3CIPA

Complex of dictyostelium discoideum actin with gelsolin
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
371
structure length
362
Chain Sequence
VQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTKDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Major actin
total genus 122
structure length 362
sequence length 371
ec nomenclature
pdb deposition date 2008-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cipA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cipA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3cipA03
4BGAA 4CBUA 4FSVA 2E2OA 4J8FA 5F1XA 5FPMA 1NGFA 2E2NA 3VEYA 3AAPA 3UKUB 4PL7A 3RSEA 3FZHA 4EAHD 2FLOA 2QWOA 3CJ9A 1Z6RA 1BDGA 1KXPA 4A62A 1BA0A 3A5OC 3G25A 3R8EA 2GWKA 4FOIA 3VEWA 3VF6A 5AQVA 1C0GA 3VGKA 1GLLO 2GWJA 2P9KB 3R6MA 4BG9A 5FPDA 4CZFA 3MCPA 3CJ7A 4PKIA 1NMDA 2ZF5O 1H1VA 3QB0A 3CJBA 2P9NB 1X9JA 3L4IA 5AFUH 1OKJA 3R9PA 1DKGD 3M6GA 3HTVA 4QS9A 1CZAN 5AQOA 5AQJA 4B9QA 5KQDA 1HJOA 3MK6A 4EHTA 3UKRA 4B1YB 3FR0A 3HBTA 3IDHA 3I8BA 1RGIA 2PBDA 2A6AA 1ESVA 2UYTA 1BG3A 2V51B 1ZC6A 3J8AA 3H45C 5AQRA 4FOEA 1NGJA 3EO3A 3WXIA 1HUXA 2Q1NA 4BC5A 1S3XA 1QZ5A 2GUPA 1K8KB 1QQMA 1V4TA 3SJHA 3ZETA 4CZMA 3ATUA 3CHWA 4BR7A 5E84A 1TUUA 2FXUA 4FWSA 4CBXA 1BO5O 1NWKA 2A40A 2EWSA 1YUWA 3CI5A 2BTFA 2P9LA 1GLFO 2ITMA 3WUHA 3MDQA 2D4WA 4FWQA 1QHAA 1IG8A 5AR0A 2DPNA 5BREA 3ZX2A 4BRQA 2E1ZA 3VENA 3A0IX 3ID8A 3A8YA 1GLDG 1LCUA 3VESA 1ATNA 4NB4A 4B1VA 4YDUC 1BA1A 2HOEA 1NM1A 5AQWA 1GLCG 4B1WB 5ADXA 2YHXA 5BR9A 4XH4A 3VPZA 1S22A 2A42A 3FZLA 4FWPA 4H0TB 2CH6A 3FGUA 3VF2A 4FPAA 2V52B 2ZGZA 1U2VB 3U9DA 4B1ZA 4WQ4C 1G99A 1GLJO 3KHYA 3QFPA 2E20A 3FFKB 4RTFD 5B8HA 2VWBA 1XC3A 2P9UA 4XH5A 3U9ZA 1KAXA 3U4LA 3WT0A 5ADXH 3CQXA 5EOYA 5AQGA 3WQUA 4F9OA 3BUZB 1ZBSA 2E2QA 2E88A 3L6QA 4Z94A 3WXLA 2V7YA 4BREA 1BWFO 3BF1A 2YI1A 2QW9A 3EZWA 4H0YB 2FF6A 1WOQA 2NZTA 4BRAA 3F9MA 5BPLA 5EX5A 4LC9B 3ZETB 5LJVA 2Q2RA 4BRFA 3SLCA 1DGKN 3VOVA 1Y64A 3VEOA 4FWOA 5F0XA 3QBXA 4M63C 2P9LB 5BN8A 2YJEA 3AY9A 1IJJA 1QZ6A 4WQ5C 3O8MA 4BRHA 1KAZA 3HZ6A 5AQLA 4BRMA 2P9IB 4CD3A 2YCHA 3DJCA 2P9PB 3CJAA 3LDNA 4BRGA 1V4SA 3CETA 2D0OA 3FZKA 3H3NO 4JHDB 4BC2A 5AQQA 2Q97A 1X3NA 5KPTA 4CZJA 3DAWA 4BR2A 4JNEA 4JN4A 4MO4A 3EL2A 4FWKA 3CJCA 1NGBA 1YVNA 3ATVA 1GLAG 1QQNA 2BUPA 4PKGA 3MMVA 4IJNA 3WEEA 2P9NA 4B1UB 2NRHA 5JLFA 3WXKA 4FO0A 4H0VB 4BVPA 3MN6A 4JAXA 1MDUB 2P9SB 1HPMA 5FPEA 1ATSA 2ASPA 4H5NA 1BU6O 3QDKA 1T6CA 3ULEA 1E4GT 2P9PA 5JMVA 2A5XA 2GTDA 4BG8A 1GLEG 4H03B 4A2BA 3GDQA 4BC3A 4BR9A 4IJAA 3B8AX 4CZKA 3O80A 4KBOA 4RCHA 4DHYA 3DXKB 5I9EB 1K8KA 4BR5A 1JCFA 3UE5A 2QM1A 4O5FA 5ELZA 2E8AA 5EVZA 2CGJA 3OHRA 5JLHA 4FWLA 3QICA 5AQUA 1DEJA 3CIPA 1BUPA 2QWNA 3FE1A 4H5RA 3VERA 3WXJA 4FWMA 3A5NC 4BRPA 3GBTA 2IVOA 3TPQA 5KPZA 3FZMA 4BRCA 2Q0UA 3D2FA 3MN7A 5AZJA 4EFHA 3A5MC 2D0PA 5E26A 4L3QA 1XUPO 4DQ8A 2WUSA 5AQMA 1NGCA 2CGLA 3LM2A 3UKRB 3LDLA 4MO5A 4BRKA 4CJ7A 1GLBG 1NGAA 3CJ1A 3D2EA 4JHDA 2YHWA 3GOIA 3VETA 2GEMA 1SQKA 3FZFA 1R59O 5AZIB 1TYQB 2QWPA 3A5LC 4FWNA 3BF3A 3O4WA 2E1YA 2Q31A 2GELA 4A61A 2FF3B 2H3GX 3JS6A 3MN5A 3C7NB 4BGBA 5AQSA 3ZX3A 4EIAA 3WEEB 3H3OB 2AP1A 1WUAA 3D2FB 3AAQA 2ZWHA 4CZIA 3VEZA 2Q0RA 3LM9A 3HM8A 5AQIA 3S41A 2P9SA 2VYPA 4FPBA 2I7PA 3W0LA 2KHOA 2HMPA 2YJFA 5KPRA 2E2PA 4BC4A 2F9TA 3VF4A 1MA9B 1D4XA 4ISFA 4BQZA 3AARA 4ISEA 1LOTB 2I7NA 4M7YA 3IMXA 1NGDA 4IZ9A 1HX1A 3M3ZA 2ASMA 2J4RA 3SMPA 4DCHA 3H1VX 3EKUA 3CERA 3VGLA 3O08A 4H5VA 3L0QA 4YDUA 4JD2B 3QBWA 4H0XB 4FWRA 3KZBA 3IUCA 3UKUA 3LDOA 4MLEA 2P9UB 1T44A 3BEXA 1HKBA 1MWKA 4AM7A 3VEXA 2CH5A 4QS7A 1QQOA 1BOTO 1RDWX 4H0PA 4M7XA 4A2AA 3JXUA 1HKGA 4BR4A 2IVNA 2P9KA 1MWMA 1J6ZA 3ZEUA 3H46O 2F9WA 4BRDA 5CE3A 3KVGA 1YAGA 4CZGA 1ATRA 1E4FT 4QS8A 2VCPA 1EQYA 4BRIA 4I6MA 5AQTA 3D7EO 3CQYA 4IXCA 4Y0WA 3C7NA 5AQYA 4CI6A 3QFUA 3ENHA 3LDQA 5AQXA 3UB5A 1P8ZA 4BRNA 5EY4A 3ULEB 5BPNA 4XH1A 4BVOA 3I33A 4CBWA 3DWLA 3ZX0A 5EXWA 4BRLA 2P9IA 3EKSA 3LDPA 3W3DA 2FSNA 2YHYA 3LL3A 1NBWA 2FSJA 2Q36A 5TKYA 3U8XA 3ZEUB 1HLUA 3VGMA 5FPNA 5LY3A 3DXMB 5AQZA 4I6MB 1SAZA 3FLCO 4PL8A 3WQTA 3M1FA 2IIRA 4K41A 4CZEA 2W40A 4MLHA 1NGHA 4BQLA 3P4IA 2FSKA 4FL9A 5AQNA 4GNIA 3RSEB 4NO7A 3C0BA 1NLVA 2HF3A 2ZGYA 3GL1A 3O1WA 4K43A 1KAYA 4DB3A 3O5BA 1Q18A 4CD1A 3QMLA 4H5TA 4CZLA 2AA4A 5AQHA 1X3MA 5AQFA 1TUYA 3H6EA 4RWTA 1NGEA 5AZIA 1Z05A 1NGGA 5BRHA 4C23A 5BPMA 5LJWA 3DXKA 3HI0A 3BP8A 4WQ5A 3O1BA 5AQPA 4AM6A 2A41A 5AQKA 5JICA 5BRFA 1U6ZA 2D1KA 4H0OA 4BR0A 3ENOA 4ISGA 4E1JA 1U2VA 3GE1A 3HSCA 4O8KA 4H5WA 4IO8A 4B1XB 1YXQA 1T6DA 5F2RA 1HKCA 2IVPA 4HTLA 4XEIA 1NGIA 4IWVA 4K42A 3MN9A 3GG4A 5AZJB 3H1QA 1RFQA 3O6WA 4GY2B 2W41A 4WYBA 5BN9A 1JCEA 2QWLA 5KQ8A 4EHUA 2V7ZA 1C0FA 4HWIA 5AFUA 3SK3A 5BRDA 2QWRA 3VEVA 3D2EB 4CZHA 2CGKA 4PKHA 2QXLA 1TYQA 1SZ2A 3IFRA 2HF4A 2OANA 1JCGA 2ASOA 1ZXOA 2QWQA 4JD2A 4K25A 2QWMA 3DXMA 4WQ4A 2A3ZA 1XQSC 3SMSA 2NLXA 3TU5A 4BROA 2PAVA 3EN9A
chains in the Genus database with same CATH superfamily
4BGAA 4CBUA 5BR8K 3OYFA 5F1XA 5HRPA 3AAPA 3VQ7A 4WCEL 2QEXN 1JLEA 1YJWN 3CCEN 4DWIA 1NG9A 3C6AA 3A5OC 4DSJA 1JL2A 4FOIA 2O8BB 4AQYK 4IBNA 3CCQN 3OS0A 3AVNA 5AQVA 1C0GA 1IKWA 3M8RA 2WC9A 4OGCA 3OBYA 2P9KB 4CZFA 2PY5A 3VQBA 3CJ7A 3D45A 1NMDA 1HQUA 4CF9A 3CJBA 3TWHA 1YTUA 1OKJA 3VTIA 4CGGA 4KH6A 5AQJA 3ID6A 4B9QA 3HSTB 1HJOA 3MXJA 4EHTA 3NF6A 1U45A 1QVFM 3FR0A 3IDHA 2A6AA 3VTHA 3QNOA 2EX3A 3MWPA 1VQ8N 1RTDA 3J7YP 4DR1K 3HK2A 4BC5A 2OZMA 1LAWA 2NRZA 2VQEK 1X9WA 3NDKA 1E3MA 4DUZK 3LWMA 2FXUA 4FWSA 4CBXA 1NWKA 3CCMN 2BTFA 3T1AA 1GLFO 3MDQA 2OPRA 2D4WA 3QINA 1TK0A 3EE8A 1X9SA 5BREA 4CJFA 3VENA 1NJIO 1ASWA 3AO5A 1C1AA 3A8YA 3M8SA 4MFBA 4B1VA 2HOEA 3QEXA 1Z26A 3CM5A 3KTQA 5C15A 4E7LA 3TSPA 2YHXA 1KQSM 2ZQBA 3FZLA 1I39A 3DLGA 4KHWA 3MEGA 4Y1DA 3T1YK 2BE2A 4CHPA 1L5UA 1VSJA 2ZGZA 4B1ZA 1TL3A 4CECA 3OYGA 4FZYA 2KTQA 5GINA 4KI6A 3LZJA 4BE0A 3I8DA 1YI2N 2P9UA 4XH5A 3U9ZA 1KAXA 3CQXA 3HPOA 1BCOA 4FM0A 3O3GA 3L6QA 1HNIA 4BE7B 3S3OA 2WTUA 3DOLA 2QKKA 4ILGB 4CE9A 4NCBA 4H0YB 5HP1A 4IFYA 4A5BA 4DTSA 3PSIA 1WOQA 2NZTA 4BRAA 2XY6A 4JI7K 2BDPA 1FKPA 2QK9A 3OY9A 1Z25A 4JKGA 1RDDA 3SLCA 1Y64A 4H4OA 3SQ0A 4JI5K 4FK4A 3QBXA 1S1UA 3VQ5A 1IJJA 1L3SA 4GVEA 4BRHA 1SKRA 5HOOA 1KAZA 5AQLA 3PO4A 3DJCA 4CEEA 4DQSA 3FZKA 4BC2A 4J2DA 4N47A 1Q86O 4F3OA 4N5SA 4I9LA 4O55A 3WXMB 3DLBA 3VMFB 3L8BA 3AVLA 4FK2A 4JNEA 4FLXA 1ZYQA 1NGBA 2KQ2A 1GLAG 3T7ZA 4PKGA 3HYFA 1LAVA 1OH6A 4FO0A 4DSFA 4CEOA 4AHSA 3V9XA 4Z4FA 4HUFA 3KD5E 2C1GA 1TKZA 1MDUB 4JKHA 4BWMA 1HPMA 4M3XA 1BU6O 4PQUA 3AVBA 1KFDA 2A5XA 4BG8A 4CVNE 1GLEG 3S5TA 4B9TA 3GDQA 2O8BA 1BGXT 3B8AX 4KBOA 4C8LA 1SUQA 1SL1A 1KD1O 2O8CB 3TSUA 4CJSA 1WNSA 2QM1A 4O5FA 1GOCA 4DTNA 5ELZA 2CGJA 3OHRA 5JLHA 1SL2A 4M3YA 5AQUA 1DEJA 3FFIA 5C25A 3FE1A 2QI2A 5GAGP 4X62K 2Y1JA 1JJ2M 1DLOA 1XHXA 3WXJA 3WNGA 1VSMA 2VGMA 4CJ5A 3P5JA 5KPZA 2KLAA 4BRCA 2Q0UA 3D2FA 2VGNA 3SYZA 3MN7A 3E9PA 4E7IA 3OYAA 4OKEA 3DLEA 2D0PA 3QESA 3E66A 4DU1A 2WUSA 4PHTX 3SBGA 3LM2A 4DF4A 4BRKA 3THYB 1HR0K 3M5RA 4CFBA 2E6MA 3B6OA 5AZIB 1R59O 1TYQB 2QWPA 4YORA 3ZT4A 2RKIA 3BF3A 4FJ7A 3O4WA 4O5BA 2GELA 3ASMA 4A61A 4OKJA 2H3GX 3MN5A 2WFBA 3WEEB 2FBXA 3H3OB 4GVMA 3TAQA 2HHTA 1KVCA 1C0UA 4AH9A 3IAYA 4YNQA 4DS4A 4K0KK 2B6AA 3LM9A 3MEDA 1QE1A 3C6HA 4IDHA 3T1HK 4YOWA 1D8YA 1IO2A 4MDAA 1QSYA 5KPRA 3O9SA 3HRGA 4FVUA 4E72A 3VF4A 5HROA 3ZSVA 4BDZA 4ISEA 4CJWA 3SZ2A 2I7NA 3KLIA 4M7YA 2P5GA 4LFCK 5KRSA 3E01A 4DCHA 3V4IA 4IOAL 4EP4A 3H1VX 3EE9A 3O08A 3SQ4A 1N34K 2DTUA 3AVFA 4YDUA 3SV4A 3VQCA 4W5OA 4CJ4A 1N36K 3AA3A 3LDOA 3QLHA 2P9UB 3OBWA 4O44A 4V19S 3VA3A 3DLHA 1HKBA 4N76A 1DTTA 4KHUA 1MU2A 4N41A 4A2AA 4DQPA 3CCUN 4KHSA 3JXUA 1UA1A 4PWDA 3ZEUA 3H46O 1ATRA 1NK9A 4BRIA 3NF8A 5AQTA 1HYZA 4Y0WA 5AQYA 3QFUA 1S9GA 3JSMA 3LDQA 1P8ZA 2OPQA 3NE6A 5EY4A 1A5WA 1M1KO 4DTJA 1JXBA 3ZX0A 4HCBA 2Y1IA 3EKSA 2HBMA 3V1RA 4IFEA 1WBBA 