3CIPA

Complex of dictyostelium discoideum actin with gelsolin
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
371
structure length
362
Chain Sequence
VQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTKDSYVGDEAQSKRGILTLKYPIEGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major actin
publication title Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 122
structure length 362
sequence length 371
ec nomenclature
pdb deposition date 2008-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cipA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cipA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3cipA03
3CJCA 1R59O 3CJ9A 2CH6A 2IIRA 2P9SA 1U6ZA 3QB0A 4FPBA 1GLBG 3LDLA 4H0XB 3WXLA 1MWKA 4BG8A 3O4WA 3P4IA 3GBTA 4FO0A 3LM2A 4CZGA 2E2QA 1YXQA 5AQMA 2IVPA 4BR9A 4JD2A 4WQ4C 2FXUA 4BRHA 5AQJA 4J8FA 1NGAA 3ZETB 3VENA 5I9EB 2P9UB 3L0QA 3O5BA 1LOTB 5BREA 1ESVA 1C0FA 1K8KA 3ZEUA 4BC3A 4PKGA 4H0VB 4DB3A 2HOEA 1MA9B 5ADXH 4BRPA 1YUWA 3VOVA 2NLXA 2P9PB 2QWMA 3EKSA 1J6ZA 3FZKA 3QBXA 4QS8A 4CD1A 5BPMA 3CI5A 1HPMA 2HF3A 1CZAN 2P9SB 4FWMA 4BC2A 3SMPA 1ATRA 3MK6A 2GUPA 1HX1A 1Y64A 3ZX0A 2CGLA 2E8AA 2F9TA 4FPAA 3EL2A 1RDWX 3FZLA 4RTFD 4CBUA 4XH5A 3WXJA 1BO5O 4JD2B 3WQTA 1JCEA 1NLVA 5KQ8A 3ID8A 2ZGZA 5AQUA 5AZJA 3LDPA 4PL8A 4Y0WA 1IG8A 4QS9A 4E1JA 4CD3A 3VF4A 5BN8A 3GL1A 1K8KB 3W3DA 1QZ6A 4B1YB 4YDUA 3EO3A 2QWOA 4BREA 1HJOA 5JLHA 4PL7A 3LDQA 4AM7A 1P8ZA 1ZXOA 4FSVA 4ISGA 1ZC6A 4ISEA 4XEIA 4EFHA 4BR5A 3J8AA 3I8BA 3MN5A 4BR2A 2FF3B 1E4FT 1IJJA 4BRLA 1T6DA 3L4IA 2E2PA 3A5MC 4WQ5C 4PKIA 1WUAA 5AQWA 2A5XA 3EZWA 4GY2B 5AFUH 5AQXA 4BQZA 2ASPA 1QQMA 5AZJB 2ZWHA 4H0PA 4IWVA 4BRQA 4BRGA 3VEWA 3IMXA 2J4RA 3O1WA 3HTVA 4PKHA 2PAVA 1JCGA 3QMLA 2FLOA 5BN9A 5AQFA 2VWBA 4HWIA 2AP1A 3H3OB 3MN7A 2PBDA 4FWKA 1BU6O 1WOQA 1X9JA 1NGIA 2QXLA 3A5OC 3BP8A 3WXIA 1BUPA 2OANA 1ZBSA 4H5WA 3R9PA 3S41A 3VGKA 3O8MA 1ATNA 3EKUA 2E1YA 1BA0A 4F9OA 2P9KA 4B9QA 3DAWA 3FZHA 3D7EO 3H3NO 3ZETA 1QQOA 3U9ZA 4BVOA 2Q97A 4K43A 1GLLO 3H46O 2D1KA 5KPZA 3QFUA 2CGKA 2ITMA 4H03B 4B1XB 1QZ5A 1GLDG 3CQXA 3HSCA 4BRDA 3BUZB 2FSNA 4BRIA 3VEOA 4M7YA 4RWTA 1NGGA 1NGCA 2KHOA 1RGIA 3GOIA 4IO8A 3BF1A 2DPNA 1H1VA 5AQZA 2BUPA 4BRMA 5AQKA 1EQYA 1KAZA 3VERA 1DEJA 1SZ2A 4JN4A 4XH4A 3M1FA 5ELZA 2HF4A 2YHXA 3HZ6A 3BF3A 1U2VB 4K41A 4DHYA 3CHWA 3R6MA 4NB4A 4FL9A 4AM6A 2I7PA 5AR0A 4CBXA 2P9KB 3A5NC 1X3MA 3QBWA 4QS7A 3DXMA 1G99A 2FSJA 3UE5A 4CZEA 3VETA 2YJEA 2IVNA 4H0OA 1ATSA 2BTFA 4H5RA 4BGAA 4FOIA 4IXCA 5E84A 3A0IX 2YJFA 1GLCG 4FWNA 4BRFA 3W0LA 5AQVA 3D2EB 2E2NA 4CI6A 1OKJA 3VEVA 4MO4A 1BDGA 5BRFA 4FWQA 1NGFA 1BOTO 4O5FA 1X3NA 3I33A 5AQQA 4EIAA 5ADXA 2CH5A 1TYQA 4YDUC 4GNIA 3KVGA 1C0GA 2V51B 2QWRA 4Z94A 3TPQA 3DXMB 2CGJA 4K25A 4M7XA 4BC5A 3LDNA 1S3XA 3FZMA 4EHTA 3F9MA 3C7NA 3WEEA 1YAGA 5F0XA 3O08A 5EVZA 2V7ZA 2P9IA 5F2RA 4MLEA 5KQDA 3VEZA 4RCHA 1TUUA 3UKRA 4L3QA 3DJCA 4BRNA 4O8KA 2P9LB 3HBTA 4H0TB 1MDUB 3KZBA 2E88A 4BGBA 5JICA 2E2OA 5EOYA 2GTDA 5AQGA 3SMSA 5AQSA 3UKUA 1E4GT 1TYQB 2QWQA 3AAPA 1YVNA 1XUPO 3JXUA 3O6WA 3AARA 3IFRA 4FWRA 2ZF5O 2A40A 4CZMA 2Q36A 3SK3A 4BG9A 5BPLA 2IVOA 1GLJO 1NMDA 1BG3A 3C7NB 3L6QA 3WEEB 3LDOA 1U2VA 5B8HA 3A8YA 2GEMA 2P9IB 2I7NA 5AQRA 3VF2A 2ASOA 5AFUA 3ATUA 3UKRB 2P9NA 4CJ7A 4BVPA 1D4XA 3O80A 3U9DA 3B8AX 2Q0UA 2A6AA 3AY9A 1NGDA 2H3GX 4M63C 2GWKA 2A42A 5BRHA 2EWSA 4CZJA 3UB5A 3UKUB 3ULEA 2NRHA 4LC9B 3ZX2A 1Z05A 1V4SA 4JNEA 3FE1A 4MLHA 3ENHA 4KBOA 4BQLA 1S22A 3FFKB 3RSEB 1QHAA 4H5TA 2VYPA 3D2EA 3D2FA 5AQIA 5JMVA 5AQNA 2VCPA 5FPNA 4K42A 3HI0A 4IJNA 4MO5A 3JS6A 3CJ7A 3CJAA 3CJBA 1NM1A 4FOEA 1JCFA 2QWNA 3ZX3A 3H6EA 2P9NB 2Q31A 4EHUA 2E20A 3VPZA 5AZIA 5BRDA 1GLFO 4JHDA 1KAYA 5AQTA 2F9WA 3EN9A 4CZLA 1HKGA 4CZFA 4IZ9A 2W40A 3ULEB 3DXKA 1NWKA 2YHYA 5EX5A 4B1UB 5FPDA 3HM8A 4H0YB 3MN9A 1Q18A 1XC3A 4A2BA 5LJVA 3D2FB 3SLCA 3QICA 4DCHA 1XQSC 2GWJA 4WQ4A 2P9LA 1RFQA 3G25A 4A2AA 4BC4A 2QWLA 2YHWA 2Q0RA 4IJAA 4XH1A 4B1WB 2W41A 3CQYA 3VEYA 1TUYA 4JAXA 3VGLA 4BRCA 5AZIB 4CZIA 1HKCA 1HLUA 3OHRA 1DGKN 3MCPA 3GDQA 4FWLA 4HTLA 4JHDB 5F1XA 5AQPA 4I6MA 5LJWA 3CERA 2UYTA 4CZKA 3DXKB 2WUSA 3KHYA 1NGHA 1HKBA 3TU5A 1BA1A 4FWSA 1NGJA 2V52B 4A62A 2Q1NA 3U4LA 1NGBA 4EAHD 3MMVA 4A61A 5KPTA 3ATVA 4BR0A 1SAZA 5JLFA 2YI1A 1HUXA 1T44A 3LM9A 2D0OA 5BR9A 1KXPA 3FGUA 3M3ZA 3O1BA 1T6CA 3MN6A 3ZEUB 4NO7A 4CZHA 2QM1A 2QW9A 3H1QA 5E26A 5AQOA 3GE1A 3VF6A 3QFPA 5AQHA 3WXKA 3LL3A 2Q2RA 2A41A 2AA4A 2D4WA 3VEXA 3SJHA 3RSEA 4I6MB 5TKYA 3FZFA 3WUHA 3MDQA 4FWOA 4H5NA 2FF6A 3DWLA 5AQLA 5FPMA 4B1VA 4DQ8A 3CJ1A 3CIPA 5EXWA 1NBWA 4WQ5A 1KAXA 2GELA 3IUCA 5CE3A 3VESA 2V7YA 3IDHA 4BR4A 4BR7A 2NZTA 3A5LC 2A3ZA 2FSKA 3AAQA 5KPRA 1DKGD 2QWPA 5LY3A 1GLAG 3U8XA 4BRKA 3ENOA 2ASMA 3QDKA 4CBWA 5BPNA 4C23A 1BWFO 4BRAA 4ISFA 5EY4A 4H5VA 4BROA 3GG4A 3WQUA 1MWMA 3M6GA 5AQYA 2ZGYA 1V4TA 2YCHA 2E1ZA 3C0BA 2P9UA 1NGEA 3WT0A 1QQNA 3R8EA 4B1ZA 1GLEG 4WYBA 3BEXA 1LCUA 5FPEA 2D0PA 3CETA 3VGMA 1Z6RA 1SQKA 3FR0A 3H1VX 2HMPA 3H45C 4FWPA 3FLCO 2P9PA
chains in the Genus database with same CATH superfamily
3CJ9A 4ILJA 3J80O 1U45A 5C10A 2P9SA 1U6ZA 4FPBA 4DUZK 1ZBHA 1W9HA 4H0XB 3WXLA 4LF6K 2ITGA 3WXMB 2DFFA 4FO0A 3E1YA 3LM2A 4CZGA 2IC3A 2YNIA 4OLBA 4BR9A 4JD2A 3F73A 2FXUA 4KREA 1ZBLA 1RTIA 1RT1A 2Z1HA 1NGAA 4E7KA 2P9UB 4I2PA 4DB3A 4FK4A 4YOUA 1YUWA 3PSFA 2G8HA 3NVKA 2B4JA 3CI5A 3TARA 3OYMA 4BC2A 1VQ4N 3JAMO 1VQMN 1RDWX 4RTFD 4OX9K 4W5RA 1JLFA 1JCEA 1NLVA 2YV0X 4DSFA 3BGRA 5KQ8A 1FKPA 2IGIA 3ID8A 5AQUA 4Y0WA 1IG8A 4M42A 2A1SA 4I2QA 5J1EA 4CD3A 3LAKA 4DTJA 4DV7K 5MLCQ 1N5YA 1VQLN 3AVGA 1K8KB 4CHPA 3ITHA 4BREA 3WNGA 1HJOA 3LDQA 4AM7A 4DLGA 1ZXOA 4ISGA 4CF8A 4M3UA 3G71N 1ZC6A 1HQEA 3OS2A 1YJWN 2OTJN 1TKDA 3I8BA 4BR2A 3ZSXA 4RW8A 1C0MA 1E4FT 3SAHA 3PLAA 4KFBA 3AA5X 1J5EK 5C0YA 1C6VA 5BR8K 3I8DA 4PKIA 4AHRA 3AVKA 2DTUA 1SUQA 1QQMA 4LF9K 2ZWHA 4H0PA 4CEZA 1S5JA 4KHYA 1EXQA 1T8EA 4PKHA 1KLMA 3VQAA 1JKHA 5J2MA 2PAVA 1QE1A 2FLOA 1VQ6N 4CEEA 3H3OB 3AVBA 2Z1IA 3WXIA 4CF9A 1NGIA 4CF2A 3A5OC 4RW9A 1TV6A 3U6FA 4H8KA 3K59A 3T19A 3VTIA 1ATNA 2O4GA 3EKUA 1BA0A 4IFYA 4BE2A 2P9KA 2XHBA 3DAWA 5H1SQ 3L8BA 1VQKN 3D7EO 2VQFK 3H3NO 3KIOA 4FLYA 3U9ZA 4W5QA 3LP1A 3H46O 4IOAL 5KPZA 2ITMA 4H03B 1XC9A 3HSCA 4DQSA 3ZSRA 1CXQA 3QEIA 4M7YA 4MFBA 1XWLA 1U49A 3BF1A 2WTUA 5AQZA 3OYHA 1NJXA 2WFBA 5AQKA 1EQYA 1DEJA 1A5VA 3M1FA 1IBMK 2YHXA 4CK3A 4NCBA 3CHWA 3SZ2A 4FL9A 3DLRA 2EX3A 1J53A 3E66A 3G10A 1YTUA 4CBXA 3AO5A 3ASMA 4LFBK 3TTDA 3SUPA 1G99A 2RE2A 3RWUA 3L3UA 3ULDA 1ASWA 2BTFA 2OZSA 3LZJA 4H5RA 1S1XA 3K2PA 4FOIA 5E84A 1ASVA 3A0IX 3SCXA 1Q86O 4BRFA 3D2EB 1XNQK 1BI4B 4MO4A 4JEPA 4U7BA 1BDGA 3EY1A 4O5FA 1WSJA 1WBDA 4B9SA 1ZBIA 1JLEA 4X66K 1X3NA 3I33A 5AQQA 1VQ8N 4CGHA 2XY7A 4CW7B 2QWRA 4Z94A 3QEXA 5C42A 1VSFA 1XMOK 1VQ7N 1B92A 5CZ1A 4CK1A 1NK7A 3DLGA 3FZMA 4Z4HA 4FZYA 4JK7A 3C7NA 3AA2A 4C1NI 4DU4A 5F0XA 1VK0A 4B8AB 4KTWA 4EP4A 4YOVA 4LD0A 3NVMA 4RCHA 3CCEN 4NLCA 3DJCA 4BRNA 3KLHA 3ALYA 1GOCA 2P9LB 4H0TB 1Q9XA 3M8SA 3KZBA 4OGCA 2NRWA 1QTMA 1EX4A 2YNFA 3UKUA 4F2SA 3V9XA 1Q7YO 4BY9C 3P39A 5JVGL 2HNDA 1KLNA 1LW2A 3AARA 3E9PA 1U47A 5BPLA 3DRPA 3OYLA 2IVOA 1NMDA 2E6LA 4PUOA 3ZT4A 3DLHA 3EEQA 2GEMA 3ZT3A 3TWHA 2I7NA 2OYQA 5IT9O 3AO4A 1IO2A 1Z25A 3LP0A 1TK0A 1YJNN 4C8NA 3BY5A 4BVPA 4DS4A 1EWQA 2Q0UA 2VWJA 2A6AA 3AY9A 2A42A 2YNHA 3UB5A 2Y1IA 2HVHA 1QVFM 3FE1A 4YOXA 3HL8A 3ENHA 3AVFA 1S22A 3FFKB 5SZTA 3RMDA 4GKKK 3NCIA 3D2EA 1N36K 3H08A 4O4GA 1FJGK 1NG9A 2UU9K 4IJNA 3OYGA 4FOEA 3NDKA 2QWNA 4GV6A 1GOBA 1QS4A 3VQ6A 5BRDA 3QO9A 2D0AA 3KK7A 1RDBA 4JKAA 2OPQA 2F9WA 5CR4A 3EN9A 4CZFA 4DSKA 3DXKA 5KRSA 1NWKA 1W7AA 4OKKA 1VQPN 4B9LA 1VSMA 4FZXC 3TAFA 3RRGA 1WAFA 4A2BA 1HYVA 5LJVA 4DCHA 4DR3K 4CECA 1XQSC 3OS0A 2P9LA 4FXDA 1KRPA 2QWLA 2YHWA 4R5PA 1A5WA 1LAVA 2W41A 3VGLA 3KLFA 4KI4A 3CD6N 4FJ5A 3NGZA 4KV8A 3PV8A 1DGKN 3MCPA 3GDQA 2OTLN 3OVNA 3C6UA 4JHDB 