3CIPA

Complex of dictyostelium discoideum actin with gelsolin
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
371
structure length
362
Chain Sequence
VQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTKDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Major actin
publication title Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 122
structure length 362
sequence length 371
ec nomenclature
pdb deposition date 2008-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cipA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cipA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3cipA03
4IO8A 1BO5O 4BRQA 2FF3B 2BTFA 4NO7A 5E26A 3HZ6A 2FSJA 4WQ4C 1T44A 3BUZB 1SAZA 3CJ1A 1ATNA 3D2FA 1XQSC 2Q0RA 5CE3A 4CI6A 2GWJA 1X3NA 5ADXA 3O1BA 1S3XA 2E1ZA 4PL8A 3ZX0A 3EZWA 2AA4A 4CBWA 4ISGA 1DGKN 4JAXA 4BR0A 1YUWA 4FWLA 5BR9A 3CQXA 1HKBA 1MWKA 2HOEA 5BPNA 1V4SA 3BF1A 3WXIA 1NGJA 3GBTA 4K43A 3SJHA 1BA1A 3VERA 5JMVA 5JLFA 3EN9A 2A41A 4K42A 1QQNA 2P9PB 4I6MB 4CBUA 3DXMA 3F9MA 3A5NC 3ZEUB 4XH4A 3MN7A 1RGIA 1QQOA 2ASPA 1V4TA 3A5OC 4BRIA 1NMDA 4A2AA 4QS7A 4BRCA 2J4RA 4XEIA 3UKUA 4B1VA 1ZC6A 4BR2A 1MA9B 3QDKA 5BPMA 2QWQA 2P9IB 5AQNA 1NGIA 1TYQA 3WQTA 1G99A 1WOQA 3AARA 3D2EA 2V51B 2Q31A 5AZIA 1U2VA 3ULEA 3SMSA 5FPNA 4EFHA 2P9SB 1DKGD 2P9UB 4JD2A 1YAGA 4B9QA 2V7YA 2ITMA 3O4WA 3A5MC 4DQ8A 2FXUA 2W41A 3CJ9A 3C7NB 1DEJA 2VWBA 5AQFA 2CH6A 3SK3A 4BRGA 2QWLA 2ZGZA 3FZLA 1NM1A 2Q0UA 1IJJA 4JHDB 3IMXA 2P9LB 3I8BA 1E4FT 4CD1A 3L0QA 1C0GA 4A62A 3VGLA 3TPQA 5AQVA 3I33A 3S41A 3WEEA 5AQWA 4BREA 2EWSA 3LDNA 4BR4A 3H45C 4L3QA 2QWOA 4B1WB 4FOIA 3WQUA 3O8MA 2ZGYA 4H0OA 3P4IA 3H1QA 2E2OA 3SLCA 5AQTA 4K25A 5AQXA 2FF6A 5AQPA 4FWRA 4FWOA 3GG4A 5F0XA 3CQYA 3U9ZA 2GWKA 1BDGA 4A2BA 5EX5A 4NB4A 1YXQA 3MCPA 4M7XA 1NGCA 1NGBA 3CHWA 2W40A 3EO3A 3IDHA 5AQJA 4M63C 3KZBA 5AQYA 2A5XA 1NGGA 1HKGA 1R59O 4Y0WA 4BRLA 4IZ9A 1YVNA 3O6WA 4CD3A 2A3ZA 1XC3A 4BC5A 2IVPA 1Y64A 3QBXA 5KQ8A 3R6MA 4CJ7A 3FZKA 1LCUA 2HF4A 1WUAA 2ZWHA 3L6QA 1XUPO 3LM2A 5EXWA 1BOTO 1KAZA 3VESA 3CETA 3FFKB 3AAQA 3VF4A 2F9WA 1BU6O 3ATVA 3MMVA 1NLVA 4FL9A 1BG3A 5AQLA 1HPMA 1QHAA 2YHYA 3GL1A 3HBTA 4PL7A 3JXUA 1HKCA 2ASOA 5FPMA 3DWLA 1CZAN 3H3NO 5AQHA 4BRMA 4CBXA 4DHYA 1BUPA 5E84A 3VEYA 4PKHA 3EKUA 1OKJA 3CERA 4YDUA 3RSEA 3FZMA 3O5BA 5AQZA 4BROA 2NZTA 4CZEA 1ZBSA 1MDUB 3AAPA 5AQGA 2E2QA 3WXLA 5KPRA 1HJOA 4BRFA 3KHYA 4H5RA 1NGEA 1RFQA 2NLXA 4AM6A 2YJFA 3FLCO 2YI1A 1IG8A 3AY9A 3L4IA 3UB5A 4MO5A 3U9DA 2P9SA 3O80A 2P9UA 4IJAA 3WUHA 3D2FB 4BR7A 3CJ7A 2E88A 3R9PA 3BEXA 3D7EO 3TU5A 5KPZA 5I9EB 3C7NA 4HTLA 5JICA 1E4GT 4F9OA 4EAHD 4HWIA 4K41A 3M6GA 3BF3A 1GLAG 5AR0A 1GLFO 4QS8A 5BRHA 1MWMA 5AZJA 1NGDA 4CZIA 3CJAA 3UKRA 4IXCA 2IVOA 4FWPA 1BWFO 5AQOA 4AM7A 1GLLO 3B8AX 2BUPA 3LDOA 2CGJA 3ZX2A 4YDUC 4RWTA 2UYTA 4FWMA 4EIAA 4DB3A 5LJWA 2HMPA 4BRAA 5LJVA 5BRDA 2P9NA 3DJCA 2I7PA 5BRFA 3JS6A 3UKUB 2VCPA 4EHTA 4H5TA 5AFUH 4QS9A 2PBDA 3A5LC 3MDQA 3QFPA 3VOVA 2D0OA 3ID8A 1TYQB 2Q36A 2YCHA 2ZF5O 3IUCA 4GY2B 1SQKA 3R8EA 5F1XA 5AQRA 5AZIB 1U2VB 3VEWA 4BVPA 1P8ZA 2OANA 3MN9A 1T6CA 4FWQA 4IJNA 3W3DA 1NBWA 3M1FA 4BRDA 2P9KB 3ENHA 3M3ZA 4BRNA 2Q2RA 4BGAA 5ADXH 4KBOA 1ZXOA 4O5FA 1U6ZA 4FO0A 3VGMA 1T6DA 4MLEA 3VEOA 3O1WA 3G25A 2IVNA 3DXKB 3VGKA 5TKYA 4BQZA 2CGLA 4DCHA 4JNEA 3WXJA 5BREA 2H3GX 3OHRA 4BVOA 1J6ZA 3VF2A 2QWMA 1X3MA 2A40A 3QFUA 3KVGA 3MK6A 3FE1A 5BPLA 4IWVA 2GELA 5EOYA 4J8FA 2CGKA 3LDLA 2NRHA 4B1YB 3C0BA 2YJEA 3VENA 3W0LA 1GLBG 4BC2A 5AQKA 1ATSA 1QQMA 4H0TB 5BN9A 1KAXA 1KAYA 2Q1NA 2E8AA 2QXLA 4BRHA 4RCHA 1Z6RA 3FZFA 3LL3A 1NWKA 4EHUA 3IFRA 5FPEA 4BR9A 4FWNA 3H3OB 4WQ5A 1HLUA 2F9TA 2P9PA 4FOEA 4I6MA 3ZX3A 3ZEUA 1K8KB 2CH5A 3H1VX 4BR5A 1GLCG 4RTFD 3A8YA 2GEMA 4H5WA 1JCGA 4GNIA 5AQUA 2P9IA 3MN5A 4H0XB 3ZETB 1NGAA 2A6AA 4H5NA 2QWPA 3VETA 4JN4A 5EY4A 2D4WA 2GUPA 3LDPA 4H0VB 3WXKA 4H0YB 4FSVA 5LY3A 4B1UB 1TUUA 2DPNA 3FGUA 4ISEA 4B1ZA 1JCEA 2E1YA 4PKGA 1RDWX 2QWRA 2PAVA 3J8AA 3GOIA 5EVZA 4E1JA 5JLHA 1GLJO 3U4LA 4FPAA 3SMPA 3GE1A 1LOTB 4PKIA 2KHOA 3CI5A 2QWNA 3MN6A 4CZFA 3DAWA 1S22A 3ATUA 1QZ5A 3QB0A 2AP1A 3ENOA 5KQDA 4JHDA 4CZKA 3EL2A 2P9LA 4CZJA 5AQIA 4WQ5C 3RSEB 3HSCA 1ATRA 1ESVA 3LDQA 2V7ZA 3HI0A 3HTVA 3QICA 4BRPA 3DXMB 4MO4A 3BP8A 4LC9B 5KPTA 3CIPA 1NGFA 2E20A 4A61A 1HUXA 2A42A 2P9KA 4BG8A 1QZ6A 3VPZA 4FWKA 4WYBA 2QM1A 3H6EA 3LM9A 3D2EB 3QBWA 4BRKA 2E2PA 2VYPA 4CZMA 3H46O 1TUYA 2Q97A 3DXKA 4H03B 3ULEB 4BC3A 3VEVA 5AQMA 1GLEG 2E2NA 4BQLA 2YHXA 5AZJB 3FZHA 4JD2B 2V52B 4FWSA 2FSKA 3FR0A 3UKRB 1SZ2A 2ASMA 2D1KA 3UE5A 2FSNA 4B1XB 4C23A 5B8HA 4BC4A 4O8KA 3WT0A 4BG9A 5FPDA 5AQSA 1KXPA 4CZHA 4WQ4A 2P9NB 3O08A 2GTDA 2D0PA 2FLOA 4XH5A 2WUSA 3CJBA 4Z94A 4H0PA 4ISFA 3VEZA 3GDQA 4BGBA 3U8XA 4FPBA 4H5VA 3A0IX 1JCFA 1HX1A 1NGHA 3WEEB 3VF6A 4MLHA 3EKSA 1H1VA 1BA0A 2I7NA 4CZLA 5AQQA 1K8KA 1Q18A 4XH1A 1D4XA 1X9JA 2HF3A 1GLDG 5BN8A 4CZGA 1Z05A 2QW9A 3VEXA 5ELZA 3HM8A 4M7YA 3CJCA 3QMLA 1EQYA 2YHWA 3ZETA 1C0FA 5AFUA 2IIRA 5F2RA
chains in the Genus database with same CATH superfamily
3CQ8A 2FF3B 4IO9L 4HHTA 4CVNE 3IAYA 3O3GA 3HZ6A 1W97L 4WQ4C 1T44A 3BUZB 4WCEL 1XQSC 4IFYA 3OTOK 5CE3A 3HPHA 2PYLA 4O5BA 1IKWA 4KH6A 1S3XA 2HBLA 2E1ZA 3ZX0A 1T3VA 3HO1A 4JAXA 1IBMK 5CYMA 5BR9A 1HKBA 5BPNA 4DSKA 2B4JA 3WXIA 1NGJA 1S1UA 4FK0A 4YOXA 4KB1A 4K43A 1BA1A 5SZTA 3SYZA 3E9PA 3MWPA 4K42A 4OKJA 3SJJA 1P90A 4CBUA 3F9MA 3MEGA 3ZEUB 1EO1A 3V9XA 4MQ3A 2VQEK 2ASPA 1D8YA 4BRCA 4JKGB 1YITN 1JLBA 1IO2A 4BR2A 3QDKA 3LZIA 3VQCA 2XY5A 1NOZA 2P9IB 4CCHA 5AQNA 3P31A 4B8CA 1FXXA 2P1JA 4X64K 1G99A 3M8RA 1VK0A 3D2EA 3TTDA 3L3VA 5K14A 2G8FA 1IH7A 1C0MA 1U2VA 2HHUA 2VQFK 1IG9A 4KI4A 1FKOA 5C0YA 1YAGA 4BE1A 2V7YA 4DKWA 4GV6A 3A5MC 3OYIA 3VQPA 1VQNN 3CF5L 1CZ9A 4JKDA 5AQFA 3L2QA 4A59A 4FW1A 3V6DA 1NK9A 1XNRK 5J2NA 4DU1A 2P9LB 1E4FT 5J1EA 4CFAA 3ZSYA 3NGIA 1X1PA 3AGKA 3NMUA 2RHKA 2HBJA 3S41A 5AQWA 4M3UA 4BR4A 5FLXO 1RDDA 2B6AA 1RT3A 1FJGK 2BE2A 3P4IA 4W5OA 2F8TA 4K25A 2FF6A 2W00A 1Q82O 4FWRA 3AVAA 3MXJA 1KC8O 2OPRA 2WC9A 2P5GA 3R1XA 4CFCA 3PY8A 3AA4A 4E7HA 4I7FA 4ZHRA 3F73A 1NGCA 5LL6Z 4FJXA 3LWLA 3NAEA 4M63C 5AQYA 3OYMA 2A5XA 3AVJA 4JKEA 2UXCK 1HKGA 1R59O 4YHHK 3PIPL 1YVNA 3ITHA 3NH2A 1WSGA 1XC3A 1UAXA 1KSPA 3FZKA 2ZJRL 3THVA 2ZWHA 4LFCK 3AVHA 3CM6A 3NVKA 1XUPO 5CZ1A 4YFUA 4X65K 3CETA 3MMVA 4CJVA 1NLVA 2G8HA 4KHQA 4FCYA 4YNQA 3HBTA 3P39A 3THXA 4CJTA 5FPMA 4DTJA 2DTUA 1JL1A 3H3NO 2WTUA 3RMAA 3ID6A 4YOTA 3CCRN 4DSEA 3TANA 1NJIO 1W9HA 3EKUA 1TKZA 3QEVA 5JVHL 3RSEA 3FZMA 4WF9L 1WSJA 4LF7K 3QO9A 3TAPA 4CJLA 3ALYA 4IKFA 1HNZK 1U49A 2VG6A 3DLKA 4KTQA 3THWB 4AM6A 3VQ8A 3PX6A 4FJMA 1QTMA 1HMVA 4Z4HA 3AY9A 2YI1A 2YX6A 3L4IA 3R3LA 4JK8A 3P83D 3KLHA 4FW2A 3UB5A 3CG7A 3NHGA 4C8NA 4YOYA 4ILGB 3WUHA 3CJ7A 3B6PA 3CC4N 4Y1CA 3BEXA 4FLZA 1EP4A 1QVFM 4F9OA 3L8BA 3SNNA 4OPAA 1JLGA 1W0HA 2D5RA 2G8VA 4HWIA 4QOZB 4CIFA 5I3UA 4YOWA 4DFMA 3WNEA 4QS8A 1VSEA 5HBMA 1BI4B 1Q86O 4FWPA 2HBKA 1BWFO 3KLIA 1GLLO 5MLCQ 3OBWA 2HHIA 3OVNA 4EIAA 5LJWA 1B92A 3TI0A 2HMPA 1JXBA 5BRDA 2P9NA 2UUBK 4DR4K 4CHNA 3KLGA 3DJCA 2KKZA 1YIJN 3RRHA 3O9UA 5AFUH 5CZ2A 3A5LC 4NXMK 2KFNA 3ID8A 3A2FA 1CLQA 1TYQB 2Q36A 2YCHA 2OZSA 2ZF5O 4GY2B 1U45A 4CERA 4DQQA 5AQRA 2ZJQL 3SPYA 4FJIA 4JRQA 1P8ZA 3AO5A 1T6CA 4DTOA 3TTCA 4GW6A 4BRDA 3M3ZA 1NNEA 4BGAA 4KBOA 1J54A 3O3HA 3RMBA 3VGMA 3O4NA 4LF6K 1T6DA 1VQMN 4UY8O 4GKJK 4EP4A 4OPHA 2KTQA 3VGKA 4BQZA 4RW9A 3OYAA 4DCHA 4KH5A 5AJ3K 4CJRA 3SV4A 1O13A 1HJRA 3V9SA 3FE1A 4O0IA 2NRZA 3C0BA 4PHTX 1BQMA 1VQ4N 4BC2A 5AQKA 1RBVA 4JKFA 2HNZA 4DR1K 4CHYA 4IOXA 3E9LA 3VQQA 3JAMO 1Z6RA 3CMAN 2FBXA 3LL3A 2D0CA 5FPEA 4HCBA 3H3OB 3THWA 3CM5A 2P9PA 3ZX3A 5KRSA 1S5JA 2CH5A 2YNIA 3DMJA 2UUAK 3RVCA 2GEMA 3KK7A 3VA0A 3AV9A 2F4VK 2O8DB 5T7BA 3PV8A 3P38A 3IG1A 3PIOL 2GV9A 4CESA 2D0BA 3ZETB 4CEBA 1NGAA 4KHYA 1JXEA 2O8CB 3SAHA 3WNHA 5EY4A 3T7ZA 3DRPA 3BGRA 3HVTA 3LDPA 