2P9KA

Crystal structure of bovine arp2/3 complex co-crystallized with atp and crosslinked with glutaraldehyde
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
411
structure length
393
Chain Sequence
GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKEMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
total genus 126
structure length 393
sequence length 411
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9kA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2p9kA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 2p9kA03
3O8MA 3WEEB 1QQOA 4CBWA 3EZWA 4BVPA 5AQLA 2QWMA 3EN9A 4KBOA 4IJNA 3VEZA 3IDHA 2YHYA 5AQSA 3IFRA 4JAXA 4CD1A 5AFUA 4A2BA 2VWBA 1C0FA 2D0PA 4FWKA 5FPMA 3QFUA 2ASPA 3FZFA 2P9NA 1QQNA 1EQYA 2FSNA 3WXJA 3ZEUA 4FOIA 3OHRA 2AP1A 3FZMA 3UKUB 2P9IA 4FWPA 5AQGA 3O6WA 4BRMA 2GELA 5FPDA 1QZ5A 3HZ6A 3HM8A 3W3DA 4YDUA 5E26A 2A41A 4BRGA 1BO5O 4B1UB 2ZWHA 4BRPA 5AQNA 4K25A 2IVNA 3LDNA 5EVZA 4JN4A 4BRLA 4H5WA 4XEIA 2ZGYA 3M1FA 2E8AA 1T44A 3S41A 1KAYA 2E1YA 5AQYA 5AZIA 5BN8A 2H3GX 3D2EA 4H0PA 4EAHD 3IUCA 3U4LA 3D7EO 3ZETA 2P9PA 4DQ8A 3AARA 3VEWA 2FXUA 4BRHA 2YJEA 2P9KB 1Z05A 3C7NB 1OKJA 3LL3A 3FFKB 5TKYA 1XQSC 5JICA 4QS9A 1BU6O 4H0OA 4CZHA 3O80A 4JHDA 2IVPA 4A2AA 3B8AX 4I6MA 3ENOA 4WYBA 3RSEA 2I7PA 4PL8A 5BRHA 4GNIA 3DXKB 3MN7A 3G25A 3WQUA 5JLFA 3MN9A 2FLOA 5BPNA 2YJFA 1S3XA 5BR9A 4O8KA 5KPRA 3EL2A 3ULEA 2QWOA 4WQ5C 2GWJA 3H45C 2P9UA 2Q2RA 2NZTA 4BC4A 1GLFO 3R9PA 4ISEA 4WQ4A 3BEXA 3JXUA 2D0OA 3O08A 4CZKA 3L6QA 3O1WA 5AQRA 3EO3A 2P9SB 5AQOA 1YUWA 3VEXA 4EFHA 3FZHA 3QICA 5JLHA 1DGKN 2A40A 3ATVA 1NGCA 3D2FB 2Q36A 1V4TA 2IVOA 4CZIA 4DB3A 2HMPA 5ELZA 4IO8A 3VERA 3WQTA 3VENA 2OANA 3CETA 4CBUA 1E4GT 3CJBA 3GE1A 2Q1NA 1Z6RA 5AQIA 2YCHA 3VPZA 3WEEA 4PKIA 4MO5A 1HUXA 2V7ZA 4FPBA 4BGBA 4EHTA 3WT0A 3IMXA 3UE5A 3L4IA 2CH5A 1Q18A 3WXKA 4H5TA 4H0VB 4JNEA 1U2VB 5BPMA 4HWIA 4XH5A 5AQFA 2GEMA 1GLDG 2DPNA 2E88A 3BP8A 1GLLO 3QB0A 5E84A 4FWQA 5LJVA 4B1WB 3CQYA 4IXCA 2CGLA 3HSCA 4H5RA 3SMPA 3ID8A 1G99A 2EWSA 3HBTA 3MMVA 3UKUA 5AQJA 2V51B 3VF6A 3CJCA 3R6MA 4PKHA 3WUHA 5AQHA 5AQUA 2UYTA 3SK3A 1HLUA 1TYQB 4FO0A 4BR0A 4H0TB 3DXMA 1T6CA 4H5NA 3A5NC 4FOEA 3VF2A 4DHYA 3AY9A 3UB5A 3H1QA 1NMDA 4BRFA 2YHWA 3BF3A 3FE1A 3FZKA 2D4WA 2ASOA 1QZ6A 4EIAA 1E4FT 4FSVA 5BN9A 3TU5A 2VCPA 1BG3A 2E2NA 1D4XA 5F0XA 1HKCA 5AQKA 3AAQA 2GWKA 2QWRA 4ISFA 1T6DA 2P9KA 4CZLA 4H0YB 3C7NA 1TUUA 1J6ZA 3FGUA 5AZJB 5LY3A 3LDPA 4H03B 2ITMA 4BG8A 5F2RA 1NGHA 3VESA 3GL1A 1MWMA 1ATSA 4NO7A 4Z94A 5BRDA 4BRDA 4CZMA 3AAPA 5AQMA 4BG9A 1HKGA 1NGBA 4FWMA 5AFUH 3H46O 4BC3A 4CZFA 5AQQA 5LJWA 4BRNA 3DXKA 3BF1A 4L3QA 1BWFO 2HOEA 3P4IA 3SMSA 4YDUC 4J8FA 3LDOA 3GDQA 3KZBA 4IWVA 2AA4A 3GBTA 1NGGA 2QXLA 2YI1A 3A5LC 1YXQA 4BR2A 2P9LB 2FSJA 1NGJA 4BR5A 4H5VA 2QWQA 1NM1A 4A62A 4RTFD 2P9SA 3ENHA 4CD3A 2Q97A 4FPAA 1LOTB 1JCGA 3M3ZA 3D2FA 3O4WA 3H3NO 2BTFA 5BRFA 3UKRB 3W0LA 1GLJO 1HX1A 3KHYA 5I9EB 2IIRA 5AQXA 1ZXOA 3GG4A 1LCUA 3RSEB 4O5FA 4FL9A 3ZX2A 2PAVA 2BUPA 2QWNA 3CQXA 4M7XA 4B1XB 2GUPA 4EHUA 5F1XA 4BRKA 1MDUB 4JD2B 1DEJA 1U2VA 1NGAA 1ATRA 2E2OA 1NGIA 1HPMA 5AQWA 4BR7A 4BQLA 4A61A 4CZEA 4MO4A 5KPTA 1QHAA 3QDKA 4PL7A 1NGFA 2Q0RA 4K41A 4CZGA 1X9JA 2PBDA 1Y64A 3A5OC 3CERA 4RCHA 4BREA 1JCFA 4LC9B 3MN5A 4XH1A 1ATNA 1X3NA 4IJAA 3HTVA 1YVNA 3A5MC 2VYPA 4WQ4C 2V7YA 3VF4A 3SJHA 3DWLA 3C0BA 2KHOA 1TYQA 3FLCO 4K43A 3DAWA 1BOTO 1U6ZA 3H3OB 4ISGA 4M7YA 4F9OA 4BRIA 3WXIA 1CZAN 4NB4A 1ZC6A 4HTLA 5KQDA 3GOIA 1K8KB 4BC2A 1X3MA 3CJAA 2W40A 3MN6A 1IJJA 1QQMA 2GTDA 3KVGA 1BA0A 4BR9A 3U8XA 4CI6A 5ADXA 1RDWX 5EX5A 3FR0A 4CBXA 4E1JA 2E2PA 1JCEA 2CGKA 2W41A 1P8ZA 3CJ9A 4MLHA 4B1VA 3H6EA 3VEYA 4FWNA 5AQVA 3LM9A 5AZJA 1RFQA 2A42A 3VETA 2CH6A 5B8HA 3MK6A 4RWTA 4AM7A 2J4RA 3BUZB 5EOYA 4XH4A 3TPQA 2NRHA 2ZF5O 2A5XA 2E20A 5AQPA 3LM2A 4BRQA 1NGDA 1NWKA 4BROA 1NGEA 3VGKA 2Q0UA 3DJCA 4IZ9A 3CI5A 4BQZA 2P9NB 4K42A 3ZEUB 4BGAA 1ZBSA 3DXMB 1IG8A 4Y0WA 3VOVA 2P9IB 4AM6A 3O1BA 1HJOA 1HKBA 1WOQA 2P9LA 3HI0A 5CE3A 3EKSA 4BRCA 2A3ZA 5BREA 3ZX3A 1DKGD 5EY4A 1R59O 1MWKA 3I33A 3LDLA 2CGJA 4WQ5A 1WUAA 1RGIA 2Q31A 3VGMA 1MA9B 1KAZA 3EKUA 4C23A 2F9WA 1YAGA 3CJ1A 3CHWA 3QFPA 5ADXH 4M63C 5AZIB 1BDGA 1SAZA 3U9DA 1ESVA 3D2EB 1V4SA 3ZETB 4DCHA 2P9PB 4MLEA 3M6GA 3ZX0A 3UKRA 3CIPA 1GLEG 4BC5A 3U9ZA 4BR4A 1S22A 2F9TA 4BVOA 2YHXA 3QBXA 2V52B 3A0IX 5AR0A 5FPNA 4FWSA 4B1ZA 3O5BA 5AQTA 1SZ2A 3CJ7A 4JHDB 3QBWA 2WUSA 3I8BA 3JS6A 4I6MB 3VEOA 1KXPA 4JD2A 1GLAG 5EXWA 4B9QA 1NBWA 3F9MA 3A8YA 2D1KA 4FWRA 3MDQA 1BUPA 3LDQA 4FWOA 5AQZA 4H0XB 1BA1A 2FF3B 2E1ZA 4PKGA 5BPLA 2NLXA 5KPZA 3R8EA 4BRAA 2ASMA 1NLVA 1GLBG 3VGLA 4CJ7A 1XUPO 1XC3A 2E2QA 2HF4A 2QM1A 3ULEB 1KAXA 3VEVA 2QW9A 1SQKA 1H1VA 1GLCG 3H1VX 4QS8A 3ATUA 5FPEA 2HF3A 2P9UB 3FZLA 3L0QA 4GY2B 1C0GA 1TUYA 2FSKA 2QWPA 3J8AA 3MCPA 2FF6A 5JMVA 2QWLA 2ZGZA 3WXLA 5KQ8A 3SLCA 4QS7A 3QMLA 4B1YB 4CZJA 2I7NA 1K8KA 4FWLA 2A6AA
chains in the Genus database with same CATH superfamily
3CCMN 1VQ7N 2G8HA 5K14A 4CBWA 1KFSA 3EN9A 3A2FA 3VEZA 1GOBA 4AQYK 3IDHA 5AQSA 2RN2A 2W6KA 4JAXA 5AFUA 2Z1GA 3EEQA 4OGCA 5JENA 5FDLA 1EETA 4FJGA 2OTLN 4H4MA 3AV9A 2WOMA 3PSFA 3WXJA 2HBLA 1BCMA 4FOIA 4FWPA 1S72N 3HZ6A 4BWJA 3SQ1A 3HVRA 2WTUA 1I94K 5KTQA 4BRGA 1SKWA 1BIUA 4CIEA 2GX9A 4I9LA 3K5OA 2BH1A 4JLHA 4JN4A 4XEIA 2ZGYA 4IFEA 3M1FA 3D45A 4AH9A 1KTQA 3S41A 3MXMA 2O8DA 5C2FA 4DU3A 1OVQA 3D2EA 3NH2A 2P9PA 5CYMA 1T03A 1N33K 3ALYA 1UOCA 1VQKN 4BRHA 4NXNK 2NRWA 3LL3A 3AA2A 5C12A 5J2NA 1JLGA 4J2AA 3OYHA 1XQSC 1P90A 4GVMA 1RTIA 4H0OA 4JHDA 1L3SA 4I6MA 4WYBA 2G8FA 2I7PA 4W5OA 3PSIA 1M90O 2KLAA 4GNIA 3DXKB 3MN7A 3G25A 2HVHA 5JLFA 1N5YA 5A2QO 1EWQA 5BR9A 1OH5A 4KHPK 3C94A 2Y1JA 3F9KA 3O3GA 4RW8A 2B6AA 3DI6A 5I42A 3EL2A 3ULEA 4FLUA 1S5JA 2I5JA 4WQ5C 2GWJA 3CYGA 3LDSA 4BC4A 1GLFO 3AO4A 2OZSA 4JI5K 3KK3A 2ZJQL 3BEXA 4AHVA 2D0OA 4DSFA 3ID6A 4ID1A 1YIJN 4DV3K 5AQOA 5J2QA 3RRGA 5GIPA 3OTOK 5C2DA 4EFHA 3V6DA 4NLBA 5I3UA 3FZHA 5JLHA 3DMJA 3J7ZO 3D2FB 3NF9A 2Q36A 1OVYA 4DB3A 2HMPA 3OS2A 2PFUA 1FKOA 1E3MA 2YCHA 4DTSA 2O8FB 5HRNA 4EHTA 2ATQA 3WT0A 3L2RA 1YJWN 1I3AA 3IMXA 4Z4HA 1HYSA 3SV3A 1Q18A 3ZSYA 2VQEK 4JNEA 3SUPA 4XH5A 3VQQA 3AVLA 2YNFA 2E88A 4DUZK 4CEDA 4IXCA 2O8BB 3QIPA 4H5RA 1HYZA 1S1VA 3G10A 3ZLJA 1YTUA 1RNHA 1NMNA 4PKHA 4DWIA 3K5NA 2ZM6K 4U7BA 1T6CA 3VF2A 3SNNA 3UB5A 1NMDA 4WE1A 2D4WA 4EIAA 4JKCA 1E4FT 4ZTJA 3AVHA 4B9UA 4CGGA 2VCPA 1KSPA 5F0XA 5AQKA 2NNWA 3V9XA 1CZ9A 3S3OA 3HK2A 2GWKA 4ISFA 1VRTA 3ZT1A 5AZJB 1JLEA 3L8BA 3LDPA 4JEPA 3SCXA 3AA4A 3VESA 1QVGM 4NO7A 2PYJA 3OS1A 5BRDA 4I2PA 4GMJB 3MCAB 1NGBA 5AFUH 3M8QA 5LMNK 4CJSA 4BC3A 1U48A 4X62K 2OA8A 4OLBA 3DXKA 2PYLA 2HOEA 5FROA 2FBTA 3QINA 2WC9A 3LDOA 3GDQA 3KZBA 4IWVA 1DTTA 1BHLA 1T7PA 3GBTA 4M41A 2YI1A 4FJ8A 2P9LB 4G1QA 3THXB 3DOLA 4BR5A 3OYCA 3NAEA 4H5VA 4R5PA 4YORA 3O3HA 4DSJA 2QWQA 3MECA 3RMDA 4A62A 3LZJA 3SJJA 4GV3A 3M5RA 3E9PA 5JVGL 3QEVA 3M3ZA 3D2FA 3O4WA 5BRFA 3UKRB 3W0LA 1GLJO 5HRPA 3EY1A 4PY5A 1RDCA 3RSEB 4O5FA 2VG7A 4FL9A 4QAGA 4FCYA 3LZIA 3TAGA 2BUPA 2QWNA 2O8FA 4DR1K 5C24A 2F7TA 3K2PA 3ZSQA 3AA3A 4B1XB 1HNWK 4RW9A 4EHUA 1N8RO 3NMUA 4JD2B 3NH0A 1Y97A 1RDAA 5LMUK 1NGAA 1ATRA 1O1WA 1YTAA 4RW6A 4DS4A 2HHWA 3C95A 4A61A 2FBVA 5KPTA 1QHAA 3QNNA 4PA1A 4JV5K 4PL7A 1NGFA 4K41A 2O8BA 3ZT2A 1EWRA 3LP1A 3CERA 4FLYA 4IJAA 2QKBA 3OYMA 3DWLA 3BGRA 4IOXA 3SAGA 3C0BA 1OH7A 2W00A 4K43A 4M42A 2EHGA 3H3OB 1U6ZA 3NVMA 5GIOA 4ISGA 4F9OA 3WXIA 4NB4A 3LP3A 1FJGK 3O9QA 3P39A 5FRMA 4HTLA 5KQDA 2W40A 3MN6A 1IJJA 2NUBA 3U8XA 4CI6A 4DFMA 3FR0A 4IOAL 4CGIA 2UUBK 3M8RA 2W41A 3ZCMA 1P8ZA 5AQVA 3LM9A 5AZJA 1TAUA 1SV5A 2X74A 2A42A 1Z25A 2UXBK 5B8HA 1HYVA 1TKXA 3MK6A 3BUZB 4XH4A 4CGDA 3KK7A 2NRHA 3SUOA 5C25A 5HLFA 2E20A 1QSLA 3CCLN 3LM2A 4BRQA 1NWKA 3V9UA 4FW2A 4IZ9A 2G8WA 2P9NB 1SS6A 2ZJRL 2JLEA 4FJHA 1XC9A 2BDPA 1W7AA 5GADP 4DUYK 3RRHA 4B3TK 