 A;  4M45 A;  3I0R A;  3VGM A;  4JK8 A;  4FWQ A;  1RT5 A;  4IKF A;  2B5J A;  4M3W A;  3CC7 N;  1J6Z A;  4DV7 K;  2FBT A;  4JAX A;  3VPZ A;  3V4I A;  4JI2 K;  3FFK B;  4F2R A;  1LCU A;  4W5T A;  4B3S K;  3TSU A;  1WAF A;  2OPR A;  3RVC A;  5BPM A;  3TAN A;  4EP5 A;  3RRG A;  4JEP A;  4DQR A;  2HHI A;  1MWM A;  3ALY A;  3CG7 A;  4M7X A;  3T1A A;  3A8Y A;  1QTM A;  3ZT3 A;  3LZJ A;  4KI4 A;  4DSI A;  4NO7 A;  3UIQ A;  3Q7B A;  4FJK A;  4QOZ B;  3PO4 A;  2X6S A;  4C8L A;  4J2B A;  1XI1 A;  4CHO A;  4CED A;  2A1R A;  3I33 A;  1VHX A;  1LAW A;  3VEW A;  1CXQ A;  3AVI A;  2Q97 A;  3D2E A;  1IG8 A;  4WQ4 C;  3PX0 A;  2XY5 A;  4CEZ A;  4EIA A;  4EAH D;  1NGA A;  5JLF A;  1HPM A;  3E9L A;  1ASW A;  1BIZ A;  4JKH A;  3WEE A;  4DR1 K;  2HMI A;  4LY7 A;  1F21 A;  4KRF A;  4Q0B A;  3QEX A;  2O4I A;  1BL3 A;  2YCH A;  3DM2 A;  4K43 A;  4R79 A;  1QSS A;  3GG4 A;  3TAM A;  1W9H A;  4NYN A;  2NRT A;  3KVG A;  4OLB A;  1T05 A;  4KKO A;  4BWJ A;  4B1W B;  1C0T A;  2BAN A;  3KTQ A;  3H1V X;  4B8A B;  3L2W A;  3H45 C;  3J8A A;  3MWP A;  4IBN A;  4I6M B;  5M1F A;  4CIG A;  2YNH A;  3AA2 A;  3E9O A;  4BEB A;  3L3V A;  1BO5 O;  4WQ5 A;  5LY3 A;  2E6L A;  3C6T A;  2WTU A;  4BRN A;  3J7A P;  1WAJ A;  1HUX A;  4DUZ K;  5FRO A;  3U3G A;  2P9S B;  4IOC L;  3V6D A;  4DUY K;  2E2O A;  4DV4 K;  3VGK A;  1ZBF A;  3A5N C;  2X74 A;  1FXX A;  4CF0 A;  3ZET A;  5DM6 L;  4LC9 B;  5HRP A;  4BR7 A;  1U47 A;  3MN7 A;  3HVR A;  2XY8 A;  4FJ7 A;  3LAK A;  4JLH A;  4DV2 K;  2QTD A;  4LF6 K;  3PY8 A;  4N5S A;  3THV A;  2A1S A;  2ATQ A;  1TYQ A;  3HRG A;  3VF4 A;  2ZGY A;  3KKS A;  4CJW A;  1VQ8 N;  3SUQ A;  3R1X A;  3M6G A;  4FO0 A;  1ZBS A;  2YNI A;  1MDU B;  3HOT A;  1SKS A;  3MED A;  4CD3 A;  3SV4 A;  1VK0 A;  2NRW A;  1EKE A;  3CFO A;  1R0A A;  5I42 A;  2Q31 A;  4CHP A;  5TKW A;  4OKJ A;  2QWM A;  5GAG P;  3CCL N;  2P9N A;  3NGI A;  3B8A X;  4M3Y A;  1JKH A;  3CJC A;  5GIN A;  5DK5 A;  2KTQ A;  1BI4 A;  4IWV A;  2HHQ A;  4C8N A;  5AFU H;  3O9R A;  2RN2 A;  3NH0 A;  3S3O A;  4K41 A;  3TU5 A;  4BWM A;  4MDA A;  1JLB A;  1TK5 A;  3THW A;  2F96 A;  3D2E B;  3TR8 A;  1JL1 A;  4ELU A;  4CFA A;  3E1Y A;  3WQT A;  1L5U A;  1Q9Y A;  4CGD A;  4JI1 K;  5F1X A;  3CC2 N;  1XWL A;  3NMU A;  4LH4 A;  3JYT A;  3ULE A;  3I55 N;  1A5W A;  4IO9 L;  3NFA A;  2JGU A;  3SMS A;  4FCY A;  5C25 A;  1XNR K;  4E7L A;  3CI5 A;  3T19 A;  4RWT A;  1N36 K;  4KAZ A;  4KRE A;  4RTF D;  3WNE A;  1TK0 A;  1UAX A;  5FRN A;  4DWI A;  3WNH A;  2V52 B;  3SBT A;  5AQG A;  1LAV A;  4O8U A;  3ITH A;  3WNF A;  1W7A A;  1VQ5 N;  5BRE A;  1HNX K;  1HQE A;  3O80 A;  2QEX N;  4G9Z A;  3ZSX A;  3L3U A;  4CZL A;  