2HNDA 4H0YB 4H0VB 3WXKA 5LY3A 3SUNA 2HHVA 4XJXA 1TUUA 1BL3A 4B1ZA 4YORA 4MFBA 3CCUN 4PWDA 3J8AA 5EVZA 4E1JA 1LW0A 1GLJO 4ELTA 4FPAA 4C8MA 1NOYA 1LOTB 2KHOA 3AA5X 2Z1GA 2QWNA 1REVA 1FK9A 4E89A 1EKEA 4NYNA 2AP1A 5KQDA 4JHDA 3TAQA 4CZJA 4GVMA 1YJWN 5AQIA 4CHZA 1NU0A 4WQ5C 3HSCA 1ATRA 3O9TA 1M90O 2OPSA 3ZT4A 4AHRA 4G1QA 4DR3K 1RNHA 3QICA 3RR7A 1G15A 3DXMB 1VQON 2E5LK 1KCFA 3AVKA 3LP0A 2HB5A 4B3MK 2Z1IA 3TSUA 2A42A 3ULDA 3ZT2A 4V19S 1A5WA 1TL3A 2HHQA 3L2RA 4JEPA 2QM1A 4HTUA 3CXCM 3QBWA 4BRKA 4Z4IA 2VYPA 3S3OA 1X9MA 1KVCA 4LFAK 4PA1A 1TKTA 5KGXA 2FSKA 1IBLK 4O8UA 4LY7A 3VTHA 1A5VA 4JI2K 4GV9A 2O8BB 2C1IA 4BG9A 1C1CA 2D0PA 3HP9A 3CJBA 1NK8A 1RDCA 3CFRA 3MX5A 4ISFA 4BDZA 4KV8A 3U8XA 4H5VA 1WBBA 3A0IX 1HX1A 1NGHA 3S3NA 2WONA 3P5JA 4QCLA 4DLGA 1YJNN 5IWAK 1KLNA 1OH8A 4XH1A 3TABA 3VN5A 5BN8A 2O8DA 4DFJA 4JKAA 5H1SQ 1EQYA 2RN2A 3CCJN 3ZETA 4IO8A 1YI2N 4KHNA 1LWCA 4NO7A 1HNWK 3M8PA 2FSJA 1E3MA 2UXBK 5GAHP 1BHLA 5LMNK 3G4SN 3CJ1A 1ZBLA 2Q0RA 3AVNA 4CI6A 1U48A 4FJJA 3HOSA 4CGDA 3DLRA 4PL8A 3LAKA 3EZWA 3J80O 1EX4A 4ISGA 1DGKN 5HRSA 3ZCMA 3F5TA 3T1YK 4CJPA 4CE9A 4ELUA 3V9WA 1MWKA 4CF1A 3VMFB 4OLAA 3M8SA 2PZSA 3MWTA 1RDUA 4I6MB 3DXMA 4HUEA 3VTIA 1RGIA 1QQOA 3A5OC 1V4TA 4BRIA 1WBDA 1YHQN 2YNGA 4H8KA 1L3VA 4CEFA 2J4RA 4XEIA 3UKUA 4CHPA 5M1FA 3HK2A 5C42A 2QTDA 2O8EA 4ID5A 2G8UA 4FJ7A 5C15A 2Q31A 3M8QA 4JI8K 4KTWA 3SMSA 1LWFA 1SV5A 4IG0A 4B9QA 2ITMA 1BIZA 4DQ8A 4JK7A 4H4MA 3K9KA 1RTIA 2VWBA 3K59A 1D9FA 4BRGA 2Z1JA 1NMNA 3KLEA 2BDPA 1TGOA 1NKEA 4OKKA 1C0GA 4A62A 3QESA 3VGLA 1J53A 4DTSA 1N8RO 3IKMA 1TKDA 3WQUA 3O8MA 2OA8A 1GOBA 1WLJA 5AQTA 4CFBA 1CZBA 4KPYA 3OYHA 1W2BM 3SUOA 4K0KK 3K57A 3GG4A 2XY8A 1RT2A 3U9ZA 1BDGA 3F9KA 2ZJPL 3ZYYX 4A57A 3C6TA 3EO3A 4DTMA 3IDHA 2HVIA 1S1VA 3LDSA 2O4GA 1BIUA 4BRLA 4E7IA 4IZ9A 4CD3A 3NDKA 2E4LA 4KHPK 2NRVA 3ISNC 4KFBA 1VHXA 4CFDA 5KQ8A 3MCAB 1NJYA 4IDHA 3L6QA 2BH1A 2E6LA 2QI2A 3OJSA 3VQ7A 3VESA 4B8AB 4DTRA 3AAQA 1NK4A 2HHSA 1BG3A 3TR8A 4LH4A 4JI0K 1YTAA 1FW6A 3THYB 5DMRA 4RW6A 3DWLA 1CZAN 4Q5VA 2Y1JA 1HYSA 4I9QA 1BUPA 5J2PA 3VEYA 3SQ0A 1QHTA 4PKHA 3G10A 3V4IA 2O4IA 3C6UA 5AQZA 1MDUB 3WXLA 4FJKA 4BRFA 4MDBA 4H5RA 2NLXA 3NGZA 4E19A 3FLCO 2PFUA 3LPTA 3U9DA 3O80A 1EETA 1J9AA 3D2FB 1VSFA 4N76A 4CJ3A 2JWLA 4CJEA 1VSMA 1L5UA 2E88A 4DQPA 5HRRA 2RE2A 3TU5A 5I9EB 4HUFA 4HTLA 4CF2A 3ZSOA 4EAHD 1VQ7N 3VQ9A 2UU9K 1RDBA 1KVAA 3ZSZA 5D3GA 1GLAG 5GINA 1RBSA 5BRHA 3DLLL 1NGDA 3CJAA 2C1GA 3UKRA 2Z1HA 4IXCA 2QK9A 3QEPA 3SAGA 2CGJA 3ZX2A 4CEDA 2UYTA 1QSYA 4DB3A 2NRRA 2QKKA 5LJVA 4WFNL 4JK9A 4KREA 3EZ5A 3NF6A 1SKWA 2FC0A 1EWQA 5BRFA 2QXFA 4AHTA 3JS6A 1JLCA 4OPKA 2VGNA 4CJ4A 5FROA 2PBDA 2OCEA 4JI6K 1HNVA 4FZZA 4CEZA 4O4GA 2D0OA 4BDPA 3CC7N 1ZBHA 4JV5K 4FJ5A 5AZIB 3NCIA 3VEWA 4DV5K 4CEEA 4FWQA 3W3DA 4MDAA 4KHSA 3AO4A 3M1FA 4ZTFA 4CGFA 1RBRA 2KQ2A 3ZT3A 4BRNA 5ADXH 4JI5K 3VQAA 4DR7K 1U6ZA 4FO0A 4MLEA 4B3TK 3SAFA 1HNXK 1YF5L 3KK1A 3VEOA 4CJWA 3AVFA 3Q7CA 1X9WA 3KD1E 3OHRA 4QAGA 3VF2A 1Z25A 2A40A 3KIOA 3QFUA 4IWVA 2GELA 3E01A 5EOYA 3THYA 4J8FA 3LDLA 2GX9A 1NK6A 2NRHA 2YJEA 5HRPA 1HYVA 3AVCA 1GLBG 4JS4A 1ATSA 1LW2A 3CCEN 3J81O 4H0TB 3N4PA 3C6HA 3SQ2A 2Q1NA 3WNGA 2QXLA 3FZFA 5HLFA 4DFKA 4BR9A 3K2PA 1TK8A 3KTQA 3NFAA 4DTPA 4EZ6A 4CF9A 3ZEUA 3H1VX 2IOCA 1CXQA 3TWHA 1GLCG 4CJ5A 3A8YA 3QNNA 2XO7A 5C10A 4FM1A 3ZT0A 4JKGA 4H5WA 2HHHK 4OGCA 4M3ZA 2PY5A 4AHSA 2P9IA 3OYEA 3NE6A 3D6RA 1YJ9N 3U3YA 2A6AA 4H5NA 3C95A 2KLAA 1Q81O 3DLBA 3O9QA 2QWPA 1T03A 2NRTA 2VWKA 1W7AA 3VETA 4M3XA 4O44A 2D4WA 2GUPA 3OS1A 4YOUA 4B1UB 2DPNA 2QWRA 3GOIA 4FLVA 2ITGA 3SMPA 3AO2A 3GE1A 4O55A 3MN6A 3KLFA 4L8RB 3DAWA 2NRXA 3LANA 4CZKA 3EL2A 2P9LA 3I0RA 3BZKA 4AH9A 3HXMA 3SQ1A 2DFEA 4F3OA 2B5JA 3OJUA 3OYCA 5KTQA 5KPTA 3CIPA 4CK2A 4CGIA 4CGJA 4B3RK 2X78A 1C0UA 4BG8A 3QEXA 5C2FA 3PO5A 1DTQA 3H6EA 1XHXA 3S5TA 1ASUA 4H03B 3ULEB 3VEVA 2OPQA 4B9TA 4BQLA 5AZJB 4JD2B 2V52B 4FWSA 3G6EN 1SZ2A 1L3UA 1LV5A 4FM2A 5FRNA 4C23A 3KKSA 1SL2A 3ZSRA 1KVBA 1ZBFA 1RCHA 2KZZA 5JS2A 3SCXA 2ETJA 3EYZA 2GTDA 2FLOA 4Z4GA 4XH5A 4HVJA 3M5RA 2F8SA 1Y97A 4H0PA 3VEZA 4B9SA 3SBGA 3MX2A 4CF8A 4RW7A 3WEEB 1SUQA 1YTUA 4MLHA 1OH6A 3NVMA 2QEXN 4DS4A 2I7NA 4CZLA 4IEIA 5AQQA 1XHZA 1N36K 3ENBA 4J2DA 4CHOA 1LAWA 3AVGA 4M7YA 3QMLA 3L2UA 2YHWA 1VQ9N 4IG3A 1C0FA 2G8KA 5AFUA 1LAVA 2IIRA 2VWJA 1S1WA 4JI7K 4CK1A 4BRQA 1I94K 3NF7A 3K5NA 2BTFA 1T7PA 1XMOK 1XI1A 2BGGA 1SAZA 3NH1A 4CK3A 5A2QO 1ATNA 4N41A 2GWJA 3O1BA 4KH4A 1SL0A 4BR0A 4F4KA 5SWMA 4FWLA 1FKPA 4B9UA 2HOEA 1K73O 3AVIA 1BI4A 3ZSWA 3BF1A 4KO0A 4B3OA 3DLGA 3GBTA 3AVBA 3OS0A 4B9VA 3EN9A 1J5EK 1QQNA 3CYGA 3A5NC 1NJXA 4XH4A 3MN7A 4A2AA 1M1KO 4BECA 1ZC6A 4FK4A 2WOMA 3OYNA 1TYQA 1Q8IA 3WQTA 1JL2A 1WOQA 2HHTA 1HPZA 1WSFA 4B08A 1XC9A 1UWBA 1RBUA 3ULEA 5EU7A 4W5TA 1DKGD 2P9UB 4JI4K 1O1WA 4JD2A 1NK7A 2I5JA 4YY3K 2X6SA 3O4WA 3TAGA 4J2AA 4KHWA 2FXUA 2W41A 5C25A 4DSIA 3EE8A 4DV0K 1DEJA 3V9ZA 4LF4K 2QWLA 4TSXA 1NM1A 4JYAK 3I56N 3SUQA 1RT6A 4CD1A 4KTZA 3L0QA 1BGXT 3CYMA 1WSEA 3SPZA 4F2SA 2FBVA 2KZMA 1IKVA 1VSIA 2VG7A 2X74A 3WEEA 4BREA 1DT9A 3LDNA 3H45C 4B1WB 2QWOA 5FDLA 5HOOA 4FOIA 1KLMA 2ZE2A 4H0OA 4AQYK 1VSKA 1MU2A 3NF8A 1C0TA 1JLFA 3CCMN 4FWOA 4DLEA 5F0XA 2YKNA 1YXQA 3BY5A 3DOLA 3MCPA 4CJSA 4M7XA 4DV4K 5M1KA 1NGBA 4JS5A 4GV3A 4GVEA 3VQBA 1RDAA 3RR8A 1UOCA 5AQJA 3AA3A 1NGGA 3JSMA 4IFVA 1ILYA 4DTNA 4Y0WA 1VQPN 1BCMA 3CPWM 4DQSA 1RTJA 4DUZK 4YOVA 2IVPA 3VQEA 1Y64A 3QBXA 3SV3A 4CJ7A 4NLCA 2HF4A 1WUAA 5KI6A 3ASMA 4NCGA 4BE7B 3G71N 3LM2A 5M1QA 5EXWA 4A5BA 2O8CA 2OPPA 4FJHA 3CPEA 1NKCA 3VF4A 2F9WA 3ATVA 4FL9A 1HPMA 3B6OA 4F3TA 5JS1A 4KKOA 3Q7BA 3JXUA 3PUFA 3TAMA 3NF9A 5AQHA 2UXDK 4CBXA 1VAZA 3KWGA 4IEEA 4DHYA 3V1RA 5E84A 3RMDA 1OKJA 3CERA 4YDUA 4DF8A 2UUCK 4BROA 2NZTA 4CZEA 3AO3A 1ZBSA 3AAPA 2E2QA 3BZCA 4BEBA 5KPRA 5FRMA 1HJOA 3CCQN 3KHYA 1RFQA 3V9UA 2YJFA 2JWKA 3HRGA 4DG1A 1JLEA 2P9UA 4IJAA 1VRUA 4J2BA 4BR7A 4JKBA 4DV7K 3R9PA 3MECA 3T1HK 2AJQA 4DSJA 3D7EO 4FVUA 5KPZA 1CXUA 4M41A 5JICA 1E4GT 1N34K 1UA1A 2OTLN 1F21A 1IKYA 4K41A 3M6GA 4OO1J 5AR0A 4CECA 4C8OA 1Q9XA 4OGEA 4CZIA 1VQ5N 3H08A 3ZSVA 2IVOA 5J2MA 2F7TA 3LP2A 4AM7A 3DM2A 3B8AX 2BUPA 1SL1A 4FWMA 2RKIA 1KFSA 2O8BA 3LWMA 4E72A 1ZBIA 4DV2K 3C65A 1QSLA 4FLWA 4OPJA 1R0AA 2YNFA 2W42A 3WXMB 4QS9A 5JENA 3CFPA 1XMQK 3PX0A 4GMJB 3SZ2A 1QS4A 1WAJA 1SQKA 4IBNA 1U2VB 3NGYA 2OANA 3MN9A 4IJNA 4BWMA 4ICLA 3CMEN 1ASWA 3I55N 5E41A 4O5FA 4E7JA 5DM6L 2KFZA 3O9SA 3OYGA 3O1WA 2IVNA 3QNOA 3DXKB 4WFBL 4CJQA 4FLXA 5DK5A 2CGLA 2P51A 3HPGA 3OYBA 4OX9K 4C8KA 1HYZA 2QWMA 3KVGA 3MK6A 3OA9A 2YV0X 2CGKA 3PSIA 4CW7B 4A5AA 4K8ZA 2ZQBA 3S3MA 4IOCL 2D0AA 1N5YA 3RWUA 1QQMA 1VQLN 1VQ8N 1KAXA 1KAYA 3E9OA 2EHGA 4BRHA 4RCHA 2Y1IA 5CYQA 1NWKA 4EHUA 1L3SA 4K8XA 4FWNA 1D9DA 1HLUA 4I6MA 3T69A 1U4BA 4FLUA 1HR0K 4BR5A 1NG9A 4RTFD 1Z26A 2GBZA 1JCGA 4O0JA 4FZYA 3EY1A 4GNIA 3MN5A 4H0XB 1KRPA 3SUPA 4Z4FA 4FM0A 4CJFA 2YNHA 3FGUA 4ISEA 1JCEA 1S6QA 2E1YA 1RDWX 3PX4A 3SQ4A 2E6MA 5GAEP 5JLHA 5IT9O 4DR2K 3U4LA 3THXB 4FJLA 1JLQA 3DYAA 3EE9A 4DQRA 3CI5A 5GIOA 4CZFA 4AHUA 3OYLA 3QEIA 1QZ5A 3QB0A 3CCVN 4C1NI 3RTVA 3RSEB 2G8WA 3CCLN 1B9DA 4X62K 4Z4EA 2DY4A 4LSLA 2IC3A 1ESVA 3LDQA 4FK2A 1VSHA 3HYFA 2V7ZA 3HI0A 3HTVA 5KRTA 4R5PA 1OVYA 3QERA 1RT5A 3D0PA 2DFFA 2NNWA 3LP1A 2NUBA 3BP8A 1C1BA 3F2KA 1U47A 4NCBA 2E20A 3HSTB 4DQIA 1ZYQA 4FLYA 4IDKA 4FLTA 3SI6A 1DLOA 4NCAA 4WYBA 3MEEA 1QSSA 3LM9A 2DFHA 2E2PA 3SBTA 4KAZA 4ID1A 4M45A 4C8LA 2Q97A 3DXKA 4BC3A 5AQMA 4BWJA 4CIGA 2PYJA 2YHXA 4W5NA 3CFOA 4CF0A 2D1KA 4OKEA 1WSIA 4N56A 1RT7A 2FSNA 4B1XB 4KB0A 4E7LA 1U04A 1KXPA 5AQSA 4WQ4A 4CZHA 2P9NB 1SKSA 4Z4CA 4M3RA 3ZSQA 4HUGA 4PQUA 1HRHA 1BISA 4BGBA 4LF5K 4FPBA 3V1OA 1JCFA 3VF6A 4RW8A 1RT1A 3EKSA 3K5LA 3OYKA 1H1VA 4DS5A 3U3GA 2LSNA 3DLEA 1Q9YA 4DMNA 1Q18A 4JI1K 3QEWA 1I3AA 2WFBA 4N5SA 1D4XA 3IRXA 1X9JA 2HF3A 1GLDG 3V81A 1Q7YO 2IAJA 4C1NK 3VEXA 1N33K 3J7AP 