4YOTA 5LJWA 4CZKA 3CM6A 3AVAA 1K8AO 1NGJA 2GBZA 4CEFA 4CESA 3SBTA 3MMVA 3LDSA 3ATVA 3S9HA 1VSHA 1OH7A 4E7HA 5KI6A 4FJMA 5JLFA 2UXDK 2BDPA 1HUXA 1RBRA 1J54A 4O55A 3M3ZA 3CCVN 4JI8K 1T6CA 2XY5A 1WLJA 4H4OA 1NMNA 4NO7A 3AA3A 2QM1A 3L2RA 3NMUA 1BIZA 3QFPA 5M1NA 3WXKA 3PIOL 1HJRA 3HOSA 2Q2RA 4EZ9A 3CFOA 2A41A 2AA4A 4F2RA 3VEXA 3SJHA 4M3WA 1A5XA 4FJXA 4KRFA 4FWOA 4B1VA 3CJ1A 3ZYYX 4CGIA 1X9MA 5FRMA 3V6DA 2E5LK 3L2VA 3QETA 4WQ5A 3ZT2A 3O3GA 2F7TA 2NZTA 3AVIA 4DV2K 2A3ZA 1RDUA 4ILHA 5KPRA 4YFUA 3O3FA 5HRSA 3SV3A 1T05A 2RN2A 3L3VA 5LY3A 1GLAG 2VG6A 2D0BA 4OPKA 2ZQBA 3CC7N 2VG7A 2ASMA 2IS3A 4LF4K 3THWB 4BRAA 4LFAK 1RBSA 2VGNA 4ELUA 1VSJA 3S5TA 1OH6A 3V4IA 3TSUA 1NGEA 2HNZA 3WT0A 5GAEP 3LAMA 3BEXA 1LCUA 3CETA 2W42A 1Z6RA 4JS4A 2KZZA 4JKCA 2P9PA 3CJCA 4FJJA 3OJUA 1NNEA 2IIRA 1C0TA 4CHYA 1GLBG 1D5AA 3LDLA 3SQ4A 3P4IA 4FJKA 3OY9A 4MDBA 4DSIA 3GBTA 4IEIA 4OKJA 2P1JA 4FJHA 4DS5A 1YXQA 3TTFA 2IVPA 3VQ5A 2Z1GA 1DT9A 4WQ4C 5GAGP 2D0CA 3NBPA 5AQJA 3VTHA 3SAFA 3G6EN 4N41A 3VENA 1LOTB 2P5OA 3E01A 4BC3A 4PKGA 4DWIA 2HOEA 4B9MA 4JS5A 2OA8A 3LP3A 4OPHA 2FBYA 3HVTA 3VOVA 4I9QA 1WNSA 3SI6A 1J6ZA 4AILC 3QBXA 4QCLA 3AA4A 2P9SB 4FWMA 3OS1A 3IRXA 4LY7A 4KAZA 1ATRA 5I3UA 1Y64A 3ZX0A 2CGLA 1CLQA 5JS2A 3JSMA 4FW2A 4XH5A 3IG1A 4DUYK 4JD2B 3WQTA 1YT3A 4IG3A 2KFZA 3AV9A 1BISA 3AGKA 3VF4A 5HLFA 3T3FA 4CGDA 4YDUA 4PL7A 3PX4A 3HPOA 3THWA 4ISEA 3T1AA 1VRUA 4N5SA 3J8AA 2KW4A 2FF3B 3F2KA 4CJQA 4IO9L 3S3OA 4DF4A 4PWDA 1T6DA 3AVCA 1ILYA 4KTQA 5DM6L 3QEPA 4M3XA 3HPGA 2C1GA 1QSLA 4PQUA 5AQWA 3DRRA 4FM1A 1NJIO 5AQXA 4BQZA 2NRZA 4DQQA 4BECA 3ZSZA 4OJRA 2IDOA 3T69A 3MECA 3HTVA 1K73O 4IEEA 4BDZA 4JKFA 5AQFA 2VWBA 4BEBA 3RR7A 1BU6O 2QXLA 1X9JA 3BP8A 1BUPA 4GVMA 1ZBSA 5FLXO 1XI1A 2JWLA 3O4QA 2IAJA 4KH6A 1P90A 4KO0A 4KHSA 4FLZA 1GLLO 3ZLJA 4WF9L 3CQ8A 4BE0A 1KVBA 5JVHL 4BRDA 1GLDG 3CQXA 1TKZA 1NGGA 2F8SA 1RGIA 3GOIA 1I94K 1DLOA 2W6LA 2ZJRL 1SZ2A 1IV0A 1T3VA 4A5BA 2HF4A 3OYJA 4K41A 2DY4A 4R79A 1IKVA 1EO1A 2HW3A 1WSIA 3ENBA 4B9UA 4NB4A 4AM6A 3KWGA 2WOMA 2I7PA 1TL3A 4HHTA 3TTCA 2P9KB 4DSLA 4Y1DA 4GW6A 4IFVA 3MWTA 4QS7A 4K0KK 1JJ2M 4CZEA 3MX5A 5M1KA 2YJEA 2DFEA 4H0OA 2QKKA 3T1HK 3S3NA 1NK9A 3PIPL 3ZCMA 4O8UA 3E9OA 4HVJA 4FLVA 4CJWA 4IXCA 4E7IA 3O9SA 2HHUA 3C6AA 3EYZA 2UUBK 3W0LA 5AQVA 1OKJA 4Y1CA 5M1PA 5BRFA 4CGFA 4FJGA 4F8RA 4YOWA 4I7FA 1TGOA 4EIAA 5ADXA 5I42A 2CH5A 1TYQA 2NRRA 1C0GA 1UAXA 2V51B 4H4MA 4WCEL 4K25A 3MX2A 4FVUA 3LDNA 5IWAK 5E41A 2HVIA 4JK9A 3I56N 3KLEA 1JXBA 3SPYA 3WEEA 1VSIA 2B5JA 5F2RA 4MLEA 4DTNA 4DR4K 3VEZA 4CEOA 2X74A 1LWCA 4G1QA 4ZTJA 3KD5E 4O8KA 1MDUB 4MDAA 2E2OA 4HUEA 2GTDA 3SMSA 3OYEA 3OW2M 3R1XA 3O6WA 1KCFA 2OZMA 4W5NA 2Q36A 3SK3A 4CJSA 1HQUA 1GLJO 1RCHA 3LALA 3C7NB 4X64K 1NOYA 4DFPA 4KI6A 3LDOA 1VQ5N 4DV1K 5KGWA 3VF2A 5AFUA 1VSDA 5JENA 2UUCK 3SJJA 2DFHA 4JKEA 3L2WA 4DR7K 4GMJB 2GWKA 5BRHA 4DTPA 3ZSOA 4JRQA 3UKUB 4DTMA 3ULEA 1QSSA 1Z05A 2QTDA 4JYAK 4CJRA 2OPPA 2O8FA 3AO3A 2PYJA 1DTQA 4O44A 2I5JA 1RTHA 4AF1A 4V19S 3D2FA 4HUGA 2VCPA 3NH2A 1L5UA 1N8RO 3HI0A 4MO5A 1J9AA 3C94A 3OYFA 3SYZA 3H6EA 3DM2A 2Q31A 5A2QO 4EHUA 1HYZA 5AZIA 2RF2A 4NCGA 5JS1A 4BWJA 4JI1K 3QEVA 3NHGA 5AQTA 1YHQN 3TANA 4CZLA 4JKDA 4ZTFA 1OH5A 4IZ9A 1TK5A 4RG8A 2YHYA 1YIJN 3M8PA 3AVJA 4OO1J 1WSEA 3HM8A 4CJPA 3RVCA 4E0DA 1D9FA 2IOCA 4BC4A 4IJAA 4FK2A 3HOTA 3CQYA 3HVRA 1TUYA 4JAXA 1U48A 4FVMA 1OH8A 3CPWM 1K6YA 1HLUA 3M5RA 3KK1A 1X9SA 4HTLA 3CERA 2UYTA 4CIGA 3DXKB 4ELVA 2WUSA 3P38A 3TU5A 4CJ4A 2V52B 4A62A 3U4LA 1NGBA 4YY3K 4BR0A 3CM5A 4DR5K 1KC8O 2YI1A 1NK4A 1JLAA 2D0OA 2FC0A 4Z0UA 3ZSVA 2QEXN 3NF8A 4CZHA 3H1QA 3GE1A 4KB0A 4DSEA 3PX0A 4C1NK 3G0ZA 3SQ0A 1HMVA 3SUOA 4EP5A 2RHKA 3KLIA 2Y1JA 5TKYA 3IAYA 3WUHA 4DKWA 4H5NA 3QNOA 4M3ZA 2LSNA 4LF8K 4CGJA 1CZ9A 3K5MA 3K58A 2GELA 3IUCA 3VESA 3IDHA 1EETA 4DTUA 3AAQA 3AVLA 4KPYA 1DKGD 4KH4A 1WSFA 4CJVA 3TAMA 3U8XA 3CF5L 3TAPA 3P1GA 1WSHA 1HYSA 2F96A 3ENOA 3Q7CA 3QDKA 4CBWA 3B6PA 3KWIA 1BWFO 2PY5A 4WE1A 4DLEA 1TL1A 3GG4A 2BGGA 1V4TA 3DLLL 2E1ZA 3LANA 3CPEA 3R8EA 3DI6A 1GLEG 4WYBA 3NFAA 1VSEA 2GV9A 3A2FA 3VGMA 1SQKA 3FR0A 4CIEA 4CIFA 1NKCA 2HBKA 3CCLN 1R59O 4B9NA 2CH6A 3SNNA 1NKBA 1TKXA 1ZYQA 3NH0A 1WBBA 1MWKA 4BG8A 5C12A 3VQCA 1SV5A 2D5RA 3PO5A 2W00A 5AQMA 1TKTA 1VSLA 3HM9A 2WONA 4OLAA 4J8FA 1T03A 4B3MK 3ZETB 3J7YP 1IKXA 5I9EB 3L0QA 3EE9A 4JI7K 4FJ8A 4O5BA 4H0VB 4W5TA 2YNGA 1MA9B 4BRPA 3HXMA 2NLXA 2P9PB 4EZ6A 1KVCA 4QS8A 4CD1A 5BPMA 5HROA 1HPMA 1CZAN 4FJ7A 4N76A 3TI0A 3MK6A 2GUPA 1HX1A 2F9TA 3AVHA 3EL2A 4FPAA 4CF1A 3J7ZO 3OYKA 4B8CA 3WXJA 4DTXA 1BO5O 2ZE2A 3CCJN 1VHXA 4B3RK 1W97L 3VQPA 1UA1A 4FM0A 5AZJA 4PL8A 4YHHK 4WFBL 1HNIA 3I55N 4CJ5A 3GL1A 1IKYA 1HPZA 4DFMA 3W3DA 4E1NA 4B1YB 5HRPA 1RDCA 5J2QA 3EO3A 3CMAN 2QWOA 4M3RA 4B08A 1KD1O 1BL3A 2ZJPL 3PY8A 1P8ZA 3O9UA 4AHUA 5M1FA 3D0PA 1YJ9N 5KTQA 3AO1A 4EFHA 4BR5A 5HRNA 5GINA 3MN5A 4YORA 4DTSA 2G8IA 1IJJA 2G8KA 4B3SK 3L4IA 4IBNA 4WQ5C 3A5MC 1O13A 5C24A 4CEQA 4CJ3A 3RR8A 3THYA 1C1BA 3LZIA 4DQRA 4J2BA 3EZWA 4GY2B 2ASPA 4X65K 1C1AA 3S3MA 1RTDA 4IWVA 4BRQA 3M8RA 4BE7B 2J4RA 3KK2A 3UIQA 1REVA 3O1WA 4ID5A 1RT4A 1JCGA 2VWKA 3QMLA 5BN9A 3WNHA 4Q0BA 4A57A 4FWKA 2PZSA 1NJWA 5CZ2A 3L2QA 4A5AA 2FBXA 4H5WA 3R9PA 3O4NA 4IG0A 3S41A 1IBKK 3O8MA 4NYNA 4C8KA 2O8BB 1SL1A 4DQPA 5CHIA 4B9QA 3FZHA 4ELTA 2JLEA 3ZETA 3OYNA 1EKEA 1QQOA 2D1KA 4UY8O 1QSYA 2CGKA 1R0AA 4J2EA 4B1XB 1QZ5A 1JL2A 1ASUA 3BUZB 2C1IA 2GX9A 4RWTA 3IS9A 1KVAA 4DV6K 3SUQA 5HBMA 3C65A 4X62K 3K0SA 1RT3A 2E4LA 2BUPA 4BRMA 1F21A 4E19A 2XRIA 3M8QA 5C2FA 4K8XA 1RT6A 3BF3A 1U2VB 3OA9A 3U3GA 4DHYA 3MEEA 3VQ8A 1W0HA 3IKMA 1LW0A 5GAHP 5AR0A 2O8DA 4JI3K 3A5NC 3MEDA 3C6TA 3DXMA 5LMNK 2FSJA 4C8OA 3VETA 4JKHA 4GKJK 3P31A 4IFEA 2HHWA 1ATSA 4KTZA 3KTQA 4KB1A 3OYDA 4JV5K 3NGIA 3ID6A 4G9ZA 4ILGB 2KKZA 2E2NA 5LL6Z 3MCAB 3O9QA 1IBLK 1O1WA 5LMUK 3HSTB 1BOTO 4OVLA 4CVNE 3K5LA 3QIOA 3SPZA 1DTTA 3V9SA 3V9WA 1N33K 4YDUC 3KVGA 3OYCA 3VQEA 3F5TA 3KKSA 1LWFA 3ZT0A 1VSKA 3CCRN 1S3XA 4PA1A 3V1OA 4EHTA 1RTJA 2X78A 2UUAK 4CCHA 4DR6K 3O08A 5EVZA 4JI0K 4XJXA 2V7ZA 2P9IA 1U04A 1L3VA 2O8BA 3UKRA 1N32K 2ZD1A 4BGBA 1N34K 3LWMA 4CJTA 4AHVA 5EOYA 2RPIA 5AQGA 3ISNC 3CCMN 1NJZA 3MWPA 4NLBA 1TYQB 2QWQA 3AAPA 1YVNA 4IDKA 1XUPO 1M1KO 3JXUA 4ICLA 2YHBA 3IFRA 4FWRA 4ZHRA 2ZF5O 4Z4EA 4FLXA 3TABA 3T7ZA 3WEEB 2G8VA 3VMFB 1U2VA 3CCUN 1TAUA 4KHQA 2NRVA 5AQRA 5D3GA 4OPAA 2F4VK 4NXMK 3ATUA 2B6AA 2P9NA 1D4XA 3O80A 3RTVA 1I39A 4JLHA 1NGDA 2H3GX 3TAGA 1S6PA 4CZJA 1QHTA 4AQYK 1RILA 2NRHA 4LC9B 2X6SA 3QNNA 4DU1A 4JNEA 4MLHA 5K14A 2KLAA 3OYIA 1QHAA 1RBTA 4CHNA 4Z4GA 4CERA 5AQIA 4C8LA 3J7AP 5CYMA 3JYTA 4J2AA 1RNHA 3THXB 1K9MO 4Q5VA 4E7LA 1RT2A 4K42A 5CYQA 2JGUA 4J2DA 3O9RA 3JS6A 4GV9A 3C6HA 3CJBA 1JCFA 4CFAA 3KJVA 3ZX3A 3EZ5A 3HPHA 2E20A 4RW4A 3DYAA 3OTOK 2ATQA 1KAYA 3CCQN 1NJYA 3K57A 2W40A 3ULEB 4FJLA 3HT3A 2O8FB 3HRGA 3MN9A 1NK5A 1IH7A 1XC3A 2E6MA 3N4PA 4FM2A 3CMEN 4WFNL 1XMQK 3D2FB 3QICA 2QKBA 3THVA 2HHVA 1RBVA 2NNWA 4AHSA 5DM7L 2Q0RA 4KKOA 4B1WB 3V9UA 2O8CA 1L3TA 3BDPA 4BRCA 5AZIB 4BDPA 1HKCA 4FWLA 5DK5A 5M1QA 3G4SN 1BCOA 5F1XA 5AQPA 4N56A 3CFRA 4I6MA 3C95A 5KGXA 4C8MA 2PYLA 1BA1A 4FCYA 4FWSA 1SKRA 2Q1NA 1WN7A 3AVNA 4EAHD 4A61A 5KPTA 2QK9A 4JI4K 2HB5A 3L4QA 1T44A 3TSPA 3DRSA 1KXPA 3FGUA 2KTQA 3MN6A 3ZEUB 3CYMA 4CGGA 2QA4N 4CJFA 4QOZB 1NU0A 2EHGA 5E26A 1KFDA 3VF6A 1LV5A 3CG7A 5AQHA 4E72A 3LL3A 4MQ3A 4DSJA 2VG5A 5J2PA 3V1RA 1WAJA 3D45A 3QESA 2HMIA 3VQ4A 3RMCA 1TVRA 3DWLA 1CZBA 2BH1A 2ZM6K 5EXWA 1FKOA 3THXA 4B9TA 1S6QA 5AJ3K 1NBWA 1KAXA 5CE3A 2V7YA 4Z4FA 3NGYA 1IKWA 4BR4A 4BR7A 3A5LC 4AHCA 4K8ZA 2FSKA 1LAWA 1VQNN 1IG9A 2GUIA 3O9TA 3SQ2A 2G8WA 2O8EB 3VQ9A 4CHZA 1S1UA 5HL7L 3P5JA 3PUFA 4UQGA 4C23A 1JLCA 4OKEA 5EY4A 3MEGA 4BROA 1FK9A 4CE9A 2OCEA 1JL1A 3DOKA 5AQYA 1S9GA 1C1CA 4DTRA 4B3TK 3C0BA 4HCBA 2KQ2A 5C15A 1TAQA 2P9UA 1QQNA 4B1ZA 4B3OA 5FPEA 2D0PA 3RMBA 3R3LA 3H1VX 2HMPA 