1NBWA 1FJGK 2XRIA 3EEQA 4KH4A 4CEAA 4DV3K 4B9MA 5FDLA 4DFPA 3DXMB 4L8RB 4PL8A 1HYVA 1NMNA 3C6TA 4WE1A 2FC0A 3N4QA 3O9TA 3WNHA 3CC4N 1NLVA 4JRPA 3O1WA 1KAYA 1QVGM 4BDYA 1HNVA 4PY5A 4CD1A 1I3AA 4H5TA 5AQHA 4CJLA 3TAEA 1NGEA 3SQ2A 5BRHA 1NGGA 1R0AA 5BPMA 4LD0A 3O1BA 4AM6A 2A41A 2HNZA 3T69A 3UIQA 1U47A 1WSJA 4JKFA 2HVIA 2IGIA 1U2VA 5CZ2A 4IO8A 2A1SA 2FBYA 2RF2A 1YXQA 4E7HA 4I2PA 4BE2A 1HKCA 2IVPA 2E5LK 4XEIA 1ZBHA 4NYFA 4K42A 3MN9A 4KH5A 1VQLN 4TSXA 4C8OA 1KVBA 2X74A 4OVLA 3JYTA 3L2RA 3EZ5A 4QAGA 4DR6K 4PUOA 2V7ZA 3AVMA 3VEVA 5KGWA 5IT9O 1N8RO 1TYQA 2HF4A 3DRSA 2ASOA 2QWQA 2A3ZA 4BROA 2RN2A 2FBVA 2C1IA 4FSVA 2E2OA 2E2NA 5KTQA 1B9DA 5M1FA 3K5LA 3FZHA 4EAHD 2QWOA 4CEDA 2JGUA 1K6YA 4G1QA 5C10A 5MLCQ 1KXPA 3P38A 2PZSA 4CGHA 4BACA 4GMJB 3VEWA 4KKOA 1A5VA 3G6EN 3MXMA 1S1XA 4JKBA 2F8TA 3R6MA 4FJGA 3AVGA 4IEIA 4PKIA 2ZF5O 3QB0A 3WNFA 4FLYA 2NUBA 4NXNK 5HRSA 3M6GA 3P1GA 3HTVA 4QS9A 4FVMA 5AQOA 2YHAA 5KQDA 4DF8A 3O9UA 3A2FA 3VQEA 3I8BA 1RGIA 2KFNA 4RW7A 1ZC6A 2VG7A 1NK0A 3H45C 5AQRA 4FOEA 1N6QA 1K8AO 3WXIA 2Q1NA 1S3XA 1QZ5A 2GUPA 2HB5A 1K8KB 1QQMA 3SJHA 3BY5A 1NNEA 3CHWA 4BR7A 4CJTA 4A5AA 3SUPA 1UA0A 1VK0A 4KAZA 3S3MA 3SAGA 2P9LA 4CJPA 1RT2A 5I42A 2UXBK 1C1CA 2I5JA 2HSTA 3VQPA 5AR0A 2DPNA 2O8EA 2AJQA 1QSSA 1QSLA 1J54A 1J5OA 5KI6A 1LCUA 3PUFA 4H8KA 4NB4A 4YDUC 1TK5A 1BA1A 4O0IA 3V9ZA 5JS2A 1NK5A 1O13A 5BR9A 4DUYK 1OH7A 3ENBA 3C65A 5I3UA 1VQ9N 1S6QA 3V9UA 2XY8A 3PLAA 2CH6A 3FGUA 4LF5K 3VF2A 4DQQA 3DM2A 3THXB 1GOBA 2V52B 4JKDA 3LDSA 4WQ4C 1GLJO 3KHYA 4ZTJA 2ZD1A 3MECA 4DMNA 5GADP 5B8HA 3DRPA 3ZT3A 2HVHA 3NVMA 3WT0A 3QEPA 1NJZA 4IG3A 3ZSYA 5EOYA 4JI8K 4DTUA 2E2QA 2E88A 4Z94A 1ZBFA 2V7YA 4CIGA 4GV9A 5FRNA 2X6SA 3V9SA 1HNZK 4BREA 3BF1A 4M45A 3ZT0A 4O8UA 2YI1A 3K5NA 2QW9A 1XNQK 1RDCA 1IKVA 2IC3A 3HPGA 1J9AA 4GKJK 1KFSA 4DLEA 3CD6N 2NNWA 2W6LA 3CPEA 2D0BA 4CK3A 4CFCA 5BN8A 4ILJA 3AY9A 2Q3SA 4WQ5C 3PX0A 3OYMA 4RW6A 5GIOA 2OPPA 3O3FA 2YNFA 2YCHA 4BRGA 2P9PB 2KW4A 1V4SA 3CETA 2D0OA 3ZSWA 4JHDB 3H08A 4JEPA 4CZJA 1BI4B 4BR2A 4W5RA 1ZBIA 2RHKA 3EY1A 3QEVA 3LZIA 1YT3A 3ATVA 1T7PA 4M3TA 1QQNA 1Q8IA 2NRHA 3WXKA 1J53A 4O0JA 4H0VB 3R1XA 3AGRA 4BVPA 3KK1A 4Z4GA 2Z1HA 4JI4K 4RG8A 5FPEA 2ASPA 2OPSA 3ULEA 4IOCL 2DY4A 5JMVA 3KWGA 3ZSRA 3NGIA 4YOYA 4H03B 4A2BA 4BC3A 3RMAA 4JKAA 3DRRA 3DXKB 4KI4A 1T3VA 5I9EB 2OYQA 3L2QA 4BR5A 4JI6K 2BH1A 4FJLA 2E8AA 1D9FA 4HUGA 1VSLA 4JI0K 3VQQA 3CIPA 2D0CA 4N56A 4DQIA 4H5RA 2B5JA 3A5NC 4FZXC 4FJ8A 1HNWK 2W6KA 1RTIA 4I2QA 1VQPN 3CFRA 1XUPO 4E1MA 4CERA 3LDLA 1NGAA 3CJ1A 3D2EA 3NGZA 3CCJN 3FZFA 5J2PA 4CHOA 5DK5A 3A5LC 4ZHRA 2JWLA 1S9EA 3L3VA 3JS6A 3C7NB 2ZJRL 2UXDK 3ZX3A 3KK2A 2HHVA 1WAFA 1CZBA 3Q7BA 1LWEA 2PYJA 5AQIA 1L3UA 3TARA 3HPHA 2WONA 1C6VA 2HMPA 4B9LA 2YJFA 3SJJA 3NF9A 4BC4A 1CLQA 3KWIA 1LOTB 2W42A 4DSKA 1TKDA 3IG1A 4IZ9A 5K14A 3M3ZA 2ZM6K 5LL6Z 4DTRA 4CJVA 3THXA 4B9UA 3EKUA 3MWTA 3L0QA 3QBWA 4H0XB 1NU0A 4MDBA 5JVHL 1NJXA 1XC9A 2NRVA 3HVTA 4FWRA 3KLHA 1NK4A 2OA8A 4CF1A 4FYDA 3CFOA 3UKUA 1T44A 2E4LA 4AHRA 1Q9YA 2GX9A 4FK0A 1YVUA 4JLHA 3L2UA 3CYMA 4AM7A 3SPZA 4QS7A 1QQOA 1BOTO 4E1NA 4DS5A 4M7XA 2O8DB 4B3SK 4C1NI 1HKGA 3V81A 3BZCA 4W5TA 1MWMA 1J6ZA 2WBNA 2F9WA 4M3UA 4J2AA 3ISNC 1E4FT 3O4NA 4FW2A 4I6MA 2NRXA 3CQYA 4IXCA 4JI2K 5IWAK 3ENHA 4B9VA 1VQKN 3MX5A 4OPHA 5J1EA 3P39A 1RBRA 3RWUA 1M90O 4DTMA 3I33A 5C2DA 2VQFK 4CBWA 1VQ4N 5EXWA 4CFAA 1NKBA 4LF9K 4OKKA 4EZ6A 2G8FA 1VQMN 4JS5A 3U8XA 2IAJA 3NH2A 2PFUA 1VAZA 3M8QA 4DSIA 4LF4K 5CYQA 4CEZA 3WQTA 3I0RA 4EZ9A 3M1FA 3U6FA 3WNEA 4X65K 4JK9A 3VQ6A 4MLHA 4BQLA 4FL9A 3RSEB 3OYHA 2XY7A 3K57A 3AVHA 4KREA 3C0BA 3O9RA 2HF3A 2YV0X 3GL1A 1U49A 3O5BA 3OJUA 1S72N 1WBDA 4K8XA 3KKRA 4YHHK 1SV5A 4B3MK 1NOZA 5HL7L 1RBTA 5AQFA 3OYDA 1RT5A 2XY5A 3H6EA 5AZIA 4F8RA 5M1KA 3KLFA 1D5AA 4DV1K 5LJWA 1BQMA 3DXKA 3BP8A 2OCEA 5AQPA 3TR8A 3LP3A 5AQKA 1U6ZA 4BR0A 3ENOA 2HNYA 2UUCK 4KHQA 3ZSZA 3HSCA 1I94K 2UUAK 4DQRA 2HHUA 4I9QA 4FJNA 5DMRA 4KPYA 1NGIA 4R79A 3H1QA 5KRTA 2JWKA 4WYBA 3NMUA 1JCEA 1TAUA 3C95A 4EHUA 3JAMO 1C0FA 4AHUA 1VQ5N 4GW6A 3D2EB 4CZHA 4PKHA 3DLLL 1NJWA 2O8FA 1SZ2A 3IFRA 2OANA 1ZXOA 2HHSA 3J81O 4K25A 3DXMA 1HNXK 4DR3K 4KTWA 2HMIA 3EN9A 2F8SA 5FPMA 1KSPA 4IDKA 4NYNA 1U04A 3TAGA 1QHTA 4LF7K 1Z6RA 4A62A 4CEQA 3U3GA 1BA0A 2PYLA 3QIOA 1IG9A 4RW4A 3G25A 3R8EA 3NCIA 3QETA 1RT7A 1GLLO 3E1YA 2RE2A 2GWJA 2QXFA 3HOSA 1ZBLA 4BG9A 1KLNA 3AO2A 2OTLN 4CJRA 2KKZA 2P9NB 1X9JA 3R9PA 3J80O 1DKGD 1CZAN 3K59A 3OYKA 5E41A 2LSNA 3NFAA 1BHLA 4B1YB 3HBTA 4CJUA 2PBDA 1VSHA 2HHWA 1YITN 4B3OA 5HRNA 4CEBA 1RTJA 3HP9A 2HBLA 3P83D 4J2EA 1HUXA 4RW9A 3EYZA 1RILA 1EP4A 3IS9A 3ZETA 3ATUA 1IH7A 5LMUK 1BO5O 1YUWA 4FWQA 1EETA 5JS1A 1QHAA 1JXEA 2G8HA 4LF6K 3ZX2A 4BRQA 2E1ZA 3R3LA 5GAHP 2X78A 4DTPA 3LP1A 3ID8A 1GLDG 2IDOA 4CHZA 1NM1A 4R5PA 1KTQA 5ADXA 5FRMA 4LFBK 4KHPK 2ETJA 2GV9A 2F96A 4LH5A 3U3YA 4BY9C 1LW0A 3LPUA 4LSNA 1WSEA 4Z0UA 2HBKA 1C0TA 4FJHA 1U2VB 3F73A 1G99A 3ITHA 4KO0A 3RVCA 3QFPA 3FFKB 2VWBA 5LMNK 1N32K 3AVJA 1BIUA 2ZJQL 3DMJA 1TK8A 4JS4A 1EWRA 3CCVN 3RMDA 3WQUA 1IBMK 2D5RA 1SS6A 3TI0A 2BGGA 4HUEA 3CC2N 4DV7K 2W00A 2FF6A 1B92A 1IKXA 3F9MA 2DFEA 4NLBA 4LC9B 2Q2RA 4CK2A 3PX4A 4BRFA 2ATQA 1DGKN 3RMCA 1NKCA 4FWOA 3CCRN 2P9LB 2YJEA 1B9FA 1JLQA 3O8MA 1NKEA 3V6DA 2F7TA 1OH5A 3TSQA 4E0DA 3QEIA 2O8EB 4BRMA 1XHZA 3CJAA 1RCHA 4FJKA 1N5YA 2ZE2A 3KK3A 2VG5A 4BDPA 3DAWA 2F4VK 4CW7B 3MCAB 1S1WA 4NCGA 4DTXA 4OX9K 4JN4A 4MO4A 3EL2A 2O8FB 3LAKA 3CJCA 1YVNA 2YNIA 3MMVA 4IJNA 1P90A 2HNDA 4B1UB 4XJXA 5M1PA 1FKOA 3ZSOA 2KZMA 3QNNA 4JAXA 5EU7A 4M3ZA 2P9SB 3SI6A 4W5NA 3OS2A 1ATSA 4H5NA 1RBSA 3AVCA 3QDKA 1T6CA 4Q5VA 3DYAA 2B4JA 4DV2K 1RT6A 5M1QA 3OJSA 4FJIA 3OS1A 3NF7A 2QA4N 3L2WA 1K8KA 4M41A 4FLZA 1W9HA 3UE5A 4KRFA 3AO4A 1O1WA 1VSDA 1NOYA 1BUPA 2QWNA 1XNRK 4FWMA 4DLGA 1JLGA 1YJ9N 2IVOA 2ITGA 3FZMA 3TAFA 4DTOA 2YKMA 5AZJA 1HMVA 4EFHA 2G8VA 1NK8A 4GV3A 2OZSA 4YOXA 4L3QA 4DQ8A 4HTUA 1BIZA 4KTQA 1NGCA 1VRTA 4CJ7A 3QO9A 4B3TK 2UXCK 4JHDA 1W0HA 1W97L 3GOIA 3VETA 1KVAA 5C2FA 5DM7L 3TAPA 1HRHA 1BI4A 3AA4A 2FF3B 4BGBA 3ULDA 4YOTA 2XO7A 2OTJN 4CGDA 4DFMA 2HHXA 1WAJA 5SZTA 3Q7CA 3D2FB 3THVA 3THWA 4CZIA 3NHGA 3VEZA 3S41A 2Q0RA 3HM8A 2HW3A 2VYPA 2I7PA 2E2PA 3THYA 2F9TA 1ASVA 1MA9B 3IRXA 4MQ3A 4BQZA 4FJ5A 2UUBK 1ASUA 4E19A 3IMXA 1NGDA 5FLXO 3VQAA 2NRTA 2HHIA 1A5XA 2J4RA 3SMPA 5J2QA 4NCAA 4CGFA 3CERA 4WFAL 4B9SA 4LFAK 4JD2B 2D0AA 4DR4K 2JLEA 4GV6A 4F2RA 3IUCA 3TTDA 2G8UA 2QKBA 2EHGA 3HVRA 1QQCA 3ALYA 4J2BA 3ZLJA 3IKMA 4CIFA 4UQGA 3VEXA 1X1PA 2CH5A 4FW1A 3RR8A 4ID1A 1F21A 5A2QO 4DKWA 1T05A 1W7AA 4BR4A 4FJJA 2P9KA 1VSEA 1XMOK 4BRDA 2VWJA 1U4BA 4CZGA 3CFPA 3VQ8A 3PIPL 1EQYA 3D7EO 3C7NA 5JENA 4M3WA 4O4GA 5AQXA 4CGJA 2YNHA 4ICLA 1JKHA 3CMAN 3ULEB 5BPNA 4XH1A 3CCSN 4KB1A 3DWLA 3KD1E 2IS3A 3VQ9A 2IOCA 3LDPA 3LWLA 4RW8A 1WSIA 4OLAA 2FSNA 2YHYA 3LL3A 1CZ9A 4IEEA 2FSJA 1KLMA 1J5EK 2Q36A 1Q81O 1WLJA 4CJ3A 3C6UA 4DR2K 3ZEUB 5FPNA 1HPZA 4LY7A 3PSFA 5CR4A 5HBMA 1SAZA 4B9NA 4CZEA 3NH1A 1QTMA 2W40A 2Z1GA 1UAXA 2NRWA 3P4IA 5AQNA 4YOUA 1RT3A 1VSFA 1WSHA 1FW6A 1TL1A 4K43A 4DB3A 1Q9XA 1Q18A 1TVRA 4KFBA 1VRUA 4CZLA 3MXIA 4RWTA 4KB0A 3V1OA 4CEFA 4C23A 3T3FA 3DOKA 2O8DA 4WQ5A 3AO1A 1IV0A 3HL8A 5BRFA 4H0OA 3K9JA 3KK7A 1RNHA 3K5OA 4E1JA 3P31A 2X6NA 3GE1A 4O8KA 4M3RA 4H5WA 5F2RA 4Y1CA 4YOVA 1TV6A 4HTLA 4JI3K 4IWVA 3LPTA 3D6RA 4C8MA 5AZJB 4B8AB 1RFQA 1S5JA 3O6WA 4GY2B 5M1OA 3RRHA 1IBKK 1YJNN 1BISA 5KQ8A 1REVA 5AFUA 3KIOA 3LP0A 2G8IA 4CK1A 4JYAK 5DM6L 4F3TA 4DV6K 4ID5A 4DFJA 2CGKA 2QXLA 1JCGA 3RMBA 2QWMA 1EX4A 4WQ4A 2Z1JA 1QS4A 1XQSC 4JKGB 3SMSA 2NLXA 3TU5A 3PIOL 4J8FA 4IFVA 1NGFA 3VEYA 3UKUB 4PL7A 3RSEA 3VA0A 3THWB 2FLOA 1K73O 3CJ9A 3F9KA 3MEEA 5C42A 1BDGA 1HJRA 3TTCA 4FLWA 3LANA 1TKTA 1LV5A 2GWKA 4CESA 3ZT1A 1S1TA 3C94A 3VF6A 5KGXA 1RT1A 3VGKA 4OO1J 4FZZA 4OPJA 1C1BA 3PY8A 1VQON 1L3VA 5FPDA 3MCPA 1H1VA 1NK7A 4ELUA 5AFUH 3L4IA 