4JKEA 4Y0WA 2E6LA 1J9AA 3VOVA 5J1EA 4BE7B 2HW3A 3O1BA 3E9OA 1HJOA 5SWMA 1WOQA 1HR0K 2P9LA 4KH5A 3CPEA 3THXA 2A3ZA 4IO9L 2Q31A 4YOWA 3VQCA 3OJUA 4FJ9A 1VK0A 3LPTA 3EKUA 3P5JA 3R1XA 4JRPA 1S9GA 3JSMA 4DF4A 1KLNA 3U9DA 2ITGA 5JS2A 4CERA 3ZX0A 3UKRA 3CIPA 1UA0A 2KTQA 3CFPA 4OX9K 4BR4A 2F9TA 4CJUA 2YHXA 2V52B 3Q7BA 5M1OA 4CE9A 3CJ7A 3TAFA 4HCCA 1KXPA 4IEIA 4JD2A 3OY9A 2UXDK 1WSHA 4FWRA 5AQZA 4H0XB 1BA1A 3CFRA 4PKGA 3R8EA 2ASMA 5GINA 4CJ7A 3LAMA 4KFBA 3QLHA 2QM1A 4KH4A 1KAXA 3VEVA 2QW9A 1SQKA 1H1VA 1L3UA 5DMRA 2P9UB 3HP6A 1HNIA 1VHXA 4DQQA 1C0GA 1C1BA 2QWPA 3J8AA 4NCAA 1NOZA 5KQ8A 2QWLA 1IBLK 2QK9A 4YOYA 3KKSA 1NK5A 4CJLA 1N32K 4C8KA 4DTJA 1CXUA 3C6UA 4EZ6A 3HOSA 4C8NA 2HHSA 1W97L 3O8MA 2Y1IA 3WEEB 2OPRA 4WFBL 3EZWA 4BVPA 5AQLA 2D0AA 4W5RA 3O3FA 4C8OA 3THVA 4FLZA 3IFRA 3MWPA 2D0PA 4FWKA 1IKXA 3VTIA 4BACA 3F5TA 4M45A 2P9NA 1QQNA 5HL7L 1Q8IA 3CMEN 3OHRA 2AP1A 5KRTA 2X6SA 3C65A 2GBZA 3HM8A 4FM2A 4YDUA 3VMFB 4DV1K 4LFBK 3LWLA 5HROA 2F96A 1C1AA 5M1KA 3SYZA 4M3ZA 2ZWHA 1REVA 4BRPA 5AQNA 1Q9YA 4CF8A 4DG1A 4O5BA 2E8AA 3TI0A 1T44A 1KAYA 4B3RK 1X9SA 4C8LA 1NK7A 4DLGA 4OGEA 3AVAA 4BDYA 2H3GX 4H0PA 2W42A 3U4LA 1ZYQA 3D7EO 2XY7A 1HNZK 4OPKA 2FXUA 3HPHA 2IGIA 2YJEA 1Z05A 4JRQA 1NU0A 4ZHRA 1RBVA 5TKYA 4QS9A 1BU6O 1RBRA 4CZHA 3QO9A 2ZJPL 4A2AA 1WAFA 3MEGA 4CEEA 2IS3A 3ENOA 3M8PA 2NRVA 2P5OA 1SL0A 2UU9K 4B9MA 3OYJA 3AVNA 5CY4A 4CJ5A 3V1RA 5CZ2A 3CCVN 1IBMK 1S3XA 4FJ7A 3AVIA 5DM7L 4ELTA 3SUQA 4Z4IA 1NKEA 2P9UA 2NZTA 3R9PA 4ISEA 1U04A 4KHUA 2R7YA 3JXUA 1YHQN 1YITN 3HVTA 4CZKA 3L6QA 2QA4N 3TAQA 3OYIA 4M3UA 2ZD1A 4BEBA 2YNHA 4CJQA 2A40A 3ATVA 1EKEA 4CJFA 1V4TA 3VQ4A 4CZIA 3AVMA 3TTDA 3VERA 4AHTA 2IOCA 4ILHA 3L2VA 2PZSA 4OJRA 1E4GT 3GE1A 3T1AA 5AQIA 3WEEA 4LF5K 4PKIA 1XNQK 1HUXA 4FPBA 4BGBA 3MX2A 4LF8K 2HHXA 1D9FA 4CJKA 4KV8A 3WXKA 4FYDA 1U2VB 5BPMA 2YHBA 1JLCA 3SPZA 1OH8A 1GLDG 4DV2K 5E84A 3BP8A 3AA5X 2Z1IA 2WONA 3HSCA 2RHKA 4JKBA 3G6EN 4AILC 4CJWA 1ZBIA 2PY5A 3SMPA 4CHOA 3CM5A 4EP5A 4CJ3A 2V51B 3B6OA 3CJCA 4U67L 1QQCA 1RDDA 5AQHA 1LWCA 1QTMA 4FO0A 4JI4K 4BR0A 4WFAL 4H0TB 3RTVA 4H5NA 4BECA 4FOEA 2WBNA 4B9LA 1LW2A 2YHWA 3BF3A 2ASOA 4FSVA 5BN9A 1Q81O 3DLKA 1YI2N 4Q0BA 5DM6L 4I9QA 2FBXA 2OPPA 4LF7K 3RR7A 3HOTA 3TSPA 4CF0A 2HHQA 3K5MA 1T6DA 1NJZA 3SAFA 5HRRA 3FGUA 4JI2K 1ASVA 4BG8A 3BDPA 1ATSA 1VSLA 4FJ5A 3HYFA 3AO1A 4BRDA 5AQMA 4BG9A 3QEXA 3CG7A 4JI8K 3CC2N 3SBTA 3TR8A 5LJWA 3AVBA 3P4IA 3SMSA 1BL3A 4DLEA 2Q3SA 2OCEA 1NGGA 2QXLA 4DU4A 1MU2A 3A5LC 3T69A 4HHTA 1T05A 4BR2A 2FSJA 2F4VK 3M8SA 4CEOA 2DTUA 4FZYA 3ZT0A 4EZ9A 3PLAA 4CEAA 2Q97A 4KI6A 1RT3A 1JLBA 4A57A 3NFAA 2RF2A 2FC0A 5I9EB 3ENBA 1XMQK 5AQXA 3OYNA 5CR4A 4W5NA 1ZXOA 4NCGA 1LCUA 3THWB 3KJVA 3E1YA 1GOAA 1SKSA 2PAVA 3QEIA 3N4PA 1JKHA 4M7XA 4CK1A 3BZKA 4O8UA 2DFHA 5F1XA 4DV0K 1YT3A 2KKZA 2G8UA 2XY5A 1DEJA 3ITHA 1U2VA 2E2OA 4CJPA 1HPMA 1RCHA 4MO4A 3QDKA 3LWMA 2Q0RA 2KZMA 2YV0X 2HNZA 1XHXA 4AF1A 4RCHA 3PX0A 3AVCA 4DU1A 1YVNA 3QERA 4WQ4C 1N36K 1LW0A 3QETA 3VQEA 4CESA 2P1JA 3C6TA 4J2BA 3DAWA 1RBUA 5GAEP 4E1MA 4BRIA 4IBNA 4FZZA 3CXCM 4Z0UA 3THYB 4HUGA 1SKRA 1Q86O 1ZC6A 3CJAA 4DR6K 1QQMA 1LWEA 4OKJA 1VSIA 1BA0A 3CCEN 2UXCK 3CCRN 1SUQA 2E2PA 1JCEA 3DOKA 3CJ9A 4MLHA 4B8AB 3D0PA 5HP1A 3S3MA 3H6EA 3T7ZA 1RFQA 3G4SN 3VETA 2CH6A 1WNSA 4RWTA 2J4RA 4C8MA 3OYDA 4CJ4A 1QSYA 4DQRA 3VQ5A 4FZXC 3CMAN 3MWTA 5AQPA 3ZYYX 1NGEA 4H4OA 2DFFA 3DJCA 1HRHA 1KRPA 1TAQA 1ZBSA 4YNQA 3DXMB 1IG8A 3V9WA 3HXMA 3LAKA 4AM6A 1NKCA 3IKMA 2VWKA 3WNFA 3VTHA 4O44A 1TGOA 1DKGD 5EY4A 3I33A 4WQ5A 3VGMA 1RGIA 4Z4EA 1BI4B 1MA9B 1K6YA 4JS5A 4ELVA 3CJ1A 5ADXH 4J2DA 2QTDA 4M63C 4F3TA 1BDGA 1S1TA 3VQ6A 4CFCA 5FLXO 4JI0K 1ESVA 4ICLA 2XO7A 3DLRA 1G15A 3ZETB 4JKDA 1YJNN 1TK8A 3M6GA 1VQON 4YOTA 1GLEG 4BC5A 1VSHA 3U9ZA 4PWDA 3FFIA 4MDAA 1NJWA 2O4IA 3A0IX 3CCUN 3CC4N 4FM0A 1HJRA 5FPNA 3EZ5A 3O5BA 5AQTA 3QBWA 2WUSA 5M1PA 3VEOA 4LSLA 3L4QA 1CZBA 1GLAG 1HQEA 4B9QA 1NBWA 5C0YA 3F9MA 3A8YA 2D1KA 3NGIA 3LDQA 3S9HA 2FF3B 1XNRK 3O9RA 3TTFA 4G9ZA 4DV7K 1NLVA 3B6PA 2P51A 3VGLA 3NCIA 3L2UA 3HPOA 1XC3A 2KFZA 2E2QA 2YX6A 2QXFA 4M3XA 3KLGA 3E9LA 1KLMA 4QS8A 3ATUA 5JVHL 4ILGB 4GY2B 1NK8A 3LP0A 4KKOA 2FF6A 5T7BA 3P83D 3WXLA 3KD1E 3SLCA 3C6AA 3THYA 4QS7A 3EYZA 3KK2A 1KVBA 3PUFA 4B08A 1KD1O 3HL8A 1CLQA 1NJXA 2HBKA 1NK0A 1IKWA 1DTQA 4QCLA 5FPMA 2A6AA 3U3YA 3U3GA 4AHRA 1Q9XA 4CGHA 1VQMN 3F73A 1C0TA 2QWMA 4KBOA 1EX4A 4F2SA 4A2BA 1ASWA 4K8XA 4N47A 3QEWA 5SZTA 4E89A 1TKZA 2ASPA 2VG6A 1LWFA 1EQYA 1SL1A 2UUAK 1U45A 1IH7A 4KHQA 1Z26A 3FZMA 3O6WA 4BRMA 5FPDA 3ZSVA 1QZ5A 4CJTA 3W3DA 3NF8A 5E26A 2A41A 4QOZB 4CF9A 2VQFK 4CEZA 1Q7YO 2IC3A 4B1UB 4IDKA 1EO1A 3VQ9A 4IOCL 4KREA 1ZBUA 4ID5A 4K25A 4E3SA 3LDNA 1O13A 1ZBFA 5EVZA 3OS0A 4FLVA 1BI4A 4H5WA 1WBBA 4IEEA 3HM9A 3CM6A 4CIFA 5AQYA 3TAMA 4A5BA 4EAHD 3IUCA 3ZETA 3V9ZA 3HSTB 4F3OA 3VEWA 1ILYA 1YF5L 3K0SA 4E7LA 3C7NB 1OKJA 1JJ2M 4TSXA 1TL3A 4Z4CA 1HNVA 3O80A 4F4KA 2KFNA 2B5JA 2E4LA 2IVPA 3ZSWA 3B8AX 3OYAA 3SQ4A 1RT4A 1S1WA 4UY8O 4DSIA 3RSEA 3PIPL 2ETJA 3V1QA 4PL8A 3SV4A 1RT2A 3TSQA 4YFUA 3DLHA 3WQUA 2EX3A 3D6RA 5BPNA 1JL1A 2YJFA 5KPRA 4M3WA 1D8YA 4LY7A 2QWOA 4LH4A 1BQNA 5C42A 1VSKA 4X66K 4FLTA 4CFAA 3O1WA 1S6QA 3OYGA 2P9SB 1YUWA 3VEXA 1KVAA 2XY8A 2DY4A 3QICA 4O4GA 3BY5A 4MQ3A 4KHNA 4FXDA 4CGFA 3WQTA 1WBDA 2OANA 5HRSA 3CCQN 1CXQA 4CBUA 3I56N 2Q1NA 3HRGA 3VPZA 4HTUA 2V7ZA 4KB0A 3VQDA 3TWHA 4JS4A 3UE5A 3L4IA 4CFDA 4H8KA 4A59A 3O9UA 3OVNA 4HUEA 4H5TA 3SQ0A 4CGJA 5AQFA 2ZE2A 2G8IA 2DPNA 3QB0A 3WNEA 4IFVA 1HNXK 1GOCA 3ID8A 1G99A 3AVKA 3HBTA 3QNOA 3MMVA 5EU7A 4A5AA 2YKMA 4KI4A 3VF6A 3R6MA 4FJKA 4B8CA 1BGXT 1JL2A 1HLUA 1TYQB 3SAHA 3DRPA 4PUOA 1K8AO 5J2MA 1RBTA 3H1QA 4JI6K 4BRFA 1U47A 1QZ6A 4WCEL 1RTDA 3E66A 3EE9A 3LANA 3ZT3A 2QWRA 3PO4A 4NCBA 4H0YB 3C7NA 1TUUA 1J6ZA 4RW4A 2ITMA 4H03B 1KVCA 4BE2A 3CPWM 4B9VA 3GL1A 4FJMA 4Z94A 4DR2K 4DTMA 4I2QA 4FWMA 4FK0A 3MEDA 3NGYA 3DLGA 2RPIA 2OYQA 5AQQA 4AHCA 4PQUA 4IG0A 3BF1A 4L3QA 1HQUA 1BWFO 4E19A 3NBPA 3J81O 2A1RA 4J8FA 4DR5K 2B4JA 4CF2A 3G0ZA 4BE0A 4I7FA 3KLFA 1YXQA 2C1GA 3RR8A 1IO2A 4FW1A 5CZ1A 1NGJA 1S1UA 1TKTA 1B9DA 1W0HA 1IV0A 4CEFA 3JYTA 2YNIA 4EP4A 3MEEA 5DK5A 3ZT4A 4RTFD 2P9SA 1DT9A 3ENHA 3T3FA 1RT6A 3N4QA 3CYMA 3O4NA 4FK4A 1JCGA 2LSNA 1C1CA 2BTFA 2GUIA 1J5EK 1HX1A 2IIRA 3L2WA 1WSFA 4CECA 3HT3A 1VQ5N 2P5GA 2NRZA 1TKDA 4FM1A 3AVJA 4DKWA 3AO3A 2GUPA 1L5UA 4BRKA 1TV6A 4KAZA 4KRFA 3P31A 3KIOA 1VQ8N 4R79A 1NGIA 2X6NA 5AQWA 4BR7A 4N76A 4DR3K 4CZEA 4CZGA 4KH6A 1X9JA 5CHIA 4BY9C 1Y64A 3KTQA 1IBKK 4BREA 1JCFA 3WNGA 2DFEA 3MN5A 4XH1A 2D5RA 1X3NA 3SZ2A 3HTVA 2XY6A 3VQ7A 3VF4A 2KHOA 2RE2A 1TYQA 3OA9A 5C10A 4JYAK 4N5SA 4DS5A 4DSLA 2F8TA 5HOOA 4ILJA 4M7YA 4OO1J 1RT7A 3KK1A 1CZAN 3T1YK 1UWBA 4DQSA 1K8KB 4WF9L 5BR8K 1XMOK 4BR9A 3RMAA 4LFAK 5ADXA 4OLAA 1RDWX 5EX5A 2KQ2A 5E41A 4E1JA 2JWKA 3VQ8A 2CGKA 4NLCA 4OPJA 3VEYA 3NF6A 4FWNA 4CIGA 4GKJK 4FVMA 4AM7A 2BGGA 1TL1A 3QIOA 2ZF5O 1WSEA 1L3TA 3CFOA 1NGDA 1QSSA 4BROA 3AVFA 3VGKA 1NJYA 4BQZA 1C0UA 4HVJA 4K42A 3ZEUB 3OJSA 4YOVA 2E5LK 2P9IB 4KTQA 4M3YA 3HJFA 3NVKA 3OW2M 5H1SQ 3HI0A 5C15A 5CE3A 3EKSA 1VQ4N 2FBYA 5BREA 3ZX3A 4F2RA 3LDLA 1ITGA 1M1KO 1L3VA 5KGWA 1NOYA 3C6HA 4FJNA 1YAGA 1R0AA 1QE1A 3QFPA 5AZIB 1WAJA 4CHZA 3MXIA 3K9KA 1LAVA 1V4SA 3CQ8A 4CVNE 4MLEA 4CK3A 1S22A 4HUFA 4DQIA 4BVOA 2QEXN 1QVFM 3ISNC 3VA3A 3RWUA 1JXBA 3AGKA 3I8DA 1SZ2A 3I8BA 4C1NI 1FK9A 4DTUA 4RW7A 3LPUA 4YHHK 5EXWA 3Q7CA 3ZSXA 4FK2A 2YNGA 1BUPA 4B9NA 2E1ZA 5BPLA 2NLXA 5KPZA 2HHUA 4BRAA 4BE1A 3VQBA 4FJJA 1GLBG 4OPHA 3DRRA 4FJIA 3PY8A 1BISA 1LAWA 1LV5A 2HF4A 1FXXA 4YY3K 3H1VX 4YOXA 3OYEA 4FLWA 1J54A 1KCFA 2BANA 2HF3A 1U49A 3JAMO 3FZLA 3OYLA 4DR4K 4CEQA 3AGRA 1KQSM 1JLQA 3IG1A 1TUYA 4KO0A 2FSKA 1JLAA 2X78A 4Z4FA 2OPQA 4GW6A 1U4BA 3MCPA 4K8ZA 4CJRA 5JMVA 2ZGZA 4DR7K 5GAGP 5FRNA 4CCHA 3QMLA 4B3SK 4CZJA 4N56A 3TAEA 2O4GA 4JKAA 1K8KA 4E7HA 3I0RA 1XWLA 