3H45C 3QLHA 4FWPA 3FLCO 4DV0K 4JKGB 3HJFA 4DV3K 3WNFA 2OPSA 2BE2A 3QB0A 4W5OA 1T7PA 3LWLA 3O4WA 1LWEA 3I0SA 4IOCL 3I0RA 2E2QA 4CJKA 4GV3A 3CYGA 1S1TA 4E89A 4BRHA 1S72N 4NYFA 4FK0A 4LF7K 4F4KA 5EU7A 4KHUA 5BREA 3O5BA 1ESVA 1C0FA 1HRHA 1K8KA 3DOLA 3TAEA 3ZEUA 4FZZA 2Z1JA 4FLWA 2HHIA 4OGEA 4WFAL 5ADXH 3HP6A 3ZSQA 2QWMA 3EKSA 1S1VA 3FZKA 4N47A 3HO1A 1C0UA 1WB9A 4HUFA 2HF3A 1L3SA 3SMPA 3CC4N 2QI2A 4CEAA 1UA0A 2E8AA 3FZLA 4CBUA 2ZGZA 3LDPA 2NRXA 4QS9A 4E1JA 5BN8A 2O8EA 3J81O 4KHWA 1QZ6A 3VA0A 2YKMA 2HHXA 5JLHA 4QAGA 3NF7A 4FSVA 3CC2N 2UXCK 4Z4CA 2G8UA 4XEIA 1KFSA 1YI2N 1X1PA 4BRLA 4LF5K 1OVQA 2XY8A 1JLQA 2E2PA 3KKRA 4NCAA 1XHXA 2HBMA 1WUAA 3O3HA 1G15A 2A5XA 5AFUH 4CJLA 3WNEA 1JLGA 3VQQA 3Q7BA 4M41A 4FJNA 4CHQA 5AZJB 4BRGA 3VEWA 3IMXA 1SL0A 4JKGA 3HP9A 2BANA 2XY6A 2HBLA 1D8YA 4IKFA 3V81A 4HWIA 2AP1A 3MN7A 2PBDA 3AGRA 4KHNA 1WOQA 1E3MA 1Z26A 2NRTA 2PFUA 2OANA 3LPTA 1HNWK 4DR2K 2YX6A 5FDLA 3VGKA 2P51A 4LH5A 2E1YA 4F9OA 1XHZA 4JKBA 4CJEA 4YOYA 4RW6A 4BVOA 2Q3SA 3THYB 2Q97A 4K43A 4AHTA 3QFUA 1ZBFA 3NH1A 5J2NA 2YKNA 2HNYA 1CXUA 1ZBUA 2FSNA 4BRIA 3VEOA 1NK8A 4JRPA 1NGCA 2KHOA 3TR8A 3QIPA 4IO8A 4DF8A 4BWMA 3CCSN 2DPNA 1H1VA 1QQCA 3VERA 1KAZA 2WBNA 1BI4A 3MXMA 4JN4A 4XH4A 5ELZA 2KFNA 1YITN 1RDAA 1JLBA 3HZ6A 2W6KA 3R6MA 3ZT1A 4F3OA 1EWRA 3K5NA 5GIPA 4FJIA 1BHLA 4CHOA 3L2UA 1NK0A 1HNXK 1X3MA 3QBWA 4E3SA 1NKEA 2HHHK 3OYBA 3UE5A 1HNZK 3LPUA 2IVNA 1KSPA 3HK2A 1ITGA 4JI2K 1KTQA 4DG1A 4BGAA 3K5OA 4M3YA 1SKWA 2YJFA 1GLCG 4FWNA 4I9LA 4FYDA 3VN5A 4ID1A 4CI6A 4DMNA 4B9VA 3VEVA 3KLGA 4FWQA 3NF9A 1NGFA 3NF6A 3SV4A 3F9KA 4PHTX 4DV4K 2ETJA 1Q8IA 1EP4A 2OPRA 4GNIA 1XNRK 3PX6A 2O8DB 3U3YA 3TPQA 3DXMB 2CGJA 4M7XA 4BC5A 3OJSA 1J5OA 3F9MA 4IDHA 4Z4IA 1YAGA 2O4IA 3QINA 4E1MA 5KQDA 2P5GA 3HYFA 5GADP 1TUUA 3VQDA 4L3QA 2FBVA 1RDDA 3K9JA 1GOAA 4XIUA 3HBTA 2E88A 5JICA 5TKWA 1MU2A 2YHAA 3KD1E 4GVEA 5AQSA 1E4GT 2AJQA 1UOCA 4DTOA 4NXNK 3TSQA 3QEWA 5CY4A 5SWMA 2A40A 4CZMA 4BG9A 4O0IA 2KZMA 5T7BA 1VQON 1BG3A 1NK6A 4E7JA 1RBUA 3L6QA 3SUNA 5FROA 3OYAA 5B8HA 3A8YA 3SQ1A 1KQSM 3SBGA 1NOZA 2P9IB 2R7YA 1BCMA 2ASOA 1QVGM 4HTUA 5C2DA 3UKRB 3VQ7A 3T1YK 1D9DA 4CJ7A 4DR1K 1X9WA 1SS6A 2HHTA 3U9DA 3B8AX 4CEDA 4FLTA 3RMAA 4M63C 3RRHA 3P83D 2EWSA 4LH4A 1UWBA 4CFCA 3CXCM 3D6RA 4CFDA 3ZX2A 1YVUA 4BACA 4JK8A 5HP1A 3BZKA 1I3AA 4A59A 1V4SA 5HRRA 3AO2A 4KBOA 4BQLA 3E9LA 3RSEB 3DLEA 3QERA 1BQNA 1BIUA 4H5TA 2VYPA 1SKSA 3LP2A 5JMVA 1YF5L 1RT7A 5AQNA 1Q81O 4DV5K 5FPNA 5M1OA 4CFBA 3CJ7A 3CJAA 1NM1A 3ZSWA 4L8RB 2P9NB 2VQEK 3AVMA 3VPZA 4KH5A 3PO4A 2JWKA 1GLFO 4JHDA 4RW7A 1HKGA 4M45A 3ZSYA 5KRTA 5FRNA 1BQMA 3PSIA 2WC9A 2XO7A 1Y97A 4OPJA 1HNVA 5EX5A 2RKIA 1FXXA 4B1UB 5FPDA 3TAQA 3V9ZA 4H0YB 4JI6K 2F8TA 2HHQA 1Q18A 4IOXA 3NE6A 3SLCA 1Q82O 3OBWA 2GWJA 4WQ4A 3EE8A 1RFQA 3G25A 4A2AA 1M90O 4XH1A 1U4BA 4FLUA 3VEYA 4JI5K 3MXJA 4F3TA 1HR0K 4CZIA 2X6NA 3OHRA 5GIOA 3DMJA 1Q9YA 3BZCA 4BE1A 2G8FA 4TSXA 4PY5A 3V1QA 3KHYA 1NGHA 4DFKA 1HKBA 1L3UA 3VQBA 4U67L 3CFPA 4FJ9A 4BDYA 5DMRA 1SAZA 4LSLA 4LFCK 3KK3A 3LM9A 3VA3A 5BR9A 3O1BA 3B6OA 5C25A 2O8CB 2QW9A 4YNQA 3MXIA 5AQOA 4HCCA 1VAZA 3NAEA 1BGXT 2HBJA 2D4WA 3N4QA 3RSEA 4DU3A 4I6MB 1N6QA 3FZFA 3MDQA 4O0JA 2FF6A 5AQLA 5FPMA 1S1WA 3SAGA 1YTAA 4DQ8A 3CIPA 4FW1A 2NUBA 1B9FA 1JXEA 1OVYA 2A1RA 2VGMA 4DFJA 2HHSA 1FW6A 3DLBA 1B9DA 4AH9A 1VRTA 2QWPA 1SL2A 1VQ9N 4CJUA 2UXBK 4BRKA 4CEBA 5BPNA 4LSNA 1RT5A 4ISFA 4H5VA 3WQUA 2ZJQL 1MWMA 3M6GA 3OBYA 2ZGYA 4M3TA 3DLKA 2YCHA 3MAQA 4DQIA 1S9EA 2FBTA 1W2BM 4KHPK 5HOOA 4CF0A 1TK8A 2QXFA 3K9KA 2HSTA 1WSGA 3FFIA 4CK2A
chains in the Genus database with same CATH topology
2HBKA 3CCLN 3CJ9A 1R59O 3CJCA 4ILJA 4JKGB 2CH6A 5C10A 2IIRA 2P9SA 1U6ZA 3QB0A 4FPBA 1GLBG 3LDLA 4H0XB 3WXLA 1MWKA 4BG8A 3O4WA 3P4IA 3WXMB 5C12A 4MDBA 3GBTA 4FO0A 4IEIA 4IOCL 3E1YA 2W00A 3LM2A 4CZGA 2E2QA 1YXQA 3TTFA 5AQMA 4GV3A 2IVPA 4BR9A 4JD2A 4WQ4C 1DT9A 2FXUA 5GAGP 4BRHA 3SAFA 5AQJA 4J8FA 3VTHA 3G6EN 1NGAA 1S72N 3ZETB 3VENA 5I9EB 2P9UB 3L0QA 3O5BA 1LOTB 3EE9A 5BREA 1ESVA 1C0FA 1K8KA 3ZEUA 4BC3A 4PKGA 5M1OA 4H0VB 4DB3A 2HOEA 4WFAL 1MA9B 5ADXH 4BRPA 4YOUA 1YUWA 4OPHA 3VOVA 2NLXA 2P9PB 2QWMA 3EKSA 1J6ZA 3FZKA 3NVKA 3QBXA 4QS8A 4CD1A 5BPMA 3CI5A 1HPMA 2HF3A 1CZAN 2P9SB 4FWMA 4BC2A 1VQ4N 3SMPA 1ATRA 3MK6A 3CC4N 2QI2A 1VQMN 2GUPA 1HX1A 1Y64A 3ZX0A 2CGLA 2E8AA 2F9TA 4FPAA 3EL2A 1RDWX 3J7ZO 3FZLA 4RTFD 4CBUA 4XH5A 3WXJA 1BO5O 4JD2B 3WQTA 3CCJN 1JCEA 1NLVA 1W97L 5KQ8A 3ID8A 2ZGZA 5AQUA 5AZJA 3LDPA 4PL8A 4Y0WA 1IG8A 2NRXA 4QS9A 4E1JA 4WFBL 4CD3A 3I55N 5MLCQ 3AGKA 3VF4A 5BN8A 1VQLN 3GL1A 1K8KB 3W3DA 1QZ6A 4B1YB 4YDUA 3EO3A 3CMAN 2QWOA 4BREA 1HJOA 5JLHA 4PL7A 1KD1O 3LDQA 4AM7A 2ZJPL 1P8ZA 3O9UA 1ZXOA 4FSVA 4ISGA 5M1FA 3CC2N 3G71N 1ZC6A 1YJ9N 4ISEA 1YJWN 2OTJN 4XEIA 4EFHA 4BR5A 3J8AA 5GINA 3I8BA 3MN5A 4YORA 4BR2A 1YI2N 2FF3B 3F2KA 3SAHA 4IO9L 1E4FT 1IJJA 4BRLA 1T6DA 3PLAA 1ILYA 5C0YA 3L4IA 5DM6L 2E2PA 3A5MC 4WQ5C 1O13A 2C1GA 2HBMA 4PKIA 1WUAA 5AQWA 2A5XA 3EZWA 4GY2B 5AFUH 1NJIO 5AQXA 4BQZA 2ASPA 2NRZA 3Q7BA 1QQMA 5AZJB 4BECA 2ZWHA 4H0PA 4IWVA 4BRQA 4BRGA 4BE7B 3VEWA 3IMXA 2J4RA 3T69A 3O1WA 4JKGA 3HTVA 1K73O 4IEEA 4PKHA 2HBLA 2PAVA 1JCGA 3QMLA 2FLOA 1VQ6N 5BN9A 4JKFA 5AQFA 4A57A 2VWBA 4HWIA 2AP1A 4BEBA 3H3OB 3MN7A 2PBDA 3AGRA 4FWKA 1BU6O 1WOQA 1X9JA 1NGIA 2QXLA 3A5OC 3BP8A 3WXIA 2PFUA 1BUPA 2NRTA 2OANA 1ZBSA 4A5AA 4H5WA 3R9PA 2JWLA 2YX6A 3S41A 3O8MA 3VGKA 1ATNA 3VTIA 3EKUA 2E1YA 1BA0A 4F9OA 5CHIA 4KH6A 2P9KA 4B9QA 3DAWA 5H1SQ 3FZHA 4JKBA 1VQKN 3D7EO 3H3NO 3ZETA 4YOYA 1QQOA 3U9ZA 4BVOA 1P90A 2Q97A 4K43A 1GLLO 3H46O 2D1KA 4IOAL 4WF9L 5KPZA 4UY8O 3QFUA 2CGKA 2ITMA 4H03B 5JVHL 4B1XB 1QZ5A 1GLDG 3CQXA 3HSCA 4BRDA 3BUZB 2FSNA 4BRIA 2C1IA 3VEOA 2GX9A 4M7YA 4RWTA 1NGGA 1NGCA 2KHOA 1RGIA 3C65A 3GOIA 4IO8A 3CCSN 3BF1A 2DPNA 1H1VA 5AQZA 2ZJRL 2BUPA 2WFBA 4BRMA 5AQKA 1EQYA 2WBNA 1KAZA 3VERA 1DEJA 1SZ2A 1T3VA 4JN4A 4XH4A 3M1FA 5ELZA 4A5BA 2HF4A 2YHXA 5C2FA 1YITN 3HZ6A 3BF3A 1U2VB 3OA9A 4K41A 4DHYA 4R79A 1EO1A 3CHWA 3ENBA 3R6MA 4NB4A 4FL9A 3IKMA 4AM6A 3KWGA 5GAHP 2I7PA 3E66A 5AR0A 5GIPA 3TTCA 4CBXA 2P9KB 3A5NC 1X3MA 3QBWA 3MWTA 4QS7A 3TTDA 3DXMA 1G99A 2FSJA 3UE5A 1JJ2M 4CZEA 3MX5A 5M1KA 3VETA 4JKHA 2RE2A 2YJEA 2IVNA 3P31A 4H0OA 4IFEA 1ATSA 2BTFA 3PIPL 4H5RA 4O8UA 3E9OA 4BGAA 4FOIA 4IXCA 3O9SA 5E84A 3A0IX 1Q86O 3C6AA 3ID6A 2YJFA 1GLCG 4FWNA 4ILGB 4G9ZA 4BRFA 2KKZA 1YHQN 3W0LA 5AQVA 3D2EB 2E2NA 3MCAB 4CI6A 1OKJA 3O9QA 5M1PA 3VEVA 4MO4A 4JEPA 4U7BA 1BDGA 5BRFA 4FWQA 1NGFA 1BOTO 4O5FA 4YOWA 1X3NA 3I33A 5AQQA 4EIAA 1VQ8N 5ADXA 2CH5A 1TYQA 2NRRA 4YDUC 4PHTX 4GNIA 3KVGA 1C0GA 2V51B 2QWRA 4Z94A 4WCEL 3TPQA 3DXMB 3F5TA 2CGJA 4K25A 1VQ7N 3MX2A 4M7XA 4FVUA 4BC5A 3LDNA 3CCRN 1S3XA 3FZMA 4EHTA 4JK9A 4JK7A 3I56N 3F9MA 3C7NA 4C1NI 4IDHA 3WEEA 1YAGA 5F0XA 3O08A 5EVZA 4XJXA 2V7ZA 2P9IA 5F2RA 4MLEA 5KQDA 3VEZA 4YOVA 3NVMA 4RCHA 5GADP 1TUUA 3CCEN 3UKRA 4L3QA 4NLCA 3DJCA 4BRNA 3K9JA 4O8KA 2P9LB 3HBTA 4H0TB 1MDUB 3KZBA 2E88A 4BGBA 2NRWA 5JICA 5TKWA 4MDAA 2E2OA 5EOYA 2GTDA 5AQGA 3SMSA 3CCMN 3MWPA 4GVEA 5AQSA 3UKUA 3CPWM 3OW2M 3R1XA 1E4GT 4NLBA 1Q7YO 4BY9C 1TYQB 2QWQA 3AAPA 1YVNA 3P39A 1XUPO 3TSQA 1M1KO 3JXUA 5JVGL 3O6WA 3AARA 3IFRA 4FWRA 3E9PA 2ZF5O 2A40A 4CZMA 2Q36A 3SK3A 4BG9A 5BPLA 2IVOA 1GLJO 1NMDA 1VQON 1BG3A 3C7NB 3T7ZA 3L6QA 3WEEB 3VMFB 3LDOA 1U2VA 5B8HA 3A8YA 3CCUN 2GEMA 1VQ5N 1KQSM 3SBGA 2P9IB 2NRVA 2I7NA 5AQRA 3VF2A 2ASOA 1QVGM 5AFUA 4OPAA 5C2DA 3ATUA 3UKRB 2P9NA 4CJ7A 1YJNN 1SS6A 4BVPA 1D4XA 3O80A 3U9DA 3B8AX 2Q0UA 2A6AA 3AY9A 1NGDA 2H3GX 4JKEA 4M63C 2GWKA 2A42A 5BRHA 2EWSA 4CZJA 3UB5A 3CXCM 3UKUB 3D6RA 3ULEA 2NRHA 4LC9B 3ZX2A 1Z05A 2QTDA 4JK8A 4A59A 1QVFM 1V4SA 4JNEA 3FE1A 4MLHA 4YOXA 2KLAA 3ENHA 4KBOA 4BQLA 1S22A 3FFKB 3E9LA 3RSEB 1QHAA 4AF1A 4H5TA 2VYPA 3D2EA 3D2FA 5AQIA 5JMVA 1YF5L 5AQNA 1Q81O 2VCPA 1K9MO 5FPNA 1N8RO 4K42A 3HI0A 4IJNA 4MO5A 3JS6A 3CJ7A 