1B9D A;  3OTO K;  5F0X A;  1LWE A;  1HYV A;  4EFH A;  4YOV A;  4MLH A;  2F8T A;  4DFK A;  1WBB A;  3R9P A;  4CFB A;  2P5O A;  5JVH L;  1P8Z A;  4RW9 A;  4EHT A;  3AAR A;  1NK5 A;  5IWA K;  3C94 A;  3CCM N;  2ASO A;  3HVT A;  3DRS A;  3CPW M;  4KFB A;  3P4I A;  4A62 A;  3AGK A;  4FPB A;  4KH5 A;  4I9Q A;  1NK4 A;  1XQS C;  2YHW A;  4PKI A;  4F9O A;  4FJL A;  4M63 C;  4FWS A;  4E7H A;  4CJP A;  4LF4 K;  4PY5 A;  3C95 A;  3DXM A;  4B9Q A;  4A2B A;  1IO2 A;  4BR5 A;  5AQL A;  5FDL A;  2P9I B;  3OYN A;  1U6Z A;  4A57 A;  4DQ8 A;  1BI4 B;  1RBV A;  4TSX A;  1KFS A;  2YNF A;  4CFD A;  3CER A;  2FF3 B;  4B9M A;  1BU6 O;  3DLE A;  3NH2 A;  3HJF A;  4FLU A;  3TAQ A;  1M90 O;  2FBY A;  1VRU A;  3DLL L;  2CGL A;  3CIP A;  2C1G A;  3NVM A;  4CK2 A;  3BUZ B;  3ZT1 A;  4KO0 A;  3A0I X;  1V4T A;  5CE3 A;  3MXM A;  4H5N A;  1TV6 A;  2VWB A;  1IKX A;  2RPI A;  3ENB A;  3O4Q A;  2O8B A;  2G8H A;  3VEY A;  4JI4 K;  1Q9X A;  2UXD K;  4FJI A;  4CF2 A;  1YJW N;  3HSC A;  1TAQ A;  1CLQ A;  4H5R A;  3RMD A;  5D3G A;  2HHV A;  3G6E N;  1NGB A;  1U2V B;  5EVZ A;  3NF6 A;  4CEO A;  3HXM A;  2ASP A;  4YY3 K;  3SQ4 A;  4DS4 A;  1VQ4 N;  3AVH A;  2BE2 A;  3C6A A;  1KXP A;  3LPT A;  2HBL A;  1VQK N;  3KD1 E;  4Z94 A;  4CF8 A;  3ATU A;  3MXJ A;  4BRE A;  2YHA A;  1RBT A;  1RT1 A;  3IFR A;  3SPY A;  2G8F A;  3KK1 A;  4B9U A;  3K5N A;  3PX6 A;  2WBN A;  1E4G T;  3IKM A;  2R7Y A;  2W41 A;  3VEO A;  2YHX A;  3OJS A;  4O0I A;  3VQ5 A;  4FSV A;  4UY8 O;  3N4P A;  4LFA K;  2IVN A;  3AVG A;  4KHN A;  2QWQ A;  3QIC A;  1HX1 A;  2FC0 A;  5AQR A;  1SQK A;  2PYJ A;  4GKK K;  4FK0 A;  2OPS A;  4JKB A;  4BRO A;  1VQN N;  4CJS A;  3K5M A;  4JV5 K;  4IFY A;  4IDK A;  3H3O B;  3P38 A;  4B08 A;  3CF5 L;  1HQU A;  1T8E A;  3DXM B;  3WT0 A;  3C6U A;  4CIE A;  1JCE A;  3HT3 A;  1U45 A;  4IOA L;  3AA3 A;  3NCI A;  1W2B M;  2B6A A;  4BR9 A;  1NGF A;  5AZJ A;  3KLH A;  1TKT A;  5E41 A;  3DOK A;  3AV9 A;  1SV5 A;  2G8V A;  2ITG A;  2V51 B;  3U9D A;  4ICL A;  3O3H A;  3K58 A;  1NGJ A;  1QSY A;  3ZSY A;  1NG9 A;  3BEX A;  3O1W A;  1VSK A;  4I7F A;  1LWF A;  1KC8 O;  4BR0 A;  1BG3 A;  2ETJ A;  3VGL A;  3K2P A;  2Q2R A;  3C7N A;  1ITG A;  2IIR A;  4DTX A;  1OH7 A;  4W5N A;  4FPA A;  2HB5 A;  3UB5 A;  2NRR A;  4HUE A;  4DFJ A;  1XC3 A;  4G1Q A;  2E20 A;  2VGM A;  4NLB A;  4DR2 K;  1DTT A;  2O8B B;  2QA4 N;  1WOQ A;  4B1V A;  5BPN A;  3RR8 A;  4RW8 A;  4OGC A;  2LSN A;  2YV0 X;  1VSE A;  3RTV A;  4RG8 A;  1XC9 A;  2GTD A;  4GV9 A;  4K8X A;  1KAX A;  2XHB A;  2HBK A;  1IBM K;  3QDK A;  3ENH A;  1L3S A;  1C1A A;  5AZI A;  4LH5 A;  1NK7 A;  2HBJ A;  2KW4 A;  4DTJ A;  1JJ2 M;  4CZE A;  1Q8I A;  