3WXMB 4NYFA 1TVRA 3TAPA 4BDZA 4F8RA 4CHQA 5AJ3K 1QQOA 1N6QA 3LP2A 4NXMK 4IDHA 4IJNA 2YHYA 4CD1A 4FJLA 3V81A 2VWBA 1C0FA 5M1FA 3T1HK 4DMNA 4CF1A 2O8CB 3TSUA 3QFUA 3K59A 4CFBA 4LSNA 3FZFA 4KPYA 4YOUA 1FKPA 3K9JA 2FSNA 3NH1A 3ZEUA 3KLIA 4DFJA 3UKUB 2KZZA 2P9IA 5AQGA 2GELA 2E6MA 2O8EB 3OYFA 2RKIA 4GV6A 1BO5O 1Q82O 3K58A 3NHGA 2IVNA 4PHTX 3VA0A 3J80O 4BRLA 4N41A 3DM2A 1RBSA 2HVIA 4OPAA 2E1YA 5AZIA 2XRIA 5BN8A 4DTOA 4NYNA 4DQ8A 1WLJA 1EP4A 3AARA 3MX5A 4L8RB 1WSGA 3RVCA 2UUCK 2P9KB 2VG5A 2OPSA 3UIQA 3F2KA 1BCOA 1W2BM 3FFKB 1J53A 1F21A 2BE2A 5JICA 4B9SA 3IS9A 3VQAA 1BIZA 2HB5A 3OYKA 1S9EA 1OH6A 4XJXA 1VQ6N 3THWA 3OBWA 1WSIA 4KHYA 4LF4K 5CYQA 5BRHA 4BDPA 4JI1K 3MN9A 2FLOA 4GV9A 3P38A 4O8KA 3DYAA 1K9MO 1FW6A 5KGXA 1BQMA 4KTZA 3H45C 4KHSA 1C0MA 2Q2RA 1B92A 5GAHP 3I55N 4C1NK 4WQ4A 4E1NA 3O08A 1NNEA 5AQRA 4DTRA 3EO3A 2HMIA 4DTNA 5M1NA 1DGKN 1NGCA 4GVEA 2IVOA 5IWAK 5ELZA 4IO8A 4B3MK 3VENA 3VQPA 1A5XA 3CETA 5TKWA 3NGZA 5MLCQ 3CJBA 4X65K 5D3GA 1Z6RA 2GV9A 4MO5A 1XHZA 1VAZA 4JK9A 4LF6K 3TARA 3QEPA 2CH5A 4KTWA 5KI6A 4H0VB 4W5QA 2ZQBA 4HWIA 2O8CA 2C1IA 5LL6Z 2GEMA 4E72A 2YKNA 1GLLO 5LJVA 4FWQA 1S1XA 4Y1DA 4B1WB 3CQYA 1IKVA 2CGLA 2VWJA 1KC8O 3BZCA 3V9SA 2EWSA 5HBMA 3UKUA 5AQJA 1RDBA 5KRSA 2Z1JA 2O8EA 4E7KA 4E7JA 3WUHA 4CEBA 2G8VA 1ZBLA 1T8EA 2HHTA 5AQUA 2UYTA 3SK3A 3OBYA 3H08A 3DXMA 2AJQA 4JKHA 3A5NC 4DHYA 3AY9A 4CW7B 3FE1A 3FZKA 3AVGA 3SQ2A 1X9MA 1JXEA 2Z1HA 3SBGA 3TU5A 2QI2A 1BG3A 2E2NA 4FLXA 1D4XA 2HHIA 1HKCA 3VN5A 3MAQA 3AAQA 1NKBA 4CHPA 3DLBA 1QS4A 1VSJA 2IDOA 3IAYA 2P9KA 4CZLA 1VQ9N 3KWIA 4DSEA 1RT1A 5LY3A 3AO2A 4OKEA 5F2RA 1NGHA 4KB1A 1A5WA 1UAXA 3DLEA 1MWMA 4JKGB 4AHUA 2HHHK 1D5AA 4CZMA 3AAPA 4LH5A 1HKGA 3MXJA 3H46O 4IFYA 4OKKA 1VQPN 1TK0A 4CZFA 3OYBA 5J2PA 4BRNA 1JLFA 3ULDA 4K0KK 3KLHA 3KKRA 3L2QA 5IT9O 3KLEA 4YDUC 1RDUA 1NK4A 1VSDA 3CCJN 2QKKA 2AA4A 4O0JA 4RG8A 1KFDA 1VQNN 3L3UA 3RMCA 2OZMA 1HPZA 4DV4K 1ZBHA 1TK5A 1VSFA 3O9SA 1WSJA 1W9HA 1NM1A 2A1SA 3PIOL 3I0SA 2HNYA 4JK7A 2JGUA 3R3LA 4V19S 4CD3A 4UQGA 4KHWA 1ASUA 4W5TA 4FPAA 1LOTB 1NK6A 3CCSN 3V1OA 3K5LA 3H3NO 1X9WA 4JI3K 4DTPA 3KHYA 2D0BA 3GG4A 1S6PA 4E7IA 3ZX2A 4DSKA 4DTXA 3CQXA 2HSTA 2NRXA 3P1GA 1WN7A 2HHVA 1MDUB 4Z4GA 1I39A 4IG3A 3KWGA 4BWMA 3DRSA 1VSMA 3SI6A 4BQLA 1YJ9N 1C6VA 3WNHA 3G71N 2PBDA 4JKFA 3A5OC 4AHSA 3ZSRA 3CD6N 3LALA 4LC9B 1ATNA 4B3OA 4LFCK 1EXQA 3A5MC 2XHBA 2VYPA 2V7YA 1T3VA 1YVUA 3SJHA 3HPGA 3FLCO 1BOTO 2HNDA 1XI1A 4MFBA 1DLOA 4M3RA 4ELUA 1IKYA 1NK9A 3EE8A 3RMBA 4E0DA 3L3VA 3ZSZA 3ZSOA 3NE6A 3GOIA 4BC2A 1X3MA 2GTDA 4CJEA 4CJVA 3KVGA 1N34K 1X1PA 1A5VA 4XIUA 1QHTA 2YHAA 4CBXA 4Q5VA 3DLLL 4Y1CA 4B1VA 4B9TA 3J7AP 3T19A 3S3NA 4JKGA 5EOYA 3TPQA 2A5XA 5JS1A 3QESA 4O0IA 3K57A 2Q0UA 3PX6A 3CI5A 4DQPA 4J2EA 4BGAA 3NDKA 2WFBA 4CHYA 3HP9A 3ASMA 1HKBA 4OVLA 2D0CA 4BRCA 3PV8A 1R59O 1MWKA 2CGJA 1WUAA 3E01A 2G8KA 1NJIO 2HBMA 3O9TA 1KAZA 4C23A 1IG9A 2F9WA 3V4IA 3CHWA 1D9DA 4FJXA 2O8DB 1SAZA 3D2EB 1HMVA 4DCHA 4MDBA 3S5TA 2P9PB 4DFKA 1K73O 4JI7K 1RTHA 3CC7N 4DV6K 4ZTFA 3QBXA 3IRXA 4O55A 5AR0A 4FWSA 4B1ZA 4CK2A 2OTJN 4JHDB 2HBJA 2W6LA 3JS6A 4I6MB 2IAJA 2F8SA 2KW4A 4DF8A 1RT5A 3KD5E 4GKKK 3MDQA 4DFPA 3NF7A 4FWOA 3PX4A 3U6FA 1RILA 4CHNA 5M1QA 4IKFA 1WB9A 1UA1A 1J5OA 1VQLN 2NRRA 1XUPO 3SUNA 3SPYA 3PO5A 3J7YP 2NRTA 2VGMA 3ULEB 3TABA 1B9FA 1GLCG 5FPEA 4LF9K 1SL2A 1RTJA 3HO1A 3O4QA 4LD0A 3L0QA 3TTCA 4HCBA 1NG9A 3CF5L 3TANA 2JWLA 1VRUA 4JK8A 4FVUA 4B1YB 2I7NA 4M3TA 4X64K 4WFNL 4FWLA 4DV5K 3AO5A 2VGNA 1VSEA
chains in the Genus database with same CATH topology
3CCMN 3HOSA 1VQ7N 1W97L 3O8MA 3WEEB 4WFBL 1QQOA 4CBWA 3EZWA 1VQMN 4BVPA 5AQLA 4IDHA 2QWMA 3EN9A 4KBOA 4IJNA 3VEZA 3IDHA 2YHYA 5AQSA 3IFRA 4JAXA 4CD1A 5AFUA 4A2BA 2VWBA 1C0FA 5M1FA 3MWPA 2D0PA 4FWKA 5FPMA 3VTIA 3TSUA 3QFUA 2ASPA 3FZFA 4YOUA 3F5TA 3K9JA 2OTLN 2P9NA 1QQNA 1EQYA 2FSNA 5HL7L 3CMEN 3WXJA 2HBLA 3ZEUA 4FOIA 3OHRA 2AP1A 3FZMA 3UKUB 2P9IA 4FWPA 5AQGA 3O6WA 3C65A 2GELA 4BRMA 5FPDA 1QZ5A 3HZ6A 3HM8A 3W3DA 1S72N 4YDUA 5E26A 2A41A 3VMFB 4BRGA 4GV6A 1Q7YO 1BO5O 4B1UB 5M1KA 2GX9A 1EO1A 2ZWHA 4IOCL 1Q82O 4BRPA 5AQNA 4K25A 2BH1A 1O13A 2IVNA 3LDNA 5EVZA 4JN4A 4PHTX 4BRLA 4H5WA 4XEIA 2ZGYA 4IFEA 3M1FA 4IEEA 2E8AA 1T44A 3S41A 1KAYA 2E1YA 4OPAA 5AQYA 5AZIA 5C2FA 5BN8A 4A5BA 2H3GX 3D2EA 4H0PA 4EAHD 3IUCA 3U4LA 3D7EO 3ZETA 2P9PA 4DQ8A 3AARA 3MX5A 3VEWA 2FXUA 1YF5L 1VQKN 1ILYA 4BRHA 3RVCA 2YJEA 2P9KB 1Z05A 2NRWA 3C7NB 1OKJA 3LL3A 3F2KA 1W2BM 5C12A 3FFKB 1JJ2M 5TKYA 1XQSC 5JICA 1P90A 1BU6O 4QS9A 4H0OA 4CZHA 3O80A 4JHDA 2ZJPL 2IVPA 4A2AA 3B8AX 4I6MA 3ENOA 4WYBA 4UY8O 4XJXA 1VQ6N 3RSEA 2NRVA 3OBWA 3PIPL 2I7PA 1M90O 2KLAA 4PL8A 5BRHA 4GNIA 3TSQA 3DXKB 3MN7A 3G25A 3WQUA 5JLFA 4GV9A 3MN9A 2FLOA 3D6RA 3CCVN 5BPNA 2YJFA 3P38A 1S3XA 5BR9A 4O8KA 1K9MO 5KPRA 3EL2A 3ULEA 5DM7L 2QWOA 4WQ5C 2GWJA 3H45C 2P9UA 2Q2RA 2NZTA 4BC4A 1GLFO 3R9PA 5GAHP 3I55N 4ISEA 4C1NK 4WQ4A 2ZJQL 3BEXA 1YHQN 3JXUA 2D0OA 1YITN 3O08A 4CZKA 3L6QA 3ID6A 3O1WA 5AQRA 2QA4N 3EO3A 2P9SB 1YIJN 5AQOA 1YUWA 3VEXA 4BEBA 5M1NA 5GIPA 5C2DA 4EFHA 4NLBA 3FZHA 3QICA 5JLHA 1DGKN 3J7ZO 2A40A 3ATVA 1NGCA 3D2FB 2Q36A 1V4TA 4GVEA 2IVOA 1OVYA 3TTDA 4CZIA 4DB3A 2HMPA 5ELZA 4IO8A 3VERA 3WQTA 3VENA 2OANA 4ILHA 2PFUA 3CCQN 3CETA 5TKWA 1E4GT 4CBUA 5MLCQ 3CJBA 3GE1A 3I56N 2Q1NA 1Z6RA 3HRGA 5AQIA 2YCHA 3VPZA 3WEEA 4PKIA 4MO5A 1HUXA 2V7ZA 4FPBA 4BGBA 1VAZA 4JK9A 4EHTA 3MX2A 3WT0A 1YJWN 3IMXA 3UE5A 3L4IA 2CH5A 1Q18A 4A59A 3WXKA 3O9UA 4H5TA 4H0VB 4JNEA 1U2VB 5BPMA 4HWIA 2C1IA 4XH5A 5AQFA 2GEMA 1GLDG 2DPNA 2E88A 3BP8A 1GLLO 3QB0A 5E84A 4FWQA 5LJVA 4B1WB 3CQYA 4IXCA 2CGLA 3HSCA 2RHKA 4H5RA 4JKBA 3G6EN 3SMPA 3ID8A 1G99A 2EWSA 3HBTA 1KC8O 3MMVA 3UKUA 4A5AA 5AQJA 2V51B 3VF6A 3CJCA 3R6MA 4PKHA 3WUHA 4U67L 5AQHA 5AQUA 2UYTA 3SK3A 1HLUA 1TYQB 3OBYA 4FO0A 3SAHA 4U7BA 4BR0A 4WFAL 4H0TB 3DXMA 1K8AO 1T6CA 4H5NA 3A5NC 4JKHA 4FOEA 2WBNA 3VF2A 4DHYA 4BECA 3AY9A 3UB5A 3H1QA 1NMDA 4BRFA 2YHWA 3BF3A 3FE1A 3FZKA 2D4WA 2ASOA 1QZ6A 4JKCA 4EIAA 1E4FT 4FSVA 5BN9A 4WCEL 1Q81O 3SBGA 1YI2N 3TU5A 2QI2A 3E66A 2VCPA 1BG3A 5DM6L 2E2NA 1D4XA 5F0XA 3EE9A 1HKCA 5AQKA 2NNWA 3AAQA 3HOTA 3TSPA 2GWKA 2QWRA 4ISFA 1T6DA 2P9KA 4CZLA 4H0YB 3KWIA 1VQ9N 3C7NA 1TUUA 3SAFA 1J6ZA 3FGUA 5AZJB 5LY3A 3LDPA 4H03B 4JEPA 2ITMA 4BG8A 5F2RA 3CPWM 1NGHA 3VESA 1QVGM 3GL1A 1MWMA 1ATSA 4JKGB 4NO7A 4Z94A 5BRDA 4BRDA 4CZMA 3AAPA 5AQMA 4BG9A 3MCAB 1HKGA 1NGBA 4FWMA 5AFUH 3H46O 3CC2N 3SBTA 1VQPN 4BC3A 4CZFA 5AQQA 5LJWA 4BRNA 3DXKA 3BF1A 4L3QA 1BWFO 2HOEA 3P4IA 3SMSA 4YDUC 1RDUA 2WC9A 4J8FA 3LDOA 3GDQA 3CCJN 3KZBA 4IWVA 2AA4A 3GBTA 1NGGA 2QXLA 2YI1A 3A5LC 3T69A 1VQNN 2C1GA 1YXQA 4BR2A 2P9LB 2FSJA 1NGJA 4BR5A 3O9SA 4H5VA 4YORA 2QWQA 1NM1A 4A62A 3PIOL 3PLAA 4RTFD 2P9SA 4JK7A 1DT9A 3ENHA 4GV3A 3R3LA 3M5RA 4CD3A 2Q97A 3N4QA 3E9PA 5JVGL 4FPAA 1LOTB 1JCGA 3CCSN 3M3ZA 3D2FA 3O4WA 3H3NO 4A57A 2BTFA 5BRFA 3UKRB 3W0LA 1GLJO 1HX1A 3KHYA 5I9EB 3ENBA 2IIRA 5AQXA 5CR4A 1ZXOA 3GG4A 1VQ5N 1LCUA 3RSEB 4O5FA 2NRZA 4FL9A 3E1YA 3ZX2A 2PAVA 2BUPA 2QWNA 4DKWA 3CQXA 2HSTA 3N4PA 2F7TA 2NRXA 4M7XA 4B1XB 4O8UA 2GUPA 4EHUA 1N8RO 3NMUA 5F1XA 4BRKA 1MDUB 4JD2B 2KKZA 3KWGA 3P31A 1DEJA 1U2VA 1NGAA 1ATRA 2E2OA 4R79A 1NGIA 1VQ8N 1HPMA 5AQWA 4BR7A 4BQLA 1YJ9N 4A61A 4CZEA 4MO4A 5KPTA 1QHAA 3QDKA 4PL7A 1NGFA 2Q0RA 4K41A 4CZGA 4KH6A 1X9JA 5CHIA 3G71N 4BY9C 2PBDA 1Y64A 4JKFA 3A5OC 3CERA 4AF1A 4RCHA 4BREA 1JCFA 3CD6N 4LC9B 3MN5A 4XH1A 1ATNA 1X3NA 4IJAA 3HTVA 1YVNA 3A5MC 2VYPA 4WQ4C 2V7YA 1T3VA 3VF4A 3SJHA 3DWLA 4IOXA 3SAGA 3C0BA 2KHOA 2W00A 2RE2A 1TYQA 3FLCO 3OA9A 4K43A 3DAWA 5C10A 1BOTO 1U6ZA 3H3OB 3NVMA 5GIOA 4ISGA 5HOOA 5GAEP 4ILJA 4M7YA 4OO1J 4F9OA 4BRIA 3WXIA 1CZAN 3CXCM 3EE8A 4NB4A 1Q86O 3O9QA 3P39A 1ZC6A 4HTLA 5KQDA 3GOIA 1K8KB 4BC2A 1X3MA 4WF9L 3CJAA 2W40A 3MN6A 1IJJA 1QQMA 2GTDA 3KVGA 1BA0A 4BR9A 3U8XA 3CCEN 4CI6A 5ADXA 1RDWX 5EX5A 3FR0A 4IOAL 