3KJVA 3VQDA 1NK6A 3OA9A 3K2PA 5CYMA 4AHVA 1T03A 3BZKA 1EKEA 1Y97A 3CF5L 4DFKA 4M42A 1FK9A 2YNGA 3MK6A 3TABA 3OVNA 3CC7N 4I7FA 4DV0K 3UKRA 4KHNA 5HLFA 5JVGL 2UYTA 3CMEN 1ESVA 4LH4A 3CG7A 1BG3A 2V51B 3J8AA 3RTVA 4DV4K 1NGJA 3AA2A 3EO3A 4DSLA 2O8CA 2VWKA 1V4TA 5CZ1A 4CZMA 3O3HA 1K9MO 5E84A 1TUUA 3NVKA 2A40A 2EWSA 1VQ7N 4LF8K 4B8CA 3CI5A 2QTDA 3WUHA 2ITMA 3AO3A 4W5QA 4Z4CA 3AVAA 1IG8A 4E7JA 4BEBA 4UY8O 1U48A 1VSIA 3OW2M 3L4QA 3A0IX 3VESA 1ATNA 4OLBA 3VQ4A 2HBJA 5AQWA 3QERA 1GLCG 4B1WB 4KTZA 2FBTA 4PA1A 2YHBA 4XH4A 3VPZA 1S22A 2A42A 4Z4HA 4CF2A 4FCYA 4FWPA 5SWMA 4H0TB 1LW2A 4DU4A 4DU3A 3I55N 3K58A 4FPAA 3HOTA 3NBPA 3U9DA 4AILC 2E20A 4RTFD 3MAQA 1XC3A 1ZBUA 3I0SA 1LWCA 5ADXH 3U4LA 3L2VA 5AQGA 4F9OA 3BUZB 1ZBSA 3WXLA 1FXXA 4DG1A 4K8ZA 1BWFO 3HXMA 4FLTA 1JLCA 3EZWA 2UU9K 4LSLA 4CIEA 5BPLA 5C12A 4CHYA 4NXMK 5EX5A 4JKCA 3ZETB 5LJVA 2E6LA 1KRPA 2YX6A 1EXQA 3VOVA 2P1JA 4AHCA 1X9MA 3VEOA 1JLBA 3TTFA 5F0XA 4FJXA 4M63C 2KZZA 3CXCM 1QZ6A 3HO1A 3ZYYX 3HZ6A 3QEWA 2YKNA 1XMQK 2P9IB 4CD3A 4JV5K 3LDNA 1UWBA 2G8WA 4X66K 1XWLA 3H3NO 3E9OA 5AQQA 3CQ8A 2Q97A 4HCCA 1X3NA 5KPTA 1G15A 4QCLA 4ELVA 1SKSA 3F5TA 2WOMA 3J7AP 2BANA 5J2MA 4FWKA 1OVQA 1L3TA 4H4MA 3BDPA 2BUPA 4CGIA 4C8KA 2R7YA 3WEEA 2P9NA 1TAQA 4E3SA 5JLFA 4ILHA 2RPIA 3DLKA 2HHQA 3MN6A 3OYBA 4XIUA 3TAMA 1IBLK 4A57A 1E4GT 2P9PA 3DLRA 1KCFA 4WFBL 4ELTA 2GTDA 1EWQA 3VN5A 1WSGA 4X64K 1VSKA 4BR9A 4IJAA 4CZKA 3O80A 1GOAA 4RCHA 4DHYA 4FLUA 3K9KA 4HHTA 1BL3A 1JCFA 1VQ6N 5C0YA 4IOXA 3CM6A 5EVZA 4FWLA 3QICA 1VQNN 3OYNA 3E9LA 1ILYA 3VERA 4BRPA 1JLFA 4CF0A 3GBTA 3TPQA 3PV8A 4QOZB 1CXQA 5H1SQ 1BCMA 4FM1A 2NRRA 2P51A 5FROA 3A5MC 4Z4EA 2DFFA 5E26A 4DV5K 4F4KA 5AQMA 4CJKA 4CF8A 4WF9L 2CGLA 3UKRB 1OVYA 4MO5A 1GLBG 1SKWA 2YHWA 1JLAA 2GEMA 1SQKA 3ZT2A 4FWNA 4GKKK 3MX2A 1CXUA 2E1YA 3NH0A 4BWJA 2Q31A 2KFZA 1EO1A 3OTOK 4E7KA 2VG6A 2A1RA 4HVJA 5T7BA 5AQSA 4EIAA 4OPKA 2AP1A 3SBTA 1WUAA 4IKFA 3CPWM 4B08A 3AAQA 4DSEA 2ZWHA 3NAEA 4U67L 3SUQA 3LP2A 2P9SA 4FPBA 4KV8A 5GIPA 3W0LA 4JRQA 2KHOA 3LALA 4OJRA 3OYCA 5AJ3K 1XI1A 2XHBA 4FJ9A 3S3NA 1RDUA 1D4XA 1BQNA 4ISFA 3KLEA 3AARA 1TKXA 3HP6A 4A59A 1VHXA 5C24A 1LWFA 3SCXA 1HX1A 2ASMA 4BE1A 1HYSA 3VGLA 5CY4A 4H5VA 3L3UA 1N33K 1NJYA 3OYJA 4FLVA 3ZSQA 1Q82O 3KZBA 4JK7A 4IO9L 3S9HA 4MLEA 4Q0BA 1D9DA 3O4QA 1WB9A 3T19A 3B6PA 1UOCA 5TKWA 3BEXA 1OH8A 2DFHA 3PX6A 1MWKA 3SPYA 4B3RK 1DT9A 3CYGA 1RDWX 2O4GA 4H0PA 2HHHK 2O4IA 3AVIA 4JI1K 3I56N 2IVNA 3BGRA 4CFDA 5CE3A 3KVGA 1YAGA 1ITGA 4QS8A 2GBZA 2VCPA 3TANA 4CI6A 2GUIA 4BECA 5J2NA 3UB5A 1RDAA 3KLGA 4BRNA 5HRRA 3RRGA 4CCHA 4BVOA 3D0PA 4JK8A 5CHIA 4BRLA 2P9IA 3W3DA 3K0SA 3AGKA 3RR7A 3AVKA 3SUNA 4DR7K 3ZSXA 1WN7A 5TKYA 4AHTA 2P5OA 1HLUA 3VGMA 3V9WA 5LY3A 4JKEA 4CJQA 3SV3A 4C8NA 2G8KA 3G10A 3OYLA 5AQZA 4I6MB 1RTHA 3FLCO 4E89A 2IIRA 1T8EA 4K41A 1YIJN 1NGHA 4C1NK 3AV9A 2FSKA 1WSFA 4CHNA 4GNIA 4YY3K 4WFNL 4FM2A 4NO7A 2ZGYA 1RDBA 3SUOA 3J7ZO 1RBUA 4EP5A 3QMLA 2AA4A 4FXDA 5M1NA 1X3MA 3SAHA 1RT4A 4Z4IA 3PO5A 1TUYA 3SQ1A 1Z05A 3OYIA 3QIPA 1YHQN 4KHYA 1W2BM 1S6PA 3HI0A 1JL1A 3V1QA 1Q7YO 3KKSA 5JICA 3CCLN 4OPAA 2D1KA 1DTQA 4IG0A 3M8PA 4ISGA 3LAMA 3G0ZA 1SL0A 1C0MA 4DR5K 3HJFA 5D3GA 4B1XB 4FJMA 1T6DA 1YF5L 3N4PA 4AF1A 1TGOA 2Z1IA 3G4SN 3GG4A 4G9ZA 4YFUA 3O9QA 3F2KA 1HQEA 1YTAA 2W41A 3AA5X 1S1VA 5BN9A 2QWLA 4F2SA 3HT3A 4HWIA 3NGYA 3SK3A 5BRDA 2QWRA 4ZTFA 1IKYA 3DI6A 3HM9A 3SNNA 4OGEA 4NLCA 3K5MA 4CJEA 4U7BA 3G71N 4JD2A 1RBVA 5GAEP 3SAFA 2ZJPL 2PAVA 4CHQA 1KC8O 3OYEA 3ZCMA
chains in the Genus database with same CATH topology
4BGAA 4CBUA 4FSVA 2E2OA 4J8FA 5F1XA 5FPMA 1NGFA 2E2NA 3VEYA 5M1FA 3AAPA 3UKUB 4PL7A 3RSEA 4WCEL 3FZHA 4EAHD 2QEXN 2FLOA 2QWOA 1K73O 3CJ9A 1Z6RA 5C10A 5MLCQ 1BDGA 1KXPA 4A62A 1YJWN 3CCEN 3TTCA 3P38A 1BA0A 3C6AA 3A5OC 3G25A 3R8EA 2GWKA 4FOIA 3VEWA 3CCQN 3VF6A 5AQVA 1C0GA 3VGKA 1GLLO 3G6EN 2WC9A 3E1YA 4OO1J 4JKBA 2RE2A 3OBYA 2GWJA 2P9KB 3HOSA 1VQON 3R6MA 4BG9A 5FPDA 4CZFA 3MCPA 4IEIA 3CJ7A 4PKIA 1NMDA 2ZF5O 1H1VA 3QB0A 2OTLN 2KKZA 3CJBA 2P9NB 1X9JA 3L4IA 5AFUH 1OKJA 3R9PA 3OA9A 3VTIA 1DKGD 3M6GA 3HTVA 4QS9A 4KH6A 1CZAN 5AQOA 5AQJA 3ID6A 4B9QA 5KQDA 3CF5L 3O9UA 1HJOA 3MK6A 4EHTA 3CC7N 3UKRA 1QVFM 4B1YB 3FR0A 3HBTA 3IDHA 3I8BA 5JVGL 2UYTA 1RGIA 2PBDA 1ESVA 2A6AA 3CMEN 1BG3A 3VTHA 2V51B 1YITN 1ZC6A 3MWPA 3J8AA 3H45C 5AQRA 1VQ8N 4FOEA 2HBLA 1NGJA 3EO3A 3WXIA 1K8AO 1HUXA 2Q1NA 4BC5A 1S3XA 1QZ5A 2GUPA 1K8KB 1QQMA 2NRZA 1V4TA 3SJHA 3ZETA 4CZMA 3ATUA 3CHWA 4BR7A 4A5AA 1K9MO 5E84A 1TUUA 2FXUA 4FWSA 4CBXA 1BO5O 1NWKA 2A40A 2EWSA 3CCMN 1YUWA 3CI5A 2QTDA 2BTFA 2P9LA 3SAGA 1GLFO 2ITMA 3WUHA 3MDQA 2D4WA 4FWQA 1QHAA 1IG8A 2HSTA 5AR0A 3EE8A 2DPNA 4UY8O 5BREA 4BEBA 3ZX2A 4BRQA 2E1ZA 3R3LA 3VENA 5GAHP 3OW2M 1NJIO 3L4QA 3A0IX 3ID8A 3A8YA 1GLDG 1LCUA 3VESA 1ATNA 4NB4A 4B1VA 4YDUC 1BA1A 2HOEA 1NM1A 2HBJA 5AQWA 1GLCG 4B1WB 5ADXA 5C15A 1O13A 3TSPA 2YHXA 5BR9A 4XH4A 3VPZA 1S22A 2A42A 3ENBA 3C65A 1KQSM 1VQ9N 3FZLA 4FWPA 4H0TB 3PLAA 2CH6A 3FGUA 3I55N 3VF2A 4FPAA 4BY9C 3HOTA 2V52B 4JKDA 2HBKA 2ZGZA 1U2VB 3U9DA 4B1ZA 4WQ4C 1G99A 1GLJO 3KHYA 3RVCA 3NVKA 5GADP 5GINA 3QFPA 2E20A 3FFKB 4RTFD 5B8HA 2VWBA 1XC3A 2ZJQL 1YI2N 2P9UA 4XH5A 3U9ZA 1KAXA 3NVMA 3U4LA 3WT0A 5ADXH 3CCVN 3CQXA 5EOYA 5AQGA 3WQUA 4F9OA 3BUZB 1SS6A 1ZBSA 2E2QA 2E88A 3L6QA 4Z94A 3WXLA 2V7YA 4GV9A 4BE7B 4BREA 1BWFO 3BF1A 4ILGB 4O8UA 2YI1A 2QW9A 3EZWA 4H0YB 3CC2N 4A5BA 2W00A 2FF6A 1WOQA 2NZTA 4BRAA 3F9MA 5C12A 5BPLA 4NLBA 4JKCA 4LC9B 5EX5A 2Q2RA 3ZETB 5LJVA 4JKGA 4BRFA 2YX6A 3SLCA 1DGKN 3CD6N 2NNWA 3VOVA 3CPEA 1Y64A 3VEOA 4FWOA 3TTFA 5F0XA 3CCRN 3QBXA 4M63C 2P9LB 5BN8A 2YJEA 4ILJA 3AY9A 3CXCM 1IJJA 1QZ6A 4WQ5C 3O8MA 4GVEA 3ZYYX 4BRHA 5GIOA 2F7TA 5HOOA 1KAZA 3HZ6A 3TSQA 5AQLA 4BRMA 2P9IB 4CD3A 2YCHA 3DJCA 2P9PB 3CJAA 3LDNA 4BRGA 1V4SA 3CETA 2D0OA 3FZKA 3H3NO 3E9OA 4JHDB 5AQQA 4BC2A 2Q97A 1X3NA 5KPTA 1Q86O 4JEPA 4CZJA 3DAWA 3WXMB 3MCAB 3F5TA 3VMFB 4BR2A 4JNEA 2RHKA 4JN4A 4MO4A 3EL2A 4FWKA 3CJCA 1NGBA 1YVNA 3ATVA 1GLAG 1QQNA 3T7ZA 2BUPA 4PKGA 3MMVA 4IJNA 1P90A 3WEEA 2P9NA 4B1UB 2NRHA 5JLFA 4ILHA 4FO0A 5M1PA 3WXKA 4XJXA 4H0VB 3R1XA 3AGRA 4BVPA 2C1GA 3MN6A 4JAXA 1MDUB 2P9SB 4JKHA 1HPMA 5FPEA 1ATSA 2ASPA 4H5NA 1BU6O 3QDKA 1T6CA 3ULEA 4A57A 4IOCL 1E4GT 2P9PA 5JMVA 4WFBL 3KWGA 2A5XA 2GTDA 4BG8A 1GLEG 5M1QA 4YOYA 4H03B 4A2BA 3GDQA 4BC3A 4BR9A 4IJAA 3B8AX 4CZKA 4JKAA 3O80A 4KBOA 4RCHA 4DHYA 3DXKB 3K9KA 1T3VA 5I9EB 2QA4N 1KD1O 1K8KA 4BR5A 3TSUA 1JCFA 1VQ6N 2BH1A 3UE5A 2QM1A 4O5FA 5C0YA 4IOXA 5ELZA 2E8AA 5EVZA 2CGJA 3OHRA 5JLHA 4FWLA 3QICA 5AQUA 1DEJA 1VQNN 3CIPA 1BUPA 2QWNA 3FE1A 3E9LA 2QI2A 5GAGP 4H5RA 1JJ2M 1ILYA 3VERA 3WXJA 4FWMA 3A5NC 4BRPA 1YJ9N 2VGMA 3GBTA 2IVOA 3TPQA 5H1SQ 5KPZA 2KLAA 3FZMA 4BRCA 2Q0UA 3D2FA 2NRRA 2VGNA 1VQPN 3MN7A 5AZJA 4EFHA 3E9PA 3A5MC 4GV3A 2D0PA 5E26A 4YOXA 4L3QA 1XUPO 3E66A 4DQ8A 2WUSA 5AQMA 3SBGA 4PHTX 1NGCA 4WF9L 2CGLA 3LM2A 3UKRB 1OVYA 3LDLA 4MO5A 4BRKA 4CJ7A 1GLBG 1NGAA 3CJ1A 3D2EA 3M5RA 4JHDA 1W97L 2YHWA 3GOIA 3CCJN 3VETA 5C2FA 2GEMA 1SQKA 3FZFA 1R59O 5AZIB 1TYQB 2QWPA 4YORA 5DM7L 3A5LC 4FWNA 3MX2A 3BF3A 3O4WA 2E1YA 2Q31A 1EO1A 2GELA 2JWLA 4A61A 2FF3B 2H3GX 3JS6A 3MN5A 3C7NB 4BGBA 4YOTA 2WFBA 2ZJRL 5AQSA 3ZX3A 4EIAA 3WEEB 3H3OB 2OTJN 2AP1A 3Q7BA 1WUAA 3SBTA 3Q7CA 3D2FB 3CPWM 3AAQA 2ZWHA 4CZIA 4U67L 3VEZA 2Q0RA 3LM9A 3HM8A 5AQIA 3S41A 2P9SA 3C6HA 4IDHA 2VYPA 4FPBA 4YOWA 2I7PA 5GIPA 4MDAA 3W0LA 2KHOA 2HMPA 2YJFA 5KPRA 2E2PA 4BC4A 2F9TA 3O9SA 3HRGA 4FVUA 1RDUA 3VF4A 1MA9B 1D4XA 4ISFA 4BQZA 3KWIA 3AARA 4ISEA 1LOTB 2I7NA 4A59A 4M7YA 3IMXA 1NGDA 4IZ9A 1HX1A 3M3ZA 2NRTA 2ASMA 2J4RA 3SMPA 4DCHA 4IOAL 3H1VX 3EKUA 3CERA 3EE9A 3MWTA 3O08A 3VGLA 4H5VA 3L0QA 4WFAL 4YDUA 4JD2B 3QBWA 4H0XB 5JVHL 4MDBA 2NRVA 4FWRA 4GV6A 1Q82O 3KZBA 3IUCA 3TTDA 4JK7A 4IO9L 3UKUA 3LDOA 4MLEA 2P9UB 1T44A 3OBWA 5TKWA 3BEXA 1HKBA 2GX9A 1MWKA 3IKMA 1DT9A 4AM7A 