4JKD A;  2CGJ A;  3IAY A;  5KGX A;  1ZBU A;  2YJE A;  3K9K A;  3QET A;  1ZC6 A;  3MEE A;  3SZ2 A;  4DKW A;  2V7Y A;  2GUP A;  3O9Q A;  1DKG D;  3MXI A;  2KQ2 A;  1K73 O;  4M42 A;  3OYG A;  5J2Q A;  4JKA A;  1RCH A;  3AA4 A;  1KLM A;  3WXM B;  1HJR A;  3O08 A;  4KH4 A;  5AQH A;  5JEN A;  1VSM A;  1W0H A;  3GBT A;  2UXC K;  3KJV A;  5AQW A;  1X9W A;  3ZSO A;  4BR2 A;  3MCP A;  4CIF A;  2Q36 A;  5LMN K;  3T3F A;  3QIO A;  1ZYQ A;  3N4Q A;  2QKK A;  1RTI A;  3HZ6 A;  3OYM A;  5C24 A;  3B6O A;  2P9L B;  5FPN A;  4B9V A;  4DTU A;  3AVA A;  2J4R A;  4CER A;  1QVG M;  1HLU A;  3GE1 A;  1TL1 A;  4BRA A;  4GY2 B;  5HRR A;  3FZK A;  3MX2 A;  3WXI A;  2H3G X;  4BE7 B;  1SL2 A;  5HLF A;  1R59 O;  1U49 A;  3C7N B;  4KTW A;  4M3X A;  5AQN A;  3LDN A;  5EY4 A;  1J54 A;  3NVK A;  4DS5 A;  4FWL A;  5HOO A;  4FJN A;  3VQ6 A;  4BE2 A;  1A5X A;  4CI6 A;  4BGB A;  5C10 A;  3MAQ A;  1NK0 A;  4WCE L;  5J2P A;  4CHZ A;  3M5R A;  3CXC M;  3LWL A;  3UKR A;  1RTH A;  5CY4 A;  3KKR A;  3ID6 A;  3O5B A;  2Z1H A;  1ZBI A;  5AFU A;  4A5A A;  4EZ6 A;  2OTJ N;  3L2Q A;  3KK7 A;  3S3M A;  4PKH A;  4FZX C;  2HST A;  3TSQ A;  5AZI B;  2CH6 A;  2IVP A;  3EE9 A;  1BWF O;  2IDO A;  1D9D A;  1YXQ A;  4WF9 L;  4WFA L;  1ZXO A;  5AQQ A;  4KHY A;  4B9T A;  3EZ5 A;  4H0X B;  3TAG A;  1YIJ N;  2YKN A;  1T6D A;  2BUP A;  1U04 A;  4OX9 K;  4FM2 A;  2RE2 A;  3EKU A;  1CZ9 A;  1S22 A;  1W97 L;  2V7Z A;  2WFB A;  5BR9 A;  5J2M A;  2FSK A;  1RBS A;  2IGI A;  3JXU A;  1VSI A;  4LFB K;  3VQP A;  3M8R A;  2RKI A;  4DTM A;  2WC9 A;  4AHR A;  3OYJ A;  2A41 A;  3CCJ N;  4J2A A;  1QSL A;  2YHY A;  5C42 A;  1ASU A;  1RNH A;  1O1W A;  3ULD A;  3NGZ A;  1S6P A;  4HUF A;  3SUO A;  4CJ4 A;  2IAJ A;  2E4L A;  3OYB A;  5TKY A;  1T03 A;  1DTQ A;  1N8R O;  5HRN A;  5C0Y A;  3VMF B;  4BC4 A;  2YNG A;  1LV5 A;  2OPQ A;  2IS3 A;  5AQF A;  4QAG A;  5AQM A;  4CZI A;  3R6M A;  5J2N A;  2UUC K;  3VQB A;  4KTZ A;  1J5O A;  4N47 A;  5ADX A;  4H0P A;  2QWL A;  1VQ9 N;  1RBU A;  1TK8 A;  4QCL A;  1GOB A;  4BE0 A;  1JCG A;  4Z4F A;  3ZSW A;  4DQI A;  1EO1 A;  1ILY A;  2D0A A;  3CCS N;  5M1O A;  1MU2 A;  5KTQ A;  3ZLJ A;  1SL1 A;  2GWK A;  4CFC A;  3KWI A;  1QZ6 A;  3UKR B;  1JLF A;  2ZJQ L;  4FJ9 A;  2GV9 A;  2W42 A;  1YUW A;  3QFU A;  4GMJ B;  3SK3 A;  3CM6 A;  3E66 A;  1NU0 A;  3JAM O;  4CJL A;  5GAH P;  2I7N A;  3CQ8 A;  4JI5 K;  4JKC A;  4PL7 A;  4DU4 A;  1RT4 A;  1XHZ A;  4OO1 J;  3THY A;  3NDK A;  3O3G A;  1NGE A;  1K8K B;  3QIN A;  1NKB A;  4B3O A;  3EKS A;  1WSE A;  1WSF A;  4MDB A;  2ZJP L;  5AQT A;  4MQ3 A;  3VES A;  3V1Q A;  4JYA K;  1NK8 A;  3H46 O;  1NM1 A;  4ID1 A;  2QWN A;  3OBW A;  1OVY