4CBXA 3CCRN 4E1JA 2E2PA 2JWKA 1JCEA 2CGKA 2W41A 3DLLL 4NLCA 1P8ZA 3CJ9A 4MLHA 4B1VA 3H6EA 3VEYA 4FWNA 3T7ZA 5AQVA 3LM9A 5AZJA 1RFQA 2A42A 3G4SN 3VETA 2CH6A 5B8HA 3MK6A 4RWTA 4AM7A 4JKGA 2J4RA 3BUZB 5EOYA 4XH4A 3TPQA 3KK7A 2NRHA 2ZF5O 2A5XA 2E20A 3CMAN 3MWTA 3CCLN 5AQPA 3LM2A 3ZYYX 4BRQA 1NGDA 1NWKA 4BROA 1NGEA 3VGKA 2Q0UA 3DJCA 4IZ9A 3CI5A 4BQZA 2P9NB 1SS6A 2ZJRL 4K42A 3ZEUB 4BGAA 1ZBSA 2WFBA 5GADP 3DXMB 1IG8A 4JKEA 4Y0WA 3VOVA 4YOVA 2P9IB 4BE7B 4AM6A 3O1BA 3E9OA 3NVKA 1HJOA 3IKMA 3OW2M 1HKBA 3VTHA 1WOQA 5H1SQ 2P9LA 3HI0A 4KH5A 5C15A 5CE3A 3CPEA 3EKSA 4BRCA 2A3ZA 4IO9L 1VQ4N 5BREA 3ZX3A 1DKGD 5EY4A 1R59O 1MWKA 3I33A 3LDLA 2CGJA 4WQ5A 1WUAA 1RGIA 2Q31A 3VGMA 4YOWA 1NJIO 1M1KO 2HBMA 1MA9B 3O9TA 1KAZA 3EKUA 4C23A 2F9WA 3C6HA 3R1XA 1YAGA 3CJ1A 3CHWA 3QFPA 5ADXH 2QTDA 4M63C 5AZIB 1BDGA 1SAZA 3K9KA 3U9DA 1ESVA 3D2EB 1V4SA 3ZETB 4MDBA 4DCHA 4JKDA 2P9PB 1YJNN 4MLEA 3M6GA 3ZX0A 1K73O 3UKRA 1VQON 4YOTA 3CIPA 1GLEG 4BC5A 3CC7N 3U9ZA 4BR4A 1S22A 2F9TA 4MDAA 4BVOA 2YHXA 3QBXA 2QEXN 1QVFM 2V52B 3A0IX 3CCUN 5AR0A 3CC4N 3Q7BA 5FPNA 4FWSA 5M1OA 4B1ZA 3O5BA 5AQTA 2OTJN 3AGKA 1SZ2A 3CJ7A 4JHDB 3QBWA 2WUSA 2HBJA 3I8BA 3JS6A 5M1PA 4C1NI 4I6MB 3VEOA 1KXPA 4IEIA 4JD2A 3L4QA 1GLAG 5EXWA 4B9QA 1NBWA 3Q7CA 5C0YA 3F9MA 3A8YA 2D1KA 4FWRA 3MDQA 1BUPA 3LDQA 4FWOA 5AQZA 4H0XB 1BA1A 2FF3B 2E1ZA 4PKGA 5BPLA 3O9RA 2NLXA 5KPZA 3TTFA 3R8EA 4BRAA 4G9ZA 2ASMA 1NLVA 5M1QA 1GLBG 4OPHA 3VGLA 5GINA 4CJ7A 1VQLN 2NRRA 1XUPO 1XC3A 2E2QA 2YX6A 2HF4A 2QM1A 2NRTA 2VGMA 4KH4A 1KAXA 3ULEB 2QW9A 1SQKA 1H1VA 3VEVA 1GLCG 3E9LA 3H1VX 3ATUA 4QS8A 5FPEA 4YOXA 2HF3A 2P9UB 5JVHL 3FZLA 3AGRA 4ILGB 3L0QA 1KQSM 4GY2B 1C0GA 1TUYA 2FSKA 2QWPA 3J8AA 3TTCA 3MCPA 2FF6A 5JMVA 2QWLA 2ZGZA 3WXLA 5KQ8A 3CF5L 3SLCA 3C6AA 5GAGP 4QS7A 2JWLA 4YOYA 3QMLA 4JK8A 4FVUA 4B1YB 4CZJA 2I7NA 4JKAA 1KD1O 1K8KA 4WFNL 4FWLA 2HBKA 3WXMB 2VGNA 2A6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O8M A;  3WEE B;  1QQO A;  4CBW A;  3EZW A;  4BVP A;  5AQL A;  2QWM A;  3EN9 A;  4KBO A;  4IJN A;  3VEZ A;  3IDH A;  2YHY A;  5AQS A;  3IFR A;  4JAX A;  4CD1 A;  5AFU A;  4A2B A;  2VWB A;  1C0F A;  2D0P A;  4FWK A;  5FPM A;  3QFU A;  2ASP A;  3FZF A;  2P9N A;  1QQN A;  1EQY A;  2FSN A;  3WXJ A;  3ZEU A;  4FOI A;  3OHR A;  2AP1 A;  3FZM A;  3UKU B;  2P9I A;  4FWP A;  5AQG A;  3O6W A;  4BRM A;  2GEL A;  5FPD A;  1QZ5 A;  3HZ6 A;  3HM8 A;  3W3D A;  4YDU A;  5E26 A;  2A41 A;  4BRG A;  1BO5 O;  4B1U B;  2ZWH A;  4BRP A;  5AQN A;  4K25 A;  2IVN A;  3LDN A;  5EVZ A;  4JN4 A;  4BRL A;  4H5W A;  4XEI A;  2ZGY A;  3M1F A;  2E8A A;  1T44 A;  3S41 A;  1KAY A;  2E1Y A;  5AQY A;  5AZI A;  5BN8 A;  2H3G X;  3D2E A;  4H0P A;  4EAH D;  3IUC A;  3U4L A;  3D7E O;  3ZET A;  2P9P A;  4DQ8 A;  3AAR A;  3VEW A;  2FXU A;  4BRH A;  2YJE A;  2P9K B;  1Z05 A;  3C7N B;  1OKJ A;  3LL3 A;  3FFK B;  5TKY A;  1XQS C;  5JIC A;  4QS9 A;  1BU6 O;  4H0O A;  4CZH A;  3O80 A;  4JHD A;  2IVP A;  4A2A A;  3B8A X;  4I6M A;  3ENO A;  4WYB A;  3RSE A;  2I7P A;  4PL8 A;  5BRH A;  4GNI A;  3DXK B;  3MN7 A;  3G25 A;  3WQU A;  5JLF A;  3MN9 A;  2FLO A;  5BPN A;  2YJF A;  1S3X A;  5BR9 A;  4O8K A;  5KPR A;  3EL2 A;  3ULE A;  2QWO A;  4WQ5 C;  2GWJ A;  3H45 C;  2P9U A;  2Q2R A;  2NZT A;  4BC4 A;  1GLF O;  3R9P A;  4ISE A;  4WQ4 A;  3BEX A;  3JXU A;  2D0O A;  3O08 A;  4CZK A;  3L6Q A;  3O1W A;  5AQR A;  3EO3 A;  2P9S B;  5AQO A;  1YUW A;  3VEX A;  4EFH A;  3FZH A;  3QIC A;  5JLH A;  1DGK N;  2A40 A;  3ATV A;  1NGC A;  3D2F B;  2Q36 A;  1V4T A;  2IVO A;  4CZI A;  4DB3 A;  2HMP A;  5ELZ A;  4IO8 A;  3VER A;  3WQT A;  3VEN A;  2OAN A;  3CET A;  4CBU A;  1E4G T;  3CJB A;  3GE1 A;  2Q1N A;  1Z6R A;  5AQI A;  2YCH A;  3VPZ A;  3WEE A;  4PKI A;  4MO5 A;  1HUX A;  2V7Z A;  4FPB A;  4BGB A;  4EHT A;  3WT0 A;  3IMX A;  3UE5 A;  3L4I A;  2CH5 A;  1Q18 A;  3WXK A;  4H5T A;  4H0V B;  4JNE A;  1U2V B;  5BPM A;  4HWI A;  4XH5 A;  5AQF A;  2GEM A;  1GLD G;  2DPN A;  2E88 A;  3BP8 A;  1GLL O;  3QB0 A;  5E84 A;  4FWQ A;  5LJV A;  4B1W B;  3CQY A;  4IXC A;  2CGL A;  3HSC A;  4H5R A;  3SMP A;  3ID8 A;  1G99 A;  2EWS A;  3HBT A;  3MMV A;  3UKU A;  5AQJ A;  2V51 B;  3VF6 A;  3CJC A;  3R6M A;  4PKH A;  3WUH A;  5AQH A;  5AQU A;  2UYT A;  3SK3 A;  1HLU A;  1TYQ B;  4FO0 A;  4BR0 A;  4H0T B;  3DXM A;  1T6C A;  4H5N A;  3A5N C;  4FOE A;  3VF2 A;  4DHY A;  3AY9 A;  3UB5 A;  3H1Q A;  1NMD A;  4BRF A;  2YHW A;  3BF3 A;  3FE1 A;  3FZK A;  2D4W A;  2ASO A;  1QZ6 A;  4EIA A;  1E4F T;  4FSV A;  5BN9 A;  3TU5 A;  2VCP A;  1BG3 A;  2E2N A;  1D4X A;  5F0X A;  1HKC A;  5AQK A;  3AAQ A;  2GWK A;  2QWR A;  4ISF A;  1T6D A;  2P9K A;  4CZL A;  4H0Y B;  3C7N A;  1TUU A;  1J6Z A;  3FGU A;  5AZJ B;  5LY3 A;  3LDP A;  4H03 B;  2ITM A;  4BG8 A;  5F2R A;  1NGH A;  3VES A;  3GL1 A;  1MWM A;  1ATS A;  4NO7 A;  4Z94 A;  5BRD A;  4BRD A;  4CZM A;  3AAP A;  5AQM A;  4BG9 A;  1HKG A;  1NGB A;  4FWM A;  5AFU H;  3H46 O;  4BC3 A;  4CZF A;  5AQQ A;  5LJW A;  4BRN A;  3DXK A;  3BF1 A;  4L3Q A;  1BWF O;  2HOE A;  3P4I A;  3SMS A;  4YDU C;  4J8F A;  3LDO A;  3GDQ A;  3KZB A;  4IWV A;  2AA4 A;  3GBT A;  1NGG A;  2QXL A;  2YI1 A;  3A5L C;  1YXQ A;  4BR2 A;  2P9L B;  2FSJ A;  1NGJ A;  4BR5 A;  4H5V A;  2QWQ A;  1NM1 A;  4A62 A;  4RTF D;  2P9S A;  3ENH A;  4CD3 A;  2Q97 A;  4FPA A;  1LOT B;  1JCG A;  3M3Z A;  3D2F A;  3O4W A;  3H3N O;  2BTF A;  5BRF A;  3UKR B;  3W0L A;  1GLJ O;  1HX1 A;  3KHY A;  5I9E B;  2IIR A;  5AQX A;  1ZXO A;  3GG4 A;  1LCU A;  3RSE B;  4O5F A;  4FL9 A;  3ZX2 A;  2PAV A;  2BUP A;  2QWN A;  3CQX A;  4M7X A;  4B1X B;  2GUP A;  4EHU A;  5F1X A;  4BRK A;  1MDU B;  4JD2 B;  1DEJ A;  1U2V A;  1NGA A;  1ATR A;  2E2O A;  1NGI A;  1HPM A;  5AQW A;  4BR7 A;  4BQL A;  4A61 A;  4CZE A;  4MO4 A;  5KPT A;  1QHA A;  3QDK A;  4PL7 A;  1NGF A;  2Q0R A;  4K41 A;  4CZG A;  1X9J A;  2PBD A;  1Y64 A;  3A5O C;  3CER A;  4RCH A;  4BRE A;  1JCF A;  4LC9 B;  3MN5 A;  4XH1 A;  1ATN A;  1X3N A;  4IJA A;  3HTV A;  1YVN A;  3A5M C;  2VYP A;  4WQ4 C;  2V7Y A;  3VF4 A;  3SJH A;  3DWL A;  3C0B A;  2KHO A;  1TYQ A;  3FLC O;  4K43 A;  3DAW A;  1BOT O;  1U6Z A;  3H3O B;  4ISG A;  4M7Y A;  4F9O A;  4BRI A;  3WXI A;  1CZA N;  4NB4 A;  1ZC6 A;  4HTL A;  5KQD A;  3GOI A;  1K8K B;  4BC2 A;  1X3M A;  3CJA A;  2W40 A;  3MN6 A;  1IJJ A;  1QQM A;  2GTD A;  3KVG A;  1BA0 A;  4BR9 A;  3U8X A;  4CI6 A;  5ADX A;  1RDW X;  5EX5 A;  3FR0 A;  4CBX A;  4E1J A;  2E2P A;  1JCE A;  2CGK A;  2W41 A;  1P8Z A;  3CJ9 A;  4MLH A;  4B1V A;  3H6E A;  3VEY A;  4FWN A;  5AQV A;  3LM9 A;  5AZJ A;  1RFQ A;  2A42 A;  3VET A;  2CH6 A;  5B8H A;  3MK6 A;  4RWT A;  4AM7 A;  2J4R A;  3BUZ B;  5EOY A;  4XH4 A;  3TPQ A;  2NRH A;  2ZF5 O;  2A5X A;  2E20 A;  5AQP A;  3LM2 A;  4BRQ A;  1NGD A;  1NWK A;  4BRO A;  1NGE A;  3VGK A;  2Q0U A;  3DJC A;  4IZ9 A;  3CI5 A;  4BQZ A;  2P9N B;  4K42 A;  3ZEU B;  4BGA A;  1ZBS A;  3DXM B;  1IG8 A;  4Y0W A;  3VOV A;  2P9I B;  4AM6 A;  3O1B A;  1HJO A;  1HKB A;  1WOQ A;  2P9L A;  3HI0 A;  5CE3 A;  3EKS A;  4BRC A;  2A3Z A;  5BRE A;  3ZX3 A;  1DKG D;  5EY4 A;  1R59 O;  1MWK A;  3I33 A;  3LDL A;  2CGJ A;  4WQ5 A;  1WUA A;  1RGI A;  2Q31 A;  3VGM A;  1MA9 B;  1KAZ A;  3EKU A;  4C23 A;  2F9W A;  1YAG A;  3CJ1 A;  3CHW A;  3QFP A;  5ADX H;  4M63 C;  5AZI B;  1BDG A;  1SAZ A;  3U9D A;  1ESV A;  3D2E B;  1V4S A;  3ZET B;  4DCH A;  2P9P B;  4MLE A;  3M6G A;  3ZX0 A;  3UKR A;  3CIP A;  1GLE G;  4BC5 A;  3U9Z A;  4BR4 A;  1S22 A;  2F9T A;  4BVO A;  2YHX A;  3QBX A;  2V52 B;  3A0I X;  5AR0 A;  5FPN A;  4FWS A;  4B1Z A;  3O5B A;  5AQT A;  1SZ2 A;  3CJ7 A;  4JHD B;  3QBW A;  2WUS A;  3I8B A;  3JS6 A;  4I6M B;  3VEO A;  1KXP A;  4JD2 A;  1GLA G;  5EXW A;  4B9Q A;  1NBW A;  3F9M A;  3A8Y A;  2D1K A;  4FWR A;  3MDQ A;  1BUP A;  3LDQ A;  4FWO A;  5AQZ A;  4H0X B;  1BA1 A;  2FF3 B;  2E1Z A;  4PKG A;  5BPL A;  2NLX A;  5KPZ A;  3R8E A;  4BRA A;  2ASM A;  1NLV A;  1GLB G;  3VGL A;  4CJ7 A;  1XUP O;  1XC3 A;  2E2Q A;  2HF4 A;  2QM1 A;  3ULE B;  1KAX A;  3VEV A;  2QW9 A;  1SQK A;  1H1V A;  1GLC G;  3H1V X;  4QS8 A;  3ATU A;  5FPE A;  2HF3 A;  2P9U B;  3FZL A;  3L0Q A;  4GY2 B;  1C0G A;  1TUY A;  2FSK A;  2QWP A;  3J8A A;  3MCP A;  2FF6 A;  5JMV A;  2QWL A;  2ZGZ A;  3WXL A;  5KQ8 A;  3SLC A;  4QS7 A;  3QML A;  4B1Y B;  4CZJ A;  2I7N A;  1K8K A;  4FWL A;  2A6A A; 