3VEXA 2CH5A 4QS7A 1QQOA 1BOTO 1RDWX 4H0PA 4M7XA 4DKWA 4A2AA 3I56N 4C1NI 3CCUN 3JXUA 1HKGA 4BR4A 2IVNA 2P9KA 1MWMA 1J6ZA 3ZEUA 2WBNA 3H46O 2F9WA 4BRDA 5CE3A 3KVGA 1YAGA 4CZGA 1ATRA 1E4FT 4QS8A 3PIPL 2VCPA 1EQYA 4BRIA 4I6MA 5AQTA 2NRXA 3CQYA 3D7EO 4IXCA 3C7NA 4Y0WA 5AQYA 4CI6A 3QFUA 3ENHA 3LDQA 1VQKN 5AQXA 4BECA 3MX5A 4OPHA 3UB5A 1P8ZA 3P39A 4BRNA 3CMAN 1M90O 5EY4A 3ULEB 5BPNA 4XH1A 4BVOA 3I33A 3CCSN 5C2DA 4JK8A 4CBWA 5CHIA 1M1KO 1VQ4N 3DWLA 3ZX0A 5EXWA 4BRLA 2P9IA 3EKSA 3LDPA 3AGKA 3W3DA 2HBMA 2FSNA 4IFEA 2YHYA 3LL3A 4IEEA 1NBWA 2FSJA 1VQMN 2Q36A 1Q81O 5TKYA 3U8XA 4KH4A 2PFUA 1HLUA 1VAZA 3VGMA 3ZEUB 5FPNA 5LY3A 4JKEA 3DXMB 5CR4A 5AQZA 4I6MB 1SAZA 3FLCO 4PL8A 3WQTA 3M1FA 2IIRA 4K41A 4CZEA 1YIJN 4JK9A 2W40A 4MLHA 1NGHA 4BQLA 4C1NK 2NRWA 3P4IA 2FSKA 3N4QA 3O9TA 4FL9A 4GNIA 5AQNA 3RSEB 4YOUA 3CC4N 4WFNL 4NO7A 3C0BA 1NLVA 2HF3A 2ZGYA 3GL1A 3O1WA 3O9RA 1KAYA 4K43A 3O5BA 4DB3A 1Q18A 3J7ZO 1S72N 1QVGM 4CD1A 3QMLA 4H5TA 4CZLA 2AA4A 5AQHA 5M1NA 1X3MA 5HL7L 5AQFA 3SAHA 1TUYA 3H6EA 4RWTA 1NGEA 5AZIA 1Z05A 1NGGA 5BRHA 5M1KA 4C23A 1VQ7N 5BPMA 5LJWA 1YHQN 3DXKA 1W2BM 3HI0A 3BP8A 4WQ5A 1Q7YO 3O1BA 5AQPA 4AM6A 2A41A 3T69A 5AQKA 5JICA 5BRFA 4OPAA 1U6ZA 2D1KA 4JKFA 3CCLN 4H0OA 3K9JA 3KK7A 4BR0A 3ENOA 4ISGA 4E1JA 1U2VA 3P31A 3GE1A 3HSCA 4O8KA 4H5WA 4IO8A 4B1XB 1YXQA 1T6DA 1YF5L 3N4PA 5F2RA 4YOVA 1HKCA 2IVPA 4HTLA 4XEIA 4AF1A 1NGIA 4IWVA 3G4SN 4K42A 3MN9A 3GG4A 4R79A 4G9ZA 3D6RA 3O9QA 3H1QA 3F2KA 4KH5A 5AZJB 2JWKA 1VQLN 1RFQA 3O6WA 4GY2B 2W41A 4WYBA 3NMUA 5BN9A 5M1OA 1JCEA 2QWLA 1YJNN 5KQ8A 4EHUA 2V7ZA 1C0FA 4HWIA 5AFUA 3SK3A 5BRDA 2QWRA 3VEVA 5DM6L 3PIOL 1VQ5N 3D2EB 4CZHA 2CGKA 4PKHA 3DLLL 2QXLA 1N8RO 4NLCA 1TYQA 1SZ2A 2HF4A 3IFRA 2OANA 4U7BA 1JCGA 3G71N 2ASOA 1ZXOA 2QWQA 4JD2A 4K25A 3DXMA 2QWMA 4WQ4A 2A3ZA 5GAEP 1XQSC 4JKGB 3SAFA 3SMSA 2NLXA 3TU5A 4BROA 2PAVA 2ZJPL 1KC8O 3EN9A 2C1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BGA A;  4CBU A;  4FSV A;  2E2O A;  4J8F A;  5F1X A;  5FPM A;  1NGF A;  2E2N A;  3VEY A;  3AAP A;  3UKU B;  4PL7 A;  3RSE A;  3FZH A;  4EAH D;  2FLO A;  2QWO A;  3CJ9 A;  1Z6R A;  1BDG A;  1KXP A;  4A62 A;  1BA0 A;  3A5O C;  3G25 A;  3R8E A;  2GWK A;  4FOI A;  3VEW A;  3VF6 A;  5AQV A;  1C0G A;  3VGK A;  1GLL O;  2GWJ A;  2P9K B;  3R6M A;  4BG9 A;  5FPD A;  4CZF A;  3MCP A;  3CJ7 A;  4PKI A;  1NMD A;  2ZF5 O;  1H1V A;  3QB0 A;  3CJB A;  2P9N B;  1X9J A;  3L4I A;  5AFU H;  1OKJ A;  3R9P A;  1DKG D;  3M6G A;  3HTV A;  4QS9 A;  1CZA N;  5AQO A;  5AQJ A;  4B9Q A;  5KQD A;  1HJO A;  3MK6 A;  4EHT A;  3UKR A;  4B1Y B;  3FR0 A;  3HBT A;  3IDH A;  3I8B A;  1RGI A;  2PBD A;  2A6A A;  1ESV A;  2UYT A;  1BG3 A;  2V51 B;  1ZC6 A;  3J8A A;  3H45 C;  5AQR A;  4FOE A;  1NGJ A;  3EO3 A;  3WXI A;  1HUX A;  2Q1N A;  4BC5 A;  1S3X A;  1QZ5 A;  2GUP A;  1K8K B;  1QQM A;  1V4T A;  3SJH A;  3ZET A;  4CZM A;  3ATU A;  3CHW A;  4BR7 A;  5E84 A;  1TUU A;  2FXU A;  4FWS A;  4CBX A;  1BO5 O;  1NWK A;  2A40 A;  2EWS A;  1YUW A;  3CI5 A;  2BTF A;  2P9L A;  1GLF O;  2ITM A;  3WUH A;  3MDQ A;  2D4W A;  4FWQ A;  1QHA A;  1IG8 A;  5AR0 A;  2DPN A;  5BRE A;  3ZX2 A;  4BRQ A;  2E1Z A;  3VEN A;  3A0I X;  3ID8 A;  3A8Y A;  1GLD G;  1LCU A;  3VES A;  1ATN A;  4NB4 A;  4B1V A;  4YDU C;  1BA1 A;  2HOE A;  1NM1 A;  5AQW A;  1GLC G;  4B1W B;  5ADX A;  2YHX A;  5BR9 A;  4XH4 A;  3VPZ A;  1S22 A;  2A42 A;  3FZL A;  4FWP A;  4H0T B;  2CH6 A;  3FGU A;  3VF2 A;  4FPA A;  2V52 B;  2ZGZ A;  1U2V B;  3U9D A;  4B1Z A;  4WQ4 C;  1G99 A;  1GLJ O;  3KHY A;  3QFP A;  2E20 A;  3FFK B;  4RTF D;  5B8H A;  2VWB A;  1XC3 A;  2P9U A;  4XH5 A;  3U9Z A;  1KAX A;  3U4L A;  3WT0 A;  5ADX H;  3CQX A;  5EOY A;  5AQG A;  3WQU A;  4F9O A;  3BUZ B;  1ZBS A;  2E2Q A;  2E88 A;  3L6Q A;  4Z94 A;  3WXL A;  2V7Y A;  4BRE A;  1BWF O;  3BF1 A;  2YI1 A;  2QW9 A;  3EZW A;  4H0Y B;  2FF6 A;  1WOQ A;  2NZT A;  4BRA A;  3F9M A;  5BPL A;  5EX5 A;  4LC9 B;  3ZET B;  5LJV A;  2Q2R A;  4BRF A;  3SLC A;  1DGK N;  3VOV A;  1Y64 A;  3VEO A;  4FWO A;  5F0X A;  3QBX A;  4M63 C;  2P9L B;  5BN8 A;  2YJE A;  3AY9 A;  1IJJ A;  1QZ6 A;  4WQ5 C;  3O8M A;  4BRH A;  1KAZ A;  3HZ6 A;  5AQL A;  4BRM A;  2P9I B;  4CD3 A;  2YCH A;  3DJC A;  2P9P B;  3CJA A;  3LDN A;  4BRG A;  1V4S A;  3CET A;  2D0O A;  3FZK A;  3H3N O;  4JHD B;  4BC2 A;  5AQQ A;  2Q97 A;  1X3N A;  5KPT A;  4CZJ A;  3DAW A;  4BR2 A;  4JNE A;  4JN4 A;  4MO4 A;  3EL2 A;  4FWK A;  3CJC A;  1NGB A;  1YVN A;  3ATV A;  1GLA G;  1QQN A;  2BUP A;  4PKG A;  3MMV A;  4IJN A;  3WEE A;  2P9N A;  4B1U B;  2NRH A;  5JLF A;  3WXK A;  4FO0 A;  4H0V B;  4BVP A;  3MN6 A;  4JAX A;  1MDU B;  2P9S B;  1HPM A;  5FPE A;  1ATS A;  2ASP A;  4H5N A;  1BU6 O;  3QDK A;  1T6C A;  3ULE A;  1E4G T;  2P9P A;  5JMV A;  2A5X A;  2GTD A;  4BG8 A;  1GLE G;  4H03 B;  4A2B A;  3GDQ A;  4BC3 A;  4BR9 A;  4IJA A;  3B8A X;  4CZK A;  3O80 A;  4KBO A;  4RCH A;  4DHY A;  3DXK B;  5I9E B;  1K8K A;  4BR5 A;  1JCF A;  3UE5 A;  2QM1 A;  4O5F A;  5ELZ A;  2E8A A;  5EVZ A;  2CGJ A;  3OHR A;  5JLH A;  4FWL A;  3QIC A;  5AQU A;  1DEJ A;  3CIP A;  1BUP A;  2QWN A;  3FE1 A;  4H5R A;  3VER A;  3WXJ A;  4FWM A;  3A5N C;  4BRP A;  3GBT A;  2IVO A;  3TPQ A;  5KPZ A;  3FZM A;  4BRC A;  2Q0U A;  3D2F A;  3MN7 A;  5AZJ A;  4EFH A;  3A5M C;  2D0P A;  5E26 A;  4L3Q A;  1XUP O;  4DQ8 A;  2WUS A;  5AQM A;  1NGC A;  2CGL A;  3LM2 A;  3UKR B;  3LDL A;  4MO5 A;  4BRK A;  4CJ7 A;  1GLB G;  1NGA A;  3CJ1 A;  3D2E A;  4JHD A;  2YHW A;  3GOI A;  3VET A;  2GEM A;  1SQK A;  3FZF A;  1R59 O;  5AZI B;  1TYQ B;  2QWP A;  3A5L C;  4FWN A;  3BF3 A;  3O4W A;  2E1Y A;  2Q31 A;  2GEL A;  4A61 A;  2FF3 B;  2H3G X;  3JS6 A;  3MN5 A;  3C7N B;  4BGB A;  5AQS A;  3ZX3 A;  4EIA A;  3WEE B;  3H3O B;  2AP1 A;  1WUA A;  3D2F B;  3AAQ A;  2ZWH A;  4CZI A;  3VEZ A;  2Q0R A;  3LM9 A;  3HM8 A;  5AQI A;  3S41 A;  2P9S A;  2VYP A;  4FPB A;  2I7P A;  3W0L A;  2KHO A;  2HMP A;  2YJF A;  5KPR A;  2E2P A;  4BC4 A;  2F9T A;  3VF4 A;  1MA9 B;  1D4X A;  4ISF A;  4BQZ A;  3AAR A;  4ISE A;  1LOT B;  2I7N A;  4M7Y A;  3IMX A;  1NGD A;  4IZ9 A;  1HX1 A;  3M3Z A;  2ASM A;  2J4R A;  3SMP A;  4DCH A;  3H1V X;  3EKU A;  3CER A;  3VGL A;  3O08 A;  4H5V A;  3L0Q A;  4YDU A;  4JD2 B;  3QBW A;  4H0X B;  4FWR A;  3KZB A;  3IUC A;  3UKU A;  3LDO A;  4MLE A;  2P9U B;  1T44 A;  3BEX A;  1HKB A;  1MWK A;  4AM7 A;  3VEX A;  2CH5 A;  4QS7 A;  1QQO A;  1BOT O;  1RDW X;  4H0P A;  4M7X A;  4A2A A;  3JXU A;  1HKG A;  4BR4 A;  2IVN A;  2P9K A;  1MWM A;  1J6Z A;  3ZEU A;  3H46 O;  2F9W A;  4BRD A;  5CE3 A;  3KVG A;  1YAG A;  4CZG A;  1ATR A;  1E4F T;  4QS8 A;  2VCP A;  1EQY A;  4BRI A;  4I6M A;  5AQT A;  3D7E O;  3CQY A;  4IXC A;  4Y0W A;  3C7N A;  5AQY A;  4CI6 A;  3QFU A;  3ENH A;  3LDQ A;  5AQX A;  3UB5 A;  1P8Z A;  4BRN A;  5EY4 A;  3ULE B;  5BPN A;  4XH1 A;  4BVO A;  3I33 A;  4CBW A;  3DWL A;  3ZX0 A;  5EXW A;  4BRL A;  2P9I A;  3EKS A;  3LDP A;  3W3D A;  2FSN A;  2YHY A;  3LL3 A;  1NBW A;  2FSJ A;  2Q36 A;  5TKY A;  3U8X A;  3ZEU B;  1HLU A;  3VGM A;  5FPN A;  5LY3 A;  3DXM B;  5AQZ A;  4I6M B;  1SAZ A;  3FLC O;  4PL8 A;  3WQT A;  3M1F A;  2IIR A;  4K41 A;  4CZE A;  2W40 A;  4MLH A;  1NGH A;  4BQL A;  3P4I A;  2FSK A;  4FL9 A;  5AQN A;  4GNI A;  3RSE B;  4NO7 A;  3C0B A;  1NLV A;  2HF3 A;  2ZGY A;  3GL1 A;  3O1W A;  4K43 A;  1KAY A;  4DB3 A;  3O5B A;  1Q18 A;  4CD1 A;  3QML A;  4H5T A;  4CZL A;  2AA4 A;  5AQH A;  1X3M A;  5AQF A;  1TUY A;  3H6E A;  4RWT A;  1NGE A;  5AZI A;  1Z05 A;  1NGG A;  5BRH A;  4C23 A;  5BPM A;  5LJW A;  3DXK A;  3HI0 A;  3BP8 A;  4WQ5 A;  3O1B A;  5AQP A;  4AM6 A;  2A41 A;  5AQK A;  5JIC A;  5BRF A;  1U6Z A;  2D1K A;  4H0O A;  4BR0 A;  3ENO A;  4ISG A;  4E1J A;  1U2V A;  3GE1 A;  3HSC A;  4O8K A;  4H5W A;  4IO8 A;  4B1X B;  1YXQ A;  1T6D A;  5F2R A;  1HKC A;  2IVP A;  4HTL A;  4XEI A;  1NGI A;  4IWV A;  4K42 A;  3MN9 A;  3GG4 A;  5AZJ B;  3H1Q A;  1RFQ A;  3O6W A;  4GY2 B;  2W41 A;  4WYB A;  5BN9 A;  1JCE A;  2QWL A;  5KQ8 A;  4EHU A;  2V7Z A;  1C0F A;  4HWI A;  5AFU A;  3SK3 A;  5BRD A;  2QWR A;  3VEV A;  3D2E B;  4CZH A;  2CGK A;  4PKH A;  2QXL A;  1TYQ A;  1SZ2 A;  3IFR A;  2HF4 A;  2OAN A;  1JCG A;  2ASO A;  1ZXO A;  2QWQ A;  4JD2 A;  4K25 A;  2QWM A;  3DXM A;  4WQ4 A;  2A3Z A;  1XQS C;  3SMS A;  2NLX A;  3TU5 A;  4BRO A;  2PAV A;  3EN9 A; 