A;  2Y1I A;  3RMA A;  4CBU A;  1QQO A;  1RDD A;  3ID8 A;  3DWL A;  3R8E A;  4KI6 A;  1NJW A;  1LW2 A;  4ILJ A;  3BF3 A;  2VWK A;  3VA3 A;  4CEC A;  3NHG A;  3BZK A;  3EEQ A;  4CJV A;  1YJ9 N;  3NGY A;  2A6A A;  3R3L A;  2CGK A;  4H5V A;  1CZA N;  1T6C A;  4IJN A;  1NGG A;  1NKE A;  4CES A;  4OGE A;  4CF9 A;  4MO5 A;  3G0Z A;  1VRT A;  3AY9 A;  5EU7 A;  4B8C A;  3CFR A;  3FLC O;  1OVQ A;  4YOU A;  3WXL A;  4BRK A;  4WFB L;  3H3N O;  2P9I A;  1NMN A;  3D2F B;  4YNQ A;  4IFE A;  2E88 A;  3KD5 E;  3L4Q A;  4E89 A;  3VEX A;  1EP4 A;  1BIS A;  1VSD A;  5LL6 Z;  4BRD A;  3E9P A;  1VQ7 N;  1NGI A;  1LW0 A;  5KI6 A;  4FVU A;  4C8O A;  3ZSR A;  3SPZ A;  4DTS A;  4B1X B;  3CCU N;  5EXW A;  3L6Q A;  1L3U A;  1FW6 A;  1GLJ O;  4OJR A;  3J7Y P;  4JI7 K;  4DTP A;  4F2S A;  1DEJ A;  4BVP A;  4NXN K;  4H0T B;  1GLE G;  3G10 A;  3F73 A;  3D7E O;  3VN5 A;  2NRH A;  3T7Z A;  3I0S A;  1Q82 O;  2WOM A;  3LPU A;  2KKZ A;  3LM2 A;  4IFV A;  4DFM A;  3V9U A;  2P9K A;  4BC3 A;  2QXL A;  1RDB A;  4RW7 A;  4FL9 A;  4Z0U A;  1BQM A;  3HM9 A;  3VTH A;  1YF5 L;  2F9W A;  5JLH A;  1X9J A;  3L4I A;  3V9W A;  3THY B;  3TSP A;  2QXF A;  1JXE A;  1GLF O;  4V19 S;  1ESV A;  4UQG A;  4HTL A;  1S1W A;  4JHD B;  1U2V A;  1K8A O;  4AF1 A;  3RRH A;  3AVL A;  4KBO A;  5LMU K;  4DTR A;  2G8K A;  4AHV A;  1BDG A;  4FOE A;  4FJ5 A;  3M8S A;  4WQ4 A;  3TAF A;  3CCR N;  3SUP A;  2GUI A;  4AHC A;  4JI6 K;  3OS1 A;  4J2D A;  4E7I A;  3SBG A;  4ILG B;  4DLE A;  2EHG A;  4XEI A;  4LSN A;  4HHT A;  1HR0 K;  4GV6 A;  2HVI A;  1HKB A;  3M8Q A;  3CHW A;  2A3Z A;  3EE8 A;  2HW3 A;  4CZH A;  1WNS A;  4PKG A;  4W5R A;  5KQD A;  4YOX A;  2HHX A;  1HYZ A;  3QFP A;  5ADX H;  4EHU A;  4O5F A;  4JI8 K;  4BRG A;  3P31 A;  4M41 A;  1VSH A;  4BC2 A;  3I8D A;  3PO5 A;  3TTD A;  3DLR A;  4LF8 K;  4O55 A;  1QZ5 A;  2F7T A;  3QIP A;  3RMB A;  2OA8 A;  4KV8 A;  1WSI A;  3F9M A;  3MN9 A;  3U4L A;  3EO3 A;  3NF9 A;  2BDP A;  4BAC A;  2KZM A;  4YOR A;  1YTA A;  3SCX A;  4OLA A;  3LP2 A;  2E2P A;  4BGA A;  4B1Y B;  4DQS A;  3DMJ A;  2QWO A;  1ATR A;  3NBP A;  3CC4 N;  4QS9 A;  1MWK A;  4BRP A;  1KAY A;  1KAZ A;  5C15 A;  3GOI A;  1JCF A;  3LZI A;  1KFD A;  4CGF A;  2P9K B;  5M1N A;  1HMV A;  5HL7 L;  4CJR A;  1NWK A;  4JK7 A;  3GL1 A;  3L2R A;  3AAQ A;  4H5W A;  1QQN A;  1X1P A;  3D0P A;  2PFU A;  3AVC A;  1TVR A;  5HBM A;  4DV0 K;  2ZF5 O;  3DLG A;  2F8S A;  2ZD1 A;  3O8M A;  2D0P A;  4GVE A;  2BH1 A;  3AAP A;  4IJA A;  5EOY A;  4CK3 A;  5AQU A;  3HP6 A;  1WLJ A;  3HOS A;  4FLT A;  2HHS A;  3FE1 A;  2RF2 A;  2NLX A;  5JMV A;  4CEB A;  3WXJ A;  2HHT A;  3DAW A;  5B8H A;  3THX A;  4FJG A;  5AQJ A;  4E3S