1IKXA 4FJ9A 3QINA 4AF1A 3PO4A 1BO5O 3OBYA 4PY5A 3VA3A 3MXIA 5E26A 5CY4A 4BACA 3PSFA 4B9NA 3PLAA 3D2FA 4Y1DA 1EXQA 1X3NA 5ADXA 4AHVA 1S1XA 3MXMA 4DUYK 1KQSM 4LSNA 2AA4A 3KKRA 4CBWA 4FJGA 2OYQA 1YUWA 3CQXA 2RPIA 4GKKK 1V4SA 3OW2M 4DR6K 4IOAL 3VQ5A 1VQKN 1NKBA 4B9LA 5JMVA 3SJHA 3VERA 5JLFA 2A41A 1ITGA 2P9PB 5M1PA 3CC2N 1UA0A 4ZTJA 4XIUA 4KRFA 5CHIA 2IS3A 1WN7A 1NMDA 1RTHA 3ZSXA 4QS7A 4B1VA 2QA4N 1MA9B 5BPMA 3C94A 2QWQA 5GAGP 1NGIA 4R79A 4LH5A 3AARA 4DV6K 4DTXA 2V51B 3DRRA 3LALA 4E7KA 1IV0A 5AZIA 3L3UA 1TK5A 5FPNA 4WE1A 4EFHA 2P9SB 4DF4A 5GIPA 4DV3K 1D5AA 4B3SK 4OLBA 2NRWA 3O3FA 4OVLA 3K9JA 1JJ2M 1XWLA 1WB9A 4EZ9A 4E3SA 3CJ9A 2A1RA 3HOTA 3C7NB 4CGGA 2O8FB 2YKMA 2CH6A 3SK3A 2ZGZA 3FZLA 2Q0UA 5C2DA 1IJJA 4JHDB 3IMXA 3I8BA 4FXDA 2W6KA 2KW4A 3C6AA 3TPQA 5AQVA 4X66K 3BDPA 3RRGA 3I33A 1KTQA 5JVGL 2EWSA 4L3QA 1KFDA 2HSTA 1WNSA 2ZGYA 4PUOA 3V1QA 3H1QA 2E2OA 3SLCA 5AQXA 5AQPA 4LF8K 3CQYA 3JYTA 2GWKA 4A2BA 5EX5A 4NB4A 3RMCA 1JLAA 3CHWA 1RTDA 2W40A 3LZJA 2A1SA 2WBNA 3KZBA 5M1OA 2W6LA 5GADP 1VRTA 3O6WA 2A3ZA 4BC5A 3R6MA 1LCUA 1DTTA 3TAEA 1WSHA 4FVMA 3ZT1A 2JLEA 1BOTO 1KAZA 3FFKB 4CEOA 4CEQA 3I8DA 1BU6O 3L2WA 1SS6A 1EWRA 2RF2A 1B9FA 4FYDA 1HNIA 4E1MA 5AQLA 1QHAA 2YHYA 4DR5K 3GL1A 4CGHA 4F8RA 1RBTA 4PL7A 5HL7L 1HKCA 2ASOA 2HHXA 1GOAA 5HP1A 4ELVA 4BRMA 3J7ZO 4BE0A 3J7YP 3KK3A 2OZMA 4G9ZA 4CJUA 3K58A 1TL1A 3LAMA 2IGIA 3KWIA 5M1NA 3OYDA 3O5BA 4U67L 4Q0BA 1IBKK 3HM9A 5AQGA 2XY7A 4WFAL 4FJNA 1NGEA 1S6PA 3MAQA 5HRNA 2FBTA 1IG8A 2HMIA 2HNYA 2XHBA 3TTFA 4MO5A 2P9SA 4CIEA 1XNQK 1KD1O 2YHAA 1VSLA 3T19A 5C12A 3HVRA 3WNFA 4RG8A 2P5OA 3VQ4A 4JKCA 3C7NA 4DTUA 2O8FA 4NXNK 2YHBA 1TV6A 3BF3A 3AA2A 1GLFO 1MWMA 5AZJA 4BY9C 2R7YA 4EP5A 3DRSA 5AQOA 1T05A 4E0DA 3LDOA 1C6VA 4YDUC 4RWTA 2GUIA 4BRAA 2Q3SA 3L2VA 1YVUA 4BE2A 1RT4A 4B9MA 2JGUA 3CD6N 2I7PA 3P1GA 3K0SA 1GOCA 1RILA 3UKUB 2VCPA 4EHTA 4H5TA 5J2QA 2HVHA 3MDQA 3QFPA 3QIPA 2ATQA 2O8EB 3VOVA 4BDYA 3IUCA 3R8EA 5F1XA 4JKHA 5CR4A 4BVPA 1TAUA 4W5RA 1NBWA 2P9KB 3DI6A 3ENHA 2OTJN 2Q2RA 5HROA 1ZXOA 4CJKA 3K5MA 3E66A 5BR8K 1OH7A 3G25A 4KI6A 4M3TA 3E1YA 5TKYA 1JKHA 1QE1A 1BCOA 1S1TA 5I42A 4JNEA 3WXJA 5BREA 2H3GX 4DFPA 4BVOA 1J6ZA 2F96A 1NJZA 1X3MA 5BPLA 1S72N 4AHCA 3HL8A 1A5XA 4B1YB 3W0LA 3VENA 3DLHA 4Z0UA 4I9LA 4OJRA 4DV1K 2ZD1A 3KK2A 4M3WA 4FZXC 3HT3A 2FBYA 5BN9A 2QKBA 4DSLA 2E8AA 3KD5E 4JI3K 3O4QA 3IFRA 3TSPA 3S9HA 1TVRA 1OH5A 3ZLJA 4F2RA 3TSQA 3N4QA 1LWEA 4WQ5A 2F9TA 4FOEA 3OS2A 1K8KB 1N32K 3VQ6A 1NK5A 5KGWA 1BQNA 3U6FA 2VGMA 3AGRA 5AQUA 1S9EA 3OYFA 1SKRA 3T3FA 1QQCA 5DM7L 4ILJA 3OY9A 2HHWA 1TKXA 3AO1A 3K5OA 3LP3A 4JN4A 2IDOA 4I2PA 4FSVA 3T1AA 4PKGA 2BANA 2PAVA 4W5QA 2EX3A 4JRPA 4E1NA 4N47A 2VG5A 4PKIA 2HBMA 3TAFA 1VQ6N 4U7BA 4DSFA 1S22A 3ATUA 2ZM6K 3ENOA 3LPUA 3VQDA 2HW3A 4M3YA 3QIOA 4LD0A 3EEQA 4H4OA 4BRPA 2XY6A 1QVGM 3FFIA 4MO4A 1N6QA 3DOKA 4LC9B 1NGFA 3QLHA 3MEDA 4DU3A 4A61A 1HUXA 4NYFA 4RW4A 1TK0A 2P9KA 3HJFA 1QZ6A 3VPZA 4FWKA 1ASVA 4CEAA 3QETA 3D2EB 1NK0A 4CZMA 3H46O 1X9SA 1TUYA 2X6NA 4HCCA 4IFEA 4NLBA 1GLEG 2E2NA 1K8AO 1I39A 3FZHA 3D45A 4LFBK 4M42A 3FR0A 3UKRB 4J2EA 4AILC 4LF9K 4ILHA 2ASMA 4KHUA 3UIQA 3AVLA 3UE5A 5B8HA 3G0ZA 4BC4A 1L3TA 4O8KA 3WT0A 5FPDA 1HQUA 2G8IA 3O08A 5C24A 3NBPA 2WUSA 4Z94A 3O9RA 1K9MO 2XRIA 5LMUK 3CCSN 1TAQA 3GDQA 4DWIA 1VSDA 1C1AA 1T8EA 1ZBUA 3AVMA 5TKWA 1K6YA 4DU4A 1BA0A 3OYJA 1YT3A 4I2QA 4JLHA 3NH0A 3KJVA 3TARA 1K8KA 1NJWA 3I0SA 1OVQA 3IS9A 3L4QA 3HPOA 1J5OA 4UQGA 1S9GA 4CZGA 1Z05A 1VSJA 2QW9A 5ELZA 1WAFA 3HM8A 3CJCA 4CHQA 4FJ8A 1HQEA 3HP6A 5F2RA
chains in the Genus database with same CATH topology
4IO8A 1BO5O 4BRQA 3OBYA 2FF3B 4IO9L 1YI2N 2BTFA 4NO7A 5E26A 3HZ6A 2FSJA 1W97L 4WQ4C 1T44A 3BUZB 5GAHP 1SAZA 3G4SN 3CJ1A 3PLAA 1ATNA 3D2FA 4WCEL 1XQSC 2Q0RA 5CE3A 4CI6A 2GWJA 3HOSA 1X3NA 5ADXA 3O1BA 4KH6A 1S3XA 2HBLA 4KH4A 2E1ZA 4PL8A 3ZX0A 1KQSM 3EZWA 1T3VA 2AA4A 4CBWA 4ISGA 1DGKN 4JAXA 4BR0A 1YUWA 3F5TA 4FWLA 5BR9A 3CQXA 1HKBA 1MWKA 2HOEA 5BPNA 1K73O 1V4SA 3OW2M 4IOAL 3BF1A 3WXIA 1VQKN 3VMFB 1NGJA 4YOXA 3GBTA 4K43A 3SJHA 1BA1A 3VERA 5JMVA 5JLFA 3MWTA 3E9PA 1RDUA 2A41A 3EN9A 1QQNA 2P9PB 1P90A 3MWPA 3DXMA 3F9MA 4I6MB 4K42A 3A5NC 5M1PA 3VTIA 3ZEUB 3CC2N 1EO1A 4XH4A 3MN7A 5CHIA 1RGIA 1QQOA 2ASPA 1V4TA 3A5OC 4BRIA 1YHQN 1NMDA 4A2AA 1M1KO 4QS7A 4BRCA 4JKGB 2J4RA 4XEIA 3UKUA 4B1VA 5M1FA 1ZC6A 1YITN 4BECA 2QA4N 4BR2A 1MA9B 3QDKA 2QTDA 5BPMA 2QWQA 2P9IB 5GAGP 5AQNA 3P31A 1NGIA 1TYQA 3WQTA 4R79A 1G99A 1WOQA 3AARA 3D2EA 2V51B 3TTDA 5C15A 2Q31A 5AZIA 1U2VA 3ULEA 3SMSA 5FPNA 4EFHA 2P9SB 1DKGD 2P9UB 5GIPA 4JD2A 2NRWA 5C0YA 1YAGA 4B9QA 2V7YA 3K9JA 2ITMA 1JJ2M 4DKWA 3O4WA 3A5MC 4GV6A 4DQ8A 2FXUA 2W41A 4JK7A 3EE8A 3CJ9A 3K9KA 3HOTA 3C7NB 1DEJA 3CF5L 1VQNN 2VWBA 4JKDA 5AQFA 4A59A 2CH6A 3SK3A 4BRGA 2QWLA 2ZGZA 3FZLA 1NM1A 2Q0UA 5C2DA 1IJJA 3I56N 4JHDB 3IMXA 2P9LB 3I8BA 4CBUA 1E4FT 4CD1A 3L0QA 3AGKA 1C0GA 4A62A 3NMUA 2RHKA 3C6AA 3VGLA 3TPQA 5AQVA 2HBJA 3I33A 3IKMA 3S41A 1N8RO 3WEEA 5AQWA 4BREA 1DT9A 5JVGL 2EWSA 3LDNA 4BR4A 3H45C 4L3QA 2QWOA 4B1WB 5HOOA 4FOIA 3WQUA 2HSTA 3O8MA 2ZGYA 4H0OA 3P4IA 3H1QA 2E2OA 3SLCA 5AQTA 4K25A 5AQXA 2FF6A 5AQPA 2W00A 1Q82O 4FWRA 1KC8O 1W2BM 3CCMN 2WC9A 4FWOA 3R1XA 3GG4A 5F0XA 3CQYA 3U9ZA 2GWKA 1BDGA 4A2BA 5EX5A 2ZJPL 4NB4A 1YXQA 3ZYYX 3MCPA 4M7XA 4A57A 1NGCA 1NGBA 3CHWA 5M1KA 4GV3A 4GVEA 2W40A 3EO3A 3IDHA 5AQJA 4M63C 2WBNA 3KZBA 5AQYA 5M1OA 2A5XA 1NGGA 4JKEA 5GADP 1HKGA 1R59O 1ILYA 4Y0WA 4BRLA 1VQPN 3CPWM 4IZ9A 3PIPL 1YVNA 3O6WA 4CD3A 2A3ZA 1XC3A 2NRVA 4BC5A 4YOVA 2IVPA 1Y64A 3QBXA 5KQ8A 3R6MA 4CJ7A 3MCAB 4NLCA 3FZKA 1LCUA 2HF4A 2ZJRL 4IDHA 1WUAA 2ZWHA 4BE7B 3L6QA 2BH1A 3NVKA 1XUPO 3G71N 3LM2A 5M1QA 5EXWA 4A5BA 2QI2A 1BOTO 1KAZA 3VESA 3CPEA 3CETA 3FFKB 3AAQA 3VF4A 2F9WA 1BU6O 3ATVA 1SS6A 3MMVA 1NLVA 4FL9A 1BG3A 5AQLA 1HPMA 1QHAA 2YHYA 3GL1A 3HBTA 3P39A 3Q7BA 4PL7A 3JXUA 1HKCA 5HL7L 2ASOA 5FPMA 3DWLA 1CZAN 3H3NO 5AQHA 4BRMA 4CBXA 1VAZA 3KWGA 3J7ZO 4IEEA 4DHYA 3ID6A 1BUPA 4YOTA 5E84A 3VEYA 3CCRN 4G9ZA 4PKHA 1NJIO 5M1NA 3KWIA 3EKUA 1OKJA 3CERA 4YDUA 3RSEA 3FZMA 3O5BA 5AQZA 4BROA 2NZTA 4CZEA 4U67L 4WF9L 1ZBSA 1MDUB 3AAPA 5AQGA 2E2QA 3WXLA 4BEBA 5KPRA 4WFAL 1HJOA 4BRFA 4MDBA 3KHYA 4H5RA 3CCQN 1NGEA 1RFQA 2NLXA 4AM6A 2YJFA 2JWKA 3AY9A 2YI1A 1IG8A 2YX6A 3FLCO 2PFUA 3L4IA 3HRGA 3R3LA 4JK8A 3TTFA 3UB5A 4MO5A 3U9DA 2P9SA 3O80A 2P9UA 4IJAA 4YOYA 4ILGB 3WUHA 3D2FB 1KD1O 4BR7A 3CJ7A 4JKBA 5C12A 2JWLA 3CC4N 2E88A 3R9PA 3BEXA 4FVUA 3D7EO 2RE2A 4JKCA 3TU5A 5KPZA 5I9EB 3C7NA 4HTLA 5JICA 1E4GT 1QVFM 4F9OA 4OPAA 4EAHD 2OTLN 1VQ7N 4HWIA 4K41A 3M6GA 3BF3A 4OO1J 4YOWA 1GLAG 5AR0A 5GINA 1GLFO 4QS8A 5BRHA 3DLLL 1MWMA 5AZJA 1NGDA 4CZIA 3CJAA 1VQ5N 2C1GA 3UKRA 4BY9C 4IXCA 1Q86O 2IVOA 4FWPA 2F7TA 2HBKA 1BWFO 5AQOA 4AM7A 3SAGA 1GLLO 3B8AX 2BUPA 3LDOA 5MLCQ 2CGJA 3OBWA 4YDUC 3ZX2A 4RWTA 2UYTA 4FWMA 4EIAA 4DB3A 5LJWA 2HMPA 4BRAA 2NRRA 5LJVA 5BRDA 4WFNL 2P9NA 3C65A 4JK9A 3DJCA 3CD6N 2I7PA 5BRFA 2KKZA 3JS6A 3UKUB 1YIJN 2VCPA 4EHTA 3O9UA 4H5TA 3WXMB 2VGNA 5AFUH 4QS9A 2PBDA 3A5LC 3MDQA 3QFPA 3VOVA 2D0OA 3ID8A 5JVHL 1TYQB 2Q36A 2YCHA 3CC7N 2ZF5O 3IUCA 4GY2B 1SQKA 3R8EA 5F1XA 4JKHA 5AQRA 5AZIB 2ZJQL 1U2VB 5CR4A 3VEWA 4BVPA 1P8ZA 2OANA 3MN9A 1T6CA 4FWQA 4IJNA 3TTCA 3W3DA 4MDAA 1NBWA 3M1FA 4BRDA 2P9KB 3ENHA 3M3ZA 4BRNA 3CMEN 2Q2RA 4BGAA 5ADXH 2OTJN 4KBOA 1ZXOA 3I55N 4O5FA 1U6ZA 4FO0A 3VGMA 1T6DA 4MLEA 3E66A 5DM6L 1VQMN 3SAFA 4UY8O 3O9SA 1YF5L 3VEOA 3O1WA 3G25A 2IVNA 4OPHA 3DXKB 3VGKA 3E1YA 5TKYA 4WFBL 4BQZA 2CGLA 4DCHA 3Q7CA 4JNEA 3WXJA 5BREA 4KH5A 2H3GX 3OHRA 4BVOA 1J6ZA 3VF2A 1O13A 2QWMA 1X3MA 2A40A 3QFUA 3KVGA 3MK6A 3FE1A 3OA9A 5BPLA 1S72N 4IWVA 2GELA 5EOYA 4J8FA 2CGKA 2GX9A 3LDLA 2NRZA 2NRHA 4B1YB 3C0BA 2YJEA 3VENA 3W0LA 4PHTX 4A5AA 1GLBG 4IOCL 1VQ4N 4BC2A 5AQKA 1ATSA 3CCEN 1QQMA 4JKFA 4H0TB 5BN9A 1VQLN 1VQ8N 1KAXA 1KAYA 3E9OA 3C6HA 3N4PA 4IOXA 2Q1NA 2E8AA 3E9LA 