#chains in the Genus database with same CATH topology
 4BGA A;  4CBU A;  5BR8 K;  3OYF A;  5F1X A;  5HRP A;  3AAP A;  3VQ7 A;  4WCE L;  2QEX N;  1JLE A;  1YJW N;  3CCE N;  4DWI A;  1NG9 A;  3C6A A;  3A5O C;  4DSJ A;  1JL2 A;  4FOI A;  2O8B B;  4AQY K;  4IBN A;  3CCQ N;  3OS0 A;  3AVN A;  5AQV A;  1C0G A;  1IKW A;  3M8R A;  2WC9 A;  4OGC A;  3OBY A;  2P9K B;  4CZF A;  2PY5 A;  3VQB A;  3CJ7 A;  3D45 A;  1NMD A;  1HQU A;  4CF9 A;  3CJB A;  3TWH A;  1YTU A;  1OKJ A;  3VTI A;  4CGG A;  4KH6 A;  5AQJ A;  3ID6 A;  4B9Q A;  3HST B;  1HJO A;  3MXJ A;  4EHT A;  3NF6 A;  1U45 A;  1QVF M;  3FR0 A;  3IDH A;  2A6A A;  3VTH A;  3QNO A;  2EX3 A;  3MWP A;  1VQ8 N;  1RTD A;  3J7Y P;  4DR1 K;  3HK2 A;  4BC5 A;  2OZM A;  1LAW A;  2NRZ A;  2VQE K;  1X9W A;  3NDK A;  1E3M A;  4DUZ K;  3LWM A;  2FXU A;  4FWS A;  4CBX A;  1NWK A;  3CCM N;  2BTF A;  3T1A A;  1GLF O;  3MDQ A;  2OPR A;  2D4W A;  3QIN A;  1TK0 A;  3EE8 A;  1X9S A;  5BRE A;  4CJF A;  3VEN A;  1NJI O;  1ASW A;  3AO5 A;  1C1A A;  3A8Y A;  3M8S A;  4MFB A;  4B1V A;  2HOE A;  3QEX A;  1Z26 A;  3CM5 A;  3KTQ A;  5C15 A;  4E7L A;  3TSP A;  2YHX A;  1KQS M;  2ZQB A;  3FZL A;  1I39 A;  3DLG A;  4KHW A;  3MEG A;  4Y1D A;  3T1Y K;  2BE2 A;  4CHP A;  1L5U A;  1VSJ A;  2ZGZ A;  4B1Z A;  1TL3 A;  4CEC A;  3OYG A;  4FZY A;  2KTQ A;  5GIN A;  4KI6 A;  3LZJ A;  4BE0 A;  3I8D A;  1YI2 N;  2P9U A;  4XH5 A;  3U9Z A;  1KAX A;  3CQX A;  3HPO A;  1BCO A;  4FM0 A;  3O3G A;  3L6Q A;  1HNI A;  4BE7 B;  3S3O A;  2WTU A;  3DOL A;  2QKK A;  4ILG B;  4CE9 A;  4NCB A;  4H0Y B;  5HP1 A;  4IFY A;  4A5B A;  4DTS A;  3PSI A;  1WOQ A;  2NZT A;  4BRA A;  2XY6 A;  4JI7 K;  2BDP A;  1FKP A;  2QK9 A;  3OY9 A;  1Z25 A;  4JKG A;  1RDD A;  3SLC A;  1Y64 A;  4H4O A;  3SQ0 A;  4JI5 K;  4FK4 A;  3QBX A;  1S1U A;  3VQ5 A;  1IJJ A;  1L3S A;  4GVE A;  4BRH A;  1SKR A;  5HOO A;  1KAZ A;  5AQL A;  3PO4 A;  3DJC A;  4CEE A;  4DQS A;  3FZK A;  4BC2 A;  4J2D A;  4N47 A;  1Q86 O;  4F3O A;  4N5S A;  4I9L A;  4O55 A;  3WXM B;  3DLB A;  3VMF B;  3L8B A;  3AVL A;  4FK2 A;  4JNE A;  4FLX A;  1ZYQ A;  1NGB A;  2KQ2 A;  1GLA G;  3T7Z A;  4PKG A;  3HYF A;  1LAV A;  1OH6 A;  4FO0 A;  4DSF A;  4CEO A;  4AHS A;  3V9X A;  4Z4F A;  4HUF A;  3KD5 E;  2C1G A;  1TKZ A;  1MDU B;  4JKH A;  4BWM A;  1HPM A;  4M3X A;  1BU6 O;  4PQU A;  3AVB A;  1KFD A;  2A5X A;  4BG8 A;  4CVN E;  1GLE G;  3S5T A;  4B9T A;  3GDQ A;  2O8B A;  1BGX T;  3B8A X;  4KBO A;  4C8L A;  1SUQ A;  1SL1 A;  1KD1 O;  2O8C B;  3TSU A;  4CJS A;  1WNS A;  2QM1 A;  4O5F A;  1GOC A;  4DTN A;  5ELZ A;  2CGJ A;  3OHR A;  5JLH A;  1SL2 A;  4M3Y A;  5AQU A;  1DEJ A;  3FFI A;  5C25 A;  3FE1 A;  2QI2 A;  5GAG P;  4X62 K;  2Y1J A;  1JJ2 M;  1DLO A;  1XHX A;  3WXJ A;  3WNG A;  1VSM A;  2VGM A;  4CJ5 A;  3P5J A;  5KPZ A;  2KLA A;  4BRC A;  2Q0U A;  3D2F A;  2VGN A;  3SYZ A;  3MN7 A;  3E9P A;  4E7I A;  3OYA A;  4OKE A;  3DLE A;  2D0P A;  3QES A;  3E66 A;  4DU1 A;  2WUS A;  4PHT X;  3SBG A;  3LM2 A;  4DF4 A;  4BRK A;  3THY B;  1HR0 K;  3M5R A;  4CFB A;  2E6M A;  3B6O A;  5AZI B;  1R59 O;  1TYQ B;  2QWP A;  4YOR A;  3ZT4 A;  2RKI A;  3BF3 A;  4FJ7 A;  3O4W A;  4O5B A;  2GEL A;  3ASM A;  4A61 A;  4OKJ A;  2H3G X;  3MN5 A;  2WFB A;  3WEE B;  2FBX A;  3H3O B;  4GVM A;  3TAQ A;  2HHT A;  1KVC A;  1C0U A;  4AH9 A;  3IAY A;  4YNQ A;  4DS4 A;  4K0K K;  2B6A A;  3LM9 A;  3MED A;  1QE1 A;  3C6H A;  4IDH A;  3T1H K;  4YOW A;  1D8Y A;  1IO2 A;  4MDA A;  1QSY A;  5KPR A;  3O9S A;  3HRG A;  4FVU A;  4E72 A;  3VF4 A;  5HRO A;  3ZSV A;  4BDZ A;  4ISE A;  4CJW A;  3SZ2 A;  2I7N A;  3KLI A;  4M7Y A;  2P5G A;  4LFC K;  5KRS A;  3E01 A;  4DCH A;  3V4I A;  4IOA L;  4EP4 A;  3H1V X;  3EE9 A;  3O08 A;  3SQ4 A;  1N34 K;  2DTU A;  3AVF A;  4YDU A;  3SV4 A;  3VQC A;  4W5O A;  4CJ4 A;  1N36 K;  3AA3 A;  3LDO A;  3QLH A;  2P9U B;  3OBW A;  4O44 A;  4V19 S;  3VA3 A;  3DLH A;  1HKB A;  4N76 A;  1DTT A;  4KHU A;  1MU2 A;  4N41 A;  4A2A A;  4DQP A;  3CCU N;  4KHS A;  3JXU A;  1UA1 A;  4PWD A;  3ZEU A;  3H46 O;  1ATR A;  1NK9 A;  4BRI A;  3NF8 A;  5AQT A;  1HYZ A;  4Y0W A;  5AQY A;  3QFU A;  1S9G A;  3JSM A;  3LDQ A;  1P8Z A;  2OPQ A;  3NE6 A;  5EY4 A;  1A5W A;  1M1K O;  4DTJ A;  1JXB A;  3ZX0 A;  4HCB A;  2Y1I A;  3EKS A;  2HBM A;  3V1R A;  4IFE A;  1WBB A;  1NBW A;  1FJG K;  2XRI A;  3EEQ A;  4KH4 A;  4CEA A;  4DV3 K;  4B9M A;  5FDL A;  4DFP A;  3DXM B;  4L8R B;  4PL8 A;  1HYV A;  1NMN A;  3C6T A;  4WE1 A;  2FC0 A;  3N4Q A;  3O9T A;  3WNH A;  3CC4 N;  1NLV A;  4JRP A;  3O1W A;  1KAY A;  1QVG M;  4BDY A;  1HNV A;  4PY5 A;  4CD1 A;  1I3A A;  4H5T A;  5AQH A;  4CJL A;  3TAE A;  1NGE A;  3SQ2 A;  5BRH A;  1NGG A;  1R0A A;  5BPM A;  4LD0 A;  3O1B A;  4AM6 A;  2A41 A;  2HNZ A;  3T69 A;  3UIQ A;  1U47 A;  1WSJ A;  4JKF A;  2HVI A;  2IGI A;  1U2V A;  5CZ2 A;  4IO8 A;  2A1S A;  2FBY A;  2RF2 A;  1YXQ A;  4E7H A;  4I2P A;  4BE2 A;  1HKC A;  2IVP A;  2E5L K;  4XEI A;  1ZBH A;  4NYF A;  4K42 A;  3MN9 A;  4KH5 A;  1VQL N;  4TSX A;  4C8O A;  1KVB A;  2X74 A;  4OVL A;  3JYT A;  3L2R A;  3EZ5 A;  4QAG A;  4DR6 K;  4PUO A;  2V7Z A;  3AVM A;  3VEV A;  5KGW A;  5IT9 O;  1N8R O;  1TYQ A;  2HF4 A;  3DRS A;  2ASO A;  2QWQ A;  2A3Z A;  4BRO A;  2RN2 A;  2FBV A;  2C1I A;  4FSV A;  2E2O A;  2E2N A;  5KTQ A;  1B9D A;  5M1F A;  3K5L A;  3FZH A;  4EAH D;  2QWO A;  4CED A;  2JGU A;  1K6Y A;  4G1Q A;  5C10 A;  5MLC Q;  1KXP A;  3P38 A;  2PZS A;  4CGH A;  4BAC A;  4GMJ B;  3VEW A;  4KKO A;  1A5V A;  3G6E N;  3MXM A;  1S1X A;  4JKB A;  2F8T A;  3R6M A;  4FJG A;  3AVG A;  4IEI A;  4PKI A;  2ZF5 O;  3QB0 A;  3WNF A;  4FLY A;  2NUB A;  4NXN K;  5HRS A;  3M6G A;  3P1G A;  3HTV A;  4QS9 A;  4FVM A;  5AQO A;  2YHA A;  5KQD A;  4DF8 A;  3O9U A;  3A2F A;  3VQE A;  3I8B A;  1RGI A;  2KFN A;  4RW7 A;  1ZC6 A;  2VG7 A;  1NK0 A;  3H45 C;  5AQR A;  4FOE A;  1N6Q A;  1K8A O;  3WXI A;  2Q1N A;  1S3X A;  1QZ5 A;  2GUP A;  2HB5 A;  1K8K B;  1QQM A;  3SJH A;  3BY5 A;  1NNE A;  3CHW A;  4BR7 A;  4CJT A;  4A5A A;  3SUP A;  1UA0 A;  1VK0 A;  4KAZ A;  3S3M A;  3SAG A;  2P9L A;  4CJP A;  1RT2 A;  5I42 A;  2UXB K;  1C1C A;  2I5J A;  2HST A;  3VQP A;  5AR0 A;  2DPN A;  2O8E A;  2AJQ A;  1QSS A;  1QSL A;  1J54 A;  1J5O A;  5KI6 A;  1LCU A;  3PUF A;  4H8K A;  4NB4 A;  4YDU C;  1TK5 A;  1BA1 A;  4O0I A;  3V9Z A;  5JS2 A;  1NK5 A;  1O13 A;  5BR9 A;  4DUY K;  1OH7 A;  3ENB A;  3C65 A;  5I3U A;  1VQ9 N;  1S6Q A;  3V9U A;  2XY8 A;  3PLA A;  2CH6 A;  3FGU A;  4LF5 K;  3VF2 A;  4DQQ A;  3DM2 A;  3THX B;  1GOB A;  2V52 B;  4JKD A;  3LDS A;  4WQ4 C;  1GLJ O;  3KHY A;  4ZTJ A;  2ZD1 A;  3MEC A;  4DMN A;  5GAD P;  5B8H A;  3DRP A;  3ZT3 A;  2HVH A;  3NVM A;  3WT0 A;  3QEP A;  1NJZ A;  4IG3 A;  3ZSY A;  5EOY A;  4JI8 K;  4DTU A;  2E2Q A;  2E88 A;  4Z94 A;  1ZBF A;  2V7Y A;  4CIG A;  4GV9 A;  5FRN A;  2X6S A;  3V9S A;  1HNZ K;  4BRE A;  3BF1 A;  4M45 A;  3ZT0 A;  4O8U A;  2YI1 A;  3K5N A;  2QW9 A;  1XNQ K;  1RDC A;  1IKV A;  2IC3 A;  3HPG A;  1J9A A;  4GKJ K;  1KFS A;  4DLE A;  3CD6 N;  2NNW A;  2W6L A;  3CPE A;  2D0B A;  4CK3 A;  4CFC A;  5BN8 A;  4ILJ A;  3AY9 A;  2Q3S A;  4WQ5 C;  3PX0 