A;  3HP9 A;  3AVF A;  1EWQ A;  1RDW X;  1RDU A;  4FYD A;  1D8Y A;  3I56 N;  2PBD A;  4E7J A;  4U67 L;  1IJJ A;  4J2E A;  1IG9 A;  2YJF A;  4FW2 A;  5H1S Q;  3PV8 A;  4DR5 K;  4J8F A;  4BRQ A;  2OYQ A;  2A40 A;  4MFB A;  1BCO A;  4IEE A;  3P83 D;  4F3O A;  2D5R A;  2P9L A;  4CEE A;  4FLW A;  4ISG A;  5KPR A;  5M1Q A;  1BA0 A;  3J80 O;  3AVJ A;  4CK1 A;  3DXK B;  2DFF A;  4BG9 A;  2GBZ A;  4BC5 A;  4JD2 A;  4CEF A;  3HM8 A;  1VAZ A;  1C0M A;  5JS2 A;  1X9S A;  3VEV A;  1KD1 O;  2VYP A;  2E2N A;  4HCB A;  4LF9 K;  5GAD P;  1HNV A;  1JLA A;  3SLC A;  1S9E A;  3SJH A;  3EYZ A;  4E19 A;  3S9H A;  1VSF A;  4H03 B;  3HBT A;  4BR4 A;  3F2K A;  1Z25 A;  3BZC A;  3DYA A;  3T69 A;  4NYF A;  3OW2 M;  4BY9 C;  1KVA A;  4FVM A;  3V9Z A;  1L3T A;  3BDP A;  4IZ9 A;  4DV6 K;  2BGG A;  4M3R A;  4JKF A;  4GVM A;  3FZF A;  3HST B;  4PUO A;  4FK4 A;  3V9S A;  4GV3 A;  1DT9 A;  4OKK A;  3A5M C;  1J9A A;  4NXM K;  2FLO A;  3LL3 A;  3QO9 A;  3QB0 A;  4C8K A;  3QEV A;  1QE1 A;  4E7K A;  2NNW A;  3L2U A;  3ZSZ A;  2GEL A;  1JXB A;  3LWM A;  3TAE A;  1I94 K;  1RT6 A;  3THX B;  3FZM A;  5J1E A;  2E2Q A;  1WSH A;  5KPZ A;  3LAN A;  3OBY A;  3OY9 A;  4M7Y A;  2D0B A;  4PHT X;  5DMR A;  4CJK A;  4HUG A;  5BR8 K;  2O8C B;  2YHB A;  5KPT A;  4MLE A;  1FK9 A;  4ZTJ A;  1UA1 A;  4CD1 A;  3LAM A;  3F9K A;  2D0C A;  2Q0U A;  5GAE P;  2E1Z A;  1K6Y A;  1NGH A;  3H08 A;  4LSL A;  4AHS A;  3OVN A;  4AM7 A;  3OS2 A;  2P9U B;  4AH9 A; 
#chains in the Genus database with same CATH homology
 3NMU A;  5ELZ A;  3ULE A;  4A5B A;  3I55 N;  5AQM A;  4CZI A;  3SAF A;  3R6M A;  4XH4 A;  4IO9 L;  2A5X A;  4MO4 A;  4CZK A;  5AQX A;  1QHA A;  3SMS A;  1HKC A;  1NLV A;  3CI5 A;  4H0P A;  5ADX A;  4RWT A;  1GLA G;  2QWL A;  3L0Q A;  1VQ9 N;  4WYB A;  3VF2 A;  3ZEU B;  2P9P B;  3A5L C;  3FZL A;  1JCG A;  3FR0 A;  4RTF D;  5E84 A;  2HF3 A;  1EO1 A;  5BRH A;  2V52 B;  3C65 A;  1ILY A;  2P9U A;  4CJ7 A;  3CCS N;  1P90 A;  1ATN A;  3KWG A;  5AQG A;  5M1O A;  4O8U A;  3CJ1 A;  4JD2 B;  3SBT A;  1VQ5 N;  5BRE A;  2GWK A;  1NBW A;  1M1K O;  3ZYY X;  4C23 A;  3KWI A;  1QZ6 A;  3UKR B;  3TTF A;  5E26 A;  2ZJQ L;  2YI1 A;  3VET A;  1YUW A;  3QFU A;  3U8X A;  3O80 A;  3SK3 A;  3E66 A;  2QEX N;  4G9Z A;  4ILH A;  4ISF A;  3ZEU A;  5GAH P;  2I7N A;  2P9P A;  4CZL A;  3O9U A;  4JKC A;  5AQY A;  4A61 A;  1LOT B;  1RFQ A;  3MWT A;  4JKG B;  5F0X A;  4EFH A;  4PL7 A;  3O9S A;  4YOV A;  4MLH A;  3CCQ N;  3LDP A;  4FOI A;  4YDU A;  4OO1 J;  5AQI A;  4IEI A;  3G71 N;  1NGE A;  3R9P A;  1K8K B;  2NRV A;  3MCA B;  4WQ5 C;  3EKS A;  5JVH L;  1P8Z A;  4EHT A;  1VQP N;  4MDB A;  2ZJP L;  3AAR A;  5AQT A;  