2QXLA 4BRHA 4RCHA 1Z6RA 3CMAN 3FZFA 3LL3A 1NWKA 4EHUA 3IFRA 3TSPA 5FPEA 4BR9A 3TSQA 3N4QA 4FWNA 3H3OB 4WQ5A 1HLUA 2F9TA 2P9PA 4FOEA 4I6MA 3T69A 3ZX3A 3ZEUA 1K8KB 2CH5A 3H1VX 4BR5A 1GLCG 4RTFD 3A8YA 3RVCA 2GEMA 3KK7A 5C10A 4JKGA 4H5WA 1JCGA 3P38A 2VGMA 4GNIA 3AGRA 5AQUA 3PIOL 2P9IA 3MN5A 4H0XB 3ZETB 5DM7L 3D6RA 1YJ9N 1NGAA 2A6AA 4H5NA 2KLAA 4ILJA 1Q81O 3O9QA 2QWPA 2NRTA 3SAHA 3VETA 4JN4A 5EY4A 2D4WA 2GUPA 3LDPA 4H0VB 3T7ZA 4H0YB 4FSVA 3WXKA 5LY3A 4XJXA 4YOUA 1TUUA 4B1UB 2DPNA 3FGUA 4ISEA 4B1ZA 1JCEA 2E1YA 4PKGA 1RDWX 4YORA 2QWRA 2PAVA 3CCUN 3J8AA 3GOIA 5GAEP 5EVZA 4E1JA 5JLHA 1GLJO 3U4LA 4FPAA 3SMPA 3GE1A 1LOTB 4PKIA 2HBMA 2KHOA 3EE9A 3CI5A 2QWNA 3MN6A 5GIOA 1VQ6N 4CZFA 4U7BA 3DAWA 1S22A 2NRXA 3ATUA 1QZ5A 3QB0A 2AP1A 3ENOA 5KQDA 3CCVN 4JHDA 4CZKA 3EL2A 4C1NI 2P9LA 4CZJA 1YJWN 5AQIA 1M90O 4WQ5C 3RSEB 3HSCA 1ATRA 3O9TA 3CCLN 1ESVA 3LDQA 2V7ZA 3HI0A 3HTVA 3QICA 4BRPA 1OVYA 1QVGM 3DXMB 4MO4A 1VQON 2NNWA 3BP8A 3F2KA 4LC9B 5KPTA 3CIPA 1NGFA 2E20A 3TSUA 4A61A 1HUXA 2A42A 2P9KA 4BG8A 1QZ6A 3VPZA 4FWKA 5C2FA 4WYBA 4JEPA 2QM1A 3H6EA 3CXCM 3LM9A 3D2EB 3QBWA 4BRKA 2E2PA 2VYPA 3SBTA 4CZMA 3H46O 1TUYA 2Q97A 3DXKA 4H03B 3ULEB 4BC3A 3VEVA 4IFEA 4NLBA 1GLEG 2E2NA 5AQMA 1K8AO 4BQLA 2YHXA 5AZJB 3FZHA 4JD2B 2V52B 4FWSA 2FSKA 3FR0A 3UKRB 3G6EN 1SZ2A 4ILHA 2ASMA 2D1KA 4O8UA 3VTHA 3UE5A 2FSNA 4B1XB 4C23A 5B8HA 4GV9A 4BC4A 4O8KA 2C1IA 3WT0A 4BG9A 5FPDA 5AQSA 1KXPA 4CZHA 4WQ4A 2P9NB 3O08A 2GTDA 2D0PA 2FLOA 4XH5A 2WUSA 3CJBA 4Z94A 3O9RA 1K9MO 3CCSN 3M5RA 4H0PA 3MX5A 4ISFA 3VEZA 3GDQA 3SBGA 4BGBA 3MX2A 3U8XA 4FPBA 4H5VA 3A0IX 1JCFA 1HX1A 1NGHA 3WEEB 3VF6A 4MLHA 3EKSA 5TKWA 3NVMA 1H1VA 1BA0A 2QEXN 2I7NA 4CZLA 4IEIA 5AQQA 1K8KA 1Q18A 1YJNN 2WFBA 3L4QA 4XH1A 1D4XA 1X9JA 2HF3A 1GLDG 3ENBA 5BN8A 1Q7YO 4CZGA 1Z05A 4C1NK 2QW9A 3VEXA 5ELZA 3HM8A 4JKAA 3CJCA 3QMLA 4M7YA 1EQYA 5H1SQ 2YHWA 1VQ9N 3CCJN 3ZETA 1C0FA 5AFUA 4AF1A 2IIRA 5F2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IO8 A;  1BO5 O;  4BRQ A;  2FF3 B;  2BTF A;  4NO7 A;  5E26 A;  3HZ6 A;  2FSJ A;  4WQ4 C;  1T44 A;  3BUZ B;  1SAZ A;  3CJ1 A;  1ATN A;  3D2F A;  1XQS C;  2Q0R A;  5CE3 A;  4CI6 A;  2GWJ A;  1X3N A;  5ADX A;  3O1B A;  1S3X A;  2E1Z A;  4PL8 A;  3ZX0 A;  3EZW A;  2AA4 A;  4CBW A;  4ISG A;  1DGK N;  4JAX A;  4BR0 A;  1YUW A;  4FWL A;  5BR9 A;  3CQX A;  1HKB A;  1MWK A;  2HOE A;  5BPN A;  1V4S A;  3BF1 A;  3WXI A;  1NGJ A;  3GBT A;  4K43 A;  3SJH A;  1BA1 A;  3VER A;  5JMV A;  5JLF A;  3EN9 A;  2A41 A;  4K42 A;  1QQN A;  2P9P B;  4I6M B;  4CBU A;  3DXM A;  3F9M A;  3A5N C;  3ZEU B;  4XH4 A;  3MN7 A;  1RGI A;  1QQO A;  2ASP A;  1V4T A;  3A5O C;  4BRI A;  1NMD A;  4A2A A;  4QS7 A;  4BRC A;  2J4R A;  4XEI A;  3UKU A;  4B1V A;  1ZC6 A;  4BR2 A;  1MA9 B;  3QDK A;  5BPM A;  2QWQ A;  2P9I B;  5AQN A;  1NGI A;  1TYQ A;  3WQT A;  1G99 A;  1WOQ A;  3AAR A;  3D2E A;  2V51 B;  2Q31 A;  5AZI A;  1U2V A;  3ULE A;  3SMS A;  5FPN A;  4EFH A;  2P9S B;  1DKG D;  2P9U B;  4JD2 A;  1YAG A;  4B9Q A;  2V7Y A;  2ITM A;  3O4W A;  3A5M C;  4DQ8 A;  2FXU A;  2W41 A;  3CJ9 A;  3C7N B;  1DEJ A;  2VWB A;  5AQF A;  2CH6 A;  3SK3 A;  4BRG A;  2QWL A;  2ZGZ A;  3FZL A;  1NM1 A;  2Q0U A;  1IJJ A;  4JHD B;  3IMX A;  2P9L B;  3I8B A;  1E4F T;  4CD1 A;  3L0Q A;  1C0G A;  4A62 A;  3VGL A;  3TPQ A;  5AQV A;  3I33 A;  3S41 A;  3WEE A;  5AQW A;  4BRE A;  2EWS A;  3LDN A;  4BR4 A;  3H45 C;  4L3Q A;  2QWO A;  4B1W B;  4FOI A;  3WQU A;  3O8M A;  2ZGY A;  4H0O A;  3P4I A;  3H1Q A;  2E2O A;  3SLC A;  5AQT A;  4K25 A;  5AQX A;  2FF6 A;  5AQP A;  4FWR A;  4FWO A;  3GG4 A;  5F0X A;  3CQY A;  3U9Z A;  2GWK A;  1BDG A;  4A2B A;  5EX5 A;  4NB4 A;  1YXQ A;  3MCP A;  4M7X A;  1NGC A;  1NGB A;  3CHW A;  2W40 A;  3EO3 A;  3IDH A;  5AQJ A;  4M63 C;  3KZB A;  5AQY A;  2A5X A;  1NGG A;  1HKG A;  1R59 O;  4Y0W A;  4BRL A;  4IZ9 A;  1YVN A;  3O6W A;  4CD3 A;  2A3Z A;  1XC3 A;  4BC5 A;  2IVP A;  1Y64 A;  3QBX A;  5KQ8 A;  3R6M A;  4CJ7 A;  3FZK A;  1LCU A;  2HF4 A;  1WUA A;  2ZWH A;  3L6Q A;  1XUP O;  3LM2 A;  5EXW A;  1BOT O;  1KAZ A;  3VES A;  3CET A;  3FFK B;  3AAQ A;  3VF4 A;  2F9W A;  1BU6 O;  3ATV A;  3MMV A;  1NLV A;  4FL9 A;  1BG3 A;  5AQL A;  1HPM A;  1QHA A;  2YHY A;  3GL1 A;  3HBT A;  4PL7 A;  3JXU A;  1HKC A;  2ASO A;  5FPM A;  3DWL A;  1CZA N;  3H3N O;  5AQH A;  4BRM A;  4CBX A;  4DHY A;  1BUP A;  5E84 A;  3VEY A;  4PKH A;  3EKU A;  1OKJ A;  3CER A;  4YDU A;  3RSE A;  3FZM A;  3O5B A;  5AQZ A;  4BRO A;  2NZT A;  4CZE A;  1ZBS A;  1MDU B;  3AAP A;  5AQG A;  2E2Q A;  3WXL A;  5KPR A;  1HJO A;  4BRF A;  3KHY A;  4H5R A;  1NGE A;  1RFQ A;  2NLX A;  4AM6 A;  2YJF A;  3FLC O;  2YI1 A;  1IG8 A;  3AY9 A;  3L4I A;  3UB5 A;  4MO5 A;  3U9D A;  2P9S A;  3O80 A;  2P9U A;  4IJA A;  3WUH A;  3D2F B;  4BR7 A;  3CJ7 A;  2E88 A;  3R9P A;  3BEX A;  3D7E O;  3TU5 A;  5KPZ A;  5I9E B;  3C7N A;  4HTL A;  5JIC A;  1E4G T;  4F9O A;  4EAH D;  4HWI A;  4K41 A;  3M6G A;  3BF3 A;  1GLA G;  5AR0 A;  1GLF O;  4QS8 A;  5BRH A;  1MWM A;  5AZJ A;  1NGD A;  4CZI A;  3CJA A;  3UKR A;  4IXC A;  2IVO A;  4FWP A;  1BWF O;  5AQO A;  4AM7 A;  1GLL O;  3B8A X;  2BUP A;  3LDO A;  2CGJ A;  3ZX2 A;  4YDU C;  4RWT A;  2UYT A;  4FWM A;  4EIA A;  4DB3 A;  5LJW A;  2HMP A;  4BRA A;  5LJV A;  5BRD A;  2P9N A;  3DJC A;  2I7P A;  5BRF A;  3JS6 A;  3UKU B;  2VCP A;  4EHT A;  4H5T A;  5AFU H;  4QS9 A;  2PBD A;  3A5L C;  3MDQ A;  3QFP A;  3VOV A;  2D0O A;  3ID8 A;  1TYQ B;  2Q36 A;  2YCH A;  2ZF5 O;  3IUC A;  4GY2 B;  1SQK A;  3R8E A;  5F1X A;  5AQR A;  5AZI B;  1U2V B;  3VEW A;  4BVP A;  1P8Z A;  2OAN A;  3MN9 A;  1T6C A;  4FWQ A;  4IJN A;  3W3D A;  1NBW A;  3M1F A;  4BRD A;  2P9K B;  3ENH A;  3M3Z A;  4BRN A;  2Q2R A;  4BGA A;  5ADX H;  4KBO A;  1ZXO A;  4O5F A;  1U6Z A;  4FO0 A;  3VGM A;  1T6D A;  4MLE A;  3VEO A;  3O1W A;  3G25 A;  2IVN A;  3DXK B;  3VGK A;  5TKY A;  4BQZ A;  2CGL A;  4DCH A;  4JNE A;  3WXJ A;  5BRE A;  2H3G X;  3OHR A;  4BVO A;  1J6Z A;  3VF2 A;  2QWM A;  1X3M A;  2A40 A;  3QFU A;  3KVG A;  3MK6 A;  3FE1 A;  5BPL A;  4IWV A;  2GEL A;  5EOY A;  4J8F A;  2CGK A;  3LDL A;  2NRH A;  4B1Y B;  3C0B A;  2YJE A;  3VEN A;  3W0L A;  1GLB G;  4BC2 A;  5AQK A;  1ATS A;  1QQM A;  4H0T B;  5BN9 A;  1KAX A;  1KAY A;  2Q1N A;  2E8A A;  2QXL A;  4BRH A;  4RCH A;  1Z6R A;  3FZF A;  3LL3 A;  1NWK A;  4EHU A;  3IFR A;  5FPE A;  4BR9 A;  4FWN A;  3H3O B;  4WQ5 A;  1HLU A;  2F9T A;  2P9P A;  4FOE A;  4I6M A;  3ZX3 A;  3ZEU A;  1K8K B;  2CH5 A;  3H1V X;  4BR5 A;  1GLC G;  4RTF D;  3A8Y A;  2GEM A;  4H5W A;  1JCG A;  4GNI A;  5AQU A;  2P9I A;  3MN5 A;  4H0X B;  3ZET B;  1NGA A;  2A6A A;  4H5N A;  2QWP A;  3VET A;  4JN4 A;  5EY4 A;  2D4W A;  2GUP A;  3LDP A;  4H0V B;  3WXK A;  4H0Y B;  4FSV A;  5LY3 A;  4B1U B;  1TUU A;  2DPN A;  3FGU A;  4ISE A;  4B1Z A;  1JCE A;  2E1Y A;  4PKG A;  1RDW X;  2QWR A;  2PAV A;  3J8A A;  3GOI A;  5EVZ A;  4E1J A;  5JLH A;  1GLJ O;  3U4L A;  4FPA A;  3SMP A;  3GE1 A;  1LOT B;  4PKI A;  2KHO A;  3CI5 A;  2QWN A;  3MN6 A;  4CZF A;  3DAW A;  1S22 A;  3ATU A;  1QZ5 A;  3QB0 A;  2AP1 A;  3ENO A;  5KQD A;  4JHD A;  4CZK A;  3EL2 A;  2P9L A;  4CZJ A;  5AQI A;  4WQ5 C;  3RSE B;  3HSC A;  1ATR A;  1ESV A;  3LDQ A;  2V7Z A;  3HI0 A;  3HTV A;  3QIC A;  4BRP A;  3DXM B;  4MO4 A;  3BP8 A;  4LC9 B;  5KPT A;  3CIP A;  1NGF A;  2E20 A;  4A61 A;  1HUX A;  2A42 A;  2P9K A;  4BG8 A;  1QZ6 A;  3VPZ A;  4FWK A;  4WYB A;  2QM1 A;  3H6E A;  3LM9 A;  3D2E B;  3QBW A;  4BRK A;  2E2P A;  2VYP A;  4CZM A;  3H46 O;  1TUY A;  2Q97 A;  3DXK A;  4H03 B;  3ULE B;  4BC3 A;  3VEV A;  5AQM A;  1GLE G;  2E2N A;  4BQL A;  2YHX A;  5AZJ B;  3FZH A;  4JD2 B;  2V52 B;  4FWS A;  2FSK A;  3FR0 A;  3UKR B;  1SZ2 A;  2ASM A;  2D1K A;  3UE5 A;  2FSN A;  4B1X B;  4C23 A;  5B8H A;  4BC4 A;  4O8K A;  3WT0 A;  4BG9 A;  5FPD A;  5AQS A;  1KXP A;  4CZH A;  4WQ4 A;  2P9N B;  3O08 A;  2GTD A;  2D0P A;  2FLO A;  4XH5 A;  2WUS A;  3CJB A;  4Z94 A;  4H0P A;  4ISF A;  3VEZ A;  3GDQ A;  4BGB A;  3U8X A;  4FPB A;  4H5V A;  3A0I X;  1JCF A;  1HX1 A;  1NGH A;  3WEE B;  3VF6 A;  4MLH A;  3EKS A;  1H1V A;  1BA0 A;  2I7N A;  4CZL A;  5AQQ A;  1K8K A;  1Q18 A;  4XH1 A;  1D4X A;  1X9J A;  2HF3 A;  1GLD G;  5BN8 A;  4CZG A;  1Z05 A;  2QW9 A;  3VEX A;  5ELZ A;  3HM8 A;  4M7Y A;  3CJC A;  3QML A;  1EQY A;  2YHW A;  3ZET A;  1C0F A;  5AFU A;  2IIR A;  5F2R A; 