A;  3OYM A;  4RW6 A;  5GIO A;  2OPP A;  3O3F A;  2YNF A;  2YCH A;  4BRG A;  2P9P B;  2KW4 A;  1V4S A;  3CET A;  2D0O A;  3ZSW A;  4JHD B;  3H08 A;  4JEP A;  4CZJ A;  1BI4 B;  4BR2 A;  4W5R A;  1ZBI A;  2RHK A;  3EY1 A;  3QEV A;  3LZI A;  1YT3 A;  3ATV A;  1T7P A;  4M3T A;  1QQN A;  1Q8I A;  2NRH A;  3WXK A;  1J53 A;  4O0J A;  4H0V B;  3R1X A;  3AGR A;  4BVP A;  3KK1 A;  4Z4G A;  2Z1H A;  4JI4 K;  4RG8 A;  5FPE A;  2ASP A;  2OPS A;  3ULE A;  4IOC L;  2DY4 A;  5JMV A;  3KWG A;  3ZSR A;  3NGI A;  4YOY A;  4H03 B;  4A2B A;  4BC3 A;  3RMA A;  4JKA A;  3DRR A;  3DXK B;  4KI4 A;  1T3V A;  5I9E B;  2OYQ A;  3L2Q A;  4BR5 A;  4JI6 K;  2BH1 A;  4FJL A;  2E8A A;  1D9F A;  4HUG A;  1VSL A;  4JI0 K;  3VQQ A;  3CIP A;  2D0C A;  4N56 A;  4DQI A;  4H5R A;  2B5J A;  3A5N C;  4FZX C;  4FJ8 A;  1HNW K;  2W6K A;  1RTI A;  4I2Q A;  1VQP N;  3CFR A;  1XUP O;  4E1M A;  4CER A;  3LDL A;  1NGA A;  3CJ1 A;  3D2E A;  3NGZ A;  3CCJ N;  3FZF A;  5J2P A;  4CHO A;  5DK5 A;  3A5L C;  4ZHR A;  2JWL A;  1S9E A;  3L3V A;  3JS6 A;  3C7N B;  2ZJR L;  2UXD K;  3ZX3 A;  3KK2 A;  2HHV A;  1WAF A;  1CZB A;  3Q7B A;  1LWE A;  2PYJ A;  5AQI A;  1L3U A;  3TAR A;  3HPH A;  2WON A;  1C6V A;  2HMP A;  4B9L A;  2YJF A;  3SJJ A;  3NF9 A;  4BC4 A;  1CLQ A;  3KWI A;  1LOT B;  2W42 A;  4DSK A;  1TKD A;  3IG1 A;  4IZ9 A;  5K14 A;  3M3Z A;  2ZM6 K;  5LL6 Z;  4DTR A;  4CJV A;  3THX A;  4B9U A;  3EKU A;  3MWT A;  3L0Q A;  3QBW A;  4H0X B;  1NU0 A;  4MDB A;  5JVH L;  1NJX A;  1XC9 A;  2NRV A;  3HVT A;  4FWR A;  3KLH A;  1NK4 A;  2OA8 A;  4CF1 A;  4FYD A;  3CFO A;  3UKU A;  1T44 A;  2E4L A;  4AHR A;  1Q9Y A;  2GX9 A;  4FK0 A;  1YVU A;  4JLH A;  3L2U A;  3CYM A;  4AM7 A;  3SPZ A;  4QS7 A;  1QQO A;  1BOT O;  4E1N A;  4DS5 A;  4M7X A;  2O8D B;  4B3S K;  4C1N I;  1HKG A;  3V81 A;  3BZC A;  4W5T A;  1MWM A;  1J6Z A;  2WBN A;  2F9W A;  4M3U A;  4J2A A;  3ISN C;  1E4F T;  3O4N A;  4FW2 A;  4I6M A;  2NRX A;  3CQY A;  4IXC A;  4JI2 K;  5IWA K;  3ENH A;  4B9V A;  1VQK N;  3MX5 A;  4OPH A;  5J1E A;  3P39 A;  1RBR A;  3RWU A;  1M90 O;  4DTM A;  3I33 A;  5C2D A;  2VQF K;  4CBW A;  1VQ4 N;  5EXW A;  4CFA A;  1NKB A;  4LF9 K;  4OKK A;  4EZ6 A;  2G8F A;  1VQM N;  4JS5 A;  3U8X A;  2IAJ A;  3NH2 A;  2PFU A;  1VAZ A;  3M8Q A;  4DSI A;  4LF4 K;  5CYQ A;  4CEZ A;  3WQT A;  3I0R A;  4EZ9 A;  3M1F A;  3U6F A;  3WNE A;  4X65 K;  4JK9 A;  3VQ6 A;  4MLH A;  4BQL A;  4FL9 A;  3RSE B;  3OYH A;  2XY7 A;  3K57 A;  3AVH A;  4KRE A;  3C0B A;  3O9R A;  2HF3 A;  2YV0 X;  3GL1 A;  1U49 A;  3O5B A;  3OJU A;  1S72 N;  1WBD A;  4K8X A;  3KKR A;  4YHH K;  1SV5 A;  4B3M K;  1NOZ A;  5HL7 L;  1RBT A;  5AQF A;  3OYD A;  1RT5 A;  2XY5 A;  3H6E A;  5AZI A;  4F8R A;  5M1K A;  3KLF A;  1D5A A;  4DV1 K;  5LJW A;  1BQM A;  3DXK A;  3BP8 A;  2OCE A;  5AQP A;  3TR8 A;  3LP3 A;  5AQK A;  1U6Z A;  4BR0 A;  3ENO A;  2HNY A;  2UUC K;  4KHQ A;  3ZSZ A;  3HSC A;  1I94 K;  2UUA K;  4DQR A;  2HHU A;  4I9Q A;  4FJN A;  5DMR A;  4KPY A;  1NGI A;  4R79 A;  3H1Q A;  5KRT A;  2JWK A;  4WYB A;  3NMU A;  1JCE A;  1TAU A;  3C95 A;  4EHU A;  3JAM O;  1C0F A;  4AHU A;  1VQ5 N;  4GW6 A;  3D2E B;  4CZH A;  4PKH A;  3DLL L;  1NJW A;  2O8F A;  1SZ2 A;  3IFR A;  2OAN A;  1ZXO A;  2HHS A;  3J81 O;  4K25 A;  3DXM A;  1HNX K;  4DR3 K;  4KTW A;  2HMI A;  3EN9 A;  2F8S A;  5FPM A;  1KSP A;  4IDK A;  4NYN A;  1U04 A;  3TAG A;  1QHT A;  4LF7 K;  1Z6R A;  4A62 A;  4CEQ A;  3U3G A;  1BA0 A;  2PYL A;  3QIO A;  1IG9 A;  4RW4 A;  3G25 A;  3R8E A;  3NCI A;  3QET A;  1RT7 A;  1GLL O;  3E1Y A;  2RE2 A;  2GWJ A;  2QXF A;  3HOS A;  1ZBL A;  4BG9 A;  1KLN A;  3AO2 A;  2OTL N;  4CJR A;  2KKZ A;  2P9N B;  1X9J A;  3R9P A;  3J80 O;  1DKG D;  1CZA N;  3K59 A;  3OYK A;  5E41 A;  2LSN A;  3NFA A;  1BHL A;  4B1Y B;  3HBT A;  4CJU A;  2PBD A;  1VSH A;  2HHW A;  1YIT N;  4B3O A;  5HRN A;  4CEB A;  1RTJ A;  3HP9 A;  2HBL A;  3P83 D;  4J2E A;  1HUX A;  4RW9 A;  3EYZ A;  1RIL A;  1EP4 A;  3IS9 A;  3ZET A;  3ATU A;  1IH7 A;  5LMU K;  1BO5 O;  1YUW A;  4FWQ A;  1EET A;  5JS1 A;  1QHA A;  1JXE A;  2G8H A;  4LF6 K;  3ZX2 A;  4BRQ A;  2E1Z A;  3R3L A;  5GAH P;  2X78 A;  4DTP A;  3LP1 A;  3ID8 A;  1GLD G;  2IDO A;  4CHZ A;  1NM1 A;  4R5P A;  1KTQ A;  5ADX A;  5FRM A;  4LFB K;  4KHP K;  2ETJ A;  2GV9 A;  2F96 A;  4LH5 A;  3U3Y A;  4BY9 C;  1LW0 A;  3LPU A;  4LSN A;  1WSE A;  4Z0U A;  2HBK A;  1C0T A;  4FJH A;  1U2V B;  3F73 A;  1G99 A;  3ITH A;  4KO0 A;  3RVC A;  3QFP A;  3FFK B;  2VWB A;  5LMN K;  1N32 K;  3AVJ A;  1BIU A;  2ZJQ L;  3DMJ A;  1TK8 A;  4JS4 A;  1EWR A;  3CCV N;  3RMD A;  3WQU A;  1IBM K;  2D5R A;  1SS6 A;  3TI0 A;  2BGG A;  4HUE A;  3CC2 N;  4DV7 K;  2W00 A;  2FF6 A;  1B92 A;  1IKX A;  3F9M A;  2DFE A;  4NLB A;  4LC9 B;  2Q2R A;  4CK2 A;  3PX4 A;  4BRF A;  2ATQ A;  1DGK N;  3RMC A;  1NKC A;  4FWO A;  3CCR N;  2P9L B;  2YJE A;  1B9F A;  1JLQ A;  3O8M A;  1NKE A;  3V6D A;  2F7T A;  1OH5 A;  3TSQ A;  4E0D A;  3QEI A;  2O8E B;  4BRM A;  1XHZ A;  3CJA A;  1RCH A;  4FJK A;  1N5Y A;  2ZE2 A;  3KK3 A;  2VG5 A;  4BDP A;  3DAW A;  2F4V K;  4CW7 B;  3MCA B;  1S1W A;  4NCG A;  4DTX A;  4OX9 K;  4JN4 A;  4MO4 A;  3EL2 A;  2O8F B;  3LAK A;  3CJC A;  1YVN A;  2YNI A;  3MMV A;  4IJN A;  1P90 A;  2HND A;  4B1U B;  4XJX A;  5M1P A;  1FKO A;  3ZSO A;  2KZM A;  3QNN A;  4JAX A;  5EU7 A;  4M3Z A;  2P9S B;  3SI6 A;  4W5N A;  3OS2 A;  1ATS A;  4H5N A;  1RBS A;  3AVC A;  3QDK A;  1T6C A;  4Q5V A;  3DYA A;  2B4J A;  4DV2 K;  1RT6 A;  5M1Q A;  3OJS A;  4FJI A;  3OS1 A;  3NF7 A;  2QA4 N;  3L2W A;  1K8K A;  4M41 A;  4FLZ A;  1W9H A;  3UE5 A;  4KRF A;  3AO4 A;  1O1W A;  1VSD A;  1NOY A;  1BUP A;  2QWN A;  1XNR K;  4FWM A;  4DLG A;  1JLG A;  1YJ9 N;  2IVO A;  2ITG A;  3FZM A;  3TAF A;  4DTO A;  2YKM A;  5AZJ A;  1HMV A;  4EFH A;  2G8V A;  1NK8 A;  4GV3 A;  2OZS A;  4YOX A;  4L3Q A;  4DQ8 A;  4HTU A;  1BIZ A;  4KTQ A;  1NGC A;  1VRT A;  4CJ7 A;  3QO9 A;  4B3T K;  2UXC K;  4JHD A;  1W0H A;  1W97 L;  3GOI A;  3VET A;  1KVA A;  5C2F A;  5DM7 L;  3TAP A;  1HRH A;  1BI4 A;  3AA4 A;  2FF3 B;  4BGB A;  3ULD A;  4YOT A;  2XO7 A;  2OTJ N;  4CGD A;  4DFM A;  2HHX A;  1WAJ A;  5SZT A;  3Q7C A;  3D2F B;  3THV A;  3THW A;  4CZI A;  3NHG A;  3VEZ A;  3S41 A;  2Q0R A;  3HM8 A;  2HW3 A;  2VYP A;  2I7P A;  2E2P A;  3THY A;  2F9T A;  1ASV A;  1MA9 B;  3IRX A;  4MQ3 A;  4BQZ A;  4FJ5 A;  2UUB K;  1ASU A;  4E19 A;  3IMX A;  1NGD A;  5FLX O;  3VQA A;  2NRT A;  2HHI A;  1A5X A;  2J4R A;  3SMP A;  5J2Q A;  4NCA A;  4CGF A;  3CER A;  4WFA L;  4B9S A;  4LFA K;  4JD2 B;  2D0A A;  4DR4 K;  2JLE A;  4GV6 A;  4F2R A;  3IUC A;  3TTD A;  2G8U A;  2QKB A;  2EHG A;  3HVR A;  1QQC A;  3ALY A;  4J2B A;  3ZLJ A;  3IKM A;  4CIF A;  4UQG A;  3VEX A;  1X1P A;  2CH5 A;  4FW1 A;  3RR8 A;  4ID1 A;  1F21 A;  5A2Q O;  4DKW A;  1T05 A;  1W7A A;  4BR4 A;  4FJJ A;  2P9K A;  1VSE A;  1XMO K;  4BRD A;  2VWJ A;  1U4B A;  4CZG A;  3CFP A;  3VQ8 A;  3PIP L;  1EQY A;  3D7E O;  3C7N A;  5JEN A;  4M3W A;  4O4G A;  5AQX A;  4CGJ A;  2YNH A;  4ICL A;  1JKH A;  3CMA N;  3ULE B;  5BPN A;  4XH1 A;  3CCS N;  4KB1 A;  3DWL A;  3KD1 E;  2IS3 A;  3VQ9 A;  2IOC A;  3LDP A;  3LWL A;  4RW8 A;  1WSI A;  4OLA A;  2FSN A;  2YHY A;  3LL3 A;  1CZ9 A;  4IEE A;  2FSJ A;  1KLM A;  1J5E K;  2Q36 A;  1Q81 O;  1WLJ A;  4CJ3 A;  3C6U A;  4DR2 K;  3ZEU B;  5FPN A;  1HPZ A;  4LY7 A;  3PSF A;  5CR4 A;  5HBM A;  1SAZ A;  4B9N A;  4CZE A;  3NH1 A;  1QTM A;  2W40 A;  2Z1G A;  1UAX A;  2NRW A;  3P4I A;  5AQN A;  4YOU A;  1RT3 A;  1VSF A;  1WSH A;  1FW6 A;  1TL1 A;  4K43 A;  4DB3 A;  1Q9X A;  1Q18 A;  1TVR A;  4KFB A;  1VRU A;  4CZL A;  3MXI A;  4RWT A;  4KB0 A;  3V1O A;  4CEF A;  4C23 A;  3T3F A;  3DOK A;  2O8D A;  4WQ5 A;  