3CJAA 3O9RA 3C6HA 1NM1A 3CJBA 1JCFA 4FOEA 2QWNA 4GV9A 4GV6A 3ZX3A 3H6EA 2P9NB 2Q31A 4EHUA 2E20A 3VPZA 5AZIA 5BRDA 4KH5A 2JWKA 1GLFO 3KK7A 4JHDA 1KAYA 4JKAA 5CR4A 2F9WA 5AQTA 3CCQN 3EN9A 4CZLA 1HKGA 4JKDA 4CZFA 4IZ9A 2W40A 3ULEB 2WC9A 3DXKA 1NWKA 2YHYA 1YIJN 1VQPN 5EX5A 4B1UB 5FPDA 4OO1J 3HRGA 3HM8A 4H0YB 3MN9A 1Q18A 1XC3A 4IOXA 3N4PA 3RVCA 4A2BA 5LJVA 3CMEN 4WFNL 3D2FB 3SLCA 3QICA 4DCHA 1Q82O 3OBWA 1XQSC 2GWJA 4WQ4A 3EE8A 2P9LA 1RFQA 3G25A 4A2AA 4BC4A 2NNWA 1M90O 2QWLA 2YHWA 2Q0RA 4IJAA 4XH1A 5DM7L 4B1WB 3HOTA 2W41A 3CQYA 3VEYA 1TUYA 4JAXA 3VGLA 3CD6N 4BRCA 5AZIB 4CZIA 1HKCA 1HLUA 3M5RA 1DGKN 3MCPA 3GDQA 3OHRA 4FWLA 5M1QA 5GIOA 3G4SN 2OTLN 4HTLA 4JHDB 5F1XA 5AQPA 4I6MA 4YOTA 5LJWA 3CERA 2UYTA 4CZKA 3DXKB 2WUSA 3KHYA 1NGHA 3P38A 1K8AO 1HKBA 3TU5A 1BA1A 4U67L 4FWSA 1NGJA 2V52B 4A62A 2Q1NA 3SBTA 1NGBA 3U4LA 4EAHD 3MMVA 4A61A 5KPTA 3ATVA 4BR0A 1SAZA 5JLFA 1KC8O 2YI1A 1HUXA 3L4QA 1T44A 3TSPA 3LM9A 2D0OA 5BR9A 1KXPA 3FGUA 3M3ZA 3O1BA 1T6CA 3CCVN 3MN6A 3ZEUB 2QEXN 4NO7A 2QA4N 4CZHA 2QM1A 2QW9A 3H1QA 3NMUA 5E26A 5AQOA 3GE1A 3VF6A 3QFPA 5M1NA 5AQHA 4C1NK 3WXKA 3LL3A 3PIOL 1VAZA 3HOSA 2Q2RA 2A41A 2AA4A 2D4WA 2HBJA 2RHKA 3SJHA 3VEXA 3N4QA 3RSEA 4I6MB 5TKYA 3FZFA 3WUHA 4DKWA 3MDQA 4FWOA 4H5NA 2FF6A 3DWLA 5AQLA 5FPMA 4B1VA 3SAGA 4DQ8A 2BH1A 3CIPA 3CJ1A 3ZYYX 5EXWA 1OVYA 1NBWA 4WQ5A 1KAXA 2GELA 3IUCA 5CE3A 2VGMA 2V7YA 3IDHA 3VESA 4BR4A 4BR7A 2F7TA 2NZTA 3A5LC 2A3ZA 1RDUA 2FSKA 3AAQA 1VQNN 4ILHA 5KPRA 1DKGD 3O9TA 4KH4A 2QWPA 5HL7L 1VQ9N 5LY3A 1GLAG 3U8XA 3CF5L 4BRKA 3CC7N 3ENOA 3Q7CA 2ASMA 3QDKA 4CBWA 5BPNA 4C23A 3KWIA 1BWFO 4BRAA 2VGNA 4ISFA 5EY4A 4H5VA 4BROA 3GG4A 3WQUA 2ZJQL 1MWMA 3M6GA 3OBYA 2ZGYA 5AQYA 1V4TA 2YCHA 3DLLL 2E1ZA 3C0BA 3TSUA 5C15A 2P9UA 1NGEA 3WT0A 5GAEP 3CPEA 1QQNA 3R8EA 4B1ZA 1GLEG 3K9KA 4WYBA 5HOOA 1W2BM 2HSTA 1LCUA 3BEXA 5FPEA 2D0PA 3CETA 3VGMA 1Z6RA 1SQKA 3FR0A 3H1VX 2HMPA 3H45C 3R3LA 4JKCA 4FWPA 3FLCO 2P9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJC A;  1R59 O;  3CJ9 A;  2CH6 A;  2IIR A;  2P9S A;  1U6Z A;  3QB0 A;  4FPB A;  1GLB G;  3LDL A;  4H0X B;  3WXL A;  1MWK A;  4BG8 A;  3O4W A;  3P4I A;  3GBT A;  4FO0 A;  3LM2 A;  4CZG A;  2E2Q A;  1YXQ A;  5AQM A;  2IVP A;  4BR9 A;  4JD2 A;  4WQ4 C;  2FXU A;  4BRH A;  5AQJ A;  4J8F A;  1NGA A;  3ZET B;  3VEN A;  5I9E B;  2P9U B;  3L0Q A;  3O5B A;  1LOT B;  5BRE A;  1ESV A;  1C0F A;  1K8K A;  3ZEU A;  4BC3 A;  4PKG A;  4H0V B;  4DB3 A;  2HOE A;  1MA9 B;  5ADX H;  4BRP A;  1YUW A;  3VOV A;  2NLX A;  2P9P B;  2QWM A;  3EKS A;  1J6Z A;  3FZK A;  3QBX A;  4QS8 A;  4CD1 A;  5BPM A;  3CI5 A;  1HPM A;  2HF3 A;  1CZA N;  2P9S B;  4FWM A;  4BC2 A;  3SMP A;  1ATR A;  3MK6 A;  2GUP A;  1HX1 A;  1Y64 A;  3ZX0 A;  2CGL A;  2E8A A;  2F9T A;  4FPA A;  3EL2 A;  1RDW X;  3FZL A;  4RTF D;  4CBU A;  4XH5 A;  3WXJ A;  1BO5 O;  4JD2 B;  3WQT A;  1JCE A;  1NLV A;  5KQ8 A;  3ID8 A;  2ZGZ A;  5AQU A;  5AZJ A;  3LDP A;  4PL8 A;  4Y0W A;  1IG8 A;  4QS9 A;  4E1J A;  4CD3 A;  3VF4 A;  5BN8 A;  3GL1 A;  1K8K B;  3W3D A;  1QZ6 A;  4B1Y B;  4YDU A;  3EO3 A;  2QWO A;  4BRE A;  1HJO A;  5JLH A;  4PL7 A;  3LDQ A;  4AM7 A;  1P8Z A;  1ZXO A;  4FSV A;  4ISG A;  1ZC6 A;  4ISE A;  4XEI A;  4EFH A;  4BR5 A;  3J8A A;  3I8B A;  3MN5 A;  4BR2 A;  2FF3 B;  1E4F T;  1IJJ A;  4BRL A;  1T6D A;  3L4I A;  2E2P A;  3A5M C;  4WQ5 C;  4PKI A;  1WUA A;  5AQW A;  2A5X A;  3EZW A;  4GY2 B;  5AFU H;  5AQX A;  4BQZ A;  2ASP A;  1QQM A;  5AZJ B;  2ZWH A;  4H0P A;  4IWV A;  4BRQ A;  4BRG A;  3VEW A;  3IMX A;  2J4R A;  3O1W A;  3HTV A;  4PKH A;  2PAV A;  1JCG A;  3QML A;  2FLO A;  5BN9 A;  5AQF A;  2VWB A;  4HWI A;  2AP1 A;  3H3O B;  3MN7 A;  2PBD A;  4FWK A;  1BU6 O;  1WOQ A;  1X9J A;  1NGI A;  2QXL A;  3A5O C;  3BP8 A;  3WXI A;  1BUP A;  2OAN A;  1ZBS A;  4H5W A;  3R9P A;  3S41 A;  3VGK A;  3O8M A;  1ATN A;  3EKU A;  2E1Y A;  1BA0 A;  4F9O A;  2P9K A;  4B9Q A;  3DAW A;  3FZH A;  3D7E O;  3H3N O;  3ZET A;  1QQO A;  3U9Z A;  4BVO A;  2Q97 A;  4K43 A;  1GLL O;  3H46 O;  2D1K A;  5KPZ A;  3QFU A;  2CGK A;  2ITM A;  4H03 B;  4B1X B;  1QZ5 A;  1GLD G;  3CQX A;  3HSC A;  4BRD A;  3BUZ B;  2FSN A;  4BRI A;  3VEO A;  4M7Y A;  4RWT A;  1NGG A;  1NGC A;  2KHO A;  1RGI A;  3GOI A;  4IO8 A;  3BF1 A;  2DPN A;  1H1V A;  5AQZ A;  2BUP A;  4BRM A;  5AQK A;  1EQY A;  1KAZ A;  3VER A;  1DEJ A;  1SZ2 A;  4JN4 A;  4XH4 A;  3M1F A;  5ELZ A;  2HF4 A;  2YHX A;  3HZ6 A;  3BF3 A;  1U2V B;  4K41 A;  4DHY A;  3CHW A;  3R6M A;  4NB4 A;  4FL9 A;  4AM6 A;  2I7P A;  5AR0 A;  4CBX A;  2P9K B;  3A5N C;  1X3M A;  3QBW A;  4QS7 A;  3DXM A;  1G99 A;  2FSJ A;  3UE5 A;  4CZE A;  3VET A;  2YJE A;  2IVN A;  4H0O A;  1ATS A;  2BTF A;  4H5R A;  4BGA A;  4FOI A;  4IXC A;  5E84 A;  3A0I X;  2YJF A;  1GLC G;  4FWN A;  4BRF A;  3W0L A;  5AQV A;  3D2E B;  2E2N A;  4CI6 A;  1OKJ A;  3VEV A;  4MO4 A;  1BDG A;  5BRF A;  4FWQ A;  1NGF A;  1BOT O;  4O5F A;  1X3N A;  3I33 A;  5AQQ A;  4EIA A;  5ADX A;  2CH5 A;  1TYQ A;  4YDU C;  4GNI A;  3KVG A;  1C0G A;  2V51 B;  2QWR A;  4Z94 A;  3TPQ A;  3DXM B;  2CGJ A;  4K25 A;  4M7X A;  4BC5 A;  3LDN A;  1S3X A;  3FZM A;  4EHT A;  3F9M A;  3C7N A;  3WEE A;  1YAG A;  5F0X A;  3O08 A;  5EVZ A;  2V7Z A;  2P9I A;  5F2R A;  4MLE A;  5KQD A;  3VEZ A;  4RCH A;  1TUU A;  3UKR A;  4L3Q A;  3DJC A;  4BRN A;  4O8K A;  2P9L B;  3HBT A;  4H0T B;  1MDU B;  3KZB A;  2E88 A;  4BGB A;  5JIC A;  2E2O A;  5EOY A;  2GTD A;  5AQG A;  3SMS A;  5AQS A;  3UKU A;  1E4G T;  1TYQ B;  2QWQ A;  3AAP A;  1YVN A;  1XUP O;  3JXU A;  3O6W A;  3AAR A;  3IFR A;  4FWR A;  2ZF5 O;  2A40 A;  4CZM A;  2Q36 A;  3SK3 A;  4BG9 A;  5BPL A;  2IVO A;  1GLJ O;  1NMD A;  1BG3 A;  3C7N B;  3L6Q A;  3WEE B;  3LDO A;  1U2V A;  5B8H A;  3A8Y A;  2GEM A;  2P9I B;  2I7N A;  5AQR A;  3VF2 A;  2ASO A;  5AFU A;  3ATU A;  3UKR B;  2P9N A;  4CJ7 A;  4BVP A;  1D4X A;  3O80 A;  3U9D A;  3B8A X;  2Q0U A;  2A6A A;  3AY9 A;  1NGD A;  2H3G X;  4M63 C;  2GWK A;  2A42 A;  5BRH A;  2EWS A;  4CZJ A;  3UB5 A;  3UKU B;  3ULE A;  2NRH A;  4LC9 B;  3ZX2 A;  1Z05 A;  1V4S A;  4JNE A;  3FE1 A;  4MLH A;  3ENH A;  4KBO A;  4BQL A;  1S22 A;  3FFK B;  3RSE B;  1QHA A;  4H5T A;  2VYP A;  3D2E A;  3D2F A;  5AQI A;  5JMV A;  5AQN A;  2VCP A;  5FPN A;  4K42 A;  3HI0 A;  4IJN A;  4MO5 A;  3JS6 A;  3CJ7 A;  3CJA A;  3CJB A;  1NM1 A;  4FOE A;  1JCF A;  2QWN A;  3ZX3 A;  3H6E A;  2P9N B;  2Q31 A;  4EHU A;  2E20 A;  3VPZ A;  5AZI A;  5BRD A;  1GLF O;  4JHD A;  1KAY A;  5AQT A;  2F9W A;  3EN9 A;  4CZL A;  1HKG A;  4CZF A;  4IZ9 A;  2W40 A;  3ULE B;  3DXK A;  1NWK A;  2YHY A;  5EX5 A;  4B1U B;  5FPD A;  3HM8 A;  4H0Y B;  3MN9 A;  1Q18 A;  1XC3 A;  4A2B A;  5LJV A;  3D2F B;  3SLC A;  3QIC A;  4DCH A;  1XQS C;  2GWJ A;  4WQ4 A;  2P9L A;  1RFQ A;  3G25 A;  4A2A A;  4BC4 A;  2QWL A;  2YHW A;  2Q0R A;  4IJA A;  4XH1 A;  4B1W B;  2W41 A;  3CQY A;  3VEY A;  1TUY A;  4JAX A;  3VGL A;  4BRC A;  5AZI B;  4CZI A;  1HKC A;  1HLU A;  3OHR A;  1DGK N;  3MCP A;  3GDQ A;  4FWL A;  4HTL A;  4JHD B;  5F1X A;  5AQP A;  4I6M A;  5LJW A;  3CER A;  2UYT A;  4CZK A;  3DXK B;  2WUS A;  3KHY A;  1NGH A;  1HKB A;  3TU5 A;  1BA1 A;  4FWS A;  1NGJ A;  2V52 B;  4A62 A;  2Q1N A;  3U4L A;  1NGB A;  4EAH D;  3MMV A;  4A61 A;  5KPT A;  3ATV A;  4BR0 A;  1SAZ A;  5JLF A;  2YI1 A;  1HUX A;  1T44 A;  3LM9 A;  2D0O A;  5BR9 A;  1KXP A;  3FGU A;  3M3Z A;  3O1B A;  1T6C A;  3MN6 A;  3ZEU B;  4NO7 A;  4CZH A;  2QM1 A;  2QW9 A;  3H1Q A;  5E26 A;  5AQO A;  3GE1 A;  3VF6 A;  3QFP A;  5AQH A;  3WXK A;  3LL3 A;  2Q2R A;  2A41 A;  2AA4 A;  2D4W A;  3VEX A;  3SJH A;  3RSE A;  4I6M B;  5TKY A;  3FZF A;  3WUH A;  3MDQ A;  4FWO A;  4H5N A;  2FF6 A;  3DWL A;  5AQL A;  5FPM A;  4B1V A;  4DQ8 A;  3CJ1 A;  3CIP A;  5EXW A;  1NBW A;  4WQ5 A;  1KAX A;  2GEL A;  3IUC A;  5CE3 A;  3VES A;  2V7Y A;  3IDH A;  4BR4 A;  4BR7 A;  2NZT A;  3A5L C;  2A3Z A;  2FSK A;  3AAQ A;  5KPR A;  1DKG D;  2QWP A;  5LY3 A;  1GLA G;  3U8X A;  4BRK A;  3ENO A;  2ASM A;  3QDK A;  4CBW A;  5BPN A;  4C23 A;  1BWF O;  4BRA A;  4ISF A;  5EY4 A;  4H5V A;  4BRO A;  3GG4 A;  3WQU A;  1MWM A;  3M6G A;  5AQY A;  2ZGY A;  1V4T A;  2YCH A;  2E1Z A;  3C0B A;  2P9U A;  1NGE A;  3WT0 A;  1QQN A;  3R8E A;  4B1Z A;  1GLE G;  4WYB A;  3BEX A;  1LCU A;  5FPE A;  2D0P A;  3CET A;  3VGM A;  1Z6R A;  1SQK A;  3FR0 A;  3H1V X;  2HMP A;  3H45 C;  4FWP A;  3FLC O;  2P9P A; 