#chains in the Genus database with same CATH topology
 3CQ8 A;  2FF3 B;  4IO9 L;  4HHT A;  4CVN E;  3IAY A;  3O3G A;  3HZ6 A;  1W97 L;  4WQ4 C;  1T44 A;  3BUZ B;  4WCE L;  1XQS C;  4IFY A;  3OTO K;  5CE3 A;  3HPH A;  2PYL A;  4O5B A;  1IKW A;  4KH6 A;  1S3X A;  2HBL A;  2E1Z A;  3ZX0 A;  1T3V A;  3HO1 A;  4JAX A;  1IBM K;  5CYM A;  5BR9 A;  1HKB A;  5BPN A;  4DSK A;  2B4J A;  3WXI A;  1NGJ A;  1S1U A;  4FK0 A;  4YOX A;  4KB1 A;  4K43 A;  1BA1 A;  5SZT A;  3SYZ A;  3E9P A;  3MWP A;  4K42 A;  4OKJ A;  3SJJ A;  1P90 A;  4CBU A;  3F9M A;  3MEG A;  3ZEU B;  1EO1 A;  3V9X A;  4MQ3 A;  2VQE K;  2ASP A;  1D8Y A;  4BRC A;  4JKG B;  1YIT N;  1JLB A;  1IO2 A;  4BR2 A;  3QDK A;  3LZI A;  3VQC A;  2XY5 A;  1NOZ A;  2P9I B;  4CCH A;  5AQN A;  3P31 A;  4B8C A;  1FXX A;  2P1J A;  4X64 K;  1G99 A;  3M8R A;  1VK0 A;  3D2E A;  3TTD A;  3L3V A;  5K14 A;  2G8F A;  1IH7 A;  1C0M A;  1U2V A;  2HHU A;  2VQF K;  1IG9 A;  4KI4 A;  1FKO A;  5C0Y A;  1YAG A;  4BE1 A;  2V7Y A;  4DKW A;  4GV6 A;  3A5M C;  3OYI A;  3VQP A;  1VQN N;  3CF5 L;  1CZ9 A;  4JKD A;  5AQF A;  3L2Q A;  4A59 A;  4FW1 A;  3V6D A;  1NK9 A;  1XNR K;  5J2N A;  4DU1 A;  2P9L B;  1E4F T;  5J1E A;  4CFA A;  3ZSY A;  3NGI A;  1X1P A;  3AGK A;  3NMU A;  2RHK A;  2HBJ A;  3S41 A;  5AQW A;  4M3U A;  4BR4 A;  5FLX O;  1RDD A;  2B6A A;  1RT3 A;  1FJG K;  2BE2 A;  3P4I A;  4W5O A;  2F8T A;  4K25 A;  2FF6 A;  2W00 A;  1Q82 O;  4FWR A;  3AVA A;  3MXJ A;  1KC8 O;  2OPR A;  2WC9 A;  2P5G A;  3R1X A;  4CFC A;  3PY8 A;  3AA4 A;  4E7H A;  4I7F A;  4ZHR A;  3F73 A;  1NGC A;  5LL6 Z;  4FJX A;  3LWL A;  3NAE A;  4M63 C;  5AQY A;  3OYM A;  2A5X A;  3AVJ A;  4JKE A;  2UXC K;  1HKG A;  1R59 O;  4YHH K;  3PIP L;  1YVN A;  3ITH A;  3NH2 A;  1WSG A;  1XC3 A;  1UAX A;  1KSP A;  3FZK A;  2ZJR L;  3THV A;  2ZWH A;  4LFC K;  3AVH A;  3CM6 A;  3NVK A;  1XUP O;  5CZ1 A;  4YFU A;  4X65 K;  3CET A;  3MMV A;  4CJV A;  1NLV A;  2G8H A;  4KHQ A;  4FCY A;  4YNQ A;  3HBT A;  3P39 A;  3THX A;  4CJT A;  5FPM A;  4DTJ A;  2DTU A;  1JL1 A;  3H3N O;  2WTU A;  3RMA A;  3ID6 A;  4YOT A;  3CCR N;  4DSE A;  3TAN A;  1NJI O;  1W9H A;  3EKU A;  1TKZ A;  3QEV A;  5JVH L;  3RSE A;  3FZM A;  4WF9 L;  1WSJ A;  4LF7 K;  3QO9 A;  3TAP A;  4CJL A;  3ALY A;  4IKF A;  1HNZ K;  1U49 A;  2VG6 A;  3DLK A;  4KTQ A;  3THW B;  4AM6 A;  3VQ8 A;  3PX6 A;  4FJM A;  1QTM A;  1HMV A;  4Z4H A;  3AY9 A;  2YI1 A;  2YX6 A;  3L4I A;  3R3L A;  4JK8 A;  3P83 D;  3KLH A;  4FW2 A;  3UB5 A;  3CG7 A;  3NHG A;  4C8N A;  4YOY A;  4ILG B;  3WUH A;  3CJ7 A;  3B6P A;  3CC4 N;  4Y1C A;  3BEX A;  4FLZ A;  1EP4 A;  1QVF M;  4F9O A;  3L8B A;  3SNN A;  4OPA A;  1JLG A;  1W0H A;  2D5R A;  2G8V A;  4HWI A;  4QOZ B;  4CIF A;  5I3U A;  4YOW A;  4DFM A;  3WNE A;  4QS8 A;  1VSE A;  5HBM A;  1BI4 B;  1Q86 O;  4FWP A;  2HBK A;  1BWF O;  3KLI A;  1GLL O;  5MLC Q;  3OBW A;  2HHI A;  3OVN A;  4EIA A;  5LJW A;  1B92 A;  3TI0 A;  2HMP A;  1JXB A;  5BRD A;  2P9N A;  2UUB K;  4DR4 K;  4CHN A;  3KLG A;  3DJC A;  2KKZ A;  1YIJ N;  3RRH A;  3O9U A;  5AFU H;  5CZ2 A;  3A5L C;  4NXM K;  2KFN A;  3ID8 A;  3A2F A;  1CLQ A;  1TYQ B;  2Q36 A;  2YCH A;  2OZS A;  2ZF5 O;  4GY2 B;  1U45 A;  4CER A;  4DQQ A;  5AQR A;  2ZJQ L;  3SPY A;  4FJI A;  4JRQ A;  1P8Z A;  3AO5 A;  1T6C A;  4DTO A;  3TTC A;  4GW6 A;  4BRD A;  3M3Z A;  1NNE A;  4BGA A;  4KBO A;  1J54 A;  3O3H A;  3RMB A;  3VGM A;  3O4N A;  4LF6 K;  1T6D A;  1VQM N;  4UY8 O;  4GKJ K;  4EP4 A;  4OPH A;  2KTQ A;  3VGK A;  4BQZ A;  4RW9 A;  3OYA A;  4DCH A;  4KH5 A;  5AJ3 K;  4CJR A;  3SV4 A;  1O13 A;  1HJR A;  3V9S A;  3FE1 A;  4O0I A;  2NRZ A;  3C0B A;  4PHT X;  1BQM A;  1VQ4 N;  4BC2 A;  5AQK A;  1RBV A;  4JKF A;  2HNZ A;  4DR1 K;  4CHY A;  4IOX A;  3E9L A;  3VQQ A;  3JAM O;  1Z6R A;  3CMA N;  2FBX A;  3LL3 A;  2D0C A;  5FPE A;  4HCB A;  3H3O B;  3THW A;  3CM5 A;  2P9P A;  3ZX3 A;  5KRS A;  1S5J A;  2CH5 A;  2YNI A;  3DMJ A;  2UUA K;  3RVC A;  2GEM A;  3KK7 A;  3VA0 A;  3AV9 A;  2F4V K;  2O8D B;  5T7B A;  3PV8 A;  3P38 A;  3IG1 A;  3PIO L;  2GV9 A;  4CES A;  2D0B A;  3ZET B;  4CEB A;  1NGA A;  4KHY A;  1JXE A;  2O8C B;  3SAH A;  3WNH A;  5EY4 A;  3T7Z A;  3DRP A;  3BGR A;  3HVT A;  3LDP A;  2HND A;  4H0Y B;  4H0V B;  3WXK A;  5LY3 A;  3SUN A;  2HHV A;  4XJX A;  1TUU A;  1BL3 A;  4B1Z A;  4YOR A;  4MFB A;  3CCU N;  4PWD A;  3J8A A;  5EVZ A;  4E1J A;  1LW0 A;  1GLJ O;  4ELT A;  4FPA A;  4C8M A;  1NOY A;  1LOT B;  2KHO A;  3AA5 X;  2Z1G A;  2QWN A;  1REV A;  1FK9 A;  4E89 A;  1EKE A;  4NYN A;  2AP1 A;  5KQD A;  4JHD A;  3TAQ A;  4CZJ A;  4GVM A;  1YJW N;  5AQI A;  4CHZ A;  1NU0 A;  4WQ5 C;  3HSC A;  1ATR A;  3O9T A;  1M90 O;  2OPS A;  3ZT4 A;  4AHR A;  4G1Q A;  4DR3 K;  1RNH A;  3QIC A;  3RR7 A;  1G15 A;  3DXM B;  1VQO N;  2E5L K;  1KCF A;  3AVK A;  3LP0 A;  2HB5 A;  4B3M K;  2Z1I A;  3TSU A;  2A42 A;  3ULD A;  3ZT2 A;  4V19 S;  1A5W A;  1TL3 A;  2HHQ A;  3L2R A;  4JEP A;  2QM1 A;  4HTU A;  3CXC M;  3QBW A;  4BRK A;  4Z4I A;  2VYP A;  3S3O A;  1X9M A;  1KVC A;  4LFA K;  4PA1 A;  1TKT A;  5KGX A;  2FSK A;  1IBL K;  4O8U A;  4LY7 A;  3VTH A;  1A5V A;  4JI2 K;  4GV9 A;  2O8B B;  2C1I A;  4BG9 A;  1C1C A;  2D0P A;  3HP9 A;  3CJB A;  1NK8 A;  1RDC A;  3CFR A;  3MX5 A;  4ISF A;  4BDZ A;  4KV8 A;  3U8X A;  4H5V A;  1WBB A;  3A0I X;  1HX1 A;  1NGH A;  3S3N A;  2WON A;  3P5J A;  4QCL A;  4DLG A;  1YJN N;  5IWA K;  1KLN A;  1OH8 A;  4XH1 A;  3TAB A;  3VN5 A;  5BN8 A;  2O8D A;  4DFJ A;  4JKA A;  5H1S Q;  1EQY A;  2RN2 A;  3CCJ N;  3ZET A;  4IO8 A;  1YI2 N;  4KHN A;  1LWC A;  4NO7 A;  1HNW K;  3M8P A;  2FSJ A;  1E3M A;  2UXB K;  5GAH P;  1BHL A;  5LMN K;  3G4S N;  3CJ1 A;  1ZBL A;  2Q0R A;  3AVN A;  4CI6 A;  1U48 A;  4FJJ A;  3HOS A;  4CGD A;  3DLR A;  4PL8 A;  3LAK A;  3EZW A;  3J80 O;  1EX4 A;  4ISG A;  1DGK N;  5HRS A;  3ZCM A;  3F5T A;  3T1Y K;  4CJP A;  4CE9 A;  4ELU A;  3V9W A;  1MWK A;  4CF1 A;  3VMF B;  4OLA A;  3M8S A;  2PZS A;  3MWT A;  1RDU A;  4I6M B;  3DXM A;  4HUE A;  3VTI A;  1RGI A;  1QQO A;  3A5O C;  1V4T A;  4BRI A;  1WBD A;  1YHQ N;  2YNG A;  4H8K A;  1L3V A;  4CEF A;  2J4R A;  4XEI A;  3UKU A;  4CHP A;  5M1F A;  3HK2 A;  5C42 A;  2QTD A;  2O8E A;  4ID5 A;  2G8U A;  4FJ7 A;  5C15 A;  2Q31 A;  3M8Q A;  4JI8 K;  4KTW A;  3SMS A;  1LWF A;  1SV5 A;  4IG0 A;  4B9Q A;  2ITM A;  1BIZ A;  4DQ8 A;  4JK7 A;  4H4M A;  3K9K A;  1RTI A;  2VWB A;  3K59 A;  1D9F A;  4BRG A;  2Z1J A;  1NMN A;  3KLE A;  2BDP A;  1TGO A;  1NKE A;  4OKK A;  1C0G A;  4A62 A;  3QES A;  3VGL A;  1J53 A;  4DTS A;  1N8R O;  3IKM A;  1TKD A;  3WQU A;  3O8M A;  2OA8 A;  1GOB A;  1WLJ A;  5AQT A;  4CFB A;  1CZB A;  4KPY A;  3OYH A;  1W2B M;  3SUO A;  4K0K K;  3K57 A;  3GG4 A;  2XY8 A;  1RT2 A;  3U9Z A;  1BDG A;  3F9K A;  2ZJP L;  3ZYY X;  4A57 A;  3C6T A;  3EO3 A;  4DTM A;  3IDH A;  2HVI A;  1S1V A;  3LDS A;  2O4G A;  1BIU A;  4BRL A;  4E7I A;  4IZ9 A;  4CD3 A;  3NDK A;  2E4L A;  4KHP K;  2NRV A;  3ISN C;  4KFB A;  1VHX A;  4CFD A;  5KQ8 A;  3MCA B;  1NJY A;  4IDH A;  3L6Q A;  2BH1 A;  2E6L A;  2QI2 A;  3OJS A;  3VQ7 A;  3VES A;  4B8A B;  4DTR A;  