3BP8 A;  1SS6 A;  3CCM N;  2FSJ A;  3VES A;  1S72 N;  2ASO A;  2QM1 A;  1V4S A;  3CPW M;  1HKG A;  1NM1 A;  3H46 O;  1TUU A;  2QWN A;  3P4I A;  4A62 A;  3F5T A;  3CCE N;  1XUP O;  1OVY A;  3OBW A;  4B1U B;  3CD6 N;  3AGK A;  4JKG A;  4CBU A;  4FPB A;  4KH5 A;  4YOW A;  4HWI A;  1XQS C;  1QQO A;  2IVO A;  3D6R A;  3ID8 A;  4IO8 A;  5JIC A;  2AP1 A;  2HF4 A;  2YHW A;  4BQZ A;  2D0O A;  3DWL A;  4PKI A;  3R8E A;  2Q0R A;  1T3V A;  4FWS A;  1K8K A;  4M63 C;  4CBX A;  4F9O A;  3DXM A;  5BN8 A;  1TUY A;  2F9T A;  3BF3 A;  4ILJ A;  4B9Q A;  4A2B A;  4BR5 A;  5AQL A;  5M1P A;  4FWP A;  2P9I B;  1YJ9 N;  4CZJ A;  2A6A A;  3R3L A;  3WXK A;  2CGK A;  4H5V A;  3LDL A;  1U6Z A;  4DHY A;  2OTL N;  3SMP A;  3VOV A;  3SAH A;  1CZA N;  2Q1N A;  2ITM A;  3ZX2 A;  4A57 A;  1T6C A;  4DQ8 A;  5C2D A;  3PIO L;  4IJN A;  1NGG A;  3S41 A;  3ZX3 A;  4BVO A;  4ISE A;  3CER A;  2FF3 B;  4BRC A;  4MO5 A;  1YI2 N;  1BUP A;  3O6W A;  3AY9 A;  1BU6 O;  2GWJ A;  3TPQ A;  1YHQ N;  3FLC O;  3CJ9 A;  3O1B A;  4YOU A;  3WXL A;  4BRK A;  4WFB L;  1M90 O;  1QVF M;  3H3N O;  2P9I A;  3Q7C A;  3DLL L;  3D2F B;  4IFE A;  2CGL A;  3WQU A;  2E88 A;  3CIP A;  2C1G A;  3W0L A;  2FXU A;  3L4Q A;  3NVM A;  2QW9 A;  3VEX A;  1Q7Y O;  5LJV A;  5GIO A;  4K42 A;  2CH5 A;  1VQM N;  3QBW A;  1E4F T;  1VQO N;  3BUZ B;  3A0I X;  1V4T A;  5CE3 A;  1G99 A;  4H5N A;  4BRD A;  3E9P A;  5AQS A;  2VWB A;  3VEZ A;  4BRM A;  1VQ7 N;  1NGI A;  3W3D A;  1BOT O;  1HJO A;  3ENB A;  2HMP A;  4FVU A;  4FWK A;  3LDO A;  3VEY A;  4XH1 A;  4B1X B;  3CCU N;  5EXW A;  2FF6 A;  3L6Q A;  4JN4 A;  4CZM A;  3D2F A;  4BEC A;  1GLJ O;  1YJW N;  3HSC A;  1DEJ A;  4BVP A;  1DGK N;  4NLC A;  2AA4 A;  4H0T B;  1GLE G;  2W40 A;  4H5R A;  1D4X A;  1NGC A;  4DB3 A;  2JWK A;  2C1I A;  3D7E O;  2NRH A;  3IMX A;  4BRI A;  3T7Z A;  3G6E N;  1Q82 O;  1VQL N;  3CJA A;  1O13 A;  3FGU A;  1NGB A;  1U2V B;  2KKZ A;  5EVZ A;  3LM2 A;  4A2A A;  2ASP A;  4CZG A;  1VQ4 N;  3P39 A;  5EX5 A;  1GLL O;  2E8A A;  4Y0W A;  2P9K A;  4BC3 A;  2PAV A;  2QXL A;  3C6A A;  1KXP A;  2HBL A;  1VQK N;  4FL9 A;  4H5T A;  4PL8 A;  3CMA N;  4Z94 A;  3ATU A;  1YF5 L;  3VTH A;  2A42 A;  2F9W A;  4BRE A;  5C2F A;  3VF6 A;  5JLH A;  5LJW A;  1X9J A;  5DM7 L;  3IFR A;  3L4I A;  3TSP A;  1NGD A;  5FPE A;  5JVG L;  2NRX A;  1GLF O;  2WBN A;  1ESV A;  5M1K A;  2GX9 A;  4HTL A;  4JHD B;  5CR4 A;  1E4G T;  1U2V A;  3IKM A;  1C0G A;  1K8A O;  2W41 A;  3CME N;  3VEO A;  2YHX A;  4AF1 A;  2D1K A;  4KBO A;  4FSV A;  2ZJR L;  3N4P A;  4UY8 O;  3MN5 A;  1BDG A;  4FOE A;  2IVN A;  5AZJ B;  2FSN A;  1Q86 O;  2OAN A;  2QWQ A;  3QIC A;  1HX1 A;  3HTV A;  2NRZ A;  