#chains in the Genus database with same CATH topology
 3CJ9 A;  4ILJ A;  3J80 O;  1U45 A;  5C10 A;  2P9S A;  1U6Z A;  4FPB A;  4DUZ K;  1ZBH A;  1W9H A;  4H0X B;  3WXL A;  4LF6 K;  2ITG A;  3WXM B;  2DFF A;  4FO0 A;  3E1Y A;  3LM2 A;  4CZG A;  2IC3 A;  2YNI A;  4OLB A;  4BR9 A;  4JD2 A;  3F73 A;  2FXU A;  4KRE A;  1ZBL A;  1RTI A;  1RT1 A;  2Z1H A;  1NGA A;  4E7K A;  2P9U B;  4I2P A;  4DB3 A;  4FK4 A;  4YOU A;  1YUW A;  3PSF A;  2G8H A;  3NVK A;  2B4J A;  3CI5 A;  3TAR A;  3OYM A;  4BC2 A;  1VQ4 N;  3JAM O;  1VQM N;  1RDW X;  4RTF D;  4OX9 K;  4W5R A;  1JLF A;  1JCE A;  1NLV A;  2YV0 X;  4DSF A;  3BGR A;  5KQ8 A;  1FKP A;  2IGI A;  3ID8 A;  5AQU A;  4Y0W A;  1IG8 A;  4M42 A;  2A1S A;  4I2Q A;  5J1E A;  4CD3 A;  3LAK A;  4DTJ A;  4DV7 K;  5MLC Q;  1N5Y A;  1VQL N;  3AVG A;  1K8K B;  4CHP A;  3ITH A;  4BRE A;  3WNG A;  1HJO A;  3LDQ A;  4AM7 A;  4DLG A;  1ZXO A;  4ISG A;  4CF8 A;  4M3U A;  3G71 N;  1ZC6 A;  1HQE A;  3OS2 A;  1YJW N;  2OTJ N;  1TKD A;  3I8B A;  4BR2 A;  3ZSX A;  4RW8 A;  1C0M A;  1E4F T;  3SAH A;  3PLA A;  4KFB A;  3AA5 X;  1J5E K;  5C0Y A;  1C6V A;  5BR8 K;  3I8D A;  4PKI A;  4AHR A;  3AVK A;  2DTU A;  1SUQ A;  1QQM A;  4LF9 K;  2ZWH A;  4H0P A;  4CEZ A;  1S5J A;  4KHY A;  1EXQ A;  1T8E A;  4PKH A;  1KLM A;  3VQA A;  1JKH A;  5J2M A;  2PAV A;  1QE1 A;  2FLO A;  1VQ6 N;  4CEE A;  3H3O B;  3AVB A;  2Z1I A;  3WXI A;  4CF9 A;  1NGI A;  4CF2 A;  3A5O C;  4RW9 A;  1TV6 A;  3U6F A;  4H8K A;  3K59 A;  3T19 A;  3VTI A;  1ATN A;  2O4G A;  3EKU A;  1BA0 A;  4IFY A;  4BE2 A;  2P9K A;  2XHB A;  3DAW A;  5H1S Q;  3L8B A;  1VQK N;  3D7E O;  2VQF K;  3H3N O;  3KIO A;  4FLY A;  3U9Z A;  4W5Q A;  3LP1 A;  3H46 O;  4IOA L;  5KPZ A;  2ITM A;  4H03 B;  1XC9 A;  3HSC A;  4DQS A;  3ZSR A;  1CXQ A;  3QEI A;  4M7Y A;  4MFB A;  1XWL A;  1U49 A;  3BF1 A;  2WTU A;  5AQZ A;  3OYH A;  1NJX A;  2WFB A;  5AQK A;  1EQY A;  1DEJ A;  1A5V A;  3M1F A;  1IBM K;  2YHX A;  4CK3 A;  4NCB A;  3CHW A;  3SZ2 A;  4FL9 A;  3DLR A;  2EX3 A;  1J53 A;  3E66 A;  3G10 A;  1YTU A;  4CBX A;  3AO5 A;  3ASM A;  4LFB K;  3TTD A;  3SUP A;  1G99 A;  2RE2 A;  3RWU A;  3L3U A;  3ULD A;  1ASW A;  2BTF A;  2OZS A;  3LZJ A;  4H5R A;  1S1X A;  3K2P A;  4FOI A;  5E84 A;  1ASV A;  3A0I X;  3SCX A;  1Q86 O;  4BRF A;  3D2E B;  1XNQ K;  1BI4 B;  4MO4 A;  4JEP A;  4U7B A;  1BDG A;  3EY1 A;  4O5F A;  1WSJ A;  1WBD A;  4B9S A;  1ZBI A;  1JLE A;  4X66 K;  1X3N A;  3I33 A;  5AQQ A;  1VQ8 N;  4CGH A;  2XY7 A;  4CW7 B;  2QWR A;  4Z94 A;  3QEX A;  5C42 A;  1VSF A;  1XMO K;  1VQ7 N;  1B92 A;  5CZ1 A;  4CK1 A;  1NK7 A;  3DLG A;  3FZM A;  4Z4H A;  4FZY A;  4JK7 A;  3C7N A;  3AA2 A;  4C1N I;  4DU4 A;  5F0X A;  1VK0 A;  4B8A B;  4KTW A;  4EP4 A;  4YOV A;  4LD0 A;  3NVM A;  4RCH A;  3CCE N;  4NLC A;  3DJC A;  4BRN A;  3KLH A;  3ALY A;  1GOC A;  2P9L B;  4H0T B;  1Q9X A;  3M8S A;  3KZB A;  4OGC A;  2NRW A;  1QTM A;  1EX4 A;  2YNF A;  3UKU A;  4F2S A;  3V9X A;  1Q7Y O;  4BY9 C;  3P39 A;  5JVG L;  2HND A;  1KLN A;  1LW2 A;  3AAR A;  3E9P A;  1U47 A;  5BPL A;  3DRP A;  3OYL A;  2IVO A;  1NMD A;  2E6L A;  4PUO A;  3ZT4 A;  3DLH A;  3EEQ A;  2GEM A;  3ZT3 A;  3TWH A;  2I7N A;  2OYQ A;  5IT9 O;  3AO4 A;  1IO2 A;  1Z25 A;  3LP0 A;  1TK0 A;  1YJN N;  4C8N A;  3BY5 A;  4BVP A;  4DS4 A;  1EWQ A;  2Q0U A;  2VWJ A;  2A6A A;  3AY9 A;  2A42 A;  2YNH A;  3UB5 A;  2Y1I A;  2HVH A;  1QVF M;  3FE1 A;  4YOX A;  3HL8 A;  3ENH A;  3AVF A;  1S22 A;  3FFK B;  5SZT A;  3RMD A;  4GKK K;  3NCI A;  3D2E A;  1N36 K;  3H08 A;  4O4G A;  1FJG K;  1NG9 A;  2UU9 K;  4IJN A;  3OYG A;  4FOE A;  3NDK A;  2QWN A;  4GV6 A;  1GOB A;  1QS4 A;  3VQ6 A;  5BRD A;  3QO9 A;  2D0A A;  3KK7 A;  1RDB A;  4JKA A;  2OPQ A;  2F9W A;  5CR4 A;  3EN9 A;  4CZF A;  4DSK A;  3DXK A;  5KRS A;  1NWK A;  1W7A A;  4OKK A;  1VQP N;  4B9L A;  1VSM A;  4FZX C;  3TAF A;  3RRG A;  1WAF A;  4A2B A;  1HYV A;  5LJV A;  4DCH A;  4DR3 K;  4CEC A;  1XQS C;  3OS0 A;  2P9L A;  4FXD A;  1KRP A;  2QWL A;  2YHW A;  4R5P A;  1A5W A;  1LAV A;  2W41 A;  3VGL A;  3KLF A;  4KI4 A;  3CD6 N;  4FJ5 A;  3NGZ A;  4KV8 A;  3PV8 A;  1DGK N;  3MCP A;  3GDQ A;  2OTL N;  3OVN A;  3C6U A;  4JHD B;  4YOT A;  5LJW A;  4CZK A;  3CM6 A;  3AVA A;  1K8A O;  1NGJ A;  2GBZ A;  4CEF A;  4CES A;  3SBT A;  3MMV A;  3LDS A;  3ATV A;  3S9H A;  1VSH A;  1OH7 A;  4E7H A;  5KI6 A;  4FJM A;  5JLF A;  2UXD K;  2BDP A;  1HUX A;  1RBR A;  1J54 A;  4O55 A;  3M3Z A;  3CCV N;  4JI8 K;  1T6C A;  2XY5 A;  1WLJ A;  4H4O A;  1NMN A;  4NO7 A;  3AA3 A;  2QM1 A;  3L2R A;  3NMU A;  1BIZ A;  3QFP A;  5M1N A;  3WXK A;  3PIO L;  1HJR A;  3HOS A;  2Q2R A;  4EZ9 A;  3CFO A;  2A41 A;  2AA4 A;  4F2R A;  3VEX A;  3SJH A;  4M3W A;  1A5X A;  4FJX A;  4KRF A;  4FWO A;  4B1V A;  3CJ1 A;  3ZYY X;  4CGI A;  1X9M A;  5FRM A;  3V6D A;  2E5L K;  3L2V A;  3QET A;  4WQ5 A;  3ZT2 A;  3O3G A;  2F7T A;  2NZT A;  3AVI A;  4DV2 K;  2A3Z A;  1RDU A;  4ILH A;  5KPR A;  4YFU A;  3O3F A;  5HRS A;  3SV3 A;  1T05 A;  2RN2 A;  3L3V A;  5LY3 A;  1GLA G;  2VG6 A;  2D0B A;  4OPK A;  2ZQB A;  3CC7 N;  2VG7 A;  2ASM A;  2IS3 A;  4LF4 K;  3THW B;  4BRA A;  4LFA K;  1RBS A;  2VGN A;  4ELU A;  1VSJ A;  3S5T A;  1OH6 A;  3V4I A;  3TSU A;  1NGE A;  2HNZ A;  3WT0 A;  5GAE P;  3LAM A;  3BEX A;  1LCU A;  3CET A;  2W42 A;  1Z6R A;  4JS4 A;  2KZZ A;  4JKC A;  2P9P A;  3CJC A;  4FJJ A;  3OJU A;  1NNE A;  2IIR A;  1C0T A;  4CHY A;  1GLB G;  1D5A A;  3LDL A;  3SQ4 A;  3P4I A;  4FJK A;  3OY9 A;  4MDB A;  4DSI A;  3GBT A;  4IEI A;  4OKJ A;  2P1J A;  4FJH A;  4DS5 A;  1YXQ A;  3TTF A;  2IVP A;  3VQ5 A;  2Z1G A;  1DT9 A;  4WQ4 C;  5GAG P;  2D0C A;  3NBP A;  5AQJ A;  3VTH A;  3SAF A;  3G6E N;  4N41 A;  3VEN A;  1LOT B;  2P5O A;  3E01 A;  4BC3 A;  4PKG A;  4DWI A;  2HOE A;  4B9M A;  4JS5 A;  2OA8 A;  3LP3 A;  4OPH A;  2FBY A;  3HVT A;  3VOV A;  4I9Q A;  1WNS A;  3SI6 A;  1J6Z A;  4AIL C;  3QBX A;  4QCL A;  3AA4 A;  2P9S B;  4FWM A;  3OS1 A;  3IRX A;  4LY7 A;  4KAZ A;  1ATR A;  5I3U A;  1Y64 A;  3ZX0 A;  2CGL A;  1CLQ A;  5JS2 A;  3JSM A;  4FW2 A;  4XH5 A;  3IG1 A;  4DUY K;  4JD2 B;  3WQT A;  1YT3 A;  4IG3 A;  2KFZ A;  3AV9 A;  1BIS A;  3AGK A;  3VF4 A;  5HLF A;  3T3F A;  4CGD A;  4YDU A;  4PL7 A;  3PX4 A;  3HPO A;  3THW A;  4ISE A;  3T1A A;  1VRU A;  4N5S A;  3J8A A;  2KW4 A;  2FF3 B;  3F2K A;  4CJQ A;  4IO9 L;  3S3O A;  4DF4 A;  4PWD A;  1T6D A;  3AVC A;  1ILY A;  4KTQ A;  5DM6 L;  3QEP A;  4M3X A;  3HPG A;  2C1G A;  1QSL A;  4PQU A;  5AQW A;  3DRR A;  4FM1 A;  1NJI O;  5AQX A;  4BQZ A;  2NRZ A;  4DQQ A;  4BEC A;  3ZSZ A;  4OJR A;  2IDO A;  3T69 A;  3MEC A;  3HTV A;  1K73 O;  4IEE A;  4BDZ A;  4JKF A;  5AQF A;  2VWB A;  4BEB A;  3RR7 A;  1BU6 O;  2QXL A;  1X9J A;  3BP8 A;  1BUP A;  4GVM A;  1ZBS A;  5FLX O;  1XI1 A;  2JWL A;  3O4Q A;  2IAJ A;  4KH6 A;  1P90 A;  4KO0 A;  4KHS A;  4FLZ A;  1GLL O;  3ZLJ A;  4WF9 L;  3CQ8 A;  4BE0 A;  1KVB A;  5JVH L;  4BRD A;  1GLD G;  3CQX A;  1TKZ A;  1NGG A;  2F8S A;  1RGI A;  3GOI A;  1I94 K;  1DLO A;  2W6L A;  2ZJR L;  1SZ2 A;  1IV0 A;  1T3V A;  4A5B A;  2HF4 A;  3OYJ A;  4K41 A;  