3AAQ A;  1NK4 A;  2HHS A;  1BG3 A;  3TR8 A;  4LH4 A;  4JI0 K;  1YTA A;  1FW6 A;  3THY B;  5DMR A;  4RW6 A;  3DWL A;  1CZA N;  4Q5V A;  2Y1J A;  1HYS A;  4I9Q A;  1BUP A;  5J2P A;  3VEY A;  3SQ0 A;  1QHT A;  4PKH A;  3G10 A;  3V4I A;  2O4I A;  3C6U A;  5AQZ A;  1MDU B;  3WXL A;  4FJK A;  4BRF A;  4MDB A;  4H5R A;  2NLX A;  3NGZ A;  4E19 A;  3FLC O;  2PFU A;  3LPT A;  3U9D A;  3O80 A;  1EET A;  1J9A A;  3D2F B;  1VSF A;  4N76 A;  4CJ3 A;  2JWL A;  4CJE A;  1VSM A;  1L5U A;  2E88 A;  4DQP A;  5HRR A;  2RE2 A;  3TU5 A;  5I9E B;  4HUF A;  4HTL A;  4CF2 A;  3ZSO A;  4EAH D;  1VQ7 N;  3VQ9 A;  2UU9 K;  1RDB A;  1KVA A;  3ZSZ A;  5D3G A;  1GLA G;  5GIN A;  1RBS A;  5BRH A;  3DLL L;  1NGD A;  3CJA A;  2C1G A;  3UKR A;  2Z1H A;  4IXC A;  2QK9 A;  3QEP A;  3SAG A;  2CGJ A;  3ZX2 A;  4CED A;  2UYT A;  1QSY A;  4DB3 A;  2NRR A;  2QKK A;  5LJV A;  4WFN L;  4JK9 A;  4KRE A;  3EZ5 A;  3NF6 A;  1SKW A;  2FC0 A;  1EWQ A;  5BRF A;  2QXF A;  4AHT A;  3JS6 A;  1JLC A;  4OPK A;  2VGN A;  4CJ4 A;  5FRO A;  2PBD A;  2OCE A;  4JI6 K;  1HNV A;  4FZZ A;  4CEZ A;  4O4G A;  2D0O A;  4BDP A;  3CC7 N;  1ZBH A;  4JV5 K;  4FJ5 A;  5AZI B;  3NCI A;  3VEW A;  4DV5 K;  4CEE A;  4FWQ A;  3W3D A;  4MDA A;  4KHS A;  3AO4 A;  3M1F A;  4ZTF A;  4CGF A;  1RBR A;  2KQ2 A;  3ZT3 A;  4BRN A;  5ADX H;  4JI5 K;  3VQA A;  4DR7 K;  1U6Z A;  4FO0 A;  4MLE A;  4B3T K;  3SAF A;  1HNX K;  1YF5 L;  3KK1 A;  3VEO A;  4CJW A;  3AVF A;  3Q7C A;  1X9W A;  3KD1 E;  3OHR A;  4QAG A;  3VF2 A;  1Z25 A;  2A40 A;  3KIO A;  3QFU A;  4IWV A;  2GEL A;  3E01 A;  5EOY A;  3THY A;  4J8F A;  3LDL A;  2GX9 A;  1NK6 A;  2NRH A;  2YJE A;  5HRP A;  1HYV A;  3AVC A;  1GLB G;  4JS4 A;  1ATS A;  1LW2 A;  3CCE N;  3J81 O;  4H0T B;  3N4P A;  3C6H A;  3SQ2 A;  2Q1N A;  3WNG A;  2QXL A;  3FZF A;  5HLF A;  4DFK A;  4BR9 A;  3K2P A;  1TK8 A;  3KTQ A;  3NFA A;  4DTP A;  4EZ6 A;  4CF9 A;  3ZEU A;  3H1V X;  2IOC A;  1CXQ A;  3TWH A;  1GLC G;  4CJ5 A;  3A8Y A;  3QNN A;  2XO7 A;  5C10 A;  4FM1 A;  3ZT0 A;  4JKG A;  4H5W A;  2HHH K;  4OGC A;  4M3Z A;  2PY5 A;  4AHS A;  2P9I A;  3OYE A;  3NE6 A;  3D6R A;  1YJ9 N;  3U3Y A;  2A6A A;  4H5N A;  3C95 A;  2KLA A;  1Q81 O;  3DLB A;  3O9Q A;  2QWP A;  1T03 A;  2NRT A;  2VWK A;  1W7A A;  3VET A;  4M3X A;  4O44 A;  2D4W A;  2GUP A;  3OS1 A;  4YOU A;  4B1U B;  2DPN A;  2QWR A;  3GOI A;  4FLV A;  2ITG A;  3SMP A;  3AO2 A;  3GE1 A;  4O55 A;  3MN6 A;  3KLF A;  4L8R B;  3DAW A;  2NRX A;  3LAN A;  4CZK A;  3EL2 A;  2P9L A;  3I0R A;  3BZK A;  4AH9 A;  3HXM A;  3SQ1 A;  2DFE A;  4F3O A;  2B5J A;  3OJU A;  3OYC A;  5KTQ A;  5KPT A;  3CIP A;  4CK2 A;  4CGI A;  4CGJ A;  4B3R K;  2X78 A;  1C0U A;  4BG8 A;  3QEX A;  5C2F A;  3PO5 A;  1DTQ A;  3H6E A;  1XHX A;  3S5T A;  1ASU A;  4H03 B;  3ULE B;  3VEV A;  2OPQ A;  4B9T A;  4BQL A;  5AZJ B;  4JD2 B;  2V52 B;  4FWS A;  3G6E N;  1SZ2 A;  1L3U A;  1LV5 A;  4FM2 A;  5FRN A;  4C23 A;  3KKS A;  1SL2 A;  3ZSR A;  1KVB A;  1ZBF A;  1RCH A;  2KZZ A;  5JS2 A;  3SCX A;  2ETJ A;  3EYZ A;  2GTD A;  2FLO A;  4Z4G A;  4XH5 A;  4HVJ A;  3M5R A;  2F8S A;  1Y97 A;  4H0P A;  3VEZ A;  4B9S A;  3SBG A;  3MX2 A;  4CF8 A;  4RW7 A;  3WEE B;  1SUQ A;  1YTU A;  4MLH A;  1OH6 A;  3NVM A;  2QEX N;  4DS4 A;  2I7N A;  4CZL A;  4IEI A;  5AQQ A;  1XHZ A;  1N36 K;  3ENB A;  4J2D A;  4CHO A;  1LAW A;  3AVG A;  4M7Y A;  3QML A;  3L2U A;  2YHW A;  1VQ9 N;  4IG3 A;  1C0F A;  2G8K A;  5AFU A;  1LAV A;  2IIR A;  2VWJ A;  1S1W A;  4JI7 K;  4CK1 A;  4BRQ A;  1I94 K;  3NF7 A;  3K5N A;  2BTF A;  1T7P A;  1XMO K;  1XI1 A;  2BGG A;  1SAZ A;  3NH1 A;  4CK3 A;  5A2Q O;  1ATN A;  4N41 A;  2GWJ A;  3O1B A;  4KH4 A;  1SL0 A;  4BR0 A;  4F4K A;  5SWM A;  4FWL A;  1FKP A;  4B9U A;  2HOE A;  1K73 O;  3AVI A;  1BI4 A;  3ZSW A;  3BF1 A;  4KO0 A;  4B3O A;  3DLG A;  3GBT A;  3AVB A;  3OS0 A;  4B9V A;  3EN9 A;  1J5E K;  1QQN A;  3CYG A;  3A5N C;  1NJX A;  4XH4 A;  3MN7 A;  4A2A A;  1M1K O;  4BEC A;  1ZC6 A;  4FK4 A;  2WOM A;  3OYN A;  1TYQ A;  1Q8I A;  3WQT A;  1JL2 A;  1WOQ A;  2HHT A;  1HPZ A;  1WSF A;  4B08 A;  1XC9 A;  1UWB A;  1RBU A;  3ULE A;  5EU7 A;  4W5T A;  1DKG D;  2P9U B;  4JI4 K;  1O1W A;  4JD2 A;  1NK7 A;  2I5J A;  4YY3 K;  2X6S A;  3O4W A;  3TAG A;  4J2A A;  4KHW A;  2FXU A;  2W41 A;  5C25 A;  4DSI A;  3EE8 A;  4DV0 K;  1DEJ A;  3V9Z A;  4LF4 K;  2QWL A;  4TSX A;  1NM1 A;  4JYA K;  3I56 N;  3SUQ A;  1RT6 A;  4CD1 A;  4KTZ A;  3L0Q A;  1BGX T;  3CYM A;  1WSE A;  3SPZ A;  4F2S A;  2FBV A;  2KZM A;  1IKV A;  1VSI A;  2VG7 A;  2X74 A;  3WEE A;  4BRE A;  1DT9 A;  3LDN A;  3H45 C;  4B1W B;  2QWO A;  5FDL A;  5HOO A;  4FOI A;  1KLM A;  2ZE2 A;  4H0O A;  4AQY K;  1VSK A;  1MU2 A;  3NF8 A;  1C0T A;  1JLF A;  3CCM N;  4FWO A;  4DLE A;  5F0X A;  2YKN A;  1YXQ A;  3BY5 A;  3DOL A;  3MCP A;  4CJS A;  4M7X A;  4DV4 K;  5M1K A;  1NGB A;  4JS5 A;  4GV3 A;  4GVE A;  3VQB A;  1RDA A;  3RR8 A;  1UOC A;  5AQJ A;  3AA3 A;  1NGG A;  3JSM A;  4IFV A;  1ILY A;  4DTN A;  4Y0W A;  1VQP N;  1BCM A;  3CPW M;  4DQS A;  1RTJ A;  4DUZ K;  4YOV A;  2IVP A;  3VQE A;  1Y64 A;  3QBX A;  3SV3 A;  4CJ7 A;  4NLC A;  2HF4 A;  1WUA A;  5KI6 A;  3ASM A;  4NCG A;  4BE7 B;  3G71 N;  3LM2 A;  5M1Q A;  5EXW A;  4A5B A;  2O8C A;  2OPP A;  4FJH A;  3CPE A;  1NKC A;  3VF4 A;  2F9W A;  3ATV A;  4FL9 A;  1HPM A;  3B6O A;  4F3T A;  5JS1 A;  4KKO A;  3Q7B A;  3JXU A;  3PUF A;  3TAM A;  3NF9 A;  5AQH A;  2UXD K;  4CBX A;  1VAZ A;  3KWG A;  4IEE A;  4DHY A;  3V1R A;  5E84 A;  3RMD A;  1OKJ A;  3CER A;  4YDU A;  4DF8 A;  2UUC K;  4BRO A;  2NZT A;  4CZE A;  3AO3 A;  1ZBS A;  3AAP A;  2E2Q A;  3BZC A;  4BEB A;  5KPR A;  5FRM A;  1HJO A;  3CCQ N;  3KHY A;  1RFQ A;  3V9U A;  2YJF A;  2JWK A;  3HRG A;  4DG1 A;  1JLE A;  2P9U A;  4IJA A;  1VRU A;  4J2B A;  4BR7 A;  4JKB A;  4DV7 K;  3R9P A;  3MEC A;  3T1H K;  2AJQ A;  4DSJ A;  3D7E O;  4FVU A;  5KPZ A;  1CXU A;  4M41 A;  5JIC A;  1E4G T;  1N34 K;  1UA1 A;  2OTL N;  1F21 A;  1IKY A;  4K41 A;  3M6G A;  4OO1 J;  5AR0 A;  4CEC A;  4C8O A;  1Q9X A;  4OGE A;  4CZI A;  1VQ5 N;  3H08 A;  3ZSV A;  2IVO A;  5J2M A;  2F7T A;  3LP2 A;  4AM7 A;  3DM2 A;  3B8A X;  2BUP A;  1SL1 A;  4FWM A;  2RKI A;  1KFS A;  2O8B A;  3LWM A;  4E72 A;  1ZBI A;  4DV2 K;  3C65 A;  1QSL A;  4FLW A;  4OPJ A;  1R0A A;  2YNF A;  2W42 A;  3WXM B;  4QS9 A;  5JEN A;  3CFP A;  1XMQ K;  3PX0 A;  4GMJ B;  3SZ2 A;  1QS4 A;  1WAJ A;  1SQK A;  4IBN A;  1U2V B;  3NGY A;  2OAN A;  3MN9 A;  4IJN A;  4BWM A;  4ICL A;  3CME N;  1ASW A;  3I55 N;  5E41 A;  4O5F A;  4E7J A;  5DM6 L;  2KFZ A;  3O9S A;  3OYG A;  3O1W A;  2IVN A;  3QNO A;  3DXK B;  4WFB L;  4CJQ A;  4FLX A;  5DK5 A;  2CGL A;  2P51 A;  3HPG A;  3OYB A;  4OX9 K;  4C8K A;  1HYZ A;  2QWM A;  3KVG A;  3MK6 A;  3OA9 A;  2YV0 X;  2CGK A;  3PSI A;  4CW7 B;  4A5A A;  4K8Z A;  2ZQB A;  3S3M A;  4IOC L;  2D0A A;  1N5Y A;  3RWU A;  1QQM A;  1VQL N;  1VQ8 N;  1KAX A;  1KAY A;  3E9O A;  2EHG A;  4BRH A;  4RCH A;  2Y1I A;  5CYQ A;  1NWK A;  4EHU A;  1L3S A;  4K8X A;  4FWN A;  1D9D A;  1HLU A;  4I6M A;  3T69 A;  1U4B A;  4FLU A;  1HR0 K;  4BR5 A;  1NG9 A;  4RTF D;  1Z26 A;  2GBZ A;  1JCG A;  4O0J A;  4FZY A;  3EY1 A;  4GNI A;  3MN5 A;  4H0X B;  1KRP A;  3SUP A;  4Z4F A;  4FM0 A;  4CJF A;  2YNH A;  3FGU A;  4ISE A;  1JCE A;  1S6Q A;  2E1Y A;  1RDW X;  3PX4 A;  3SQ4 A;  2E6M A;  5GAE P;  5JLH A;  5IT9 O;  4DR2 K;  3U4L A;  3THX B;  4FJL A;  1JLQ A;  3DYA A;  3EE9 A;  4DQR A;  3CI5 A;  5GIO A;  4CZF A;  4AHU A;  3OYL A;  3QEI A;  1QZ5 A;  3QB0 A;  3CCV N;  4C1N I;  3RTV A;  3RSE B;  2G8W A;  3CCL N;  1B9D A;  4X62 K;  4Z4E A;  2DY4 A;  4LSL A;  2IC3 A;  1ESV A;  3LDQ A;  4FK2 A;  1VSH A;  3HYF A;  2V7Z A;  3HI0 A;  3HTV A;  5KRT A;  4R5P A;  1OVY