2WUS A;  4WQ4 A;  3CCR N;  5AQR A;  3VEN A;  1SQK A;  1Q81 O;  4FWR A;  4IXC A;  4BQL A;  4JKB A;  1WUA A;  4BRO A;  3OA9 A;  3I8B A;  1VQN N;  1ATS A;  1GLC G;  3ENO A;  3H3O B;  3SBG A;  3H6E A;  4ILG B;  3MX5 A;  3P38 A;  5AQV A;  4U7B A;  3CF5 L;  4XEI A;  4IOX A;  3DXM B;  3WT0 A;  3UKU B;  4JHD A;  5AQO A;  3RSE B;  4BRH A;  4GV6 A;  3DJC A;  1HKB A;  1JCE A;  4DCH A;  4IOA L;  3CHW A;  2A3Z A;  1W2B M;  3EE8 A;  4CZH A;  4BR9 A;  4PKG A;  1NGF A;  2DPN A;  5CHI A;  5KQD A;  5AZJ A;  4YOX A;  5KQ8 A;  3QFP A;  5ADX H;  1YIT N;  4EHU A;  4O5F A;  5BRD A;  2V51 B;  2BTF A;  3U9D A;  1S3X A;  4YOT A;  2QWP A;  4FWN A;  4BRG A;  3PIP L;  1NGJ A;  3BF1 A;  3MK6 A;  3P31 A;  1OKJ A;  5AQZ A;  1QQM A;  4KH6 A;  3BEX A;  3LDQ A;  3O1W A;  4BC2 A;  3G4S N;  3CJB A;  3PLA A;  5F2R A;  3TTD A;  3UKU A;  1KC8 O;  1KQS M;  4BR0 A;  1BG3 A;  3RSE A;  1NMD A;  2JWL A;  3VGL A;  5I9E B;  1QZ5 A;  2F7T A;  2GEM A;  2Q2R A;  3C7N A;  1BA1 A;  4AM6 A;  4XJX A;  1RGI A;  2IIR A;  4WFN L;  4RCH A;  3VTI A;  4FPA A;  3F9M A;  3MN9 A;  3UB5 A;  3U4L A;  2NRR A;  4I6M A;  1XC3 A;  2E20 A;  2QI2 A;  2ZGZ A;  4L3Q A;  3C6H A;  2VGM A;  3EO3 A;  4H0V B;  4NLB A;  3M3Z A;  4B1Z A;  4YOR A;  3HI0 A;  2QA4 N;  3G25 A;  1WOQ A;  4B1V A;  5BPN A;  3EN9 A;  4O8K A;  3IDH A;  1MA9 B;  2E2P A;  4BGA A;  4B1Y B;  5C12 A;  2VCP A;  4OPA A;  3O4W A;  2QWO A;  1T44 A;  3QML A;  4JKE A;  4CZF A;  1X3N A;  3U9Z A;  3CCV N;  1ATR A;  4FWM A;  3CC4 N;  4QS9 A;  2P9S A;  2YX6 A;  1MWK A;  3KZB A;  4BRP A;  2GTD A;  4GV9 A;  1KAY A;  1KAX A;  1KAZ A;  5C15 A;  3GOI A;  1JCF A;  1GLB G;  3AGR A;  4QS8 A;  2HBK A;  2D4W A;  3QDK A;  3QBX A;  3H1Q A;  3ENH A;  3CJ7 A;  3MDQ A;  5AZI A;  2HOE A;  2P9K B;  5M1N A;  5HL7 L;  2HBJ A;  3JS6 A;  4CZE A;  1JJ2 M;  1NWK A;  4JKD A;  2CGJ A;  4JK7 A;  1Z05 A;  2VGN A;  2YJE A;  3GL1 A;  3AAQ A;  3K9K A;  1QQN A;  4H5W A;  4JNE A;  4JK9 A;  1ZC6 A;  2PFU A;  2UYT A;  3VGM A;  5FPD A;  2EWS A;  4JK8 A;  4DKW A;  2ZF5 O;  2V7Y A;  2GUP A;  4FWQ A;  3O9Q A;  1DKG D;  3O8M A;  2D0P A;  4GVE A;  2BH1 A;  1K73 O;  3CC7 N;  1Z6R A;  3AAP A;  1YAG A;  4JKA A;  4IJA A;  5EOY A;  1J6Z A;  4JAX A;  3VPZ A;  3WXM B;  5AQU A;  3FFK B;  1LCU A;  3O08 A;  2ASM A;  3FZH A;  3LM9 A;  3TSU A;  4A59 A;  5BPM A;  3RVC A;  4KH4 A;  3HOS A;  5AQH A;  4JEP A;  3FE1 A;  1MWM A;  2NLX A;  5JMV A;  3GBT A;  4M7X A;  3WXJ A;  3A8Y A;  4BG8 A;  3DAW A;  3WEE B;  3K9J A;  5AQW A;  4BR2 A;  5B8H A;  3MCP A;  4NO7 A;  1SZ2 A;  2Q36 A;  3Q7B A;  5AQJ A;  3VER A;  5AR0 A;  1RDW X;  3N4Q A;  1RDU A;  3HZ6 A;  3I33 A;  5AQK A;  3VEW A;  3I56 N;  2PBD A;  2Q97 