3AO1 A;  1IV0 A;  3HL8 A;  5BRF A;  4H0O A;  3K9J A;  3KK7 A;  1RNH A;  3K5O A;  4E1J A;  3P31 A;  2X6N A;  3GE1 A;  4O8K A;  4M3R A;  4H5W A;  5F2R A;  4Y1C A;  4YOV A;  1TV6 A;  4HTL A;  4JI3 K;  4IWV A;  3LPT A;  3D6R A;  4C8M A;  5AZJ B;  4B8A B;  1RFQ A;  1S5J A;  3O6W A;  4GY2 B;  5M1O A;  3RRH A;  1IBK K;  1YJN N;  1BIS A;  5KQ8 A;  1REV A;  5AFU A;  3KIO A;  3LP0 A;  2G8I A;  4CK1 A;  4JYA K;  5DM6 L;  4F3T A;  4DV6 K;  4ID5 A;  4DFJ A;  2CGK A;  2QXL A;  1JCG A;  3RMB A;  2QWM A;  1EX4 A;  4WQ4 A;  2Z1J A;  1QS4 A;  1XQS C;  4JKG B;  3SMS A;  2NLX A;  3TU5 A;  3PIO L;  4J8F A;  4IFV A;  1NGF A;  3VEY A;  3UKU B;  4PL7 A;  3RSE A;  3VA0 A;  3THW B;  2FLO A;  1K73 O;  3CJ9 A;  3F9K A;  3MEE A;  5C42 A;  1BDG A;  1HJR A;  3TTC A;  4FLW A;  3LAN A;  1TKT A;  1LV5 A;  2GWK A;  4CES A;  3ZT1 A;  1S1T A;  3C94 A;  3VF6 A;  5KGX A;  1RT1 A;  3VGK A;  4OO1 J;  4FZZ A;  4OPJ A;  1C1B A;  3PY8 A;  1VQO N;  1L3V A;  5FPD A;  3MCP A;  1H1V A;  1NK7 A;  4ELU A;  5AFU H;  3L4I A;  3KJV A;  3VQD A;  1NK6 A;  3OA9 A;  3K2P A;  5CYM A;  4AHV A;  1T03 A;  3BZK A;  1EKE A;  1Y97 A;  3CF5 L;  4DFK A;  4M42 A;  1FK9 A;  2YNG A;  3MK6 A;  3TAB A;  3OVN A;  3CC7 N;  4I7F A;  4DV0 K;  3UKR A;  4KHN A;  5HLF A;  5JVG L;  2UYT A;  3CME N;  1ESV A;  4LH4 A;  3CG7 A;  1BG3 A;  2V51 B;  3J8A A;  3RTV A;  4DV4 K;  1NGJ A;  3AA2 A;  3EO3 A;  4DSL A;  2O8C A;  2VWK A;  1V4T A;  5CZ1 A;  4CZM A;  3O3H A;  1K9M O;  5E84 A;  1TUU A;  3NVK A;  2A40 A;  2EWS A;  1VQ7 N;  4LF8 K;  4B8C A;  3CI5 A;  2QTD A;  3WUH A;  2ITM A;  3AO3 A;  4W5Q A;  4Z4C A;  3AVA A;  1IG8 A;  4E7J A;  4BEB A;  4UY8 O;  1U48 A;  1VSI A;  3OW2 M;  3L4Q A;  3A0I X;  3VES A;  1ATN A;  4OLB A;  3VQ4 A;  2HBJ A;  5AQW A;  3QER A;  1GLC G;  4B1W B;  4KTZ A;  2FBT A;  4PA1 A;  2YHB A;  4XH4 A;  3VPZ A;  1S22 A;  2A42 A;  4Z4H A;  4CF2 A;  4FCY A;  4FWP A;  5SWM A;  4H0T B;  1LW2 A;  4DU4 A;  4DU3 A;  3I55 N;  3K58 A;  4FPA A;  3HOT A;  3NBP A;  3U9D A;  4AIL C;  2E20 A;  4RTF D;  3MAQ A;  1XC3 A;  1ZBU A;  3I0S A;  1LWC A;  5ADX H;  3U4L A;  3L2V A;  5AQG A;  4F9O A;  3BUZ B;  1ZBS A;  3WXL A;  1FXX A;  4DG1 A;  4K8Z A;  1BWF O;  3HXM A;  4FLT A;  1JLC A;  3EZW A;  2UU9 K;  4LSL A;  4CIE A;  5BPL A;  5C12 A;  4CHY A;  4NXM K;  5EX5 A;  4JKC A;  3ZET B;  5LJV A;  2E6L A;  1KRP A;  2YX6 A;  1EXQ A;  3VOV A;  2P1J A;  4AHC A;  1X9M A;  3VEO A;  1JLB A;  3TTF A;  5F0X A;  4FJX A;  4M63 C;  2KZZ A;  3CXC M;  1QZ6 A;  3HO1 A;  3ZYY X;  3HZ6 A;  3QEW A;  2YKN A;  1XMQ K;  2P9I B;  4CD3 A;  4JV5 K;  3LDN A;  1UWB A;  2G8W A;  4X66 K;  1XWL A;  3H3N O;  3E9O A;  5AQQ A;  3CQ8 A;  2Q97 A;  4HCC A;  1X3N A;  5KPT A;  1G15 A;  4QCL A;  4ELV A;  1SKS A;  3F5T A;  2WOM A;  3J7A P;  2BAN A;  5J2M A;  4FWK A;  1OVQ A;  1L3T A;  4H4M A;  3BDP A;  2BUP A;  4CGI A;  4C8K A;  2R7Y A;  3WEE A;  2P9N A;  1TAQ A;  4E3S A;  5JLF A;  4ILH A;  2RPI A;  3DLK A;  2HHQ A;  3MN6 A;  3OYB A;  4XIU A;  3TAM A;  1IBL K;  4A57 A;  1E4G T;  2P9P A;  3DLR A;  1KCF A;  4WFB L;  4ELT A;  2GTD A;  1EWQ A;  3VN5 A;  1WSG A;  4X64 K;  1VSK A;  4BR9 A;  4IJA A;  4CZK A;  3O80 A;  1GOA A;  4RCH A;  4DHY A;  4FLU A;  3K9K A;  4HHT A;  1BL3 A;  1JCF A;  1VQ6 N;  5C0Y A;  4IOX A;  3CM6 A;  5EVZ A;  4FWL A;  3QIC A;  1VQN N;  3OYN A;  3E9L A;  1ILY A;  3VER A;  4BRP A;  1JLF A;  4CF0 A;  3GBT A;  3TPQ A;  3PV8 A;  4QOZ B;  1CXQ A;  5H1S Q;  1BCM A;  4FM1 A;  2NRR A;  2P51 A;  5FRO A;  3A5M C;  4Z4E A;  2DFF A;  5E26 A;  4DV5 K;  4F4K A;  5AQM A;  4CJK A;  4CF8 A;  4WF9 L;  2CGL A;  3UKR B;  1OVY A;  4MO5 A;  1GLB G;  1SKW A;  2YHW A;  1JLA A;  2GEM A;  1SQK A;  3ZT2 A;  4FWN A;  4GKK K;  3MX2 A;  1CXU A;  2E1Y A;  3NH0 A;  4BWJ A;  2Q31 A;  2KFZ A;  1EO1 A;  3OTO K;  4E7K A;  2VG6 A;  2A1R A;  4HVJ A;  5T7B A;  5AQS A;  4EIA A;  4OPK A;  2AP1 A;  3SBT A;  1WUA A;  4IKF A;  3CPW M;  4B08 A;  3AAQ A;  4DSE A;  2ZWH A;  3NAE A;  4U67 L;  3SUQ A;  3LP2 A;  2P9S A;  4FPB A;  4KV8 A;  5GIP A;  3W0L A;  4JRQ A;  2KHO A;  3LAL A;  4OJR A;  3OYC A;  5AJ3 K;  1XI1 A;  2XHB A;  4FJ9 A;  3S3N A;  1RDU A;  1D4X A;  1BQN A;  4ISF A;  3KLE A;  3AAR A;  1TKX A;  3HP6 A;  4A59 A;  1VHX A;  5C24 A;  1LWF A;  3SCX A;  1HX1 A;  2ASM A;  4BE1 A;  1HYS A;  3VGL A;  5CY4 A;  4H5V A;  3L3U A;  1N33 K;  1NJY A;  3OYJ A;  4FLV A;  3ZSQ A;  1Q82 O;  3KZB A;  4JK7 A;  4IO9 L;  3S9H A;  4MLE A;  4Q0B A;  1D9D A;  3O4Q A;  1WB9 A;  3T19 A;  3B6P A;  1UOC A;  5TKW A;  3BEX A;  1OH8 A;  2DFH A;  3PX6 A;  1MWK A;  3SPY A;  4B3R K;  1DT9 A;  3CYG A;  1RDW X;  2O4G A;  4H0P A;  2HHH K;  2O4I A;  3AVI A;  4JI1 K;  3I56 N;  2IVN A;  3BGR A;  4CFD A;  5CE3 A;  3KVG A;  1YAG A;  1ITG A;  4QS8 A;  2GBZ A;  2VCP A;  3TAN A;  4CI6 A;  2GUI A;  4BEC A;  5J2N A;  3UB5 A;  1RDA A;  3KLG A;  4BRN A;  5HRR A;  3RRG A;  4CCH A;  4BVO A;  3D0P A;  4JK8 A;  5CHI A;  4BRL A;  2P9I A;  3W3D A;  3K0S A;  3AGK A;  3RR7 A;  3AVK A;  3SUN A;  4DR7 K;  3ZSX A;  1WN7 A;  5TKY A;  4AHT A;  2P5O A;  1HLU A;  3VGM A;  3V9W A;  5LY3 A;  4JKE A;  4CJQ A;  3SV3 A;  4C8N A;  2G8K A;  3G10 A;  3OYL A;  5AQZ A;  4I6M B;  1RTH A;  3FLC O;  4E89 A;  2IIR A;  1T8E A;  4K41 A;  1YIJ N;  1NGH A;  4C1N K;  3AV9 A;  2FSK A;  1WSF A;  4CHN A;  4GNI A;  4YY3 K;  4WFN L;  4FM2 A;  4NO7 A;  2ZGY A;  1RDB A;  3SUO A;  3J7Z O;  1RBU A;  4EP5 A;  3QML A;  2AA4 A;  4FXD A;  5M1N A;  1X3M A;  3SAH A;  1RT4 A;  4Z4I A;  3PO5 A;  1TUY A;  3SQ1 A;  1Z05 A;  3OYI A;  3QIP A;  1YHQ N;  4KHY A;  1W2B M;  1S6P A;  3HI0 A;  1JL1 A;  3V1Q A;  1Q7Y O;  3KKS A;  5JIC A;  3CCL N;  4OPA A;  2D1K A;  1DTQ A;  4IG0 A;  3M8P A;  4ISG A;  3LAM A;  3G0Z A;  1SL0 A;  1C0M A;  4DR5 K;  3HJF A;  5D3G A;  4B1X B;  4FJM A;  1T6D A;  1YF5 L;  3N4P A;  4AF1 A;  1TGO A;  2Z1I A;  3G4S N;  3GG4 A;  4G9Z A;  4YFU A;  3O9Q A;  3F2K A;  1HQE A;  1YTA A;  2W41 A;  3AA5 X;  1S1V A;  5BN9 A;  2QWL A;  4F2S A;  3HT3 A;  4HWI A;  3NGY A;  3SK3 A;  5BRD A;  2QWR A;  4ZTF A;  1IKY A;  3DI6 A;  3HM9 A;  3SNN A;  4OGE A;  4NLC A;  3K5M A;  4CJE A;  4U7B A;  3G71 N;  4JD2 A;  1RBV A;  5GAE P;  3SAF A;  2ZJP L;  2PAV A;  4CHQ A;  1KC8 O;  3OYE A;  3ZCM A; 
#chains in the Genus database with same CATH homology
 4BGA A;  4CBU A;  4FSV A;  2E2O A;  4J8F A;  5F1X A;  5FPM A;  1NGF A;  2E2N A;  3VEY A;  5M1F A;  3AAP A;  3UKU B;  4PL7 A;  3RSE A;  4WCE L;  3FZH A;  4EAH D;  2QEX N;  2FLO A;  2QWO A;  1K73 O;  3CJ9 A;  1Z6R A;  5C10 A;  5MLC Q;  1BDG A;  1KXP A;  4A62 A;  1YJW N;  3CCE N;  3TTC A;  3P38 A;  1BA0 A;  3C6A A;  3A5O C;  3G25 A;  3R8E A;  2GWK A;  4FOI A;  3VEW A;  3CCQ N;  3VF6 A;  5AQV A;  1C0G A;  3VGK A;  1GLL O;  3G6E N;  2WC9 A;  3E1Y A;  4OO1 J;  4JKB A;  2RE2 A;  3OBY A;  2GWJ A;  2P9K B;  3HOS A;  1VQO N;  3R6M A;  4BG9 A;  5FPD A;  4CZF A;  3MCP A;  4IEI A;  3CJ7 A;  4PKI A;  1NMD A;  2ZF5 O;  1H1V A;  3QB0 A;  2OTL N;  2KKZ A;  3CJB A;  2P9N B;  1X9J A;  3L4I A;  5AFU H;  1OKJ A;  3R9P A;  3OA9 A;  3VTI A;  1DKG D;  3M6G A;  3HTV A;  4QS9 A;  4KH6 A;  1CZA N;  5AQO A;  5AQJ A;  3ID6 A;  4B9Q A;  5KQD A;  3CF5 L;  3O9U A;  1HJO A;  3MK6 A;  4EHT A;  3CC7 N;  3UKR A;  1QVF M;  4B1Y B;  3FR0 A;  3HBT A;  3IDH A;  3I8B A;  5JVG L;  2UYT A;  1RGI A;  2PBD A;  1ESV A;  2A6A A;  3CME N;  1BG3 A;  3VTH A;  2V51 B;  1YIT N;  1ZC6 A;  3MWP A;  3J8A A;  3H45 C;  5AQR A;  1VQ8 N;  4FOE A;  2HBL A;  1NGJ A;  3EO3 A;  3WXI A;  1K8A O;  1HUX A;  2Q1N A;  4BC5 A;  1S3X A;  1QZ5 A;  2GUP A;  1K8K B;  1QQM A;  2NRZ A;  1V4T A;  3SJH A;  3ZET A;  4CZM A;  3ATU A;  3CHW A;  4BR7 A;  4A5A A;  1K9M O;  5E84 A;  1TUU A;  2FXU A;  4FWS A;  4CBX A;  1BO5 O;  1NWK A;  2A40 A;  2EWS A;  3CCM N;  1YUW A;  