A;  3QER A;  1RT5 A;  3D0P A;  2DFF A;  2NNW A;  3LP1 A;  2NUB A;  3BP8 A;  1C1B A;  3F2K A;  1U47 A;  4NCB A;  2E20 A;  3HST B;  4DQI A;  1ZYQ A;  4FLY A;  4IDK A;  4FLT A;  3SI6 A;  1DLO A;  4NCA A;  4WYB A;  3MEE A;  1QSS A;  3LM9 A;  2DFH A;  2E2P A;  3SBT A;  4KAZ A;  4ID1 A;  4M45 A;  4C8L A;  2Q97 A;  3DXK A;  4BC3 A;  5AQM A;  4BWJ A;  4CIG A;  2PYJ A;  2YHX A;  4W5N A;  3CFO A;  4CF0 A;  2D1K A;  4OKE A;  1WSI A;  4N56 A;  1RT7 A;  2FSN A;  4B1X B;  4KB0 A;  4E7L A;  1U04 A;  1KXP A;  5AQS A;  4WQ4 A;  4CZH A;  2P9N B;  1SKS A;  4Z4C A;  4M3R A;  3ZSQ A;  4HUG A;  4PQU A;  1HRH A;  1BIS A;  4BGB A;  4LF5 K;  4FPB A;  3V1O A;  1JCF A;  3VF6 A;  4RW8 A;  1RT1 A;  3EKS A;  3K5L A;  3OYK A;  1H1V A;  4DS5 A;  3U3G A;  2LSN A;  3DLE A;  1Q9Y A;  4DMN A;  1Q18 A;  4JI1 K;  3QEW A;  1I3A A;  2WFB A;  4N5S A;  1D4X A;  3IRX A;  1X9J A;  2HF3 A;  1GLD G;  3V81 A;  1Q7Y O;  2IAJ A;  4C1N K;  3VEX A;  1N33 K;  3J7A P;  1IKX A;  4FJ9 A;  3QIN A;  4AF1 A;  3PO4 A;  1BO5 O;  3OBY A;  4PY5 A;  3VA3 A;  3MXI A;  5E26 A;  5CY4 A;  4BAC A;  3PSF A;  4B9N A;  3PLA A;  3D2F A;  4Y1D A;  1EXQ A;  1X3N A;  5ADX A;  4AHV A;  1S1X A;  3MXM A;  4DUY K;  1KQS M;  4LSN A;  2AA4 A;  3KKR A;  4CBW A;  4FJG A;  2OYQ A;  1YUW A;  3CQX A;  2RPI A;  4GKK K;  1V4S A;  3OW2 M;  4DR6 K;  4IOA L;  3VQ5 A;  1VQK N;  1NKB A;  4B9L A;  5JMV A;  3SJH A;  3VER A;  5JLF A;  2A41 A;  1ITG A;  2P9P B;  5M1P A;  3CC2 N;  1UA0 A;  4ZTJ A;  4XIU A;  4KRF A;  5CHI A;  2IS3 A;  1WN7 A;  1NMD A;  1RTH A;  3ZSX A;  4QS7 A;  4B1V A;  2QA4 N;  1MA9 B;  5BPM A;  3C94 A;  2QWQ A;  5GAG P;  1NGI A;  4R79 A;  4LH5 A;  3AAR A;  4DV6 K;  4DTX A;  2V51 B;  3DRR A;  3LAL A;  4E7K A;  1IV0 A;  5AZI A;  3L3U A;  1TK5 A;  5FPN A;  4WE1 A;  4EFH A;  2P9S B;  4DF4 A;  5GIP A;  4DV3 K;  1D5A A;  4B3S K;  4OLB A;  2NRW A;  3O3F A;  4OVL A;  3K9J A;  1JJ2 M;  1XWL A;  1WB9 A;  4EZ9 A;  4E3S A;  3CJ9 A;  2A1R A;  3HOT A;  3C7N B;  4CGG A;  2O8F B;  2YKM A;  2CH6 A;  3SK3 A;  2ZGZ A;  3FZL A;  2Q0U A;  5C2D A;  1IJJ A;  4JHD B;  3IMX A;  3I8B A;  4FXD A;  2W6K A;  2KW4 A;  3C6A A;  3TPQ A;  5AQV A;  4X66 K;  3BDP A;  3RRG A;  3I33 A;  1KTQ A;  5JVG L;  2EWS A;  4L3Q A;  1KFD A;  2HST A;  1WNS A;  2ZGY A;  4PUO A;  3V1Q A;  3H1Q A;  2E2O A;  3SLC A;  5AQX A;  5AQP A;  4LF8 K;  3CQY A;  3JYT A;  2GWK A;  4A2B A;  5EX5 A;  4NB4 A;  3RMC A;  1JLA A;  3CHW A;  1RTD A;  2W40 A;  3LZJ A;  2A1S A;  2WBN A;  3KZB A;  5M1O A;  2W6L A;  5GAD P;  1VRT A;  3O6W A;  2A3Z A;  4BC5 A;  3R6M A;  1LCU A;  1DTT A;  3TAE A;  1WSH A;  4FVM A;  3ZT1 A;  2JLE A;  1BOT O;  1KAZ A;  3FFK B;  4CEO A;  4CEQ A;  3I8D A;  1BU6 O;  3L2W A;  1SS6 A;  1EWR A;  2RF2 A;  1B9F A;  4FYD A;  1HNI A;  4E1M A;  5AQL A;  1QHA A;  2YHY A;  4DR5 K;  3GL1 A;  4CGH A;  4F8R A;  1RBT A;  4PL7 A;  5HL7 L;  1HKC A;  2ASO A;  2HHX A;  1GOA A;  5HP1 A;  4ELV A;  4BRM A;  3J7Z O;  4BE0 A;  3J7Y P;  3KK3 A;  2OZM A;  4G9Z A;  4CJU A;  3K58 A;  1TL1 A;  3LAM A;  2IGI A;  3KWI A;  5M1N A;  3OYD A;  3O5B A;  4U67 L;  4Q0B A;  1IBK K;  3HM9 A;  5AQG A;  2XY7 A;  4WFA L;  4FJN A;  1NGE A;  1S6P A;  3MAQ A;  5HRN A;  2FBT A;  1IG8 A;  2HMI A;  2HNY A;  2XHB A;  3TTF A;  4MO5 A;  2P9S A;  4CIE A;  1XNQ K;  1KD1 O;  2YHA A;  1VSL A;  3T19 A;  5C12 A;  3HVR A;  3WNF A;  4RG8 A;  2P5O A;  3VQ4 A;  4JKC A;  3C7N A;  4DTU A;  2O8F A;  4NXN K;  2YHB A;  1TV6 A;  3BF3 A;  3AA2 A;  1GLF O;  1MWM A;  5AZJ A;  4BY9 C;  2R7Y A;  4EP5 A;  3DRS A;  5AQO A;  1T05 A;  4E0D A;  3LDO A;  1C6V A;  4YDU C;  4RWT A;  2GUI A;  4BRA A;  2Q3S A;  3L2V A;  1YVU A;  4BE2 A;  1RT4 A;  4B9M A;  2JGU A;  3CD6 N;  2I7P A;  3P1G A;  3K0S A;  1GOC A;  1RIL A;  3UKU B;  2VCP A;  4EHT A;  4H5T A;  5J2Q A;  2HVH A;  3MDQ A;  3QFP A;  3QIP A;  2ATQ A;  2O8E B;  3VOV A;  4BDY A;  3IUC A;  3R8E A;  5F1X A;  4JKH A;  5CR4 A;  4BVP A;  1TAU A;  4W5R A;  1NBW A;  2P9K B;  3DI6 A;  3ENH A;  2OTJ N;  2Q2R A;  5HRO A;  1ZXO A;  4CJK A;  3K5M A;  3E66 A;  5BR8 K;  1OH7 A;  3G25 A;  4KI6 A;  4M3T A;  3E1Y A;  5TKY A;  1JKH A;  1QE1 A;  1BCO A;  1S1T A;  5I42 A;  4JNE A;  3WXJ A;  5BRE A;  2H3G X;  4DFP A;  4BVO A;  1J6Z A;  2F96 A;  1NJZ A;  1X3M A;  5BPL A;  1S72 N;  4AHC A;  3HL8 A;  1A5X A;  4B1Y B;  3W0L A;  3VEN A;  3DLH A;  4Z0U A;  4I9L A;  4OJR A;  4DV1 K;  2ZD1 A;  3KK2 A;  4M3W A;  4FZX C;  3HT3 A;  2FBY A;  5BN9 A;  2QKB A;  4DSL A;  2E8A A;  3KD5 E;  4JI3 K;  3O4Q A;  3IFR A;  3TSP A;  3S9H A;  1TVR A;  1OH5 A;  3ZLJ A;  4F2R A;  3TSQ A;  3N4Q A;  1LWE A;  4WQ5 A;  2F9T A;  4FOE A;  3OS2 A;  1K8K B;  1N32 K;  3VQ6 A;  1NK5 A;  5KGW A;  1BQN A;  3U6F A;  2VGM A;  3AGR A;  5AQU A;  1S9E A;  3OYF A;  1SKR A;  3T3F A;  1QQC A;  5DM7 L;  4ILJ A;  3OY9 A;  2HHW A;  1TKX A;  3AO1 A;  3K5O A;  3LP3 A;  4JN4 A;  2IDO A;  4I2P A;  4FSV A;  3T1A A;  4PKG A;  2BAN A;  2PAV A;  4W5Q A;  2EX3 A;  4JRP A;  4E1N A;  4N47 A;  2VG5 A;  4PKI A;  2HBM A;  3TAF A;  1VQ6 N;  4U7B A;  4DSF A;  1S22 A;  3ATU A;  2ZM6 K;  3ENO A;  3LPU A;  3VQD A;  2HW3 A;  4M3Y A;  3QIO A;  4LD0 A;  3EEQ A;  4H4O A;  4BRP A;  2XY6 A;  1QVG M;  3FFI A;  4MO4 A;  1N6Q A;  3DOK A;  4LC9 B;  1NGF A;  3QLH A;  3MED A;  4DU3 A;  4A61 A;  1HUX A;  4NYF A;  4RW4 A;  1TK0 A;  2P9K A;  3HJF A;  1QZ6 A;  3VPZ A;  4FWK A;  1ASV A;  4CEA A;  3QET A;  3D2E B;  1NK0 A;  4CZM A;  3H46 O;  1X9S A;  1TUY A;  2X6N A;  4HCC A;  4IFE A;  4NLB A;  1GLE G;  2E2N A;  1K8A O;  1I39 A;  3FZH A;  3D45 A;  4LFB K;  4M42 A;  3FR0 A;  3UKR B;  4J2E A;  4AIL C;  4LF9 K;  4ILH A;  2ASM A;  4KHU A;  3UIQ A;  3AVL A;  3UE5 A;  5B8H A;  3G0Z A;  4BC4 A;  1L3T A;  4O8K A;  3WT0 A;  5FPD A;  1HQU A;  2G8I A;  3O08 A;  5C24 A;  3NBP A;  2WUS A;  4Z94 A;  3O9R A;  1K9M O;  2XRI A;  5LMU K;  3CCS N;  1TAQ A;  3GDQ A;  4DWI A;  1VSD A;  1C1A A;  1T8E A;  1ZBU A;  3AVM A;  5TKW A;  1K6Y A;  4DU4 A;  1BA0 A;  3OYJ A;  1YT3 A;  4I2Q A;  4JLH A;  3NH0 A;  3KJV A;  3TAR A;  1K8K A;  1NJW A;  3I0S A;  1OVQ A;  3IS9 A;  3L4Q A;  3HPO A;  1J5O A;  4UQG A;  1S9G A;  4CZG A;  1Z05 A;  1VSJ A;  2QW9 A;  5ELZ A;  1WAF A;  3HM8 A;  3CJC A;  4CHQ A;  4FJ8 A;  1HQE A;  3HP6 A;  5F2R A; 
#chains in the Genus database with same CATH homology
 4IO8 A;  1BO5 O;  4BRQ A;  3OBY A;  2FF3 B;  4IO9 L;  1YI2 N;  2BTF A;  4NO7 A;  5E26 A;  3HZ6 A;  2FSJ A;  1W97 L;  4WQ4 C;  1T44 A;  3BUZ B;  5GAH P;  1SAZ A;  3G4S N;  3CJ1 A;  3PLA A;  1ATN A;  3D2F A;  4WCE L;  1XQS C;  2Q0R A;  5CE3 A;  4CI6 A;  2GWJ A;  3HOS A;  1X3N A;  5ADX A;  3O1B A;  4KH6 A;  1S3X A;  2HBL A;  4KH4 A;  2E1Z A;  4PL8 A;  3ZX0 A;  1KQS M;  3EZW A;  1T3V A;  2AA4 A;  4CBW A;  4ISG A;  1DGK N;  4JAX A;  4BR0 A;  1YUW A;  3F5T A;  4FWL A;  5BR9 A;  3CQX A;  1HKB A;  1MWK A;  2HOE A;  5BPN A;  1K73 O;  1V4S A;  3OW2 M;  4IOA L;  3BF1 A;  3WXI A;  1VQK N;  3VMF B;  1NGJ A;  4YOX A;  3GBT A;  4K43 A;  3SJH A;  1BA1 A;  3VER A;  5JMV A;  5JLF A;  3MWT A;  3E9P A;  1RDU A;  2A41 A;  3EN9 A;  1QQN A;  2P9P B;  1P90 A;  3MWP A;  3DXM A;  3F9M A;  4I6M B;  4K42 A;  3A5N C;  5M1P A;  3VTI A;  3ZEU B;  3CC2 N;  1EO1 A;  4XH4 A;  3MN7 A;  5CHI A;  1RGI A;  1QQO A;  2ASP A;  1V4T A;  3A5O C;  4BRI A;  1YHQ N;  1NMD A;  4A2A A;  1M1K O;  4QS7 A;  4BRC A;  4JKG B;  2J4R A;  4XEI A;  3UKU A;  4B1V A;  5M1F A;  1ZC6 A;  1YIT N;  4BEC A;  2QA4 N;  4BR2 A;  1MA9 B;  3QDK A;  2QTD A;  5BPM A;  2QWQ A;  2P9I B;  5GAG P;  5AQN A;  3P31 A;  1NGI A;  1TYQ A;  3WQT A;  4R79 A;  1G99 A;  1WOQ A;  3AAR A;  3D2E A;  2V51 B;  3TTD A;  5C15 A;  2Q31 A;  5AZI A;  1U2V A;  3ULE A;  3SMS A;  5FPN A;  4EFH A;  2P9S B;  1DKG D;  2P9U B;  5GIP A;  4JD2 A;  2NRW A;  5C0Y A;  1YAG A;  4B9Q A;  