2DY4 A;  4R79 A;  1IKV A;  1EO1 A;  2HW3 A;  1WSI A;  3ENB A;  4B9U A;  4NB4 A;  4AM6 A;  3KWG A;  2WOM A;  2I7P A;  1TL3 A;  4HHT A;  3TTC A;  2P9K B;  4DSL A;  4Y1D A;  4GW6 A;  4IFV A;  3MWT A;  4QS7 A;  4K0K K;  1JJ2 M;  4CZE A;  3MX5 A;  5M1K A;  2YJE A;  2DFE A;  4H0O A;  2QKK A;  3T1H K;  3S3N A;  1NK9 A;  3PIP L;  3ZCM A;  4O8U A;  3E9O A;  4HVJ A;  4FLV A;  4CJW A;  4IXC A;  4E7I A;  3O9S A;  2HHU A;  3C6A A;  3EYZ A;  2UUB K;  3W0L A;  5AQV A;  1OKJ A;  4Y1C A;  5M1P A;  5BRF A;  4CGF A;  4FJG A;  4F8R A;  4YOW A;  4I7F A;  1TGO A;  4EIA A;  5ADX A;  5I42 A;  2CH5 A;  1TYQ A;  2NRR A;  1C0G A;  1UAX A;  2V51 B;  4H4M A;  4WCE L;  4K25 A;  3MX2 A;  4FVU A;  3LDN A;  5IWA K;  5E41 A;  2HVI A;  4JK9 A;  3I56 N;  3KLE A;  1JXB A;  3SPY A;  3WEE A;  1VSI A;  2B5J A;  5F2R A;  4MLE A;  4DTN A;  4DR4 K;  3VEZ A;  4CEO A;  2X74 A;  1LWC A;  4G1Q A;  4ZTJ A;  3KD5 E;  4O8K A;  1MDU B;  4MDA A;  2E2O A;  4HUE A;  2GTD A;  3SMS A;  3OYE A;  3OW2 M;  3R1X A;  3O6W A;  1KCF A;  2OZM A;  4W5N A;  2Q36 A;  3SK3 A;  4CJS A;  1HQU A;  1GLJ O;  1RCH A;  3LAL A;  3C7N B;  4X64 K;  1NOY A;  4DFP A;  4KI6 A;  3LDO A;  1VQ5 N;  4DV1 K;  5KGW A;  3VF2 A;  5AFU A;  1VSD A;  5JEN A;  2UUC K;  3SJJ A;  2DFH A;  4JKE A;  3L2W A;  4DR7 K;  4GMJ B;  2GWK A;  5BRH A;  4DTP A;  3ZSO A;  4JRQ A;  3UKU B;  4DTM A;  3ULE A;  1QSS A;  1Z05 A;  2QTD A;  4JYA K;  4CJR A;  2OPP A;  2O8F A;  3AO3 A;  2PYJ A;  1DTQ A;  4O44 A;  2I5J A;  1RTH A;  4AF1 A;  4V19 S;  3D2F A;  4HUG A;  2VCP A;  3NH2 A;  1L5U A;  1N8R O;  3HI0 A;  4MO5 A;  1J9A A;  3C94 A;  3OYF A;  3SYZ A;  3H6E A;  3DM2 A;  2Q31 A;  5A2Q O;  4EHU A;  1HYZ A;  5AZI A;  2RF2 A;  4NCG A;  5JS1 A;  4BWJ A;  4JI1 K;  3QEV A;  3NHG A;  5AQT A;  1YHQ N;  3TAN A;  4CZL A;  4JKD A;  4ZTF A;  1OH5 A;  4IZ9 A;  1TK5 A;  4RG8 A;  2YHY A;  1YIJ N;  3M8P A;  3AVJ A;  4OO1 J;  1WSE A;  3HM8 A;  4CJP A;  3RVC A;  4E0D A;  1D9F A;  2IOC A;  4BC4 A;  4IJA A;  4FK2 A;  3HOT A;  3CQY A;  3HVR A;  1TUY A;  4JAX A;  1U48 A;  4FVM A;  1OH8 A;  3CPW M;  1K6Y A;  1HLU A;  3M5R A;  3KK1 A;  1X9S A;  4HTL A;  3CER A;  2UYT A;  4CIG A;  3DXK B;  4ELV A;  2WUS A;  3P38 A;  3TU5 A;  4CJ4 A;  2V52 B;  4A62 A;  3U4L A;  1NGB A;  4YY3 K;  4BR0 A;  3CM5 A;  4DR5 K;  1KC8 O;  2YI1 A;  1NK4 A;  1JLA A;  2D0O A;  2FC0 A;  4Z0U A;  3ZSV A;  2QEX N;  3NF8 A;  4CZH A;  3H1Q A;  3GE1 A;  4KB0 A;  4DSE A;  3PX0 A;  4C1N K;  3G0Z A;  3SQ0 A;  1HMV A;  3SUO A;  4EP5 A;  2RHK A;  3KLI A;  2Y1J A;  5TKY A;  3IAY A;  3WUH A;  4DKW A;  4H5N A;  3QNO A;  4M3Z A;  2LSN A;  4LF8 K;  4CGJ A;  1CZ9 A;  3K5M A;  3K58 A;  2GEL A;  3IUC A;  3VES A;  3IDH A;  1EET A;  4DTU A;  3AAQ A;  3AVL A;  4KPY A;  1DKG D;  4KH4 A;  1WSF A;  4CJV A;  3TAM A;  3U8X A;  3CF5 L;  3TAP A;  3P1G A;  1WSH A;  1HYS A;  2F96 A;  3ENO A;  3Q7C A;  3QDK A;  4CBW A;  3B6P A;  3KWI A;  1BWF O;  2PY5 A;  4WE1 A;  4DLE A;  1TL1 A;  3GG4 A;  2BGG A;  1V4T A;  3DLL L;  2E1Z A;  3LAN A;  3CPE A;  3R8E A;  3DI6 A;  1GLE G;  4WYB A;  3NFA A;  1VSE A;  2GV9 A;  3A2F A;  3VGM A;  1SQK A;  3FR0 A;  4CIE A;  4CIF A;  1NKC A;  2HBK A;  3CCL N;  1R59 O;  4B9N A;  2CH6 A;  3SNN A;  1NKB A;  1TKX A;  1ZYQ A;  3NH0 A;  1WBB A;  1MWK A;  4BG8 A;  5C12 A;  3VQC A;  1SV5 A;  2D5R A;  3PO5 A;  2W00 A;  5AQM A;  1TKT A;  1VSL A;  3HM9 A;  2WON A;  4OLA A;  4J8F A;  1T03 A;  4B3M K;  3ZET B;  3J7Y P;  1IKX A;  5I9E B;  3L0Q A;  3EE9 A;  4JI7 K;  4FJ8 A;  4O5B A;  4H0V B;  4W5T A;  2YNG A;  1MA9 B;  4BRP A;  3HXM A;  2NLX A;  2P9P B;  4EZ6 A;  1KVC A;  4QS8 A;  4CD1 A;  5BPM A;  5HRO A;  1HPM A;  1CZA N;  4FJ7 A;  4N76 A;  3TI0 A;  3MK6 A;  2GUP A;  1HX1 A;  2F9T A;  3AVH A;  3EL2 A;  4FPA A;  4CF1 A;  3J7Z O;  3OYK A;  4B8C A;  3WXJ A;  4DTX A;  1BO5 O;  2ZE2 A;  3CCJ N;  1VHX A;  4B3R K;  1W97 L;  3VQP A;  1UA1 A;  4FM0 A;  5AZJ A;  4PL8 A;  4YHH K;  4WFB L;  1HNI A;  3I55 N;  4CJ5 A;  3GL1 A;  1IKY A;  1HPZ A;  4DFM A;  3W3D A;  4E1N A;  4B1Y B;  5HRP A;  1RDC A;  5J2Q A;  3EO3 A;  3CMA N;  2QWO A;  4M3R A;  4B08 A;  1KD1 O;  1BL3 A;  2ZJP L;  3PY8 A;  1P8Z A;  3O9U A;  4AHU A;  5M1F A;  3D0P A;  1YJ9 N;  5KTQ A;  3AO1 A;  4EFH A;  4BR5 A;  5HRN A;  5GIN A;  3MN5 A;  4YOR A;  4DTS A;  2G8I A;  1IJJ A;  2G8K A;  4B3S K;  3L4I A;  4IBN A;  4WQ5 C;  3A5M C;  1O13 A;  5C24 A;  4CEQ A;  4CJ3 A;  3RR8 A;  3THY A;  1C1B A;  3LZI A;  4DQR A;  4J2B A;  3EZW A;  4GY2 B;  2ASP A;  4X65 K;  1C1A A;  3S3M A;  1RTD A;  4IWV A;  4BRQ A;  3M8R A;  4BE7 B;  2J4R A;  3KK2 A;  3UIQ A;  1REV A;  3O1W A;  4ID5 A;  1RT4 A;  1JCG A;  2VWK A;  3QML A;  5BN9 A;  3WNH A;  4Q0B A;  4A57 A;  4FWK A;  2PZS A;  1NJW A;  5CZ2 A;  3L2Q A;  4A5A A;  2FBX A;  4H5W A;  3R9P A;  3O4N A;  4IG0 A;  3S41 A;  1IBK K;  3O8M A;  4NYN A;  4C8K A;  2O8B B;  1SL1 A;  4DQP A;  5CHI A;  4B9Q A;  3FZH A;  4ELT A;  2JLE A;  3ZET A;  3OYN A;  1EKE A;  1QQO A;  2D1K A;  4UY8 O;  1QSY A;  2CGK A;  1R0A A;  4J2E A;  4B1X B;  1QZ5 A;  1JL2 A;  1ASU A;  3BUZ B;  2C1I A;  2GX9 A;  4RWT A;  3IS9 A;  1KVA A;  4DV6 K;  3SUQ A;  5HBM A;  3C65 A;  4X62 K;  3K0S A;  1RT3 A;  2E4L A;  2BUP A;  4BRM A;  1F21 A;  4E19 A;  2XRI A;  3M8Q A;  5C2F A;  4K8X A;  1RT6 A;  3BF3 A;  1U2V B;  3OA9 A;  3U3G A;  4DHY A;  3MEE A;  3VQ8 A;  1W0H A;  3IKM A;  1LW0 A;  5GAH P;  5AR0 A;  2O8D A;  4JI3 K;  3A5N C;  3MED A;  3C6T A;  3DXM A;  5LMN K;  2FSJ A;  4C8O A;  3VET A;  4JKH A;  4GKJ K;  3P31 A;  4IFE A;  2HHW A;  1ATS A;  4KTZ A;  3KTQ A;  4KB1 A;  3OYD A;  4JV5 K;  3NGI A;  3ID6 A;  4G9Z A;  4ILG B;  2KKZ A;  2E2N A;  5LL6 Z;  3MCA B;  3O9Q A;  1IBL K;  1O1W A;  5LMU K;  3HST B;  1BOT O;  4OVL A;  4CVN E;  3K5L A;  3QIO A;  3SPZ A;  1DTT A;  3V9S A;  3V9W A;  1N33 K;  4YDU C;  3KVG A;  3OYC A;  3VQE A;  3F5T A;  3KKS A;  1LWF A;  3ZT0 A;  1VSK A;  3CCR N;  1S3X A;  4PA1 A;  3V1O A;  4EHT A;  1RTJ A;  2X78 A;  2UUA K;  4CCH A;  4DR6 K;  3O08 A;  5EVZ A;  4JI0 K;  4XJX A;  2V7Z A;  2P9I A;  1U04 A;  1L3V A;  2O8B A;  3UKR A;  1N32 K;  2ZD1 A;  4BGB A;  1N34 K;  3LWM A;  4CJT A;  4AHV A;  5EOY A;  2RPI A;  5AQG A;  3ISN C;  3CCM N;  1NJZ A;  3MWP A;  4NLB A;  1TYQ B;  2QWQ A;  3AAP A;  1YVN A;  4IDK A;  1XUP O;  1M1K O;  3JXU A;  4ICL A;  2YHB A;  3IFR A;  4FWR A;  4ZHR A;  2ZF5 O;  4Z4E A;  4FLX A;  3TAB A;  3T7Z A;  3WEE B;  2G8V A;  3VMF B;  1U2V A;  3CCU N;  1TAU A;  4KHQ A;  2NRV A;  5AQR A;  5D3G A;  4OPA A;  2F4V K;  4NXM K;  3ATU A;  2B6A A;  2P9N A;  1D4X A;  3O80 A;  3RTV A;  1I39 A;  4JLH A;  1NGD A;  2H3G X;  3TAG A;  1S6P A;  4CZJ A;  1QHT A;  4AQY K;  1RIL A;  2NRH A;  4LC9 B;  2X6S A;  3QNN A;  4DU1 A;  4JNE A;  4MLH A;  5K14 A;  2KLA A;  3OYI A;  1QHA A;  1RBT A;  4CHN A;  4Z4G A;  4CER A;  5AQI A;  4C8L A;  3J7A P;  5CYM A;  3JYT A;  4J2A A;  1RNH A;  3THX B;  1K9M O;  4Q5V A;  4E7L A;  1RT2 A;  4K42 A;  5CYQ A;  2JGU A;  4J2D A;  3O9R A;  3JS6 A;  4GV9 A;  3C6H A;  3CJB A;  1JCF A;  4CFA A;  3KJV A;  3ZX3 A;  3EZ5 A;  3HPH A;  2E20 A;  4RW4 A;  3DYA A;  3OTO K;  2ATQ A;  1KAY A;  3CCQ N;  1NJY A;  3K57 A;  2W40 A;  3ULE B;  4FJL A;  3HT3 A;  2O8F B;  3HRG A;  3MN9 A;  1NK5 A;  1IH7 A;  1XC3 A;  2E6M A;  3N4P A;  4FM2 A;  3CME N;  4WFN L;  1XMQ K;  3D2F B;  3QIC A;  2QKB A;  3THV A;  2HHV A;  1RBV A;  2NNW A;  4AHS A;  5DM7 L;  2Q0R A;  4KKO A;  4B1W B;  3V9U A;  2O8C A;  1L3T A;  3BDP A;  4BRC A;  5AZI B;  4BDP A;  1HKC A;  4FWL A;  5DK5 A;  5M1Q A;  3G4S N;  1BCO A;  5F1X A;  5AQP A;  4N56 A;  3CFR A;  4I6M A;  3C95 A;  5KGX A;  4C8M A;  2PYL A;  1BA1 A;  4FCY A;  4FWS A;  1SKR A;  2Q1N A;  1WN7 A;  3AVN A;  4EAH D;  4A61 A;  5KPT A;  2QK9 A;  4JI4 K;  2HB5 A;  3L4Q A;  1T44 A;  3TSP A;  3DRS A;  