#chains in the Genus database with same CATH topology
 3CCM N;  1VQ7 N;  2G8H A;  5K14 A;  4CBW A;  1KFS A;  3EN9 A;  3A2F A;  3VEZ A;  1GOB A;  4AQY K;  3IDH A;  5AQS A;  2RN2 A;  2W6K A;  4JAX A;  5AFU A;  2Z1G A;  3EEQ A;  4OGC A;  5JEN A;  5FDL A;  1EET A;  4FJG A;  2OTL N;  4H4M A;  3AV9 A;  2WOM A;  3PSF A;  3WXJ A;  2HBL A;  1BCM A;  4FOI A;  4FWP A;  1S72 N;  3HZ6 A;  4BWJ A;  3SQ1 A;  3HVR A;  2WTU A;  1I94 K;  5KTQ A;  4BRG A;  1SKW A;  1BIU A;  4CIE A;  2GX9 A;  4I9L A;  3K5O A;  2BH1 A;  4JLH A;  4JN4 A;  4XEI A;  2ZGY A;  4IFE A;  3M1F A;  3D45 A;  4AH9 A;  1KTQ A;  3S41 A;  3MXM A;  2O8D A;  5C2F A;  4DU3 A;  1OVQ A;  3D2E A;  3NH2 A;  2P9P A;  5CYM A;  1T03 A;  1N33 K;  3ALY A;  1UOC A;  1VQK N;  4BRH A;  4NXN K;  2NRW A;  3LL3 A;  3AA2 A;  5C12 A;  5J2N A;  1JLG A;  4J2A A;  3OYH A;  1XQS C;  1P90 A;  4GVM A;  1RTI A;  4H0O A;  4JHD A;  1L3S A;  4I6M A;  4WYB A;  2G8F A;  2I7P A;  4W5O A;  3PSI A;  1M90 O;  2KLA A;  4GNI A;  3DXK B;  3MN7 A;  3G25 A;  2HVH A;  5JLF A;  1N5Y A;  5A2Q O;  1EWQ A;  5BR9 A;  1OH5 A;  4KHP K;  3C94 A;  2Y1J A;  3F9K A;  3O3G A;  4RW8 A;  2B6A A;  3DI6 A;  5I42 A;  3EL2 A;  3ULE A;  4FLU A;  1S5J A;  2I5J A;  4WQ5 C;  2GWJ A;  3CYG A;  3LDS A;  4BC4 A;  1GLF O;  3AO4 A;  2OZS A;  4JI5 K;  3KK3 A;  2ZJQ L;  3BEX A;  4AHV A;  2D0O A;  4DSF A;  3ID6 A;  4ID1 A;  1YIJ N;  4DV3 K;  5AQO A;  5J2Q A;  3RRG A;  5GIP A;  3OTO K;  5C2D A;  4EFH A;  3V6D A;  4NLB A;  5I3U A;  3FZH A;  5JLH A;  3DMJ A;  3J7Z O;  3D2F B;  3NF9 A;  2Q36 A;  1OVY A;  4DB3 A;  2HMP A;  3OS2 A;  2PFU A;  1FKO A;  1E3M A;  2YCH A;  4DTS A;  2O8F B;  5HRN A;  4EHT A;  2ATQ A;  3WT0 A;  3L2R A;  1YJW N;  1I3A A;  3IMX A;  4Z4H A;  1HYS A;  3SV3 A;  1Q18 A;  3ZSY A;  2VQE K;  4JNE A;  3SUP A;  4XH5 A;  3VQQ A;  3AVL A;  2YNF A;  2E88 A;  4DUZ K;  4CED A;  4IXC A;  2O8B B;  3QIP A;  4H5R A;  1HYZ A;  1S1V A;  3G10 A;  3ZLJ A;  1YTU A;  1RNH A;  1NMN A;  4PKH A;  4DWI A;  3K5N A;  2ZM6 K;  4U7B A;  1T6C A;  3VF2 A;  3SNN A;  3UB5 A;  1NMD A;  4WE1 A;  2D4W A;  4EIA A;  4JKC A;  1E4F T;  4ZTJ A;  3AVH A;  4B9U A;  4CGG A;  2VCP A;  1KSP A;  5F0X A;  5AQK A;  2NNW A;  3V9X A;  1CZ9 A;  3S3O A;  3HK2 A;  2GWK A;  4ISF A;  1VRT A;  3ZT1 A;  5AZJ B;  1JLE A;  3L8B A;  3LDP A;  4JEP A;  3SCX A;  3AA4 A;  3VES A;  1QVG M;  4NO7 A;  2PYJ A;  3OS1 A;  5BRD A;  4I2P A;  4GMJ B;  3MCA B;  1NGB A;  5AFU H;  3M8Q A;  5LMN K;  4CJS A;  4BC3 A;  1U48 A;  4X62 K;  2OA8 A;  4OLB A;  3DXK A;  2PYL A;  2HOE A;  5FRO A;  2FBT A;  3QIN A;  2WC9 A;  3LDO A;  3GDQ A;  3KZB A;  4IWV A;  1DTT A;  1BHL A;  1T7P A;  3GBT A;  4M41 A;  2YI1 A;  4FJ8 A;  2P9L B;  4G1Q A;  3THX B;  3DOL A;  4BR5 A;  3OYC A;  3NAE A;  4H5V A;  4R5P A;  4YOR A;  3O3H A;  4DSJ A;  2QWQ A;  3MEC A;  3RMD A;  4A62 A;  3LZJ A;  3SJJ A;  4GV3 A;  3M5R A;  3E9P A;  5JVG L;  3QEV A;  3M3Z A;  3D2F A;  3O4W A;  5BRF A;  3UKR B;  3W0L A;  1GLJ O;  5HRP A;  3EY1 A;  4PY5 A;  1RDC A;  3RSE B;  4O5F A;  2VG7 A;  4FL9 A;  4QAG A;  4FCY A;  3LZI A;  3TAG A;  2BUP A;  2QWN A;  2O8F A;  4DR1 K;  5C24 A;  2F7T A;  3K2P A;  3ZSQ A;  3AA3 A;  4B1X B;  1HNW K;  4RW9 A;  4EHU A;  1N8R O;  3NMU A;  4JD2 B;  3NH0 A;  1Y97 A;  1RDA A;  5LMU K;  1NGA A;  1ATR A;  1O1W A;  1YTA A;  4RW6 A;  4DS4 A;  2HHW A;  3C95 A;  4A61 A;  2FBV A;  5KPT A;  1QHA A;  3QNN A;  4PA1 A;  4JV5 K;  4PL7 A;  1NGF A;  4K41 A;  2O8B A;  3ZT2 A;  1EWR A;  3LP1 A;  3CER A;  4FLY A;  4IJA A;  2QKB A;  3OYM A;  3DWL A;  3BGR A;  4IOX A;  3SAG A;  3C0B A;  1OH7 A;  2W00 A;  4K43 A;  4M42 A;  2EHG A;  3H3O B;  1U6Z A;  3NVM A;  5GIO A;  4ISG A;  4F9O A;  3WXI A;  4NB4 A;  3LP3 A;  1FJG K;  3O9Q A;  3P39 A;  5FRM A;  4HTL A;  5KQD A;  2W40 A;  3MN6 A;  1IJJ A;  2NUB A;  3U8X A;  4CI6 A;  4DFM A;  3FR0 A;  4IOA L;  4CGI A;  2UUB K;  3M8R A;  2W41 A;  3ZCM A;  1P8Z A;  5AQV A;  3LM9 A;  5AZJ A;  1TAU A;  1SV5 A;  2X74 A;  2A42 A;  1Z25 A;  2UXB K;  5B8H A;  1HYV A;  1TKX A;  3MK6 A;  3BUZ B;  4XH4 A;  4CGD A;  3KK7 A;  2NRH A;  3SUO A;  5C25 A;  5HLF A;  2E20 A;  1QSL A;  3CCL N;  3LM2 A;  4BRQ A;  1NWK A;  3V9U A;  4FW2 A;  4IZ9 A;  2G8W A;  2P9N B;  1SS6 A;  2ZJR L;  2JLE A;  4FJH A;  1XC9 A;  2BDP A;  1W7A A;  5GAD P;  4DUY K;  3RRH A;  4B3T K;  4JKE A;  4Y0W A;  2E6L A;  1J9A A;  3VOV A;  5J1E A;  4BE7 B;  2HW3 A;  3O1B A;  3E9O A;  1HJO A;  5SWM A;  1WOQ A;  1HR0 K;  2P9L A;  4KH5 A;  3CPE A;  3THX A;  2A3Z A;  4IO9 L;  2Q31 A;  4YOW A;  3VQC A;  3OJU A;  4FJ9 A;  1VK0 A;  3LPT A;  3EKU A;  3P5J A;  3R1X A;  4JRP A;  1S9G A;  3JSM A;  4DF4 A;  1KLN A;  3U9D A;  2ITG A;  5JS2 A;  4CER A;  3ZX0 A;  3UKR A;  3CIP A;  1UA0 A;  2KTQ A;  3CFP A;  4OX9 K;  4BR4 A;  2F9T A;  4CJU A;  2YHX A;  2V52 B;  3Q7B A;  5M1O A;  4CE9 A;  3CJ7 A;  3TAF A;  4HCC A;  1KXP A;  4IEI A;  4JD2 A;  3OY9 A;  2UXD K;  1WSH A;  4FWR A;  5AQZ A;  4H0X B;  1BA1 A;  3CFR A;  4PKG A;  3R8E A;  2ASM A;  5GIN A;  4CJ7 A;  3LAM A;  4KFB A;  3QLH A;  2QM1 A;  4KH4 A;  1KAX A;  3VEV A;  2QW9 A;  1SQK A;  1H1V A;  1L3U A;  5DMR A;  2P9U B;  3HP6 A;  1HNI A;  1VHX A;  4DQQ A;  1C0G A;  1C1B A;  2QWP A;  3J8A A;  4NCA A;  1NOZ A;  5KQ8 A;  2QWL A;  1IBL K;  2QK9 A;  4YOY A;  3KKS A;  1NK5 A;  4CJL A;  1N32 K;  4C8K A;  4DTJ A;  1CXU A;  3C6U A;  4EZ6 A;  3HOS A;  4C8N A;  2HHS A;  1W97 L;  3O8M A;  2Y1I A;  3WEE B;  2OPR A;  4WFB L;  3EZW A;  4BVP A;  5AQL A;  2D0A A;  4W5R A;  3O3F A;  4C8O A;  3THV A;  4FLZ A;  3IFR A;  3MWP A;  2D0P A;  4FWK A;  1IKX A;  3VTI A;  4BAC A;  3F5T A;  4M45 A;  2P9N A;  1QQN A;  5HL7 L;  1Q8I A;  3CME N;  3OHR A;  2AP1 A;  5KRT A;  2X6S A;  3C65 A;  2GBZ A;  3HM8 A;  4FM2 A;  4YDU A;  3VMF B;  4DV1 K;  4LFB K;  3LWL A;  5HRO A;  2F96 A;  1C1A A;  5M1K A;  3SYZ A;  4M3Z A;  2ZWH A;  1REV A;  4BRP A;  5AQN A;  1Q9Y A;  4CF8 A;  4DG1 A;  4O5B A;  2E8A A;  3TI0 A;  1T44 A;  1KAY A;  4B3R K;  1X9S A;  4C8L A;  1NK7 A;  4DLG A;  4OGE A;  3AVA A;  4BDY A;  2H3G X;  4H0P A;  2W42 A;  3U4L A;  1ZYQ A;  3D7E O;  2XY7 A;  1HNZ K;  4OPK A;  2FXU A;  3HPH A;  2IGI A;  2YJE A;  1Z05 A;  4JRQ A;  1NU0 A;  4ZHR A;  1RBV A;  5TKY A;  4QS9 A;  1BU6 O;  1RBR A;  4CZH A;  3QO9 A;  2ZJP L;  4A2A A;  1WAF A;  3MEG A;  4CEE A;  2IS3 A;  3ENO A;  3M8P A;  2NRV A;  2P5O A;  1SL0 A;  2UU9 K;  4B9M A;  3OYJ A;  3AVN A;  5CY4 A;  4CJ5 A;  3V1R A;  5CZ2 A;  3CCV N;  1IBM K;  1S3X A;  4FJ7 A;  3AVI A;  5DM7 L;  4ELT A;  3SUQ A;  4Z4I A;  1NKE A;  2P9U A;  2NZT A;  3R9P A;  4ISE A;  1U04 A;  4KHU A;  2R7Y A;  3JXU A;  1YHQ N;  1YIT N;  3HVT A;  4CZK A;  3L6Q A;  2QA4 N;  3TAQ A;  3OYI A;  4M3U A;  2ZD1 A;  4BEB A;  2YNH A;  4CJQ A;  2A40 A;  3ATV A;  1EKE A;  4CJF A;  1V4T A;  3VQ4 A;  4CZI A;  3AVM A;  3TTD A;  3VER A;  4AHT A;  2IOC A;  4ILH A;  3L2V A;  2PZS A;  4OJR A;  1E4G T;  3GE1 A;  3T1A A;  5AQI A;  3WEE A;  4LF5 K;  4PKI A;  1XNQ K;  1HUX A;  4FPB A;  4BGB A;  3MX2 A;  4LF8 K;  2HHX A;  1D9F A;  4CJK A;  4KV8 A;  3WXK A;  4FYD A;  1U2V B;  5BPM A;  2YHB A;  1JLC A;  3SPZ A;  1OH8 A;  1GLD G;  4DV2 K;  5E84 A;  3BP8 A;  3AA5 X;  2Z1I