2V7Y A;  3K9J A;  2ITM A;  1JJ2 M;  4DKW A;  3O4W A;  3A5M C;  4GV6 A;  4DQ8 A;  2FXU A;  2W41 A;  4JK7 A;  3EE8 A;  3CJ9 A;  3K9K A;  3HOT A;  3C7N B;  1DEJ A;  3CF5 L;  1VQN N;  2VWB A;  4JKD A;  5AQF A;  4A59 A;  2CH6 A;  3SK3 A;  4BRG A;  2QWL A;  2ZGZ A;  3FZL A;  1NM1 A;  2Q0U A;  5C2D A;  1IJJ A;  3I56 N;  4JHD B;  3IMX A;  2P9L B;  3I8B A;  4CBU A;  1E4F T;  4CD1 A;  3L0Q A;  3AGK A;  1C0G A;  4A62 A;  3NMU A;  2RHK A;  3C6A A;  3VGL A;  3TPQ A;  5AQV A;  2HBJ A;  3I33 A;  3IKM A;  3S41 A;  1N8R O;  3WEE A;  5AQW A;  4BRE A;  1DT9 A;  5JVG L;  2EWS A;  3LDN A;  4BR4 A;  3H45 C;  4L3Q A;  2QWO A;  4B1W B;  5HOO A;  4FOI A;  3WQU A;  2HST A;  3O8M A;  2ZGY A;  4H0O A;  3P4I A;  3H1Q A;  2E2O A;  3SLC A;  5AQT A;  4K25 A;  5AQX A;  2FF6 A;  5AQP A;  2W00 A;  1Q82 O;  4FWR A;  1KC8 O;  1W2B M;  3CCM N;  2WC9 A;  4FWO A;  3R1X A;  3GG4 A;  5F0X A;  3CQY A;  3U9Z A;  2GWK A;  1BDG A;  4A2B A;  5EX5 A;  2ZJP L;  4NB4 A;  1YXQ A;  3ZYY X;  3MCP A;  4M7X A;  4A57 A;  1NGC A;  1NGB A;  3CHW A;  5M1K A;  4GV3 A;  4GVE A;  2W40 A;  3EO3 A;  3IDH A;  5AQJ A;  4M63 C;  2WBN A;  3KZB A;  5AQY A;  5M1O A;  2A5X A;  1NGG A;  4JKE A;  5GAD P;  1HKG A;  1R59 O;  1ILY A;  4Y0W A;  4BRL A;  1VQP N;  3CPW M;  4IZ9 A;  3PIP L;  1YVN A;  3O6W A;  4CD3 A;  2A3Z A;  1XC3 A;  2NRV A;  4BC5 A;  4YOV A;  2IVP A;  1Y64 A;  3QBX A;  5KQ8 A;  3R6M A;  4CJ7 A;  3MCA B;  4NLC A;  3FZK A;  1LCU A;  2HF4 A;  2ZJR L;  4IDH A;  1WUA A;  2ZWH A;  4BE7 B;  3L6Q A;  2BH1 A;  3NVK A;  1XUP O;  3G71 N;  3LM2 A;  5M1Q A;  5EXW A;  4A5B A;  2QI2 A;  1BOT O;  1KAZ A;  3VES A;  3CPE A;  3CET A;  3FFK B;  3AAQ A;  3VF4 A;  2F9W A;  1BU6 O;  3ATV A;  1SS6 A;  3MMV A;  1NLV A;  4FL9 A;  1BG3 A;  5AQL A;  1HPM A;  1QHA A;  2YHY A;  3GL1 A;  3HBT A;  3P39 A;  3Q7B A;  4PL7 A;  3JXU A;  1HKC A;  5HL7 L;  2ASO A;  5FPM A;  3DWL A;  1CZA N;  3H3N O;  5AQH A;  4BRM A;  4CBX A;  1VAZ A;  3KWG A;  3J7Z O;  4IEE A;  4DHY A;  3ID6 A;  1BUP A;  4YOT A;  5E84 A;  3VEY A;  3CCR N;  4G9Z A;  4PKH A;  1NJI O;  5M1N A;  3KWI A;  3EKU A;  1OKJ A;  3CER A;  4YDU A;  3RSE A;  3FZM A;  3O5B A;  5AQZ A;  4BRO A;  2NZT A;  4CZE A;  4U67 L;  4WF9 L;  1ZBS A;  1MDU B;  3AAP A;  5AQG A;  2E2Q A;  3WXL A;  4BEB A;  5KPR A;  4WFA L;  1HJO A;  4BRF A;  4MDB A;  3KHY A;  4H5R A;  3CCQ N;  1NGE A;  1RFQ A;  2NLX A;  4AM6 A;  2YJF A;  2JWK A;  3AY9 A;  2YI1 A;  1IG8 A;  2YX6 A;  3FLC O;  2PFU A;  3L4I A;  3HRG A;  3R3L A;  4JK8 A;  3TTF A;  3UB5 A;  4MO5 A;  3U9D A;  2P9S A;  3O80 A;  2P9U A;  4IJA A;  4YOY A;  4ILG B;  3WUH A;  3D2F B;  1KD1 O;  4BR7 A;  3CJ7 A;  4JKB A;  5C12 A;  2JWL A;  3CC4 N;  2E88 A;  3R9P A;  3BEX A;  4FVU A;  3D7E O;  2RE2 A;  4JKC A;  3TU5 A;  5KPZ A;  5I9E B;  3C7N A;  4HTL A;  5JIC A;  1E4G T;  1QVF M;  4F9O A;  4OPA A;  4EAH D;  2OTL N;  1VQ7 N;  4HWI A;  4K41 A;  3M6G A;  3BF3 A;  4OO1 J;  4YOW A;  1GLA G;  5AR0 A;  5GIN A;  1GLF O;  4QS8 A;  5BRH A;  3DLL L;  1MWM A;  5AZJ A;  1NGD A;  4CZI A;  3CJA A;  1VQ5 N;  2C1G A;  3UKR A;  4BY9 C;  4IXC A;  1Q86 O;  2IVO A;  4FWP A;  2F7T A;  2HBK A;  1BWF O;  5AQO A;  4AM7 A;  3SAG A;  1GLL O;  3B8A X;  2BUP A;  3LDO A;  5MLC Q;  2CGJ A;  3OBW A;  4YDU C;  3ZX2 A;  4RWT A;  2UYT A;  4FWM A;  4EIA A;  4DB3 A;  5LJW A;  2HMP A;  4BRA A;  2NRR A;  5LJV A;  5BRD A;  4WFN L;  2P9N A;  3C65 A;  4JK9 A;  3DJC A;  3CD6 N;  2I7P A;  5BRF A;  2KKZ A;  3JS6 A;  3UKU B;  1YIJ N;  2VCP A;  4EHT A;  3O9U A;  4H5T A;  3WXM B;  2VGN A;  5AFU H;  4QS9 A;  2PBD A;  3A5L C;  3MDQ A;  3QFP A;  3VOV A;  2D0O A;  3ID8 A;  5JVH L;  1TYQ B;  2Q36 A;  2YCH A;  3CC7 N;  2ZF5 O;  3IUC A;  4GY2 B;  1SQK A;  3R8E A;  5F1X A;  4JKH A;  5AQR A;  5AZI B;  2ZJQ L;  1U2V B;  5CR4 A;  3VEW A;  4BVP A;  1P8Z A;  2OAN A;  3MN9 A;  1T6C A;  4FWQ A;  4IJN A;  3TTC A;  3W3D A;  4MDA A;  1NBW A;  3M1F A;  4BRD A;  2P9K B;  3ENH A;  3M3Z A;  4BRN A;  3CME N;  2Q2R A;  4BGA A;  5ADX H;  2OTJ N;  4KBO A;  1ZXO A;  3I55 N;  4O5F A;  1U6Z A;  4FO0 A;  3VGM A;  1T6D A;  4MLE A;  3E66 A;  5DM6 L;  1VQM N;  3SAF A;  4UY8 O;  3O9S A;  1YF5 L;  3VEO A;  3O1W A;  3G25 A;  2IVN A;  4OPH A;  3DXK B;  3VGK A;  3E1Y A;  5TKY A;  4WFB L;  4BQZ A;  2CGL A;  4DCH A;  3Q7C A;  4JNE A;  3WXJ A;  5BRE A;  4KH5 A;  2H3G X;  3OHR A;  4BVO A;  1J6Z A;  3VF2 A;  1O13 A;  2QWM A;  1X3M A;  2A40 A;  3QFU A;  3KVG A;  3MK6 A;  3FE1 A;  3OA9 A;  5BPL A;  1S72 N;  4IWV A;  2GEL A;  5EOY A;  4J8F A;  2CGK A;  2GX9 A;  3LDL A;  2NRZ A;  2NRH A;  4B1Y B;  3C0B A;  2YJE A;  3VEN A;  3W0L A;  4PHT X;  4A5A A;  1GLB G;  4IOC L;  1VQ4 N;  4BC2 A;  5AQK A;  1ATS A;  3CCE N;  1QQM A;  4JKF A;  4H0T B;  5BN9 A;  1VQL N;  1VQ8 N;  1KAX A;  1KAY A;  3E9O A;  3C6H A;  3N4P A;  4IOX A;  2Q1N A;  2E8A A;  3E9L A;  2QXL A;  4BRH A;  4RCH A;  1Z6R A;  3CMA N;  3FZF A;  3LL3 A;  1NWK A;  4EHU A;  3IFR A;  3TSP A;  5FPE A;  4BR9 A;  3TSQ A;  3N4Q A;  4FWN A;  3H3O B;  4WQ5 A;  1HLU A;  2F9T A;  2P9P A;  4FOE A;  4I6M A;  3T69 A;  3ZX3 A;  3ZEU A;  1K8K B;  2CH5 A;  3H1V X;  4BR5 A;  1GLC G;  4RTF D;  3A8Y A;  3RVC A;  2GEM A;  3KK7 A;  5C10 A;  4JKG A;  4H5W A;  1JCG A;  3P38 A;  2VGM A;  4GNI A;  3AGR A;  5AQU A;  3PIO L;  2P9I A;  3MN5 A;  4H0X B;  3ZET B;  5DM7 L;  3D6R A;  1YJ9 N;  1NGA A;  2A6A A;  4H5N A;  2KLA A;  4ILJ A;  1Q81 O;  3O9Q A;  2QWP A;  2NRT A;  3SAH A;  3VET A;  4JN4 A;  5EY4 A;  2D4W A;  2GUP A;  3LDP A;  4H0V B;  3T7Z A;  4H0Y B;  4FSV A;  3WXK A;  5LY3 A;  4XJX A;  4YOU A;  1TUU A;  4B1U B;  2DPN A;  3FGU A;  4ISE A;  4B1Z A;  1JCE A;  2E1Y A;  4PKG A;  1RDW X;  4YOR A;  2QWR A;  2PAV A;  3CCU N;  3J8A A;  3GOI A;  5GAE P;  5EVZ A;  4E1J A;  5JLH A;  1GLJ O;  3U4L A;  4FPA A;  3SMP A;  3GE1 A;  1LOT B;  4PKI A;  2HBM A;  2KHO A;  3EE9 A;  3CI5 A;  2QWN A;  3MN6 A;  5GIO A;  1VQ6 N;  4CZF A;  4U7B A;  3DAW A;  1S22 A;  2NRX A;  3ATU A;  1QZ5 A;  3QB0 A;  2AP1 A;  3ENO A;  5KQD A;  3CCV N;  4JHD A;  4CZK A;  3EL2 A;  4C1N I;  2P9L A;  4CZJ A;  1YJW N;  5AQI A;  1M90 O;  4WQ5 C;  3RSE B;  3HSC A;  1ATR A;  3O9T A;  3CCL N;  1ESV A;  3LDQ A;  2V7Z A;  3HI0 A;  3HTV A;  3QIC A;  4BRP A;  1OVY A;  1QVG M;  3DXM B;  4MO4 A;  1VQO N;  2NNW A;  3BP8 A;  3F2K A;  4LC9 B;  5KPT A;  3CIP A;  1NGF A;  2E20 A;  3TSU A;  4A61 A;  1HUX A;  2A42 A;  2P9K A;  4BG8 A;  1QZ6 A;  3VPZ A;  4FWK A;  5C2F A;  4WYB A;  4JEP A;  2QM1 A;  3H6E A;  3CXC M;  3LM9 A;  3D2E B;  3QBW A;  4BRK A;  2E2P A;  2VYP A;  3SBT A;  4CZM A;  3H46 O;  1TUY A;  2Q97 A;  3DXK A;  4H03 B;  3ULE B;  4BC3 A;  3VEV A;  4IFE A;  4NLB A;  1GLE G;  2E2N A;  5AQM A;  1K8A O;  4BQL A;  2YHX A;  5AZJ B;  3FZH A;  4JD2 B;  2V52 B;  4FWS A;  2FSK A;  3FR0 A;  3UKR B;  3G6E N;  1SZ2 A;  4ILH A;  2ASM A;  2D1K A;  4O8U A;  3VTH A;  3UE5 A;  2FSN A;  4B1X B;  4C23 A;  5B8H A;  4GV9 A;  4BC4 A;  4O8K A;  2C1I A;  3WT0 A;  4BG9 A;  5FPD A;  5AQS A;  1KXP A;  4CZH A;  4WQ4 A;  2P9N B;  3O08 A;  2GTD A;  2D0P A;  2FLO A;  4XH5 A;  2WUS A;  3CJB A;  4Z94 A;  3O9R A;  1K9M O;  3CCS N;  3M5R A;  4H0P A;  3MX5 A;  4ISF A;  3VEZ A;  3GDQ A;  3SBG A;  4BGB A;  3MX2 A;  3U8X A;  4FPB A;  4H5V A;  3A0I X;  1JCF A;  1HX1 A;  1NGH A;  3WEE B;  3VF6 A;  4MLH A;  3EKS A;  5TKW A;  3NVM A;  1H1V A;  1BA0 A;  2QEX N;  2I7N A;  4CZL A;  4IEI A;  5AQQ A;  1K8K A;  1Q18 A;  1YJN N;  2WFB A;  3L4Q A;  4XH1 A;  1D4X A;  1X9J A;  2HF3 A;  1GLD G;  3ENB A;  5BN8 A;  1Q7Y O;  4CZG A;  1Z05 A;  4C1N K;  2QW9 A;  3VEX A;  5ELZ A;  3HM8 A;  4JKA A;  3CJC A;  3QML A;  4M7Y A;  1EQY A;  5H1S Q;  2YHW A;  1VQ9 N;  3CCJ N;  3ZET A;  1C0F A;  5AFU A;  4AF1 A;  2IIR A;  5F2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...