A;  5BPL A;  3D2E A;  1IG8 A;  4WQ4 C;  2P9L B;  4IDH A;  5FPN A;  1C0F A;  4EIA A;  4U67 L;  1IJJ A;  4EAH D;  1NGA A;  5JLF A;  1HPM A;  3E9L A;  4K25 A;  2YJF A;  4YDU C;  5H1S Q;  4JKH A;  3WEE A;  2J4R A;  4C1N I;  3O9T A;  1QVG M;  1HLU A;  3GE1 A;  4BRA A;  4GY2 B;  4J8F A;  4BRQ A;  2YCH A;  4K43 A;  3FZK A;  4R79 A;  3MX2 A;  3GG4 A;  1H1V A;  3WXI A;  2A40 A;  3CPE A;  2NZT A;  2H3G X;  4BE7 B;  4OPH A;  4IEE A;  2NRT A;  3KVG A;  3TTC A;  4YOY A;  3IUC A;  1R59 O;  3CQX A;  4B1W B;  3C7N B;  5BN9 A;  5AQN A;  2P9L A;  3LDN A;  3H1V X;  4ISG A;  5KPR A;  5EY4 A;  3H45 C;  3J8A A;  1Y64 A;  5M1Q A;  2KHO A;  3NVK A;  3MN6 A;  1BA0 A;  3MWP A;  3OHR A;  4H0O A;  4FWL A;  3GDQ A;  4I6M B;  5HOO A;  3DXK B;  4CI6 A;  4BGB A;  3ZET B;  5C10 A;  5M1F A;  4BG9 A;  4QS7 A;  4BC5 A;  4WCE L;  5BRF A;  1YJN N;  4JD2 A;  3E9O A;  3CET A;  3M5R A;  3HM8 A;  3CXC M;  4BEB A;  1VAZ A;  1BO5 O;  3UKR A;  4WQ5 A;  3VEV A;  5LY3 A;  4C1N K;  1KD1 O;  2VYP A;  2E2N A;  4BRN A;  2HBM A;  1TYQ B;  3ID6 A;  3O5B A;  5GAD P;  3SLC A;  3J7Z O;  1HUX A;  3SJH A;  1Q18 A;  3M1F A;  2P9S B;  4IOC L;  5AFU A;  4A5A A;  2OTJ N;  3MMV A;  2E2O A;  1VQ6 N;  3KK7 A;  3VGK A;  3A5N C;  4PKH A;  3UE5 A;  3DXK A;  4H03 B;  5MLC Q;  2RHK A;  3HBT A;  3ZET A;  5DM6 L;  2HST A;  4LC9 B;  3TSQ A;  5AZI B;  2CH6 A;  2IVP A;  3EE9 A;  3F2K A;  4BR4 A;  1BWF O;  4BR7 A;  3SAG A;  1YXQ A;  1GLD G;  3MN7 A;  3T69 A;  4WF9 L;  4NB4 A;  4WFA L;  1ZXO A;  3OW2 M;  4FWO A;  5AQQ A;  4BY9 C;  2QTD A;  4H0X B;  2P9N B;  1X3M A;  4IZ9 A;  1YIJ N;  3EL2 A;  1TYQ A;  2QWR A;  4BRL A;  3HRG A;  3VF4 A;  2ZGY A;  2E1Y A;  2I7P A;  1VQ8 N;  1T6D A;  4JKF A;  3FZF A;  3EZW A;  2BUP A;  3C0B A;  4GV3 A;  3R1X A;  1DT9 A;  2RE2 A;  3A5M C;  3M6G A;  3EKU A;  1K9M O;  3A5O C;  1S22 A;  1ZBS A;  4FO0 A;  1MDU B;  3HOT A;  1W97 L;  2FLO A;  3ZX0 A;  4XH5 A;  4CD3 A;  2V7Z A;  3LL3 A;  2WFB A;  5GIP A;  1SAZ A;  3QB0 A;  2NRW A;  5BR9 A;  4E1J A;  3CQY A;  2FSK A;  2Q31 A;  3KHY A;  2NNW A;  5TKW A;  2QWM A;  5GAG P;  3CCL N;  2P9N A;  2GEL A;  3B8A X;  3JXU A;  1EQY A;  3CJC A;  5GIN A;  3WUH A;  2WC9 A;  4H0Y B;  3FZM A;  4IWV A;  4CBW A;  5AFU H;  2A41 A;  2E2Q A;  3O9R A;  3CCJ N;  2KLA A;  3ULE B;  4K41 A;  2YHY A;  3TU5 A;  5KPZ A;  3OBY A;  2ZWH A;  4M7Y A;  4MDA A;  4PHT X;  1NJI O;  4GNI A;  3ATV A;  5KPT A;  4MLE A;  3D2E B;  5TKY A;  1N8R O;  4CD1 A;  5GAE P;  2Q0U A;  2W00 A;  3E1Y A;  5C0Y A;  5AQP A;  2E1Z A;  4AM7 A;  1NGH A;  4BRF A;  3VMF B;  3WQT A;  4BC4 A;  1YVN A;  2P9U B;  5AQF A;  5F1X A;  3CC2 N;  5FPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...