A;  2WON A;  3HSC A;  2RHK A;  4JKB A;  3G6E N;  4AIL C;  4CJW A;  1ZBI A;  2PY5 A;  3SMP A;  4CHO A;  3CM5 A;  4EP5 A;  4CJ3 A;  2V51 B;  3B6O A;  3CJC A;  4U67 L;  1QQC A;  1RDD A;  5AQH A;  1LWC A;  1QTM A;  4FO0 A;  4JI4 K;  4BR0 A;  4WFA L;  4H0T B;  3RTV A;  4H5N A;  4BEC A;  4FOE A;  2WBN A;  4B9L A;  1LW2 A;  2YHW A;  3BF3 A;  2ASO A;  4FSV A;  5BN9 A;  1Q81 O;  3DLK A;  1YI2 N;  4Q0B A;  5DM6 L;  4I9Q A;  2FBX A;  2OPP A;  4LF7 K;  3RR7 A;  3HOT A;  3TSP A;  4CF0 A;  2HHQ A;  3K5M A;  1T6D A;  1NJZ A;  3SAF A;  5HRR A;  3FGU A;  4JI2 K;  1ASV A;  4BG8 A;  3BDP A;  1ATS A;  1VSL A;  4FJ5 A;  3HYF A;  3AO1 A;  4BRD A;  5AQM A;  4BG9 A;  3QEX A;  3CG7 A;  4JI8 K;  3CC2 N;  3SBT A;  3TR8 A;  5LJW A;  3AVB A;  3P4I A;  3SMS A;  1BL3 A;  4DLE A;  2Q3S A;  2OCE A;  1NGG A;  2QXL A;  4DU4 A;  1MU2 A;  3A5L C;  3T69 A;  4HHT A;  1T05 A;  4BR2 A;  2FSJ A;  2F4V K;  3M8S A;  4CEO A;  2DTU A;  4FZY A;  3ZT0 A;  4EZ9 A;  3PLA A;  4CEA A;  2Q97 A;  4KI6 A;  1RT3 A;  1JLB A;  4A57 A;  3NFA A;  2RF2 A;  2FC0 A;  5I9E B;  3ENB A;  1XMQ K;  5AQX A;  3OYN A;  5CR4 A;  4W5N A;  1ZXO A;  4NCG A;  1LCU A;  3THW B;  3KJV A;  3E1Y A;  1GOA A;  1SKS A;  2PAV A;  3QEI A;  3N4P A;  1JKH A;  4M7X A;  4CK1 A;  3BZK A;  4O8U A;  2DFH A;  5F1X A;  4DV0 K;  1YT3 A;  2KKZ A;  2G8U A;  2XY5 A;  1DEJ A;  3ITH A;  1U2V A;  2E2O A;  4CJP A;  1HPM A;  1RCH A;  4MO4 A;  3QDK A;  3LWM A;  2Q0R A;  2KZM A;  2YV0 X;  2HNZ A;  1XHX A;  4AF1 A;  4RCH A;  3PX0 A;  3AVC A;  4DU1 A;  1YVN A;  3QER A;  4WQ4 C;  1N36 K;  1LW0 A;  3QET A;  3VQE A;  4CES A;  2P1J A;  3C6T A;  4J2B A;  3DAW A;  1RBU A;  5GAE P;  4E1M A;  4BRI A;  4IBN A;  4FZZ A;  3CXC M;  4Z0U A;  3THY B;  4HUG A;  1SKR A;  1Q86 O;  1ZC6 A;  3CJA A;  4DR6 K;  1QQM A;  1LWE A;  4OKJ A;  1VSI A;  1BA0 A;  3CCE N;  2UXC K;  3CCR N;  1SUQ A;  2E2P A;  1JCE A;  3DOK A;  3CJ9 A;  4MLH A;  4B8A B;  3D0P A;  5HP1 A;  3S3M A;  3H6E A;  3T7Z A;  1RFQ A;  3G4S N;  3VET A;  2CH6 A;  1WNS A;  4RWT A;  2J4R A;  4C8M A;  3OYD A;  4CJ4 A;  1QSY A;  4DQR A;  3VQ5 A;  4FZX C;  3CMA N;  3MWT A;  5AQP A;  3ZYY X;  1NGE A;  4H4O A;  2DFF A;  3DJC A;  1HRH A;  1KRP A;  1TAQ A;  1ZBS A;  4YNQ A;  3DXM B;  1IG8 A;  3V9W A;  3HXM A;  3LAK A;  4AM6 A;  1NKC A;  3IKM A;  2VWK A;  3WNF A;  3VTH A;  4O44 A;  1TGO A;  1DKG D;  5EY4 A;  3I33 A;  4WQ5 A;  3VGM A;  1RGI A;  4Z4E A;  1BI4 B;  1MA9 B;  1K6Y A;  4JS5 A;  4ELV A;  3CJ1 A;  5ADX H;  4J2D A;  2QTD A;  4M63 C;  4F3T A;  1BDG A;  1S1T A;  3VQ6 A;  4CFC A;  5FLX O;  4JI0 K;  1ESV A;  4ICL A;  2XO7 A;  3DLR A;  1G15 A;  3ZET B;  4JKD A;  1YJN N;  1TK8 A;  3M6G A;  1VQO N;  4YOT A;  1GLE G;  4BC5 A;  1VSH A;  3U9Z A;  4PWD A;  3FFI A;  4MDA A;  1NJW A;  2O4I A;  3A0I X;  3CCU N;  3CC4 N;  4FM0 A;  1HJR A;  5FPN A;  3EZ5 A;  3O5B A;  5AQT A;  3QBW A;  2WUS A;  5M1P A;  3VEO A;  4LSL A;  3L4Q A;  1CZB A;  1GLA G;  1HQE A;  4B9Q A;  1NBW A;  5C0Y A;  3F9M A;  3A8Y A;  2D1K A;  3NGI A;  3LDQ A;  3S9H A;  2FF3 B;  1XNR K;  3O9R A;  3TTF A;  4G9Z A;  4DV7 K;  1NLV A;  3B6P A;  2P51 A;  3VGL A;  3NCI A;  3L2U A;  3HPO A;  1XC3 A;  2KFZ A;  2E2Q A;  2YX6 A;  2QXF A;  4M3X A;  3KLG A;  3E9L A;  1KLM A;  4QS8 A;  3ATU A;  5JVH L;  4ILG B;  4GY2 B;  1NK8 A;  3LP0 A;  4KKO A;  2FF6 A;  5T7B A;  3P83 D;  3WXL A;  3KD1 E;  3SLC A;  3C6A A;  3THY A;  4QS7 A;  3EYZ A;  3KK2 A;  1KVB A;  3PUF A;  4B08 A;  1KD1 O;  3HL8 A;  1CLQ A;  1NJX A;  2HBK A;  1NK0 A;  1IKW A;  1DTQ A;  4QCL A;  5FPM A;  2A6A A;  3U3Y A;  3U3G A;  4AHR A;  1Q9X A;  4CGH A;  1VQM N;  3F73 A;  1C0T A;  2QWM A;  4KBO A;  1EX4 A;  4F2S A;  4A2B A;  1ASW A;  4K8X A;  4N47 A;  3QEW A;  5SZT A;  4E89 A;  1TKZ A;  2ASP A;  2VG6 A;  1LWF A;  1EQY A;  1SL1 A;  2UUA K;  1U45 A;  1IH7 A;  4KHQ A;  1Z26 A;  3FZM A;  3O6W A;  4BRM A;  5FPD A;  3ZSV A;  1QZ5 A;  4CJT A;  3W3D A;  3NF8 A;  5E26 A;  2A41 A;  4QOZ B;  4CF9 A;  2VQF K;  4CEZ A;  1Q7Y O;  2IC3 A;  4B1U B;  4IDK A;  1EO1 A;  3VQ9 A;  4IOC L;  4KRE A;  1ZBU A;  4ID5 A;  4K25 A;  4E3S A;  3LDN A;  1O13 A;  1ZBF A;  5EVZ A;  3OS0 A;  4FLV A;  1BI4 A;  4H5W A;  1WBB A;  4IEE A;  3HM9 A;  3CM6 A;  4CIF A;  5AQY A;  3TAM A;  4A5B A;  4EAH D;  3IUC A;  3ZET A;  3V9Z A;  3HST B;  4F3O A;  3VEW A;  1ILY A;  1YF5 L;  3K0S A;  4E7L A;  3C7N B;  1OKJ A;  1JJ2 M;  4TSX A;  1TL3 A;  4Z4C A;  1HNV A;  3O80 A;  4F4K A;  2KFN A;  2B5J A;  2E4L A;  2IVP A;  3ZSW A;  3B8A X;  3OYA A;  3SQ4 A;  1RT4 A;  1S1W A;  4UY8 O;  4DSI A;  3RSE A;  3PIP L;  2ETJ A;  3V1Q A;  4PL8 A;  3SV4 A;  1RT2 A;  3TSQ A;  4YFU A;  3DLH A;  3WQU A;  2EX3 A;  3D6R A;  5BPN A;  1JL1 A;  2YJF A;  5KPR A;  4M3W A;  1D8Y A;  4LY7 A;  2QWO A;  4LH4 A;  1BQN A;  5C42 A;  1VSK A;  4X66 K;  4FLT A;  4CFA A;  3O1W A;  1S6Q A;  3OYG A;  2P9S B;  1YUW A;  3VEX A;  1KVA A;  2XY8 A;  2DY4 A;  3QIC A;  4O4G A;  3BY5 A;  4MQ3 A;  4KHN A;  4FXD A;  4CGF A;  3WQT A;  1WBD A;  2OAN A;  5HRS A;  3CCQ N;  1CXQ A;  4CBU A;  3I56 N;  2Q1N A;  3HRG A;  3VPZ A;  4HTU A;  2V7Z A;  4KB0 A;  3VQD A;  3TWH A;  4JS4 A;  3UE5 A;  3L4I A;  4CFD A;  4H8K A;  4A59 A;  3O9U A;  3OVN A;  4HUE A;  4H5T A;  3SQ0 A;  4CGJ A;  5AQF A;  2ZE2 A;  2G8I A;  2DPN A;  3QB0 A;  3WNE A;  4IFV A;  1HNX K;  1GOC A;  3ID8 A;  1G99 A;  3AVK A;  3HBT A;  3QNO A;  3MMV A;  5EU7 A;  4A5A A;  2YKM A;  4KI4 A;  3VF6 A;  3R6M A;  4FJK A;  4B8C A;  1BGX T;  1JL2 A;  1HLU A;  1TYQ B;  3SAH A;  3DRP A;  4PUO A;  1K8A O;  5J2M A;  1RBT A;  3H1Q A;  4JI6 K;  4BRF A;  1U47 A;  1QZ6 A;  4WCE L;  1RTD A;  3E66 A;  3EE9 A;  3LAN A;  3ZT3 A;  2QWR A;  3PO4 A;  4NCB A;  4H0Y B;  3C7N A;  1TUU A;  1J6Z A;  4RW4 A;  2ITM A;  4H03 B;  1KVC A;  4BE2 A;  3CPW M;  4B9V A;  3GL1 A;  4FJM A;  4Z94 A;  4DR2 K;  4DTM A;  4I2Q A;  4FWM A;  4FK0 A;  3MED A;  3NGY A;  3DLG A;  2RPI A;  2OYQ A;  5AQQ A;  4AHC A;  4PQU A;  4IG0 A;  3BF1 A;  4L3Q A;  1HQU A;  1BWF O;  4E19 A;  3NBP A;  3J81 O;  2A1R A;  4J8F A;  4DR5 K;  2B4J A;  4CF2 A;  3G0Z A;  4BE0 A;  4I7F A;  3KLF A;  1YXQ A;  2C1G A;  3RR8 A;  1IO2 A;  4FW1 A;  5CZ1 A;  1NGJ A;  1S1U A;  1TKT A;  1B9D A;  1W0H A;  1IV0 A;  4CEF A;  3JYT A;  2YNI A;  4EP4 A;  3MEE A;  5DK5 A;  3ZT4 A;  4RTF D;  2P9S A;  1DT9 A;  3ENH A;  3T3F A;  1RT6 A;  3N4Q A;  3CYM A;  3O4N A;  4FK4 A;  1JCG A;  2LSN A;  1C1C A;  2BTF A;  2GUI A;  1J5E K;  1HX1 A;  2IIR A;  3L2W A;  1WSF A;  4CEC A;  3HT3 A;  1VQ5 N;  2P5G A;  2NRZ A;  1TKD A;  4FM1 A;  3AVJ A;  4DKW A;  3AO3 A;  2GUP A;  1L5U A;  4BRK A;  1TV6 A;  4KAZ A;  4KRF A;  3P31 A;  3KIO A;  1VQ8 N;  4R79 A;  1NGI A;  2X6N A;  5AQW A;  4BR7 A;  4N76 A;  4DR3 K;  4CZE A;  4CZG A;  4KH6 A;  1X9J A;  5CHI A;  4BY9 C;  1Y64 A;  3KTQ A;  1IBK K;  4BRE A;  1JCF A;  3WNG A;  2DFE A;  3MN5 A;  4XH1 A;  2D5R A;  1X3N A;  3SZ2 A;  3HTV A;  2XY6 A;  3VQ7 A;  3VF4 A;  2KHO A;  2RE2 A;  1TYQ A;  3OA9 A;  5C10 A;  4JYA K;  4N5S A;  4DS5 A;  4DSL A;  2F8T A;  5HOO A;  4ILJ A;  4M7Y A;  4OO1 J;  1RT7 A;  3KK1 A;  1CZA N;  3T1Y K;  1UWB A;  4DQS A;  1K8K B;  4WF9 L;  5BR8 K;  1XMO K;  4BR9 A;  3RMA A;  4LFA K;  5ADX A;  4OLA A;  1RDW X;  5EX5 A;  2KQ2 A;  5E41 A;  4E1J A;  2JWK A;  3VQ8 A;  2CGK A;  4NLC A;  4OPJ A;  3VEY A;  3NF6 A;  4FWN A;  4CIG A;  4GKJ K;  4FVM A;  4AM7 A;  2BGG A;  1TL1 A;  3QIO A;  2ZF5 O;  1WSE A;  1L3T A;  3CFO A;  1NGD A;  1QSS A;  4BRO A;  3AVF A;  3VGK A;  1NJY A;  4BQZ A;  1C0U A;  4HVJ A;  4K42 A;  3ZEU B;  3OJS A;  4YOV A;  2E5L K;  2P9I B;  4KTQ A;  4M3Y A;  3HJF A;  3NVK A;  3OW2 M;  5H1S Q;  3HI0 A;  5C15 A;  5CE3 A;  3EKS A;  1VQ4 N;  2FBY A;  5BRE A;  3ZX3 A;  4F2R A;  3LDL A;  1ITG A;  1M1K O;  1L3V A;  5KGW A;  1NOY A;  3C6H A;  4FJN