1KXP A;  3FGU A;  2KTQ A;  3MN6 A;  3ZEU B;  3CYM A;  4CGG A;  2QA4 N;  4CJF A;  4QOZ B;  1NU0 A;  2EHG A;  5E26 A;  1KFD A;  3VF6 A;  1LV5 A;  3CG7 A;  5AQH A;  4E72 A;  3LL3 A;  4MQ3 A;  4DSJ A;  2VG5 A;  5J2P A;  3V1R A;  1WAJ A;  3D45 A;  3QES A;  2HMI A;  3VQ4 A;  3RMC A;  1TVR A;  3DWL A;  1CZB A;  2BH1 A;  2ZM6 K;  5EXW A;  1FKO A;  3THX A;  4B9T A;  1S6Q A;  5AJ3 K;  1NBW A;  1KAX A;  5CE3 A;  2V7Y A;  4Z4F A;  3NGY A;  1IKW A;  4BR4 A;  4BR7 A;  3A5L C;  4AHC A;  4K8Z A;  2FSK A;  1LAW A;  1VQN N;  1IG9 A;  2GUI A;  3O9T A;  3SQ2 A;  2G8W A;  2O8E B;  3VQ9 A;  4CHZ A;  1S1U A;  5HL7 L;  3P5J A;  3PUF A;  4UQG A;  4C23 A;  1JLC A;  4OKE A;  5EY4 A;  3MEG A;  4BRO A;  1FK9 A;  4CE9 A;  2OCE A;  1JL1 A;  3DOK A;  5AQY A;  1S9G A;  1C1C A;  4DTR A;  4B3T K;  3C0B A;  4HCB A;  2KQ2 A;  5C15 A;  1TAQ A;  2P9U A;  1QQN A;  4B1Z A;  4B3O A;  5FPE A;  2D0P A;  3RMB A;  3R3L A;  3H1V X;  2HMP A;  3H45 C;  3QLH A;  4FWP A;  3FLC O;  4DV0 K;  4JKG B;  3HJF A;  4DV3 K;  3WNF A;  2OPS A;  2BE2 A;  3QB0 A;  4W5O A;  1T7P A;  3LWL A;  3O4W A;  1LWE A;  3I0S A;  4IOC L;  3I0R A;  2E2Q A;  4CJK A;  4GV3 A;  3CYG A;  1S1T A;  4E89 A;  4BRH A;  1S72 N;  4NYF A;  4FK0 A;  4LF7 K;  4F4K A;  5EU7 A;  4KHU A;  5BRE A;  3O5B A;  1ESV A;  1C0F A;  1HRH A;  1K8K A;  3DOL A;  3TAE A;  3ZEU A;  4FZZ A;  2Z1J A;  4FLW A;  2HHI A;  4OGE A;  4WFA L;  5ADX H;  3HP6 A;  3ZSQ A;  2QWM A;  3EKS A;  1S1V A;  3FZK A;  4N47 A;  3HO1 A;  1C0U A;  1WB9 A;  4HUF A;  2HF3 A;  1L3S A;  3SMP A;  3CC4 N;  2QI2 A;  4CEA A;  1UA0 A;  2E8A A;  3FZL A;  4CBU A;  2ZGZ A;  3LDP A;  2NRX A;  4QS9 A;  4E1J A;  5BN8 A;  2O8E A;  3J81 O;  4KHW A;  1QZ6 A;  3VA0 A;  2YKM A;  2HHX A;  5JLH A;  4QAG A;  3NF7 A;  4FSV A;  3CC2 N;  2UXC K;  4Z4C A;  2G8U A;  4XEI A;  1KFS A;  1YI2 N;  1X1P A;  4BRL A;  4LF5 K;  1OVQ A;  2XY8 A;  1JLQ A;  2E2P A;  3KKR A;  4NCA A;  1XHX A;  2HBM A;  1WUA A;  3O3H A;  1G15 A;  2A5X A;  5AFU H;  4CJL A;  3WNE A;  1JLG A;  3VQQ A;  3Q7B A;  4M41 A;  4FJN A;  4CHQ A;  5AZJ B;  4BRG A;  3VEW A;  3IMX A;  1SL0 A;  4JKG A;  3HP9 A;  2BAN A;  2XY6 A;  2HBL A;  1D8Y A;  4IKF A;  3V81 A;  4HWI A;  2AP1 A;  3MN7 A;  2PBD A;  3AGR A;  4KHN A;  1WOQ A;  1E3M A;  1Z26 A;  2NRT A;  2PFU A;  2OAN A;  3LPT A;  1HNW K;  4DR2 K;  2YX6 A;  5FDL A;  3VGK A;  2P51 A;  4LH5 A;  2E1Y A;  4F9O A;  1XHZ A;  4JKB A;  4CJE A;  4YOY A;  4RW6 A;  4BVO A;  2Q3S A;  3THY B;  2Q97 A;  4K43 A;  4AHT A;  3QFU A;  1ZBF A;  3NH1 A;  5J2N A;  2YKN A;  2HNY A;  1CXU A;  1ZBU A;  2FSN A;  4BRI A;  3VEO A;  1NK8 A;  4JRP A;  1NGC A;  2KHO A;  3TR8 A;  3QIP A;  4IO8 A;  4DF8 A;  4BWM A;  3CCS N;  2DPN A;  1H1V A;  1QQC A;  3VER A;  1KAZ A;  2WBN A;  1BI4 A;  3MXM A;  4JN4 A;  4XH4 A;  5ELZ A;  2KFN A;  1YIT N;  1RDA A;  1JLB A;  3HZ6 A;  2W6K A;  3R6M A;  3ZT1 A;  4F3O A;  1EWR A;  3K5N A;  5GIP A;  4FJI A;  1BHL A;  4CHO A;  3L2U A;  1NK0 A;  1HNX K;  1X3M A;  3QBW A;  4E3S A;  1NKE A;  2HHH K;  3OYB A;  3UE5 A;  1HNZ K;  3LPU A;  2IVN A;  1KSP A;  3HK2 A;  1ITG A;  4JI2 K;  1KTQ A;  4DG1 A;  4BGA A;  3K5O A;  4M3Y A;  1SKW A;  2YJF A;  1GLC G;  4FWN A;  4I9L A;  4FYD A;  3VN5 A;  4ID1 A;  4CI6 A;  4DMN A;  4B9V A;  3VEV A;  3KLG A;  4FWQ A;  3NF9 A;  1NGF A;  3NF6 A;  3SV4 A;  3F9K A;  4PHT X;  4DV4 K;  2ETJ A;  1Q8I A;  1EP4 A;  2OPR A;  4GNI A;  1XNR K;  3PX6 A;  2O8D B;  3U3Y A;  3TPQ A;  3DXM B;  2CGJ A;  4M7X A;  4BC5 A;  3OJS A;  1J5O A;  3F9M A;  4IDH A;  4Z4I A;  1YAG A;  2O4I A;  3QIN A;  4E1M A;  5KQD A;  2P5G A;  3HYF A;  5GAD P;  1TUU A;  3VQD A;  4L3Q A;  2FBV A;  1RDD A;  3K9J A;  1GOA A;  4XIU A;  3HBT A;  2E88 A;  5JIC A;  5TKW A;  1MU2 A;  2YHA A;  3KD1 E;  4GVE A;  5AQS A;  1E4G T;  2AJQ A;  1UOC A;  4DTO A;  4NXN K;  3TSQ A;  3QEW A;  5CY4 A;  5SWM A;  2A40 A;  4CZM A;  4BG9 A;  4O0I A;  2KZM A;  5T7B A;  1VQO N;  1BG3 A;  1NK6 A;  4E7J A;  1RBU A;  3L6Q A;  3SUN A;  5FRO A;  3OYA A;  5B8H A;  3A8Y A;  3SQ1 A;  1KQS M;  3SBG A;  1NOZ A;  2P9I B;  2R7Y A;  1BCM A;  2ASO A;  1QVG M;  4HTU A;  5C2D A;  3UKR B;  3VQ7 A;  3T1Y K;  1D9D A;  4CJ7 A;  4DR1 K;  1X9W A;  1SS6 A;  2HHT A;  3U9D A;  3B8A X;  4CED A;  4FLT A;  3RMA A;  4M63 C;  3RRH A;  3P83 D;  2EWS A;  4LH4 A;  1UWB A;  4CFC A;  3CXC M;  3D6R A;  4CFD A;  3ZX2 A;  1YVU A;  4BAC A;  4JK8 A;  5HP1 A;  3BZK A;  1I3A A;  4A59 A;  1V4S A;  5HRR A;  3AO2 A;  4KBO A;  4BQL A;  3E9L A;  3RSE B;  3DLE A;  3QER A;  1BQN A;  1BIU A;  4H5T A;  2VYP A;  1SKS A;  3LP2 A;  5JMV A;  1YF5 L;  1RT7 A;  5AQN A;  1Q81 O;  4DV5 K;  5FPN A;  5M1O A;  4CFB A;  3CJ7 A;  3CJA A;  1NM1 A;  3ZSW A;  4L8R B;  2P9N B;  2VQE K;  3AVM A;  3VPZ A;  4KH5 A;  3PO4 A;  2JWK A;  1GLF O;  4JHD A;  4RW7 A;  1HKG A;  4M45 A;  3ZSY A;  5KRT A;  5FRN A;  1BQM A;  3PSI A;  2WC9 A;  2XO7 A;  1Y97 A;  4OPJ A;  1HNV A;  5EX5 A;  2RKI A;  1FXX A;  4B1U B;  5FPD A;  3TAQ A;  3V9Z A;  4H0Y B;  4JI6 K;  2F8T A;  2HHQ A;  1Q18 A;  4IOX A;  3NE6 A;  3SLC A;  1Q82 O;  3OBW A;  2GWJ A;  4WQ4 A;  3EE8 A;  1RFQ A;  3G25 A;  4A2A A;  1M90 O;  4XH1 A;  1U4B A;  4FLU A;  3VEY A;  4JI5 K;  3MXJ A;  4F3T A;  1HR0 K;  4CZI A;  2X6N A;  3OHR A;  5GIO A;  3DMJ A;  1Q9Y A;  3BZC A;  4BE1 A;  2G8F A;  4TSX A;  4PY5 A;  3V1Q A;  3KHY A;  1NGH A;  4DFK A;  1HKB A;  1L3U A;  3VQB A;  4U67 L;  3CFP A;  4FJ9 A;  4BDY A;  5DMR A;  1SAZ A;  4LSL A;  4LFC K;  3KK3 A;  3LM9 A;  3VA3 A;  5BR9 A;  3O1B A;  3B6O A;  5C25 A;  2O8C B;  2QW9 A;  4YNQ A;  3MXI A;  5AQO A;  4HCC A;  1VAZ A;  3NAE A;  1BGX T;  2HBJ A;  2D4W A;  3N4Q A;  3RSE A;  4DU3 A;  4I6M B;  1N6Q A;  3FZF A;  3MDQ A;  4O0J A;  2FF6 A;  5AQL A;  5FPM A;  1S1W A;  3SAG A;  1YTA A;  4DQ8 A;  3CIP A;  4FW1 A;  2NUB A;  1B9F A;  1JXE A;  1OVY A;  2A1R A;  2VGM A;  4DFJ A;  2HHS A;  1FW6 A;  3DLB A;  1B9D A;  4AH9 A;  1VRT A;  2QWP A;  1SL2 A;  1VQ9 N;  4CJU A;  2UXB K;  4BRK A;  4CEB A;  5BPN A;  4LSN A;  1RT5 A;  4ISF A;  4H5V A;  3WQU A;  2ZJQ L;  1MWM A;  3M6G A;  3OBY A;  2ZGY A;  4M3T A;  3DLK A;  2YCH A;  3MAQ A;  4DQI A;  1S9E A;  2FBT A;  1W2B M;  4KHP K;  5HOO A;  4CF0 A;  1TK8 A;  2QXF A;  3K9K A;  2HST A;  1WSG A;  3FFI A;  4CK2 A; 
#chains in the Genus database with same CATH homology
 2HBK A;  3CCL N;  3CJ9 A;  1R59 O;  3CJC A;  4ILJ A;  4JKG B;  2CH6 A;  5C10 A;  2IIR A;  2P9S A;  1U6Z A;  3QB0 A;  4FPB A;  1GLB G;  3LDL A;  4H0X B;  3WXL A;  1MWK A;  4BG8 A;  3O4W A;  3P4I A;  3WXM B;  5C12 A;  4MDB A;  3GBT A;  4FO0 A;  4IEI A;  4IOC L;  3E1Y A;  2W00 A;  3LM2 A;  4CZG A;  2E2Q A;  1YXQ A;  3TTF A;  5AQM A;  4GV3 A;  2IVP A;  4BR9 A;  4JD2 A;  4WQ4 C;  1DT9 A;  2FXU A;  5GAG P;  4BRH A;  3SAF A;  5AQJ A;  4J8F A;  3VTH A;  3G6E N;  1NGA A;  1S72 N;  3ZET B;  3VEN A;  5I9E B;  2P9U B;  3L0Q A;  3O5B A;  1LOT B;  3EE9 A;  5BRE A;  1ESV A;  1C0F A;  1K8K A;  3ZEU A;  4BC3 A;  4PKG A;  5M1O A;  4H0V B;  4DB3 A;  2HOE A;  4WFA L;  1MA9 B;  5ADX H;  4BRP A;  4YOU A;  1YUW A;  4OPH A;  3VOV A;  2NLX A;  2P9P B;  2QWM A;  3EKS A;  1J6Z A;  3FZK A;  3NVK A;  3QBX A;  4QS8 A;  4CD1 A;  5BPM A;  3CI5 A;  1HPM A;  2HF3 A;  1CZA N;  2P9S B;  4FWM A;  4BC2 A;  1VQ4 N;  3SMP A;  1ATR A;  3MK6 A;  3CC4 N;  2QI2 A;  1VQM N;  2GUP A;  1HX1 A;  1Y64 A;  3ZX0 A;  2CGL A;  2E8A A;  2F9T A;  4FPA A;  3EL2 A;  1RDW X;  3J7Z O;  3FZL A;  4RTF D;  4CBU A;  4XH5 A;  3WXJ A;  1BO5 O;  4JD2 B;  3WQT A;  3CCJ N;  1JCE A;  1NLV A;  1W97 L;  5KQ8 A;  3ID8 A;  2ZGZ A;  5AQU A;  5AZJ A;  3LDP A;  4PL8 A;  4Y0W A;  1IG8 A;  2NRX A;  4QS9 A;  4E1J A;  4WFB L;  4CD3 A;  3I55 N;  5MLC Q;  3AGK A;  3VF4 A;  5BN8 A;  1VQL N;  3GL1 A;  1K8K B;  3W3D A;  1QZ6 A;  4B1Y B;  4YDU A;  3EO3 A;  3CMA