3CI5 A;  2QTD A;  2BTF A;  2P9L A;  3SAG A;  1GLF O;  2ITM A;  3WUH A;  3MDQ A;  2D4W A;  4FWQ A;  1QHA A;  1IG8 A;  2HST A;  5AR0 A;  3EE8 A;  2DPN A;  4UY8 O;  5BRE A;  4BEB A;  3ZX2 A;  4BRQ A;  2E1Z A;  3R3L A;  3VEN A;  5GAH P;  3OW2 M;  1NJI O;  3L4Q A;  3A0I X;  3ID8 A;  3A8Y A;  1GLD G;  1LCU A;  3VES A;  1ATN A;  4NB4 A;  4B1V A;  4YDU C;  1BA1 A;  2HOE A;  1NM1 A;  2HBJ A;  5AQW A;  1GLC G;  4B1W B;  5ADX A;  5C15 A;  1O13 A;  3TSP A;  2YHX A;  5BR9 A;  4XH4 A;  3VPZ A;  1S22 A;  2A42 A;  3ENB A;  3C65 A;  1KQS M;  1VQ9 N;  3FZL A;  4FWP A;  4H0T B;  3PLA A;  2CH6 A;  3FGU A;  3I55 N;  3VF2 A;  4FPA A;  4BY9 C;  3HOT A;  2V52 B;  4JKD A;  2HBK A;  2ZGZ A;  1U2V B;  3U9D A;  4B1Z A;  4WQ4 C;  1G99 A;  1GLJ O;  3KHY A;  3RVC A;  3NVK A;  5GAD P;  5GIN A;  3QFP A;  2E20 A;  3FFK B;  4RTF D;  5B8H A;  2VWB A;  1XC3 A;  2ZJQ L;  1YI2 N;  2P9U A;  4XH5 A;  3U9Z A;  1KAX A;  3NVM A;  3U4L A;  3WT0 A;  5ADX H;  3CCV N;  3CQX A;  5EOY A;  5AQG A;  3WQU A;  4F9O A;  3BUZ B;  1SS6 A;  1ZBS A;  2E2Q A;  2E88 A;  3L6Q A;  4Z94 A;  3WXL A;  2V7Y A;  4GV9 A;  4BE7 B;  4BRE A;  1BWF O;  3BF1 A;  4ILG B;  4O8U A;  2YI1 A;  2QW9 A;  3EZW A;  4H0Y B;  3CC2 N;  4A5B A;  2W00 A;  2FF6 A;  1WOQ A;  2NZT A;  4BRA A;  3F9M A;  5C12 A;  5BPL A;  4NLB A;  4JKC A;  4LC9 B;  5EX5 A;  2Q2R A;  3ZET B;  5LJV A;  4JKG A;  4BRF A;  2YX6 A;  3SLC A;  1DGK N;  3CD6 N;  2NNW A;  3VOV A;  3CPE A;  1Y64 A;  3VEO A;  4FWO A;  3TTF A;  5F0X A;  3CCR N;  3QBX A;  4M63 C;  2P9L B;  5BN8 A;  2YJE A;  4ILJ A;  3AY9 A;  3CXC M;  1IJJ A;  1QZ6 A;  4WQ5 C;  3O8M A;  4GVE A;  3ZYY X;  4BRH A;  5GIO A;  2F7T A;  5HOO A;  1KAZ A;  3HZ6 A;  3TSQ A;  5AQL A;  4BRM A;  2P9I B;  4CD3 A;  2YCH A;  3DJC A;  2P9P B;  3CJA A;  3LDN A;  4BRG A;  1V4S A;  3CET A;  2D0O A;  3FZK A;  3H3N O;  3E9O A;  4JHD B;  5AQQ A;  4BC2 A;  2Q97 A;  1X3N A;  5KPT A;  1Q86 O;  4JEP A;  4CZJ A;  3DAW A;  3WXM B;  3MCA B;  3F5T A;  3VMF B;  4BR2 A;  4JNE A;  2RHK A;  4JN4 A;  4MO4 A;  3EL2 A;  4FWK A;  3CJC A;  1NGB A;  1YVN A;  3ATV A;  1GLA G;  1QQN A;  3T7Z A;  2BUP A;  4PKG A;  3MMV A;  4IJN A;  1P90 A;  3WEE A;  2P9N A;  4B1U B;  2NRH A;  5JLF A;  4ILH A;  4FO0 A;  5M1P A;  3WXK A;  4XJX A;  4H0V B;  3R1X A;  3AGR A;  4BVP A;  2C1G A;  3MN6 A;  4JAX A;  1MDU B;  2P9S B;  4JKH A;  1HPM A;  5FPE A;  1ATS A;  2ASP A;  4H5N A;  1BU6 O;  3QDK A;  1T6C A;  3ULE A;  4A57 A;  4IOC L;  1E4G T;  2P9P A;  5JMV A;  4WFB L;  3KWG A;  2A5X A;  2GTD A;  4BG8 A;  1GLE G;  5M1Q A;  4YOY A;  4H03 B;  4A2B A;  3GDQ A;  4BC3 A;  4BR9 A;  4IJA A;  3B8A X;  4CZK A;  4JKA A;  3O80 A;  4KBO A;  4RCH A;  4DHY A;  3DXK B;  3K9K A;  1T3V A;  5I9E B;  2QA4 N;  1KD1 O;  1K8K A;  4BR5 A;  3TSU A;  1JCF A;  1VQ6 N;  2BH1 A;  3UE5 A;  2QM1 A;  4O5F A;  5C0Y A;  4IOX A;  5ELZ A;  2E8A A;  5EVZ A;  2CGJ A;  3OHR A;  5JLH A;  4FWL A;  3QIC A;  5AQU A;  1DEJ A;  1VQN N;  3CIP A;  1BUP A;  2QWN A;  3FE1 A;  3E9L A;  2QI2 A;  5GAG P;  4H5R A;  1JJ2 M;  1ILY A;  3VER A;  3WXJ A;  4FWM A;  3A5N C;  4BRP A;  1YJ9 N;  2VGM A;  3GBT A;  2IVO A;  3TPQ A;  5H1S Q;  5KPZ A;  2KLA A;  3FZM A;  4BRC A;  2Q0U A;  3D2F A;  2NRR A;  2VGN A;  1VQP N;  3MN7 A;  5AZJ A;  4EFH A;  3E9P A;  3A5M C;  4GV3 A;  2D0P A;  5E26 A;  4YOX A;  4L3Q A;  1XUP O;  3E66 A;  4DQ8 A;  2WUS A;  5AQM A;  3SBG A;  4PHT X;  1NGC A;  4WF9 L;  2CGL A;  3LM2 A;  3UKR B;  1OVY A;  3LDL A;  4MO5 A;  4BRK A;  4CJ7 A;  1GLB G;  1NGA A;  3CJ1 A;  3D2E A;  3M5R A;  4JHD A;  1W97 L;  2YHW A;  3GOI A;  3CCJ N;  3VET A;  5C2F A;  2GEM A;  1SQK A;  3FZF A;  1R59 O;  5AZI B;  1TYQ B;  2QWP A;  4YOR A;  5DM7 L;  3A5L C;  4FWN A;  3MX2 A;  3BF3 A;  3O4W A;  2E1Y A;  2Q31 A;  1EO1 A;  2GEL A;  2JWL A;  4A61 A;  2FF3 B;  2H3G X;  3JS6 A;  3MN5 A;  3C7N B;  4BGB A;  4YOT A;  2WFB A;  2ZJR L;  5AQS A;  3ZX3 A;  4EIA A;  3WEE B;  3H3O B;  2OTJ N;  2AP1 A;  3Q7B A;  1WUA A;  3SBT A;  3Q7C A;  3D2F B;  3CPW M;  3AAQ A;  2ZWH A;  4CZI A;  4U67 L;  3VEZ A;  2Q0R A;  3LM9 A;  3HM8 A;  5AQI A;  3S41 A;  2P9S A;  3C6H A;  4IDH A;  2VYP A;  4FPB A;  4YOW A;  2I7P A;  5GIP A;  4MDA A;  3W0L A;  2KHO A;  2HMP A;  2YJF A;  5KPR A;  2E2P A;  4BC4 A;  2F9T A;  3O9S A;  3HRG A;  4FVU A;  1RDU A;  3VF4 A;  1MA9 B;  1D4X A;  4ISF A;  4BQZ A;  3KWI A;  3AAR A;  4ISE A;  1LOT B;  2I7N A;  4A59 A;  4M7Y A;  3IMX A;  1NGD A;  4IZ9 A;  1HX1 A;  3M3Z A;  2NRT A;  2ASM A;  2J4R A;  3SMP A;  4DCH A;  4IOA L;  3H1V X;  3EKU A;  3CER A;  3EE9 A;  3MWT A;  3O08 A;  3VGL A;  4H5V A;  3L0Q A;  4WFA L;  4YDU A;  4JD2 B;  3QBW A;  4H0X B;  5JVH L;  4MDB A;  2NRV A;  4FWR A;  4GV6 A;  1Q82 O;  3KZB A;  3IUC A;  3TTD A;  4JK7 A;  4IO9 L;  3UKU A;  3LDO A;  4MLE A;  2P9U B;  1T44 A;  3OBW A;  5TKW A;  3BEX A;  1HKB A;  2GX9 A;  1MWK A;  3IKM A;  1DT9 A;  4AM7 A;  3VEX A;  2CH5 A;  4QS7 A;  1QQO A;  1BOT O;  1RDW X;  4H0P A;  4M7X A;  4DKW A;  4A2A A;  3I56 N;  4C1N I;  3CCU N;  3JXU A;  1HKG A;  4BR4 A;  2IVN A;  2P9K A;  1MWM A;  1J6Z A;  3ZEU A;  2WBN A;  3H46 O;  2F9W A;  4BRD A;  5CE3 A;  3KVG A;  1YAG A;  4CZG A;  1ATR A;  1E4F T;  4QS8 A;  3PIP L;  2VCP A;  1EQY A;  4BRI A;  4I6M A;  5AQT A;  2NRX A;  3CQY A;  3D7E O;  4IXC A;  3C7N A;  4Y0W A;  5AQY A;  4CI6 A;  3QFU A;  3ENH A;  3LDQ A;  1VQK N;  5AQX A;  4BEC A;  3MX5 A;  4OPH A;  3UB5 A;  1P8Z A;  3P39 A;  4BRN A;  3CMA N;  1M90 O;  5EY4 A;  3ULE B;  5BPN A;  4XH1 A;  4BVO A;  3I33 A;  3CCS N;  5C2D A;  4JK8 A;  4CBW A;  5CHI A;  1M1K O;  1VQ4 N;  3DWL A;  3ZX0 A;  5EXW A;  4BRL A;  2P9I A;  3EKS A;  3LDP A;  3AGK A;  3W3D A;  2HBM A;  2FSN A;  4IFE A;  2YHY A;  3LL3 A;  4IEE A;  1NBW A;  2FSJ A;  1VQM N;  2Q36 A;  1Q81 O;  5TKY A;  3U8X A;  4KH4 A;  2PFU A;  1HLU A;  1VAZ A;  3VGM A;  3ZEU B;  5FPN A;  5LY3 A;  4JKE A;  3DXM B;  5CR4 A;  5AQZ A;  4I6M B;  1SAZ A;  3FLC O;  4PL8 A;  3WQT A;  3M1F A;  2IIR A;  4K41 A;  4CZE A;  1YIJ N;  4JK9 A;  2W40 A;  4MLH A;  1NGH A;  4BQL A;  4C1N K;  2NRW A;  3P4I A;  2FSK A;  3N4Q A;  3O9T A;  4FL9 A;  4GNI A;  5AQN A;  3RSE B;  4YOU A;  3CC4 N;  4WFN L;  4NO7 A;  3C0B A;  1NLV A;  2HF3 A;  2ZGY A;  3GL1 A;  3O1W A;  3O9R A;  1KAY A;  4K43 A;  3O5B A;  4DB3 A;  1Q18 A;  3J7Z O;  1S72 N;  1QVG M;  4CD1 A;  3QML A;  4H5T A;  4CZL A;  2AA4 A;  5AQH A;  5M1N A;  1X3M A;  5HL7 L;  5AQF A;  3SAH A;  1TUY A;  3H6E A;  4RWT A;  1NGE A;  5AZI A;  1Z05 A;  1NGG A;  5BRH A;  5M1K A;  4C23 A;  1VQ7 N;  5BPM A;  5LJW A;  1YHQ N;  3DXK A;  1W2B M;  3HI0 A;  3BP8 A;  4WQ5 A;  1Q7Y O;  3O1B A;  5AQP A;  4AM6 A;  2A41 A;  3T69 A;  5AQK A;  5JIC A;  5BRF A;  4OPA A;  1U6Z A;  2D1K A;  4JKF A;  3CCL N;  4H0O A;  3K9J A;  3KK7 A;  4BR0 A;  3ENO A;  4ISG A;  4E1J A;  1U2V A;  3P31 A;  3GE1 A;  3HSC A;  4O8K A;  4H5W A;  4IO8 A;  4B1X B;  1YXQ A;  1T6D A;  1YF5 L;  3N4P A;  5F2R A;  4YOV A;  1HKC A;  2IVP A;  4HTL A;  4XEI A;  4AF1 A;  1NGI A;  4IWV A;  3G4S N;  4K42 A;  3MN9 A;  3GG4 A;  4R79 A;  4G9Z A;  3D6R A;  3O9Q A;  3H1Q A;  3F2K A;  4KH5 A;  5AZJ B;  2JWK A;  1VQL N;  1RFQ A;  3O6W A;  4GY2 B;  2W41 A;  4WYB A;  3NMU A;  5BN9 A;  5M1O A;  1JCE A;  2QWL A;  1YJN N;  5KQ8 A;  4EHU A;  2V7Z A;  1C0F A;  4HWI A;  5AFU A;  3SK3 A;  5BRD A;  2QWR A;  3VEV A;  5DM6 L;  3PIO L;  1VQ5 N;  3D2E B;  4CZH A;  2CGK A;  4PKH A;  3DLL L;  2QXL A;  1N8R O;  4NLC A;  1TYQ A;  1SZ2 A;  2HF4 A;  3IFR A;  2OAN A;  4U7B A;  1JCG A;  3G71 N;  2ASO A;  1ZXO A;  2QWQ A;  4JD2 A;  4K25 A;  3DXM A;  2QWM A;  4WQ4 A;  2A3Z A;  5GAE P;  1XQS C;  4JKG B;  3SAF A;  3SMS A;  2NLX A;  3TU5 A;  4BRO A;  2PAV A;  2ZJP L;  1KC8 O;  3EN9 A;  2C1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...