A;  1YAG A;  1R0A A;  1QE1 A;  3QFP A;  5AZI B;  1WAJ A;  4CHZ A;  3MXI A;  3K9K A;  1LAV A;  1V4S A;  3CQ8 A;  4CVN E;  4MLE A;  4CK3 A;  1S22 A;  4HUF A;  4DQI A;  4BVO A;  2QEX N;  1QVF M;  3ISN C;  3VA3 A;  3RWU A;  1JXB A;  3AGK A;  3I8D A;  1SZ2 A;  3I8B A;  4C1N I;  1FK9 A;  4DTU A;  4RW7 A;  3LPU A;  4YHH K;  5EXW A;  3Q7C A;  3ZSX A;  4FK2 A;  2YNG A;  1BUP A;  4B9N A;  2E1Z A;  5BPL A;  2NLX A;  5KPZ A;  2HHU A;  4BRA A;  4BE1 A;  3VQB A;  4FJJ A;  1GLB G;  4OPH A;  3DRR A;  4FJI A;  3PY8 A;  1BIS A;  1LAW A;  1LV5 A;  2HF4 A;  1FXX A;  4YY3 K;  3H1V X;  4YOX A;  3OYE A;  4FLW A;  1J54 A;  1KCF A;  2BAN A;  2HF3 A;  1U49 A;  3JAM O;  3FZL A;  3OYL A;  4DR4 K;  4CEQ A;  3AGR A;  1KQS M;  1JLQ A;  3IG1 A;  1TUY A;  4KO0 A;  2FSK A;  1JLA A;  2X78 A;  4Z4F A;  2OPQ A;  4GW6 A;  1U4B A;  3MCP A;  4K8Z A;  4CJR A;  5JMV A;  2ZGZ A;  4DR7 K;  5GAG P;  5FRN A;  4CCH A;  3QML A;  4B3S K;  4CZJ A;  4N56 A;  3TAE A;  2O4G A;  4JKA A;  1K8K A;  4E7H A;  3I0R A;  1XWL A;  3WXM B;  4NYF A;  1TVR A;  3TAP A;  4BDZ A;  4F8R A;  4CHQ A;  5AJ3 K;  1QQO A;  1N6Q A;  3LP2 A;  4NXM K;  4IDH A;  4IJN A;  2YHY A;  4CD1 A;  4FJL A;  3V81 A;  2VWB A;  1C0F A;  5M1F A;  3T1H K;  4DMN A;  4CF1 A;  2O8C B;  3TSU A;  3QFU A;  3K59 A;  4CFB A;  4LSN A;  3FZF A;  4KPY A;  4YOU A;  1FKP A;  3K9J A;  2FSN A;  3NH1 A;  3ZEU A;  3KLI A;  4DFJ A;  3UKU B;  2KZZ A;  2P9I A;  5AQG A;  2GEL A;  2E6M A;  2O8E B;  3OYF A;  2RKI A;  4GV6 A;  1BO5 O;  1Q82 O;  3K58 A;  3NHG A;  2IVN A;  4PHT X;  3VA0 A;  3J80 O;  4BRL A;  4N41 A;  3DM2 A;  1RBS A;  2HVI A;  4OPA A;  2E1Y A;  5AZI A;  2XRI A;  5BN8 A;  4DTO A;  4NYN A;  4DQ8 A;  1WLJ A;  1EP4 A;  3AAR A;  3MX5 A;  4L8R B;  1WSG A;  3RVC A;  2UUC K;  2P9K B;  2VG5 A;  2OPS A;  3UIQ A;  3F2K A;  1BCO A;  1W2B M;  3FFK B;  1J53 A;  1F21 A;  2BE2 A;  5JIC A;  4B9S A;  3IS9 A;  3VQA A;  1BIZ A;  2HB5 A;  3OYK A;  1S9E A;  1OH6 A;  4XJX A;  1VQ6 N;  3THW A;  3OBW A;  1WSI A;  4KHY A;  4LF4 K;  5CYQ A;  5BRH A;  4BDP A;  4JI1 K;  3MN9 A;  2FLO A;  4GV9 A;  3P38 A;  4O8K A;  3DYA A;  1K9M O;  1FW6 A;  5KGX A;  1BQM A;  4KTZ A;  3H45 C;  4KHS A;  1C0M A;  2Q2R A;  1B92 A;  5GAH P;  3I55 N;  4C1N K;  4WQ4 A;  4E1N A;  3O08 A;  1NNE A;  5AQR A;  4DTR A;  3EO3 A;  2HMI A;  4DTN A;  5M1N A;  1DGK N;  1NGC A;  4GVE A;  2IVO A;  5IWA K;  5ELZ A;  4IO8 A;  4B3M K;  3VEN A;  3VQP A;  1A5X A;  3CET A;  5TKW A;  3NGZ A;  5MLC Q;  3CJB A;  4X65 K;  5D3G A;  1Z6R A;  2GV9 A;  4MO5 A;  1XHZ A;  1VAZ A;  4JK9 A;  4LF6 K;  3TAR A;  3QEP A;  2CH5 A;  4KTW A;  5KI6 A;  4H0V B;  4W5Q A;  2ZQB A;  4HWI A;  2O8C A;  2C1I A;  5LL6 Z;  2GEM A;  4E72 A;  2YKN A;  1GLL O;  5LJV A;  4FWQ A;  1S1X A;  4Y1D A;  4B1W B;  3CQY A;  1IKV A;  2CGL A;  2VWJ A;  1KC8 O;  3BZC A;  3V9S A;  2EWS A;  5HBM A;  3UKU A;  5AQJ A;  1RDB A;  5KRS A;  2Z1J A;  2O8E A;  4E7K A;  4E7J A;  3WUH A;  4CEB A;  2G8V A;  1ZBL A;  1T8E A;  2HHT A;  5AQU A;  2UYT A;  3SK3 A;  3OBY A;  3H08 A;  3DXM A;  2AJQ A;  4JKH A;  3A5N C;  4DHY A;  3AY9 A;  4CW7 B;  3FE1 A;  3FZK A;  3AVG A;  3SQ2 A;  1X9M A;  1JXE A;  2Z1H A;  3SBG A;  3TU5 A;  2QI2 A;  1BG3 A;  2E2N A;  4FLX A;  1D4X A;  2HHI A;  1HKC A;  3VN5 A;  3MAQ A;  3AAQ A;  1NKB A;  4CHP A;  3DLB A;  1QS4 A;  1VSJ A;  2IDO A;  3IAY A;  2P9K A;  4CZL A;  1VQ9 N;  3KWI A;  4DSE A;  1RT1 A;  5LY3 A;  3AO2 A;  4OKE A;  5F2R A;  1NGH A;  4KB1 A;  1A5W A;  1UAX A;  3DLE A;  1MWM A;  4JKG B;  4AHU A;  2HHH K;  1D5A A;  4CZM A;  3AAP A;  4LH5 A;  1HKG A;  3MXJ A;  3H46 O;  4IFY A;  4OKK A;  1VQP N;  1TK0 A;  4CZF A;  3OYB A;  5J2P A;  4BRN A;  1JLF A;  3ULD A;  4K0K K;  3KLH A;  3KKR A;  3L2Q A;  5IT9 O;  3KLE A;  4YDU C;  1RDU A;  1NK4 A;  1VSD A;  3CCJ N;  2QKK A;  2AA4 A;  4O0J A;  4RG8 A;  1KFD A;  1VQN N;  3L3U A;  3RMC A;  2OZM A;  1HPZ A;  4DV4 K;  1ZBH A;  1TK5 A;  1VSF A;  3O9S A;  1WSJ A;  1W9H A;  1NM1 A;  2A1S A;  3PIO L;  3I0S A;  2HNY A;  4JK7 A;  2JGU A;  3R3L A;  4V19 S;  4CD3 A;  4UQG A;  4KHW A;  1ASU A;  4W5T A;  4FPA A;  1LOT B;  1NK6 A;  3CCS N;  3V1O A;  3K5L A;  3H3N O;  1X9W A;  4JI3 K;  4DTP A;  3KHY A;  2D0B A;  3GG4 A;  1S6P A;  4E7I A;  3ZX2 A;  4DSK A;  4DTX A;  3CQX A;  2HST A;  2NRX A;  3P1G A;  1WN7 A;  2HHV A;  1MDU B;  4Z4G A;  1I39 A;  4IG3 A;  3KWG A;  4BWM A;  3DRS A;  1VSM A;  3SI6 A;  4BQL A;  1YJ9 N;  1C6V A;  3WNH A;  3G71 N;  2PBD A;  4JKF A;  3A5O C;  4AHS A;  3ZSR A;  3CD6 N;  3LAL A;  4LC9 B;  1ATN A;  4B3O A;  4LFC K;  1EXQ A;  3A5M C;  2XHB A;  2VYP A;  2V7Y A;  1T3V A;  1YVU A;  3SJH A;  3HPG A;  3FLC O;  1BOT O;  2HND A;  1XI1 A;  4MFB A;  1DLO A;  4M3R A;  4ELU A;  1IKY A;  1NK9 A;  3EE8 A;  3RMB A;  4E0D A;  3L3V A;  3ZSZ A;  3ZSO A;  3NE6 A;  3GOI A;  4BC2 A;  1X3M A;  2GTD A;  4CJE A;  4CJV A;  3KVG A;  1N34 K;  1X1P A;  1A5V A;  4XIU A;  1QHT A;  2YHA A;  4CBX A;  4Q5V A;  3DLL L;  4Y1C A;  4B1V A;  4B9T A;  3J7A P;  3T19 A;  3S3N A;  4JKG A;  5EOY A;  3TPQ A;  2A5X A;  5JS1 A;  3QES A;  4O0I A;  3K57 A;  2Q0U A;  3PX6 A;  3CI5 A;  4DQP A;  4J2E A;  4BGA A;  3NDK A;  2WFB A;  4CHY A;  3HP9 A;  3ASM A;  1HKB A;  4OVL A;  2D0C A;  4BRC A;  3PV8 A;  1R59 O;  1MWK A;  2CGJ A;  1WUA A;  3E01 A;  2G8K A;  1NJI O;  2HBM A;  3O9T A;  1KAZ A;  4C23 A;  1IG9 A;  2F9W A;  3V4I A;  3CHW A;  1D9D A;  4FJX A;  2O8D B;  1SAZ A;  3D2E B;  1HMV A;  4DCH A;  4MDB A;  3S5T A;  2P9P B;  4DFK A;  1K73 O;  4JI7 K;  1RTH A;  3CC7 N;  4DV6 K;  4ZTF A;  3QBX A;  3IRX A;  4O55 A;  5AR0 A;  4FWS A;  4B1Z A;  4CK2 A;  2OTJ N;  4JHD B;  2HBJ A;  2W6L A;  3JS6 A;  4I6M B;  2IAJ A;  2F8S A;  2KW4 A;  4DF8 A;  1RT5 A;  3KD5 E;  4GKK K;  3MDQ A;  4DFP A;  3NF7 A;  4FWO A;  3PX4 A;  3U6F A;  1RIL A;  4CHN A;  5M1Q A;  4IKF A;  1WB9 A;  1UA1 A;  1J5O A;  1VQL N;  2NRR A;  1XUP O;  3SUN A;  3SPY A;  3PO5 A;  3J7Y P;  2NRT A;  2VGM A;  3ULE B;  3TAB A;  1B9F A;  1GLC G;  5FPE A;  4LF9 K;  1SL2 A;  1RTJ A;  3HO1 A;  3O4Q A;  4LD0 A;  3L0Q A;  3TTC A;  4HCB A;  1NG9 A;  3CF5 L;  3TAN A;  2JWL A;  1VRU A;  4JK8 A;  4FVU A;  4B1Y B;  2I7N A;  4M3T A;  4X64 K;  4WFN L;  4FWL A;  4DV5 K;  3AO5 A;  2VGN A;  1VSE A; 
#chains in the Genus database with same CATH homology
 3CCM N;  3HOS A;  1VQ7 N;  1W97 L;  3O8M A;  3WEE B;  4WFB L;  1QQO A;  4CBW A;  3EZW A;  1VQM N;  4BVP A;  5AQL A;  4IDH A;  2QWM A;  3EN9 A;  4KBO A;  4IJN A;  3VEZ A;  3IDH A;  2YHY A;  5AQS A;  3IFR A;  4JAX A;  4CD1 A;  5AFU A;  4A2B A;  2VWB A;  1C0F A;  5M1F A;  3MWP A;  2D0P A;  4FWK A;  5FPM A;  3VTI A;  3TSU A;  3QFU A;  2ASP A;  3FZF A;  4YOU A;  3F5T A;  3K9J A;  2OTL N;  2P9N A;  1QQN A;  1EQY A;  2FSN A;  5HL7 L;  3CME N;  3WXJ A;  2HBL A;  3ZEU A;  4FOI A;  3OHR A;  2AP1 A;  3FZM A;  3UKU B;  2P9I A;  4FWP A;  5AQG A;  3O6W A;  3C65 A;  2GEL A;  4BRM A;  5FPD A;  1QZ5 A;  3HZ6 A;  3HM8 A;  3W3D A;  1S72 N;  4YDU A;  5E26 A;  2A41 A;  3VMF B;  4BRG A;  4GV6 A;  1Q7Y O;  1BO5 O;  4B1U B;  5M1K A;  2GX9 A;  1EO1 A;  2ZWH A;  4IOC L;  1Q82 O;  4BRP A;  5AQN A;  4K25 A;  2BH1 A;  1O13 A;  2IVN A;  3LDN A;  5EVZ A;  4JN4 A;  4PHT X;  4BRL A;  4H5W A;  4XEI A;  2ZGY A;  4IFE A;  3M1F A;  4IEE A;  2E8A A;  1T44 A;  3S41 A;  1KAY A;  2E1Y A;  4OPA A;  5AQY A;  5AZI A;  5C2F A;  5BN8 A;  4A5B A;  2H3G X;  3D2E A;  4H0P A;  4EAH D;  3IUC A;  3U4L A;  3D7E O;  3ZET A;  2P9P A;  4DQ8 A;  3AAR A;  3MX5 A;  3VEW A;  2FXU A;  1YF5 L;  1VQK N;  1ILY A;  4BRH A;  3RVC A;  2YJE A;  2P9K B;  1Z05 A;  2NRW A;  3C7N B;  1OKJ A;  3LL3 A;  3F2K A;  1W2B M;  5C12 A;  3FFK B;  1JJ2 M;  5TKY A;  1XQS C;  5JIC A;  1P90 A;  1BU6 O;  4QS9 A;  4H0O A;  4CZH A;  3O80 A;  4JHD A;  2ZJP L;  2IVP A;  4A2A A;  