N;  2QWO A;  4BRE A;  1HJO A;  5JLH A;  4PL7 A;  1KD1 O;  3LDQ A;  4AM7 A;  2ZJP L;  1P8Z A;  3O9U A;  1ZXO A;  4FSV A;  4ISG A;  5M1F A;  3CC2 N;  3G71 N;  1ZC6 A;  1YJ9 N;  4ISE A;  1YJW N;  2OTJ N;  4XEI A;  4EFH A;  4BR5 A;  3J8A A;  5GIN A;  3I8B A;  3MN5 A;  4YOR A;  4BR2 A;  1YI2 N;  2FF3 B;  3F2K A;  3SAH A;  4IO9 L;  1E4F T;  1IJJ A;  4BRL A;  1T6D A;  3PLA A;  1ILY A;  5C0Y A;  3L4I A;  5DM6 L;  2E2P A;  3A5M C;  4WQ5 C;  1O13 A;  2C1G A;  2HBM A;  4PKI A;  1WUA A;  5AQW A;  2A5X A;  3EZW A;  4GY2 B;  5AFU H;  1NJI O;  5AQX A;  4BQZ A;  2ASP A;  2NRZ A;  3Q7B A;  1QQM A;  5AZJ B;  4BEC A;  2ZWH A;  4H0P A;  4IWV A;  4BRQ A;  4BRG A;  4BE7 B;  3VEW A;  3IMX A;  2J4R A;  3T69 A;  3O1W A;  4JKG A;  3HTV A;  1K73 O;  4IEE A;  4PKH A;  2HBL A;  2PAV A;  1JCG A;  3QML A;  2FLO A;  1VQ6 N;  5BN9 A;  4JKF A;  5AQF A;  4A57 A;  2VWB A;  4HWI A;  2AP1 A;  4BEB A;  3H3O B;  3MN7 A;  2PBD A;  3AGR A;  4FWK A;  1BU6 O;  1WOQ A;  1X9J A;  1NGI A;  2QXL A;  3A5O C;  3BP8 A;  3WXI A;  2PFU A;  1BUP A;  2NRT A;  2OAN A;  1ZBS A;  4A5A A;  4H5W A;  3R9P A;  2JWL A;  2YX6 A;  3S41 A;  3O8M A;  3VGK A;  1ATN A;  3VTI A;  3EKU A;  2E1Y A;  1BA0 A;  4F9O A;  5CHI A;  4KH6 A;  2P9K A;  4B9Q A;  3DAW A;  5H1S Q;  3FZH A;  4JKB A;  1VQK N;  3D7E O;  3H3N O;  3ZET A;  4YOY A;  1QQO A;  3U9Z A;  4BVO A;  1P90 A;  2Q97 A;  4K43 A;  1GLL O;  3H46 O;  2D1K A;  4IOA L;  4WF9 L;  5KPZ A;  4UY8 O;  3QFU A;  2CGK A;  2ITM A;  4H03 B;  5JVH L;  4B1X B;  1QZ5 A;  1GLD G;  3CQX A;  3HSC A;  4BRD A;  3BUZ B;  2FSN A;  4BRI A;  2C1I A;  3VEO A;  2GX9 A;  4M7Y A;  4RWT A;  1NGG A;  1NGC A;  2KHO A;  1RGI A;  3C65 A;  3GOI A;  4IO8 A;  3CCS N;  3BF1 A;  2DPN A;  1H1V A;  5AQZ A;  2ZJR L;  2BUP A;  2WFB A;  4BRM A;  5AQK A;  1EQY A;  2WBN A;  1KAZ A;  3VER A;  1DEJ A;  1SZ2 A;  1T3V A;  4JN4 A;  4XH4 A;  3M1F A;  5ELZ A;  4A5B A;  2HF4 A;  2YHX A;  5C2F A;  1YIT N;  3HZ6 A;  3BF3 A;  1U2V B;  3OA9 A;  4K41 A;  4DHY A;  4R79 A;  1EO1 A;  3CHW A;  3ENB A;  3R6M A;  4NB4 A;  4FL9 A;  3IKM A;  4AM6 A;  3KWG A;  5GAH P;  2I7P A;  3E66 A;  5AR0 A;  5GIP A;  3TTC A;  4CBX A;  2P9K B;  3A5N C;  1X3M A;  3QBW A;  3MWT A;  4QS7 A;  3TTD A;  3DXM A;  1G99 A;  2FSJ A;  3UE5 A;  1JJ2 M;  4CZE A;  3MX5 A;  5M1K A;  3VET A;  4JKH A;  2RE2 A;  2YJE A;  2IVN A;  3P31 A;  4H0O A;  4IFE A;  1ATS A;  2BTF A;  3PIP L;  4H5R A;  4O8U A;  3E9O A;  4BGA A;  4FOI A;  4IXC A;  3O9S A;  5E84 A;  3A0I X;  1Q86 O;  3C6A A;  3ID6 A;  2YJF A;  1GLC G;  4FWN A;  4ILG B;  4G9Z A;  4BRF A;  2KKZ A;  1YHQ N;  3W0L A;  5AQV A;  3D2E B;  2E2N A;  3MCA B;  4CI6 A;  1OKJ A;  3O9Q A;  5M1P A;  3VEV A;  4MO4 A;  4JEP A;  4U7B A;  1BDG A;  5BRF A;  4FWQ A;  1NGF A;  1BOT O;  4O5F A;  4YOW A;  1X3N A;  3I33 A;  5AQQ A;  4EIA A;  1VQ8 N;  5ADX A;  2CH5 A;  1TYQ A;  2NRR A;  4YDU C;  4PHT X;  4GNI A;  3KVG A;  1C0G A;  2V51 B;  2QWR A;  4Z94 A;  4WCE L;  3TPQ A;  3DXM B;  3F5T A;  2CGJ A;  4K25 A;  1VQ7 N;  3MX2 A;  4M7X A;  4FVU A;  4BC5 A;  3LDN A;  3CCR N;  1S3X A;  3FZM A;  4EHT A;  4JK9 A;  4JK7 A;  3I56 N;  3F9M A;  3C7N A;  4C1N I;  4IDH A;  3WEE A;  1YAG A;  5F0X A;  3O08 A;  5EVZ A;  4XJX A;  2V7Z A;  2P9I A;  5F2R A;  4MLE A;  5KQD A;  3VEZ A;  4YOV A;  3NVM A;  4RCH A;  5GAD P;  1TUU A;  3CCE N;  3UKR A;  4L3Q A;  4NLC A;  3DJC A;  4BRN A;  3K9J A;  4O8K A;  2P9L B;  3HBT A;  4H0T B;  1MDU B;  3KZB A;  2E88 A;  4BGB A;  2NRW A;  5JIC A;  5TKW A;  4MDA A;  2E2O A;  5EOY A;  2GTD A;  5AQG A;  3SMS A;  3CCM N;  3MWP A;  4GVE A;  5AQS A;  3UKU A;  3CPW M;  3OW2 M;  3R1X A;  1E4G T;  4NLB A;  1Q7Y O;  4BY9 C;  1TYQ B;  2QWQ A;  3AAP A;  1YVN A;  3P39 A;  1XUP O;  3TSQ A;  1M1K O;  3JXU A;  5JVG L;  3O6W A;  3AAR A;  3IFR A;  4FWR A;  3E9P A;  2ZF5 O;  2A40 A;  4CZM A;  2Q36 A;  3SK3 A;  4BG9 A;  5BPL A;  2IVO A;  1GLJ O;  1NMD A;  1VQO N;  1BG3 A;  3C7N B;  3T7Z A;  3L6Q A;  3WEE B;  3VMF B;  3LDO A;  1U2V A;  5B8H A;  3A8Y A;  3CCU N;  2GEM A;  1VQ5 N;  1KQS M;  3SBG A;  2P9I B;  2NRV A;  2I7N A;  5AQR A;  3VF2 A;  2ASO A;  1QVG M;  5AFU A;  4OPA A;  5C2D A;  3ATU A;  3UKR B;  2P9N A;  4CJ7 A;  1YJN N;  1SS6 A;  4BVP A;  1D4X A;  3O80 A;  3U9D A;  3B8A X;  2Q0U A;  2A6A A;  3AY9 A;  1NGD A;  2H3G X;  4JKE A;  4M63 C;  2GWK A;  2A42 A;  5BRH A;  2EWS A;  4CZJ A;  3UB5 A;  3CXC M;  3UKU B;  3D6R A;  3ULE A;  2NRH A;  4LC9 B;  3ZX2 A;  1Z05 A;  2QTD A;  4JK8 A;  4A59 A;  1QVF M;  1V4S A;  4JNE A;  3FE1 A;  4MLH A;  4YOX A;  2KLA A;  3ENH A;  4KBO A;  4BQL A;  1S22 A;  3FFK B;  3E9L A;  3RSE B;  1QHA A;  4AF1 A;  4H5T A;  2VYP A;  3D2E A;  3D2F A;  5AQI A;  5JMV A;  1YF5 L;  5AQN A;  1Q81 O;  2VCP A;  1K9M O;  5FPN A;  1N8R O;  4K42 A;  3HI0 A;  4IJN A;  4MO5 A;  3JS6 A;  3CJ7 A;  3CJA A;  3O9R A;  3C6H A;  1NM1 A;  3CJB A;  1JCF A;  4FOE A;  2QWN A;  4GV9 A;  4GV6 A;  3ZX3 A;  3H6E A;  2P9N B;  2Q31 A;  4EHU A;  2E20 A;  3VPZ A;  5AZI A;  5BRD A;  4KH5 A;  2JWK A;  1GLF O;  3KK7 A;  4JHD A;  1KAY A;  4JKA A;  5CR4 A;  2F9W A;  5AQT A;  3CCQ N;  3EN9 A;  4CZL A;  1HKG A;  4JKD A;  4CZF A;  4IZ9 A;  2W40 A;  3ULE B;  2WC9 A;  3DXK A;  1NWK A;  2YHY A;  1YIJ N;  1VQP N;  5EX5 A;  4B1U B;  5FPD A;  4OO1 J;  3HRG A;  3HM8 A;  4H0Y B;  3MN9 A;  1Q18 A;  1XC3 A;  4IOX A;  3N4P A;  3RVC A;  4A2B A;  5LJV A;  3CME N;  4WFN L;  3D2F B;  3SLC A;  3QIC A;  4DCH A;  1Q82 O;  3OBW A;  1XQS C;  2GWJ A;  4WQ4 A;  3EE8 A;  2P9L A;  1RFQ A;  3G25 A;  4A2A A;  4BC4 A;  2NNW A;  1M90 O;  2QWL A;  2YHW A;  2Q0R A;  4IJA A;  4XH1 A;  5DM7 L;  4B1W B;  3HOT A;  2W41 A;  3CQY A;  3VEY A;  1TUY A;  4JAX A;  3VGL A;  3CD6 N;  4BRC A;  5AZI B;  4CZI A;  1HKC A;  1HLU A;  3M5R A;  1DGK N;  3MCP A;  3GDQ A;  3OHR A;  4FWL A;  5M1Q A;  5GIO A;  3G4S N;  2OTL N;  4HTL A;  4JHD B;  5F1X A;  5AQP A;  4I6M A;  4YOT A;  5LJW A;  3CER A;  2UYT A;  4CZK A;  3DXK B;  2WUS A;  3KHY A;  1NGH A;  3P38 A;  1K8A O;  1HKB A;  3TU5 A;  1BA1 A;  4U67 L;  4FWS A;  1NGJ A;  2V52 B;  4A62 A;  2Q1N A;  3SBT A;  1NGB A;  3U4L A;  4EAH D;  3MMV A;  4A61 A;  5KPT A;  3ATV A;  4BR0 A;  1SAZ A;  5JLF A;  1KC8 O;  2YI1 A;  1HUX A;  3L4Q A;  1T44 A;  3TSP A;  3LM9 A;  2D0O A;  5BR9 A;  1KXP A;  3FGU A;  3M3Z A;  3O1B A;  1T6C A;  3CCV N;  3MN6 A;  3ZEU B;  2QEX N;  4NO7 A;  2QA4 N;  4CZH A;  2QM1 A;  2QW9 A;  3H1Q A;  3NMU A;  5E26 A;  5AQO A;  3GE1 A;  3VF6 A;  3QFP A;  5M1N A;  5AQH A;  4C1N K;  3WXK A;  3LL3 A;  3PIO L;  1VAZ A;  3HOS A;  2Q2R A;  2A41 A;  2AA4 A;  2D4W A;  2HBJ A;  2RHK A;  3SJH A;  3VEX A;  3N4Q A;  3RSE A;  4I6M B;  5TKY A;  3FZF A;  3WUH A;  4DKW A;  3MDQ A;  4FWO A;  4H5N A;  2FF6 A;  3DWL A;  5AQL A;  5FPM A;  4B1V A;  3SAG A;  4DQ8 A;  2BH1 A;  3CIP A;  3CJ1 A;  3ZYY X;  5EXW A;  1OVY A;  1NBW A;  4WQ5 A;  1KAX A;  2GEL A;  3IUC A;  5CE3 A;  2VGM A;  2V7Y A;  3IDH A;  3VES A;  4BR4 A;  4BR7 A;  2F7T A;  2NZT A;  3A5L C;  2A3Z A;  1RDU A;  2FSK A;  3AAQ A;  1VQN N;  4ILH A;  5KPR A;  1DKG D;  3O9T A;  4KH4 A;  2QWP A;  5HL7 L;  1VQ9 N;  5LY3 A;  1GLA G;  3U8X A;  3CF5 L;  4BRK A;  3CC7 N;  3ENO A;  3Q7C A;  2ASM A;  3QDK A;  4CBW A;  5BPN A;  4C23 A;  3KWI A;  1BWF O;  4BRA A;  2VGN A;  4ISF A;  5EY4 A;  4H5V A;  4BRO A;  3GG4 A;  3WQU A;  2ZJQ L;  1MWM A;  3M6G A;  3OBY A;  2ZGY A;  5AQY A;  1V4T A;  2YCH A;  3DLL L;  2E1Z A;  3C0B A;  3TSU A;  5C15 A;  2P9U A;  1NGE A;  3WT0 A;  5GAE P;  3CPE A;  1QQN A;  3R8E A;  4B1Z A;  1GLE G;  3K9K A;  4WYB A;  5HOO A;  1W2B M;  2HST A;  1LCU A;  3BEX A;  5FPE A;  2D0P A;  3CET A;  3VGM A;  1Z6R A;  1SQK A;  3FR0 A;  3H1V X;  2HMP A;  3H45 C;  3R3L A;  4JKC A;  4FWP A;  3FLC O;  2P9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...