3B8A X;  4I6M A;  3ENO A;  4WYB A;  4UY8 O;  4XJX A;  1VQ6 N;  3RSE A;  2NRV A;  3OBW A;  3PIP L;  2I7P A;  1M90 O;  2KLA A;  4PL8 A;  5BRH A;  4GNI A;  3TSQ A;  3DXK B;  3MN7 A;  3G25 A;  3WQU A;  5JLF A;  4GV9 A;  3MN9 A;  2FLO A;  3D6R A;  3CCV N;  5BPN A;  2YJF A;  3P38 A;  1S3X A;  5BR9 A;  4O8K A;  1K9M O;  5KPR A;  3EL2 A;  3ULE A;  5DM7 L;  2QWO A;  4WQ5 C;  2GWJ A;  3H45 C;  2P9U A;  2Q2R A;  2NZT A;  4BC4 A;  1GLF O;  3R9P A;  5GAH P;  3I55 N;  4ISE A;  4C1N K;  4WQ4 A;  2ZJQ L;  3BEX A;  1YHQ N;  3JXU A;  2D0O A;  1YIT N;  3O08 A;  4CZK A;  3L6Q A;  3ID6 A;  3O1W A;  5AQR A;  2QA4 N;  3EO3 A;  2P9S B;  1YIJ N;  5AQO A;  1YUW A;  3VEX A;  4BEB A;  5M1N A;  5GIP A;  5C2D A;  4EFH A;  4NLB A;  3FZH A;  3QIC A;  5JLH A;  1DGK N;  3J7Z O;  2A40 A;  3ATV A;  1NGC A;  3D2F B;  2Q36 A;  1V4T A;  4GVE A;  2IVO A;  1OVY A;  3TTD A;  4CZI A;  4DB3 A;  2HMP A;  5ELZ A;  4IO8 A;  3VER A;  3WQT A;  3VEN A;  2OAN A;  4ILH A;  2PFU A;  3CCQ N;  3CET A;  5TKW A;  1E4G T;  4CBU A;  5MLC Q;  3CJB A;  3GE1 A;  3I56 N;  2Q1N A;  1Z6R A;  3HRG A;  5AQI A;  2YCH A;  3VPZ A;  3WEE A;  4PKI A;  4MO5 A;  1HUX A;  2V7Z A;  4FPB A;  4BGB A;  1VAZ A;  4JK9 A;  4EHT A;  3MX2 A;  3WT0 A;  1YJW N;  3IMX A;  3UE5 A;  3L4I A;  2CH5 A;  1Q18 A;  4A59 A;  3WXK A;  3O9U A;  4H5T A;  4H0V B;  4JNE A;  1U2V B;  5BPM A;  4HWI A;  2C1I A;  4XH5 A;  5AQF A;  2GEM A;  1GLD G;  2DPN A;  2E88 A;  3BP8 A;  1GLL O;  3QB0 A;  5E84 A;  4FWQ A;  5LJV A;  4B1W B;  3CQY A;  4IXC A;  2CGL A;  3HSC A;  2RHK A;  4H5R A;  4JKB A;  3G6E N;  3SMP A;  3ID8 A;  1G99 A;  2EWS A;  3HBT A;  1KC8 O;  3MMV A;  3UKU A;  4A5A A;  5AQJ A;  2V51 B;  3VF6 A;  3CJC A;  3R6M A;  4PKH A;  3WUH A;  4U67 L;  5AQH A;  5AQU A;  2UYT A;  3SK3 A;  1HLU A;  1TYQ B;  3OBY A;  4FO0 A;  3SAH A;  4U7B A;  4BR0 A;  4WFA L;  4H0T B;  3DXM A;  1K8A O;  1T6C A;  4H5N A;  3A5N C;  4JKH A;  4FOE A;  2WBN A;  3VF2 A;  4DHY A;  4BEC A;  3AY9 A;  3UB5 A;  3H1Q A;  1NMD A;  4BRF A;  2YHW A;  3BF3 A;  3FE1 A;  3FZK A;  2D4W A;  2ASO A;  1QZ6 A;  4JKC A;  4EIA A;  1E4F T;  4FSV A;  5BN9 A;  4WCE L;  1Q81 O;  3SBG A;  1YI2 N;  3TU5 A;  2QI2 A;  3E66 A;  2VCP A;  1BG3 A;  5DM6 L;  2E2N A;  1D4X A;  5F0X A;  3EE9 A;  1HKC A;  5AQK A;  2NNW A;  3AAQ A;  3HOT A;  3TSP A;  2GWK A;  2QWR A;  4ISF A;  1T6D A;  2P9K A;  4CZL A;  4H0Y B;  3KWI A;  1VQ9 N;  3C7N A;  1TUU A;  3SAF A;  1J6Z A;  3FGU A;  5AZJ B;  5LY3 A;  3LDP A;  4H03 B;  4JEP A;  2ITM A;  4BG8 A;  5F2R A;  3CPW M;  1NGH A;  3VES A;  1QVG M;  3GL1 A;  1MWM A;  1ATS A;  4JKG B;  4NO7 A;  4Z94 A;  5BRD A;  4BRD A;  4CZM A;  3AAP A;  5AQM A;  4BG9 A;  3MCA B;  1HKG A;  1NGB A;  4FWM A;  5AFU H;  3H46 O;  3CC2 N;  3SBT A;  1VQP N;  4BC3 A;  4CZF A;  5AQQ A;  5LJW A;  4BRN A;  3DXK A;  3BF1 A;  4L3Q A;  1BWF O;  2HOE A;  3P4I A;  3SMS A;  4YDU C;  1RDU A;  2WC9 A;  4J8F A;  3LDO A;  3GDQ A;  3CCJ N;  3KZB A;  4IWV A;  2AA4 A;  3GBT A;  1NGG A;  2QXL A;  2YI1 A;  3A5L C;  3T69 A;  1VQN N;  2C1G A;  1YXQ A;  4BR2 A;  2P9L B;  2FSJ A;  1NGJ A;  4BR5 A;  3O9S A;  4H5V A;  4YOR A;  2QWQ A;  1NM1 A;  4A62 A;  3PIO L;  3PLA A;  4RTF D;  2P9S A;  4JK7 A;  1DT9 A;  3ENH A;  4GV3 A;  3R3L A;  3M5R A;  4CD3 A;  2Q97 A;  3N4Q A;  3E9P A;  5JVG L;  4FPA A;  1LOT B;  1JCG A;  3CCS N;  3M3Z A;  3D2F A;  3O4W A;  3H3N O;  4A57 A;  2BTF A;  5BRF A;  3UKR B;  3W0L A;  1GLJ O;  1HX1 A;  3KHY A;  5I9E B;  3ENB A;  2IIR A;  5AQX A;  5CR4 A;  1ZXO A;  3GG4 A;  1VQ5 N;  1LCU A;  3RSE B;  4O5F A;  2NRZ A;  4FL9 A;  3E1Y A;  3ZX2 A;  2PAV A;  2BUP A;  2QWN A;  4DKW A;  3CQX A;  2HST A;  3N4P A;  2F7T A;  2NRX A;  4M7X A;  4B1X B;  4O8U A;  2GUP A;  4EHU A;  1N8R O;  3NMU A;  5F1X A;  4BRK A;  1MDU B;  4JD2 B;  2KKZ A;  3KWG A;  3P31 A;  1DEJ A;  1U2V A;  1NGA A;  1ATR A;  2E2O A;  4R79 A;  1NGI A;  1VQ8 N;  1HPM A;  5AQW A;  4BR7 A;  4BQL A;  1YJ9 N;  4A61 A;  4CZE A;  4MO4 A;  5KPT A;  1QHA A;  3QDK A;  4PL7 A;  1NGF A;  2Q0R A;  4K41 A;  4CZG A;  4KH6 A;  1X9J A;  5CHI A;  3G71 N;  4BY9 C;  2PBD A;  1Y64 A;  4JKF A;  3A5O C;  3CER A;  4AF1 A;  4RCH A;  4BRE A;  1JCF A;  3CD6 N;  4LC9 B;  3MN5 A;  4XH1 A;  1ATN A;  1X3N A;  4IJA A;  3HTV A;  1YVN A;  3A5M C;  2VYP A;  4WQ4 C;  2V7Y A;  1T3V A;  3VF4 A;  3SJH A;  3DWL A;  4IOX A;  3SAG A;  3C0B A;  2KHO A;  2W00 A;  2RE2 A;  1TYQ A;  3FLC O;  3OA9 A;  4K43 A;  3DAW A;  5C10 A;  1BOT O;  1U6Z A;  3H3O B;  3NVM A;  5GIO A;  4ISG A;  5HOO A;  5GAE P;  4ILJ A;  4M7Y A;  4OO1 J;  4F9O A;  4BRI A;  3WXI A;  1CZA N;  3CXC M;  3EE8 A;  4NB4 A;  1Q86 O;  3O9Q A;  3P39 A;  1ZC6 A;  4HTL A;  5KQD A;  3GOI A;  1K8K B;  4BC2 A;  1X3M A;  4WF9 L;  3CJA A;  2W40 A;  3MN6 A;  1IJJ A;  1QQM A;  2GTD A;  3KVG A;  1BA0 A;  4BR9 A;  3U8X A;  3CCE N;  4CI6 A;  5ADX A;  1RDW X;  5EX5 A;  3FR0 A;  4IOA L;  4CBX A;  3CCR N;  4E1J A;  2E2P A;  2JWK A;  1JCE A;  2CGK A;  2W41 A;  3DLL L;  4NLC A;  1P8Z A;  3CJ9 A;  4MLH A;  4B1V A;  3H6E A;  3VEY A;  4FWN A;  3T7Z A;  5AQV A;  3LM9 A;  5AZJ A;  1RFQ A;  2A42 A;  3G4S N;  3VET A;  2CH6 A;  5B8H A;  3MK6 A;  4RWT A;  4AM7 A;  4JKG A;  2J4R A;  3BUZ B;  5EOY A;  4XH4 A;  3TPQ A;  3KK7 A;  2NRH A;  2ZF5 O;  2A5X A;  2E20 A;  3CMA N;  3MWT A;  3CCL N;  5AQP A;  3LM2 A;  3ZYY X;  4BRQ A;  1NGD A;  1NWK A;  4BRO A;  1NGE A;  3VGK A;  2Q0U A;  3DJC A;  4IZ9 A;  3CI5 A;  4BQZ A;  2P9N B;  1SS6 A;  2ZJR L;  4K42 A;  3ZEU B;  4BGA A;  1ZBS A;  2WFB A;  5GAD P;  3DXM B;  1IG8 A;  4JKE A;  4Y0W A;  3VOV A;  4YOV A;  2P9I B;  4BE7 B;  4AM6 A;  3O1B A;  3E9O A;  3NVK A;  1HJO A;  3IKM A;  3OW2 M;  1HKB A;  3VTH A;  1WOQ A;  5H1S Q;  2P9L A;  3HI0 A;  4KH5 A;  5C15 A;  5CE3 A;  3CPE A;  3EKS A;  4BRC A;  2A3Z A;  4IO9 L;  1VQ4 N;  5BRE A;  3ZX3 A;  1DKG D;  5EY4 A;  1R59 O;  1MWK A;  3I33 A;  3LDL A;  2CGJ A;  4WQ5 A;  1WUA A;  1RGI A;  2Q31 A;  3VGM A;  4YOW A;  1NJI O;  1M1K O;  2HBM A;  1MA9 B;  3O9T A;  1KAZ A;  3EKU A;  4C23 A;  2F9W A;  3C6H A;  3R1X A;  1YAG A;  3CJ1 A;  3CHW A;  3QFP A;  5ADX H;  2QTD A;  4M63 C;  5AZI B;  1BDG A;  1SAZ A;  3K9K A;  3U9D A;  1ESV A;  3D2E B;  1V4S A;  3ZET B;  4MDB A;  4DCH A;  4JKD A;  2P9P B;  1YJN N;  4MLE A;  3M6G A;  3ZX0 A;  1K73 O;  3UKR A;  1VQO N;  4YOT A;  3CIP A;  1GLE G;  4BC5 A;  3CC7 N;  3U9Z A;  4BR4 A;  1S22 A;  2F9T A;  4MDA A;  4BVO A;  2YHX A;  3QBX A;  2QEX N;  1QVF M;  2V52 B;  3A0I X;  3CCU N;  5AR0 A;  3CC4 N;  3Q7B A;  5FPN A;  4FWS A;  5M1O A;  4B1Z A;  3O5B A;  5AQT A;  2OTJ N;  3AGK A;  1SZ2 A;  3CJ7 A;  4JHD B;  3QBW A;  2WUS A;  2HBJ A;  3I8B A;  3JS6 A;  5M1P A;  4C1N I;  4I6M B;  3VEO A;  1KXP A;  4IEI A;  4JD2 A;  3L4Q A;  1GLA G;  5EXW A;  4B9Q A;  1NBW A;  3Q7C A;  5C0Y A;  3F9M A;  3A8Y A;  2D1K A;  4FWR A;  3MDQ A;  1BUP A;  3LDQ A;  4FWO A;  5AQZ A;  4H0X B;  1BA1 A;  2FF3 B;  2E1Z A;  4PKG A;  5BPL A;  3O9R A;  2NLX A;  5KPZ A;  3TTF A;  3R8E A;  4BRA A;  4G9Z A;  2ASM A;  1NLV A;  5M1Q A;  1GLB G;  4OPH A;  3VGL A;  5GIN A;  4CJ7 A;  1VQL N;  2NRR A;  1XUP O;  1XC3 A;  2E2Q A;  2YX6 A;  2HF4 A;  2QM1 A;  2NRT A;  2VGM A;  4KH4 A;  1KAX A;  3ULE B;  2QW9 A;  1SQK A;  1H1V A;  3VEV A;  1GLC G;  3E9L A;  3H1V X;  3ATU A;  4QS8 A;  5FPE A;  4YOX A;  2HF3 A;  2P9U B;  5JVH L;  3FZL A;  3AGR A;  4ILG B;  3L0Q A;  1KQS M;  4GY2 B;  1C0G A;  1TUY A;  2FSK A;  2QWP A;  3J8A A;  3TTC A;  3MCP A;  2FF6 A;  5JMV A;  2QWL A;  2ZGZ A;  3WXL A;  5KQ8 A;  3CF5 L;  3SLC A;  3C6A A;  5GAG P;  4QS7 A;  2JWL A;  4YOY A;  3QML A;  4JK8 A;  4FVU A;  4B1Y B;  4CZJ A;  2I7N A;  4JKA A;  1KD1 O;  1K8K A;  4WFN L;  4FWL A;  2HBK A;  3WXM B;  2VGN A;  2A6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...